4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
3N4MA 5BPXA 4MGRA 4EJOA 2IA2A 5ICEA 4HF1A 2GWRA 5DCMB 2W25A 1F5TA 3LAPA 1BC8C 5L3GA 1U5TB 4AVPA 3D5LA 3FFQA 1HKSA 1L0OC 4JVAA 2R7DA 4OINF 1K6OA 3KFWX 2GC1A 3CLPA 3I0TA 3IWZA 2Q30A 4JK1X 5CYVA 2NS0A 3BY6A 4LGWA 4LJZF 2EFNA 1GQHA 1P92A 1ZG1A 4H7LA 2JTVA 4MHGA 4NVPA 1KQ0A 2RGVA 1BC7C 1SEFA 3BPXA 3ABUA 2FBHA 2MA3A 4IEPA 2KJCA 5I0UA 3L00A 4IEQA 3J81K 3FHIB 4HVQA 3ERED 2PI0A 2YX4A 3E6BA 1XMAA 4YFXF 4X6QB 4JTNA 2O0YA 3KZZA 1SFXA 1TW2A 3ETQA 4R52A 2P5KA 1J9IA 2GU9A 3E5QA 3FHZA 4HQMA 2FMYA 5D6FA 3M70A 1OYWA 2NRAC 5D4SA 4U7DA 3VHRA 2DO7A 1B9MA 1Q1HA 3VB2A 4EMSA 2ZNZA 4EJTA 1FI2A 2EA4A 4OU0A 1RI7A 3QRFF 2H94A 2HJIA 4HLTA 3FE5A 3K1MA 1UHMA 4HOBA 2ZBKA 4EM0B 4U7BA 2C0ZA 4KIFA 5JFRA 3WTSC 5ILVA 1KQ9A 1P2FA 4A0XA 1ZVFA 1BM9A 4MGKE 1Z6RA 2BNNA 4PIXA 3JSOA 5EZWA 5L3CA 5ILUA 2L4MA 3DL3A 3H50A 4GYIA 2ESNA 1QBJA 2E7XA 2ATFA 5HLHA 3IC7A 1ZARA 1ZGAA 3F3XA 4GCVA 3WODF 2ACJA 3SCGA 1YTYA 2JPCA 4QMAA 3R0AA 4OMYA 2M5WA 2QVSB 5DCFA 3H8UA 3ZPLA 5CLSA 3BCWA 3LQQA 1BI1A 2EAAA 2ZNYA 4BAYA 3T8RA 3K0LA 1ZRFA 2BNOA 1ZHFA 1X3UA 4KU8A 1LQ1A 2MBFA 5I8TA 2E1NA 4AQ6A 4DINB 1OI6A 2UXNA 2IJLA 3WE3A 3ZMDA 3BJ6A 4KUMA 1Z91A 2STTA 4IHTA 1I1SA 3JTHA 3NW4A 2XKPA 1LNWA 2H0VA 4MH0E 3E6CC 4LB6B 4EVIA 4G7HF 2BEOA 4XSZF 2ETHA 1U6GA 3W6JB 1IN7A 3R6SA 2V79A 5LGNA 4MX3A 1YW9A 4YG2F 2N7GA 1FP2A 2XASA 5E17F 1QZYA 4WVZA 4YIIA 4XFAA 4L5JA 3H3ZA 5D5UB 4WWCA 1U78A 5FQ0B 5JSPA 4MGYE 4KMUX 3SCHA 1O3TA 4LLLA 1LVAA 1MJ9A 2V1XA 4RGRA 3TNQA 3HTUA 2F5EA 1R1TA 2BBYA 2PTMA 2MC3A 5K5RA 4X6RB 4EGZA 4ENKA 3HHHA 3H92A 3ZMTA 2O8QA 2OZJA 3VODA 5L3EA 1XE8A 1B4AA 2VN2A 2X0LA 4LULA 4ZYGA 3WU0A 2FMLA 1ZGJA 5J6XA 5DUKA 3B73A 2GH2A 1QXRA 3K1PA 3I5UA 1IN4A 2O6GE 3G73A 2KIFA 2ZO4A 3SZTA 1WQ2A 5KBFA 4PDKA 3VEPA 3GWZA 2B5HA 2O8XA 4UVBA 3MZYA 1P4XA 3TO9A 1W7PD 1KGSA 2XLFA 2Z99A 3L2HA 1S7OA 1R5HA 4UV9A 5HOOA 3HRMA 1ZG3A 4G7OF 3DPTA 4DNCA 2HGCA 1V3FA 3FX3A 4XLNF 3MYXA 1Y0UA 5FB2A 1GHCA 3TOBA 4OIQF 1UB9A 3WU1B 1J3QA 2KKOA 2X4HA 2FQ3A 1U3EM 1IW7F 4IEOA 1TLHB 2GXBA 1XSVA 4N9IA 2XAHA 4MV2A 2VBXA 3EBRA 3Q9VA 3EQLF 1J3RA 3HSFA 4Q29A 5E1XA 2XRNA 2RQPA 5IT3A 4M9SA 1OPCA 3FXUA 4ENNA 3EYYA 2P5LC 2DAOA 3F8FA 1ZAOA 3GF2A 3ISPA 4QX5A 4KWKA 1YFWA 5KK1A 1XSDA 1RIOH 4IEZA 3HRUA 2D2WA 4PJYA 5ILSA 1BN5A 4CZZA 3M8EA 4FAGA 2UWMA 1B1BA 3J81Z 3IRRA 4BHCA 3DN7A 2ZMEA 3WW1A 3ZDSA 4CYDA 2EA2A 3CJXA 3SHRA 3U10A 2WFPA 5I0SA 1B6AA 1IRGA 1SD7A 5FLHA 3QPHA 4XFIA 5J8CA 3LAJA 2MH9A 2ADUA 2O1QA 5FD6A 2DLLA 4OOIA 4P9GA 3P9IA 1XE7A 1IAWA 2RVCA 4UVAA 3RIRA 2AXLA 4B29A 3I4PA 2M1BA 5BQTA 3WTVC 2IXIA 2O61A 3ZP5A 3ECOA 2ZKZA 2B0LA 1NE4A 5EEHA 2DT5A 2HS5A 3MFKA 4Q0PA 2BE5F 1SFEA 1SFNA 1YW7A 1UW8A 1VR3A 5LGTA 3EO6A 4HX8A 1YS6A 3H9AA 4AXOA 3RJPA 1J59A 1L3LA 3EDPA 2J5PA 5F64A 2Q8KA 1MZBA 4U0YA 1XD7A 1OKRA 2KIMA 2CG4A 3FXRA 5L3DA 4KA4A 3UKVA 2Y0OA 1TNSA 1D8KA 2O03A 2P8TA 1C0WA 2GC3A 5L3FA 1SQ4A 3HOSA 3QACA 4UBGA 2A6HF 3ZMSA 3H1MA 3GYDA 1XGSA 4ON0A 2ISYA 2EB7A 1QZZA 2XAFA 2DPUA 2MNGA 1FSEA 1O57A 2QLZA 1U5TA 1IZ1A 4D0PA 1IPKA 2E1CA 4FBFA 4O6JA 1FC3A 4HF2A 2P6SA 4L5IA 3KEOA 2XAJA 2V1UA 2D40A 2PQ8A 4F8AA 2EV0A 3HIFA 4AVBA 2HFHA 4M9XA 1F1ZA 3ZMZA 3TNPB 5DDGA 1D5VA 3ACLA 4RB2C 2PMHA 3S7IA 1O5LA 4WXCA 4D7SA 1CAUB 2IXLA 3G7DA 2P5VA 5LGUA 3UKNA 2UY9A 2PAEA 3CL1A 2E9QA 4HVRA 5HS9A 4META 3I53A 3LWCA 4UUVA 3GYHX 2EJRA 4FX0A 1EY2A 2GA2A 1FOKA 4YARA 4P96A 3H1YA 4I3PA 2M45A 3RYRA 4HSJA 4XF4A 2Z9OA 5I8YA 5FLIA 5JR7B 4I09A 4XFHA 3LQRA 2V09A 2CO5A 1JE8A 1LDDA 4BXUA 2EA7A 3ST7A 5I91A 1TQMA 3GLXA 1XMKA 2OZUA 3TDZC 2CQKA 3D0SA 3EQEA 3KP4A 3F8BA 4A0ZA 3KZYA 3RZZA 3HSEA 4K2EA 3NL1A 3FZ3A 5E1WA 3MQ0A 4KYWA 1FP1D 4CDGA 1Z1DA 4AIKA 1G3YA 1ZYRF 2Y75A 2OPKA 3C3WA 2NYXA 2RC4A 2Q2EA 1RTVA 4MNUA 4QGMA 2H09A 3KGLA 4GXOA 4HV5A 2UXXA 5E8GA 3WGGA 5LEKA 1Z7UA 2QBYB 2VT3A 2DPDA 2QUFA 1ZZ8A 3FM3A 3M8FA 1WWXA 2Y0MA 2P17A 1I5ZA 1KU3A 3RKYA 3BJOA 2FU4A 2EWNA 1D3YA 2HKOA 4M6YA 1AOYA 4I7HA 5D5VB 1SD4A 4E2QA 3F8CA 1ZZBA 1W4MA 5LLQA 4OMZA 4ZYEA 1O3RA 5TJJA 2ZFWA 4NHJA 5AIPA 1DPRA 2FF4A 2C6YA 1YG2A 4HZFA 1ZZ9A 1MDMA 4O9GA 3HUGA 5AONA 4FT8A 5LHGA 4CHUA 3DEUA 4G6QA 3EETA 5FPZA 2DBBA 2ESHA 4YRDA 4P9UA 1HKQA 3R60A 5FLXK 4XFCA 4EWEA 4KDPA 4MQ9F 4QWQA 3MZHA 2MHFA 2A3SA 2QZ8A 2OYZA 3KP5A 1UIJA 2MD5A 2IRFG 4RGSA 3IIAA 4B09A 4PGGA 1KYWA 5FQ0A 1WGPA 4M71A 3JAMK 3AAFA 3L7WA 2OZ6A 2VQAA 3JW4A 2K86A 4YYOA 1ZLKA 2HOEA 4HQEA 3ZN1A 4IRHA 4LB5A 2EFWA 4IEVA 1RL3A 5D8KB 2TDXA 2UY8A 2VT2A 1T39A 2CYYA 1YQAA 4E70A 2G7UA 1FBSA 3NSTA 1T38A 1EH8A 1QWRA 3HHGA 4LLGF 2COMA 4YSFA 3WTYC 3GFJA 3U0ZA 3FJSA 5ICGA 4S05A 1LEAA 2G7HA 4G7ZF 2K0GA 1LKNA 3V8JA 3RYPA 2XHKA 3C18A 3FMRA 5K8SA 2Z5UA 3OF1A 1KU2A 4EJUA 4M74A 5CVVA 3K2ZA 4ENJA 4IETA 4XRFA 1BIAA 2IA0A 4Q0VA 4WX9A 4BHBA 1CX4A 1O5UA 1QNTA 4EQQA 4ZZDA 3LZZA 6PAXA 3H7YA 1ZRCA 2PLYA 1FLIA 1YHFA 4UHTA 4IESA 1R7JA 1G4DA 2P7CB 2IC1A 2P7VB 4L11A 4M73A 1FZPB 3FWEA 2EFOA 3MPBA 2KIUA 1ZLJA 4HX7A 2DCTA 5HS8A 1EPZA 2EFQA 4GULA 2ET7A 4I2OA 4HBNA 1G6NA 1TQ5A 1R1UA 3DQVC 4MUVA 3KETA 3FXQA 1PM7A 2IXCA 3IWFA 2GC0A 3SMHA 3W6KB 3CUQC 4PZJA 1K7AA 3TKYA 3JSPA 4HSLA 3WGHA 2GXGA 3CEWA 4KFCA 4R8HA 4AIJA 4IHSA 2DQRA 3IDCB 5BUVA 1S6LA 2M87A 1ZRRA 5EFUA 3GVAA 5HLIA 3KSCA 1VJ2A 1XB4A 2BGCA 3KP3A 3C1DA 4OIPF 2AS5F 2L02A 4RD7A 5L3BA 4ZU7A 3L09A 1MDMB 4IXAA 3BZ6A 2PHDA 4Y13A 4HN0A 2FA5A 4Q0QA 3VOEA 5JSOA 3H3UA 3WGIA 2D93A 5CVUA 3ECHA 4WCGA 3ES1A 3NQOA 1R00A 1QQIA 2FNPA 5J48A 4I0BA 3O3KA 4GGGA 1R22A 3EHKA 3FMQA 5I8SA 3C3VA 2OU2A 4HF0A 5E1ZB 5H20A 3T5XA 1ZX5A 2WTEA 1T6SA 1F9NA 5AIQA 1V4RA 2XKOA 1H1IA 3BU7A 3WTZA 3EJKA 4R1HA 4EV0A 1HXDA 2PJPA 4OLLA 5KHKA 1FX7A 1GXPA 1MKMA 3CUOA 4KN7X 1X8EA 5FPXA 3BJAA 4IEYA 2M8EA 4ORFA 1LJ9A 4XF3A 1R36A 1K78B 3BPVA 3FMSA 5HDKA 3HRTA 2LDUA 3J7AO 4ZYHA 3MCZA 2XGXA 3I71A 1FYKA 1I27A 4KICA 3GO5A 5ICCA 3NJZA 2HR3A 2QQ9A 4XF1A 1UHWA 4IRIA 3DV8A 1EV7A 2KJBA 3GEZA 3LWFA 2RV8A 4IEWA 3O6BB 1F4KA 2MH2A 5BXXA 4HMZA 1CAUA 5HDNA 5BY5A 4BQAA 3IRQA 4HBLA 2JPBA 3RI4A 1KQ8A 3M7GA 2H6BA 3V7RA 4LA3A 3CO7C 4EJWA 2EFPA 2K4JA 3DF8A 1D8JA 2QENA 3NRVA 4OIRF 2EV6A 4HLYA 5T3NA 3CDHA 1HW2A 2QJVA 4KIGA 2P6TA 2HTJA 2VBYA 1W5SA 1U8RA 5FLXZ 2XL9A 4XF0A 1JHFA 3ABTA 1REPC 3PQJA 3V8LA 1S7AA 5D8LB 5FFXA 3V7SA 4FX4A 4RGUA 3ZMUA 3SHFA 1ZRDA 3MDPA 4A12A 2K9ZA 5JI6A 4LEJA 1T98A 3JAMZ 4WF2A 3M9AA 2GIVA 3DPLC 1FT9A 4HVOA 1JHHA 4AWXB 1WLTA 1PDNC 2KXLA 2XLAA 4IRGA 1IUYA 1L3JA 2R3SA 3QAHA 1LEBA 3BWGA 1XN7A 3FF5A 3HT1A 4XFFA 4L9NA 1H9TA 1H1MA 2QM3A 1KU9A 5JVTA 2FRHA 1Z05A 3HQXA 5HDGA 1YFXA 4QM9A 3ZQ7A 4KU7A 4G8XA 2K4BA 4JQFA 2Q0OA 3GZ5A 1A04A 1SD6A 4P9FA 1IPJA 1I6XA 3NVCA 4PIYA 1TBXA 3QU3A 1EH6A 1UCXA 2XAGA 1OFNA 2QBYA 1EH7A 5I0RA 1CAXB 2D5FA 5D1IA 5JAXA 1IXSB 3S2WA 2FXAA 1ZNPA 3CTAA 3COAC 3E5XA 2HQNA 2XROA 4Q5SF 3F21A 5BOXA 4JTOA 1OMIA 2CV6A 4LUMA 1ZH5A 3USSA 1HBXG 4LFUA 1NXMA 1FXZA 1RNLA 3LSTA 1UCRA 2PMUA 2DTRA 4KNYA 2PG4A 1GXQA 2XUBA 4TV7A 1H0MA 2ET1A 3NEUA 1YFYA 2VOPA 3CUQB 1XGOA 2PYTA 2L54A 1RUOA 1Y9QA 1R1VA 1S3JA 3C7JA 4L2NA 3I7DA 1YO5C 5IT9K 2XAQA 1S29A 3BB6A 1KYZA 5EEGA 1ZN2A 2RNJA 2YPRA 4P55A 3R61A 4MEYF 1SD5A 5ERIA 2CWEA 4QLCU 2H6CA 3K9TA 1O4TA 5BPIA 3GZ6A 1LDKB 5CADA 2IXJA 4ZU4A 2XV4S 2DI3A 1NYWA 1RUNA 4XFGA 1GQGA 4WZCA 4I98B 3KCCA 2FNAA 3QOPA 4U0VA 1TQPA 4UXAA 1GVJA 2L3DA 4WK8F 1HW5A 3M3IA 2PN6A 5E20A 4UBHA 3V8KA 2VC1A 3RPQA 5DV5A 1TW3A 1P6RA 3F8MA 3TO6A 5KHGA 3IHUA 2XIGA 1IXRC 2XVCA 5E16A 2FE3A 5LRRA 4A6DA 5BPDA 2VBWA 2ETEA 4A5MA 3TGNA 2EV5A 2PEXA 3ELKA 3GUDA 2IA1A 3I58A 3PVBB 2V1DA 4P5OA 1XDUA 3GX4X 2W57A 1STZA 2F2EA 4F7ZA 1J75A 3BPZA 1IXCA 1ODDA 5FFZA 4EGYA 1V70A 2YR2A 4ESFA 3IL2A 4HW0A 1J3PA 1FPQA 4NQWA 5CJ9A 4XFBA 2K27A 3SCFA 1PMIA 3CO2A 3J80K 2ZXJA 2IXKA 1OR7A 3E5UA 5ICFA 4M72A 1MJAA 1XDSA 1BI0A 2YSRA 2VONA 3BALA 1WI9A 1UFMA 1KU7A 1IN8A 1MJBA 2PAMA 2OBPA 1Q3EA 4WXDA 2QWWA 4UNOA 2UYAA 1ZG5A 2R7FA 4RS8A 1Q5OA 3LA7A 1G3SA 1IN6A 5FO5A 1WSUA 4IEXA 4MZUA 3KGZA 1YIOA 5HVQC 2A6EF 5KVRA 1LR5A 2A68F 2FBKA 2A07F 3D0JA 2JSCA 4Q4ZF 3WTUC 2VECA 1BI3A 2IPQX 4XSXF 5JCTA 2YX7A 2QDRA 1YFHA 2HEOA 2GZWA 4E2SA 2EVXA 2IP2A 5TRDA 2LNBA 4A2UA 3ES4A 2M30A 1USTA 3SQNA 3BROA 1X8MA 1U12A 2OA4A 1JXSA 4MEXF 3GW2A 4CICA 4A5NA 2DFIA 4Z82A 1OD5A 4AVCA 1J58A 1XRUA 1YYVA 5JR3A 4KWJA 1XGNA 1PUEE 2ELHA 5JSRA 3WW2A 4Z2YA 2CGPA 5I0TA 5BS6A 1R58A 3DKWA 2HTSA 3Q5FA 2LSOA 3SXWA 4L0ZB 3HSRA 5BMZA 1HQCA 1R23A 4U88A 1MGTA 2L4AA 2G9WA 4MTEA 2Z33A 2YU3A 1UD1A 5HI0A 4XF9A 5D6EA 2V9VA 2KRFA 4G6DA 4OIOF 3IKVA 4J1XA 1RGSA 4BH9A 2K02A 3F22A 1OYYA 4UVCA 1XGMA 1SMTA 4HV6A 4LG0B 3PLQA 4FHTA 2W24A 4LK1F 1FBUA 5FLJA 1J2XA 1K78A 2CSOA 4N9HA 1DGWA 3NKTA 1HW1A 3HYIA 2MPFA 4IERA 5KHJA 3BP8A 1J0RA 5CVRA 3WW3A 2VXZA 2QQBA 3RKWA 1YWKA 1ZZ6A 1LB2A 1X82A 4ESBA 1ONVA 4EWDA 2RKHA 4U0WA 2B8MA 5D5WB 1P4WA 2DK5A 3T0YA 2PA7A 2OA2A 3WTWC 2F5FA 1CAWA 2LF7A 5DD4A 1O3SA 5FD5A 5A2QK 3U9GA 1YFUA 1NE6A 2NNNA 2UYBA 2BV6A 1HKTA 5HS7A 2GAUA 3T8TA 2OD5A 3LFKA 5DUIA 2VE9A 3MEXA 1DPUA 5C6CA 3KLOA 3PQKA 1EP0A 1W7PB 3ROUA 4MTDA 2QCSB 4J1WA 1B59A 2DU9A 1DZRA 3RPUA 2Z3YA 4QGNA 5IT9Z 2F5DA 2RDPA 4S04A 4EWAA 3H1WA 3LA2A 3IKTA 4QGLA 4AQ2A 1CF7B 3TDUC 4M9ZA 4BNCA 1VTNC 4A0YA 1Y3TA 4RB0A 1ZREA 1DUXC 1NHAA 4CXFA 3GXOA 4G9YA 3U1DA 1WA4A 5HLGA 4R79A 4Q47A 2XL7A 5ED4A 3N97A 4XLPF 4LLOA 2DQLA 3ZMVA 3KLNA 3P9CA 5D5XB 3V7CA 2VODA 5K5QA 4PGHA 4G94A 5C8WA 3U11A 3B02A 2VC0A 3OGJA 2J5OA 4UV8A 3TO7A 2HWVA 4KN4X 2PAKA 1CAVA 3KP7A 1ON1A 4N0BA 1Z9CA 1RZ4A 3P7NA 3KP2A 2P4WA 4RAYA 4M6XA 2FBIA 5E18F 4DQ2A 2PFBA 4I02A 2W84A 2HQRA 2A5YB 4MQVA 4L18B 1CAXA 2CW0F 4GYGA 3QPTA 5LRSA 4Y15A 1Q43A 2ZJ2A 5J8FA 4ZZLA 2MLKA 2B9UA 1H9GA 3HT2A 3WE2A 3J80Z 1TQIA 1BIBA 5CVJA 3PFIA 1FYMA 4L9TA 2BNMA 4LTAA 4WXHA 1VP6A 3RYKA 4PCQA 4LA2A 1U2WA 2IT0A 3KE2A 3E3VA 5CVIA 4JBAA 3ML6A 3BOQA 5DYMA 4XETA 4HLXA 2JRTA 1BI2A 3O14A 5E8IA 3OV8A 4YIFA 3CUQA 2A61A 4LMYA 4CO8A 5J7MA 4ESJA 5D4RA 2L01A 3KMHA 3CLOA 4Z07A 3LAGA 2OQRA 3R0JA 5KHHA 2WV0A 4HX4A 3JTGA 5F6FA 1QO0D 2F5CA 1DP7P 4E2GA 3S7EA 3ZN0A 2NNYA 1BBYA 2HZTA 1TTYA 1YUDA 2Q1ZB 2VBZA 5JHUA 5E1RA 4CGZA 3F8NA 1CAWB 1ZZ7A 1QPMA 1YLFA 4KIBA 3RTRA 1I1GA 2CFXA 1FY7A 3EYIA 3TOAA 1JUHA 3T1BA 1JGSA 4WBBA 4L0YB 4YFNF 1YS7A 3K69A 3SZPA 3H7JA 4LK0F 3CF6E 4A6EA 2HKXA 3WG9A 2FEZA 2JZYA 1RC6A 4RGXA 1G3TA 2GA1A 1HSTA 4QXKA 5CU1A 4ENMA 1FBQA 1BOAA 4KMFA 2QNKA 1IN5A 4Q48A 4Q0SA 2D5HA 3I54A 2K7LA 4H0EA 2E7WA 4FAHA 3I59A 4YFKF 3DFGA 2D45A 5I93A 1R5GA 3F6OA 1K79A 3G3ZA 3SXYA 1CGPA 2ZKLA 4BIFA 4EJVA 1DZTA 1U5TC 5K5OA 4EROA 1FSHA 3WTTC 3V4GA 1XCBA 3E6MA 3S0MA 1WRJA 4LLNA 1PP8F 2F4PA 2UZKA 4IJAA 1CAVB 5DEQA 2Z69A 3MAJA 3UKTA 1FWZA 5FDBA 4I01A 3OD0A 3CJNA 2CAVA 3O2PE 3LOIA 4ETSA 1ULYA 1EYBA 3WW4A 2O3FA 4EM2A 2IVMA 4O5VA 3D82A 1J5YA 3QP6A 4HYEA 5KHIA 4MGIE 1BJAA 4ZYDA 1LRHA 5A2QZ 1QGPA 3QU6A 4XBFA 2CAUA 4PIZA 2I45A 4AIHA 2FQPA 2IW5A 3RNSA 3EUHA 1XSXA 4EM1A 2V6CA 2OQGA 2A69F 5H6QA 1J7KA 4AVAA 4IPAA 1MD0A 4D7TA 1B9NA 1PP7U 3VFZA 1AWCA 1SAXA 5BV6A 4JV4A 1LDJA 3DP7A 2FSWA 1ON2A 4RAZA 2QQAA 5LHIA 2QVOA 1O7LA 2Y48A 3F6VA 4KT5C 1S8NA 1YLLA 4Q0UA 1KA8A 1HSJA 5DCMA 3ULQB 3JZVA 4YNIA 2W85A 2DK8A 4O9EA 5FGMA 2GQQA 2H27A 2VPVA 4BYYA 1FYLA 4LD5A 5LBQA 3CO6C 2PFWA 4K8FA 2JT1A 4RB3C 2NAZA 2HDCA 3HRSA 2RN7A 3BDDA 2PBIA 3TQNA 5H6RA 3R4KA 4LG0A 2VE8A 4L9JA 1T2KA 3LA3A 1DDNA 4HDUA 2IXHA 2Q4SA 2FOKA 1G3WA 3FZVA 3OCPA 3RDIA 3L2CA 2BYVE 2PQQA 4QM8A 1X7NA 2OAZA 2LF8A 4I0AA 4KWLA 2Q0AA 2WC2A 4LUKA 3K1NA 3OTFA 3DXJF 3GFLA 1UIKA 5J3UA 1T0FA 2HYGD 2PHLA 2XLGA 4L9VA 3GBFA 5DD8A 1SMYF 2GC2A 2VOOA 3I59B 2HYFA 3L9FA 1USSA 3REOA 3M1EA 4KL1A 4RB1A 2QYOA 3KEQA 2STWA 1TNTA 2D1HA 3WTXC 4ASNA 3IDBB 1QXJA 3I64A 3QP5A 3F23A 4XEZA 1XCVA 2ISZA 4ZH4F 1IF1A 5K1YA 3HTSB 2DW4A 1O3QA 1W5TA 4MGZE 1W7PA 4TLFA 2ZMEB 3SFZA 4GO1A 3E97A 1WKMA 2Z2SB 4O3MA 3GFMA 4IF4A 1SFUA 4Y17A 1O7FA 4IEUA 3PNAA 5LHHA 5LEJA 3E6DA 4AD9A 3IBMA 3U2RA 3Q9SA 1CF7A 4IVNA 4HN1A 3F72A 3RKXA 4HDVA 1DGRA 4NB5A 1YW8A 3MWMA 3P9KA 1UPIA 2ZCWA 2MLGA 5AVPA 3FM5A 3ELNA 1ZZCA 2D1VA 1J1LA 3OOPA 2LKPA 1OYIA 1E2XA 4HAMA 4BHPA 4ONUA 5FCCA 4HA8A 4ZU5A 1E17A 3GFIA 2WWYA 1Z6TA 1QY4A 1NZCA 4OFGA 2EK5A 1P4AA 5F1RA 3KP6A 3HOTA 4B8XA 4UXNA 1IRFA 1FNNA
chains in the Genus database with same CATH superfamily
4MGRA 2F48A 4EJOA 2JIJA 5ICEA 1NOVA 2VVFA 1NY71 1WMEA 1WW5A 3DXUA 1W6QB 5A7WA 3HOBA 2CUEA 3IP4B 3U07A 3RJRA 3Q8FA 3CCQI 1SLLA 1VAMA 3OBAA 2JSPA 3D5RC 1SVMA 4JC1A 2NS0A 2DXIA 2P6HA 4LGWA 2HYKA 5LA9A 2E1MB 1UMQA 4EEFG 2DA1A 1A78A 1ZA4A 4H7LA 4YEJA 1WH7A 2RGVA 3MLJA 3W5NA 1YOVB 2RM23 1UWWA 2MA3A 2GNBA 4IX7A 2TBVA 4IEQA 4HVQA 3N35A 2FDJA 1P7IA 4JYKA 4QXHA 4RGGA 2IS6A 2DTWA 4YFXF 2X5IB 2P5KA 4ASKA 1J9IA 4BACA 1VQ8I 5D6FA 5FYIA 1AU7A 1ZGWA 4ZXKA 4ES9A 1KDKA 4E6KG 1CESA 1Z67A 4Q27A 2G9ZA 4U7DA 3MW3A 1Q1HA 2ZNZA 3WG1A 2EA4A 1RI7A 3FUOA 1GZ9A 2HJIA 1V55H 2ZKNA 1LHVA 3FE5A 3K1MA 3AMQA 3WF3A 2E19A 5LK7B 2C0ZA 4XORA 4KIFA 2GXAA 3WTSC 1AL21 1LJ7A 2ECBA 4PIXA 1R9TJ 5FY7A 2WNVA 5ILUA 4XR6A 5HCFA 1YO8A 3NJVA 1U9NA 1HCRA 4XQ4A 3H50A 3POJA 4YG0A 4CEYA 2ESNA 1U5IA 4QT6A 4FPHA 1TNRA 2ATFA 5HLHA 1AX0A 5ANQA 2ACJA 1YTYA 1XTAA 4QMAA 2K9LA 4BQQA 3OGRA 3PNVA 3W3CA 4R4XA 4KH9A 3VKNA 1VRH1 5IK8A 3LSDA 3Q8CA 3VB9A 3WHUA 3AYDA 1ZRFA 3K0LA 1XSQA 1LQ1A 2OJED 4NPLA 3OYHA 2R32A 2E1NA 3IAS2 1OI6A 2UUZA 2UXNA 3JQWA 4XRSG 5CQGA 2DF7A 3VD9A 1VZ0A 3A01B 2YUEA 4P9LA 1VQLI 2J1AA 4NDLA 1YIFA 4HRIA 2QZ2A 2H0VA 1TG7A 3O1OA 4MH0E 3HUGB 4XSZF 1U6GA 1IN7A 2BZTA 2V79A 1RUG1 3K4MA 3BZCA 1Z0HA 1YW9A 4YG2F 2WO3A 4B4QA 5JOZA 5E17F 4YIIA 3NRUA 4XUTA 4L5JA 4C0HA 4JOMA 4QB1A 5IAVA 5DS9A 3VD7A 3ZPOA 4MGYE 1ZBE2 4A3ZA 2YBSA 1ORKA 4KMUX 3SCHA 4BM8A 3NKGA 1SLIA 2FZ2A 3ASNH 1ZA7A 1MJ9A 3HEIA 5D8AB 3HTUA 3L2UA 1H88C 2D3PA 1MEC2 2PTMA 2W87A 2EIGA 3GLLA 2JJ7A 2LW8A 3HHHA 4RA2A 2EZIA 4JZRA 2CWSA 1SC7A 2ZXQA 4XJAA 1QJY2 1B4AA 2VN2A 4NIAA 3ZR8X 1ND2A 2GP3A 1ZGJA 5J6XA 2R7XA 3IN9A 1KS4A 1XS9A 2WZPP 3I5UA 1JI8A 1EV12 2MD0A 2PLV2 5GJ6A 4L97A 3VEPA 2L9LA 2B5HA 4XLCA 4A7YA 1VQKI 4QPIA 3AG4H 2ZEZA 1RUF2 1P4XA 3BCAA 4CPBA 1W7PD 2XC7A 1UYXA 5FYSA 3RWKX 1CJDA 3CZ6A 1R5HA 4UV9A 3FN9A 1A8MA 2LRPA 3SYTA 4G7OF 5FKMA 3UT0A 4OAZA 1Z7S3 4Y20B 1WUVA 2HGCA 1V3FA 3FX3A 5GZDA 1YRZA 3TYJA 3UETA 1GHCA 1UB9A 2XVGA 3GBWA 2VCAA 2AEZA 1NQJA 3JREA 1M1EB 5CG9A 1EJ9A 1QA6A 3A0KA 4MV2A 2XAHA 1POQA 3ILFA 3SISA 1W9SA 3HSFA 3JRGA 2XSDC 3VHNA 2XRNA 2RQPA 2A5WA 4ENNA 1NLRA 3EYYA 1LEMA 4P9YA 4M6VA 4QX5A 2W08A 4A45A 5KK1A 1XX5A 2C26A 2EXIA 4IHWA 4ZZ8A 5ILSA 4B7EA 3M8EA 2JB4A 2DOFA 4Q1RA 2VXRA 5JZGB 2WAQN 4DYQA 2EA2A 2SLIA 3T08A 5K7FA 4XKWA 5I0SA 3AXEA 1OCPA 5FJKA 3QPHA 5K9YA 1G9FA 2W7NA 1W90A 2MH9A 2BJSA 2ADUA 2DLLA 4OOIA 5BNPC 2DFHA 3P9IA 1XE7A 2CS3A 3RQ4A 3KYLA 5LBFA 2G0EA 4B29A 3I4PA 2A70A 3DYPA 5LW9A 3KX2A 3ECOA 5EEHA 3VD5A 5IAXA 4Q0PA 4BQ1A 1SFEA 1YW7A 1YS6A 4AXOA 2PN5A 2VZVA 4RAFA 1RUE2 2XVLA 1MBGA 4YZ2A 5F64A 1NQDA 4JRAA 5AC93 1MZBA 4A7KA 5FZ9A 2CG4A 2CFOA 1U5XA 5L3DA 4KA4A 5SV5A 1TNSA 1XNDA 2O03A 1VMJA 4QIWN 2P8TA 2A6HF 3H1MA 2F4OB 4QKNA 2Z1DA 2J1EA 4L9BA 4INDA 1XGSA 2UWBA 2EB7A 2CQNA 4FTSA 4YVSB 2Q8EA 1U5TA 1S0IA 5DAWA 3TEYA 2E1CA 2IFRA 4O6JA 2CW8A 2HOAA 4C3JJ 4A3MJ 4OUSA 2P6SA 1SZBA 2XAJA 2V1UA 2D40A 3T30A 3PSIA 4M9XA 1OCRH 3ZMZA 3TNPB 5DDGA 1DQ4A 3EXUA 4ITCA 4PSWA 1H2LA 1Z21A 2R5YB 2NMOA 1PK6C 4WXCA 1CAUB 2EIKH 3G7DA 3JRAA 2JWPA 4XZPA 1REDA 2W94A 3UR3C 1W03A 2UY9A 2PAEA 2YY1A 3PDQA 5E3OA 1MH4A 3ZYRA 1JTYA 2IGOA 5CFDA 5HS9A 1N1TA 4FPGA 3MKLA 5EWSA 1JGGA 4P5YA 2DMTA 2GA2A 3TL4X 1TC3C 2ZHNA 4CU8A 5D21A 3OPTA 3SEZA 2Y64A 3I2FA 2COBA 5H2FC 3LQRA 1C1FA 5E6HA 1JE8A 2CV2A 4LLFA 1APNA 1MIJA 3AL0C 5I91A 3GLXA 4M3CB 2OZUA 3TDZC 1LFPA 4CRQA 4R9DA 3KP4A 5L9VA 1ENRA 3PVNA 4E7KA 2EF6A 4KYWA 3QBQA 3C3WA 1RUC3 3O1RA 1QZEA 1XYNA 2Q2EA 1RTVA 4MNUA 1JU3A 2Z16A 2H09A 3M8LA 4NC6A 3VUOA 3GZUC 2CGNA 3WGGA 2RG4A 4I99C 3QYEA 2QBYB 4H2AA 4COYA 4B48A 4NIGA 2Y0MA 1GP6A 2Y60A 1GNHA 3RKYA 1I3QJ 3BJOA 1RHI2 1H8TA 1YI2I 5D5VB 1R71A 1ACCA 5LLQA 4B4RA 4AAXA 4LJHA 5F39A 1BMV1 3M4OJ 1TWHJ 3WG2A 1DPRA 1Y7BA 5A3TA 1YG2A 3EYPA 2R6QA 4D7NA 5A3OA 5FZ0A 4CP1A 1UG2A 3CCRI 2RDQA 3DEUA 5FPZA 2DN0A 3KZ4C 4H4KC 2ZX0A 2ESHA 3ABZA 3U21A 4P9UA 4XFCA 1WJAA 1S0FA 2JDUA 5FP8A 4BJTA 4A3FJ 4MQ9F 4HPKA 3MZHA 2C6SA 2A3SA 2XB5A 1SVLA 3JRDA 2L9VA 2MD5A 2IRFG 3N7LA 1DDLA 2QSGX 1B35B 4DB5A 4ISQA 1KYWA 2VZRA 1D0HA 3AAFA 3L7WA 2OZ6A 2VQAA 4YYOA 2K86A 4EZHA 1ZLKA 2HOEA 1UY3A 5BNQA 2VXDA 2ARAA 5D8KB 2UY8A 4M3EA 1RUI3 2VT2A 1XE0A 1T39A 2X1CA 2CYYA 2K46A 3ABLH 5KAIC 5FZKA 1SMVA 1TE1B 4HPQA 3LDKA 4DOZA 4YFZA 1WBFA 1EH8A 1JODA 3GTJJ 2BGPA 3FHQA 2VKDA 3GFJA 3OYNA 3MFCA 1LEAA 3WP4A 4ZS2A 4C2MJ 3O7OA 4P9WA 2XHKA 4N7IA 1XB9A 2WV1A 4F55A 3ZX7A 3HN3A 3PM1A 1S0JA 1KU2A 1RMU3 5F6LB 5CVVA 4XRFA 4NQWB 4TWTA 2IA0A 4COWA 4Q0VA 2Y6LA 1CN1A 4BHBA 1W0NA 3ZYFA 1WPKA 4EQQA 1DYOA 4AEDC 6PAXA 1QRYA 2HU9A 1CZTA 1ZRCA 4R4ZA 4CCOA 1YHFA 2HH9A 4Y1UA 2PHTA 3B9IA 4UHTA 3GDBA 4IESA 1R7JA 1WFXA 4F52A 2C9AA 2IC1A 4WM8C 3WG3A 3MPBA 2R7RA 3VPRA 2LTNA 5C9AC 2OTLI 1RR8C 1MQTA 5A70A 2NN8A 2ET7A 1H1AA 3M3OA 4MXVA 1TQ5A 3V65A 3DQVC 3KETA 3FXQA 3VKOA 2WJSA 1SBDA 3S17J 1YCIA 4GD4A 4PZJA 2CQ7A 3OYBA 1HDPA 3WGHA 1XSRA 4KFCA 4R8HA 2DQRA 5BUVA 2R30A 1Y9GA 4GRIA 5HLIA 1VJ2A 2MGQA 1PO21 3IMMA 5A3MA 1HN1A 4OIPF 5APAA 4RD7A 2XGCA 3FBYA 4Y13A 3CMEI 1GYKA 1OA3A 3H3UA 4CP9B 2F4MB 1E3PA 1KEXA 4P9IA 2D93A 5CVUA 2N8GA 2L7FP 3NQOA 2R49A 5J40A 4XMYA 2D6NA 4I0BA 2KDZA 1DU0A 2E32A 4GGGA 2R7SA 4XN0A 2OKXA 3LDRA 1UG0A 3SNMA 4HG2A 3D3AA 2QA4I 1NG0A 1MMGA 3BIWE 2XPWA 2B7YA 2XKOA 2K9SA 5GTHC 4EV0A 4EYUA 1HXDA 1VMFA 2LROA 3CCEI 1IS6A 3ZXJA 3IPVB 2HLEA 3ZYBA 1NKGA 4DBRA 1NK3P 2LLKA 2FDHA 1AX1A 3CUOA 2BERA 2NS7A 4Q2FA 1X8EA 4JDNA 1X58A 2DMPA 5FAXA 2H0BA 2P3JA 4ORFA 2M8EA 3DBHB 1K78B 3BPVA 5HNHA 4LHNA 2LDUA 1BHGA 3RZKA 4CXWA 1NLQA 2I2SA 3LEIA 2XGXA 1I27A 1CQ9A 4HKWA 3NJZA 2I10A 2HR3A 1VBD3 1UHWA 4LK7A 3MICA 3I3DA 5JOWA 1VBB1 1BL0A 1EV7A 1G9AA 3GEZA 2RV8A 5FUIA 4FPOB 4Y22A 3S6PA 5BXXA 2WFF1 2B4KA 2CY6A 4BQAA 4HBLA 3RI4A 3M7GA 5IVEA 2H6BA 5TISC 3V7RA 3CO7C 3NRVA 4BMBA 2EV6A 1UYZA 5FZHA 1OCOH 1HW2A 4KIGA 2P6TA 3SH3A 2VBYA 2W4SA 4BQOA 1AR83 2V5YA 3BTZA 2XL9A 1AR93 1EAH1 2Y26A 2DFFA 1U0AA 5J4YA 2VKEA 3V7SA 3ZQHA 1QH7A 3ZMUA 1ZRDA 5HCHA 3PTRB 4A12A 2MC4A 5HV4A 5JI6A 4XCBA 1T56A 3N9MA 2QQKA 1GZWB 1IQDC 3PL8A 4BJ0A 1JHHA 5FYUA 2ENRA 1HRV2 1L3JA 5JI7A 2ZGUA 3BWGA 4A6SA 1COV3 3FF5A 4TLGA 4L9NA 3UESA 4G3YC 5DM6F 1LHOA 2QM3A 4XOPA 3TN91 3I3MA 3SJMA 1D4VB 4YG3A 1PZ9A 2KQRA 3AVRA 1AYM2 2VUMJ 1IKQA 3WLUA 1YFXA 5F1JA 4KU7A 4G8XA 1N25A 5F9TA 5GPAA 4TTGA 5FPBA 1SD6A 2WY7Q 1IPJA 1WI3A 4LBQB 3NVCA 2X29A 3NO8A 3O1MA 1BLZA 1UCXA 5KXEA 1ETQA 3AMMA 3WDVA 4OULA 1ZNPA 3CTAA 1MZ5A 4EJRA 3E5XA 2HQNA 2GOXB 2XROA 4YZ1A 4CUGA 2BVMA 3A02A 1ZH5A 1YE9A 1HBXG 3AZVA 5IVYA 1NXMA 4Y4YA 5LY2A 1X3ZB 1RNLA 4DOUA 1UCRA 2PMUA 2K3FA 4J6GA 2KD7A 1UXZA 2PG4A 3OMYA 4TV7A 2JB8A 2WQZC 3OSGA 5DUVA 3OIPA 3CJTB 2VOPA 4MIMA 3CUQB 1PO22 2PYTA 3F95A 1X4PA 3G1LA 4E7HA 1S3JA 2JX9A 4UUSB 4BEHB 2JA8J 4N4OB 2OVUA 1QJU1 1DGRM 3BB6A 5EEGA 4P55A 5FYYA 5J1RA 1O4TA 5FMCA 5BPIA 3N7MA 1LDKB 2GALA 3ZQQA 3TP0A 1NYWA 1GQGA 3KCCA 1QOTA 2MEV3 1OQDA 4DS0A 2E7AA 1BEV1 1GVJA 3LEKA 3CZJA 5E20A 3RSNA 2JUCA 3V8KA 2QKLB 2VC1A 2ZBJA 4LOTA 3I2GA 4D5CA 4MADA 1JZ8A 4YM3A 1TW3A 3F8MA 1O59A 5KHGA 5LRRA 1GWMA 5BPDA 3HOVJ 3OJBA 4RGKA 1X36A 4CA0A 1V9U3 2ETEA 4A5MA 4Q5OA 3MIGA 1LHNA 4NHYA 3WP5A 3HQRA 1J09A 4DXSA 4LKFA 1U9OA 4JKMA 3PVBB 3GX4X 2W57A 2O7OA 3BPZA 1RUJ1 3DPRC 4ESFA 3IL2A 1B72B 5A1FA 4XFBA 2K27A 4YGDA 5FYHA 4Q8KA 1F36A 3D1NI 2TUNA 3R4SA 3KV5A 3E5UA 5ICFA 3SEEA 4M3BA 2YSRA 2VONA 1G59A 3WQ1A 4QD2A 3MIHA 4NUBA 5LBEA 2H1KA 2XF5A 3ZXSA 1IN8A 1MJBA 2PAMA 3U4XA 1W9YA 1ZG5A 4P14A 1Q5OA 3LA7A 3PURA 3B6AA 1IN6A 3J7NA 1QHGA 5FO5A 5FMOL 2NMNA 2HWF2 2VW1A 3KGZA 4RYDA 3J8F3 2V6EA 5KVRA 4PF1A 1V6MA 4EN6B 2A68F 2FBKA 2ORXA 2VJ4A 4FVVA 2VJJA 2M0MA 2ZX4A 2YX7A 2HEOA 4FTBA 4IE7A 2EVXA 4GMP0 3LD8A 2V73A 2LNBA 2YB7A 3B69A 1VQ6I 3ALQA 4IQJA 1OCTC 3ES4A 4LOSA 4AFMA 4DEQA 1MZFA 1F5JA 3THTA 4CICA 5LATA 4AVCA 1MS8A 2DYRH 4KWJA 1D4M2 3H3LA 1CD3G 1ETOA 3LSRA 1TVGA 3WW2A 4CEWA 4Z2YA 2DOAA 2ZEYA 3TEDA 5EYRA 4BQWA 2AZ5A 3CU7A 3TEXA 1J1TA 1Y6IA 1FMD3 2VW2A 2AREA 3VBSC 3SXWA 2NVYJ 4BZ4A 2E60A 3MW2A 4C2TA 1WMXA 1ZBA3 4U88A 4AI8A 1MGTA 2L4AA 1GT0C 3POWA 3MV01 2XH6A 5D6EA 2V9VA 1QQP1 3A22A 5IYDJ 2K02A 4ASMB 4XZUG 4LG0B 2BQPA 5ABJB 2CDPA 4AW7A 1FIAA 5FUNA 1ULOA 4BU2A 2JDPA 5FLJA 4LMFA 4N9HA 1DGWA 5IK4A 4Q4W2 4IERA 3BP8A 2VXZA 2RVAA 4BA6A 4BMEA 3RKWA 1YWKA 2WAAA 1V54H 2EICA 3VBUC 2RS32 2FDFA 2B8MA 1POV3 4OMDA 4QQHA 1CAWA 2Y0IA 4A7ZA 5DD4A 3ZMNA 2VQ0A 5FD5A 4SLIA 2JA2A 3VBFB 4P02B 4HFSA 2BV6A 2GAUA 2W82A 3VKLA 3BTYA 4IV1C 2YV8A 5DUIA 1FATA 1DPUA 4J1WA 2QCSB 4P9JA 3VBOA 1OHFA 2Z3YA 3M3YJ 3DECA 3AXDA 2BW8A 4C9YA 2RDPA 1C3HA 4FPLA 1JTXA 2Q8OA 4S04A 1JYXA 2WKKA 4EWAA 3PMEA 4CDUA 2PJRB 4NHXA 1CF7B 2VU9A 3VBRA 4A0YA 3VDDA 5GZEA 1N3QA 4V2WA 3CF2A 3HGYA 1Y3TA 2ZA9A 1ZREA 2ARXA 1NHAA 3GXOA 1YQCA 3HOZJ 3J7HA 1RUJ2 1ULDA 4KMQA 4LLOA 2DQLA 5B4NA 3P9CA 5D5XB 3V7CA 5K5QA 1B09A 4G94A 5C8WA 2VC0A 2VI6A 3MKWB 1V6KA 3QH7A 4KJZA 1IO2A 2PAKA 5A7SA 4DNYA 1RZ4A 5FZAA 1DYKA 3AJYA 4E7SA 2FBIA 5EJ3A 4DQ2A 5IP7J 3W5MA 1R1A2 4L18B 2Y6JA 4II2A 4Y15A 3WU2C 5L73A 5A7WB 1K3IA 1WVRA 4TXWA 1BIBA 3B93A 1FYMA 4D1QA 4L9TA 2G9FA 4PCQA 4LA2A 2P3IA 3BC8A 2BVBA 3IMNA 3DYOA 3H5AA 4JBAA 4LBKA 3BOQA 4Q1PA 3AJZA 4XJ8A 4HLXA 1OH4A 3OV8A 1IRZA 4C90A 4LMYA 1XNTA 1ND3C 1MS0A 4E4HA 2L01A 5KC6A 4DUWA 3ZMOA 1DG6A 3R0JA 2WV0A 4FE7A 3JTGA 5F6FA 5IP6A 4M3CF 1DP7P 3TBDA 3LE0A 2NNYA 2KMUA 2GSYA 2RMU1 3MIBA 3VZKA 4Z92B 4FPFA 2RS52 2Q1ZB 1YUDA 5L7OC 3BT9A 1UZ0A 4JGZC 3AP5A 5FYTA 4KIBA 4GA9A 4YZ5A 1HKDA 3GHMA 1JUHA 5B4XA 5FRNA 5K7HA 1LOBA 1TWGJ 4YFNF 4DPNA 2WNVB 4RHV3 1SLBA 3A21A 3ONQA 3H7JA 1LFUP 2W0XA 3AKPA 3CF6E 2Z5WA 2DMUA 3G71I 3ZFEC 4CEYB 2JZYA 3JXSA 5EYXA 3K4NA 1FV3A 5CU1A 4JGYC 3N3HA 1DP0A 1WCMJ 2K7LA 1UMIA 4H0EA 2R073 3DFGA 1K83J 3HEFA 2HOSA 3K7AJ 2LRDA 3F6OA 2OTJI 2BY2A 3SXYA 3TW6A 2ZKLA 3ZVXA 1PMJX 4DXRA 1TMF3 2BXZA 2BDRA 1PGL1 3WHTA 4DZGA 1HRI1 4EROA 3V4GA 2DA7A 5LASA 1LFBA 3GCXA 1SFKA 2ZFUA 4IJAA 1CAVB 1LGBA 4M01A 2QQLA 5DEQA 4XACA 3IZOA 2E1MC 1U0JA 1HJFA 4BDVB 1F31A 4I01A 2D6LX 3CJNA 3LOIA 2O3FA 2IVMA 5GZCA 4BXSV 4GKYA 1U8BA 5DZFA 3S14J 4GMP1 1DGWY 4I76A 4HYEA 1RUH2 1AR61 2EZLA 5KHIA 2DJIA 2X5IC 1LRHA 5A2QZ 1LESA 1VQPI 2QFEA 3AMNA 3QU6A 1S9HA 3H9QA 1IJWC 1W9TA 1GOGA 3VDCA 5I0DA 3HD8B 4MGSA 2A69F 1J7KA 2KPMA 3E7LA 4IPAA 4D7TA 1GSLA 1W0PA 1Q8VA 3VSKA 3WNXA 1PVC1 2VUJA 2FSWA 1ON2A 4RAZA 3ZSJA 2WS91 2Y48A 1TL8A 3F6VA 2A3YA 1S8NA 5DDJ2 1WZ2A 1F43A 3UK9A 1HSJA 1ND2B 3ULQB 1KONA 1X19A 5FO8B 1WJEA 3JZVA 3NAPB 1HXS1 2HWD3 1W6QA 2DK8A 2ME6A 2H27A 3ZQCA 1UZWA 1QU0A 4BYYA 3KQRA 4AHXA 1PNGA 4LT5A 3CCSI 4RB3C 1AL23 4PLMA 2LK2A 4OI4A 3TQNA 4QPIB 2VVDA 2DVFA 4URAA 4BDYA 1X2NA 5FRMA 3R4KA 1LVKA 2AENA 2BP6A 3VV1A 2BVLA 1DU6A 4M4PA 2QQ8A 2IXHA 5DG1A 3RPUD 3ZN4A 2XJPA 1MS9A 2FOKA 1JZ3A 4X6AJ 2XGEA 3JBG1 2OAZA 1WD4A 5F3IA 2DJNA 3RWNA 5IW0A 2XPJA 1N47A 2L9RA 2WC2A 3DXJF 2AGSA 1RUH3 3V0BA 4IOCF 3S5AA 4L9VA 4WV8A 3GBFA 4ZHNA 4AWDA 2VOOA 2EIMH 1FNZA 1JZ7A 3I59B 3HBLA 4UAPA 1SFPA 5CAZA 3PVOA 4GB33 1W0TA 4RB1A 2VMHA 2RDRA 5K4LA 1VBE2 1QXJA 4XEZA 2ISZA 1RVF1 4BISA 2DW4A 3W58A 3ZKYA 3I3BA 2VCMA 3RZMA 4FASD 2XG3A 1S55A 4LBQD 2Z2SB 4O3MA 3GFMA 5DQ0A 3FL7A 4IF4A 1O7FA 5FZDA 3RQ0A 1T2XA 4XW3A 1RUG3 2DWRA 3RI8A 5LEJA 5D8AC 4XKCA 4YVWA 3KT4A 4HN1A 3F72A 4UW6A 2QKDA 2XPVA 2C5DA 2ZCWA 2MLGA 2LC2A 4II3A 4LHSA 3AMPA 1ZZCA 3OOPA 1N1VA 2LKPA 1F2NA 1TNFA 2G19A 1FEXA 2ZJQF 4HA8A 4ZU5A 2RDSA 5GLZA 2IS4A 3H0DA 1QY4A 2YROA 5FMOS 3VYUB 5J1UA 4UT5A 3KVBA 2CQQA 4XQWA 1IRFA 2WSUA 1FNNA 5BPXA 1E5RA 5HCBA 3DF0A 4O65A 1OA4A 4CDWC 4HF1A 2GWRA 5DCMB 1W9WA 1L7LA 4P5HA 1W2OA 3BG9A 4FO9A 1FOYA 1U5TB 4AVPA 1L0OC 4RM2A 5FY0A 2X85A 4OINF 3CLPA 3CC2I 3KYDB 5C5TA 4JK1X 3A2KA 3INAA 1RPWA 4OCTA 1N1SA 1QKQA 1ZG1A 4YGCA 2VOTA 4PQ9A 1EKEA 4MHGA 3J7ZI 2IGKA 2A6YA 4J01A 2Y33A 4AYUA 2QGUA 1X1CA 4IHXA 1O91A 2KJCA 3L00A 4IUGA 3PUFA 3FHIB 3ERED 4CVUA 2YX4A 1XMAA 3T1MA 1XNCA 4XICA 4X6QB 2O0YA 4IO9F 1SFXA 3WF4A 5E79C 2WN3A 5CFDB 4CCEA 2GU9A 4N4NB 5JIAA 5JZGC 3BQZA 2NRAC 1AA7A 2CV0A 3T3YA 3VHRA 1B9MA 4EMSA 2E7QA 1K5MA 1X2MA 5BNGA 4HLTA 3CQZJ 5JOXA 4FFHA 1OCZH 1UHMA 2HQ5A 3H35A 3NNLA 4QQ2A 2X1DA 2VOKA 3IV5A 1SPPA 5ILVA 1YJWI 2J1UA 1P2FA 4PDWA 3VBHA 4A42A 1ZVFA 1Z6RA 2UV1A 2L0KA 2K9MA 4BDZA 4WM7A 5EZWA 3G2BA 5GKAC 4F92B 3FK7A 3W59A 4OWRB 1WLCA 5FJHA 3IC7A 3ZN5A 5A3PA 1ZGAA 3F3XA 3AP6A 1PO12 3C7FA 3WV6A 3R0AA 4CYCA 2PHFA 5FK8A 4BE3A 2Q2EB 3MF6A 4OMYA 2QVSB 3BTLA 4CCJA 3ZPLA 3BCWA 3LQQA 3ITQA 1BI1A 2AEYA 3AZYA 1UY4A 4BAYA 4DGWB 2BNOA 4KU8A 3JD73 2EINH 2MBFA 2DCZA 2DURA 4DINB 5J1YA 4YVSC 1JOJA 4FPYA 2D98A 2OF7A 3ZMDA 2ZZJA 1H8TB 1VALA 3RZJA 2STTA 1JUPA 4IHTA 1ETWA 4AFDA 4HNVA 3AP7A 3FBMA 4IV3A 1IG7A 2LP0A 2Z42A 5LB6A 4EVIA 1VBA2 3WNOA 4XXAA 2BW3A 3AKZA 5LGNA 4GFBA 1IS5A 1ENXA 3WP3A 4EATA 4LK6A 5FKCA 2E63A 3I2IA 3J4UH 2W1OA 1FP2A 3CDZB 4HPKB 1OBNA 3S3MA 3I3LA 1QZYA 3ZXEA 4DIQA 5FROA 4WWCA 4NOTA 3IDEA 1TP4A 4XC9A 2HWC1 4OHWA 4QQOA 3TNQA 4QQLA 2MC3A 5JMOA 3CJRB 5FZCA 4ENKA 2YC0A 2OZJA 1PO13 1XE8A 4QKFA 3K10A 3NJYA 3PIOF 4ZYGA 4LULA 2FMLA 1HLCA 4N7UA 4F93B 2XSJC 4Q4X2 1SCRA 2GH2A 4NIHA 2MG4A 3K1PA 2E5ZA 1R091 2EIJH 4Q4V1 2ZO4A 2XQRA 4LO8A 5KAFC 2DDAA 2J42A 1Z0XA 3FLRA 2DBNA 2YU1A 2O8XA 3MZYA 1US3A 3TO9A 4YRVA 3RS6A 1KGSA 1GVDA 2XLFA 3NV3A 1A34A 2DT7B 3OYCA 5HOOA 5L9BA 3HRMA 3K4CA 4GALA 4DNCA 1QXPA 5KCMA 5FPUA 3MYXA 3TOBA 4OIQF 2KKOA 4BBSJ 4IEOA 3WT3A 2OC6A 4JHZA 1XSVA 2VBXA 3EBRA 2XJUA 1S4CA 4OI0A 2DBIA 1IGOA 1J3RA 3OL4A 5E3LA 4BCUA 5E1XA 1MQTB 3ACHA 2KFDA 4M9SA 3PUSA 2JG9A 2F5VA 1OXCA 1ZAOA 3LPFA 3ISPA 2LFBA 2D7FA 1UPSA 5C4WA 1RIOH 2DU0A 2J22A 3HRUA 4PJYA 1BN5A 4CZZA 5FPVA 4BHCA 2ZMEA 3ZDSA 3LEGA 2W39A 3CJXA 3K4ZA 5DN2A 2D6MA 2WFPA 1B6AA 1B35C 1AJKA 1SD7A 5FLHA 4NWVA 1MMSA 4QXCA 3PNTA 3LAJA 3Q8EA 1DBNA 4Q4X3 2ZHKA 5FD6A 4KI5M 4RAGA 2DA3A 4B3XA 3LFIA 4UVAA 2JXAA 5ACA1 2AXLA 2HWE1 1S2BA 1R082 4YM1A 5BQTA 3WTVC 3K4AA 4LBJA 2IXIA 3WNNA 2O61A 4FOVA 2ZKZA 2B0LA 2A3WA 3W21A 3K77A 2DT5A 2BE5F 2R0FA 3QD6A 3A0HC 1UW8A 4E4DX 4Z2WA 5LGTA 3EO6A 4HX8A 3CJQB 3H9AA 4HL0A 3IT8A 4PF5A 3BG3A 1TME1 3GCMA 1XD7A 1OKRA 4B7KA 2J1TA 1C5HA 3UKVA 2B42B 3RZLA 2VZTA 4OAYA 1D8KA 5C7GA 2QQNA 4RM3A 3HOSA 1EA3A 3QACA 1WJDA 4BK5A 4QAWA 1Y8RB 3OYWB 4CP2A 2DPUA 1NZIA 1O57A 2QLZA 1ULPA 2WQ8A 4FQGA 1DP3A 4BY7J 1IG3A 2Q8CA 3ABMH 2PHXA 5FXVA 2KIQA 1FJLA 3IH2A 2WSVA 4V1PA 2AQEA 5A3NA 1V5FA 2P6CA 1WJBA 1BBT2 1MW7A 1T6GC 4Y22B 2GP5A 3V64A 2FD5A 4B43A 2HWB2 1IQAA 3S7IA 5A3LA 1OJLA 2ZEWA 5T5JA 3Q0VA 1UOGA 4E4SA 4HVRA 4META 3ZFFA 3I53A 4BLIA 1UOJA 5IOZA 4OZOA 3GYHX 1KITA 4P96A 5EZGA 3H1YA 4I3PA 3WDXA 2M45A 1HC8A 1RKWA 3V56A 5K0UA 1GV5A 3L2WA 3TW7A 1EUTA 4V2VA 5I8YA 1ETKA 2DA6A 5FLIA 1QHHD 2WBKA 2BHZA 4IKFA 2V09A 2PXJA 2VZOA 4LBNA 2EA7A 3ACFA 2EIBA 2A05A 2R062 3E0JB 2CQKA 3WR0A 3EQEA 4M0HA 4A0ZA 3AB0A 3KZYA 2KR2A 3RZZA 5A3UA 1MVEA 1FPN3 2W91A 4CDGA 1Z1DA 4AIKA 4DUXA 1VAKA 3GCWA 2Y75A 5LWBA 5FZ1A 4PJJA 4Q4Y1 4GXOA 4HV5A 3K4LA 5E8GA 5LEKA 1WBLA 1X9TA 1Z7UA 2VT3A 3OYFA 3OUIA 2DPDA 1IRXA 3M8FA 1WWXA 1GWKA 4FCAA 5HCAA 1NG6A 3H0GJ 2V4AA 1KU3A 2HVSA 1D3YA 2HKOA 5F08A 1AOYA 3PJQA 1SD4A 1UZYA 3F8CA 4CCLA 1W4MA 2BOLA 1ZZBA 2ZGTA 1O3RA 1ASJ1 1W8TA 2K5CA 1AR72 3S1MJ 1I3AA 2FF4A 1ZZ9A 4XRSA 4PJMA 1ZRIA 5FXZA 3K51A 2WAFA 5LHGA 4CHUA 3JB8A 2UWCA 5J09A 2ZOEB 1JT0A 2DBBA 4CP9A 3R60A 5FLXK 2EH3A 1FOD2 2JENA 2GMMA 3PIPF 2W46A 1VBC1 2YS9A 3RVHA 2XBO2 1D2QA 3ZXAC 1CZSA 3IDAA 4CPBD 1O6UA 4B09A 2HWE2 4PGGA 1F4AA 4CZCA 5FQ0A 3P3PA 2R16A 2WFF3 1XPXA 4IRHA 1R49A 4IEVA 1RL3A 1FTZA 2TDXA 3ZLIA 1RKTA 5GALA 2OUMA 3DCQA 2GLOA 3ZSLA 2OT7A 5CFCB 3PMSA 1EAH3 4GKXA 3G6EI 3NSTA 1QWRA 2CGOA 3W20A 1RB8G 2JIGA 1S5LC 2H1LA 1CPNA 1QEXA 4JQRA 3T2TA 2K0GA 3O0XA 5EJZB 1LKNA 3V8JA 3BZKA 2YYOA 2Z5UA 4QHZA 4IXLA 1NCQA 4A3XA 1JZ2A 4D5FA 2ZGKA 3FMGA 4ENJA 2QDNA 1RINA 1XU1A 5FKKA 2QSHX 5J37A 2XDVA 3M4FA 3H9JA 3TN93 2WT0A 2R1BA 1QNTA 1AR73 4ZZDA 4QKDA 3POFA 3L2RA 3LZZA 4BE1A 1FLIA 4X0GA 1X1PA 2JVHA 1K42A 1WWYA 1RIRA 2P7CB 4M73A 2EFOA 2L2OA 2WR9A 1FOD3 2X48A 2CQXA 3JUUA 3SH5A 2VW0A 2JUGA 5HS8A 2EFQA 2VNGA 2TCTA 1R1UA 1PM7A 2IXCA 2GC0A 1GZWA 3R0RA 2WZR1 4J25A 3CUQC 3A1YA 3JSPA 1S2EA 4HSLA 2HOTA 4N8MA 4FPJA 4IHSA 1QJZA 4UB6C 2K3PA 3BG5A 3ZXGA 1J83A 3KSCA 2JE8A 1XB4A 4W1UA 2BGCA 2FCTA 3KP3A 2AS5F 4ZU7A 2CUZA 4O61A 4Z6YA 4KITB 4OUEA 1N1YA 4Q0QA 5CISA 1QJU3 2ZXHA 5JSOA 1ZYBA 1WCKA 5F0FA 2YC4A 1PYVA 5F3EA 5JLWA 4CEWB 1W8OA 1UMZA 2XF6A 3AYAA 1QVUA 2ZABA 4A44A 1R00A 2BRTA 3O3KA 5FKNA 5IPAA 1F35A 4Q4Y2 5I8SA 3OR2C 1BEV3 2WTEA 1LOFA 3S3OA 3WNKA 1V4RA 5A6XA 3ZYJB 1BJZA 3EJKA 3VZJA 2L7MP 3FKJA 3HOUJ 2L9SA 2PJPA 3BG6A 2BWAA 1FX7A 1MKMA 5CKQA 1GLNA 1W28A 1JJ6C 4IEYA 1LJ9A 4FI9A 3FMSA 4P9XA 1MBEA 3FBNB 2R5ZB 4ZYHA 3MCZA 4UUSA 4KICA 5TGTA 3O1SA 1IUFA 1PGW2 3JCIA 4GWJA 2QQ9A 4IRIA 5GTIC 1W0OA 3HNYM 4X1EA 1LOEA 4FXGB 2RR12 2KDOA 4IEWA 2MH2A 4BKXA 2V9KA 2DMNA 2E1OA 5BY5A 4C30A 4MHRA 3C8XA 5FRAA 1GP5A 4LA3A 1HB1A 2RM21 2EFPA 1F8VA 1YI9A 2QENA 4OIRF 2RJ2A 1XOYA 4HLYA 3C7GA 1IGNA 3PSFA 1ETYA 2HTJA 5M5WJ 1U8RA 4XF0A 3VBOB 1Y1WJ 5AFEA 4AG4A 1REPC 3V8LA 1S7AA 2GN7A 1H30A 4RGUA 3B00A 2X6XA 5GLVA 1OOPA 3EUHC 3CC7I 3GZTB 1T98A 1K4SA 2DCKA 4WF2A 2L9NA 4CDUB 2X8KA 3OS0A 3M9AA 1Y0NA 5C5UA 3VBRB 2O14A 3VDDB 1PIV2 4D7MA 3KF5A 3GTLJ 2VGDA 3HN1A 1WLTA 1PDNC 2KXLA 5CA6A 5FIXA 4I6ZA 2PHRA 3I55I 3QAHA 3HT1A 4XFFA 3BKZA 1D1AA 1JKPC 1GFF2 1W2UA 2CU7A 4ITVA 3HQXA 1TT5B 4FQZA 2VE1A 2K4BA 5FO7B 3I2OA 1A04A 4P9FA 3BTAA 1TBXA 3QU3A 4AEKA 2VD7A 2CJJA 4S2HA 2JQ7A 1EH7A 5ABJC 5JAXA 1O4ZA 4NRMA 1VQ7I 4MXWA 4HOOA 1QQP3 2TEPA 4CCNA 2YHJA 3ZXKA 3ZQGA 5FZGA 2CV6A 1KJRA 4LFUA 4DXTA 2O8OA 3PUHA 4A4AA 4KNYA 4RDUA 2XUBA 3H3VK 3N9NA 5KXBA 3NEUA 4YWAA 1QDCA 3ON7A 2VB6A 1PGSA 2A73B 2L54A 1DF0A 1QNYA 2ILMA 3VBFC 4L2NA 3QYBA 3SKJE 3PFYA 3ZIXA 2I74A 5IT9K 4JCKA 4XIKA 1W8UA 3DTIA 3ZN6A 1ZN2A 1IPSA 2VUCA 5ERIA 1SD5A 4QLCU 2CWEA 2GNTA 2H6CA 2P0WA 4YZ4A 2IXJA 2XV4S 2ADDA 3AM2A 2DI3A 5C3SA 2RS12 3FIWA 4RLQA 4WZCA 2R7EB 3QOPA 4U0VA 3K2AA 2NOGA 1ONAA 3W2VA 1AVBA 4UXAA 2E2HJ 1YQ6A 4PK4A 4XHBA 2IS1A 3M3IA 4XILA 1IZ3A 5FZ7A 4V2FA 3PIGA 1EPWA 5DV5A 3LNQA 4FPKA 2QKMB 2XVCA 1IXRC 5E16A 3NQHA 2FE3A 2FUG2 5DG2A 2BV4A 4K9SA 3BR0A 2D6KA 1X1BA 4FP3A 1FYUA 3OPWA 1E0EA 2XJQA 1STZA 1JKQC 1L7QA 1V70A 2YR2A 3GTOJ 1J3PA 1FPQA 1ENSA 2KHMA 5CJ9A 4TYSA 4NRQA 3J80K 4V19K 4AQTA 2IXKA 1WCQA 1OR7A 2HXIA 4M72A 2WADA 2TRTA 2EXJA 5FZ8A 4QPWA 3CCYA 1VQ4I 2W47A 4QPYA 3B3QE 3M7AA 3VYSB 3ZRGA 1OISA 4O7XA 1Q3EA 1YC61 2DU1A 1PZ8A 3BIEA 2FHRA 2QWWA 2XVKA 5C44J 1REFA 1GUIA 1OLRA 1W6NA 2F17A 4RS8A 1G3SA 2YGLA 3FXLA 3O1UA 2DCYA 1YIOA 2PJRA 5HVQC 5DM7F 5HODA 2A6EF 1NTCA 4YELA 2OX0A 4QPGA 2AQFA 3PUBA 5FZLA 1ZBE1 2M34A 3D0JA 2CU5A 4HK8A 1BI3A 4XSXF 2GZWA 1MEC1 5TRDA 3F0CA 4JKKA 4A2UA 3CESA 2HEWF 4NC7A 4QSHA 4BQ2A 3BROA 1X8MA 2OA4A 4A3DJ 3ACIA 4MEXF 3KHBA 2X10A 1YI7A 2ZGNA 4XLEA 1QJY1 1OD5A 1J58A 1XRUA 4F3QA 3LSPA 2JICA 1S0GA 5FUPA 1XGNA 3J7LA 1ST8A 3I2HA 2ELHA 5JSRA 2B63J 5FZFA 2CGPA 4HETA 3AKQA 2W48A 5BNOA 1IV8A 3BG7A 4L0PA 3S1NJ 2RMU3 2ZGMA 5FY9A 1EV11 2F4LA 2ZGQA 1W8FA 2PLV1 2WNVC 3OYJA 3HSRA 2AUYA 4XQFA 1RUF1 5CYYA 1WLDA 2G9WA 2Z33A 2CSGA 4CEYC 1UD1A 1BR1A 5B5EC 4DFSA 2KRFA 1BVVA 4G6DA 4OIOF 1M06G 3TRSB 1MSEC 3F22A 1OH3A 1X33A 1QH6A 4Y24A 4G4FA 4IW3A 1FBUA 3PJYA 3PIJA 2MW8A 5LA0A 4X8PA 2A71A 4E7ZA 2CSOA 4HONA 3PTYA 1FTTA 1HW1A 4D94A 2MPFA 5KHJA 1J0RA 3WW3A 3LFMA 3T1LA 2Z79A 2VZ1A 2GN3A 3V0BB 1LB2A 4EWDA 2PMWB 3LPGA 1SAUA 4U0WA 5D5WB 2YBKA 2DK5A 1RUD2 2PA7A 1DFQA 2OA2A 3CJIA 3WTWC 1SLCA 1HRI3 2IZWA 1QU3A 4N43A 1NE6A 2UYBA 4E8DA 4CCKA 2WA4A 4P00B 3NV1A 3LFKA 3UGHA 4COUA 1EP0A 3ROUA 2D43A 5EG0A 3S2HJ 5LD2C 4QGNA 1JKRC 1RITA 4OI2A 1UNBA 1ULFA 5FYZA 3ZR5A 4M3FA 3AX4A 2JMWA 3H1WA 1AR63 4AQ2A 1N78A 4DY3A 4YVWB 3TDUC 2WABA 5T52A 1V6JA 3O0WA 5J3LA 1ACIA 5JHFA 1IOAA 5CG8A 3PUIA 3TMOA 4BWOA 4YW1A 4G9YA 3U1DA 3K6GA 1C4RA 1RUE1 3VZMA 4Q47A 4UF0B 5ED4A 2RAEA 1C8M2 1ND2C 4U2AA 4XLPF 3NWSA 3KLNA 3B94A 2VODA 3OIQA 1BCXA 3DU6A 3B02A 2P5BA 1PVC3 3EPZA 3A03A 4UV8A 3TO7A 2WS93 2HWVA 4IDZA 3AKRA 1CAVA 2Y6GA 1ON1A 4NHLA 4CU9A 1FIPA 3P7NA 2P4WA 1Z7S2 4QPIC 3MGUA 1ETXA 1N3PA 5E18F 4MOAA 3VD4A 1ZTRA 4I02A 4MQVA 4JX4A 4QX8A 3OYKA 1CAXA 5A33A 4GYGA 5LRSA 1W2AX 2ZJ2A 2LREA 1GNZA 3HT2A 1RUD3 2BFUL 2YPJA 2ZX1A 3ABKH 5CVJA 3NAUA 3AFHA 5DAQA 1Z3XA 2BNMA 4LTAA 1W3XA 2VULA 2IT0A 4H14A 3KE2A 5JR2A 5CVIA 5DYMA 1H9WA 4DQAA 3JBG3 2C1FA 3H8OA 4DMIA 5E8IA 1Q56A 1S2KA 2SBAA 2VL4A 5J7MA 5D4RA 3KMHA 4GJZA 5BYNA 3FKIJ 3APBA 1YX5A 2Y9ZA 4IHVA 3CF5F 1F5FA 2J7MA 5DPNA 4MFDA 4EN0A 4HX4A 3A4CA 1QO0D 3S16J 5A7QA 1BZWA 3NAPA 9ANTA 3RQIA 3KF3A 1SEUA 2BU9A 3K3NA 1C8M3 1K5MB 1RVF3 3NMBA 2VBZA 3QWLA 4Y5SA 4XDQA 1JUSA 1MNEA 3KM5A 2CFXA 1RUI1 1FY7A 1SPPB 3VBHB 4PDWB 4C1XA 2CYFA 1JGSA 2JDKA 3AL5A 2DODA 3PUQA 1CR7A 4GWNA 1RJ8A 4UFMA 1DGRN 4WM7B 5AC92 5FK7A 3OB8A 4XLHA 4LK0F 3RSJA 4A6EA 2Q5TA 2YFUA 5FZ4A 2ME0A 1RC6A 5J36A 3TBIA 1ALYA 4XDPA 1R5ID 1HSTA 4CYCB 4QXKA 1ULCA 1PUFA 1BOAA 4KMFA 1IN5A 3CHXA 4Q48A 1I3HA 2D5HA 3I54A 2VMDA 1DQ6A 3CCLI 4BQNA 3I59A 4YFKF 1HV1A 1I1EA 5I93A 1RHI1 2DFBA 2AO9A 3G3ZA 1CGPA 3OS2A 2V72A 2E36A 3PJRA 2PMZA 4EJVA 1U5TC 4BXXJ 1LENA 2VQUA 1WRJA 3CLQA 2FMDA 4LLNA 1PP8F 4LKDA 4NN0A 1BA5A 3UKTA 1S0CA 3H5NA 4IV3B 3CBNA 3CDIA 3OY8A 1PNFA 4LXLA 3DBLB 2CAVA 4ETSA 1ULYA 1QOSA 3WW4A 4BK4A 2BW3B 3QOEA 1OLTA 3AFKA 2XOMA 4DYCA 1BJAA 2C9KA 1JYWA 4BJ5C 1QGPA 1E5SA 1D0YA 5CFDC 1A36A 1HOMA 3LSJA 4PIZA 4JRLA 1UHSA 3Q0UA 4CDQA 3RFRA 2J1VA 3HOWJ 2FQPA 3BLYA 3RNSA 1AXKA 1T0FC 5DUUA 1XSXA 3OS1A 2OQGA 2EQRA 3K70D 5B3SH 1PP7U 3VFZA 3GXUA 5IHRA 4B3AA 1Q8OA 3AP4A 1H6YA 2JE9A 4B1RA 5M3FJ 1O7LA 5J47A 4GH4B 1YLLA 1KA8A 3LSIA 4E8CA 1KD7A 4AEJA 1O4YA 5DCMA 4EE2A 3T0DA 4D6RA 4PSXA 4ZDPA 1LU1A 1QJX3 2W85A 4WVMA 2JRMA 2JA7J 2GQQA 5KHDA 4KBBA 1RUC2 2VJ5A 2VBDA 1FYLA 5LBQA 2CH0A 2MYSA 4K8FA 3KCXA 4H55A 4AM3A 3HRSA 1ZK8A 3RZDJ 3KD4A 2PBIA 3HZJA 3HJEA 1ENHA 2ZHMA 1T2KA 1XG1A 1DDNA 2DCJA 4OVEA 4UOJA 4UUTA 1WA6X 2Q4SA 1HIXA 4PI0A 2E71A 2ID3A 2BOIA 1SLTA 1W36C 2PQQA 2LF8A 3WQ7A 3OSFA 2V4JC 4KWLA 3E1SA 3GZNB 3K1NA 3CP2A 2JG8A 5H9QA 1H8TC 5CEHA 1T0FA 2ZGPA 2PHLA 3HPHA 3DKQA 2O9LA 5DD8A 1G9DA 4KNCA 4L8QA 3QPSA 3L9FA 3M1EA 2JG9B 4KL1A 2QYOA 2NPIA 2STWA 3HR9A 1TNTA 2MSYA 3WTXC 4ASNA 3IAM2 4XAAA 4C91A 1XCVA 5C4WB 4ZH4F 2E51A 3IH4A 2V26A 5HBAA 1O3QA 2VY0A 2BY1A 1DGWX 1JN2P 1POV0 2ZMEB 3SFZA 4XDOA 4YZ3A 3X2QH 1SFUA 1RUI2 1AR81 4RS5A 5KC5A 2VIXA 1BOBA 3KIOA 1AXZA 1H4HA 3PNAA 4AD9A 5IOYA 4QB6A 1ERDA 4IOAF 4IVNA 3RKXA 4CE8A 1IDYA 4NB5A 2YDEA 4QWNA 1O8SA 4AI0A 1V6LA 1NCRA 3FM5A 2WAEA 2HWC3 2BUKA 2D1VA 2B39A 3NNMA 1GR3A 4BHPA 5FCCA 3WUCA 5FLMJ 3S1QJ 1RMU2 1E17A 3GFIA 1AYN2 5DAXA 2WLPA 3HOXJ 1NZCA 3OPZA 2V7FA 2BGOA 3KP6A 2XUMA 4C3HJ 2WWUA 2VNRA 1WHUA 3POEA 2WUHA 2IA2A 3ZYIB 4IGQA 4JX5A 4NRPA 1K6YA 1F5TA 1R093 2JD9A 4Q4V3 1BC8C 3H36A 1KGYA 4ZTJA 3FFQA 1HKSA 2FD8A 1A6IA 1X9PA 2ZPXA 3OEBA 3IWZA 1LGCA 1OFCX 5CYVA 1ULGA 4CZSA 3BY6A 3HC7A 1OCCH 1NAEA 2EFNA 1GQHA 2LVSA 4KQ7A 1P92A 1IHMA 4NVPA 1KQ0A 1BC7C 1SEFA 4FOQA 3VYRB 1MQTC 3ABUA 2FBHA 1ODMA 4IEPA 5I0UA 3J81K 3OGVA 2FDKA 2PI0A 3E6BA 4CDXB 1BVP1 4MHUA 3GNEA 3KZZA 3JRIA 3ETQA 4R52A 3E5QA 4AFCA 3ZFFB 3RJ2X 4HQMA 3M70A 4IZZA 1OYWA 1EF4A 2DO7A 4A3KJ 1D2SA 4EJTA 1FI2A 4OU0A 2HNHA 2O5RA 1HRV1 5K0UB 3I97A 2M9HA 2VCBA 4MLOA 2ZBKA 5FP9A 4EM0B 1AYN3 3POSA 3HQUA 3T09A 4A0XA 3A4UA 1BM9A 3ORJA 3JSOA 1AYM1 2IVIB 4A41A 2JJ6A 3ASOH 3KEYA 1C1LA 3PHMA 3MPPG 5JXIA 3VKFC 2KA3A 5ACA3 1YX3A 1V9U1 1ZARA 3WODF 2W1WA 3SCGA 1WJFA 1M4WA 5LA2A 4XPVA 1FMVA 1CIYA 2RNGA 3QPLA 5DCFA 2LG4A 4LE3A 5F6KA 2ZACA 4AI3A 2HBTA 5CLSA 1FOWA 3GTMJ 3OGGA 1Y1VJ 2EAAA 1TME3 4LR4A 2WNUA 1QIQA 5IJRA 3S57A 4TZDA 5F0CA 5B2GB 3MO4A 4AQ6A 1VBD2 4RQPA 5FWJA 1L7RA 3E1F1 5LK5A 1Y8QB 3BJ6A 4KUMA 1Z91A 1I1SA 5EF6A 2QZ3A 3NW4A 3DTKA 2XKPA 2DA5A 1UZZA 5F5AA 5C3QA 2XRLA 1UX7A 4FE4A 1HB4A 3E6CC 4G7HF 2BEOA 3S3NA 5FY4A 2ETHA 3I4IA 2XGDA 2ID6A 1PM4A 1AR82 3BQYA 1YHQI 1AR92 4XKBA 2N7GA 1V6OA 2XASA 4WVZA 3MN2A 5D5UB 1U78A 5FWEA 5FQ0B 5JSPA 4FPCA 5EJ1B 2OS2A 3D8CA 1O3TA 4LLLA 1LVAA 4RGRA 1RYYA 4Y1ZA 2E31A 2BBYA 4W8JA 1YQ5A 4X6RB 1COV2 3H92A 2B7EA 2O8QA 5J1XA 3VODA 5L3EA 2BFUS 2PX9A 2LM3A 4R9BA 3MUY1 1QMJA 2M0CA 3K48A 3OYWA 4PLNA 3JRCA 2LBFA 5DUKA 4QHBA 2WINB 2OCEA 5FY5A 5FP4A 1T8IA 1W5CC 3B73A 1FMD1 1JHNA 1IN4A 4PHZA 1OUXA 3G73A 2BWCA 4YW3A 1I50J 1ZR4A 1JUIA 1RETA 4XLAA 3BTCA 1NCQB 1ZBA1 3OYIA 2ZXWH 3WUDA 3W2AA 3MUZ1 3D6EA 2Z99A 1Z77A 2BHYA 1S7OA 2GH8A 3T2PA 4C2UA 1ZG3A 1WCUA 3DPTA 4AIDA 1PMHX 2P81A 4K8RB 3LOBA 4XLNF 3WU1B 1J3QA 1OURA 2X4HA 3OBRA 4JHTA 1JZ4A 2FQ3A 1XU2A 4RBOA 2DVDA 3BCBA 4N9IA 2HWF1 3OYLA 3H42B 2W1UA 2GNDA 5IT3A 3FXUA 2YZ4A 2P5LC 2IGNA 4NAMA 2CRGA 2DAOA 5B66C 3G6JB 3D5SC 3ZPYA 3GF2A 2AYHA 2ZMLA 1WGXA 4KWKA 3J7MA 1XSDA 3N9LA 5SV8A 3RMXA 5G04L 3WQ0A 1LPQA 1BK1A 3C2BA 1ASJ3 4AFAA 4ET7A 2NVQJ 1B1BA 3USUB 1QF3A 1ETVA 4CYDA 1YXWA 2MEV2 3BR3A 3ECQA 3U10A 4YW6A 1D4M1 3RGBA 4CUAA 5J8CA 2DFCA 2VBBA 3SH4A 1HQNA 4CP0A 4P9GA 1F9KA 2QQWA 1VBC3 1IAWA 2K9NA 2M7AA 2RVCA 4XMAA 1TWCJ 3RIRA 4RR3A 2A6WA 3RMYA 1V9U2 3ZP5A 5CFCC 3ZXFA 2WO1A 3GTPJ 2HS5A 3MFKA 4LE4A 1SFNA 3POIA 2VO5A 1VR3A 3DXTA 5FPAA 4IL7A 3VDBA 1JMUB 3HOYJ 5IK7A 2KIMA 3L9JT 1GMMA 2Y0OA 2YFZA 4QX7A 2R7WA 4XUOA 4DEVA 3AZWA 2WT1A 1C0WA 2GC3A 1SQ4A 1D1BA 3N36A 5FXXA 4AFBA 4Y1VA 4ON0A 4Q4W1 2ISYA 3H8XA 2XAFA 3V42A 4D0PA 4FBFA 1TZLA 1JOPA 4XLFA 1FC3A 2XR4A 4HF2A 2RS31 4OHYA 5GP9A 3KEOA 4LBOA 4AVBA 1W04A 5FYCA 1NG7A 2HFHA 3AG2H 1F1ZA 2A3XA 1D5VA 3J8F2 2WYFA 3B9CA 4RB2C 3I4MJ 2PMHA 2LYCA 4ZKTB 1VRBA 2EILH 1MS3A 4HNTA 3OYAA 4A3CJ 4KBZA 2P5VA 5LGUA 3WVJA 5CFCA 3NV2A 3CL1A 3WEZA 1E3HA 4DYRA 3OUHA 1XJAA 3RZOJ 3LWCA 1MS1A 3AC0A 2VZQA 4QTRA 1IKPA 4FX0A 1EY2A 3T4HB 4IE4A 2IBDA 2WZR3 1V6IA 4Y5TA 1OOPB 3RYRA 4HSJA 5JR7B 1VQ9I 4XFHA 1FMD2 2CO5A 1UX6A 4FETA 1HF0A 4HKOA 1LDDA 4CEWC 3ST7A 2GBYA 2ZAHA 2QSFX 2ORZA 1ZBA2 4CH7A 1XMKA 1BK0A 2VC9A 2E6VA 3WDTA 1ITYA 3F8BA 1NA1A 2YBPA 5EV7A 1WD3A 4RHV1 3MQ0A 1W8WA 1FP1D 3Q8AA 5A1AA 1ZYRF 3KHCA 1CZVA 2XJRA 3JRBA 1R1A1 3Q9OA 2RC4A 4QGMA 4XHXA 2UXXA 5JVVA 4DY5A 5E8AA 2VQLA 5BNNA 2R043 4AVTA 2DYCA 2QUFA 3FM3A 2BY0A 3BU0A 3FHNA 4MXWB 4LPLA 5IFTA 1SLAA 1DYPA 1MMNA 1I5ZA 2XWJB 3URFA 2EWNA 4E7IA 3ZO0B 2CTVA 4OMZA 2YPDA 2G4IA 3KT7A 2ZFWA 5T5PA 4NHJA 5C33A 2WA3A 3T0AA 1JZ5A 2C6YA 4HZFA 3AVSA 5HNFA 3NV4A 1RRJA 4FT8A 2UU8A 2BBAA 3PNYA 2ZS6B 4ZYAA 3BN6A 4YRDA 3HWJA 2YG0A 4XYXA 4EWEA 4KDPA 1D5YA 1HLVA 3MZ8A 2JECA 4FSJA 3WOGA 4QWQA 2MHFA 1YNAA 3KP5A 3U75A 1I39A 1UIJA 3ZN6B 4RGSA 2RS51 3MI8A 2DMQA 2VVEA 1CPMA 3KYCB 4M00A 2P37A 3WNPA 5C8CA 3JAMK 3NNGA 3VBOC 2ZGRA 3JW4A 5FREA 4HQEA 3ZN1A 2GDFA 5CNAA 4CUCA 2EFWA 2ES3A 2DA2A 1A31A 3MVPA 5IVBA 4A3GJ 1YQAA 1SG3A 4CDUC 2ZMKA 4AVSA 2DTZA 2G7UA 5GLUA 3OYDA 3VBRC 4LO5B 3VDDC 2E53A 1T38A 2F4IA 2VMGA 3WTYC 1UZCA 3WINE 3L2YA 4BL0B 5ICGA 4G12A 4S05A 3MIDA 2G7HA 3LGRA 4G7ZF 3BTIA 4BY1J 2R5ZA 4AHWA 3RYPA 4BQ5A 2HWD1 3FXJA 2AR6A 2Y0SN 4RGAA 4EJUA 4H3WA 4QX1A 4M74A 1VI0A 4IETA 4IE0A 4WX9A 2B9SA 1O5UA 3DTEA 1HX6A 3ETPA 4NE9A 3IIIA 3H7YA 2PLYA 5C3RA 2W5FA 2QE3A 5LZ6A 2QQMA 4MO3M 4L11A 3V0AA 4CXXA 2KIUA 1XQNA 4XJZA 2OCCH 5A6ZA 2ZHLA 2DCTA 1W6NB 3HMYA 5IVFA 1G2HA 5FBZA 1UELB 1RUH1 1VMHA 4I2OA 4HBNA 1C8NA 3SC7X 2XB0X 3W6KB 2ARCA 4QPGB 1K45A 4ZPIA 1K7AA 4GB31 2Q8DA 3ASIA 3TKYA 4RL7A 1V5EA 2GXGA 4UFHA 3IDCB 2LKSA 1S6LA 2M87A 3WSOA 3GVAA 2JN6A 5CQEA 4AYBN 2VJXA 4QDRA 4HNUA 1E57A 3C1DA 2L02A 5L3BA 1MDMB 2DVGA 3VKMA 4IXAA 3BZ6A 3WHCA 5DDJ1 1W3VA 2HPIA 4HN0A 3FDYA 3VOEA 2VNVA 2ZSIB 2IVJA 3WGIA 1MBFA 4RHV2 2R92J 5JDBA 5BNOB 1BW6A 3ES1A 5JIUA 4OI1A 2FNPA 4KWUA 2DV9A 3EHKA 3FMQA 3C3VA 2OU2A 4HF0A 5E1ZB 2CUFA 5H20A 3T5XA 4NR1A 1ZX5A 1F9NA 1SBFA 5C71A 1H1IA 4NIDA 3BU7A 3WTZA 2R072 4URTA 2OUJA 3B6CA 4OLLA 5KHKA 4D6QA 1QHDA 1RC9A 4E7JA 1GICA 2QQOA 3BTJA 2XQXA 1MNDA 1R4MB 1TMF2 5C3EJ 3ZM8A 5IFPA 3SQOA 2VQCA 5HDKA 3UL2A 5C3OA 3HRTA 3UV9A 5LA1A 3HNMA 1NY72 3T2QA 4N53B 3J7AO 5IT6A 2HDDA 2Y2ZA 1OLME 4JKLA 3HL2A 2LR8A 2XJVA 2HI3A 4Q26A 4XF1A 5HXMA 4CDWB 1VBE1 3VL9A 3O6BB 1F4KA 1WW6A 3OYMA 3CJIB 2ID4A 2JPBA 4L99A 4N43B 4NPMA 4EJWA 5IVVA 5T3NA 4GWMA 3CDHA 5JVGF 3A23A 1LU2A 1W5SA 5FLXZ 5LBBA 5EG0B 1JHFA 2GMPA 3ABTA 3PQJA 4K1ZA 5D8LB 5FFXA 4FX4A 4GXLA 2K9ZA 3WZ1A 3GBGA 4W6WA 1ZBE3 3KV6A 3JRFA 1SDDB 1NT0A 2GIVA 4ZXEA