4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
3BCWA 3FE5A 1GQHA 1ZGJA 1J3RA 2K02A 2P7CB 4AXOA 4KUMA 4R52A 5E17F 2A6EF 2PAEA 1ZLKA 3T5XA 3BROA 3GZ6A 1P4AA 4LD5A 2L4MA 1U5TC 1Z05A 2RGVA 3SXWA 3RYKA 4PJYA 5H6RA 5J7MA 3I58A 3V8LA 4E2QA 5L3DA 2H27A 2KIFA 4ZU4A 4OFGA 4I98B 3JSPA 1YW7A 1Y9QA 3ES4A 4OIRF 1ZRRA 5CLSA 2A61A 3RJPA 3FFQA 2M45A 4LK0F 1NE6A 4GGGA 1LDKB 2F5FA 3VB2A 5L3CA 4ZZLA 4Q29A 3CUQA 2I45A 3I5UA 1KQ9A 5LEJA 3EETA 4JK1X 4AIJA 2VQAA 4G6DA 2PJPA 2K4BA 3IKVA 1O3SA 2XHKA 5CADA 2IVMA 3KEQA 3LAJA 2P6SA 1T39A 1EYBA 2DQLA 3FXUA 2IP2A 1QQIA 3H8UA 1STZA 2NYXA 3LFKA 4X6RB 4Y17A 1MD0A 4XFCA 4BIFA 4YIIA 3E5UA 2OQRA 2J5OA 2XV4S 2JPBA 3DPLC 3VOEA 2FMYA 4YYOA 4LB5A 4QGMA 4EGYA 4I2OA 2EA7A 1Q43A 1G4DA 3TDUC 2CV6A 5CVJA 3T8TA 3HTUA 4LLNA 1XGSA 4IJAA 5DV5A 1P6RA 1KGSA 3BPZA 2FXAA 3OTFA 2DLLA 3P9CA 2VBWA 1TQIA 4JVAA 4OMYA 1SMTA 1HBXG 4XF3A 2O6GE 4L18B 1AWCA 3CEWA 2QWWA 1P2FA 2LDUA 5ILVA 2D2WA 2WTEA 5I0RA 3RIRA 3LZZA 2XVCA 2TDXA 1W7PB 4AWXB 4O9GA 1WWXA 4G8XA 1YIOA 4BQAA 3D5LA 1WI9A 4JBAA 5BMZA 1D5VA 4EROA 3RKXA 5E1RA 1SFEA 5HLHA 2OU2A 4RB0A 1DDNA 1NE4A 1ZZ6A 1X3UA 2AXLA 5I8YA 4IRHA 4IEVA 4A6EA 3HTSB 5J48A 4HMZA 4FBFA 4G7ZF 1T2KA 2YSRA 1H1IA 3CTAA 2PQQA 1YG2A 2P6TA 1ZREA 2V9VA 1NXMA 3UKTA 1R58A 5FLHA 4HV6A 2PYTA 1PP8F 1KQ0A 1G3YA 2FRHA 3KZZA 4P5OA 3S7IA 1IN5A 1O4TA 4IF4A 1Q3EA 5EEHA 1ZHFA 1FY7A 4A6DA 4ENMA 1MJ9A 1DPRA 2PBIA 2NAZA 3BWGA 1XMKA 4UHTA 3F8FA 4BH9A 1Q5OA 1MKMA 1CAXA 2QQAA 2QNKA 4Q0UA 1XGMA 3R60A 3HSRA 2XROA 5D5XB 1ZG1A 4YNIA 1T6SA 4OINF 1DZRA 3FWEA 3QU6A 5HOOA 1LRHA 3IRRA 2QJVA 4EM1A 2F4PA 4MQVA 1HKSA 2DPDA 5HS9A 3U0ZA 1WGPA 3SMHA 2Z9OA 5AIQA 2O8QA 2ZMEA 2HKXA 3GYHX 1Z7UA 4LG0B 1I1SA 5ICFA 3FHZA 3LA3A 4B8XA 3V7RA 4PIYA 3EQLF 5K5OA 2LKPA 1ZVFA 4AVCA 5I0SA 5BY5A 1OYYA 4RAZA 4MQ9F 5D4RA 4Q48A 2V79A 3CO6C 3WE3A 2HTSA 2IXHA 4XF1A 2G7HA 4AVPA 1Z1DA 3F6VA 2ZCWA 3HSEA 5FLJA 3ELNA 5F64A 4WVZA 5D8KB 1BJAA 2VE8A 3HOSA 1QXJA 1G3WA 1YFHA 3ST7A 2O8XA 2V6CA 3HOTA 2LF7A 5DD4A 1NHAA 3GFIA 1QY4A 4H7LA 3ECOA 3SHFA 3CO7C 3E6BA 2Q0OA 2V09A 2L54A 4KMUX 3FXQA 1YHFA 5FQ0B 3MZYA 2XLAA 2W84A 5BS6A 3BY6A 4AIKA 2PHDA 3HUGA 2JRTA 4Q0QA 5I91A 4I7HA 4KN4X 3LQRA 2GC0A 2Z2SB 4MGIE 3F23A 5EEGA 2R7DA 4F7ZA 5FD5A 1L0OC 2UYAA 2HKOA 3DFGA 4OIQF 2OAZA 2MNGA 4HF2A 4WK8F 4LEJA 2J5PA 2XASA 4QM9A 4J1XA 1EPZA 2P8TA 3JAMZ 5HLIA 4YFXF 5E1ZB 3V7CA 2XAQA 4RS8A 4UVCA 2XGXA 5KHJA 4O6JA 2QVSB 4L5IA 4F8AA 3QRFF 3ES1A 2EV5A 3R6SA 2E9QA 2IA1A 3COAC 2H6CA 1U8RA 5T3NA 2M5WA 1YFWA 3PFIA 1KU7A 2BE5F 1AOYA 2D40A 5JCTA 1R36A 4JV4A 1R1VA 1XB4A 5BV6A 4I01A 2GAUA 1SD5A 5ILUA 2DPUA 3I4PA 3WW3A 3GFMA 3J81K 1J3PA 3C3WA 5K1YA 3MYXA 5CYVA 4HZFA 1JHFA 3IDBB 5K5QA 4MGKE 2F5CA 2WV0A 1PMIA 4GXOA 4AQ2A 5LGUA 5A2QK 1R22A 3OF1A 5HDKA 4HAMA 4JQFA 2CQKA 5LHGA 4YRDA 1J59A 5CU1A 4BNCA 1ZGAA 3SQNA 3W6JB 1TTYA 3KGZA 2V1DA 5FPZA 1OD5A 4D7TA 1P92A 3ZDSA 2M30A 4TV7A 3ETQA 4EQQA 2QM3A 2MPFA 1ZARA 4CICA 2VC0A 3M8EA 1H1MA 3E5XA 4U0VA 4XF0A 1TQMA 2L4AA 5BPIA 3IRQA 3G7DA 3JZVA 5L3FA 2BEOA 3QP6A 1L3LA 1OFNA 1YLLA 3MEXA 5J8CA 1SFNA 3ZMTA 3PQJA 3PLQA 1W4MA 1Z91A 2EVXA 4UNOA 5JI6A 3DKWA 4DNCA 1R5GA 1J5YA 1QGPA 3QP5A 1XCVA 2Z3YA 4QLCU 5D5VB 2WFPA 1HXDA 5JVTA 4U7BA 1LEBA 4O9EA 2HR3A 2VE9A 2E7XA 4P9FA 2MH9A 4XRFA 1CAVA 2FQ3A 2BGCA 2OYZA 3LA2A 5I93A 2E1CA 5D4SA 4LLOA 2VBYA 1KQ8A 4IVNA 2CW0F 3M7GA 1XSXA 1O3QA 4HX8A 2COMA 3WTVC 4N9IA 2VT2A 3C1DA 2A68F 4XLNF 2O0YA 3V7SA 2QQBA 1DGRA 3I53A 2CAVA 2E7WA 2Z5UA 4CO8A 1BI1A 2HFHA 5HDNA 2JPCA 1OMIA 5JR3A 3ZPLA 4Q0VA 4HSLA 1WLTA 3GXOA 5JSPA 1QNTA 1IRGA 3HQXA 2IT0A 3R0AA 2Z99A 2OPKA 2FF4A 2PN6A 3VHRA 1RC6A 2Z69A 3OGJA 1TQ5A 5H20A 1CAUA 5CVVA 4EJUA 1FOKA 3DEUA 4U0YA 3KETA 1BC7C 2W25A 4KWJA 2WC2A 3HHHA 1TW2A 4IXAA 4YG2F 4HX7A 3E97A 2QCSB 4ZU5A 3U10A 3QACA 5BOXA 2IA2A 2JTVA 3LA7A 1RUOA 1HW5A 3CDHA 3FF5A 3WTTC 3QPTA 4M72A 1DPUA 3RDIA 2A69F 1L3JA 1GVJA 1CAWB 3ABTA 1CF7A 3HHGA 3CJXA 1I1GA 1XGNA 2HZTA 5EZWA 2FE3A 1ZZ8A 5LHHA 1FNNA 2YX4A 1ZZCA 1U5TA 2N7GA 2QVOA 2XLGA 3WTSC 4LGWA 2DFIA 1YTYA 1E17A 2DW4A 4MGRA 3IKTA 1RNLA 3MZHA 3T8RA 1FX7A 1YFUA 2ISYA 4XETA 2HQRA 5BUVA 2Y48A 3KEOA 2M8EA 4IEUA 1WA4A 2IC1A 4IEYA 3C18A 2PAKA 2OA2A 1U6GA 1FP2A 2JZYA 2B9UA 1RGSA 4M74A 4KIFA 2XAFA 1D8JA 2ZJ2A 3F3XA 3RPQA 3WU0A 1IXRC 1CGPA 3EQEA 3JW4A 2MLGA 4NVPA 1F1ZA 1J58A 1YS7A 1ZRDA 1ZAOA 2Q0AA 3T0YA 2ET7A 4IEPA 4WXCA 3NL1A 5E1WA 3WTUC 2UY9A 3TNPB 2VODA 1SMYF 2K27A 2PEXA 4ZYHA 4NHJA 3QU3A 1KYWA 2VECA 2IXIA 3NKTA 5C8WA 2UXNA 3B02A 4XF4A 4MNUA 2NS0A 1FPQA 3JTGA 2DBBA 4FT8A 2C6YA 1JUHA 1KA8A 1LB2A 4CDGA 4OIOF 3HRTA 4ASNA 2GC1A 4L0ZB 3SZTA 1QXRA 1ZZ7A 1S6LA 1BOAA 2CWEA 2G7UA 3E6MA 4GO1A 3KP5A 5F6FA 3PVBB 2C0ZA 4UVBA 2QLZA 4RB1A 4I0AA 2VONA 4B29A 2EK5A 1UFMA 4HQEA 2EA2A 2FEZA 5DEQA 4R79A 2R3SA 3SCFA 1R23A 3L2CA 1FYLA 3H1YA 1ZG3A 1XD7A 2STTA 3WE2A 2OZ6A 3BDDA 3QPHA 3HIFA 5E8GA 4QX5A 2D93A 3VODA 2EFWA 1XDUA 1WKMA 4PGGA 3O3KA 4G7OF 4OLLA 1ZNPA 3FMRA 2P4WA 4EM2A 1E2XA 1OR7A 1G6NA 4N9HA 1R00A 3NW4A 3UKNA 1IN6A 4M9XA 3ELKA 3H3ZA 1U78A 2L02A 5JSOA 4N0BA 2K0GA 1SD4A 3SZPA 2GC3A 1TNSA 1MJAA 1Q1HA 3DV8A 4ESFA 4IHSA 1WSUA 4CZZA 3Q5FA 2ACJA 4BHBA 2FNAA 5F1RA 1LNWA 3GF2A 2VXZA 3WTXC 2YU3A 4ESJA 3ACLA 4MGZE 4LK1F 4XSZF 5KHGA 4KU8A 4MHGA 1CF7B 5LRSA 4M9SA 1S3JA 1I6XA 3NVCA 4TLFA 3U9GA 3N97A 4HVQA 1Z6TA 3ERED 2O03A 1GQGA 4K8FA 1J7KA 5FFXA 4A5NA 1EH6A 4HN0A 5J3UA 1YQAA 2FNPA 5CVRA 4OIPF 5LBQA 2HOEA 3HT1A 4LB6B 4K2EA 4P9UA 2XKOA 3CUQB 5ERIA 2D1HA 3JSOA 2Q30A 3K69A 3HSFA 5D8LB 1XCBA 4CHUA 2GA2A 5A2QZ 4ENNA 2QBYA 4E70A 3WGHA 4HYEA 1UIKA 1RTVA 2XAJA 1V4RA 1ODDA 2BNOA 1QBJA 1EH7A 2IXKA 1BI2A 4RGXA 4EJTA 1DP7P 1K78A 3W6KB 4UV9A 2V1XA 1IAWA 5LRRA 5I8TA 4KDPA 2GZWA 3NEUA 1HW2A 2DTRA 3HT2A 4WXHA 3I71A 1YUDA 4HVOA 5FLIA 3EJKA 2IXLA 4ZYEA 1FI2A 4I0BA 3GW2A 2MLKA 5DD8A 2D1VA 3DF8A 4LLLA 4MEYF 3WTWC 4IESA 5JAXA 1TQPA 1Z6RA 3V4GA 4KT5C 4L9VA 3V8KA 3H50A 3GVAA 2ZKLA 3U11A 2ESNA 4EWEA 4Y13A 1FBQA 2HWVA 1GXQA 4HBLA 2F5DA 3S0MA 5BXXA 1ON1A 3LAGA 3DL3A 3M70A 1G3TA 3RNSA 2GC2A 4EJWA 3U1DA 4ZU7A 1HW1A 1XDSA 4KMFA 2DO7A 1IXCA 1W5TA 5FGMA 1ONVA 5FD6A 4Q4ZF 3M9AA 3IL2A 1GXPA 5ICCA 1MDMA 1X82A 3ZMVA 4HBNA 1IPKA 3WTZA 4META 1FSEA 1LDJA 1S7OA 2H94A 1RIOH 1EP0A 1UIJA 1IRFA 2XUBA 4YSFA 5C6CA 4LFUA 4A0XA 1BBYA 5AIPA 1TW3A 1FBUA 2OA4A 5ILSA 4M6XA 3HRSA 4KIGA 3Q9SA 4L2NA 4MZUA 4G7HF 5HS8A 3F72A 2DK5A 3H7YA 2P5KA 1K6OA 1MZBA 3REOA 2L3DA 2ZKZA 4FHTA 2JT1A 3R61A 1ZRFA 4KWKA 1A04A 2WWYA 4Q47A 4HSJA 3KGLA 1XGOA 2EJRA 2RVCA 3TQNA 4MX3A 4LUKA 3S7EA 3H1MA 5HS7A 1I27A 4OU0A 2RN7A 2Z33A 4EWAA 4ESBA 1QZYA 2ZNZA 4QXKA 2EFOA 3FXRA 1EH8A 1V3FA 2OD5A 4KU7A 2DT5A 1TBXA 3BU7A 3F6OA 3FMSA 3O14A 3I59A 5E16A 2KJBA 2BYVE 1CAXB 2PFBA 4O5VA 2HJIA 3MWMA 5CJ9A 5FPXA 5K8SA 1LDDA 1IN7A 4HLTA 3F21A 4HVRA 1ZRCA 4RGSA 3BJOA 5FLXK 1SD7A 3EYIA 1YW8A 1SEFA 2ZBKA 1YWKA 1VR3A 3SCHA 2MA3A 2QBYB 2VOOA 1LQ1A 3F8NA 4P9GA 4Z82A 1ZG5A 1ZH5A 2ZMEB 4BHPA 3F8CA 2ESHA 2VOPA 2IXCA 1WQ2A 1K79A 4BHCA 4KNYA 4LUMA 3LQQA 2PA7A 1O5LA 3KLOA 4NQWA 4U0WA 2ZFWA 1HSTA 5DUIA 4U7DA 1MGTA 3H92A 2GWRA 2Y75A 4EJOA 2OBPA 2P5LC 2O3FA 3EO6A 3R0JA 4MGYE 2MH2A 2FSWA 4E2GA 4LLGF 2RKHA 2CYYA 4PIZA 1YW9A 1FYMA 3KP4A 3U2RA 2DAOA 4M6YA 4UUVA 2PMUA 1KU3A 2MD5A 2UYBA 1LEAA 1XN7A 4GCVA 2IJLA 3HRMA 3TO7A 4IRGA 3M3IA 3SXYA 3C7JA 3OD0A 5KHIA 4PZJA 2IA0A 2M1BA 4AD9A 4GULA 3N4MA 5J6XA 1EY2A 5I0TA 1O7FA 4IRIA 4JTNA 2Y0OA 2UZKA 1SD6A 4XFIA 4ZH4F 2DCTA 4H0EA 3CLOA 4J1WA 5E8IA 3IWZA 4L5JA 4BAYA 3BB6A 3EHKA 4KN7X 3FJSA 4R8HA 1LR5A 5DDGA 5LGTA 2GU9A 3LWFA 4NB5A 2PQ8A 2HEOA 4EJVA 1QWRA 3WGGA 3SHRA 5HI0A 3F8BA 5DUKA 3VFZA 4XBFA 2DQRA 3E6CC 1YO5C 3FM5A 2EA4A 3CO2A 4Y15A 1X8MA 2IW5A 1IN4A 2PHLA 3B73A 1H9GA 2EWNA 1PDNC 4UXNA 3L7WA 2CAUA 4IEXA 3EUHA 1J0RA 3WU1B 3WW2A 3E6DA 3CLPA 3DPTA 2H6BA 1LKNA 2PG4A 3J80K 1BN5A 5EFUA 3LSTA 2DK8A 4MTEA 3JAMK 1S29A 2CO5A 3OOPA 2B5HA 2GA1A 4HN1A 2BBYA 2CG4A 1H9TA 3CL1A 1F5TA 1OPCA 4Q0SA 2L01A 2A6HF 4WX9A 3CJNA 3DP7A 3GFLA 2KXLA 3I54A 2MHFA 3IBMA 4DINB 2IRFG 1Y0UA 1P4WA 2HGCA 1B4AA 1W7PA 2H0VA 3H7JA 3M1EA 1X7NA 4HLXA 1KU2A 3D0JA 1QZZA 3PQKA 1ZZ9A 4MH0E 5D5UB 1BC8C 4G94A 3ZMSA 4G6QA 2PFWA 3FZ3A 3DN7A 2RNJA 3TGNA 2ZO4A 1B6AA 4CYDA 2R7FA 2STWA 2XLFA 4RB2C 3KP7A 2XAGA 3KFWX 5KVRA 3FZVA 3F8MA 2HQNA 5LGNA 4JTOA 2XAHA 1B9NA 2VBXA 2YPRA 5BPDA 4UBGA 2ELHA 1JXSA 2EFNA 5TRDA 4XLPF 3O2PE 4ZZDA 1VTNC 4LULA 4Q5SF 2GXBA 1W7PD 2CSOA 2A5YB 1DUXC 4LTAA 4RD7A 2F2EA 3LWCA 4KICA 3EDPA 3EBRA 1LJ9A 5LHIA 4ENKA 1SQ4A 2DI3A 3TOBA 3GUDA 4EV0A 2GQQA 3K2ZA 1O57A 1KU9A 3CUQC 2LSOA 2FMLA 2JSCA 2Q1ZB 2W57A 4A0YA 1IW7F 3RI4A 3TKYA 3GZ5A 5D6EA 3WW1A 1FLIA 2XRNA 3HYIA 2HS5A 2XL9A 3VEPA 2E1NA 2UXXA 3FMQA 3R4KA 3H3UA 1D3YA 5H6QA 3BPXA 4LMYA 5IT9K 2ZNYA 4YFKF 3WTYC 4WXDA 2PMHA 2KRFA 2MC3A 1RUNA 3TDZC 4S05A 4WF2A 2FOKA 3O6BB 4KYWA 3ZMDA 1ZX5A 2EFPA 3AAFA 4LG0A 3ZP5A 3J7AO 3H9AA 1CAVB 1T98A 1JGSA 4QWQA 3TOAA 2PTMA 1P4XA 2O61A 1SFXA 2AS5F 4LA3A 3RPUA 4XSXF 1FT9A 1UHMA 2D45A 1FC3A 2ISZA 2P5VA 2PLYA 3EYYA 2EFQA 4X6QB 2VC1A 3ZN0A 2FA5A 5HDGA 3WGIA 1IF1A 3JTHA 4EM0B 1G3SA 4P96A 2BV6A 3BJ6A 4L9NA 3MQ0A 1T38A 4BXUA 2HTJA 4HDUA 3WG9A 3NRVA 1DGWA 3M8FA 4UV8A 4XF9A 3L9FA 1RL3A 4KFCA 3FHIB 3V8JA 2IXJA 5AONA 4XFBA 3RZZA 3WW4A 2XKPA 5DYMA 1BI3A 1CAUB 5KHKA 4HV5A 2RC4A 2A3SA 4HDVA 4ONUA 5KHHA 5FQ0A 3QAHA 1UCXA 2Q2EA 1TNTA 1B1BA 3KZYA 4UXAA 5FFZA 4HX4A 1UPIA 1DZTA 3ABUA 4FX0A 1J9IA 2NNNA 4KL1A 4PCQA 4D0PA 1PUEE 1V70A 1IPJA 3I64A 1IUYA 1XSVA 2O1QA 3RKWA 4XFHA 4XEZA 1UCRA 2XIGA 3P7NA 5JFRA 4IEWA 4PIXA 4A2UA 3T1BA 3ML6A 4FX4A 2X0LA 1F4KA 2PI0A 4MEXF 2CGPA 1U5TB 2Y0MA 3OCPA 4HW0A 5TJJA 3F22A 3K1MA 2YX7A 2GIVA 3ZMUA 3H1WA 2EV6A 4PDKA 3WODF 1NYWA 3HRUA 3L09A 5JHUA 3LOIA 3J81Z 4KWLA 1O3TA 4M73A 5ED4A 2RDPA 3MDPA 4RGRA 5D1IA 1FBSA 4QGLA 3GFJA 4RGUA 4CGZA 1ZLJA 3K9TA 1UHWA 5FB2A 2P7VB 3SCGA 2QUFA 2KIUA 1FZPB 5FLXZ 5ICEA 2NRAC 3RYRA 5HLGA 4FAHA 4MV2A 5FO5A 1CX4A 3TO9A 4RAYA 2BNNA 4AVBA 1O3RA 1XMAA 1O7LA 1S8NA 1HKQA 3NQOA 1U2WA 1SFUA 3KE2A 2QDRA 3ULQB 2FBHA 3ZN1A 2H09A 2QYOA 1WRJA 4EMSA 1VP6A 5L3BA 5I0UA 4IERA 4Z2YA 1FSHA 2RQPA 3GLXA 3KLNA 3RYPA 3LAPA 1IZ1A 1VJ2A 2BNMA 1HSJA 3D0SA 4YIFA 1IXSB 3CF6E 2D5HA 3ZQ7A 4G9YA 1J1LA 1QPMA 1S7AA 5LLQA 1XRUA 3GWZA 2UY8A 2FBIA 4MUVA 2GXGA 5AVPA 5HVQC 1ULYA 2EV0A 1NZCA 2ZXJA 1TLHB 4MTDA 2LNBA 3K1PA 4AIHA 4ZYDA 1FWZA 3FM3A 4QGNA 4WBBA 3MPBA 1ZZBA 5FCCA 5CVUA 1HKTA 2EAAA 3I0TA 4M71A 1FXZA 1JE8A 2OQGA 2ADUA 1MJBA 5J8FA 1JHHA 4FAGA 2K7LA 3DQVC 5D6FA 1T0FA 4M9ZA 4UBHA 3P9IA 4IETA 2FU4A 1OYIA 3RKYA 1PM7A 2DU9A 5BPXA 1USSA 3MAJA 1BIBA 3GO5A 5L3GA 3G3ZA 3C3VA 1FP1D 1B59A 2P17A 4EGZA 2FQPA 1OYWA 3NJZA 3ISPA 3K1NA 3KP6A 4L0YB 5E1XA 4GYIA 4HA8A 2ETEA 1H0MA 2Q4SA 3RTRA 2PAMA 4EWDA 3J80Z 2W24A 2VT3A 3S2WA 4A0ZA 2HDCA 1XE8A 2IPQX 3ECHA 2VN2A 5D5WB 1J75A 3GBFA 1Z9CA 4QMAA 1PP7U 4OMZA 5KK1A 4OOIA 4L9JA 1R1UA 1I5ZA 5DCMA 1Y3TA 4AVAA 5CVIA 3K0LA 1ON2A 1RI7A 4A5MA 1FYKA 4ENJA 4IPAA 2B8MA 5FDBA 2F5EA 1O5UA 1R7JA 4L9TA 3USSA 2OZJA 3GX4X 2K4JA 2X4HA 4KA4A 3E3VA 1BIAA 4HF0A 4DQ2A 2V1UA 2KIMA 2A07F 4KIBA 4CXFA 4XFGA 3OV8A 1UW8A 4AQ6A 3ROUA 4ETSA 1K78B 3BALA 4XFAA 2ATFA 4U88A 4IEZA 5E20A 1CAWA 5LEKA 3SFZA 4I09A 4HLYA 2K86A 2ET1A 3BZ6A 2XL7A 4HQMA 3IWFA 2HYFA 1OKRA 3MCZA 4B09A 4ORFA 5JR7B 3D82A 4XFFA 3BOQA 1EV7A 1UB9A 1ZN2A 1U3EM 1YYVA 1D8KA 3P9KA 2B0LA 3TNQA 4EVIA 4WCGA 2QQ9A 3KP3A 4R1HA 1YS6A 3IHUA 4E2SA 3E5QA 1UD1A 1BM9A 3CUOA 3G73A 4ON0A 1XE7A 4Z07A 3IIAA 2VBZA 1XSDA 5KBFA 2UWMA 2K9ZA 1YFXA 2FBKA 5IT9Z 3IDCB 3QOPA 1ZYRF 3DXJF 3GEZA 4D7SA 1RZ4A 3TO6A 3PNAA 2QZ8A 2ETHA 1YLFA 4P55A 4I02A 4WWCA 1R1TA 3FX3A 1F9NA 3BP8A 1REPC 4I3PA 2EB7A 1MDMB 4WZCA 2G9WA 3UKVA 4QM8A 3I7DA 5K5RA 1SAXA 2YR2A 2NNYA 5DCFA 2KKOA 3ZMZA 4ZYGA 3KCCA 2LF8A 4HOBA 4O3MA 3Q9VA 1IN8A 4LA2A 1J3QA 3MFKA 1GHCA 4YFNF 1B9MA 1R5HA 1W5SA 5E18F 3KP2A 4YARA 1HQCA 6PAXA 4IEOA 2OZUA 4Q0PA 4L11A 3GYDA 1K7AA 5IT3A 1J2XA 3KSCA 4S04A 5I8SA 3NSTA 4GYGA 3BJAA 2D5FA 2KJCA 3L2HA 1U12A 2Q8KA 2VPVA 3L00A 4LJZF 1BI0A 4IEQA 5L3EA 4BYYA 2HYGD 4UVAA 2M87A 3IC7A 1USTA 5JSRA 4RB3C 2GH2A 2W85A 3I59B 4IHTA 5DCMB 2CFXA 4PGHA 5BQTA 1KYZA 4A12A 1X8EA 1YFYA 2QENA 2MBFA 3BPVA 1QO0D 5ICGA 3KMHA 1OI6A 1LVAA 4HF1A 1C0WA 2RV8A
chains in the Genus database with same CATH superfamily
3FE5A 4E8DA 1J3RA 4MVTA 4KUMA 5FYUA 4R52A 4OUMA 2X6YA 1ZLKA 2PLV2 4GWMA 3T5XA 4NMIA 2JA7J 3GZ6A 3LOBA 3FUOA 2W0XA 1RETA 1NQJA 3DTEA 3ZCOA 1BW5A 1EAH2 1PZ7A 2HWF1 3KIOA 3V8LA 1JGGA 2BTVC 5FY8A 5L3DA 4XUQA 4D9JA 4PJJA 4FI9A 2DU1A 3T30A 4OIRF 4FPJA 4RSUA 3RJPA 3M8JA 4EN7B 1W2NA 5FY7A 3NWKA 5L3CA 3LF7A 2HEVF 4Q29A 3CUQA 1KQ9A 5LEJA 4L0PA 2XGEA 3FBYA 2K4BA 5LWBA 1XYNA 3UYJA 4QPQA 1YE9A 1A78A 2V73A 5CADA 2P6SA 1XQNA 4ZZ8A 1GV2A 3SKVA 2CUZA 1QQIA 3PSIA 3LPGA 2P1BA 2NYXA 1H8VA 4G3YC 4GMP1 5FZ6A 4Y17A 4AW7A 4XDPA 5LA1A 2J5OA 2K5CA 2XV4S 3U14A 4IZZA 3VOEA 3GBGA 2FMYA 5L9BA 4I2OA 3J8F3 1QHHD 4AG4A 4WM7A 1Q43A 4LLFA 3TDUC 3HJEA 1QQP2 4JRLA 2D3SA 1S0IA 3EMRA 1XGSA 4UYBA 1P6RA 1H4HA 2ZMKA 1MEC2 3BPZA 2C1FA 4LOSA 3OTFA 1MS8A 4KJZA 1GP4A 1Z7S2 1SMTA 2ECCA 4PLNA 3VPRA 4UF0B 1G59A 4L18B 3CEWA 2QWWA 2LDUA 3V0BB 3ZFEB 2BQPA 2WTEA 4M3CE 3RIRA 3BG7A 1W7PB 1WWXA 1PZ8A 2A6XA 2JD9A 4YZ5A 4KBBA 2DA7A 1SFEA 2RS52 3MKWB 2Q8DA 2RR13 3S3OA 5KXDA 1X3UA 4B4CA 4A6EA 3HOBA 1US2A 4HMZA 1S0DA 4G7ZF 1NCQB 4CDXC 5IVYA 2OT7A 2MC4A 2IGMA 1QEXA 1O91A 2MD0A 5GM0A 1T33A 1IRZA 1BXHA 1ZREA 5GZFA 2P5BA 1QJY2 1PP8F 2X09A 3KZZA 4PJMA 2JDMA 3QWLA 1Q3EA 5JR2A 2VOTA 1H8AC 1EA3A 1N3OA 3AK0A 2Y60A 2QKLB 3BWGA 1IGOA 3F8FA 2A6ZA 1CAXA 2QNKA 2AH2A 4NC8A 4Q0UA 4XQDA 5IFPA 1CZTA 1ZG1A 3OS0A 4BOWA 1TG7A 2ELKA 3FWEA 4QPIB 1LRHA 4ASMB 2E60A 4XPVA 1AR71 4JAAA 4MQVA 4CA0A 5H9SA 2DPDA 4OMCA 2DUPA 3SMHA 2Z9OA 4AE2A 1GOHA 3I49A 4YRVA 3GYHX 1Z7UA 4LG0B 1I1SA 4M00A 3FHZA 2VZVA 3LA3A 3CLQA 4EATA 1BYHA 1CN1A 2NOGA 2QQUA 3ILRA 4PIYA 5CBLA 1F2NA 2LKPA 1ZVFA 3HMYA 2VVDA 4PJNA 2D98A 1OYYA 1IC8A 2D6NA 2B39A 4QHOA 3O1VA 2IVIB 1RIRA 3K4CA 1MBEA 3TW6A 2HTSA 2IXHA 5FWEA 3LSIA 1RXFA 1LOCA 3DKQA 2G7HA 4AVPA 2FJ1A 5FZOA 2ZCWA 2QA4I 4FPGA 5F64A 4RMNA 5D8KB 3Q0UA 4NAOA 2G0EA 2JG8A 2O8XA 3ZPOA 2LF7A 4JDMA 1KD7A 3BCBA 2GNBA 1QY4A 3DPRC 3CO7C 4QKFA 2LTPA 1GV5A 2Q0OA 4KMUX 2BERA 3M1HA 2R5ZA 2DA5A 1YHFA 5A3UA 5FQ0B 2BWAA 5JLWA 3IN9A 3LDBA 5BS6A 1DBNA 3BUCA 3HUGA 5ACA3 1TVGA 2RM23 2W82A 3F23A 4F7ZA 2ZJQF 2WYSA 3O0VA 4UWDA 1L0OC 2LD5A 1UOBA 2I10A 2XASA 4QM9A 1EPZA 2P8TA 4PDWC 4F3JA 3B6AA 4AVSA 5HLIA 4YFXF 1UQXA 5DN2A 1L7RA 5KHJA 4O6JA 5EIYB 2UWCA 1K61A 4F8AA 4E7ZA 2PHUA 3OY8A 3JRCA 3NV4A 1J83A 1Y9MA 2ZFUA 3R6SA 2E9QA 2HWC2 2V5YA 1U8RA 1YFWA 1LOFC 3LE0A 5CFDA 1PK6C 1KU7A 1E5HA 5LD2C 1R36A 2J1SA 3VSKA 3K4NA 4ZPIA 5BV6A 4XIDA 2GAUA 2DPUA 4L5EA 3J81K 2B7YA 2V6EA 3C3WA 2WA0A 2WNUB 5CYVA 2BHZA 3VD3A 3DPUA 4TYSA 4HZFA 3V56A 3BIEA 4LG3A 1FOXA 1ENRA 3OF1A 2X9DA 4QPGB 1PUFA 2QQLA 4BEHA 3KGZA 4MO7A 2V1DA 1OD5A 2J1VA 2QE3A 2M4KA 2IGOA 2BXZA 4RGAA 2WNVA 1JHJA 1LOEA 3CMMA 5J37A 3PMEA 3G7DA 4X8NA 5L9VA 3POSA 3I2HA 3KF5A 1KQRA 4AVTA 1W0TA 3DU6A 1OFNA 1BQPA 3AYEA 1H2MA 3ZMTA 3PQJA 2X8KA 4YVSB 3J7YJ 2YZ4A 4NUBA 1Z0HA 1OLMA 1Z91A 4KG0A 3HM5A 1VBB2 2R7WA 1P8JA 3JBG2 4DNCA 1QGPA 2PQSA 4QLCU 1HB3A 2CDPA 1GZWB 2WFPA 1JN2P 4U7BA 3CU7A 3SITA 4XRMA 2E7XA 4P9FA 2E31A 1CAVA 1AKHA 2BGCA 5I93A 2E1CA 5D4SA 1KQ8A 5FYVA 3M7GA 3N9QA 2JD4A 1K5MB 5A7OA 3WTVC 3QOEA 2GP5A 2WWJA 1X3WB 4FVVA 4Y20B 4PT6A 5EXOA 1ZYBA 1X50A 3H0OA 4CP9B 2JPCA 1AHDP 2YC2A 4M3CB 4EN8B 3BPSA 4HSLA 1WLTA 5DABA 2NN8A 1QNTA 1U5ZA 1MMGA 2FCTA 3R0AA 4W6WA 5BNNA 2OPKA 5FPLA 3WHTA 5IK5A 1D4M3 2Z69A 5H20A 2YB7A 5A3OA 5EHDA 3OYWA 2K9QA 3DEUA 1WJEA 4Z2WA 4RYDA 2ADEA 2WC2A 1MIJA 1YOVB 2NVXJ 1UZWA 3CCMI 4YG2F 4HX7A 5FZ9A 4ZU5A 3U10A 2ARXA 3MV11 2IA2A 4CU9A 3LA7A 2C9KA 3M8LA 1HDDC 3CDHA 3WTTC 4CU6A 4M72A 2XB6C 3AP9A 3AG2H 3FBNB 1GVJA 4MO3M 1VRH1 1CF7A 5JZGC 1I1GA 4QU2A 4JKKA 1XGNA 5LHHA 1FNNA 1V9U1 2QSFX 3CD6I 2JG9B 2XLGA 2YUSA 4AWDA 5FWJA 1LGBA 2DW4A 4MGRA 2QSGX 3ILFA 4XILA 5FYBA 3D5SC 3A22A 2XQXA 2YHJA 1UY2A 2HQAA 2JZYA 3CIHA 1UU6A 1RGSA 1UY3A 4M74A 3MKZA 1WCUA 4AK3A 2G9GA 3WU0A 3EQEA 3JW4A 1R091 2DOFA 4NVPA 1F1ZA 1YS7A 1ZRDA 3FUQA 2ENRA 1OHFA 4IEPA 2MSYA 1YQ2A 3WTUC 2P34A 1PGSA 1O59A 2D44A 1SMYF 2K27A 2HWE2 2OQ6A 3PHMA 1JTXA 2PEXA 3KCYA 4L92A 1C8NA 4BGDA 4QQ2A 3DXUA 2IXIA 2WO1A 3VDDB 3NQHA 4XF4A 4MNUA 1TMF2 3MBWA 4NPMA 3ZXLA 2VUJA 1K5JA 3CESA 2DBBA 1WI3A 4OIOF 1VI0A 4DY5A 3GBWA 5GALA 1XSRA 2C0ZA 5IVBA 2DCKA 3B7MA 1KDKA 4RB1A 3LSDA 2Y9ZA 3ZSLA 1IG3A 2VONA 1UFMA 4RGKA 2FEZA 2DYSH 1R23A 4GWIA 2DCZA 2STTA 5FLVA 4DPNA 3QPHA 2B7EA 1H30A 1R1A3 2KA3A 2VQGA 3LSMA 3GZTB 4CZSA 3PO3J 3CQOA 4B1MA 3ELKA 4M9XA 2CRGA 4AHYA 4NHMA 2VGDA 1U78A 4FTBA 5KNLA 1JYCA 2FMDA 5JSOA 2L7MP 1KJLA 2K0GA 2DMNA 1HIXA 5T5PA 4O7XA 3C2BA 1WCMJ 1HXS2 3SZPA 1WMXA 2GC3A 5FO7B 5DAWA 2BY0A 2B45X 1WSUA 2D6PA 2NYYA 5IHRA 2ACJA 4BHBA 2FNAA 1LNWA 2RMU3 2RAEA 5DTDA 2YU3A 2WAQN 4HNUA 2DFHA 3C7OA 4CDXA 1OLRA 3HOZJ 2VTXA 3LSRA 4XZPA 2WUHA 4KU8A 2VBBA 2Z79A 2E7TA 1GNYA 1S3JA 5EJ3A 4CXWA 4LO5B 1BBT2 3NVCA 3U9GA 5EYRA 4PQ9A 3K6GA 3ERED 1RUG2 4K8FA 2TCTA 2W46A 3IDEA 3D6EA 1LFUP 3FXKA 4Q26A 2JWPA 1YX5A 1EV11 3HT1A 3KV9A 3A7QA 4Q1PA 3I2OA 4LOTA 4P9UA 2XKOA 3CUQB 4MYEA 1W39A 4P5YA 3GZNB 2VZUA 2J1UA 5T50A 5DS9A 3CDZB 3MIEA 2GA2A 5A2QZ 4ZHNA 4ENNA 2QBYA 3WGHA 4NIIA 3FN9A 3SH4A 3N9PA 2X48A 1N47A 4AOCA 4IE7A 1EH7A 4AYUA 1MS9A 2JSPA 4NDLA 1IAWA 2Y9YA 5J4VA 1JU4A 4L8QA 1LENA 5L9RA 2GZWA 1YJNI 1HW2A 3HT2A 4WXHA 2AACA 2DFBA 5C3EJ 4IHWA 1WGXA 3U21A 1VRBA 3EJKA 1V0AA 2W2IA 1MS5A 3HAGA 4I0BA 2MLKA 4MFEA 4CP0A 3JRAA 3WTWC 2YU9J 5JAXA 4MIMA 1TQPA 3AM2A 4M0NA 4NPLA 3V4GA 3GMEA 4JKLA 3QCWA 2ZKLA 4LKEA 3BU0A 4Q4X3 3CC7I 2Z42A 2NVUB 3K3OA 5JDBA 2W00A 1F36A 3WNLA 3DGTA 2D3PA 3DPRA 2F5DA 1REFA 5BXXA 1OA4A 1ON1A 3LAGA 3VKFC 4I0WB 2WAFA 1VAKA 2XUMA 2D97A 3G6JB 3OYDA 3URFA 4FPYA 4Q4ZF 4B48A 4UFKA 4FOWA 1VBA3 4Z2AA 2GBYA 2YBPA 3HZJA 1H8TB 3BR1A 2E35A 1S7OA 1RIOH 4N4OB 3FXMA 1E3OC 1UIJA 2XUBA 2QQVA 1WW5A 1RVF2 4N43C 5IVJA 1GLHA 1AUYA 1QOSA 1J84A 3OD4A 3O12A 1GYKA 1TZOA 1H4GA 1QH7A 4RN5A 5CIRA 3F72A 2DJNA 1GOFA 4PDWA 3I2KA 3AP7A 4FHTA 3R61A 4KWKA 4HSJA 4Q47A 2RVCA 1W5CC 4M0HA 3ENRA 3S7EA 5L7OB 2Y6LA 3KT4A 3BOPA 2RN7A 2DUOA 4QU1A 4QXKA 2MW8A 1LOFA 1MZFA 1PK6A 3B9IA 2DT5A 3GLLA 3RG0A 3F6OA 3S30A 5E16A 4GMP0 1CAXB 4IE5A 2IEKA 4XONA 1VNDA 4AI2A 1WFXA 1QA6A 1ZKGA 1ZRIA 1IN7A 1GFF2 4HLTA 4HVRA 1TP4A 4AGGA 3EYIA 2HI3A 1Y6IA 3OYEA 2AQEA 1YWKA 2RDQA 2MA3A 2VOOA 1YRNA 2OTLI 1YCIA 4Z82A 3F8CA 4UW6A 3WQ7A 2VOPA 1WQ2A 1RHI2 3C7EA 4BHCA 4KNYA 1YEWA 2EPFA 3C2HA 3TBIA 2LYCA 3ZN6B 4I6ZA 1W8OA 5KXCA 1QJU3 1R081 1HSTA 3JQXA 2C26A 3OPWA 3NAPC 1DYOA 2Y75A 2WAEA 2WWUA 3K46A 4FPFA 5FAXA 4MGYE 2MH2A 4UUTA 1LCLA 3ZLIA 5FZOB 4LLGF 1U0AA 2RKHA 4CU8A 1U5XA 4Y5TA 4DYCA 1YW9A 1X3ZB 3C7HA 3KP4A 2PMUA 3OIQA 2BWCA 3KM5A 1XNKA 1MMAA 2JG8B 2FUG2 1PO23 3VBRB 4GCVA 2IJLA 2KIQA 1AYN1 1KRIA 3GTOJ 1Q56A 2QFEA 3OD0A 3H5AA 2R7SA 2VZQA 3NJYA 1O7FA 4PCRA 4U2AA 5HLTA 1IJWC 2R5ZB 4ZH4F 4NC7A 2WY7Q 4CUBA 3CLOA 4J1WA 2EINH 4BAYA 3HUGB 3PU8A 3WUCA 2VNRA 3LWFA 2XB5A 2EZIA 1AL22 1W6QA 1ZBA2 1MZ6A 5HI0A 5F0CA 4LJHA 3VFZA 2XR4A 2DQRA 3V0AA 1YO5C 3KV6A 1WUVA 2EA4A 3CO2A 4B7EA 3B73A 3JD71 4UXNA 1VIWB 4CP2A 2CAUA 2WO3A 4IEXA 2FDKA 2X1DA 3R4SA 1DLCA 4RHV3 1J0RA 1NZIA 1U5IA 4BE2A 2TUNA 3N7KA 4D6RA 2FDHA 3OY8B 3LSTA 4MTEA 5FIXA 3JAMK 2B5HA 3H9JA 3OOPA 4HN1A 4RAFA 3CL1A 1NY71 2L01A 2A6HF 5CFDB 5FK7A 3OPZA 3GFLA 2KXLA 4F55A 5EV7A 5GAHJ 4DINB 2IRFG 1T6BX 4COWA 1FATA 4BZ4A 1IZ3A 1Q8SA 2EAKA 3ALQA 3H7JA 2VJJA 1X7NA 1DP3A 3D1NI 5JOWA 3PU3A 4MH0E 1YJKA 3H3LA 3W59A 4G6QA 3DN7A 2R041 4YGCA 5FZFA 2ZO4A 1B6AA 4CYDA 4AAPA 2E2IJ 4RB2C 5FY9A 3K4JA 5FUIA 3L2UA 2YY1A 4LKSA 5FR3A 5J1XA 4JTOA 2VBXA 4BEHB 4AFMA 5BPDA 3U07A 3W6VA 3ZPYA 2ELHA 1JXSA 3OGVA 3H36A 3VDCA 3ZR6A 4F83A 5JZGA 3BYWA 4Q5SF 5F37A 2WNVB 5IVEA 4V19K 2BHYA 5T54A 1AXZA 2F2EA 2X5IB 1PVC1 1ULCA 3EBRA 1LJ9A 3ZYRA 1SQ4A 4ENKA 1EUUA 2K9MA 4E4DX 4EV0A 4ASLA 1KU9A 2Q1ZB 2LSOA 2W57A 4HG2A 3RI4A 4Q8KA 2CQXA 3GZ5A 1AJOA 4JGYC 5D6EA 2XRNA 3HYIA 3SLIA 2E1NA 1VBE3 4YW6A 2CW7A 2DT7B 3FMQA 5LBFA 3R4KA 2E1OA 3H3UA 1XNTA 5H6QA 1MS4A 2KT0A 4QX7A 2BPA2 2PMHA 2KRFA 4D3WA 3TDZC 3O6BB 4X8PA 3ZMDA 3B9CA 3EPZA 3AAFA 1V6MA 3J7AO 2BUKA 4NIHA 3H9AA 1CAVB 1AKHB 2XB0X 4QWQA 3ESWB 1RUC2 4LA3A 3S1MJ 2ZXWH 1SCRA 1TME2 3MO4A 2P5VA 2PLYA 3EYYA 2EFQA 2FA5A 5HDGA 3DUIA 1MMNA 1A3KA 1GSLA 4A3EJ 2JX9A 5DUWA 2BV6A 2UU8A 4HT1T 1POV1 4Y7NJ 2OC6A 2Y6GA 3MQ0A 2VNOA 3WG9A 4NWVA 4Q2FA 4XF9A 3L9FA 3SEQA 3CCLI 2IXJA 5AONA 2FD8A 4XM3A 3DF0A 3EB7A 1BI3A 3OYWB 2LMDA 2E32A 4IL7A 3I56I 3O0WA 2PELA 3TBDA 3KZYA 4HX4A 1ASJ3 2QSHX 4D8MA 2RS13 4PSXA 4FX0A 4BKXA 1FEXA 2NNNA 4N8MA 4Z6YA 5HODA 3N05A 1IPJA 3AG3H 1WJDA 3RKWA 1UYXA 4XFHA 1VAMA 2XIGA 2OJED 4IEWA 4D69A 5HNFA 2WZR1 2WV1A 5FP4A 2CGPA 3RZJA 5TJJA 3F22A 1O4ZA 1BVP1 2GIVA 3H1WA 2EV6A 1T56A 3AFHA 2C4XA 3SZGA 1NYWA 3L09A 1DQUA 1MMDA 5LASA 3LOIA 3J81Z 1YI2I 1O3TA 3FXLA 5ED4A 2LROA 3VD7A 3OYGA 4YZ2A 4BQ4A 3K9TA 1W3XA 3RFRA 3RZGA 5HCBA 4Q1RA 5FLXZ 2D7FA 2JK3A 1HRV1 4FE4A 4FAHA 1ZBE3 2YC4A 4P9XA 2VNGA 4RAYA 4AVBA 1T6GC 1RUJ3 2WIIB 2MEV3 3HNYM 3PUIA 4XURA 3NQOA 2Z16A 1RUI1 1H6XA 4GRIA 4XJAA 2Z4FA 2QYOA 5IWFA 1VP6A 5I0UA 2V9PA 1PVXA 3BLYA 2RQPA 2A1XA 2V72A 1W9YA 1IQDC 1ENSA 3VL8A 1VJ2A 4AI9A 3ZR8X 2BNMA 4C9YA 3N35A 1IXSB 3ZQ7A 4ZTFA 1GZCA 2CJJA 5AFBA 2WAQA 3DCQA 1QPMA 2D6LX 5LLQA 3U1KA 3CMEI 4BQYA 1AU7A 2FBIA 3CMYA 2GXGA 5AVPA 1NZCA 3ZN4A 2ZXJA 1TLHB 4C1XA 4B43A 5FRNA 4AIHA 2BFUS 1FWZA 1JU3A 2KDOA 3MPBA 2X51A 1A6IA 4XTMA 5FCCA 3NRUA 4Y52J 4D7YA 2ZX0A 4P9WA 1UJ8A 1LPQA 2CUJA 4ET7A 1MJBA 5BNGA 4OZXA 1JHHA 4FAGA 3A23A 3VDAA 3VYSB 4Q4V3 1BK1A 3I3MA 3H8OA 1DLLA 4FP2A 1HOMA 2HWD3 5C4XJ 2GM4A 4OHYA 4B3AA 3GO5A 3C3VA 4L97A 4EGZA 3K1NA 1RUE3 3M3EA 3S14J 4BB3A 2Q4SA 4CDXB 5F3IA 5IJRA 2M4GA 3KYCB 3OYHA 3SEPA 2PAMA 3BOWA 3J80Z 1HRI3 1DP0A 2W24A 2VT3A 3FDYA 2HDCA 2WADA 2IPQX 1QMJA 3CZJA 5D5WB 1J75A 3BTCA 1PP7U 1S2KA 4NIDA 4QT6A 4E6KG 1AYM1 3PMSA 5E6HA 1OCPA 1R1UA 1I5ZA 2VZOA 1T2XA 3AB0A 4BE0A 1R6RA 1E3PA 1WVRA 4LOCA 4Y4YA 1Y3TA 5CVIA 3K0LA 2BJSA 3G1LA 1RI7A 4A5MA 1FYKA 2A3YA 4ENJA 4IPAA 5IP7J 5KR7A 2XBO1 2F5EA 1CQ9A 4JQTA 5GPCA 2L7ZA 5GP9A 2RM22 2K4JA 3SEEA 4BQQA 2VL4A 3CDIA 2CTVA 4GH4C 3FHAA 2CGOA 1OQYA 4CXFA 3RZHA 2L0KA 2NP0A 4I3GA 1HLCA 1AR91 2ATFA 1OFSA 5E20A 1ZA7A 3SFZA 4I09A 2XSDC 3CQZJ 1W06A 1CVNA 3BZ6A 1WLDA 3LEIA 1QRYA 3NAPA 1R5ID 3OSGA 3MCZA 4B09A 4XFFA 1FOD1 1LHVA 1ZN2A 1MBFA 2DTWA 2ICWG 3P9KA 1BVVA 3DCFA 4WCGA 1PO12 2P3YA 1YS6A 1WKYA 1LOGA 4Y1VA 4E2SA 1BM9A 4HL0A 2PX9A 2HOAA 1VMJA 4N7UA 4Y24A 1YO8A 5KBFA 3VDXA 3DPRB 1YFXA 3VBFB 5IT9Z 2WB1N 5FZ3A 3GEZA 1Y8RB 3BTLA 4D7SA 2ZXIA 4FXKB 3PNAA 4XACA 3O1SA 4WVMA 3ACHA 2QZ8A 1WD4A 3QYFA 1Z3YA 1R1TA 1A36A 3FX3A 1F9NA 1REPC 1BHGA 2R061 5IOYA 1VBD1 2F6BA 2G9WA 1Z78A 3ZYBA 4CU7A 2BRTA 5DCFA 1R9TJ 4XOPA 3OBRA 3ZMZA 4QSHA 3N3HA 3KCCA 4RR3C 2LF8A 4K6BA 5CNAA 3Q9VA 1IN8A 4FFFA 2R7VA 1GHCA 3T1MA 2IBDA 1B9MA 2NOJB 4Y33A 2WSUA 5JIUA 1W5SA 4E8CA 4PDWB 3QPSA 3KP2A 2PLV3 6PAXA 1K7AA 4YW4A 4BJTA 3POBA 3S1NJ 3KSCA 4GYGA 4D1QA 1JS9A 2D5FA 5CB7A 2CWSA 2R7RA 1EAH3 1RUF1 1PNGA 1U12A 3E7LA 3HL2A 3L00A 3WF1A 4CZCA 2E7AA 4WVWA 5JXHA 1PK6B 4GDFA 5JI9A 2B4KA 2VBPA 5DCMB 3TYJA 4A3JJ 4DW6A 3AZWA 4PGHA 1X8EA 1ITYA 2DU0A 4MOAA 2QENA 3WCRA 4DGWB 1UN1A 1QO0D 3RMYA 1JKQC 3KMHA 4HPKB 1C0WA 1H0BA 1QU0A 4LO8A 1OH4A 1A31A 2NS8A 4ZDOA 1ZGJA 2P7CB 1YRNB 2Q8CA 1HDKA 4Q4W2 4XJZA 3P6BA 2P6CA 4S2HA 3HDDA 3GZEA 1P4AA 1X2MA 2OPTA 2L4MA 3T1LA 5DZFA 1U5TC 1Z05A 4AEJA 2G1MA 3QD6A 3SXWA 2V1NA 3RYKA 5H6RA 2ID6A 5J1RA 3I58A 4E2QA 2RHPA 2GOMA 3JSPA 1D1AA 3ES4A 4MGSA 2A71A 1ZRRA 3H1CA 1F8VA 3M4OJ 1QQP3 3POFA 1YIPA 4GGGA 5J40A 1U8BA 3VB2A 4ZZ5A 3CCUI 2DBNA 1W2TA 5APAA 1MEC3 2MG4A 1A6CA 3EETA 1RJ8A 2X10A 1UKRA 3IP4B 2PJPA 3IKVA 2AREA 4JGYA 4YW2A 3R4DB 1Z7S3 1DU0A 4J01A 2DTZA 3LAJA 3RJRA 1T39A 2ZJRF 4A7KA 2DQLA 1OQEA 5F2SA 5AC92 1ODNA 5FY5A 2W4SA 3H8UA 1PGL1 4COVA 3PIOF 2ME0A 5IOZA 4BIFA 2VUCA 2OQRA 1NOVA 1RMU2 3DEMA 4QGMA 2UUZA 4EGYA 1RJ7A 3AC0A 3V0AB 2RS53 1YRZA 1WMDA 3AXEA 3TL4X 4XW3A 1LUJB 3MW2A 3T8TA 3ZYHA 3AFGA 2LK2A 2JIJA 1K45A 4KISA 3MKLA 3AMQA 4FPKA 1DG6A 2Y6FA 1TQIA 3T0DA 4JVAA 3K51A 1QJY3 1HBXG 2ZAAA 3A0BC 1QJX1 5FUNA 1P2FA 4OMDA 5ILVA 4UB6C 5I0RA 1ND3C 4TXWA 1ST8A 2TDXA 4AWXB 3JREA 1YIOA 4PLMA 1WI9A 1GZTA 3DYMA 4JBAA 1N78A 3ZX7A 5E1RA 5FYTA 2UWBA 3KQ4B 2Q1MA 4JDOA 2BFUL 1DDNA 4LO4B 4ARXA 2AXLA 2SLIA 5I8YA 3WXPA 4IRHA 1BZWA 2VG9A 3IZOA 1CIWA 3OYCA 1C8M1 1T2KA 4BMEA 1CESA 2W1WA 1WMEA 2DCJA 1H1IA 3CTAA 2ZJPF 5JZGB 4FTHA 3EUKL 4BQ1A 4CDUC 1SPPA 2H8RA 1W2OA 3ZYJB 2R071 2O7OA 5E8AA 1MQTA 1KQ0A 1G3YA 2FRHA 3ZO0B 4YW7A 4P5OA 3S7IA 1O4TA 3WEZA 3OL3A 4CCDA 3I4MJ 4BQ3A 5C4JJ 4QX0A 1FY7A 1MJ9A 1DPRA 5A6ZA 2PBIA 1SACA 2WQ4A 4BH9A 2CNAA 4Z8BA 1BOBA 1N1YA 2CQNA 1T6SA 5FV3A 4DBRA 3ZXAC 2F4PA 2XPUA 1HKSA 1LOBA 3U0ZA 1DQ5A 3KX2A 1HCRA 1GWLA 3A4CA 3LNQA 4UW4A 3OY9A 1IO2A 3G2BA 4B8XA 2IS1A 2HH9A 3WNMA 4A7ZA 3DKYA 5K5OA 4RS5C 5ANNA 1WH5A 4LORA 4XR6A 1A8DA 5I0SA 4RAZA 2YGMA 4CE8A 3S3NA 3POWA 1UAIA 4Q48A 2V79A 1Y39A 2E53A 2IVJA 1JUIA 3ACGA 3NNGA 3ZXFA 3H35A 1UX7A 2QQNA 1BJAA 5JHFA 1MSFC 2QKMB 2A5WA 1X36A 1NXD1 1W36C 3HOSA 4EJRA 3ST7A 4YFWA 1KJRA 1MZ5A 3VHOA 2WAOA 1IHMA 2DDAA 2ZJCA 4B4QA 3ABMH 5AFEA 1LHOA 3ECOA 2Y6HA 1SFKA 3IUOA 1C5HA 2HWC3 5HXVA 1DCSA 1JH5A 3PJYA 5FMOS 3ZYPA 2XVGA 4FCAA 1ND2C 3BY6A 5HXMA 1JYIA 2JRTA 1ETQA 1H2KA 4Q0QA 3CCEI 2VMCA 4I7HA 2YU1A 3LQRA 3VHPA 2DYRH 1P7IA 9ANTA 2HWF2 2UYAA 5F08A 1G8XA 2HKOA 4OIQF 2OAZA 5FK8A 5A3MA 3ECQA 4XKVA 1GV9A 1VQ8I 3JAMZ 1VBC1 1V5GA 3H0DA 4YZ3A 2ZGSA 4R9DA 4RS8A 4IGPA 1AVBA 4CXYA 3DEEA 2K9NA 5EGOA 4H7MA 5HBAA 1WW6A 2EV5A 3OYKA 1MS3A 4CEWC 1SVMA 1Q8PA 1OJLA 2DN0A 2XJRA 2D6OX 5FZEA 2CFOA 4C3HJ 2BE5F 5JCTA 3IAM2 2VUDA 5CAZA 3CJIC 4CRQA 1R1VA 1XB4A 3OBZA 1SVOA 1VZ0A 4I01A 3J26N 4P02B 1UZVA 4DJAA 4ATFA 5HV0A 2PHTA 4LKFA 1AR61 3LCPA 3MYXA 4P9IA 1TWCJ 5KC5A 1GR3A 2E71A 2OCEA 3WG4A 2W9XA 1PMIA 2LREA 2OUHA 4AQ2A 4GH4A 1VBB3 1R22A 4QB1A 5HDKA 4HAMA 2CQKA 1LKXA 3JBG3 5LHGA 1F5FA 4YRDA 2YV8A 4BNCA 1ZGAA 1J1TA 1FMWA 3SQNA 3M3OA 1FPN1 4D7TA 3L2QA 5C33A 2R0HA 2XJPA 3ZDSA 2VOVA 4XUOA 1UMZA 2M30A 5EYXA 2X53S 3W2AA 1ZARA 4CICA 3ZQFA 1H1MA 3TP0A 4U0VA 4XF0A 2FZ1A 2WT1A 1S0JA 2BEOA 3I3EA 3RI9A 5HCHA 2JDHA 3MEXA 1SFNA 3PLQA 3KZ4C 5JI6A 1PVEA 1XOYA 5K7ZA 2BV4A 1J5YA 4AQSA 1XU1A 2WN3A 2A70A 2M0MA 1OCRH 4NAMA 4O9EA 2HR3A 2EIDA 5LFAA 4AVVA 1V6KA 2OYZA 2VTFA 2ZHKA 2CH0A 4LLOA 2VBYA 3NO8A 3OYNA 4XKBA 4HX8A 4W8JA 4RR3A 4N43B 1UZYA 3ATGA 2ZSHB 2VT2A 3I3BA 3TN91 3PIGA 2QQBA 2WJSA 3I53A 1BMV1 2E34A 1XSQA 4FISA 1UG2A 2HFHA 3VBUC 2VM9A 5D8AC 2ZHLA 4AHXA 5JR3A 3ZPLA 2JDPA 2KD7A 3L1PA 2AZ5A 3GXOA 1DGWY 5JSPA 3HQXA 5JPMB 2IWGB 3CKHA 5IATA 4NE9A 4D0QA 2VJXA 1DU6A 2D6KA 1S0FA 4F52A 2W1SA 2PN6A 2NVQJ 3WP4A 4F91B 2WS91 1AR72 3OGJA 3OOXA 1TQ5A 5FREA 2LFBA 4MFDA 1GLNA 4EJUA 3ILNA 4XCBA 4IHVA 4XHXA 2ZHNA 1MPXA 2HWB3 2JEMA 2LY9A 2VJ5A 4KWJA 3HHHA 1ZA4A 2GLOA 4IXAA 2BVVA 2QDNA 1ZQ3P 1NCRC 2QCSB 4LBMA 1KFUL 1FTZA 2RS31 5BOXA 4BK5A 3OG2A 3GTKJ 4AEDC 5BNOB 3QPTA 4DUWA 4UAPA 1RRJA 4YZ4A 1FV2A 1QGLA 3HHGA 3CJXA 4BM8A 4BPZA 1COV1 5EZWA 2M34A 1S5LC 3U4XA 3JU9A 2BP6A 1MACA 1ZZCA 1U5TA 4XC9A 4K1YA 2QVOA 2HWE3 4LGWA 3F2ZA 2WO7A 3T2PA 1YTYA 1E17A 3T8RA 3BTZA 2ISYA 4CCEA 4XETA 1TMF3 1D1CA 2HQRA 4C3IJ 3ZR5A 3KEOA 2M8EA 4IEYA 2O14A 1QNWA 2OA2A 4AI3A 1U6GA 3LGRA 1I39A 2VVEA 5LATA 2ZGMA 1D8JA 1IGNA 1IXRC 1CGPA 2VC9A 1RKWA 5GZCA 3PFYA 2MLGA 2GMEA 5J98B 3S1RJ 3I2IA 1ZAOA 4UFHA 3CF2A 4XLEA 2Q0AA 3T0YA 3QYBA 3PVEA 1SLLA 2PJRB 4AGRA 4HSRA 3TNPB 2ECBA 3QU3A 2VECA 1IRXA 4KG8A 1ETKA 5C9AC 1HXS3 1QVUA 4W1UA 2Y30A 1W05A 1D2QA 2C6YA 4DQAA 1Z7LA 4CDGA 2X85A 4L0ZB 4HANA 4XZUG 5IT6A 2CWEA 1BOAA 5FYCA 2CW8A 3KP5A 5F6FA 5FOBB 4UVBA 2QLZA 4ANJA 2K9SA 5DZGA 1C4RA 3FKIJ 4HQEA 3VUOA 5DEQA 1BBT3 1LU1A 3L2CA 2W7NA 1ZG3A 3ZQLA 5F9TA 2Y38A 2VULA 3VGIA 1C1LA 1RUG3 1OFCX 3HIFA 5E8GA 1W6PA 3VODA 2EFWA 4OHXA 1ND3A 3AJYA 3F95A 3O3KA 3AL6A 1ONAA 3ZMNA 4G7OF 4OLLA 1NKGA 5FPUA 3FMRA 2ZC2A 1E2XA 5F2WA 4XMYA 2DYCA 2YXSA 3THCA 3LSEA 1IN6A 3H3ZA 2JDAA 3THDA 1GICA 1JZ3A 2BZTA 3AJZA 1UMHA 2VMIA 3CCVI 1MJAA 1QHGA 3DV8A 5CKTA 2DMUA 1SFYA 4IOAF 2WNOA 1JYXA 5F1RA 4AFCA 2EILH 1G8WA 1PIV1 3I2DA 5LA2A 3MVPA 3ACLA 1LULA 4WVVA 5C71A 5FRAA 4MGZE 5LBEA 4EN9B 3G1MA 4LK1F 3QYEA 5IAVA 2JICA 4MHGA 1QHDA 3PUFA 1JODA 3VZLA 2WQZC 3O0XA 1NLRA 2ZX3A 4P9YA 2O8KA 4M9SA 1V6JA 4HVQA 3W2WA 2PHFA 4LO7A 2F17A 1GQGA 4E7SA 3RKQA 5FFXA 4A5NA 4FPHA 3WVJA 1VQ6I 2FNPA 4OIPF 3SC7X 2HOEA 1ZTRA 4LB6B 4K2EA 1BLZA 3VDBA 2L9RA 2X1CA 5ERIA 3OB8A 2D1HA 4AFBA 2H1LA 3K69A 3HSFA 2E2JJ 4M3FA 1ASJ2 4BQ2A 2H8WA 1UAAA 4YG3A 3THTA 5CKMA 2R5YA 1N75A 1RTVA 3ETPA 2BNOA 1DYPA 4QAWA 4RGXA 4EJTA 5J09A 1K78A 3ZVXA 4UV9A 1Z21A 5C4WA 3WNXA 2A6VA 1XPWA 4RS5A 1FOYA 3NEUA 2R32A 2EZLA 5B2GB 1ULPA 3LSGA 3A21A 5FMDA 2MABA 2DVBA 3ZXEA 5JLXA 4HVOA 4NHLA 5C3SA 5FLIA 5KCMA 1UNBA 1RVF3 1OURA 3ZYIB 4A7YA 1T8IA 4Q4Y1 2D1VA 4LE4A 2O0OA 3DF8A 4LLLA 2O8OA 4FE7A 1Z6RA 2OTJI 2QTWB 4L9VA 4A93J 5FBJA 4A3GJ 3GVAA 3U11A 4CUCA 4O61A 2ESNA 2P3KA 2J1RA 5LW9A 4Y13A 1W03A 1OSGA 3VBOB 4M3CF 3CJQB 1G9BA 1M1EB 3Q8AA 2AYHA 3RNSA 2GC2A 4EJWA 3MKYB 1LEMA 1ULFA 2DO7A 4UW5A 1IXCA 5FGMA 4OI0A 4M3EA 1X1PA 3HBKA 3BKZA 2DCEA 1F35A 1ND2A 2G4IA 4HBNA 1STMA 3WQ0A 2P81A 4M3DA 1VRH2 2ZGKA 4META 4P9JA 1FSEA 4GB31 1LDJA 5AVAA 1EP0A 2H94A 1HA8A 2ZA9A 1V9U2 5C6CA 4AYBN 4SLIA 4IV1C 1BBYA 1TW3A 1FBUA 4ZXEA 3B69A 2OA4A 3LFUA 4M6XA 4KIGA 4MZUA 1H88C 5D21A 5HS8A 5GZDA 2DK5A 3H7YA 1RHI3 1YQ8A 1MZBA 2JDNA 1SPPB 4A69C 2ZKZA 2ZX4A 2JT1A 3KD4A 1XGOA 3K48A 2EJRA 4LUKA 1V5EA 4ZYAA 3H1MA 1IOAA 5HS7A 2WN2A 3HWJA 1SC7A 1JBCA 4CEWA 2Z33A 2ZBJA 4NJ4A 4EWAA 2WR9A 1LTEA 3KB5A 3VYRB 2OD5A 4KU7A 3BU7A 3O14A 4DOUA 3I59A 2BYVE 3BR5A 3CJIA 4H2AA 3J7AY 3MWMA 2HJIA 1LDDA 2VW2A 3I55I 2NPIA 4AR2A 3VBHC 1BEV1 1SD7A 5DM6F 1ORKA 3CP2A 2ZBKA 4E7LA 3SCHA 2XGCA 2X29A 3PUBA 3WR0A 1DGWX 5A7PA 2DA3A 3B94A 5FY0A 1XS9A 1GNHA 1N3PA 1GP5A 4P00B 5FKCA 4ITVA 5IVFA 4NQWA 3RZDJ 2ZFWA 4TLGA 4ZDPA 4XE9A 2XWJB 4U7DA 2XF6A 1KFXL 2HQ5A 2GWRA 1DIWA 1AL23 2OBPA 1ZBA3 2JVGA 2O3FA 1OA2A 3OS1A 2RQQA 2QQ8A 2FSWA 4NWWA 4E2GA 4XLAA 5CG8A 2L2OA 4PIZA 3PVNA 5FYMA 3U2RA 2DAOA 4UUVA 2X6WA 3GTJJ 2UYBA 3TB0A 1H89C 4LPLA 4IRGA 5KHIA 2M1BA 4AD9A 4D7NA 4GULA 3N4MA 5J6XA 1GVDA 2VVFA 2BU9A 5A70A 4II2A 4JTNA 2BY2A 2XJVA 5EG0A 4XFIA 4JX6A 2YPDA 1WJ5A 5E8IA 3IWZA 1RUH1 4CSWA 3BB6A 5LA0A 2QCOA 3EHKA 1I1EA 2CL2A 5DDGA 5ABJA 2VZ3A 2GU9A 4YVWC 2E26A 1OPOA 4CYCB 3WGGA 3SHRA 5EZHA 3F8BA 1F9KA 4K40A 4UFIA 3I3LA 5C44J 4CCJA 1N3QA 5JI7A 3CCJI 4K7JA 2BY3A 1E5SA 2PHLA 1EJ9A 1H9GA 4HSTA 5TSWA 4P5HA 4XVHA 3H5NA 3VBUA 3WU1B 1R71A 2GNMA 3D5OA 1LKNA 5EGOB 2PG4A 1VQKI 5F5QA 1S29A 2CO5A 3MFAA 2GA1A 5B1BH 2BBYA 2CG4A 1LU2A 3CJNA 3DP7A 5BNNC 1NX9A 3PURA 1XNCA 1PM4A 2HGCA 1B4AA 1NH3A 3J9SA 4G4FA 4B8EA 5GLZA 3NJXA 1JT6A 5D5UB 4TN7A 4G94A 3WNOA 1W1WE 2N8GA 2W91A 2HOTA 4EYUA 2CQQA 3VZOA 4A3MJ 1NCRA 4GH4B 2R7FA 3BR6A 4F3QA 1DF0A 2XLFA 2F6CA 2XAGA 3DBHB 4GAZA 5FZIA 4AEDA 3L2RA 1JYTA 2BBAA 3S57A 3S32A 2WDBA 1WJAA 1U9OA 3RSNA 2EFNA 1H1AA 4PFPA 5TRDA 4XLPF 3BCAA 2I74A 3CCRI 1BJQA 1RUC3 3PIJA 3DLLF 4UY8I 4Q8LA 5SV8A 3RMXA 3ZXGA 1TME3 4XAEA 4HNTA 3POYA 5H2FC 4S0HB 1POQA 5FFOC 5A3WA 1SFOJ 1O57A 2JSCA 2KQRA 1OISA 4A0YA 1IW7F 5GPAA 2WA4A 3TKYA 4QKBA 1RUD1 1FIAA 4XNFA 2Y8KA 4A3ZA 3VEPA 5JMOA 2LY1A 1AL0G 1LOAA 4XLCA 4AI1A 3SH3A 3S1QJ 4YFKF 3WTYC 2LC2A 4KYWA 1ZX5A 1W8TA 3P3PA 1JGSA 3AP5A 4AI0A 1YXWA 1P4XA 1C57A 4Y5Z0 3RPUA 4FQ4A 3ZXDA 3SDBA 1SVLA 1FT9A 1VQ4I 4RR3B 1UHMA 4QHZA 4IEJA 2GIZA 5C9AA 2FDJA 3DTKA 2VC1A 1Y4WA 4G6TB 1GU3A 1YJWI 2A05A 2QZ3A 4CDWC 2JIGA 3POGA 4UB8C 1REEA 4BACA 2VR4A 1G3SA 3HBZA 1XXNA 2BGOA 1LECA 1T38A 5EEAA 2HTJA 4HDUA 3NRVA 5A3TA 4JYKA 2D43A 3FHIB 2XHNA 3RPUD 4XFBA 3WW4A 3B93A 2XKPA 5DYMA 3ZQIA 4COZA 2VZ1A 4HV5A 3ZXSA 5LBCA 2BW3A 2RC4A 1AR81 4HDVA 1IS4A 4ONUA 5LBBA 3HEFA 3QAHA 2Q2EA 5J36A 2NXNB 4NPRA 1B1BA 5FFZA 1DZTA 4JHZA 1FMD2 1R082 2K3FA 4KL1A 1PZ9A 3FBIB 4D0PA 1XSVA 4XEZA 5SV5A 4AU7A 4FOVA 1WD3A 5LK7B 2ZXQA 1F4KA 1SLCA 1P9QC 1U5TB 4HW0A 2JA5J 3KS7A 4QQHA 1JYNA 1JTZX 3VV1A 1U0JA 5EZGA 1AYN2 4KWUA 4C0HA 3HOWJ 3F9KA 3O8GA 4K9SA 1GQPA 1N1TA 2VJ4A 1YI9A 4QQPA 2X05A 2RDPA 4RGRA 4QGLA 4XBNA 2EXKA 4XXAA 4RGUA 4CGZA 1ZLJA 5J4YA 3KWVA 2E6VA 1UHWA 3ZDVA 2P7VB 2KIUA 4AIDA 5FP9A 1WZ2A 2WZ8A 3W3CA 2ZMLA 2R7XA 2L7KA 5DM7F 5F3GA 3AMMA 5A7WA 2BOJA 3KT1A 4LHSA 3QH7A 3K77A 5FJHA 4QPGC 1ODMA 1WBFA 2VMHA 3AMPA 1U2WA 4XN3A 1VALA 3ULQB 4EZHA 2FBHA 3IDAA 3RZOJ 3JD72 2I8DA 1WRJA 1UX6A 4EMSA 1CJDA 4IERA 4Z2YA 1FSHA 3ON7A 4N4NB 3LAPA 4XLHA 1I5PA 3PL0A 2LW8A 3W5MA 3MN2A 2VASA 1WH7A 3DBLB 2D5HA 3OR2C 1J1LA 1NY72 1VQPI 1AA7A 5IVCA 1S7AA 2VIXA 4N90A 3HKZN 3VLBB 2UY8A 5BNPC 4MUVA 4OULA 4OI4A 3VD5A 4DEVA 1SLBA 2R042 2ZMNA 4NRMA 3N7LA 1ND3B 1X9TA 4M4PA 4I99C 3ZRGA 1YQ6A 2R7TA 3IMMA 3DQVC 2JMWA 4Y1ZA 2KM2A 4UBHA 5IY5H 1AJKA 2FU4A 4IO9F 4F93B 4BA6A 1PM7A 2PXJA 3UESA 2J1TA 4CA9A 4K21A 4HKOA 3ISPA 2VY0A 4IV1A 5E88A 2P37A 5H9PA 2ZGQA 4GYIA 4HA8A 1Y9GA 1PVC2 3RTRA 5EF6A 1G2HA 2M8GX 2B42B 3RWNA 3GNEA 1UMQA 3OGRA 1XNAA 4CDUB 1JJ8C 4A0ZA 1H9PA 1UPSA 2HZDA 2DTYA 5FKBA 1D0XA 3OMYA 3GBFA 4LBQA 1WCDJ 4L9JA 3S2DJ 4BU2A 2KISA 4NO4A 3QLQA 2R7UA 1TWFJ 3WG7H 5A80A 1YC61 2AGSA 2VI6A 3MZ8A 1PO13 4WM8A 3CP8A 1G7YA 4OVEA 4FFIA 1X9PA 3KV4A 3A01A 5FKKA 1R7JA 5JWPA 2OZJA 1CPNA 4KA4A 3E3VA 2VCCA 5F27A 3VBHA 3SYTA 2R5YB 1KS5A 1UL9A 3AYCA 2A07F 4XFGA 4LBQD 3OV8A 1UW8A 3RZKA 1K78B 1DGRN 3BALA 2QQPA 3IT8A 3QH6A 4DY3A 3J8F1 4ATEA 1PGW1 2K86A 2ET1A 4RS5B 2XL7A 4JQRA 2ME6A 1WLWA 3IWFA 5H9QA 2BDRA 1OKRA 4AYBA 1PJRA 3BOQA 4XTPA 5F6LB 1UB9A 1IS6A 1QU3A 3OIOA 1VMFA 4HKWA 4EVIA 1W8NA 2RVAA 3CMGA 4LE3A 1QDOA 2C24A 3IHUA 4JDNA 2JDYA 3VD4A 3CCYA 3AZYA 3D3AA 3Q9OA 4ON0A 2VBZA 1XSDA 3MUY1 2FBKA 2ZS6B 1ZYRF 3DXJF 1JOJA 5K9YA 2ZGLA 1T08B 4GD4A 2XSJC 4P55A 4WWCA 4I3PA 2RG4A 1ND2B 1WJBA 2X6XA 4D5FA 2RR11 3DECA 4HPQA 3I7DA 1G9AA 1K4SA 2YR2A 3RVHA 2Y0IA 1Z3XA 3IM0A 4FTSA 2KKOA 4YVWA 1Y56A 2VUAA 2WZR2 5LY2A 2ERFA 4ZYGA 1LNSA 4CPBA 3CZ6A 3ZOIA 4LA2A 5EJ1B 4C2UA 4YW1A 2TEPA 3JR9A 2QQIA 1S0GA 4C91A 4H3WA 5E18F 4Q4W3 2ARAA 3QODA 3HR9A 4IEOA 1LVKA 2OZUA 2R92J 5ERLA 3GYDA 3U78A 3UGGA 2R7OA 1J2XA 5FO9B 4S04A 5I8SA 2XONA 3WUDA 1QPIA 2D6MA 2OF7A 3ZQGA 3L2HA 5E79C 4UF0A 4CEWB 1S55A 5C5UA 4LJZF 5KC6A 3V0BA 3ZFEA 2YMZA 4QIWN 5L3EA 1HRV2 2E33A 1USTA 2DFEA 1GWMA 1WMFA 4RB3C 1YNAA 4QPOA 4CPBD 3H8XA 2W85A 3IPVB 5K7HA 3I59B 4IHTA 1QIQA 3WNPA 3CJIB 1BW6A 1YI7A 1KYZA 4XJ8A 4BDVB 1R4MB 1RUI2 2MBFA 1GNZA 2R49A 4XABA 2GN7A 5ICGA 2R0FA 1OA3A 4HF1A 3AXDA 2LS6A 1LHWA 3BCWA 2NMNA 2MYSA 2K02A 4AXOA 3BROA 2RREA 4IQ4A 4RL7A 5AC93 4NQWB 4LD5A 5E3MA 1W2AX 1TT5B 2RGVA 3B5LB 3K4AA 4PJYA 2JA6J 1RMU3 5J3LA 2H27A 1RESA 4BUPA 2KIFA 1OF4A 3ZSJA 4OFGA 3KVAA 4L99A 3OWTA 2DFCA 1UU4A 2WT0A 3FFQA 3BI3A 2M45A 4LK0F 1NE6A 4N7IA 4A3CJ 4I30A 1LDKB 2F5FA 4COYA 1X4PA 2V5DA 4FTEA 1X1CA 3PSFA 1SDDB 2Y0SN 4Y22A 3SFIA 4JK1X 4AIJA 3TEDA 2HWB2 2VQAA 2V4JC 2OX0A 5G04L 5FKMA 1ACIA 3MV01 4QDSA 3TRSB 1C28A 4XXPA 3KEQA 3O1RA 1DGLA 5EG0B 2W92A 2ZGTA 5FJ8J 1EYBA 1XC5A 1IPSA 3FXUA 5ACA1 2RM21 4QD2A 3JXSA 4YM1A 4ZS3A 1X4OA 3UGHA 1APLC 4OCTA 5FZBA 1STZA 3LFKA 4XJWA 1BCXA 3POIA 2KRCA 4XFCA 3NNLA 3M4FA 4INDA 4YIIA 2JPBA 1VE0A 4GZ9A 1MNDA 1Z67A 4LB5A 4BBSJ 3O1TA 4EE2A 1G4DA 1QKQA 5EQUA 1PX4A 2BXYA 3HTUA 2COBA 1AYM2 1DU3D 3JRFA 4CDWA 2B63J 2XPJA 3L9JT 1ENHA 5FP8A 3OUHA 5D8AB 1KGSA 2MGQA 3P9CA 3CJTB 1OVSA 2VBWA 2WLQA 3RQIA 4OMYA 2XBO2 2O6GE 3B00A 1VQNI 1AWCA 2KZVA 2D2WA 3AZXA 5FZ0A 2XVCA 3WOGA 1BA5A 3WHUA 3G6EI 4BQAA 3D5LA 1H8TC 1FNYA 3VWBA 2HEYF 5BMZA 1D5VA 1AR92 4EROA 2LVSA 5FZKA 2WWSA 4FSJA 1CIYA 5HLHA 2OU2A 1JT0A 1N77A 5JMCA 5E3OA 1NCRB 3GHMA 3HBLA 1YQ5A 4BK4A 1NE4A 1ZZ6A 4YW5A 4JGZC 3M3QA 4AEDB 1BR4A 3HOXJ 3JB4C 3EUAA 5C3PA 5J48A 3HTSB 4XK4A 5FROA 1OPMA 1FOD2 1W0UA 3WINE 1RITA 3Q8BA 2P6TA 1IKQA 2V9VA 4LIVA 1R58A 2Z1DA 2PYTA 4QX1A 2F4OB 3FHQA 5EP9A 2VZRA 3AVSA 3WT3A 1WJFA 1G9CA 3CCSI 1WCSA 3VZMA 1SEUA 2OKXA 1A34A 3F0CA 2HPIA 4A6DA 4ENMA 3NV2A 2Y31A 2FCVA 2UWAA 1LAJA 3OUJA 1XMKA 4UHTA 3NNJA 1Q5OA 2XRLA 1XNDA 1XGMA 1FV3A 3R60A 2WZPP 4YGDA 3GDBA 2AXTC 2R062 4YNIA 1VBD2 4OINF 2OUJA 3VYTB 1DZRA 3K2AA 3QU6A 5HOOA 4BLJA 4EM1A 2YUEA 2YFUA 2TBVA 1NT0A 1WGPA 2VU9A 1W8FA 3RWKX 3UKGA 4QPGA 2O8QA 2OCCH 3V7RA 2ZHMA 1OLME 2JJ6A 2DT6A 3KT7A 4QDQA 3N9MA 3LEMA 4AVCA 1QJZA 3PJQA 4JKMA 3LIHA 4NIGA 2HDWA 4YLZA 3BN6A 2HVQA 5C9AB 5D4RA 2DJIA 1LODA 1KS4A 3CO6C 1RUF2 4WM7B 3WE3A 2HWF3 2JE7A 4PFOA 5F3EA 3HSEA 3VBRC 3K70C 3J7HA 5FLJA 5A7QA 3WY6A 3ELNA 5BNPA 4WVZA 4YVSA 4ZC3A 1JZ5A 4B44A 3LD8A 2JN6A 1D4M1 3C7FA 3GFIA 4Y3OA 5DUXA 4H7LA 4V1PA 1W3VA 3RSJA 3IAQA 3T0BA 3LDRA 2DUQA 4BXFA 1JHNA 3GTMJ 3E6BA 2V09A 3WCSA 1D5YA 1UZ0A 3D8CA 2XLAA 3NV3A 2Q2EB 1Q8OA 2VKDA 5A3NA 4CDQC 4BLIA 2WKKA 4ABZA 4GXLA 5I91A 4PUSA 5EJCA 5C70A 2GC0A 1EPWA 2WLPA 4GMP3 3MHZA 5EEGA 3M3YJ 2DWRA 5FY1A 5FD5A 3ZM8A 5M5WJ 4M6VA 3DFGA 3VL9A 2NVYJ 5D2AA 4WK8F 3MICA 4CCKA 4FXGB 2J5PA 4UFLA 5LB6A 1JKPC 4LIUA 1PMJX 4YEJA 1H9WA 3V7CA 1F4AA 1W9SA 4UVCA 2QBXA 4BQNA 4DXZA 2DXIA 1VAVA 4BMBA 2RDRA 2X6OA 4LK7A 3VB9A 3COAC 2D5VA 2H6CA 3PFIA 2DURA 3HKZA 1AOYA 2D40A 1ETXA 1NLSA 2CUEA 3AP6A 4QWNA 1SD5A 3DU5A 1B35C 1UYYA 2OS2A 2LLKA 4E27A 3WW3A 3GFMA 1J3PA 4UFMA 3OOUA 5F7UA 1PGL2 4DUXA 3IH3A 3AYDA 5K1YA 2XG3A 2JA2A 3EXUA 4AUXA 2YC0A 5A7WB 1JHFA 1OKOA 3IDBB 4MGKE 4NC6A 4GXOA 2AO9A 4W4ZA 5A2QK 1HQLA 4JQFA 2ZZJA 3CC4I 3Q0VA 2DV9A 5JXJA 3OJBA 5IVVA 3W6JB 1HN1A 4O65A 1TTYA 1N1VA 1X33A 3GF6A 2LTNA 3FLTA 1LJ7A 2JG9A 4BXSV 3DYPA 2DODA 2QM3A 2MPFA 3PUQA 3J7NA 1DYKA 1JOPA 2VC0A 3E5XA 3D5RC 3MUZ1 1OLQA 1S72I 4XIKA 1TQMA 5BPIA 1QJX2 2JKBA 3JRGA 3S8PA 3JZVA 5L3FA 3QP6A 2LOOA 1XC6A 1L3LA 1W8WA 1YLLA 3NNMA 3K4ZA 4KT6A 4M3GA 1W4MA 3T2QA 2PHRA 1R1A1 3PVOA 3NARA 4UNOA 2IFRA 1R5GA 4KMQA 3QP5A 1IDZA 2WAAA 1Q8VA 4TTGA 1R64A 4DFSA 2VE9A 1AR73 2HEWF 2JWTA 1C8M2 1OQDA 3MW3A 4XRFA 3LA2A 3FXOA 2VO5A 2IS4A 2GOXB 1G86A 2RMU1 4MHUA 2CW0F 2R072 2EBIA 3C2GA 3BTXA 3POEA 4IV1B 5A3LA 3WZ1A 4XLNF 4B3XA 2O0YA 3V7SA 3KEYA 1DGRA 2NZ9A 2E7WA 2Z5UA 3FLPA 4CO8A 1BI1A 2LY2A 1XJAA 4Q0VA 1OD3A 5IP9J 1NLQA 3MIBA 2C6SA 4FOYA 1WA6X 4JRAA 2RE9A 3ASOH 5IFTA 2FF4A 4QXHA 2WFF2 2BBVA 2K9LA 5C8CC 3WSOA 1OKQA 1DGRM 4DYQA 1HQNA 5GJ6A 5C7GA 2VPRA 2EIGA 3A01B 3KETA 1BC7C 4XCAA 2W25A 1TW2A 1H2LA 2HDDA 3VBHB 3E97A 1S0EA 3LIGA 5GKAC 2JTVA 1RUOA 3CC2I 3FF5A 5M3FJ 1MVEA 4R4ZA 1PNFA 4XQWA 1DPUA 3RDIA 3ERMA 3ABTA 4DYRA 5EYYA 3G1OA 4LBLA 1PUFB 2VL8A 2QF7A 2HBUA 3MI8A 2VCBA 1LE8A 5LK5A 1JOBA 4FFHA 1GBGA 3TAYA 5CKNA 2N7GA 2AQFA 3MMYB 3VKMA 4PJ0C 1GT0C 1ZK8A 3IKTA 3GJAA 1RNLA 2AR6A 1YFUA 1WCKA 1W9FA 4YIRX 5BUVA 1Y8QB 2ZEXA 4IEUA 3UK9A 4Q4X1 2VOKA 3P5JA 3C18A 3I2FA 1UOGA 1FP2A 4JX5A 1GANA 2XAFA 4LBKA 4QKNA 4LO6B 3F3XA 3RPQA 2DVFA 2FX0A 4OYUA 3Q8FA 1TWHJ 2WBMA 1J58A 3KYLA 4C90A 2VQHA 1VBA1 4RLFA 4YM0A 1MS0A 3LSKA 4IDZA 3I8TA 4CUGA 2VODA 4XLFA 2JA8J 3GM8A 2LH9A 1VBC2 4YVWB 2XGDA 1KYWA 3NKTA 3RI8A 3AKPA 3BIWE 2XDVA 2NS0A 3JTGA 4FT8A 1KA8A 4HK9A 4E7KA 4ASNA 3GHNA 1YQCA 1UY0A 3SZTA 1QXRA 4AZZA 2JUGA 1S6LA 2G7UA 1XB9A 4GO1A 3ZKYA 2M3AA 3PVBB 3VN4A 2FOWA 2EQRA 5E3LA 2YS9A 2EK5A 3M2MA 4QKDA 4B1RA 4R79A 2R3SA 3SCFA 1AR62 1XD7A 3X2QH 3BDDA 2H1KA 5BNNB 1S2EA 5ANQA 3FMGA 1NA1C 4PGGA 3NMBA 4G9SB 1ZNPA 2W1OA 2P4WA 3UKNA 1R00A 3G71I 2Y0SA 1H8TA 3OSDA 3TEZA 3MF9A 1FPN2 1TL8A 4U87A 2L02A 4N0BA 1SD4A 3VZJA 1TNSA 1Q1HA 4EEFG 4ZTJA 4IHSA 4DZPA 4JGZA 5FZAA 3GF2A 1HF0A 1QJU1 5DQ0A 4BQWA 2LBFA 4ESJA 1E3HA 1XTAA 2HNHA 1CWPA 5KHGA 1XX5A 3IAPA 1W9TA 2HVSA 1B8IA 1CF7B 4JOMA 2CV0A 2CV1A 1I6XA 5L7OA 4TLFA 5FYIA 4WZFA 1MQTC 4AC0A 2NVTJ 4LHNA 3TOJA 4XN0A 3R0RA 2O03A 5DAXA 2W47A 1J7KA 5JOYA 4HN0A 2Q8OA 1MBHA 1XYPA 5FZ8A 1PO21 5CVRA 4BJ6C 3ASNH 2W52A 1XBFA 2JKXA 1WHUA 3CNAA 3PIPF 1TNRA 2OUMA 4Y22B 2R1DA 3FIWA 2EZHA 5FBZA 5D8LB 1BR2A 1XCBA 1CX1A 1NG0A 2CS3A 1VLNA 3UJOA 3W20A 1APNA 3HGYA 4CHUA 3GTGJ 3R05A 4C1WA 5T5JA 4HYEA 4LNVA 1UIKA 2QQJA 5JVGF 4YGEA 2CUFA 1E0EA 5FKLA 2A3WA 1DP7P 1G9FA 3TN92 2W94A 3ZN6A 4A3BJ 1Y43B 1JKOC 1OUXA 1BMV2 1IDYA 3PNTA 1ETWA 3S6PA 1VRH3 2VQ0A 4QXCA 4BISA 1V9U3 2E2HJ 1KDMA 4RHV1 4DXSA 1FI2A 1SG3A 4CDWB 1K3IA 4A45A 3GW2A 1LFPA 2IS6A 1JZ6A 2ZB9A 3OYBA 3VBRA 4MEYF 2WS92 3AG1H 3VZNA 5A33A 5A1FA 5FPVA 2FHRA 3VBFC 3OYFA 3Q8EA 1GZ9A 1DDLA 3MPPG 3AKSA 4XKCA 4EZ4A 3KF3A 2PMZA 3DL3A 3M70A 2RS32 3U1DA 1HW1A 3JCUC 3J4UH 4KMFA 2RJKA 1W5TA 1R093 3JCIA