4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
1XE8A 5E8GA 4I09A 4XLPF 3F22A 1ON2A 1FPQA 2L4MA 1HQCA 1LQ1A 4IJAA 2CV6A 3HHHA 5C8WA 4KFCA 1DZTA 3LA3A 2MH2A 4MTDA 1Z05A 1NHAA 3F8BA 5T3NA 2ZXJA 3E5QA 3I59B 4B8XA 4IXAA 4BHCA 1D8KA 4ZYGA 5K5RA 4QX5A 4HVQA 2EV0A 4AVPA 4MZUA 5FDBA 2O61A 3ISPA 5D4RA 3RI4A 3JAMZ 4ESJA 1OFNA 5AIPA 3V7CA 2UWMA 5HLIA 1I1SA 3P7NA 2A69F 2V1XA 1MGTA 3MQ0A 2OYZA 3HRMA 4M9SA 5KBFA 1ZZ9A 1KGSA 2IVMA 1I6XA 2GZWA 4E70A 1ULYA 2VPVA 5J7MA 3BALA 4QM9A 3J80K 3H9AA 4XBFA 5TRDA 1U5TA 2NNNA 3FF5A 4MGRA 2VBZA 3RTRA 1TNSA 4AIHA 1EH6A 4KMUX 3ZMVA 2D1HA 5H6QA 2WV0A 3TNPB 3OF1A 3DF8A 4K8FA 4ETSA 4HBLA 3WTSC 1ZRCA 1FBSA 2DK5A 5HLGA 1RUOA 4KU7A 2UZKA 1W7PB 1YO5C 3E5UA 1WWXA 2OD5A 2ZKLA 4L9JA 4RGRA 1XSVA 5LRSA 4L0ZB 4EV0A 1FSHA 3MWMA 4HF1A 2CGPA 1ZLJA 1YFXA 1FSEA 1XDSA 4OIRF 1BBYA 2XLFA 3WW3A 3EJKA 4MGZE 4Q4ZF 4Q0SA 2XKPA 3H92A 2HTSA 2EWNA 3GO5A 1LRHA 3CO2A 1VTNC 2VT2A 2J5PA 3GUDA 2JSCA 3ZMZA 1S3JA 5D5VB 5E16A 3PVBB 1IN6A 3E6DA 4KT5C 2STWA 5JHUA 2PMUA 2O8QA 2P17A 1BIAA 1XGSA 3WTZA 1XE7A 3IWFA 4BHPA 4AVAA 3SXWA 4ON0A 3FX3A 1ZRFA 3PQJA 3F8MA 3S7EA 4LK0F 3HSRA 2HDCA 2XUBA 2HTJA 2IPQX 4JTNA 1SMYF 3FE5A 2LSOA 1B4AA 1FBQA 5ILUA 2WWYA 3RKXA 3BJAA 4ZZLA 3NKTA 2IXKA 4D0PA 2EV5A 3ZMSA 4EWDA 1U12A 3ST7A 4HLXA 3RDIA 4HV6A 1W7PA 3HT2A 1ONVA 2QJVA 4ZU4A 3V7RA 4LA3A 3GYDA 3F8NA 2WTEA 3O3KA 2C6YA 1J3QA 4LUKA 1XDUA 4UVAA 5ED4A 4QM8A 3U9GA 3ZPLA 3FM3A 4UXNA 1KQ8A 2R7DA 1CGPA 1S6LA 1AOYA 2FBHA 4G6QA 2KIMA 3I53A 3I5UA 3EO6A 1IW7F 1HKSA 3ROUA 5A2QZ 4YFNF 4OMZA 4RGSA 1Z7UA 4J1WA 3DP7A 4MGYE 4O9EA 3USSA 3KP4A 3IDBB 1U6GA 3FHZA 3Q5FA 4LTAA 4HQEA 1YIOA 2Z2SB 1CAUB 4IESA 2VONA 1SMTA 2EFQA 5I91A 4XFFA 2ZO4A 4I98B 2Q4SA 4LD5A 5HOOA 2O6GE 3RYRA 2KKOA 1JUHA 5BPDA 3O2PE 5BV6A 4Y13A 1F4KA 2CQKA 4LFUA 2ET7A 1LNWA 2VQAA 2A5YB 4N0BA 3BCWA 3EDPA 4XLNF 2PTMA 2ZNYA 5H6RA 4KIFA 4AVBA 1SD7A 3H1WA 3OGJA 3NL1A 1QPMA 2Z33A 1LVAA 4S05A 2BNOA 4Q0PA 2G9WA 1RIOH 4M9ZA 3JTGA 3JSOA 3W6KB 4BIFA 3HHGA 4YFXF 5DCMB 4U0WA 4DINB 2FA5A 1XB4A 4LJZF 1WQ2A 2JTVA 1QQIA 1O3QA 3I54A 1J3PA 3U1DA 1MZBA 3HSFA 5FFXA 1XCBA 1IXSB 3BB6A 3E3VA 4I2OA 2HGCA 4OIOF 1J3RA 1WLTA 5IT3A 3CUOA 3FM5A 3ULQB 3JW4A 1SD5A 2FXAA 2VODA 2MHFA 3JZVA 4R8HA 2QQAA 3KLNA 1XSDA 1DZRA 4Q0QA 3IC7A 4O5VA 4TV7A 5D8KB 3TNQA 1LKNA 3M1EA 1R58A 4EROA 5FLJA 4P9UA 4WWCA 2XRNA 4GGGA 2RN7A 1K78A 3UKVA 3ZMUA 1PM7A 4PIYA 5I8TA 4EGZA 1WKMA 2Z3YA 4E2QA 4YIIA 1D3YA 2EFWA 1LEAA 3RIRA 2NS0A 4ORFA 5AVPA 4A0XA 4MNUA 3Q9SA 5FPZA 2CSOA 3WGGA 4J1XA 1R1UA 3CL1A 4GYGA 2O03A 2UXXA 1OPCA 1G6NA 1G3YA 2EJRA 3FWEA 1IRFA 4HOBA 2ZKZA 2E1CA 4R52A 4BNCA 5BY5A 4I0AA 3IL2A 1K79A 5CJ9A 3R0JA 3FFQA 4YNIA 1J2XA 1HKTA 4KWLA 5I0RA 2HOEA 4JVAA 1QZZA 2HFHA 3GFJA 2L54A 2K02A 2W85A 2Z99A 2XAQA 3LQQA 3NEUA 5D5XB 4LUMA 1J59A 1FYMA 1BIBA 1P6RA 2H6CA 5IT9Z 1OD5A 2M30A 3UKNA 3C7JA 1IPKA 2WFPA 2V79A 1HW1A 4A6EA 4ONUA 4RD7A 5J48A 4MGIE 5JR7B 4WCGA 4EM2A 1NZCA 3F21A 5DD8A 3FHIB 4XFCA 3WGIA 3IIAA 4LK1F 4X6RB 3GZ5A 3GXOA 5CVUA 2V09A 4WX9A 1P2FA 1ZG3A 4G7OF 2NRAC 1GQHA 2CWEA 2CYYA 4HX4A 3C18A 2PEXA 2GC0A 2Y75A 1FP2A 5FD6A 3V8KA 5D8LB 3D0SA 2O1QA 2P5LC 3RJPA 5FD5A 4EM1A 1S8NA 4A12A 5ILSA 2Q2EA 1J75A 5KK1A 1LB2A 1R7JA 1U3EM 4XF1A 2MH9A 2FBIA 3GFIA 1FBUA 1USSA 1YUDA 2CAUA 2DLLA 3ECOA 1ZX5A 3BY6A 3OOPA 1WSUA 3MFKA 2HYFA 1ZZ8A 2PFBA 4RB1A 3I58A 1UCRA 1YG2A 4KL1A 4P55A 2DBBA 2EAAA 3KLOA 5E20A 5FLXZ 1Y9QA 4NB5A 3CDHA 1JHHA 4D7TA 4XFGA 4U88A 1O4TA 4B09A 5HVQC 4EGYA 2QWWA 2A68F 3TGNA 4KA4A 5ILVA 4YRDA 2YX4A 1TNTA 2TDXA 3LAPA 4ENNA 4M9XA 1GHCA 1Z6TA 3E6MA 1C0WA 2UYBA 3HRUA 2PHLA 4KN7X 4FHTA 4I01A 4OIQF 1EV7A 4HA8A 4OINF 3KP7A 2ETEA 1BM9A 2QVOA 2DI3A 1PP8F 5LHHA 2R3SA 4CICA 1ZN2A 3SHFA 2Q30A 3GEZA 3KE2A 5DCMA 3I59A 5A2QK 3ELNA 2DCTA 1FWZA 4O9GA 4RAZA 4IF4A 2GQQA 4OIPF 2KXLA 2O0YA 4IHTA 5D5WB 4XFBA 4UVCA 1O5UA 3BPZA 2XIGA 4RB2C 2Y0OA 5E1XA 3WODF 5HS8A 3TO9A 1ZH5A 2B9UA 3V7SA 2XAGA 3WW2A 1IN4A 4OOIA 1LEBA 1FXZA 3SMHA 5HS9A 4AIJA 3L9FA 3CJNA 2FBKA 4JBAA 4X6QB 4JK1X 2IRFG 2XAJA 3CJXA 3P9KA 3SCHA 3OTFA 4OLLA 2ZBKA 2HQNA 4KN4X 3H1MA 2G7HA 5CYVA 5LHIA 3H1YA 2M5WA 3MAJA 5LGTA 2PAEA 4I02A 4FBFA 2IP2A 2MBFA 4CGZA 3DPLC 3WTVC 2VOPA 4KWJA 5JVTA 4LLGF 3RKWA 1KU3A 4BHBA 3FMSA 4CYDA 1YFHA 5FGMA 5JR3A 1YTYA 1PDNC 2PFWA 2XKOA 3PQKA 2DQLA 2P4WA 4R79A 2NNYA 2BE5F 4MUVA 2MLGA 1G3SA 2B5HA 3D5LA 2Q0AA 3TKYA 1UPIA 1K78B 1W4MA 1CAWB 2RGVA 3ECHA 3L09A 4CXFA 1U8RA 4PIXA 3KETA 3ZQ7A 5KHIA 2M87A 1LDJA 2H27A 1U78A 3M3IA 2ZMEB 3BPXA 4BYYA 2XAFA 2QBYA 4NHJA 1OKRA 4LG0A 4HX8A 5H20A 4Q29A 3TQNA 1MDMB 4MGKE 1G4DA 3L2CA 4Y17A 3J81K 4QGMA 2M1BA 1USTA 1ZLKA 1H1IA 3F6OA 4L9NA 2RC4A 1NYWA 2BNNA 1RZ4A 4UBGA 1MJAA 3QAHA 2GIVA 2G7UA 1FI2A 5K1YA 5I8YA 2FEZA 4AIKA 4XRFA 2IA0A 4O6JA 1L3LA 5DEQA 3UKTA 2BV6A 5BUVA 3AAFA 2V9VA 1TQMA 2YU3A 1T38A 2ZMEA 1MD0A 2OZ6A 5CVVA 1DPRA 2MPFA 3DV8A 4DNCA 2H6BA 5DYMA 1MKMA 4ENKA 4HF2A 4HYEA 4ZYDA 3T0YA 4A2UA 5JI6A 4JTOA 2QLZA 1UIKA 2D1VA 3MYXA 3WTUC 2COMA 3LA2A 4G8XA 1IN5A 2IXJA 1GXQA 2DFIA 4YFKF 5JSOA 4YIFA 1O3SA 3CUQA 2XLAA 1YW8A 4Z82A 4L9TA 4KUMA 1OYWA 1S7OA 5HS7A 2QQBA 5L3CA 5DUIA 1X82A 3GVAA 2STTA 4HAMA 2A6EF 4MEXF 5AIQA 4AD9A 2F5FA 1ZGJA 3KP3A 3IDCB 5CVJA 4EWAA 4RGUA 3SXYA 2EB7A 2D5HA 1TW2A 4A0YA 2X0LA 2GH2A 4HLTA 4IEXA 1EY2A 2QYOA 1T0FA 1T39A 2L01A 1EH7A 2MC3A 2IA2A 2HR3A 4G94A 4EM0B 4XSZF 4I0BA 3S0MA 2FNPA 4AQ6A 2PAMA 3M9AA 4FAHA 5L3EA 3CUQB 1R5HA 3QACA 2YSRA 3ABTA 3LWFA 1XN7A 2X4HA 3GFLA 5JSRA 5E1WA 1DDNA 2JT1A 3IWZA 2HEOA 4XF0A 1L3JA 3LA7A 4WBBA 2H0VA 1IN8A 3WTTC 3KGZA 4XEZA 2EFNA 4B29A 5K5OA 5DD4A 2L3DA 1YQAA 3HRTA 3RZZA 4HDUA 3O14A 3GYHX 1IUYA 4LULA 4HQMA 1B6AA 1KU7A 1YHFA 4FX0A 3CLPA 1H1MA 2P7VB 3R0AA 2RNJA 3NQOA 4WVZA 3IHUA 3U2RA 3TO7A 1R5GA 3J81Z 1CAUA 3DL3A 1FOKA 1UW8A 2KJCA 1XMAA 2GC1A 2LF8A 2P5KA 3SCGA 3KP6A 2MLKA 3GF2A 5FCCA 4UVBA 5DV5A 2F5EA 3L7WA 1ZRRA 3WE2A 2F2EA 3R61A 2JPBA 2W24A 3KFWX 1R1VA 2W84A 2GC2A 1BC8C 1TTYA 3N4MA 1RL3A 3M70A 4GYIA 2FOKA 3BOQA 1REPC 3F8CA 3HOSA 3B02A 2DAOA 1FZPB 1U2WA 3LWCA 4CO8A 1I27A 2OA4A 3M8EA 5BPXA 4UUVA 2EVXA 4LG0B 1YW7A 5AONA 4GXOA 2HYGD 1RGSA 2L02A 1ODDA 3ZMTA 4BQAA 4LLNA 4IRIA 2DU9A 4K2EA 5D6FA 4RAYA 1SFXA 2RVCA 5J8CA 2OPKA 1SFUA 2K86A 1H9TA 2D2WA 3OD0A 1WRJA 3CO6C 2BEOA 4ESBA 2QDRA 3VODA 1KYWA 4XF9A 1QY4A 1O3RA 4IRHA 3R60A 2JZYA 2V1UA 4EWEA 1P92A 2ZJ2A 1R1TA 3F3XA 4FX4A 1FYLA 3G3ZA 2QBYB 2K4JA 1ZHFA 3H50A 4PIZA 1EYBA 3EBRA 3HT1A 3FJSA 1UHWA 1J0RA 1QBJA 1SEFA 2UY9A 3VEPA 2R7FA 2ACJA 3H8UA 2VXZA 4WXCA 3H3UA 4Q48A 3PNAA 2VBWA 4M73A 3E97A 4MTEA 2IXHA 4R1HA 2XLGA 1P4AA 1K6OA 1AWCA 3HTUA 4JV4A 2OA2A 2AXLA 2ESHA 1W5TA 5LEJA 1CX4A 1DP7P 5LHGA 1QNTA 4NQWA 4OMYA 2A61A 1SAXA 5D5UB 5HLHA 4ENMA 1G3WA 4HV5A 5DUKA 3TOBA 1F1ZA 1DGWA 4NVPA 3E5XA 3J7AO 1SD4A 1IF1A 1BI1A 4QGNA 3ZN1A 5EFUA 3DFGA 2CAVA 4META 2D45A 3G7DA 2V1DA 5FB2A 1ZREA 2BNMA 2K7LA 3WTXC 1T6SA 1SQ4A 2PN6A 4CHUA 3NSTA 4YYOA 4LB6B 1KU2A 5D4SA 1E17A 5DDGA 2UY8A 1FT9A 4XF3A 3TDUC 1BJAA 5HDGA 1STZA 5I8SA 3GFMA 3LSTA 2EA7A 1PP7U 1IPJA 2D5FA 5FO5A 1B9NA 3D82A 4O3MA 2FMLA 5FQ0A 4ZYEA 3MZHA 3U11A 3ELKA 1S7AA 4QGLA 3OCPA 1LDDA 3GW2A 1YS7A 2ETHA 3LAJA 3CEWA 2E1NA 4Z2YA 1RI7A 1KYZA 4A6DA 4HX7A 3ZDSA 4UHTA 2EK5A 3J80Z 3DXJF 2VE9A 2OU2A 1FYKA 3G73A 1BOAA 2CW0F 1XCVA 4P5OA 1MJ9A 3S2WA 4L11A 3WU0A 3PLQA 2P6TA 3I64A 5L3DA 3LOIA 3T1BA 1Y0UA 3P9IA 2FMYA 2BBYA 3HIFA 4WXDA 2YX7A 5FPXA 2DW4A 1UD1A 1TQPA 4IEVA 3SFZA 1QGPA 3F8FA 3KCCA 3CLOA 4EJWA 3DQVC 1P4WA 4H0EA 3Q9VA 2GXBA 1J1LA 2HS5A 5LEKA 4PCQA 3QPHA 2VBXA 3HSEA 1U5TC 1HBXG 4M74A 1O7LA 2ELHA 3M7GA 3WG9A 3FXUA 2L4AA 4AVCA 3QU3A 3LZZA 1F5TA 1XD7A 5LGNA 4QMAA 4L18B 1V70A 5L3GA 4U0YA 1HSTA 1W7PD 2I45A 1XMKA 3NRVA 4Q0VA 3FMQA 4EJOA 4G7HF 2Z69A 4IEYA 3T8RA 4HN1A 4HVOA 4KWKA 3GX4X 4XETA 2PYTA 4BH9A 1R00A 1ZZ7A 4E2SA 1UCXA 1UHMA 3EETA 4IVNA 1X7NA 3EYYA 3EQEA 5E8IA 1R23A 2ZFWA 1SD6A 1G3TA 3E6BA 2RV8A 3H7JA 5CVIA 1RUNA 2QVSB 4IEUA 4HF0A 2XGXA 2OQGA 4HVRA 1VJ2A 4IHSA 3GLXA 1XSXA 2YPRA 5FLXK 2FQ3A 2LDUA 3FMRA 2K0GA 1IAWA 4FT8A 5HDNA 3RYPA 4KNYA 1GXPA 3KP5A 2LNBA 2ZCWA 4LMYA 2DO7A 1YFYA 3RPQA 5JCTA 4KDPA 2IC1A 2ISZA 3KGLA 3REOA 3TO6A 4M71A 2DTRA 3BDDA 1Z9CA 3ETQA 1DGRA 1ZZCA 1CAXB 2XHKA 3FZVA 3V8LA 2XAHA 2KJBA 2Q0OA 3O6BB 4MH0E 3JSPA 2OZJA 2EA4A 1HKQA 3KZZA 2IA1A 5K8SA 3NVCA 1YYVA 2VT3A 1NE6A 1KQ0A 4L0YB 2EA2A 2NYXA 3NW4A 5I0SA 1Q43A 3LAGA 1OR7A 3ERED 2XVCA 3RYKA 4MV2A 2ADUA 2MA3A 2P7CB 1PUEE 2AS5F 4IEPA 3ZP5A 2PJPA 4M6YA 3ES4A 4WXHA 5E17F 1IN7A 4ZYHA 2DT5A 3F23A 1TLHB 3ML6A 4PJYA 2GXGA 3U0ZA 1RC6A 3L00A 1YWKA 2H09A 2JPCA 3E6CC 4YARA 1X8MA 2XV4S 3P9CA 5E18F 2HWVA 4UNOA 1OI6A 1ZYRF 1NXMA 2PBIA 2F5CA 3QPTA 5FLIA 1O3TA 3MZYA 3R6SA 2ESNA 4QLCU 2QQ9A 1Z1DA 2PQ8A 3LQRA 4AXOA 1VR3A 4UV9A 1W5SA 2VN2A 4IRGA 5JAXA 3KP2A 3FXQA 3K2ZA 2HJIA 2FF4A 1ZZ6A 1TBXA 3HOTA 4D7SA 4AWXB 3DN7A 2E9QA 1KA8A 4MX3A 5FFZA 4ZU7A 3H7YA 2DPDA 1V3FA 2IT0A 1JE8A 5KHGA 2XASA 1UB9A 1ON1A 2CFXA 2K9ZA 4KMFA 4WZCA 1ZVFA 4RGXA 1NE4A 3KEQA 3HYIA 1OYIA 1ZZBA 5F6FA 2GWRA 1MJBA 4EJVA 4LEJA 4EJUA 5LBQA 2Q8KA 1FP1D 2DK8A 3MCZA 2PI0A 2GU9A 3TDZC 4XFHA 2O8XA 2N7GA 3DEUA 1FNNA 2D40A 2HZTA 2PLYA 5KHKA 3I71A 5EZWA 3W6JB 3K1NA 3QU6A 4L5IA 4YSFA 4BXUA 3CTAA 3T5XA 4EVIA 5LLQA 2KIUA 3VFZA 5F64A 1I5ZA 4ZU5A 4XSXF 4XFIA 1FLIA 1HW2A 5HDKA 3BU7A 3SCFA 3DPTA 5E1ZB 2E7WA 5EEHA 5LGUA 1EPZA 4P9FA 5CVRA 1YW9A 4RB3C 1BI0A 4U0VA 1Q1HA 4LLLA 6PAXA 1S29A 3QRFF 1QWRA 3I7DA 4YG2F 4F8AA 2GAUA 1F9NA 1XGNA 1I1GA 2B0LA 4PGGA 4EJTA 3IRQA 3LFKA 4AQ2A 3BPVA 2GA2A 1K7AA 1DUXC 1O5LA 3T8TA 3QP5A 4PDKA 2EFOA 5D6EA 3U10A 3V8JA 3F6VA 1HSJA 5IT9K 1MDMA 5DCFA 4HW0A 4GULA 2BYVE 3R4KA 4CDGA 1JHFA 1YS6A 3TOAA 2UYAA 4G6DA 4MHGA 2QM3A 4HN0A 3ZN0A 1FY7A 3RKYA 4PGHA 5BPIA 5ICGA 4Z07A 2QENA 4A0ZA 1HXDA 1ZG5A 1BC7C 4FAGA 3SZPA 4N9HA 2C0ZA 1KQ9A 1IZ1A 4KU8A 4EMSA 2A3SA 3COAC 5TJJA 4ENJA 1GQGA 3JAMK 4BAYA 1Y3TA 5CADA 1QO0D 2IXIA 3I4PA 4P96A 4LB5A 2OBPA 3EQLF 5CLSA 2BGCA 3WU1B 4E2GA 2CO5A 3PFIA 3S7IA 4XF4A 1KU9A 5C6CA 3ES1A 2J5OA 5BS6A 1YLFA 4GCVA 4IEQA 2E7XA 1Z91A 1UFMA 3F72A 3SQNA 1TQ5A 4ZH4F 2FRHA 1X3UA 1ZAOA 4RS8A 2Y48A 2EV6A 2PA7A 4LGWA 3M8FA 3HTSB 3BROA 3C1DA 3WTYC 3BP8A 4A5NA 2XL9A 1LDKB 4HBNA 1ZGAA 1CAWA 1BI2A 3BJOA 1PMIA 3JTHA 4L2NA 2IXLA 4QWQA 1O57A 2IW5A 4WF2A 3C3WA 1E2XA 5BXXA 3BZ6A 2FE3A 1SFNA 1OMIA 1V4RA 4U7DA 4UV8A 2IXCA 2ATFA 4A5MA 3VB2A 4WK8F 1P4XA 4IEOA 4LLOA 1U5TB 1CF7A 1H9GA 1FX7A 1D5VA 4Q0UA 4ESFA 3HUGA 2GC3A 2VE8A 4F7ZA 2EFPA 5I93A 4G7ZF 1ZNPA 1DPUA 1JGSA 3ABUA 5KHHA 1O7FA 2FU4A 2WC2A 5JSPA 3KSCA 3CO7C 1WA4A 2P8TA 3MDPA 1CAVA 3ZMDA 5CU1A 1CAVB 1A04A 4IEZA 5FQ0B 1XGOA 1EP0A 2Z5UA 4MQ9F 5ICEA 2F5DA 1ZG1A 2XL7A 4EQQA 5KVRA 3EHKA 2K27A 1HW5A 2M45A 5J6XA 2W57A 4HZFA 4M72A 2UXNA 1QXRA 2QNKA 4RB0A 3WE3A 2VOOA 2KIFA 4QXKA 1J58A 5L3FA 3IKTA 3MEXA 1SFEA 3QP6A 1CF7B 2A6HF 1B59A 2KRFA 1FC3A 4JQFA 3FXRA 4HDVA 2PMHA 5ICCA 2GA1A 5FLHA 5JFRA 2OZUA 3WW1A 4I3PA 3KMHA 1T2KA 3WW4A 1TQIA 4G9YA 4L5JA 2W25A 4L9VA 1OYYA 3EUHA 5EEGA 1H0MA 2Y0MA 2XROA 5BOXA 2P6SA 2FQPA 2CG4A 2M8EA 1R36A 3K1PA 1B1BA 2HQRA 2LF7A 3BWGA 3GZ6A 1Q5OA 3K0LA 3NJZA 4I7HA 1VP6A 2MD5A 4PZJA 3K1MA 2FSWA 5J8FA 2ZNZA 4LA2A 2V6CA 2VECA 1X8EA 4IETA 2IJLA 2ISYA 4HSLA 2QUFA 1RNLA 4KYWA 1LR5A 3VHRA 3CF6E 5KHJA 3H3ZA 2PQQA 5BQTA 1XRUA 3V4GA 3IRRA 3QOPA 4KIGA 4HMZA 1B9MA 3SHRA 4ZZDA 4Q47A 2PAKA 1BN5A 2B8MA 2PG4A 5I0UA 2O3FA 5J3UA 2DQRA 5I0TA 2HKXA 2F4PA 3K69A 4U7BA 3ACLA 4IPAA 2VC0A 1XGMA 3K9TA 4S04A 1UIJA 4Y15A 4H7LA 4TLFA 1BI3A 2H94A 3OV8A 2Z9OA 1T98A 2DPUA 2NAZA 3DKWA 4KIBA 1EH8A 5ICFA 2ET1A 3SZTA 4DQ2A 4P9GA 2VBYA 4MEYF 4N9IA 1D8JA 3IBMA 2QZ8A 1GVJA 3N97A 3BJ6A 1Z6RA 2MNGA 2HKOA 1J9IA 1WI9A 2FNAA 5F1RA 3IKVA 4UXAA 4Q5SF 3KZYA 2K4BA 5BMZA 3GWZA 4XFAA 5E1RA 1RTVA 3MPBA 1TW3A 2RQPA 3HQXA 1IRGA 3HRSA 3RNSA 2D93A 3WGHA 2JRTA 3B73A 4MQVA 1WGPA 4IERA 5K5QA 2P5VA 1LJ9A 3C3VA 5L3BA 1CAXA 1QZYA 2YR2A 1YLLA 2QCSB 3GBFA 4HSJA 3KEOA 1JXSA 4UBHA 2VC1A 4KICA 1L0OC 5LRRA 4OFGA 1QXJA 5D1IA 3CUQC 5ERIA 1J5YA 1R22A 2A07F 2LKPA 3D0JA 3I0TA 4M6XA 1IXCA 4HLYA 2OAZA 3L2HA 3WTWC 2Q1ZB 3VOEA 4GO1A 4CZZA 1YFWA 4IEWA 1IXRC 2PHDA 1ZRDA 1ZARA 2OQRA 1J7KA 4ASNA 2RKHA 4OU0A 1YFUA 2RDPA 3RPUA 3FZ3A 3EYIA 1Q3EA 5HI0A
chains in the Genus database with same CATH superfamily
4CDQB 3DKQA 4I09A 3V42A 1HDDC 3IAPA 1K4TA 4N8MA 1FPQA 2L4MA 5H9RA 4V2FA 4CU9A 2CV6A 2NOGA 2WYFA 4NPRA 3JBG1 4KFCA 1DZTA 3ACGA 2RDQA 4M3EA 1Z05A 3F8BA 1Y8RB 2R7UA 1R1ZA 3K10A 2ZXJA 3HBLA 4IXAA 4YG6A 2IVJA 5K5RA 5CQEA 2YC0A 2EV0A 1AL23 4NC7A 3QWLA 1UOBA 3WG3A 5DAPA 3NNMA 3JCIA 2WY7Q 5FUNA 1H4HA 2HEWF 5JPMB 2UWMA 1UYXA 2Y69H 1SG3A 4CUBA 1UY4A 4OHVA 2IVMA 2GZWA 4XKVA 4E70A 2VPVA 1BJQA 4V2WA 3GTGJ 3DTEA 3ZR6A 3H9AA 4XBFA 1QHDA 1U5TA 2GMPA 5FLMJ 5TSWA 1TNSA 1NZIA 1OQYA 3JRIA 4RR3C 1RIRA 1QJY3 3ZMVA 2D1HA 3OF1A 1KQRA 2WA0A 4DXTA 4HBLA 5HLGA 2JICA 3E5UA 1WWXA 2W1UA 1D0HA 2J1EA 1W0TA 4N43B 3I55I 3MV11 1YQ6A 4RGRA 4PBPA 4QAWA 4L0ZB 4EV0A 3MWMA 2OPWA 3AK0A 1FSEA 4OIRF 4Q4ZF 3H92A 4XHXA 4DBRA 2HWB2 2HTSA 3VBUA 1AR91 2DF7A 3ASNH 4HOOA 1R4MB 3FXOA 3ZMZA 2EICA 4PFPA 2DOEA 3RS6A 1AJKA 4YZ5A 5EZHA 3IAQA 2STWA 1Z7LA 4CP9A 4QPYA 2PMUA 4XCBA 4PLMA 3C2BA 1XE7A 1G9BA 3IWFA 1OLME 2Q8EA 3ZYBA 2JJ6A 3UESA 2BVLA 1J1TA 3FX3A 1PO23 1ZRFA 3PQJA 4MFEA 4PSWA 1EAH1 2E2JJ 3PUHA 2BQPA 3Q0VA 2RS13 5LA9A 3LSGA 4LK0F 3HC7A 3S7EA 4F83A 2K9NA 3OPTA 2CV2A 5FP7A 3PVEA 3TMOA 3K4JA 1B4AA 2WWYA 3RKXA 5IY5H 4ZZLA 4GQ7A 4CA9A 3M3EA 5DG2A 1B35B 4KQ7A 1FOYA 2HLEA 3I2JA 2PHTA 2OQ6A 5A6QA 3BPSA 2ORXA 3KWVA 3RDIA 3AMHA 4FFFA 1AHDP 3HT2A 1ONVA 2QJVA 1I3HA 4W50A 2DOFA 2KT0A 4LA3A 3GYDA 4GFBA 2WNEA 4LQRA 3VZLA 4LUKA 1PIV1 3UGFA 3RRDA 2HNHA 4MXVA 1CJDA 4IQ4A 4QTRA 3HEIA 3EO6A 1HKSA 4YEJA 4XPVA 1S2KA 4J1WA 2YZ4A 5CG8A 4OAZA 3AYDA 2ZXQA 3IDBB 3PTYA 1R081 4NWWA 2LRDA 2EFQA 1ZK8A 4P14A 2ZX3A 5I91A 4XFFA 2ZX0A 1L7LA 2XBO1 5HOOA 4H3WA 2O6GE 1GQPA 4IUGA 4A3LJ 5FRMA 5SV8A 3PIJA 1RMU2 1OCTC 1F4KA 1X9TA 5B66C 2BV4A 2A5YB 1ULCA 1XX5A 3BCWA 1DU3D 4IE6A 3OYJA 4KIFA 3H1WA 4CE8A 1W1WE 3IDAA 5FZOB 3GTPJ 2K3FA 1H0BA 2PHFA 2Z33A 3JRBA 4C8DA 2G9WA 4XN0A 3GDBA 1RIOH 3ZSEA 2UV1A 4K9SA 2HWF1 1W8FA 3JSOA 3SDBA 2Y6JA 3QH6A 5DCMB 1VRH3 4AL9A 1WQ2A 4XUOA 4AG4A 2JTVA 4ANJA 2XPJA 3CDZB 1O3QA 4NAMA 2XVKA 3U1DA 1FX5A 4N53C 5FZDA 2GDFA 3HSFA 5FFXA 1IXSB 2OTLI 3E3VA 3O1TA 5C4WB 2HGCA 2GNMA 1UMHA 1Y8QB 1NK3P 3K77A 3CUOA 3WD5A 4LHLA 5AC93 3S3MA 2WWUA 3JW4A 3AL5A 1YI9A 3QYBA 4FI9A 3RI9A 4KT6A 1FPN2 2VOVA 2QQAA 2K46A 3KLNA 4HSTA 2XXZA 3IC7A 3HBKA 3J9SA 2XRNA 4QX7A 1W90A 3FBNB 1K78A 3UKVA 1HOMA 2R1BA 3NWTA 3CQOA 1SVMA 5GKAC 3RI8A 2EFWA 1LEAA 4ORFA 1NCQC 1BR4A 3IV5A 2CSOA 1HB4A 4LIUA 5F2WA 4C2MJ 4J1XA 3AZWA 3M3QA 3CL1A 3ZQQA 2M3AA 2UXXA 1G3YA 4MXWB 1LHOA 3OYGA 3AKRA 4CCLA 3I2HA 2ZAHA 4DXSA 2BZTA 4B3AA 1CVNA 4M3FA 5C3EJ 1V6KA 5BY5A 4JDOA 2E53A 2IS4A 3FKIJ 4QKFA 3IL2A 2IXSA 3R0JA 4YNIA 1QEXA 3KCYA 2B9SA 1WMFA 4Q1PA 5L73A 1UZCA 3CBNA 1GU3A 2WO1A 2EIGA 5LBEA 2Z99A 2XAQA 3LQQA 4QU1A 1CPMA 3FHNA 4LUMA 1E5SA 3DECA 4O7XA 1P6RA 5DS9A 4FTEA 4D7YA 4YG0A 4MGIE 5JR7B 4EM2A 1NZCA 2G9ZA 1POQA 3FHIB 1WD4A 4A6SA 4G7OF 4AHXA 2NRAC 1PNGA 1GQHA 2CYYA 3Q0WA 2WUHA 3HM5A 3C18A 2GC0A 2JDHA 4LITA 2NVTJ 3T0AA 5BNNA 3ZFGC 4Y5SA 2QQ8A 2O1QA 3RJPA 4EM1A 2ERFA 4A12A 1J75A 2HPMA 4MOAA 3ZXJA 1R7JA 1FOD2 1YQCA 2HBTA 1YUDA 3JRFA 3OGVA 3BY6A 2WV1A 1WSUA 2BFUL 2PFBA 4NHMA 4E7SA 3CHXA 4M0HA 2DA2A 1AR82 4IE0A 3DGTA 4NB5A 1JHHA 4XFGA 5DQ0A 4B09A 1JOJA 2R16A 1OXCA 5ILVA 4FTHA 2YX4A 5JHFA 4UFJA 1QPIA 2VG9A 1TNTA 1V5EA 1GMMA 5A80A 3DCQA 3U14A 3VHPA 4LBNA 4H14A 2WT1A 4JKKA 3TN93 2CUJA 1WZ2A 3UKGA 4XOGA 2FJ1A 5BNQA 5C70A 4OINF 2ZGTA 2ZSIB 5LHHA 4QB1A 4BUPA 4CICA 2Q30A 3GEZA 5FUPA 5AVAA 2VZVA 2ZX1A 4B1RA 5GTHC 1E0EA 2KXLA 4RS5A 1YI2I 2ES3A 3BPZA 4RB2C 3HOYJ 3IMMA 5HS8A 1ZH5A 1SCRA 2WO2A 3VBOB 1FXZA 4LBKA 5HS9A 3AFKA 1V0AA 5F0HA 4N7UA 1A34A 4JBAA 4X6QB 3SCHA 2R49A 1QXPA 1RUE1 3HN1A 3RZLA 2ZX4A 2RDNA 2A5ZA 2M5WA 1SVLA 3AP5A 4AGRA 4E7KA 4CGZA 3QOEA 3DPLC 2AQFA 2DDUA 5FLVA 2R7VA 2BOLA 5IOYA 3AYAA 1YFHA 5FGMA 5JR3A 4H7MA 3S32A 2XKOA 4BQ3A 2DQLA 2BE5F 4QX1A 3I2DA 1PVXA 4A3JJ 5DDJ3 4XJWA 4UOJA 4YM2A 4D5CA 1W4MA 2RGVA 3ECHA 2NOJB 2YY1A 4CXFA 3CZ6A 3KETA 4XDOA 1MZ5A 2ZOEB 5CIRA 2BERA 4LBLA 4NHJA 1ZA4A 1OKRA 1LEMA 4MGKE 1MDMB 5EJ3A 5EEAA 1I6HJ 4Y17A 3J81K 4RQPB 2CQXA 5FZMA 2M1BA 4BB3A 1Y0NA 2OPTA 1RZ4A 2WN3A 2PHWA 1JZ6A 2MEV2 2G7UA 1SDDB 2IA0A 5DEQA 4DMIA 3UKTA 3S3OA 1Q8SA 5JOXA 5BUVA 5EWSA 2V9VA 1RB8G 4AI1A 1TQMA 4CDUB 4HNTA 4LR4A 3JBG3 2ZMEA 1MD0A 2A3YA 1NT0A 1DPRA 2X10A 3AVRA 1D4M3 1P7IA 5BNPA 5JI6A 2CDOA 4JTOA 4XR6A 1UIKA 4OMDA 2MABA 4E8DA 3LA2A 3PFYA 4G8XA 1IN5A 3BTLA 1GXQA 2DFIA 4YFKF 3H5NA 5JSOA 4YIFA 1O3SA 3BI3A 3CUQA 4D69A 1YW8A 3ZXDA 1S7OA 1QJFA 2VQHA 3H1CA 1HN0A 1X2NA 4HAMA 4JQTA 5FYBA 3KT4A 5AIQA 4JKLA 4C0HA 1RUF2 4AD9A 1B8IB 2J1TA 2E34A 3OOXA 1IV8A 2ARAA 1F43A 3IDCB 2XJPA 1GZWB 1GUUA 4RGUA 3SXYA 4CYCA 2D5HA 3CD6I 1EY2A 3KF3A 5C3OA 2IA2A 2HR3A 4EM0B 3AG1H 3U1KA 4XSZF 5A33B 3S0MA 1C8M1 4AQ6A 2PAMA 3M9AA 5DUVA 4XLHA 4FAHA 3QACA 2IS6A 5G04L 5GLZA 4QKDA 5DUUA 2X4HA 4BACA 5E1WA 1RVF2 4CPBA 3AMPA 4LBMA 2YDEA 3CCRI 4B29A 3IH2A 2WYSA 1PVC3 4AAPA 5K5OA 5DD4A 4GH4C 1ND3A 1HRV3 2L7ZA 1J83A 4HL0A 2P6CA 3A21A 2L7KA 3VBRB 1YOVB 1Y9MA 2L5QA 4TYSA 4A4AA 2Z79A 1ND2B 2FDHA 4WVZA 3AKQA 2WY8Q 3S2HJ 3HPGA 3P3PA 3IHUA 1R5GA 1PHMA 3VV1A 4NUBA 4XAEA 1CAUA 3DL3A 1W6QB 4ZC3A 1VNDA 5APAA 5A7SA 1QNYA 3O0WA 4GWJA 3Q0UA 3BTJA 3WHCA 3L7WA 3WE2A 4HPKB 5DN2A 3R61A 3GHMA 2PLV2 2W84A 1R092 1ETWA 1A5JA 4AVZA 5IK5A 4GAZA 1TTYA 3A1YA 3TN91 4AYUA 1YRNA 2VCBA 1YX5A 3M70A 3BG7A 4GYIA 3BOQA 3F8CA 3B02A 4QPOA 2DAOA 4WVMA 1W2OA 2JD9A 2OA4A 1NA1A 4NRMA 3GTJJ 3RMXA 4LG0B 5AONA 2IBDA 1X9PA 3S17J 4GXOA 4WM7C 1RGSA 2L02A 1ODDA 3ZYIB 1WH7A 4B4PA 3B6CA 4BQAA 2R0QC 2VU9A 3NJXA 1AUYA 2JG9A 1SFXA 1QOOA 4D6QA 2TCTA 1LHVA 5FY9A 4CP0A 1SFUA 1H9TA 2DBIA 5FUIA 2BBAA 2A75A 1F4AA 1G9DA 5E79C 3CO6C 2VZQA 2QDRA 1KYWA 1GLHA 5IP7J 3ZSMA 2JG8B 2D6OX 2YPJA 4M3CB 1VZ0A 5IPAA 1DF0A 1R64A 3RZHA 3J7HA 1W2TA 4FX4A 2A70A 3DPRA 2QBYB 2DDBA 1TNRA 4PIZA 2VM9A 1EYBA 1WKYA 1COV1 4CA0A 1J0RA 2YUSA 1QBJA 2QF7A 4U87A 2ZEZA 1X3ZB 2NVUB 3SEQA 4YGBA 2R7QA 5IYBJ 3H8UA 3THPA 2OW4A 4MTEA 2QCOA 1YQ5A 4R1HA 2XLGA 1Z77A 3ACHA 2OX0A 1T6BX 4JV4A 2OA2A 5ACA1 3O1VA 2AXLA 2F6CA 5LEJA 1RC9A 5LHGA 3OR1C 4OMYA 2JX9A 3BQZA 3CCMI 2QBXA 3WNKA 1RJ7A 3ZYRA 1QRYA 5DUKA 1F1ZA 1DGWA 1VBA2 5IP9J 3H0DA 4NVPA 3RWNA 3J7AO 1UHSA 3UYJA 5T55A 4OWRB 1JJ8C 5DAWA 5GLTA 4IZZA 1B35A 3G7DA 1ZREA 4KBZA 5K0UA 5JZGC 1T6SA 4CHUA 3NSTA 4NRQA 1YYNA 3WDUA 5D4SA 4IQJA 4XOTA 1BK0A 1OVSA 1JYXA 2UY8A 3DCFA 1XG1A 3TDUC 3J4UH 2EIMH 5HDGA 4OMCA 3POEA 2EA7A 2RDSA 3B94A 4Y26A 5FXWA 1B9NA 1UG0A 1VMHA 1CQ9A 3ZKYA 4EYUA 5FQ0A 3L2WA 4P9XA 4Q4W2 3ELKA 1F4HA 4BY1J 1IRZA 3LAJA 2E1NA 4Z2YA 5FMDA 3OGGA 2XAUA 4A6DA 3ZDSA 3JRGA 2EXJA 1KONA 3JBG2 3J80Z 2VE9A 3SLIA 1DHKB 2YS9A 2GSYA 3G73A 2CW0F 5J4YA 3ZCOA 4Y4RA 1Y0UA 2FMYA 1OFCX 4WXDA 3WU2C 3NMBA 1UD1A 1TQPA 4GWMA 1QQP2 1QGPA 2RM23 2WQZC 4NHLA 4OI1A 4HNUA 3LL7A 1P4WA 5LW9A 1YITI 4H0EA 3H8XA 1DU6A 5JOYA 2V4JC 1J1LA 1BKZA 5LEKA 1DP3A 1WGXA 3WNLA 1H30A 1W9TA 2ELHA 1FMVA 1LOFC 1M06G 2K40A 4M4RA 1G7YA 2MFZA 5J96B 5LGNA 3IPVA 1H2NA 3A2KA 4Y22A 1XYOA 3DLAA 4Y7NJ 3F9KA 4XILA 4NQWB 3T8RA 4XETA 1ETXA 1R00A 4NC8A 1ZZ7A 3BR0A 4NDLA 3CJRB 1LJ7A 4PQQA 1QJY1 1VQ9I 2P4EA 4IVNA 3OSFA 3W21A 2JWTA 4Y5Z0 2WNUB 2VQUA 1BQPA 3M3CA 2ZFWA 4N4OB 1G3TA 4PF5A 1N25A 1W9FA 1E5IA 5AFBA 4XLEA 2ZGOA 3BTIA 1RUNA 4GWNA 4LHKA 2QVSB 3PUAA 2W95A 4MVTA 4HF0A 2XGXA 1AKHB 2FQ3A 4DJAA 4JC1A 4KG8A 4UFIA 4FT8A 3IPVB 5KC6A 5LBFA 4PDWB 1FJLA 3ZO0B 1T33A 5CYYA 2ZCWA 1CIYA 2HYKA 2OS2A 2VIXA 4FPFA 1ZBA3 1OCOH 2IFRA 4LMFA 1MS3A 1WMDA 1QJU1 1OISA 3TO6A 2QUOA 5F3IA 1FNYA 3BDDA 3PU8A 2VJIA 3V8LA 2XAHA 2KJBA 2Q0OA 4XQDA 4MH0E 3JSPA 1S72I 3BTAA 2ARCA 1ZBA1 2EA4A 1MMGA 2IA1A 5ERLA 3WF4A 5LFAA 5L9VA 4L0YB 1N47A 2X5IC 3D8CA 3ECQA 5IVFA 1NTCA 3LAGA 1UX6A 5C4XJ 3UR3C 2OC6A 1HCRA 1GP5A 1PIV2 4MG2A 1NG7A 2JECA 4MV2A 1W2UA 3BR1A 3ZP5A 1OLTA 5F7UA 1FMD2 1CZSA 3F23A 1W06A 1CWPA 1QVTA 4FPCA 2KDZA 3A0NA 5LBCA 2BJSA 2C9KA 4BQNA 4W6XA 3AFHA 1TWFJ 2QFEA 2LR8A 5FZ9A 1LECA 2FDKA 5HNHA 2GOXB 3VUOA 2OV7A 4UNOA 5L19A 1NXMA 3C7FA 2FD8A 3LKJA 3R6SA 2VW0A 1VRH2 2LD5A 4PT6A 2QQ9A 1Z1DA 3ABKH 2QA4I 4UV9A 1NX9A 3GGLA 1V6IA 3L2YA 2VN2A 3OOUA 5JUVA 2C6SA 2X6OA 1URXA 1JMUB 2LM3A 4LBQA 3HOTA 4D7SA 1C1LA 3ORJA 2E9QA 1AR73 1XS9A 1S0IA 5IW0A 2IT0A 2X53S 4XZPA 3IP4B 1UB9A 1ON1A 2CFXA 2K9ZA 4KMFA 4KGGA 3IT8A 2EBIA 2XB5A 1ZVFA 3FKJA 3CMAI 4EJVA 1P8JA 5EJCA 2C26A 2RM22 2P34A 3FLRA 4J01A 3DYOA 1FP1D 5IHRA 4FXKB 2DK8A 1DQ6A 3MCZA 2GU9A 3TDZC 4CP1A 1W6PB 2PQSA 4C9YA 5IVEA 4P9WA 3DEUA 2D40A 1R49A 5K7HA 4OHYA 2PHXA 4YSFA 3I3MA 3CTAA 3T5XA 2GMMA 2WAEA 1GUIA 1I5ZA 1UMZA 5C71A 2VZSA 4ZU5A 3T3YA 4NIAA 2D6KA 2VD7A 3OYDA 1VBE3 4PLOA 3O8GA 2A6XA 3SCFA 4FCAA 3DPTA 4FISA 5EEHA 2W0XA 3NV1A 2ORZA 1Q1HA 4LLLA 3K4KA 4EN7B 2Y34A 2VNRA 1QWRA 3I7DA 4LNVA 3RQIA 2GAUA 1I1GA 4LBQD 4RHV3 4EJTA 3LFKA 1YRNB 2BZDA 4BLIA 3GJAA 2GA2A 1K7AA 5IAXA 3QP5A 1XU1A 1UY1A 4IGOA 1SHWB 3WZ1A 2EFOA 1PVEA 1AXKA 3THCA 5AFEA 4FFHA 3SDGA 3EYPA 4XMYA 5IT9K 5DCFA 4A3EJ 3QPSA 3FN9A 3S93A 4CDGA 5M5XJ 1A31A 4Y24A 1MEC2 2VXRA 2VXJA 4YVSB 1P7JA 4BA6A 2GXAA 4RA2A 5ICGA 2R071 5CG9A 2VW1A 2Y2ZA 2HOSA 3R4SA 2V9PA 3SZPA 4XJ9A 4EMSA 2A3SA 3COAC 3QH7A 4ENJA 1GQGA 3AKZA 4BAYA 4XACA 5BNNC 4ZXKA 3NJYA 3I4PA 4M0NA 3S3NA 3ZR5A 3EQLF 1RXGA 2XVLA 2CO5A 1CPNA 5FPUA 1WCKA 4XF4A 4ES8A 1B35C 1X1AA 1ETYA 2VZ1A 1F31A 4F91B 4LXLA 2J5OA 2AEZA 2DXIA 2Z4FA 1D2SA 2MSYA 2KZGA 2EILH 4IEQA 1MQTA 1Z91A 1QU3A 4Y1ZA 3F72A 2NMNA 2FRHA 4RS8A 5FZCA 3CP8A 2ZGQA 1D1BA 3BROA 3QYEA 3VPRA 2ZGLA 1RKWA 2VI6A 2M4KA 1Q8VA 1LDKB 1ORKA 4W97A 2ZZJA 2EXHA 4UWDA 2V1NA 3ZRGA 1ASJ2 3BJOA 2HVRA 2E51A 4QWQA 2YUEA 1V9U3 1RUH2 2IW5A 3T2TA 1SFNA 2EIEA 2DA7A 4U7DA 3Q8EA 3MPPG 2IXCA 5FY4A 2ATFA 4COUA 2JVGA 2E6VA 3DXUA 5ABJB 3N7MA 1FX7A 1D5VA 2OUMA 3HUGA 2GC3A 1PMJX 2YBSA 4FP2A 2VCCA 3RQ0A 1DPUA 4P02B 1RUE2 1WJDA 3CF2A 5JXIA 3O1PA 4QQ2A 3SEPA 1WA4A 2JB4A 4KG0A 3MDPA 2QQLA 3FHQA 5CU1A 1EAH3 1CAVB 1ZR2A 5GM0A 3TBDA 5CKQA 5FQ0B 1XGOA 3GTMJ 3WNOA 4OI0A 2X6XA 1ZG1A 4QXHA 2XL7A 4EQQA 5J6XA 2W48A 4DXZA 5F0FA 1QXRA 2R7EB 4U36A 2NM1A 5L3FA 3QP6A 2LFBA 3H0GJ 3FXRA 2B39A 3RZMA 3VBFC 4G6TB 3DU6A 2ZTNA 2LG4A 3WW1A 4I3PA 2FZ1A 3RSNA 1TQIA 4L5JA 2R5ZB 1OYYA 3EUHA 3ACFA 3O12A 2X29A 2P6SA 2KZVA 2FQPA 2CG4A 4XRSA 2I74A 3NO8A 1VP6A 2MD5A 5F5IA 3K1MA 1VQ4I 1JTYA 5IATA 2V26A 2ZA9A 1X1PA 1NQJA 1EV13 1R71A 4KYWA 2VLAA 4DZGA 3VHRA 1QJU2 3PO2J 2Q5TA 2BW3B 3H42B 5A1LA 2J1UA 4PDWC 1B9MA 2AXTC 2MYSA 1KD7A 5F1JA 4ZZDA 2PAKA 2Z16A 4N4NB 3I2IA 1UX7A 3K69A 4U7BA 3KX2A 2RR12 3CF5F 1JT6A 4XJAA 2DTZA 2H94A 5IOZA 3A0HC 2DPUA 5M0TA 4Y4YA 1EH8A 5ICFA 3VBUC 4S2DA 4FQZA 2VBYA 3WXPA 1D8JA 3IBMA 2QZ8A 3BJ6A 1US2A 4AEKA 1WI9A 2V4VA 4IDZA 3RZDJ 4HK9A 2FCVA 1ZRIA 4XUNA 1S0GA 3MV01 5IFTA 1RTVA 1NCRB 1LTEA 3M4FA 2RQPA 2NS8A 1R6RA 3BKZA 1RITA 2R072 5JIAA 4ARYA 1W6MA 3OPWA 3WGHA 2KMUA 3R4DB 1QH6A 3AXEA 4DNYA 2P5VA 1X36A 1DQ1A 2AUYA 2D98A 4BEHB 1YE9A 3NAPA 2X05A 3KEOA 1JXSA 4UBHA 4KICA 1L0OC 3WG7H 1QXJA 4Z2AA 5ERIA 3CMGA 3IH4A 4A3ZA 4DYCA 4A3CJ 2QQWA 1HRV1 1SLAA 1JU4A 4GO1A 5FXVA 4CZZA 4EN9B 4Y52J 2W1WA 1JXNA 4HFSA 1IUFA 1MACA 1A3KA 1ZRDA 2ADDA 3J7MA 5C4JJ 2MEV3 5E3NA 1YFUA 5KWRA 2L9SA 2BRTA 1Q3EA 4BDYA 1FV2A 2LMDA 2P2KA 5HI0A 3SH4A 1XE8A 1JT0A 5E8GA 4GB33 2IUWA 4LKSA 4GB31 2QQKA 2W2IA 5FV3A 4A6OA 2IGOA 4NIIA 4BOWA 4XDQA 3S8PA 2F6BA 2J42A 1W6NA 3OEBA 4AUXA 2WAAA 1NHAA 2RM21 5JR2A 2Y6GA 2FDJA 4HK8A 4M6VA 2XQXA 5A6XA 1H2MA 2H8RA 4RFT0 1D8KA 1IS4A 4EQVA 4PI0A 4HVQA 4AVPA 4XIDA 1YXWA 5FYUA 1LE8A 5FDBA 4YG3A 5KXDA 3ISPA 1JHNA 1OFNA 2B63J 1LOAA 3T0BA 3P7NA 4BQ5A 4ARXA 1T95A 2XJRA 2ZHLA 3HRMA 1ZZ9A 1YJ9I 4Q5OA 1MBKA 4OI4A 2XGEA 4BQOA 2E5ZA 5DM6F 3RGBA 1XYNA 2AZ5A 2V72A 2ZMNA 3X2QH 5J7MA 4QM9A 4TTGA 3KVBA 5JLXA 3J80K 3LEKA 4RA0A 5TRDA 1NA1C 3LPFA 4W4ZA 2CGOA 3OB8A 1D5YA 4L5EA 3OY9A 2D3RA 3NJVA 5FYVA 5F5AA 3TNPB 2JD4A 1NLRA 2VVEA 5J36A 2ZSHB 3ZYJB 3TWIA 3ZQLA 4YVWC 4KU7A 5EG0B 2UZKA 3EUAA 5L7OA 1YO5C 2OD5A 1RUJ3 2WR9A 3CC4I 2WSVA 1W0UA 4D7MA 2DCJA 3V65A 1ZLJA 3SZGA 2Q8OA 2WNUA 2YV8A 1MIJA 3EJKA 4QIWN 4Q0SA 4K1ZA 3LQCA 3GO5A 3CO2A 2QKMB 2JG9C 4AF9A 1UN1A 5IK4A 3U4XA 2JSCA 1V6LA 2VW2A 1GANA 1FAYA 5D5VB 2DVGA 3DYMA 3NWSA 3POSA 3VDDC 3M3YJ 2RS32 5FKNA 2X6YA 1UZWA 1G2HA 2O8QA 2P17A 2IFWA 1BIAA 3USUA 3BG6A 4BHPA 1T2XA 4AVAA 4ON0A 1N75A 1W8HA 3OS0A 3HDDA 2IS1A 1WH5A 3JD71 2HWE2 1OOPC 2XUBA 2D5VA 2WBMA 1VQ8I 2LKXA 1SMYF 3W2WA 1NK2P 1FATA 3TN92 5JPNB 1L7RA 5GZGA 5IYCJ 5ILUA 3O7OA 3BJAA 4HANA 3SYTA 3NKTA 4BXSV 1H6XA 4E7HA 4U2AA 2EV5A 2ZMLA 1MQTC 2R1DA 4Q4X2 2VZTA 4HLXA 5FRNA 1DQ0A 4YVSA 1B72A 3V7RA 4AYBN 2WTEA 2VMIA 4AI0A 3K4BA 5K7FA 2YFUA 3U1XA 3ZPLA 4UXNA 2LRPA 1B09A 3QYFA 4Z1VA 2ZKNA 4CSWA 3ROUA 5A2QZ 1M1EB 4OMZA 4JAAA 1WJEA 4XOPA 1Z21A 4MGYE 5FIXA 3DWLE 1U6GA 1AYN2 2XJUA 4HQEA 1QQP1 5HCFA 1YIOA 1CAUB 3WDVA 2VONA 1SMTA 2ZO4A 1MZEA 3I3LA 4K40A 1WMEA 3C2UA 1ZA7A 1XTAA 1N3QA 4N0BA 4XLNF 1SBFA 2LUWA 4XKBA 1SD7A 4YIRX 3LSHA 1RVF1 1LVAA 1BR2A 3JTGA 2KIQA 3LMMA 3GMEA 3M4OJ 3B3QE 2AREA 2ZMKA 4MGQA 3DEEA 5H9QA 4JGZA 1QQIA 1I3QJ 3I54A 1RUD1 1MZBA 3VD9A 1UZZA 4AFAA 1U0AA 3LCPA 3WVJA 3WDTA 5IT3A 1EF4A 2GNDA 4FOQA 2I07B 2FXAA 2MHFA 4A3DJ 1W9YA 3CJTB 1XSDA 1U9OA 1LKNA 4Q4Y2 3M1EA 2R062 2VASA 3VBSC 3LB9A 1W0OA 2AEYA 3NV2A 5LK5A 1W39A 1TMF3 3AG4H 4BMBA 1JUSA 1PM7A 5FMOS 2E2HJ 1AX2A 5I8TA 4EGZA 1WKMA 1UKRA 2Z3YA 2QTWB 1V00A 5AVPA 3ZQGA 2NS0A 4A0XA 3Q9SA 2HWF2 2O5RA 3K4DA 3I2GA 3VL9A 1RUC1 3WGGA 3WOGA 1TVGA 3MMYB 2EJRA 3FWEA 1NLSA 4EZ4A 2JK3A 5J4VA 3A03A 2KP6A 2ZKZA 4I0AA 5FZ6A 1HKTA 4KWLA 2HOEA 4RFRB 1UMQA 1W8OA 5FBZA 2L54A 1TG7A 3FUOA 3ZOBA 1QJX2 5EV7A 5D5XB 3OIPA 2XWJB 1J59A 4FP3A 4IEJA 1IPKA 2EQRA 1HV0A 3RQ4A 4WCGA 2A3XA 3IIAA 4LK1F 1ZG3A 4XLFA 1LFBA 3WQBA 1FP2A 3ZX7A 2VBDA 5HV0A 5FD5A 3MN2A 1WMXA 3W5MA 2Q2EA 2XUEA 1U3EM 4XF1A 3THDA 2WNVA 1FPN3 1ND2A 5DPNA 3GTQJ 1FMWA 1FBUA 3F0CA 1JOPA 2Y30A 3ECOA 4DFSA 2VKHA 2L9NA 3VSKA 2OIIA 1G8WA 1JH5A 3KV5A 4FCYA 4ZXEA 3FFZA 2CDPA 3I58A 1UCRA 4JDMA 4KL1A 5JXGA 3H9GA 2DBBA 2BW3A 1ULFA 5C9AB 3P1IA 3CDHA 2BW8A 1O59A 4BCUA 5EF6A 4XURA 3AP9A 4CDXB 4EGYA 2QWWA 5T52A 3VD4A 5EJ1B 3CDLA 1PVC1 2HWB3 2BFUS 4CDXC 2TDXA 4QPIB 1JU3A 3LAPA 4ENNA 2L9LA 3I2OA 3NNGA 1GHCA 1AYN3 1Z6TA 2DN0A 3DUIA 2M4GA 2PHLA 3OYHA 4PJJA 3RZOJ 1UAAA 4OIQF 1IDZA 4HA8A 4JP0A 1BM9A 2QVOA 3FISA 4AFCA 2YYOA 2R3SA 5LA1A 2BVVA 3KE2A 5DCMA 5A2QK 2PLV1 3ELNA 3B5LB 2GQQA 1W6QA 2JA2A 2X1EA 2XRLA 4XFBA 3POJA 3HOZJ 2B9UA 3V7SA 2XAGA 3W3CA 1MPXA 1GWKA 3VBOC 1ND3C 4NR1A 4AIJA 3L9FA 2L9RA 2FBKA 2EH3A 3ZXKA 1AR81 4DUWA 2XAJA 3CJXA 3P9KA 2ZFUA 3GALA 4JGZB 4XN3A 4GWIA 1ZR4A 4P5YA 4ZS2A 2G7HA 3NNJA 3WP5A 3M2MA 3AFGA 3HR9A 5ISLA 4FBFA 1OCRH 4A42A 2MBFA 2R7TA 2VOPA 4KWJA 3LDKA 5G05L 4KJZA 4JYKA 1KITA 2R063 2M7BA 2RS11 1HV1A 1X1CA 2MGQA 3UGGA 2JUGA 4CUGA 4BHBA 4CYDA 1YTYA 1PDNC 2X5IB 3O1MA 5C44J 5T5PA 3ILNA 2P4WA 1RHI3 4B8EA 4DY3A 4RLFA 1C28A 5HNFA 1G3SA 2B5HA 2Q0AA 2V9KA 1UPIA 4W1UA 3OYMA 4YZ2A 3JB8A 1BVVA 2CQNA 3ZQ7A 3H0OA 3WNNA 2M87A 1LDJA 5C8CC 1PYVA 3OYLA 2ZMEB 1HA8A 2A6TA 2XAFA 2QBYA 5AC92 4HX8A 5H20A 4Q4V1 3GBGA 4Q29A 3MKYB 3TQNA 2CTVA 4KI5M 4QGMA 1USTA 1H1IA 1VLNA 2RC4A 1H2LA 1NYWA 3AJYA 2B9VA 1BEV2 1DDLA 2RS53 1FI2A 4AIKA 4HG2A 1MR5A 2WIIB 4JOMA 4BE3A 3IM0A 5T5LA 2GBYA 4TSVA 3AAFA 2WZEA 4NE9A 1K83J 2Y0SN 2MPFA 4DNCA 4RGKA 3T2PA 5JI7A 2H6BA 1WPKA 5DYMA 1W8UA 1ITYA 4ENKA 5E3OA 4AEJA 1IS3A 2VUDA 2VCMA 1DQ4A 3MIDA 2D1VA 3VDXA 2FZ2A 2IXJA 1KJRA 3THTA 3K46A 3IIIA 5JZGB 2VVDA 2IVIB 2WJSA 4L9TA 2GOMA 3S16J 5L3CA 4R4XA 3VDAA 5DUIA 2W87A 4C1XA 3QD6A 2CQ7A 5JOZA 4XVHA 5B5EC 4Y3OA 4NMIA 1BEV3 2F5FA 2VPRA 1ZGJA 3LIHA 1F15A 2QQMA 5LASA 5CVJA 5FO8B 4A0YA 2X0LA 5E3MA 4IEXA 1T39A 2L01A 1EH7A 1RKTA 2B7EA 3CCYA 3R4UA 2OCEA 1GZCA 1SPPA 4I0BA 3CCEI 2FNPA 5KHDA 4NRPA 1W9WA 4IKFA 1R5HA 2YSRA 2ZX2A 1HF0A 3ABTA 1LU1A 4UYBA 5FR3A 5EXOA 2A5WA 1K6YA 5JSRA 3VKOA 3OYBA 5FREA 3IWZA 2HEOA 2G9FA 4XF0A 5GLUA 1H2KA 4WBBA 4PCRA 3A02A 2H0VA 1IN8A 3NARA 2BUKA 4FE4A 2EFNA 4B47A 3CJIC 3CDIA 3OYKA 2JEMA 1AR62 4WVMB 2VMFA 1HQWA 4HDUA 1CD3G 2VKVA 1VBA3 1E5RA 1WBLA 3GYHX 1B6AA 1KU7A 4FX0A 2RNJA 3HOWJ 3U2RA 3TO7A 1FMD1 3SH5A 2O7OA 3LOBA 3K48A 1RHI2 1FOKA 2AHQA 3JRHA 1UXZA 1EUUA 2YC4A 3KP6A 3GF2A 2MLKA 5FCCA 4GMP3 2BXZA 3DBHB 5DV5A 2F5EA 3JU9A 3QODA 1QJX1 3D1NI 1ZRRA 4DO0A 3LE0A 4BM8A 3SITA 1REFA 5A7PA 5LBBA 1RINA 2W24A 3MGUA 3Q8CA 5L9BA 1A6IA 1R1VA 2B42B 4CDWC 2GC2A 3PUBA 1BC8C 3W58A 4AC0A 2V73A 4TWTA 1Y7BA 3O5SA 2P5BA 1BYHA 2DUQA 4R9BA 1PK6C 2ZHKA 3Q8FA 2DVBA 4CO8A 4AAXA 1GOGA 4AFBA 1FIPA 3GCXA 3M8EA 5BPXA 2DCYA 2P3JA 2WINB 3GF6A 3A23A 5F5CA 2EVXA 1K3IA 1SZBA 5GPAA 1UAIA 1W8NA 1LOEA 1WZXA 3TEXA 3I3EA 4DYRA 4LLNA 3AP4A 4IRIA 2DU9A 3JD73 4K2EA 4RAYA 4QX2A 2D2WA 2QKLB 3OD0A 1IOAA 2ADEA 2BEOA 1GNHA 2VQCA 1PM4A 1O8SA 4XF9A 2VMEA 3ZXSA 3INAA 4IRHA 3R60A 3TW6A 2DVFA 4K8RB 3IH3A 4EWEA 1P92A 4FQ4A 3F3XA 5B1BH 2ZMEC 3EPZA 3BLYA 4Z92B 1MS0A 2KISA 1Y43B 2VBPA 3H50A 4X8NA 1ALYA 1VQ5I 2AENA 4EN0A 3FJSA 4FOWA 4UW3A 4BU2A 1SEFA 2R7FA 3AL0C 1UY3A 3VSLA 3HGYA 3BOPA 2VXZA 4K6BA 4R9DA 4N90A 3PNAA 2VBWA 2W4SA 3CCLI 2ZJPF 4MHUA 2XSDC 1XXNA 2ESHA 4HRIA 1LEDA 1CX4A 2KA3A 3WQ7A 5FKBA 1SBDA 1WFXA 4N43A 4QXCA 2A61A 3VD7A 4AI9A 5FZ0A 2HI3A 2Z5WA 3APBA 1OOPB 2R061 1H89C 3OL3A 3TOBA 1OJLA 3ZDVA 4AYBA 5IWFA 2OUJA 2GNBA 5A32A 3N9QA 1RUD2 3NV4A 4CYCB 3NAPB 4DBQA 3ZN1A 2XH6A 3NAPC 4JX4A 4QPWA 2R0HA 2RDRA 2BNMA 2JXAA 2K7LA 2PN6A 3QBQA 4YYOA 5FOJB 5FPAA 4YZ1A 2R6QA 4LB6B 1KU2A 5FP8A 2E63A 1IS6A 5DDGA 4EE2A 2EF6A 1MS9A 1FT9A 1F35A 2GH8A 3PIGA 2M2EA 1WJFA 1D4M2 3CCQI 3X29B 5I8SA 3PSIA 1WBFA 3WNPA 2ZEWA 5GZEA 1PP7U 5M3MJ 4FOYA 1IPJA 2V5DA 2D5FA 2WSUA 3JRDA 4IX7A 3JR9A 5E89A 3TP0A 4OHWA 3V0AB 2FMLA 4ZYEA 3MZHA 3TEYA 3OIQA 1LDDA 1WCSA 3DTKA 3GW2A 1YS7A 2ETHA 1ERDA 1D0GA 3RZJA 1KYZA 1JZ7A 2RR13 3ZYPA 3A4CA 4UHTA 4XQ4A 1AYN1 3OYFA 4XIKA 5GALA 5GTIC 3C8XA 1QIQA 1QOTA 1OLMA 4D3WA 4N53A 4BS9A 1PIV3 1RUJ1 4L11A 3TBIA 3MW4A 4SBVA 4BL0B 2P0WA 2EPFA 3I64A 5L3DA 3AC0A 3P9IA 3OEAA 2DW4A 1W6PA 1YIFA 1VQ6I 4IEVA 3ZSLA 4XZUG 3N7LA 3HNYM 4Y1UA 1ZYBA 1D1CA 3CLOA 4EJWA 1JZ3A 1Z7S1 4BZ4A 2JA5J 2G0EA 4W65A 3N7KA 1RHI1 3GLLA 3BGAA 5C4WA 2VBXA 3E0JB 2J1VA 3LFIA 3FXUA 2L4AA 4ZZ5A 1YHQI 3QU3A 1XD7A 4JRAA 4QMAA 3ABLH 2YG0A 4DW6A 4U0YA 4PI2A 1R082 5B2GB 2YB7A 3DYPA 1W7PD 2HWC3 1XMKA 1GP4A 3NRVA 3ZFFA 3FMQA 4EJOA 4G7HF 2R5ZA 1KJLA 2CS3A 3VBHC 4BH9A 1GOHA 3N05A 4E2SA 4IV1C 1OKOA 3NV3A 4FPEA 1UCXA 1WCUA 4FXGB 5C8CA 4LBOA 3H7JA 1SLBA 1YC61 3ZXLA 1NH3A 1JHJA 1AR93 4LJHA 3N36A 4NHKA 4C2UA 2UWAA 5L7OC 2OQGA 1LUJB 2FQ4A 2Q8CA 1VJ2A 1YJNI 1XSXA 2YPRA 1MMSA 2ELKA 5EPAA 1XYPA 4XBNA 1GV9A 3RPQA 1PK6B 5JCTA 2QQNA 3W9AA 2CW8A 3JQXA 2IC1A 2DTRA 5KAIC 3DEMA 2VUJA 1Z9CA 2HVQA 3MF9A 4CXWA 3HQRA 2PJRB 3O6BB 5KAFC 4PHZA 2KM2A 3ON7A 3RPUD 3W2AA 1HKQA 3KZZA 5K8SA 2LOOA 1YYVA 4B3NA 1V6JA 3BU0A 3N7JA 3HNMA 2XJQA 5D8AC 2NYXA 2QSGX 1YCIA 1Q43A 1OR7A 3MKLA 1RUI1 1MEC3 5JLVA 2XVCA 4JKMA 4E4DX 1PGSA 2Y33A 1JTXA 1JUIA 1F5JA 2EXIA 2Y9YA 4OQ9A 2DMTA 1DBNA 4GIQA 1WJ5A 1N1TA 4XC9A 1S0EA 1ASJ1 3WNMA 1ZBE3 4UW6A 3ES4A 4WXHA 1HDKA 5DZEA 5T50A 1MNEA 2DT5A 2HWE3 4YW3A 1TLHB 4OVEA 4PJYA 2WNOA 3DBLB 3KPHA 1RC6A 1ETOA 4X1EA 2HPIA 1RVF3 3CZUA 4MXWA 2JPCA 2B46X 3OJBA 2DA3A 1APNA 1GT0C 2HYXA 2VUAA 2LBFB 1ZYRF 3JRCA 1Y1WJ 2XF6A 1ST8A 4YPJA 2ZGMA 2BWCA 1MSFC 3ZFGB 1YI7A 1O3TA 3FMGA 4I3GA 1MW7A 1W05A 2LKSA 5A7WB 2RJKA 4AXOA 1K5JA 4I30A 4GH4B 1Q56A 2WKKA 1SLLA 2Q2EB 4IRGA 2DMQA 3OS2A 3FXQA 2L9VA 1CX1A 1AR72 2HJIA 5IAVA 2NP0A 4AWXB 3DN7A 1HB3A 4A7YA 4PJNA 4RS5C 2WL1A 5FFZA 4QPQA 2DPDA 5FZIA 2CU7A 5CFCC 2XASA 3ZM8A 4CXYA 1Z67A 2DVAA 4LHNA 5J1XA 2E26A 2WZR1 2DTYA 3KEQA 4XIOA 5F6FA 1DGRN 1U5YA 5A3UA 2DFHA 1XSQA 1VQ7I 4LEJA 4Y22B 4DXRA 4C90A 4AQSA 2LREA 2Q8KA 1XC6A 3K4AA 1LU2A 2HU9A 2D43A 4Q4X3 4XFHA 5FP4A 4CDQA 2O8XA 3MIBA 2XJSA 2PLYA 5KHKA 3HOVJ 3K1NA 1UY0A 1X58A 1H9WA 4BXUA 5FXZA 2KIUA 5F64A 4XCAA 4DY5A 2C9AA 2YBPA 2A05A 4XSXF 2E7QA 2CU5A 5F0CA 3VBFA 4RR3B 4AOCA 5LGUA 4Q4X1 1U9NA 4P9FA 5CVRA 3UNGC 2VQ0A 2M0MA 1BI0A 4U0VA 5IFPA 6PAXA 1RXFA 3PO3J 1H88C 1XGNA 3W2VA 5FYHA 4PGGA 1VBA1 3IRQA 1ONAA 2RG4A 3BPVA 4E7IA 3AVSA 3T8TA 2VOXA 3ZPOA 3PSFA 3U10A 1AXZA 3UGHA 2ZB9A 3F6VA 1WCDJ 5A3LA 4BXFA 5CEHA 1MDMA 1H8TC 4GULA 1IG7A 3M8LA 1YS6A 2F5VA 1IC8A 4XMAA 5LZ6A 3MIEA 1BA5A 2P6HA 3OGSA 1V9U1 1W8WA 3ZN0A 2BGPA 3GTKJ 4Q26A 2XGDA 5BPIA 4DZJA 3EUKL 5FZEA 1NCRA 2X6WA 4A0ZA 1HXDA 5M5YJ 1ZG5A 1BC7C 4FAGA 3WUCA 4N9HA 5A3TA 3PNYA 1KQ9A 1IZ1A 4P9LA 4IOCF 4Q8KA 4YGCA 4IXLA 1AF9A 2DUOA 5CADA 1QO0D 1DU0A 3POYA 4YW6A 4LB5A 2OBPA 4CEWB 2HQ5A 3WU1B 4E2GA 3OL4A 3PFIA 1LGCA 1S0FA 1KU9A 4B1MA 5FYMA 3C7OA 2JG9B 5BS6A 1I50J 4K3UA 4E7LA 3WHBA 2CHHA 2VUMJ 4BBRJ 2E7XA 2FCUA 3WR0A 3J7YJ 1UFMA 3SQNA 4P9JA 3U37A 1ZAOA 3WLUA 2Y48A 1PVC2 1CZTA 1W6MB 3MHZA 4LGWA 2VCAA 3MUY1 2XL9A 4A5NA 2XB6C 2VQLA 1ZGAA 1RUJ2 4QPIA 2GIZA 4E6KG 5JVGF 5A3NA 5C3RA 2X9DA 2IXLA 5JVVA 2BWAA 4WF2A 4BGDA 2FE3A 1ODNA 4UV8A 3JRAA 4Q4W3 2VO5A 4FPJA 4A5MA 3VB2A 4WK8F 4XDPA 1OF4A 4LLOA 1VMJA 1Z7S2 4Q0UA 5DABA 2NLRA 2EFPA 3B7MA 1DGWX 3FC0A 4CDXA 2W3JA 4BE0A 3ZYHA 4AU7A 1D2QA 1LOGA 2H0BA 1JGSA 1HRI3 2ZS6B 2GLOA 5KHHA 4LO6B 2C5DA 5JSPA 3UJQA 1PNFA 2EZHA 3VHOA 4FASD 2E32A 5E88A 2P37A 3C2HA 5EHDA 1NY71 4CP2A 3OYEA 1YX3A 1EP0A 1WW7A 4OUSA 4JQRA 4MQ9F 3IKWA 3EHKA 1BMV2 3U4SA 4GB32 2LY9A 2CV0A 1UU4A 3HAGA 2JMWA 4IHWA 3UNPA 1RUH1 1JTZX 3CQZJ 4QXKA 4YFWA 3MEXA 1SFEA 1CF7B 5FYCA 2KRFA 4JQFA 2W39A 5J37A 3HOXJ 3VBOA 2ZHNA 4P08A 3G6JB 1VQPI 4WVWA 4QX3A 2GA1A 5FLHA 1KEXA 5FO9B 2JDNA 3J8F1 3HN3A 2Q1FA 4G9YA 4IV3C 1D4M1 2DCEA 5EG0A 1C3HA 4II2A 5D2AA 5BOXA 1X4OA 2DA5A 3FDYA 1R36A 3PURA 1B1BA 2FCTA 4ATEA 3MIGA 4I7HA 5IK7A 2FSWA 4P1WA 3ME2A 3MD2A 3K70C 1ETVA 4QU2A 1RUG2 2EIKH 5GAHJ 4Q2FA 1X8EA 4IETA 1IO2A 2IJLA 3BZKA 3KV4A 2HDDA 2J22A 2EINH 4HSLA 1RUH3 4GKYA 1RNLA 1NCQA 1OLRA 5DTDA 1LR5A 1HB1A 2KFDA 3JXSA 3SISA 5KHJA 5FZ1A 3FLPA 4DOUA 3IRRA 2FOWA 4KIGA 3QLQA 2D97A 3DBRB 2I5UA 1BN5A 2JG8C 3VB9A 2CW7A 2ILMA 2O3FA 4DEVA 2VZPA 2DQRA 4XE9A 1H8VA 1O8PA 2VKEA 2VC0A 5KR7A 5KXBA 4H7LA 4TLFA 1PX3A 1E3PA 1AHSA 2Z9OA 1T98A 2MEV1 4KIBA 3N9LA 3SZTA 1EKEA 3T30A 4LT5A 2VBBA 3ZIXA 5IK8A 3O1UA 2MNGA 1Z6RA 1T6GC 5DAXA 5F1RA 2FHRA 4UXAA 4BIOA 1NCQB 3NWKA 4I99C 4DUXA 2K5CA 2AYHA 2ZGSA 2DMPA 1IRGA 5EZGA 3GTOJ 2JRTA 4Y1YA 3WG1A 4UB6C 4MQVA 3K4LA 2W82A 3HJEA 4CDUA 4BLJA 1R1A2 4LK7A 1CAXA 2YR2A 1UMIA 3VDBA 3GBFA 3G2BA 4CZSA 2GP5A 2F4LA 2OTJI 4RDUA 1RUD3 2A07F 1XE0A 3K2OA 3DEWA 2QQIA 3I0TA 4M4PA 1UNBA 3L2HA 1H8TB 3WTWC 3VOEA 1JZ5A 3B93A 4IEWA 2OT7A 2PHDA 1LE8B 1ZARA 3ABZA 2RDPA 3FZ3A 3EYIA 4CH7A 1WW4A 5LCWL 1E57A 3IAM2 4XLPF 4CVUA 5HPOA 1ON2A 1HQCA 2ZGNA 4ATFA 1LQ1A 4IV1B 4QX8A 2OVUA 3B9IA 1E3HA 3LA3A 3O1OA 3AL6A 2CJJA 1Y39A 4MTDA 3K4NA 2WFF3 1T08B 5BNGA 4OHXA 5DDJ1 4QXBA 5H9PA 1HRI2 3CJIA 4S2HA 4NROA 2CRGA 3RI4A 3JAMZ 4ESJA 5AIPA 1LVKA 5EGOA 1I1SA 2A69F 3WG2A 3MQ0A 2OYZA 1S5LC 4M9SA 1KGSA 2HOAA 2HYJA 4IHVA 1VBD2 2ID6A 3N9PA 1C8NA 1F2NA 3VGIA 1IRXA 4MGRA 2NNNA 3KYLA 2JVHA 3RTRA 3OYAA 3DXTA 3HXLA 4AIHA 4KMUX 5F04A 5H6QA 2WV0A 2WN2A 1UJ8A 2BHYA 2DCZA 3A4UA 2R7SA 3OGRA 3PM1A 4LE3A 1ZRCA 5F9TA 3ITQA 5FKCA 1NLQA 1W7PB 4DUVA 2ZKLA 3K70D 2ZC2A 1RUG3 2JA7J 1COV3 1XSVA 3VBSA 3P5JA 2XPVA 1FSHA 4RGAA 3TP3A 2CGPA 1YFXA 4R9CA 1XDSA 1BBYA 1HIXA 3WW3A 4MGZE 4RM3A 5JMCA 4CXXA 1WJBA 5FZ8A 2VT2A 2IEKA 4PLNA 4QQLA 1OCZH 3T2QA 5E16A 1TWHJ 3PVBB 4IOAF 5A33A 3J26N 1HC8A 4KT5C 2DDAA 4QQOA 3SNMA 4F55A 2C1FA 3PNVA 4BBSJ 1QJY2 3GTLJ 3HOUJ 1HLVA 3SXWA 3FUQA 2R5YB 1TP4A 3WCRA 3ZYGA 2JDYA 4B4QA 4XTMA 1FOD1 2X5IA 3PUIA 3D3AA 4CU7A 4BQXA 2ARXA 1QQP3 2D7FA 3HSRA 1I9RA 2HDCA 2HTJA 1W8ZA 1GDTA 2IPQX 4JTNA 3ZFEA 4IL6C 2LSOA 1MS8A 3K7AJ 1HLCA 3VBRC 2YXSA 2RS12 1FBQA 4AHWA 1PGW1 1ULGA 4HNVA 5L36A 2IXKA 3RZKA 1OH3A 5JXJA 5DMYA 3M7AA 5GLVA 4Q8LA 4RGGA 3F2ZA 1R9TJ 4MIMA 1DLLA 4A7KA 4ZHNA 4XXPA 3F8NA 1BEV1 1LENA 4CTEA 2C6YA 2QQUA 5I0DA 1J3QA 1GYKA 5EGOB 1XDUA 5ED4A 2R0FA 3U9GA 3FM3A 4XJ8A 1KQ8A 1K42A 1S6LA 1AOYA 4G6QA 1V55H 3FXKA 2KIMA 3I5UA 1OA4A 2WNVC 5BNOB 1IW7F 2BXYA 5J40A 1OCPA 2W47A 1KRIA 3KCXA 3DP7A 2XPUA 5CPRB 3GXUA 5FZAA 1XB9A 2XF5A 3USSA 3KP4A 2VE1A 3HEFA 4LIVA 3FHZA 1BHGA 2Z2SB 4IESA 4ITVA 5SV5A 1IQAA 5FK7A 1OF3A 1SFYA 5C9AA 4FO9A 1Z3YA 5L9RA 2Q4SA 1F9KA 2HXOA 4XTPA 5FOBB 1NKGA 5BPDA 2R5YA 1YIPA 5BV6A 2ET7A 1XNBA 1LNWA 2PTMA 3I9V2 4AVBA 4GH4A 3ASIA 1XMXA 3NL1A 3WINE 1QPMA 3MFCA 1X1BA 5J98B 3W6KB 3HHGA 4YFXF 2WWSA 4NIDA 1O4ZA 1O6UA 5T54A 4LJZF 3ATGA 2X48A 5F5QA 3HWJA 2W1OA 2ZGUA 3AG2H 4JHZA 1PZ9A 3ZLIA 2HEVF 1T56A 3RZGA 4OIOF 1J3RA 1MMDA 3FM5A 1H9PA 3E1SA 1SD5A 2MC4A 1P9QC 2VODA 4JGYA 4R8HA 5GAEJ 1DZRA 3WP3A 2KRCA 4Q0QA 4O5VA 4XRSG 4TV7A 5D8KB 1ENXA 1R58A 3CCUI 4EROA 2AH2A 5FLJA 3UETA 1X19A 4WWCA 5F3EA 1NG6A 1QDOA 4L0PA 4IV1A 3ZMUA 1JS9A 3HOBA 1RMU1 1GICA 2P81A 5ABJC 1Z7S3 3S1QJ 2YU1A 2HWF3 4K1YA 4E2QA 4YIIA 1N1SA 3IZOA 3OBAA 4MNUA 1OURA 4UFLA 1QJU3 5F32A 1R1UA 1LHNA 2UWCA 5CBLA 4GDFA 4GYGA 1EUTA 1G6NA 3OWTA 4MO3M 3SJMA 5CFDC 2I8DA 1A8MA 1VB4A 5T5JA 1BR1A 5HCBA 2E1CA 4R52A 4BNCA 4Q4Y3 4M01A 1V5GA 4DRRA 3ASOH 3BC8A 1K79A 4JGYB 4NHYA 5CJ9A 3ZIWA 3L2QA 3FFQA 3WP4A 1J2XA 1ZELA 3GFJA 3WP6A 5FZ3A 4CCCA 3GCWA 4L9BA 3NEUA 3LD8A 1XBFA 3FBIB 2Y60A 3WSOA 2H6CA 5IT9Z 1JKPC 1OD5A 2M30A 2WFPA 1HW1A 2FX0A 4RD7A 4N7IA 3CCJI 3F21A 3WGIA 4X6RB 3GXOA 3CZJA 1P2FA 2CWEA 1AR92 1DP0A 1F36A 2PEXA 4Q4Y1 3T08A 2FDGA 2M9HA 2RE9A 1IHMA 3B9CA 5FD6A 3V8KA 5D8LB 3D0SA 2P5LC 1S8NA 4QQPA 4CUCA 5KK1A 1LB2A 1JKQC 3TRSB 3POBA 1AR63 1EAH2 2VVFA 1W6NB 5CZKA 2MH9A 1TNFA 1YRZA 2FBIA 3GFIA 4RLQA 1OQEA 1VB2A 2CAUA 2DLLA 3WQ1A 3TW7A 2VB6A 1ZX5A 1N1YA 3MFKA 2VJ5A 2DFBA 1ZZ8A 5J1UA 4RB1A 1TMF2 2CSGA 4OZXA 3ZOIA 2DYCA 1YG2A 4P55A 2WS92 3AKPA 1YO8A 2EAAA 3KLOA 5E20A 5FLXZ 4HXCA 3AZVA 4D7TA 1QU0A 4U88A 1O4TA 3S5QA 3TGNA 1XU2A 4KA4A 4YRDA 2CUEA 3DU5A 4BE2A 3E6MA 1C0WA 2DA4A 3ENRA 3K51A 3VBSB 5DAQA 4C0BA 3M07A 3CP2A 3KP7A 4M00A 4CCNA 4FTBA 2J1RA 2WT0A 1TME3 1ZN2A 3SHFA 1OA2A 1FWZA 2PMZN 4RAZA 2NZ9A 4IF4A 4LKEA 1OHFA 4OIPF 2O0YA 5D8AB 5D5WB 3LOCA 3JREA 1HQNA 2XF7A 4D7NA 2HBUA 4LHSA 4B4RA 3WODF 3H9JA 3WW2A 2W00A 2B4KA 3SMHA 4BDVB 3S5AA 4P00B 5A70A 2IGNA 5FP9A 1U5XA 2DA1A 2VPLA 3FK6A 3CJNA 1QKQA 1DG6A 5JI9A 1S2BA 4OULA 3BIEA 4OLLA 2ZBKA 1RUC3 1TMF1 2QQVA 5CFCA 5EIYB 1BBT1 2FDFA 3SC7X 1V6NA 4IGQA 5FYZA 4AEMA 4P9IA 1S0BA 3MAJA 5LGTA 2JDPA 1SLCA 4I02A 4E4HA 1Y6IA 3WTVC 4LLGF 3RKWA 1KU3A 3USUB 2Y26A 4TLGA 4RL7A 3FMSA 3ZSJA 2PFWA 4H55A 3EUHC 4JCKA 4Y1VA 3NAUA 1RUF1 5JXHA 4HPKA 1PUFA 4MUVA 2MLGA 3D5LA 4B3XA 3POFA 4UT5A 2JIGA 1CZVA 5BNOA 1BCXA 1CAWB 3L09A 4NPMA 3MIHA 4BQ2A 4QD2A 2KRHA 1W04A 3UV9A 2WADA 1U78A 2KL4A 2X51A 2K9MA 4CUAA 4LG0A 4M3BA 2LH9A 3VN4A 3KT1A 1G4DA 3L2CA 3S30A 1AL22 3UT0A 3F6OA 4L9NA 1B8IA 2G9GA 3PUFA 3I97A 2BNNA 2JN6A 4B48A 5FYTA 2D6PA 2WA4A 1MJAA 1SDWA 2D6NA 2C24A 3K6GA 4IE7A 4F3JA 3QAHA 2GIVA 5I8YA 2FEZA 4XRFA 4IGPA 3WF0A 4QX0A 4DGWB 3D4KA 2RMU1 4LO8A 1COV2 2LW8A 4Y33A 4F92B 2YU3A 1T38A 2OZ6A 1CIWA 4COZA 1MKMA 4XORA 1GSLA 3CNAA 4HF2A 2L0KA 4ZYDA 4A2UA 5FZ4A 3WG4A 2DT6A 4PJ0C 1WLCA 3WTUC 5FKLA 3C2GA 2ZGRA 3ZN6A 4RAFA 5FJKA 5IVJA 2GP3A 4KUMA 1OYWA 5HS7A 1MMAA 1RR7A 3ERMA 1SEUA 3GVAA 1VBB3 2A6EF 1XC5A 1WW6A 3VDCA 2ZABA 2NYYA 1ZGWA 5CNAA 3KP3A 5JDBA 4ZKTB 3AKSA 4EWAA 3KQ4B 4LOSA 2EB7A 2GH2A 1K12A 3I4NJ 1T0FA 2RV9A 4CEYC 5IUQA 2LY1A 1VI0A 4BQWA 1POV3 5EYYA 4CEWA 3GBWA 4IL7A 2HH9A 5L3EA 1GNZA 3CUQB 5B3SH 4GKXA 3POGA 3FHAA 4A45A 2WT2A 5C9AC 1XN7A 1X2MA 1VRBA 2RHPA 3GFLA 2X09A 1VIWB 5FJHA 1DDNA 1L3JA 3LA7A 4YRVA 1TT0A 3WTTC 5HCHA 3PVOA 1TZOA 4WM8A 1CONA 1R083 1UKGA 1F8VA 2BPA2 2F48A 2AGSA 3BOWA 1YQAA 2QZ2A 2YROA 3Q8BA 3RZZA 3BCAA 1GZWA 2BVBA 2Y6HA 5B4NA 1FIAA 1VAVA 3NQOA 3KEYA 5IYYA 3J81Z 2CYFA 2KJCA 4LO4B 4XNFA 1XMAA 2LF8A 1POGA 2XR4A 4RHV1 1LOCA 4E9KA 1D7PM 4PJLA 2R043 1U0JA 3VKFC 1JGGA 2BDRA 3KFWX 3UL2A 3BG9A 4JX5A 2CWMA 2VXDA 3HB9A 4B1LA 2ZAAA 3OUHA 2CGNA 2KHMA 1VBE1 2VMHA 5IVVA 2FOKA 1REPC 1GV2A 4AWDA 1O91A 1U2WA 4BJ0A 3MIFA 3GCMA 1PZ7A 1DZQA 4ZONA 3WF2A 4URAA 3OSGA 1N78A 1AX1A 3I49A 2HYGD 1RMU3 4GJYA 3ZMTA 3PL8A 5IYDJ 2JE7A 4UI9L 2UWBA 3N9NA 5D6FA 5F2SA 4DIQA 5J8CA 4YVWA 2TUNA 5A7OA 5CFDB 4R9AA 3RSJA 4XONA 3BODA 3IMNA 2Y6KA 2KQRA 1UELB 3LDBA 2X1CA 4ESBA 3VODA 5FMCA 4PSXA 5DG1A 2JZYA 2V1UA 3H8OA 5BYNA 5J1YA 2ZJ2A 1R1TA 3BZCA 3T1LA 4ES9A 1OOPA 2R041 1MBJA 1FYLA 2YC2A 2K4JA 1ZHFA