4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
3HTSB 3T1BA 3EO6A 3KLNA 3TDZC 2Q30A 4ZU7A 2XAGA 3FXQA 3DQVC 5HS9A 5TJJA 1ZRFA 1FBUA 3HT1A 2NNYA 3RKYA 5DV5A 4CYDA 2O6GE 2P6TA 3JTHA 2QENA 3FXRA 3LSTA 4IEUA 2WFPA 1MGTA 1ZN2A 4P96A 2GA1A 3RI4A 1ZZCA 3COAC 4LK0F 1KA8A 1C0WA 3K2ZA 2DBBA 5KBFA 3E5XA 3CJXA 1YLFA 5E1WA 2RKHA 2QUFA 3ZP5A 2EJRA 4M73A 4XFAA 1P6RA 1KQ0A 1PUEE 2VXZA 2XAHA 3ULQB 2IXHA 3ZDSA 1BN5A 4HLYA 4H7LA 1KQ9A 5CADA 5HDGA 2FBHA 3I0TA 3ISPA 1BM9A 3K1PA 5BXXA 1R5GA 1BOAA 3E5UA 1Z6TA 1XE7A 2OQRA 1BI3A 3ECOA 4IEXA 3QPHA 2RGVA 2ESHA 2L54A 2ZNYA 2EA7A 4XSXF 1DGRA 4QGMA 1Q1HA 2IJLA 1SD4A 2Y0MA 1UCRA 1EP0A 5LLQA 4JTNA 4YARA 5DCMB 5H6QA 3C3WA 3GF2A 3I64A 1OR7A 4L0YB 3SCFA 2CGPA 2GXGA 3F8BA 4LJZF 3BJ6A 4KWLA 3HRSA 4EWEA 1U2WA 1IN5A 4I7HA 5FQ0B 4P55A 2IRFG 5J3UA 3JSOA 5BY5A 3HOTA 3M9AA 3E6BA 2ETHA 1UHMA 1ZNPA 1LDDA 3H3ZA 1O7FA 4KUMA 4L9JA 1CAVB 3NVCA 1TQMA 2IA1A 2K7LA 4LUKA 4HBLA 1TW2A 1BC7C 3UKNA 3RYPA 2HEOA 4U0VA 3P9IA 2FXAA 1DZRA 5BMZA 2O8XA 4EWAA 5ICGA 5I91A 4RB2C 3UKVA 5LHIA 1ZX5A 4I0BA 2VQAA 1IPKA 4U0WA 1FT9A 1O3QA 2D5HA 2ET1A 3IIAA 1IRFA 3J81K 4ASNA 5D5WB 2BE5F 2MH2A 1YFUA 4FT8A 5D1IA 1HKSA 2Z99A 3U0ZA 1YFWA 5ICEA 1Y0UA 2A6HF 1W7PA 5I8SA 5J8CA 3MEXA 5HS8A 4FBFA 2EV0A 2ZXJA 2PJPA 1KU7A 2V79A 4Y13A 2MNGA 2XAFA 1Z1DA 1XN7A 4N0BA 4D7SA 1ZZ9A 2CWEA 5BQTA 1K6OA 1Q3EA 2FNPA 3F8MA 4MGYE 4WF2A 4EROA 3F8FA 1J59A 5AIQA 3K1NA 1IN8A 4WXHA 1NE6A 3VB2A 2GC2A 5FLIA 1XSXA 1X7NA 1ZARA 3USSA 3VOEA 4JTOA 4XETA 3RZZA 4Q5SF 4BXUA 3V8KA 4M74A 5FDBA 3HRMA 2PG4A 2EFQA 1SFUA 3L09A 2CFXA 4YYOA 4QX5A 5JI6A 4YG2F 5K5QA 5KHJA 3KP4A 2X0LA 4MZUA 2QNKA 3H92A 4BQAA 1FX7A 3FHZA 3MDPA 4FAHA 4MHGA 5LGNA 2PYTA 3GWZA 1XSVA 2O3FA 3GW2A 3KMHA 4AVPA 4QXKA 1YFXA 2EFOA 3N97A 1WWXA 2OU2A 2EWNA 1G3YA 4XLPF 1J3QA 3O14A 4R52A 5J7MA 1PDNC 4XFIA 2H94A 2QQ9A 2WV0A 4Q4ZF 3WTUC 1QGPA 2HTJA 3F6OA 5HOOA 2L02A 5FD6A 1S7OA 3ML6A 3ERED 1QZZA 1UB9A 3I7DA 3NSTA 2PAKA 3GBFA 5L3BA 1DDNA 3GO5A 1B1BA 2D1VA 4GYGA 2HJIA 2EAAA 3C3VA 2K0GA 2R7FA 3RYRA 2STTA 1MD0A 1BI0A 3LZZA 4OU0A 1CAUB 2GWRA 2HKXA 2YU3A 1F5TA 2YX7A 2F5FA 1J3RA 2G7UA 1G3TA 4EJUA 4ENNA 4HSJA 3LOIA 4M72A 2JTVA 4AWXB 2COMA 2STWA 3ETQA 3LA2A 2D2WA 5CVVA 2F5EA 4ENJA 2A68F 4AQ2A 5I8YA 2BNMA 1Y9QA 3FMQA 3WG9A 2HFHA 1ZZ7A 1EY2A 4OMYA 3TO6A 1QQIA 5JSPA 3PVBB 4M6YA 4BAYA 1FLIA 3ES1A 3ZMSA 3WW2A 3H7YA 1W5TA 2M5WA 4CGZA 5LRRA 1OKRA 3GFMA 2V9VA 3L9FA 3S0MA 2V1XA 3S7IA 3L00A 2P5LC 1ZG1A 2DT5A 4KU7A 2EV6A 2FMLA 1R7JA 4Y15A 1O4TA 1UPIA 5F6FA 4IETA 3LA7A 4KA4A 4EV0A 1S8NA 1J5YA 5ILSA 3Q5FA 4B29A 3H3UA 2VBYA 2HZTA 1ZYRF 2ACJA 5JR7B 4Z82A 5HLIA 2Q0AA 2KKOA 2HS5A 2Z33A 3P9KA 4HX4A 4YFKF 1EH7A 4META 1VP6A 3F6VA 3F8CA 4E2QA 4QMAA 1FYMA 3EHKA 2BEOA 3SXWA 2IXKA 3U1DA 2NRAC 2XGXA 3WTYC 1D3YA 3MPBA 3EJKA 2IXCA 4ZYEA 2XV4S 4X6RB 2M87A 3BCWA 5AVPA 1G6NA 2BNOA 1KYWA 4A2UA 2J5PA 5HDNA 2VPVA 2YR2A 2OBPA 1F4KA 2MC3A 1GXPA 3DV8A 3J80Z 4EM1A 1BJAA 2A61A 3DEUA 4KICA 2PHDA 1KGSA 4TV7A 4KT5C 2LNBA 2HDCA 2JRTA 3FZ3A 2GQQA 3FFQA 4JK1X 3I59A 2MPFA 2VT3A 1BIAA 1H1MA 5ICCA 3RPUA 4WXDA 1DP7P 1YYVA 1CAWA 3GUDA 2XAJA 1FY7A 4F7ZA 1ZRCA 1GXQA 4HV5A 3NEUA 4YRDA 1XCBA 1T38A 3V7RA 3QAHA 1UIJA 1G4DA 4G6QA 4QWQA 5FD5A 1V70A 4OIRF 3UKTA 2CO5A 5HLGA 2XHKA 2RNJA 1YG2A 3PQJA 3WTXC 1FWZA 1YQAA 2H09A 4IF4A 2DO7A 1EH8A 5I8TA 4ZYHA 3MCZA 2YPRA 2A07F 2JT1A 3KP3A 5CLSA 1YFYA 4EMSA 4OFGA 4JBAA 3DFGA 1HW5A 3R0AA 2XLAA 4O9GA 2M30A 1P4XA 3L7WA 4QGNA 4LUMA 4MH0E 3Q9SA 5D4RA 2DLLA 1OYYA 2IXIA 2PQ8A 3WU1B 1FYLA 4AIHA 4IRHA 3V4GA 4I2OA 4A5NA 1DPRA 2RVCA 3QP5A 2BNNA 3BOQA 4S05A 3GFLA 5D8LB 4RGRA 2NNNA 4NB5A 3B02A 2ZKLA 3KP7A 4HYEA 2XL7A 1V3FA 4OIPF 3FF5A 3TO9A 3K0LA 4H0EA 5E16A 4G7HF 1KQ8A 1LVAA 4KFCA 2W25A 5LEJA 3F23A 4KN7X 5ICFA 4ZZLA 3V7SA 3CLPA 1OPCA 4HQMA 4HX8A 1VJ2A 4ENKA 3GYDA 1PM7A 5FQ0A 4OLLA 2HQNA 1BIBA 1KU9A 1LDJA 4MGRA 2O61A 1JGSA 1CF7B 2MD5A 1EV7A 1UFMA 1XMAA 4QGLA 3WW4A 1LKNA 2QQAA 2M45A 3NKTA 4QM9A 3QP6A 3R61A 3GVAA 3CEWA 1KYZA 4HAMA 2PQQA 3M8FA 3HSRA 3EBRA 3JZVA 1O57A 2XIGA 1CAWB 2JPCA 4L2NA 3MQ0A 4IEQA 3LAJA 1W5SA 3TQNA 5L3GA 3HHHA 1EH6A 2VBWA 1LEBA 1ZRRA 4IPAA 3SXYA 2BV6A 3CLOA 2GH2A 4Q0UA 1J58A 3M70A 5CYVA 2RQPA 2MHFA 4PIXA 2UWMA 2E1NA 2F5CA 2XLGA 5KHGA 1T0FA 2XVCA 5ILVA 3FMRA 3IKTA 1UHWA 2LF7A 4ZZDA 1HSTA 3IKVA 5BV6A 2IW5A 4M9XA 4K8FA 1TW3A 3ACLA 4R8HA 1J3PA 3EUHA 3KCCA 4Q0SA 1SFEA 3BJOA 5E18F 4F8AA 1S3JA 4EM2A 1TQ5A 4IRIA 1ZREA 3OD0A 4M9ZA 5LBQA 1JE8A 4IEZA 1SFXA 4PJYA 1ZLKA 4MTEA 5JAXA 1IW7F 4GXOA 5I0UA 3TKYA 3LAPA 4LLLA 2AS5F 3WE2A 3J81Z 3RNSA 2UY9A 2K02A 5IT9Z 3V7CA 2KIUA 4B8XA 1TQIA 2EA4A 3D0SA 2EA2A 3ZMVA 1WGPA 5CVUA 1DUXC 4A12A 1SEFA 1S6LA 1BI2A 2KIMA 1P4AA 1XD7A 4I02A 3H8UA 4HQEA 2H6CA 2F2EA 2WWYA 1QWRA 1LEAA 2FMYA 3BU7A 2IVMA 5FFXA 3V8JA 1RZ4A 5DUKA 3FM5A 2B8MA 2OYZA 2UYAA 4XF9A 4YSFA 3FM3A 1E2XA 1YW7A 1YS6A 4UV8A 3SZTA 4UBHA 1RUOA 4IERA 2EVXA 2I45A 3DPLC 1RGSA 2K86A 4HN1A 1TQPA 1HXDA 1I6XA 2QQBA 3BPVA 4KL1A 1RI7A 4U0YA 2HR3A 1LQ1A 3NJZA 1ZZ6A 5JHUA 1H9GA 2FU4A 4LLOA 1GVJA 2HKOA 4YFNF 2KJBA 2D45A 3M1EA 3RKWA 1ZVFA 2VECA 5JSOA 1CAUA 2AXLA 3EYIA 3FMSA 3GZ6A 2PI0A 3ABTA 3HHGA 5A2QZ 1IXCA 3SQNA 2DK8A 2J5OA 3WGGA 4IHTA 4Y17A 2VN2A 2YSRA 4CDGA 3H1WA 4HF0A 1T2KA 1V4RA 3WODF 5HS7A 1E17A 4XF1A 1TTYA 3EDPA 3I4PA 2LF8A 2B5HA 3C7JA 1S7AA 3QOPA 3GXOA 2D1HA 2KJCA 4M6XA 3P9CA 4ORFA 3IL2A 4XBFA 2ETEA 4Q0QA 4WK8F 2HTSA 2D40A 1USSA 1ZG3A 5D8KB 4G7ZF 2ZO4A 2PAMA 4KWKA 4UNOA 1EYBA 2BBYA 2FRHA 2GXBA 1I5ZA 1H1IA 2E7WA 2CW0F 3DXJF 5E8GA 4L5IA 3E6DA 5KHKA 3RPQA 4Q47A 1R1VA 2Y0OA 2PHLA 1J7KA 1IXSB 4LGWA 1ON2A 4CICA 2QVOA 4RB1A 3WTSC 3FHIB 4HMZA 3BJAA 2W24A 3TOAA 3W6KB 1U5TC 5AIPA 4L5JA 2D93A 1TLHB 2A69F 4RS8A 5K1YA 2YX4A 4AIJA 5I0RA 4AIKA 4FX0A 3MFKA 5LGUA 1ZG5A 3KGZA 4UVBA 4HN0A 2DPDA 1XGMA 3HUGA 2GU9A 1K79A 3RIRA 4AQ6A 3KZYA 3NRVA 3MAJA 5FO5A 3CF6E 3F3XA 2Z2SB 3E6MA 2IXJA 2RC4A 3DP7A 4IESA 3KFWX 4QLCU 4CO8A 3OOPA 3BB6A 1SD7A 5JVTA 1MJAA 5TRDA 4CHUA 4HF2A 1FSHA 5KHHA 2PFWA 2A5YB 3G3ZA 5BPIA 1BI1A 1STZA 3WE3A 1ZGJA 4MGKE 1MZBA 4Z07A 5JSRA 1SQ4A 5BOXA 1FBSA 1FI2A 1WLTA 4RB3C 2W84A 2B0LA 2FBIA 2OA4A 5F1RA 2OD5A 3EQEA 4B09A 5LEKA 3L2CA 3ECHA 1P92A 4A0XA 1D8KA 3R6SA 2C0ZA 4J1XA 3LA3A 5D6EA 4QM8A 1ZHFA 1K78B 4X6QB 1FP1D 2K4JA 2PFBA 2QBYB 3HSEA 3FE5A 4I01A 1RUNA 5D5UB 1REPC 2BGCA 4BH9A 1DZTA 2G9WA 2K27A 1IF1A 1WKMA 1YUDA 1O3RA 3NQOA 3TGNA 3K9TA 4P9UA 2PTMA 5JR3A 1IXRC 2DFIA 1AOYA 3E6CC 4G9YA 2UXNA 1RNLA 5HDKA 1B9MA 3KLOA 1D8JA 1K7AA 3MZYA 5FCCA 4O3MA 3JSPA 4ZU4A 4RGUA 3PQKA 1YFHA 2QLZA 2M1BA 4LULA 2ET7A 4WXCA 5DEQA 3LQQA 1O5LA 4IJAA 3VEPA 1OD5A 4OMZA 5KHIA 2KIFA 1I27A 2ZFWA 4HDUA 1O7LA 3IRQA 4R1HA 3P7NA 2QWWA 1P2FA 2Z9OA 4IEVA 4P5OA 3V8LA 2HWVA 3F22A 2EFPA 2IXLA 2QDRA 2H6BA 1QZYA 1IPJA 2P7VB 5DUIA 1LDKB 4LFUA 5KVRA 5L3DA 4A5MA 3VHRA 1NYWA 3FWEA 5HVQC 3WW1A 2QCSB 3Q9VA 1L3LA 1HSJA 1T98A 4WBBA 1JXSA 3SHFA 2K9ZA 3OGJA 2B9UA 4UXNA 1O3TA 4HA8A 3CJNA 4KYWA 2QM3A 6PAXA 4EJTA 4WVZA 3HRUA 1B6AA 2O0YA 5D5VB 1W4MA 4E2SA 4XLNF 4RGXA 3VFZA 4CXFA 1R23A 4ETSA 2LSOA 2MLGA 3E97A 4PGGA 4A0YA 4BYYA 1PP7U 3JAMZ 5BPXA 2JZYA 4U88A 1CF7A 5DYMA 2CYYA 1Z7UA 2ATFA 4WZCA 2GZWA 2PLYA 3RJPA 3U10A 2Z5UA 2XKOA 4AXOA 5I0TA 3LFKA 1L0OC 4WCGA 2EV5A 4OOIA 5DD8A 1HBXG 2ESNA 4N9IA 4WWCA 1OI6A 1ZLJA 1HW2A 1OMIA 1UD1A 4IVNA 4ZYDA 2FQ3A 2HGCA 4LA3A 3IRRA 5EZWA 4IHSA 2FEZA 1X8MA 1MJBA 5HI0A 2PMUA 2PMHA 4OIOF 1P4WA 1DGWA 4U7BA 2ISZA 2Y75A 3IHUA 2V6CA 5FPXA 4EJOA 3ZMUA 4EGYA 3E5QA 4RB0A 3ES4A 3KETA 3QRFF 1HQCA 2D5FA 3CO2A 4BHCA 3SCHA 5F64A 3FZVA 2MBFA 3O3KA 4UUVA 2OA2A 4KDPA 5KK1A 4XFGA 2WC2A 2A3SA 3IC7A 1YO5C 5FFZA 4Q0PA 2ADUA 1LR5A 2XKPA 2DI3A 3ZN0A 3MYXA 1Z9CA 5T3NA 2R3SA 3L2HA 1QXRA 3KSCA 4EWDA 1SFNA 2DTRA 3IDCB 5D4SA 3BPXA 4ON0A 1D5VA 2HYGD 3GFIA 1MKMA 2F5DA 3KGLA 4UVAA 3ZPLA 1I1GA 4FX4A 1IAWA 1U8RA 4DNCA 4LMYA 3J80K 4G94A 3S7EA 3MWMA 3WGHA 5HLHA 1NXMA 4MQ9F 3OTFA 1IUYA 4S04A 3CUQC 2UYBA 2L3DA 4L0ZB 4MGIE 4D0PA 2HOEA 4XEZA 5E1ZB 3TDUC 4FAGA 2HQRA 1VTNC 3FJSA 3PNAA 5L3CA 3FXUA 2H0VA 2GC3A 3BWGA 3ELKA 1X8EA 4YIFA 4PZJA 3WU0A 1A04A 1IN4A 3H1MA 2M8EA 1QBJA 5ERIA 4PCQA 5FPZA 4I0AA 1BC8C 3QU3A 3TNPB 2RDPA 3DF8A 1XRUA 5C8WA 3BDDA 2DQRA 4LTAA 5I0SA 3KEOA 3BROA 1Z05A 4EGZA 1OYWA 1QNTA 1FSEA 1LJ9A 4M9SA 3H7JA 2E7XA 3D5LA 3REOA 3WTTC 1WSUA 3IWFA 4MUVA 5K8SA 5C6CA 4XF4A 2PAEA 5FLXK 2P7CB 2FBKA 2EFWA 2CQKA 4O9EA 2O03A 5FB2A 4LLNA 1F1ZA 1FBQA 1XB4A 3IBMA 2E9QA 3ZMDA 4A6EA 1SAXA 1R1UA 3GFJA 3SCGA 1QO0D 1QPMA 4I98B 4NHJA 3ST7A 3I53A 2P5VA 1SMTA 4EQQA 2ISYA 1FZPB 2IC1A 1R36A 2PBIA 4EM0B 3EYYA 1ODDA 3CO6C 1BBYA 2OQGA 3ZN1A 2O8QA 2OPKA 1OFNA 1WA4A 4MTDA 3KP5A 4E2GA 3HIFA 4HLXA 2CAUA 2UXXA 3WW3A 1FNNA 4ESJA 1IN6A 5CJ9A 2W85A 3TO7A 1TBXA 1YIOA 5JCTA 1Q5OA 3RYKA 5D5XB 2ZMEB 1H9TA 4LG0A 1T6SA 5E1RA 1GQGA 1ONVA 4GO1A 2XAQA 3OCPA 3SFZA 1U78A 3SZPA 2Q4SA 3LAGA 2DCTA 3DN7A 5ILUA 4RAYA 2P8TA 4XRFA 2IT0A 3QU6A 4UBGA 3IWZA 2NAZA 4MGZE 1NHAA 4YNIA 4E70A 4PIYA 1R58A 4ESFA 3R60A 1RTVA 1U5TA 4Q29A 4UVCA 4IEWA 3HRTA 3QACA 4JV4A 3TNQA 2JPBA 4ESBA 3BPZA 5FLHA 3HTUA 1G3WA 3HOSA 1MJ9A 3QPTA 3T8TA 4IEOA 1ON1A 1R1TA 3E3VA 1XGSA 3ZMZA 4AVCA 5AONA 2V1UA 1CX4A 4LB5A 4LK1F 5CU1A 1X3UA 3KP6A 3GYHX 4YIIA 1UW8A 3SHRA 3M8EA 3K1MA 2MH9A 2RN7A 2OZ6A 5D6FA 4PIZA 5FGMA 2PA7A 2K4BA 1TNSA 1CAXA 1G3SA 2L4MA 3JTGA 1JHHA 2ELHA 4L9VA 3KZZA 4HVRA 1H0MA 4I3PA 4JVAA 4KN4X 3I5UA 5IT9K 3M7GA 5CVJA 2ZJ2A 3CL1A 2TDXA 4HSLA 3WTVC 2GA2A 4GYIA 1K78A 2P4WA 4EJVA 2QBYA 2CV6A 1RC6A 1S29A 5K5RA 1XE8A 2VC1A 1WI9A 3F8NA 1B59A 1QY4A 3NW4A 1F9NA 4HDVA 1USTA 4J1WA 2UZKA 4L18B 1RL3A 1UIKA 1ZGAA 4LB6B 2FQPA 4D7TA 1XDSA 2V09A 3I71A 2Q0OA 1ZRDA 2EFNA 3WTWC 1U3EM 3ELNA 4MX3A 4N9HA 3F21A 2GC0A 2FSWA 3FX3A 1IRGA 2Q8KA 4O5VA 4LG0B 1W7PD 4EJWA 4KWJA 1MDMA 3IDBB 3DPTA 2FOKA 3D0JA 1XGOA 4HOBA 4XFFA 3O2PE 2FF4A 4L9NA 3PFIA 1KU2A 1XDUA 4OIQF 2VODA 5L3FA 2NYXA 1I1SA 3VODA 3R0JA 3B73A 3JW4A 1YW8A 4HVQA 5ED4A 1U5TB 1YWKA 1HW1A 3C1DA 1FXZA 3RDIA 5CVIA 2DQLA 4KNYA 3KE2A 2XROA 4KIFA 1KU3A 2UY8A 1WRJA 4PDKA 5BPDA 2CAVA 5A2QK 4IXAA 4LD5A 2ZBKA 1FYKA 4HF1A 1JUHA 4HV6A 4P9FA 3ZMTA 2NS0A 3I58A 3OV8A 3RTRA 1JHFA 5LHHA 3EQLF 4LEJA 1CAXB 3G73A 4AVAA 4Z2YA 2KXLA 1YS7A 3HSFA 1NE4A 4K2EA 2LKPA 4ZU5A 1U6GA 3PLQA 1B4AA 2P5KA 4Q48A 2QVSB 2LDUA 1SD6A 1W7PB 4BNCA 2VOPA 2P6SA 2W57A 1PP8F 2PN6A 4Q0VA 4P9GA 4G8XA 4A6DA 5H20A 2EB7A 1XCVA 1XSDA 3NL1A 5FLJA 4R79A 1WQ2A 1YW9A 2N7GA 3RKXA 2BYVE 3HYIA 1AWCA 2VBZA 4ZH4F 5I93A 2IA0A 1O3SA 2XUBA 4L11A 3TOBA 3T8RA 2RV8A 4HZFA 2HYFA 5DDGA 3K69A 3CUOA 2FNAA 4UHTA 2OZUA 1MDMB 4A0ZA 1IN7A 2JSCA 4ZYGA 1J1LA 1FOKA 2Z3YA 1FPQA 2VC0A 4RD7A 4G7OF 4NQWA 3OF1A 5J48A 2VOOA 1J0RA 2IA2A 5LHGA 1LB2A 1ZZ8A 4LLGF 1HKTA 2IP2A 1L3JA 1J75A 2DW4A 2ZKZA 5LGTA 3BALA 1SMYF 2Q2EA 4AD9A 5DD4A 2GIVA 5BUVA 2XRNA 1Z91A 3U11A 3SMHA 3MZHA 3DKWA 3BY6A 2VE9A 4HW0A 1IZ1A 4GGGA 5E8IA 2DPUA 3G7DA 2GC1A 2G7HA 4XSZF 4IEPA 2VONA 4HBNA 4EVIA 1QXJA 5E17F 4BHPA 4ENMA 2L01A 4O6JA 3J7AO 3DL3A 2XASA 5L3EA 2WTEA 3ROUA 3W6JB 1T39A 4KU8A 3H50A 1XGNA 3CDHA 3CUQA 3GEZA 1ZAOA 3GLXA 1U12A 1YHFA 4DINB 2H27A 1OYIA 4WX9A 1ZZBA 3N4MA 1FC3A 1XMKA 3BP8A 3C18A 2X4HA 4HX7A 2C6YA 2V1DA 2IPQX 2FE3A 4BIFA 4KMFA 3M3IA 3O6BB 2VT2A 4CZZA 2QZ8A 4G6DA 3T5XA 2P17A 5J8FA 3BZ6A 2Y48A 1YTYA 4DQ2A 2VE8A 4IEYA 4KIBA 2PEXA 2MA3A 4XF0A 1Z6RA 3WGIA 4AVBA 2A6EF 2VBXA 4MEXF 4PGHA 2DK5A 5E1XA 3HT2A 5EFUA 2ZCWA 4GULA 4UXAA 2E1CA 4MNUA 2O1QA 3LWCA 4BHBA 1Q43A 2KRFA 2Z69A 1GQHA 3ZQ7A 3R4KA 1UCXA 2CG4A 1EPZA 1YLLA 2OAZA 1ZH5A 3U2RA 1NZCA 2DAOA 1R00A 2ZNZA 3U9GA 4UV9A 4RGSA 1R22A 3H9AA 3ABUA 5EEHA 1FP2A 2FA5A 4LA2A 4GCVA 1HKQA 4MV2A 4MEYF 1DPUA 4HLTA 1VR3A 4IRGA 3D82A 1B9NA 3WTZA 3CTAA 3LWFA 1GHCA 3H1YA 3AAFA 2Q1ZB 2GAUA 4TLFA 1O5UA 2QYOA 3LQRA 2DU9A 1TNTA 2L4AA 5J6XA 4HVOA 3JAMK 4FHTA 3CO7C 5FLXZ 1ULYA 4KIGA 2XLFA 4U7DA 5LRSA 2CSOA 3S2WA 1Y3TA 5H6RA 3F72A 1X82A 1J2XA 5IT3A 5K5OA 3I54A 4XFHA 4XFCA 1CGPA 2ZMEA 4ONUA 5E20A 1J9IA 4NVPA 2QJVA 5DCMA 3KP2A 4I09A 5JFRA 3CUQB 3GX4X 2F4PA 5CVRA 4YFXF 3T0YA 4M71A 5BS6A 4MQVA 3EETA 4KMUX 1R5HA 1PMIA 2MLKA 5DCFA 2OZJA 3KEQA 1LNWA 1RIOH 4RAZA 4XF3A 4OINF 2EK5A 1LRHA 5EEGA 4JQFA 4L9TA 3HQXA 2XL9A 4XFBA 1SD5A 3I59B 1CAVA 2R7DA 3GZ5A
chains in the Genus database with same CATH superfamily
4AYUA 4ZYAA 3T1BA 2OIIA 2XG3A 4B43A 1UY3A 2R073 2XAGA 4AIDA 3H9GA 3DQVC 5HS9A 4IHVA 3R0RA 3KZIC 2K9LA 4LKFA 1QJU2 2E31A 2A7AA 1VQPI 4CYDA 2P6TA 3JTHA 4B4RA 4BBSJ 4OHZA 2DT7B 2VPRA 4ARYA 2CFOA 3RI4A 1T6GC 4RDUA 1ZZCA 1QRYA 2BVVA 3THPA 2E35A 3B69A 2J1TA 4B7EA 1KA8A 3HBZA 3ESWB 1F4HA 2M7AA 1N3PA 2DBBA 1QMJA 5KBFA 3OS1A 3GZAA 4PJ0C 4TLGA 4XFAA 1SLLA 4AHXA 2XAHA 3ULQB 1REDA 4HLYA 4H7LA 2BRTA 3TMOA 1DQ6A 3O1PA 3MZ8A 1VBE3 3B01A 4YFZA 2QQMA 3B5LB 2DA5A 1AYM2 2R4GA 3OY8B 1XE7A 3VWBA 1ZBA1 3ECOA 3POGA 4MADA 2WO3A 1W2UA 1RUI3 3FC0A 2A6VA 1ZR4A 2JDYA 1H89C 4CP9B 3ZFFC 2CH0A 4QGMA 2HWC1 2W48A 1Q1HA 2JB8A 1CQTA 1UCRA 2R7EB 4LKSA 2GMMA 1VQ4I 4JGYA 4FFIA 2VZ1A 3QODA 4JYKA 1MR5A 3L1PA 3F2ZA 3BJ6A 5ANQA 4IGOA 1OCRH 4P55A 3QBQA 3M9AA 2EALA 1D2QA 3E6BA 3AL5A 1V9U1 3G71I 3H3ZA 1O7FA 4JGZA 4L97A 4YM1A 5F7UA 4HBLA 1TW2A 5DM6F 4E4HA 3RYPA 3ZR8X 4U0VA 3FIWA 4CCJA 3P9IA 2FXAA 2IGMA 1DZRA 3KB5A 2O8XA 4MGQA 2XWBB 1C8M3 2WY8Q 2XF5A 2NPIA 2WFF2 5LHIA 1RINA 1ZX5A 1OQYA 3JD71 1FT9A 2ET1A 2J42A 3EUHC 2VNOA 4FT8A 3GJAA 3ASIA 1IG7A 2Z99A 1T6BX 3T08A 2A6HF 1PO13 5A33A 5I8SA 4E6KG 1AKHB 1W9WA 5GALA 1BXHA 3L2YA 4FBFA 4RA2A 4DIQA 4DNYA 1Q8PA 2ZMNA 4M00A 3W6VA 1WW6A 5J09A 2WYFA 2VOTA 4N0BA 3H0GJ 3I4NJ 1Q3EA 4XQ4A 2FNPA 1A6QA 2Y30A 2ID6A 1W3XA 2EPFA 3F8MA 4BJ6C 1C3HA 4MGYE 3NO8A 2MSYA 3K1NA 4XLAA 3AP7A 4IE5A 1GR3A 3ASNH 3RZOJ 4ES9A 3FK6A 4JTOA 2QQ8A 1D0GA 1VF9A 1VFCA 3RZZA 5FYUA 1A3KA 5DPNA 3BG5A 2F6CA 1OOPA 4JGYB 5FO8B 5B1BH 2EFQA 2RMU1 3OS2A 1SFUA 1QJY3 1Z77A 3L09A 2K3PA 2R30A 3SEPA 3ZYRA 2JECA 1ACCA 2OUJA 2L7FP 4JDNA 4BQAA 2VZOA 4MHGA 4LKEA 4D6SA 1V5GA 2BWAA 3LIHA 1HV0A 4J6GA 1YFXA 1D1BA 1BEV3 2EWNA 3O14A 4R52A 3HJEA 1UYXA 4E7IA 1ASJ2 4QSHA 5BNNC 3N9OA 2DBIA 3T2QA 3DWLE 4HONA 1IG3A 3H5RA 5B2GB 5HOOA 1R6RA 3ONQA 4E4ZA 5FD6A 1S7OA 1SAUA 2X10A 3V0AB 3ML6A 5A3TA 3I7DA 3GO5A 1VBB1 1T2XA 3CESA 4FE7A 1WJBA 2YX7A 3GTOJ 4DXSA 5EZHA 1TEIA 2FDKA 1J3RA 2G7UA 3OYNA 3IAPA 4WM7B 1V6NA 1I50J 4ENNA 4OUMA 5JI9A 1S0JA 4NROA 1FMVA 2COMA 3ETQA 3MKYB 4Q2FA 4D0QA 1W9SA 2JICA 1POV0 5E8AA 5I8YA 2BNMA 3HC7A 3BOPA 3RI8A 4DGWB 4NC8A 4B4PA 3TO6A 1PVC2 4BAYA 1SFKA 1FLIA 3GZTB 3ZMSA 3WW2A 4CGZA 5LRRA 1TNRA 3S7IA 3AX4A 5JXHA 2A3WA 2I10A 2E71A 5FOBB 4KU7A 1IS4A 2MABA 3RZDJ 3FUOA 4D7YA 4FPYA 5M5XJ 4Y15A 1O4TA 5FKKA 3PIJA 3LA7A 2VD7A 4EV0A 1S8NA 1J5YA 1UYYA 1TME2 1Z78A 3Q5FA 1W6QA 4B29A 3GCMA 3TEXA 2L7KA 1Z7S3 4INDA 5GLVA 4BDYA 1NA1A 5JR7B 5FK8A 5C4WC 1LNSA 3PDQA 5T5JA 2HS5A 1IG0A 3GGLA 1WD3A 3M4FA 1R092 2BEOA 1U0JA 2VZTA 4QKDA 1D3YA 3GJBA 1HCRA 2IXCA 3QOEA 2XV4S 5AVPA 5IATA 2BNOA 1KYWA 2VO5A 4A2UA 2WADA 4HPQA 2D6KA 4Y5Z0 1XYNA 1HRI1 2MC3A 5FJ8J 2D3PA 3DEUA 3AXDA 4KICA 2PHDA 5EIYB 1KGSA 2W7NA 4TV7A 1WI3A 2LNBA 5F3CA 1OHFA 3FFQA 5L7OA 3GM8A 1YJKA 4WXDA 4NDLA 2HVSA 1V5EA 3J4UH 4UB6C 5EYXA 1DP7P 2VGDA 5ABJA 1PIV3 4F7ZA 4HSRA 2HPIA 1GXQA 4HV5A 1LKXA 1T38A 3THCA 3V7RA 3TW6A 1UIJA 2LG4A 1ULGA 4G6QA 1MS5A 4DXRA 1H2MA 1W6OA 2XHKA 4KMQA 3M4OJ 5LFAA 4CUCA 5K0UC 3WTXC 1UZZA 5T54A 2DO7A 1EH8A 4ZYHA 2VCCA 4HXCA 4RN5A 4OFGA 3HZJA 4J19A 3RPUD 2VJIA 2R7VA 1W6QB 2XLAA 1P4XA 3L7WA 4QGNA 3POWA 4MH0E 3Q9SA 4AIHA 1S2BA 3NQHA 1S5LC 1A8MA 1DPRA 5KXCA 2IGKA 5FZGA 2FZ2A 2NNNA 5BNGA 5FREA 3JRDA 5IVCA 1OSGA 2VQLA 5C4JJ 1RRJA 2M0MA 2D5VA 3TO9A 3K0LA 2WAQN 5E16A 2ZC2A 1AR71 1WJDA 1KQ8A 4MVTA 4KFCA 2W25A 4BL0B 2D6LX 4LK7A 4ZZLA 2DYRH 1VJ2A 2BVLA 4B44A 5FQ0A 4OLLA 5IVFA 2HQNA 5LA2A 4Q4V1 1LDJA 1VQOI 2O61A 4K3UA 1JGSA 3G1OA 4A3LJ 1K5JA 3HVDA 5FZMA 2RM23 3NKTA 3NNLA 3R61A 3GVAA 3VZKA 4HAMA 2PQQA 1TWHJ 2A73B 3AXEA 2JK3A 2X6YA 2GOXB 2OCCH 3WDXA 1O57A 2XIGA 3DTKA 3EB7A 3FHQA 1JKRC 4KGQA 5L3GA 3TBIA 1BLZA 1BL0A 3G2BA 4XONA 4XABA 1J58A 3HG9A 3BTJA 2MW8A 2GDFA 5CYVA 2B46X 1BA5A 1W6OB 1T0FA 4H7MA 4TSVA 2YDEA 2XVKA 2XVCA 5M5YJ 3IKTA 3O12A 1UHWA 1E3PA 5GKAC 2E26A 3Q0UA 2ME6A 1TW3A 4R8HA 4JP0A 1STMA 1SFEA 2H1LA 1PK6A 4LG3A 4QAWA 5E18F 3OR2C 1R083 1JOBA 2RDNA 3ZRGA 3LFUA 1W06A 5CIRA 5IP7J 4IRIA 4BXSV 1U5IA 4ZZ8A 2XVGA 5L9RA 1ZLKA 4UFKA 3ZYJB 3D5SC 4MTEA 5JAXA 2YZ4A 1IW7F 3NV4A 1BZWA 5I0UA 4NIDA 2CQQA 3CMMA 1OLME 2UY9A 1AX0A 4UUTA 3UGHA 2PHXA 3ZKYA 2ZMEC 1E0EA 2E60A 4YG0A 5F5IA 3D0SA 1X4OA 4F55A 1LOAA 2XGEA 1DUXC 1PUFB 4A12A 3UKGA 1FPN1 1QJU3 1W6NA 2Y9YA 2CW8A 1P4AA 1O91A 1OLMA 1FOD1 2WWYA 2VVEA 1LEAA 2FMYA 3BU7A 3ZFEA 2IVMA 4I3GA 1XMXA 5FFXA 5DUKA 3S1RJ 5L73A 3V65A 2WB1N 3ZN5A 3WF0A 4XF9A 2XF6A 4XYXA 4ZONA 1W0OA 3UNGC 1YS6A 4UBHA 4QPWA 2DYSH 2QA4I 4W4ZA 2I45A 4Y5TA 2EH3A 4QPOA 2HWE3 3BPVA 4KL1A 3FMGA 2YC4A 2W39A 2EF6A 2VPLA 4CU8A 4LLOA 3BUCA 5FXWA 4Q5OA 2NM1A 5FTTC 4XUNA 4GDFA 3Q8EA 2KJBA 4CVUA 4UF0B 2WNVC 1CAUA 4JCKA 3OYJA 3GZ6A 3WHUA 2GH8A 3ZPOA 1NG0A 2OW4A 1IXCA 4LKDA 3WGGA 4IHTA 4F93B 1PK6B 1T2KA 1A35A 1NY71 5C8CA 1R1A1 5HS7A 4P00B 2VMCA 3C7JA 5FYCA 1S7AA 3QOPA 3GXOA 1MH4A 3IL2A 2ETEA 2D40A 5D8KB 2GNTA 4G7ZF 1D4VB 2PAMA 4UNOA 2FRHA 4FVVA 4Q4W1 2E7WA 2QZ3A 3H5NA 3VL8A 1W6NB 3E6DA 2C9KA 1SLBA 2KIQA 2WZR2 3S5AA 3GCXA 3JXSA 2Y0OA 4LGWA 5FZDA 3KWVA 1GOFA 2VG9A 4RB1A 3JBG3 4OWRB 3ZFEB 3JB4C 1F8VA 1U8BA 1IRZA 2VIXA 2W24A 3BJAA 3TOAA 2IVIB 1U5TC 1XS9A 3S32A 4YW6A 3P1IA 2O14A 4HSTA 2WT2A 4QB2A 2JIGA 1A31A 4CPBD 1P9QC 3MICA 2O5RA 4AYBA 4B1LA 3KGZA 5HODA 2DPDA 3P5JA 2DFCA 1AL21 1VIWB 1KEXA 4F52A 3KZYA 3MAJA 1JI6A 3CF6E 4LHNA 3F3XA 2RE9A 3NRUA 4YWAA 2ZS6B 1JU3A 4R4ZA 3BB6A 2E33A 2ZGQA 1HN0A 3RFRA 1FSHA 2XMLA 2Y6LA 3ACIA 5FZ8A 5KHHA 3VZJA 3LEIA 2OPTA 2E2JJ 2BY1A 2JD9A 3BOWA 1DDLA 2X53S 1EKEA 1MZBA 5JSRA 5BOXA 1FI2A 3P5BA 1FV2A 2HEYF 4UFMA 3WF3A 2FBIA 2W95A 5A7SA 1DGWY 4OI1A 3FXLA 4CU6A 2DDUA 2QQLA 2C0ZA 3BI3A 1ZHFA 3ZYBA 3HSEA 1UZ0A 4XILA 3DGTA 1Z3XA 2IUWA 3SISA 5D5UB 4R9CA 1NUKA 2ID3A 5KWRA 2BGCA 1DZTA 2G9WA 2R061 1ASJ3 4GWMA 1WKMA 1YUDA 3TGNA 3K9TA 5LB6A 4P9UA 5JR3A 3HMYA 1V6LA 1YXWA 1YJNI 3VHPA 4P9XA 1NQJA 1D8JA 5FCCA 4RGUA 1WJEA 1CPMA 5E3MA 2M1BA 4LULA 5JUVA 5DEQA 3WEZA 3LEGA 3HOXJ 1ZQ3P 1RUG1 5KHIA 1AR82 3J7LA 4M01A 4HDUA 1AXZA 4R1HA 2BY2A 3W2WA 3VKMA 2NZ9A 4P5OA 1Q1VA 3V8LA 2HWVA 1ZGWA 4IUGA 2PHWA 1PNGA 2QDRA 1QZYA 2R071 3IPVA 1G59A 5KVRA 3VHRA 5CZKA 3O0VA 1I39A 4AAXA 4GZ9A 4W6XA 3RCOA 4QPQA 4DBQA 2QCSB 2VQUA 4WBBA 1JXSA 1RMU2 1RJ7A 2RDSA 4HA8A 3CJNA 4BEHA 6PAXA 3WY6A 4XMIA 4KG8A 5A3UA 1B6AA 2LY1A 3I49A 3FLPA 2EIEA 1GMMA 1PVC3 4RGXA 3VFZA 4PDWB 4D69A 1R23A 5GADJ 5CFCA 2MLGA 4PGGA 3JAMZ 5BPXA 3TEWA 2OTJI 4U88A 1CF7A 1CVNA 5FV3A 5DYMA 3JRHA 2V73A 1RUD3 1VBE1 1Z7UA 3LSHA 3H3VK 4WZCA 4Y1VA 2JA2A 3K46A 3RJPA 1FMD2 4P1WA 4J01A 2XKOA 4AXOA 1FJLA 3LFKA 1KFUL 5IOYA 1YQ5A 1TME3 2ERFA 1O4XA 1RUI1 1UNBA 5DD8A 4CYCB 1SLTA 4WWCA 1CPNA 3WDWA 1ZLJA 1HW2A 4YVSC 1IOAA 2FQ3A 1JUMA 1AHDP 4K1YA 2L2OA 2HGCA 4IHSA 3AZWA 2Y0SA 2JENA 3AZXA 1DGWA 4U7BA 2ISZA 2Y75A 1W6MB 5FPXA 3PVOA 2NOGA 2JDNA 5IT6A 4EGYA 1XYPA 3IN9A 4RB0A 3ES4A 3KETA 4UY8I 2MEV2 3SCHA 5F64A 1LHVA 4IL7A 4QPYA 3FZVA 4JKKA 2J7MA 3LEKA 4KDPA 5KK1A 3J8F2 5DUWA 1H30A 2A3SA 1JYWA 1NT0A 1D0HA 3MYXA 3L2HA 1QXRA 3TN93 4QKFA 3OY9A 1OCCH 4XZUG 1SFNA 4HK8A 3TOJA 2DTRA 1PVXA 3IPVB 4DFSA 4CCCA 1HV1A 4ON0A 1C8M1 2HYGD 3GFIA 1BVP1 2HWD2 1MKMA 3VBUC 4F83A 1NCQC 1Y9MA 3BR0A 3KGLA 4UVAA 1U8RA 3DTIA 1X1BA 4G94A 2MG4A 3S7EA 5C3RA 5EGOA 2LK2A 4MQ9F 2V5DA 1IUYA 3AYEA 4XQDA 2UYBA 2L3DA 4MGIE 1UY1A 2NQYA 2XR4A 4LO4B 5FZKA 1PO11 2HOEA 2L0KA 4XRMA 5IWFA 4BGDA 2HQRA 5J1UA 1VQ7I 2YUSA 1VTNC 1HLVA 5JOYA 2HBUA 1RR7A 5HV4A 3FXUA 3SEZA 2A6YA 2W94A 2DF7A 4U36A 4F3JA 4Y5SA 4I76A 4B4CA 5CISA 2EBIA 1IN4A 3N9NA 3H1MA 3ALQA 2GALA 1K3IA 3UR3C 3WP4A 1BC8C 3QU3A 3NNJA 3DF8A 1HOMA 4C1WA 1XRUA 2ZGMA 3AYCA 2OQ7A 2C5DA 1ZTRA 4EGZA 1IKPA 1QJY1 4M9SA 4CEYC 2E7XA 3D5LA 3REOA 4K6BA 2WT1A 3FBIB 1Y0NA 4XTPA 5E88A 4XF4A 3GCWA 2PAEA 2BOLA 2YC0A 5SV5A 1PJRA 2DCJA 2LBFA 3IBMA 2EIBA 2E9QA 5F3IA 3ZIXA 1SDWA 1WCQA 3RZKA 1BEV1 2QQOA 3PTYA 2QQPA 1QPMA 3ST7A 1QKQA 2ZHKA 4E9KA 1ZKGA 1JBCA 4XBNA 2ISYA 1FZPB 5FYVA 1R36A 2PBIA 2DCEA 2BBVA 1BBYA 2OQGA 1WA4A 4SLIA 4BM8A 3HIFA 4FASD 2VM9A 1JJ6C 3A0BC 1NK3P 4QX1A 3WW3A 4UFLA 5JI7A 4XORA 1M1EB 3E1SA 3WNLA 1YIOA 4S2FA 3DEMA 3AJZA 3RYKA 4LNVA 2ZXHA 1FNYA 3ZMNA 4CEWC 5FP7A 1ONVA 3LAGA 3PUAA 2DCTA 1QJX2 2VMEA 5ILUA 3POSA 2M4KA 4XRFA 5IVEA 2D97A 2NAZA 4MGZE 5BNOC 1NHAA 2HDWA 4E70A 1RB8G 4ESFA 1XYOA 2LRPA 3R60A 1RTVA 1F5JA 1X3WB 4UVCA 3HRTA 1LCLA 2DUQA 1RKTA 4JV4A 2UURA 4ESBA 3SLIA 2ORXA 2VCMA 3GMEA 3BR3A 5K9YA 3KYLA 4NJ4A 5BNNA 1XGSA 1E5IA 4NHMA 5FUIA 4LB5A 3KP6A 1RVF3 3GYHX 1N3QA 4FPHA 4XJZA 2MH9A 2RN7A 2FX0A 4S2GA 1SVLA 1XTAA 1VE0A 3OYCA 1F43A 3VD3A 2BGPA 3SH4A 1JHHA 4L9VA 2LBFB 1Z7S1 1TWCJ 2KQRA 1KJLA 3MLJA 3ACGA 2X6XA 5CVJA 2D7FA 4EN0A 3H35A 5HLTA 3WTVC 3MW2A 2HYJA 4CPBA 4EJVA 1RETA 4ZDPA 3A01A 1XE8A 3IIIA 1QY4A 1YEWA 4ES8A 2ZKNA 3BG6A 3S3NA 1F9NA 2L9RA 4HDVA 1USTA 4J1WA 2WAAA 1OKOA 1F4AA 3WF1A 2Y2ZA 4DYCA 5ACA3 1Q8QA 2PMZA 1ZGAA 1H88C 4COUA 4D7TA 1CX1A 4J25A 3SNMA 1L7RA 3I71A 2Q0OA 5FIXA 3WTWC 5IW0A 1ZBA2 3CMYA 1BYHA 1GDTA 1WGXA 2CRGA 4O5VA 1W7PD 1SDDB 4EJWA 2HXOA 4K7JA 2WT0A 2LTNA 2HWC2 3IDBB 4LE4A 2M2EA 3BIEA 1VBD3 2FD8A 3K10A 1KU2A 4RHV3 4OIQF 2BW3A 3K4NA 5J1YA 1I1SA 5FUNA 3POJA 3R0JA 4HVQA 5ED4A 1PIV1 5IAVA 5HPOA 3B7MA 2PLV2 2QF7A 5L9BA 2YGLA 3KE2A 3LFIA 2VZ3A 4E7ZA 1V9U2 2UY8A 2JE7A 4PDKA 5BPDA 2X8KA 4GQ7A 2WY7Q 1FYKA 5GAEJ 4HF1A 4P9FA 4XICA 2C9AA 3MLKA 3I58A 2OJED 3AL0B 3WQ7A 5FP9A 3EQLF 4PJNA 2X09A 4UWDA 4IL6C 2GLOA 4M4PA 3G73A 2WZR3 2SLIA 1YS7A 4LBOA 3IDAA 4AQTA 2ARBA 4BU2A 2X5IA 4K2EA 2LKPA 3LEMA 2ZGOA 5FXZA 3JD72 2AXTC 2R7OA 1SD6A 2OC6A 4BNCA 2EZKA 3D3AA 1N3OA 3LQCA 2GXAA 4BACA 1HQLA 3QD6A 4Q0VA 4G8XA 4COZA 2AACA 1LFUP 2CMPA 1KJRA 5GPAA 5GAGJ 5CA6A 3RKXA 1OH3A 3POFA 1DZQA 1H8TC 5FKCA 2VBZA 2LVSA 2VNRA 2XUBA 3D8CA 3Q8AA 3WDYA 3CNAA 1N75A 5DDGA 3NAPC 3PNYA 2R1BA 3CUOA 4UHTA 5LK5A 2RM21 2JSCA 4RD7A 1JZ4A 4GIQA 5J48A 5K0UA 2X51A 2R5ZA 2RMU2 2OTLI 4URTA 3RZMA 1XBFA 2XOMA 1HKTA 3N9LA 2IP2A 1XQNA 3BALA 2Q2EA 4MSVA 3I2OA 3ENRA 2WZPP 3I4MJ 1SFPA 3SMHA 2R0FA 3BY6A 2VE9A 4HW0A 1IZ1A 4V2FA 2VQCA 2CHHA 2DPUA 1ETXA 1GICA 1ODNA 5K7PA 5F27A 1QXJA 5E17F 3JR9A 1V5FA 4O6JA 2XASA 3TB0A 4FTBA 1GV5A 1ENHA 2UWCA 3HBKA 3ZR6A 2X5IB 5IOZA 1UZCA 4WX9A 1AR83 1FC3A 1DGRN 4AI2A 5F6LB 2Y60A 2OXBA 4ZXEA 1VAVA 3AP6A 2X4HA 4HX7A 2V1DA 3B6CA 4XN3A 1VBB2 2ARXA 2F6BA 2PQSA 1VQMI 4JC1A 3PL0A 3AP9A 2P17A 3PNVA 9ANTA 2I74A 2BTVC 4HRIA 4IEYA 4KIBA 2BJSA 4AVBA 2TRTA 4D3WA 3HT2A 5EFUA 3OGGA 4KT6A 4O61A 4YZ1A 4FCYA 2XPVA 3W5MA 3ZQ7A 4NNJA 1UCXA 4QQPA 4L0PA 5F08A 3U2RA 1DQ0A 4NPRA 1WLWA 2X1DA 4ABZA 3U9GA 4RGSA 1H2KA 5D8AB 3T1LA 1KD7A 3GHNA 4AFMA 1HKQA 4WM8C 4HLTA 1VR3A 2ZJQF 4IRGA 4A3KJ 1GHCA 3CTAA 1DCSA 2JDMA 3AAFA 2HWE1 2Q1ZB 1SBEA 5J4VA 1JT6A 3LQRA 2FBEA 1TNTA 4KBZA 1JW6A 3K2OA 3CQZJ 5FMOS 3N7MA 1A5JA 4FHTA 1MBHA 5F5CA 4NPLA 5IK4A 1W36C 2JRMA 5LA0A 3F72A 1J2XA 4N43A 5IT3A 1B8IB 2ZJRF 4RS5C 4XFHA 4XFCA 1CGPA 4BCUA 2ZMEA 4ONUA 3GXUA 4NVPA 1E5SA 5JFRA 3QYFA 3ZN6A 2DWRA 1J1TA 2MEV3 3GX4X 2F4PA 4HEA2 2YXSA 3T0YA 5D2AA 5F9TA 5DCFA 4RA0A 5LBEA 1RIOH 1HRI2 4XF3A 1MIJA 5EQUA 5IYBJ 3MFAA 3T0AA 4L9TA 3SH5A 3ZXDA 1IHMA 2W1SA 5EPAA 1TE1B 3I3LA 1NK2P 1V6IA 4AVVA 1W90A 4DEQA 5DABA 1UO9A 3EO6A 3KLNA 4YW5A 1OQEA 3QQAA 2A71A 2Q30A 3HEFA 4HKLA 4GA9A 5TJJA 1XU1A 2MD0A 1J83A 1QGLA 5H9PA 5M0TA 3JBG1 2FCUA 1LENA 2O6GE 5B5EC 2HOSA 1NOVA 1V54H 1ZN2A 2V5YA 2W92A 1L7LA 3ORJA 1HDDC 4LK0F 2TEPA 2D44A 3CDIA 2WWUA 3VUOA 4Y22A 1Z3YA 3AG1H 1YLFA 2WNVA 4GH4A 1H4GA 2LW8A 2QUFA 2EJRA 2O8OA 4FO9A 1KQ0A 5A1AA 1BJZA 3ZVXA 1PUEE 2IXHA 3ZDSA 3AKTA 1UOJA 3LGRA 1KQ9A 2VTXJ 1LFPA 2PN5A 1OPMA 3I0TA 1H4HA 3ISPA 1BM9A 3B6AA 4YGEA 1W3VA 4D6RA 1O4ZA 1JZ2A 2M3AA 3A4CA 2UU8A 3TW7A 3QPHA 3MGUA 4YW1A 5B4NA 3HM5A 2WBKA 2L54A 4R9BA 1TG7A 2BY0A 1T08B 3CBNA 4N43B 3ZQLA 5A3LA 2IJLA 1N78A 1SD4A 5FRAA 2Z16A 4CCEA 4JTNA 3C3WA 5DM7F 4L5EA 2LOOA 1OR7A 4L0YB 2CGPA 2GXGA 3F8BA 4LJZF 2GOMA 3HRSA 1NX9A 1U2WA 2VOWA 3UGGA 3AP5A 1AR72 3MKWB 3ECQA 2IRFG 4NC7A 1G7YA 2I5UA 3THDA 2VE1A 5BY5A 3HOTA 1H8AC 5FPLA 4FPOB 5EG0A 1W1WE 5A70A 3VZNA 1ASJ1 4KUMA 3VLBB 3U14A 2VQHA 4XMAA 4Q4V2 5KAIC 3HN1A 1YYNA 2IA1A 3OJBA 2K7LA 3UKNA 3IT8A 3WDTA 2WNEA 1WH5A 3H8RA 5GM0A 5FKBA 2AYHA 5FZ6A 3BGAA 3UKVA 5LASA 1OF3A 4IV3C 1O3QA 2BFUS 3HEIA 2Q8DA 2QTWB 4CCNA 1WPKA 1YFUA 2B7YA 3CQOA 1R49A 5DDJ3 1LGNA 1YFWA 5J98B 3U0ZA 1Y0UA 2YPDA 4MXWA 4Y22B 1AF9A 1W7PA 2WNVB 4GH4B 1T8IA 5J8CA 4GXLA 5FBZA 2DFFA 3KT1A 3WX5A 1QJX3 4OCTA 1AJKA 4A3GJ 4XNFA 2KDOA 1KONA 3W20A 4CZSA 3P3NA 3RZGA 4SBVA 1Z1DA 4CXXA 3IAQA 2CWEA 2ZA9A 5BQTA 5B4XA 4WF2A 1XU2A 4UW5A 1ND3C 3HOBA 3VB2A 3K4ZA 3JRBA 1MS1A 5FLIA 1XSXA 4EZHA 3WINE 3VOEA 3D1NI 2XXZA 3C8XA 3WP3A 3V8KA 1RUD1 4QWNA 1IJWC 2PG4A 2D6OX 3OYKA 2WBMA 4XUQA 1SACA 4YYOA 4IX7A 4YG2F 5IP6A 1TME1 3KP4A 1FPN2 2L5QA 2AQEA 1EAH2 1Y4WA 1SFOJ 1FX7A 1FOD2 3FHZA 1ETYA 5LGNA 2PYTA 3GW2A 2WN2A 3EUKL 1F5FA 2EFOA 2KHMA 3N97A 1WWXA 2OU2A 4XLPF 1UY2A 5A3NA 2Y8KA 1GWKA 4QB1A 1PDNC 4MYEA 3E7LA 3HPHA 4Q4ZF 3WQ1A 4JX6A 2Q5TA 4NAMA 3WTUC 2ZOEB 1QGPA 3WHTA 2HTJA 2WQ8A 1ULDA 2VW0A 1AJOA 3ERED 1UB9A 2VOVA 2PXJA 3S2DJ 3O5SA 1NLQA 1S0CA 3RYRA 2STTA 1MD0A 3TN91 4MXWB 2KISA 3CCVI 1MW7A 3ZO0B 1ZELA 2A1XA 2YU3A 2F5FA 3OMYA 2GNMA 4TXWA 1G3TA 2VKHA 5EYRA 2ID4A 4HSJA 3JRFA 2BDRA 2P3JA 4BKXA 1CIWA 3OYDA 4BQ2A 1SCRA 1OCZH 2STWA 1ACIA 4B1MA 2PLV3 1NY72 2A68F 2NVTJ 2YPJA 1E5HA 2Y6JA 1VMJA 1QA6A 4W6YA 5JSPA 1PZ9A 1ND2C 2W52A 2AEYA 4BDZA 5D21A 3CD6I 2WQ4A 2M5WA 5LA1A 2V9VA 3L9FA 4Q26A 2X29A 2V1XA 4Q4W2 3DEWA 3TEZA 1WCUA 2FMLA 1R7JA 5GP9A 5HCHA 2J1EA 5HV0A 3PIGA 3B9IA 1M4WA 2WSVA 4UAPA 3JD73 2P0WA 2NYYA 3J7HA 1BR1A 4E7LA 5LK7B 2VBYA 3P6BA 2HZTA 4AFDA 1MMSA 1ZYRF 2XJVA 1DU0A 5HLIA 3I2FA 2KKOA 3P9KA 2CU7A 3ZQIA 1EH7A 3KZ4C 2D3RA 4QMAA 1REEA 1X1AA 2WZ8A 3VBUA 3FXJA 3RQIA 2WNUB 3SXWA 1REFA 1MZEA 2NRAC 2XGXA 1WMDA 3WTYC 5A3MA 1QF3A 1ZK8A 3EJKA 4ZYEA 3WLUA 2M87A 2VH9A 1FYUA 2BV4A 4LHSA 2OBPA 3C2HA 1F4KA 2YG0A 5IVYA 3P3PA 4GB31 3J80Z 1MS0A 1BJAA 1YQCA 1WW7A 1VBC2 3MV01 2VAUA 4KT5C 2HDCA 4I0WB 3PSIA 2GQQA 2RMU3 4QQLA 3CCUI 4JK1X 1ODMA 3AG3H 3I59A 1YC61 5HCBA 3RSJA 5ICCA 3VBHB 1YQ8A 1IV6A 1YYVA 1CAWA 3GUDA 4WVMA 2DA6A 2XAJA 1ZRCA 5LY1A 3NEUA 1XCBA 1W04A 5JXIA 3ZDVA 3O1RA 1V70A 2R062 4CEYA 2ZSHB 2RNJA 2YS9A 2HOAA 1FWZA 2H09A 3CJIA 2IBDA 3W21A 5I8TA 2Y6FA 4PJJA 2E34A 3KP3A 5CLSA 1YFYA 2G19A 4JBAA 3ZXFA 1HW5A 2ZHMA 4O9GA 3ZOIA 1YIJI 1HRV3 2MC4A 3S1MJ 4LUMA 2BHZA 2CWSA 5D4RA 4IW3A 3PNTA 4CUBA 4I2OA 4A5NA 2RVCA 1IS6A 1RVF1 4S05A 3GFLA 1VQKI 3F0CA 3B02A 2R072 2DMTA 1W03A 3KP7A 4HYEA 3GTMJ 3LF7A 4QPIB 1V3FA 1AZDA 1K12A 3CKHA 4H0EA 3X29B 1QPIA 4BY1J 2RS53 3M3QA 1RYYA 2QSGX 4KN7X 2XJUA 5ICFA 3CLPA 3IKWA 1JGGA 4HX8A 5DUXA 3FBNB 2W2IA 1TZOA 1BIBA 2WUHA 4CEWA 2DVDA 3RG0A 4XJWA 3W5NA 2MD5A 1EV7A 1UFMA 4DOUA 2ZX2A 4QGLA 1SLIA 2QQAA 4BQ5A 1LODA 3QP6A 2ZHNA 5ACA1 1X50A 1JXNA 1KYZA 4BJTA 1S0BA 3M8FA 1VBE2 2VZSA 1S4CA 2QSFX 3MKZA 2D6PA 1CAWB 2JPCA 4L2NA 4WVMB 3LAJA 1MQTA 1GZTA 2FDGA 3TQNA 1RUI2 1EH6A 4TZDA 1W8HA 1LEBA 1ZRRA 4IPAA 4AUXA 2GH2A 2MYSA 3BN6A 4A44A 2D6MA 3CCEI 1VBD1 4E7JA 1CD3G 5FY5A 2GP5A 4RHV1 4BB3A 3HQRA 3KT4A 3L2UA 4UFIA 4ZZDA 3CJIB 3WVJA 4FQ4A 2JG8B 4M9XA 2VCBA 2VKEA 1C4RA 3ACLA 4XLEA 1IO2A 3KCCA 4L92A 1D0ZA 1ERDA 3ZXAC 5A1LA 1ETQA 1G2HA 4EM2A 5FZ0A 5HXVA 3OD0A 4M9ZA 5F0HA 1JE8A 4PJYA 5EXOA 1PM4A 3KYCB 4LLLA 2KDZA 3WG4A 4CCDA 2E1MB 2XUEA 1U0AA 2K02A 1NH3A 1LE8A 5IT9Z 3V7CA 5FYZA 4B8XA 1C8M2 3MKLA 5CVUA 4PJLA 1S6LA 1BI2A 3K4DA 4QU1A 1XD7A 3H0DA 3RMYA 3H8UA 4UW3A 4HQEA 1R64A 4KBBA 3V8JA 2LFBA 1NAEA 1PO12 3RVHA 3T0BA 3FM5A 2B7EA 2B8MA 2OYZA 5M3MJ 2DTWA 3S1QJ 1OLRA 1YE9A 3POEA 4YSFA 2OQ6A 5DAPA 4XL9A 5JWPA 1ZA7A 2BERA 3VBFC 1JTYA 2B42B 2EVXA 3DPLC 1RGSA 2Y26A 1ULPA 1T33A 1HXDA 3FDYA 2K9MA 2QQBA 4DO0A 1MQTB 1RI7A 4U0YA 3SEEA 2YHJA 2XRLA 1RUJ3 2QE3A 2AZ5A 1RUF3 1YJLA 2ZJCA 1GVJA 1BHGA 2NVQJ 5C9AA 1RESA 1OUSA 2J1VA 2JWTA 5DXDA 3M1EA 2JEMA 3RKWA 1ZVFA 2W82A 1QJY2 3LMMA 4BQQA 3CP8A 1Y56A 2BOIA 3ZYFA 3D5RC 3BQZA 3HHGA 3A2KA 2DK8A 3KPHA 2YBSA 4YELA 3OYGA 1GOGA 3H1WA 5HNFA 4HF0A 4BA6A 4LR4A 2WYSA 4YG6A 1TTYA 1GUIA 2QKDA 5CKMA 4CZCA 5E3LA 1BEV2 3AB0A 2V1NA 4Q4V3 4M6XA 3P9CA 4NO4A 1LU1A 4KGGA 4UUSA 4BJ0A 1ZG3A 2WABA 1OCTC 4BK5A 1YX5A 2GXBA 3O8GA 4X6AJ 2L9SA 1H1IA 3CCRI 3BR2A 4NOTA 2YROA 3DXJF 2Q8OA 3HD8B 3RPQA 1GYKA 4Q47A 5FKNA 3AVSA 4WVVA 2QVOA 3WTSC 2GN7A 3A0NA 4HMZA 4BMEA 5FLMJ 4QQHA 4XJ9A 3G6JB 2JG9A 2WA3A 1WMFA 3O1UA 5AIPA 4L5JA 2OUHA 1TLHB 3MIDA 4RS8A 5K1YA 4HKWA 2YX4A 2LREA 3N7JA 4FX0A 3MFKA 1ZG5A 3HB9A 5DAXA 1IRXA 1I1EA 4AVSA 2VVDA 3DU6A 5JZGC 5EP9A 2L9NA 3RIRA 3GLLA 4X8NA 3NRVA 1EF4A 1ITYA 5FYMA 1SCSA 4CDQC 3ZKUA 4H2AA 2WR9A 4IESA 3HQUA 4QLCU 4AAPA 3ABZA 1SD7A 2XGCA 1TT5B 4QX8A 5JVTA 2EIDA 1MJAA 3SEQA 4N90A 4AM3A 5C9AB 4M3CE 3Q0WA 4CHUA 4HF2A 3UL2A 3ZM8A 2A5YB 3O0XA 2OX0A 3KVBA 5FY1A 4QPGC 5FZ7A 1STZA 4ARXA 2E19A 5DAQA 1SQ4A 1WLTA 1W9FA 3N35A 4RB3C 2W84A 2B0LA 2OA4A 1H8VA 2OD5A 1EAH3 4B09A 3ECHA 1FOD3 3L9JT 3N9PA 4FQZA 1YCIA 4Q1RA 2YBKA 3R6SA 1GZ9A 4RLQA 3A4UA 1K78B 1V0AA 1FP1D 5A1FA 5F37A 2DDBA 4UUSB 4A6OA 3KIOA 3LSEA 1REPC 2W91A 2OPWA 1IF1A 1K5MC 2OVUA 1HXS2 1PX4A 5AC91 1IXRC 2DFIA 4KQ7A 3E6CC 5FJHA 1N25A 5B66C 2MEV1 1B9MA 3KLOA 3I9V2 1N1SA 1KRIA 5CG9A 5FKLA 3HPGA 2QLZA 5FY8A 4UFJA 4HNUA 4WXCA 3ZR5A 2UV1A 3VEPA 4RR3B 2R7ZJ 4HFSA 2JG9B 4OMZA 2VKVA 3MF9A 2ZFWA 3IRQA 4CDXA 2GMEA 1RUC1 3UV9A 1XPWA 1N1VA 3GNEA 4XDQA 2RS33 2IXLA 2H8RA 1OVSA 4K20A 2H6BA 1APLC 4AW7A 1RPWA 1LDKB 3BTZA 5L3DA 1NYWA 5KC5A 3FWEA 5HVQC 2JQ7A 3WW1A 3AYDA 1L3LA 1T98A 2Z1DA 1S0DA 1RXFA 2E5NA 3FFZA 1R1ZA 2QM3A 3VBSB 3ETPA 4AGRA 1SMVA 5GLUA 4MXVA 1W4MA 5GLWA 3DXTA 4E2SA 1QNYA 1U9NA 4XLNF 2ZGSA 4CXFA 2XJPA 3F95A 4ETSA 4XUPA 4A0YA 1ZBE1 4DZJA 2JZYA 5FZLA 2QKMB 3K51A 3EUAA 3ZYPA 2PLYA 4B8EA 2Z5UA 3PVEA 3PUBA 1FV3A 3JRAA 3ZCOA 1CJPA 4WCGA 2EV5A 1DFQA 1LOBA 5BNPB 4CP1A 3Q0VA 1HBXG 1P7JA 1MPXA 1OI6A 4CDWA 1DQ5A 3NNFA 2WJSA 4Q1PA 4KG0A 1OMIA 2ZXIA 4P9IA 2W46A 2XONA 2X48A 2FEZA 3LNQA 2V9KA 1JT0A 2E7QA 2PMUA 2PMHA 4OIOF 2DT6A 1H0BA 4MO7A 2V6CA 3ILFA 3AZZA 3ZMUA 2VZQA 1W8OA 2NXNB 1MNDA 5IYYA 2K9SA 1CR7A 1HKDA 3IC7A 3SKJE 5FFZA 1TNFA 2ADUA 3I2DA 2XKPA 4CDXB 3SKVA 5IK5A 2DI3A 5EJ3A 3IAM2 1VZ0A 2W87A 2RM22 1VBC3 5A32B 3FN9A 2VL8A 1W2NA 2LLKA 2FMDA 2W68A 5C70A 4E7HA 3WDVA 4FPFA 3ZPLA 2R7XA 1I1GA 4FX4A 4AI1A 2F4IA 4DNCA 4LMYA 3MWMA 5AVAA 2P6HA 4XQWA 2JMWA 3ZQFA 4DUWA 4S04A 3CUQC 1FTTA 5DDJ1 3GTJJ 4XEZA 3OBZA 1QJX1 3VBRB 3KVAA 3BTCA 5LA9A 1JUPA 4ZZ5A 2H0VA 1F9KA 1JTZX 3QPLA 4YFWA 1X8EA 3AZYA 1FNZA 4C91A 4CDUC 3WU0A 3V56A 3N36A 2EXKA 1WBFA 4GMP0 2CL2A 3JB8A 1IS5A 4NHKA 2D98A 1GT0C 1XNCA 3WR0A 3BODA 4C1XA 5CKTA 4CDWB 1N1YA 1AR63 4XCBA 1Y8QB 1TMF1 4OUEA 3BDDA 3KEOA 1S2EA 3BROA 2Q1FA 3DKQA 1HB4A 1FSEA 4C8DA 1WSUA 2WSUA 4MUVA 1S55A 3M7AA 1QOOA 1J09A 2WV1A 1B35A 2TCTA 2FBKA 2EFWA 3AFHA 1UOGA 1QHHD 3KLSA 4IV3A 2AC1A 5FBJA 3HNMA 3VZMA 1I9RA 3C7FA 2WLQA 3ZMDA 4A6EA 1SAXA 1R1UA 3GFJA 4I98B 1SMTA 4EQQA 4P5HA 4Y20A 4CXYA 4OHXA 5CQGA 2IC1A 4EM0B 3EYYA 3NARA 1OD3A 3RZJA 3T2TA 3GTKJ 4XLHA 4YZ4A 1UOFA 3KP5A 1DF0A 1JYNA 2HWE2 3UGFA 1ND3A 4AI0A 3JQWA 4MG2A 3OSFA 4ESJA 3TAYA 5CJ9A 2W85A 4RAGA 5JCTA 3LSIA 3DTEA 4FQGA 5J96B 2ZGKA 5D5XB 2VC9A 3W58A 4LG0A 1T6SA 3VDDB 4A69C 3SFZA 5JR2A 2Q4SA 4QD2A 3MW3A 4F3QA 5FYSA 2IT0A 3PJYA 3QU6A 3AKZA 2XB5A 4R4XA 1JS9A 2PLV1 3N9QA 2OUMA 5L19A 5K7ZA 1VQ9I 1YQ6A 1XSQA 3ITQA 4AR2A 5DUUA 4MHRA 3LSRA 1C1LA 3PUSA 3N3HA 2ZXWH 4GWIA 4II3A 5F5QA 2XGDA 3GTPJ 1SFYA 3TNQA 3B94A 1K45A 5T5OA 3T8TA 2VMHA 3S15J 4XJUA 4BIOA 5AONA 1POQA 2DA3A 2VBPA 4YIIA 3Q8BA 2FQ4A 5JPNB 1B35B 2PA7A 4ZS3A 1BR4A 4IV3B 2L4MA 3JTGA 3JBG2 1H0MA 4JVAA 3POIA 4KN4X 4KISA 3H5AA 4NBQA 2CUEA 3MW4A 3M3EA 4CP2A 1S0IA 4ISQA 3HOUJ 5CNAA 3I55I 3VBOA 3QYBA 5CAZA 2ZB9A 2EILH 2QBYA 2CV6A 5K5RA 1OUXA 2VC1A 1GWMA 4HOOA 1B59A 2V4VA 4ZJZA 4DBRA 2YGMA 5IP9J 3NW4A 2DTZA 3ZYIB 1RKWA 4A3CJ 5IFTA 5FK7A 5E6HA 4L18B 1UIKA 2VUAA 4JGYC 2W1WA 1JH5A 2DFBA 3OR1C 1LOFA 5CPRB 1ULEA 1ZRDA 1RUE3 2ADEA 4JRAA 4P9WA 2XH6A 2DOFA 4BJ5C 1IRGA 2Q8KA 4LG0B 1OA2A 4KWJA 3KS7A 1PO23 3OEBA 1JZ6A 2FOKA 5CEHA 1HQWA 1XGOA 4HOBA 4XFFA 5TSWA 3O2PE 4L9NA 1ULFA 3PFIA 3LFMA 4C3IJ 2VODA 1ENSA 1IUFA 3RRDA 3U1KA 3N7LA 3CHXA 3DLLF 2AREA 2QGUA 2JX9A 1YWKA 5CB7A 1HW1A 3OYHA 5CVIA 4YIRX 4DQAA 3AMNA 2DQLA 2FJ1A 4JGZB 3WV6A 3CC7I 2RR13 4M3BA 3FHNA 1NG6A 1KU3A 1WRJA 2CAVA 3OD4A 1MS9A 1XNDA 1VRBA 2NS0A 3NWKA 5C3SA 1LAJA 1RIRA 2YYOA 3H3LA 4OZOA 2ARAA 3OSGA 1QVTA 2KXLA 1NE4A 4BQ1A 4YZ5A 1HRV1 4WM7C 1D0YA 2KP6A 3ON7A 2QVSB 2LDUA 5A33B 2VUCA 2LKXA 2NS8A 4BXFA 1BCXA 2DVAA 3VBOB 2VOPA 2ZHLA 2P6SA 2QKLB 5A7NA 2Y0IA 5FRNA 3O1VA 1PP8F 2ES3A 1JYXA 1ETKA 2PN6A 1UELB 2F4MB 5H20A 4YVWC 3O1MA 2ZGTA 3ABMH 5J1RA 3LDKA 2PJRA 3BZKA 2RS51 1GUUA 1W8ZA 3HYIA 2IA0A 4JHTA 4L11A 3T8RA 1BMV1 1R5ID 2RV8A 2VZVA 2HYFA 3KV4A 3HNYM 3J7AY 1WLDA 1OOPB 2HXIA 1GBGA 1J1LA 1H2LA 1FPQA 2VC0A 3PM1A 4NQWA 1RUD2 3OF1A 2XC7A 2VOOA 4AWDA 3K48A 2J1AA 1ZZ8A 4LLGF 3K70C 1J75A 3AMMA 3LL7A 1VRH1 4GKYA 1W0NA 3MIEA 4LOSA 2GIVA 3TP3A 5C5UA 2EIJH 1H6XA 2XRNA 1Z91A 2QSHX 4XBQA 3DKWA 3TWIA 4AF9A 3G7DA 3KCXA 1SG3A 2GC1A 2VONA 4XZPA 1HXS3 4EVIA 2LM3A 4B4QA 2E7AA 3SJMA 1UKGA 4DXZA 5FZ4A 3A02A 4IOAF 3BTXA 3CCJI 1XGNA 3GEZA 1ZAOA 1U12A 2H27A 3VHOA 5FP3A 1OYIA 2EXJA 1MMGA 1XB9A 4ZPIA 3BP8A 2WAOA 5DUVA 4PK4A 2NN8A 4FCAA 3WDUA 3TN92 5DN2A 2ICWG 3RGBA 4ASLA 4I99C 3ZIWA 4CZZA 4AE2A 5LBBA 3RZHA 1GZCA 1Z0HA 3BZ6A 2Y48A 1YTYA 5FRMA 2FDHA 4DQ2A 3A03A 2RNGA 2VE8A 2DU0A 4LBQA 4ATEA 2IS6A 4C0BA 5J1XA 1Y8RB 2H8WA 2VBXA 2G9FA 4ANJA 2DK5A 1UOBA 5E1XA 2ZCWA 4UXAA 4YG3A 1HX6A 1VQ8I 5LBFA 4MNUA 2O1QA 3LWCA 1MBKA 1Z0XA 5KXBA 4XLCA 4BOWA 1UYZA 5CFDC 4KI5M 4BQNA 2CG4A 1EPZA 3U4SA 2YMZA 4RM3A 3ZYHA 2ZNZA 4UV9A 1R22A 1S72I 4NQWB 3ABUA 3CDLA 1FP2A 2BHYA 2FA5A 4LA2A 1LEDA 3A1YA 3D82A 2YU2A 4KNCA 3L2WA 1B9NA 3WTZA 3ZXJA 3H1YA 5FKMA 2G0EA 1O5UA 2DBNA 4TLFA 1GSLA 1OCOH 1X33A 2DU9A 3HGYA 3FBYA 4X0GA 1RUJ1 2DFHA 5J6XA 1YJ9I 2LYCA 1MS8A 3JAMK 1RUF1 5DZFA 1NA1B 2ZSIB 3CO7C 5M5WJ 1PGL1 3DPUA 2XLFA 1BOBA 2ELJA 1OLTA 2CSOA 3OYFA 5H6RA 3QH6A 2HNHA 4CTEA 1X82A 2R1DA 5KXEA 3QCWA 4YM3A 2P6CA 4CU7A 4E7KA 1J9IA 2JB4A 2QJVA 2O9LA 3CF2A 2RREA 1MZ6A 2KA3A 2KRCA 3H9JA 4DEVA 3K75B 5BS6A 2VMIA 3KEYA 1YHQI 3KEQA 3I3EA 2OKXA 1Q8SA 4Y1ZA 4RAZA 2BXYA 1SVOA 4OINF 2EK5A 5EZGA 3SC7X 2ZFUA 4GB32 5IK7A 2XL9A 4RQPA 3HOVJ 5L7OB 1CAVA 5F04A 3IH4A 2LUWA 4MFEA 3VBFA 5JHFA 4ZU7A 3HGGA 2R5YA 5ABJB 1FBUA 2V4AA 2NNYA 3AG2H 3VKNA 2FCTA 3RKYA 5DV5A 1E5RA 4GJZA 2QENA 4NPMA 5IYCJ 3FXRA 3LSTA 4IEUA 2WFPA 1MGTA 4P96A 4PQ9A 2D6NA 3GTQJ 1BBT3 3OUJA 2IWGB 2CUFA 3WSOA 2DV9A 4Q8KA 5JOWA 4MIMA 5E1WA 1GP5A 2RKHA 3ZP5A 4M73A 4XRSA 4IV1C 1BN5A 3PUQA 4RYDA 3BR5A 3ABKH 2CUJA 4B7KA 2FBHA 1QJFA 5F3GA 1IV8A 2YB7A 4XCAA 5BXXA 1R5GA 1BOAA 4KH9A 3O1SA 2OQRA 4UYBA 2QDNA 2BZDA 4IEXA 4M3CF 1GOHA 2VZPA 2ESHA 2ZNYA 2KRHA 2EA7A 4XSXF 3ZLIA 3WNOA 4A45A 1UL9A 4XPVA 3K4CA 2Y0MA 1GP6A 1RVF2 2ECCA 3LSDA 3R05A 1OBNA 4A7YA 4XKBA 1XSRA 1DQUA 3GF2A 4I30A 1EAH1 3SCFA 2FDFA 2EAKA 4C9YA 1UMHA 1IN5A 5LD2C 4NIHA 5FQ0B 2HI3A 2HH9A 3JSOA 4YEJA 4LHLA 3DU5A 3WOGA 1LDDA 3I2JA 3HOYJ 1AYN3 4BS9A 2VQTA 4RQPB 4L9JA 1CAVB 2P3KA 3ZFGA 1VALA 3I3BA 4FOVA 1BC7C 4C2TA 5JZGA 1A34A 3MI8A 2HEOA 1HIXA 1W8TA 5ACA2 4OQ8A 1T0FC 2KM2A 2JDPA 2R7WA 3ZXGA 5I91A 2CQNA 1C8NA 4IE6A 5A7WA 4JRLA 4OVEA 5GTHC 2HWB3 4I0BA 3H8XA 4U0WA 4RGKA 2D5HA 1X2NA 1GVDA 3ASOH 1IRFA 3J81K 3IIAA 3AMPA 4ASNA 5D5WB 4DY5A 1WJFA 1LOEA 2RS31 4JDMA 5ICEA 1KS5A 2VZRA 5FZ3A 1VBD2 1MBJA 4QPGA 5HS8A 4RHV2 2EV0A 2PJPA 1KU7A 2V79A 1TL8A 2X05A 1XN7A 3LB9A 4D7SA 1ZZ9A 1HJGA 3U1XA 2GNBA 1PGSA 1D4M3 3BIWE 3GALA 3OPZA 4EROA 4B3XA 3S17J 3F8FA 2CQ7A 5ANNA 4LORA 4WXHA 1NE6A 3BPSA 4CU9A 5E79C 1X7NA 1ZARA 4AI3A 1OFSA 4N4NB 4XETA 3ZFEC 2W47A 1K5MA 2JKXA 1AR93 2D3SA 5FFOC 4BXUA 4PLOA 3HRMA 1UF2C 2WA4A 3FUQA 3FLTA 4RFRB 2V6EA 4GJYA 2CFXA 3ZXEA 4QKNA 4BUPA 4QX5A 5K5QA 5KHJA 4GWNA 1N1TA 2X0LA 1Y9GA 2DCKA 3H92A 1NKGA 2ZACA 3MDPA 4IE0A 4XRSG 5DZGA 1HJFA 1XSVA 3KMHA 4AVPA 4QXKA 3M8LA 5FZAA 3U75A 1W2OA 4Y1UA 4Q27A 3ZFGB 1LHWA 4W65A 3S5QA 2E2IJ 2BVBA 4ITCA 2H94A 5DTDA 2WV0A 1JTXA 5LW9A 4UFHA 3UT0A 1F31A 2HWF1 2AH2A 3AKSA 3F6OA 1UG2A 3DYOA 2L02A 2R49A 3F9KA 5A7WB 4C0HA 5DAWA 5G04L 1QZZA 2HYXA 2B9VA 1AXKA 1DDNA 1B1BA 2AEZA 2HJIA 3C3VA 3FKIJ 3UJQA 1SPPA 1VBC1 1WFXA 2HU9A 3VD9A 3LZZA 1CAUB 1QJZA 3LDRA 3TBDA 3OBTA 4QPGB 4PI2A 2CUZA 5C5TA 4CH7A 3K70D 3VPRA 1QU0A 2WKKA 5C8CB 5ERLA 3B93A 4LIVA 4M72A 5IYDJ 2AQFA 5ISLA 1LHNA 1NCRA 5CVVA 2D2WA 2F5EA 1AHSA 2JE9A 4E8CA 2XWJB 4AQ2A 4NRQA 3WD5A 3AJYA 1Y9QA 1M06G 2BQPA 1POV3 1BKZA 5BYNA 1W0UA 2YBPA 2VOXA 3SDGA 4OMYA 1BW6A 1OT5A 4PHZA 1G9FA 2ZEXA 2QCOA 5J37A 3SQOA 4OI4A 2XHNA 4QX3A 1OKRA 5FZFA 3GFMA 3BC8A 3S0MA 5FYHA 3L00A 2P5LC 1TVGA 1ZG1A 2DT5A 3M3YJ 3KV9A 1X3ZB 5F6FA 3QLQA 2BW8A 4KA4A 2ZPXA 1UMZA 1AR61 5ILSA 4I6ZA 5A3WA 4XJAA 3H3UA 5CYYA 4A4AA 2XJRA 2ACJA 4P9JA 2R7RA 2Q0AA 2P81A 4Q4X2 2Z33A 4XXAA 4YFKF 3K4LA 4META 3R4DB 1VP6A 3F8CA 1FYMA 3EHKA 2FCVA 2R6QA 4NHYA 4PDWC 3DYPA 1XNAA 3U1DA 1W0TA 4OUSA 2M0CA 3DEEA 5A6XA 2PHFA 1BR2A 2VZUA 3L2RA 2RHPA 2Y38A 2V7FA 5C3OA 4C3HJ 3FKJA 2J5PA 2VPVA 4EE2A 1ULOA 4N7IA 2A61A 1DYKA 2GP3A 5EJZB 3FZ3A 5FPUA 1YI7A 4Y26A 3WP5A 2MPFA 3JRIA 1NCRB 2XB6C 4IDZA 3RPUA 1UG0A 3OB8A 3NV1A 4DY3A 1FY7A 3IP4B 5FXVA 2CV1A 4IEJA 1AU7A 1G4DA 1OH4A 4QWQA 4XLFA 5FD5A 4N53C 5FAXA 1FIPA 1QOTA 5EV7A 1OF4A 2CO5A 1NTCA 3VV1A 5HLGA 2QQKA 5AC92 1QH7A 2JDKA 3W3CA 3ACFA 1S0GA 3OYIA 3JU9A 2EQRA 4E8DA 4XMYA 4PUSA 3MCZA 2A07F 1ST8A 2JT1A 5FZIA 2IXSA 1I6HJ 1WCSA 3DFGA 3R0AA 4XBLA 1ULCA 1PVEA 3HR9A 1EV13 1C5HA 1SEUA 3HN3A 2IXIA 2PQ8A 4XIOA 1RUC2 3V4GA 4BE1A 1K61A 1E3HA 3VHNA 4PLMA 3OWTA 3BOQA 1W8UA 4CP9A 4D9JA 4AFCA 3M1CA 2ZKLA 2RS13 4OIPF 4BEHB 1UMIA 4D1QA 1LVAA 2L9LA 4OI0A 3VSKA 3V7SA 4K21A 3ZFFA 1OPCA 4JQRA 3GTLJ 1PM7A 5CFCB 4Z2WA 3BTYA 4NR1A 1O59A 5F5AA 4MGRA 3GDBA 1CF7B 2HLEA 4Y33A 3RQ4A 4GD4A 1XMAA 4MLOA 3WW4A 4FTSA 3O0WA 4M4RA 5FZHA 1I3QJ 1ZBE2 2FUG2 2M45A 5C3QA 5FO9B 2WA0A 3CEWA 4FXKB 1IZ3A 4D6QA 1W99A 3QWLA 1RUE1 2HQ5A 2A3XA 1W5SA 3EYPA 1BJQA 3HHHA 2M9HA 1JOPA 2VBWA 5G05L 4AYBN 4B47A 4QXCA 4JOMA 1F2NA 2L9VA 1MS4A 3ZQHA 1PO21 3M70A 1PX3A 3QPSA 1YX3A 2E1NA 2F5CA 1GNHA 2R0HA 5FYIA 2X9DA 5KHGA 2LROA 1RUH1 3G4SI 5ILVA 3FMRA 1RHI1 1AKHA 2JD4A 1HSTA 3IKVA 2IW5A 4HNVA 1W8FA 3UESA 2JDUA 1J3PA 3EUHA 2RR11 4D8MA 2VMFA 4CXWA 4F8AA 1S3JA 1MEC2 4NN0A 5A6ZA 1TQ5A 1WW5A 5GLZA 5LBQA 1URXA 1DLLA 4FPGA 1ENXA 4GXOA 1S0FA 4GB33 3TKYA 3RWNA 2AS5F 3WE2A 3J81Z 2NLRA 3RNSA 3E0JB 3MVPA 1TQIA 2EA4A 1BK0A 1UAIA 2EA2A 3ZMVA 1WGPA 4FE4A 5EGOB 2OT7A 3FISA 3S93A 5EJ1B 5C71A 2VY0A 2EIKH 5CBLA 3OYLA 2H6CA 3ZFFB 2F2EA 1QU3A 3OG2A 2E6VA 1IQDC 5L9VA 3S1NJ 1LGBA 5DDJ2 1YRNA 2UYAA 4LJHA 3HOWJ 5LY2A 1W28A 1YW7A 2LS6A 2DN0A 4DPNA 4IERA 1F36A 4HN1A 2NMOA 5HNHA 1T95A 1TQPA 1X9TA 3V0BA 1LQ1A 1LUJB 2JDHA 1ZZ6A 3V0AA 5JHUA 2FU4A 2QQUA 2IAIA 3B9CA 2HKOA 3A22A 1TMF2 1VNDA 4BQYA 4YFNF 1Y1VJ 5JSOA 2VECA 3TL4X 5FPBA 3EYIA 3FMSA 2F4LA 2PI0A 3ABTA 2A75A 5A2QZ 3K3NA 3SQNA 2XAUA 1O8PA 2YSRA 1UJ8A 4CDGA 4WM7A 2RDQA 4FPCA 3WODF 3T0DA 4XF1A 4NIGA 3EDPA 3I4PA 2PHTA 1HC8A 2WAQA 1VQNI 4C30A 3U21A 1G9CA 1HXS1 4V2GA 4ORFA 1OCPA 4XBFA 1WJAA 1E57A 5BNQA 3KD4A 1USSA 4YVWA 2ZO4A 2E2HJ 2VKDA 1XJAA 4DYQA 1E3OC 2WDBA 2BBYA 2KD7A 2ZX1A 4UB8C 5E8GA 4YRVA 4L5IA 4A7ZA 5KHKA 1R1VA 2PHLA 1J7KA 1IXSB 5C3EJ 1ON2A 4CICA 4Z8BA 5FWJA 4LMFA 3W6KB 4Y7NJ 1YRNB 2Y0SN 2D93A 4EN7B 3G6EI 4OI2A 2A69F 1KZHA 2XQRA 5I0RA 4AIKA 3KF5A 1MSFC 3I3QA 4HN0A 3UK9A 1XGMA 2HPMA 3HUGA 2GU9A 2XPJA 3JUUA 2E53A 4L99A 4AQ6A 1MSEC 2GSYA 1QQP3 2K3FA 3V0BB 4RM2A 4EN9B 3AL0C 1MBFA 2IXJA 2RC4A 3DP7A 5C4WA 3KFWX 4AI9A 4CO8A 3ZXLA 5L36A 1AL0G 4D5FA 4UI9L 1S9HA 5BNNB 1W0PA 3CJTB 2PFWA 1UY0A 3G3ZA 2Z42A 2XPWA 3PJRA 3VD4A 4GAZA 1FMWA 2X6OA 3PTRB 1GLNA 2XBO2 3PIPF 2W9XA 2P2KA 3EQEA 1UZYA 4DMIA 1GV9A 1COV3 3VYUB 1P92A 4A0XA 4CA0A 1RXGA 1D8KA 4A6SA 3S3MA 1ZR2A 1WJCA 3LA3A 5D6EA 5APAA 4RGAA 4X6QB 1UX6A 2PFBA 3PVNA 3A01B 3FE5A 4I01A 2YV8A 4LE3A 4YVWB 1UXZA 3C7GA 3NQOA 1JKOC 1ENQA 1NLSA 1PGW1 4LQRA 1R71A 1AOYA 2WB1A 4EJRA 2WO7A 2CYFA 1RNLA 5HDKA 3FLRA 4D94A 3BTLA 3MZYA 4ET7A 1HQNA 4QB6A 3PQKA 1YFHA 2AUYA 2ET7A 2V4JC 3WNKA 3KYDB 4YPJA 3LQQA 4IJAA 1OD5A 2B9SA 5CFDA 3POYA 4XOPA 4GMP1 2KIFA 1I27A 3PURA 5J47A 1VB4A 5T5PA 3WQ0A 1WBLA