4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
2PBIA 3O3KA 4PIZA 4AIJA 1O7FA 3OCPA 4XBFA 2BNOA 4XF3A 2RVCA 4BHPA 2ZNYA 4OFGA 3WW4A 4M9SA 3CUQA 2RV8A 1TW3A 2GWRA 4L9TA 4HV6A 3MFKA 5F64A 2M8EA 4E2GA 2LF8A 2D5HA 4KWKA 4PGGA 3TOBA 5FB2A 4OMZA 4KIGA 5HDNA 4LG0B 4IERA 5CVJA 4WK8F 2XAJA 3E5XA 3LWFA 3CO2A 3H9AA 2JRTA 1Q43A 1IRFA 2I45A 4AVAA 4DQ2A 3L09A 4IEQA 3QP5A 4EGZA 3K1MA 4MQVA 4UV8A 2D45A 3KEQA 4U0WA 3HRSA 1WSUA 1J59A 2DQLA 1YFXA 2ATFA 4GYGA 1S8NA 2W24A 2QYOA 1GQGA 2XAHA 3DPTA 1X8EA 1UFMA 1J58A 3GEZA 2FXAA 5K5OA 3SHRA 1LJ9A 3EHKA 4PIXA 4JQFA 2DK5A 2EFOA 4G8XA 2VN2A 3MAJA 1G3TA 1YFUA 5JAXA 4Q5SF 4Y17A 1T2KA 2QJVA 4WX9A 3FXQA 2KIMA 2P8TA 4O9EA 4KA4A 3N97A 4O9GA 1CAXA 2CQKA 3OOPA 1X3UA 1OI6A 3WTXC 5J8CA 1BM9A 2Z2SB 5J3UA 1P6RA 4P96A 2Y75A 1BOAA 3KP2A 3K1NA 1FYLA 5CLSA 1FYMA 3FMQA 1ZREA 4ZYEA 1YLLA 3H3UA 3TDZC 5LGTA 1FC3A 4HZFA 3JZVA 5K5RA 1RGSA 1NHAA 3E6MA 1T39A 5AIQA 1IF1A 1YIOA 2HTSA 1QGPA 2XLAA 2DAOA 4XLNF 4Q4ZF 3HRTA 5FPXA 1Q1HA 2O8XA 1O3QA 1O3RA 2Z9OA 4EM0B 3QPHA 1D5VA 1Q3EA 1U8RA 1W7PB 4AWXB 4B8XA 1ZZ9A 2HQNA 5JR7B 2NAZA 4UBGA 4U0VA 1ULYA 3M3IA 1H1MA 5LHIA 2MHFA 1LDJA 1OYIA 2FOKA 2HKOA 4FHTA 1G3YA 3J80K 3HUGA 5ICEA 1Z7UA 1R5GA 2IPQX 3DEUA 1HBXG 1OR7A 1T98A 1PP8F 3FZVA 1BJAA 2GU9A 6PAXA 3KCCA 1HXDA 3M70A 4CYDA 1G4DA 5D8LB 3WGGA 1HKTA 3QOPA 2IXIA 2DPDA 2W84A 2M30A 2ZXJA 1V70A 5TJJA 1IN5A 4XSZF 1O4TA 2VC1A 4UV9A 4AVPA 3GZ6A 2OZJA 4JV4A 1KU9A 1LRHA 3KGZA 3CUOA 2W57A 1T38A 3SCFA 4QGLA 2K7LA 2V9VA 1UPIA 4UVAA 4MX3A 4YRDA 3QP6A 4LA3A 1DPUA 3BROA 3O6BB 1ZGJA 4A0ZA 3ROUA 5FLIA 4Y15A 1D8KA 2WWYA 2VBXA 1ZZCA 5H6RA 2DLLA 3CLOA 5L3GA 2YPRA 4D0PA 4XLPF 1HSJA 2OYZA 1VR3A 3F23A 5KVRA 1IN6A 2V09A 1QZZA 4R52A 3LA2A 3CEWA 1YHFA 1HSTA 1LEAA 3GFLA 3DXJF 2EA7A 4Q0UA 4HX7A 1HKQA 3SMHA 1YW7A 4UXAA 1QBJA 2FF4A 3BJ6A 4CO8A 1BIAA 2VE9A 2V1DA 4MTEA 2ESHA 3SZPA 4LLOA 1SMTA 4META 3SXWA 5DCMB 3S7EA 2EB7A 1NE6A 4WCGA 2B0LA 2JPCA 3LFKA 3FFQA 5HVQC 5C6CA 3C3WA 4EGYA 4FBFA 1CAVB 3EQEA 5CVUA 2DU9A 2EV6A 4E2QA 4Q48A 5CYVA 2O1QA 2PFWA 2V6CA 2E1CA 1OMIA 1T0FA 2QM3A 4HVQA 4ENKA 4YIFA 4I01A 4LULA 4UVCA 1UW8A 2DQRA 2STWA 1U6GA 4HVRA 3BB6A 4OU0A 1R1TA 2VBYA 4Z2YA 2HYGD 1UIJA 3RPUA 5H6QA 3IL2A 5FCCA 2DCTA 3F6OA 3CJNA 2JT1A 2O03A 3F3XA 1I1GA 1P4XA 2Z33A 5E8GA 3RIRA 2L01A 5HI0A 3IBMA 1YFWA 4BNCA 3U9GA 3H8UA 3REOA 2ZKLA 4IVNA 4G9YA 3BJAA 2IP2A 4GULA 3TOAA 1J0RA 2EV5A 4FX0A 2LKPA 1XMKA 4HDUA 1QPMA 4XFAA 2XL9A 3RYRA 3J7AO 5HS8A 4YNIA 4MV2A 3HT1A 1PM7A 2ZJ2A 5JCTA 3F8CA 4XEZA 1O5UA 1EV7A 2K02A 1W5TA 2KJBA 4XRFA 4LTAA 4HF1A 1IXRC 5IT3A 4EM2A 2L4MA 1U5TB 2LNBA 1HW2A 2D93A 2J5PA 2XVCA 4ASNA 1OPCA 3KGLA 1H9GA 1NZCA 5D5UB 5CU1A 5DD8A 2STTA 1R58A 5LBQA 2PJPA 1O5LA 4LUMA 1NE4A 4M73A 3SCGA 3HTUA 4ESFA 1J9IA 3E5UA 4LG0A 3MDPA 1ZH5A 2VOOA 1WWXA 1XSXA 2A6EF 4MQ9F 4WXCA 5H20A 1X82A 1TNSA 1WKMA 4BXUA 3ES4A 5L3DA 3UKNA 1YTYA 4AD9A 1Y9QA 5JSRA 4GGGA 4MGIE 3ABUA 3SCHA 2XKPA 3ZMVA 1SEFA 4AXOA 4OINF 3SQNA 2Q0OA 2VOPA 2X4HA 2PAEA 1USTA 3FF5A 5KBFA 3ZP5A 3R4KA 4QM8A 4YFNF 5D5WB 3KZYA 2QBYB 1YW8A 1HKSA 4HX8A 1LVAA 4WZCA 1B9MA 5LEKA 4KMFA 4WXHA 2DFIA 2B8MA 1AOYA 1J3QA 4LFUA 3V7RA 4NQWA 1MJBA 4L18B 4HSJA 3I7DA 4ZU4A 2VBZA 4IRGA 5FDBA 5I0SA 1I27A 1ON2A 4MGRA 1DGWA 1QY4A 1SD4A 1OD5A 1LEBA 5EZWA 5ILVA 3QAHA 5L3BA 3LAJA 4HN1A 4OOIA 3HIFA 2QBYA 4I7HA 4ZU7A 1R7JA 3BWGA 2FQ3A 2ADUA 4G6DA 3RI4A 5CVRA 3WTYC 1S7AA 1OYWA 1FYKA 1V4RA 5FLJA 3FXRA 3VOEA 2D2WA 2NYXA 5K8SA 2PLYA 5BPDA 1ZG3A 4IHTA 3HRUA 5I0UA 4JBAA 1F1ZA 2Q0AA 3QPTA 2RGVA 1YG2A 5LRSA 2JPBA 5FFZA 3CL1A 3BDDA 3OF1A 2FRHA 1FT9A 2EFQA 5JSPA 2O3FA 2YR2A 4HDVA 1ON1A 3RYPA 3FMRA 2E7XA 3J81Z 1JXSA 4HAMA 3FJSA 1QZYA 2D1VA 2ETEA 1SAXA 3I53A 2COMA 4JTOA 3TO7A 2OA2A 4ESJA 2FA5A 1MGTA 5DYMA 4ENMA 1CAWA 3ZMUA 1E17A 3M8FA 5J48A 3EYYA 4F8AA 2NNYA 2HQRA 2GZWA 4L0YB 2D40A 3W6KB 3CDHA 3L9FA 1U5TC 2PQQA 2Q4SA 3IC7A 4HA8A 5FPZA 1UD1A 2B5HA 4KIFA 3RKXA 3C18A 4QXKA 1XCBA 4XFCA 4L9NA 4LJZF 3GX4X 1REPC 1IXSB 4A0XA 3KMHA 4AQ2A 1BI1A 2IA2A 4ENNA 1WA4A 5L3FA 5HS9A 1KU7A 3FE5A 1WRJA 3COAC 4XFFA 4AVCA 3BCWA 1CF7A 4ESBA 5KHKA 3QU6A 2OBPA 4WWCA 1K78B 3SHFA 3P9KA 2XIGA 4IRHA 5E1XA 3IWFA 1XDUA 1GVJA 4P55A 3U1DA 1LB2A 3EO6A 5FLXK 2PI0A 3KP4A 5D6EA 2GH2A 1V3FA 4WF2A 3EUHA 2IXHA 2CFXA 4EM1A 4AQ6A 2A61A 3ULQB 2EVXA 1ZX5A 5KHHA 3CO6C 5LRRA 1TQPA 3M8EA 1EY2A 2JZYA 4D7SA 3EJKA 2D1HA 3C3VA 4EJTA 3IRQA 3F8NA 3RZZA 2IRFG 3EDPA 4HX4A 2P4WA 1KU3A 4UNOA 4U88A 2MD5A 2L54A 3LSTA 1ZZ7A 1TQ5A 2ISYA 2PTMA 3ERED 2MNGA 4UXNA 4FX4A 3H7YA 3P7NA 3NEUA 3HSRA 1SFUA 3FZ3A 3FX3A 3KEOA 4MNUA 2PG4A 5BS6A 3NL1A 1XD7A 2PYTA 1B6AA 2QQBA 2L02A 3KP6A 1ZZBA 2GXGA 3HYIA 2CG4A 1MDMB 3HHGA 4LMYA 5F1RA 2HWVA 2BYVE 4IJAA 4I98B 3W6JB 2EWNA 1G3WA 3H1YA 1ZG1A 4MGKE 4RS8A 3AAFA 2P6SA 4P9UA 3ZN0A 4PJYA 2Y0OA 3BPZA 3PVBB 3KP3A 1J2XA 1ZHFA 1JUHA 2BEOA 1Z1DA 5TRDA 1Z05A 3IIAA 1S7OA 3FM5A 4M6YA 2DT5A 5E1WA 3WGIA 2XLGA 1WLTA 1ZYRF 2IXCA 3ZMDA 1TQMA 4P9FA 5LHHA 1CX4A 4H0EA 4UUVA 1KQ0A 1ZVFA 3HT2A 2K4BA 2QDRA 3H3ZA 5E1ZB 5J6XA 1UB9A 1FZPB 4MUVA 4EJVA 5FQ0B 5D1IA 3HOTA 1CAXB 1FBSA 4TLFA 3JSOA 1FI2A 3MEXA 2PN6A 2VT2A 4Q0PA 1IXCA 4NVPA 4O5VA 1USSA 4XFBA 4EJOA 2UY8A 5I0RA 1PMIA 3CUQB 1SFXA 3OTFA 4KDPA 1J5YA 5HDKA 2FMLA 4OLLA 1YQAA 4MGZE 3V7CA 5T3NA 3GVAA 3FHIB 2GAUA 4HV5A 1ODDA 4P5OA 2Q1ZB 3R6SA 1UIKA 4PGHA 4F7ZA 5LHGA 2H6CA 3DF8A 3ZMTA 4G7HF 4OIOF 1RTVA 2A07F 1WGPA 2XV4S 1MJAA 4JK1X 3QRFF 5FQ0A 3E6DA 3V8JA 3VFZA 1KYZA 4ZH4F 2CV6A 3MQ0A 5L3EA 2HFHA 3CLPA 2QVOA 1RZ4A 3NSTA 1U5TA 3S2WA 1YFYA 1RNLA 4G7ZF 1XMAA 1R5HA 3BZ6A 1CAUA 4G7OF 5E20A 2FMYA 2X0LA 2RKHA 1TQIA 4ZYGA 3LAPA 2XAGA 1IUYA 1Y0UA 3HRMA 5DDGA 4O6JA 3PNAA 1KQ9A 1R36A 1XE7A 1BIBA 4NHJA 4KL1A 2R7DA 2UXXA 4EQQA 3R0JA 4ZU5A 4FAHA 3KFWX 3KZZA 3RJPA 5E1RA 1J1LA 2VXZA 4EV0A 5DCMA 3WTVC 3HSEA 3UKTA 1BI2A 1RC6A 2VE8A 1VJ2A 2C0ZA 4D7TA 3TKYA 4A6EA 3G3ZA 1FLIA 4IEUA 4GXOA 4IEWA 3KLNA 4RB1A 1QXRA 4LB5A 2KKOA 1ZRFA 2UYBA 1DPRA 2MH9A 4R1HA 4XFGA 4K2EA 4S05A 2HDCA 4LLLA 2PAMA 3RKWA 3TNPB 1YS7A 4ETSA 3RYKA 2JTVA 4M9XA 3J80Z 3RPQA 4XF1A 1BI0A 4ZZDA 5ERIA 4XFIA 1XB4A 3ZN1A 1DDNA 5D4RA 1YW9A 2HTJA 1TTYA 3DN7A 3GUDA 4J1WA 1FSHA 2UYAA 4BQAA 1ONVA 4A6DA 5L3CA 5J8FA 4UBHA 3K9TA 3WU0A 3P9IA 5I93A 1WI9A 2Q8KA 5BV6A 1XGMA 1S29A 3C1DA 5E8IA 5DCFA 4EJWA 4LD5A 4GYIA 3WTZA 5J7MA 1I6XA 3VHRA 3ES1A 3ZMZA 2M45A 4Z82A 1EH7A 4EWAA 3JTGA 3K69A 2ZMEB 4OMYA 1FXZA 5KK1A 4WBBA 1IN4A 4KN7X 1Y3TA 2EA4A 3NKTA 1ZARA 4BHBA 4YYOA 5JFRA 2OZUA 3T0YA 2PA7A 3D0JA 4IEVA 4HLXA 4Q0SA 1MJ9A 1LNWA 3V8LA 1Q5OA 3GBFA 1W7PA 1J3RA 2GA1A 2PAKA 4X6QB 3G73A 1UCXA 3TO9A 1XN7A 2E9QA 5F6FA 3L00A 1B59A 3EETA 1L3JA 3RKYA 2YSRA 1F9NA 2K0GA 3H92A 3PQKA 1DZRA 3I59B 5JI6A 4I2OA 2XAQA 1RUOA 2FBHA 2ZFWA 1ZN2A 1GXQA 1OYYA 2J5OA 1UHWA 4BH9A 3FM3A 1ZLKA 4L11A 2HGCA 3BOQA 1OKRA 2FBKA 2M1BA 2UXNA 4G6QA 3BPXA 1H1IA 1F5TA 1GHCA 3NQOA 3I64A 4LLGF 1KGSA 1A04A 5D5VB 3VODA 4B09A 1K78A 3SFZA 1Z9CA 3VEPA 3N4MA 2KIUA 2ACJA 4B29A 5EFUA 2ISZA 1BC7C 2DK8A 3QACA 1PUEE 4FAGA 5K1YA 2EV0A 3F72A 4IEXA 4M9ZA 2AS5F 1LR5A 2VT3A 1S6LA 5CJ9A 3LA3A 5AIPA 2BGCA 3EQLF 1WQ2A 1X7NA 1DP7P 1X8MA 2Z5UA 3H7JA 1ZZ8A 2ZBKA 2CO5A 2K4JA 4QX5A 1MKMA 1H9TA 1FX7A 3L7WA 3WE3A 3GWZA 2AXLA 5CADA 3IKVA 1D3YA 2MA3A 1XCVA 5D6FA 2FSWA 2PMHA 1AWCA 2MBFA 1I1SA 1CAUB 3E6BA 2IT0A 2OU2A 3D5LA 3B02A 1J3PA 3U0ZA 1KYWA 2ET1A 4LA2A 4I0BA 3B73A 3V7SA 4ZYDA 4M72A 5BY5A 3I4PA 1U78A 2FBIA 3MZYA 3CUQC 1XGSA 4XETA 1T6SA 5BPXA 4L5JA 5I91A 2OD5A 1YYVA 2EFNA 1SD7A 4RGSA 2HZTA 5FGMA 2CYYA 4CICA 2M87A 2QUFA 2ZO4A 2VONA 3TNQA 1SD5A 2XL7A 2QNKA 2F5EA 4RAYA 1P4AA 2EAAA 4IETA 4HQMA 4BYYA 2QQ9A 2BNNA 4LUKA 4S04A 2VECA 4MZUA 1FSEA 1CGPA 4RB3C 1QNTA 3LQRA 1IZ1A 4R79A 3DV8A 1UCRA 5HDGA 2DBBA 3FHZA 4HQEA 1JHHA 2VPVA 1R1VA 1EPZA 2WFPA 5A2QZ 2IXKA 3HOSA 5KHIA 3E97A 5BXXA 3FWEA 2FNPA 3U11A 3OGJA 4XFHA 4ORFA 1K7AA 2A68F 3KLOA 3IKTA 1ZRRA 1JHFA 3QU3A 2UZKA 1G6NA 2G9WA 2OQRA 4I09A 2GXBA 4JVAA 2EFPA 1ZZ6A 4HYEA 1C0WA 2P6TA 5AONA 2C6YA 4GO1A 4O3MA 1QO0D 3GW2A 3TGNA 3GF2A 3OD0A 4IEZA 4Q47A 3WGHA 5EEGA 4KN4X 1IPJA 4RD7A 3VB2A 1XSDA 4GCVA 4A0YA 4LK0F 4A5NA 4I3PA 3ABTA 2H27A 5JSOA 2FE3A 3R0AA 5HLHA 3TQNA 5BPIA 1XE8A 1YWKA 2GC2A 1LDKB 2L4AA 2CAUA 4I0AA 4HVOA 2IVMA 2BV6A 3I0TA 1ZAOA 2XASA 5ILUA 2CAVA 2HR3A 5FFXA 3H50A 1MD0A 2A6HF 2IA0A 2IW5A 4MTDA 3KP5A 2H94A 4IEYA 3F8BA 3GO5A 3IRRA 4MEYF 3JSPA 3GYDA 5I8SA 2E7WA 5D8KB 3ISPA 3CF6E 2VC0A 4CDGA 1B1BA 2RNJA 2V79A 2FNAA 1OFNA 3I71A 2LF7A 4UVBA 1EH6A 3HQXA 3ZPLA 5EEHA 4KIBA 3WTTC 4CHUA 1YFHA 3CTAA 2P5LC 4KWJA 3BPVA 2HS5A 2KXLA 4JTNA 2P7CB 4XF4A 3GFMA 1IAWA 1ZRCA 5BQTA 4M6XA 1B4AA 3E6CC 2VBWA 2P5VA 2Q30A 1XSVA 2XRNA 5BOXA 1W7PD 1RIOH 1G3SA 3Q9SA 2K9ZA 4WVZA 4XF9A 1TBXA 3WW3A 2BBYA 1NXMA 2GQQA 3CJXA 2P5KA 2PHDA 4KUMA 4TV7A 1U12A 3IDBB 2ZNZA 4Q0VA 1R00A 2ESNA 1ZLJA 5HS7A 2VQAA 4H7LA 1W4MA 1GXPA 3BP8A 2O8QA 1EH8A 2LDUA 4IXAA 4KT5C 4EVIA 2A69F 1LDDA 4KU7A 3S0MA 4L0ZB 3C7JA 2CGPA 2IXLA 4IHSA 1R1UA 4AIHA 4NB5A 1BC8C 3D82A 4IEOA 4MEXF 3T8TA 2Y48A 4YG2F 3ZDSA 5CVIA 2JSCA 4ZZLA 4YSFA 3MYXA 3JAMZ 1FWZA 4U0YA 2GC3A 3GXOA 3T1BA 4PIYA 2Q2EA 3ST7A 3NW4A 2QWWA 4CGZA 3HHHA 3T8RA 5FLXZ 2QENA 3TO6A 2DTRA 5LEJA 1Z91A 1SQ4A 2OQGA 1L3LA 5I0TA 4L9JA 2HKXA 1CAWB 2MH2A 2A3SA 2VODA 3JAMK 4IEPA 3ACLA 3NRVA 2K86A 2D5FA 1XDSA 4R8HA 1MZBA 3KP7A 1K6OA 2PMUA 3EYIA 2EA2A 3JTHA 3E3VA 2KIFA 1BI3A 4RGUA 4HSLA 4I02A 5KHJA 2G7UA 2OAZA 2IC1A 1SD6A 4K8FA 5FLHA 3MCZA 2HJIA 1P92A 2MLKA 4P9GA 5E16A 5BMZA 2ZCWA 4MGYE 5LLQA 4OIPF 3OV8A 1YLFA 2IJLA 2EFWA 3IDCB 1XGNA 2BE5F 1PP7U 4HN0A 3U10A 3PLQA 2BNMA 1P4WA 2V1XA 1IN8A 2MLGA 4LB6B 3UKVA 3BY6A 1HW1A 3RTRA 5LGUA 1TLHB 5IT9Z 3PQJA 2MPFA 3WW1A 2EJRA 2Y0MA 3SXYA 4RB2C 1FPQA 2P7VB 2W85A 3DPLC 4QWQA 2PFBA 4XSXF 4HOBA 2XROA 4PZJA 1IN7A 1R23A 5DEQA 1FP1D 4IF4A 4UHTA 2A5YB 4OIRF 1Z6TA 4N9IA 1YS6A 4YIIA 4N0BA 2NRAC 1VP6A 3LAGA 2ZMEA 1XGOA 3MPBA 4HMZA 2ETHA 2O6GE 2MC3A 3SZTA 3F22A 2WC2A 2XHKA 3RNSA 2N7GA 2OZ6A 4KWLA 1HQCA 4BAYA 4E70A 4A5MA 2TDXA 1EYBA 5ILSA 4KMUX 4M74A 1IW7F 2CWEA 3I58A 1DZTA 4QGMA 1LQ1A 4DNCA 2DPUA 3F21A 3LQQA 3KE2A 1PDNC 3F6VA 1SFNA 3GFJA 1NYWA 5E18F 1VTNC 1W5SA 3K1PA 4QM9A 5FD6A 2HOEA 4Q29A 5ICCA 2B9UA 5HLGA 3WG9A 1STZA 2F4PA 2XGXA 3GFIA 1ZGAA 1KQ8A 5BUVA 4HF0A 4X6RB 4ENJA 3ECOA 1DUXC 1FOKA 3U2RA 1E2XA 1SFEA 3DL3A 3ECHA 1EP0A 4EWDA 4EMSA 2HEOA 4FT8A 4EROA 5HLIA 3LZZA 5JHUA 2GIVA 4A2UA 2UY9A 4QLCU 2IA1A 3MWMA 3PFIA 1XRUA 2OPKA 2FQPA 2EK5A 1IPKA 4AVBA 2GA2A 3DFGA 4RGRA 3I54A 2ET7A 3KSCA 3WTUC 4CZZA 4KFCA 2R7FA 3JW4A 1QQIA 3F8FA 1MDMA 4XF0A 3FMSA 3WW2A 5DV5A 1H0MA 1BN5A 1L0OC 4HW0A 4BHCA 5I8YA 1O3TA 5AVPA 2RDPA 4Q0QA 2ZKZA 1I5ZA 5ICFA 4LLNA 3G7DA 4WXDA 1QWRA 2CW0F 2H0VA 4Z07A 4HF2A 2XAFA 3O2PE 3I5UA 4E2SA 2DO7A 4KU8A 4HBNA 1BBYA 1FBQA 2PQ8A 4LGWA 1RL3A 3CO7C 3T5XA 2E1NA 2XUBA 2R3SA 3L2CA 4HLYA 1O57A 2QLZA 2YU3A 5C8WA 1CAVA 3DP7A 3M1EA 3S7IA 4HBLA 4OIQF 4CXFA 1QXJA 1KU2A 1FY7A 2DW4A 2IXJA 5D5XB 3ELNA 2F5DA 1R22A 3H1MA 5D4SA 2DI3A 1D8JA 1F4KA 3BALA 4U7BA 4MHGA 1UHMA 2M5WA 2K27A 3ETQA 3ML6A 3LOIA 1ZRDA 3V8KA 4LK1F 4RAZA 1J75A 2XLFA 5ED4A 4U7DA 5FO5A 4L9VA 4Y13A 3EBRA 1U3EM 2FU4A 1U2WA 5KHGA 2FEZA 5K5QA 5A2QK 4ONUA 2YX4A 5FD5A 2H6BA 4KICA 5DUKA 3LWCA 2V1UA 4BIFA 3R61A 2F2EA 2QQAA 2QZ8A 3USSA 2CSOA 5DUIA 1FNNA 2W25A 2GC1A 3V4GA 4HLTA 1LKNA 2PEXA 4A12A 2F5CA 2KRFA 3GLXA 4L5IA 5ICGA 3I59A 4MH0E 5HOOA 3WE2A 4KYWA 1B9NA 2G7HA 1ZNPA 1FP2A 4M71A 2Z3YA 3NVCA 5I8TA 4G94A 3MZHA 1RI7A 4RB0A 3WTWC 3IWZA 2P17A 4EJUA 4ZYHA 3K2ZA 4EWEA 2RQPA 4LEJA 1DGRA 2GC0A 1JGSA 3FXUA 4J1XA 4ON0A 2Z69A 1YUDA 2WTEA 3M7GA 4IRIA 1P2FA 5JR3A 3ZMSA 4PCQA 2QVSB 3ELKA 3KETA 3GZ5A 3NJZA 4AIKA 2F5FA 5JVTA 3GYHX 2RC4A 1ZG5A 3BU7A 5E17F 1RUNA 3R60A 3IHUA 4IESA 3O14A 5DD4A 3WTSC 4N9HA 1KA8A 2Z99A 2OA4A 4YFKF 1SMYF 2QCSB 3P9CA 1IRGA 3H1WA 1FBUA 3HTSB 1HW5A 3L2HA 1O7LA 2NS0A 3WODF 1TW2A 4YFXF 3J81K 4PDKA 2YX7A 1YO5C 1J7KA 3DQVC 4RGXA 3Q5FA 4L2NA 2PHLA 2O61A 2HYFA 3RDIA 1TNTA 3BJOA 3LA7A 1Z6RA 2L3DA 3D0SA 2LSOA 1GQHA 2H09A 4DINB 1O3SA 2KJCA 2XKOA 3M9AA 5LGNA 3F8MA 3WU1B 4QMAA 3HSFA 1JE8A 4KNYA 2WV0A 1K79A 2RN7A 3DKWA 2NNNA 5IT9K 2UWMA 4IPAA 3K0LA 3Q9VA 3TDUC 5CVVA 1S3JA 4QGNA 4YARA 1CF7B 2O0YA 2ELHA 3ZQ7A 3E5QA
chains in the Genus database with same CATH superfamily
3OEBA 4AIJA 4L5EA 4P9YA 4XBFA 3FHAA 1ETWA 1XJAA 2ZNYA 3CUQA 1SHWB 1KDKA 5A32B 1GWKA 2GWRA 1X4PA 2ZS6B 2K3PA 4E2GA 5K0UA 2LF8A 4GMP0 4KWKA 3K2OA 4LBQB 1YRNB 4ES8A 1QQP2 5FRMA 3LDKA 1IDYA 5FYMA 1LECA 1EKEA 3B6AA 4H3WA 2DTYA 3KWVA 3QP5A 5A7WA 4MQVA 2DTZA 4YELA 5F6LB 5A7WB 1UY0A 2Y0SN 3RMXA 5LCWL 1NAEA 1TME3 4XBLA 1YFXA 2ATFA 3OMYA 4Y1ZA 2HEYF 4Q4Y1 1DLCA 3AJZA 2V6EA 4WM7C 2JSPA 2XAHA 1X8EA 2E2JJ 5C3SA 4GKXA 2FXAA 2YHJA 3ZYGA 5K5OA 1X50A 1H8TC 3SHRA 4ANJA 2EFOA 3USUA 5A6XA 2N8GA 1ND3C 3JRHA 3K48A 2W3JA 2VN2A 3MAJA 1UMZA 1N78A 3OYLA 1YFUA 4LOSA 5JAXA 2E19A 4Q5SF 1OVPA 4NC8A 2QCOA 1W36D 4O9EA 5C33A 4L9BA 5ANQA 4LG3A 1OI6A 3WTXC 5J8CA 2R043 1MS0A 4AGVA 2Z2SB 4P96A 3I4IA 1RVF3 2VI6A 4AK3A 1HDKA 3S15J 3WNLA 3ZR5A 4NIHA 4ZYEA 1YLLA 3BR6A 4Y5Z0 2I10A 4B3NA 1FC3A 2Y60A 5K5RA 1RGSA 4LHLA 4DB5A 1LPQA 3AYCA 1EV11 1IF1A 1RESA 1YIOA 4CCCA 2ARCA 1XYNA 2O14A 2HTSA 2XLAA 2DA6A 3K4JA 3A4UA 1UN1A 3OPTA 2HOSA 1JT0A 1O3RA 3GGLA 3I3BA 2QQWA 3K4CA 2RM22 2M0CA 1ZKGA 3QPHA 1IPSA 1CX1A 1VBB3 1UHSA 1U8RA 1W7PB 4BJ5C 3Q0VA 1FOD3 1PO22 5GTIC 3AMQA 1OCRH 3C7OA 2E7TA 2CRGA 2XPJA 1FJLA 1SFPA 4BY7J 1OYIA 4CYCB 4UI9L 1BKZA 4FHTA 4Y52J 2D3PA 2QFEA 3GCXA 3HEIA 2ENRA 1Z7UA 2WB1N 5FTTC 1R5GA 1ZA4A 3GDBA 3FZVA 4ES9A 3VN4A 2GU9A 3AFKA 3GXUA 1HXDA 1FPN2 4CCMA 4CYDA 4PDWC 5D8LB 3BGAA 4QKDA 4JX6A 3QOPA 2R16A 2M30A 4FCAA 1V70A 3FLPA 2LTNA 5A7PA 4XSZF 2XWJB 1V5FA 3PJRA 4U2AA 3KHCA 4UV9A 4BACA 2HYXA 2R072 2TUNA 1MBGA 3OD4A 1T38A 3SCFA 4YW7A 2GMMA 1R49A 2ERFA 4BISA 5LA9A 2RDSA 2W92A 1HJGA 1GMMA 5DM6F 1AR61 3QP6A 4S2FA 4LA3A 4Q4W2 5J40A 2DYRH 2DMNA 3ROUA 3O0VA 5DDJ1 4TYSA 3A0BC 4AYBN 1ZZCA 3MKLA 5A3TA 2DLLA 3CLOA 4XLPF 4Q8KA 1B8IB 4RR3B 4UUTA 2V09A 3LSMA 1QZZA 2BXZA 3CEWA 2HWF3 3HGGA 1LEAA 1ZR2A 2EA7A 2WZR2 1AXYA 4HX7A 4YVSA 2HYKA 4NHMA 1HKQA 3SMHA 1FX5A 5KXCA 1QBJA 4D8MA 4AI2A 4L0PA 5JXJA 3WHTA 5GAHJ 4LLOA 4CCKA 1SMTA 3P3PA 4META 1GZTA 3S7EA 2EB7A 3LFKA 3FFQA 5A7OA 4UW3A 5C9AC 1C8NA 5IVYA 4EGYA 4IQJA 1V55H 3LIHA 2PFWA 1AU7A 3VBFA 2V6CA 5D8AA 1OMIA 3AP5A 1REDA 2TBVA 2XUEA 1T0FA 1W0UA 3AKPA 1BYHA 4N8MA 3K4KA 1RXFA 3V64A 5A6YA 3DXUA 2DQRA 5JWPA 3HN3A 1U6GA 4HVRA 4GJYA 3T0DA 4CCNA 3I56I 5AFEA 4Z2YA 3RPUA 3IL2A 5FCCA 4BB3A 4IX7A 4KI5M 2QSFX 1LOFC 1QIQA 3CF2A 4AE2A 1QZEA 1LGBA 5JVVA 2JT1A 3VHNA 3SZGA 4NBQA 3S3NA 3UETA 3FXMA 2DV9A 1YFWA 3U9GA 2IFRA 2ZKLA 3LE0A 2QQLA 3OYCA 4G9YA 4A3LJ 5FY8A 1BVVA 4FX0A 3N36A 2LKPA 1W04A 2WO3A 1R092 3GTKJ 5IAVA 4LBKA 1JYTA 3H9JA 2AGSA 4XIDA 3HT1A 2D43A 1EUUA 1W2TA 4AC0A 5TSWA 4A3CJ 1W5TA 4LTAA 1P8JA 1JOBA 3UNGC 2J5PA 1ULDA 4ASNA 1LEDA 1H9GA 1NZCA 4QIWN 3OBRA 2ZJCA 4M6VA 2VJ4A 4S0HB 4M73A 1J9IA 3E5UA 1WWXA 1YIPA 2A6EF 2NXNB 2ZAHA 4BXUA 3BN6A 1DGWX 3OGGA 3UKNA 5JSRA 2YROA 1AX0A 3LFIA 2Y33A 4I30A 3ZMVA 1ZGWA 5JUVA 2JD4A 2PAEA 1USTA 5KBFA 4QM8A 1ZR4A 5D5WB 1ULOA 1FNYA 5HCBA 3D5OA 3PNVA 4HX8A 3A0KA 3WG3A 3CC2I 3GM8A 3IP4B 1AR91 2DFIA 2B8MA 4BE0A 3V7RA 2G19A 4Y3OA 1GBGA 1ENHA 2BHYA 4ZU4A 1XG1A 4F91B 1JKOC 2W95A 1WJAA 3POGA 3IUOA 1JGGA 1DGWA 4ZTJA 1LEBA 4GWMA 4IL6C 3VBHA 1F35A 4OOIA 5JR2A 3OYWB 5B5EC 4G4FA 4ZU7A 2HWD3 3KQRA 5LA0A 4AWDA 4YZ1A 3P6BA 4AGRA 5CVRA 2V9PA 2VTFA 4CUGA 2R7TA 1VRBA 1FYKA 4IV3A 2RS33 3LD8A 2YZ4A 4B47A 1O8SA 4IQPA 1WWYA 2XQXA 3U4SA 1BBT1 5C5TA 4BM8A 1F1ZA 2GIZA 2RGVA 1BMV1 5KHDA 5LRSA 4YW3A 3BDDA 2LC2A 3HBLA 2WADA 1XBFA 3RYPA 2E7XA 1RHI2 2DT7B 2XJPA 4HAMA 3FK6A 5C9AB 2NOJB 2COMA 4JTOA 1US2A 1MGTA 3HPNA 1NUKA 4OAZA 3VSKA 4C0BA 3ZMUA 5GZEA 5FYCA 4JGYC 2XOMA 3TW7A 3L9FA 1F9KA 5IWFA 5LBEA 1RUD1 2DFFA 1POV1 2PQQA 2CV1A 2Q4SA 3IC7A 2JG9A 2G4IA 5FPZA 4KIFA 3RKXA 3C18A 3BG3A 3ZFEA 5C3OA 2J1VA 4LJZF 1REPC 4F3QA 4AQ2A 4UFKA 1BI1A 4MO3M 1LHNA 4HXCA 4MSVA 5L3FA 1KU7A 3FE5A 1WRJA 3BCWA 4XCBA 4ESBA 3QU6A 2R5ZB 2MYSA 1O4YA 4WWCA 2NPIA 3SHFA 3P9KA 4IRHA 3FXOA 3IWFA 5EDNA 2WAQA 3M3YJ 1GP5A 3U1DA 3GJBA 4RFRB 2ZGMA 3FLRA 5LZ6A 2VQ0A 3NNJA 1V3FA 5C44J 1NG7A 3EUHA 1OCPA 2QKLB 4EM1A 3F0CA 4Y20B 3I9V2 1T0FC 2JZYA 1H4GA 1SAUA 3CCQI 1GU3A 3C3VA 5J1XA 1NY71 5EJZB 3IRQA 2DDAA 4D0QA 4F93B 1YI7A 2P4WA 4D6SA 1OURA 1TT5B 5T5PA 3U37A 5C8CB 2X6XA 1D0GA 1G9FA 5CKQA 4EN0A 2VIXA 2HLEA 3H7YA 4JKLA 4KGGA 4UF0B 4FXGB 3LFUA 4E7IA 3JD71 4N43A 4LHSA 3TEYA 5IK5A 2WL1A 2RS52 4OZXA 2D6KA 5FZEA 2M8GX 2L02A 3ZYHA 3LKJA 5EGOA 3HYIA 2AXTC 2HBTA 5F39A 3UT0A 4LMYA 2OVUA 1W0OA 2BYVE 5A3UA 1PYVA 3WSOA 1Y1WJ 4IJAA 4XRSA 1G3WA 1G9CA 1ZG1A 4UOJA 2VZPA 3L2WA 4M3CB 3VBSB 4B3XA 3VD7A 3ZN0A 4C3IJ 4BJTA 2YPJA 1MEC3 1JUHA 3WCSA 4DPNA 4AHYA 4FASD 1N3QA 5E1WA 3Q8AA 3WGIA 4CUCA 1ZYRF 1ACCA 1TMF1 1JZ8A 1MBHA 2CW8A 3AM2A 2QDRA 3I4MJ 2MG4A 2DVAA 4YW4A 4B4PA 1AR81 4XE9A 1UB9A 1GANA 4MUVA 5FQ0B 4Z2WA 3HOTA 5KWRA 2LLKA 1US3A 1HB1A 3JSOA 2B63J 4QHZA 3CD6I 3ZSLA 2VT2A 4NVPA 1F5FA 5HV4A 4EJOA 2UY8A 2NS7A 1UY1A 4N53A 1YC61 1YQAA 4NN0A 1PO12 1UG2A 3J8F2 2DBIA 3V0AA 3AL0B 4W6XA 3IMMA 5EEAA 2VG9A 4BQ5A 3GLLA 2WA4A 2DCZA 4SLIA 2BBAA 2UURA 2MSYA 3R6SA 1JTZX 3ZMTA 3DF8A 4AFAA 2CHHA 2Y9YA 2BVMA 4ZC3A 5K7FA 4ASKA 5JZGA 3QRFF 5FQ0A 2QKDA 3V8JA 3FBMA 1F36A 3E7LA 5FZ6A 2QVOA 2XPVA 1DQ4A 1XSQA 1U5TA 3UYJA 1E0EA 3D3AA 1XMAA 2TCTA 4XOTA 3RZOJ 4BY1J 2CU5A 4JHTA 5IVVA 1PO11 1AKHB 4AR2A 1IUYA 1Y0UA 4O6JA 3PNAA 2CQXA 1SZBA 2IGKA 1OVSA 1XE7A 1OCCH 1BIBA 2LM3A 1Y8QB 4KL1A 5GAGJ 2R7DA 4RM2A 5GPCA 1Z3YA 3R0JA 2VNRA 3D8CA 3MV11 3USUB 2WIIB 1T33A 4EV0A 3WTVC 3FUQA 3UKTA 3MW4A 2XVKA 3TKYA 2CUFA 4K21A 2XQRA 3HG9A 4A6EA 2LS6A 4IEUA 5EYXA 5FZGA 4CDUC 4IEWA 4GXOA 1V9U2 2VZOA 2FCTA 1DPRA 2YGMA 4R1HA 4XFGA 4K2EA 3WF2A 4F92B 2L5QA 2HDCA 2L2OA 4I6ZA 4LLLA 5J4VA 2PAMA 3O12A 3PUHA 3RRDA 4ZZDA 3M1CA 4XFIA 1OCTC 1GDTA 1ZBE3 1G86A 5D4RA 3N7JA 3SEPA 1ONVA 4A6DA 4R9BA 1YITI 1Z21A 1HLVA 3S1RJ 3P9IA 1WI9A 2Q8KA 4YW2A 5A3WA 2Z4FA 5DCFA 3KV6A 2ZXHA 4EJWA 4HPKA 4ITVA 2M45A 1QKQA 4Z82A 3D6EA 1XX5A 4PSXA 4N90A 1SLIA 4RGAA 3U4XA 4PK4A 2ORZA 2D3SA 2ZMEB 3PDQA 2A6WA 5KK1A 4WBBA 2OTLI 1YRZA 2EIBA 4KN7X 1Y3TA 2XF6A 2EA4A 4UF0A 1ZARA 5LY1A 1CJDA 3VYRB 2WY8Q 2OZUA 1EUTA 4AQSA 4PJ0C 4Q0SA 3ZN5A 5LFAA 3DTEA 3GBFA 4IHWA 1F15A 2PAKA 1G9DA 1RUC3 2QE3A 2FD8A 1ENRA 4N4NB 3HJRA 3L00A 4PJLA 3M3QA 3HQUA 9ANTA 5FY7A 1XNDA 1L3JA 1H2LA 4FFHA 5DG1A 3PNTA 3PQKA 1JHJA 5JI6A 2EILH 3ZXFA 4I99C 2Y26A 1DU0A 1UHWA 3JCIA 4YW5A 1ZLKA 2VQGA 4QD2A 1BCXA 1W6OA 2UXNA 4G6QA 3BPXA 3OEAA 1CWPA 1OOPB 1PZ9A 3NQOA 3GHMA 2HNHA 4IV3C 4KBZA 2KFDA 3VODA 5FPLA 4B09A 1K61A 4XYXA 1Z9CA 3VEPA 2KIUA 2ACJA 2C5DA 2ISZA 3W21A 3OSDA 3B5LB 1BC7C 4IE6A 3QACA 1PUEE 2AS5F 2NQYA 2LVSA 2R071 2WNVA 3EQLF 1X7NA 2K46A 5FYHA 4M00A 2XB5A 1WD3A 2WAFA 2Z5UA 1ZZ8A 1VQPI 2R93J 3BVCA 1H9TA 4OHXA 1FX7A 1PJRA 1A36A 3GWZA 3EPZA 5CADA 4RYDA 2DCYA 2YU9J 1PVC3 2W91A 2MA3A 2I07B 1XCVA 3W2VA 1FPN1 5D6FA 2PMHA 2ZC2A 3AMHA 1AWCA 2MBFA 1W0NA 1I1SA 2IEKA 1F2NA 1S55A 2IT0A 4XQFA 4OHYA 2QTWB 1J3PA 2CYFA 3VHOA 3U0ZA 2W87A 1V6LA 5FZDA 1LUJB 2HXIA 3KYDB 4XICA 2DA3A 1MMDA 4YEJA 2GSYA 3B73A 3V7SA 5BY5A 2FBIA 2X29A 4XETA 3OUJA 3ECQA 1T6SA 1PIV3 1AX2A 4ZXKA 2DDUA 2KDZA 2EFNA 1I6HJ 3N7MA 1OOPC 1SD7A 4OMCA 3H9QA 4XDPA 1RR8C 4CICA 2ZO4A 2UWBA 2VONA 4Y4YA 1OA4A 2XL7A 3VBUB 1QQP3 3U14A 4BKXA 4IETA 5E89A 3S1NJ 3DPRC 3T1LA 5B3SH 3LEIA 2XB0X 1CGPA 4RB3C 1QNTA 5CFCC 3KD4A 2HBUA 1GFF2 3H3VK 3DV8A 5HDGA 4HQEA 1JHHA 2LY2A 2VPVA 1EPZA 4BQXA 1H9PA 2R7OA 1VQLI 4XURA 2QEXI 3VZOA 3U11A 1OC1A 4HK8A 4ORFA 1DYKA 4RSUA 3KLOA 3NNGA 3H8OA 2GNDA 2CMPA 3I97A 1UZZA 1ZRRA 1G6NA 2R7ZJ 5EJ3A 4DRVA 4YW6A 2VTXA 4BQ1A 3T3YA 3ZFFC 3AK0A 4AZZA 1C0WA 2C6YA 4GO1A 3POWA 4GIQA 1LU2A 4UFHA 1QNYA 3K3OA 5IPAA 3WGHA 2WAOA 4XRMA 3WDUA 1DBNA 3VB2A 3S30A 3JRCA 5HNHA 1KFXL 4XQDA 4A0YA 4LK0F 2CQ7A 2DMTA 4A5NA 4I3PA 1QJU2 5IVFA 2GC2A 3TQNA 4ZPIA 3ZXSA 4I0AA 2F4OB 3DBRB 2BV6A 4K3UA 1QXPA 2CAVA 4YGEA 3BIEA 4JX0A 1W8UA 2IW5A 3OYJA 3KP5A 3IRRA 5C8CA 4GB31 1Z7S3 4DBQA 3JSPA 4LK7A 2Y2ZA 5M5XJ 1HDPA 3CF6E 3MW3A 2VC0A 1B1BA 2RNJA 4J25A 2V79A 2ICWG 3TEZA 1OFNA 2LF7A 4UVBA 4F52A 1XU1A 4GWIA 3ZPLA 4INDA 1CIYA 1BR1A 3PUIA 4KJZA 1BVP1 4PBOA 2JWTA 3ZX7A 2HS5A 3MLJA 3UR3C 1D1BA 2ZGUA 3Q3SA 3OB8A 4O65A 2DOAA 4GH4C 1IAWA 1RVF2 1ZRCA 2IWGB 1VAVA 3I3LA 3OPZA 1COV3 4A3GJ 3JUUA 2XRNA 4UW6A 4XJWA 3GF6A 2K9ZA 5IJRA 5C7GA 4QDQA 5FZOA 2RJKA 3LDRA 3WW3A 3S2DJ 1FMD1 3S17J 2VJ5A 2OS2A 2VPRA 3LIGA 1Z3XA 2GQQA 2KIQA 4QDRA 1U5ZA 3WQBA 1W6QA 1U12A 2ZNZA 4CDWA 3JRAA 4AQTA 2VQAA 4MIMA 1DGWY 3DBHB 4IXAA 1W2AX 4KU7A 1DFQA 5C3EJ 4NB5A 3VZMA 3BCBA 2IFWA 4AIDA 5JVGF 4IEOA 3T8TA 1PZ7A 3CJQB 4YG2F 3ZDSA 5L7OC 1O91A 4ZZLA 1ENSA 4YSFA 1DQ5A 3MYXA 3PJYA 3JAMZ 2KP6A 1FWZA 4QPGA 3E1F1 4CEWC 4FTEA 1RUG2 1FPN3 4JKMA 3TO6A 2JE7A 4Q4X1 2R7RA 3O1OA 3D1NI 5I0TA 2ZPXA 1G8XA 4MGQA 2MH2A 2A3SA 2VODA 2VBBA 4AHZA 2VXJA 2C4XA 2K86A 2UWCA 1U8BA 3MV01 5CNAA 5FZMA 1Q8PA 4P14A 1MZBA 2WS91 2AR6A 3CMYA 2CY6A 5EJ1B 2W5FA 2KIFA 2W1UA 2OAZA 2ZGTA 1SD6A 2VMEA 3S8PA 4K8FA 1QHHD 2K2SA 2EIEA 3OV8A 2GMPA 1E5IA 1QA6A 5CEHA 2BE5F 2NVXJ 2AQFA 1PP7U 5DABA 3U10A 3FDYA 3PLQA 2BNMA 2QZ3A 4BXFA 2DCKA 2MLGA 2VZ1A 1GWMA 4LB6B 1HW1A 3RTRA 2ZX4A 5FV3A 1TLHB 3PQJA 3KM5A 3K4MA 1VAKA 4RB2C 5F0CA 1CZVA 3FFZA 1PHMA 1OSGA 2W85A 4ZZ5A 3ZQIA 1OH4A 4QWQA 3I2DA 1JZ3A 2QBXA 3TBDA 5HNFA 2XROA 3I2KA 2QQJA 1R23A 2DJIA 2WAQN 5DEQA 3K70D 4XXAA 1IS6A 4MGSA 4UHTA 2YBPA 4OIRF 1CIWA 3SH5A 3K4LA 1VP6A 4N0BA 1D4M3 2ZMEA 1XGOA 3IAM2 3F22A 1IV8A 2DYCA 3RG0A 3RNSA 3FC0A 1MS3A 2BY3A 2N7GA 4KISA 1ND2C 2MFZA 5IOYA 3G71I 3H0OA 2WNUC 4E70A 4A5MA 2XMLA 1EYBA 1Z7LA 5E3NA 3KEYA 5BNOC 4M74A 2E53A 3ZCOA 4B1RA 4RS5C 2CWEA 3I58A 1DZTA 1WMXA 1LQ1A 3QH6A 1FIAA 3F21A 1WBLA 5G04L 3GFJA 3HOVJ 2NVYJ 4IDZA 4RQPA 3K1PA 2XGDA 4A93J 4AAPA 2AYHA 4CZCA 2A7AA 3MUZ1 2VVEA 1STZA 2XGXA 1RUF1 1YE9A 4LBLA 1ZGAA 5GJ6A 4AW7A 5BUVA 4HF0A 2E32A 5CBLA 5FIXA 1E2XA 4YG6A 2V7FA 1EP0A 2RJLA 2B42B 4EWDA 4FT8A 5HLIA 3OYMA 3LZZA 4QX1A 4A2UA 3WCRA 2UY9A 5FUPA 2OIIA 3MKWB 3GBWA 2OPKA 2XJQA 3T2OA 2FQPA 4AVBA 2JDHA 2LW8A 1XC6A 1B35A 5AVAA 1J09A 1LOEA 4Q2FA 1MZFA 4CA0A 1EF4A 3KSCA 2VOXA 2A6XA 4HK9A 1OH3A 2R7FA 2Y0SA 4LITA 1H0MA 4XHXA 2L9RA 1ZYBA 4TLGA 3AG1H 3IDAA 4W6WA 4XPVA 1O3TA 2GALA 2Y69H 2ZKZA 4EZHA 2X1DA 3VBRC 3G7DA 5DUUA 4WXDA 2B45X 3S16J 4GMP1 4AFCA 2NM1A 1TC3C 1VBE2 4HBNA 4NRMA 1P9QC 1M4WA 2IBDA 3T5XA 4BA6A 5D8AB 2OF7A 1RUH1 3FISA 2XBO1 2X48A 1CAVA 2JICA 3PIPF 5EGOB 3M1EA 3S7IA 1TMF3 4C1XA 1VBD3 1QXJA 1UZWA 1VBC2 2IXJA 4WM8C 2DMUA 1RRJA 1LOGA 4M3CA 2ZAAA 2W1SA 3ELNA 5CFDC 2R042 5F0HA 3H1MA 1QVTA 1UF2C 1XYPA 1ODNA 4DZPA 2JQ7A 1UHMA 4Y1UA 2XRLA 1ZRDA 4B3AA 3UKGA 1J75A 5FO5A 1H89C 3DLAA 3VBSC 1OKQA 3BQZA 4Y13A 5FZBA 1U3EM 2FEZA 2PELA 2OV7A 5JI7A 5FD5A 3O8GA 4UFJA 4KICA 4XKVA 3O5SA 2V1UA 5FP3A 3N9QA 3R61A 2R6QA 5C70A 1VNDA 1YIJI 2CSOA 1FNNA 2W25A 4HLTA 3VKNA 2P34A 2PEXA 2E1MB 4A12A 1H9WA 2R0FA 2F5CA 2LUWA 5ICGA 3I59A 5HOOA 3WE2A 3A0HC 4IGOA 1B9NA 1UX7A 1MMAA 2RHPA 4XKCA 2QQIA 1EA3A 4LO4B 4CH7A 3MFAA 3ZXAC 2OC6A 4K7JA 1VLNA 1PGSA 4BS9A 4EJUA 3K2ZA 3LSDA 1QJX1 1VBA1 2EXJA 2OJED 2GC0A 4Q8LA 5KXDA 2Z69A 1YUDA 3O7OA 1G2HA 5JR3A 1C4RA 3ZMSA 4CUAA 4MFEA 2H8WA 1IG3A 4Y26A 4RGKA 1AYM2 2Y6GA 3KETA 3GZ5A 1IG0A 3CJIA 1SEUA 4AIKA 1F4AA 2LREA 1MIJA 4FPKA 1RUNA 4CXWA 1F8VA 2LY1A 4D6RA 3X2QH 2R5YA 5IP6A 2ZABA 4GRIA 1W99A 2IZWA 1KA8A 2Z99A 4LO6B 1SMYF 3THDA 2C1FA 5KAIC 1IRGA 1OA3A 3ZPOA 4YLZA 3L2HA 2D3RA 3WODF 4YFXF 4DYCA 3J81K 5F3CA 2ID3A 4P9IA 3NRUA 1ETKA 2CDPA 2PHLA 1TNTA 3LA7A 1Z6RA 2R7VA 2L3DA 2K9QA 3D0SA 2EIGA 2LSOA 3DCFA 3IDEA 4DINB 1H8TB 2CGOA 3SKVA 1QOSA 2D6LX 3K0LA 1BA5A 3TDUC 2DU1A 2NOGA 4YARA 2W0XA 1BL0A 2JDNA 3J7MA 1XSRA 3AG2H 4CYCA 2PBIA 3O3KA 1N47A 1WCDJ 4ARYA 4UW5A 4LNVA 1A3KA 2M34A 4OYUA 4BHPA 4OFGA 2VJXA 1OR7C 3VDDA 1V00A 3WW4A 1VBE1 1GV5A 2RV8A 4DXZA 1TW3A 2QQMA 4OUEA 3RZLA 4IV1A 1JJ8C 3M07A 4PBPA 1WJFA 2XJTA 2V4VA 3OUHA 2VH9A 5C4JJ 3R4UA 2BY0A 5F8PA 3IN9A 4OMZA 4IERA 4HKLA 4CVUA 5CVJA 4WK8F 5HCFA 1RETA 3GZTB 5GLUA 1Q43A 2F6BA 3AX4A 3UGHA 5BNNC 4QQOA 1YQ8A 1PUFA 4K40A 4EGZA 3WP4A 2D45A 1JHNA 3KEQA 2KQRA 4ZDLA 3H9GA 5E88A 3HRSA 4GYGA 1MNEA 4BOWA 4FP3A 1GQGA 4C30A 1YJWI 3HGYA 1R71A 2VQTA 2CJJA 2ZGNA 3TN93 4GA9A 4BK5A 2BOLA 1PK6B 3HPHA 3EHKA 4RDUA 4JQFA 1GWLA 3N9LA 2ZA9A 4G8XA 5C4XJ 1WLWA 3PU8A 1G3TA 4IOAF 4KG8A 4XMIA 5ANNA 2P8TA 4KA4A 3N97A 1W0PA 4CA9A 5B1BH 1CAXA 4XACA 1X3UA 2L9NA 4Q4W3 4I0WB 1IUFA 5GZFA 1CR7A 1FYLA 3AG3H 5CLSA 1FYMA 3FMQA 1W8TA 1E5HA 3H3UA 4IHXA 4I76A 4RA0A 4S2GA 4JQTA 3JZVA 1NHAA 4CRQA 2ADEA 4CE8A 3AL6A 2DAOA 1JUPA 5FPXA 2O8XA 1NA1C 4OMDA 1O3QA 3FBYA 1SLAA 1PGW2 3PHMA 1XC5A 1G7YA 3FN9A 4XOPA 1ZZ9A 5JR7B 4UBGA 1ULYA 3K10A 1PNFA 3DTIA 2VTXJ 5AC93 1LOCA 4CU6A 5D21A 4HOOA 4GH4B 1FOD1 3HUGA 4RM3A 2VW1A 5LBBA 1HBXG 4A3FJ 3HC7A 4BGDA 4YVSB 2AEZA 5B4NA 3J7HA 4LKDA 2ZX1A 1BQPA 3KLSA 2JA8J 4CCEA 4HNVA 4IL7A 4OHVA 4E7SA 2EINH 1G4DA 3WGGA 1HKTA 4GKYA 3ZYJB 4D69A 2IXIA 2DPDA 5IK8A 4OHWA 3M4OJ 4UYBA 5FY4A 2ZXJA 2OXBA 1IN5A 4LXLA 2ZXQA 1O4TA 2VC1A 2VB6A 4AVPA 1RKTA 3FIWA 1LRHA 4XBQA 3DYOA 1JN2P 3KGZA 4F3JA 2JJ7A 5K0UC 3VBOC 1V9U1 4S2DA 2O7OA 3NQHA 1X1DA 2K7LA 2V9VA 3M3CA 3ZVXA 3DKQA 4MX3A 3HBZA 4E7KA 4CSWA 2BY1A 1KDMA 1O6UA 1BEV3 3BROA 1SPPB 3U1XA 3T4HB 1H2MA 1EPWA 4Y15A 1VF9A 4NC6A 3W5MA 2FDGA 2VBXA 4BDZA 3CF5F 3EYPA 5DDJ3 1VR3A 5M3MJ 5KVRA 4WM7B 4FE4A 3ZPYA 1YX3A 3LA2A 2VZRA 2IVIB 1KONA 1YHFA 3GFLA 4Q27A 5M3FJ 1HLCA 1OPOA 2VL4A 4CP2A 5FPBA 5IW0A 2LG4A 1YW7A 4UXAA 4EN9B 3BJ6A 4CEYA 1WJ5A 2V1DA 4MTEA 2W08A 2HWB2 4QX3A 1Z67A 3B3QE 2V72A 5A33A 3LF7A 1BHGA 1GZCA 3G2BA 2X53S 4WCGA 2B0LA 2EIDA 5F2SA 2FDHA 2LK2A 3C3WA 4YVWA 5FZFA 3C7EA 1IDZA 3WV6A 2RR13 2DU9A 3DWLE 4QPGB 2XUMA 5CYVA 1D0XA 2E1CA 2GM4A 3I55I 2R1DA 1W8OA 4I01A 4LULA 3QBQA 4UVCA 5CQGA 3BG9A 5ACA1 4YG3A 4NWWA 2STWA 1MH4A 4OU0A 3MIBA 1NA1B 3P5BA 1A5JA 4FOVA 1JUSA 1CONA 2AACA 2M9HA 1P4XA 2Z33A 1C28A 5E8GA 5B66C 3AZXA 5GLZA 4IGQA 4FPOB 4OUMA 1V6JA 4E8CA 4BNCA 4D9JA 3VLBB 2FX0A 4IVNA 3TOAA 5JPNB 1CZSA 1J0RA 4FISA 1RUJ2 5FAXA 3WF3A 4M3FA 4CU9A 1UZVA 2NS8A 4A44A 2XL9A 3J7AO 4MV2A 5EV7A 5FZ0A 3ABZA 3KS7A 2A75A 4D5CA 4HL0A 3I2OA 2D5VA 4QX2A 5JCTA 1O5UA 4NAOA 3G1MA 1EV7A 4RL7A 3ZXEA 3PUFA 2F17A 5A80A 3VD5A 5IT3A 1HW2A 2D93A 5A6ZA 2XVCA 3FHNA 1R58A 1RUC2 4FE7A 5LBQA 5DG2A 4GB33 3ZIWA 3TP0A 4QX0A 1S9HA 1NE4A 3DYMA 4ESFA 2GLOA 4LG0A 1V6KA 2ZSHB 1XSXA 2WT1A 2XJVA 1BEV1 2P6CA 4WXCA 1X82A 1TNSA 1UYYA 3L1PA 3WP5A 4AD9A 5KXEA 1Y9QA 4GGGA 2MEV3 2WABA 5A32A 5AC91 1DU6A 1UZCA 5IUQA 2XKPA 1AL23 1SACA 1SEFA 4OINF 3JRIA 2E60A 5FO9B 2Q0OA 3K4BA 2X4HA 4W50A 2CH0A 3ZP5A 2DN0A 2WDBA 2QBYB 2RNGA 4A3JJ 5IFTA 2VUJA 2R7UA 1MQTB 1LVAA 4WZCA 2WS93 4Y24A 5FLMJ 2DTWA 4WXHA 4E7HA 4DOUA 2DVGA 3WQ1A 2Q8OA 3HEFA 4NQWA 2OQ7A 4L18B 4HSJA 3I7DA 2MD0A 1YRNA 2VBZA 5FKBA 2W7NA 1ZBE2 5FY5A 5TISC 1ON2A 4MGRA 4BUPA 4NROA 4AEMA 5EZWA 3LSJA 5L3BA 3HIFA 1XNKA 4CDXB 5FZCA 3N9NA 2M4GA 1R7JA 3BWGA 1REFA 1R083 2ADUA 3RI4A 1KGYA 3WTYC 3VPRA 3ACFA 5J36A 3S1MJ 1V4RA 3FXRA 3R4SA 4D6QA 2CWMA 2F4LA 1IKQA 5DAWA 3OBAA 5BPDA 1ZG3A 3HRUA 3MGUA 2Q0AA 1K83J 3QPTA 1YG2A 2HVQA 2ZKNA 4XMAA 3BODA 2CUEA 1YOVB 3OYNA 2QF7A 5FFZA 3CL1A 2HEWF 2FRHA 2D98A 1FT9A 1CJPA 3MD2A 2O3FA 4QU1A 3O1RA 2P2KA 1ON1A 5C71A 3HVDA 4AEKA 5L7OB 1U5XA 1RC9A 4YGBA 2L7ZA 3FJSA 4LK6A 2HQAA 2D1VA 4AG4A 2ETEA 2E26A 4LBOA 3I53A 3FKIJ 5FUNA 3TO7A 4ESJA 3C7GA 2FA5A 4DUVA 5J4YA 5DYMA 2VNVA 4A3IJ 1E17A 5J48A 1UY2A 5E6HA 4F8AA 1M06G 4IHVA 3CCRI 5F9TA 2HQRA 3CC4I 4L0YB 2XF7A 3CDHA 1WW5A 2YC0A 3PM1A 3AC0A 4Q1RA 4HA8A 2RS11 1JI6A 4XFCA 4L9NA 3GX4X 4A0XA 3ZQCA 3ATGA 4ZDPA 1WA6X 3K3NA 4B7EA 1MACA 2HXOA 2G0EA 3CLQA 1W2NA 2VQHA 1X33A 3OYDA 3GTGJ 1W1WE 3ZMNA 4M3EA 4AF9A 1UOFA 1T2XA 2XIGA 4P55A 5GTHC 1NZIA 1WBFA 3IZOA 1UO9A 1X4OA 1UL9A 1BLZA 2VW2A 3SFIA 3I3MA 1S1AA 4WF2A 2X6YA 2VQUA 2CFXA 2A61A 1URXA 1S0FA 2HWE2 4HKWA 1ULCA 3V56A 3CO6C 3M8EA 1T8IA 2RMU1 3SDBA 4FPYA 3F8NA 3RZZA 2IRFG 3JQXA 3ZFGC 3KYCB 4YIRX 4UNOA 1K5JA 4U88A 2MD5A 3LSTA 5J1RA 1TQ5A 1E5SA 3P5JA 5FKNA 5FP8A 4K20A 2MNGA 2P3KA 4FX4A 3HSRA 1H0BA 2HWD2 4Y5SA 1D2SA 2V26A 1JXNA 1SBEA 3KEOA 2PG4A 1NX9A 5F7UA 4H7MA 3NL1A 1ETVA 3OS0A 3NAPC 1B6AA 2HWE1 2CTVA 4KNCA 3T30A 3KP6A 3SH4A 2GXGA 5J47A 1MDMB 1ULPA 2XJUA 2ZB9A 1UU4A 2HWB1 1K12A 2E1OA 4I98B 3W6JB 3ZSKA 2EWNA 1S4CA 5LWBA 5IK7A 3JREA 4MGKE 4RS8A 3AKSA 3AAFA 4AFMA 2XVGA 4P9UA 4LLFA 4NAMA 3CZ6A 3BPZA 2TRTA 1SFKA 2HWC1 4RBOA 5K9YA 4OWRB 2D7FA 2BEOA 1Z1DA 1S7OA 2DT5A 1GZWA 2XLGA 1DCSA 1HQLA 4O61A 2IXCA 1DQ1A 5F3GA 1TQMA 2E34A 2M7BA 4QXHA 1CX4A 1ZVFA 3WG7H 2LOOA 5E1ZB 3O1SA 1FZPB 2COBA 4AHWA 3OS2A 1FBSA 1D2QA 1K5MA 2Q1FA 4TLFA 3WNMA 3SYTA 3H36A 3FXJA 3V42A 4QPWA 4AVZA 2VNGA 5EG0A 4KWUA 5H9RA 3BTAA 2VZVA 1PIV2 3ZSJA 3CUQB 3OTFA 3OOXA 4OLLA 3GVAA 3L2YA 2LY9A 3FHIB 4WVWA 2AO9A 1QH7A 2Z16A 4BBRJ 3ITQA 4HV5A 1FNZA 3MLLA 2Q1ZB 1H2KA 5BNPA 1IGOA 1VBD1 1XOYA 5F27A 3SLIA 4F7ZA 3MUY1 4G7HF 1WGPA 3LNQA 3H1CA 1Q56A 3J8F3 4BQOA 4RMNA 2HOTA 3AFHA 1KYZA 2KISA 3VZLA 4LPLA 2CV6A 2DURA 3W58A 5FLVA 2VPLA 3HR9A 3PJQA 1YFYA 1PUFB 4G7ZF 4JOMA 1W05A 1UJ8A 4C9YA 3MICA 2A5WA 2RKHA 1O4XA 1AR71 2NVTJ 1Y9MA 2VKHA 2J1TA 4WVMB 3LAPA 2XAGA 3BUCA 1KQ9A 2J1AA 1R36A 2EAKA 4HSRA 1B72B 4BLJA 4NHJA 2Y8KA 2VZ3A 1W6MB 2UUZA 1VE0A 1LFBA 4MFDA 2R5YB 5E1RA 4K1YA 2A5ZA 4QKNA 5JPMB 4Y1VA 5IYYA 1MQTC 2E33A 1BI2A 5FZ3A 1VJ2A 2VE8A 1HV1A 3A0NA 2H1KA 3BPSA 3T0AA 2LMDA 1WJEA 3O1TA 1WJCA 4B7KA 1GZ9A 2F48A 1MVQA 2R061 4QU2A 1CPMA 2KZGA 4YZ2A 5F37A 2MGQA 1S2KA 5FZIA 4CUBA 4DGWB 3TNPB 4NJ4A 3RPQA 4NC7A 3OGVA 2WT2A 2CU7A 5FY0A 3ZN1A 1MBJA 1A6IA 1FSHA 4BQAA 1MS1A 2P3JA 4EEFG 3A21A 1XGMA 3C1DA 4YM2A 4QPIB 4LD5A 3WTZA 3ES1A 2WKKA 5A3MA 5EYYA 1HRI1 1LAJA 4LIVA 5DQ0A 2UWAA 3U21A 1A78A 4HG6B 2ZGRA 3K69A 5A7SA 4GWJA 4PLMA 3PTYA 4DY5A 1IN4A 3RZHA 3W3CA 2NLRA 3X29B 4YYOA 1QOTA 3T08A 5JFRA 2BZTA 2VVFA 5A70A 2PA7A 1W2UA 4N7IA 2H0BA 4RS5B 1YI2I 1ST8A 3VBUC 3PURA 1J3RA 1VQ5I 5E8AA 1QU3A 3AMPA 3G73A 2MW8A 3LQCA 2E9QA 3RI9A 2X5IC 1B59A 3EETA 4J19A 2D6OX 4PLNA 3H92A 1V6OA 2JG9B 3WNXA 3I59B 1IOAA 2XAQA 1OLRA 1OYYA 1ZBA2 2J5OA 4BH9A 1UELB 2EH3A 2WS92 4AYUA 1BK0A 2HGCA 3MW2A 3BOQA 2FBKA 2BGOA 2R7EB 3PSFA 3L9JT 1BEV2 3TAYA 3I64A 5FYTA 3RWNA 2R5ZA 1K78A 3SFZA 3N4MA 4YFWA 1JBCA 3N35A 2JE9A 4MADA 1X3ZB 4QX7A 2RVAA 1TWAJ 5FYUA 4M9ZA 2VT3A 1S6LA 5AIPA 2WYFA 1X8MA 4C3JJ 3ZFEB 2ZBKA 2CO5A 2K4JA 5FK7A 2WWUA 1MKMA 1AHDP 1W90A 3ZLIA 2A6YA 4KMQA 3L7WA 3WE3A 4ZY9A 1VPHA 3PUSA 4IUGA 2AXLA 4QKFA 3IKVA 3LEMA 1JYNA 2FSWA 2RDQA 2VOWA 4Q4W1 3B02A 2R0QC 3T2PA 3CCSI 1SBDA 1MZEA 4QQPA 4CDXC 4LA2A 4I0BA 5K0UB 4M3DA 2ZX0A 4CP1A 4QT6A 1UOBA 2ZZQA 5FGMA 1GT0C 1TME2 2GP3A 2KD7A 2QUFA 2EIKH 3NV1A 2JA6J 2QNKA 4D7YA 3NMBA 1P4AA 4RLQA 2EAAA 4HQMA 2RQQA 5FOJB 4S04A 1JJ6C 3LPFA 1TWHJ 2HWC2 3DEWA 1FSEA 3LQRA 2ZMKA 1IZ1A 2CNAA 4R79A 2J22A 4BXXJ 4L8QA 3CESA 2PX9A 1R1VA 4OAYA 1NK3P 5FBZA 2IXKA 3J7AY 4RAFA 2ME6A 5BXXA 3FWEA 2B39A 3WOGA 2LKXA 4QQ2A 2PLV2 2DDBA 3H5AA 2Q5TA 2A68F 4A3DJ 1OQYA 2LKSA 4HG2A 2G9WA 1BW6A 1W6PB 2X1EA 3NWKA 1CQTA 3DKXA 4I09A 2GXBA 3V0BA 5KXBA 3J9SA 3I3EA 1ZZ6A 2MEV1 5EQUA 1SMVA 3GW2A 3GF2A 5IOZA 4IEZA 3VKFC 3O1UA 3F9KA 4AEDC 3OSFA 1X3WB 3QLQA 1LGNA 4COZA 5IYCJ 3OG2A 3AKQA 3BTLA 1XSDA 5DDJ2 4URAA 4IQ4A 5JSOA 5HLHA 1C1FA 5C4WB 1LDKB 3U78A 4FFIA 2ZX3A 1ZAOA 3I2FA 4AOCA 1Y43B 4XQWA 3OGRA 2E6VA 2HR3A 5FFXA 1MD0A 1NG0A 3FHQA 2ZHKA 4JGZA 3F8BA 1NCRB 3GO5A 5J09A 3V0BB 2ME0A 2I2SA 3GYDA 1DDLA 1JTYA 3ORJA 3NWSA 4R9CA 1BBT3 3ISPA 4LHNA 1QJY3 1E3HA 2FBEA 4AVSA 4RHV3 2ZZJA 4DXRA 4AM3A 2HDDA 3AYDA 5EEHA 4KIBA 5CB7A 1FMVA 4KWJA 1UZ0A 3JXSA 5JMOA 4W97A 2YB7A 5IK4A 1RUE2 4XF4A 2YU1A 5BQTA 4AYBA 1B4AA 1N75A 1BR2A 4G6TB 2P5VA 3T2TA 2Q30A 5FZ8A 3OYIA 1J84A 4P02B 4XF9A 1VBC1 4PFOA 1RVF1 2GNMA 3HAGA 4Z2AA 2VU9A 3OGSA 2BBYA 1COV1 2YPDA 3U07A 3MIEA 4KUMA 4TV7A 5B2GB 3BTZA 3ZMOA 2ESNA 1ZLJA 5HS7A 1VQ4I 1EH8A 3W59A 4KT5C 2K9NA 1OLME 4EVIA 2ID4A 3T2QA 2R92J 1ND2B 3IAPA 4L0ZB 4AFDA 2IXLA 5HXMA 1JMUB 1R1UA 1W9TA 3D82A 2ARBA 3RZDJ 2DUOA 2GBYA 3HPGA 1D4M2 3VWBA 3L2QA 2JSCA 2EBIA 3VZNA 1A6QA 1MSEC 2Q2EA 3MMYB 3ST7A 2XPWA 4ZXEA 3HHHA 3LEGA 4DNYA 2VXRA 1XQNA 2WA3A 1DYPA 1TZOA 4X8NA 4AI9A 5FREA 2WV1A 4XZUG 4FPLA 4XABA 3UV9A 1AA7A 4QB1A 1CAWB 2QA4I 3JAMK 1P7JA 4XDQA 1UYZA 4YZ5A 1SLLA 2VY0A 3AXEA 2RR12 5ABJC 3BG6A 2RMU2 3ETPA 4RGUA 3HKZA 3OIQA 3CBNA 2Y9ZA 1PM4A 4XONA 5KHJA 2G7UA 1FTTA 4JP0A 2JUCA 5FLHA 3MCZA 1REEA 2HJIA 1P92A 2MLKA 3GMEA 1UOGA 2WO7A 3WP3A 3J26N 5BMZA 2JA7J 4GD4A 4MGYE 5LLQA 1N1VA 2VMHA 2IJLA 1FAYA 3IDCB 1W8WA 4HN0A 5JIUA 4P9JA 2V1XA 3QPLA 5F1JA 4BK4A 1CPNA 2HYJA 1D5YA 3UKVA 3BY6A 2BTVC 4BDYA 5LGUA 3MVPA 5IT9Z 3G6EI 2MPFA 1QHDA 3WW1A 2EJRA 3RMYA 2Y0MA 2HPMA 3PTRB 1R093 1FPQA 1W6PA 3MKYB 2BXYA 5LA2A 4XAAA 4XSXF 3BTYA 4PZJA 1Y7BA 4ABZA 1FP1D 4IF4A 4UWDA 2A5YB 4A7ZA 2DF7A 5FBJA 3ZN6A 3PVOA 2ETHA 2ARXA 4IV1C 1MS4A 3OUIA 3IAS2 2DMPA 2RDRA 4FTBA 2JMWA 1HQCA 5JOZA 4BAYA 3T1MA 2TDXA 1YHQI 4FP2A 2XBO2 4KMUX 1VBE3 2CDOA 1FOXA 3PFYA 2BUKA 2DPUA 1CESA 1POQA 1PDNC 5FYZA 5JHFA 5FJKA 1ZBA3 2ZHNA 1NYWA 2J7MA 2JDZA 5E18F 2R7XA 3H3LA 3WHCA 4QM9A 5I0DA 2V5DA 1TWCJ 3WG9A 1FMD2 1VBB2 2RDNA 2C6SA 1WD4A 1UG0A 2K85A 5GAEJ 2PHXA 2YUEA 3MIGA 4X6RB 1ODMA 1FOKA 4XQ4A 4LKFA 2I5UA 1SFEA 3DL3A 2HEOA 2B46X 1JU4A 1XNBA 2AENA 2GIVA 3ACIA 3OBZA 1W8NA 4QKBA 2I74A 1XRUA 3C7FA 5CKTA 2XPUA 3LL7A 2JA2A 4Q4Y2 2EK5A 2WWSA 1IPKA 3MHZA 3DFGA 1VQ8I 4XLHA 3CCMI 2DODA 2VAUA 4RGRA 4BQNA 5H9PA 2OTJI 3I54A 3VBUA 1QRYA 4DUWA 4E4HA 3WTUC 2BV4A 2X8KA 4CZZA 1LE8B 4C2TA 1V9U3 3KX2A 3BU0A 3WW2A 3JW4A 1MDMA 4XF0A 4CDUB 1VALA 2WAAA 2WR9A 2KT0A 3B9CA 4HW0A 2R32A 4Q4V3 5I8YA 5CFCB 5AVPA 2RJ2A 1H88C 3ON7A 4XCAA 4V2VA 1PO23 2WA0A 3OYKA 1R082 3VBFB 3IIIA 5DAVA 2DO7A 4KU8A 3VDBA 2JG9C 1BBYA 3TN92 1FBQA 3TBIA 5F5CA 4IE7A 1B09A 3GZAA 4D1QA 2Y64A 4HETA 1PX4A 2R3SA 3L2CA 2L7FP 2QLZA 4PCRA 4XN3A 4BQWA 3FLTA 5C8WA 3DP7A 1ZRIA 1A31A 1J1TA 4JDNA 3HJEA 2DW4A 2XF5A 1LNSA 4HNUA 4XUTA 3SNMA 2F5DA 3VKLA 2G9ZA 5D4SA 1D8JA 1U9NA 2VASA 1AR82 3BALA 1K4TA 4U7BA 2ADDA 4E4SA 4YM1A 1TNFA 4NMIA 2VZQA 2ZMNA 2W1WA 3ETQA 3ML6A 5IVBA 3RZKA 4LK1F 2W94A 4U7DA 4L9VA 1HN1A 2FU4A 2B9VA 2NVUB 3ZYPA 5A2QK 4ONUA 3DUIA 1X2NA 2FDJA 4DZJA 4LT5A 1AJKA 5DUKA 3LWCA 4MLOA 4B4QA 3NV2A 5FR3A 5DUIA 2GC1A 3AZYA 2JG8C 3DGTA 2RS53 3GLXA 4L5IA 1OA2A 3K46A 3DU6A 2G7HA 4AFBA 4CU8A 1ZNPA 5LY2A 1FIPA 2ORXA 3WZ1A 2Z3YA 3NVCA 4G94A 1LGCA 1ITYA 4RB0A 3WTWC 3IWZA 5H2FC 2RQPA 4Q26A 2X5IA 1DGRA 3FXUA 4J1XA 3ZYBA 2X9DA 4ON0A 1YX5A 5C4WC 2WTEA 1NKGA 5IVEA 1P2FA 3UL2A 1S2EA 4Q4Y3 4DXSA 4HFSA 3IH2A 5FMOL 2RC4A 3ZYFA 5FROA 3JR9A 5E17F 4Q4X2 3RI8A 2A05A 4IESA 4NIGA 3O14A 3WTSC 5FWEA 4S2HA 4N9HA 1VMHA 2OA4A 4B4RA 3GJAA 4JKKA 4AAXA 2QCSB 5FZKA 3H1WA 1G8WA 2FDKA 2NS0A 2JEMA 2JX9A 3WUCA 2YX7A 4XJZA 4UW4A 1W5CC 1YO5C 2BERA 3WDTA 3DQVC 1PGL2 2JG8B 1SBFA 4YG0A 4MHRA 2HYFA 3BJOA 1WH7A 4M0HA 2A6VA 1QMJA 3K7AJ 1GQHA 4JCKA 4FOQA 5KCMA 4B8EA 3V65A 2WFF2 2KJCA 3ZXGA 3F8MA 4A7KA 1JE8A 3G1OA 1TME1 4YGCA 1L7LA 2Q8DA 1DQ2A 2FCVA 1VRH2 1RUJ3 1S3JA 2Q1MA 2O0YA 1CF7B 4EN6B 3VD9A 3SEZA 1RUH2 3OCPA 4XF3A 2BW8A 3HB9A 3AG4H 4LQRA 1XTAA 1U0AA 1HX6A 4L9TA 1RUD3 3U75A 1TVGA 4MXVA 3QODA 2IGNA 5ABJA 3CCYA 5F64A 2M8EA 2C9KA 2DFHA 4Q4V1 5IT6A 4PGGA 5A7QA 2VKDA 3SDGA 2VJIA 4KIGA 5HDNA 4LG0B 2XAJA 3LWFA 3CO2A 5LW9A 2I45A 4DQ2A 3ZM8A 4JDMA 1MEC2 2NMOA 3K1MA 2R063 2JD9A 4UV8A 2VULA 4OUSA 3BR2A 2HZDA 5T50A 5A1FA 4A6SA 4U0WA 5D8AC 2DQLA 3BTIA 3ZXKA 2VR4A 2YV8A 4NO4A 4KT6A 1UFMA 2FCUA 3IT8A 2JIGA 4PJJA 2BP6A 1LJ9A 4PIXA 3WNKA 1W28A 2WN3A 3WDXA 1FV2A 5FKLA 4IV1B 3AFGA 1I39A 2LALA 3KV9A 1T2KA 2QJVA 4WX9A 4ZJZA 2KIMA 3CJRB 3DPRB 1AR83 4O9GA 1JTXA 2CQKA 3NARA 2OUHA 2DWRA 1BM9A 1VQ9I 3OL4A 1P6RA 2WZ8A 1BOAA 1MBKA 3K1NA 3H0DA 3RPUD 1DGLA 1ZREA 3TDZC 1C5IA 4HZFA 5FP9A 1NLQA 5FZ4A 3E6MA 1T39A 5AIQA 3HNMA 3WEZA 4Y1XA 5EYRA 1QGPA 3JU9A 5FKMA 1S0EA 4XLNF 4Q4ZF 1OJLA 3HRTA 3VBRA 3TW6A 1GKBA 1ZK8A 3WUDA 2Z9OA 1W0TA 2HQNA 2NAZA 4U0VA 3M3IA 2MHFA 3HL2A 2FOKA 2HKOA 5DS9A 2DA2A 1AZDA 5ICEA 3IKWA 5FPVA 3DEUA 1ASJ2 1MSFC 1OR7A 1PP8F 2BFUS 1W9FA 2DXIA 1BJAA 3ZSEA 1WCQA 1BK1A 4I3GA 2CW7A 4XLFA 1GUIA 4UB6C 4JRLA 4QHOA 4URTA 2BDRA 1V5EA 2V1NA 2LR8A 4Y7NJ 4FETA 2OZJA 2W57A 4PHZA 2R062 1NOVA 1BBT2 3LSHA 2GN3A 1AYM3 4UVAA 1UPIA 4YRDA 1QF3A 4FOWA 3C7HA 3JD72 1UWWA 1W2OA 1EAH2 1DPUA 1GV9A 3O6BB 4BIOA 5GLTA 5DXDA 2ZGLA 2WWYA 4ET7A 2OCCH 5H6RA 3WDWA 3L2VA 4A7YA 2YPRA 4D0PA 3HM5A 2OYZA 1HSJA 3F23A 1MZ6A 1IN6A 2K3FA 1UX6A 5FMOS 1O4ZA 4R52A 3HN1A 1HSTA 1JODA 1RUG1 1UMHA 3DXJF 3OL3A 4Q0UA 5T5JA 4Z1VA 1R4MB 4GB32 4DRRA 1JYVA 2ESHA 1VQMI 1IS3A 5GALA 2PLV1 1UOJA 5FP7A 1QJY2 3MI8A 3RSNA 1NE6A 5F5QA 3B94A 5HVQC 4XC9A 2ID6A 1CAVB 3EQEA 2JDPA 1AHSA 2Q2EB 3KV4A 2CGNA 3ZFFA 2O1QA 3I2GA 1JZ4A 2RR11 1BR4A 3CDIA 4IE0A 1D0ZA 5DAQA 4HVQA 3ZFGB 1SVLA 4ENKA 2HVSA 3VGIA 1SFYA 1UW8A 2W1OA 3I2HA 4FTSA 3QYFA 3BB6A 4LE4A 1MVEA 4Q1PA 3WG4A 2PHRA 4GWNA 1R1TA 2VBYA 2HYGD 1UIJA 5H6QA 5ACA3 2DCTA 3F6OA 1GP6A 2W00A 4CPBD 2LBFB 2O03A 3CJTB 1XYOA 5CFCA 4XK4A 5HI0A 3DBLB 3H8UA 5E3OA 1VB2A 2IP2A 3K75B 4PDWB 2EV5A 3RKQA 3BG5A 1XMKA 4HDUA 1QPMA 5T55A 1TP4A 4IEJA 2YBSA 1K5MC 1JKQC 3RYRA 3CCJI 2SBAA 4YNIA 1V6NA 1Z0HA 4DBRA 1PM7A 3R4DB 2ZJ2A 2WRAA 3ZR8X 2TEPA 1GVDA 4XEZA 3IPVB 4QTRA 1XPXA 1UKRA 2K02A 2KJBA 4XRFA 1IXRC 1SCRA 1ZM1A 2ZBJA 3KGLA 3S3MA 1LU1A 3TRSB 5D5UB 1HF0A 5CU1A 2DOEA 2STTA 3O0XA 2Y6FA 1O5LA 4LUMA 5FZ9A 4GFBA 3SCGA 4E27A 5CKMA 4DEQA 1DG6A 4CCDA 2VOOA 5FOBB 4MQ9F 1LULA 1JT6A 4RAGA 5FJHA 2PXJA 2R4GA 1RUF3 2ZGSA 4BU2A 4LHKA 4ITCA 4MGIE 5HBAA 2JECA 1STMA 5J1UA 3SCHA 5BYNA 1Q8OA 4AXOA 2VOPA 3S6PA 3R4KA 1AL21 3KZYA 3W2AA 3ZR6A 1YW8A 1NA1A 3I8TA 2Z1DA 1B9MA 1DU3D 3O1PA 1AOYA 1KEXA 2A3WA 4LFUA 4LBQD 3RZGA 4CXXA 1QHGA 4MO7A 1MJBA 1OISA 4Z8BA 1GLNA 5LD2C 4XKBA 5A3OA 1I27A 4UY8I 3NJXA 1SD4A 4FPHA 2IS1A 5ILVA 3QAHA 3LAJA 2BU9A 2LROA 3QCWA 1T95A 2BW3B 3KT4A 3W9AA 4I7HA 4COVA 5B1AH 1APLC 4RGGA 2XSJC 1D0YA 1S7AA 1QJFA 3A03A 1XU2A 2ZFUA 2B7YA 3DTKA 2JDYA 4RQPC 3C2UA 2D2WA 2NYXA 2ARAA 5K7HA 2PLYA 2WNVC 2L9VA 3GTLJ 2JA5J 4Y33A 1WCKA 2W82A 4JBAA 3AP9A 3ZQQA 1RMU2 2P1BA 1C3HA 3URFA 1KFUL 4ZONA 2PJRA 2WNOA 1AL22 2G9GA 2EFQA 5JSPA 3FXKA 1C8M2 1SDDB 2LP0A 4Y4RA 2WUHA 3J81Z 4F83A 3MEPA 1SAXA 2OA2A 3O1VA 1G9AA 3DEEA 3POFA 4ENMA 4DYRA 3G6JB 4CZSA 4TN7A 2NNYA 2D40A 4IXLA 4B43A 3E1SA 4AL9A 2MC4A 3WR0A 1ORKA 3T4VA 2B5HA 2VCMA 3NV3A 1A35A 1OQDA 3LPGA 5IATA 1IXSB 1QJEA 4R9DA 3KMHA 3LEKA 1BW5A 1D1CA 2IA2A 2RS13 4FFFA 4TZDA 2KDOA 3C2HA 1ZELA 3TP3A 4P1WA 5C9AA 4XFFA 3HZJA 1CF7A 5KHKA 1VQNI 2BWCA 1KITA 1K78B 4QQHA 2K40A 2VGDA 3WDYA 5E1XA 2VQCA 2XBO3 2LRDA 2WNUB 1HDDC 1LB2A 3JRDA 4NE9A 1XE0A 4DIQA 4LO7A 3VYSB 3HOUJ 3HBKA 5JLXA 3E0JB 3A01A 1GQPA 1E5RA 1Z7S2 2IXHA 4A3BJ 4AQ6A 3ULQB 2EVXA 2D6NA 1ZX5A 1HOMA 3ZOIA 5KHHA 1TQPA 5ISLA 3CZUA 2D1HA 4EJTA 1FMD3 3SISA 4CTEA 3EDPA 5IP7J 1KU3A 4QAWA 5TGTA 2E2HJ 2L54A 2JWPA 3VBOA 1HJFA 4QPGC 4SBVA 4CEYB 1OPMA 3BTJA 2PTMA 1I3AA 4ZHNA 3NEUA 3WG2A 3EUAA 1K4SA 5L7OA 1MS9A 1TT0A 3FZ3A 3FX3A 5DTDA 5L9RA 2CUZA 4MNUA 2VNOA 5BS6A 1MPXA 2EALA 1VRH3 1H8VA 1ZZBA 1IKPA 1B35C 1N3OA 3HHGA 1NLSA 2HWVA 4K6BA 2YUSA 4HSTA 3ILFA 3THCA 2J1SA 5GM0A 3ZXDA 2VMCA 2P6SA 3WX5A 4Q4V2 3NAPA 3PVBB 2ZXIA 1D4VB 1ACIA 5TRDA 4M6YA 4FOYA 1WLTA 3B69A 1RINA 3ZXLA 3ZMDA 2PMWB 2W68A 2E71A 5BNGA 1RXGA 3RSJA 2FDIA 4A41A 4UUVA 3VZKA 3F2ZA 3HT2A 3B00A 1O59A 2EIMH 1JW6A 5EF6A 1RUJ1 1OQEA 4EJVA 1CAXB 2FQ4A 1FI2A 1PO21 3Q8BA 2PN6A 3VSLA 2JDUA 3A02A 2JDKA 2L7MP 1IG7A 4FSJA 3S3OA 2VM9A 4O5VA 4XLEA 4GDFA 1SFXA 4KDPA 5HDKA 3GCWA 3V7CA 4A3EJ 5T3NA 3NAPB 2DUPA 2Y6JA 3ILRA 4NHXA 4HANA 1MS8A 2VKEA 5GKAC 5EP9A 2P3YA 4QX8A 4AUXA 1NQDA 1HRV3 3PUQA 4N43C 3N9OA 1UIKA 4PGHA 1S5LC 5LHGA 4OIOF 1MJAA 4LR4A 2X10A 4JK1X 3E6DA 3KIOA 3VFZA 4ZH4F 4FPFA 1VBC3 1QJY1 1RZ4A 3BYWA 2HWF1 2A6ZA 2OW4A 3S2WA 5FPAA 2DA5A 2X09A 1R5HA 1CAUA 2JG8A 2CWSA 4XJAA 1OKOA 2FMYA 2P37A 1HXS2 1LESA 5FKCA 2E2IJ 1TWFJ 4IO9F 4ZYGA 5GPAA 2NYYA 2K5CA 3HRMA 1RHI3 5DDGA 1AR73 1X9TA 4FTHA 1TL8A 3KQ4B 1I50J 4JGZC 2UXXA 4MHUA 4ZU5A 1UNBA 3KFWX 1JI8A 3A1YA 3HXLA 1GOGA 1WW7A 1LVKA 2ZGQA 3BR5A 4HRIA 2VXZA 3AB0A 3RQ0A 2RS12 3HSEA 3R05A 2C0ZA 1W3VA 4F55A 1NY72 4A42A 3JQWA 4MG2A 2OKXA 1FLIA 2EICA 3SQOA 3N05A 3KLNA 4RB1A 1QXRA 4LB5A 2KKOA 1T08B 3VBOB 3MLKA 3ABMH 4NRQA 4M01A 1DP3A 2DBNA 1SLBA 3ZFGA 3RKWA 3RYKA 1RUE3 3J8F1 3J80Z 1YQ2A 5ERIA 1C8M1 2M0MA 4YM3A 4B48A 2JB4A 4GXLA 3KZ4C 5ERLA 2EIJH 1ZA7A 3GUDA 2L0KA