4HZFA

Structure of the wild type catabolite gene activator protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hzfA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hzfA01
2HWVA 5LRSA 4WXDA 4U0YA 3HRTA 4DQ2A 2P17A 2HTJA 4Q0SA 1XSXA 2XKOA 3TDZC 4LUMA 4ETSA 1A04A 3KE2A 3VFZA 4CZZA 1D5VA 3QAHA 5ICFA 4IVNA 4G7HF 2DPUA 1OYIA 1T38A 1KGSA 5BPXA 4D7TA 4KWKA 1SFEA 1RIOH 2O8XA 2H27A 5KK1A 1XGNA 1AWCA 4XEZA 4LLLA 2LDUA 5L3EA 1DP7P 3IWZA 2PEXA 1U5TC 1OKRA 1EH8A 1L3LA 4J1XA 1QY4A 4MEXF 5AIQA 2Z2SB 2LKPA 3JAMZ 1FC3A 4M9XA 2MPFA 4I0BA 3PLQA 4BH9A 2YR2A 5ICCA 4GXOA 1U6GA 4I7HA 2DU9A 3S2WA 1HBXG 1ON2A 4MV2A 5CADA 3P9KA 4ON0A 3R6SA 1TNSA 2PN6A 2XRNA 4HA8A 4BIFA 1R36A 1FY7A 1MJ9A 2DCTA 3MZYA 4IXAA 1QZZA 3S7EA 2OA4A 4PGHA 4L18B 4JK1X 4CGZA 3VEPA 5FDBA 5HS7A 4HLXA 1DPUA 4UVCA 4IRHA 5D6EA 2K9ZA 1NE4A 1I6XA 2P5LC 5BPDA 4YARA 1FP2A 3L2HA 1RNLA 1ZLJA 4U0VA 1T0FA 3R0AA 4KA4A 3MEXA 3Q9SA 5TRDA 4Q0VA 5K5OA 3HT2A 3OF1A 2H0VA 3KEQA 2KIFA 2IW5A 3FZVA 3KZYA 3V7SA 2VOPA 1PMIA 3O14A 3U0ZA 1DGWA 3JZVA 2ETHA 2P7VB 2KIUA 3TKYA 1CAXB 2F4PA 4IRIA 3ULQB 4AIKA 2Y0OA 4ORFA 1UFMA 1R7JA 2QVSB 3LZZA 2IVMA 5HI0A 3WTUC 1W7PD 1XGOA 3P7NA 3BZ6A 3ZMVA 2RGVA 5D4RA 1R23A 2MHFA 2QZ8A 2ZMEB 4IHSA 4ESJA 4KL1A 3HSFA 2DQRA 2W57A 4QMAA 3CF6E 3ELKA 3TGNA 4ESBA 1F1ZA 4Q0QA 2Y75A 3I4PA 2PI0A 5L3BA 2I45A 1MJAA 2XROA 2HGCA 1R00A 4PJYA 3GX4X 1ZGAA 3ZN1A 2DPDA 1EH7A 2OZJA 1OR7A 3ZPLA 3KLOA 1KU3A 1X8MA 5D1IA 4WCGA 4Y17A 4D7SA 5LGTA 4RAYA 1YHFA 5JCTA 4GULA 4CDGA 4I02A 1J75A 1SFNA 2M1BA 2NAZA 4YIFA 3KP3A 4ZZLA 4MQVA 1W7PB 1PUEE 4AQ6A 3IBMA 2HR3A 1XSDA 4IESA 3L09A 4KIBA 5I91A 2HFHA 1QXJA 2ZNZA 2HKOA 1BM9A 1FBUA 1RC6A 2M87A 1U5TB 3N97A 3ECHA 1O3SA 3LQQA 5E20A 4AXOA 4I0AA 3WGIA 1YUDA 2GU9A 2PFWA 4ONUA 3RKYA 3SCFA 3WTTC 2IRFG 2ISZA 1SEFA 4YSFA 3CEWA 3HYIA 1CX4A 3ZMSA 3H1WA 5ILUA 4JTNA 2M5WA 4IEYA 1YIOA 2KRFA 3GF2A 5LGNA 5FGMA 2ZO4A 3HOSA 4EJTA 1EY2A 1J3PA 1DZTA 3QP5A 2FQ3A 6PAXA 3QPTA 4EGZA 5KBFA 4XFBA 3E5UA 4FX0A 2RC4A 1S7OA 3GXOA 1JE8A 5JSRA 4NHJA 4ESFA 1O57A 3HRUA 4OINF 4MTDA 5DCMB 4RB3C 3GYDA 5DUIA 5C8WA 1MD0A 1ZREA 4HSLA 2PHLA 2CQKA 5K5RA 3EJKA 1BJAA 4E70A 2QENA 4KMFA 3I58A 4I2OA 4UVAA 1K6OA 4B29A 5FLHA 1S29A 3BJ6A 5F64A 4OIPF 4YYOA 3FWEA 3ES1A 4HDVA 3JSOA 3WTWC 5LEJA 4QGLA 2M30A 3BJAA 4KMUX 1BC7C 2EAAA 3HSRA 3H1YA 4IF4A 4O3MA 1K79A 3ABTA 3UKNA 2C6YA 2J5OA 1UW8A 1K78A 2O6GE 2HYFA 4N9IA 5A2QZ 4EQQA 4HQMA 4KUMA 1ZX5A 3MCZA 1FYLA 4U7BA 1IAWA 1W4MA 2L02A 3LA2A 3RI4A 2Z99A 1ZHFA 3SCGA 2QWWA 3E97A 2XAJA 2XLFA 2KKOA 3TDUC 2IA0A 1YFHA 3O3KA 2FU4A 2P4WA 4H0EA 3N4MA 4XFHA 2CYYA 2RNJA 2BNOA 1QZYA 2M8EA 4YNIA 5K8SA 3HHGA 1P6RA 3GFIA 3RYPA 4A0XA 2H94A 1GXPA 3ZDSA 1KYWA 2C0ZA 4XF0A 1HW1A 4GO1A 4G9YA 1J5YA 2NS0A 3DKWA 2XUBA 1HKTA 2P5VA 1L3JA 3O6BB 4N0BA 1FLIA 3CTAA 3HQXA 1KU2A 1AOYA 1YLLA 2ETEA 3KSCA 4XFAA 4ZZDA 4B8XA 5C6CA 2Q8KA 2XHKA 4EV0A 4IEVA 3NL1A 2FF4A 2IXKA 2IJLA 2GXBA 4HAMA 1FP1D 3I59B 5BUVA 2TDXA 3IDBB 4OOIA 4Q0UA 3T1BA 5TJJA 2RN7A 1ZYRF 4IJAA 1QBJA 1MKMA 2ET1A 3VODA 4KYWA 2GH2A 3GO5A 3BALA 4UNOA 4ZU5A 1O3TA 5J6XA 2YPRA 1GQHA 3IKVA 3RDIA 5E1WA 5CVUA 3BP8A 2Q0AA 2FA5A 3NRVA 2FXAA 1WKMA 1PDNC 2GAUA 4ENKA 1MJBA 3KGZA 1LDDA 1FBSA 2BNNA 5EEHA 2K7LA 1LR5A 1YS7A 2K0GA 1ZZ9A 4WX9A 2KXLA 3HRMA 1LJ9A 3VHRA 2EFNA 5E16A 3RIRA 3K2ZA 2HJIA 2NNYA 3DFGA 4PZJA 1MGTA 3BU7A 1XD7A 4S05A 5BY5A 1B6AA 1E2XA 1ZRCA 2EFOA 1CF7A 4AQ2A 2PYTA 1U78A 1WLTA 4AWXB 2CFXA 5E18F 5IT9K 1EH6A 2JT1A 4D0PA 1GQGA 1MDMB 1MZBA 1ZVFA 3F6OA 4QGMA 5AVPA 1RZ4A 1VR3A 3GYHX 4Q29A 1E17A 1TW2A 2XIGA 1B59A 1FT9A 3ZP5A 3JAMK 4L0ZB 4PDKA 4UXNA 1IF1A 2QUFA 2ACJA 3TO9A 3P9CA 1Z91A 2W85A 4L9TA 2B5HA 3WE3A 4HLYA 3EQEA 2Q2EA 2KJBA 1ZZ7A 2Q30A 4KFCA 3ETQA 2JPCA 3B73A 5HVQC 1VP6A 3CUOA 5IT3A 1GHCA 1I1SA 1HKSA 3V7CA 3GFJA 2IC1A 1ZZBA 4RGRA 3FMQA 4HF1A 1BIBA 5LEKA 3TNQA 3SHRA 3CO2A 5LBQA 2GIVA 3KP4A 2KIMA 1ZGJA 4LD5A 2Z5UA 3IWFA 4OIOF 1R1TA 4MZUA 4XFGA 1R5HA 3K9TA 1DDNA 3M7GA 4P9GA 1FX7A 2OBPA 3WTVC 4Q5SF 2WFPA 4L5JA 4JTOA 3G3ZA 4EWDA 3L2CA 4A12A 1SD5A 3O2PE 2OQRA 3G73A 3M8FA 4IEXA 3E6MA 1V70A 1WWXA 5D5XB 3T5XA 4AIHA 1OI6A 3MPBA 4HVRA 4HV6A 1Q1HA 5FFZA 5HLGA 3K69A 5T3NA 3FHIB 2XLAA 4N9HA 2EFQA 3E6DA 4A2UA 2E9QA 2MLGA 3U2RA 3MWMA 4Z07A 2XAQA 2EV5A 1B4AA 2EWNA 3U9GA 1WSUA 1OPCA 2ZFWA 1XDSA 2BBYA 3IRQA 1OFNA 1ZG3A 2VBYA 2QCSB 3J81Z 3CJXA 2P5KA 4WBBA 1JHFA 4Q47A 1TQ5A 1IN6A 1BI1A 1I5ZA 2UXXA 4LFUA 5IT9Z 2RV8A 1ONVA 5HS9A 2MH9A 5FQ0A 4KN4X 2A6HF 1D8JA 5JAXA 5E1RA 2OA2A 2IXHA 3WU0A 2MLKA 1FPQA 2UYAA 3I0TA 4LK1F 3REOA 1J7KA 3F8MA 3FE5A 2XKPA 2BYVE 5ILVA 3LFKA 2COMA 3LAJA 1CAUA 3EHKA 1O4TA 4UBGA 4YG2F 2IA2A 4G6DA 3NVCA 3F8BA 2MH2A 2K4BA 1UD1A 3DV8A 2GZWA 1YS6A 1DZRA 1S6LA 4NVPA 3WU1B 1NHAA 4A5NA 5FO5A 4X6QB 3NQOA 1YW7A 4O9GA 3GBFA 4LGWA 1VJ2A 2WC2A 2Y0MA 3HRSA 2G7UA 1BBYA 2O1QA 2OQGA 1R1VA 1WA4A 1XMKA 2ZKLA 2PG4A 1S8NA 1S7AA 3QPHA 1H0MA 2D5FA 3I71A 3L7WA 1XSVA 3E6CC 2XLGA 5I93A 4M73A 1EPZA 1U2WA 4S04A 2QJVA 4XFCA 1CAWB 2GC1A 3H9AA 2VC0A 4HW0A 2PAMA 3CUQB 5FLJA 3WW1A 1SFUA 1LDKB 4BQAA 3MFKA 3ERED 1X82A 5I0SA 5L3CA 1H1MA 1X8EA 4R79A 3BWGA 2EB7A 1NE6A 4OMYA 4RGSA 3PQKA 1S3JA 1XN7A 1G3WA 5ERIA 2MNGA 2VONA 3ELNA 5LHGA 2CW0F 2FBKA 4IETA 1YFUA 5D5UB 1G3YA 1FYMA 2YX7A 2EA4A 4M6XA 3U10A 3H8UA 1DPRA 3T8TA 5FB2A 1J2XA 1MDMA 1WQ2A 5EEGA 4NB5A 4PIZA 2PA7A 5A2QK 4LB5A 3FM5A 4A0YA 1H1IA 1CAVA 5D4SA 3FXQA 1NYWA 4KIFA 1RL3A 1OMIA 1UCXA 3D5LA 4ZU4A 4ZU7A 3ZMZA 4TLFA 5FLIA 3KP2A 3U1DA 2A07F 4FAGA 1XGSA 4CYDA 2QQAA 2DO7A 2OD5A 4YFNF 2P8TA 1XCVA 1TLHB 5KHKA 5H6RA 2V6CA 5FLXZ 3GZ6A 1RI7A 2LF8A 1WI9A 2GC3A 2O8QA 4HBLA 3RPQA 4ASNA 5JSPA 3I5UA 4J1WA 3LA3A 3K1NA 3KP6A 4LG0B 2QDRA 2GXGA 2CAUA 4HF0A 4HN1A 2QVOA 1IRFA 2WTEA 1W5TA 2JZYA 1IPJA 3CO7C 2XASA 2DLLA 5HDNA 5J48A 3TO6A 1FZPB 3FX3A 1B1BA 1T39A 2QQBA 2EVXA 1F9NA 3ZN0A 3R60A 2DBBA 2JTVA 3ML6A 2W25A 3E5XA 2QBYB 4U0WA 2OZUA 2EFWA 3DF8A 4GGGA 4P96A 1Z05A 2D93A 2UY8A 4EWEA 2PBIA 2PAKA 3MYXA 4ENNA 4X6RB 4I01A 3NW4A 1X7NA 2M45A 3IRRA 5BPIA 1IXRC 5CJ9A 4EM1A 3QU6A 3QACA 1T98A 3D0SA 4A5MA 2V09A 3ZQ7A 4EVIA 4G7OF 1OYWA 1UB9A 2ZXJA 4XFIA 3K1PA 3H92A 3KLNA 4KWJA 2EK5A 4BHCA 1BI2A 4GYIA 1GVJA 4IHTA 3W6JB 1XRUA 3HUGA 3HT1A 4U88A 2MC3A 3LAGA 2HQRA 3KEOA 1Z7UA 2LNBA 4LLOA 4OLLA 2HYGD 2CWEA 1H9TA 5JR3A 2WWYA 2EJRA 1P4WA 2FEZA 1USTA 2IXJA 1ZG1A 2QNKA 4L9VA 2PHDA 3ST7A 1O5UA 4L9NA 4OIQF 2A3SA 3R61A 3T0YA 3SQNA 4IEUA 1KYZA 4CO8A 2FBHA 4IEPA 1RUOA 4IRGA 3B02A 4PGGA 3GUDA 1WGPA 1XE7A 5I0TA 2YSRA 1R22A 4CICA 2FNAA 4P5OA 3M3IA 3VB2A 1YFWA 5JI6A 1SD7A 1YFYA 4Q0PA 5D8LB 3CDHA 4PIXA 3DEUA 3SXYA 2AS5F 4JQFA 1HQCA 3JTHA 2UY9A 4RAZA 2D5HA 3EDPA 4G6QA 3KETA 4A6DA 3D0JA 2KJCA 2GC2A 4EJVA 2V1XA 5ILSA 3RYKA 2PMHA 4M9SA 2R7FA 4UV9A 1REPC 3NSTA 4FBFA 4BXUA 4O6JA 1BN5A 3J7AO 2IXLA 4JBAA 3GFLA 2OYZA 5CLSA 2HTSA 3C1DA 2E7WA 1CAXA 3GW2A 1V3FA 3LWFA 2UWMA 5CU1A 2R7DA 4E2GA 2FBIA 2PFBA 2DAOA 2FQPA 1LEAA 2ZJ2A 2ZMEA 5J3UA 5DUKA 1H9GA 4FX4A 5BS6A 1USSA 4QGNA 4XF4A 2DFIA 5D8KB 4KU7A 2UZKA 2IXIA 3ACLA 2XL7A 3NKTA 4RD7A 3USSA 5CVIA 2QM3A 1D3YA 2A61A 3LAPA 1QPMA 4HF2A 2K4JA 3DP7A 4MX3A 4QLCU 1YWKA 2D1HA 3SZPA 2HDCA 1J1LA 2JRTA 2W24A 5AIPA 5D5VB 3H1MA 2L4AA 1O5LA 3S0MA 4AIJA 3ZMTA 4BNCA 1ULYA 1W7PA 3HHHA 4XSXF 3MDPA 4UV8A 1U12A 1J3QA 4HYEA 3FXUA 3BPVA 1BI0A 2DK5A 3J81K 3M9AA 2PJPA 4EM2A 3F3XA 1ZRRA 3V8LA 2MA3A 3OV8A 2K02A 1U5TA 2VT3A 2P6TA 4YRDA 4HVQA 2J5PA 5DYMA 1QGPA 1ZNPA 3BY6A 2O61A 1NZCA 3F72A 3SCHA 3ISPA 2CSOA 5JHUA 3EUHA 4ZYEA 3LSTA 4XLNF 1LB2A 4WWCA 3OD0A 3TO7A 4OU0A 3COAC 4GYGA 5FD6A 3EETA 2ZCWA 4LB6B 1NXMA 3F8FA 4LULA 2QQ9A 4R8HA 1FYKA 1IXCA 4HX7A 4FAHA 2Q4SA 2OZ6A 5DCMA 1RTVA 1J3RA 3EBRA 3CUQC 3V4GA 1LRHA 2HZTA 3EYYA 3Q9VA 1KU9A 3EYIA 4L9JA 2DK8A 2B8MA 3DXJF 4WK8F 2ZBKA 4HSJA 2L54A 2NRAC 1O3QA 2VE8A 2B0LA 2F5EA 2XV4S 5I8TA 5DEQA 3IIAA 2FMLA 2X4HA 5KHIA 3ECOA 2EA2A 3I64A 2YX4A 2A69F 3V7RA 1Q5OA 5AONA 3ABUA 2D2WA 2VOOA 4RB1A 1L0OC 4XBFA 2Z69A 1XDUA 2ELHA 3PNAA 2PMUA 1IXSB 3F23A 1KQ8A 3LOIA 4Z82A 3DL3A 4HBNA 2XAGA 5KVRA 1IRGA 4MGIE 2V1UA 5BQTA 4LLNA 2L4MA 2PQQA 4AVBA 5E1XA 1YW9A 4FT8A 3KZZA 4EJWA 3F6VA 2LSOA 3SXWA 1SAXA 1W5SA 1XE8A 2STWA 3C3WA 4HVOA 2A5YB 2VQAA 4P55A 2GWRA 1QQIA 4P9UA 3OGJA 4B09A 3RZZA 4CHUA 4ZYDA 2XGXA 1R1UA 2IPQX 3J80Z 3D82A 1UIJA 1ON1A 3WW3A 1IN7A 1ZH5A 1C0WA 4OMZA 4QWQA 4XETA 2PTMA 4MEYF 1UIKA 1YQAA 5ICEA 1Y0UA 3AAFA 2BNMA 2ESNA 1G6NA 2V1DA 4BHBA 4LA3A 2VBWA 1X3UA 3WTZA 2H6BA 1Z1DA 2FRHA 1KA8A 4EROA 3PVBB 4MQ9F 5JSOA 5FLXK 3MZHA 5I0UA 5KHJA 3FM3A 3IHUA 1YG2A 2Z9OA 4PCQA 3F21A 2RKHA 1ZN2A 3M1EA 5D6FA 4K8FA 5LLQA 4O5VA 1K78B 1XGMA 4O9EA 3GFMA 3UKTA 4AVAA 3LQRA 2ZNYA 2IXCA 4HDUA 3I59A 1ZARA 1FNNA 1TNTA 3WTSC 3DN7A 4ENJA 5I8SA 3F8NA 5F1RA 3I53A 1SD6A 5E1ZB 2UYBA 2H6CA 2UXNA 1HSTA 4A6EA 1CGPA 3WTYC 4UBHA 2WV0A 2D1VA 4EJOA 1YTYA 2VN2A 2BV6A 2FE3A 3FMSA 4MGRA 3QOPA 1IZ1A 3E3VA 1G3TA 1IN8A 2OPKA 1YLFA 4HQEA 1DUXC 3SFZA 2JPBA 2ZKZA 5HLIA 4BHPA 1TQMA 1PP8F 3H3ZA 3TQNA 4XF1A 1BOAA 5D5WB 2V9VA 5HOOA 2HKXA 1O7FA 3C3VA 2DT5A 3ROUA 1SMTA 4M6YA 4MHGA 3OTFA 5LGUA 3U11A 5JR7B 1JXSA 3RKXA 3FMRA 4KU8A 3SHFA 4MUVA 1T2KA 1YFXA 3FXRA 4IEOA 4KIGA 5DCFA 3RYRA 4ENMA 2L01A 2CV6A 3CLPA 5L3GA 1HKQA 4I09A 1TBXA 2VPVA 1FSHA 4EWAA 4HX8A 4F8AA 5BXXA 4U7DA 1B9MA 3NEUA 5E8IA 4MH0E 1FXZA 2ADUA 3ES4A 1XB4A 4IEWA 4ZH4F 2HS5A 3JW4A 1IN4A 4EM0B 4XRFA 3NJZA 4XLPF 2GA1A 3C18A 4M71A 2FSWA 3R0JA 2VXZA 2VECA 1EP0A 5EZWA 2ISYA 3L00A 4IEQA 3BB6A 3KFWX 1FWZA 2NYXA 4I3PA 5BMZA 2VBXA 1P4XA 3CO6C 2L3DA 4MTEA 1ZZCA 1R58A 4KN7X 3OOPA 4QX5A 4HOBA 5HS8A 4AVCA 2W84A 5CYVA 4DNCA 3FZ3A 2QLZA 1IPKA 3JTGA 5LRRA 4G8XA 3T8RA 4LUKA 4R52A 1PM7A 4IEZA 4LMYA 3S7IA 3K1MA 3KP7A 1QXRA 4KT5C 4QM8A 2CGPA 1JHHA 3ZMDA 2VBZA 2EFPA 1FBQA 3H3UA 4F7ZA 2O0YA 2H09A 3R4KA 1KQ9A 4RGUA 3UKVA 2K86A 1O7LA 4EMSA 3DPTA 3QU3A 5FPZA 1UHMA 1U8RA 1CF7B 4IPAA 1LEBA 2O3FA 2R3SA 3HIFA 4LLGF 1ZZ6A 4EGYA 3I7DA 4RB0A 2VE9A 1FI2A 5ED4A 1BC8C 4Q4ZF 4DINB 1EYBA 3M8EA 1UCRA 4OFGA 2DTRA 4UHTA 3RJPA 5K5QA 3BDDA 1I1GA 1STZA 3BJOA 2G7HA 2CAVA 5FPXA 2A6EF 1J0RA 5HLHA 3M70A 2K27A 2QYOA 4TV7A 1ZLKA 4WF2A 4M9ZA 3EQLF 1TTYA 1Z9CA 2MD5A 4FHTA 2Y48A 4QXKA 2DQLA 2O03A 3KP5A 1SD4A 2BE5F 3HTUA 4WZCA 1EV7A 2OAZA 2F5DA 1HXDA 2XVCA 1V4RA 5BOXA 2FMYA 1OD5A 3V8JA 3MAJA 3WG9A 4MGYE 4PIYA 5DD4A 2XAFA 4XFFA 2ESHA 4LEJA 5FFXA 1J58A 3KGLA 4E2QA 4UUVA 1YW8A 3BOQA 4CXFA 3GEZA 3EO6A 3SMHA 2E7XA 1Y9QA 4KICA 4AVPA 5H6QA 5L3FA 2F2EA 4MNUA 2Q0OA 4G7ZF 5ICGA 4XF3A 5J8FA 3KCCA 5CVJA 2FOKA 1G3SA 2Q1ZB 4HX4A 3HTSB 4BAYA 3WTXC 1T6SA 4AD9A 5FD5A 2EV0A 2IA1A 1XCBA 1KU7A 5KHGA 3LA7A 5LHIA 3HOTA 2E1NA 1LQ1A 4P9FA 1P92A 4GCVA 3MQ0A 3L9FA 4ZYGA 3F22A 1F4KA 1CAWA 1JUHA 4UXAA 4KNYA 4IERA 2Z3YA 3HSEA 2STTA 3CUQA 1SQ4A 3CL1A 4ZYHA 1U3EM 1G4DA 2G9WA 3RKWA 5FQ0B 1I27A 4RS8A 4A0ZA 3TOBA 5JFRA 1Z6TA 4Y15A 5BV6A 2JSCA 3DPLC 1JGSA 2NNNA 3IL2A 1ZG5A 2PQ8A 1BIAA 2Z33A 2GA2A 1Z6RA 5L3DA 4HZFA 1HSJA 2RDPA 1P4AA 1J9IA 5FCCA 4L11A 1B9NA 4MGKE 1DGRA 1CAUB 1TW3A 3VOEA 3BPXA 2PAEA 4BYYA 2X0LA 4EJUA 5EFUA 3WW2A 3QRFF 2CO5A 4KWLA 3W6KB 4H7LA 4L2NA 4JV4A 3LWCA 3CLOA 1QWRA 2GC0A 1LNWA 3FFQA 5I8YA 1ZAOA 3F8CA 2DW4A 5HDKA 5JVTA 2HEOA 2XL9A 3FF5A 1UHWA 2RVCA 4RB2C 2AXLA 2GQQA 3IKTA 2E1CA 1RGSA 1WRJA 3WGHA 4NQWA 4LK0F 4UVBA 1HW5A 1P2FA 5DDGA 3H7JA 2A68F 1IUYA 1KQ0A 3BPZA 1VTNC 5KHHA 3J80K 5CVRA 1RUNA 2BGCA 2EV6A 3JSPA 2ET7A 4XF9A 1YYVA 4LG0A 1ODDA 5I0RA 1XMAA 1FOKA 3GLXA 1Y3TA 4HLTA 1K7AA 4WXCA 1FSEA 3P9IA 4M72A 2VODA 3GVAA 1Q43A 5LHHA 3DQVC 3WGGA 1QO0D 4Y13A 2HQNA 1IW7F 5H20A 2LF7A 4LA2A 3G7DA 3E6BA 1Q3EA 2QBYA 4HN0A 5J7MA 1TQPA 1F5TA 4K2EA 1GXQA 3BROA 3IDCB 3H7YA 2P7CB 2DI3A 2BEOA 1QNTA 4L5IA 4WXHA 4META 3QP6A 2IT0A 4E2SA 3RTRA 1CAVB 4R1HA 1R5GA 4MGZE 4LTAA 3H50A 1LKNA 2EA7A 2RQPA 2F5FA 1ZRDA 1UPIA 1ZZ8A 3RNSA 2VC1A 1OYYA 5E8GA 3I54A 1SFXA 3PFIA 4Z2YA 4YIIA 5E17F 2P6SA 2V79A 2YU3A 3ZMUA 2MBFA 3KMHA 2HOEA 1TQIA 2D40A 4M74A 3WODF 4LJZF 3E5QA 1HW2A 2XAHA 4HV5A 2OU2A 3K0LA 5DD8A 3Q5FA 1D8KA 3WW4A 3C7JA 2F5CA 2PLYA 4XSZF 5CVVA 3GZ5A 5F6FA 1LVAA 3FHZA 4Q48A 1LDJA 3GWZA 4G94A 1ZRFA 2B9UA 1SMYF 2IP2A 1PP7U 5K1YA 5HDGA 2ATFA 3WE2A 3TOAA 4YFKF 4HMZA 1J59A 4KDPA 1BI3A 4I98B 3PQJA 5J8CA 3TNPB 4OIRF 1IN5A 2FNPA 4L0YB 4QM9A 3CJNA 1YO5C 3OCPA 4YFXF 5DV5A 3SZTA 2VT2A 3IC7A 4RGXA 2N7GA 3BCWA 3FJSA 3V8KA 3RPUA 1O3RA 4WVZA 4JVAA 2CG4A 2D45A
chains in the Genus database with same CATH superfamily
2HWVA 3HC7A 4NMIA 4U0YA 1VIWB 5A80A 4DQ2A 3NNMA 2P17A 2HTJA 5C4WB 3ZPYA 3CKHA 3KE2A 2RS31 3P3NA 3QAHA 1MMGA 4IVNA 2J1VA 2DPUA 1OYIA 1JYWA 5C4XJ 4BXXJ 1TME3 3SISA 4ZJZA 2W46A 4KWKA 4F52A 2O8XA 2H27A 4CCLA 1RVF2 2LROA 2BY1A 1J1TA 4XEZA 1SLBA 5L3EA 1CQTA 4JKMA 2E34A 4NRMA 1U5TC 1VE0A 1L3LA 5IOZA 2FJ1A 4XJUA 3PLQA 3TEXA 4BH9A 1RUI2 4LLFA 2VJ4A 3VBFB 1U6GA 2DU9A 4QQLA 1HBXG 4WZFA 5HPOA 4MV2A 3R6SA 4ON0A 4R9CA 3K70D 1O4XA 4QD2A 1AX0A 1JZ4A 4XN0A 3WLUA 2DCTA 3VBHA 5C8CB 2EIEA 2R041 1QZZA 4PJ0C 3H35A 2OA4A 4PGHA 4L18B 3S7EA 3GXUA 1H8VA 3SDBA 5CA6A 5FDBA 3GJBA 4HLXA 4UVCA 4YVWC 3MLLA 4HNVA 5GAHJ 5FJKA 1X4OA 4TXWA 1ZLJA 4U0VA 4GDFA 3Q9SA 4TSVA 4D8MA 5TRDA 2ZSIB 3HPHA 2YU1A 3RQ0A 2W5FA 5K5OA 4AI3A 3AL5A 4GWNA 3K4LA 4GKYA 3NAUA 5A32A 4BXFA 5CKTA 4AEMA 3TMOA 3V7SA 1ENSA 1DGWA 1NG7A 5HCAA 4IRIA 4AIKA 1UY0A 1XG1A 1MQTC 1AYM3 3LKJA 3WTUC 1VF9A 1W7PD 1QOSA 3K10A 1XGOA 3P7NA 3CMYA 4MYEA 2ECBA 3I9V2 2LY1A 5A33B 3GM8A 4IQJA 1TMF1 1R23A 1PK6B 2R6QA 1T56A 1NY71 4ESJA 1F31A 3BR0A 4H3WA 4HT1T 4QMAA 2F6BA 3TGNA 4XQWA 1JOJA 5L3BA 2HGCA 1R00A 4PJYA 2Y6LA 3GX4X 4XJWA 1ZGAA 1IV8A 5IYBJ 5D1IA 4E7HA 4KGGA 4E7ZA 4BJ6C 3A01B 4B8EA 2RJLA 3VGIA 3BR2A 4RAYA 3K77A 4RQPB 2JMWA 1YJNI 4AE2A 3U1XA 4QDRA 2QSGX 2M1BA 2NAZA 3KX2A 3CCRI 4W6WA 4ZZLA 1LGNA 4MQVA 1W7PB 3LSMA 2MG4A 3HBKA 4AIDA 2HKOA 3KS7A 1FBUA 2M0MA 1RC6A 5CB7A 3KM5A 5F0CA 2E60A 4AXOA 2PFWA 1QJU2 3GCXA 1N1TA 2HYJA 5FXWA 2ISZA 1CX4A 4RL7A 3VBSC 1C4RA 4BLIA 3ILNA 4JTNA 3OS2A 1N3OA 2UWBA 1YIOA 3GF2A 5LGNA 5FGMA 4EJTA 4EN9B 1EY2A 5FYVA 3MLKA 2FQ3A 1VQKI 4Q4Y3 2WN2A 4ISRA 5BNNC 2WAOA 4RHV2 4P5HA 5KBFA 4XFBA 1G8WA 1GV2A 1S7OA 3S93A 4BUPA 5JSRA 3ZQLA 4QIWN 4OWRB 4MTDA 5DCMB 3GYDA 5DUIA 5FY7A 1QU3A 4E70A 1LGCA 1V55H 2VG9A 3W2AA 5LBBA 1V6IA 1PYVA 3N7LA 4FTEA 3ES1A 5CBLA 1LECA 3JSOA 2JWPA 5LEJA 2Y9YA 4XTMA 4JDNA 5EF6A 3ABTA 3UKNA 3WOGA 2C6YA 1UW8A 5A2QZ 1HB1A 4FETA 1XB9A 5FP4A 5IK7A 1MPXA 3AYDA 2VXRA 1W3XA 5IY5H 4DW6A 3THCA 2XPUA 3ZSMA 3FXOA 1RJ7A 2NVYJ 5A70A 3TRSB 3AKQA 1OQYA 4XFHA 2ZGOA 2CYYA 4XLEA 5FP9A 3ZYFA 2DV9A 2RNJA 1QZYA 4FSJA 3ZN4A 1Z77A 1JT0A 2AZ5A 2W4SA 3FDYA 4XKVA 3TL4X 3RYPA 4A0XA 2H94A 4II3A 2CSGA 3NV1A 1XC6A 4XF0A 3PJYA 1RUD1 4XOTA 1V9U1 1IS6A 1WW4A 1L3JA 2BVLA 4N0BA 1AOYA 4ASLA 4ZZDA 4B8XA 4YFWA 2J1SA 2XHKA 5EZGA 2CV1A 5FY9A 2FF4A 2XAUA 4BQYA 2GXBA 4Y1ZA 5F7UA 3ZQQA 1ND2C 3AZZA 3A22A 1OJLA 1D5YA 2V7FA 4Q0UA 1K5MC 5A33A 3O1OA 1UY3A 4IJAA 1QBJA 1MKMA 2CV0A 2HEWF 3A4UA 2DMTA 3I4NJ 4AAPA 4UNOA 3POBA 2G9FA 3JREA 5E1WA 5CVUA 2Q8CA 1WMDA 2A6WA 2VOTA 2FA5A 1H6XA 1KXGA 4HANA 4OQ8A 2Y31A 1PDNC 4ENKA 2M7AA 2E63A 5GLVA 2K3PA 5FYUA 2DCYA 5EEHA 2E32A 4AF9A 1LR5A 2DDBA 2RREA 2DUQA 4A44A 1AYN2 1U9OA 3RIRA 1C3HA 1V5EA 3RMYA 4PZJA 1QOTA 1MGTA 3L2QA 4IV3B 2MEV3 2ZBJA 3MGUA 2CW8A 1CF7A 4DXTA 3PSIA 1S7EA 3MF6A 2WT1A 1GZTA 2R1BA 2CFXA 4ZTFA 2ENRA 5IT9K 1ZKGA 2JT1A 4RA2A 3ABKH 4K40A 3F6OA 2AGSA 4QGMA 4UW5A 4PDWB 4UW6A 4JX6A 4M3FA 2L7MP 2VASA 3SEPA 4FPCA 5C8CC 5CG9A 3N9PA 3T0BA 3BU0A 5C3SA 1O4YA 1RR7A 2UWAA 5FMDA 3WNOA 4PDKA 4UXNA 3TO9A 4BM8A 2VZOA 4JKLA 4LBLA 4OMDA 1CPMA 2B5HA 4FP2A 3WE3A 2OT7A 3VYUB 3GALA 3SEQA 2Q2EA 1HV1A 1ZZ7A 4XUOA 2JPCA 4JGYA 4AYBA 3S2HJ 1WCSA 5KXCA 5AVAA 1ZZBA 1Y1WJ 4JQRA 1PZ8A 4HF1A 3L2UA 4P00B 1UN1A 3TNQA 2W92A 4FO9A 3MW2A 3SC7X 5LBQA 4LD5A 2ID4A 1R1TA 3V56A 4HKLA 1TWCJ 2CWMA 4KBZA 2E2JJ 3WTVC 1PK6C 4JTOA 4DBQA 3L2CA 1EAH2 1Q8QA 2ZOEB 4E7KA 5DZGA 4L99A 3HQRA 5J98B 3PIJA 1OI6A 3AJYA 2TNFA 4HV6A 1S0CA 2WZR2 1NK2P 5FFZA 5HLGA 1G8XA 3H8XA 1JS9A 3JRAA 4CPBD 2XLAA 4BJ5C 4XJ9A 2EFQA 2E9QA 3U2RA 5ABJA 1TEIA 4FPYA 2XAQA 3DF0A 3U9GA 1STMA 3IRQA 1I3AA 2LLKA 4BDZA 3VDDB 2LW8A 4BPZA 4M4PA 2JJ7A 3CJXA 2JXAA 3W59A 4Q47A 4LQRA 3DKYA 4IHWA 2XBO3 1ND3B 1IN6A 1BI1A 2XWJB 3AXEA 4LBMA 4LFUA 1HQLA 1JOBA 3I2FA 1BJQA 1W5CC 1RKTA 2X85A 4AC0A 2ICWG 2BVMA 3PDQA 1U0AA 3REOA 5FZ6A 2P2KA 3C7EA 3CIHA 5F32A 1J7KA 1QHDA 3LL7A 1SFKA 2H8WA 4JGZA 2OCCH 2W1WA 5TSWA 5ILVA 1VQNI 3EHKA 4G6DA 2K4BA 1PGL1 3DPRB 2GZWA 1YS6A 3G4SI 1S6LA 4NVPA 3OGRA 3ESWB 2PHXA 4CYCB 1W6OB 4E4DX 2BXZA 4O9GA 4LGWA 2WJSA 1EV11 2WT2A 1BBYA 3G6JB 1OLMA 5JPNB 2PQSA 1WCKA 3I71A 2K3FA 1CPNA 4YM1A 2IS1A 4XFCA 1CAWB 1HXS1 4Y22B 2BGPA 2B46X 1VQMI 4NUBA 3WP6A 3A2KA 1R093 1ULEA 1SFUA 1ULDA 4A3ZA 3ERED 1JYXA 1DGRN 1UAAA 2J1UA 5IK8A 1X8EA 3PNVA 3BWGA 2W08A 4B4RA 4C1WA 4B48A 3PQKA 1AXZA 5ERIA 1LFBA 2QQPA 2MNGA 3I8TA 3CMGA 5M5WJ 1QQP1 3LEIA 1FAYA 2DBNA 3J8F3 3RZJA 1DPRA 4CP9A 4CEYC 3HPGA 3ASNH 1JW6A 1ZRIA 3HOWJ 1ASJ2 4LHKA 2AACA 3TBDA 1E5HA 2PA7A 2Y33A 5A2QK 4CA0A 4UF0A 4A3EJ 4LB5A 2VL8A 5JIAA 3FM5A 2WYFA 3HPNA 3N05A 1WH7A 3HOYJ 4QKFA 2BU9A 4Q5OA 5B1BH 3D5LA 4AHZA 4ZU4A 1SFYA 1BBT2 4WV8A 5C9AC 4TLFA 1A6CA 2V1NA 3TN93 1MS8A 1OFCX 5F6KA 2R7WA 4XAEA 2WNUB 1RI7A 1OF4A 1WH5A 3HOXJ 1GMMA 2W1SA 3OUIA 3LEMA 4LG0B 4GFBA 2GXGA 1QMJA 2LR8A 1ETQA 3BIEA 2FD8A 2IS6A 3THTA 1PVEA 1PJRA 5JHFA 1X3ZB 1PIV2 4D6RA 3WG2A 3UL2A 3I2KA 1H6YA 3INAA 3AP4A 4B7EA 2ZJPF 1VRH2 4PF5A 1POQA 2EFWA 3DF8A 1OFSA 2UY8A 1REDA 2RDSA 2NVTJ 3OGGA 4EWEA 3H36A 3NW4A 1VBB2 4PQ9A 3H9QA 4GH4C 1SCSA 1V6NA 3MEPA 1OLQA 4FTSA 2Y64A 1KZHA 2P81A 1HLCA 2PELA 1AUYA 2ZEXA 1UB9A 2ZXJA 3AYEA 4XFIA 3L9JT 3CJIA 2HQ5A 3AZXA 1RUF2 5APAA 1JZ2A 4Y5SA 3RVHA 1Z0XA 2LBFA 1BI2A 2NZ9A 5FPVA 2ZMLA 1TNRA 3HUGA 4QHBA 4NDLA 5L7OA 1UYXA 3S17J 4LKSA 3KEOA 3C2BA 4DS0A 5EG0A 1H9TA 4IV1A 1P4WA 2FZ1A 2FEZA 2E5NA 1USTA 2RM23 1RPWA 4L9VA 1O5UA 3O0WA 4L9NA 4OIQF 2O8OA 1QJY2 2CUFA 1Z78A 4LKEA 3J4UH 4OULA 4IEUA 3U4XA 4G6TB 1Q8OA 1LVKA 4CO8A 4MSVA 3MMYB 4IEPA 4XQDA 3GUDA 2OKXA 1OHFA 5I0TA 3UETA 4YW6A 1R22A 1SDWA 3OYAA 3M3IA 5JI6A 1NKGA 1BMV1 2BERA 4PIXA 3DEUA 2AS5F 1HC8A 4Q4X1 1HQCA 3PJQA 3VHPA 5IWFA 4KITB 3EDPA 3OYEA 4UY8I 4JKKA 2KJCA 2GC2A 4EJVA 2QGUA 2V1XA 3A02A 5ILSA 5FRNA 1LESA 3NSTA 4FBFA 4BXUA 4D5CA 3G1OA 4K9SA 3J7AO 4JBAA 2OYZA 4AEDC 2HTSA 1COV3 2XQRA 1H0BA 3BG5A 4LBOA 2WN3A 2Y0IA 3AMMA 2QQIA 5EPAA 1WWYA 3NAPA 2JDPA 4W65A 2HPIA 3VBRA 4JHZA 5M3MJ 3ZSEA 3LSIA 5FYSA 5LA2A 4E2GA 5K0UA 3DGTA 1VBE1 2FQPA 3ZMOA 1QNYA 3OB8A 1LEAA 2ZJ2A 5DUKA 3C7HA 4FX4A 4F83A 5BS6A 1USSA 1OOPB 1ORKA 1I3HA 2K2SA 1HIXA 4KU7A 3ZN6B 2W9XA 5LZ6A 1W9SA 2R061 1UZZA 2H1KA 3CLQA 3USSA 5CVIA 2VTXA 1D3YA 4HF2A 4QLCU 2D1HA 4QKBA 5DDJ2 3SZPA 4QX7A 2HDCA 2HWC3 1J1LA 3JUUA 2HWF2 4AVTA 2VZQA 2GP3A 2WV1A 1O5LA 3S0MA 1OCCH 3NV2A 1ULYA 1V6OA 3AP9A 4XSXF 2BOLA 2YV8A 2XVKA 1U12A 1BR2A 4XK4A 2HPMA 1J3QA 4B1RA 3LE0A 4CUGA 1VAVA 2NLRA 3M9AA 3F3XA 3V8LA 1YJKA 4K20A 5C4JJ 1W36C 1U5TA 1FMWA 4V2VA 2FX0A 3ZYIB 1ZNPA 2O61A 5FRMA 1OF3A 3F72A 4NNJA 5KCMA 2CSOA 3D1NI 2ZGPA 1VBD2 2QDNA 1TWFJ 3GHMA 4XUPA 2XSJC 1RXGA 1LE8B 4C3JJ 2RDRA 2PN5A 3TO7A 2WS93 1N25A 3EETA 3FN9A 4XQFA 4XYXA 1C5IA 1NXMA 4B4PA 1HQNA 2VQGA 5FFOC 4CDQC 5SV8A 4YVWA 3H3LA 4FAHA 4NIHA 4YZ1A 5IVCA 1X1DA 2WR9A 1EPWA 4JC1A 1QJEA 4Q4W1 3VBOB 4E7IA 2P5BA 4UFKA 4A6SA 3FK6A 1A8MA 3Q9VA 3WNMA 2ZB9A 2KM2A 4PI0A 4L9JA 4A3LJ 2B8MA 4AU7A 2WA0A 2L54A 2XPWA 2VE8A 1OCTC 2XV4S 1H2MA 2R93J 2IFRA 3T3YA 5I8TA 3KCXA 3QPSA 2YUSA 4Z8BA 2FMLA 4QPQA 5LFAA 1Q8SA 1VQ5I 1MQTA 4QQPA 2OX0A 3BR1A 5AONA 4OUMA 2JDHA 1XPWA 2Z69A 2JRMA 4CDUA 2XC7A 1FOWA 4KG8A 4PCRA 2W3JA 5FYIA 4N43C 3OYFA 4DEQA 3A7QA 1GP6A 4MGIE 2V1UA 5BQTA 1JU4A 4LBQA 2PQQA 4HPKB 4FT8A 4EJWA 4X0GA 2W95A 2F4OB 3ABZA 3C3WA 2ZJRF 3GTLJ 2VQAA 1K6YA 1XJAA 1V5FA 1H1AA 3RZZA 2LS6A 3AFHA 3R05A 4ZYDA 1Q56A 3RZKA 3LSRA 1S0EA 2QFEA 4QQOA 4XIKA 2WNUC 1JOPA 4OMZA 2QSFX 1M06G 1LHNA 1UIKA 5F5QA 5ICEA 5JI7A 2LRPA 1D4M1 1TWGJ 5GLWA 1WVRA 4BHBA 5ACA3 3OEBA 1YQ5A 2LUWA 1X3UA 2H6BA 1RMU2 1KA8A 5FZBA 2BTVC 1V5GA 3JBG3 4C0HA 1ZBA3 5FY1A 3A0HC 3JRGA 3F21A 1ZN2A 4K8FA 1X3WB 3HN3A 4O9EA 4AVAA 5FJHA 2V73A 3K4AA 2IXCA 2PLV1 1MNMC 5KXBA 1FNNA 2O7OA 1L7LA 3WTSC 1UZCA 2XSDC 3DN7A 5I8SA 3I53A 3PUIA 5E1ZB 2GH8A 3BKZA 2ARCA 2UYBA 4DOUA 4QT6A 1HSTA 4A6EA 1CGPA 3N9QA 1FOD3 1YTYA 4AK3A 3NWKA 2HBUA 1OKOA 2GSYA 1IZ1A 1BEV2 3ZO0B 1HJFA 2K40A 3SKJE 4BHPA 1QVUA 2ZKZA 1PP8F 3H3ZA 3TQNA 4RR3C 4UT5A 3GHNA 4LG3A 4LK6A 2HKXA 5A6QA 1R5ID 3H3VK 4MXWA 1O7FA 3C3VA 2OQ6A 1H8TC 1SMTA 4YVSA 2Y8KA 4MHGA 2JA6J 3OTFA 1R1A1 5LGUA 3U11A 3RKXA 1E3OC 3FMRA 3E1F1 1RHI2 4DUWA 1Q1VA 3KYDB 1AHSA 4ENMA 2L01A 2D98A 3WT3A 2TRTA 5EGOB 1JU3A 5L3GA 1TBXA 2JG8B 4EWAA 4EYUA 1W8NA 1VFCA 2WRAA 1JUMA 5GADJ 3HNBM 4MIMA 5FPBA 4A7KA 3OYNA 5E8IA 1BR4A 2HWD1 1FXZA 5F3CA 1XB4A 4XRFA 1AX1A 3OYBA 2MABA 2GA1A 5A7PA 2FSWA 2VJIA 2ARAA 3S1RJ 5AC91 2ISYA 4UB6C 1S4CA 3BB6A 2NQYA 3GF6A 4AEKA 1W8WA 2L3DA 1AVBA 2WABA 4LBJA 3SEZA 2XJRA 2ZJCA 5L73A 4MGSA 1SLIA 5HS8A 3G6EI 5CKQA 4LT5A 2VJXA 3FZ3A 1X2MA 1CIWA 1OT5A 3JTGA 5LRRA 2VCMA 2PMWB 1PM7A 2WFF1 4XMIA 3AVSA 4QM8A 1JHHA 2RS53 2EFPA 4V2WA 5FZEA 2O0YA 2R7RA 1ZQ3P 4ITCA 3V0BB 2J1AA 4EMSA 1OQEA 3QU3A 3VDAA 5FMOL 1X1PA 1M1EB 2O3FA 1ZZ6A 3C2GA 3IDEA 5GZGA 2RS33 2ERFA 2VE9A 1RUJ2 1VBC2 3B3QE 3ZFFC 2E1MC 1ND2A 3AL0B 4LOTA 2XJQA 1K5MA 2TUNA 1XNBA 4G9SB 3UV9A 1RUE1 3M3CA 1ZBE3 4DFSA 1B72B 2DVAA 5FPXA 4BQQA 1FMD1 5HLHA 1VMFA 3AZVA 3I3LA 2K27A 4WF2A 1OPOA 1TTYA 2IGMA 1FNZA 2Y48A 4MOAA 4QQ2A 3KVBA 3FUQA 3HJEA 2JVHA 2IS2A 5JI9A 1ETOA 2BE5F 2XGDA 3HTUA 1EV7A 2OAZA 2RR11 4IW3A 2XF6A 2R043 2F5DA 3MBWA 4UFMA 1MACA 2IFWA 1OCRH 5BOXA 2KQRA 3V8JA 1TC3C 2ESHA 5FFXA 1J58A 1UG0A 2VPRA 2CGNA 3OS0A 4BBRJ 5J4VA 1KFXL 2VQLA 3BOQA 2Y26A 1X2NA 4KICA 4BISA 5IP7J 5H6QA 3S2DJ 1X9TA 4QPIA 2KP6A 5IJRA 3WHTA 5FXZA 3WP5A 2Q0OA 4G7ZF 2Q1ZB 2DCZA 3LFMA 3HTSB 2WYSA 5DAXA 4AW7A 3WTXC 4B4CA 5J1UA 1IG0A 3LNQA 1UOJA 1W0PA 3KLSA 4MO7A 1XCBA 3VBOC 1JYIA 1F4KA 3F22A 2P4EA 4URAA 5BNQA 2HU9A 3HSEA 3A23A 2STTA 1XOYA 3POEA 5FYHA 1SQ4A 1RUC2 3CL1A 3R4UA 2OPTA 2G9WA 4FFGA 2VLAA 5FQ0B 3E0JB 5DS9A 3PUBA 3VBUB 4BACA 4A0ZA 3IV5A 2QA4I 1MEC3 2PHUA 5BV6A 3DPLC 2CWSA 2NNNA 2Y6GA 2XF5A 1ZG5A 2M34A 2Z33A 1XNAA 2W00A 5DM7F 3LFUA 2RDPA 3B93A 4QHZA 4PFOA 1J9IA 5DAWA 3ZX7A 1CAUB 5T52A 2L9RA 1H89C 4I6ZA 3BPXA 5GALA 2PAEA 1UZVA 1ETKA 3RZOJ 1QIQA 2HVSA 4IX7A 5FPLA 2BBVA 3WR0A 4N7IA 3NNFA 4JV4A 4DY3A 4XL9A 5FIXA 5I8YA 5C33A 1ZAOA 4QQHA 2R7VA 5DQ0A 4NOTA 4AI2A 4R4XA 2RVCA 2DODA 2GQQA 3MIEA 2E1CA 3R4DB 3OWTA 1WRJA 3WGHA 4Y7NJ 2CQNA 4OZOA 4NROA 3X2QH 2YZ4A 3BPZA 2O8KA 5CVRA 3WNPA 1IKPA 4XF9A 5I0RA 5CAZA 2P37A 5FZDA 1FOKA 4GWIA 3ONQA 2W0XA 1K7AA 1YX5A 2ZGLA 5FZ1A 3ZFGC 4GB33 1QJX2 5M5XJ 2QTWB 4C0BA 4QU1A 3WGGA 1NG0A 2BY3A 5H20A 1RYYA 5DUWA 1D4VB 5LW9A 1LU2A 3LOBA 1NCQB 2FBEA 1D1CA 5E8AA 4EN0A 4PBOA 2DI3A 2BEOA 1QNTA 1S0BA 3A03A 2VH9A 1US2A 2N8GA 1DU3D 4YIRX 5ISLA 2EA7A 2XHNA 2GNTA 1ZR4A 3OR1C 1OYYA 1DQ6A 5E8GA 3PFIA 1SFXA 2QQVA 1CESA 1Z67A 3KMHA 1FPN2 2B9VA 4AFBA 4M74A 5A3WA 4II2A 3C7GA 2DDUA 5JXIA 4HV5A 1FNYA 3Q5FA 2D6NA 2NXNB 3LPFA 1FX5A 1SLTA 5CVVA 1W0NA 1W6NA 4OUEA 3GWZA 3SJMA 4CTEA 4G94A 3SH5A 2B9UA 2VZ3A 1IDZA 4D6QA 5AFBA 1RUD3 3HL2A 3SH3A 5IOYA 3OPTA 3N35A 4CEYA 4HMZA 1V9U3 1R4NB 5F5CA 4LK7A 1BI3A 4OIRF 2QZ3A 4BQNA 4QTRA 2FNPA 1YO5C 5BNOA 4XW3A 2JB4A 1RITA 2XF7A 1MIJA 1XXNA 2W68A 4GD4A 5E3LA 4JVAA 2DCEA 2VE1A 5C9AA 3HRTA 1GNYA 1Q8PA 2JE7A 3JRHA 3ETPA 4UUSB 4ETSA 1A04A 1JTYA 3U4SA 1AR91 4OI4A 1J84A 4G7HF 4YWAA 4OYUA 3OY8A 4RAGA 5BPXA 5DAPA 3DPUA 5KK1A 1XGNA 4IKFA 3IB3A 1IJWC 3KV4A 5EJZB 1KRIA 1OKRA 3BQZA 2WB1A 1XSRA 1QY4A 2LD5A 4Q4Y1 1R6RA 5KR7A 4BU2A 2WWSA 1FC3A 4M9XA 5FV3A 4EJRA 3W21A 1HRI2 1PGW2 4GXOA 2JN6A 5FZAA 1AR72 4I7HA 2R5ZA 3P9KA 4FPJA 5B5EC 3IUOA 1K4SA 4BIFA 2LH9A 2YDEA 5DG1A 2KMUA 3BLYA 3MZYA 3WDYA 4IXAA 3CDLA 4JK1X 2WY8Q 4GH4A 2MD0A 4YG0A 3ZFEB 1DPUA 2DCKA 1NT0A 4CUAA 2Y6KA 4H7MA 5F08A 3ZQHA 2X5IA 2YBKA 4FFFA 1S0GA 3CJTB 1YI7A 3K4KA 4KA4A 3R0AA 5CFDB 1L7QA 5EIYB 2WO2A 1PUFA 3NO8A 3OF1A 2ZHNA 4RDUA 2UU8A 2NM1A 5DUXA 3TYJA 4QX1A 5J3LA 3U0ZA 2ETHA 2KIUA 3TKYA 2L7KA 3ULQB 4ARYA 3ZKUA 3TWIA 3DBHB 4QAWA 1WJFA 3ZR6A 1R7JA 5HI0A 2IVMA 4BB3A 4NAOA 2KDOA 4AHWA 3ZR5A 4AGRA 4MGTA 1RUH3 3ZMVA 2AEYA 2DBIA 5HXVA 4IHSA 3HSFA 2VUJA 3OYWB 2W57A 4UB8C 1K12A 4NHMA 3ELKA 4ESBA 1F1ZA 2PI0A 2I45A 1MJAA 2XROA 4NIGA 4OHVA 2DPDA 5FP7A 3AP6A 2OZJA 3KF5A 4CCMA 1JZ6A 3S6PA 3RFRA 5J96B 3KLOA 1KU3A 4WCGA 4CU7A 4COWA 1QEXA 1HRV3 4FOWA 2WSUA 1OLME 1OISA 1YHFA 4CDGA 1J75A 1PMJX 1SFNA 4LO5B 2PJRA 4N53C 2GP5A 3ZXAC 3KP3A 1FV3A 3IBMA 4NO4A 4XVHA 3L09A 4KIBA 2DMUA 4AEDA 2AQEA 5FWEA 4WVVA 1LOCA 1W1WE 4KISA 1KJLA 1VQLI 2ZNZA 4AVSA 2HZDA 4Q26A 2HXIA 1RJ8A 5D2AA 3ECHA 3T2TA 3V0AA 1YUDA 2GU9A 2JD4A 1FIAA 1RVF1 3RKYA 1JXNA 5F2WA 4LO8A 3NWSA 2BGOA 4CP0A 4XABA 1SEFA 3H1WA 1TWHJ 1LTEA 5ILUA 3BQYA 4HXCA 4HSRA 4A3BJ 4IEYA 3JRBA 2HQAA 3I3EA 3PTRB 4LIVA 2ZO4A 2E31A 2L7ZA 3MKZA 2XR4A 4XBQA 4RGGA 3QP5A 4IHVA 3QPTA 1RUI1 2VMDA 5BNPC 2RS12 4P9IA 2KD7A 3E5UA 2D6KA 3JCUC 4FX0A 2RC4A 4MLOA 2X8KA 2LKXA 1JE8A 4NHJA 4M3CB 1NK3P 4PHZA 4RB3C 1PM4A 2DF7A 4Z6YA 4IGOA 2NMNA 4IE7A 1MD0A 1PZ9A 1GR3A 3M3YJ 3T09A 4ASMB 2B42B 4ZXKA 4I2OA 2RMU3 1EV13 5F64A 4YYOA 3FWEA 4CEWC 3MPPG 4KMQA 3I2HA 4HDVA 2EXJA 2ZFUA 3WTWC 2EIMH 2DJNA 1W6PB 4QGLA 3BJAA 4KMUX 1BC7C 3H1YA 4IF4A 5H2FC 2ZMNA 3KPHA 4JQTA 3NWTA 3ZXEA 2O6GE 3KB5A 4N9IA 3B9CA 4DZGA 4HQMA 4KUMA 2EILH 4P9JA 1FYLA 4U7BA 1NCQC 1W4MA 3RI4A 2Z99A 1ZHFA 2R5YA 2ZS6B 2QWWA 1MVQA 3WXPA 2GMMA 2JK3A 4GALA 3UR3C 5JXJA 1D1BA 1WA6X 3KYCB 1VLNA 1V0AA 3OOXA 4CDQA 2FU4A 3N4MA 1YOVB 3ZIWA 3L2VA 3KHCA 1UXXX 1SCRA 4YNIA 5LASA 1N75A 1BZWA 4M3GA 1BYHA 5BNGA 4HPQA 2HWB2 1GXPA 3ZDSA 1HW1A 4GO1A 1V00A 4CCKA 2NS0A 5JDBA 4BEHA 5FMOS 2CW7A 2PHWA 3PJRA 1V6KA 5F37A 2X1CA 3JRCA 2W1UA 2Q8KA 5A7WB 4PSXA 4EN8B 5FZ0A 1K45A 3T2OA 2IXKA 1BVVA 3M3QA 1FP1D 3F95A 3I59B 2JSPA 2VMFA 1VBA2 2KA3A 4FTBA 4N43A 2TDXA 4Q4V2 2V6EA 5B4NA 4BLJA 2RJ2A 2YC4A 2RN7A 5LA0A 3CF2A 2ET1A 3ITQA 3VODA 3CCVI 2ES3A 5F5AA 1QHGA 1ODMA 3BALA 2Y0SA 3TB0A 4LOSA 2ZTNA 5FUIA 4NC6A 5J6XA 3RDIA 1LOGA 1JZ5A 4BIOA 5DXDA 2COBA 4KNCA 3VUOA 2WUHA 1OCPA 4TTGA 3HOUJ 1WKMA 2GAUA 3RZGA 1DGWY 3KGZA 2EIGA 1LDDA 1X1AA 2K7LA 3B6AA 3QH7A 2K0GA 1MZ5A 5FZFA 3MN2A 1ZZ9A 3I2JA 4WX9A 2KXLA 3HRMA 3VHRA 3LSKA 5E16A 4XC9A 3K2ZA 2HJIA 2O5RA 3PO3J 1ULCA 2A3YA 1DG6A 2AEZA 4AEJA 1ZRCA 2FD5A 5CZKA 3MW3A 1U78A 5FZOB 2WNVC 4WM8C 5FBZA 5E18F 4XM3A 5CFCA 1MDMB 4FVVA 4XKCA 1W06A 2IGKA 3TOJA 4LE3A 3NMBA 1RZ4A 4DYQA 5J4YA 1EF4A 3BPSA 1B59A 5FZ9A 2B63J 3ZP5A 3DEMA 4LKFA 2YS9A 2ACJA 2VY0A 2W85A 5GAGJ 1S0JA 5FKMA 4RR3A 1O59A 4HLYA 3ZR8X 5JOYA 5FYCA 3CUOA 1H8TA 4EZHA 3OBTA 2E19A 2Q8OA 3V7CA 4A3JJ 3CHXA 3B01A 2JA5J 2IC1A 5K7FA 1MS3A 4GMP1 3FMQA 5LEKA 1UZWA 2J1RA 3U07A 1TMF2 1R71A 4IE0A 2R49A 5F6LB 2KIMA 3VYSB 3LIHA 1Z7S2 2Z5UA 3ME2A 4F92B 1BW5A 4MG2A 2H8RA 5F0HA 1R5HA 2WIIB 4FPHA 2DYSH 3BOWA 3ZYHA 1DQ4A 2AH2A 2PHRA 4OHYA 4L5JA 1JBCA 5A1AA 4A12A 1E5RA 3BCBA 1V70A 5LATA 2CTVA 4DQAA 3AKRA 3T5XA 3T4VA 2KIQA 4AIHA 3ZQIA 4HKWA 3MPBA 4HVRA 3M1CA 2ZMKA 4CU8A 3F9KA 3TN91 1HJGA 3J7NA 4N9HA 5J36A 3E6DA 4A2UA 2MLGA 3MWMA 4HSTA 2CFOA 2NVQJ 3POGA 4Z07A 4CCJA 2EWNA 3K48A 2ZFWA 1S0DA 1VBE3 3VYRB 2Y34A 2QCSB 2F6CA 4PUSA 2XJVA 1YJWI 2YU2A 2KLOA 1UELB 2X6OA 2R063 2EZKA 3RI8A 3ZXFA 4KN4X 2Q8EA 2YROA 3HB9A 2DFFA 1AU7A 2GN7A 2GDFA 5E1RA 3FHQA 1FOXA 5LK5A 2WWUA 2YFZA 4BQ3A 3MICA 5FOBB 3F8MA 3ZFFA 2DYCA 1AX2A 2COMA 2QKLB 4BXSV 3LAJA 1WMFA 3JR9A 1O4TA 4YG2F 4OZXA 4DEVA 1W2UA 1F4HA 1K42A 3F8BA 3JB4C 5FY8A 2R072 4QKDA 5B2GB 4RLFA 3WU1B 4DY5A 3NQOA 1YW7A 5EQUA 3N9MA 1VJ2A 2Y0MA 4QXBA 3PNYA 1WLCA 5A3OA 2OQGA 1R1VA 2EZLA 3RJRA 1B35C 1SLAA 2ZGTA 3GZUC 1O4ZA 4ZS2A 3ZPOA 1XSVA 3E6CC 4CDXB 1EPZA 4S04A 2QJVA 2WZEA 3HEIA 2GC1A 3ZOIA 4GJZA 3JD72 2WWJA 4YG3A 4O65A 3CUQB 5FLJA 1A31A 2DUPA 1IRXA 4CU9A 4QX0A 3MFKA 4KG0A 5I0SA 5L3CA 2JDKA 4DNYA 2J7MA 5LY1A 2QBXA 4A41A 5HCHA 4OMYA 1N77A 1H2LA 3THDA 4JDMA 2ME6A 1XN7A 4P9XA 4F91B 4Q4W3 2CW0F 2VXJA 5T55A 2PMZN 2YX7A 1BK1A 2E1OA 4BJTA 1MDMA 5HBAA 1WQ2A 1EUUA 3N7KA 4BKXA 4COVA 1EAH1 2VVDA 3ZM8A 1H1IA 2F5VA 3FXQA 1GYKA 1W03A 1NYWA 3ZVXA 4J25A 2LMDA 2FDIA 1RL3A 1OMIA 3SEEA 2WZR1 4ZU7A 5FLIA 4Y24A 4XR6A 4CYDA 1UMQA 3CP2A 2ZEZA 3IT8A 4D1QA 5JLVA 3ABMH 3WF3A 2P8TA 5H6RA 5FLXZ 3GZ6A 4NC8A 3CCJI 3HMYA 4PK4A 4NHKA 5JOWA 1WFXA 2O8QA 3GZAA 2XDVA 1XNDA 3K4CA 3U75A 1AXYA 3FXKA 3LA3A 2RNGA 2VUMJ 3M2MA 2QDRA 3O1UA 2CAUA 4HF0A 2F48A 2QVOA 1IRFA 1NCRB 2DA4A 4NPLA 4YFZA 2DLLA 2MFZA 5HDNA 1TZLA 2AENA 4KWUA 2VKEA 3FX3A 3R60A 3ML6A 4CXYA 2VGDA 3E5XA 1D4M3 2HWC1 4U0WA 2GXAA 2PHFA 4P5YA 2ADEA 4RS5C 4W6YA 3DWLE 3F0CA 4Y4YA 4XLHA 2AXTC 2PBIA 3RSNA 2R7UA 4ENNA 2DVDA 1UOFA 4QPGC 4X6RB 3I3MA 1C8M2 1XNCA 1W8HA 1X7NA 3IRRA 3MIHA 1LGBA 3J7YJ 5JUVA 2PLV3 3ACGA 3QACA 1T98A 1CN1A 5CISA 3ZQ7A 3SH4A 2K9LA 1UU5A 1OYWA 3K1PA 3RPUD 3AZWA 2VBBA 2EK5A 2JDYA 2V72A 2VJJA 3OUHA 1P7JA 5K7PA 3ZFGA 5IAXA 2HQRA 2V4AA 4LLOA 2HYGD 2CWEA 2XXZA 2WS91 2WWYA 5DM6F 2P6HA 1IO2A 2I74A 4UFIA 2JIGA 4Y26A 3MKLA 3H0OA 3AMQA 1ZG1A 5A1LA 1R1A3 2P1BA 4XRSG 1RUG2 2A3SA 3WQBA 3KV5A 3MW4A 1VMHA 3KWVA 1JTZX 2EINH 5E3NA 1S0IA 1W6QA 4G12A 3PUSA 1XE7A 2YC2A 2YSRA 1NX9A 4HG6B 1W9YA 5IP6A 4TZDA 4WM7B 3VB2A 1YFWA 4S2DA 2R0QC 1YFYA 4Q0PA 3O1MA 5E79C 1HN0A 2EALA 1OR7C 2LVSA 4JQFA 1ASJ1 3JTHA 4RAZA 2D5HA 3W9AA 1IDYA 4A6DA 1X33A 5CKMA 2KISA 4EN6B 5EJ1B 3A1YA 3Q0UA 4ZONA 4M9SA 4TYSA 1FTTA 1REPC 5AC93 4AVZA 3H9JA 1BBT1 4PI2A 2BVBA 3NNGA 2X6YA 2VTFA 3QODA 5CYYA 4FFIA 2ZHMA 1WZXA 1CAXA 3GW2A 4BL0B 2GOXB 4MGQA 3ZSJA 3GTKJ 3LWFA 1K61A 1OBNA 2WFF3 2K9NA 2JENA 2GN3A 2DAOA 4W4ZA 2VUCA 1HKDA 1Z0HA 4FPKA 3OOUA 4QPYA 3ALQA 2ZMEA 5J3UA 1PO12 2ZX1A 4XF4A 3ZXLA 4Y1UA 2CDOA 3ACLA 2XL7A 3NKTA 3RQ4A 1W2TA 2A61A 3LAPA 1VRH1 1W8UA 4PJLA 4MX3A 5JMCA 3B5LB 5JXGA 3DYPA 1ETYA 2BDRA 1QJZA 5JZGC 5D5VB 4IL7A 2HXOA 1ST8A 2L4AA 3QPLA 4NHLA 1VBB1 2VW0A 3BN6A 1RUE3 3HHHA 1NQDA 4MHUA 2Y6HA 4C3HJ 3MDPA 3POJA 4UV8A 3UJQA 5A32B 1FMD3 3FXUA 2WAEA 1BI0A 1DYKA 4C1XA 4Q8KA 2JG9C 4AI1A 2PJPA 1PGL2 2EPFA 4EM2A 5M3FJ 1ZRRA 1T95A 1RUF1 3VDXA 3I4MJ 1SMVA 2K02A 2MW8A 3WP4A 1YRZA 2P6TA 1PVXA 1FOD1 3VKLA 2I8DA 5LA1A 1OXCA 2DTZA 1N3QA 2KFDA 1K4TA 1XU1A 4Y52J 3BIWE 1S5LC 2X6XA 1NOVA 1WZ2A 4ZYEA 2WZPP 1WBFA 2V9KA 4XLNF 4LR4A 5EV7A 2WBKA 4WWCA 1RR8C 1OLRA 5DAVA 1URXA 1HXS2 4GYGA 2WO7A 2QQKA 5IYDJ 2ZCWA 1QJY1 2EIBA 4LB6B 1G9FA 1US3A 3BOPA 4R8HA 3CF5F 1U5IA 5DPNA 4RFT0 1AA7A 4YM2A 4CDXC 4X8NA 1TG7A 1ZK8A 2Q4SA 2OZ6A 3PUAA 3EBRA 4JX5A 3CUQC 3V4GA 4RA0A 1D0ZA 2HZTA 1LRHA 4LNVA 4W50A 3EYYA 3EYIA 4OI2A 3WDVA 3WF1A 2ZBKA 1W8FA 4DOZA 1Y43B 2IS4A 2LM3A 4UI9L 4ZS3A 3CESA 1DCSA 5FUPA 2DMPA 5FZ4A 5DEQA 4Y1YA 1JN2P 3C2UA 2X4HA 3EXUA 3ECOA 3IZOA 1RRJA 2HOSA 4XBFA 2BZDA 1CQ9A 3PNAA 3PU8A 3HG9A 5IVBA 1IXSB 3CQZJ 4R9AA 3LOIA 1I6HJ 3BODA 4HBNA 2ZZJA 3ZYJB 4TWTA 4LLNA 3I2GA 3KZZA 1QOOA 1TE1B 4XNFA 1SAXA 2STWA 4LKDA 1R082 1YQ2A 4YW2A 2A1XA 1GWMA 2L9LA 3B6CA 5KXDA 4LBKA 4GXLA 5T5LA 4P02B 2IPQX 1HB4A 3J80Z 1ON1A 4BGDA 4U2AA 1IN7A 1ZH5A 4N53A 4XETA 5DDJ1 2PTMA 3VD4A 3TAYA 4MEYF 1PO22 2HWF1 2AUYA 1REEA 1RESA 2V1DA 3OBZA 4W1UA 4XJZA 2VBWA 2D5VA 3WTZA 1GUUA 1O91A 1FTZA 3VL9A 2V9PA 3WU2C 4EROA 3PVBB 4MQ9F 2DYRH 1YCIA 5FLXK 2EXHA 5D6FA 1ZBE1 4O5VA 3N36A 4AFAA 3ZQFA 2ZNYA 5FYTA 4QHOA 1ZARA 1AJOA 1TNTA 1A5JA 2QCOA 1T6BX 5F1RA 2WLPA 5GZDA 2UXNA 2PX9A 2JA7J 3FHNA 2Z16A 3DYOA 1H2NA 1BA5A 2WV0A 4EJOA 4UBHA 4CCDA 2BV6A 2HDWA 2FE3A 4K7JA 4R9BA 4GWJA 5BNPA 2OUJA 3QOPA 3E3VA 1AR62 1G3TA 1YLFA 1DUXC 2TEPA 2WO1A 1GDTA 1OUSA 1TQMA 2QQJA 5D5WB 4JDOA 5HOOA 1LU1A 2J1TA 1DIWA 3QLQA 3CP8A 2KL4A 4M6YA 1GSLA 2I10A 5JR7B 1JXSA 3WZ1A 3A0NA 2WA3A 4IEOA 4M0NA 1Z3YA 4KIGA 2L2OA 1E5SA 3AKZA 1LOEA 1H4GA 1X9PA 3S16J 4B1MA 5JLXA 5FK8A 3KIOA 1E3HA 1B9MA 3NEUA 4DO0A 4A3MJ 5CQGA 2C1FA 4AI0A 3ABLH 3LSEA 2ARBA 4YZ4A 4IEWA 1N3PA 4QB2A 4Q4X2 3JW4A 4IL6C 3WG3A 3NJZA 4XLPF 1FEXA 1MBEA 5C7GA 3R0JA 3KEYA 1XYOA 2JDUA 3KFWX 2AR6A 2WAFA 1APNA 2NYXA 4HRIA 4I3PA 1VQ6I 5J1XA 1ZZCA 4H2AA 4KN7X 3OOPA 3AC0A 4AUXA 1MEC1 3FXMA 2JDZA 4AG4A 2QLZA 1OKQA 3RI9A 4G8XA 3T8RA 4LUKA 1UPSA 1ERDA 3GTQJ 4ZPIA 3KP7A 3ZMDA 2VBZA 1QGLA 1FBQA 3LDBA 3H3UA 3K2AA 2YGLA 2OTLI 1KQ9A 3H8RA 2CH0A 4NJ4A 4RGUA 1IZ3A 3UKVA 5A7QA 2M7BA 4S2HA 1UJ8A 4ARXA 4B3XA 1CF7B 2I2SA 4IPAA 1LEBA 4LLGF 3HIFA 4ZDLA 3S14J 3MKYB 3I55I 4NHYA 3I7DA 4LIUA 4LJHA 1AR93 4AWDA 2H1LA 3I4IA 4Q4ZF 4DINB 1WMEA 2CL2A 1MZEA 4Y3OA 3BDDA 1I1GA 5FBJA 4RGKA 3BJOA 3VBHC 1WI3A 3G71I 2G7HA 1OLTA 3GBGA 1PX3A 1JYNA 2A6EF 1S1AA 2LYCA 4DXSA 2D3SA 2QYOA 4TV7A 1ZLKA 1SLCA 1G9BA 4ANJA 2C6SA 4D9JA 2EZIA 1VNDA 1Z9CA 2MD5A 5A3MA 4FHTA 1HA8A 3M1HA 4XMYA 3MIBA 2Q2EB 1CR7A 4JGYB 4GB31 1SD4A 2FUG2 1GP4A 1LJ7A 1AR82 3ZRGA 1GKBA 4FXKB 2M4GA 3ENRA 1RC9A 1OD5A 5DD4A 2XAFA 3GTGJ 2BFUL 2WNVA 4WM8A 3CMAI 5FROA 4B1LA 1YW8A 1I3QJ 1A34A 3O0VA 1VAKA 2R7QA 1AL22 2I5UA 2DU1A 2Y60A 5L3FA 3DKXA 5CVJA 2FOKA 1G3SA 4BAYA 1LAJA 1LOAA 5ABJB 1OA3A 2D3RA 2JKBA 1XNKA 1QH6A 1DZQA 2L9SA 4QKNA 4Z1VA 3PL0A 5LHIA 1N1YA 2P34A 1Y8QB 2AQFA 2E1NA 5FKKA 2GMPA 5A3NA 1SAUA 3VWBA 1JUHA 3B00A 2G9ZA 4UXAA 4UYBA 4KNYA 4IERA 2C9KA 3BZKA 4XDQA 3J7ZI 1U3EM 1H8AC 1DU0A 4B3AA 1PVC2 3W58A 1T2XA 3ZIXA 1S0FA 3BTZA 4XZUG 4Y15A 2UWCA 3AX4A 2GOMA 1R083 3MIGA 3IL2A 3I97A 2PQ8A 1BIAA 5C44J 1P4AA 4JGZB 2KR2A 4L11A 2FOWA 5D8AB 1GOGA 3H42B 4N4NB 1A8DA 2X0LA 1PO23 3WW2A 2W47A 3ZXJA 2CO5A 4A45A 4SLIA 4CU6A 4L2NA 3LWCA 3CLOA 4EN7B 3PSFA 4GKXA 4GRIA 1A36A 3F8CA 2A5ZA 1RVF3 1VMJA 2F4LA 2ZXIA 2XL9A 4EATA 1UZYA 2AXLA 3WY6A 1DLCA 1RGSA 5C4WC 3UNGC 4NQWA 2HEVF 4LK0F 4UVBA 1KFUL 2ZHLA 1P2FA 3AKTA 2A68F 1IUYA 3AVRA 3T4HB 3ZLIA 4CA9A 1RUI3 4D0QA 3J80K 4AQSA 1RUNA 3JSPA 2ZXWH 2ET7A 3T0DA 1YYVA 3KZ4C 2MSYA 4FPGA 1XMAA 5FLMJ 1Y3TA 5FRAA 1IGOA 1AZDA 3PTYA 3UESA 1WW7A 3GVAA 1BL0A 1JHJA 4CXWA 2HQNA 3K3OA 1VALA 1R4MB 2VKVA 2VNVA 3E6BA 1Q3EA 4CP9B 2QBYA 3VBFC 3G1MA 4DGWB 3IDCB 1FV2A 2NOJB 2P7CB 2VPLA 4JX0A 5C3PA 3CC2I 4L5IA 3HKZA 4ATFA 4W6XA 2YXSA 3K51A 4UF0B 3T2PA 4DPNA 4FFHA 2IT0A 4R1HA 2VNRA 3SZGA 1B35A 4LTAA 2SLIA 1LKNA 1YEWA 1GLNA 1IG3A 1F8VA 3RNSA 2VC1A 1T8IA 2CGOA 3I54A 4CUBA 2P6SA 2V79A 3ZMUA 4UAPA 1WJCA 3D5RC 1XC5A 3WODF 2G0EA 4LJZF 4BQOA 3K0LA 2HWE2 5DD8A 4KGQA 1RUH1 5JPMB 2NS8A 2F5CA 2PLYA 3AG4H 2BOIA 1OVPA 4CDWB 1LVAA 3FHZA 3OYDA 2QQMA 3K70C 1W0UA 4LHSA 2WO3A 3QBQA 4ZY9A 2ATFA 1HRV1 1TT0A 2LALA 5F1JA 4I98B 1KQRA 1MMSA 3LSJA 1GNHA 4UOJA 4PBPA 4DXRA 5J37A 3AM2A 3SZTA 3BCWA 1DQ5A 2F17A 2VO5A 1FIPA 2GBYA 1RIRA 2YFUA 3QYEA 4WVZA 3S5QA 1I39A 4QPWA 2BW3A 4X6AJ 4CZSA 2DOFA 2VZPA 3OBAA 4WXDA 3GZTB 3HZJA 5HNFA 4A3KJ 3VHNA 2X29A 4Q0SA 1XSXA 4RQPC 2XKOA 4LUMA 3VZLA 3VFZA 1QJU3 4CUCA 3AYCA 3BTCA 1W6MA 3CJIB 5ICFA 1T38A 2LBFB 3UGGA 5FMBA 1OCOH 4PT6A 4AHYA 2DDAA 4DZJA 3HUGB 2VUAA 1AWCA 2VMHA 4LLLA 4F93B 1WMXA 2LDUA 5L7OB 3POIA 1BHGA 4DRVA 5EYRA 3E7LA 3IWZA 3HBZA 3KF3A 1W90A 5EG0B 5FZMA 4IV1B 4RYDA 3FUOA 5ANNA 4RHV3 3JU9A 1IQAA 4O7XA 5T50A 3JAMZ 1LODA 4YW5A 3RS6A 4I0BA 2IGOA 3EUHC 5ICCA 1QJX1 5D8AA 1ON2A 1CZTA 4RS5A 5IK5A 4P9YA 2XPJA 2VTXJ 5GPAA 4HA8A 1R36A 1FY7A 2HH9A 3URFA 4NN0A 1MJ9A 4QPGA 1DLLA 2NYYA 2RR12 5T54A 2VKDA 4IDZA 2M9HA 1AXKA 3FBNB 4D5FA 2RMU1 2TBVA 5HS7A 4XBLA 2V4JC 5D6EA 1NE4A 4DJAA 3NNLA 2ZZQA 3MKWB 4GA9A 3IMMA 2G4IA 3GZNB 1VPHA 1RNLA 5CQEA 2JE8A 3DXTA 1LEDA 3LEKA 1T0FA 3MEXA 4Q0VA 3M7AA 1IOAA 3HT2A 2BY0A 2H0VA 3KEQA 2OXBA 3KZYA 5K7ZA 2VOPA 1PMIA 4YM3A 2RE9A 2LY2A 2QQNA 1FPN1 1NLSA 2F4PA 1R64A 1TZOA 3NAPB 1UFMA 3BR5A 3LZZA 2QVSB 3VBRB 4NRQA 3GGLA 3J7HA 2X48A 5K0UB 4GMP3 3F2ZA 5K9YA 5D4RA 2VOKA 2MHFA 2QZ8A 1GP5A 3K4NA 2DQRA 5FZ8A 2XVGA 3ZGKA 4Q0QA 4OHXA 2JDMA 2QUOA 5DUVA 1OR7A 3CCSI 1SVMA 3ILFA 4PLMA 4D7SA 2A75A 2Y30A 3IAS2 4M00A 4Z92B 1UF2C 5JCTA 3OIOA 4IE5A 4I02A 1KS5A 4XIDA 2QQWA 5EP9A 5L9RA 4AQ6A 1MMDA 4XLFA 1NLRA 4IESA 5JXHA 1WD3A 3J7AY 4BWOA 3RCOA 1QXJA 2X9DA 5LBEA 3O0XA 1YJLA 2WLQA 1KGYA 3DTIA 1BM9A 2M87A 5FYYA 1UY2A 5H9QA 3RGBA 3KT7A 1U5TB 2AO9A 5T5JA 3WEZA 3LQQA 1DQ0A 5E20A 4CDWA 3WGIA 9ANTA 4ONUA 1NA1A 2ARXA 2GLOA 1VQ8I 4BQ4A 2EIDA 3WTTC 3IPVA 4YSFA 1FATA 3VLBB 3SYTA 1W3VA 5H9PA 1TME2 2M5WA 3TEYA 3VZKA 3BI3A 4I0WB 4P08A 2ZKNA 3HOSA 3FBIB 1ODNA 1J3PA 1DZTA 3VDBA 1HRI1 6PAXA 1PGW1 1AYN3 1XQNA 3A0KA 3KV9A 3T1LA 4EGZA 3GBWA 1AR71 1UKGA 4CXXA 4YVWB 4BOWA 1NTCA 1ENHA 3GXOA 1O57A 4GQ7A 5JZGA 2R7XA 3HRUA 2E53A 4LBQD 2UV1A 2ORXA 5FXXA 3RWKX 1IQDC 5F04A 1ENQA 2FDKA 4HSLA 2PHLA 5K5RA 2P3JA 1BJAA 2VULA 4Y20A 2QQUA 1UMIA 3VKOA 2BRTA 4COYA 4KMFA 1X1BA 3VN4A 3I58A 3CCYA 4UVAA 4B29A 2ID3A 1S29A 3BJ6A 3PNTA 2K5CA 3VL8A 2JG9A 1WLWA 5DABA 5HCFA 3LSDA 1U9NA 2LK2A 3J26N 4XHBA 4IV3C 2EAAA 3HSRA 3KCYA 5FO9B 1MQTB 2SBAA 1SACA 2WAQA 1N1SA 1BR1A 2J5OA 1K78A 2HYFA 4ITVA 4EQQA 4CDUB 2E6VA 3PHMA 2W87A 4M4RA 1A78A 1ZX5A 3MCZA 1IS5A 1IAWA 3E97A 3CCMI 4PDWC 2IA0A 4LBQB 1YFHA 5LBCA 1LENA 1AYM2 5FKBA 2P4WA 2FDFA 4AFDA 5K8SA 2BNOA 2M8EA 3USUA 4HK8A 4IQPA 4W8JA 4NIAA 2W91A 3Q8BA 4N8MA 4NWWA 3X29B 2OS2A 2C0ZA 5A3TA 4WVMA 4G9YA 4Q8LA 1EAH3 1ETXA 3DKWA 1YC61 1HKTA 3WP3A 3WVJA 3O6BB 4BBSJ 2VQCA 1FLIA 3AFGA 3HQXA 1KU2A 1OD3A 3BVCA 1YLLA 3KSCA 2Q1MA 4XFAA 2WZR3 5C6CA 5B3SH 4IEVA 3JB8A 2IJLA 4YW1A 4HAMA 5FZGA 2VXDA 5BUVA 2DUOA 1UY4A 4OOIA 1VQ7I 1ZYRF 1KS4A 4KYWA 4NPMA 4WVWA 4ZHNA 1MZFA 1KEXA 3GO5A 5EJCA 2LTNA 3CZ6A 4DMIA 1GQHA 1E5IA 3CU7A 4XAAA 2NP0A 4QPOA 2YPJA 5F8PA 3K4DA 2Q0AA 4IQ4A 2XONA 2FXAA 3NARA 3VDDC 4MXWB 3CJIC 2RS11 3PU3A 4FCAA 2BNNA 1U0JA 3ZN5A 4YVSB 1YS7A 3W3CA 2DN0A 2ZSHB 1ND3C 3MIFA 4Q4Y2 2X1EA 2BFUS 3PFYA 4TLGA 3AZYA 1RXFA 2EFNA 3MUZ1 3BTYA 4Y5TA 1F4AA 4D3WA 1DQ2A 2NNYA 5J09A 3DFGA 3TW7A 3T08A 1W0TA 1C5HA 2WDBA 1XD7A 4IZZA 5BY5A 4A3IJ 5IVJA 2PYTA 1WLTA 3DEEA 4BE1A 4AWXB 2QQ8A 5A7NA 3WQ7A 1EH6A 4D0PA 1GQGA 4JX4A 1MMAA 2GMEA 2ZX2A 5JMOA 4E8DA 1MZBA 4HFSA 5AVPA 2VCAA 3P1IA 4YGCA 2HBTA 3DPRC 2NVXJ 3B69A 1E17A 2ZJQF 2XIGA 3H5NA 1GV9A 1B8IA 2JUCA 1YRNA 3DLLF 3JAMK 4NRPA 3HQUA 2ELJA 3S32A 4BK4A 3MFCA 5EEAA 2B4KA 3P9CA 4L9TA 1AKHA 1BXHA 4CCNA 4OHWA 3CMMA 3EQEA 2E5ZA 3DYMA 3HXLA 2DXIA 2DURA 3ETQA 4P9LA 3B73A 5HVQC 1VP6A 5IT3A 1GHCA 5DUUA 2DVBA 4K3UA 2HI3A 1HDPA 4BMBA 2DJIA 1BIBA 2VQTA 2HWB1 4GAZA 1MS5A 3U78A 1ASJ3 5E3OA 3KP4A 1ZGJA 3WNKA 1K3IA 3GNEA 1X4PA 4MZUA 4XFGA 1SBEA 1X58A 3MF9A 4P9GA 4OHZA 1FX7A 2OBPA 4Q5SF 1GVDA 2BWAA 1ND2B 1SANA 3G3ZA 1BBT3 2X51A 4P9WA 1SD5A 3O2PE 2OQRA 2JIJA 1WPKA 4PQQA 2M4KA 4BCUA 3M8FA 1K5MB 3E6MA 3MZ8A 2VVEA 2WSVA 4L97A 2XB6C 4ES8A 4HK9A 1MSFC 1Q1HA 3K69A 5T3NA 3FHIB 2WQ8A 3FLRA 5FY0A 3H0DA 3EYPA 2EV5A 1YIJI 4BQWA 1WSUA 2B7YA 1XYNA 1OFNA 1JMUB 4CZCA 2VBYA 1H30A 3J81Z 2P5KA 1PIV3 2Q1FA 4YM0A 1O8SA 3HGYA 3S30A 2HOAA 4ZTJA 1TQ5A 1TWAJ 5FZCA 2UXXA 2KRHA 5IT9Z 4K6BA 1LHOA 1QKQA 2CU5A 5HS9A 3IDAA 2MH9A 2FHRA 2A6HF 2VQ0A 1QNWA 2C4XA 1D8JA 1VRH3 3OJBA 5JAXA 5FP8A 2JEMA 2IXHA 4PJMA 3ERMA 1FPQA 1CZSA 1XX5A 2UYAA 4HG2A 3VDCA 3I0TA 4LK1F 2A73B 1VBB3 3FE5A 4PF1A 2XKPA 2BYVE 3LFKA 3WHUA 4UBGA 2IA2A 3NVCA 3AK0A 4XOGA 4QPIB 1UD1A 3DV8A 3VBSA 1DZRA 1ZM1A 2ZA9A 2M3AA 1V6JA 1NHAA 1W8OA 5FO5A 4X6QB 3CQOA 1RUF3 3FISA 4KQ7A 2AHQA 2MEV2 3GBFA 4ZC3A 3OY9A 5DZEA 2CUEA 2WC2A 4N7UA 2O1QA 1WA4A 1XMKA 2ZKLA 2PG4A 3C7OA 1S8NA 1A3KA 3LSPA 2D5FA 1H0MA 5BNNA 2YUEA 1BLZA 3VZNA 3HNMA 3ZCOA 2XLGA 4NE9A 4M73A 4M0HA 1U2WA 3EUAA 1G9CA 3H9AA 2KT0A 5IP9J 1UO9A 2PAMA 2D6OX 1LDKB 4BQAA 2VNOA 4E4SA 1JT6A 4R9DA 4XBNA 4RFRB 1H1MA 1QJY3 3JXSA 4F55A 3FIWA 4RN5A 5A3PA 3VYTB 4RGSA 4A7ZA 4AGVA 1S3JA 1G86A 1LHUA 3D3AA 4CDUC 1YFUA 5D5UB 4AOCA 3LEGA 2EA4A 1UNBA 2E36A 1UOGA 1Z7S1 3H8UA 1GZWA 5FB2A 1UZ0A 3Q0WA 2X53S 5B66C 1R9TJ 1FMVA 3GTOJ 5EEGA 4NB5A 4PIZA 4N4OB 3RZHA 4DUVA 3JRIA 1CAVA 3CNAA 5D4SA 2KRCA 5IHRA 3LOCA 1X1CA 1OCZH 5JWPA 5SV5A 2EH3A 3K4JA 5FWJA 3UT0A 2QQAA 1WCMJ 2DO7A 2OD5A 4YFNF 5KHKA 1AJKA 1TLHB 2V6CA 1W2AX 2VOVA 1WI9A 4LXLA 2GC3A 3FKJA 4ASNA 5JSPA 1MBGA 4J1WA 3M4FA 2XUEA 4HN1A 4H55A 4YELA 2IWGB 3H8OA 5TGTA 2JZYA 2Z79A 4YLZA 2BW8A 3OBRA 1FZPB 4EEFG 1B1BA 1T39A 2QQBA 1F9NA 3ZN0A 1SG3A 2XBO2 5DDJ3 2KHMA 4B3NA 2JTVA 2YBPA 1I50J 5EXOA 2HWF3 1SPPA 1TNFA 1D2SA 4BK5A 2JX9A 2V5YA 2OZUA 1SFOJ 1OVSA 5A6ZA 5M5YJ 5C3OA 5F2SA 4GGGA 4P96A 1Z05A 1OOPC 3SNMA 3O7OA 3RMXA 5FAXA 3MYXA 2R071 2M45A 2W94A 3FL7A 5CJ9A 4M3CF 2CS3A 4A5MA 5J40A 5C4WA 3VD5A 4YVSC 2V09A 3H1CA 4EVIA 3WV6A 4KWJA 3Q8AA 2DA6A 1AF9A 4U87A 1V6LA 1NG6A 2E2IJ 4GYIA 1VBD3 1GVJA 1CJPA 1XBFA 3H5AA 3L2RA 3JD71 1XRUA 1VI0A 3HT1A 2WQ4A 2MC3A 1NZIA 1W6NB 2ZAHA 4CH7A 1UHSA 2LKSA 2LNBA 3I3DA 3KQ4B 3BG7A 2BOJA 1YI2I 2GM4A 1R092 3BR6A 3BTXA 2IXJA 2QNKA 2PHDA 3LQCA 5FZLA 4CEYB 3T0YA 3VBFA 3SQNA 3OGSA 1UY1A 1KYZA 2FBHA 2ECCA 4RMNA 1RUOA 2CU7A 4IRGA 1IPSA 2NPIA