2PQQA

Structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
147
Chain Sequence
b'GHMDDVLRRNPLFAALDDEQSAELRASMSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENMLAVVGPSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDAMLVFSDGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title The crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2)
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 34
structure length 147
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pqqA00
3IIAA 3DKWA 3H9AA 3OF1A 4AQ6A 5I0SA 4F7ZA 2OA2A 4JVAA 1J3QA 3D0JA 3H1MA 1ZRDA 4JV4A 2ETEA 4MV2A 3SXWA 4I09A 5J3UA 3JZVA 4LULA 1CAVA 2CAUA 1V70A 1OMIA 4D7SA 2GC3A 3U10A 3EQEA 1NYWA 3FE5A 3H8UA 4WVZA 2GAUA 5KHJA 1ZRRA 3IBMA 4XFFA 3SCHA 3MPBA 4XEZA 4Q0SA 5JSOA 1QXRA 2XGXA 5BPXA 2H0VA 4FAHA 1QY4A 3UKVA 3G7DA 3C3VA 3I7DA 4ONUA 4YNIA 1ZZ9A 4HZFA 2EVXA 4IERA 3WW1A 3B02A 2DCTA 4A2UA 4I3PA 4QXKA 4ORFA 2B8MA 5FPXA 4KWJA 1OD5A 1EY2A 3BU7A 5FDBA 5KHGA 2PFWA 4QGLA 2WC2A 1NE4A 2CGPA 3E6BA 3NKTA 2UYBA 3RYKA 4META 1UIJA 5EFUA 4XFIA 5BV6A 4IEVA 2K0GA 3RYPA 4CYDA 3SHRA 2FQPA 3ETQA 3BCWA 3DN7A 4LUMA 1GQHA 1ZX5A 3SMHA 4MGIE 2Q30A 3M70A 5T3NA 1X8EA 2GH2A 3IDBB 4ZU7A 5LRRA 2GC0A 4X6RB 4YRDA 5KHKA 1QXJA 5I0TA 3S7EA 3PVBB 2XKOA 5JCTA 4LTAA 1RC6A 2D5FA 2D40A 1J59A 1CAWB 1Q5OA 2O1QA 2Q0AA 3SCGA 5K8SA 3LA7A 1XRUA 2GC2A 2VQAA 4GULA 1G6NA 4MH0E 4I0BA 4Q0QA 5I8YA 2PHDA 1EYBA 3H7YA 1ZZ6A 4I0AA 5E16A 1O3TA 1ZNPA 1UPIA 1EP0A 2H6BA 2OZJA 3U0ZA 2XLFA 4XF9A 4IEZA 1SQ4A 4PIZA 2EAAA 4LLOA 4J1XA 3WW2A 3DV8A 3OTFA 3UKNA 4EWEA 4MGZE 1LB2A 3L2HA 2PA7A 3S7IA 1L3JA 1O7FA 4FAGA 1J3RA 1Y9QA 5I93A 4J1WA 2QNKA 3BB6A 5C6CA 5CU1A 2VECA 1PMIA 5FPZA 2D5HA 4MX3A 1RUNA 2PAEA 2Z2SB 1CAXB 1XE7A 3EJKA 4L11A 2O8QA 3KCCA 4KU8A 3CJXA 1VP6A 3CO2A 4YARA 1DGWA 3SCFA 4NVPA 2CAVA 3UKTA 4EWDA 3LZZA 4D7TA 3ELNA 2QVSB 1Q3EA 3LA3A 2C0ZA 1ZRFA 1GQGA 4KU7A 4XF0A 3S0MA 1I6XA 2QDRA 2B5HA 2KXLA 2XLGA 1YWKA 3GBFA 4XF4A 3OCPA 4R8HA 4QM9A 4AXOA 1WLTA 2MPFA 1ZZ7A 3I54A 4R52A 1ZREA 2ATFA 3KGLA 1J1LA 5JSRA 4MZUA 3TNPB 3E6CC 3PNAA 3H3UA 2HJIA 2HKXA 3DL3A 2CV6A 3I59B 3E5XA 3FZ3A 4E2GA 2PHLA 4Q29A 2E9QA 3O14A 4XF3A 4AQ2A 2FMYA 2GU9A 4FT8A 3RZZA 2IXLA 1CAUB 3H50A 4YYOA 2K9ZA 1VR3A 1CGPA 2ET1A 2BYVE 4BH9A 2VPVA 4XF1A 2XL7A 4XFCA 4AVCA 3HT1A 1CAWA 1FT9A 2BNMA 5HI0A 1DZTA 1UD1A 4HVRA 4AVBA 4UXAA 3CLPA 4OLLA 4XFAA 3CF6E 1NXMA 4KL1A 4DINB 3HT2A 5CADA 4P9GA 4O9EA 4MGKE 5KBFA 4Q0VA 1QWRA 3PLQA 5FLIA 2B9UA 4IEUA 1VJ2A 3BPZA 4IETA 4BHPA 2UYAA 3NVCA 3LA2A 5AVPA 4BYYA 3NW4A 4MUVA 4HSLA 4IEXA 1WGPA 3EBRA 5KHHA 2F4PA 5I8TA 3MZHA 1TQ5A 4QM8A 4E2QA 4BIFA 3IWZA 4Z82A 3NJZA 5BUVA 1FI2A 2PAKA 1YFYA 4WZCA 4H7LA 1X8MA 2MNGA 3ST7A 1CAXA 2BNOA 3NL1A 4LEJA 4HN0A 4QMAA 1O3RA 1J3PA 4EV0A 3H7JA 1ZZBA 1O3QA 2EA7A 5I8SA 2I45A 4HMZA 3NSTA 4PJYA 2BEOA 4HN1A 4LUKA 5FCCA 5FQ0A 2XKPA 1DGRA 3M3IA 4KWKA 4QX5A 4F8AA 5I0RA 5JAXA 1FXZA 1NE6A 1X82A 1RL3A 2IXHA 1NZCA 4HBNA 2PQQA 3IDCB 4PIXA 4TLFA 5J7MA 4LA3A 5JSPA 5LEKA 3LAGA 3KGZA 4AVAA 3FWEA 3OD0A 4IEQA 5FQ0B 3RDIA 1UCXA 4PIYA 3D82A 4QGNA 2P17A 4YSFA 3E5UA 4X6QB 3MDPA 1OFNA 3I59A 3ES4A 4HVOA 4IEOA 5BY5A 1H1IA 4RD7A 2ZKLA 3GYDA 1PM7A 2IXCA 4HLTA 1RUOA 2GC1A 4HVQA 1CAUA 1EPZA 1CX4A 2OZ6A 1Q43A 1DZRA 3QACA 2WFPA 3E6DA 3ES1A 5FLHA 1LRHA 5LEJA 2IC1A 4KWLA 2IXKA 3FJSA 3HQXA 2BNNA 3H3ZA 4MGYE 3KMHA 1ZVFA 5BXXA 4B29A 5D1IA 1SFNA 1ZZCA 1O5UA 1YFXA 3LWCA 2QCSB 2XL9A 5I91A 2Q4SA 4FBFA 1U12A 1RGSA 4I01A 3FX3A 1I5ZA 3RYRA 3OGJA 2H6CA 1UIKA 1RTVA 1HW5A 1CAVB 1Y3TA 3EO6A 1YHFA 2D93A 1IPJA 2PTMA 2Q1ZB 4O9GA 4Z07A 4E2SA 3U11A 5I0UA 3FFQA 3QOPA 5EZWA 1WA4A 1YFUA 4Q0PA 3LOIA 1LR5A 2QJVA 4QGMA 5FLJA 3RNSA 3ROUA 3E5QA 5E1RA 4XFBA 4I2OA 3KSCA 4JTNA 1YLLA 1SEFA 1ZZ8A 5KHIA 2XHKA 2GZWA 2IXIA 4IEYA 1YUDA 3H1WA 4IESA 4Q0UA 3RPQA 2PAMA 5F1RA 4K8FA 1J58A 2IXJA 2OPKA 1O4TA 2UY8A 4EROA 4I02A 3BALA 3TNQA 4EWAA 1JUHA 4ZU5A 3CEWA 1LKNA 3ACLA 5JR7B 3MYXA 2OYZA 2BGCA 5J48A 4IEWA 2ZCWA 3E97A 2MHFA 2Y0OA 2N7GA 3H1YA 3R6SA 5C8WA 3D0SA 3N4MA 1XE8A 1H1MA 3WW4A 2XLAA 2ET7A 4ZU4A 2V09A 1UW8A 4XFGA 4XETA 1IPKA 4L2NA 1X7NA 1OI6A 2Z69A 3CL1A 3EHKA 3USSA 5LRSA 2UY9A 1O5LA 4IEPA 4HSJA 3VHRA 5CVRA 1O3SA 4LA2A 4XFHA 3FHIB 3HIFA 4N9HA 1ZRCA 4N9IA 4UBGA 4UBHA 1YFWA 3ZDSA 2PYTA 3WW3A 4JTOA 4WBBA 4OFGA
chains in the Genus database with same CATH superfamily
1KFXL 3B5LB 3DF0A 3O7OA 4P02B 3OF1A 1SACA 4XMAA 1XE0A 4IV1A 3PJYA 1DFQA 1V6OA 2A71A 2VW2A 2GN3A 5F6KA 4BPZA 1HLCA 4N8MA 3UJQA 4UWDA 2GSYA 4Q2FA 1FOD2 4D6SA 2OA2A 3LF7A 5FWJA 4P9JA 3IPVA 3KZ4C 1CR7A 2YU2A 4AGRA 3H1MA 4QWNA 5JLVA 4JV4A 4Q1PA 3QD6A 3NV1A 2ADEA 1AR71 4QQHA 2ZXQA 1REEA 4GIQA 3AM2A 5A80A 2XWBB 2Q8OA 3HBKA 4GWMA 3HJRA 3GBWA 4FP2A 3FC0A 1CAVA 2CAUA 1VIWB 5DUWA 2BQPA 4ARXA 4LK7A 1V70A 1OMIA 2RJLA 4RHV1 2GC3A 1RYYA 4XVHA 3TYJA 4CCMA 1E5IA 4WVZA 3P6BA 2QQOA 1UMIA 3MPBA 1RUF3 3NQHA 4XBLA 3SQOA 4XEZA 1OUXA 2Y38A 3AKSA 5FZMA 3TN92 5J09A 5L7OC 4UFKA 3AKTA 3SEPA 3ZXKA 1ULDA 4CCLA 1QNWA 2GMEA 2JIGA 2WA3A 4OHYA 1GZWA 2YZ4A 1UX6A 4YVSA 4ISQA 2H0VA 5C4WA 3MF6A 3P3PA 5HBAA 1VB4A 1HN1A 1VAMA 3TAYA 1AR72 5DZGA 1AR62 3ZM8A 2PHFA 5I0DA 1ND3C 2JDKA 3AKRA 1UZWA 4O7XA 1BCXA 1KXGA 4RYDA 4TWTA 5FYSA 5A7WB 4COUA 1ENSA 2ZAHA 3WNPA 3INAA 2WN3A 1N1SA 2QQLA 2RHPA 4XUNA 1RUC3 4PF5A 2VQ0A 4RHV2 3POGA 4AI1A 4A2UA 2CYFA 4QXKA 3UJOA 3OYWA 2ZA9A 1KEXA 1H1AA 4Q4Y3 3TOJA 1EY2A 5FDBA 1M06G 4Y33A 2PFWA 4XC9A 1NE4A 3KV9A 4HOOA 1DQ5A 1PK6A 3R0RA 3NKTA 2UYBA 4NIAA 1TMF3 4CU6A 1MS1A 2Y64A 3FHQA 1S0BA 4XFIA 4GMP0 3T09A 5D21A 2R041 2YC0A 2ZHNA 3RYPA 4A3ZA 4CYDA 2FQPA 4AI0A 4C91A 1ENQA 2RDQA 3BCWA 1AYN1 3CDZB 3DN7A 3TEYA 3IMNA 4M3CB 3SMHA 2VTXA 1UZVA 1QJU3 3IDBB 1W28A 3KHBA 5LRRA 2D44A 2BERA 1UX7A 3K51A 3WF2A 2W08A 2GNDA 3N9LA 4LBOA 4N43C 5I0TA 3S7EA 2OVUA 3WP6A 4QX2A 2XKOA 3O1SA 1ZBA1 2DUPA 2RDNA 2D40A 2A75A 3ZYFA 4BISA 5FPUA 1CAWB 1VBB1 1XC6A 4GJYA 3TB0A 1UQXA 4YW1A 1S0GA 5FMDA 2GC2A 2VQAA 3K2OA 1N3OA 2WBKA 4HETA 1JZ2A 1MPXA 1WMDA 1PGSA 4CUBA 3RZKA 1AR92 2HWD3 1KJLA 1POV1 1SPPB 1W8HA 1W6PA 2PHDA 5FP8A 3M4FA 3ZYHA 2DV9A 3KT4A 2G9ZA 1F31A 2K46A 4GALA 1IPSA 1AYN2 4M00A 5C8CC 1G9BA 3ABZA 1UOJA 5A3NA 5GZFA 5LA9A 2VCBA 4KG8A 1KITA 4XQ4A 4CEYB 4LLOA 2DVDA 1WW6A 4RSUA 2C1FA 3DGTA 2VOWA 2RS13 4WM8C 2F17A 3N7LA 1ND2A 3OTFA 2Y6JA 5J1XA 4JDOA 4EWEA 4RR3A 1LESA 4CXYA 2E51A 5KC6A 3J7HA 1O7FA 2CTVA 3HNYM 5FZ9A 4FAGA 3LSDA 1J3RA 5I93A 1NCQB 4J1WA 4CDXA 2QNKA 2W2IA 4KG0A 5C6CA 1WCSA 5EJ3A 2VECA 2ARXA 2YROA 2D5HA 4JGYC 4AHWA 1GV9A 2PAEA 3AXDA 2GP5A 4KI5M 3RG0A 4L11A 3NJXA 4MSVA 1JYVA 1NA1C 3CJXA 3ZYRA 1OVPA 3X29B 4BMBA 3ACGA 2W68A 3CO2A 4DY5A 3AVRA 4H55A 5A3WA 5LBCA 1OOPC 1OKOA 4SBVA 3SCFA 2RVAA 3VGIA 4NVPA 3AC0A 2Z5WA 3ZSKA 3LZZA 3CJIB 3VD7A 3R05A 1C8M3 5FYVA 1G86A 5D8AC 4XQWA 3ELNA 3ZXLA 1IQAA 3LA3A 2C0ZA 4XXPA 5CFCA 1ZRFA 2JDPA 5KWRA 1ASJ3 3H8XA 2YGMA 4LOSA 5FZ6A 4I3GA 1GZ9A 3N35A 5J37A 3HQUA 3IZOA 2L9LA 5A7WA 4D3WA 4ES9A 2YV8A 4U36A 2ZMLA 1YWKA 2BTVC 1W9FA 3I2FA 4LO4B 5DDJ1 2YC2A 5FZCA 3GBFA 5FY5A 1H4GA 1U5IA 1TNFA 5A7OA 4K9SA 2YFUA 3UL2A 1ULCA 4QM9A 4AXOA 1WMFA 1RUI1 4ZS3A 1WLTA 5IVYA 4A3XA 1JZ7A 2W91A 1ZREA 4P08A 4XAAA 1IKPA 2VW1A 1QHDA 4MZUA 2NMOA 1QEXA 2HYXA 2P5BA 4MHUA 3TNPB 3PNAA 3H3UA 5FMOL 1OC1A 1XU1A 2HJIA 3JB8A 1WCQA 3AX4A 2WO7A 5DABA 3VKMA 4D69A 4EJRA 2CV6A 1NG0A 3E5XA 1VE0A 3FZ3A 1AYM3 5F3GA 4UFHA 1NXD1 2V4VA 4AAXA 2FMYA 3MBWA 1LHNA 1QDCA 4CDQC 3PIGA 1UL9A 3HWJA 4FT8A 1KRIA 4XMIA 5H9SA 2A6ZA 3H50A 2Q1MA 3H8RA 1OLQA 5DDJ2 1IZ3A 2HWF2 3TEXA 1SDWA 2ZGTA 1D4VB 3WX5A 2G9FA 4U2AA 1QJY2 2BYVE 4BH9A 2BBVA 1XYNA 1D2QA 3FBMA 1VPHA 4FXKB 1NCRA 1RUI2 3ZFEC 3ZR6A 3QH7A 1HIXA 1YRZA 3AP7A 4XFCA 3KF5A 4XOGA 5ANNA 4E4SA 4OYUA 4GJZA 5BNOB 1A6CA 5DN2A 2QZ3A 1CAWA 1FT9A 4B7KA 2BNMA 3NNFA 3OUJA 5TSWA 1W03A 2DBNA 5ABJC 1SBDA 3LPGA 4XFAA 5FFOC 3T3YA 3C8XA 1NXMA 1W8WA 3OJBA 1SPPA 4DINB 2QFEA 4ES8A 4P9GA 2FD8A 4MGKE 1ODNA 2QQMA 4Q0VA 1RVF3 4DFSA 3C7HA 1PX3A 4PDWA 3HD8B 5T55A 4C90A 3PUSA 1POV0 2ZMKA 4IETA 2UYAA 1BK0A 3NVCA 1SLBA 2A70A 4OQ9A 5JOYA 1BLZA 3MFAA 4BQ1A 4HSLA 1WCKA 3POIA 4CCNA 4OI2A 3RMYA 1PVC2 3GF6A 2VGDA 2W47A 3R4SA 4Y5TA 1RJ7A 3ZFGB 5JZGC 3U1XA 2X5IC 2P6CA 3NV3A 2VUDA 4YLZA 1RUD3 4FPHA 4Y4YA 4BIFA 5FY7A 1ONAA 4E4ZA 1R1A3 1QDOA 4RFT0 5H9RA 3UGGA 3F95A 3W5MA 3U37A 3NJZA 2E32A 4A41A 5C9AC 1FI2A 2RV9A 4LE4A 1BVVA 1TVGA 3VL9A 1QJZA 2R072 2JE8A 3ATGA 1US2A 1STMA 2HBTA 1JOBA 2VMFA 3K77A 3ALQA 3PVEA 4H7LA 4L99A 1SZBA 4TN7A 1R081 3ST7A 1HQLA 2XQRA 4TYSA 4ATEA 4QKDA 1OPMA 3OBAA 2BFUS 4GQ7A 4PBPA 4LEJA 4HN0A 3URFA 5DMYA 1LNSA 1VBD3 3ZXGA 2CNAA 2EA7A 3ZMOA 2LTNA 3AP9A 4B4RA 3AZVA 5C71A 5BNPB 3WQ7A 1SLAA 2I45A 1GFF2 2WAOA 3ZSLA 1WLDA 5LK5A 1WKYA 3VBHC 3CJIA 5LZ6A 5A3LA 1R091 5CIRA 2MEV3 1EAH2 2BOIA 5HXMA 2XKPA 2LROA 1HB3A 4F8AA 5CKQA 3MUY1 1K12A 4EN9B 5JAXA 1RUF1 1GANA 1FXZA 1H9WA 1H2NA 3LB9A 4LKEA 4OMDA 1W8UA 5FZBA 2A7AA 3WLUA 1TME3 4K20A 3BI3A 4FPJA 2IXHA 2A5ZA 5J36A 2XDVA 3GXUA 1R082 5CYYA 2PQQA 2WYSA 3IDCB 3RJRA 3RZJA 3AMNA 3ZYBA 2WFF3 5T5LA 5JSPA 1W9WA 3M2MA 4Z92B 3JD72 2VZPA 1LOCA 3KF3A 5IVEA 3K3NA 2A6WA 1UYXA 4Y26A 1G9CA 4FPYA 1JN2P 4NMIA 1W39A 1RUC1 4Y24A 3WUDA 1R092 3R4DB 3E5UA 1D4M3 4NR1A 4ASKA 2RDRA 4NRMA 4YZ5A 1W9SA 1T6BX 3CHXA 3ES4A 3G6JB 4HG6B 1H1IA 2JENA 5K0UB 1PM7A 4YFZA 1BQPA 2JE7A 1KS5A 2BU9A 5AC92 3O1OA 1W6OB 1GWKA 3KHCA 4CDUB 1FOD3 2OZ6A 1CJPA 1Q43A 3B7MA 3IAPA 3UV9A 2ZAAA 3QACA 3E6DA 3DKQA 1LRHA 2W1WA 2WL1A 3LKJA 1A34A 1UU5A 2IC1A 1H0BA 2C4XA 3WINE 1KS4A 5IUQA 1GP4A 4RN5A 3KMHA 4XZUG 1ZVFA 1SDDB 2XVGA 4QDQA 4B29A 1H8TB 4NWWA 1Q56A 1YFXA 1NZIA 3VLBB 5FZ0A 4R9BA 2AEYA 4YZ3A 4WM7B 1JTZX 1QQP1 2Q4SA 2XR4A 5HCBA 3TN93 2AACA 2R0FA 2YGLA 3JQWA 3Q8BA 1RUJ1 1AR82 5FKCA 4JAAA 1NKGA 2EIDA 4B3NA 2IWGB 3AZYA 2VXJA 2WWSA 1H2KA 1KFUL 3MF9A 1HW5A 3EO6A 4GKXA 3RZMA 4BK5A 2ZBJA 2HWD1 5CISA 4CEWC 3CU7A 2Q1FA 1C4RA 4O9GA 3FFZA 2VOVA 5DAPA 4Z07A 3LQCA 5I0UA 1AR63 1ZA7A 4XABA 5FZHA 2D98A 5L9BA 5EJ1B 3U11A 3JUUA 1PZ8A 2GMPA 1JOJA 4YWAA 1XJAA 5C3RA 1OD3A 3LOIA 1ODMA 5F37A 1C5HA 3MW2A 4RHV3 1LGCA 1G9DA 4KBBA 1LR5A 2QJVA 2RS11 5EPAA 2D6KA 3AZZA 1QQP2 3OBTA 4MXWA 4W6YA 4XCAA 3WD5A 3RNSA 5APAA 3VZLA 1ULGA 3M3QA 4XFBA 3KSCA 1UY2A 3N9NA 1RUJ2 1W06A 3OSDA 4JTNA 4QPGC 4XBNA 1H2MA 2ZEXA 2FCUA 4JHZA 4XHBA 5KHIA 2VNRA 5A3UA 3LDKA 1E5SA 1RHI1 4HKWA 2RS32 3LOBA 3O1PA 2IXIA 2WAAA 2CU5A 4BCUA 3DXTA 3SC7X 4XUQA 1YUDA 3LEMA 5LBBA 1SHWB 3PU8A 4Y1YA 2KM2A 4CP1A 1XOYA 4ZHNA 2PAMA 1GP5A 2Q8EA 4K6BA 4K8FA 2XPJA 1J58A 2JWPA 2E31A 2IFRA 2OPKA 3ACFA 4Q4W2 4QPIC 1JI6A 1O4TA 2Y26A 1MZEA 3GGLA 2DVBA 4AG4A 5IATA 4NOTA 4QHOA 3ZDVA 4OULA 4ZU5A 1MR5A 4JCKA 1LKNA 4NIGA 2R7EB 3NNJA 1YQ5A 5K7PA 2XVKA 5J48A 1PMJX 1OHFA 5IFPA 4LLFA 2WZR1 2ZCWA 4ARYA 3E97A 1C8M1 2BW8A 2Y0OA 3R6SA 3AYAA 1V00A 1T2XA 4E8CA 2VNGA 1K5MB 4AAPA 4DIQA 4WVMA 5FIXA 1RHI2 1ASJ1 1SG3A 2VBDA 4RFRB 1AR93 1EUUA 1OF4A 4CXWA 4XAEA 3ZXEA 1AJKA 3BTZA 1UW8A 3NNLA 1AYN3 2ARBA 1W6QB 1UAIA 1S0FA 1GZCA 1SBFA 1UYYA 3D6EA 4PI2A 4RL7A 4XETA 1IPKA 5JUVA 2HWE3 4L2NA 1OVSA 2J42A 2ZHLA 1YIPA 5GZDA 5HCFA 4NHYA 2VG9A 3K4DA 1VAVA 2UY9A 3AKPA 3RRDA 3VDDB 5JPNB 5CA6A 5K0UA 2WZR2 2YUEA 4XJZA 4HSJA 3VL8A 2QKDA 1W6OA 3RFRA 3W9AA 4CDUA 1HRI2 5M0TA 3WDYA 2VCAA 2HYKA 3B01A 1E5RA 1OXCA 4N9IA 4C8DA 3MPPG 2ZACA 1LU2A 3VHPA 5KXDA 1PGL1 4NHLA 4Y20B 3ZIWA 5HCAA 3ZKUA 4QDSA 2QQKA 3NNGA 4HONA 2WNVB 4LKSA 5I0SA 1YNAA 2ZGQA 1PM4A 2RS53 4F7ZA 1IQDC 1VRBA 2XJUA 1J3QA 4OZOA 2ZEWA 2NPIA 5L9RA 4WM7A 3ZMNA 1REDA 1XU2A 3OGGA 1SLIA 3VBRA 4Q26A 1P8JA 1O6UA 2UWBA 2W92A 3NKGA 4Z8BA 4N53A 1W3VA 2FBEA 1GBGA 3A21A 4LORA 1LODA 3SXWA 2ZX2A 5LA1A 2QQPA 2AR6A 2VW0A 4LXLA 3JZVA 3DPRB 5A3OA 1PGL2 1SLTA 1UOGA 1MQTC 4CDWB 4XJUA 1RITA 1NYWA 4W6XA 1RVF1 1O8PA 2VZ3A 3IBMA 3I2DA 3N3HA 5KHJA 3SCHA 1HQWA 3MLLA 4IV1C 3ZVXA 4Q0SA 4LBKA 5F5QA 2DCKA 2ZJCA 3TWIA 5JI9A 1UF2C 4LBQD 2TBVA 1W6MB 4GXLA 1GWLA 5FMBA 1NLSA 4BA6A 5BPXA 2Y0IA 3TBDA 4EZ4A 3PMSA 5GLVA 3ZYIB 3UKVA 4LBQB 3I7DA 1UZZA 2DVAA 5IVCA 3AMHA 2TUNA 3WCSA 3I3MA 3B94A 1BYHA 1DGWX 1RUD1 2Y6GA 5FZ1A 2BOJA 2P4EA 2ZS6B 1R1A1 2ZGUA 4NE9A 3ZX7A 2HEVF 4RS5C 4BLJA 3PVOA 4IV3B 4XURA 1UKGA 1RXGA 2BZDA 2ZGSA 4ITCA 3WEZA 5FRAA 4EN6B 2ZX0A 2YFZA 3LCPA 3WG1A 1UPSA 3M7AA 5E88A 1PIV1 2NQYA 2VCMA 5FPXA 4KWJA 3VB9A 1XNTA 2XMLA 1YIFA 4JGZC 4HK9A 5C4WB 5KHGA 2FDIA 1S0DA 2WR9A 1VBD1 3VBSB 1PMHX 2HWF3 3SH5A 3J4UH 1LEMA 1UIJA 5EFUA 1QJY3 1U5YA 3WSOA 3POBA 5EIYB 4DEVA 4LO6B 5GM0A 3WXPA 1RUI3 3I2HA 1CZVA 2CDPA 5A6XA 3KLSA 5B4XA 2OUJA 4YZ4A 2K0GA 2RJ2A 3SHRA 3ETQA 3WF1A 5FJHA 4AK3A 3KD4A 5BNNC 1RJ8A 1LOFC 5C3PA 5A7QA 4BLIA 1Z0HA 2YY1A 4V2WA 3MIDA 1X8EA 3O12A 2FZ2A 2GH2A 2OIIA 4ZU7A 3ZN6A 1TME1 1AX2A 1GNHA 1X33A 3ACHA 4YRDA 5C3QA 4KQ7A 3DEMA 5KHKA 3Q8CA 4LR4A 4LKFA 1DYPA 1PIV2 1ZA4A 1WLCA 1W6QA 3PVBB 2OKXA 1S55A 2ORXA 4LTAA 2DURA 2P3KA 3ZPYA 2WFF1 2B42B 5IVVA 5F39A 1ZBE2 1UZ0A 2J22A 3T1MA 5K8SA 5AVAA 4GULA 1BXHA 1JU3A 2JG9C 4OHXA 1PGW2 1PVC3 4DXRA 1QH6A 2JKBA 1EYBA 1XNBA 2W52A 3ZFFB 1ZZ6A 1O3TA 4ZXKA 3PUQA 5DQ0A 3KM5A 4LQRA 1UPIA 2AC1A 1YQ2A 2OZJA 4CCDA 3MIEA 4NHKA 4B1MA 2XLFA 3VKNA 2D7FA 2ZTNA 4L8QA 1SQ4A 4QXCA 4XF9A 1W2TA 4PIZA 2EAAA 4UT5A 2CGNA 4Y20A 2R073 5A3TA 1IGOA 1XBFA 2ZX4A 2A6XA 2OPWA 2P3YA 2VM9A 1W04A 2DDUA 4CCEA 5EWSA 3L2HA 4Q8LA 1KD7A 5CKNA 2QQNA 3OGSA 1SFPA 1D0GA 3OGVA 3O1UA 3BB6A 2FDJA 2ERFA 2G9GA 4COWA 2C26A 2Y6HA 1PMIA 3KV6A 5CU1A 5FPZA 2BV4A 1RUNA 4FOWA 1F5FA 3VBUC 1EAH3 1CAXB 3ZN4A 3ZSMA 3S5AA 5JPMB 3DPRA 4DRVA 2J1SA 3VZKA 1ND2B 4F83A 4KU8A 2PLV1 4QQ2A 3TN91 1VP6A 1YQCA 4H2AA 1QH7A 3AXEA 4H14A 2JKXA 5DUUA 4CDWA 4RR3B 4FO9A 4P9IA 4RQPA 2PN5A 2G1MA 2FDGA 1DGWA 1AZDA 1B35A 1R083 4FI9A 1PNFA 3V65A 3UKTA 2JDYA 1VBA2 2VZSA 3KV5A 5DAQA 4CDXB 3NJVA 1C3HA 2JX9A 1YJKA 1W6MA 3MI8A 3JD73 2B39A 1AR61 5A1LA 1GQGA 4KU7A 4NIHA 4XF0A 2A6YA 4XDPA 5A32B 4LBQA 1K5JA 1AUYA 4MXVA 1R093 2E7AA 4DS0A 3POWA 4NRQA 4ZPIA 4COYA 2J1EA 2WSUA 4D94A 4IV3A 3O0XA 2PLV2 1SCSA 5FZDA 5T5PA 4XF4A 4HXCA 3PVNA 5ACA2 2VMCA 1RUH3 4Q5OA 1GSLA 5AC93 2XHNA 2MPFA 3I54A 3F2ZA 4R52A 4BU2A 1SFYA 4UFJA 2E26A 5CFCB 3VBSA 3GDBA 1V6KA 1CD3G 3NMBA 4J6GA 5FWEA 2HKXA 1WCDJ 2E6VA 5L7OB 4AL9A 4E2GA 3I4IA 2E9QA 4LHLA 4O61A 4S2DA 4V1PA 2WYFA 2YPJA 3DUIA 3NAPC 4XTMA 4QB6A 3RZZA 3WUCA 2R16A 2K9ZA 1VR3A 2JB8A 4P9YA 4CP9A 3ZR5A 4LK6A 1ND3B 1NLRA 4UOJA 4AYUA 2WSVA 4YZ1A 2DTYA 5HV4A 2PQSA 4XF1A 4DUVA 2JIJA 1AR83 4N7UA 4CCKA 2DWRA 3HT1A 5IAVA 4FOQA 4GH4C 4A42A 4COZA 2ZX3A 5HI0A 1AR91 3AL5A 3N9PA 2E7TA 1DZTA 5JIUA 1UD1A 4HVRA 5LATA 4AVBA 4UXAA 5FY9A 3V64A 2E7QA 2WS92 4UFIA 3SH4A 4ATFA 4ZONA 2IUWA 3O1RA 2SBAA 5F7UA 3EYPA 2HWE1 3FBYA 1PVXA 2NZ9A 2VZRA 1YC61 3HT2A 4IDZA 3ZFFA 1URXA 4LBMA 2XBO2 4BXFA 3A4UA 4DUXA 5ANQA 2PHTA 4PF1A 5FY4A 1VALA 2JG8A 3EB7A 2VVFA 1VJ2A 2DU0A 1NCRB 3FN9A 1DYKA 2O14A 5LBEA 1QQP3 5EHDA 1BMV1 4UFLA 2H0BA 3FLPA 3J26N 2Y6LA 5AVPA 2VD7A 4C1XA 4XUOA 4BYYA 1RUJ3 3NW4A 4MUVA 2C24A 1WUVA 1UYZA 1FNYA 1F2NA 1SLCA 2D3PA 2F4PA 2RS33 2XH6A 3VBFA 4Y1ZA 3KS7A 1S4CA 1EV11 1TQ5A 4N43B 4E2QA 4AEKA 2A3WA 2RMU1 3IWZA 4OZXA 3GHNA 4XE9A 4PDWB 3DCQA 3Q8FA 3ME2A 5BUVA 2HWE2 5C5TA 4Q4W3 2CL2A 2RS51 1ULPA 4WZCA 5FYUA 1UMHA 3ZN5A 1BEV2 3MW3A 3QCWA 4WZFA 1CAXA 2WNUA 2UURA 3NL1A 3PTYA 3NRUA 2YBKA 1J3PA 5IW0A 4B1LA 1BMV2 1ZZBA 1DGRN 2WDBA 1JODA 1W9TA 1O3QA 4CEYC 2UU8A 1W8OA 1XXNA 2YXSA 3APBA 5I8SA 4CU7A 1ENRA 4HKOA 5FZIA 1OSGA 3KCYA 4QD2A 4HMZA 5A7PA 2W9XA 3NSTA 1HJGA 2VE1A 4FSJA 2JDAA 5FCCA 1RHI3 1Y4WA 3N36A 4AVSA 5J98B 1EV12 5FQ0A 1DU3D 4OI1A 3U78A 2RMU2 3MLJA 1GNYA 3M3IA 1AXYA 4KWKA 1OH3A 5I0RA 1NCQC 4M0HA 4NAMA 5A32A 4AFCA 2YDEA 2RS52 1COV1 2JXAA 3T08A 2R49A 5A70A 1RL3A 1GLHA 1NQJA 3C2UA 3CBNA 4Q1RA 1Y9GA 1K42A 1LHUA 5J7MA 3R4UA 1CN1A 2DCZA 1JHNA 3WDWA 2CDOA 4NROA 4AVAA 4YW7A 2WZR3 5A6ZA 4ZKTB 4W65A 4IEQA 4XDOA 3RDIA 2OQ6A 1VRH2 4E4HA 1HRI3 2BBAA 4YM3A 1G8WA 2AZ5A 4QGNA 5JWPA 2DU1A 2WZPP 1OOPB 1QIQA 5IJRA 3NO8A 4X6QB 2HEWF 3WNKA 5LWBA 3MDPA 2A73B 1OFNA 1A3KA 5L7OA 4HVOA 4QX1A 1HKDA 2X53S 4W50A 5BY5A 4AFMA 2JDMA 2EICA 2HWF1 2ZKLA 1CWPA 1COV2 2W1UA 3DECA 4HLTA 5K4LA 2CWMA 2VMHA 1QJY1 4HVQA 3PL0A 2JEMA 4R4XA 3BTXA 1CX4A 2AGSA 1DZRA 3RWKX 4Y1VA 4YGDA 1OQ1A 4TSVA 2V72A 5KXBA 1ND3A 3ACIA 1GICA 2B4KA 1OLME 2J7MA 3OY8A 4KWLA 3GZEA 4PLNA 1SLLA 2XJTA 3H3ZA 4MGYE 5FV3A 1CZTA 3MIHA 2EXJA 5BXXA 1D7PM 2VTFA 1ZZCA 5H9QA 3WCRA 3AP5A 5J96B 4MO3M 1QXPA 5JI7A 4JQRA 5FBJA 2XL9A 2ARAA 1OA2A 2W5FA 3J9SA 3RWNA 1RMU1 5FXZA 1ULOA 3CKHA 4AVTA 1OT5A 1U12A 3E1F1 4M4RA 2ZGLA 4CP0A 5LA0A 1R64A 3FX3A 4I01A 4CUAA 3K4ZA 2QE3A 3GHMA 3T2OA 4UW4A 1Y3TA 1YHFA 4AGVA 4A6SA 1PVC1 2HEYF 1FX5A 2D93A 1VBC1 2PTMA 2VJXA 1V6IA 4FQ4A 3AFGA 4FFGA 4E27A 3OUHA 2OQ7A 2GMMA 1NLQA 4KWUA 4QXBA 5CG8A 2E63A 3EXUA 4Q0PA 3VV1A 4CSWA 1BKZA 2P3IA 1EUTA 1LU1A 4LO5B 2XG3A 2KR2A 3BIWE 3IT8A 2R071 3LEIA 4N43A 3WR0A 3FL7A 5LY1A 4QGMA 4PT6A 3ZYPA 4B7EA 1RMU2 5CFDC 1G7YA 3KB5A 3VKLA 2ZGMA 5FLJA 5CKMA 2VBPA 2DF7A 5E1RA 4FPOB 5EJZB 1PO22 1I1EA 1YLLA 2ES3A 3LIGA 1WW5A 3PUIA 3MHZA 1UOFA 3VKOA 5GZGA 4R9DA 1FATA 1JU4A 4IEYA 1VBC2 2DVFA 3H1WA 3WF3A 4IESA 1MS4A 1EAH1 1HRV1 1RXFA 2X8KA 3FLRA 2BGOA 3BVCA 4S2GA 3ZXFA 3S6PA 4MXWB 3T4HB 1WBFA 2KA3A 5FJKA 3ZFGC 1F35A 3OGRA 4WM8A 4ISRA 1HN0A 4IUGA 4QDRA 2VU9A 1PIV3 4OUSA 4JHTA 1YXWA 2XJRA 5JZGB 3VBOC 5CEHA 2W46A 3B3QE 5JIAA 5KR7A 1ZBE3 1V6NA 3JD71 4O65A 1S2BA 2VZ1A 4FFFA 2XJQA 5GLTA 3B9IA 1XYPA 5C9AB 5C70A 4YZ2A 4NIIA 4KBZA 1MS3A 2ILMA 5F6LB 4JGYA 3OOXA 2WJSA 1MACA 5F9TA 5FZOB 4UW6A 1HRV2 3OD4A 5BNPC 1B09A 4IE6A 4XFGA 2WWJA 4A7ZA 1W2OA 1X7NA 2HLEA 3B93A 3HNMA 2NLRA 3J8F1 1OOPA 2D43A 1RUH1 4LIUA 1UXXX 3CL1A 3LD8A 2XOMA 4NRPA 5AC91 3D8CA 1WD4A 3USSA 3H3LA 1O5LA 4WVMB 3OB8A 1FAYA 3PUAA 4OVEA 3ASIA 4XYXA 5FPAA 4XJ8A 1T6GC 5FYCA 4M0NA 3VHRA 5FOJB 1O3SA 2WQZC 5FYMA 4FTSA 4XFHA 2WKKA 3FHIB 3O1MA 2VNVA 4N9HA 4JDNA 4XPVA 1ZRCA 1LEDA 3MLKA 3TEWA 2BVBA 3HR9A 4NWVA 1QJEA 2AEZA 3NWKA 3ZDSA 4OI0A 4Y1XA 2HH9A 3WW3A 4YFWA 3IIAA 1YI7A 3DKWA 3H9AA 4LITA 2JDUA 3W5NA 3W59A 1Z7S1 3WNXA 4AQ6A 2YB7A 1JZ5A 3J8F2 5JMOA 1LOGA 4QB2A 1RUH2 1XNAA 5FYYA 4IGOA 4KGQA 4JVAA 1W05A 1AR81 1BHGA 4BZ4A 3GZAA 1DIWA 1WMXA 3TEZA 2QZ2A 4Y4RA 5K0UC 2ZGNA 1W2AX 1VBA3 4IQPA 2ETEA 2RE9A 1NOVA 4MV2A 3WF0A 2QBXA 3VHNA 1W0OA 4LULA 5FYBA 2CHHA 4CDQA 1F8VA 3POFA 2WNOA 4QQLA 3OEAA 1ENXA 3PU3A 4XJ9A 2VULA 3QLQA 4M3CF 1QMJA 3FE5A 4LOTA 4UF0B 4CCJA 3S57A 3MGUA 2X29A 5EXOA 3KV4A 4DXZA 1Z7S2 1AL0G 1C5IA 4UAPA 4XIOA 3HMYA 1H6XA 1H8TC 3HAGA 1O8SA 4EQVA 3VBRB 2PLV3 3ZFEA 4AE2A 1A8DA 5ACA3 2P37A 4N53B 3I2KA 4BQWA 3GNEA 2XB6C 5LCWL 2VZOA 4FXGB 3ECQA 4E8DA 3G7DA 2RS31 1UOBA 3C3VA 2QQVA 4IL7A 3ZKYA 4YM2A 3ZSEA 3UGFA 5ABJA 4HANA 1BJQA 5C3SA 4IE4A 1ZZ9A 4HZFA 3OBZA 1JZ3A 2A3YA 2EVXA 4IERA 1C1LA 1DZQA 5IK7A 3FHAA 2DCTA 3WDVA 1K45A 1O4YA 3WNLA 4Q4W1 4EYUA 3V0BB 2QQJA 4AEDC 5F5CA 4GKYA 4I3PA 4ORFA 4CCCA 4CP2A 4AI8A 4QU1A 5SV5A 1OD5A 1W9YA 4QGLA 4CEWB 1IS4A 2WZ8A 2FZ1A 4WV8A 3E6BA 3C7EA 3M3CA 1POQA 3RYKA 4META 3LE0A 1UY0A 1AVBA 3MV11 5BV6A 5FUPA 5JZGA 3VD4A 3IAQA 4FOVA 1J83A 1GP6A 3PTRB 5BNOC 4BB3A 1HV0A 1YYNA 4LUMA 2Q8DA 2W3JA 4MGIE 2Q30A 5T3NA 4AI3A 5C9AA 2G4IA 5L19A 2WS93 4CXXA 3RI8A 2GC0A 2FMDA 5FP3A 4K1YA 4NIDA 5FZOA 2XBO3 3POEA 4N90A 4S2FA 4AZZA 2QUOA 2VUJA 4YVWC 5JCTA 4J25A 4ET7A 1RC6A 2D5FA 2GDFA 1LAJA 4AQTA 1Q5OA 2O1QA 5ERLA 2Q0AA 3SCGA 2E53A 3W20A 3WZ1A 4QPIB 2WRAA 1YJLA 4K1ZA 1UU6A 1HRI1 3CNAA 4MH0E 4XBQA 4YGBA 5EQUA 3VBHA 5IK4A 3OPTA 5I8YA 3ZN6B 3H7YA 1O91A 4M01A 5E16A 1LECA 5A3MA 3WNOA 4DRRA 5FAXA 1K5MC 1BK1A 2H6BA 5L36A 2VMGA 4D7YA 2HBUA 4IEZA 1NT0A 1GR3A 1QNYA 1PZ9A 4J1XA 4E9KA 3WW2A 3P5BA 2ZPXA 2ADDA 1BEV3 5FK8A 3PUHA 3IDAA 4DO0A 1KQRA 3A0NA 4XIKA 3T4VA 3UKNA 2R1BA 4QT6A 1NQDA 2YYOA 1VAKA 2PA7A 4QXHA 2VVEA 4DEQA 4MGSA 3S7IA 2JD4A 2XVLA 1H9PA 2ORZA 1Y9QA 1MEC2 3VZNA 2ENRA 2VMIA 2RG4A 2ZOEB 3VDDC 4QHBA 1DBNA 4FQZA 2BGPA 4M4PA 3WDXA 2DFCA 2GNTA 4XQDA 5DXDA 1AHSA 1EV13 1XE7A 2RMU3 3D5OA 3AMQA 3KCCA 5CB7A 3KQRA 3GJAA 3IM0A 5E89A 3AYEA 3WG3A 2TEPA 1IS3A 2C9KA 4OHWA 4UF0A 1DQ4A 2CAVA 3KVAA 2WNVC 4EWDA 4NO4A 3RS6A 2D3SA 2QVSB 4L97A 1W2UA 4N7IA 1VMFA 4BQ4A 1XNDA 1VRH3 1I6XA 5A7SA 1GZTA 4BIOA 3IMMA 2NM1A 2VTXJ 4E4DX 1SCRA 2QDRA 2B5HA 3ILFA 4FVVA 4BQYA 1U5ZA 2KXLA 2XQXA 2VZQA 3J7NA 4RQPB 1OPOA 1B35B 3SKVA 5FKBA 1KJRA 3V0BA 2ZEZA 3I2OA 4JQTA 2W1QA 3I2JA 4EN8B 1COV3 2D6OX 1FYUA 1NAEA 2JDZA 2OT7A 2WINB 4FPLA 1L7QA 4CEWA 4IE5A 1RUE2 2ZZJA 3OBRA 1MQTB 2ATFA 1J1LA 4JKKA 1JYCA 5JSRA 2VXRA 5FXWA 4P00B 5DPNA 1RB8G 4LHKA 3I59B 3VZMA 2Y60A 4Q29A 4AQ2A 4XZPA 2DCJA 3BYWA 2VCCA 3D4KA 4B4QA 5LK7B 1C1FA 1UU4A 2IXLA 2JDNA 2ZABA 2Q8CA 4YYOA 5AFBA 2RR11 3T0BA 4TXWA 2EALA 3JBG1 4YW6A 2JECA 4LHSA 4QPGA 2D6PA 4Q4X2 3U14A 4IXLA 4LIVA 1ZBE1 4D6QA 2VPVA 1CQ9A 5JR2A 2XL7A 5H9PA 2LUWA 3M1HA 4YVSC 5F2WA 4BK4A 1GUIA 5C4WC 2XJSA 3ZPOA 1D0HA 4D6RA 1PGW1 4CTEA 2P34A 1AXZA 5A6QA 4A7KA 4QPIA 5FUNA 2AH2A 4OLLA 2D6MA 1AXKA 2WLPA 4KL1A 2ZHKA 1YCIA 2WWUA 4O9EA 4CP9B 1HB4A 5KBFA 3I3QA 1QWRA 2NN8A 3PLQA 4YW3A 5FLIA 1FNZA 1H8VA 3S5QA 5BNQA 2RR12 4LBLA 3MEPA 3VKFC 2O8OA 3BPZA 4G4FA 3TRSB 4AFDA 4BHPA 3RZLA 4XTPA 1RMU3 3JBG2 1VBE1 4NHXA 2GH8A 2Y8KA 1PK6C 2EF6A 2QDNA 3LA2A 5KXCA 1PO23 4QX0A 2GNBA 3MUZ1 3IKWA 4IEXA 5FYIA 2WT0A 2BPA2 1CX1A 1ZRIA 2YMZA 2WZEA 1BBT1 4XHXA 2P2KA 5GZCA 5I8TA 4CRQA 1FPN2 3U4SA 3MZHA 1H6YA 1I9RA 2D97A 2XUEA 1VBC3 3PURA 4QM8A 1ZYBA 2BFUL 1I5PA 3P3NA 1LHVA 2JG8B 1NX9A 4R9AA 1HX6A 2WNEA 1C8NA 2WO3A 2PAKA 2EIGA 3VDCA 2WO2A 5SV8A 4B8EA 1XB9A 3S30A 5HXVA 2MNGA 2EXIA 2F4LA 2RDSA 5IAXA 2JG9B 1TE1B 1WZXA 3ZYGA 1Y43B 2YPDA 4QMAA 2XJVA 4I0WB 1VBE2 1M4WA 3H7JA 4MHRA 1MS5A 1VBA1 5L9VA 3NV2A 3VBFB 5F2SA 2W87A 1L7RA 1W8TA 5FP9A 3HNBM 4BQXA 2V4AA 2LALA 5A33B 1PZ7A 1BBT2 2BEOA 3B00A 4HFSA 4HN1A 4Q4V1 3GALA 1QJFA 4QKBA 4DPNA 1R1ZA 1Y7BA 4FPCA 2A3XA 4K21A 4LBJA 4JKLA 1AL21 2ZEYA 1JYWA 5IFTA 1C28A 1DGRA 1GYKA 1Q8OA 3SKJE 1XSRA 1HRV3 4INDA 2WNUB 1G9AA 3NV4A 1PO12 1X82A 2XWJB 3KT7A 3MICA 3V0AB 4F3JA 3VHOA 2V5DA 5A3PA 4HBNA 1U0AA 3ZO0B 5ACA1 4QU2A 4TLFA 4ASMB 1OKQA 1CIYA 1YQ8A 1ND2C 1RUG1 2D3RA 3RJ2X 1ST8A 2ZGRA 3BTAA 3LAGA 3LDBA 2A1XA 2ZMNA 5LEKA 3FWEA 3VBUB 3USUB 4MOAA 4Y5Z0 4RR3C 3OD0A 5JOXA 5FQ0B 2YHJA 4A4AA 1Q8QA 3RVHA 3V56A 2VMDA 4Q4V2 1MQTA 2P17A 4CDXC 1Q8VA 1AL22 2J1AA 3HBZA 1SBEA 1Z78A 4L92A 4QKNA 2X05A 3I59A 3C7FA 5FZ3A 3AJYA 3OUIA 4IEOA 2W39A 1G9FA 3HPNA 1BZWA 3MO4A 4BXSV 1QOSA 4RD7A 4LMFA 4QAWA 4GB32 3WF4A 2IXCA 1MS9A 3J8F3 3K3OA 3O1VA 1GOHA 2GC1A 5IK8A 4P9XA 5IYYA 1EPZA 3O0WA 4LPLA 3MIFA 4QX7A 3PMEA 3RQ0A 2WFPA 1RUG2 3ES1A 1RIRA 1VLNA 3UGHA 5FTTC 4OUEA 3ZSJA 1TG7A 4KH9A 4FPGA 4ZXEA 1DLCA 4GD4A 2IXKA 4RS5A 5FO7B 3JCIA 4BJ0A 2CGOA 3JXSA 1ULEA 3EMRA 2WS91 2JICA 4P14A 5CFCC 1SFNA 1O5UA 4DXTA 1QF3A 3LWCA 2QCSB 1OA4A 2P1BA 1DF0A 1HB1A 2XBO1 1ZM1A 2IVIB 4JGZA 4UYBA 4ZY9A 5FP4A 4IW3A 1GWMA 4HL0A 4FBFA 1Z7S3 3LIHA 4AI9A 4AQSA 1RGSA 5ISLA 2GN7A 2G19A 3I3BA 3RYRA 1PNGA 3B9CA 1N1VA 4K3UA 2H6CA 1UIKA 4YGCA 1RTVA 4YG6A 1DQ2A 3OY8B 4AFAA 5C7GA 3AP6A 1O59A 2CWSA 2B45X 4PI0A 3NAPB 3BOWA 5BNNA 1LOFA 2C9AA 2Q1ZB 4GA9A 5IWFA 3DXUA 4BMEA 3QOPA 4Y5SA 1W6NB 1WA4A 3VD9A 1CJDA 1YFUA 4DB5A 4V2VA 5F3EA 2CY6A 5FREA 2EIBA 4AVVA 2FCVA 5FO9B 3PDQA 4GH4B 1BEV1 2OXBA 2B7YA 3SISA 1GQPA 2VY0A 3E5QA 3UETA 1OQEA 4I2OA 5FZLA 2ZGPA 4DOUA 4AF9A 5GLWA 3I2IA 3LFMA 2JG9A 2PMWB 5CBLA 3CQOA 4PLMA 3SEEA 1NCRC 5F5AA 4ASLA 3KWVA 1HQNA 5FMCA 2VVDA 3A7QA 3K4AA 3ZYJB 2W95A 4TTGA 3RPQA 3O1TA 5F1RA 1DCSA 2IXJA 5A33A 4PCRA 4Q8KA 2K2SA 5DZEA 5IT6A 4EROA 1PHMA 3T0AA 2XUMA 1UYPA 1OLMA 1OH4A 3BALA 4K8RB 1S1AA 4EWAA 4YG0A 5GLZA 3ACLA 5JR7B 4CCOA 3MYXA 3J7MA 5T5OA 4AOCA 2WT1A 4IGQA 3BPSA 4YW4A 2OYZA 2BGCA 1GNZA 4PDWC 4A6OA 1LTEA 1UXZA 3BN6A 5FY0A 4Z1VA 4QHZA 5DG1A 3SH3A 3V0AA 4LO7A 5GKAC 5C8WA 2VQUA 5FXXA 3VDAA 3D0SA 5C8CB 2V5YA 5IVJA 1XE8A 2R042 2E33A 3MFCA 5F3CA 3WW4A 1KDMA 1VRH1 2ET7A 2JD9A 1DHKB 3WHTA 1UY3A 3FUOA 3BKZA 3VBUA 5IK5A 3USUA 3FUQA 5FY8A 4WM8B 4GAZA 1MZ5A 1H2LA 2DFBA 5HCHA 1FV3A 3ETPA 1X9PA 4P9WA 5T52A 2VQTA 1W0PA 2Z69A 3GCWA 3SLIA 3A23A 5B4NA 1S2EA 5A6YA 3MV01 3N7KA 4Y3OA 3EHKA 1ZBA2 3WHUA 3D3AA 4AHXA 5LRSA 1CPNA 1VBB2 3VZOA 4QPWA 1CZSA 1FMD1 3U75A 3WQ1A 3ZXJA 4NHMA 4FPKA 3LFIA 4JGYB 5CVRA 4NAOA 4LA2A 1XNCA 3HIFA 1DG6A 4JX0A 2J1VA 3HN1A 1JH5A 1MEC3 1NA1B 3GZUC 1YFWA 1Q8PA 3BU0A 3WP4A 3IN9A 4JTOA 4WBBA 3CJIC 3POJA 3PJQA 5E6HA 5AFEA 5F3IA 2DUQA 4XILA 5B2GB 5FPBA 5T5JA 3OPWA 4MLOA 3HEIA 1N1TA 1LULA 4DXSA 5D8AB 1C57A 2PXJA 3D0JA 1AX0A 4I30A 2YU1A 1ZRDA 3PIJA 1FMD2 1OUSA 1F9KA 1W8NA 3IB3A 1LCLA 1REFA 2WO1A 2O0OA 2BRTA 4I09A 5J3UA 3O0VA 2PHRA 4L0PA 3W58A 2DCYA 2SLIA 1L7LA 3NAPA 4DNYA 4D7SA 3U10A 1JMUB 3EQEA 4R9CA 2WT2A 1QU0A 4CU8A 2R061 3H8UA 2GAUA 1ZRRA 1W6NA 1WLWA 1HV1A 2EAKA 4XFFA 5A7NA 3SNMA 5C33A 1TZOA 2KD7A 4Y22B 4CZSA 4NPMA 5JSOA 1QXRA 1X50A 4YW5A 3A22A 5G05L 5A1AA 4BQ5A 2V73A 1PO21 3VN4A 1JZ8A 2XGXA 1LOAA 3C7GA 4GH4A 4ZZ5A 4QQOA 4FAHA 2TNFA 3BODA 1QY4A 2QTWB 2VZVA 5LA2A 1OA3A 2LM3A 4ONUA 4YNIA 4CDQB 1RUE3 2R6QA 4A7YA 1W99A 1PX4A 5GLUA 4Q27A 2DBIA 4JKMA 4AW7A 5CAZA 2Q5TA 4H3WA 2IVJA 5F32A 4DY3A 5HV0A 3WW1A 2RM21 1XPWA 1Y9MA 3B02A 2WN2A 1LGBA 3WDUA 1JUIA 1V9U1 1HB2A 4KGGA 2OX0A 4OQ8A 4M3CA 4W4ZA 1OQDA 2R062 3M8LA 4XACA 2I2SA 2B8MA 2EXHA 5EYYA 3ZFEB 5C3OA 1HXS1 4CUCA 5KXEA 3NJYA 3BU7A 3ENRA 1D2SA 2QQUA 3RMXA 2PELA 2VUCA 2WC2A 2CGPA 3JB4C 1AJOA 2HWB3 1QJX1 4Q4X3 3ILNA 5ABJB 1E57A 3WP3A 5FPVA 5CG9A 5L73A 2VZUA 3KCXA 1LENA 1XSQA 3OPZA 1F4AA 4RGGA 3CZUA 1MZ6A 3UYJA 1H30A 4IEVA 2XONA 4PQ9A 4LBNA 3T0DA 4DMIA 3GZTB 5C8CA 1GQHA 1ZX5A 5CFDB 4G3YC 3M70A 1A78A 1MZFA 3AZXA 3WV6A 2RM22 4UW5A 2OUHA 4X6RB 2VO5A 2WA4A 1V9U2 2BWAA 3THDA 1ALYA 4LT5A 2VUAA 2WQ8A 4HT1T 5FZGA 1W0NA 1E5HA 4URTA 1QXJA 1HXS2 2JDHA 1WW7A 2RR13 2ZHMA 3I3DA 4QX8A 4EE2A 2WIIB 1IS5A 3C7OA 4CEYA 4FTEA 1J59A 2X5IB 3AL6A 1QJX2 3JBG3 3LGRA 2A6VA 3THPA 2HWC1 3OEBA 1Q8SA 1JXNA 2Y6KA 4RA0A 1DQ1A 3LA7A 1XRUA 3K75B 1G6NA 4I0BA 4CU9A 4Q0QA 2IFWA 4YW2A 1GU3A 5FP7A 2WABA 1FPN3 4I0AA 1JHJA 1KGYA 1NCQA 2AYHA 2FCTA 1ZNPA 4K40A 5CZKA 1V0AA 5LB6A 1EP0A 2OW4A 3VBOB 4AWDA 4CUGA 3U0ZA 3VZJA 1DGLA 1NA1A 3AYCA 1N1YA 3BGAA 5DZFA 4IE7A 3WG2A 1W8ZA 4XDQA 3AJZA 3RGBA 1OFSA 3WQ0A 1JYNA 5FO8B 2FHRA 3DV8A 1UMZA 1YEWA 5FBZA 2J1RA 1W3XA 2ID4A 5DUXA 3VBHB 1MVEA 4MGZE 3ZLIA 4PQQA 1VBE3 5JOWA 2VNOA 1LB2A 2HWC2 5D8AA 5FZAA 1L3JA 2Y34A 4ZZ8A 1LOEA 3K46A 1EPWA 3GBGA 4MGTA 4W8JA 4M3CE 4OHZA 3AYDA 1JYTA 1BBT3 4OHVA 2NMNA 1DDLA 5GALA 3LDRA 4MX3A 2DUOA 2Z2SB 5JXJA 2LW8A 5LY2A 3EJKA 3DYPA 3ZXAC 2O8QA 4GMP3 2Z79A 1LOBA 1N3PA 1S0IA 1VMJA 3ITQA 1LGNA 3PHMA 4JZRA 3VDBA 4W6WA 1UZYA 1PO13 3L9JT 4YARA 3O5SA 5IVBA 3T2QA 5FZ7A 1JOPA 3CMGA 2AENA 3HVDA 1S2KA 4Y22A 4AHYA 5DAXA 5DAWA 3RSJA 2UWCA 2X10A 4D7TA 5FZ4A 2BVVA 1K3IA 1AX1A 5FXVA 1Q3EA 3AMMA 5C5UA 3J7LA 4CDUC 4FTBA 3JU9A 3SITA 3S0MA 1TNRA 4Q4V3 4LHNA 4Q4Y1 1AL23 1RUF2 2XLGA 4PHZA 3FLTA 2DYCA 3CIHA 1N47A 4C0HA 4C1WA 1XNKA 3VD5A 2R32A 2VL4A 4GWJA 5FYTA 5FOBB 2C5DA 2PHXA 4DZGA 1TMF1 1ACCA 1JBCA 3OCPA 2VOXA 4R8HA 2NP0A 4GB33 1IG3A 4YM1A 1SMVA 1GKBA 5FZ8A 1ZZ7A 2Y33A 4WM7C 3B69A 4AI2A 3KGLA 1RUG3 4XXAA 3QH6A 3VBRC 4DUWA 3E6CC 3WP5A 4EN7B 1CPMA 4N53C 3DL3A 2FDHA 1QJU1 3ON7A 2BUKA 4NUBA 2PHLA 1DP0A 1RUC2 3O14A 3Q8AA 4XF3A 2W0XA 4R4ZA 1CIWA 4FCAA 4FPFA 2GU9A 2P6HA 4Q4Y2 5CFDA 1CAUB 5FUIA 3KVBA 5HPOA 3N7MA 3U4XA 3KQ4B 1CGPA 3T2PA 3T2TA 4AEMA 2ET1A 1TMF2 2LS6A 4EN0A 2B9VA 3I97A 2R0HA 4YM0A 4URAA 3BUCA 4B4PA 2VOTA 5E8AA 1W8FA 2WUHA 4SLIA 3Q9OA 1W90A 2BWCA 4AVCA 4AR2A 4AEDB 2J1TA 4C0BA 2X5IA 4D0QA 1AR73 3RZHA 1APNA 4HPKB 1DQ0A 3H8OA 1F15A 4MADA 2JE9A 1F4HA 2D6NA 3CLPA 1W2NA 4XUPA 3VUOA 1QJU2 2RJKA 3AKQA 2JB4A 3CF6E 3Q8EA 3ZFGA 4DQAA 2AREA 1X9TA 2VR4A 5CADA 5CNAA 1IS6A 4CPBD 4QPGB 1QKQA 2YBPA 4FFIA 4WVWA 4MG2A 2B9UA 1QOTA 3LPFA 4RGAA 4IEUA 3VBOA 1VB2A 3I8TA 5G04L 3U07A 2YBSA 1LHWA 1S0EA 3I2GA 1GOFA 3LEKA 4WVVA 5A1FA 1IOAA 4PBOA 1MS8A 3AMPA 1WGPA 1MS0A 2HWD2 3EBRA 1MEC1 2I74A 5KHHA 4Y1UA 3H42B 2EIEA 2YG0A 4GWNA 5BNPA 4YVWB 2I07B 3T1LA 4Z82A 1WA6X 1JYIA 1S0CA 2VMEA 4G9SB 1YFYA 5FYZA 4FOYA 3RI9A 2RS12 4BQ2A 1UY4A 1X8MA 5F5IA 1NUKA 2BNOA 5FYHA 5JXHA 3BOPA 3BTYA 3MIBA 1O3RA 1QOOA 3KT1A 4EV0A 4EZHA 4S2HA 4H7MA 5FZEA 4YGEA 1A8MA 3WG4A 2BDRA 4CE8A 4ZS2A 2PHUA 4PJYA 2R043 1YQ6A 4LUKA 1VMHA 4QX3A 5FZKA 1YI9A 3AVSA 4A45A 4HKLA 3M3EA 4QX5A 1OF3A 4P5YA 1NE6A 5DUVA 4LE3A 1IHMA 1NZCA 5IHRA 1NY71 3LSEA 5FPLA 2DTWA 4IE0A 4PIXA 3WY6A 1ULFA 4LO8A 4AEJA 4AFBA 4LA3A 1ZBA3 3P1IA 1XYOA 2ZGKA 2WLQA 1C8M2 1VBB3 3IDEA 3KGZA 1RUE1 1UWWA 4COVA 3POSA 1AYM1 3FMGA 1KDKA 1UCXA 5FY1A 1ASJ2 1JW6A 4QQPA 4PIYA 5T50A 1CVNA 3D82A 4Z2AA 3UK9A 1POV3 1OURA 4XCBA 4YSFA 4OMCA 1WWYA 5FK7A 4MGQA 4P5HA 3IIIA 4HK8A 4OCTA 3ILRA 2VC9A 4KNCA 2VBBA 1H8TA 3ORJA 4UI9L 3N7JA 1DQ6A 3DPRC 2HWB1 3GYDA 5EYXA 3ZXDA 4Q4X1 4QPYA 4NJ4A 3T30A 2C6SA 4NPLA 2XJPA 1RUOA 1UKRA 1NY72 1CAUA 2Z4FA 1XQNA 4CDWC 2VH9A 5DAVA 4RQPC 4XJAA 2LRPA 3I49A 1B35C 5FLHA 1CESA 4XUTA 1FMD3 1UNBA 4A44A 5LEJA 5JXGA 3FJSA 4NN0A 3HQXA 2BNNA 3LEGA 1AYM2 3W21A 2D6LX 4IV1B 2VZTA 5D1IA 4AEDA 5EP9A 1DLLA 3AK0A 4HPKA 1OBNA 2VAUA 1J84A 3IPVB 3ZOIA 5I91A 4FPEA 5K9YA 1FV2A 4BWOA 5GJ6A 5FMOS 3N9OA 2HWB2 4IV3C 1US3A 1I5ZA 2JJ6A 4XW3A 1I3HA 3OGJA 3OG2A 1WW4A 1CONA 2P3JA 5LASA 4RS5B 1J1TA 2ARCA 4MYEA 4UW3A 1CAVB 3GJBA 4GZ9A 5BNOA 4JRLA 1LJ7A 4CPBA 4BM8A 4BQ3A 3VBSC 1IPJA 3WNNA 1FPN1 1HDKA 4E2SA 3FFQA 3AP4A 3MIGA 3K48A 4YG3A 1MVQA 2ZGOA 2PHWA 4JGZB 5EZWA 1H4HA 2YC4A 2VOKA 4JRAA 5IVFA 2J1UA 4CA9A 1JZ4A 1V6JA 1RVF2 4OI4A 4YVWA 1GZWB 4YVSB 2R063 4GWIA 4AHZA 5DDJ3 5JOZA 1BVP1 5JMCA 4X8PA 3ROUA 3A0KA 3HN3A 3QBQA 5DG2A 1IG0A 2ZZQA 4YPJA 3CZJA 4TLGA 4TZDA 4K7JA 4XJWA 5BNNB 3H0OA 4P9LA 1SEFA 2Z42A 1ZZ8A 2QQIA 4Z2WA 2XHKA 3AFKA 4L9BA 1JS9A 3THCA 5FR3A 1UN1A 2GNMA 3WQBA 2GZWA 2GP3A 1N3QA 4OUMA 4QKFA 4CVUA 2MEV1 1WD3A 1RUD2 1O4ZA 1AF9A 1R1A2 5GZEA 1JYXA 1K5MA 5F8PA 3UESA 1F5JA 4Q0UA 1QGLA 3OYWB 3WT3A 3M3OA 4PLOA 4QB1A 2ZX1A 3UNPA 5EV7A 4GMP1 1JZ6A 2UY8A 2NYYA 1PK6B 4I02A 3TNQA 2RM23 1JUHA 2F6BA 2BP6A 1PO11 3CEWA 4RGKA 1UY1A 2ZKNA 1V9U3 3ZFFC 2DVGA 3AZWA 1HJFA 3GM8A 1WCUA 3JQXA 3POYA 2BJSA 3THTA 3DYMA 2AUYA 1DYOA 1VBD2 2JG8C 3VD3A 3WOGA 1HXS3 1OLRA 2IZWA 1WMEA 5JDBA 2FDFA 3I3EA 4IEWA 3AB0A 4D8MA 4IGPA 4AGGA 2MHFA 3GCXA 2N7GA 3H1YA 1V6LA 1QJX3 4KMQA 4X8NA 3WDTA 3N4MA 5JXIA 1RINA 5LW9A 2CSGA 3HOBA 3VDDA 1H1MA 5KC5A 3WVJA 2W94A 2XLAA 1IKQA 2MEV2 4ZU4A 3ZIXA 2EXKA 2UWAA 1D4M1 2V09A 5T54A 2QQWA 3BIEA 4FFHA 3VBFC 1GMMA 1X36A 3HQRA 1TEIA 1YO8A 4BOWA 1TME2 4JDMA 2W1SA 3N9QA 4LNVA 4MVTA 1OI6A 2GALA 4GB31 1FOD1 3N9MA 3WNMA 1U5XA 1WBLA 4BDVB 2WQ4A 1GOGA 5LBFA 2R1DA 2WNVA 1UO9A 2WFF2 4LJHA 4NPRA 2WNUC 4IEPA 4JC1A 5D2AA 1W6PB 3DYOA 3MW4A 5FZFA 3UT0A 3RZGA 2XXZA 3NNMA 5BYNA 5JVVA 4UFMA 3L2YA 2HWC3 1S0JA 2R30A 2FDKA 2X09A 4UBGA 4UBHA 1LHOA 4BE3A 1D4M2 2PYTA 2B46X 2Y6FA 2OS2A 4LKDA 1V6MA 4FP3A 4OFGA
chains in the Genus database with same CATH topology
1KFXL 3B5LB 3DF0A 3O7OA 4XMAA 3OF1A 1SACA 4IV1A 3PJYA 1DFQA 1V6OA 2A71A 2VW2A 2GN3A 5F6KA 4BPZA 1HLCA 3UJQA 2GSYA 4Q2FA 1FOD2 2OA2A 4P9JA 3IPVA 3KZ4C 1CR7A 4AGRA 3H1MA 5JLVA 4JV4A 4Q1PA 3QD6A 3NV1A 1AR71 4QQHA 1REEA 4GIQA 3AM2A 2Q8OA 2XWBB 4GWMA 3GBWA 4FP2A 3FC0A 1CAVA 2CAUA 1VIWB 5DUWA 2BQPA 1V70A 1OMIA 2RJLA 4RHV1 2GC3A 3TYJA 4WVZA 3MPBA 1RUF3 4XBLA 4XEZA 3TN92 2Y38A 3AKSA 5J09A 5L7OC 3AKTA 3ZXKA 1ULDA 1QNWA 2GMEA 4OHYA 2WA3A 1GZWA 2YZ4A 1UX6A 4YVSA 4ISQA 2H0VA 5C4WA 3MF6A 3P3PA 1VB4A 1VAMA 3TAYA 1AR72 5DZGA 1AR62 2PHFA 1ND3C 3AKRA 4TWTA 1BCXA 1KXGA 4COUA 1ENSA 2ZAHA 3INAA 1N1SA 2RHPA 1RUC3 4PF5A 2VQ0A 4RHV2 4AI1A 4A2UA 2CYFA 4QXKA 3UJOA 3OYWA 2ZA9A 1H1AA 4Q4Y3 3TOJA 1EY2A 5FDBA 1M06G 2PFWA 1NE4A 1DQ5A 1PK6A 3R0RA 3NKTA 2UYBA 1TMF3 1MS1A 1S0BA 4XFIA 4GMP0 2R041 2YC0A 2ZHNA 3RYPA 4CYDA 2FQPA 4AI0A 4C91A 1ENQA 3BCWA 3DN7A 1AYN1 3IMNA 4M3CB 3SMHA 3IDBB 1QJU3 5LRRA 2D44A 3K51A 2W08A 2GNDA 4N43C 4LBOA 5I0TA 3S7EA 3WP6A 2OVUA 2XKOA 1ZBA1 2DUPA 2D40A 2A75A 1CAWB 1VBB1 3TB0A 4YW1A 1S0GA 2GC2A 2VQAA 1N3OA 4HETA 1WMDA 1PGSA 1AR92 2HWD3 1KJLA 1POV1 2PHDA 1W6PA 3M4FA 2DV9A 3KT4A 1F31A 4GALA 4M00A 1G9BA 1AYN2 5C8CC 5GZFA 4KG8A 1KITA 4XQ4A 4CEYB 4LLOA 2DVDA 1WW6A 4RSUA 2C1FA 3DGTA 2VOWA 2RS13 4WM8C 3N7LA 1ND2A 3OTFA 4JDOA 4EWEA 4RR3A 1LESA 2E51A 5KC6A 1O7FA 2CTVA 4FAGA 3LSDA 1J3RA 5I93A 1NCQB 4J1WA 4CDXA 2QNKA 4KG0A 5C6CA 1WCSA 5EJ3A 2VECA 2ARXA 2YROA 2D5HA 4JGYC 4AHWA 1GV9A 2PAEA 3AXDA 3RG0A 4L11A 4MSVA 1NA1C 3CJXA 3ZYRA 3X29B 4BMBA 3CO2A 2W68A 4DY5A 4H55A 1OOPC 4SBVA 3SCFA 3VGIA 4NVPA 2Z5WA 3ZSKA 3LZZA 3CJIB 3R05A 1C8M3 1G86A 5D8AC 4XQWA 3ELNA 3ZXLA 1IQAA 3LA3A 2C0ZA 4XXPA 5CFCA 1ZRFA 5KWRA 1ASJ3 2YGMA 4I3GA 1GZ9A 3N35A 5J37A 4ES9A 4D3WA 2YV8A 4U36A 2ZMLA 1YWKA 2BTVC 4EJRA 4LO4B 5DDJ1 3GBFA 1H4GA 1U5IA 1TNFA 4K9SA 3UL2A 1ULCA 4QM9A 4AXOA 1WMFA 1RUI1 1WLTA 4A3XA 1ZREA 1IKPA 2VW1A 1QHDA 4MZUA 2NMOA 3TNPB 3PNAA 3H3UA 5FMOL 1XU1A 2HJIA 3JB8A 3WT3A 3AX4A 3VKMA 4D69A 2CV6A 1NG0A 3E5XA 3FZ3A 1AYM3 1NXD1 2FMYA 1LHNA 1QDCA 4CDQC 1UL9A 3HWJA 4FT8A 1KRIA 4XMIA 5H9SA 2A6ZA 3H50A 2Q1MA 1OLQA 5DDJ2 1IZ3A 2HWF2 1SDWA 2ZGTA 1D4VB 3WX5A 2G9FA 4U2AA 1QJY2 2BYVE 4BH9A 2BBVA 1XYNA 1D2QA 3FBMA 3ZFEC 4FXKB 1NCRA 1RUI2 3QH7A 1HIXA 1YRZA 3AP7A 4XFCA 4XOGA 4E4SA 1A6CA 2QZ3A 1CAWA 1FT9A 4B7KA 2BNMA 5TSWA 5ABJC 1SBDA 4XFAA 5FFOC 1NXMA 3OJBA 4DINB 2QFEA 4ES8A 4P9GA 4MGKE 4Q0VA 1RVF3 4DFSA 4PDWA 3HD8B 5T55A 4C90A 1POV0 2ZMKA 4IETA 2UYAA 3NVCA 1SLBA 2A70A 5JOYA 3MFAA 4BQ1A 4HSLA 1WCKA 4OI2A 3RMYA 1PVC2 3GF6A 2VGDA 3R4SA 3ZFGB 1RJ7A 5JZGC 2X5IC 3NV3A 4YLZA 1RUD3 4FPHA 4Y4YA 4BIFA 4E4ZA 1ONAA 1R1A3 1QDOA 4RFT0 5H9RA 3NJZA 5C9AC 1FI2A 4LE4A 3VL9A 1BVVA 1QJZA 2R072 3PVEA 3ATGA 4L99A 3ALQA 4H7LA 1R081 3ST7A 1HQLA 4TYSA 4ATEA 1OPMA 4GQ7A 2BFUS 4PBPA 3URFA 4LEJA 4HN0A 1VBD3 3ZXGA 2CNAA 2EA7A 3ZMOA 2LTNA 3AP9A 4B4RA 3AZVA 5BNPB 3WQ7A 1SLAA 2I45A 1GFF2 3ZSLA 1WLDA 5LK5A 3VBHC 3CJIA 5A3LA 1R091 5CIRA 2MEV3 1EAH2 2XKPA 4F8AA 4EN9B 5JAXA 1RUF1 1GANA 1FXZA 1H9WA 1H2NA 3LB9A 3WLUA 2A7AA 1TME3 4K20A 4FPJA 2IXHA 2A5ZA 5J36A 1R082 2PQQA 3IDCB 3RJRA 3AMNA 2WFF3 5T5LA 5JSPA 3M2MA 4Z92B 3JD72 1LOCA 2A6WA 4Y26A 1G9CA 4FPYA 1JN2P 1W39A 1RUC1 4Y24A 3WUDA 1R092 3R4DB 3E5UA 1D4M3 4NR1A 4YZ5A 3G6JB 3ES4A 1H1IA 2JENA 5K0UB 1PM7A 4YFZA 1BQPA 2JE7A 1KS5A 5AC92 1W6OB 4CDUB 1FOD3 2OZ6A 1CJPA 1Q43A 3B7MA 3UV9A 2ZAAA 3QACA 3E6DA 1LRHA 2WL1A 3LKJA 1UU5A 2IC1A 1H0BA 3WINE 1KS4A 5IUQA 3KMHA 1ZVFA 2XVGA 4B29A 1H8TB 4NWWA 1Q56A 1YFXA 3VLBB 4R9BA 4YZ3A 4WM7B 1JTZX 1QQP1 2Q4SA 5HCBA 3TN93 2R0FA 2YGLA 3JQWA 1RUJ1 1AR82 4B3NA 4JAAA 2IWGB 3AZYA 2WWSA 1H2KA 1KFUL 3MF9A 1HW5A 3EO6A 4GKXA 2ZBJA 2HWD1 4CEWC 3CU7A 1C4RA 4O9GA 3FFZA 2VOVA 4Z07A 3U11A 5I0UA 1AR63 2D98A 3JUUA 1PZ8A 2GMPA 1JOJA 3LOIA 1C5HA 3MW2A 4RHV3 1LGCA 1G9DA 4KBBA 1LR5A 2QJVA 2RS11 2D6KA 3AZZA 1QQP2 3OBTA 4MXWA 4W6YA 3WD5A 3RNSA 3VZLA 1ULGA 3M3QA 4XFBA 3KSCA 3WG4A 4QPGC 1RUJ2 4JTNA 4XBNA 4XHBA 5BNOB 5IK4A 1H2MA 5KHIA 2VNRA 3LOBA 1RHI1 4HKWA 2RS32 2IXIA 4BCUA 1YUDA 4Y1YA 2KM2A 4CP1A 2PAMA 4K6BA 4K8FA 2XPJA 1J58A 2OPKA 2IFRA 4Q4W2 4QPIC 1O4TA 4AG4A 2Y26A 1MZEA 2DVBA 4NOTA 4OULA 4ZU5A 1MR5A 4JCKA 1LKNA 5K7PA 2XVKA 5J48A 1OHFA 4LLFA 2WZR1 2ZCWA 3E97A 1C8M1 2BW8A 2Y0OA 3R6SA 3AYAA 1V00A 2VNGA 1K5MB 4WVMA 1RHI2 1ASJ1 1AR93 3ZXEA 1AJKA 1UW8A 1AYN3 2ARBA 1W6QB 1UAIA 1S0FA 1GZCA 1SBFA 4RL7A 3D6EA 4XETA 1IPKA 2HWE3 4L2NA 2ZHLA 1YIPA 5GZDA 5HCFA 2VG9A 1VAVA 2UY9A 3AKPA 3RRDA 3VDDB 5JPNB 5CA6A 5K0UA 2WZR2 2YUEA 4XJZA 4HSJA 3VL8A 2QKDA 1W6OA 3W9AA 4CDUA 1HRI2 3WDYA 2HYKA 3B01A 4N9IA 3MPPG 2ZACA 1LU2A 3VHPA 5KXDA 1PGL1 4NHLA 4Y20B 3ZIWA 5HCAA 2WNVB 5I0SA 1YNAA 2ZGQA 2RS53 4F7ZA 2XJUA 1J3QA 2NPIA 4WM7A 3ZMNA 1REDA 1XU2A 3OGGA 1SLIA 3VBRA 4Q26A 2UWBA 3NKGA 4Z8BA 4N53A 2FBEA 1GBGA 3SXWA 1LODA 2ZX2A 2QQPA 2AR6A 2VW0A 3JZVA 3DPRB 1PGL2 1SLTA 1MQTC 4CDWB 4XJUA 1RITA 1NYWA 4W6XA 1RVF1 3N3HA 5KHJA 3IBMA 3I2DA 3SCHA 1HQWA 3MLLA 4IV1C 3ZVXA 4Q0SA 4LBKA 5F5QA 2DCKA 2ZJCA 3TWIA 5JI9A 1UF2C 4LBQD 2TBVA 1W6MB 4GXLA 1NLSA 4BA6A 5BPXA 2Y0IA 3TBDA 3PMSA 5GLVA 3ZYIB 3UKVA 4LBQB 3I7DA 1UZZA 2DVAA 3AMHA 2TUNA 3WCSA 3B94A 1BYHA 1DGWX 1RUD1 2ZS6B 3ZX7A 1R1A1 2ZGUA 2HEVF 4RS5C 4BLJA 3PVOA 4IV3B 1UKGA 2ZGSA 4ITCA 5FRAA 4EN6B 2ZX0A 3LCPA 3WG1A 1UPSA 3M7AA 5E88A 1PIV1 2NQYA 5FPXA 4KWJA 5KHGA 1YIFA 4JGZC 4HK9A 5C4WB 1S0DA 3VBSB 1VBD1 2HWF3 3SH5A 3J4UH 1LEMA 1UIJA 5EFUA 1QJY3 1U5YA 4LO6B 5GM0A 3WXPA 1RUI3 3KLSA 2OUJA 4YZ4A 2K0GA 3SHRA 3ETQA 4AK3A 3KD4A 5BNNC 1RJ8A 1LOFC 4BLIA 1Z0HA 2YY1A 3MIDA 1X8EA 3O12A 2FZ2A 2GH2A 2OIIA 4ZU7A 3ZN6A 1TME1 1AX2A 1GNHA 1X33A 4YRDA 4KQ7A 5KHKA 4LR4A 1DYPA 1PIV2 1ZA4A 1WLCA 1W6QA 3PVBB 1S55A 4LTAA 2DURA 2P3KA 3ZPYA 2WFF1 2B42B 1ZBE2 3T1MA 5K8SA 5AVAA 4GULA 1BXHA 2JG9C 4OHXA 1PGW2 1PVC3 1QH6A 2JKBA 1EYBA 1XNBA 2W52A 3ZFFB 1ZZ6A 1O3TA 4ZXKA 3KM5A 1UPIA 2OZJA 3MIEA 4NHKA 2XLFA 3VKNA 2D7FA 2ZTNA 4L8QA 1SQ4A 4XF9A 4PIZA 2EAAA 2CGNA 4Y20A 2R073 1IGOA 2ZX4A 2A6XA 5EWSA 3L2HA 4Q8LA 1KD7A 1D0GA 3BB6A 2ERFA 2G9GA 4COWA 5CU1A 5FPZA 1PMIA 1RUNA 4FOWA 1F5FA 3VBUC 1EAH3 1CAXB 3ZN4A 3ZSMA 5JPMB 3DPRA 4DRVA 3VZKA 1ND2B 4F83A 4KU8A 2PLV1 4QQ2A 3TN91 1VP6A 1QH7A 3AXEA 4H14A 5DUUA 4CDWA 4RR3B 4FO9A 4P9IA 4RQPA 2PN5A 1DGWA 1AZDA 1B35A 1R083 1PNFA 3V65A 3UKTA 1VBA2 4CDXB 1C3HA 2JX9A 1YJKA 1W6MA 3MI8A 3JD73 2B39A 1AR61 1GQGA 4KU7A 4XF0A 2A6YA 5A32B 4LBQA 1AUYA 4MXVA 1R093 2E7AA 4DS0A 3POWA 4COYA 2WSUA 4D94A 4IV3A 3O0XA 2PLV2 1SCSA 5T5PA 4XF4A 3PVNA 5ACA2 1RUH3 1GSLA 5AC93 2MPFA 3I54A 4R52A 1SFYA 5CFCB 3VBSA 1V6KA 1CD3G 4J6GA 2HKXA 1WCDJ 2E6VA 5L7OB 4E2GA 3I4IA 2E9QA 4LHLA 4S2DA 4V1PA 3DUIA 2YPJA 3NAPC 3WUCA 4XTMA 3RZZA 2R16A 2K9ZA 1VR3A 4P9YA 1ND3B 1NLRA 4AYUA 2WSVA 4YZ1A 2DTYA 4XF1A 1AR83 4N7UA 2DWRA 3HT1A 4FOQA 4GH4C 4COZA 2ZX3A 5HI0A 1AR91 2E7TA 1DZTA 5JIUA 1UD1A 4HVRA 4AVBA 4UXAA 3V64A 2E7QA 2WS92 3SH4A 4ATFA 2SBAA 2HWE1 3FBYA 1PVXA 2NZ9A 3HT2A 3ZFFA 1URXA 4LBMA 2XBO2 3A4UA 2PHTA 1VALA 2JG8A 2VVFA 1VJ2A 2DU0A 1NCRB 1DYKA 1QQP3 1BMV1 2H0BA 3FLPA 3J26N 5AVPA 4C1XA 4BYYA 1RUJ3 3NW4A 4MUVA 1WUVA 1FNYA 1F2NA 1SLCA 2D3PA 2F4PA 2RS33 2XH6A 3VBFA 4Y1ZA 3KS7A 1EV11 1TQ5A 4N43B 4E2QA 4AEKA 2A3WA 2RMU1 3IWZA 4OZXA 3GHNA 4XE9A 4PDWB 3ME2A 5BUVA 2HWE2 4Q4W3 2CL2A 2RS51 4WZCA 3ZN5A 1BEV2 3MW3A 3QCWA 4WZFA 1CAXA 2WNUA 2UURA 3NL1A 3PTYA 1J3PA 1BMV2 1ZZBA 1DGRN 1O3QA 4CEYC 2UU8A 5I8SA 1XXNA 2YXSA 3APBA 1ENRA 4HKOA 1OSGA 3KCYA 4QD2A 4HMZA 4FSJA 3NSTA 5FCCA 1RHI3 3N36A 4AVSA 5J98B 1EV12 5FQ0A 1DU3D 4OI1A 2RMU2 3MLJA 3M3IA 4KWKA 1AXYA 5I0RA 1NCQC 4M0HA 5A32A 4AFCA 2YDEA 2RS52 1COV1 2JXAA 2R49A 1RL3A 1GLHA 1NQJA 3C2UA 4Q1RA 1LHUA 5J7MA 3R4UA 1CN1A 2DCZA 1JHNA 3WDWA 4AVAA 2WZR3 4ZKTB 4W65A 4IEQA 3RDIA 1VRH2 1HRI3 4YM3A 1G8WA 2AZ5A 4QGNA 5JWPA 2DU1A 2WZPP 1OOPB 3NO8A 4X6QB 2HEWF 3MDPA 2A73B 1OFNA 1A3KA 5L7OA 4HVOA 1HKDA 2X53S 5BY5A 4AFMA 2ZKLA 2HWF1 1COV2 4HLTA 2CWMA 2VMHA 1QJY1 4HVQA 2JEMA 4R4XA 1CX4A 2AGSA 1DZRA 4Y1VA 4YGDA 1OQ1A 4TSVA 5KXBA 1ND3A 1GICA 4KWLA 4XJWA 3OY8A 4PLNA 1SLLA 2XJTA 3H3ZA 4MGYE 3MIHA 5BXXA 2EXJA 3WCRA 1ZZCA 5H9QA 5J96B 3AP5A 1QXPA 5JI7A 4JQRA 2XL9A 1OA2A 3J9SA 3RWNA 1RMU1 4AVTA 1U12A 2ZGLA 4CP0A 4I01A 3FX3A 2QE3A 3GHMA 4UW4A 1Y3TA 1YHFA 4AGVA 1PVC1 2HEYF 1FX5A 2D93A 1VBC1 2PTMA 1V6IA 4FQ4A 3AFGA 4E27A 2GMMA 5CG8A 2E63A 3EXUA 4Q0PA 3VV1A 1BKZA 2P3IA 1LU1A 4LO5B 2XG3A 3BIWE 3IT8A 2R071 4N43A 3WR0A 4QGMA 3ZYPA 4B7EA 1RMU2 5CFDC 1G7YA 3KB5A 3VKLA 2ZGMA 5FLJA 2DF7A 5E1RA 4FPOB 1PO22 1I1EA 1YLLA 2ES3A 1WW5A 3VKOA 5GZGA 4R9DA 1FATA 4IEYA 1VBC2 2DVFA 3H1WA 4IESA 1MS4A 1EAH1 1HRV1 2X8KA 3FLRA 4S2GA 3ZXFA 3S6PA 4MXWB 1WBFA 2KA3A 3ZFGC 4WM8A 4ISRA 2VU9A 1PIV3 4OUSA 1YXWA 2XJRA 5JZGB 3VBOC 3B3QE 5JIAA 1ZBE3 1V6NA 3JD71 1S2BA 2XJQA 5GLTA 3B9IA 1XYPA 5C9AB 4YZ2A 1MS3A 2ILMA 5F6LB 4JGYA 2WJSA 1MACA 5F9TA 4UW6A 1HRV2 3OD4A 5BNPC 1B09A 4XFGA 4A7ZA 1X7NA 3J8F1 3B93A 2NLRA 1OOPA 2D43A 1RUH1 3CL1A 5AC91 3D8CA 1WD4A 3USSA 1O5LA 4WVMB 4OVEA 1FAYA 3ASIA 4XYXA 4XJ8A 1T6GC 3VHRA 4M0NA 5FOJB 1O3SA 2WQZC 4FTSA 4XFHA 2WKKA 3FHIB 4N9HA 4JDNA 4XPVA 1ZRCA 1LEDA 3MLKA 2BVBA 3HR9A 4NWVA 3NWKA 3ZDSA 4OI0A 4Y1XA 3WW3A 4YFWA 3IIAA 1YI7A 3DKWA 3H9AA 3W59A 1Z7S1 3WNXA 4AQ6A 3J8F2 1LOGA 1RUH2 4KGQA 4JVAA 1AR81 4BZ4A 3GZAA 1DIWA 2QZ2A 5K0UC 2ZGNA 1VBA3 4IQPA 2ETEA 2RE9A 1NOVA 4MV2A 3VHNA 1W0OA 4LULA 4CDQA 1F8VA 4QQLA 1ENXA 4XJ9A 2VULA 3QLQA 4M3CF 1QMJA 3FE5A 3MGUA 2X29A 5EXOA 4DXZA 1Z7S2 1AL0G 1C5IA 4XIOA 3HMYA 3HAGA 1H8TC 3VBRB 2PLV3 3ZFEA 4AE2A 1A8DA 5ACA3 2P37A 4N53B 3GNEA 2XB6C 4FXGB 3ECQA 3G7DA 2RS31 3C3VA 4IL7A 3ZSEA 5ABJA 4YM2A 4HANA 1BJQA 1ZZ9A 4HZFA 2A3YA 2EVXA 4IERA 1C1LA 1DZQA 5IK7A 2DCTA 3WDVA 1O4YA 4Q4W1 3V0BB 4AEDC 4GKYA 4I3PA 4ORFA 4CP2A 4AI8A 5SV5A 1OD5A 4QGLA 4CEWB 1IS4A 2FZ1A 4WV8A 3E6BA 3M3CA 3RYKA 4META 1AVBA 5BV6A 5JZGA 4FOVA 5BNOC 1HV0A 1YYNA 4LUMA 4MGIE 2Q30A 5T3NA 4AI3A 5C9AA 2G4IA 5L19A 2WS93 3RI8A 2GC0A 2FMDA 4K1YA 2XBO3 4N90A 4S2FA 2QUOA 2VUJA 4YVWC 5JCTA 1RC6A 2D5FA 2GDFA 4AQTA 1Q5OA 2O1QA 2Q0AA 3SCGA 2E53A 3WZ1A 4QPIB 1YJLA 4K1ZA 1UU6A 1HRI1 3CNAA 4MH0E 4XBQA 4YGBA 3VBHA 5I8YA 3ZN6B 3H7YA 1O91A 4M01A 5E16A 1LECA 5A3MA 4DRRA 5FAXA 1K5MC 1BK1A 2H6BA 5L36A 2VMGA 4D7YA