2PQQA

Structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
147
Chain Sequence
GHMDDVLRRNPLFAALDDEQSAELRASMSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENMLAVVGPSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDAMLVFSDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative transcriptional regulator
publication title The crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2)
rcsb
source organism Streptomyces coelicolor a3(2)
total genus 34
structure length 147
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pqqA00
3E6DA 4LUMA 5D1IA 2WFPA 1ZZ9A 4J1WA 1ZZ7A 1EPZA 5FLIA 1RUOA 2UYBA 4KL1A 3RYPA 3SXWA 1LKNA 5BY5A 1H1IA 1SQ4A 1CAXA 1OMIA 4HBNA 4FBFA 4MV2A 2ET7A 5C8WA 2XL9A 3G7DA 2KXLA 1IPKA 4ONUA 3KGLA 2IXLA 2BNMA 4AVBA 3EQEA 3BU7A 3IWZA 3EBRA 1EY2A 5F1RA 4AVAA 1JUHA 3IBMA 4MUVA 3D0JA 3OD0A 4HVQA 3UKVA 3NKTA 1J3PA 3LA3A 1TQ5A 4IEYA 4ORFA 3CJXA 4YYOA 4AVCA 2CGPA 4IEWA 4I09A 2H6CA 3GYDA 4QX5A 2GU9A 2PYTA 3DKWA 3C3VA 3MDPA 1LR5A 1NE6A 4IESA 1QWRA 5JAXA 4F7ZA 5E16A 4UXAA 1O5LA 4BYYA 5K8SA 1I5ZA 4QXKA 2E9QA 5I8SA 2OPKA 3SMHA 4N9HA 1ZZBA 4XFGA 3QOPA 3H1MA 4WBBA 2Q30A 1J1LA 4IEZA 5I91A 1YFUA 2UY9A 3H3UA 2Q0AA 5FQ0B 3E6CC 2MHFA 2ATFA 2VECA 3MYXA 4KU7A 1RTVA 4QGNA 2PAEA 5FLHA 1LRHA 1J3RA 1EYBA 3EHKA 1ZNPA 3LWCA 4FT8A 4P9GA 2XLAA 3H1YA 2IXKA 3IIAA 2Y0OA 4QM8A 3QACA 3LA7A 4Q0VA 4EWDA 5J48A 2CAVA 1CAUA 4XFFA 1J58A 3L2HA 2OYZA 4O9EA 2PHLA 1QY4A 3HT1A 5BXXA 3MZHA 5CVRA 4MGZE 4META 3H50A 3BPZA 2PA7A 4PIXA 2IXHA 3NJZA 5AVPA 3OTFA 4QMAA 4LTAA 5BV6A 2XKOA 4JVAA 3NL1A 2GC1A 3LZZA 3U10A 4AQ6A 2PQQA 3CF6E 4MGKE 3FX3A 1SEFA 1HW5A 1X82A 2GZWA 4YRDA 5JSOA 3S7IA 3HIFA 1ZREA 2OZ6A 1UPIA 5JSRA 3WW4A 5EFUA 5E1RA 1RGSA 5LEKA 2P17A 2PTMA 3FE5A 1WLTA 4LEJA 4IEPA 1DGWA 5I93A 4XF1A 3OCPA 1EP0A 3PLQA 3LOIA 4X6RB 4QM9A 2XGXA 3RDIA 3IDCB 4MZUA 1UW8A 3RYRA 1UIJA 4UBGA 5FQ0A 5KHIA 1FXZA 5HI0A 4KU8A 2XHKA 2Z2SB 1NE4A 3N4MA 4D7TA 2B8MA 2Q4SA 4RD7A 3RNSA 5FCCA 1O3QA 4LUKA 1O5UA 5J3UA 4HSLA 1Q3EA 4HN0A 4AQ2A 4EWAA 1CX4A 1QXJA 3FHIB 4J1XA 1CGPA 2CAUA 3FZ3A 2D40A 2WC2A 3I54A 1O4TA 3H8UA 3H7JA 1CAWB 3O14A 1OFNA 1OD5A 4GULA 4IEXA 5KHKA 1RUNA 1UIKA 2H0VA 4EV0A 4AXOA 3ES1A 1Q43A 3NW4A 3SCFA 3ST7A 1J59A 1J3QA 4I0BA 3R6SA 3USSA 1ZZCA 1YLLA 4E2QA 1H1MA 1ZRCA 5C6CA 3FFQA 2GC2A 4MGIE 4Z82A 2BNNA 2O8QA 4K8FA 3TNQA 4XF9A 1WA4A 2EVXA 5LRSA 4IEOA 4B29A 1SFNA 3HT2A 1RC6A 4XF3A 1YFYA 3KGZA 4WZCA 1CAXB 4LA2A 3RPQA 4A2UA 3ZDSA 5JSPA 3JZVA 3RZZA 3E97A 2PAKA 3VHRA 3DL3A 5LRRA 1YWKA 5FDBA 1Y9QA 1UCXA 3E6BA 4LLOA 3PNAA 4YNIA 3H3ZA 4BIFA 3D0SA 5CADA 5JCTA 2XLFA 2MPFA 2BNOA 2EAAA 2H6BA 1ZZ8A 4F8AA 2XKPA 3WW1A 2K9ZA 4BH9A 3CO2A 2ZKLA 3UKNA 2I45A 3BALA 4KWJA 4JV4A 2D5FA 2QVSB 1GQGA 4HVRA 2BEOA 3H9AA 5I0UA 4I0AA 5I0SA 1X7NA 3HQXA 2ZCWA 1L3JA 1NXMA 3ACLA 5FPXA 1VR3A 1YFWA 3EJKA 5I8TA 1VJ2A 2VPVA 4UBHA 2HJIA 3SCHA 1DZTA 1O3SA 4IERA 5BUVA 4IEVA 4MH0E 4R8HA 2PFWA 1ZVFA 1V70A 4XF4A 1UD1A 5KHJA 2XL7A 5I0TA 5FLJA 5FPZA 3ROUA 3WW2A 4JTNA 4HMZA 1PMIA 1I6XA 1FT9A 4I01A 3CEWA 3I59B 1ZX5A 3SHRA 2Q1ZB 1X8EA 4NVPA 4XFCA 2IXJA 1ZRDA 4XF0A 2QNKA 4ZU7A 1CAVB 2OA2A 1WGPA 4X6QB 2O1QA 2DCTA 4LULA 3FJSA 2GC3A 2PHDA 2B5HA 3DN7A 1ZZ6A 2XLGA 3OF1A 4PIZA 4Q0UA 3KMHA 4XFBA 1CAUB 4MGYE 2UYAA 4MX3A 4Z07A 2OZJA 1DZRA 2IC1A 1LB2A 4HVOA 2Z69A 1ZRRA 4JTOA 3U0ZA 1O7FA 3NSTA 3S7EA 3ES4A 3RYKA 3I7DA 3IDBB 3BCWA 1O3RA 2PAMA 4OLLA 1FI2A 4PJYA 4CYDA 4EROA 4DINB 3LA2A 1GQHA 4IEQA 1IPJA 1DGRA 2FMYA 4BHPA 3FWEA 3E5UA 5J7MA 2QCSB 4O9GA 5T3NA 2BGCA 3DV8A 5KHGA 4Q0PA 4R52A 1XE8A 5BPXA 1ZRFA 4Q29A 2K0GA 4LA3A 1XE7A 2CV6A 4I02A 1G6NA 1O3TA 4HN1A 5KBFA 4I3PA 2ETEA 3MPBA 4FAHA 3BB6A 4OFGA 5JR7B 2IXIA 4L2NA 4FAGA 1OI6A 3WW3A 4PIYA 3H1WA 1NZCA 3B02A 2UY8A 4XETA 2QJVA 2F4PA 2GC0A 4Q0SA 5I0RA 4TLFA 2D5HA 2GH2A 5EZWA 4IETA 4E2GA 4XEZA 3UKTA 5CU1A 3I59A 2BYVE 4E2SA 2FQPA 4QGMA 4QGLA 4ZU4A 4HLTA 1CAVA 3NVCA 1NYWA 1Y3TA 3PVBB 4ZU5A 2QDRA 2ET1A 2N7GA 1YUDA 1QXRA 5KHHA 3LAGA 3M3IA 3GBFA 1XRUA 1VP6A 4WVZA 4HZFA 3M70A 4YSFA 2HKXA 3CLPA 4XFIA 2C0ZA 2D93A 4H7LA 3D82A 5LEJA 1U12A 2GAUA 4KWKA 1RL3A 2VQAA 4L11A 3ETQA 3S0MA 3EO6A 4YARA 5I8YA 2EA7A 2IXCA 4I2OA 1YHFA 1CAWA 3CL1A 1Q5OA 4HSJA 3KSCA 4EWEA 2V09A 3TNPB 3U11A 3ELNA 4Q0QA 2B9UA 3SCGA 1PM7A 3OGJA 2MNGA 4XFHA 4N9IA 4XFAA 1X8MA 4IEUA 1YFXA 3H7YA 4D7SA 3E5XA 3KCCA 3E5QA 4KWLA
chains in the Genus database with same CATH superfamily
3WF0A 4CDXB 2GNBA 1RUE3 2PMWB 3E6DA 1BBT2 3OY8A 1UZWA 1VAVA 3O1MA 2ZGQA 1ZZ9A 4DNYA 1URXA 4M4RA 2UWBA 4FXGB 4LMFA 2HWD1 2YBSA 3C7FA 2VOTA 2XUEA 1O91A 3AP5A 1GWMA 2BDRA 3AC0A 4PF1A 4GKXA 5C3PA 4BQ2A 1RUOA 1QJX3 3ALQA 4RQPC 1JYTA 2VY0A 5DG2A 2DUOA 1W8ZA 3EMRA 1QJU3 2X10A 3SQOA 3VZNA 5FZ9A 4H7MA 4J25A 5BY5A 1B09A 1E57A 1H8TC 3MF9A 4NIDA 2FDIA 1R1A1 2Q8OA 1DQ6A 4LXLA 4QX3A 1W6MB 2CU5A 4FBFA 4XCAA 1IQAA 1OA2A 4AEKA 2RS53 3U4XA 4RGAA 2XL9A 2VE1A 2VUJA 2WIIB 3AMQA 1JU3A 3M3OA 4CDXC 1IPKA 4ONUA 4Y1YA 3KGLA 2J1UA 1W03A 5J1XA 2JDAA 5DN2A 1CN1A 1LENA 1X9TA 3B00A 1GWLA 2WYSA 3Q8EA 5FYIA 3VBUA 3BU7A 3A7QA 2R1DA 1WBFA 1WW5A 2XBO2 2RM21 2XG3A 4AFAA 2CTVA 2BJSA 2YG0A 3JQWA 1IG3A 2ZX4A 3T4VA 5C3OA 2OPWA 2ZABA 4XBLA 4IV1B 3WINE 1OPOA 4KBZA 1TNRA 3LA3A 1TQ5A 4HL0A 1OH4A 3AX4A 1QOOA 4CVUA 1PNFA 5CNAA 2QQLA 2GNMA 1W8OA 3AP7A 3H42B 2VNVA 1JW6A 2PYTA 1LGCA 3PUAA 4FPYA 4XACA 2ZMLA 2ZZQA 3VBHB 2D6PA 4IESA 2BU9A 5T52A 1C8M2 4XBQA 1FOD2 4F7ZA 5E16A 1UU6A 1I5ZA 2NMNA 4QXKA 4ITCA 5LASA 4EN0A 2WRAA 1Q8SA 4N9HA 1ZZBA 4XFGA 2XHNA 4YW7A 1CX1A 4UW6A 4IEZA 3WQ1A 5I91A 4IV1C 5SV8A 2P4EA 2WL1A 3H3UA 3ZSKA 2P6CA 3MYXA 3I2KA 4D7YA 4CDWB 4QGNA 4CPBD 5J37A 5FZAA 3AFGA 1ULDA 4XIOA 5T5PA 1J3RA 1EYBA 1OPMA 5FXVA 2WS91 1SBDA 1W6OA 1ZNPA 5L7OA 1UQXA 4BJ0A 2E6VA 2XLAA 4UF0A 2IXKA 5LA0A 3VBHC 3BIEA 1J1TA 2ZPXA 2E53A 2JE7A 4LO6B 1LU1A 3R4DB 3QACA 1WLCA 2R071 3BUCA 2JD9A 2DFBA 1WKYA 2EIGA 2QQWA 2VAUA 4W6WA 3ZYRA 3GJAA 5FJKA 3I3BA 1UY1A 4XURA 5DUWA 2A6XA 4M0NA 1XSQA 2WO3A 3MZHA 5T50A 2UWAA 4MGZE 1NOVA 4CDWC 5CFCB 3H8OA 4BDVB 4RFRB 1RUE2 4AVVA 5IVCA 2PA7A 1NCQA 1JZ7A 3N9OA 3LOBA 5JXGA 3ZSMA 4QMAA 1RUH1 2O0OA 2WWJA 5BV6A 1V6OA 2EF6A 4DS0A 1CIYA 3RZHA 4WVMA 3RZGA 1AR72 3QD6A 5FZGA 5GZDA 3AYCA 2VZRA 3ZDVA 4QHZA 1N1VA 1QJX2 2GC1A 3RSJA 4GAZA 1OF3A 5C8CA 1QJU2 4OCTA 3OGVA 3FX3A 3AKRA 3VDBA 5BNQA 5C5UA 2XQRA 1X82A 5EHDA 3S6PA 1UU5A 4KGGA 5F8PA 4PF5A 1QH6A 3B01A 2R0HA 3SISA 5AFBA 3K4AA 3HIFA 1PVXA 1QJY2 1RXGA 3VDDB 2WN2A 3HN1A 4XZPA 3WD5A 1GZCA 1LOGA 3TAYA 2DUPA 5JSRA 3MLJA 3UK9A 1YXWA 3NV4A 5CFCC 2MEV2 1RMU1 1VBB1 5GLUA 1NAEA 3CJIB 1SCRA 1N3OA 4YW6A 1NA1A 3I2GA 1US3A 3AFKA 2HYKA 2X5IB 1GQPA 1WLTA 3OBTA 4V2VA 1V6MA 3T08A 3WW3A 4CUCA 1VMHA 3WG1A 2D3SA 3BYWA 5DZEA 5I93A 1IPSA 4XQDA 4JRAA 1W6NA 4AG4A 4LOTA 4TWTA 3RDIA 2VOXA 4P14A 4LE3A 2JDZA 3IPVA 1UW8A 1GNZA 2A7AA 4L99A 1UIJA 4UBGA 5A7NA 3RYRA 1V9U2 4YZ3A 5HCBA 4YZ4A 3VDDC 2HWB3 2X53S 2XHKA 2Y8KA 4KH9A 1N1YA 4YW1A 3WQBA 2R073 5LBCA 3OGRA 3R4UA 2RVAA 1J84A 2ZA9A 1AR81 3CJIC 3KT4A 1RITA 4IV3B 5CEHA 4PBPA 1XB9A 4YW4A 2XJPA 4LUKA 2JDYA 3ZFGA 3PL0A 2X5IC 5LA2A 1Q3EA 4OULA 2BRTA 1LOFC 3SKJE 2ZJCA 4HN0A 4EWAA 1QXJA 3FHIB 3IZOA 5FBJA 4DXSA 3AMMA 3I54A 4BLIA 2JDNA 4N90A 3H7JA 3HAGA 3NKGA 3O14A 4RGGA 5FMDA 4AI0A 1UY4A 1T6BX 1DLCA 4IEXA 1RUNA 2UU8A 1ULEA 1UIKA 3K46A 4BB3A 1G9CA 3PJYA 1SDWA 2BWAA 3SCFA 1WCKA 2WAOA 3IIIA 2GDFA 1HRI3 4GJYA 1QKQA 4B4PA 3ST7A 4Z92B 4RQPA 2XMLA 1KDMA 2WBKA 4IV3C 3K2OA 4FFGA 5L9RA 1PGW1 4OQ9A 2ZMNA 1H8TA 5C5TA 1NXD1 1VRH3 4LOSA 1ZZCA 2NLRA 1YLLA 1GYKA 1COV2 1H1MA 1H2LA 3ZXAC 4QQPA 4B4QA 1ZRCA 4YW3A 2GC2A 5FZ6A 1V6KA 5JOZA 4QAWA 4D0QA 4XF9A 1F15A 5IVEA 3POEA 4XCBA 2NP0A 2EVXA 1SPPA 1YJLA 4OZOA 2VMGA 3ME2A 1YQ6A 3I2DA 3VBOA 4SBVA 4B29A 5FWJA 2QE3A 1C1LA 1W9SA 4XDPA 3MIDA 1YFYA 3T0BA 1QF3A 1JHNA 3OD4A 4N43A 4QKBA 2KR2A 4QPGB 3RZKA 4P02B 4PLMA 3RPQA 1KFUL 2JG9C 4IE5A 3PUQA 3JZVA 4A6SA 2XJQA 2PAKA 2SLIA 3NNMA 4IGPA 1NLRA 4LQRA 3W5MA 5FDBA 1VIWB 4WM7A 5FYZA 4E4DX 1RUJ3 5A6XA 1OOPB 3VKLA 3D0SA 4KBBA 5M0TA 2XWJB 1GLHA 4YZ2A 5L19A 2R49A 5CADA 4CZSA 1G9BA 1HB4A 5AC91 2DBIA 3QCWA 1FPN1 2ADDA 2DCZA 3MGUA 4CU9A 3RRDA 1V6NA 4YM1A 3O12A 3POSA 2Y64A 2YB7A 2ZX2A 4Q4X3 3J8F3 2A1XA 1UNBA 1V6LA 2YPJA 1MR5A 2C4XA 3DYPA 5F2SA 3V65A 3FHAA 4QPGC 5JXJA 2BEOA 3ZN6B 1VRBA 5I0UA 4OUEA 2QQKA 5FP9A 1UOGA 1L3JA 4RHV3 1FMD1 2DFCA 1VR3A 4OUMA 5FIXA 3I3MA 5F2WA 1YFWA 3EJKA 4AFCA 1WWYA 1VJ2A 2TNFA 3J7NA 5GZGA 5A3MA 2NPIA 5GM0A 1OOPC 2VUAA 4YG3A 2JICA 4GMP1 3IAPA 1O3SA 1QDCA 3OUIA 4IERA 4F3JA 4GKYA 3KD4A 2OX0A 4R8HA 1LECA 2RDRA 4GALA 5KHJA 2XVLA 1XYOA 5IVFA 4MGTA 4MVTA 1RHI3 2P3KA 3ZFGC 4HK9A 2ZGTA 2RG4A 3NMBA 4D8MA 5D8AA 4FOWA 4HMZA 3GJBA 3O0WA 3IB3A 5F39A 2BVBA 2C26A 2HWB2 3VBHA 2EXKA 3I59B 4YM2A 5FP4A 2Q1ZB 3BGAA 3SHRA 3FN9A 4MXWA 3WDWA 4KMQA 3T30A 5A3TA 4XF0A 3UNPA 1S2KA 3U1XA 3VBFB 2WFF1 5FZDA 1BMV1 1MS9A 1WGPA 1XXNA 2ZKNA 4RR3A 4AYUA 4EE2A 4LULA 4EZ4A 2YFUA 2V4AA 3TEXA 4QB2A 1C4RA 1EPWA 5FYYA 3VHNA 4TYSA 5FZLA 1GOHA 1Z7S3 4MXVA 4Y24A 5A7QA 2H0BA 4B8EA 1AUYA 3DN7A 5GALA 2B4KA 4AI8A 4PIZA 4DXTA 1AL0G 4UFMA 3VLBB 1NCRC 2PQSA 2XJVA 2VMEA 5JDBA 2P3YA 3ZSEA 4NUBA 4AHZA 2UYAA 2VMIA 2XWBB 3CMGA 2JEMA 3BOWA 4LPLA 1UKRA 3O1SA 1FPN3 4A42A 4C0BA 1SACA 2XJRA 4HVOA 1HRI2 1ZRRA 4EN7B 1O7FA 1E5IA 2VZVA 4MHUA 1BEV1 4K8RB 3VBFC 3ES4A 4R4ZA 3RYKA 1MACA 3D5OA 4FPOB 4QDRA 3I7DA 3WY6A 3BCWA 4B1MA 1VRH2 3J7LA 4RS5B 4ZS3A 1O8PA 3K48A 2QQNA 1L7LA 3LKJA 4R9DA 4DINB 5FUNA 2XXZA 2WDBA 3LEGA 3RJRA 4IEQA 1IPJA 4BA6A 2FDGA 3VD4A 4LBQD 2QCSB 1VBD2 4O9GA 1KITA 2ZGLA 4Q0PA 4R52A 5BPXA 5DDJ1 3UV9A 4AW7A 1C5IA 1BK0A 1W8FA 4R9AA 4LA3A 3N7KA 2FMDA 3VD5A 1HXS1 5APAA 1O3TA 5A1LA 5KBFA 1KXGA 1HB2A 1S1AA 2ETEA 4GB33 5FRAA 3RZLA 3BB6A 2WAAA 2VTXA 4W4ZA 1RUI3 1ZM1A 1RUJ2 4LBNA 5F6KA 4L2NA 4S2HA 1OI6A 4JDOA 1NZCA 3GBGA 2UY8A 3NNLA 1TME1 5J96B 1KQRA 1TE1B 2GC0A 3V0AA 5EIYB 2WZR3 2JDHA 2D5HA 1DCSA 1YJKA 2WFF3 3KQ4B 3PURA 4PLNA 5LK5A 3LPFA 4COWA 2QFEA 2XOMA 3WDUA 3RZMA 1F4AA 1ZBE3 1WZXA 2R062 3ZYPA 4K1ZA 1PO23 4OYUA 2BYVE 5IYYA 1TVGA 3RWNA 5JOYA 3N9LA 1GANA 4XJAA 3MW4A 4XDOA 3I49A 2CHHA 4RHV2 1D0HA 1S2EA 3MO4A 3LEKA 2XH6A 1R082 1Y3TA 1Q8VA 3AJZA 4AR2A 4ATEA 3GGLA 4AL9A 3VBUB 3KM5A 4ZU5A 4CP9A 3PU8A 5FZ8A 3K4DA 4BXSV 1YUDA 1WMFA 2KM2A 1QXRA 1JS9A 1ODNA 3EB7A 1CZSA 1RUC3 1PO13 1TZOA 1RUD3 2ARCA 2Z42A 4GQ7A 5A7OA 3C2UA 3U4SA 2ADEA 3KLSA 3M3IA 5CB7A 1UX7A 4Y1XA 3ASIA 1RINA 1PX4A 4LKEA 4WVZA 1RHI2 3M70A 4YSFA 5IK5A 1D4M3 3PIJA 1S0EA 4P9LA 4BZ4A 2VOKA 2YYOA 5JZGB 3FBMA 2C0ZA 2D93A 4QPIA 4MG2A 4H7LA 1XJAA 5LEJA 1NY71 4OZXA 2DUQA 4P5YA 1PGSA 1W0NA 1AL23 2BUKA 5E8AA 2PHXA 3WZ1A 2WNUA 4L11A 3GCXA 3FLPA 3EO6A 4MSVA 4P9WA 2OIIA 5F9TA 1ULCA 3VBUC 4A41A 1R1ZA 2VBBA 3CL1A 5FK8A 3BPSA 4LKFA 1F31A 4AGVA 5FZMA 3RMXA 3KSCA 4PLOA 4Y3OA 1JI6A 2V09A 3U11A 3ZXDA 1HXS3 4LLFA 1PM7A 2VBDA 4H14A 3V64A 3ZXEA 2MNGA 2RJKA 2VVEA 2WSUA 4FPLA 5IVVA 5JMCA 4CEWA 4B3NA 4XFAA 3VZJA 1QQP1 1XNAA 1POV3 1VBE2 1YFXA 2GMEA 3D6EA 4GD4A 4HKOA 4IEUA 4NPRA 5FUPA 2XPJA 3E5QA 3P1IA 2ZHKA 4KWLA 1SLAA 2VVFA 3HBKA 1WUVA 3Q8BA 4K7JA 4AQSA 3C7GA 4LUMA 5DG1A 4FFIA 1S0JA 1W6OB 4NAMA 5C3SA 5L7OB 4A4AA 4LKDA 1UYXA 1C28A 1ZZ7A 2HWF3 2Q1MA 4FOVA 1KD7A 1PVC3 5A3LA 4CSWA 4FSJA 2XBO1 2UYBA 5ACA1 1D7PM 1N3PA 3RYPA 1JUIA 2WZPP 3SXWA 2B46X 1XNKA 1LKNA 5T54A 3HQRA 4LE4A 1H4HA 1H1IA 3HBZA 4ZKTB 1UYYA 3OGGA 3ZXLA 1H8VA 1OMIA 4HBNA 3LIHA 1VMFA 5JWPA 4QHBA 1PGL1 4MV2A 4CXWA 1AZDA 5DAVA 3OPZA 1MS4A 3AZVA 5ERLA 2W92A 1GICA 1SLIA 3M3QA 4GMP0 1NCQB 3POBA 2I74A 3ZYFA 3IKWA 5L7OC 1QU0A 1W9YA 2VXJA 4UT5A 2WSVA 4WVMB 4GB32 4AQTA 2BNMA 4K21A 1ACCA 3JD72 4XJUA 1OQDA 3EQEA 4QXBA 3HMYA 1B35A 5J98B 1XQNA 1SHWB 3EBRA 4C8DA 2HWE2 4COUA 3JBG3 1ND2B 3URFA 4BXFA 1W3XA 2IFRA 4Y33A 5C8CB 1JYNA 5FYTA 1GP5A 4YW2A 3U78A 1MEC3 1E5HA 3L2YA 1SG3A 1YC61 4ZXKA 2WZR2 4MUVA 1DF0A 5AVAA 5EJZB 5GLTA 3WDTA 3N35A 2VULA 3ZN6A 2GP3A 3NKTA 3SLIA 3GM8A 2RMU3 4IEYA 4ORFA 2C9KA 1DYKA 4AVCA 1ZBE2 4IEWA 2FZ2A 2J7MA 2RR11 4ZZ8A 3T4HB 2BZDA 1PO22 3O7OA 2GSYA 1NCQC 4CEYA 3MDPA 3GDBA 5FZ3A 4YPJA 1NA1B 1OD3A 4CDQA 5B4NA 4LK6A 1JZ6A 3BTAA 4LBLA 4BYYA 2ZGOA 2BW8A 4NHLA 5I8SA 3WCRA 1KJLA 5FZ4A 4P9XA 2E7QA 2OPKA 1ND2C 3N9QA 5C8CC 1PO12 1RUD2 3DPRA 3OB8A 3QOPA 1J1LA 1UZ0A 4ZXEA 5FV3A 4YZ1A 1DGLA 2UY9A 2YFZA 3IPVB 4MHRA 3E6CC 4L92A 1F5FA 2J1TA 3WF4A 1EUUA 5KC5A 1AYM3 1OF4A 5FLHA 1LGBA 5JLVA 1MS3A 5LCWL 4OI4A 5H9SA 5F5CA 4QXCA 1US2A 4P08A 1PZ9A 1O59A 4NHYA 4P9GA 1AL22 5DZGA 1VBC2 3H1YA 5GLZA 1NA1C 1AR71 2A6WA 3THTA 4Q4V1 4QM8A 3AXEA 3N9NA 5JMOA 1UPSA 2YU1A 1XYPA 1AX0A 1LOBA 2B39A 4XDQA 1EUTA 1POQA 2RS13 1J58A 3BN6A 5FO8B 4Q1RA 4XTPA 4O9EA 4AZZA 3HT1A 4Z1VA 2L9LA 1GOGA 1D0GA 1H2MA 3A0KA 5B2GB 1QJY1 4M01A 5CVRA 3NNFA 4ZPIA 2WA4A 3ACFA 4QHOA 1RUF3 3H50A 2BBVA 3GALA 3T0AA 2WQ8A 3BPZA 5FJHA 4PIXA 3WNKA 1W6QA 2LALA 2D97A 3OTFA 4RS5A 1QGLA 4LTAA 4QX1A 3BTYA 1N3QA 2XKOA 3VL9A 3POFA 2HWF2 2IZWA 1OUSA 1ALYA 2J1SA 1EAH3 3MFCA 3P6BA 4R9BA 4LIUA 3FMGA 1TMF2 3BOPA 3B9CA 4IQPA 3NO8A 1DHKB 2ZGPA 3UYJA 4AQ6A 2IUWA 2J1EA 1S55A 2EALA 2J22A 2PHWA 4NPLA 2VUCA 4QKNA 3THDA 3TOJA 2XJUA 3DGTA 1CPNA 3W58A 1HW5A 2GZWA 1DIWA 1SPPB 2KA3A 3GXUA 1OQEA 3CZUA 4HK8A 4NAOA 5JSOA 3ZR5A 2ARAA 3VBOB 3BI3A 1UOJA 1W6PB 4AGGA 1OFSA 2OZ6A 4N43B 5FZ0A 2WUHA 4A3ZA 2B7YA 3WW4A 5EFUA 2QTWB 4P9IA 5IK8A 3AJYA 4D3WA 2UWCA 1GZTA 2R32A 5FZEA 1H0BA 1K12A 3PTRB 5F3EA 3TYJA 4ES8A 4WM7B 2YROA 1A78A 1CD3G 4YFZA 1ASJ2 1BQPA 2NYYA 4DXZA 4DY5A 1O4YA 3HD8B 4Q4W2 3I2FA 1EP0A 3U07A 2RS31 3PLQA 3LOIA 4X6RB 4Y4RA 1PIV2 1VBA3 2ILMA 1N47A 2XGXA 4FOQA 5DUXA 5B4XA 4MZUA 2F17A 4V1PA 1W8HA 4CCMA 3AZYA 1SBEA 4L8QA 5FQ0A 4E8CA 3VBOC 3MW3A 5A32A 1GNYA 2RMU2 1HJGA 1FV2A 4JDMA 1JN2P 4N43C 5A80A 1JYWA 1WW7A 4M4PA 4Q1PA 2ZMKA 4D7TA 2VC9A 3ILFA 4JKLA 2B8MA 1CJPA 3GZAA 3M3CA 4RD7A 3BVCA 4Y1VA 5FXZA 1O3QA 2ZAAA 3RQ0A 4WM7C 1DBNA 1HRV1 1W2OA 3CBNA 4IXLA 3WNNA 3W5NA 1JODA 1COV1 3ZN4A 2AH2A 1EV13 2JIGA 4YM3A 3VZMA 3J26N 1CX4A 4DB5A 3SEPA 1YRZA 3FZ3A 4DRRA 2GMPA 1DG6A 3POYA 2Q5TA 4Q4Y1 1O4TA 4CUBA 1RVF3 5JZGA 2FCTA 4QPWA 4F83A 5DAPA 5D8AB 2HEYF 5F32A 4CP1A 3NNGA 4EV0A 2V73A 1AYM2 1M06G 4QX0A 3NW4A 2FCUA 5A3PA 4MXWB 2ZHMA 4FPHA 2R1BA 1SZBA 5DAXA 3LFIA 5ISLA 3NNJA 4ASMB 2D44A 3MIHA 4NIGA 3R6SA 2B9VA 2XDVA 1W8TA 2W94A 4RR3B 5FZIA 4BOWA 2ZGRA 5C6CA 2AEZA 4MGIE 2HWD3 4TLGA 2W39A 1IS6A 3AKSA 3U37A 3WHUA 4K8FA 3TNQA 3WNOA 4CCEA 4CPBA 4D69A 2JKXA 5LA9A 3WDVA 4IEOA 4YGCA 2WINB 4JAAA 1K5MA 1FX5A 4YVWA 4FTEA 1R1A3 1RC6A 1V6JA 5IAVA 5D8AC 4WZCA 1CAXB 2QQJA 3M3EA 4PBOA 1NLSA 4DRVA 1RUF2 2P1BA 2ZEYA 2HWC2 5G05L 1Y9MA 4PCRA 3ZDSA 1I1EA 1PMJX 2VGDA 2JB8A 2X29A 4URTA 3E97A 3OOXA 5LRRA 1YWKA 1Y9QA 1UCXA 3S5AA 4FTBA 4XBNA 5FMOL 4YNIA 3UESA 1EAH2 2W9XA 4NWVA 4I30A 4QWNA 4BQXA 2B45X 4DUVA 4RR3C 2AZ5A 5T5JA 1W99A 4S2FA 5DPNA 4JRLA 3K75B 4OVEA 1JOPA 5FY8A 2EAAA 2H6BA 3OBAA 1JOJA 1ZZ8A 2XKPA 4Q2FA 2K9ZA 2RM23 3CO2A 2YPDA 1LGNA 4B7KA 5FBZA 3UKNA 2JDPA 1OLRA 3K3OA 3WXPA 3HNBM 1DZQA 1U5ZA 3AP4A 1MQTA 3MI8A 4KWJA 1OKOA 3KQRA 3NV3A 3O0XA 4R4XA 1W0PA 3H9AA 2NMOA 1NLQA 5I0SA 2CGNA 1KS4A 1X7NA 2ZCWA 4LBMA 1Z78A 2VH9A 5FYCA 1DQ0A 1ND2A 2WT0A 2YC4A 3IDAA 4UBHA 4WM8A 2HJIA 2Y6LA 3I4IA 1CR7A 4KNCA 3RS6A 5BNPA 1UOFA 1C8NA 2FDJA 1G86A 5JUVA 4IEVA 3RWKX 1YNAA 1CONA 2G19A 4MH0E 2CDOA 4KWUA 2VO5A 3LPGA 3V0AB 1VBA2 4QQOA 4XF4A 1IS4A 2RS52 2WZEA 1V0AA 4DQAA 2R041 4NE9A 2GNTA 3ROUA 2CNAA 1DQ5A 1XBFA 3T2TA 3T3YA 1I6XA 3FLRA 5LWBA 3U75A 1WD4A 3KVAA 4COVA 3ZO0B 2JJ6A 3HPNA 1X8EA 1BJQA 2A70A 3ACHA 3PU3A 4NVPA 5FZHA 3ZYBA 2A6VA 2BOJA 3ZSLA 1HIXA 1Y7BA 1LHUA 2C9AA 5IVYA 1UXXX 4E9KA 3VDAA 2OA2A 1D2SA 2WS93 3FFZA 3R4SA 1XU1A 4CP9B 1GFF2 4UI9L 1SFPA 2O1QA 3NV2A 4NRMA 5IFTA 2DCTA 1OVSA 4AHXA 1EV12 5JIAA 3I2IA 3O1OA 4IL7A 1F2NA 1WCDJ 2WLPA 3FJSA 2GALA 5CIRA 2VZUA 2B5HA 1VBD1 1RVF2 3OF1A 2P37A 4Q0UA 4LIVA 4OHWA 5EWSA 3WX5A 4HKWA 2QQMA 2ZX1A 2Y38A 4MX3A 4CUAA 4Y5Z0 4QPIB 2FHRA 1R091 3HWJA 2D98A 4HKLA 2Z69A 2BPA2 3U0ZA 4AAPA 4G4FA 2QQVA 1RXFA 2K46A 2WNUB 3ILRA 4BIOA 1WCUA 4QU1A 4CP2A 3GCWA 1QMJA 1RUH3 4PJYA 2V5DA 4FI9A 4YZ5A 5GZCA 2Y60A 3LA2A 4QKFA 4RL7A 1QXPA 1DDLA 3PMEA 5GKAC 1GMMA 5LBFA 2FMYA 2DBNA 4CRQA 3FWEA 2CGOA 2JB4A 2Q1FA 5J7MA 5BNNA 2BGCA 3DV8A 5KHGA 4JGYA 2PELA 1DYPA 4CEWB 4RA0A 3KHCA 1JXNA 4A6OA 3I3DA 3T09A 1UY3A 1R1A2 2CL2A 2R061 3WLUA 1MZ5A 3RGBA 2J1AA 1LHWA 1CWPA 4QPIC 4AFDA 1WW6A 2K0GA 2CV6A 3HQUA 3AYDA 4I02A 3S5QA 4JCKA 1KFXL 4YM0A 2Y26A 2R043 1R081 1RMU3 1VBB3 2PLV1 2WNUC 4NOTA 1GU3A 1H30A 5A3OA 1BVVA 3LQCA 5JR7B 4FAGA 1SDDB 3POJA 4D94A 3Q9OA 4PIYA 2XVGA 3H1WA 1NG0A 3B02A 3JCIA 2Y33A 2ZAHA 1BLZA 2JECA 2WWUA 2QJVA 4RYDA 4XETA 2F4PA 1W6PA 5DXDA 1GP4A 4HG6B 4TLFA 3VD3A 4LT5A 3ZFEA 1JZ5A 4E2GA 2RM22 1DYOA 1LCLA 1OVPA 3GNEA 4XEZA 4CEWC 3GHNA 3VL8A 3TEWA 3B9IA 3JUUA 1HX6A 1LAJA 4NN0A 5A70A 3OBRA 1FNZA 4RGKA 4E2SA 4GZ9A 2R0FA 2ZGKA 4ZU4A 2G9FA 4HLTA 1CAVA 3AP6A 1YQCA 2W47A 1VE0A 1AR83 1H9PA 5F37A 1B35B 2NQYA 2QDRA 5FUIA 3VBRB 5F3CA 2A71A 3TN91 3A4UA 1KJRA 2D6MA 2WO2A 1UMHA 2LW8A 2J1RA 1JYCA 5FY5A 5KXBA 3AL5A 1S0FA 3AM2A 4HZFA 5FOBB 1VBE1 4M3CB 2OW4A 1G9DA 4TXWA 5F3GA 2HKXA 1LTEA 2P3JA 4XFIA 1BVP1 3LSEA 3VD9A 5FYVA 1JTZX 3W59A 3O1VA 4CEYB 1U12A 2EXIA 2VCAA 2GAUA 3M1HA 1YQ2A 1H6XA 3WP4A 3C7HA 4DZGA 5FXWA 4CDQB 1E5SA 3S0MA 5G04L 2EICA 5FP7A 3O5SA 4I2OA 3ZOIA 2VQTA 3TWIA 1B35C 3J7HA 4FQ4A 3VBRC 4CXYA 3M2MA 4BISA 3MHZA 2ZZJA 2SBAA 3DPRB 3AVSA 1AR91 2B9UA 2EIBA 5A3WA 1QIQA 4Y5SA 4YGBA 3GF6A 2R072 4XUQA 4N9IA 4Q8LA 4D7SA 3E5XA 3KCCA 3OG2A 1WBLA 2VD7A 4P9YA 1ZRDA 2JDKA 3SC7X 1XOYA 3B3QE 5DZFA 5A7PA 5DAWA 2NZ9A 2WFPA 5CBLA 1YQ5A 4O61A 5E88A 4G3YC 4CEYC 2VW2A 1PNGA 5LB6A 2TEPA 1WLWA 5FLIA 2QBXA 4CDQC 4JGZA 1HN0A 2E51A 1BXHA 2YC2A 3AB0A 1WMDA 4KL1A 3ZLIA 1RUH2 1O8SA 2G1MA 2WNVA 4XZUG 4UFIA 1LHOA 1SQ4A 1UMZA 2YDEA 2VNRA 3DPRC 4LJHA 1RUG1 1CAXA 4XJZA 3RI9A 3ZFFB 5AC93 1ZBA1 3WCSA 4CCLA 1AX1A 3ZYIB 3OYWA 3M8LA 2A3YA 1VLNA 2G4IA 4XUNA 4Q8KA 4CCDA 1T2XA 5T5LA 3FUQA 5C8WA 4PDWB 3I2HA 3ON7A 1HQWA 2JXAA 2DTWA 5K0UA 1IS3A 2KXLA 4CXXA 1W6QB 2YBPA 2LS6A 2D7FA 5HCHA 3RI8A 1TG7A 3CZJA 1STMA 1VMJA 5IHRA 1O6UA 3OUHA 5FZ7A 4AAXA 3WG3A 1F35A 3POIA 4XUPA 4ZS2A 4Y4YA 2OVUA 1FMD3 3A23A 4MGSA 2RJLA 1EY2A 1W2NA 2VNOA 3DKQA 2E26A 3SEEA 2QQIA 2FZ1A 3THPA 4DUWA 1RJ7A 5F1RA 2FDHA 1JUHA 4NHXA 4GMP3 4OHVA 3AZZA 3SH5A 1AR61 2YY1A 2OQ7A 2Z5WA 2VW1A 3N36A 4NO4A 4RN5A 1I3HA 4AFBA 3CJXA 4YYOA 3IMNA 2HBTA 4PI0A 4S2DA 4XPVA 4Z8BA 4I09A 4PDWC 4OI2A 2VG9A 4QX5A 2W95A 1X50A 4XQWA 1LEDA 1RJ8A 4IE7A 1YI7A 2JKBA 5C9AA 1AR93 4RS5C 3KHBA 3NQHA 4XMIA 3WF3A 1LR5A 1VBC1 1NE6A 1OHFA 1Y43B 5FZ1A 1HKDA 2F6BA 2HLEA 1OT5A 4LO8A 5JAXA 4X8NA 1O5LA 1AR82 1F9KA 1OLQA 1PK6A 2CYFA 3E1F1 5K8SA 4D6QA 2E9QA 2P5BA 3ECQA 1UXZA 4KG8A 1PMHX 2JIJA 3UL2A 4DEVA 3AYEA 3JB4C 3MICA 4XUTA 5L9BA 4G9SB 3WEZA 5KXDA 4HT1T 3H1MA 3ETPA 4MADA 4Q4X2 3J8F2 4WBBA 2ZOEB 2ZX3A 3ZPYA 5KWRA 3DF0A 5A6ZA 2Q0AA 5FQ0B 2MHFA 2ATFA 5A32B 4KU7A 3ZM8A 5CKQA 1RTVA 3WQ7A 2DDUA 1UMIA 2XVKA 2CY6A 1GWKA 4ZY9A 1IS5A 4E4SA 1S4CA 4AI2A 1XC6A 3F95A 3EHKA 1JZ3A 3PHMA 4YLZA 4EN8B 3LWCA 4FT8A 3ZR6A 1PZ7A 2ZX0A 5GJ6A 2VTFA 2Y0OA 2XB6C 5CG8A 3CDZB 2E7AA 1BYHA 1BEV3 1WCQA 1H4GA 2WT1A 3LA7A 2VCCA 1AYN1 3CKHA 1PGW2 4PQQA 4EWDA 3WT3A 2CAVA 4RFT0 2OYZA 3KWVA 5C3RA 2Y6GA 3KT7A 2PHLA 1AHSA 1BBT1 1UU4A 3LEMA 5BXXA 4UAPA 1QOSA 5FZOA 2WNEA 5EXOA 2VZOA 5JXHA 5FY4A 3KV4A 3UGHA 2IVJA 4AVSA 1XYNA 4FCAA 1ND3A 5DDJ3 5EP9A 1ODMA 5DMYA 4BQ5A 3QBQA 1Q8QA 1Z0HA 1GNHA 4JQRA 5IT6A 4W65A 5LZ6A 2WLQA 5GLWA 4B1LA 2I07B 5LATA 1C5HA 3NL1A 1MS0A 5IFPA 1ASJ1 1HLCA 4PT6A 3N9MA 4BQYA 1Z7S2 4WVWA 3VKOA 2DCYA 4FO9A 3H8XA 4Q4W1 1IKPA 5LY2A 4NIIA 3LZZA 3U10A 5DABA 4OUSA 1PIV1 1YIPA 1DGWX 2PQQA 4MGKE 3O0VA 1S2BA 4J6GA 3WP6A 5IVBA 1W0OA 2BWCA 3V56A 5JZGC 3S7IA 5AC92 1DFQA 1GV9A 1K5MB 1FPN2 1TME3 4XVHA 4YVWB 3WV6A 4CDUB 2LM3A 3ZSJA 1ZREA 4JC1A 2VUDA 4CU6A 1DU3D 1YYNA 2Y34A 1SLTA 1VB2A 2D43A 5LW9A 5E1RA 1RGSA 3ILNA 5HCFA 5F5QA 2ZS6B 3AYAA 3QH6A 5LEKA 2P17A 2PTMA 4MLOA 3MUZ1 4FPGA 1RYYA 3WP5A 4YG0A 3FL7A 4IEPA 3TEZA 4AEDB 3ZFFA 5K4LA 1FMD2 3O1RA 2FDKA 2D3RA 4GH4A 4ET7A 4URAA 1PM4A 4W8JA 2JE8A 3IDCB 5H9QA 1HV0A 5FXXA 1AXZA 2DU1A 2VU9A 4NHMA 1K5MC 4GIQA 4YVWC 5FO7B 5C33A 2RHPA 1MZFA 1LESA 1W2TA 4K6BA 4CDUC 5HI0A 1MQTB 3FHQA 4C1XA 3FC0A 1CJDA 4MOAA 3V0BB 5A7WB 1C8M1 4LNVA 3N4MA 3MIBA 1FOD1 2VR4A 1RUI2 1FNYA 4XUOA 5GLVA 3C8XA 2Q4SA 3ZN5A 5FCCA 3VBRA 5JXIA 5HPOA 1BBT3 2E7TA 2WO7A 1O5UA 5FKCA 1SMVA 5FY9A 3WSOA 4HSLA 4WM8B 3O1TA 2D6LX 3IAQA 5F5IA 2YMZA 5BNPB 3PMSA 1HV1A 3MV11 4AQ2A 4Y1UA 2WFF2 3T2QA 1K45A 2WN3A 1QEXA 1WLDA 4M3CA 2WC2A 5L9VA 3H8UA 2HYXA 1CAWB 3J7MA 2B42B 1KDKA 1JU4A 1UWWA 3AMPA 4KGQA 5F3IA 5A33A 1OD5A 4ATFA 5A3UA 4K1YA 1JOBA 5C4WA 2H0VA 2HEWF 2A5ZA 4JDNA 4C91A 1MQTC 2A75A 1LJ7A 3I8TA 1QQP3 1GP6A 1J59A 3IM0A 2C24A 4DPNA 5ABJA 3PDQA 4I0BA 4IE0A 3PVNA 4NHKA 4QQHA 4GJZA 3TB0A 3B7MA 1RUC2 5A6QA 4E2QA 3PUHA 4U36A 1F4HA 4WM8C 5FZCA 3WG4A 2D3PA 4XQ4A 1VAKA 5BNPC 4Z82A 1X36A 2BNNA 2O8QA 4RSUA 4HXCA 2TBVA 4U2AA 2QDNA 2O8OA 1D4M2 2XBO3 5ACA3 3NWKA 2VOVA 3NRUA 4X8PA 5LRSA 2JE9A 1RUE1 1VPHA 1SFNA 4K3UA 2R16A 1A6CA 4AGRA 5BNOA 3AMNA 1BHGA 2BP6A 4PQ9A 5IW0A 3ATGA 4LA2A 4BE3A 5T55A 2IFWA 5EYXA 2VTXJ 2DU0A 5JSPA 2DTYA 5DDJ2 4ASLA 1QJX1 4HPKA 1UX6A 3VHRA 4BLJA 3DL3A 3GZTB 4MGQA 3LDBA 5A1AA 1QJU1 5K7PA 3E6BA 1QOTA 4TTGA 1UY0A 2VVDA 2RDQA 3PNAA 3H3ZA 4LLOA 5FZBA 5FY0A 2TUNA 2HBUA 4Y20A 4AEMA 4BIFA 4OQ8A 2VCMA 1HXS2 4IW3A 5H9PA 1LHNA 3I97A 3WNPA 4D6SA 5JCTA 5CG9A 2VMHA 2XLFA 2Y6KA 4A7YA 1HDKA 1ULPA 1FOD3 2R6QA 1U0AA 2ARBA 1W9WA 2VZ1A 3J9SA 3WW1A 4PDWA 2GN7A 2RS51 4BH9A 2UURA 5BNNB 2MEV1 4JGYB 2AACA 2I45A 3BALA 1NUKA 5FMOS 3VBSA 4W6YA 3EYPA 2I2SA 2D5FA 4CUGA 5HXVA 4CCCA 1PVC2 2EAKA 2QUOA 4I0AA 1PZ8A 4QT6A 3BIWE 5FREA 3RVHA 1X9PA 3B69A 1ULGA 2RR13 2W08A 2WA3A 3ACLA 3A22A 3CHXA 3ITQA 4UOJA 4E8DA 2ZHNA 3C7OA 3QLQA 4R9CA 5FPBA 5TSWA 3VHPA 4EN9B 2VPVA 5I8TA 3SCHA 5FP3A 3OEAA 1JHJA 5E6HA 1AXKA 1DZTA 2VZQA 4QQLA 1V9U1 1MVEA 2PFWA 1OH3A 4AI9A 1REDA 1G9AA 3ZFEB 2XL7A 1Y9GA 3J4UH 2CDPA 2JWPA 4OMDA 5FLJA 5BNNC 3W9AA 3P3PA 4JGYC 4K9SA 4JTNA 3WW2A 2ID4A 4BQ1A 1FT9A 4I01A 1S0BA 4O7XA 4NIHA 1NQDA 1IGOA 1ZX5A 2BFUL 3AXDA 3FBYA 3DYOA 2GH8A 4XE9A 3WP3A 3D8CA 2QNKA 4ZU7A 1CAVB 3POWA 3F2ZA 3JBG2 1Q8PA 3LCPA 1NY72 2AREA 1QJFA 1MEC2 2EIEA 4X6QB 3WQ0A 1OXCA 5FAXA 1UL9A 3MIEA 2CWMA 1AR73 2OS2A 1LEMA 4Q4V3 2GN3A 5EV7A 2YXSA 4BK5A 5J36A 2XLGA 3VUOA 3ZFEC 3KMHA 1UOBA 5J09A 1GZWA 4KI5M 3ACIA 2E32A 1MS5A 1AJOA 3WNLA 1CAUB 1I9RA 4MGYE 4UW5A 3NAPA 1UAIA 4XJ9A 3OEBA 3S57A 2OKXA 5HBAA 1CIWA 4DY3A 3X29B 1QJY3 2VQ0A 1AJKA 1WMXA 3VHOA 4JTOA 1QQP2 2V72A 3D4KA 4FP3A 1Q8OA 3S7EA 1VB4A 3UGGA 3OBZA 2WABA 1BK1A 2MEV3 1K5JA 3IDBB 1HB1A 2PAMA 1N1TA 4OLLA 1FI2A 1U5YA 4CYDA 4Y22A 3DUIA 5JR2A 2JG8B 2JDMA 4P5HA 4FTSA 3DEMA 1DGRA 3Q8CA 3LF7A 4YWAA 3SH4A 4BHPA 1NT0A 2DV9A 5KC6A 4PI2A 5T3NA 5ACA2 2OUHA 3TRSB 4CP0A 1ENRA 1XE8A 2BOIA 4JQTA 4BMEA 1TNFA 1UO9A 2F4LA 4Q29A 4FPFA 4XJ8A 1XE7A 3R0RA 1V9U3 1PGL2 2DCJA 3LSDA 2E31A 1K3IA 3AKTA 4HN1A 2WJSA 4I3PA 2G9ZA 3MPBA 4OFGA 4IE6A 4JGZB 3LE0A 2IXIA 1GR3A 5DUVA 2RS12 3A0NA 4M3CF 5EJ3A 3ZPOA 2VMDA 4JKMA 3ABZA 1QJZA 3L9JT 3WDXA 2JG8C 2WNVB 4CDUA 3A21A 4W50A 2Y6HA 3HN3A 4JHZA 3GHMA 5EZWA 4IETA 4Q26A 4UYBA 1AVBA 2RS33 2VZPA 2XQXA 3OYWB 1H9WA 5IK7A 4IGOA 5KXCA 4YG6A 1ONAA 2DF7A 2VXRA 2PHTA 1C57A 3USUA 3OUJA 4QX2A 3KS7A 4LO4B 4AFMA 2YZ4A 1GBGA 1FATA 2BERA 1YCIA 3VKNA 5K0UB 1W8UA 4XIKA 2Q8EA 3GZEA 2FQPA 3JXSA 4GXLA 4QGMA 1YEWA 4QGLA 5SV5A 4AEDA 2AGSA 1OLMA 2RR12 1NYWA 1T6GC 4LR4A 4DMIA 4LBQB 1OC1A 4SLIA 3PVBB 2BVVA 4JGZC 2ET1A 3VD7A 5JPNB 3H3LA 3S30A 2IVIB 1HRV3 2OQ6A 3LEIA 3DYMA 5CYYA 5KHHA 3LAGA 1F5JA 1COV3 2VM9A 2WNVC 3BODA 3KF5A 4TN7A 4Y26A 2XR4A 2HWB1 3V0BA 2ERFA 5A7WA 1XRUA 2V5YA 5CISA 1V6IA 3N7LA 1ZRIA 4Q4Y3 3ZYHA 2W46A 3CLPA 3G6JB 4YVSA 5FY7A 2X09A 3UETA 2W1SA 1KGYA 4N53B 4QXHA 5FFOC 5K0UC 1S0CA 3ZYJB 5C9AB 1QDOA 4C0HA 4KWKA 1RL3A 2VQAA 3WNXA 2K2SA 3ETQA 2ARXA 3EXUA 2QQUA 5I8YA 1V00A 2EA7A 2BQPA 4M3CE 3WF2A 3WUCA 1YHFA 1PK6B 2DVDA 1CAWA 4K20A 3KV6A 1Q5OA 3JB8A 3KCYA 3TEYA 4HSJA 3MBWA 4EWEA 4JKKA 1CVNA 3ZXFA 3TNPB 4ARXA 4Q0QA 4HONA 4Q4V2 1JYVA 3SCGA 5T5OA 1L7RA 3OGJA 1E5RA 2ZGNA 2X8KA 3AP9A 4H2AA 3NJVA 4XFHA 2YUEA 4I0WB 4XTMA 4BQWA 2G9GA 1HRI1 1UYPA 1X8MA 1N1SA 4A7KA 2EXHA 1I5PA 4Y1ZA 1JH5A 4NWWA 5FWEA 4BQ3A 4XABA 5D1IA 1VRH1 4N53C 1WA6X 5KXEA 3BTZA 2RE9A 5C9AC 2Z79A 1PX3A 4J1WA 5E89A 4AI3A 1EPZA 2CWSA 1W2UA 3T2OA 3H8RA 2W3JA 2X05A 5CAZA 1OA3A 4XW3A 1M4WA 2AR6A 1OA4A 1PK6C 3CQOA 3K4ZA 3PIGA 1UZZA 2R30A 1W8NA 1SBFA 1REFA 1XNBA 4BCUA 3PVEA 5JI7A 4LORA 4CTEA 1JZ2A 1A3KA 4Y5TA 1W06A 2W91A 3ENRA 3WHTA 4FP2A 5FMBA 2ET7A 5FZOB 3G7DA 2VCBA 1W39A 1QNWA 3O1UA 4QB1A 1G8WA 1BZWA 1ND3B 1RUJ1 3UT0A 2AYHA 1LHVA 2IXLA 2Y6FA 1G9FA 2E33A 3VB9A 2VMCA 1APNA 3CNAA 2AEYA 1UN1A 2HWD2 4XHBA 1D4VB 2Y0IA 2YC0A 3B94A 3KT1A 4AVBA 1HQNA 4FXKB 2DVAA 3IWZA 2D6OX 2RDSA 3OSDA 4D6RA 3WF1A 4FOYA 4UFHA 1NZIA 5FYSA 2BGPA 2JDUA 2LRPA 5L73A 4AVAA 4M0HA 4Q4X1 5FPUA 3IBMA 2YGMA 3J8F1 5LY1A 3KZ4C 1A34A 5CFDA 1RIRA 1NX9A 3D0JA 2PHFA 3OD0A 3UKVA 3VV1A 2VMFA 4HVQA 1J3PA 5KR7A 2RS32 3BTXA 1LOAA 4LHLA 1HB3A 4YGDA 2CGPA 4RHV1 2A3WA 4BPZA 1DQ1A 1QNYA 2KD7A 5CZKA 3MF6A 2H6CA 3GYDA 4XXAA 2W1WA 2GU9A 3DKWA 3LD8A 3OGSA 1DQ4A 1ND3C 3C3VA 4HANA 4QU2A 4TSVA 2BV4A 3RMYA 4L97A 5FYBA 5FPAA 5C7GA 4XHXA 1QWRA 2JG9B 3TBDA 2W68A 3B5LB 1ZYBA 4LKSA 4XAEA 4UXAA 4TZDA 3HEIA 2Z4FA 2ZBJA 4Q27A 3NJYA 4QDSA 4S2GA 1LOCA 4ZONA 1IZ3A 4LHSA 3WR0A 3OPTA 1VALA 1RHI1 4GH4B 4GWMA 3SMHA 2YU2A 1HRV2 5A7SA 5IVJA 4CCNA 2ZEXA 2Q30A 4BU2A 1YFUA 5BYNA 2D6NA 1NQJA 2WKKA 2WO1A 5GZEA 3MUY1 2VECA 1UF2C 4H3WA 3POGA 1VBD3 2PAEA 4Q4Y2 2W52A 4CDXA 3MLLA 1GZ9A 1LRHA 4HOOA 4LBKA 5A1FA 2VBPA 4CE8A 1WD3A 3DXUA 3VN4A 2EXJA 4YGEA 4IDZA 3MLKA 4XILA 1R093 2A73B 3ZXGA 4B4RA 1XPWA 3IIAA 1DP0A 5IUQA 2ORXA 4DXRA 1Z7S1 1H6YA 4LITA 5CA6A 3KB5A 4OHYA 3LB9A 3ZFFC 1S0IA 5D21A 4HETA 4Q0VA 4DEQA 5J48A 4GH4C 2DVBA 1CAUA 1UYZA 3MPPG 1SLBA 4XFFA 5FPVA 3L2HA 4AI1A 1CPMA 2YHJA 4XJWA 1W6MA 1QY4A 5A33B 5HV0A 4NIAA 2NM1A 5C4WB 1JMUB 4IE4A 3I2JA 2VZSA 4META 1OSGA 4DUXA 3ZFGB 2WS92 2IXHA 3NJZA 5AVPA 4AF9A 4DIQA 5ABJB 2R063 5F6LB 4GA9A 3WVJA 5F5AA 3VZOA 4JVAA 4BK4A 2JG8A 3Q8AA 1W9TA 4HFSA 2YV8A 2W1QA 2XONA 5HV4A 4ARYA 1W2AX 4AVTA 1R083 2PLV3 3AZWA 3CF6E 2DYCA 3IMMA 4CCKA 1SEFA 3AK0A 2FD8A 1XNTA 3NJXA 4IV1A 4C1WA 1CESA 5IK4A 2XJSA 4A7ZA 3RFRA 1KEXA 4INDA 4ASKA 4YRDA 4OI1A 1L7QA 1ZA7A 4LHNA 5BNOB 1H1AA 4XYXA 1XE0A 1BKZA 1OKQA 1UPIA 5C4WC 3P3NA 1FAYA 1YI9A 4GB31 1NCRB 3JD71 1RUI1 3T1LA 1H2NA 5ABJC 4Z2AA 5A3NA 4HPKB 2HWE1 2IWGB 2ZTNA 3FE5A 2YGLA 4IUGA 4LEJA 4Y20B 2WZR1 1DGWA 4K40A 3R05A 1XU2A 2ZGSA 4XF1A 3OCPA 1KS5A 5LBEA 4IGQA 4O65A 2J1VA 1S0GA 5IJRA 5JIUA 2XJTA 2ZACA 4QM9A 4ZHNA 2OT7A 2VQUA 1U5IA 1ZBE1 3CIHA 1D2QA 4FFFA 5FYMA 1PO21 2RV9A 4XAAA 5KHIA 3VBSB 4FPCA 5CKMA 3TN93 3VGIA 4B7EA 4QX8A 4E27A 5EYYA 5BNOC 1FXZA 5IWFA 2HEVF 4KU8A 3SH3A 5ANNA 1W3VA 4UFKA 4CDWA 1U5XA 3ORJA 2Z2SB 4EN6B 5IAXA 1ULOA 1OLME 1NE4A 4AHYA 2R042 1RMU2 1VBB2 1VBE3 3H0OA 4LBQA 2JD4A 4EYUA 3WG2A 2LUWA 4BWOA 2NN8A 2XUMA 3RNSA 1SCSA 1LOEA 2QQPA 5FR3A 1RB8G 1RUC1 4MO3M 1PO11 1R64A 1RUD1 5J3UA 3AL6A 2V4VA 3BU0A 5FY1A 4ISQA 2HH9A 1IHMA 4Q5OA 4NPMA 2CSGA 4J1XA 3IDEA 1CGPA 2CAUA 3K77A 1XSRA 3MEPA 2D40A 1IG0A 1D4M1 4ES9A 2ENRA 1Y4WA 1ST8A 1OFNA 1CZVA 4GULA 4N53A 5KHKA 2P34A 4XOGA 3W21A 3N9PA 3MIFA 3VBSC 2A6YA 4AXOA 1AL21 1ENXA 2AUYA 1Q43A 3ES1A 5EQUA 5CFCA 5C3QA 1W04A 1DQ2A 4COYA 4E4ZA 1J3QA 2O14A 2VNGA 5HCAA 3RZJA 2VW0A 3ZIWA 1JYXA 4QQ2A 4H55A 2R7EB 1R092 3T0DA 1X33A 3USSA 3OY8B 3DXTA 3KF3A 3HNYM 4XMAA 1REEA 2BTVC 1W28A 3FFQA 4L0PA 4MYEA 3U14A 2WQZC 3RJ2X 3VZLA 3JD73 3N3HA 1POV1 2VJXA 1O4ZA 1WA4A 4LO7A 5D2AA 2HWE3 3M7AA 2W2IA 1JYIA 1GKBA 3ZXJA 4BMBA 1GZWB 3RG0A 1MS1A 5ANQA 5JPMB 2P3IA 3HT2A 3VDDA 5DQ0A 4XF3A 5EPAA 3KGZA 1IKQA 1RUG3 3MFAA 3NAPB 4DOUA 3B93A 1W05A 1ZBA3 2HWF1 2VZTA 5FPLA 1FV3A 1PVC1 1VAMA 2ORZA 4LO5B 3AVRA 4A2UA 2FDFA 3CJIA 3KCXA 2WNOA 3RZZA 1TMF1 1MS8A 5FOJB 5JOWA 3JU9A 2X5IA 4L9BA 3K51A 1LU2A 1HJFA 1LOFA 2BGOA 2FBEA 4PHZA 3VKMA 3DCQA 1PHMA 2ZHLA 5LK7B 5LA1A 4AEJA 1MPXA 3LGRA 4Y22B 1YQ8A 2BNOA 2MPFA 2Q8CA 2D6KA 2PLV2 2WYFA 1JZ4A 4F8AA 3WNMA 1K42A 3ZKUA 5F7UA 4A3XA 2ZKLA 2ZGMA 3FUOA 1NKGA 3I3EA 3KV9A 4N7IA 1BCXA 5H9RA 5FTTC 3CU7A 1ENQA 4JV4A 5FP8A 3NAPC 2QVSB 1GQGA 4HVRA 1AR63 4JHTA 3NV1A 3THCA 4AK3A 1ZA4A 3APBA 3ZKYA 4JX0A 4IV3A 3HQXA 3Q8FA 1NXMA 4CU7A 5FPXA 3DECA 3AZXA 2E63A 3JBG1 4XC9A 3PVOA 4Z2WA 1HQLA 1GSLA 1MEC1 3ZVXA 4M00A 2QQOA 1LNSA 1XNDA 2FCVA 1VBC3 1GOFA 4E4HA 4QD2A 5BUVA 4EZHA 3ZIXA 2RMU1 5C70A 1ZVFA 1V70A 2P6HA 2WQ4A 1UD1A 1W9FA 5I0TA 2W0XA 5FPZA 1Q56A 4NMIA 1QH7A 2OUJA 5JVVA 1SLLA 3LFMA 1YO8A 3TN92 2VL4A 3USUB 2GMMA 1PMIA 4AOCA 4QKDA 2JX9A 1XNCA 3CEWA 4AHWA 1UZVA 4WV8A 1DGRN 2JG9A 3MW2A 4FPEA 2C5DA 4XFCA 5C71A 1JBCA 2IXJA 2Q8DA 2WWSA 4DO0A 1FYUA 1LODA 4CCJA 3ZMNA 3VKFC 1WCSA 2DVGA 4UF0B 1AXYA 1QHDA 2BFUS 2QZ2A 4KG0A 4NR1A 1GUIA 3HR9A 4WZFA 3INAA 1TMF3 1AF9A 3IT8A 1AYM1 2GC3A 2PHDA 2RDNA 1ZZ6A 2A3XA 5FK7A 1LULA 2RJ2A 1C1FA 1AYN3 4N7UA 1MZEA 4UW3A 2WT2A 4LBJA 4XFBA 3P5BA 2PN5A 2PXJA 5LBBA 1AR92 4QPGA 3PUSA 5L36A 1WW4A 4Z07A 3AMHA 2C6SA 2OZJA 1DZRA 4YVSB 4UW4A 1OQ1A 2IC1A 2AENA 4NROA 1LB2A 3SITA 2EIDA 4UFJA 2BBAA 3ACGA 2P2KA 3NSTA 4FPKA 1A8MA 2LTNA 4CCOA 2W5FA 4FQZA 4AEDC 4AE2A 4CA9A 3UJQA 5A6YA 1BMV2 2DCKA 4QDQA 3OJBA 4LK7A 4QX7A 1OOPA 3W20A 4COZA 2RS11 1O3RA 2ES3A 5I0DA 1W8WA 3PTYA 5DAQA 4EROA 1GQHA 1UKGA 4GWJA 5IATA 1ASJ3 1W90A 3AKQA 1H2KA 1F8VA 4XXPA 2Y6JA 3E5UA 1C3HA 2ZXQA 4Q4W3 2J42A 1DLLA 1CQ9A 3FLTA 5FKBA 1RUF1 5FYHA 3WUDA 2HWC1 4OHXA 1ENSA 1P8JA 1PIV3 2DURA 4P9JA 3ZMOA 1A8DA 5CKNA 1QJEA 3HNMA 1RUG2 3N7JA 3PUIA 3SKVA 1ZRFA 1ZBA2 3LDKA 4LBOA 5EJ1B 4YVSC 3WOGA 4KQ7A 4OI0A 2W1UA 1EAH1 1G6NA 1OURA 1OBNA 2VOWA 1BEV2 3WDYA 4FAHA 4FVVA 2C1FA 1UY2A 4AWDA 3D3AA 3IN9A 3QH7A 2AC1A 3ZXKA 1ULFA 2JENA 4FPJA 4P00B 1SFYA 5FYUA 3KVBA 1TEIA 2ZEWA 2WR9A 3GBWA 4YFWA 5FZKA 4Q0SA 1SLCA 5I0RA 4ZZ5A 4NJ4A 3K3NA 3BKZA 2GH2A 4NRQA 1IOAA 1WMEA 1HN1A 1NCRA 3M4FA 1W6NB 2QZ3A 4JZRA 1IQDC 3UKTA 5DUUA 3AKPA 5CU1A 4OHZA 4DFSA 2GP5A 3I59A 4GWNA 1MZ6A 3LIGA 5AFEA 1AR62 2PHRA 4EJRA 4A44A 1MVQA 2A6ZA 2DWRA 3N7MA 3VZKA 5HXMA 3VBFA 4A45A 3NVCA 1G7YA 1C8M3 3MV01 5FMCA 1VBA1 3C7EA 4W6XA 4QPYA 2N7GA 3HVDA 3MIGA 1TME2 3ZX7A 4UFLA 3GBFA 5JOXA 4WVVA 4N8MA 5CFDB 2QKDA 3JQXA 1S0DA 5K9YA 5JI9A 3VDCA 3PJQA 1VP6A 4EQVA 2VZ3A 1OUXA 3HOBA 4GWIA 3OPWA 5GZFA 4C90A 3ZYGA 3HJRA 3D82A 2ZGUA 2WZ8A 4V2WA 4CU8A 4NRPA 1YIFA 1EV11 4OMCA 2ZEZA 3T2PA 1POV0 2HWC3 3LDRA 3I2OA 5FZFA 2PHUA 4YARA 4FFHA 4RQPB 4BM8A 2W87A 1CZTA 2IXCA 3UJOA 1KRIA 1RVF1 1JZ8A 4UWDA 3UGFA 4BQ4A 2GNDA 4YW5A 1H8TB 4I3GA 4QB6A 3I3QA 3T1MA 1AX2A 2OXBA 2DVFA 3ELNA 3SNMA 3O1PA 5CFDC 1UZYA 2LROA 3KV5A 4LHKA 1AYN2 3GZUC 2YBKA 4ISRA 1J83A 3H7YA 5FO9B
chains in the Genus database with same CATH topology
4CDXB 2GNBA 1RUE3 3E6DA 1BBT2 3OY8A 1VAVA 2ZGQA 1ZZ9A 4DNYA 1URXA 2UWBA 4FXGB 2HWD1 3AP5A 1O91A 4GKXA 1RUOA 1QJX3 3ALQA 4RQPC 2VY0A 5DG2A 2DUOA 1QJU3 3VZNA 4H7MA 5BY5A 1B09A 1E57A 1H8TC 3MF9A 1R1A1 2Q8OA 1DQ6A 1W6MB 4FBFA 1IQAA 1OA2A 4AEKA 2RS53 3U4XA 4RGAA 2XL9A 2VUJA 2WIIB 3AMQA 3M3OA 4CDXC 1IPKA 4ONUA 4Y1YA 3KGLA 1CN1A 1LENA 3B00A 3VBUA 3BU7A 2R1DA 1WBFA 1WW5A 2XBO2 2RM21 2XG3A 4AFAA 2CTVA 3JQWA 2ZX4A 4XBLA 2ZABA 3WINE 4IV1B 1OPOA 1TNRA 3LA3A 1TQ5A 4HL0A 3AX4A 1QOOA 1PNFA 5CNAA 2GNMA 3AP7A 1JW6A 2PYTA 1LGCA 4FPYA 2ZMLA 2ZZQA 3VBHB 2D6PA 4IESA 5T52A 1C8M2 4XBQA 1FOD2 4F7ZA 5E16A 1UU6A 1I5ZA 2NMNA 4QXKA 4ITCA 4EN0A 1Q8SA 4N9HA 1ZZBA 4XFGA 4UW6A 4IEZA 3WQ1A 5I91A 4IV1C 5SV8A 2WL1A 3H3UA 3ZSKA 3MYXA 4D7YA 4CDWB 4QGNA 5J37A 3AFGA 1ULDA 4XIOA 5T5PA 1J3RA 1EYBA 1OPMA 2WS91 1SBDA 1W6OA 1ZNPA 5L7OA 2E6VA 2XLAA 2IXKA 3VBHC 1J1TA 2ZPXA 2E53A 2JE7A 4LO6B 1LU1A 3R4DB 3QACA 1WLCA 2R071 2DFBA 2EIGA 4W6WA 3ZYRA 5DUWA 2A6XA 4M0NA 3MZHA 5T50A 2UWAA 4MGZE 1NOVA 4CDWC 5CFCB 1RUE2 4AVVA 2PA7A 1NCQA 3LOBA 3ZSMA 4QMAA 1RUH1 2O0OA 5BV6A 1V6OA 2EF6A 4DS0A 4WVMA 1AR72 3QD6A 5GZDA 3AYCA 1N1VA 1QJX2 2GC1A 3RSJA 5C8CA 1QJU2 3FX3A 3AKRA 5BNQA 1X82A 3S6PA 1UU5A 4KGGA 4PF5A 1QH6A 3B01A 2R0HA 3SISA 5AFBA 3HIFA 1PVXA 1QJY2 3VDDB 3WD5A 3HN1A 4XZPA 1GZCA 1LOGA 3TAYA 2DUPA 5JSRA 3MLJA 3UK9A 1YXWA 3NV4A 5CFCC 2MEV2 1RMU1 1VBB1 5GLUA 3CJIB 1SCRA 1N3OA 1NA1A 3AFKA 2HYKA 2X5IB 3OBTA 1WLTA 3WW3A 1V6MA 3WG1A 2D3SA 5DZEA 5I93A 4XQDA 4JRAA 1W6NA 4AG4A 4TWTA 3RDIA 2VOXA 4P14A 4LE3A 2JDZA 3IPVA 1UW8A 1GNZA 2A7AA 4L99A 1UIJA 4UBGA 3RYRA 1V9U2 4YZ3A 5HCBA 4YZ4A 3VDDC 2HWB3 2X53S 2XHKA 4KH9A 4YW1A 1N1YA 2R073 3R4UA 2ZA9A 1AR81 3CJIC 3KT4A 1RITA 4IV3B 4PBPA 4YW4A 2XJPA 4LUKA 2X5IC 1Q3EA 4OULA 1LOFC 2ZJCA 4HN0A 4EWAA 1QXJA 3FHIB 3AMMA 3I54A 4BLIA 4N90A 3H7JA 3HAGA 3NKGA 3O14A 4RGGA 4AI0A 4IEXA 1RUNA 2UU8A 1ULEA 1UIKA 1G9CA 3PJYA 1SDWA 2BWAA 3SCFA 1WCKA 2GDFA 1HRI3 1QKQA 4B4PA 3ST7A 4Z92B 4RQPA 1KDMA 4IV3C 1PGW1 2ZMNA 1H8TA 1NXD1 1VRH3 1ZZCA 2NLRA 1YLLA 1GYKA 1COV2 1H1MA 1H2LA 3ZXAC 4QQPA 4B4QA 1ZRCA 4YW3A 2GC2A 1V6KA 5JOZA 4XF9A 2NP0A 2EVXA 1YJLA 2VMGA 3ME2A 4B29A 3I2DA 3VBOA 4SBVA 2QE3A 1C1LA 3MIDA 1YFYA 1QF3A 1JHNA 3OD4A 4N43A 4QPGB 4PLMA 3RPQA 1KFUL 2JG9C 3JZVA 2XJQA 2PAKA 2SLIA 1NLRA 5FDBA 1VIWB 4WM7A 4E4DX 1RUJ3 1OOPB 3VKLA 3D0SA 4KBBA 2XWJB 1GLHA 4YZ2A 5L19A 2R49A 5CADA 4CZSA 1G9BA 5AC91 3QCWA 1FPN1 3MGUA 2DCZA 3RRDA 1V6NA 4YM1A 3O12A 3POSA 2ZX2A 4Q4X3 3J8F3 2YPJA 1V6LA 1MR5A 3V65A 4QPGC 2BEOA 3ZN6B 5I0UA 1L3JA 4RHV3 1FMD1 2DFCA 1VR3A 4OUMA 1YFWA 3EJKA 4AFCA 2TNFA 1VJ2A 5GZGA 5A3MA 2NPIA 5GM0A 1OOPC 2VUAA 4YG3A 2JICA 4GMP1 1O3SA 1QDCA 4IERA 4F3JA 4GKYA 3KD4A 4R8HA 1LECA 4GALA 5KHJA 2XVLA 1XYOA 4MVTA 1RHI3 2P3KA 3ZFGC 4HK9A 2ZGTA 5D8AA 4FOWA 4HMZA 3O0WA 3VBHA 2BVBA 2HWB2 2EXKA 3I59B 4YM2A 3SHRA 2Q1ZB 4MXWA 3WDWA 4XF0A 1S2KA 3VBFB 2WFF1 1BMV1 1MS9A 1WGPA 1XXNA 2ZKNA 4RR3A 4AYUA 4LULA 1C4RA 1EPWA 3VHNA 4TYSA 1Z7S3 4MXVA 4Y24A 2H0BA 4B8EA 1AUYA 3DN7A 5GALA 4AI8A 4PIZA 1AL0G 3VLBB 1NCRC 2XJVA 5JDBA 3ZSEA 4AHZA 2UYAA 2VMIA 2XWBB 2JEMA 3BOWA 1UKRA 1FPN3 4C0BA 2XJRA 1SACA 4HVOA 1HRI2 1ZRRA 4EN7B 1O7FA 1BEV1 3VBFC 3ES4A 4R4ZA 3RYKA 1MACA 3D5OA 4FPOB 3I7DA 3WY6A 3BCWA 1VRH2 4RS5B 3K48A 3LKJA 4R9DA 4DINB 3RJRA 4IEQA 1IPJA 4BA6A 4LBQD 2QCSB 1VBD2 4O9GA 1KITA 2ZGLA 4Q0PA 4R52A 5BPXA 5DDJ1 3UV9A 1C5IA 4R9AA 4LA3A 3N7KA 2FMDA 1HXS1 1O3TA 5KBFA 1KXGA 5FRAA 1S1AA 2ETEA 4GB33 3BB6A 1RUI3 1ZM1A 1RUJ2 4LBNA 5F6KA 4L2NA 4S2HA 1OI6A 4JDOA 1NZCA 3GBGA 2UY8A 1TME1 5J96B 1KQRA 1TE1B 2GC0A 3V0AA 2WZR3 2D5HA 1YJKA 2WFF3 4PLNA 5LK5A 4COWA 2QFEA 3WDUA 1ZBE3 2R062 3ZYPA 4K1ZA 1PO23 2BYVE 3RWNA 5JOYA 1GANA 4XJAA 3MW4A 4RHV2 1D0HA 2XH6A 1R082 1Y3TA 1Q8VA 3AJZA 4ATEA 3VBUB 3KM5A 4ZU5A 1YUDA 1WMFA 2KM2A 1QXRA 4AW7A 1RUC3 1PO13 2Z42A 1RUD3 4GQ7A 3C2UA 3KLSA 3M3IA 5CB7A 4Y1XA 3ASIA 1RINA 4WVZA 1RHI2 3M70A 4YSFA 5IK5A 1D4M3 4P9LA 1S0EA 4BZ4A 2VOKA 2YYOA 5JZGB 3FBMA 2C0ZA 2D93A 4QPIA 4H7LA 5LEJA 1NY71 4OZXA 2DUQA 1PGSA 1AL23 2BUKA 5E8AA 2PHXA 3WZ1A 2WNUA 4L11A 3FLPA 3EO6A 4MSVA 4P9WA 2OIIA 5F9TA 1ULCA 3VBUC 1R1ZA 3CL1A 1F31A 4AGVA 3RMXA 3KSCA 4PLOA 2V09A 3U11A 3ZXDA 1HXS3 4LLFA 1PM7A 4H14A 3V64A 3ZXEA 2MNGA 2RJKA 2VVEA 2WSUA 4FPLA 5JMCA 4CEWA 4B3NA 4XFAA 3VZJA 1QQP1 3D6EA 1POV3 1VBE2 1YFXA 2GMEA 4HKOA 4IEUA 4NPRA 2XPJA 3E5QA 4KWLA 2ZHKA 1SLAA 2VVFA 4K7JA 1WUVA 4AQSA 4LUMA 5DG1A 1S0JA 1W6OB 5L7OB 1C28A 1ZZ7A 2HWF3 2Q1MA 4FOVA 1KD7A 1PVC3 5A3LA 4FSJA 2XBO1 2UYBA 5ACA1 3RYPA 1N3PA 1JUIA 2WZPP 3SXWA 2B46X 1XNKA 1LKNA 5T54A 4LE4A 1H4HA 1H1IA 3HBZA 4ZKTB 3OGGA 3ZXLA 1H8VA 1OMIA 4HBNA 5JWPA 4QHBA 1PGL1 4MV2A 1AZDA 3OPZA 1MS4A 3AZVA 1GICA 1SLIA 3M3QA 4GMP0 1NCQB 2I74A 3IKWA 5L7OC 1QU0A 2WSVA 4WVMB 4GB32 4AQTA 2BNMA 4K21A 3JD72 4XJUA 1OQDA 3EQEA 3HMYA 1B35A 5J98B 1XQNA 4COUA 3EBRA 2HWE2 3JBG3 1ND2B 3URFA 5C8CB 2IFRA 4YW2A 1MEC3 3L2YA 4ZXKA 2WZR2 4MUVA 1DF0A 5AVAA 3WDTA 5GLTA 3N35A 2VULA 3ZN6A 3NKTA 3SLIA 2RMU3 4IEYA 4ORFA 1DYKA 4AVCA 1ZBE2 4IEWA 2FZ2A 2RR11 1PO22 3O7OA 2GSYA 1NCQC 4CEYA 3MDPA 1NA1B 4CDQA 3BTAA 4LBLA 4BYYA 2ZGOA 2BW8A 4NHLA 5I8SA 3WCRA 1KJLA 4P9XA 2E7QA 2OPKA 1ND2C 5C8CC 1PO12 1RUD2 3DPRA 3QOPA 1J1LA 4YZ1A 1DGLA 2UY9A 3IPVB 3E6CC 4L92A 1F5FA 5KC5A 1AYM3 5FLHA 1LGBA 5JLVA 1MS3A 4OI4A 5H9SA 1PZ9A 4P9GA 1AL22 5DZGA 1VBC2 3H1YA 5GLZA 1NA1C 1AR71 2A6WA 3THTA 4Q4V1 4QM8A 3AXEA 1UPSA 1XYPA 1AX0A 1LOBA 2B39A 4XDQA 2RS13 1J58A 5FO8B 4Q1RA 4XTPA 4O9EA 3HT1A 4Z1VA 5B2GB 1D0GA 1H2MA 3A0KA 1QJY1 4M01A 5CVRA 2WA4A 1RUF3 3H50A 2BBVA 3GALA 3BPZA 4PIXA 1W6QA 2LALA 2D97A 3OTFA 4RS5A 1QGLA 4LTAA 1N3QA 2XKOA 3VL9A 2HWF2 2IZWA 1ALYA 1EAH3 3MFCA 4R9BA 3FMGA 1TMF2 3BOPA 3B9CA 4IQPA 3NO8A 1DHKB 2ZGPA 4AQ6A 1S55A 2EALA 2PHWA 3TOJA 3W58A 2XJUA 3DGTA 1CPNA 1HW5A 2GZWA 1DIWA 2KA3A 4HK8A 1OQEA 5JSOA 3VBOB 1W6PB 4AGGA 1OFSA 2OZ6A 4N43B 2B7YA 3WW4A 5EFUA 4P9IA 5IK8A 3AJYA 4D3WA 2UWCA 2R32A 1H0BA 3TYJA 4ES8A 4WM7B 2YROA 1A78A 1CD3G 4YFZA 1ASJ2 1BQPA 2NYYA 4DXZA 4DY5A 1O4YA 3HD8B 4Q4W2 1EP0A 3U07A 2RS31 3PLQA 3LOIA 4X6RB 1PIV2 1VBA3 2ILMA 1N47A 2XGXA 4FOQA 5DUXA 4MZUA 4V1PA 3AZYA 1SBEA 4L8QA 5FQ0A 3VBOC 3MW3A 5A32A 2RMU2 1FV2A 4JDMA 1JN2P 4N43C 1WW7A 4Q1PA 2ZMKA 4D7TA 3ILFA 2B8MA 1CJPA 3GZAA 3M3CA 4RD7A 4Y1VA 1O3QA 2ZAAA 3RQ0A 4WM7C 1DBNA 1HRV1 4IXLA 3ZN4A 1COV1 4YM3A 2AH2A 1EV13 3VZMA 3J26N 1CX4A 4DB5A 1YRZA 3FZ3A 4DRRA 2GMPA 1DG6A 3POYA 2Q5TA 4Q4Y1 1O4TA 1RVF3 5JZGA 4F83A 5D8AB 2HEYF 4EV0A 4CP1A 2V73A 1AYM2 1M06G 3NW4A 4MXWB 2ZHMA 4FPHA 2R1BA 4ASMB 2D44A 3MIHA 3R6SA 4RR3B 4BOWA 2ZGRA 5C6CA 4MGIE 2HWD3 2W39A 1IS6A 3AKSA 3WHUA 4K8FA 3TNQA 4D69A 3WDVA 4IEOA 4YGCA 2WINB 4JAAA 1K5MA 1FX5A 4YVWA 4FTEA 1R1A3 1RC6A 1V6JA 5D8AC 4WZCA 1CAXB 3M3EA 4PBOA 1NLSA 4DRVA 1RUF2 2HWC2 3ZDSA 4PCRA 1I1EA 2VGDA 4URTA 2X29A 3E97A 5LRRA 1YWKA 1Y9QA 1UCXA 4FTBA 4XBNA 5FMOL 4YNIA 1EAH2 4NWVA 4I30A 2B45X 4RR3C 2AZ5A 5T5JA 4S2FA 4JRLA 4OVEA 2EAAA 2H6BA 1JOJA 1ZZ8A 2XKPA 4Q2FA 2K9ZA 2RM23 3CO2A 4B7KA 1LGNA 5FBZA 3UKNA 1OLRA 3WXPA 1DZQA 1U5ZA 3AP4A 1MQTA 3MI8A 4KWJA 3KQRA 3NV3A 4R4XA 3O0XA 1W0PA 3H9AA 2NMOA 5I0SA 2CGNA 1KS4A 1X7NA 2ZCWA 4LBMA 1Z78A 2VH9A 1DQ0A 1ND2A 2WT0A 4UBHA 4WM8A 2HJIA 3I4IA 1CR7A 4KNCA 3RS6A 5BNPA 1C8NA 1G86A 4IEVA 1YNAA 1CONA 4MH0E 3V0AB 1VBA2 4QQOA 4XF4A 1IS4A 2RS52 4DQAA 2R041 2GNTA 3ROUA 2CNAA 1DQ5A 3T2TA 1I6XA 3FLRA 1WD4A 4COVA 3ZO0B 2JJ6A 1X8EA 1BJQA 2A70A 4NVPA 2A6VA 3ZSLA 1HIXA 1Y7BA 1LHUA 2C9AA 4E9KA 2OA2A 1D2SA 2WS93 3FFZA 3R4SA 1XU1A 1GFF2 2O1QA 3NV2A 2DCTA 4AHXA 1EV12 5JIAA 4IL7A 1F2NA 1WCDJ 2WLPA 3FJSA 2GALA 5CIRA 2B5HA 1VBD1 1RVF2 3OF1A 2P37A 4Q0UA 5EWSA 4OHWA 3WX5A 4HKWA 2ZX1A 2Y38A 4MX3A 4Y5Z0 4QPIB 2FHRA 1R091 3HWJA 2D98A 4HKLA 2Z69A 2BPA2 3U0ZA 4G4FA 2WNUB 3ILRA 4BIOA 4CP2A 1QMJA 1RUH3 4PJYA 4YZ5A 5GZCA 3LA2A 4RL7A 1DDLA 1QXPA 3PMEA 5GKAC 2FMYA 3FWEA 2CGOA 5J7MA 5BNNA 2BGCA 3DV8A 5KHGA 4JGYA 2PELA 1DYPA 4CEWB 4RA0A 1JXNA 1R1A2 2CL2A 2R061 3WLUA 1MZ5A 1LHWA 4QPIC 4AFDA 1WW6A 2K0GA 2CV6A 4I02A 3AYDA 4JCKA 1KFXL 4YM0A 2Y26A 2R043 1R081 1RMU3 1VBB3 2PLV1 2WNUC 4NOTA 1H30A 1BVVA 5JR7B 4FAGA 4D94A 3Q9OA 4PIYA 2XVGA 3H1WA 1NG0A 3B02A 3JCIA 2ZAHA 4XETA 2JECA 5DXDA 2QJVA 2F4PA 1W6PA 4TLFA 4LT5A 3ZFEA 4E2GA 2RM22 1LCLA 3GNEA 4XEZA 4CEWC 3GHNA 3VL8A 3B9IA 3JUUA 1HX6A 4NN0A 3OBRA 1FNZA 4E2SA 2R0FA 2ZGKA 4ZU4A 2G9FA 4HLTA 1CAVA 3AP6A 1AR83 1H9PA 1B35B 2NQYA 2QDRA 3VBRB 2A71A 3TN91 3A4UA 1KJRA 2D6MA 1JYCA 5KXBA 1S0FA 3AM2A 4HZFA 5FOBB 1VBE1 4M3CB 2OW4A 1G9DA 2HKXA 1LTEA 2P3JA 4XFIA 1BVP1 3LSEA 1JTZX 3W59A 4CEYB 1U12A 2EXIA 2GAUA 3M1HA 3WP4A 4DZGA 4CDQB 3S0MA 3O5SA 4I2OA 3TWIA 1B35C 4FQ4A 3VBRC 3M2MA 2ZZJA 2SBAA 3DPRB 1AR91 2B9UA 4YGBA 3GF6A 2R072 4N9IA 4Q8LA 4D7SA 3E5XA 3KCCA 4P9YA 1WBLA 1ZRDA 3B3QE 5DZFA 2NZ9A 2WFPA 5CBLA 5E88A 4G3YC 4CEYC 2VW2A 1PNGA 2TEPA 1WLWA 5FLIA 4CDQC 4JGZA 2E51A 1BXHA 3AB0A 1WMDA 4KL1A 1RUH2 2WNVA 1LHOA 1SQ4A 1UMZA 2YDEA 2VNRA 3DPRC 1RUG1 1CAXA 4XJZA 3RI9A 5AC93 1ZBA1 3WCSA 1AX1A 3ZYIB 3OYWA 3M8LA 2A3YA 1VLNA 2G4IA 4Q8KA 5T5LA 3FUQA 5C8WA 4PDWB 1HQWA 2JXAA 2DTWA 5K0UA 1IS3A 2KXLA 1W6QB 2D7FA 3RI8A 3WG3A 4Y4YA 2OVUA 1FMD3 2RJLA 1EY2A 2VNOA 3THPA 5F1RA 2FZ1A 1RJ7A 1JUHA 4GMP3 4OHVA 3AZZA 3SH5A 1AR61 2YY1A 2Z5WA 3N36A 2VW1A 4NO4A 1I3HA 4AFBA 3CJXA 4YYOA 3IMNA 4S2DA 4XPVA 4Z8BA 4I09A 4PDWC 4OI2A 2VG9A 4QX5A 4XQWA 1X50A 1LEDA 1RJ8A 1YI7A 2JKBA 5C9AA 1AR93 4RS5C 4XMIA 1LR5A 1VBC1 1NE6A 1OHFA 1Y43B 1HKDA 2F6BA 4LO8A 5JAXA 4X8NA 1O5LA 1AR82 1F9KA 1OLQA 1PK6A 2CYFA 5K8SA 2E9QA 4KG8A 3ECQA 3UL2A 3AYEA 3JB4C 3MICA 4G9SB 4HT1T 3H1MA 4Q4X2 4WBBA 3J8F2 2ZOEB 2ZX3A 3ZPYA 5KWRA 3DF0A 2Q0AA 5FQ0B 2MHFA 2ATFA 5A32B 4KU7A 1RTVA 3WQ7A 2XVKA 2CY6A 1IS5A 4E4SA 4AI2A 3EHKA 3PHMA 4YLZA 4EN8B 3LWCA 4FT8A 1PZ7A 2ZX0A 5GJ6A 2Y0OA 2XB6C 5CG8A 2E7AA 1BYHA 1BEV3 1H4GA 2WT1A 3LA7A 1AYN1 1PGW2 4EWDA 3WT3A 2CAVA 4RFT0 2OYZA 3KT7A 2PHLA 1AHSA 1BBT1 1UU4A 5BXXA 1QOSA 2WNEA 5EXOA 4AVSA 1XYNA 4FCAA 1ND3A 5DDJ3 3QBQA 1Q8QA 1Z0HA 1GNHA 4JQRA 5IT6A 4W65A 2WLQA 5GLWA 2I07B 1C5HA 3NL1A 1MS0A 1ASJ1 1HLCA 1Z7S2 4WVWA 3VKOA 2DCYA 4FO9A 4Q4W1 1IKPA 3LZZA 3U10A 4OUSA 1PIV1 1YIPA 1DGWX 2PQQA 4MGKE 3O0VA 1S2BA 4J6GA 3WP6A 1W0OA 2BWCA 3V56A