2PQQA

Structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
147
Chain Sequence
GHMDDVLRRNPLFAALDDEQSAELRASMSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENMLAVVGPSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDAMLVFSDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title The crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2)
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 34
structure length 147
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pqqA00
1ZRRA 4EV0A 4I01A 2PA7A 3CLPA 2OPKA 3D82A 1CAXB 2QNKA 2EAAA 1VP6A 2B9UA 3HT1A 1RUNA 3EHKA 3KSCA 1ZRFA 4EWAA 2DCTA 3PNAA 4A2UA 2V09A 5FQ0A 5I8SA 1RGSA 3KMHA 3E6DA 2GC3A 3R6SA 1H1MA 4IEUA 3KCCA 5I8YA 1ZRDA 2VQAA 4JTNA 4I0AA 3SXWA 3BALA 1O7FA 1OI6A 2XLFA 4JVAA 4WBBA 3OD0A 2IXIA 3FX3A 4LA2A 3E5XA 3SCHA 1NZCA 4MZUA 5FQ0B 4JV4A 4FAHA 2PAEA 1VR3A 1XE7A 4O9EA 4EWDA 2Q30A 5I93A 4AXOA 3I54A 1OD5A 2FMYA 2IXCA 2CAVA 1O4TA 2UY9A 4QMAA 3ES4A 2PHDA 3NJZA 4YARA 3H3UA 1H1IA 1SQ4A 3B02A 2K9ZA 3BPZA 2GC1A 5LEKA 2GH2A 4Z07A 4X6QB 1UIKA 1PMIA 1J3QA 2EVXA 2CAUA 4CYDA 4LTAA 4UBHA 4Q0QA 2PTMA 1X7NA 5FCCA 5JSPA 3ROUA 5E1RA 5CADA 2ETEA 4AVBA 1RL3A 2XLGA 4N9IA 1PM7A 4XF0A 4XFIA 4HVRA 1O3SA 2IXLA 4XF1A 1YUDA 1GQGA 1ZZBA 3IWZA 4OFGA 2MNGA 3LZZA 5T3NA 4X6RB 5CU1A 3I7DA 1Y9QA 4KWLA 5E16A 4HSJA 3PLQA 4WZCA 5FDBA 3DKWA 2F4PA 3H1MA 4R52A 3GBFA 4QM8A 3RYPA 1J3RA 4N9HA 4MH0E 2BNMA 3SCFA 3NKTA 4HSLA 2O1QA 1ZVFA 3MPBA 2PHLA 3NW4A 1XE8A 2HKXA 4I3PA 3WW2A 1LR5A 4FAGA 2XKPA 3I59A 1UD1A 1CAVA 2Z2SB 2PAMA 4IETA 2K0GA 1ZZ8A 1O3QA 1CAWA 4BIFA 3E97A 3H1YA 1G6NA 1UCXA 4META 3DV8A 4LUKA 2ATFA 1YFYA 1HW5A 2VECA 3I59B 3OTFA 2EA7A 4Q0PA 4QGLA 5BXXA 2FQPA 2UYBA 1YLLA 4Q0VA 2GZWA 2XL9A 1CAWB 1U12A 4E2SA 5C8WA 5HI0A 3HQXA 4IEOA 4TLFA 5JSRA 3CEWA 3U10A 1OFNA 4KL1A 4AQ2A 3M70A 5KHIA 3BU7A 2Q4SA 4H7LA 5K8SA 3SHRA 4XFCA 2P17A 4JTOA 3WW4A 1EP0A 3UKTA 1XRUA 3TNPB 5I0RA 1EPZA 5KHKA 2KXLA 3RNSA 1ZZ7A 1X82A 1I5ZA 2GU9A 3WW3A 1LRHA 5I91A 1J1LA 1ZREA 4LUMA 4MGIE 4F7ZA 1QXRA 4MUVA 4E2GA 3H3ZA 4IESA 1NE4A 3MYXA 4XFGA 2H6CA 5FLIA 5JCTA 3QACA 4YSFA 1ZRCA 1EY2A 4Z82A 1ZZCA 4IEXA 2OYZA 3FZ3A 3LA2A 2OZ6A 1SFNA 2N7GA 1FT9A 3S7IA 1WGPA 3OCPA 1RC6A 5AVPA 4Q29A 3CJXA 3H8UA 1ZX5A 4MV2A 4ONUA 1J59A 2ET7A 4IEVA 2XLAA 5KBFA 3UKVA 2QVSB 3H7JA 3L2HA 4HN0A 1ZZ9A 2E9QA 1YFUA 3DN7A 5KHGA 1O3TA 4MGYE 3FFQA 3TNQA 4J1XA 5I0UA 2MPFA 3MZHA 3E6CC 1WLTA 2IXJA 3H9AA 4HVOA 4QGMA 5JAXA 2IXHA 2BNNA 4XETA 3LAGA 4QXKA 5JR7B 2OA2A 3ACLA 4KWJA 4KU8A 1NXMA 1OMIA 2D93A 3FJSA 4UXAA 2PYTA 3VHRA 3QOPA 4XFAA 4KU7A 2O8QA 5LRRA 2D5FA 1TQ5A 3IDCB 1CAUA 2WC2A 5F1RA 4IEZA 4P9GA 5FPXA 4QX5A 1I6XA 1NE6A 1EYBA 1V70A 4FBFA 3ZDSA 3CF6E 1RUOA 3IBMA 2GC0A 2GC2A 2ZKLA 2OZJA 3E5UA 1CAUB 1ZZ6A 1J58A 1DZTA 3DL3A 4IEQA 4YRDA 4XF9A 5EFUA 1X8EA 1O3RA 4L11A 2XGXA 2MHFA 3MDPA 4NVPA 5FLJA 1CAVB 3O14A 4D7SA 4EROA 3U0ZA 2UYAA 3NSTA 3CL1A 1QY4A 1ZNPA 3NVCA 4EWEA 4RD7A 5I8TA 1L3JA 4L2NA 4YYOA 4FT8A 1GQHA 1Q3EA 4IEWA 3ETQA 4XFBA 3H1WA 2ET1A 3C3VA 1RTVA 1JUHA 3U11A 4B29A 4AQ6A 5C6CA 5J3UA 3H50A 3SCGA 2D40A 2UY8A 2QJVA 4YNIA 4XF3A 2PQQA 1YWKA 2IXKA 4WVZA 2PFWA 4GULA 4MX3A 3E6BA 3RYKA 4D7TA 2BGCA 3BB6A 3EBRA 2PAKA 4J1WA 4LULA 4AVCA 2QCSB 2VPVA 1YHFA 2GAUA 3USSA 2I45A 4MGKE 2BYVE 4LLOA 2Q1ZB 1LKNA 1NYWA 3LWCA 4IEYA 3GYDA 4QGNA 4BYYA 4PIXA 3WW1A 2XKOA 4HLTA 3S0MA 1Q43A 3SMHA 2BEOA 5BY5A 3HIFA 5BPXA 3LA3A 3ES1A 5BV6A 1O5UA 1J3PA 3JZVA 1X8MA 3KGLA 4Q0SA 1YFWA 4F8AA 3OF1A 4O9GA 4AVAA 1FXZA 3HT2A 4ZU4A 1O5LA 3FWEA 2HJIA 5KHJA 3IIAA 3D0JA 4HVQA 4OLLA 4DINB 1DZRA 5JSOA 4HBNA 4KWKA 3ELNA 1QXJA 1SEFA 5FPZA 5J48A 2XHKA 3EJKA 4MGZE 4IERA 1VJ2A 3PVBB 2CGPA 4LA3A 1CGPA 1UIJA 2Z69A 2IC1A 4PIZA 1LB2A 5CVRA 1Y3TA 1IPJA 3CO2A 4K8FA 4LEJA 5KHHA 4XFHA 3UKNA 3LOIA 3EQEA 4ZU7A 4BHPA 5LEJA 4I0BA 1QWRA 3G7DA 3IDBB 2WFPA 5J7MA 4R8HA 2BNOA 1UW8A 2Q0AA 3ST7A 2C0ZA 4HMZA 4XEZA 3KGZA 4BH9A 4PJYA 5FLHA 4ZU5A 4Q0UA 4E2QA 2CV6A 2H6BA 1UPIA 3FE5A 4XFFA 4I09A 5I0SA 3EO6A 3FHIB 2B5HA 5D1IA 2D5HA 4UBGA 1WA4A 3N4MA 1CX4A 1YFXA 4HN1A 1DGRA 5LRSA 4PIYA 3RYRA 1DGWA 4IEPA 4QM9A 3LA7A 3OGJA 5I0TA 3M3IA 5BUVA 2XL7A 3RZZA 3H7YA 2QDRA 4HZFA 4XF4A 1Q5OA 1CAXA 1IPKA 1FI2A 3BCWA 2ZCWA 3S7EA 2B8MA 3RDIA 2Y0OA 3E5QA 4ORFA 3NL1A 5EZWA 2H0VA 3D0SA 4I02A 4I2OA 3RPQA
chains in the Genus database with same CATH superfamily
1ND3C 1ZRRA 4I01A 1LAJA 3FLTA 2PA7A 4IE4A 2A6WA 4IQPA 3D82A 1DYOA 1VRBA 2UURA 4KBBA 4XJ8A 4QB2A 3T1LA 1YYNA 2P2KA 2QNKA 3VBUA 2EAAA 3FN9A 4JGZC 2RM22 3W58A 2XJUA 3HT1A 5CYYA 1GWMA 1RUNA 4QKFA 4Z1VA 4JQTA 4WM7B 4XCAA 4AI9A 1WA6X 3WLUA 2ZGOA 2WYFA 3WOGA 3ZM8A 5JXHA 1DU3D 4FPLA 4LBJA 5CBLA 4YG3A 2RDQA 3VKFC 3GHMA 4E8CA 2AH2A 2E26A 2D6PA 2OXBA 2P1BA 1H1MA 2VQTA 2IFWA 4IEUA 3VBUB 3ZFGC 2FCUA 3WNMA 3SXWA 1D7PM 3VBRA 1S0GA 1YQCA 4B7KA 1F2NA 3TN93 2ZXQA 3OD0A 2IXIA 3FX3A 4LA2A 3SCHA 2QQUA 1LGBA 4K6BA 1XYNA 2WZPP 4CUBA 1GOHA 1RUC3 3V56A 4N7IA 4RR3A 4UFHA 1AXKA 5C5TA 3I49A 2JB8A 5A7PA 3WP5A 4EWDA 1GU3A 4I0WB 5A3PA 5ACA2 1OH4A 2A3XA 1K5JA 4CDWC 5I93A 1K12A 2ORXA 2CL2A 1W9WA 5D21A 5F3GA 1UY1A 5FOJB 2Z79A 3VBRB 4YW4A 5HV4A 1KDKA 2IXCA 3AX4A 1CJDA 1VRH2 1H8VA 2DURA 4YM0A 5A6QA 4DY3A 5BNQA 1ASJ2 1DYKA 1ND3A 1OVPA 2CNAA 4H3WA 3ES4A 1FOD2 4RR3B 3NJZA 1OKOA 5LZ6A 3H3UA 1SQ4A 4CCEA 2XBO3 2A5ZA 2BERA 5LEKA 3AMMA 5T50A 2ZA9A 4FPYA 4JGZA 1E5SA 1YC61 4ZZ5A 4KWUA 1PMIA 2WRAA 3GBWA 4R9CA 1CJPA 5A80A 5DZFA 5DAQA 1GNYA 1HB3A 1BMV1 2WZR2 1W39A 2PN5A 2WLPA 2WO1A 4C0HA 1ND3B 3FUOA 1X7NA 5ABJA 2WKKA 5L9VA 4FOYA 1DF0A 1MPXA 2UU8A 2A71A 2WWSA 4PF5A 3PMSA 5TSWA 1XJAA 1PVC3 3WG4A 5LWBA 1G9BA 1LU2A 2H0BA 2B42B 2W0XA 5CADA 2ETEA 2Y6FA 4JGZB 1RL3A 3KT7A 5F3IA 3ZFGA 3MIFA 5T5JA 4XF0A 5FPVA 3TAYA 1RYYA 2IXLA 3TN91 1YUDA 3CNAA 5FZCA 3TOJA 3I3MA 4OFGA 1PO13 1XXNA 4IGOA 5ABJB 1IG0A 4ASMB 3GJBA 3JD72 2DWRA 3QBQA 5CISA 3VKOA 1OA4A 2BGPA 2WFF2 1RUG3 1OA2A 2WUHA 1T2XA 1Y9QA 5FAXA 2VTXJ 5ISLA 4CDWA 4XC9A 3OG2A 3ZFGB 1HB4A 2DVAA 4HSJA 2V73A 2XUEA 3CHXA 5AFBA 5FDBA 2QZ2A 1STMA 3DKWA 4Y4YA 3SITA 1C3HA 3GBFA 1GWLA 2XJRA 4A7YA 4N9HA 1PMHX 3WEZA 4ASLA 3O1SA 4XXPA 1HRV3 1Y9MA 3VHNA 3NKTA 4F3JA 1JYVA 1IHMA 2XBO1 4Q8LA 4HSLA 4C0BA 4K1ZA 2O1QA 4CDWB 2AENA 4O7XA 1XE8A 1XNAA 3HJRA 4DEVA 1LR5A 4EN8B 2PLV2 3I59A 3WD5A 1CAVA 3D5OA 4D6RA 5FZ6A 1YJKA 3AJYA 4B4RA 5B2GB 1Q8QA 1LESA 3KHBA 4IETA 1Z78A 5C7GA 3R4SA 3PVOA 3GXUA 4WVMB 1OT5A 2XQRA 3RWNA 4DXRA 4FI9A 3NNMA 1WW6A 2E51A 2RS52 3MW4A 1JN2P 4BPZA 3INAA 1PVC1 1G86A 1XNBA 2EF6A 4GALA 4V2VA 5FYHA 1FNZA 5FYVA 3WP6A 3ZYHA 1I3HA 4NRQA 4BU2A 4GWIA 4LUKA 3OGSA 3OUIA 1HW5A 3I59B 4QGLA 1S55A 5JOXA 1V6NA 4S2DA 2VBBA 1PO11 1YLLA 1RUI2 4E2SA 4P5YA 1RUG1 1KEXA 3CMGA 1NLRA 4IEOA 2VAUA 4M4PA 1R1A3 4UOJA 4Y22A 3SKVA 4Q4Y2 3UGGA 1C5IA 1BZWA 5FZ3A 1VIWB 3LDKA 2Y6GA 3V64A 1S0CA 3AP7A 5EP9A 1W6QB 2ADDA 4FPCA 3AXEA 1HN1A 3UV9A 5K8SA 3SHRA 2RVAA 4XFCA 1HRV1 1D4VB 2P37A 3WW4A 4QQLA 4C1WA 3LDRA 4LKSA 1AYN3 4UAPA 3TNPB 5I0RA 3WDVA 2KXLA 4BMEA 1IG3A 1KFXL 2YROA 3N7KA 3DYPA 1W6NA 4OULA 3ZYIB 4Y22B 2ZZJA 4NHXA 1X82A 2VOTA 1E5RA 2WS93 3AYAA 4KQ7A 2GU9A 5FXXA 3S30A 5HBAA 3OGVA 4XHXA 4YW2A 2BVBA 2W68A 3VL9A 4AAPA 2WSVA 3AMQA 4LK6A 1QXRA 2XOMA 4XZUG 3FLRA 3H3ZA 4QKNA 2G9ZA 3ZOIA 1NOVA 4NHKA 4AYUA 2J1EA 5LA2A 5FLIA 4CP1A 2ARBA 1W05A 4UI9L 3VB9A 1EAH1 1W6NB 1WD4A 3O12A 1AJOA 4N8MA 2P6HA 3PTYA 2X05A 4A4AA 1EY2A 1LOCA 1HXS3 4H55A 1RVF3 2V5DA 2G9GA 3BTAA 4DY5A 4COZA 1VAKA 2BP6A 2IVJA 4XDQA 3WDWA 3WF4A 5FR3A 4HK8A 1WCQA 4IW3A 5FOBB 1LOEA 1AR93 2QQIA 1MQTC 4UFLA 1R1A1 1AR82 1XU1A 2DCJA 2JE7A 3CJXA 3H8UA 4YZ4A 2WT1A 1VBB2 3AKPA 4QU2A 5FYSA 1WCUA 3AZYA 3LDBA 3GALA 4IEVA 4ARYA 1NQJA 2W46A 1F4AA 2Y38A 4CU7A 5KBFA 4G4FA 1BBT2 5JI9A 4FPHA 4K1YA 4YW6A 4HN0A 4QQPA 2E9QA 4QQHA 1CQ9A 2A73B 2B4KA 5IVEA 1AYN1 3RI9A 1S1AA 4TYSA 4CEYC 2YFUA 3SH5A 3S57A 3R4UA 2NMOA 2L9LA 2WQ8A 4J1XA 3ZSLA 3ZLIA 4LBQD 5JVVA 1U5YA 5I0UA 3MZHA 4LO8A 4CCMA 1WLTA 3TEZA 4LQRA 1RIRA 2DU1A 3H9AA 5FO7B 1YIPA 2AYHA 1YQ6A 2BNNA 4XETA 4AGVA 5JIUA 1VPHA 2HYXA 4CDQA 1XNCA 2XH6A 3SQOA 1NXMA 2VBDA 1OMIA 2D93A 2ZEZA 4CTEA 2GNBA 3T2QA 3THCA 1BVVA 1UNBA 4URTA 2PYTA 2A75A 3VHRA 4XFAA 2I07B 1HXS1 4YW7A 1RVF1 3MICA 5FJHA 3N36A 1TQ5A 1EUUA 3OSDA 1GMMA 1DQ5A 1C4RA 4IEZA 3NV3A 4P9GA 4YW1A 4CDQB 2AGSA 1DGLA 2CSGA 3U1XA 1RMU3 4YVSC 5FBZA 3WG2A 1UL9A 2YV8A 3ZDSA 2PMWB 1AR91 1MQTA 3RZGA 1W8UA 1RUOA 3O0WA 1XQNA 2JDPA 2VVFA 1MS9A 1U0AA 2ZKNA 4UYBA 1FMD3 3VBFC 2RR13 3GM8A 2J1VA 2OZJA 1BEV2 1VMHA 3POYA 4L97A 5D2AA 5F37A 1QH7A 1J58A 1ZZ6A 2D97A 3IN9A 3LB9A 2D98A 3UK9A 4A3ZA 4KH9A 4GMP1 2ZGSA 3DEMA 1RJ8A 4LHNA 4KG8A 3QCWA 1IS5A 1QJX2 2P3YA 3A21A 1MQTB 1Y43B 2JG9C 1X8EA 3D4KA 3HQUA 3I3EA 4MSVA 5FZBA 2XPJA 2XGXA 3MDPA 2PHWA 4Q27A 4NO4A 3KWVA 1ULPA 2YC4A 4PDWA 3UJQA 4D7SA 1KS4A 1O6UA 2UYAA 1IS4A 5FJKA 4PI2A 4CCKA 4D94A 4H14A 3NVCA 1V0AA 1HJGA 4MXWB 1AXYA 1PO23 4QX8A 1S0BA 4KGGA 3G6JB 1UKRA 3I2IA 4YYOA 1REFA 4FT8A 4LORA 4EZ4A 4ISRA 3RJ2X 1H2LA 4XQWA 1QH6A 2CHHA 4AFBA 3AP4A 4CCCA 3O7OA 5F2WA 1RTVA 1S0FA 1OC1A 2AEYA 2Y0IA 5HV0A 3MIEA 4DXTA 1DQ4A 2D40A 1K5MC 1LHVA 1S0JA 5A3TA 3KQRA 1ZBE3 1NX9A 4YGEA 3ZYJB 1IGOA 2FDJA 2W9XA 4YVSA 2QJVA 4CCOA 1RMU1 1WBFA 5IK4A 2WIIB 2PQQA 5DG1A 4ZY9A 3LPGA 1GSLA 5FZ0A 3VBFA 2QQPA 1FMD1 1F4HA 4K8RB 2RR11 4FFGA 1NCQC 4OI0A 1GYKA 3ENRA 5FYTA 4C8DA 2BGCA 3BB6A 2KA3A 4TLGA 3DPRC 2JD9A 2C9AA 2Y6HA 2Z42A 4J1WA 5A3WA 4YVSB 2DYCA 3JQXA 3A0KA 1F31A 2A3WA 2JG9A 2C26A 5JOWA 4BLJA 4Z8BA 1UXXX 2NZ9A 2GDFA 3VBFB 2A6VA 4GWMA 4RQPC 3RG0A 4E9KA 2HWC1 1PX3A 1PVXA 1IPSA 1BHGA 2A70A 1PO21 2HEYF 1AHSA 5JIAA 3VD5A 5JPMB 1RUH2 4QGNA 3POFA 4XJAA 3TWIA 2J42A 2P3JA 2ZEXA 3GCWA 4QXHA 2JG9B 3A7QA 4Y1XA 5DPNA 5A7NA 2VJXA 1VMFA 2XHNA 2XKOA 2J7MA 1YI9A 3SMHA 4ASKA 1M4WA 5BY5A 2G4IA 4Q4X3 5F3CA 1CESA 5CEHA 3VBOC 1K5MA 1XBFA 3ES1A 5J96B 1A8MA 1O5UA 2ZGMA 1O8SA 2WDBA 3V0BA 1JHNA 1X8MA 4ZXEA 4AE2A 1ZBE1 2DCYA 4F8AA 3DXTA 1WMDA 2SLIA 4O9GA 1WCDJ 1VBE2 2GH8A 1R091 2OUHA 1O5LA 1UY2A 2MEV2 1JMUB 2WN3A 3PDQA 5SV5A 3VD3A 3KB5A 4HVQA 3ZYPA 3H8XA 1AR63 2XMLA 4M0NA 1JBCA 4IE6A 2X5IC 5DUVA 1NCQA 1XC6A 2EALA 4YM1A 1TMF3 1K5MB 5IVYA 2CDPA 1DZRA 1Z0HA 2BUKA 2VE1A 4MHRA 4AVSA 1RXFA 2C9KA 3V0BB 4BQ1A 1QOSA 1PGL2 3DPRA 1YQ5A 2WR9A 3WP4A 3WQ7A 3EJKA 3HVDA 1MS3A 4CZSA 5IFTA 2CGPA 1HRI3 2GP5A 3MGUA 3VLBB 4K8FA 5FYBA 4V2WA 1EUTA 4RQPA 5H9PA 1NCQB 4W6WA 2VW0A 2YY1A 3EQEA 4COYA 4K3UA 4QDRA 3EMRA 3GGLA 3IM0A 1JZ8A 3BKZA 2WNEA 4FTSA 3WT3A 5LEJA 3DPRB 3G7DA 1SDWA 5DABA 4L92A 1ULGA 2VCMA 3MFCA 2W95A 3NMBA 4N53A 1IKQA 1SLCA 1UW8A 2Q0AA 5FZMA 3MIDA 4HMZA 3LGRA 3THPA 3HQRA 3LEGA 2D7FA 2FZ1A 1VB4A 4RQPB 1T6GC 5A6YA 3LF7A 4Q4X1 2CV6A 1H2MA 2D44A 1KFUL 5FYZA 3MIHA 3VBOA 4B7EA 1UPIA 4NRPA 1RHI2 4XFFA 1ZYBA 3AFGA 1H30A 3HNMA 1LHWA 3FHIB 4N53B 1QU0A 5FMOL 2BBVA 5FPAA 1GBGA 2RE9A 5IK8A 1POV0 3PVEA 4QDSA 1AR61 1CN1A 3AFKA 5K9YA 5DUUA 5LRSA 2WT2A 3VBOB 1JYWA 1TMF1 3RYRA 1O59A 1VBC1 3MLLA 5FZEA 5DAXA 4CXWA 4ATEA 1F15A 1U5ZA 2XL7A 3IDAA 4AR2A 1VE0A 2RMU1 1Q5OA 3WDUA 1NY72 2R1BA 2G9FA 2B8MA 5IW0A 1H2NA 1PGSA 3RDIA 3WDTA 2Y0OA 4DXZA 4P9XA 2VZPA 2X5IB 3FMGA 1UQXA 4LBLA 2H0VA 4I02A 4JZRA 4RL7A 3OD4A 1WWYA 1H1AA 2HEWF 1Z7S3 1UMZA 5ANQA 3ACHA 3MF6A 2OPKA 4ZXKA 3R05A 2E63A 1D4M3 5IAVA 1XE0A 3AKQA 4KI5M 4QU1A 2R063 1WW4A 2VVDA 4ZONA 4NIIA 5FBJA 2P4EA 1C8M2 4M01A 2PHRA 3ITQA 3MF9A 4E4HA 3EHKA 5F6KA 1KRIA 1Q8PA 4BCUA 2JDUA 3PNAA 5FUIA 2ZHKA 5JXGA 1QQP3 4OI4A 2VUAA 4FSJA 3U07A 5DDJ3 2D6KA 3UJOA 2EIGA 3E6DA 4OUMA 3LEMA 3BIEA 3KCCA 5C3QA 1HB2A 1LEMA 4FOQA 3SH3A 2D6MA 4HKLA 1AR72 3BALA 1U5IA 1PZ8A 3OY8A 1OI6A 2WWJA 4JVAA 5A6XA 3I2JA 2W94A 1ULFA 3WSOA 1ULCA 2ZGNA 1OA3A 3ORJA 1SPPA 3QLQA 4EN7B 1OLME 1SLIA 3WF1A 3OGRA 3AMHA 3J9SA 4QQOA 4JRAA 3I54A 1EV13 3W9AA 3MI8A 1A6CA 3HEIA 1UZ0A 2VCCA 3OY8B 2NPIA 4JGYC 4BB3A 2CAVA 2W87A 4QDQA 3MFAA 4B1MA 2QQWA 1OQEA 3N9OA 1XYOA 3U14A 1HV1A 1ZBA2 2JKBA 3RFRA 4YARA 2HWD3 1SPPB 1H2KA 2ZZQA 3HN3A 2RS12 3R4DB 3WDXA 4GWNA 2GC1A 5KC5A 4YZ1A 2GH2A 1NQDA 5CFDA 5FZ9A 1UIKA 4CPBD 4GAZA 1W0NA 4MYEA 4CYDA 4Q2FA 1US3A 3K48A 4LTAA 3WQ0A 4TWTA 3ME2A 1GOFA 4LJHA 4UBHA 1S0DA 5A1AA 2A7AA 4UW3A 1WLCA 4MOAA 4K21A 1FOD1 1PGW1 4XTPA 4LKFA 2DFCA 3SKJE 1A34A 4QPYA 3WY6A 2UWCA 5FPUA 1D2QA 1W3XA 1GR3A 4XBLA 2QKDA 4BDVB 2HWB2 4Y1YA 4XHBA 5F32A 4CDXC 4OUEA 2XLGA 3OB8A 5CFDB 3ZSMA 4PLMA 4XFIA 1SCRA 4A7ZA 1ZZBA 1PNGA 5DG2A 3CU7A 1T6BX 2PHXA 4IXLA 4QX1A 1ZRIA 5FZ1A 1QDCA 2MNGA 2VOXA 1VAVA 1BKZA 3KV9A 5CU1A 1TZOA 1HIXA 1DBNA 1JW6A 3RZMA 2W1QA 1H4HA 4KWLA 5E16A 3S5AA 1YNAA 4X8PA 4JDNA 4ZZ8A 3NV1A 3K3NA 4WZCA 1EV11 2DBNA 3KVAA 4JGYA 5EQUA 2EIDA 3VZMA 3RZJA 4CP9A 2F4PA 3Q8AA 3I2FA 1OF4A 4UW5A 2WT0A 3J8F2 4QM8A 1BLZA 1QJY2 4MH0E 1W3VA 1V9U3 3SCFA 5CA6A 1PX4A 2P34A 5EYXA 3VBSC 2WFF1 5E8AA 4K9SA 3VZOA 2D3PA 2VZTA 2YPJA 1ZVFA 2QFEA 1VBD2 3IT8A 2PHLA 4HOOA 4N7UA 1AL22 1WCKA 3PIJA 2HKXA 4NN0A 1MVEA 3VBRC 4JGYB 3WW2A 5LA9A 1MR5A 1TE1B 2XKPA 4CP9B 4UW4A 2YGMA 2PAMA 4PI0A 5FTTC 1XSRA 4QPGC 4RR3C 3FBMA 2WL1A 1ZZ8A 2GNMA 3AP6A 2ERFA 2FDHA 3C7GA 1G6NA 1MZEA 1SBEA 4META 3U37A 4CDXA 1W28A 1NUKA 4W4ZA 4QQ2A 2BU9A 4COUA 3M3EA 2WZEA 3HPNA 2AREA 2PLV1 3EB7A 3RVHA 3UGFA 2ZAAA 2HEVF 4Q0PA 5FXVA 5BXXA 3POGA 2KD7A 2FQPA 1URXA 2UYBA 4LITA 2DUOA 5FUNA 5FYCA 5B4NA 4O65A 2EAKA 2GZWA 5APAA 4NRMA 3PUHA 2X8KA 1LNSA 2R0FA 4CDXB 4TLFA 5JSRA 1I9RA 1UMHA 1COV3 3I3DA 1TME2 3CEWA 3NRUA 5JCTA 1LJ7A 1DZQA 4I3GA 3TRSB 3ZXEA 1FPN2 3LCPA 4AQ2A 1QEXA 2D43A 2RDNA 2WO2A 3A0NA 5JXIA 3BU7A 3I8TA 2Q4SA 4H7LA 3PTRB 2F4LA 1ACCA 1R082 1UOGA 3Q8BA 4QHZA 5ABJC 3PJQA 1V9U1 3GNEA 3VBSA 4OQ9A 2YC0A 2W1UA 1CX1A 2I2SA 2XB6C 1D0HA 1V6JA 2RDSA 1DQ1A 2ZMNA 4XURA 3ZO0B 3ZN5A 1ZZ7A 2C5DA 3GHNA 4NHYA 3OPTA 5FIXA 1FYUA 4LE3A 1LOAA 3WW3A 4EJRA 4YW5A 2O14A 4QPGA 4R4ZA 1W03A 3ZMOA 3O1PA 1LOBA 2GP3A 3VBSB 4E2GA 1RUD2 2VQ0A 3KD4A 4IESA 1NE4A 2QUOA 3AC0A 4XCBA 3HNYM 2VZSA 3UL2A 1K42A 4K7JA 1U5XA 1UXZA 4CRQA 1W8OA 1MS4A 3EYPA 4PLOA 4WVWA 1ZZCA 1W2TA 5KR7A 1UMIA 1MEC3 2XWJB 4IEXA 1AJKA 1OLMA 2OZ6A 1BJQA 2XR4A 4QPGB 4AVTA 2HWE3 1EPWA 2AACA 1QNYA 1RC6A 2XDVA 2XONA 4XDOA 5AVPA 2FZ2A 1Q56A 5EYYA 3AKRA 1COV1 3IAPA 2Y26A 5A32A 5F5CA 2BFUS 4FPFA 3ZSJA 1W8NA 2J1SA 1ZX5A 3J4UH 4FP2A 4ONUA 3THDA 3UYJA 4AW7A 1QDOA 1S0EA 2ET7A 3UGHA 4P00B 4CUGA 2XLAA 2VUCA 1UZVA 3N9MA 1FAYA 2QVSB 5A7QA 3L2HA 5ANNA 3WHUA 2WNOA 4PBPA 1G7YA 2VQUA 5FPLA 3N35A 1MZ5A 2PHFA 1O3TA 1KJLA 1VBA3 4C1XA 1B35C 1Q8SA 4LHLA 3BYWA 2TUNA 3FFQA 3GBGA 4JDMA 4YGCA 1AR81 3O1OA 1C1LA 4GD4A 3PHMA 3NKGA 3ILRA 3WNKA 3E6CC 5FYUA 2BPA2 1SLTA 2VMHA 4FPOB 4HVOA 4QGMA 4RFT0 3TEWA 1OUXA 4MHUA 5JUVA 3ZSEA 5H9RA 3P3PA 3A4UA 1HQWA 1UX6A 4IUGA 4QXKA 1X33A 2D3SA 3J26N 2Y6KA 4CA9A 4KWJA 5JXJA 3AKSA 3P1IA 4UXAA 5LBCA 1J84A 1O91A 2O8QA 3JU9A 2X29A 3ZIXA 5AC92 3T0DA 1MEC1 4LE4A 3WQ1A 3WNXA 4AF9A 2WC2A 3H8OA 3N9QA 2HWE1 1I6XA 2W08A 3ACGA 2WAOA 5DZEA 3ZDVA 4FXKB 2XJTA 1V70A 4FBFA 2BOJA 2BTVC 1ND2C 1UAIA 1MZFA 4L8QA 5EV7A 5F5QA 4CCDA 4Y20A 4GA9A 5IVCA 4QKDA 1F5FA 2LROA 2GC0A 2GC2A 1Q8OA 1SBDA 1JOPA 2BJSA 2JE9A 4DO0A 1UN1A 5C5UA 1XNTA 5DZGA 1AYM2 3MW2A 2ZS6B 1RUE2 3NV4A 2F6BA 2OPWA 4D0QA 5FZOA 3DL3A 4FPGA 3UNPA 3RMXA 1B35A 1EAH3 1VBA1 3GZAA 3Q9OA 3T2TA 2JX9A 3AL6A 3CQOA 1H8TA 1NZIA 4KNCA 4Y20B 3ZR5A 1KGYA 2FDIA 2MHFA 4NVPA 4C90A 1CAVB 1JOBA 1QJU2 3HNBM 5FRAA 4EROA 1NXD1 2XUMA 3NSTA 3SC7X 4DFSA 1S0IA 1ZNPA 1KITA 3DYMA 3PL0A 5GZFA 2IUWA 4NAMA 1WW5A 4G3YC 1HDKA 1PIV2 1W9YA 3IKWA 4Y1UA 4CE8A 4E27A 4EWEA 3BU0A 1UYXA 2VD7A 1L3JA 4N43C 4L2NA 4AZZA 5FZOB 1B35B 4KMQA 2ZJCA 1H8TB 2IWGB 4IEWA 1HJFA 3H1WA 3J7HA 4OZOA 3C3VA 4ZS2A 1JUHA 1UZYA 2X09A 3THTA 3BVCA 3CJIC 4FXGB 5F5IA 5FYYA 2WSUA 3UT0A 2OT7A 1M06G 1CVNA 4Q26A 4HETA 4B8EA 5IYYA 1DHKB 1ODNA 2C4XA 1C8NA 3PMEA 1LHUA 5FZDA 2W52A 5LA0A 3DECA 4RHV3 2FD8A 1ND2A 2EXKA 4YNIA 2ZAHA 3ACFA 4QPWA 3ZVXA 4XF3A 4YFWA 4IGPA 1YWKA 4WVZA 2D6NA 5CG8A 2PFWA 2Q8DA 4AHZA 5GALA 4DMIA 4Q4W3 2OVUA 3E6BA 3RYKA 3DYOA 4CDQC 3EBRA 1US2A 3AL5A 4OHXA 4V1PA 3RI8A 3I3QA 4LULA 4O61A 1ND2B 4PHZA 2AUYA 2YXSA 2NMNA 2VPVA 2R073 1IQAA 2E6VA 2I45A 2DU0A 2Q1ZB 4LLOA 5M0TA 4UW6A 3CIHA 2J22A 2XVLA 3CZJA 1NYWA 3TB0A 4N43A 5J36A 1X9TA 3TEXA 2HWF3 2JDAA 4ISQA 2A1XA 2DVBA 3FFZA 4AGGA 1JZ5A 1QNWA 3C7OA 1NCRC 1Q43A 1UKGA 2BEOA 3CJIA 4NWVA 4EE2A 2CWSA 3SNMA 2DFBA 2Q1MA 2VNOA 1ONAA 1RUJ3 2ZPXA 1BMV2 4GMP3 4N43B 3D3AA 4OMCA 4D3WA 3NNLA 2V4AA 3AVRA 1YFWA 3HD8B 4TSVA 4RHV1 3VHPA 4AVAA 3AYCA 3NNJA 3HT2A 5FK8A 4AWDA 2ZX3A 1LEDA 3VDDC 1CPMA 3N9LA 3FWEA 3K46A 4XUPA 3T0AA 5KHJA 3IIAA 4PDWC 3WNLA 5FO8B 2Y34A 5IVVA 3CJIB 4OLLA 3MO4A 3APBA 4Q4W1 4XW3A 3TN92 5FV3A 3ZXKA 3ELNA 1QXJA 1YRZA 3KM5A 4M3CF 4XABA 5FPZA 3KS7A 5IVBA 2YDEA 3D8CA 3M3CA 1RUC2 5KXBA 4LA3A 3ZMNA 5DMYA 1UIJA 2Z69A 2ZEYA 4XJZA 4A6OA 1LB2A 1CGPA 3USUA 2R071 1IPJA 1LHNA 1QJZA 4PF1A 3UKNA 3HWJA 4MGSA 3CDZB 4Y3OA 2Z4FA 1ZM1A 3T3YA 2VZOA 4I0BA 3PUAA 3VD7A 1QWRA 2JJ6A 3NAPA 5JPNB 3IDBB 3M1HA 2WFPA 2KM2A 5T54A 3B9CA 2ZMLA 2E31A 5J7MA 2HWF1 2YGLA 4AFAA 2XBO2 2ZGTA 5LATA 2R043 1NCRA 2C0ZA 2ILMA 3I2HA 3K75B 3ST7A 1V6KA 3USUB 4BH9A 4L9BA 2FDGA 4PJYA 4XIOA 1FX5A 1OBNA 2WAAA 2FDKA 2VNRA 3PJYA 2ZX2A 1RUJ1 3WF2A 2F17A 4I09A 5FK7A 3NAPB 4QPIC 4JHZA 4LMFA 1HQLA 5FKCA 1SFYA 3EO6A 2B5HA 3MIBA 1OSGA 1DIWA 4GKYA 4WM8A 1PVC2 3VDDA 3N4MA 1NCRB 3HOBA 4W50A 2WWUA 4LHSA 4BQ3A 4PBOA 1G9CA 4HN1A 2HWC3 1CONA 1W6MA 4UFKA 1SACA 1OPMA 1DGWA 1RHI1 2RV9A 3O5SA 4IEPA 4BM8A 5HCBA 1GANA 4CCLA 1UU6A 1HQNA 1PO12 3AMPA 1AUYA 2YU1A 3IIIA 2A6XA 3H7YA 2QDRA 1H6YA 2R32A 3CBNA 4XF4A 3MBWA 4WM8B 5BNOC 3O1VA 1RUG2 3VDDB 2UWAA 4JKKA 2J1TA 5BYNA 2Q8CA 4PDWB 3I2DA 4ZHNA 1WW7A 4ET7A 4ITCA 4QHOA 5H9QA 4ORFA 1W6MB 1RB8G 4S2GA 2DUQA 3NL1A 1PZ7A 3OOXA 3ZPOA 3ZXJA 2W2IA 5A70A 1IZ3A 5G05L 3M3OA 4Q4V3 2GN7A 2RJ2A 4XYXA 5KXDA 2P5BA 3K77A 1DGRN 4EV0A 2PHUA 1W04A 4LPLA 3AZVA 4RSUA 2ZOEB 2G19A 5FP4A 2JDZA 1HRV2 1GNZA 1R093 2QDNA 2XJVA 1MZ6A 5ERLA 2D6LX 2R041 2CU5A 4YG0A 5FXWA 2BZDA 2GMPA 1OHFA 3POIA 1ZRFA 2DCTA 1SFPA 2FHRA 4M4RA 2V09A 5I8SA 4QPIA 4P9LA 5LW9A 1K3IA 2VMIA 5L73A 3ZIWA 5FZ7A 4YW3A 1GWKA 1YCIA 1ZRDA 2VQAA 4Y5Z0 4XBNA 4AGRA 1WMEA 4I0AA 4TTGA 1CZTA 1TEIA 1O7FA 1XSQA 1E5HA 4EYUA 5H9SA 5T55A 1POV1 3BN6A 3POJA 4AL9A 2VMGA 1NZCA 1BCXA 1DQ6A 4QPIB 1NA1A 5IT6A 4FPKA 3C2UA 4XAEA 3X29B 2OX0A 4O9EA 3RGBA 4FAHA 1C28A 2Y8KA 1W8FA 3FLPA 3MLJA 2WQZC 3WZ1A 4ES8A 5BNOA 1BK1A 4N53C 5C70A 3DXUA 5DQ0A 2J1UA 4YGBA 3LOBA 4AI3A 1AR71 1ULOA 2B39A 5FP8A 1OD5A 1APNA 2ORZA 2FMYA 2V72A 4LHKA 1R1A2 1CZVA 3AK0A 2GNTA 1O4TA 1LOGA 5A6ZA 2UY9A 3QD6A 4Q4V1 4D6QA 4M00A 3VKNA 2JD4A 2PHDA 4GJZA 1NA1B 1PK6C 4RGGA 1H1IA 5FZKA 2K9ZA 4BLIA 4LO7A 3O1TA 5BNOB 3AYDA 4Z07A 4W6YA 2DTYA 5LB6A 1AYN2 4NHMA 5J1XA 1E5IA 2EVXA 2JDKA 3Q8EA 2CAUA 4E4SA 1RUF3 5IAXA 4KGQA 1LU1A 3T09A 2Q8OA 4NIHA 4BMBA 1VBC3 4LBNA 1XB9A 4Q0QA 2WS92 4J25A 4Y33A 5EJ3A 3U4SA 4OHYA 3SISA 3FC0A 3FHAA 1O4ZA 4GB33 1GQPA 2RMU3 4YG6A 3KV6A 2O0OA 3ROUA 4DS0A 2QQLA 3QH7A 4HFSA 1PM4A 4QB1A 3SEPA 3ZYRA 5A1LA 1V00A 5C3PA 1DFQA 1A8DA 1PM7A 4YM2A 4BIOA 4NWWA 4AAXA 3IAQA 4E4DX 1O3SA 5E88A 2HYKA 3JBG3 4XF1A 4E8DA 3IWZA 5GZEA 1HXS2 5FZHA 1LENA 3LZZA 1RVF2 3ON7A 3I7DA 4B1LA 4BQ2A 4BQWA 4HG6B 2HWB1 3LSDA 4YM3A 2OW4A 2RS33 4CP0A 4XTMA 1HN0A 5KWRA 3PLQA 1AR92 3L2YA 1CPNA 4GH4C 2XVGA 1AX0A 2QQOA 3H1MA 1LTEA 2GMMA 5LBEA 4AHWA 2HLEA 2BNMA 3ZYFA 4XUOA 1JTZX 5GM0A 1REEA 4Q8KA 1DQ2A 4CCNA 1PK6A 3ZYGA 2RM23 1N1VA 2P6CA 2UWBA 3MPBA 1H4GA 1RJ7A 1FV3A 5J98B 3NW4A 4BQ5A 3W5MA 1RUF1 3MV01 1WMXA 5FP3A 4FAGA 4JCKA 1UD1A 4JDOA 2Z2SB 1SHWB 2VY0A 1UPSA 2BGOA 3HR9A 4GZ9A 2K0GA 1PK6B 1GUIA 1CAWA 4GB31 4NIAA 5HCAA 1O3QA 4BIFA 1ODMA 4BJ0A 3GZEA 3I4IA 4HONA 2VO5A 1QIQA 5JDBA 2FDFA 4NROA 4DUVA 2ATFA 2VCAA 3IMMA 1YFYA 5FY9A 4CUCA 1UOBA 2EA7A 5FZIA 3JBG1 1Y9GA 1LODA 4NUBA 2JE8A 4SBVA 4K40A 4Y26A 2QZ3A 2QQNA 1JU3A 4XE9A 4Q0VA 4CU9A 1IOAA 4COVA 1CAWB 1U12A 5ACA3 2VGDA 5A3OA 5F6LB 4NOTA 3T2OA 1OLRA 5HI0A 4HXCA 1GZCA 3B93A 4Y1ZA 2RS31 5CFDC 1YQ8A 1MVQA 4AK3A 1RMU2 1VRH3 1JS9A 4GH4A 3U10A 1ASJ3 4P5HA 4FTEA 4KL1A 3M70A 4ATFA 1MS0A 1W99A 1KS5A 1FOD3 1FMD2 5FPBA 3WF0A 2NM1A 2RR12 3MPPG 2DVGA 3K3OA 2P17A 5CKQA 3T2PA 3VKLA 3O0VA 5FWEA 3UKTA 1UOFA 5FZLA 1S2EA 4GKXA 3WINE 1DQ0A 2QQMA 1EPZA 3LE0A 2RM21 4XBQA 5DUXA 3WDYA 5CFCA 5KHKA 5GLUA 5JI7A 1JYXA 1MS1A 1DYPA 1YIFA 2K46A 2WZR3 4GH4B 4CPBA 4PQ9A 4A42A 1DGWX 4OCTA 1I5ZA 2ZX4A 4OHWA 3WUDA 3ZXAC 2TBVA 1LRHA 5I91A 3OBZA 1GZWA 4MGIE 3KLSA 1N1TA 4Y5SA 4MGQA 1RITA 1PO22 1DP0A 1CZSA 3MLKA 3MYXA 5CFCB 3J7NA 1LCLA 1VALA 1BQPA 3ZXDA 1DLCA 3QACA 4YSFA 3NV2A 2OS2A 4Y4RA 2JDNA 5LY1A 2JDMA 1ZRCA 2EXHA 3LKJA 5LBBA 3I2KA 3JD73 2OYZA 3FZ3A 5A33A 3LA2A 1GZWB 3RZKA 5F8PA 2DUPA 2WFF3 1ULEA 1QMJA 4EN6B 5DAPA 1ALYA 1WGPA 2VG9A 3POEA 5ACA1 3U78A 5IK7A 4JKMA 4M3CE 3KHCA 1ZBE2 1YEWA 4P9JA 4NR1A 1SLAA 4AEMA 1OFSA 3GZTB 1VRH1 5IATA 4BXSV 4MV2A 1ASJ1 3B94A 2QTWB 3FL7A 5FO9B 5A7OA 3UKVA 5A33B 1UU5A 4P9IA 4BE3A 3JB8A 2Q8EA 3H7JA 2VUDA 4XUTA 4FCAA 4NAOA 4XJWA 2P3IA 2OIIA 1JHJA 3FUQA 4S2HA 1CD3G 5G04L 4ZKTB 3NWKA 5IVFA 3AZWA 3TNQA 3FHQA 3WUCA 4GIQA 2PLV3 4DEQA 5GZCA 4A3XA 2WZR1 4HKWA 5K7PA 5CG9A 1W90A 2BDRA 3MIGA 4CCJA 4XPVA 1JYCA 3VKMA 2A6ZA 2W47A 5CAZA 5LA1A 2RS53 1IKPA 2IXHA 2WABA 2RDRA 2X10A 3LAGA 1WD3A 2ZMKA 3ABZA 4CUAA 3WP3A 1J1TA 4D69A 5HXVA 2VZUA 5A3LA 2GN3A 3ACLA 2G1MA 1JZ6A 3RMYA 1UU4A 4XAAA 1C57A 4RN5A 2SBAA 4SLIA 2EIBA 3K4AA 3OUJA 1W6PA 4YZ3A 1F35A 5LRRA 4KU7A 5EWSA 1OXCA 1RUI3 2D5FA 3JD71 4YZ5A 3K4ZA 3IDCB 4Q4X2 1CAUA 5F1RA 5FPXA 2DCKA 2YUEA 3DKQA 2W91A 4FO9A 1JZ7A 3M2MA 1EYBA 1PNFA 2XG3A 1HB1A 3B00A 1UYPA 3LIGA 4LXLA 3CF6E 1NT0A 3LPFA 4Q4Y3 3POSA 5C3OA 5L7OA 1W6PB 3LFIA 4INDA 4ZPIA 3DCQA 3U4XA 3IBMA 4P14A 1W8TA 1CIWA 1AR62 2BQPA 3E5UA 1HV0A 4D6SA 1JODA 2RHPA 1CAUB 3ZN4A 1TMF2 3ATGA 4LLFA 1DZTA 4YWAA 1V6IA 5F5AA 1W6OA 3ZKUA 1LULA 4YRDA 5EFUA 2VH9A 1W9TA 1P8JA 3KF3A 1N1SA 2ZEWA 3HMYA 4AOCA 1AL0G 2ARCA 4L11A 1HRI2 5L7OB 2PXJA 5FLJA 2DV9A 4AQTA 1OOPC 1REDA 2I74A 1Y4WA 1W8HA 5C71A 2JIJA 4BQXA 2RS51 5A3NA 5KXEA 2AEZA 1RUE1 4P02B 4A6SA 1NLSA 5CNAA 1WZXA 1W6OB 4NPMA 3ZR6A 1GQHA 4TZDA 1JXNA 3ETQA 4DQAA 3ECQA 2ET1A 4QKBA 3HN1A 2JDHA 2EXIA 3MEPA 1S4CA 2CY6A 2DCZA 3TYJA 3U11A 1GNHA 4K20A 2VTFA 1QF3A 3LQCA 3VDCA 4AQ6A 1RUI1 1PIV1 5J3UA 4LK7A 3I97A 3OPWA 1K45A 1O4YA 1WLWA 2RJKA 2R7EB 4H2AA 1W8WA 2BW8A 1GZ9A 3AM2A 3FBYA 3JB4C 5D8AC 4QAWA 1SCSA 3KVBA 4P9YA 1AR83 4Q4Y1 5J37A 3RWKX 1VBB3 2VZ3A 1N3PA 2E7AA 2QE3A 4OHZA 2VNGA 1BBT3 4AFDA 3NQHA 4MLOA 2HBUA 2VULA 3IB3A 1JH5A 3RZLA 2CTVA 1LGNA 2EIEA 3A23A 3AZZA 3MUY1 4A41A 2VMCA 3ZXFA 4XZPA 2PAKA 1D2SA 2O8OA 3GCXA 4AEJA 2WA4A 4AVCA 5LBFA 2QCSB 3KF5A 1YHFA 2VW2A 1SZBA 2GAUA 3NJVA 5JOZA 1OOPA 1XNDA 2A3YA 3PU3A 3VN4A 3K4DA 1H6XA 1JYNA 1ST8A 3DUIA 5DAVA 5A3MA 1G8WA 1WCSA 5JZGC 2YFZA 4NIGA 3B01A 4IEYA 3GYDA 1QGLA 5FZ4A 1Z7S2 3H8RA 5HCFA 4WZFA 4PCRA 3VZLA 1D4M2 3WW1A 3B9IA 4HLTA 3S0MA 2TNFA 2ZGPA 1FNYA 2R062 1X50A 1OOPB 5LASA 4LBMA 2EXJA 3ASIA 3D6EA 4M3CA 4FTBA 1PMJX 1W2NA 2WNUA 3HIFA 3LA3A 5BPXA 2OQ7A 3WHTA 4R9AA 4XJUA 1W0PA 3OYWA 4Q5OA 3JZVA 3KGLA 1B09A 4DRVA 2A6YA 4Q0SA 1PGW2 5D8AA 5HCHA 2YHJA 1QQP2 3OF1A 1X9PA 1H8TC 5DDJ2 4ZU4A 3RZHA 5A32B 1VBB1 1W2OA 3VHOA 1QKQA 3D0JA 1JU4A 1BEV3 2JG8C 3HBZA 1BBT1 4URAA 3VDAA 1QOOA 4LO6B 4M3CB 2WNUB 3T4VA 2YZ4A 4BWOA 2CGOA 3GDBA 3C7EA 3OYWB 4KWKA 5J48A 5IK5A 3O1RA 5D8AB 1QJX3 2ARAA 4MGZE 3PVBB 1AX1A 5FUPA 2VC9A 3F2ZA 4PIZA 5K4LA 4DUWA 2QQKA 3NJXA 2YBPA 1YJLA 5FZGA 1EV12 3LOIA 1BXHA 2Z5WA 1SG3A 4XJ9A 3SLIA 4XQDA 5A1FA 4ZU7A 4BHPA 5JZGA 4MADA 3WNPA 3BOPA 1WMFA 1NAEA 5A3UA 1RUC1 3OEAA 1OUSA 4LR4A 1W9SA 1O8PA 4IL7A 1LHOA 2HWD2 3SEEA 2P3KA 1VLNA 2AZ5A 2BWAA 3WNNA 3ZKYA 3K2OA 4WVVA 5JR2A 3KGZA 1JZ2A 4RGKA 3H42B 1OQ1A 4IE7A 4Q0UA 5C9AC 3A22A 2ZABA 1ENSA 1HLCA 3S6PA 2LS6A 3OBRA 3FE5A 5JZGB 2V5YA 2VZ1A 4XACA 2VZRA 4WVMA 2LM3A 1N3OA 2Q5TA 4BQYA 5IFPA 5D1IA 2D5HA 2DVDA 4FPJA 1ZA4A 1VMJA 4PQQA 1CX4A 2BRTA 2Y64A 1DGRA 3HAGA 2JG8A 4TN7A 1BEV1 4LBKA 1QHDA 1JZ3A 3KZ4C 4PIYA 2NP0A 1LOFC 4QM9A 4J6GA 3OGJA 4HKOA 5FXZA 5I0TA 4DOUA 3M3IA 1OQDA 5BUVA 2VZQA 1QJX1 4HZFA 1F9KA 2ZHLA 1CAXA 4LKDA 1FI2A 3BCWA 3S7EA 2ZCWA 4EQVA 3WXPA 4GJYA 1POQA 3ZYBA 1X36A 3E5QA 1JUIA 2JG8B 4A45A 1GV9A 1LECA 3MV11 5JOYA 1L7LA 5FREA 1QOTA 4BISA 4QX7A 2R6QA 2GMEA 1UX7A 1AX2A 3L9JT 1W6QA 3W21A 4CP2A 1CWPA 1RUH3 2BBAA 2LRPA 1GLHA 3CLPA 4JC1A 3O1MA 1V9U2 3T0BA 4LNVA 2JEMA 2RJLA 1KXGA 1CAXB 4OQ8A 3ZXGA 4AI0A 1YI7A 1VP6A 2B9UA 5FZAA 2D3RA 4EN0A 3BPSA 3R0RA 2RG4A 3KV4A 5F7UA 4MVTA 5C9AA 5I0DA 4XDPA 2JKXA 3KSCA 1W2UA 4EWAA 4HK9A 1DG6A 4A2UA 4AEDC 3ZN6A 1GKBA 5FQ0A 1RGSA 1RXGA 1VBE3 4OMDA 5FMOS 3ZFEC 3KMHA 2MEV3 4GQ7A 2GC3A 3R6SA 2E33A 2FCTA 5I8YA 1UY4A 1BK0A 4JTNA 3PUSA 4LBQA 2Y6JA 3KV5A 3PUQA 3AJZA 1H0BA 1Y7BA 4QWNA 5C9AB 2XLFA 3MW3A 3T4HB 5DUWA 4WBBA 5C8CC 3IPVA 4L0PA 4NIDA 2WINB 2QBXA 4BK5A 1LOFA 1XYPA 3E5XA 4Y24A 1CR7A 1H9PA 4MZUA 4RFRB 3ZN6B 5FQ0B 2VL4A 2JIGA 3I3BA 3NAPC 4JV4A 3O1UA 2PAEA 1VR3A 1XE7A 3OUHA 3MUZ1 2BOIA 3WNOA 4OI2A 4RA0A 2Q30A 4AHXA 1GP4A 3KT1A 4AXOA 4XMAA 4LBQB 4AI2A 4LO5B 1IS6A 3AP9A 3PU8A 1COV2 5A7SA 4QX0A 2E7QA 3OJBA 3OBAA 3IPVB 2OQ6A 1R1ZA 4QD2A 3KQ4B 1MS8A 4AG4A 4QMAA 1RUH1 2YC2A 3B02A 4LOSA 3BPZA 4WM8C 1MACA 5CIRA 2FMDA 1FATA 2ES3A 4X6QB 3RS6A 4DB5A 4EN9B 4YPJA 3RSJA 1J3QA 4IV1C 1OKQA 1SLBA 5EIYB 3O0XA 3I2GA 4W6XA 2ID4A 1RHI3 3ZFFC 2XQXA 1FV2A 2PTMA 4AEDA 4BQ4A 1KD7A 2C1FA 4N90A 5FCCA 2XWBB 4FP3A 5JSPA 1UY3A 4IE0A 2W1SA 2ZGQA 3OGGA 3ZFEA 1VBE1 5E1RA 5GLVA 2MEV1 2R16A 4AVBA 4N9IA 4HPKA 4YLZA 1HKDA 2ZGLA 2HH9A 2VZVA 4HVRA 5FMCA 4AEKA 4XIKA 4UFMA 5C8CA 4BZ4A 1GQGA 2WS91 1VAMA 4A44A 1PGL1 5IJRA 4AEDB 3ZXLA 1UYZA 3Q8FA 1MEC2 2CWMA 1Q8VA 3IZOA 5T3NA 4X6RB 1ZA7A 4XQ4A 4YVWC 3ZFEB 5BNNC 5GZGA 3UESA 5GKAC 1ENXA 2HWE2 2R1DA 4NPRA 4HL0A 4HPKB 3Q8CA 4OYUA 4CSWA 4FPEA 4JQRA 3T30A 3VBHC 1JZ4A 2DDUA 2GNDA 1AF9A 1ULDA 4FFFA 5FY0A 5C8CB 1UZWA 3AZXA 4GWJA 3H0OA 4R52A 3M4FA 5F39A 3RYPA 1J3RA 2B45X 1YQ2A 2ZTNA 3ETPA 5FMBA 2BWCA 4YZ2A 4W65A 2QQJA 2YBSA 1WLDA 4R9DA 3W59A 1C8M3 3GJAA 3PURA 3AMNA 4IV1A 1VBA2 2Y33A 3VZKA 1H9WA 4I3PA 4C91A 4Y5TA 1GICA 1POV3 3OBTA 4DUXA 4TXWA 4DNYA 1UOJA 3ZFFA 2E7TA 4JRLA 1G9DA 4RGAA 5C4WC 4COWA 4ES9A 1NA1C 3ILFA 5SV8A 4MXWA 3N9NA 4CXXA 3P6BA 4DZGA 2JICA 3ZX7A 1W9FA 3E97A 3H1YA 1UCXA 3N9PA 4YFZA 2BV4A 2WZ8A 2XJSA 4CEYA 1AR73 3DV8A 5BNPC 3ACIA 4IV1B 3UETA 2PELA 2DVFA 2JXAA 3OTFA 2VECA 4Q1RA 4E4ZA 2Y60A 3AP5A 3SH4A 3ZFFB 3DGTA 4UFJA 5FY8A 2PHTA 4AFMA 2R49A 5FYIA 1OD3A 1I1EA 2D6OX 2XL9A 4YVWA 5IWFA 3JXSA 2CGNA 5BNNA 1NY71 5C8WA 2GSYA 5FY1A 3BODA 3HQXA 4CEYB 5LK7B 3VBHA 2OKXA 3N3HA 2NN8A 4UWDA 5DAWA 3WG1A 1J83A 3BOWA 1OFNA 5T52A 4QT6A 5EJZB 5KHIA 3WCSA 3WV6A 4LKEA 1ZBA3 1OURA 3BTZA 2BFUL 5EJ1B 1OVSA 2RS13 3DF0A 2ZBJA 1N1YA 4JTOA 4YVWB 1TVGA 5BNNB 1EP0A 1XRUA 4JX0A 4LT5A 3K51A 4S2FA 4WV8A 4DPNA 1C8M1 2CDOA 1GOGA 3RNSA 3VBHB 1EAH2 4YGDA 2ENRA 2XVKA 3RJRA 3BI3A 4DXSA 5FP9A 2VBPA 5C4WA 1J1LA 1ZREA 4LUMA 1C5HA 1DDLA 4F7ZA 4IDZA 2ZGRA 2VOKA 4MUVA 2HWB3 2IZWA 3IMNA 3KCXA 3NJYA 4Q1PA 2B9VA 5CKNA 4QXBA 3I2OA 2W92A 4XFGA 1UYYA 4ARXA 2H6CA 4B3NA 5BNPA 3WVJA 4CEWC 3E1F1 4Z82A 1NG0A 4ZS3A 3VD9A 2Q1FA 3B7MA 2R30A 3AXDA 1L7QA 1YXWA 5C4WB 3B69A 2WBKA 1SFNA 2N7GA 1FT9A 4U2AA 3S7IA 3TBDA 5JMCA 2TEPA 3JCIA 3GF6A 3OCPA 4QX3A 1W06A 1JYTA 4QHBA 5BNPB 4KBZA 4Q29A 4RHV2 4FFIA 5FKBA 3V65A 3RRDA 3J8F3 3P5BA 1J59A 1QJY3 2ZX1A 1SMVA 2IFRA 2XXZA 1ZBA1 4U36A 5IVJA 4Z2WA 4AI8A 4GMP0 4P08A 2JENA 2V4VA 2RS11 4NE9A 2VM9A 4RYDA 1ZZ9A 4Q4W2 1YFUA 3DN7A 5KHGA 1BVP1 1VBD3 1GP5A 1DLLA 4QB6A 3WQBA 2NQYA 1AL23 5LY2A 2W3JA 4HANA 3B3QE 4MGYE 4PT6A 5A7WA 1V6OA 1KDMA 4H7MA 5GLWA 3ZPYA 2MPFA 4JAAA 4XOGA 5FMDA 5F2SA 2R072 2VTXA 2IXJA 1F5JA 2B46X 3U75A 5L9RA 5JAXA 3N7JA 2WNVC 1N3QA 4XUNA 1PZ9A 1QXPA 3VDBA 5JR7B 3T08A 2OA2A 5AVAA 2ZHNA 1OH3A 4EZHA 4KU8A 3POBA 1RINA 2CYFA 1CIYA 2QQVA 1UWWA 3ALQA 4LIVA 5DXDA 5FP7A 5A7WB 2HWF2 3FJSA 4CEWA 4NMIA 3QOPA 1OLQA 4W8JA 1AVBA 1S2KA 4MXVA 4QX5A 4FVVA 1W0OA 1SLLA 1RUJ2 2KR2A 2WN2A 2WYSA 4NJ4A 4QX2A 5LK5A 3T1MA 5CFCC 3LEKA 1TME3 1NE6A 5KC6A 1NKGA 1W2AX 5L9BA 2WO7A 1XPWA 3NNGA 4CEWB 5L19A 1FPN3 5EPAA 5GJ6A 4GXLA 1ENRA 3J8F1 1R083 1HX6A 4NHLA 1QJY1 2C6SA 3J7MA 2FCVA 3RQ0A 2ZKLA 4MG2A 2W39A 5GZDA 2ZX0A 4CDUC 3LIHA 5C3RA 4AI1A 1VBD1 3H3LA 3HBKA 3N7MA 4B4PA 4JHTA 5FFOC 1WUVA 4CU8A 1AL21 4CVUA 4IEQA 1F8VA 4JKLA 1W8ZA 4XF9A 3S5QA 1C1FA 1R64A 1O3RA 1VB2A 3IDEA 3URFA 1G9AA 3VUOA 2VMFA 4RS5C 3O14A 4XILA 2YB7A 3U0ZA 1L7RA 3CL1A 2X5IA 1QY4A 1TNRA 1V6LA 3KCYA 1RUD3 4RD7A 2WNVA 3WCRA 3VZNA 5I8TA 5T5LA 5LCWL 3LD8A 3P3NA 5GLZA 3C8XA 5T5OA 5EHDA 4B4QA 5AFEA 2LUWA 4A7KA 5C3SA 5FZFA 1IS3A 1Q3EA 2YG0A 4XFBA 3GZUC 3V0AA 1HRI1 2OUJA 5F3EA 2VU9A 4OHVA 1DCSA 2ZGUA 4CU6A 2R042 4XVHA 4B29A 4OVEA 1OPOA 3BTXA 5C6CA 3LFMA 3H50A 3SCGA 3WX5A 3LEIA 2UY8A 1MS5A 2WNVB 4MGTA 2AR6A 2VR4A 5F9TA 5FY5A 3LSEA 3M7AA 1G9FA 4AVVA 3W5NA 3ZSKA 1XNKA 3BTYA 2ZGKA 1TME1 2VXRA 4Y1VA 5IHRA 1QJFA 3OPZA 2X53S 3V0AB 2ADEA 1UO9A 2J1AA 1FPN1 2VVEA 2VUJA 4L99A 2IXKA 5DN2A 3VGIA 3BGAA 4HT1T 1R081 4AHYA 4GULA 4BXFA 2JECA 2VOWA 4MX3A 2HWC2 3F95A 3BUCA 3AB0A 4R4XA 4CDUA 4D7TA 4CXYA 3PUIA 5K0UC 1NLQA 5E6HA 1A3KA 2GALA 1KJRA 3PVNA 3WR0A 3CKHA 4LBOA 3C7HA 4BOWA 2NYYA 4RS5A 3USSA 4MGKE 4G9SB 3OEBA 4FOWA 2BYVE 2ZHMA 3JUUA 1RUD1 1LKNA 2LW8A 4CDUB 3LWCA 4X8NA 2WA3A 4Q4V2 2E32A 3PIGA 1OF3A 4M0HA 1UY0A 2B7YA 2DTWA 4BYYA 4PIXA 5CZKA 5L7OC 1R092 5AC93 4RS5B 2AC1A 4DRRA 1JYIA 4XUQA 1PHMA 2ZACA 4QXCA 4FOVA 4LOTA 1GFF2 2VNVA 5FWJA 5BV6A 3M8LA 4AFCA 1J3PA 2VCBA 2C24A 3VZJA 3NNFA 2DBIA 3TEYA 4OUSA 2J1RA 5JWPA 2VXJA 1KQRA 1Z7S1 4BK4A 1S2BA 3KT4A 3VL8A 1D4M1 1FXZA 1A78A 4LO4B 4MO3M 3POWA 3AKTA 2HJIA 2R061 3JQWA 2YPDA 2WJSA 3AYEA 2XJPA 4LIUA 1UF2C 4UFIA 4IV3C 1AYM3 5JLVA 2VW1A 4DINB 5FY4A 1RUE3 5T5PA 2JWPA 5JSOA 2LALA 4HBNA 3WG3A 1SEFA 5L36A 1LGCA 5K0UA 2XHKA 1QQP1 4OZXA 5KXCA 3AVSA 4IERA 1SDDB 3W20A 1VJ2A 5DDJ1 5E89A 1YO8A 1TG7A 4R9BA 2WO3A 2IC1A 1QJU3 1UZZA 2HBTA 1E57A 1Y3TA 3BIWE 5CVRA 2DF7A 5CB7A 3CO2A 4LEJA 4UF0A 5C33A 5KHHA 4XXAA 4XFHA 4WM7C 1PIV3 3M3QA 4IGQA 1AXZA 3VV1A 4P9WA 5HPOA 2FBEA 1V6MA 2ARXA 3VD4A 5K0UB 5B4XA 4FQZA 4FQ4A 5FY7A 4R8HA 1GP6A 4Z92B 3C7FA 2BNOA 2K2SA 3VBUC 1AZDA 2E53A 1IQDC 2YBKA 1D0GA 2YU2A 2WLQA 4UF0B 1I5PA 4XEZA 2VMDA 5AC91 5FLHA 4ZU5A 2JDYA 4E2QA 3MHZA 4BA6A 5HXMA 2R0HA 2H6BA 1RUF2 1TNFA 2Y6LA 5CKMA 4DIQA 4D8MA 3EXUA 1VBC2 2JB4A 4PLNA 2IVIB 2WQ4A 2XJQA 1BYHA 4NPLA 2BVVA 2HWD1 4FFHA 5I0SA 4GB32 2RMU2 4UBGA 1JI6A 1WA4A 5FZ8A 2YYOA 3ILNA 3QH6A 2LTNA 4IE5A 4UT5A 5EXOA 1WKYA 1YFXA 5IUQA 4F83A 5J09A 1XU2A 1GZTA 3N7LA 3WF3A 4IV3A 5GLTA 1AYM1 2VOVA 1SBFA 3JBG2 4AQSA 1ENQA 3B5LB 3CZUA 3LA7A 2PQSA 4KG0A 1QJEA 2EICA 3J7LA 5FYMA 4Z2AA 3RZZA 4I30A 2W5FA 1WBLA 4XMIA 1XOYA 2YMZA 1IPKA 2VMEA 1QJU1 4D7YA 2RS32 5JMOA 1N47A 1JOJA 4WM7A 4IV3B 5EZWA 2W1WA 2WNUC 3D0SA 3NO8A 4I2OA 2NLRA 3RPQA 4OI1A
chains in the Genus database with same CATH topology
1ND3C 1ZRRA 4I01A 3FLTA 2PA7A 2A6WA 4IQPA 3D82A 2UURA 4KBBA 4XJ8A 3T1LA 1YYNA 2P2KA 2QNKA 3VBUA 2EAAA 4JGZC 3W58A 2RM22 2XJUA 3HT1A 1RUNA 4Z1VA 4WM7B 3WOGA 3WLUA 2ZGOA 1DU3D 4FPLA 4LBJA 5CBLA 4YG3A 3VKFC 3GHMA 2AH2A 2D6PA 1H1MA 2IFWA 4IEUA 3VBUB 3ZFGC 3SXWA 3VBRA 1S0GA 4B7KA 1F2NA 3TN93 3OD0A 2IXIA 3FX3A 4LA2A 3SCHA 1LGBA 4K6BA 1XYNA 2WZPP 1RUC3 3V56A 4N7IA 4RR3A 1AXKA 3WP5A 4EWDA 4I0WB 5ACA2 2A3XA 4CDWC 5I93A 2CL2A 5FOJB 2Z79A 3VBRB 4YW4A 1KDKA 2IXCA 3AX4A 1CJDA 1VRH2 1H8VA 2DURA 4YM0A 4DY3A 5BNQA 1ASJ2 1DYKA 1ND3A 2CNAA 4H3WA 3ES4A 1FOD2 4RR3B 3NJZA 3H3UA 1SQ4A 2XBO3 2A5ZA 5LEKA 3AMMA 5T50A 2ZA9A 4FPYA 4JGZA 1PMIA 3GBWA 4R9CA 1CJPA 5DZFA 1BMV1 2WZR2 1W39A 2PN5A 2WLPA 4C0HA 1ND3B 3FUOA 1X7NA 5ABJA 2WKKA 4FOYA 1DF0A 2UU8A 2A71A 2WWSA 4PF5A 3PMSA 5TSWA 1G9BA 1PVC3 3WG4A 1LU2A 2H0BA 2B42B 2W0XA 5CADA 2ETEA 4JGZB 1RL3A 3KT7A 3ZFGA 3MIFA 5T5JA 4XF0A 3TAYA 2IXLA 3TN91 1YUDA 3CNAA 3TOJA 4OFGA 1PO13 1XXNA 5ABJB 4ASMB 3JD72 2DWRA 3QBQA 3VKOA 1OA4A 2WFF2 1RUG3 1OA2A 1Y9QA 5FAXA 4CDWA 3ZFGB 2DVAA 4HSJA 2V73A 5AFBA 5FDBA 2QZ2A 3DKWA 4Y4YA 3SITA 1C3HA 3GBFA 2XJRA 4A7YA 4N9HA 4ASLA 4XXPA 1HRV3 3VHNA 3NKTA 4F3JA 1IHMA 2XBO1 4Q8LA 4HSLA 4C0BA 4K1ZA 2O1QA 4CDWB 2AENA 1XE8A 1LR5A 4EN8B 2PLV2 3I59A 3WD5A 1CAVA 3D5OA 4B4RA 1YJKA 3AJYA 5B2GB 1Q8QA 1LESA 4IETA 1Z78A 3R4SA 3PVOA 4WVMB 3RWNA 1WW6A 2E51A 2RS52 3MW4A 1JN2P 4BPZA 3INAA 1PVC1 1G86A 1XNBA 2EF6A 4GALA 3WP6A 1FNZA 1I3HA 4LUKA 1HW5A 3I59B 4QGLA 1S55A 5JOXA 1V6NA 4S2DA 1PO11 1YLLA 1RUI2 4E2SA 1RUG1 1NLRA 4IEOA 1R1A3 4Y22A 4Q4Y2 1C5IA 1BZWA 1VIWB 3V64A 1S0CA 3AP7A 1W6QB 4FPCA 3AXEA 3UV9A 5K8SA 3SHRA 4XFCA 1D4VB 1HRV1 2P37A 3WW4A 4QQLA 4C1WA 1AYN3 3TNPB 5I0RA 3WDVA 2KXLA 4BMEA 1KFXL 2YROA 3N7KA 4OULA 1W6NA 3ZYIB 4Y22B 2ZZJA 1X82A 2WS93 4KQ7A 3AYAA 3S30A 5HBAA 2GU9A 4XHXA 4YW2A 2BVBA 2W68A 3VL9A 2WSVA 3AMQA 1QXRA 3FLRA 3H3ZA 1NOVA 4NHKA 4AYUA 4CP1A 5FLIA 5JCTA 2ARBA 1EAH1 1W6NB 1WD4A 3O12A 1AJOA 3PTYA 1EY2A 1LOCA 1HXS3 4H55A 1RVF3 2G9GA 3BTAA 4DY5A 4COZA 1VAKA 4XDQA 3WDWA 4HK8A 5FOBB 1LOEA 1AR93 1MQTC 1R1A1 1AR82 1XU1A 2DCJA 2JE7A 3CJXA 3H8UA 4YZ4A 2WT1A 1VBB2 3AKPA 3AZYA 3GALA 4IEVA 5KBFA 1NQJA 2Y38A 4G4FA 1BBT2 5JI9A 4FPHA 4K1YA 4HN0A 4QQPA 2E9QA 4QQHA 1CQ9A 2A73B 1AYN1 3RI9A 1S1AA 4TYSA 4CEYC 3SH5A 3R4UA 2NMOA 3ZSLA 4J1XA 4LBQD 5JVVA 1U5YA 5I0UA 3MZHA 4LO8A 1WLTA 1RIRA 2DU1A 3H9AA 5FO7B 1YIPA 2AYHA 2BNNA 4XETA 4AGVA 5JIUA 4CDQA 1XNCA 2XH6A 1NXMA 1OMIA 2D93A 4CTEA 2GNBA 1BVVA 4URTA 2PYTA 2A75A 3VHRA 4XFAA 2I07B 1HXS1 1RVF1 3MICA 3N36A 1TQ5A 1DQ5A 1C4RA 4IEZA 3NV3A 4P9GA 4YW1A 4CDQB 2AGSA 1DGLA 1RMU3 4YVSC 5FBZA 3WG2A 1UL9A 2YV8A 3ZDSA 1AR91 1MQTA 1RUOA 3O0WA 1XQNA 2VVFA 2ZKNA 1MS9A 1U0AA 3VBFC 1FMD3 2RR13 2OZJA 1BEV2 3POYA 4L97A 1QH7A 1J58A 1ZZ6A 2D97A 3IN9A 3LB9A 2D98A 3UK9A 4KH9A 4GMP1 2ZGSA 1RJ8A 4LHNA 4KG8A 3QCWA 1IS5A 1QJX2 4QU2A 1MQTB 1Y43B 2JG9C 1X8EA 3D4KA 4MSVA 2XPJA 2XGXA 3MDPA 2PHWA 4Q27A 4NO4A 4D7SA 4PDWA 3UJQA 1KS4A 2UYAA 1IS4A 4D94A 4H14A 3NVCA 4MXWB 1AXYA 1PO23 1S0BA 4KGGA 3G6JB 1UKRA 4YYOA 1REFA 4FT8A 4ISRA 3RJ2X 1H2LA 4XQWA 1QH6A 4AFBA 3AP4A 3O7OA 1RTVA 1S0FA 2Y0IA 3MIEA 1DQ4A 2D40A 1K5MC 1LHVA 1S0JA 3KQRA 1ZBE3 3ZYJB 4YGEA 1IGOA 4YVSA 2QJVA 1RMU1 1WBFA 5IK4A 2WIIB 2PQQA 5DG1A 1GSLA 3VBFA 2QQPA 1FMD1 2RR11 1NCQC 4OI0A 1GYKA 3ENRA 2BGCA 3BB6A 2KA3A 3DPRC 2C9AA 2Z42A 4J1WA 4YVSB 2DYCA 3JQXA 3A0KA 1F31A 2A3WA 2JG9A 5JOWA 4BLJA 4Z8BA 2NZ9A 3VBFB 2GDFA 2A6VA 4GWMA 4RQPC 3RG0A 4E9KA 2HWC1 1PVXA 2A70A 1PO21 2HEYF 1AHSA 5JIAA 5JPMB 1RUH2 4QGNA 4XJAA 3TWIA 2P3JA 4Y1XA 2JG9B 2XKOA 1YI9A 3SMHA 1M4WA 5BY5A 2G4IA 4Q4X3 1CESA 3VBOC 1K5MA 3ES1A 5J96B 1A8MA 1O5UA 2ZGMA 3V0BA 1JHNA 1X8MA 4AE2A 1ZBE1 2DCYA 4F8AA 1WMDA 2SLIA 4O9GA 1WCDJ 1VBE2 2GH8A 1R091 2OUHA 1O5LA 2MEV2 5SV5A 3KB5A 4HVQA 3ZYPA 1AR63 4M0NA 1JBCA 2X5IC 5DUVA 1NCQA 2EALA 4YM1A 1TMF3 1K5MB 1DZRA 1Z0HA 2BUKA 4AVSA 3V0BB 4BQ1A 1QOSA 1PGL2 3DPRA 3WP4A 3WQ7A 3EJKA 1MS3A 4CZSA 2CGPA 1HRI3 3MGUA 3VLBB 4K8FA 4RQPA 5H9PA 1NCQB 4W6WA 2VW0A 2YY1A 3EQEA 4COYA 4K3UA 3IM0A 4FTSA 2WNEA 3WT3A 5LEJA 3DPRB 3G7DA 1SDWA 4L92A 1ULGA 3MFCA 4N53A 5J36A 1IKQA 2Q0AA 1SLCA 1UW8A 3MIDA 4HMZA 3LGRA 3THPA 2D7FA 2FZ1A 1VB4A 4RQPB 1T6GC 4Q4X1 2CV6A 1H2MA 2D44A 1KFUL 3VBOA 3MIHA 4B7EA 1UPIA 1RHI2 4XFFA 1ZYBA 3AFGA 1H30A 1LHWA 3FHIB 4N53B 1QU0A 5FMOL 2BBVA 1GBGA 2RE9A 5IK8A 1POV0 3PVEA 1AR61 1CN1A 3AFKA 5K9YA 5DUUA 5LRSA 2WT2A 3VBOB 1TMF1 3RYRA 1VBC1 3MLLA 4ATEA 1U5ZA 2XL7A 2RMU1 1Q5OA 3WDUA 1NY72 2R1BA 2G9FA 2B8MA 1H2NA 1PGSA 3RDIA 3WDTA 2Y0OA 4DXZA 4P9XA 2X5IB 3FMGA 4LBLA 2H0VA 4I02A 4RL7A 3OD4A 1H1AA 2HEWF 1Z7S3 1UMZA 3MF6A 2OPKA 4ZXKA 3R05A 2E63A 1D4M3 3AKQA 2R063 1WW4A 2VVDA 1C8M2 4M01A 2PHRA 3MF9A 3EHKA 5F6KA 1KRIA 1Q8PA 4BCUA 3PNAA 2ZHKA 1QQP3 4OI4A 2VUAA 4FSJA 3U07A 5DDJ3 2D6KA 3UJOA 2EIGA 3E6DA 4OUMA 3KCCA 1LEMA 4FOQA 3SH3A 2D6MA 4HKLA 1AR72 3BALA 1U5IA 1PZ8A 3OY8A 1OI6A 4JVAA 1ULFA 1ULCA 2ZGNA 1OA3A 3QLQA 4EN7B 1SLIA 3AMHA 3J9SA 4QQOA 4JRAA 3I54A 1EV13 3W9AA 3MI8A 1A6CA 4JGYC 3OY8B 2NPIA 2CAVA 3MFAA 1OQEA 1XYOA 1HV1A 1ZBA2 2JKBA 4YARA 2HWD3 1H2KA 2ZZQA 3WDXA 2RS12 3R4DB 4GWNA 2GC1A 5KC5A 4YZ1A 2GH2A 1NQDA 5CFDA 1UIKA 4MYEA 4CYDA 4Q2FA 3K48A 4LTAA 3WQ0A 4TWTA 3ME2A 4UBHA 1S0DA 2A7AA 4UW3A 1WLCA 4K21A 1FOD1 1PGW1 4XTPA 2DFCA 4QPYA 3WY6A 2UWCA 1D2QA 4XBLA 1GR3A 2QKDA 2HWB2 4Y1YA 4XHBA 4CDXC 2XLGA 5CFDB 3ZSMA 4PLMA 4XFIA 1SCRA 4A7ZA 1ZZBA 1PNGA 5DG2A 3CU7A 4IXLA 2PHXA 1QDCA 2MNGA 2VOXA 1VAVA 1BKZA 5CU1A 1HIXA 1DBNA 1JW6A 1H4HA 4KWLA 5E16A 1YNAA 4X8PA 4JDNA 3NV1A 4WZCA 1EV11 4JGYA 3VZMA 2F4PA 4UW5A 2WT0A 3J8F2 4QM8A 1QJY2 4MH0E 1V9U3 3SCFA 5CA6A 2P34A 5EYXA 3VBSC 2WFF1 5E8AA 4K9SA 3VZOA 2D3PA 2YPJA 1ZVFA 2QFEA 1VBD2 3IT8A 2PHLA 4N7UA 1AL22 1WCKA 4NN0A 2HKXA 1MVEA 3VBRC 4JGYB 3WW2A 1MR5A 1TE1B 2XKPA 4UW4A 2YGMA 2PAMA 5FTTC 4QPGC 4RR3C 3FBMA 2WL1A 1ZZ8A 2GNMA 3AP6A 2ERFA 1G6NA 1MZEA 1SBEA 4META 4CDXA 4QQ2A 4COUA 3M3EA 2AREA 2PLV1 2ZAAA 2HEVF 4Q0PA 5BXXA 2FQPA 1URXA 2UYBA 2DUOA 2EAKA 2GZWA 2X8KA 2R0FA 4CDXB 4TLFA 5JSRA 1I9RA 1COV3 1TME2 3CEWA 1LJ7A 1DZQA 4I3GA 3TRSB 3ZXEA 1FPN2 3LCPA 4AQ2A 2D43A 3A0NA 3BU7A 3I8TA 2Q4SA 4H7LA 1R082 5ABJC 3PJQA 1V9U1 3GNEA 3VBSA 2YC0A 2I2SA 2XB6C 1D0HA 1V6JA 1DQ1A 2ZMNA 3ZO0B 3ZN5A 1ZZ7A 2C5DA 3GHNA 1FYUA 4LE3A 1LOAA 3WW3A 4EJRA 4YW5A 4QPGA 3ZMOA 4R4ZA 1LOBA 3VBSB 4E2GA 1RUD2 2VQ0A 3KD4A 4IESA 1NE4A 2QUOA 3UL2A 4K7JA 1U5XA 4CRQA 1MS4A 4PLOA 4WVWA 1ZZCA 1MEC3 2XWJB 4IEXA 1AJKA 2OZ6A 1BJQA 4QPGB 4AVTA 2HWE3 1EPWA 1QNYA 1RC6A 5AVPA 2FZ2A 1Q56A 5EYYA 3AKRA 1COV1 2Y26A 5A32A 2BFUS 4FPFA 3ZSJA 1ZX5A 3J4UH 4FP2A 4ONUA 4AW7A 1QDOA 1S0EA 2ET7A 2XLAA 1FAYA 2QVSB 3L2HA 3WHUA 4PBPA 1G7YA 1O3TA 3N35A 1MZ5A 2PHFA 1KJLA 1VBA3 4C1XA 1B35C 1Q8SA 4LHLA 3FFQA 2TUNA 4JDMA 3GBGA 4YGCA 1AR81 1C1LA 3PHMA 3NKGA 3ILRA 3E6CC 2BPA2 1SLTA 2VMHA 4FPOB 4HVOA 4QGMA 4RFT0 3ZSEA 5H9RA 3P3PA 3A4UA 1HQWA 1UX6A 4QXKA 1X33A 2D3SA 3J26N 4KWJA 3AKSA 4UXAA 1O91A 2O8QA 3JU9A 2X29A 3ZIXA 5AC92 1MEC1 4LE4A 3WQ1A 3WNXA 4AF9A 2WC2A 2HWE1 1I6XA 2W08A 5DZEA 4FXKB 2XJTA 1V70A 4FBFA 1ND2C 1UAIA 1MZFA 2BTVC 5EV7A 4L8QA 5F5QA 4Y20A 4GA9A 1F5FA 2GC0A 2GC2A 1Q8OA 1SBDA 2JE9A 1UN1A 5DZGA 1AYM2 3MW2A 2ZS6B 1RUE2 3NV4A 2F6BA 3DL3A 4FPGA 3RMXA 1B35A 1EAH3 1VBA1 3GZAA 3Q9OA 3T2TA 2JX9A 1H8TA 4Y20B 4KNCA 2MHFA 4NVPA 4C90A 1CAVB 5FRAA 1QJU2 4EROA 1NXD1 2XUMA 3NSTA 4DFSA 1S0IA 1ZNPA 1KITA 5GZFA 1WW5A 4G3YC 1HDKA 1PIV2 3IKWA 4Y1UA 4E27A 4EWEA 1L3JA 4N43C 4L2NA 1B35B 2ZJCA 1H8TB 2IWGB 4IEWA 3H1WA 3C3VA 1JUHA 1UZYA 3THTA 3CJIC 4FXGB 2WSUA 1M06G 1CVNA 4Q26A 4HETA 4B8EA 1DHKB 1C8NA 3PMEA 1LHUA 2W52A 4RHV3 1ND2A 2EXKA 4YNIA 2ZAHA 3ZVXA 4XF3A 4YFWA 1YWKA 4WVZA 2D6NA 5CG8A 2PFWA 4AHZA 5GALA 4DMIA 4Q4W3 2OVUA 3E6BA 3RYKA 4CDQC 3EBRA 4OHXA 4V1PA 3RI8A 4LULA 1ND2B 2AUYA 2YXSA 2NMNA 2VPVA 2R073 1IQAA 2E6VA 2I45A 2DU0A 2Q1ZB 4LLOA 4UW6A 2XVLA 3TB0A 1NYWA 4N43A 2HWF3 4ISQA 2DVBA 3FFZA 4AGGA 1QNWA 1NCRC 1Q43A 1UKGA 2BEOA 3CJIA 4NWVA 2CWSA 3SNMA 2DFBA 2Q1MA 2VNOA 1ONAA 1RUJ3 2ZPXA 1BMV2 4GMP3 4N43B 4D3WA 1YFWA 3HD8B 4TSVA 4RHV1 3VHPA 4AVAA 3AYCA 3HT2A 4AWDA 2ZX3A 1LEDA 3VDDC 1CPMA 3FWEA 5KHJA 3IIAA 4PDWC 5FO8B 3CJIB 4OLLA 3APBA 4Q4W1 4XW3A 3TN92 3ZXKA 3ELNA 1QXJA 1YRZA 3KM5A 4M3CF 5FPZA 3KS7A 2YDEA 3D8CA 3M3CA 1RUC2 5KXBA 4LA3A 3ZMNA 1CGPA 1UIJA 2Z69A 4XJZA 1LB2A 3USUA 2R071 1IPJA 1LHNA 1QJZA 3UKNA 3HWJA 1ZM1A 4I0BA 1QWRA 2JJ6A 3NAPA 5JPNB 3IDBB 3M1HA 2WFPA 2KM2A 5T54A 3B9CA 2ZMLA 5J7MA 2HWF1 2YGLA 4AFAA 2XBO2 2ZGTA 2R043 1NCRA 2C0ZA 2ILMA 3ST7A 3USUB 1V6KA 4BH9A 4L9BA 4PJYA 4XIOA 1FX5A 2VNRA 3PJYA 2ZX2A 1RUJ1 4I09A 3NAPB 4QPIC 1HQLA 1SFYA 3EO6A 2B5HA 3MIBA 1OSGA 1DIWA 4GKYA 4WM8A 1PVC2 3VDDA 3N4MA 1NCRB 4PBOA 1G9CA 4HN1A 2HWC3 1CONA 1W6MA 1SACA 1OPMA 1DGWA 1RHI1 3O5SA 4BM8A 4IEPA 5HCBA 1GANA 1UU6A 1HQNA 1PO12 3AMPA 1AUYA 2A6XA 3H7YA 2QDRA 2R32A 4XF4A 4WM8B 5BNOC 1RUG2 3VDDB 2UWAA 5BYNA 4PDWB 3I2DA 1WW7A 4ITCA 5H9QA 4ORFA 1W6MB 1RB8G 4S2GA 2DUQA 3NL1A 1PZ7A 3ZXJA 1IZ3A 3M3OA 4Q4V3 2GN7A 4XYXA 5KXDA 1DGRN 4EV0A 2PHUA 4RSUA 3AZVA 2ZOEB 2JDZA 1HRV2 1GNZA 1R093 2QDNA 2XJVA 1MZ6A 2D6LX 2R041 4YG0A 2GMPA 1OHFA 1ZRFA 2DCTA 2FHRA 2V09A 5I8SA 4QPIA 4P9LA 2VMIA 5L73A 3ZIWA 4YW3A 1YCIA 1ZRDA 2VQAA 4Y5Z0 4XBNA 4AGRA 1WMEA 4I0AA 1TEIA 1O7FA 5H9SA 5T55A 1POV1 2VMGA 1NZCA 1BCXA 1DQ6A 4QPIB 1NA1A 5IT6A 4FPKA 3C2UA 3X29B 4FAHA 4O9EA 1C28A 3FLPA 3MLJA 2WQZC 3WZ1A 4ES8A 5BNOA 1BK1A 4N53C 4YGBA 3LOBA 4AI3A 1AR71 2B39A 1OD5A 1APNA 2FMYA 4LHKA 1R1A2 3AK0A 2GNTA 1O4TA 1LOGA 2UY9A 3QD6A 4Q4V1 4M00A 3VKNA 2JD4A 2PHDA 1NA1B 1PK6C 4RGGA 1H1IA 2K9ZA 4BLIA 4LO7A 5BNOB 3AYDA 4Z07A 4W6YA 2DTYA 1AYN2 4NHMA 2EVXA 2CAUA 4E4SA 1RUF3 4KGQA 1LU1A 2Q8OA 4BMBA 1VBC3 4LBNA 4Q0QA 2WS92 5EJ3A 4OHYA 3SISA 3FC0A 1O4ZA 4GB33 4YG6A 2RMU3 3ROUA 4DS0A 2O0OA 3ZYRA 3QH7A 4HFSA 1V00A 1DFQA 1A8DA 1PM7A 4YM2A 4BIOA 4NWWA 4E4DX 1O3SA 5E88A 2HYKA 3JBG3 4XF1A 3IWZA 5GZEA 1HXS2 1LENA 3LZZA 1RVF2 3I7DA 2HWB1 3LSDA 4YM3A 2OW4A 2RS33 4CP0A 4XTMA 5KWRA 3PLQA 1AR92 3L2YA 1CPNA 4GH4C 2XVGA 1AX0A 3H1MA 1LTEA 2GMMA 4AHWA 2BNMA 1JTZX 5GM0A 1REEA 4Q8KA 1DQ2A 1PK6A 3ZYGA 2RM23 1N1VA 2UWBA 3MPBA 1H4GA 1RJ7A 1FV3A 5J98B 3NW4A 1RUF1 4FAGA 4JCKA 1UD1A 4JDOA