2PQQA

Structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
147
Chain Sequence
GHMDDVLRRNPLFAALDDEQSAELRASMSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENMLAVVGPSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDAMLVFSDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title The crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2)
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 34
structure length 147
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pqqA00
3OCPA 3C3VA 3CL1A 3H8UA 4GULA 1SFNA 1J3QA 3CJXA 1O4TA 3HT2A 4XFCA 1CAXB 1FT9A 5FLHA 3ES4A 4IERA 5AVPA 1O3QA 4KU8A 2XLFA 1NE6A 4HVQA 4QXKA 4O9GA 2GAUA 2KXLA 1LB2A 5F1RA 3OGJA 4XFIA 2VPVA 1FXZA 3BB6A 3KGLA 4IETA 3LA2A 4MZUA 4XF4A 1YLLA 4IEXA 3QOPA 4MH0E 3EBRA 4AXOA 4ZU7A 1RC6A 3RYPA 5BUVA 5T3NA 1O3TA 4HN0A 2H6BA 1NE4A 4FBFA 2Q30A 2PAEA 1RGSA 2BNOA 2QVSB 4IEOA 5KHIA 1J3PA 3PNAA 4DINB 3O14A 3RDIA 1Q5OA 2QJVA 4IEWA 4KWLA 5EZWA 3EQEA 3RNSA 3U0ZA 4KU7A 4WZCA 1Q3EA 2ETEA 1CAVA 2IXLA 4QM9A 3E5UA 3ROUA 2XL7A 4IEVA 1YFUA 3ST7A 5CVRA 5I91A 1TQ5A 3IWZA 2BNMA 5E16A 1H1MA 1VJ2A 3RZZA 1OFNA 2E9QA 1ZZ7A 4YRDA 1IPKA 1ZREA 3MYXA 5FDBA 1UW8A 2Q1ZB 3EJKA 5BXXA 1XRUA 3NSTA 2D40A 2HKXA 2ET7A 3LZZA 5J48A 1YFXA 3E6DA 2QNKA 1EY2A 4LEJA 5I8YA 2BYVE 3D82A 5BY5A 4EWEA 2XLGA 3B02A 3EO6A 2GH2A 4Z82A 1OMIA 2VQAA 3VHRA 1XE7A 3SCFA 4HZFA 2OZ6A 3NKTA 1DZRA 5KHGA 2XGXA 2UY8A 3RPQA 2OYZA 4FT8A 4F8AA 4EWDA 4XEZA 4HVRA 4Q0PA 2PHDA 3S7IA 4IEYA 3WW4A 4IEQA 4B29A 1RUNA 3MPBA 2F4PA 1EP0A 1EPZA 3CEWA 3HQXA 1O5LA 2MPFA 3FJSA 4HMZA 3I7DA 3DV8A 1Y3TA 2MNGA 1I6XA 1YUDA 5I8TA 1ZRFA 3UKVA 1PM7A 2XLAA 2BEOA 5KHHA 3FX3A 2B8MA 3ACLA 1GQGA 1QXRA 1NZCA 2IXHA 3FHIB 2ATFA 2UYBA 3USSA 4QGMA 2PA7A 1CX4A 2UYAA 2C0ZA 2PYTA 1LKNA 3G7DA 2B5HA 4EWAA 4PJYA 2PTMA 1JUHA 1SQ4A 1YFWA 3ES1A 4JVAA 4AVAA 4F7ZA 3OD0A 1IPJA 2EVXA 1ZZ6A 4I3PA 3KSCA 4N9IA 4QGLA 5FLIA 2DCTA 3WW1A 3E6BA 4BH9A 2XL9A 1VR3A 3LA7A 3H3ZA 3H3UA 2D5HA 5E1RA 4L2NA 4HN1A 1J1LA 2PAMA 4N9HA 3CLPA 4XFAA 2N7GA 5BPXA 2CAUA 4I2OA 1V70A 2Q0AA 3DN7A 1CAUA 4KWJA 5KHKA 4META 4R52A 5I0RA 5LEKA 2ZKLA 3SCGA 4XFHA 1UIJA 4LTAA 1J59A 3BPZA 1UIKA 2OPKA 4YARA 4QMAA 2PQQA 5EFUA 3JZVA 5KHJA 1Q43A 2IXIA 2GC2A 4Q29A 1G6NA 4LLOA 5J7MA 1VP6A 4D7SA 1CAVB 2PFWA 4QGNA 3I59A 1HW5A 3NW4A 4HSJA 3D0JA 1EYBA 4UXAA 4Q0SA 5CU1A 1ZRRA 1LR5A 1PMIA 4IEUA 4J1XA 2CV6A 4JTOA 5I8SA 4EROA 5FQ0A 5LRSA 2O8QA 1X7NA 1GQHA 4ORFA 5I0UA 4XFGA 3CO2A 1CAWA 3M70A 3HIFA 3ZDSA 5K8SA 4XF3A 5JAXA 3NL1A 3NVCA 3RYKA 1WGPA 5C8WA 3H7YA 4E2GA 3IIAA 4X6QB 2XKPA 4BIFA 3UKNA 2O1QA 3LWCA 2ZCWA 1L3JA 3OTFA 1J3RA 4LA3A 2WFPA 4WBBA 5I93A 1UCXA 1QWRA 1ZX5A 4LA2A 3M3IA 3SMHA 4R8HA 4PIYA 4HBNA 4X6RB 4EV0A 1ZZCA 1WLTA 1YHFA 3R6SA 3TNPB 4YSFA 3SCHA 3S0MA 5LRRA 4BHPA 2GZWA 5FPXA 1I5ZA 2CAVA 3H7JA 4OFGA 1NYWA 4J1WA 4L11A 5I0SA 1DGWA 4TLFA 2MHFA 4LULA 1O3SA 3FFQA 3KGZA 3WW3A 3H1WA 3UKTA 4AVBA 4I01A 1U12A 4MX3A 2EAAA 1J58A 1CAXA 3H9AA 2K9ZA 2OZJA 3FZ3A 5FCCA 3KCCA 2VECA 4E2QA 1X82A 4H7LA 4LUMA 3SXWA 5HI0A 4QM8A 3MDPA 4WVZA 1SEFA 2ET1A 4JTNA 4KL1A 4P9GA 4MGYE 5JSOA 3MZHA 3FE5A 4ONUA 1ZRDA 4MUVA 2IC1A 5FLJA 5JSPA 3BALA 4IEPA 3DL3A 2HJIA 4RD7A 1O3RA 3FWEA 3LA3A 2V09A 4Q0VA 4XETA 1UPIA 1ZZBA 3E5XA 4PIXA 1NXMA 4O9EA 3U11A 3E97A 4XFBA 3IDBB 3ETQA 1XE8A 4XF1A 2Z69A 2IXCA 4YNIA 3RYRA 1CAUB 3I54A 4MV2A 4BYYA 3H1MA 3IDCB 2QCSB 5BV6A 4MGKE 4AVCA 3CF6E 1YFYA 2QDRA 2D93A 3E5QA 5CADA 2PHLA 4XFFA 3WW2A 4AQ2A 5J3UA 1O7FA 1ZZ8A 1WA4A 4AQ6A 4PIZA 2CGPA 2IXKA 4UBHA 4MGZE 2Z2SB 4MGIE 4XF9A 1LRHA 1RL3A 3D0SA 4HSLA 4ZU5A 3ELNA 3TNQA 1ZNPA 1ZRCA 3I59B 4ZU4A 3H50A 5FPZA 2EA7A 4K8FA 3PLQA 2XHKA 3N4MA 3IBMA 2B9UA 4FAGA 5JCTA 3H1YA 4Q0QA 4Q0UA 4OLLA 4CYDA 4JV4A 1ZZ9A 3OF1A 4I09A 1QXJA 2WC2A 5JR7B 3PVBB 5FQ0B 1FI2A 5LEJA 1O5UA 2OA2A 1UD1A 1ZVFA 3NJZA 1OD5A 2BGCA 2GC1A 1OI6A 2XKOA 3LAGA 4E2SA 3EHKA 4HLTA 3LOIA 4I0AA 1RUOA 1CGPA 2Q4SA 4I02A 1X8MA 2I45A 1CAWB 3SHRA 1DGRA 2Y0OA 2P17A 2IXJA 4YYOA 3S7EA 2PAKA 4QX5A 4A2UA 3GBFA 4D7TA 3DKWA 1QY4A 2H0VA 3QACA 1DZTA 3HT1A 4LUKA 2FQPA 4I0BA 4KWKA 1YWKA 2GC0A 4Z07A 3E6CC 3U10A 2FMYA 1X8EA 4IESA 1H1IA 2GU9A 4IEZA 4HVOA 4UBGA 5D1IA 3BU7A 3L2HA 5C6CA 1RTVA 5I0TA 4FAHA 3GYDA 2BNNA 2D5FA 1Y9QA 4NVPA 3BCWA 4XF0A 5JSRA 2H6CA 2GC3A 5KBFA 3KMHA 2UY9A 2K0GA
chains in the Genus database with same CATH superfamily
4GULA 1SFNA 1W2OA 5DABA 1DDLA 1LENA 1J3QA 3NNMA 3SISA 3POBA 3WP3A 5GZDA 5IAVA 3HEIA 3N7JA 3HT2A 4ATEA 3K2OA 2Y64A 2V4VA 3PURA 1VBC3 1RYYA 3GALA 4PF5A 4XFCA 2JIGA 3LD8A 4BQ2A 4JGZC 4FPLA 1PO21 2XLFA 2I2SA 2KXLA 4LBNA 1D4VB 5FYTA 3KHBA 3QH7A 4XJAA 3QLQA 3WF1A 4BMBA 2E51A 3SITA 3L9JT 1K3IA 1YLLA 2ZGPA 3DEMA 5KC5A 1VRH2 1K45A 4IEXA 2YU1A 1AR63 2ARXA 3OGRA 3AMHA 4OULA 5GM0A 1ZYBA 1EAH1 5FZ3A 4DXSA 5FZBA 4XBNA 2VE1A 2B39A 1AXZA 3A0NA 4Y3OA 4YGDA 3RYPA 4AQSA 4BE3A 3ILRA 4CU6A 5IVEA 4LBJA 5ABJB 4HN0A 4Z2AA 4MHRA 4A6SA 4JC1A 3DYPA 3SEPA 3U14A 1QXPA 1XYNA 4K7JA 3T2OA 2JDYA 2P3YA 2BNOA 2ZEZA 4IEOA 1RVF3 4B4PA 4D6RA 1CZSA 4M0HA 3VLBB 2JD4A 3O14A 2W1WA 4XCAA 1RUH2 3VDCA 2A6WA 3L2YA 5FY9A 4XPVA 2FMDA 2CYFA 4IEWA 3VGIA 5EZWA 2JJ6A 3OGSA 4FCAA 2E7QA 1RUH1 3JB4C 4PDWA 4SLIA 5FZ9A 3AYCA 1Z0HA 4QKFA 5FFOC 4NIHA 3AMMA 3OY8A 3PUIA 1N3OA 1OXCA 3A7QA 5SV5A 2JE8A 2RE9A 2WO3A 3CBNA 1GZWA 3ROUA 4R9DA 2JE9A 4LO6B 1KJRA 2DUPA 1YFUA 4DS0A 3ZXLA 3BODA 3KB5A 4CDUC 4LR4A 2PHFA 3H0OA 3RZLA 5I91A 3IZOA 4G3YC 5T5PA 3UK9A 2EXIA 4K1ZA 2ZMNA 3S5AA 1U0AA 1QJFA 3O1OA 2ADEA 3WDUA 4CRQA 2AEYA 1VJ2A 2E9QA 1ZZ7A 1IPKA 5GLZA 4COWA 4UAPA 5FDBA 3OGGA 3POSA 1GOHA 5JMCA 1UY1A 3VV1A 4AZZA 5KXDA 3M3OA 4KI5M 3M3CA 4O65A 1WCSA 3EJKA 5BXXA 2LRPA 2GP5A 3FUOA 3VD5A 2XVKA 4CP2A 4JGZB 1HQLA 1L7LA 3ORJA 2WA3A 1DQ1A 1XNKA 1EY2A 1H2NA 4LEJA 4ZS2A 3D82A 4Q4V3 5HCBA 5BY5A 3B02A 3EO6A 4LK7A 1LNSA 3DPRA 2AENA 4LORA 1PIV3 4BDVB 3VB9A 2VQAA 5JZGA 2ZGOA 1RHI2 1MS0A 3T0BA 1OQDA 2J7MA 3ZOIA 4HZFA 5T5LA 4QX1A 3CIHA 3WG1A 1DZRA 1HB4A 1RHI1 2YC4A 4B8EA 3RPQA 1W6OB 3NAPA 5FYYA 4F8AA 3ZFEC 4CE8A 1DYOA 2YXSA 5LCWL 1K5MB 1NCRC 1CVNA 4HVRA 1GOFA 4Q0PA 2Y6LA 2XQRA 1COV3 3C2UA 3S7IA 4IEYA 3CQOA 4IEQA 2WBKA 2XJQA 1EPZA 3DECA 3HQXA 4HMZA 3DV8A 5FY1A 4DIQA 1WW4A 4HKLA 1FOD2 4XACA 1R1A3 1Y3TA 3USUB 1RUI2 3VKFC 3ZSMA 1AZDA 1I6XA 1XNBA 1YUDA 1ZRFA 2VZ3A 1PM7A 2ZGTA 1FOD1 4Y5TA 1RUI1 2CHHA 3AX4A 4H2AA 2BEOA 4CDQC 3H8XA 5A7OA 2B8MA 2DVDA 2DCZA 2ZEXA 1GWKA 2BUKA 3WDWA 1QXRA 1OFSA 4XZUG 5FZMA 4U36A 5DUUA 1S0DA 2IXHA 3RZJA 2YB7A 5AC92 1VB2A 4YM1A 3USSA 2E26A 2A6YA 1HB1A 4UFIA 2Q8OA 2UYAA 3THPA 5IVCA 2Q8EA 2P6CA 2X29A 5C3PA 1OHFA 5AC91 3M8LA 2VVFA 3G7DA 1AF9A 2XWBB 4ATFA 3HBKA 1W0OA 4IW3A 1OUXA 4EQVA 2JX9A 2C26A 2BVBA 1JUHA 1QF3A 2PTMA 3CMGA 3O0XA 3WNLA 4A45A 5IT6A 4QXBA 5A3OA 1UOFA 3OD0A 2EVXA 4JZRA 4FQ4A 1HKDA 4QGLA 1DLCA 1WBFA 4SBVA 5A7WA 1NCQA 4FPJA 5A32B 1MS4A 4OQ9A 3E6BA 3B7MA 4UW6A 3VL8A 4BH9A 1PGW1 2J1VA 2Y8KA 3KCXA 5LB6A 4RFRB 5IFPA 1RUG2 2D5HA 1RUD3 4Y5Z0 2J1UA 2F6BA 2FCUA 1J1LA 1RUJ2 3LCPA 1RUG1 1O6UA 1RUE1 2RHPA 4MO3M 1PX4A 4RS5C 5DAPA 1EUUA 3SKJE 2JDHA 5BPXA 3VDDA 1DYKA 2XWJB 3HMYA 4IE7A 1XE0A 4I2OA 5D8AC 1V70A 4IQPA 1RUJ1 3JBG3 3W59A 5C4WA 3WG4A 2XPJA 1K42A 3IAQA 3VHPA 1ULDA 2FDKA 3LEMA 1SDWA 3GDBA 5IYYA 1ENSA 2ZABA 4W65A 5KHKA 4META 4R52A 5JI7A 2DVAA 2PHWA 2WNEA 1V6KA 3F95A 3U1XA 3WLUA 1NCRB 1UIJA 1AX0A 1W8UA 1S4CA 2HYXA 4M3CE 1J59A 4ES8A 5KXBA 2YG0A 4D0QA 3WUDA 2X05A 1AL0G 1GZ9A 4FPGA 4QMAA 1HRV3 1ST8A 2BW8A 2WRAA 5EFUA 2ZZQA 4Q27A 5LA0A 4E27A 4LO4B 4BMEA 1RITA 3VN4A 4A7YA 3C7EA 3POWA 4Q29A 3P1IA 3CJIC 3AKPA 3DYOA 4DOUA 2DCYA 2QQPA 3N9NA 4LLOA 3O1PA 1BBT2 4H7MA 1PZ9A 3I97A 1LGNA 5BNPB 5GZCA 5H9SA 2PFWA 4DUVA 2Z4FA 5FJHA 2IFRA 3MFAA 1QGLA 1U5IA 2HWD3 1HW5A 3OPWA 1BBT1 3NW4A 5CG9A 1TG7A 3ZR6A 4COZA 1CX1A 1AJKA 1VBC1 4DFSA 1SG3A 2Y38A 2EF6A 5ANNA 1H8TA 1MZFA 4JQTA 4GD4A 4COUA 2ZHKA 2A5ZA 2VH9A 1W28A 2BV4A 3WNMA 4YZ5A 3N9MA 3B94A 2D3SA 2CV6A 3URFA 3BIEA 3AVSA 2XOMA 2WWSA 1W9YA 4GJYA 3U4SA 4CDXA 5A6QA 5LK5A 5LRSA 1W8WA 2EICA 4AOCA 2C1FA 4LIVA 1GQHA 4WM7B 5A33A 2WWJA 4GXLA 3C7OA 1SLAA 4OZXA 4MXWB 4OI2A 1B09A 4Y26A 3MF9A 3ZFFA 1CAWA 4LBQA 5A7SA 2EAKA 2NMNA 2W92A 5JAXA 3ZXGA 4N43A 4RS5B 2P34A 3RYKA 1UKRA 5C8WA 1IQAA 3H7YA 4OI4A 1S0FA 2Y6FA 4E2GA 2WQ8A 4A44A 5A33B 5F3IA 2BPA2 4AFDA 5J36A 3LWCA 5JR2A 2OX0A 1BK0A 3GHNA 1TME3 3ITQA 3OTFA 5ERLA 4A3XA 2WNOA 3TRSB 1UCXA 1YYNA 1QWRA 1HN1A 5FP3A 4R8HA 2W46A 4PIYA 1WZXA 1AYM3 5LY2A 1U5XA 3VZJA 4C0HA 5C71A 5IVBA 1JZ4A 5FOJB 2WR9A 2WLQA 1GZCA 2WWUA 1YI7A 4Z92B 5FV3A 2VU9A 3TNPB 4B4RA 1QU0A 2G19A 2WNUC 3SCHA 1Y43B 2V72A 2ZGUA 3WT3A 5CFDC 1Y7BA 1HRI3 1MEC3 2ZHNA 1I3HA 3CZJA 2CAVA 3K4ZA 4XDQA 1DGWA 3VBFB 5JIAA 4YW3A 4CEYA 5C3QA 3CJIB 4XQ4A 3T30A 1UX6A 2BGPA 3KGZA 4C1WA 3IPVA 1JHJA 1POQA 4WVMA 4EN0A 2ZX1A 4HG6B 4CZSA 4Y1ZA 4YW2A 4OHZA 1APNA 1NLRA 2V5YA 2EAAA 1NAEA 3PIJA 1J58A 4QPIA 4N53A 3H9AA 1ULCA 4TWTA 4W8JA 3ZYBA 1WMFA 1FMD2 2GMPA 3KCCA 4Y20A 2Q8CA 2DU0A 1FX5A 4LUMA 4XABA 4AF9A 1IKQA 3KV9A 3LQCA 4WVZA 2QQUA 1FMD1 2ET1A 4DO0A 4JTNA 1UPSA 4KL1A 4GWIA 4LKSA 4YVWA 1PIV2 5C3RA 5C5TA 5FZAA 3DF0A 1Y9MA 1V6LA 1ZRDA 5EPAA 3WDVA 2IC1A 2QBXA 4LHKA 5FLJA 1PIV1 1GZTA 2OVUA 1TNFA 5EP9A 5GZEA 5CISA 2WABA 1JZ2A 3O7OA 3DL3A 2HJIA 3IIIA 3OPZA 4NROA 4NIIA 4AWDA 4Q8LA 4HXCA 4ZPIA 1FNZA 1VMHA 4GJZA 2V09A 3ZSLA 1QNYA 4XUOA 4PIXA 1COV2 3KLSA 1XOYA 5BNQA 1F2NA 3HN1A 3MV01 1C57A 4MSVA 3GM8A 3IDBB 1COV1 1R1A2 4XF1A 4P9YA 1WD3A 4YNIA 3FMGA 1DCSA 4AGGA 4XAEA 1R1A1 1IS4A 1JU3A 2YPDA 1QOTA 3BGAA 4IV1C 1MACA 5FXVA 1DP0A 4LHNA 1B35C 4HL0A 5FXWA 1PGL2 3N7KA 1Z7S3 2D93A 3IAPA 4K40A 1NA1C 1V6IA 4QXHA 3AM2A 3E5QA 3WOGA 1RIRA 5FZ1A 1N3PA 1NQDA 2WNUB 4QX7A 4YM0A 4MGSA 5FYVA 5J3UA 1W8HA 1R1ZA 1WA4A 2VMHA 1SBEA 4WVVA 3VL9A 1W8OA 5FY5A 4GWMA 3ZYIB 2IXKA 5A7NA 3MGUA 3AYDA 2BERA 2HYKA 1DZQA 1UWWA 4YVSA 5JXHA 4XMIA 1MS9A 1W39A 4RSUA 2FHRA 3T4HB 3ZMNA 4HKWA 3ZXJA 5HCAA 4W6WA 1LRHA 4MYEA 4XF9A 2A3YA 4RGAA 5DAXA 3LIHA 4AFMA 1OUSA 3PLQA 1DFQA 2XHKA 1YJKA 5CIRA 2NM1A 2XR4A 3ZYJB 3OJBA 1JBCA 4P08A 1RUD2 4CU9A 1IOAA 3PL0A 3O1UA 5CEHA 2Z5WA 3H1YA 3HWJA 1AR92 4OLLA 4CYDA 2VBBA 1RUD1 1ZZ9A 1D2QA 2ARBA 2K2SA 2AUYA 1HJGA 2WDBA 3IT8A 3OF1A 4I09A 4O7XA 1GR3A 5FK8A 1QXJA 5LBEA 2WC2A 3KM5A 4B7KA 3JBG2 2JG8C 5FQ0B 1FI2A 4CCKA 1E5IA 2JDUA 3MF6A 1QJEA 1NQJA 4RYDA 1OI6A 3JBG1 1G7YA 1KD7A 3EHKA 4E2SA 2JB4A 4KQ7A 1VRH3 1G9AA 1YO8A 5LASA 3S6PA 2RG4A 4M3CA 5IJRA 3VBOA 1F15A 1K5JA 2W5FA 2I45A 5A70A 1S0GA 1OKQA 1SFPA 1UZYA 3NQHA 3ZKYA 2VZTA 3ZXKA 2BDRA 2VNVA 2IXJA 3S7EA 1GUIA 4QX5A 3I3DA 1QY4A 1ULGA 3MUY1 4UYBA 3TOJA 1DZTA 2RS13 2ZMLA 3HT1A 1QMJA 1UMIA 1F5FA 3J7LA 3OUHA 4LUKA 3VBSA 3VZNA 4I0BA 4FOYA 4BWOA 2GDFA 3NNGA 4PQ9A 1NUKA 4WM8C 3WXPA 3RZKA 1YWKA 1YIFA 3AP6A 1VE0A 1B35B 2WO2A 2HWE2 3LFIA 4WVWA 3BYWA 3WNOA 1X8EA 5EIYB 4XILA 4IESA 2HWD2 1NA1B 3OBRA 5IVJA 1XYPA 4QWNA 4LJHA 3VBHC 5C8CC 2HWD1 3AYEA 2CWMA 3NNFA 4Q4Y2 4NVPA 2O14A 1ODMA 5LY1A 2XJVA 4ISQA 4XJWA 2H6CA 3RG0A 5JPMB 1NYWA 1ZBE3 3KMHA 4AEMA 2VMDA 1W90A 4KGGA 3I49A 1L7RA 5HPOA 1SPPB 2VO5A 3VD4A 5DMYA 5AFEA 2XMLA 5APAA 5G04L 1UYZA 2WNVB 3W58A 3ES4A 2E31A 5AVPA 4GH4C 5IUQA 2WS92 2ZMKA 2WN3A 4JRLA 1O3QA 4P5YA 4KU8A 1NE6A 4W6YA 4YWAA 2Y60A 1W2TA 4W6XA 2WS91 4C90A 2VPVA 4FOVA 4S2DA 1FXZA 1J1TA 5FP9A 2HWC2 4IETA 4IV3A 4AI9A 1JZ5A 4MZUA 2XXZA 2X5IC 2JG9C 3BVCA 5F5AA 3Q8EA 1KS5A 3QOPA 4N7UA 4MH0E 4PCRA 4NPLA 3ZXAC 4HONA 2D6NA 2P6HA 4OQ8A 2QQKA 2AH2A 2JD9A 5FY7A 4AFCA 3A4UA 5BUVA 3NJYA 1VBA2 1O3TA 2TUNA 1TME1 1S0EA 5CG8A 1AYM2 4YZ3A 5LA9A 3AKSA 4CCOA 1N1SA 1ASJ2 1RGSA 2PAEA 5CYYA 4X8NA 3KZ4C 5A7QA 4XCBA 5C33A 1AYM1 1PZ8A 3NKGA 2WA4A 4YZ4A 2Q8DA 5BNOB 4Q8KA 2HEYF 4FQZA 1VAMA 1HRI2 3AMQA 1MEC2 1LAJA 5C9AA 5DUVA 3RDIA 2VY0A 2R042 2IUWA 4KWLA 1HRI1 3WR0A 3WNPA 1MEC1 3EQEA 4WM8B 2GNMA 5HV4A 4XHBA 2V5DA 3OSDA 1SLBA 2Y6GA 3KQ4B 4G9SB 4TSVA 3MLKA 4QM9A 3I2HA 3E5UA 4Y22B 5GALA 2ZACA 1G9BA 4GMP3 3VBRC 4HT1T 1CIWA 4OHWA 5FYSA 4AG4A 5EJ1B 4IEVA 5FWEA 2R16A 2VMGA 3VBHB 4DRRA 1M4WA 2XBO2 2ZGRA 2PXJA 2LM3A 2W91A 1REFA 2D6PA 3J4UH 4TLGA 3M2MA 3NV1A 5CVRA 2OKXA 1LOGA 1S55A 1TQ5A 1UXXX 4MVTA 4XBLA 2JDZA 4OHVA 1NX9A 2NN8A 3POJA 4RR3B 5E16A 2QFEA 3UL2A 2NMOA 2R1BA 4UW4A 1OFNA 5FO9B 3MW2A 5FYIA 5IHRA 3T1LA 5J1XA 1ZREA 2HEVF 1DQ5A 3MYXA 5FXZA 2VQUA 4CTEA 4IGQA 2Q1ZB 1J84A 4JKKA 4MOAA 2BOIA 2LUWA 5J96B 4QQOA 4QD2A 2VQ0A 5IK5A 3NNJA 3W5MA 4GH4B 4IE6A 4CXWA 2A71A 2RM23 4CP9B 1UNBA 3RZGA 1GNHA 4DUWA 3UESA 3GJBA 2QNKA 5A3TA 4A7KA 5I8YA 3K51A 1PMJX 4LQRA 5KWRA 3FUQA 1JU4A 4LBLA 5GKAC 5ABJC 2GH2A 2P3JA 3KCYA 1WMXA 2NQYA 4JAAA 3VD7A 1OMIA 1WKYA 2JG9B 3VHRA 2JDMA 1GFF2 2A6ZA 1LOFC 2W52A 3PMEA 4KBBA 2OZ6A 3NKTA 3JD73 3JCIA 1UY4A 2VTXA 4LBOA 4BOWA 5KHGA 1GNZA 1BQPA 4XJ9A 2OYZA 3BN6A 2TNFA 1D0HA 1CN1A 2J1RA 3C8XA 1W6NA 1YI9A 4XEZA 3THDA 4LITA 3I2OA 4JCKA 4HK9A 3KV4A 5CFCA 3BTZA 2ZAHA 3SKVA 4AFAA 4B29A 2F4PA 1EP0A 2GSYA 1Z7S1 5FZHA 4PBPA 1O5LA 3TEXA 3PU3A 2AGSA 1FNYA 5DZFA 2W9XA 1QH7A 2KR2A 2Y0IA 4RL7A 5I8TA 1ULFA 3O1TA 1W03A 3S5QA 1CD3G 1XC6A 4PDWC 4E4SA 5KHHA 3FX3A 1P8JA 2XJUA 1GQGA 2ZGLA 5AVAA 3ZN6B 5F9TA 1OOPB 3GZTB 4E8CA 1M06G 1NZIA 3OBZA 1NZCA 4NHMA 3T1MA 2WAAA 2ATFA 2WLPA 4QGMA 4J25A 5L36A 2C0ZA 3PVNA 5FXXA 4NWWA 5A6YA 2UWAA 1GBGA 4AI1A 4QQ2A 2GNDA 3WDTA 4PT6A 4EWAA 3AZZA 1UKGA 1SQ4A 1HV1A 3ES1A 4JVAA 3FL7A 4F3JA 5KXEA 1IPJA 5FBZA 4I3PA 3AZVA 2CL2A 2YY1A 4N9IA 5IWFA 1WCKA 5LBBA 4Y1VA 1XPWA 5L9VA 2VNOA 4UFKA 2DCTA 4UW5A 5GLUA 3WW1A 2VJXA 3O1SA 1VR3A 4KH9A 4NIGA 1W9TA 3KHCA 2C4XA 2ID4A 4GB32 4KNCA 4AW7A 2KD7A 3T08A 5JOZA 4AEJA 1VRH1 2RJ2A 1H8VA 1GV9A 4EN6B 1BMV2 1SDDB 2PAMA 2VW0A 1FYUA 3VBUA 1K5MC 1XB9A 2N7GA 3MV11 5H9PA 1GLHA 2CAUA 1W0NA 2DBIA 2RR13 5JZGC 2BJSA 1BMV1 2KM2A 2RS12 5E89A 4JQRA 4L92A 4XBQA 1HXS2 1R64A 4AVSA 1CAUA 2WL1A 2QQOA 1XSRA 1OLQA 3LF7A 5GLWA 3VZOA 1UZVA 3SNMA 1H4HA 1TE1B 4AEDA 4QAWA 2RS11 2DFBA 5LEKA 2FDHA 2P3KA 1A6CA 3RMXA 1D2SA 1UL9A 1WMEA 3PDQA 4LPLA 2BRTA 1IQDC 3BIWE 4YFWA 5JPNB 3RWKX 4Y24A 3T2QA 2YHJA 3VKLA 3MFCA 1UU5A 4XUPA 4YARA 2YYOA 1XJAA 3JZVA 5FOBB 2XB6C 2YBKA 5FYZA 5KHJA 1Q43A 2IXIA 1HQNA 3KVBA 4JKLA 1UZZA 1V0AA 2YGLA 4PDWB 1WCQA 4XAAA 2BZDA 1ZBE2 4LOTA 3OY8B 1SLCA 4CUCA 3K3NA 3JB8A 1ZBE1 1GZWB 4HSJA 3AP4A 4Y33A 1QOOA 2IWGB 1F31A 4DPNA 4Q0SA 5CU1A 1MQTA 3WSOA 1PO13 2GH8A 1LR5A 1DU3D 1H6YA 1PMIA 4GA9A 4FOQA 1YIPA 1W0PA 4LK6A 2J1SA 1POV3 1JYNA 4YG6A 1FMD3 4PLNA 3N3HA 4IEUA 4J1XA 4UT5A 2WFF3 4NMIA 3PTYA 5FYBA 4YFZA 5G05L 2VZSA 4FXGB 4XXPA 5I8SA 3AXEA 4BQYA 4XDPA 4BQ3A 1UOGA 3BTYA 1OVPA 4IDZA 1X7NA 4GQ7A 4CUAA 2PMWB 1ZA4A 3A21A 2XONA 2IVJA 4DEVA 2JB8A 2J1TA 1JH5A 3LEGA 4RFT0 1DIWA 2DF7A 3M70A 5FPUA 5FUIA 5GZGA 1DYPA 2R0FA 2FBEA 4AGRA 3DPRB 3RSJA 3WEZA 3NL1A 1NG0A 2VCCA 3MLLA 1MS3A 5K4LA 1FV3A 5JZGB 4X6QB 2XKPA 1URXA 3IN9A 3Q8BA 4GWJA 2ZGMA 4L0PA 1PGSA 2ZCWA 1L3JA 4L99A 4LKEA 5DG2A 4EYUA 2BTVC 2VR4A 3CHXA 3NAPB 1LESA 4JX0A 4CSWA 4ZZ5A 4HBNA 5FZOA 4AI0A 4XTMA 4JHTA 3P6BA 1DQ4A 5J98B 1ZZCA 4PLOA 4DXZA 4QU2A 5TSWA 2E33A 2P1BA 5EHDA 1WUVA 5BNPC 1LU1A 2VC9A 5LRRA 3SH5A 4OHYA 3H42B 4GMP1 4BHPA 2J22A 3ME2A 1BEV2 4EN7B 4B1LA 1UN1A 1I5ZA 3OD4A 4QKBA 5DZEA 2AC1A 2RJKA 4BXFA 5C3SA 5F3GA 3ZYHA 1LHNA 4LIUA 4PLMA 2VUCA 4TLFA 2MHFA 1O3SA 3FFQA 4QPYA 5F7UA 5CKNA 2W87A 4QU1A 3LPGA 3WW3A 2QQWA 5A3PA 2A70A 3T0DA 4RHV3 4LLFA 4DY5A 5FMOS 1U12A 4CDUA 4XE9A 5JUVA 1CAXA 1V00A 3GCWA 4OUEA 2C6SA 3V56A 3TN93 4CP0A 4CCDA 2K9ZA 2RM22 2VTXJ 2OZJA 3LEKA 2PHUA 1VLNA 5FCCA 4D3WA 1PK6A 2W95A 4PQQA 4E2QA 1X82A 4H7LA 3SXWA 2ZX4A 1YQCA 5HI0A 1H8TC 1TNRA 2YC2A 1C5HA 1MS5A 2RM21 3MDPA 3MIGA 1ND2A 1LEMA 4UFJA 4WM7C 5K0UA 2ZHMA 2SBAA 2W39A 4E4HA 4NPMA 5FMBA 4MGYE 2VCAA 5FIXA 5JSOA 3TYJA 1OSGA 4CDXC 3BKZA 3MZHA 4ONUA 4MUVA 1F4HA 3W5NA 1AR93 2F4LA 2ZGNA 4JKMA 2X8KA 3JD72 3RGBA 5A7WB 1NCQB 2BVVA 5JLVA 2ZX3A 2I07B 5T52A 2ZTNA 4FPHA 2WUHA 4B4QA 4S2GA 5CAZA 1ND2B 2BBAA 4YZ2A 3JD71 1JZ6A 2A6XA 4TXWA 1EV12 3ZFFC 2A73B 2J42A 1PM4A 4XETA 1OF3A 1UPIA 1UOJA 1W6QA 2P2KA 2YPJA 1NXMA 1X9PA 4N43C 2G9FA 4FPKA 2QQJA 3VDDB 4EJRA 3E97A 4FPYA 3GGLA 4CCJA 4COYA 3N9LA 1YCIA 5EYXA 3DXTA 4INDA 5C4WB 4RQPA 2IXCA 3RVHA 2ZA9A 4C8DA 3A23A 3I54A 4MG2A 2YU2A 3ZFEA 4BYYA 5D21A 3H1MA 2Z79A 2UURA 4P14A 1S0IA 1WWYA 4FI9A 2QCSB 2FD8A 3IDAA 3THCA 4AVCA 5FKBA 3CF6E 1AVBA 2RDRA 3VBFC 2FDGA 4K3UA 4XC9A 1C8M2 3AXDA 1OH3A 2EXJA 5CADA 2PHLA 5FZ0A 2HWE3 1YEWA 1O7FA 1XXNA 3ETPA 1C8M1 1Q56A 5IVYA 5K7PA 2W3JA 1W8FA 2ZJCA 2CGPA 4CDQA 3NJXA 2A75A 3WCRA 4KMQA 4R9BA 4UBHA 4EZ4A 5JXIA 2Z2SB 4V2WA 1RMU2 4CEYC 5F3EA 4Q4Y3 5L7OA 2O0OA 3Q8FA 2W94A 3ZYPA 3KT1A 3M1HA 4HSLA 1I9RA 3ELNA 1ZRCA 2NLRA 5FPZA 2EA7A 4QPIC 4N53C 4CXXA 4P9IA 1N1TA 4DB5A 2DTWA 2R7EB 3N4MA 2ZOEB 3IBMA 2HWB3 3MIFA 5JCTA 1H8TB 2Y26A 3GZAA 3LDBA 3AYAA 4FPOB 1O8SA 1DG6A 1S0JA 4CEWA 3KF3A 2UWBA 3A22A 1BZWA 3M4FA 2WS93 1ZBA2 4JV4A 5FPBA 2E32A 2RR12 4XUTA 5ACA3 3ZFGA 4CDXB 3ZYGA 5JR7B 1S2BA 4LKFA 4Z2WA 5LK7B 4BQ4A 5LEJA 2VD7A 1GICA 2RR11 2ZEWA 2HWC3 1ZVFA 2XUEA 4GIQA 1YRZA 3OEBA 4NHYA 2OS2A 2A3XA 1I1EA 2GNTA 2PHXA 3RWNA 1N3QA 3LOIA 3B69A 1RUOA 1CGPA 2Q4SA 2HLEA 4I02A 4Y1XA 1BVP1 1CAWB 2ZGKA 3KV6A 3SHRA 3ZFFB 2NPIA 4BJ0A 4LBQB 2C24A 2YROA 3ZXEA 2R6QA 4M00A 5D8AA 1TVGA 3DYMA 4BISA 4N43B 1VBA3 5FYUA 3AFKA 4M01A 2PAKA 4Y1UA 1GWMA 2VVDA 1MVQA 2CY6A 1X33A 3I2KA 1ASJ3 2VZQA 1QJY2 1G9DA 4GKYA 2AZ5A 1YNAA 3AL5A 4OZOA 1S0BA 1A34A 3SEEA 3ZR5A 4FFHA 1ULEA 5LBCA 1UQXA 4QQPA 2XVLA 3PVEA 4KWKA 2QQLA 5JOXA 3WV6A 2GC0A 3O1MA 3E6CC 2PQSA 4B1MA 3MIEA 2R043 1FAYA 1STMA 5FZDA 3RJRA 5J09A 3ZDVA 3GBWA 4XIKA 3H8RA 3GZEA 2ADDA 2GU9A 4DZGA 2QZ2A 2VBPA 3C7FA 4IEZA 4LO7A 4Q1RA 5D1IA 3RQ0A 3V0AA 5IFTA 3L2HA 1O59A 4XHXA 2JKBA 2WJSA 4D6SA 2UWCA 2EIDA 1PO12 1RJ7A 2VZPA 2D5FA 2W1QA 3KS7A 4CU7A 5A6XA 5JSRA 5E8AA 4TZDA 1AL23 1ND3A 1PO11 5C3OA 2GC3A 3ACFA 4NO4A 2WFF2 2XBO3 3ACIA 3IMNA 4CEYB 4FPCA 3HBZA 3ASIA 3IPVB 1POV1 4LE3A 4C1XA 3OCPA 3C3VA 4WVMB 2WFF1 3RJ2X 1PVXA 5FTTC 1O4TA 1C3HA 4QPIB 3KT4A 2ZX2A 4N53B 1AX1A 1C1FA 3I3QA 3J7MA 4IERA 1TMF2 2WZR3 3BTXA 4Y20B 3RS6A 1JW6A 4HVQA 4UFHA 3DGTA 4GZ9A 4QXKA 5IATA 4O9GA 2FCVA 1TMF1 2GAUA 4QB6A 4ZY9A 4ARXA 3V0BA 1LB2A 4XFIA 5HXMA 4A41A 1OF4A 3VD3A 4YVWB 2E6VA 4ARYA 5T5JA 1LHUA 2XJPA 1RUF2 1XU1A 3SH4A 4AHZA 3VDAA 4AXOA 3EBRA 3GF6A 1SACA 5FYMA 1AXYA 2Y34A 1UF2C 3PUSA 4ZZ8A 5JOYA 5JMOA 4H3WA 1IS5A 3LSEA 4XURA 3VBOC 3LB9A 5EYYA 1YC61 1ODNA 2H6BA 4FBFA 3I4IA 3UT0A 4A7ZA 1BYHA 1IGOA 4ASMB 1SFYA 4Q26A 4K9SA 2QVSB 5KHIA 1J3PA 2VOVA 4XZPA 3VBSC 1GQPA 1DHKB 2QJVA 3WF4A 3ZYFA 4AGVA 4AHWA 4Q5OA 3HR9A 3Q9OA 4KG0A 3TB0A 1PGL1 2QQNA 5DQ0A 4F83A 2HH9A 1BJQA 1W9SA 4WZCA 1Q3EA 1CAVA 2IXLA 1N1YA 1CPMA 4RHV2 2B46X 5CFDA 3UJOA 4NOTA 1S0CA 2BGOA 2ZPXA 3WHTA 5HBAA 5HV0A 1W6MA 2QUOA 3TN92 3VKNA 5A6ZA 3OPTA 3AP5A 1H4GA 4RHV1 3AKTA 4JHZA 5IW0A 3ST7A 1WCDJ 4DQAA 1F5JA 3RFRA 2XVGA 4Y4RA 3TN91 2WNVC 3WQ7A 4CDWA 4COVA 3IWZA 4BZ4A 1SLIA 4IE4A 5FY4A 5JDBA 2BNMA 4YVSB 1R092 5F37A 2IVIB 3FBMA 3CU7A 5F2SA 5FZ6A 2JE7A 3RZZA 4WZFA 2J1AA 1GYKA 1LHWA 2YUEA 4XIOA 5FREA 3FHAA 1UW8A 4BLIA 3K4AA 3LKJA 3N9OA 1KEXA 1VBE3 4NIAA 3C7HA 1AR91 1CQ9A 5AFBA 1XRUA 4XDOA 1LGBA 2D40A 2HKXA 1VAVA 3U78A 5J48A 2XQXA 1YFXA 2DYCA 2UU8A 4OUSA 4AK3A 1SLTA 1T2XA 4XUNA 4EWEA 1JHNA 2XLGA 1W2AX 1C4RA 4LKDA 4IV3C 5DZGA 1NXD1 4GB33 3MPPG 1JZ7A 2A7AA 1GWLA 1LGCA 2VL4A 2HWF3 5BNOC 1JZ3A 1A78A 5EQUA 1D7PM 1UX7A 4S2HA 2XGXA 4EZHA 2UY8A 4FFGA 4M3CB 1HXS3 3AZXA 3VBOB 2RDQA 4AI3A 4L8QA 3W9AA 2BBVA 3WX5A 2BP6A 3BTAA 2X53S 4M0NA 3N9PA 1RUNA 3HAGA 1QIQA 1F8VA 3AL6A 3NV2A 2K46A 3I7DA 5F39A 5BNNA 2MNGA 1XYOA 1US3A 3THTA 4IV1A 2R49A 2HWE1 2DCJA 2G4IA 1YQ8A 2YDEA 3AMPA 4OMDA 4ZKTB 3UKVA 2VNGA 3HVDA 4UF0A 2VG9A 3WQ1A 4Q4W3 4K1YA 2TBVA 1YJLA 2E7AA 5GJ6A 3D5OA 1OA2A 4Q1PA 1VPHA 1UY0A 2DBNA 3AVRA 4HANA 4FP3A 4Q4Y1 4RR3C 3WUCA 1QNWA 3DUIA 4O61A 5BNNB 4E4DX 3FHIB 2UYBA 1YQ6A 4IXLA 4BU2A 1CX4A 1LOEA 5FZFA 2PYTA 1IKPA 1YQ5A 2HWB2 4R9CA 2VW2A 1LKNA 1W6PA 2VNRA 1PMHX 1V6OA 2EIBA 3SLIA 4PJYA 2QDNA 2HWB1 5ACA2 4QHZA 1CJDA 3KSCA 4P00B 4IE0A 2YBPA 5ACA1 3WP4A 5FLIA 3DKQA 3T09A 1LCLA 3ZXDA 3LSDA 1SBFA 1UY2A 3M3QA 2HWC1 3H3ZA 3H3UA 3OUIA 1SCRA 4NRMA 2XUMA 3DXUA 4ITCA 5F6KA 2WKKA 4QQLA 2LALA 4QQHA 4MADA 4YLZA 4UWDA 1G9CA 4M4RA 4NHLA 2JG8A 4N9HA 1K12A 4IV3B 2BFUL 4XFAA 5T50A 3V64A 1OC1A 3TWIA 2EXKA 4LO8A 3WVJA 4CCLA 1WLWA 3ZMOA 1VBA1 4LNVA 1CJPA 3V65A 4KWJA 5F5QA 1T6GC 1KITA 3HQRA 1ASJ1 5L73A 3APBA 5LWBA 1R083 5I0RA 2VMIA 4Q4X2 4BCUA 3MICA 3CDZB 2ZKLA 3SCGA 3WDXA 1UO9A 2DU1A 4GAZA 4XFHA 4YW7A 3PMSA 3VKOA 5C7GA 1GP4A 1IZ3A 1JTZX 5C5UA 2R041 5LBFA 1MZ5A 1OOPC 1UIKA 5KC6A 5JXJA 4ZXEA 3ZSJA 3O1RA 5C9AB 2ORZA 2RV9A 4E9KA 2QTWB 3ILFA 1XNTA 2B42B 1AL22 4YGBA 1V6JA 2GC2A 3QBQA 5FP4A 1AHSA 3ZSKA 2FDFA 1FPN3 2O8OA 2GALA 3ACGA 4OMCA 2W68A 1NLSA 2HBUA 4N8MA 5EJZB 1BEV3 3FHQA 3SQOA 1G6NA 1MS8A 4NWVA 3AMNA 1AL21 1VIWB 3S57A 3ALQA 1VB4A 3GBGA 2XBO1 5C8CA 4YG3A 2AYHA 4HK8A 4QGNA 5E88A 1Z78A 2PELA 2RS32 3I59A 4AVTA 2ILMA 3D0JA 1QDOA 1SZBA 2WZR2 1HB3A 2RS31 4JGYA 4UOJA 3MIHA 1AR83 4I3GA 2WZR1 2RS52 1UAIA 4EN9B 5CBLA 3O0WA 5DUWA 1E5RA 2DVGA 3JU9A 3TEZA 4Y5SA 1IHMA 1QDCA 1VBB2 4LXLA 4AAXA 4BQ1A 2PHTA 2GN7A 4D6QA 4JTOA 4OHXA 5LW9A 2VBDA 2OT7A 3N36A 2LTNA 1JS9A 4XJZA 2ARCA 1JN2P 2O8QA 2OXBA 3UETA 5A3UA 3J8F3 2XJTA 4ORFA 4PI0A 5CKMA 1HDKA 4HPKA 4XFGA 2WZPP 3CO2A 5FZ4A 5K8SA 1LJ7A 2X5IA 2DVBA 3WNKA 3VBUC 4P9LA 3T2PA 2RVAA 1EV13 1WGPA 2EIGA 3A0KA 4PBOA 4HKOA 3IIAA 1TZOA 3MIBA 4BIFA 3UKNA 5HCFA 3U07A 2O1QA 2ENRA 3OYWA 4AEDC 5I93A 3NMBA 3OOXA 5CNAA 3O1VA 2VZOA 5FUPA 1ZX5A 2ZGQA 4LA2A 1AJOA 2BU9A 1A8DA 1QJZA 2QQVA 1DGRN 3ZIXA 1W6NB 5FZGA 2WZEA 5EJ3A 5FZKA 2DV9A 5FMCA 5CFCB 1CWPA 1JZ8A 3QD6A 1YHFA 5T5OA 1RUC3 3S0MA 3EMRA 4NAMA 1H30A 4YZ1A 4JDMA 2XHNA 5M0TA 3O0VA 1C8M3 2GZWA 2WT0A 1IS6A 5FPXA 1J83A 1WW5A 2AACA 4IE5A 1WD4A 1LHOA 2Y33A 3AFGA 4J1WA 4L11A 2AR6A 3BPSA 4TYSA 5F5CA 5FZ7A 1REDA 1U5ZA 2ZBJA 2P4EA 3PJQA 2XG3A 4AVVA 3VBRA 4RGGA 4XQWA 4MHUA 3H1WA 1VBD3 1HQWA 3AJZA 3UKTA 2JXAA 1MVEA 4ZHNA 1KFXL 3J7HA 1RMU3 1GANA 2ZEYA 4I01A 1QJU3 1VBE2 2IFWA 1CZVA 3ZLIA 3LOBA 4LHSA 3PUHA 2F17A 2JENA 2W1SA 4Z1VA 1VBE1 2VECA 2YBSA 4S2FA 1N1VA 1NT0A 5A3MA 2JIJA 4XJUA 2D3PA 4ASLA 4RA0A 2VM9A 1GSLA 4PHZA 5FK7A 4BK4A 4A4AA 3ECQA 2VMEA 4P02B 4P9GA 3N9QA 4D8MA 4DEQA 1PO22 1XQNA 1DBNA 2HWF2 3DPRC 5FPVA 3I2JA 1Q8PA 4GB31 5A1FA 1XNDA 1ZBA3 1V9U3 1UZ0A 3T3YA 1CESA 4LO5B 2HWF1 4AI2A 3AB0A 2VQTA 1PNGA 3KV5A 3PUQA 3LIGA 5IVVA 1O4YA 1OQEA 2ORXA 2OPWA 3MEPA 4NR1A 4X8PA 5ABJA 1DGLA 3IDEA 5FBJA 1EAH2 1ZZBA 3E5XA 1HXS1 3NAPC 1VMJA 1WLCA 4K6BA 4O9EA 3VBUB 1LOFA 1E5SA 3U11A 3I2GA 2XH6A 3FLPA 4XFBA 1PHMA 1XE8A 2V73A 3HOBA 1ENXA 1CAUB 1NKGA 2PLV3 3H8OA 5FKCA 2Q1FA 4Q4W2 4AEDB 4CXYA 2BOJA 3TEYA 4LBQD 1QJY3 3FBYA 3WNNA 4CPBD 5JXGA 2W1UA 4NE9A 1OVSA 3ILNA 2QKDA 1SLLA 4Q4W1 2I74A 3OEAA 3WHUA 3RZMA 3K48A 5JI9A 1GP6A 1YFYA 3I3MA 1QHDA 1ACCA 1L7QA 1S2KA 2Y6JA 3JQWA 4XFFA 3WW2A 4AQ2A 4QPGA 3GHMA 4FPEA 1MR5A 4QPWA 3AKRA 5LATA 4PIZA 4XTPA 4YW5A 3AK0A 1BXHA 1MZ6A 4TTGA 5FP8A 3I2IA 4MGIE 3B5LB 3ABZA 5FYCA 3POYA 4AE2A 1E57A 1WCUA 3AZYA 1O8PA 1RL3A 3D0SA 4QPGB 4ZU5A 4R4XA 1ZNPA 2MEV3 2YZ4A 4OYUA 1ENQA 2RMU3 3TNQA 2YGMA 2JWPA 5K9YA 4ZU4A 3H50A 5LZ6A 2NYYA 2ZHLA 3WP6A 4K8FA 5KXCA 3WF3A 1MQTB 1PK6C 3R0RA 4AYUA 2JECA 3VZKA 4JGZA 1NCQC 3B9CA 5A1LA 1V6MA 2QZ3A 3JXSA 1ND2C 4Q0UA 1PVC3 5K0UC 2WINB 3VZMA 3J9SA 1TMF3 2JEMA 2NP0A 5FZCA 1KXGA 2OQ6A 3OB8A 4YG0A 1C28A 1X36A 2J1EA 3U37A 1OLRA 1JOJA 3MHZA 3VDDC 2OA2A 2BGCA 2R063 3MLJA 4XMAA 2X10A 1R082 2XKOA 5FPLA 2D6MA 1IPSA 4N90A 1RUF3 5C4WC 1LECA 4I0AA 1QJX3 1W06A 1W6OA 2H0BA 4NRQA 2WAOA 3SC7X 3NWKA 1X8MA 3VHNA 5FMDA 1W8ZA 1K5MA 1R081 1DQ2A 3PHMA 3R4DB 5B2GB 3T0AA 1JOBA 4OCTA 3UNPA 3R4UA 3VUOA 1QKQA 3KF5A 1DGRA 2Y0OA 5FAXA 3U4XA 2GMMA 2VXJA 4P9XA 1F4AA 3P3PA 1BHGA 1W8NA 5FO8B 2H0VA 3QACA 4RQPC 3USUA 4AEKA 1VRBA 5F2WA 1S1AA 1W2NA 2BWCA 2FQPA 2WIIB 4KG8A 2ARAA 1FPN2 2LS6A 3K75B 1HJFA 2W08A 3M3EA 2VMFA 4KWUA 4Z07A 1OURA 3GNEA 1MZEA 1RXFA 1FPN1 5FZOB 3J26N 3N7MA 1BEV1 2R30A 2C9AA 4FFFA 4GWNA 1UZWA 4P5HA 3BUCA 4HVOA 3BU7A 5FMOL 5J37A 5A80A 2DTYA 2D3RA 3VHOA 4FAHA 1AR82 2BNNA 1Y9QA 5FY0A 3BCWA 4Y1YA 1VAKA 1ENRA 2FDJA 1AR81 2GN3A 4QX0A 2OQ7A 1OKOA 5L7OC 5GLVA 5FZEA 2CU5A 1RINA 2NZ9A 3CL1A 3H8UA 5DAWA 3ZVXA 3CJXA 1R093 4EE2A 1JUIA 1LHVA 2P37A 3CZUA 4ZS3A 4CDUB 3ZIWA 1CAXB 1FT9A 3J8F2 5FLHA 5A32A 3HJRA 1LULA 1W99A 4C91A 4QB2A 4K20A 1PK6B 4IUGA 3OBAA 1H2KA 3J8F1 4A6OA 4GMP0 5DDJ3 1GMMA 1DQ6A 3GJAA 3WG3A 4FO9A 4CUBA 1G8WA 4CEWC 5K0UB 1PX3A 2VZ1A 3OGJA 5F1RA 1GP5A 1PGW2 4GALA 2VOWA 3BB6A 3KGLA 3G6JB 4QX2A 4QT6A 3WQBA 3LA2A 4XF4A 5L9BA 3ZFGC 2R32A 5A1AA 3NO8A 5H9RA 4CCEA 3IMMA 4GKXA 1G9FA 2R073 2P3IA 1EV11 1OBNA 3AP7A 4H55A 4ES9A 1RUE2 3B9IA 4ZU7A 2GP3A 2DVFA 1JI6A 2WO7A 5DUXA 1RC6A 4FVVA 1IG0A 5T3NA 3FFZA 3RMYA 1A3KA 1KFUL 1AX2A 1O4ZA 1D4M2 3ACHA 4FFIA 1NE4A 3WF0A 1NCRA 2Q30A 1IS3A 4Q2FA 3INAA 4NN0A 4W50A 1W6QB 2D6LX 1D4M1 1RUC2 1OQ1A 1EUTA 4JDNA 4V2VA 2Z42A 4NHKA 1W9FA 1CR7A 3PNAA 1OA3A 4DINB 1RUC1 4RQPB 4ZXKA 1Q5OA 5FUNA 3ZFEB 3ON7A 4PI2A 3RNSA 4D69A 2DCKA 1CZTA 4IGPA 1BK1A 2DUQA 3I3BA 1VBD2 2K0GA 4XW3A 4KU7A 3U0ZA 2ETEA 4LE4A 5BNPA 3FLTA 1QJU2 1F35A 5A3NA 3B01A 4MXVA 1VBD1 1ALYA 3ZN5A 4QX8A 1JYVA 2XL7A 1RMU1 3PIGA 3OG2A 4PF1A 1QJU1 1QQP3 2VCBA 2WT1A 3O5SA 1AR73 4YGCA 1JYIA 3ZPOA 5EV7A 4CU8A 1C5IA 3AKQA 4CDQB 2Q5TA 3I2FA 3UGFA 2LW8A 4CVUA 1DGWX 1ND3C 1H1MA 5L7OB 1VBC2 5CA6A 1BLZA 4Z8BA 4YRDA 4CA9A 2YFUA 3E1F1 3U75A 1ULPA 1V9U2 4YVWC 3T2TA 2DFCA 4E8DA 1LU2A 4L97A 5F8PA 1LEDA 3D4KA 3NSTA 4WM7A 1ZBA1 1V9U1 2ET7A 1JOPA 2G9ZA 3LZZA 4MXWA 3E6DA 5C70A 2YV8A 1DQ0A 3KVAA 4FXKB 2BYVE 5LA1A 1W8TA 4CEWB 2WYSA 4LMFA 3VBSB 1YQ2A 4FP2A 1AR62 1QEXA 1GOGA 4RS5A 4FSJA 4URTA 4Z82A 3ZFGB 1H2MA 1AR61 3K77A 1XE7A 2B7YA 3SCFA 2E63A 5FYHA 2PLV2 5B4XA 4BXSV 3KQRA 3EXUA 4U2AA 4G4FA 4AFBA 4YGEA 4CPBA 3FLRA 2VZUA 2PLV1 1IG3A 2SLIA 3HN3A 4FT8A 4W4ZA 1QOSA 5B4NA 3BI3A 3WQ0A 1RVF2 1WW6A 4EWDA 1D0GA 3IM0A 2EALA 1QJY1 4ISRA 4YW4A 3T4VA 3QH6A 5D8AB 2PHDA 3WW4A 1SMVA 3HNYM 4Q4X3 1RVF1 2AREA 3MPBA 3CEWA 3PVOA 3VD9A 2MPFA 1S2EA 2RJLA 3FJSA 4P9WA 5JOWA 4A3ZA 1JYXA 4Y4YA 4R9AA 1DLLA 2CSGA 4ASKA 3D6EA 4B7EA 2D6KA 1W9WA 2ERFA 3PTRB 4BK5A 4R4ZA 2VXRA 2XLAA 4KBZA 1US2A 4NPRA 2YMZA 3VBFA 4ET7A 3CJIA 5JVVA 5FZIA 3ACLA 2E7TA 4OI1A 3RI8A 3B00A 2MEV2 4YVSC 2PHRA 1OPMA 2RMU2 5CB7A 2QQMA 2LROA 2WSUA 4RGKA 1UXZA 2C9KA 2VUJA 5JIUA 1F9KA 5EWSA 3V0AB 1LTEA 3H3LA 2ES3A 2MEV1 2RMU1 4RN5A 2PA7A 1FATA 3J7NA 3QCWA 1WBLA 2RS33 2EXHA 1GNYA 4K8RB 3K3OA 4IL7A 4CDWC 2B9VA 1VALA 2E53A 1PVC2 3WY6A 2OUHA 3HD8B 4DMIA 2B5HA 3WNXA 4NJ4A 1ND3B 5DAQA 2CDPA 5JWPA 1AYN3 4IGOA 2B45X 2VZRA 1YFWA 3LGRA 1PVC1 2VVEA 5HXVA 4AVAA 4CP1A 3NJVA 2ZXQA 1ZZ6A 4F7ZA 2RS53 3BU0A 1UU6A 1XNAA 1AXKA 2R062 1CIYA 2DUOA 3HNMA 1VBB3 5F32A 1BKZA 3I3EA 4Q4V2 3LDKA 4E4ZA 2XL9A 3UV9A 1QJX2 4CCMA 3LEIA 1KJLA 2PN5A 3LA7A 2R061 4CCCA 1KQRA 2Y6HA 3BOPA 4AHXA 2FZ1A 1C1LA 4Q4V1 5E1RA 2VGDA 1RUF1 1Q8OA 1HLCA 1QJX1 2RDSA 3O12A 2X09A 4L2NA 4QKNA 4HN1A 4V1PA 4XVHA 3CLPA 5FP7A 3WF2A 5DG1A 3WZ1A 2V4AA 1OLME 2Q0AA 3MW3A 1POV0 2WT2A 3DN7A 2P5BA 3FN9A 4LOSA 2ZAAA 3RRDA 1ONAA 2VAUA 3POEA 4MGTA 5L19A 5GZFA 1ZA7A 1CONA 2OUJA 1G86A 2TEPA 1EPWA 5FZ8A 2XDVA 2ZS6B 3EB7A 4LTAA 1H9PA 3BPZA 3CKHA 2WNUA 1RB8G 2OPKA 2C5DA 2Q1MA 5L9RA 5ANQA 2PQQA 4AAPA 4QHBA 1HN0A 5BNNC 1HX6A 2RDNA 2ZZJA 2VTFA 1X9TA 2FCTA 3ZPYA 5J7MA 3HPNA 1VP6A 1W3XA 1CAVB 2G9GA 4L9BA 2VOXA 3MW4A 4D7SA 5F3CA 3N35A 2JDPA 3R4SA 5CFDB 2DWRA 1UMZA 1KGYA 2VULA 5LA2A 1W6MB 3DCQA 5DN2A 1JYTA 1EYBA 1R091 4UXAA 5IAXA 2D98A 1WMDA 1ZRRA 4QDQA 1JXNA 5DDJ2 4FOWA 4CDWB 3LDRA 5D2AA 2R1DA 1PNFA 1HIXA 3C7GA 5DDJ1 1LOBA 1UOBA 2YFZA 4AL9A 4QHOA 3K46A 4XJ8A 1LOCA 1Q8VA 2R072 4QDRA 4OI0A 1H6XA 3AZWA 4EROA 5FQ0A 2BWAA 4NIDA 4FTSA 2W0XA 3HNBM 1QH6A 4DXRA 1PO23 2R071 4URAA 4NRPA 5I0UA 1SHWB 1KDMA 1W2UA 4QDSA 3HIFA 3MUZ1 4OUMA 3ZDSA 3ENRA 2JDAA 1V6NA 4I30A 4XF3A 3POIA 3NVCA 3SH3A 4P9JA 4DNYA 1JYWA 2CWSA 4LHLA 3ZX7A 5I0DA 1EAH3 1XU2A 3W20A 3VZLA 3BOWA 2OIIA 5T55A 1BVVA 3AJYA 4AR2A 5CKQA 1J3RA 3KD4A 4LA3A 2WFPA 4WBBA 5C9AC 4QXCA 5EXOA 3NNLA 1UYPA 1LODA 3M3IA 3SMHA 3OBTA 1B35A 4X6RB 2YC0A 3OGVA 3S30A 1W3VA 1HRV2 2QE3A 4EV0A 3ZO0B 1NA1A 3LE0A 4NAOA 1WLTA 1C8NA 2JDKA 3R6SA 4YSFA 3VDBA 1HRV1 3WP5A 1QQP2 5H9QA 1AR72 4YW6A 1GKBA 4KGQA 2XJSA 1HB2A 3LFMA 3RI9A 4IV1B 5IK4A 1GU3A 3POGA 3H7JA 1RUH3 2JKXA 1QQP1 4OFGA 3KWVA 4UF0B 3ZSEA 1AR71 4CCNA 5I0SA 3V0BB 1HV0A 3EYPA 4YW1A 4LULA 2WO1A 2QQIA 1Q8QA 2CNAA 5FJKA 3TBDA 3MBWA 5FRAA 5DXDA 4AVBA 4UI9L 2WQZC 1SPPA 3W21A 3WINE 2VOTA 4D7YA 2FZ2A 4MX3A 2GMEA 2CTVA 2HEWF 2WNVA 2AEZA 2JDNA 1X50A 4NUBA 3FZ3A 4BQWA 4JGYC 4WV8A 2DURA 4HETA 1XNCA 1KDKA 1W6PB 3IB3A 4BB3A 1H2LA 1ZM1A 5IVFA 1JMUB 4QM8A 3HQUA 4A42A 1OT5A 3P5BA 4XXAA 4UFLA 5SV8A 1SEFA 2CGOA 4FTEA 4I0WB 1PZ7A 2DDUA 4LBKA 1WA6X 2VW1A 2A1XA 3FE5A 2W47A 1OPOA 4XUQA 5JSPA 3GCXA 3BALA 3I8TA 2D43A 4IEPA 4TN7A 1JYCA 3Q8AA 4RD7A 3D3AA 1O3RA 4M3CF 3FWEA 2A6VA 3UJQA 2D7FA 3JQXA 4B3NA 1W05A 3LA3A 4OVEA 4Q0VA 2CDOA 2JG8B 3I2DA 1KS4A 5T54A 1NY72 3ZKUA 5BNOA 1Y4WA 3CNAA 4LBMA 1TME2 2WQ4A 4C0BA 2IZWA 3ETQA 3B93A 5CFCC 4Q4X1 4FPFA 1RHI3 1T6BX 2Z69A 1NY71 3RYRA 5FPAA 3ZXFA 4MV2A 4AQTA 5F6LB 2WN2A 1WLDA 3IDCB 3FC0A 4NHXA 1OA4A 2Y6KA 4UFMA 4MLOA 4DY3A 1MS1A 1XSQA 1YXWA 2OW4A 4M4PA 2BFUS 4WM8A 5FZLA 3OUJA 3ZM8A 3R05A 5BV6A 4MGKE 1REEA 2QDRA 4Y22A 3IKWA 3NV4A 4JRAA 2B4KA 2VZVA 3UGHA 4DXTA 2G1MA 3UGGA 1TEIA 3VBHA 1ZZ8A 4AQ6A 3AC0A 5A3WA 1UU4A 4FTBA 3UYJA 1FOD3 4HOOA 1RUI3 1OD3A 1UYYA 1U5YA 4LT5A 4MGZE 2XJRA 1AYN2 5HCHA 4XQDA 5KR7A 1NLQA 4H14A 4RR3A 4EN8B 1VMFA 2CGNA 5DPNA 1AYN1 4D94A 5C8CB 1Y9GA 4QKDA 4DUXA 5BYNA 1AUYA 4BQXA 3I59B 1LOAA 3PUAA 2RS51 2D44A 1MPXA 3M7AA 3NV3A 1UYXA 3WD5A 3D8CA 5AC93 4GH4A 1I5PA 4JGYB 4CP9A 2ZKNA 1N47A 3RZHA 3ATGA 1VBB1 2GNBA 1ULOA 2B9UA 2VCMA 1NOVA 3N7LA 4ZONA 3Q8CA 5A7PA 3ZN4A 4FAGA 5IK8A 1A8MA 5ISLA 1E5HA 4Q0QA 3ZYRA 2VUAA 3K4DA 1OLMA 4CUGA 1RJ8A 4AI8A 3P3NA 4HFSA 1W04A 4YM3A 4BM8A 5FWJA 4XOGA 4N7IA 4QB1A 1OH4A 1DF0A 2FDIA 2JG9A 3F2ZA 1Q8SA 2VUDA 3PVBB 2WYFA 4K21A 3WG2A 1O5UA 2W2IA 1UD1A 2VOKA 3JUUA 1OD5A 2GC1A 3NJZA 5IK7A 3POFA 1FV2A 3B3QE 3GZUC 3LAGA 4YM2A 4HLTA 2VMCA 1XBFA 2BQPA 4HPKB 3TEWA 1RUG3 1RUE3 2X5IB 1UMHA 3WDYA 1KRIA 1ZRIA 4MGQA 1SBDA 3MIDA 1RUJ3 2P17A 3PU8A 3LPFA 4BQ5A 1D4M3 4YYOA 4A2UA 3GBFA 5F5IA 4D7TA 2ZX0A 3DKWA 4BA6A 4JDOA 2A3WA 2JICA 1SCSA 3AP9A 1JODA 3OYWB 3WCSA 1Z7S2 4BLJA 2ZGSA 3MI8A 5A3LA 5FO7B 5GLTA 3U10A 2FMYA 3VKMA 4AHYA 3ZN6A 1H1AA 2KA3A 2HBTA 1OOPA 4XYXA 1H1IA 1RXGA 5FR3A 4YPJA 1BCXA 4J6GA 4UBGA 2D97A 4QPGC 3TAYA 1UY3A 5CZKA 4DRVA 5C6CA 3X29B 2WZ8A 1H0BA 1RTVA 3PJYA 2D6OX 1CPNA 3GYDA 5I0TA 3MO4A 4UW3A 4XF0A 5E6HA 2EIEA 1WW7A 1MQTC 4QX3A 3GXUA 5DAVA 2L9LA 5KBFA 4BPZA 3NRUA 1O91A 5FY8A 2WSVA 3VBRB 4BIOA 2R0HA 2UY9A 3KT7A 1H9WA 1BBT3
chains in the Genus database with same CATH topology
4GULA 1SFNA 1DDLA 1LENA 1J3QA 3SISA 3WP3A 5GZDA 4ATEA 3N7JA 3HT2A 4COWA 4XFCA 1VBC3 3GALA 4PF5A 4JGZC 4FPLA 1PO21 2XLFA 2I2SA 2KXLA 4LBNA 1D4VB 3QH7A 4XJAA 3QLQA 4BMBA 2E51A 3SITA 3L9JT 1YLLA 2ZGPA 5KC5A 1VRH2 4IEXA 1AR63 2ARXA 5GM0A 3AMHA 4OULA 1ZYBA 1EAH1 4XBNA 2B39A 1AXZA 3A0NA 3RYPA 4YGDA 4AQSA 4BE3A 3ILRA 4LBJA 5ABJB 4HN0A 4JC1A 1QXPA 1XYNA 4K7JA 2BNOA 4IEOA 1RVF3 4B4PA 4M0HA 3VLBB 2JD4A 3O14A 1RUH2 2A6WA 3L2YA 4XPVA 2FMDA 2CYFA 4IEWA 3VGIA 5EZWA 2JJ6A 4FCAA 2E7QA 1RUH1 3JB4C 4PDWA 4SLIA 3AYCA 1Z0HA 5FFOC 3AMMA 3OY8A 1N3OA 5SV5A 2RE9A 1GZWA 3ROUA 4R9DA 2JE9A 4LO6B 1KJRA 2DUPA 1YFUA 4DS0A 3ZXLA 3BODA 3KB5A 4CDUC 4LR4A 2PHFA 3H0OA 5I91A 4G3YC 5T5PA 3UK9A 2EXIA 4K1ZA 2ZMNA 1U0AA 3WDUA 4CRQA 1VJ2A 2E9QA 1ZZ7A 1IPKA 5GLZA 5FDBA 3OGGA 3POSA 5JMCA 3VV1A 5KXDA 3M3OA 3M3CA 1WCSA 3EJKA 5BXXA 3FUOA 2XVKA 4CP2A 4JGZB 1HQLA 2WA3A 1DQ1A 1XNKA 1EY2A 1H2NA 4LEJA 3D82A 4Q4V3 5HCBA 5BY5A 3B02A 3EO6A 3DPRA 2AENA 1PIV3 2VQAA 5JZGA 2ZGOA 1RHI2 1MS0A 1OQDA 4HZFA 5T5LA 3WG1A 1DZRA 1RHI1 4B8EA 3RPQA 1W6OB 3NAPA 4F8AA 3ZFEC 2YXSA 1K5MB 1NCRC 1CVNA 4HVRA 4Q0PA 3C2UA 1COV3 3S7IA 4IEYA 4IEQA 2XJQA 1EPZA 3HQXA 4HMZA 3DV8A 1WW4A 4HKLA 1FOD2 3USUB 1R1A3 1Y3TA 3ZSMA 1RUI2 3VKFC 1AZDA 1I6XA 1XNBA 1YUDA 1ZRFA 1PM7A 2ZGTA 1FOD1 1RUI1 3AX4A 2BEOA 4CDQC 2B8MA 2DVDA 2DCZA 2BUKA 3WDWA 1QXRA 1OFSA 4U36A 5DUUA 1S0DA 2IXHA 5AC92 1VB2A 4YM1A 3USSA 2A6YA 2Q8OA 3THPA 2UYAA 2X29A 1OHFA 5AC91 3M8LA 2VVFA 3G7DA 1AF9A 2XWBB 4ATFA 1W0OA 2JX9A 3O0XA 2BVBA 1JUHA 1QF3A 2PTMA 5IT6A 3OD0A 2EVXA 4FQ4A 1HKDA 4QGLA 1WBFA 4SBVA 1NCQA 4FPJA 5A32B 1MS4A 3E6BA 3B7MA 4UW6A 3VL8A 4BH9A 1PGW1 3KCXA 1RUG2 2D5HA 1RUD3 4Y5Z0 2F6BA 1J1LA 1RUJ2 3LCPA 1RUG1 1RUE1 2RHPA 4RS5C 3VDDA 5BPXA 1DYKA 2XWJB 3HMYA 4I2OA 5D8AC 1V70A 4IQPA 1RUJ1 3JBG3 3W59A 5C4WA 3WG4A 2XPJA 3VHPA 1ULDA 1SDWA 1ENSA 2ZABA 4W65A 5KHKA 4META 4R52A 5JI7A 2DVAA 2PHWA 2WNEA 1V6KA 3WLUA 1NCRB 1UIJA 1AX0A 4M3CE 1J59A 4ES8A 5KXBA 3WUDA 1AL0G 1GZ9A 4FPGA 4QMAA 1HRV3 2BW8A 5EFUA 2ZZQA 4Q27A 4E27A 4LO4B 4BMEA 1RITA 3VN4A 4A7YA 3POWA 4Q29A 3CJIC 3AKPA 4DOUA 2QQPA 2DCYA 4LLOA 1BBT2 4H7MA 1PZ9A 1LGNA 5BNPB 5GZCA 5H9SA 2PFWA 2IFRA 3MFAA 1QGLA 1U5IA 2HWD3 1HW5A 1BBT1 3NW4A 5CG9A 4COZA 1AJKA 1VBC1 4DFSA 2Y38A 2EF6A 1H8TA 1MZFA 4COUA 2ZHKA 2A5ZA 2VH9A 4YZ5A 3B94A 2D3SA 2CV6A 3URFA 2WWSA 4CDXA 5LK5A 5LRSA 2C1FA 1GQHA 4WM7B 5A33A 4GXLA 1SLAA 4OZXA 4MXWB 4OI2A 1B09A 4Y26A 3MF9A 3ZFFA 1CAWA 4LBQA 2EAKA 2NMNA 5JAXA 3ZXGA 4N43A 4RS5B 2P34A 3RYKA 1UKRA 5C8WA 1IQAA 3H7YA 4OI4A 1S0FA 4E2GA 5A33B 2BPA2 4AFDA 5J36A 3LWCA 1RB8G 3GHNA 3OTFA 1TME3 4A3XA 3TRSB 1UCXA 1YYNA 1QWRA 4R8HA 4PIYA 1AYM3 1U5XA 3VZJA 4C0HA 5FOJB 2WLQA 1GZCA 4Z92B 1YI7A 2VU9A 3TNPB 4B4RA 1QU0A 2WNUC 3SCHA 1Y43B 2ZGUA 3WT3A 5CFDC 1Y7BA 1HRI3 1MEC3 2ZHNA 1I3HA 2CAVA 4XDQA 1DGWA 3VBFB 5JIAA 4YW3A 4CEYA 3CJIB 4XQ4A 1UX6A 3KGZA 4C1WA 3IPVA 4EN0A 4WVMA 2ZX1A 4CZSA 4Y1ZA 4YW2A 4OHZA 1APNA 1NLRA 2V5YA 2EAAA 1J58A 4QPIA 4N53A 3H9AA 1ULCA 4TWTA 1WMFA 1FMD2 2GMPA 3KCCA 4Y20A 2DU0A 1FX5A 4LUMA 4AF9A 1IKQA 4WVZA 1FMD1 2ET1A 4JTNA 1UPSA 4KL1A 4YVWA 1PIV2 3DF0A 1V6LA 1ZRDA 3WDVA 2IC1A 4LHKA 5FLJA 1PIV1 2OVUA 1TNFA 5GZEA 3O7OA 3DL3A 2HJIA 3OPZA 4AWDA 4Q8LA 1FNZA 3ZSLA 2V09A 1QNYA 4PIXA 1COV2 3KLSA 5BNQA 1F2NA 3HN1A 1C57A 4MSVA 3IDBB 1COV1 1R1A2 4XF1A 4P9YA 1WD3A 4YNIA 3FMGA 4AGGA 1R1A1 1IS4A 1QOTA 4IV1C 1MACA 4LHNA 1B35C 4HL0A 1PGL2 3N7KA 1Z7S3 2D93A 4K40A 1NA1C 1V6IA 3AM2A 3E5QA 3WOGA 1RIRA 1N3PA 1NQDA 2WNUB 4YM0A 5J3UA 1R1ZA 1WA4A 2VMHA 1SBEA 4WVVA 3VL9A 3ZYIB 4GWMA 2IXKA 3MGUA 3AYDA 2HYKA 1DZQA 4YVSA 4XMIA 1MS9A 1W39A 4RSUA 2FHRA 3ZMNA 4HKWA 3ZXJA 5HCAA 4W6WA 1LRHA 4MYEA 4XF9A 2A3YA 4RGAA 4AFMA 3PLQA 1DFQA 2XHKA 1YJKA 5CIRA 2NM1A 3ZYJB 3OJBA 1JBCA 1RUD2 1IOAA 2Z5WA 3H1YA 3HWJA 1AR92 4OLLA 4CYDA 1RUD1 1ZZ9A 1D2QA 2ARBA 2K2SA 2AUYA 3IT8A 3OF1A 4I09A 4B7KA 1GR3A 1QXJA 2WC2A 3KM5A 3JBG2 2JG8C 5FQ0B 1FI2A 3MF6A 1NQJA 1OI6A 3JBG1 1G7YA 1KD7A 3EHKA 4E2SA 4KQ7A 1VRH3 1G9AA 1YO8A 3S6PA 4M3CA 3VBOA 2I45A 1S0GA 1OKQA 1UZYA 3ZXKA 2IXJA 3S7EA 4QX5A 1QY4A 1ULGA 3TOJA 1DZTA 2RS13 2ZMLA 3HT1A 1QMJA 4LUKA 1F5FA 3VBSA 3VZNA 4I0BA 4FOYA 4BWOA 2GDFA 4PQ9A 4WM8C 3WXPA 1YWKA 1YIFA 3AP6A 1B35B 2HWE2 4WVWA 1X8EA 4XILA 4IESA 2HWD2 1NA1B 3OBRA 1XYPA 3VBHC 5C8CC 2HWD1 3AYEA 2CWMA 4Q4Y2 4NVPA 2XJVA 4ISQA 4XJWA 2H6CA 3RG0A 5JPMB 1NYWA 1ZBE3 3KMHA 4AEMA 4KGGA 5AFEA 2WNVB 3W58A 3ES4A 5AVPA 4GH4C 5IUQA 2WS92 2ZMKA 4JRLA 1O3QA 4KU8A 1NE6A 4W6YA 4W6XA 2WS91 4C90A 2VPVA 4FOVA 4S2DA 1FXZA 1J1TA 2HWC2 4IETA 4IV3A 4MZUA 2X5IC 2JG9C 1KS5A 3QOPA 4N7UA 4MH0E 4PCRA 3ZXAC 2D6NA 2AH2A 5BUVA 4AFCA 3A4UA 1VBA2 1O3TA 2TUNA 1TME1 1S0EA 5CG8A 1AYM2 4YZ3A 3AKSA 1N1SA 1ASJ2 1RGSA 2PAEA 4X8NA 3KZ4C 5C33A 1AYM1 1PZ8A 3NKGA 2WA4A 4YZ4A 5BNOB 4Q8KA 2HEYF 4FQZA 1VAMA 1HRI2 3AMQA 1MEC2 5C9AA 5DUVA 3RDIA 2VY0A 2R042 4KWLA 1HRI1 3WR0A 1MEC1 3EQEA 4WM8B 2GNMA 4XHBA 1SLBA 4G9SB 4TSVA 3MLKA 4QM9A 5GALA 3E5UA 4Y22B 1G9BA 2ZACA 4GMP3 3VBRC 4HT1T 1CIWA 4OHWA 4AG4A 4IEVA 3VBHB 2R16A 2VMGA 4DRRA 1M4WA 2XBO2 2ZGRA 2LM3A 1REFA 2D6PA 3J4UH 5CVRA 3M2MA 3NV1A 1LOGA 1S55A 1TQ5A 4MVTA 4XBLA 2JDZA 4OHVA 2NN8A 4RR3B 5E16A 2QFEA 3UL2A 2NMOA 2R1BA 4UW4A 1OFNA 5FO9B 3MW2A 1ZREA 3T1LA 2HEVF 1DQ5A 3MYXA 4CTEA 2Q1ZB 5J96B 2LUWA 4QQOA 4QD2A 2VQ0A 5IK5A 4GH4B 2A71A 2RM23 1GNHA 2QNKA 4A7KA 5I8YA 3K51A 5KWRA 3FUQA 4LBLA 5GKAC 5ABJC 2GH2A 2P3JA 3KCYA 2NQYA 4JAAA 1OMIA 2JG9B 3VHRA 1GFF2 2A6ZA 1LOFC 2W52A 3PMEA 4KBBA 2OZ6A 3NKTA 3JD73 3JCIA 4LBOA 4BOWA 5KHGA 1GNZA 1BQPA 4XJ9A 2OYZA 2TNFA 1D0HA 1CN1A 4XEZA 1W6NA 1YI9A 4JCKA 4HK9A 5CFCA 2ZAHA 4AFAA 4B29A 2F4PA 1EP0A 2GSYA 1Z7S1 4PBPA 1O5LA 2AGSA 1FNYA 5DZFA 1QH7A 2Y0IA 4RL7A 5I8TA 1ULFA 1CD3G 4PDWC 4E4SA 5KHHA 3FX3A 2XJUA 1GQGA 2ZGLA 5AVAA 3ZN6B 5F9TA 1OOPB 3GZTB 1M06G 1NZCA 4NHMA 3T1MA 2ATFA 2WLPA 4QGMA 5L36A 2C0ZA 3PVNA 4NWWA 2UWAA 1GBGA 4AI1A 4QQ2A 2GNDA 3WDTA 4EWAA 3AZZA 1UKGA 1SQ4A 1HV1A 3ES1A 4JVAA 4F3JA 5KXEA 1IPJA 5FBZA 4I3PA 3AZVA 2CL2A 2YY1A 4N9IA 1WCKA 4Y1VA 2VNOA 2DCTA 4UW5A 5GLUA 3WW1A 1VR3A 4KH9A 4GB32 4KNCA 4AW7A 5JOZA 4AEJA 1VRH1 1H8VA 1GV9A 4EN6B 1BMV2 2PAMA 2VW0A 1FYUA 3VBUA 1K5MC 2N7GA 5H9PA 1GLHA 2CAUA 2RR13 5JZGC 1BMV1 2KM2A 2RS12 5E89A 4JQRA 4L92A 4XBQA 1HXS2 4AVSA 1CAUA 2WL1A 1OLQA 5GLWA 3VZOA 3SNMA 1H4HA 1TE1B 4AEDA 2RS11 2DFBA 5LEKA 2P3KA 1A6CA 3RMXA 1D2SA 1UL9A 1WMEA 3BIWE 4YFWA 5JPNB 4Y24A 2YHJA 3VKLA 3MFCA 1UU5A 4YARA 2YYOA 3JZVA 5FOBB 2XB6C 5KHJA 1Q43A 2IXIA 1HQNA 1UZZA 2YGLA 4PDWB 1ZBE2 3OY8B 1SLCA 3JB8A 1ZBE1 1GZWB 4HSJA 3AP4A 1QOOA 2IWGB 1F31A 4DPNA 4Q0SA 5CU1A 1MQTA 1PO13 2GH8A 1LR5A 1DU3D 1PMIA 4GA9A 4FOQA 1YIPA 1W0PA 1POV3 4YG6A 1FMD3 4PLNA 3N3HA 4IEUA 4J1XA 2WFF3 3PTYA 4YFZA 4FXGB 4XXPA 5I8SA 3AXEA 1X7NA 4GQ7A 1ZA4A 1JH5A 4RFT0 1DIWA 2DF7A 3M70A 5GZGA 1DYPA 2R0FA 2FBEA 4AGRA 3DPRB 3RSJA 3NL1A 1NG0A 3MLLA 1MS3A 1FV3A 5JZGB 4X6QB 2XKPA 1URXA 3IN9A 2ZGMA 4L99A 1PGSA 2ZCWA 1L3JA 5DG2A 2BTVC 3NAPB 1LESA 4HBNA 4AI0A 4XTMA 1DQ4A 5J98B 1ZZCA 4PLOA 4DXZA 4QU2A 5TSWA 1WUVA 5BNPC 1LU1A 5LRRA 4OHYA 3SH5A 4GMP1 4BHPA 3ME2A 1BEV2 4EN7B 1UN1A 1I5ZA 3OD4A 5DZEA 2RJKA 1LHNA 4PLMA 4TLFA 2MHFA 1O3SA 3FFQA 4QPYA 3WW3A 2A70A 4RHV3 4LLFA 4DY5A 5FMOS 1U12A 4CDUA 4XE9A 1CAXA 1V00A 3V56A 4CP0A 3TN93 4D3WA 2K9ZA 2RM22 2OZJA 2PHUA 1VLNA 5FCCA 1PK6A 4E2QA 1X82A 4H7LA 3SXWA 2ZX4A 5HI0A 1H8TC 1TNRA 1C5HA 1MS5A 2RM21 3MDPA 3MIGA 1ND2A 1LEMA 4WM7C 5K0UA 2ZHMA 2SBAA 2W39A 4MGYE 5JSOA 3MZHA 3TYJA 1OSGA 4CDXC 4ONUA 4MUVA 1AR93 2ZGNA 2X8KA 3JD72 1NCQB 2BVVA 5JLVA 2ZX3A 2I07B 5T52A 2ZTNA 4FPHA 4B4QA 4S2GA 5CAZA 1ND2B 4YZ2A 3JD71 2A6XA 3ZFFC 1EV12 2A73B 4XETA 1UPIA 1W6QA 2P2KA 2YPJA 1NXMA 4N43C 2G9FA 4FPKA 3VDDB 4EJRA 3E97A 4FPYA 4COYA 1YCIA 5EYXA 4INDA 5C4WB 4RQPA 2IXCA 2ZA9A 3I54A 3ZFEA 4BYYA 3H1MA 2Z79A 2UURA 4P14A 1S0IA 2QCSB 4AVCA 3CF6E 1AVBA 3VBFC 4K3UA 1C8M2 3AXDA 2EXJA 5CADA 2PHLA 2HWE3 1O7FA 1XXNA 1C8M1 1Q56A 5K7PA 2ZJCA 2CGPA 4CDQA 2A75A 3WCRA 4UBHA 4R9BA 2Z2SB 1RMU2 4CEYC 4Q4Y3 5L7OA 2O0OA 3ZYPA 3KT1A 3M1HA 4HSLA 1I9RA 3ELNA 1ZRCA 2NLRA 5FPZA 2EA7A 4QPIC 4N53C 4P9IA 1N1TA 4DB5A 2DTWA 3N4MA 2ZOEB 3IBMA 2HWB3 3MIFA 5JCTA 1H8TB 2Y26A 3GZAA 4FPOB 3AYAA 1DG6A 1S0JA 4CEWA 3M4FA 2UWBA 1BZWA 2WS93 1ZBA2 4JV4A 5ACA3 2RR12 3ZFGA 4CDXB 3ZYGA 5JR7B 1S2BA 4Z2WA 5LK7B 5LEJA 2RR11 1GICA 2HWC3 1ZVFA 4GIQA 1YRZA 2A3XA 1I1EA 2GNTA 2PHXA 3RWNA 1N3QA 3LOIA 3B69A 1RUOA 1CGPA 2Q4SA 4I02A 4Y1XA 1BVP1 1CAWB 2ZGKA 3ZFFB 3SHRA 2NPIA 4LBQB 3ZXEA 2YROA 2R6QA 4M00A 5D8AA 4N43B 1VBA3 3AFKA 4M01A 2PAKA 4Y1UA 2VVDA 1MVQA 2CY6A 1X33A 1ASJ3 1QJY2 1G9DA 4GKYA 2AZ5A 1YNAA 1S0BA 1ULEA 4QQPA 2XVLA 3PVEA 4KWKA 5JOXA 3WV6A 2GC0A 3E6CC 5J09A 3MIEA 2R043 1FAYA 3RJRA 3GBWA 4XIKA 4DZGA 2GU9A 2QZ2A 4LO7A 4IEZA 3RQ0A 4Q1RA 5D1IA 3V0AA 3L2HA 4XHXA 2JKBA 2WJSA 2UWCA 1PO12 1RJ7A 2D5FA 3KS7A 5JSRA 5E8AA 4TZDA 1AL23 1ND3A 1PO11 2GC3A 4NO4A 2WFF2 2XBO3 3IMNA 4CEYB 4FPCA 3HBZA 3ASIA 3IPVB 1POV1 4LE3A 4C1XA 3OCPA 3C3VA 4WVMB 2WFF1 3RJ2X 1PVXA 5FTTC 1O4TA 1C3HA 4QPIB 3KT4A 2ZX2A 4N53B 1AX1A 1C1FA 4IERA 1TMF2 2WZR3 4Y20B 3RS6A 1JW6A 4HVQA 3DGTA 4QXKA 4O9GA 2GAUA 1TMF1 3V0BA 1LB2A 4XFIA 4YVWB 2E6VA 5T5JA 1LHUA 2XJPA 1RUF2 1XU1A 3SH4A 4AHZA 4AXOA 3EBRA 3GF6A 1SACA 1AXYA 1UF2C 5JOYA 4H3WA 1IS5A 3LSEA 3VBOC 3LB9A 5EYYA 2H6BA 4FBFA 3I4IA 4A7ZA 1BYHA 1IGOA 4ASMB 1SFYA 4Q26A 4K9SA 2QVSB 5KHIA 1J3PA 2VOVA 4XZPA 3VBSC 1DHKB 2QJVA 4AGVA 4AHWA 1PGL1 3HR9A 3Q9OA 4KG0A 3TB0A 4F83A 1BJQA 4WZCA 1Q3EA 1CAVA 2IXLA 1N1YA 1CPMA 4RHV2 2B46X 5CFDA 3UJOA 4NOTA 1S0CA 2ZPXA 3WHTA 5HBAA 1W6MA 2QUOA 3TN92 3VKNA 3AP5A 1H4GA 4RHV1 3AKTA 3ST7A 1WCDJ 4DQAA 1F5JA 2XVGA 3TN91 3WQ7A 2WNVC 4CDWA 4COVA 3IWZA 4BZ4A 1SLIA 5JDBA 2BNMA 4YVSB 1R092 3FBMA 3CU7A 2JE7A 3RZZA 4WZFA 1GYKA 1LHWA 2YUEA 4XIOA 5FREA 1UW8A 4BLIA 3LKJA 1VBE3 1AR91 1CQ9A 5AFBA 1XRUA 1LGBA 2D40A 2HKXA 1VAVA 5J48A 1YFXA 2DYCA 2UU8A 4OUSA 4AK3A 1SLTA 4EWEA 1JHNA 2XLGA 1C4RA 4IV3C 5DZGA 1NXD1 4GB33 3MPPG 2A7AA 1LGCA 2HWF3 5BNOC 1A78A 4S2HA 2XGXA 2UY8A 4M3CB 1HXS3 3AZXA 3VBOB 4AI3A 4L8QA 3W9AA 2BBVA 3WX5A 3BTAA 2X53S 4M0NA 1RUNA 3HAGA 1F8VA 3NV2A 3I7DA 5BNNA 2MNGA 1XYOA 3THTA 4IV1A 2R49A 2HWE1 2DCJA 2G4IA 2YDEA 3AMPA 3VBSB 4ZKTB 3UKVA