4JQRA

Crystal structure of a duf4465 family protein (baccac_02373) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
KNEVVVSFENLLTEENSQFIADGTPNNQAFQETDFKDPKNLINFNHYYADWGSGYSFAGFSYMNITDNQTANSPAPITGKAKIGSVYIGVDSTDGEYGTPAILTILDTNYKLKGTWIANSTWAYMGMIQGDGYARAFKAGDWYKVTATGYDEAGNETGKAEILLANYKTDNDLPVKEWIWFDLTPLQNAVKVKFIPDSSDKNEYGMNTASYFCLDGITLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14717 DUF4465 Domain of unknown function (DUF4465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1350 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jqrA00
4JQRA 4E9KA
chains in the Genus database with same CATH superfamily
1AXYA 1SQ4A 4YW2A 1G86A 4XJZA 4BQYA 1IS6A 5EJ1B 5JUVA 3R05A 1H8TB 4LK7A 1A78A 1RJ7A 1HRV2 2DBIA 5AFEA 5A1AA 2VMEA 2WAOA 1OQEA 1W2AX 2O0OA 1GZTA 2XLAA 4UYBA 4XDPA 2HBUA 5GLZA 1BLZA 2DVDA 4BOWA 2JDNA 5K0UA 3VZJA 1WW5A 4AHXA 1RUE3 3KGLA 1OA3A 5CFDB 1WMFA 4PF1A 1FNYA 4I3PA 4M01A 1BJQA 1FX5A 1LGBA 2TEPA 2VQUA 3DYOA 1RVF1 2GN7A 3OYWB 3T1LA 1G8WA 2WNVC 1HRI2 1VBB2 4I0BA 2D6LX 5FZ9A 3BKZA 4A6OA 2CWMA 2J7MA 3OSDA 1UY3A 2ZGRA 3DL3A 2WZR2 5CB7A 1W0NA 4RR3B 4K3UA 4BIOA 1SLIA 2NN8A 3I8TA 5KC6A 1WCSA 2OQ6A 1NCQA 4IERA 3WZ1A 1AR81 2XB6C 2K46A 2UYBA 1EYBA 4S2DA 3ROUA 4CE8A 3VDDA 2YBSA 3ZYRA 3RVHA 1RVF3 3POSA 4DY3A 4AQTA 4IETA 4DXRA 4HSLA 1NX9A 4I02A 5A3NA 4EN6B 3Q8AA 4D69A 3THPA 3U0ZA 3NNMA 3PUIA 1DU3D 1DGRN 3ZOIA 4UI9L 4CUGA 4Y5SA 4MO3M 4CEWB 1AR83 3AYAA 1W28A 3N7MA 1DZTA 4XIKA 5FPLA 3WHUA 5CEHA 3ZIXA 3KCYA 1E5IA 4MOAA 5BXXA 4E2GA 3H9AA 5FPXA 1JMUB 4LOSA 4QMAA 3K75B 1ZZ7A 1AL23 1H1MA 3KV9A 2YB7A 1LHNA 5JI9A 3WQ1A 1DZRA 4INDA 2P37A 4OHZA 1QJX1 5DZEA 1OUSA 1VMJA 4WBBA 3FN9A 1GZCA 1MQTB 1WW6A 1YQ8A 2WR9A 1R1ZA 4QKNA 3IDCB 2HWE1 4BMEA 1F31A 1W2OA 3UYJA 3M2MA 4QKDA 1ULEA 4PHZA 1EP0A 4CP1A 1O7FA 2HWD1 3AM2A 2D40A 4M4PA 4YGDA 2A3WA 4HXCA 2EVXA 5C4WA 2VBPA 1JU4A 3F2ZA 4CEYA 4UAPA 1YQCA 1MS5A 2VW2A 2WT0A 2FHRA 5J36A 1RUI1 4ASLA 1UL9A 3I3DA 4CYDA 3B9IA 2AH2A 2DV9A 2QZ2A 2JD9A 4MX3A 4PDWA 4XILA 2IXLA 3ATGA 4IV3C 3PVOA 1AYM1 2Y64A 4YLZA 3RG0A 3TAYA 5IK8A 1U0AA 1R1A3 2LTNA 3TB0A 3FHAA 2HWD3 2RDRA 5T55A 3VBUC 3I3QA 1HXS1 2G9GA 1UY0A 1HRV3 3IZOA 4UFJA 3RZHA 1ZYBA 4LMFA 3I2KA 3I2OA 2RR12 5GJ6A 2QBXA 2C4XA 2DVAA 3C7HA 2WZPP 5JR2A 4JQRA 1RUI3 4MXVA 1O3SA 5BNNA 3BB6A 5FYYA 1W6MB 2GNDA 3HNYM 1AYM3 4BXFA 2ZZJA 4LR4A 1LHWA 5TSWA 3AVSA 3PURA 1JZ2A 1OPMA 3CDZB 1HRI3 4CDUB 4HVQA 1HV0A 1Q8OA 1ZBE1 3NAPA 2JG9A 5GLTA 1A6CA 5E89A 3ZKYA 4LE3A 4COWA 2YUEA 3E6CC 2ZGLA 3OOXA 3EBRA 1Z78A 3K77A 4IEQA 4P5HA 4L92A 3U11A 5JZGC 1PM7A 5BPXA 2EIGA 3BYWA 3UESA 1HJFA 5GALA 1H2MA 1AR62 4PBPA 2WLPA 3J7MA 2IFWA 4IEOA 1RUF1 4YPJA 2E7AA 4Y1VA 1PVXA 1ZZ8A 1FPN1 1WGPA 3KT7A 3M8LA 4GH4B 4XBLA 2Q8CA 5KHJA 3I3MA 3H1MA 5A3PA 3GZAA 1NOVA 1S0CA 4KG0A 4PIXA 1FATA 2C26A 2VBBA 3KT1A 3WLUA 1WCDJ 4YYOA 3DPRA 2WFF3 2ATFA 4Y24A 2KD7A 3AFKA 3B00A 5CIRA 4ZKTB 5M0TA 1LHUA 1UY2A 4NRQA 4CP9B 5A6ZA 2JKBA 4GZ9A 2EXJA 1JW6A 1YHFA 2WBKA 5DZGA 1W90A 2HJIA 5EJ3A 4JVAA 4XW3A 1UO9A 4AEDA 3BTYA 4AEKA 2GMEA 5FP7A 3WP3A 4HKLA 1W0PA 1OOPB 4FFFA 1OFSA 5KR7A 1K45A 1UX6A 3LE0A 2UY9A 2QUOA 3CQOA 3PVBB 4PLMA 4NIIA 4N43C 2A75A 2X53S 3RGBA 4QGLA 3K4AA 1GP5A 4EWAA 4OHVA 5FUNA 4K1ZA 4CUBA 3KVAA 5JMCA 5FCCA 4LA2A 5C71A 3W59A 1UOFA 2P3KA 2XJRA 3MUZ1 4YVSA 2Z69A 1NE4A 2EXHA 3ZFGB 1VALA 1JZ6A 4LQRA 1UOBA 4R8HA 3LF7A 2OA2A 3A21A 1KEXA 3ZXEA 4EV0A 1W99A 4X6RB 2E7QA 5DUXA 4MYEA 3J7NA 4H3WA 1QDOA 2UYAA 4HBNA 4ZXKA 3U1XA 3CHXA 4CVUA 1AUYA 4XF1A 2RE9A 2A70A 1NLSA 1RUC2 4AEMA 4MADA 4D6SA 2JIGA 4BHPA 4AI1A 3ACLA 3E5QA 4XURA 3WP4A 1X9PA 1KDKA 2JDUA 2RJ2A 3D4KA 2P1BA 1QJFA 3UT0A 4G3YC 3AP7A 3K3NA 2WZ8A 4QU2A 1N1SA 1DCSA 3N35A 3OJBA 4IDZA 4RS5A 1OI6A 2QQKA 2R32A 4XPVA 4L8QA 5H9QA 4J1WA 4OZOA 2ZOEB 2VMFA 3AYEA 3PU3A 4FFHA 4NHYA 2JDKA 1ULDA 4ONUA 3O1RA 1O3QA 2Y6FA 3RI9A 1RL3A 1XE0A 2NQYA 5FBZA 5JXJA 5DAWA 1YUDA 3ZYFA 5BNPA 3PU8A 3VKNA 1DQ4A 5K9YA 1W8UA 1PIV1 1WA4A 3SCGA 1UYYA 2YU1A 2RV9A 2VVFA 4I3GA 5T54A 4FPJA 4QX1A 1RINA 2WA3A 1SBDA 4XUOA 1VBE1 2F4LA 4CDWC 3I2DA 4H14A 1LODA 5HBAA 2W94A 5CFDC 4AEJA 3R6SA 4DFSA 5FY4A 1V6JA 5J3UA 4I30A 1GKBA 3ZLIA 4FAGA 5K4LA 1GWLA 2PFWA 1VAKA 1PIV3 1W6NA 4PQ9A 3S6PA 1GU3A 1HJGA 3EYPA 4OYUA 4ZZ8A 4MGYE 4WM8A 4QXCA 3NJXA 2RMU3 4RR3C 4QX8A 2Y26A 1LCLA 1NA1B 1VBE3 2WNVA 3I2FA 4W6XA 3FUQA 1FMD2 1LENA 4TXWA 4XF0A 1ODNA 1COV1 1CZSA 1W39A 1QQP1 1BK0A 3CJIB 1CAUA 1XU1A 4Q0PA 5KHKA 4ZPIA 5FFOC 5JSPA 1PGL2 2PELA 4P5YA 1UY4A 3VKOA 1KXGA 1QWRA 1ULGA 2JECA 4QM8A 4AWDA 3C7OA 4C1XA 1N47A 4DUWA 4UFHA 2LRPA 3MIFA 2LM3A 2RDSA 4Q4X1 3Q9OA 4B7KA 1WW4A 5A3LA 3ZXGA 5C7GA 5FY5A 2ZKLA 4K40A 5FZ6A 3WVJA 4CDQC 1COV3 5IVVA 3LSDA 1XJAA 1YNAA 3VHRA 1LHVA 4BE3A 2NZ9A 1W3VA 3PVEA 1Z0HA 1BBT2 2J42A 1QH6A 4FPKA 2W95A 1BXHA 1RXGA 2XKPA 2DTYA 1R64A 2P6CA 1CAWB 4Q4X3 3I59A 1DYKA 4YVWC 4WV8A 1STMA 3KVBA 4JDOA 1REEA 1WLTA 2YV8A 1AL0G 3VDBA 2JDMA 3NNLA 1QY4A 1KD7A 2X10A 4UW3A 2P17A 3Q8CA 1C8M2 2ZEXA 4OI0A 5ERLA 1UIKA 3N7KA 1ENQA 4DZGA 1CD3G 1XYOA 5A7QA 4XCAA 2ZHMA 4HANA 3GHMA 1KFUL 3UGGA 1WZXA 2EXIA 3H42B 4I01A 1O5LA 2NPIA 2VBDA 3WD5A 1VBA1 2QDNA 2WS91 4YFZA 5K7PA 5ISLA 2YC0A 3NJZA 3WR0A 1NQDA 4N9IA 2ZTNA 4XFCA 3IWZA 5FZOA 3N9MA 1D7PM 3WDVA 1SG3A 3ZVXA 4B1LA 4AG4A 4BXSV 1PZ7A 3AMHA 3B5LB 4OI4A 2VTXJ 5HCFA 1O6UA 2CYFA 4IV3A 5KHHA 4WM7B 4XUPA 3JBG1 2PLV1 3ZYBA 3AP6A 3OPZA 1O5UA 3N9NA 1VBA3 2WS93 5JIAA 1PMIA 2H0VA 2W68A 1V6NA 2BVBA 2ARBA 2YC2A 3GF6A 3OTFA 4AAPA 3OB8A 2VTFA 2VY0A 2Z5WA 4QPGB 1O91A 4LO8A 2PQQA 4YFWA 1OUXA 5FUPA 3O0VA 4QB2A 1S0BA 4X8PA 5BUVA 1VBD2 4H2AA 4EWDA 1MS3A 4Z07A 1ACCA 1L3JA 2XH6A 1GOHA 1QF3A 2Q30A 2EICA 3OGVA 1GQPA 1G9AA 2ET7A 5T5LA 3WG1A 1AR72 4OMDA 4Q0VA 4ISRA 4BLIA 4Y22A 3JUUA 1FMD3 4AF9A 3H8OA 3OD4A 1O4YA 4QB6A 1YXWA 3VKMA 4CU8A 4AVTA 4K6BA 4FI9A 2CTVA 2JJ6A 2ZCWA 4K8RB 2QJVA 4IEVA 4XXAA 5CZKA 2RS51 3RPQA 3VN4A 4C90A 1S2KA 5D8AC 4XHXA 5JZGA 3RZKA 2PN5A 1OD3A 2R041 4IE6A 5CFCC 3MBWA 3USUB 3T2OA 4DY5A 2Q8OA 1LOCA 4GH4C 5FZAA 3UV9A 1OQDA 1D2SA 2J1SA 4BQWA 1RGSA 1CESA 5APAA 5EXOA 1VRBA 4NOTA 1OXCA 1W2NA 1F15A 1RUD2 3WQ0A 5DXDA 1SLAA 3I4IA 4LKEA 3AVRA 4MSVA 2YY1A 4AVSA 2RS53 2IC1A 1V6KA 2BUKA 2VMCA 4I2OA 3LEGA 1UD1A 5FKCA 1TVGA 3VZOA 3EO6A 4UFKA 1DQ0A 1W05A 4YG3A 1TME1 5DZFA 1DGRA 1WD3A 4OUEA 4YGEA 3USSA 1K12A 4FPGA 1OF4A 1CJDA 1Y9QA 3O14A 2DUOA 2YBPA 1M4WA 3OD0A 4JTNA 5EFUA 2AUYA 4URTA 1C8M3 3ZX7A 2PMWB 2WABA 1PX3A 2E33A 3OEAA 4O9GA 3RJRA 2VZRA 3RYRA 3I54A 3SISA 4DINB 2CAVA 3OBTA 4Z1VA 5ABJC 5F1RA 1R082 4URAA 3IIAA 1HQWA 1OA4A 1TME3 2ZACA 3C7EA 4BK4A 3AL6A 3OY8A 2CDOA 4N43A 1HQNA 1R091 2DU0A 1ULOA 2LALA 1CIYA 2G19A 2W87A 3BVCA 3WF3A 1OLME 3PMSA 2CWSA 4D7TA 4NPRA 3MIBA 1DYPA 2CL2A 1V0AA 3SCHA 1V70A 3JD72 1B09A 4FFGA 3POGA 4B7EA 5F5CA 4LKDA 5JPMB 4AE2A 1W03A 3DECA 5F9TA 3RRDA 3S5QA 1ASJ2 1PX4A 2JE7A 4G4FA 3ZM8A 4NIAA 3M3IA 4LHLA 1DDLA 3NO8A 3MICA 3RMXA 2FZ2A 2AR6A 2UY8A 1Q56A 1VRH2 2DCKA 2XXZA 3U4XA 1SLTA 4AVAA 5G05L 1RHI1 2ZHNA 5A33A 1ZRDA 4ATEA 3V0BB 3WDXA 1IKPA 3AMNA 3HD8B 5K8SA 3KB5A 2XHKA 4YZ1A 5C3PA 4XOGA 5A7SA 3NJVA 5LWBA 3TNPB 1HIXA 2DVGA 5IK7A 4GA9A 4M0HA 3VKFC 3RZZA 4FCAA 1BQPA 1JN2P 3HN3A 1C8NA 4LXLA 2D6MA 4R52A 3MLKA 3SXWA 2VO5A 3P3NA 1JYCA 2WWUA 1SHWB 1PO11 3TEZA 3EHKA 3J8F2 1DG6A 3OCPA 3A7QA 3NV2A 3AKQA 5JOYA 4QDRA 1NCRC 2JWPA 2RS32 4CDWA 3NSTA 1AR92 4HPKA 5L9BA 3WQBA 2PHDA 5CFDA 3GGLA 1AJKA 3W58A 5EYYA 5L7OB 1I6XA 1EAH2 5A3UA 3BU0A 1YJLA 4NHXA 4TTGA 2J1AA 2E63A 1RUD3 2DFBA 4IGPA 3MYXA 1EUTA 1WCQA 1U5ZA 1PO13 1ZBA2 2Z42A 4AHWA 2P34A 5E16A 3CJIC 1ULCA 3J26N 1AF9A 3AJYA 5AFBA 4O9EA 4NPLA 4PLNA 4RR3A 2VXRA 1I5ZA 2CHHA 4EE2A 1V9U1 5FTTC 3HNMA 5FP8A 1N3OA 1BCXA 1PM4A 2PYTA 2ZAHA 5JOZA 2D6OX 1BYHA 3FJSA 4EN8B 1IQAA 4NRMA 1PVC1 3N9PA 1VR3A 1OH3A 3BPSA 4P9YA 1C1FA 5FY8A 3Q8BA 5DAVA 3ZYHA 3MIHA 1GICA 4LHNA 4P9LA 5I0RA 1O3RA 5D1IA 4N53B 1GR3A 2RDQA 3IMMA 4QX2A 5I8TA 1VP6A 4LO6B 3AYCA 4J1XA 1VE0A 4BQ5A 2UWBA 1QXRA 1V9U3 2EALA 3S5AA 3L2YA 4CDQA 3PUAA 1PVC3 4BWOA 2HH9A 2JX9A 3UJQA 3ACGA 2A71A 2YHJA 4LT5A 1NXMA 1WMXA 1QJU1 2XUEA 1UPSA 1QXJA 3CJXA 4RGAA 2O14A 4CCJA 1Q43A 5FJKA 3MUY1 5CG8A 5AC91 2XG3A 3ES4A 1VMHA 3IPVB 1GZWB 4LKFA 4QD2A 4RGKA 4W65A 1OKQA 4FQZA 2VG9A 2ZKNA 2VUCA 4YVWA 2VECA 3VKLA 2C1FA 4C0BA 4TWTA 5FZ1A 1XU2A 3WP6A 1LB2A 1UZWA 4ZZ5A 5FUIA 2EAKA 3SH4A 3U10A 4AI0A 4KNCA 3LQCA 1VRH3 2PAMA 4TLFA 3UK9A 2JG8B 5H9SA 1RUOA 3NMBA 4FO9A 3VBOC 5FXWA 2VMIA 3SH5A 1W8FA 3GZEA 4E4SA 4LBOA 1CIWA 1B35B 4MGTA 1W6PB 4D3WA 3RYKA 3HEIA 1W8WA 2IXKA 1FYUA 4Y5TA 4Y5Z0 2PTMA 2Q4SA 4XZPA 2FDGA 3AZZA 4BQ3A 1XNKA 4E27A 3FE5A 3QCWA 1JYXA 2ES3A 5GZDA 2YGMA 5FRAA 1X7NA 1ZRIA 1RVF2 2BNNA 2D3RA 3MFCA 5JPNB 3X29B 2WINB 5GLUA 2A7AA 1H4HA 1FAYA 3B01A 3SMHA 1RXFA 3HVDA 3J8F3 1DQ5A 1RUJ1 2D3SA 3I2GA 4KWLA 4OHXA 4SLIA 5GLWA 3SH3A 2ORXA 1E57A 4Q2FA 1AR82 3ZN4A 2RS33 4Y4YA 5KHIA 2VVEA 3WV6A 4UW4A 2IZWA 3NV3A 2UURA 1LTEA 3THCA 3AXDA 3C2UA 3POBA 4AR2A 4E8DA 1CWPA 3RI8A 3DGTA 4GD4A 4RFT0 1ZBA3 1BEV1 4KU7A 1RUJ3 3HR9A 4MXWA 4CUAA 5FLJA 2PHTA 1CN1A 1FV3A 5J98B 1Y7BA 4NO4A 5DDJ1 2XQXA 3K4ZA 4W8JA 2W3JA 5HCBA 5IFPA 4A3ZA 3GZTB 4A3XA 2VMDA 4MGZE 1GV9A 1UCXA 4UXAA 1C5HA 1Q8SA 2Z79A 1IPKA 5D8AA 2C5DA 5CFCA 2BWAA 2UU8A 2X5IB 4NMIA 4WZFA 4YARA 2BYVE 2IXJA 3WW4A 4Y20B 5KXDA 1QJX2 2R16A 1GP6A 1I5PA 2B39A 3TBDA 5BNOC 4K7JA 4UF0A 3ETQA 4DXSA 5FIXA 2B45X 3AMMA 5L9VA 3VD3A 5IVEA 2WO3A 4RN5A 4JAAA 2HWE2 4CU9A 2VQAA 5GZFA 1R1A2 4FPHA 2H6CA 2O1QA 2SLIA 3ZR5A 2HWD2 2V5YA 5FZ8A 1N3QA 2JE8A 4ARYA 1YIFA 2JB8A 2OUJA 3DYPA 4ZS3A 1UU4A 2JKXA 3OBZA 1ZNPA 4OLLA 4B4PA 5FP4A 2VMHA 3POFA 5SV8A 2W47A 1NZIA 4DB5A 4NIHA 1RUI2 4QPIB 3TNQA 2PAKA 3U14A 1ND3B 2G9FA 3MW2A 1AYM2 5T5OA 3AK0A 1FNZA 1D4M1 4HG6B 5FQ0A 5CYYA 3RJ2X 1XBFA 2YC4A 1S55A 3RWNA 3MIGA 1IOAA 3BCWA 1PNFA 1HXS2 2R49A 1MS0A 3M7AA 3M4FA 1LR5A 2A6VA 3AMPA 4F8AA 5ABJA 1BMV2 1ZVFA 1YFXA 2I74A 4DPNA 2RM21 3VD9A 5FZEA 2L9LA 4M00A 2ZGPA 5C3RA 1X50A 2QNKA 2GNBA 4M4RA 4XUQA 5FZ4A 4UFMA 2C9AA 3VD4A 4GJYA 4BQ4A 4IGOA 2NLRA 2PHUA 3ZFFB 1YRZA 4LORA 3E6DA 4QX5A 1SCRA 1ZBE2 4LHSA 5DUUA 4YG6A 1W9WA 4JDNA 5A7WB 2VU9A 1LOGA 3PTRB 4O7XA 4M3CF 3VHOA 1AVBA 2D5HA 3U07A 1O8PA 2VOTA 4P9JA 1ULFA 1RUH1 1IZ3A 1JU3A 4XVHA 1S2BA 1GLHA 1O59A 3PUQA 5GLVA 2BU9A 2WFF2 2E6VA 2IXHA 3AX4A 3T4HB 1MEC1 4XF9A 1RUF2 1W8TA 4BLJA 1KITA 4CTEA 5EJZB 5I0TA 5T50A 1FPN2 3UETA 1DP0A 5HV4A 5HCHA 2BPA2 4FP3A 4AFBA 5A3MA 4AAXA 5FMOL 5F2WA 3OUIA 4IV1C 1F5JA 1RUH3 4FFIA 3VBRB 1YI7A 2P5BA 1UPIA 2LW8A 1PGSA 1UQXA 1GSLA 2LROA 3PUSA 5LY2A 1HQLA 2ORZA 2QQIA 4FAHA 3DXUA 4UFLA 2OVUA 3S30A 4QQLA 3P1IA 2JE9A 2ZA9A 2Y33A 3WNOA 5L7OC 5IWFA 4XFFA 3INAA 1QNYA 1NCRA 2R1BA 1Q8VA 5FJHA 3C8XA 5C8WA 1W6OA 4HVOA 4OQ9A 1QJX3 2WSVA 3TN91 1JYTA 2DBNA 4DMIA 5A80A 2R0HA 5FP3A 2QQLA 2C9KA 2E53A 2HWE3 1UU6A 4GMP0 5FPBA 2VMGA 4B3NA 3CJIA 1HB1A 5LEJA 2QTWB 1CAVB 2MEV1 5EHDA 1NXD1 2XBO1 2ZABA 1D4VB 3H1YA 1H2NA 4HMZA 2WO2A 2ZX0A 4A4AA 5JAXA 5C8CC 3O1MA 2Y0OA 3WDTA 5JSRA 5T5PA 2Y38A 1GNYA 2WNOA 1FI2A 2ARAA 1HXS3 5FYMA 3SNMA 4AHZA 2WYFA 4IEUA 4GQ7A 3WP5A 5LRRA 4W50A 5A1LA 3PUHA 2XBO3 4HOOA 1OURA 2HEWF 2FDFA 3AFGA 3FC0A 3L9JT 1QKQA 3B7MA 5FYSA 1MS8A 1REFA 5DAXA 1UZVA 2OKXA 5A7OA 4D6QA 1WLDA 4BDVB 2W0XA 5FAXA 4PIZA 3FFZA 1IPSA 1V6MA 1SBEA 2PHFA 3VV1A 4GIQA 4CCCA 1IPJA 4Q0SA 4BM8A 1ZM1A 3MW4A 2R0FA 3AL5A 5IYYA 2YROA 1ZBE3 2PHXA 2ZGKA 2GMMA 5FYBA 1QMJA 2J1EA 4XDOA 4GWMA 3M1HA 4DRVA 2FDKA 5EYXA 1PIV2 1AX0A 4CCNA 4YZ3A 5JDBA 3T2QA 5LBCA 5C70A 1B35C 5C3QA 2BW8A 2RMU2 3J4UH 4E9KA 1VBE2 3A23A 3VBOA 3VBSB 2VZ3A 1RUF3 4C0HA 1A8MA 1U5IA 2HEYF 2WC2A 4E4HA 4LBJA 5F3GA 3E1F1 1NQJA 1FPN3 1H1AA 4XETA 4NIGA 3C3VA 4GWNA 3CBNA 4UBHA 4M3CB 2ILMA 3ZO0B 3N4MA 2VPVA 1K5MB 5E1RA 1W6QB 5LA1A 1UN1A 3OF1A 3JB4C 2IXIA 3ECQA 1C3HA 3NV1A 2BP6A 2GNMA 4MGIE 5EV7A 5FP9A 1COV2 4A42A 3O0WA 1QQP2 1ENSA 4M0NA 4XFHA 5A7NA 4BA6A 4CDXC 1JTZX 4X6QB 5FYVA 3WDUA 2VJXA 4UT5A 5CKNA 3S0MA 3TYJA 4XQWA 5FZBA 4TSVA 1N3PA 3LOIA 5IUQA 2VUAA 4Y3OA 1IGOA 2XLGA 3OGSA 3ENRA 4N8MA 4Q4X2 4ZU5A 2Q8EA 4KWJA 3S7EA 1WCUA 3WF4A 1H1IA 3ZFEC 5K0UB 2A6YA 4RHV1 2W1UA 3EMRA 4QB1A 1XSRA 1V00A 2NMOA 2DF7A 2E7TA 2BQPA 3KHCA 2TBVA 2Y8KA 3ZYJB 3K48A 3ZMNA 1LEDA 1ND2B 3SQOA 5F6KA 2FMYA 2VAUA 4K9SA 5C33A 5HV0A 3R4UA 4QPWA 2ZMKA 1AX1A 1S1AA 3AZWA 3URFA 4D6RA 4FOVA 5F3IA 1NCQB 5HXVA 3FWEA 4D94A 1UW8A 2XOMA 1J3PA 2FD8A 2VCAA 2XJTA 1SCSA 3BGAA 4LBLA 4OUSA 5DAQA 1OLMA 4YGBA 1H8TC 3GDBA 5BNOA 1WKYA 4XMIA 2GP3A 3O1TA 1OF3A 1ZA7A 3H0OA 4AI2A 2MHFA 3ZSEA 4KL1A 3EXUA 1UXXX 3V0AA 1XQNA 3D82A 5T52A 1VBA2 2WS92 2EIEA 2DVBA 3WXPA 1JZ4A 5JR7B 4CU6A 4P14A 3AP5A 4LBQA 2ZMLA 1ZRRA 4W6WA 4AFMA 1TEIA 4CCEA 1OMIA 4L2NA 4HFSA 1FOD1 1T6GC 4Q27A 5DUWA 4AVVA 3GXUA 4O65A 4XTMA 2WLQA 1RJ8A 1S0EA 1AR61 1SZBA 1O8SA 4HT1T 4Z8BA 1CONA 1MZ5A 3MF9A 2PLV2 5FMOS 5FZCA 1LHOA 4JCKA 4AFCA 3T30A 3TOJA 2WNUB 1A8DA 1ENXA 5FREA 4GWIA 5IHRA 2XJQA 4OHWA 1OVPA 3CLPA 1CAXA 4JGZB 3PIJA 1FOD3 4NAMA 4KG8A 2Y6LA 4AVCA 3HOBA 3K3OA 1DZQA 1MACA 1LESA 2CU5A 2H0BA 4KWUA 4XDQA 2I2SA 2RJKA 5A3WA 1LOAA 1WMDA 5C4WB 3T1MA 3T08A 1A34A 2J1TA 4CEYB 2QVSB 4XJ9A 3DXTA 3VGIA 2Q8DA 1MVQA 2UWAA 2ET1A 5DPNA 2D6KA 4CEWC 3QOPA 5LATA 4PDWB 4FPYA 1QQP3 3CZJA 3WG3A 2D5FA 2ZGOA 2WA4A 2TNFA 1WCKA 2IXCA 2PA7A 3BOWA 1SFNA 4DEVA 3WOGA 1Y3TA 2RS52 3DCQA 3V0BA 2R042 3WG2A 2FDIA 2IVIB 5FXZA 2ZGNA 2YG0A 1GZ9A 5D21A 1P8JA 2WT1A 1IS3A 3NQHA 5BNNB 1ONAA 2JB4A 3ZXKA 1JI6A 1BVVA 1PGW1 3OEBA 4NHLA 3ETPA 5B4NA 4MH0E 3WCSA 2DURA 1OVSA 3VBRC 3WUCA 1MQTC 2AACA 2VD7A 4BIFA 3VHPA 2WZEA 4Y1UA 4IV1A 1HX6A 1UMIA 1AYN1 2P4EA 3JCIA 3PL0A 5FO9B 2CDPA 1GQGA 4HK8A 4MGSA 3NAPB 1GWMA 3FUOA 5IATA 3E5XA 2ADDA 4XTPA 1RUC1 2DUPA 2W2IA 3ZXJA 2W1WA 1TME2 1YJKA 3ZIWA 1KS5A 4COZA 4BK5A 2BNMA 4DUVA 4K20A 1Y9MA 2ZEZA 4XFGA 1SDWA 1VPHA 4J25A 4KGQA 2BV4A 3ZR6A 1Z7S1 4CXXA 2HYXA 2YFUA 5IJRA 3WNKA 5I91A 1HV1A 1AYN3 1PK6B 3BTAA 2DU1A 1EPWA 5FOBB 2HWC1 3ZN6B 1M06G 4EWEA 5EPAA 2ZEWA 5DG1A 3ASIA 2XPJA 1LGCA 2CNAA 4XABA 5CAZA 1J1TA 3VBUA 3LEMA 1F9KA 2V5DA 5LBEA 4HLTA 1Z7S3 4LOTA 1QOTA 1RUG1 2VZPA 1S2EA 2KXLA 4QX7A 2XVGA 4LK6A 2J1UA 2GALA 1US2A 4P9IA 2C0ZA 3KS7A 1UYZA 4CZSA 3W5NA 3IDEA 5C8CA 1XYPA 2K0GA 4CDUC 2F17A 3JBG3 2PLV3 2Q1MA 2Y0IA 4FQ4A 4NN0A 3I49A 2ARCA 1N1TA 4JGYB 2BOIA 4A44A 1ZZBA 4CRQA 1RUG3 5CADA 5A6XA 1GANA 3ZXDA 4BZ4A 3FLTA 2GSYA 1RHI2 5F8PA 1XXNA 3OG2A 1I3HA 1QJY1 3AKRA 5H9PA 1DLCA 3QH7A 2W39A 5FMBA 4QQPA 2ZMNA 1WW7A 4META 1O3TA 3W20A 2GU9A 1JOBA 1SPPA 5J7MA 2EF6A 3U37A 1BHGA 4ORFA 2ZEYA 2A3XA 1GOFA 3AB0A 5FXXA 3LB9A 1CGPA 3D6EA 4WVMA 3WCRA 1QEXA 3DKWA 5EQUA 1JUHA 3SEPA 1PO12 2CV6A 1UOGA 5L73A 1UIJA 4AI8A 1B35A 5FYTA 5F3CA 5HXMA 4PJYA 2R043 3ZPOA 1IS4A 3MGUA 4AGVA 1SACA 4BMBA 2B9VA 1MS1A 3A4UA 1I9RA 3IDBB 4HETA 4AGRA 1NZCA 4QDSA 3CNAA 1TMF1 2YMZA 2PAEA 3R4DB 4A2UA 3WINE 3KCCA 4KBBA 3BUCA 3DUIA 3NW4A 1OOPC 4RS5B 4K8FA 1QJEA 1YYNA 4GB31 1DIWA 3M3EA 3ZXFA 1UKRA 3KCXA 1V9U2 4NIDA 3LPFA 2RS11 3H50A 2JXAA 3IMNA 1W04A 3KMHA 4ZU4A 5BNPB 4CDXA 1APNA 3BOPA 3MPBA 1PVC2 1JYIA 3H8RA 2QQNA 3N7LA 1DQ6A 2W52A 2VCBA 2WRAA 4Q4Y1 4D7SA 4PI0A 1EPZA 3ZFGC 1G7YA 3T0AA 5FY0A 1AX2A 5JVVA 4Q4W1 4DXTA 2BZDA 2FCUA 4AQ6A 4KBZA 1YQ2A 1PZ8A 1AXKA 3ZFEA 1CR7A 4HKOA 4Y33A 5CU1A 1W6NB 2YBKA 2BFUL 1Q8QA 3OPTA 1ND2C 2E9QA 2VQ0A 3RSJA 1R093 1J84A 1KJLA 3MIDA 3NNFA 3IBMA 3VD5A 1GYKA 4WM8B 4XJAA 5FZIA 5A7PA 1LU2A 1ZRCA 2WNVB 5AC92 3MZHA 1MR5A 2JDZA 2RJLA 3DYMA 4FTBA 3WW3A 3U4SA 2VXJA 2OS2A 4Q4W3 2VZ1A 4OI1A 2BGCA 1CAUB 5J1XA 2JDYA 3KD4A 5CVRA 5E8AA 4P00B 5FKBA 2BDRA 1UMZA 3LEIA 4Y20A 1XOYA 1EV11 1QH7A 5LW9A 1VAMA 1VBD1 3ON7A 4Y26A 4XIOA 5ANQA 2ZGUA 2VOXA 4OCTA 3RS6A 5F3EA 1HB3A 1NT0A 2J22A 3B93A 3N7JA 5FY7A 2XVLA 2P3YA 3AMQA 3PTYA 2HEVF 3FL7A 1H8TA 3WHTA 1QHDA 1W8ZA 2VNOA 3RQ0A 5IVBA 2QQVA 4C1WA 5IK4A 1RHI3 3IT8A 4NHMA 2JDAA 4OVEA 5CISA 2QQJA 4ISQA 4W4ZA 1JZ5A 2AYHA 5C3SA 5GKAC 4W6YA 2E26A 4NJ4A 4P9WA 2W1QA 3I3EA 3QLQA 3C7FA 3ZSJA 4AFDA 5I93A 1NLRA 4Q29A 2E31A 2UWCA 3DF0A 4L0PA 2XJSA 3U78A 2HBTA 5CKQA 3WF1A 2O8OA 3I59B 4XAAA 3V56A 2BEOA 2WNUC 3OYWA 3WUDA 5ACA1 1X8MA 1NA1C 2WNEA 3A22A 3B02A 3VBFB 1ZRFA 4JGZC 5B4XA 3DN7A 4EN7B 1G9FA 2Y34A 1RUJ2 3FZ3A 1C57A 2NYYA 2QDRA 4XE9A 3SKVA 1YO8A 5FLHA 4E2QA 4EYUA 5BYNA 1JYWA 3UKTA 5C9AB 5CBLA 3THDA 2XWJB 4JTOA 5LK5A 5C4WC 3WF0A 4LBMA 3DEMA 3CL1A 4LPLA 4AXOA 1RB8G 4OZXA 5ACA3 1WWYA 2EA7A 3EB7A 3LCPA 3OGRA 4TZDA 5HPOA 1XNAA 1BEV2 4BU2A 2R071 5J37A 2WQ4A 5GZCA 1W8HA 2WO1A 4QDQA 1QNWA 2PHRA 2VW0A 4B8EA 3O0XA 2E32A 5DDJ2 2X09A 4E2SA 4Q1RA 4CEWA 4GXLA 2QKDA 2WN3A 2X8KA 2BOJA 2XGXA 1E5RA 1KFXL 1OPOA 4Q4V1 4AHYA 1UKGA 2HWF1 3MI8A 3KF3A 3Q8EA 3M3QA 4GKXA 4ASKA 4WZCA 1H6YA 1XNTA 4R9AA 2R6QA 3NL1A 2WN2A 3O12A 3ZSMA 4FPFA 1QOOA 1N1YA 2ZX1A 4CPBA 4CCDA 2QQPA 1VBC1 3IAQA 4JX0A 1NE6A 4EN9B 3PIGA 2VTXA 3P6BA 2B42B 4LNVA 1MS9A 3T2PA 3MV01 1HN0A 4FTSA 2NM1A 4YW5A 3F95A 3VBRA 1RUNA 1BKZA 2MPFA 3NAPC 1S0IA 3MIEA 1QJU3 4ATFA 1MQTA 2HWF3 4LEJA 4NE9A 4EROA 3JQXA 3SHRA 4XJUA 3GBWA 4AOCA 5AC93 1D2QA 1W2UA 1AHSA 2D6PA 2VZOA 1VBC3 3NKTA 5FZ3A 3VL8A 4XFBA 4EJRA 1WBLA 4C8DA 3LOBA 1UYPA 2X29A 2BRTA 4YZ2A 5B2GB 1PK6C 2GMPA 1A3KA 2YGLA 4RL7A 1SBFA 2WT2A 2GP5A 3SITA 4H55A 1JXNA 1OLQA 1Q3EA 2EXKA 4WM7C 5FYZA 4L9BA 5IAVA 3H8UA 1K3IA 2PQSA 3UGHA 3W9AA 1PMHX 4QPGC 4RYDA 2RM22 4Q26A 3FBYA 4LUKA 3ES1A 1NY71 5A1FA 4LLOA 2XL9A 2VGDA 4ITCA 5FZFA 1W6MA 2OIIA 2Y6JA 3HQXA 1NG0A 3LSEA 4WVZA 3CEWA 4MHRA 2RVAA 4FTEA 2FCVA 5HI0A 4BYYA 4R4ZA 4F83A 5F5QA 1E5HA 4JGYC 4ZY9A 3WNMA 4CDUA 1SEFA 3PNAA 1H9WA 5FWEA 1H2KA 4IL7A 1PO21 2NMNA 5JOWA 4IEZA 2V72A 3AZYA 1RUH2 4B1MA 1LOBA 2VUJA 4AW7A 1W2TA 4Y1YA 4IE7A 4RQPB 2R061 2YPJA 2VULA 1POV1 3O1VA 1OQ1A 4YWAA 2ZX2A 3WQ7A 4RFRB 3OY8B 3RZMA 4N43B 2ZGSA 4KWKA 4HL0A 2WKKA 4TN7A 1BEV3 3HBKA 3D5OA 2ZPXA 5BY5A 5F2SA 4IUGA 1X8EA 4GH4A 4IEWA 4GKYA 4KI5M 2JD4A 5KXBA 3ILNA 5DDJ3 1W9TA 2MNGA 2R30A 1VMFA 1SLLA 2VNRA 2KR2A 2G9ZA 5FPAA 2BFUS 1F4HA 2D3PA 2ZHKA 3BU7A 4B4QA 3B9CA 3AP4A 3EQEA 5LCWL 1DLLA 4BQ1A 1WMEA 1WBFA 2C24A 3NWKA 4DOUA 2VOKA 3MLJA 1RIRA 4CP9A 1XNDA 3OUJA 3FFQA 4LJHA 5KC5A 1G6NA 4MHUA 1HLCA 3TN92 5A33B 2VZQA 4LIVA 3NVCA 3RZLA 1W6QA 1W06A 3WSOA 5FZMA 3VHNA 1ZX5A 1CJPA 5BV6A 5F5AA 1POV0 1XNCA 1X33A 3K51A 3MF6A 4BQ2A 5H9RA 2D7FA 1OOPA 4IEYA 2GC2A 4QX3A 3ZDVA 4HSJA 4Q0QA 4YM1A 5FXVA 2VCCA 4EN0A 1KDMA 2GC0A 5FBJA 3BALA 2YFZA 1UU5A 1JYVA 1RUE1 2QQUA 2MEV2 5FYHA 1W9YA 4PLOA 2HKXA 3ACFA 2XBO2 2B9UA 3HPNA 3LPGA 3VD7A 4CXWA 5LB6A 4MGQA 4S2GA 2O8QA 1YC61 3HT2A 1XE7A 3T2TA 2Z4FA 3PJYA 4ZU7A 1TNFA 2AGSA 5A32B 4R4XA 4COYA 3MFAA 2W1SA 4Q8LA 1D4M3 1ZA4A 2QZ3A 4QQHA 3ZFGA 2XVKA 1XNBA 5I0UA 4XJWA 4CDWB 5IVJA 2AC1A 2FMDA 4RA0A 4HPKB 1J3RA 2ZAAA 3HBZA 1W3XA 3ITQA 1I1EA 1C28A 3P3PA 1W8OA 4GJZA 4JZRA 2XMLA 2Q1ZB 1TQ5A 3KV5A 4AVBA 4QXKA 4XCBA 4WM8C 1ZREA 4EZHA 3NV4A 3LA7A 2RM23 1UF2C 5C5TA 3JB8A 1IHMA 1ND2A 3RNSA 1W9FA 3FMGA 3FLRA 4OULA 1S0GA 4CUCA 4HN0A 2N7GA 3LFMA 4NR1A 4OI2A 4SBVA 3RMYA 1RMU1 3KZ4C 4S2HA 5LK7B 1H8VA 3D0SA 3WT3A 4GAZA 3HN1A 2ZS6B 4JHZA 3LKJA 4GMP1 4CCOA 3FBMA 1SFPA 4JQTA 4YM2A 1ALYA 3HQUA 4XEZA 5LA0A 1AL21 3HQRA 3ILFA 2WFPA 1VB4A 5FZLA 1X82A 3ACIA 3TEXA 1YFWA 4CSWA 1RMU3 3HT1A 4KU8A 4CDQB 5FR3A 5FY9A 3APBA 3O5SA 1MEC3 4YM3A 2WO7A 3KM5A 1LEMA 4GMP3 3OBAA 1OLRA 3T4VA 1IG3A 3VBHB 4LULA 5ANNA 3WDWA 5JXHA 2VH9A 4QHBA 4WVVA 4KH9A 2BJSA 4AZZA 3ZPYA 3H1WA 2KM2A 2V4AA 4LBKA 3ZXAC 1GP4A 3VBFC 4TLGA 4FPEA 3ILRA 1QOSA 4FT8A 3GNEA 1H6XA 2ERFA 3IAPA 2K2SA 3KSCA 4N7UA 3A0NA 2WNUA 4ZONA 2WJSA 4YVWB 5FMCA 3RZJA 1NA1A 2OXBA 3LAGA 5AVPA 5J09A 2DUQA 2VE1A 4JGZA 3A0KA 5FO7B 5C9AC 1Q5OA 2HWB1 3ORJA 5F39A 4CCMA 5J48A 3BTZA 3J7LA 3ST7A 1LULA 1TG7A 5JSOA 5LRSA 3WEZA 1R1A1 1D0GA 1J58A 4N53C 3OGJA 1RTVA 2ZGMA 4U2AA 3TN93 3TEYA 1OBNA 2EAAA 2P3JA 1HRV1 5DN2A 4FVVA 4RSUA 4XZUG 3IN9A 2ZHLA 5D2AA 1UOJA 2QQMA 1DQ1A 2Y60A 1K42A 4DIQA 1L7QA 3MO4A 1JS9A 3VB9A 5DG2A 3WNNA 2A5ZA 3POYA 3OPWA 4Y4RA 4H7LA 5EP9A 4RHV2 2HWB3 3LIGA 4IE5A 4JRAA 3AKPA 3JQWA 4BJ0A 1Y43B 2MEV3 2B8MA 1YFYA 4OMCA 4QT6A 4AI9A 2WYSA 4BCUA 3O1SA 1LAJA 1V6LA 2A73B 3ACHA 1HRI1 1VBB1 3AP9A 1OHFA 4OHYA 1LJ7A 4E8CA 4D7YA 1CAWA 3RYPA 1CZVA 3KF5A 5GM0A 1BMV1 4P02B 3FLPA 2WZR1 2HYKA 3H7YA 4NROA 5FZKA 3WW1A 1TNRA 4V2VA 4LTAA 1PZ9A 2BNOA 2XJVA 3ZKUA 3EJKA 1WLWA 2C6SA 2W08A 2VZTA 4XHBA 4R9BA 1AZDA 4G9SB 4I0WB 4QQOA 3UNPA 2XWBB 1CPNA 3VZKA 2V09A 1JUIA 1VBB3 2YPDA 4R9DA 2JG8C 3T0DA 2HLEA 3WF2A 1F4AA 2WZR3 4MXWB 5FYIA 2BGOA 2WWSA 5IVFA 4PI2A 1KGYA 2YZ4A 4V1PA 2Y6GA 2GH2A 4IEXA 1OT5A 3CKHA 5EIYB 2AEZA 3LFIA 4NVPA 4XXPA 5JXGA 4FOQA 4YRDA 1FOD2 5DABA 3S57A 4ES9A 3VDAA 3E97A 1KQRA 1SMVA 2WFF1 1YQ6A 3VDCA 1HN1A 1PK6A 3BN6A 2OT7A 2BTVC 2VM9A 1S0DA 2P2KA 5D8AB 4OQ8A 3ZN6A 3LZZA 4P9XA 1F8VA 5CFCB 3KV6A 3SLIA 3KV4A 4DUXA 3UJOA 1C1LA 4WM7A 4DEQA 4PBOA 1LOFC 2XJPA 3MEPA 4UF0B 3GM8A 1XC6A 5LEKA 4QPGA 2OZJA 5FMDA 2BERA 2YDEA 4Q8KA 1JZ3A 2BBAA 3ME2A 1YI9A 2LS6A 4ET7A 2VOVA 3CF6E 4OUMA 3QACA 5FZHA 3I2IA 5FZDA 2FZ1A 5JWPA 1US3A 3S7IA 1VJ2A 2XDVA 1TE1B 3GYDA 4IESA 2IUWA 5E6HA 3I3BA 4JGYA 3OGGA 5KBFA 2VR4A 4JKLA 3JU9A 3I7DA 1OD5A 4MLOA 2OQ7A 4FBFA 4Y1ZA 1YIPA 2JICA 5FQ0B 4RQPC 1OSGA 4FPLA 2IWGB 2XL7A 3HAGA 5C5UA 3MHZA 4M3CE 3WW2A 1MZEA 2VOWA 4NWVA 4B4RA 4FPCA 1O4ZA 4BISA 1L7LA 1JHJA 1T2XA 5ABJB 3O7OA 3AJZA 2X5IC 4LE4A 3USUA 3BIEA 3LDRA 2RR11 1E5SA 1NYWA 3NRUA 3UGFA 1QJZA 1PGW2 5DQ0A 3N36A 4RHV3 4UW6A 1UNBA 3WG4A 1OC1A 3CU7A 4YW6A 3VDDB 4MGKE 2VCMA 4PF5A 1AYN2 1DGWX 4CCLA 1MPXA 3Q8FA 5J96B 3ZYIB 5BNQA 1QIQA 2CSGA 2YU2A 1GFF2 1V6IA 3WNLA 2RR13 2W5FA 3GZUC 1D0HA 4A7ZA 3D8CA 4D0QA 3BIWE 4QPIC 2DCTA 1CPMA 2EIBA 2FBEA 1ZZ6A 2Q1FA 4F7ZA 4DXZA 5FWJA 2G1MA 1ND3C 1Z7S2 5LZ6A 4QM9A 2CY6A 5JXIA 2J1VA 4MUVA 1JZ8A 2HWC2 2ZJCA 2VW1A 3NKGA 2CGOA 1UXZA 2ZX3A 3C7GA 3JBG2 3GHNA 2B46X 3VL9A 1VB2A 2D43A 2ZXQA 4A7YA 2I07B 1YWKA 1G9CA 1PMJX 3ZSLA 5L36A 1BZWA 4XC9A 1IKQA 1RUG2 1UZ0A 5FY1A 3ZXLA 4YSFA 5A6YA 2WUHA 2RMU1 2PXJA 2IVJA 4AL9A 4XQDA 2DCZA 3ABZA 5LA9A 2ZZQA 1DYOA 1AR63 4DS0A 5I8YA 3ZFFC 4Q5OA 1UMHA 4AGGA 1NCRB 4ARXA 4HN1A 4WVWA 1W6OB 3RDIA 3I97A 5C6CA 5KWRA 3PVNA 5DMYA 2WQ8A 5JIUA 3POJA 2OZ6A 1FV2A 5C3OA 2BBVA 5JCTA 3PJQA 1ENRA 2OYZA 4UWDA 2DCYA 4LBQD 1QJY2 5FZGA 3MW3A 2ZGTA 5I0DA 3D0JA 2WQZC 3KLSA 1ULPA 2YYOA 4LUMA 1GUIA 4N9HA 2TUNA 4IXLA 3CIHA 4DO0A 3ALQA 3KT4A 1KRIA 1WUVA 1URXA 5E88A 5FV3A 1POQA 1WA6X 3IKWA 2GC3A 2JDHA 2PHLA 4EQVA 1DGWA 4LO4B 2B5HA 2D6NA 1JOPA 5LBFA 3V65A 2Q5TA 1HB2A 2DFCA 4Q0UA 1H2LA 4R9CA 4A6SA 3VBHC 4Y1XA 2JG9B 2B4KA 4PQQA 5CA6A 2GDFA 1IS5A 5IVYA 1ODMA 1TMF2 4QWNA 3BI3A 1HKDA 2SBAA 3RFRA 4P08A 2AENA 1HW5A 4HZFA 5F32A 5L7OA 5FYCA 5CG9A 5FPVA 3T09A 3FX3A 3VLBB 2KA3A 5I8SA 1VIWB 1U5XA 2ETEA 2OUHA 3MV11 5FZ7A 2X05A 4A7KA 3VBFA 5LA2A 4GB32 4N90A 4UOJA 1CX4A 4QKBA 3H7JA 4L11A 2QCSB 2AREA 2RS12 4NRPA 3T3YA 3AZXA 3O1OA 5A3TA 1RUC3 4AQ2A 4U36A 3RWKX 5C9AA 1PHMA 2RG4A 3GBGA 1CQ9A 5L19A 4XQ4A 2P6HA 5AVAA 3AZVA 3R0RA 2XONA 4XBQA 4Q4Y2 1R092 1J83A 1U12A 4GALA 3POWA 1LKNA 1DFQA 4LA3A 5SV5A 4MVTA 4C91A 1DHKB 4YW7A 3DPRB 4N53A 3VBOB 4CP0A 4CXYA 3WX5A 3WNPA 4KMQA 1W8NA 4Q4W2 3MDPA 4XAEA 2HWC3 4DNYA 5DUVA 3V64A 4NHKA 3IDAA 1DGLA 4AEDB 2F4PA 4HKWA 3N9QA 2EIDA 4YW1A 4QXBA 3ZSKA 1FT9A 1GQHA 3ZYPA 4Z2WA 1DQ2A 3THTA 3RZGA 4IQPA 1O4TA 3PDQA 4QKFA 2OW4A 1SFYA 3LDKA 4FXKB 3AKTA 4AQSA 4BQXA 5JMOA 2VC9A 3IPVA 1FMD1 4AK3A 1GZWA 1OH4A 3AKSA 4DQAA 5EZWA 4XF3A 2DVFA 3QBQA 1EV12 3KQ4B 4FXGB 4UW5A 5F6LB 1PGL1 1UAIA 3TRSB 3GCWA 2VVDA 4IEPA 3MPPG 1Y4WA 3B94A 2AEYA 3O1PA 4YVSB 4XF4A 1WLCA 2RDNA 2B7YA 3KGZA 1NAEA 1MS4A 1EUUA 4XBNA 5FDBA 2XUMA 2JG8A 2ZGQA 1QJY3 3L2HA 2W92A 4QQ2A 3VBSC 4D8MA 1YEWA 5F5IA 3O1UA 3HNBM 1S0FA 3LWCA 2V73A 1W6PA 4P9GA 3SKJE 5IFTA 3SEEA 4LIUA 1BBT1 4ZXEA 4GULA 2A1XA 5CNAA 3BPZA 1ZZCA 1K5MC 4GWJA 2GNTA 5KXCA 4QXHA 4X8NA 3B3QE 4XJ8A 5ACA2 5IT6A 5IW0A 4IE0A 5KHGA 2FDHA 3WNXA 3ZYGA 4QGMA 1LOFA 2GAUA 4NWWA 4N7IA 2A6XA 1BBT3 1C8M1 5BNOB 5IAXA 2W91A 1TMF3 1H9PA 1QGLA 4QPYA 1YLLA 3V0AB 4LKSA 5DAPA 4XYXA 4XFIA 3I2JA 4L97A 1W0OA 3CO2A 5GZGA 4LBQB 4Z82A 3POIA 3ZDSA 2R072 2ZX4A 2ADEA 4FP2A 1UZYA 2BGPA 4GB33 5T3NA 3FHQA 4YZ5A 5K0UC 2WL1A 2VUDA 2XHNA 4BH9A 1BVP1 3HIFA 3POEA 2RS13 1FXZA 1F35A 1U5YA 2A6ZA 4KGGA 2H6BA 1JHNA 4CU7A 2FDJA 4JHTA 2J1RA 4OFGA 4ES8A 5F37A 3AXEA 2V4VA 4MV2A 4Q4V2 3GJAA 4Q4Y3 1QJU2 4RQPA 2HWF2 5LY1A 4V2WA 2CGPA 3U75A 4YW3A 1L7RA 3WY6A 4Z92B 2OX0A 1CAXB 1NCQC 4UFIA 3HJRA 1VBC2 3M3CA 2Z2SB 2VQTA 2RHPA 2X5IA 2VZVA 3VDDC 3LEKA 1H30A 5G04L 1JZ7A 1UWWA 3IM0A 1DBNA 4AI3A 3KHBA 5LBBA 1IG0A 4UBGA 1LU1A 2CAUA 2JEMA 1VAVA 4PT6A 2ARXA 4BB3A 3VUOA 2XR4A 3DKQA 3PHMA 2BWCA 1UY1A 3DV8A 3OUHA 4HK9A 1AR71 4YG0A 1W9SA 4O61A 3LA3A 4QGNA 2VZSA 4FPOB 1EV13 3NNGA 3QH6A 4XFAA 1NKGA 1YCIA 1NLQA 1VBD3 2I45A 4QPIA 4QU1A 4XMAA 5FK8A 1IQDC 1CVNA 4KQ7A 1VLNA 3UL2A 3K46A 3ELNA 1ND3A 1GNZA 4FOYA 1OKOA 4JC1A 2LUWA 3SCFA 2VZUA 1MZ6A 3GJBA 5EWSA 1AR73 2WIIB 1F2NA 1SLCA 1KJRA 2W46A 3UKNA 5A70A 1X9TA 2ENRA 2Y6KA 4ZS2A 2VNGA 3BTXA 4DRRA 4JKMA 1NY72 1RUD1 1XPWA 2WWJA 3IB3A 2JDPA 5I0SA 4COVA 2VNVA 4L99A 3LIHA 2D98A 4IV1B 4A45A 5A32A 3K2OA 2DWRA 2NP0A 2DCJA 2R7EB 1LNSA 4NPMA 3TWIA 5A3OA 2XKOA 3BODA 4CEYC 1AXZA 1UX7A 1ZZ9A 1LOEA 2JENA 2OPWA 2G4IA 1H0BA 3ZFFA 5T5JA 4I09A 2A3YA 4PDWC 4MG2A 2F6BA 1PO22 5FZOB 5GZEA 5FOJB 3PMEA 1YQ5A 5A7WA 1BK1A 1AJOA 4MZUA 4JRLA 2Q0AA 2GH8A 3VZNA 1J59A 3SC7X 3HWJA 4IV3B 2R062 4E4ZA 1C5IA 1S0JA 2GC1A 3AYDA 3GCXA 3LD8A 5CKMA 2R1DA 3ZMOA 3NNJA 1GWKA 2Y6HA 1R081 4J6GA 1REDA 3VBUB 5BNNC 3FHIB 4YGCA 5KXEA 4LO5B 4QHOA 2R073 2A6WA 4JV4A 2BVVA 1MZFA 1X36A 1RC6A 4FSJA 3JXSA 1KS4A 2FCTA 2D97A 3CMGA 4EZ4A 1LRHA 1GOGA 1V6OA 1XE8A 3UKVA 4YM0A 1OA2A 5A6QA 4CCKA 5C8CB 2YXSA 1PNGA 3JD71 4Q4V3 4HVRA 1N1VA 1UZZA 2JG9C 1J1LA 1R083 3R4SA 4H7MA 3GBFA 1NUKA 1XSQA 3ZN5A 1SDDB 3QD6A 2P3IA 4XACA 1QDCA 3H3LA 4XUNA 1ASJ1 4Y22B 1J3QA 1XYNA 4JKKA 3VBHA 3KQRA 5FZ0A 4HONA 1H4GA 1S4CA 5JI7A 1VRH1 4QX0A 2D93A 4XUTA 5F7UA 4LLFA 3JZVA 2GZWA 4QAWA 3JD73 3AC0A 4F3JA 4LHKA 5JZGB 4YNIA 1D4M2 3H3ZA 1XB9A 1JYNA 2DDUA 4E4DX 1QXPA 1SPPB 3M3OA 1ASJ3 1QU0A 4IGQA 1RUE2 1GBGA 4LITA 5FYUA 1JBCA 1JH5A 1CZTA 1WD4A 2QE3A 2XJUA 1CAVA 2XQRA 4WVMB 1F5FA 2PHWA 3D3AA 1CX1A 2K9ZA 3N3HA 3DPRC 3H3UA 5FK7A 4CPBD 3LA2A 2D44A 5IK5A 4ASMB 5IVCA 3J8F1 3LDBA 4AFAA 3P5BA 1GNHA 4RGGA 2WDBA 3G6JB 4CP2A 2RS31 3LGRA 4AEDC 5FPZA 1AR91 1HDKA 1RITA 2ID4A 3NJYA 1SLBA 5FPUA 1T6BX 1Q8PA 1EAH1 1K5JA 1LECA 2JIJA 4YW4A 4NAOA 3VZLA 1UYXA 3N9OA 2QQOA 1GMMA 1EY2A 4NUBA 4ZHNA 1ZBA1 1YFUA 1LGNA 2CGNA 3E6BA 4JDMA 1DF0A 4S2FA 5FLIA 4IW3A 4RD7A 2FQPA 1JOJA 1RMU2 2W9XA 3WDYA 4CDXB 1AR93 1MEC2 2QFEA 3KWVA 4I0AA 4AYUA 3HMYA 2XLFA 3OBRA 2IFRA 1EAH3 5LASA 4YVSC 3H8XA 1G9BA 3E5UA 3GALA 1HB4A 2GN3A 4PIYA 1MVEA 1PO23 3CZUA 4TYSA 3N9LA 1AL22 1JODA 3IIIA 3VZMA 4LO7A 3B69A 5JLVA 4FOWA 5JOXA 3T0BA 2R063 2DYCA 4CA9A 2OPKA 1POV3 1C4RA 3J9SA 1ST8A 5L9RA 4Q1PA 3ZFEB 4B29A 1Y9GA 3VBSA 3W5MA 3K4DA 4YZ4A 2WSUA 4K1YA 2DTWA 2WAAA 3G7DA 4A41A 5FO8B 4QHZA 5HCAA 4M3CA 4RS5C 3MLLA 1RYYA 1K5MA 2AZ5A 2QQWA 3I2HA 3M70A 4PCRA 3W21A 4BPZA 3TEWA 4K21A 4COUA 4Z2AA 2VL4A 2ZBJA 3J7HA 2E51A 1TZOA 4IE4A 1OFNA 5BNPC 4LBNA 3PLQA 2HWB2 1XRUA 1G9DA
chains in the Genus database with same CATH topology
1AXYA 1SQ4A 4YW2A 1G86A 4XJZA 1IS6A 3R05A 1H8TB 1A78A 1RJ7A 1HRV2 5AFEA 1OQEA 2O0OA 2XLAA 5GLZA 2DVDA 5K0UA 3VZJA 1WW5A 4AHXA 1RUE3 3KGLA 1OA3A 5CFDB 1WMFA 1FNYA 4I3PA 4M01A 1BJQA 1FX5A 1LGBA 2TEPA 3OYWB 1RVF1 2GN7A 3T1LA 1G8WA 2WNVC 1HRI2 1VBB2 4I0BA 2D6LX 2CWMA 2ZGRA 3DL3A 2WZR2 5CB7A 4RR3B 4K3UA 4BIOA 1SLIA 2NN8A 3I8TA 5KC6A 1WCSA 1NCQA 4IERA 3WZ1A 1AR81 2XB6C 2UYBA 1EYBA 4S2DA 3ROUA 3VDDA 3ZYRA 1RVF3 3POSA 4DY3A 4AQTA 4IETA 4HSLA 4I02A 4EN6B 4D69A 3THPA 3U0ZA 1DU3D 1DGRN 4CEWB 1AR83 3AYAA 3N7MA 1DZTA 4XIKA 3WHUA 3ZIXA 3KCYA 5BXXA 4E2GA 3H9AA 5FPXA 4QMAA 1ZZ7A 1AL23 1H1MA 1LHNA 5JI9A 3WQ1A 1DZRA 4INDA 2P37A 4OHZA 1QJX1 5DZEA 4WBBA 1GZCA 1MQTB 1WW6A 1R1ZA 3IDCB 2HWE1 4BMEA 1F31A 3M2MA 1ULEA 1EP0A 4CP1A 1O7FA 2HWD1 3AM2A 2D40A 4YGDA 2A3WA 2EVXA 5C4WA 4CEYA 1MS5A 2VW2A 2WT0A 2FHRA 5J36A 1RUI1 4ASLA 1UL9A 4CYDA 3B9IA 2AH2A 2DV9A 2QZ2A 4PDWA 4MX3A 4XILA 2IXLA 3ATGA 4IV3C 3PVOA 1AYM1 4YLZA 3RG0A 3TAYA 5IK8A 1U0AA 1R1A3 2LTNA 3TB0A 2HWD3 5T55A 3VBUC 1HXS1 2G9GA 1HRV3 1ZYBA 2RR12 5GJ6A 2DVAA 2WZPP 1O3SA 4JQRA 1RUI3 4MXVA 5BNNA 3BB6A 1W6MB 2GNDA 1AYM3 2ZZJA 4LR4A 1LHWA 5TSWA 1OPMA 1HRI3 4CDUB 4HVQA 1HV0A 1Q8OA 1ZBE1 3NAPA 2JG9A 5GLTA 1A6CA 5E89A 4LE3A 4COWA 2YUEA 3E6CC 2ZGLA 3EBRA 1Z78A 4IEQA 4P5HA 4L92A 3U11A 5JZGC 1PM7A 5BPXA 2EIGA 5GALA 1H2MA 1AR62 4PBPA 2WLPA 2IFWA 4IEOA 1RUF1 2E7AA 4Y1VA 1PVXA 1ZZ8A 1FPN1 1WGPA 3KT7A 3M8LA 4GH4B 4XBLA 5KHJA 3H1MA 3GZAA 1NOVA 1S0CA 4KG0A 4PIXA 1FATA 3KT1A 3WLUA 1WCDJ 4YYOA 3DPRA 2WFF3 2ATFA 4Y24A 3AFKA 3B00A 5CIRA 4ZKTB 1LHUA 2JKBA 2EXJA 1JW6A 1YHFA 5DZGA 2HJIA 5EJ3A 4JVAA 4XW3A 4AEDA 4AEKA 2GMEA 3WP3A 4HKLA 1W0PA 1OOPB 1OFSA 1UX6A 2UY9A 2QUOA 3PVBB 4PLMA 4N43C 2A75A 2X53S 4QGLA 4EWAA 4OHVA 5JMCA 4K1ZA 5FCCA 4LA2A 3W59A 2P3KA 2XJRA 4YVSA 2Z69A 1NE4A 2EXHA 3ZFGB 1VALA 4R8HA 4EV0A 2OA2A 3ZXEA 4X6RB 2E7QA 5DUXA 4MYEA 4H3WA 1QDOA 2UYAA 4HBNA 4ZXKA 1AUYA 4XF1A 2RE9A 2A70A 1NLSA 1RUC2 4AEMA 4BHPA 4AI1A 3ACLA 3E5QA 3WP4A 1KDKA 3D4KA 4G3YC 3AP7A 4QU2A 1N1SA 3N35A 3OJBA 4RS5A 1OI6A 4XPVA 2R32A 5H9QA 4L8QA 4J1WA 2ZOEB 3AYEA 4ONUA 1ULDA 1O3QA 3RI9A 1RL3A 2NQYA 5FBZA 1YUDA 5BNPA 3VKNA 1DQ4A 5K9YA 1WA4A 1PIV1 3SCGA 2VVFA 4I3GA 5T54A 4FPJA 1RINA 2WA3A 1SBDA 1VBE1 4CDWC 3I2DA 4H14A 1LODA 5HBAA 5CFDC 4AEJA 3R6SA 4DFSA 1V6JA 5J3UA 4I30A 1GKBA 4FAGA 2PFWA 1VAKA 1PIV3 1W6NA 4PQ9A 3S6PA 4MGYE 4WM8A 4RR3C 2RMU3 2Y26A 1LCLA 1NA1B 1VBE3 2WNVA 4W6XA 4XF0A 3FUQA 1FMD2 1LENA 1COV1 1W39A 1QQP1 3CJIB 1CAUA 1XU1A 4Q0PA 1PGL2 5FFOC 5JSPA 2PELA 3VKOA 1KXGA 1QWRA 1ULGA 2JECA 4QM8A 4AWDA 4C1XA 1N47A 3MIFA 2LM3A 4Q4X1 3Q9OA 4B7KA 1WW4A 5A3LA 3ZXGA 2ZKLA 4K40A 3WVJA 4CDQC 1COV3 3LSDA 1YNAA 3VHRA 1LHVA 4BE3A 2NZ9A 3PVEA 1Z0HA 1BBT2 1QH6A 4FPKA 1BXHA 2XKPA 2DTYA 1CAWB 4Q4X3 3I59A 1DYKA 4YVWC 4WV8A 4JDOA 1REEA 1WLTA 2YV8A 1AL0G 1QY4A 1KD7A 4UW3A 2P17A 1C8M2 4OI0A 1UIKA 3N7KA 1ENQA 4DZGA 1CD3G 1XYOA 2ZHMA 4HANA 3GHMA 1KFUL 2EXIA 4I01A 1O5LA 2NPIA 3WD5A 1VBA1 2QDNA 2WS91 4YFZA 5K7PA 2YC0A 3NJZA 3WR0A 1NQDA 4N9IA 2ZTNA 4XFCA 3IWZA 3WDVA 3ZVXA 4AG4A 1PZ7A 3AMHA 3B5LB 4OI4A 5HCFA 2CYFA 4IV3A 5KHHA 4WM7B 3JBG1 2PLV1 3AP6A 3OPZA 1O5UA 1VBA3 2WS93 5JIAA 1PMIA 2H0VA 2W68A 1V6NA 2BVBA 2ARBA 3GF6A 3OTFA 2VY0A 2Z5WA 4QPGB 1O91A 4LO8A 2PQQA 4YFWA 3O0VA 1S0BA 4X8PA 5BUVA 1VBD2 4EWDA 1MS3A 4Z07A 1L3JA 2XH6A 1QF3A 2Q30A 1G9AA 2ET7A 5T5LA 3WG1A 1AR72 4Q0VA 4ISRA 4BLIA 4Y22A 3JUUA 1FMD3 4AF9A 3OD4A 1O4YA 1YXWA 3VKMA 4AVTA 4K6BA 2CTVA 2JJ6A 2ZCWA 4XXAA 2QJVA 4IEVA 3VN4A 4C90A 2RS51 3RPQA 1S2KA 5D8AC 4XHXA 5JZGA 2PN5A 2R041 5CFCC 3USUB 4DY5A 2Q8OA 1LOCA 4GH4C 3UV9A 1OQDA 1D2SA 1RGSA 1CESA 5EXOA 4NOTA 1RUD2 3WQ0A 5DXDA 1SLAA 3I4IA 4MSVA 2YY1A 4AVSA 2RS53 2IC1A 1V6KA 2BUKA 4I2OA 1UD1A 3VZOA 3EO6A 1DQ0A 4YG3A 1TME1 5DZFA 1DGRA 1WD3A 3USSA 4YGEA 4FPGA 1CJDA 1Y9QA 3O14A 2DUOA 1M4WA 3OD0A 4JTNA 5EFUA 2AUYA 4URTA 1C8M3 3ZX7A 4O9GA 3RJRA 3RYRA 3I54A 3SISA 4DINB 2CAVA 3OBTA 4Z1VA 5ABJC 5F1RA 1R082 3IIAA 1HQWA 1OA4A 1TME3 2ZACA 3OY8A 4N43A 1HQNA 1R091 2DU0A 2LALA 3PMSA 2CWSA 4D7TA 4NPRA 3MIBA 1DYPA 2CL2A 3SCHA 1V70A 3JD72 1B09A 4B7EA 5JPMB 4AE2A 5F9TA 3RRDA 1ASJ2 2JE7A 4G4FA 1DDLA 3M3IA 4LHLA 3NO8A 3MICA 3RMXA 2FZ2A 2AR6A 2UY8A 1Q56A 1VRH2 2DCKA 3U4XA 1SLTA 4AVAA 1RHI1 2ZHNA 5A33A 1ZRDA 4ATEA 3V0BB 3WDXA 1IKPA 3AMNA 3HD8B 5K8SA 3KB5A 2XHKA 4YZ1A 4XOGA 3TNPB 1HIXA 2DVGA 5IK7A 4GA9A 4M0HA 3VKFC 3RZZA 4FCAA 1BQPA 1JN2P 1C8NA 2D6MA 4R52A 3MLKA 3SXWA 3P3NA 1JYCA 1PO11 3EHKA 3J8F2 1DG6A 3OCPA 3NV2A 3AKQA 5JOYA 1NCRC 4CDWA 2RS32 3NSTA 1AR92 4HPKA 2PHDA 5CFDA 1AJKA 3W58A 5L7OB 1I6XA 1EAH2 1YJLA 2E63A 1RUD3 2DFBA 3MYXA 4AHWA 1U5ZA 1PO13 1ZBA2 2Z42A 2P34A 5E16A 3CJIC 1ULCA 3J26N 1AF9A 3AJYA 5AFBA 4O9EA 4PLNA 4RR3A 2VXRA 1I5ZA 1V9U1 5FTTC 1N3OA 1BCXA 2ZAHA 2PYTA 5JOZA 2D6OX 1BYHA 3FJSA 4EN8B 1IQAA 1PVC1 1VR3A 4P9YA 1C1FA 3MIHA 1GICA 4LHNA 4P9LA 5I0RA 1O3RA 5D1IA 4N53B 1GR3A 5I8TA 1VP6A 4LO6B 3AYCA 4J1XA 2UWBA 1QXRA 1V9U3 2EALA 3L2YA 4CDQA 1PVC3 4BWOA 2JX9A 3UJQA 2A71A 2YHJA 4LT5A 1NXMA 1QJU1 1UPSA 1QXJA 3CJXA 4RGAA 1Q43A 5CG8A 5AC91 2XG3A 3ES4A 3IPVB 4QD2A 1GZWB 4W65A 1OKQA 4FQZA 2VG9A 2ZKNA 4YVWA 2VECA 3VKLA 2C1FA 4C0BA 4TWTA 1XU2A 3WP6A 1LB2A 2EAKA 3SH4A 3U10A 4AI0A 4KNCA 4TLFA 1VRH3 2PAMA 3UK9A 2JG8B 5H9SA 1RUOA 4FO9A 3VBOC 2VMIA 3SH5A 4E4SA 4LBOA 1CIWA 1B35B 1W6PB 4D3WA 3RYKA 2IXKA 1FYUA 4Y5Z0 2PTMA 2Q4SA 4XZPA 3AZZA 1XNKA 4E27A 3FE5A 3QCWA 2ES3A 5GZDA 2YGMA 5FRAA 1X7NA 2BNNA 1RVF2 2D3RA 3MFCA 5JPNB 3X29B 2WINB 5GLUA 2A7AA 1H4HA 1FAYA 3B01A 3SMHA 4OHXA 3J8F3 1DQ5A 1RUJ1 2D3SA 4KWLA 4SLIA 5GLWA 3SH3A 1E57A 4Q2FA 1AR82 3ZN4A 2RS33 4Y4YA 5KHIA 2VVEA 3WV6A 4UW4A 2IZWA 3NV3A 2UURA 1LTEA 3AXDA 3C2UA 3RI8A 3DGTA 4RFT0 1ZBA3 1BEV1 4KU7A 1RUJ3 3HR9A 4MXWA 5FLJA 2PHTA 1CN1A 1FV3A 5J98B 1Y7BA 4NO4A 5DDJ1 5HCBA 3GZTB 4A3XA 4MGZE 1GV9A 1UCXA 4UXAA 1C5HA 1Q8SA 2Z79A 1IPKA 5D8AA 2C5DA 5CFCA 2BWAA 2UU8A 2X5IB 4WZFA 4YARA 2BYVE 2IXJA 3WW4A 4Y20B 5KXDA 1QJX2 2R16A 3TBDA 2B39A 5BNOC 4K7JA 3ETQA 2B45X 3AMMA 4JAAA 2HWE2 2VQAA 5GZFA 1R1A2 4FPHA 2H6CA 2O1QA 2SLIA 2HWD2 2V5YA 1N3QA 1YIFA 2OUJA 1UU4A 1ZNPA 4OLLA 4B4PA 2VMHA 5SV8A 4DB5A 1RUI2 4QPIB 3TNQA 2PAKA 1ND3B 2G9FA 3MW2A 1AYM2 5T5OA 3AK0A 1FNZA 1D4M1 5FQ0A 3RJ2X 1S55A 3RWNA 3MIGA 1IOAA 3BCWA 1PNFA 1HXS2 2R49A 1MS0A 3M7AA 3M4FA 1LR5A 2A6VA 3AMPA 4F8AA 5ABJA 1BMV2 1ZVFA 1YFXA 2I74A 4DPNA 2RM21 4M00A 2ZGPA 1X50A 2QNKA 2GNBA 2C9AA 2NLRA 2PHUA 3ZFFB 1YRZA 3E6DA 4QX5A 1SCRA 1ZBE2 5DUUA 4YG6A 4JDNA 2VU9A 1LOGA 4M3CF 3VHOA 1AVBA 2D5HA 3U07A 4P9JA 1ULFA 1RUH1 1IZ3A 1S2BA 1GLHA 5GLVA 2WFF2 2E6VA 2IXHA 3AX4A 1MEC1 4XF9A 1RUF2 4BLJA 1KITA 4CTEA 5T50A 5I0TA 1FPN2 2BPA2 4FP3A 4AFBA 5A3MA 5FMOL 4IV1C 1F5JA 1RUH3 3VBRB 1YI7A 1UPIA 1PGSA 1GSLA 1HQLA 4FAHA 3S30A 2OVUA 4QQLA 2JE9A 2ZA9A 5L7OC 4XFFA 3INAA 1QNYA 1NCRA 2R1BA 1Q8VA 5C8WA 1W6OA 4HVOA 1QJX3 2WSVA 3TN91 4DMIA 2R0HA 2E53A 2HWE3 1UU6A 4GMP0 2VMGA 4B3NA 3CJIA 5LEJA 1CAVB 2MEV1 1NXD1 2XBO1 2ZABA 1D4VB 3H1YA 1H2NA 4HMZA 2ZX0A 5JAXA 5C8CC 2Y0OA 3WDTA 5JSRA 5T5PA 2Y38A 1FI2A 3SNMA 1HXS3 4AHZA 4IEUA 4GQ7A 3WP5A 5LRRA 2XBO3 2HEWF 3AFGA 3FC0A 3L9JT 1QKQA 3B7MA 1MS8A 1REFA 1WLDA 2W0XA 5FAXA 4PIZA 3FFZA 1V6MA 1SBEA 2PHFA 3VV1A 4GIQA 1IPJA 4Q0SA 4BM8A 1ZM1A 3MW4A 2R0FA 2YROA 1ZBE3 2PHXA 2ZGKA 2GMMA 1QMJA 4GWMA 3M1HA 4DRVA 5EYXA 1PIV2 1AX0A 4YZ3A 5JDBA 1B35C 2BW8A 2RMU2 3J4UH 4E9KA 1VBE2 3VBOA 3VBSB 1RUF3 4C0HA 1A8MA 1U5IA 2HEYF 2WC2A 4LBJA 1NQJA 1FPN3 1H1AA 4XETA 3C3VA 4GWNA 4UBHA 4M3CB 2ILMA 3ZO0B 3N4MA 2VPVA 1K5MB 5E1RA 1W6QB 1UN1A 3OF1A 3JB4C 2IXIA 3ECQA 1C3HA 3NV1A 2GNMA 5EV7A 4MGIE 4CZSA 1COV2 3O0WA 1QQP2 1ENSA 4M0NA 4XFHA 4BA6A 4CDXC 1JTZX 4X6QB 3WDUA 3S0MA 3TYJA 4XQWA 4TSVA 1N3PA 3LOIA 5IUQA 2VUAA 1IGOA 2XLGA 3ENRA 4Q4X2 4ZU5A 4KWJA 3S7EA 1H1IA 3ZFEC 5K0UB 2A6YA 4RHV1 1V00A 2NMOA 2DF7A 2E7TA 2BQPA 2TBVA 3ZYJB 3K48A 3ZMNA 1LEDA 1ND2B 5F6KA 2FMYA 4K9SA 5C33A 3R4UA 2ZMKA 1AX1A 1S1AA 3AZWA 3URFA 4FOVA 1NCQB 5HXVA 3FWEA 4D94A 1UW8A 1J3PA 2XJTA 1SCSA 4LBLA 4OUSA 4YGBA 1H8TC 5BNOA 4XMIA 3H0OA 4AI2A 2MHFA 3ZSEA 4KL1A 3EXUA 3V0AA 1XQNA 3D82A 5T52A 1VBA2 2WS92 2DVBA 3WXPA 5JR7B 4P14A 3AP5A 4LBQA 2ZMLA 1ZRRA 4W6WA 4AFMA 1TEIA 1OMIA 4L2NA 4HFSA 1FOD1 1T6GC 4Q27A 5DUWA 4AVVA 4XTMA 2WLQA 1RJ8A 1S0EA 1AR61 4Z8BA 4HT1T 1CONA 1MZ5A 3MF9A 2PLV2 5FMOS 1LHOA 4JCKA 4AFCA 3TOJA 2WNUB 1A8DA 1ENXA 5FREA 2XJQA 4OHWA 3CLPA 1CAXA 4JGZB 1FOD3 4KG8A 4AVCA 1DZQA 1MACA 1LESA 2H0BA 4XDQA 2I2SA 2RJKA 1LOAA 1WMDA 5C4WB 3T1MA 4CEYB 2QVSB 4XJ9A 3VGIA 1MVQA 2UWAA 2ET1A 2D6KA 4CEWC 3QOPA 4PDWB 4FPYA 1QQP3 3WG3A 2D5FA 2ZGOA 2WA4A 2TNFA 1WCKA 2IXCA 2PA7A 3BOWA 1SFNA 3WOGA 1Y3TA 2RS52 3V0BA 2R042 3WG2A 2ZGNA 1GZ9A 2WT1A 1IS3A 5BNNB 1ONAA 3ZXKA 1BVVA 1PGW1 4NHLA 4MH0E 3WCSA 2DURA 3VBRC 3WUCA 1MQTC 4BIFA 3VHPA 4Y1UA 4IV1A 1HX6A 3JCIA 1AYN1 5FO9B 1GQGA 4HK8A 3NAPB 3FUOA 3E5XA 4XTPA 1RUC1 2DUPA 3ZXJA 1TME2 1YJKA 3ZIWA 1KS5A 4COZA 2BNMA 4K20A 4XFGA 1SDWA 4KGQA 1Z7S1 5I91A 1HV1A 1AYN3 1PK6B 3BTAA 2DU1A 1EPWA 5FOBB 2HWC1 3ZN6B 1M06G 4EWEA 5DG1A 3ASIA 2XPJA 1LGCA 2CNAA 5CAZA 1J1TA 3VBUA 1F9KA 4HLTA 1Z7S3 1QOTA 1RUG1 2KXLA 2XVGA 2GALA 4P9IA 2C0ZA 3KS7A 3IDEA 5C8CA 1XYPA 2K0GA 4CDUC 3JBG3 2PLV3 2Q1MA 2Y0IA 4FQ4A 4NN0A 1N1TA 4JGYB 1ZZBA 4CRQA 1RUG3 5CADA 1GANA 3ZXDA 4BZ4A 3FLTA 2GSYA 1RHI2 1XXNA 1I3HA 1QJY1 3AKRA 5H9PA 3QH7A 2W39A 4QQPA 2ZMNA 1WW7A 4META 1O3TA 2GU9A 5J7MA 2EF6A 4ORFA 2A3XA 3AB0A 1CGPA 3LB9A 3D6EA 4WVMA 3WCRA 3DKWA 1JUHA 1PO12 2CV6A 5L73A 4AI8A 1UIJA 1B35A 4PJYA 2R043 4BMBA 1IS4A 3MGUA 4AGVA 1SACA 1MS1A 3A4UA 1I9RA 3IDBB 4HETA 4AGRA 1NZCA 3CNAA 1TMF1 2YMZA 2PAEA 3R4DB 4A2UA 3WINE 3KCCA 4KBBA 3DUIA 3NW4A 1OOPC 4RS5B 4K8FA 1YYNA 4GB31 1DIWA 3M3EA 3ZXFA 1UKRA 3KCXA 1V9U2 2RS11 3H50A 2JXAA 3IMNA 4ZU4A 3KMHA 5BNPB 4CDXA 1APNA 3BOPA 3MPBA 1PVC2 1JYIA 3N7LA 1DQ6A 2W52A 4Q4Y1 4D7SA 3ZFGC 1EPZA 1G7YA 1AX2A 5JVVA 4Q4W1 4AQ6A 1PZ8A 1AXKA 3ZFEA 1CR7A 4HKOA 5CU1A 1W6NB 2BFUL 1Q8QA 1ND2C 2E9QA 2VQ0A 3RSJA 1R093 3MIDA 1KJLA 3IBMA 1GYKA 4WM8B 4XJAA 1LU2A 1ZRCA 2WNVB 5AC92 3MZHA 1MR5A 2JDZA 2RJLA 4FTBA 3WW3A 4Q4W3 4OI1A 2BGCA 1CAUB 5CVRA 3KD4A 5E8AA 1UMZA 4Y20A 1EV11 1QH7A 1VAMA 1VBD1 4Y26A 4XIOA 2ZGUA 2VOXA 3RS6A 3B93A 3N7JA 2XVLA 3AMQA 3PTYA 2HEVF 1H8TA 3WHTA 1QHDA 2VNOA 3RQ0A 4C1WA 5IK4A 1RHI3 3IT8A 4NHMA 4OVEA 4ISQA 2AYHA 5GKAC 4W6YA 4P9WA 4AFDA 3QLQA 3ZSJA 5I93A 1NLRA 4Q29A 2UWCA 3DF0A 2XJSA 2O8OA 3I59B 3V56A 2BEOA 2WNUC 3OYWA 3WUDA 5ACA1 1X8MA 1NA1C 2WNEA 3B02A 3VBFB 1ZRFA 4JGZC 3DN7A 4EN7B 1G9FA 1RUJ2 3FZ3A 1C57A 2NYYA 2QDRA 4XE9A 1YO8A 5FLHA 4E2QA 5BYNA 3UKTA 5C9AB 5CBLA 2XWJB 4JTOA 5LK5A 5C4WC 4LBMA 3CL1A 4AXOA 1RB8G 4OZXA 5ACA3 2EA7A 3LCPA 4TZDA 1BEV2 2R071 5J37A 2WQ4A 5GZCA 1QNWA 2PHRA 2VW0A 4B8EA 3O0XA 5DDJ2 4E2SA 4Q1RA 4CEWA 4GXLA 2QKDA 2X8KA 2XGXA 1KFXL 1OPOA 4Q4V1 4AHYA 1UKGA 2HWF1 3MI8A 3M3QA 4GKXA 4WZCA 4R9AA 2R6QA 3NL1A 3O12A 2QQPA 3ZSMA 4FPFA 1QOOA 1N1YA 2ZX1A 1VBC1 1NE6A 4EN9B 2B42B 4LNVA 1MS9A 4FTSA 2NM1A 4YW5A 3VBRA 1RUNA 1BKZA 2MPFA 3NAPC 1S0IA 3MIEA 1QJU3 4ATFA 1MQTA 2HWF3 4LEJA 4EROA 3JQXA 3SHRA 4XJUA 3GBWA 5AC93 1D2QA 1W2UA 1AHSA 2D6PA 3NKTA 1VBC3 3VL8A 4XFBA 4EJRA 1WBLA 3LOBA 2X29A 4YZ2A 5B2GB 1PK6C 2GMPA 1A3KA 2YGLA 4RL7A 1SBFA 2WT2A 3SITA 4H55A 1JXNA 1OLQA 1Q3EA 2EXKA 4WM7C 4L9BA 3H8UA 3W9AA 4QPGC 2RM22 4Q26A 3FBYA 4LUKA 3ES1A 1NY71 4LLOA 2XL9A 2VGDA 4ITCA 1W6MA 2OIIA 3HQXA 1NG0A 3LSEA 4WVZA 3CEWA 4FTEA 5HI0A 4BYYA 4R4ZA 4F83A 5F5QA 4JGYC 4CDUA 1SEFA 3PNAA 1H9WA 1H2KA 4IL7A 1PO21 2NMNA 5JOWA 4IEZA 3AZYA 1RUH2 1LOBA 2VUJA 4AW7A 4Y1YA 4RQPB 2R061 2YPJA 2VULA 1POV1 1OQ1A 2ZX2A 3WQ7A 3OY8B 4N43B 2ZGSA 4KWKA 4HL0A 2WKKA 1BEV3 3D5OA 2ZPXA 5BY5A 1X8EA 4GH4A 4IEWA 4GKYA 2JD4A 5KXBA 3ILNA 5DDJ3 2MNGA 2R30A 1SLLA 2VNRA 2BFUS 2ZHKA 2D3PA 3BU7A 4B4QA 3B9CA 3AP4A 3EQEA 1DLLA 4BQ1A 1WMEA 1WBFA 3NWKA 4DOUA 2VOKA 3MLJA 1RIRA 1XNDA 3FFQA 5KC5A 1G6NA 1HLCA 3TN92 5A33B 3NVCA 1W6QA 3VHNA 1ZX5A 1CJPA 5BV6A 1POV0 1XNCA 1X33A 3K51A 3MF6A 5H9RA 2D7FA 1OOPA 4IEYA 2GC2A 4HSJA 4Q0QA 4YM1A 4EN0A 1KDMA 2GC0A 3BALA 1UU5A 1RUE1 2MEV2 4PLOA 2HKXA 2XBO2 2B9UA 4S2GA 2O8QA 3HT2A 1XE7A 3T2TA 3PJYA 4ZU7A 1TNFA 2AGSA 5A32B 4R4XA 4COYA 3MFAA 4Q8LA 4QQHA 1D4M3 1ZA4A 2QZ3A 3ZFGA 2XVKA 1XNBA 5I0UA 4XJWA 4CDWB 2FMDA 4RA0A 4HPKB 1J3RA 2ZAAA 3HBZA 1I1EA 1C28A 3P3PA 2Q1ZB 1TQ5A 4AVBA 4QXKA 4WM8C 1ZREA 3NV4A 3LA7A 2RM23 1UF2C 3JB8A 1IHMA 1ND2A 3RNSA 3FMGA 3FLRA 4OULA 1S0GA 4HN0A 2N7GA 4NR1A 4OI2A 4SBVA 3RMYA 1RMU1 3KZ4C 4S2HA 5LK7B 1H8VA 3D0SA 3WT3A 3HN1A 2ZS6B 3LKJA 4GMP1 3FBMA 4YM2A 1ALYA 4XEZA 1AL21 3ILFA 2WFPA 1VB4A 1X82A 1YFWA 1RMU3 3HT1A 4KU8A 4CDQB 3APBA 3O5SA 1MEC3 4YM3A 3KM5A 1LEMA 4GMP3 1OLRA 3VBHB 4LULA 3WDWA 2VH9A 4QHBA 4WVVA 4KH9A 3ZPYA 3H1WA 2KM2A 4LBKA 3ZXAC 3VBFC 4FPEA 3ILRA 1QOSA 4FT8A 3GNEA 3KSCA 2ERFA 5EYYA 2K2SA 4N7UA 3A0NA 2WNUA 4YVWB 2WJSA 1NA1A 3LAGA 5AVPA 5J09A 2DUQA 4JGZA 5FO7B 3A0KA 5C9AC 1Q5OA 2HWB1 5J48A 3ST7A 1LULA 5JSOA 5LRSA 1R1A1 1D0GA 1J58A 4N53C 3OGJA 1RTVA 2ZGMA 4U2AA 3TN93 2EAAA 2P3JA 1HRV1 4FVVA 4RSUA 3IN9A 2ZHLA 1DQ1A 5DG2A 2A5ZA 3POYA 4H7LA 4RHV2 2HWB3 4JRAA 3AKPA 3JQWA 1Y43B 2MEV3 2B8MA 1YFYA 4QT6A 4BCUA 1V6LA 2A73B 4OHYA 1HRI1 1VBB1 3AP9A 1OHFA 1LJ7A 4D7YA 1CAWA 3RYPA 5GM0A 1BMV1 3FLPA 2WZR1 2HYKA 3H7YA 3WW1A 1TNRA 4LTAA 1PZ9A 2BNOA 2XJVA 3EJKA 1WLWA 2W08A 4XHBA 4R9BA 1AZDA 4G9SB 4I0WB 4QQOA 2XWBB 1CPNA 3VZKA 2V09A 1JUIA 1VBB3 4R9DA 2JG8C 4MXWB 2WZR3 2WWSA 2YZ4A 4V1PA 2GH2A 4IEXA 4NVPA 4XXPA 4FOQA 4YRDA 1FOD2 4ES9A 3E97A 1KQRA 1SMVA 2WFF1 1PK6A 2BTVC 1S0DA 2P2KA 5D8AB 3ZN6A 3LZZA 4P9XA 1F8VA 5CFCB 3SLIA 3UJOA 1C1LA 4WM7A 4PBOA 1LOFC 2XJPA 3MEPA 5LEKA 4QPGA 2OZJA 4Q8KA 2YDEA 3ME2A 1YI9A 2VOVA 3CF6E 4OUMA 3QACA 2FZ1A 5JWPA 3S7IA 1VJ2A 1TE1B 3GYDA 4IESA 4JGYA 3OGGA 5KBFA 3JU9A 3I7DA 1OD5A 4MLOA 4FBFA 4Y1ZA 1YIPA 2JICA 5FQ0B 4RQPC 1OSGA 4FPLA 2IWGB 2XL7A 3HAGA 4M3CE 3WW2A 1MZEA 2VOWA 4NWVA 4B4RA 4FPCA 1O4ZA 5ABJB 3O7OA 3AJZA 2X5IC 4LE4A 3USUA 2RR11 1NYWA 1QJZA 1PGW2 3N36A 4RHV3 4UW6A 3WG4A 3CU7A 3VDDB