4JQRA

Crystal structure of a duf4465 family protein (baccac_02373) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
KNEVVVSFENLLTEENSQFIADGTPNNQAFQETDFKDPKNLINFNHYYADWGSGYSFAGFSYMNITDNQTANSPAPITGKAKIGSVYIGVDSTDGEYGTPAILTILDTNYKLKGTWIANSTWAYMGMIQGDGYARAFKAGDWYKVTATGYDEAGNETGKAEILLANYKTDNDLPVKEWIWFDLTPLQNAVKVKFIPDSSDKNEYGMNTASYFCLDGITLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14717 DUF4465 Domain of unknown function (DUF4465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1350 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jqrA00
4E9KA 4JQRA
chains in the Genus database with same CATH superfamily
3OUIA 4INDA 2WO1A 2WS93 3SH3A 1NCRA 4FBFA 4UFMA 2L9LA 5L9VA 4QXKA 3W5NA 4DEVA 2J1TA 3V65A 2JDZA 1VBC2 1QMJA 2VMIA 5HV0A 3JBG1 2G4IA 4OQ9A 1KGYA 1RHI1 2ZX2A 3M3OA 2HWF3 5JXIA 1IPSA 1VJ2A 3OY8B 4FXKB 1OH3A 1OUXA 1E5HA 3INAA 4RL7A 4CU9A 1REDA 4QPIB 1PZ8A 2VCAA 4WM8B 1G9BA 1W39A 4S2FA 4LIUA 1Q8QA 4IEWA 4ZU7A 1BCXA 4CDQA 5T5PA 3U14A 1RUOA 3ATGA 4TLFA 1LESA 1PO12 1TME1 1ZYBA 2JKXA 5CU1A 4CP1A 4EQVA 2FZ1A 2DUOA 3WOGA 4BYYA 3RZHA 5F39A 1EY2A 1A6CA 1GZWB 1RUE3 2C1FA 2JXAA 2RS32 4LHSA 1O3QA 1R081 1CIYA 1GOGA 1YLLA 5FY5A 3NJXA 1KJRA 2PFWA 5AC92 1ZZ9A 1LOGA 4Q0QA 1V6MA 1YNAA 1V6NA 4JHTA 4S2GA 3AP6A 4WM8A 2GZWA 5DDJ2 3ZXJA 2JE8A 3OPZA 3P1IA 3QCWA 1WA6X 3FHIB 1KRIA 2PLV3 3CDZB 1IG0A 3VBFA 5FYSA 3FJSA 2RS51 3I59A 1AR73 1ND3C 2X5IA 3AKRA 2XLAA 3I2DA 4ZU4A 3ZFGC 1UY2A 5IFTA 2DVAA 5BNPA 1IS6A 1R1A2 5KXCA 1RL3A 1RUH1 3AMQA 3MIEA 5IK4A 1LJ7A 1RJ7A 2XJRA 4NOTA 2IXJA 1COV2 4E4HA 1ULFA 1WWYA 4OI2A 1CPMA 4XPVA 1SZBA 1ND2B 5KWRA 1W6NB 4OHXA 1AR93 4BQXA 3N35A 1O59A 1GNHA 4Y1ZA 3R05A 1ZM1A 3K4AA 4KU7A 1ZBA1 1NY72 4IV3A 3SCFA 2GNTA 3J7LA 5FZBA 1PO21 3W59A 4KWLA 3OG2A 3Q8BA 1N3PA 4NHYA 2QKDA 4QPGA 1QHDA 4RQPB 2YGLA 3I3DA 1VBE2 4YGCA 3K46A 1UMHA 2DFCA 5HBAA 3T2TA 1HB2A 1S0FA 5FPAA 2R043 5J1XA 2RM21 4FP2A 3VBHC 4WM7B 4QX0A 5F8PA 3A4UA 3RI8A 3ZIWA 4URTA 2HWC3 4QB6A 4I02A 4R9AA 1DQ6A 4MGIE 5FUPA 1QJU1 2NQYA 4PBPA 1PGSA 2P2KA 2HWC1 4FPKA 1Y43B 4CDWA 2JG9C 4ISQA 1GBGA 3AYEA 4X8PA 3ETQA 2Q8CA 1GP5A 3IWZA 3KQRA 1PGL1 3IBMA 1YEWA 1H8TA 2ZMKA 1NZCA 3K4DA 3MDPA 2WQ4A 3JZVA 5DUWA 3UNPA 3C3VA 1LENA 3DN7A 3GBGA 2ET7A 3VBOA 4CCDA 5JPMB 4LKEA 5K0UB 1SHWB 3KD4A 3TOJA 4YRDA 2HWD3 3ZXEA 2IFWA 1HXS1 4BIFA 2IXHA 4AI2A 3S7IA 3HN3A 4Q4Y2 4E4DX 4XBLA 2RV9A 4EZ4A 1F9KA 1OLRA 3OJBA 3D6EA 4NN0A 3AYCA 3WZ1A 1EAH3 4IV1C 5T55A 5D1IA 2QBXA 1OKQA 1ZBE3 4IQPA 1Z0HA 4WM8C 4TSVA 4Y22B 3KV6A 1US2A 3I97A 2DV9A 4ET7A 4RGGA 2Z4FA 4I0WB 1ZBE1 2YU1A 1DP0A 2CGOA 4LO8A 3P3PA 1QDOA 2ZMLA 4RS5C 3RQ0A 4J1XA 3ZLIA 5C3QA 2WYSA 4MHUA 3C7EA 4GB31 1RUH3 3B5LB 4AE2A 5KR7A 3WX5A 2C4XA 4Y1YA 4QB2A 4RR3B 3J26N 5KHKA 4Q4X1 5A32B 4G4FA 5A6YA 2JG9B 4EN7B 2OQ7A 4BJ0A 4YYOA 4MGYE 2UYAA 3NNFA 1OI6A 5IYYA 5B4NA 3ZYGA 5DXDA 3C7FA 4YM0A 4BMEA 3I2IA 1R1ZA 4RSUA 4LXLA 4UXAA 5JXGA 1PMJX 1AYN2 3C8XA 4QX5A 1H4GA 3NKGA 4COUA 2NP0A 4DXRA 3MIDA 1F35A 4AEDB 5AC93 5LA2A 1W9SA 2WNUC 3SXWA 2P6CA 2JJ6A 2CY6A 3QACA 5BNOB 4QX1A 4FPJA 4F3JA 3IAPA 3LSEA 2ATFA 1CZVA 1EPZA 1D4M1 4M0HA 3DF0A 3VBUC 4CRQA 4EN0A 1RHI2 3WVJA 2H0VA 5JAXA 2W46A 4HL0A 1N3QA 4CDQB 4K20A 2K2SA 2WZR1 2J1VA 4N53A 4BISA 3LSDA 2VM9A 3RPQA 1TNRA 2Q4SA 2A3XA 3UV9A 4BIOA 1UU4A 1NX9A 1JHJA 2A73B 5HXMA 3POFA 3ZSKA 5H9PA 1SFYA 1NQJA 1UYYA 2JB4A 3HMYA 3U07A 4Y33A 1H0BA 2G9GA 3IZOA 1PVC2 4HANA 5HPOA 2KR2A 5A7WB 3SLIA 2Y38A 4OUMA 4DNYA 4YZ1A 4O61A 1ZRFA 2FD8A 4ES9A 1SBDA 3OBZA 3VBOC 1YC61 2E63A 1W0NA 1GWLA 4GALA 5FWJA 3I2OA 2JIGA 4D0QA 1BVVA 2RS53 4NR1A 4DS0A 5AC91 1OXCA 2BNNA 3H8OA 2W0XA 4FQZA 5HXVA 4BQ3A 3B01A 2BWAA 4GMP0 3T2OA 1GYKA 4PLOA 4AEDC 5DUVA 5A6ZA 2B4KA 2ZGSA 4V1PA 3KT4A 3MLLA 3VN4A 2DUPA 5K7PA 3VBFC 3NRUA 1AR72 2HBTA 4YVSC 5CNAA 1DZTA 4BPZA 4Q4V2 4NHXA 3CLPA 5FK7A 3B7MA 4UFHA 2Y6KA 1ULGA 1BEV1 1OT5A 4HVRA 4R9DA 5GLTA 2BOJA 3VL9A 1TNFA 2E7QA 5L73A 4YVSB 1RUD1 2CWSA 2B46X 4ZXEA 5KXBA 2VXRA 4Q29A 3W9AA 3N7JA 3M7AA 4MO3M 1MQTA 3RNSA 3SITA 1RGSA 5IAVA 3WG1A 4AHXA 4C0BA 1XB9A 2AYHA 2ZGRA 5FTTC 4N43B 2N7GA 4NHLA 1CJPA 4JDNA 3DUIA 2PHXA 3MYXA 4Y3OA 1YO8A 1YQCA 4NROA 1ULEA 1YUDA 1CX1A 3F2ZA 4AVAA 1DQ0A 2AZ5A 5LBFA 5JOYA 2Q1ZB 4FPGA 3KSCA 1VRBA 1NA1B 4YVSA 1W28A 2WZR3 4CCLA 4AZZA 5GZEA 1HX6A 2RS13 5KXDA 1LOBA 2IC1A 4FOQA 1R093 4AEJA 1HRI1 3PTRB 2GC3A 1VMJA 3VD4A 2PELA 2IXKA 1QDCA 1JUHA 3B02A 3SNMA 1QU0A 4O7XA 1K5MB 3KVBA 1A78A 1V70A 1VBE3 4LBQD 3ZSJA 2Z79A 2DVFA 3THPA 5JPNB 1G7YA 1ZREA 3WQBA 4MXVA 3VL8A 4F83A 1RYYA 2P5BA 1RUC3 1W8ZA 5I0TA 4KQ7A 2QFEA 1RMU2 1QOTA 2CSGA 4IERA 4YGDA 1S0JA 4ZPIA 3MFCA 4Q0VA 4Z92B 1VBD2 5IAXA 2ORXA 3TNQA 4LOSA 4UT5A 3PUIA 3MW3A 2OA2A 2WO2A 3AMMA 2XJUA 1QJX3 2V09A 1YWKA 4WVMA 4Y22A 2ZGOA 4O9EA 3O1VA 2XBO1 1DYPA 3TYJA 1KJLA 1O8SA 4IE5A 1AUYA 4YW3A 4XC9A 1I5ZA 3WDUA 1NT0A 4IE7A 3PMSA 4LUKA 1WUVA 4YSFA 4QB1A 4XJ8A 5A7NA 4DRRA 4D6QA 2EALA 1VAMA 3LIGA 5FPXA 3D8CA 1H2KA 3KT7A 2VZ3A 3POJA 3PTYA 4WVMB 1VPHA 3KF3A 3ZO0B 1ULCA 1UL9A 1TZOA 2VBDA 1H2LA 1H30A 3WNMA 3BTAA 1AR81 3ELNA 5EP9A 3VDDC 4HSJA 1JUIA 4GMP1 2ZKNA 3CKHA 3LA3A 4OHZA 4AHWA 1LU1A 4D6SA 4EE2A 1RUD3 5JUVA 2CAUA 2YUEA 4B8EA 4BQ1A 5CISA 4UFJA 2HEWF 3N7LA 2OVUA 2VMGA 2XH6A 2UWCA 3WF3A 5FDBA 2Z42A 4CDUC 5A3NA 2VW1A 5IT6A 2QE3A 1NLSA 3H42B 5J36A 1HIXA 1QJX1 1PK6A 5LY1A 1PHMA 1WLWA 1DCSA 3C7OA 1QIQA 1GP4A 5FZ7A 4YZ2A 2R071 5DMYA 1UY1A 1LHUA 1DDLA 2HWC2 1QF3A 4GULA 3SKJE 3O0XA 3SCGA 3BVCA 3POEA 5FOBB 1GOFA 2AREA 2PA7A 3E1F1 3MW2A 3UL2A 2E51A 3T3YA 4DRVA 2OZJA 2LUWA 3GBFA 2VCMA 1C1LA 1VP6A 4PI0A 1NA1A 3TWIA 3MIHA 2VOTA 4B7EA 1O4ZA 3MF6A 2D5FA 1XSRA 5JI7A 1MZ6A 3KQ4B 2VNVA 5AFEA 1LOFA 3CJIC 1WD3A 4JV4A 1NY71 4CDUA 2OPWA 4BK4A 5CB7A 3IB3A 4NWWA 4UOJA 4XETA 1AF9A 1MS3A 3BPSA 3RYRA 4QT6A 1ZA4A 3HJRA 5FP3A 1IHMA 1U0AA 2ZGPA 2VE1A 3AFKA 3TB0A 1CVNA 1MPXA 3RZJA 1C8M3 1CESA 1HQWA 1UPIA 5J98B 3RZMA 3ILFA 2ZEZA 4I3PA 5C3PA 2VOVA 2PTMA 4TWTA 1DQ1A 2ZAAA 4M3CA 2CYFA 1FOD1 4WZFA 1I9RA 5CG9A 1R1A3 3AZYA 3ZFEB 1NG0A 1NCRC 3H8UA 3I54A 2XJQA 1RUF3 3PU8A 4GZ9A 3KHCA 1BLZA 1YIPA 3GYDA 4OYUA 5LA1A 2XPJA 3Q8FA 5CEHA 4LOTA 1J3QA 5FMCA 2J22A 2PXJA 2Q8OA 1QQP2 1UQXA 1CAWB 3LZZA 1W8OA 3S7EA 1W0OA 5D8AA 1X8MA 2D3SA 2JD4A 2Y60A 1K5MA 2FCUA 1JZ5A 5C4WC 3NJZA 3WQ7A 3NL1A 4RGAA 4PBOA 4PQQA 2Y6GA 3VD5A 1QXJA 3T4HB 4QWNA 1UNBA 3FC0A 1NLRA 1S4CA 2O14A 4Q5OA 3A23A 5T3NA 3N9MA 4A7KA 4WBBA 2ARXA 1VBD1 4AHZA 5LY2A 4XVHA 4P9LA 2DVBA 1I1EA 1RUI2 1AL0G 5A32A 2EIGA 2WYFA 1G9CA 1VBC1 1V9U3 2O1QA 2W08A 3GBWA 5GZFA 2QNKA 3WXPA 2WZEA 4JC1A 2A70A 4JCKA 3POIA 5F6LB 3VDDB 1C5HA 2MEV3 1EUUA 1L7LA 1L7RA 1QOOA 1ZNPA 3ACLA 4DXTA 1QJX2 2EAAA 2MEV2 4AEKA 4HN1A 2CGNA 4Z8BA 4XABA 4MHRA 1GOHA 1KS5A 3TN91 3RG0A 1DLLA 3RDIA 1OF3A 4S2HA 5T50A 1EP0A 1US3A 2YC4A 3ACHA 1AX1A 1LODA 3CQOA 4A7YA 2VG9A 1XYPA 2J1UA 3NO8A 3H3ZA 1FV2A 2LS6A 5BNOA 2WNUA 3MPBA 4XUNA 2D40A 3WY6A 3FLPA 1ND2A 4IEVA 5G05L 1UPSA 3THDA 1EV12 3ZXDA 1KEXA 4YLZA 3FBMA 1YYNA 3LE0A 1PX4A 1S0EA 3ZSEA 1O6UA 5GJ6A 4I0BA 2YDEA 4D7SA 5C33A 2ZS6B 2E53A 3HQRA 1X8EA 1O8PA 1RVF2 1RUI1 3AVRA 2W3JA 4FO9A 3E5UA 1DGLA 3M3CA 3O14A 2X05A 1LOCA 5ABJA 2BUKA 3LA2A 2MNGA 1XXNA 1STMA 4IUGA 4AVCA 4E9KA 1JZ8A 3WHUA 4XDQA 3AKQA 2JEMA 4OZOA 4NPMA 5C3RA 2R30A 2MEV1 1GUIA 2D97A 2DYCA 4OI0A 1PNGA 1AYN3 1W2AX 2DBIA 2GAUA 2ZX4A 3ZXFA 1GZCA 1KFUL 1ZBA2 1GZTA 5GZGA 4JDOA 3OBRA 1G9AA 1ZRCA 2JDAA 2WDBA 4LKFA 2R073 5E1RA 3BIEA 2PHLA 5JCTA 3MUZ1 4EN8B 3WF2A 2WLPA 3EBRA 1C8M2 1DBNA 4XXPA 2WT2A 5FBJA 5FPZA 5FO7B 1Z7S1 2ORZA 4PT6A 1ZRDA 1CAXB 4PCRA 4K8FA 3WDTA 2QQPA 1AR71 5ANQA 4K8RB 4D7TA 5FYTA 2BEOA 4CXXA 3TEXA 2O0OA 1XC6A 4IESA 1MACA 4NVPA 2NMNA 2X10A 3NQHA 5D2AA 1CAUB 1EAH2 2AACA 4Z2WA 2ZHMA 4YM2A 3MIFA 4NIGA 3IT8A 4A42A 5TSWA 2VL4A 1H2MA 1HB4A 1YQ8A 1PZ9A 2AEZA 2VZTA 4RFRB 5E6HA 4ASMB 4Y4YA 2VJXA 3AC0A 2LROA 5FPBA 3WW1A 3WF4A 5EJ1B 3DKQA 2KD7A 3OD0A 4K9SA 4QDRA 4DXSA 2NPIA 2XHKA 4LKDA 1DQ5A 4FP3A 4XF1A 4YM3A 1H1MA 1XOYA 4MXWA 4TXWA 4JQRA 4E2SA 2W47A 5C4WB 2VVFA 3VHNA 2PAMA 4Q1RA 1X36A 2VO5A 1XSQA 2OXBA 4D8MA 1BK0A 1WCDJ 3AM2A 3L9JT 4XUQA 1WA4A 2FDJA 2EVXA 3EJKA 1HQNA 2IVIB 1Q56A 2GMEA 3VDAA 4CTEA 3G7DA 4LK6A 1HRV1 4A3XA 2HWE1 3BPZA 5FAXA 2BBAA 5LWBA 2K46A 1T6BX 2R6QA 2VOWA 1AR91 1NA1C 4QPIA 4PDWC 4XUPA 5T5JA 2OKXA 4UWDA 4RR3C 3VKMA 4BQ4A 4FT8A 4MXWB 2FDHA 1JBCA 1B35B 1SMVA 1W3VA 3LPFA 4P08A 3ZOIA 5F1RA 4GB32 4LIVA 5FYHA 3J7NA 3C2UA 3E6CC 1POQA 4K21A 2WT1A 1W9WA 2ZOEB 3M8LA 4KWUA 1REEA 2BDRA 2G9ZA 1DIWA 2GC0A 3POSA 3AKPA 1SPPA 1QJY3 1KXGA 5ACA1 1O4YA 2R042 4N53C 4NMIA 4B4RA 1OOPC 4XF0A 4CCJA 4NAMA 2WSUA 5IUQA 4RR3A 1GNZA 3ZMNA 1V6OA 5BNNC 2DFBA 1UMZA 5JOWA 1P8JA 1H2NA 1KDKA 2VMEA 4CUAA 4DY3A 3WP3A 4AI9A 5D21A 1BK1A 1QOSA 3MIGA 2NM1A 1W8UA 2I74A 4K40A 4L0PA 3AZZA 3LDBA 3CF6E 4FPCA 3U75A 4XCAA 1V9U1 3NMBA 4UI9L 4AEMA 1VBA1 4ZY9A 2BYVE 3ZFFB 3DYOA 3WV6A 4AWDA 1TME3 2WN2A 3N3HA 4L99A 1JYCA 5GLUA 5JIAA 2XQXA 2IXLA 1KQRA 1UY3A 2ZGLA 4Q26A 3VDDA 1RUC2 1OH4A 2PLV2 2JDHA 4XOGA 4QQHA 4Q4W1 1XU1A 2JDUA 1NQDA 1EYBA 5EJ3A 3UETA 4CP0A 4COWA 1D4VB 3KF5A 3VD9A 3J9SA 1Y3TA 4NO4A 3H9AA 5L9BA 1J3RA 1RHI3 3MIBA 4MZUA 5IVCA 4UW5A 2YC0A 2E9QA 2QQVA 3KCXA 4CSWA 3ZKYA 3T0BA 1R092 5LA0A 4FAGA 5IK8A 3BOPA 4XF3A 4NHMA 4NIDA 4CUCA 4RS5B 2CTVA 4Y1VA 1HLCA 1BQPA 4A4AA 1OURA 1S2BA 3FFQA 3NV2A 3I59B 2YC2A 1JH5A 1W9YA 4KI5M 1QJZA 4RHV3 4FI9A 4QD2A 2V5YA 2RM23 2W91A 1R64A 4CU6A 3FZ3A 2Y6JA 3SHRA 2HBUA 3SISA 5C9AB 5JMCA 1NE4A 4JGYA 1OFNA 4CU8A 3ZYHA 1O5UA 1F5FA 1LEMA 4NIAA 4BLIA 3ZVXA 1IPJA 1CD3G 2YFUA 2WJSA 5FFOC 2NN8A 1DQ4A 2BVVA 2WWUA 4BU2A 4RFT0 3VBUA 1M06G 1SLIA 5T52A 4NUBA 2W94A 3V0AB 2Z5WA 1HXS3 1DYOA 3CZJA 3ZR5A 5FZFA 5BNQA 5IATA 2Q30A 3O1SA 2XB6C 2Q8DA 2I2SA 4LBQA 1XQNA 1PZ7A 4OCTA 4XYXA 4AF9A 1OKOA 2QTWB 2W1WA 2VOXA 3KV5A 3AMNA 5FYIA 1GU3A 2B9VA 1FPN3 1C8NA 1NCQC 1VBA2 4KBZA 1DZRA 3GCXA 4LE3A 4XJAA 5LB6A 3PIJA 4E2GA 3ZFFC 1MQTB 4HSLA 1GV9A 3NV3A 4HT1T 5KBFA 3I2GA 5FY0A 1LHOA 2A3WA 1V9U2 2J42A 2QVSB 1MZFA 4KWJA 5GLVA 4CEYB 1UIJA 5FZDA 1K5JA 5FZ9A 1V6KA 3SCHA 3VZMA 1VBB3 2VQTA 3WT3A 4RGKA 4R52A 5DPNA 2R0HA 4Q4X3 4XTMA 5ACA2 4AVTA 1J59A 3LFIA 4YARA 1ZRRA 1CR7A 4QHZA 5FY4A 2YV8A 5J09A 1MS1A 5FYZA 4Z1VA 3P3NA 2F6BA 1YCIA 1SFPA 2J7MA 5C6CA 1SCRA 3LOIA 3I8TA 2ID4A 4GB33 4MSVA 5IJRA 3A22A 1QNYA 3HBKA 2ZJCA 2PMWB 4YG6A 5J7MA 4N43A 1VIWB 2OUJA 1FAYA 4GH4A 1DF0A 4LHLA 2XJPA 2VW2A 1PO11 1K3IA 2ZZQA 3CZUA 3PNAA 1WGPA 4KBBA 4TZDA 3OGVA 1RUC1 2Y6FA 3WF0A 5FZ3A 1OA4A 4LNVA 3VBRB 2WAOA 1CWPA 1MR5A 3V56A 4JRLA 4EJRA 4PLMA 1OBNA 3VHOA 3USUB 5F6KA 5G04L 4W50A 5J96B 2ZGKA 3U4XA 1W2UA 2GNBA 4W8JA 2X8KA 1UAIA 2IWGB 1HN1A 2VVDA 2VU9A 4HZFA 5BYNA 4FPEA 1TME2 3D0SA 3OGRA 2WS92 3RYKA 1QXRA 3B00A 3WUCA 3GZUC 5GKAC 4NIIA 5FYMA 2C9AA 4ZONA 2C6SA 4YG3A 5FRAA 1SPPB 4Y20B 2RR13 2ZHLA 4QU1A 3O0WA 5FQ0B 5LW9A 1F2NA 4GH4C 3KV9A 1J1LA 1RUG2 5C9AC 5A7WA 2XQRA 3P5BA 4Q27A 3NV1A 1XNDA 1ENSA 3MPPG 3B9IA 4V2VA 4K1ZA 4N90A 3VZLA 3HPNA 3NW4A 3ZYJB 2D6PA 2HEVF 1GP6A 4LE4A 4ARYA 3LWCA 5CVRA 2LM3A 2Z2SB 5HCAA 4B1LA 5JZGC 2DUQA 4IEPA 2QQWA 5CFDA 1GICA 3O1OA 1XBFA 4KMQA 1W6MB 1XPWA 1H6YA 2YPDA 4LMFA 1V6JA 4FFFA 1PK6B 2DVGA 1E5IA 3ZKUA 1W6PA 3POWA 4EV0A 4UBGA 1ZZ7A 4IEYA 4XIOA 1E57A 1JXNA 4YFWA 5FJKA 4AG4A 1GANA 3ALQA 1YJKA 4RYDA 3PUSA 4G3YC 2P4EA 2X29A 3GZEA 4MVTA 4QX2A 1UN1A 4Q0PA 1HB3A 2C9KA 2P1BA 4JX0A 4IEQA 4YM1A 3ST7A 3WP5A 2BOIA 5A7QA 1N3OA 3UT0A 4RS5A 1HQLA 4CXWA 5KXEA 3V0AA 1RVF3 1GMMA 2LW8A 5FXVA 1W2NA 2QQKA 3MW4A 4E27A 1IS3A 1OQEA 1WW5A 3FHQA 4HK8A 4Z07A 1EUTA 1D2QA 1XE8A 2KA3A 4XFGA 4QU2A 5GZCA 2GNMA 4YG0A 1W6OB 3JQXA 4EWAA 2NLRA 1PNFA 3A0NA 4P9XA 4JGYB 3HD8B 1GKBA 1I3HA 4IEXA 4N7IA 5D8AC 4HOOA 3T0AA 3KCYA 1H8TB 3VD7A 2RDQA 2EXJA 3M1HA 3N7KA 3ZSMA 4XDOA 2QJVA 4ZHNA 2UURA 1DHKB 2BRTA 2CNAA 4QHOA 5EWSA 3ZYIB 4KNCA 3U11A 4NRPA 4LHKA 2X09A 3U1XA 5FZ1A 5JOXA 2WO7A 1V6LA 4QGMA 2VULA 2VZSA 5L7OA 1JYWA 1OA2A 1W99A 3WQ0A 1FOD3 3N36A 3LEMA 4YW1A 1XNKA 3OEBA 2TEPA 4XFIA 3J4UH 4CYDA 1PGW1 3IPVA 1LKNA 4AVVA 1SLCA 1QJU2 3RI9A 3I2KA 4QPGC 1WBLA 2D6OX 3MGUA 1ODMA 3ON7A 2BGOA 2G9FA 4P9IA 1JZ6A 4AR2A 5FZEA 4IE4A 2BFUL 3U4SA 1ZBE2 5KC6A 1W6QB 4R9BA 1UZYA 3RZZA 2BVBA 1WMFA 3NNMA 2VQAA 4IW3A 2P37A 1QH6A 1HW5A 4JDMA 4NJ4A 1YIFA 4LULA 5EPAA 3RWNA 2DTWA 2MHFA 4AI0A 2YY1A 1SBFA 2RS33 4LO4B 3BYWA 5CKMA 2A5ZA 2B45X 2C5DA 3IDCB 1UZWA 5FIXA 2RR11 4QQOA 2Y6HA 2GSYA 3D82A 4PJYA 3MEPA 1UKGA 5CFDB 1IGOA 4LPLA 2ZMNA 2WNEA 3B9CA 1DLCA 2BQPA 2WWJA 4Y5TA 3UJQA 5BNPB 2BNMA 3ROUA 2OPKA 3Q8AA 3ZDSA 5CFCA 2R32A 1LAJA 3ZM8A 1KITA 4IDZA 1JOPA 1GLHA 3CBNA 3DPRA 5FZ4A 5FXWA 2WT0A 4Y20A 3WINE 3D5OA 3BKZA 2ZEWA 5CAZA 3CEWA 4GWJA 2E26A 3ACFA 1K45A 3IIAA 5J48A 4YW4A 2FCTA 5HCHA 1F8VA 2XJVA 4FFIA 3WNLA 3BIWE 2D44A 5AFBA 2UU8A 4AAXA 3AZWA 3KGZA 3LPGA 4XAEA 4QKNA 5IFPA 1H1AA 1W2OA 1UXXX 3QH6A 5FYYA 4EN6B 3M3EA 4NPLA 3T08A 3IN9A 2HWB3 4O9GA 5DABA 4F7ZA 5LZ6A 3EYPA 3IKWA 3Q8EA 1Q8PA 1PIV2 4KGGA 4M3CB 1AYN1 3OSDA 1IQDC 2XKPA 4FQ4A 1JYXA 1EPWA 1PIV3 1WZXA 3OUHA 1JZ2A 4AVSA 4NRMA 4LA2A 2YFZA 2RR12 4NPRA 3I7DA 1KDMA 1W6NA 2XONA 1QJY2 4FTBA 3FE5A 2JENA 4Q4V1 2GH8A 4HG6B 1LR5A 3USSA 2IXIA 2VPVA 2HYXA 5L7OC 5JXHA 3I3MA 2VZVA 1RUG1 4JGZB 3JU9A 3ILRA 5C8WA 2TBVA 4OULA 1A8DA 5DDJ3 2OIIA 2JE7A 1ZZCA 3H7YA 3PUHA 4I30A 1R082 1YFXA 4XZUG 4XMAA 4XQWA 1X9TA 3VBFB 1OMIA 2WNVC 4BZ4A 2WRAA 1DGWA 3ZFEA 2V4AA 5FY1A 4IE6A 1SBEA 2QDNA 3QD6A 5FYCA 1J83A 2B5HA 2HWB1 2RDNA 4FSJA 5C70A 1S0BA 1UYZA 2ZAHA 3O1RA 4QM8A 4DMIA 4AFDA 4AI1A 2GN3A 1OQDA 1LTEA 4FOYA 5DG1A 4CDUB 3BU7A 1RINA 1WKYA 1ENXA 4UFLA 4NWVA 4YPJA 5A3PA 4CDXB 5A1FA 4Y24A 1LGBA 1AX0A 1WCUA 5F5AA 4DUXA 1F31A 5EXOA 2FZ2A 2Y0OA 2ET1A 5H9QA 2CAVA 4NE9A 3RZLA 4R4ZA 4BXSV 4XXAA 2GH2A 4XCBA 5EFUA 5A33A 5T5LA 4Q4V3 3KM5A 4CDXC 4PDWA 4M4RA 2UWBA 3JB4C 4NRQA 2W1QA 1UU5A 2D6MA 2DCKA 2D6NA 5I0DA 1YHFA 1UX6A 1H9PA 4AQ6A 5I0SA 1E5SA 2QZ3A 2VC9A 2WA4A 5FZMA 2A6ZA 4TTGA 4XBNA 1COV3 3I49A 4FTSA 1FMD1 1BYHA 2VMCA 4GWIA 4OHWA 3K77A 5C4WA 1CGPA 3ZDVA 4A44A 3S57A 4HVQA 2H0BA 5KHJA 3VBSA 4D3WA 3KS7A 1RIRA 1UZVA 1RUI3 3V64A 3GDBA 3MI8A 3CHXA 3T30A 4ISRA 2W92A 2XOMA 1RMU1 2VUDA 1LNSA 2A6YA 2J1SA 3PMEA 3KGLA 5JSRA 1QJY1 3ITQA 5JDBA 3BOWA 3JCIA 2FDGA 2HWD2 2GP3A 3JQWA 3GNEA 1SG3A 1HV1A 2LRPA 3UK9A 2B9UA 4YFZA 1K42A 1XU2A 2EIEA 3C7GA 3RJRA 4AK3A 4A7ZA 5FZCA 3J8F2 3F95A 1AR82 2VBPA 5L36A 1ONAA 2Z69A 1UOBA 3ETPA 3IDEA 2OS2A 4GQ7A 3FUOA 1S0GA 1FNZA 3VKFC 4AVBA 5L19A 3JBG3 2QUOA 3O1TA 3I3QA 4XUTA 2HWF1 4XJ9A 2ZCWA 4L8QA 5F7UA 5CBLA 5FLJA 3BN6A 4L2NA 5C5TA 1LB2A 1VRH3 4QHBA 5ERLA 3ZYPA 4CP9B 1HRV3 1LRHA 4JQTA 3KLSA 1WMXA 2QCSB 2E32A 3ES1A 3GM8A 1Z7S2 1UZZA 2CU5A 4HFSA 4PI2A 2WS91 5FPVA 1YRZA 2VZQA 2EXIA 4KWKA 5A1LA 4FXGB 4CUBA 5BY5A 1YFUA 3FL7A 3GGLA 3OGSA 4IV3B 5ISLA 2FDFA 3MLKA 4BQYA 3AJZA 3MF9A 3O5SA 5I91A 3H1YA 4CEWB 4DFSA 2VTXA 4IE0A 2KM2A 2Q1FA 1O3SA 2HWE3 1AL21 1C3HA 5LBBA 3WUDA 1NAEA 4U36A 1RUJ2 3VZKA 1W8WA 3R6SA 3VBHA 1VBA3 4F8AA 1QY4A 2WFF3 1MS0A 1AR61 4BXFA 2PHDA 1Y4WA 4JTOA 3JD72 1K5MC 4OLLA 1SLTA 1VMHA 4Q0SA 2H6BA 3UGGA 3CU7A 3PJYA 4CP2A 4XHXA 1N1SA 2WQZC 5F2WA 2XL9A 1UIKA 3H50A 5CA6A 4XF4A 2VUCA 4Q0UA 5FPUA 2VCCA 1OFSA 1QWRA 3OPWA 4IL7A 4H14A 3WF1A 5FPLA 2P3KA 1WMEA 2ZTNA 4N53B 3EHKA 5FZ0A 4XE9A 4LK7A 3ZXKA 1PVC1 5BXXA 2W1UA 2GNDA 5K8SA 3VDBA 1A3KA 4GWMA 1D4M2 3KMHA 4XF9A 2BBVA 2V73A 4ATFA 1NOVA 3R4SA 4LO7A 1AJKA 4EROA 2WN3A 4CVUA 3W21A 4LLFA 4YZ4A 1AVBA 4E4SA 3U78A 3BU0A 1RUE2 3LIHA 1LULA 2WA3A 2ZX0A 2SLIA 5ACA3 4XW3A 2AC1A 2F17A 2VMFA 2PLV1 3OOXA 3UESA 5EIYB 4QKDA 2YZ4A 4P9GA 4XIKA 3HT2A 1BVP1 2Y33A 1CAWA 5FV3A 2QQMA 1S2EA 2PHTA 1XJAA 2XLFA 4CPBA 2I45A 2TUNA 1REFA 3OCPA 4AL9A 4CCKA 5BV6A 1BBT3 4JTNA 3WEZA 4JGYC 3WR0A 2JG9A 4AI3A 2YB7A 4GJYA 2VXJA 5JSOA 3O1UA 1AL23 2XL7A 3FN9A 3D3AA 3WDWA 1VMFA 4BB3A 1VLNA 3TN92 1OLMA 3N9NA 4YVWC 1G9FA 5FMOS 1M4WA 5JXJA 3HNBM 4SBVA 5DUXA 1POV0 3WNOA 4LBNA 1OLQA 1CAVA 1MVEA 5A3MA 1B09A 2W95A 3BCWA 4L11A 5JZGB 4META 1WLCA 4H3WA 4J6GA 2OUHA 4WVZA 4DXZA 4QPWA 2QQNA 2O8OA 1HRI2 1RXGA 5GALA 1VRH1 2QQUA 4OHVA 5A3TA 1NKGA 1ZBA3 5FREA 2XUMA 2YPJA 4C91A 4DQAA 1XYOA 3Q9OA 1YI7A 1HXS2 5EJZB 2DWRA 2Y34A 1UMIA 4X8NA 2D6KA 1TMF1 2JDKA 3JXSA 3MLJA 3P6BA 2R1BA 1V0AA 4PQ9A 2DURA 2VZRA 1NXMA 3VDCA 3S6PA 4P5YA 5EZWA 5HCBA 3K3OA 5BNNA 2PHFA 4CP9A 2WR9A 2YU2A 2OZ6A 3WG4A 3ZN6B 1CQ9A 2RVAA 3CL1A 2RS12 3G6JB 5IVVA 1PO13 4HKWA 1YQ2A 4YZ3A 4JGZC 5LATA 4ASLA 2VNRA 5IVBA 3A7QA 1UYPA 3RYPA 3PVOA 2RJ2A 3DXTA 5FP8A 5FZGA 4NAOA 3ZR6A 3CNAA 5FMDA 2ARAA 1VBB1 4AEDA 1MS8A 2ZHKA 2V5DA 4RA0A 4B29A 4K1YA 1R083 3E5QA 3H1MA 1EAH1 3NAPB 2W39A 1F4AA 4LBKA 4ASKA 1WW6A 4LBQB 4Q4X2 4DEQA 1MZEA 5ABJB 4UW6A 2JG8B 2A6WA 2R16A 2Y8KA 4HPKB 2EXKA 3N7MA 4KU8A 5JR7B 1OVPA 4XUOA 4J1WA 5FKCA 3VBHB 3ZN4A 1XE0A 5LK7B 3NJYA 2VMHA 2NYYA 1W8TA 1W8HA 3CJXA 3SH5A 2FBEA 3ACIA 3R4UA 1TMF3 2DDUA 4RD7A 4MLOA 2RMU3 4P9YA 3BODA 1UKRA 1O91A 1POV3 4UAPA 4QQPA 1GQPA 1DFQA 2BGPA 4H7LA 1JYTA 2ZEXA 4IXLA 1PGL2 1ENQA 2B42B 4IEUA 5E89A 1C4RA 4D7YA 3U0ZA 3LOBA 4HVOA 4JKMA 4ONUA 5GM0A 1W0PA 2P3YA 4I3GA 3K4ZA 5F5CA 2AH2A 2ARCA 3DYPA 2HWE2 1FPN1 1IKQA 3EMRA 2RMU2 3FLRA 2V4VA 2DBNA 4E4ZA 1FNYA 1OUSA 1Q5OA 3R4DB 5FJHA 3V0BA 1RUNA 4UFKA 5H9RA 5JR2A 3AX4A 2HKXA 2P6HA 2Y26A 3PLQA 1WCSA 1I6XA 3SEPA 3T09A 1SLLA 4Y1UA 2Y64A 1J3PA 2BP6A 3OGGA 1NCQB 5A3OA 2PAEA 5L7OB 1ULDA 4XACA 1D2SA 3UGFA 4R9CA 4QGNA 4CCOA 2JG8C 4QDQA 1ZZ8A 1UX7A 4RQPA 4CDXA 1DU3D 3OD4A 5DUUA 1W6MA 1F5JA 3WDYA 5JZGA 1WD4A 3PL0A 2YHJA 3ENRA 2QQOA 2D6LX 2A75A 3O7OA 4ES8A 2H6CA 2R061 2D93A 4N9IA 1U5XA 3FFZA 2DCZA 3ASIA 3W5MA 2F4LA 1X7NA 1YI9A 5B2GB 2RS11 2QQJA 3AB0A 4E8DA 3E6BA 3J7HA 3TEZA 5A7OA 5FBZA 1FMD2 2WIIB 3AYAA 5CKNA 1T6GC 1GZ9A 4JAAA 4PIXA 2BNOA 1C57A 2E31A 2X5IC 3C7HA 3BTYA 2A71A 5BNNB 1FOD2 1VBB2 3AFGA 1W04A 3OBAA 1NCRB 1YQ6A 2EIBA 3OYWB 1SACA 4UFIA 4WVVA 2AUYA 2BJSA 2D98A 4AFBA 2LTNA 5FZOB 4OHYA 3MHZA 4Q8LA 3USUA 5I8SA 1DG6A 3DYMA 2YROA 1AX2A 3EO6A 3FHAA 3OEAA 3POBA 1AR92 3VV1A 4FOWA 4EZHA 2CHHA 5CFCB 2EICA 1CX4A 1IKPA 2B8MA 3THCA 3RSJA 2UYBA 2PHUA 2RDRA 4GIQA 1HV0A 4V2WA 2J1AA 1QNWA 1RUH2 4XJZA 5F32A 3TRSB 1X9PA 2R063 4FPYA 4ARXA 1DQ2A 4JVAA 4WV8A 3OGJA 2W68A 3TNPB 1LGNA 3WD5A 1TG7A 2AEYA 1ND2C 1L7QA 3BUCA 1S0DA 2JICA 1AL22 3H8RA 2BV4A 1SDWA 1GZWA 4A2UA 4KL1A 4QM9A 4FPFA 1RC6A 3CMGA 1L3JA 1SEFA 2JKBA 1FXZA 5EYXA 1CAVB 4PIZA 1UXZA 3WLUA 1BBT2 2XGXA 5F5IA 3ZYFA 1BEV2 5CFDC 1FATA 1V6IA 4Y5SA 4DY5A 3KVAA 1JYNA 1O3RA 5HCFA 2D7FA 3U37A 4FOVA 4A41A 2RS31 3POGA 3SEEA 3WSOA 1ST8A 1W05A 3PURA 5FZKA 3MUY1 3CIHA 3O1MA 2W87A 3OF1A 3ZX7A 1FV3A 5LRSA 1VALA 5IVEA 4OZXA 2ZGQA 3U10A 1DGRA 3AKSA 4JHZA 2HLEA 1C8M1 1F15A 1ULOA 4S2DA 1G9DA 1ALYA 4GD4A 4W6YA 4IETA 4MX3A 3PDQA 2ETEA 3RRDA 4AFCA 1AR62 2I07B 1QKQA 2VUJA 1NCQA 5A6XA 4AGRA 1TE1B 3J8F3 2PHRA 1PGW2 1SFNA 1D4M3 1VBC3 2B7YA 1LU2A 1JYIA 1YQ5A 4A3ZA 3KZ4C 3WNKA 4IV1A 2ILMA 3AP4A 4QXCA 4COZA 4GWNA 2EXHA 1F4HA 3BGAA 2IVJA 3HNMA 3NNLA 1H6XA 2W2IA 4IGQA 2VTXJ 4UYBA 3UKVA 1EV13 1ND3B 1Y7BA 1W2TA 1ULPA 2BZDA 2HYKA 2ZGMA 3ZFGB 4BQ2A 3PUQA 4OFGA 4FPOB 3DPRC 1NXD1 3LQCA 1OVSA 3NAPA 1H8VA 5FUNA 3GHNA 3WQ1A 2J1RA 2W5FA 3E6DA 3GALA 2QQLA 2BERA 4XBQA 5DZGA 3PVNA 2XBO2 4N43C 5FCCA 4YW2A 2AGSA 1RUJ3 1JHNA 1W9FA 1JZ4A 4BH9A 1XNCA 2Q8EA 4GMP3 3VLBB 3ORJA 2GMMA 4KGQA 3J7MA 3WW3A 5HI0A 2YMZA 1SLBA 1CONA 1WMDA 2VQ0A 4XMIA 1WLDA 3KT1A 4U2AA 1VBD3 2B39A 4Y5Z0 5JVVA 3A0KA 3RMXA 5A33B 3J8F1 5A6QA 4M0NA 1RUF1 2NZ9A 4MG2A 4Z2AA 1RVF1 1LEDA 3B93A 5LA9A 4YNIA 3LEIA 5FLHA 5M0TA 3TEYA 1JODA 1O5LA 2VNOA 4Q2FA 4ZS2A 2ES3A 1VB2A 3VD3A 4BK5A 5JMOA 4Q8KA 4HK9A 3ZYBA 1EV11 4W4ZA 4YW6A 4HETA 3K75B 1MEC1 1KD7A 4QX7A 5H9SA 1HN0A 2VOKA 1YJLA 2VMDA 3TAYA 5FP9A 4OMCA 5FK8A 4YWAA 4YW7A 3AKTA 1ASJ1 1JZ7A 5FZ6A 3MZHA 3OPTA 4IV3C 2VCBA 4GXLA 5DAWA 2E7TA 2FDKA 3ES4A 1RITA 4Y26A 2VGDA 2EF6A 1QH7A 1HJFA 1BJQA 1V00A 2O8QA 4ORFA 3ABZA 4DUVA 1MVQA 3ZPOA 1SDDB 3KHBA 3MV11 5L9RA 2RHPA 1LOAA 1G6NA 1UZ0A 1VE0A 4BOWA 3I2FA 4CU7A 2A7AA 2GC1A 3AYDA 4C1WA 5D8AB 1QJU3 2FCVA 2R7EB 4OVEA 5IVFA 4KG0A 5DAPA 4CCMA 4QPYA 1NUKA 1GNYA 1T2XA 2E6VA 2R062 3SQOA 3IM0A 1ZZBA 3POYA 3RMYA 1UOFA 3AP7A 2OYZA 5KHHA 2VY0A 5FYBA 3VKOA 3H8XA 3CJIB 3IIIA 4XDPA 1XYNA 1IS5A 3WP6A 4CDWC 5DZFA 1KFXL 1N1YA 4PF1A 1IOAA 1HKDA 3S5AA 5FLIA 2BTVC 3AK0A 2OX0A 3SMHA 4FFHA 5I8YA 3OUJA 1AYM3 2ZABA 3A21A 2AR6A 4JGZA 1HJGA 2CDPA 4YGEA 5CG8A 4AXOA 2Q5TA 5EQUA 3K2OA 4P9WA 2QDRA 3K51A 3N9QA 5JOZA 5F3CA 4H2AA 1CIWA 1WBFA 3ZFFA 4P9JA 1UOJA 4PHZA 2XVLA 1PVC3 1N1TA 3GF6A 3FX3A 2VBBA 5A3WA 4AFMA 2PHWA 3PVEA 4BA6A 2CGPA 1AR63 2JDYA 3AP9A 4MOAA 2QQIA 3VBSC 1AYM1 2ZKLA 3H7JA 3RVHA 1UY0A 4I01A 5C71A 2ZZJA 1O4TA 1SQ4A 4HPKA 1W90A 2R49A 2HJIA 1G8WA 1Q43A 1WCKA 3AJYA 1DYKA 3GZAA 4MGKE 2CWMA 5FO9B 4LBJA 2DVDA 3O0VA 2G1MA 2VZ1A 5APAA 3VBUB 4Y4RA 5FZHA 3AL5A 4MGQA 5AVPA 3ZN5A 3NSTA 3JUUA 4XEZA 1CAXA 4LEJA 4M4PA 5CKQA 3WNNA 1FT9A 2ADEA 5EV7A 4CEWA 1W03A 4D69A 3WW2A 2WWSA 3ZXLA 1UYXA 2XWBB 4FVVA 5LEJA 3GJBA 5FMOL 5IK5A 4LO5B 4XAAA 2A3YA 2WZ8A 3WG2A 1U5ZA 5DDJ1 4FPHA 4M3CF 2V72A 4DZGA 5C8CB 1O3TA 4XQDA 1X33A 1BMV1 1XRUA 2XKOA 3FLTA 1H9WA 3FUQA 3WHTA 1S55A 3AMPA 4P00B 4RQPC 2PYTA 5JI9A 1SLAA 1OPOA 3DEMA 1LHVA 3VZJA 4QGLA 1ACCA 3DXUA 3TN93 5A80A 3OTFA 3QLQA 1Y9MA 1Y9GA 2EA7A 2VVEA 2XVGA 4J25A 4PLNA 4QPIC 2UWAA 5I0UA 3ZFEC 2ZX3A 5CIRA 4H7MA 5T54A 1TMF2 2FDIA 1QJEA 4HBNA 5CADA 1WCQA 1GR3A 2R041 2Q0AA 3PUAA 5AVAA 3UGHA 1TQ5A 3KB5A 3TEWA 2WNOA 1D0HA 2ZACA 1AXYA 3BI3A 4BDVB 4QKFA 4C1XA 3GZTB 1CPNA 2RMU1 5CYYA 3AMHA 2NMOA 4K6BA 3PU3A 4Q4W3 1PO22 1OD3A 2DCYA 1GWKA 2Q1MA 2DCTA 3HIFA 5FP4A 4CA9A 3GCWA 4RHV1 4BE3A 2JDNA 1CAUA 4GA9A 5I8TA 3GJAA 3VBSB 3AZXA 1U12A 1PX3A 2VQUA 4LHNA 3URFA 2YBKA 1BMV2 4JKLA 3T2QA 5K0UC 2JE9A 3FBYA 1JI6A 1UCXA 3RJ2X 1MEC3 5A70A 3AXDA 3LEGA 1RJ8A 5FKBA 1W8FA 4AI8A 3ECQA 4LBMA 1XNAA 4PDWB 3VKLA 3NAPC 5K4LA 1IPKA 3FMGA 5C3SA 5JLVA 4CDWB 1VAVA 4AYUA 1JYVA 2JWPA 1BHGA 2XMLA 3HVDA 4XFAA 4EWEA 1S1AA 2UY9A 4K3UA 1PVXA 3AXEA 4HKLA 4P02B 3HBZA 5F3IA 3I2JA 2GDFA 2GMPA 3HAGA 3NNJA 3HQXA 4JZRA 5C8CC 3L2HA 1LOEA 4TLGA 1OD5A 1AYM2 1QXPA 1FPN2 3LGRA 4CXYA 4QX3A 3H3LA 1IG3A 4N9HA 2TNFA 2YBPA 2ZHNA 4HN0A 2WFPA 3B69A 2W1SA 2G19A 4HXCA 4XJWA 2BU9A 4SLIA 1GWMA 1OQ1A 5B4XA 2JIJA 4Q1PA 2W52A 1VBE1 3I2HA 1UF2C 4EWDA 1OPMA 5EHDA 2UY8A 5FQ0A 5F3EA 2JD9A 4N7UA 5A1AA 4XTPA 3DCQA 2FQPA 2XHNA 4CDQC 4C90A 1BKZA 3M2MA 4E2QA 4XJUA 2ZGUA 1UD1A 3T4VA 1VAKA 4BCUA 1BBT1 3M3QA 3HEIA 1W06A 1AXKA 5KC5A 1SCSA 2C26A 2RE9A 3ZSLA 4NIHA 5KHIA 1IQAA 1HRV2 3EXUA 3ZPYA 2YXSA 5FYVA 1D0GA 3DV8A 4ATEA 3MO4A 2XWJB 5E16A 2GU9A 2OT7A 1FX5A 4CUGA 2ADDA 5LRRA 4XHBA 5LBCA 5FXZA 3ZN6A 1MS5A 1RXFA 2IZWA 1XE7A 3HNYM 3VBRC 1E5RA 2VD7A 4M01A 1BEV3 4R4XA 4B4PA 2K9ZA 2ZXQA 3RS6A 3VGIA 1GQHA 2VZPA 1OOPB 1PM7A 4GAZA 3APBA 2MPFA 2PN5A 5FZLA 1CJDA 4RN5A 5K0UA 3W58A 2HWF2 4ZS3A 3KWVA 1JS9A 3W20A 1NLQA 4ZXKA 4ITCA 5IW0A 1W6OA 3NJVA 4QKBA 1Q8OA 4OUSA 1MS4A 3LD8A 5FO8B 3AZVA 2D3RA 4QQLA 4X6RB 2XBO3 3N4MA 1OSGA 2VECA 2HEYF 4QXHA 2WFF1 4QQ2A 2FMYA 5DG2A 1MS9A 4LITA 4AHYA 2WO3A 3WNPA 1Q3EA 4UF0B 4XFBA 4N8MA 4XZPA 3O1PA 4HONA 5BNOC 4XFHA 1QEXA 4AQSA 1D7PM 3DGTA 2C0ZA 4LA3A 1LHWA 3VHRA 2E33A 5FZOA 1RTVA 4HKOA 5FY9A 5FR3A 5F2SA 4R8HA 3BTZA 1CN1A 3NKTA 1I5PA 2HWD1 1W3XA 2WC2A 2BPA2 4AQTA 4XFCA 1JN2P 3JD71 4Q4Y3 3IPVB 1YFWA 5FZIA 4OQ8A 4BQ5A 4B3NA 1UWWA 3LCPA 5C7GA 1JW6A 3B3QE 3NWKA 1LHNA 1N47A 1JU3A 1X50A 4FCAA 4FFGA 4DOUA 4EYUA 4YZ5A 5C3OA 3H0OA 4I09A 5DAVA 1QQP1 4FPLA 4WM7C 4AGGA 2OW4A 4B4QA 2JDMA 2A6XA 2IUWA 4YVWA 3HT1A 3RZKA 3WW4A 1UO9A 2RM22 3E5XA 4M3CE 5IVJA 1ZX5A 5KHGA 4AOCA 3FWEA 4QXBA 1GFF2 1X82A 2VR4A 4JRAA 4K7JA 3UJOA 5CFCC 2JECA 2LALA 1UU6A 4L97A 4A6OA 1LECA 3WDVA 3AL6A 4LKSA 2D3PA 3BALA 2XG3A 1PO23 3AP5A 1R091 5C5UA 4GH4B 2VZOA 1AXZA 4G9SB 4MYEA 3H1WA 2ZGTA 4XFFA 3S0MA 3IMNA 2E7AA 3PVBB 4NHKA 2WNUB 1DGRN 4I0AA 1JTZX 4QDSA 4ZU5A 3UKTA 5A3UA 1ZZ6A 4LBLA 1UY4A 1A8MA 5IWFA 3LB9A 2RDSA 1PM4A 2ZEYA 4PIYA 5F3GA 5FY7A 1W6QA 3SH4A 3VBRA 3WNXA 1PMHX 2ZBJA 3PHMA 4CEYC 4D6RA 5GZDA 3VHPA 2VTFA 4DINB 3N9PA 5IHRA 1MQTC 1N1VA 2X5IB 3LAGA 2Y6LA 2WAAA 4OMDA 1WLTA 1OF4A 1QJFA 2Y0IA 2RS52 2ARBA 5A7PA 1Q8SA 3MFAA 4ZKTB 4AW7A 5FYUA 1OLME 3VB9A 4LO6B 5A7SA 3N9LA 5DN2A 3T1MA 5A3LA 4AQ2A 4Q4Y1 1J84A 2XR4A 2DTYA 1URXA 2R072 3BB6A 3RZGA 3N9OA 2WLQA 1OA3A 2OQ6A 5EYYA 5FXXA 4XURA 5C9AA 3RWKX 5J3UA 1ZRIA 4LR4A 4BLJA 2WUHA 4AGVA 4I2OA 4URAA 1DZQA 4OI4A 1VRH2 2J1EA 4KG8A 4WVWA 5DQ0A 3WG3A 2ZA9A 3WDXA 4CE8A 3CO2A 2R0FA 2VZUA 3ZMOA 2DU0A 3GXUA 5C8CA 4LT5A 4IV1B 1MZ5A 1ENRA 3Q8CA 2YG0A 1VB4A 1POV1 4RHV2 1WW4A 2P17A 1OOPA 1C5IA 1R1A1 2JB8A 2XLGA 2XJSA 3R0RA 4LLOA 4P14A 3VUOA 1IZ3A 3IDBB 1NYWA 3H3UA 4CCCA 1XNTA 5DAXA 2FMDA 4COYA 3S30A 1HRI3 3T0DA 4AFAA 1ODNA 3LF7A 3VKNA 2PQSA 5HV4A 1LCLA 3LA7A 1W9TA 5BUVA 5LCWL 1Q8VA 2XDVA 4FTEA 3LFMA 1RB8G 1CZTA 3SC7X 2VAUA 1JU4A 5F5QA 5FY8A 2WZPP 2ZX1A 3UYJA 4BMBA 3JB8A 1YFYA 2K0GA 2XUEA 3OB8A 5IVYA 4BQWA 4W6XA 3X29B 2VUAA 3JD73 4YVWB 3V0BB 4COVA 5I0RA 1WW7A 4UF0A 4LJHA 1JZ3A 1Z78A 1JOBA 3PJQA 1PMIA 1C1FA 3ZXAC 2HWB2 2A6VA 1U5IA 2XXZA 2EAKA 2YGMA 5K9YA 4DIQA 4C0HA 4MGSA 5I93A 3OYWA 1OHFA 4LUMA 3VZOA 3LEKA 2XJTA 1NE6A 1H4HA 1YXWA 1RMU3 2D5HA 2C24A 4D94A 1VR3A 2BWCA 3D4KA 2BFUS 1NZIA 5E8AA 2A1XA 3I4IA 3ILNA 2P34A 1TVGA 1S0CA 4DUWA 1TEIA 3DKWA 3PIGA 1AHSA 2AENA 5LBEA 3NV4A 4QAWA 5FZ8A 3VZNA 1U5YA 3DECA 5JIUA 4CZSA 3ZXGA 4L92A 4CEYA 1RUE1 3T2PA 4DB5A 1QGLA 4A45A 5LK5A 4CPBD 1PIV1 4MV2A 5J37A 4OUEA 4XILA 3THTA 2ENRA 3NVCA 2GN7A 2YYOA 5JSPA 3LKJA 3AVSA 1Y9QA 2ZGNA 4Y1XA 4YW5A 1LGCA 2VNGA 3K3NA 4LTAA 5SV5A 2GP5A 5JWPA 2WZR2 3SKVA 5FWEA 1MEC2 4A6SA 2IFRA 2PQQA 3KCCA 5SV8A 5FMBA 4MUVA 1BZWA 4P5HA 4MADA 4E8CA 3M70A 3HN1A 3IMMA 1O7FA 2WNVB 4C8DA 1QQP3 5ANNA 4ZZ8A 3DL3A 3QOPA 1W6PB 4DO0A 5BPXA 3S5QA 1LOFC 3CJIA 5CZKA 4JKKA 2GC2A 1UOGA 2EIDA 2WBKA 1AZDA 2XVKA 2FHRA 4KH9A 1A34A 5F37A 3ME2A 2WQ8A 1AJOA 1IS4A 2HH9A 3HR9A 3ZIXA 4L9BA 1W8NA 4BWOA 5GLWA 1H8TC 1JMUB 3RFRA 2SBAA 3KV4A 1J58A 3B94A 5T5OA 1GQGA 4BM8A 5ABJC 5F9TA 3ACGA 3E97A 3D0JA 1JOJA 4QMAA 1C28A 5GLZA 3I3EA 4ZZ5A 1OC1A 5LASA 3MBWA 4CCEA 2CV6A 2JDPA 1ASJ2 2BGCA 4LQRA 3DPRB 5DAQA 3IDAA 3BTXA 4DPNA 1ASJ3 2JG8A 4W6WA 4OI1A 2VH9A 4MH0E 3QBQA 3WP4A 3RGBA 1CZSA 3GHMA 2BW8A 4PF5A 4O65A 1RUJ1 4H55A 1FMD3 3HQUA 3ZYRA 2DCJA 1S2KA 1XNBA 1UW8A 2QZ2A 4HMZA 1Z7S3 1KS4A 3JBG2 5LEKA 1J1TA 2VW0A 4WZCA 4TN7A 4M00A 2RJKA 3IAQA 1APNA 4UW4A 3WCSA 4B1MA 3LDKA 2RJLA 3O12A 5FZAA 2KXLA 3T1LA 5IK7A 3HWJA 1AR83 4GKYA 5DZEA 2F4PA 4GKXA 2GALA 1COV1 2W9XA 1H1IA 2CDOA 4IEZA 3QH7A 1S0IA 5BNPC 1B35C 4Z82A 3TBDA 4W65A 4XQ4A 1ND3A 3ZFGA 1DGWX 5E88A 5FUIA 4EN9B 4MGTA 3UKNA 3L2YA 4X6QB 2P3IA 1RUF2 2YBSA 3I3BA 2IXCA 2R1DA 3LDRA 2WKKA 4Q4W2 5FP7A 5FOJB 1GSLA 3EQEA 4IGOA 2D43A 1BXHA 1RUD2 3MV01 4LORA 3HOBA 2ZPXA 4YGBA 4TYSA 3M4FA 1G86A 1K12A 1ZVFA 4CCNA 2WABA 2CL2A 3VBOB 2WSVA 4MGZE 3M3IA 4B7KA 4QX8A 1ZA7A 4GJZA 4LBOA 1FI2A 2WINB 4UBHA 4BHPA 4QPGB 1HB1A 3NNGA 2WL1A 4IGPA 4CEWC 3K48A 1B35A 3EB7A 3MICA 2DU1A 4HLTA 2WFF2 1PK6C 1FYUA 3OBTA 2WNVA 2X53S 4FAHA 2P3JA 1RUG3 2RG4A 3OY8A 2ERFA 4IEOA 2JX9A 3WCRA 2PAKA 4UW3A 4AAPA 4WM7A 2DF7A 1HDKA
chains in the Genus database with same CATH topology
4INDA 2WS93 3SH3A 1NCRA 4FBFA 4QXKA 3V65A 2JDZA 1VBC2 1QMJA 2VMIA 3JBG1 2G4IA 1RHI1 3M3OA 2ZX2A 2HWF3 1VJ2A 4FXKB 3OY8B 3INAA 4RL7A 1REDA 4QPIB 1PZ8A 4WM8B 1G9BA 1W39A 4S2FA 1Q8QA 4IEWA 4ZU7A 1BCXA 4CDQA 5T5PA 1RUOA 3ATGA 4TLFA 1LESA 1PO12 1TME1 1ZYBA 5CU1A 4CP1A 2FZ1A 2DUOA 3WOGA 4BYYA 1EY2A 1A6CA 1GZWB 1RUE3 2C1FA 2JXAA 2RS32 1O3QA 1R081 1YLLA 1KJRA 2PFWA 5AC92 1ZZ9A 1LOGA 4Q0QA 1V6MA 1YNAA 1V6NA 4S2GA 4WM8A 3AP6A 5DDJ2 2GZWA 3ZXJA 5A3LA 3OPZA 3QCWA 3FHIB 1KRIA 2PLV3 3VBFA 3FJSA 2RS51 3I59A 1AR73 1ND3C 2X5IA 3AKRA 2XLAA 3I2DA 4ZU4A 3ZFGC 2DVAA 5BNPA 1IS6A 1R1A2 5KXCA 1RL3A 1RUH1 3AMQA 3MIEA 5IK4A 1LJ7A 1RJ7A 2XJRA 4NOTA 2IXJA 1COV2 1ULFA 4OI2A 1CPMA 4XPVA 5KWRA 1ND2B 1W6NB 4OHXA 1AR93 3N35A 1GNHA 4Y1ZA 3R05A 1ZM1A 4KU7A 1ZBA1 1NY72 4IV3A 3SCFA 2GNTA 1PO21 3W59A 4KWLA 1N3PA 2QKDA 4QPGA 1QHDA 4RQPB 2YGLA 1VBE2 4YGCA 2DFCA 5HBAA 3T2TA 1S0FA 2R043 2RM21 4FP2A 3VBHC 4WM7B 3RI8A 3A4UA 3ZIWA 4URTA 2HWC3 4I02A 4R9AA 1DQ6A 4MGIE 1QJU1 2NQYA 4PBPA 1PGSA 2P2KA 2HWC1 4FPKA 1Y43B 4CDWA 2JG9C 4ISQA 1GBGA 3AYEA 4X8PA 3ETQA 3IWZA 3KQRA 1PGL1 3IBMA 1H8TA 2ZMKA 1NZCA 3MDPA 2WQ4A 3JZVA 5DUWA 3C3VA 1LENA 3DN7A 3GBGA 2ET7A 3VBOA 5JPMB 5K0UB 3KD4A 3TOJA 4YRDA 2HWD3 3ZXEA 2IFWA 1HXS1 4BIFA 2IXHA 4AI2A 3S7IA 4Q4Y2 4E4DX 4XBLA 1F9KA 1OLRA 3OJBA 3D6EA 4NN0A 3AYCA 3WZ1A 1EAH3 4IV1C 5T55A 5D1IA 1OKQA 1ZBE3 4IQPA 1Z0HA 4WM8C 4TSVA 4Y22B 2DV9A 4RGGA 4I0WB 1ZBE1 2CGOA 4LO8A 3P3PA 1QDOA 2ZMLA 4RS5C 3RQ0A 4J1XA 4GB31 1RUH3 3B5LB 4AE2A 3WX5A 4Y1YA 4RR3B 3J26N 5KHKA 4Q4X1 5A32B 4G4FA 2JG9B 4EN7B 4YYOA 4MGYE 2UYAA 1OI6A 3ZYGA 5DXDA 4YM0A 4BMEA 1R1ZA 4RSUA 4UXAA 1AYN2 4QX5A 1H4GA 3NKGA 4COUA 2NP0A 3MIDA 4AEDB 5AC93 2WNUC 3SXWA 2JJ6A 2CY6A 3QACA 5BNOB 4FPJA 4F3JA 3LSEA 2ATFA 3VBUC 1EPZA 1D4M1 4M0HA 3DF0A 4CRQA 4EN0A 1RHI2 3WVJA 2H0VA 5JAXA 4HL0A 1N3QA 4CDQB 4K20A 2K2SA 2WZR1 4N53A 3LSDA 3RPQA 1TNRA 2Q4SA 2A3XA 3UV9A 4BIOA 1UU4A 2A73B 3ZSKA 5H9PA 1SFYA 1NQJA 3HMYA 3U07A 1H0BA 2G9GA 1PVC2 4HANA 3SLIA 2Y38A 4OUMA 4DNYA 4YZ1A 1ZRFA 4ES9A 1SBDA 3VBOC 2E63A 4GALA 1BVVA 2RS53 4NR1A 4DS0A 5AC91 2BNNA 2W0XA 4FQZA 5HXVA 3B01A 2BWAA 4GMP0 1GYKA 4PLOA 4AEDC 5DUVA 2ZGSA 4V1PA 3KT4A 3MLLA 3VN4A 2DUPA 5K7PA 1AR72 4YVSC 5CNAA 1DZTA 4BPZA 4Q4V2 3CLPA 3B7MA 1ULGA 1BEV1 4HVRA 4R9DA 3VL9A 5GLTA 1TNFA 2E7QA 5L73A 4YVSB 1RUD1 2CWSA 2B46X 5KXBA 2VXRA 4Q29A 3W9AA 3N7JA 3M7AA 3RNSA 1MQTA 3SITA 4AHXA 1RGSA 3WG1A 4C0BA 2AYHA 2ZGRA 5FTTC 4N43B 2N7GA 4NHLA 1CJPA 4JDNA 3DUIA 2PHXA 3MYXA 1YO8A 1ULEA 1YUDA 4AVAA 1DQ0A 2AZ5A 5JOYA 2Q1ZB 4FPGA 3KSCA 1NA1B 4YVSA 2WZR3 5KXDA 5GZEA 1HX6A 2RS13 1LOBA 2IC1A 4FOQA 1R093 4AEJA 1HRI1 2GC3A 2PELA 2IXKA 1QDCA 1JUHA 3B02A 3SNMA 1QU0A 1K5MB 1A78A 1V70A 1VBE3 4LBQD 3ZSJA 2Z79A 2DVFA 3THPA 5JPNB 1G7YA 1ZREA 4F83A 4MXVA 3VL8A 1RUC3 5I0TA 4KQ7A 2QFEA 1RMU2 1QOTA 4IERA 4YGDA 1S0JA 3MFCA 4Q0VA 4Z92B 1VBD2 3TNQA 3MW3A 2OA2A 3AMMA 2XJUA 1QJX3 2V09A 1YWKA 4WVMA 4Y22A 2ZGOA 4O9EA 2XBO1 1DYPA 3TYJA 1KJLA 4YW3A 1AUYA 1I5ZA 3WDUA 3PMSA 4LUKA 1WUVA 4YSFA 4XJ8A 4DRRA 2EALA 1VAMA 5FPXA 3D8CA 1H2KA 3KT7A 3PTYA 4WVMB 3ZO0B 1ULCA 1UL9A 1H2LA 1H30A 3BTAA 1AR81 3ELNA 3VDDC 4HSJA 1JUIA 4GMP1 2ZKNA 3LA3A 4OHZA 4AHWA 1LU1A 1RUD3 2CAUA 2YUEA 4B8EA 4BQ1A 2HEWF 3N7LA 2OVUA 2VMGA 2XH6A 2UWCA 5FDBA 2Z42A 4CDUC 2VW1A 5IT6A 2QE3A 1NLSA 5J36A 1HIXA 1QJX1 1PK6A 1PHMA 1WLWA 4YZ2A 2R071 1LHUA 1DDLA 2HWC2 1QF3A 4GULA 3O0XA 3SCGA 5FOBB 2AREA 2PA7A 3MW2A 3UL2A 2E51A 4DRVA 2OZJA 2LUWA 3GBFA 1C1LA 1VP6A 1NA1A 3TWIA 3MIHA 4B7EA 1O4ZA 3MF6A 2D5FA 5JI7A 1MZ6A 5AFEA 1LOFA 3CJIC 1WD3A 4JV4A 1NY71 4CDUA 5CB7A 4NWWA 4XETA 1AF9A 1MS3A 3RYRA 4QT6A 1ZA4A 1IHMA 1U0AA 2ZGPA 3AFKA 3TB0A 1CVNA 1C8M3 1CESA 1HQWA 1UPIA 5J98B 3ILFA 4I3PA 2VOVA 2PTMA 4TWTA 1DQ1A 2ZAAA 4M3CA 2CYFA 1FOD1 4WZFA 1I9RA 5CG9A 1R1A3 3AZYA 3ZFEB 1NG0A 1NCRC 3H8UA 3I54A 2XJQA 1RUF3 3GYDA 1YIPA 2XPJA 1J3QA 2Q8OA 1QQP2 1CAWB 3LZZA 3S7EA 1W0OA 5D8AA 1X8MA 2D3SA 2JD4A 1K5MA 5C4WC 3NJZA 3WQ7A 3NL1A 4RGAA 4PBOA 1QXJA 3FC0A 1NLRA 5T3NA 4A7KA 4WBBA 2ARXA 1VBD1 4AHZA 4P9LA 2DVBA 1I1EA 1RUI2 1AL0G 5A32A 2EIGA 1G9CA 1VBC1 1V9U3 2O1QA 2W08A 3GBWA 5GZFA 2QNKA 3WXPA 4JC1A 2A70A 4JCKA 5F6LB 3VDDB 1C5HA 1QOOA 2MEV3 3ACLA 1ZNPA 1QJX2 2EAAA 2MEV2 4AEKA 4HN1A 2CGNA 4Z8BA 3TN91 1KS5A 3RG0A 1DLLA 3RDIA 5T50A 4S2HA 1EP0A 1AX1A 1LODA 4A7YA 2VG9A 1XYPA 3NO8A 3H3ZA 1FV2A 5BNOA 2WNUA 3MPBA 2D40A 3WY6A 3FLPA 1ND2A 4IEVA 1UPSA 1EV12 3ZXDA 4YLZA 3FBMA 1YYNA 1S0EA 3ZSEA 5GJ6A 4I0BA 2YDEA 4D7SA 5C33A 2ZS6B 2E53A 1X8EA 1RVF2 1RUI1 4FO9A 3E5UA 1DGLA 3M3CA 3O14A 5ABJA 1LOCA 2BUKA 3LA2A 2MNGA 1XXNA 4AVCA 4E9KA 3WHUA 4XDQA 3AKQA 2JEMA 2R30A 2MEV1 2D97A 2DYCA 4OI0A 1PNGA 1AYN3 2GAUA 2ZX4A 3ZXFA 1GZCA 1KFUL 1ZBA2 5GZGA 4JDOA 3OBRA 1G9AA 1ZRCA 5E1RA 2R073 2PHLA 5JCTA 4EN8B 2WLPA 3EBRA 1C8M2 1DBNA 4XXPA 2WT2A 5FPZA 5FO7B 1Z7S1 1ZRDA 1CAXB 4PCRA 4K8FA 3WDTA 2QQPA 1AR71 4D7TA 2BEOA 2O0OA 4NVPA 4IESA 1MACA 2NMNA 1CAUB 1EAH2 4Z2WA 2ZHMA 4YM2A 3MIFA 3IT8A 5TSWA 1H2MA 1PZ9A 4ASMB 4Y4YA 3WW1A 3OD0A 4K9SA 2NPIA 2XHKA 4XF1A 1DQ5A 4FP3A 4YM3A 1H1MA 4MXWA 4E2SA 4JQRA 5C4WB 2VVFA 3VHNA 2PAMA 4Q1RA 1X36A 1WCDJ 3L9JT 3AM2A 1WA4A 3EJKA 2EVXA 1HQNA 1Q56A 2GMEA 4CTEA 3G7DA 1HRV1 4A3XA 2HWE1 3BPZA 5FAXA 2R6QA 2VOWA 1AR91 1NA1C 4QPIA 4PDWC 5T5JA 4RR3C 3VKMA 4FT8A 4MXWB 1JBCA 1B35B 1SMVA 5F1RA 4GB32 3C2UA 3E6CC 4K21A 2WT1A 3M8LA 2ZOEB 1REEA 1DIWA 2GC0A 3POSA 3AKPA 1QJY3 1KXGA 5ACA1 1O4YA 2R042 4N53C 4B4RA 1OOPC 4XF0A 2WSUA 5IUQA 4RR3A 1GNZA 3ZMNA 1V6OA 5BNNC 2DFBA 1UMZA 5JOWA 1H2NA 1KDKA 4DY3A 3WP3A 1BK1A 1QOSA 3MIGA 2NM1A 2I74A 4K40A 3AZZA 3CF6E 4FPCA 1V9U1 4AEMA 1VBA1 2BYVE 3ZFFB 4AWDA 3WV6A 1TME3 3N3HA 4L99A 1JYCA 5GLUA 5JIAA 2IXLA 1KQRA 4Q26A 2ZGLA 3VDDA 1RUC2 2PLV2 4XOGA 4QQHA 4Q4W1 1XU1A 1NQDA 1EYBA 5EJ3A 4CP0A 4COWA 1D4VB 3J9SA 1Y3TA 4NO4A 3H9AA 1J3RA 1RHI3 3MIBA 4MZUA 4UW5A 2YC0A 2E9QA 3KCXA 1R092 4FAGA 5IK8A 3BOPA 4XF3A 4NHMA 4RS5B 2CTVA 4Y1VA 1HLCA 1BQPA 1S2BA 3FFQA 3NV2A 3I59B 1JH5A 1QJZA 4RHV3 4QD2A 2V5YA 2RM23 3FZ3A 3SHRA 5C9AB 3SISA 5JMCA 1NE4A 4JGYA 1OFNA 1O5UA 1F5FA 1LEMA 4BLIA 3ZVXA 1IPJA 1CD3G 2WJSA 5FFOC 2NN8A 1DQ4A 2BVVA 4RFT0 3VBUA 1M06G 1SLIA 5T52A 3V0AB 2Z5WA 1HXS3 5BNQA 2Q30A 2XB6C 2I2SA 4LBQA 1XQNA 1PZ7A 4XYXA 4AF9A 2VOXA 3AMNA 1FPN3 1C8NA 1NCQC 1VBA2 1DZRA 4LE3A 4XJAA 4E2GA 3ZFFC 1MQTB 4HSLA 1GV9A 3NV3A 4HT1T 5KBFA 1LHOA 2A3WA 1V9U2 2QVSB 4CEYB 1MZFA 4KWJA 5GLVA 1UIJA 3SCHA 1V6KA 3VZMA 1VBB3 3WT3A 4R52A 2R0HA 4Q4X3 4XTMA 5ACA2 4AVTA 1J59A 4YARA 1ZRRA 1CR7A 2YV8A 5J09A 1MS1A 4Z1VA 3P3NA 2F6BA 1YCIA 5C6CA 1SCRA 3LOIA 3I8TA 4GB33 4MSVA 1QNYA 2ZJCA 4YG6A 5J7MA 4N43A 1VIWB 2OUJA 1FAYA 4GH4A 1DF0A 4LHLA 2XJPA 2VW2A 1PO11 2ZZQA 3PNAA 1WGPA 4KBBA 4TZDA 1RUC1 1OA4A 4LNVA 3VBRB 1MR5A 3V56A 4JRLA 4EJRA 4PLMA 3VHOA 3USUB 5F6KA 5J96B 2ZGKA 3U4XA 1W2UA 2GNBA 2X8KA 1UAIA 2IWGB 4HZFA 2VVDA 2VU9A 5BYNA 4FPEA 1TME2 3D0SA 2WS92 3RYKA 1QXRA 3B00A 3WUCA 3GZUC 5GKAC 2C9AA 4YG3A 5FRAA 4Y20B 2RR13 2ZHLA 3O0WA 5FQ0B 1F2NA 4GH4C 1J1LA 1RUG2 5C9AC 4Q27A 3NV1A 1XNDA 1ENSA 3MPPG 3B9IA 3VZLA 4K1ZA 4N90A 3NW4A 2D6PA 2HEVF 4LE4A 3LWCA 5CVRA 2LM3A 2Z2SB 5HCAA 5JZGC 2DUQA 4IEPA 5CFDA 1GICA 1W6MB 1V6JA 1PK6B 2DVGA 1W6PA 3POWA 4EV0A 4UBGA 1ZZ7A 4IEYA 4XIOA 1E57A 1JXNA 4YFWA 4AG4A 1GANA 3ALQA 1YJKA 4G3YC 2X29A 4MVTA 1UN1A 4Q0PA 4YM1A 3ST7A 4IEQA 3WP5A 1N3OA 4RS5A 1HQLA 5KXEA 3V0AA 1RVF3 3MW4A 4E27A 1IS3A 1OQEA 1WW5A 4HK8A 4Z07A 1XE8A 1D2QA 2KA3A 4XFGA 4QU2A 5GZCA 2GNMA 4YG0A 1W6OB 3JQXA 4EWAA 2NLRA 1PNFA 3A0NA 4P9XA 4JGYB 3HD8B 1GKBA 1I3HA 4IEXA 4N7IA 5D8AC 3KCYA 1H8TB 3M1HA 2EXJA 3N7KA 3ZSMA 2QJVA 2UURA 1DHKB 2CNAA 5EWSA 3ZYIB 4KNCA 3U11A 4LHKA 5JOXA 1V6LA 4QGMA 2VULA 5L7OA 1OA2A 3WQ0A 1FOD3 3N36A 4YW1A 1XNKA 2TEPA 4XFIA 3J4UH 4CYDA 1PGW1 3IPVA 1LKNA 4AVVA 1SLCA 1QJU2 3RI9A 4QPGC 1WBLA 2D6OX 3MGUA 4P9IA 2G9FA 2BFUL 5KC6A 1ZBE2 1W6QB 4R9BA 1UZYA 3RZZA 2BVBA 1WMFA 2VQAA 2P37A 1QH6A 1HW5A 4JDMA 1YIFA 4LULA 3RWNA 2DTWA 2MHFA 4AI0A 2YY1A 1SBFA 2RS33 4LO4B 2A5ZA 2B45X 2C5DA 3IDCB 2RR11 4QQOA 2GSYA 3D82A 4PJYA 3MEPA 1UKGA 5CFDB 1IGOA 2ZMNA 2WNEA 3B9CA 2BQPA 3UJQA 5BNPB 2BNMA 3ROUA 2OPKA 3ZDSA 5CFCA 2R32A 1KITA 1GLHA 3DPRA 2WT0A 4Y20A 3WINE 3D5OA 5CAZA 3CEWA 3IIAA 5J48A 4YW4A 1F8VA 2XJVA 3BIWE 2D44A 5AFBA 2UU8A 3AZWA 3KGZA 1H1AA 5L36A 3QH6A 4EN6B 3M3EA 3IN9A 2HWB3 4O9GA 4F7ZA 3IKWA 1Q8PA 1PIV2 4KGGA 4M3CB 1AYN1 4FQ4A 2XKPA 1EPWA 1PIV3 4AVSA 4LA2A 2RR12 4NPRA 3I7DA 1KDMA 1W6NA 1QJY2 4FTBA 3FE5A 2JENA 4Q4V1 2GH8A 1LR5A 3USSA 2IXIA 2VPVA 5L7OC 1RUG1 4JGZB 3JU9A 3ILRA 5C8WA 2TBVA 4OULA 1A8DA 5DDJ3 2OIIA 2JE7A 1ZZCA 3H7YA 4I30A 1R082 1YFXA 4XMAA 4XQWA 3VBFB 1OMIA 2WNVC 4BZ4A 1DGWA 3ZFEA 1SBEA 2QDNA 3QD6A 2B5HA 2HWB1 4FSJA 1S0BA 2ZAHA 4QM8A 4DMIA 4AFDA 4AI1A 2GN3A 1OQDA 1LTEA 4FOYA 5DG1A 4CDUB 3BU7A 1RINA 1ENXA 4NWVA 4CDXB 4Y24A 1LGBA 1AX0A 1F31A 5EXOA 2FZ2A 2Y0OA 2ET1A 5H9QA 2CAVA 4R4ZA 4XXAA 2GH2A 5EFUA 5T5LA 5A33A 4Q4V3 3KM5A 4CDXC 4PDWA 2UWBA 3JB4C 1UU5A 2D6MA 2DCKA 2D6NA 1YHFA 1UX6A 1H9PA 4AQ6A 5I0SA 2WA4A 2QZ3A 2A6ZA 4XBNA 1COV3 4FTSA 1FMD1 1BYHA 5C4WA 1CGPA 4OHWA 4HVQA 2H0BA 5KHJA 3VBSA 4D3WA 3KS7A 1RIRA 3V64A 1RUI3 3MI8A 4ISRA 1RMU1 2A6YA 3PMEA 3KGLA 5JSRA 1QJY1 5JDBA 3BOWA 3JCIA 2HWD2 3JQWA 3GNEA 1HV1A 3UK9A 2B9UA 4YFZA 1XU2A 3RJRA 4AK3A 4A7ZA 3J8F2 1AR82 1ONAA 2Z69A 3IDEA 4GQ7A 3FUOA 1S0GA 1FNZA 3VKFC 4AVBA 5L19A 3JBG3 2QUOA 2HWF1 4XJ9A 2ZCWA 4L8QA 5CBLA 5FLJA 4L2NA 1LB2A 1VRH3 4QHBA 3ZYPA 1HRV3 1LRHA 3KLSA 2QCSB 3ES1A 1Z7S2 1UZZA 4HFSA 2WS91 1YRZA 5BY5A 2EXIA 4KWKA 4FXGB 1YFUA 4IV3B 3MLKA 3AJZA 3MF9A 3O5SA 5I91A 3H1YA 4CEWB 4DFSA 2KM2A 1O3SA 2HWE3 1AL21 1C3HA 3WUDA 4U36A 1RUJ2 3VZKA 3R6SA 3VBHA 1VBA3 4F8AA 1QY4A 2WFF3 1MS0A 1AR61 2PHDA 4JTOA 3JD72 1K5MC 4OLLA 1SLTA 4Q0SA 2H6BA 3CU7A 3PJYA 4CP2A 4XHXA 1N1SA 2WQZC 2XL9A 1UIKA 3H50A 5CA6A 4XF4A 4Q0UA 1OFSA 1QWRA 4IL7A 4H14A 2P3KA 1WMEA 2ZTNA 4N53B 3EHKA 4XE9A 3ZXKA 1PVC1 5BXXA 2GNDA 5K8SA 1A3KA 4GWMA 1D4M2 3KMHA 4XF9A 2BBVA 2V73A 4ATFA 1NOVA 3R4SA 4LO7A 1AJKA 4EROA 4LLFA 4YZ4A 1AVBA 4E4SA 1RUE2 1LULA 2WA3A 2ZX0A 2SLIA 5ACA3 4XW3A 2PLV1 2YZ4A 4P9GA 4XIKA 3HT2A 1BVP1 1CAWA 2XLFA 2PHTA 2I45A 2TUNA 1REFA 3OCPA 5BV6A 1BBT3 4JTNA 4JGYC 3WR0A 2JG9A 4AI3A 5JSOA 1AL23 2XL7A 3WDWA 1VLNA 3TN92 5FMOS 4YVWC 1G9FA 1M4WA 4SBVA 5DUXA 1POV0 4LBNA 1OLQA 1CAVA 1MVEA 5A3MA 1B09A 3BCWA 4L11A 5JZGB 4META 1WLCA 4H3WA 4J6GA 2OUHA 4WVZA 4DXZA 2O8OA 1HRI2 5GALA 1VRH1 1ZBA3 5FREA 2XUMA 2YPJA 4C91A 4DQAA 1XYOA 3Q9OA 1YI7A 1HXS2 2DWRA 4X8NA 2D6KA 1TMF1 3MLJA 2R1BA 4PQ9A 2DURA 1NXMA 3S6PA 5EZWA 5HCBA 5BNNA 2PHFA 3ZN6B 2OZ6A 3WG4A 1CQ9A 3CL1A 3G6JB 2RS12 1PO13 4HKWA 4YZ3A 4JGZC 4ASLA 2VNRA 3RYPA 3PVOA 3CNAA 1VBB1 4AEDA 1MS8A 2ZHKA 4RA0A 4B29A 4K1YA 1R083 3E5QA 3H1MA 1EAH1 3NAPB 2W39A 4LBKA 1WW6A 4LBQB 4Q4X2 1MZEA 5ABJB 4UW6A 2JG8B 2A6WA 2R16A 4HPKB 2EXKA 3N7MA 4KU8A 5JR7B 3ZN4A 4J1WA 5LK7B 3VBHB 2VMHA 2NYYA 3SH5A 3CJXA 2FBEA 3R4UA 4RD7A 1TMF3 4MLOA 2RMU3 4P9YA 3BODA 1UKRA 1O91A 1POV3 4QQPA 1DFQA 4H7LA 4IXLA 1PGL2 1ENQA 2B42B 4IEUA 5E89A 1C4RA 4D7YA 3U0ZA 3LOBA 4HVOA 4ONUA 5GM0A 1W0PA 4I3GA 2AH2A 2HWE2 1FPN1 1IKQA 2RMU2 3FLRA 4E4ZA 1FNYA 3R4DB 1Q5OA 3V0BA 1RUNA 5H9RA 3AX4A 2HKXA 2Y26A 3PLQA 1WCSA 1I6XA 1SLLA 4Y1UA 1J3PA 3OGGA 1NCQB 2PAEA 5L7OB 1ULDA 1D2SA 4R9CA 4QGNA 2JG8C 4RQPA 1ZZ8A 4CDXA 1DU3D 3OD4A 5DUUA 1W6MA 1F5JA 3WDYA 5JZGA 1WD4A 2YHJA 3ENRA 2D6LX 2A75A 3O7OA 4ES8A 2H6CA 2R061 2D93A 4N9IA 1U5XA 3FFZA 2DCZA 3ASIA 1X7NA 1YI9A 5B2GB 2RS11 3AB0A 3E6BA 5FBZA 1FMD2 2WIIB 3AYAA 1T6GC 1GZ9A 4JAAA 4PIXA 2BNOA 1C57A 2X5IC 2A71A 5BNNB 1FOD2 1VBB2 3AFGA 1NCRB 3OYWB 1SACA 4WVVA 2AUYA 4AFBA 2D98A 2LTNA 4OHYA 4Q8LA 3USUA 5I8SA 1DG6A 2YROA 1AX2A 3EO6A 5CFCB 1AR92 3VV1A 4FOWA 1CX4A 1IKPA 2B8MA 3RSJA 2UYBA 2PHUA 4GIQA 1HV0A 4XJZA 1QNWA 1RUH2 3TRSB 2R063 4FPYA 1DQ2A 4JVAA 4WV8A 3OGJA 2W68A 3TNPB 1LGNA 3WD5A 1ND2C 1S0DA 2JICA 1AL22 1SDWA 1GZWA 4A2UA 4KL1A 4QM9A 4FPFA 1RC6A 5EYXA 1L3JA 1SEFA 2JKBA 1FXZA 3ZYJB 1CAVB 4PIZA 5CFDC 3WLUA 1BBT2 2XGXA 1BEV2 1FATA 1V6IA 4DY5A 1O3RA 5HCFA 2D7FA 4FOVA 2RS31 3OF1A 3ZX7A 1FV3A 5LRSA 1VALA 4OZXA 2ZGQA 3U10A 1DGRA 3AKSA 1G9DA 1C8M1 4S2DA 1ALYA 4W6YA 4IETA 4MX3A 4AFCA 2ETEA 3RRDA 1AR62 2I07B 1QKQA 2VUJA 1NCQA 4AGRA 1TE1B 3J8F3 2PHRA 1PGW2 1SFNA 1D4M3 1VBC3 2B7YA 1LU2A 1JYIA 3KZ4C 4IV1A 2ILMA 3AP4A 4COZA 4GWNA 2EXHA 4OHVA 3UKVA 1EV13 1ND3B 1Y7BA 2HYKA 2ZGMA 3ZFGB 4OFGA 4FPOB 3DPRC 1NXD1 3NAPA 1H8VA 3GHNA 3WQ1A 3E6DA 3GALA 4XBQA 5DZGA 3PVNA 2XBO2 4N43C 5FCCA 4YW2A 2AGSA 1RUJ3 1JHNA 4BH9A 1XNCA 3VLBB 4GMP3 2GMMA 4KGQA 3WW3A 5HI0A 2YMZA 1SLBA 1CONA 1WMDA 2VQ0A 4XMIA 1WLDA 3KT1A 4U2AA 1VBD3 2B39A 4Y5Z0 5JVVA 3A0KA 3RMXA 5A33B 3J8F1 4M0NA 1RUF1 2NZ9A 1RVF1 1LEDA 3B93A 4YNIA 5FLHA 1O5LA 2VNOA 4Q2FA 2ES3A 1VB2A 4Q8KA 4HK9A 1EV11 4HETA 1MEC1 1KD7A 5H9SA 2VOKA 1YJLA 3TAYA 3AKTA 1ASJ1 3MZHA 4IV3C 4GXLA 2E7TA 3ES4A 1RITA 4Y26A 2VGDA 2EF6A 1QH7A 2O8QA 1BJQA 1V00A 4ORFA 1MVQA 2RHPA 1LOAA 1G6NA 4BOWA 2A7AA 2GC1A 3AYDA 4C1WA 5D8AB 1QJU3 4OVEA 4KG0A 4QPYA 2E6VA 2R062 3IM0A 1ZZBA 3POYA 3RMYA 2OYZA 3AP7A 5KHHA 2VY0A 3VKOA 3CJIB 1XYNA 1IS5A 3WP6A 4CDWC 5DZFA 1KFXL 1N1YA 1IOAA 1HKDA 5FLIA 2BTVC 3AK0A 3SMHA 5I8YA 1AYM3 2ZABA 2AR6A 4JGZA 4YGEA 5CG8A 4AXOA 2Q5TA 4P9WA 2QDRA 3K51A 5JOZA 1CIWA 1WBFA 3ZFFA 4P9JA 2XVLA 1PVC3 1N1TA 3GF6A 3FX3A 2PHWA 3PVEA 4BA6A 2CGPA 1AR63 3AP9A 3VBSC 1AYM1 2ZKLA 3H7JA 4I01A 2ZZJA 1O4TA 1SQ4A 4HPKA 2R49A 2HJIA 1G8WA 1Q43A 1WCKA 3AJYA 1DYKA 3GZAA 4MGKE 2CWMA 5FO9B 4LBJA 2DVDA 3O0VA 3VBUB 3ZN5A 5AVPA 3NSTA 3JUUA 4XEZA 1CAXA 4LEJA 1FT9A 5EV7A 4CEWA 4D69A 3WW2A 2WWSA 3ZXLA 4FVVA 2XWBB 5LEJA 5FMOL 5IK5A 4LO5B 2A3YA 3WG2A 1U5ZA 5DDJ1 4FPHA 4M3CF 4DZGA 5C8CB 1O3TA 4XQDA 1X33A 1BMV1 1XRUA 2XKOA 3FLTA 1H9WA 3FUQA 3WHTA 1S55A 3AMPA 5JI9A 4RQPC 2PYTA 1SLAA 1OPOA 1LHVA 3VZJA 4QGLA 3TN93 3OTFA 3QLQA 2EA7A 2VVEA 2XVGA 4PLNA 4QPIC 2UWAA 5I0UA 3ZFEC 2ZX3A 5CIRA 4H7MA 5T54A 1TMF2 4HBNA 5CADA 1GR3A 2R041 2Q0AA 5AVAA 1TQ5A 3KB5A 1D0HA 2ZACA 1AXYA 4C1XA