4JQRA

Crystal structure of a duf4465 family protein (baccac_02373) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
b'KNEVVVSFENLLTEENSQFIADGTPNNQAFQETDFKDPKNLINFNHYYADWGSGYSFAGFSYMNITDNQTANSPAPITGKAKIGSVYIGVDSTDGEYGTPAILTILDTNYKLKGTWIANSTWAYMGMIQGDGYARAFKAGDWYKVTATGYDEAGNETGKAEILLANYKTDNDLPVKEWIWFDLTPLQNAVKVKFIPDSSDKNEYGMNTASYFCLDGITLIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14717 DUF4465 Domain of unknown function (DUF4465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1350 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jqrA00
4E9KA 4JQRA
chains in the Genus database with same CATH superfamily
5DUXA 2XL9A 5L36A 1AYN3 1LENA 2DU1A 4M0NA 4Q0UA 4I0BA 1S0BA 1D4M2 4PBOA 4NPRA 3SH4A 5E8AA 2IC1A 2PYTA 4IE7A 4LBQB 5BNOC 3OY8B 3HT2A 1XNCA 2Z42A 1IGOA 4AWDA 2VULA 5ERLA 1EY2A 3U37A 3OGRA 1FOD1 1VBA3 4NRPA 3URFA 1H8TC 2VUDA 4LITA 3JQXA 1EPZA 1RUOA 5FY8A 3VHNA 2X8KA 2QUOA 1URXA 4YGDA 3VDCA 3JXSA 2BFUS 3D0SA 4I3GA 2LS6A 4AEDC 4I0AA 3RG0A 4AZZA 1MS4A 1OA4A 3M3CA 4OFGA 4YGBA 2W08A 3I2JA 3AX4A 3IZOA 2ZGOA 5FKCA 1FOD2 1REFA 5T50A 3T4VA 4DUVA 4KL1A 1UW8A 2OT7A 5B4XA 4QQPA 1AYM1 3T2TA 4QPIC 1IPSA 1J3RA 1N3OA 2K9ZA 4KWLA 4Q4X3 1BK0A 1W8ZA 2ZX3A 1OA2A 3O14A 4MADA 1K42A 2JG9A 1BLZA 3I3EA 4YYOA 5A70A 3P3PA 4Y20A 4AW7A 4LXLA 4N7IA 4FOWA 1W0OA 1IG3A 1CIYA 1AR91 1DQ5A 1H1IA 1PX4A 2BZDA 2O14A 2ZHNA 3WCSA 3WDUA 4O61A 2XR4A 1GNZA 1DF0A 3FJSA 3OGJA 1EUTA 2A73B 2GC0A 2QQUA 2AGSA 4AVTA 1W2AX 1L7RA 1NZIA 1YQCA 2PQQA 2VMIA 3KV9A 1CAWA 3VBSA 1AYM2 1WCDJ 4OHXA 1SHWB 5A1FA 2DCTA 2F17A 2R063 2VW0A 4QGLA 4UFMA 1XSQA 5A6QA 1GP5A 4MV2A 4UT5A 3GZTB 5T55A 5FZ9A 3RFRA 3VDDB 3FFZA 2YHJA 1OLMA 1ZNPA 4LKEA 1AR92 3B94A 5J3UA 5C33A 2BQPA 1UY4A 5JI7A 2QBXA 3VZLA 2PHXA 5K8SA 3BU0A 1KJLA 5I0SA 2CDOA 2P3YA 2QKDA 1NQJA 4AHWA 1AXZA 2G19A 1UU6A 3T0DA 2JD4A 5EP9A 2BFUL 3NQHA 4XILA 2WT0A 5A32B 4A41A 1RUG1 2BOJA 2DVGA 1ULCA 2R1DA 3DEMA 4M01A 4RS5C 3FHIB 4FPGA 5DAQA 2AEZA 5I0RA 1PHMA 3TOJA 1NA1B 1HB4A 1LHVA 3SEEA 1UX6A 1I3HA 3HBZA 1R083 1KEXA 2A6XA 3IDAA 3ZXGA 1RUG2 3M1HA 1QJX3 3EYPA 4IUGA 4MGKE 4XXAA 4ZONA 3VGIA 2VCBA 1DQ2A 1TEIA 2Z69A 3Q8AA 3VZNA 1H8VA 2EIEA 1AL21 1HLCA 1Y9QA 2VCCA 2VR4A 3J7MA 4YNIA 3GZEA 2W87A 1J1LA 5DN2A 2BWAA 4QB2A 4R52A 4UF0B 4PLOA 1AX2A 4B4QA 2DFBA 5KHIA 2IFWA 5GZEA 1QJEA 3T3YA 3ZFFB 5FPAA 3VV1A 4AVAA 4M3CB 1B35C 1PO23 1WBLA 1C1LA 1W2UA 1NLSA 3T1MA 1AL22 1OH3A 3MW4A 2DV9A 3AYAA 1STMA 2A6WA 4ARYA 3ZSMA 2E6VA 1W6PB 4TWTA 1C8NA 4Y3OA 1LEMA 5K0UC 1LAJA 3MUZ1 3WD5A 3H50A 3O0WA 1JOJA 3PIGA 5T3NA 5ABJC 4BQYA 5IK8A 5JCTA 1S2KA 4TLGA 1N47A 1J83A 2I74A 3PHMA 1CESA 3S5QA 4LBQA 4LE4A 3VBHC 3OY8A 2YROA 5EHDA 1BMV1 1IOAA 2DVDA 4KNCA 3GXUA 4XETA 2B9UA 1FPN1 4BE3A 2EF6A 3E6DA 5G05L 3WCRA 1AL0G 1CR7A 1I5ZA 2JKBA 3CU7A 4LULA 3U11A 4B4PA 2VMGA 2D44A 4COZA 2JD9A 3PDQA 1ND2B 3GCWA 3RI9A 3LCPA 1W6NB 1AYN1 1O4YA 1BEV1 3OGGA 1W90A 2P5BA 4XF1A 1YNAA 4COUA 2YGMA 5EPAA 5L7OA 4CDQC 4D69A 1IQDC 1YI7A 1AXKA 2HWC3 4ZXKA 4L92A 4LEJA 1A78A 5A3NA 4FSJA 1KJRA 3A7QA 3NV2A 4WVVA 4FVVA 3TRSB 2NN8A 4P9XA 1UY0A 1BMV2 2VOVA 4CUBA 2B45X 1RMU3 1FPN2 3HVDA 3H42B 4LBQD 1Y9MA 4PCRA 4EE2A 5JIUA 4XE9A 3ZN5A 5DG2A 3H8XA 1JOBA 5LW9A 2VQUA 5FZMA 2BDRA 1AYN2 2D98A 1BEV2 4OZOA 4YM1A 4EN0A 5B4NA 2FDIA 1NCRB 1MS3A 5FOJB 1LOBA 5FP3A 1POQA 3I7DA 5JAXA 1RJ8A 2XJSA 1HRV3 2JIJA 1K5MB 2WINB 1W3XA 1V9U1 2A3YA 3O1MA 1HW5A 1LHNA 4YGEA 1UXXX 3WW1A 4RGAA 2X5IC 1VP6A 2VC9A 3WR0A 5EJZB 4LBJA 5CFCC 5IATA 2D6MA 4Y5SA 4QDRA 1WCSA 5H9QA 5F3EA 1NZCA 2D7FA 5FYIA 1YIFA 4BOWA 4Q29A 2WBKA 4BQ3A 5FO8B 3ZSKA 1MQTB 1YQ2A 2BP6A 2WZR3 1V9U2 4ET7A 5FY9A 1DGWX 5CYYA 5A32A 4Q4X2 2UWCA 5M0TA 2ZGRA 4RHV3 3LF7A 4R4ZA 4XF0A 2G1MA 1PZ8A 4LO5B 1O4TA 1AR61 2PMWB 5F3GA 2Y0IA 1Z78A 2GDFA 5CKQA 5IVJA 1JHJA 1X9PA 4AAPA 3N4MA 2QNKA 1O5UA 4PQQA 2WWUA 2WKKA 2SLIA 3B69A 4XF3A 1WLTA 3NAPB 3BPSA 3KS7A 2W46A 3LIHA 4XZUG 3WNLA 4YFZA 4OHYA 2R062 1NA1C 1CAXA 3WW2A 3AP9A 3D4KA 3FBYA 4DIQA 4DXZA 3GDBA 4KBBA 1UYPA 3NNGA 1AR62 4N7UA 2D3SA 3ZKUA 1N1VA 1Q8SA 4WBBA 1A3KA 4UF0A 4IERA 2R071 3QD6A 4MGZE 1DDLA 4EWEA 4D0QA 4H3WA 1IPJA 1UZYA 2XVGA 1XNDA 2NLRA 4HOOA 5A7OA 3I3DA 4G9SB 4IV1B 3ME2A 3B02A 5JPMB 2QQJA 5JOZA 1GQHA 1NE4A 2ORZA 4HVOA 1CJPA 4UW3A 5FPVA 4CDUC 4W6XA 1MR5A 3ZFFC 3KV6A 1TQ5A 3LGRA 1J84A 1W6PA 3NV1A 2R072 2VVEA 3UT0A 4P14A 1GQGA 2BU9A 1QDCA 3DCQA 1DQ1A 3KCCA 3NRUA 4Q8LA 3A0KA 3THPA 1VE0A 2WYFA 4CCMA 4TN7A 3C7GA 1OSGA 1Q8VA 1RINA 3ORJA 4LIVA 2VUAA 5B2GB 3VB9A 4YW3A 2NM1A 4NVPA 1AJOA 1XXNA 2PTMA 2DCKA 3UJQA 3HPNA 3ZM8A 2RDRA 2WNUA 3NSTA 1W9WA 4LK6A 4QKDA 1ND2A 4S2FA 3TEZA 4LA2A 1GP6A 1DZQA 3NWKA 4CUCA 2A3XA 3S6PA 4GWMA 1A8MA 1ODNA 4AQ2A 1ZA4A 3INAA 1RUF3 3HQRA 2OPKA 4XBLA 2FD8A 5I93A 3I2KA 4KU8A 4Y26A 4RFRB 3ZFEA 2WAAA 3SCGA 3QLQA 5H9SA 3S0MA 4EN6B 3RMXA 5GZFA 4CRQA 2R043 2WLQA 5FY7A 3SKJE 1PNFA 2CAUA 1UPSA 2OVUA 3FN9A 4FQ4A 1GZWA 1OI6A 3PU3A 2A70A 3FL7A 4YM2A 3THTA 3I3MA 3O1RA 1W2NA 2W1WA 1FNZA 3AMNA 2ZMKA 4ISQA 1NAEA 1TNFA 2V09A 3OGSA 3RI8A 1K5MA 4P9IA 1SFPA 1XPWA 4CCDA 2BGCA 4WM7A 5E1RA 1DHKB 1I5PA 5FPUA 4AG4A 4NIDA 3CJIA 3WNPA 2CGPA 1UMZA 2J1EA 1GQPA 4CEYC 2GH2A 4DY5A 5FZAA 4CUAA 3ZFGB 1ENQA 3OYWB 2VZOA 4QX5A 4AXOA 1OBNA 1UXZA 2C0ZA 2AZ5A 4MSVA 2OYZA 1SFNA 5AFBA 4PHZA 1KITA 2HH9A 2VGDA 3I4IA 2ZMNA 3HD8B 4GH4B 2TUNA 2BERA 1V6JA 2JDKA 2RM23 2X53S 1QU0A 1VIWB 3A21A 3NV4A 4MHRA 2GH8A 4MO3M 4IGPA 1C1FA 4E4ZA 1MQTA 1DZTA 4FTSA 3CDZB 4UAPA 4ES8A 3ILRA 3DXTA 3JU9A 4TXWA 4YWAA 5KR7A 3D0JA 1S0FA 1ULGA 4LLOA 4B4RA 1ZZ6A 3SEPA 4PDWC 4UYBA 3LFIA 2CGNA 4X6RB 3D82A 5F3IA 1GWMA 1N1YA 1MZ6A 1C28A 2G9FA 3LEKA 2D5FA 4FFFA 3FHAA 2P1BA 3BIWE 3H3LA 2WZR1 4QDSA 1DYPA 1VBB3 3UL2A 4WM8A 3WP3A 1OOPA 4BQ1A 4COWA 5DMYA 1VAKA 4LHSA 2IXIA 4RHV1 4K1YA 1LHWA 2VMFA 1NG0A 2KD7A 2VZRA 2ZGQA 5L19A 4BB3A 2JG8C 4DRRA 4JDMA 4ATFA 2XUMA 5KHKA 3M3IA 4HN0A 2YGLA 2FBEA 2FDJA 2WZR2 2P4EA 3GALA 2VO5A 2NQYA 5LA1A 3HN1A 3FX3A 3WUDA 1QWRA 3VD4A 1VALA 4RHV2 3HWJA 4OUEA 2QDNA 4HLTA 2PHUA 1RB8G 5FYCA 4LIUA 3TAYA 4IV1C 4XJ8A 3AZVA 2AC1A 2NMNA 1SLIA 2ZGLA 4FP3A 4XFFA 4W50A 1V70A 3DYPA 2RHPA 2B7YA 2VMHA 2ZJCA 4YVWB 3GM8A 1H1AA 4JGZB 4LO6B 5I8SA 2XHKA 3HIFA 4LMFA 3MI8A 1TME1 5T5OA 4XUPA 1FMD1 3VUOA 3OD0A 3D6EA 3P3NA 4PLMA 1FATA 5LY1A 5FZ4A 2MHFA 1WWYA 5FYSA 1Q8OA 2WFF1 2E53A 5A80A 4CCNA 5A3TA 1GLHA 5A3OA 4K3UA 1PIV3 4JHTA 4RR3A 2Q8OA 3WF3A 1HV0A 2Z79A 4LO7A 4QHBA 4FFGA 5KC5A 1WCKA 4C90A 5E88A 1TNRA 1OHFA 3PTRB 4IEZA 1TME2 3AKPA 3UKTA 5J7MA 1FT9A 1FMD2 2C9AA 2BNMA 3W58A 1WW6A 5LASA 4IW3A 5JSRA 3AZYA 4CEWC 2QDRA 1NCQC 2W9XA 1C8M1 4AI3A 3E6CC 2WFF2 3NJVA 5FYZA 5FZ3A 3R6SA 1LOFA 2RJKA 3UJOA 1O3RA 2WS93 1AVBA 3UNPA 2D6KA 2QE3A 2DCZA 1RL3A 2ZGKA 3C7OA 1WA6X 1WW4A 2W1UA 1I1EA 1W04A 1NYWA 4Z07A 3ZFGA 3ZDSA 1JYIA 1HX6A 3AZWA 1CPNA 4KU7A 3U1XA 5F5AA 2UU8A 4B8EA 2XBO3 4O65A 1C8M2 1UU4A 3PLQA 4JC1A 1UZ0A 4CDWB 2RR13 3N7JA 5CNAA 2DUQA 5CB7A 2UY8A 1JZ3A 5A3UA 4HETA 4QPGB 1CAUB 3WG1A 2XLFA 1JZ8A 2XJQA 4E27A 4DFSA 1V00A 1F35A 1QOTA 2CSGA 3C2UA 1E5HA 1HRI3 1LTEA 3Q9OA 2R042 3I97A 3ITQA 4YG6A 1UY3A 2XVKA 1W3VA 4CA9A 1X7NA 4GH4C 4Q4V3 4YVSC 4JZRA 2VNGA 5ANQA 3SISA 1ASJ3 5F3CA 5FO9B 3MF9A 2ZGSA 5FMBA 5D8AB 3MF6A 3OSDA 2A6YA 2GC1A 4URTA 5A1LA 3KT1A 2RM21 1ZRFA 2XVLA 4ZU7A 3OPZA 5GALA 3AFGA 1SLBA 2PHFA 3AL6A 4Q5OA 4E2QA 2AYHA 1W6OB 2Q1ZB 4RD7A 4FPLA 1X9TA 2D6NA 5IW0A 3WNNA 5D21A 3WEZA 2FDKA 1HKDA 2I07B 5SV8A 1J3PA 2D43A 1W9FA 1XE7A 3CO2A 3VBFC 1CIWA 1S2EA 3PUSA 2RM22 1XB9A 1SEFA 4HZFA 4UXAA 2VCAA 3VBRB 3H8OA 2BUKA 2WYSA 2Q4SA 3V56A 4CCKA 3LKJA 4N53A 4E4DX 4FFIA 1QQP1 4UI9L 1J59A 2XMLA 1VB2A 2JEMA 4BQ5A 2QQPA 2WUHA 4BPZA 3J9SA 4GB31 5DZFA 5BNOB 3K75B 3THCA 4JCKA 3MIGA 1QMJA 1D0GA 2VOKA 1PZ7A 5LZ6A 4CDXC 1WLWA 1W6MB 1BKZA 1H8TB 2A7AA 1SBFA 4X8PA 1VBB2 4EN7B 1QQP2 2VD7A 2ZEWA 4EV0A 2Y33A 2E9QA 1AR83 2VBDA 5AC93 1RC6A 3T09A 1GBGA 2YPDA 3R0RA 3RDIA 3MV11 4GB32 1TG7A 2OQ7A 4LQRA 4AEDB 2BBVA 3CL1A 2LM3A 3WDVA 5FRAA 1HIXA 2W5FA 5BYNA 3RZLA 5FLHA 2ZX0A 3WG3A 2GNTA 1PVXA 3AKTA 1KDKA 4YVWC 4HONA 1DLLA 1AR73 4QPIB 3MIEA 4UFKA 2ADEA 3DN7A 5LA2A 3J7HA 2R16A 4ZZ5A 3NNMA 3S57A 4OUMA 3U75A 4OZXA 4Y1YA 1RUJ1 3H3UA 3P1IA 5FIXA 1YFWA 5GZDA 3T0AA 5TSWA 3TEWA 4A6SA 2EIDA 2HWE3 5CU1A 5GLZA 5I8YA 5EYYA 2FQPA 1MZFA 2DUPA 1QJFA 4UFIA 2Q0AA 2XWJB 5DUVA 3VZOA 4JKMA 4XTMA 2PLV3 1W8TA 3A0NA 1UX7A 3AL5A 4QXCA 4DO0A 4AEKA 4YZ5A 4IV3B 1OXCA 1OLRA 5FKBA 1LR5A 2ZS6B 1AX1A 3C8XA 4FPEA 5C8WA 1SG3A 5AVAA 2W1QA 3ZKYA 2XL7A 1X50A 2PN5A 4QD2A 1RUJ2 5CFDC 5D2AA 2ZX2A 4GMP1 4FPCA 3WP4A 5JUVA 4IESA 1GZCA 4Z8BA 1OVPA 4MZUA 5IVYA 2PQSA 3USUA 3R05A 5LCWL 5FUPA 4AHZA 4AI8A 4KBZA 5JOYA 2C5DA 2LUWA 1SACA 3FFQA 5I8TA 4B1LA 2V73A 1DIWA 1DP0A 4IXLA 2WS91 2RS31 4LKDA 2WNEA 4RS5B 1SLTA 4QPGA 2W2IA 2HBUA 3WQ0A 5E6HA 4A7KA 3NMBA 5FK7A 1P8JA 4GQ7A 4LHLA 4QKFA 2R49A 4PI0A 4CDWC 3LOBA 1G8WA 2ET7A 3B3QE 3ZSLA 1O7FA 1DGRA 1CZVA 3ETQA 4IE4A 2XBO1 4K21A 4KGGA 4XDOA 4Y22B 1G9AA 1CZSA 2JB4A 3IPVB 3I3BA 3EXUA 2RR11 3R4UA 4E4HA 3J26N 2WS92 2RS32 4H7MA 1E5IA 3ZIXA 3WP5A 1XNKA 3PJQA 4YGCA 2VVDA 1COV3 5IK5A 2RVAA 3SITA 3C7FA 4F3JA 5JSPA 4IL7A 5FZBA 3WDXA 4XACA 3UKVA 4FBFA 2XBO2 1ASJ1 2ZKLA 3RWNA 3I2OA 2Y6FA 4AI2A 1B35B 4Z2WA 1RHI3 3L2HA 1CN1A 2RR12 4MXWB 2VY0A 4YM3A 2GP5A 1LB2A 2F4PA 3I59A 3J8F3 4G4FA 3WSOA 1QOSA 3VBRA 3WDTA 4AFCA 5K0UB 1UF2C 1QNWA 2VTXJ 4NO4A 3OTFA 4UWDA 5L73A 3DXUA 3FLPA 4NMIA 2YU1A 3JBG3 4GWJA 3SC7X 4E9KA 1JZ5A 5C3RA 2IXCA 2R1BA 3MICA 4KQ7A 4QGMA 4YLZA 5JR2A 1PK6A 3NKGA 1S4CA 1ASJ2 2Y6JA 5BNOA 3V0BB 3VBHB 4NPMA 1KGYA 1OPMA 1KRIA 1IS4A 1GOGA 4BXSV 4I02A 3W59A 3UYJA 4QQHA 4CP9B 3PVBB 4N43A 2B8MA 3AB0A 4HL0A 4ASLA 2D97A 2V72A 4XQ4A 3GZUC 3TBDA 3LQCA 2EXHA 3FHQA 3RGBA 3OF1A 2HWD3 1VPHA 2HEYF 4HKWA 5BV6A 2EVXA 4IGOA 2PAMA 4CDQB 2JDMA 4GJYA 4HVQA 4NROA 1C5IA 1W8FA 3OUHA 1NY71 2E63A 1W03A 2XONA 4HMZA 2EICA 5CKNA 3EBRA 1R1ZA 5F5QA 3LEGA 1U5YA 5JVVA 3CQOA 1MZEA 1QJU1 4XHBA 2WZPP 3NO8A 2ATFA 4XAEA 1AR81 3ACGA 4WV8A 3ZSJA 2JDYA 4CE8A 4OI1A 1JYNA 2QQNA 1NY72 4PBPA 2GZWA 5C5UA 4ZPIA 5F8PA 4YW6A 2ZZJA 5K4LA 1GICA 3SCFA 3SCHA 1QJU2 1HN0A 1AR71 1HXS3 2X5IB 1DQ6A 1T6BX 1VBE3 1AR82 5DPNA 5I0DA 3POIA 3BI3A 4LHKA 1OLME 2CDPA 3DPRB 3KM5A 4QPYA 3ZXFA 5CFCB 1LKNA 4FXKB 2JB8A 5IFTA 4IV3C 4JDNA 3NW4A 3I3QA 4RFT0 1QDOA 1GWLA 1ZYBA 2V4AA 2R30A 2VNOA 3PURA 4OYUA 4ZU4A 1EAH1 4EN9B 2VUCA 5IK4A 4CYDA 2HWB1 1PMHX 4XMIA 2HWF1 3TYJA 1AR72 3MIBA 1AX0A 1SFYA 2VOTA 3BVCA 4JKKA 4DY3A 1A34A 4I3PA 4D3WA 2O8OA 1QHDA 1U5ZA 5DAXA 4BHPA 3KZ4C 2VNVA 3ZN6B 1GOHA 1RUI3 4MG2A 3ZYGA 1CD3G 1BCXA 3CLPA 3B00A 4JQRA 2GALA 1QKQA 4W4ZA 1EAH2 2HEWF 3POFA 4IDZA 2HWB2 4C1WA 5C3PA 3KF3A 2HWF2 3H1MA 4BZ4A 2J1SA 4NUBA 4Y22A 3B9CA 5A6XA 3BB6A 3IPVA 5EV7A 5JPNB 5K9YA 5KXBA 3DF0A 1MZ5A 2XJPA 2ZX4A 2A75A 4YW7A 4DB5A 4ATEA 3VL9A 5C71A 1FV2A 5FQ0A 3APBA 4Y1UA 1G7YA 4G3YC 3IM0A 4FOVA 5IJRA 4Z2AA 1ZBE3 1YQ8A 3NKTA 1MS1A 1UZVA 2HYKA 3CZJA 1SMVA 1OFNA 1JZ7A 3L2YA 3N7MA 1LU1A 3AMHA 5CADA 2K2SA 1UZWA 1B35A 2A6ZA 4MGQA 4YM0A 2XJVA 4AQTA 5HV4A 2RS53 3WNMA 4CDUB 2A3WA 2WSVA 4PIZA 2V5YA 3LE0A 2RS11 5K0UA 2J1UA 2VZPA 2BV4A 2D3PA 2DYCA 4K6BA 2W3JA 3VBUC 1F4AA 1CPMA 1WW7A 2E31A 5FYYA 2WFPA 4IE5A 5ABJA 3DUIA 2OQ6A 4CZSA 2FDHA 5FMOS 4ZKTB 4MHUA 4R9AA 1H2KA 3AJYA 1WMXA 3VBHA 5C9AA 4RQPA 1YI9A 3H8UA 3J8F1 4QXKA 3HR9A 2RV9A 4K20A 4YRDA 4CP9A 4D7YA 4BQ2A 2WN3A 1N3QA 4L11A 4ZU5A 1UU5A 2RS12 2TEPA 4L9BA 5FP7A 3VL8A 5J36A 1RUH3 2VQAA 1MACA 1QXJA 1REDA 3MYXA 2ZX1A 3OG2A 2X09A 1WLDA 4CDQA 3N35A 1VMFA 4XTPA 2YBSA 1DG6A 2FMDA 1JU4A 1XRUA 1W05A 1UKGA 3EJKA 4Q4W3 2YFZA 1ST8A 3ACFA 4GJZA 1LOAA 5A7PA 3I8TA 1X36A 3J8F2 2IWGB 3V64A 3WQBA 4AAXA 3SQOA 3N9NA 3BU7A 3KGLA 3DECA 4NHLA 4BIOA 3FMGA 1DYKA 4PLNA 3I2HA 1BBT3 1VBA1 3WNOA 4S2HA 1Q8PA 3WNXA 4GWNA 3RZZA 4QM9A 3VKMA 3WT3A 4JGYC 3V0AB 2Y34A 2BNNA 1APNA 1XE0A 1FI2A 1JI6A 3LDRA 4EWDA 2E51A 5FUNA 4FAGA 5FMOL 4AI1A 3HQXA 4BWOA 1S2BA 2OXBA 1DFQA 4XOGA 3LA3A 4CEYB 2WQ8A 5JZGC 4RGKA 2PHLA 4DXRA 2ET1A 1VBA2 3KF5A 2VE1A 2QZ2A 1O59A 4CSWA 1BYHA 1HJGA 2Q5TA 4LKFA 4Q4X1 2W91A 4Q26A 4M4PA 5BXXA 4ASMB 4F7ZA 2BGOA 5L7OC 3LIGA 4P9LA 4Y24A 1RUC3 1JYTA 4W6WA 4A3XA 4KG0A 1HXS1 3DPRC 4XVHA 3VDDA 1HB2A 4GXLA 5ACA3 1JBCA 1W8HA 4TZDA 4PDWB 5LRRA 4FPFA 1UNBA 1LJ7A 1D4VB 4RSUA 1JN2P 1CAVB 4AHXA 4HT1T 3WF0A 5HCFA 5FPXA 3F95A 3NVCA 4DUXA 3GF6A 1OA3A 2R061 3RJRA 1X8EA 4BQWA 5DZGA 1H6XA 1HXS2 5JSOA 2PHDA 4KGQA 5FREA 5IWFA 5FYTA 5CEHA 1NA1A 5LBFA 1TMF3 4O9GA 4CCJA 1JHNA 1RITA 1VBD3 1RUI1 1MS8A 3RYPA 4OLLA 3S5AA 2JG8B 5LEKA 2FCTA 1PMIA 2GNDA 4NRMA 3BUCA 1IG0A 1MVQA 1JZ4A 3RJ2X 2YXSA 3ASIA 1U12A 2PXJA 3NV3A 4D6QA 2DCYA 1BJQA 1US3A 2YC4A 2ZTNA 5BY5A 3N7LA 2HLEA 5F7UA 1KS4A 2ZAHA 5LATA 3BODA 3CJXA 3LA2A 1R081 1RUI2 2W1SA 2FHRA 3KSCA 1RUE3 4UOJA 3T1LA 3U4XA 3BTZA 3ZFFA 1QJX1 1LULA 2C24A 3UGHA 3I2DA 1H2NA 3MPPG 4J6GA 4M3CA 5EQUA 3WP6A 4CCEA 3M2MA 4BMBA 3POEA 3PMSA 1YUDA 3U10A 1LECA 2VQTA 4DEQA 2OUHA 3ACIA 2XJTA 3IKWA 3WW4A 3VHRA 4YG3A 1GR3A 3FUQA 4FP2A 3CKHA 1R082 2WLPA 5I0UA 2BPA2 4LOSA 5BNNB 4R9BA 5FXZA 1AHSA 4NHKA 5J09A 1QJX2 3FE5A 4XYXA 5EZWA 1XNTA 3SHRA 1T2XA 1PO21 4D7TA 1NQDA 3AP6A 1XYOA 5FZIA 3ZYRA 4QXHA 4DRVA 2LRPA 4KWUA 3OOXA 4D7SA 4D94A 4QX2A 4RN5A 2AACA 2BW8A 5FMCA 2WNVC 2XQXA 3QACA 4D8MA 2JECA 1W6NA 2WO1A 2QQKA 4XZPA 3RZKA 4IQPA 1V6MA 2JDZA 2VMDA 4R9CA 4UFJA 1PO22 4E4SA 1L7LA 5FBJA 1S0DA 4CEWB 2Y26A 1NCQB 1CGPA 2JDNA 1R1A3 4BLJA 1FXZA 2B5HA 4N90A 3ACLA 3HNYM 3ES4A 2VZ1A 1LESA 3FUOA 1RVF3 4S2GA 1GZ9A 1KS5A 1LOCA 1YJLA 2BVVA 5DAWA 3V0AA 3K4AA 4XXPA 1RUD3 1NCRA 2HWC1 3MLKA 5IUQA 3HQUA 3R4DB 3LFMA 3THDA 1RUH2 3IAPA 1WMFA 3B7MA 2WQ4A 4R8HA 3WG2A 1H6YA 2GN3A 1O8SA 1WW5A 4CEYA 4QMAA 1OD3A 1RMU1 1VAMA 2CAVA 1BBT1 4QQOA 3LWCA 2WNUC 4Y4YA 5FYHA 1UOGA 4Y5Z0 5LA0A 1G6NA 2ZACA 5KBFA 4XURA 2D3RA 4GAZA 3CBNA 4Q4Y3 2QQWA 5C7GA 4OQ8A 2RMU3 5FWJA 2WL1A 4LHNA 4ZY9A 3V65A 3OD4A 2X05A 1YFYA 1PGL1 2HWC2 5L9BA 1W6QB 4IGQA 5J96B 2DVBA 1HRV1 3AMPA 1E5SA 4Q27A 4CP0A 3MIDA 4YVSB 4AGVA 4E8CA 1RMU2 3OB8A 4A7YA 1BBT2 2YDEA 5ANNA 4ZXEA 1I9RA 5KXEA 3B01A 1YCIA 4NIAA 2B46X 1O3QA 1CAVA 2XJUA 1S0CA 1NXD1 3ZYHA 4KI5M 2CTVA 4TYSA 2IXHA 4ZS3A 1LCLA 3AXDA 1PGL2 1HJFA 3JD73 1L3JA 2GC2A 2Z2SB 4NHXA 1WUVA 4Q0VA 2B39A 3IWZA 4O9EA 5FP8A 1HRV2 2YV8A 3B93A 3GJAA 1GKBA 3H8RA 4XJZA 4CP2A 1MS9A 4I30A 2WO2A 1YIPA 2AREA 4U2AA 4AQ6A 3CJIC 1ODMA 2YFUA 4QB6A 4CPBA 3VBFB 3NAPA 3Q8EA 4XUNA 1KQRA 3BALA 4OQ9A 1CVNA 2JWPA 4CXWA 4DXSA 1YYNA 3AZXA 3SXWA 2VZUA 2LROA 2LALA 5KHGA 4P08A 1SLCA 3WXPA 3WUCA 4C0HA 1GUIA 3O12A 5FZ7A 1V6OA 2VZ3A 2AEYA 1M4WA 1XE8A 1RYYA 2B4KA 3ZYPA 2P6CA 4NHYA 1GV9A 2DWRA 3EMRA 5HCHA 1OH4A 4K9SA 5HBAA 1E5RA 5H9PA 5HCBA 4CCLA 1JYWA 2IFRA 2J1RA 3K3OA 2FDGA 4CDXB 3D3AA 1IKQA 1OQDA 2NMOA 4IV1A 4CPBD 4LORA 2LTNA 1XJAA 1UYZA 4FPJA 1ZBA3 4BCUA 1QJZA 4HG6B 4AFAA 4RYDA 4P00B 4B7EA 1QH6A 4YZ1A 5C5TA 4WM8C 1OOPC 2D6PA 4A7ZA 4ASKA 1RXFA 2P34A 1QJY3 1RUE1 3T2PA 1LHUA 4H7LA 1OLQA 2TNFA 3KCYA 3WV6A 1HN1A 4J1WA 4XCBA 2DDUA 5FZKA 5APAA 1OT5A 1EYBA 3AMQA 2PHRA 4V2VA 3TWIA 2GSYA 3AZZA 5BNNC 5BUVA 2VU9A 3BN6A 1K45A 2QQIA 1Q43A 3OUJA 2G9GA 4S2DA 1RUE2 1W9YA 5LBEA 4QKBA 1YFUA 1F2NA 4CEWA 4XJAA 1H2LA 1NCQA 5J1XA 2EALA 5EFUA 4BH9A 3O0XA 5L9RA 5CFDB 4QX1A 1LGNA 2J42A 5KHJA 2ERFA 1GP4A 1S0GA 4XW3A 3IAQA 4DNYA 3RYKA 5C3QA 1XC6A 1YXWA 2Y60A 1XYNA 2VNRA 2E33A 5CISA 4WZFA 1RUF1 4FPHA 4WVWA 4QQLA 2DURA 4BJ0A 1WGPA 5CG8A 1R1A1 2FZ2A 3AVRA 3N9QA 3MGUA 2YBPA 2R041 3W21A 2Y38A 5FPLA 1YQ6A 3JZVA 1WKYA 3MLLA 3RWKX 3VBOB 4UFHA 2XUEA 2B42B 5HXVA 2ZGNA 3OYWA 3QH7A 4HSJA 1ACCA 4KWJA 1RUF2 4LLFA 3VD7A 3KWVA 4WVMB 1ZREA 3WOGA 4MGTA 2BYVE 4FPOB 3IIAA 3K51A 4GH4A 4XUTA 5FY1A 2P17A 4YVSA 3JB8A 4AVSA 2H6BA 2JIGA 4AYUA 1R1A2 2YPJA 5C8CA 1WMEA 5FJHA 5FYVA 4XC9A 2VTFA 5JXHA 3CIHA 3H3ZA 4UW5A 4OI2A 3T0BA 3BGAA 1BVP1 3DGTA 5FZHA 3ZIWA 5JOWA 3LD8A 4B3NA 4YPJA 1LOFC 4FOYA 3ZXDA 4JTNA 2CL2A 4UBHA 2PFWA 4NHMA 4BQ4A 3FLRA 2I2SA 1Q3EA 4CCOA 1VB4A 3ZYIB 1Y43B 2Z5WA 1Q8QA 4K8FA 4QQ2A 5FV3A 4BM8A 5DABA 1GNHA 3IMMA 5E89A 4IE0A 2VXRA 4FPKA 1QF3A 5E16A 1BHGA 2DVAA 4LK7A 2W92A 3VBFA 4J1XA 2RMU2 3EHKA 4JTOA 3G7DA 5DDJ3 3FC0A 3HJRA 4YW1A 5JIAA 1GOFA 1O3TA 4HK8A 5FZ8A 3JD71 5G04L 1IKPA 1F15A 2WZ8A 3H9AA 2YZ4A 4AQSA 4Q0QA 4QX7A 5FZ1A 1VBC3 5IVEA 2QQMA 1UMIA 3BPZA 3ON7A 3N7KA 3W5MA 1EP0A 1VBB1 4XDQA 4H14A 4XIOA 4Z92B 3ZR6A 1D4M3 4QHZA 2YU2A 3OBTA 5F5CA 2XLAA 4RL7A 3JD72 5FUIA 1ULEA 3IIIA 1POV3 1S55A 2VBPA 4C1XA 2DUOA 1OD5A 3MLJA 4WVZA 3TB0A 3VDAA 3IDBB 2DU0A 5I0TA 4BK4A 1H9PA 5FY4A 4BLIA 2A1XA 4HFSA 4Y1VA 4XFAA 3ACHA 4X6QB 3U78A 4YVWA 2IXKA 5T5JA 1OKOA 4JGZA 3AYCA 4MVTA 4OI4A 3KT7A 2QTWB 3ZXKA 1FOD3 4PF5A 4A3ZA 2VMCA 2IXJA 5CVRA 3VKOA 4N53C 1HV1A 2ZAAA 4LBOA 1W8OA 2OKXA 2AENA 3CMGA 4HPKB 4LT5A 4QHOA 3GZAA 3NNLA 3POJA 5CBLA 4OHZA 2VJXA 2PELA 3E1F1 3QOPA 4IEXA 1AF9A 1V6KA 1JS9A 3K46A 2Q8CA 3OPTA 1KFUL 3MV01 3IMNA 3Q8BA 1LEDA 1IPKA 1AYM3 2WAOA 3U0ZA 3LZZA 1R093 1QJY2 3E6BA 4XFHA 1IS3A 2UY9A 2AR6A 5FFOC 3ZN4A 3N9MA 1PIV1 3NNJA 2VAUA 1AR93 5KWRA 2CU5A 2E7AA 4V1PA 5EJ3A 3VN4A 2XHNA 3O0VA 5DUUA 5K7PA 3W5NA 2A5ZA 3L9JT 1SCRA 1MEC3 3KV5A 2VQ0A 5BNPC 2ARAA 5F2SA 3JCIA 2R6QA 2QQLA 4W65A 2VTXA 3WDWA 5GLUA 5C4WC 2JKXA 3MIFA 3VD3A 4L97A 3M3OA 1PVC3 4XDPA 2QJVA 3VLBB 4CDWA 1PIV2 2XXZA 4LTAA 1Z0HA 1CAUA 2EAKA 5GLVA 2UYAA 5A3PA 1JUIA 3VBOC 4GALA 2JENA 3PVNA 5F6LB 1H9WA 1ULOA 2ARBA 1PGW1 1O4ZA 3VBSB 1CAWB 2Q8EA 2WRAA 2VUJA 3HOBA 3KHCA 1TVGA 3LPFA 3P6BA 1NXMA 1ND3C 1NLQA 3PUHA 4NIGA 4M0HA 5FZCA 2ZGPA 4M4RA 4CU6A 2JDUA 3I2FA 5D8AA 3OJBA 2VW1A 3AKSA 2WIIB 4XCAA 4A44A 1ZZ8A 1PM7A 2AUYA 5LEJA 2JDHA 1OQ1A 2BGPA 2UURA 1HRI1 4UBGA 5DAPA 4PIYA 1C4RA 1PGW2 3VZJA 4Y33A 3PUAA 5FR3A 1EUUA 3N3HA 3HT1A 4URAA 2J1TA 4BIFA 4A2UA 4Q4V1 1W6OA 1AZDA 2AH2A 2MPFA 1VMJA 2KM2A 4ORFA 1F8VA 3ILNA 5D1IA 2XLGA 2RJ2A 3VBUB 1AL23 2YMZA 3VZMA 3AFKA 2OX0A 4K1ZA 4OUSA 4XJ9A 1UAIA 3HAGA 4TTGA 4HKOA 5ISLA 1HRI2 2X29A 4IEYA 5AVPA 4OCTA 2R7EB 5AFEA 4Q4V2 2FCVA 4KH9A 3LDBA 5DQ0A 5JR7B 1V0AA 5FYUA 1Q5OA 5DUWA 4ES9A 5A6ZA 5FAXA 1WCUA 2ZOEB 1Z7S3 3IB3A 4Y5TA 5DG1A 5F5IA 5A7SA 1HB3A 2BWCA 4FCAA 5HI0A 3KT4A 2H6CA 4AEJA 2HBTA 1H4HA 5HCAA 3T2QA 3RZJA 1W6MA 3OPWA 1H8TA 1O8PA 2ZPXA 4K7JA 3TN93 2Z4FA 5FP9A 4XQDA 1OURA 2BRTA 3C7HA 1I6XA 1PM4A 4QX3A 1ZRIA 4DS0A 4AEDA 2FCUA 1LHOA 2TBVA 3FBMA 4PJYA 5A3LA 4P5HA 4XPVA 2CHHA 4UW4A 5A3MA 2MEV3 4B29A 4Q1PA 1XU1A 3NJZA 5LK5A 3VZKA 2NPIA 1HQLA 1V6NA 1BEV3 3AKRA 4IEQA 2C6SA 4HPKA 4JGYB 4LR4A 2MNGA 4QPIA 3WY6A 1PK6C 2OZJA 4QU2A 4AFBA 1JMUB 4EWAA 3AC0A 3I54A 5AC91 1Q56A 3VKNA 3MBWA 4MGSA 4C8DA 3HEIA 1POV0 4QGNA 1JYVA 2Q1FA 4I01A 2WA4A 4XBNA 2GNBA 4FOQA 2ZXQA 3BCWA 4N43C 1QNYA 4NRQA 3WINE 5JZGB 1VJ2A 4C91A 1PO13 4P5YA 2VOWA 1H30A 4JDOA 2VZTA 2ZGUA 1ZVFA 3MO4A 3PUIA 1W99A 3DKQA 4LBNA 3ZX7A 4IV3A 1DYOA 2JE7A 5L7OB 2E7QA 2GU9A 4MX3A 2LW8A 4E2SA 1KDMA 3VKFC 1IS5A 3IDCB 5AC92 3AKQA 2WDBA 2HWE1 4BDVB 5GZGA 3I49A 1CONA 1ULDA 4JHZA 3W20A 3VD5A 1W39A 1SPPB 1XU2A 3W9AA 2ZGMA 4AGGA 1V9U3 4EQVA 2PLV1 3ZDVA 2OPWA 1JU3A 2BNOA 1EV13 4HVRA 4YW4A 3VHPA 2V4VA 1J58A 1R091 3POBA 1DCSA 1VAVA 1RXGA 2CWMA 4QM8A 3NNFA 1XQNA 3ZXEA 1D0HA 2HWE2 2J22A 4RS5A 3WVJA 1T6GC 5GLTA 3ZO0B 1W8WA 1NT0A 2WA3A 4JVAA 1E57A 3E5XA 3ZYBA 4DQAA 1ULPA 2JG9C 1LU2A 4AF9A 1MEC1 1YC61 4NOTA 3NJYA 2PLV2 4C0BA 2XQRA 4BQXA 1QH7A 1R092 2O8QA 3JB4C 4EZ4A 1LNSA 1YFXA 1UOBA 1PVC1 5H9RA 3MUY1 4FFHA 3J7NA 4QAWA 5IYYA 3VBSC 5KXDA 1AR63 5FTTC 4IE6A 4Y1XA 3WLUA 1VR3A 1GZTA 3ZMOA 5FLIA 5HV0A 2ZEYA 2ES3A 3N9PA 3ZVXA 1DZRA 1MEC2 3PU8A 3H7YA 5A7QA 1DBNA 1JYCA 2HYXA 2XH6A 3OUIA 3ZXJA 3WW3A 1DLCA 3ZLIA 1MVEA 3E97A 4QU1A 4XJWA 5CKMA 4XIKA 3K48A 3UGGA 2N7GA 1PVC2 5IK7A 4MXWA 2IVJA 1QXPA 5FPBA 3VBUA 4AVVA 2Y6GA 1RIRA 2GC3A 1VLNA 1ENRA 3R4SA 4QT6A 3NJXA 1COV1 4QX0A 2Q8DA 3PL0A 2R073 4GKXA 2UWBA 2W94A 1ZA7A 4F83A 3JUUA 1HQNA 3K2OA 4Q0SA 4YZ4A 1J1TA 3WX5A 4E8DA 3EB7A 1LRHA 1RHI1 1CAXB 3VKLA 3QCWA 3V0BA 4IEWA 4JQTA 3DYMA 2VZSA 1UPIA 4AI0A 2JDPA 2WABA 4MUVA 3DYOA 3N36A 4NIIA 1COV2 4QPWA 3RZGA 1FAYA 1M06G 2WNVB 4IETA 3RVHA 2VPVA 3JBG1 1KD7A 3WDYA 3WHUA 1OF4A 4N9HA 5J98B 1PZ9A 4YW5A 3UK9A 2A71A 3MFAA 2Q1MA 4OMDA 3KCXA 2VH9A 1RHI2 1Z7S1 1LGCA 5F39A 2CWSA 2BVBA 2FZ1A 2IVIB 1YHFA 4AGRA 5F1RA 4LOTA 4LNVA 2ARXA 1D2QA 1XBFA 2R32A 2CY6A 3DL3A 4GD4A 2ARCA 4HK9A 3TN91 3WQ7A 3CNAA 2HWD1 4EROA 5T54A 3S7IA 3JBG2 1RGSA 4JGYA 2QZ3A 2GMMA 1H1MA 3T30A 2ORXA 5C9AC 4RQPC 5JXJA 4YARA 3ZYFA 1Z7S2 3BTYA 4EYUA 2D6LX 3C7EA 1SZBA 5JZGA 1ENSA 1JOPA 2JICA 2MEV1 2WNUB 1X33A 1PX3A 2YYOA 3H1YA 3ELNA 3PMEA 4GA9A 4N8MA 1CX4A 2BEOA 1F5FA 5JMOA 1GWKA 1WZXA 2G9ZA 4COVA 3TN92 2HWD2 4Z1VA 1AJKA 2X5IA 1DGLA 3FWEA 3FZ3A 2UWAA 5T52A 4RA0A 3SKVA 4Y1ZA 4LBLA 1GANA 5GKAC 3WF2A 2ILMA 3ZFEB 3DPRA 4D6RA 5CFCA 1S0JA 2BOIA 4I2OA 2ZMLA 2J1VA 3S7EA 1SPPA 4XFIA 3BYWA 4QWNA 5C8CB 3ZPYA 2MEV2 2D5HA 2GN7A 1PO11 1W0NA 2D40A 2J1AA 5FJKA 1X8MA 1C5HA 1UZZA 3ECQA 2Q30A 1BXHA 1JZ6A 2OW4A 1GZWB 2H0VA 1VBE1 4XMAA 1N1TA 3CHXA 1GNYA 3UV9A 2XJRA 3ROUA 4CXYA 2Y6HA 3POGA 3ZN6A 5F37A 4P9YA 1ENXA 3EO6A 4OMCA 1LOGA 4WM7B 3GHNA 4XJUA 3UESA 3A23A 4A45A 3KVBA 1BK1A 1NUKA 1PO12 3CJIB 5EIYB 1EV11 3ZYJB 4COYA 3HNBM 1AXYA 4DMIA 1VMHA 2VBBA 1VBE2 3SH3A 3O1SA 2P3KA 3K3NA 3ZSEA 4DXTA 4ONUA 4QXBA 2W68A 2CV6A 4P9WA 5I91A 4CU7A 3KLSA 4NIHA 2W0XA 3O1TA 1C3HA 5FZLA 1CZTA 1VRH3 2E7TA 5IVCA 3VDDC 2DTWA 4L8QA 1EV12 1U5XA 2O1QA 2QQOA 4SBVA 5FK8A 4PT6A 4M3CE 4NWWA 4PIXA 1WD4A 4YZ2A 1QGLA 3IDEA 1LGBA 1JW6A 2W52A 1IHMA 2KXLA 4R9DA 5F2WA 2QQVA 1W2TA 4B7KA 4BU2A 2HJIA 2VZQA 3CZUA 4CDUA 1NX9A 2NZ9A 4XFBA 2RDSA 3VDBA 1ZBE1 4PI2A 3IN9A 3MEPA 2F6BA 1SDDB 4LKSA 4WM8B 3OBRA 1OOPB 4KMQA 3TNPB 2Y6KA 1G9DA 4AFMA 2WT2A 1LODA 5HXMA 4AL9A 2ZEXA 5FY5A 3LSEA 5CAZA 3KV4A 1JYXA 4CU8A 5FPZA 1ZZBA 1R64A 4A4AA 1BVVA 2O0OA 4FPYA 3GBWA 1ZRCA 4ISRA 2RS51 1NLRA 4LA3A 4XEZA 4A6OA 2NYYA 3MW3A 2YB7A 1J3QA 2PHWA 1HQWA 1ZBE2 1UQXA 2WNVA 3B5LB 1K3IA 1Y7BA 3AP5A 3ZOIA 3GGLA 4U36A 5LK7B 4TLFA 1N3PA 1QIQA 4XHXA 3WF4A 2R0HA 3OCPA 3BKZA 3H7JA 3AVSA 4BA6A 1NE6A 2OUJA 2VL4A 2RS52 1TME3 3USSA 3GYDA 3OEAA 1FMD3 4FI9A 4NWVA 1W28A 5KHHA 1CJDA 1RUH1 4LUMA 3LPGA 3NL1A 1YEWA 1G86A 1WBFA 2WT1A 3J7LA 4MOAA 2WFF3 4XF9A 3SMHA 4IEUA 1ZM1A 4HKLA 2WN2A 4WZCA 1EPWA 1US2A 2W39A 4Q4W1 2OZ6A 2RDNA 3GHMA 4NAMA 2GNMA 2VVFA 3WG4A 4ARXA 5JI9A 4LO8A 5JLVA 4A42A 2QCSB 4D6SA 2K0GA 3ZR5A 3GBFA 3SLIA 2ZABA 1ZRDA 1C8M3 3ABZA 4SLIA 3KB5A 4FQZA 2ZKNA 1GSLA 3S30A 1NKGA 4EJRA 1QXRA 4RR3B 2ETEA 3HNMA 2ZA9A 4NPLA 5FCCA 1YLLA 5J48A 5L9VA 1ND2C 3VHOA 4DZGA 1O6UA 4Q4W2 4RGGA 2ZHKA 2XG3A 3SH5A 1F4HA 1ZZCA 2EXKA 2P6HA 2BTVC 5FMDA 4DUWA 4OI0A 4MGYE 1UN1A 1XNBA 3H1WA 3ZFEC 4IEVA 1S0IA 4LJHA 1LOEA 4DINB 1XOYA 1WLCA 3D5OA 3BTXA 1DQ0A 4Q0PA 4PDWA 1FX5A 1GFF2 4LBMA 2YBKA 3POSA 3CF6E 4O7XA 1O3SA 2EAAA 4FTBA 2L9LA 2VZVA 5FLJA 2HKXA 2CNAA 5FZOB 1NCRC 3PVOA 3C3VA 2D6OX 4XF4A 2QVSB 1W0PA 1RUC1 2A6VA 5FYMA 2ZEZA 2P2KA 4QB1A 2E26A 4MLOA 1K5MC 1GU3A 3OBZA 3X29B 2D93A 5ACA1 4ZS2A 4WM7C 4CCCA 3LDKA 3UGFA 3BIEA 2H0BA 5DXDA 4CVUA 3ATGA 1CWPA 2P3IA 1QY4A 1BQPA 1F5JA 2DBIA 4KWKA 1IS6A 1SBEA 2JG8A 1OQEA 3MIHA 3OEBA 2OIIA 1RUC2 2I45A 1ZZ9A 3MZHA 1UY1A 1JXNA 1N1SA 5LWBA 3ENRA 1D7PM 5ACA2 3PIJA 3J4UH 1IQAA 1MQTC 1TMF1 1XYPA 1UKRA 3I2GA 1TE1B 4AVBA 1AUYA 4P02B 1H4GA 1VBD1 5EJ1B 3U07A 5DZEA 1YJKA 4L99A 2ZCWA 1ZX5A 3SNMA 5FXWA 2WNOA 5FZDA 1VRH1 1QQP3 1TZOA 2WC2A 4KG8A 3TEXA 1WCQA 4AFDA 4M3CF 4CU9A 2XPJA 5EXOA 2PAEA 2WO7A 4Z82A 1V6LA 4GB33 5HPOA 1TMF2 2XGXA 4HXCA 2OS2A 1GYKA 2Y0OA 1VBD2 3NAPC 1SLLA 4AHYA 4MGIE 1KFXL 1A8DA 3POYA 5BNNA 4EN8B 4N53B 4INDA 2RE9A 1VRH2 4JRAA 1U0AA 3AJZA 4DEVA 4E2GA 3O1VA 4Y4RA 2WO3A 1PMJX 3GBGA 2HEVF 3LA7A 1CX1A 1UOJA 4GZ9A 2VG9A 3M70A 2G4IA 1XNAA 2RDQA 4J25A 1OMIA 4GULA 5JXIA 2C4XA 3EQEA 1ZZ7A 4L0PA 2EIGA 3AP7A 1UWWA 3U14A 4W8JA 1VRBA 2JE8A 3GJBA 3BOPA 5LA9A 3HBKA 5FO7B 4XFCA 3DKWA 4PQ9A 3WZ1A 4I09A 3WQ1A 4ZHNA 4K40A 1RUJ3 4CTEA 5KC6A 1YO8A 4JV4A 2KR2A 4IEOA 3T08A 4BISA 2F4LA 3ETPA 1S0EA 3KGZA 3KVAA 2EXJA 3O1UA 2Y8KA 3LOIA 1G9FA 3KD4A 5GLWA 3AYDA 1OF3A 5BNPB 2C26A 1F31A 1RJ7A 1SLAA 5C6CA 2WWJA 1KXGA 5C4WB 4FXGB 1G9BA 1UIJA 3G6JB 1IZ3A 4AI9A 2ZZQA 4GMP3 3T2OA 1JTZX 1REEA 2IXLA 2YG0A 3BOWA 3PNAA 1FNYA 1RVF1 1W8UA 3F2ZA 4BXFA 5FZEA 1FV3A 1A6CA 5GZCA 1RUD1 1B09A 2VXJA 4OULA 1GMMA 1YWKA 5A7WB 4RR3C 5FBZA 4R4XA 4OVEA 1W6QA 4YFWA 5J37A 3FLTA 3AYEA 4BYYA 1ND3B 1H2MA 4JAAA 4XUOA 5IAXA 4ITCA 1JH5A 2RS33 1RTVA 5CG9A 4XABA 4Q4Y1 3BTAA 3LEMA 1OKQA 3MDPA 1UMHA 1RVF2 2PHTA 2RMU1 4LUKA 5FZOA 3USUB 2NP0A 4X8NA 1V6IA 3M7AA 3UETA 4NJ4A 1RUD2 1ONAA 2ENRA 3TNQA 2YY1A 3RZMA 1Y3TA 5BPXA 4NR1A 3RPQA 5A33B 2W95A 5IVVA 3IT8A 3M3EA 2JXAA 3GCXA 3MFCA 4OHWA 5IVBA 3RS6A 1MS0A 3B9IA 2P3JA 1UCXA 3RQ0A 4Q4Y2 4BMEA 1S1AA 3OBAA 1OUXA 2YUEA 5FZ0A 2Y6LA 3ZFGC 3U4SA 2EXIA 1MS5A 4GWIA 4FT8A 3PUQA 2XOMA 2DVFA 4IEPA 3QH6A 5SV5A 5C8CC 5A6YA 3MW2A 1JUHA 3JQWA 1ZRRA 2VM9A 1Y9GA 3VD9A 3WNKA 4YZ3A 3M3QA 5LBCA 4UFLA 4H2AA 4BK5A 2CGOA 2DF7A 5C3OA 3K77A 2ADDA 4MYEA 4CDXA 1WA4A 2WR9A 2EA7A 2YC2A 4NE9A 4AOCA 3ZMNA 2DCJA 1UL9A 3TEYA 3ALQA 2P37A 3QBQA 3LEIA 4P9JA 3OGVA 2PAKA 5FWEA 1DGWA 2WJSA 3RYRA 4MH0E 5IHRA 5IFPA 3RRDA 2VECA 2XKOA 3M8LA 3I59B 5DAVA 5IVFA 1OPOA 1W2OA 2OA2A 5CA6A 1O5LA 4DPNA 4B1MA 4YW2A 1ALYA 4P9GA 1OC1A 3Q8CA 1BZWA 4L2NA 5JOXA 4HSLA 1MPXA 4GKYA 4LBKA 5FDBA 2RG4A 1ZBA1 1PK6B 2Y64A 3O5SA 1C57A 1UO9A 2IUWA 5IT6A 2IZWA 2DFCA 1OUSA 1YQ5A 2FDFA 5FOBB 4XQWA 3AP4A 4XFGA 3IBMA 1QJY1 3E5UA 2W47A 1FYUA 3N9OA 4N43B 4XUQA 4CUGA 2R0FA 3A22A 4FTEA 1QJU3 1PGSA 2CYFA 5F32A 5BNQA 1W9TA 3RMYA 4JKLA 3ZXLA 3GNEA 4YSFA 2GMPA 1L7QA 2WQZC 5KXCA 3O1PA 2SBAA 2ZHLA 5FZ6A 1ZBA2 1SBDA 4UW6A 2WWSA 5JWPA 5CFDA 1UIKA 5LBBA 1WMDA 5FZGA 2RJLA 5T5PA 4QKNA 4META 1CQ9A 4HBNA 4NAOA 5FP4A 1HDKA 3MHZA 3HMYA 3UKNA 2XKPA 1DQ4A 5BNPA 5JDBA 4Q1RA 2XDVA 5JXGA 4JGZC 4PF1A 3DV8A 1UYYA 1XSRA 3CEWA 5GM0A 3PTYA 5C4WA 2C9KA 4GIQA 1PNGA 5GJ6A 3ST7A 3T4HB 1SCSA 4XAAA 1UY2A 1D2SA 2YC0A 3Q8FA 2WZEA 1O91A 2E32A 3VBOA 1G9CA 2JG9B 1EAH3 2X10A 5FXXA 4Y20B 5A7WA 1UD1A 2HWB3 4WVMA 1F9KA 3A4UA 2HWF3 2DBNA 4AE2A 2WSUA 1ULFA 3H0OA 3KQ4B 1JZ2A 1ND3A 1SDWA 4YG0A 2EIBA 1K12A 1W9SA 1X82A 2B9VA 2VW2A 5EWSA 3K4DA 4HN1A 1QEXA 5FZFA 1RUG3 3POWA 5LB6A 4Q8KA 4ZZ8A 1K5JA 5LRSA 1Y4WA 5FXVA 4HANA 4OHVA 3RNSA 2BBAA 4QDQA 4JRLA 3RSJA 2ZHMA 4H55A 4LO4B 3AXEA 5A33A 4LPLA 2JDAA 1JODA 4GMP0 1QOOA 3KQRA 4AEMA 4AVCA 3KHBA 3O7OA 2QFEA 4CXXA 5IAVA 2PA7A 5LY2A 2VCMA 1OVSA 2JJ6A 4Q2FA 1RUNA 3PVEA 4W6YA 4MXVA 2JX9A 4QPGC 1YRZA 4V2WA 2VMEA 3E5QA 1UYXA 3M4FA 4NN0A 5A3WA 5T5LA 5A1AA 3ES1A 1DU3D 2V5DA 4JX0A 5F6KA 3ZPOA 1OFSA 2XB6C 3LSDA 2ZGTA 5F9TA 1SQ4A 5FQ0B 3KMHA 5CZKA 5A7NA 4QX8A 5DDJ1 4CP1A 2RS13 2DTYA 2XWBB 3AMMA 4TSVA 1W06A 5D8AC 3PJYA 4M00A 3MPBA 5FYBA 1WD3A 2FMYA 3AM2A 5C3SA 3RZHA 3WF1A 1VBC1 4XBQA 4AR2A 3I2IA 2ID4A 4LE3A 2GAUA 1NOVA 3N9LA 5JMCA 4DOUA 3K4ZA 3HN3A 2JE9A 2UYBA 4FO9A 4N9IA 1DGRN 2ZBJA 3LB9A 1D4M1 3D8CA 2GP3A 4I0WB 1HB1A 1U5IA 2BJSA 5DDJ2 1W8NA 4F8AA 5EYXA 4FAHA 3O1OA 3ZXAC 1H0BA 2K46A 3AK0A 5CIRA 5FY0A 5ABJB 3P5BA 4AK3A 4EZHA 1POV1 1UOFA 3ILFA 4K8RB 1FPN3 3VBRC 2GMEA 1VBC2 2VOXA 2J7MA 3LAGA 3WHTA 2KA3A 5C70A 2C1FA 5C9AB 4RQPB
chains in the Genus database with same CATH topology
5DUXA 2XL9A 5L36A 1AYN3 1LENA 2DU1A 4M0NA 4Q0UA 4I0BA 1S0BA 1D4M2 4PBOA 4NPRA 3SH4A 5E8AA 2IC1A 2PYTA 5BNOC 4LBQB 3OY8B 3HT2A 1XNCA 2Z42A 1IGOA 4AWDA 2VULA 1EY2A 1FOD1 1VBA3 3URFA 1H8TC 3JQXA 1EPZA 1RUOA 3VHNA 2X8KA 2QUOA 1URXA 4YGDA 2BFUS 3D0SA 4I3GA 4AEDC 4I0AA 3RG0A 1MS4A 1OA4A 3M3CA 4OFGA 4YGBA 2W08A 3AX4A 2ZGOA 1FOD2 1REFA 5T50A 4KL1A 1UW8A 4QQPA 1AYM1 3T2TA 4QPIC 1J3RA 1N3OA 4KWLA 2K9ZA 4Q4X3 2ZX3A 1OA2A 3O14A 2JG9A 4YYOA 3P3PA 4Y20A 4AW7A 4N7IA 4FOWA 1W0OA 1AR91 1DQ5A 1H1IA 2ZHNA 3WCSA 3WDUA 1GNZA 1DF0A 3FJSA 3OGJA 2A73B 2GC0A 4AVTA 2AGSA 3VBSA 2PQQA 2VMIA 1CAWA 1AYM2 1WCDJ 4OHXA 2DCTA 2VW0A 2R063 4QGLA 5T55A 4MV2A 3GZTB 3VDDB 3FFZA 2YHJA 1ZNPA 1AR92 3B94A 5J3UA 5C33A 2BQPA 5JI7A 5K8SA 3VZLA 2PHXA 1KJLA 5I0SA 2QKDA 1NQJA 4AHWA 1AXZA 1UU6A 2JD4A 2BFUL 4XILA 5A32B 2WT0A 1RUG1 2DVGA 1ULCA 2R1DA 4M01A 4RS5C 3FHIB 4FPGA 5I0RA 1PHMA 3TOJA 1NA1B 1LHVA 1UX6A 1I3HA 3HBZA 1R083 2A6XA 3ZXGA 1RUG2 3M1HA 1QJX3 4MGKE 4XXAA 3VGIA 3VZNA 1DQ2A 1TEIA 2Z69A 1H8VA 1AL21 1HLCA 1Y9QA 4YNIA 1J1LA 2BWAA 4R52A 4PLOA 1AX2A 4B4QA 2DFBA 5KHIA 2IFWA 5GZEA 3ZFFB 3VV1A 4AVAA 4M3CB 1B35C 1PO23 1WBLA 1C1LA 1W2UA 1NLSA 3T1MA 1AL22 3MW4A 2DV9A 3AYAA 2A6WA 3ZSMA 2E6VA 1W6PB 4TWTA 1C8NA 5K0UC 1LEMA 3WD5A 3H50A 3O0WA 1JOJA 5ABJC 5T3NA 5IK8A 5JCTA 1S2KA 1N47A 2I74A 3PHMA 1CESA 4LBQA 4LE4A 3VBHC 3OY8A 2YROA 1BMV1 1IOAA 2DVDA 4KNCA 4XETA 2B9UA 1FPN1 4BE3A 2EF6A 3E6DA 3WCRA 1AL0G 1CR7A 1I5ZA 2JKBA 3CU7A 4LULA 3U11A 4B4PA 2VMGA 2D44A 4COZA 1ND2B 3RI9A 3LCPA 1W6NB 1AYN1 1O4YA 1BEV1 3OGGA 4XF1A 1YNAA 4COUA 2YGMA 5L7OA 4CDQC 4D69A 1YI7A 2HWC3 1AXKA 4ZXKA 4L92A 4LEJA 1A78A 4FSJA 1KJRA 3NV2A 4WVVA 4FVVA 3TRSB 2NN8A 4P9XA 1BMV2 2VOVA 2B45X 1RMU3 1FPN2 4LBQD 4PCRA 5JIUA 4XE9A 3ZN5A 5DG2A 2D98A 1AYN2 4EN0A 1BEV2 4YM1A 1NCRB 1MS3A 5FOJB 1LOBA 3I7DA 5JAXA 1RJ8A 2XJSA 1HRV3 1K5MB 2WINB 1V9U1 2A3YA 1HW5A 1LHNA 4YGEA 3WW1A 4RGAA 2X5IC 1VP6A 3WR0A 4LBJA 5CFCC 2D6MA 1WCSA 5H9QA 1NZCA 2D7FA 1YIFA 4BOWA 4Q29A 5FO8B 3ZSKA 1MQTB 2WZR3 1V9U2 1DGWX 5A32A 4Q4X2 2UWCA 2ZGRA 4RHV3 4R4ZA 4XF0A 1PZ8A 4LO5B 1O4TA 1AR61 2Y0IA 1Z78A 2GDFA 3N4MA 2QNKA 1O5UA 4XF3A 3B69A 2WKKA 2SLIA 1WLTA 3NAPB 3KS7A 4YFZA 4OHYA 2R062 1NA1C 1CAXA 3WW2A 3AP9A 3D4KA 3FBYA 4DXZA 4KBBA 1AR62 4N7UA 2D3SA 1N1VA 1Q8SA 4WBBA 1A3KA 4IERA 2R071 3QD6A 4MGZE 1DDLA 4EWEA 4H3WA 1IPJA 1UZYA 2XVGA 1XNDA 2NLRA 4G9SB 4IV1B 3ME2A 3B02A 5JPMB 5JOZA 1GQHA 1NE4A 4HVOA 1CJPA 4UW3A 4CDUC 4W6XA 1MR5A 3ZFFC 1TQ5A 3LGRA 1W6PA 3NV1A 2R072 2VVEA 4P14A 1GQGA 1QDCA 3KCCA 1DQ1A 4Q8LA 3THPA 3A0KA 1OSGA 1Q8VA 1RINA 2VUAA 5B2GB 4YW3A 2NM1A 4NVPA 1AJOA 1XXNA 2PTMA 2DCKA 3UJQA 2WNUA 3NSTA 1ND2A 4S2FA 4LA2A 1DZQA 3NWKA 2A3XA 3S6PA 4GWMA 1A8MA 4AQ2A 1ZA4A 3INAA 1RUF3 2OPKA 4XBLA 5I93A 4Y26A 4KU8A 3ZFEA 3SCGA 3QLQA 5H9SA 3S0MA 4EN6B 3RMXA 5GZFA 4CRQA 2R043 2WLQA 1PNFA 2CAUA 1UPSA 2OVUA 4FQ4A 1GZWA 1OI6A 2A70A 4YM2A 3THTA 1FNZA 3AMNA 2ZMKA 4ISQA 2V09A 1TNFA 3RI8A 1K5MA 4P9IA 2BGCA 4WM7A 5E1RA 1DHKB 4AG4A 3CJIA 2CGPA 1UMZA 4CEYC 4DY5A 2GH2A 3ZFGB 1ENQA 3OYWB 4QX5A 4AXOA 2C0ZA 2AZ5A 4MSVA 2OYZA 1SFNA 5AFBA 1KITA 2VGDA 3I4IA 2ZMNA 3HD8B 4GH4B 2TUNA 1V6JA 2RM23 2X53S 5C8CB 1QU0A 1VIWB 3NV4A 2GH8A 1C1FA 4E4ZA 1MQTA 1DZTA 4FTSA 4ES8A 3ILRA 3JU9A 3D0JA 1S0FA 1ULGA 4LLOA 4B4RA 1ZZ6A 4PDWC 2CGNA 4X6RB 3D82A 1N1YA 1MZ6A 2G9FA 1C28A 2D5FA 3BIWE 2WZR1 3UL2A 1DYPA 1VBB3 4WM8A 3WP3A 1OOPA 4BQ1A 4COWA 1VAKA 2IXIA 4RHV1 4K1YA 1LHWA 1NG0A 2ZGQA 5L19A 2JG8C 4DRRA 4JDMA 4ATFA 2XUMA 5KHKA 3M3IA 4HN0A 2YGLA 2FBEA 2WZR2 3GALA 2NQYA 3HN1A 3FX3A 3WUDA 1QWRA 1VALA 4RHV2 3HWJA 2QDNA 4HLTA 2PHUA 1RB8G 3TAYA 4IV1C 4XJ8A 3AZVA 2NMNA 2ZGLA 1SLIA 4FP3A 4XFFA 1V70A 2RHPA 2B7YA 2VMHA 2ZJCA 4YVWB 1H1AA 4JGZB 4LO6B 5I8SA 2XHKA 3HIFA 3MI8A 1TME1 5T5OA 1FMD1 3VUOA 3OD0A 3D6EA 3P3NA 4PLMA 1FATA 2MHFA 1Q8OA 2WFF1 2E53A 1GLHA 4K3UA 1PIV3 4RR3A 2Q8OA 1HV0A 2Z79A 4LO7A 4QHBA 5KC5A 1WCKA 4C90A 5E88A 1TNRA 1OHFA 4IEZA 5J7MA 1TME2 3AKPA 3UKTA 1FT9A 1FMD2 2C9AA 2BNMA 3W58A 1WW6A 5JSRA 3AZYA 4CEWC 2QDRA 1NCQC 4AI3A 1C8M1 3E6CC 2WFF2 3R6SA 3UJOA 1LOFA 2RJKA 1O3RA 2WS93 1AVBA 2D6KA 2QE3A 2DCZA 1RL3A 2ZGKA 1WW4A 1I1EA 3ZDSA 1NYWA 4Z07A 1JYIA 1HX6A 3AZWA 1CPNA 4KU7A 2UU8A 4B8EA 2XBO3 1C8M2 1UU4A 3PLQA 4JC1A 4CDWB 2RR13 3N7JA 5CNAA 2DUQA 5CB7A 2UY8A 4HETA 4QPGB 1CAUB 3WG1A 2XLFA 2XJQA 4E27A 4DFSA 1V00A 1QOTA 3C2UA 1HRI3 1LTEA 3Q9OA 2R042 4YG6A 2XVKA 1X7NA 4GH4C 4Q4V3 4YVSC 2VNGA 3SISA 1ASJ3 5FO9B 3MF9A 2ZGSA 5D8AB 3MF6A 2A6YA 2GC1A 4URTA 3KT1A 2RM21 1ZRFA 2XVLA 4ZU7A 3OPZA 5GALA 3AFGA 1SLBA 2PHFA 4E2QA 2AYHA 2Q1ZB 1W6OB 4RD7A 4FPLA 2D6NA 1HKDA 2I07B 5SV8A 1J3PA 2D43A 1XE7A 3CO2A 3VBFC 1CIWA 4UXAA 2RM22 3VBRB 1SEFA 4HZFA 2BUKA 3V56A 2Q4SA 4E4DX 3LKJA 4N53A 1QQP1 1J59A 1VB2A 2JEMA 2QQPA 4BPZA 3J9SA 4GB31 5DZFA 5BNOB 4JCKA 3MIGA 1QMJA 1D0GA 2VOKA 1PZ7A 4CDXC 1WLWA 1W6MB 1BKZA 1H8TB 2A7AA 1SBFA 4X8PA 1VBB2 4EN7B 1QQP2 4EV0A 2E9QA 1AR83 5AC93 1RC6A 1GBGA 3R0RA 3RDIA 4GB32 4AEDB 2BBVA 3CL1A 2LM3A 3WDVA 5FRAA 1HIXA 5BYNA 5FLHA 2ZX0A 3WG3A 2GNTA 1PVXA 3AKTA 1KDKA 4YVWC 1DLLA 1AR73 4QPIB 3MIEA 3DN7A 2R16A 4OUMA 4OZXA 4Y1YA 1RUJ1 3H3UA 5GZDA 1YFWA 5TSWA 2HWE3 5CU1A 5GLZA 5I8YA 5EYYA 2FQPA 1MZFA 2DUPA 5DUVA 2Q0AA 2XWJB 3VZOA 4XTMA 2PLV3 3A0NA 4AEKA 4YZ5A 4IV3B 1OLRA 1LR5A 2ZS6B 1AX1A 4FPEA 5C8WA 5AVAA 2XL7A 1X50A 2PN5A 4QD2A 1RUJ2 5CFDC 2ZX2A 4GMP1 4FPCA 3WP4A 4IESA 1GZCA 4Z8BA 4MZUA 3USUA 3R05A 4AHZA 4AI8A 5JOYA 2C5DA 2LUWA 1SACA 3FFQA 5I8TA 2V73A 1DIWA 4IXLA 2WS91 2RS31 2WNEA 4RS5B 1SLTA 4QPGA 3WQ0A 4A7KA 4LHLA 4GQ7A 2R49A 4CDWC 3LOBA 1G8WA 2ET7A 3B3QE 3ZSLA 1O7FA 1DGRA 3ETQA 4K21A 4KGGA 2XBO1 1G9AA 4Y22B 3IPVB 3EXUA 2RR11 3R4UA 3J26N 2WS92 2RS32 4H7MA 3ZIXA 3WP5A 1XNKA 3PJQA 4YGCA 2VVDA 1COV3 5IK5A 3SITA 4F3JA 5JSPA 4IL7A 3WDXA 3UKVA 4FBFA 2XBO2 1ASJ1 2ZKLA 3RWNA 4AI2A 1B35B 4Z2WA 1RHI3 3L2HA 1CN1A 2RR12 4MXWB 2VY0A 4YM3A 1LB2A 2F4PA 3I59A 3J8F3 4G4FA 1QOSA 3VBRA 3WDTA 4AFCA 5K0UB 1UF2C 1QNWA 4NO4A 3OTFA 5L73A 3FLPA 3JBG3 4E9KA 2IXCA 2R1BA 3MICA 4KQ7A 4QGMA 4YLZA 1PK6A 3NKGA 1ASJ2 5BNOA 3V0BB 3VBHB 1KRIA 1OPMA 1IS4A 4I02A 3W59A 4QQHA 3PVBB 4N43A 2B8MA 3AB0A 4HL0A 4ASLA 2D97A 4XQ4A 3GZUC 3TBDA 2EXHA 3OF1A 2HWD3 2HEYF 4HKWA 5BV6A 2EVXA 4HVQA 2PAMA 4CDQB 1C5IA 1NY71 2E63A 4HMZA 3EBRA 1R1ZA 5F5QA 1U5YA 5JVVA 1MZEA 1QJU1 4XHBA 2WZPP 3NO8A 2ATFA 1AR81 4WV8A 3ZSJA 4OI1A 1NY72 2GZWA 2ZZJA 1GICA 3SCFA 3SCHA 1QJU2 1AR71 1HXS3 2X5IB 1DQ6A 1VBE3 1AR82 4LHKA 3DPRB 3KM5A 3ZXFA 4QPYA 5CFCB 1LKNA 4FXKB 4IV3C 4JDNA 3NW4A 4RFT0 1QDOA 1ZYBA 2VNOA 4ZU4A 2R30A 4EN9B 1EAH1 5IK4A 4CYDA 2HWB1 4XMIA 2HWF1 3TYJA 1AR72 3MIBA 1AX0A 1SFYA 4DY3A 4I3PA 4D3WA 2O8OA 1QHDA 1U5ZA 4BHPA 3KZ4C 3ZN6B 1RUI3 3ZYGA 1CD3G 1BCXA 3CLPA 3B00A 4JQRA 2GALA 1QKQA 1EAH2 2HEWF 2HWB2 4C1WA 2HWF2 3H1MA 4BZ4A 4Y22A 3B9CA 5KXBA 3BB6A 3IPVA 5EV7A 5JPNB 5K9YA 3DF0A 1MZ5A 2XJPA 2ZX4A 2A75A 4DB5A 4ATEA 3VL9A 1FV2A 5FQ0A 3APBA 4Y1UA 1G7YA 4G3YC 3IM0A 4FOVA 1ZBE3 3NKTA 1MS1A 2HYKA 1SMVA 1OFNA 3L2YA 3N7MA 1LU1A 3AMHA 5CADA 2K2SA 1B35A 2A6ZA 4YM0A 2XJVA 4AQTA 2RS53 4CDUB 2A3WA 2WSVA 4PIZA 2V5YA 2RS11 5K0UA 2D3PA 2DYCA 4K6BA 3VBUC 1CPMA 1WW7A 5ABJA 2WFPA 3DUIA 4CZSA 5FMOS 4ZKTB 4R9AA 1H2KA 3AJYA 3VBHA 5C9AA 4RQPA 1YI9A 3H8UA 3J8F1 4QXKA 3HR9A 4K20A 4D7YA 4YRDA 1N3QA 4L11A 4ZU5A 1UU5A 2RS12 2TEPA 4L9BA 3VL8A 5J36A 1RUH3 2VQAA 1MACA 1QXJA 1REDA 3MYXA 2ZX1A 1WLDA 4CDQA 3N35A 4XTPA 1DG6A 2FMDA 1XRUA 3EJKA 1UKGA 4Q4W3 1LOAA 3I8TA 1X36A 3J8F2 2IWGB 3V64A 3BU7A 3KGLA 4NHLA 4BIOA 3FMGA 1DYKA 4PLNA 1BBT3 1VBA1 4S2HA 1Q8PA 3WNXA 4GWNA 3RZZA 4QM9A 3VKMA 3WT3A 4JGYC 3V0AB 2BNNA 1APNA 1FI2A 4EWDA 2E51A 4FAGA 5FMOL 4AI1A 3HQXA 4BWOA 1S2BA 4XOGA 1DFQA 4CEYB 3LA3A 5JZGC 2PHLA 2ET1A 1VBA2 2QZ2A 1BYHA 2Q5TA 4Q4X1 5BXXA 4Q26A 4ASMB 4F7ZA 5L7OC 4P9LA 4Y24A 1RUC3 4W6WA 4A3XA 4KG0A 1HXS1 3DPRC 3VDDA 4GXLA 5ACA3 1JBCA 4TZDA 4PDWB 5LRRA 4FPFA 1LJ7A 1D4VB 4RSUA 1JN2P 1CAVB 4AHXA 4HT1T 5HCFA 5FPXA 3NVCA 3GF6A 1OA3A 2R061 3RJRA 1X8EA 5DZGA 1HXS2 5JSOA 2PHDA 4KGQA 5FREA 1NA1A 1TMF3 4O9GA 1JHNA 1RITA 1VBD3 1RUI1 1MS8A 3RYPA 4OLLA 2JG8B 5LEKA 1PMIA 2GNDA 1MVQA 3RJ2X 2YXSA 3ASIA 1U12A 3NV3A 5BY5A 2DCYA 1BJQA 2ZTNA 3N7LA 1KS4A 2ZAHA 3BODA 3CJXA 3LA2A 1R081 1RUI2 3KSCA 2FHRA 3T1LA 1RUE3 3U4XA 3ZFFA 1QJX1 1LULA 3I2DA 1H2NA 3MPPG 4J6GA 4M3CA 3WP6A 3M2MA 4BMBA 3PMSA 1YUDA 3U10A 1LECA 2OUHA 2XJTA 3IKWA 3WW4A 3VHRA 4YG3A 1GR3A 3FUQA 4FP2A 1R082 2WLPA 5I0UA 2BPA2 5BNNB 4R9BA 1AHSA 4NHKA 5J09A 1QJX2 3FE5A 4XYXA 5EZWA 3SHRA 4D7TA 1PO21 1NQDA 3AP6A 1XYOA 3ZYRA 4DRVA 4D7SA 4D94A 2BW8A 2WNVC 3QACA 2JECA 1W6NA 4XZPA 4IQPA 1V6MA 2JDZA 4R9CA 1PO22 4E4SA 1S0DA 4CEWB 2Y26A 1NCQB 1CGPA 1R1A3 4BLJA 1FXZA 2B5HA 4N90A 3ACLA 3ES4A 1LESA 3FUOA 1RVF3 4S2GA 1GZ9A 1KS5A 1LOCA 1YJLA 2BVVA 3V0AA 4XXPA 1RUD3 1NCRA 2HWC1 3MLKA 5IUQA 3R4DB 1RUH2 4R8HA 1WMFA 3B7MA 2WQ4A 3WG2A 2GN3A 1WW5A 4CEYA 4QMAA 1RMU1 1VAMA 2CAVA 4QQOA 1BBT1 3LWCA 2WNUC 4Y4YA 4Y5Z0 1G6NA 2ZACA 5KBFA 2D3RA 4Q4Y3 2RMU3 2WL1A 4LHNA 3V65A 3OD4A 1YFYA 1PGL1 2HWC2 1W6QB 5J96B 2DVBA 1HRV1 3AMPA 4Q27A 4CP0A 3MZHA 3MIDA 4YVSB 4AGVA 1RMU2 4A7YA 1BBT2 2YDEA 5KXEA 1I9RA 3B01A 1YCIA 2B46X 1O3QA 1CAVA 2XJUA 1S0CA 1NXD1 2CTVA 4TYSA 2IXHA 1LCLA 3AXDA 1PGL2 3JD73 1L3JA 2GC2A 2Z2SB 1WUVA 4Q0VA 2B39A 3IWZA 4O9EA 1HRV2 2YV8A 3B93A 1GKBA 4XJZA 4CP2A 1MS9A 4I30A 4U2AA 1YIPA 2AREA 4AQ6A 3CJIC 3VBFB 3NAPA 1KQRA 3BALA 1CVNA 1YYNA 3AZXA 3SXWA 2LALA 5KHGA 1SLCA 3WXPA 3WUCA 4C0HA 3O12A 1V6OA 1M4WA 1XE8A 3ZYPA 1GV9A 2DWRA 4K9SA 5HBAA 5H9PA 5HCBA 2IFRA 4CDXB 1IKQA 1OQDA 2NMOA 4IV1A 2LTNA 4FPJA 1ZBA3 4BCUA 1QJZA 4AFAA 4B7EA 1QH6A 4YZ1A 4WM8C 1OOPC 2D6PA 4A7ZA 2P34A 1QJY3 1RUE1 1LHUA 4H7LA 1OLQA 2TNFA 3KCYA 3WV6A 4J1WA 3AMQA 1EYBA 2PHRA 3TWIA 2GSYA 3AZZA 5BNNC 5BUVA 2VU9A 1Q43A 2G9GA 4S2DA 1RUE2 1YFUA 1F2NA 4CEWA 4XJAA 1H2LA 1NCQA 2EALA 5EFUA 4BH9A 3O0XA 5CFDB 1LGNA 5KHJA 2ERFA 4DNYA 1S0GA 4XW3A 3RYKA 1YXWA 1XYNA 2VNRA 4WZFA 1RUF1 4FPHA 4WVWA 4QQLA 2DURA 1WGPA 5CG8A 1R1A1 2FZ2A 3MGUA 2R041 2Y38A 3JZVA 3MLLA 3VBOB 2B42B 5HXVA 2ZGNA 3OYWA 3QH7A 4HSJA 3ZFGA 4KWJA 1RUF2 4LLFA 1ZREA 4WVMB 3WOGA 2BYVE 4FPOB 3IIAA 3K51A 4GH4A 2P17A 4YVSA 3JB8A 4AVSA 2H6BA 4AYUA 5C8CA 1R1A2 2YPJA 1WMEA 3H3ZA 4UW5A 4OI2A 1BVP1 3DGTA 3ZIWA 5JOWA 4B3NA 1LOFC 4FOYA 3ZXDA 4JTNA 2CL2A 4UBHA 2PFWA 4NHMA 3FLRA 2I2SA 1Q3EA 1VB4A 3ZYIB 1Y43B 2Z5WA 1Q8QA 4K8FA 4QQ2A 4BM8A 1GNHA 5E89A 2VXRA 4FPKA 1QF3A 5E16A 2DVAA 3VBFA 4J1XA 2RMU2 3EHKA 4JTOA 3G7DA 5DDJ3 3FC0A 4YW1A 5JIAA 1O3TA 4HK8A 3JD71 1IKPA 3H9AA 2YZ4A 4AQSA 4Q0QA 1VBC3 3BPZA 3N7KA 1EP0A 1VBB1 4XDQA 4H14A 4XIOA 4Z92B 1D4M3 3OBTA 2XLAA 4RL7A 3JD72 1ULEA 1POV3 1S55A 4C1XA 2DUOA 1OD5A 3MLJA 4WVZA 3TB0A 3IDBB 2DU0A 5I0TA 1H9PA 4BLIA 4HFSA 4Y1VA 4XFAA 4X6QB 4YVWA 2IXKA 5T5JA 4JGZA 4MVTA 3AYCA 4OI4A 3KT7A 3ZXKA 1FOD3 4PF5A 5CVRA 2IXJA 3VKOA 4N53C 1HV1A 2ZAAA 4LBOA 2AENA 4LT5A 4HPKB 3GZAA 5CBLA 4OHZA 2PELA 3QOPA 4IEXA 1AF9A 1V6KA 1KFUL 3IMNA 1LEDA 1IPKA 1AYM3 3U0ZA 3LZZA 1R093 1QJY2 3E6BA 4XFHA 1IS3A 2UY9A 2AR6A 5FFOC 3ZN4A 1PIV1 1AR93 5KWRA 2E7AA 4V1PA 5EJ3A 3VN4A 3O0VA 5DUUA 5K7PA 2A5ZA 3L9JT 1SCRA 1MEC3 2VQ0A 5BNPC 3JCIA 2R6QA 4W65A 3WDWA 5GLUA 5C4WC 3MIFA 4L97A 3M3OA 1PVC3 3VLBB 2QJVA 4CDWA 1PIV2 4LTAA 1Z0HA 1CAUA 2EAKA 5GLVA 2UYAA 1JUIA 3VBOC 4GALA 2JENA 3PVNA 5F6LB 1H9WA 2ARBA 1PGW1 1O4ZA 3VBSB 1CAWB 2VUJA 1NXMA 1ND3C 4M0HA 2ZGPA 5D8AA 3OJBA 2VW1A 3AKSA 2WIIB 1ZZ8A 1PM7A 2AUYA 5LEJA 1OQ1A 4UBGA 2UURA 1HRI1 4PIYA 1C4RA 1PGW2 3VZJA 3N3HA 3HT1A 4BIFA 4A2UA 4Q4V1 1W6OA 1AZDA 2AH2A 2MPFA 2KM2A 4ORFA 1F8VA 3ILNA 5D1IA 2XLGA 3VBUB 1AL23 2YMZA 3VZMA 3AFKA 4K1ZA 4OUSA 4XJ9A 1UAIA 3HAGA 4HKOA 1HRI2 2X29A 4IEYA 5AVPA 5AFEA 4Q4V2 4KH9A 5JR7B 4ES9A 1Q5OA 5DUWA 5FAXA 2ZOEB 1Z7S3 5DG1A 4FCAA 2BWCA 5HI0A 3KT4A 2H6CA 4AEJA 1H4HA 5HCAA 1W6MA 1H8TA 2ZPXA 4K7JA 3TN93 4XQDA 1I6XA 4DS0A 4AEDA 1LHOA 2TBVA 3FBMA 4PJYA 5A3LA 4P5HA 4XPVA 4UW4A 5A3MA 2MEV3 4B29A 4Q1PA 1XU1A 3NJZA 5LK5A 3VZKA 2NPIA 1HQLA 1V6NA 1BEV3 3AKRA 4IEQA 4JGYB 4HPKA 4LR4A 4QPIA 2MNGA 3WY6A 1PK6C 2OZJA 4QU2A 4AFBA 5AC91 4EWAA 3I54A 1Q56A 3VKNA 1POV0 4QGNA 4I01A 2WA4A 4XBNA 2GNBA 4FOQA 3WINE 3BCWA 4N43C 1QNYA 5JZGB 1VJ2A 4C91A 1PO13 2VOWA 1H30A 4JDOA 2ZGUA 1ZVFA 3ZX7A 4LBNA 4IV3A 2JE7A 5L7OB 2E7QA 2GU9A 4MX3A 4E2SA 1KDMA 3VKFC 1IS5A 3IDCB 5AC92 3AKQA 2HWE1 5GZGA 1CONA 1ULDA 1W39A 1XU2A 3W9AA 2ZGMA 4AGGA 1V9U3 2PLV1 2BNOA 1EV13 4HVRA 4YW4A 3VHPA 1J58A 1R091 1VAVA 2CWMA 4QM8A 1XQNA 3ZXEA 1D0HA 2HWE2 4RS5A 3WVJA 1T6GC 5GLTA 3ZO0B 2WA3A 4JVAA 1E57A 3E5XA 4DQAA 2JG9C 1LU2A 4AF9A 1MEC1 4NOTA 2PLV2 4C0BA 1QH7A 1R092 2O8QA 3JB4C 1YFXA 1PVC1 5H9RA 5KXDA 3VBSC 1AR63 5FTTC 4Y1XA 3WLUA 1VR3A 3ZMOA 5FLIA 2ES3A 3ZVXA 1DZRA 1MEC2 3H7YA 1DBNA 1JYCA 2XH6A 3ZXJA 3WW3A 1MVEA 3E97A 4XJWA 4XIKA 3K48A 5IK7A 2N7GA 1PVC2 4MXWA 1QXPA 4AVVA 3VBUA 1RIRA 2GC3A 1VLNA 1ENRA 3R4SA 4QT6A 1COV1 2R073 4GKXA 2UWBA 4F83A 3JUUA 1HQNA 4Q0SA 4YZ4A 1J1TA 3WX5A 1LRHA 1RHI1 1CAXB 3VKLA 3QCWA 3V0BA 4IEWA 1UPIA 4AI0A 4MUVA 3N36A 1COV2 1FAYA 1M06G 2WNVB 4IETA 2VPVA 3JBG1 1KD7A 3WDYA 3WHUA 5J98B 4N9HA 3UK9A 1PZ9A 4YW5A 2A71A 3MFAA 2Q1MA 3KCXA 2VH9A 1RHI2 1Z7S1 1LGCA 2CWSA 2BVBA 2FZ1A 1YHFA 4AGRA 5F1RA 4LNVA 2ARXA 1D2QA 2R32A 2CY6A 3DL3A 3WQ7A 4HK9A 3TN91 4EROA 3CNAA 2HWD1 5T54A 3S7IA 3JBG2 1RGSA 4JGYA 2QZ3A 2GMMA 1H1MA 5C9AC 4RQPC 4YARA 1Z7S2 2D6LX 5JZGA 1ENSA 2MEV1 2JICA 2WNUB 2YYOA 1X33A 3H1YA 3PMEA 4GA9A 3ELNA 4PBPA 1CX4A 2BEOA 1F5FA 4COVA 3TN92 2HWD2 4Z1VA 1AJKA 2X5IA 1DGLA 3FWEA 3FZ3A 2UWAA 5T52A 4RA0A 4Y1ZA 4LBLA 1GANA 5GKAC 3ZFEB 2ILMA 3DPRA 5CFCA 1S0JA 4I2OA 2ZMLA 3S7EA 4XFIA 3ZPYA 2MEV2 2D5HA 2GN7A 1PO11 2D40A 1X8MA 1C5HA 1UZZA 3ECQA 2Q30A 1BXHA 2OW4A 1GZWB 2H0VA 1VBE1 4XMAA 1N1TA 3UV9A 2XJRA 3ROUA 3ZN6A 4P9YA 1ENXA 3EO6A 1LOGA 4WM7B 3GHNA 4XJUA 1BK1A 1PO12 3CJIB 1EV11 3ZYJB 4COYA 1AXYA 4DMIA 1VBE2 3SH3A 2P3KA 3ZSEA 4ONUA 2W68A 2CV6A 4P9WA 5I91A 3KLSA 2W0XA 1C3HA 1VRH3 2E7TA 3VDDC 2DTWA 4L8QA 1EV12 1U5XA 2O1QA 4SBVA 4M3CE 4NWWA 4PIXA