4JQRA

Crystal structure of a duf4465 family protein (baccac_02373) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
KNEVVVSFENLLTEENSQFIADGTPNNQAFQETDFKDPKNLINFNHYYADWGSGYSFAGFSYMNITDNQTANSPAPITGKAKIGSVYIGVDSTDGEYGTPAILTILDTNYKLKGTWIANSTWAYMGMIQGDGYARAFKAGDWYKVTATGYDEAGNETGKAEILLANYKTDNDLPVKEWIWFDLTPLQNAVKVKFIPDSSDKNEYGMNTASYFCLDGITLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14717 DUF4465 Domain of unknown function (DUF4465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1350 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jqrA00
4E9KA 4JQRA
chains in the Genus database with same CATH superfamily
2AGSA 4P00B 1GR3A 4QX7A 4YRDA 3ZR5A 4BA6A 4CDQC 1EUUA 1HQLA 1XYOA 1V6OA 2IXCA 3VL8A 4B4QA 2ZCWA 3M3QA 4HZFA 4Q8KA 1ZA4A 4HK8A 5IAVA 1DGRA 3K2OA 3OD4A 3I2GA 5ERLA 1CX4A 2IXLA 3WG2A 2ZGKA 4QX1A 1ZZBA 2XH6A 3LSDA 3RWNA 5A3NA 1JHJA 3WZ1A 1FI2A 1OOPC 2G1MA 1XNBA 4P9IA 5KHHA 3ZN4A 4OUEA 4AFBA 5DABA 2P37A 2DFBA 2WSUA 2HYXA 3NNFA 3O1UA 1JBCA 4PDWA 1SLTA 2HWB3 2WNOA 4AQ6A 2GNDA 3OGJA 1ZRFA 3WDWA 4JHZA 2VZRA 2CHHA 1RUG3 2HWB1 1APNA 1FMD2 3KM5A 1BBT3 1F35A 3LDRA 4L97A 3Q8CA 1LECA 4ZS2A 4LBNA 1RUG1 1ST8A 4AXOA 4LIUA 5A32A 1BBT1 2EXKA 1J3QA 2I07B 2K0GA 2MEV2 4LO5B 4NJ4A 5FMOS 3ZKUA 4AQ2A 4CU9A 4E9KA 1NE4A 3C3VA 1SBDA 2WC2A 5BNOA 3VD4A 2VQUA 5EP9A 1XB9A 4HVOA 3K3NA 4MUVA 2V4VA 2DVFA 5G05L 3HBKA 3WG4A 2PAKA 3R4UA 4I0WB 4Y4RA 3KGZA 4YZ2A 3Q8BA 4WM8C 2QTWB 4NE9A 1V6JA 3P5BA 3I3QA 1BHGA 5C9AA 3WDVA 4JC1A 4LJHA 4LKEA 1WCQA 5AVPA 4W50A 2XJRA 1W2AX 2QQKA 2W87A 4A3ZA 4A7YA 5FUIA 1PMHX 1YO8A 4OI1A 4AFCA 3EXUA 4KGQA 4A6SA 5JDBA 1V9U3 2HJIA 5L7OC 1FNZA 4JGZC 2EIDA 1BVP1 2WJSA 4EZ4A 1V9U1 3ZSMA 4BOWA 1HXS2 4COYA 5JZGC 5CKQA 5C4WA 3ZKYA 1NLRA 4WVZA 1NZIA 1W9FA 3HQRA 3UESA 1FNYA 5J37A 3A23A 3VN4A 1O7FA 3AP9A 4OHXA 4Y22B 4M4PA 5FYHA 5HV4A 4D94A 4N53B 4P14A 1UPSA 1XNKA 2ZABA 5EZWA 2A5ZA 4D7TA 3WNLA 3NL1A 4JV4A 2DTYA 1S2BA 1GKBA 2ZKNA 4XZPA 5J96B 1HIXA 1SLAA 1ULDA 1WMEA 2WABA 2V72A 5J48A 4AG4A 2RS52 4ZPIA 3OUHA 3TEZA 3HNBM 3PHMA 5FMDA 1G9BA 4YGBA 2OPWA 1BK0A 3GJBA 4XF4A 3LFIA 2CL2A 1VRH2 4PBOA 4V2VA 3A4UA 1XE0A 3OY8A 3PU3A 4M3CA 4MHUA 4RD7A 2ZXQA 3N9MA 3WNMA 3ZMNA 4DINB 5FWJA 4COWA 1NZCA 5H9RA 5LEJA 4K1YA 3OUIA 4UXAA 2KA3A 3E6BA 4HONA 3EB7A 4LLOA 3TEXA 1GOHA 3NJVA 5DG2A 5K8SA 3J7MA 4P08A 5BNNA 3SLIA 1C5IA 2VOWA 1LOCA 4P9WA 3DKQA 2OKXA 4AQSA 1ODMA 1H30A 2XMLA 4A44A 2KD7A 5LA0A 1VR3A 2FD8A 2YBSA 4LT5A 4OHVA 4UFLA 2W3JA 4YVSB 3OPTA 3WNKA 1BCXA 1DIWA 2VECA 1TNFA 1EP0A 1XYPA 4Q26A 4RHV2 4WZFA 3W21A 3GGLA 4QPIB 2R49A 5IK4A 2BNNA 4H7MA 1GZTA 1YQ8A 2FZ1A 2YYOA 3I7DA 4PLNA 3EO6A 1WW5A 5E88A 1UD1A 1YHFA 3NAPB 5FUPA 3VDBA 4IV3B 4JKKA 3S57A 1RUD3 1SFYA 2OZ6A 1RINA 2NN8A 1TG7A 3OBTA 3ZFGC 4KI5M 1WMFA 2IC1A 2EXHA 3AVSA 4QX5A 3CJIA 5CAZA 1RUD1 2ZGMA 5BNQA 4W65A 2P6CA 2FMYA 3D6EA 1PMJX 4A42A 1LEMA 2YHJA 2ZJCA 1BMV1 2JIJA 3X29B 5IVYA 2MHFA 1JZ4A 2ATFA 3SEPA 1GQGA 4XFAA 1XOYA 4FSJA 3WVJA 1LHNA 5E8AA 1AR91 3ITQA 1O3TA 3AYEA 3N9OA 4X8NA 3TEYA 3CBNA 1DQ6A 1YFUA 1LOAA 5CVRA 4QGLA 4CE8A 4M0HA 1XXNA 4NO4A 3TYJA 4C90A 1CZSA 2GU9A 2J42A 3CKHA 4TLFA 3VDDB 4E2QA 4AGRA 3CU7A 2JKXA 5FY8A 1XRUA 1HB3A 5DAPA 1H0BA 1SEFA 2EALA 2OQ6A 3JD73 1QF3A 5HV0A 1QXJA 4Y1VA 4K20A 2UWAA 3JD71 1K5MA 2W47A 4AHZA 4FBFA 5ABJA 1F9KA 1DGWX 5GALA 5CYYA 2ARAA 2XWBB 4EN9B 2OA2A 5FZ7A 5C33A 4QXHA 4XFCA 3BB6A 1IHMA 2JDNA 3D4KA 5FZLA 2PMWB 1JW6A 3OCPA 2X8KA 4IE5A 5KR7A 1JZ5A 1FOD2 2W5FA 3V0BB 2Q8DA 2DCZA 2BGPA 2H6CA 3EYPA 4FI9A 5K9YA 3WHUA 2VW2A 1H1MA 1VBB3 3POJA 1VRBA 5C8CB 1PGW1 1OSGA 3AJYA 1ZBE3 1GZWB 5C3QA 3AYAA 4Q4W2 3HPNA 3RG0A 1AR62 4OMCA 1VBB1 3CIHA 1LCLA 3PU8A 2BP6A 2HWE3 2YROA 1ZBE1 3FWEA 3H3ZA 4YW6A 4EWAA 2IXIA 3I97A 1R1ZA 2HWE1 3UKTA 3WEZA 1O4TA 2VD7A 3WDYA 2IFWA 4EROA 1IS6A 5CFCB 2ZHMA 5L36A 4GMP3 2Q30A 3GZEA 1W8OA 2CGOA 5FZ1A 4P9JA 3UJQA 1PGSA 3OPZA 2DCYA 3LE0A 3MIDA 2LS6A 4G9SB 4GMP1 2ZGNA 4AVAA 3W20A 1ZX5A 1FPN3 3M70A 5JR7B 1GZ9A 1MS1A 1QJZA 1A8DA 1HV1A 1NG0A 2AC1A 2BJSA 2WUHA 3NJYA 3QH7A 4W6YA 1IG0A 4E4SA 3AKRA 3USUB 5L19A 1WBLA 1FPN1 2B7YA 3GM8A 4AYUA 3DPRA 2WQ8A 4CDUA 1RUH3 2B39A 1JYVA 1C57A 3Q8AA 3OYWA 3ZM8A 4FTSA 5ACA3 2CGNA 2JE8A 1OLRA 1RUH1 3F2ZA 1WBFA 1QOOA 2XUEA 3VZLA 3ZSLA 3T30A 5ACA1 4FO9A 5FP9A 3VB9A 4IEQA 2Y6JA 2XKPA 5K7PA 2ES3A 4L2NA 3OGGA 3ZX7A 2GC3A 3IZOA 1PM4A 3KT7A 2Y64A 4ES8A 3VBUB 2J1RA 4JTNA 4AEDA 4N53C 2XJQA 4IDZA 4CEWB 2WBKA 2WN3A 3H7YA 5L9VA 3ILNA 2PA7A 5D8AB 5CKNA 3ZPYA 5FJHA 1IQAA 4XF9A 3W9AA 3OTFA 5JR2A 2B9VA 2Q4SA 2JG8B 1GUIA 1R092 4IGPA 2C5DA 4LIVA 3OBZA 4LK6A 2WT1A 4TSVA 3DCQA 3SH5A 2RDQA 3Q8EA 2Y6HA 3PUAA 3J8F2 1WCSA 3M2MA 4MG2A 1POQA 4K3UA 3S6PA 4JRLA 2YZ4A 1OF3A 5JPNB 1D2SA 2E6VA 2WQZC 3B7MA 3FBMA 4YM0A 1V6LA 2C9KA 1JH5A 4JKMA 4CCMA 3ZN6A 5ANQA 4XIOA 4QX3A 1SLLA 1OOPA 2FQPA 3N3HA 2EF6A 3N9LA 3WW4A 1N1TA 1CPNA 3UV9A 4QDRA 5EFUA 3O1OA 2XJSA 2XPJA 4TWTA 1S2KA 1YI9A 2WYFA 5FZEA 3ZDVA 1RITA 3ETPA 3R4DB 4LO8A 5F2WA 4BQ4A 4F8AA 5FXVA 5KHKA 4YVSC 4FCAA 1RUC3 1H2NA 4LBQB 2DWRA 3OY8B 4Q0QA 4HOOA 4DEQA 5DQ0A 1H9PA 1ULPA 1WA4A 1RUC1 1UY4A 2QQUA 2R062 4QPIC 4HN1A 5C7GA 1EY2A 5I0RA 2YFZA 4OI4A 3PUSA 3VZKA 4DXTA 4Q0PA 3ZXKA 3WINE 5GLTA 1NKGA 3C7EA 4QQHA 1XJAA 3DL3A 3NAPC 4IV3C 1W0PA 1XC6A 4HN0A 4AHXA 1I1EA 3HD8B 4IV1A 3FBYA 4BWOA 5A3PA 3J4UH 5A7WB 1R081 2XR4A 3LDBA 5FFOC 3DYPA 4WM8A 3KT1A 1PGL2 5FLJA 4JZRA 3IPVB 2K46A 1WW7A 3T1LA 1BZWA 2JDKA 4HG6B 4YM1A 4N7UA 1TMF2 3KCCA 5DDJ3 1RUF2 3LEIA 4QU2A 3ZYJB 4ATFA 2D98A 5IT6A 4H14A 3AP6A 1ZBA3 1MS4A 1POV0 2ORXA 2XJVA 5DDJ1 2E51A 4QB1A 3DUIA 1NT0A 2HWB2 3VKFC 4FFIA 1ZBA1 2WZ8A 2D7FA 1CJPA 3VDDC 1RUG2 4CRQA 1J58A 4CUCA 4CCCA 1BBT2 1JOBA 4JGZA 4QM9A 3ZN5A 1YYNA 3MICA 2GDFA 4ISQA 1XYNA 5GM0A 5LBCA 3AMNA 5LASA 3C8XA 2Q8EA 3LEGA 2WZR3 5DUUA 1VBA3 1RVF1 1CN1A 1GWKA 1W39A 2DYCA 4LBLA 3M7AA 3GZUC 3ROUA 4C0BA 2WZR1 2O8QA 1VBA1 5T5JA 2A1XA 4JCKA 3UGHA 1Q3EA 3B93A 4N43B 3GDBA 5DAWA 4ZS3A 1NYWA 3RYKA 4I2OA 3ABZA 2JJ6A 1FATA 5JCTA 2VH9A 3L2YA 4D7YA 2E7QA 4YG3A 1FAYA 2XLGA 1BJQA 3BTAA 4META 1ALYA 4LPLA 3ZIWA 5C8CC 2XQRA 4HETA 5A6YA 3SISA 3HNYM 3AKQA 2Q1FA 2ZS6B 3UGFA 2ZOEB 2OS2A 1DCSA 5DG1A 2BWAA 2EA7A 4ONUA 4PDWC 2AEYA 2WNUB 4LHKA 4PF5A 4XUTA 5GKAC 1GNYA 1J83A 1DHKB 3KB5A 3KLSA 2VZPA 3K46A 4LO6B 5F3IA 1KDMA 2BW8A 1V9U2 5FZGA 4W8JA 5CFCC 2GNBA 3IIIA 5F5AA 4UAPA 1O8PA 3H50A 4LA3A 2D3SA 2XG3A 4A7ZA 4MYEA 2VMEA 1MZ6A 3ZVXA 4BCUA 5LW9A 5FZ3A 3POSA 4KU7A 4M0NA 4BE3A 4EQVA 4S2DA 4PQQA 2SBAA 5A6XA 1DZQA 1EV13 2VOVA 1Y4WA 3ACGA 4KU8A 4QAWA 4XDQA 2A6XA 1CZTA 1CAVA 4LBKA 1EV11 1BLZA 4S2FA 3VHNA 3GZAA 4BB3A 1DGLA 2ARBA 2GNTA 2XB6C 1A3KA 3EBRA 3VBUC 4K7JA 1QHDA 2YY1A 1C3HA 4CEWC 1JN2P 5FV3A 1H9WA 5IWFA 5IHRA 5IYYA 1RMU3 4QKDA 1NOVA 3POFA 4MGIE 5D8AC 2GNMA 3DPRB 5IW0A 3JZVA 2YXSA 5LBBA 4BLJA 5KWRA 1W9WA 4LORA 3OYWB 1W2OA 2JG8C 1RMU1 2JD9A 3FZ3A 4CCJA 4GULA 1Q8VA 1PVC3 1ZZ6A 2Q5TA 3I2DA 4EN6B 3SCFA 1SLIA 4PI2A 3T0DA 1LU2A 1DQ4A 2WFPA 2ZEZA 3AP4A 1PMIA 4XYXA 5LWBA 1PVC1 5FY5A 2WN2A 3U75A 1GQHA 5FYIA 2P6HA 2A70A 4YFZA 5FXXA 1U5ZA 1F5JA 3U0ZA 1K12A 2RJLA 4MADA 4AEDB 1XE7A 1IGOA 3PVOA 2P34A 3HT2A 1VE0A 2ARXA 1A78A 1OVSA 2D93A 2XL9A 4OFGA 3N7KA 4N7IA 5FY9A 5LBEA 1CAWB 2YBKA 3SXWA 1GNHA 2R0HA 5CA6A 4NHKA 1YFWA 3ACLA 5A7SA 2Y60A 2P4EA 2HBUA 3IT8A 4EYUA 1YJLA 3AK0A 2DF7A 5F8PA 3V0AA 4NIIA 2QFEA 4ISRA 4A3XA 1JUIA 1PZ8A 3VBHB 3M8LA 1AXYA 1XNAA 3LKJA 1RUD2 4Q1RA 3DGTA 5FREA 3LB9A 2CSGA 1VBD3 1RYYA 5FP3A 5A3LA 1BEV2 3RZGA 2BGOA 3ENRA 5BXXA 2HWD3 1AYN3 3HOBA 1QH6A 1VBD1 2LROA 3AKSA 4GD4A 4PIZA 4U36A 3OD0A 1LEDA 1LENA 2BEOA 1AR83 5CU1A 4CUBA 1AYN1 2XVGA 1UIJA 3THTA 2NYYA 1BXHA 1AR81 1O5UA 1V70A 2BWCA 2IUWA 2VZ1A 5FXWA 2D3PA 1N3OA 2RJKA 3HT1A 4QMAA 4E8CA 1AL0G 2WA3A 4FPCA 1REEA 1G86A 4X8PA 3MIEA 3RJ2X 2XL7A 3IAPA 2DVDA 1XQNA 4MOAA 3T0BA 2YMZA 3MLLA 2WNVB 3D0JA 2BVVA 3LDKA 4Q4X3 4XFFA 5JI7A 4D6SA 2AREA 2Z2SB 4E8DA 4XC9A 4BHPA 2HEVF 3AMQA 3SITA 4CCNA 2DCKA 3I3EA 2W1QA 4YGEA 5K0UA 3W58A 3TNPB 1UCXA 1H8TA 3MPPG 2RM23 3SC7X 4IV1B 5D21A 5T3NA 1IQDC 2QZ2A 2RM21 3ZYIB 4MGTA 1IPJA 1PGW2 4P02B 1W8TA 2A7AA 3M3OA 2AUYA 4XQDA 4IESA 4BXSV 4FPFA 5C70A 4Y22A 4Z92B 1DLLA 1KJLA 2XLAA 2EIGA 2QQWA 4PLMA 5FZ8A 2YPDA 2HWE2 3R05A 3PIJA 4Y1ZA 5IJRA 3AXDA 4AL9A 2HWC3 3VZNA 5I91A 5FYSA 3K4AA 5DMYA 5FYTA 3P3NA 4HKWA 4Z07A 2VY0A 4NRMA 2HWC1 4P9GA 3LQCA 4DXZA 2ZGTA 4AEJA 3BUCA 4OULA 4OHZA 3FLPA 5C3RA 2A6YA 3FL7A 2J1TA 4FOWA 3B69A 4XABA 4LBOA 1W6QB 1ZNPA 1FPN2 3BALA 4MSVA 1OFNA 1SBEA 4GZ9A 4TLGA 3MIHA 1UZYA 2WNUC 2ZTNA 1HB1A 3AZZA 1YI7A 1RJ7A 1AF9A 1W8ZA 2P2KA 1IKPA 2AZ5A 3K51A 3BTXA 2QUOA 2F4LA 4ZU5A 1OHFA 1RUH2 3MV01 1DFQA 4QX2A 4INDA 1X33A 4FQZA 3D82A 4XETA 1ENRA 1SPPB 5ACA2 2PHFA 4B1MA 1J3RA 3WY6A 2VG9A 4QX0A 4YW4A 3GZTB 4IERA 2VZ3A 4AAXA 1NLSA 1XBFA 4BDVB 2UWCA 1GOGA 2P3KA 5FYZA 4AAPA 3SNMA 3A7QA 3PVBB 1X8MA 2HKXA 4XDPA 2DURA 4YVSA 4A45A 4O65A 5FMOL 3ILFA 4LEJA 3WNXA 3THCA 3WR0A 5J98B 5FP8A 1XSRA 2X53S 5F6KA 3WF2A 2ZKLA 2OUHA 1MS0A 2WO1A 4QPIA 2NMNA 3D0SA 4FT8A 4YGDA 1H2MA 3A0NA 1ULOA 5FMCA 1N1YA 1N1SA 3G7DA 3ZIXA 3UL2A 5F39A 3ZYFA 3NAPA 4IEVA 1QH7A 4L92A 2D6LX 1DYPA 5JUVA 4IV3A 2J1SA 3LIHA 4OCTA 1G8WA 1K45A 1YCIA 3THPA 5F37A 2XHKA 3DPRC 3SQOA 1OA3A 1MS3A 3B9IA 1AJKA 4Z1VA 3BOPA 2EAAA 3NO8A 4V2WA 3LAGA 1CAVB 3CF6E 1PM7A 1V6KA 4GH4B 2VNRA 4QKNA 2RHPA 4NAMA 2BFUL 4IUGA 1ZRRA 2RJ2A 1UN1A 4DUVA 3W5NA 1OD5A 3H0OA 3LCPA 4M4RA 1DQ2A 3WQBA 3IM0A 4AVSA 4AEDC 1HRV2 1W6MB 1RUC2 4XJ9A 4AQTA 2A3XA 2VVDA 1KS5A 1KQRA 2HYKA 1WGPA 5JVVA 4B7EA 3POYA 4NVPA 1PO22 4S2HA 4UFMA 3GXUA 4FXKB 1V6IA 3RMXA 2QJVA 3O0VA 5KHJA 4I3PA 4IE4A 3NV1A 2FDFA 2CWMA 5LBFA 5A6ZA 3KCXA 2QDRA 1ZM1A 4AFMA 3VBHC 5F5IA 4B1LA 4LITA 2CY6A 1IG3A 4XCAA 3KCYA 4DY5A 1UKGA 3C7GA 3V0BA 2BPA2 2NMOA 4L8QA 1YIFA 4QXCA 2A3WA 2TEPA 1A34A 1NQJA 4I30A 3T2PA 3S7IA 3K3OA 5C8CA 1CQ9A 2R16A 3CNAA 4LNVA 1GZWA 5FZMA 4DUWA 3KQRA 3FHQA 1D4M3 4UWDA 4ZKTB 1ZBA2 3M4FA 3ACHA 3PJYA 4XJZA 2GH8A 1O59A 2Z79A 1D4M1 3V0AB 4RGKA 4AI3A 4FAHA 4AEKA 2ZX2A 4LHLA 4UFHA 2W0XA 3AP7A 5FCCA 5CFCA 1QU0A 2WS93 1OMIA 2J7MA 5JXJA 3I3MA 1UW8A 1QJEA 2JD4A 2NPIA 1JYCA 4XDOA 3E6CC 2WNVC 4NIDA 2WS91 1OFSA 1E5HA 1PO13 2A6VA 2WZR2 3AKPA 3KGLA 4MHRA 1F4AA 3KWVA 1V00A 4LMFA 2PHUA 4H55A 1COV3 3PNAA 3USUA 3S7EA 3RI9A 1PO11 5HI0A 1OBNA 2A6ZA 4MGKE 4CP0A 1COV1 4UBGA 4BU2A 4IV1C 3ZOIA 3TAYA 2PLV1 1JYWA 3ES1A 4CCLA 4DPNA 3MW4A 5A6QA 3IDAA 4IEYA 2DU0A 5IK8A 1NUKA 2PHDA 3RZZA 1H2KA 4C1WA 5IATA 1RUOA 3FLTA 5DZGA 3MZHA 1VBC3 4CCKA 5JIAA 4DMIA 3BKZA 3C7FA 4FOQA 4WVWA 2D6NA 2WLQA 1SZBA 3VBUA 1VBC1 4CEWA 4DO0A 4BIOA 1UX6A 5FPVA 4CUGA 1QXPA 4PIXA 5K0UB 5D8AA 2WLPA 1CPMA 3IDBB 1H8TB 2ZZQA 3R6SA 4LO7A 1WA6X 1TE1B 4XF1A 2V5YA 2JG8A 3C7HA 1SMVA 5FZDA 1UZWA 3WDTA 1QIQA 2DVAA 5E1RA 2RVAA 5J09A 1DU3D 2C4XA 4C91A 3LWCA 1C8NA 1YQ6A 4IE6A 1UMHA 3O5SA 3L2HA 1WLDA 2VNOA 5E89A 4D3WA 4C0HA 4YW3A 2C9AA 1OD3A 3EMRA 1I5PA 2GP3A 4WM7B 5JOYA 5JOZA 3THDA 1UKRA 3CO2A 1S0CA 5FO8B 1EV12 4L11A 4BQ1A 1S0BA 1LRHA 2VCBA 4HBNA 4R4XA 3RS6A 2VZVA 1W28A 1Y9QA 3ASIA 5I8SA 3SMHA 3AYCA 1EPZA 5CG9A 2B42B 3VKMA 5JOXA 3A21A 1WMXA 4QM8A 4Z8BA 1W8HA 4LBQA 1JZ8A 5EPAA 3VD3A 2X10A 3K77A 1RMU2 3QOPA 1GLHA 4CU8A 3PURA 2GC1A 3B00A 5AFEA 4WVMB 5BPXA 2ZA9A 4QGNA 1RUJ2 3I8TA 4PI0A 4Q0SA 3OBRA 2WAOA 4K6BA 1Z78A 2WINB 4GWNA 4OYUA 3RZJA 4FP2A 4NRQA 3UJOA 4EN8B 5FAXA 4LE3A 5GZCA 5A7WA 1MQTA 4XBNA 4QQLA 5A33A 4JVAA 2JEMA 2RDRA 3U11A 3IPVA 2YC0A 3WP6A 3ZXGA 2BU9A 1GSLA 1LJ7A 2RDNA 4XFIA 1KITA 3K75B 1WD4A 2OQ7A 1LOFC 4MV2A 2DDUA 4GH4C 3N4MA 4EN7B 5L73A 1LOBA 5FOJB 5JSOA 4GALA 3IIAA 2A75A 2BVBA 2G9ZA 4YW2A 5DAVA 3PLQA 4HT1T 2XHNA 2P3JA 4OI0A 3WF0A 3ZXFA 1PZ9A 1VBD2 4GKXA 1DYKA 2VL4A 3KSCA 1FXZA 1REFA 3MV11 4R4ZA 1SDDB 2VCAA 1AYN2 2HWD2 2JDHA 5F3GA 3U14A 5FPZA 2GSYA 2OUJA 1AR82 1PIV3 3S5QA 2R0FA 5DUVA 3ZMOA 4AZZA 1AR93 2D3RA 3PJQA 4HLTA 2MNGA 3AFGA 5FP7A 5FZHA 4XXAA 3H8RA 3VHOA 4BJ0A 3CL1A 1HQWA 1PIV1 5DN2A 5DZFA 1HRI3 4N43A 1JOJA 2VMFA 1S0DA 1MEC3 3BIWE 2ZGRA 4GWJA 1HRI1 3VDAA 1QJY3 5A3WA 4UOJA 4Q4Y3 1MEC1 5A3OA 4A7KA 2WKKA 4IGOA 1ZZ9A 1QJY1 1FT9A 3E5UA 4J25A 4Q4Y1 4DIQA 3FJSA 4Q4X2 1QNWA 2W9XA 5K4LA 2YC2A 1SFPA 2WNUA 5GLZA 4FPGA 4NN0A 4OVEA 5IUQA 3T4HB 3FHAA 3WV6A 1YIPA 5CFDA 1XE8A 4AFAA 1WCUA 1LHUA 2RM22 1PK6B 1NLQA 1GANA 1M06G 3A0KA 2QNKA 2JG9B 5DUWA 2OYZA 2YUEA 2Y38A 3AZVA 4K9SA 4Y1XA 3D3AA 2EXJA 1BVVA 4X6RB 3SKJE 1L7RA 4XQWA 3WCSA 2VGDA 3TB0A 2BYVE 2BV4A 1X82A 3MF9A 3AFKA 4KG0A 5FRAA 1CX1A 3PMSA 4M3CE 3WNNA 1QJX3 3DYMA 5H9PA 4IL7A 2HBTA 4NRPA 2VU9A 2V4AA 2BQPA 4XF3A 5JXGA 1QJX1 5FYBA 3LOBA 3AJZA 1Z0HA 3HN1A 2VXJA 4R9BA 5FYVA 4YFWA 2QQIA 5TSWA 3B02A 1L7QA 2RR13 5FKCA 1JYTA 4BM8A 1N47A 3SEEA 1DG6A 3MGUA 3ZXAC 4AI0A 1HJFA 1YWKA 2F6BA 4NHYA 2RR11 2WFF3 2V73A 4GQ7A 3S5AA 2VUJA 4MXVA 3MF6A 1RXGA 4ZZ8A 5GJ6A 3LOIA 2ADEA 2WFF1 4GAZA 4JRAA 5K0UC 2FDIA 2AACA 1DGRN 1H8TC 2W68A 2ET7A 4BIFA 4BK4A 1W6NB 1TME3 3H1WA 3POBA 3K4DA 4GXLA 1XSQA 1SDWA 3M1HA 5FY7A 2PQQA 5AVAA 1TME1 3HN3A 4TXWA 4YVWB 4L0PA 5JPMB 4OQ8A 2BBAA 3DN7A 2BOIA 1U0AA 2P3IA 4CP1A 1WMDA 4H3WA 2GMMA 1AYM3 2H0BA 1GFF2 4Y3OA 3WF4A 2FCTA 3NVCA 3ZXLA 3WHTA 4WM7C 3KT4A 1AYM1 1A6CA 2IVIB 1C8M1 2P1BA 4G3YC 2GMEA 2ZGPA 2ZMNA 4YSFA 1UF2C 1LKNA 4YZ5A 4NIHA 1CAWA 4XFGA 1W99A 4NOTA 2VNVA 4GMP0 4QHOA 1K3IA 3H3LA 4DXRA 4RFRB 2PFWA 1PHMA 4EJRA 3O1RA 5BNPB 1RB8G 1LESA 3ATGA 3N7MA 4QKFA 1W8NA 3VBHA 2FBEA 2I74A 2QQNA 4KBZA 4COUA 4QB2A 1Q5OA 5HPOA 5EJ3A 1QJU2 2FDKA 2FDJA 3BTZA 2RDSA 4FPLA 4CCOA 1J3PA 1NCRA 2EVXA 4HSJA 5CB7A 4FTBA 2NLRA 5HXMA 3PTYA 4NUBA 1YJKA 3ZYRA 3VD9A 3BTYA 4WBBA 3NW4A 4I01A 1H1IA 3BI3A 2FMDA 4AVCA 1S0IA 1GYKA 3LA3A 4TN7A 3BYWA 4MZUA 1R1A3 2HWF3 3C2UA 2CWSA 4DB5A 3KV9A 1Q8PA 3CJXA 3CLPA 4UW3A 5FZCA 1N3PA 1R1A1 1UMIA 2HWF1 2AH2A 2JB4A 2WNVA 3Q9OA 5FZ6A 3WLUA 3VBSA 4F83A 1IS5A 1GICA 1GWMA 5A7OA 4Y1UA 1DBNA 1RGSA 4P9LA 2VC9A 4QKBA 3NRUA 2VMHA 1I3HA 3LZZA 3PTRB 2VXRA 2X05A 2ZX1A 1HN0A 2XONA 4BQYA 2CDOA 1R083 3QCWA 4RFT0 3OJBA 4WV8A 2UY8A 4ASMB 3AMHA 3NV2A 4R52A 1VP6A 4W4ZA 1MQTB 5A33B 3VGIA 4NAOA 1NA1B 3DECA 3BGAA 4R9CA 4DZGA 2XDVA 1JTZX 4A41A 3UK9A 4HVRA 3OEAA 2ZHNA 5FO9B 1X7NA 3GBFA 3I2OA 1D4M2 1W8WA 1NE6A 3ST7A 5I0SA 2BDRA 3AZXA 2C6SA 2I45A 3WW1A 2C1FA 5IVEA 4WVVA 5FJKA 5A1AA 2ZMKA 4Q2FA 5FK8A 1UNBA 4YW7A 1J1LA 5ISLA 4TYSA 4KWKA 4UYBA 3T2OA 2NP0A 2WS92 4KMQA 2VO5A 5A70A 3I59A 2IZWA 1X50A 1GU3A 1SG3A 2UY9A 4K40A 1W9YA 4AVTA 1RVF3 1O4YA 2XJUA 1W6QA 1XNTA 4I0AA 1PO12 2HH9A 1CGPA 1S1AA 2ZGLA 4HFSA 1COV2 2CNAA 3TN93 2LRPA 4DS0A 1CIYA 3LF7A 2C24A 1PK6C 2O8OA 3TN91 3ZPOA 1GOFA 4QGMA 1U5YA 1PNFA 1SPPA 2JG9C 3O1VA 1UXXX 4JTOA 5JIUA 2Y33A 3R4SA 4MXWB 4HXCA 5FPLA 2WRAA 5FIXA 1UQXA 4D7SA 3A22A 4AFDA 2WSVA 4FPYA 1H4GA 1W0OA 4YW5A 3GBGA 1YQ2A 3N36A 1NXMA 3JBG3 4D69A 5KXBA 2MEV1 1GQPA 1OI6A 5FZOA 5CFDB 3H3UA 3JBG1 5BV6A 2QKDA 4KWJA 5ANNA 4AEMA 3PL0A 1LHWA 2XXZA 4XCBA 3VUOA 3DV8A 4XTPA 4MGSA 4BPZA 3RMYA 2JDZA 4TZDA 2BGCA 1SCRA 3E97A 1UZ0A 2VZSA 4Z82A 2O14A 3KF5A 3RWKX 2E9QA 3NNGA 3KVBA 5APAA 3O0WA 1MZFA 4JDOA 1QWRA 2QBXA 3P1IA 4BQ2A 5FUNA 1OLMA 5A7PA 4D0QA 5FYYA 3CMGA 2X09A 5FZIA 2PHLA 1D0HA 1G9FA 1LOFA 4YVWC 4RR3B 4ASLA 4E2GA 4GH4A 1YRZA 1AHSA 2L9LA 4NHLA 2PQSA 4LA2A 1CAXB 5CEHA 4M3CF 5T55A 4CP9A 3FHIB 4Y33A 4IEXA 1UOGA 4O61A 1W03A 4CPBA 1W6MA 5C71A 5KC5A 4UT5A 5HXVA 1L7LA 5FPUA 1Q43A 1EPWA 1JOPA 2GH2A 4AK3A 5EV7A 1ND3B 1WLCA 3HQXA 3PMEA 1ULGA 2OZJA 1G9AA 3MW2A 4AR2A 4O9GA 3MW3A 3J7HA 3T2TA 4KNCA 4UFJA 4OI2A 4Z2AA 5FWEA 4DOUA 1UL9A 4KH9A 3BODA 2E26A 3H1MA 3FE5A 1J1TA 1S2EA 4UW5A 1GP4A 2RS51 2Y8KA 4GIQA 3GALA 3MIBA 2OVUA 1PVXA 1W05A 1VB4A 1OPMA 1US2A 2K2SA 4WZCA 4YM2A 4E4HA 2VZUA 2YG0A 1C1FA 4GJYA 1AVBA 1AZDA 1SHWB 1ULEA 1AR73 1CD3G 2LM3A 3PUQA 4OHWA 3WNPA 1E5RA 3RPQA 1HN1A 4AW7A 3NMBA 4YW1A 4QHZA 4QQ2A 1AR71 3OPWA 1D4VB 5AC93 5JAXA 3ZYHA 2RMU3 3VBOA 2VQ0A 1F5FA 5AC91 1UIKA 1UU6A 2RMU1 2ZEWA 3AC0A 3MI8A 4XHBA 3URFA 4FOVA 2FHRA 4ZY9A 4ATEA 2QQLA 3S30A 3AKTA 5C8WA 2V09A 1BMV2 5F2SA 5T5LA 3IBMA 3B3QE 4URTA 3E1F1 5EJZB 5A3TA 5DAQA 1NCRB 1PIV2 2ILMA 5LY2A 3WUDA 3L9JT 1AR92 4AGGA 3NWKA 2ZPXA 4BQ3A 4LKDA 2Y34A 1LODA 3GBWA 3T0AA 1JHNA 2LALA 2VULA 1NCQB 3IWZA 5D2AA 5JMCA 5A80A 2W94A 1ASJ3 3VBRA 2IWGB 3VL9A 5C6CA 1MQTC 4NWWA 5JSRA 5F5QA 1NA1C 2ZAAA 1MR5A 1QJY2 3EJKA 3T4VA 1ASJ1 4Q4Y2 1TZOA 3J26N 3I3BA 2JE7A 3JD72 2PN5A 2VOTA 4XJAA 1KD7A 4UW4A 1B09A 3HAGA 3VBSB 5CKMA 2VOKA 2CAVA 3KMHA 4BMEA 5CADA 1D0GA 2D43A 3QH6A 2RE9A 2EIEA 2JENA 2LTNA 3Q8FA 2V5DA 1O3SA 4IXLA 5B4NA 5I0TA 1NQDA 5FLIA 1I9RA 3AZWA 1KGYA 2Q0AA 4X6QB 2DU1A 2BERA 1G7YA 4HK9A 1VBB2 2ZGSA 4BLIA 1NX9A 2WO7A 1ZBE2 2W95A 2WR9A 3PUHA 3AMMA 2E32A 1VMFA 1QY4A 4LOSA 4CDWB 3OEBA 1VAVA 3LA7A 2VCMA 4GA9A 5GLUA 4WM7A 4NHMA 1QJX2 5CISA 1XNCA 4N8MA 3MIGA 4N43C 3POEA 3KHBA 2VE1A 3PVNA 3UNPA 5FYMA 5C3PA 2H0VA 2QQPA 2AEZA 4LBMA 1UZVA 2GAUA 2OX0A 1U12A 1JU3A 2RR12 1X9PA 2VMIA 3I59B 4XJUA 3BN6A 1RTVA 1S55A 4Y5Z0 5KBFA 4E4DX 3W59A 4GB33 2VCCA 2VM9A 1PNGA 2WFF2 2VR4A 2XJPA 1FX5A 2VOXA 1IPKA 4JDMA 2DFCA 4JHTA 5FQ0B 1CJDA 3RDIA 4BZ4A 4GB31 4KQ7A 5CFDC 1JS9A 4AVBA 2ZZJA 2JE9A 4WVMA 2WZPP 4H7LA 4URAA 2E7TA 3ORJA 2A6WA 4Q4W1 2R1DA 1TME2 1O6UA 2Z42A 1IOAA 1RUI3 3IN9A 4ET7A 1J59A 4LBQD 5LY1A 1D2QA 5GZEA 1QKQA 1RUI1 4P9XA 3UETA 1FV3A 3VBFB 2SLIA 1AYM2 4W6WA 1GV9A 1ZYBA 5EYYA 2VUCA 2J1VA 1JI6A 1C28A 1GP5A 3WXPA 5A1LA 3B9CA 4XOGA 4FTEA 4XW3A 4NPRA 2BNOA 4PT6A 3POIA 3J7LA 1VIWB 5FZOB 2JDYA 4XZUG 3LEMA 3ZXDA 1UAIA 1DLCA 4RR3C 3LFMA 2ZX4A 3BCWA 5T50A 3I2FA 1U5XA 3PUIA 4N90A 2H6BA 4GJZA 1CZVA 1FYUA 4NR1A 2PXJA 1QDCA 4PJYA 4PBPA 2CV6A 1UYPA 4NWVA 4D8MA 1WZXA 1HDKA 4FOYA 1B35B 2WNEA 2QDNA 2VUDA 2R30A 4ARXA 2Z4FA 5M0TA 3H8XA 1I6XA 2NQYA 1ND3C 4J1XA 5H9QA 4AI1A 4B7KA 3JU9A 1UOJA 5A3UA 4UF0B 1AL23 2ZGOA 4FPJA 4CU6A 5GZGA 1KEXA 4XMAA 1C4RA 4TTGA 2YPJA 2VPVA 1JZ7A 1AL21 4PQ9A 2I2SA 4XAAA 4ES9A 1R093 4F7ZA 4LQRA 5E6HA 2CAUA 2PHRA 3TNQA 5FY1A 4LE4A 1UYYA 1W6OA 1JYXA 4CP9B 1R091 1Q8QA 3M3EA 1J84A 1MZ5A 1OA4A 1YC61 1RUNA 1R1A2 3ZYGA 2HWF2 2N7GA 2WYSA 4AI2A 4OHYA 5I0UA 4K21A 2PAMA 4LK7A 4NPMA 1D7PM 1UY2A 4XQ4A 2CYFA 4XUQA 5JXHA 4LOTA 3E5QA 1QOTA 5G04L 2E53A 2PTMA 5DAXA 3JB4C 3D5OA 4JKLA 3UT0A 1R082 5CZKA 4EE2A 4ZU4A 3WUCA 4RGGA 1PK6A 1QJFA 1AXZA 3HQUA 2DVBA 1PZ7A 2XUMA 3NNJA 4OUMA 4XILA 3ZFFB 4XURA 2JG9A 2TNFA 3FUQA 3SH4A 3RSJA 2LW8A 3MLJA 1OF4A 2D5FA 3OSDA 4QDSA 3KV6A 4XVHA 3WQ1A 3RGBA 3ZFGB 4RS5B 3RYRA 1DZTA 3NV3A 4RYDA 1LTEA 1NCRC 2YU1A 5DDJ2 1CWPA 2GC0A 2PYTA 3AVRA 3I3DA 1FV2A 3ZSKA 5FZBA 5EXOA 5JMOA 1V6MA 1OH3A 2R061 4UFKA 3B5LB 4HL0A 2ERFA 4MGQA 3VBOB 1LULA 4CCDA 4QHBA 3NKTA 3P6BA 2Q1MA 1DYOA 5T5OA 2FCUA 5C3SA 2E33A 4XACA 4FFGA 1RVF2 3WP4A 3VBSC 1IS4A 1WLTA 4DXSA 3FFQA 4BMBA 1TMF3 1KXGA 2WA4A 1VBA2 1RUF3 4I3GA 3ZXJA 3CHXA 4E27A 2BTVC 1PGL1 4JGYB 3TN92 3AYDA 5GZFA 4FP3A 3RJRA 2IVJA 4BXFA 1TMF1 2PLV3 2W52A 1RUF1 2QQMA 3ZR6A 2ETEA 2GN7A 4XAEA 3HBZA 4DRVA 1KFUL 4JAAA 3VBRB 1W6NA 2JWPA 4L9BA 2OT7A 3U4XA 2D97A 2DV9A 1Y43B 4COZA 5JI9A 4N9IA 4YVWA 3WDUA 4LKSA 4XHXA 2W1SA 2XQXA 4PLOA 1HB4A 2YV8A 3RI8A 4AWDA 1OC1A 4CDWC 3OOXA 3HJRA 5LK5A 3VD5A 1RHI3 3JBG2 4XUOA 4MGZE 1F4HA 2Q1ZB 2BUKA 2Z69A 4E4ZA 2EICA 2VQTA 2ZACA 2WWUA 4DUXA 2DCTA 1RHI1 1Y3TA 1WW6A 2WWSA 2ZX3A 1F2NA 3MEPA 1ENXA 2Y0IA 1W3VA 3M3CA 2FDHA 4XE9A 5EJ1B 4EWEA 1Y7BA 5SV8A 2Z5WA 3JQXA 5BNPA 3IMNA 5FZKA 3WW3A 2YDEA 4SLIA 5D1IA 3VZJA 4YWAA 3USSA 1O4ZA 2TUNA 3SCGA 4BK5A 3AL5A 3BIEA 3N9QA 5HCFA 5IK5A 5FY0A 2E63A 4IW3A 1AXKA 5FBJA 3TRSB 4AI9A 4QX8A 5FMBA 2A3YA 3FUOA 4CSWA 2AENA 3LD8A 2BFUS 4JQRA 3V56A 4MO3M 5A7NA 3BPZA 1X9TA 3M3IA 1YFXA 3VBFC 3ACFA 2D6KA 1N3QA 1H2LA 3DXTA 1R64A 4K8RB 4R8HA 2EAKA 1YEWA 3RZMA 5EQUA 3KQ4B 5JSPA 2GALA 1JU4A 1EAH3 2DUQA 4ARYA 4B4PA 4CU7A 1EYBA 1O5LA 1UOFA 1VALA 1VBE3 5F3EA 1EAH1 4PHZA 1OQ1A 3RZLA 3WT3A 1PVC2 4FVVA 3N7JA 3NSTA 1VBE1 3QBQA 1JUHA 4JDNA 5GLVA 4DY3A 5JLVA 2JIGA 1HV0A 3U37A 1LGCA 5FP4A 5KXCA 1Z7S3 3IDCB 3MLKA 3WOGA 1B35C 3P3PA 3O1MA 4RQPA 4UFIA 1QXRA 1QQP3 4BQWA 3GHNA 4MGYE 1Z7S1 3POWA 1NA1A 4N9HA 1QQP1 4XIKA 5A7QA 1W04A 2F17A 4O7XA 4Y5TA 3GNEA 2DCJA 1AR72 2OXBA 4YARA 4GWMA 1UYZA 4XFHA 4PCRA 1OQDA 3SHRA 4Q0UA 1K42A 5AC92 3ZFEA 5I0DA 2RMU2 4QPGB 4EV0A 4Y26A 1LHVA 2XJTA 3BU7A 4XXPA 5JOWA 4R9AA 4Y24A 1GWLA 4YPJA 1QOSA 4QD2A 1WLWA 1NAEA 4CA9A 2WL1A 2XWJB 2E7AA 4NPLA 4AI8A 4BH9A 1YNAA 2YB7A 2WAAA 5IK7A 1UYXA 2WQ4A 1E5SA 1HKDA 1ND2B 1UMZA 1S0GA 4IEPA 5KXEA 4ASKA 1QGLA 3ZSJA 3H8OA 5FKBA 1E57A 5T54A 2C26A 1SQ4A 3VD7A 2JDUA 3UGGA 2CGPA 1AX1A 3T08A 1W6OB 4C8DA 4E2SA 1ASJ2 3TBDA 3ZFFC 3IMMA 4YZ1A 4HPKB 1F15A 3HWJA 3LIGA 4MVTA 4XMIA 4F3JA 3UKVA 4MXWA 4RS5C 4D6QA 3I2IA 2RS33 3WP5A 1BEV3 4FXGB 4AHWA 3VDCA 5A3MA 1W6PB 2BOJA 3MDPA 3O1TA 4S2GA 1X8EA 3CDZB 2G9FA 2RS31 4DRRA 1BEV1 1YXWA 5FY4A 1ODNA 5CG8A 3JXSA 3FX3A 2W1WA 4Q1PA 3VBOC 4HMZA 4AOCA 3KV4A 1JMUB 4FPKA 2UYBA 4ZZ5A 4ORFA 4Q4V3 3N7LA 4KG8A 4XUNA 2QCSB 2R043 2F4PA 3VHPA 2ZAHA 3T09A 4Q0VA 1STMA 1ZZ7A 3VLBB 1Y9MA 2B46X 4Q4V1 4CDXB 3AL6A 4OLLA 1NY71 1ZREA 1SCSA 2R041 3SKVA 1BK1A 2CDPA 2ZGUA 4YM3A 4JGYC 3IDEA 2WO3A 4AF9A 4CYDA 4G4FA 5FK7A 1UXZA 3IB3A 1HW5A 2VNGA 3RNSA 3O1PA 2JDMA 1LB2A 5F6LB 2J1UA 3VBRC 1S0FA 2HWC2 2VTFA 4MLOA 1W2NA 5LZ6A 1URXA 5CNAA 5IFPA 4EN0A 2FCVA 5AFBA 4RR3A 3SCHA 1UO9A 1UU5A 2WO2A 4Z2WA 2BZDA 2VUAA 5C5TA 4CXXA 2G9GA 1CAXA 4CP2A 3DF0A 1XPWA 2D6OX 1CAUA 3IAQA 4GB32 1XU1A 2IXKA 3QD6A 4HANA 5CIRA 3BOWA 2VZOA 3WD5A 2GZWA 4AE2A 3WW2A 4OQ9A 3AMPA 1REDA 1TVGA 1CIWA 1ND3A 1XNDA 4J1WA 1UU4A 3R0RA 3ON7A 4PDWB 2B45X 2R073 2YC4A 2ZGQA 3PIGA 3DYOA 2IFRA 1RUI2 1AJOA 5IVBA 3N35A 5T5PA 5HBAA 2R071 4CPBD 2QZ3A 4V1PA 2ZEYA 2QQOA 2D6PA 3AB0A 2WT0A 5IFTA 1SFNA 1OH4A 2VW1A 5A32B 1C8M3 2GMPA 2BNMA 3G6JB 5DPNA 4B3NA 2YFUA 5BUVA 3RVHA 2B8MA 2OW4A 4CEYA 4IEOA 5HCHA 2VVEA 3OGRA 5BNOB 5L9BA 1ZVFA 1HX6A 2WDBA 3OF1A 2EIBA 2D40A 3AXEA 3GCWA 2B9UA 2RG4A 1LR5A 1RUE3 4Y20A 5LCWL 1A8MA 3GHMA 4RN5A 3WF3A 3CEWA 3MPBA 1ZRDA 2NZ9A 4LLFA 5JWPA 2QQJA 5C9AB 3BU0A 1RUE1 2X5IA 4B29A 1E5IA 1S0EA 3OG2A 5E16A 4FFFA 3KF3A 5FR3A 4EZHA 1RC6A 1OKOA 5SV5A 4I0BA 2ARCA 1LGNA 4JX0A 3ZXEA 4FAGA 5LA2A 1LGBA 4ZU7A 3HMYA 5C3OA 3ZLIA 2O1QA 5F32A 3ZYBA 1AL22 3KV5A 3O14A 2XKOA 4LHNA 4CVUA 1O3RA 4XBLA 2DTWA 1NCQA 1CVNA 4YNIA 2GC2A 3MIFA 5F5CA 5C4WB 1W06A 4PIYA 4CDQA 1KS4A 3ZYPA 5IVFA 3MUY1 3NQHA 4CXWA 1ENQA 4XEZA 5FZFA 3C7OA 4OUSA 4W6XA 1ULFA 4JQTA 4LXLA 1YQ5A 3H1YA 2W91A 1UY0A 2ZMLA 2ZX0A 5FPAA 3H7JA 3DEMA 1VAKA 1OXCA 3GF6A 3DKWA 3AP5A 3H8UA 1JZ2A 4QPGC 3DXUA 1EUTA 1WKYA 4QU1A 2AYHA 5HCBA 5I8TA 3ELNA 4K8FA 4KGGA 1POV3 3JB8A 1VLNA 1JODA 4QXBA 2Y6KA 4RQPB 5C5UA 2XBO3 3BVCA 1L3JA 1YLLA 5B4XA 5LEKA 3TEWA 3I54A 4XJ8A 1GNZA 1HRV3 1POV1 3WP3A 2IXHA 3AM2A 3LSEA 3N9NA 1O91A 1AX0A 1T6BX 2XBO1 3MYXA 4GKYA 4M3CB 1ND2C 4P9YA 4XF0A 4QWNA 3ZDSA 3KHCA 1Y9GA 1SLBA 1HRV1 2MPFA 3MUZ1 2ID4A 3FFZA 4IEUA 5F3CA 3WQ0A 4B4RA 1S0JA 2R6QA 1PO23 3GYDA 4CDWA 4HSLA 1HJGA 1V6NA 4A6OA 2RS13 3ETQA 4IQPA 3ZFEB 5BNNB 1PO21 1QEXA 4BQ5A 1QNYA 5LB6A 3VKLA 2HEYF 1W3XA 2RS11 1DP0A 4XBQA 1DZRA 3NV4A 1UPIA 1BKZA 2E31A 2XVKA 2Y6GA 1SACA 1ZZ8A 2DBIA 5FXZA 4AHYA 3INAA 2ZBJA 1F31A 3FC0A 4Q8LA 4XFBA 1MZEA 3WQ7A 1MVQA 5FQ0A 3I4IA 1TQ5A 4UBHA 3T3YA 5FYUA 2TBVA 2G4IA 1YQCA 2JDAA 3OGVA 3WNOA 4LUKA 2PLV2 3VZMA 1ULCA 1W9TA 4CUAA 4LKFA 4IGQA 1KFXL 3KS7A 4CDXC 2P17A 3U1XA 3LA2A 3ZSEA 3E6DA 2GP5A 4DNYA 1QDOA 2IXJA 1FMD3 3NKGA 5FZ9A 1W2TA 3QACA 5L7OA 1ONAA 1ENSA 3CJIB 4ITCA 4O9EA 4Y4YA 3VBFA 1VBC2 4QB6A 1FMD1 2ORZA 1KRIA 5JZGA 2MEV3 1LAJA 3CQOA 4EWDA 2JXAA 1RHI2 4OMDA 5LATA 2Q8CA 4RL7A 1W0NA 2DBNA 2Y26A 1JXNA 1SLCA 3U78A 2ADDA 1WD3A 4Q5OA 4KWUA 2QVSB 3ECQA 5GZDA 3WF1A 1O8SA 4QPYA 1OKQA 2KXLA 5J36A 1VPHA 5F9TA 1C1LA 3B01A 5DZEA 1RIRA 1CESA 5DUXA 1UX7A 2D6MA 3VKOA 3NJXA 3WSOA 2WT2A 1B35A 1VAMA 4CZSA 4PF1A 3JCIA 3T1MA 3I49A 4P5HA 1WCKA 4RSUA 2D5HA 1U5IA 5I8YA 2P3YA 2XOMA 3J9SA 1K5MB 1Q8OA 3ME2A 2B4KA 3ES4A 4XJWA 5ABJB 4UF0A 5L9RA 2C0ZA 2W39A 2YU2A 3MO4A 3VV1A 2ZHLA 3I2KA 1HLCA 3RFRA 1X36A 2YGMA 1O3QA 3LGRA 1H8VA 1HXS3 5J3UA 1CAUB 2A73B 2LUWA 1MS8A 3KD4A 1JYIA 1S4CA 4YZ3A 1CONA 1HXS1 1PX3A 3OGSA 4A4AA 5IVCA 5BNOC 1EAH2 4FPEA 1ZZCA 4IEWA 4YG6A 4UW6A 4A2UA 2R7EB 1VBE2 1LNSA 1RL3A 2OPKA 2VW0A 2YGLA 5FO7B 2J1EA 3RZKA 3VZOA 4CTEA 3I2JA 5BNPC 5C9AC 2RS53 2EXIA 4YGCA 1JYNA 1Z7S2 4ZXKA 1W8FA 2ENRA 3O0XA 4BYYA 4FPHA 1QQP2 3EHKA 3UYJA 1W8UA 3ZFFA 3WG3A 2Y6LA 1VRH3 2JX9A 5FPXA 2W08A 1IKQA 4CEYB 3QLQA 1NXD1 2R32A 1H6YA 2W46A 4RS5A 4IE0A 3ZFGA 5A1FA 1VRH1 4CDUB 5FOBB 4Y1YA 2W1UA 1IPSA 4IEZA 1DQ5A 3FN9A 4LTAA 4Y20B 5BYNA 5KXDA 1RUJ3 1WCDJ 3OB8A 2CU5A 2D44A 4IE7A 1OT5A 2PELA 1C5HA 2PHWA 2X5IB 3POGA 1QMJA 5C4WC 1MPXA 1RUJ1 1P8JA 4FPOB 1K5JA 1OLQA 4HKOA 4LBJA 4Q27A 5EYXA 5FDBA 4CXYA 1F8VA 1V0AA 3APBA 4LHSA 1DGWA 3AZYA 2HEWF 1MS5A 3O12A 2Y0OA 1MVEA 2WZEA 4B8EA 4RHV3 2PHTA 3V64A 5EWSA 3RYPA 3VHRA 1UY3A 3N9PA 1WWYA 4JGYA 4RHV1 1H4HA 2X29A 2P5BA 1HRI2 4RQPC 4C1XA 1YUDA 1MEC2 2BBVA 3JUUA 4CDQB 2VAUA 4CCEA 2VZTA 5JXIA 4YG0A 4QXKA 4RA0A 3GCXA 4NHXA 2RS32 3OBAA 4LO4B 3D8CA 3HIFA 2O0OA 3T2QA 4YZ4A 4M01A 4OZXA 4DEVA 3KVAA 3ZN6B 5BY5A 1W9SA 3GJAA 3I2HA 3ZFEC 5BNNC 1OOPB 2HWD1 3O7OA 3SH3A 2J22A 1I5ZA 5EIYB 1OPOA 2PAEA 4Q4V2 5H9SA 1OLME 1NY72 4ZXEA 2R042 3U07A 1AUYA 1LOEA 3ILRA 1UZZA 2VQAA 3RZHA 2JKBA 1BQPA 4YLZA 3JQWA 1YFYA 1T6GC 4DFSA 4AVVA 2FDGA 2DUOA 3LPFA 1GMMA 1GBGA 3S0MA 4BQXA 1LHOA 2Y6FA 4DQAA 5KHIA 1TNRA 3B94A 2A71A 4Q4X1 3U10A 1UY1A 2VTXA 4P5YA 5LRRA 4H2AA 5F7UA 5FZ0A 3CZUA 2VBPA 1MACA 4RGAA 3CJIC 3V65A 1W2UA 4GWIA 2JB8A 1FOD3 1HB2A 3K48A 2WWJA 3PDQA 4WM8B 3WG1A 4HKLA 2HLEA 5KC6A 4QT6A 2G19A 5FZ4A 2BRTA 1FOD1 1OURA 3MFAA 4MX3A 1ZRIA 5B2GB 5HCAA 2WIIB 4Y5SA 1PX4A 4ZHNA 1IZ3A 3NNMA 4Q4W3 1G9DA 1AR63 2OIIA 1OA2A 3HNMA 4SBVA 4N53A 2R072 5FPBA 1AR61 2JICA 2ET1A 1WUVA 2VBBA 2XLFA 1DQ1A 4KWLA 1ACCA 1UWWA 3LEKA 2JDPA 2QE3A 5IAXA 3TOJA 3NJZA 3TWIA 4XPVA 2ZEXA 5L7OB 4JGZB 5EHDA 5FTTC 1JZ6A 3RRDA 5IVVA 3UKNA 1C8M2 3H9AA 5JZGB 1K5MC 1ZA7A 3HEIA 5GLWA 2PHXA 2UU8A 4I09A 4IETA 5ABJC 3E5XA 1KJRA 1RXFA 5FLHA 5CBLA 2XGXA 3FMGA 1DF0A 1OQEA 4FFHA 2K9ZA 5T52A 5FZAA 3O1SA 3OUJA 2VBDA 5LK7B 1RUE2 2VMGA 4NMIA 1H1AA 1Q56A 1MS9A 4LUMA 5IVJA 1W90A 1IS3A 2RV9A 4KL1A 4QPGA 3PVEA 2Q8OA 4COVA 3K4ZA 3WX5A 3HVDA 1M4WA 2QQVA 2VJXA 2R1BA 3WDXA 2VMCA 2XVLA 1TEIA 1G9CA 1H6XA 3MBWA 2VVFA 5KHGA 1VMJA 1LU1A 1ND2A 4Q29A 1GP6A 1T2XA 2YBPA 3KZ4C 3CZJA 4R9DA 4QPWA 5FYCA 1GZCA 5LA9A 4LULA 3W5MA 2VTXJ 3U4SA 2FZ2A 2UURA 4I02A 4XTMA 2VZQA 2UWBA 2W92A 1OUSA 1UOBA 2NM1A 4HPKA 5DXDA 1DQ0A 3IKWA 2DVGA 3H42B 3ALQA 2J1AA 3J8F3 4CEYC 3HR9A 4HVQA 3MFCA 1RJ8A 4CDUC 4L99A 1QJU3 2KM2A 1W6PA 3J8F1 4NROA 4OZOA 1US3A 2AR6A 4QQOA 1VJ2A 5F1RA 1SBFA 1HQNA 1JZ3A 1ZRCA 4QQPA 5FBZA 1QJU1 1VB2A 3EQEA 4FQ4A 1OUXA 2W2IA 3MHZA 1N1VA 2JECA 4QDQA 2X5IC 1G6NA 4YYOA 1BYHA 1KDKA 3BPSA 4D6RA 1DDLA 2B5HA 2VMDA 3LPGA 4M00A 4U2AA 3ZO0B 5J1XA 1OVPA 2XBO2 4MH0E 3WCRA 4CDXA 2KR2A 3RQ0A 4ZONA 4BISA 1LOGA 1Q8SA 4UI9L 2GN3A 4J6GA 3AX4A 1AX2A 4XUPA 3VDDA 4NIGA 5I93A 4AGVA 3NNLA 2CTVA 5LRSA 2ZHKA 1VMHA 1XU2A 3F95A 2R063 4K1ZA 3VKNA 3ACIA 4KBBA 3FLRA 4NIAA 1WW4A 5LA1A 3J7NA 2RS12 1NCQC 2UYAA 4LR4A 5J7MA 2DUPA 1CR7A
chains in the Genus database with same CATH topology
2AGSA 1GR3A 4YRDA 4BA6A 4CDQC 1HQLA 1XYOA 3VL8A 1V6OA 2IXCA 4B4QA 2ZCWA 3M3QA 4HZFA 4Q8KA 1ZA4A 4HK8A 1DGRA 3OD4A 1CX4A 2IXLA 3WG2A 2ZGKA 1ZZBA 2XH6A 3LSDA 3RWNA 3WZ1A 1FI2A 1OOPC 1XNBA 4P9IA 5KHHA 3ZN4A 4AFBA 2P37A 2DFBA 2WSUA 1JBCA 4PDWA 1SLTA 2HWB3 4AQ6A 2GNDA 3OGJA 1ZRFA 3WDWA 1RUG3 2HWB1 1APNA 1FMD2 3KM5A 1BBT3 4L97A 1LECA 4LBNA 1RUG1 4AXOA 5A32A 1BBT1 2EXKA 1J3QA 2I07B 2K0GA 2MEV2 4LO5B 5FMOS 4AQ2A 4E9KA 1NE4A 3C3VA 1SBDA 2WC2A 5BNOA 4HVOA 4MUVA 2DVFA 3WG4A 2PAKA 3R4UA 4I0WB 3KGZA 4YZ2A 4WM8C 1V6JA 5C9AA 3WDVA 4JC1A 5AVPA 2XJRA 4A7YA 1YO8A 4OI1A 4AFCA 3EXUA 4KGQA 5JDBA 1V9U3 2HJIA 5L7OC 1FNZA 4JGZC 1BVP1 2WJSA 1V9U1 3ZSMA 4BOWA 1HXS2 4COYA 5JZGC 5C4WA 1NLRA 4WVZA 1FNYA 5J37A 3VN4A 1O7FA 3AP9A 4OHXA 4Y22B 4D94A 4N53B 4P14A 1UPSA 1XNKA 2ZABA 5EZWA 2A5ZA 4D7TA 3NL1A 4JV4A 2DTYA 1S2BA 1GKBA 2ZKNA 4XZPA 5J96B 1HIXA 1SLAA 1ULDA 1WMEA 5J48A 4AG4A 2RS52 3PHMA 1G9BA 4YGBA 4XF4A 2CL2A 1VRH2 4PBOA 3A4UA 3OY8A 4M3CA 4RD7A 4DINB 3ZMNA 4COWA 1NZCA 5H9RA 5LEJA 4K1YA 4UXAA 2KA3A 3E6BA 4LLOA 5DG2A 5K8SA 5BNNA 3SLIA 1C5IA 2VOWA 1LOCA 4P9WA 4AQSA 1H30A 1VR3A 4LT5A 4OHVA 4YVSB 1BCXA 1DIWA 2VECA 1TNFA 1EP0A 1XYPA 4Q26A 4RHV2 4WZFA 4QPIB 2R49A 5IK4A 2BNNA 4H7MA 2FZ1A 2YYOA 3I7DA 4PLNA 3EO6A 1WW5A 5E88A 1UD1A 1YHFA 3NAPB 4IV3B 1RUD3 1SFYA 2OZ6A 1RINA 2NN8A 3OBTA 3ZFGC 1WMFA 2IC1A 2EXHA 4QX5A 3CJIA 5CAZA 1RUD1 2ZGMA 5BNQA 4W65A 2FMYA 3D6EA 1LEMA 2YHJA 2ZJCA 1BMV1 3X29B 2MHFA 2ATFA 1GQGA 4XFAA 4FSJA 3WVJA 1LHNA 5E8AA 1AR91 1O3TA 3AYEA 4X8NA 1DQ6A 1YFUA 1LOAA 5CVRA 4QGLA 4M0HA 1XXNA 4NO4A 3TYJA 4C90A 2GU9A 4E2QA 4TLFA 3VDDB 4AGRA 3CU7A 1XRUA 1H0BA 1SEFA 2EALA 3JD73 1QF3A 1QXJA 4Y1VA 4K20A 2UWAA 3JD71 1K5MA 4AHZA 4FBFA 5ABJA 1F9KA 1DGWX 5GALA 2XWBB 4EN9B 2OA2A 5C33A 4XFCA 3BB6A 1IHMA 3D4KA 1JW6A 3OCPA 2X8KA 1FOD2 3V0BB 2DCZA 2H6CA 5K9YA 3WHUA 2VW2A 1H1MA 1VBB3 5C8CB 1PGW1 1OSGA 3AJYA 1ZBE3 1GZWB 3AYAA 4Q4W2 3RG0A 1AR62 1VBB1 1LCLA 2HWE3 2YROA 1ZBE1 3FWEA 3H3ZA 4EWAA 2IXIA 1R1ZA 2HWE1 3UKTA 4EROA 1O4TA 3WDYA 2IFWA 1IS6A 5CFCB 2ZHMA 5L36A 4GMP3 2Q30A 2CGOA 4P9JA 3UJQA 1PGSA 3OPZA 2DCYA 4AVAA 3MIDA 4G9SB 4GMP1 2ZGNA 1ZX5A 1FPN3 3M70A 5JR7B 1GZ9A 1MS1A 1QJZA 1A8DA 1HV1A 1NG0A 3QH7A 4YM3A 4W6YA 4E4SA 5L19A 3AKRA 3USUB 1WBLA 1FPN1 2B7YA 4AYUA 4CDUA 3DPRA 1RUH3 2B39A 1C57A 3OYWA 4FTSA 5ACA3 2CGNA 1OLRA 1RUH1 1WBFA 1QOOA 3VZLA 3ZSLA 5ACA1 4FO9A 4IEQA 5K7PA 2XKPA 2ES3A 4L2NA 3OGGA 2GC3A 3KT7A 4ES8A 3VBUB 4JTNA 4AEDA 4CEWB 4N53C 2XJQA 3H7YA 3ILNA 2PA7A 5D8AB 3ZPYA 1IQAA 4XF9A 3W9AA 3OTFA 2Q4SA 2JG8B 1R092 2C5DA 4TSVA 2WT1A 3SH5A 3J8F2 1WCSA 3M2MA 4K3UA 3S6PA 4JRLA 2YZ4A 5JPNB 1D2SA 2E6VA 2WQZC 3B7MA 3FBMA 4YM0A 1V6LA 1JH5A 3ZN6A 4XIOA 1SLLA 1OOPA 2FQPA 3N3HA 2EF6A 3WW4A 1N1TA 1CPNA 3UV9A 5EFUA 2XPJA 2XJSA 4TWTA 1S2KA 1YI9A 1RITA 3R4DB 4LO8A 4F8AA 5KHKA 4YVSC 4FCAA 1RUC3 1H2NA 4LBQB 2DWRA 3OY8B 4Q0QA 1H9PA 1WA4A 1RUC1 2R062 4QPIC 4HN1A 1EY2A 5I0RA 4OI4A 3VZKA 4Q0PA 3ZXKA 3WINE 5GLTA 4QQHA 3DL3A 3NAPC 4IV3C 1W0PA 4HN0A 4AHXA 1I1EA 3HD8B 4IV1A 3FBYA 4BWOA 3J4UH 1R081 5FFOC 4WM8A 3KT1A 1PGL2 5FLJA 3IPVB 1WW7A 3T1LA 1BZWA 4YM1A 4N7UA 1TMF2 3KCCA 5DDJ3 1RUF2 3ZYJB 4QU2A 4ATFA 2D98A 5IT6A 4H14A 3AP6A 1ZBA3 1MS4A 1POV0 5DDJ1 2XJVA 2E51A 3DUIA 2HWB2 3VKFC 1ZBA1 2D7FA 1CJPA 3VDDC 1RUG2 4CRQA 1J58A 1BBT2 4JGZA 4QM9A 3ZN5A 1YYNA 3MICA 2GDFA 4ISQA 1XYNA 5GM0A 3AMNA 2WZR3 5DUUA 1VBA3 1RVF1 1CN1A 1W39A 2DYCA 4LBLA 3M7AA 3GZUC 3ROUA 4C0BA 2WZR1 2O8QA 1VBA1 5T5JA 4JCKA 1Q3EA 3B93A 4N43B 4I2OA 1NYWA 3RYKA 2JJ6A 1FATA 5JCTA 2VH9A 3L2YA 4D7YA 2E7QA 4YG3A 1FAYA 2XLGA 1BJQA 3BTAA 4META 1ALYA 3ZIWA 5C8CC 4HETA 3SISA 3AKQA 2ZS6B 2ZOEB 5DG1A 2BWAA 2EA7A 4ONUA 4PDWC 2WNUB 4LHKA 4PF5A 5GKAC 3KB5A 1DHKB 3KLSA 4LO6B 1KDMA 2BW8A 1V9U2 5CFCC 2GNBA 3H50A 4LA3A 2D3SA 2XG3A 4A7ZA 4MYEA 1MZ6A 3ZVXA 4BCUA 3POSA 4KU7A 4M0NA 4BE3A 4S2DA 2SBAA 1DZQA 1EV13 2VOVA 4KU8A 4XDQA 2A6XA 1CAVA 4LBKA 1EV11 4S2FA 3VHNA 3GZAA 1DGLA 2ARBA 2GNTA 2XB6C 1A3KA 3EBRA 3VBUC 4K7JA 1QHDA 2YY1A 1C3HA 4CEWC 1JN2P 1H9WA 1RMU3 5D8AC 1NOVA 4MGIE 5FO9B 2GNMA 3DPRB 4BLJA 3JZVA 2YXSA 5KWRA 3OYWB 2JG8C 1RMU1 3FZ3A 4GULA 1Q8VA 1PVC3 1ZZ6A 2Q5TA 3I2DA 4EN6B 3SCFA 1SLIA 1LU2A 1DQ4A 2WFPA 4XYXA 3AP4A 1PMIA 1PVC1 1GQHA 2A70A 4YFZA 1U5ZA 1F5JA 3U0ZA 2RJLA 4AEDB 1XE7A 1IGOA 3PVOA 2P34A 3HT2A 2ARXA 1A78A 2XL9A 2D93A 4OFGA 3N7KA 4N7IA 3SXWA 1CAWB 1GNHA 2R0HA 5CA6A 4NHKA 1YFWA 3ACLA 3IT8A 1YJLA 3AK0A 2DF7A 3V0AA 2QFEA 4ISRA 4A3XA 1JUIA 1PZ8A 3VBHB 3M8LA 1AXYA 3LKJA 1RUD2 4Q1RA 3DGTA 5FREA 3LB9A 1VBD3 5A3LA 1BEV2 3ENRA 5BXXA 2HWD3 1AYN3 1QH6A 1VBD1 4U36A 3AKSA 4PIZA 3OD0A 1LEDA 1LENA 2BEOA 1AR83 5CU1A 1AYN1 2XVGA 1UIJA 3THTA 2NYYA 1BXHA 1AR81 1O5UA 1V70A 2BWCA 2D3PA 1N3OA 2RJKA 3HT1A 4QMAA 1AL0G 2WA3A 4FPCA 1REEA 1G86A 4X8PA 3MIEA 3RJ2X 2XL7A 2DVDA 1XQNA 2YMZA 3MLLA 2WNVB 3D0JA 2BVVA 4Q4X3 4XFFA 5JI7A 2AREA 2Z2SB 4BHPA 2HEVF 3AMQA 3SITA 2DCKA 4YGEA 5K0UA 3W58A 3TNPB 1UCXA 1H8TA 3MPPG 2RM23 4IV1B 5T3NA 2QZ2A 2RM21 3ZYIB 1IPJA 1PGW2 2A7AA 4XQDA 3M3OA 2AUYA 4IESA 4FPFA 4Y22A 4Z92B 1DLLA 1KJLA 2XLAA 2EIGA 4PLMA 2HWE2 3R05A 4Y1ZA 3AXDA 2HWC3 3VZNA 5I91A 3P3NA 4HKWA 4Z07A 2VY0A 4P9GA 2HWC1 4DXZA 2ZGTA 4AEJA 4OULA 4OHZA 3FLPA 2A6YA 4FOWA 3B69A 4LBOA 1W6QB 1ZNPA 1FPN2 3BALA 4MSVA 1OFNA 1SBEA 3MIHA 1UZYA 2WNUC 2ZTNA 3AZZA 3ZX7A 1YI7A 1RJ7A 1AF9A 2P2KA 3K51A 1IKPA 2AZ5A 2QUOA 4ZU5A 1OHFA 1RUH2 1DFQA 4INDA 1X33A 4FQZA 3D82A 4XETA 1ENRA 5ACA2 2PHFA 1J3RA 3WY6A 2VG9A 4YW4A 3GZTB 4IERA 1NLSA 2UWCA 2P3KA 3SNMA 3PVBB 1X8MA 2HKXA 2DURA 4YVSA 5FMOL 3ILFA 4LEJA 3WNXA 3WR0A 5J98B 2X53S 5F6KA 2ZKLA 2OUHA 1MS0A 4QPIA 2NMNA 3D0SA 4FT8A 4YGDA 1H2MA 3A0NA 1N1YA 1N1SA 3G7DA 3ZIXA 3UL2A 3NAPA 4IEVA 1QH7A 4L92A 2D6LX 1DYPA 4IV3A 1G8WA 3THPA 1YCIA 2XHKA 3DPRC 1OA3A 1MS3A 3B9IA 1AJKA 4Z1VA 3BOPA 2EAAA 3NO8A 3LAGA 1CAVB 3CF6E 1PM7A 1V6KA 4GH4B 2VNRA 2RHPA 2BFUL 1ZRRA 1UN1A 1OD5A 3H0OA 3LCPA 1DQ2A 3IM0A 4AVSA 4AEDC 1HRV2 1W6MB 1RUC2 4XJ9A 4AQTA 2A3XA 2VVDA 1KS5A 1KQRA 2HYKA 1WGPA 5JVVA 4B7EA 3POYA 4NVPA 1PO22 4S2HA 4FXKB 1V6IA 3RMXA 2QJVA 3O0VA 5KHJA 4I3PA 3NV1A 2CWMA 3KCXA 2QDRA 1ZM1A 4AFMA 3VBHC 2CY6A 3KCYA 4DY5A 1UKGA 3V0BA 2BPA2 2NMOA 4L8QA 1YIFA 2A3WA 2TEPA 1NQJA 4I30A 3S7IA 5C8CA 1CQ9A 2R16A 3CNAA 4LNVA 1GZWA 3KQRA 1D4M3 4ZKTB 1ZBA2 3M4FA 4XJZA 3PJYA 2GH8A 2Z79A 1D4M1 3V0AB 4AI3A 4FAHA 4AEKA 2ZX2A 4LHLA 2W0XA 3AP7A 5FCCA 5CFCA 1QU0A 2WS93 1OMIA 1UW8A 2JD4A 2NPIA 3E6CC 1JYCA 2WNVC 2WS91 1OFSA 1PO13 2A6VA 2WZR2 3AKPA 3KGLA 1V00A 2PHUA 4H55A 1COV3 3PNAA 3USUA 3S7EA 3RI9A 1PO11 5HI0A 2A6ZA 4MGKE 4CP0A 1COV1 4UBGA 4IV1C 3TAYA 2PLV1 3ES1A 4DPNA 3MW4A 4IEYA 2DU0A 5IK8A 2PHDA 3RZZA 1H2KA 4C1WA 1RUOA 3FLTA 5DZGA 3MZHA 1VBC3 4DMIA 5JIAA 4FOQA 4WVWA 2D6NA 2WLQA 3VBUA 1VBC1 4CEWA 4BIOA 1UX6A 1QXPA 4PIXA 5K0UB 5D8AA 2WLPA 1CPMA 3IDBB 1H8TB 2ZZQA 3R6SA 4LO7A 1TE1B 4XF1A 2V5YA 2JG8A 1SMVA 3WDTA 2DVAA 5E1RA 5J09A 1DU3D 4C91A 3LWCA 1C8NA 3O5SA 3L2HA 1WLDA 2VNOA 5E89A 4D3WA 4C0HA 4YW3A 2C9AA 4WM7B 5JOYA 5JOZA 1UKRA 3CO2A 1S0CA 5FO8B 1EV12 4L11A 4BQ1A 1S0BA 1LRHA 4HBNA 4R4XA 3RS6A 1Y9QA 3ASIA 5I8SA 3SMHA 3AYCA 1EPZA 5CG9A 2B42B 3VKMA 5JOXA 4QM8A 4Z8BA 4LBQA 3QOPA 1RMU2 1GLHA 2GC1A 3B00A 5AFEA 4WVMB 5BPXA 2ZA9A 4QGNA 1RUJ2 3I8TA 4Q0SA 3OBRA 4K6BA 1Z78A 2WINB 4GWNA 4FP2A 3UJOA 4EN8B 5FAXA 4LE3A 5GZCA 1MQTA 4XBNA 4QQLA 5A33A 4JVAA 2JEMA 3U11A 3WP6A 3IPVA 2YC0A 3ZXGA 1GSLA 1LJ7A 4XFIA 1KITA 1WD4A 1LOFC 4MV2A 4GH4C 3N4MA 4EN7B 5L73A 1LOBA 5FOJB 5JSOA 4GALA 3IIAA 2A75A 2BVBA 4YW2A 3PLQA 4HT1T 2P3JA 3ZXFA 1PZ9A 1VBD2 4GKXA 1DYKA 3KSCA 1FXZA 1REFA 4R4ZA 1AYN2 2HWD2 5FPZA 2GSYA 2OUJA 1AR82 1PIV3 2R0FA 5DUVA 3ZMOA 1AR93 2D3RA 3PJQA 4HLTA 2MNGA 3AFGA 4XXAA 3VHOA 3CL1A 1HQWA 1PIV1 5DZFA 1HRI3 4N43A 1JOJA 1S0DA 1MEC3 3BIWE 2ZGRA 1HRI1 1QJY3 4Q4Y3 1MEC1 4A7KA 2WKKA 1ZZ9A 1QJY1 1FT9A 3E5UA 4Q4Y1 3FJSA 4Q4X2 1QNWA 2WNUA 5GLZA 4FPGA 4NN0A 4OVEA 5IUQA 3WV6A 1YIPA 5CFDA 1XE8A 4AFAA 1LHUA 2RM22 1PK6B 1GANA 1M06G 3A0KA 2QNKA 2JG9B 5DUWA 2OYZA 2YUEA 2Y38A 3AZVA 4K9SA 4Y1XA 2EXJA 1BVVA 4X6RB 4XQWA 3WCSA 2VGDA 3TB0A 2BYVE 1X82A 3MF9A 3AFKA 4KG0A 5FRAA 3PMSA 4M3CE 1QJX3 5H9PA 4IL7A 2VU9A 2BQPA 4XF3A 1QJX1 3LOBA 3AJZA 1Z0HA 3HN1A 4R9BA 5TSWA 4YFWA 3B02A 2RR13 4BM8A 1N47A 1DG6A 3MGUA 3ZXAC 4AI0A 1YWKA 2F6BA 2RR11 2WFF3 2V73A 4GQ7A 2VUJA 4MXVA 3MF6A 5GJ6A 3LOIA 4JRAA 2WFF1 5K0UC 1DGRN 1H8TC 2W68A 2ET7A 4BIFA 1W6NB 1TME3 3H1WA 4GXLA 1SDWA 3M1HA 2PQQA 5AVAA 1TME1 4YVWB 5JPMB 3DN7A 2P3IA 1U0AA 4CP1A 1WMDA 4H3WA 2GMMA 1AYM3 2H0BA 1GFF2 3ZXLA 3NVCA 3WHTA 4WM7C 3KT4A 1AYM1 1A6CA 1C8M1 4G3YC 2GMEA 2ZGPA 2ZMNA 4YSFA 1UF2C 1LKNA 4YZ5A 1CAWA 4XFGA 4NOTA 4GMP0 2PFWA 1PHMA 4EJRA 5BNPB 1RB8G 1LESA 3ATGA 3N7MA 3VBHA 2FBEA 2I74A 4COUA 1Q5OA 5EJ3A 1QJU2 4FPLA 1J3PA 1NCRA 2EVXA 4HSJA 5CB7A 4FTBA 2NLRA 3PTYA 1YJKA 3ZYRA 4WBBA 3NW4A 4I01A 1H1IA 2FMDA 4AVCA 1S0IA 1GYKA 3LA3A 4MZUA 1R1A3 2HWF3 3C2UA 2CWSA 4DB5A 1Q8PA 3CJXA 3CLPA 4UW3A 1N3PA 1R1A1 3Q9OA 2HWF1 2AH2A 2WNVA 3WLUA 3VBSA 4F83A 1IS5A 1GICA 4Y1UA 1DBNA 1RGSA 4P9LA 2VMHA 1I3HA 3LZZA 2VXRA 2ZX1A 1R083 3QCWA 4RFT0 3OJBA 4WV8A 2UY8A 4ASMB 3AMHA 3NV2A 4R52A 1VP6A 1MQTB 5A33B 3VGIA 1NA1B 4R9CA 4DZGA 1JTZX 3UK9A 4HVRA 2ZHNA 1X7NA 3GBFA 1D4M2 3ST7A 1NE6A 5I0SA 3AZXA 2I45A 3WW1A 2C1FA 4WVVA 2ZMKA 4Q2FA 1J1LA 4TYSA 4KWKA 2NP0A 2WS92 3I59A 2IZWA 1X50A 2UY9A 4K40A 4AVTA 1RVF3 1O4YA 2XJUA 1W6QA 4I0AA 1PO12 1CGPA 1S1AA 2ZGLA 4HFSA 1COV2 2CNAA 3TN93 4DS0A 1PK6C 2O8OA 3TN91 4QGMA 1U5YA 1PNFA 2JG9C 4JTOA 5JIUA 3R4SA 4MXWB 4D7SA 4AFDA 2WSVA 4FPYA 1H4GA 1W0OA 4YW5A 3GBGA 3N36A 1NXMA 3JBG3 4D69A 5KXBA 2MEV1 1OI6A 5CFDB 3H3UA 3JBG1 5BV6A 2QKDA 4KWJA 4AEMA 1LHWA 3VUOA 3DV8A 4XTPA 4BPZA 3RMYA 2JDZA 4TZDA 2BGCA 1SCRA 3E97A 4Z82A 2E9QA 3O0WA 1MZFA 4JDOA 1QWRA 2PHLA 1D0HA 1G9FA 1LOFA 4YVWC 4RR3B 4ASLA 4E2GA 4GH4A 1YRZA 1AHSA 4NHLA 4LA2A 1CAXB 4M3CF 5T55A 3FHIB 4IEXA 1W6MA 5KC5A 5HXVA 1Q43A 1EPWA 2GH2A 4AK3A 5EV7A 1ND3B 1WLCA 3HQXA 3PMEA 1ULGA 2OZJA 1G9AA 3MW2A 4O9GA 3MW3A 3T2TA 4KNCA 4OI2A 4DOUA 1UL9A 4KH9A 3BODA 3H1MA 3FE5A 1J1TA 4UW5A 2RS51 4GIQA 3GALA 3MIBA 2OVUA 1PVXA 1VB4A 1OPMA 2K2SA 4WZCA 4YM2A 1C1FA 1AVBA 1AZDA 1ULEA 1AR73 1CD3G 2LM3A 4OHWA 3RPQA 4AW7A 4YW1A 4QQ2A 1AR71 5JAXA 1D4VB 5AC93 2RMU3 3VBOA 2VQ0A 1F5FA 5AC91 1UIKA 1UU6A 2RMU1 3MI8A 4XHBA 3URFA 4FOVA 2FHRA 4ATEA 3S30A 3AKTA 5C8WA 2V09A 1BMV2 5T5LA 3IBMA 3B3QE 4URTA 1NCRB 1PIV2 2ILMA 3WUDA 3L9JT 1AR92 4AGGA 3NWKA 2ZPXA 1LODA 3GBWA 1JHNA 2LALA 2VULA 1NCQB 3IWZA 5JMCA 1ASJ3 3VBRA 2IWGB 3VL9A 5C6CA 1MQTC 4NWWA 5JSRA 5F5QA 1NA1C 2ZAAA 1MR5A 1QJY2 3EJKA 1ASJ1 4Q4Y2 3J26N 2JE7A 3JD72 2PN5A 4XJAA 1KD7A 4UW4A 1B09A 3HAGA 3VBSB 2VOKA 2CAVA 3KMHA 4BMEA 5CADA 1D0GA 2D43A 3QH6A 2RE9A 2JENA 2LTNA 1O3SA 4IXLA 5I0TA 1NQDA 5FLIA 1I9RA 3AZWA 2Q0AA 4X6QB 2DU1A 1G7YA 4HK9A 1VBB2 2ZGSA 4BLIA 1ZBE2 3AMMA 1QY4A 4CDWB 1VAVA 3LA7A 5GLUA 4GA9A 4WM7A 4NHMA 1QJX2 1XNCA 3MIGA 4N43C 3PVNA 2H0VA 2QQPA 4LBMA 2GAUA 1U12A 2RR12 3I59B 2VMIA 4XJUA 1RTVA 1S55A 4Y5Z0 5KBFA 4E4DX 3W59A 4GB33 2WFF2 1PNGA 2XJPA 4JDMA 1FX5A 2VOXA 1IPKA 5FQ0B 2DFCA 4BZ4A 1CJDA 3RDIA 4GB31 4KQ7A 5CFDC 4AVBA 2ZZJA 2JE9A 4WVMA 2WZPP 4H7LA 2E7TA 4Q4W1 2A6WA 2R1DA 1TME2 2Z42A 1IOAA 1RUI3 3IN9A 1J59A 4LBQD 1D2QA 5GZEA 1QKQA 1RUI1 4P9XA 3VBFB 1FV3A 2SLIA 1AYM2 4W6WA 1GV9A 1ZYBA 5EYYA 1C28A 3WXPA 3B9CA 4XOGA 4FTEA 4XW3A 4NPRA 2BNOA 1VIWB 3ZXDA 1UAIA 4RR3C 2ZX4A 3BCWA 5T50A 1U5XA 4N90A 2H6BA 4NR1A 1FYUA 1QDCA 4PJYA 4PBPA 2CV6A 4NWVA 1HDKA 4FOYA 1B35B 2WNEA 2QDNA 2R30A 1I6XA 2NQYA 1ND3C 4J1XA 5H9QA 4AI1A 4B7KA 3JU9A 1AL23 2ZGOA 4FPJA 4XMAA 1C4RA 2YPJA 2VPVA 1AL21 4PQ9A 2I2SA 4ES9A 1R093 4F7ZA 2CAUA 2PHRA 3TNQA 4LE4A 1W6OA 1R091 1Q8QA 3M3EA 1MZ5A 1OA4A 1RUNA 1R1A2 3ZYGA 2HWF2 2N7GA 4AI2A 4OHYA 5I0UA 4K21A 2PAMA 4XQ4A 2CYFA 3E5QA 1QOTA 2E53A 2PTMA 3JB4C 3D5OA 1R082 4ZU4A 3WUCA 4RGGA 1PK6A 1AXZA 4OUMA 2DVBA 1PZ7A 2XUMA 4XILA 4AF9A 5GZGA 3ZFFB 1ZRDA 2JG9A 2TNFA 3FUQA 3SH4A 3RSJA 3MLJA 2D5FA 3WQ1A 3ZFGB 4RS5B 3RYRA 1DZTA 3NV3A 1LTEA 1NCRC 5DDJ2 2GC0A 2PYTA 1FV2A 3ZSKA 5EXOA 1V6MA 2R061 3B5LB 4HL0A 2ERFA 3VBOB 1LULA 4QHBA 3NKTA 2Q1MA 5T5OA 1RVF2 3WP4A 3VBSC 1IS4A 1WLTA 3FFQA 4BMBA 1TMF3 1KXGA 2WA4A 1VBA2 1RUF3 4I3GA 3ZXJA 1PGL1 4E27A 2BTVC 4JGYB 3TN92 3AYDA 5GZFA 4FP3A 3RJRA 1TMF1 2PLV3 2W52A 1RUF1 2ETEA 2GN7A 4DRVA 3HBZA 1KFUL 4JAAA 3VBRB 1W6NA 4L9BA 3U4XA 2D97A 2DV9A 1Y43B 4COZA 5JI9A 4N9IA 4YVWA 3WDUA 4XHXA 4PLOA 4AWDA 2YV8A 3RI8A 4CDWC 5LK5A 1RHI3 3JBG2 4MGZE 2Q1ZB 2BUKA 2Z69A 4E4ZA 2ZACA 2DCTA 1RHI1 1Y3TA 1WW6A 2WWSA 2ZX3A 1F2NA 3MEPA 1ENXA 2Y0IA 3M3CA 4OI0A 4XE9A 4EWEA 1Y7BA 5SV8A 2Z5WA 3JQXA 5BNPA 3IMNA 3WW3A 2YDEA 4SLIA 5D1IA 3VZJA 3USSA 1O4ZA 2TUNA 3SCGA 5HCFA 5IK5A 2E63A 1AXKA 3TRSB 2A3YA 3FUOA 2AENA 4JQRA 2BFUS 3V56A 3BPZA 3M3IA 1YFXA 3VBFC 2D6KA 1N3QA 1H2LA 4R8HA 2EAKA 5JSPA 2GALA 1EAH3 2DUQA 4B4PA 1EYBA 1O5LA 1VALA 1VBE3 1EAH1 1OQ1A 3WT3A 1PVC2 4FVVA 3N7JA 3NSTA 1VBE1 3QBQA 1JUHA 4JDNA 5GLVA 4DY3A 5JLVA 1HV0A 1LGCA 5KXCA 1Z7S3 3IDCB 3MLKA 3WOGA 1B35C 3P3PA 4RQPA 1QXRA 1QQP3 3GHNA 4MGYE 1Z7S1 3POWA 1NA1A 4N9HA 1QQP1 4XIKA 3GNEA 2DCJA 1AR72 4YARA 4GWMA 4XFHA 4PCRA 1OQDA 3SHRA 4Q0UA 5AC92 3ZFEA 2RMU2 4QPGB 4EV0A 4Y26A 1LHVA 2XJTA 3BU7A 4XXPA 5JOWA 4R9AA 4Y24A 1QOSA 4QD2A 1WLWA 2WL1A 2XWJB 2E7AA 4AI8A 4BH9A 1YNAA 5IK7A 2WQ4A 1HKDA 1ND2B 1UMZA 1S0GA 4IEPA 5KXEA 1QGLA 3ZSJA 1E57A 5T54A 1SQ4A 2CGPA 1AX1A 1W6OB 4E2SA 1ASJ2 3TBDA 3ZFFC 4YZ1A 4HPKB 3HWJA 4MVTA 4XMIA 4F3JA 3UKVA 4MXWA 4RS5C 2RS33 3WP5A 1BEV3 4FXGB 4AHWA 5A3MA 1W6PB 3MDPA 4S2GA 1X8EA 2G9FA 2RS31 4DRRA 1BEV1 1YXWA 5CG8A 3FX3A 4Q1PA 3VBOC 4HMZA 4FPKA 2UYBA 4ORFA 4Q4V3 3N7LA 4KG8A 2QCSB 2R043 2F4PA 3VHPA 2ZAHA 4Q0VA 1ZZ7A 3VLBB 2B46X 4Q4V1 4CDXB 1ZREA 4OLLA 1NY71 1SCSA 2R041 1BK1A 2ZGUA 4JGYC 3IDEA 4CYDA 4G4FA 1HW5A 2VNGA 3RNSA 1LB2A 5F6LB 3VBRC 1S0FA 2HWC2 4MLOA 1URXA 5CNAA 4EN0A 5AFBA 4RR3A 3SCHA 1UU5A 4Z2WA 2VUAA 2G9GA 1CAXA 4CP2A 3DF0A 4GB32 2D6OX 1CAUA 4HANA 3WD5A 1XU1A 2IXKA 3QD6A 5CIRA 4AE2A 3BOWA