4JQRA

Crystal structure of a duf4465 family protein (baccac_02373) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
KNEVVVSFENLLTEENSQFIADGTPNNQAFQETDFKDPKNLINFNHYYADWGSGYSFAGFSYMNITDNQTANSPAPITGKAKIGSVYIGVDSTDGEYGTPAILTILDTNYKLKGTWIANSTWAYMGMIQGDGYARAFKAGDWYKVTATGYDEAGNETGKAEILLANYKTDNDLPVKEWIWFDLTPLQNAVKVKFIPDSSDKNEYGMNTASYFCLDGITLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14717 DUF4465 Domain of unknown function (DUF4465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1350 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jqrA00
4E9KA 4JQRA
chains in the Genus database with same CATH superfamily
1OC1A 4JGZC 2GMPA 1ZNPA 4UFLA 1PO21 2HWE2 2LTNA 3DYOA 1LU2A 5L73A 3BOWA 2DVGA 4Q4W1 5HCHA 2JWPA 4R9CA 5FQ0B 4QB6A 5C9AB 1UY4A 5I8YA 4S2DA 2YC0A 1C4RA 1O4TA 4AG4A 4YVWA 2ZA9A 2I45A 3I2JA 3MYXA 3H3UA 3PUQA 4FOYA 4CDUB 4P9WA 2P4EA 4HG6B 4Y24A 1W6PA 2P34A 5FYTA 1PX4A 4MADA 3INAA 4QHOA 1WMDA 4IESA 4XW3A 4J6GA 4CEWA 5E8AA 4DRVA 2Q30A 2R073 3LDBA 4HKOA 4XTPA 5EP9A 5FAXA 5FWEA 4Y20B 4U2AA 4XMIA 5FTTC 2DUQA 2TEPA 2AUYA 1IG3A 5DAVA 1ACCA 2DF7A 4FQZA 3PTYA 4LPLA 4XBLA 1NCRC 2RM22 2X5IC 4P9XA 3OYWB 1SDDB 4OI0A 1WMFA 3KVAA 1C57A 1HX6A 4LBMA 4ISQA 3ZFGC 2Y6HA 4W4ZA 4F8AA 1ND3C 2R072 4TXWA 3ZFEC 1YCIA 4CPBA 3U14A 1WW6A 5FYCA 3PIJA 4ZZ8A 3UJOA 3NV3A 4AEMA 3WP4A 4LBLA 4CEYC 5A32B 3ELNA 5CFDA 2D3SA 1BCXA 1JU3A 2WO3A 2C9AA 1MACA 1OURA 3FFQA 1BBT1 2D3PA 2VW1A 4JVAA 3LA7A 2HBTA 3ON7A 3VZNA 5BV6A 3T1LA 2EAAA 2FHRA 1YQCA 2VZSA 3OBTA 2D7FA 3B7MA 2XJTA 1DF0A 1ZZBA 3POEA 1T6BX 3KSCA 1CX1A 2ZS6B 2BOJA 2YBPA 3O12A 1VRBA 1SLBA 1PO11 2ORZA 1X8EA 3OJBA 2HYXA 3WXPA 2RS31 1QH6A 4PDWB 4JDOA 1ZZ7A 4OYUA 2P3IA 1LESA 4XUPA 4R8HA 4P9YA 3MEPA 5FYYA 1ASJ1 5FRAA 4UW3A 1UYPA 3H42B 3NJYA 1FX5A 5KC6A 4GH4A 4HSLA 2W1UA 3M2MA 2C6SA 4GMP1 1H6YA 3ZKUA 1W9TA 4XVHA 3M3OA 3ZDVA 1PNFA 4URAA 1NE6A 3A4UA 1W2UA 1KEXA 3ILNA 4BOWA 5HBAA 1PIV1 4AEJA 1BVVA 3IDBB 1JMUB 3VZOA 2WNVB 3T09A 4N9HA 4GAZA 4OHZA 1JHNA 3DYMA 4MUVA 1S0GA 1WWYA 4XETA 1W2NA 4OMCA 1YEWA 1N3QA 3OB8A 1O5LA 4P5HA 5JSPA 1PK6A 4Z2AA 1F2NA 2D6PA 4XZUG 1H30A 5BNQA 3NSTA 2W39A 2CYFA 2PQSA 2ARXA 5LWBA 4Y33A 2CHHA 1C8NA 1LOFA 2RMU3 2E26A 1ZZCA 4PI0A 4WM7B 5FJKA 5FYHA 3LEKA 2ZGNA 3AYAA 3OG2A 3GALA 4INDA 1CZTA 2D6LX 2O1QA 2OUJA 4HMZA 1W39A 4BIOA 1JYWA 5JOXA 2RVAA 3ZMNA 2XWBB 3FX3A 2AEYA 1D0HA 4C1XA 1GYKA 1HQNA 3CL1A 2MEV3 3AB0A 2VNRA 3VL9A 2XJVA 5ABJC 1J3PA 4M01A 4QPGC 1U5ZA 2X8KA 3IBMA 1QJU3 2RMU2 1G86A 3FJSA 4HSJA 4NAMA 5EXOA 5GM0A 3THPA 3WF1A 3S6PA 4OFGA 4XQ4A 2VXRA 2AENA 3WDTA 1UXZA 2Z5WA 1W8UA 5LY1A 4IEPA 3J4UH 3M4FA 4P00B 4QPIB 5F32A 5L7OB 2ARAA 2KM2A 2SLIA 2DTWA 4N90A 5DUXA 4DMIA 5IK8A 2MEV2 4LOTA 1AL21 3MIBA 1AHSA 5ACA1 3CEWA 1GOGA 2NQYA 1YQ6A 1V6LA 5JUVA 3VKMA 1QJU2 5C8CC 2Y6GA 3H0OA 3R4UA 3ZX7A 4YW2A 3QCWA 1K5MA 1W03A 1XRUA 3IB3A 3T2TA 4AVCA 4ATEA 4BU2A 5K8SA 2XB6C 3VKLA 1BEV1 1GBGA 4AE2A 1PZ8A 4BHPA 1XJAA 4B4RA 3OPTA 3A22A 2DVBA 1OT5A 2R043 3O1VA 1G8WA 1YIPA 4LKDA 4FVVA 2B46X 2WWSA 2ZGTA 3D3AA 1M06G 1GWKA 2WO1A 5A70A 4AHYA 1Q8VA 3J7HA 3ZKYA 1VPHA 3BGAA 5LEJA 1W8TA 4AWDA 3I2DA 3A0NA 3N35A 4HL0A 1W3XA 1HV0A 2ZHLA 4Q4V3 3WF3A 4AVBA 5IVCA 1V6OA 1HXS3 2VZUA 3FE5A 5DUVA 3EBRA 3D6EA 2QQNA 1CPNA 2PELA 4IUGA 1SLIA 1YJLA 2BGPA 2GNMA 4RL7A 1PVC1 5KC5A 1D0GA 1ND2B 1LULA 2I07B 2JD9A 2R042 4YG6A 1WA6X 3KV9A 5DAWA 3UV9A 3WDWA 3WQ7A 1GICA 2JG9A 3BALA 4RQPB 1F15A 2Q8EA 3DPRB 1SCRA 1WD4A 4GIQA 1HRI1 1VJ2A 2VAUA 4PQQA 2ZGMA 2HWC1 3ZLIA 2IXIA 2Q5TA 1WMXA 2GH2A 1CAUB 4Q4V2 4QGLA 1W6QA 4YVSB 5T5LA 3QH6A 3BTYA 1GFF2 1HXS2 2GC1A 5F3CA 4A3XA 1J1LA 4LHKA 1EV11 4YNIA 4C91A 1ONAA 3OOXA 2GMEA 1JOJA 1LGNA 2ENRA 4XUOA 3Q8BA 1IG0A 1R081 3T0BA 5BNNB 1W0OA 2DBIA 4CP1A 3JUUA 2H0VA 1NLSA 4MHUA 3N9MA 4AEDB 1QXRA 2XG3A 2XOMA 3WW4A 5CG8A 4RS5B 3APBA 5HV0A 2O8OA 4IGPA 4JKKA 4NHKA 2EAKA 4AVAA 3W5MA 3H9AA 3IT8A 2HJIA 1HIXA 1GV9A 4JRLA 1VBE3 4AXOA 4FPJA 1RINA 2XL7A 1ZRCA 4BQ2A 1Z7S3 4ZHNA 1OQEA 2XJPA 3WP5A 3NV1A 4A45A 1DYPA 2ILMA 2R16A 3H3ZA 1DQ4A 3ITQA 4HK8A 1LU1A 2OW4A 3LKJA 1OLME 3I3BA 1UO9A 2V4AA 4GH4C 1XPWA 4ZS3A 3NVCA 3IPVA 3AKQA 3IMNA 4W6XA 1G9CA 3ILFA 3FHAA 4LORA 4O7XA 4B1MA 1VBE2 1P8JA 5AC93 5BNPB 1KS5A 4FSJA 2WFF1 2J7MA 3WNPA 1ZVFA 4XJUA 5KWRA 1ZRDA 1Q8PA 1QOSA 1Z7S2 2W1WA 4GULA 4XXPA 5F2SA 2PHXA 5EJ1B 4EYUA 2IXKA 4B29A 4QHBA 4IEOA 4CVUA 1LJ7A 1RUC1 5FXZA 5A7SA 4K8FA 5CA6A 4B4QA 5HXMA 4AI8A 1DZTA 5IFTA 2VL4A 2WR9A 2WS93 1W6MB 1AL0G 2GH8A 1LGBA 4CDXC 4EE2A 3JCIA 1J59A 4YM3A 1RUJ3 1PK6C 2VH9A 4IV3A 5AC92 5LK7B 5CU1A 4C8DA 1W8ZA 1YLLA 5BXXA 1JZ2A 5K4LA 1JU4A 4COWA 1VBD3 3HNBM 2CAUA 3NJXA 5FO7B 4ZKTB 3ZFFA 1H1IA 4L0PA 5FZ4A 4YGCA 1MZ6A 3ABZA 2FCVA 4Y22A 4BLJA 4CCEA 4CUCA 1V6IA 2HWD1 2MNGA 3LA2A 2JX9A 4XBQA 2WS92 1FAYA 1YNAA 2E51A 1LB2A 1QNYA 1J3RA 1RUJ2 2QDNA 2G1MA 5DMYA 3U4XA 1R64A 3TEWA 1LOCA 2QBXA 2IFWA 4Q8LA 5JR2A 4Q0UA 2XL9A 4BM8A 2W68A 1VBD2 1VLNA 5FPVA 3VBFA 2Y38A 2XHKA 3JXSA 5JDBA 5FZKA 1COV3 2C9KA 3S5QA 2HWB3 5DN2A 1AX0A 4A2UA 3GNEA 1VBB1 3S57A 4CDWC 1IS5A 2R7EB 3KQ4B 4LK7A 2BFUS 1K12A 4QDQA 4YG3A 3E1F1 1FPN3 3O7OA 4Y3OA 1NKGA 1S4CA 3ETPA 3MIFA 3ZYFA 1O7FA 4AI3A 4ASMB 3OPZA 3VD5A 3V0BB 1IPJA 2VUJA 5FZ1A 1F5FA 4U36A 5FY0A 3RWKX 4CP0A 3TBDA 1COV2 3WY6A 2HWB2 5HPOA 1EUUA 5JI7A 1K5MC 2D6MA 3VDAA 2YHJA 1JH5A 2JDAA 5FYZA 4LXLA 1O3TA 1BMV1 1VB2A 4A7ZA 1KXGA 5FZ9A 3NO8A 4KNCA 5CNAA 3IKWA 1RMU3 1C1LA 1FPN2 5BPXA 5LY2A 1AR72 1QXPA 3AZVA 3HNYM 3MFCA 4LQRA 4MGQA 3FHIB 3DCQA 5FMBA 2A73B 4RR3C 3ZSEA 1WKYA 4XOGA 3PMEA 5FY8A 4DIQA 2KA3A 3IIIA 2JE7A 4N8MA 3GZUC 3MW4A 2WO7A 5AVAA 4CRQA 2SBAA 1REEA 1UOGA 5FO9B 1RMU2 4PJYA 4H3WA 4LKSA 4QGMA 2KXLA 4XHBA 2JG9C 2QQKA 2ZEXA 2V73A 3KCXA 4J1WA 3OUJA 4NE9A 3SKJE 3VZLA 4CCMA 3ZR6A 1UZWA 3HVDA 3V65A 1A6CA 1JOPA 1UX6A 4LITA 4WZFA 3SC7X 4QX0A 5K9YA 2WT2A 4CDQC 4ZONA 4HVRA 3ACFA 5GZCA 5FV3A 4F83A 1U12A 1UZ0A 4MG2A 1ZA7A 4UBGA 5FUIA 4QXHA 1PMJX 2VECA 1UQXA 4FXKB 3K3NA 1ZZ8A 4HN1A 3ZDSA 5FKBA 1CJDA 1LEDA 4LO5B 5F5AA 3DXUA 2YY1A 1F35A 1DG6A 2R061 4QDRA 2P17A 3W21A 1ODMA 1JXNA 1XE7A 2P2KA 2DFCA 2XBO1 2BTVC 4TYSA 1XC6A 4E27A 3AFKA 1VE0A 5KR7A 3WHTA 1H8TC 3KGZA 3KMHA 4UFKA 5BNOB 1F31A 1OQ1A 4KU7A 2ZCWA 4PI2A 1C8M1 2NPIA 3R4SA 1LOGA 3I2HA 4QKFA 4DEQA 5KXCA 2G4IA 1NQDA 2CGOA 4META 1US3A 1PVXA 1EPWA 4DQAA 3VUOA 1LEMA 4XQDA 5F9TA 4TSVA 3E5XA 2FDHA 2A6VA 1NA1C 2VPVA 2ID4A 2ZMNA 3K51A 3P5BA 3THCA 3TNQA 1R1ZA 3ZVXA 1HB2A 4NRMA 4P14A 4ZS2A 2IFRA 2PHUA 3QD6A 3MPPG 3AKPA 1U5XA 3OUIA 1QJY1 2ZGSA 2DCJA 2XHNA 3USSA 1NXD1 2PHRA 2VC9A 4M4PA 1DU3D 3ZXLA 1G7YA 2QZ3A 2RE9A 2BRTA 2YPJA 2C0ZA 2XUMA 2VQTA 3OY8B 2I2SA 2NZ9A 5F2WA 4BA6A 3N9PA 3VGIA 3RNSA 2J42A 4TN7A 5FZIA 4IXLA 1XB9A 4QB1A 5FZ0A 4N53B 1FMD1 1JUHA 5JXIA 4LA3A 3ZFFC 2PAMA 4IETA 2GNDA 4AHZA 2WNOA 3RZZA 2AACA 5FOJB 1NCQA 1OPMA 2K2SA 4FAGA 1WLTA 1AZDA 4E4SA 1GLHA 3PVBB 2GC2A 1G6NA 3AYEA 5GLZA 1C28A 3VV1A 3C7EA 2JECA 2B39A 2Y34A 4BDVB 3D8CA 1A78A 3KT1A 2E9QA 4GXLA 3J7LA 3VBFC 1X36A 2VNGA 3VKNA 3SQOA 5JZGA 2XJRA 4NIDA 4XAEA 1TE1B 3WF0A 5FY7A 1IS6A 1TMF3 4GALA 4NWWA 5ERLA 3UKNA 1O3QA 3VBUA 3GDBA 3WNKA 2PFWA 4KI5M 4S2GA 5CYYA 3VHOA 4Q4W3 1OD5A 1RHI1 1MS0A 3BYWA 3NAPA 1QU0A 1H8VA 4JC1A 5CKMA 4JGZA 5F5CA 2XJQA 5FPLA 2BU9A 3G7DA 4GZ9A 1SLTA 4Z92B 1QHDA 1Y3TA 3VDDC 1GQGA 1NAEA 1S1AA 1OUXA 1H2NA 4FOVA 3D0SA 5F37A 2BPA2 3V0AB 4IEVA 1R093 4JQTA 2H6CA 1B35B 2HYKA 4MV2A 1TMF2 4B8EA 4CU6A 2E32A 4IV3B 4LKEA 2Y0IA 3OGRA 3VBSB 1VMFA 4Q2FA 1H2MA 1O91A 3ASIA 2HWF1 4JRAA 1CGPA 3N36A 4NO4A 1OA3A 2QQPA 2CNAA 3KHCA 1XE8A 1V0AA 5IW0A 2C1FA 4D7YA 1Q8OA 2Q4SA 4XDQA 3WUDA 5F8PA 2QVSB 4FPEA 3ETQA 1R092 1D4M3 2P5BA 2FQPA 3U1XA 2CGPA 3AZWA 1QY4A 2RS13 4D6SA 4BXSV 2YPDA 1NCRA 5CFCB 4DUXA 4FQ4A 3VHNA 3TEYA 3B00A 4CU8A 2XVKA 2X53S 3A0KA 1AR83 1N3OA 3LDRA 5FZ6A 4BH9A 4AFCA 3B5LB 1JZ7A 3AXDA 2JE8A 1HN0A 3MF9A 1K42A 1ND3A 4P08A 4B7KA 3ZFEA 2ES3A 3ZIWA 3GCXA 1JS9A 1CN1A 5J37A 4M3CA 1GMMA 3AMPA 1JYTA 1IS4A 1D4M2 1EUTA 2VTXJ 4GQ7A 4YPJA 1RUOA 1POQA 2GAUA 4ZPIA 4BQWA 5JMOA 1R1A3 5EFUA 2RS12 2WYSA 3KM5A 4J1XA 4QPYA 5H9PA 1ALYA 5B4NA 5IWFA 5DAQA 3ZXKA 3WF4A 2W91A 3POFA 1AR82 4WM8B 2ZZJA 1AYM1 5D8AB 1AX1A 1GZWA 3PL0A 1HB1A 2ZEWA 2EXKA 2RS33 4H7MA 3WNNA 4X6RB 2RR11 3AKSA 1UY2A 4R9DA 2VZVA 2FDFA 2Z79A 4YRDA 5EIYB 1UKRA 2VBDA 3KB5A 3O1TA 1R1A2 2YBKA 4UFIA 5C5TA 3JQWA 4HLTA 1ENQA 1VBA1 1IOAA 4P5YA 1J84A 4R4ZA 4X6QB 2A6XA 5IT6A 2ZX1A 3AP7A 4AF9A 2WC2A 5GJ6A 5J36A 1XNAA 3VBRC 2A6WA 2EXHA 5E89A 4IDZA 1PZ7A 1RUF3 4CCDA 2VULA 1TEIA 1FOD1 2P3YA 1N47A 2PHDA 5EQUA 4YYOA 5HV4A 2WIIB 4MYEA 5C4WC 2PA7A 5GZEA 3VL8A 1OKOA 3T4VA 3K4ZA 2PAKA 1A34A 2OS2A 1KD7A 4XDPA 5A7WA 3L2YA 4LO7A 3H1WA 5GLTA 1RUNA 1L3JA 2W94A 5LA2A 2ZJCA 5A3LA 3I49A 2YU2A 1WBLA 3CJIB 3FUOA 4XMAA 5FY1A 3UESA 4XFBA 3MPBA 4MGSA 3WNOA 1RUF2 1AR91 2Y6LA 4P9IA 1OOPC 3TN92 4AI2A 3VD3A 1YXWA 1XE0A 1V9U1 3ZXJA 2WZ8A 1GZ9A 4ONUA 4C0BA 5L36A 2YB7A 4L8QA 1F4AA 3WG1A 4CYDA 4W6YA 3ZMOA 5BYNA 3Q8EA 3LCPA 4EWAA 3PJQA 2Z2SB 1XSRA 5FPAA 3TYJA 4O61A 4FPOB 1KFXL 4QKBA 2WSVA 3ZN6B 4I02A 3KHBA 4Y1XA 1ULOA 1NX9A 2EXJA 1SZBA 1S0JA 4FPLA 4QX1A 3WR0A 3C7OA 4I0BA 5C9AC 3T08A 2BVBA 1W6NA 2BYVE 4CP9A 5J96B 3GCWA 2IXCA 1LHOA 2RG4A 3EYPA 2IC1A 4XUTA 2BWCA 5CKNA 5A3OA 5FREA 1SPPB 4OQ8A 5ABJA 1QJEA 5JZGC 2E7TA 3I97A 2VMFA 4QPGA 3C7HA 3MFAA 2PAEA 3B01A 2W92A 2DUPA 3WUCA 2DTYA 4NAOA 3TAYA 4DEVA 3RYRA 3AL5A 1RUG3 4KWLA 4V1PA 5FLHA 3VZJA 2ZMLA 1VIWB 3RVHA 2D3RA 2RV9A 1PGW2 1T6GC 2VZ3A 3NV4A 5JIUA 3QBQA 4IEUA 3RZLA 2J1VA 2JD4A 3GZTB 4AQ6A 1KDKA 1W6OB 3CZUA 1G9BA 4XJ9A 1E5RA 1W2TA 4BB3A 3ST7A 1JZ4A 5DDJ3 2YC4A 3WQ0A 3MBWA 1WLDA 1U5IA 2J1SA 5C8CA 2VUDA 3OGGA 4HZFA 2W08A 3O1OA 4FPKA 4HPKB 1RUG2 4LHNA 3N9LA 3T2QA 1GP4A 3LWCA 3SLIA 3QH7A 4A7KA 1WUVA 1F8VA 1CAVB 2BV4A 4DRRA 4YARA 3LA3A 4XCAA 4AAPA 4MGIE 1UNBA 4PF1A 3B94A 4Q4Y3 5L9RA 1OQDA 3KT7A 4JCKA 1NCQB 3LB9A 1MQTB 3WINE 1OVPA 1VMJA 4E8DA 3WDUA 1VB4A 5DDJ2 3GZEA 2RS53 2LM3A 2VMGA 2YUEA 3E6DA 4XF9A 3JD73 5A3WA 3UL2A 1PVC3 3OBZA 3O0XA 3ZYGA 3LFMA 2VMIA 4NVPA 1W05A 2V4VA 1DGLA 4UW5A 4YWAA 5JXJA 1JYCA 3HAGA 4QT6A 1CIWA 1HRI3 3AXEA 3AX4A 3HN3A 3PDQA 4Q4Y2 3AZXA 4MHRA 4LBQD 3VHPA 2IUWA 2QQWA 4B3NA 3OBAA 3H8UA 4K20A 2XMLA 2GN7A 1I3HA 2WUHA 3H50A 5D2AA 5FFOC 3WDXA 3WW2A 3WDYA 1MVQA 3I2GA 4IE4A 4YZ1A 4LUMA 2RS52 1EV13 4IERA 3JD72 3OGSA 3KQRA 4XFAA 4XYXA 1GANA 3NJZA 3VBHB 1QJX3 3PU3A 4KMQA 1WW7A 3NAPB 4RN5A 3FHQA 2RDSA 3M70A 3WG2A 1CONA 1SLAA 1CJPA 3HQRA 4BJ0A 4NWVA 1HRI2 3H8XA 2ADDA 3TRSB 4RD7A 1ZX5A 4XC9A 1XSQA 3B69A 4ISRA 5J98B 5CB7A 3W59A 4UW6A 3GM8A 2ORXA 3JBG3 3GXUA 1OMIA 4GB31 2DCYA 1HB3A 5I8SA 4YFZA 1EV12 4BISA 3ZXGA 4HXCA 3RZHA 4AI1A 4NOTA 1QJX2 3VKOA 2OPWA 3T4HB 4IV1C 3V56A 3M8LA 2WNVC 4CXWA 4FTBA 4XDOA 5FPUA 2IZWA 5JSRA 3HN1A 3Q8CA 3AZYA 5F7UA 3X29B 1Y9MA 5C5UA 3SITA 3CKHA 5C71A 4OHYA 2HH9A 3LZZA 4P9JA 1MEC3 3JBG2 3J8F1 1HQLA 2GC0A 4UBHA 5LBEA 3H7JA 3W9AA 3WCRA 2FD8A 3NMBA 2JDPA 4IL7A 4F3JA 2B4KA 3N4MA 1NCRB 2PLV3 2D98A 2X5IB 2YXSA 3PHMA 1YC61 3P3PA 4GWIA 5EJ3A 1D7PM 3SMHA 3T0AA 2CWMA 3TB0A 3ZFGB 4GJZA 4ASLA 3POWA 1ND3B 3DEMA 4ET7A 1EAH1 3PURA 3AVSA 2Q1MA 5LBBA 3IM0A 2GSYA 4LLOA 2NP0A 1MEC2 4CEYB 4AYUA 3WG4A 5FP7A 4YZ2A 4BMEA 3CQOA 2OZJA 3ES4A 5KXEA 3S0MA 2B8MA 1NUKA 2EIGA 2PLV2 2A6ZA 5T52A 4RGAA 1LHNA 5FZOB 4CDXA 1JZ6A 4Q1RA 5CVRA 3VB9A 2B9VA 1VAMA 5L7OC 4QPIC 3RRDA 3POSA 3FUQA 5KHJA 5LATA 1BLZA 2FBEA 3DL3A 3KCCA 4KGQA 5I0RA 3EHKA 4DXSA 5A6ZA 1SLLA 1MZEA 1AR63 1RUD3 2VM9A 4OZOA 4PHZA 2VMEA 4QGNA 4CUBA 1IQAA 3B93A 1MPXA 4JZRA 2VZPA 5DAXA 4RHV1 2E7QA 2VZQA 4NPRA 4WVMA 2ARBA 4HVOA 4IGQA 2JG8B 5FXXA 4A7YA 4DUVA 2ZKLA 2DURA 1QJZA 4PIYA 4GKYA 3DGTA 4YLZA 3F95A 4LHSA 5GKAC 1SMVA 1CIYA 1H4GA 2WNUA 1JUIA 1RUD2 5L9BA 1AR62 1REDA 3JZVA 4CDWA 1Q3EA 1HV1A 1O5UA 3O5SA 2LALA 5A7WB 2CY6A 4AVTA 2BNNA 4DS0A 2KR2A 1DQ0A 4AFBA 3CJXA 3FBMA 5FMCA 4AQSA 5LBCA 3UGHA 4QDSA 4K40A 1ENRA 3KZ4C 3EJKA 3POBA 2JDNA 2NMNA 4DINB 2XLAA 2R30A 2ZHMA 4FPHA 5A7OA 4Y1VA 4BQYA 2OZ6A 2R1DA 2ZX4A 2GP5A 4IEZA 4JKMA 4LBKA 1FYUA 2WN3A 1OXCA 4RQPC 2A3XA 5FZ8A 5LZ6A 5T3NA 1SBEA 2HWE1 3BPZA 1RYYA 4D6RA 4LIUA 1RL3A 3FC0A 3VKFC 4FI9A 4YVSC 2WZR1 1LHWA 2ZX0A 5EJZB 3VN4A 4C90A 3BKZA 3O1UA 4NIHA 1IHMA 4G3YC 3AFGA 3KLSA 4I30A 3T2OA 3I2KA 2C4XA 4FBFA 1KITA 3JU9A 3MI8A 4RR3A 4CP9B 1W6NB 3C2UA 4JGYA 5E88A 2W1QA 3GF6A 3Q8AA 4HK9A 5JVVA 3WHUA 4AEDC 4RS5C 1BHGA 4COVA 1MR5A 4CCCA 1S0IA 3KV6A 3U37A 1SCSA 1WLCA 4Y1ZA 4C0HA 1HQWA 2VQAA 3WV6A 5LA1A 5F6LB 1UMIA 3M3IA 2BUKA 5FZHA 1ZZ6A 3IAPA 1Y43B 1JYNA 5FMDA 1NLRA 4I0WB 2WL1A 4PLNA 4MXWB 2RM21 5CZKA 3N7JA 1SBFA 1FATA 1MS9A 2XPJA 2DDUA 4EWDA 5IK5A 3MLKA 1GWLA 4UF0A 2A6YA 3UYJA 4CDQA 1WD3A 1U0AA 3RJ2X 3OGVA 4Y5Z0 1WCUA 5DG1A 3NV2A 1LHUA 2R063 4FFIA 1G9FA 4NPLA 4YG0A 1UY1A 3OEAA 5BNPC 4BK5A 3WDVA 3WW1A 4BQ4A 2GALA 3LPGA 1ODNA 1YWKA 1GNHA 4YVWB 1EP0A 2XJSA 2JB4A 4A3ZA 3K4AA 1S2EA 2E33A 3QACA 3GZAA 3HQXA 4MH0E 1XNBA 1DDLA 2E63A 3LOIA 1W6PB 4D69A 1FNYA 4ATFA 4XUQA 4CEWB 2D93A 4H14A 2ZX3A 4FFGA 4LULA 4QQLA 1LECA 3SNMA 4WVWA 2UU8A 1H8TA 1N1SA 2YV8A 2ZABA 4NJ4A 2P3JA 5I0UA 2P6CA 2WNEA 4N9IA 2ZGOA 4PQ9A 5T5PA 1SFYA 3H7YA 4NIAA 2ZBJA 4DXZA 1JI6A 3LGRA 2J22A 5K7PA 1SEFA 4N43A 5JMCA 4M4RA 5IATA 4XFIA 5A3PA 4BQ1A 3RI8A 1JODA 1NA1A 3FLRA 4YM0A 4YZ4A 2PHLA 4UI9L 4XILA 1AYN3 4BQ5A 4HVQA 2GP3A 1J3QA 2AR6A 1RITA 5F3EA 1YQ8A 2OA2A 4LMFA 3HJRA 2X29A 5CFDB 1W9WA 1DLCA 1TME3 2E53A 2YFZA 4QKDA 2K9ZA 1WGPA 4FPCA 1E5HA 4XJZA 3GYDA 4M3CE 4MSVA 5L19A 3DKWA 2W95A 4MOAA 1SLCA 3CBNA 3ZXFA 1W2OA 1SFPA 2RJLA 2WN2A 3SEEA 4DXTA 2VBBA 2PHWA 4MXVA 3ORJA 3PU8A 5C3PA 3TEZA 4MO3M 4Z07A 5T55A 1UIKA 4K21A 1AYN2 4QQPA 1L7QA 1J83A 2W87A 4LKFA 1JHJA 1ZBA3 1S2KA 3IN9A 4XE9A 3ZM8A 2UWBA 1K45A 2Y33A 3U4SA 2DWRA 1TME2 4P9LA 4Q1PA 4PIZA 4AGRA 1JYXA 4B7EA 2YBSA 1NY72 3GBWA 3R6SA 4B4PA 1GKBA 5DAPA 2QQJA 1CAXA 4IEQA 4I3GA 1GQPA 5FMOS 3UT0A 3QOPA 3GJAA 3AYCA 2J1TA 2B5HA 4GH4B 1ZBA2 1RVF1 1O3RA 3ZYPA 2WNUC 4OMDA 3ZPOA 4FTEA 3BPSA 5A80A 1H9PA 2EIBA 2Q8DA 3MICA 5TSWA 5IVVA 4E8CA 1CX4A 3R05A 1WCDJ 4OULA 3RZJA 5T5OA 4KL1A 3RZKA 4KBZA 2RMU1 3NKTA 3NNMA 1RUH3 4PLMA 2FDIA 4NROA 4JV4A 4AL9A 2QQUA 1HDKA 3MGUA 2MHFA 1POV3 2YC2A 1XNCA 2AEZA 3E5QA 3VDDA 4JTNA 5FBJA 3CF6E 2VR4A 3SCHA 1ZRRA 2BJSA 2MEV1 5FP3A 4CDXB 1ULDA 2ZKNA 5KHHA 3RSJA 5A33A 1PK6B 1ULPA 2VZRA 4GA9A 1AXZA 1UZVA 3KS7A 3LIHA 4GWJA 3ZR5A 1PGL2 3VBOA 1QJU1 2LUWA 1KJRA 3MO4A 1RUH2 3D82A 3ZXAC 1HRV3 3ZXEA 2DUOA 1RTVA 2QJVA 4CCKA 3HT2A 4Q29A 4JGYC 3MUY1 4D3WA 2ZZQA 5LRRA 3LAGA 1QQP3 2A5ZA 3AMNA 4A6SA 1VRH3 4A6OA 1CZSA 5FK8A 2L9LA 3IWZA 4F7ZA 3BVCA 4CP2A 2JE9A 4Z2WA 4R4XA 1HRV2 5FPXA 5A7QA 2DCTA 4GKXA 1XQNA 1DZQA 5FP8A 3BODA 2XXZA 4BQ3A 2H0BA 5FYBA 2ZGKA 3OD0A 4CA9A 4A44A 4A41A 3VHRA 4L99A 1QQP2 1RJ8A 1VBC1 1VRH2 1GWMA 2YMZA 5J09A 1UXXX 4CXYA 4QM9A 1OLRA 2A71A 3IZOA 5HCBA 1MS8A 5CKQA 3POGA 2DYCA 2BGOA 4Q4V1 1UZZA 4Y1YA 2TUNA 1NXMA 3UETA 4AFMA 1K5MB 1Y9GA 4XFCA 4NIIA 3ZN4A 4COYA 4JHZA 4GWMA 4ARXA 1YO8A 4FCAA 5JOWA 3IDCB 2WSUA 5GLVA 1EYBA 4OI2A 5FYVA 1LRHA 1ZBE1 2AC1A 4YW5A 1XYOA 3J9SA 1ZA4A 2BBAA 1BQPA 1E5SA 2QQVA 2VOWA 3WOGA 2OKXA 3CU7A 1FOD3 2JDMA 5F3GA 5A6XA 4MGTA 4E2QA 3NNJA 2Y60A 1BYHA 3W58A 1LAJA 4N53C 2ZGUA 3VD9A 3VBRA 3LSEA 3I3EA 2W1SA 4N43C 4ZXEA 5C3QA 1PMHX 2Y8KA 4XPVA 5I93A 2PTMA 3I59A 1IS3A 4QX2A 5C4WA 3T1MA 1UD1A 4OQ9A 1UN1A 2JG9B 4FTSA 4DB5A 4XABA 4PBOA 3WT3A 2WINB 1FOD2 1V9U3 1ZRIA 1DGWA 3NNGA 4W6WA 3JB8A 1WCQA 5HCFA 3H1YA 3PVOA 1OA4A 1VBE1 2WA3A 1W6QB 4IEYA 2VOVA 4UF0B 1ULFA 2ZAHA 5DUUA 5E6HA 4COZA 5FO8B 4YW3A 5IUQA 2JICA 4BE3A 1ST8A 4AEKA 1OBNA 1OOPA 1ULEA 3LEGA 1UWWA 2UY9A 4I0AA 1MZFA 1XU1A 2X05A 5C70A 4OHXA 1CVNA 5K0UC 1CD3G 1N1TA 2JKXA 3BU0A 2D6KA 4UAPA 1V9U2 5F5IA 4E4ZA 2OVUA 5JPNB 1GZCA 5IVYA 5AC91 3GBGA 2UYBA 1IKQA 4O9GA 3H8OA 1LCLA 2YGMA 2ZX2A 2F4LA 3ZYRA 1K5JA 3NW4A 2QNKA 5FQ0A 5C9AA 5IVJA 5T5JA 2RJ2A 4LBJA 2UWAA 1B35C 4MZUA 1IKPA 3LEIA 4RFT0 2D40A 5JR7B 3VBSC 1RUE3 2UURA 5EPAA 1W9SA 2VOXA 2OIIA 4Y5TA 4CDUA 2Q0AA 1TG7A 3IPVB 3O1SA 1QGLA 5A3NA 3AMQA 2WS91 1W90A 1GR3A 1S0EA 1JYVA 4XF4A 1OH4A 1OA2A 1B09A 4UOJA 1RUJ1 3GHMA 3MHZA 3ZYIB 1W28A 3ZYHA 3T0DA 1DFQA 3GGLA 1PO23 4Y20A 1FV2A 2VNOA 1RXFA 1PM7A 3I2IA 1VBD1 1TNRA 4D6QA 2WT0A 3ES1A 1AVBA 5CADA 4W65A 2N7GA 1RUE2 1QWRA 5FPZA 2CWSA 4LT5A 2G9ZA 5CFCC 4BLIA 1TVGA 1ULGA 2AZ5A 3OYWA 3DKQA 3O0WA 1WW5A 2O14A 5JOZA 3BB6A 1OKQA 3RS6A 1D4VB 1XU2A 1AXKA 4KWKA 1HKDA 3KD4A 4HT1T 3U78A 2P37A 2WWUA 1PO22 5CBLA 2MPFA 1DYOA 4FFFA 2GU9A 5T54A 4ES9A 1YFYA 4YSFA 1QKQA 4JDNA 3B9CA 3VBOC 2KD7A 3AJZA 4IE7A 4Q4W2 4A42A 5FZCA 5A32A 5IYYA 1V6MA 1COV1 2WLQA 2HWB1 2AGSA 4PF5A 1DGRA 3ACLA 1H6XA 3ZFFB 1ZREA 1GP6A 4L2NA 1QDCA 4Y22B 2YROA 3PMSA 5D8AC 3PUIA 5FY9A 3ILRA 4Q5OA 1FPN1 4OUEA 1AR71 4K7JA 3TOJA 2VMCA 4UWDA 3W5NA 2YYOA 4WV8A 2BNMA 5LBFA 2IXHA 3M1HA 2EF6A 4UYBA 4LK6A 4QQHA 3WP6A 2XKOA 1BK0A 2BFUL 3LIGA 4WBBA 3VBFB 2FZ2A 1UPIA 2XR4A 4OHVA 3S7EA 2F6BA 2A7AA 3HIFA 3AZZA 3M3QA 2XKPA 3BTXA 1BBT3 1Y7BA 2GNBA 1QOTA 4Q0SA 4HOOA 1RMU1 4MGKE 3HQUA 5DZGA 2NYYA 4ES8A 4LUKA 4JX0A 2E7AA 2ETEA 3NNFA 3VZMA 4Q8KA 1OFNA 2DU0A 1H0BA 1YI7A 1PO13 4FPYA 4N7IA 4WVVA 2R32A 1IQDC 1L7LA 1X50A 2VMDA 3D4KA 4CCLA 5F39A 3EQEA 2OT7A 3FBYA 2Q8CA 1BBT2 4FXGB 1I5ZA 3FMGA 4GWNA 3ROUA 1T2XA 3OSDA 5A33B 3EB7A 3MIEA 4LBQA 1OI6A 1HJFA 1YUDA 3CJIC 1WA4A 4EV0A 1ASJ3 2PHTA 3B3QE 1LODA 1RB8G 1F5JA 4IV1A 5FK7A 2WNVA 5DUWA 4DXRA 5T50A 3VD7A 5FXVA 2A75A 1PO12 2F4PA 2P3KA 4OLLA 1NZIA 3KF5A 3ZSJA 4GMP3 1UY3A 4QX7A 4QX8A 5DG2A 5L9VA 2RS32 5DQ0A 3I8TA 3H1MA 2PHFA 3PUSA 1UF2C 3WZ1A 2E6VA 1EAH3 4FFHA 1ZYBA 4J25A 1ASJ2 1AXYA 4RGGA 1OUSA 4WM7A 3VZKA 4XFFA 4DPNA 1QNWA 2VQ0A 1UW8A 1PIV3 2NM1A 3RPQA 1GSLA 2FCUA 1GNZA 3I3DA 4LTAA 3UKVA 1H2KA 5JXGA 1IZ3A 3HEIA 2BBVA 4IE5A 5LCWL 2R49A 3H8RA 2PXJA 5LASA 1Q8QA 4BQXA 3C8XA 1EAH2 2BDRA 5IK4A 2ZOEB 1EPZA 4TZDA 4QXCA 3K77A 2B7YA 1GU3A 1PIV2 4I3PA 3O1MA 5A3TA 2WRAA 3Q8FA 4S2FA 3Q9OA 3POYA 2OUHA 3GJBA 4QPIA 4R9AA 5L7OA 3RZGA 3LPFA 4XFHA 4YM2A 3WW3A 3D5OA 3U07A 4ARYA 4Y4YA 2Z42A 4IGOA 2BGCA 1UIJA 2LROA 3J7MA 4IEXA 1UU5A 3AP4A 4CDUC 2AYHA 4JHTA 2A3YA 1YFUA 2Q8OA 3PTRB 4LBNA 2Q1FA 1MS3A 5C3RA 3VBRB 4XXAA 3AVRA 4OI1A 1KS4A 3AKTA 3I7DA 4R52A 5EV7A 4UT5A 4KU8A 1AL23 2VOKA 3G6JB 2BVVA 5ACA3 1JOBA 2RDQA 2VG9A 4H2AA 2TBVA 5AFBA 1YYNA 1LTEA 3A23A 3F2ZA 3ZSLA 3I2OA 2VCAA 1KGYA 2IWGB 4HKWA 5I0TA 4AAXA 1I1EA 2C5DA 2FZ1A 2GZWA 2XWJB 4ZU7A 5BY5A 1S0DA 1YI9A 1X33A 3WQ1A 1UPSA 2VMHA 2GDFA 3ZIXA 5KBFA 3B02A 1BEV3 1KJLA 2GMMA 1Z0HA 2LW8A 5IK7A 1DP0A 3PJYA 1ND2A 1XBFA 4G4FA 4ORFA 4L92A 2WZR3 4XTMA 2G9FA 1AL22 1Y4WA 4Q0VA 3W20A 5ACA2 1NOVA 4RQPA 4YM1A 4BMBA 3DPRA 4NRPA 4BXFA 3OBRA 5FCCA 4CUAA 5CEHA 3VBHC 2VD7A 1CAUA 4YVSA 1X7NA 1W2AX 4MGZE 4Q0PA 4OZXA 1AF9A 2C26A 3IDAA 1LOEA 4MVTA 1TMF1 3S30A 4B1LA 4NHLA 1STMA 2JJ6A 4CE8A 1BEV2 4EN7B 4EWEA 3VDBA 5FP4A 1OHFA 1VAKA 2ET7A 4CCNA 3O0VA 4DY5A 4LJHA 5BNNA 1PMIA 2DVDA 2WZR2 1Q5OA 4JTOA 4AEDA 2WQZC 2D44A 4RS5A 3QLQA 3KV5A 4RFRB 2VGDA 1FXZA 4QU2A 2RM23 2DCZA 4EZHA 1POV0 2HWC3 3KF3A 1E57A 2RDRA 4PDWC 1R091 5JZGB 1M4WA 2D5FA 1S0BA 3LEMA 5BUVA 2W9XA 2K0GA 3SH3A 4O65A 3AL6A 3VBUB 5H9QA 1V6KA 1PVC2 1VP6A 1JBCA 2DU1A 1R083 2Y26A 3LQCA 2ZPXA 3MV11 1LENA 4LR4A 2QQOA 1YIFA 3MUZ1 4OCTA 5A1FA 2X09A 4JGZB 5IVFA 5J7MA 4HETA 5IAXA 3TNPB 2HWC2 2YG0A 2HEVF 3L2HA 5BNPA 1D4M1 1QMJA 2EIDA 1MS1A 2VO5A 2ZACA 4RGKA 2LS6A 4AOCA 3WD5A 2RS11 2Q1ZB 4XJ8A 3RDIA 2D97A 4PT6A 5C3OA 1R082 1AR81 3HWJA 1UMZA 1AJOA 1GOHA 3O14A 4P02B 3C7FA 4MX3A 1OH3A 1W6MA 5C33A 5FIXA 1QIQA 3BIWE 3FL7A 3R0RA 1R1A1 4URTA 2WFF3 3LDKA 1URXA 5DZEA 5EHDA 4CUGA 4WM7C 5C8WA 1RUI1 2UY8A 2XLGA 1D2QA 3S7IA 1KDMA 4DZGA 3O1PA 2Y6FA 3IMMA 4FT8A 5APAA 2XUEA 1RUC3 5FPBA 3WSOA 2DVFA 1C5HA 2JDKA 2B9UA 1PHMA 5C7GA 3ZFEB 4TWTA 4M3CB 2NMOA 2WFF2 4FPGA 1HW5A 1OF4A 3WLUA 4CTEA 1V00A 2JG8C 1NYWA 2VZTA 4IW3A 2X10A 3WP3A 5JSOA 3NKGA 2VW2A 5FKCA 1JYIA 2A3WA 3EMRA 3I54A 3KWVA 2ZGLA 3MIHA 1RUC2 2A70A 1GZWB 1UCXA 4K1YA 3M7AA 1RUF1 2HWD3 1AX2A 5EWSA 2HEYF 4Z1VA 2Z4FA 2PMWB 3TN91 2OX0A 4QAWA 4EN9B 3MW2A 4LBQB 2JDUA 4CU7A 1DYKA 3N7MA 1US2A 3V0BA 4AFDA 1LHVA 4IV1B 2RHPA 4BYYA 2O0OA 3AMHA 4Q4X1 4E2SA 1APNA 3UGFA 1RVF3 3ZOIA 1PM4A 2XQXA 1G9AA 3HR9A 1VBB3 3NQHA 3WVJA 2HWD2 3WNXA 3P6BA 2QQIA 3GHNA 4JAAA 5D1IA 1WCSA 4QHZA 2ZGPA 4JDMA 1W9FA 3LD8A 4OUSA 3E5UA 5C3SA 3CIHA 4XF3A 1RC6A 4EN8B 4ZU5A 1SHWB 3O1RA 3LOBA 3K3OA 1RVF2 4EZ4A 4KG8A 4BK4A 1SG3A 1ENXA 4OUMA 4KBBA 3NRUA 1VBB2 2VCBA 3DN7A 2ZHKA 3PNAA 4UXAA 3ZN5A 1QJFA 2O8QA 4Z82A 5FR3A 4PLOA 4Y5SA 1ND2C 4BWOA 2CAVA 2WQ8A 1PGW1 3P1IA 2DV9A 3MDPA 3MIDA 4SBVA 4TLGA 4XURA 4DFSA 2ZGQA 3ZYBA 3DPRC 2Y6JA 1O4YA 4QKNA 1KQRA 4L9BA 5FOBB 4O9EA 3N7KA 4HONA 4W8JA 5E16A 2VCMA 3VLBB 2JIJA 1QDOA 2QKDA 3ACIA 5F1RA 3DECA 1N1VA 1BMV2 1RUG1 1W0NA 4YW7A 1O59A 5BNNC 3UNPA 2QE3A 2EVXA 2V72A 5G05L 2VJXA 5FZBA 3ZSMA 1NLQA 3TWIA 1SACA 5A1LA 4AGGA 4YVWC 1KRIA 2G19A 5FYMA 2VZOA 1IGOA 3RMYA 3I2FA 4AW7A 4EN6B 3AMMA 2IXJA 5DDJ1 2WAAA 4CPBD 1FI2A 2A1XA 5ABJB 2FDKA 2OYZA 4QPGB 4CEWC 2VQUA 3I3QA 3N9NA 1W06A 3FLPA 1VBC3 5F3IA 2IVJA 1W9YA 3WNMA 1TZOA 2J1AA 2WA4A 5BNOA 4MLOA 4QD2A 3N9QA 3VDCA 1AUYA 4I2OA 2JDZA 4Q4Y1 2WYFA 4KH9A 2VU9A 3T3YA 2R071 4AI0A 2PQQA 1FNZA 1JW6A 4FOWA 3BOPA 4XFGA 1OSGA 5A1AA 2RS51 1JZ8A 2JXAA 5JI9A 1XNKA 3JD71 1SDWA 4LBOA 3FFZA 3UKTA 3SH4A 5C8CB 2XBO3 1GP5A 1UL9A 1VBC2 2YZ4A 3HBKA 3POIA 4PIXA 5FZ3A 5IHRA 1H9WA 5JLVA 4AVSA 1ZBE3 1L7RA 5FBZA 1X9PA 1F4HA 2VCCA 1MS4A 1KFUL 4XACA 3J7NA 5I0DA 5CFDC 1SQ4A 1C8M3 3EXUA 5E1RA 3S5AA 1REFA 1BKZA 3MLLA 2VE1A 4XAAA 2R062 2I74A 4XEZA 5FUPA 4AGVA 4IE0A 1H4HA 1X82A 3MLJA 5A7NA 2CV6A 2XBO2 3OY8A 1WW4A 1QJX1 4QXKA 1TQ5A 1HJGA 3SHRA 4M00A 3SH5A 4AQTA 1BVP1 1ZBE2 3FWEA 3CNAA 3HPNA 4N53A 5GZFA 3U75A 3USUA 3WCSA 1X8MA 2VW0A 1NG0A 2BP6A 2CDOA 2AH2A 2P6HA 3N7LA 3AKRA 4L97A 2ZEYA 1C8M2 3OF1A 3SXWA 1JZ3A 1MZ5A 1QJY3 4X8NA 3SISA 4XF0A 4MGYE 5I0SA 4NUBA 2B45X 3JBG1 4UW4A 1Y9QA 3ECQA 5FLIA 5LA9A 3T30A 1UY0A 4YW4A 4D7TA 1BJQA 5A6QA 1DLLA 3OD4A 5HCAA 4LHLA 2V5YA 4D0QA 4WVZA 2OQ6A 4XCBA 4G9SB 1UOFA 2QQMA 1EY2A 2WLPA 3M3EA 4QX3A 3DXTA 4AHXA 1FMD3 2ZEZA 3A7QA 1O8PA 1QJY2 3MZHA 4HBNA 4GMP0 1UYXA 1PZ9A 1MEC1 4Y26A 5K0UA 5LRSA 5FP9A 2EA7A 3ME2A 4RYDA 2ERFA 3UK9A 3SCGA 3KCYA 2CGNA 1IPSA 1DQ2A 1LOBA 2PLV1 5H9RA 4EN0A 4OHWA 5LW9A 5JIAA 4I01A 3LSDA 1I9RA 1YQ2A 1FMD2 4Y1UA 4XHXA 1OLQA 2OPKA 5FYUA 3V0AA 4XJAA 4FPFA 4E9KA 1B35A 4KWUA 4NPMA 5GLWA 3GBFA 1H1MA 3VBSA 3WEZA 2Z69A 2J1UA 2PYTA 1N3PA 4QWNA 4CU9A 2BNOA 3K75B 1CR7A 4H7LA 4UFJA 1LOFC 2QFEA 1RHI3 2JIGA 3AP9A 3DV8A 3T2PA 2JB8A 5JAXA 4NHYA 1W8OA 1LKNA 3PVNA 1RGSA 5EYXA 1CZVA 4AI9A 4JQRA 2HBUA 4QPWA 3CO2A 1ZZ9A 1DHKB 5LK5A 4CZSA 4DUWA 5IFPA 1YFXA 4K1ZA 2GN3A 3HBZA 4E4DX 1WCKA 3HD8B 1GZTA 2DVAA 3B9IA 3UJQA 1AR61 1RUD1 5CFCA 4LE4A 1ZRFA 1J58A 2D6OX 2ADEA 1RHI2 4GJYA 3PUAA 4YFWA 5AVPA 5GALA 2HWF3 2W3JA 2YFUA 3NWKA 1GUIA 1HN1A 4FOQA 1UAIA 3MIGA 4BPZA 5FYSA 1YHFA 2C24A 1YFWA 2WDBA 3FLTA 3JB4C 4YW1A 1GOFA 5F5QA 1FT9A 5A3UA 2WZEA 4NHXA 2VXJA 1AR73 3DYPA 2TNFA 5GZGA 2R0HA 2K46A 5A6YA 5M0TA 2IVIB 1S2BA 4WM8A 5D8AA 3EO6A 4DNYA 1VALA 2ARCA 3E97A 2HWF2 1W0PA 1CAWA 4YZ3A 3BU7A 3HOBA 4WVMB 5FJHA 2VOTA 3RYKA 5KHKA 1DIWA 3HMYA 1AJKA 4LIVA 4XIOA 2WJSA 1XXNA 5KXDA 1UU6A 3OCPA 4KQ7A 1UU4A 1O4ZA 2WNUB 3ZXDA 5BNOC 2VTFA 3BN6A 4CDWB 3BTZA 1ULCA 2Y64A 5ANNA 3MW3A 5FY4A 3CMGA 1AYM3 1XNTA 2R041 4FO9A 4HKLA 4C1WA 1MVEA 4NN0A 2JKBA 1C1FA 1XYPA 3I4IA 3K46A 4LE3A 3JQXA 3UGGA 2RR13 2Y6KA 3SEPA 2WKKA 3PUHA 4D8MA 2FDJA 4L11A 3L9JT 1HXS1 1RIRA 1JTZX 2CU5A 4YGBA 1HB4A 2FCTA 3CLPA 5JCTA 1VBA3 2VVEA 1NQJA 1BXHA 3ATGA 3D0JA 4AFAA 2P1BA 4K9SA 1AYM2 1QXJA 2BQPA 2EALA 2HEWF 2JEMA 2W0XA 3CJIA 4I09A 4YGEA 3URFA 5DXDA 2BEOA 4TTGA 4DY3A 1GQHA 5DPNA 5EZWA 2OXBA 5ANQA 2ATFA 3M3CA 4NHMA 2WT1A 2RR12 1V6NA 1HLCA 4E2GA 2NN8A 2YDEA 1OFSA 1UOJA 4QMAA 4RR3B 1UMHA 2D6NA 2GC3A 4JGYB 4DOUA 3E6CC 3CDZB 2D5HA 4LO6B 4R9BA 4SLIA 3LE0A 3WG3A 1N1YA 1VBA2 2LRPA 3AP6A 4AQ2A 4QM8A 2J1EA 2HLEA 4D94A 3ZN6A 4IE6A 3WNLA 1MS5A 2ZXQA 4LA2A 3KGLA 5FZAA 2UYAA 1I6XA 1JN2P 1AR93 2ZTNA 2FDGA 4KG0A 1GNYA 5IVEA 2WZPP 5IAVA 3ACGA 3ZYJB 1UYYA 3AK0A 3ENRA 1WZXA 2H6BA 2XONA 4CDQB 1C5IA 1A8DA 1SPPA 1Z7S1 4CSWA 1H2LA 1OD3A 1OPOA 1S55A 2B42B 2XVGA 2ZAAA 5B4XA 1XNDA 4KWJA 4OVEA 5JWPA 4WZCA 3U0ZA 2ZMKA 1AR92 1W8HA 2NLRA 5B2GB 2VUAA 3OEBA 1H1AA 5FZLA 2F17A 2WO2A 1WMEA 3AC0A 4QB2A 3CHXA 1W6OA 4Z8BA 2W52A 3RQ0A 3ACHA 5SV8A 4ITCA 1AYN1 2J1RA 4LO8A 4IEWA 1W8FA 5HXVA 3NL1A 3J26N 5DZFA 1UX7A 5FZFA 1H8TB 4IV3C 4EQVA 2DBNA 4HPKA 3RZMA 4XIKA 3SCFA 5FWJA 1TME1 4S2HA 3RG0A 4D7SA 2VUCA 1CAVA 4M0HA 3PLQA 1I5PA 1NY71 4LLFA 4ZXKA 4E4HA 5FDBA 5F6KA 3USUB 4N43B 5FUNA 4IQPA 3P3NA 3H3LA 5I91A 3A21A 1NT0A 1MQTA 3BCWA 1NA1B 3BTAA 1NE4A 2ZHNA 1LR5A 3FN9A 3OUHA 4QX5A 1ZBA1 5IJRA 3NJVA 3RYPA 5A3MA 2G9GA 1JZ5A 5FY5A 2WAOA 4V2WA 5KXBA 4XZPA 1K3IA 1NZCA 1DQ6A 4HN0A 1X9TA 1Q56A 3ZSKA 2FMYA 4BIFA 1CQ9A 3WF2A 3N3HA 1CESA 2DFBA 3RFRA 2CDPA 2R1BA 2BW8A 3KT4A 1UYZA 5K0UB 4GD4A 4M3CF 4NMIA 4CXXA 5D21A 1A3KA 3THTA 1DBNA 4V2VA 1E5IA 4FP3A 5FMOL 3VBHA 3BIEA 2WFPA 1BK1A 3LF7A 3RWNA 2E31A 1J1TA 1G9DA 1TNFA 4FP2A 4WM8C 3KV4A 4K3UA 5J3UA 1PGL1 4RSUA 2WABA 4Q27A 1Q43A 3OGJA 1CAXB 1UOBA 2JENA 1RUH1 1QOOA 5FYIA 4AZZA 4LO4B 2W47A 5I8TA 1POV1 1W8NA 3E6BA 3CZJA 1U5YA 2QZ2A 3FZ3A 2QUOA 4HFSA 1Q8SA 5EYYA 4PDWA 4ASKA 1FV3A 4AHWA 4EROA 5J48A 4AK3A 4BZ4A 1SBDA 2VTXA 1OLMA 2W5FA 1OVSA 3AYDA 5ISLA 2FMDA 4AVVA 1S0FA 5CAZA 1BZWA 4FAHA 4M0NA 2YGLA 3OPWA 1F9KA 1HRV1 2WBKA 1WLWA 1RJ7A 2D43A 2WQ4A 1VAVA 4GB33 4Q26A 3RMXA 4LOSA 3TEXA 1ENSA 2RJKA 2X5IA 2YU1A 5KHGA 2R0FA 2UWCA 4OI4A 3VDDB 4QU1A 1QQP1 3ZFGA 1VRH1 3RI9A 1O6UA 5G04L 2AREA 4A4AA 1LNSA 1VMHA 2QTWB 2WWJA 3SKVA 2Y0OA 5FZMA 1DGWX 3VBOB 1ZM1A 1W04A 4CEYA 1PNGA 4YW6A 1S0CA 3C7GA 3N9OA 2VVFA 3J8F3 5CIRA 3VD4A 4GB32 4LNVA 4TLFA 1W3VA 1DZRA 4K8RB 4N7UA 2OQ7A 5FZOA 3ZPYA 1RUI3 4YGDA 1C3HA 4NR1A 1DQ1A 1CAWB 1UZYA 3IAQA 3ZO0B 1W8WA 5FLJA 1CWPA 3R4DB 4CCJA 3K2OA 2BZDA 2VVDA 3THDA 4PBPA 2ZGRA 3IDEA 1QH7A 2VY0A 3J8F2 4QXBA 5C6CA 4NRQA 5HI0A 5CG9A 3PVEA 2XH6A 5FZ7A 1SFNA 1YJKA 3AJYA 1YQ5A 1YRZA 2W2IA 2XVLA 1RUI2 3MF6A 5AFEA 4NIGA 4W50A 1PGSA 2EIEA 3KVBA 1DGRN 2JG8A 2QCSB 3RGBA 5A7PA 4PCRA 4BCUA 3TN93 2GNTA 4Y4RA 3POJA 1A8MA 5J1XA 1D2SA 4KGGA 4X8PA 2VZ1A 2W46A 1QEXA 1OF3A 5FZEA 3NNLA 5LA0A 3BI3A 2CSGA 3DUIA 3PIGA 2EXIA 4Q4X3 3I3MA 2XLFA 2V5DA 4P9GA 4RHV3 4HANA 2EICA 5GLUA 5CISA 4QQOA 3HNMA 4RA0A 4ZY9A 1O3SA 2VBPA 4ZU4A 2DCKA 1V6JA 2CL2A 1WBFA 5JOYA 1DCSA 2XDVA 4CCOA 5KHIA 2RDNA 1W99A 3K4DA 2JDHA 4YZ5A 1O8SA 2JDYA 1IPKA 3DF0A 3OTFA 4UFMA 4XBNA 3BUCA 5GZDA 3ALQA 3MV01 1VR3A 2BWAA 4LEJA 4Q4X2 1CPMA 4XQWA 5IVBA 1V70A 1PX3A 1NCQC 2V09A 1MQTC 4RHV2 2QDRA 2XQRA 5H9SA 1LGCA 3I59B 3RJRA 4AR2A 5C4WB 4QQ2A 1DQ5A 3C3VA 4COUA 4UFHA 2QQLA 4XJWA 3AP5A 3IIAA 5JXHA 3K48A 1RXGA 2XGXA 5LEKA 2IXLA 3LFIA 2ET1A 4ZZ5A 2HWE3 4H55A 5FZGA 5LB6A 3WQBA 2CTVA 1XOYA 2XJUA 3V64A 1LOAA 1UKGA 4JKLA 4DO0A 5JPMB 1OOPB 2R6QA 2PN5A 4Q0QA 4EJRA 2BOIA 3U10A 3AM2A 3U11A 1RUE1 5FXWA 1Z78A 2VNVA 4MXWA 5FZDA 3VBUC 4XUNA 5DABA 5SV5A 4XF1A 1QF3A 2BERA 3WX5A 2HKXA 3NAPC 4K6BA 3HT1A 1XYNA
chains in the Genus database with same CATH topology
4JGZC 2GMPA 1ZNPA 1PO21 2HWE2 2LTNA 1LU2A 5L73A 3BOWA 2DVGA 4Q4W1 4R9CA 5FQ0B 5C9AB 5I8YA 4S2DA 2YC0A 1C4RA 1O4TA 4AG4A 4YVWA 2ZA9A 2I45A 3MYXA 4FOYA 3H3UA 4CDUB 4P9WA 4Y24A 1W6PA 2P34A 3INAA 1WMDA 4IESA 4XW3A 4J6GA 4CEWA 5E8AA 4DRVA 2Q30A 2R073 5FAXA 4HKOA 4XTPA 4Y20B 4U2AA 4XMIA 5FTTC 2DUQA 2TEPA 2AUYA 2DF7A 4FQZA 3PTYA 4XBLA 1NCRC 2RM22 2X5IC 4P9XA 3OYWB 4OI0A 1WMFA 1C57A 1HX6A 4LBMA 4ISQA 3ZFGC 4F8AA 1ND3C 2R072 3ZFEC 1YCIA 1WW6A 3UJOA 3NV3A 4AEMA 3WP4A 4LBLA 4CEYC 5A32B 3ELNA 5CFDA 2D3SA 1BCXA 2C9AA 1MACA 3FFQA 1BBT1 2D3PA 2VW1A 4JVAA 3LA7A 3VZNA 5BV6A 3T1LA 2EAAA 2FHRA 3OBTA 2D7FA 3B7MA 2XJTA 1DF0A 1ZZBA 3KSCA 2ZS6B 3O12A 1SLBA 1PO11 1X8EA 3OJBA 3WXPA 2RS31 1QH6A 4PDWB 4JDOA 1ZZ7A 2P3IA 1LESA 4R8HA 4P9YA 3MEPA 1ASJ1 5FRAA 4UW3A 5KC6A 1FX5A 4GH4A 4HSLA 3M2MA 4GMP1 3M3OA 1PNFA 1NE6A 3A4UA 1W2UA 3ILNA 4BOWA 5HBAA 1PIV1 4AEJA 1BVVA 3IDBB 3VZOA 2WNVB 4N9HA 4OHZA 1JHNA 4MUVA 1S0GA 4XETA 1N3QA 1O5LA 4P5HA 5JSPA 1PK6A 1F2NA 2D6PA 1H30A 5BNQA 3NSTA 2W39A 2CYFA 2ARXA 1C8NA 1LOFA 2RMU3 1ZZCA 4WM7B 2ZGNA 3AYAA 3GALA 4INDA 2OUJA 2D6LX 2O1QA 4HMZA 4BIOA 1W39A 3ZMNA 2XWBB 3FX3A 1D0HA 4C1XA 1GYKA 1HQNA 3CL1A 2MEV3 3AB0A 2VNRA 3VL9A 2XJVA 5ABJC 1J3PA 4M01A 4QPGC 1U5ZA 2X8KA 3IBMA 1QJU3 2RMU2 1G86A 3FJSA 4HSJA 5EXOA 5GM0A 3THPA 3S6PA 4OFGA 4XQ4A 2VXRA 2AENA 3WDTA 2Z5WA 4IEPA 3J4UH 3M4FA 4QPIB 5L7OB 2KM2A 2SLIA 2DTWA 4N90A 5DUXA 4DMIA 5IK8A 2MEV2 1AL21 3MIBA 1AHSA 5ACA1 3CEWA 2NQYA 1V6LA 3VKMA 1QJU2 5C8CC 3H0OA 3R4UA 3ZX7A 4YW2A 3QCWA 1K5MA 5K8SA 1XRUA 3T2TA 4AVCA 4ATEA 2XB6C 3VKLA 1BEV1 1GBGA 4AE2A 1PZ8A 4BHPA 4B4RA 2DVBA 2R043 1G8WA 1YIPA 1M06G 4FVVA 2B46X 2WWSA 2ZGTA 4AHYA 1Q8VA 5LEJA 4AWDA 3I2DA 3A0NA 3N35A 4HL0A 4Q4V3 1HV0A 2ZHLA 4AVBA 1V6OA 1HXS3 5DUVA 3FE5A 3EBRA 3D6EA 1CPNA 2PELA 1SLIA 1YJLA 2GNMA 4RL7A 5KC5A 1PVC1 1D0GA 1ND2B 1LULA 2I07B 2R042 4YG6A 5J48A 3UV9A 3WQ7A 3WDWA 1GICA 2JG9A 3BALA 4RQPB 3DPRB 1SCRA 1WD4A 4GIQA 1HRI1 1VJ2A 2ZGMA 2HWC1 2IXIA 2Q5TA 2GH2A 1CAUB 4Q4V2 4QGLA 1W6QA 4YVSB 5T5LA 3QH6A 1GFF2 1HXS2 2GC1A 4A3XA 1J1LA 4LHKA 1EV11 4YNIA 4C91A 1ONAA 1JOJA 1LGNA 2GMEA 2ENRA 5BNNB 1R081 1W0OA 4CP1A 3JUUA 2H0VA 1NLSA 4AEDB 1QXRA 2XG3A 3WW4A 5CG8A 4RS5B 3APBA 2O8OA 4NHKA 2EAKA 4AVAA 3H9AA 3IT8A 2HJIA 1HIXA 1GV9A 4JRLA 1VBE3 4AXOA 4FPJA 1RINA 2XL7A 1ZRCA 1Z7S3 1OQEA 2XJPA 3WP5A 3NV1A 1DYPA 2ILMA 2R16A 3H3ZA 1DQ4A 4HK8A 5KWRA 1LU1A 2OW4A 3LKJA 4GH4C 3NVCA 3IPVA 3AKQA 3IMNA 4W6XA 1G9CA 3ILFA 1VBE2 5BNPB 5AC93 1KS5A 4FSJA 2WFF1 1ZVFA 4XJUA 1ZRDA 1Q8PA 1QOSA 1Z7S2 4GULA 4XXPA 2PHXA 2IXKA 4B29A 4QHBA 4IEOA 1LJ7A 1RUC1 4K8FA 5CA6A 4B4QA 4AI8A 1DZTA 2WS93 1W6MB 1AL0G 2GH8A 1LGBA 4CDXC 1J59A 3JCIA 4YM3A 1RUJ3 1PK6C 2VH9A 4IV3A 5AC92 5LK7B 5CU1A 5BXXA 1YLLA 4COWA 1VBD3 2CAUA 5FO7B 4ZKTB 3ZFFA 1H1IA 4YGCA 1MZ6A 4Y22A 4BLJA 1V6IA 2HWD1 2MNGA 3LA2A 2JX9A 4XBQA 2WS92 1FAYA 1YNAA 2E51A 1LB2A 1QNYA 1J3RA 1RUJ2 2QDNA 3U4XA 1LOCA 4Q8LA 2IFWA 4Q0UA 2XL9A 4BM8A 2W68A 1VBD2 1VLNA 3VBFA 2Y38A 2XHKA 5JDBA 1COV3 4A2UA 2HWB3 1AX0A 3GNEA 1VBB1 4CDWC 1IS5A 2BFUS 4YG3A 3O7OA 1FPN3 4AI3A 3MIFA 4ASMB 1O7FA 3OPZA 3V0BB 1IPJA 2VUJA 1F5FA 4U36A 4CP0A 3TBDA 1COV2 3WY6A 2HWB2 5JI7A 1K5MC 2D6MA 2YHJA 1JH5A 1O3TA 1BMV1 1VB2A 4A7ZA 1KXGA 3NO8A 4KNCA 5CNAA 3IKWA 1RMU3 1C1LA 1FPN2 5BPXA 1AR72 1QXPA 3AZVA 3MFCA 3FHIB 2A73B 4RR3C 3ZSEA 4XOGA 3PMEA 2KA3A 2JE7A 3GZUC 3MW4A 5AVAA 4CRQA 2SBAA 1REEA 5FO9B 1RMU2 4PJYA 4H3WA 4QGMA 2KXLA 4XHBA 2JG9C 2V73A 3KCXA 4J1WA 3VZLA 3V65A 1A6CA 1UX6A 4WZFA 5K9YA 2WT2A 4CDQC 4HVRA 5GZCA 4F83A 1U12A 4UBGA 2VECA 4FXKB 4HN1A 1ZZ8A 3ZDSA 1CJDA 1LEDA 4LO5B 2YY1A 1DG6A 2R061 2P17A 1JXNA 1XE7A 2P2KA 2DFCA 2XBO1 2BTVC 4TYSA 4E27A 3AFKA 3WHTA 1H8TC 3KGZA 3KMHA 5BNOB 1F31A 1OQ1A 4KU7A 2ZCWA 1C8M1 2NPIA 3R4SA 1LOGA 5KXCA 2G4IA 1NQDA 2CGOA 4META 1PVXA 1EPWA 4DQAA 3VUOA 1LEMA 4XQDA 5F9TA 4TSVA 3E5XA 2A6VA 1NA1C 2VPVA 2ZMNA 3K51A 3TNQA 1R1ZA 3ZVXA 4P14A 2IFRA 2PHUA 3QD6A 3MPPG 3AKPA 1U5XA 1QJY1 2ZGSA 2DCJA 3USSA 1NXD1 2PHRA 1DU3D 3ZXLA 1G7YA 2QZ3A 2RE9A 2YPJA 2C0ZA 2XUMA 3OY8B 2I2SA 2NZ9A 4BA6A 3VGIA 3RNSA 4IXLA 4N53B 1FMD1 1JUHA 4LA3A 3ZFFC 2PAMA 4IETA 2GNDA 4AHZA 5FOJB 3RZZA 1NCQA 1OPMA 2K2SA 4FAGA 1WLTA 1AZDA 4E4SA 1GLHA 3PVBB 2GC2A 1G6NA 3AYEA 5GLZA 1C28A 3VV1A 2JECA 2B39A 3D8CA 1A78A 3KT1A 2E9QA 4GXLA 3VBFC 1X36A 2VNGA 3VKNA 5JZGA 2XJRA 1TE1B 1IS6A 1TMF3 4GALA 4NWWA 3UKNA 1O3QA 3VBUA 2PFWA 4S2GA 3VHOA 4Q4W3 1OD5A 1RHI1 1MS0A 3NAPA 4JC1A 1QU0A 1H8VA 4JGZA 2XJQA 3G7DA 1SLTA 4Z92B 1QHDA 1Y3TA 3VDDC 1GQGA 1S1AA 1H2NA 4FOVA 3D0SA 2BPA2 3V0AB 4IEVA 1R093 2H6CA 1B35B 2HYKA 4MV2A 1TMF2 4B8EA 4IV3B 2Y0IA 3VBSB 4Q2FA 1H2MA 1O91A 3ASIA 2HWF1 4JRAA 1CGPA 3N36A 4NO4A 1OA3A 2QQPA 2CNAA 1XE8A 2C1FA 4D7YA 1Q8OA 2Q4SA 4XDQA 3WUDA 2QVSB 4FPEA 3ETQA 1R092 1D4M3 2FQPA 2CGPA 3AZWA 1QY4A 2RS13 1NCRA 5CFCB 4FQ4A 3VHNA 3B00A 2XVKA 2X53S 3A0KA 1AR83 1N3OA 4BH9A 4AFCA 3B5LB 3AXDA 3MF9A 1ND3A 4B7KA 3ZFEA 2ES3A 3ZIWA 1CN1A 5J37A 4M3CA 3AMPA 1IS4A 1D4M2 4GQ7A 1RUOA 2GAUA 1R1A3 5EFUA 2RS12 4QPYA 3KM5A 4J1XA 5H9PA 1ALYA 3ZXKA 1AR82 4WM8B 2ZZJA 1AYM1 5D8AB 1AX1A 1GZWA 2EXKA 2RS33 4H7MA 4X6RB 2RR11 3AKSA 4R9DA 2Z79A 4YRDA 1UKRA 3KB5A 1R1A2 3JQWA 4HLTA 1ENQA 1VBA1 1IOAA 4R4ZA 4X6QB 2A6XA 5IT6A 2ZX1A 3AP7A 4AF9A 2WC2A 5GJ6A 5J36A 3VBRC 2A6WA 2EXHA 5E89A 1PZ7A 1RUF3 2VULA 1TEIA 1FOD1 1N47A 2PHDA 4YYOA 2WIIB 4MYEA 5C4WC 2PA7A 5GZEA 3VL8A 2PAKA 1KD7A 1RUNA 3L2YA 4LO7A 3H1WA 5GLTA 1L3JA 2ZJCA 5A3LA 3CJIB 1WBLA 3FUOA 4XMAA 4XFBA 3MPBA 1RUF2 1AR91 4P9IA 1OOPC 3TN92 4AI2A 4C0BA 1YXWA 1V9U1 3ZXJA 1GZ9A 4ONUA 5L36A 4L8QA 3WG1A 4CYDA 4W6YA 3ZMOA 5BYNA 3LCPA 4EWAA 3PJQA 2Z2SB 3TYJA 4FPOB 1KFXL 2WSVA 3ZN6B 4I02A 4Y1XA 2EXJA 4FPLA 1S0JA 3WR0A 4I0BA 5C9AC 2BVBA 1W6NA 2BYVE 5J96B 2IXCA 1LHOA 2IC1A 2BWCA 5FREA 5ABJA 5JZGC 2E7TA 4QPGA 3MFAA 2PAEA 3B01A 2DUPA 3WUCA 2DTYA 3TAYA 3RYRA 1RUG3 4KWLA 4V1PA 5FLHA 3VZJA 2ZMLA 1VIWB 2D3RA 1PGW2 1T6GC 3NV4A 5JIUA 3QBQA 4IEUA 2JD4A 3GZTB 4AQ6A 1KDKA 1W6OB 1G9BA 4XJ9A 3ST7A 5DDJ3 3WQ0A 1WLDA 1U5IA 5C8CA 3OGGA 4HZFA 2W08A 4FPKA 4HPKB 1RUG2 4LHNA 3LWCA 3SLIA 3QH7A 4A7KA 1WUVA 1F8VA 1CAVB 4DRRA 4YARA 3LA3A 4MGIE 3B94A 4Q4Y3 1OQDA 3KT7A 4JCKA 1NCQB 3LB9A 1MQTB 3WINE 3WDUA 1VB4A 5DDJ2 2RS53 2LM3A 2VMGA 2YUEA 3E6DA 4XF9A 3JD73 3UL2A 1PVC3 3ZYGA 3O0XA 2VMIA 4NVPA 1DGLA 4UW5A 1JYCA 3HAGA 4QT6A 1CIWA 1HRI3 3AXEA 3AX4A 4Q4Y2 3AZXA 4LBQD 3VHPA 4B3NA 4K20A 3H8UA 2GN7A 1I3HA 5FFOC 3H50A 3WDXA 3WW2A 3WDYA 1MVQA 4YZ1A 4LUMA 2RS52 1EV13 4IERA 3JD72 3KQRA 4XFAA 4XYXA 1GANA 3NJZA 3VBHB 1QJX3 3WG2A 1WW7A 3NAPB 3M70A 1CONA 1SLAA 1CJPA 4NWVA 1HRI2 3TRSB 4RD7A 1ZX5A 4ISRA 3B69A 5J98B 5CB7A 3W59A 4UW6A 3JBG3 1OMIA 4GB31 2DCYA 4YFZA 5I8SA 1EV12 3ZXGA 4AI1A 4NOTA 1QJX2 3VKOA 4FTBA 3V56A 4IV1C 3M8LA 2WNVC 2IZWA 5JSRA 3HN1A 3AZYA 3X29B 3SITA 4OHYA 3LZZA 4P9JA 1MEC3 3JBG2 3J8F1 1HQLA 2GC0A 4UBHA 3W9AA 3H7JA 3WCRA 4IL7A 4F3JA 1NCRB 2PLV3 2D98A 2X5IB 2YXSA 3PHMA 3P3PA 5EJ3A 3SMHA 2CWMA 3TB0A 3ZFGB 4ASLA 3POWA 1ND3B 1EAH1 2Q1MA 3IM0A 2GSYA 4LLOA 2NP0A 1MEC2 4CEYB 4AYUA 3WG4A 4YZ2A 4BMEA 2OZJA 3ES4A 5KXEA 3S0MA 2B8MA 2EIGA 2PLV2 5T52A 2A6ZA 4RGAA 1LHNA 4CDXA 4Q1RA 5CVRA 1VAMA 5L7OC 4QPIC 3RRDA 3POSA 3FUQA 5KHJA 3DL3A 2FBEA 3KCCA 4KGQA 5I0RA 3EHKA 1SLLA 1MZEA 1AR63 1RUD3 4QGNA 1IQAA 3B93A 4RHV1 2E7QA 4NPRA 4WVMA 2ARBA 4HVOA 2JG8B 4A7YA 2ZKLA 2DURA 1QJZA 4PIYA 4GKYA 3DGTA 4YLZA 5GKAC 1SMVA 1H4GA 2WNUA 1JUIA 1RUD2 1AR62 1REDA 3JZVA 4CDWA 1Q3EA 1HV1A 1O5UA 3O5SA 2LALA 2CY6A 4AVTA 2BNNA 4DS0A 4AFBA 1DQ0A 3CJXA 3FBMA 4AQSA 4K40A 1ENRA 3KZ4C 3EJKA 4DINB 2NMNA 2XLAA 2R30A 2ZHMA 4FPHA 4Y1VA 2OZ6A 2R1DA 2ZX4A 4IEZA 4LBKA 1FYUA 4RQPC 2A3XA 5T3NA 1SBEA 2HWE1 3BPZA 1RL3A 3FC0A 3VKFC 4YVSC 2WZR1 1LHWA 2ZX0A 3VN4A 4C90A 1IHMA 4G3YC 3AFGA 3KLSA 4I30A 4FBFA 1KITA 3JU9A 3MI8A 4RR3A 1W6NB 3C2UA 4JGYA 5E88A 5JVVA 3GF6A 4AEDC 4HK9A 3WHUA 4COVA 5FOBB 4RS5C 1MR5A 5JOXA 1S0IA 1SCSA 1WLCA 4Y1ZA 4C0HA 1HQWA 2VQAA 3WV6A 5F6LB 3M3IA 2BUKA 1ZZ6A 1Y43B 1NLRA 4I0WB 2WL1A 4PLNA 4MXWB 2RM21 3N7JA 1SBFA 1FATA 1MS9A 2XPJA 4EWDA 5IK5A 3MLKA 2A6YA 4CDQA 1WD3A 1U0AA 3RJ2X 4Y5Z0 5DG1A 3NV2A 1LHUA 2R063 4YG0A 1G9FA 5BNPC 3WDVA 3WW1A 2GALA 1YWKA 1GNHA 4YVWB 1EP0A 2XJSA 3QACA 3GZAA 3HQXA 4MH0E 1XNBA 1DDLA 2E63A 3LOIA 1W6PB 4D69A 1FNYA 4ATFA 4CEWB 2D93A 4H14A 2ZX3A 4LULA 4QQLA 1LECA 3SNMA 4WVWA 2UU8A 1H8TA 1N1SA 2YV8A 2ZABA 2P3JA 5I0UA 2WNEA 4N9IA 2ZGOA 4PQ9A 5T5PA 1SFYA 3H7YA 2ZBJA 4DXZA 3LGRA 5K7PA 1SEFA 4N43A 5JMCA 4XFIA 4BQ1A 3RI8A 1NA1A 3FLRA 4YM0A 4YZ4A 2PHLA 4XILA 4HVQA 1AYN3 1J3QA 2AR6A 1RITA 2OA2A 5CFDB 2X29A 1TME3 2E53A 5L19A 2K9ZA 1WGPA 4FPCA 4XJZA 3GYDA 4M3CE 4MSVA 3DKWA 1SLCA 3ZXFA 2RJLA 2PHWA 4MXVA 5T55A 4Z07A 1UIKA 4K21A 1AYN2 4QQPA 1ZBA3 3IN9A 1S2KA 4XE9A 2UWBA 2DWRA 1TME2 4P9LA 4Q1PA 4PIZA 4AGRA 4B7EA 1NY72 3GBWA 3R6SA 4B4PA 1GKBA 1CAXA 4IEQA 4I3GA 5FMOS 3QOPA 3AYCA 4GH4B 2B5HA 1ZBA2 1RVF1 1O3RA 3ZYPA 2WNUC 4FTEA 1H9PA 3MICA 5TSWA 1CX4A 3R05A 1WCDJ 4OULA 5T5OA 4KL1A 2RMU1 3NKTA 1RUH3 4PLMA 4JV4A 1HDKA 3MGUA 2MHFA 1POV3 1XNCA 3E5QA 3VDDA 4JTNA 3CF6E 3SCHA 1ZRRA 2MEV1 4CDXB 1ULDA 2ZKNA 5KHHA 3RSJA 5A33A 1PK6B 4GA9A 1AXZA 3KS7A 1PGL2 3VBOA 1QJU1 2LUWA 1KJRA 1RUH2 3D82A 3ZXAC 1HRV3 3ZXEA 2DUOA 1RTVA 2QJVA 3HT2A 4Q29A 4JGYC 4D3WA 2ZZQA 5LRRA 3LAGA 1QQP3 2A5ZA 3AMNA 1VRH3 3IWZA 4F7ZA 4CP2A 2JE9A 4Z2WA 4R4XA 1HRV2 5FPXA 2DCTA 4GKXA 1XQNA 1DZQA 3BODA 2H0BA 2ZGKA 3OD0A 3VHRA 4L99A 1QQP2 1RJ8A 1VBC1 1VRH2 2YMZA 5J09A 4QM9A 1OLRA 2A71A 5HCBA 1MS8A 2DYCA 4Q4V1 1UZZA 4Y1YA 2TUNA 1NXMA 4AFMA 1K5MB 4XFCA 3ZN4A 4COYA 4GWMA 1YO8A 4FCAA 5JOWA 3IDCB 2WSUA 5GLVA 1EYBA 4OI2A 1LRHA 1ZBE1 4YW5A 1XYOA 3J9SA 1ZA4A 1BQPA 2VOWA 3WOGA 3CU7A 1FOD3 4E2QA 1BYHA 3W58A 4N53C 2ZGUA 3VBRA 3LSEA 4N43C 4XPVA 5I93A 2PTMA 3I59A 1IS3A 3T1MA 5C4WA 1UD1A 1UN1A 2JG9B 4FTSA 4DB5A 4PBOA 3WT3A 2WINB 1FOD2 1V9U3 4W6WA 1DGWA 3JB8A 5HCFA 3H1YA 3PVOA 1OA4A 1VBE1 2WA3A 1W6QB 4IEYA 2VOVA 4COZA 1ULFA 2ZAHA 5DUUA 5FO8B 4YW3A 5IUQA 2JICA 4BE3A 4AEKA 1ULEA 1OOPA 2UY9A 4I0AA 1MZFA 1XU1A 4OHXA 1CVNA 5K0UC 1CD3G 1N1TA 2D6KA 1V9U2 4E4ZA 2OVUA 5JPNB 1GZCA 5AC91 3GBGA 2UYBA 1IKQA 4O9GA 1LCLA 2YGMA 2ZX2A 3ZYRA 3NW4A 2QNKA 5FQ0A 5C9AA 5T5JA 4LBJA 2UWAA 1B35C 4MZUA 1IKPA 4RFT0 2D40A 5JR7B 3VBSC 1RUE3 2UURA 2VOXA 2OIIA 4CDUA 2Q0AA 3IPVB 1QGLA 3AMQA 2WS91 1GR3A 1S0EA 4XF4A 1OA2A 1B09A 1RUJ1 3GHMA 3ZYIB 1DFQA 1PO23 4Y20A 1FV2A 2VNOA 1PM7A 1VBD1 1TNRA 2WT0A 3ES1A 1AVBA 5CADA 4W65A 2N7GA 1RUE2 1QWRA 5FPZA 2CWSA 4LT5A 5CFCC 4BLIA 3OYWA 1ULGA 2AZ5A 3O0WA 1WW5A 5JOZA 3BB6A 1OKQA 3RS6A 1D4VB 1XU2A 1AXKA 4KWKA 1HKDA 3KD4A 4HT1T 2P37A 1PO22 5CBLA 2MPFA 4YSFA 2GU9A 5T54A 4ES9A 1YFYA 1QKQA 4JDNA 3B9CA 3VBOC 3AJZA 4Q4W2 5A32A 1V6MA 1COV1 2WLQA 2HWB1 2AGSA 4PF5A 1DGRA 3ACLA 3ZFFB 1ZREA 4L2NA 1QDCA 4Y22B 2YROA 3PMSA 5D8AC 3ILRA 1FPN1 1AR71 4K7JA 3TOJA 2YYOA 4WV8A 2BNMA 2IXHA 3M1HA 2EF6A 4QQHA 3WP6A 2XKOA 2BFUL 4WBBA 3VBFB 2FZ2A 1UPIA 4OHVA 3S7EA 2F6BA 2A7AA 3HIFA 3AZZA 3M3QA 2XKPA 1BBT3 1Y7BA 2GNBA 1QOTA 4Q0SA 1RMU1 4MGKE 5DZGA 2NYYA 4ES8A 4LUKA 2E7AA 2ETEA 3VZMA 4Q8KA 1OFNA 2DU0A 1H0BA 1YI7A 1PO13 4FPYA 4N7IA 4WVVA 2R32A 1X50A 3D4KA 3EQEA 3FBYA 1BBT2 4FXGB 1I5ZA 3FMGA 4GWNA 3ROUA 5A33B 3MIEA 4LBQA 1OI6A 1YUDA 3CJIC 1WA4A 4EV0A 1ASJ3 2PHTA 3B3QE 1LODA 1RB8G 1F5JA 4IV1A 2WNVA 5DUWA 5T50A 2A75A 1PO12 2F4PA 2P3KA 4OLLA 3ZSJA 4GMP3 5DG2A 2RS32 3I8TA 3H1MA 2PHFA 1UF2C 3WZ1A 2E6VA 1EAH3 1ZYBA 1ASJ2 1AXYA 4RGGA 4WM7A 3VZKA 4DPNA 4XFFA 1QNWA 2VQ0A 1UW8A 1PIV3 2NM1A 3RPQA 1GSLA 1GNZA 4LTAA 3UKVA 1H2KA 1IZ3A 2BBVA 2R49A 1Q8QA 1EAH2 5IK4A 2ZOEB 1EPZA 4TZDA 2B7YA 4I3PA 1PIV2 4S2FA 3Q9OA 3POYA 2OUHA 4R9AA 4QPIA 5L7OA 4XFHA 4YM2A 3WW3A 3D5OA 3U07A 4Y4YA 2Z42A 2BGCA 1UIJA 4IEXA 1UU5A 3AP4A 4CDUC 2AYHA 2A3YA 1YFUA 2Q8OA 4LBNA 1MS3A 3VBRB 4XXAA 4OI1A 1KS4A 3AKTA 3I7DA 4R52A 5EV7A 4KU8A 1AL23 2VOKA 3G6JB 2BVVA 5ACA3 2VG9A 5AFBA 2TBVA 1YYNA 1LTEA 3ZSLA 2IWGB 4HKWA 5I0TA 1I1EA 2C5DA 2FZ1A 2GZWA 2XWJB 4ZU7A 5BY5A 1S0DA 1YI9A 1X33A 3WQ1A 1UPSA 2VMHA 2GDFA 3ZIXA 5KBFA 3B02A 1BEV3 1KJLA 2GMMA 1Z0HA 5IK7A 3PJYA 1ND2A 4G4FA 4ORFA 4L92A 2WZR3 4XTMA 2G9FA 1AL22 5ACA2 4Q0VA 1NOVA 4RQPA 4YM1A 4BMBA 3DPRA 3OBRA 5FCCA 3VBHC 1CAUA 4YVSA 1X7NA 4MGZE 4Q0PA 4OZXA 1AF9A 1LOEA 4MVTA 1TMF1 3S30A 4EN7B 4NHLA 4EWEA 2JJ6A 3N4MA 1BEV2 1OHFA 1VAKA 2ET7A 5BNNA 3O0VA 4DY5A 1PMIA 2DVDA 2WZR2 1Q5OA 4JTOA 4AEDA 2WQZC 2D44A 4RS5A 3QLQA 2VGDA 1FXZA 4QU2A 2RM23 2DCZA 1POV0 2HWC3 1E57A 4PDWC 1R091 5JZGB 1M4WA 2D5FA 1S0BA 5BUVA 2K0GA 3SH3A 3VBUB 5H9QA 1V6KA 1PVC2 1VP6A 1JBCA 2DU1A 1R083 2Y26A 2ZPXA 1LENA 4LR4A 1YIFA 4JGZB 5J7MA 4HETA 3TNPB 2HWC2 2HEVF 3L2HA 5BNPA 1D4M1 1QMJA 1MS1A 2ZACA 3WD5A 2RS11 2Q1ZB 4XJ8A 3RDIA 2D97A 1R082 1AR81 3HWJA 1UMZA 1AJOA 3O14A 4MX3A 1W6MA 5C33A 3BIWE 3R0RA 1R1A1 4URTA 2WFF3 1URXA 5DZEA 4WM7C 5C8WA 1RUI1 2UY8A 2XLGA 1D2QA 3S7IA 1KDMA 4DZGA 4FT8A 1RUC3 2DVFA 1C5HA 2B9UA 1PHMA 3ZFEB 4TWTA 4M3CB 2NMOA 2WFF2 4FPGA 1HW5A 3WLUA 4CTEA 1V00A 2JG8C 1NYWA 3WP3A 5JSOA 3NKGA 2VW2A 1JYIA 2A3WA 3I54A 3MIHA 2ZGLA 1RUC2 2A70A 1GZWB 1UCXA 4K1YA 3M7AA 1RUF1 2HWD3 1AX2A 5EWSA 2HEYF 4Z1VA 3TN91 4EN9B 3MW2A 4LBQB 1DYKA 3N7MA 3V0BA 4AFDA 1LHVA 4IV1B 2RHPA 4BYYA 2O0OA 3AMHA 4Q4X1 4E2SA 1APNA 1RVF3 1G9AA 3HR9A 1VBB3 3WVJA 2HWD2 3WNXA 3GHNA 4JAAA 5D1IA 1WCSA 2ZGPA 4JDMA 4OUSA 3E5UA 4XF3A 1RC6A 4EN8B 4ZU5A 3LOBA 1RVF2 4KG8A 1ENXA 4OUMA 4KBBA 1VBB2 3DN7A 2ZHKA 3PNAA 4UXAA 3ZN5A 4Z82A 2O8QA 4PLOA 1ND2C 4BWOA 2CAVA 1PGW1 2DV9A 3MDPA 3MIDA 4SBVA 4DFSA 2ZGQA 3DPRC 1O4YA 1KQRA 4L9BA 4O9EA 3N7KA 5E16A 3VLBB 1QDOA 2QKDA 5F1RA 1N1VA 1BMV2 1RUG1 5BNNC 2QE3A 2EVXA 3ZSMA 3TWIA 1SACA 4AGGA 4YVWC 1KRIA 3RMYA 1IGOA 4AW7A 4EN6B 3AMMA 2IXJA 5DDJ1 1FI2A 5ABJB 2OYZA 4QPGB 4CEWC 3FLPA 1VBC3 2WA4A 5BNOA 4MLOA 4QD2A 1AUYA 4I2OA 2JDZA 4Q4Y1 4KH9A 2VU9A 2R071 4AI0A 2PQQA 1FNZA 1JW6A 4FOWA 3BOPA 4XFGA 1OSGA 2RS51 2JXAA 5JI9A 1XNKA 3JD71 1SDWA 4LBOA 3FFZA 3UKTA 3SH4A 5C8CB 2XBO3 1UL9A 1VBC2 2YZ4A 4PIXA 1H9WA 5JLVA 4AVSA 1ZBE3 5FBZA