3WQ7A

New crystal form of the hyperthermophilic family 12 endo-cellulase from pyrococcus furiosus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new crystal form of a hyperthermophilic endocellulase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 74
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq7A00
2DCJA 4XPVA 1HV1A 3HD8B 1XYOA 2JEMA 3WQ7A 3B7MA 1XNBA 1OLQA 3B5LB 1H4GA 3AMNA 4IXLA 3VHOA 3VGIA 3MF6A 1C5IA 2BW8A 3AMHA 3VHPA 1HV0A 1H1AA 3MFCA 1BCXA 2NLRA 1T6GC 3LB9A 3AMQA 3O7OA 5HXVA 4XQWA 1KS5A 4HKLA 1QH6A 3WP3A 3MF9A 2VUJA 2D97A 1H8VA 1REEA 2JENA 3VZKA 3VHNA 3AKRA 2VG9A 1REFA 1UKRA 3WQ0A 1W2UA 5EJ3A 1M4WA 2NQYA 3M4FA 2DCZA 1OA2A 3RI8A 2VULA 3WXPA 1YNAA 2DCYA 1F5JA 4XQ4A 3AMMA 3VZLA 4H7MA 2DFCA 3AKSA 4HK8A 3VZMA 5K9YA 1HIXA 3VL8A 1NLRA 2B45X 3RI9A 4XQDA 3WP6A 3WQ1A 3LGRA 4HKOA 1REDA 1KS4A 1XYNA 2C1FA 2QZ3A 1XNCA 1AXKA 3VZOA 3WT3A 1OA4A 4S2FA 3ZSEA 2B46X 1PVXA 1OLRA 3AKTA 3AMPA 3EXUA 4S2HA 3WR0A 1XYPA 1ENXA 1UU5A 2BWCA 3VL9A 4HKWA 1H0BA 2D98A 2Z79A 2DFBA 2B42B 1XNDA 1XNKA 1IGOA 1OA3A 2VGDA 3WY6A 2F6BA 3VZJA 1TE1B 2DCKA 4NPRA 3AKQA 5K7PA 1QH7A 2JICA 2QZ2A 1UU4A 3AKPA 2BVVA 1XXNA 4S2DA 3VLBB 3VZNA 3WP5A 1C5HA 4HK9A 2BWAA 1BVVA 1BK1A 3WP4A 3WX5A 1H4HA 4S2GA 1UU6A 3MFAA
chains in the Genus database with same CATH superfamily
5LA1A 4LHLA 4PQ9A 1W0OA 5A80A 5T5PA 3LEIA 5GJ6A 5IHRA 5HCHA 1RITA 1XYOA 1PK6C 2LW8A 3LSEA 4D3WA 5G04L 5T52A 3W21A 5A33B 3B7MA 1GUIA 4BISA 4QKFA 5JOZA 3WDWA 2ZX3A 4A7KA 2RS31 3AJYA 1MZ6A 1NA1C 4PDWB 3B5LB 3DPRC 3OYWA 1HDKA 2WSVA 3AMNA 4C0HA 1ZZBA 2DWRA 3ILFA 5FZDA 1Q8OA 5CBLA 4ZXEA 1DZRA 1CVNA 3VHPA 1RUH2 5J7MA 1FOD3 1GNYA 5CIRA 4AVSA 2NLRA 3U10A 4YZ1A 4FPCA 4H14A 4LE4A 5GZFA 1LU1A 4Y20B 2D43A 3NJVA 2D97A 4XJAA 1AX1A 2BUKA 3I97A 1SLLA 5EJ1B 2JG9C 1KD7A 1E5IA 4KGQA 1QDCA 2R0HA 2OQ6A 4XCAA 4F7ZA 1KRIA 4MHUA 1IS6A 2QQUA 3ACLA 3C7OA 5BNOA 4OCTA 5HI0A 1SBFA 1NCQC 3PHMA 2EAKA 3N7MA 1W99A 4RR3C 3RMYA 1JZ3A 1R1A2 1HN0A 1W05A 5CU1A 3J8F3 4CXWA 3HQUA 2Y26A 4FQ4A 4EWEA 2DVDA 1GICA 5JR2A 4OI2A 2FBEA 3KD4A 1NCRA 2GMEA 3VZMA 3POIA 4K1ZA 4PIZA 4KWUA 1OPOA 2DUQA 3VDDB 1AYM2 2YROA 3N7LA 1URXA 2IFRA 3JQXA 1I3HA 1LEMA 1ONAA 5L19A 3FJSA 4PHZA 1XYNA 3PLQA 4RA0A 3TBDA 3ON7A 5H9QA 2D6LX 3ZO0B 3OPZA 5FP7A 5FMOL 1C8M3 3TNQA 2R073 5A32B 2EIEA 1HXS3 3EXUA 5I0SA 4RHV2 4LEJA 3VDCA 4XILA 1RUF2 1TME1 2HWD2 5A7NA 1YXWA 1NXMA 4RFRB 2E53A 5L9VA 3MUY1 4D0QA 1G9AA 1LR5A 1ZA7A 4GWMA 3BVCA 3ZN6A 4EZ4A 3PU3A 4CVUA 3WY6A 2MHFA 1J3QA 4YW7A 2W5FA 3RYKA 4MGKE 1UKGA 2XQRA 2W94A 3AKQA 3H3ZA 2GMMA 4LA2A 4YLZA 3ZXGA 3AXEA 4KBBA 3CF6E 1RUF1 2JX9A 4CP9A 5LEKA 3BB6A 1C8M1 1QJU1 4QGNA 4Q4W3 5J98B 2WT1A 3IMNA 1WBFA 2VOVA 1JODA 2EIDA 4AZZA 1AR82 4P9IA 4LIVA 1UY2A 3CU7A 5SV8A 5IW0A 2YFZA 5FMBA 1DZTA 1MPXA 1UF2C 1VR3A 2W3JA 2WFF2 2BVBA 2D93A 2UY9A 2WT2A 3LD8A 3MPBA 3QCWA 1G9BA 1WMDA 3DEMA 3DXTA 1JI6A 4BA6A 4OUEA 5FDBA 5FWJA 1YFWA 4GIQA 2PLV1 3NV2A 4XBNA 2W2IA 2ZTNA 3J8F1 5A7WA 5JIAA 1CAUB 4FPFA 2CGPA 1MS9A 3GJAA 2GC3A 2O0OA 4ZZ5A 1ZZ7A 1MACA 1O3SA 3R4UA 1RUG2 3WVJA 5JIUA 2CU5A 1RHI2 2B8MA 2HWB1 3DKWA 4HBNA 4Y1UA 1ALYA 2AENA 2P34A 4DO0A 5LA2A 1MEC3 4Q8LA 1WLWA 4AVAA 1KITA 1LOAA 3POJA 4META 3ZDSA 2HWB2 5C4WA 1PO12 4MV2A 2A7AA 5T3NA 1NOVA 3LIHA 3Q8BA 1RUG1 3SC7X 5LY1A 1OOPB 4LOTA 3SQOA 5AC91 3IT8A 4M0NA 4YZ4A 5IUQA 5IVEA 1LTEA 1S1AA 4LK7A 2PTMA 3E6CC 4AI1A 1AJKA 1KJRA 2EXIA 3OCPA 4LA3A 1DDLA 4QT6A 2VOWA 1LOBA 2JD4A 5EJ3A 1W2OA 4HG6B 3ZMNA 4QHBA 4XUNA 5EJZB 2QQWA 2GALA 4LE3A 3WDTA 1CWPA 3Q8EA 2BFUL 4ITCA 4TXWA 3GM8A 1GWKA 5JDBA 2JDKA 1EPWA 2YBPA 4UT5A 5GLVA 4A45A 2DURA 3ZYBA 1DU3D 2J1UA 3AKSA 4W65A 5A3LA 1MS4A 1PM4A 1W8ZA 4Y26A 1O5LA 1WCSA 3V65A 4LHSA 3RI9A 1FAYA 2VNGA 3WF4A 4ISQA 5JPMB 1OH4A 2HWE3 2W95A 3AYCA 4H2AA 3POBA 4E8DA 2GC2A 1XNCA 5CFCB 2VTXA 1NE6A 1H30A 2Q30A 4TTGA 1WLDA 2WINB 4ASMB 2E9QA 1JUIA 5A6ZA 3KQ4B 1WCUA 4BJ0A 2P1BA 5C6CA 4QXKA 1UY0A 4Z82A 3NKTA 4MGYE 5F2WA 4O61A 1TMF3 1HRV1 2VW1A 3VL9A 3NJZA 2L9LA 4AFMA 4CCNA 4MGIE 4XBLA 2PLV2 5L9RA 3GDBA 1VBE1 1HRV2 4QQHA 2WKKA 1CESA 1J3PA 1KFXL 2Y34A 2CSGA 4OI1A 2R32A 5J48A 4QKDA 4MXWA 5FYBA 2RJLA 2BQPA 1SHWB 3D4KA 2VUCA 4DUWA 4QPGB 5CFDB 2HWF2 4OUSA 2V5DA 4ORFA 4IE7A 2EAAA 5FZAA 3H3UA 1GP6A 2K0GA 4O7XA 1AR71 4YW3A 4LIUA 1OVSA 2GN7A 1DQ5A 5F39A 1EP0A 1Q3EA 5APAA 2CTVA 4BQ3A 4W6XA 2IXJA 3WP5A 5IVJA 1ACCA 1BVVA 1JUHA 2ARXA 4JHZA 2XJVA 3WUCA 4OVEA 3O12A 3OUJA 3MIEA 4OHWA 4XZUG 3DXUA 4S2GA 4CXYA 1WW4A 3MW2A 4GH4C 3H8RA 5F3GA 2HEYF 1OUXA 4YRDA 1AL0G 2FDHA 3NV3A 1KFUL 3FC0A 3T08A 1MQTB 2BYVE 4IEVA 3AB0A 1COV3 5FY1A 3T1LA 4XBQA 1KXGA 1NXD1 3JZVA 1XU2A 4N90A 1BQPA 4NRQA 4UWDA 1XQNA 1S0CA 3J4UH 4AEDC 3MIHA 4RR3B 3RNSA 4XUOA 5ACA2 1GNHA 4G9SB 4QX7A 4NAMA 1MS0A 3KSCA 3LIGA 5DN2A 5BUVA 3RZJA 4NOTA 4QPIC 4YVWA 1R083 5F3IA 3RJ2X 5A3OA 1BEV1 1U5IA 5F7UA 1YCIA 3WHTA 3CLPA 3MFCA 1E57A 1C8NA 3HJRA 4YNIA 3SXWA 1GKBA 1VBD1 1T6GC 1RJ8A 1PGSA 3MIGA 1RIRA 3VDDA 3MW4A 5I0DA 2DBNA 2ZGLA 1DGRA 1PZ7A 4YZ2A 1H8VA 3VD3A 2JENA 4KU7A 1LOCA 4JGYC 4MGZE 1RMU3 1NCQB 2DF7A 4UW4A 1A34A 3MGUA 1UKRA 2B9UA 3PIJA 2UURA 2GC1A 5FQ0A 1LOFA 1KJLA 3WW1A 1XE0A 4PIYA 5C5UA 3M4FA 2XUMA 1QNYA 2XBO3 1AL21 3BTAA 2FDIA 3P3PA 4LK6A 2CL2A 5FUNA 3VBUC 1PO11 3CJXA 2OPKA 3RRDA 2RS52 2DFCA 4CU8A 2A1XA 4MZUA 4COVA 1RUC1 4IV1A 4U36A 1F4AA 1DQ0A 3C7EA 3H1MA 2JDMA 2W1SA 3VHRA 2X05A 4D69A 2FDFA 2HEVF 2HWB3 2RMU1 1NLSA 4Y1ZA 1QQP2 2VCMA 2WC2A 1MEC2 2SBAA 2VUDA 1PIV3 2EVXA 5BY5A 4FFFA 3N35A 4XZPA 2QVSB 1W03A 2A6WA 3KWVA 2H0BA 1RGSA 2J1TA 3GZAA 4RQPA 1AF9A 1DLCA 1H8TA 5F5IA 4CSWA 2CHHA 4EN6B 2DUPA 4XUQA 3I2OA 2Y64A 2VZRA 2PAMA 3IDEA 2B4KA 3NWKA 1GU3A 2VQUA 4LR4A 1SBDA 4P9WA 1C1FA 2WO1A 1W6PA 4KQ7A 3KV6A 4AQ2A 5EV7A 2XWBB 3D82A 1XNAA 1SDWA 2DFBA 2DTWA 1HN1A 2ZGTA 5DQ0A 4BQWA 3L2YA 4GB32 5F3EA 4AFBA 3OPTA 4BU2A 1YUDA 2PHDA 3J7HA 4Q2FA 2PN5A 3ES4A 1NCRB 3H50A 1CIYA 4GKXA 2BRTA 3HN3A 3ZKUA 3WDVA 1TE1B 3V0AB 3OUHA 4XF3A 2RS53 1FMD2 4DXSA 4C0BA 3IAPA 5FPZA 4CCLA 1UAIA 1AR61 1X9PA 1V6NA 4XCBA 2VXJA 4L2NA 4PI2A 1DLLA 1WW6A 3J7NA 4J6GA 4G3YC 3OEAA 1HXS2 2TBVA 4AHWA 1UL9A 1VAVA 2QCSB 1MEC1 4TSVA 2GMPA 4KWKA 5ERLA 4A3ZA 5FP8A 4WM7A 4EJRA 1ASJ1 2RDRA 3ZDVA 1OQ1A 2VECA 3M3IA 2E7QA 1DF0A 4MSVA 1US2A 1X50A 4FPJA 4WV8A 4Y4YA 4AVVA 3PUIA 4BHPA 4QM8A 4WZFA 4QKNA 1BZWA 4RS5C 5EPAA 1VB4A 4YSFA 2JB4A 2B9VA 2VTXJ 3OGGA 1RUI3 3QOPA 4EV0A 2R072 4Q1PA 2ARCA 1MVEA 4BMEA 4CDXA 3ZXKA 5ACA3 2YYOA 2NMOA 3LQCA 3A23A 3VHOA 4QPGA 4FFHA 4XF1A 5IK8A 1I5PA 4FPEA 5EWSA 1SMVA 4IQPA 1H1AA 3NJYA 4XDOA 4ZONA 3S5AA 1LRHA 4AQTA 1VBA1 2JXAA 4XXAA 3LEMA 1N47A 2Y8KA 5DG1A 4AFCA 3LCPA 1S0DA 4BXSV 5DUUA 4M01A 3VKLA 4K8RB 3HT2A 4ZU5A 3V64A 4MO3M 5A7QA 1KDKA 2AYHA 1JTZX 2J1EA 1A78A 4LO7A 3TEXA 1FMD3 1H8TC 1V6LA 3U75A 4AAXA 2VMHA 5EIYB 1TME3 1POV1 1W9WA 1A8MA 2CGOA 4Q4V3 4FOQA 4RGGA 1DZQA 4Y33A 4PDWA 4LBJA 5H9RA 2YDEA 2A3YA 4OHZA 3ZXDA 5F6LB 2XB6C 3QH7A 4KU8A 3VBOA 5LCWL 1GOGA 5CVRA 4YFWA 2ERFA 2W1QA 3ZXJA 3SMHA 3LZZA 4CU6A 3N9PA 1SPPA 3CQOA 5K9YA 1SZBA 4MGQA 4E4SA 1G8WA 2WS91 1QHDA 4BIOA 2BGCA 2BOIA 4CU7A 2HWE2 4D7YA 5FPXA 5IFPA 4J1XA 3GGLA 3VBSB 5I8SA 3JBG3 2DV9A 3G6JB 2BNMA 4CUBA 1QJZA 1F8VA 1RUH3 4N7IA 4JGZC 4AVTA 2A3XA 2WZR3 2OUJA 3ES1A 3OBZA 1WMXA 3WT3A 3BALA 5A7PA 2VZSA 3OSDA 2E33A 1W6QB 2TEPA 4INDA 5EP9A 2BPA2 2GP5A 5BNQA 2B46X 1UQXA 1YHFA 2A6XA 5A70A 4YW2A 2Y6HA 1UU5A 1ZA4A 1JHJA 1WZXA 3ZIXA 3WDYA 1WWYA 2WT0A 4LBLA 2MPFA 2WYFA 3I4IA 1UOJA 1VMHA 4XEZA 4QQ2A 4QWNA 1IOAA 4L8QA 4FP3A 3CJIB 4HN1A 5FXXA 2OKXA 2AGSA 4IE5A 1U5XA 1IGOA 3WW3A 4AVBA 1CAXA 2JD9A 1ND3B 2DDUA 3LDBA 4IV3A 5JXJA 2FDGA 1W6PB 3KMHA 3HQXA 3WW4A 2CAVA 2CGNA 4HL0A 4P14A 3J26N 1N3QA 1S0GA 1BHGA 2ZX2A 5E1RA 3GBWA 5A7WB 1NA1B 4PDWC 3VZNA 5A6YA 3WNLA 3OBAA 5ANNA 2ZCWA 1FV3A 1RUG3 5GZCA 2PAEA 1OMIA 1XJAA 1W3XA 5C3OA 1H9WA 2XXZA 1WGPA 4K6BA 3MFAA 3E5UA 3WF3A 4QPIB 1GP4A 3D3AA 3NAPC 1R082 5CISA 1VALA 5FOBB 2OQ7A 3FLRA 1YEWA 1FMD1 2IFWA 2UYBA 3WUDA 4Y5Z0 3S6PA 2XQXA 4BCUA 1XSQA 3JB8A 4N9HA 4D7SA 1OKQA 2LROA 2WQZC 3F95A 4Z2AA 4YVSC 5AFEA 1RJ7A 5LEJA 4J1WA 3IAQA 3RWKX 3KCCA 1JMUB 4Z07A 5BNNA 5A32A 4AHXA 4N9IA 1ODNA 4NAOA 4CP9B 1E5RA 2WAOA 3ENRA 3JD72 1O8PA 1IKPA 2RE9A 4YARA 1JYIA 2IVIB 1OPMA 1C5IA 5K4LA 3W59A 3O1TA 1FI2A 3I54A 2P3IA 4UFKA 4YGCA 1J3RA 4P5YA 2HYXA 2PXJA 1EYBA 4E4DX 3UJOA 4OULA 4XF4A 1UCXA 4CCMA 2I07B 3U37A 4CDWB 5FY8A 2D6NA 4HT1T 3ZKYA 1K3IA 5HPOA 1O3RA 3SITA 4K1YA 3VKOA 5HXVA 4M4RA 3KVAA 3O0WA 3AZZA 1PMIA 5A7OA 1OVPA 2WQ8A 4XF0A 1UO9A 1YQ2A 4Q1RA 2VAUA 3HT1A 2FMYA 4Q27A 4RD7A 1REFA 4COYA 1ULEA 2J22A 5M0TA 4PIXA 2R7EB 1JOJA 1GSLA 5DZEA 5FZ7A 1UZWA 2LM3A 2VULA 1JH5A 3LA3A 1LHNA 1F5JA 4UF0B 2GN3A 4AGVA 5FUIA 4LKDA 5IVYA 2QDRA 4I0AA 3EQEA 4LKFA 2BOJA 4ASLA 1SPPB 1TQ5A 5IVVA 1GLHA 5ISLA 3MUZ1 3BCWA 3LEKA 1PMHX 5L7OB 1ST8A 1O4ZA 2G9ZA 5DUXA 1GQHA 1TNFA 4LXLA 1NZCA 3UK9A 4GKYA 3THCA 2LRPA 4MADA 1VBA3 3P6BA 2JE7A 2ZHKA 1VBE3 3Q8AA 4YM1A 4XJ9A 3HNMA 5C8CA 2XJRA 3HWJA 4QB1A 4Q4Y1 1AR92 2A73B 3HR9A 3MYXA 4NN0A 2RS11 3MLJA 4A3XA 2Q8DA 1PVC3 1W8WA 3BOPA 2VZ1A 4M3CB 5IVCA 1PVXA 3HQRA 5LA9A 5IAVA 3U11A 4X6RB 3BYWA 1R1A3 4K9SA 3LA7A 1CGPA 2FZ1A 1ZBA1 3MIFA 1H0BA 1IG3A 3UKTA 2B42B 3AP7A 4HVOA 2XDVA 4KI5M 4WM7B 5IK7A 4QX1A 3S0MA 1IPSA 3JD71 3IDCB 5F9TA 1IPKA 3K2OA 4I3GA 2V72A 5FAXA 4IEUA 1UX6A 4B3NA 2QZ2A 3C7HA 4GAZA 1MS3A 4R9AA 3TWIA 2RS51 4L99A 4YVSB 3JB4C 5F37A 4GULA 5C8CB 1S0JA 5D21A 2BEOA 3WNOA 3V56A 2G1MA 4FBFA 2H6BA 4PBPA 1HJGA 5T5JA 3NAPB 1ZZ8A 5G05L 4PLMA 4KH9A 5CG8A 4JDNA 1OQDA 1I1EA 1W6NA 1AL22 3POFA 1HV1A 2P37A 1APNA 4UBGA 2IZWA 5C33A 1RUE3 2ZA9A 4AWDA 1HB1A 1PGW2 2BGOA 4L0PA 5DAVA 3VBHA 1MZEA 4LLOA 4NUBA 1CPMA 4DUXA 1L7RA 5D8AC 3PJYA 4LJHA 3RDIA 2RDQA 5B4NA 4JGZB 3ALQA 1H4GA 3LAGA 4QX2A 4RQPB 1RUJ3 2FCVA 4CCKA 3P5BA 4MGTA 2XL7A 4QHZA 3AYEA 2VO5A 2ZGSA 4WZCA 3ZXLA 4SBVA 4V1PA 5I8TA 1LHWA 1OOPA 3DN7A 3TEYA 2GNMA 2Y6GA 1O4TA 4HSJA 4Q4Y2 2JKBA 3ZLIA 4ES9A 1DHKB 5CKQA 1BEV2 2I74A 4OI4A 4Y1XA 4Q0VA 1OF3A 3D0SA 1IS5A 5GLZA 3O7OA 1CAWB 2VBPA 4NE9A 1C4RA 3HEIA 1E5HA 4IE4A 2XL9A 1Q8SA 5FY0A 2EIBA 1RVF1 1NZIA 2C9KA 4YG0A 3SCGA 5C8CC 4CXXA 1ZRCA 2IXKA 4RS5A 2EF6A 1RUC3 3KT4A 4OHVA 2Q8EA 5IFTA 1LB2A 3RYRA 2XVKA 1CR7A 3ZFGB 4QAWA 1H8TB 2VUAA 3BIEA 4EN9B 1K5JA 1MR5A 4P08A 3I2DA 2VQAA 3WNPA 2WNEA 3KV4A 5H9PA 3GZUC 4BQ4A 2XVGA 3KV5A 2VMEA 3N7KA 1VRH3 5C3SA 3T2OA 4Z2WA 3NNJA 4TLGA 5D8AA 1SQ4A 5KXDA 1AYN3 2RDSA 4R52A 4COUA 4XAAA 4AQSA 1I5ZA 4URTA 2XHKA 4UFIA 4OMDA 1H1MA 4HKOA 1REDA 2XBO1 4CCEA 2BNNA 5HV0A 3ACGA 3WNMA 3FWEA 2F17A 3VBHC 1SCRA 4FOVA 5J36A 5JUVA 5FXVA 2J1SA 1W8FA 1S0IA 5FPBA 4QPWA 1UYXA 3ZFGA 3JD73 1X36A 2E63A 3S30A 1AUYA 4UYBA 5J37A 1UPIA 4FPKA 2DU1A 3CL1A 3FBYA 3ZFGC 4OMCA 4O65A 5FP3A 3WHUA 1WMFA 2Z79A 5CZKA 3HNBM 4IV1C 5FMCA 2WFPA 1O3QA 3FHIB 2WNUA 3PMEA 1ENQA 1LEDA 1O59A 3QD6A 3VBRA 1S4CA 1U5ZA 2GNBA 5J96B 4FOYA 2ZEZA 3UJQA 4FTEA 4ES8A 4K7JA 4E4ZA 3D8CA 1Y3TA 1J1TA 1X8EA 2W87A 3UNPA 1JU3A 1VIWB 5LBCA 4JTOA 4TN7A 4AAPA 5DDJ1 2G9FA 1PZ9A 4E8CA 4CCDA 1FPN3 4BLIA 4UW3A 3O1MA 3IB3A 4XJ8A 3U4SA 4JKMA 4ASKA 4DPNA 4L97A 5JXGA 2JIJA 3AXDA 1H4HA 4YGBA 2DCJA 3JUUA 2E26A 1HXS1 2W91A 3NV4A 1AVBA 2JE9A 2QQMA 2YC0A 3BPZA 4TLFA 3I3MA 4HXCA 3T2QA 4BK5A 4B4PA 4QQPA 1AR72 1ZBE1 2HBTA 5E8AA 5FY9A 3ZYFA 2WL1A 2OVUA 4JGYA 4D6QA 4QX0A 5JMCA 3ZXFA 1UOFA 1NAEA 2P17A 2R1BA 4P9XA 4NHLA 5DMYA 4X8NA 1YIFA 4LBOA 3FL7A 3WV6A 4B29A 4N43C 1X9TA 4ARXA 1JS9A 5FPUA 1F15A 4QGLA 4H7LA 3RZGA 3M3EA 5DZFA 4HN0A 2QJVA 3NMBA 1S2BA 1W2AX 1XOYA 2DVFA 3MPPG 4RYDA 1MZFA 4XFCA 5EYYA 5FXWA 3KHCA 1NYWA 3RGBA 3OBRA 1GP5A 2YHJA 1Q8QA 5J09A 4LKEA 3GJBA 2ZBJA 4Q0QA 1QU0A 2WYSA 1QXPA 3GNEA 1DGWA 3MIDA 1Q43A 3HIFA 3AKRA 4QDQA 3VHNA 3G7DA 1UIJA 1QXJA 2GSYA 3OGSA 3OB8A 4QX5A 4X6QB 5DPNA 4N43B 1WLTA 4PF1A 4IL7A 4XUTA 4KWJA 1PO13 2CNAA 2VM9A 5F32A 1OA2A 3AVSA 4OZXA 5CFCA 2XR4A 3WXPA 1AR91 1Y9QA 2WWJA 4NPMA 2WRAA 3VZLA 1DG6A 1RXFA 1Y7BA 2XJSA 3AP9A 4AEKA 1X8MA 2DBIA 3AP6A 4F8AA 1EV13 3ZN6B 4JCKA 2VQTA 4QKBA 4RN5A 3UT0A 4A41A 4EROA 3BKZA 3UL2A 4ARYA 2Q1ZB 4I30A 4IUGA 1YRZA 2ORXA 3WP6A 4CEYB 4Y5TA 4FAGA 1JYTA 2ZX1A 1GBGA 4LITA 4JTNA 3WW2A 1N1VA 1LODA 4CUCA 4YVWB 2X53S 3M2MA 2R49A 2XJPA 3H0OA 4GWNA 3THTA 4K20A 3OEBA 5IK4A 1ULOA 4XDPA 4XIKA 3AKTA 3RPQA 1RC6A 2ZX4A 4Z1VA 4W6YA 1BBT3 3O14A 2WFF3 1JZ6A 2X10A 3T0BA 2SLIA 4Y3OA 1V9U3 2F4PA 4N53C 5LK5A 1CAWA 2AC1A 4E2QA 1G7YA 2VZUA 5C4WB 3I7DA 1ZBA3 2VW0A 2JDAA 5EHDA 4CDWA 1A8DA 1RHI1 2WO2A 1WCKA 2ZGNA 5D1IA 3ZFFB 2D5HA 1PMJX 1VAMA 2VZTA 4C90A 2ZHLA 1JU4A 5EFUA 2Q4SA 3UKVA 2TUNA 4AFDA 3MZHA 3OTFA 4BQXA 1MVQA 3AFKA 2J1RA 2VMFA 1EAH3 2W92A 3ZFFC 1QY4A 3C7GA 3TEZA 5DAWA 1WW5A 4A42A 1RUI2 1DP0A 5FPLA 2X8KA 2Y6JA 4RFT0 3I2GA 4QXBA 4CCOA 1YLLA 2IC1A 2Y6LA 3FLPA 5K0UA 5BNNB 2P4EA 3VLBB 5BV6A 3DKQA 3VDDC 2R1DA 2XG3A 3CMGA 5FMDA 5A3WA 2WWSA 2BWAA 2ILMA 3BN6A 2RS32 1O8SA 1QJU3 3NNLA 3AP4A 1J1LA 3BIWE 3USSA 3C7FA 3RZMA 4BE3A 3LEGA 1PHMA 2VD7A 4UFMA 1V6MA 1GV9A 4QPIA 3HD8B 4YVWC 2PHXA 1ENSA 4IEQA 1YJKA 1N1TA 2JEMA 1RTVA 3SLIA 4OQ8A 1EAH1 5FZOA 3VN4A 1OLME 2C0ZA 1VBD3 5FZKA 1XNBA 2VPVA 4XOGA 1V6OA 5CG9A 1OLQA 1XRUA 5FZMA 1ZZCA 4AI8A 3MO4A 4NR1A 3OYWB 3B00A 3ECQA 3KLSA 3ZYJB 2JDZA 1JYVA 1FX5A 3VGIA 3HPNA 4BYYA 1LOGA 5I8YA 2P6HA 3FE5A 1FNYA 1SFNA 3OGJA 2R062 5JMOA 3NRUA 2ZHMA 2UYAA 3MLKA 1CJPA 2N7GA 3J8F2 4OYUA 1W6MA 2VH9A 2Q1FA 4BQ5A 3BTXA 2YGLA 2R061 3KCXA 2ADDA 2D7FA 1KS5A 1YI9A 4DINB 4LO6B 5E89A 4C91A 4Q26A 3LSDA 4QM9A 3U07A 1XC6A 3DL3A 5FLIA 3W5NA 4IGQA 2R071 2V5YA 2V09A 5C9AA 3IIAA 3SNMA 4AG4A 2KR2A 3LF7A 1SLTA 2VG9A 3HBZA 3IWZA 4EWDA 5IJRA 1X82A 3GYDA 4JKLA 2ZAAA 3AK0A 2R30A 2XBO2 1QJY1 2BZDA 3DECA 3K4AA 1UYZA 3A7QA 4DB5A 3ACIA 3HVDA 2X5IC 4EWAA 1OKOA 1ZVFA 2MEV1 1O6UA 3O0XA 2FDKA 1V00A 1Z7S3 2FDJA 2PMWB 2XKOA 3PVOA 3IM0A 3MDPA 2CDOA 4JV4A 1W6NB 1VE0A 2Q5TA 3THPA 3VBSC 4G4FA 1W6MB 5A6XA 3I2FA 1LOFC 2DTYA 5FY7A 2CV6A 1WD4A 2QZ3A 3M3OA 1VBB1 4J25A 4WM7C 1R093 1EUUA 1GWLA 2Z42A 1N3OA 1PM7A 3WG4A 3F2ZA 4BMBA 1DYPA 3O0VA 4YW6A 1OOPC 3LOIA 5GLUA 1SACA 3TN92 1CAUA 4C8DA 2YFUA 1FPN1 2JJ6A 1FT9A 1W9FA 4LBQB 4YGDA 3ZN4A 4YZ5A 5KBFA 2X5IB 5LATA 4M4PA 4Y20A 1PO22 2NM1A 3NW4A 3OJBA 1N1SA 3MIBA 1SG3A 3PVEA 1VAKA 2ZGMA 4OFGA 3RJRA 5IK5A 1UIKA 2OYZA 3HOBA 2GH8A 4OUMA 1W39A 3VZJA 1OLMA 2VTFA 3MI8A 1GANA 1O91A 4YM0A 1J59A 2I45A 1ZBE3 2F4LA 4BWOA 2KD7A 5JPNB 4CZSA 4CTEA 2H6CA 5A3PA 2XJTA 2XONA 4Q5OA 2OT7A 4EN8B 5FZFA 5HXMA 1ULDA 2AR6A 1CIWA 1NT0A 1CJDA 4UW5A 3NVCA 3GCWA 2KA3A 3H8UA 4HETA 3T4VA 1HQLA 3AYDA 5FP4A 3WP4A 3MF6A 3IIIA 4NRPA 2LALA 2AACA 1CAXB 5LBBA 1POQA 4B7EA 4OLLA 1HRI2 2G9GA 1J83A 2X29A 3ABZA 1F9KA 3WQ7A 4NRMA 1TZOA 3K46A 3N9QA 3U1XA 2BERA 2CWSA 2FQPA 2JIGA 4GALA 1WUVA 2W46A 3ME2A 4AR2A 4EZHA 4AI3A 1TMF2 5DAPA 4LBQD 3LPFA 2RM21 3LE0A 1HRI3 4DMIA 3I2IA 4WVMB 4K3UA 1ZREA 5FUPA 3DYPA 1LESA 1PNGA 3VBRB 3KS7A 2P3JA 3PUSA 3WF0A 4MLOA 1XE7A 2A6ZA 3JXSA 4LHNA 4I01A 4AQ6A 1NQJA 5A1FA 1QXRA 2A3WA 4M3CE 5GM0A 1EAH2 3W9AA 2Q1MA 4EN7B 5JCTA 5BXXA 2RMU3 5C5TA 1JXNA 1A3KA 3PVNA 5ACA1 3FUQA 4LLFA 5L73A 5HBAA 5LASA 1REEA 5DAQA 4E2SA 4WVMA 4ATFA 5KHKA 1OHFA 2VCAA 3BGAA 1SFYA 4WM8A 5GZEA 2VZPA 1YQ8A 4F83A 1FV2A 1CX4A 3Q9OA 3FN9A 3LA2A 2OIIA 4XVHA 1X33A 1M4WA 2QQJA 4CU9A 4BQ1A 4Z92B 3D0JA 2ZKNA 2Z5WA 1UYPA 2VOXA 5FZOB 3ZYHA 4FOWA 2Y38A 4ZY9A 1RUD3 2RR11 3ROUA 3KHBA 2WWUA 1H9PA 4XFBA 5EXOA 4H7MA 4QHOA 1LJ7A 3T0DA 3ATGA 1OT5A 2E51A 1T2XA 3N3HA 5LB6A 5BNPB 5D8AB 1OI6A 2QQNA 3VBFC 4ONUA 4XQDA 1ZRIA 4Z8BA 3TNPB 2V4AA 3H1WA 3VV1A 1ULCA 5DDJ3 1LOEA 1LU2A 4ET7A 5GLWA 3USUB 1IQAA 1EV12 1AR63 3CBNA 4CEWC 4GJZA 1YQ6A 1H2LA 4NJ4A 3B9IA 5DG2A 3WF1A 1GR3A 1GQPA 4CDXB 2O14A 4ATEA 1PX3A 1F2NA 1IKQA 4HPKA 5KC5A 5LRSA 2ZMLA 3WR0A 1ZZ6A 3O5SA 5FZCA 2IWGB 1OSGA 4IEZA 4GH4A 4V2VA 5EZWA 3T1MA 3T3YA 2YU2A 3P3NA 3WQBA 4AF9A 2RVAA 1STMA 3S57A 3OGVA 2EXJA 3NJXA 5JSPA 3GHMA 1ND3C 3H42B 3M8LA 2QQIA 5AVPA 4DUVA 3O1RA 2C4XA 2X5IA 2YBSA 3V0BA 1XBFA 2AUYA 3UGHA 5K7PA 2AZ5A 3NNMA 4P00B 3POEA 3H3LA 2BBAA 4DIQA 3VBUA 1C3HA 1BKZA 1D4M2 2HEWF 3UESA 1RVF2 4QXHA 2HLEA 1OD3A 5J3UA 3JU9A 4YG3A 4QQLA 4XHBA 3E6DA 4ZXKA 4I3PA 2BDRA 4Q0UA 3ORJA 3PUHA 2TNFA 1H2MA 3IN9A 3MBWA 2IXCA 3X29B 4Q0PA 1MS8A 2C24A 4XPVA 1OH3A 1WCDJ 4BZ4A 2DYCA 2YXSA 1MQTC 1NG0A 2HBUA 3BU0A 3OOXA 3O1SA 2D3SA 4KBZA 4D7TA 1O7FA 3O1VA 2B39A 1DBNA 4GXLA 2EICA 4LBMA 1EY2A 1RUF3 4W4ZA 4HOOA 4N43A 4DXRA 4ZKTB 3HNYM 2OXBA 1RMU2 4I2OA 4A6SA 1I9RA 1ZM1A 4LO4B 5F2SA 3USUA 3OUIA 3V0BB 1ENRA 2JDNA 1VLNA 2RMU2 4OHYA 3K48A 1QOOA 1C1LA 3CO2A 2VNVA 4FO9A 3L9JT 4MXWB 4UOJA 2WNVC 4JZRA 5FJHA 5FZIA 2UWAA 4DXZA 3W20A 2ZEXA 4LBKA 2JE8A 5DUWA 1L7LA 2NPIA 5BYNA 2QUOA 4RHV1 1U12A 2ARBA 3B01A 1UD1A 4RHV3 4FVVA 2WLPA 4FAHA 3ZXAC 4LBQA 5L7OC 2K46A 3FZ3A 3DF0A 2ET7A 2XUEA 3VZKA 3GCXA 5FYZA 1W04A 2VE1A 1BBT1 1H1IA 1ND2A 2UU8A 3DYMA 3NQHA 4QDRA 5L9BA 4CDUB 3C2UA 2EIGA 2WO3A 5FQ0B 5JVVA 3TAYA 4NHKA 2C9AA 1QJX3 2Z4FA 5E88A 2BJSA 3J7LA 3NV1A 1AYN1 3D5OA 2WBKA 3AP5A 3POGA 2WNVA 1YYNA 3CEWA 4FCAA 1B35A 1BBT2 2R042 1HB3A 3N7JA 3ZPYA 2E31A 2RG4A 2V73A 3FMGA 4K40A 4DNYA 1AR81 4L92A 5F5AA 1S55A 2WNUC 5LK7B 3I3EA 3DCQA 4CA9A 4NROA 1EPZA 5FKBA 4CPBA 5JOXA 2BU9A 3LDRA 2JG8A 2Y60A 3CDZB 4WBBA 3PJQA 1T6BX 3FX3A 4CYDA 5A6QA 1AYN2 2ZGRA 4B8EA 5F5QA 1WD3A 3GALA 4HONA 4MUVA 1VBB3 1FYUA 1ZZ9A 1WA4A 5FZ4A 3U78A 1YFYA 3R0RA 4P9YA 2WQ4A 1YC61 2HWC1 4FFIA 4C1XA 1QWRA 4S2HA 4B1LA 1RINA 5CFDC 4IERA 3VDBA 2XHNA 3V0AA 3UGGA 4EQVA 4I0BA 2YUEA 4XFAA 1WCQA 1P8JA 1UNBA 4NPLA 3WF2A 4CDQB 2PLV3 1FOD2 3K51A 3CNAA 5F6KA 1JBCA 5LRRA 1AXYA 2JDPA 4QDSA 2PHRA 5AFBA 2RR13 2ZX0A 4UW6A 4HFSA 4AYUA 3CKHA 5JZGB 3AZWA 1IPJA 3I3DA 3QACA 2UWCA 3ZX7A 4U2AA 1GOHA 1Y9GA 1QKQA 3IMMA 4YFZA 4Y1YA 4Q8KA 3I2KA 1US3A 5FZ9A 1B35C 1W8HA 4NHYA 3O1OA 3K3OA 3VBUB 2XKPA 5A7SA 1RUE1 2E32A 4CDXC 3AVRA 1PIV1 4S2DA 4NIHA 2QQPA 4PCRA 1LAJA 2H0VA 4HK9A 4UXAA 1QJEA 4LHKA 2A6VA 1VBB2 2GH2A 3H7JA 3LFIA 2FMDA 1K45A 2FCTA 1UWWA 2WZR2 2VVDA 3WG3A 1JZ8A 5FP9A 3EJKA 4JRLA 2ZZJA 5FO9B 4FP2A 4QU2A 4E4HA 1CZSA 1RUE2 1K12A 2VBDA 4I0WB 3H8XA 2EA7A 4MH0E 4XFHA 3MLLA 2FD8A 2JDYA 2WR9A 4XIOA 5BPXA 1PO21 3D6EA 5F8PA 3ZSMA 1ULGA 3EHKA 4IEXA 5T50A 2ZEYA 4FT8A 2WUHA 2XPJA 4RSUA 1PGL1 2UWBA 2JWPA 2WN2A 1LGNA 1YFUA 3AMHA 1OXCA 4HSLA 4KGGA 4Y22B 2AREA 3BUCA 1POV3 1QNWA 1W8OA 4P9LA 3K4ZA 4Q4V1 5JI9A 5JZGC 4DRVA 5BNPC 4OHXA 4QU1A 3KQRA 2PELA 4FQZA 1FPN2 3HMYA 3KGLA 3LB9A 2P3YA 3TN91 3CZJA 4HKLA 4Q29A 4XJUA 1Y9MA 1YWKA 4LT5A 1VMFA 3RS6A 3T2TA 3MV11 2VVEA 4QGMA 3ZXEA 2YPJA 2PYTA 3UKNA 3VBOC 3PNAA 1DQ6A 5FK8A 3M70A 1FNZA 4WVZA 4CP2A 3KVBA 2J42A 3M3QA 3RVHA 2NMNA 5FMOS 3RI8A 5B2GB 1ULPA 1RUNA 4NIGA 4LTAA 2ZHNA 3GBGA 4AEDB 1F4HA 2VU9A 2D6OX 1RUI1 4AGGA 1AR93 2YY1A 2W1UA 1TG7A 2WNUB 4MHRA 5LWBA 2YGMA 2G19A 4DRRA 1OF4A 1QJU2 3QLQA 5FOJB 1GQGA 1QIQA 2OZ6A 3NAPA 2C1FA 4GH4B 2XJUA 2O8QA 4Y1VA 2BBVA 2HWD3 3MHZA 2QQOA 3P1IA 3SH4A 4FPOB 4YPJA 4R4XA 2QDNA 5AC93 4FXKB 1LENA 1QF3A 2HWD1 3VKNA 5AC92 3AMPA 3B02A 3A21A 2XH6A 1XYPA 1UMHA 1HQNA 4FXGB 1TVGA 4CE8A 5A3NA 5LBEA 5LBFA 2CDPA 4HKWA 2YB7A 1BK0A 5FYYA 3UYJA 2ZMNA 1ND2C 2P5BA 3ETPA 5DXDA 4JHTA 4BQYA 4B1MA 5CFCC 5KHGA 1CZVA 1C57A 3GXUA 1XNKA 1BLZA 2OA2A 5FYMA 3KF3A 3WEZA 5HV4A 2WNVB 1J58A 1C8M2 2VMDA 3AYAA 4AGRA 2NZ9A 2IXLA 2WSUA 2BVVA 2VQ0A 3JBG1 1AYM1 3I2HA 1COV1 1RYYA 2HWE1 3HBKA 4LUMA 2XGXA 4HZFA 4YWAA 4DS0A 3DPRB 2R0FA 4NO4A 4XACA 1AYM3 5ABJC 1NLQA 1Y43B 4JGZA 4B4QA 1QGLA 1JYNA 2V4VA 1VRBA 1W8UA 1LGCA 4M3CF 5JSOA 2ID4A 2A70A 1PK6B 5ABJA 4MG2A 5KHJA 1F5FA 4GMP1 1UN1A 1NKGA 3SCFA 4JVAA 2ENRA 3VUOA 3BTZA 3B3QE 4AI2A 2ZEWA 4F3JA 1UMZA 3OBTA 5EYXA 4AXOA 5KWRA 1W8TA 1X7NA 3WD5A 4BOWA 1HB4A 4LQRA 2PHWA 2W39A 5T5OA 5T5LA 4FI9A 4AFAA 2W08A 5A3MA 3LOBA 3EMRA 1DQ4A 1W6QA 1W0PA 2YC4A 3N9LA 1JZ4A 1RUD2 1UZ0A 2QTWB 5FKCA 2AH2A 5LW9A 3CHXA 4PBOA 4ISRA 4N7UA 3AFGA 4Q4X1 5FPVA 4BQ2A 1W8NA 1KQRA 2JG8B 2KXLA 3ZVXA 4R9BA 2RJKA 2XLAA 4YM2A 1UW8A 3Q8FA 3RZHA 1D0HA 5DAXA 1YQCA 4COWA 1GZ9A 2VCBA 4UI9L 5C9AC 1G9FA 4XFGA 5FYTA 4GD4A 1AX0A 1ULFA 3MF9A 5FZHA 3SKJE 1RUD1 3WP3A 5IVBA 2BV4A 2ZGQA 3HAGA 5HCAA 1OUSA 5FO7B 3B93A 4D6SA 1QJY3 3URFA 3VDAA 1W28A 5I93A 2ZGPA 1PZ8A 4PT6A 1QQP1 2ZKLA 3UGFA 3W58A 3EBRA 1V70A 5HCBA 1CN1A 4EE2A 1FXZA 5IAXA 2HYKA 3C8XA 4ZS3A 5FV3A 3KV9A 4UFLA 3SISA 2HWF1 4FPHA 5C70A 2PHLA 4HK8A 3VBFB 4IV3C 3RSJA 2RR12 3PMSA 4CUAA 4P9JA 5C7GA 1PVC2 2GNDA 1NLRA 2B45X 2ZPXA 1L7QA 1UZVA 1D2QA 1GZCA 1COV2 2VNRA 3JBG2 4TYSA 4BB3A 1FOD1 4FPGA 2WS93 5FFOC 1VBE2 2A75A 3E97A 3M3CA 5JR7B 3VD5A 5F5CA 4NIDA 1L3JA 1ZRRA 3IKWA 5C71A 2ADEA 3M1HA 4BXFA 2R043 4AHYA 3RYPA 2ZS6B 2MNGA 4I02A 1D0GA 2CYFA 2P2KA 4FPLA 4LO8A 1ENXA 4PI0A 1QJX2 3UV9A 4ZU7A 3BTYA 2WABA 4LBNA 2E7TA 4AOCA 5KXBA 2D5FA 2D98A 1HW5A 1XE8A 4HVRA 1HQWA 3ITQA 1SBEA 3PIGA 1AXZA 2QBXA 1S2EA 5F3CA 1D7PM 4MYEA 3T09A 1Q8VA 2WNOA 1W9YA 3I8TA 5C4WC 4PJYA 4NWVA 1W3VA 5FYSA 3T30A 4TWTA 2DCKA 2B7YA 2WZR1 2B5HA 4BDVB 2W52A 5FY5A 3KB5A 1V6KA 5FXZA 4AW7A 3I3QA 5A1AA 1KEXA 4IGPA 3ZYPA 2HJIA 1PGW1 1W6OA 4IW3A 5FIXA 3H8OA 1SLIA 3SCHA 1XXNA 5LY2A 1WBLA 3FFZA 1LKNA 1JN2P 2PHUA 5FYUA 2WIIB 5C8WA 1ZRFA 5FWEA 1JZ5A 2RV9A 1ODMA 3FHQA 2VZOA 3KT7A 3E1F1 2YZ4A 2ZACA 4N53A 1YIPA 5FY4A 5D2AA 3KZ4C 1LNSA 2UY8A 5FZEA 3ZPOA 3RZKA 5KHIA 1Z0HA 4CDQA 2R6QA 2ZABA 3AZXA 2Q8CA 4JQTA 5FZ6A 1PO23 4JDOA 1DFQA 2RM23 1KDMA 2VZ3A 2D6PA 1C28A 1IQDC 4GB31 3JQWA 4IE0A 4RQPC 5IWFA 5E16A 2PA7A 1I6XA 1G9CA 4AE2A 2Z69A 1VRH1 3SKVA 2J1AA 3BU7A 4WVWA 1Q56A 3RFRA 1SLBA 1CONA 3K4DA 5GLTA 4LKSA 4XMAA 2QE3A 4W8JA 1JOPA 1VRH2 5FYVA 3VKFC 2GC0A 4CEYC 1SLCA 4LPLA 5IATA 2JG8C 1LHUA 1A6CA 1FATA 3OD4A 5DZGA 4YZ3A 4LMFA 3OPWA 5FZ0A 2VY0A 4O9GA 1QH6A 4DQAA 1BYHA 1B35B 2MEV3 2VUJA 4Y22A 5CFDA 4DZGA 5KXCA 2Q8OA 3O1PA 3TRSB 1RUC2 3I2JA 3VD7A 1WKYA 1RUJ2 5CKMA 4BM8A 1NCRC 3S5QA 3ACFA 1Y4WA 2GZWA 4XJZA 1LCLA 3HN1A 1VBC2 5IT6A 1NQDA 1BJQA 3WQ0A 5CEHA 2WA3A 4CDUA 5FBZA 2R063 4CDQC 4IEPA 1ASJ2 1UZZA 2Z2SB 1BEV3 4I09A 1R1ZA 1YI7A 1ZNPA 2DCYA 3N9OA 5DUVA 5T55A 5TSWA 3WOGA 4B7KA 1HLCA 4BLJA 5IVFA 1CAVA 3AC0A 4IE6A 2VMCA 1V9U1 1G6NA 2C5DA 2IUWA 4QB2A 3PU8A 5CYYA 1V6JA 1D4VB 3OD0A 3WCRA 3ZIWA 5CA6A 2BFUS 3R05A 1AR62 1OURA 1HIXA 2BP6A 1BXHA 2EXKA 1PIV2 2DVGA 3A4UA 2DVAA 2Y0OA 5DDJ2 2R16A 3N4MA 2YC2A 2P6CA 2WAAA 3IPVB 3WNXA 3KF5A 3RWNA 2NN8A 3U4XA 2RS13 3W5MA 4QB6A 5FPAA 1VJ2A 2CY6A 1AXKA 3ILRA 5KXEA 2LTNA 3ACHA 4Q4V2 1JZ7A 1TEIA 4BIFA 4CP1A 5B4XA 4L11A 1VMJA 4S2FA 4RR3A 5FZBA 1OLRA 2A6YA 1GNZA 4FSJA 1AL23 1DGRN 3A0NA 1G86A 4P9GA 3WLUA 4D8MA 5BNOC 2VXRA 1Q8PA 5JI7A 1CX1A 1POV0 3K77A 4KL1A 4WM8C 3SH5A 1UY4A 1W2NA 2EALA 2XJQA 5FYCA 5FYHA 2XMLA 3WNKA 3ZYRA 4NMIA 1NUKA 5FK7A 2WA4A 4DY5A 1VB2A 2PFWA 3PTRB 1UPSA 2GU9A 5A1LA 3WNNA 4QMAA 1OA3A 2W47A 1E5SA 2HWC2 2VGDA 3B69A 4CDUC 5CB7A 1XSRA 1QDOA 3MV01 2J1VA 5EQUA 2DVBA 1U5YA 1JYXA 1O5UA 2A71A 4RL7A 5GKAC 1RL3A 1W0NA 3S7IA 2FZ2A 1W6OB 2I2SA 2RHPA 4HANA 4Q0SA 5FLHA 1F35A 2ZZQA 5E6HA 5GALA 1ND2B 2W68A 2YBKA 1O4YA 2HKXA 3AL6A 1OFNA 3IZOA 3J7MA 3N36A 5IYYA 4XTMA 3EYPA 4OI0A 1BK1A 1MQTA 1YO8A 2E7AA 3CIHA 2E6VA 3OG2A 4FPYA 4JC1A 2WZPP 3IDAA 4D94A 1F31A 2O1QA 2QNKA 4AVCA 1AJOA 4IV1B 3ZFEA 4ZZ8A 4CUGA 3KGZA 4N8MA 1PNFA 3I3BA 3LPGA 3NO8A 3VD4A 3SEEA 5LZ6A 1DGWX 1WLCA 1ZYBA 3ELNA 4ZU4A 1V9U2 1VBA2 1YFXA 1SLAA 2VZVA 4XC9A 4ZHNA 5JXHA 3TYJA 4K21A 4YW1A 3ZR6A 4DY3A 2QQLA 3VKMA 4Y5SA 1DYKA 2OPWA 2DU0A 3POYA 2OZJA 5A3TA 3RQ0A 3KCYA 1GWMA 4CEWA 2D3RA 5K0UC 3WDUA 4LUKA 4DOUA 2ATFA 2RS12 4GQ7A 2NP0A 1Z7S1 5KR7A 1LULA 1RB8G 3GBFA 5JSRA 4GB33 1PGL2 4LOSA 3POWA 2D44A 3H9AA 2AEYA 1RVF3 4H55A 1H6YA 1ZBE2 2D40A 4YGEA 4GMP3 5A3UA 4XDQA 4FTSA 4TZDA 3GHNA 3NNFA 4BH9A 3MEPA 4JQRA 2VNOA 4N53B 4AL9A 1XB9A 3TB0A 1NY71 1S2KA 4NVPA 2XLGA 4Y24A 1QMJA 5J1XA 5H9SA 4E27A 2VOTA 5FR3A 4B4RA 2NQYA 3PUQA 4JDMA 3NKGA 5I0UA 1QQP3 1OQEA 2JECA 1RUOA 5A33A 2AEZA 4HVQA 3L2HA 3WDXA 4E9KA 2LUWA 3E5XA 1UX7A 5C9AB 1VPHA 1S0EA 5JXIA 1NY72 3B9CA 3VB9A 4AEMA 4E2GA 2P3KA 4UBHA 2MEV2 4XABA 3ST7A 4A44A 4MVTA 2JG9B 5FCCA 4MXVA 2ZJCA 1AZDA 5GZDA 3DYOA 5C3QA 2VOKA 2DUOA 3WQ1A 2Y6KA 3JCIA 3H7YA 3LDKA 4NHMA 5JLVA 4OQ9A 3APBA 1G9DA 1QEXA 1V6IA 4R9CA 3ZFEC 4CCCA 4K8FA 2X09A 1DIWA 1W9TA 4HPKB 4GJYA 4AEJA 1RUH1 1R091 5CKNA 1YJLA 1BMV1 3AM2A 4QX3A 1QOTA 5FTTC 4XTPA 1XU1A 3INAA 4UAPA 5CAZA 1OD5A 1R092 3N9NA 2RM22 2ZAHA 3K75B 2VVFA 5AVAA 4NIIA 4KNCA 4CEYA 1TMF1 2Y0IA 4KWLA 1PK6A 1UY3A 5ABJB 3A22A 4MGSA 1BMV2 5I91A 5DABA 4C1WA 3LWCA 2F6BA 3LFMA 1CAVB 3WCSA 3BPSA 4IETA 5C3PA 1Z7S2 1K5MC 3THDA 2WFF1 3DPRA 3WX5A 1LHOA 2R041 2ETEA 2EXHA 3B94A 1W9SA 1VP6A 2O8OA 3GZEA 4JRAA 5FZLA 2D6KA 2IXHA 3PURA 4XMIA 5FZ1A 3E6BA 3S7EA 1UXXX 1RHI3 4V2WA 2GNTA 5JOYA 1R081 4YW5A 1LHVA 1UXZA 2RJ2A 3N9MA 4SLIA 5FREA 4NWWA 2IXIA 2GP3A 2OS2A 5FZGA 5KHHA 4PLNA 3SEPA 3U14A 2K2SA 3PUAA 4XF9A 2VR4A 5L7OA 4R8HA 5BNPA 2Y33A 4QXCA 1S0FA 2VCCA 3GZTB 1R1A1 2ET1A 4W6WA 1MS1A 1U0AA 3RMXA 2FCUA 3ZR5A 3RZLA 3ZYGA 4LO5B 1Z78A 3FBMA 4HLTA 1JYCA 4XURA 3I49A 1K42A 1ZRDA 3FLTA 2BGPA 2PQSA 1TME2 4WVVA 1IHMA 2ORZA 4RGKA 4XAEA 1NCQA 2RDNA 4XJWA 1S0BA 3MICA 4IXLA 3I59A 3T0AA 4XHXA 5CADA 1AR83 2XOMA 3BOWA 4MX3A 1DCSA 4ZPIA 1HRI1 2PAKA 2BW8A 1HV0A 1AHSA 2QQVA 3ZFFA 1TNRA 3IBMA 4IESA 4GMP0 5FJKA 2YMZA 3DV8A 4XETA 1B09A 1EUTA 3KM5A 4AI9A 4CDWC 4QD2A 3IDBB 3PL0A 4IEYA 2WO7A 1GZWB 2YU1A 4LORA 2HWF3 3I59B 3VBOB 1ZBA2 2RS33 5SV5A 1DGLA 2G4IA 2A5ZA 4Q4X2 1SDDB 5JOWA 5LA0A 2WN3A 1JYWA 1AX2A 1JW6A 1W2UA 2ZGUA 5BNOB 1PVC1 4GA9A 2DCTA 3ZYIB 3VBHB 1YNAA 1SCSA 1XPWA 3SHRA 3IPVA 3PVBB 2JB8A 3LKJA 3VBSA 3AMMA 5I0RA 5L36A 1JZ2A 3WG1A 2WDBA 2HWC3 1OBNA 3TN93 2CWMA 1D4M1 3ZM8A 1ZX5A 4NHXA 2VL4A 2QFEA 3ETQA 1J84A 1KS4A 1NE4A 3Q8CA 4Q4Y3 5JWPA 2WJSA 2VC9A 4XFIA 4YYOA 1DYOA 2YV8A 3VZOA 3TOJA 2OW4A 1W2TA 3RZZA 4YVSA 2PHTA 1JOBA 1GMMA 4M3CA 1OA4A 4AHZA 3R4DB 3RG0A 3OY8A 3AZVA 2QQKA 4LNVA 4COZA 4UFJA 1N1YA 4X8PA 3FFQA 4CCJA 2BWCA 5T54A 1SEFA 4XW3A 1ND3A 4IV3B 4XXPA 4AI0A 5HCFA 3DGTA 4L9BA 1EV11 1UOBA 4CPBD 1QJX1 1HJFA 2ES3A 1XNDA 5F1RA 4PF5A 1IG0A 3ZFEB 1D4M3 3VBFA 3CJIC 3NNGA 2WZEA 2C26A 2VMGA 3BODA 3FUOA 2WLQA 2XVLA 3H1YA 3WZ1A 4JX0A 4DEVA 1CD3G 2VW2A 2Y6FA 5I0TA 4NPRA 4CEWB 1H2NA 4UF0A 4IGOA 3M7AA 1UZYA 4M0HA 4CRQA 1H2KA 1N3PA 1UOGA 2VMIA 1NX9A 1RXGA 3AKPA 4JAAA 4NIAA 1W90A 1CZTA 3ZSJA 4JGYB 2C6SA 2GDFA 2OX0A 3ASIA 1XNTA 1VBC3 3C3VA 3KT1A 1PX4A 3DUIA 4PLOA 4R4ZA 4XFFA 3ZN5A 4A4AA 3J9SA 2QKDA 4KG0A 1UU6A 2JG9A 5K8SA 1VBC1 2W9XA 3QBQA 1CPNA 4AK3A 3CJIA 5FZ8A 3WINE 3BI3A 1AR73 1LGBA 4PQQA 2YPDA 4A7ZA 1V0AA 1HB2A 2K9ZA 2W1WA 4IDZA 4JKKA 4W50A 4YG6A 3R6SA 2YG0A 1ASJ3 4P02B 1VBD2 5FLJA 4GZ9A 4Q4W2 3CZUA 1M06G 5FYIA 4FFGA 4KG8A 4Q4W1 4MOAA 2JDUA 3GF6A 2HH9A 3AZYA 4H3WA 4RGAA 4XYXA 1RMU1 2PHFA 3R4SA 1K5MA 2GAUA 4O9EA 1DQ1A 1BCXA 5C3RA 3VBRC 4Q4X3 5BNNC 2ZMKA 4YM3A 1GFF2 2NYYA 1GOFA 1QJFA 3AMQA 4LULA 1R64A 2D3PA 4XQWA 4DXTA 4BK4A 5FZ3A 1BVP1 1WMEA 4D6RA 2OUHA 3POSA 2VBBA 3QH6A 4URAA 3T4HB 4XUPA 1MS5A 3OY8B 1GYKA 4DEQA 4YW4A 1NA1A 5K0UB 3PTYA 2FHRA 3TEWA 1UY1A 3AJZA 1RUJ1 2VZQA 3K3NA 4BPZA 1MZ5A 1CQ9A 2DCZA 4QPGC 1GZTA 4XE9A 2JDHA 3ILNA 4M00A 3OGRA 3EO6A 4RS5B 3NSTA 3O1UA 4XQ4A 1WW7A 1YQ5A 4HMZA 1D2SA 2ZGOA 3U0ZA 4IEOA 4A6OA 1O3TA 3PDQA 5CNAA 3VL8A 1IS3A 3EB7A 4KMQA 3LGRA 1W06A 3WG2A 2BNOA 1JHNA 5FO8B 4UFHA 3ZOIA 5GZGA 1OC1A 1IZ3A 4R9DA 4OZOA 2CAUA 4A7YA 2KM2A 5FRAA 3AL5A 4WM8B 3ZSEA 2WZ8A 2ARAA 2BTVC 2XLFA 3NL1A 3WSOA 5ANQA 2VJXA 5KC6A 1GZWA 1UYYA 3FHAA 1UMIA 2Q0AA 4ZS2A 2IVJA 5JZGA 3OF1A 4QPYA 1DQ2A 3ZMOA 1HX6A 4EYUA 1SFPA 4Y4RA 1K5MB 2ZGKA 4GWIA 2LS6A 3AX4A 4AEDA 3T2PA 5FBJA 1HKDA 1Q5OA 3SH3A 1LECA 1QH7A 1KGYA 2JICA 2W0XA 3ZSLA 4EN0A 5JAXA 4QQOA 1UU4A 3VD9A 4FTBA 4DFSA 2D6MA 2JKXA 1H6XA 2ZXQA 3E5QA 3A0KA 2WS92 3ZSKA 2XWJB 2J7MA 1HRV3 1WA6X 1C5HA 4A2UA 3MW3A 4P5HA 1IS4A 2ZOEB 1OFSA 4IEWA 3UETA 4CP0A 1QJY2 2PQQA 1QOSA 4QX8A 4GWJA
chains in the Genus database with same CATH topology
4LHLA 4PQ9A 1W0OA 5T5PA 5GJ6A 1RITA 1XYOA 1PK6C 3LSEA 4D3WA 5T52A 5A33B 3B7MA 5JOZA 3WDWA 2ZX3A 4A7KA 2RS31 3AJYA 1MZ6A 1NA1C 4PDWB 3B5LB 3DPRC 3OYWA 1HDKA 2WSVA 3AMNA 4C0HA 1ZZBA 2DWRA 3ILFA 5CBLA 1Q8OA 1DZRA 1CVNA 3VHPA 1RUH2 5J7MA 1FOD3 5CIRA 4AVSA 2NLRA 3U10A 4YZ1A 4FPCA 4H14A 4LE4A 5GZFA 1LU1A 4Y20B 2D43A 4XJAA 2D97A 1AX1A 2BUKA 1SLLA 2JG9C 1KD7A 4KGQA 1QDCA 2R0HA 4F7ZA 1KRIA 1IS6A 3ACLA 5BNOA 5HI0A 1SBFA 1NCQC 3PHMA 2EAKA 3N7MA 4RR3C 3RMYA 1R1A2 5CU1A 3J8F3 4EWEA 2Y26A 4FQ4A 2DVDA 1GICA 4OI2A 2FBEA 3KD4A 1NCRA 2GMEA 3VZMA 4K1ZA 4PIZA 3VDDB 1OPOA 2DUQA 1AYM2 2YROA 3N7LA 1URXA 2IFRA 3JQXA 1I3HA 1LEMA 1ONAA 5L19A 3FJSA 1XYNA 3PLQA 4RA0A 3TBDA 5H9QA 2D6LX 3ZO0B 3OPZA 5FMOL 1C8M3 3TNQA 2R073 5A32B 1HXS3 3EXUA 5I0SA 4RHV2 4LEJA 4XILA 1RUF2 1TME1 2HWD2 1YXWA 1NXMA 2E53A 1G9AA 1LR5A 4GWMA 3ZN6A 3WY6A 2MHFA 1J3QA 3RYKA 4MGKE 1UKGA 3H3ZA 3AKQA 4LA2A 4YLZA 2GMMA 3ZXGA 3AXEA 4KBBA 3CF6E 1RUF1 2JX9A 5LEKA 3BB6A 1C8M1 1QJU1 4QGNA 4Q4W3 5J98B 2WT1A 3IMNA 1WBFA 2VOVA 1AR82 4P9IA 3CU7A 5SV8A 1DZTA 1UF2C 1VR3A 2WFF2 3QCWA 4E2QA 2BVBA 2UY9A 2D93A 2WT2A 3MPBA 1G9BA 1WMDA 4BA6A 5FDBA 1YFWA 4GIQA 2PLV1 3NV2A 4XBNA 2ZTNA 3J8F1 5JIAA 1CAUB 4FPFA 2CGPA 1MS9A 2GC3A 2O0OA 1ZZ7A 1MACA 1O3SA 3R4UA 1RUG2 3WVJA 5JIUA 1RHI2 2B8MA 2HWB1 3DKWA 4HBNA 4Y1UA 1ALYA 2AENA 2P34A 1MEC3 4Q8LA 1WLWA 4AVAA 1KITA 1LOAA 4META 3ZDSA 2HWB2 5C4WA 1PO12 4MV2A 2A7AA 5T3NA 1NOVA 1RUG1 1OOPB 5AC91 3IT8A 4M0NA 4YZ4A 5IUQA 1LTEA 1S1AA 3E6CC 2PTMA 4AI1A 1AJKA 1KJRA 2EXIA 3OCPA 4LA3A 1DDLA 4QT6A 2VOWA 1LOBA 2JD4A 5EJ3A 3ZMNA 4QHBA 3WDTA 4LE3A 2GALA 2BFUL 4ITCA 5JDBA 1EPWA 5GLVA 2DURA 1DU3D 3AKSA 4W65A 5A3LA 1MS4A 4Y26A 1O5LA 1WCSA 3V65A 3RI9A 1FAYA 2VNGA 4ISQA 5JPMB 2HWE3 5CFCB 3AYCA 2GC2A 1XNCA 1NE6A 1H30A 2Q30A 1WLDA 2WINB 4ASMB 1JUIA 2E9QA 5C6CA 4QXKA 4Z82A 3NKTA 4MGYE 1TMF3 1HRV1 2VW1A 3VL9A 3NJZA 4AFMA 4MGIE 4XBLA 2PLV2 1VBE1 1HRV2 4QQHA 2WKKA 1CESA 1J3PA 1KFXL 4OI1A 2R32A 5J48A 4MXWA 2RJLA 2BQPA 3D4KA 4QPGB 2HWF2 4OUSA 4ORFA 2EAAA 3H3UA 2K0GA 1AR71 4YW3A 2GN7A 1DQ5A 1EP0A 1Q3EA 2CTVA 4W6XA 2IXJA 3WP5A 1JUHA 1BVVA 2ARXA 3WUCA 2XJVA 4OVEA 3O12A 3MIEA 4OHWA 4S2GA 1WW4A 3MW2A 4GH4C 2HEYF 4YRDA 1AL0G 3NV3A 1KFUL 3FC0A 1MQTB 2BYVE 4IEVA 3AB0A 1COV3 3T1LA 4XBQA 1KXGA 1NXD1 3JZVA 1XU2A 4N90A 1BQPA 1XQNA 1S0CA 3J4UH 4AEDC 3MIHA 4RR3B 3RNSA 5ACA2 1GNHA 4G9SB 1MS0A 3KSCA 5BUVA 4NOTA 4QPIC 4YVWA 1R083 3RJ2X 1BEV1 1U5IA 1YCIA 3WHTA 3CLPA 3MFCA 1E57A 1C8NA 4YNIA 3SXWA 1GKBA 1VBD1 1T6GC 1RJ8A 1PGSA 3MIGA 1RIRA 3VDDA 3MW4A 2ZGLA 1DGRA 1PZ7A 4YZ2A 1H8VA 2JENA 4KU7A 1LOCA 4JGYC 4MGZE 1RMU3 1NCQB 2DF7A 4UW4A 3MGUA 1UKRA 2B9UA 2UURA 2GC1A 5FQ0A 1LOFA 1KJLA 3WW1A 4PIYA 3M4FA 2XUMA 1QNYA 2XBO3 1AL21 3BTAA 3P3PA 2CL2A 3VBUC 1PO11 3CJXA 2OPKA 3RRDA 2RS52 2DFCA 4COVA 4MZUA 1RUC1 4IV1A 4U36A 1DQ0A 3H1MA 3VHRA 4D69A 2HEVF 2HWB3 2RMU1 1NLSA 4Y1ZA 1QQP2 2WC2A 1MEC2 2SBAA 1PIV3 2EVXA 5BY5A 4XZPA 3N35A 2QVSB 2A6WA 2H0BA 1RGSA 3GZAA 4RQPA 1AF9A 1H8TA 4EN6B 2DUPA 2PAMA 3IDEA 3NWKA 4LR4A 1SBDA 4P9WA 1C1FA 4AQ2A 1W6PA 4KQ7A 5EV7A 2XWBB 3D82A 1SDWA 2DFBA 2DTWA 2ZGTA 3L2YA 4GB32 4AFBA 1YUDA 2PHDA 4Q2FA 2PN5A 3ES4A 1NCRB 3H50A 4GKXA 3V0AB 3WDVA 1TE1B 4XF3A 2RS53 1FMD2 4C0BA 5FPZA 1UAIA 1AR61 1V6NA 4L2NA 1DLLA 1WW6A 4J6GA 4G3YC 1HXS2 2TBVA 4AHWA 1UL9A 1VAVA 2QCSB 1MEC1 4TSVA 2GMPA 4KWKA 4WM7A 4EJRA 1ASJ1 1OQ1A 2VECA 3M3IA 2E7QA 1DF0A 4MSVA 1X50A 4FPJA 4WV8A 4AVVA 4Y4YA 4BHPA 4QM8A 4WZFA 1BZWA 4RS5C 1VB4A 4YSFA 3OGGA 1RUI3 3QOPA 4EV0A 2R072 4Q1PA 1MVEA 4BMEA 4CDXA 3ZXKA 5ACA3 2YYOA 2NMOA 3VHOA 4QPGA 4XF1A 5IK8A 4FPEA 5EWSA 1SMVA 4IQPA 1H1AA 1LRHA 4AQTA 1VBA1 2JXAA 4XXAA 1N47A 5DG1A 4AFCA 3LCPA 1S0DA 5DUUA 4M01A 3VKLA 3HT2A 4ZU5A 3V64A 1KDKA 2AYHA 1JTZX 4LO7A 1A78A 1FMD3 1H8TC 1V6LA 2VMHA 1TME3 1POV1 2CGOA 1A8MA 4Q4V3 4RGGA 4FOQA 1DZQA 4PDWA 4LBJA 5H9RA 2YDEA 2A3YA 4OHZA 5F6LB 2XB6C 3QH7A 4KU8A 3VBOA 5CVRA 4YFWA 2ERFA 3ZXJA 3SMHA 3LZZA 5K9YA 4E4SA 1G8WA 2WS91 1QHDA 4BIOA 2BGCA 2HWE2 4D7YA 5FPXA 4J1XA 3VBSB 5I8SA 3JBG3 2DV9A 3G6JB 2BNMA 1QJZA 1F8VA 1RUH3 4N7IA 4JGZC 4AVTA 2A3XA 2WZR3 2OUJA 3ES1A 3WT3A 3BALA 2BPA2 4INDA 1W6QB 2TEPA 5BNQA 2B46X 1YHFA 2A6XA 4YW2A 1UU5A 1ZA4A 3ZIXA 3WDYA 2WT0A 4LBLA 2MPFA 3I4IA 4XEZA 4QQ2A 1IOAA 4L8QA 4FP3A 3CJIB 4HN1A 2AGSA 1U5XA 1IGOA 3WW3A 4AVBA 1CAXA 1ND3B 4IV3A 1W6PB 3KMHA 3HQXA 3WW4A 2CAVA 2CGNA 4HL0A 4P14A 3J26N 1N3QA 1S0GA 2ZX2A 5E1RA 3GBWA 1NA1B 4PDWC 3VZNA 2ZCWA 1FV3A 1RUG3 5GZCA 2PAEA 1OMIA 1H9WA 1WGPA 4K6BA 3MFAA 3E5UA 4QPIB 3NAPC 1R082 1VALA 5FOBB 3FLRA 1FMD1 2IFWA 2UYBA 3WUDA 4Y5Z0 3S6PA 4BCUA 3JB8A 4N9HA 4D7SA 1OKQA 2WQZC 4YVSC 5AFEA 1RJ7A 5LEJA 4J1WA 3KCCA 5BNNA 4Z07A 5A32A 4AHXA 4N9IA 3ENRA 3JD72 1IKPA 2RE9A 4YARA 1JYIA 1OPMA 1C5IA 3W59A 1FI2A 3I54A 2P3IA 4YGCA 1J3RA 4E4DX 1EYBA 3UJOA 4OULA 4XF4A 1UCXA 2I07B 4CDWB 2D6NA 4HT1T 1O3RA 3SITA 4K1YA 3VKOA 5HXVA 3O0WA 3AZZA 1PMIA 4XF0A 4Q1RA 3HT1A 4Q27A 2FMYA 4RD7A 1REFA 4COYA 1ULEA 4PIXA 1JOJA 1GSLA 5DZEA 2LM3A 2VULA 1JH5A 3LA3A 1LHNA 1F5JA 2GN3A 4AGVA 2QDRA 4I0AA 3EQEA 4ASLA 1TQ5A 1GLHA 3BCWA 5L7OB 1O4ZA 5DUXA 1GQHA 1TNFA 1NZCA 3UK9A 4GKYA 1VBA3 2JE7A 2ZHKA 1VBE3 4YM1A 4XJ9A 5C8CA 2XJRA 3HWJA 4Q4Y1 1AR92 2A73B 3HR9A 3MYXA 4NN0A 2RS11 3MLJA 4A3XA 1PVC3 3BOPA 4M3CB 1PVXA 3U11A 4X6RB 1R1A3 4K9SA 3LA7A 1CGPA 2FZ1A 1ZBA1 3MIFA 1H0BA 3UKTA 2B42B 3AP7A 4HVOA 4WM7B 5IK7A 3S0MA 3JD71 3IDCB 5F9TA 1IPKA 4I3GA 5FAXA 4IEUA 1UX6A 4B3NA 2QZ2A 4R9AA 1MS3A 3TWIA 2RS51 4L99A 4YVSB 3JB4C 4GULA 5C8CB 1S0JA 2BEOA 3V56A 4FBFA 2H6BA 4PBPA 5T5JA 3NAPB 1ZZ8A 4PLMA 4KH9A 5CG8A 4JDNA 1OQDA 1I1EA 1W6NA 1AL22 1HV1A 2P37A 1APNA 4UBGA 2IZWA 5C33A 1RUE3 2ZA9A 4AWDA 1PGW2 3VBHA 1MZEA 4LLOA 1CPMA 3RDIA 5D8AC 3PJYA 3ALQA 1H4GA 3LAGA 4RQPB 1RUJ3 2XL7A 3AYEA 2ZGSA 4WZCA 3ZXLA 4SBVA 4V1PA 5I8TA 1LHWA 1OOPA 3DN7A 2GNMA 1O4TA 4HSJA 4Q4Y2 2JKBA 4ES9A 1DHKB 1BEV2 2I74A 4OI4A 4Y1XA 4Q0VA 3D0SA 5GLZA 1IS5A 3O7OA 1CAWB 1C4RA 2XL9A 1Q8SA 1RVF1 3SCGA 4YG0A 5C8CC 1ZRCA 2IXKA 4RS5A 2EF6A 1RUC3 3KT4A 4OHVA 1LB2A 3RYRA 2XVKA 1CR7A 3ZFGB 1H8TB 2VUAA 4EN9B 1MR5A 3I2DA 2VQAA 2WNEA 5H9PA 3GZUC 2XVGA 3N7KA 1VRH3 4Z2WA 5D8AA 1SQ4A 5KXDA 1AYN3 4R52A 4COUA 4AQSA 1I5ZA 4URTA 2XHKA 1H1MA 4HKOA 1REDA 2XBO1 2BNNA 3FWEA 3VBHC 1SCRA 4FOVA 5J36A 1S0IA 3ZFGA 3JD73 1X36A 2E63A 3S30A 1AUYA 5J37A 1UPIA 4FPKA 2DU1A 3CL1A 3FBYA 3ZFGC 3WHUA 1WMFA 2Z79A 4IV1C 2WFPA 1O3QA 3FHIB 2WNUA 3PMEA 1ENQA 1LEDA 3QD6A 3VBRA 1U5ZA 2GNBA 5J96B 4FOYA 3UJQA 4FTEA 4ES8A 4K7JA 4E4ZA 3D8CA 1Y3TA 1J1TA 1X8EA 1VIWB 4JTOA 5DDJ1 2G9FA 1PZ9A 1FPN3 4BLIA 4UW3A 4XJ8A 4DPNA 4L97A 3AXDA 1H4HA 4YGBA 2DCJA 3JUUA 1HXS1 3NV4A 1AVBA 2JE9A 2YC0A 3BPZA 4TLFA 4B4PA 4QQPA 1AR72 1ZBE1 5E8AA 2WL1A 2OVUA 4JGYA 5JMCA 3ZXFA 2P17A 2R1BA 4P9XA 4NHLA 4X8NA 1YIFA 4LBOA 3WV6A 4B29A 4N43C 4QGLA 4H7LA 3M3EA 5DZFA 4HN0A 2QJVA 4XFCA 1S2BA 3MPPG 5EYYA 2DVFA 1MZFA 1NYWA 3OBRA 2YHJA 1Q8QA 5J09A 2ZBJA 4Q0QA 1QU0A 1QXPA 3GNEA 1DGWA 3MIDA 1Q43A 3HIFA 3AKRA 3VHNA 3G7DA 1UIJA 1QXJA 2GSYA 4QX5A 4X6QB 4N43B 1WLTA 4IL7A 4KWJA 1PO13 2CNAA 1OA2A 4OZXA 5CFCA 3WXPA 1AR91 1Y9QA 3VZLA 1DG6A 1Y7BA 2XJSA 3AP9A 4AEKA 1X8MA 3AP6A 4F8AA 1EV13 3ZN6B 4JCKA 4EROA 3UL2A 2Q1ZB 4I30A 4FAGA 1YRZA 3WP6A 4CEYB 2ZX1A 1GBGA 4JTNA 3WW2A 1N1VA 1LODA 4YVWB 2X53S 3M2MA 2R49A 2XJPA 3H0OA 4GWNA 3THTA 4K20A 5IK4A 4XIKA 3AKTA 3RPQA 1RC6A 2ZX4A 4Z1VA 4W6YA 1BBT3 3O14A 2WFF3 2SLIA 1V9U3 2F4PA 4N53C 5LK5A 1CAWA 5C4WB 1G7YA 3I7DA 1ZBA3 2VW0A 4CDWA 1A8DA 1RHI1 1WCKA 2ZGNA 5D1IA 3ZFFB 2D5HA 4C90A 1VAMA 2ZHLA 5EFUA 2Q4SA 3UKVA 2TUNA 4AFDA 3MZHA 3OTFA 1MVQA 3AFKA 3ZFFC 1EAH3 1QY4A 1WW5A 1RUI2 2X8KA 4RFT0 1YLLA 2IC1A 3FLPA 5K0UA 5BNNB 3VLBB 5BV6A 3VDDC 2R1DA 2XG3A 2WWSA 2BWAA 2ILMA 2RS32 1QJU3 3AP4A 1J1LA 3BIWE 3USSA 4BE3A 1PHMA 1V6MA 1GV9A 4QPIA 3HD8B 4YVWC 2PHXA 1ENSA 4IEQA 1YJKA 1N1TA 2JEMA 1RTVA 3SLIA 1EAH1 3VN4A 2C0ZA 1VBD3 5CG9A 1XNBA 2VPVA 4XOGA 1V6OA 1OLQA 1XRUA 4AI8A 1ZZCA 4NR1A 3OYWB 3B00A 3ECQA 3KLSA 3ZYJB 2JDZA 1FX5A 3VGIA 4BYYA 1LOGA 5I8YA 3FE5A 3OGJA 1FNYA 1SFNA 2R062 2ZHMA 2UYAA 3MLKA 1CJPA 2N7GA 3J8F2 1W6MA 2VH9A 2YGLA 2R061 3KCXA 2D7FA 1KS5A 1YI9A 4DINB 4LO6B 5E89A 4C91A 4Q26A 3LSDA 4QM9A 3U07A 3DL3A 5FLIA 2R071 2V5YA 2V09A 5C9AA 3IIAA 3SNMA 4AG4A 1SLTA 2VG9A 3HBZA 3IWZA 1X82A 3GYDA 2ZAAA 3AK0A 2R30A 2XBO2 1QJY1 4DB5A 2X5IC 4EWAA 1ZVFA 2MEV1 3O0XA 1V00A 1Z7S3 3PVOA 2XKOA 3IM0A 3MDPA 4JV4A 1W6NB 2Q5TA 3THPA 3VBSC 4G4FA 1W6MB 1LOFC 2DTYA 2QZ3A 2CV6A 1WD4A 3M3OA 1VBB1 4WM7C 1R093 2Z42A 1N3OA 1PM7A 3WG4A 4BMBA 1DYPA 3O0VA 5GLUA 1OOPC 3LOIA 1SACA 3TN92 1CAUA 1FPN1 2JJ6A 1FT9A 3ZN4A 4LBQB 4YGDA 4YZ5A 5KBFA 2X5IB 4Y20A 1PO22 2NM1A 3NW4A 3OJBA 1N1SA 3MIBA 3PVEA 1VAKA 2ZGMA 4OFGA 3RJRA 5IK5A 1UIKA 2OYZA 2GH8A 4OUMA 1W39A 3VZJA 3MI8A 4YM0A 1J59A 1GANA 1O91A 2I45A 1ZBE3 4BWOA 5JPNB 4CZSA 4CTEA 2H6CA 2XJTA 4EN8B 1ULDA 2AR6A 1CIWA 4UW5A 1CJDA 3NVCA 2KA3A 3H8UA 4HETA 1HQLA 3AYDA 3WP4A 3MF6A 2LALA 1CAXB 4B7EA 4OLLA 1HRI2 2G9GA 2X29A 1F9KA 3WQ7A 2CWSA 2FQPA 4GALA 1WUVA 3ME2A 4AI3A 1TMF2 4LBQD 2RM21 1HRI3 4DMIA 4WVMB 4K3UA 1ZREA 1LESA 1PNGA 3VBRB 3KS7A 2P3JA 4MLOA 1XE7A 2A6ZA 4LHNA 4AQ6A 4I01A 1NQJA 1QXRA 2A3WA 4M3CE 5GM0A 1EAH2 3W9AA 2Q1MA 4EN7B 5JCTA 5BXXA 2RMU3 1JXNA 1A3KA 3PVNA 5ACA1 3FUQA 4LLFA 5L73A 5HBAA 1REEA 4E2SA 4WVMA 4ATFA 5KHKA 1OHFA 5GZEA 1SFYA 4WM8A 4F83A 1FV2A 1CX4A 3Q9OA 3LA2A 2OIIA 1X33A 1M4WA 4BQ1A 4Z92B 3D0JA 2ZKNA 2Z5WA 2VOXA 4FOWA 2Y38A 1RUD3 2RR11 3ROUA 5EXOA 4XFBA 1H9PA 4H7MA 1LJ7A 3ATGA 2E51A 3N3HA 5BNPB 5D8AB 1OI6A 3VBFC 4ONUA 4XQDA 4Z8BA 3TNPB 3H1WA 3VV1A 1ULCA 5DDJ3 1LOEA 1LU2A 5GLWA 3USUB 1IQAA 1EV12 1AR63 4CEWC 1H2LA 3B9IA 5DG2A 4CDXB 1GR3A 4ATEA 1F2NA 1IKQA 4HPKA 5KC5A 5LRSA 2ZMLA 3WR0A 1ZZ6A 3O5SA 2IWGB 1OSGA 4IEZA 4GH4A 5EZWA 3T1MA 3P3NA 4AF9A 2EXJA 5JSPA 3GHMA 1ND3C 5AVPA 3M8LA 2X5IA 3V0BA 2AUYA 5K7PA 2AZ5A 3VBUA 1C3HA 1BKZA 1D4M2 2HEWF 1RVF2 5J3UA 3JU9A 4YG3A 4QQLA 4XHBA 3E6DA 4ZXKA 4I3PA 4Q0UA 3X29B 2TNFA 1H2MA 3IN9A 2IXCA 4Q0PA 1MS8A 4XPVA 4BZ4A 1WCDJ 2DYCA 2YXSA 1MQTC 1NG0A 2D3SA 4D7TA 1O7FA 2B39A 1DBNA 4GXLA 4LBMA 1EY2A 1RUF3 4N43A 4ZKTB 1RMU2 4I2OA 1I9RA 1ZM1A 4LO4B 3USUA 3V0BB 1ENRA 2RMU2 1VLNA 4OHYA 3K48A 1QOOA 1C1LA 3CO2A 4FO9A 3L9JT 4MXWB 4DXZA 2WNVC 2UWAA 4LBKA 5DUWA 2NPIA 5BYNA 2QUOA 4RHV1 1U12A 2ARBA 3B01A 1UD1A 4RHV3 4FVVA 2WLPA 4FAHA 3ZXAC 4LBQA 5L7OC 3FZ3A 3DF0A 2ET7A 3VZKA 1BBT1 1H1IA 1ND2A 2UU8A 4CDUB 3C2UA 2EIGA 5FQ0B 5JVVA 3TAYA 4NHKA 2C9AA 1QJX3 5E88A 3NV1A 1AYN1 3D5OA 3AP5A 2WNVA 1YYNA 3CEWA 4FCAA 1B35A 1BBT2 2R042 3N7JA 3ZPYA 2V73A 3FMGA 4K40A 4DNYA 1AR81 4L92A 1S55A 2WNUC 5LK7B 1EPZA 5JOXA 2JG8A 4WBBA 3PJQA 3FX3A 4CYDA 1AYN2 2ZGRA 4B8EA 5F5QA 1WD3A 3GALA 4MUVA 1VBB3 1FYUA 1ZZ9A 1WA4A 1YFYA 3R0RA 4P9YA 2WQ4A 2HWC1 4C1XA 1QWRA 4S2HA 1RINA 5CFDC 4IERA 3V0AA 4I0BA 2YUEA 4XFAA 4CDQB 2PLV3 1FOD2 3K51A 3CNAA 5F6KA 1JBCA 5LRRA 1AXYA 2PHRA 5AFBA 2RR13 2ZX0A 4UW6A 4HFSA 4AYUA 5JZGB 3AZWA 1IPJA 3QACA 2UWCA 3ZX7A 4U2AA 4YFZA 1QKQA 4Y1YA 4Q8KA 1B35C 3VBUB 2XKPA 1RUE1 4CDXC 1PIV1 4S2DA 2QQPA 4PCRA 2H0VA 4HK9A 4UXAA 4LHKA 2A6VA 1VBB2 2GH2A 3H7JA 2FMDA 2WZR2 2VVDA 3WG3A 3EJKA 4JRLA 2ZZJA 5FO9B 4FP2A 4QU2A 1RUE2 4I0WB 2EA7A 4MH0E 4XFHA 3MLLA 4XIOA 5BPXA 1PO21 3D6EA 3ZSMA 1ULGA 3EHKA 4IEXA 5T50A 4FT8A 2XPJA 4RSUA 1PGL1 2UWBA 4KGGA 1LGNA 1YFUA 3AMHA 4HSLA 4Y22B 2AREA 1POV3 1QNWA 4P9LA 4Q4V1 5JI9A 5JZGC 4DRVA 5BNPC 4OHXA 3KQRA 2PELA 4FQZA 1FPN2 3HMYA 3KGLA 3LB9A 3TN91 4HKLA 4XJUA 4Q29A 1YWKA 4LT5A 3RS6A 3T2TA 2VVEA 4QGMA 3ZXEA 2YPJA 2PYTA 3UKNA 3VBOC 3PNAA 1DQ6A 3M70A 1FNZA 4WVZA 4CP2A 3M3QA 2NMNA 5FMOS 3RI8A 5B2GB 1RUNA 4LTAA 2ZHNA 3GBGA 4AEDB 2VU9A 2D6OX 1RUI1 4AGGA 1AR93 2YY1A 2WNUB 2YGMA 4DRRA 1QJU2 3QLQA 5FOJB 1GQGA 2OZ6A 3NAPA 2C1FA 4GH4B 2XJUA 2O8QA 4Y1VA 2BBVA 2HWD3 3SH4A 4FPOB 4R4XA 2QDNA 5AC93 4FXKB 1LENA 1QF3A 2HWD1 3VKNA 5AC92 3AMPA 3B02A 2XH6A 1XYPA 1HQNA 4FXGB 4HKWA 2ZMNA 1ND2C 5DXDA 5KHGA 5CFCC 1C57A 1XNKA 2OA2A 2WNVB 1J58A 1C8M2 3AYAA 4AGRA 2NZ9A 2IXLA 2WSUA 2BVVA 2VQ0A 3JBG1 1AYM1 4LUMA 1COV1 2HWE1 3ZXDA 4DS0A 2XGXA 4HZFA 3DPRB 2R0FA 4NO4A 1AYM3 5ABJC 4JGZA 1Y43B 4B4QA 1QGLA 4M3CF 1LGCA 5JSOA 2A70A 1PK6B 5ABJA 5KHJA 1F5FA 4GMP1 1UN1A 3SCFA 4JVAA 2ENRA 3VUOA 3B3QE 4AI2A 4F3JA 1UMZA 3OBTA 5EYXA 4AXOA 5KWRA 1X7NA 3WD5A 4BOWA 2PHWA 2W39A 5T5OA 5T5LA 4AFAA 2W08A 5A3MA 3LOBA 1DQ4A 1W6QA 1W0PA 1RUD2 2AH2A 4PBOA 4ISRA 4N7UA 3AFGA 4Q4X1 2JG8B 1KQRA 2KXLA 3ZVXA 4R9BA 2RJKA 2XLAA 4YM2A 1UW8A 1D0HA 4COWA 1GZ9A 5C9AC 1G9FA 4XFGA 3WP3A 1AX0A 1ULFA 3MF9A 1RUD1 2ZGQA 3HAGA 5HCAA 3B93A 1QJY3 5I93A 2ZGPA 1PZ8A 1QQP1 2ZKLA 3W58A 3EBRA 1V70A 5HCBA 1CN1A 1FXZA 2HYKA 3SISA 2HWF1 4FPHA 2PHLA 4HK8A 3VBFB 4IV3C 3RSJA 2RR12 3PMSA 4P9JA 1PVC2 2GNDA 1NLRA 2B45X 2ZPXA 3JBG2 4JGZB 1D2QA 1GZCA 1COV2 2VNRA 4TYSA 1FOD1 4FPGA 2WS93 5FFOC 1VBE2 2A75A 3E97A 3M3CA 5JR7B 1L3JA 1ZRRA 3IKWA 3M1HA 2R043 4AHYA 3RYPA 2ZS6B 2MNGA 4I02A 1D0GA 2CYFA 2P2KA 4FPLA 4LO8A 1ENXA 4ZU7A 1QJX2 3UV9A 4LBNA 2E7TA 5KXBA 2D5FA 2D98A 1HW5A 1XE8A 4HVRA 1HQWA 1SBEA 1AXZA