3WQ7A

New crystal form of the hyperthermophilic family 12 endo-cellulase from pyrococcus furiosus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new crystal form of a hyperthermophilic endocellulase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 74
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq7A00
3VL8A 4HKWA 1M4WA 1HV1A 1XXNA 3EXUA 3VHOA 2NQYA 3VZLA 1UU4A 1XYOA 2JENA 1XYNA 2D97A 1H4HA 1H1AA 4HKLA 4HK9A 1UU5A 2DCKA 2DCZA 4H7MA 4NPRA 2VULA 1XNKA 2Z79A 1XYPA 2BWCA 2B46X 3AKPA 3VZJA 1REFA 3AMHA 3VLBB 3VZNA 1BCXA 5HXVA 1AXKA 3WP4A 3WT3A 1PVXA 3VZKA 2QZ2A 4XQWA 2BWAA 1HV0A 3B5LB 3MF6A 1OA3A 3WQ0A 1UU6A 3LB9A 4XQDA 1BVVA 1H8VA 2F6BA 4S2HA 3WR0A 1H0BA 2BW8A 2D98A 2VUJA 3WQ1A 3VZOA 3RI8A 1OLRA 3WY6A 1TE1B 4IXLA 1KS4A 4XQ4A 3M4FA 1XNBA 2JEMA 5K9YA 3ZSEA 1KS5A 3LGRA 1XNDA 1XNCA 3WQ7A 5K7PA 3VZMA 3B7MA 1REEA 1OLQA 1T6GC 3AKTA 2VGDA 3VGIA 1OA4A 1QH7A 2DFCA 5EJ3A 3VHNA 3WP5A 2BVVA 1HIXA 4S2FA 3AMPA 1UKRA 4S2GA 3MFCA 3AKSA 3VL9A 3WP6A 3MF9A 3RI9A 1H4GA 3AMMA 3AMNA 2DCJA 1NLRA 1BK1A 4HKOA 4XPVA 3MFAA 1REDA 2JICA 1IGOA 4S2DA 2B42B 3AKRA 3HD8B 1C5HA 1F5JA 3VHPA 2B45X 2C1FA 1YNAA 2VG9A 3AMQA 1QH6A 2NLRA 2DCYA 2QZ3A 3WP3A 4HK8A 1W2UA 1C5IA 3O7OA 1ENXA 3WX5A 2DFBA 1OA2A 3AKQA 3WXPA
chains in the Genus database with same CATH superfamily
1MQTC 2W3JA 1W8UA 4P9IA 5DABA 3U07A 4J1WA 1PMIA 3TN91 1DGRA 2QQIA 3LAGA 1QJEA 2RS11 1H4HA 3HNYM 1G6NA 5CBLA 4NOTA 3DPRB 3LFIA 5CFCC 2UWBA 2WAAA 4Y1VA 2P37A 2NN8A 5J7MA 3POIA 4I30A 4I02A 5LA9A 4FAGA 1AR71 2ET7A 3CMGA 4MADA 3T4VA 1QQP1 1XYPA 2JE9A 1YFXA 4XVHA 2ENRA 3VLBB 3VZJA 4RS5C 5K0UB 1QJX2 3B00A 5CNAA 3UJOA 1AYM1 1Z7S3 2SLIA 4LHNA 4ZS3A 4ARYA 1QGLA 5JWPA 2AZ5A 2DDUA 4NN0A 3I59B 5B4NA 5L9VA 1ZNPA 4EN6B 2MNGA 1AR82 2MEV3 1GZ9A 3K4AA 1GWKA 5IW0A 1LOFA 1PO11 2D3RA 2P6CA 2YPDA 2YZ4A 4AEDA 2DTYA 5FOBB 5JPMB 1HXS1 2BPA2 4XHXA 3ZYBA 3KGLA 4XW3A 2E7AA 1RHI2 2QTWB 4PDWB 4HONA 2G1MA 1LTEA 1JHJA 2JDKA 4NAMA 2VUJA 4CCCA 2Y64A 2E7QA 2WA3A 4TSVA 4ES8A 3F95A 4OI0A 3AM2A 3M4FA 5A6QA 3E5XA 4OLLA 5GLWA 4Z82A 5IUQA 4AEJA 1RXFA 2XJUA 3VBOC 4MG2A 2BBVA 1ND3B 3O1OA 4J25A 4IGPA 4IL7A 1YXWA 4E27A 5IVVA 4C90A 2PMWB 5FMBA 1TMF2 3Q8FA 1PM7A 1F8VA 4HPKA 2VCCA 4XOGA 4LITA 1YQ8A 4Z07A 3PJYA 4JDOA 4YG0A 1SLIA 1UPIA 3RPQA 4D94A 4P00B 4C1XA 2PYTA 4XDPA 5FYTA 3ST7A 3USUA 3IT8A 5C8CC 5JAXA 1W0NA 4DPNA 3HAGA 1GQPA 1W39A 3ZMOA 5KR7A 4QQHA 1XNTA 4OHZA 3MZHA 2EIBA 3I3MA 4COVA 1DYKA 4URAA 2RG4A 1CONA 3P1IA 4YW5A 2WO2A 2DURA 4YW7A 2RS53 2Z4FA 4B4RA 3FJSA 2VL4A 4HN1A 1PK6A 1LODA 1SQ4A 4M00A 4Q2FA 5CVRA 4Z8BA 2RM23 4N9HA 3OD4A 3ECQA 3MV01 3V56A 4PBPA 3VDBA 3BVCA 1UQXA 2BUKA 2VTFA 2Q1MA 3FMGA 2HWE2 3NV1A 3IDEA 1Q8OA 3WZ1A 4OI2A 1PK6C 3ATGA 5FZ3A 3VDDB 2HEWF 4RR3C 2ZZJA 2GN3A 2HJIA 1MZ5A 1N1YA 2J1SA 3N7KA 1FI2A 1HRI2 3E6CC 1MQTB 4LBMA 4FPJA 1VP6A 3CO2A 1CD3G 3ACGA 5FKBA 4BISA 1LOAA 2WZEA 5FY9A 5JMOA 1W04A 4QU1A 3ZXGA 1VAVA 3U1XA 1G9AA 3HR9A 3CJIB 2WS93 1KDMA 4M3CA 2Q8EA 4IEVA 4TZDA 2DVDA 3CBNA 1OT5A 2J1EA 4GULA 1WGPA 5FZLA 5JOYA 5CFCB 1A8MA 1DG6A 3RZHA 1ZREA 2N7GA 2ZX2A 5AC93 4CUAA 4KWJA 1KDKA 3PUSA 4LHKA 5DZEA 3DCQA 2HBUA 1GU3A 1O91A 2Y6KA 4FPLA 1CWPA 4YZ3A 3OB8A 1I5ZA 4CRQA 1CPMA 2WC2A 5FK8A 1F35A 3WHUA 5CFDB 2AYHA 4LO8A 2EIEA 2GNBA 4YVSA 5KXCA 2TNFA 4I01A 5EPAA 5L7OA 2CTVA 1SEFA 3HEIA 2WN3A 4QPWA 2EVXA 2WLPA 3VBRA 5FOJB 3TEYA 5FBJA 1ZYBA 2D93A 5D1IA 4CEWC 5JCTA 2ZMNA 1QNYA 3TEXA 3TNQA 5BNOB 1YIPA 2YGLA 2ZAAA 5LZ6A 3WSOA 4JGZA 1UCXA 3OBTA 4CZSA 2VMEA 3MGUA 1GWLA 2AC1A 3S30A 5ANNA 4MX3A 1CQ9A 4M0NA 4EJRA 2BW8A 2XGXA 1VB2A 1YI9A 2Q1FA 1KJRA 3ZYGA 4AEDC 4B4QA 5AFBA 5T3NA 2AENA 1W8WA 5KHKA 3KGZA 2A73B 3O1MA 2AEYA 1VBD3 3JCIA 1TG7A 3NJXA 1L7QA 5I8SA 2IWGB 3KMHA 3MO4A 3MPPG 3C7EA 1CVNA 1GLHA 2YPJA 4F8AA 2VXJA 5EJZB 3ZSMA 2WS91 4LK6A 1LESA 5DAPA 4Q4X2 2G9FA 4TLGA 5FREA 2NMOA 2Q1ZB 4COWA 5A7NA 3KT1A 1NY72 4I3GA 1T6GC 4YG6A 4MGQA 3GNEA 3KCCA 5LW9A 1DDLA 2J1TA 4OVEA 3JB4C 1Q5OA 1H6YA 3MIEA 3VUOA 3NKGA 4FOYA 4Y1XA 2BGPA 1VBD1 1NAEA 4P9XA 1GOFA 4YVWB 4C0HA 2RDNA 5A80A 3W5NA 3I2DA 5ABJA 1V70A 4LT5A 3V65A 4DXTA 1B35B 1K5MA 1UZ0A 5EHDA 5B2GB 2QUOA 4M4PA 4XILA 4CCEA 1Z0HA 1D4M1 1OPOA 4PF5A 1GKBA 4PIZA 2K2SA 1SBDA 4UF0A 1JZ8A 4FCAA 1NLSA 5F3EA 2MEV2 5BNNB 1ENRA 3K75B 1IQDC 4E4SA 2B39A 1O3QA 2B5HA 2D6LX 3TWIA 3PIJA 3WEZA 2B42B 4BH9A 4A4AA 3IB3A 1VBE3 2YYOA 2JG8B 2WN2A 1RUG1 1UNBA 1CAVB 1VLNA 3K3NA 4XBNA 4AL9A 1PO21 3NV4A 2CL2A 2OA2A 3WCRA 1YJKA 2JJ6A 1J3RA 2VVFA 1V9U3 2C24A 3M2MA 1R093 3N9LA 5ABJC 2QVSB 3O0XA 4X8NA 4CDQA 3N4MA 3VBUC 3AZZA 2VW1A 3H0OA 4AHZA 4CU7A 2W87A 4FPCA 1W6PA 3WG1A 2RS31 2VQUA 1AVBA 4QXCA 1H8TB 1LGNA 2BTVC 2FZ1A 5A32B 5CEHA 3S57A 3NVCA 4KU7A 2RDRA 4B29A 2RR11 1S0CA 3VKNA 1LOBA 3AB0A 1VMFA 1YO8A 5F2WA 4MLOA 3J4UH 4XFAA 3AYEA 1W0OA 4OFGA 1Q8PA 1SLTA 4HK9A 3T1MA 2DCZA 1HRV2 1CAWB 2VZ3A 4LKDA 2PTMA 4N7UA 3VV1A 1W8HA 3HWJA 2Z69A 4PIYA 2BU9A 3HMYA 4Y33A 2CSGA 4IV1A 3ZDSA 4C8DA 5C4WB 3ZSKA 1C3HA 1BK0A 1MEC1 1S1AA 3KT7A 3NJYA 3H3LA 4QXBA 4ASMB 4NMIA 4E2GA 3N9PA 1FATA 1AL21 4UFMA 1JU4A 2XVGA 3POYA 3ZXEA 4BQ4A 4D0QA 2KD7A 1GYKA 1VBC1 2CHHA 3DPRC 3NV3A 3C8XA 4NJ4A 5LBCA 1QDOA 3ZXJA 4CDUA 1BZWA 1HB2A 2WL1A 1FPN2 1PHMA 2AREA 1C8M2 1H8VA 1PVC2 1EYBA 1RUH3 1RJ8A 2A3XA 5DG1A 4GIQA 1NCQA 3RFRA 3LD8A 1W9FA 1R64A 1PGL1 1Y9MA 3HT2A 4LUKA 2XWJB 5JOXA 2XR4A 4WZCA 1NUKA 4XBQA 4HT1T 3LQCA 4E9KA 4LOSA 5AVAA 1D4VB 1RUJ1 1VMJA 2JE7A 2W5FA 3OBZA 4OI1A 1POQA 1DU3D 3ILNA 5K9YA 2WT1A 1W6MB 4XJAA 2ZAHA 4FPOB 5FY7A 4XJUA 3B7MA 1W90A 3W59A 2K0GA 1ND2A 2GH2A 2F17A 2R063 1WCKA 1PZ8A 3OYWA 4LKSA 3DEMA 2OQ7A 5EJ3A 3SMHA 3ZVXA 1PZ7A 2VMHA 3PIGA 4COYA 4FFHA 4YZ2A 4GMP0 3AMPA 4HN0A 3OOXA 3OGVA 4YZ4A 2V5YA 2XLFA 5JVVA 5LRRA 1A78A 4K20A 4UW4A 5LBBA 4E2SA 1DF0A 4Q27A 5FWJA 1LEDA 5CYYA 2Y6GA 1I9RA 2DU0A 3B3QE 3KV9A 4UT5A 4LBJA 4A42A 4XJ9A 3O1UA 3UYJA 2GMPA 3BOPA 2JICA 3M3CA 1NZIA 1ZA7A 5DAXA 5FLIA 1HRV3 3I3QA 4OHXA 1UMHA 2DWRA 3C7FA 2OQ6A 4FPHA 3D3AA 3RZGA 2VTXJ 5FRAA 4CEYA 2R16A 5FTTC 1Z7S1 2PXJA 5JOZA 4K8FA 1JS9A 2VBDA 4WVVA 1ZBA1 4YW3A 3I3DA 2BOJA 4CVUA 2DVGA 1UYPA 3NAPC 2WZPP 4AQ6A 1SG3A 1PIV1 2VZRA 3JD73 4GB33 3SEEA 4C91A 1KGYA 4CPBD 5C8CA 1GBGA 1SLLA 1SLCA 3I4IA 4XF1A 4BE3A 1G9BA 3RJ2X 2NZ9A 3NJVA 3WF0A 4HKWA 4JRAA 4QQLA 2WWJA 1DBNA 2RS33 2NQYA 1J83A 3OGGA 3ABZA 2Z42A 2XJQA 3HIFA 4BQ2A 1W3VA 1ZBA2 2ES3A 4JKMA 4EN8B 3RDIA 3DV8A 1ZX5A 1WW6A 4XZPA 4LA3A 1QOSA 2OZJA 3PURA 3VBUA 4AYUA 1XNKA 1PGSA 2DUPA 2O0OA 3KS7A 3I49A 2A6VA 4KBBA 1LCLA 4CP0A 3JQWA 3AMHA 4TLFA 4Q4V1 4BWOA 4QAWA 3CDZB 4LE4A 5A3TA 2NPIA 4AHYA 3S5QA 2Q4SA 5FZFA 5FZBA 1HV0A 2YG0A 2W1QA 1H1IA 2EXHA 2PLV2 3NL1A 1VJ2A 3UETA 1IPSA 4EN0A 1AR91 2NYYA 2WBKA 4XQDA 5GALA 3HBKA 2XL9A 3CZUA 3MIGA 4DXRA 5HCHA 1IS5A 1QJX3 2CAVA 3U4SA 1ZRCA 3VBHB 1UOFA 2A6YA 3D6EA 5KWRA 2RM22 3NW4A 4QQPA 5FBZA 5JZGC 4KWKA 1RUE2 4CXYA 5IK7A 1NQDA 2YFUA 2ZHLA 4OQ8A 3RGBA 2XUMA 4UFKA 1ULOA 4IE5A 4RN5A 3MPBA 1LNSA 2ZGNA 3WY6A 3O1PA 3WDWA 2EF6A 3VB9A 1KS4A 2JDUA 4XFFA 3PNAA 5FP9A 5BNOC 1WCUA 3JQXA 4UI9L 1YQ2A 3NWKA 2ZGQA 3LEGA 1C8NA 3HPNA 1ODNA 4NE9A 3UGGA 3J8F3 1PIV2 3WQ7A 2IXJA 1GP6A 4K40A 1PNFA 3IZOA 1J1LA 4CU9A 5IHRA 5GZDA 1UYXA 1W6MA 1UIJA 2DFCA 2GAUA 4ZZ8A 5HV0A 2VE1A 3HBZA 2AEZA 4OUMA 5FY8A 4W50A 1IZ3A 3VBFC 2VOTA 4AE2A 1NOVA 1IG3A 3POSA 1V6OA 5I93A 1JHNA 4Q8LA 3VKMA 1NCQB 1W6OB 3U10A 3OD0A 1A8DA 4DOUA 1O6UA 4AI1A 1YIFA 3C7OA 3FHAA 4GWMA 1XSRA 2V72A 1PNGA 2ZBJA 1Y3TA 5J37A 4LKEA 4CDUB 1VBA2 5JXHA 4LO6B 3IBMA 4D69A 4GWNA 5FKCA 1HJGA 1JYVA 2R041 1M06G 2BZDA 3VD5A 4U2AA 1C8M1 3MW4A 4QX7A 2ET1A 5CG9A 4ZONA 3FHQA 3VBRC 2JDHA 5DDJ3 4WVWA 3ZXKA 4EN7B 2DCYA 2EXIA 1DGRN 3C7HA 4ISQA 2JB8A 4YGDA 5GLVA 1CAUA 3M70A 5FZGA 1CAWA 1AF9A 2F4LA 1WZXA 4FFFA 5A33A 5LATA 1QNWA 1LU2A 2Z5WA 4UFJA 4CCDA 4BK5A 1SFPA 5A70A 4B1MA 1VR3A 2ZKLA 4HANA 1QOOA 3RQ0A 3I2OA 2YUEA 2GMEA 2HWE3 4FPKA 4H55A 5ACA1 2UWAA 5LA0A 1UW8A 5A32A 1Q43A 2X53S 3NNMA 1UOJA 5C71A 3VHRA 1W6PB 3VZLA 5LEJA 3CQOA 5H9RA 4BIFA 1POV1 2D97A 4HFSA 1C28A 3O14A 4DO0A 2VUAA 4LLOA 1JZ2A 4E8DA 5JIAA 2UYBA 5F8PA 2ZJCA 4YM3A 4N53C 4WM8A 1IQAA 1NE6A 2DBNA 3SH3A 4B1LA 4D6RA 1I5PA 1W99A 3OUIA 1SDDB 4FI9A 2IXKA 3Q8EA 1EV13 3B93A 4ZY9A 5E16A 5SV8A 2WZR3 2JG8A 4KQ7A 4ATFA 1G7YA 1V00A 3K51A 4LLFA 3WVJA 1AXKA 3WT3A 4Q4W1 4BB3A 1D4M2 3ZDVA 1S0GA 4UW6A 4HOOA 1RUI2 1VBE1 1F4HA 1S0JA 2EA7A 2ORZA 1YFWA 3QACA 3FWEA 1FNYA 1SBEA 4LO5B 3WDYA 3WQ0A 1NA1C 2EICA 3JU9A 5BNNA 4UF0B 4Y1YA 5I0UA 1DFQA 2C4XA 3MYXA 4ATEA 2E7TA 4FAHA 5F9TA 4XXPA 1BBT2 1VRH3 5DPNA 2CU5A 4D6SA 1RUI1 1VBE2 3A4UA 1K5MB 1B35A 4IGQA 4QHOA 3T3YA 4OCTA 4BOWA 3POFA 4HETA 4P9GA 4RGGA 3MIFA 3NMBA 5EXOA 3RG0A 3K48A 1VPHA 4RHV3 1MZFA 2EALA 3VZOA 4JQTA 2BERA 1T2XA 3OGJA 4AVVA 2ZXQA 3HT1A 3T2OA 3ME2A 4FO9A 4XQ4A 2JECA 4FFGA 1XE7A 4R9BA 4UWDA 3NJZA 5A6ZA 4Y1UA 1XNCA 1UIKA 2XJVA 4IE0A 3UKVA 4DNYA 1LHVA 4NVPA 4P02B 2JWPA 1JYNA 3EHKA 1S0DA 1OH4A 4GAZA 5H9SA 4WM7B 2QCSB 1RXGA 5C7GA 5C3OA 1LRHA 2HWC2 3JBG1 4EQVA 4FTBA 3MLKA 4OMDA 3TB0A 1W8FA 1V0AA 1WW4A 3MLJA 4UFHA 1JZ6A 2VZQA 2XQRA 4AFMA 2IUWA 3WDVA 5D8AC 1OQDA 3ILRA 5C4WC 4XF4A 3THDA 4M4RA 3RZJA 4H14A 1SPPA 4MXVA 3SH4A 4PDWC 2XONA 5FP8A 3LPGA 4O7XA 4AFDA 4K21A 4NRPA 3ZYIB 1N47A 3V0AA 3AMNA 2O8QA 1GQHA 2DCJA 4XUQA 3NV2A 3OSDA 3MW3A 4FOWA 4QMAA 5BNOA 1BK1A 1AR93 3C3VA 4WZFA 4XPVA 3HNBM 3AFGA 4CE8A 4YNIA 3VBRB 2W94A 2R042 3CF6E 1PX4A 4RGKA 1WUVA 4FP2A 4R9DA 2VMDA 1FPN3 5L7OB 1HB4A 2R6QA 3AYAA 2PHDA 1HKDA 1E5SA 1VBB1 2DYCA 2PLV1 2VZPA 5CFDA 5CFDC 2C26A 1EV11 1FOD2 1RUD2 2AUYA 4QM8A 4AF9A 1B09A 3KLSA 1UO9A 2PN5A 3POGA 4LIVA 5IYYA 3T0DA 3WX5A 1IS6A 2RS13 3ALQA 4K8RB 3RYPA 3WLUA 1OSGA 3BALA 4NIGA 4R52A 3P3NA 2B9VA 4A41A 4W6YA 4DEQA 5CFCA 3WF3A 4WVMA 4Q0VA 2GZWA 1R092 2OUJA 4UBGA 3RWKX 1M4WA 3M8LA 1X33A 4MOAA 4AHWA 4K7JA 1CGPA 2CWSA 4M3CB 1RUF2 4MVTA 4PF1A 4XACA 4NRMA 1XPWA 4LBQB 4OZXA 4AI9A 4META 1G9FA 4QU2A 5FZ0A 4GH4C 4QQ2A 5FWEA 3TOJA 5IK8A 4XYXA 1MQTA 5HV4A 3Q8CA 2ADDA 1QJFA 4GB31 5EJ1B 3WF1A 2XBO2 3VDDA 3DL3A 5I0RA 2BBAA 3DGTA 2VZUA 1JZ3A 4XAAA 2X09A 1O4YA 1FMD1 4GALA 1RIRA 4IUGA 2ZHMA 5DXDA 2J7MA 1JOBA 1GOHA 2XDVA 3LZZA 1RUG3 1ULFA 1PK6B 3AL5A 3VD7A 4V2WA 2RM21 4LBOA 1GP4A 3AX4A 3KZ4C 5FJKA 4CU6A 1O4TA 2QQKA 4MGSA 3KM5A 1OVSA 2IC1A 2OXBA 5KHJA 2GNMA 2XKOA 2PAMA 4FQZA 4DY3A 3BPSA 4N90A 1ZZBA 4OI4A 2QJVA 3USSA 3ZFGA 5JXIA 2C5DA 1F15A 1B35C 1F5FA 5J1XA 1KFUL 4Y20A 1I3HA 1WMFA 1TMF1 2XVKA 3LA3A 3USUB 2EIGA 5IVYA 1Y9QA 4IV3A 4K1ZA 2X10A 1DGWA 5T54A 2OKXA 2QE3A 4N43C 1DIWA 5F6KA 2A7AA 2D5FA 3KV6A 4HPKB 4QX2A 4K3UA 1V6MA 3UGFA 3CLPA 1MR5A 5ACA3 1UZZA 1ASJ2 3UK9A 5FQ0A 4BXFA 1RUF1 1ZZ6A 2A6ZA 2JKBA 5FXXA 4XJ8A 4AQ2A 2P34A 2YC4A 4QWNA 1W9TA 5JSPA 5LA2A 3E6BA 4XF9A 3WNXA 3R4UA 4YGEA 2YU2A 4BQWA 2CY6A 5CADA 3D82A 2HWF2 2VZTA 2XLAA 4QX5A 1WD4A 3LIHA 1C1FA 1JZ7A 1SDWA 3KVAA 4FTEA 3KB5A 1RMU1 1QJY1 2WA4A 2YBKA 3EBRA 3MLLA 1DQ0A 3N36A 1RUF3 4Y4RA 2OT7A 4XCBA 3M3EA 4YGCA 4NHMA 4GKXA 1PGL2 3CL1A 3ZXFA 4DMIA 1HB3A 2DV9A 4GMP3 2KA3A 3VBHC 2LRPA 5FO8B 1JYIA 3I59A 2H6CA 4EN9B 4KH9A 1AL23 1JUHA 5GZEA 2IFRA 1O3TA 2BGOA 4IW3A 4KGQA 3M7AA 3N9OA 3NNJA 5K0UA 3GJBA 1XOYA 2QQJA 4O9EA 1OOPB 2RS12 4HVRA 4Y24A 1A34A 4QXKA 3INAA 5FMOS 1DGLA 5HCFA 1R083 2FMYA 2ZX1A 3GCXA 3PHMA 3WF2A 1H1MA 3WQBA 2DUOA 2XB6C 3DPRA 4KWUA 2RMU3 5D21A 2J42A 1AYN3 4BQ1A 3N7JA 5FUIA 3KHBA 2A3YA 5LBFA 3T2TA 4TWTA 4QB2A 3ZIWA 4RYDA 5F5QA 2JB4A 4NWWA 2BV4A 4AR2A 4C1WA 3Q8BA 3IIAA 1BLZA 4FT8A 4LR4A 5T5JA 4D6QA 1XXNA 2IXLA 3RZMA 4IV1C 2VOKA 1NCRB 1EAH2 3I97A 3LA2A 4JDMA 4MUVA 1A6CA 2RS32 1JXNA 1L7LA 3I2GA 4Y22A 1DLLA 4CCNA 1KJLA 1YLLA 5L19A 3B69A 1PMHX 4AI2A 1R1A1 1LHUA 3O12A 4CDXC 2HWC1 4Q4X3 3MIHA 4ZXEA 2XHNA 1IHMA 2WJSA 4LXLA 3BYWA 4G9SB 2CGNA 5TSWA 3ZR5A 5DG2A 4LHSA 1DYOA 2D43A 4RD7A 1ZZ7A 2VY0A 3L2YA 4XQWA 3B5LB 5T5PA 3RS6A 2OVUA 4DINB 3ZFGC 4CXWA 3JUUA 2E26A 2XWBB 1UU6A 4H3WA 4IEZA 3LB9A 3RMXA 2YFZA 4AAPA 1OHFA 5M0TA 4K6BA 4RQPA 1OQ1A 4I09A 2WIIB 2X5IA 4I3PA 3EQEA 5JZGA 1H8TC 1H2KA 1OF4A 4AI0A 3Q8AA 3VD3A 2GP5A 1FOD3 4FPEA 1O3RA 1LU1A 2G19A 4XABA 4Q0PA 4Q4Y3 2Q30A 4CP9B 4GWJA 4HXCA 3CJXA 4IXLA 1ULGA 1AHSA 4XJWA 3T0BA 4Q4Y2 1OUXA 1ZZ9A 1Y9GA 4AOCA 3BB6A 3L9JT 3AK0A 2R0FA 1NT0A 1UZVA 2E51A 3ASIA 4PLOA 3BKZA 1OD5A 1S0BA 4BK4A 1V6LA 3H50A 4MYEA 5EP9A 5L73A 4CDWB 1OA4A 4F7ZA 4LBKA 3J8F2 3KF3A 1QH7A 3AZWA 4A45A 2ZEXA 4ONUA 2P3KA 1LAJA 3AXEA 4YGBA 3GCWA 4E4HA 5FZDA 5A7SA 1RMU3 2YU1A 1YQCA 5C9AA 3GJAA 3UT0A 2Q8DA 4LNVA 1FMD3 2BYVE 4DRVA 4ARXA 1UYYA 1S0FA 3AKSA 3T2QA 2WNVB 1TME3 4GJYA 2R1BA 2HEVF 3AMMA 1UPSA 3DYPA 4RR3B 2BRTA 5CIRA 3IN9A 1AX0A 1RVF2 2JDYA 1NKGA 2J1AA 3AYCA 3NAPA 4IEPA 1WW5A 1VAMA 3ZMNA 3LPFA 3THTA 2WT2A 4CEWB 1OUSA 1OD3A 2CAUA 1WCDJ 4UBHA 3JD72 4CEYC 2D6PA 4DB5A 3WDXA 5T5OA 2QZ3A 1JMUB 4JGZC 3ROUA 5A1AA 2O14A 5IFTA 5EYXA 1RGSA 3WUDA 3VBSB 4BU2A 4EWAA 1X8EA 2UY9A 5A1FA 4QHBA 2Q8OA 3BTYA 3AP7A 3NRUA 3UJQA 5BV6A 5J98B 2ZPXA 5L7OC 1TZOA 3LDBA 4FP3A 1CAXA 4K9SA 1JOPA 4IEOA 4LKFA 4XJZA 3HNMA 3O1SA 1ZRIA 1MEC3 2BFUL 2JENA 5C6CA 3RZKA 2WYSA 4E2QA 3KHCA 3QCWA 2HWC3 4Q4X1 3HQRA 4SLIA 2RJKA 4B3NA 4CDXB 4HZFA 1DGWX 5FZOA 1POV0 2J22A 2HWF3 2P4EA 2OPKA 3OTFA 1JBCA 2PELA 4UAPA 4UFLA 3SHRA 2ZACA 4LQRA 3AZYA 4BZ4A 1J1TA 4E4ZA 4QT6A 2B4KA 1T6BX 3AP4A 2WSUA 2FQPA 3W58A 4FPFA 2W92A 4YFZA 1ZVFA 1AR92 3V0BB 3BIWE 3UKTA 4AG4A 2WNOA 2PHXA 1QF3A 4CYDA 1GZTA 2OZ6A 2IXHA 3DUIA 2J1RA 1URXA 5HCAA 1SFYA 3MUZ1 3KCXA 1AXYA 1KRIA 3O0WA 4NHKA 4Y4YA 3J7MA 3T0AA 4Z2AA 1AR61 3ZO0B 1HB1A 1OFSA 4IEXA 1OC1A 5L9BA 5A7QA 2EAKA 1NQJA 1AR63 2K46A 5A7OA 1R1ZA 4PCRA 4AGVA 2VOXA 4BCUA 1RINA 4JC1A 3V64A 1AYN2 2ZGSA 3EJKA 2ZOEB 4N53A 1LGBA 4Q1RA 5FPBA 3JBG3 4YSFA 2YBSA 2JX9A 4JDNA 3ILFA 2VUCA 3KVBA 1UWWA 3R0RA 4NAOA 1E5IA 1K45A 1FT9A 3OY8B 2D6OX 5BNQA 1NXMA 4M01A 2VZOA 4CUCA 1ULDA 1CIYA 4NIDA 5FFOC 5FUPA 1UX7A 1W2AX 2Q8CA 3GYDA 2DUQA 4GB32 3OPWA 2VOVA 2WSVA 2K9ZA 2ID4A 3SISA 2Y6JA 4NIAA 4YW2A 1N1TA 1BEV3 3ZOIA 3K77A 5FZKA 5A1LA 3NO8A 4XUTA 4S2GA 1BEV1 3MFCA 4BJ0A 1QHDA 3DXUA 5JI7A 4XMIA 2PAKA 4FVVA 5C3RA 2WAOA 3PVEA 5DUUA 2RVAA 3RI9A 5JOWA 1SMVA 3GZEA 4QD2A 1AJKA 1JH5A 4MHUA 1X82A 1CPNA 5IK5A 4NUBA 2WFPA 1UY3A 2WRAA 3PVBB 3DECA 1YWKA 4N53B 2H0VA 2VMGA 2LUWA 3MIDA 2B45X 2QDRA 4URTA 3JXSA 1N3OA 1EV12 1FOD1 4JCKA 5FIXA 3HJRA 4N43B 1D7PM 1VBB2 1AZDA 2ZX3A 1CR7A 3QLQA 3LSEA 4GJZA 3SKJE 1V6KA 3M3OA 3WP3A 5T55A 3LWCA 1W03A 2DBIA 1CZSA 5A3OA 5FK7A 1YUDA 5FO9B 4OULA 4XFIA 1EP0A 1JODA 4SBVA 5A3LA 3VBFB 3N9QA 1AR72 3AL6A 5AFEA 1UX6A 4B4PA 3V0BA 3FC0A 5BUVA 2TEPA 3OGRA 3TN93 4GH4A 1JYCA 2RJ2A 2BQPA 1HV1A 4JX0A 3OEBA 1K5MC 2ORXA 4QX3A 2Q0AA 2RHPA 4O9GA 1OH3A 2B7YA 2KR2A 3R05A 5GJ6A 1QU0A 2BFUS 2D3SA 4OQ9A 3RRDA 3N3HA 5GLTA 5JSRA 2GN7A 4OUEA 1YQ5A 4DXZA 5GZFA 4CSWA 5E88A 3BIEA 3I2FA 1VRBA 1KITA 1TME1 4BPZA 3OBRA 1U0AA 1NX9A 4P9LA 4MO3M 3JBG2 2OS2A 5LB6A 4XHBA 4XDQA 3BODA 4PHZA 3M3IA 5APAA 2Y6HA 4MH0E 2VW2A 1TVGA 1X36A 1VE0A 2BNNA 2VR4A 5AC92 2JDPA 5KC6A 1CN1A 2DVAA 2BWAA 3MF6A 1UMZA 1W9WA 3AFKA 2L9LA 2IXIA 1EUTA 1SBFA 5DQ0A 1PO12 4LBQD 1VBC2 2GNDA 3ZYRA 4XFGA 4YYOA 4IDZA 4L97A 1BVVA 4QM9A 4PI2A 5JI9A 3FBMA 3VBSA 4DUXA 1Q56A 1S0IA 2VNRA 3G6JB 1VB4A 4N7IA 2VU9A 1H0BA 3KQRA 4XAEA 2VZ1A 4CTEA 2JG9C 4BXSV 2ZGLA 5FY0A 3A7QA 3IAQA 4RFT0 2ILMA 1FPN1 4NPMA 1DQ6A 4CEWA 1QMJA 1QJU2 1ENQA 4FOQA 4QHZA 1C8M3 1W8TA 3ZIXA 5DAQA 1C1LA 1X9TA 3NAPB 2VZSA 5D8AA 3D5OA 4XUPA 5FZAA 4A6SA 1BMV1 1YRZA 1GNYA 3LOBA 3NNFA 3ACIA 4Q4W2 2PAEA 2EXKA 3HN1A 5DDJ2 5IK4A 4Y26A 5LCWL 3H42B 2XXZA 4R8HA 1HN1A 3AJZA 3CKHA 2FZ2A 4HVOA 3DYMA 2IXCA 4YARA 1W6NA 2WR9A 3KV4A 2DVBA 4BQ3A 2XJSA 5CB7A 1KEXA 1JN2P 5C9AB 5T52A 5J36A 3J7NA 2CGPA 1WWYA 1HX6A 3KV5A 1W2OA 1YHFA 4NR1A 5E8AA 4YG3A 5E1RA 3LIGA 5FYZA 1EPZA 1HQNA 1RITA 4CDWC 2WWSA 1WMEA 2UWCA 3U78A 3PU8A 1LHWA 2WFF2 1I1EA 4CCOA 4AI8A 5IFPA 2A1XA 1W6QA 2VCBA 1O8PA 1W2NA 3RJRA 3X29B 2ETEA 3POEA 1ZZCA 4PIXA 5FAXA 5CISA 4ASKA 3VHPA 1EAH1 2FBEA 1YNAA 3LEIA 3WCSA 3SLIA 3BU0A 4ISRA 4DEVA 4OHWA 3O1TA 1ULEA 4Y5TA 4Q4Y1 2ZABA 1ZBE2 2WNEA 1NG0A 2JG8C 4LBLA 2YXSA 1RUI3 5FYMA 5EZWA 4YW4A 5FMDA 4AVTA 4CCLA 5IVEA 5JZGB 1YC61 4X8PA 3P5BA 1IG0A 1O59A 2A5ZA 1VBC3 3E5QA 4RQPB 4WM8C 3F2ZA 2MEV1 4LTAA 1KQRA 4B8EA 1E57A 4P9JA 1EUUA 1FV2A 1JUIA 1US2A 4JZRA 1QXRA 4CCMA 1MS8A 4QDSA 4QKDA 5FJHA 2H6BA 5DZFA 5H9PA 1Q8QA 5DMYA 1R082 3UNPA 1NY71 2X29A 3I2IA 5FP4A 1ZRDA 1J59A 2JD4A 3PMSA 4PT6A 3S0MA 1S2KA 3A0NA 4EROA 1WLWA 1G8WA 1HJFA 4HLTA 1VBD2 1UU5A 3P6BA 4JRLA 5IT6A 4H7MA 3THCA 5LWBA 1Z78A 4P9WA 3IKWA 1Q3EA 2P3JA 5IVBA 3E6DA 3BTZA 5JIUA 1MS4A 2ZMKA 4Y22B 1QJY2 1UZYA 3DXTA 4GQ7A 3A21A 2PHFA 2YGMA 1TME2 3GXUA 1D2SA 1R1A2 1OBNA 1NCRA 1MACA 3FLRA 2WO7A 3ZFFA 2W2IA 1QJZA 3FX3A 1JYXA 1SZBA 1SCSA 3I7DA 1TEIA 2RS51 5BYNA 2ZGPA 5FZ9A 1DQ4A 2RMU1 2WUHA 4DFSA 3IPVB 3ES4A 1QQP3 4A3ZA 1COV3 1CIWA 1O8SA 2F6BA 1JOJA 2JG9B 5DUWA 5FZ6A 3J9SA 4S2HA 2WO1A 5GKAC 1XNAA 4BM8A 2QQUA 3VBSC 5BY5A 5HI0A 1XRUA 3UGHA 1PIV3 3FE5A 4Z2WA 3LFMA 1VBB3 5FPVA 3W20A 3BUCA 4QGNA 1OOPA 2VVEA 5CKMA 1LOFC 1X50A 3RI8A 2C9AA 1OLRA 3E5UA 1DHKB 3VBOB 1IKQA 5FLJA 3VDCA 1TMF3 1PVC3 3PVNA 5K4LA 4BYYA 2AACA 3AXDA 3R4SA 5DAVA 1J58A 1JZ4A 2XOMA 2ZGOA 2WINB 2R061 3N7MA 4XMAA 2LALA 1OLMA 2ZGTA 3FFQA 1SHWB 3AC0A 1P8JA 1QKQA 2ADEA 3AKTA 3D0SA 4CUBA 1RUD3 2V73A 1W0PA 3NSTA 4BMEA 1OKQA 4TN7A 3AP5A 1W3XA 4LJHA 1Y43B 4NHXA 2AGSA 1LOGA 2QKDA 4H2AA 4AHXA 1LR5A 5KHHA 1IPJA 4LUMA 1RB8G 2W39A 4QPIC 3VN4A 2CV6A 1FV3A 5F3GA 3WP6A 5A7WA 1OQEA 1XU1A 2RDQA 4LMFA 3H7YA 1AL0G 2OIIA 4JGYA 1OPMA 1LOEA 2QQLA 1HXS3 1OKOA 2E32A 2PHUA 1RC6A 3AP9A 3ACLA 5FQ0B 4AFCA 1PO13 2VQ0A 2XBO3 2TUNA 4FPGA 4COUA 2PHLA 1HRI3 3E1F1 4OZOA 5F1RA 3EO6A 5DN2A 4LA2A 1LKNA 1F5JA 2X05A 5JR2A 1VRH2 2FD8A 5C3SA 4BQXA 1UZWA 4IV3B 1R091 3QBQA 2OUHA 1U12A 3ACFA 3GZTB 4Y20B 2Y26A 4YM1A 3ZFGB 3RVHA 4CU8A 3TYJA 2IVIB 3AKQA 3K4ZA 4QPIA 3CJIC 3FHIB 3ZYFA 5FYIA 4QX1A 1EAH3 1LEMA 1W8NA 1E5RA 1DQ5A 4Q4V2 5T50A 4AGGA 4Q4W3 4L9BA 5KXEA 3K2OA 1EPWA 4AI3A 2JKXA 4Q4V3 3PDQA 4QB6A 1XYOA 4OYUA 5CZKA 3MEPA 4DIQA 5I8TA 2I2SA 1D2QA 2WABA 2Y0OA 2IFWA 2VECA 5ISLA 1NA1B 1CZTA 4EWEA 4FFIA 1QJY3 2DCKA 2DTWA 4QGLA 4QPGB 4PJYA 4UFIA 4EWDA 4LULA 1QOTA 1BEV2 3MV11 1DLCA 2GMMA 1F4AA 1PGW1 2JIJA 4RFRB 2V4AA 5BNPB 3VZNA 4H7LA 5FCCA 3POJA 4HSJA 4LBQA 1RHI3 2XPJA 2VOWA 1XU2A 1YFUA 2RR13 2DF7A 3VKLA 5A3WA 5FYCA 4W6XA 4ZPIA 4WVMB 2P6HA 2GC3A 4D8MA 3ENRA 2WNUB 5DUVA 3B9CA 1D0HA 1GQGA 4HL0A 4LIUA 5LK5A 1Z7S2 5IAVA 4DZGA 1AYN1 1DP0A 1V9U1 2W1SA 4BA6A 4MZUA 4OMCA 3KD4A 2FDGA 2PLV3 1FAYA 3U4XA 4WM7C 3PLQA 3TAYA 3KCYA 3H8OA 3POBA 1ZBE3 2D3PA 2VCMA 3H7JA 3OBAA 3DN7A 4IEYA 3BCWA 2R30A 1HXS2 1WD3A 2W91A 3UV9A 4CXXA 1F9KA 2XJPA 1ZRRA 3QH6A 4L2NA 1GZWA 1L7RA 3O0VA 3M3QA 3OPTA 3SH5A 3ZFEB 5A6XA 5K7PA 1HN0A 4W8JA 4ET7A 2XL7A 3ZXAC 3IMNA 3TN92 2XMLA 2W9XA 4X6QB 1DQ2A 4DS0A 3V0AB 5A3UA 3WV6A 2VQTA 2VXRA 3WP5A 1HIXA 3U14A 3E97A 3GALA 1WBFA 5HPOA 4Q0UA 1ZBE1 1SPPB 1S2BA 1OI6A 2V5DA 2AR6A 3IDCB 5I0TA 3KSCA 3W21A 1CJDA 3PL0A 3ZYJB 2ZEWA 4RS5B 3CU7A 3ZN6A 2A6XA 2MHFA 1UKRA 3ZX7A 4CCKA 4MXWB 2HYKA 5I8YA 3B94A 3FN9A 4LK7A 3SEPA 2RJLA 2W0XA 2VO5A 3IM0A 5FUNA 1TNFA 5L9RA 4WM7A 4U36A 3BN6A 3LF7A 2HWD1 2PFWA 4AGRA 5F7UA 1MS0A 4AQSA 1NLRA 4NIHA 4XTPA 1V6JA 1ST8A 5DZGA 5FY1A 5FP3A 1REDA 3GHNA 4NROA 4CDUC 2QNKA 2BDRA 5FLHA 4FSJA 2XUEA 2GC2A 1BBT1 2QQVA 4HBNA 2F4PA 4L0PA 4KMQA 4BIOA 1S55A 1AXZA 1TQ5A 2MPFA 2YHJA 5JUVA 1A3KA 1SCRA 4LPLA 1QDCA 2EAAA 2FCUA 4ZHNA 3TNPB 1XQNA 3C7GA 2YBPA 3WG2A 1JU3A 1ND3C 1O5LA 2V4VA 5DDJ1 2WLQA 3WXPA 4V1PA 2WT0A 3OGSA 4R4ZA 4XZUG 2QQOA 4LORA 1MEC2 4AQTA 5C70A 2E6VA 2QBXA 4LO4B 5K8SA 2D6KA 1ZZ8A 4XIOA 3VHOA 1RUE3 2W08A 1LHNA 1RJ7A 5DUXA 1ULCA 2WZR1 5LASA 1QJU1 2OYZA 2HBTA 4QX0A 2NP0A 4IEQA 2FCVA 1OFNA 5FR3A 1GV9A 3GBWA 3HOBA 3QH7A 1W06A 2R072 5HCBA 1LJ7A 3S7IA 1RL3A 4UYBA 5SV5A 1UXZA 2ZMLA 2VULA 2VH9A 4WM8B 1HQLA 1H9WA 4UOJA 2RDSA 3EMRA 3HVDA 1BJQA 2KM2A 2Y6LA 3OPZA 4NHYA 2BVBA 4A7KA 4HVQA 4KL1A 1FXZA 4JKLA 2ATFA 5FYHA 5T5LA 5F37A 1UY4A 2R1DA 4WV8A 1V6NA 2BNMA 4HG6B 4JTOA 3EYPA 1HQWA 4Q26A 3H8RA 2W1WA 4OHVA 3CIHA 3SXWA 3GBGA 1W2TA 5C3PA 5JSOA 1AX1A 3JZVA 3N9MA 4ZU5A 5FO7B 4BQ5A 3NQHA 1O3SA 4XDOA 5A33B 1RUG2 4X6RB 1S2EA 4PI0A 1CAUB 3T4HB 2WZ8A 3CNAA 2JXAA 2XQXA 2X5IC 2FMDA 4MXWA 3WQ1A 3WNKA 3ZN6B 5FZEA 4RS5A 4KG8A 3NNLA 4QX8A 1LOCA 1H2LA 2Y0IA 3BPZA 4KNCA 3ZSJA 5FZHA 4NPLA 3TEZA 4K1YA 5G05L 3FUOA 1RUNA 4N9IA 2I74A 1XNBA 3GM8A 1RUC2 5EQUA 4A7ZA 2FDHA 3OUJA 3ZN5A 4MGIE 1US3A 2J1UA 3T30A 2RV9A 4AW7A 5KC5A 5KBFA 2ZGUA 4FPYA 2HH9A 3FFZA 4PLNA 3ZR6A 3ZFEA 1IPKA 4CP1A 1GZWB 3VHNA 1W6OA 3K46A 3BU7A 1UD1A 3GZAA 5F3IA 1SFNA 5JMCA 5FZ8A 5JLVA 5IATA 4AVAA 2VNOA 3I3EA 2Y8KA 4XUOA 2B8MA 1OOPC 3BOWA 5I0SA 1S0EA 2WNUA 4YZ1A 1Y4WA 1TNRA 4KGGA 5LEKA 4AXOA 2P3YA 1QXPA 3LEKA 2D7FA 5A7PA 1V9U2 1PZ9A 3K3OA 5FZ4A 3ZKUA 1UOGA 2VQAA 2ZZQA 1YFYA 2ZTNA 2GP3A 1COV2 3GDBA 3BTAA 5CKQA 1OVPA 2C1FA 4AFAA 4XC9A 3AMQA 4LHLA 4FBFA 1WA6X 5BNPA 2OPWA 4MSVA 3ELNA 4BHPA 1K5JA 4Y1ZA 2OW4A 2GH8A 1W2UA 2YDEA 1G86A 2LW8A 3PTYA 4QPGA 3MHZA 2VMCA 1FX5A 3KWVA 3FL7A 3O7OA 4AVBA 4Z1VA 3IDBB 3VBHA 1NA1A 2D6MA 4FQ4A 5C5UA 1RYYA 5FPAA 2CWMA 3SKVA 4XBLA 4P5HA 4W65A 1LGCA 2BNOA 3GF6A 1WMXA 4AK3A 5FYVA 2XVLA 4PBOA 4YPJA 2G9GA 2HYXA 3CEWA 4DXSA 1MS1A 2R073 5ERLA 2VM9A 3ETPA 1LENA 3WF4A 1LECA 4Q29A 1XYNA 3FLTA 4IGOA 2EXJA 4IETA 4INDA 4RGAA 4PLMA 4YVWC 4QPIB 1AR62 2FDFA 4AVSA 4M3CF 2XJRA 2VPVA 3VBUB 1JYTA 2FDKA 1RUC3 1FMD2 5CU1A 1BKZA 1K3IA 4RSUA 4YLZA 2B46X 4IEWA 2IVJA 1PMJX 2Y34A 3G7DA 5JXGA 5FPZA 5F3CA 3B02A 3ES1A 3THPA 2XBO1 2ZGMA 3GGLA 3PUAA 3TRSB 1H9PA 3PUHA 1QXJA 2W1UA 2WNVC 2E33A 4ORFA 2Q5TA 1PGW2 4MHRA 4NHLA 3A23A 1ENSA 1XJAA 3GBFA 4A6OA 1X9PA 4Q0QA 4JGYB 5IVJA 1Q8VA 2LTNA 3WHTA 2WQ8A 4IV3C 4QDRA 4A7YA 1MS3A 1J3PA 5C8CB 4IEUA 3C2UA 5A7WB 1PO23 2VUDA 5B4XA 1WW7A 3N9NA 2TBVA 3WW4A 3R4DB 3RZZA 4TTGA 3A0KA 2OX0A 5FZ1A 2XG3A 1UOBA 4D7YA 4OUSA 4P5YA 3WG3A 1C57A 1MS5A 2EIDA 2YB7A 2HWB1 4CEYB 4Q5OA 3VKOA 1K42A 1RTVA 5FZCA 4ITCA 3WW2A 4ZKTB 4YFWA 1FNZA 1RUD1 2ARXA 2E9QA 5BXXA 1HW5A 1W8ZA 1DQ1A 4Q0SA 2R043 2I45A 5FP7A 1PM4A 2A6WA 3ZSEA 5F5IA 3LGRA 2JDNA 2Y6FA 5I0DA 5I91A 2CDOA 4UW3A 1AYM2 3VZMA 3O5SA 5IAXA 2ZKNA 4G4FA 4L99A 5BPXA 3RZLA 1UL9A 3RSJA 1GZCA 2JIGA 1J84A 4P9YA 3VGIA 3H3ZA 2W46A 4EZHA 1DCSA 5KHGA 5A3MA 3VDDC 2PHRA 2QQNA 3RNSA 3VBOA 3IIIA 3AYDA 4KU8A 2GU9A 3I2JA 2D6NA 1ONAA 1GFF2 1W9YA 2HWB3 2XLGA 4I0AA 5EWSA 4AWDA 3A22A 4FXGB 1ACCA 3ZFEC 2ZCWA 4XIKA 1DZTA 3KQ4B 4E8CA 3O1VA 2UURA 3QD6A 2JD9A 3H8UA 2P17A 2ZA9A 2C9KA 1H2NA 2D44A 2JG9A 5J96B 5ANQA 5E6HA 4RHV2 1WMDA 3IPVA 2LM3A 3OYWB 4A44A 2NM1A 1ND2B 2XKPA 3MW2A 3N7LA 1IKPA 1COV1 1KXGA 1G9CA 1HDKA 1JZ5A 5C33A 3KT4A 1W9SA 3H1WA 3ZFFB 3LEMA 3VD4A 2IZWA 2E53A 1RUH2 3GHMA 2ZHKA 5C3QA 3S5AA 4Y5SA 2VAUA 2G9ZA 1YJLA 3MDPA 1OXCA 5GLUA 4EZ4A 2ZEYA 2RS52 1QH6A 1RHI1 1RUJ3 3DKQA 2B9UA 2YY1A 2DCTA 4YZ5A 1JTZX 4HK8A 5JXJA 4YM2A 4XTMA 3ZKYA 5A3PA 3CZJA 3O1RA 3HQUA 1R081 1RUJ2 3OG2A 3PMEA 4YW6A 1AL22 1ZBA3 2H0BA 1BVP1 3I54A 2P2KA 3PJQA 5FZIA 1MZEA 2BP6A 3WW1A 1CESA 3JB8A 2R071 3J7HA 2Y38A 1PX3A 1XC6A 1PVC1 3UESA 4AEKA 3MIBA 4TYSA 4G3YC 3WD5A 1IS3A 2WQZC 2WZR2 2HKXA 4JTNA 1BQPA 1GP5A 1VMHA 5EV7A 5C4WA 2NMNA 4IV1B 1H1AA 1D4M3 2VBPA 1D0GA 3LE0A 3MUY1 1MZ6A 1N3PA 4HKLA 2R7EB 3WDTA 3ZPYA 3ZXLA 2CGOA 2O1QA 4RL7A 3FLPA 3I8TA 5LA1A 2VJXA 4XE9A 5FPXA 3WNPA 3DKWA 3LOIA 1AX2A 1R1A3 4LBNA 2P1BA 2SBAA 4I2OA 2ERFA 3AKPA 4IE7A 3POWA 1REFA 3U75A 1I6XA 3WP4A 4D3WA 1PVXA 4O61A 1KFXL 2FDJA 3VZKA 5J48A 3WNLA 4DQAA 2A3WA 1H8TA 2BGCA 3LCPA 2GC0A 1W6QB 1OA3A 2BJSA 2VTXA 1NLQA 1G9DA 3ZN4A 2QFEA 1PO22 1NYWA 3ETQA 4CDQB 4GWIA 2X8KA 4F3JA 5FY5A 2JE8A 3WR0A 3WNOA 3HN3A 1NZCA 4Q8KA 3ZYHA 1XE0A 3S6PA 4NIIA 1WLTA 1ZM1A 3AZVA 1CAVA 5J09A 1JW6A 1SLBA 3MBWA 4P08A 3HQXA 4EYUA 1OLME 3MI8A 4XUNA 3T2PA 4DUVA 1H30A 3J7LA 1W6NB 4XETA 2JEMA 1JYWA 1EY2A 5FYUA 5CAZA 1GWMA 2JDZA 2ZS6B 3ITQA 2ARCA 4LE3A 3IDAA 4Q1PA 1OLQA 4BLIA 3TBDA 5FZ7A 5D8AB 4FXKB 3OUHA 5JR7B 3BI3A 2WYFA 2GSYA 3VDAA 4S2FA 4R9CA 3FZ3A 5ABJB 2VW0A 3CHXA 2YMZA 4YVWA 1APNA 5FZMA 1QY4A 2CNAA 4A2UA 1H6XA 5A6YA 2I07B 3ORJA 4L92A 2QQMA 1ALYA 1GICA 3AZXA 2E63A 4B7EA 3MF9A 1H4GA 3H8XA 5AC91 4HMZA 1QEXA 5G04L 4J1XA 4KG0A 1H2MA 2WDBA 3QOPA 5K0UC 1DYPA 2FCTA 3MFAA 5CA6A 2VC9A 3PUIA 1AJOA 2GNTA 5LY1A 1IOAA 1FYUA 1N1VA 5ACA2 1DZQA 3Q9OA 4BDVB 1ASJ3 3AKRA 3LDRA 4QKFA 1C5HA 1N1SA 1GMMA 3BGAA 4RHV1 1VIWB 2HWF1 4JHTA 3H3UA 1YI7A 3SITA 3UL2A 2WS92 2A71A 2ZGRA 3EB7A 3WINE 5FXVA 4M0HA 4LOTA 4XCAA 5GZCA 1ZA4A 4KI5M 3WW3A 5FDBA 1ENXA 1BXHA 1RUH1 1UXXX 1GSLA 2DFBA 3SQOA 4AAXA 4JGZB 5F39A 1BMV2 1QJU3 2FHRA 5AVPA 4ZZ5A 1RUE1 3FBYA 2VBBA 2WNUC 3SCGA 4COZA 3VL8A 3WOGA 1ASJ1 4XEZA 4YM0A 1AYM3 4GH4B 3ZM8A 5LK7B 1XB9A 4MGYE 1VBA1 2ARBA 1OF3A 3WUCA 4XFBA 5L36A 4YVSB 1AR73 4IE4A 4BMBA 2CDPA 3VBFA 4I0WB 2WWUA 4XURA 5FXWA 3I2HA 1HLCA 2P5BA 2GALA 1W8OA 2ZEZA 5CG8A 2HWB2 1WA4A 4EE2A 2C0ZA 3NNGA 1U5IA 1MVQA 1O5UA 1SACA 2PHWA 4QKBA 4W6WA 4XFHA 2YC0A 4PQQA 1QIQA 2VMFA 2YROA 3D8CA 4N43A 2Y33A 3ZPOA 1BBT3 5KHIA 2ZX4A 4ZXKA 2A70A 2QDNA 1U5ZA 2QZ2A 1HRI1 3AJYA 1XBFA 2JDMA 1VBA3 3OJBA 4QDQA 4CDQC 4IQPA 3CJIA 2XHKA 4XXAA 1RMU2 4KBZA 5IVCA 2ZX0A 5KXDA 4AEMA 2HWD3 2AH2A 4J6GA 1MVEA 3SCFA 4JQRA 5FYBA 4B7KA 5F5CA 3ZYPA 3ZXDA 2D98A 4KWLA 3W9AA 1Y7BA 4NRQA 1GR3A 2XJTA 3PVOA 2ARAA 1WCSA 1IS4A 1TE1B 2HLEA 4Y5Z0 2ZHNA 3NKTA 3APBA 3WNMA 1W28A 4Z92B 4RA0A 3RMYA 3TEWA 1MS9A 2PA7A 3FUQA 1KS5A 2HWE1 3WNNA 4QB1A 5C9AC 5KXBA 1XNDA 3DYOA 2PHTA 2QQWA 3OY8A 4IESA 4MGZE 1REEA 4HSLA 1UKGA 1W05A 3WG4A 1YCIA 3I2KA 3T08A 4YW1A 1UMIA 5LRSA 1QWRA 2R062 3OF1A 1SLAA 3I3BA 3LA7A 3SCHA 2RE9A 3N35A 1Q8SA 2C6SA 3VKFC 2FDIA 5EIYB 3IWZA 2Z2SB 4JKKA 1UF2C 5F2SA 4XF0A 4QQOA 2R0HA 2W95A 2R32A 1QJX1 4L11A 4AFBA 2E31A 3K4DA 3GZUC 1C4RA 4MGTA 4MV2A 1GOGA 4PQ9A 1VRH1 3M1HA 3W5MA 4MGKE 1O7FA 2WKKA 4QPYA 3R6SA 1ND3A 2D40A 1WCQA 1E5HA 2PQSA 4RQPC 2WO3A 2RMU2 4ASLA 3HD8B 3RYRA 1U5XA 4JVAA 4I0BA 2W68A 2VCAA 4Y3OA 3U0ZA 5JPNB 2UY8A 3H9AA 1NE4A 2VG9A 5FPUA 3B9IA 4V2VA 2NLRA 5C8WA 1F2NA 5IJRA 2WFF3 1S4CA 5D2AA 3D4KA 1AR81 3ZSLA 1VAKA 5FZOB 3VD9A 1C5IA 3PTRB 1F31A 4XFCA 4PDWA 4CA9A 4CDXA 1JI6A 5FYSA 3IAPA 1RUOA 2R49A 3LSDA 5HBAA 4AEDB 3ZFFC 1LHOA 4CCJA 1UY1A 1NCRC 3OCPA 1LULA 3EXUA 4YVSC 5FY4A 1CAXB 4R9AA 5DAWA 1CX4A 5J3UA 2W52A 5FMCA 1UU4A 1UYZA 1LB2A 1GUIA 1AUYA 2G4IA 5F6LB 5EYYA 1RUC1 4OHYA 2VNVA 1YYNA 4BQYA 1L3JA 5GZGA 5GM0A 4NPRA 4GXLA 1KD7A 1OMIA 2KXLA 3DF0A 4WBBA 3S7EA 4XF3A 1O4ZA 3U11A 2Z79A 2YV8A 2BOIA 1RVF1 2WQ4A 4N8MA 2BWCA 2PQQA 3IMMA 1ND2C 1QQP2 2J1VA 1BCXA 5HXVA 1HRV1 1ZRFA 2YC2A 3PU3A 1POV3 3PUQA 5FPLA 2P3IA 3ZLIA 1BYHA 4FTSA 4UW5A 4JV4A 2LS6A 3RYKA 3WDUA 3RWNA 1YEWA 4ZU7A 5FYYA 1X7NA 4YRDA 4LO7A 1UY2A 5F32A 5HXMA 3UKNA 2A75A 4RR3A 5IWFA 1OURA 4C0BA 4ES9A 1CX1A 4NO4A 4L8QA 4LEJA 4JAAA 5BNNC 3MICA 1AR83 1WKYA 4BLJA 3AP6A 4FOVA 1NCQC 2WNVA 2BEOA 2O8OA 2WFF1 4ZS2A 5LY2A 4DRRA 5FV3A 2JDAA 3ACHA 3H1MA 2DU1A 5GLZA 4JHZA 1UN1A 4M3CE 4YWAA 1VALA 3URFA 3H1YA 1ULPA 2CYFA 4CDWA 2LROA 4AZZA 2VZVA 1X8MA 1CJPA 4CUGA 1MPXA 2UU8A 4AVCA 2V09A 2VGDA 4DY5A 3AVSA 4UXAA 4DUWA 2UYAA 3JD71 4CP2A 2ZGKA 3L2HA 3J8F1 1GANA 3AVRA 2BVVA 5E89A 2W47A 4A3XA 5IVFA 4WVZA 4F83A 4D7TA 2VNGA 3U37A 4GKYA 4CP9A 1GNHA 2HEYF 5FMOL 1V6IA 1ODMA 1RVF3 3LDKA 3LKJA 3VL9A 1U5YA 1J3QA 3ON7A 5C5TA 4QPGC 2XH6A 3B01A 2D5HA 3OEAA 2X5IB 4GMP1 4O65A 1BHGA 3P3PA 5BNPC 2QQPA 3KF5A 4W4ZA 5JDBA 2RR12 4HKOA 1UAIA 1UY0A 3SNMA 4GZ9A 4EV0A 1XSQA 5A3NA 4QGMA 5EFUA 1IGOA 3SC7X 2VVDA 3BTXA 5CKNA 4GD4A 4S2DA 3J26N 4NWVA 4ZU4A 2Y60A 1DZRA 1CZVA 2HWD2 4TXWA 1YQ6A 5F5AA 2GC1A 5FXZA 1N3QA 3T09A 2VMIA 4GA9A 4QKNA 4CPBA 4E4DX 1K12A 1NXD1 4R4XA 4IERA 4P14A 4QXHA 5H9QA 4D7SA 3D0JA 1WBLA 1XE8A 1STMA 1OA2A 1WLDA 3T1LA 5LBEA 1GNZA 2DVFA 1WLCA 4JGYC 4IE6A 2VD7A 2GDFA
chains in the Genus database with same CATH topology
1MQTC 4P9IA 3U07A 4J1WA 1PMIA 3TN91 1DGRA 3LAGA 2RS11 1H4HA 1G6NA 5CBLA 4NOTA 3DPRB 5CFCC 2UWBA 4Y1VA 2P37A 2NN8A 5J7MA 4I30A 4I02A 4FAGA 1AR71 2ET7A 1QQP1 1XYPA 2JE9A 1YFXA 3VZJA 2ENRA 3VLBB 5K0UB 4RS5C 1QJX2 3B00A 5CNAA 3UJOA 1AYM1 1Z7S3 2SLIA 4LHNA 1QGLA 5JWPA 2AZ5A 4NN0A 3I59B 1ZNPA 4EN6B 2MNGA 1AR82 2MEV3 1GZ9A 1LOFA 1PO11 2D3RA 2YZ4A 4AEDA 5FOBB 5JPMB 2DTYA 1HXS1 2BPA2 4XHXA 3KGLA 4XW3A 2E7AA 1RHI2 4PDWB 1LTEA 2VUJA 2E7QA 2WA3A 4TSVA 4ES8A 4OI0A 3AM2A 3M4FA 3E5XA 4OLLA 5GLWA 4Z82A 4AEJA 2BBVA 2XJUA 3VBOC 1ND3B 4IL7A 1YXWA 4E27A 4C90A 1TMF2 1PM7A 1F8VA 4HPKA 4XOGA 4Z07A 3PJYA 4JDOA 4YG0A 1SLIA 1UPIA 3RPQA 4D94A 4C1XA 2PYTA 3ST7A 5C8CC 3USUA 3IT8A 5JAXA 4DPNA 3HAGA 1W39A 3ZMOA 4QQHA 4OHZA 3MZHA 4COVA 1DYKA 1CONA 4YW5A 2DURA 2RS53 4B4RA 3FJSA 4HN1A 1PK6A 1LODA 1SQ4A 4M00A 4Q2FA 5CVRA 4Z8BA 2RM23 4N9HA 3OD4A 3ECQA 3V56A 4PBPA 2BUKA 2Q1MA 3FMGA 2HWE2 3NV1A 3IDEA 1Q8OA 3WZ1A 4OI2A 1PK6C 3ATGA 3VDDB 2HEWF 4RR3C 2ZZJA 2GN3A 2HJIA 1MZ5A 1N1YA 3N7KA 1FI2A 1HRI2 3E6CC 1MQTB 4LBMA 4FPJA 1VP6A 3CO2A 1CD3G 1LOAA 3ZXGA 1VAVA 1G9AA 3HR9A 3CJIB 2WS93 1KDMA 4M3CA 4IEVA 4TZDA 2DVDA 4GULA 1WGPA 5JOYA 5CFCB 1A8MA 1DG6A 1ZREA 2N7GA 2ZX2A 5AC93 4KWJA 1KDKA 4LHKA 5DZEA 1O91A 4FPLA 4YZ3A 1I5ZA 4CRQA 1CPMA 2WC2A 3WHUA 5CFDB 2AYHA 4LO8A 2GNBA 4YVSA 5KXCA 2TNFA 4I01A 5L7OA 2CTVA 1SEFA 2EVXA 2WLPA 3VBRA 5FOJB 1ZYBA 2D93A 5D1IA 4CEWC 5JCTA 2ZMNA 1QNYA 3TNQA 5BNOB 1YIPA 2YGLA 2ZAAA 4JGZA 1UCXA 3OBTA 4CZSA 3MGUA 3S30A 4MX3A 1CQ9A 4M0NA 4EJRA 2BW8A 2XGXA 1VB2A 1YI9A 1KJRA 3ZYGA 4AEDC 4B4QA 5AFBA 5T3NA 2AENA 5KHKA 3KGZA 2A73B 1VBD3 3JCIA 5I8SA 2IWGB 3KMHA 3MPPG 1CVNA 1GLHA 2YPJA 4F8AA 3ZSMA 2WS91 1LESA 4Q4X2 2G9FA 5FREA 4COWA 2NMOA 2Q1ZB 3KT1A 1NY72 4I3GA 1T6GC 4YG6A 3GNEA 3KCCA 1DDLA 4OVEA 3JB4C 1Q5OA 3MIEA 3VUOA 3NKGA 4FOYA 4Y1XA 1VBD1 4P9XA 4YVWB 4C0HA 3I2DA 5ABJA 1V70A 4LT5A 3V65A 1B35B 1K5MA 5B2GB 2QUOA 4XILA 1Z0HA 1D4M1 1OPOA 4PF5A 1GKBA 4PIZA 2K2SA 1SBDA 4FCAA 1NLSA 2MEV2 5BNNB 1ENRA 4E4SA 2B39A 1O3QA 2B5HA 2D6LX 3TWIA 2B42B 4BH9A 1VBE3 2YYOA 2JG8B 1RUG1 1CAVB 1VLNA 4XBNA 1PO21 3NV4A 2CL2A 2OA2A 3WCRA 1YJKA 2JJ6A 1J3RA 2VVFA 1V9U3 3M2MA 1R093 5ABJC 2QVSB 3O0XA 4X8NA 4CDQA 3N4MA 3VBUC 3AZZA 2VW1A 3H0OA 4AHZA 4FPCA 1W6PA 3WG1A 2RS31 5A32B 1AVBA 1H8TB 1LGNA 2BTVC 2FZ1A 3NVCA 4KU7A 4B29A 2RR11 1S0CA 3VKNA 1LOBA 3AB0A 1YO8A 4MLOA 3J4UH 4XFAA 3AYEA 1W0OA 4OFGA 1Q8PA 1SLTA 4HK9A 3T1MA 2DCZA 1HRV2 1CAWB 2PTMA 4N7UA 3VV1A 3HWJA 2Z69A 4PIYA 3HMYA 3ZDSA 4IV1A 5C4WB 3ZSKA 1C3HA 1MEC1 1S1AA 3KT7A 4ASMB 4E2GA 1FATA 1AL21 2XVGA 3POYA 3ZXEA 1GYKA 1VBC1 3DPRC 3NV3A 4CDUA 1QDOA 3ZXJA 1BZWA 2WL1A 1FPN2 1PHMA 2AREA 1C8M2 1H8VA 1PVC2 1EYBA 1RUH3 1RJ8A 2A3XA 5DG1A 4GIQA 1NCQA 1PGL1 3HT2A 4LUKA 2XWJB 5JOXA 4XBQA 4WZCA 4HT1T 4E9KA 5AVAA 1D4VB 1RUJ1 2JE7A 4OI1A 1DU3D 3ILNA 5K9YA 2WT1A 1W6MB 4XJAA 2ZAHA 4FPOB 4XJUA 3B7MA 3W59A 1ND2A 2GH2A 2K0GA 2R063 1WCKA 1PZ8A 3OYWA 5EJ3A 3SMHA 3ZVXA 1PZ7A 2VMHA 4COYA 4YZ2A 4GMP0 3AMPA 4HN0A 4YZ4A 2V5YA 2XLFA 5JVVA 5LRRA 1A78A 4K20A 4UW4A 4E2SA 1DF0A 4Q27A 1LEDA 1I9RA 2DU0A 3B3QE 4LBJA 4XJ9A 2GMPA 3BOPA 2JICA 3M3CA 5FLIA 1HRV3 4OHXA 2DWRA 4FPHA 5FRAA 4CEYA 2R16A 5FTTC 1Z7S1 5JOZA 4K8FA 4WVVA 1ZBA1 4YW3A 2DVGA 3NAPC 2WZPP 4AQ6A 3JD73 1PIV1 4C91A 4GB33 5C8CA 1GBGA 1SLLA 1SLCA 3I4IA 4XF1A 4BE3A 1G9BA 3RJ2X 2NZ9A 4HKWA 4JRAA 4QQLA 1DBNA 2RS33 2NQYA 3OGGA 2Z42A 2XJQA 3HIFA 1ZBA2 2ES3A 4EN8B 3RDIA 3DV8A 1ZX5A 1WW6A 4XZPA 4LA3A 1QOSA 2OZJA 3VBUA 4AYUA 1XNKA 1PGSA 2DUPA 2O0OA 3KS7A 2A6VA 4KBBA 1LCLA 4CP0A 3JQWA 3AMHA 4TLFA 4Q4V1 4BWOA 4LE4A 2NPIA 4AHYA 2Q4SA 1HV0A 3NL1A 1H1IA 2EXHA 2PLV2 1VJ2A 4EN0A 1AR91 2NYYA 4XQDA 5GALA 2XL9A 3MIGA 1IS5A 1QJX3 2CAVA 3VBHB 2A6YA 3D6EA 5KWRA 2RM22 3NW4A 4QQPA 5FBZA 5JZGC 4KWKA 1RUE2 5IK7A 1NQDA 2ZHLA 2XUMA 3MPBA 2ZGNA 3WY6A 3WDWA 2EF6A 1KS4A 4XFFA 3PNAA 5BNOC 3JQXA 3NWKA 2ZGQA 1C8NA 3J8F3 1PIV2 3WQ7A 2IXJA 4K40A 1PNFA 1J1LA 5GZDA 1W6MA 1UIJA 2DFCA 2GAUA 3HBZA 4OUMA 1IZ3A 3VBFC 4AE2A 1NOVA 3POSA 1V6OA 5I93A 1JHNA 4Q8LA 3VKMA 1NCQB 1W6OB 3U10A 3OD0A 1A8DA 4DOUA 4AI1A 1YIFA 4GWMA 1PNGA 2ZBJA 1Y3TA 5J37A 4CDUB 1VBA2 4LO6B 3IBMA 4D69A 4GWNA 1M06G 2R041 4U2AA 1C8M1 3MW4A 2ET1A 5CG9A 3VBRC 5DDJ3 4WVWA 3ZXKA 4EN7B 2DCYA 2EXIA 1DGRN 4ISQA 4YGDA 5GLVA 1CAUA 3M70A 1CAWA 1AF9A 5A33A 1QNWA 1LU2A 2Z5WA 2ZKLA 1VR3A 4HANA 1QOOA 3RQ0A 2YUEA 2GMEA 2HWE3 4FPKA 4H55A 5ACA1 2UWAA 1UW8A 5A32A 1Q43A 2X53S 3VHRA 1W6PB 3VZLA 5LEJA 5H9RA 4BIFA 1POV1 2D97A 4HFSA 1C28A 3O14A 2VUAA 4LLOA 5JIAA 2UYBA 2ZJCA 4YM3A 4N53C 4WM8A 1IQAA 1NE6A 3SH3A 2IXKA 1EV13 3B93A 5SV8A 5E16A 2WZR3 2JG8A 4KQ7A 4ATFA 1G7YA 1V00A 3K51A 4LLFA 3WVJA 1AXKA 3WT3A 4Q4W1 1D4M2 1S0GA 4UW6A 1RUI2 1VBE1 1S0JA 2EA7A 1YFWA 3QACA 3FWEA 1FNYA 1SBEA 4LO5B 3WDYA 3WQ0A 1NA1C 5BNNA 3JU9A 4Y1YA 5I0UA 1DFQA 3MYXA 4ATEA 2E7TA 4FAHA 5F9TA 4XXPA 1BBT2 1VRH3 1RUI1 1VBE2 3A4UA 1K5MB 1B35A 4BOWA 4HETA 4P9GA 4RGGA 3MIFA 5EXOA 3RG0A 3K48A 4RHV3 1MZFA 2EALA 3VZOA 3OGJA 4AVVA 3HT1A 3ME2A 4FO9A 4XQ4A 2JECA 1XE7A 4R9BA 3NJZA 4Y1UA 1XNCA 1UIKA 2XJVA 3UKVA 4DNYA 1LHVA 4NVPA 3EHKA 1S0DA 5H9SA 4WM7B 2QCSB 1LRHA 2HWC2 3JBG1 4FTBA 3MLKA 3TB0A 1WW4A 3MLJA 4AFMA 3WDVA 5D8AC 1OQDA 3ILRA 5C4WC 4XF4A 4H14A 4MXVA 3SH4A 4PDWC 4AFDA 4K21A 3ZYIB 1N47A 3V0AA 3AMNA 2O8QA 1GQHA 2DCJA 3NV2A 4FOWA 3MW3A 4QMAA 5BNOA 1BK1A 1AR93 3C3VA 4WZFA 4XPVA 3AFGA 4YNIA 3VBRB 2R042 3CF6E 1WUVA 4FP2A 4R9DA 1FPN3 5L7OB 2R6QA 3AYAA 2PHDA 1HKDA 1VBB1 2DYCA 5CFDA 2PLV1 5CFDC 1EV11 1FOD2 1RUD2 2AUYA 4QM8A 4AF9A 1B09A 3KLSA 2PN5A 3WX5A 1IS6A 2RS13 3ALQA 3RYPA 3WLUA 1OSGA 3BALA 4R52A 3P3NA 4W6YA 5CFCA 4WVMA 4Q0VA 2GZWA 1R092 2OUJA 4UBGA 1M4WA 3M8LA 1X33A 4AHWA 4K7JA 1CGPA 2CWSA 4M3CB 1RUF2 4MVTA 4LBQB 4OZXA 4META 1G9FA 4QU2A 4GH4C 4QQ2A 3TOJA 5IK8A 4XYXA 1MQTA 4GB31 2XBO2 3VDDA 3DL3A 5I0RA 3DGTA 1O4YA 1FMD1 4GALA 1RIRA 2ZHMA 5DXDA 3LZZA 1RUG3 1ULFA 1PK6B 2RM21 4LBOA 3AX4A 3KZ4C 1O4TA 3KM5A 2IC1A 5KHJA 2GNMA 2XKOA 2PAMA 4FQZA 4DY3A 4N90A 1ZZBA 4OI4A 2QJVA 3USSA 3ZFGA 2C5DA 1F5FA 1B35C 1KFUL 4Y20A 1I3HA 1WMFA 1TMF1 2XVKA 3LA3A 3USUB 2EIGA 1Y9QA 4IV3A 4K1ZA 5T54A 1DGWA 2QE3A 4N43C 1DIWA 5F6KA 2A7AA 2D5FA 4HPKB 4K3UA 1V6MA 3CLPA 1MR5A 5ACA3 1UZZA 1ASJ2 5FQ0A 1RUF1 1ZZ6A 2A6ZA 2JKBA 4XJ8A 4AQ2A 2P34A 5JSPA 3E6BA 4XF9A 3WNXA 3R4UA 4YGEA 2CY6A 5CADA 3D82A 2HWF2 2XLAA 4QX5A 1WD4A 1C1FA 1SDWA 4FTEA 3KB5A 1RMU1 1QJY1 2WA4A 3EBRA 3MLLA 1DQ0A 3N36A 1RUF3 3M3EA 4YGCA 4NHMA 4GKXA 1PGL2 3CL1A 3ZXFA 4DMIA 2DV9A 4GMP3 2KA3A 3VBHC 5FO8B 1JYIA 3I59A 2H6CA 4EN9B 4KH9A 1AL23 1JUHA 5GZEA 2IFRA 1O3TA 4KGQA 3M7AA 5K0UA 4O9EA 1OOPB 2RS12 4HVRA 4Y24A 4QXKA 3INAA 5FMOS 1DGLA 5HCFA 1R083 2FMYA 2ZX1A 3PHMA 1H1MA 2DUOA 2XB6C 3DPRA 2RMU3 4BQ1A 1AYN3 3N7JA 2A3YA 3T2TA 4TWTA 3ZIWA 5F5QA 4NWWA 4C1WA 3IIAA 4FT8A 4LR4A 5T5JA 1XXNA 2IXLA 4IV1C 2VOKA 1NCRB 1EAH2 3LA2A 4JDMA 4MUVA 1A6CA 2RS32 1JXNA 4Y22A 1DLLA 5L19A 1KJLA 1YLLA 3B69A 4AI2A 1R1A1 1LHUA 3O12A 4CDXC 2HWC1 4Q4X3 3MIHA 1IHMA 2WJSA 4G9SB 2CGNA 5TSWA 5DG2A 2D43A 4RD7A 4XQWA 1ZZ7A 2VY0A 3L2YA 5T5PA 3B5LB 3RS6A 4DINB 2OVUA 3ZFGC 3JUUA 2XWBB 1UU6A 4H3WA 4IEZA 3LB9A 3RMXA 1OHFA 4K6BA 4RQPA 1OQ1A 4I09A 2WIIB 2X5IA 4I3PA 3EQEA 5JZGA 1H8TC 1H2KA 4AI0A 1FOD3 4FPEA 1O3RA 1LU1A 4Q0PA 4Q4Y3 2Q30A 3CJXA 4IXLA 1ULGA 1AHSA 4XJWA 4Q4Y2 1ZZ9A 3BB6A 3L9JT 3AK0A 2R0FA 2E51A 3ASIA 4PLOA 1OD5A 1S0BA 1V6LA 3H50A 4MYEA 5L73A 4CDWB 1OA4A 4F7ZA 4LBKA 3J8F2 1QH7A 3AZWA 4ONUA 2P3KA 3AXEA 4YGBA 1RMU3 5C9AA 4LNVA 1FMD3 2BYVE 4DRVA 1S0FA 3AKSA 2WNVB 1TME3 2R1BA 2HEVF 3AMMA 1UPSA 4RR3B 5CIRA 3IN9A 1AX0A 1RVF2 3NAPA 3AYCA 4IEPA 1WW5A 1VAMA 3ZMNA 3THTA 2WT2A 4CEWB 2CAUA 1WCDJ 4UBHA 3JD72 4CEYC 2D6PA 4DB5A 3WDXA 5T5OA 2QZ3A 4JGZC 3ROUA 5EYXA 1RGSA 3WUDA 3VBSB 4EWAA 1X8EA 2UY9A 4QHBA 2Q8OA 3AP7A 3UJQA 5BV6A 5J98B 2ZPXA 5L7OC 4FP3A 4K9SA 1CAXA 4IEOA 4XJZA 1MEC3 2BFUL 2JENA 5C6CA 4E2QA 3QCWA 2HWC3 4Q4X1 4SLIA 2RJKA 4B3NA 4CDXB 4HZFA 1DGWX 1POV0 2HWF3 2OPKA 3OTFA 1JBCA 2PELA 3SHRA 2ZACA 4BZ4A 3AZYA 4E4ZA 1J1TA 4QT6A 3AP4A 2WSUA 2FQPA 3W58A 4FPFA 4YFZA 1ZVFA 1AR92 3V0BB 3BIWE 3UKTA 4AG4A 2PHXA 1QF3A 4CYDA 2OZ6A 2IXHA 3DUIA 1URXA 5HCAA 1SFYA 3KCXA 1AXYA 1KRIA 3O0WA 4NHKA 4Y4YA 1AR61 3ZO0B 1OFSA 4IEXA 2EAKA 1NQJA 1AR63 1R1ZA 4PCRA 4AGVA 2VOXA 4BCUA 1RINA 4JC1A 3V64A 1AYN2 2ZGSA 3EJKA 2ZOEB 4N53A 1LGBA 4Q1RA 4YSFA 3JBG3 2JX9A 4JDNA 3ILFA 3R0RA 1FT9A 3OY8B 2D6OX 5BNQA 1NXMA 4M01A 1ULDA 5FFOC 3GYDA 2DUQA 4GB32 2VOVA 2WSVA 2K9ZA 3SISA 4YW2A 1N1TA 1BEV3 3NO8A 4S2GA 1BEV1 3MFCA 1QHDA 5JI7A 4XMIA 2PAKA 4FVVA 3PVEA 5DUUA 3RI9A 5JOWA 1SMVA 4QD2A 1AJKA 1JH5A 1X82A 1CPNA 5IK5A 2WFPA 3PVBB 1YWKA 4N53B 2H0VA 2VMGA 2LUWA 3MIDA 2B45X 2QDRA 4URTA 1N3OA 1EV12 1FOD1 4JCKA 4N43B 1VBB2 1AZDA 2ZX3A 1CR7A 3QLQA 3LSEA 3WP3A 1V6KA 3M3OA 5T55A 3LWCA 5FO9B 1YUDA 4OULA 4XFIA 1EP0A 4SBVA 5A3LA 3VBFB 1AR72 5AFEA 1UX6A 4B4PA 3V0BA 3FC0A 5BUVA 2TEPA 3TN93 4GH4A 1JYCA 2BQPA 1HV1A 1K5MC 2Q0AA 2RHPA 4O9GA 2B7YA 3R05A 5GJ6A 5JSRA 1QU0A 2BFUS 2D3SA 3RRDA 3N3HA 5GLTA 2GN7A 4DXZA 5GZFA 5E88A 1KITA 1TME1 4BPZA 3OBRA 1U0AA 4P9LA 3JBG2 4XHBA 4XDQA 3BODA 3M3IA 4MH0E 2VW2A 1X36A 2BNNA 5AC92 5KC6A 1CN1A 2DVAA 2BWAA 3MF6A 1UMZA 3AFKA 2IXIA 1SBFA 1PO12 4LBQD 1VBC2 2GNDA 3ZYRA 4XFGA 4YYOA 4L97A 1BVVA 4QM9A 5JI9A 3FBMA 3VBSA 1Q56A 1S0IA 2VNRA 3G6JB 1VB4A 4N7IA 2VU9A 1H0BA 3KQRA 4CTEA 2JG9C 2ZGLA 4RFT0 2ILMA 1FPN1 1DQ6A 4CEWA 1QMJA 1QJU2 1ENQA 4FOQA 3ZIXA 1C8M3 1C1LA 3NAPB 1BMV1 5D8AA 3D5OA 1YRZA 3LOBA 4Q4W2 2PAEA 2EXKA 3HN1A 5DDJ2 5IK4A 4Y26A 4R8HA 2FZ2A 3AJZA 4HVOA 2IXCA 4YARA 1W6NA 2DVBA 2XJSA 5CB7A 1JN2P 5C9AB 5T52A 5J36A 1HX6A 1YHFA 4NR1A 5E8AA 4YG3A 5E1RA 1EPZA 1HQNA 1RITA 4CDWC 2WWSA 1WMEA 2UWCA 1LHWA 2WFF2 1I1EA 4AI8A 1W6QA 3X29B 3RJRA 2ETEA 4PIXA 1ZZCA 5FAXA 3VHPA 1EAH1 2FBEA 1YNAA 3WCSA 3SLIA 4ISRA 4OHWA 1ULEA 4Q4Y1 2ZABA 1ZBE2 2WNEA 1NG0A 2JG8C 4LBLA 2YXSA 1RUI3 5JZGB 5EZWA 4YW4A 4AVTA 4X8PA 2A5ZA 1VBC3 3E5QA 4RQPB 4WM8C 2MEV1 4LTAA 1KQRA 4B8EA 1E57A 4P9JA 1FV2A 1JUIA 1QXRA 1MS8A 2H6BA 5DZFA 5H9PA 1Q8QA 1R082 1NY71 2X29A 1ZRDA 1J59A 2JD4A 3PMSA 3S0MA 1S2KA 3A0NA 4EROA 1WLWA 1G8WA 4HLTA 1VBD2 1UU5A 4JRLA 5IT6A 4H7MA 1Z78A 4P9WA 3IKWA 1Q3EA 2P3JA 3E6DA 5JIUA 1MS4A 2ZMKA 4Y22B 1QJY2 1UZYA 4GQ7A 2PHFA 2YGMA 1TME2 1D2SA 1R1A2 1NCRA 1MACA 3FLRA 3ZFFA 1QJZA 3FX3A 1SCSA 3I7DA 1TEIA 2RS51 5BYNA 2ZGPA 1DQ4A 2RMU1 4DFSA 3IPVB 3ES4A 1QQP3 1COV3 1CIWA 2F6BA 2JG9B 1JOJA 5DUWA 5GKAC 3J9SA 4S2HA 4BM8A 3VBSC 5BY5A 5HI0A 1XRUA 2CGPA 1PIV3 3FE5A 4Z2WA 1VBB3 4QGNA 1OOPA 2VVEA 1LOFC 1X50A 3RI8A 2C9AA 1OLRA 3E5UA 1DHKB 3VBOB 1IKQA 5FLJA 1TMF3 1PVC3 3PVNA 4BYYA 3AXDA 3R4SA 1J58A 2ZGOA 2WINB 2R061 3N7MA 4XMAA 2LALA 5IUQA 2ZGTA 3FFQA 1QKQA 3D0SA 3AKTA 1RUD3 2V73A 1W0PA 3NSTA 4BMEA 1OKQA 3AP5A 1Y43B 2AGSA 1LOGA 2QKDA 4AHXA 1LR5A 5KHHA 1IPJA 4LUMA 1RB8G 2W39A 4QPIC 3VN4A 2CV6A 1FV3A 3WP6A 1OQEA 1XU1A 3H7YA 1AL0G 2OIIA 4JGYA 1OPMA 1LOEA 1HXS3 2PHUA 3AP9A 1RC6A 5FQ0B 3ACLA 4AFCA 1PO13 2VQ0A 2XBO3 2TUNA 4FPGA 4COUA 2PHLA 1HRI3 5F1RA 3EO6A 4LA2A 1LKNA 1F5JA 1VRH2 4IV3B 1R091 3QBQA 2OUHA 1U12A 4Y20B 3GZTB 2Y26A 4YM1A 3ZFGB 3TYJA 3AKQA 4QPIA 3CJIC 3FHIB 1EAH3 1LEMA 1DQ5A 4Q4V2 5T50A 4AGGA 4Q4W3 4L9BA 5KXEA 1EPWA 4AI3A 4Q4V3 1XYOA 5I8TA 3MEPA 2I2SA 1D2QA 2Y0OA 2IFWA 2VECA 1NA1B 4EWEA 1QJY3 2DCKA 2DTWA 4QGLA 4QPGB 4PJYA 4EWDA 4LULA 1QOTA 1BEV2 2GMMA 1PGW1 5BNPB 3VZNA 4H7LA 5FCCA 4HSJA 4LBQA 1RHI3 2XPJA 2VOWA 1XU2A 1YFUA 2RR13 2DF7A 3VKLA 4W6XA 4WVMB 2GC3A 3ENRA 2WNUB 5DUVA 3B9CA 1D0HA 1GQGA 4HL0A 5LK5A 4DZGA 1Z7S2 1AYN1 4BA6A 1V9U1 4MZUA 3KD4A 2PLV3 1FAYA 3U4XA 4WM7C 3PLQA 3TAYA 3KCYA 1ZBE3 2D3PA 3H7JA 3DN7A 4IEYA 3BCWA 2R30A 1HXS2 1WD3A 3UV9A 1F9KA 2XJPA 1ZRRA 3QH6A 4L2NA 1GZWA 3O0VA 3M3QA 3ZFEB 3SH5A 5K7PA 2XL7A 3ZXAC 3IMNA 3TN92 4X6QB 1DQ2A 4DS0A 3V0AB 3WV6A 3WP5A 2VXRA 1HIXA 3E97A 3GALA 1WBFA 4Q0UA 1ZBE1 3IDCB 1S2BA 1OI6A 4BIOA 2AR6A 5I0TA 3KSCA 1CJDA 3ZYJB 4RS5B 3CU7A 3ZN6A 2A6XA 2MHFA 1UKRA 3ZX7A 4MXWB 2HYKA 5I8YA 3B94A 2RJLA 2W0XA 3IM0A 1TNFA 4WM7A 4U36A 2HWD1 2PFWA 4AGRA 1MS0A 4AQSA 1NLRA 4XTPA 1V6JA 5DZGA 1REDA 3GHNA 4CDUC 2QNKA 5FLHA 4FSJA 2GC2A 1BBT1 4HBNA 2F4PA 1S55A 1AXZA 1TQ5A 2MPFA 2YHJA 1A3KA 1SCRA 1QDCA 2EAAA 3TNPB 1XQNA 3WG2A 1ND3C 1O5LA 5DDJ1 2WLQA 3WXPA 4V1PA 2WT0A 4R4ZA 1MEC2 4AQTA 2E6VA 4LO4B 5K8SA 2D6KA 1ZZ8A 4XIOA 3VHOA 1RUE3 2W08A 1LHNA 1RJ7A 5DUXA 1ULCA 2WZR1 1QJU1 2OYZA 2NP0A 4IEQA 1OFNA 1GV9A 3GBWA 3QH7A 2R072 5HCBA 1LJ7A 3S7IA 1RL3A 5SV5A 2ZMLA 2VULA 2VH9A 4WM8B 1HQLA 1H9WA 1BJQA 2KM2A 4HVQA 3OPZA 4A7KA 2BVBA 1ZRCA 4KL1A 1FXZA 2ATFA 5T5LA 2R1DA 4WV8A 1V6NA 2BNMA 4JTOA 4Q26A 1HQWA 4OHVA 3SXWA 3GBGA 5JSOA 1AX1A 3JZVA 4ZU5A 5FO7B 1O3SA 5A33B 1RUG2 4X6RB 1CAUB 3CNAA 2JXAA 4MXWA 2X5IC 2FMDA 3WQ1A 3ZN6B 4RS5A 4KG8A 1LOCA 1H2LA 2Y0IA 3BPZA 4KNCA 3ZSJA 4K1YA 3FUOA 1RUNA 4N9IA 2I74A 1XNBA 1RUC2 4A7ZA 3ZN5A 4MGIE 5KBFA 5KC5A 4AW7A 2ZGUA 4FPYA 3FFZA 4PLNA 3ZFEA 1IPKA 4CP1A 1GZWB 3VHNA 1W6OA 3BU7A 1UD1A 3GZAA 1SFNA 5JMCA 5JLVA 4AVAA 2VNOA 2B8MA 1OOPC 3BOWA 5I0SA 1S0EA 2WNUA 4YZ1A