3WQ7A

New crystal form of the hyperthermophilic family 12 endo-cellulase from pyrococcus furiosus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
b'KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title A new crystal form of a hyperthermophilic endocellulase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 74
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq7A00
1H4GA 1HIXA 1KS4A 3AKSA 4NPRA 1XNDA 2QZ3A 1BCXA 2BWCA 1TE1B 2D98A 2DFCA 3VHOA 1PVXA 4S2GA 2BWAA 2DCZA 3M4FA 3O7OA 3VGIA 1H1AA 4S2HA 3VZKA 1REDA 3VL9A 3VZOA 1M4WA 1XNCA 1UU4A 3RI9A 3B5LB 5K7PA 3VZMA 3WXPA 5HXVA 3AMNA 4HK8A 3VZNA 1XNBA 3AKTA 2JICA 2BVVA 4XQDA 3WP6A 1HV0A 1QH7A 3ZSEA 3MF9A 3VZLA 1BVVA 2B46X 1OA3A 1T6GC 2VULA 2B45X 3LGRA 4XQ4A 1OLQA 4HKWA 2JENA 4XQWA 1REFA 5K9YA 3AKRA 4HKOA 2BW8A 2DCJA 1REEA 4IXLA 3LB9A 4HK9A 1AXKA 1XYPA 3AMQA 1W2UA 1OA2A 1IGOA 1H0BA 1NLRA 4S2FA 4XPVA 3VZJA 3WT3A 2JEMA 1UU5A 3WX5A 3WQ0A 3MFCA 3WP5A 1OLRA 2VGDA 1ENXA 3WQ1A 3AMHA 2F6BA 1QH6A 1UU6A 1UKRA 3VLBB 2QZ2A 1H4HA 5EJ3A 2VUJA 1H8VA 1XXNA 2C1FA 3WP3A 1HV1A 3WP4A 3AKQA 1XYNA 3AKPA 2Z79A 1YNAA 4HKLA 3WQ7A 1BK1A 1KS5A 3WR0A 3MFAA 3HD8B 2B42B 1OA4A 3AMPA 4H7MA 2DCKA 3RI8A 3VHPA 3AMMA 3EXUA 3VHNA 1C5IA 3MF6A 2NLRA 2D97A 1XYOA 1C5HA 2NQYA 3B7MA 2VG9A 1F5JA 1XNKA 3VL8A 2DFBA 4S2DA 2DCYA 3WY6A
chains in the Genus database with same CATH superfamily
1RUC1 1JOBA 1WCSA 2XJQA 3MBWA 2R073 4HN0A 5FFOC 3TYJA 1I5ZA 4QQHA 2DFCA 3CJIB 2ZMLA 2XQXA 4IV3A 4F3JA 5A70A 3A23A 4A7ZA 3VHOA 4ZY9A 3P3NA 3CL1A 3PVOA 4N7IA 5A3UA 3C7HA 1XSQA 1YJKA 4G3YC 3F95A 4YFZA 1ASJ2 4RGAA 1RGSA 2TNFA 1C8M2 3FBMA 5GLVA 3U14A 5E6HA 1ULFA 3H7YA 1S0GA 1AL22 3E5QA 3OF1A 4CP2A 1W6QA 3MUZ1 5C8CB 3ZXEA 3TNPB 1AYN2 2PHUA 1RUE2 5J48A 2WUHA 1OVPA 3N36A 1G9BA 5DXDA 2B8MA 1VR3A 2UYAA 2JXAA 3AJYA 2TUNA 3ABZA 3H42B 4QPGC 3N4MA 3H3LA 4IV1A 2VUAA 1IS6A 2RJKA 2BJSA 3I59A 3IN9A 1CAWA 1ZZ8A 3OBTA 3OOXA 4FFFA 4D69A 4B8EA 2MEV3 4PQ9A 2IFRA 3FUQA 4H55A 4XZUG 5DAQA 5I8YA 2V72A 3W9AA 2BUKA 5FZ3A 2WNUC 4AQTA 1LOAA 1W9FA 1RUG3 3GZEA 3UK9A 3ZFFC 1YC61 3DYPA 4HKWA 2CL2A 1NKGA 2BV4A 4COWA 4MYEA 1QIQA 2VUCA 5F2SA 1S0IA 4JCKA 2OKXA 4XFFA 3BGAA 3WCSA 5JXHA 3VBFA 4FQ4A 4RQPB 1DQ2A 4PF5A 2ORZA 1AXKA 2K46A 3Q8AA 2ARCA 5DAPA 1CZTA 3DCQA 1SFYA 3ACIA 3KB5A 3LEIA 4XCBA 4AEDA 2XVKA 1LHVA 1IS3A 1PO12 3ZSKA 5FYSA 2FDKA 1MEC2 5A3NA 5I0DA 2H6CA 1SCRA 3MIGA 2RMU1 3AP6A 1AUYA 5K0UB 4JAAA 4Q4W1 4N43C 5I91A 3M70A 2X8KA 5GM0A 3UETA 4DRVA 3K4AA 1JXNA 1JHNA 4HXCA 4BQ2A 1J58A 1VBE1 2E51A 4LPLA 4FO9A 1UKRA 1OPOA 3DV8A 2DVDA 1H4HA 4JDOA 5FY8A 1XE7A 4Y5TA 3RZZA 3WW2A 1Q56A 4QDSA 5FKCA 2VCBA 2Y38A 3ZFEC 1DQ0A 4YG0A 1N1VA 2VQTA 1Y7BA 4QQ2A 5FZEA 2G1MA 3I54A 3K2OA 3ETQA 1BHGA 2WNVC 1W3VA 5DUWA 4YW5A 3AK0A 2BQPA 3KWVA 1JYWA 4FBFA 1W6PA 1LECA 4IQPA 4AI1A 2QQKA 1LOFC 3AL6A 3BCWA 2QCSB 2ZGQA 1ODNA 3OTFA 3I2FA 4OVEA 5FPUA 1S4CA 4ZXEA 5IAVA 2JG9C 3QLQA 3MF6A 3MIHA 5FZ6A 5T50A 2A6YA 5E8AA 3THDA 1WW6A 4UT5A 5BPXA 3D4KA 1C5HA 1PIV1 4FPFA 2HWE2 1VBD2 2WSVA 1XE8A 2JD9A 3ASIA 1XJAA 2WSUA 4OZXA 5F5IA 1F15A 2DBIA 3AB0A 4BDVB 1LRHA 1SPPB 4Q27A 1WD4A 1RUI1 1NG0A 2W95A 5FZ7A 3GZUC 4URAA 3ZX7A 1TE1B 1OUXA 3MPPG 3HIFA 4B3NA 1WLTA 2O8OA 2H6BA 1WCUA 3ZYFA 3T2TA 4C1WA 3B93A 1SQ4A 2BWAA 3GHNA 1OQEA 4NHMA 4ZPIA 4NE9A 3RWKX 5GALA 3UT0A 5A33A 2QQMA 3ZKYA 2MHFA 4PI0A 2BBAA 1HRV3 2YYOA 4GALA 4LBNA 2BERA 2W9XA 1DG6A 5A7WB 2IXIA 1GOFA 1COV2 1Y9QA 3MW3A 3BN6A 1FX5A 3PHMA 4K7JA 1DZQA 4DUVA 4O7XA 1JI6A 1PZ7A 1JHJA 1XB9A 2A6ZA 1AYM2 5LK7B 2XGXA 1YFYA 3T2PA 1MQTA 2W3JA 3NV3A 3ELNA 3P6BA 5CYYA 5FCCA 5AVAA 4BHPA 1H1MA 1QQP3 1VBB3 2OA2A 3HBZA 5FZ1A 1BEV1 4XQDA 2GSYA 3ILNA 4NHYA 1JZ8A 1QH7A 5KHIA 2YZ4A 4MHUA 3Q9OA 4BLIA 2RM21 5FMOL 4Q26A 4HOOA 2OUJA 4MGYE 2E63A 2C26A 4J1XA 1OF4A 2ARAA 4KGQA 3SLIA 4XF9A 2B45X 3OBRA 3U4SA 1FOD3 1N3OA 4FVVA 5B4NA 4XQWA 5CNAA 3T09A 2AH2A 5F3EA 3VD4A 3SQOA 2JDYA 2W08A 1O7FA 4B7KA 1UQXA 1HDKA 3H3ZA 5A3LA 2WYSA 4FPYA 5KXDA 1C1FA 1C8NA 4OI2A 2WN3A 3HT2A 2HYXA 2WC2A 4XPVA 4IEVA 3WG4A 3JBG1 3POBA 5C5TA 2FCVA 2QQPA 5FYHA 2A7AA 4DRRA 1WMEA 1YFXA 1OLRA 3MO4A 4KNCA 3HN1A 4AL9A 4XUNA 4QGLA 4AI9A 3EBRA 3GHMA 3RYRA 4JVAA 3THCA 2DU1A 1AR83 3RZMA 4YYOA 4B7EA 5L7OB 2HBUA 1W2OA 4MXVA 4IE7A 2WWJA 4IEPA 3T2QA 2IXKA 2K0GA 5D8AA 2GH8A 3WDUA 1NCQC 2W46A 3KCCA 4NJ4A 1JYTA 3NNLA 3WSOA 3IDCB 1RUD3 1HRI2 2P2KA 2PYTA 2RVAA 3WG3A 3P1IA 1RL3A 3FHAA 3ZIXA 2ZGMA 3NNMA 2DVBA 3K4ZA 1QXJA 3V0AA 1BMV1 2YU2A 5FZAA 3PU3A 4GAZA 2YFZA 2W1WA 3WF1A 5EV7A 3R6SA 2Z4FA 4J6GA 4UAPA 3UESA 2DCTA 4A3ZA 4Z8BA 1NLQA 2VPVA 2ZHLA 4M3CA 1F2NA 1UCXA 3OGJA 3S7EA 3VUOA 2NQYA 4OHWA 2VZ3A 4O65A 5EWSA 5CKMA 4E9KA 2BVBA 3BYWA 2AGSA 1OMIA 1TME2 3RZGA 4IL7A 1AR61 1HIXA 2D6PA 1R1A1 2VJXA 5FO8B 1TMF1 1JOPA 1WD3A 2PFWA 3I8TA 4M3CF 3SEPA 2D98A 5FP4A 5FOBB 5A3OA 4QDQA 2XH6A 2XKOA 3J7LA 1XE0A 4JGYC 4CEYA 2VMCA 2Q1ZB 4IEXA 5AC93 3R0RA 5C9AB 4YVSB 3O7OA 2WO7A 5JOXA 3H8XA 2EXKA 5FYCA 1MS4A 3AP7A 5SV8A 4LK6A 4ARYA 2VAUA 5FZLA 2XJSA 3ZN4A 1ZBE1 3BI3A 3I2DA 2XR4A 5KXEA 1UU4A 2D6LX 3S5AA 1S2BA 4TTGA 4OQ9A 1RUJ2 4Z2WA 1QJU2 2ZHMA 4WVWA 4YVWA 1UOGA 1GNYA 1YIPA 1H8TC 4I30A 4Y4RA 3S7IA 4EV0A 2OQ7A 4ATFA 3TWIA 1Q3EA 1FMD3 2TBVA 1RHI1 1ZZ9A 1B35B 4RR3C 4FAGA 3SC7X 3ZPOA 3KQ4B 2HWF2 5A32B 5BNPB 5EP9A 1NA1C 3WD5A 3ECQA 4A45A 3CF6E 3EMRA 2L9LA 4I0WB 2W1QA 2IZWA 3GXUA 1MZ6A 1QDCA 4QKFA 3VZLA 2DUQA 3UGFA 1LOEA 1CONA 4M0HA 3VBRC 1F35A 4B1MA 3WF2A 1ST8A 5FZCA 3IDAA 1W6OA 2XLFA 3ZYGA 4CEWC 1NCRB 3VBUC 5A32A 2X53S 3KS7A 4LO6B 3ZXDA 4AW7A 2DTWA 2OQ6A 2WQ8A 4QWNA 3BKZA 1X8EA 3FE5A 5C3PA 4HKOA 2XBO1 4C91A 1W6NB 2GDFA 5KC5A 2QQWA 5EQUA 3HNYM 1VBC1 2R072 2R30A 3VDDC 2JIJA 1LOFA 1WWYA 1QJY3 4OUSA 4XFAA 3WW4A 5FZOA 1LTEA 2G19A 2N7GA 2AR6A 4QPIB 4UXAA 2VOVA 1W8FA 3CO2A 4KQ7A 4AVAA 2A3YA 2HWD1 3LSEA 4GH4C 4MZUA 4GWMA 5APAA 1KXGA 4CP9A 5FK8A 2HWC2 1DF0A 2JJ6A 3BODA 1DFQA 5DN2A 2WS91 2UY8A 1HB1A 1ZBA3 4XJ8A 4AOCA 4E4SA 1LCLA 1PGW1 1ACCA 2E6VA 4IGOA 2B4KA 4PT6A 1XXNA 5FKBA 4C0HA 4W6WA 1QJZA 4BYYA 4CDXA 4D94A 2Y60A 3V65A 5JMOA 1WLCA 5FO9B 2QQIA 4NR1A 5DG1A 1QJX3 4XXAA 3PTRB 1GP4A 1LHOA 2XOMA 1ONAA 4HZFA 2MEV2 5FPBA 3AMPA 1W0PA 2FD8A 4NIAA 5JSRA 3FHIB 4QGNA 1QOSA 5FY7A 1C8M3 4LIVA 2VZQA 1UOJA 4Y3OA 4NRMA 5BNNB 1RUG2 5BNOA 3LA3A 4LHSA 5LEKA 2C9KA 4U2AA 1M06G 5IVJA 4ZZ5A 3OG2A 1DLCA 4CDQB 2RS11 2ZKNA 5CIRA 2ET1A 2CGOA 3NV1A 2WNEA 4X8PA 3N9PA 3TEWA 4H3WA 4K20A 4L2NA 3EQEA 3RPQA 5DMYA 2RS33 1AVBA 2Z42A 2RDSA 1VRBA 4XIOA 1HJGA 1I9RA 1HB4A 4IGQA 1OH3A 5G05L 4YW3A 3L2HA 2P5BA 5ANQA 3I3MA 2VO5A 2LUWA 3DPRB 3VL9A 4JTOA 1FNYA 2VY0A 5FBJA 4KL1A 3SNMA 2RS51 3GCXA 1SLBA 1MZFA 2BNOA 4XJZA 4CDUC 1LESA 1RVF1 2D6MA 5E1RA 4DFSA 2VMDA 1WA6X 5GZEA 4P9YA 2QQNA 5CFDB 2QQJA 3NJVA 3NW4A 2ARXA 4HK8A 5LBCA 3HNMA 1TZOA 2HH9A 3POIA 4JKKA 4PF1A 2ORXA 4QXKA 1OURA 2BOIA 1T6BX 1V6JA 4LNVA 2D5HA 2H0VA 2P6CA 3VBHC 5F5QA 1FAYA 4HVQA 2ZGNA 3POYA 4HN1A 4EWEA 1RJ8A 4JGZB 1GYKA 1HV0A 4E8CA 1GZWB 4AFAA 1PO13 2WFPA 3FL7A 3OUIA 4PIYA 4OCTA 4K40A 5J09A 1IZ3A 4DEQA 1NT0A 1L3JA 1V6KA 1QDOA 1MZEA 2WR9A 2FCTA 3RWNA 3U4XA 2EALA 3H1WA 5JZGC 3POJA 1QKQA 1YO8A 2UWAA 3JQWA 1NE6A 4LKDA 2W91A 4X6RB 5K9YA 2EF6A 1RYYA 2A73B 2ZACA 4IDZA 2IVIB 2YROA 3PL0A 2CGNA 1MVEA 1GUIA 4GIQA 1H0BA 4S2FA 2LS6A 3H8RA 4CCEA 3K48A 3QBQA 2XVLA 4Q0UA 4MGQA 1TQ5A 2W47A 5L7OA 3AYCA 4NIHA 1ZRDA 2VU9A 4LO8A 5KHGA 4FPHA 4PDWB 3KCXA 3WP5A 3H9AA 4IV3C 1RUH3 4TXWA 4N53A 1HQNA 1QWRA 1HRV2 4XTPA 5EPAA 4AR2A 1CWPA 1APNA 3GYDA 4MVTA 4XURA 2GALA 3AYDA 3VLBB 1O5LA 3OY8B 1V0AA 3PURA 2OW4A 5JXIA 4JGYA 5C7GA 4CZSA 4HG6B 4Y20B 3I49A 1OOPB 1Q8QA 4H7LA 4W6YA 1NOVA 3T3YA 2YFUA 1BK1A 1VBB2 1L7QA 2VZSA 2ZHNA 5FUNA 5FZBA 3SCFA 2FDHA 1W8NA 4MOAA 1RTVA 4K1ZA 4OHYA 1BKZA 2PAKA 1OA4A 1PNGA 3KVAA 4M4PA 4XJWA 5E16A 4BQYA 5A6XA 3A22A 1MZ5A 1W8OA 4QX0A 4WM7C 3VBOB 3ZFGA 4IV1C 1TG7A 5JCTA 4M01A 3OBZA 1TEIA 1FOD2 3AJZA 4RR3A 5DZGA 2VG9A 3VDAA 3FFZA 1O6UA 2VZOA 4RGGA 3WNXA 3KF5A 4D0QA 4CCLA 1CAVB 3PUIA 1DU3D 5CAZA 3KF3A 4WM8B 3TNQA 1K42A 4IE6A 4P9XA 3RG0A 5FPXA 5DAXA 1GFF2 4CRQA 1IPJA 3ZYPA 2R061 3N9QA 2A3WA 2A71A 4B29A 1UZ0A 1NXMA 5IWFA 3VBUA 3VBFC 4NIGA 1NY72 4ISQA 3RRDA 1UZZA 4DIQA 1W03A 4I09A 1B35A 1CX4A 1WBLA 4IE4A 4X6QB 1YHFA 3ZYRA 3H7JA 2EXJA 3WNMA 4AEDC 2WZPP 4YM3A 1JZ2A 1ND3A 1LGNA 3VDDA 3B5LB 3NMBA 1AR82 3I2IA 3ILRA 2J1RA 2W52A 4GB33 1BBT1 3AP9A 2XQRA 3D0SA 1SDDB 3RZKA 5EFUA 3E5XA 2JX9A 4GH4A 1DQ6A 1KD7A 3DN7A 5CA6A 1MPXA 2X05A 3SHRA 4OUMA 4XUPA 2VVEA 4YGDA 3I3QA 1KJRA 3W58A 2VE1A 2JICA 1RUD2 3LF7A 1CGPA 5A3WA 4W50A 3OD4A 4BMBA 4AXOA 4YM1A 1ULEA 1OSGA 1QNYA 2A6VA 1DQ1A 4LOTA 1RJ7A 1K5MA 4QKDA 4XUQA 4A44A 2JWPA 3A4UA 4HPKA 4AEJA 4BM8A 4HMZA 1QJEA 1VP6A 2BDRA 1PVC1 2R6QA 1LHWA 4YLZA 1RUF1 5IVYA 4BOWA 3IDBB 2ARBA 3WUCA 4AGRA 3PIGA 5FQ0A 3IT8A 4QDRA 5JSOA 1Y9MA 3TRSB 2EAKA 3VZJA 3Q8EA 4GWNA 2W2IA 4IEOA 2WA3A 2BGPA 5DAVA 3HMYA 4RGKA 3M1HA 4B4PA 1Z7S1 4UF0B 4HL0A 5AC92 1JUIA 2D43A 2PMWB 4GMP0 3LA2A 3WF3A 2ZMKA 5C4WA 4DXSA 4M00A 1KEXA 2RHPA 2WZR1 3HBKA 4XBNA 4OI1A 2Q8CA 2ZX2A 5AFBA 1QGLA 3K77A 3ZM8A 1PK6A 2P1BA 2GNDA 4AGVA 1WLWA 4ZU5A 1H8VA 1L7LA 4Y5Z0 4BQXA 1HXS3 1UY3A 2AACA 2GAUA 2PTMA 1XYNA 5FY9A 1ZNPA 1R64A 3MW2A 1JMUB 1YQ2A 2ZS6B 5T54A 4FTBA 4UW4A 3IIAA 3DYOA 1C3HA 2A5ZA 4LHKA 4L92A 4BIFA 1EUUA 1FV3A 4P9GA 4QX1A 4MHRA 5A1AA 4LBQB 4QQPA 4FPLA 1YQCA 3N9NA 4K1YA 3NVCA 1MQTC 1VBA3 1ZA4A 4AFCA 2R16A 4QB6A 3FFQA 5GZFA 1YFWA 1U0AA 3CJXA 1UYYA 2JD4A 1DIWA 1QJU3 3OBAA 5ABJA 1AHSA 4E4ZA 4FTEA 3D6EA 5JLVA 2DFBA 4I0BA 4Q4V2 2HJIA 2MPFA 4N9HA 4UFJA 1VRH3 2K2SA 5LASA 3ZSJA 5FREA 2VMFA 1TME1 2QZ3A 1CZSA 5GZGA 1QJY2 2Y34A 5HV0A 4GZ9A 4FCAA 4OHVA 1DQ5A 1R091 3L9JT 5C8WA 1ENRA 3M7AA 1XNAA 1Q8PA 3W5NA 2WFF2 4K9SA 5JZGA 3KLSA 2ZAHA 4OHXA 4QAWA 3RJ2X 3PUAA 3RQ0A 1PGL2 4FFIA 4NWVA 2I07B 1REDA 1W3XA 3VZOA 3ZIWA 3MLLA 3AYAA 3PMEA 5A7QA 3VD9A 3EHKA 3NAPB 4YG3A 1ZBA2 2IC1A 5DG2A 3B94A 1ND2B 4BQWA 3CHXA 3LDBA 4LTAA 1GZWA 1UW8A 3K51A 1ZREA 3MICA 3TEYA 1A34A 5C6CA 1V6OA 1J1TA 5FPLA 5HCBA 1W8WA 4Q4X1 4ASLA 1V6NA 4URTA 4JDNA 3O1RA 3CBNA 4QU1A 4CDWA 2KA3A 5L36A 1QJX2 1W04A 1WKYA 2FBEA 5LA9A 2XJUA 3WHTA 5D8AC 5J37A 3I2OA 4E2SA 5A6YA 4GXLA 4QKBA 4A41A 5C3SA 2IXLA 4Z82A 2HWC3 5LATA 3PVEA 1LGBA 4OZOA 3A0NA 3O1UA 1DGWX 1W9WA 2WINB 2VW1A 2BPA2 5LWBA 1REFA 2R041 3GJAA 4R9CA 1GV9A 2EAAA 4P14A 1GLHA 3FJSA 2RJLA 1YJLA 4TYSA 3M8LA 1WMDA 3V56A 4KGGA 1EV11 2KR2A 4RHV1 2ZEYA 3KM5A 2RS32 3JD71 1RB8G 1OI6A 1U5YA 2CHHA 2WAAA 4LBMA 1H2KA 1SBDA 2X5IA 2ZTNA 2R071 2ZGSA 4QPGB 4WM7A 4GMP1 3WT3A 5CB7A 4KWUA 2LTNA 1UZYA 3LIHA 3OY8A 2A6WA 4LUKA 4XFGA 2ZHKA 1PO21 2V4VA 3LPGA 3E1F1 1HB3A 5F3CA 2D3SA 1V70A 2ZJCA 4NHLA 4MSVA 2WNUB 5C8CC 5J98B 4INDA 2JE8A 3ZFFB 4CEYC 1GICA 5A3PA 5CFCA 5K4LA 1P8JA 1OVSA 3BOWA 2X10A 4NPLA 4WBBA 3SITA 3K75B 2UY9A 4CU7A 3UKTA 4UW5A 2YC0A 3AKQA 1D4M3 4BB3A 4DB5A 1W2NA 5CEHA 5I0TA 4YVWC 1E57A 3ATGA 3T30A 3UKVA 1AR71 2EXHA 4AAPA 1F5FA 5AFEA 4R52A 2QDNA 4Q4W3 1CAUB 3BTYA 3VD7A 3R4DB 2QQLA 2HEYF 3VDBA 5FMCA 1VBE3 2I2SA 1H2LA 3B9IA 1AZDA 5EXOA 2MEV1 3K3NA 4N43B 4RS5A 5FWEA 2V5DA 4MGZE 5A6ZA 5KC6A 1PX4A 1I3HA 5F6KA 4AGGA 4M3CE 2VZ1A 2QTWB 4UOJA 5F5AA 4JRLA 3RS6A 1N47A 2R32A 1AL0G 4QX7A 5EJ1B 5EIYB 5T5JA 4XBLA 1ULOA 3FLTA 5FMOS 4NO4A 1MS9A 2W68A 3V64A 4NPRA 3ZFEB 2Y6FA 4XIKA 4LBLA 4CYDA 1KDMA 2YGLA 4JKLA 4XE9A 3HN3A 4CUCA 4R9BA 5FIXA 4EYUA 1ZRFA 5KHKA 2WNVB 3JCIA 3ZLIA 2JDKA 1ODMA 4DUWA 2GMEA 5FYTA 1PVXA 1I1EA 3RGBA 1YQ5A 1H1AA 3FHQA 1CZVA 4AZZA 1PIV3 3GGLA 4PIZA 3LEMA 2JG9B 1RUH2 2YY1A 5T5PA 5T3NA 4MXWA 1Y43B 2CSGA 1W8UA 4AAXA 4B1LA 3FBYA 1HB2A 2NPIA 2G9GA 3IB3A 1RUI3 5JIAA 5HXVA 5L9RA 2NZ9A 2NM1A 2QDRA 1WW4A 3I3DA 1IQDC 1H9PA 2VUDA 4CXXA 5IT6A 2YBPA 4P5YA 1DYKA 1UOFA 3GBGA 3LSDA 3P5BA 3PNAA 4EWAA 2D6NA 1F8VA 1H30A 4NHXA 4ES8A 3ACLA 4NHKA 4COYA 5L19A 3J8F3 5LY1A 1S1AA 2VMGA 4WV8A 2Q8EA 4AVCA 4CDXC 1F31A 1SACA 3KT4A 4YSFA 4P9LA 1RUNA 4COZA 2VD7A 1DCSA 1OA3A 1OLME 1SHWB 1ULCA 5EYXA 3RJRA 1X9PA 1UYZA 3HQXA 3IAQA 5GZCA 4XUOA 2PN5A 4IEYA 1DDLA 2RE9A 1MR5A 1R083 2C24A 4O61A 1U5IA 4XJAA 1N3QA 3WW3A 3S0MA 5FZKA 4UF0A 3ZVXA 5HCAA 2LW8A 3LWCA 2VTXJ 2ZZJA 5KWRA 3RYPA 4WVMB 1BEV3 5BNOC 2PA7A 4Y22A 3ZN6B 2RV9A 3TN91 2AUYA 5H9SA 2WLPA 5F7UA 3M3EA 5A7SA 4IE0A 4E27A 5LCWL 5JAXA 3I97A 2YPDA 3WX5A 3FX3A 4CCJA 3WEZA 3U11A 4RD7A 2IVJA 1LEMA 2HEWF 3ZXLA 4XJ9A 3KCYA 2WABA 2ATFA 4P9JA 3RZLA 4F7ZA 3OEAA 1A3KA 4FXGB 4N8MA 5EYYA 2QZ2A 1JUHA 1NUKA 1UY2A 4GB32 1C57A 2VM9A 2XJVA 4IUGA 2C1FA 3W59A 1QXRA 5JOZA 4H2AA 4E2GA 5DUVA 2VBDA 3BPZA 3JBG3 4P9IA 1WMXA 4LBKA 2PHTA 4D8MA 5IVEA 2CYFA 2A1XA 4PHZA 3DUIA 2JB4A 4UFKA 4HONA 5F1RA 3HT1A 1QEXA 3NJZA 5BUVA 1QQP1 1VBB1 1HN0A 5FUPA 1H6YA 2WO2A 2C0ZA 2CWMA 3BTZA 4COUA 5G04L 2GC2A 5FY0A 1OC1A 2O8QA 4MGKE 1UIJA 5FK7A 3MLKA 1OFSA 2AEZA 2DURA 4PI2A 1X9TA 4R9AA 2VTXA 3WDWA 2AZ5A 3ACGA 4V2WA 4YARA 5C3OA 4HETA 3M2MA 3V0BB 5GJ6A 3MIDA 2XLAA 1K45A 4RN5A 3G6JB 2JG8B 1CR7A 1WCQA 3R4SA 4YW2A 1V6MA 4AF9A 4D6SA 4DXTA 4EN9B 5JI7A 1NCQB 3T1LA 5LRRA 1W99A 2GH2A 3AVSA 5L73A 5L9VA 1CQ9A 1N1YA 2EVXA 2NYYA 1EPZA 1GZ9A 5JPNB 5FP9A 3WNOA 2HWB1 4LR4A 3N7JA 5JUVA 3ZR6A 1S2KA 3OD0A 1GZTA 4YM0A 1SLLA 2VR4A 1IG0A 1HW5A 4Y24A 2BFUS 3GJBA 1NE4A 1VALA 2Q5TA 2WT1A 4RA0A 1MS5A 3W5MA 2PHXA 3WG2A 3PJQA 3IM0A 3U0ZA 3KZ4C 1CD3G 3CJIA 4FFGA 3RVHA 5L7OC 3AM2A 5F39A 3AMNA 1UD1A 1GMMA 2R7EB 2WT2A 3MGUA 1HXS2 5CBLA 1LNSA 4N53C 2VQUA 2IUWA 4A7KA 3KGZA 4BXSV 3PIJA 2GZWA 5DDJ1 2RG4A 4XXPA 4AVBA 2BVVA 1AJKA 1VIWB 4Y1VA 5C8CA 2P4EA 5FLHA 5FPVA 4PBPA 3WZ1A 3LIGA 3U78A 4I3PA 2J1UA 4FOWA 2BEOA 1KJLA 4Y1YA 1G9FA 1VBA2 2ZEZA 1DGRN 1CVNA 3MIBA 2WKKA 4Y1UA 1U12A 1V9U1 4YGBA 2J1SA 1H8TB 2NMNA 2QQOA 2WZ8A 3EO6A 5FZ0A 3UNPA 1EY2A 3GCWA 3VB9A 2O14A 3T0BA 3ZFGC 1PHMA 5CG9A 1W9TA 1O4TA 1CAXB 4KH9A 2DUPA 2TEPA 3X29B 2Q4SA 3ZMNA 1VRH2 3AFKA 1KFUL 2OXBA 4FP3A 2AEYA 2P17A 2ZMNA 2VQ0A 2VZVA 3FN9A 3J7MA 3LD8A 4BA6A 3ZMOA 5J7MA 1H2NA 3TB0A 3BU7A 5HCHA 1UOBA 1W0OA 2RDRA 2NP0A 5FWJA 4Q8KA 2EIEA 5FPZA 4GQ7A 3HPNA 2Y6LA 3MIFA 3WW1A 5FYYA 4LHNA 4MLOA 5T52A 5F3GA 3WQ1A 4RQPA 2ETEA 2XBO3 4CEWB 4XC9A 3AMHA 5GKAC 1D4VB 4F8AA 1ZZBA 1QH6A 1UU6A 5TSWA 3TEZA 3BIEA 1FXZA 1VBC3 3ME2A 1O3TA 3WDTA 3ZR5A 1H1IA 5SV5A 2VVDA 4TLGA 1BQPA 1B35C 1RMU3 1AR93 4P9WA 4Q4V3 1HV1A 5GLWA 4DY3A 3KMHA 5I8SA 4IERA 4CU8A 5BNPC 3RZHA 1ND3C 2HWD3 2PHWA 2ZEWA 5K0UA 1JU4A 1FMD1 2HEVF 3RDIA 1YNAA 3AXDA 3CQOA 4FAHA 2K9ZA 4Z1VA 4PQQA 2ZX3A 2WFF3 4LBOA 1Y4WA 2WS93 4XJUA 2JECA 1IG3A 1VPHA 2Y33A 2XVGA 4O9GA 3NJYA 2QUOA 3AMMA 1SMVA 3EXUA 5A80A 3N9LA 1UO9A 4K3UA 2NLRA 4Q2FA 5JR7B 3VHRA 1BVP1 2XHKA 1FPN3 4CXWA 1ENQA 1W2AX 1FV2A 3B02A 5HV4A 3BB6A 5ERLA 2VMEA 3WUDA 2W92A 1K5MC 4L11A 1BYHA 1EUTA 4JDMA 1GBGA 2PAMA 3RZJA 2B7YA 3LDKA 5ACA1 3JXSA 1BCXA 4QPIC 2VBBA 3MYXA 2MNGA 3LOBA 5JOYA 1O3RA 1QJY1 2VBPA 2XUMA 1SFNA 2PLV1 3LZZA 1N1SA 4KG8A 2AYHA 5C33A 2RR11 3IMNA 2VMHA 3KGLA 3U1XA 1SPPA 1UXZA 1M4WA 2C4XA 4Q29A 4D6RA 3BUCA 2FDGA 5I0RA 5EHDA 2BNNA 2BU9A 3SH3A 4CUBA 4WVZA 1HQWA 3NV4A 5C4WC 1W6MB 1QF3A 5B2GB 1HX6A 1O4ZA 2AENA 2P3JA 3SXWA 1ZM1A 1OQ1A 1D4M2 2PXJA 3OUHA 1YEWA 1BJQA 2CTVA 1Q8SA 4Y4YA 1S0CA 1O91A 1PK6C 4TZDA 3FLPA 5FYUA 1X82A 2SLIA 3KT7A 4I3GA 2WT0A 4Q4W2 2RS53 5DQ0A 2BRTA 5A7WA 2BGCA 4QGMA 5DAWA 1RVF3 1VBE2 5FJHA 3ZPYA 2VVFA 3LE0A 1VAVA 1J59A 4Q0PA 3LKJA 3N7KA 2AC1A 4LORA 1GQHA 3VBSB 3HAGA 3J7HA 1ASJ1 4CDUB 3O0VA 4ZS3A 3ZN6A 4MGTA 1VE0A 1C8M1 2DWRA 4EN7B 1GQPA 1MS8A 1W2TA 5CVRA 1IHMA 4FOQA 1AL21 1EAH3 4EROA 2PHLA 4YRDA 5KBFA 4MX3A 5FMDA 4DOUA 2BW8A 2DCJA 1AYN1 3PVNA 2VZUA 2KXLA 4JRAA 3Q8CA 4ZS2A 1RUE1 3S57A 4CCMA 3LB9A 1S2EA 2VNGA 3ENRA 3AMQA 3BVCA 3POWA 4HK9A 1UY0A 5E88A 1K3IA 3VBHB 5ABJC 3Q8FA 2XB6C 1ALYA 3HQUA 3POSA 1NLRA 4A7YA 1G9DA 3UJOA 1JZ5A 4NAOA 1CPMA 2I45A 4KBBA 2ZABA 4W6XA 3DPRC 3OYWB 4XF1A 4N9IA 3LCPA 3AX4A 1PIV2 2VGDA 4LBQD 4XCAA 3RFRA 3H8UA 5CKNA 3AP5A 1NXD1 2DVFA 3VD3A 5KR7A 5F5CA 1ZYBA 3USUB 1RUI2 1UPSA 3MUY1 4LKSA 1J3QA 1OD3A 3K46A 4KI5M 4MH0E 4SLIA 5D21A 5HBAA 3BALA 4YPJA 3POEA 5FMBA 4LE3A 1LENA 3JUUA 1JZ4A 2YXSA 4JGZC 4LMFA 4A6SA 4CUAA 2EIBA 1PMIA 1YXWA 1UN1A 3M3OA 2J1VA 3OPZA 3MV11 4HKLA 4Y26A 3WVJA 1V6IA 1UX6A 1GNZA 3J8F2 4LHLA 4A4AA 1WW5A 1B09A 4H7MA 3DF0A 1CX1A 3I2KA 1PO11 3WHUA 4QHOA 1MEC1 3E97A 4IV3B 5ANNA 3HQRA 3FUOA 3H3UA 3UKNA 4CDWC 3ITQA 3ZYIB 4NIDA 1YQ6A 1LU1A 1R082 1E5RA 3AXEA 2WO3A 5T5OA 1DLLA 2WRAA 1DZRA 3WNNA 1XPWA 1WUVA 5BY5A 2QKDA 5T5LA 1KFXL 2ADDA 1IPSA 5FZDA 5I0UA 5H9RA 3ZYJB 1HQLA 1POV3 4JHTA 4YNIA 1XNDA 1BEV2 4QX2A 1YYNA 1UZVA 1W6QB 3BTAA 5FDBA 2RM22 2NMOA 2B5HA 4JQRA 1C4RA 2BBVA 3T08A 3KVBA 1C1LA 2O0OA 3MI8A 2ZAAA 2YU1A 4XOGA 4PDWC 1G8WA 1D2QA 1UAIA 3IWZA 3GBFA 2X5IC 5JVVA 1FNZA 4W8JA 4IV1B 4ZXKA 3U07A 4R4XA 4XHXA 3I59B 1CAWB 5CKQA 3O1TA 1WCKA 2JKXA 2V5YA 2CAVA 4IEUA 3WXPA 1I5PA 2ZXQA 2R063 4YZ5A 5C9AA 1OOPC 2QQVA 4YVSA 3MDPA 2HWE1 1VBD1 3JBG2 4K6BA 4P5HA 4ZONA 3CZJA 4YWAA 1RITA 2ZEXA 3N9MA 5CFCC 3L2YA 1UIKA 1BZWA 5FP8A 3NWKA 2J1AA 2R1DA 2XHNA 2XMLA 1BK0A 2OUHA 3GZTB 1Y3TA 1XNTA 2ZGTA 3O0XA 3VBFB 3VBOC 3INAA 3EJKA 3HWJA 2XJTA 1O8PA 3VL8A 4AQSA 3LDRA 3SKJE 2FDIA 1ULGA 2VULA 1BBT3 1HKDA 5FYZA 5BNPA 1WBFA 3N7MA 2Y0OA 5F37A 4UFMA 1RC6A 4NOTA 1L7RA 2OZJA 5FZFA 1J1LA 3AKRA 4E8DA 3JZVA 3CIHA 3QH6A 4XF4A 4RS5C 1E5IA 1SLAA 3AZXA 3NRUA 2B9VA 5HXMA 3J26N 1COV1 1XYPA 1BMV2 2WO1A 3KV9A 5LBFA 2ILMA 3DKQA 4QQLA 1IGOA 4ZU4A 3ES4A 3WCRA 4DMIA 1AYM1 1NCRA 1X8MA 2JB8A 2JEMA 1OFNA 5IUQA 1JBCA 3SCGA 2PQQA 4AHWA 1CPNA 5F32A 2QJVA 5LY2A 3ZYHA 4QKNA 1W6NA 1GWMA 2YUEA 4BE3A 1RUF3 1W8TA 4QX3A 4M0NA 2A6XA 1MVQA 4BMEA 3BTXA 4BISA 5LA2A 1YI9A 4MG2A 4KWKA 1W6PB 1XSRA 1O8SA 4QXCA 1AR62 4LO5B 2YG0A 4QPIA 2Y6JA 1TMF2 1SDWA 2VW0A 3NO8A 4LIUA 1OUSA 5FAXA 2A70A 2WJSA 4I01A 1GQGA 1EP0A 3E6BA 1AJOA 1Z7S3 5FXZA 3GM8A 3WQ7A 3HR9A 4KWLA 4HVRA 4L99A 5A6QA 2WN2A 4FPEA 5JXJA 4CP1A 1ZBE2 2WZR3 1W8HA 2DVGA 2OYZA 2OZ6A 2JDUA 5IW0A 4J25A 1KDKA 3VHPA 4AVSA 1IPKA 5IJRA 5IAXA 3N7LA 4QT6A 2JDMA 4FFHA 2D97A 2RJ2A 1RHI2 2IXJA 4OUEA 5DZEA 4ES9A 3O1VA 3WLUA 3N9OA 4BWOA 4Q4Y3 3W21A 4QXHA 5A33B 5GLZA 4NIIA 3AKSA 4BXFA 4AI2A 3AZZA 1IQAA 1IOAA 1YLLA 3ETPA 3S30A 5FRAA 3GZAA 2GNBA 2GP5A 4AVTA 1YRZA 2WYFA 2VCAA 5BNNA 2QBXA 3PUSA 2ZPXA 2D5FA 3K4DA 1SG3A 3ST7A 1JODA 2D6KA 4UYBA 4FTSA 1HRI1 4FPCA 4YZ1A 5H9PA 5LK5A 4CDQA 4CE8A 1U5XA 4ZZ8A 2W94A 1V6LA 1UMZA 5FZHA 2VZPA 1X7NA 3LFMA 3T0DA 1S0DA 2XBO2 3IZOA 3B00A 1VBC2 1GP5A 4W65A 4AK3A 1SBEA 2W1UA 5FO7B 2QE3A 3WQBA 4EQVA 2YPJA 1RMU2 3HJRA 1AR92 2LM3A 1R093 4PJYA 5LB6A 1LR5A 3B01A 2WBKA 4SBVA 3DPRA 3MEPA 2HWD2 4HBNA 3VBSA 4IGPA 4PLNA 1RXFA 3AKTA 3HEIA 4C8DA 4OQ8A 1QU0A 1YI7A 2BYVE 3GDBA 4QB2A 3O1OA 5T55A 4XFBA 4GWJA 4XHBA 4DS0A 4Z2AA 1H9WA 2E26A 2WS92 5CFDA 2J22A 1BVVA 3OPWA 1PMHX 3U10A 1O5UA 4MUVA 1PGW2 1NAEA 1US2A 2W1SA 4CVUA 4UBHA 5A3TA 1VBA1 3OGRA 3S6PA 1FPN2 3QACA 5F8PA 3BOPA 3CEWA 4Q4X3 1RUC3 4JGZA 4KMQA 3SKVA 1RUJ1 3WV6A 1VMHA 1QJU1 1Y9GA 5A7PA 3C2UA 4FOYA 1JYVA 2ZGRA 3WOGA 1V00A 2E31A 5KHJA 2R0FA 3WG1A 3CMGA 4GJZA 5I93A 1BLZA 1G6NA 1EYBA 5C5UA 2HWF1 1S0JA 4FP2A 4XFIA 3RNSA 1GOGA 3ZOIA 1YUDA 2C9AA 4OI0A 3OGVA 3I2HA 2OX0A 2V73A 2ET7A 5DUUA 2R043 3LA7A 2FMYA 2UU8A 4LLOA 1XBFA 4AFBA 5CZKA 2RS12 1ND2C 5BYNA 4WVVA 5DPNA 3V0AB 1EV13 4RHV3 4ASMB 1MS1A 2ZGPA 3JD73 3DEMA 5IK5A 3T0AA 5BNQA 4D3WA 3D82A 1Z0HA 3HNBM 3KV5A 4J1WA 5D1IA 3AZYA 4GMP3 4M3CB 2XUEA 4A6OA 3IIIA 4PBOA 1LU2A 4PDWA 3OSDA 3CJIC 4UWDA 5IVVA 4R4ZA 5L9BA 3OPTA 1PO23 4AG4A 2AREA 1JW6A 1OKQA 2YBSA 3F2ZA 5IFPA 2RS52 5KHHA 3O0WA 2CDOA 5FY1A 5FUIA 4CCOA 4COVA 1RVF2 2BGOA 1KGYA 2B9UA 4EZHA 5H9QA 2CDPA 4AFDA 3MW4A 3VHNA 4D7YA 4Y20A 1JZ3A 1OOPA 4AHXA 3CZUA 2HWC1 4BJ0A 4CEYB 3B7MA 4KU8A 5FP7A 1JZ6A 5FXVA 4XF0A 1F5JA 1DGRA 2XWJB 4Q1RA 3WNKA 1EAH2 1OF3A 3MZHA 1VMFA 1XC6A 2JDNA 4QM8A 4CCCA 4D7SA 1AR73 2Q1MA 1KS4A 3H8OA 5JPMB 4XAEA 4WZFA 1Q43A 1QHDA 3VBOA 5CG8A 3UGHA 4XFCA 4YVWB 1WGPA 2HKXA 4LO7A 3RSJA 2RMU3 2Q8DA 5JI9A 3GNEA 3W20A 4AWDA 2CY6A 1CAVA 1DGWA 4H14A 4WM8A 2CWSA 4BZ4A 2D6OX 4UI9L 3DL3A 3T2OA 3J9SA 5C3RA 1S55A 4UW3A 3URFA 4XACA 1S0EA 3VD5A 1RUG1 5A1LA 1TNRA 2BNMA 2QNKA 3ZO0B 1W6OB 1LGCA 3C7EA 4LULA 1W9SA 1PZ9A 2CU5A 3LEKA 4RQPC 4UFIA 4BQ3A 4DZGA 5JWPA 1VAKA 3POGA 4P02B 4XZPA 1D4M1 3ZXAC 1FT9A 2VNRA 2PQSA 2ZKLA 4TSVA 1JU3A 5LBBA 4DINB 3J7NA 2XDVA 1PNFA 5LBEA 5K0UC 1ZRCA 2YC2A 4I0AA 2I74A 4BK5A 5FZOB 5IVBA 4AYUA 4RYDA 4XQ4A 2VC9A 5F6LB 5DABA 2Z5WA 3IDEA 3USSA 1IS4A 1LKNA 4CP9B 2P3YA 3A21A 1D0HA 1IKPA 2DVAA 1W39A 1A6CA 4GULA 4JKMA 3ORJA 5FLIA 5JMCA 1HJFA 3SCHA 1X50A 4ITCA 4D6QA 5FZ9A 4QHBA 1NX9A 2Y6HA 2Z2SB 1UY1A 4NN0A 1WLDA 3SH5A 4CDXB 1QJFA 2FCUA 4N7UA 1ZZ6A 4YW1A 2OPWA 1ZRIA 4NVPA 2RDQA 3H1MA 2XWBB 5FZMA 4E4DX 4CUGA 1LODA 2ZGUA 1NYWA 3QCWA 4AQ2A 3AL5A 4Y1XA 4XABA 1J84A 1JYXA 1N3PA 1WW7A 1LAJA 2FDJA 4Q0QA 4RSUA 3TN93 4BQ1A 5GLTA 2XKPA 2R062 2VCCA 4IE5A 1FATA 4LT5A 4OHZA 5BNOB 1W05A 4E4HA 1LJ7A 4OFGA 2E7AA 1CIYA 4NAMA 1OH4A 3ZKUA 5C70A 2F17A 2XL7A 5FYIA 1UF2C 2RM23 4JTNA 1HLCA 4FPGA 1DHKB 2HLEA 2OIIA 1JN2P 4XYXA 4JZRA 4A42A 2B42B 4DXZA 2JDHA 2LALA 3RMXA 3J8F1 2ZX0A 4NPMA 3VKNA 3ZXKA 1PGSA 4HFSA 4KG0A 4Q1PA 3UGGA 3NL1A 1G7YA 1UWWA 1GZCA 2EIDA 4FXKB 4OMCA 1BBT2 3VKOA 1XYOA 3FMGA 3ALQA 5F9TA 1XNKA 1IS5A 3SMHA 3AVRA 1HRV1 1ULPA 3PLQA 2GP3A 1R081 3AZVA 4LBQA 3O14A 1VLNA 3NKGA 2W5FA 5FYBA 2YV8A 5JIUA 2DYCA 2ZGOA 1YQ8A 1O3QA 1FYUA 4AI0A 1ZZ7A 3OGSA 4XAAA 4Y33A 1WMFA 3PTYA 2D93A 3M4FA 4YW4A 5LA1A 4XMIA 4N90A 4S2HA 1UMIA 1EPWA 1NZCA 1YWKA 1PVC2 4E2QA 4EN8B 2JDAA 1RUF2 1O3SA 2D3RA 1O4YA 5C71A 1LULA 5K7PA 4DEVA 4LOSA 3DXUA 3IPVB 3KV4A 2OT7A 1JYCA 2VNVA 1FOD1 3DECA 1U5ZA 2G9FA 4IESA 3G7DA 3VZNA 3BU0A 1GOHA 1XU2A 2HWB3 1Z7S2 2C6SA 3D0JA 4P08A 5FYVA 3I2GA 2EIGA 1XQNA 3LQCA 1VJ2A 3NAPA 4MO3M 2Q1FA 3TEXA 4K21A 4EN0A 1VMJA 1ND2A 2WZR2 4R9DA 3MHZA 1QY4A 3ZYBA 4CPBD 4EN6B 2B46X 3J4UH 4K8RB 3FLRA 3RYKA 5IK4A 2WWSA 1IKQA 2UURA 3A7QA 5A7NA 1NY71 3LGRA 2WL1A 1UYPA 4JC1A 4TLFA 2O1QA 4QD2A 4W4ZA 4XF3A 2H0BA 5A3MA 1A78A 4LKEA 1AR63 1CJPA 2PHDA 4CU9A 2JG8C 1R1A3 4PCRA 3WNPA 1TMF3 4Q4Y2 3M3CA 2IXCA 4DNYA 1Q5OA 1C28A 4IW3A 3AP4A 1J3RA 5DDJ3 5FJKA 1AR81 3EYPA 3KSCA 4N53B 5CISA 2FZ2A 3NKTA 2R0HA 2ES3A 4CXYA 2WDBA 5GZDA 3CLPA 3I3BA 3PDQA 1OBNA 4AHZA 3O1PA 3MPBA 3OB8A 1SEFA 4JGYB 1D0GA 1ZBE3 1RUD1 3A0KA 3WQ0A 5I0SA 2P34A 4XDPA 4IEQA 1DBNA 4FT8A 1V9U3 3FZ3A 1LHUA 2YHJA 4FPKA 4HT1T 2YC4A 4I02A 2JE9A 3SEEA 3AFGA 5GLUA 1WA4A 2DDUA 4QPGA 4XFHA 1RHI3 4Q8LA 5E89A 3ZSLA 2ZOEB 4UFLA 3ZFGB 3WP3A 3ILFA 1PX3A 1R092 1AX2A 1UPIA 2KD7A 3OJBA 4G9SB 1GWLA 3AKPA 4RR3B 2YDEA 4AI3A 2JE7A 2YB7A 3NV2A 3KD4A 1US3A 1NA1B 2WNUA 3BIWE 3E6CC 2GC1A 2WQ4A 1OXCA 2VQAA 3ZFFA 1AX1A 1ZZCA 2CNAA 4AEMA 2FZ1A 3I7DA 5C9AC 4YVSC 2Y0IA 1DYPA 2E32A 2R49A 3HOBA 4EJRA 4B4QA 1DP0A 4U36A 4RFRB 1WZXA 3VBRB 2DF7A 5AC91 1OD5A 4DUXA 1JOJA 3MV01 4EE2A 1TNFA 3VBUB 3C7FA 4Q4X2 1RUC2 3ZN5A 2FQPA 2ZX1A 4G4FA 2FHRA 4JHZA 1MS0A 2E9QA 1CAUA 4FPJA 3N35A 3VKLA 3DGTA 3IBMA 3C7OA 5KXCA 5LW9A 3DXTA 5BXXA 1D2SA 3I2JA 1ND3B 4P00B 1F4HA 1SLIA 1X33A 2BWCA 2J7MA 3VDDB 5I8TA 4N43A 2J42A 4LUMA 1GSLA 1AX0A 2EA7A 3P3PA 2ZGLA 1OLMA 5EJZB 4GH4B 4NWWA 4KU7A 4BK4A 4A3XA 4KBZA 2R042 2FMDA 2Y26A 1ZRRA 3ZFEA 1PM7A 1NCRC 1SBFA 4CTEA 2XL9A 1EV12 4RHV2 5A1FA 2WNVA 3PMSA 3JD72 5ACA3 3UV9A 5LEJA 1K5MB 2EXIA 2WIIB 4YFWA 1ZVFA 1JS9A 2BFUL 4HPKB 3H1YA 4Q4V1 1RMU1 2B39A 1AR91 2OVUA 2PLV3 1XNBA 2IXHA 2VL4A 4OYUA 4BCUA 5JXGA 2E7QA 2JG9A 5FTTC 1RINA 1PO22 2RR13 1OQDA 2BP6A 3GBWA 3LAGA 4GJYA 4ISRA 3WP6A 4BPZA 1G9CA 3ZSEA 4TWTA 3MF9A 2VZRA 5FQ0B 4FI9A 5IYYA 1JTZX 1G9AA 2WFF1 5JR2A 1T6GC 1GU3A 5IVFA 4F83A 2Y6KA 4X8NA 5FR3A 2E53A 1PGL1 1OLQA 3NNFA 2RS13 3BPSA 1AXYA 1W8ZA 4QU2A 4CU6A 5J3UA 1CESA 3WDVA 4NRPA 1XOYA 4FPOB 5C4WB 1FPN1 1ZBA1 2F4LA 1I6XA 1AR72 2Y8KA 4B4RA 5J36A 2YGMA 2JKBA 2ZGKA 3B3QE 1S0FA 3ACHA 3UL2A 4CCKA 1PK6B 2YMZA 4RL7A 1CIWA 5BV6A 1POV0 1A8MA 2RMU2 4HSJA 4LA2A 1ASJ3 4YW7A 4CSWA 4BIOA 1QJX1 3MFCA 4QPYA 1NZIA 4WVMA 5BNNC 1AL23 3OEBA 4JX0A 5M0TA 2GNTA 1AYN3 5HCFA 3ZXJA 4DPNA 4XBQA 4BLJA 1RUE3 4LEJA 3SH4A 2A3XA 3M3IA 2D3PA 3NQHA 2VUJA 2A75A 2DUOA 2XONA 1ZA7A 4AHYA 4CDQC 3C8XA 3AYEA 4XMAA 3WP4A 4OMDA 3B9CA 3QH7A 3ROUA 2DTYA 3D5OA 2EICA 1K12A 5ABJB 2Z79A 5HI0A 4Z07A 4CCNA 2XLGA 4LO4B 5F2WA 2RS31 1SCSA 3AC0A 2XG3A 3WDYA 3WR0A 4YZ3A 4XDQA 4UW6A 4V2VA 2DCKA 1XRUA 3VBSC 4JQTA 2DBNA 2GNMA 5CADA 1C5IA 2J1TA 1O59A 2FDFA 2PELA 4C1XA 5A7OA 2UWCA 2VOTA 2XXZA 4XDOA 1KRIA 5JZGB 1JZ7A 5CFDC 4O9EA 3U37A 2SBAA 4S2DA 4QHZA 5CU1A 3WY6A 4XTMA 1H4GA 1Z78A 1EAH1 2E33A 2KM2A 4EWDA 2C5DA 4ZHNA 1T2XA 2Q8OA 3UJQA 3H50A 5FP3A 4XVHA 1MEC3 1RXGA 2VH9A 3IPVA 3V0BA 4L97A 4L0PA 3R05A 2VECA 3VGIA 4R8HA 4NUBA 2V09A 2WAOA 2JG8A 1XNCA 4CDWB 4LXLA 1NCQA 1ENSA 1GR3A 1UXXX 1H6XA 3H0OA 5IHRA 3POFA 1LHNA 2GMMA 1OPMA 4GKXA 4LA3A 3VZMA 4BU2A 5F3IA 3ZDSA 2ID4A 1OT5A 2JIGA 3VDCA 3TN92 1KITA 5EZWA 2W39A 3LOIA 3JB8A 5FY5A 2LRPA 1N1TA 4FQZA 1ULDA 4L9BA 2Y6GA 1CJDA 1OHFA 2P3KA 2Q30A 3DYMA 4GA9A 1DZTA 3KQRA 5IFTA 5K8SA 3PVBB 4MV2A 1TVGA 3JQXA 4NMIA 1QOOA 4XILA 4QX5A 2X09A 4AI8A 4QB1A 1NLSA 1FI2A 2X5IB 3JU9A 4WM7B 2UYBA 2GC3A 2JENA 1QOTA 2XJRA 3ACFA 1UZWA 2HWE3 5LA0A 1VBD3 1RUH1 2GC0A 1QMJA 3MIEA 3CU7A 4QXBA 3WNLA 2W87A 2ADEA 1R1ZA 1KQRA 2VXJA 4IXLA 1YCIA 2NN8A 4IEZA 1Q8OA 4WZCA 4GKYA 3SISA 2V4AA 2VTFA 1POV1 1QQP2 1W2UA 1OA2A 3U75A 4D7TA 3E5UA 4LJHA 5CFCB 3DKWA 2XPJA 1DQ4A 4CA9A 1UU5A 2IFWA 1URXA 3NSTA 1A8DA 1H8TA 1DYOA 4LQRA 1J3PA 4Y5SA 4META 1E5HA 1CAXA 3KHBA 2JDZA 2RDNA 4DY5A 1ENXA 2QQUA 4HLTA 1NQDA 2YBKA 1F9KA 4YZ4A 1DGLA 4Q0SA 5IVCA 1JYNA 5FZIA 4AEDB 2F6BA 2X29A 4OLLA 1LEDA 1NA1A 2OPKA 2ZZQA 2D40A 3C7GA 4XW3A 3ZDVA 2HBTA 5EJ3A 1COV3 1AF9A 1W28A 4ONUA 2WWUA 2GN7A 2VOKA 1SLCA 4WM8C 4ASKA 4OULA 3D3AA 4QM9A 4RS5B 4GWIA 3CKHA 1AYM3 2HWB2 5FOJB 3VBRA 4PIXA 5JOWA 2VMIA 4GD4A 3OCPA 3M3QA 3T4VA 1RIRA 2WLQA 1QNWA 1GNHA 3T1MA 1H2MA 1PZ8A 2VOXA 4FOVA 4CEWA 3PJYA 1KS5A 3MFAA 1LB2A 1W9YA 1J83A 2GU9A 1UL9A 4QMAA 3RI8A 3WINE 1UX7A 3CDZB 4YM2A 1PVC3 4HVOA 4NROA 2P37A 4HSLA 1RUOA 2PAEA 3APBA 3ES1A 3IAPA 3PUHA 3PUQA 4DXRA 2DV9A 2JDPA 2IWGB 5HPOA 1UNBA 1S0BA 1SFPA 3FWEA 1R1A2 5AVPA 5JDBA 2VW2A 3QOPA 5ISLA 5DDJ2 3D8CA 3KHCA 2WA4A 3IKWA 3O12A 2J1EA 4GB31 1LOBA 4MXWB 3NJXA 4PLMA 2CAUA 2LROA 4YGEA 4XEZA 4XUTA 1VB2A 1W90A 3ZXGA 2CGPA 2HYKA 1UMHA 3MLJA 2D44A 2D7FA 2W0XA 4IETA 1QXPA 1JH5A 2ZBJA 2ZCWA 4TN7A 5FZ8A 4S2GA 2GMPA 2DCZA 1VAMA 5B4XA 3ON7A 3HVDA 4BH9A 4LE4A 3VZKA 4MGSA 3E6DA 4QX8A 1V9U2 3CNAA 4IEWA 3C3VA 3I3EA 5LZ6A 3UYJA 2DU0A 3RI9A 3THPA 3OUJA 4ARXA 1MACA 4MGIE 1AXZA 4XETA 3IMMA 1LOGA 3VV1A 4EZ4A 4Q5OA 4L8QA 5IK7A 4UBGA 2VXRA 3KT1A 1K5JA 4ZKTB 4YGCA 3FC0A 1LOCA 3ZXFA 1HN1A 2GN3A 4LK7A 4HANA 4BQ5A 1HRI3 5FYMA 3AZWA 4LKFA 1MS3A 3R4UA 5DUXA 2PHFA 2BTVC 5FXXA 1PM4A 3K3OA 4Z92B 1GP6A 1W6MA 2XJPA 4Y22B 3N3HA 3Q8BA 3NNJA 1X36A 3B69A 1XU1A 3EB7A 1MQTB 5DZFA 3WF4A 2OS2A 1G86A 4AEKA 3LPFA 4CP0A 4ET7A 2PHRA 3O1SA 5J1XA 2WQZC 2ZA9A 4BQ4A 1BXHA 1UKGA 2F4PA 2VNOA 2Y64A 3NNGA 4LLFA 4NRQA 4QPWA 5FY4A 1UY4A 1TME3 1UYXA 3WDXA 1FMD2 3VKFC 3LFIA 1REEA 1SLTA 1W0NA 2VCMA 3QD6A 4Q4Y1 5FXWA 3TOJA 3GF6A 1ZX5A 3VKMA 1HXS1 4RFT0 4CDUA 4LBJA 4PLOA 3O5SA 1GANA 4A2UA 5FLJA 5FBZA 4YW6A 4MADA 3LEGA 3TAYA 1VB4A 3GALA 2P3IA 2R1BA 4UFHA 2P6HA 1POQA 1RUJ3 4I2OA 1SZBA 3T4HB 4K8FA 3JB4C 4V1PA 5FZGA 4QQOA 4KWJA 3PU8A 3VBHA 1YFUA 1WCDJ 2Z69A 4ATEA 2QVSB 4Q0VA 3TBDA 4CPBA 2ZX4A 5ACA2 4Y1ZA 4FSJA 5J96B 1PMJX 4ORFA 3OYWA 5FPAA 4AFMA 2CV6A 4DQAA 2HWF3 2UWBA 1E5SA 2PLV2 2VOWA 1GWKA 4YG6A 5IK8A 2ERFA 3OGGA 4JV4A 1VRH1 2E7TA 2RR12 4DO0A 1OKOA 5KXBA 1Q8VA 3THTA 2Q0AA 3USUA 4AQ6A 4AVVA 2BZDA 1NQJA 2QFEA 3HD8B 3KV6A 3RMYA 5FZ4A 3WF0A 5IATA 3O1MA 5D8AB 1CN1A 1YIFA 2G4IA 2ENRA 5C3QA 5JSPA 1D7PM 1W06A 2WNOA 4OI4A 4M4RA 3ZSMA 2G9ZA 3NAPC 5D2AA 5FV3A 4LITA 3S5QA 1GKBA 4AE2A 1JYIA 2VZTA 2BOJA 4YZ2A 3I4IA 1STMA 5LRSA 4C90A 4C0BA 4ZU7A 4CCDA 2WZEA 2DCYA 3VN4A 1F4AA
chains in the Genus database with same CATH topology
1RUC1 1WCSA 2XJQA 4HN0A 5FFOC 2R073 3TYJA 1I5ZA 4QQHA 2DFCA 3CJIB 2ZMLA 4IV3A 4F3JA 4A7ZA 3VHOA 3P3NA 3CL1A 3PVOA 4N7IA 1YJKA 4G3YC 4YFZA 1ASJ2 4RGAA 1RGSA 2TNFA 1C8M2 3FBMA 5GLVA 1ULFA 3H7YA 1S0GA 1AL22 3E5QA 3OF1A 4CP2A 1W6QA 5C8CB 3ZXEA 3TNPB 1AYN2 2PHUA 1RUE2 5J48A 1G9BA 3N36A 5DXDA 2B8MA 1VR3A 2UYAA 2JXAA 3AJYA 2TUNA 4QPGC 3N4MA 4IV1A 2VUAA 1IS6A 2RJKA 3I59A 3IN9A 3OBTA 1CAWA 1ZZ8A 4D69A 4B8EA 2MEV3 4PQ9A 2IFRA 3FUQA 4H55A 3W9AA 2BUKA 2WNUC 4AQTA 1LOAA 1RUG3 3UK9A 3ZFFC 4HKWA 2CL2A 4COWA 4MYEA 1S0IA 4JCKA 4XFFA 3WCSA 3VBFA 4FQ4A 4RQPB 1DQ2A 4PF5A 1AXKA 1SFYA 3KB5A 4AEDA 2XVKA 1LHVA 1IS3A 1PO12 3ZSKA 1MEC2 2H6CA 1SCRA 3MIGA 2RMU1 3AP6A 1AUYA 5K0UB 4JAAA 4Q4W1 4N43C 5I91A 3M70A 2X8KA 5GM0A 4DRVA 4Z1VA 1JXNA 1JHNA 1J58A 1VBE1 2E51A 4FO9A 1UKRA 1OPOA 3DV8A 2DVDA 1H4HA 4JDOA 1XE7A 3RZZA 3WW2A 1Q56A 2Y38A 3ZFEC 1DQ0A 4YG0A 1N1VA 1Y7BA 4QQ2A 3I54A 3ETQA 2WNVC 5DUWA 4YW5A 3AK0A 2BQPA 4FBFA 1W6PA 1LECA 4IQPA 4AI1A 3BCWA 1LOFC 2QCSB 2ZGQA 3OTFA 4OVEA 2JG9C 3QLQA 3MF6A 3MIHA 5T50A 2A6YA 5E8AA 1WW6A 5BPXA 3D4KA 1C5HA 1PIV1 4FPFA 2HWE2 1VBD2 2WSVA 1XE8A 3VL8A 3ASIA 2WSUA 4OZXA 3AB0A 1LRHA 4Q27A 1WD4A 1RUI1 1NG0A 3GZUC 3ZX7A 1TE1B 3MPPG 3HIFA 4B3NA 1WLTA 2O8OA 2H6BA 3T2TA 4C1WA 3B93A 1SQ4A 2BWAA 3GHNA 1OQEA 4NHMA 5GALA 5A33A 2MHFA 1HRV3 2YYOA 4GALA 4LBNA 1DG6A 2IXIA 1COV2 1Y9QA 3MW3A 3PHMA 1FX5A 4K7JA 1DZQA 1PZ7A 5LK7B 2A6ZA 1AYM2 2XGXA 1YFYA 1MQTA 3NV3A 3ELNA 5FCCA 5AVAA 4D7TA 2OA2A 1H1MA 1QQP3 1VBB3 3HBZA 1BEV1 4XQDA 2GSYA 3ILNA 1QH7A 5KHIA 2YZ4A 3Q9OA 4BLIA 2RM21 5FMOL 4Q26A 2OUJA 4MGYE 2E63A 4J1XA 4KGQA 3SLIA 4XF9A 2B45X 3OBRA 1FOD3 1N3OA 4FVVA 4XQWA 5CNAA 2AH2A 2W08A 1O7FA 4B7KA 1HDKA 3H3ZA 5A3LA 4FPYA 5KXDA 1C1FA 1C8NA 4OI2A 3HT2A 2WC2A 4XPVA 4IEVA 3WG4A 3JBG1 2QQPA 2A7AA 4DRRA 1WMEA 1YFXA 1OLRA 4KNCA 3HN1A 4QGLA 3EBRA 3GHMA 3RYRA 4JVAA 2DU1A 1AR83 4YYOA 4B7EA 5L7OB 4MXVA 4IEPA 2IXKA 2K0GA 5D8AA 2GH8A 3WDUA 1NCQC 3KCCA 3IDCB 1RUD3 1HRI2 2P2KA 2PYTA 3WG3A 1RL3A 3ZIXA 2ZGMA 1BMV1 2DVBA 1QXJA 3V0AA 5EV7A 3R6SA 4J6GA 2DCTA 4Z8BA 2VPVA 2ZHLA 4M3CA 1F2NA 1UCXA 3OGJA 3S7EA 3VUOA 2NQYA 4OHWA 5EWSA 4E9KA 2BVBA 2AGSA 1OMIA 1TME2 4IL7A 1AR61 1HIXA 2D6PA 1R1A1 5FO8B 1TMF1 1WD3A 2PFWA 3I8TA 4M3CF 2D98A 5FOBB 2XH6A 2XKOA 4JGYC 4CEYA 2Q1ZB 4IEXA 5AC93 3R0RA 5C9AB 4YVSB 3O7OA 5JOXA 2EXKA 1MS4A 3AP7A 5SV8A 2XJSA 3ZN4A 1ZBE1 3I2DA 5KXEA 1UU4A 2D6LX 1S2BA 1RUJ2 4Z2WA 1QJU2 2ZHMA 4WVWA 4YVWA 4I30A 1YIPA 1H8TC 3S7IA 4EV0A 4ATFA 3TWIA 1Q3EA 1FMD3 2TBVA 1RHI1 1ZZ9A 1B35B 4RR3C 4FAGA 2HWF2 5A32B 5BNPB 3WD5A 1NA1C 3ECQA 3CF6E 4I0WB 2IZWA 1MZ6A 1QDCA 3VZLA 2DUQA 1LOEA 1CONA 4M0HA 3VBRC 1W6OA 2XLFA 3ZYGA 4CEWC 1NCRB 3VBUC 2X53S 3KS7A 4LO6B 3ZXDA 4AW7A 2DTWA 1X8EA 3FE5A 4HKOA 2XBO1 4C91A 1W6NB 2GDFA 5KC5A 1VBC1 2R072 2R30A 3VDDC 1LOFA 4OUSA 1QJY3 3WW4A 4XFAA 1LTEA 2N7GA 2AR6A 4QPIB 4UXAA 2VOVA 3CO2A 4KQ7A 4AVAA 2A3YA 2HWD1 3LSEA 4GH4C 4MZUA 4GWMA 1KXGA 2HWC2 1DF0A 2JJ6A 3BODA 1DFQA 2WS91 2UY8A 1ZBA3 4XJ8A 4E4SA 1LCLA 1PGW1 2E6VA 1XXNA 4C0HA 4D94A 4W6WA 1QJZA 4BYYA 4CDXA 3V65A 1WLCA 5FO9B 4NR1A 5DG1A 1QJX3 4XXAA 1LHOA 1ONAA 4HZFA 2MEV2 3AMPA 1W0PA 5JSRA 3FHIB 4QGNA 1QOSA 1C8M3 5BNNB 1RUG2 5BNOA 3LA3A 5LEKA 4U2AA 1M06G 4CDQB 2RS11 2ZKNA 5CIRA 2ET1A 2CGOA 3NV1A 2WNEA 4X8PA 4H3WA 4K20A 4L2NA 3EQEA 3RPQA 2RS33 1AVBA 2Z42A 4XIOA 1I9RA 4YW3A 3L2HA 2LUWA 3DPRB 3VL9A 4JTOA 1FNYA 2VY0A 4KL1A 3SNMA 2RS51 1SLBA 1MZFA 2BNOA 4XJZA 4CDUC 1LESA 1RVF1 2D6MA 5E1RA 4DFSA 5GZEA 4P9YA 5CFDB 3NW4A 2ARXA 4HK8A 4QXKA 4LNVA 1V6JA 2D5HA 2H0VA 3VBHC 5F5QA 1FAYA 4HVQA 2ZGNA 3POYA 4HN1A 4EWEA 1RJ8A 4JGZB 1GYKA 1HV0A 1GZWB 4AFAA 1PO13 2WFPA 4PIYA 4K40A 5J09A 1IZ3A 1L3JA 1V6KA 1QDOA 1MZEA 3RWNA 3U4XA 2EALA 3H1WA 5JZGC 1QKQA 1YO8A 2UWAA 3JQWA 1NE6A 4X6RB 5K9YA 2EF6A 2A73B 2ZACA 2YROA 2CGNA 1MVEA 4GIQA 4S2FA 1H0BA 3K48A 3QBQA 2XVLA 4Q0UA 1TQ5A 5L7OA 3AYCA 1ZRDA 2VU9A 4LO8A 5KHGA 4FPHA 4PDWB 3KCXA 3WP5A 3H9AA 4IV3C 1RUH3 4N53A 1HQNA 1QWRA 1HRV2 4XTPA 1APNA 3GYDA 4MVTA 2GALA 3AYDA 3VLBB 1O5LA 3OY8B 2OW4A 4JGYA 4CZSA 4Y20B 1OOPB 1Q8QA 4H7LA 4W6YA 1NOVA 1BK1A 1VBB2 2ZHNA 3SCFA 1RTVA 4K1ZA 4OHYA 1BKZA 2PAKA 1OA4A 1PNGA 4XJWA 5E16A 1MZ5A 3ZFGA 3VBOB 4WM7C 4IV1C 5JCTA 4M01A 1TEIA 1FOD2 3AJZA 4RR3A 5DZGA 2VG9A 3FFZA 4RGGA 3WNXA 1CAVB 1DU3D 5CAZA 4WM8B 3TNQA 4P9XA 3RG0A 5FPXA 1GFF2 4CRQA 1IPJA 3ZYPA 2R061 2A3WA 2A71A 4B29A 1NXMA 3VBUA 3VBFC 1NY72 4ISQA 3RRDA 1UZZA 4I09A 1B35A 1CX4A 1WBLA 3ZYRA 4X6QB 1YHFA 4AEDC 3H7JA 2EXJA 4YM3A 5A32A 2WZPP 1ND3A 1LGNA 3VDDA 3B5LB 1AR82 3ILRA 2W52A 4GB33 1BBT1 3AP9A 3D0SA 5EFUA 3E5XA 2JX9A 4GH4A 1DQ6A 1KD7A 3DN7A 5CA6A 3SHRA 4OUMA 2VVEA 4YGDA 1KJRA 3W58A 1CGPA 2JICA 1RUD2 3OD4A 4BMBA 4AXOA 4YM1A 1ULEA 1OSGA 1QNYA 2A6VA 1DQ1A 1RJ7A 1K5MA 3A4UA 4HPKA 4AEJA 4BM8A 4HMZA 1VP6A 1PVC1 2R6QA 1LHWA 4YLZA 1RUF1 4BOWA 3IDBB 2ARBA 3WUCA 4AGRA 5FQ0A 3IT8A 5JSOA 3TRSB 2EAKA 3VZJA 4GWNA 4IEOA 2WA3A 4B4PA 3HMYA 3M1HA 1Z7S1 4HL0A 5AC92 1JUIA 2D43A 4GMP0 3LA2A 2ZMKA 5C4WA 4M00A 2RHPA 2WZR1 4OI1A 4XBNA 2ZX2A 5AFBA 1QGLA 4AGVA 1PK6A 2GNDA 1WLWA 4ZU5A 1H8VA 4Y5Z0 1HXS3 2GAUA 2PTMA 1XYNA 1ZNPA 5T54A 3MW2A 2ZS6B 4FTBA 4UW4A 3IIAA 1C3HA 2A5ZA 4LHKA 4L92A 4BIFA 1FV3A 4P9GA 4LBQB 4QQPA 4FPLA 4K1YA 3NVCA 1MQTC 1VBA3 1ZA4A 4AFCA 2R16A 3FFQA 5GZFA 1YFWA 1U0AA 3CJXA 2JD4A 5ABJA 1DIWA 1QJU3 4FTEA 1AHSA 4E4ZA 3D6EA 5JLVA 2DFBA 4I0BA 4Q4V2 2HJIA 2MPFA 4N9HA 1VRH3 2K2SA 3ZSJA 5FREA 1TME1 2QZ3A 5GZGA 1QJY2 4OHVA 4FCAA 1DQ5A 1R091 3L9JT 5C8WA 1ENRA 3M7AA 1Q8PA 2WFF2 4K9SA 5JZGA 3KLSA 2ZAHA 4OHXA 3RJ2X 1PGL2 3RQ0A 4NWVA 2I07B 1REDA 3ZIWA 3VZOA 3MLLA 3AYAA 3PMEA 3EHKA 3NAPB 4YG3A 1ZBA2 2IC1A 5DG2A 3B94A 1ND2B 4LTAA 1GZWA 1UW8A 3K51A 1ZREA 3MICA 5C6CA 1V6OA 1J1TA 5HCBA 4Q4X1 4ASLA 1V6NA 4URTA 4JDNA 4CDWA 2KA3A 5L36A 1QJX2 2FBEA 2XJUA 3WHTA 5D8AC 5J37A 4E2SA 4GXLA 2IXLA 4Z82A 2HWC3 3PVEA 1LGBA 3A0NA 1DGWX 2WINB 2VW1A 2BPA2 1REFA 2R041 4R9CA 1GV9A 2EAAA 4P14A 1GLHA 3FJSA 2RJLA 1YJLA 4TYSA 3M8LA 1WMDA 3V56A 4KGGA 1EV11 4RHV1 3KM5A 2RS32 3JD71 1RB8G 1OI6A 1U5YA 4LBMA 5I8YA 1H2KA 1SBDA 2X5IA 2ZTNA 2R071 2ZGSA 4QPGB 4WM7A 4GMP1 3WT3A 5CB7A 2LTNA 1UZYA 3OY8A 2A6WA 4LUKA 4XFGA 2ZHKA 1PO21 2D3SA 1V70A 2ZJCA 4NHLA 4MSVA 2WNUB 5C8CC 5J98B 4INDA 3ZFFB 4CEYC 1GICA 5CFCA 3BOWA 4WBBA 3SITA 2UY9A 3UKTA 4UW5A 2YC0A 3AKQA 1D4M3 4DB5A 5I0TA 4YVWC 1E57A 3ATGA 3UKVA 1AR71 2EXHA 1F5FA 5AFEA 4R52A 2QDNA 4Q4W3 1CAUB 3R4DB 2HEYF 1VBE3 2I2SA 1H2LA 3B9IA 1AZDA 5EXOA 2MEV1 4N43B 4RS5A 4MGZE 5KC6A 1I3HA 5F6KA 4AGGA 4M3CE 3RS6A 4JRLA 1N47A 2R32A 1AL0G 5T5JA 4XBLA 3FLTA 5FMOS 4NO4A 1MS9A 2W68A 3V64A 4NPRA 3ZFEB 4XIKA 4CYDA 4LBLA 1KDMA 2YGLA 4XE9A 4R9BA 1ZRFA 5KHKA 2WNVB 3JCIA 2GMEA 1PVXA 1I1EA 1H1AA 1PIV3 4PIZA 2JG9B 1RUH2 2YY1A 5T5PA 5T3NA 4MXWA 1Y43B 3FBYA 2NPIA 2G9GA 1RUI3 5JIAA 5HXVA 2NZ9A 2NM1A 2QDRA 1WW4A 1H9PA 5IT6A 1DYKA 3LSDA 3GBGA 3PNAA 4EWAA 2D6NA 1F8VA 1H30A 4ES8A 3ACLA 4NHKA 4COYA 5L19A 3J8F3 1S1AA 2VMGA 4WV8A 4CDXC 4AVCA 1F31A 1SACA 3KT4A 4YSFA 4P9LA 1RUNA 4COZA 1OA3A 1ULCA 5EYXA 3RJRA 3HQXA 5GZCA 2PN5A 4IEYA 1DDLA 2RE9A 1MR5A 1R083 4XJAA 1U5IA 1N3QA 3WW3A 3S0MA 3ZVXA 5HCAA 3LWCA 2ZZJA 5KWRA 3RYPA 4WVMB 1BEV3 5BNOC 2PA7A 4Y22A 3ZN6B 3TN91 2AUYA 5H9SA 2WLPA 3M3EA 4E27A 5JAXA 3WX5A 3FX3A 3U11A 4RD7A 1LEMA 2HEWF 3ZXLA 4XJ9A 3KCYA 2ATFA 4P9JA 1A3KA 4FXGB 5EYYA 2QZ2A 1JUHA 4GB32 1C57A 2XJVA 2C1FA 3W59A 1QXRA 5JOZA 4E2GA 5DUVA 3BPZA 4P9IA 3JBG3 4LBKA 2PHTA 2CYFA 3DUIA 5F1RA 3HT1A 3NJZA 5BUVA 1QQP1 1VBB1 2C0ZA 2CWMA 4COUA 2GC2A 2O8QA 4MGKE 1UIJA 3MLKA 1OFSA 2DURA 3WDWA 4R9AA 2AZ5A 4YARA 4HETA 3M2MA 3V0BB 5GJ6A 3MIDA 2XLAA 3G6JB 2JG8B 1CR7A 3R4SA 4YW2A 4AF9A 1V6MA 4EN9B 5JI7A 1NCQB 3T1LA 5LRRA 2GH2A 5L73A 1CQ9A 1N1YA 2EVXA 2NYYA 1EPZA 1GZ9A 5JPNB 2HWB1 4LR4A 3N7JA 1S2KA 3OD0A 4YM0A 1SLLA 1HW5A 4Y24A 2BFUS 1NE4A 1VALA 2Q5TA 2WT1A 4RA0A 1MS5A 2PHXA 3WG2A 3PJQA 3IM0A 3U0ZA 3KZ4C 1CD3G 3CJIA 5L7OC 3AM2A 3AMNA 1UD1A 2WT2A 3MGUA 1HXS2 5CBLA 4N53C 4A7KA 3KGZA 2GZWA 5DDJ1 4XXPA 4AVBA 2BVVA 1AJKA 1VIWB 4Y1VA 5C8CA 3WZ1A 5FLHA 4PBPA 4I3PA 4FOWA 2BEOA 1KJLA 4Y1YA 1G9FA 1VBA2 1DGRN 1CVNA 3MIBA 2WKKA 4Y1UA 1U12A 1V9U1 4YGBA 1H8TB 2NMNA 3EO6A 1EY2A 3ZFGC 1PHMA 5CG9A 1O4TA 1CAXB 4KH9A 2DUPA 2TEPA 3X29B 2Q4SA 3ZMNA 1VRH2 3AFKA 1KFUL 4FP3A 2P17A 2ZMNA 2VQ0A 4BA6A 3ZMOA 5J7MA 1H2NA 3TB0A 3BU7A 1W0OA 2NP0A 4Q8KA 5FPZA 4GQ7A 3MIFA 3WW1A 4LHNA 4MLOA 5T52A 3WQ1A 4RQPA 2ETEA 2XBO3 4CEWB 4F8AA 3AMHA 5GKAC 1D4VB 1ZZBA 1QH6A 1UU6A 5TSWA 1FXZA 1VBC3 3ME2A 1O3TA 3WDTA 1H1IA 5SV5A 2VVDA 1BQPA 1B35C 1RMU3 1AR93 4P9WA 4Q4V3 1HV1A 5GLWA 4DY3A 3KMHA 5I8SA 4IERA 5BNPC 1ND3C 2HWD3 2PHWA 5K0UA 1FMD1 2HEVF 3RDIA 1YNAA 3AXDA 4FAHA 2K9ZA 2ZX3A 2WFF3 4LBOA 2WS93 4XJUA 2JECA 2XVGA 4O9GA 2QUOA 3AMMA 1SMVA 3EXUA 4K3UA 2NLRA 4Q2FA 5JR7B 3VHRA 1BVP1 2XHKA 1FPN3 1ENQA 1FV2A 3B02A 3BB6A 3WUDA 1K5MC 4L11A 1BYHA 4JDMA 1GBGA 2PAMA 2B7YA 5ACA1 1BCXA 4QPIC 3MYXA 2MNGA 3LOBA 5JOYA 1O3RA 1QJY1 2XUMA 1SFNA 2PLV1 3LZZA 1N1SA 4KG8A 2AYHA 5C33A 2RR11 3IMNA 2VMHA 3KGLA 1M4WA 4Q29A 5I0RA 2BNNA 3SH3A 4WVZA 1HQWA 3NV4A 5C4WC 1W6MB 1QF3A 5B2GB 1HX6A 1O4ZA 2AENA 2P3JA 3SXWA 1ZM1A 1OQ1A 1D4M2 1BJQA 2CTVA 1Q8SA 4Y4YA 1S0CA 1O91A 1PK6C 4TZDA 3FLPA 1X82A 2SLIA 3KT7A 4I3GA 2WT0A 4Q4W2 2RS53 2BGCA 4QGMA 1RVF3 1VBE2 2VVFA 1VAVA 4Q0PA 3LKJA 3N7KA 3VBSB 1GQHA 3HAGA 4CDUB 1ASJ1 3O0VA 3ZN6A 1C8M1 2DWRA 4EN7B 1MS8A 5CVRA 1IHMA 4FOQA 1AL21 1EAH3 4EROA 2PHLA 4YRDA 5KBFA 4MX3A 4DOUA 2BW8A 2DCJA 1AYN1 3PVNA 2KXLA 4JRAA 1RUE1 3LB9A 2VNGA 3POWA 3ENRA 3AMQA 4HK9A 5E88A 3ZPYA 5ABJC 1J59A 3VBHB 2XB6C 1ALYA 3POSA 1NLRA 4A7YA 1G9DA 3UJOA 1CPMA 2I45A 4KBBA 2ZABA 4W6XA 3DPRC 3OYWB 4XF1A 4N9IA 3LCPA 3AX4A 1PIV2 2VGDA 4LBQD 3H8UA 3AP5A 1NXD1 2DVFA 3USUB 1ZYBA 1RUI2 1UPSA 1J3QA 5HBAA 4SLIA 4MH0E 3BALA 4LE3A 1LENA 3JUUA 2YXSA 4JGZC 1PMIA 1YXWA 1UN1A 3M3OA 3OPZA 4HKLA 4Y26A 3WVJA 1V6IA 1UX6A 1GNZA 3J8F2 4LHLA 1WW5A 1B09A 4H7MA 3DF0A 1PO11 3WHUA 1MEC1 3E97A 4IV3B 4CDWC 3FUOA 3H3UA 3UKNA 3ZYIB 1LU1A 3AXEA 1R082 5T5OA 1DLLA 1DZRA 1WUVA 5BY5A 2QKDA 5T5LA 1KFXL 5I0UA 5H9RA 3ZYJB 1HQLA 1POV3 4YNIA 1XNDA 1BEV2 1YYNA 1W6QB 3BTAA 5FDBA 2RM22 2NMOA 2B5HA 4JQRA 1C4RA 2BBVA 1C1LA 2O0OA 3MI8A 2ZAAA 4XOGA 4PDWC 1G8WA 1D2QA 1UAIA 3IWZA 3GBFA 2X5IC 5JVVA 1FNZA 4IV1B 4ZXKA 3U07A 4R4XA 4XHXA 3I59B 1CAWB 1WCKA 2V5YA 2CAVA 4IEUA 3WXPA 2R063 4YZ5A 5C9AA 1OOPC 4YVSA 3MDPA 2HWE1 1VBD1 3JBG2 4K6BA 4P5HA 1RITA 5CFCC 3L2YA 1UIKA 1BZWA 3NWKA 2R1DA 2OUHA 3GZTB 1Y3TA 2ZGTA 3VBFB 3O0XA 3VBOC 3INAA 3EJKA 3HWJA 2XJTA 4AQSA 1ULGA 2VULA 1BBT3 1HKDA 5BNPA 1WBFA 3N7MA 2Y0OA 1RC6A 4NOTA 2OZJA 1J1LA 3AKRA 3JZVA 3QH6A 4XF4A 4RS5C 1SLAA 3AZXA 3J26N 1COV1 1XYPA 1BMV2 2ILMA 4QQLA 1IGOA 4ZU4A 3ES4A 3WCRA 4DMIA 1AYM1 1NCRA 1X8MA 2JEMA 1OFNA 5IUQA 1JBCA 3SCGA 2PQQA 4AHWA 1CPNA 2QJVA 1W6NA 4BE3A 2YUEA 1RUF3 4M0NA 2A6XA 1MVQA 4BMEA 1YI9A 4KWKA 1W6PB 1AR62 4LO5B 4QPIA 1TMF2 1SDWA 2VW0A 3NO8A 5FAXA 2A70A 2WJSA 4I01A 1GQGA 1EP0A 3E6BA 1AJOA 1Z7S3 3WQ7A 3HR9A 4KWLA 4HVRA 4L99A 4FPEA 4CP1A 1ZBE2 2WZR3 2DVGA 2OYZA 2OZ6A 1KDKA 3VHPA 4AVSA 1IPKA 3N7LA 4QT6A 2D97A 1RHI2 2IXJA 4ES9A 5DZEA 3WLUA 4BWOA 4Q4Y3 5A33B 5GLZA 3AKSA 4AI2A 3AZZA 1IQAA 1IOAA 1YLLA 3S30A 5FRAA 3GZAA 2GNBA 4AVTA 1YRZA 5BNNA 2ZPXA 2D5FA 3ST7A 2D6KA 4FTSA 1HRI1 4FPCA 4YZ1A 5H9PA 5LK5A 4CDQA 1U5XA 1V6LA 1UMZA 1X7NA 1S0DA 2XBO2 3B00A 1VBC2 4W65A 4AK3A 1SBEA 5FO7B 2QE3A 2YPJA 1RMU2 4PJYA 1AR92 2LM3A 1R093 1LR5A 3B01A 4SBVA 3DPRA 3MEPA 2HWD2 4HBNA 3VBSA 4PLNA 3AKTA 1QU0A 1YI7A 2BYVE 5T55A 4XFBA 4XHBA 4DS0A 1H9WA 2WS92 5CFDA 1BVVA 3U10A 1O5UA 4MUVA 1PGW2 4UBHA 1VBA1 3S6PA 1FPN2 3QACA 3BOPA 3CEWA 4Q4X3 1RUC3 4JGZA 1RUJ1 3WV6A 1QJU1 3C2UA 4FOYA 2ZGRA 3WOGA 1V00A 5KHJA 2R0FA 3WG1A 5I93A 1G6NA 1EYBA 2HWF1 1S0JA 4FP2A 4XFIA 3RNSA 1YUDA 2C9AA 4OI0A 2V73A 2ET7A 5DUUA 2R043 3LA7A 2FMYA 2UU8A 4LLOA 4AFBA 2RS12 1ND2C 5BYNA 4WVVA 3V0AB 1EV13 4RHV3 4ASMB 1MS1A 2ZGPA 3JD73 5IK5A 5BNQA 4D3WA 3D82A 1Z0HA 4J1WA 5D1IA 3AZYA 4GMP3 4M3CB 4PBOA 1LU2A 4PDWA 3CJIC 4R4ZA 1PO23 4AG4A 2AREA 1JW6A 1OKQA 2RS52 5KHHA 3O0WA 4COVA 1RVF2 2B9UA 5H9QA 4AFDA 3MW4A 3VHNA 4D7YA 4Y20A 1OOPA 4AHXA 2HWC1 4CEYB 3B7MA 4KU8A 4XF0A 1F5JA 1DGRA 2XWJB 4Q1RA 1EAH2 3MZHA 4QM8A 4D7SA 1AR73 2Q1MA 1KS4A 5JPMB 4WZFA 1Q43A 1QHDA 3VBOA 5CG8A 4XFCA 4YVWB 1WGPA 2HKXA 4LO7A 3RSJA 2RMU3 5JI9A 3GNEA 4AWDA 2CY6A 1CAVA 1DGWA 4H14A 4WM8A 2CWSA 4BZ4A 2D6OX 3DL3A 3J9SA 1S55A 4UW3A 3URFA 1S0EA 1RUG1 1TNRA 2BNMA 2QNKA 3ZO0B 1W6OB 1LGCA 4LULA 4RQPC 4DZGA 1PZ9A 5JWPA 1VAKA 4XZPA 1D4M1 3ZXAC 1FT9A 2VNRA 2ZKLA 4TSVA 4DINB 1PNFA 5K0UC 1ZRCA 4I0AA 2I74A 4AYUA 4XQ4A 5F6LB 2Z5WA 3IDEA 3USSA 1IS4A 1LKNA 1D0HA 1IKPA 2DVAA 1W39A 1A6CA 4GULA 5FLIA 5JMCA 3SCHA 1X50A 4ITCA 4QHBA 2Z2SB 4NN0A 3SH5A 1WLDA 4CDXB 4N7UA 1ZZ6A 4YW1A 4NVPA 3H1MA 2XWBB 4E4DX 1LODA 2ZGUA 1NYWA 3QCWA 4AQ2A 4Y1XA 1N3PA 1WW7A 4Q0QA 4RSUA 3TN93 4BQ1A 5GLTA 2XKPA 2R062 1FATA 4LT5A 4OHZA 5BNOB 1LJ7A 4OFGA 2E7AA 2XL7A 1UF2C 2RM23 4JTNA 1HLCA 4FPGA 1DHKB 2OIIA 4XYXA 1JN2P 2B42B 4DXZA 2LALA 3RMXA