3WQ7A

New crystal form of the hyperthermophilic family 12 endo-cellulase from pyrococcus furiosus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title A new crystal form of a hyperthermophilic endocellulase.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 74
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq7A00
3VZOA 1M4WA 3WR0A 4H7MA 1OLRA 2D97A 1XNDA 1BCXA 4S2FA 1HV0A 1KS5A 1KS4A 1TE1B 1XNKA 3VZKA 3WT3A 3B7MA 1XNBA 2B45X 2DCZA 3VHPA 1IGOA 1NLRA 2VULA 1H4GA 1H4HA 1H8VA 1H1AA 1H0BA 3AMQA 3MFAA 2B42B 3O7OA 5K9YA 1UU6A 2DCJA 3ZSEA 2JEMA 2DFBA 5EJ3A 1C5HA 3AMHA 1PVXA 1XYNA 3VGIA 1HIXA 3MF6A 3VZLA 4NPRA 2JICA 3EXUA 1XYPA 1UU5A 2BWCA 1REDA 3AKQA 1F5JA 3RI8A 3M4FA 3WQ1A 2BWAA 2VUJA 4HKWA 4HK8A 4S2GA 2Z79A 3AKPA 3AMMA 1OA2A 3VLBB 3WP6A 1XXNA 3RI9A 3LGRA 3B5LB 1QH7A 1AXKA 3AKSA 1XYOA 3HD8B 1REFA 2D98A 3WQ0A 1QH6A 3WXPA 1REEA 5HXVA 2C1FA 3WP5A 1OLQA 3VHNA 2DFCA 3WP3A 3VZMA 1C5IA 4HK9A 2F6BA 1BVVA 1OA4A 2DCKA 2VGDA 1OA3A 2DCYA 4S2HA 3VHOA 3AKRA 2B46X 1T6GC 1BK1A 3LB9A 1ENXA 3VZJA 4XQWA 2QZ2A 4HKOA 3AMPA 1YNAA 3VZNA 5K7PA 1HV1A 2NQYA 4S2DA 4XPVA 3AKTA 3AMNA 2BVVA 3WY6A 2VG9A 2JENA 3WX5A 3VL9A 4HKLA 3WP4A 1W2UA 2QZ3A 1UKRA 4IXLA 1XNCA 4XQ4A 2BW8A 3MF9A 1UU4A 4XQDA 2NLRA 3MFCA 3VL8A 3WQ7A
chains in the Genus database with same CATH superfamily
4AGVA 1Q5OA 4AVAA 2YFZA 2BOJA 1CAXA 1CZTA 4A7KA 2E7TA 1ODNA 1UXXX 2ET7A 4QHZA 4COZA 1JBCA 4LO7A 1RUJ1 1R1ZA 5FYHA 1H9WA 3SC7X 1CAXB 4ZPIA 3AJZA 4TN7A 4MGSA 4OUMA 5T3NA 4CPBA 1G9AA 2WAOA 3AL6A 3FHQA 2DF7A 4Z2AA 3H50A 2WO2A 1QXJA 3N3HA 3FLTA 2IZWA 1W0OA 1WLTA 5LA2A 1WCDJ 2ZGNA 3S7EA 1OD5A 1UIJA 3D0JA 3GGLA 4RHV2 5H9PA 1VBE1 3K4DA 3O7OA 1OPMA 4WVMA 1QJY3 3H1WA 4HG6B 5SV5A 3WQBA 1VIWB 5FZ8A 3B00A 3PIGA 3WD5A 1YUDA 2HJIA 1ZRRA 1MEC3 1H1IA 4XZPA 3ILRA 4CUCA 2X10A 4U2AA 5FUIA 1NE4A 3Q8AA 4JZRA 5DAPA 2W94A 4NHYA 2W87A 1XRUA 5F2SA 2QBXA 4UFLA 1S0CA 1OF4A 2RM21 1K3IA 1CIWA 4YW2A 3RZLA 1OH4A 3AC0A 3POJA 2UURA 4P14A 3RI8A 3ZYFA 3U78A 3SEEA 2BZDA 5J3UA 3CJXA 1G86A 1MZFA 1SDDB 3LDBA 4JRLA 2WNUC 4A6SA 1PIV3 4PI0A 4UW6A 3UESA 2AGSA 2R6QA 3N9LA 5FY5A 3ZFEA 4FTSA 4AE2A 3UYJA 1LKNA 1J84A 1HB2A 4KGQA 2WABA 1XYOA 2WO7A 1AL22 3N7KA 3VKFC 3ZFEB 5C33A 1TVGA 4E8DA 3DKQA 3H1MA 4XFFA 1RIRA 5CNAA 1OLQA 3MV11 1CESA 1R092 3W59A 2GNBA 1IG0A 4AQSA 1W8ZA 4N43C 4AW7A 4TSVA 1MS9A 3SQOA 4JCKA 3N7JA 4ZY9A 3ZPYA 2O8QA 1GQGA 1W8NA 4IEPA 4PF5A 1JMUB 5JR2A 2FQPA 5I0DA 4HBNA 2Z2SB 5T5OA 3O1VA 2K46A 1QNYA 2MEV1 3B01A 5CADA 1JU3A 1QJY2 2FDFA 3POEA 2VCMA 4P9JA 1HV1A 1VBE2 4DS0A 1VBB2 2QQKA 2W5FA 4XPVA 4ZU5A 1MEC2 2BVBA 3PUIA 3GZUC 4AFAA 3KT4A 4FSJA 1UMZA 5F2WA 1SHWB 4QAWA 1FOD3 1W06A 5J09A 3ZYRA 3LWCA 3VKOA 4YG3A 2JDUA 5IAXA 2RMU3 1CWPA 1GP4A 5E89A 2VUCA 5KHGA 5JCTA 1OFSA 1K5MA 4K7JA 3VN4A 2LUWA 3ECQA 1ZREA 2B9UA 5IK4A 4LIUA 3QH7A 2WT1A 2B4KA 4DIQA 3NW4A 2F4LA 1BXHA 1MS5A 2R1BA 1K5MB 5A6XA 3VL8A 1PIV2 1GOHA 2WC2A 1N1YA 3CDZB 2AYHA 3UK9A 2YC2A 3POWA 4A4AA 4JDNA 4UFJA 2ZHMA 4EN8B 4NIGA 4R9DA 1YJLA 4H7MA 3URFA 1T6BX 5FRAA 4LORA 1Q8SA 1AUYA 1LESA 3ACGA 3PMEA 4P9YA 2ZHLA 4XYXA 1H6YA 1QY4A 1I6XA 3GJAA 4FPYA 3E97A 1WW4A 2Y34A 4OCTA 3NNJA 1VAVA 1LOBA 4LBQD 4A2UA 5AFEA 1PHMA 1UZ0A 5C3QA 5C3RA 1POV1 5LA1A 2YBKA 3VBOC 2VZQA 2G9ZA 4M3CE 4NR1A 4AEDC 1PGW1 2VECA 3AVSA 4XFIA 1KITA 2NM1A 2V09A 4EN0A 3T2PA 1S2EA 4I2OA 1YQ2A 3RFRA 3VHRA 1V6LA 4NWWA 5FYBA 2CDPA 3QD6A 2IFWA 1LHOA 2YHJA 5A1AA 3ABZA 4BQ3A 1BBT1 3HWJA 3T2QA 3WNLA 2YROA 3JUUA 1OPOA 3GXUA 1F9KA 2DFBA 3OYWA 2A70A 4XUTA 4N53C 3P6BA 1NG0A 2VJXA 4OVEA 4D6SA 2RS11 5FBZA 4E4ZA 1PX4A 4YGEA 2BPA2 3ACHA 3OYWB 5A3UA 5JWPA 2W3JA 3LEKA 4XCAA 3O1PA 2G9GA 4GWMA 3OPZA 1BLZA 1JZ7A 1RTVA 2V72A 1RUH3 4DNYA 5JOWA 3KV9A 3ALQA 1RUF3 5FY8A 5GLUA 3VBRA 1ND3A 4XVHA 4GULA 4XJWA 4GKYA 2R30A 3H8RA 3BTXA 1EV12 1NA1C 2EIDA 4JGZC 1JTZX 3JU9A 3VBRB 1ND3B 1YQ8A 2JDPA 3WP6A 1ZRIA 1BEV1 4CXYA 1DG6A 4KBBA 2VZSA 4JQRA 3E5XA 3N36A 4KU8A 1RUD3 4Q0UA 3ZYGA 1TZOA 1W3VA 2ZMLA 3B9IA 4O9EA 4XAAA 4D7YA 4E2SA 1OKQA 5ABJC 1EAH3 1NAEA 1JODA 2B8MA 3I3MA 3FX3A 4AF9A 2FDHA 4QX1A 4K1ZA 4PLMA 2ZEZA 2EVXA 2PHLA 4AHYA 4XACA 3WP3A 3VB9A 4LA3A 3LPGA 2XBO1 2W1WA 5KXBA 1RHI3 1XU1A 2RS31 1UWWA 1N3QA 2HWF3 3EBRA 4LLFA 3VD5A 4AGRA 3ACFA 4GXLA 1BVVA 1OI6A 3ZLIA 4QKNA 1R1A1 3H0OA 4XBLA 4D0QA 4Y5SA 3WF2A 4TTGA 5FOJB 2D6PA 4KNCA 1IQDC 3N35A 4AXOA 1NZCA 2XLGA 3DF0A 1ZRFA 1OXCA 1J1TA 2RDRA 1ENXA 3KHBA 2C26A 1O4TA 3EB7A 4URAA 3AFGA 2VVFA 1MQTA 5F9TA 1W6NA 2NQYA 2X53S 2GC2A 2QQMA 1Z0HA 5A6YA 3KF3A 3HQXA 4LNVA 1MQTB 1W6NB 5FPZA 4MGZE 4H7LA 3T1LA 3SCHA 4OI0A 2PTMA 3KD4A 5C4WA 3ELNA 4J6GA 4OQ8A 1YFUA 1H9PA 3IIIA 4N90A 2ETEA 2HWC2 2D7FA 1YO8A 2ZHNA 1G9BA 3GZTB 5BV6A 1DLLA 5C4WB 3SLIA 5FFOC 1RUF2 3ETPA 5G04L 4B8EA 2R063 4U36A 4BK4A 4OHYA 5HCAA 5AC91 3VD4A 4CEYC 4CCJA 4EROA 1QF3A 1R083 2F17A 3AZWA 5IJRA 4D7SA 5C71A 1GANA 4LBKA 5JR7B 1QMJA 2W1QA 4P5YA 3W20A 3U14A 3VBUB 2OS2A 1BCXA 1DGLA 1O3TA 1KS5A 2N7GA 2RJKA 1SLAA 4AOCA 1KEXA 1UOBA 1PMHX 2VW1A 5BNQA 4J1WA 1KFXL 2BP6A 5IYYA 4AYUA 3PDQA 1D4M2 4ZS2A 1UW8A 3AL5A 1AX0A 4GMP3 4BXSV 2FBEA 1JYNA 4AGGA 1H8VA 4CDUC 3M3QA 3R4SA 5FZ9A 4EZ4A 1PZ9A 3OGJA 1CR7A 5GALA 3THCA 2IC1A 3I3EA 2ERFA 4XFCA 2Z42A 4FQZA 3PUAA 3D8CA 1F35A 1OVPA 3ZOIA 2WS91 1WW7A 3CMGA 3H8UA 1ZBA2 3WDTA 4BMBA 5FPAA 1KJRA 3ST7A 1IKPA 4H55A 1H8TC 5DDJ2 5K9YA 3VZLA 4Q4X1 1Y9QA 1HXS2 1UU5A 1UY1A 2JDHA 2VE1A 4R4ZA 4P9LA 4CP2A 1J1LA 2BNOA 1PVC3 5A32A 1GU3A 4BM8A 4QKFA 1JYCA 3G6JB 3Q8FA 5JLVA 2WZR2 3ZIXA 4QXKA 5IT6A 5A32B 1D2QA 2VR4A 4XJ8A 4YFZA 2AH2A 2QFEA 3WW3A 1DZTA 4MHRA 4BK5A 1R082 2VXRA 4HANA 3C8XA 2HWB2 3IIAA 4XF0A 4JGZA 1TMF1 2RS51 1IS6A 2R041 4Q4Y3 1S55A 2WQZC 1GNHA 5EP9A 2R0FA 2LALA 5BNOC 4JGZB 2BGOA 1AR63 1QJU1 4RN5A 2VTXA 1QJX2 3CO2A 4BE3A 2IXLA 3J7MA 1H6XA 1LJ7A 2CAVA 3K75B 5FZDA 4B1MA 3PLQA 2WNVC 2D40A 1I3HA 2ZGOA 2PHTA 5FKBA 2LROA 4FP2A 3RWKX 2E7AA 3B9CA 2Q1ZB 2KD7A 3PVEA 1AR73 2WT2A 1YNAA 1LULA 2EICA 2X29A 2XJTA 3GM8A 4ISQA 4P9IA 3SCGA 4AVTA 5KHKA 2RDQA 2BBAA 3A0KA 3AP7A 1CX4A 4ORFA 1NX9A 2YY1A 1NT0A 2V4VA 1IZ3A 4GB31 1GWMA 2JG9C 4C90A 3WY6A 5L36A 2AACA 3HAGA 3NV1A 2V5DA 4FXGB 5FP3A 4LLOA 3UV9A 5FY7A 4YW1A 2WN2A 4JV4A 1UKRA 2E51A 1TME3 1WCKA 1I5PA 2ZGQA 4QGNA 3MIFA 4ZU4A 1A78A 1LB2A 2DV9A 3DKWA 4XW3A 4LTAA 4EV0A 3P5BA 4A41A 1F2NA 1MS0A 3KQRA 2W0XA 2YPJA 1M4WA 5FJKA 5J1XA 4YGCA 1OLRA 2GP3A 2NYYA 3TYJA 1XNDA 2GZWA 3D6EA 2X05A 3JCIA 2PAEA 4CDQC 4CEYA 4AI0A 2VNRA 3BI3A 3EYPA 1RUNA 2O0OA 4QQPA 2CGOA 4UOJA 4LULA 1AR92 2VW2A 3E6DA 3OPWA 3CNAA 4CUAA 3H8OA 2OIIA 3VHPA 2P37A 3APBA 4LOTA 2O14A 3IMNA 5DXDA 3GBFA 1H0BA 5FZFA 3ILFA 5CFDA 2B42B 1VBA3 3U07A 3MLLA 4L0PA 4I3PA 4MH0E 3O0XA 4JVAA 4EN6B 4D3WA 4UBGA 5DAXA 2DCTA 3IAQA 2GN3A 4OYUA 3USUA 5CFDB 1U5ZA 1AR72 2DBIA 3LCPA 4CDUA 5JZGA 5IFTA 2IWGB 2NZ9A 4AVVA 3BU7A 5KC5A 3RSJA 1DQ5A 3USUB 5JZGB 3OPTA 4XFBA 2JDKA 1APNA 1FATA 4SBVA 1LAJA 2GP5A 4Z92B 4JKMA 1W8FA 2JDYA 3AP9A 5L73A 1XE7A 1HLCA 4G4FA 1RUG2 4LKEA 1OQDA 3JQWA 4RQPA 4KQ7A 4YVSC 3CJIC 5D8AA 1FI2A 4BH9A 3UL2A 3JBG2 1FNYA 5A3MA 1JZ6A 3JD71 1ZZ7A 1X36A 4ES9A 4PI2A 4RQPB 3BTYA 3OOXA 5D8AB 3LGRA 4QXBA 2WNOA 1AYM3 1S0IA 5FYSA 5A3OA 2PMWB 3UGHA 4DRRA 3POFA 4BZ4A 5AVPA 5J96B 4I0AA 1O4YA 3QACA 3GZEA 1W2OA 1PMJX 4O65A 5DUXA 2XWJB 3NAPA 1Y3TA 5ACA1 4LUKA 1WMFA 4AHZA 4HVQA 4IDZA 3ZPOA 1IKQA 1MZ6A 3BYWA 3MIBA 1PO22 3NAPB 1O8PA 2QDNA 3RMXA 5FZEA 4B4QA 1PGL1 4JKKA 3ZFFA 3LOBA 3AX4A 3I2JA 1WMXA 4RS5A 1DU3D 1CN1A 4M0HA 2XJUA 1AL0G 3SKVA 3ZFFB 4XJAA 2GNDA 1SEFA 2ZHKA 5FY1A 1VBA2 4RS5B 4KBZA 1UPIA 3PUSA 5FO7B 5FYCA 3J8F2 1UYZA 4URTA 4S2DA 2VY0A 1QXPA 2C4XA 1FMD3 4M01A 3IDEA 4A6OA 4FPEA 2XPJA 2IXKA 1XSQA 3IBMA 1FYUA 2ARAA 2BVVA 2K9ZA 4RFT0 4XF9A 5LB6A 5I91A 1YFXA 2VG9A 3NVCA 3DPRA 1DGWA 4NWVA 5JVVA 3A7QA 3WP4A 3WNMA 4IXLA 3VDCA 1H2KA 1GICA 4TYSA 1SQ4A 3DPRB 4WM8A 3K48A 1FV3A 3U11A 1QDCA 2WSVA 3WHTA 5FP8A 1GOFA 2NLRA 5DAWA 1RUE1 2GN7A 2D5HA 4WM8B 3KT7A 4E2GA 4Y26A 2X5IA 3R6SA 1D4VB 1ONAA 3PL0A 2Y64A 2Q8CA 3GCXA 3WVJA 5KXEA 2H6BA 4Q4W1 3ZM8A 2X5IB 5A7QA 4CCEA 1A3KA 5C9AA 2PLV2 2VQAA 1Z7S3 1OVSA 5F3EA 3ZSKA 3WDUA 1WCUA 5APAA 2WZEA 2R32A 4NIIA 2Y8KA 4XUOA 4QX0A 3WCSA 5C9AB 5LA0A 1VRH3 4ZKTB 1HRV1 4FOVA 2A75A 5DN2A 1TQ5A 4E4SA 4AAPA 2VZOA 3RG0A 3RYPA 3MBWA 2A5ZA 3LE0A 1MVQA 4DEVA 4DO0A 3S0MA 5FMDA 1YEWA 3M70A 1DYKA 1DZQA 5C5TA 1JZ5A 1UZYA 1AR81 1WD4A 1X8MA 2YYOA 3U37A 4XABA 1G6NA 4DMIA 1SLLA 4Y22A 3I2GA 2D43A 2JEMA 1IS4A 2HWE1 4BLIA 3PU8A 1PVXA 4GAZA 3OUJA 1ZBE3 3ON7A 2YBSA 1XNTA 3OSDA 2RVAA 2QQUA 4MADA 1HIXA 1DFQA 1RMU1 4K8FA 4Y22B 3VKLA 3ZR5A 1VBC2 2AEYA 3UKTA 1W3XA 4EWEA 3WW1A 4CCKA 1WW5A 4Y1UA 1HRI1 4OLLA 1RUC3 4YW6A 3RJRA 1HX6A 2W95A 3ZFGA 2VVDA 5DUVA 3TWIA 1VAMA 4Z82A 1CAVA 3JB8A 3KSCA 1S0GA 1ZZ6A 3MPPG 4LO8A 3ZFGB 1NE6A 3ZYJB 3ZMOA 2A73B 3R0RA 1VMHA 4B3NA 1CAVB 2LS6A 3JB4C 4FVVA 3IKWA 3RNSA 4I3GA 2JB8A 4Y4YA 4YARA 2H0VA 2W52A 1JUIA 4CUBA 5FZ4A 1G9FA 1OBNA 2RJ2A 1UIKA 1C8M2 1UAIA 1PZ7A 1WCQA 3CJIA 3LIGA 3MI8A 3HD8B 2Z5WA 1MS4A 4XCBA 1O91A 5I93A 2CTVA 5HXVA 3WP5A 3ZYHA 1AXYA 3B3QE 3CJIB 4IGPA 4CP9A 3VHNA 2DFCA 1Z7S2 4L92A 4Y3OA 1W8HA 1ASJ3 3J7HA 4CCMA 3TN92 4BU2A 1LU2A 4Q0VA 3ZFEC 4ATEA 4CP9B 1K12A 5FK8A 1OA4A 1QQP3 2ARCA 3VDBA 5JXJA 3MO4A 1GLHA 3WEZA 4B7KA 4CU6A 2WFF2 4UW3A 1DZRA 4QHBA 1AHSA 1XE8A 4TLGA 2FDIA 2ZGSA 3QH6A 1UOFA 4DB5A 1YQ6A 2QVSB 4LBQA 4K3UA 1JOPA 3AZZA 5JSOA 1C3HA 2RR13 3AMNA 2AREA 5FWEA 4FTEA 4LBQB 5L7OA 3J4UH 3WG2A 2PFWA 2PQQA 1C57A 4L9BA 3B93A 4HL0A 1NY72 3L9JT 1V9U3 4IEOA 5FZKA 3ORJA 3HBKA 1UYXA 2ZPXA 5LBFA 4RHV1 5L7OB 1X9PA 3POYA 3NO8A 1VBD2 2C5DA 4K9SA 4FTBA 5GZEA 5T55A 4COWA 5L9RA 5F7UA 1GZTA 1L7RA 2WL1A 4V1PA 1CGPA 2ZS6B 1U5XA 1RUI2 2VQUA 4XFGA 3E6CC 1GWLA 1UO9A 4EWAA 2LTNA 3FN9A 4FOYA 1ND2A 2OZ6A 4ZXKA 1QJZA 2R073 4QU1A 5EYXA 4K8RB 1CAUA 1ND2B 1EUTA 2C24A 1K5MC 5DUWA 1HV0A 4YPJA 1KS4A 3BTAA 1FPN2 3C7OA 4R9BA 3LFIA 3H9AA 1XNKA 4FO9A 3T0BA 1CAUB 1RVF3 2ZABA 4AVCA 1W0NA 1OQEA 2FHRA 4RGKA 3S6PA 4E27A 4FFHA 1ULCA 1PK6A 4DY5A 4DZGA 4Q4V1 3HVDA 4R52A 4TWTA 2FMYA 1ASJ2 4Y20A 3ZXEA 2VNOA 1I5ZA 1UY2A 1PK6B 1ULPA 1GP5A 1VP6A 4Y20B 2OUHA 1AL21 1QU0A 2XQRA 3UKVA 2OYZA 2AR6A 5BNPB 3KGZA 5EJ3A 1C5HA 1R091 4FPCA 3GF6A 4XOGA 4ARYA 5A7NA 4LOSA 2GAUA 4XUPA 2YDEA 3MW2A 1VPHA 1GMMA 3POBA 3WINE 5EQUA 1DYOA 5FYTA 4EJRA 2BBVA 3J7NA 1O5UA 1W90A 1COV2 1ZVFA 2VBBA 4QXHA 3K46A 4BLJA 3RZZA 4D7TA 4HVOA 4HK8A 2CY6A 2W08A 1DGRA 1CJDA 2VMFA 4IEQA 3M3OA 4CCCA 3V0BA 1QJY1 1LEDA 3VLBB 2GC1A 1Y7BA 1VBB1 2P1BA 3PURA 2XVLA 4GH4A 4HSLA 2I74A 3OF1A 5A3WA 3M7AA 3V0BB 2HH9A 2BFUL 3KCXA 1MEC1 3LEIA 4YZ1A 5FWJA 1AXKA 1UX6A 3M1HA 3MIHA 4HXCA 5FPUA 4GH4B 3WNPA 5BY5A 1WBFA 5FQ0A 1GYKA 1P8JA 1NQDA 3QLQA 5FAXA 4R8HA 1REEA 2DVBA 1ND3C 1YYNA 3VBRC 3WXPA 3ZN6B 4FPFA 5IW0A 2YFUA 4PT6A 5JXIA 5FQ0B 2YZ4A 1YQ5A 2GC3A 2MHFA 5JXHA 1ZA4A 2DU1A 1KGYA 2HWD3 4MGKE 3I4IA 1RJ7A 4DOUA 3UJOA 1PIV1 2D5FA 2QDRA 2Q1FA 1F5FA 1OA3A 5D1IA 3T3YA 4UI9L 3SCFA 4PCRA 1AJOA 4Q4V2 4XIKA 4A3ZA 3PVNA 1KXGA 4QDSA 5DAVA 3VZNA 2X09A 5LRSA 3SEPA 2WR9A 3WNNA 3WG4A 2P4EA 2WWJA 2C6SA 3E5QA 3VBSC 3UT0A 2C0ZA 2A7AA 4JGYA 4LBOA 5JAXA 4NIHA 2DDUA 1IQAA 1OKOA 3N9QA 1MACA 3ZMNA 3V56A 2VVEA 4J25A 4JGYB 4GKXA 4MG2A 1BMV2 2WSUA 4LHNA 1UZWA 5LCWL 4IEYA 2Z69A 1MQTC 4AK3A 2YU1A 3CKHA 3ZSLA 4A7YA 3NNLA 3SH3A 3SKJE 3LSDA 3KZ4C 4QDQA 1RXGA 1NCRA 3O1OA 4D6RA 1VRBA 4FT8A 5FK7A 1QOOA 4YW7A 4GZ9A 4QXCA 3INAA 1LR5A 4YZ4A 2UY9A 1NCRB 2YG0A 3DL3A 3WR0A 5FY4A 5A80A 3IDCB 5C4WC 3S30A 3LSEA 4BB3A 4MGYE 4D69A 2XHKA 4M0NA 2WWSA 3M2MA 3ME2A 4QQHA 1Q56A 3FBYA 5GLTA 4XF1A 4Q1RA 1EV11 2B45X 2GNTA 3PUQA 4N8MA 2OUJA 4B7EA 3MV01 3EQEA 1S0JA 5F3IA 5JDBA 3HN1A 2E6VA 4RYDA 3VBUC 1CZSA 3HBZA 4AI8A 2HWD2 3U75A 2JWPA 4Y33A 3AMQA 5I0SA 3VV1A 3FBMA 3OUHA 4W65A 1FNZA 1HDKA 3K3OA 4AR2A 4CU8A 2NPIA 2YGLA 3C2UA 4IESA 5FIXA 2EIGA 3IPVA 4QU2A 3ZSEA 4F83A 3K51A 1J3RA 3K4AA 3FL7A 4NHXA 2OXBA 2Q8DA 3THPA 1BQPA 3IPVB 1E5RA 1ULOA 5IAVA 1TNFA 2JICA 3I2OA 2QKDA 4LPLA 5FYZA 2JKBA 4PQQA 1WLDA 1CX1A 3ZKYA 4PLNA 3VUOA 5BPXA 3IT8A 1O3SA 3O1SA 5FZ1A 5FPVA 4PHZA 4LA2A 3AYCA 2W46A 2ZGPA 1ULFA 4L8QA 3I49A 1ZNPA 2Y26A 2ZGLA 3O1TA 2K0GA 1W6OA 4BYYA 2ZX3A 3GCWA 1YI9A 4Y4RA 1H2LA 3B5LB 3DEMA 5I0TA 4QX8A 1W6OB 2P3YA 2WYSA 3L2YA 4K21A 5FYIA 4A42A 3ZXKA 3ZXDA 4BQYA 3SISA 4PDWA 5CKMA 2HWC1 1LCLA 3WF3A 5HXMA 5FO9B 3NKTA 4NRPA 5AFBA 5IVFA 5LWBA 1AYN3 3FLPA 2WINB 5T5JA 1RUH1 3WF4A 1Y9MA 5LBEA 1AZDA 1K45A 4PDWB 3OGGA 1RUF1 1PM7A 2VZTA 1UY0A 5CKNA 1POV3 3P3NA 2PA7A 4PBPA 4ZZ8A 1FOD2 5B4NA 4F7ZA 5CU1A 2WA4A 2RMU2 1X8EA 3IN9A 4OI4A 5EIYB 1AX1A 2AEZA 1ODMA 1H1MA 1PNGA 3WZ1A 4YLZA 2WQ4A 2B5HA 2H0BA 2XJSA 4AVBA 4L11A 3CLPA 5FO8B 1VB2A 1WBLA 1BBT3 5J48A 5E8AA 4XJ9A 2XJRA 3TOJA 4TZDA 3I2IA 4ASKA 4D6QA 2FDKA 1D4M1 2QUOA 2RS13 3HN3A 4GJZA 4HN1A 2I45A 5FZHA 3ZN4A 2PYTA 3BN6A 2XB6C 1VAKA 3ZIWA 2WWUA 1SLIA 3M3CA 4EE2A 2OA2A 3TNQA 5EXOA 2HLEA 4MX3A 1J3PA 5GLWA 3VBSA 3H7JA 4AEMA 5CBLA 2PHFA 1OC1A 1S0FA 2FZ2A 3WUDA 1WCSA 4Y5Z0 4IW3A 4CP1A 3VBSB 2XLFA 1ZBA1 4Z07A 3RZMA 3O1RA 3QCWA 4K20A 1LOFA 1BEV3 1OHFA 2XHNA 2VMGA 4N7IA 2KM2A 4IEWA 1BHGA 5DDJ1 5L9VA 3AXDA 1HXS1 3JQXA 1HQWA 2ATFA 3AZXA 2BGCA 2LRPA 1DQ1A 2WAAA 4R9AA 1EPWA 3DYPA 5L19A 2W9XA 4HFSA 4QX7A 2B9VA 5EJZB 4P9WA 2Y60A 3AM2A 4RD7A 5A3TA 3F2ZA 3SITA 4UT5A 2WZR1 1JN2P 2RV9A 1POQA 2DVAA 2Z4FA 4OZOA 4QB6A 1WA6X 4CPBD 2P17A 2RS33 4KMQA 3NSTA 2J1SA 4WV8A 2IVIB 1RUH2 3NV3A 3BIEA 4WVZA 4XILA 1R081 1R1A3 4HSJA 3LDKA 3MFAA 5IVBA 2HWB1 4CDWA 1F4AA 4WM7A 2BGPA 1UU6A 1IOAA 1HW5A 3FUQA 4IEXA 2D6KA 1X82A 2DCJA 4EYUA 5LY2A 4QT6A 1VB4A 3N9OA 3VBUA 5FUNA 5FMCA 2AC1A 3IM0A 4P9GA 4CDWB 5GLZA 4WM7B 2VC9A 1XB9A 1OMIA 1RUD2 4XXPA 3MW4A 1B35A 1QJX1 1EAH2 3EXUA 2ORXA 1XYPA 2BRTA 3AZYA 1X33A 5CFDC 2VM9A 1B35B 1UZVA 4IETA 2JDNA 5FP4A 1F5JA 1RINA 2VMEA 4DPNA 5C8WA 1ACCA 1LGCA 5JZGC 5CG9A 3UGFA 2XQXA 3GNEA 5FLIA 5C3PA 1RHI2 4HN0A 2HWF2 1LODA 1N47A 2ZGTA 1OA2A 2WBKA 5AC93 1QOTA 1DQ0A 3ZSJA 5JI7A 3MLJA 1D7PM 2OPWA 1YRZA 1RJ8A 4XFAA 4LBJA 1ZZBA 4ARXA 5JSPA 3P1IA 2W47A 1VLNA 1YJKA 4OFGA 1V70A 2D3RA 2CDOA 2D98A 4E4HA 4HVRA 2A6WA 4MSVA 3UETA 3W9AA 1LTEA 3WQ0A 1OUXA 2VCCA 1SACA 4RQPC 5FZ7A 3I8TA 5D8AC 1IPKA 5E16A 4QWNA 1VALA 1ENQA 2ZOEB 5A1LA 1GOGA 3LAGA 4META 3D4KA 3WDXA 4AQ2A 5FZIA 3NV2A 4FAHA 1E5SA 3KGLA 3PJYA 4XDQA 1J59A 5CFCA 3H8XA 1SG3A 4QHOA 4BQ4A 2BU9A 2UY8A 4UYBA 4PIZA 1W05A 4CCDA 2FCVA 1N1TA 1UCXA 4E2QA 1PNFA 5CFCB 3PTYA 2R062 1Y43B 3AFKA 5EWSA 5JIAA 2A6YA 3NAPC 1O6UA 4HKOA 3L2HA 5BYNA 3KV4A 5FZCA 2VTFA 2FZ1A 2WS93 1AR91 1BJQA 4XETA 1SBEA 4NHMA 4FOWA 5C8CB 1W9FA 3ZFFC 5FZGA 4Q4X3 4OI2A 2HBUA 2QCSB 4GALA 4RS5C 1V6JA 5GZFA 5HCBA 4LEJA 3OGVA 2VD7A 5I0UA 2ES3A 2W1UA 3FC0A 4XE9A 3A23A 2NMOA 1EPZA 2ZEWA 4XUQA 3OG2A 4IGOA 1LHVA 5K0UA 1IS5A 1AR71 3IWZA 5FP9A 3MFCA 1QJFA 1W6PA 2LM3A 5K0UB 1QWRA 2MPFA 1X9TA 4YSFA 2TNFA 3SH4A 3DPRC 5AVAA 1W6PB 4XTMA 1UD1A 5FYVA 4ASMB 3ILNA 4S2FA 2EIEA 1TMF3 4GWIA 5FBJA 5FCCA 2RS53 3T2TA 2R043 3IDAA 4GWNA 3VDDA 2OW4A 1RUG1 2QQIA 3KCCA 1BZWA 3KMHA 4WM8C 4YFWA 5FOBB 2FDJA 2EAKA 2PQSA 2WLQA 3A22A 3B7MA 1XNBA 3VDDB 3JBG1 1QJU3 4LKDA 3UKNA 2DUOA 4F3JA 2F4PA 3HMYA 2X5IC 3FUOA 1H1AA 1PVC2 4FBFA 5JOYA 2W39A 4LXLA 3DGTA 4W8JA 5C9AC 2ILMA 1ENRA 1W9SA 3K77A 2GU9A 2OZJA 2Q0AA 3SH5A 5B4XA 2E33A 4IEUA 3WDYA 3A21A 2ZGRA 4Y5TA 4YYOA 5F3GA 4MLOA 4NIDA 4SLIA 5LASA 4GJYA 4IV1A 2DURA 2IVJA 4AFDA 5CAZA 3WF0A 3LEGA 1PO21 4GB33 3MIDA 3H7YA 3ZYIB 4ES8A 4OHWA 1DQ2A 2BWCA 4IV1B 1FV2A 2I07B 2R0HA 4Q4Y2 3OCPA 2Q4SA 3KB5A 4NHKA 2RDNA 1UX7A 2BWAA 3HPNA 1AR62 1JHJA 2VUJA 4HKWA 3EJKA 5A3PA 3ZVXA 1WD3A 1VBA1 3CEWA 3E1F1 3DXTA 4IQPA 4F8AA 3J8F1 2FD8A 1GBGA 3TB0A 5F32A 2K2SA 2J7MA 3O12A 2G9FA 4JKLA 4BDVB 3PTRB 4FFFA 2VOWA 1IPSA 1XC6A 1LU1A 2WFPA 3VD9A 1UZZA 3QBQA 3ZFGC 2JJ6A 1YC61 3P3PA 1DGRN 3T4HB 4FP3A 1N3PA 4ZXEA 5IWFA 5LZ6A 4XC9A 2J1AA 4IV3A 4JX0A 4TXWA 2D3SA 4AHXA 4GMP0 2GH8A 2JDZA 2R49A 1W2AX 1XQNA 3LZZA 4IV3B 3ASIA 2QE3A 1SBDA 3OGSA 2DCYA 2YPDA 3I2KA 4KI5M 1NLQA 5IVYA 3GHMA 1TME2 4Q0SA 1G9CA 1N1SA 2GALA 3LB9A 3CIHA 2ZJCA 3M3IA 3THTA 2PLV1 1JUHA 5FLHA 3U10A 2D93A 3WCRA 4CVUA 5D2AA 5E88A 2JE7A 4AI1A 4AFMA 2QQOA 1YWKA 3AYDA 1HJFA 3H3UA 4QQLA 3UNPA 1A34A 2KXLA 2D6LX 2WLPA 2IXCA 4KG0A 4KU7A 4L97A 4AI2A 3EMRA 1CD3G 4Q8KA 3WX5A 1ENSA 1UXZA 3O14A 1UKGA 4JAAA 4MYEA 4XDOA 3ZSMA 1GSLA 1NCQA 2JX9A 1OD3A 1LRHA 2PHXA 3KS7A 4IEZA 3WDWA 5DQ0A 1RB8G 4XQ4A 3Q8EA 2DYCA 1WUVA 4XUNA 5FYMA 2BTVC 1NCQB 4QDRA 5FKCA 1EUUA 1UU4A 1YQCA 2BJSA 2Q5TA 3JD73 4H2AA 4AEJA 1W8OA 2A3WA 4Y1YA 5I8TA 5L7OC 1ULDA 1F4HA 1VBC1 3C7GA 3NNFA 5KWRA 1A8DA 1RXFA 5CB7A 3PJQA 5J7MA 5FZLA 1KQRA 3KF5A 2ET1A 1C8NA 2X8KA 5HI0A 2ZX1A 4LR4A 2E7QA 4J1XA 2BV4A 2WRAA 2GMMA 5FZ0A 5ACA3 3IMMA 4UWDA 2VTXJ 3K4ZA 3T08A 4P00B 3WV6A 2VULA 1H4GA 1ND2C 1H4HA 1XPWA 2UWAA 4LKFA 3VBHA 4D8MA 5KR7A 4IE5A 4HZFA 1OOPA 4JC1A 5C3OA 3RPQA 1SLTA 2LW8A 3FLRA 3VBHB 4AZZA 4BMEA 1C8M1 1JOJA 4BWOA 1OOPB 3ZR6A 3ZXFA 1KDMA 2A6VA 2ENRA 3AMHA 4MXWA 4TLFA 2XG3A 2JD9A 1Z7S1 1AYM2 1PK6C 2VZPA 1UY3A 3O1MA 3LD8A 3TN91 4LE3A 4MXWB 5BNPC 4Y24A 3ETQA 4CZSA 3C3VA 4DINB 3POSA 5KHIA 5GJ6A 2Y6LA 3PVBB 4Q0QA 4NIAA 2WFF1 3BB6A 1UQXA 3U0ZA 5JMCA 3J9SA 1UMIA 1HB4A 3AKPA 1U5IA 2QNKA 5IHRA 5T54A 1Q8QA 5M0TA 2J1EA 2VUAA 5CVRA 2WO1A 4HOOA 4UF0A 1SLCA 1C1LA 4QPGA 1OQ1A 4L2NA 5H9SA 4NPLA 4B29A 1W28A 1R64A 4GA9A 4UF0B 4Q4W3 1NY71 2JIGA 2WKKA 3MUY1 2QQPA 4QPGB 5FDBA 3ACIA 4WZFA 5FMOL 1QIQA 1VBD1 1BK0A 1DBNA 4KGGA 4BCUA 1FMD2 1KFUL 4Z2WA 3TEXA 2Y6FA 4AAXA 5ANNA 4HPKA 4NJ4A 1HRV3 1Q8OA 4GH4C 3RZHA 3JXSA 2PAKA 3BIWE 4Q27A 2QJVA 1RUI1 3WHUA 4Y1VA 1CVNA 1RL3A 5C7GA 2DCKA 4AWDA 1ZA7A 4HPKB 4AI9A 3TEWA 4ATFA 2Y0OA 5GLVA 2VXJA 3PVOA 5LK5A 4HETA 1W39A 2CAUA 4EQVA 1J83A 3BU0A 5HPOA 4IERA 4EZHA 3CF6E 3OBAA 2UWCA 5LW9A 3AMPA 4QD2A 1FPN1 1TNRA 2TBVA 3Q8BA 2EF6A 1QKQA 1PO13 2HWE3 4P08A 5A33A 3C7FA 3AP6A 4LMFA 2Y6HA 5LRRA 3C7EA 3T2OA 4AQTA 3KV6A 1RMU3 2JB4A 5A33B 3HQRA 4NAOA 4A45A 1ASJ1 4LJHA 1DF0A 2IFRA 4HKLA 3BVCA 1HRI3 2OX0A 4G9SB 4YW4A 4EWDA 4FAGA 1GZCA 1VRH2 2QZ3A 3KCYA 4UFMA 3S7IA 3KVBA 4O9GA 5FZMA 3MYXA 1LOCA 1RITA 2V73A 2OPKA 5A1FA 1PX3A 4JGYC 5LATA 1GP6A 4KWKA 4CTEA 1GZ9A 4AHWA 5IK5A 1N3OA 3LKJA 4BQ5A 3I3BA 3FFZA 1G7YA 1DIWA 1NUKA 2IXJA 2EAAA 1COV1 2RR11 4ZZ5A 5FZBA 5DABA 4V2WA 1JH5A 1ZBE2 1LOEA 4XMAA 3HR9A 4I01A 3WT3A 5DPNA 3THDA 1NCRC 5DZEA 5FPLA 4BQWA 1QNWA 5KHJA 1IGOA 2QTWB 3MW3A 3N9NA 1A6CA 1LOAA 4ZU7A 3R4DB 1RUC2 3NMBA 1H30A 3S57A 1L7LA 4LT5A 2D6MA 1STMA 2YC0A 5FZ3A 5KXCA 4MXVA 3RYRA 4K6BA 2WJSA 1V6IA 3MHZA 2Y6KA 1GFF2 3HEIA 2YBPA 3NV4A 4XF3A 1AF9A 3X29B 3VBFA 2ZGKA 5E1RA 1S0BA 5A6QA 1O59A 3VGIA 1WZXA 2ZA9A 3O1UA 2TUNA 3FMGA 2IXHA 4WBBA 4XJUA 3VBFB 4QQ2A 3PU3A 2DBNA 4OULA 4O61A 2VAUA 1D2SA 3IB3A 5J98B 4DXZA 5T52A 2YV8A 3ES1A 4H14A 3FJSA 1ZX5A 3NJXA 2JG8C 4RHV3 2VUDA 5DUUA 4QPIA 2P3JA 4LUMA 3VKNA 2AUYA 2XONA 3LA2A 3RWNA 3NJVA 3ZDSA 5F3CA 2HEVF 2Z79A 5F5IA 5H9RA 3AMMA 5BNPA 1YI7A 1X7NA 4P5HA 1C1FA 1QQP2 4LO6B 1XXNA 2Y33A 3DUIA 1IPJA 2WQ8A 4QPIB 1JW6A 1LHNA 2E31A 1BYHA 1NOVA 2AENA 4BQ1A 2KR2A 5A7PA 1AJKA 3T1MA 4QX5A 3ZXLA 1ZM1A 1HQLA 2P34A 1REFA 3NNMA 4W50A 2ZKNA 2ZZJA 3KV5A 3T0DA 1S2BA 4JHTA 4FPJA 2WDBA 3TAYA 1BMV1 1DYPA 1OLME 1SLBA 1U12A 1W8TA 1YHFA 2VW0A 4A7ZA 4Q29A 3WG1A 4RA0A 4XMIA 2RR12 1L3JA 2IXIA 2ZZQA 3ENRA 4HK9A 4HT1T 4IEVA 4M00A 3VKMA 2J1RA 3AK0A 4NN0A 5DMYA 5LBBA 3PHMA 1V9U2 4GD4A 3WDVA 2VGDA 5F37A 3HOBA 4YM3A 2VMDA 4CYDA 2WYFA 1GUIA 3LQCA 1SMVA 5HCFA 4PDWC 2VCBA 2XH6A 3DYOA 3ZDVA 1T6GC 1AL23 2JD4A 1JZ3A 2WIIB 5K4LA 5KXDA 3PUHA 3F95A 1V6OA 1OLMA 1LECA 3ZN6A 3RQ0A 3POGA 1UOJA 1R093 1OH3A 3I3QA 4WVWA 2JDAA 5JSRA 2L9LA 2ZGUA 3AVRA 2R072 2OT7A 2MNGA 1RUJ3 3I2HA 5LEKA 2CU5A 5T5LA 5CYYA 3OUIA 3FHIB 3DV8A 1IHMA 2ZAHA 2HWD1 4JTNA 3VL9A 1LOGA 2JE9A 1W03A 1MR5A 1Q43A 1F31A 1RVF2 5FZOA 2NMNA 1XNCA 2BW8A 3OD4A 1UOGA 4XAEA 1Q3EA 3BTZA 2VMIA 1CZVA 2HEWF 5FZOB 4RGGA 5HBAA 1VBE3 1VBB3 4IE6A 2VQTA 4DXSA 4CA9A 2WUHA 1S2KA 1YFYA 4WVMB 5EJ1B 3RS6A 1YFWA 2WA3A 3SMHA 1O5LA 3NJZA 5CA6A 2VU9A 3H1YA 1HQNA 4OHVA 5JPNB 4NMIA 1DQ6A 2FDGA 3E5UA 4CCOA 2P3KA 2DVFA 3OBRA 3RYKA 3M3EA 1CIYA 2Q1MA 3WNXA 2EXIA 2J1UA 4QB2A 3V65A 1LOFC 2RM23 1YCIA 4HONA 4CDXA 2D44A 5I8SA 4X6QB 4Q26A 3S5QA 2D3PA 3R05A 2ZEYA 1W6MA 3NL1A 3JZVA 4XBNA 4CDXB 4RSUA 5JI9A 1LENA 1JYXA 4KG8A 3GALA 3CU7A 5F1RA 4CRQA 1CPMA 4QB1A 1W6MB 5LA9A 3MLKA 4BXFA 4Z1VA 5FY9A 1G9DA 1UMHA 3TNPB 3IZOA 4ZHNA 1WMDA 3HQUA 4LE4A 5A7OA 5BXXA 2P2KA 2A1XA 2SLIA 5FV3A 1FOD1 4NPRA 3FZ3A 1U5YA 1W9YA 5HCHA 2A3YA 2XUMA 2RMU1 3IAPA 1LNSA 4C1WA 1SBFA 2DVDA 1RUJ2 4CDWC 4I02A 4WM7C 4YVWA 3AKQA 3FWEA 4RR3A 5H9QA 5JUVA 3A0NA 2GNMA 3UJQA 5DZFA 3HNBM 4S2GA 3MGUA 4XDPA 4YVWB 4Y1XA 1VMJA 4RR3B 5A7WA 3RVHA 1B35C 3M8LA 5IVVA 2G4IA 3HNYM 2O1QA 1MVEA 1QH7A 2JG8A 3N7MA 4QM8A 1YIPA 2MEV3 2VZ3A 4NRMA 5A7WB 3LOIA 1ZYBA 5F8PA 2JG8B 4BIFA 5DAQA 5CEHA 1W99A 5KHHA 3WOGA 1MS1A 2JIJA 2P6HA 3RMYA 3GBGA 4YG6A 1MS3A 1BVP1 3MEPA 2PXJA 2W1SA 5JMOA 1EV13 2BYVE 3N9MA 3ROUA 2YGMA 5SV8A 3T0AA 1ALYA 4LO4B 2RE9A 4Z8BA 5IVEA 1XBFA 1EYBA 2PHWA 2RM22 2KA3A 2JE8A 3VHOA 1E5IA 4BIOA 2A71A 3AKRA 4N7UA 3W21A 4CUGA 1EP0A 3WNOA 3NRUA 4AI3A 4XQWA 2Y6GA 3ZKUA 5C3SA 3BKZA 3HT1A 3T30A 1PGSA 4XHXA 4NPMA 1MPXA 4KWUA 2VNVA 5FPBA 4AVSA 1DP0A 3RGBA 2ZTNA 2C9AA 1AYN1 3AKTA 4QGMA 3AP5A 4YZ3A 3WW2A 4EN9B 5CFCC 3MZHA 3GJBA 2BDRA 2UYBA 2Y38A 1YIFA 5A3NA 1XSRA 1TEIA 1DCSA 1W2NA 1U0AA 1LGNA 1L7QA 3V64A 1NKGA 2CGNA 5FTTC 1ULEA 1S0EA 5C8CC 2GDFA 5A3LA 3HJRA 3DN7A 2FCTA 1V0AA 2ARXA 4LBMA 1DHKB 5IATA 1JOBA 4QX3A 2CSGA 5B2GB 3BPZA 1RUD1 4X8NA 3FHAA 1J3QA 3VZOA 1GR3A 1EAH1 4C8DA 1QEXA 3ES4A 2YB7A 2D97A 3O0VA 2MEV2 3I7DA 4NAMA 4Q1PA 3HNMA 4M3CA 4YGDA 4QM9A 3RJ2X 3NKGA 2HWC3 2CV6A 4IL7A 4B4PA 2XWBB 4DUVA 3LF7A 5K0UC 1JYVA 4PF1A 2R1DA 5I0RA 4M3CB 1RHI1 2DCZA 2J42A 4O7XA 2HWF1 1VMFA 4XIOA 2FCUA 1YLLA 3WLUA 2YC4A 1H2MA 3FE5A 5TSWA 1I1EA 2XVKA 3BOWA 2DVGA 3EO6A 1OT5A 3VDDC 5CG8A 2VQ0A 4N9IA 1IG3A 1Q8PA 1O3QA 1I9RA 2XXZA 1Z78A 2ZAAA 1Q8VA 1US3A 2WNUA 3Q9OA 4JHZA 4KL1A 4R4XA 1XYNA 3WUCA 3ZX7A 1OFNA 1H2NA 4E4DX 1D4M3 2DTYA 1CQ9A 3SNMA 2WNUB 5LBCA 1JHNA 3MIEA 2ADDA 1SDWA 1FXZA 4YNIA 3R4UA 2Y6JA 3CL1A 1AYN2 3H3LA 2R16A 3WQ1A 2XBO3 4HLTA 2QQJA 1MZ5A 1XU2A 2R061 5T5PA 4QKBA 1ZRCA 4I0BA 2A6ZA 1GV9A 2XOMA 4N43A 4YM0A 3GZAA 1PGW2 2XR4A 4W6XA 3ZXJA 3BODA 4IV1C 3GHNA 3RI9A 1ZBA3 4EN7B 2BEOA 2B39A 2XKOA 3B69A 4LK6A 4N43B 5F6LB 4XXAA 5DDJ3 2XLAA 3RZKA 3CZUA 4ONUA 1HXS3 4W6YA 1BBT2 4QQOA 2ZMKA 2VL4A 3ZYPA 4I09A 4AL9A 1GQHA 3GBWA 3SHRA 2WZR3 2RS12 4Q2FA 4D94A 4OHXA 4GMP1 3DECA 1NYWA 1MS8A 2ZX2A 3PNAA 3W5MA 1WWYA 2XL9A 2FMDA 4OZXA 2PAMA 4XTPA 4M4RA 1SFPA 2CWMA 4MVTA 1QHDA 4S2HA 4ZS3A 1C28A 2VCAA 4YM2A 3N4MA 2HWB3 2XL7A 5FUPA 5FMBA 2CYFA 3VZJA 2ZX4A 4E8CA 1ZZCA 4HMZA 4AG4A 1NXD1 4IV3C 4CP0A 2XJPA 5DZGA 4P02B 1BEV2 4COUA 4OMCA 3I97A 1ZZ9A 1QJX3 3ATGA 3FFQA 4XHBA 4CXXA 4KH9A 1O8SA 3B02A 1PVC1 4FCAA 4DRVA 3MUZ1 3HT2A 3ZXAC 3WNKA 4MGIE 3MIGA 5LEJA 1W2UA 1V6KA 3IDBB 1W2TA 5EYYA 2XBO2 1JI6A 1E57A 1X50A 3ZO0B 5GKAC 2RS32 5FZ6A 2WT0A 2QQLA 2OQ6A 3VBOA 1PMIA 4UW5A 1JZ4A 4MGTA 3CHXA 4AEDA 1DLCA 1JYTA 1GKBA 3D3AA 3NQHA 5JOXA 1R1A2 4JTOA 1V6MA 4GQ7A 4UBHA 3VBOB 1D0HA 4MZUA 3KVAA 3TRSB 5C8CA 2BNMA 4MUVA 5FY0A 4AEDB 3AZVA 1G8WA 1NCQC 2P3IA 2UYAA 3ITQA 4Q4Y1 1WLCA 2GC0A 3U4SA 3ZYBA 2O8OA 2R7EB 3RDIA 4FFGA 4FI9A 1AR61 1C4RA 2PHDA 2CNAA 4A3XA 1POV0 5DG2A 3J7LA 4N9HA 3N7LA 4N53A 1W9TA 5CKQA 2D6NA 2HBTA 4YWAA 1ZRDA 4FQ4A 4N53B 1JZ8A 4FPOB 5FR3A 1AX2A 2OKXA 1VR3A 1RUOA 3CQOA 2VZVA 4IUGA 4IE4A 4YM1A 3VD7A 5AC92 2E63A 5BNNC 4DXTA 1NA1A 4DUXA 4BPZA 5JPMB 4JQTA 2V4AA 2VBDA 3NWKA 1QJEA 5C70A 2UU8A 1LHWA 3VBHC 5GZGA 1AR93 3LDRA 3MF6A 4LO5B 5K8SA 4W6WA 5GZCA 5KC6A 1NA1B 3KM5A 3H3ZA 4H3WA 1OOPC 1F15A 2QQNA 4XBQA 3BPSA 4MV2A 3RRDA 5CISA 5ABJA 5LY1A 4YRDA 1JS9A 3Q8CA 4G3YC 4XFHA 3AP4A 1HN1A 2E9QA 3AYEA 1TME1 2I2SA 2W68A 4OUEA 5ABJB 4PQ9A 3MDPA 1QOSA 1E5HA 1NLSA 1HJGA 2BOIA 3G7DA 4CU7A 2WO3A 2BQPA 4NE9A 4WVVA 5HV4A 4GIQA 3HIFA 3D82A 4V2VA 5JIUA 3POIA 3U4XA 5KBFA 4UAPA 1QH6A 3OB8A 4BHPA 2WS92 3AYAA 1RUG3 1URXA 5FYUA 2BNNA 2ZEXA 1IS3A 1W8WA 4B4RA 5LK7B 2UWBA 2DWRA 1NXMA 2F6BA 3JBG3 4Q4X2 3V0AA 2JKXA 1CJPA 4FPHA 3LA7A 4QPGC 5FXXA 1N1VA 3V0AB 1D0GA 5IUQA 1HKDA 1TG7A 4C1XA 3TBDA 4DFSA 5K7PA 5DG1A 1DDLA 4X6RB 2CWSA 2HYXA 2YU2A 1KRIA 2CL2A 3OY8A 4CSWA 1Y4WA 3O5SA 3ZXGA 2CGPA 4LHLA 4NUBA 2NN8A 4QGLA 4CEWC 2V5YA 1VE0A 4CEYB 1PO23 3OY8B 1TMF2 2JENA 2Q8OA 2G19A 2RS52 2R042 3KWVA 2ADEA 4XF4A 5ANQA 1W9WA 2QQWA 4PIYA 3VDAA 3S5AA 1M06G 2G1MA 5IVJA 4YZ2A 2HKXA 1SCSA 3BCWA 2XMLA 3MPBA 1DQ4A 1QJU2 3CBNA 4YW3A 3ZN5A 3TEYA 4PIXA 5FXVA 1UL9A 3DXUA 1RC6A 3MF9A 2P6CA 4IE0A 1FX5A 4UFHA 1K5JA 3J8F3 2ZCWA 1YXWA 4BOWA 2RG4A 1AYM1 2VPVA 2A6XA 2RJLA 5FJHA 5IK7A 3K2OA 4XZUG 1QGLA 5A7SA 2ZX0A 1GZWA 2VZRA 4LQRA 3LIHA 4JDMA 1KJLA 1FT9A 2SBAA 2XJQA 4A44A 4CDUB 4XEZA 2JDMA 3GYDA 4P9XA 1GZWB 2E32A 2W2IA 3VZKA 3BOPA 2W91A 4YGBA 4OHZA 4AEKA 5F5QA 4GB32 1AXZA 1JXNA 2J1TA 4XJZA 1H8TA 4FXKB 4PJYA 5J36A 4Q8LA 4DUWA 2VZ1A 5EFUA 1WGPA 1H8TB 4NVPA 5F5CA 4CXWA 2GSYA 4LIVA 1V6NA 4B1LA 5D21A 2H6CA 4UFIA 2PLV3 4NRQA 4QKDA 5F39A 2ARBA 2XGXA 3CZJA 4MO3M 4COYA 2ID4A 4YG0A 1FMD1 4RGAA 1EY2A 2IUWA 3I59A 3NNGA 2OQ7A 5C5UA 4CCLA 3AJYA 1HB1A 4K40A 1US2A 3I59B 1XNAA 2DUPA 3K3NA 3WSOA 2EALA 3OEAA 5BNNA 1S1AA 4XURA 2ZMNA 3AXEA 5G05L 3M4FA 3OTFA 1WKYA 4LHKA 3H42B 2XVGA 5T50A 3VBFC 5BNNB 1XJAA 2Q30A 2TEPA 3TEZA 2ORZA 3I3DA 2GMEA 4IGQA 4L99A 3T4VA 4MHUA 1ZZ8A 5BNOA 3KLSA 1ULGA 5BNOB 2JXAA 5CIRA 2WNVA 4LKSA 1UN1A 2OVUA 2Y0IA 3AKSA 3D5OA 3LPFA 3PMSA 1AVBA 1VBC3 1V00A 4GWJA 1O7FA 1WA4A 3W58A 1GNZA 1RGSA 5IFPA 5FXWA 2C1FA 1LHUA 2J1VA 2WNVB 4QPIC 4BA6A 4C0HA 5FMOS 1CONA 5IK8A 3UGGA 1VRH1 2C9KA 5FLJA 3WF1A 3VZMA 3OJBA 1C5IA 2YUEA 1RYYA 3I2DA 1CPNA 1GWKA 4ASLA 1CAWA 2QQVA 4DXRA 3BUCA 2EA7A 4FFIA 2HEYF 4UXAA 4PLOA 3SXWA 2JG9A 2CHHA 3W5NA 3J26N 2EXJA 1CAWB 3WG3A 3OBTA 4PBOA 2PHRA 2YMZA 4QPWA 4X8PA 1C8M3 2VNGA 2JG9B 2EXHA 2DTWA 1F8VA 1RUE3 1KDKA 2QZ2A 2RHPA 3JD72 4COVA 4NROA 5JOZA 1OF3A 1ZBE1 4QX2A 4C91A 2E53A 5FP7A 4E9KA 1O4ZA 1XE0A 2VOKA 2DUQA 1W0PA 4QMAA 3AB0A 2XJVA 4ITCA 3EHKA 3TN93 4YW5A 3OEBA 4NO4A 4CE8A 4W4ZA 5JXGA 1PZ8A 1RUC1 4LK7A 1W6QA 2VOTA 3MICA 4ISRA 4KWJA 4R9CA 2ZBJA 1PM4A 2VOXA 2ZKLA 4FPKA 2VMCA 3BGAA 4QPYA 5CZKA 4CDQA 5ACA2 1OSGA 3C7HA 2WFF3 1W6QB 1UNBA 4CEWA 4OMDA 3LEMA 4CDQB 1NZIA 4XQDA 1PGL2 1WW6A 3WQ7A 1MZEA 4NOTA 4OI1A 1AR83 1HN0A 3PIJA 4CEWB 1PO11 2GH2A 1OUSA 2VO5A 1LEMA 1UPSA 2XDVA 5FXZA 4ET7A 1JYWA 1SCRA 4CCNA 1W04A 4BQXA 3OD0A 1TE1B 1ST8A 2EIBA 1QDOA 5EPAA 2RDSA 1SFYA 1GNYA 4INDA 3NJYA 1QXRA 1VBD3 2GMPA 5ERLA 1SPPA 5FZAA 2BERA 1NLRA 2HYKA 1A8MA 1WLWA 1QQP1 3B94A 1SPPB 1RUI3 4UW4A 2BUKA 3O0WA 4MOAA 3GDBA 4WZCA 3LFMA 4OUSA 4Q0PA 4I30A 2WNEA 4DEQA 3WW4A 3D0SA 1JU4A 2XUEA 3I54A 3E6BA 4M3CF 1JZ2A 4YVSA 4LITA 5J37A 1O3RA 1S4CA 1WMEA 1FPN3 1RUE2 4LBLA 5C6CA 1HB3A 2EXKA 2PHUA 4MGQA 4CDXC 4YVSB 5I8YA 5ISLA 1VJ2A 3OGRA 4OQ9A 3N9PA 1W8UA 4Q4W2 4C0BA 5A70A 1V9U1 2J22A 5A6ZA 2PN5A 3DCQA 4KWLA 1REDA 5E6HA 1JYIA 1J58A 2P5BA 2W92A 1SFNA 5GM0A 1HRV2 2VH9A 3A4UA 4UFKA 4Y1ZA 3RZJA 4BQ2A 4NHLA 5FYYA 5F5AA 3BALA 4LHSA 2B7YA 3OBZA 2VBPA 2R071 2WZ8A 5IVCA 1AR82 1BKZA 2AZ5A 2ZACA 2DU0A 4YVWC 2PELA 4RR3C 1COV3 1UF2C 2XKPA 4AFCA 3I2FA 2A3XA 2HWE2 1PO12 2WZPP 1RVF1 4YZ5A 1UYPA 2WN3A 5L9BA 5FREA 5BUVA 1RMU2 4AQ6A 2VMHA 5HV0A 4JRAA 4FOQA 3KHCA 3LA3A 4CU9A 4K1YA 4RFRB 3ACLA 4AFBA 1HRI2 4DY3A 4M4PA 4I0WB 1UYYA 2D6OX 4BJ0A 1DGWX 2B46X 4RL7A 2VZUA 1S0DA 5F6KA 1BK1A 3USSA 2JECA 5EV7A 3RZGA 2BFUS 3QOPA 4FPLA 2ZXQA 5EHDA 2VOVA 1SZBA 1UY4A 3KQ4B 1B09A 2ZGMA 2NP0A 1GQPA 4LBNA 3T09A 4DQAA 3VD3A 3U1XA 4JDOA 1NQJA 4Q5OA 3DYMA 1Y9GA 4ZONA 1LGBA 1OURA 5EZWA 1XOYA 1K42A 2Q8EA 2YXSA 4Q4V3 4FPGA 4IE7A 2E26A 4BISA 5GZDA 1T2XA 1KD7A 3KT1A 5FPXA 1FAYA
chains in the Genus database with same CATH topology
4AGVA 1Q5OA 4AVAA 1CAXA 4A7KA 2E7TA 2ET7A 4COZA 1JBCA 4LO7A 1RUJ1 1R1ZA 1H9WA 1CAXB 3AJZA 4OUMA 5T3NA 1G9AA 2DF7A 3H50A 1QXJA 3N3HA 3FLTA 2IZWA 1W0OA 1WLTA 1WCDJ 2ZGNA 3S7EA 1OD5A 1UIJA 3D0JA 4RHV2 5H9PA 1VBE1 3O7OA 1OPMA 4WVMA 1QJY3 3H1WA 5SV5A 1VIWB 3B00A 3WD5A 1YUDA 2HJIA 1ZRRA 1MEC3 1H1IA 4XZPA 3ILRA 4U2AA 1NE4A 1XRUA 1S0CA 2RM21 1CIWA 4YW2A 2UURA 4P14A 3RI8A 5J3UA 3CJXA 1G86A 1MZFA 4JRLA 2WNUC 1PIV3 4UW6A 2AGSA 2R6QA 3ZFEA 4FTSA 4AE2A 1LKNA 4KGQA 3N7KA 1XYOA 3VKFC 1AL22 3ZFEB 5C33A 3H1MA 4XFFA 1RIRA 5CNAA 1OLQA 1CESA 1R092 3W59A 2GNBA 4AQSA 4N43C 4AW7A 4TSVA 1MS9A 4JCKA 3N7JA 3ZPYA 2O8QA 1GQGA 4IEPA 4PF5A 2FQPA 4HBNA 2Z2SB 5T5OA 1QNYA 2MEV1 3B01A 5CADA 1QJY2 4P9JA 1HV1A 1VBE2 4DS0A 1VBB2 4XPVA 4ZU5A 1MEC2 2BVBA 4AFAA 3GZUC 4FSJA 3KT4A 1UMZA 1FOD3 5J09A 3ZYRA 3LWCA 3VKOA 4YG3A 2RMU3 5E89A 5KHGA 5JCTA 1OFSA 1K5MA 4K7JA 3VN4A 2LUWA 3ECQA 1ZREA 2B9UA 5IK4A 3QH7A 2WT1A 3NW4A 2R1BA 1BXHA 1MS5A 1K5MB 3VL8A 1PIV2 2WC2A 3UK9A 1N1YA 2AYHA 3POWA 4JDNA 2ZHMA 4EN8B 4R9DA 1YJLA 4H7MA 3URFA 5FRAA 1Q8SA 1AUYA 1LESA 3PMEA 4P9YA 2ZHLA 4XYXA 1QY4A 1I6XA 4FPYA 3E97A 1WW4A 1VAVA 1LOBA 4LBQD 4A2UA 5AFEA 1PHMA 1POV1 3VBOC 4M3CE 4NR1A 4AEDC 1PGW1 2VECA 4XFIA 1KITA 2NM1A 2V09A 4EN0A 4I2OA 3VHRA 1V6LA 4NWWA 3QD6A 2IFWA 1LHOA 2YHJA 1BBT1 3HWJA 2YROA 3JUUA 1OPOA 1F9KA 2DFBA 3OYWA 2A70A 4N53C 1NG0A 4OVEA 2RS11 5FBZA 4E4ZA 2BPA2 4YGEA 3OYWB 5JWPA 2G9GA 4GWMA 3OPZA 1RTVA 1RUH3 4DNYA 5JOWA 3ALQA 1RUF3 5GLUA 3VBRA 1ND3A 4GULA 4XJWA 4GKYA 2R30A 1EV12 1NA1C 4JGZC 1JTZX 3JU9A 3VBRB 1ND3B 3WP6A 1BEV1 1DG6A 4KBBA 4JQRA 4KU8A 3E5XA 3N36A 4Q0UA 1RUD3 2ZMLA 3B9IA 4O9EA 4E2SA 5ABJC 4D7YA 1OKQA 1EAH3 2B8MA 3FX3A 4AF9A 4K1ZA 4PLMA 2EVXA 2PHLA 4AHYA 3WP3A 4LA3A 2XBO1 5KXBA 1RHI3 1XU1A 2RS31 2HWF3 1N3QA 3EBRA 4LLFA 4AGRA 4GXLA 1BVVA 1OI6A 1R1A1 3H0OA 4XBLA 5FOJB 2D6PA 4KNCA 3N35A 4AXOA 1NZCA 2XLGA 3DF0A 1ZRFA 1J1TA 1ENXA 1O4TA 3AFGA 2VVFA 1MQTA 5F9TA 1W6NA 2NQYA 2X53S 2GC2A 1Z0HA 3HQXA 4LNVA 1MQTB 1W6NB 5FPZA 4MGZE 4H7LA 3T1LA 3SCHA 4OI0A 2PTMA 3KD4A 5C4WA 3ELNA 4J6GA 1YFUA 1H9PA 4N90A 2ETEA 2HWC2 2D7FA 1YO8A 2ZHNA 1G9BA 3GZTB 5BV6A 1DLLA 5C4WB 3SLIA 5FFOC 1RUF2 4B8EA 2R063 4U36A 4OHYA 5HCAA 5AC91 4CEYC 4EROA 1QF3A 1R083 3AZWA 4D7SA 1GANA 4LBKA 5JR7B 1QMJA 3VBUB 1BCXA 1DGLA 1O3TA 1KS5A 2N7GA 2RJKA 1SLAA 2VW1A 5BNQA 4J1WA 1KFXL 4AYUA 1D4M2 1UW8A 1AX0A 4GMP3 2FBEA 4AGGA 1H8VA 4CDUC 3M3QA 3R4SA 1PZ9A 3OGJA 1CR7A 5GALA 2IC1A 2ERFA 4XFCA 2Z42A 4FQZA 3D8CA 2WS91 1WW7A 3H8UA 1ZBA2 3WDTA 4BMBA 1KJRA 3ST7A 1IKPA 4H55A 1H8TC 5DDJ2 3VZLA 4Q4X1 1Y9QA 1HXS2 1UU5A 4R4ZA 4P9LA 4CP2A 1J1LA 2BNOA 1PVC3 5A32A 4BM8A 1JYCA 3G6JB 5JLVA 2WZR2 3ZIXA 4QXKA 5IT6A 5A32B 1D2QA 4XJ8A 4YFZA 2AH2A 2QFEA 3WW3A 1DZTA 1R082 2VXRA 4HANA 2HWB2 3IIAA 4XF0A 4JGZA 1TMF1 2RS51 1IS6A 2R041 4Q4Y3 1S55A 2WQZC 1GNHA 2R0FA 2LALA 5BNOC 4JGZB 1AR63 1QJU1 1QJX2 3CO2A 4BE3A 2IXLA 1LJ7A 2CAVA 3PLQA 2WNVC 2D40A 1I3HA 2ZGOA 2PHTA 4FP2A 2E7AA 3B9CA 2Q1ZB 3PVEA 1AR73 2WT2A 1YNAA 1LULA 2X29A 2XJTA 4ISQA 4P9IA 4AVTA 3SCGA 5KHKA 3AP7A 3A0KA 4ORFA 1CX4A 2YY1A 1IZ3A 4GB31 2JG9C 4C90A 3WY6A 5L36A 3HAGA 3NV1A 3UV9A 4FXGB 4LLOA 4YW1A 4JV4A 1UKRA 2E51A 1TME3 1WCKA 2ZGQA 4QGNA 3MIFA 4ZU4A 1A78A 2DV9A 3DKWA 4XW3A 4LTAA 4EV0A 1F2NA 1MS0A 3KQRA 2W0XA 2YPJA 1M4WA 4YGCA 1OLRA 2NYYA 3TYJA 1XNDA 2GZWA 3D6EA 3JCIA 2PAEA 4CDQC 4CEYA 4AI0A 2VNRA 1RUNA 2O0OA 4QQPA 2CGOA 4LULA 1AR92 2VW2A 3E6DA 3CNAA 2OIIA 3VHPA 2P37A 3APBA 3IMNA 5DXDA 3GBFA 1H0BA 3ILFA 5CFDA 2B42B 1VBA3 3U07A 3MLLA 4MH0E 4I3PA 3O0XA 4JVAA 4EN6B 4D3WA 4UBGA 5CFDB 2DCTA 3USUA 2GN3A 1LB2A 5JZGA 1U5ZA 1AR72 4CDUA 3LCPA 2IWGB 2NZ9A 4AVVA 3BU7A 5KC5A 3RSJA 1DQ5A 3USUB 5JZGB 4XFBA 1APNA 1FATA 4SBVA 4Z92B 3AP9A 5L73A 1XE7A 1HLCA 4G4FA 1RUG2 1OQDA 3JQWA 4RQPA 4KQ7A 4YVSC 3CJIC 5D8AA 1FI2A 4BH9A 3UL2A 3JBG2 1FNYA 5A3MA 3JD71 1ZZ7A 1X36A 4ES9A 4RQPB 5D8AB 3LGRA 1AYM3 1S0IA 4DRRA 4BZ4A 5AVPA 5J96B 4I0AA 1O4YA 3QACA 5DUXA 2XWJB 3NAPA 1Y3TA 5ACA1 4LUKA 1WMFA 4AHZA 4HVQA 1IKQA 1MZ6A 3MIBA 1PO22 3NAPB 2QDNA 3RMXA 4B4QA 1PGL1 3ZFFA 3LOBA 3AX4A 4RS5A 1DU3D 1CN1A 4M0HA 2XJUA 1AL0G 3ZFFB 4XJAA 2GNDA 1SEFA 2ZHKA 1VBA2 4RS5B 1UPIA 5FO7B 3J8F2 4URTA 4S2DA 2VY0A 1QXPA 1FMD3 4M01A 3IDEA 4FPEA 2XPJA 2IXKA 3IBMA 1FYUA 2BVVA 2K9ZA 4RFT0 4XF9A 5I91A 1YFXA 2VG9A 3NVCA 3DPRA 1DGWA 4NWVA 5JVVA 3WP4A 4IXLA 1H2KA 1GICA 4TYSA 1SQ4A 3DPRB 4WM8A 3K48A 1FV3A 3U11A 1QDCA 2WSVA 3WHTA 2NLRA 1RUE1 2GN7A 2D5HA 4WM8B 3KT7A 4E2GA 4Y26A 2X5IA 3R6SA 1D4VB 1ONAA 3WVJA 5KXEA 2H6BA 4Q4W1 2X5IB 5C9AA 1A3KA 2PLV2 2VQAA 1Z7S3 3ZSKA 3WDUA 2R32A 3WCSA 5C9AB 1VRH3 4ZKTB 1HRV1 4FOVA 2A75A 4E4SA 1TQ5A 3RG0A 3RYPA 2A5ZA 1MVQA 3S0MA 3M70A 1DYKA 1DZQA 1UZYA 1AR81 1WD4A 1X8MA 2YYOA 1G6NA 4DMIA 1SLLA 4Y22A 2D43A 2JEMA 1IS4A 2HWE1 4BLIA 1PVXA 1ZBE3 4Y22B 1HIXA 1DFQA 1RMU1 4K8FA 3VKLA 1VBC2 3UKTA 4EWEA 3WW1A 1WW5A 4Y1UA 1HRI1 4OLLA 1RUC3 3RJRA 3ZFGA 1HX6A 2VVDA 5DUVA 3TWIA 1VAMA 4Z82A 1CAVA 3JB8A 3KSCA 1S0GA 1ZZ6A 3MPPG 4LO8A 3ZFGB 1NE6A 3ZYJB 3ZMOA 2A73B 3R0RA 4B3NA 1CAVB 4FVVA 3JB4C 3IKWA 3RNSA 4I3GA 4Y4YA 4YARA 2H0VA 2W52A 1JUIA 1G9FA 1UIKA 1C8M2 1UAIA 1PZ7A 3CJIA 3MI8A 3HD8B 2Z5WA 1MS4A 1O91A 5I93A 2CTVA 5HXVA 3WP5A 1AXYA 3B3QE 3CJIB 3VHNA 2DFCA 1Z7S2 4L92A 1ASJ3 3TN92 1LU2A 4Q0VA 3ZFEC 4ATEA 1OA4A 1QQP3 1GLHA 4B7KA 2WFF2 4UW3A 1DZRA 4QHBA 1AHSA 1XE8A 2ZGSA 3QH6A 4DB5A 2QVSB 4LBQA 4K3UA 3AZZA 5JSOA 1C3HA 2RR13 3AMNA 2AREA 4FTEA 4LBQB 5L7OA 3J4UH 3WG2A 2PFWA 2PQQA 1C57A 4L9BA 3B93A 4HL0A 1NY72 3L9JT 1V9U3 4IEOA 2ZPXA 5L7OB 4RHV1 3POYA 3NO8A 1VBD2 2C5DA 4K9SA 4FTBA 5GZEA 5T55A 4COWA 2WL1A 4V1PA 1CGPA 2ZS6B 1U5XA 1RUI2 4XFGA 4EWAA 2LTNA 4FOYA 1ND2A 2OZ6A 4ZXKA 1QJZA 2R073 5EYXA 1CAUA 1ND2B 5DUWA 1K5MC 1HV0A 1KS4A 3BTAA 1FPN2 4R9BA 3H9AA 1XNKA 4FO9A 1CAUB 1RVF3 2ZABA 4AVCA 1OQEA 2FHRA 3S6PA 4E27A 1ULCA 1PK6A 4DY5A 4DZGA 4Q4V1 4R52A 4TWTA 2FMYA 1ASJ2 4Y20A 3ZXEA 2VNOA 1I5ZA 1PK6B 5K9YA 1VP6A 4Y20B 2OUHA 1AL21 1QU0A 3UKVA 2OYZA 2AR6A 5BNPB 3KGZA 5EJ3A 1C5HA 1R091 4FPCA 3GF6A 4XOGA 2GAUA 2YDEA 3MW2A 3WINE 2BBVA 4EJRA 1O5UA 1COV2 1ZVFA 4BLJA 3RZZA 4D7TA 4HVOA 4HK8A 2CY6A 2W08A 1DGRA 1CJDA 4IEQA 3V0BA 3M3OA 1QJY1 1LEDA 3VLBB 2GC1A 1Y7BA 1VBB1 4GH4A 4HSLA 2XVLA 3V0BB 2I74A 3OF1A 3M7AA 2BFUL 3KCXA 1MEC1 4YZ1A 1AXKA 1UX6A 3M1HA 3MIHA 4GH4B 5BY5A 1WBFA 5FQ0A 1GYKA 3QLQA 1NQDA 5FAXA 3ZYGA 4R8HA 1REEA 2DVBA 1ND3C 1YYNA 3VBRC 3WXPA 3ZN6B 4FPFA 5FQ0B 2YZ4A 2GC3A 2MHFA 1ZA4A 2DU1A 2HWD3 4MGKE 3I4IA 1RJ7A 4DOUA 3UJOA 1PIV1 2D5FA 2QDRA 1F5FA 1OA3A 5D1IA 3SCFA 4PCRA 1AJOA 4Q4V2 4XIKA 3PVNA 1KXGA 3VZNA 5LRSA 3WG4A 3E5QA 3VBSC 2C0ZA 2A7AA 4JGYA 4LBOA 5JAXA 1IQAA 1MACA 3ZMNA 3V56A 2VVEA 4JGYB 4GKXA 1BMV2 2WSUA 4LHNA 4IEYA 2Z69A 1MQTC 4AK3A 3ZSLA 4A7YA 3SH3A 3LSDA 3KZ4C 1NCRA 4FT8A 1QOOA 3INAA 1LR5A 4YZ4A 2UY9A 1NCRB 3DL3A 3WR0A 5C4WC 3IDCB 3S30A 3LSEA 4MGYE 4D69A 2XHKA 4M0NA 2WWSA 3M2MA 3ME2A 4QQHA 1Q56A 3FBYA 5GLTA 4XF1A 4Q1RA 1EV11 2B45X 2GNTA 2OUJA 4B7EA 3EQEA 1S0JA 5JDBA 3HN1A 2E6VA 3VBUC 3HBZA 4AI8A 2HWD2 3AMQA 5I0SA 3VV1A 3FBMA 4W65A 1FNZA 1HDKA 2NPIA 2YGLA 3C2UA 4IESA 2EIGA 3IPVA 4QU2A 3ZSEA 4F83A 3K51A 1J3RA 3THPA 1BQPA 3IPVB 1TNFA 2JICA 2QKDA 2JKBA 1WLDA 4PLNA 3VUOA 5BPXA 3IT8A 1O3SA 4LA2A 3AYCA 2ZGPA 1ULFA 4L8QA 1ZNPA 2Y26A 2ZGLA 2K0GA 1W6OA 4BYYA 2ZX3A 1YI9A 1H2LA 3B5LB 5I0TA 1W6OB 4K21A 3L2YA 3ZXKA 3ZXDA 3SISA 4PDWA 2HWC1 1LCLA 5FO9B 3NKTA 5AFBA 1AYN3 3FLPA 2WINB 5T5JA 1RUH1 1AZDA 4PDWB 3OGGA 1RUF1 1PM7A 1POV3 3P3NA 2PA7A 4PBPA 1FOD2 4F7ZA 5CU1A 2WA4A 2RMU2 1X8EA 3IN9A 4OI4A 1AX1A 1H1MA 1PNGA 3WZ1A 4YLZA 2WQ4A 2B5HA 2XJSA 2H0BA 4AVBA 4L11A 3CLPA 5FO8B 1VB2A 1WBLA 1BBT3 5J48A 5E8AA 4XJ9A 2XJRA 3TOJA 4TZDA 1D4M1 2QUOA 2RS13 4HN1A 2I45A 3ZN4A 2PYTA 2XB6C 1VAKA 3ZIWA 1SLIA 3M3CA 2OA2A 3TNQA 5EXOA 4MX3A 1J3PA 5GLWA 3VBSA 3H7JA 4AEMA 5CBLA 2PHFA 1S0FA 2FZ2A 3WUDA 1WCSA 4Y5Z0 4CP1A 3VBSB 2XLFA 1ZBA1 4Z07A 3QCWA 4K20A 1LOFA 1BEV3 1OHFA 2VMGA 4N7IA 2KM2A 4IEWA 5DDJ1 3AXDA 1HXS1 3JQXA 1HQWA 2ATFA 3AZXA 2BGCA 4R9AA 1DQ1A 5L19A 1EPWA 4HFSA 4P9WA 3AM2A 4RD7A 3SITA 2WZR1 1JN2P 2DVAA 2P17A 2RS33 3NSTA 4WV8A 1RUH2 3NV3A 4WVZA 4XILA 1R081 1R1A3 4HSJA 3MFAA 2HWB1 4CDWA 4WM7A 1UU6A 1IOAA 1HW5A 3FUQA 4IEXA 2D6KA 1X82A 2DCJA 4QT6A 1VB4A 3VBUA 3IM0A 4P9GA 4CDWB 5GLZA 4WM7B 1OMIA 1RUD2 4XXPA 3MW4A 1B35A 1QJX1 1EAH2 3EXUA 1XYPA 3AZYA 1X33A 5CFDC 1B35B 4IETA 1F5JA 1RINA 4DPNA 5C8WA 1LGCA 5JZGC 5CG9A 3GNEA 5FLIA 1RHI2 4HN0A 2HWF2 1LODA 1N47A 2ZGTA 1OA2A 5AC93 1QOTA 1DQ0A 3ZSJA 5JI7A 3MLJA 1YRZA 1RJ8A 4XFAA 4LBJA 1ZZBA 5JSPA 1VLNA 1YJKA 4OFGA 1V70A 2D3RA 3E6CC 2D98A 4HVRA 2A6WA 4MSVA 3W9AA 3WQ0A 1LTEA 1SACA 4RQPC 3I8TA 5D8AC 1IPKA 5E16A 1VALA 1ENQA 2ZOEB 3LAGA 4META 3D4KA 3WDXA 4AQ2A 4FAHA 3NV2A 1J59A 3PJYA 3KGLA 4XDQA 5CFCA 2UY8A 4PIZA 1N1TA 1UCXA 4E2QA 1PNFA 5CFCB 3PTYA 2R062 1Y43B 3AFKA 5EWSA 5JIAA 2A6YA 3NAPC 4HKOA 3L2HA 5BYNA 2FZ1A 2WS93 1AR91 1BJQA 4XETA 1SBEA 4NHMA 4FOWA 5C8CB 3ZFFC 4Q4X3 4OI2A 4GALA 2QCSB 4RS5C 5GZFA 1V6JA 5HCBA 4LEJA 5I0UA 2ES3A 3FC0A 4XE9A 2NMOA 1EPZA 1LHVA 5K0UA 1IS5A 1AR71 3IWZA 3MFCA 1W6PA 2LM3A 5K0UB 1QWRA 2MPFA 4YSFA 2TNFA 3SH4A 3DPRC 5AVAA 1W6PB 4XTMA 1UD1A 4ASMB 3ILNA 4S2FA 5FCCA 1TMF3 3VDDA 2RS53 3T2TA 2R043 4GWNA 2OW4A 1RUG1 3KCCA 4WM8C 1BZWA 3KMHA 4YFWA 5FOBB 2EAKA 2WLQA 3B7MA 1XNBA 3VDDB 3JBG1 1QJU3 3UKNA 2DUOA 4F3JA 2F4PA 3HMYA 2X5IC 3FUOA 1H1AA 1PVC2 4FBFA 5JOYA 2W39A 3DGTA 5C9AC 2ILMA 1ENRA 2GU9A 2OZJA 2Q0AA 3SH5A 4IEUA 3WDYA 2ZGRA 4YYOA 4MLOA 4SLIA 4IV1A 2DURA 4AFDA 5CAZA 1PO21 4GB33 3MIDA 3H7YA 3ZYIB 4ES8A 4OHWA 1DQ2A 2BWCA 4IV1B 1FV2A 2I07B 2R0HA 4Q4Y2 3OCPA 2Q4SA 3KB5A 4NHKA 2BWAA 1AR62 2VUJA 4HKWA 3EJKA 3ZVXA 1WD3A 1VBA1 3CEWA 4F8AA 4IQPA 3J8F1 1GBGA 3TB0A 2K2SA 3O12A 2G9FA 2VOWA 1LU1A 2WFPA 1UZZA 3QBQA 3ZFGC 2JJ6A 3P3PA 1DGRN 4FP3A 1N3PA 4IV3A 4AHXA 2D3SA 4GMP0 2GH8A 2JDZA 2R49A 1XQNA 3LZZA 4IV3B 3ASIA 2QE3A 1SBDA 2DCYA 3GHMA 1TME2 4Q0SA 1G9CA 1N1SA 2GALA 3LB9A 3M3IA 2ZJCA 3THTA 2PLV1 1JUHA 5FLHA 3U10A 2D93A 3WCRA 5E88A 2JE7A 4AI1A 4AFMA 1YWKA 3AYDA 3H3UA 4QQLA 2KXLA 2D6LX 2WLPA 2IXCA 4KG0A 4KU7A 4L97A 4AI2A 4Q8KA 1CD3G 3WX5A 1ENSA 4JAAA 3O14A 1UKGA 3ZSMA 4MYEA 1GSLA 1NCQA 2JX9A 1LRHA 2PHXA 3KS7A 4IEZA 3WDWA 1RB8G 4XQ4A 2DYCA 1WUVA 2BTVC 1NCQB 1UU4A 3JD73 4AEJA 2Q5TA 2A3WA 4Y1YA 5I8TA 5L7OC 1ULDA 1VBC1 5KWRA 1A8DA 5CB7A 3PJQA 5J7MA 1KQRA 5HI0A 2ET1A 1C8NA 2X8KA 2ZX1A 4LR4A 2E7QA 4J1XA 2GMMA 5ACA3 3WV6A 2VULA 1H4GA 1ND2C 1H4HA 3VBHA 2UWAA 4HZFA 1OOPA 4JC1A 3RPQA 1SLTA 3FLRA 3VBHB 4BMEA 1C8M1 1JOJA 4BWOA 1OOPB 3ZXFA 1KDMA 2A6VA 2ENRA 3AMHA 4MXWA 4TLFA 2XG3A 1Z7S1 1AYM2 1PK6C 3TN91 4LE3A 4MXWB 5BNPC 4Y24A 3ETQA 4CZSA 3C3VA 4DINB 3POSA 5KHIA 5GJ6A 3PVBB 4Q0QA 2WFF1 3BB6A 3U0ZA 5JMCA 3J9SA 3AKPA 1U5IA 2QNKA 5T54A 1Q8QA 2VUAA 5CVRA 1SLCA 1C1LA 4QPGA 1OQ1A 4L2NA 5H9SA 4B29A 4GA9A 4Q4W3 1NY71 2WKKA 2QQPA 4QPGB 5FDBA 4WZFA 5FMOL 1VBD1 1DBNA 4KGGA 4BCUA 1FMD2 1KFUL 4Z2WA 4HPKA 1HRV3 1Q8OA 4GH4C 3WHUA 2PAKA 3BIWE 4Q27A 2QJVA 1RUI1 4Y1VA 1CVNA 1RL3A 2DCKA 4AWDA 4HPKB 4ATFA 2Y0OA 5GLVA 3PVOA 5LK5A 4HETA 1W39A 2CAUA 4IERA 3CF6E 2UWCA 3AMPA 4QD2A 1FPN1 1TNRA 2TBVA 2EF6A 1QKQA 1PO13 2HWE3 5A33A 4AQTA 3AP6A 5LRRA 1RMU3 5A33B 1ASJ1 1DF0A 2IFRA 4HKLA 1HRI3 4G9SB 4YW4A 4EWDA 4FAGA 1GZCA 1VRH2 2QZ3A 3KCYA 3S7IA 4O9GA 3MYXA 1LOCA 1RITA 2V73A 2OPKA 4JGYC 4KWKA 4CTEA 1GZ9A 4AHWA 5IK5A 1N3OA 3LKJA 3FFZA 1G7YA 1DIWA 2IXJA 2EAAA 1COV1 2RR11 1JH5A 1ZBE2 1LOEA 4XMAA 3HR9A 4I01A 3WT3A 1NCRC 5DZEA 1QNWA 5KHJA 1IGOA 3MW3A 1A6CA 1LOAA 4ZU7A 3R4DB 1RUC2 1H30A 4LT5A 2D6MA 2YC0A 5KXCA 4MXVA 3RYRA 4K6BA 2WJSA 1V6IA 1GFF2 3NV4A 4XF3A 3X29B 1AF9A 3VBFA 2ZGKA 5E1RA 1S0BA 3VGIA 2ZA9A 2TUNA 3FMGA 2IXHA 4WBBA 4XJUA 3VBFB 4QQ2A 4OULA 5J98B 1D2SA 4DXZA 5T52A 2YV8A 3ES1A 4H14A 3FJSA 1ZX5A 4RHV3 2JG8C 5DUUA 4QPIA 2P3JA 4LUMA 3VKNA 2AUYA 3LA2A 3RWNA 3ZDSA 2HEVF 2Z79A 5H9RA 3AMMA 5BNPA 1YI7A 1X7NA 4P5HA 1C1FA 1QQP2 4LO6B 1XXNA 3DUIA 4QPIB 1IPJA 1JW6A 1LHNA 1BYHA 1NOVA 2AENA 4BQ1A 1AJKA 3T1MA 4QX5A 3ZXLA 1ZM1A 1HQLA 2P34A 1REFA 2ZKNA 2ZZJA 1S2BA 4FPJA 3TAYA 1BMV1 1DYPA 1YHFA 1SLBA 1U12A 2VW0A 4A7ZA 4Q29A 3WG1A 4RA0A 4XMIA 2RR12 1L3JA 2IXIA 2ZZQA 3ENRA 4HK9A 4HT1T 4IEVA 4M00A 3VKMA 4NN0A 3AK0A 3PHMA 1V9U2 3WDVA 2VGDA 4YM3A 4CYDA 1SMVA 5HCFA 4PDWC 2XH6A 1T6GC 1AL23 2JD4A 2WIIB 5KXDA 1V6OA 1LECA 3ZN6A 3RQ0A 1R093 4WVWA 5JSRA 2ZGUA 2R072 2MNGA 1RUJ3 5LEKA 5T5LA 3FHIB 3DV8A 1IHMA 2ZAHA 2HWD1 4JTNA 3VL9A 1LOGA 2JE9A 1MR5A 1Q43A 1F31A 1RVF2 2NMNA 1XNCA 2BW8A 3OD4A 1Q3EA 2VMIA 2HEWF 4RGGA 5HBAA 1VBE3 1VBB3 1S2KA 1YFYA 4WVMB 3RS6A 3SMHA 1YFWA 2WA3A 1O5LA 3NJZA 5CA6A 2VU9A 3H1YA 1HQNA 4OHVA 5JPNB 1DQ6A 3E5UA 2P3KA 2DVFA 3OBRA 3RYKA 3M3EA 2Q1MA 3WNXA 2EXIA 3V65A 1LOFC 2RM23 1YCIA 4CDXA 2D44A 5I8SA 4X6QB 4Q26A 2D3PA 3R05A 1W6MA 3NL1A 3JZVA 4XBNA 4CDXB 4RSUA 5JI9A 1LENA 4KG8A 3GALA 3CU7A 5F1RA 4CRQA 1CPMA 1W6MB 3MLKA 4Z1VA 1G9DA 3TNPB 1WMDA 4LE4A 5BXXA 2P2KA 2SLIA 1FOD1 4NPRA 3FZ3A 1U5YA 2A3YA 2XUMA 2RMU1 4C1WA 1SBFA 2DVDA 1RUJ2 4CDWC 4I02A 4WM7C 4YVWA 3AKQA