3H1MA

Crystal structure of mannose 6-phosphate isomerase (holo; zinc bound)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
392
Chain Sequence
ASMQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITTAGETVSLRDAIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERLSQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGELLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLVLKPGESAFIGADESPVNASGTGRLARVYNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-6-phosphate isomerase
publication title Crystal structure of mannose 6-phosphate isomerase fromSalmonella typhimurium bound to metal atoms and substrate: Implications for catalytic mechanism
rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 116
structure length 392
sequence length 393
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 3h1mA03
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1mA01
1PMIA 3DL3A 3ZDSA 5HI0A 5EFUA 2BNMA 4Z07A 2PAEA 1UIKA 4B29A 4FAHA 4H7LA 3IDBB 4AVAA 2K0GA 2XHKA 4GULA 4META 1YFYA 4LUKA 4HLTA 1WLTA 1IPJA 4Q0SA 4JVAA 5CADA 3KGLA 4IEQA 1RUNA 4I0BA 2ZCWA 1RL3A 4HBNA 1NE4A 3KGZA 5I91A 1UPIA 4PJYA 4XEZA 3USSA 4EWAA 4TLFA 4JTOA 3SCHA 3E5UA 4ONUA 1O3QA 3CEWA 3LWCA 4DINB 4YRDA 4AQ2A 1QY4A 1GQHA 1Q5OA 1Q43A 3H8UA 3ACLA 3RYRA 3FFQA 3EO6A 3NVCA 2DCTA 4MUVA 1X8EA 1DZTA 2B8MA 3TNQA 4HVRA 5F1RA 2QCSB 1PM7A 1O3SA 1VJ2A 5LRSA 2PAMA 4N9HA 1EY2A 3BPZA 4HVOA 1SQ4A 3HT1A 4HSJA 4HN1A 2XLAA 4KL1A 3LA7A 5I0RA 5KHIA 4EROA 2VPVA 2IC1A 3CLPA 2BNNA 2OPKA 4R52A 5I8YA 1CX4A 4FBFA 2B9UA 5LEKA 4XF9A 3CL1A 4XF4A 4MZUA 4XFBA 4IETA 5FCCA 3H1MA 2XLFA 4XF3A 4Q29A 1OFNA 4I01A 3I59B 2EA7A 5JAXA 3UKNA 1UIJA 4XETA 2EAAA 2Q0AA 4MGIE 4WVZA 3I7DA 3E5QA 4P9GA 3KSCA 4XFHA 3FX3A 3HT2A 1GQGA 1DGWA 4L2NA 2D40A 2IXCA 5FPXA 4IERA 3R6SA 3ETQA 1Y9QA 2KXLA 3MZHA 5EZWA 1LKNA 1Q3EA 4QXKA 5C8WA 2Z69A 1CAVB 5I8TA 3L2HA 4Q0QA 2Q1ZB 1LRHA 2CGPA 3BALA 3LZZA 1CAWB 4BHPA 4K8FA 2GU9A 3OGJA 1OI6A 3E6DA 4CYDA 4OFGA 5BUVA 3FE5A 3H3ZA 2GC2A 2GC1A 3NJZA 4QGNA 4ZU7A 3GBFA 2N7GA 1J3RA 4ZU5A 2GC0A 1IPKA 4IEYA 5LRRA 1FT9A 2Z2SB 1ZNPA 4BIFA 4F8AA 1UD1A 2CV6A 3OCPA 5FQ0B 4J1WA 2FMYA 3OTFA 1ZRRA 3CJXA 3EHKA 4BYYA 4LA3A 1J3PA 4KU7A 3CO2A 3IDCB 1V70A 2ATFA 3OD0A 4X6QB 2Q4SA 4LUMA 4EV0A 2H0VA 1O3TA 3PNAA 2QVSB 2GC3A 5E16A 5J48A 5KHKA 4NVPA 2OZ6A 2CAUA 2HKXA 3KMHA 5CVRA 5J7MA 2H6BA 4WZCA 4BH9A 1O5LA 4IEPA 4IEWA 2ET1A 4IEOA 4X6RB 1ZRCA 4YNIA 5C6CA 4EWEA 2BGCA 3H7JA 1RGSA 4XFIA 1J58A 2XLGA 4XFAA 1G6NA 2MNGA 5K8SA 1L3JA 4KWJA 5FLHA 3KCCA 3FZ3A 4MV2A 3VHRA 5E1RA 2PTMA 3FJSA 3LA2A 4HZFA 4IEZA 4KWKA 1ZZ6A 1U12A 4MGKE 4XFCA 1O4TA 4QX5A 5BPXA 1CAUA 4Q0PA 4R8HA 2BYVE 5I0TA 1VR3A 1RTVA 3IIAA 2IXIA 5JR7B 3WW3A 3RNSA 1UCXA 1YLLA 4UBHA 2Q30A 4IEUA 2XKPA 1O7FA 4LEJA 2PA7A 5JSOA 1CAUB 4LULA 5KHJA 1FXZA 4HN0A 2QDRA 3EBRA 2WFPA 4KWLA 2UY9A 3RYPA 3SCGA 3S7EA 1J59A 3IBMA 2OZJA 3ST7A 4OLLA 1LR5A 3E6BA 1RUOA 2D5FA 1NYWA 1YWKA 3HQXA 1WA4A 2UY8A 2WC2A 3M70A 4HVQA 3RZZA 3SCFA 3SMHA 5J3UA 1YUDA 1JUHA 1TQ5A 3RPQA 2GZWA 2OA2A 1XRUA 3B02A 2IXLA 2XL9A 3ES1A 3H3UA 3S0MA 5BXXA 1NXMA 4PIYA 1EPZA 1QXRA 4D7TA 1X82A 4I0AA 4KU8A 1UW8A 3E5XA 3EQEA 2ZKLA 2UYAA 2VECA 3QACA 3SHRA 5FPZA 5D1IA 4IEXA 2C0ZA 3MYXA 4D7SA 1OMIA 2EVXA 4XFGA 5I8SA 4E2SA 1CAXA 3H50A 3O14A 4LA2A 2MHFA 2I45A 3NL1A 5FDBA 1LB2A 3ES4A 4UXAA 1X8MA 3LOIA 1ZRDA 3LAGA 3I54A 1ZZ8A 2K9ZA 4I2OA 5I93A 4AXOA 2ETEA 3JZVA 4IESA 4E2QA 1FI2A 2PFWA 4FAGA 2E9QA 4O9GA 2MPFA 4ZU4A 3WW2A 2PYTA 1ZREA 3U10A 5LEJA 3GYDA 4AQ6A 1SEFA 4PIXA 3NKTA 1VP6A 4UBGA 4MGZE 4AVBA 1HW5A 3RYKA 1NE6A 4Z82A 4MH0E 3M3IA 2BNOA 2PQQA 3NSTA 5T3NA 1DZRA 4MGYE 4QM8A 3D0SA 1ZZBA 4I3PA 2HJIA 5KHHA 3H1WA 3WW4A 4L11A 5JSRA 2F4PA 1J1LA 2QJVA 3DN7A 2OYZA 1DGRA 4F7ZA 3SXWA 2V09A 1H1MA 4XFFA 3FWEA 2PHDA 4J1XA 3HIFA 1EP0A 1RC6A 4XF1A 1J3QA 4YSFA 2XL7A 1XE7A 1ZZ9A 3NW4A 4JTNA 4QM9A 1Y3TA 3N4MA 4LLOA 1YHFA 1I6XA 1ZZ7A 1QXJA 3H1YA 2CAVA 2VQAA 2GH2A 3E6CC 2UYBA 1CGPA 4I02A 3H7YA 4AVCA 4E2GA 2FQPA 3MDPA 5BV6A 3H9AA 3UKVA 1XE8A 4QMAA 2O1QA 2PAKA 4O9EA 4EWDA 2QNKA 3ROUA 1OD5A 4RD7A 4LTAA 3MPBA 3BB6A 3I59A 5BY5A 5FLJA 4YYOA 1O3RA 3E97A 1I5ZA 3D0JA 2H6CA 2D5HA 4Q0UA 2XGXA 5AVPA 4IEVA 5KBFA 2ET7A 2XKOA 5CU1A 4PIZA 4MX3A 2Y0OA 3C3VA 2IXKA 3WW1A 3IWZA 2O8QA 1EYBA 3BU7A 2PHLA 1YFUA 4Q0VA 3TNPB 4ORFA 1WGPA 3DKWA 1CAVA 3QOPA 3CF6E 4N9IA 4QGLA 1SFNA 3G7DA 5I0SA 1YFXA 2B5HA 5I0UA 3LA3A 1X7NA 3PLQA 1NZCA 1CAWA 4YARA 3BCWA 3OF1A 2IXHA 1ZZCA 1O5UA 4I09A 4HMZA 5JCTA 2D93A 4JV4A 4QGMA 5KHGA 1H1IA 1YFWA 2P17A 4XF0A 1ZRFA 4HSLA 2IXJA 2GAUA 4WBBA 3FHIB 1CAXB 3D82A 5FLIA 4FT8A 3ELNA 1QWRA 3UKTA 3S7IA 3U11A 1ZVFA 3DV8A 4A2UA 3U0ZA 5FQ0A 5JSPA 3RDIA 3EJKA 1ZX5A 3PVBB 2BEOA
chains in the Genus database with same CATH superfamily
1PMIA 4E8DA 2E6VA 3DL3A 1Z7S1 2G9ZA 4UFLA 3MIBA 4C0HA 2BNMA 2XQXA 4D7YA 2WABA 3ZYGA 3UGHA 4B29A 1LESA 5KC5A 3SH4A 1ODMA 3T0DA 1GZCA 1BK0A 2VMEA 4H7LA 2DF7A 4CRQA 5IWFA 5IVBA 1XXNA 2WS92 2XHKA 4GULA 2TUNA 4KNCA 4Q26A 2J22A 5F3IA 3WF2A 4GZ9A 4LUKA 5T5LA 3L9JT 5FPVA 1ALYA 4C8DA 4GA9A 5FZ9A 3GBWA 4CU7A 3NJYA 4P9LA 4Q0SA 4JVAA 4FXKB 5CG8A 1POV1 2Y38A 1A8MA 3BVCA 4I0BA 2ZCWA 3C8XA 4GIQA 4TN7A 4QPWA 1W04A 1NE4A 4CDWC 3OG2A 1AL22 1QU0A 1UPIA 2YXSA 1F15A 4PJYA 3VB9A 3USSA 4FPGA 4LMFA 4TLFA 4CU9A 1VBA2 3ON7A 1OVPA 4QKNA 1HXS2 1K5MA 2LROA 3E5UA 1PVXA 1O3QA 5FOBB 4DINB 1WMDA 1IKPA 1BKZA 3DPRB 4H3WA 2YROA 4OI2A 5A6QA 2D6NA 4Y20A 1GQHA 5A70A 1F35A 1OC1A 4XZPA 3B69A 3RYRA 3FFQA 3ZSLA 2ENRA 1TEIA 3FMGA 4BCUA 3NVCA 3V65A 4MUVA 5IAXA 3WR0A 2B8MA 1JYNA 3BTZA 4HVRA 2LRPA 3DXUA 1VRBA 1E5RA 2DBIA 1O91A 5BNNA 4MXWA 4N9HA 5DAQA 4XUPA 5FUNA 1HB2A 2AEYA 5AVAA 1IHMA 1ULGA 4HONA 3VKOA 3HT1A 4RGKA 4Y5SA 2VCMA 3PUIA 1C4RA 4SLIA 5FYZA 3ZMNA 2VUJA 3I2OA 2D6PA 4KL1A 3LA7A 4A45A 1AX2A 3VBHC 4MADA 5I0RA 3WZ1A 2GN7A 2BNNA 3ZXDA 1CX4A 1VBB2 1TNFA 2HWD2 2LW8A 2YV8A 3WCSA 5HV4A 2B9UA 4JQTA 5JZGC 4YVSA 5LEKA 1JZ8A 1X33A 5A3MA 1QOSA 2TNFA 4MZUA 1POV3 5BNPB 2WA4A 5B2GB 5ERLA 1IGOA 1DP0A 1V6JA 5K0UB 2W95A 2XLFA 1OURA 4IGOA 2WT1A 3LEIA 5FZ8A 3HJRA 4M4RA 1S2EA 3OGVA 4QPIA 1NLRA 1OD3A 1RUH2 3N9QA 1BVP1 4AFMA 3AJZA 3J8F1 5F9TA 1WMEA 1G9DA 5H9PA 4FOVA 5FWJA 5L73A 4MGIE 3ZSMA 4P9GA 1AYM1 1MEC1 3KSCA 3BI3A 1W2NA 4XFHA 2WQ4A 4BLJA 1PO23 2ZXQA 3HT2A 4LHLA 4BWOA 4L2NA 5A7PA 1LOFC 2R6QA 4W50A 5SV5A 5C8CA 3R6SA 2NQYA 2JX9A 3NJXA 4J6GA 1COV3 5HCBA 2WZR2 4IV1B 5L7OC 4BMBA 4NOTA 2HWB1 4L92A 4JGYB 1RVF2 1H0BA 2Q1MA 1BLZA 3MEPA 4PBOA 2AACA 3AXEA 5EZWA 4AI1A 5KC6A 1FNYA 2FCTA 1Q3EA 4X8PA 1L7LA 5EWSA 3EYPA 5C8WA 1VBD1 2B42B 5LW9A 4ZONA 5FPAA 3AMPA 5CYYA 4D3WA 4CVUA 4Q4W2 4QHZA 4PI0A 1GICA 4M0NA 1AYN2 3HBKA 3LZZA 4UFIA 4BHPA 1ZBA2 1ACCA 1U5IA 3KCYA 2W94A 5EJ3A 3E1F1 4FPJA 5C9AA 1UL9A 1V6KA 4JHZA 2QQLA 1APNA 1SACA 4AGRA 4C90A 1JODA 4ES8A 3AKQA 4LE4A 5IHRA 4N43C 4BQ4A 5E6HA 2J1UA 1J3RA 3ZN6A 3TN91 4AR2A 1Y43B 2A3WA 5FP3A 2HH9A 4TLGA 5FP7A 1AR91 4ZHNA 3J8F3 1RUE3 4UT5A 5FQ0B 3HAGA 4XJWA 5FR3A 1MEC3 4J1WA 4FP2A 2VE1A 1UWWA 4WM8B 3ZIWA 3K4AA 1NLQA 5JUVA 1YC61 2DUQA 2VOTA 2VQTA 2WR9A 4KI5M 1ZBE1 4KU7A 1V0AA 2AZ5A 1V70A 5FMOL 3VN4A 4SBVA 2D6LX 2JKXA 1W6OA 1QHDA 2H0VA 2UWBA 4LUMA 4QPYA 1IS3A 4FTSA 3PU3A 1YCIA 4LO8A 1H2LA 5J48A 3PHMA 4NAMA 2D98A 1NKGA 4AVTA 4XTPA 3P6BA 4OI1A 2E26A 5F2SA 5T5OA 2K2SA 5CKNA 1VBD3 2CAUA 2HKXA 5FZIA 4OI0A 2D97A 2RV9A 1AX0A 3KMHA 2VD7A 4WM7B 3JB4C 5J7MA 1LENA 2RR12 1ODNA 4IEPA 1ZRCA 3AP4A 1MACA 1PVC1 3U4XA 3WNXA 2HWE2 4CU8A 5C6CA 2HWC2 1PK6A 5J98B 4IW3A 4LE3A 3VHPA 2BGCA 4DOUA 4ATEA 1RUC3 3AFKA 3THDA 5HXVA 1J58A 1W8OA 4LHNA 4XFAA 4YW6A 5K8SA 1R64A 5FZAA 3B3QE 4KG0A 4AI9A 5A7QA 2YDEA 5G04L 3TN93 3A0KA 3D3AA 2PTMA 3FJSA 3LA2A 2YGLA 4HZFA 2CHHA 1UZYA 4DO0A 4KWKA 3ZXEA 1M06G 3A0NA 4FI9A 4MGKE 3Q8FA 1AR93 1O4TA 1NX9A 1H2KA 3MLLA 3BIEA 2RM21 1DYOA 2WS93 3LB9A 1QOTA 1MS8A 5FXWA 2DVGA 3TWIA 4G9SB 1HB3A 2JB4A 3ZLIA 4CPBA 1JUIA 2GP5A 3PVEA 1YLLA 1YQ5A 2VMHA 4XVHA 1UYZA 5LZ6A 1WW5A 5K7PA 3M7AA 5JI9A 4DRRA 4URTA 2C1FA 5DN2A 5JSOA 2ZABA 2JWPA 5F6KA 1IS4A 5FZEA 1SCSA 5KHJA 3T2QA 2JDMA 5A7WA 5C4WB 2R49A 2R0FA 5FYTA 3VBRB 1UY0A 2Y60A 2R7EB 1VBA3 3EBRA 4XIKA 5FY7A 3O5SA 1HXS3 2OZJA 1GSLA 2V5DA 1D0GA 1W6QA 4KBZA 5K0UA 4MLOA 4QHBA 2ZEYA 3OJBA 5FP8A 5ISLA 1LOGA 1YWKA 2ZGPA 1YNAA 3AVSA 4XACA 3BIWE 1JYIA 2CY6A 1WA4A 2QZ3A 5A1LA 1JZ6A 4JRAA 2IZWA 2WC2A 3M70A 3SCFA 4KGQA 1W8ZA 5J3UA 5GZEA 1GUIA 1YUDA 2ZMNA 4EN9B 2BRTA 4AEDC 4G3YC 3M3QA 5A80A 2AGSA 1FAYA 4AF9A 2EAKA 3HNMA 1EUUA 4OCTA 4LOSA 5L9BA 3TEXA 3AKPA 1OOPC 3B02A 1T2XA 2IXLA 4K9SA 4B3NA 3H3UA 4FPOB 3S0MA 3MIGA 5IT6A 1EPZA 1QXRA 4XMAA 3O1TA 4I0AA 1GP5A 1PGW1 2FCUA 3UGFA 3GCWA 3V0BA 4JGZB 5CISA 2JJ6A 3FLRA 4XBLA 4FCAA 3U07A 2GMEA 3E5XA 2RM23 3EQEA 4FFGA 2RVAA 1BEV3 2UYAA 3QACA 2ZOEB 4A7KA 1UZZA 1VBB3 4A4AA 5JOZA 3MF6A 4RFRB 2W39A 4M0HA 1AXYA 5FPZA 1DQ1A 1RINA 1JTZX 1UN1A 2X05A 3VDCA 4BOWA 1GNYA 3RZKA 4IEXA 3O1RA 3RGBA 3VBOB 3N9NA 2X29A 2PLV1 4WVMA 1VMHA 1MZ5A 2RJLA 3ZPYA 2WT2A 4H14A 3FLTA 4B4PA 4COWA 5JMOA 2JDHA 4WZFA 3H50A 2HWF2 3VDBA 4MGSA 4LA2A 2WNOA 1C8M2 3POBA 1GZWA 1JMUB 2XBO2 4XBQA 4ASLA 1XC6A 4FPHA 5A32A 3VV1A 5FDBA 2YMZA 5A6XA 4CDUA 2YBPA 1X8MA 3LOIA 4MGQA 4OUSA 1QMJA 5T50A 2VMIA 4ASKA 3IKWA 5FK8A 3PTYA 1ZZ8A 2K9ZA 4DMIA 2QZ2A 4DS0A 3AZVA 4R9CA 1QEXA 2EXKA 4AXOA 4HPKB 3VD7A 1ULDA 1DQ5A 1GU3A 4YFZA 4LKEA 2TEPA 1GKBA 2C26A 3OPTA 3TBDA 4OHVA 2ZGMA 3ZDVA 1NCRC 2D6KA 3HQUA 1S0DA 3VBUB 2E9QA 4IE0A 4O9GA 3LSDA 1OPOA 2ZZJA 3S30A 3WW2A 3WXPA 1ZREA 4MVTA 3B5LB 1CZSA 3AP7A 4QQHA 3ZFEC 5CG9A 3TYJA 3GYDA 3JD72 4AQ6A 2HBTA 3PIGA 3KVAA 2VTFA 3ENRA 3POEA 4N90A 4NROA 1IS5A 1Y9MA 4YZ3A 1OLME 4Q4X1 3CBNA 3WG4A 2BBVA 3OY8B 1NE6A 5FO7B 1ZA7A 3QD6A 1XYOA 1GZTA 1GYKA 4ZKTB 1UOJA 3LD8A 1M4WA 2ZX3A 1OA3A 1HV1A 3RZGA 1F2NA 2A75A 4P08A 4Y4RA 1MZEA 2PLV3 4CDWA 4LT5A 1FATA 1ULPA 1RUF2 2JDUA 4XAEA 5APAA 1RUG2 1TME1 3QH7A 3C7HA 4I3PA 5LCWL 2HJIA 2Z5WA 1UYXA 2W9XA 3OEBA 3H1WA 4YGCA 4XQWA 3RJ2X 4HOOA 1YIFA 2D44A 1JXNA 5ANQA 4QQPA 1AR62 4QKFA 2OYZA 3VUOA 1FOD1 1DGRA 1HB4A 1W9SA 2VOKA 1FMD2 3SXWA 3S5QA 1RUJ1 3RWNA 1K5JA 2NPIA 2QQOA 4XFFA 2E7QA 2PHDA 1QQP2 4N7IA 3B00A 5JIAA 2Y6HA 4UI9L 3BTYA 1WCKA 4QM9A 1XB9A 1ZZ9A 4LORA 3ZKYA 3WDTA 4CP2A 1ND3C 4PI2A 2EXJA 4P9IA 3VBSC 1YHFA 1D4M1 1LOCA 1O8SA 4UW6A 4YW2A 4QX0A 2GH2A 1MS3A 4QDRA 1DQ6A 4YWAA 4E2GA 5BYNA 2PHUA 3JBG1 1PNGA 1UZVA 2RR13 1DCSA 2IVIB 3VBHA 1XE8A 4QMAA 4AI0A 2Z4FA 1QDOA 2QNKA 2R043 5JZGA 4Q8KA 3BB6A 4ZS2A 2PHWA 1LOAA 2Q5TA 4QX2A 1L7QA 2C24A 1HQWA 4XC9A 1AX1A 2A7AA 1W2UA 2BTVC 1VMFA 2OX0A 1SBFA 4Q0UA 4YW3A 2B45X 4DXSA 5L9VA 3IM0A 3KV4A 5KBFA 4GJYA 3WNPA 1BMV2 3LDBA 1BHGA 2CGOA 1QIQA 3OSDA 4QKBA 4NE9A 1UXXX 1N1VA 1EYBA 3J26N 3VDDC 1VAMA 1QJZA 1UMIA 1FOD3 2A6VA 2B46X 3W9AA 3RS6A 3TNPB 4AEMA 5LY1A 3ZN4A 1RUJ3 4Y5Z0 1D2QA 1LOFA 4FO9A 2WLQA 4QPGA 4YM2A 1TE1B 4JDMA 3ZSEA 4CCNA 5IVCA 1SFNA 1BJQA 2VMDA 2JB8A 5L7OA 5I0SA 4UW3A 2P3JA 3VHOA 1QJY1 5FYVA 2W5FA 3PLQA 5GKAC 4YARA 4KGGA 3SITA 3OF1A 1ZZCA 2J1EA 3V0AA 1CONA 1SMVA 4AWDA 5IVFA 5K4LA 5JCTA 2V73A 5FJKA 3THCA 3JBG3 1B35B 3KM5A 2D3PA 4JV4A 4LLFA 2BZDA 2DCJA 4URAA 2X5IB 1H1IA 3T2PA 2P17A 1HRI3 5JLVA 4AEJA 4LBQB 3FHQA 3MV01 1MZFA 3VKNA 2SLIA 2BGPA 4NIDA 4P02B 1WLDA 4GH4B 5F39A 4XPVA 3UKTA 5HXMA 1ZVFA 3POFA 3ZYBA 2VTXA 1V9U1 1PGL2 1NLSA 2WO1A 4N43A 3B93A 4CP9A 1AZDA 4OZOA 4XJ8A 2JXAA 1NY72 3ZDSA 5HI0A 3HVDA 5EFUA 2WRAA 2MEV3 2RS53 3ASIA 4Z07A 5FYIA 1Z7S2 5H9QA 5C70A 1LHVA 1OUSA 5TSWA 3IDBB 2K0GA 1D4VB 5EYYA 2D3RA 1WLTA 4YGEA 4RQPA 4GWJA 1A8DA 5FMDA 1US3A 5LASA 3FL7A 3SH3A 5FYUA 1RHI1 2OXBA 2YB7A 4P9WA 3WT3A 3AM2A 4IEQA 1UOFA 4UWDA 2D7FA 1A3KA 2JDKA 1RL3A 3ABZA 3VBFA 3VZKA 3GZUC 1IQAA 4HBNA 4FTEA 2WYSA 3KGZA 3DPRC 3M3CA 1CESA 1FYUA 1JN2P 1F31A 1QJY3 2LTNA 5I91A 1UO9A 4W6YA 1GLHA 2Y6KA 3LIGA 1GMMA 2VUAA 3SC7X 2QQIA 2VU9A 4PQQA 5JPMB 1C8M3 3WQ0A 2XBO3 3U4SA 1DGRN 2HEYF 4XDQA 2ZGUA 3SCHA 3TAYA 2WAOA 2KM2A 1A78A 1MS5A 1SPPA 2BV4A 3J7HA 4LXLA 2CGNA 3HPNA 5LK7B 1S0FA 2GNDA 4D94A 1UZWA 5JMCA 1DQ4A 1O8PA 1PO22 2UWCA 4CDXB 2DCTA 3PMEA 2W1QA 1GV9A 5FK7A 3ZPOA 2Y6LA 1S0BA 5F1RA 4IE7A 5F6LB 4NHKA 4NUBA 4BQ5A 5FYMA 3PL0A 4Y20B 5JOWA 4GJZA 4OHWA 3CU7A 2QKDA 4HN1A 2EF6A 4CSWA 2WNUB 4S2DA 4Q4V1 5FXVA 4C1WA 1JYTA 2F4LA 1DFQA 4JCKA 4QD2A 1EAH3 3ZFFA 2VPVA 1QJX1 2IC1A 3CLPA 4L0PA 4MXWB 5T5JA 1JZ3A 3ZXGA 4K8RB 3VKLA 1XNTA 3GNEA 1DDLA 2ZGKA 2TBVA 4DRVA 5JXHA 3LFIA 4GWNA 4XUNA 5FBZA 3RI9A 4IETA 2GNTA 2VW0A 3ACIA 4V2WA 2VR4A 3H1MA 4Q29A 1F8VA 4AQTA 1NUKA 1OFNA 5FZBA 1RUD1 4R4ZA 1WLWA 4FOWA 3UKNA 4FSJA 2EAAA 1YI7A 4QX7A 3J8F2 1RUE2 3E5QA 1CX1A 1CJPA 4JGYC 2XPJA 4H2AA 4LITA 1YQ8A 3SKJE 2BJSA 1L7RA 1GQGA 2VJXA 1AYM2 1DGWA 1MEC2 2RMU1 5FY5A 3D4KA 4I3GA 2VL4A 4QPIB 2D40A 3OGGA 1W6PA 5SV8A 3ETQA 4BE3A 1HRV1 4W6XA 1ZYBA 5FUIA 3CJIC 2XUMA 2ZEXA 2V72A 1SLAA 3O0WA 5FO9B 4TXWA 1GANA 4XURA 1LKNA 4LHSA 4CEWA 4CU6A 2HWB2 3IIIA 1R081 5C8CB 3HNBM 3TOJA 3AZZA 4AFDA 4OULA 3P5BA 2WFF1 3W21A 3OD4A 5JOXA 1VBD2 4Q0QA 1YJLA 4Q4V3 4L97A 4D6RA 4HANA 1HIXA 2P6HA 3CNAA 3R05A 3ZIXA 2FZ2A 5GLUA 3S6PA 4Y22A 5A6ZA 1QJX3 3KS7A 1AR81 1CAWB 2NM1A 3M3OA 1X50A 4YW7A 1HJFA 3RMYA 5ABJB 2GSYA 2GU9A 4AHZA 5DUXA 3NKGA 5BNOB 1JOPA 4CYDA 4OFGA 1VBE1 1RUC2 2GC1A 3ATGA 1XNDA 1PZ7A 4QGNA 3GBFA 2N7GA 1POQA 2W47A 1MVEA 5FZ7A 2YGMA 4EN6B 3AKSA 3IDAA 1IPKA 1Z0HA 2VAUA 5LRRA 3T1MA 3HQRA 2J1AA 3TN92 3WLUA 1IPSA 2VO5A 5C9AB 4R9DA 4A3XA 2XVKA 3MHZA 1TMF1 1ZNPA 4BIFA 1RMU1 2WNVC 2A6YA 3WVJA 4QT6A 4Y26A 3WDUA 1AR92 1W6NA 5FZLA 2VUCA 5FP4A 3ZN6B 2P1BA 5C5UA 1ZRRA 4NRMA 4B4RA 5IVEA 4W65A 2CWSA 4BYYA 3N7LA 4LA3A 2RMU3 4GMP1 4YLZA 2EIBA 2ATFA 3I2FA 1W9WA 2JECA 4E4HA 3GM8A 3O0VA 3GZEA 4WM7C 4AW7A 3B01A 5A33A 1UU6A 3I2IA 3PNAA 5D8AC 3LKJA 1FPN1 1U5ZA 5KHKA 2NMNA 2RJ2A 1H30A 3FLPA 1NCRA 1SHWB 4K40A 1XNKA 2AH2A 4NVPA 2E31A 4KG8A 4Q5OA 1UKGA 1UYPA 2VMCA 1KRIA 3O1MA 1E5HA 1H9WA 3ZFEA 2E51A 3IN9A 3IMNA 2GDFA 2BFUS 1JBCA 4IEWA 4DXTA 2BVBA 4X6RB 4GB31 1AR83 2FDFA 1XQNA 4ASMB 1PVC2 3PDQA 4IQPA 4JZRA 4LBNA 1RGSA 2OUHA 2CL2A 2WZ8A 1PZ8A 1VBE3 1V6MA 2MNGA 4S2HA 1WW7A 4K1ZA 1YRZA 2WNEA 4KWJA 1KFXL 5FMBA 4DXRA 1KQRA 3LCPA 3VHRA 1DLLA 4NAOA 2CDPA 4YZ2A 4IEZA 4QXCA 4QQLA 1Z7S3 1ZZ6A 1RXFA 4XFCA 1TMF3 3GHMA 4P14A 1GOHA 3ETPA 4X8NA 3NMBA 4HT1T 2LM3A 3NNJA 1R1A1 4R8HA 1NZIA 2BYVE 2RM22 4AFCA 1BEV2 1US2A 1OSGA 2IXIA 3C7GA 2ZEZA 1HX6A 2ZBJA 2XB6C 2B9VA 4GMP3 2W68A 3I2DA 3WHUA 1W3XA 1O7FA 2CNAA 2ZACA 5JWPA 3PJYA 1W6MA 1WD3A 3N3HA 4NN0A 1ND3A 1JZ7A 3I3EA 3GALA 1FPN3 2W1SA 4YVWC 1N1SA 3VBSA 5FPUA 5C33A 3SH5A 2RDNA 3PU8A 5HBAA 2WKKA 2R061 1O4YA 4LBQD 3RYPA 3SCGA 1ND2B 1DQ2A 3MW2A 3DEMA 1WLCA 1K3IA 3DF0A 1VPHA 4M01A 4QB6A 3HBZA 4XZUG 5IYYA 3I3QA 5FZ1A 1S2BA 5FZ0A 4OQ8A 2D5FA 5FZOA 3P3NA 4YPJA 4GB33 5DG1A 2JG9B 2UY8A 4NPLA 4OYUA 4XAAA 4QPGC 3ZYJB 5H9SA 5CZKA 3ZSJA 4BQ2A 1XYNA 1NT0A 1W6QB 1XNAA 2B7YA 1XSQA 2YFZA 1CJDA 1I5PA 2GZWA 3IAQA 3LEGA 1DLCA 3RPQA 4N7UA 4JQRA 5A3PA 3ACHA 2CTVA 2JE9A 2JG8B 5BXXA 1NXMA 4C91A 4D7TA 1OT5A 3MFAA 1CPMA 5F5QA 1PGSA 2ZKLA 1PGW2 3VDDA 1LU2A 2E7AA 4EE2A 3CMGA 1R1A3 1VMJA 2VC9A 4ARYA 5FMCA 4LJHA 1LOEA 1SZBA 3SHRA 1N47A 1VE0A 5IFTA 2ZGLA 1UX6A 1W3VA 5D1IA 5ANNA 3V0BB 3UJOA 2C0ZA 5CKQA 2IFWA 2EVXA 4O65A 3WUDA 4XFGA 2PLV2 4ZXKA 5I8SA 4Q4Y1 4E2SA 4MGTA 4XQDA 4AFBA 1WUVA 4RHV1 2HEVF 2EICA 2E33A 3ZO0B 2JEMA 2R063 2MHFA 3WNLA 4DEVA 3CKHA 5FZ6A 1KXGA 2I45A 4N53B 4WVMB 3GHNA 1LB2A 5GLWA 2XMLA 3NNGA 4NO4A 1MS1A 4QB2A 1AYM3 3VZOA 4CCCA 3NO8A 3VBUC 3LAGA 4RQPC 3VHNA 3U78A 3VD5A 4TSVA 1GZWB 3J7LA 3N36A 1T6BX 2OQ6A 2XWBB 1Y9GA 5FUPA 1LGCA 4P5YA 1JZ4A 4RGAA 4CCKA 2P6CA 3JZVA 3PUQA 4IGPA 2VBPA 3Q8CA 3VBFC 4CDUB 2QQNA 2P3IA 4Y5TA 1WW6A 3N9OA 1FI2A 2PXJA 4RR3B 2HWB3 1EV11 5J09A 5ACA1 2VMGA 3FN9A 1S0JA 2MPFA 2PYTA 5FZ4A 4GQ7A 5J37A 3TB0A 4YZ1A 2YBKA 1JS9A 1F4AA 2DFCA 1OH4A 2XOMA 3NAPB 5EJ1B 1HN0A 3LEKA 1SEFA 4PIXA 5F3EA 3THTA 3NKTA 2ZEWA 4AK3A 2A6WA 4BQ3A 4UBGA 2OS2A 4MGZE 1XU2A 1HW5A 2R042 3RYKA 2VMFA 1LHWA 1TVGA 4MH0E 1DBNA 4IV3C 4Q4X2 1K42A 3KT7A 1AL21 3KV6A 3M4FA 3POGA 5FY9A 4Q1PA 5KXDA 2PQQA 4ZS3A 2DVAA 1LHUA 1LOBA 4XUTA 5LA9A 1AVBA 1WZXA 1OQ1A 3DPRA 3DYPA 1LEDA 3X29B 3Q9OA 1BBT1 4Q4Y3 4BQWA 4CXWA 1TME2 4JAAA 4CZSA 4PQ9A 4L11A 1JYCA 1WBLA 4M00A 5FOJB 2VZRA 3MLKA 2QJVA 3DN7A 4GD4A 4V1PA 4CDWB 1AR71 3ZFFC 2FDKA 2QE3A 3I3MA 4XBNA 5LA1A 4F7ZA 4DY3A 2ZGTA 1H1MA 3WX5A 1FOD2 1W8TA 3D8CA 3FWEA 1SLBA 3HIFA 4UFMA 1YQ2A 3T1LA 1RUJ2 3O1VA 1RC6A 1ULEA 2VULA 4AG4A 1ZBE3 4ET7A 1LU1A 3DYMA 5DZGA 4EJRA 2WAAA 4OHYA 4JTNA 2JICA 1LAJA 1E5IA 3WP6A 1CZTA 3IPVB 2J1VA 3PMSA 3HN1A 4JKKA 4XW3A 1ZZ7A 3H1YA 1EV13 1HQNA 4DIQA 5ACA3 3NV2A 4CA9A 3ZFGC 1D4M2 4AVCA 2J42A 1VB4A 1AUYA 5JIUA 3WD5A 4COZA 1WD4A 2FZ1A 4XJAA 3SNMA 2O1QA 3BODA 3JBG2 1KJRA 1DQ0A 4XILA 4O61A 4Y24A 3HMYA 2JIJA 1HRI2 4B7KA 1QJEA 5C3QA 1PVC3 5JDBA 2VH9A 1DF0A 5H9RA 4R4XA 5I0DA 4U2AA 4QU1A 2XUEA 1UNBA 3VDAA 2DVDA 2LS6A 2ZX2A 2RDSA 2BDRA 1PHMA 4FPFA 1K12A 1H4HA 2XJPA 4OMDA 3WP5A 3N9PA 4NJ4A 3HWJA 1EUTA 1PX4A 1BBT3 4LK7A 3POYA 2G4IA 4CEWC 1JHNA 2DTWA 2WSVA 5L9RA 5FIXA 5C3SA 3RZHA 2Y0OA 1OVSA 2WZEA 3KWVA 4YM3A 1H1AA 4LK6A 2MEV2 4XUQA 2RS52 4BMEA 2JDPA 3FBYA 3FFZA 2WN3A 4JGYA 2W92A 1YFUA 1QXPA 1AR73 1SLTA 1TG7A 4XABA 1QNWA 5FY4A 4BXSV 5A1AA 1QNYA 3AYEA 1GNZA 1WGPA 2WZR1 3DKWA 3W5MA 4N9IA 2VBBA 4QKDA 1JI6A 5LBCA 2JE7A 2O0OA 1QKQA 3PVNA 4JRLA 2ZHMA 3CJIA 3D5OA 2BGOA 2C5DA 3TEYA 1AJKA 3AP6A 2D6OX 3BCWA 3TEWA 1QJY2 3I3DA 4GH4C 4CP0A 4KWUA 3MGUA 3MBWA 4Q4W1 3QCWA 5K9YA 4HMZA 4QHOA 3AP5A 3PJQA 1AYN1 5IUQA 3GZAA 4LBOA 4CXYA 1GBGA 2W2IA 4QGMA 1WKYA 4EZ4A 4HSLA 1NA1C 1LECA 1H8TB 2GAUA 3SKVA 4LBKA 1CAXB 3V0AB 2R071 4GWIA 2RHPA 5A3NA 3D6EA 1QWRA 3K48A 3K77A 5F3CA 3S7IA 3DV8A 4I30A 5HV0A 2VNGA 3U0ZA 3AZYA 2CSGA 3BGAA 2YYOA 5FQ0A 4YW1A 3PUAA 4LQRA 4Z2WA 4C0BA 3EJKA 1V9U2 3PVBB 2BEOA 4RFT0 4XF3A 4XJZA 1XJAA 2VBDA 3EMRA 2BOJA 3WP4A 2WNVA 2ADDA 2A3XA 4OUMA 4YG0A 1RUI1 3USUB 4AVAA 4N43B 4XOGA 3AKRA 3W20A 3AMMA 1EAH2 5M0TA 5F5IA 4FPYA 4ISQA 2VCBA 5IVYA 4MYEA 2VXJA 4RSUA 1PIV1 3VL8A 4A41A 4AVSA 5KWRA 3ALQA 1S0IA 2DCYA 3U1XA 5GZDA 1YQ6A 3KGLA 4CPBD 2ZHLA 3T09A 4WM7A 1LGBA 1RHI2 4GALA 5D8AA 2DFBA 4NIHA 5DZEA 2RJKA 4A3ZA 2G19A 3SISA 1FV2A 4EWAA 5AFBA 1C57A 4JTOA 4AHWA 2BOIA 2VY0A 1U5YA 3T0BA 2W1UA 5CEHA 3RG0A 3IB3A 1WCDJ 1AL0G 1IQDC 3GZTB 3WF3A 1JYXA 1A6CA 2JDAA 2ZA9A 3NNLA 2ERFA 1UU4A 3LPFA 3R4UA 4NHYA 3JXSA 4UFJA 4YRDA 4AQ2A 4CDQB 2X09A 3ME2A 1W90A 3OUHA 4RS5C 1Q5OA 2DUPA 4P5HA 3EO6A 1UY2A 2WNUC 1JW6A 2OUJA 4RYDA 3HOBA 4K21A 4QDQA 5AC91 1HDKA 1SBEA 1SPPB 2ZAHA 1SBDA 3ZR6A 1VIWB 4DUWA 1QOOA 2WSUA 5FFOC 1O3SA 2G9FA 2GALA 5CNAA 2PAMA 2VZ1A 2WA3A 4NR1A 4HVOA 3H0OA 4LBMA 2GNBA 1J83A 1SQ4A 2JD4A 1UYYA 1W03A 2R0HA 2X10A 3ECQA 4HSJA 5A3OA 4PDWB 1QH6A 4QXBA 2VZVA 3ZXAC 3AXDA 4UAPA 5CFDC 3H8OA 4JKMA 2YG0A 4DFSA 5KHIA 1PO11 3KV5A 1RUI3 3J7MA 4Q4V2 4EROA 3H8XA 2Q8CA 2OPKA 4Q27A 1W8FA 1YEWA 4NRPA 5DUVA 4FBFA 1QJX2 3N7JA 4BQ1A 4Q4X3 3UETA 1XOYA 4WV8A 5FO8B 4K6BA 3AC0A 4XFBA 5FCCA 1W8WA 3NJVA 4CEYB 2XG3A 3PURA 2VCAA 5F3GA 2L9LA 3R4SA 1RJ7A 4YVWA 2O14A 1W2TA 1GNHA 2VZSA 4CP1A 4I01A 1SDDB 1TME3 3I59B 2V4VA 2E7TA 4QXHA 4QX1A 1RUD2 4XETA 4BISA 3OEAA 2Q0AA 2XVLA 3KF3A 2JDYA 3I7DA 4NIIA 3UJQA 4W4ZA 4HFSA 1NCQC 1ASJ1 2YC4A 3FX3A 2VM9A 3W59A 3LEMA 1R091 3AL5A 1C8NA 1AXZA 4C1XA 1MZ6A 2EXIA 3K3OA 5FPXA 2C6SA 2RMU2 3AMNA 4OHZA 3GJAA 1Q8PA 4IE5A 4L9BA 1OQEA 4JGZA 5F5CA 4AHYA 1Y9QA 2BP6A 5L36A 3UT0A 1HRV2 1SLCA 2QQPA 3OYWB 3N7MA 3WG3A 1S0CA 5ABJC 5CFCB 3BTXA 1CAVB 1D4M3 4HKLA 3A21A 5BNOC 5I8TA 5FZGA 1KEXA 1XNBA 2Q1ZB 1LRHA 4K20A 4AEDB 3UYJA 2VGDA 2WFF2 5DPNA 5EXOA 3ZMOA 1OOPB 2RS11 1REFA 2OQ7A 4P9JA 4K8FA 3UGGA 4EQVA 5DAWA 3OGJA 1AR82 3E6DA 3THPA 5LA2A 5BUVA 3AMQA 3I2JA 3H3ZA 4DUXA 5FTTC 3POSA 5GLTA 4UF0A 4Y22B 5DDJ1 5FBJA 1OBNA 1VBE2 5FYCA 2LUWA 2OIIA 4ZXEA 4ZU5A 1GWMA 1MQTB 2W46A 1KS4A 4IUGA 4ISRA 5E88A 1I3HA 3H3LA 2BWAA 1H4GA 2EIGA 1FT9A 2QQMA 1VRH1 2Y33A 4BM8A 3C2UA 3POWA 4HPKA 1HB1A 5LB6A 3AYAA 3OCPA 2JENA 1TMF2 4AVVA 1QJFA 1RMU2 2FMYA 3CJXA 3EHKA 1IG0A 3J9SA 5T5PA 2Q8EA 4EZHA 1YO8A 1LNSA 3VZJA 3VBUA 1OUXA 1J3PA 1GZ9A 4XCAA 1XSRA 3IDCB 5DAVA 2Q8OA 3ZR5A 3ZN5A 2Z42A 2CYFA 3MIEA 1A34A 2Q4SA 2VZUA 2A3YA 5GJ6A 4EV0A 1W6NB 5LK5A 1O3TA 4BLIA 1C5HA 3L2YA 2QVSB 2GC3A 5KXBA 5E8AA 1HN1A 2Z79A 4GWMA 5IFPA 1PNFA 1DIWA 3DYOA 3OY8A 1FPN2 1Q56A 2WO2A 2XDVA 2OZ6A 5LA0A 5F37A 5J1XA 4Z1VA 1AF9A 4JC1A 4D8MA 3MO4A 1AXKA 3K3NA 5CVRA 2ID4A 4K1YA 5C71A 3OOXA 3QLQA 2XJVA 2ZS6B 2H6BA 4V2VA 3F95A 1O5LA 4WZCA 4AHXA 4BH9A 2ET1A 4XHXA 3GGLA 1G9CA 3KF5A 4YNIA 5F32A 5J36A 1OKQA 5IW0A 3U75A 5EQUA 4GB32 1MR5A 1C1FA 5FXZA 4BPZA 5AFEA 4PF1A 4IV3A 4FXGB 3KCXA 1KDKA 1VBC1 4NPMA 4OHXA 4XFIA 2A71A 2BWCA 1AJOA 3ZFEB 1K5MB 3BOPA 1RUG1 4U36A 1BXHA 5F7UA 5FZCA 3C7OA 1SG3A 1L3JA 5FJHA 2AR6A 1LODA 4S2FA 1V9U3 5DDJ3 5A3LA 3WDVA 2YBSA 1W39A 3T30A 1H8VA 1V6OA 1N1YA 2BU9A 1WW4A 4ZPIA 4OQ9A 2FDHA 1VRH3 1U12A 4UW5A 4QX5A 2A70A 2P34A 5BNPC 3BPSA 3MI8A 1CAUA 1QQP1 4HK8A 1VR3A 2WLPA 4NWVA 3PIJA 5BNNB 3CDZB 3H42B 1OLMA 3GCXA 3IIAA 4H55A 1TNRA 1R1A2 4HETA 4LKSA 3WW3A 5IVVA 1UCXA 3LDKA 4GAZA 4IEUA 3WNOA 3O1OA 5FPBA 1ND2C 4A7YA 1RHI3 2JD9A 2PA7A 4Y33A 1JOBA 1UAIA 4LULA 2EALA 3ILNA 3GBGA 1FXZA 3O0XA 4HN0A 4BQXA 2JG9C 2X8KA 4BK5A 4BIOA 1DG6A 2WFPA 4KWLA 4HKWA 4YVSB 4YW4A 2BFUL 3ZFGA 1CQ9A 1GP6A 1J59A 3ST7A 2R062 2FD8A 4OLLA 2Y26A 3IAPA 4IV1C 1JH5A 1OFSA 4M3CA 1LR5A 1ND3B 2ORXA 3WDXA 4HL0A 4ATFA 4YG3A 4CCEA 1SLLA 1NYWA 3CZUA 2JG8C 1OKOA 4E8CA 1UX7A 3NNFA 2YPJA 3SMHA 3JQWA 3HN3A 1VBC3 4NHMA 4NMIA 4CCJA 2D3SA 2DCKA 1LEMA 2OA2A 2VVFA 2J1RA 4KH9A 1XRUA 3FHAA 4OMCA 2A1XA 3MUZ1 4XMIA 4AL9A 3ES1A 1POV0 4PIYA 2VG9A 4EN0A 4OZXA 1X82A 1XE0A 4KU8A 5EP9A 3LSEA 4AFAA 1HQLA 1VAKA 4E4ZA 3WF0A 1OXCA 2CWMA 3WHTA 5IK8A 3PTRB 4TWTA 2PELA 5F8PA 3W5NA 3EXUA 4AYUA 4XTMA 3KQ4B 1X36A 4K3UA 3ZKUA 1CPNA 3MYXA 4D7SA 1OMIA 5FV3A 4CCLA 1C28A 5F5AA 4AI2A 1W05A 3ACGA 4LIUA 4WM8C 4BJ0A 4GH4A 2DDUA 4MXVA 1REDA 3AVRA 4G4FA 4Q4Y2 2F6BA 1NOVA 1RUD3 5G05L 4RHV2 5CIRA 1ENSA 1XBFA 2DWRA 1G9BA 1RB8G 2IUWA 3NL1A 3VZMA 3ES4A 4UXAA 1IS6A 3WP3A 4RR3C 2ZKNA 1NA1A 4JDNA 2R1DA 5LBBA 1W0NA 4LKDA 3AP9A 4DB5A 5C3PA 4I2OA 3C7EA 4UFHA 5I93A 3NAPC 1HRV3 1ZBE2 3NQHA 1NY71 4PLMA 5KR7A 4Z92B 5L19A 3K51A 2VOXA 4IESA 3TEZA 4E2QA 4B7EA 2PFWA 4XYXA 3OBAA 2WN2A 3KVBA 4L99A 4FAGA 4O7XA 5FRAA 4ZU4A 5CKMA 4XXPA 4FP3A 2D43A 1EV12 1R083 5ACA2 3LE0A 1VALA 4QWNA 2WFF3 1C5IA 1W6OB 3K4DA 2A5ZA 3I4IA 5FPLA 1E57A 2ARXA 4FPEA 4NRQA 3AYDA 5LWBA 4XJ9A 3DGTA 1VP6A 4INDA 3WQ7A 3ZOIA 2VZTA 4Z82A 2QDNA 5EYXA 2YY1A 4KQ7A 4PBPA 2R30A 3M3IA 2BNOA 5GLZA 5FYHA 4FPKA 3I49A 4CUBA 5T3NA 3KT4A 2A6XA 1WCUA 5JVVA 1JU3A 1CR7A 2NP0A 4QM8A 2RDRA 3D0SA 1J84A 4XJUA 4A42A 5KHHA 1PK6B 1BBT2 4CDXA 1IG3A 1VAVA 1N3OA 2XHNA 3APBA 1F5JA 4FQZA 3WW4A 3WNMA 4ZZ5A 4P9YA 5JR2A 1CWPA 3O1PA 1LHOA 1J1LA 1PO21 1JU4A 1RMU3 2P3YA 1S0GA 2C9AA 5GZFA 1REEA 3WDYA 3TRSB 2FMDA 4GKYA 4XIOA 1AR72 4RS5A 5C4WC 1O59A 3A22A 1BQPA 1UF2C 4XDPA 3VBRC 2DVFA 3T08A 4JDOA 1COV1 2WNUA 1J3QA 2QTWB 4YSFA 1VLNA 4YZ4A 1DU3D 2RE9A 1I9RA 3AJYA 4BU2A 1XE7A 2VZPA 4CCDA 1G9FA 3BKZA 2YZ4A 4CTEA 2AEZA 4HG6B 3N4MA 1W8NA 2BERA 3URFA 4ES9A 1RITA 2CAVA 2VQAA 1OLQA 1ONAA 1QXJA 4BK4A 3FC0A 2ZZQA 4M3CF 1UMHA 3JCIA 3POIA 4XE9A 4OVEA 5GALA 5JOYA 1YJKA 2FQPA 1LTEA 3MDPA 5BV6A 5CFDA 1HLCA 2BPA2 1C3HA 3KB5A 1UY3A 4O9EA 4BZ4A 4FFIA 3JQXA 1WCSA 3OBRA 5A7WB 4RD7A 1JYVA 3DECA 3MPBA 2OVUA 1FNZA 2BW8A 5BY5A 2DBNA 3KV9A 3WINE 2VOVA 3PUHA 5F2WA 4YYOA 3DCQA 1G9AA 3RVHA 4JGZC 4TYSA 1XU1A 1RYYA 4FFFA 4E4DX 2KD7A 1I5ZA 3D0JA 2OPWA 2QQUA 1U0AA 2XGXA 4IEVA 2ET7A 5HCHA 2NN8A 5CU1A 5DG2A 2RS31 1QF3A 1RUE1 5FYSA 4TTGA 4JKLA 4DEQA 3GF6A 2IXKA 3VBOC 3IWZA 2J1TA 3CHXA 2WL1A 1NQJA 1NCQA 3BU7A 3MW3A 2BUKA 1NQDA 2NLRA 3KT1A 2DYCA 1PMJX 1STMA 4HK9A 5KXCA 4LBJA 3WF1A 1MS0A 2BVVA 2G1MA 2VZOA 2P37A 4QGLA 3U14A 3G7DA 1JYWA 3SQOA 3VKMA 4LHKA 2Y6FA 1XYPA 2B5HA 4CUGA 5I0UA 1H8TC 2YC2A 4NIAA 1NZCA 1CAWA 4FPLA 4CCMA 5JXJA 3WQBA 5ABJA 2IXHA 5E89A 2VVEA 4QX3A 1YI9A 1HJGA 1O5UA 1BK1A 4I09A 4NHXA 2FBEA 4AGVA 5BNOA 2WUHA 2D93A 4LO7A 2C4XA 2VCCA 2PHXA 3ZYRA 3RQ0A 2RG4A 3CJIB 3WY6A 4YG6A 2W08A 4XF0A 4AGGA 1ZRFA 2IXJA 3FHIB 3NV1A 4FT8A 3VD9A 3F2ZA 1RUC1 3AFGA 3ELNA 1O4ZA 2OKXA 3SEEA 1C1LA 1O6UA 1QJU1 2FCVA 3WEZA 2R072 3U11A 5IK4A 3HR9A 2UU8A 2EIEA 2J7MA 1H2NA 3KZ4C 1YYNA 5A32B 4Y1YA 4MOAA 2CDOA 5JSPA 2EIDA 2G9GA 3KQRA 3RDIA 3VL9A 1V6LA 4NPRA 1IKQA 3WUCA 4Z8BA 5A1FA 4Y3OA 1SFPA 2DCZA 3T3YA 3ZYPA 5HCFA 3A7QA 4XDOA 5KXEA 2RS33 4Y1XA 1H2MA 2WS91 5C3RA 2PAEA 1UIKA 2Y6GA 3INAA 3VGIA 4FAHA 2DV9A 5HPOA 2JE8A 2OW4A 1G7YA 2QQWA 5JI7A 4META 4Q8LA 4P9XA 5FZKA 3OB8A 1YFYA 4HLTA 1RUI2 3T2TA 5FREA 1IPJA 4E27A 2WZPP 5CADA 4L8QA 1HKDA 1PIV2 1RUNA 3ILFA 2WNVB 2AC1A 4F83A 3WCRA 3A23A 1ENXA 4CDQC 3ORJA 1VBA1 4XEZA 5C3OA 4BQYA 3RJRA 1HXS1 1Q8VA 3BYWA 4RHV3 4E4SA 3LOBA 2Y8KA 1IOAA 3O1SA 3AZXA 2WT0A 4ONUA 5D8AB 3O1UA 4UW4A 3CEWA 3LWCA 2ZHNA 5FP9A 3K46A 1RIRA 2PHFA 4YFWA 4AAXA 1QY4A 1Z78A 3RSJA 1Q43A 1PZ9A 3ACLA 3H8UA 2P2KA 4MSVA 4YGDA 4PDWC 1OQDA 1QJU3 1X8EA 2ZX0A 5EJZB 3V64A 1DZTA 1UPSA 1FV3A 4R9BA 4WVVA 2QCSB 4FOQA 3TNQA 1W9TA 4LR4A 2SBAA 1PM7A 5A7NA 1VJ2A 4DPNA 5AC92 1SCRA 4N8MA 1I1EA 5LRSA 3HNYM 4PT6A 1IZ3A 1EY2A 3JB8A 1YIPA 3BPZA 3BUCA 3RZLA 2FDGA 3WG1A 3K2OA 2XLAA 2YFUA 4YM0A 2ZGOA 1UY4A 4CEYC 3QBQA 1BEV1 3WG2A 5BNPA 4IL7A 1VBB1 2HWD1 1V6NA 3MLJA 3DXTA 3EB7A 3MFCA 4R52A 3ZXLA 5I8YA 1PO12 4R9AA 5JPNB 3ZVXA 1ST8A 4AZZA 4XF9A 2O8OA 1VB2A 3CL1A 2WQZC 1ND2A 3OPWA 3OPZA 4RL7A 1S2KA 2VZ3A 4XF4A 3VZNA 5FZ3A 1BCXA 1AHSA 1AL23 1Q8SA 3VBHB 1OLRA 1KGYA 4QQOA 5DAPA 1RUH1 4S2GA 1QGLA 1MS9A 2ZPXA 3OUJA 2JG9A 4COVA 5JZGB 3Q8AA 4DXZA 3UESA 2EA7A 5JAXA 2WQ8A 1UIJA 1D0HA 2VW2A 3AL6A 4PHZA 4XUOA 4IV1A 4WVZA 2AENA 2WWJA 2P4EA 1ULCA 4YVWB 2VQUA 1W8UA 3UL2A 2VNRA 2JG8A 1ASJ2 4B1MA 3M2MA 5CFCC 1OHFA 1DYKA 3BN6A 2GH8A 2IXCA 3M3EA 3VZLA 1R092 1Y4WA 3FUOA 4IERA 4NWWA 1RVF1 2VNVA 1B35C 2R1BA 4KMQA 5FMOS 2KXLA 2JIGA 1BVVA 2WDBA 2X5IC 3C7FA 3MZHA 3PUSA 1UXZA 2QQVA 2PQSA 4QXKA 2Z69A 5DUWA 1B09A 1V00A 4GXLA 4QPGB 5EHDA 3RFRA 3B94A 4LNVA 1WMFA 3L2HA 4H7MA 2W91A 5L7OB 1W28A 1GOGA 1KFUL 1WBFA 1ZBA1 1UOGA 3AB0A 2ZMLA 3I2GA 2CGPA 3BALA 2HWD3 1MQTC 4Z2AA 1F4HA 3IT8A 3OUIA 2IFRA 3JUUA 5T52A 3MV11 4FFHA 1OI6A 1Q8QA 2GMMA 1H9PA 2H0BA 2RS12 1P8JA 5DZFA 2CU5A 2UWAA 4N53A 3FE5A 5EPAA 3ZXKA 1SFYA 4AAPA 2GC2A 2GMPA 2WINB 3NJZA 4MHUA 4ZU7A 2FDIA 2W3JA 2YUEA 4B4QA 4RGGA 1UZ0A 3LIHA 2ZMKA 4WM8A 1RUH3 1UU5A 4Y1UA 4LKFA 4LO4B 5DDJ2 2GC0A 4IEYA 2Q1FA 3T4HB 3ZSKA 2P5BA 3N9LA 2Y0IA 5FAXA 2W0XA 2UURA 2Z2SB 1PX3A 1OA4A 2DTYA 3ZM8A 1YQCA 4JHTA 1UD1A 2J1SA 1VRH2 2CV6A 4UF0B 4F8AA 3LGRA 4QDSA 2XQRA 1JZ2A 3OTFA 4RR3A 4CP9B 1DYPA 3H8RA 5A6YA 5CA6A 3CO2A 3S5AA 3VKFC 2WZR3 3DKQA 3OD0A 2V5YA 4K7JA 4X6QB 3POJA 4CCOA 1RVF3 3NAPA 2RDQA 2AREA 4IGQA 2A6ZA 2R32A 3NV3A 4QB1A 5E16A 4RN5A 3VD3A 2VZQA 3I3BA 5GZGA 3U37A 1NAEA 4RQPB 4CUCA 2ZGSA 3K4ZA 3MICA 3MIDA 2HBUA 4CDXC 2RR11 5JXIA 4Q4W3 1K5MC 3VBFB 1AYN3 3AMHA 2R041 3CIHA 2HWE1 2A73B 1CIWA 1ZBA3 2HWC1 2QBXA 1ULOA 4IEOA 3RRDA 4CXXA 1UKRA 3Q8EA 3WF4A 4EWEA 3RI8A 2ARBA 2R073 4BA6A 3H7JA 3WV6A 4CE8A 3T4VA 1W0PA 2XLGA 4LBLA 1G6NA 2ZX4A 1WWYA 1VBC2 3DUIA 5GLVA 5BNNC 5FLHA 2XXZA 3KCCA 3LF7A 3FZ3A 4IDZA 4MV2A 1KJLA 3UNPA 5E1RA 4UYBA 3MIFA 5CAZA 4XXAA 4IV3B 2P3KA 5D21A 4A7ZA 3WSOA 2K46A 4M3CE 4NIGA 4IXLA 4FPCA 4A44A 3J4UH 3Q8BA 5DAXA 3OGSA 1CD3G 1QDCA 4PF5A 5FYYA 5BPXA 5T55A 5A3WA 4Q0PA 1JOJA 3IPVA 3CZJA 5I0TA 5A7SA 2ZHKA 1RTVA 2JKBA 1OA2A 2Y6JA 3AZWA 4YZ5A 4HXCA 5JR7B 3FUQA 3O12A 5C4WA 1OF3A 4XHBA 4YVSC 3RNSA 3VBRA 4UBHA 2Q30A 1N1TA 3MPPG 2XKPA 4Q2FA 1PIV3 4NHLA 2E53A 2QQKA 4LEJA 3P1IA 1CZVA 5D2AA 2HYXA 1W06A 1MPXA 5IATA 1CAUB 1GWKA 1W8HA 3ZFFB 3N7KA 1J1TA 4B1LA 4BDVB 3AK0A 4D0QA 4F3JA 2OT7A 1KS5A 1TZOA 2ZGNA 2QDRA 3WDWA 4QPIC 3WQ1A 1FX5A 2UY9A 2E32A 3S7EA 3IBMA 4EN8B 2YU1A 1HRI1 2W1WA 3OBZA 3BU0A 5IK7A 2VQ0A 1JHJA 3FBMA 3CQOA 1KDMA 2HWE3 3E6BA 1RUOA 2XONA 2HWC3 3AYCA 1Q8OA 3HQXA 3QH6A 5LBEA 4D6QA 4EYUA 5LATA 4JX0A 1GFF2 2LALA 4YW5A 3VLBB 5C8CC 1PM4A 3ZFGB 4D6SA 5IK5A 4HVQA 3RZZA 2ZJCA 5FY1A 5DXDA 4M3CB 3KHCA 2WBKA 1JUHA 4P00B 1TQ5A 1ENQA 5AC93 1WCQA 4FVVA 2ES3A 1K45A 1QH7A 2XL9A 1S1AA 2MEV1 1EPWA 5HCAA 2RS51 4E9KA 3R4DB 1OPMA 1W6PB 3VD4A 2BBAA 3M8LA 1UW8A 3VBOA 2VVDA 1R082 4AI8A 3MIHA 3AX4A 3MUY1 3LPGA 2VUDA 4PCRA 2YPDA 2PHRA 2NZ9A 4OUEA 1X9TA 2VECA 2WWUA 2ILMA 1T6GC 1PO13 3IDEA 4CEWB 1UQXA 3B9CA 5C7GA 5C5TA 4BXFA 2DU1A 3O7OA 5GZCA 2WJSA 4QU2A 5C9AC 2F17A 2IVJA 3N9MA 3RMXA 4AE2A 4LIVA 1UY1A 3P3PA 2XJQA 2XR4A 4Y1ZA 5FKCA 1SDWA 5GM0A 2IWGB 2HWF1 1H8TA 2B39A 1C8M1 2DU0A 5IJRA 1YXWA 2I2SA 1W0OA 1CAXA 1Y7BA 1UOBA 2XBO1 3O14A 1BYHA 1H6YA 2XWJB 1UMZA 4Y4YA 4FTBA 2WYFA 1LJ7A 5J96B 2C9KA 4ZZ8A 2Y64A 2VTXJ 3T0AA 1LULA 4UOJA 2V4AA 1ASJ3 2AYHA 4AI3A 5FZHA 2QFEA 4LOTA 1ZRDA 1ULFA 2ZGRA 1XPWA 3I54A 1R093 2ARCA 2JDNA 1JZ5A 1KD7A 2ETEA 5CBLA 1CIYA 2PN5A 3USUA 3OBTA 3NNMA 3IZOA 1X9PA 5BNQA 2KR2A 1NA1B 5EIYB 3NV4A 1GP4A 1DGWX 1N3QA 2E63A 2HLEA 3I97A 3M1HA 3N35A 2VNOA 4Q1RA 2VW1A 3JD71 3ZYHA 1G86A 1EAH1 3U10A 2HEWF 4OI4A 3V56A 5LEJA 5A33B 4A6SA 1MS4A 4QQ2A 4AEKA 3KLSA 1NCRB 1BZWA 4AVBA 1PK6C 1WA6X 4B8EA 2RS13 2YHJA 1ENRA 3W58A 5A7OA 3I2HA 1GR3A 1RUF1 3I2KA 3NSTA 4MHRA 4LO6B 1ZM1A 5DABA 1ZA4A 1DZRA 4IE6A 3MF9A 4MGYE 5FZMA 3WNNA 2HWF3 2X53S 4CDQA 1ZZBA 2GNMA 4PLNA 3LDRA 5FY0A 4CUAA 3NWKA 3OGRA 5CB7A 2WO3A 1AR61 1H6XA 5FZFA 4ZY9A 4DQAA 1W9FA 1V6IA 3UV9A 2F4PA 1OF4A 3PVOA 5JSRA 3RZMA 1FMD1 1LHNA 3MW4A 4DUVA 1CN1A 1DGLA 1W9YA 4RA0A 2XJSA 1PMHX 1G8WA 2V09A 5DMYA 2QUOA 4UFKA 1F9KA 2FDJA 1U5XA 3BTAA 4J1XA 5DUUA 3GDBA 5FYBA 1EP0A 4XF1A 3ZYFA 4PDWA 2XL7A 1MVQA 3ILRA 1COV2 4COUA 3NW4A 4FOYA 1Y3TA 2QQJA 2I07B 4XQ4A 3ZX7A 4LLOA 1RXGA 2ZAAA 2GN3A 3K75B 1I6XA 4RS5B 4MO3M 1GWLA 4BB3A 5FZDA 3RZJA 3GXUA 4M4PA 2UYBA 3E6CC 1R1ZA 1CGPA 1RJ8A 3H7YA 4I02A 5EV7A 5DQ0A 1HV0A 3JD73 1W6MB 1SLIA 2DUOA 4CEYA 3H9AA 4ITCA 2XJRA 3UKVA 2YU2A 2VXRA 4DNYA 5K0UC 1KITA 2W87A 2PAKA 5FWEA 2B4KA 3SEPA 4J25A 4EWDA 4W6WA 4D69A 3ROUA 1OD5A 3VBSB 4AOCA 5FXXA 1GOFA 1W2OA 4LTAA 3R0RA 3J7NA 4I0WB 4IE4A 3WOGA 4A6OA 3I59A 5JXGA 1E5SA 2KA3A 2YC0A 5FLJA 2NMOA 2DURA 1O3RA 3I8TA 5CFDB 1NG0A 3E97A 1RUF3 1N3PA 2XH6A 1RUG3 2H6CA 1D2SA 2D5HA 3RWKX 4Y1VA 5FZOB 1BMV1 4GMP0 5AVPA 2XKOA 3AKTA 2ADEA 2R16A 4PLOA 4PIZA 4MX3A 3LFMA 3ZYIB 3C3VA 1AR63 1DZQA 2Q8DA 3WW1A 4ARXA 4DZGA 2RS32 2O8QA 4WVWA 5IVJA 5B4XA 1FMD3 3ZXJA 3JU9A 2PHLA 3OYWA 4LO5B 1WMXA 3LQCA 4Q0VA 2I74A 2D6MA 2W52A 4W8JA 1QQP3 5IAVA 4ORFA 5CFCA 2FHRA 3HEIA 1CAVA 1DHKB 2PHTA 3KHBA 3QOPA 2NYYA 1W2AX 3CF6E 4KBBA 5FKBA 5A3UA 5A3TA 2AUYA 3S57A 4MG2A 1OH3A 3B9IA 1GQPA 3IMMA 4AEDA 4FQ4A 4N53C 1B35A 1YFXA 5T54A 1NCQB 2XJTA 3VDDB 2X5IA 2WIIB 1OOPA 1X7NA 2WO7A 3LA3A 4DY5A 4LBQA 1S55A 2GP3A 3BOWA 4TZDA 4COYA 3T2OA 2EXHA 3B7MA 3GJBA 1F5FA 3A4UA 3WNKA 4EN7B 4XCBA 1URXA 2WWSA 3G6JB 3ACFA 3UK9A 4QAWA 2ORZA 5KHGA 2XJUA 2PMWB 2XVGA 1YFWA 2ZGQA 3HD8B 4CDUC 3ZXFA 5LY2A 2JDZA 1MQTA 1D7PM 4WBBA 4YGBA 4GKXA 1S0EA 1LGNA 3D82A 2ARAA 5FLIA 4QX8A 2VOWA 1NXD1 4YM1A 1LCLA 2BQPA 5FY8A 5LBFA 1PGL1 4AQSA 2DVBA 1XNCA 3SLIA 4A2UA 3KD4A 1CVNA 1S4CA 1ZRIA 5B4NA 1QJU2 1W99A 2ZTNA 4HKOA 2HYKA 2Y34A 4LPLA 3ITQA 2ZX1A 1ZX5A 3NRUA
chains in the Genus database with same CATH topology
1PMIA 2E6VA 3DL3A 1Z7S1 3MIBA 4C0HA 2BNMA 4D7YA 3ZYGA 4B29A 5KC5A 1LESA 3SH4A 1GZCA 4H7LA 4CRQA 2DF7A 1XXNA 2WS92 2XHKA 4GULA 2TUNA 4KNCA 4Q26A 4LUKA 5T5LA 3L9JT 1ALYA 4GA9A 3GBWA 4P9LA 4Q0SA 4JVAA 4FXKB 5CG8A 1POV1 2Y38A 1A8MA 4I0BA 2ZCWA 4GIQA 1NE4A 4CDWC 1AL22 1QU0A 1UPIA 2YXSA 4PJYA 3USSA 4FPGA 4TLFA 1VBA2 1HXS2 1K5MA 3E5UA 1PVXA 1O3QA 5FOBB 4DINB 1WMDA 1IKPA 1BKZA 3DPRB 4H3WA 2YROA 4OI2A 2D6NA 4Y20A 1GQHA 4XZPA 3B69A 3RYRA 3FFQA 3ZSLA 2ENRA 1TEIA 3FMGA 4BCUA 3NVCA 3V65A 4MUVA 3WR0A 2B8MA 4HVRA 1O91A 5BNNA 4MXWA 4N9HA 5AVAA 1IHMA 1ULGA 3VKOA 3HT1A 4SLIA 1C4RA 3ZMNA 2VUJA 2D6PA 4KL1A 3LA7A 1AX2A 3VBHC 5I0RA 3WZ1A 2GN7A 2BNNA 3ZXDA 1CX4A 1VBB2 1TNFA 2HWD2 2YV8A 3WCSA 5JZGC 2B9UA 4YVSA 5LEKA 1X33A 5A3MA 1QOSA 2TNFA 4MZUA 1POV3 5BNPB 2WA4A 5B2GB 1IGOA 1V6JA 2XLFA 2WT1A 4QPIA 1NLRA 1RUH2 1BVP1 4AFMA 3AJZA 3J8F1 5F9TA 1WMEA 1G9DA 5H9PA 4FOVA 5L73A 4MGIE 3ZSMA 4P9GA 1AYM1 1MEC1 3KSCA 4XFHA 2WQ4A 4BLJA 1PO23 4LHLA 3HT2A 4BWOA 4L2NA 1LOFC 2R6QA 5SV5A 5C8CA 3R6SA 2NQYA 2JX9A 5HCBA 4J6GA 1COV3 2WZR2 4IV1B 5L7OC 4BMBA 4NOTA 2HWB1 4L92A 4JGYB 1RVF2 1H0BA 2Q1MA 3MEPA 4PBOA 5EZWA 3AXEA 4AI1A 5KC6A 1FNYA 5EWSA 1Q3EA 4X8PA 5C8WA 1VBD1 2B42B 3AMPA 4D3WA 4Q4W2 1GICA 4M0NA 1AYN2 3LZZA 4BHPA 1ZBA2 1U5IA 3KCYA 4FPJA 5C9AA 1UL9A 1V6KA 1APNA 1SACA 4AGRA 4C90A 4ES8A 3AKQA 4LE4A 4N43C 3ZN6A 1J3RA 3TN91 1Y43B 2A3WA 1AR91 3J8F3 1RUE3 5FQ0B 3HAGA 4XJWA 1MEC3 4J1WA 4FP2A 4WM8B 3ZIWA 2DUQA 1ZBE1 4KU7A 2AZ5A 1V70A 5FMOL 3VN4A 4SBVA 2D6LX 4LUMA 1W6OA 1QHDA 2H0VA 2UWBA 4QPYA 4FTSA 1IS3A 1YCIA 4LO8A 1H2LA 5J48A 3PHMA 2D98A 4AVTA 4XTPA 4OI1A 5T5OA 2K2SA 1VBD3 2CAUA 2HKXA 4OI0A 2D97A 3KMHA 1AX0A 4WM7B 3JB4C 5J7MA 1LENA 2RR12 4IEPA 1ZRCA 3AP4A 1MACA 1PVC1 3U4XA 3WNXA 2HWE2 5C6CA 2HWC2 1PK6A 5J98B 4LE3A 3VHPA 2BGCA 4DOUA 4ATEA 1RUC3 3AFKA 5HXVA 1J58A 4XFAA 4LHNA 5K8SA 3B3QE 4KG0A 2YDEA 3TN93 3A0KA 2PTMA 3FJSA 3LA2A 2YGLA 4HZFA 1UZYA 4KWKA 3ZXEA 1M06G 3A0NA 4MGKE 1AR93 1O4TA 1H2KA 3MLLA 2RM21 2WS93 3LB9A 1QOTA 1MS8A 2DVGA 3TWIA 4G9SB 1JUIA 3PVEA 1YLLA 2VMHA 1WW5A 5K7PA 3M7AA 5JI9A 4DRRA 4URTA 2C1FA 5JSOA 2ZABA 5F6KA 1IS4A 1SCSA 5KHJA 5C4WB 2R49A 2R0FA 3VBRB 3EBRA 1VBA3 4XIKA 3O5SA 1HXS3 2OZJA 1GSLA 1D0GA 1W6QA 5K0UA 4MLOA 4QHBA 3OJBA 1LOGA 1YWKA 2ZGPA 1YNAA 3BIWE 1JYIA 2CY6A 1WA4A 2QZ3A 4JRAA 2IZWA 2WC2A 3M70A 3SCFA 4KGQA 5J3UA 5GZEA 1YUDA 2ZMNA 4EN9B 4AEDC 4G3YC 3M3QA 2AGSA 1FAYA 4AF9A 2EAKA 3AKPA 1OOPC 3B02A 4K9SA 2IXLA 4B3NA 3H3UA 4FPOB 3S0MA 3MIGA 5IT6A 1EPZA 1QXRA 4XMAA 4I0AA 1PGW1 3V0BA 4JGZB 2JJ6A 3FLRA 4XBLA 4FCAA 3U07A 2GMEA 3E5XA 2RM23 3EQEA 1BEV3 2UYAA 3QACA 2ZOEB 4A7KA 1UZZA 1VBB3 5JOZA 3MF6A 2W39A 4M0HA 1AXYA 5FPZA 1DQ1A 1RINA 1JTZX 1UN1A 4BOWA 4IEXA 3VBOB 2X29A 2PLV1 4WVMA 1MZ5A 2RJLA 3ZPYA 2WT2A 4H14A 3FLTA 4B4PA 4WZFA 3H50A 2HWF2 4LA2A 1C8M2 1GZWA 2XBO2 4XBQA 4ASLA 4FPHA 5A32A 3VV1A 5FDBA 2YMZA 4CDUA 1X8MA 3LOIA 4OUSA 1QMJA 5T50A 2VMIA 3IKWA 3PTYA 1ZZ8A 2K9ZA 4DMIA 2QZ2A 4DS0A 3AZVA 4R9CA 2EXKA 4AXOA 4HPKB 1ULDA 1DQ5A 4YFZA 3TBDA 2TEPA 1GKBA 4OHVA 2ZGMA 1NCRC 2D6KA 1S0DA 3VBUB 2E9QA 4O9GA 3WXPA 3LSDA 1OPOA 2ZZJA 3S30A 3WW2A 1ZREA 4MVTA 3B5LB 3AP7A 4QQHA 3ZFEC 5CG9A 3TYJA 3GYDA 3JD72 4AQ6A 3ENRA 4N90A 1IS5A 4YZ3A 4Q4X1 3WG4A 2BBVA 3OY8B 1NE6A 5FO7B 3QD6A 1XYOA 1GYKA 4ZKTB 1M4WA 2ZX3A 1OA3A 1HV1A 1F2NA 2A75A 1MZEA 2PLV3 4CDWA 4LT5A 1FATA 1RUF2 1RUG2 1TME1 3QH7A 4I3PA 2HJIA 2Z5WA 3H1WA 4YGCA 4XQWA 3RJ2X 1YIFA 2D44A 1JXNA 4QQPA 1AR62 2OYZA 3VUOA 1FOD1 1DGRA 2VOKA 1FMD2 3SXWA 1RUJ1 3RWNA 2NPIA 4XFFA 2E7QA 2PHDA 1QQP2 4N7IA 3B00A 5JIAA 1WCKA 4QM9A 1ZZ9A 3WDTA 4CP2A 1ND3C 2EXJA 4P9IA 3VBSC 1YHFA 1D4M1 1LOCA 4YW2A 4UW6A 2GH2A 1MS3A 1DQ6A 4E2GA 5BYNA 2PHUA 3JBG1 1PNGA 2RR13 4AI0A 3VBHA 1XE8A 4QMAA 1QDOA 2QNKA 2R043 5JZGA 4Q8KA 3BB6A 2PHWA 1LOAA 2Q5TA 1HQWA 1AX1A 2A7AA 1W2UA 2BTVC 1SBFA 4Q0UA 4YW3A 2B45X 3IM0A 5KBFA 1BMV2 2CGOA 1N1VA 1EYBA 3J26N 3VDDC 1VAMA 1QJZA 1FOD3 2A6VA 2B46X 3W9AA 3RS6A 3TNPB 4AEMA 3ZN4A 1RUJ3 4Y5Z0 1D2QA 1LOFA 4FO9A 2WLQA 4QPGA 4YM2A 1TE1B 4JDMA 3ZSEA 1SFNA 1BJQA 5L7OA 5I0SA 4UW3A 2P3JA 3VHOA 1QJY1 5GKAC 3PLQA 4YARA 4KGGA 3SITA 3OF1A 1ZZCA 3V0AA 1CONA 1SMVA 4AWDA 5JCTA 2V73A 3JBG3 1B35B 3KM5A 2D3PA 4JV4A 4LLFA 2DCJA 2X5IB 1H1IA 2P17A 1HRI3 5JLVA 4AEJA 4LBQB 1MZFA 3VKNA 2SLIA 1WLDA 4GH4B 4XPVA 3UKTA 1ZVFA 1V9U1 1PGL2 1NLSA 4N43A 3B93A 1AZDA 4XJ8A 2JXAA 1NY72 3ZDSA 5HI0A 5EFUA 2MEV3 2RS53 3ASIA 4Z07A 5H9QA 1Z7S2 1LHVA 5TSWA 3IDBB 2K0GA 1D4VB 5EYYA 2D3RA 1WLTA 4YGEA 4RQPA 1A8DA 3SH3A 1RHI1 4P9WA 3WT3A 3AM2A 4IEQA 2D7FA 1A3KA 3VBFA 1RL3A 3VZKA 3GZUC 1IQAA 4HBNA 4FTEA 3KGZA 3DPRC 3M3CA 1CESA 1FYUA 1JN2P 1F31A 1QJY3 2LTNA 5I91A 4W6YA 1GLHA 2VUAA 2VU9A 5JPMB 1C8M3 3WQ0A 2XBO3 1DGRN 2HEYF 4XDQA 2ZGUA 3SCHA 3TAYA 2KM2A 1A78A 1MS5A 2CGNA 5LK7B 1S0FA 2GNDA 4D94A 5JMCA 1DQ4A 1PO22 2UWCA 4CDXB 2DCTA 3PMEA 1GV9A 1S0BA 5F1RA 5F6LB 4NHKA 5JOWA 4Y20B 4OHWA 3CU7A 2QKDA 4HN1A 2EF6A 2WNUB 4S2DA 4Q4V1 4C1WA 1DFQA 4JCKA 4QD2A 1EAH3 3ZFFA 2VPVA 1QJX1 2IC1A 3CLPA 4MXWB 5T5JA 3ZXGA 3VKLA 3GNEA 1DDLA 2ZGKA 2TBVA 4DRVA 4GWNA 5FBZA 3RI9A 4IETA 2GNTA 2VW0A 3H1MA 4Q29A 1F8VA 4AQTA 1OFNA 1RUD1 4R4ZA 1WLWA 4FOWA 3UKNA 4FSJA 2EAAA 1YI7A 3J8F2 1RUE2 3E5QA 1CJPA 4JGYC 2XPJA 1GQGA 1AYM2 1DGWA 1MEC2 2RMU1 3D4KA 4I3GA 4QPIB 2D40A 3OGGA 1W6PA 5SV8A 3ETQA 4BE3A 1HRV1 4W6XA 1ZYBA 3CJIC 2XUMA 1SLAA 3O0WA 5FO9B 1GANA 1LKNA 4CEWA 2HWB2 1R081 5C8CB 3TOJA 3AZZA 4AFDA 4OULA 2WFF1 3OD4A 5JOXA 1VBD2 4Q0QA 1YJLA 4Q4V3 4L97A 2FZ2A 4HANA 1HIXA 3CNAA 3R05A 3ZIXA 5GLUA 3S6PA 4Y22A 1QJX3 3KS7A 1AR81 1CAWB 2NM1A 3M3OA 1X50A 3RMYA 5ABJB 2GSYA 2GU9A 4AHZA 5DUXA 3NKGA 5BNOB 4CYDA 4OFGA 1VBE1 1RUC2 2GC1A 3ATGA 1XNDA 1PZ7A 4QGNA 3GBFA 2N7GA 1MVEA 2YGMA 4EN6B 3AKSA 1IPKA 1Z0HA 5LRRA 3T1MA 3TN92 3WLUA 5C9AB 4R9DA 4A3XA 2XVKA 1TMF1 1ZNPA 4BIFA 1RMU1 2WNVC 2A6YA 3WVJA 4QT6A 4Y26A 3WDUA 1AR92 1W6NA 3ZN6B 1ZRRA 4B4RA 4W65A 2CWSA 4BYYA 3N7LA 4LA3A 2RMU3 4GMP1 4YLZA 2ATFA 2JECA 4AW7A 3O0VA 4WM7C 3B01A 5A33A 1UU6A 3PNAA 5D8AC 3LKJA 1FPN1 1U5ZA 5KHKA 2NMNA 3FLPA 1H30A 1NCRA 4NVPA 4K40A 1XNKA 2AH2A 4KG8A 1UKGA 1KRIA 1H9WA 3ZFEA 2E51A 3IN9A 3IMNA 2GDFA 2BFUS 1JBCA 4IEWA 2BVBA 4X6RB 4GB31 1AR83 1XQNA 1PVC2 4IQPA 4LBNA 1RGSA 2OUHA 2CL2A 1PZ8A 1VBE3 1V6MA 2MNGA 4S2HA 1WW7A 4K1ZA 1YRZA 2WNEA 4KWJA 1KFXL 1KQRA 3LCPA 3VHRA 1DLLA 4YZ2A 4IEZA 4QQLA 1Z7S3 1ZZ6A 4XFCA 1TMF3 3GHMA 4P14A 4X8NA 4HT1T 2LM3A 1R1A1 4R8HA 2BYVE 2RM22 4AFCA 1BEV2 1OSGA 2IXIA 1HX6A 2ZBJA 2XB6C 4GMP3 2W68A 3I2DA 3WHUA 1O7FA 2CNAA 2ZACA 5JWPA 3PJYA 1W6MA 1WD3A 3N3HA 4NN0A 1ND3A 3GALA 1FPN3 4YVWC 1N1SA 3VBSA 5C33A 3SH5A 5HBAA 2WKKA 2R061 1O4YA 4LBQD 3RYPA 3SCGA 1ND2B 1DQ2A 3MW2A 1WLCA 3DF0A 4M01A 3HBZA 1S2BA 2D5FA 3P3NA 4GB33 5DG1A 2JG9B 2UY8A 4QPGC 3ZYJB 5H9SA 3ZSJA 1XYNA 1W6QB 2B7YA 5K0UB 1CJDA 3RPQA 2GZWA 4N7UA 4JQRA 2CTVA 2JE9A 2JG8B 5BXXA 1NXMA 4C91A 4D7TA 3MFAA 1CPMA 5F5QA 1PGSA 2ZKLA 1PGW2 3VDDA 1LU2A 2E7AA 1R1A3 1LOEA 3SHRA 1N47A 2ZGLA 1UX6A 5D1IA 3V0BB 3UJOA 2C0ZA 2IFWA 2EVXA 3WUDA 4XFGA 2PLV2 4ZXKA 5I8SA 4Q4Y1 4E2SA 4XQDA 4AFBA 1WUVA 4RHV1 2HEVF 3ZO0B 2JEMA 2R063 2MHFA 1KXGA 2I45A 4N53B 4WVMB 3GHNA 1LB2A 5GLWA 4NO4A 1MS1A 3VZOA 1AYM3 3NO8A 3VBUC 3LAGA 4RQPC 3VHNA 4TSVA 1GZWB 3N36A 2XWBB 1LGCA 4RGAA 3JZVA 3VBFC 4CDUB 2P3IA 1WW6A 1FI2A 4RR3B 2HWB3 1EV11 5J09A 5ACA1 2VMGA 1S0JA 2MPFA 2PYTA 4GQ7A 5J37A 3TB0A 4YZ1A 2DFCA 3NAPB 1SEFA 4PIXA 3THTA 3NKTA 4AK3A 2A6WA 4UBGA 4MGZE 1XU2A 1HW5A 2R042 3RYKA 1LHWA 4MH0E 4Q4X2 1DBNA 4IV3C 3KT7A 1AL21 3M4FA 5KXDA 4Q1PA 2PQQA 2DVAA 1LHUA 1LOBA 1AVBA 1OQ1A 3DPRA 1LEDA 3X29B 3Q9OA 1BBT1 4Q4Y3 1TME2 4JAAA 4CZSA 4PQ9A 4L11A 1JYCA 1WBLA 4M00A 5FOJB 3MLKA 2QJVA 3DN7A 4CDWB 4V1PA 1AR71 3ZFFC 2QE3A 4XBNA 4F7ZA 4DY3A 2ZGTA 1H1MA 3WX5A 1FOD2 3D8CA 3FWEA 1SLBA 3HIFA 3T1LA 1RUJ2 1RC6A 1ULEA 2VULA 4AG4A 1ZBE3 1LU1A 4EJRA 5DZGA 4OHYA 4JTNA 2JICA 3WP6A 3PMSA 3IPVB 3HN1A 4XW3A 1ZZ7A 3H1YA 1EV13 1HQNA 5ACA3 3NV2A 3ZFGC 1D4M2 4AVCA 1VB4A 1AUYA 5JIUA 3WD5A 4COZA 1WD4A 2FZ1A 4XJAA 3SNMA 2O1QA 3BODA 3JBG2 1KJRA 1DQ0A 4XILA 4Y24A 3HMYA 1HRI2 4B7KA 1PVC3 5JDBA 2VH9A 1DF0A 5H9RA 4R4XA 4U2AA 2DVDA 2ZX2A 1PHMA 4FPFA 1H4HA 2XJPA 3WP5A 3HWJA 1BBT3 3POYA 2G4IA 4CEWC 1JHNA 2DTWA 2WSVA 2Y0OA 4YM3A 1H1AA 2MEV2 2RS52 4BMEA 3FBYA 3FFZA 4JGYA 4ES9A 1QXPA 1AR73 1SLTA 1YFUA 1QNWA 1QNYA 3AYEA 1GNZA 1WGPA 2WZR1 3DKWA 4N9IA 2JE7A 2O0OA 1QKQA 3PVNA 4JRLA 2ZHMA 3CJIA 3D5OA 2C5DA 1AJKA 3AP6A 2D6OX 3BCWA 1QJY2 4CP0A 4GH4C 3MGUA 4Q4W1 3QCWA 5K9YA 4HMZA 3AP5A 3PJQA 1AYN1 5IUQA 3GZAA 4LBOA 1GBGA 4QGMA 4HSLA 1NA1C 1LECA 1H8TB 2GAUA 4LBKA 1CAXB 3V0AB 2R071 2RHPA 3D6EA 1QWRA 3K48A 3S7IA 3DV8A 4I30A 2VNGA 3U0ZA 3AZYA 5FQ0A 2YYOA 4YW1A 4Z2WA 4C0BA 3EJKA 1V9U2 3PVBB 2BEOA 4RFT0 4XF3A 4XJZA 3WP4A 2WNVA 2A3XA 4OUMA 4YG0A 1RUI1 3USUB 4AVAA 4N43B 4XOGA 3AKRA 3AMMA 1EAH2 4FPYA 4ISQA 4MYEA 4RSUA 3VL8A 1PIV1 4AVSA 5KWRA 3ALQA 1S0IA 2DCYA 5GZDA 3KGLA 2ZHLA 4WM7A 1LGBA 1RHI2 4GALA 5D8AA 2DFBA 5DZEA 2RJKA 3SISA 1FV2A 4EWAA 5AFBA 1C57A 4JTOA 4AHWA 2VY0A 1U5YA 3RG0A 1WCDJ 1AL0G 3GZTB 1A6CA 2ZA9A 3R4UA 2ERFA 1UU4A 4YRDA 4AQ2A 4CDQB 3ME2A 4RS5C 1Q5OA 2DUPA 4P5HA 3EO6A 2WNUC 1JW6A 2OUJA 4K21A 5AC91 1HDKA 1SBEA 2ZAHA 1SBDA 1VIWB 1QOOA 2WSUA 5FFOC 1O3SA 2G9FA 2GALA 5CNAA 2PAMA 2WA3A 4NR1A 4HVOA 3H0OA 4LBMA 2GNBA 2R0HA 1SQ4A 2JD4A 3ECQA 4HSJA 4PDWB 1QH6A 3ZXAC 3AXDA 5CFDC 4DFSA 5KHIA 1PO11 4EROA 1RUI3 4Q4V2 2OPKA 4Q27A 5DUVA 4FBFA 1QJX2 3N7JA 4BQ1A 4Q4X3 4WV8A 5FO8B 4K6BA 4XFBA 5FCCA 4CEYB 2XG3A 3R4SA 1RJ7A 4YVWA 1GNHA 4CP1A 4I01A 1TME3 3I59B 2E7TA 4XETA 1RUD2 2Q0AA 2XVLA 3UJQA 3I7DA 4HFSA 1NCQC 1ASJ1 3FX3A 3W59A 1R091 1C8NA 1AXZA 4C1XA 1MZ6A 2EXIA 5FPXA 2RMU2 3AMNA 4OHZA 4L9BA 1Q8PA 4AHYA 1OQEA 4JGZA 1Y9QA 5L36A 1HRV2 1SLCA 2QQPA 3OYWB 3N7MA 3WG3A 1S0CA 5ABJC 5CFCB 1CAVB 1D4M3 4HKLA 5BNOC 5I8TA 1XNBA 2Q1ZB 1LRHA 4K20A 4AEDB 2VGDA 2WFF2 5EXOA 3ZMOA 1OOPB 2RS11 1REFA 4P9JA 4K8FA 3OGJA 1AR82 3E6DA 3THPA 5BUVA 3AMQA 3H3ZA 5FTTC 3POSA 5GLTA 4Y22B 5DDJ1 1VBE2 2LUWA 2OIIA 4ZU5A 1MQTB 1KS4A 4ISRA 5E88A 1I3HA 2BWAA 1H4GA 2EIGA 1FT9A 1VRH1 4BM8A 3C2UA 3POWA 4HPKA 3AYAA 3OCPA 2JENA 1TMF2 4AVVA 1RMU2 2FMYA 3CJXA 3EHKA 3J9SA