3H1MA

Crystal structure of mannose 6-phosphate isomerase (holo; zinc bound)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
392
Chain Sequence
b'ASMQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITTAGETVSLRDAIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERLSQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGELLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLVLKPGESAFIGADESPVNASGTGRLARVYNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-6-phosphate isomerase
publication title Crystal structure of mannose 6-phosphate isomerase fromSalmonella typhimurium bound to metal atoms and substrate: Implications for catalytic mechanism
rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 116
structure length 392
sequence length 393
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 3h1mA03
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1mA01
3BU7A 4JVAA 4KL1A 1ZZCA 3B02A 2D5FA 4I0AA 4XF1A 3ACLA 1Y3TA 2PAEA 3IDCB 2IXLA 3H1YA 2GC3A 4LEJA 3E5XA 1XE7A 4FT8A 2MHFA 5I8TA 3LAGA 4MH0E 5FCCA 1CAUA 4BH9A 2PTMA 3LZZA 4O9EA 2PFWA 2H0VA 3EJKA 3ES4A 3C3VA 5AVPA 1O3RA 1IPKA 3G7DA 4L2NA 4O9GA 2B5HA 5BXXA 1LR5A 4R52A 1JUHA 5LRSA 1ZRFA 4L11A 5JSRA 4LA3A 4IEZA 4AVAA 1H1IA 2GZWA 1UCXA 3ST7A 2XKOA 1FXZA 4AQ2A 4YRDA 2PYTA 4F8AA 3MZHA 3FJSA 3GBFA 3KCCA 5BV6A 2XL7A 5J48A 4Z82A 4XF9A 1LB2A 4BIFA 4AVBA 3LA7A 3S7IA 3H1MA 1ZRDA 5CU1A 4EV0A 2OZJA 1O3QA 1QY4A 5E16A 4KU8A 2XL9A 2E9QA 4LTAA 2GC1A 1U12A 5BPXA 3LA2A 4HVQA 1RUOA 4BYYA 1YUDA 3KGZA 2Y0OA 1RUNA 4I01A 1YFXA 2UYBA 4HSJA 2QNKA 1OI6A 2UY9A 5LRRA 1UPIA 3O14A 3H3UA 4PIZA 3BB6A 4YNIA 2QCSB 4MGKE 1DGWA 3KSCA 4OLLA 4META 5KHHA 3KGLA 3U11A 3U10A 4I3PA 3NW4A 3CLPA 2CV6A 1ZZ9A 1I5ZA 3LOIA 3OGJA 1EYBA 4I09A 1ZX5A 4YSFA 4ZU4A 1J1LA 2PAKA 1QXRA 4PIYA 2HKXA 4IEXA 4J1WA 4MGZE 4XFIA 4X6QB 2ETEA 4HN1A 3M3IA 4Z07A 2PHLA 2BYVE 4Q0SA 5T3NA 2XKPA 1YLLA 1O5UA 2I45A 2IXKA 4BHPA 4XEZA 2Z69A 2ZKLA 3CF6E 3HQXA 2VECA 4XETA 4HMZA 1VJ2A 2VPVA 2GH2A 3BPZA 4LUMA 2GAUA 1FI2A 4LULA 2V09A 5FPXA 3SCFA 1OMIA 1X7NA 2O1QA 3PNAA 5JAXA 4ORFA 3E97A 5E1RA 2ZCWA 1O3SA 4XFBA 3IWZA 1SFNA 4Q0UA 4XFHA 4AXOA 4EWAA 4E2QA 3RYRA 1OD5A 3TNQA 5EZWA 2PA7A 1CAUB 4ONUA 2GC0A 3PLQA 3OD0A 3WW3A 4GULA 5C6CA 4I02A 3DL3A 2O8QA 3OCPA 1QWRA 4FAHA 1X82A 3GYDA 1ZZ6A 4NVPA 1QXJA 5BUVA 4IEUA 1YWKA 4P9GA 1NZCA 1RTVA 4QXKA 3NKTA 4Q0VA 5KBFA 2FQPA 4OFGA 3FHIB 2XLGA 2CAVA 2XHKA 2WC2A 4JTNA 3IIAA 4WVZA 2Q1ZB 1O3TA 2QVSB 2KXLA 2Q0AA 4XFFA 3ZDSA 3IBMA 1EPZA 3H50A 3OF1A 3MPBA 1IPJA 1WA4A 4IEVA 4MGIE 4R8HA 3U0ZA 4EROA 4LA2A 5D1IA 2IXHA 4HVRA 3RNSA 1J3QA 4LUKA 4QX5A 1CAVB 4N9HA 1CAVA 3CO2A 2B9UA 1NE6A 4HLTA 4IESA 1ZRRA 3QACA 3CJXA 4KWLA 5I8YA 5JCTA 2UYAA 4XFAA 1I6XA 2H6BA 2WFPA 3E6BA 4QGMA 4FAGA 5I0RA 2MPFA 1SEFA 4KWJA 5JSPA 5I8SA 3HT1A 1CAXB 2IC1A 1CAXA 5FPZA 2K9ZA 4IEQA 4WZCA 2BNOA 5I0SA 5FLIA 1O4TA 3FZ3A 3LA3A 4IEYA 3WW1A 4QGNA 3H1WA 2ATFA 4EWEA 1ZNPA 4TLFA 3OTFA 3NJZA 4KWKA 4YYOA 1VR3A 1H1MA 4CYDA 1L3JA 3RDIA 3SCHA 1XE8A 2OA2A 3FFQA 4Q0QA 1EY2A 3D82A 3FX3A 4N9IA 1J3RA 4HSLA 3SXWA 4D7TA 1OFNA 5JSOA 1ZZBA 2BNMA 1GQGA 2XLFA 3ROUA 1DZRA 1NYWA 3CL1A 3NVCA 3HIFA 2XLAA 4LLOA 4MV2A 5J3UA 2IXCA 5KHGA 3VHRA 2C0ZA 4HZFA 4XFGA 4I0BA 2OPKA 2PHDA 1LKNA 1RGSA 1G6NA 1V70A 1NXMA 3JZVA 1Q5OA 1WLTA 2BNNA 4Q0PA 5LEKA 1Q3EA 3IDBB 2F4PA 4IEPA 1X8EA 2H6CA 2Q30A 4J1XA 4E2SA 5J7MA 3H9AA 2CAUA 1ZVFA 3USSA 3S7EA 4QM8A 4ZU7A 5FLHA 3E5UA 4AQ6A 4EWDA 1UIKA 1DZTA 5JR7B 2PQQA 3HT2A 3KMHA 1J58A 2EVXA 2HJIA 4FBFA 3BALA 4XF3A 2XGXA 2VQAA 4MX3A 3R6SA 4QM9A 1RC6A 4UXAA 1FT9A 3WW4A 5BY5A 1XRUA 5KHJA 3UKTA 4F7ZA 2D93A 2MNGA 1WGPA 5K8SA 1Y9QA 4IERA 3ES1A 2DCTA 1HW5A 5I93A 3L2HA 2D5HA 3N4MA 1CX4A 4ZU5A 2CGPA 2P17A 5KHKA 1ZRCA 3EHKA 4UBGA 5I0UA 4E2GA 3M70A 4HN0A 1YFWA 5HI0A 1J3PA 3DKWA 2ET7A 3EO6A 4MZUA 4WBBA 4XF0A 3SMHA 2PAMA 4IETA 4XF4A 5C8WA 3MYXA 4I2OA 1PM7A 2BEOA 1YFUA 1X8MA 4UBHA 3ETQA 2OZ6A 1EP0A 4JV4A 1VP6A 4XFCA 1Q43A 1PMIA 3TNPB 4KU7A 3RPQA 2B8MA 4IEOA 4IEWA 2EAAA 3BCWA 3UKNA 4YARA 3SHRA 5I91A 1CGPA 4MUVA 2Q4SA 5FLJA 4PJYA 3LWCA 5LEJA 3FE5A 3QOPA 3PVBB 1YFYA 5CVRA 2QDRA 1SQ4A 2Z2SB 4JTOA 5FQ0B 3MDPA 2OYZA 5FQ0A 2QJVA 1UW8A 3NL1A 1TQ5A 4X6RB 4D7SA 1J59A 3RYPA 3DV8A 5KHIA 1YHFA 3I59B 1DGRA 3I59A 3S0MA 2N7GA 1O7FA 4K8FA 3E5QA 3RZZA 3WW2A 1ZZ8A 2GU9A 3H8UA 5EFUA 5I0TA 3EBRA 3FWEA 2IXIA 3H7YA 1CAWB 1CAWA 2EA7A 3H3ZA 4PIXA 1GQHA 2ET1A 2GC2A 1ZZ7A 3CEWA 2D40A 4DINB 2FMYA 4H7LA 4Q29A 1UIJA 3SCGA 5F1RA 1UD1A 4HVOA 4QGLA 4A2UA 4AVCA 5FDBA 1NE4A 3D0SA 3EQEA 5CADA 3NSTA 4HBNA 2BGCA 3I7DA 4MGYE 1LRHA 2UY8A 3E6DA 4QMAA 1RL3A 1O5LA 3ELNA 3I54A 3E6CC 4RD7A 2K0GA 3UKVA 3D0JA 1ZREA 3DN7A 4B29A 3H7JA 2IXJA 3RYKA
chains in the Genus database with same CATH superfamily
2Y60A 2QZ3A 4L0PA 4YGCA 3GM8A 4JVAA 1XE0A 1ZZCA 3IDAA 1REDA 1DQ6A 4K7JA 4RHV1 3K48A 1MS0A 1WD4A 1FNZA 2JE9A 1JTZX 5JR2A 5FZ1A 3D5OA 1MACA 4QPYA 4D3WA 4I0AA 3AP9A 1S4CA 3NV1A 2WSVA 3IDCB 2IXLA 1FMD3 2GC3A 4BISA 4GKXA 2ZMNA 3HNMA 1XPWA 2HBUA 3E5XA 4XACA 4MOAA 1TVGA 2PHFA 1CONA 4XABA 2MHFA 5D2AA 1S0BA 5DUVA 4MH0E 1UU5A 5KWRA 1ST8A 2TNFA 1AXYA 3LZZA 2XQRA 4UWDA 2H0VA 1GWMA 5C8CB 2VNVA 2XJSA 5FP3A 5IK4A 5JMOA 1NLQA 2VOVA 3ZFEA 3WP4A 1IS6A 3HBKA 5FFOC 4N90A 3K77A 4FPKA 1YYNA 2X8KA 2ZBJA 3VZLA 3TB0A 4CDUB 1JHNA 1KITA 5CKQA 3Q8EA 4L2NA 5BXXA 2NQYA 4N7IA 2B4KA 2SBAA 4R9DA 4L11A 4MGSA 4XUTA 1UX7A 1B35C 3OJBA 3PL0A 3Q8FA 4AVAA 1H1IA 4DXRA 2LS6A 4QHOA 5JWPA 5A32A 4J6GA 4G3YC 1IZ3A 1KS4A 4H3WA 1LEMA 1VBC2 3TBDA 1MS5A 3UK9A 5T50A 3GBFA 3GJAA 2VAUA 3FC0A 5BV6A 1DQ2A 5FZHA 1SCRA 4I30A 1R1A2 2D3PA 1LOBA 2ID4A 4QXHA 3THPA 4BQ1A 1HXS1 2ZZQA 3LA7A 4O7XA 1MEC2 2RDQA 3LOBA 1F5FA 1NA1C 4LKFA 5BNPA 1QKQA 4GWIA 4NIAA 1JI6A 1NT0A 1VBC3 1O3QA 1QY4A 5E16A 3CJIB 2ZGKA 1WMDA 4YVWA 4QPIC 2QQVA 4LOSA 1UL9A 3MICA 1H2NA 1XB9A 2GC1A 2F4LA 5H9PA 1UY3A 4AFDA 5IVEA 4A3XA 2RJ2A 5BPXA 3M3EA 4HVQA 4MO3M 1H6XA 1MEC3 4CCMA 3RWNA 4YZ3A 1DP0A 1DLCA 1NLRA 1OD3A 3BOWA 2D3RA 3KV6A 4I01A 4BE3A 3VDDB 5LA1A 2Y6LA 2FDJA 4Y1XA 4R9BA 2UYBA 3VBHA 3T3YA 4QB6A 5C4WC 5BNQA 1YJLA 1DIWA 1W2NA 3AZWA 2UY9A 3BIEA 4AFBA 3WP5A 4C91A 4COVA 5EJ1B 4RR3C 4FQZA 3O14A 3BU0A 3BB6A 1PGW1 1DGWA 4DIQA 4LKDA 2ORXA 2YROA 4WVWA 3KSCA 4LR4A 3ZXFA 1H8VA 2PHRA 4LO7A 4OI2A 5BNOC 1SFYA 2IFRA 2RS11 1LGCA 5KHHA 4AEKA 2VBDA 2P3YA 2C5DA 4I3PA 3VLBB 1OPOA 3NO8A 3VZMA 2YBSA 5A3PA 1ULPA 4URAA 2QQWA 1REEA 4ZS2A 1NXD1 4AQSA 2VGDA 4YZ4A 2BWAA 3RZMA 1JOBA 1HV1A 1OSGA 1F35A 2PHUA 1YQCA 1FPN3 3C2UA 4LITA 2BOJA 4BLIA 5K0UB 4J1WA 4Y1YA 5ABJA 3KVAA 2P37A 4Y1VA 2BYVE 4Q0SA 4DY3A 1YIPA 1IKPA 4BZ4A 1FPN1 4GAZA 1GICA 5EPAA 1K3IA 1NAEA 2CYFA 4BHPA 1UN1A 4FFFA 1ULCA 4ATFA 2Q5TA 1SBFA 4HMZA 4LUMA 2VH9A 3VHNA 3WSOA 5FAXA 2GAUA 1ZBA2 5A3LA 2ZEZA 2VZRA 3MIFA 5B4NA 3DCQA 3J8F2 2E33A 2A73B 1C57A 1X7NA 2VW2A 3T1MA 5JAXA 4ORFA 2BGPA 1QMJA 1KJLA 4Y4RA 4E4HA 1OQDA 4FVVA 5JIUA 1NUKA 3CIHA 2R16A 3IWZA 5CKNA 3T0DA 1BCXA 3DYPA 4AXOA 4AI8A 1ZBA3 3WDXA 3ORJA 2VBBA 1U0AA 1FV2A 2XWBB 1OD5A 3FL7A 3J7NA 2QUOA 3K2OA 2PA7A 1SACA 1LHUA 2IUWA 3U75A 1XYNA 2LUWA 3WW3A 1AL22 2YGLA 5C3QA 1BHGA 1WW6A 4UW5A 5C6CA 4TZDA 3ZXJA 1JYXA 3LFMA 1ZBA1 5CFDB 3DL3A 2O8QA 4QXBA 5LA2A 3WINE 1G9AA 2VTXJ 4IL7A 5CZKA 3MFCA 1HIXA 4PBPA 3C7HA 1PZ8A 5E88A 4XCAA 5JI7A 4DEQA 3VD5A 3AMQA 4UF0A 1YWKA 3PTRB 4B7KA 3POBA 1AL23 3K3OA 3I2IA 2VCBA 4OFGA 1XNCA 2F17A 2YG0A 2JDNA 3WQ0A 1MVQA 4GA9A 3U37A 5FYZA 1ULEA 2YC4A 1OA3A 4BQ3A 1LGBA 5HXVA 4PF1A 1AL21 2OQ7A 2Z5WA 2W3JA 2VVDA 1HRV2 4ET7A 2BVBA 2P6HA 4W8JA 4E8CA 5BYNA 3BTAA 3ZDSA 1Y9GA 1EPZA 2YYOA 3ZOIA 3H50A 4LBNA 1HRI2 4MGIE 5FO7B 3SLIA 5LY2A 2D97A 4BK4A 1W6MB 1X50A 2WS92 4V1PA 4A44A 3RVHA 2RDSA 3H8OA 3RNSA 1J3QA 1PK6A 4QX7A 1CAVB 4QHZA 2B9UA 1NE6A 3AMNA 4HLTA 4AFAA 4Y1ZA 4ATEA 2ZX2A 1AR62 4PI2A 1V6JA 4CP1A 1JZ5A 5JXGA 3WNXA 1US3A 4E4ZA 1AXZA 3AVSA 4LOTA 4Y22A 4AHXA 2CWMA 4CCNA 4Z2AA 1B09A 1HRI3 4XUOA 3MI8A 2WS93 1URXA 4H55A 1GZ9A 4NPLA 4URTA 4B8EA 3TOJA 5FY9A 4CDXC 4NHLA 3E6BA 1RHI2 2HWD2 5KXDA 2WJSA 1SEFA 3K4AA 4KWJA 1G9BA 2XMLA 5I8SA 4UFKA 3WEZA 2K9ZA 2O14A 3GZTB 1W9TA 1VAVA 5D21A 2VZVA 3JQXA 3PMEA 3O0WA 4Q1RA 5FWEA 3LA3A 4C0HA 2WO1A 1OKOA 4JKLA 4CUCA 1F9KA 1N47A 3AC0A 4WVMA 2CGNA 2VY0A 1GLHA 1QOSA 3VKMA 3OTFA 2HWD3 1BMV2 4CTEA 1VR3A 5L7OA 4XE9A 4Y20A 4N53C 1KS5A 3RDIA 2ZGTA 1FX5A 2BW8A 3FFQA 3AXEA 1R64A 5FPVA 4MYEA 4BQYA 4CUBA 3SITA 4N9IA 5DABA 2WQZC 1ULFA 4YPJA 3C7FA 2HWD1 3FMGA 1ZZBA 2BNMA 5DN2A 2WNVC 1GQGA 1Q8VA 1S0CA 3O7OA 2RS32 4B4QA 4BLJA 4QQ2A 3VBFC 3O0XA 4TN7A 2AENA 1XXNA 1LOAA 2XLAA 2P1BA 3I2HA 3SEPA 3M1HA 1OVSA 3M2MA 1VAMA 2BWCA 1Y9MA 1S0GA 1ZA4A 5KHGA 2AR6A 1W04A 3KV9A 2OPKA 1MVEA 2W91A 3JD73 1AL0G 4LBJA 3BIWE 3RMYA 2R042 1LKNA 1BMV1 4ITCA 3JZVA 3H42B 1QJFA 1YNAA 2C9AA 2PXJA 2RS33 1NCQB 2BNNA 3OG2A 5G04L 3VKFC 4EQVA 3AMMA 2VE1A 4YZ2A 1AYM2 1POQA 2DYCA 2D6MA 4MVTA 3JD71 1JUIA 1UXZA 2Q30A 3H9AA 3B93A 5D8AA 3VV1A 2ZMKA 3ZXAC 4IE4A 3IMNA 5IHRA 4AVVA 3HBZA 3QCWA 2RS31 1F8VA 5CKMA 3AZYA 4LXLA 4QX3A 2A6ZA 4KI5M 4DY5A 4NJ4A 1Q56A 4DFSA 1SPPB 2IVIB 4AQ6A 2PQSA 5H9QA 4B4PA 5C7GA 3ZFFB 1DZTA 3OYWA 1Z7S2 2PQQA 1AYM3 5AC92 4JZRA 4CDWB 4XOGA 4LHKA 4CCKA 3I2JA 4JGZA 2EVXA 3PVOA 2HJIA 3RJ2X 1D0GA 1RJ8A 5L19A 2R1BA 2JE8A 2BQPA 4HPKA 1WKYA 5FMBA 5FUNA 2OS2A 5FZ7A 3R6SA 4CCJA 1V6NA 2MEV1 5KHJA 3OD4A 1GANA 2D93A 1WGPA 1NCRA 3RZLA 1GU3A 1ULOA 2V5DA 2WINB 5FY4A 1Z7S3 4IERA 4RL7A 1UKGA 4R9CA 3X29B 1D4M2 2ZAHA 3VD3A 3I3MA 1IQAA 2A5ZA 1HW5A 2GH8A 2XR4A 3ASIA 3JB8A 5F32A 3RMXA 3ILNA 3HNYM 3L2HA 1PIV2 4N7UA 3VBSC 3ZYPA 1YIFA 4AEMA 2QQPA 1ND3B 3SEEA 3NJYA 1E5HA 2WA3A 1JHJA 2W1QA 5GLWA 1A8MA 4OMDA 4FFIA 3A23A 1Z7S1 4Q26A 3M70A 2FDGA 2JG9B 3NWKA 4WZFA 4M3CB 3KZ4C 4KWUA 4CXWA 2DUOA 1JZ2A 1XNAA 4GQ7A 3TEXA 3U4SA 3I97A 4MZUA 1R1ZA 1PIV3 3V0BB 2EF6A 4NIGA 2EXKA 2JXAA 5C8WA 2X5IC 2TEPA 3AK0A 4I2OA 2BEOA 2X09A 4XYXA 1W6QA 5A7PA 3GBGA 1W2TA 3OBRA 2WYSA 2G1MA 2Y8KA 4Q4W3 5FUIA 4LBKA 4CEWB 3IIIA 2W47A 1GR3A 4E8DA 2XPJA 1W2AX 2IFWA 1PIV1 4PBOA 4XFCA 3RSJA 2HEYF 3TN93 4CPBD 5FYIA 4DRRA 1M4WA 4AVTA 2WT0A 1X9TA 3I2GA 4WV8A 2PLV2 3ATGA 4KU7A 4IEOA 4BM8A 1POV0 5FRAA 4Q4W1 1XSRA 4DUWA 1ZA7A 1RUF2 4AF9A 3MBWA 5L9BA 3ZXLA 1CGPA 4MUVA 2OT7A 3RRDA 4BDVB 2VW0A 2WA4A 4NHKA 1B35A 3TN91 1HB2A 5DAPA 2G9GA 3KV4A 1DDLA 5A6QA 3QOPA 4GMP0 4AEDB 1ASJ2 2AC1A 4KBZA 4GH4C 2VZ3A 2Z2SB 1C8NA 2OYZA 2PLV3 4XBLA 5FO9B 3RFRA 1DF0A 1GKBA 3VGIA 4J25A 1RUF3 3NAPC 4A6SA 1TQ5A 1A78A 1H30A 5EJ3A 2ADDA 2DVAA 5FZDA 2RJKA 4ASKA 4P5YA 3U78A 3W9AA 3POWA 1NA1A 1DFQA 4XW3A 3I59A 2XB6C 1AR82 1O7FA 2RMU2 4K3UA 1ASJ3 3TRSB 3A0KA 4YW3A 3T4VA 5EFUA 1N3PA 1ZBE2 2W94A 4Q4V3 4DQAA 5I0TA 4JKMA 3EBRA 3O1TA 2XXZA 4LIUA 4QPIA 4TXWA 3H7YA 5F8PA 1CAWB 1IGOA 3ZSKA 2JDMA 1HJFA 1DGRN 2OIIA 1ASJ1 3C8XA 3K75B 1LOGA 5DAWA 1ZZ7A 3WF2A 2V4AA 1JYNA 1W0PA 1AJOA 2FMYA 2XJPA 1AR83 2RMU3 3POSA 4Q1PA 2YFUA 3SC7X 4DXZA 2ILMA 4Q4V1 4QX2A 5C4WA 3GCWA 3MPPG 3B9IA 1WCKA 4NROA 1VAKA 3NJXA 5LBEA 5CFCB 4QGLA 1OF4A 4AVCA 4QDRA 2J1AA 4RR3A 2YC2A 3RQ0A 5CADA 3EQEA 4OUMA 5L9VA 3TEZA 1KJRA 2BGCA 3WF4A 1ULDA 1AR81 4P5HA 2A7AA 3AYDA 3B00A 2J1SA 2J1RA 1UYZA 1TE1B 4N43B 3ZYIB 5BNOA 3NNMA 4QMAA 2NLRA 2VC9A 1EV12 4LHSA 1RL3A 5FWJA 4MG2A 4UT5A 1N3OA 3T2OA 1APNA 1RINA 3Q9OA 1JZ3A 5A3MA 3ELNA 1SLIA 3AMHA 1WMXA 2HWB1 1BEV3 2X29A 4IE0A 4RD7A 3ZN4A 2AYHA 4D0QA 4JGYC 2A6WA 2GNBA 2ZHMA 2VUDA 2QQNA 3JBG2 2IXJA 3D4KA 3RYKA 3BU7A 5CISA 1EV13 3KF3A 1BEV1 4CPBA 4OUSA 2GMPA 4OHYA 3HJRA 3MUZ1 3Q8AA 4OVEA 3ZSJA 5IVVA 1JYTA 5CA6A 5IATA 4XF1A 2VM9A 1Y3TA 5C8CC 5DAQA 3JBG3 1O91A 1W8ZA 4RS5B 5FBJA 3WP6A 2B39A 5C3RA 4DRVA 5J1XA 5H9RA 3ZMNA 3NJVA 3ACIA 2B42B 2Y6FA 3OBZA 5HCFA 3W5MA 4DXSA 4M00A 1W9FA 3LAGA 4YGEA 1AZDA 3JBG1 1CAUA 3MIEA 3PVNA 2PTMA 5FCCA 5LBCA 4UAPA 4AOCA 1R091 2DCJA 4P9XA 1K42A 4DPNA 3WHTA 5GM0A 3EJKA 3KB5A 4D94A 2VZQA 3ZFEB 3C3VA 5FPBA 3M3QA 5LA0A 4Y5SA 4XPVA 3J7MA 1I9RA 2B9VA 1WUVA 1QQP2 4O9GA 5FMCA 5JVVA 3A0NA 1W6OA 2SLIA 3CU7A 4P08A 5LRSA 1ULGA 5F3GA 1ZRFA 2W2IA 3K3NA 5JSRA 1SLAA 3OY8A 5E6HA 3VBOB 2WZR2 4LA3A 4IEZA 2GZWA 2ZGUA 4A7ZA 2R0HA 4GALA 4OMCA 5A32B 3ST7A 1UU4A 4YFWA 3IZOA 1JZ8A 3FJSA 1QGLA 5FZKA 1SLBA 2WDBA 3GBWA 1QQP3 4NPRA 1RXFA 2BGOA 5J48A 4Z82A 3ZYJB 1D2QA 1YRZA 4XUQA 5IAVA 3H8RA 1LB2A 1Q8OA 3ECQA 4JRLA 4AVBA 1US2A 1AF9A 1YO8A 2WZR3 3MW3A 4HETA 1Q8PA 4YM2A 4ZPIA 3VDDC 5BNPB 4E9KA 5CU1A 1A34A 2E53A 3U14A 1QQP1 1AX0A 2A3WA 2W68A 4LO4B 3B5LB 3AZVA 3B69A 4YVWB 5EJZB 1F4AA 4PLOA 4JHTA 4M4RA 2WZR1 2D44A 2E9QA 1QDOA 4W6WA 4LTAA 5FPLA 1Z78A 3HPNA 5GZDA 1OLME 1RUOA 1MPXA 3KGZA 4YW6A 4Q8KA 2UURA 3I2OA 2JD9A 2KD7A 3PUIA 1YFXA 3VBHB 2DBNA 2VULA 3MFAA 3UGFA 1P8JA 1ENQA 1RIRA 3LEMA 5JZGC 1LNSA 1BQPA 5LRRA 4CP0A 5EXOA 2VZTA 1UPIA 4ZHNA 1N1VA 4YNIA 4P9IA 3FLTA 1X36A 4OLLA 4XIKA 2HWC2 1CPMA 4ZONA 3Q8BA 4Y5Z0 1QH7A 3USUB 3UYJA 3O1RA 3KGLA 2BBAA 5A1AA 4IV1C 2BV4A 2V73A 3U10A 4CDXA 4JKKA 2W92A 1J59A 2WABA 1H2KA 4I0WB 3CLPA 4QAWA 2CV6A 1OLMA 1ZZ9A 4AHWA 4HL0A 3LKJA 3APBA 3LOIA 3PUAA 3T2QA 1EYBA 3PDQA 2R32A 4I09A 4YWAA 1GZTA 5ANQA 4ZU4A 5FYBA 2VCAA 2XUMA 3ACGA 4LKSA 4OULA 3K51A 2R7EB 4JDNA 1VMFA 1RUG2 1W39A 1A8DA 5FYTA 5FPAA 3WXPA 1GNZA 2HKXA 3OGVA 2VUAA 4X6QB 5ABJB 5EIYB 2YDEA 3L2YA 2PHLA 2XJRA 4LK7A 3THDA 3JU9A 1W8HA 2XKPA 5T3NA 3WVJA 1PO12 1XOYA 1O5UA 4N53A 2ARAA 4XJWA 1IS4A 4XEZA 2JIGA 4U2AA 1OA4A 5FPUA 4B1MA 3AP7A 1EPWA 3AKRA 3RS6A 1RVF2 3ZN6B 1VBA2 2BERA 2NZ9A 2D6LX 2WNVA 1W6PA 4YVWC 4Q5OA 2V09A 1S2BA 2XONA 3VBFA 2BFUL 2XVGA 2CGOA 3U4XA 1G8WA 1GWLA 1WLCA 3E97A 2PELA 3IN9A 3SNMA 2ZCWA 1LOFC 3K4ZA 1J83A 4XFBA 1FV3A 2B45X 1GP5A 2GALA 4NPMA 5DPNA 2FZ1A 4K21A 5FYMA 4NO4A 4Q0UA 3AZZA 5J98B 1RVF3 4E2QA 4Z1VA 2EIEA 2YUEA 3BTYA 2W95A 3IMMA 1BJQA 1FMD1 3AXDA 1PVC2 2K2SA 5FBZA 4B3NA 3PLQA 1PMJX 1OQEA 1WZXA 3LPFA 1HQWA 1OH3A 5A1FA 4E4DX 5FMOL 1RVF1 3HD8B 4TSVA 3VL9A 3S5QA 3ALQA 1I1EA 1UMIA 2DCZA 5DAXA 4HK9A 2P4EA 3MF9A 2YHJA 3KQRA 5AVAA 1U5ZA 1S0IA 2VVEA 3OGSA 1LHOA 4FTEA 5BUVA 3BN6A 3ZKYA 5F9TA 4UF0B 4UW3A 3R4UA 1PVC3 2E7TA 4P9GA 2CL2A 1NY72 2I07B 4FOWA 3W5NA 4Q0VA 4XMAA 1HLCA 2DDUA 3V0AA 1IG3A 2WUHA 3S30A 3VBRC 2CWSA 5F6LB 2KA3A 2XOMA 3OUIA 1HQNA 5C71A 4G9SB 4CEYB 3FHIB 2XLGA 4QQPA 5DZGA 4HFSA 1I5PA 1PVC1 2WC2A 3OUJA 4JTNA 2Q1ZB 4NUBA 1SBDA 3B9CA 4QPGC 4OQ8A 1DLLA 1HKDA 3AKTA 1UOJA 3VB9A 4FPHA 3ACHA 1NOVA 3IBMA 5LB6A 4FSJA 2C24A 1UWWA 3MPBA 1IPJA 1WA4A 2R1DA 3OF1A 2WL1A 1LU1A 1YEWA 2WYFA 3OGGA 3ZVXA 1QJZA 5LWBA 5D1IA 1PGL2 3NV2A 4IGQA 3I2DA 2JEMA 3P3NA 3AVRA 3TEYA 2OPWA 2Z4FA 3O1MA 4LUKA 4PHZA 1CZVA 4FTBA 4GIQA 3L9JT 5A7SA 1KFXL 3MF6A 3VUOA 1R1A3 1W05A 2VOTA 1LHNA 1VBB2 1ZRRA 1UY0A 2LM3A 2VZPA 1VBC1 2Y64A 4Y22B 5JXHA 4HK8A 4W50A 2ERFA 1O8PA 2NM1A 4YG0A 3AP6A 5A3TA 3LIGA 2ZGNA 2X5IA 3HMYA 2E32A 3HVDA 3PHMA 1R1A1 1BLZA 2RHPA 3OPWA 3T4HB 5JMCA 4AGRA 1F31A 1MEC1 3DECA 2WZPP 3IAQA 2IC1A 1CAXA 5FPZA 1W06A 4IEQA 1VBB3 4WZCA 4NIIA 4DXTA 1UAIA 1SLTA 3EYPA 1TEIA 5FYYA 3FZ3A 5T5PA 5IYYA 1QJU2 1YQ8A 4CDQC 4WVMB 1DHKB 5LK5A 5F5AA 3B01A 4FXGB 5A80A 1C3HA 4DOUA 2W9XA 4TLFA 3I2KA 4CVUA 4YYOA 3CHXA 1XNBA 3RGBA 3W20A 1H1MA 4CYDA 2G4IA 5FZ6A 4IGPA 5DUUA 1SMVA 4GH4A 5FY7A 3FX3A 1QF3A 1QJU3 2EAKA 3KCXA 1OC1A 4NWVA 1BBT2 3FFZA 5JSOA 4O61A 1JODA 5EP9A 5LBBA 1VMJA 1NCQC 3NAPA 2XLFA 3ROUA 1DZRA 3CL1A 2W1SA 4NAOA 3WNOA 3ZN5A 4OZOA 2DTYA 3O12A 4Y24A 4MV2A 3OSDA 4QDQA 5J3UA 4LBMA 2IXCA 4QDSA 1V6OA 4EE2A 1VPHA 1N1SA 4NIDA 5F2WA 2XWJB 1BBT3 3HQUA 4CU8A 5BNNC 1XNKA 3O1PA 2JG8B 2Y0IA 2E51A 2VCCA 5G05L 4CDWC 1Q3EA 3I3DA 3Q8CA 5HCBA 1R082 4IEPA 1X8EA 4MSVA 3ZR6A 1W8TA 4E2SA 4BQWA 5J7MA 2RR12 1QJX2 5D8AB 1H1AA 1UQXA 3I3BA 2ZPXA 5FZOA 1AR92 2DVBA 4UW4A 3O0VA 4QD2A 4QX1A 3J4UH 4ZU7A 2VNOA 3W21A 4AYUA 3KQ4B 3LE0A 1E5RA 5FXVA 2WQ8A 2WNUC 3J8F3 1F15A 3OPTA 2TBVA 1L7QA 2DUQA 4Q27A 5FZ4A 1R083 2R072 3KMHA 3WCRA 1QJY2 2VL4A 4JGZB 3KT1A 4ES8A 1N3QA 5DZFA 5A3UA 1GQPA 5A7QA 4FBFA 2RR13 1QJX3 3HN3A 1ND3C 4HPKB 4PI0A 3EXUA 3N9QA 4X8NA 1AR93 4MX3A 3UETA 1XRUA 3UKTA 4JGYA 3J8F1 1XNTA 2ZX3A 3T2PA 1LENA 3ZPYA 3QBQA 3ZYGA 1R081 1NCRB 2Y6HA 4FOVA 4F7ZA 5K8SA 2Y34A 4MGQA 1Y9QA 3SH5A 3ES1A 2RR11 1CZTA 1QJX1 2R073 1SLCA 1QJY3 4ZS3A 1AR91 5T5OA 1V00A 4PLMA 1AYN2 2DCKA 2YFZA 3VBUC 2HEWF 2CGPA 2OUJA 5KHKA 1PZ7A 2ZZJA 5C8CA 5I0UA 4FOQA 2R071 3H0OA 5EYXA 1UF2C 1QJY1 3N35A 2GNMA 2UWAA 3D8CA 1UY2A 1YFWA 2LW8A 1J3PA 2YC0A 3AJYA 2ET7A 2BFUS 4NMIA 3KHCA 4OI0A 1V9U2 4YZ5A 2ADEA 4R4XA 2RE9A 1LGNA 1PHMA 2OQ6A 1QHDA 2ZGMA 2RG4A 1AYN3 2QQJA 3SMHA 4AI1A 3AFKA 2QQKA 4QHBA 3MYXA 1PM7A 1W6QB 5JPNB 3GF6A 5FK7A 5KC6A 4BWOA 5L9RA 4XXAA 3ETQA 1E5SA 5FYHA 1OUXA 5A6ZA 2OZ6A 1BZWA 1GZWA 4ZXKA 1PMIA 1AYN1 1V9U3 3PUHA 1HRV3 3IB3A 3AM2A 1K12A 4XJZA 2B8MA 4IEWA 1GNYA 3UKNA 4YM1A 3DPRC 5FZFA 1AXKA 3VZKA 2VZOA 5I91A 4BB3A 1JYIA 1B35B 1IS5A 1V9U1 2ZX4A 1C1LA 1HRV1 3LWCA 3N9NA 4NOTA 4XILA 3VDAA 2JKBA 1AR63 1YQ6A 2EXJA 2ZS6B 1HRI1 4BA6A 4JTOA 5T54A 2DVDA 3MDPA 5FQ0A 2WS91 4NWWA 2ZGOA 4AGGA 2XH6A 3DXUA 5F37A 3NNJA 4W6YA 4AI3A 2VMCA 3C7OA 1QIQA 4XDQA 1HB4A 2VOKA 4HG6B 4RGKA 1GOHA 1U5IA 1AR61 4BXSV 2WO7A 4K8RB 1RHI3 1QOOA 1NA1B 3VDDA 1RUJ2 1YHFA 3I59B 5FZLA 1N1TA 2DU1A 1XU1A 2N7GA 3RZGA 4C8DA 3RZZA 2DTWA 3H8UA 4B4RA 5C33A 5CFCC 1JXNA 2A3YA 4QPIB 1RHI1 4BPZA 1SDWA 2I74A 4OHZA 4CZSA 1C8M2 2VMEA 3FBMA 3K4DA 3N7LA 1GQHA 1C5HA 3PU3A 3V65A 2ET1A 2QQLA 2JB8A 2GC2A 2JDKA 3JQWA 4MXVA 5FZAA 1QOTA 2Q1MA 2ZGQA 2XJQA 1RUI2 3M3OA 4IE7A 2Y26A 4WM8C 4KQ7A 3RWKX 2JDHA 5C4WB 3ETPA 4DB5A 4QPWA 4PDWC 1ZM1A 2GMMA 5F1RA 5A33B 5JZGA 1WCDJ 1UU6A 2RJLA 1UD1A 2YY1A 3J7LA 3A21A 4HVOA 4RFRB 4GD4A 1NE4A 1IQDC 1O59A 2A6VA 3D0SA 3KLSA 4HBNA 1YQ2A 4AFMA 5I0DA 4LO5B 2BBVA 4RQPC 3ZXEA 4UI9L 5FY5A 3W59A 5BNOB 3SQOA 2W08A 3T1LA 2UY8A 4R9AA 4A3ZA 4AI9A 1COV2 5IK5A 1G86A 1O5LA 4OZXA 1XC6A 4L97A 4IV1A 2FMDA 3I54A 3NNGA 1TME2 3MV01 3UKVA 3D0JA 1OOPB 1XJAA 2R043 4RS5C 1NX9A 1GSLA 2ENRA 4B29A 1OHFA 1DU3D 3DEMA 3P6BA 3DYOA 5L73A 2ZGLA 1UOGA 2ARBA 2E7AA 2AACA 3FUOA 4KL1A 5L36A 1COV3 4MLOA 4Q8LA 2E63A 4GJYA 2EIBA 3B02A 1DCSA 1YI7A 3QD6A 2EIGA 5C9AC 2R041 2YGMA 3O1OA 1SDDB 3CKHA 2VUJA 1NQDA 1TME3 1O4ZA 2VMHA 3CBNA 4BQ5A 2Q8EA 1AUYA 1TNFA 3S6PA 3J26N 1AYM1 1LEDA 3AYCA 4LEJA 3ZSEA 2LROA 5JIAA 3FLPA 3WF3A 5CYYA 1FNYA 2QQMA 5AC93 1VE0A 1HQLA 3I8TA 1GYKA 1XE7A 3AYEA 3POYA 4FT8A 4IV3C 4LO8A 3PUSA 4GB32 5I8TA 2VUCA 3LEGA 4OI1A 4JDMA 5J96B 5LATA 2JJ6A 5FKBA 4BH9A 3VBOC 4ASMB 4JDOA 4O9EA 2PFWA 5IFTA 2CHHA 2VCMA 5AC91 1SZBA 3ES4A 5FZ3A 1WWYA 4CP9A 1MZFA 1LOFA 4UYBA 3ZXDA 5DQ0A 1HB3A 4XUNA 1RITA 1W9WA 2C1FA 5AVPA 2WLQA 3ILRA 3MIHA 1RMU2 4PQ9A 1D4M3 3WUDA 3AKSA 5K9YA 2W46A 4OUEA 4CE8A 2VMDA 4GB33 4P00B 2IZWA 5FY8A 5KHIA 1W6OB 4R52A 5FKCA 3WQ1A 1J84A 2QFEA 3EMRA 3WP3A 2D6KA 4XUPA 3OY8B 4Q2FA 1MZ5A 1K5MC 1ND2C 3N9PA 4IE6A 2JDUA 2R062 1D4M1 2WNEA 3RJRA 1JMUB 4F8AA 3LGRA 4YRDA 2PYTA 3MLKA 1RMU3 4QQLA 3WDWA 3ZIWA 3WY6A 3DKQA 5FUPA 1JZ4A 2DVGA 1H8TC 4NAMA 1KGYA 2XL7A 3W58A 5F3CA 4O65A 4COWA 1VLNA 4W6XA 1T6BX 1JN2P 1VB2A 1WCUA 2E31A 2XJTA 4Q4X2 4XF9A 5J09A 1Y43B 5A7WA 3S7IA 3RZHA 3H1MA 5JI9A 1RMU1 5IVCA 2J1EA 1ZRDA 4K6BA 4EJRA 2AZ5A 2JDYA 2ZEWA 3VBRA 1W6NA 4KBBA 4CA9A 2WNOA 2XL9A 1UY4A 2AEZA 1JYCA 4CSWA 2ZABA 2FCUA 1UPSA 1MS1A 1U12A 1FOD2 4QPGA 1IHMA 4M01A 3LA2A 4ZKTB 5ANNA 4BYYA 1YUDA 1RUNA 4D69A 4F83A 1W28A 3BUCA 4CCCA 2NN8A 3GHMA 5J36A 4FO9A 2PLV1 1VB4A 5GLVA 3ZXKA 2QNKA 2BDRA 1H2MA 1OI6A 4K1YA 1JYVA 4P9YA 1JZ7A 3UJQA 1RUF1 4PIZA 3H3UA 2ARXA 2QCSB 4MGKE 1UZZA 2QKDA 4COZA 3ZFGC 1G7YA 1FOD3 2JDPA 4IQPA 4META 4NN0A 4NRMA 4A42A 4Y5TA 5DUWA 1OKQA 2ZHLA 3BI3A 2ZX1A 2ZTNA 3GJBA 4A6OA 4AVSA 4XHBA 2NYYA 3AKQA 2YBPA 3V64A 5LK7B 3NW4A 2D6OX 2ES3A 2ZX0A 1FATA 4WM7C 1JW6A 1FOD1 1QDCA 1ZBE3 3KS7A 1I5ZA 3BODA 4WVVA 1Y4WA 4YVSC 1WCSA 2WRAA 3OGJA 2GP5A 4A7KA 1LJ7A 1MQTC 3WG4A 1ZX5A 3LPGA 1UX6A 2YZ4A 1W03A 2RMU1 5T5JA 5M0TA 3VBSA 4CDQA 5ISLA 2YV8A 1ZBE1 5FO8B 3N7JA 2AUYA 4IEXA 4H2AA 4RGAA 4XFIA 3WDVA 1XBFA 2ETEA 1KD7A 4HN1A 5A3WA 3M3IA 1NQJA 3HR9A 4U36A 4Z07A 5DG1A 2KR2A 5IT6A 1VIWB 4XMIA 1YLLA 4N53B 4LHLA 1KFUL 3WF0A 2I45A 1POV3 2IVJA 4YGDA 1MR5A 4E4SA 3I2FA 5FP7A 2ZKLA 3CF6E 3HQXA 3AFGA 5DG2A 4XJAA 2VECA 3WT3A 5C70A 2GH2A 3BPZA 5FP9A 1RUH2 2WNVB 1W6PB 2C26A 1NCQA 4GMP3 4FPJA 1HDKA 1POV1 4DEVA 3NMBA 1OMIA 2QQUA 3PNAA 4XAEA 3SCFA 3TAYA 3O1SA 2O0OA 3CZJA 4CUGA 3C7GA 4QKDA 1EV11 2ZACA 4UFJA 1BXHA 1J1TA 2VU9A 3LB9A 2Q8DA 2Z42A 4GMP1 1UYXA 1HN1A 4CDUC 3IAPA 4M0HA 5BNNA 4EZ4A 3WQBA 3R4SA 1VALA 4EYUA 1T6GC 3RYRA 4ZZ8A 2XJVA 3TNQA 1TNRA 1Z0HA 4CDWA 2GC0A 1MZ6A 3OD0A 4LKEA 5CB7A 3WG3A 4C0BA 3LFIA 2Q1FA 4OCTA 3WOGA 3B3QE 2J1TA 2RS52 4I02A 4NRPA 1JZ6A 2ZOEB 4BCUA 4CEYC 5EV7A 4BU2A 1LTEA 4K1ZA 4FAHA 1X82A 3GYDA 3T09A 2QBXA 2WWUA 1W90A 2CNAA 4IEUA 3VZJA 5JXIA 3V56A 4M3CF 2WNUA 4COYA 2WT2A 4BMEA 4GZ9A 3WZ1A 1RTVA 1ENSA 1W9SA 3NKTA 4FP3A 4QU1A 4BXFA 3V0AB 3I3EA 4CCOA 2RS53 1PO22 4QX0A 5F5IA 4FOYA 1ND3A 2WZ8A 2G9FA 3UGHA 3O1VA 3CJIC 2YXSA 1DYPA 2X53S 2WO3A 3VHOA 4WVZA 1W8NA 5T55A 2V72A 4ARYA 1UY1A 4DS0A 1O6UA 1XYPA 2QVSB 3CNAA 4ES9A 2RS51 3PU8A 5FMDA 1H9WA 4ZY9A 4JCKA 5C5TA 4P9WA 4CCDA 1MZEA 3VBSB 1PO23 2WKKA 3U0ZA 2UU8A 1RUD2 1IOAA 4IEVA 4UOJA 3VBUA 2IWGB 2JICA 2XG3A 4YW1A 4EROA 4NHMA 2IXHA 5GZEA 5LY1A 4AHYA 4B7EA 3B94A 4XJUA 4AK3A 3IDEA 4N9HA 3CO2A 1KDMA 4IXLA 5EWSA 4IESA 5FYVA 4XHXA 1DGLA 1MS4A 1H4GA 5HCAA 3NKGA 4NR1A 3VDCA 1DG6A 5KXBA 3QACA 1LULA 4TWTA 2Y38A 2ZAAA 5A70A 5I8YA 5IJRA 2EALA 3C7EA 3GALA 5E8AA 1HV0A 2X5IB 2UYAA 5FTTC 3UJOA 3HNBM 5JCTA 1JYWA 4XFAA 3S57A 3UESA 2H6BA 2WFPA 1D0HA 3PMSA 4FAGA 1K45A 1CIWA 2MPFA 2YU1A 3JCIA 2A1XA 3HT1A 1CAXB 3OPZA 3INAA 5I0SA 2WLPA 1O4TA 2DUPA 3KV5A 3WW1A 1Q8SA 3IKWA 2BP6A 2CDOA 3IPVA 3VHPA 4NIHA 3VKOA 1RUC2 2ARCA 1ZRIA 3DPRA 3DYMA 4AZZA 5K0UC 4CXYA 3F2ZA 3H1WA 2ATFA 5EQUA 1AR72 5LCWL 1ZNPA 1F4HA 4LBOA 4CRQA 2HLEA 1V6IA 1PX3A 2VD7A 2JDAA 3ON7A 2E6VA 2FDKA 2ZGRA 5LBFA 5C3SA 4YW4A 3SCHA 5FYCA 1XE8A 2OA2A 4BQ2A 4Q0QA 2HWC3 2FCTA 2A6YA 2UWBA 1UOBA 3N9MA 1W8UA 4GH4B 2LTNA 4XDOA 2HEVF 1CVNA 5CBLA 1J3RA 2JG8C 2NPIA 1CJPA 1XQNA 3SXWA 1OFNA 4D7TA 5AFBA 1RUC3 4NRQA 5I93A 3NAPB 2A75A 2JD4A 1AR73 1MS9A 1NYWA 4V2WA 1WCQA 2RDNA 1BK1A 2FHRA 2HWC1 4SLIA 4C1XA 3KT7A 5FV3A 1W0OA 3MIBA 3HIFA 2E26A 5FXXA 5FYSA 3VKLA 4DZGA 2O8OA 3VHRA 2C0ZA 4HZFA 5CIRA 2GNDA 3I4IA 4OQ9A 1VRBA 4EZHA 5CFCA 2ZXQA 1AR71 4UW6A 5F5QA 5HXMA 4Q4Y2 1RGSA 4P14A 1RUG3 2WN3A 1NXMA 3AJZA 4TTGA 1Q5OA 5LEKA 3KD4A 2VMGA 4A7YA 3IDBB 4P9JA 2BU9A 2F4PA 1UXXX 3N3HA 4WM8A 1PO13 2H6CA 4J1XA 2JENA 4PDWA 4QWNA 5CFDC 1RUG1 5FZOB 4B1LA 4LBQD 1ZVFA 3USSA 2YBKA 3HEIA 4BMBA 1W2OA 2VR4A 4Q4Y3 4Y4YA 3CDZB 3GNEA 4YLZA 1LAJA 4GWNA 4QM8A 4MXWA 3ZMOA 5C3PA 1VBA3 5FLHA 3E5UA 3TEWA 1OVPA 1OT5A 2JIJA 4HKOA 4RQPA 1PO11 4EWDA 2W52A 1ONAA 3HT2A 4EN0A 1GNHA 1J58A 1YQ5A 4QKFA 2EXIA 1AJKA 1V6LA 3KCYA 1H0BA 3AZXA 3PIJA 4Q4Y1 4FPLA 3VD7A 2XGXA 3NRUA 2VQAA 1VBA1 1CD3G 4QM9A 4A4AA 1OQ1A 1WLWA 4UXAA 3WW4A 4GKYA 3BTXA 4JGYB 5A7OA 1V0AA 4AFCA 3UGGA 3OGRA 1GUIA 4RS5A 3VDBA 2MNGA 1ODNA 3POFA 3MEPA 1UYPA 3ZDVA 2BPA2 4K40A 4IE5A 2DF7A 1AVBA 2DCTA 4INDA 3JB4C 2VBPA 1CX4A 3N4MA 5C9AA 4H14A 2PHTA 2VNRA 3GGLA 1ZRCA 3EHKA 1C28A 4UBGA 4EN9B 4E2GA 3OB8A 5JOWA 1HXS2 4AWDA 5FR3A 1G9CA 2VQ0A 3HWJA 4L9BA 3DKWA 3N7KA 4HT1T 5FJKA 3EO6A 2VZUA 1NZIA 5CEHA 1SLLA 4WBBA 4IV3A 2PAMA 5FZ8A 4IETA 4XF4A 2OXBA 1LODA 4YW5A 4CXXA 4XIOA 1SCSA 3WDTA 1PGSA 2QTWB 3VBOA 2J1VA 3BKZA 2FD8A 1PMHX 2QQIA 4QKNA 5GALA 3UNPA 1PZ9A 1HXS3 4W4ZA 3A22A 1PK6B 5FY1A 4M0NA 2A3XA 1NY71 1JOPA 1GZWB 1EP0A 1U5XA 5KC5A 4JV4A 2VTXA 2WAAA 3NV3A 5FXWA 2A70A 5FP4A 4C1WA 5HV0A 2W5FA 4XTMA 1W9YA 4MHRA 5GLUA 5A3OA 3RPQA 5JUVA 3BCWA 5FZMA 4YARA 3MV11 2V5YA 4LK6A 1PGW2 5FLJA 2ZGSA 5KR7A 4XDPA 1K5MA 1ND2A 1XNDA 2CU5A 5IVJA 2LALA 5LEJA 5LA9A 4CU6A 1TMF2 2XJUA 4GWMA 3ABZA 4M4PA 4S2HA 3PVBB 2QZ2A 4COUA 1STMA 2RS12 2HYKA 1GOFA 1UO9A 1SQ4A 3WF1A 1C1FA 5FQ0B 2QJVA 1PGL1 1UW8A 3NL1A 3QH7A 4LHNA 4LBQA 1H8TA 5A7NA 4QXCA 3GHNA 1IPSA 3WG1A 3WLUA 4PT6A 4UFLA 4S2DA 4OHWA 4DUVA 3E1F1 1U5YA 5FOJB 3RYPA 1VBB1 3DV8A 4RFT0 4A45A 4CP2A 1TMF3 3P1IA 5CG8A 2W1UA 2ZMLA 4H7MA 4K8FA 4R4ZA 5L7OB 3E5QA 4Y20B 2RV9A 2RS13 4AAPA 4BIOA 4YG6A 3LQCA 4RYDA 4JQRA 1VRH2 3DF0A 3I3QA 2FDFA 1O8SA 2IXIA 1D7PM 2EA7A 4ARXA 1TMF1 1W2UA 2ZEYA 1NLSA 3H3ZA 5FZEA 3CEWA 3IM0A 2D40A 1FPN2 1UOFA 3ZM8A 3USUA 5IVYA 1JOJA 2QQOA 3ZPOA 4H7LA 3H3LA 4Q29A 3NNFA 3WDYA 1UIJA 2D43A 3J7HA 1ENRA 1LHWA 1QJU1 2PMWB 3MUY1 4HOOA 1SHWB 4FPCA 5JZGB 1BK0A 1SG3A 1OURA 1OOPC 4A2UA 1VRH3 2XDVA 3MGUA 5LW9A 3ZFGA 3I7DA 5JOYA 1QJEA 3D6EA 1WW5A 3U07A 4LORA 4XCBA 3ZFFC 5TSWA 1HN0A 2NMNA 3K46A 1LRHA 4LPLA 2DV9A 1W3XA 1WLDA 3MW4A 1DQ1A 1A3KA 3CZUA 3P3PA 4IV1B 1VRH1 4PCRA 3FLRA 1BBT1 4MHUA 3E6CC 4ISRA 1N1YA 4WM7A 3DUIA 3PUQA 4MADA 2K0GA 3T2TA 1W99A 3JXSA 2DBIA 4YVSA 1KXGA 3R4DB 3DN7A 1ZREA 1MQTA 4TLGA 5DDJ2 3AL5A 2FBEA 1Q8QA 4FI9A 4QB2A 5SV5A 3OYWB 4ISQA 4QT6A 3SH4A 4E27A 3S5AA 3ZN6A 3FBYA 2Y6KA 4YW2A 3ZYRA 4XC9A 1W8OA 2DURA 3J9SA 5FZ0A 4LNVA 2D5FA 3SKVA 2GDFA 3ACLA 4PF5A 3OEAA 2PAEA 3LSEA 3ZO0B 1E57A 1QEXA 1BVP1 4P9LA 4Z92B 3H1YA 2JG9C 5DDJ3 1RXGA 5GLZA 1ODMA 2OW4A 3POEA 4A41A 2BVVA 2WZEA 2KM2A 3ZYBA 5IK7A 3OOXA 4FPEA 2WWSA 1V6KA 5GKAC 1O4YA 1LESA 3HN1A 4LQRA 3ZYHA 1YXWA 4FPYA 5DDJ1 1BYHA 4XBNA 3WNMA 1V6MA 3MLLA 5EHDA 4IGOA 1CIYA 1HX6A 4CEWC 1GWKA 4CU9A 1H2LA 4AAXA 4CP9B 2CTVA 5A6XA 3VD4A 2G9ZA 1O3RA 2VVFA 4D8MA 2BUKA 1IPKA 1DQ5A 2VJXA 4CDUA 2BRTA 3G7DA 5FOBB 1SFPA 2B5HA 1LR5A 1JUHA 2DWRA 4Y33A 2G19A 4LE3A 3TYJA 2PHWA 3B7MA 5JPMB 1UCXA 2R30A 4RSUA 2XKOA 3GZEA 4AEDC 3I49A 1FXZA 4AQ2A 2D6PA 3CMGA 4CEYA 3H8XA 3MZHA 1UZ0A 3KCCA 3QH6A 5A1LA 2XHNA 2AH2A 3ENRA 3BTZA 5FMOS 5FZGA 3BPSA 4L99A 4CU7A 2W87A 1L7RA 1IG0A 4BIFA 3VN4A 5GJ6A 5A7WB 4AI0A 5FZ9A 1OBNA 1EAH2 3ILFA 4XZPA 3VBRB 4EV0A 4LBLA 4RGGA 1W6NB 2OZJA 1OXCA 4D6RA 4KU8A 3CJIA 4BK5A 4EN8B 2ZA9A 3A7QA 4QPGB 4FPFA 5EYYA 5FP8A 3HAGA 4XXPA 3T30A 1AX2A 2Y0OA 2YPJA 2ZGPA 5FREA 3ZX7A 1EAH3 1F2NA 1NG0A 3ZLIA 2AREA 1SBEA 2R49A 4HSJA 3AX4A 3PURA 5FIXA 2X05A 2VMFA 5HCHA 3WDUA 3ZXGA 5CAZA 5JOZA 2QDNA 2ZEXA 4L92A 2P3KA 3R0RA 3UV9A 4DO0A 2VW1A 1WBLA 2HWE2 3ZYFA 2ORZA 2HH9A 1EAH1 2F6BA 1WW7A 2FCVA 3LSDA 3OBTA 2X10A 1CR7A 4K9SA 4LE4A 4N43C 4OI4A 1QH6A 1RUJ3 2FDIA 3U11A 2P3IA 3N36A 3R05A 5T5LA 2JE7A 2BJSA 4BQ4A 3VD9A 5DXDA 5DMYA 5E89A 5FDBA 2J7MA 4XJ9A 2HWE3 3KM5A 2P5BA 4RR3B 1C4RA 1D4VB 2WAOA 1LOEA 1RUJ1 2XQXA 4YSFA 1C8M3 1KEXA 3JD72 3NV4A 1J1LA 4CDQB 2PAKA 1QXRA 3WG2A 4JAAA 1RUI3 3O1UA 4PIYA 4MGZE 2HWE1 4FXKB 5K0UA 3N7MA 1G9FA 2OKXA 2Y33A 1C8M1 1W8WA 4HANA 2B46X 3WCSA 1LU2A 5C3OA 2IXKA 1RUI1 2Z69A 4LO6B 4XETA 1VJ2A 1VBD2 2VPVA 3ZSLA 2JG8A 1OF3A 5AFEA 1IS3A 1FI2A 1MS3A 2MEV2 3RZKA 1LECA 4LULA 2GP3A 5FPXA 2O1QA 1BVVA 2WSUA 2Q8CA 3GZUC 1WMFA 5E1RA 1WMEA 3ZFEC 5JXJA 2JDZA 1O3SA 4D6QA 1COV1 3N9LA 2RVAA 1S1AA 1SFNA 4V2VA 1VBD3 2WT1A 1GMMA 2D7FA 3PVEA 4QQOA 4XFHA 3VKNA 4EWAA 5BNNB 5FZIA 3WD5A 3WV6A 1YI9A 3T0AA 2MEV3 1ZYBA 4AG4A 1TME1 1KQRA 1HB1A 3N9OA 4AR2A 3MW2A 1CJDA 5EZWA 5B4XA 2E7QA 1CAUB 4ONUA 4ZZ5A 1S2KA 5GLTA 2XBO2 1QNYA 3GXUA 5T52A 4XURA 4Z2WA 1VBD1 4ASLA 4GULA 1RB8G 2YB7A 2OUHA 1EUUA 1OPMA 5CFDA 3MO4A 3OCPA 4FPGA 2A71A 1QWRA 2WO2A 3PJYA 1XU2A 1ZZ6A 3AB0A 4NVPA 1RUE2 2VZ1A 3URFA 1UMHA 1QXJA 4Y26A 2RDRA 2FZ2A 1GOGA 1KDKA 2WNUB 4SBVA 1NKGA 1NZCA 2XBO3 4QXKA 1BKZA 3KVBA 3M7AA 3AP5A 5BNPC 3BGAA 5KBFA 2FQPA 3LEKA 4YW7A 1UMZA 1C5IA 3LEIA 5FXZA 3THCA 2WFF2 4GB31 3GCXA 5DAVA 1S0DA 3OUHA 3G6JB 4S2GA 2P6CA 4P02B 2CAVA 2XHKA 1RUE3 4Q4W2 4L8QA 1DQ0A 3IIAA 3AYAA 4TYSA 1UZWA 2XBO1 5F3EA 3WX5A 4K20A 2UWCA 5HV4A 1O3TA 1QU0A 1Y7BA 2KXLA 2Q0AA 4GJZA 3TN92 3TWIA 2V4VA 4XFFA 1GBGA 2W1WA 5IWFA 4I3GA 4QX8A 3HOBA 3VBHC 2Q8OA 4XAAA 4R8HA 2R063 4HONA 2WFF3 1RUE1 3U1XA 5IW0A 3VBUB 4JX0A 1CX1A 1W6MA 4LA2A 4PLNA 5ERLA 4D7YA 2ZKNA 5F3IA 4YM3A 4HVRA 1AX1A 4XVHA 4YM0A 4QX5A 4EN6B 1IKQA 1CAVA 4N8MA 2C4XA 2Z79A 4FPOB 2W39A 4HKLA 2D3SA 2R061 1S0FA 2WFF1 4Q4X3 2HWF2 2VTFA 3WNLA 1OH4A 5K4LA 2NMOA 3CJXA 4KWLA 5CNAA 2FDHA 2WR9A 2PN5A 3ITQA 4NHXA 3LIHA 2P2KA 3ZSMA 4JRAA 4F3JA 1OA2A 1YC61 1JBCA 5FY0A 1I6XA 4QGMA 4UFMA 3CQOA 4QU2A 5I0RA 1DQ4A 1XYOA 4Q4X1 4RN5A 3AMPA 3THTA 5JSPA 2CDPA 4XQ4A 1LOCA 2VOWA 4KG0A 2BNOA 2HWF3 1DYKA 1UYYA 2EIDA 5FLIA 1RYYA 1UZVA 4IEYA 4YG3A 4Q4V2 2VMIA 2XUEA 3IPVB 2CSGA 4QGNA 4Z8BA 3DPRB 2L9LA 3AKPA 1PNFA 3BYWA 4RA0A 4CDXB 4EWEA 5ABJC 5LASA 3NJZA 4KWKA 2HWF1 4KG8A 2WQ4A 4LJHA 3M4FA 1L3JA 1F5JA 1CZSA 1EY2A 2GNTA 3D82A 3WUCA 3BVCA 2A6XA 5CG9A 4HSLA 5H9SA 5IVBA 1AHSA 2JX9A 4XQDA 1KRIA 2HWB2 5HBAA 5J37A 3O5SA 5IFPA 1CESA 5GZFA 3NVCA 4Y3OA 1OFSA 2HYXA 3RZJA 3DXTA 2C6SA 4AGVA 1OLQA 1PNGA 4LLOA 2EICA 5JR7B 3POIA 5A33A 2D6NA 4XFGA 4I0BA 1BEV2 2ZJCA 2PHDA 3QLQA 5IK8A 4YZ1A 2VG9A 5F2SA 2Y6JA 1G6NA 1V70A 2HWB3 4XZUG 3WNNA 1WLTA 4Q0PA 5DZEA 3ZR5A 1GZCA 3FHAA 1X9PA 2R6QA 4IW3A 4QQHA 1H9PA 2JKXA 3F95A 3IT8A 4WM8B 4Y1UA 3VBFB 3VL8A 4AL9A 5KXEA 2ZHNA 1DBNA 4PDWB 4C90A 3DGTA 2VOXA 3LCPA 4FQ4A 2CAUA 3KHBA 1I3HA 3RI9A 4FTSA 1OOPA 3EB7A 3S7EA 2VQUA 4MXWB 4CUAA 1RUH3 1JH5A 4RQPB 1R092 1SPPA 3FHQA 4GXLA 1UIKA 1CN1A 5F5CA 3ZFFA 3ZKUA 5HPOA 1ALYA 2LRPA 2H0BA 1YCIA 2AGSA 3BALA 1S0EA 4M3CE 4XF3A 2BTVC 5FZCA 3T0BA 2GN7A 1OUSA 1RUH1 1QXPA 1UZYA 5GZGA 1GFF2 1RC6A 2J1UA 1FT9A 2GN3A 2YU2A 3FN9A 4OYUA 5APAA 5BY5A 3RI8A 1WBFA 1R093 4QKBA 4EN7B 1DZQA 2DFCA 1WW4A 3GZAA 4W65A 1XSQA 4XQWA 2PHXA 1VBE2 2D5HA 2VXRA 3FUQA 1GP4A 4ZU5A 4LLFA 2EXHA 1K5JA 5C9AB 1L7LA 2P17A 2I2SA 3ME2A 4CCLA 1MS8A 2VXJA 5IAXA 1GV9A 3NNLA 4KNCA 1PK6C 2RM22 1RJ7A 1W0NA 1LHVA 1H6YA 1H4HA 2DVFA 2JG9A 3A4UA 4HN0A 5IVFA 5HI0A 2R0FA 1PX4A 4M3CA 3JUUA 3LDBA 5KXCA 4IDZA 4HXCA 4AEJA 1VBE3 2HBTA 4IV3B 4XF0A 1FYUA 3V0BA 3BOPA 4LMFA 1YFUA 1X8MA 2DFBA 3UT0A 2RM23 1G9DA 4CEWA 1OLRA 2K46A 2Y6GA 4UBHA 4AQTA 3NQHA 1QNWA 4KGGA 4LIVA 3UL2A 3HQRA 5ACA2 1VBE1 2AEYA 1VP6A 2ZHKA 1Q43A 1X33A 3D3AA 4G4FA 4XTPA 3TNPB 1PO21 3M3CA 4AW7A 1WA6X 4AHZA 4NHYA 2EAAA 3SISA 5C5UA 1D2SA 1RUD3 2RM21 3MIGA 3SHRA 1E5IA 5JLVA 1W8FA 2P34A 5LZ6A 1A6CA 3VZOA 1DYOA 2Q4SA 1GP6A 1K5MB 1ND2B 4PJYA 4LT5A 5F39A 3OEBA 3AL6A 2JB4A 4PQQA 5L7OC 3FE5A 1UNBA 2GSYA 3KF5A 4OHVA 5ACA3 4AEDA 1DGWX 1YFYA 1LCLA 2QDRA 2TUNA 5CVRA 4NE9A 3PTYA 4AE2A 1RUD1 4BOWA 2XVLA 3PIGA 3POJA 3WR0A 1TG7A 4LBQB 1H8TB 4JC1A 5FJHA 3RG0A 5GZCA 1CWPA 4FFGA 4XJ8A 2WN2A 3P5BA 1S0JA 2WWJA 1TZOA 3LF7A 3MLJA 3POGA 2GMEA 1ACCA 1FAYA 1ENXA 5A3NA 5ACA1 4FFHA 3VZNA 5IUQA 3WHUA 4X6RB 4D7SA 4OHXA 2QE3A 4X8PA 3ACFA 4KH9A 1REFA 1DGRA 2P3JA 2OVUA 4KGQA 3S0MA 1PVXA 4IUGA 5B2GB 5JDBA 5DUXA 3ZIXA 2J42A 5FZBA 4AI2A 3LDRA 1ZZ8A 2GU9A 1CQ9A 2BZDA 4UFHA 3WW2A 4KMQA 3WNPA 5K7PA 1UKRA 3FWEA 4UFIA 1JU4A 3WQ7A 2WBKA 2C9KA 2CY6A 1CAWA 3MHZA 4QB1A 3T08A 4PIXA 5F7UA 1WD3A 2YPDA 4MGTA 2YMZA 2J22A 1T2XA 1YJKA 1CPNA 3AP4A 4YGBA 4BQXA 4DINB 1EUTA 4S2FA 1JU3A 4ZXEA 2W0XA 3SCGA 4YFZA 4HKWA 3LD8A 5D8AC 4FP2A 1W3VA 2VZSA 4JQTA 5F6KA 4BJ0A 1RUC1 2XVKA 3MIDA 2NP0A 4RHV2 2DCYA 5FK8A 2VNGA 3WNKA 2WIIB 1S2EA 1HJGA 5A6YA 3NSTA 3ZFGB 3PJQA 1M06G 2JWPA 4DNYA 1S55A 4MGYE 4N43A 3LDKA 2VO5A 3E6DA 4JGZC 2DU0A 3SH3A 2BOIA 2VQTA 3KWVA 5FYUA 4DUXA 4WM7B 1JS9A 1PM4A 3GDBA 5SV8A 2OX0A 4FCAA 4GWJA 4RHV3 4XBQA 4D6SA 1VMHA 3OBAA 4YVSB 1FMD2 1NCRC 3M8LA 5JOXA 1MQTB 4DMIA 3H7JA 4JHZA 3KT4A 2B7YA 2D98A 3SKJE 4CCEA 2JECA
chains in the Genus database with same CATH topology
2QZ3A 4YGCA 4JVAA 1ZZCA 1REDA 1DQ6A 4K7JA 4RHV1 3K48A 1MS0A 1WD4A 1FNZA 2JE9A 1JTZX 3D5OA 1MACA 4QPYA 4D3WA 4I0AA 3AP9A 3NV1A 2WSVA 3IDCB 2IXLA 1FMD3 2GC3A 4GKXA 2ZMNA 3E5XA 2PHFA 1CONA 2MHFA 1S0BA 5DUVA 4MH0E 1UU5A 5KWRA 2TNFA 1AXYA 3LZZA 2H0VA 5C8CB 2XJSA 5IK4A 2VOVA 3ZFEA 3WP4A 1IS6A 5FFOC 4N90A 4FPKA 1YYNA 2X8KA 2ZBJA 3VZLA 3TB0A 4CDUB 1JHNA 1KITA 4L2NA 5BXXA 2NQYA 4N7IA 2SBAA 4R9DA 4L11A 1B35C 3OJBA 4AVAA 1H1IA 5JWPA 5A32A 4J6GA 4G3YC 1IZ3A 1KS4A 4H3WA 1LEMA 1VBC2 3TBDA 1MS5A 3UK9A 5T50A 3GBFA 3FC0A 5BV6A 1DQ2A 1SCRA 4I30A 1R1A2 2D3PA 1LOBA 3THPA 4BQ1A 1HXS1 2ZZQA 3LA7A 1MEC2 3LOBA 1F5FA 1NA1C 5BNPA 1QKQA 1VBC3 1O3QA 1QY4A 5E16A 3CJIB 2ZGKA 1WMDA 4YVWA 4QPIC 5H9PA 1UL9A 3MICA 1H2NA 2GC1A 4AFDA 4A3XA 5BPXA 3M3EA 4HVQA 1MEC3 3RWNA 4YZ3A 3BOWA 1NLRA 4BE3A 4I01A 2D3RA 3VDDB 4Y1XA 3VBHA 4R9BA 2UYBA 5C4WC 5BNQA 1YJLA 1DIWA 3AZWA 2UY9A 4AFBA 3WP5A 4C91A 4COVA 4RR3C 4FQZA 3O14A 3BB6A 1PGW1 1DGWA 2YROA 4WVWA 3KSCA 4LR4A 3ZXFA 1H8VA 2PHRA 4LO7A 4OI2A 5BNOC 1SFYA 2IFRA 2RS11 1LGCA 5KHHA 4AEKA 2C5DA 4I3PA 3VLBB 1OPOA 3NO8A 3VZMA 1REEA 1NXD1 4AQSA 2VGDA 4YZ4A 2BWAA 1HV1A 1OSGA 2PHUA 4BLIA 3C2UA 1FPN3 5K0UB 4J1WA 4Y1YA 5ABJA 2P37A 4Y1VA 2BYVE 4Q0SA 4DY3A 1YIPA 1IKPA 4BZ4A 1FPN1 1GICA 4BHPA 2CYFA 1UN1A 1ULCA 4ATFA 2Q5TA 1SBFA 4HMZA 4LUMA 2VH9A 3VHNA 5FAXA 2GAUA 1ZBA2 5A3LA 3MIFA 3J8F2 2A73B 1C57A 1X7NA 2VW2A 3T1MA 5JAXA 4ORFA 1QMJA 1KJLA 1OQDA 4FVVA 5JIUA 2R16A 3IWZA 1BCXA 4AXOA 4AI8A 1ZBA3 3WDXA 1U0AA 1FV2A 2XWBB 1OD5A 2QUOA 2PA7A 1SACA 1LHUA 1XYNA 2LUWA 3WW3A 1AL22 2YGLA 4UW5A 1WW6A 5C6CA 4TZDA 3ZXJA 1ZBA1 5CFDB 3DL3A 2O8QA 3WINE 1G9AA 4IL7A 3MFCA 1HIXA 4PBPA 1PZ8A 5E88A 5JI7A 3AMQA 1YWKA 4B7KA 1AL23 4OFGA 1XNCA 3WQ0A 1MVQA 4GA9A 1ULEA 1OA3A 1LGBA 5HXVA 1AL21 2Z5WA 2VVDA 1HRV2 2BVBA 5BYNA 3BTAA 3ZDSA 1EPZA 2YYOA 3H50A 4LBNA 1HRI2 4MGIE 5FO7B 3SLIA 2D97A 1W6MB 1X50A 2WS92 4V1PA 3RNSA 1J3QA 1PK6A 1CAVB 2B9UA 1NE6A 3AMNA 4HLTA 4AFAA 4Y1ZA 4ATEA 2ZX2A 1AR62 1V6JA 4CP1A 3WNXA 4E4ZA 1AXZA 4AHXA 4Y22A 2CWMA 1B09A 1HRI3 3MI8A 2WS93 1URXA 4H55A 1GZ9A 4URTA 4B8EA 4CDXC 3TOJA 4NHLA 3E6BA 1RHI2 2HWD2 5KXDA 2WJSA 1SEFA 4KWJA 1G9BA 5I8SA 2K9ZA 3GZTB 1VAVA 3PMEA 3JQXA 4Q1RA 3O0WA 4C0HA 3LA3A 1F9KA 1N47A 4WVMA 2CGNA 2VY0A 1GLHA 1QOSA 3VKMA 3OTFA 2HWD3 1BMV2 4CTEA 1VR3A 5L7OA 4XE9A 4Y20A 4N53C 1KS5A 3RDIA 2ZGTA 1FX5A 2BW8A 3FFQA 3AXEA 3URFA 4MYEA 3SITA 4N9IA 2WQZC 1ULFA 2HWD1 3FMGA 1ZZBA 2BNMA 2WNVC 1GQGA 1Q8VA 1S0CA 3O7OA 2RS32 4B4QA 4QQ2A 3VBFC 3O0XA 2AENA 1XXNA 1LOAA 2XLAA 3M1HA 3M2MA 1VAMA 2BWCA 5KHGA 1S0GA 1ZA4A 2AR6A 2OPKA 1MVEA 3JD73 1AL0G 4LBJA 3BIWE 3RMYA 2R042 1LKNA 1BMV1 4ITCA 3JZVA 2RS33 1YNAA 2C9AA 4BLJA 3VKFC 1NCQB 2BNNA 3AMMA 4YZ2A 1AYM2 2DYCA 2D6MA 4MVTA 3JD71 1JUIA 2Q30A 3H9AA 3B93A 5D8AA 3VV1A 2ZMKA 3ZXAC 3IMNA 4AVVA 3HBZA 3QCWA 2RS31 1F8VA 3AZYA 4DY5A 2A6ZA 1Q56A 4DFSA 4AQ6A 5H9QA 4B4PA 3ZFFB 1DZTA 3OYWA 1Z7S2 2PQQA 1AYM3 5AC92 4CDWB 4XOGA 4LHKA 4JGZA 2EVXA 3PVOA 2HJIA 3RJ2X 1D0GA 1RJ8A 5L19A 2R1BA 2BQPA 4HPKA 3R6SA 1V6NA 2MEV1 5KHJA 3OD4A 1GANA 2D93A 1WGPA 1NCRA 2WINB 1Z7S3 4IERA 4RL7A 1UKGA 4R9CA 3X29B 1D4M2 2ZAHA 1IQAA 2A5ZA 1HW5A 2GH8A 3ASIA 3JB8A 3RMXA 5I93A 3ILNA 3L2HA 4N7UA 1PIV2 3VBSC 3ZYPA 1YIFA 4AEMA 2QQPA 1ND3B 2WA3A 5GLWA 1A8MA 1Z7S1 4Q26A 3M70A 2JG9B 3NWKA 4WZFA 4M3CB 3KZ4C 2DUOA 4GQ7A 4MZUA 1R1ZA 1PIV3 3V0BB 2EF6A 2EXKA 2JXAA 5C8WA 2X5IC 2TEPA 3AK0A 4I2OA 2BEOA 4XYXA 1W6QA 3GBGA 3OBRA 4CEWB 4Q4W3 4LBKA 1GR3A 2XPJA 2IFWA 4XFCA 1PIV1 4PBOA 3RSJA 2HEYF 3TN93 4DRRA 1M4WA 4AVTA 2WT0A 4WV8A 2PLV2 3ATGA 4KU7A 4IEOA 4BM8A 1POV0 5FRAA 4Q4W1 1RUF2 4AF9A 3ZXLA 1CGPA 4MUVA 3RRDA 2VW0A 2WA4A 4NHKA 1B35A 3TN91 2G9GA 1DDLA 3QOPA 4GMP0 4AEDB 1ASJ2 4GH4C 2Z2SB 1C8NA 2OYZA 2PLV3 4XBLA 5FO9B 1DF0A 1GKBA 3VGIA 1RUF3 3NAPC 1TQ5A 1A78A 1H30A 5EJ3A 2DVAA 2RJKA 3W9AA 3POWA 1NA1A 1DFQA 4XW3A 3I59A 2XB6C 1AR82 1O7FA 2RMU2 4K3UA 1ASJ3 3TRSB 3A0KA 4YW3A 5EFUA 1N3PA 1ZBE2 4DQAA 4Q4V3 5I0TA 3EBRA 4QPIA 3H7YA 1CAWB 1IGOA 3ZSKA 1DGRN 2OIIA 1ASJ1 1LOGA 1ZZ7A 1W0PA 1AJOA 2FMYA 2XJPA 1AR83 2RMU3 3POSA 4Q1PA 4DXZA 4EJRA 2ILMA 4Q4V1 5C4WA 3MPPG 3B9IA 1WCKA 1VAKA 5CFCB 4QGLA 4AVCA 5FDBA 4RR3A 3RQ0A 5CADA 3EQEA 4OUMA 1KJRA 2BGCA 1ULDA 1AR81 4P5HA 2A7AA 3AYDA 3B00A 1TE1B 4N43B 3ZYIB 5BNOA 4QMAA 2NLRA 1EV12 1RL3A 1N3OA 1APNA 1RINA 3Q9OA 5A3MA 3ELNA 1SLIA 3AMHA 2X29A 2HWB1 1BEV3 4RD7A 3ZN4A 2AYHA 4JGYC 2A6WA 2GNBA 2ZHMA 3JBG2 2IXJA 3D4KA 3RYKA 3BU7A 1EV13 1BEV1 4OUSA 2GMPA 4OHYA 4OVEA 3ZSJA 5CA6A 4XF1A 1Y3TA 5C8CC 3JBG3 1O91A 4RS5B 3WP6A 2B39A 4DRVA 5H9RA 3ZMNA 2B42B 5HCFA 4M00A 3LAGA 4YGEA 1AZDA 3JBG1 1CAUA 3MIEA 3PVNA 2PTMA 5FCCA 1R091 2DCJA 4P9XA 4DPNA 3WHTA 5GM0A 3EJKA 3KB5A 4D94A 3ZFEB 3C3VA 3M3QA 4XPVA 1I9RA 1WUVA 1QQP2 4O9GA 5JVVA 3A0NA 1W6OA 2SLIA 3CU7A 5LRSA 1ULGA 1ZRFA 5JSRA 1SLAA 3OY8A 3VBOB 2WZR2 4LA3A 4IEZA 2GZWA 2ZGUA 4A7ZA 2R0HA 4GALA 5A32B 3ST7A 1UU4A 4YFWA 3FJSA 1QGLA 1SLBA 3GBWA 1QQP3 4NPRA 5J48A 4Z82A 3ZYJB 1D2QA 1YRZA 1LB2A 1Q8OA 3ECQA 4JRLA 4AVBA 1AF9A 1YO8A 2WZR3 3MW3A 4HETA 1Q8PA 4YM2A 3VDDC 5BNPB 4E9KA 5CU1A 2E53A 1QQP1 1AX0A 2A3WA 2W68A 4LO4B 3B5LB 3AZVA 3B69A 4YVWB 4PLOA 2WZR1 2D44A 2E9QA 1QDOA 4W6WA 4LTAA 5GZDA 1Z78A 1RUOA 3KGZA 4Q8KA 2UURA 1YFXA 3VBHB 2VULA 3MFAA 1ENQA 1RIRA 5JZGC 1BQPA 5LRRA 4CP0A 5EXOA 1UPIA 1N1VA 4YNIA 4P9IA 3FLTA 1X36A 4OLLA 4XIKA 2HWC2 1CPMA 4Y5Z0 1QH7A 3USUB 3KGLA 4IV1C 2V73A 3U10A 4CDXA 4I0WB 1H2KA 3CLPA 2CV6A 1ZZ9A 4AHWA 4HL0A 3LKJA 3APBA 3LOIA 1EYBA 2R32A 4I09A 4ZU4A 2XUMA 4OULA 3K51A 4JDNA 1RUG2 1W39A 1A8DA 3WXPA 1GNZA 2HKXA 2VUAA 4X6QB 5ABJB 2YDEA 3L2YA 2PHLA 2XJRA 3JU9A 5T3NA 2XKPA 3WVJA 1PO12 1O5UA 4N53A 4XJWA 1IS4A 4XEZA 4U2AA 1OA4A 3AP7A 1EPWA 3AKRA 3RS6A 1RVF2 3ZN6B 1VBA2 2NZ9A 2D6LX 2WNVA 1W6PA 2V09A 1S2BA 3VBFA 2BFUL 2XVGA 2CGOA 3U4XA 1G8WA 1WLCA 3E97A 3IN9A 2PELA 3SNMA 2ZCWA 1LOFC 4XFBA 1FV3A 2B45X 2GALA 2FZ1A 4K21A 4NO4A 4Q0UA 3AZZA 5J98B 1RVF3 4E2QA 4Z1VA 2YUEA 1BJQA 1FMD1 3AXDA 1PVC2 2K2SA 5FBZA 4B3NA 3PLQA 1OQEA 1HQWA 4E4DX 5FMOL 1RVF1 3HD8B 4TSVA 3VL9A 3ALQA 1I1EA 2DCZA 4HK9A 3MF9A 2YHJA 3KQRA 5AVAA 1U5ZA 1S0IA 2VVEA 1LHOA 4FTEA 5BUVA 5F9TA 4UW3A 3R4UA 1PVC3 2E7TA 4P9GA 2CL2A 1NY72 2I07B 4FOWA 4Q0VA 4XMAA 1HLCA 3V0AA 3S30A 3VBRC 2CWSA 5F6LB 2KA3A 1HQNA 4G9SB 4CEYB 3FHIB 2XLGA 4QQPA 5DZGA 4HFSA 4JTNA 1PVC1 2WC2A 2Q1ZB 1SBDA 3B9CA 4QPGC 1DLLA 1HKDA 3AKTA 4FPHA 4FSJA 1NOVA 3IBMA 3OF1A 3VBSA 3MPBA 1IPJA 1WA4A 2R1DA 3ZVXA 2WL1A 1LU1A 3OGGA 1QJZA 5D1IA 1PGL2 3NV2A 3I2DA 2JEMA 3P3NA 4LUKA 4FTBA 4GIQA 3L9JT 1KFXL 3MF6A 3VUOA 1R1A3 1LHNA 1VBB2 1ZRRA 2LM3A 1VBC1 4Y22B 4HK8A 2ERFA 2NM1A 4YG0A 3AP6A 2ZGNA 2X5IA 3HMYA 3PHMA 1R1A1 2RHPA 5JMCA 4AGRA 1F31A 1MEC1 2WZPP 2IC1A 1CAXA 5FPZA 4IEQA 4WZCA 1VBB3 1UAIA 1SLTA 1TEIA 3FZ3A 5T5PA 1QJU2 4CDQC 4WVMB 1DHKB 5LK5A 3B01A 4FXGB 4DOUA 1C3HA 4TLFA 4YYOA 1XNBA 1H1MA 4CYDA 2G4IA 5DUUA 1SMVA 4GH4A 3FX3A 1QF3A 1QJU3 2EAKA 3KCXA 4NWVA 1BBT2 3FFZA 5JSOA 1NCQC 3NAPA 2XLFA 3ROUA 1DZRA 3CL1A 3ZN5A 2DTYA 3O12A 4Y24A 4MV2A 5J3UA 4LBMA 2IXCA 1V6OA 1N1SA 2XWJB 1BBT3 5BNNC 1XNKA 2JG8B 2Y0IA 2E51A 4CDWC 1Q3EA 5HCBA 1R082 4IEPA 1X8EA 4MSVA 4E2SA 5J7MA 2RR12 1QJX2 5D8AB 1H1AA 2ZPXA 1AR92 2DVBA 4UW4A 3O0VA 4QD2A 3J4UH 4ZU7A 2VNOA 4AYUA 2WNUC 3J8F3 5JR7B 2TBVA 2DUQA 4Q27A 3WCRA 1R083 2R072 3KMHA 4ES8A 1QJY2 4JGZB 3KT1A 1N3QA 5DZFA 4FBFA 2RR13 1QJX3 1ND3C 4HPKB 3EXUA 4X8NA 1AR93 4MX3A 1XRUA 3UKTA 4JGYA 3J8F1 2ZX3A 3ZYGA 1LENA 3ZPYA 3QBQA 4F7ZA 1R081 1NCRB 4FOVA 5K8SA 3SH5A 1Y9QA 3ES1A 2RR11 1QJX1 2R073 1SLCA 1QJY3 1AR91 5T5OA 1V00A 4PLMA 1AYN2 2DCKA 3VBUC 2HEWF 2CGPA 2OUJA 5KHKA 1PZ7A 2ZZJA 5C8CA 5I0UA 4FOQA 2R071 3H0OA 5EYXA 1UF2C 1QJY1 3N35A 2GNMA 2UWAA 3D8CA 3AJYA 1YFWA 1J3PA 2YC0A 2ET7A 2BFUS 4OI0A 1V9U2 4YZ5A 4R4XA 2RE9A 1LGNA 1PHMA 2ZGMA 1QHDA 1AYN3 3SMHA 4AI1A 3AFKA 4QHBA 3MYXA 1PM7A 1W6QB 5JPNB 3GF6A 5KC6A 4BWOA 4XXAA 3ETQA 2OZ6A 1BZWA 1GZWA 4ZXKA 1PMIA 1AYN1 1V9U3 1HRV3 3AM2A 4XJZA 2B8MA 4IEWA 3UKNA 4YM1A 3DPRC 1AXKA 3VZKA 5I91A 1JYIA 1B35B 1IS5A 1V9U1 2ZX4A 1C1LA 1HRV1 3LWCA 4NOTA 4XILA 2JKBA 1AR63 2EXJA 2ZS6B 1HRI1 4BA6A 4JTOA 5T54A 2DVDA 3MDPA 5FQ0A 2WS91 4NWWA 2ZGOA 4AGGA 2XH6A 4AI3A 4W6YA 4XDQA 2VOKA 1U5IA 1AR61 1RHI3 1QOOA 1NA1B 3VDDA 1RUJ2 1YHFA 3I59B 5KHIA 1N1TA 2DU1A 1XU1A 2N7GA 3RZZA 2DTWA 3H8UA 4B4RA 5C33A 5CFCC 1JXNA 2A3YA 4QPIB 1RHI1 4BPZA 1SDWA 2I74A 4OHZA 4CZSA 1C8M2 3FBMA 3N7LA 3V65A 1GQHA 1C5HA 2ET1A 2GC2A 4MXVA 3JQWA 1QOTA 2Q1MA 2ZGQA 2XJQA 1RUI2 3M3OA 4WM8C 2Y26A 4KQ7A 5C4WB 4DB5A 4PDWC 1ZM1A 2GMMA 5F1RA 5A33B 5JZGA 1WCDJ 1UU6A 2RJLA 1UD1A 2YY1A 4HVOA 1NE4A 3D0SA 2A6VA 3KLSA 4HBNA 2BBVA 4AFMA 4LO5B 4RQPC 3ZXEA 3W59A 5BNOB 2W08A 3T1LA 2UY8A 4R9AA 1COV2 5IK5A 1G86A 1O5LA 4OZXA 4L97A 4IV1A 2FMDA 3I54A 1TME2 3UKVA 3D0JA 1OOPB 2R043 4RS5C 1GSLA 2ENRA 4B29A 1OHFA 1DU3D 5L73A 2ZGLA 2ARBA 2E7AA 3FUOA 5L36A 4KL1A 1COV3 4MLOA 4Q8LA 2E63A 3B02A 3QD6A 1YI7A 2EIGA 5C9AC 2R041 2YGMA 2VUJA 1NQDA 1TME3 1O4ZA 2VMHA 1AUYA 1TNFA 3S6PA 3J26N 1AYM1 1LEDA 3AYCA 4LEJA 3ZSEA 5JIAA 3FLPA 5AC93 1FNYA 1HQLA 3I8TA 1GYKA 1XE7A 3AYEA 3POYA 4FT8A 4IV3C 4LO8A 4GB32 5I8TA 4OI1A 4JDMA 5J96B 2JJ6A 4BH9A 3VBOC 4ASMB 4JDOA 4O9EA 2PFWA 5AC91 3ES4A 1MZFA 1LOFA 3ZXDA 5AVPA 1RITA 2C1FA 2WLQA 3ILRA 3MIHA 1RMU2 4PQ9A 1D4M3 3WUDA 3AKSA 5K9YA 4GB33 2IZWA 1W6OB 4R52A 3WQ1A 2QFEA 3WP3A 2D6KA 3OY8B 4Q2FA 1MZ5A 1K5MC 1ND2C 2R062 1D4M1 2WNEA 3RJRA 4F8AA 3LGRA 4YRDA 2PYTA 3MLKA 1RMU3 4QQLA 3WDWA 3ZIWA 3WY6A 2DVGA 1H8TC 2XL7A 3W58A 4COWA 1VLNA 4W6XA 1VB2A 1JN2P 2XJTA 4XF9A 5J09A 4Q4X2 1Y43B 3S7IA 3H1MA 5JI9A 1RMU1 1ZRDA 4K6BA 2AZ5A 3VBRA 1W6NA 4KBBA 2XL9A 1JYCA 2ZABA 1UPSA 1MS1A 1U12A 1FOD2 4QPGA 1IHMA 4M01A 3LA2A 4ZKTB 4BYYA 1YUDA 1RUNA 4D69A 4F83A 5J36A 2NN8A 3GHMA 4FO9A 2PLV1 1VB4A 5GLVA 3ZXKA 2QNKA 1H2MA 1OI6A 4K1YA 4P9YA 3UJQA 1RUF1 4PIZA 3H3UA 2ARXA 2QCSB 4MGKE 1UZZA 2QKDA 4COZA 3ZFGC 1G7YA 1FOD3 4IQPA 4META 4NN0A 5DUWA 1OKQA 2ZHLA 2ZX1A 2ZTNA 4AVSA 4XHBA 2NYYA 3AKQA 3V64A 5LK7B 3NW4A 2D6OX 2ES3A 2ZX0A 1FATA 4WM7C 1JW6A 1FOD1 1QDCA 1ZBE3 3KS7A 1I5ZA 3BODA 4WVVA 4YVSC 1WCSA 3OGJA 4A7KA 1LJ7A 1MQTC 3WG4A 1ZX5A 1UX6A 2YZ4A 2RMU1 5T5JA 4CDQA 2YV8A