5BNOC

Crystal structure of human enterovirus d68 in complex with 6'sln
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Sialic acid-dependent cell entry of human enterovirus D68.
pubmed doi rcsb
total genus 41
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bnoC00
4QPGB 4WM8A 5GKAC 4GB32 5A33B 5C4WB 2RS11 5C8CC 4YVWB 5ACA1 1BEV2 1RUD3 2WFF3 2R071 4QPGC 1VBB1 3DPRA 5C4WC 3LOBA 1VBD2 2FZ1A 2MEV1 2RS51 4RS5C 3VBHA 4IV3C 1NG0A 4YVSA 2HWB2 5J96B 1HXS3 4CDXC 1AYN1 2XPJA 4Q4V2 5A32A 1NCQA 1AL21 1VRH2 1FPN3 3VDDB 1OOPA 1QJY1 3ZFEA 2ZTNA 1FPN2 3JBG2 1HRI3 4RR3B 2Y26A 5J98B 2X5IB 4Q4Y3 3VBRA 5BNNB 1TMF2 2R041 1RUJ1 1NA1B 1FOD1 4RR3C 3JB8A 1RUE2 4AEDB 3HAGA 1ND3C 5CFDC 4N43A 1ZBA3 1Z7S1 1RUG3 2HWE2 1VBA3 1ZBA2 1AYM3 4Z92B 1AUYA 4AEDC 1PGW1 1QJU2 1AR73 2HWD3 1DDLA 1PIV3 2WS92 2RS31 3ZXAC 1AR93 4LLFA 5AC92 1EAH3 1RUH2 5BNOB 1AR92 1QJX3 4Y5Z0 1EAH2 4Q4X1 1COV3 1RHI3 1RUI1 3TN92 1ND3A 1B35A 5BNOC 3VBOA 1VBC1 2RR13 5K0UC 5C9AB 2RS52 4IV1B 1ND2A 5FMOL 4CDUB 2HWC1 1QQP3 1NOVA 1MQTC 4N53C 4IV1C 1EV11 1ASJ3 1FMD1 2WLPA 1K5MC 3VBSB 1AR83 2XBO3 3JD72 3VBSC 4PDWC 4FTBA 2WFF1 2R062 3J8F3 4RQPB 1R093 1PO13 1AR63 2QQPA 2FZ2A 4JGZA 1FOD2 1PO12 1MQTA 3M8LA 4GMP0 3JB4C 4RQPC 4Q4W3 1ZBE1 3ZFFC 4FTEA 1HXS1 2HWF3 5L7OC 5D8AB 1PGW2 1NY71 1VBE1 3CJIB 1BMV1 4PDWA 5DDJ3 4EJRA 1HRI1 2RM21 5D8AC 1C8NA 4JGYA 5JZGA 3CJIC 4GMP3 4RHV2 4GB33 1X33A 1BBT1 1F8VA 1BEV3 4CEYC 1RUF1 3ZFFA 1RVF2 2RMU2 2DF7A 1CJDA 5FMOS 4CEWA 1SMVA 1VBD3 3VBUA 5ABJB 3VBFA 1R1A1 1RMU1 4YVWC 1RUG1 1HX6A 1VBA1 4BCUA 1AYM1 2HWB3 5A32B 1AR71 4CDWA 1HQNA 2HWD1 2BFUL 1POV3 5ABJC 1R082 3ZFEB 1NCRB 4Q4V3 1V9U1 1X36A 4GH4B 4CDQB 1VRH3 1C8M1 1TME1 1HRV1 1QJX1 4QPIB 5C8CA 2BPA2 3JBG3 3NAPB 1NCRC 4GH4C 2PLV3 4QPGA 1VAKA 1TMF3 4QPIC 5C4WA 2PLV2 2RR11 1PO22 4RS5A 3VDDC 3NAPC 4IV3A 1RUE3 3ZFGB 1ZBE2 4WM7B 2X5IC 5BNNC 4CDXA 2HWE3 1ASJ1 1NA1C 2BUKA 1NY72 1VBE2 3ZFGC 1QJU3 1AR81 1MEC1 1RUC1 1PGL2 2XBO1 2WS93 2RM22 5AC93 1RUH3 3VDDA 1H8TB 3FBMA 5CFCB 3J8F1 1R091 4RR3A 3TN93 2RS12 1RUF2 5ACA2 5CFDA 2R072 5CFCC 1VBB2 2MEV3 2RS53 1R1A2 1RMU2 2MEV2 4AEDA 2BFUS 1D4M1 2HWF1 5C9AC 5DDJ1 4RFT0 1V9U2 1AYN2 2WZR1 5BNPB 4CDUC 1PVC1 1AL22 1OPOA 4GMP1 3JD73 1QJY2 5BNOA 4JGZB 5K0UA 5BNPC 2R063 1RUD1 1FOD3 2R042 1RUJ2 5C9AA 4N53A 1WCDJ 4IV1A 2HWB1 1QJZA 1K5MA 1CD3G 1Z7S2 4Q4V1 1RUC2 2GH8A 2ZAHA 3VBSA 1FPN1 3JBG1 2RS32 4WM8B 1TMF1 4RHV3 4Q4Y1 1POV0 4Q4X2 4WM8C 1RUI2 1VB4A 3DPRB 4RQPA 1RVF3 2RMU3 1VBC2 1E57A 3VBHB 4CDWB 5L7OA 3DPRC 4YVSB 1OHFA 1D4M2 2HWE1 1ZBA1 4FTSA 2HWC2 1QJU1 1FMD3 3VBHC 1NCQB 2WS91 5D8AA 1R083 1W39A 4YVSC 1EV12 2WZR2 1FMD2 1PIV1 3IDEA 1OOPB 5AC91 3CJIA 1RUH1 1PVC2 3S6PA 1AR91 1EAH1 1NCQC 3VBRB 4CEYA 1AL0G 4RS5B 3TN91 1OOPC 3ZFEC 1COV1 1RHI1 4IV3B 1RUD2 4CDQC 2WFF2 1PO23 5A33A 3VBRC 1A6CA 5FOJB 4YVWA 4CDXB 4N43B 1ZBE3 1VB2A 5ABJA 1QQP1 4N43C 1VBE3 1HXS2 4WM7C 1BMV2 1NCRA 4GH4A 3JD71 2RM23 4CDQA 1RB8G 4QPIA 1HRI2 2R061 1BBT3 1ND3B 3NAPA 4Q4Y2 5CFDB 1B35B 3VBOB 1BBT2 2RS13 2IZWA 1RUF3 5ACA3 1PO11 1AR61 2X5IA 1IHMA 4NWVA 5BNNA 2R073 1VBB3 1H8TC 1B35C 1ND2B 3VBOC 1NA1A 1R1A3 1RMU3 2TBVA 4Q4W1 3ZFGA 4WM7A 1RUG2 1VBA2 1AYM2 1ND2C 1AR72 2HWD2 2ZZQA 1F2NA 1PIV2 1V9U3 1AYN3 2BBVA 4FSJA 5LK7B 1C8M3 1TME3 1HRV3 5K0UB 1AL23 1C8M2 1TME2 1HRV2 1QJX2 4RHV1 1QJY3 2WWSA 1H8TA 4GB31 1COV2 1RHI2 5CFCA 1BEV1 1M06G 1RVF1 2RMU1 1MQTB 4N53B 2RR12 2R043 1RUJ3 1K5MB 1VBD1 4JGZC 1QQP2 1Z7S3 1R081 1ASJ2 1POV1 4PDWB 1MEC3 1RUC3 4CDUA 1AR82 1MEC2 1VRH1 2XBO2 2RS33 4JGYB 5JZGB 5BNPA 2PLV1 4SBVA 1PO21 4Q4X3 4JGYC 3J8F2 5JZGC 3ZFFB 1R092 1RUI3 2VQ0A 1AR62 5L7OB 4CEWB 3VBUB 1VBC3 3VBFB 4Y4YA 1RUE1 4Q4W2 1D4M3 2GSYA 3VBUC 4CEWC 1GFF2 2HWC3 2HWF2 3VBFC 1PGL1 1EV13 2WZR3 4CEYB 4CDWC 5DDJ2 5C8CB 4NWWA 1PVC3
chains in the Genus database with same CATH superfamily
3N9MA 3IIIA 2BDRA 5K9YA 1CX1A 3THPA 3F95A 4TLFA 3WP5A 4GB32 1XNAA 1QXJA 4LOSA 2ZX1A 1SCSA 1XSQA 3H7YA 4YVWB 1LJ7A 5I91A 2LALA 1TVGA 3AX4A 3CLPA 3OJBA 5JPMB 5D2AA 5F1RA 4QM8A 5C4WC 3C7HA 4TYSA 1GNHA 1SHWB 1ZZBA 2ZACA 2ZGPA 4CU7A 1ACCA 2OQ7A 1WBFA 4HG6B 3ZN6B 1W8NA 3KV5A 2RDQA 1XXNA 1Q8SA 4YVSA 2HWB2 1MS0A 2WT1A 2X8KA 4MXVA 1YRZA 4UW5A 2J1VA 3X29B 1NCQA 5BV6A 3PUAA 4LTAA 2EIBA 4Y1ZA 2FCVA 2VZUA 2EXHA 3VDDB 3WLUA 4MADA 1QJY1 2JX9A 3KF3A 3AMHA 1HRI3 3ZXJA 3RWKX 4D0QA 1JMUB 2I45A 2Y26A 5J98B 3AFGA 3KGZA 4FFHA 1TMF2 4CTEA 1DGWA 5KR7A 3S0MA 2R041 5GZCA 1NA1B 4BQ1A 3C7EA 1BVVA 2WA3A 4YZ4A 2Q5TA 5HCAA 5LWBA 5I0DA 1JYWA 1GZCA 2JENA 3O1TA 4K8RB 1RUE2 4AEDB 3GALA 1ND3C 4N43A 2JB4A 2XJSA 4BXSV 5J37A 1Z7S1 3OUIA 4W8JA 4CCJA 1AYM3 5ISLA 4Z92B 1AUYA 2YXSA 2WT0A 3ZDVA 1QJU2 3IKWA 2D5HA 4P5YA 4R4ZA 2NQYA 1XYPA 4XMIA 4QB6A 3BCWA 4Y20A 3I3QA 2WS92 2RS31 1BJQA 3RZHA 1AR93 3LGRA 5FYSA 3RJRA 3N9QA 3IDBB 1AR92 1HQLA 2Y33A 4QHBA 4JX0A 5A3WA 4RSUA 3ZDSA 2BGCA 3AM2A 4ATFA 4RL7A 1JUIA 1Q8QA 1XU1A 3INAA 4LBQB 1COV3 3ASIA 3ZYBA 4QGNA 4ZS3A 4EZ4A 4AL9A 3NJYA 3WINE 1AZDA 4UBGA 2DCZA 4XJUA 4F3JA 4MGKE 3PMEA 2QQMA 2RR13 5A7OA 2CGOA 4R9AA 4B29A 3N7KA 1RITA 2QDRA 2D5FA 3MF9A 2ZHNA 4GALA 3NKGA 1DGWX 2ZKLA 4IE0A 2VMDA 4AVAA 2HWC1 4XC9A 4C8DA 3TB0A 4E4SA 4URAA 1E5IA 4K9SA 1F35A 3S5QA 1ASJ3 4DY3A 4J1WA 1ENQA 4MSVA 4AI2A 4XACA 2XBO3 3RFRA 4FPKA 3WV6A 1H8VA 1VIWB 3POEA 1C1LA 3OGRA 2Q30A 5FZFA 5FPAA 5FZAA 4CXWA 5FK7A 3POIA 1GLHA 2CDOA 4L92A 5F3GA 3WEZA 4FTBA 2ENRA 3GBWA 2QQPA 2Y34A 1GYKA 3I54A 1PVXA 1V6KA 3CF6E 3R4DB 1MQTA 3M8LA 1H9WA 1Q8VA 2YC0A 5DUVA 5IFPA 1YWKA 3M7AA 4QXBA 2G19A 1OQDA 5ANQA 1AVBA 1G9FA 1Q5OA 1CIYA 5A7NA 4XCBA 1OF4A 4BHPA 3AXDA 1HXS1 4NRQA 1JHJA 4JDMA 5A3MA 5L7OC 5D8AB 2JIGA 5LRSA 5FZOB 2ZGQA 4D6QA 1HJGA 3CJIB 4A3XA 2ZHMA 4U2AA 3I59B 2WNUB 1UYPA 4PDWA 3WDTA 3I2OA 3N7MA 2QZ3A 2WKKA 3MW3A 3NRUA 2WA4A 2AUYA 3WQBA 2RM21 1O91A 1LENA 3W5NA 4TN7A 5DAPA 5FZKA 2GNBA 4HMZA 5JZGA 2VMFA 1S0FA 1VMFA 2G1MA 1IOAA 3PUSA 4B4PA 3BVCA 1X33A 3FMGA 4LT5A 1BBT1 4UFJA 4RA0A 3HNYM 2PHLA 3UYJA 2DVDA 2ZHLA 4N9HA 4LBOA 5CVRA 3WG3A 2VBDA 1JZ5A 5FYTA 1WZXA 1D4VB 1WLDA 2QE3A 2DYCA 2QQIA 2RMU2 4XHXA 3WD5A 4HVQA 2DF7A 3WNLA 5FMOS 3S5AA 3A21A 3AKSA 1JU4A 3VBUA 1VBD3 5FO7B 5E6HA 5JIAA 3WF1A 2A1XA 5J3UA 5ABJB 4XDQA 5FYUA 4IE6A 2UY8A 1HX6A 1UMZA 1VBA1 2JWPA 3BTAA 3Q8AA 4HVRA 2OS2A 4BCUA 3T0DA 2OKXA 3W58A 1W2AX 1W06A 1HQNA 1DYPA 1UY4A 3L2YA 5F5IA 2DFCA 4OQ9A 4LIUA 4NHMA 2X53S 1X9PA 1R082 5JXHA 2B4KA 4Q0UA 3U4XA 1O4TA 1NXD1 1TEIA 3A4UA 4CDQB 5F6LB 2JE9A 2YBPA 3O1PA 1HRV1 4QPIB 4FOWA 1BHGA 3FFZA 3GYDA 2K0GA 1E5SA 2VMGA 4YW1A 5DZEA 1TG7A 1UW8A 2JDKA 1QWRA 2D6MA 1STMA 2PLV3 2ZZJA 4UW4A 1W99A 4LOTA 4MGIE 3PHMA 2PLV2 1BLZA 5D21A 3BTXA 2ADDA 3OCPA 4RS5A 3NAPC 4JHZA 3ILNA 2B9UA 2CAVA 4TXWA 3ZR5A 2IXKA 2W95A 1XNBA 1BCXA 2JG9C 2EAAA 4XF0A 3IPVB 4IV3A 3RYKA 1V70A 3E97A 2HEYF 1LGCA 4HN1A 4EN9B 1WBLA 4HANA 1W6PB 3ZYJB 3H8OA 3EO6A 4CDXA 4HT1T 1MS4A 2N7GA 3L2HA 3PL0A 4JTNA 2RDNA 2SBAA 2HWE3 2RHPA 2WYFA 2BUKA 4XABA 4Z8BA 1K5JA 2BTVC 2ZGUA 1RUC1 2Q0AA 1GWKA 1OQEA 3ACGA 3HQXA 4YWAA 4LBKA 2VOTA 4PI0A 2ARBA 3CKHA 2LROA 2RM22 2OIIA 1HV0A 1H2LA 2IUWA 4GKXA 3JU9A 1J3QA 3VDDA 1MZFA 2DDUA 4XF3A 3WT3A 3DL3A 2C1FA 2VNRA 2VY0A 4GA9A 4YG3A 3J8F1 1E5RA 2RS12 1SDDB 1WD3A 3VZJA 5ACA2 1JYIA 5B4NA 3CZJA 5CFDA 1K45A 4OZXA 4XXAA 5CFCC 3K48A 2WYSA 1VBB2 3OPZA 1JZ7A 3JZVA 1YI9A 4K6BA 4YW5A 3AJZA 3AYEA 4KWLA 3GGLA 2E7QA 3H8UA 4ISQA 3I97A 4AEDA 3CEWA 4BH9A 2NP0A 1D4M1 2HWF1 2CWSA 3FL7A 3B94A 2YFZA 3U07A 5EYXA 5BY5A 2GN7A 4Y33A 3B9IA 1XC6A 4XBQA 4YGBA 4JKMA 3R6SA 4BDVB 1GP6A 2P5BA 4LO7A 5KC5A 4XBNA 4CXYA 4I0AA 1AL22 4LJHA 4LORA 3MGUA 1HQWA 4HPKB 2P6HA 2C6SA 1CAVB 1J1LA 3GJAA 4JGZB 1S4CA 2EXJA 5K0UA 5CA6A 5BNPC 3CIHA 2YC4A 5F8PA 5C5UA 3C7OA 3LOBA 4D6RA 2E63A 4XFIA 5AFBA 3RI9A 1D7PM 3ACLA 2VJXA 2WFPA 2LUWA 2P4EA 4Z82A 3MFAA 4R4XA 4OMDA 4LO4B 2DUQA 2BJSA 2WNOA 3T0BA 2D93A 1CD3G 1XOYA 4MHRA 3RZLA 3CO2A 4OI2A 3EQEA 4NJ4A 4Q4V1 3QCWA 3IWZA 1RUC2 2XXZA 2MHFA 2PAKA 1NLQA 1Y43B 3GHNA 2E33A 3GZUC 1FPN1 2VW1A 4O9GA 1LEMA 4INDA 2Y6FA 5IVVA 4LITA 5T52A 2Y6KA 4NPMA 1V0AA 4CUGA 2VCMA 2YC2A 1AX1A 1O4YA 2NN8A 2PTMA 2BNOA 1W2TA 4AI3A 1OBNA 1FV3A 1RUI2 2AACA 1TQ5A 1OXCA 2ZAAA 2BNMA 3KQ4B 3LZZA 2GN3A 1YJKA 4LKDA 5L73A 1VBC2 4ZU7A 3I2GA 1G7YA 2A75A 1YCIA 2HBUA 3KV6A 2WLQA 3QACA 4DMIA 1OH3A 5FUPA 2XWBB 2OZJA 1D4M2 1SLBA 1ZBA1 3O12A 4G4FA 4LKSA 1H9PA 5E88A 3DUIA 3BALA 3FUOA 3D0JA 1POQA 1YQ2A 5DZFA 2OYZA 5BYNA 2YV8A 5JAXA 1CZVA 5KHKA 1DF0A 5D8AA 1C3HA 4YVSC 4YZ2A 4XETA 5LY1A 2P34A 5F32A 1LAJA 1QY4A 1YFWA 3CJIA 3I59A 2WNUA 2XLFA 3KD4A 5K8SA 4A41A 1EAH1 5FAXA 5FYHA 1NCQC 4CEYA 1LHWA 1AL0G 3FLRA 4EZHA 2WINB 2PHDA 2A70A 4W65A 4Z1VA 1LU2A 1W0OA 4QKDA 1GOFA 3CZUA 2D6KA 1WD4A 2WFF2 2EIEA 3SKJE 4LBLA 5A33A 1XSRA 1LOGA 1A6CA 5FOJB 3MDPA 3R4UA 3H8XA 2ZX3A 2VBPA 1UIKA 3H1WA 1PHMA 1UPSA 5A6YA 1OLQA 3HT2A 3U1XA 4NIAA 5AVPA 1QH6A 1IG0A 1VB2A 5ABJA 5FV3A 2W94A 3WF0A 2Y6LA 3LIGA 1S0DA 3FN9A 4RFRB 1JOJA 3N7LA 4N43C 1VBE3 1CGPA 4COVA 2IFRA 2EIDA 3MHZA 3VUOA 1NZIA 5CG9A 5EJ3A 3JD71 4CDQA 5HXMA 2AEYA 2W0XA 1K12A 3D3AA 1GV9A 4JKKA 4QPIA 1VPHA 2PMWB 3AK0A 4R8HA 1OH4A 2Z5WA 4JAAA 1F15A 1B35B 4A7ZA 4KGQA 4OFGA 1CZTA 3KT1A 2GDFA 1PO11 1AR61 4OI4A 2X29A 1W04A 2UY9A 3VHPA 4BPZA 1IHMA 2I07B 1LOAA 5CIRA 4ZXKA 4HSLA 1ZRDA 4PJYA 4XDOA 4ZU4A 3MPPG 4NIHA 1J1TA 1R1A3 3IPVA 3OGGA 5K7PA 4Q4W1 4PBPA 3UL2A 3LEIA 3APBA 3ITQA 4Y5TA 4K20A 2ZGTA 2CSGA 4LHLA 4FQ4A 1NLSA 4DPNA 2CTVA 2UWCA 3DYPA 4KG8A 5FOBB 1AR72 4IEPA 1DQ1A 2D97A 3RGBA 2HWD2 5CEHA 4YM1A 5A3LA 3G6JB 2BZDA 4XFGA 4FSJA 1A34A 1C8M3 1WLCA 3LKJA 4RN5A 4I3PA 4QU1A 4LHNA 4FBFA 1SFPA 1C8M2 4IGOA 4Z2WA 1A78A 4LE4A 1OSGA 3GNEA 4CCLA 1W2UA 4C1XA 5GJ6A 1L7RA 3OPTA 4DUWA 4OUEA 1BEV1 1A3KA 3N35A 4IEXA 3NSTA 2WN2A 3HEIA 2JECA 4XFHA 1RUJ3 3VZOA 4IEQA 1K5MB 4OYUA 5IVEA 2J1RA 2WDBA 3AP5A 3LPFA 1D2QA 1DQ0A 4PLMA 4DIQA 2ES3A 4AFAA 1EPWA 1IS4A 1DFQA 3U14A 1GWLA 1UYYA 3B00A 3LQCA 5HV4A 1SDWA 3SQOA 4UW3A 3CNAA 1POV1 2YDEA 4HXCA 4AVVA 5FXWA 5FPBA 4YNIA 5F5CA 4WV8A 3J4UH 4E2GA 1VRH1 4P9IA 1AXKA 4FP2A 5FMDA 3ORJA 5T3NA 1GOGA 2GU9A 4LPLA 5GZFA 4FXGB 5FO8B 4NO4A 1H1MA 1U5YA 4HPKA 4E4HA 1C5HA 1AXYA 1CAVA 5FLJA 5FPZA 1PO21 4L8QA 1H30A 4Q4X3 5JZGC 3ZFFB 1H4GA 1R092 2VQ0A 1AR62 1QH7A 1XBFA 2J1AA 2JKXA 3H3UA 2XJQA 5I0RA 5KBFA 1TZOA 3EHKA 3VBFB 4LBQD 2LM3A 4O7XA 1ST8A 1OLME 5FMCA 4Q4W2 1W3XA 1KDMA 1MPXA 2RDRA 2ILMA 2VZOA 5FYZA 1ENSA 5IUQA 3VBUC 2NYYA 3RZKA 3DYOA 4ES9A 5IK8A 2JIJA 3HN1A 3PU8A 3ZVXA 2OUHA 5APAA 4OUMA 2D3SA 3S57A 2C9KA 3H3LA 1EV13 2GALA 2LTNA 3UGGA 4DXRA 3P5BA 3BIWE 4XFFA 5DDJ2 5F5AA 5C8CB 4NWWA 3OEAA 2GMPA 1QU0A 4XUOA 1JBCA 2YPJA 2WR9A 1UXZA 1CX4A 4GZ9A 4QGMA 3KQRA 2VAUA 4MZUA 3AYCA 1BEV2 2J1EA 3VGIA 4NRMA 5FWJA 3PJYA 5FBZA 5BXXA 1X50A 2A6XA 2R071 3SXWA 3J7HA 3ZMOA 3VLBB 4K40A 3HQRA 4NE9A 1F9KA 2XVKA 3NJVA 3OGSA 4Q0VA 3ABZA 4AEJA 3ALQA 2RS51 3IZOA 4XJWA 2PFWA 4BISA 4RS5C 3NKTA 1U0AA 4B1MA 4XQDA 2TUNA 3FLTA 4Y1UA 3PUQA 3WF4A 1MZEA 3O0XA 3KM5A 3Q8BA 3HBZA 1NG0A 4IV3C 3WY6A 3WDVA 1G9BA 3U0ZA 2DVGA 3OG2A 3VV1A 3GBGA 4AEMA 2XMLA 5J96B 3O1SA 1KRIA 4CDXC 3DKQA 1AYN1 4YG0A 3IDCB 2WNVA 3GHMA 4LEJA 5CAZA 2VMIA 3THTA 2ZBJA 1VRH2 1OA2A 3MPBA 3KVBA 3RJ2X 2EXKA 3VD3A 5JXGA 1BYHA 4H3WA 5LZ6A 1L7LA 2DFBA 2VZ3A 3ACHA 3JBG2 2V09A 1REEA 2H6BA 2QJVA 2F17A 4D69A 3IM0A 4RR3B 5F5QA 3WR0A 2X5IB 5BNNB 3TEYA 3AZXA 3AKQA 1UQXA 1NUKA 2NM1A 4AGGA 3ZM8A 4V2WA 5C7GA 1UN1A 1ULFA 1UOFA 1ZVFA 1FOD1 1H2NA 4BQYA 1XE7A 2XJUA 1UXXX 1GMMA 2H6CA 4AZZA 1R64A 3UGHA 5CFDC 3B5LB 2O8QA 1FATA 3T1MA 2RJ2A 5FCCA 1XNTA 4QHOA 1DCSA 2JDYA 1RUG3 2I2SA 4CUCA 2A71A 1W2NA 2HKXA 4ZY9A 1T6BX 4AEDC 4FFGA 4CUBA 2DUOA 4NIIA 3HN3A 4Q29A 1LOFA 5D1IA 1O3RA 3ZXAC 3PIGA 2GNMA 3A0NA 3WQ7A 3GM8A 4LLFA 4W6YA 4XF1A 4UFHA 5AC92 1W6MB 1RUH2 1O5UA 3OYWA 4TTGA 1CWPA 1QJX3 3PVBB 3D4KA 2VVDA 1EPZA 3K4DA 4ARYA 1S0BA 1J3RA 4LA3A 5HPOA 1UL9A 2UYBA 4WVVA 4DOUA 1G8WA 4QX2A 4YZ3A 3ZN4A 5DUUA 3TN92 2VNGA 3MZHA 3WQ1A 1B35A 1SEFA 1TNRA 3SH5A 4GWNA 1U5IA 2PHUA 3N9OA 2HLEA 2BYVE 3Q8CA 5K0UC 5FZEA 5A6QA 1JTZX 3O1OA 2RS52 2WWUA 2ZEYA 5H9SA 4IV1B 1H6XA 3WNNA 3FHAA 4CDUB 1X9TA 1QNYA 1QQP3 2DBIA 1NOVA 4HLTA 4QX7A 5KXDA 1CAWB 1CPMA 1YFXA 4XMAA 2JJ6A 3VBSB 3LE0A 5JSRA 5LBFA 1AR83 1PX4A 4IEWA 4QGLA 4AF9A 5LEJA 2W9XA 3N3HA 3MFCA 1WCUA 3VHRA 3O0VA 4YM2A 2XQRA 1FYUA 4ISRA 3R05A 4BLIA 4UF0A 3EB7A 2QQVA 3R4SA 2R062 5F39A 2P37A 2DBNA 1XRUA 1HB1A 4XJ8A 5FREA 3NJZA 1FOD2 3BPSA 2BW8A 2XL7A 1DZRA 1RYYA 1S0JA 2ZEWA 3N9NA 4I0WB 4K7JA 3T30A 3ZYGA 4CU8A 1JYTA 1BK0A 2WO2A 4YGCA 5F3EA 3KCXA 1KJRA 1W90A 3AB0A 5FLHA 3SNMA 1US3A 3I49A 1J84A 1QKQA 1ZBE1 1N3QA 1XNKA 2VXRA 3I8TA 1HJFA 1VE0A 1PK6A 4MLOA 4NPLA 3LFIA 1O3TA 1WWYA 2FDFA 2VZPA 4QDQA 4Y5SA 4B4QA 2ADEA 1YHFA 2O14A 2VVFA 1CJPA 1BMV1 2OXBA 4BXFA 1SCRA 4XAAA 1VP6A 3S30A 3MEPA 1HRI1 1SPPA 5D8AC 2W1SA 4KQ7A 1C8NA 3VKLA 1KITA 3CJIC 4ES8A 3M2MA 2BWAA 4GMP3 4KWJA 4GB33 4L0PA 4RHV2 5FZBA 3U75A 1OA4A 5C70A 1F8VA 1T6GC 4CEYC 1AXZA 1DGLA 1UMIA 2JDAA 1NE4A 3ZFFA 1REFA 1RVF2 2VZQA 4YW3A 4K8FA 4BQXA 1SMVA 3IIAA 3PUIA 2AGSA 4N9IA 4UFKA 4PF5A 3VBFA 4MOAA 1OVPA 1RMU1 3RG0A 5GLZA 4QX5A 1AYM1 4X6RB 2VCAA 2HWB3 5A32B 4CDWA 3NNGA 3ZN5A 3MI8A 2ARAA 3K4ZA 4KL1A 5ABJC 2WQZC 3ZFEB 4R9CA 1NCRB 3J7MA 3ZSMA 1V9U1 4GH4B 3LAGA 3FC0A 1WW4A 3ZO0B 2VOVA 2BEOA 3VD5A 4BZ4A 5C8CA 2QCSB 1W8ZA 2VUAA 5I0UA 1W8UA 3VZLA 2E6VA 4ZONA 4M3CB 3B01A 4I3GA 3USSA 3VB9A 5FZ3A 4FPYA 3I2KA 3AMMA 1TMF3 4QPIC 3D6EA 2RR11 4DFSA 2ET1A 4AHXA 2ID4A 5FZ6A 1OLRA 2FDKA 5F6KA 2WZPP 3PVOA 4LBJA 1JOBA 1CR7A 5KHGA 1ULCA 1W9WA 2G9GA 1RUE3 3BUCA 3ZFGB 1HLCA 2QVSB 4G3YC 1ZBE2 4WM7B 3VZMA 2ARXA 5JXJA 2KM2A 3GBFA 2A3WA 2QKDA 4XUTA 1ASJ1 1DU3D 3DCQA 3K51A 2NMOA 4ZS2A 1GQHA 3UKVA 1QJU3 4FPHA 4OMCA 2KXLA 3WUDA 3WNPA 4YARA 2FQPA 2QQLA 2WS93 1RC6A 2XBO1 1ZZ9A 3S7EA 4CZSA 1GP5A 5FBJA 3HNMA 4CVUA 3WOGA 3HNBM 2J1UA 2O0OA 3BI3A 3AP4A 1H8TB 3I2DA 3FBMA 1A8DA 2OT7A 2A3XA 2VOWA 2ORXA 2QQWA 4JV4A 4AHWA 2CV6A 3NJXA 4RR3A 3I2IA 3RQ0A 1ZZ7A 1B09A 3POBA 5F7UA 2ZKNA 1SBEA 4CP9A 1J3PA 2W87A 3KLSA 1OT5A 2E9QA 4A45A 2VTXA 4Q0SA 2FD8A 4Q1RA 1RMU2 2E32A 3P6BA 3H8RA 2Q1FA 1W9YA 2BFUS 3CHXA 1IQDC 1UMHA 2ZMKA 4CP1A 1UX7A 1VLNA 2W92A 2Z79A 4YW4A 3CBNA 5FLIA 5C9AC 2YB7A 4YW2A 2W1QA 2WN3A 4B3NA 3ZSEA 3FX3A 3ILRA 3RMYA 1V9U2 1WW7A 5C3QA 4NN0A 3V64A 1VR3A 3E5XA 1V6NA 1S2BA 2P6CA 1IS6A 2BVBA 1PVC1 3G7DA 3PVNA 1XE8A 1HB3A 2JE8A 1QJY2 1W6MA 5LB6A 3L9JT 3QH7A 3LCPA 3U11A 2FDGA 3RS6A 5FY5A 1ZYBA 4DINB 5FYBA 1RUD1 3BU0A 1LKNA 4IQPA 1Q56A 2R042 4QPYA 5C8WA 3MO4A 1SLCA 1UY2A 2GP3A 1MS9A 3D82A 4XE9A 1AHSA 4N53A 3SCHA 2WQ4A 4IV1A 1Y9GA 3PMSA 1QJZA 1CAUB 4PQQA 4CCCA 4CU9A 4YW6A 1Z7S2 2AZ5A 4K1YA 3RYRA 4AEKA 3VD4A 3OBRA 4Q1PA 1KEXA 4V1PA 4DXSA 1KS5A 1ZRIA 3IAQA 3D5OA 3Q9OA 4MGQA 3VBSA 2RS32 4XTPA 4BMEA 3NL1A 2DU0A 3LPGA 1UZ0A 4P9YA 3RI8A 3V0BB 3UESA 4Q4Y1 1WMEA 1POV0 4BA6A 3IN9A 5A80A 4U36A 2AEZA 3RYPA 5LA2A 1S1AA 1VB4A 1QXPA 3DPRB 5L9BA 4F7ZA 3ZPOA 2A3YA 2RMU3 3DECA 5A1FA 5L36A 4ASMB 4ZKTB 5FXXA 1XU2A 3C2UA 2VOXA 3VBHB 3NVCA 5T5LA 3OB8A 3M3EA 4LE3A 2CNAA 2HWE1 4MVTA 5T50A 1CONA 5HBAA 2Y6HA 3ON7A 2HWC2 1ZRRA 4J25A 4Y3OA 5KWRA 3URFA 3GCXA 4OHYA 4CP0A 5IJRA 3WUCA 1C1FA 5CG8A 1R083 1LULA 1PIV1 4AQTA 1OOPB 3WNMA 3N4MA 1W0PA 5GZDA 5JMCA 5EFUA 1PVC2 2R7EB 3HJRA 4FOQA 2WNVC 4QXHA 5J1XA 1VALA 4UT5A 4QDRA 4LNVA 1V6OA 2WC2A 1YLLA 4QQPA 3LA7A 2YROA 3U10A 4KU8A 4XVHA 4DS0A 2VECA 3C7FA 2Q8OA 1RHI1 4I02A 5A6ZA 3SH4A 2VTXJ 1RUD2 1AX2A 1H6YA 1JN2P 4F8AA 3H42B 4X8PA 5F37A 4YVWA 1IS3A 1GP4A 4KWKA 1NXMA 4AG4A 1ODNA 4AAXA 2CL2A 5T55A 4R9BA 2LS6A 4COWA 3BTYA 1UOGA 2D6PA 4GD4A 3ZIXA 2CGPA 3H1YA 1IPJA 3TNQA 3ZN6A 1HXS2 2F6BA 4FPFA 5EWSA 1SLTA 4P14A 2AR6A 2VPVA 2VXJA 4UYBA 4BK5A 4WVMB 1NCRA 1C57A 1NYWA 5FPXA 1LESA 4GH4A 2RM23 5HCFA 3EBRA 5KXBA 1W9SA 5H9PA 1HDKA 1LOFC 4QD2A 1ULOA 1KD7A 1H4HA 4META 3NW4A 3WP4A 3WCSA 1MS3A 1BBT3 1ND3B 4Q4Y2 4XURA 1LOEA 5CKMA 5LASA 4M3CA 3VBOB 5IAVA 1BBT2 1JOPA 1YC61 2BP6A 2IZWA 2QBXA 2RS13 4JC1A 4WVWA 3VKOA 4RGKA 4XJAA 5ACA3 5JWPA 1PM7A 4IXLA 4NAOA 4NWVA 4YW7A 1VBB3 3AKTA 3LD8A 1W9FA 2DURA 1KDKA 4KBZA 1B35C 5FZHA 3VZKA 2IXLA 2CDPA 4NROA 1NA1A 4ZPIA 2TBVA 2RV9A 1ONAA 3TRSB 5FY8A 3I3DA 3ZFGA 2R32A 4WM7A 5C3PA 1W8FA 1MACA 3AMPA 2J7MA 1VBA2 1HN0A 1UZZA 1PMIA 5FYYA 4J1XA 4NR1A 1GSLA 2BRTA 2QNKA 1F2NA 2E53A 2UURA 1PIV2 2W47A 3CL1A 1VRBA 2BBVA 4AXOA 1YEWA 4EN6B 1MS1A 2ZJCA 1HRV3 5FJKA 3FWEA 5JR2A 2X10A 1AL23 5FZ9A 3LFMA 1HRV2 1HB4A 4Q0PA 4URTA 1YQ5A 5A70A 4NUBA 4EQVA 5FY4A 4YZ1A 3JQXA 1H8TA 1RHI2 2XHKA 5FUIA 3IMNA 4H7LA 5DZGA 4LBMA 1JZ3A 1AJOA 4Q26A 4ZU5A 4NVPA 1W2OA 4LBQA 4FI9A 3W9AA 4QMAA 5JMOA 2Q1MA 2D3RA 4KWUA 3TOJA 2VNVA 3WW1A 1RJ8A 5FR3A 1Y9MA 2YZ4A 2R1DA 2C0ZA 2PAEA 4FAGA 5IVBA 4XQ4A 2HEVF 1F5JA 5E8AA 2WO1A 2W08A 1GUIA 3MICA 4KU7A 3WHUA 1GWMA 1SQ4A 3NWKA 1RUC3 3SH3A 1PK6C 2VQUA 3A0KA 3PJQA 5DUWA 4ATEA 1OKQA 2J1TA 1MZ5A 2R6QA 2UU8A 5DABA 2RVAA 4L97A 3I3EA 2P2KA 3DEMA 1W8OA 1G86A 4JGYB 4QHZA 4OQ8A 1IQAA 4B1LA 1YFYA 3POGA 5J48A 3LIHA 2D6NA 4B4RA 1BVP1 2VQTA 2XGXA 5FY1A 4BB3A 1W8TA 4XILA 3KF5A 4QXCA 4YRDA 3J8F2 5FP8A 1RUI3 4LO5B 3T2OA 4YGEA 3ROUA 2WABA 3Q8FA 5L7OB 1UAIA 3ZXGA 4NIGA 2P3KA 4JZRA 1VBC3 2K46A 3OY8B 1PGSA 5IVJA 2TNFA 4S2DA 2B39A 3N7JA 2HYXA 4XHBA 1D4M3 2EALA 2LW8A 4EV0A 4YFZA 4D7TA 1DHKB 5FPUA 5DXDA 2V4AA 4FFIA 4OHXA 1CAUA 2HWF2 1SBDA 3VBFC 1I1EA 1PGL1 2J22A 4KH9A 3V65A 4MO3M 3VDBA 1LEDA 3NNMA 4CDWC 3NV1A 1UYZA 5FZOA 3POYA 1DQ2A 5FXZA 3WP3A 1JZ8A 2GAUA 3KB5A 5FY7A 3UV9A 1MZ6A 1X82A 4QPGB 4ASKA 2RG4A 4MX3A 1C4RA 1SZBA 3EXUA 1DG6A 5C8CC 4BLJA 3V0BA 3ZXDA 4I0BA 1O59A 3SHRA 3FJSA 1EP0A 2WFF3 3AP7A 2JE7A 4IE7A 4M4PA 3DPRA 1N1TA 2QZ2A 4MGZE 4W6WA 3HQUA 2G9FA 2MEV1 1GNZA 4QX3A 1FX5A 3AVRA 3BPZA 2P3YA 3VBHA 4HZFA 4XIOA 3LEGA 1ZZCA 3SLIA 3TNPB 4AVSA 1O8PA 1X8EA 3OSDA 1LTEA 4LULA 2VMHA 5FPVA 1UPIA 4H55A 2XPJA 2B5HA 3AL6A 4Q4V2 4QQOA 4WZCA 4ORFA 4EWDA 3WDUA 1W6QB 1FPN3 5J09A 1OOPA 1O6UA 1XNCA 1W8WA 1PZ8A 3RSJA 1FPN2 2JG9B 2XKPA 2B9VA 4AGRA 2X09A 1Z0HA 5EQUA 1CIWA 2VZRA 3AZZA 1PX3A 2VG9A 3WNXA 5FYMA 1H0BA 2XHNA 4MUVA 1REDA 5A3TA 1RUJ1 3AYDA 4ZHNA 1UU4A 5C33A 5I8YA 4RR3C 3TEWA 4YLZA 4BIOA 2RJKA 1C28A 3JB8A 5FZDA 2MNGA 4GXLA 3T3YA 3HAGA 5KXEA 1N3PA 4WVZA 1ZBA3 4XW3A 2Z2SB 1RGSA 2JDMA 3MLJA 3AXEA 5EPAA 1ZBA2 2J42A 2XL9A 5DAXA 1GICA 2PA7A 1W6PA 3AJYA 5CADA 1AR73 2ZGSA 4BU2A 2HWD3 3A7QA 4AR2A 5FWEA 5GLUA 1QOOA 4QQ2A 2WJSA 1RIRA 4AHZA 3MIDA 5FZ8A 2FDHA 2QUOA 2XQXA 1EAH3 5BNOB 2W39A 3T2PA 4Q8LA 4Y5Z0 4DB5A 1EAH2 4XCAA 2GC3A 1SLLA 4Q4X1 1LOBA 5EHDA 2J1SA 3W59A 2XJRA 1ND3A 3TYJA 3LB9A 5ERLA 5HV0A 1IG3A 1ALYA 3VBOA 1I6XA 1MS5A 1MR5A 4YYOA 2FDIA 2OX0A 2XVGA 1LODA 5IFTA 5IHRA 1S2KA 3E1F1 4NOTA 5E16A 1VMJA 3GZEA 4BE3A 2Y60A 5FMOL 1DYKA 1FAYA 5L9VA 3C7GA 3HT1A 5SV5A 2GMEA 4JVAA 3VHNA 1SFNA 1MQTC 4N53C 1UKGA 4IV1C 4HOOA 4QM9A 5DPNA 1EV11 1FMD1 2FCTA 3RNSA 4A4AA 5C3SA 4TWTA 2VZTA 2QQNA 2XG3A 2WIIB 3NNLA 5FQ0B 1SLIA 4HETA 5C6CA 3WZ1A 1ODMA 1J58A 2DCJA 1P8JA 4GWIA 3VD7A 2WAOA 3JD72 1URXA 2LRPA 4PCRA 4COUA 5BNQA 3VBSC 2XKOA 2R30A 1IKPA 1WKYA 4PDWC 4JQRA 4E4ZA 3HIFA 4RQPB 4Y1XA 1R093 1PO13 1AR63 3M3QA 5JLVA 3T2TA 3O1MA 2FZ2A 3POWA 4JGZA 4NRPA 2VMEA 2W3JA 1PO12 1O4ZA 1UU5A 2CGNA 5LBCA 5IK4A 1HW5A 5I8SA 3AKPA 3LF7A 1S2EA 5JR7B 4Q4W3 3RZJA 2BU9A 5EP9A 2IWGB 4RGGA 5DQ0A 1WMXA 4FTEA 3E6CC 2DU1A 3UETA 3ZXEA 3KV4A 1NY71 1I5PA 1UZWA 3ZKUA 4CUAA 3MW4A 2C9AA 4Q27A 1ULPA 2GC2A 3AVSA 5FKBA 2R49A 4EYUA 4Q0QA 5DDJ3 1GZWB 3SEPA 2B46X 4XPVA 2WO7A 3ZXKA 4AI9A 4FPGA 2Y38A 3VKMA 2FMDA 4JGYA 2XLAA 1OVSA 3PNAA 3I3MA 4MV2A 2CWMA 3B02A 1BEV3 1ULDA 2PHWA 3LOIA 1XE0A 1I5ZA 3ZX7A 4XEZA 2GNTA 5I93A 1RUF1 2XH6A 1ZA7A 1W6NB 1IPSA 2WAAA 3UJQA 1CJDA 1DP0A 2PQQA 2VE1A 2D98A 5FZLA 3BOWA 3ES4A 4V2VA 1KGYA 3OY8A 1CN1A 1JYCA 4M0HA 1RUG1 1OC1A 1W9TA 4P9WA 4YVWC 5HCBA 2HYKA 3K2OA 1MS8A 2UYAA 4QB2A 1POV3 1AJKA 2H0VA 1CZSA 4D7YA 4QKBA 1X36A 2VC9A 3VD9A 3ECQA 3V0AB 1VRH3 2HH9A 3OBZA 1DZTA 3I7DA 1U5XA 1TME1 5FP7A 1QJX1 2C5DA 1NZCA 5FTTC 2EA7A 2DUPA 2XJVA 1JYVA 2E51A 3JBG3 5A7SA 1NCRC 1W28A 2EICA 4GH4C 4GWJA 4QPGA 2O1QA 1VAKA 2UWBA 2A5ZA 2VMCA 3NNFA 3ZIWA 4BK4A 5CKNA 4NAMA 2I74A 1PO22 4AI0A 3VDDC 2ZS6B 2DVBA 2JDUA 2IXHA 3H3ZA 5T5JA 3MW2A 2WUHA 5M0TA 2ZX2A 4C0HA 4YZ5A 4C90A 2XLGA 1UOJA 4PI2A 3M3CA 5DAVA 5JOWA 5LRRA 1LCLA 3SEEA 3ZPYA 4ZZ5A 3OEBA 1NA1C 3SKVA 1NY72 1S0IA 5H9RA 3TBDA 3ZFGC 1AR81 5EIYB 3FHQA 1MEC1 1UO9A 5FZCA 1PMHX 2ZGLA 3RDIA 4JRLA 4DNYA 5JXIA 5LCWL 1S0GA 1LRHA 5AC93 2QFEA 1W6QA 1RUH3 1DYOA 1O5LA 3K3OA 3W21A 3MBWA 1LHUA 4XQWA 3VDAA 2JKBA 3ELNA 5LBBA 1LNSA 3TN93 2XDVA 5HCHA 3H0OA 3LEMA 1RUF2 4A7KA 2FHRA 5IYYA 2CHHA 2P17A 2E26A 2R072 5JI7A 1W6OB 2RS53 3JCIA 4FPEA 4P9XA 5FPLA 4DXZA 1DZQA 4MXWB 4XTMA 4P08A 2JDHA 4QAWA 3VHOA 3K75B 4HKLA 2VULA 2QQJA 4AVTA 2XOMA 2VCBA 4XXPA 5HI0A 3ZYIB 4W4ZA 2ZGRA 4XJZA 4B7KA 3UNPA 2ZEZA 4KMQA 1OPMA 3I2FA 3I4IA 4LMFA 5T5PA 2DCYA 3USUB 4BQ4A 3FHIB 2XB6C 4ARXA 4AAPA 4E4DX 5BPXA 4XUNA 1AYN2 2WZR1 1WLTA 3KCYA 3SCGA 1CESA 3BTZA 2SLIA 1UY3A 1IKQA 3MIHA 4HBNA 1OPOA 1OFNA 4GMP1 4BMBA 3BGAA 5IVYA 1D2SA 5BNOA 4I2OA 4IDZA 4IE5A 1GANA 1N1SA 2R063 4A3ZA 4P00B 1Y3TA 3OF1A 3MIGA 3PIJA 1UY0A 1FOD3 4H2AA 1ZZ6A 3ZKYA 4AHYA 4XZUG 4FVVA 1QNWA 4QKFA 3IBMA 4BQWA 4FPOB 4S2HA 4BYYA 1WCDJ 4HONA 2HWB1 1NE6A 5A6XA 1K5MA 1GBGA 1FI2A 2IC1A 3H7JA 3MUY1 5T5OA 4QQHA 4ASLA 1D0GA 4S2FA 4OULA 1DQ5A 2GH8A 1SACA 4S2GA 3ZYPA 1I9RA 5ANNA 3U78A 3QH6A 5CU1A 4WM8B 3BKZA 5A1AA 4LR4A 2VUDA 4BQ3A 4EN8B 4LUKA 1XPWA 1TMF1 4RHV3 1YFUA 5B4XA 2ZA9A 2WNUC 2X05A 5IK7A 3TWIA 3O1UA 1S0EA 4LLOA 4RQPA 1RVF3 1ZNPA 4CA9A 2TEPA 2PQSA 3B3QE 2W91A 2QDNA 1ZA4A 4Q5OA 1JH5A 1E57A 2JDNA 3VZNA 3W20A 5JI9A 3O1VA 1DBNA 3DPRC 1OHFA 2DVFA 5DN2A 4FTSA 2ZXQA 2YFUA 4Y22B 1QJU1 3GXUA 3R0RA 3T4HB 2WQ8A 4FFFA 4OHVA 4UFMA 3VBHC 2WS91 1W39A 1WLWA 5LA9A 2W68A 2WZR2 3IDEA 1QOSA 3MIFA 3IB3A 1WCKA 3MIBA 2GH2A 3BYWA 2QQUA 3JUUA 5LBEA 5J36A 1AR91 3O5SA 4P9GA 1GZWA 2CYFA 3GZAA 5A7WB 4XOGA 3VBRB 3WX5A 5FYVA 1LHVA 2BQPA 1PZ9A 1OOPC 4RS5B 4JTOA 5I0TA 4ET7A 4RGAA 4UWDA 1COV1 5GM0A 4N90A 1WCSA 4IV3B 4CDQC 2YY1A 3NQHA 5FY9A 3RMXA 4O61A 4CCEA 1LB2A 2RDSA 4CDXB 4LK6A 4N7IA 1WMFA 2AC1A 3HWJA 1W6NA 1W8HA 1ZRCA 2K9ZA 5FUNA 1ZBE3 2W46A 1QJEA 2Y0OA 3WSOA 2BGPA 3POFA 2D6LX 2WSUA 1JYXA 1ULGA 2ZGNA 3N9LA 2IXIA 4JQTA 4PF1A 4DRVA 1DLLA 3ACIA 5TSWA 4CU6A 1IS5A 3NV3A 2ZPXA 2C4XA 2DTYA 2ZX0A 3F2ZA 1YI7A 1BMV2 5LY2A 3V0AA 2PELA 1QGLA 1U12A 4YM0A 1VAMA 2R0HA 1HRI2 2PAMA 3M70A 5DAWA 1IPKA 3B9CA 3TEZA 4AVBA 3QOPA 5CFDB 1KXGA 1XNDA 5F3IA 3WW4A 4X6QB 2X5IA 5BNNA 4MGTA 4PBOA 4AYUA 1O3SA 4NHLA 3KZ4C 1ND2B 1Y4WA 4XIKA 3VBOC 1GZTA 1ZZ8A 1RMU3 4AFCA 5GZGA 1WW5A 1BXHA 1ZM1A 3ILFA 4CP2A 4YSFA 4MG2A 2Q8CA 1AYM2 1NX9A 4HSJA 1T2XA 2V5YA 4M0NA 1GKBA 2GMMA 4QQLA 4E8DA 5BUVA 3ZYHA 3HVDA 2ZZQA 3ZXLA 2V72A 2AREA 4GQ7A 1V9U3 1MVEA 4AFMA 5C3RA 1O3QA 3PTYA 3H9AA 5LK7B 4E2SA 1X8MA 2JB8A 2D40A 5K0UB 1QEXA 5EYYA 1PNGA 4BJ0A 5IVCA 1JODA 1FNYA 1QJY3 1SFYA 3AZWA 3KT7A 4TLGA 2WWSA 4XZPA 5IK5A 3EYPA 3GCWA 1JZ6A 1COV2 4AVCA 2DCTA 4AQ6A 1NT0A 5JOZA 2BWCA 4HK9A 2RMU1 4DZGA 5G05L 3MLKA 2RR12 2A6YA 2R043 4OZOA 1QJFA 5F3CA 4DRRA 2OVUA 1VBD1 1V6JA 2IVIB 2ZCWA 1W6OA 2IVJA 4JGZC 1SLAA 1WW6A 2A6ZA 4MXWA 4OI0A 4FQZA 5F2SA 5I8TA 2VM9A 2YYOA 3T09A 2VR4A 3PDQA 1Z7S3 3FLPA 4UI9L 1N1VA 1R081 4GWMA 1ASJ2 4CDUA 3ZLIA 3EMRA 4MGYE 3USUA 3VL8A 1KQRA 1I3HA 1CAWA 1Q3EA 2Y6JA 5CYYA 2XBO2 2RS33 1SG3A 1JW6A 1RINA 1Q8OA 1RXGA 4IW3A 5FMBA 4PHZA 3KVAA 3TAYA 2EAKA 2JG8B 2PLV1 4SBVA 1UOBA 4M4RA 3PU3A 4JGYC 1GU3A 3ZYFA 4CEWB 4LIVA 4Z2AA 4OHWA 3M3IA 4Y4YA 4FPJA 3JQWA 4N7UA 1WGPA 3ATGA 4DXTA 4OI1A 4E9KA 3HOBA 4IEOA 1GR3A 5T54A 2HWC3 1GQPA 2EIGA 3J26N 3N9PA 5FZGA 3EJKA 4XF9A 3CJXA 3GDBA 5IW0A 1AF9A 4CEYB 1UWWA 3AMQA 2V73A 3I2HA 3OOXA 3WG4A 1PVC3 3DN7A 4O65A 4A44A 2FDJA 5CB7A 4EROA 3DV8A 4R9DA 5FYIA 4FOVA 4WM8A 1UYXA 3VKFC 5GKAC 2O8OA 2IXCA 3FE5A 4CPBA 5A33B 5C4WB 2RS11 2VGDA 3SMHA 4AQSA 5IVFA 5E1RA 5ACA1 1YQ6A 4NHXA 1QDCA 4FP3A 1RUD3 5K4LA 5JPNB 3DGTA 4QPGC 1VBB1 3SCFA 2L9LA 4CSWA 2YMZA 4C1WA 1Z78A 1VBD2 2FZ1A 2VZSA 1WA4A 4OVEA 5GLVA 1JS9A 3QD6A 1HV1A 4QB1A 5FZ4A 5IAXA 2R1BA 1ZX5A 2CAUA 4YM3A 3RZMA 2XR4A 2BERA 1HXS3 1VJ2A 1XB9A 3OD0A 4Y22A 3T1LA 2VH9A 1HKDA 3RZGA 2FMYA 2OQ6A 5A32A 1NLRA 5H9QA 1AL21 2ZOEB 1UF2C 4YPJA 5FXVA 3FUQA 4IEUA 4AQ2A 2ETEA 1BKZA 1YO8A 3ZFEA 2ZTNA 4OCTA 5FZIA 3OTFA 1LU1A 1F4HA 1YQCA 1UX6A 3QLQA 5A7WA 1XJAA 4Q4Y3 3VBRA 1OKOA 4EE2A 4D7SA 5L9RA 3IDAA 4COYA 4CYDA 5A3OA 2ZEXA 3LDKA 1KJLA 5C3OA 4WZFA 3DF0A 1PNFA 2BBAA 3POJA 4P02B 1W03A 4PQ9A 4DEVA 1ZREA 3I2JA 2HWE2 1JHNA 1VBA3 3WQ0A 3ZXFA 2JEMA 1LOCA 1PGW1 4EWEA 3P1IA 5AVAA 5AFEA 1YJLA 4Q2FA 1DDLA 1OFSA 3OUJA 3AMNA 1PIV3 2YU1A 3OBTA 4GJYA 5CZKA 4C91A 4KGGA 2B8MA 4LKFA 3AC0A 1GZ9A 3WG1A 5DUXA 2VTFA 1E5HA 1WUVA 3ZSLA 4CCNA 2Q8DA 4UOJA 2WNEA 3PLQA 1RHI3 1RUI1 4LA2A 3LA2A 4HKWA 5BNOC 2MPFA 2IFWA 2GC0A 3TEXA 4FOYA 1VBC1 5FP4A 2HJIA 3MLLA 5C9AB 2D3PA 4UFIA 3JXSA 3E6BA 4IE4A 3CQOA 1PM4A 4BM8A 1CQ9A 1ND2A 4DQAA 3K4AA 1F31A 5IWFA 4CCMA 1M4WA 3AP6A 2XUMA 3J7NA 3KS7A 2WLPA 1K5MC 3O7OA 2QQKA 4RD7A 3NNJA 1V6MA 1IGOA 3BOPA 2VD7A 5LK5A 4IGQA 4LHSA 1HIXA 5DAQA 5A7QA 2UWAA 2OA2A 4XJ9A 5LEKA 2CY6A 3KSCA 4IESA 5GZEA 4AFDA 1ULEA 1QIQA 4M3CF 1G9DA 2WFF1 3RPQA 1Y9QA 1CPNA 1QF3A 3J8F3 3ACFA 2VUJA 4P9JA 1PZ7A 3UGFA 2QQOA 2Q1ZB 5CNAA 2ZMNA 4IEZA 1EUTA 4EWAA 1RJ7A 5F2WA 1H1IA 2VW0A 3FZ3A 4GMP0 2ZGMA 3B7MA 4TZDA 3JB4C 2AENA 4RQPC 5EV7A 4M3CE 1RUOA 1UU6A 3KT4A 3ZFFC 3ETQA 2ZGOA 4K1ZA 3WVJA 2HWF3 2F4PA 4MHUA 5B2GB 1PGW2 2Y6GA 1NQDA 4QDSA 1VBE1 2WZEA 3BU7A 4IERA 5HXVA 5GLWA 4NHYA 3NO8A 5LATA 4FCAA 3FFQA 3S7IA 2OZ6A 4E27A 3LA3A 2D43A 1YQ8A 3WDWA 2JD9A 4AW7A 2DVAA 4EJRA 3DKWA 5J7MA 3SISA 1L3JA 2YGLA 4JRAA 2PHRA 3WF2A 1F5FA 3KMHA 1UCXA 3J7LA 1BQPA 2B45X 2PHFA 3IAPA 4AI8A 5C5TA 1G9AA 3WF3A 4RYDA 2KD7A 3MIEA 2JG8A 2PHXA 4KG0A 2Q4SA 4L11A 5FDBA 3O1RA 2RE9A 5FRAA 4B7EA 5I0SA 2OUJA 2EVXA 3P3PA 3Q8EA 4CEWA 4PIYA 2YHJA 4LQRA 1LR5A 4FT8A 1R1A1 1RTVA 4K21A 5EZWA 1CAXB 4XUPA 2WNVB 2FBEA 3VL9A 2NMNA 5JDBA 1AR71 2DV9A 5KHHA 4I09A 2HWD1 2VU9A 5KC6A 1RXFA 2BFUL 4A6SA 1KFXL 4KBBA 3NMBA 4JHTA 4Q4V3 3V56A 2XUEA 3WDYA 3W5MA 5GLTA 5A7PA 1C8M1 5JIUA 2BPA2 1DIWA 5FJHA 3POSA 2D6OX 3UT0A 2E31A 2G4IA 2GZWA 3NAPB 1ENXA 4L9BA 4Z07A 4CCDA 1G9CA 3HMYA 1UNBA 3ES1A 1DQ4A 3K3NA 5DG2A 1EUUA 2PXJA 4YG6A 5FK8A 5C4WA 2A73B 2E7AA 2GNDA 3HBKA 1VMHA 4FPCA 4JKLA 4L99A 2W2IA 1W0NA 2DTWA 4HVOA 4OUSA 4CPBD 1JZ4A 1X7NA 3IT8A 2H0BA 3THCA 4ITCA 1HB2A 2ZGKA 4N8MA 4YGDA 2EXIA 3VDCA 1EYBA 2X5IC 5BNNC 2W1WA 4JDOA 3GF6A 3BODA 4IL7A 3O14A 4Q8KA 1TNFA 3H50A 4HK8A 1KS4A 4J6GA 4LKEA 1VBE2 1KFUL 1AX0A 1HN1A 1PMJX 1PGL2 3OYWB 4XFAA 1DGRN 2P3IA 3HD8B 2WL1A 5CKQA 1V6LA 4Y1VA 1QDOA 3WDXA 2KR2A 4LXLA 3PVEA 2Z42A 2WSVA 3M3OA 3WCRA 3WP6A 2NZ9A 4E8CA 3T0AA 1D0HA 1YNAA 1YYNA 1FXZA 4WVMA 5CFCB 1OLMA 1QHDA 5L19A 1W3VA 5FIXA 1R091 3E5UA 1MVQA 3C3VA 4FO9A 4NHKA 3MV01 1L7QA 4A6OA 4D3WA 1NAEA 2AYHA 4MGSA 2YBKA 3MYXA 3OPWA 1OUXA 5FY0A 1JI6A 2MEV3 2WO3A 2XJTA 2XWJB 1R1A2 4NMIA 2MEV2 4XBLA 3BN6A 2BNNA 2G9ZA 3D0SA 1XYOA 4C0BA 1ZRFA 2W5FA 1S0CA 4FPLA 4IETA 5LA0A 1OD3A 2YPDA 1JYNA 3OD4A 4AWDA 2VCCA 5DDJ1 4RFT0 1H1AA 1LHNA 3GJBA 2OPKA 3MF6A 4UF0B 4CCKA 2Y0IA 3D8CA 1IZ3A 3WHTA 4A7YA 5BNPB 4XFCA 3NV4A 4CDUC 1BZWA 3RWNA 3QBQA 3JD73 5FO9B 1OA3A 4JDNA 3ENRA 1Q8PA 4NPRA 1LGNA 1WCQA 4JCKA 3U4SA 2QTWB 2JICA 3WNOA 3PTRB 2V4VA 3LEKA 1DQ6A 1H2KA 1JXNA 1JU3A 4I01A 4PT6A 3WW3A 3KWVA 5JCTA 5JSPA 1RUJ2 3M4FA 4W50A 3RVHA 3MV11 5C9AA 1YIPA 1PK6B 1YUDA 3ZMNA 1F4AA 2RJLA 1ENRA 5F9TA 3WXPA 2A7AA 3GZTB 1Q43A 4IUGA 2VNOA 4L2NA 2VL4A 5G04L 2P1BA 1OD5A 2E7TA 4SLIA 4H14A 4W6XA 5JOYA 1SPPB 3VN4A 3H1MA 2ZAHA 1N3OA 1OF3A 2ZABA 3JBG1 3MUZ1 4IGPA 4B8EA 4XYXA 5A1LA 5IT6A 4ONUA 5LW9A 4QU2A 4GAZA 1JZ2A 2A6VA 4DUXA 2R16A 3PUHA 1OURA 4HKOA 5EXOA 3ZOIA 4HFSA 3HR9A 2ZX4A 5FZMA 4OHZA 2DWRA 4Q4X2 4WM8C 2XONA 2ZMLA 5EJ1B 4HL0A 4DEQA 3BB6A 4AGVA 2YUEA 1UY1A 3AYAA 4I30A 3KV9A 3AFKA 3M1HA 3I3BA 4GJZA 3WG2A 4CDWB 4QX1A 2K2SA 5L7OA 5KXCA 2VOKA 4YVSB 2W1UA 3CDZB 4LK7A 1U5ZA 4AK3A 5JUVA 5FZ7A 2KA3A 4PLOA 3E5QA 4EN0A 4O9EA 4BOWA 3O0WA 5EJZB 1QOTA 1FMD3 1OUSA 1NCQB 1APNA 1J59A 2P3JA 1EV12 1JUHA 1FMD2 2BV4A 4IEYA 4ZZ8A 5AC91 2WT2A 4KNCA 1RUH1 2JDZA 2YU2A 3S6PA 2BGOA 4DY5A 2DCKA 1OI6A 1XQNA 1G6NA 3WNKA 2GC1A 2VZVA 4Y24A 2F4LA 3TN91 1VAVA 3FBYA 3ZFEC 1S55A 2AH2A 1SBFA 4BWOA 4AOCA 3OBAA 2D7FA 2WZ8A 2YG0A 4UBHA 5E89A 1PO23 3KHBA 2WBKA 2ZHKA 3VBRC 3NV2A 1N1YA 3ETPA 4EN7B 3T2QA 4CRQA 4E2QA 1RUNA 2WRAA 4N43B 4PIZA 3KHCA 4TSVA 5FZ0A 2JXAA 2HEWF 4F83A 4LO8A 4PLNA 2C26A 1YIFA 1QQP1 4LHKA 3ZR6A 4AI1A 1CAXA 4R52A 3ST7A 3RRDA 5FZ1A 3DXTA 4A2UA 5KHJA 4Y20B 1WA6X 2PN5A 3OGVA 3AKRA 5FP9A 4P9LA 2FCUA 2IXJA 4QXKA 4WM7C 2OW4A 2B42B 2OPWA 3CU7A 2BVVA 3UK9A 5IATA 1RB8G 1WMDA 1DGRA 2VUCA 3PURA 3B69A 4XUQA 3T4VA 4COZA 2PYTA 2R061 3NAPA 1OMIA 1NQJA 3K46A 2BOJA 4CP9B 1O7FA 2JG9A 1FV2A 4P5HA 4LUMA 3IMMA 2A6WA 4QKNA 1RUF3 4CCOA 2JDPA 4IEVA 2VBBA 3RZZA 3HPNA 4QPWA 2R073 4Y1YA 5LA1A 4XFBA 3LDRA 3T08A 1H8TC 1FNZA 1TE1B 2HBTA 4WBBA 1UD1A 5DG1A 3UJOA 1US2A 2ERFA 1GOHA 1K3IA 4UAPA 4QWNA 3BIEA 1V00A 4AE2A 3LWCA 4Y26A 4D8MA 2NLRA 2VQAA 3ZSKA 1RUG2 4K3UA 2Q8EA 5C71A 4D6SA 1XYNA 2JD4A 5JOXA 1ND2C 2W52A 4PIXA 3P3NA 4BIFA 4BQ5A 1OQ1A 5FKCA 5FP3A 1J83A 5FYCA 3THDA 2D44A 1AYN3 3KGLA 1CVNA 4BQ2A 3AZVA 1TME3 3A22A 4X8NA 2EF6A 4LBNA 4UW6A 2Y64A 1TME2 4RHV1 1QJX2 3U37A 1YXWA 2YGMA 4NIDA 3LSDA 4GB31 3LSEA 5CFCA 1M06G 4FXKB 2YBSA 4CE8A 2VO5A 1RVF1 1MQTB 4N53B 4ZXEA 1K42A 2ORZA 4UXAA 4XAEA 2ARCA 4H7MA 1Y7BA 4XF4A 2VW2A 4GULA 5GALA 2CU5A 4D94A 3E6DA 1LGBA 3J9SA 1BK1A 4QX0A 4XDPA 5JSOA 3UKNA 3ME2A 2B7YA 1QQP2 4A42A 1R1ZA 4MH0E 5A3NA 4M00A 1LECA 3A23A 1FT9A 4G9SB 3WW2A 1N47A 1W05A 4DUVA 1LHOA 4PDWB 1EY2A 1MEC3 2WWJA 5CISA 3AL5A 3DXUA 2VZ1A 4FAHA 5KHIA 1AR82 3OUHA 4GKYA 2XVLA 1MEC2 2R0FA 3K77A 4AFBA 2PHTA 3CMGA 4Y4RA 3DYMA 4UFLA 4HN0A 5JZGB 4M01A 5JVVA 5BNPA 2ATFA 1UIJA 1GNYA 2Z69A 5FQ0A 1RL3A 5DMYA 2Z4FA 4QX8A 2NPIA 1C5IA 3ZYRA 3B93A 2Y8KA 2ET7A 3SITA 1QXRA 5A3UA 2BOIA 1GQGA 3VBUB 3ZSJA 2XJPA 3KCCA 2GP5A 1O8SA 4YFWA 4GIQA 2JG8C 4DO0A 5A3PA 4KI5M 2C24A 1NKGA 3VKNA 1RUE1 3UKTA 4OLLA 3AZYA 3C8XA 3N36A 3AP9A 1UZYA 4LO6B 4CXXA 2GSYA 4CEWC 5CBLA 1GFF2 1QMJA 3SC7X 2V5DA 3LDBA 2VVEA 4QT6A 1H2MA 2WZR3 1DLCA 3OGJA 5FFOC 1UKRA 1A8MA 1UZVA 1V6IA 4MYEA 5SV8A
chains in the Genus database with same CATH topology
5K9YA 3THPA 4TLFA 3WP5A 4GB32 1QXJA 2ZX1A 1SCSA 3H7YA 4YVWB 5I91A 1LJ7A 2LALA 3AX4A 3CLPA 3OJBA 5JPMB 5F1RA 4QM8A 5C4WC 4TYSA 1GNHA 1ZZBA 2ZACA 2ZGPA 1WBFA 3ZN6B 1XXNA 1Q8SA 4YVSA 2HWB2 1MS0A 2WT1A 2X8KA 4MXVA 1YRZA 4UW5A 3X29B 1NCQA 5BV6A 4LTAA 4Y1ZA 3VDDB 2EXHA 3WLUA 1QJY1 2JX9A 3AMHA 1HRI3 3ZXJA 2I45A 2Y26A 5J98B 3AFGA 3KGZA 4CTEA 1TMF2 1DGWA 3S0MA 2R041 5GZCA 1NA1B 4BQ1A 4YZ4A 1BVVA 2WA3A 5HCAA 2Q5TA 1GZCA 2JENA 1RUE2 4AEDB 3GALA 1ND3C 4N43A 2XJSA 5J37A 1Z7S1 1AYM3 4Z92B 2YXSA 1AUYA 2WT0A 1QJU2 3IKWA 2D5HA 4R4ZA 2NQYA 1XYPA 4XMIA 3BCWA 4Y20A 2WS92 2RS31 1BJQA 1AR93 3LGRA 3RJRA 3IDBB 1AR92 1HQLA 4QHBA 4RSUA 3ZDSA 2BGCA 3AM2A 4ATFA 4RL7A 1JUIA 1Q8QA 1XU1A 3INAA 4LBQB 1COV3 3ASIA 4QGNA 3WINE 1AZDA 4UBGA 2DCZA 4XJUA 4F3JA 4MGKE 3PMEA 2RR13 2CGOA 4R9AA 4B29A 3N7KA 1RITA 2QDRA 2D5FA 3MF9A 2ZHNA 4GALA 3NKGA 1DGWX 2ZKLA 4AVAA 2HWC1 3TB0A 4E4SA 4K9SA 1ASJ3 4DY3A 4J1WA 1ENQA 4MSVA 4AI2A 2XBO3 4FPKA 3WV6A 1H8VA 1VIWB 1C1LA 2Q30A 1GLHA 4L92A 4FTBA 2ENRA 3GBWA 2QQPA 1GYKA 3I54A 1PVXA 1V6KA 3CF6E 3R4DB 1MQTA 3M8LA 1H9WA 1Q8VA 2YC0A 5DUVA 1YWKA 3M7AA 1OQDA 1AVBA 1G9FA 1Q5OA 4BHPA 3AXDA 1HXS1 4JDMA 5A3MA 5L7OC 5D8AB 5LRSA 2ZGQA 4A3XA 3CJIB 2ZHMA 4U2AA 3I59B 2WNUB 4PDWA 3WDTA 3N7MA 2QZ3A 2WKKA 3MW3A 2WA4A 2AUYA 2RM21 1O91A 1LENA 2GNBA 4HMZA 5JZGA 1S0FA 1IOAA 4LT5A 1X33A 3FMGA 1BBT1 4RA0A 2PHLA 2DVDA 2ZHLA 4N9HA 4LBOA 5CVRA 3WG3A 1D4VB 1WLDA 2QE3A 2DYCA 3WD5A 2RMU2 4XHXA 4HVQA 2DF7A 5FMOS 3AKSA 3VBUA 1VBD3 5FO7B 5JIAA 5J3UA 5ABJB 4XDQA 2UY8A 1HX6A 1UMZA 1VBA1 3BTAA 4HVRA 4BCUA 3W58A 3L2YA 1HQNA 1DYPA 2DFCA 4NHMA 2X53S 1R082 4Q0UA 3U4XA 1O4TA 1NXD1 1TEIA 3A4UA 4CDQB 5F6LB 2JE9A 1HRV1 4QPIB 4FOWA 3FFZA 3GYDA 2K0GA 2VMGA 4YW1A 5DZEA 1UW8A 1QWRA 2D6MA 2PLV3 2ZZJA 4UW4A 4MGIE 3PHMA 2PLV2 3OCPA 4RS5A 3NAPC 3ILNA 2B9UA 2CAVA 2IXKA 1XNBA 1BCXA 2JG9C 2EAAA 4XF0A 3IPVB 4IV3A 3RYKA 1V70A 3E97A 2HEYF 1LGCA 4HN1A 4EN9B 1WBLA 4HANA 1W6PB 3ZYJB 3EO6A 4CDXA 4HT1T 1MS4A 2N7GA 3L2HA 4JTNA 2SBAA 4Z8BA 2HWE3 2RHPA 2BUKA 2BTVC 2ZGUA 1RUC1 2Q0AA 3HQXA 1OQEA 4LBKA 2ARBA 2RM22 2OIIA 1HV0A 1H2LA 4GKXA 3JU9A 1J3QA 3VDDA 1MZFA 4XF3A 3WT3A 3DL3A 2C1FA 2VNRA 2VY0A 4GA9A 4YG3A 3J8F1 2RS12 1WD3A 3VZJA 5ACA2 1JYIA 5CFDA 4OZXA 4XXAA 5CFCC 3K48A 1VBB2 3OPZA 3JZVA 1YI9A 4K6BA 4YW5A 3AJZA 3AYEA 4KWLA 3H8UA 2E7QA 4ISQA 4BH9A 4AEDA 3CEWA 2NP0A 1D4M1 2HWF1 2CWSA 3B94A 3U07A 5EYXA 5BY5A 2GN7A 4YGBA 3B9IA 3R6SA 4XBQA 4LO7A 5KC5A 4XBNA 4I0AA 1AL22 3MGUA 1HQWA 4HPKB 1CAVB 1J1LA 4JGZB 2EXJA 5K0UA 5CA6A 5BNPC 2E63A 4XFIA 5AFBA 3RI9A 3ACLA 2WFPA 2LUWA 4Z82A 3MFAA 4R4XA 4LO4B 2DUQA 2D93A 1CD3G 3CO2A 4OI2A 3EQEA 4Q4V1 3QCWA 3IWZA 1RUC2 2MHFA 2PAKA 1Y43B 3GHNA 3GZUC 1FPN1 2VW1A 4O9GA 1LEMA 4INDA 5T52A 1AX1A 1O4YA 2NN8A 2PTMA 2BNOA 4AI3A 1FV3A 1RUI2 1TQ5A 2ZAAA 3LZZA 2BNMA 2GN3A 1YJKA 4ZU7A 5L73A 1VBC2 1G7YA 2A75A 1YCIA 4DMIA 2WLQA 3QACA 2XWBB 2OZJA 1D4M2 1SLBA 1ZBA1 3O12A 4G4FA 5E88A 1H9PA 3DUIA 3BALA 3FUOA 3D0JA 5DZFA 2OYZA 5BYNA 2YV8A 5JAXA 5KHKA 1DF0A 5D8AA 1C3HA 4YVSC 4YZ2A 4XETA 2P34A 1QY4A 1YFWA 3CJIA 3I59A 2WNUA 2XLFA 3KD4A 5K8SA 1EAH1 5FAXA 1NCQC 4CEYA 1LHWA 1AL0G 3FLRA 2WINB 2PHDA 2A70A 4W65A 4Z1VA 1LU2A 1W0OA 2D6KA 1WD4A 2WFF2 4LBLA 5A33A 1LOGA 1A6CA 5FOJB 3MDPA 3R4UA 2ZX3A 1UIKA 3H1WA 1PHMA 1UPSA 1OLQA 3HT2A 5AVPA 1QH6A 1VB2A 5ABJA 1S0DA 1JOJA 3N7LA 4N43C 1VBE3 1CGPA 4COVA 2IFRA 3VUOA 5CG9A 5EJ3A 3JD71 4CDQA 2W0XA 1GV9A 4QPIA 3AK0A 4R8HA 2Z5WA 4JAAA 1B35B 4A7ZA 4KGQA 4OFGA 3KT1A 2GDFA 1PO11 1AR61 4OI4A 2X29A 3VHPA 2UY9A 4BPZA 1IHMA 2I07B 1LOAA 5CIRA 4HSLA 1ZRDA 4PJYA 4ZU4A 3MPPG 1J1TA 1R1A3 3IPVA 3OGGA 5K7PA 4Q4W1 4PBPA 3UL2A 3APBA 4K20A 2ZGTA 4LHLA 4FQ4A 1NLSA 4DPNA 2CTVA 2UWCA 4KG8A 5FOBB 1AR72 4IEPA 1DQ1A 2D97A 2HWD2 4YM1A 5A3LA 3G6JB 4XFGA 4FSJA 1C8M3 1WLCA 3LKJA 4I3PA 4LHNA 4FBFA 1C8M2 4Z2WA 1A78A 4LE4A 1OSGA 3GNEA 1W2UA 4C1XA 5GJ6A 1BEV1 1A3KA 3N35A 4IEXA 3NSTA 2JECA 4XFHA 1RUJ3 3VZOA 4IEQA 1K5MB 3AP5A 1D2QA 1DQ0A 4PLMA 2ES3A 4AFAA 1EPWA 1IS4A 1DFQA 3B00A 1SDWA 4UW3A 3CNAA 1POV1 2YDEA 4AVVA 4YNIA 4WV8A 3J4UH 4E2GA 1VRH1 4P9IA 1AXKA 4FP2A 5T3NA 2GU9A 5FO8B 5GZFA 4FXGB 4NO4A 1H1MA 1U5YA 4HPKA 1C5HA 1AXYA 1CAVA 5FLJA 5FPZA 1PO21 4L8QA 1H30A 4Q4X3 5JZGC 3ZFFB 1H4GA 1R092 2VQ0A 1AR62 1QH7A 3H3UA 2XJQA 5I0RA 5KBFA 3EHKA 3VBFB 4LBQD 2LM3A 4Q4W2 1KDMA 2ILMA 1ENSA 5IUQA 3VBUC 2NYYA 4ES9A 5IK8A 3HN1A 3ZVXA 2OUHA 4OUMA 2D3SA 1EV13 2GALA 2LTNA 4XFFA 3BIWE 5DDJ2 5C8CB 4NWWA 2GMPA 1QU0A 1JBCA 2YPJA 1CX4A 4QGMA 3KQRA 4MZUA 3AYCA 1BEV2 3VGIA 3PJYA 5FBZA 5BXXA 1X50A 2A6XA 2R071 3SXWA 3ZMOA 3VLBB 4K40A 1F9KA 2XVKA 4Q0VA 4AEJA 3LOBA 3ALQA 2RS51 4XJWA 2PFWA 4RS5C 3NKTA 1U0AA 4XQDA 2TUNA 3FLTA 4Y1UA 1MZEA 3O0XA 3KM5A 3HBZA 1NG0A 4IV3C 3WY6A 3WDVA 1G9BA 3U0ZA 2DVGA 3VV1A 3GBGA 4AEMA 5J96B 1KRIA 4CDXC 4YG0A 1AYN1 3IDCB 2WNVA 3GHMA 4LEJA 5CAZA 2VMIA 3THTA 2ZBJA 1VRH2 1OA2A 3MPBA 3RJ2X 2EXKA 1BYHA 4H3WA 2DFBA 3JBG2 2V09A 1REEA 2H6BA 2QJVA 4D69A 3IM0A 4RR3B 5F5QA 3WR0A 2X5IB 5BNNB 3AZXA 3AKQA 2NM1A 4AGGA 1UN1A 1ULFA 1ZVFA 1FOD1 1H2NA 1XE7A 2XJUA 2H6CA 5CFDC 3B5LB 2O8QA 1FATA 3T1MA 5FCCA 1RUG3 2I2SA 2A71A 2HKXA 4AEDC 2DUOA 4Q29A 1LOFA 5D1IA 1O3RA 3ZXAC 2GNMA 3A0NA 3WQ7A 4LLFA 4W6YA 4XF1A 5AC92 1W6MB 1RUH2 1O5UA 3OYWA 1QJX3 3PVBB 3D4KA 2VVDA 1EPZA 1S0BA 1J3RA 4LA3A 1UL9A 2UYBA 4WVVA 4DOUA 1G8WA 3ZN4A 4YZ3A 5DUUA 3TN92 2VNGA 3MZHA 3WQ1A 1B35A 1SEFA 1TNRA 3SH5A 4GWNA 1U5IA 2PHUA 5K0UC 2BYVE 1JTZX 2RS52 5H9SA 4IV1B 4CDUB 1QNYA 1QQP3 5KXDA 1NOVA 4HLTA 1CAWB 1CPMA 1YFXA 4XMAA 2JJ6A 3VBSB 5JSRA 1AR83 4IEWA 4QGLA 4AF9A 5LEJA 3N3HA 3MFCA 3VHRA 3O0VA 4YM2A 1FYUA 4ISRA 3R05A 4BLIA 3R4SA 2R062 2P37A 1XRUA 4XJ8A 5FREA 3NJZA 1FOD2 4I0WB 2BW8A 2XL7A 1DZRA 4B4PA 1S0JA 4K7JA 5JOXA 3ZYGA 4YGCA 3SNMA 5FLHA 3KCXA 1KJRA 3AB0A 1QKQA 1ZBE1 1N3QA 1XNKA 2VXRA 3I8TA 1PK6A 4MLOA 1O3TA 4B4QA 1YHFA 2VVFA 1CJPA 1BMV1 1SCRA 1VP6A 3S30A 3MEPA 1HRI1 5D8AC 4KQ7A 1C8NA 3VKLA 1KITA 3CJIC 4ES8A 3M2MA 2BWAA 4GMP3 4KWJA 4GB33 4RHV2 1OA4A 1F8VA 1T6GC 4CEYC 1AXZA 1DGLA 1NE4A 3ZFFA 1REFA 1RVF2 4YW3A 4K8FA 1SMVA 3IIAA 2AGSA 4N9IA 4PF5A 3VBFA 1RMU1 3RG0A 5GLZA 4QX5A 1AYM1 4X6RB 2HWB3 5A32B 4CDWA 3ZN5A 3MI8A 5ABJC 4KL1A 2WQZC 3ZFEB 4R9CA 1NCRB 3ZSMA 1V9U1 4GH4B 3LAGA 3FC0A 1WW4A 3ZO0B 2VOVA 2BEOA 4BZ4A 5C8CA 2QCSB 2VUAA 5I0UA 3VZLA 2E6VA 4M3CB 3B01A 4I3GA 3USSA 4FPYA 3AMMA 1TMF3 4QPIC 3D6EA 2RR11 4DFSA 2ET1A 4AHXA 1OLRA 5F6KA 2WZPP 3PVOA 4LBJA 5KHGA 1CR7A 1ULCA 2G9GA 1RUE3 3ZFGB 1HLCA 2QVSB 4G3YC 1ZBE2 4WM7B 3VZMA 2ARXA 2KM2A 3GBFA 2A3WA 2QKDA 1ASJ1 1DU3D 3K51A 2NMOA 1GQHA 3UKVA 1QJU3 4FPHA 2KXLA 3WUDA 4YARA 2FQPA 2XBO1 2WS93 1RC6A 3S7EA 1ZZ9A 4CZSA 3WOGA 2O0OA 3AP4A 1H8TB 3I2DA 3FBMA 1A8DA 2VOWA 2A3XA 4AHWA 4JV4A 2CV6A 4RR3A 3RQ0A 1ZZ7A 1B09A 2ZKNA 1SBEA 1J3PA 3KLSA 2E9QA 4Q0SA 4Q1RA 1RMU2 2BFUS 2ZMKA 4CP1A 1VLNA 4YW4A 2Z79A 5FLIA 5C9AC 4YW2A 4B3NA 3ZSEA 3FX3A 3ILRA 3RMYA 1V9U2 1WW7A 4NN0A 3V64A 1VR3A 3E5XA 1V6NA 1S2BA 1IS6A 2BVBA 1PVC1 3G7DA 3PVNA 1XE8A 1QJY2 1W6MA 3L9JT 3QH7A 3LCPA 3U11A 3RS6A 1ZYBA 4DINB 1RUD1 1LKNA 4IQPA 1Q56A 2R042 4QPYA 5C8WA 1SLCA 1MS9A 3D82A 4XE9A 1AHSA 4N53A 3SCHA 2WQ4A 4IV1A 3PMSA 1QJZA 1CAUB 1Z7S2 2AZ5A 4K1YA 3RYRA 4AEKA 3OBRA 4Q1PA 4V1PA 1KS5A 3VBSA 3D5OA 3Q9OA 2RS32 4XTPA 4BMEA 3NL1A 2DU0A 3RI8A 4P9YA 3V0BB 4Q4Y1 1WMEA 1POV0 4BA6A 3IN9A 4U36A 3RYPA 1S1AA 1VB4A 1QXPA 3DPRB 4F7ZA 2A3YA 2RMU3 5L36A 4ASMB 4ZKTB 1XU2A 3C2UA 2VOXA 3VBHB 3NVCA 5T5LA 3M3EA 4LE3A 2CNAA 2HWE1 4MVTA 5T50A 1CONA 5HBAA 2HWC2 1ZRRA 5KWRA 3URFA 4OHYA 4CP0A 3WUCA 1C1FA 5CG8A 1R083 1LULA 1PIV1 4AQTA 1OOPB 3N4MA 1W0PA 5GZDA 5JMCA 5EFUA 1PVC2 4FOQA 2WNVC 1VALA 4LNVA 1V6OA 2WC2A 1YLLA 4QQPA 3LA7A 2YROA 3U10A 4KU8A 4DS0A 2VECA 2Q8OA 1RHI1 4I02A 3SH4A 1RUD2 1AX2A 1JN2P 4F8AA 4X8PA 4YVWA 1IS3A 4KWKA 1NXMA 4AG4A 2CL2A 5T55A 4R9BA 4COWA 2D6PA 3ZIXA 2CGPA 3H1YA 1IPJA 3TNQA 3ZN6A 1HXS2 2F6BA 4FPFA 5EWSA 1SLTA 4P14A 2AR6A 2VPVA 4WVMB 1NCRA 1C57A 1NYWA 5FPXA 1LESA 4GH4A 2RM23 5HCFA 3EBRA 5KXBA 5H9PA 1HDKA 1LOFC 4QD2A 1KD7A 1H4HA 4META 3NW4A 3WP4A 3WCSA 1MS3A 1BBT3 1ND3B 4Q4Y2 1LOEA 4M3CA 3VBOB 1BBT2 2RS13 2IZWA 4JC1A 3VKOA 4WVWA 5ACA3 5JWPA 4XJAA 1PM7A 4IXLA 4NWVA 1VBB3 3AKTA 3VZKA 2DURA 1KDKA 1B35C 2IXLA 1NA1A 2TBVA 3TRSB 1ONAA 3ZFGA 2R32A 4WM7A 3AMPA 1MACA 1VBA2 1UZZA 1PMIA 4J1XA 4NR1A 1GSLA 2QNKA 1F2NA 2E53A 2UURA 1PIV2 3CL1A 2BBVA 4AXOA 4EN6B 1MS1A 2ZJCA 1HRV3 3FWEA 1AL23 1HRV2 4Q0PA 4URTA 4YZ1A 3JQXA 1H8TA 1RHI2 2XHKA 3IMNA 4H7LA 5DZGA 4LBMA 1AJOA 4Q26A 4ZU5A 4NVPA 4LBQA 3W9AA 4QMAA 2Q1MA 2D3RA 3TOJA 3WW1A 1RJ8A 2YZ4A 2R1DA 2C0ZA 2PAEA 4FAGA 4XQ4A 2HEVF 1F5JA 5E8AA 2W08A 3MICA 4KU7A 3WHUA 1SQ4A 3NWKA 1RUC3 3SH3A 1PK6C 5DUWA 3A0KA 3PJQA 4ATEA 1OKQA 1MZ5A 2R6QA 2UU8A 4L97A 4JGYB 2P2KA 1G86A 1IQAA 1YFYA 5J48A 2D6NA 4B4RA 1BVP1 2XGXA 4XILA 4YRDA 3J8F2 1RUI3 4LO5B 4YGEA 3ROUA 5L7OB 1UAIA 3ZXGA 2P3KA 1VBC3 3OY8B 1PGSA 2TNFA 4S2DA 2B39A 3N7JA 4XHBA 1D4M3 2EALA 4YFZA 4EV0A 4D7TA 1DHKB 5DXDA 4OHXA 1I1EA 1CAUA 2HWF2 1SBDA 3VBFC 1PGL1 4KH9A 3V65A 1LEDA 4CDWC 3NV1A 3POYA 1DQ2A 3WP3A 2GAUA 3KB5A 3UV9A 1MZ6A 1X82A 4QPGB 4MX3A 1C4RA 3EXUA 1DG6A 5C8CC 4BLJA 3V0BA 3ZXDA 4I0BA 3SHRA 3FJSA 1EP0A 2WFF3 3AP7A 2JE7A 3DPRA 1N1TA 2QZ2A 4MGZE 4W6WA 2G9FA 2MEV1 1GNZA 1FX5A 3BPZA 3VBHA 4HZFA 4XIOA 1ZZCA 3SLIA 3TNPB 4AVSA 1X8EA 1LTEA 4LULA 2VMHA 1UPIA 4H55A 2XPJA 2B5HA 4Q4V2 4QQOA 4WZCA 4ORFA 4EWDA 3WDUA 1W6QB 1FPN3 5J09A 1OOPA 1XNCA 3RSJA 1PZ8A 1FPN2 2JG9B 2XKPA 4AGRA 1Z0HA 1CIWA 3AZZA 2VG9A 3WNXA 1H0BA 4MUVA 1REDA 1RUJ1 3AYDA 1UU4A 5C33A 5I8YA 4RR3C 4YLZA 4BIOA 2RJKA 1C28A 3JB8A 2MNGA 4GXLA 3HAGA 5KXEA 1N3PA 4WVZA 1ZBA3 4XW3A 2Z2SB 1RGSA 3MLJA 3AXEA 1ZBA2 2XL9A 1GICA 2PA7A 1W6PA 3AJYA 5CADA 1AR73 2ZGSA 2HWD3 5GLUA 1QOOA 4QQ2A 2WJSA 1RIRA 4AHZA 3MIDA 2QUOA 1EAH3 5BNOB 2W39A 4Q8LA 4Y5Z0 4DB5A 1EAH2 2GC3A 1SLLA 4Q4X1 1LOBA 3W59A 2XJRA 1ND3A 3TYJA 3LB9A 1ALYA 3VBOA 1I6XA 1MS5A 1MR5A 4YYOA 2XVGA 1LODA 1S2KA 4NOTA 5E16A 4BE3A 5FMOL 1DYKA 1FAYA 3HT1A 5SV5A 2GMEA 4JVAA 3VHNA 1SFNA 1MQTC 4N53C 1UKGA 4IV1C 4QM9A 1EV11 1FMD1 3RNSA 4TWTA 2XG3A 5FQ0B 2WIIB 1SLIA 4HETA 5C6CA 3WZ1A 2DCJA 1J58A 5BNQA 4PCRA 3JD72 1URXA 4COUA 3VBSC 2XKOA 2R30A 1IKPA 4PDWC 4JQRA 4E4ZA 3HIFA 4RQPB 4Y1XA 1R093 1PO13 1AR63 3M3QA 5JLVA 3T2TA 2FZ2A 3POWA 4JGZA 1PO12 1O4ZA 1UU5A 2CGNA 5IK4A 1HW5A 5I8SA 3AKPA 5JR7B 4Q4W3 2IWGB 4RGGA 4FTEA 3E6CC 2DU1A 3ZXEA 1NY71 3MW4A 2C9AA 4Q27A 2GC2A 2R49A 4Q0QA 5DDJ3 1GZWB 2B46X 4XPVA 3ZXKA 4FPGA 2Y38A 3VKMA 2FMDA 4JGYA 2XLAA 3PNAA 4MV2A 2CWMA