1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
molecule keywords putative xylanase
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
5A1AA 2WZ8A 3OEAA 1NKGA 2JE8A 1XNAA 2J1SA 4M4PA 1UXXX 3MUY1 2VO5A 2VZ1A 4XVHA 4HG6B 2Y8KA 2ZEWA 3MV01 2ZXQA 1UY2A 3K4DA 2V5DA 4UAPA 3UNPA 2QBXA 1WCQA 2YG0A 4BDVB 5C70A 5JR2A 3I2GA 2VCAA 1O8SA 4JKMA 4JKLA 3LE0A 3FN9A 2BGPA 1H6XA 2BBAA 1K3IA 2XQXA 2JKXA 3WNOA 2XHNA 5LCWL 2ZEZA 1J83A 4QDQA 4QX2A 1JZ6A 2QQKA 4QAWA 4QX0A 2R7EB 4IUGA 3HEIA 2PQSA 4AG4A 2ORZA 2W3JA 2B9VA 5IJRA 1CZVA 2E31A 4MO3M 3WNLA 3CKHA 1SHWB 1ULOA 2ZEXA 3CMGA 1F4HA 2L9LA 3DECA 3NRUA 1CZSA 2J1VA 2LS6A 2WQ8A 2Y6GA 1OF3A 4ZY9A 4OUEA 2RJ2A 1J84A 4XUTA 4QDSA 1JI6A 4MGSA 3A22A 5I0DA 4D8MA 3T0AA 5LA0A 4ZZ8A 3VD9A 3JXSA 2VZTA 2Y64A 3A21A 2X10A 2X05A 5IFTA 4TXWA 2ID4A 4CU9A 1RYYA 2QQLA 3HOBA 3I2JA 1L7RA 4D0QA 4ZZ5A 4A45A 1W9SA 2J22A 4BK5A 3LEIA 1UYYA 4UOJA 5EJ1B 4W8JA 2QQNA 3FHAA 3ABZA 2XONA 2EICA 1JZ5A 3P6BA 1W99A 3SKJE 3ACGA 1EUUA 3UESA 1NX9A 1CIYA 1JU3A 2W92A 2VM9A 2YFUA 3K75B 1GOHA 1TG7A 2VZQA 2VJXA 1GQPA 2WO3A 3WF1A 2V4VA 3HPNA 4LHSA 4DXRA 2Y6KA 1NUKA 4XUQA 5C7GA 2W87A 1OD3A 4OMCA 4GWIA 3T0BA 3ACIA 1JZ2A 3THDA 2W1UA 3ACFA 5DPNA 3T08A 3K4AA 2W1QA 4JKKA 4QB6A 2VZVA 3VDCA 1LNSA 1D7PM 1UYZA 2WN2A 4CUBA 1DP0A 2W5FA 2J1EA 3CZUA 4BK4A 3WQBA 2J1RA 4QDRA 3OB8A 1BHGA 2WAAA 3HNMA 1W8NA 1DLCA 2WYSA 4PT6A 4QB1A 2ZEYA 3IDAA 3SEEA 5JXIA 3ETPA 1P8JA 5B4NA 5HPOA 1K42A 4E8DA 3FHQA 2Y6JA 4QPWA 3VDBA 1UY4A 2QQMA 1WKYA 2B4KA 4ARYA 1GOGA 1CZTA 1XPWA 4QX3A 3C7FA 3HN3A 3WNKA 4E8CA 4OZOA 4XURA 1UY0A 5HXMA 1K45A 1O59A 1UXZA 3AC0A 5EIYB 3LEKA 3I97A 3GM8A 4OMDA 3C8XA 3F2ZA 4MOAA 4XUNA 2VC9A 2XOMA 5FUIA 3WNNA 2VR4A 1US2A 2QQIA 2W91A 1US3A 1W8OA 2VCCA 3GDBA 4ET7A 4DUXA 3IAQA 4A41A 5JUVA 2VZOA 2VZPA 2WN3A 2WUHA 1W9TA 3NNGA 4OYUA 3VD3A 3PUIA 2W9XA 3LPFA 3T0DA 5EJZB 2VL4A 3EB7A 3EYPA 5DN2A 5G05L 2YC2A 5B4XA 4CU7A 3D3AA 3BN6A 3WF4A 1GUIA 4GZ9A 5IFPA 2LW8A 2W1WA 4A4AA 4CUCA 2V72A 1GOFA 1I5PA 3OBAA 2CDOA 1MPXA 2J1TA 3WNMA 2E26A 2VCBA 2VMCA 3P1IA 4PF1A 4JHZA 3T09A 3W5NA 3T2PA 3IB3A 4ZXEA 4Z2AA 3W5MA 3VD4A 1YQ2A 1JYXA 4KI5M 2W94A 3C7EA 4KWUA 1T2XA 3WF0A 2W95A 4DUVA 5IHRA 1UWWA 2WO1A 3OG2A 1DYOA 3LPGA 5CYYA 3HNYM 3CDZB 3GGLA 4KMQA 2WABA 2E33A 3I3DA 2JDAA 2EIDA 3BGAA 3MV11 1KGYA 4MADA 3I2IA 2DCJA 2VZRA 4P02B 4A3ZA 2E32A 4QX1A 3VD7A 2EIEA 1JYWA 4XUOA 2Z4FA 1EUTA 3NJVA 1JZ8A 2VMDA 4YPJA 2J1UA 1UX7A 3K4ZA 4CUAA 2WBKA 2VOTA 3A7QA 4PQQA 4ARXA 4DEQA 1PMHX 1O8PA 5J1XA 4LQRA 3PUHA 1UYXA 3I3EA 2VQUA 3MO4A 3T2QA 3SEPA 2QQJA 1JZ4A 2VZ3A 3ACHA 4QB2A 3HJRA 4L0PA 3LEGA 1NAEA 5G04L 3T2OA 2BERA 3MUZ1 5LA2A 3NJXA 2WDBA 3C7HA 4M4RA 3ZM8A 1GMMA 4P08A 4RYDA 3CIHA 2W46A 2C9KA 1JZ3A 2RV9A 3LQCA 3K46A 2EIBA 2DDUA 1F4AA 3OGSA 2DCKA 2VQTA 3OGVA 2J7MA 5DQ0A 4AAXA 3I2KA 5IYYA 1XNTA 2X09A 2BGOA 2C26A 2CDPA 3ECQA 2YFZA 2C4XA 2W1SA 3MBWA 3I2FA 3VD5A 2WO2A 1ULPA 2VZUA 3C7GA 4DXTA 1PX4A 1UY3A 3HNBM 4LPLA 2J1AA 3U37A 1OF4A 3DYPA 3C7OA 2VMFA 1PMJX 4P5YA 4A44A 1JU4A 1SG3A 4BJ0A 5LA1A 1UMHA 5F7UA 3UETA 4XUPA 4DUWA 5DMYA 1CX1A 3VDAA 4BXSV 3J7HA 4CVUA 2QQOA 2WZEA 2Y6HA 1JHJA 1OH4A 3SKVA 1XC6A 4CU8A 4W4ZA 2JD9A 4MGQA 3CZJA 3OGRA 1UMIA 3THCA 3A23A 3DYMA 5JMOA 2VTFA 4GWJA 1KEXA 3FL7A 2WAOA 4P00B 5C71A 2YC4A 4TTGA 4W50A 3K77A 4A42A 1GU3A 3CQOA 4CU6A 3GXUA 1OT5A 3DYOA 1PX3A 5JXGA 2ORXA 5CZKA 1W0NA 2Y6LA 2RVAA 1K12A 5JXHA 3E1F1 4FI9A 3IAPA 1UY1A 1L7QA 2KD7A 1IQDC 2YB7A 1JZ7A 1UZ0A 2BZDA 2HLEA 3OEBA 1GNYA 4XZUG 2HYXA 3WNPA 4A6OA 1JYVA 4DEVA 3WF3A 3WSOA 4RN5A 1R64A 3I3BA 4JX0A 3WF2A 4DXSA 5JXJA 1TVGA 3I2HA 1H6YA 3NQHA 1SDDB 4LKSA 2VZSA 2W47A 2VMEA 3WEZA 4UI9L 3IIIA 1W9WA 1HN1A 1JYNA 2OKXA
chains in the Genus database with same CATH superfamily
4PBOA 2KM2A 1LODA 2I2SA 4IESA 2EF6A 1QF3A 2PTMA 3MICA 5FYVA 5A7OA 1ASJ3 4QQLA 3VBSC 3WDUA 4CA9A 4CDUA 1V00A 1W6MA 4XF3A 4I30A 1RINA 4NRQA 1XNDA 2VZ1A 3VBOB 3ZFFA 4LULA 5IAXA 1G9AA 2WQZC 1LJ7A 2DCTA 2CTVA 4XHBA 1A78A 2E6VA 3O14A 3LKJA 5BPXA 5JIUA 3I2OA 2JDUA 1UY2A 4CXWA 3LEMA 3M7AA 2WT0A 4FPOB 2YG0A 4UW3A 5BNOC 2WIIB 5C70A 1PM4A 1X50A 1ZRIA 1O8SA 2XLGA 1OLME 3D6EA 3JD73 1RUH2 2DWRA 1H6XA 1VRH1 2XQXA 3BOPA 3LE0A 5EYXA 1IPKA 2HWD2 4QGLA 2XHNA 5C8WA 1HRV2 1ZBE1 2ZEZA 2NPIA 5FYCA 1YHFA 1OH3A 2EXHA 2K0GA 4D7SA 4ZHNA 4QX0A 3PDQA 2R7EB 4LEJA 4NPRA 3THTA 4AEDB 4AQ2A 3LIHA 5DG1A 5LY2A 4AG4A 1F8VA 4NUBA 4YGBA 1ENSA 4NWVA 2OT7A 4BQWA 2P3JA 4Q4V3 4EZ4A 2C0ZA 4WV8A 2A5ZA 4XQWA 5T55A 1AX0A 2E9QA 1QJZA 3CKHA 1SHWB 1ULOA 3VLBB 2RMU1 3PHMA 5F6LB 3U75A 3Q8FA 2WFPA 3NV4A 5FZAA 2FDHA 4HANA 4PJYA 4K3UA 3DECA 4JQRA 2BNMA 2QDRA 5FPLA 2DUOA 3NRUA 4AF9A 1CZSA 5DUUA 5A3MA 2VQAA 4ISRA 5EQUA 2I07B 2DF7A 1WLDA 1OF3A 2XH6A 4XUTA 1J84A 1U0AA 3U1XA 4GB31 1IS3A 5FP4A 1E57A 5CFDC 1DQ4A 1ULDA 3M8LA 2YUEA 4IGQA 3T0AA 5LA0A 4FFGA 2WZPP 4I01A 1QJY1 2VZTA 1GP4A 2WNVB 3IDBB 4XF0A 5FPZA 5DG2A 4RGGA 3VV1A 1XU1A 3AFKA 5IFTA 1GQGA 5AFBA 4KH9A 2VUCA 4TXWA 2ID4A 4ASLA 4CU9A 2V73A 3IN9A 1FX5A 3H7JA 2WS92 1W03A 2RMU3 4YM0A 2QQLA 2VOXA 4PLMA 5IVJA 2ZGUA 3HWJA 4Q0QA 4MUVA 1MEC3 2VH9A 4D0QA 4ZZ5A 4UW6A 4IEWA 4A45A 1O7FA 1GNHA 3J7MA 2ZACA 2JDYA 5E6HA 1S4CA 4HSLA 4DRRA 3O1SA 2AR6A 3ZFFC 3KV6A 2ZX4A 1HW5A 5LK7B 2BOJA 2C5DA 4FOWA 1RUE2 2D3PA 1XRUA 3RNSA 3K2OA 5I0SA 1Q8VA 3GNEA 1Z0HA 4CTEA 3UESA 1NX9A 1YC61 1CIYA 1KFUL 4MZUA 3VZNA 4B1MA 1FXZA 3K75B 1SLIA 2HWC2 1C8M3 4QHOA 3DEMA 4BXFA 5KXDA 4BMEA 4ZKTB 1ZZ8A 2PHFA 1LHNA 4YVWA 3WF1A 5H9RA 4F7ZA 4BPZA 4IV3C 1A3KA 1PGL2 4FSJA 1NUKA 3KM5A 3TYJA 4UFLA 2JB4A 1RUJ2 1W6MB 2CNAA 2ZCWA 2W87A 1OUXA 3JB8A 3ON7A 1W3XA 3C3VA 3VBSA 1YO8A 1QQP1 2LALA 4JDNA 4MGYE 3O0XA 3L9JT 2A6YA 3H42B 1RUJ1 3WG3A 2A6XA 1VBC1 3ZYRA 4Y5Z0 2B9UA 3VDCA 4HVQA 1AX1A 1UYZA 4EWDA 3FLTA 2AGSA 4CUBA 1XSQA 2W5FA 2VVEA 5FZEA 1IPSA 2RDSA 5JPNB 4RS5C 1DYPA 3JBG3 3ZFGB 2J1RA 3GZEA 2WC2A 2IVIB 3EBRA 3HNMA 4PIZA 2WYSA 2PHUA 3DPRA 4HSJA 4XJUA 5FK7A 1V6JA 2OPWA 2Q1MA 2JDHA 3NL1A 2HWE1 2XPJA 2IXLA 3CJIB 1U5XA 1LU2A 4LNVA 1P8JA 3MFAA 3JD72 4FPLA 1LESA 1LR5A 4YG3A 1C8M2 2DUPA 5ACA3 1AR81 2W68A 1LOCA 3MGUA 1B35A 2Y6JA 4GIQA 1FMD3 1VBE3 2P34A 2RM23 1RVF1 3GALA 4N53A 4QPWA 1S0GA 3NO8A 5F32A 3IWZA 5JIAA 4IEPA 2B45X 4FOVA 4QQPA 2B4KA 4GKYA 4BCUA 4YFZA 1KDMA 4NHXA 2JX9A 2VOKA 4Y1UA 3S5QA 3N4MA 2VGDA 1JUIA 3Q9OA 4YVWB 1GICA 4JGZB 1ZZBA 2YBSA 4BB3A 1O3RA 4OZOA 3PNAA 1W2OA 3AVRA 4BU2A 4O9GA 1LHOA 2UU8A 2BUKA 2QZ3A 4LXLA 4QPIA 4XZPA 4Q1PA 4LOTA 1NG0A 2R16A 1JXNA 1S2BA 3ZKYA 1GQHA 2ZTNA 3ZXJA 3C8XA 4XUNA 2VC9A 5FUIA 1O4YA 4XAEA 2FD8A 3H1WA 2VR4A 4FFHA 2QQIA 2W91A 3UKTA 1CPNA 1W8OA 2RDNA 1W6NA 5T52A 3AYEA 3LDKA 4DY5A 3POBA 3GDBA 5C5UA 1HXS3 4RR3B 1W90A 3ZYJB 3MLLA 1GANA 1ND3A 1OQ1A 4IEYA 2RS52 1E5SA 2NQYA 5A7WA 1CX1A 2XQRA 2VZOA 2ZGQA 2P5BA 4WM8B 5CG9A 2WN3A 2WUHA 1W9TA 1C28A 4CDWC 4EQVA 2R1BA 3T4VA 2UWCA 2YC0A 2HWF1 4OHVA 2DU1A 4YGCA 2YV8A 3VBHA 3O1RA 2VL4A 2JDMA 2UWBA 3DXUA 5F5CA 1G8WA 1TME2 4CU7A 1GUIA 3HT2A 5FIXA 4GZ9A 5C6CA 1BEV3 5CKMA 3WNKA 3ZYHA 3E6CC 1X8MA 1DQ6A 2CWSA 4W6WA 5FV3A 5FZIA 3B9CA 3MW4A 1RXFA 1TNFA 4GWMA 3ZYFA 5FPXA 1OMIA 5FY5A 1I5PA 1SPPB 3VBSB 3OBAA 2HWC3 1GFF2 1O4ZA 1QJU2 1CIWA 1UZVA 1MPXA 4HONA 3EO6A 2IXHA 3WQ1A 2KXLA 3LCPA 1ENRA 4CDUC 2VCBA 4YWAA 2VBPA 2VMCA 5F3IA 5C3QA 1DZTA 4CP9B 1EAH1 1X9PA 3ZFEA 2W52A 1ENXA 3NMBA 1YNAA 1HDKA 5GLUA 3AK0A 4QXCA 4LK6A 3FX3A 2EAAA 3VZOA 1VBC2 1YQ2A 3VD4A 1H1AA 1EAH2 2VAUA 4KWUA 1T2XA 1S2KA 4K20A 5IHRA 2YBPA 2VMHA 1UWWA 2WO1A 3ZFGC 1UL9A 4KGGA 3LPGA 1HN0A 1UCXA 4PDWC 4WVMA 1GP6A 3LA3A 4KMQA 4QX8A 2R041 1W6QB 1AL21 2E33A 2X5IA 4XQDA 5D8AC 5BNOB 3BGAA 5FK8A 1JH5A 4G9SB 4RR3A 3MV11 2GNMA 3JUUA 1HRI2 2DCJA 1CD3G 2ZZJA 3MIFA 4P02B 4RS5A 2R30A 5K9YA 4XEZA 3W9AA 2MPFA 4QKNA 4WVZA 1JYXA 3UL2A 1JZ8A 3USSA 2RDRA 1IKPA 1N1YA 1W8ZA 3OGJA 1YI9A 2PLV3 1J58A 1OD5A 4URTA 4J1XA 5T5OA 5J7MA 2BJSA 4ITCA 2VOTA 3KZ4C 4LOSA 4XOGA 5K0UB 5C4WB 2D6LX 2V4AA 5DAPA 2BFUS 1PMHX 2GSYA 5J1XA 2TBVA 4P9WA 1WA4A 1PNGA 3EHKA 4B1LA 2P6HA 3WXPA 4Y26A 2OZ6A 5LBFA 1CPMA 2ZKNA 4QQ2A 4L92A 4M3CB 2V09A 2WS91 3LAGA 1VE0A 3QD6A 5JAXA 4XPVA 2O8QA 3JBG2 4HT1T 1XB9A 1VBA3 4XYXA 1S55A 1REDA 3DL3A 5IVEA 1UU5A 1XQNA 2VOWA 4IE0A 2JENA 3O0VA 2ZX1A 5I8SA 5KXBA 4L0PA 5G04L 1W6NB 1O3QA 3VGIA 1E5RA 1R081 2ARXA 2VQ0A 1BBT3 3EQEA 3NJXA 4G4FA 4AFBA 2WDBA 2D6NA 4M4RA 3ZM8A 5HI0A 4Q4X2 4RYDA 5DUVA 5ANQA 3V0BA 1LTEA 3DCQA 3SC7X 2AACA 2VG9A 3T4HB 1PO23 1AR61 5FZ9A 1R1A1 2JDKA 2YMZA 1Q8SA 1VBE2 5FKCA 1G9DA 3LQCA 3K46A 1AXYA 4CCLA 2DVAA 4QQOA 3SXWA 5CIRA 1JYTA 3OJBA 4FPCA 4NO4A 5FOBB 5LRSA 3M3IA 4UWDA 1PZ9A 3ZYIB 1NOVA 5IK5A 4ES8A 1NCRC 5AC91 2VBDA 5FKBA 4HLTA 4LORA 5JDBA 4CE8A 5DQ0A 2QQWA 4LA3A 3VKNA 4URAA 1VBE1 4I2OA 5AC92 4QM8A 2FMYA 3WW3A 4GJYA 1V9U1 2A3WA 3ME2A 5CKQA 2GP3A 4XXPA 3WG2A 5KHIA 3FLRA 3USUB 2HWD1 2IXCA 2WT1A 3KCXA 1OSGA 4XJAA 5A3WA 2FDKA 1GZ9A 5FMOS 5C4WA 2W1SA 2D97A 1B09A 4TSVA 1RC6A 2VZUA 3FMGA 4HN1A 1QDOA 3B3QE 2C1FA 2D93A 4Q4Y3 4BQXA 2WNEA 5C9AB 4C1XA 4GJZA 2IXIA 4HPKB 4L97A 2DUQA 1ODNA 1W2TA 5EZWA 3U37A 1UF2C 1PO13 2WLPA 3DYPA 2ES3A 3RWNA 3C7OA 4AVTA 1LOAA 4X6RB 1V6KA 3MYXA 3ZFFB 3VBOA 1WGPA 2Y26A 4BJ0A 1S1AA 4WZFA 1RUNA 3VKOA 1Q5OA 5F7UA 3UETA 3BUCA 1EAH3 2D3RA 1DGRA 2G4IA 4XF1A 2E63A 3AZXA 5D8AA 1OXCA 1H1MA 1CAVA 1WCKA 4YVSB 5FZKA 3RRDA 1VAVA 4XF9A 5FTTC 3ZDSA 4AEJA 3KGLA 4RS5B 3RJ2X 4CDWB 2VMGA 4XJWA 4N90A 3VB9A 1FT9A 3ZYGA 3AXEA 2WZEA 5FYBA 4DO0A 5A70A 2I74A 1N3OA 1JHJA 4LHLA 3SKVA 1XC6A 4JTOA 1CAWA 1OKOA 3LOBA 1DU3D 3CU7A 5DZFA 1QNYA 4XAAA 4IV3A 3WG1A 1J59A 1W8TA 3VBRC 4YVWC 2ZAHA 4DMIA 4UW5A 3DYMA 4Q27A 4E27A 3ZXKA 3NJYA 5FLJA 2IUWA 5JMOA 1FPN3 1OVSA 1OOPB 2Y0OA 3BALA 4Q4Y2 2PLV2 1KEXA 3RZKA 3FL7A 4OHXA 2WAOA 5FZDA 1UO9A 2NZ9A 3PURA 4EE2A 2EIGA 2ZGNA 2BDRA 1NZIA 1PO21 1TMF3 1A8MA 5FPBA 5CFDB 4W50A 1SMVA 1ODMA 4OI2A 3ZKUA 4CPBD 3GJAA 4GMP3 1RUI3 2DFBA 4LBOA 4CU6A 1OT5A 3DYOA 2XUMA 4ISQA 5FZOB 5J3UA 2XHKA 3IPVA 3WHUA 3WW4A 1VBA2 2XBO3 2RVAA 1VRBA 1PK6A 3S7IA 2WNVA 1J3QA 4AQSA 4FI9A 4LBKA 1DZRA 3P3PA 1SCRA 5FZBA 1UY1A 2PN5A 1MS9A 4XETA 2BOIA 1V6LA 1ZM1A 4MVTA 4CP0A 4GB33 3TRSB 5FZ4A 2XJTA 1PHMA 1T6GC 3GZAA 1OA3A 1KS5A 1MZ6A 2IFRA 2ZOEB 3DKWA 5DAQA 2N7GA 4LHNA 3RYPA 3NAPB 4COZA 5F3GA 1VMFA 2QVSB 2R1DA 1IHMA 3M3QA 2ERFA 4DPNA 3I59A 4RN5A 4RGKA 2Q4SA 4DXSA 5JXJA 2EXKA 3KGZA 4I09A 1A34A 4YM2A 3J8F1 3ILNA 5JPMB 1TME1 4CCCA 4LKSA 4XCAA 1OLQA 4IV3B 1PNFA 2Z69A 4YNIA 5FYHA 4R4XA 1J3PA 2WFF1 5HV0A 1AR71 1SACA 1W9WA 2BGCA 4XURA 3U4XA 3CBNA 2VW0A 4B7KA 1N1VA 1AYM2 1BYHA 5FP9A 1AL23 1NKGA 2D43A 3AMHA 3OEAA 2RS51 1W05A 2A1XA 2BWAA 4YW7A 4UF0B 3VL9A 5C8CA 3VKLA 5FWJA 5K0UC 1XNAA 4LK7A 5CB7A 2XJQA 3OD4A 4QWNA 2VO5A 4XVHA 1HJGA 4HG6B 2GDFA 1ZRDA 3OCPA 4S2HA 2YPDA 2ZEWA 5LY1A 2R32A 2LTNA 3UNPA 2V5DA 4UAPA 5KC6A 3RFRA 4AWDA 3HQXA 3ZN5A 1PO11 4GB32 4AE2A 2DCZA 4IDZA 4BDVB 4NIHA 4B4PA 2OUHA 3GBWA 1D4M3 1VMHA 1EV11 1NA1C 4FVVA 1ULEA 2AZ5A 3B9IA 1UPIA 5A3NA 3W20A 3FN9A 2FDFA 2QQUA 5CA6A 1H2NA 1MZFA 1RUD2 1J83A 3B93A 4ZU5A 3POWA 4YG6A 5DZGA 4OI1A 4QKDA 3J7NA 1W6PA 2PQSA 1MQTA 1RVF2 4Y1ZA 3PTRB 2A6ZA 3RZJA 2W3JA 4S2GA 2IC1A 5LW9A 3VBOC 1LECA 2P3YA 4XFIA 4AI2A 1RUOA 1WW5A 1XNCA 3POGA 4UFKA 1XYNA 5A6YA 4WZCA 3WNLA 4Y1VA 2ZMKA 3IDCB 5JR7B 1OOPA 1X82A 4XE9A 2I45A 3KVBA 4K1ZA 5JI7A 3AJYA 4IEOA 4E2QA 1RJ8A 2L9LA 4CEWA 2A70A 4KWJA 1W3VA 3OD0A 4YZ5A 1E5HA 4M00A 5IW0A 2RS31 3LFMA 2FDJA 3TN93 3VBHC 3OUHA 5CFDA 2OYZA 4QPIC 2J1VA 2WQ8A 1X36A 4AI3A 1CONA 1BMV2 2RJ2A 1R092 2Q1ZB 3FE5A 3JCIA 4CUGA 1CJPA 4QDSA 3I3QA 5F9TA 1JI6A 1IPJA 1VBB1 1AR92 1AJOA 3MI8A 1QJFA 2G19A 4Y1YA 3JXSA 5FBJA 1UZYA 2Y64A 2ZAAA 3UT0A 2OQ7A 3H7YA 4QPGC 2WNUB 2VUDA 1JN2P 1YQCA 2D3SA 1RYYA 5IAVA 1POV1 4PI2A 3HOBA 1BKZA 2JG8B 4N7IA 1S0FA 2XBO2 1O3SA 2J22A 5CKNA 1VBD1 2QQNA 4DNYA 2XONA 1MR5A 2EICA 1JZ5A 3ACGA 4LBMA 1NXD1 3ZXDA 1E5IA 1YFYA 3ILRA 3KVAA 3FBMA 1W2NA 3AMQA 4J25A 1AXZA 2QCSB 4K9SA 4RFRB 5EJ3A 3UGHA 1AYN3 3AB0A 4QKFA 2ETEA 3H9AA 3BTAA 3TEZA 2RR11 3VHPA 2AC1A 1JU3A 2JG9A 1QJX1 4N9HA 4Y1XA 2XJRA 3Q8BA 4KWKA 2GAUA 2B42B 3ZXLA 1GWMA 4C0HA 1MS1A 4AGGA 5KC5A 3OPWA 1XBFA 3NW4A 4IEVA 4R9BA 3FZ3A 3UK9A 3Q8AA 2XWJB 4FPFA 3RZLA 1VP6A 3HPNA 4LHSA 3MIEA 4PIXA 4ZS2A 3M70A 4RL7A 5C8CB 4XUQA 5CBLA 1K5JA 1NCQC 4YARA 3BKZA 1OD3A 2BW8A 4E4HA 4GWIA 1JZ2A 3ACIA 4L9BA 1GYKA 3CEWA 3ACFA 3T08A 5SV5A 1RUG3 1HQWA 4FPHA 4XDPA 5FPVA 4QB6A 3HIFA 3H8RA 2VU9A 4HMZA 1LNSA 1RJ7A 2DURA 1ND2C 1XNBA 4QM9A 1EV12 5FMDA 5F2WA 2O14A 1XOYA 3AP9A 1QOOA 5AFEA 1DP0A 4BIFA 1YCIA 2WL1A 2J1EA 3ZX7A 4LT5A 1IG0A 1ND3B 5CNAA 2JG9C 5A7WB 2Y34A 2EVXA 1FI2A 3GF6A 4N43A 1HRI3 2GH2A 3WQBA 1PVC2 2WNUA 2GNBA 1DQ2A 2UY8A 3HBZA 5KHGA 2PHWA 3T1MA 1LRHA 3NNLA 5FYSA 3AM2A 4GH4B 3IDAA 1XSRA 2DV9A 4UXAA 3SEEA 5JXIA 4RHV1 3AZYA 4MGIE 3S0MA 4AI9A 3O1UA 1GKBA 2D6KA 5F5IA 5JWPA 5BNPC 3BTYA 4WM7A 5ABJB 3WQ0A 1VMJA 5KWRA 4FQ4A 1G7YA 1MS8A 3RMYA 3ZPYA 5FOJB 5LBBA 1RXGA 2QQMA 2SLIA 4XCBA 3KB5A 4ARYA 2VVDA 2X29A 2QZ2A 1CZTA 3N9NA 4HOOA 2D44A 1XPWA 3QOPA 4QX3A 3KLSA 3N36A 2O0OA 4Z8BA 2VTXA 3SNMA 3LDRA 1PZ8A 3ZFEB 4E8CA 3CJXA 4CDQC 5L36A 5BXXA 2AH2A 1UY0A 1HV0A 2IFWA 1U5YA 2WA4A 3T2TA 1LEDA 2BP6A 1G9FA 3PLQA 5EIYB 1M4WA 2WSUA 1R093 3OPTA 1S0EA 5DXDA 4YW3A 3BIEA 3I97A 2PYTA 5GLTA 4F8AA 3IMMA 3ZSKA 3F2ZA 1AR93 3FWEA 4Q1RA 4Q8LA 1FV2A 1RUC2 3NJZA 4FPEA 3TNQA 1US2A 1H2MA 4MHRA 1Q56A 5GLWA 4IEUA 4XFFA 1CN1A 4KQ7A 1H8TB 4X6QB 2HWB3 3M4FA 3SQOA 3CO2A 4C1WA 4ET7A 1LEMA 1W9YA 2CHHA 1RHI1 4XFGA 1N1TA 3NV2A 1CAUA 1REEA 2EALA 4GKXA 4W6XA 3WY6A 5A6ZA 4ASMB 1STMA 3NNGA 3HR9A 4OYUA 1W0OA 2FZ1A 1OUSA 1ONAA 3PUIA 3I3MA 2AYHA 5FRAA 5I0TA 2R043 5CU1A 1SFPA 1FOD1 1V70A 1ZRFA 5B4XA 3U0ZA 3BN6A 1QWRA 1X7NA 2ZGMA 4FBFA 5A3OA 2W1WA 4XFAA 5EFUA 3NNFA 5A33A 5T54A 1JTZX 3POEA 1GLHA 1GP5A 4N53B 1LULA 5C5TA 1QU0A 5FZ8A 1ZRRA 1DCSA 1AVBA 5A7PA 3ZSMA 2J1TA 4XMAA 3BPSA 1F5JA 2Z5WA 2AEZA 4XTMA 3FJSA 2JDZA 3VHNA 5A7NA 1QH6A 2NYYA 4XMIA 3N7JA 4XTPA 4EN7B 1URXA 3I7DA 4HKLA 1RUC3 3E5UA 3AMPA 1Y9QA 2WNOA 3I8TA 4XQ4A 1ALYA 2WZR1 5IVCA 2F4PA 1W0PA 5C9AA 3T3YA 3ZFGA 4JGYA 5GZGA 1J1LA 2HWB2 3AKTA 3KV4A 3QCWA 1ULCA 4BHPA 1RL3A 2W94A 2IXJA 3C7EA 4LBNA 4P14A 4K8FA 3R4SA 1APNA 4Y4RA 2RS33 4GA9A 1CAXA 1DYOA 2PAKA 4RQPB 1POV3 1VALA 2CU5A 5CYYA 4DIQA 2RR12 3HNYM 4UT5A 4NPMA 4LBQB 3H8XA 1QQP3 2P2KA 4YW1A 1C8NA 2JDAA 2EIDA 1LAJA 3CHXA 1WA6X 2ZKLA 1JW6A 5FYMA 4B29A 3TEWA 3IBMA 3AFGA 4W6YA 1JODA 2ZGSA 4D3WA 1SLLA 2E32A 3R4UA 4YW2A 2D40A 1EY2A 1S0CA 1OPMA 1MS5A 1EUTA 5A3PA 3ZOIA 1CAWB 4UBGA 2JEMA 4XF4A 5E1RA 3BCWA 1AXKA 4TLGA 1RUH1 4IEQA 3SH5A 1TMF2 4LLOA 1I6XA 2BEOA 2R071 5FY0A 1O8PA 3E97A 4XILA 5BNPB 2B8MA 1FMD2 2RM22 4LQRA 4JGZC 3B01A 1SPPA 1NLSA 2WFF3 3SHRA 1TE1B 1H9PA 3AP5A 1PIV3 3A4UA 5LA9A 3T2QA 3IMNA 5BNNC 4YM3A 3FUOA 2HWE2 1YIFA 3J8F3 1X9TA 2ZX3A 5FY4A 1PVC1 2CAUA 2VNVA 3KD4A 3MW2A 1AR62 2JXAA 2QQJA 2YPJA 3OBRA 3AKQA 2VZ3A 3OY8B 3ZN4A 3ACHA 4QB2A 4DY3A 3NNMA 1NAEA 3NAPC 4QGMA 1NA1A 4CCMA 2BERA 2FMDA 3WDTA 5HCAA 2AENA 1WBLA 2E7QA 1N47A 3SISA 4D69A 3C7HA 3M2MA 1RUF3 3WT3A 1CAUB 3CIHA 5FLIA 1CESA 2C9KA 3ACLA 3X29B 3RMXA 2G9FA 4H14A 5FBZA 4WBBA 5TSWA 1JZ3A 2RV9A 1WMXA 2EXJA 4QU2A 2OXBA 5BNNB 1LENA 2B5HA 2XDVA 4LKFA 4LBQA 3R6SA 2DDUA 2ZGPA 5FZ3A 2HWF3 2WNVC 1DGWA 1R1A2 2PXJA 5FZMA 3HD8B 1H8TC 2KA3A 3ITQA 3VKMA 1W04A 2VQTA 1HRV3 4CEWC 5KXCA 4O65A 2C24A 3IKWA 4U2AA 1QJX2 3PTYA 1BCXA 1TEIA 4NAOA 4YW4A 1O91A 3I2KA 2RJKA 2YDEA 3RG0A 1WZXA 1W8UA 5JSRA 3ECQA 1JS9A 1TME3 1MZ5A 5K0UA 1FAYA 2C4XA 2Z42A 3VD5A 3I2FA 4HL0A 2WO2A 3PMSA 1IKQA 1ULPA 1NY71 5IK4A 5D2AA 1GNZA 5A3LA 4AHZA 5AVAA 4X8PA 1UY3A 4Y5SA 5FO9B 5DAVA 4Q4W2 3LGRA 4RGAA 1QGLA 4S2DA 3WD5A 1WD4A 4LPLA 2J1AA 3AJZA 5ABJC 3BPZA 3AX4A 3MZHA 3O7OA 2WWJA 3M3EA 4CDXA 5FXZA 4IE4A 2D5HA 4I0AA 1PMJX 4P5YA 4A44A 1B35C 1JU4A 1YLLA 4K7JA 2H0BA 3GHNA 2YGLA 1YQ5A 1NY72 5EPAA 3S6PA 3WV6A 5LA1A 4B7EA 2JDPA 5D1IA 3D4KA 3P3NA 3RZZA 4XUPA 1QJY2 1YI7A 4FPKA 5FZ6A 1OFNA 1HRI1 1CJDA 4CVUA 1W8FA 2QQOA 3POIA 3ZYBA 1XE0A 3ZXFA 5C4WC 5IVFA 4GMP1 4D7YA 3CLPA 4DFSA 1DGLA 1L3JA 3LFIA 3UKNA 3TN92 3RDIA 4LHKA 2ZGOA 1A6CA 1MQTB 3OGRA 3QBQA 3H8UA 4R8HA 5DABA 5LK5A 1F5FA 4PLNA 5T50A 3THCA 1F15A 2ILMA 2K2SA 1ULFA 5LEJA 2G9ZA 1FPN1 5J09A 3VBUC 4BQ4A 1PVXA 2TEPA 3E5XA 5CFCC 4XDQA 1QOSA 2JDNA 1Q8PA 1SQ4A 1D2SA 1D4VB 1UZZA 1VBD3 3I4IA 5ERLA 4QXKA 1SCSA 2E51A 2ZS6B 3NSTA 4R9DA 5LZ6A 5I91A 2RS32 3FLPA 1C3HA 4H7LA 4NPLA 2P4EA 3K77A 5GLVA 1GU3A 1NLRA 3GXUA 1PIV2 3VL8A 1RUJ3 3BTZA 3PVNA 3HQUA 1NE6A 5JZGA 2Y6FA 2D5FA 2ORXA 4AFMA 1NLQA 1QNWA 2A71A 1W0NA 1RMU1 2CV6A 3ZXGA 2JJ6A 4YM1A 2CGNA 4Y4YA 4Q5OA 3LF7A 5JXHA 5AVPA 4LUMA 4AR2A 4CDXB 3KV9A 1MVEA 5FJHA 1HKDA 2KD7A 1IQDC 2YB7A 4XIKA 2ZGKA 5LEKA 2R072 2HLEA 2RJLA 1GNYA 3IZOA 2OS2A 4BQ3A 3P5BA 5CAZA 5J48A 1I9RA 2NMNA 5JSOA 4FPYA 1CAVB 3VKFC 3AKRA 5FZ0A 3S7EA 2PAEA 2GMPA 4DEVA 1Y3TA 1ZBE3 4NVPA 4QPYA 5EV7A 2VUAA 4EV0A 5L73A 4XW3A 4I0WB 1AYN1 1WLWA 4OI4A 1TVGA 2FHRA 4HBNA 3WINE 4PBPA 2C9AA 1BXHA 1R1A3 2BRTA 3MFCA 3OBZA 5FZCA 1UZWA 5FP7A 2VZSA 1N3PA 4FCAA 4AFDA 1HLCA 3APBA 4IE5A 5F3EA 3WDWA 4NIIA 2NMOA 3WEZA 4K21A 3FFZA 4ZU7A 4UI9L 2XMLA 3IIIA 5GKAC 1HQNA 1RIRA 1JYNA 4NWWA 2GN3A 5FREA 4HPKA 1KDKA 4FO9A 1RMU2 5CISA 5F1RA 3K3NA 3WDYA 5A3TA 2CGPA 3J26N 3MIGA 3ENRA 2J1SA 4M4PA 5C3PA 1W6OB 1UXXX 3K3OA 5IUQA 4CEYA 2RS13 4V1PA 5F3CA 5E88A 1BJQA 5L7OB 2Y8KA 2XKOA 3MV01 1C5IA 4N43C 3K4DA 3SCFA 5C33A 1QIQA 1VBB3 2XJPA 4Q4W3 1WCQA 2BQPA 1FNZA 1XYPA 2FCTA 2HBTA 4KGQA 1MACA 5D8AB 5FZLA 2WZR3 5JR2A 4FPGA 2EXIA 2WQ4A 4COWA 2B39A 4CCEA 1BBT1 1PK6B 1G9CA 2BGPA 4R9CA 3WNOA 1K3IA 2LRPA 4FT8A 4Q0PA 4DQAA 4MYEA 3KT1A 5LCWL 5FDBA 3ETQA 3QACA 4QX2A 4JVAA 1KQRA 1WUVA 2QQKA 1QJY3 3BIWE 3OF1A 1Q8OA 3RS6A 1ND3C 2ADDA 1LOEA 1NE4A 3AP6A 2JE9A 5BNQA 2GN7A 4B8EA 2B9VA 1RUE3 1OVPA 3N7KA 5IJRA 4BM8A 3ZN6A 2E31A 1MEC1 3AKSA 1RUF1 4PCRA 3ST7A 4MLOA 3CMGA 1XYOA 3U11A 1BQPA 5A6XA 3TAYA 3B94A 1RMU3 1YFXA 2RE9A 2WLQA 3FFQA 1YUDA 1QOTA 5FZ1A 2AEYA 5JOWA 2XVKA 3E5QA 2BU9A 3CF6E 1COV2 1WW4A 1EPWA 5T5JA 2Y6GA 4S2FA 4ZY9A 4OUEA 2RDQA 1GSLA 2GMMA 3B00A 4COVA 1HB2A 3D5OA 4NR1A 1YQ8A 1ZA4A 1HV1A 3A22A 4RR3C 5I0DA 5FCCA 4CPBA 1OQDA 4RQPC 1UNBA 4IEZA 4O7XA 1HB3A 1VB4A 3VD9A 2R49A 1NT0A 1UU6A 3OSDA 4FFIA 2X10A 4CP1A 1IOAA 1RUH3 2XJVA 3HVDA 1OC1A 2D7FA 5L7OA 1SLTA 2FCVA 4AL9A 4BWOA 3KMHA 3ILFA 4M0HA 3OBTA 1POV0 4W8JA 2XR4A 3PIGA 1BZWA 4WM7B 5ABJA 1YXWA 4GULA 2AREA 1OA4A 4PIYA 5A32A 1W99A 1SZBA 3WP6A 1EUUA 2XWBB 3VBFC 3R0RA 4YZ3A 1LGNA 2XBO1 2YGMA 3ZVXA 4O9EA 3VUOA 3RYKA 4WM8A 5GZCA 4LLFA 2BFUL 2RG4A 1UIKA 2W92A 1QHDA 2YFUA 3AZZA 4V2VA 1GOHA 3O5SA 1TG7A 5T5LA 1W9FA 5IK8A 5ACA2 4I3PA 1GQPA 1PMIA 1SBDA 2JD4A 2WO3A 4DB5A 5FO8B 5CG8A 3ZN6B 3UGGA 4XC9A 5B2GB 2QKDA 4AW7A 5C7GA 2Y33A 3CNAA 4QD2A 5KHJA 3AYAA 1I3HA 4ZS3A 3T0BA 1W39A 3BU0A 1W6OA 1MZEA 4R4ZA 2XL7A 5JLVA 4LO5B 3THDA 2P6CA 1WLTA 2W1UA 1RUG1 3INAA 1ASJ1 3PUSA 4CXXA 2X5IC 3K4AA 5JMCA 2W1QA 2ZMNA 2GC2A 1KRIA 2VZVA 2X53S 4MSVA 4Z2WA 1W28A 1ASJ2 4COYA 2VW1A 3J4UH 1YJKA 1RUI1 4FPJA 2W0XA 1SFNA 1CGPA 2FDIA 5JSPA 4YZ2A 4FP3A 2ATFA 3OB8A 4QDRA 2FZ2A 3GYDA 5FZFA 1DLCA 2QFEA 4PT6A 4QB1A 4COUA 5IATA 1W6PB 3LA7A 1Z7S2 1RGSA 1CAXB 2JG8A 4RQPA 1DG6A 1C1LA 4Z07A 4R52A 4UFHA 3VZLA 1ST8A 3RJRA 2PAMA 3GZTB 4P9LA 4ES9A 5IT6A 1AR83 4CCJA 1PGL1 3G6JB 1K42A 4E8DA 2O8OA 3FHQA 4GXLA 1TQ5A 2ZX2A 4LO7A 1HIXA 1ZX5A 1R082 4QU1A 5F39A 5HCFA 1UY4A 1EPZA 3A0KA 1WKYA 3VBUA 2VW2A 2XVLA 3VHOA 4RHV2 2HWE3 5A6QA 1GOGA 5BYNA 5KBFA 3MDPA 4IGPA 4EN6B 3H8OA 1X33A 4QHBA 3L2YA 3QLQA 4U36A 3H1YA 5IWFA 1R1ZA 2F4LA 2Y38A 3FHIB 3AZWA 2PFWA 4NHYA 3U78A 5C3OA 3D0JA 3KF3A 3NV3A 3W58A 3SH4A 1AX2A 2ARBA 4OVEA 4Y20B 3WW2A 1PIV1 2YU1A 1O59A 1UXZA 4AZZA 1DF0A 3GCWA 2DYCA 3LEKA 2DVBA 5GALA 2FQPA 1LOFA 1AR91 1OURA 3GM8A 4MOAA 4OMDA 4CCOA 5A1LA 4YFWA 1NCRA 2XOMA 3BVCA 3LZZA 4EZHA 2X8KA 5I8YA 3N7MA 1R091 4WVMB 4AAPA 5M0TA 2P17A 4Z82A 4G3YC 4EN9B 3KCCA 5IVVA 1W8HA 4IE6A 1XE8A 4LKDA 1YFWA 4DUXA 4N43B 4BXSV 3IAQA 3U07A 5JUVA 3V0AB 1MEC2 4QXBA 4AYUA 3GZUC 3V0BB 2VZPA 3O1MA 5DZEA 2DU0A 4L11A 4RD7A 1WMEA 4AEDC 2HJIA 3DPRB 5FY7A 4XDOA 3H3ZA 2Z2SB 2W9XA 4ASKA 3LPFA 5BUVA 5C8CC 1RHI2 5AC93 3DF0A 4YGDA 2YC2A 5DAWA 4AVVA 3D3AA 2ZX0A 5APAA 5FQ0B 5IFPA 2LW8A 1VB2A 2HEWF 1D4M1 4XBLA 2V72A 4GWNA 3KHCA 1GOFA 3E6DA 4XBNA 2CDOA 1DGWX 4K1YA 1UX6A 5CFCB 1UU4A 2W39A 4BH9A 1WCUA 2JIGA 3JU9A 3ZIXA 4MGTA 4ONUA 4AHXA 2A3XA 1SBEA 3MF9A 4JQTA 2BBVA 3P1IA 4WM8C 4NHLA 4PF1A 1PO12 1ZZCA 4JHZA 3RPQA 2QNKA 2LROA 2GC0A 3D0SA 3T2PA 2VOVA 1LHVA 2FBEA 1GZWB 2DBIA 2MNGA 3FC0A 1JBCA 4DRVA 4IV1C 4M0NA 4ZXEA 1O6UA 5EHDA 1LGBA 3ELNA 4OHZA 3WUDA 4C0BA 1SBFA 5DAXA 5A7QA 4M3CF 5FUNA 4KI5M 4WVVA 1CX4A 3JZVA 3WF0A 4BLIA 1ZYBA 2W95A 1RUG2 4LJHA 4DUVA 1YIPA 1RB8G 1M06G 2D6PA 3OG2A 1AYM1 4FXGB 4LO8A 1K5MA 2R0HA 4XHXA 4EWAA 2GZWA 3ZSJA 3AMNA 3GGLA 3H1MA 2PELA 4J1WA 3I3DA 2BPA2 3M1HA 3PJQA 3O1VA 1B35B 5H9SA 4HZFA 4N9IA 2PQQA 5FYUA 3I2IA 2BVVA 4CP2A 1PVC3 4JHTA 3BOWA 4L99A 4A3ZA 5JCTA 1T6BX 2OW4A 4Q4V1 4QX1A 1HX6A 4IV1B 1KXGA 4XUOA 3VN4A 5FO7B 5EXOA 2Q1FA 1G86A 1A8DA 2WO7A 3NJVA 4OCTA 5EP9A 4AGVA 3N9OA 1FPN2 1NQDA 4YPJA 4FQZA 2J1UA 3VBHB 1ND2A 1UX7A 3K4ZA 3ZSLA 3LWCA 2WBKA 1AHSA 1Y43B 2DTYA 2PA7A 4AOCA 4XACA 3A7QA 4PQQA 1RUD1 2IZWA 2ZGLA 3MIDA 1HQLA 1OOPC 4Q0UA 4YW6A 4Y33A 4ZPIA 2D6MA 3PUHA 4D94A 1UYXA 1C57A 3MO4A 2BVBA 3WCRA 1UD1A 2YZ4A 4LR4A 3WCSA 4I0BA 1W8WA 2PHRA 3F95A 3ROUA 4HN0A 1BK1A 4GQ7A 2TNFA 2VNGA 3OOXA 1JZ4A 1UOFA 3R4DB 2R073 1IGOA 4C91A 5L7OC 3LEGA 4PI0A 1Z7S3 1UOBA 3B7MA 4DS0A 4FTSA 4KU7A 3MUZ1 2DVDA 2F6BA 4NIAA 1NXMA 1BVVA 3VDDB 4P08A 1XNKA 2J42A 3IPVB 4HXCA 1LGCA 4CDWA 3WR0A 1VJ2A 3U4SA 4W65A 1H2KA 4MXVA 1CWPA 4LO6B 4R9AA 3UGFA 4JV4A 1ZBA1 4IERA 3D8CA 4BQ1A 4GAZA 1WMDA 5FP3A 5FMOL 3TOJA 5D21A 2QDNA 4JRAA 5DDJ2 5L19A 2K46A 1D4M2 1F9KA 1F31A 3OYWA 4RHV3 3IIAA 1DQ1A 4FP2A 3WDVA 1F4AA 3VZMA 4HVOA 4OQ9A 3W59A 4MGKE 4OI0A 4Y22B 2P3IA 4ATEA 2BTVC 3ES4A 3H3UA 3OGVA 2QUOA 1GWLA 2J7MA 5DDJ1 1JHNA 1ZBA2 3W21A 1RHI3 2NN8A 2RHPA 1G6NA 4K6BA 3RGBA 4JTNA 1BK0A 1H30A 4NAMA 4PHZA 2HWB1 1XNTA 3BODA 2X09A 2A75A 4YW5A 5FY1A 4OQ8A 2C26A 2CDPA 5LBEA 4NHMA 4CP9A 2UY9A 3G7DA 2YU2A 5FMBA 5J98B 4XFCA 5L9BA 4AVSA 4HK8A 3MBWA 2WYFA 2ZGRA 4YZ1A 4ZU4A 1FATA 3C7GA 1KITA 1QJU3 2YROA 5C3RA 3PUQA 3ZR5A 2WZR2 3WDXA 3AXDA 3LDBA 5FFOC 1SLCA 2ZPXA 3HNBM 4FAGA 3TEYA 1BBT2 1NQJA 1MS4A 4IE7A 1HXS2 4HVRA 4BMBA 3KF5A 3URFA 5I0RA 1N1SA 2HWD3 1OKQA 3V56A 1K5MB 2VMFA 2C6SA 4YZ4A 1RUI2 1GBGA 4CEYB 1PO22 5FJKA 4YRDA 2WWSA 3V64A 3ZDVA 1UMHA 2K9ZA 4HFSA 1LU1A 3H3LA 1NA1B 2ZHLA 5DDJ3 1S0IA 4A2UA 2Q8CA 4DUWA 5DMYA 4H7MA 2JG8C 3MEPA 1QXPA 3VBFA 2MHFA 1QJU1 3GHMA 3N9PA 3BTXA 2H6CA 3BYWA 4YG0A 5GZFA 5L9RA 3BB6A 1QXRA 2A7AA 1VAKA 4N7UA 1DDLA 1DQ5A 5HV4A 4MV2A 4BISA 5HCBA 4AFAA 4WVWA 1OH4A 5J36A 1DBNA 1FMD1 1ZBA3 2RM21 4CU8A 3K51A 4W4ZA 5BNNA 1V9U3 1PGW2 2JD9A 5LB6A 3ZSEA 4MGQA 1I1EA 1DQ0A 1Y9MA 3ASIA 3NWKA 3CZJA 4LKEA 4MGZE 3TEXA 2OVUA 3V65A 3MLJA 4CEYC 2ZJCA 3A23A 4UBHA 5ANNA 3ZPOA 4AGRA 2TUNA 4AHWA 4H3WA 3ZLIA 2VTFA 1Z7S1 5KHHA 1WLCA 1D2QA 2BWCA 4RA0A 2DVGA 2ENRA 4CDUB 4BQYA 4AHYA 4AVAA 4BQ5A 3K48A 2CAVA 2Q8OA 3IDEA 4P00B 4Q4X1 1VPHA 5C71A 3AL6A 4DOUA 2DBNA 2Q0AA 2YC4A 2PHLA 2WS93 3TB0A 4BIOA 3DN7A 4LIUA 3RYRA 1Q43A 3CQOA 4CCDA 4A7ZA 5I8TA 1I5ZA 3H50A 4LBJA 4NOTA 4XFHA 1S0BA 1UMZA 4JAAA 3I2DA 1J1TA 3WHTA 5BV6A 4Z92B 1LHUA 2VY0A 4RSUA 4RFT0 4SBVA 1S0DA 4D6QA 5FXVA 4META 4KWLA 5F8PA 1OA2A 5FMCA 2QQPA 2ET7A 3L2HA 4PQ9A 4AK3A 3IAPA 4QXHA 2ZHMA 2ZGTA 1L7QA 2BNNA 3SH3A 2DVFA 3UV9A 1JZ7A 1UAIA 1WW6A 1UZ0A 4ORFA 3OEBA 4Q4X3 5GJ6A 1V9U2 3KT4A 1ZA7A 3WG4A 1FV3A 3AMMA 2W2IA 4B3NA 2DTWA 3KQ4B 2HYXA 2IWGB 3N35A 3KWVA 4XZUG 3WNPA 4CDQA 3HT1A 3UYJA 3WF3A 2OPKA 4PDWB 3WSOA 2F17A 2PHXA 4CEWB 3I2HA 2LUWA 1N3QA 1RVF3 3SMHA 3USUA 3NQHA 4L8QA 5BY5A 3GBGA 1SLAA 1IQAA 1UW8A 2GNTA 5EYYA 5FYIA 1JMUB 2W47A 2WKKA 4EROA 1HJFA 1FOD2 4OFGA 1HN1A 3SKJE 4H2AA 2OKXA 2VNRA 2DCYA 5A1AA 2WZ8A 5FUPA 2G9GA 2VMIA 4Q8KA 4P9IA 2JE8A 1VR3A 4IXLA 4NHKA 2WJSA 1UPSA 5FZ7A 3O1PA 5F2SA 1DFQA 2HYKA 3MUY1 1QXJA 3ZXEA 4QMAA 2YY1A 2P3KA 1S0JA 1WWYA 1NCQB 3KSCA 2ZXQA 4ZONA 4OHWA 4XBQA 4Q4W1 2ZHNA 4FTBA 2HKXA 2QBXA 3MLKA 3WOGA 4YVSA 3TN91 4QX5A 1IG3A 5JZGB 2A3YA 3I2GA 2VCAA 4UFJA 4X8NA 3PVEA 1AR82 1D0GA 4JKMA 4Q0VA 4JKLA 2UURA 2BBAA 3JD71 2JKXA 3AP4A 3O0WA 3EMRA 3N9QA 4PF5A 3S57A 3SITA 4QDQA 3MF6A 1JZ6A 4BZ4A 3IT8A 4QAWA 4Y24A 4IUGA 2ADEA 3PU3A 3HEIA 1JYCA 2PMWB 4AI1A 2ORZA 1Z78A 2JE7A 3CJIA 3U14A 1GV9A 1O5UA 4P5HA 2NLRA 4CDQB 4DINB 1CZVA 2E53A 5F5QA 4MO3M 1J3RA 1X8EA 2MEV2 3N7LA 3SLIA 1JOJA 2VVFA 3O1TA 2ZEXA 3I59B 4QPGA 4I3GA 4KG0A 2R6QA 1AJKA 2WRAA 2WSVA 5JZGC 1F4HA 1V6OA 4BQ2A 3WW1A 1AL22 1SDWA 4M3CE 1DYKA 2XLAA 4AFCA 2JECA 3RZGA 1Q3EA 1V6MA 1WCDJ 3O12A 2Q30A 4HKWA 1H1IA 3LSEA 2ZZQA 2LS6A 2HEYF 2XXZA 4AVBA 3U10A 4NROA 1C5HA 1KS4A 2CSGA 1MQTC 2XVGA 1MS3A 3VBRB 1VIWB 4JGZA 4MGSA 4TLFA 3WP5A 4IW3A 4D8MA 1VLNA 1F35A 1YEWA 4ZZ8A 4EYUA 5IVBA 4IEXA 3VDDC 1H9WA 2OX0A 2R062 4Y5TA 2E7AA 3A21A 4Y20A 4OLLA 2X05A 1GZCA 5DUXA 1OLRA 5FY8A 4BLJA 5HBAA 3PUAA 4QQHA 4NIDA 2GNDA 3GBFA 2XGXA 3I2JA 1DZQA 1HB4A 3WLUA 1L7RA 2UYAA 2R061 4KBBA 3LSDA 4OUSA 3WP4A 1W9SA 4BK5A 3O1OA 3LEIA 1UYYA 4UOJA 4LIVA 5EJ1B 3FHAA 3ABZA 1UIJA 1W06A 3FBYA 3JQWA 3P6BA 4AQ6A 2VTXJ 1QMJA 2EAKA 3OTFA 3RI8A 2ZMLA 4CXYA 4FOYA 5A1FA 1Y4WA 1XJAA 2QJVA 3AVSA 4V2WA 1XU2A 3FUQA 2VM9A 4LO4B 1ACCA 4NN0A 2OUJA 4GMP0 2VZQA 2VJXA 1QKQA 2FCUA 2AUYA 1AF9A 1PGSA 4JGYC 4JDMA 1V6NA 2V4VA 4NE9A 3TWIA 1FNYA 5CEHA 5E89A 4DXRA 2Y6KA 3I54A 4YSFA 4CRQA 4D6RA 2E7TA 1H4GA 4UF0A 1LOGA 3MHZA 3PVBB 4OMCA 3DUIA 1VBC3 4OZXA 1OBNA 5DPNA 5CFCA 3LIGA 3T1LA 1NCQA 3BU7A 5HCHA 1LOBA 1CQ9A 3KCYA 1JOBA 4JKKA 1NCRB 4QT6A 1ZVFA 5LATA 1D7PM 3B69A 4I02A 1LCLA 2WN2A 2GP5A 2CL2A 4XIOA 3VBRA 4AEKA 4BYYA 1GZWA 3POFA 4NJ4A 4YVSC 4XABA 4IQPA 3RZMA 3CZUA 5FZGA 3RQ0A 5FLHA 4A7YA 4BK4A 3J8F2 4B4RA 1SLBA 2MEV1 4FOQA 4UFIA 3QH6A 1BHGA 5E16A 4TZDA 2WAAA 3OUJA 1MVQA 1W8NA 2H6BA 3PU8A 1H8VA 4LUKA 3WNXA 4CSWA 1LB2A 4KBZA 3ZFEC 2ZEYA 4AEDA 4GD4A 3AKPA 5T3NA 3ZMNA 2Q8DA 1JOPA 3ETPA 3CL1A 3N9MA 4XXAA 5B4NA 1RUF2 3AZVA 4OUMA 1WMFA 3NNJA 3AL5A 4UYBA 2A6VA 5HPOA 2IXKA 4NMIA 2YHJA 3N3HA 5GLZA 2B7YA 5A33B 1JYIA 4XFBA 5H9PA 1BVP1 1C8M1 1PK6C 3VDBA 3MIBA 1IS4A 3S5AA 3PMEA 2CWMA 4K40A 2R042 4IV1A 4C8DA 2A6WA 5DUWA 5EWSA 2JG9B 1ZRCA 4EWEA 1ZZ6A 2JIJA 1LHWA 3ZR6A 3KQRA 3VZKA 2MEV3 1SFYA 4MG2A 4O61A 4Q4V2 3C7FA 2WA3A 2IVJA 2WR9A 3HN3A 3R05A 4GH4C 1ENQA 3KV5A 4P9YA 5FYTA 1VBA1 4AQTA 2GMEA 3CJIC 3UJOA 2H0VA 3LB9A 4MXWA 4P9XA 5A7SA 4EN8B 3LD8A 5BNPA 3Q8CA 4KG8A 4HETA 2VXRA 5HXMA 1K45A 4E2GA 3AC0A 1DLLA 2VUJA 1CR7A 4PLOA 2JICA 4M01A 5LASA 4Q0SA 1XE7A 5FXWA 5LRRA 4CYDA 1RUD3 3N9LA 1K5MC 3WNNA 3J7LA 1REFA 4OULA 2QQVA 1US3A 1W6QA 5BNOA 1RITA 5FXXA 4L2NA 5C3SA 2VCCA 4P9JA 1U5ZA 4EJRA 5A32B 4D6SA 1O3TA 3HBKA 1OLMA 3AP7A 5ACA1 5KHKA 4A41A 4ATFA 2HWF2 4YYOA 2QE3A 1RTVA 4GALA 1TNRA 2RMU2 1TZOA 1JUHA 3NKGA 3NV1A 3ES1A 4YGEA 4GH4A 5CVRA 3VD3A 5SV8A 5FYYA 3E6BA 1QJX3 3EJKA 5EJZB 3T0DA 2OZJA 1AR72 3EB7A 3EYPA 5DN2A 5G05L 5JOYA 3WF4A 4KNCA 3AYCA 2VECA 1QY4A 4A4AA 4CUCA 1AYN2 4SLIA 2GC1A 1RUE1 2Y60A 4UFMA 3S30A 1GWKA 4CDXC 1OQEA 3VZJA 5JOZA 1G9BA 1YQ6A 1H4HA 1OFSA 3MIHA 3M3CA 5GZDA 1NYWA 4M3CA 1PGW1 3SCHA 3VBUB 1L7LA 1DGRN 2DFCA 2V5YA 2R063 5A80A 2E26A 3WNMA 1POQA 4IGOA 4QX7A 3ZO0B 2PHDA 2XJUA 3T09A 1QJEA 1VRH3 1EP0A 4XJ8A 3W5NA 4AI0A 1YJLA 5JVVA 3DXTA 5GM0A 2UWAA 2GU9A 1VAMA 2YBKA 3IB3A 1AL0G 2GC3A 2WFF2 2XLFA 3QH7A 3ATGA 4MXWB 3WZ1A 3RSJA 4QPIB 2WNUC 4Z1VA 4Z2AA 3THPA 3W5MA 2D98A 3J9SA 5IVYA 5H9QA 2BV4A 1AR63 5FY9A 4A6SA 5FYZA 3C2UA 2RS11 1KJLA 5C9AC 1BEV1 2NP0A 4MHUA 4F83A 3KHBA 4FXKB 3CDZB 2WABA 4JDOA 5E8AA 1IS6A 5JOXA 2XKPA 4AXOA 1D0HA 4Y22A 1KGYA 1C1FA 4MADA 3NVCA 5LWBA 2VZRA 3V0AA 4XJZA 4OHYA 2BYVE 3VD7A 1KFXL 2EIEA 5FPAA 3ZXAC 1JYWA 2Z79A 2Z4FA 2A73B 2WINB 4MX3A 3IM0A 4K8RB 2VMDA 4D7TA 1WBFA 3A0NA 4CUAA 1UQXA 2UYBA 4LBLA 4AI8A 1IS5A 5GZEA 4DEQA 4ARXA 1O5LA 1UKRA 3OUIA 1WCSA 1VBD2 3ZIWA 5JI9A 1GZTA 2Y0IA 1EV13 3I3EA 4E9KA 2VCMA 2NM1A 2VQUA 4JCKA 1QDCA 2SBAA 4WM7C 4AVCA 2O1QA 3SEPA 5FP8A 3TNPB 5F5AA 5FWEA 4NRPA 4A3XA 3POSA 1Y7BA 1WW7A 2HBUA 3PIJA 3UKVA 4C90A 3AYDA 4E4DX 1RUC1 3HJRA 3RI9A 1H8TA 3T2OA 2ZABA 5LA2A 3BI3A 4E2SA 2PLV1 1COV1 4A7KA 4TWTA 5F6KA 4JGYB 1GMMA 2HWC1 2HH9A 5ISLA 2W46A 4LE3A 4QHZA 3JQXA 1Y9GA 1NZCA 1ZZ9A 5K8SA 1QEXA 4Q29A 1C4RA 1SEFA 3Q8EA 4LMFA 1U12A 3HQRA 5IK7A 2FDGA 2EIBA 4JRLA 3MW3A 4NRMA 1BMV1 3DPRC 4LTAA 4DXZA 4FAHA 1DIWA 2OIIA 2X5IB 3KT7A 5FQ0A 3OGSA 2BNOA 5A3UA 5I0UA 2DCKA 2ARCA 5L9VA 4LITA 2G1MA 1FOD3 2VNOA 2RS53 3NAPA 1UOJA 1H0BA 2B46X 3NKTA 3WP3A 1AYM3 4YLZA 1ZNPA 4CCNA 4H55A 1OPOA 4AAXA 1AR73 2PHTA 3TBDA 1CVNA 3I49A 4FFFA 4N53C 5IYYA 1HB1A 4BOWA 2BGOA 2ZHKA 4Y3OA 3POJA 1F2NA 4NIGA 2VXJA 2YFZA 3POYA 3HMYA 2GH8A 2YYOA 1BEV2 4QGNA 2XB6C 2RS12 1IZ3A 4IETA 4DXTA 1PX4A 2KR2A 4Q26A 1PM7A 5I93A 3GJBA 4J6GA 5FZOA 1AZDA 3LA2A 4QKBA 3RWKX 4E4SA 5J96B 2VPVA 1OF4A 3HN1A 2ZBJA 1V0AA 1W2UA 1SG3A 2ET1A 2XG3A 1HXS1 3ZYPA 2XJSA 4ZXKA 4CCKA 5K4LA 3UJQA 1UOGA 1LKNA 3H0OA 5F37A 2VBBA 4UW4A 5LBCA 2WWUA 3VDAA 3J7HA 3LOIA 2XL9A 1YYNA 2ZA9A 3VDDA 3ZMOA 4PDWA 2GALA 3WVJA 2CYFA 2Y6HA 4INDA 1AUYA 5CADA 1GR3A 2EA7A 1ND2B 2JWPA 1TMF1 3GCXA 1PZ7A 3OPZA 1DHKB 4XJ9A 5FPUA 5FZHA 1BLZA 1FYUA 2VE1A 5J37A 4LBQD 2W08A 2OA2A 1UMIA 4KL1A 3WQ7A 3JB4C 4HKOA 3DKQA 3HAGA 4FTEA 1HRV1 1ZBE2 4KU8A 4P9GA 1COV3 1ULGA 1H2LA 4B4QA 2CGOA 1VRH2 4JC1A 1UN1A 4BE3A 4GWJA 1UYPA 5FAXA 4LA2A 5KXEA 3ALQA 3JBG1 2QTWB 1ZZ7A 4QPGB 4AEMA 1MS0A 3ORJA 2YXSA 4HK9A 3B02A 5T5PA 3WUCA 5K7PA 5KR7A 1ZREA 3PJYA 1V6IA 3OY8A 3B5LB 3DGTA 4TTGA 2VULA 4LE4A 3RZHA 1W2AX 4A42A 2VD7A 3SCGA 4TN7A 2RR13 1U5IA 1OI6A 2XUEA 1PX3A 4Q2FA 4E4ZA 5JXGA 5FR3A 5CZKA 1QQP2 3T30A 2Y6LA 4IL7A 1QH7A 4MH0E 1WD3A 1K12A 2Q8EA 3E1F1 1LOFC 3EXUA 1VBB2 1YWKA 2ARAA 2WT2A 3OGGA 3PL0A 2HEVF 2BZDA 4DZGA 3OYWB 3MPBA 1KD7A 3D82A 2JKBA 3VHRA 1YFUA 2R0FA 3DV8A 4F3JA 2P37A 2OQ6A 3VBFB 4JZRA 3M3OA 4A6OA 5HXVA 3WX5A 1JYVA 1KJRA 1R64A 3I3BA 4Q4Y1 4JX0A 3MPPG 3WF2A 1OHFA 4BA6A 2D6OX 1H6YA 1S2EA 4EN0A 1SDDB 2JB8A 1O4TA 1YRZA 3PVOA 1XXNA 1UKGA 2Q5TA 2P1BA 2VMEA 3RVHA 2CY6A 2LM3A 4CZSA 3KS7A 1Q8QA 4N8MA 4TYSA 1R083 1EYBA
chains in the Genus database with same CATH topology
5A1AA 2WZ8A 3OEAA 1NKGA 2JE8A 1XNAA 2J1SA 4M4PA 1UXXX 3MUY1 2VO5A 2VZ1A 4XVHA 4HG6B 2Y8KA 2ZEWA 3MV01 2ZXQA 1UY2A 3K4DA 2V5DA 4UAPA 3UNPA 2QBXA 1WCQA 2YG0A 4BDVB 5C70A 5JR2A 3I2GA 2VCAA 1O8SA 4JKMA 4JKLA 3LE0A 3FN9A 2BGPA 1H6XA 2BBAA 1K3IA 2XQXA 2JKXA 3WNOA 2XHNA 5LCWL 2ZEZA 1J83A 4QDQA 4QX2A 1JZ6A 2QQKA 4QAWA 4QX0A 2R7EB 4IUGA 3HEIA 2PQSA 4AG4A 2ORZA 2W3JA 2B9VA 5IJRA 1CZVA 2E31A 4MO3M 3WNLA 3CKHA 1SHWB 1ULOA 2ZEXA 3CMGA 1F4HA 2L9LA 3DECA 3NRUA 1CZSA 2J1VA 2LS6A 2WQ8A 2Y6GA 1OF3A 4ZY9A 4OUEA 2RJ2A 1J84A 4XUTA 4QDSA 1JI6A 4MGSA 3A22A 5I0DA 4D8MA 3T0AA 5LA0A 4ZZ8A 3VD9A 3JXSA 2VZTA 2Y64A 3A21A 2X10A 2X05A 5IFTA 4TXWA 2ID4A 4CU9A 1RYYA 2QQLA 3HOBA 3I2JA 1L7RA 4D0QA 4ZZ5A 4A45A 1W9SA 2J22A 4BK5A 3LEIA 1UYYA 4UOJA 5EJ1B 4W8JA 2QQNA 3FHAA 3ABZA 2XONA 2EICA 1JZ5A 3P6BA 1W99A 3SKJE 3ACGA 1EUUA 3UESA 1NX9A 1CIYA 1JU3A 2W92A 2VM9A 2YFUA 3K75B 1GOHA 1TG7A 2VZQA 2VJXA 1GQPA 2WO3A 3WF1A 2V4VA 3HPNA 4LHSA 4DXRA 2Y6KA 1NUKA 4XUQA 5C7GA 2W87A 1OD3A 4OMCA 4GWIA 3T0BA 3ACIA 1JZ2A 3THDA 2W1UA 3ACFA 5DPNA 3T08A 3K4AA 2W1QA 4JKKA 4QB6A 2VZVA 3VDCA 1LNSA 1D7PM 1UYZA 2WN2A 4CUBA 1DP0A 2W5FA 2J1EA 3CZUA 4BK4A 3WQBA 2J1RA 4QDRA 3OB8A 1BHGA 2WAAA 3HNMA 1W8NA 1DLCA 2WYSA 4PT6A 4QB1A 2ZEYA 3IDAA 3SEEA 5JXIA 3ETPA 1P8JA 5B4NA 5HPOA 1K42A 4E8DA 3FHQA 2Y6JA 4QPWA 3VDBA 1UY4A 2QQMA 1WKYA 2B4KA 4ARYA 1GOGA 1CZTA 1XPWA 4QX3A 3C7FA 3HN3A 3WNKA 4E8CA 4OZOA 4XURA 1UY0A 5HXMA 1K45A 1O59A 1UXZA 3AC0A 5EIYB 3LEKA 3I97A 3GM8A 4OMDA 3C8XA 3F2ZA 4MOAA 4XUNA 2VC9A 2XOMA 5FUIA 3WNNA 2VR4A 1US2A 2QQIA 2W91A 1US3A 1W8OA 2VCCA 3GDBA 4ET7A 4DUXA 3IAQA 4A41A 5JUVA 2VZOA 2VZPA 2WN3A 2WUHA 1W9TA 3NNGA 4OYUA 3VD3A 3PUIA 2W9XA 3LPFA 3T0DA 5EJZB 2VL4A 3EB7A 3EYPA 5DN2A 5G05L 2YC2A 5B4XA 4CU7A 3D3AA 3BN6A 3WF4A 1GUIA 4GZ9A 5IFPA 2LW8A 2W1WA 4A4AA 4CUCA 2V72A 1GOFA 1I5PA 3OBAA 2CDOA 1MPXA 2J1TA 3WNMA 2E26A 2VCBA 2VMCA 3P1IA 4PF1A 4JHZA 3T09A 3W5NA 3T2PA 3IB3A 4ZXEA 4Z2AA 3W5MA 3VD4A 1YQ2A 1JYXA 4KI5M 2W94A 3C7EA 4KWUA 1T2XA 3WF0A 2W95A 4DUVA 5IHRA 1UWWA 2WO1A 3OG2A 1DYOA 3LPGA 5CYYA 3HNYM 3CDZB 3GGLA 4KMQA 2WABA 2E33A 3I3DA 2JDAA 2EIDA 3BGAA 3MV11 1KGYA 4MADA 3I2IA 2DCJA 2VZRA 4P02B 4A3ZA 2E32A 4QX1A 3VD7A 2EIEA 1JYWA 4XUOA 2Z4FA 1EUTA 3NJVA 1JZ8A 2VMDA 4YPJA 2J1UA 1UX7A 3K4ZA 4CUAA 2WBKA 2VOTA 3A7QA 4PQQA 4ARXA 4DEQA 1PMHX 1O8PA 5J1XA 4LQRA 3PUHA 1UYXA 3I3EA 2VQUA 3MO4A 3T2QA 3SEPA 2QQJA 1JZ4A 2VZ3A 3ACHA 4QB2A 3HJRA 4L0PA 3LEGA 1NAEA 5G04L 3T2OA 2BERA 3MUZ1 5LA2A 3NJXA 2WDBA 3C7HA 4M4RA 3ZM8A 1GMMA 4P08A 4RYDA 3CIHA 2W46A 2C9KA 1JZ3A 2RV9A 3LQCA 3K46A 2EIBA 2DDUA 1F4AA 3OGSA 2DCKA 2VQTA 3OGVA 2J7MA 5DQ0A 4AAXA 3I2KA 5IYYA 1XNTA 2X09A 2BGOA 2C26A 2CDPA 3ECQA 2YFZA 2C4XA 2W1SA 3MBWA 3I2FA 3VD5A 2WO2A 1ULPA 2VZUA 3C7GA 4DXTA 1PX4A 1UY3A 3HNBM 4LPLA 2J1AA 3U37A 1OF4A 3DYPA 3C7OA 2VMFA 1PMJX 4P5YA 4A44A 1JU4A 1SG3A 4BJ0A 5LA1A 1UMHA 5F7UA 3UETA 4XUPA 4DUWA 5DMYA 1CX1A 3VDAA 4BXSV 3J7HA 4CVUA 2QQOA 2WZEA 2Y6HA 1JHJA 1OH4A 3SKVA 1XC6A 4CU8A 4W4ZA 2JD9A 4MGQA 3CZJA 3OGRA 1UMIA 3THCA 3A23A 3DYMA 5JMOA 2VTFA 4GWJA 1KEXA 3FL7A 2WAOA 4P00B 5C71A 2YC4A 4TTGA 4W50A 3K77A 4A42A 1GU3A 3CQOA 4CU6A 3GXUA 1OT5A 3DYOA 1PX3A 5JXGA 2ORXA 5CZKA 1W0NA 2Y6LA 2RVAA 1K12A 5JXHA 3E1F1 4FI9A 3IAPA 1UY1A 1L7QA 2KD7A 1IQDC 2YB7A 1JZ7A 1UZ0A 2BZDA 2HLEA 3OEBA 1GNYA 4XZUG 2HYXA 3WNPA 4A6OA 1JYVA 4DEVA 3WF3A 3WSOA 4RN5A 1R64A 3I3BA 4JX0A 3WF2A 4DXSA 5JXJA 1TVGA 3I2HA 1H6YA 3NQHA 1SDDB 4LKSA 2VZSA 2W47A 2VMEA 3WEZA 4UI9L 3IIIA 1W9WA 1HN1A 1JYNA 2OKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1A A;  2WZ8 A;  3OEA A;  1NKG A;  2JE8 A;  1XNA A;  2J1S A;  4M4P A;  1UXX X;  3MUY 1;  2VO5 A;  2VZ1 A;  4XVH A;  4HG6 B;  2Y8K A;  2ZEW A;  3MV0 1;  2ZXQ A;  1UY2 A;  3K4D A;  2V5D A;  4UAP A;  3UNP A;  2QBX A;  1WCQ A;  2YG0 A;  4BDV B;  5C70 A;  5JR2 A;  3I2G A;  2VCA A;  1O8S A;  4JKM A;  4JKL A;  3LE0 A;  3FN9 A;  2BGP A;  1H6X A;  2BBA A;  1K3I A;  2XQX A;  2JKX A;  3WNO A;  2XHN A;  5LCW L;  2ZEZ A;  1J83 A;  4QDQ A;  4QX2 A;  1JZ6 A;  2QQK A;  4QAW A;  4QX0 A;  2R7E B;  4IUG A;  3HEI A;  2PQS A;  4AG4 A;  2ORZ A;  2W3J A;  2B9V A;  5IJR A;  1CZV A;  2E31 A;  4MO3 M;  3WNL A;  3CKH A;  1SHW B;  1ULO A;  2ZEX A;  3CMG A;  1F4H A;  2L9L A;  3DEC A;  3NRU A;  1CZS A;  2J1V A;  2LS6 A;  2WQ8 A;  2Y6G A;  1OF3 A;  4ZY9 A;  4OUE A;  2RJ2 A;  1J84 A;  4XUT A;  4QDS A;  1JI6 A;  4MGS A;  3A22 A;  5I0D A;  4D8M A;  3T0A A;  5LA0 A;  4ZZ8 A;  3VD9 A;  3JXS A;  2VZT A;  2Y64 A;  3A21 A;  2X10 A;  2X05 A;  5IFT A;  4TXW A;  2ID4 A;  4CU9 A;  1RYY A;  2QQL A;  3HOB A;  3I2J A;  1L7R A;  4D0Q A;  4ZZ5 A;  4A45 A;  1W9S A;  2J22 A;  4BK5 A;  3LEI A;  1UYY A;  4UOJ A;  5EJ1 B;  4W8J A;  2QQN A;  3FHA A;  3ABZ A;  2XON A;  2EIC A;  1JZ5 A;  3P6B A;  1W99 A;  3SKJ E;  3ACG A;  1EUU A;  3UES A;  1NX9 A;  1CIY A;  1JU3 A;  2W92 A;  2VM9 A;  2YFU A;  3K75 B;  1GOH A;  1TG7 A;  2VZQ A;  2VJX A;  1GQP A;  2WO3 A;  3WF1 A;  2V4V A;  3HPN A;  4LHS A;  4DXR A;  2Y6K A;  1NUK A;  4XUQ A;  5C7G A;  2W87 A;  1OD3 A;  4OMC A;  4GWI A;  3T0B A;  3ACI A;  1JZ2 A;  3THD A;  2W1U A;  3ACF A;  5DPN A;  3T08 A;  3K4A A;  2W1Q A;  4JKK A;  4QB6 A;  2VZV A;  3VDC A;  1LNS A;  1D7P M;  1UYZ A;  2WN2 A;  4CUB A;  1DP0 A;  2W5F A;  2J1E A;  3CZU A;  4BK4 A;  3WQB A;  2J1R A;  4QDR A;  3OB8 A;  1BHG A;  2WAA A;  3HNM A;  1W8N A;  1DLC A;  2WYS A;  4PT6 A;  4QB1 A;  2ZEY A;  3IDA A;  3SEE A;  5JXI A;  3ETP A;  1P8J A;  5B4N A;  5HPO A;  1K42 A;  4E8D A;  3FHQ A;  2Y6J A;  4QPW A;  3VDB A;  1UY4 A;  2QQM A;  1WKY A;  2B4K A;  4ARY A;  1GOG A;  1CZT A;  1XPW A;  4QX3 A;  3C7F A;  3HN3 A;  3WNK A;  4E8C A;  4OZO A;  4XUR A;  1UY0 A;  5HXM A;  1K45 A;  1O59 A;  1UXZ A;  3AC0 A;  5EIY B;  3LEK A;  3I97 A;  3GM8 A;  4OMD A;  3C8X A;  3F2Z A;  4MOA A;  4XUN A;  2VC9 A;  2XOM A;  5FUI A;  3WNN A;  2VR4 A;  1US2 A;  2QQI A;  2W91 A;  1US3 A;  1W8O A;  2VCC A;  3GDB A;  4ET7 A;  4DUX A;  3IAQ A;  4A41 A;  5JUV A;  2VZO A;  2VZP A;  2WN3 A;  2WUH A;  1W9T A;  3NNG A;  4OYU A;  3VD3 A;  3PUI A;  2W9X A;  3LPF A;  3T0D A;  5EJZ B;  2VL4 A;  3EB7 A;  3EYP A;  5DN2 A;  5G05 L;  2YC2 A;  5B4X A;  4CU7 A;  3D3A A;  3BN6 A;  3WF4 A;  1GUI A;  4GZ9 A;  5IFP A;  2LW8 A;  2W1W A;  4A4A A;  4CUC A;  2V72 A;  1GOF A;  1I5P A;  3OBA A;  2CDO A;  1MPX A;  2J1T A;  3WNM A;  2E26 A;  2VCB A;  2VMC A;  3P1I A;  4PF1 A;  4JHZ A;  3T09 A;  3W5N A;  3T2P A;  3IB3 A;  4ZXE A;  4Z2A A;  3W5M A;  3VD4 A;  1YQ2 A;  1JYX A;  4KI5 M;  2W94 A;  3C7E A;  4KWU A;  1T2X A;  3WF0 A;  2W95 A;  4DUV A;  5IHR A;  1UWW A;  2WO1 A;  3OG2 A;  1DYO A;  3LPG A;  5CYY A;  3HNY M;  3CDZ B;  3GGL A;  4KMQ A;  2WAB A;  2E33 A;  3I3D A;  2JDA A;  2EID A;  3BGA A;  3MV1 1;  1KGY A;  4MAD A;  3I2I A;  2DCJ A;  2VZR A;  4P02 B;  4A3Z A;  2E32 A;  4QX1 A;  3VD7 A;  2EIE A;  1JYW A;  4XUO A;  2Z4F A;  1EUT A;  3NJV A;  1JZ8 A;  2VMD A;  4YPJ A;  2J1U A;  1UX7 A;  3K4Z A;  4CUA A;  2WBK A;  2VOT A;  3A7Q A;  4PQQ A;  4ARX A;  4DEQ A;  1PMH X;  1O8P A;  5J1X A;  4LQR A;  3PUH A;  1UYX A;  3I3E A;  2VQU A;  3MO4 A;  3T2Q A;  3SEP A;  2QQJ A;  1JZ4 A;  2VZ3 A;  3ACH A;  4QB2 A;  3HJR A;  4L0P A;  3LEG A;  1NAE A;  5G04 L;  3T2O A;  2BER A;  3MUZ 1;  5LA2 A;  3NJX A;  2WDB A;  3C7H A;  4M4R A;  3ZM8 A;  1GMM A;  4P08 A;  4RYD A;  3CIH A;  2W46 A;  2C9K A;  1JZ3 A;  2RV9 A;  3LQC A;  3K46 A;  2EIB A;  2DDU A;  1F4A A;  3OGS A;  2DCK A;  2VQT A;  3OGV A;  2J7M A;  5DQ0 A;  4AAX A;  3I2K A;  5IYY A;  1XNT A;  2X09 A;  2BGO A;  2C26 A;  2CDP A;  3ECQ A;  2YFZ A;  2C4X A;  2W1S A;  3MBW A;  3I2F A;  3VD5 A;  2WO2 A;  1ULP A;  2VZU A;  3C7G A;  4DXT A;  1PX4 A;  1UY3 A;  3HNB M;  4LPL A;  2J1A A;  3U37 A;  1OF4 A;  3DYP A;  3C7O A;  2VMF A;  1PMJ X;  4P5Y A;  4A44 A;  1JU4 A;  1SG3 A;  4BJ0 A;  5LA1 A;  1UMH A;  5F7U A;  3UET A;  4XUP A;  4DUW A;  5DMY A;  1CX1 A;  3VDA A;  4BXS V;  3J7H A;  4CVU A;  2QQO A;  2WZE A;  2Y6H A;  1JHJ A;  1OH4 A;  3SKV A;  1XC6 A;  4CU8 A;  4W4Z A;  2JD9 A;  4MGQ A;  3CZJ A;  3OGR A;  1UMI A;  3THC A;  3A23 A;  3DYM A;  5JMO A;  2VTF A;  4GWJ A;  1KEX A;  3FL7 A;  2WAO A;  4P00 B;  5C71 A;  2YC4 A;  4TTG A;  4W50 A;  3K77 A;  4A42 A;  1GU3 A;  3CQO A;  4CU6 A;  3GXU A;  1OT5 A;  3DYO A;  1PX3 A;  5JXG A;  2ORX A;  5CZK A;  1W0N A;  2Y6L A;  2RVA A;  1K12 A;  5JXH A;  3E1F 1;  4FI9 A;  3IAP A;  1UY1 A;  1L7Q A;  2KD7 A;  1IQD C;  2YB7 A;  1JZ7 A;  1UZ0 A;  2BZD A;  2HLE A;  3OEB A;  1GNY A;  4XZU G;  2HYX A;  3WNP A;  4A6O A;  1JYV A;  4DEV A;  3WF3 A;  3WSO A;  4RN5 A;  1R64 A;  3I3B A;  4JX0 A;  3WF2 A;  4DXS A;  5JXJ A;  1TVG A;  3I2H A;  1H6Y A;  3NQH A;  1SDD B;  4LKS A;  2VZS A;  2W47 A;  2VME A;  3WEZ A;  4UI9 L;  3III A;  1W9W A;  1HN1 A;  1JYN A;  2OKX A; 
#chains in the Genus database with same CATH topology
 4PBO A;  2KM2 A;  1LOD A;  2I2S A;  4IES A;  2EF6 A;  1QF3 A;  2PTM A;  3MIC A;  5FYV A;  5A7O A;  1ASJ 3;  4QQL A;  3VBS C;  3WDU A;  4CA9 A;  4CDU A;  1V00 A;  1W6M A;  4XF3 A;  4I30 A;  1RIN A;  4NRQ A;  1XND A;  2VZ1 A;  3VBO B;  3ZFF A;  4LUL A;  5IAX A;  1G9A A;  2WQZ C;  1LJ7 A;  2DCT A;  2CTV A;  4XHB A;  1A78 A;  2E6V A;  3O14 A;  3LKJ A;  5BPX A;  5JIU A;  3I2O A;  2JDU A;  1UY2 A;  4CXW A;  3LEM A;  3M7A A;  2WT0 A;  4FPO B;  2YG0 A;  4UW3 A;  5BNO C;  2WII B;  5C70 A;  1PM4 A;  1X50 A;  1ZRI A;  1O8S A;  2XLG A;  1OLM E;  3D6E A;  3JD7 3;  1RUH 2;  2DWR A;  1H6X A;  1VRH 1;  2XQX A;  3BOP A;  3LE0 A;  5EYX A;  1IPK A;  2HWD 2;  4QGL A;  2XHN A;  5C8W A;  1HRV 2;  1ZBE 1;  2ZEZ A;  2NPI A;  5FYC A;  1YHF A;  1OH3 A;  2EXH A;  2K0G A;  4D7S A;  4ZHN A;  4QX0 A;  3PDQ A;  2R7E B;  4LEJ A;  4NPR A;  3THT A;  4AED B;  4AQ2 A;  3LIH A;  5DG1 A;  5LY2 A;  4AG4 A;  1F8V A;  4NUB A;  4YGB A;  1ENS A;  4NWV A;  2OT7 A;  4BQW A;  2P3J A;  4Q4V 3;  4EZ4 A;  2C0Z A;  4WV8 A;  2A5Z A;  4XQW A;  5T55 A;  1AX0 A;  2E9Q A;  1QJZ A;  3CKH A;  1SHW B;  1ULO A;  3VLB B;  2RMU 1;  3PHM A;  5F6L B;  3U75 A;  3Q8F A;  2WFP A;  3NV4 A;  5FZA A;  2FDH A;  4HAN A;  4PJY A;  4K3U A;  3DEC A;  4JQR A;  2BNM A;  2QDR A;  5FPL A;  2DUO A;  3NRU A;  4AF9 A;  1CZS A;  5DUU A;  5A3M A;  2VQA A;  4ISR A;  5EQU A;  2I07 B;  2DF7 A;  1WLD A;  1OF3 A;  2XH6 A;  4XUT A;  1J84 A;  1U0A A;  3U1X A;  4GB3 1;  1IS3 A;  5FP4 A;  1E57 A;  5CFD C;  1DQ4 A;  1ULD A;  3M8L A;  2YUE A;  4IGQ A;  3T0A A;  5LA0 A;  4FFG A;  2WZP P;  4I01 A;  1QJY 1;  2VZT A;  1GP4 A;  2WNV B;  3IDB B;  4XF0 A;  5FPZ A;  5DG2 A;  4RGG A;  3VV1 A;  1XU1 A;  3AFK A;  5IFT A;  1GQG A;  5AFB A;  4KH9 A;  2VUC A;  4TXW A;  2ID4 A;  4ASL A;  4CU9 A;  2V73 A;  3IN9 A;  1FX5 A;  3H7J A;  2WS9 2;  1W03 A;  2RMU 3;  4YM0 A;  2QQL A;  2VOX A;  4PLM A;  5IVJ A;  2ZGU A;  3HWJ A;  4Q0Q A;  4MUV A;  1MEC 3;  2VH9 A;  4D0Q A;  4ZZ5 A;  4UW6 A;  4IEW A;  4A45 A;  1O7F A;  1GNH A;  3J7M A;  2ZAC A;  2JDY A;  5E6H A;  1S4C A;  4HSL A;  4DRR A;  3O1S A;  2AR6 A;  3ZFF C;  3KV6 A;  2ZX4 A;  1HW5 A;  5LK7 B;  2BOJ A;  2C5D A;  4FOW A;  1RUE 2;  2D3P A;  1XRU A;  3RNS A;  3K2O A;  5I0S A;  1Q8V A;  3GNE A;  1Z0H A;  4CTE A;  3UES A;  1NX9 A;  1YC6 1;  1CIY A;  1KFU L;  4MZU A;  3VZN A;  4B1M A;  1FXZ A;  3K75 B;  1SLI A;  2HWC 2;  1C8M 3;  4QHO A;  3DEM A;  4BXF A;  5KXD A;  4BME A;  4ZKT B;  1ZZ8 A;  2PHF A;  1LHN A;  4YVW A;  3WF1 A;  5H9R A;  4F7Z A;  4BPZ A;  4IV3 C;  1A3K A;  1PGL 2;  4FSJ A;  1NUK A;  3KM5 A;  3TYJ A;  4UFL A;  2JB4 A;  1RUJ 2;  1W6M B;  2CNA A;  2ZCW A;  2W87 A;  1OUX A;  3JB8 A;  3ON7 A;  1W3X A;  3C3V A;  3VBS A;  1YO8 A;  1QQP 1;  2LAL A;  4JDN A;  4MGY E;  3O0X A;  3L9J T;  2A6Y A;  3H42 B;  1RUJ 1;  3WG3 A;  2A6X A;  1VBC 1;  3ZYR A;  4Y5Z 0;  2B9U A;  3VDC A;  4HVQ A;  1AX1 A;  1UYZ A;  4EWD A;  3FLT A;  2AGS A;  4CUB A;  1XSQ A;  2W5F A;  2VVE A;  5FZE A;  1IPS A;  2RDS A;  5JPN B;  4RS5 C;  1DYP A;  3JBG 3;  3ZFG B;  2J1R A;  3GZE A;  2WC2 A;  2IVI B;  3EBR A;  3HNM A;  4PIZ A;  2WYS A;  2PHU A;  3DPR A;  4HSJ A;  4XJU A;  5FK7 A;  1V6J A;  2OPW A;  2Q1M A;  2JDH A;  3NL1 A;  2HWE 1;  2XPJ A;  2IXL A;  3CJI B;  1U5X A;  1LU2 A;  4LNV A;  1P8J A;  3MFA A;  3JD7 2;  4FPL A;  1LES A;  1LR5 A;  4YG3 A;  1C8M 2;  2DUP A;  5ACA 3;  1AR8 1;  2W68 A;  1LOC A;  3MGU A;  1B35 A;  2Y6J A;  4GIQ A;  1FMD 3;  1VBE 3;  2P34 A;  2RM2 3;  1RVF 1;  3GAL A;  4N53 A;  4QPW A;  1S0G A;  3NO8 A;  5F32 A;  3IWZ A;  5JIA A;  4IEP A;  2B45 X;  4FOV A;  4QQP A;  2B4K A;  4GKY A;  4BCU A;  4YFZ A;  1KDM A;  4NHX A;  2JX9 A;  2VOK A;  4Y1U A;  3S5Q A;  3N4M A;  2VGD A;  1JUI A;  3Q9O A;  4YVW B;  1GIC A;  4JGZ B;  1ZZB A;  2YBS A;  4BB3 A;  1O3R A;  4OZO A;  3PNA A;  1W2O A;  3AVR A;  4BU2 A;  4O9G A;  1LHO A;  2UU8 A;  2BUK A;  2QZ3 A;  4LXL A;  4QPI A;  4XZP A;  4Q1P A;  4LOT A;  1NG0 A;  2R16 A;  1JXN A;  1S2B A;  3ZKY A;  1GQH A;  2ZTN A;  3ZXJ A;  3C8X A;  4XUN A;  2VC9 A;  5FUI A;  1O4Y A;  4XAE A;  2FD8 A;  3H1W A;  2VR4 A;  4FFH A;  2QQI A;  2W91 A;  3UKT A;  1CPN A;  1W8O A;  2RDN A;  1W6N A;  5T52 A;  3AYE A;  3LDK A;  4DY5 A;  3POB A;  3GDB A;  5C5U A;  1HXS 3;  4RR3 B;  1W90 A;  3ZYJ B;  3MLL A;  1GAN A;  1ND3 A;  1OQ1 A;  4IEY A;  2RS5 2;  1E5S A;  2NQY A;  5A7W A;  1CX1 A;  2XQR A;  2VZO A;  2ZGQ A;  2P5B A;  4WM8 B;  5CG9 A;  2WN3 A;  2WUH A;  1W9T A;  1C28 A;  4CDW C;  4EQV A;  2R1B A;  3T4V A;  2UWC A;  2YC0 A;  2HWF 1;  4OHV A;  2DU1 A;  4YGC A;  2YV8 A;  3VBH A;  3O1R A;  2VL4 A;  2JDM A;  2UWB A;  3DXU A;  5F5C A;  1G8W A;  1TME 2;  4CU7 A;  1GUI A;  3HT2 A;  5FIX A;  4GZ9 A;  5C6C A;  1BEV 3;  5CKM A;  3WNK A;  3ZYH A;  3E6C C;  1X8M A;  1DQ6 A;  2CWS A;  4W6W A;  5FV3 A;  5FZI A;  3B9C A;  3MW4 A;  1RXF A;  1TNF A;  4GWM A;  3ZYF A;  5FPX A;  1OMI A;  5FY5 A;  1I5P A;  1SPP B;  3VBS B;  3OBA A;  2HWC 3;  1GFF 2;  1O4Z A;  1QJU 2;  1CIW A;  1UZV A;  1MPX A;  4HON A;  3EO6 A;  2IXH A;  3WQ1 A;  2KXL A;  3LCP A;  1ENR A;  4CDU C;  2VCB A;  4YWA A;  2VBP A;  2VMC A;  5F3I A;  5C3Q A;  1DZT A;  4CP9 B;  1EAH 1;  1X9P A;  3ZFE A;  2W52 A;  1ENX A;  3NMB A;  1YNA A;  1HDK A;  5GLU A;  3AK0 A;  4QXC A;  4LK6 A;  3FX3 A;  2EAA A;  3VZO A;  1VBC 2;  1YQ2 A;  3VD4 A;  1H1A A;  1EAH 2;  2VAU A;  4KWU A;  1T2X A;  1S2K A;  4K20 A;  5IHR A;  2YBP A;  2VMH A;  1UWW A;  2WO1 A;  3ZFG C;  1UL9 A;  4KGG A;  3LPG A;  1HN0 A;  1UCX A;  4PDW C;  4WVM A;  1GP6 A;  3LA3 A;  4KMQ A;  4QX8 A;  2R04 1;  1W6Q B;  1AL2 1;  2E33 A;  2X5I A;  4XQD A;  5D8A C;  5BNO B;  3BGA A;  5FK8 A;  1JH5 A;  4G9S B;  4RR3 A;  3MV1 1;  2GNM A;  3JUU A;  1HRI 2;  2DCJ A;  1CD3 G;  2ZZJ A;  3MIF A;  4P02 B;  4RS5 A;  2R30 A;  5K9Y A;  4XEZ A;  3W9A A;  2MPF A;  4QKN A;  4WVZ A;  1JYX A;  3UL2 A;  1JZ8 A;  3USS A;  2RDR A;  1IKP A;  1N1Y A;  1W8Z A;  3OGJ A;  1YI9 A;  2PLV 3;  1J58 A;  1OD5 A;  4URT A;  4J1X A;  5T5O A;  5J7M A;  2BJS A;  4ITC A;  2VOT A;  3KZ4 C;  4LOS A;  4XOG A;  5K0U B;  5C4W B;  2D6L X;  2V4A A;  5DAP A;  2BFU S;  1PMH X;  2GSY A;  5J1X A;  2TBV A;  4P9W A;  1WA4 A;  1PNG A;  3EHK A;  4B1L A;  2P6H A;  3WXP A;  4Y26 A;  2OZ6 A;  5LBF A;  1CPM A;  2ZKN A;  4QQ2 A;  4L92 A;  4M3C B;  2V09 A;  2WS9 1;  3LAG A;  1VE0 A;  3QD6 A;  5JAX A;  4XPV A;  2O8Q A;  3JBG 2;  4HT1 T;  1XB9 A;  1VBA 3;  4XYX A;  1S55 A;  1RED A;  3DL3 A;  5IVE A;  1UU5 A;  1XQN A;  2VOW A;  4IE0 A;  2JEN A;  3O0V A;  2ZX1 A;  5I8S A;  5KXB A;  4L0P A;  5G04 L;  1W6N B;  1O3Q A;  3VGI A;  1E5R A;  1R08 1;  2ARX A;  2VQ0 A;  1BBT 3;  3EQE A;  3NJX A;  4G4F A;  4AFB A;  2WDB A;  2D6N A;  4M4R A;  3ZM8 A;  5HI0 A;  4Q4X 2;  4RYD A;  5DUV A;  5ANQ A;  3V0B A;  1LTE A;  3DCQ A;  3SC7 X;  2AAC A;  2VG9 A;  3T4H B;  1PO2 3;  1AR6 1;  5FZ9 A;  1R1A 1;  2JDK A;  2YMZ A;  1Q8S A;  1VBE 2;  5FKC A;  1G9D A;  3LQC A;  3K46 A;  1AXY A;  4CCL A;  2DVA A;  4QQO A;  3SXW A;  5CIR A;  1JYT A;  3OJB A;  4FPC A;  4NO4 A;  5FOB B;  5LRS A;  3M3I A;  4UWD A;  1PZ9 A;  3ZYI B;  1NOV A;  5IK5 A;  4ES8 A;  1NCR C;  5AC9 1;  2VBD A;  5FKB A;  4HLT A;  4LOR A;  5JDB A;  4CE8 A;  5DQ0 A;  2QQW A;  4LA3 A;  3VKN A;  4URA A;  1VBE 1;  4I2O A;  5AC9 2;  4QM8 A;  2FMY A;  3WW3 A;  4GJY A;  1V9U 1;  2A3W A;  3ME2 A;  5CKQ A;  2GP3 A;  4XXP A;  3WG2 A;  5KHI A;  3FLR A;  3USU B;  2HWD 1;  2IXC A;  2WT1 A;  3KCX A;  1OSG A;  4XJA A;  5A3W A;  2FDK A;  1GZ9 A;  5FMO S;  5C4W A;  2W1S A;  2D97 A;  1B09 A;  4TSV A;  1RC6 A;  2VZU A;  3FMG A;  4HN1 A;  1QDO A;  3B3Q E;  2C1F A;  2D93 A;  4Q4Y 3;  4BQX A;  2WNE A;  5C9A B;  4C1X A;  4GJZ A;  2IXI A;  4HPK B;  4L97 A;  2DUQ A;  1ODN A;  1W2T A;  5EZW A;  3U37 A;  1UF2 C;  1PO1 3;  2WLP A;  3DYP A;  2ES3 A;  3RWN A;  3C7O A;  4AVT A;  1LOA A;  4X6R B;  1V6K A;  3MYX A;  3ZFF B;  3VBO A;  1WGP A;  2Y26 A;  4BJ0 A;  1S1A A;  4WZF A;  1RUN A;  3VKO A;  1Q5O A;  5F7U A;  3UET A;  3BUC A;  1EAH 3;  2D3R A;  1DGR A;  2G4I A;  4XF1 A;  2E63 A;  3AZX A;  5D8A A;  1OXC A;  1H1M A;  1CAV A;  1WCK A;  4YVS B;  5FZK A;  3RRD A;  1VAV A;  4XF9 A;  5FTT C;  3ZDS A;  4AEJ A;  3KGL A;  4RS5 B;  3RJ2 X;  4CDW B;  2VMG A;  4XJW A;  4N90 A;  3VB9 A;  1FT9 A;  3ZYG A;  3AXE A;  2WZE A;  5FYB A;  4DO0 A;  5A70 A;  2I74 A;  1N3O A;  1JHJ A;  4LHL A;  3SKV A;  1XC6 A;  4JTO A;  1CAW A;  1OKO A;  3LOB A;  1DU3 D;  3CU7 A;  5DZF A;  1QNY A;  4XAA A;  4IV3 A;  3WG1 A;  1J59 A;  1W8T A;  3VBR C;  4YVW C;  2ZAH A;  4DMI A;  4UW5 A;  3DYM A;  4Q27 A;  4E27 A;  3ZXK A;  3NJY A;  5FLJ A;  2IUW A;  5JMO A;  1FPN 3;  1OVS A;  1OOP B;  2Y0O A;  3BAL A;  4Q4Y 2;  2PLV 2;  1KEX A;  3RZK A;  3FL7 A;  4OHX A;  2WAO A;  5FZD A;  1UO9 A;  2NZ9 A;  3PUR A;  4EE2 A;  2EIG A;  2ZGN A;  2BDR A;  1NZI A;  1PO2 1;  1TMF 3;  1A8M A;  5FPB A;  5CFD B;  4W50 A;  1SMV A;  1ODM A;  4OI2 A;  3ZKU A;  4CPB D;  3GJA A;  4GMP 3;  1RUI 3;  2DFB A;  4LBO A;  4CU6 A;  1OT5 A;  3DYO A;  2XUM A;  4ISQ A;  5FZO B;  5J3U A;  2XHK A;  3IPV A;  3WHU A;  3WW4 A;  1VBA 2;  2XBO 3;  2RVA A;  1VRB A;  1PK6 A;  3S7I A;  2WNV A;  1J3Q A;  4AQS A;  4FI9 A;  4LBK A;  1DZR A;  3P3P A;  1SCR A;  5FZB A;  1UY1 A;  2PN5 A;  1MS9 A;  4XET A;  2BOI A;  1V6L A;  1ZM1 A;  4MVT A;  4CP0 A;  4GB3 3;  3TRS B;  5FZ4 A;  2XJT A;  1PHM A;  1T6G C;  3GZA A;  1OA3 A;  1KS5 A;  1MZ6 A;  2IFR A;  2ZOE B;  3DKW A;  5DAQ A;  2N7G A;  4LHN A;  3RYP A;  3NAP B;  4COZ A;  5F3G A;  1VMF A;  2QVS B;  2R1D A;  1IHM A;  3M3Q A;  2ERF A;  4DPN A;  3I59 A;  4RN5 A;  4RGK A;  2Q4S A;  4DXS A;  5JXJ A;  2EXK A;  3KGZ A;  4I09 A;  1A34 A;  4YM2 A;  3J8F 1;  3ILN A;  5JPM B;  1TME 1;  4CCC A;  4LKS A;  4XCA A;  1OLQ A;  4IV3 B;  1PNF A;  2Z69 A;  4YNI A;  5FYH A;  4R4X A;  1J3P A;  2WFF 1;  5HV0 A;  1AR7 1;  1SAC A;  1W9W A;  2BGC A;  4XUR A;  3U4X A;  3CBN A;  2VW0 A;  4B7K A;  1N1V A;  1AYM 2;  1BYH A;  5FP9 A;  1AL2 3;  1NKG A;  2D43 A;  3AMH A;  3OEA A;  2RS5 1;  1W05 A;  2A1X A;  2BWA A;  4YW7 A;  4UF0 B;  3VL9 A;  5C8C A;  3VKL A;  5FWJ A;  5K0U C;  1XNA A;  4LK7 A;  5CB7 A;  2XJQ A;  3OD4 A;  4QWN A;  2VO5 A;  4XVH A;  1HJG A;  4HG6 B;  2GDF A;  1ZRD A;  3OCP A;  4S2H A;  2YPD A;  2ZEW A;  5LY1 A;  2R32 A;  2LTN A;  3UNP A;  2V5D A;  4UAP A;  5KC6 A;  3RFR A;  4AWD A;  3HQX A;  3ZN5 A;  1PO1 1;  4GB3 2;  4AE2 A;  2DCZ A;  4IDZ A;  4BDV B;  4NIH A;  4B4P A;  2OUH A;  3GBW A;  1D4M 3;  1VMH A;  1EV1 1;  1NA1 C;  4FVV A;  1ULE A;  2AZ5 A;  3B9I A;  1UPI A;  5A3N A;  3W20 A;  3FN9 A;  2FDF A;  2QQU A;  5CA6 A;  1H2N A;  1MZF A;  1RUD 2;  1J83 A;  3B93 A;  4ZU5 A;  3POW A;  4YG6 A;  5DZG A;  4OI1 A;  4QKD A;  3J7N A;  1W6P A;  2PQS A;  1MQT A;  1RVF 2;  4Y1Z A;  3PTR B;  2A6Z A;  3RZJ A;  2W3J A;  4S2G A;  2IC1 A;  5LW9 A;  3VBO C;  1LEC A;  2P3Y A;  4XFI A;  4AI2 A;  1RUO A;  1WW5 A;  1XNC A;  3POG A;  4UFK A;  1XYN A;  5A6Y A;  4WZC A;  3WNL A;  4Y1V A;  2ZMK A;  3IDC B;  5JR7 B;  1OOP A;  1X82 A;  4XE9 A;  2I45 A;  3KVB A;  4K1Z A;  5JI7 A;  3AJY A;  4IEO A;  4E2Q A;  1RJ8 A;  2L9L A;  4CEW A;  2A70 A;  4KWJ A;  1W3V A;  3OD0 A;  4YZ5 A;  1E5H A;  4M00 A;  5IW0 A;  2RS3 1;  3LFM A;  2FDJ A;  3TN9 3;  3VBH C;  3OUH A;  5CFD A;  2OYZ A;  4QPI C;  2J1V A;  2WQ8 A;  1X36 A;  4AI3 A;  1CON A;  1BMV 2;  2RJ2 A;  1R09 2;  2Q1Z B;  3FE5 A;  3JCI A;  4CUG A;  1CJP A;  4QDS A;  3I3Q A;  5F9T A;  1JI6 A;  1IPJ A;  1VBB 1;  1AR9 2;  1AJO A;  3MI8 A;  1QJF A;  2G19 A;  4Y1Y A;  3JXS A;  5FBJ A;  1UZY A;  2Y64 A;  2ZAA A;  3UT0 A;  2OQ7 A;  3H7Y A;  4QPG C;  2WNU B;  2VUD A;  1JN2 P;  1YQC A;  2D3S A;  1RYY A;  5IAV A;  1POV 1;  4PI2 A;  3HOB A;  1BKZ A;  2JG8 B;  4N7I A;  1S0F A;  2XBO 2;  1O3S A;  2J22 A;  5CKN A;  1VBD 1;  2QQN A;  4DNY A;  2XON A;  1MR5 A;  2EIC A;  1JZ5 A;  3ACG A;  4LBM A;  1NXD 1;  3ZXD A;  1E5I A;  1YFY A;  3ILR A;  3KVA A;  3FBM A;  1W2N A;  3AMQ A;  4J25 A;  1AXZ A;  2QCS B;  4K9S A;  4RFR B;  5EJ3 A;  3UGH A;  1AYN 3;  3AB0 A;  4QKF A;  2ETE A;  3H9A A;  3BTA A;  3TEZ A;  2RR1 1;  3VHP A;  2AC1 A;  1JU3 A;  2JG9 A;  1QJX 1;  4N9H A;  4Y1X A;  2XJR A;  3Q8B A;  4KWK A;  2GAU A;  2B42 B;  3ZXL A;  1GWM A;  4C0H A;  1MS1 A;  4AGG A;  5KC5 A;  3OPW A;  1XBF A;  3NW4 A;  4IEV A;  4R9B A;  3FZ3 A;  3UK9 A;  3Q8A A;  2XWJ B;  4FPF A;  3RZL A;  1VP6 A;  3HPN A;  4LHS A;  3MIE A;  4PIX A;  4ZS2 A;  3M70 A;  4RL7 A;  5C8C B;  4XUQ A;  5CBL A;  1K5J A;  1NCQ C;  4YAR A;  3BKZ A;  1OD3 A;  2BW8 A;  4E4H A;  4GWI A;  1JZ2 A;  3ACI A;  4L9B A;  1GYK A;  3CEW A;  3ACF A;  3T08 A;  5SV5 A;  1RUG 3;  1HQW A;  4FPH A;  4XDP A;  5FPV A;  4QB6 A;  3HIF A;  3H8R A;  2VU9 A;  4HMZ A;  1LNS A;  1RJ7 A;  2DUR A;  1ND2 C;  1XNB A;  4QM9 A;  1EV1 2;  5FMD A;  5F2W A;  2O14 A;  1XOY A;  3AP9 A;  1QOO A;  5AFE A;  1DP0 A;  4BIF A;  1YCI A;  2WL1 A;  2J1E A;  3ZX7 A;  4LT5 A;  1IG0 A;  1ND3 B;  5CNA A;  2JG9 C;  5A7W B;  2Y34 A;  2EVX A;  1FI2 A;  3GF6 A;  4N43 A;  1HRI 3;  2GH2 A;  3WQB A;  1PVC 2;  2WNU A;  2GNB A;  1DQ2 A;  2UY8 A;  3HBZ A;  5KHG A;  2PHW A;  3T1M A;  1LRH A;  3NNL A;  5FYS A;  3AM2 A;  4GH4 B;  3IDA A;  1XSR A;  2DV9 A;  4UXA A;  3SEE A;  5JXI A;  4RHV 1;  3AZY A;  4MGI E;  3S0M A;  4AI9 A;  3O1U A;  1GKB A;  2D6K A;  5F5I A;  5JWP A;  5BNP C;  3BTY A;  4WM7 A;  5ABJ B;  3WQ0 A;  1VMJ A;  5KWR A;  4FQ4 A;  1G7Y A;  1MS8 A;  3RMY A;  3ZPY A;  5FOJ B;  5LBB A;  1RXG A;  2QQM A;  2SLI A;  4XCB A;  3KB5 A;  4ARY A;  2VVD A;  2X29 A;  2QZ2 A;  1CZT A;  3N9N A;  4HOO A;  2D44 A;  1XPW A;  3QOP A;  4QX3 A;  3KLS A;  3N36 A;  2O0O A;  4Z8B A;  2VTX A;  3SNM A;  3LDR A;  1PZ8 A;  3ZFE B;  4E8C A;  3CJX A;  4CDQ C;  5L36 A;  5BXX A;  2AH2 A;  1UY0 A;  1HV0 A;  2IFW A;  1U5Y A;  2WA4 A;  3T2T A;  1LED A;  2BP6 A;  1G9F A;  3PLQ A;  5EIY B;  1M4W A;  2WSU A;  1R09 3;  3OPT A;  1S0E A;  5DXD A;  4YW3 A;  3BIE A;  3I97 A;  2PYT A;  5GLT A;  4F8A A;  3IMM A;  3ZSK A;  3F2Z A;  1AR9 3;  3FWE A;  4Q1R A;  4Q8L A;  1FV2 A;  1RUC 2;  3NJZ A;  4FPE A;  3TNQ A;  1US2 A;  1H2M A;  4MHR A;  1Q56 A;  5GLW A;  4IEU A;  4XFF A;  1CN1 A;  4KQ7 A;  1H8T B;  4X6Q B;  2HWB 3;  3M4F A;  3SQO A;  3CO2 A;  4C1W A;  4ET7 A;  1LEM A;  1W9Y A;  2CHH A;  1RHI 1;  4XFG A;  1N1T A;  3NV2 A;  1CAU A;  1REE A;  2EAL A;  4GKX A;  4W6X A;  3WY6 A;  5A6Z A;  4ASM B;  1STM A;  3NNG A;  3HR9 A;  4OYU A;  1W0O A;  2FZ1 A;  1OUS A;  1ONA A;  3PUI A;  3I3M A;  2AYH A;  5FRA A;  5I0T A;  2R04 3;  5CU1 A;  1SFP A;  1FOD 1;  1V70 A;  1ZRF A;  5B4X A;  3U0Z A;  3BN6 A;  1QWR A;  1X7N A;  2ZGM A;  4FBF A;  5A3O A;  2W1W A;  4XFA A;  5EFU A;  3NNF A;  5A33 A;  5T54 A;  1JTZ X;  3POE A;  1GLH A;  1GP5 A;  4N53 B;  1LUL A;  5C5T A;  1QU0 A;  5FZ8 A;  1ZRR A;  1DCS A;  1AVB A;  5A7P A;  3ZSM A;  2J1T A;  4XMA A;  3BPS A;  1F5J A;  2Z5W A;  2AEZ A;  4XTM A;  3FJS A;  2JDZ A;  3VHN A;  5A7N A;  1QH6 A;  2NYY A;  4XMI A;  3N7J A;  4XTP A;  4EN7 B;  1URX A;  3I7D A;  4HKL A;  1RUC 3;  3E5U A;  3AMP A;  1Y9Q A;  2WNO A;  3I8T A;  4XQ4 A;  1ALY A;  2WZR 1;  5IVC A;  2F4P A;  1W0P A;  5C9A A;  3T3Y A;  3ZFG A;  4JGY A;  5GZG A;  1J1L A;  2HWB 2;  3AKT A;  3KV4 A;  3QCW A;  1ULC A;  4BHP A;  1RL3 A;  2W94 A;  2IXJ A;  3C7E A;  4LBN A;  4P14 A;  4K8F A;  3R4S A;  1APN A;  4Y4R A;  2RS3 3;  4GA9 A;  1CAX A;  1DYO A;  2PAK A;  4RQP B;  1POV 3;  1VAL A;  2CU5 A;  5CYY A;  4DIQ A;  2RR1 2;  3HNY M;  4UT5 A;  4NPM A;  4LBQ B;  3H8X A;  1QQP 3;  2P2K A;  4YW1 A;  1C8N A;  2JDA A;  2EID A;  1LAJ A;  3CHX A;  1WA6 X;  2ZKL A;  1JW6 A;  5FYM A;  4B29 A;  3TEW A;  3IBM A;  3AFG A;  4W6Y A;  1JOD A;  2ZGS A;  4D3W A;  1SLL A;  2E32 A;  3R4U A;  4YW2 A;  2D40 A;  1EY2 A;  1S0C A;  1OPM A;  1MS5 A;  1EUT A;  5A3P A;  3ZOI A;  1CAW B;  4UBG A;  2JEM A;  4XF4 A;  5E1R A;  3BCW A;  1AXK A;  4TLG A;  1RUH 1;  4IEQ A;  3SH5 A;  1TMF 2;  4LLO A;  1I6X A;  2BEO A;  2R07 1;  5FY0 A;  1O8P A;  3E97 A;  4XIL A;  5BNP B;  2B8M A;  1FMD 2;  2RM2 2;  4LQR A;  4JGZ C;  3B01 A;  1SPP A;  1NLS A;  2WFF 3;  3SHR A;  1TE1 B;  1H9P A;  3AP5 A;  1PIV 3;  3A4U A;  5LA9 A;  3T2Q A;  3IMN A;  5BNN C;  4YM3 A;  3FUO A;  2HWE 2;  1YIF A;  3J8F 3;  1X9T A;  2ZX3 A;  5FY4 A;  1PVC 1;  2CAU A;  2VNV A;  3KD4 A;  3MW2 A;  1AR6 2;  2JXA A;  2QQJ A;  2YPJ A;  3OBR A;  3AKQ A;  2VZ3 A;  3OY8 B;  3ZN4 A;  3ACH A;  4QB2 A;  4DY3 A;  3NNM A;  1NAE A;  3NAP C;  4QGM A;  1NA1 A;  4CCM A;  2BER A;  2FMD A;  3WDT A;  5HCA A;  2AEN A;  1WBL A;  2E7Q A;  1N47 A;  3SIS A;  4D69 A;  3C7H A;  3M2M A;  1RUF 3;  3WT3 A;  1CAU B;  3CIH A;  5FLI A;  1CES A;  2C9K A;  3ACL A;  3X29 B;  3RMX A;  2G9F A;  4H14 A;  5FBZ A;  4WBB A;  5TSW A;  1JZ3 A;  2RV9 A;  1WMX A;  2EXJ A;  4QU2 A;  2OXB A;  5BNN B;  1LEN A;  2B5H A;  2XDV A;  4LKF A;  4LBQ A;  3R6S A;  2DDU A;  2ZGP A;  5FZ3 A;  2HWF 3;  2WNV C;  1DGW A;  1R1A 2;  2PXJ A;  5FZM A;  3HD8 B;  1H8T C;  2KA3 A;  3ITQ A;  3VKM A;  1W04 A;  2VQT A;  1HRV 3;  4CEW C;  5KXC A;  4O65 A;  2C24 A;  3IKW A;  4U2A A;  1QJX 2;  3PTY A;  1BCX A;  1TEI A;  4NAO A;  4YW4 A;  1O91 A;  3I2K A;  2RJK A;  2YDE A;  3RG0 A;  1WZX A;  1W8U A;  5JSR A;  3ECQ A;  1JS9 A;  1TME 3;  1MZ5 A;  5K0U A;  1FAY A;  2C4X A;  2Z42 A;  3VD5 A;  3I2F A;  4HL0 A;  2WO2 A;  3PMS A;  1IKQ A;  1ULP A;  1NY7 1;  5IK4 A;  5D2A A;  1GNZ A;  5A3L A;  4AHZ A;  5AVA A;  4X8P A;  1UY3 A;  4Y5S A;  5FO9 B;  5DAV A;  4Q4W 2;  3LGR A;  4RGA A;  1QGL A;  4S2D A;  3WD5 A;  1WD4 A;  4LPL A;  2J1A A;  3AJZ A;  5ABJ C;  3BPZ A;  3AX4 A;  3MZH A;  3O7O A;  2WWJ A;  3M3E A;  4CDX A;  5FXZ A;  4IE4 A;  2D5H A;  4I0A A;  1PMJ X;  4P5Y A;  4A44 A;  1B35 C;  1JU4 A;  1YLL A;  4K7J A;  2H0B A;  3GHN A;  2YGL A;  1YQ5 A;  1NY7 2;  5EPA A;  3S6P A;  3WV6 A;  5LA1 A;  4B7E A;  2JDP A;  5D1I A;  3D4K A;  3P3N A;  3RZZ A;  4XUP A;  1QJY 2;  1YI7 A;  4FPK A;  5FZ6 A;  1OFN A;  1HRI 1;  1CJD A;  4CVU A;  1W8F A;  2QQO A;  3POI A;  3ZYB A;  1XE0 A;  3ZXF A;  5C4W C;  5IVF A;  4GMP 1;  4D7Y A;  3CLP A;  4DFS A;  1DGL A;  1L3J A;  3LFI A;  3UKN A;  3TN9 2;  3RDI A;  4LHK A;  2ZGO A;  1A6C A;  1MQT B;  3OGR A;  3QBQ A;  3H8U A;  4R8H A;  5DAB A;  5LK5 A;  1F5F A;  4PLN A;  5T50 A;  3THC A;  1F15 A;  2ILM A;  2K2S A;  1ULF A;  5LEJ A;  2G9Z A;  1FPN 1;  5J09 A;  3VBU C;  4BQ4 A;  1PVX A;  2TEP A;  3E5X A;  5CFC C;  4XDQ A;  1QOS A;  2JDN A;  1Q8P A;  1SQ4 A;  1D2S A;  1D4V B;  1UZZ A;  1VBD 3;  3I4I A;  5ERL A;  4QXK A;  1SCS A;  2E51 A;  2ZS6 B;  3NST A;  4R9D A;  5LZ6 A;  5I91 A;  2RS3 2;  3FLP A;  1C3H A;  4H7L A;  4NPL A;  2P4E A;  3K77 A;  5GLV A;  1GU3 A;  1NLR A;  3GXU A;  1PIV 2;  3VL8 A;  1RUJ 3;  3BTZ A;  3PVN A;  3HQU A;  1NE6 A;  5JZG A;  2Y6F A;  2D5F A;  2ORX A;  4AFM A;  1NLQ A;  1QNW A;  2A71 A;  1W0N A;  1RMU 1;  2CV6 A;  3ZXG A;  2JJ6 A;  4YM1 A;  2CGN A;  4Y4Y A;  4Q5O A;  3LF7 A;  5JXH A;  5AVP A;  4LUM A;  4AR2 A;  4CDX B;  3KV9 A;  1MVE A;  5FJH A;  1HKD A;  2KD7 A;  1IQD C;  2YB7 A;  4XIK A;  2ZGK A;  5LEK A;  2R07 2;  2HLE A;  2RJL A;  1GNY A;  3IZO A;  2OS2 A;  4BQ3 A;  3P5B A;  5CAZ A;  5J48 A;  1I9R A;  2NMN A;  5JSO A;  4FPY A;  1CAV B;  3VKF C;  3AKR A;  5FZ0 A;  3S7E A;  2PAE A;  2GMP A;  4DEV A;  1Y3T A;  1ZBE 3;  4NVP A;  4QPY A;  5EV7 A;  2VUA A;  4EV0 A;  5L73 A;  4XW3 A;  4I0W B;  1AYN 1;  1WLW A;  4OI4 A;  1TVG A;  2FHR A;  4HBN A;  3WIN E;  4PBP A;  2C9A A;  1BXH A;  1R1A 3;  2BRT A;  3MFC A;  3OBZ A;  5FZC A;  1UZW A;  5FP7 A;  2VZS A;  1N3P A;  4FCA A;  4AFD A;  1HLC A;  3APB A;  4IE5 A;  5F3E A;  3WDW A;  4NII A;  2NMO A;  3WEZ A;  4K21 A;  3FFZ A;  4ZU7 A;  4UI9 L;  2XML A;  3III A;  5GKA C;  1HQN A;  1RIR A;  1JYN A;  4NWW A;  2GN3 A;  5FRE A;  4HPK A;  1KDK A;  4FO9 A;  1RMU 2;  5CIS A;  5F1R A;  3K3N A;  3WDY A;  5A3T A;  2CGP A;  3J26 N;  3MIG A;  3ENR A;  2J1S A;  4M4P A;  5C3P A;  1W6O B;  1UXX X;  3K3O A;  5IUQ A;  4CEY A;  2RS1 3;  4V1P A;  5F3C A;  5E88 A;  1BJQ A;  5L7O B;  2Y8K A;  2XKO A;  3MV0 1;  1C5I A;  4N43 C;  3K4D A;  3SCF A;  5C33 A;  1QIQ A;  1VBB 3;  2XJP A;  4Q4W 3;  1WCQ A;  2BQP A;  1FNZ A;  1XYP A;  2FCT A;  2HBT A;  4KGQ A;  1MAC A;  5D8A B;  5FZL A;  2WZR 3;  5JR2 A;  4FPG A;  2EXI A;  2WQ4 A;  4COW A;  2B39 A;  4CCE A;  1BBT 1;  1PK6 B;  1G9C A;  2BGP A;  4R9C A;  3WNO A;  1K3I A;  2LRP A;  4FT8 A;  4Q0P A;  4DQA A;  4MYE A;  3KT1 A;  5LCW L;  5FDB A;  3ETQ A;  3QAC A;  4QX2 A;  4JVA A;  1KQR A;  1WUV A;  2QQK A;  1QJY 3;  3BIW E;  3OF1 A;  1Q8O A;  3RS6 A;  1ND3 C;  2ADD A;  1LOE A;  1NE4 A;  3AP6 A;  2JE9 A;  5BNQ A;  2GN7 A;  4B8E A;  2B9V A;  1RUE 3;  1OVP A;  3N7K A;  5IJR A;  4BM8 A;  3ZN6 A;  2E31 A;  1MEC 1;  3AKS A;  1RUF 1;  4PCR A;  3ST7 A;  4MLO A;  3CMG A;  1XYO A;  3U11 A;  1BQP A;  5A6X A;  3TAY A;  3B94 A;  1RMU 3;  1YFX A;  2RE9 A;  2WLQ A;  3FFQ A;  1YUD A;  1QOT A;  5FZ1 A;  2AEY A;  5JOW A;  2XVK A;  3E5Q A;  2BU9 A;  3CF6 E;  1COV 2;  1WW4 A;  1EPW A;  5T5J A;  2Y6G A;  4S2F A;  4ZY9 A;  4OUE A;  2RDQ A;  1GSL A;  2GMM A;  3B00 A;  4COV A;  1HB2 A;  3D5O A;  4NR1 A;  1YQ8 A;  1ZA4 A;  1HV1 A;  3A22 A;  4RR3 C;  5I0D A;  5FCC A;  4CPB A;  1OQD A;  4RQP C;  1UNB A;  4IEZ A;  4O7X A;  1HB3 A;  1VB4 A;  3VD9 A;  2R49 A;  1NT0 A;  1UU6 A;  3OSD A;  4FFI A;  2X10 A;  4CP1 A;  1IOA A;  1RUH 3;  2XJV A;  3HVD A;  1OC1 A;  2D7F A;  5L7O A;  1SLT A;  2FCV A;  4AL9 A;  4BWO A;  3KMH A;  3ILF A;  4M0H A;  3OBT A;  1POV 0;  4W8J A;  2XR4 A;  3PIG A;  1BZW A;  4WM7 B;  5ABJ A;  1YXW A;  4GUL A;  2ARE A;  1OA4 A;  4PIY A;  5A32 A;  1W99 A;  1SZB A;  3WP6 A;  1EUU A;  2XWB B;  3VBF C;  3R0R A;  4YZ3 A;  1LGN A;  2XBO 1;  2YGM A;  3ZVX A;  4O9E A;  3VUO A;  3RYK A;  4WM8 A;  5GZC A;  4LLF A;  2BFU L;  2RG4 A;  1UIK A;  2W92 A;  1QHD A;  2YFU A;  3AZZ A;  4V2V A;  1GOH A;  3O5S A;  1TG7 A;  5T5L A;  1W9F A;  5IK8 A;  5ACA 2;  4I3P A;  1GQP A;  1PMI A;  1SBD A;  2JD4 A;  2WO3 A;  4DB5 A;  5FO8 B;  5CG8 A;  3ZN6 B;  3UGG A;  4XC9 A;  5B2G B;  2QKD A;  4AW7 A;  5C7G A;  2Y33 A;  3CNA A;  4QD2 A;  5KHJ A;  3AYA A;  1I3H A;  4ZS3 A;  3T0B A;  1W39 A;  3BU0 A;  1W6O A;  1MZE A;  4R4Z A;  2XL7 A;  5JLV A;  4LO5 B;  3THD A;  2P6C A;  1WLT A;  2W1U A;  1RUG 1;  3INA A;  1ASJ 1;  3PUS A;  4CXX A;  2X5I C;  3K4A A;  5JMC A;  2W1Q A;  2ZMN A;  2GC2 A;  1KRI A;  2VZV A;  2X53 S;  4MSV A;  4Z2W A;  1W28 A;  1ASJ 2;  4COY A;  2VW1 A;  3J4U H;  1YJK A;  1RUI 1;  4FPJ A;  2W0X A;  1SFN A;  1CGP A;  2FDI A;  5JSP A;  4YZ2 A;  4FP3 A;  2ATF A;  3OB8 A;  4QDR A;  2FZ2 A;  3GYD A;  5FZF A;  1DLC A;  2QFE A;  4PT6 A;  4QB1 A;  4COU A;  5IAT A;  1W6P B;  3LA7 A;  1Z7S 2;  1RGS A;  1CAX B;  2JG8 A;  4RQP A;  1DG6 A;  1C1L A;  4Z07 A;  4R52 A;  4UFH A;  3VZL A;  1ST8 A;  3RJR A;  2PAM A;  3GZT B;  4P9L A;  4ES9 A;  5IT6 A;  1AR8 3;  4CCJ A;  1PGL 1;  3G6J B;  1K42 A;  4E8D A;  2O8O A;  3FHQ A;  4GXL A;  1TQ5 A;  2ZX2 A;  4LO7 A;  1HIX A;  1ZX5 A;  1R08 2;  4QU1 A;  5F39 A;  5HCF A;  1UY4 A;  1EPZ A;  3A0K A;  1WKY A;  3VBU A;  2VW2 A;  2XVL A;  3VHO A;  4RHV 2;  2HWE 3;  5A6Q A;  1GOG A;  5BYN A;  5KBF A;  3MDP A;  4IGP A;  4EN6 B;  3H8O A;  1X33 A;  4QHB A;  3L2Y A;  3QLQ A;  4U36 A;  3H1Y A;  5IWF A;  1R1Z A;  2F4L A;  2Y38 A;  3FHI B;  3AZW A;  2PFW A;  4NHY A;  3U78 A;  5C3O A;  3D0J A;  3KF3 A;  3NV3 A;  3W58 A;  3SH4 A;  1AX2 A;  2ARB A;  4OVE A;  4Y20 B;  3WW2 A;  1PIV 1;  2YU1 A;  1O59 A;  1UXZ A;  4AZZ A;  1DF0 A;  3GCW A;  2DYC A;  3LEK A;  2DVB A;  5GAL A;  2FQP A;  1LOF A;  1AR9 1;  1OUR A;  3GM8 A;  4MOA A;  4OMD A;  4CCO A;  5A1L A;  4YFW A;  1NCR A;  2XOM A;  3BVC A;  3LZZ A;  4EZH A;  2X8K A;  5I8Y A;  3N7M A;  1R09 1;  4WVM B;  4AAP A;  5M0T A;  2P17 A;  4Z82 A;  4G3Y C;  4EN9 B;  3KCC A;  5IVV A;  1W8H A;  4IE6 A;  1XE8 A;  4LKD A;  1YFW A;  4DUX A;  4N43 B;  4BXS V;  3IAQ A;  3U07 A;  5JUV A;  3V0A B;  1MEC 2;  4QXB A;  4AYU A;  3GZU C;  3V0B B;  2VZP A;  3O1M A;  5DZE A;  2DU0 A;  4L11 A;  4RD7 A;  1WME A;  4AED C;  2HJI A;  3DPR B;  5FY7 A;  4XDO A;  3H3Z A;  2Z2S B;  2W9X A;  4ASK A;  3LPF A;  5BUV A;  5C8C C;  1RHI 2;  5AC9 3;  3DF0 A;  4YGD A;  2YC2 A;  5DAW A;  4AVV A;  3D3A A;  2ZX0 A;  5APA A;  5FQ0 B;  5IFP A;  2LW8 A;  1VB2 A;  2HEW F;  1D4M 1;  4XBL A;  2V72 A;  4GWN A;  3KHC A;  1GOF A;  3E6D A;  4XBN A;  2CDO A;  1DGW X;  4K1Y A;  1UX6 A;  5CFC B;  1UU4 A;  2W39 A;  4BH9 A;  1WCU A;  2JIG A;  3JU9 A;  3ZIX A;  4MGT A;  4ONU A;  4AHX A;  2A3X A;  1SBE A;  3MF9 A;  4JQT A;  2BBV A;  3P1I A;  4WM8 C;  4NHL A;  4PF1 A;  1PO1 2;  1ZZC A;  4JHZ A;  3RPQ A;  2QNK A;  2LRO A;  2GC0 A;  3D0S A;  3T2P A;  2VOV A;  1LHV A;  2FBE A;  1GZW B;  2DBI A;  2MNG A;  3FC0 A;  1JBC A;  4DRV A;  4IV1 C;  4M0N A;  4ZXE A;  1O6U A;  5EHD A;  1LGB A;  3ELN A;  4OHZ A;  3WUD A;  4C0B A;  1SBF A;  5DAX A;  5A7Q A;  4M3C F;  5FUN A;  4KI5 M;  4WVV A;  1CX4 A;  3JZV A;  3WF0 A;  4BLI A;  1ZYB A;  2W95 A;  1RUG 2;  4LJH A;  4DUV A;  1YIP A;  1RB8 G;  1M06 G;  2D6P A;  3OG2 A;  1AYM 1;  4FXG B;  4LO8 A;  1K5M A;  2R0H A;  4XHX A;  4EWA A;  2GZW A;  3ZSJ A;  3AMN A;  3GGL A;  3H1M A;  2PEL A;  4J1W A;  3I3D A;  2BPA 2;  3M1H A;  3PJQ A;  3O1V A;  1B35 B;  5H9S A;  4HZF A;  4N9I A;  2PQQ A;  5FYU A;  3I2I A;  2BVV A;  4CP2 A;  1PVC 3;  4JHT A;  3BOW A;  4L99 A;  4A3Z A;  5JCT A;  1T6B X;  2OW4 A;  4Q4V 1;  4QX1 A;  1HX6 A;  4IV1 B;  1KXG A;  4XUO A;  3VN4 A;  5FO7 B;  5EXO A;  2Q1F A;  1G86 A;  1A8D A;  2WO7 A;  3NJV A;  4OCT A;  5EP9 A;  4AGV A;  3N9O A;  1FPN 2;  1NQD A;  4YPJ A;  4FQZ A;  2J1U A;  3VBH B;  1ND2 A;  1UX7 A;  3K4Z A;  3ZSL A;  3LWC A;  2WBK A;  1AHS A;  1Y43 B;  2DTY A;  2PA7 A;  4AOC A;  4XAC A;  3A7Q A;  4PQQ A;  1RUD 1;  2IZW A;  2ZGL A;  3MID A;  1HQL A;  1OOP C;  4Q0U A;  4YW6 A;  4Y33 A;  4ZPI A;  2D6M A;  3PUH A;  4D94 A;  1UYX A;  1C57 A;  3MO4 A;  2BVB A;  3WCR A;  1UD1 A;  2YZ4 A;  4LR4 A;  3WCS A;  4I0B A;  1W8W A;  2PHR A;  3F95 A;  3ROU A;  4HN0 A;  1BK1 A;  4GQ7 A;  2TNF A;  2VNG A;  3OOX A;  1JZ4 A;  1UOF A;  3R4D B;  2R07 3;  1IGO A;  4C91 A;  5L7O C;  3LEG A;  4PI0 A;  1Z7S 3;  1UOB A;  3B7M A;  4DS0 A;  4FTS A;  4KU7 A;  3MUZ 1;  2DVD A;  2F6B A;  4NIA A;  1NXM A;  1BVV A;  3VDD B;  4P08 A;  1XNK A;  2J42 A;  3IPV B;  4HXC A;  1LGC A;  4CDW A;  3WR0 A;  1VJ2 A;  3U4S A;  4W65 A;  1H2K A;  4MXV A;  1CWP A;  4LO6 B;  4R9A A;  3UGF A;  4JV4 A;  1ZBA 1;  4IER A;  3D8C A;  4BQ1 A;  4GAZ A;  1WMD A;  5FP3 A;  5FMO L;  3TOJ A;  5D21 A;  2QDN A;  4JRA A;  5DDJ 2;  5L19 A;  2K46 A;  1D4M 2;  1F9K A;  1F31 A;  3OYW A;  4RHV 3;  3IIA A;  1DQ1 A;  4FP2 A;  3WDV A;  1F4A A;  3VZM A;  4HVO A;  4OQ9 A;  3W59 A;  4MGK E;  4OI0 A;  4Y22 B;  2P3I A;  4ATE A;  2BTV C;  3ES4 A;  3H3U A;  3OGV A;  2QUO A;  1GWL A;  2J7M A;  5DDJ 1;  1JHN A;  1ZBA 2;  3W21 A;  1RHI 3;  2NN8 A;  2RHP A;  1G6N A;  4K6B A;  3RGB A;  4JTN A;  1BK0 A;  1H30 A;  4NAM A;  4PHZ A;  2HWB 1;  1XNT A;  3BOD A;  2X09 A;  2A75 A;  4YW5 A;  5FY1 A;  4OQ8 A;  2C26 A;  2CDP A;  5LBE A;  4NHM A;  4CP9 A;  2UY9 A;  3G7D A;  2YU2 A;  5FMB A;  5J98 B;  4XFC A;  5L9B A;  4AVS A;  4HK8 A;  3MBW A;  2WYF A;  2ZGR A;  4YZ1 A;  4ZU4 A;  1FAT A;  3C7G A;  1KIT A;  1QJU 3;  2YRO A;  5C3R A;  3PUQ A;  3ZR5 A;  2WZR 2;  3WDX A;  3AXD A;  3LDB A;  5FFO C;  1SLC A;  2ZPX A;  3HNB M;  4FAG A;  3TEY A;  1BBT 2;  1NQJ A;  1MS4 A;  4IE7 A;  1HXS 2;  4HVR A;  4BMB A;  3KF5 A;  3URF A;  5I0R A;  1N1S A;  2HWD 3;  1OKQ A;  3V56 A;  1K5M B;  2VMF A;  2C6S A;  4YZ4 A;  1RUI 2;  1GBG A;  4CEY B;  1PO2 2;  5FJK A;  4YRD A;  2WWS A;  3V64 A;  3ZDV A;  1UMH A;  2K9Z A;  4HFS A;  1LU1 A;  3H3L A;  1NA1 B;  2ZHL A;  5DDJ 3;  1S0I A;  4A2U A;  2Q8C A;  4DUW A;  5DMY A;  4H7M A;  2JG8 C;  3MEP A;  1QXP A;  3VBF A;  2MHF A;  1QJU 1;  3GHM A;  3N9P A;  3BTX A;  2H6C A;  3BYW A;  4YG0 A;  5GZF A;  5L9R A;  3BB6 A;  1QXR A;  2A7A A;  1VAK A;  4N7U A;  1DDL A;  1DQ5 A;  5HV4 A;  4MV2 A;  4BIS A;  5HCB A;  4AFA A;  4WVW A;  1OH4 A;  5J36 A;  1DBN A;  1FMD 1;  1ZBA 3;  2RM2 1;  4CU8 A;  3K51 A;  4W4Z A;  5BNN A;  1V9U 3;  1PGW 2;  2JD9 A;  5LB6 A;  3ZSE A;  4MGQ A;  1I1E A;  1DQ0 A;  1Y9M A;  3ASI A;  3NWK A;  3CZJ A;  4LKE A;  4MGZ E;  3TEX A;  2OVU A;  3V65 A;  3MLJ A;  4CEY C;  2ZJC A;  3A23 A;  4UBH A;  5ANN A;  3ZPO A;  4AGR A;  2TUN A;  4AHW A;  4H3W A;  3ZLI A;  2VTF A;  1Z7S 1;  5KHH A;  1WLC A;  1D2Q A;  2BWC A;  4RA0 A;  2DVG A;  2ENR A;  4CDU B;  4BQY A;  4AHY A;  4AVA A;  4BQ5 A;  3K48 A;  2CAV A;  2Q8O A;  3IDE A;  4P00 B;  4Q4X 1;  1VPH A;  5C71 A;  3AL6 A;  4DOU A;  2DBN A;  2Q0A A;  2YC4 A;  2PHL A;  2WS9 3;  3TB0 A;  4BIO A;  3DN7 A;  4LIU A;  3RYR A;  1Q43 A;  3CQO A;  4CCD A;  4A7Z A;  5I8T A;  1I5Z A;  3H50 A;  4LBJ A;  4NOT A;  4XFH A;  1S0B A;  1UMZ A;  4JAA A;  3I2D A;  1J1T A;  3WHT A;  5BV6 A;  4Z92 B;  1LHU A;  2VY0 A;  4RSU A;  4RFT 0;  4SBV A;  1S0D A;  4D6Q A;  5FXV A;  4MET A;  4KWL A;  5F8P A;  1OA2 A;  5FMC A;  2QQP A;  2ET7 A;  3L2H A;  4PQ9 A;  4AK3 A;  3IAP A;  4QXH A;  2ZHM A;  2ZGT A;  1L7Q A;  2BNN A;  3SH3 A;  2DVF A;  3UV9 A;  1JZ7 A;  1UAI A;  1WW6 A;  1UZ0 A;  4ORF A;  3OEB A;  4Q4X 3;  5GJ6 A;  1V9U 2;  3KT4 A;  1ZA7 A;  3WG4 A;  1FV3 A;  3AMM A;  2W2I A;  4B3N A;  2DTW A;  3KQ4 B;  2HYX A;  2IWG B;  3N35 A;  3KWV A;  4XZU G;  3WNP A;  4CDQ A;  3HT1 A;  3UYJ A;  3WF3 A;  2OPK A;  4PDW B;  3WSO A;  2F17 A;  2PHX A;  4CEW B;  3I2H A;  2LUW A;  1N3Q A;  1RVF 3;  3SMH A;  3USU A;  3NQH A;  4L8Q A;  5BY5 A;  3GBG A;  1SLA A;  1IQA A;  1UW8 A;  2GNT A;  5EYY A;  5FYI A;  1JMU B;  2W47 A;  2WKK A;  4ERO A;  1HJF A;  1FOD 2;  4OFG A;  1HN1 A;  3SKJ E;  4H2A A;  2OKX A;  2VNR A;  2DCY A;  5A1A A;  2WZ8 A;  5FUP A;  2G9G A;  2VMI A;  4Q8K A;  4P9I A;  2JE8 A;  1VR3 A;  4IXL A;  4NHK A;  2WJS A;  1UPS A;  5FZ7 A;  3O1P A;  5F2S A;  1DFQ A;  2HYK A;  3MUY 1;  1QXJ A;  3ZXE A;  4QMA A;  2YY1 A;  2P3K A;  1S0J A;  1WWY A;  1NCQ B;  3KSC A;  2ZXQ A;  4ZON A;  4OHW A;  4XBQ A;  4Q4W 1;  2ZHN A;  4FTB A;  2HKX A;  2QBX A;  3MLK A;  3WOG A;  4YVS A;  3TN9 1;  4QX5 A;  1IG3 A;  5JZG B;  2A3Y A;  3I2G A;  2VCA A;  4UFJ A;  4X8N A;  3PVE A;  1AR8 2;  1D0G A;  4JKM A;  4Q0V A;  4JKL A;  2UUR A;  2BBA A;  3JD7 1;  2JKX A;  3AP4 A;  3O0W A;  3EMR A;  3N9Q A;  4PF5 A;  3S57 A;  3SIT A;  4QDQ A;  3MF6 A;  1JZ6 A;  4BZ4 A;  3IT8 A;  4QAW A;  4Y24 A;  4IUG A;  2ADE A;  3PU3 A;  3HEI A;  1JYC A;  2PMW B;  4AI1 A;  2ORZ A;  1Z78 A;  2JE7 A;  3CJI A;  3U14 A;  1GV9 A;  1O5U A;  4P5H A;  2NLR A;  4CDQ B;  4DIN B;  1CZV A;  2E53 A;  5F5Q A;  4MO3 M;  1J3R A;  1X8E A;  2MEV 2;  3N7L A;  3SLI A;  1JOJ A;  2VVF A;  3O1T A;  2ZEX A;  3I59 B;  4QPG A;  4I3G A;  4KG0 A;  2R6Q A;  1AJK A;  2WRA A;  2WSV A;  5JZG C;  1F4H A;  1V6O A;  4BQ2 A;  3WW1 A;  1AL2 2;  1SDW A;  4M3C E;  1DYK A;  2XLA A;  4AFC A;  2JEC A;  3RZG A;  1Q3E A;  1V6M A;  1WCD J;  3O12 A;  2Q30 A;  4HKW A;  1H1I A;  3LSE A;  2ZZQ A;  2LS6 A;  2HEY F;  2XXZ A;  4AVB A;  3U10 A;  4NRO A;  1C5H A;  1KS4 A;  2CSG A;  1MQT C;  2XVG A;  1MS3 A;  3VBR B;  1VIW B;  4JGZ A;  4MGS A;  4TLF A;  3WP5 A;  4IW3 A;  4D8M A;  1VLN A;  1F35 A;  1YEW A;  4ZZ8 A;  4EYU A;  5IVB A;  4IEX A;  3VDD C;  1H9W A;  2OX0 A;  2R06 2;  4Y5T A;  2E7A A;  3A21 A;  4Y20 A;  4OLL A;  2X05 A;  1GZC A;  5DUX A;  1OLR A;  5FY8 A;  4BLJ A;  5HBA A;  3PUA A;  4QQH A;  4NID A;  2GND A;  3GBF A;  2XGX A;  3I2J A;  1DZQ A;  1HB4 A;  3WLU A;  1L7R A;  2UYA A;  2R06 1;  4KBB A;  3LSD A;  4OUS A;  3WP4 A;  1W9S A;  4BK5 A;  3O1O A;  3LEI A;  1UYY A;  4UOJ A;  4LIV A;  5EJ1 B;  3FHA A;  3ABZ A;  1UIJ A;  1W06 A;  3FBY A;  3JQW A;  3P6B A;  4AQ6 A;  2VTX J;  1QMJ A;  2EAK A;  3OTF A;  3RI8 A;  2ZML A;  4CXY A;  4FOY A;  5A1F A;  1Y4W A;  1XJA A;  2QJV A;  3AVS A;  4V2W A;  1XU2 A;  3FUQ A;  2VM9 A;  4LO4 B;  1ACC A;  4NN0 A;  2OUJ A;  4GMP 0;  2VZQ A;  2VJX A;  1QKQ A;  2FCU A;  2AUY A;  1AF9 A;  1PGS A;  4JGY C;  4JDM A;  1V6N A;  2V4V A;  4NE9 A;  3TWI A;  1FNY A;  5CEH A;  5E89 A;  4DXR A;  2Y6K A;  3I54 A;  4YSF A;  4CRQ A;  4D6R A;  2E7T A;  1H4G A;  4UF0 A;  1LOG A;  3MHZ A;  3PVB B;  4OMC A;  3DUI A;  1VBC 3;  4OZX A;  1OBN A;  5DPN A;  5CFC A;  3LIG A;  3T1L A;  1NCQ A;  3BU7 A;  5HCH A;  1LOB A;  1CQ9 A;  3KCY A;  1JOB A;  4JKK A;  1NCR B;  4QT6 A;  1ZVF A;  5LAT A;  1D7P M;  3B69 A;  4I02 A;  1LCL A;  2WN2 A;  2GP5 A;  2CL2 A;  4XIO A;  3VBR A;  4AEK A;  4BYY A;  1GZW A;  3POF A;  4NJ4 A;  4YVS C;  4XAB A;  4IQP A;  3RZM A;  3CZU A;  5FZG A;  3RQ0 A;  5FLH A;  4A7Y A;  4BK4 A;  3J8F 2;  4B4R A;  1SLB A;  2MEV 1;  4FOQ A;  4UFI A;  3QH6 A;  1BHG A;  5E16 A;  4TZD A;  2WAA A;  3OUJ A;  1MVQ A;  1W8N A;  2H6B A;  3PU8 A;  1H8V A;  4LUK A;  3WNX A;  4CSW A;  1LB2 A;  4KBZ A;  3ZFE C;  2ZEY A;  4AED A;  4GD4 A;  3AKP A;  5T3N A;  3ZMN A;  2Q8D A;  1JOP A;  3ETP A;  3CL1 A;  3N9M A;  4XXA A;  5B4N A;  1RUF 2;  3AZV A;  4OUM A;  1WMF A;  3NNJ A;  3AL5 A;  4UYB A;  2A6V A;  5HPO A;  2IXK A;  4NMI A;  2YHJ A;  3N3H A;  5GLZ A;  2B7Y A;  5A33 B;  1JYI A;  4XFB A;  5H9P A;  1BVP 1;  1C8M 1;  1PK6 C;  3VDB A;  3MIB A;  1IS4 A;  3S5A A;  3PME A;  2CWM A;  4K40 A;  2R04 2;  4IV1 A;  4C8D A;  2A6W A;  5DUW A;  5EWS A;  2JG9 B;  1ZRC A;  4EWE A;  1ZZ6 A;  2JIJ A;  1LHW A;  3ZR6 A;  3KQR A;  3VZK A;  2MEV 3;  1SFY A;  4MG2 A;  4O61 A;  4Q4V 2;  3C7F A;  2WA3 A;  2IVJ A;  2WR9 A;  3HN3 A;  3R05 A;  4GH4 C;  1ENQ A;  3KV5 A;  4P9Y A;  5FYT A;  1VBA 1;  4AQT A;  2GME A;  3CJI C;  3UJO A;  2H0V A;  3LB9 A;  4MXW A;  4P9X A;  5A7S A;  4EN8 B;  3LD8 A;  5BNP A;  3Q8C A;  4KG8 A;  4HET A;  2VXR A;  5HXM A;  1K45 A;  4E2G A;  3AC0 A;  1DLL A;  2VUJ A;  1CR7 A;  4PLO A;  2JIC A;  4M01 A;  5LAS A;  4Q0S A;  1XE7 A;  5FXW A;  5LRR A;  4CYD A;  1RUD 3;  3N9L A;  1K5M C;  3WNN A;  3J7L A;  1REF A;  4OUL A;  2QQV A;  1US3 A;  1W6Q A;  5BNO A;  1RIT A;  5FXX A;  4L2N A;  5C3S A;  2VCC A;  4P9J A;  1U5Z A;  4EJR A;  5A32 B;  4D6S A;  1O3T A;  3HBK A;  1OLM A;  3AP7 A;  5ACA 1;  5KHK A;  4A41 A;  4ATF A;  2HWF 2;  4YYO A;  2QE3 A;  1RTV A;  4GAL A;  1TNR A;  2RMU 2;  1TZO A;  1JUH A;  3NKG A;  3NV1 A;  3ES1 A;  4YGE A;  4GH4 A;  5CVR A;  3VD3 A;  5SV8 A;  5FYY A;  3E6B A;  1QJX 3;  3EJK A;  5EJZ B;  3T0D A;  2OZJ A;  1AR7 2;  3EB7 A;  3EYP A;  5DN2 A;  5G05 L;  5JOY A;  3WF4 A;  4KNC A;  3AYC A;  2VEC A;  1QY4 A;  4A4A A;  4CUC A;  1AYN 2;  4SLI A;  2GC1 A;  1RUE 1;  2Y60 A;  4UFM A;  3S30 A;  1GWK A;  4CDX C;  1OQE A;  3VZJ A;  5JOZ A;  1G9B A;  1YQ6 A;  1H4H A;  1OFS A;  3MIH A;  3M3C A;  5GZD A;  1NYW A;  4M3C A;  1PGW 1;  3SCH A;  3VBU B;  1L7L A;  1DGR N;  2DFC A;  2V5Y A;  2R06 3;  5A80 A;  2E26 A;  3WNM A;  1POQ A;  4IGO A;  4QX7 A;  3ZO0 B;  2PHD A;  2XJU A;  3T09 A;  1QJE A;  1VRH 3;  1EP0 A;  4XJ8 A;  3W5N A;  4AI0 A;  1YJL A;  5JVV A;  3DXT A;  5GM0 A;  2UWA A;  2GU9 A;  1VAM A;  2YBK A;  3IB3 A;  1AL0 G;  2GC3 A;  2WFF 2;  2XLF A;  3QH7 A;  3ATG A;  4MXW B;  3WZ1 A;  3RSJ A;  4QPI B;  2WNU C;  4Z1V A;  4Z2A A;  3THP A;  3W5M A;  2D98 A;  3J9S A;  5IVY A;  5H9Q A;  2BV4 A;  1AR6 3;  5FY9 A;  4A6S A;  5FYZ A;  3C2U A;  2RS1 1;  1KJL A;  5C9A C;  1BEV 1;  2NP0 A;  4MHU A;  4F83 A;  3KHB A;  4FXK B;  3CDZ B;  2WAB A;  4JDO A;  5E8A A;  1IS6 A;  5JOX A;  2XKP A;  4AXO A;  1D0H A;  4Y22 A;  1KGY A;  1C1F A;  4MAD A;  3NVC A;  5LWB A;  2VZR A;  3V0A A;  4XJZ A;  4OHY A;  2BYV E;  3VD7 A;  1KFX L;  2EIE A;  5FPA A;  3ZXA C;  1JYW A;  2Z79 A;  2Z4F A;  2A73 B;  2WIN B;  4MX3 A;  3IM0 A;  4K8R B;  2VMD A;  4D7T A;  1WBF A;  3A0N A;  4CUA A;  1UQX A;  2UYB A;  4LBL A;  4AI8 A;  1IS5 A;  5GZE A;  4DEQ A;  4ARX A;  1O5L A;  1UKR A;  3OUI A;  1WCS A;  1VBD 2;  3ZIW A;  5JI9 A;  1GZT A;  2Y0I A;  1EV1 3;  3I3E A;  4E9K A;  2VCM A;  2NM1 A;  2VQU A;  4JCK A;  1QDC A;  2SBA A;  4WM7 C;  4AVC A;  2O1Q A;  3SEP A;  5FP8 A;  3TNP B;  5F5A A;  5FWE A;  4NRP A;  4A3X A;  3POS A;  1Y7B A;  1WW7 A;  2HBU A;  3PIJ A;  3UKV A;  4C90 A;  3AYD A;  4E4D X;  1RUC 1;  3HJR A;  3RI9 A;  1H8T A;  3T2O A;  2ZAB A;  5LA2 A;  3BI3 A;  4E2S A;  2PLV 1;  1COV 1;  4A7K A;  4TWT A;  5F6K A;  4JGY B;  1GMM A;  2HWC 1;  2HH9 A;  5ISL A;  2W46 A;  4LE3 A;  4QHZ A;  3JQX A;  1Y9G A;  1NZC A;  1ZZ9 A;  5K8S A;  1QEX A;  4Q29 A;  1C4R A;  1SEF A;  3Q8E A;  4LMF A;  1U12 A;  3HQR A;  5IK7 A;  2FDG A;  2EIB A;  4JRL A;  3MW3 A;  4NRM A;  1BMV 1;  3DPR C;  4LTA A;  4DXZ A;  4FAH A;  1DIW A;  2OII A;  2X5I B;  3KT7 A;  5FQ0 A;  3OGS A;  2BNO A;  5A3U A;  5I0U A;  2DCK A;  2ARC A;  5L9V A;  4LIT A;  2G1M A;  1FOD 3;  2VNO A;  2RS5 3;  3NAP A;  1UOJ A;  1H0B A;  2B46 X;  3NKT A;  3WP3 A;  1AYM 3;  4YLZ A;  1ZNP A;  4CCN A;  4H55 A;  1OPO A;  4AAX A;  1AR7 3;  2PHT A;  3TBD A;  1CVN A;  3I49 A;  4FFF A;  4N53 C;  5IYY A;  1HB1 A;  4BOW A;  2BGO A;  2ZHK A;  4Y3O A;  3POJ A;  1F2N A;  4NIG A;  2VXJ A;  2YFZ A;  3POY A;  3HMY A;  2GH8 A;  2YYO A;  1BEV 2;  4QGN A;  2XB6 C;  2RS1 2;  1IZ3 A;  4IET A;  4DXT A;  1PX4 A;  2KR2 A;  4Q26 A;  1PM7 A;  5I93 A;  3GJB A;  4J6G A;  5FZO A;  1AZD A;  3LA2 A;  4QKB A;  3RWK X;  4E4S A;  5J96 B;  2VPV A;  1OF4 A;  3HN1 A;  2ZBJ A;  1V0A A;  1W2U A;  1SG3 A;  2ET1 A;  2XG3 A;  1HXS 1;  3ZYP A;  2XJS A;  4ZXK A;  4CCK A;  5K4L A;  3UJQ A;  1UOG A;  1LKN A;  3H0O A;  5F37 A;  2VBB A;  4UW4 A;  5LBC A;  2WWU A;  3VDA A;  3J7H A;  3LOI A;  2XL9 A;  1YYN A;  2ZA9 A;  3VDD A;  3ZMO A;  4PDW A;  2GAL A;  3WVJ A;  2CYF A;  2Y6H A;  4IND A;  1AUY A;  5CAD A;  1GR3 A;  2EA7 A;  1ND2 B;  2JWP A;  1TMF 1;  3GCX A;  1PZ7 A;  3OPZ A;  1DHK B;  4XJ9 A;  5FPU A;  5FZH A;  1BLZ A;  1FYU A;  2VE1 A;  5J37 A;  4LBQ D;  2W08 A;  2OA2 A;  1UMI A;  4KL1 A;  3WQ7 A;  3JB4 C;  4HKO A;  3DKQ A;  3HAG A;  4FTE A;  1HRV 1;  1ZBE 2;  4KU8 A;  4P9G A;  1COV 3;  1ULG A;  1H2L A;  4B4Q A;  2CGO A;  1VRH 2;  4JC1 A;  1UN1 A;  4BE3 A;  4GWJ A;  1UYP A;  5FAX A;  4LA2 A;  5KXE A;  3ALQ A;  3JBG 1;  2QTW B;  1ZZ7 A;  4QPG B;  4AEM A;  1MS0 A;  3ORJ A;  2YXS A;  4HK9 A;  3B02 A;  5T5P A;  3WUC A;  5K7P A;  5KR7 A;  1ZRE A;  3PJY A;  1V6I A;  3OY8 A;  3B5L B;  3DGT A;  4TTG A;  2VUL A;  4LE4 A;  3RZH A;  1W2A X;  4A42 A;  2VD7 A;  3SCG A;  4TN7 A;  2RR1 3;  1U5I A;  1OI6 A;  2XUE A;  1PX3 A;  4Q2F A;  4E4Z A;  5JXG A;  5FR3 A;  5CZK A;  1QQP 2;  3T30 A;  2Y6L A;  4IL7 A;  1QH7 A;  4MH0 E;  1WD3 A;  1K12 A;  2Q8E A;  3E1F 1;  1LOF C;  3EXU A;  1VBB 2;  1YWK A;  2ARA A;  2WT2 A;  3OGG A;  3PL0 A;  2HEV F;  2BZD A;  4DZG A;  3OYW B;  3MPB A;  1KD7 A;  3D82 A;  2JKB A;  3VHR A;  1YFU A;  2R0F A;  3DV8 A;  4F3J A;  2P37 A;  2OQ6 A;  3VBF B;  4JZR A;  3M3O A;  4A6O A;  5HXV A;  3WX5 A;  1JYV A;  1KJR A;  1R64 A;  3I3B A;  4Q4Y 1;  4JX0 A;  3MPP G;  3WF2 A;  1OHF A;  4BA6 A;  2D6O X;  1H6Y A;  1S2E A;  4EN0 A;  1SDD B;  2JB8 A;  1O4T A;  1YRZ A;  3PVO A;  1XXN A;  1UKG A;  2Q5T A;  2P1B A;  2VME A;  3RVH A;  2CY6 A;  2LM3 A;  4CZS A;  3KS7 A;  1Q8Q A;  4N8M A;  4TYS A;  1R08 3;  1EYB A; 
#chains in the Genus database with same CATH homology
 5A1A A;  2WZ8 A;  3OEA A;  1NKG A;  2JE8 A;  1XNA A;  2J1S A;  4M4P A;  1UXX X;  3MUY 1;  2VO5 A;  2VZ1 A;  4XVH A;  4HG6 B;  2Y8K A;  2ZEW A;  3MV0 1;  2ZXQ A;  1UY2 A;  3K4D A;  2V5D A;  4UAP A;  3UNP A;  2QBX A;  1WCQ A;  2YG0 A;  4BDV B;  5C70 A;  5JR2 A;  3I2G A;  2VCA A;  1O8S A;  4JKM A;  4JKL A;  3LE0 A;  3FN9 A;  2BGP A;  1H6X A;  2BBA A;  1K3I A;  2XQX A;  2JKX A;  3WNO A;  2XHN A;  5LCW L;  2ZEZ A;  1J83 A;  4QDQ A;  4QX2 A;  1JZ6 A;  2QQK A;  4QAW A;  4QX0 A;  2R7E B;  4IUG A;  3HEI A;  2PQS A;  4AG4 A;  2ORZ A;  2W3J A;  2B9V A;  5IJR A;  1CZV A;  2E31 A;  4MO3 M;  3WNL A;  3CKH A;  1SHW B;  1ULO A;  2ZEX A;  3CMG A;  1F4H A;  2L9L A;  3DEC A;  3NRU A;  1CZS A;  2J1V A;  2LS6 A;  2WQ8 A;  2Y6G A;  1OF3 A;  4ZY9 A;  4OUE A;  2RJ2 A;  1J84 A;  4XUT A;  4QDS A;  1JI6 A;  4MGS A;  3A22 A;  5I0D A;  4D8M A;  3T0A A;  5LA0 A;  4ZZ8 A;  3VD9 A;  3JXS A;  2VZT A;  2Y64 A;  3A21 A;  2X10 A;  2X05 A;  5IFT A;  4TXW A;  2ID4 A;  4CU9 A;  1RYY A;  2QQL A;  3HOB A;  3I2J A;  1L7R A;  4D0Q A;  4ZZ5 A;  4A45 A;  1W9S A;  2J22 A;  4BK5 A;  3LEI A;  1UYY A;  4UOJ A;  5EJ1 B;  4W8J A;  2QQN A;  3FHA A;  3ABZ A;  2XON A;  2EIC A;  1JZ5 A;  3P6B A;  1W99 A;  3SKJ E;  3ACG A;  1EUU A;  3UES A;  1NX9 A;  1CIY A;  1JU3 A;  2W92 A;  2VM9 A;  2YFU A;  3K75 B;  1GOH A;  1TG7 A;  2VZQ A;  2VJX A;  1GQP A;  2WO3 A;  3WF1 A;  2V4V A;  3HPN A;  4LHS A;  4DXR A;  2Y6K A;  1NUK A;  4XUQ A;  5C7G A;  2W87 A;  1OD3 A;  4OMC A;  4GWI A;  3T0B A;  3ACI A;  1JZ2 A;  3THD A;  2W1U A;  3ACF A;  5DPN A;  3T08 A;  3K4A A;  2W1Q A;  4JKK A;  4QB6 A;  2VZV A;  3VDC A;  1LNS A;  1D7P M;  1UYZ A;  2WN2 A;  4CUB A;  1DP0 A;  2W5F A;  2J1E A;  3CZU A;  4BK4 A;  3WQB A;  2J1R A;  4QDR A;  3OB8 A;  1BHG A;  2WAA A;  3HNM A;  1W8N A;  1DLC A;  2WYS A;  4PT6 A;  4QB1 A;  2ZEY A;  3IDA A;  3SEE A;  5JXI A;  3ETP A;  1P8J A;  5B4N A;  5HPO A;  1K42 A;  4E8D A;  3FHQ A;  2Y6J A;  4QPW A;  3VDB A;  1UY4 A;  2QQM A;  1WKY A;  2B4K A;  4ARY A;  1GOG A;  1CZT A;  1XPW A;  4QX3 A;  3C7F A;  3HN3 A;  3WNK A;  4E8C A;  4OZO A;  4XUR A;  1UY0 A;  5HXM A;  1K45 A;  1O59 A;  1UXZ A;  3AC0 A;  5EIY B;  3LEK A;  3I97 A;  3GM8 A;  4OMD A;  3C8X A;  3F2Z A;  4MOA A;  4XUN A;  2VC9 A;  2XOM A;  5FUI A;  3WNN A;  2VR4 A;  1US2 A;  2QQI A;  2W91 A;  1US3 A;  1W8O A;  2VCC A;  3GDB A;  4ET7 A;  4DUX A;  3IAQ A;  4A41 A;  5JUV A;  2VZO A;  2VZP A;  2WN3 A;  2WUH A;  1W9T A;  3NNG A;  4OYU A;  3VD3 A;  3PUI A;  2W9X A;  3LPF A;  3T0D A;  5EJZ B;  2VL4 A;  3EB7 A;  3EYP A;  5DN2 A;  5G05 L;  2YC2 A;  5B4X A;  4CU7 A;  3D3A A;  3BN6 A;  3WF4 A;  1GUI A;  4GZ9 A;  5IFP A;  2LW8 A;  2W1W A;  4A4A A;  4CUC A;  2V72 A;  1GOF A;  1I5P A;  3OBA A;  2CDO A;  1MPX A;  2J1T A;  3WNM A;  2E26 A;  2VCB A;  2VMC A;  3P1I A;  4PF1 A;  4JHZ A;  3T09 A;  3W5N A;  3T2P A;  3IB3 A;  4ZXE A;  4Z2A A;  3W5M A;  3VD4 A;  1YQ2 A;  1JYX A;  4KI5 M;  2W94 A;  3C7E A;  4KWU A;  1T2X A;  3WF0 A;  2W95 A;  4DUV A;  5IHR A;  1UWW A;  2WO1 A;  3OG2 A;  1DYO A;  3LPG A;  5CYY A;  3HNY M;  3CDZ B;  3GGL A;  4KMQ A;  2WAB A;  2E33 A;  3I3D A;  2JDA A;  2EID A;  3BGA A;  3MV1 1;  1KGY A;  4MAD A;  3I2I A;  2DCJ A;  2VZR A;  4P02 B;  4A3Z A;  2E32 A;  4QX1 A;  3VD7 A;  2EIE A;  1JYW A;  4XUO A;  2Z4F A;  1EUT A;  3NJV A;  1JZ8 A;  2VMD A;  4YPJ A;  2J1U A;  1UX7 A;  3K4Z A;  4CUA A;  2WBK A;  2VOT A;  3A7Q A;  4PQQ A;  4ARX A;  4DEQ A;  1PMH X;  1O8P A;  5J1X A;  4LQR A;  3PUH A;  1UYX A;  3I3E A;  2VQU A;  3MO4 A;  3T2Q A;  3SEP A;  2QQJ A;  1JZ4 A;  2VZ3 A;  3ACH A;  4QB2 A;  3HJR A;  4L0P A;  3LEG A;  1NAE A;  5G04 L;  3T2O A;  2BER A;  3MUZ 1;  5LA2 A;  3NJX A;  2WDB A;  3C7H A;  4M4R A;  3ZM8 A;  1GMM A;  4P08 A;  4RYD A;  3CIH A;  2W46 A;  2C9K A;  1JZ3 A;  2RV9 A;  3LQC A;  3K46 A;  2EIB A;  2DDU A;  1F4A A;  3OGS A;  2DCK A;  2VQT A;  3OGV A;  2J7M A;  5DQ0 A;  4AAX A;  3I2K A;  5IYY A;  1XNT A;  2X09 A;  2BGO A;  2C26 A;  2CDP A;  3ECQ A;  2YFZ A;  2C4X A;  2W1S A;  3MBW A;  3I2F A;  3VD5 A;  2WO2 A;  1ULP A;  2VZU A;  3C7G A;  4DXT A;  1PX4 A;  1UY3 A;  3HNB M;  4LPL A;  2J1A A;  3U37 A;  1OF4 A;  3DYP A;  3C7O A;  2VMF A;  1PMJ X;  4P5Y A;  4A44 A;  1JU4 A;  1SG3 A;  4BJ0 A;  5LA1 A;  1UMH A;  5F7U A;  3UET A;  4XUP A;  4DUW A;  5DMY A;  1CX1 A;  3VDA A;  4BXS V;  3J7H A;  4CVU A;  2QQO A;  2WZE A;  2Y6H A;  1JHJ A;  1OH4 A;  3SKV A;  1XC6 A;  4CU8 A;  4W4Z A;  2JD9 A;  4MGQ A;  3CZJ A;  3OGR A;  1UMI A;  3THC A;  3A23 A;  3DYM A;  5JMO A;  2VTF A;  4GWJ A;  1KEX A;  3FL7 A;  2WAO A;  4P00 B;  5C71 A;  2YC4 A;  4TTG A;  4W50 A;  3K77 A;  4A42 A;  1GU3 A;  3CQO A;  4CU6 A;  3GXU A;  1OT5 A;  3DYO A;  1PX3 A;  5JXG A;  2ORX A;  5CZK A;  1W0N A;  2Y6L A;  2RVA A;  1K12 A;  5JXH A;  3E1F 1;  4FI9 A;  3IAP A;  1UY1 A;  1L7Q A;  2KD7 A;  1IQD C;  2YB7 A;  1JZ7 A;  1UZ0 A;  2BZD A;  2HLE A;  3OEB A;  1GNY A;  4XZU G;  2HYX A;  3WNP A;  4A6O A;  1JYV A;  4DEV A;  3WF3 A;  3WSO A;  4RN5 A;  1R64 A;  3I3B A;  4JX0 A;  3WF2 A;  4DXS A;  5JXJ A;  1TVG A;  3I2H A;  1H6Y A;  3NQH A;  1SDD B;  4LKS A;  2VZS A;  2W47 A;  2VME A;  3WEZ A;  4UI9 L;  3III A;  1W9W A;  1HN1 A;  1JYN A;  2OKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...