1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
b'GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative xylanase
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
4ET7A 2LS6A 2QQJA 2HYXA 3FL7A 3NJXA 2VZ1A 4XUPA 2J22A 3C7OA 4ZZ5A 2VCAA 4JKLA 5EJZB 2WABA 4L0PA 3SEEA 3VDCA 4CUCA 3THCA 1UMHA 2WN3A 5LCWL 2RVAA 4PF1A 3GM8A 4BDVB 2W5FA 2ORZA 2W3JA 1ULOA 1W0NA 4PQQA 1NKGA 4MGSA 5IYYA 5IFPA 4D8MA 4QB2A 3CKHA 1NX9A 1TVGA 1I5PA 2VMCA 3A22A 1DYOA 1K3IA 2QQMA 5CYYA 1UYYA 1EUTA 2R7EB 5IJRA 1J84A 2XHNA 5DN2A 2YB7A 1JU3A 3IAQA 2EIDA 3HPNA 4DXSA 2CDPA 3W5MA 4P5YA 4GWIA 1UY3A 1UXXX 1UZ0A 2VZOA 5B4XA 2E33A 3VD5A 1PMHX 4CU8A 2W1SA 3ACIA 3HOBA 4DXRA 4M4RA 5CZKA 3OG2A 1CX1A 3I97A 3ECQA 3UETA 3EB7A 3LE0A 2ID4A 4ARXA 2C26A 3I2IA 4IUGA 2ZEXA 2VQTA 3LEGA 2BGOA 1UXZA 1O8SA 3CMGA 1W8NA 2ZEWA 5JXHA 3WF3A 4A6OA 1K45A 1UWWA 1SDDB 3J7HA 2B9VA 2QQIA 1YQ2A 5LA0A 2W95A 2RV9A 1CZVA 1EUUA 3MO4A 2JE8A 1JU4A 3MV11 4W4ZA 2VZSA 2QQNA 3WNLA 1R64A 2ZEZA 3F2ZA 2WUHA 2EICA 3T2PA 4E8DA 2YFZA 2VO5A 2VR4A 4P08A 2PQSA 3I2JA 1OF4A 5G04L 3HNBM 1GUIA 3OEAA 4LKSA 1WCQA 3MUY1 2QQOA 4BK4A 1T2XA 3I3EA 2VZUA 1NAEA 3WSOA 3ACFA 4MOAA 3DECA 3IB3A 4MO3M 3MUZ1 1JYNA 3MV01 5I0DA 1K42A 4LPLA 4HG6B 1BHGA 1CIYA 4A44A 2Y8KA 2VMEA 5HPOA 2WAAA 2W1UA 3HN3A 1HN1A 3VD3A 3NRUA 1US2A 1WKYA 2J1SA 4AAXA 2DCJA 4W8JA 3SKJE 3NQHA 4P02B 2QQLA 2WO1A 3VDBA 1L7QA 5JXGA 5HXMA 4CUAA 5B4NA 4QX1A 3WNMA 2DDUA 2V72A 4OMCA 4CUBA 1GQPA 3LEIA 3WNPA 4DXTA 2VL4A 3DYOA 5EIYB 2VZVA 2WZEA 3E1F1 1XC6A 4ARYA 2W1QA 3VDAA 3K4AA 2JKXA 2WYSA 3BN6A 2WAOA 1KGYA 4GWJA 4BK5A 1JZ5A 3THDA 4BXSV 4RYDA 1PMJX 1US3A 2KD7A 2YC4A 4M4PA 2V4VA 2E32A 3LPGA 4XURA 3VD7A 4XUQA 2OKXA 2Y6GA 1ULPA 3UESA 1RYYA 3WF0A 4CVUA 1GOFA 2QQKA 3UNPA 4OMDA 4MGQA 3C7EA 2X10A 5DMYA 3FHQA 1CZSA 3WF2A 2VZQA 2VCBA 1DP0A 2J1RA 1UYZA 1XNTA 1F4AA 2XONA 3T2OA 3GDBA 2X09A 3T0BA 1J83A 1UY2A 4AG4A 1P8JA 4QX2A 2J1TA 4QX3A 4A45A 1JYWA 5FUIA 2VTFA 4MADA 4TXWA 4XVHA 2VZRA 1JYVA 4XUNA 3T09A 4QB1A 3PUIA 3OEBA 2RJ2A 4W50A 3ABZA 2Y6LA 2Y6HA 2BERA 5DQ0A 4FI9A 5JMOA 2CDOA 2VJXA 1UYXA 3HEIA 1XNAA 2BBAA 4GZ9A 1DLCA 4JX0A 3T0AA 4QPWA 5C7GA 3K77A 2Y6JA 3T2QA 5JR2A 4QAWA 3GGLA 2VM9A 3NJVA 3OGVA 1W8OA 2C4XA 3HNMA 1F4HA 4E8CA 2W9XA 3WF1A 3WEZA 4JHZA 3K4ZA 3SKVA 3SEPA 5A1AA 3ACGA 5LA2A 3C7GA 1UY4A 1W99A 3I3DA 4Z2AA 3P1IA 5JXJA 1W9WA 2ORXA 1MPXA 5G05L 4JKKA 4CU9A 4UAPA 1NUKA 2W94A 1GMMA 2V5DA 3IAPA 3IIIA 1JZ6A 2W46A 3D3AA 3JXSA 2Y64A 2XQXA 4TTGA 4ZY9A 1H6XA 2VMFA 4A41A 1UMIA 3BGAA 3CZJA 5J1XA 3WNNA 2EIEA 1GU3A 1W9TA 2X05A 1JZ7A 1JYXA 3I2FA 5LA1A 4D0QA 3I2KA 2WO2A 3WF4A 2VQUA 3LPFA 4XZUG 3W5NA 1SG3A 2W92A 3GXUA 3WNKA 3C7FA 4KI5M 3LEKA 3HNYM 3T08A 1GOGA 2VZTA 4UOJA 3EYPA 3IDAA 4CU6A 2HLEA 4OZOA 4KMQA 2J1VA 2J1AA 3K46A 2VMDA 2VCCA 2J1EA 3OB8A 2ZEYA 2WQ8A 3CZUA 2B4KA 4XUOA 4XUTA 2ZXQA 1GOHA 3OBAA 1OD3A 3ZM8A 4DEQA 1JZ2A 1H6YA 2JDAA 2VZPA 3CQOA 5IHRA 2VC9A 2C9KA 3A23A 4DUXA 3K4DA 3T0DA 3A7QA 3I2GA 5DPNA 3LQCA 2Z4FA 4A3ZA 3FN9A 2BGPA 2QBXA 2YFUA 4QDQA 1O8PA 2VOTA 4YPJA 4QB6A 1L7RA 4DEVA 4OUEA 4QDRA 2WBKA 1OT5A 2J1UA 4DUVA 5F7UA 5JUVA 3C7HA 1CZTA 3P6BA 3ACHA 2WDBA 1W9SA 5EJ1B 2DCKA 4QX0A 3K75B 1LNSA 4ZZ8A 2EIBA 4KWUA 3DYMA 3C8XA 3CDZB 4P00B 4A4AA 4PT6A 3NNGA 2BZDA 3DYPA 1SHWB 1JI6A 3AC0A 1GNYA 1IQDC 4DUWA 2W91A 2LW8A 2W47A 1OH4A 3ETPA 3I2HA 3U37A 3VD4A 1PX3A 2WN2A 4CU7A 2J7MA 4BJ0A 2YG0A 3WQBA 4QDSA 3OGSA 1PX4A 4A42A 1KEXA 4ZXEA 5C70A 3I3BA 3A21A 1JHJA 3HJRA 2WO3A 4LHSA 2VZ3A 2YC2A 4RN5A 1UX7A 2JD9A 5JXIA 1JZ8A 1K12A 3PUHA 2L9LA 1TG7A 2W87A 5C71A 2W1WA 1UY0A 5IFTA 4LQRA 1OF3A 1UY1A 3FHAA 1XPWA 2Y6KA 1O59A 2WZ8A 1JZ3A 3VD9A 3OGRA 4JKMA 3WNOA 2XOMA 4OYUA 3MBWA 4UI9L 2E26A 1D7PM 3CIHA 1JZ4A 2E31A
chains in the Genus database with same CATH superfamily
1LGNA 3WZ1A 1ND3A 4AHYA 1AR61 1H4GA 2PHWA 1VBD3 1RUJ3 3O0WA 1UN1A 2XJPA 5DAQA 2JG8A 4JKLA 2IFWA 4JRLA 4X6QB 5F5IA 3PUSA 2LM3A 1N1TA 1XNKA 2IXHA 2UY9A 3AKSA 2P37A 4Q8LA 3ZPYA 4RQPC 1XB9A 2QZ3A 2BTVC 4GB31 4L0PA 3IWZA 3RSJA 3VDCA 1L7LA 2YPDA 1JUHA 3UJQA 1G9CA 2BOJA 3AMMA 3MF6A 2R042 2WN3A 2ZACA 5LCWL 5GLTA 3CJIB 3VBFA 2YUEA 5GJ6A 4Y20A 4ZXKA 2DVDA 2Y26A 4UT5A 3M2MA 1ULOA 1OSGA 2XLFA 1NKGA 3F95A 4PQQA 4LNVA 4QQOA 2XJVA 1NLSA 3CKHA 5FK7A 1NX9A 2IXLA 4Y1VA 2VMCA 2YBKA 3FBYA 1V0AA 3PUQA 2ZX3A 4DY3A 1IS5A 2A71A 5C8CA 1X8EA 5KHIA 3OY8A 4M3CB 4NIDA 1O6UA 5IJRA 3SC7X 2HWC3 2ARBA 2BJSA 2DCYA 3JB8A 1JU3A 3KWVA 4JDOA 3AFGA 5A6XA 1UOGA 5A33A 5CKNA 3HPNA 1YQ5A 3E6CC 4LJHA 3ZOIA 1AHSA 1F9KA 3ZMOA 4GWIA 1W6NB 3QLQA 4IE4A 4IE7A 1MZEA 5FYBA 1UXXX 4AEKA 4YM0A 5DAWA 5B4XA 3KF5A 3WDUA 2WO7A 3WT3A 4JQRA 4FT8A 1CIWA 3HAGA 5F5AA 2O8OA 4WVMB 5BY5A 3WP5A 3AKRA 4JDMA 5DZFA 2ZA9A 4C0BA 3AVSA 3HMYA 5BNPA 3T4VA 1F5JA 2EAAA 5LB6A 4OI1A 5LBFA 1RHI1 3NJZA 1W2OA 5KXDA 3LOBA 3OG2A 4QX8A 2WNVC 2HWE1 2IUWA 5E8AA 1ENSA 4C1WA 1H9PA 1OLRA 5D2AA 5FMOS 3LE0A 5C3OA 2VMIA 3LIGA 1QDOA 4K8FA 2C26A 2JWPA 4L9BA 5FPUA 1R083 5A7SA 2ZHLA 5AC91 5JOWA 3VDDC 1UU4A 4Q29A 4LO7A 4IEVA 1OOPA 3MF9A 3E6BA 1W8FA 4D69A 3QACA 2B46X 3WNXA 2DU0A 4A6OA 4AFDA 5GZFA 3WCRA 2PHDA 2ZX4A 1VBE1 1K45A 1OKOA 3MPPG 1WUVA 1C1FA 1KS4A 4L2NA 5K0UA 3ZXDA 3J7HA 1UKRA 5FZ6A 1UU6A 5T5OA 4TLGA 5LA0A 2W95A 3LDKA 2RV9A 4P9IA 5FQ0A 4Q4Y3 5C8CB 1H1MA 2EF6A 3MV11 3O5SA 4DO0A 2NQYA 1WBLA 1EV11 3TNPB 5APAA 4ES8A 2XWJB 3WDWA 3VBOA 3WNLA 1R64A 2ZEZA 4ZS3A 3MIGA 3TEWA 1SFYA 1N3OA 4P08A 1SPPB 5JPNB 4HN0A 2VVEA 4BQWA 1GUIA 2KM2A 1WCQA 1NLRA 1RUNA 4Y4YA 4HMZA 1MVEA 4FFGA 1C8M3 5A1LA 1RJ8A 3DKWA 4KQ7A 2VZUA 3WSOA 4NROA 5FKCA 3X29B 4GA9A 1AYN1 2WS93 3DECA 3HBKA 5J48A 4YW6A 3MUZ1 2BFUS 1V6MA 4R52A 4CCKA 1YEWA 1UX6A 4XQ4A 1JYNA 2P3JA 4V2VA 3IDCB 1STMA 5LW9A 4LPLA 2XDVA 3BKZA 4QPGC 1JH5A 5T50A 2R073 5KXEA 2C5DA 2F4PA 5E16A 5DAPA 5FZIA 2ARXA 1UW8A 2JENA 2Y8KA 3NV4A 4IL7A 1QQP3 3TOJA 2VMEA 4RFT0 5FTTC 5FXZA 3PVNA 4JZRA 4OUMA 1WZXA 1MQTC 1W04A 2R16A 4CA9A 1SACA 2GP3A 4RS5A 4G3YC 5A7WB 2FDJA 1QDCA 4YZ1A 1D0HA 4EE2A 2J1SA 2DCJA 3SKJE 1OKQA 1SLBA 2GNMA 2AENA 5FYZA 1UU5A 1UO9A 2ZHMA 4JC1A 2JDPA 2QQUA 3K2OA 3ZXLA 2ZPXA 1BQPA 5FY5A 3WVJA 1YFXA 5J96B 1U5IA 3RMYA 3OBZA 2K0GA 1TMF3 2PMWB 2R041 3ZDSA 1O3RA 1B35B 1ZA4A 5JXGA 5IK7A 3RZLA 1O7FA 1YJLA 3ZFEA 1EPZA 2RM22 4B7EA 1AL22 3WNMA 3G7DA 4QXKA 1UAIA 3DPRA 3LDBA 2R32A 5GLZA 2PAEA 1GQPA 3DXUA 2FCVA 4CUBA 1RL3A 3TN92 4BQ4A 1LHVA 1UCXA 3HWJA 4N9HA 3S7IA 3WNPA 2O0OA 5I0RA 1DGWA 3ZXKA 4ZKTB 4R9AA 3DYOA 3M3CA 3M3IA 4D6QA 2WNOA 5JSPA 3NAPC 5JR7B 4XAEA 3SNMA 3RZKA 1S2BA 1UNBA 4YZ5A 1VRBA 5LY1A 2YY1A 3UL2A 1W8HA 4FO9A 2G9ZA 2W1QA 3AM2A 4XJAA 5CFDB 1VAMA 3AMHA 3M1HA 4IEUA 1MS0A 4LHKA 4GAZA 4JGZA 5EYYA 4XPVA 2SLIA 3GHNA 2FZ1A 1HRI3 3VKOA 3KVBA 1RUG3 3J7LA 3H1YA 1PMJX 1UZVA 3UGGA 2ET1A 1ONAA 1N1SA 2KD7A 2RS32 2YC4A 3ZKUA 2V4VA 5L7OB 3LCPA 2E32A 1GQGA 1UF2C 1W6OA 3JB4C 2E9QA 4H2AA 4IV3C 3VKLA 5K9YA 4XUQA 2OKXA 1XNBA 4IETA 3CU7A 3I4IA 2ZAAA 1LEDA 3NW4A 1BEV2 3LOIA 1ODNA 4NPLA 4QPIB 1QHDA 4CVUA 2PAMA 1XBFA 3KLSA 3E97A 5A7NA 1ZRIA 1CZSA 4DIQA 3HBZA 2VCBA 2F4LA 3AZWA 3O1UA 3ETQA 1LAJA 1C4RA 5LK7B 3FHIB 2D43A 3VBUA 2Y0OA 3VBSC 2VY0A 1AF9A 1UY2A 3OGGA 1GP5A 3SISA 3L9JT 3S5AA 1G7YA 1X9PA 4QX2A 4IV1A 4CDWB 3RMXA 4CP9A 1JYWA 1AR82 1R1A3 5FUIA 1YI7A 3JQWA 3BUCA 2ZOEB 3POGA 2O14A 2VZRA 1JYVA 1RIRA 1WD3A 1O4YA 4XUNA 1RB8G 1HRV3 4QB1A 1WCUA 4QU1A 3ABZA 1HLCA 1HB1A 1ST8A 3PLQA 4BU2A 4FPJA 4JCKA 2Y6HA 3OBRA 2H0VA 3ZFFB 1Z7S3 3HIFA 4CZSA 2LRPA 1LGCA 2VUAA 3V64A 1QH6A 3QD6A 3JQXA 5JMOA 3ZXAC 3CL1A 4QGLA 4EJRA 2BBAA 4GZ9A 1DQ0A 3WY6A 1BYHA 3T0AA 4G9SB 3ITQA 3HT1A 4XFHA 1XSRA 1NE4A 3B69A 4K3UA 2VM9A 3IN9A 4LBLA 1SLAA 4I30A 1OLMA 3OD4A 2DURA 2EXHA 4I3GA 5FIXA 3HNMA 5HCAA 4QKBA 3DKQA 4E8CA 4NOTA 3KSCA 3SEPA 5C9AA 1PO13 1TE1B 1WMFA 5F8PA 3KM5A 3ZVXA 2BFUL 1HB4A 3WP6A 2H6BA 4BPZA 5C4WC 4HK9A 3I3DA 4Z2AA 3INAA 4CDXC 3ATGA 1UOFA 5DG2A 4A2UA 3RZMA 1NLQA 2A6ZA 4JKKA 2ZGLA 1YRZA 2RR12 3IAPA 5FYVA 4GIQA 1ASJ1 1HIXA 3M3EA 5DDJ2 3NKTA 4QGMA 2IXIA 2WFF2 4DRVA 5LRSA 3AP5A 3LSDA 4OI0A 3VBHB 1UMIA 4A41A 3KT1A 5EQUA 3CZJA 3V0BA 3B9CA 4AEDC 1GU3A 4AOCA 2TUNA 1W9TA 3WP4A 1O91A 1JYXA 1JYIA 4NWWA 3GJBA 1GP6A 4XW3A 1EAH2 5LA1A 4I01A 1VRH2 3WW2A 2WO2A 3OYWA 4XXPA 4NHXA 2XKPA 4XTPA 3WW4A 1LKNA 2EVXA 2RM21 3S5QA 2YXSA 5A3LA 4YG3A 3W5NA 2C1FA 5FMCA 4K8RB 2R6QA 1ND3B 2P5BA 1RC6A 4AQTA 1H4HA 1Q8QA 2WSVA 3L2YA 3TN91 1RUI3 2R062 3PMEA 1PMIA 4META 5F3IA 5FP4A 3C7FA 4KI5M 4LBQA 2JG8B 4AEMA 3R4SA 3QCWA 1AJKA 4CCDA 1DG6A 5FK8A 1H9WA 1OBNA 2PHXA 5A32A 3IDBB 2QE3A 1IZ3A 3PIJA 4YM3A 2VZTA 2LROA 3EYPA 2HLEA 4AYUA 3AKTA 2ZGTA 1RGSA 2Z2SB 4RD7A 1EYBA 1HXS3 1S2EA 2PHTA 3KV6A 1FMD1 4Q1RA 3C2UA 3VBFB 2UWAA 4Y20B 1S0IA 1AR72 2NLRA 5DZEA 4N53A 3ZXFA 3JD72 4XUOA 4ZONA 5F32A 1GNHA 4XUTA 5K4LA 2RS31 4D94A 3VZLA 4IEWA 1OD3A 4GULA 1JZ2A 4FP3A 4AR2A 2GC1A 3OY8B 3D5OA 5FZOA 3CQOA 5IHRA 1QOTA 4OQ9A 1UIKA 5DAXA 3O14A 3AMQA 3Q9OA 4GJZA 3K4DA 4QHZA 4EZHA 4E2GA 3T0DA 3U07A 2GMMA 3AL6A 5CKQA 1ZZ8A 3A7QA 5A33B 4LUKA 3LQCA 4QM9A 4N7UA 4WVVA 3PVOA 4NAMA 3LF7A 4CDUA 3V65A 4M0NA 1KXGA 2X53S 4FXKB 4LBJA 4A3ZA 4E2QA 4R9BA 3FN9A 4KU7A 4PIYA 2VBPA 4UFHA 2JD4A 2YFUA 4QDQA 2QJVA 4MGKE 4PJYA 4P9YA 5FXWA 4CEWC 4EV0A 2RS12 3VB9A 2VNRA 3THTA 4OUEA 2K46A 4LR4A 4CPBD 1XNCA 5F7UA 2AC1A 5JUVA 1AR81 1CZTA 1MS1A 2FCUA 5FBJA 3ZFGA 1HW5A 2PLV3 4Y26A 2D5FA 4QX0A 5FFOC 2D3PA 2DBNA 1KJRA 3MW3A 1AR92 4HVOA 1PO23 1CONA 4QX5A 2WIIB 5BNOB 4V2WA 3ILRA 4BH9A 3CDZB 1OOPB 1OFNA 2A75A 1XJAA 1QJX2 2X8KA 3EXUA 4HLTA 3SHRA 3NNGA 5FWEA 1W2UA 2Z42A 4YARA 3MPBA 4Q4W3 3DYPA 4NPMA 3I54A 3AC0A 1GNYA 5K0UB 2RHPA 1OQ1A 2RMU3 5FY0A 3AXEA 5A3TA 4JTNA 4J6GA 2W47A 4LO6B 5HCFA 1I1EA 1AYM1 3VBRA 3R4UA 1NA1C 2JG9A 1SDWA 5FQ0B 1PX3A 2WZPP 5A80A 1RUE1 1QNYA 3NV1A 1PM4A 4ISQA 1ULEA 3ME2A 4CUGA 4Q4V3 5FPZA 4JTOA 3VBOB 1O3SA 4XMAA 4DMIA 1QJY3 1POV3 3OGSA 4K6BA 4QPYA 5C8CC 3VKNA 1I6XA 2VMGA 3H8RA 1H1IA 2IXKA 3FC0A 4M00A 4TSVA 1GV9A 3AVRA 3RG0A 4DOUA 4BXFA 1KEXA 4C0HA 2YGMA 3Q8FA 2QTWB 2RR11 2X5IA 3ZLIA 3ZYHA 4AGRA 4YYOA 5DDJ1 1S0GA 1ZBA1 4UW6A 1QKQA 1JHJA 1OA2A 3NO8A 3TB0A 2CV6A 4TTGA 5F3CA 1M4WA 4WM8A 4CCNA 3KCYA 1R092 2YC2A 4RN5A 2R0FA 1SEFA 5JXIA 1X9TA 5JOXA 5LK5A 3LFMA 1HB3A 1OUXA 4TLFA 5C71A 1AZDA 2BV4A 2W1WA 1EAH1 1UY0A 2XLGA 3MIFA 1OF3A 1FI2A 1VRH1 2VOXA 1Q3EA 2ZKLA 4LTAA 3SCFA 4IE0A 4B4QA 1XPWA 2YROA 2Y6KA 4N43C 3K3OA 1MEC3 4R4ZA 5BXXA 4OHVA 4JKMA 3ILNA 3KV9A 3DV8A 2XOMA 3WCSA 4OYUA 4RS5B 2WNUA 3C3VA 2E26A 2Q30A 2VNVA 1JBCA 4XBLA 1CPMA 3WDXA 5A3OA 2R061 1WLCA 4Q26A 5C5TA 2OX0A 4ET7A 1S4CA 3RWKX 2QQJA 3KT7A 2HYXA 5FV3A 1WW5A 3OUJA 1BVP1 2VZ1A 2PHRA 3RYPA 1ODMA 2LTNA 2MEV3 4A7ZA 3BIEA 5FZKA 1XU1A 1VBB3 3IMMA 4XJ9A 2JDNA 2WWJA 1VB4A 3PHMA 1JOJA 4HN1A 5ANNA 5EJZB 5ACA1 1UZZA 1V70A 2WABA 2YMZA 4LLOA 5H9RA 5BNNA 2GC3A 2LUWA 3SEEA 1OVPA 1YIPA 2D6KA 3ZFEB 5CA6A 5IVCA 3THCA 2G9FA 3AJYA 1LRHA 3DPRB 4RR3B 5EZWA 1UMHA 3JD71 1DIWA 2BWAA 2HWD2 4QHBA 4PF1A 1B35C 1NCQA 3GM8A 4HVRA 5I0TA 2ZX2A 2OT7A 3GALA 1PVC3 3LB9A 4YW5A 5FP9A 1W0NA 1QXRA 4XF3A 4YW4A 2HWF2 1VMHA 1W6MA 4D8MA 2JICA 1I5PA 1PNFA 1LHOA 4XQWA 5EYXA 1K3IA 4NHMA 4NR1A 4A6SA 2JEMA 1YCIA 3APBA 1UYYA 3OJBA 2R7EB 2P17A 4ASKA 4JGZB 1J84A 3D82A 4BCUA 4PLOA 4KU8A 5DN2A 4P9WA 3KHBA 5CFDC 1W0PA 3B00A 1NY72 1F8VA 4U2AA 4F8AA 3POEA 1PGL1 5IVFA 1W6OB 1F35A 1UY3A 1OURA 2RS11 4IDZA 5KR7A 1DLLA 1H2MA 2VZOA 1OLME 2XL7A 2R49A 3JCIA 4DFSA 2E33A 5L7OC 1PMHX 1WMEA 1Y43B 3O1OA 4CU8A 3ST7A 4AQ6A 5LEKA 4XTMA 1GICA 4OULA 1RVF3 4UFLA 2TBVA 2OUJA 4XYXA 2D6LX 3JBG3 1NQDA 4QPIC 4WM7A 4XE9A 5KXBA 3TEYA 2E7TA 3HOBA 4RL7A 1MEC1 2E6VA 3ES4A 5FY4A 5FUPA 4GWNA 1KD7A 1DBNA 1AR91 5C6CA 3DN7A 1YC61 1RXFA 5ISLA 5FY8A 3ECQA 4JDNA 2EIGA 2PHLA 3VBUB 5FOBB 3UETA 4ARXA 1QJX1 1RUD3 1KQRA 3RJRA 5FZ9A 2W52A 4IUGA 4NHKA 1APNA 5IUQA 5IVEA 1YNAA 3BYWA 2NPIA 4QGNA 1DGRN 3CMGA 1W8NA 3TRSB 4CP9B 1VBD2 1RUJ2 1OQDA 1DGLA 4EROA 4E27A 4CDWC 5JAXA 2XVKA 3RVHA 3U78A 4D7SA 1DCSA 1GNZA 1S0CA 1D4M3 4A7KA 2BOIA 2BBVA 1IS4A 1VR3A 4M0HA 5KXCA 1XNDA 3TAYA 2WFPA 4QKDA 1EUUA 1E5RA 4W65A 3MO4A 3POFA 1JU4A 3I7DA 1COV3 4Y1YA 4YVWA 5LBCA 5C8WA 4W4ZA 1LEMA 2D6PA 5A7QA 3CBNA 3RZHA 3MZHA 2VE1A 3T2PA 4OUSA 1OLQA 4NRQA 2VMHA 3AP4A 4B4RA 5JCTA 1OF4A 5ABJA 4LKSA 2D6MA 2JDKA 2QQOA 3MUY1 2XMLA 4Y24A 4YZ2A 2ARCA 4XDOA 2P6HA 3VLBB 2HWC2 2F17A 1OXCA 4FPOB 1LGBA 3WG3A 5C9AB 3ACFA 4FFIA 4YFWA 1VJ2A 2XG3A 3IB3A 3LA3A 4IGOA 5FY7A 4ZU7A 3RFRA 4KWLA 4DXZA 2YU1A 2D3SA 2ZCWA 5I0DA 1K42A 3VZMA 1ZM1A 4KG8A 4E4HA 4QKFA 2IXCA 1XXNA 2HH9A 5LWBA 5FZ7A 4XQDA 2QDNA 3O12A 5T5JA 1DFQA 5GKAC 3BIWE 3GCWA 1A3KA 5AFEA 1G8WA 1YFYA 4Q0UA 4QD2A 1RUF3 5F6KA 5FKBA 3PU8A 4LMFA 3AK0A 3SLIA 5HPOA 3BU0A 4D7TA 4NIHA 4UFJA 1W90A 1RUOA 3VZNA 3HN3A 3K48A 1ALYA 1HN1A 4LHLA 5HV4A 3NRUA 1US2A 2EXIA 4AAXA 4LA3A 3VZOA 4O9EA 1ENXA 5D8AA 3VBHC 1GYKA 3LKJA 3H7YA 4OI4A 3KGZA 2C9AA 3ASIA 3HQUA 4BOWA 4KH9A 2Y38A 5LA9A 1R082 3U75A 4UBGA 3VDBA 4FTBA 4RQPA 1L7QA 2HWD1 2RS53 5FZEA 4EN8B 4FPGA 3NVCA 5B4NA 3BTZA 2WT1A 2V72A 4LBQB 4OMCA 4ZHNA 4NAOA 5T54A 1IOAA 4QXHA 1ND3C 5A32B 2HWF1 4LEJA 2WLQA 4DXTA 3H42B 2BNNA 3MHZA 2JG8C 3H3UA 4Q4Y2 2YDEA 1XC6A 3MIDA 4M01A 3N9QA 4PBPA 1S1AA 2DVAA 5CIRA 3H50A 3M3OA 1WD4A 1NQJA 3K4AA 1QH7A 4N53B 4ORFA 4C1XA 3BN6A 1O5UA 4Y5Z0 2V09A 2UYBA 3B93A 1NY71 4Q0SA 3WDVA 2WA4A 4BK5A 3VKMA 3EJKA 3VBFC 1PNGA 4DINB 1FOD3 2XJTA 4C91A 1SZBA 1GR3A 2OZJA 2YHJA 1C8M2 3BOPA 1REFA 3AKPA 4XIKA 5D21A 2BYVE 5FY9A 4NIGA 1DQ4A 2B42B 2A3YA 3J7NA 2WS92 4HBNA 5AVPA 1Y9QA 4XBQA 3UJOA 2PTMA 3GNEA 1I9RA 3Q8CA 2VXJA 5FZ1A 2AEZA 4FVVA 1RMU1 3LEMA 2Y6GA 1F15A 3U10A 1MR5A 3EQEA 3POBA 2VVFA 4XC9A 1C5HA 5FXXA 2R072 4CDUB 3UNPA 4XFCA 2XXZA 3C7EA 4B7KA 4CRQA 3ZSLA 3O1TA 5FLIA 1GLHA 2XVLA 5JPMB 1DP0A 2J1RA 1XNTA 4LOTA 1F4AA 1DQ5A 2WNVA 4LE4A 3GDBA 2HWB1 1OA3A 2X09A 2P6CA 4GD4A 1HV1A 1TQ5A 4HL0A 3GCXA 4B1MA 4UFMA 1J83A 2WJSA 3GZAA 1V6OA 3MFAA 4I0AA 4IE5A 5E88A 4JGYC 4U36A 1D4VB 1VBD1 1QOOA 1IS6A 5CG8A 2VVDA 1RUJ1 3RPQA 1P8JA 4WBBA 3ZFGB 2FZ2A 4GH4A 2AGSA 1SCRA 1U5YA 1DF0A 4A45A 3N7JA 3H3LA 5JLVA 3S30A 3H9AA 4E4ZA 5FPXA 1MS8A 3NNJA 1TMF2 4QXCA 4QXBA 4LKDA 3I3QA 1AL0G 2JB8A 1K5MA 2GNDA 4NRMA 3AL5A 1S0EA 3WW1A 5BNOC 2QNKA 5DQ0A 4OVEA 1V6IA 1FXZA 2ZGMA 5KHGA 1W2TA 1BMV1 1KRIA 3HT2A 4ZU4A 3UKVA 1PK6C 4LHNA 3SITA 1CVNA 3VBRB 1JYTA 4QPWA 5FRAA 1Z78A 3T2QA 5JR2A 1HJGA 5K0UC 1LECA 5IK8A 5CG9A 2HWC1 1GZTA 3NMBA 4RHV3 2C4XA 1AX2A 5FZHA 4MHUA 4FTEA 1VALA 3WQ7A 1BJQA 4HPKA 1JODA 4YVSB 3U4SA 1RUG2 5A1AA 4Y1UA 3C7GA 2E7QA 4XETA 5FZMA 1UY4A 1Q8SA 5FYMA 2E51A 2CGPA 1FPN3 4RA0A 3GJAA 2X5IB 3WW3A 4N8MA 4MHRA 1LU2A 5G05L 5IWFA 3N35A 1NUKA 2W94A 1ZRFA 2B8MA 3POSA 2V5DA 3FFZA 4WM8B 5JIUA 1JZ6A 2W46A 4XJUA 4C8DA 3ZXGA 1BBT3 1ASJ2 2ARAA 2XR4A 3D3AA 3OUHA 1MQTA 2ZMKA 4Q27A 1BZWA 4ZY9A 4FAGA 1DQ2A 1H6XA 3MFCA 3T30A 1S0DA 1VAVA 2ZZQA 1UOJA 2VOKA 4YFZA 1ND2A 2P34A 5L36A 1R081 5L9RA 5FZ8A 1VLNA 3DCQA 1NCRA 2I07B 3I2KA 2WNUB 4XFIA 1VBA3 5KHKA 1V00A 4Y33A 1W8WA 4YG0A 3ZPOA 5GZEA 3CJXA 3T2TA 5FZ4A 2VPVA 3E5XA 2XVGA 3GZUC 2VU9A 5EPAA 3AMPA 4BMEA 2XHKA 3AZXA 5A3NA 2QQPA 5FP8A 3TWIA 4COVA 4Q4Y1 2WL1A 3B3QE 3KT4A 4QU2A 1J58A 3T08A 5BNNB 1QF3A 2YU2A 4Z2WA 3NAPA 1K5JA 1JOPA 1F31A 4OZOA 4S2HA 1MS9A 1TME3 3S0MA 2XJUA 1QU0A 1NCQB 3NWKA 1QIQA 4FOYA 2EXJA 1EY2A 1CX4A 2VMDA 2VCCA 1WLDA 3FX3A 3MIHA 3UYJA 4DPNA 5J3UA 1G9AA 1FMD2 2ZEYA 2WQ8A 3DPRC 2ZS6B 4RR3C 3S6PA 2B4KA 1W6MB 2A73B 3AXDA 1C8M1 4BQ1A 4O61A 4RGKA 2Q8CA 1QJU3 2WLPA 3PTRB 5HCBA 3OBAA 2WS91 2CWSA 3URFA 1SBDA 2RJKA 4IEZA 4HXCA 3SH4A 2VZPA 4NO4A 5LZ6A 4EYUA 4FPLA 4FPCA 2BPA2 1PO12 1ZYBA 5CFCA 4UW4A 1D2SA 3KV5A 3THPA 4DUXA 2R071 4R8HA 5LY2A 1SLCA 1O4TA 2OVUA 2Q5TA 2DFCA 4OCTA 3I2GA 4TWTA 5KHHA 1V6KA 4JGZC 1QQP1 3I3MA 4K21A 5A7PA 4PLMA 2D6NA 4K40A 4E9KA 2D93A 4W6WA 5C5UA 3CEWA 3ZN6B 1G9BA 1O8PA 1OH3A 1XYNA 4B3NA 4QB6A 1X82A 5H9SA 3H7JA 2PHUA 5L73A 3ZN5A 1J1TA 3IDEA 1Y7BA 5IW0A 4WM7B 4PCRA 1IS3A 2W68A 1VBC3 4MX3A 3I8TA 1SQ4A 3T1MA 2OW4A 2P4EA 3J9SA 2A5ZA 2WDBA 3MW2A 1TMF1 1U12A 2YGLA 3PJQA 4AVAA 3K75B 3J4UH 4O65A 4S2DA 4XHBA 3DF0A 1JMUB 1XOYA 5FPLA 5IK5A 2AR6A 1YFUA 2CAVA 4XCAA 1H8TA 4P9GA 4ASLA 3VBUC 4A4AA 5KC5A 1RUI2 1HX6A 2BU9A 2Q1FA 4KNCA 4OHXA 4PT6A 4NWVA 1XE8A 2P3YA 3RGBA 5GALA 5F1RA 1IKPA 2BZDA 3HD8B 4KBBA 2BWCA 5CAZA 1O4ZA 1AL23 1Y9MA 4CCJA 5KC6A 3NJYA 3VL9A 4UFIA 1PIV3 4BIOA 3U4XA 5IT6A 1GZWA 2CNAA 1LOGA 3U37A 3USUA 1AYM2 2QZ2A 4YVWB 2D7FA 1WCSA 1HXS2 3GBWA 1W8UA 3POYA 2ZGKA 4IGQA 4CU7A 4BJ0A 1RUE2 5FO8B 1HRI1 1N3QA 2VULA 1BLZA 2XBO3 1RUG1 1QJU1 1U5ZA 1PX4A 4MVTA 4AXOA 4Y1ZA 2G19A 2ZMNA 3BCWA 1MACA 4Q0QA 4S2FA 1MZFA 4MG2A 2VW0A 5C4WA 2BRTA 1GKBA 5ABJB 4LA2A 1FATA 1W8TA 4ZXEA 2RDRA 2YBPA 5DABA 2TNFA 5DZGA 5I93A 5FYTA 1J3QA 3HJRA 4NPRA 1ZBA2 4FP2A 4PI2A 3CO2A 1GZ9A 4YSFA 2FDKA 3IT8A 2JD9A 1ZZ6A 1IPKA 3PUHA 4BLJA 3K3NA 3LIHA 3R05A 1BEV3 2FBEA 5JVVA 4EN9B 3KVAA 2PXJA 3T4HB 3ZR6A 4LQRA 4DQAA 1GQHA 1UY1A 4H3WA 4L8QA 4AVBA 2JECA 1ZA7A 2W2IA 1O59A 1YO8A 3BTAA 4BHPA 3NV3A 3PUAA 3MICA 3VD9A 2V73A 3OGRA 4PIXA 1CGPA 1YFWA 2R1BA 2O8QA 1D7PM 1R1A1 1LHNA 3OGJA 4PLNA 1FYUA 4NHYA 1AX1A 4H7MA 5D8AB 1FV2A 4K7JA 2PLV2 2LS6A 3FL7A 5A6QA 4GMP3 1HRV1 3NJXA 1W6PA 2BDRA 3AP6A 1S0BA 3ZKYA 3LDRA 4BE3A 1KDMA 2ZBJA 4ZZ5A 1PO22 3SCHA 5FYHA 3D6EA 3GBFA 1Z7S1 3KMHA 4RQPB 3AB0A 3PIGA 2KXLA 1LTEA 3B7MA 5ACA2 2AUYA 4Q1PA 3O1PA 4CUCA 5A6ZA 4LT5A 3DXTA 1BKZA 3O0VA 2ZGNA 1DYPA 2OYZA 2Q8EA 1CAUA 2RMU2 2CSGA 5DXDA 2W5FA 4HONA 4OHYA 3L2HA 1E5SA 3CJIC 4BB3A 2IVIB 3J26N 4NRPA 4X8PA 5HBAA 1YJKA 4LITA 4YZ3A 4CDQA 3WUCA 4COYA 5GLWA 1V9U3 1PO11 1KDKA 3OBTA 4Q4V2 3RWNA 5HI0A 1W03A 5I91A 1G9DA 1Q5OA 4Q2FA 3GYDA 1O5LA 2DFBA 4DY5A 3TBDA 1JS9A 2A70A 1I5ZA 2WINB 5F37A 2JDMA 4D6RA 1RUC3 2YB7A 3ZSEA 3IAQA 2BEOA 2HKXA 2X29A 4XFAA 5JZGA 3UKNA 4LXLA 4LOSA 3ELNA 3W5MA 4P5YA 5J7MA 3EHKA 3LSEA 1PGL2 1GZCA 1UZ0A 5FAXA 2OA2A 4A3XA 4CEWA 4CP0A 3FLRA 1W2NA 3EO6A 1F2NA 1MZ6A 4HKLA 1JHNA 3PTYA 2WYFA 3W21A 4YW7A 5BNPB 3H8OA 4AQ2A 3M4FA 2VUCA 4MH0E 3N3HA 4QWNA 2NN8A 3WHTA 2WFF3 1W28A 2QQVA 4M4RA 4MGZE 2GC0A 3AP9A 2WNVB 3B9IA 3ILFA 1MEC2 4GXLA 1NZCA 3RZGA 1YXWA 2DVGA 1Q43A 2AZ5A 1VIWB 4NMIA 3EB7A 2ID4A 1RUI1 4KGQA 1XQNA 2ZGSA 4AI9A 3ZIWA 3I2IA 5BYNA 2JX9A 2ZEXA 2VQTA 2DUQA 1YIFA 2BGOA 3IPVA 3LEGA 1UXZA 1O8SA 4GH4B 2MEV2 4JAAA 5FZGA 2XJSA 1Q8VA 4PHZA 2XWBB 1VBB2 5JXHA 1IQAA 4K1YA 4I0BA 2JXAA 1OVSA 1VB2A 1UWWA 4UF0A 1HXS1 1NA1A 1G9FA 1K5MB 2B9VA 2QQIA 4ASMB 1S55A 1YQ2A 2VTXA 4K20A 2R1DA 2WZR3 4BISA 3KCCA 2JE8A 2K9ZA 2E7AA 2QQWA 2R30A 3Q8BA 2VZSA 2GN7A 2XJRA 2QQNA 3JZVA 3F2ZA 2HBUA 4E8DA 2Y6FA 3SCGA 4FPKA 2YFZA 3ZYFA 1AR73 2VO5A 2VR4A 1NXD1 3I2JA 4AK3A 1QXPA 1XSQA 4BQXA 3VBRC 3WX5A 1ZZ7A 2UYAA 3FFQA 4WZFA 4IE6A 2HBTA 3J8F3 4XF1A 1S0JA 2FCTA 2ZX1A 1WA4A 3I3EA 4DB5A 4HPKB 4FFHA 3PJYA 4IERA 3K51A 4MOAA 1A8MA 4EWEA 2W0XA 3R4DB 3Q8AA 4BZ4A 3E5QA 5FLHA 4YGBA 1HQNA 3MV01 3TEXA 3RYRA 1CD3G 2DV9A 4YVSC 3BALA 1SBFA 5E6HA 1LENA 5CISA 1BHGA 1CIYA 4XF9A 3VGIA 4BQYA 1WW7A 3ZYJB 4A44A 2XJQA 1YQ6A 3D4KA 3PMSA 1Y3TA 2W39A 5LATA 4MLOA 4N43A 4FAHA 3O1VA 2ET7A 1MQTB 2DCZA 2PN5A 3D0SA 4AHXA 2ZGOA 1OPOA 1RVF2 2WAAA 1ZZ9A 4HVQA 1CPNA 4ATFA 2VXRA 1I3HA 3N9PA 3JBG2 4WM8C 2PLV1 4NJ4A 3NNMA 1ZBE3 1HJFA 2ENRA 4Q5OA 3VD3A 1DYKA 4ZU5A 1ND2B 2IFRA 3N9LA 1PGW2 4FFFA 1PO21 2AEYA 4CEYA 2DUPA 2YC0A 2ETEA 4LBQD 1JZ4A 2ZKNA 1NCRB 2WQ4A 2DVFA 2JIJA 3NQHA 1RUH3 5I8YA 1X7NA 3WINE 2PAKA 3N9MA 3OCPA 4EN7B 1VAKA 2QQLA 2WO1A 4Q4W1 1XYOA 2PYTA 1SMVA 1DZRA 2WNUC 2GNBA 2ZGQA 2RMU1 4LORA 4GKYA 4LKFA 5FPVA 4CUAA 3KHCA 4BYYA 4N7IA 2OXBA 1Y9GA 3AFKA 4HZFA 5D1IA 1WW4A 5TSWA 1D4M2 4YZ4A 4G4FA 3I2OA 2VL4A 4P9LA 3NAPB 3IMNA 4Q4V1 5EIYB 1MS4A 1LOFC 1QJY1 1POV1 5FCCA 1AXZA 3D8CA 3H8XA 5A70A 5BNNC 2GZWA 2VUJA 3AP7A 2P3KA 2ZHNA 4S2GA 2EA7A 2GH8A 3KS7A 3VDAA 4ARYA 4EQVA 4I2OA 5CB7A 2WYSA 1DDLA 3VV1A 2NZ9A 2WAOA 3AJZA 4IEYA 1KGYA 1NCQC 3HVDA 1JZ5A 3RI9A 1J3PA 3THDA 3SXWA 4I09A 2EXKA 4RYDA 2ZGPA 1N3PA 1OQEA 1YYNA 2ZGRA 4M4PA 3WOGA 5CFCB 2UWCA 3LPGA 4XURA 1CESA 4CTEA 4EN0A 3VHOA 4YLZA 2ZTNA 5L7OA 2V5YA 2XUEA 2GNTA 2BNOA 1ULPA 2ADEA 3UESA 1RMU2 1RYYA 4GJYA 2ZZJA 3IBMA 3WF0A 2Q4SA 2QQKA 5JI7A 1KFXL 1VMFA 4IGPA 4MGQA 2PELA 4MV2A 4QPIA 4Q4X3 3D0JA 4XDQA 5I0UA 4CCLA 5DMYA 4L97A 5L19A 1R093 3CNAA 1RUF2 3O7OA 3H3ZA 5FPBA 3I2DA 4WV8A 4XEZA 4NIAA 3B94A 2HWB2 4Y4RA 2MEV1 4IV1B 5EXOA 4BIFA 4K1ZA 1VBB1 3PU3A 1EP0A 1CJDA 1OHFA 4AEJA 1J1LA 2WWUA 1AXYA 5BNQA 2J1TA 4YRDA 2KA3A 4LK6A 5FXVA 1FAYA 3A0KA 4WM7C 1BK1A 2VTFA 3BU7A 4XIOA 3VHPA 4TXWA 3MDPA 4XVHA 2IWGB 3E5UA 4Z92B 3RDIA 3O1MA 2HEWF 1H8TB 4HKOA 4PDWA 4YNIA 1AR63 3PUIA 3OEBA 1D0GA 3KGLA 2WSUA 1RTVA 2B45X 3ZYBA 3B02A 1CAVA 1PVC1 3PURA 1LESA 2VD7A 4CP2A 4CCOA 3ZFFC 2CDOA 3IM0A 1UYXA 2DUOA 2VNOA 1BMV2 2VG9A 4GB33 1WCDJ 1FNYA 1DLCA 3BI3A 3MI8A 1GZWB 4OLLA 2FMYA 3USUB 5C7GA 5HV0A 2Y6JA 5F9TA 5LBBA 4P9JA 1WMXA 1CWPA 2VBBA 3NJVA 4MXWA 3CHXA 1W8OA 4COZA 3OTFA 1F4HA 1PZ7A 1SCSA 4YVWC 3WF1A 3WEZA 5A3MA 1U0AA 4AI0A 1ENRA 3K4ZA 2E63A 5E1RA 2NMNA 3SKVA 1FOD2 4YW3A 1O3QA 3ACGA 5LA2A 5C4WB 3O1SA 5DUUA 5M0TA 2A3WA 2FQPA 5JXJA 2YZ4A 1W9WA 3W9AA 4DS0A 1UOBA 4XHXA 2GMPA 1FV3A 5ABJC 1OD5A 3BPSA 3UGFA 4CU9A 4UAPA 4B1LA 4LO4B 1RVF1 1DZTA 2OPKA 4PF5A 3NNLA 1DQ1A 3IIIA 1IPJA 3JBG1 4XFGA 2Q1MA 3WHUA 4L99A 5J36A 3JXSA 2MNGA 1S2KA 2BUKA 2Y64A 3MIBA 5IVJA 1HN0A 2VMFA 3V0BB 3ZN4A 1PGW1 3N7MA 4M3CE 5FOJB 4PIZA 2VAUA 1HDKA 3BGAA 5J1XA 2EIEA 2BNMA 4ISRA 3KCXA 3VBHA 1RUD1 2FDHA 1JTZX 1C3HA 3O0XA 1JZ7A 5L9VA 1EPWA 3I2FA 3OYWB 1UKGA 2DBIA 5FO9B 4D0QA 3KV4A 4O7XA 4UFKA 2Q0AA 1SFNA 2F6BA 1WGPA 3OUIA 3LPFA 1L3JA 1RHI3 3RQ0A 4AGGA 3N7KA 2NM1A 1GBGA 2HWE3 2W92A 5JIAA 3TNQA 1W6PB 1W6QA 4BM8A 1W8ZA 1M06G 5A3UA 5GZDA 1DGRA 1D4M1 1TNRA 3WNKA 1WMDA 2Z79A 5AC93 5D8AC 3LEKA 1LU1A 4N9IA 3HNYM 3VHNA 1ZZBA 1COV1 2KR2A 1LODA 1BVVA 5JOYA 1GFF2 5E89A 5KWRA 4H55A 2VNGA 4ITCA 4KMQA 1VBE3 1CAUB 2GN3A 2J1AA 3P3PA 4W6YA 2FDFA 4QQLA 4AHWA 1W3VA 3OB8A 3QBQA 4HANA 2H0BA 4CDQB 3ZSJA 2ZXQA 1LCLA 4RHV2 1EV13 4NHLA 3OPWA 5FZOB 3DGTA 1H0BA 4DEQA 2XLAA 1H6YA 1UQXA 1POV0 2D6OX 2Z5WA 4AFMA 1ZRRA 2C9KA 2JDHA 3HN1A 4BA6A 3A23A 3VZKA 1LB2A 1FPN2 2HEYF 4P9XA 1VE0A 5JZGB 4YGCA 4YGEA 4WVZA 2JDUA 3GZTB 4DNYA 1RUF1 5FZDA 1QQP2 5F3EA 1AYN3 4PQ9A 2SBAA 2CTVA 1CJPA 1WBFA 4QQ2A 4CEWB 3WXPA 5EP9A 1BBT2 4LBKA 4LLFA 3WQ1A 4LBNA 2D5HA 4QT6A 1L7RA 3VDDA 4DEVA 4JGYA 4QKNA 2GU9A 1AVBA 4AFBA 5BNPC 4XABA 3ACHA 5LASA 1A34A 4Z8BA 2C6SA 2DCKA 1VBA2 1Z0HA 2ZHKA 2RS51 4PI0A 1IPSA 3N7LA 5DAVA 4IXLA 1HB2A 4MGIE 1O3TA 4FQ4A 3G6JB 1QXJA 3B01A 4KWUA 3T1LA 4AWDA 3IPVB 1LJ7A 3C8XA 1VP6A 3DYMA 4GALA 3FZ3A 3BPZA 4P00B 1G6NA 4H7LA 3VZJA 2MPFA 3FLTA 5J37A 4GKXA 4EWAA 5BNOA 2DVBA 2N7GA 1OOPC 4XILA 4HKWA 4EWDA 1D2QA 4GH4C 1YUDA 5FP3A 1PK6A 3AZYA 2R043 1LOCA 4GQ7A 3H8UA 1S0FA 5I0SA 4CCMA 2JG9B 4UF0B 1IQDC 1NA1B 2W91A 1ZVFA 5EHDA 3RS6A 3WR0A 4BQ2A 1H2LA 1XU2A 5F2SA 1OH4A 1WA6X 1JXNA 3ETPA 3I2HA 4FOVA 1TME2 2VW2A 4D3WA 2CAUA 1GP4A 1UZYA 2VBDA 1A6CA 2WN2A 2VOWA 1HKDA 1K5MC 4ES9A 3WD5A 3WLUA 3WQBA 2XH6A 1FOD1 4D7YA 5J09A 4E4DX 1HRI2 3GF6A 4XDPA 3VL8A 3VBOC 1BK0A 1FX5A 1LULA 1QJU2 3OPTA 5T5LA 3RRDA 1Q56A 4QPGA 3I59A 2CU5A 1OI6A 1Q8PA 4CP1A 3N9NA 3UKTA 2VQ0A 1UD1A 5C70A 5HXVA 1YWKA 5GM0A 5IVVA 4WZCA 4CXYA 1YLLA 5FMBA 3POWA 5CBLA 1NOVA 3U0ZA 1LOEA 3V0AA 2CY6A 2WO3A 4LHSA 2VZ3A 4ONUA 5JI9A 4AZZA 2BP6A 5FZBA 5CVRA 1N1VA 5JOZA 1K12A 5LEJA 2WRAA 4MUVA 1W2AX 3ZYPA 2HYKA 1TG7A 2HJIA 2WQZC 5IK4A 4XJ8A 2CGOA 1UZWA 4N43B 5DUWA 5FBZA 5AVAA 2FHRA 2Q1ZB 3FHAA 3M3QA 5DG1A 4LE3A 3CF6E 2XGXA 3POIA 2WZ8A 3ACLA 1H30A 1QNWA 4R9CA 3WNOA 1SLTA 5T52A 4ZPIA 4LBMA 2RDSA 1VBC2 1HQLA 1IG3A 4RS5C 5IVYA 2GSYA 3LA7A 1R1A2 5H9PA 3B5LB 4NVPA 4LK7A 2E31A 2A7AA 2W87A 5T3NA 2DU1A 1JW6A 5CU1A 4CEYB 5IATA 1QOSA 2UWBA 2Q8DA 5I8TA 2NYYA 4JV4A 4J1XA 4XUPA 1HRV2 1WLTA 2J22A 1RINA 1ND2C 2WR9A 3W20A 3C7OA 4COUA 5JDBA 1W3XA 1ZRCA 2VCAA 3AKQA 2OQ6A 4CCEA 1NCRC 2EALA 3LFIA 1Z7S2 5KBFA 2OUHA 3RYKA 1OUSA 2XUMA 5C3PA 4AE2A 3LGRA 2JB4A 5FUNA 1ACCA 3ZIXA 3ZFEC 2IZWA 1JYCA 2B39A 2RVAA 4BDVB 1CR7A 3AZZA 1Q8OA 4AVSA 4RHV1 3EMRA 4RR3A 1PIV2 4YWAA 5LBEA 4F7ZA 1AJOA 2ORZA 2W3JA 4MGSA 4X6RB 5IYYA 5IFPA 4QB2A 5F3GA 1TVGA 1ZRDA 3A22A 2PQQA 1DYOA 2XBO2 3P5BA 4IV3A 1MS3A 1NZIA 2HEVF 5T55A 2QQMA 4AI1A 1XE7A 2GMEA 5CYYA 5EJ3A 3U11A 3AX4A 1EUTA 1FPN1 4AF9A 3PNAA 5C3SA 4Z82A 2XHNA 3RZJA 4AI8A 3I49A 2CL2A 2EIDA 1OC1A 1BXHA 4DXSA 3CLPA 2JDYA 2CDPA 3J7MA 4AFAA 2VGDA 4AQSA 2DCTA 4W6XA 3M8LA 1BBT1 3QH7A 1LOBA 4LO8A 3UGHA 4B8EA 5ERLA 1C8NA 3PVEA 1IGOA 4XCBA 1C57A 5A3PA 3WDYA 4Y22A 5FZ0A 3VD5A 5K7PA 1C28A 1RITA 5CFCC 3VBSA 4QM8A 1DGWX 1U5XA 1B09A 4OQ8A 2MHFA 2W1SA 3ACIA 4TYSA 2O1QA 5A1FA 2BVBA 3ON7A 5BV6A 2FDGA 1ASJ3 3U1XA 1QWRA 1ULCA 1VBA1 1QY4A 4DXRA 2B5HA 4JVAA 5CZKA 5FZFA 1HV0A 4P14A 4Y5TA 4XF0A 1CX1A 1RJ7A 3I97A 4I0WB 2UY8A 4J25A 1WW6A 4NIIA 4BQ3A 3BTYA 3OF1A 4OI2A 1URXA 5FMOL 5FZAA 3KZ4C 2DTYA 4XBNA 3S7EA 2G4IA 4CPBA 3UT0A 2ZEWA 4IV1C 5BUVA 2UURA 3ZSMA 3FMGA 1SLLA 3AMNA 4TZDA 3ALQA 2GP5A 4INDA 3WF3A 2RM23 2VECA 1QMJA 2YPJA 2Q8OA 4XMIA 4AFCA 1TME1 3ZR5A 4IW3A 4LIVA 4PDWB 3OPZA 4MXVA 1NG0A 1SDDB 3TN93 3GHMA 5I8SA 1RXGA 1CAVB 3USSA 4AVTA 1OFSA 1CZVA 1H8TC 4SLIA 4OFGA 4E2SA 2BW8A 5J98B 1W05A 1MZ5A 3P3NA 1CAXA 2FD8A 1HQWA 1ZNPA 1PGSA 1YI9A 2WUHA 2EICA 4LO5B 3N9OA 2DWRA 3RZZA 5FP7A 4CDXA 1V9U2 4P5HA 4R9DA 1ZREA 5FLJA 1NXMA 1FMD3 2PQSA 4MXWB 5G04L 1R1ZA 1T6BX 3HNBM 3OEAA 4XF4A 2FMDA 4BK4A 3NL1A 1UIJA 1T2XA 3LAGA 4MZUA 4IQPA 2Y34A 4JRAA 2RS33 1NAEA 1RUC2 4NE9A 3VN4A 3U14A 4J1WA 2XKOA 3JUUA 2ERFA 5EWSA 2QVSB 3E6DA 5C9AC 3NV2A 4MO3M 4BQ5A 3MLJA 5AFBA 1IG0A 1LHUA 3WG1A 4AGVA 2ILMA 2P3IA 4L11A 4B4PA 4AEDA 4D6SA 5C33A 4FSJA 3WP3A 1X33A 4HG6B 4YM1A 1XRUA 2DF7A 2OZ6A 2K2SA 5JSRA 3A0NA 1ZZCA 2E53A 4Y5SA 1QJFA 5T5PA 4CXXA 3NNFA 4XXAA 2QUOA 1VBC1 3PVBB 4QMAA 1CAWA 4FXGB 2W1UA 4FTSA 2D3RA 1W0OA 1SBEA 1GWLA 3LA2A 2OQ7A 3AYDA 2PA7A 1WKYA 2BQPA 2D97A 3LZZA 4W8JA 1A8DA 1KFUL 4LKEA 4FPFA 4P02B 5CADA 1DQ6A 2VUDA 1FNZA 1AR83 1CQ9A 3QH6A 3VHRA 2YV8A 3FUQA 2Y60A 2A6VA 2GALA 2H6CA 1VMJA 2WWSA 1W6QB 2VTXJ 2Y0IA 2I74A 4Q4W2 4AHZA 2ZMLA 4EZ4A 1AL21 2C0ZA 5HXMA 4I02A 3ZDVA 1CN1A 4Z1VA 4QX1A 1PIV1 2C24A 2ATFA 2DDUA 1W9FA 4FPEA 4MGTA 3IIAA 1SFPA 2D98A 2AREA 3RI8A 2VOVA 4FQZA 5FMDA 3CJIA 3LEIA 4DRRA 4OZXA 3IZOA 4UBHA 2XBO1 1C1LA 1AX0A 1ULGA 4BMBA 2VZVA 2GDFA 2WZR2 2WZEA 3E1F1 1QJY2 2RE9A 4IEOA 2QDRA 1AYM3 1ULDA 2JKXA 4BLIA 4F83A 5KHJA 4M3CA 1QEXA 1LHWA 4FBFA 4Q0VA 5FYCA 4N53C 1H2KA 1RUE3 4KL1A 2JE9A 2YBSA 4GWJA 4R4XA 4ZS2A 3T3YA 3VKFC 1W9YA 4YGDA 3PDQA 4BXSV 1UMZA 2R0HA 3KD4A 2IVJA 3J8F2 4TN7A 4CDQC 3AYEA 2I2SA 2WT2A 1US3A 4XACA 4LBOA 4KWKA 2QFEA 3ZYIB 2BVVA 5CKMA 1W6NA 3MLLA 4YW1A 3VD7A 4RFRB 3WUDA 1BEV1 4SBVA 2RR13 4CYDA 1E5IA 2CWMA 3KB5A 5EFUA 1LOAA 1GOFA 3BB6A 5DDJ3 2Z69A 2RDNA 1ZBA3 5FPAA 4WVMA 4OMDA 4A7YA 1QJEA 2X10A 4CDUC 4IESA 5JZGC 3FHQA 4IEPA 3WF2A 2VZQA 5FZ3A 3UV9A 1UYZA 2XL9A 1WLWA 2XONA 3T2OA 4AL9A 5B2GB 3R6SA 2RG4A 5FJKA 3T0BA 3VDDB 3ENRA 2AYHA 4JGYB 2G9GA 1EAH3 4GMP1 1ZBE2 3FWEA 1YHFA 4HOOA 2OIIA 1VRH3 4JQTA 4Y1XA 1OA4A 2BGCA 4AG4A 1XYPA 3OSDA 1NYWA 2NMOA 3FUOA 4YM2A 5A3WA 3VUOA 2WT0A 1A78A 4MGYE 4QX3A 1RUH2 3ZFGC 4ATEA 4AW7A 4AI2A 4MADA 4Z07A 2R063 5ANQA 2CYFA 4QQHA 4XAAA 5FWJA 3T09A 3GZEA 1UPIA 2RJ2A 4W50A 1QJZA 5GZGA 2Y6LA 4H14A 1E57A 3W59A 5FYYA 1JOBA 2BERA 1PVC2 2WNEA 3WDTA 1PK6B 1PZ9A 2V4AA 4FI9A 4AI3A 2A3XA 5F2WA 5ACA3 1KITA 1N1YA 2VJXA 4QQPA 1V9U1 3HEIA 1UL9A 1XNAA 2A6XA 4JHTA 1GWMA 5DUVA 2JKBA 4JX0A 2A6YA 1YQ8A 3JD73 3K77A 5IVBA 4QAWA 2JG9C 1TNFA 1W06A 3FLPA 4OHWA 1SPPA 3GGLA 2LALA 4URAA 1RUC1 3OGVA 2ZJCA 4F3JA 2RDQA 2ZABA 3HQRA 1V6NA 4L92A 1UYPA 2VCMA 2W9XA 3TYJA 4IEQA 3NKGA 4JHZA 3W58A 5A7OA 4AAPA 4QHOA 1PHMA 3ZMNA 1V6JA 3A4UA 4QX7A 4WVWA 4QPGB 5IAXA 3SMHA 1W99A 5F5CA 3WG2A 3I59B 3KF3A 3ES1A 3O1RA 4PBOA 2JE7A 4YVSA 3P1IA 4HSJA 5F6LB 5L9BA 2ORXA 2IXJA 4O9GA 1MPXA 3ZXEA 5C3QA 2X5IC 1POQA 4COWA 3JU9A 1GMMA 3V0AB 1AUYA 3DEMA 4MYEA 2P2KA 3BODA 3SQOA 2WFF1 2VW1A 2XQXA 4GWMA 4YG6A 5GZCA 5JMCA 3MIEA 2XQRA 3NSTA 4Q4X2 2RS13 2AH2A 4FPHA 2QKDA 2ZAHA 3H1WA 1GANA 3FE5A 3WNNA 5A7WA 1ULFA 1H2NA 4LULA 4X8NA 2X05A 2CHHA 1RUD2 3LWCA 3MW4A 1X50A 2EAKA 2VH9A 3DL3A 3ZO0B 1NT0A 3WF4A 2ZX0A 3H0OA 2VQUA 4XZUG 2AACA 2XB6C 3ZSKA 2OPWA 1AR93 1SG3A 2UU8A 1SLIA 5FYUA 2B7YA 1B35A 4FOQA 1Y4WA 1QJX3 1WCKA 5DUXA 3RJ2X 3ZYGA 5GLVA 1W39A 3GXUA 4CEYC 2DYCA 5FREA 3MYXA 1AXKA 2WZR1 2ADDA 4URTA 5K8SA 1AR62 1GOGA 1PVXA 4LIUA 1REEA 2VQAA 4UOJA 1COV2 1LOFA 3IDAA 3SH5A 1DU3D 4CU6A 2FDIA 1V6LA 1MVQA 3MEPA 4RGGA 3QOPA 3FJSA 1J59A 2PFWA 2J1VA 3K46A 4GB32 2PHFA 4HK8A 1AR71 2J1EA 5BPXA 4UWDA 3R0RA 1J3RA 3HQXA 4XFFA 3EBRA 1REDA 5CFDA 1NE6A 2ES3A 1T6GC 3CZUA 3J8F1 5EV7A 4LUMA 5JWPA 3WQ0A 1GOHA 1F5FA 4MSVA 3AYAA 1ENQA 1G86A 4IV3B 3AYCA 5HCHA 4HFSA 3ZM8A 4RSUA 3BVCA 2JDAA 5FYSA 4AVCA 1IKQA 4UYBA 4OHZA 2VC9A 3GBGA 4XFBA 1PZ8A 4KWJA 4FOWA 1TEIA 1PM7A 2G1MA 4CCCA 4KBZA 5DPNA 2A6WA 1TZOA 3IKWA 4BWOA 4EN6B 4DZGA 3SH3A 3ROUA 3N36A 2Z4FA 4YW2A 3UK9A 2WA3A 2TEPA 3ZX7A 4XZPA 5CNAA 4C90A 2GAUA 2BGPA 2JJ6A 2QBXA 4HSLA 4Y22B 2VOTA 3WV6A 1VPHA 1ZBE1 3VBSB 4Q0PA 5JSOA 4YPJA 2IC1A 1DZQA 1ZX5A 3ZN6A 5FZCA 3ZXJA 1IHMA 4QDRA 2WBKA 1OT5A 5F5QA 2J1UA 5FYIA 4DUVA 1RUH1 4V1PA 3C7HA 4KG0A 1JUIA 1WWYA 3P6BA 1GWKA 2B9UA 1W9SA 5EJ1B 4CDWA 2Y33A 4CE8A 3FBMA 2NP0A 1RHI2 4UW3A 1C5IA 2RS52 4M3CF 1LNSA 1N47A 4ZZ8A 2EIBA 2J42A 3Q8EA 4HT1T 3BTXA 2HWE2 2WC2A 4E4SA 4KGGA 4GMP0 2I45A 5AC92 3ZFFA 1SHWB 1JI6A 3V56A 2HWD3 1X8MA 1YQCA 2GC2A 4I3PA 4UXAA 4DUWA 3HR9A 2QCSB 1KS5A 2LW8A 4HETA 1VBE2 2A1XA 4PDWC 4UW5A 3VD4A 2HWF3 1X36A 5SV5A 1FT9A 5GLUA 3WG4A 1XE0A 1CAXB 2J7MA 3BOWA 5SV8A 4CXWA 1DHKB 2YG0A 1JN2P 1H8VA 3M7AA 2WKKA 2JIGA 4B29A 1LR5A 2P1BA 3KQ4B 4QDSA 5LRRA 4AVVA 4FCAA 5C3RA 5FY1A 3TEZA 1EV12 4CDXB 5A6YA 3LD8A 1E5HA 5FO7B 4A42A 2JDZA 1KJLA 2GH2A 4NUBA 4IEXA 2W08A 2YYOA 1OPMA 5H9QA 5CEHA 3N4MA 2ZGUA 2CGNA 2D44A 3I3BA 4Y3OA 4XOGA 1H1AA 3A21A 2XPJA 1GSLA 3POJA 4Q4X1 4XJWA 1R091 4N90A 3AZVA 3PL0A 1UPSA 4AEDB 4XJZA 1UX7A 1AYN2 1JZ8A 5FJHA 3RNSA 3KQRA 2L9LA 2OS2A 2D40A 3OOXA 4CSWA 3MLKA 3MGUA 1RMU3 3M70A 5F39A 2DTWA 4NN0A 5FDBA 5IFTA 1MS5A 4RGAA 2RJLA 3OD0A 4K9SA 1OMIA 1CAWB 3ZYRA 5FZLA 1JZ3A 5FR3A 1BCXA 3H1MA 1QGLA 3MBWA 4UI9L 3S57A 4Q8KA 3ORJA 5IAVA 3DUIA 3CIHA 2HWB3 4FPYA
chains in the Genus database with same CATH topology
4ET7A 2LS6A 2QQJA 2HYXA 3FL7A 3NJXA 2VZ1A 4XUPA 2J22A 3C7OA 4ZZ5A 2VCAA 4JKLA 5EJZB 2WABA 4L0PA 3SEEA 3VDCA 4CUCA 3THCA 1UMHA 2WN3A 5LCWL 2RVAA 4PF1A 3GM8A 4BDVB 2W5FA 2ORZA 2W3JA 1ULOA 1W0NA 4PQQA 1NKGA 4MGSA 5IYYA 5IFPA 4D8MA 4QB2A 3CKHA 1NX9A 1TVGA 1I5PA 2VMCA 3A22A 1DYOA 1K3IA 2QQMA 5CYYA 1UYYA 1EUTA 2R7EB 5IJRA 1J84A 2XHNA 5DN2A 2YB7A 1JU3A 3IAQA 2EIDA 3HPNA 4DXSA 2CDPA 3W5MA 4P5YA 4GWIA 1UY3A 1UXXX 1UZ0A 2VZOA 5B4XA 2E33A 3VD5A 1PMHX 4CU8A 2W1SA 3ACIA 3HOBA 4DXRA 4M4RA 5CZKA 3OG2A 1CX1A 3I97A 3ECQA 3UETA 3EB7A 3LE0A 2ID4A 4ARXA 2C26A 3I2IA 4IUGA 2ZEXA 2VQTA 3LEGA 2BGOA 1UXZA 1O8SA 3CMGA 1W8NA 2ZEWA 5JXHA 3WF3A 4A6OA 1K45A 1UWWA 1SDDB 3J7HA 2B9VA 2QQIA 1YQ2A 5LA0A 2W95A 2RV9A 1CZVA 1EUUA 3MO4A 2JE8A 1JU4A 3MV11 4W4ZA 2VZSA 2QQNA 3WNLA 1R64A 2ZEZA 3F2ZA 2WUHA 2EICA 3T2PA 4E8DA 2YFZA 2VO5A 2VR4A 4P08A 2PQSA 3I2JA 1OF4A 5G04L 3HNBM 1GUIA 3OEAA 4LKSA 1WCQA 3MUY1 2QQOA 4BK4A 1T2XA 3I3EA 2VZUA 1NAEA 3WSOA 3ACFA 4MOAA 3DECA 3IB3A 4MO3M 3MUZ1 1JYNA 3MV01 5I0DA 1K42A 4LPLA 4HG6B 1BHGA 1CIYA 4A44A 2Y8KA 2VMEA 5HPOA 2WAAA 2W1UA 3HN3A 1HN1A 3VD3A 3NRUA 1US2A 1WKYA 2J1SA 4AAXA 2DCJA 4W8JA 3SKJE 3NQHA 4P02B 2QQLA 2WO1A 3VDBA 1L7QA 5JXGA 5HXMA 4CUAA 5B4NA 4QX1A 3WNMA 2DDUA 2V72A 4OMCA 4CUBA 1GQPA 3LEIA 3WNPA 4DXTA 2VL4A 3DYOA 5EIYB 2VZVA 2WZEA 3E1F1 1XC6A 4ARYA 2W1QA 3VDAA 3K4AA 2JKXA 2WYSA 3BN6A 2WAOA 1KGYA 4GWJA 4BK5A 1JZ5A 3THDA 4BXSV 4RYDA 1PMJX 1US3A 2KD7A 2YC4A 4M4PA 2V4VA 2E32A 3LPGA 4XURA 3VD7A 4XUQA 2OKXA 2Y6GA 1ULPA 3UESA 1RYYA 3WF0A 4CVUA 1GOFA 2QQKA 3UNPA 4OMDA 4MGQA 3C7EA 2X10A 5DMYA 3FHQA 1CZSA 3WF2A 2VZQA 2VCBA 1DP0A 2J1RA 1UYZA 1XNTA 1F4AA 2XONA 3T2OA 3GDBA 2X09A 3T0BA 1J83A 1UY2A 4AG4A 1P8JA 4QX2A 2J1TA 4QX3A 4A45A 1JYWA 5FUIA 2VTFA 4MADA 4TXWA 4XVHA 2VZRA 1JYVA 4XUNA 3T09A 4QB1A 3PUIA 3OEBA 2RJ2A 4W50A 3ABZA 2Y6LA 2Y6HA 2BERA 5DQ0A 4FI9A 5JMOA 2CDOA 2VJXA 1UYXA 3HEIA 1XNAA 2BBAA 4GZ9A 1DLCA 4JX0A 3T0AA 4QPWA 5C7GA 3K77A 2Y6JA 3T2QA 5JR2A 4QAWA 3GGLA 2VM9A 3NJVA 3OGVA 1W8OA 2C4XA 3HNMA 1F4HA 4E8CA 2W9XA 3WF1A 3WEZA 4JHZA 3K4ZA 3SKVA 3SEPA 5A1AA 3ACGA 5LA2A 3C7GA 1UY4A 1W99A 3I3DA 4Z2AA 3P1IA 5JXJA 1W9WA 2ORXA 1MPXA 5G05L 4JKKA 4CU9A 4UAPA 1NUKA 2W94A 1GMMA 2V5DA 3IAPA 3IIIA 1JZ6A 2W46A 3D3AA 3JXSA 2Y64A 2XQXA 4TTGA 4ZY9A 1H6XA 2VMFA 4A41A 1UMIA 3BGAA 3CZJA 5J1XA 3WNNA 2EIEA 1GU3A 1W9TA 2X05A 1JZ7A 1JYXA 3I2FA 5LA1A 4D0QA 3I2KA 2WO2A 3WF4A 2VQUA 3LPFA 4XZUG 3W5NA 1SG3A 2W92A 3GXUA 3WNKA 3C7FA 4KI5M 3LEKA 3HNYM 3T08A 1GOGA 2VZTA 4UOJA 3EYPA 3IDAA 4CU6A 2HLEA 4OZOA 4KMQA 2J1VA 2J1AA 3K46A 2VMDA 2VCCA 2J1EA 3OB8A 2ZEYA 2WQ8A 3CZUA 2B4KA 4XUOA 4XUTA 2ZXQA 1GOHA 3OBAA 1OD3A 3ZM8A 4DEQA 1JZ2A 1H6YA 2JDAA 2VZPA 3CQOA 5IHRA 2VC9A 2C9KA 3A23A 4DUXA 3K4DA 3T0DA 3A7QA 3I2GA 5DPNA 3LQCA 2Z4FA 4A3ZA 3FN9A 2BGPA 2QBXA 2YFUA 4QDQA 1O8PA 2VOTA 4YPJA 4QB6A 1L7RA 4DEVA 4OUEA 4QDRA 2WBKA 1OT5A 2J1UA 4DUVA 5F7UA 5JUVA 3C7HA 1CZTA 3P6BA 3ACHA 2WDBA 1W9SA 5EJ1B 2DCKA 4QX0A 3K75B 1LNSA 4ZZ8A 2EIBA 4KWUA 3DYMA 3C8XA 3CDZB 4P00B 4A4AA 4PT6A 3NNGA 2BZDA 3DYPA 1SHWB 1JI6A 3AC0A 1GNYA 1IQDC 4DUWA 2W91A 2LW8A 2W47A 1OH4A 3ETPA 3I2HA 3U37A 3VD4A 1PX3A 2WN2A 4CU7A 2J7MA 4BJ0A 2YG0A 3WQBA 4QDSA 3OGSA 1PX4A 4A42A 1KEXA 4ZXEA 5C70A 3I3BA 3A21A 1JHJA 3HJRA 2WO3A 4LHSA 2VZ3A 2YC2A 4RN5A 1UX7A 2JD9A 5JXIA 1JZ8A 1K12A 3PUHA 2L9LA 1TG7A 2W87A 5C71A 2W1WA 1UY0A 5IFTA 4LQRA 1OF3A 1UY1A 3FHAA 1XPWA 2Y6KA 1O59A 2WZ8A 1JZ3A 3VD9A 3OGRA 4JKMA 3WNOA 2XOMA 4OYUA 3MBWA 4UI9L 2E26A 1D7PM 3CIHA 1JZ4A 2E31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ET7 A;  2LS6 A;  2QQJ A;  2HYX A;  3FL7 A;  3NJX A;  2VZ1 A;  4XUP A;  2J22 A;  3C7O A;  4ZZ5 A;  2VCA A;  4JKL A;  5EJZ B;  2WAB A;  4L0P A;  3SEE A;  3VDC A;  4CUC A;  3THC A;  1UMH A;  2WN3 A;  5LCW L;  2RVA A;  4PF1 A;  3GM8 A;  4BDV B;  2W5F A;  2ORZ A;  2W3J A;  1ULO A;  1W0N A;  4PQQ A;  1NKG A;  4MGS A;  5IYY A;  5IFP A;  4D8M A;  4QB2 A;  3CKH A;  1NX9 A;  1TVG A;  1I5P A;  2VMC A;  3A22 A;  1DYO A;  1K3I A;  2QQM A;  5CYY A;  1UYY A;  1EUT A;  2R7E B;  5IJR A;  1J84 A;  2XHN A;  5DN2 A;  2YB7 A;  1JU3 A;  3IAQ A;  2EID A;  3HPN A;  4DXS A;  2CDP A;  3W5M A;  4P5Y A;  4GWI A;  1UY3 A;  1UXX X;  1UZ0 A;  2VZO A;  5B4X A;  2E33 A;  3VD5 A;  1PMH X;  4CU8 A;  2W1S A;  3ACI A;  3HOB A;  4DXR A;  4M4R A;  5CZK A;  3OG2 A;  1CX1 A;  3I97 A;  3ECQ A;  3UET A;  3EB7 A;  3LE0 A;  2ID4 A;  4ARX A;  2C26 A;  3I2I A;  4IUG A;  2ZEX A;  2VQT A;  3LEG A;  2BGO A;  1UXZ A;  1O8S A;  3CMG A;  1W8N A;  2ZEW A;  5JXH A;  3WF3 A;  4A6O A;  1K45 A;  1UWW A;  1SDD B;  3J7H A;  2B9V A;  2QQI A;  1YQ2 A;  5LA0 A;  2W95 A;  2RV9 A;  1CZV A;  1EUU A;  3MO4 A;  2JE8 A;  1JU4 A;  3MV1 1;  4W4Z A;  2VZS A;  2QQN A;  3WNL A;  1R64 A;  2ZEZ A;  3F2Z A;  2WUH A;  2EIC A;  3T2P A;  4E8D A;  2YFZ A;  2VO5 A;  2VR4 A;  4P08 A;  2PQS A;  3I2J A;  1OF4 A;  5G04 L;  3HNB M;  1GUI A;  3OEA A;  4LKS A;  1WCQ A;  3MUY 1;  2QQO A;  4BK4 A;  1T2X A;  3I3E A;  2VZU A;  1NAE A;  3WSO A;  3ACF A;  4MOA A;  3DEC A;  3IB3 A;  4MO3 M;  3MUZ 1;  1JYN A;  3MV0 1;  5I0D A;  1K42 A;  4LPL A;  4HG6 B;  1BHG A;  1CIY A;  4A44 A;  2Y8K A;  2VME A;  5HPO A;  2WAA A;  2W1U A;  3HN3 A;  1HN1 A;  3VD3 A;  3NRU A;  1US2 A;  1WKY A;  2J1S A;  4AAX A;  2DCJ A;  4W8J A;  3SKJ E;  3NQH A;  4P02 B;  2QQL A;  2WO1 A;  3VDB A;  1L7Q A;  5JXG A;  5HXM A;  4CUA A;  5B4N A;  4QX1 A;  3WNM A;  2DDU A;  2V72 A;  4OMC A;  4CUB A;  1GQP A;  3LEI A;  3WNP A;  4DXT A;  2VL4 A;  3DYO A;  5EIY B;  2VZV A;  2WZE A;  3E1F 1;  1XC6 A;  4ARY A;  2W1Q A;  3VDA A;  3K4A A;  2JKX A;  2WYS A;  3BN6 A;  2WAO A;  1KGY A;  4GWJ A;  4BK5 A;  1JZ5 A;  3THD A;  4BXS V;  4RYD A;  1PMJ X;  1US3 A;  2KD7 A;  2YC4 A;  4M4P A;  2V4V A;  2E32 A;  3LPG A;  4XUR A;  3VD7 A;  4XUQ A;  2OKX A;  2Y6G A;  1ULP A;  3UES A;  1RYY A;  3WF0 A;  4CVU A;  1GOF A;  2QQK A;  3UNP A;  4OMD A;  4MGQ A;  3C7E A;  2X10 A;  5DMY A;  3FHQ A;  1CZS A;  3WF2 A;  2VZQ A;  2VCB A;  1DP0 A;  2J1R A;  1UYZ A;  1XNT A;  1F4A A;  2XON A;  3T2O A;  3GDB A;  2X09 A;  3T0B A;  1J83 A;  1UY2 A;  4AG4 A;  1P8J A;  4QX2 A;  2J1T A;  4QX3 A;  4A45 A;  1JYW A;  5FUI A;  2VTF A;  4MAD A;  4TXW A;  4XVH A;  2VZR A;  1JYV A;  4XUN A;  3T09 A;  4QB1 A;  3PUI A;  3OEB A;  2RJ2 A;  4W50 A;  3ABZ A;  2Y6L A;  2Y6H A;  2BER A;  5DQ0 A;  4FI9 A;  5JMO A;  2CDO A;  2VJX A;  1UYX A;  3HEI A;  1XNA A;  2BBA A;  4GZ9 A;  1DLC A;  4JX0 A;  3T0A A;  4QPW A;  5C7G A;  3K77 A;  2Y6J A;  3T2Q A;  5JR2 A;  4QAW A;  3GGL A;  2VM9 A;  3NJV A;  3OGV A;  1W8O A;  2C4X A;  3HNM A;  1F4H A;  4E8C A;  2W9X A;  3WF1 A;  3WEZ A;  4JHZ A;  3K4Z A;  3SKV A;  3SEP A;  5A1A A;  3ACG A;  5LA2 A;  3C7G A;  1UY4 A;  1W99 A;  3I3D A;  4Z2A A;  3P1I A;  5JXJ A;  1W9W A;  2ORX A;  1MPX A;  5G05 L;  4JKK A;  4CU9 A;  4UAP A;  1NUK A;  2W94 A;  1GMM A;  2V5D A;  3IAP A;  3III A;  1JZ6 A;  2W46 A;  3D3A A;  3JXS A;  2Y64 A;  2XQX A;  4TTG A;  4ZY9 A;  1H6X A;  2VMF A;  4A41 A;  1UMI A;  3BGA A;  3CZJ A;  5J1X A;  3WNN A;  2EIE A;  1GU3 A;  1W9T A;  2X05 A;  1JZ7 A;  1JYX A;  3I2F A;  5LA1 A;  4D0Q A;  3I2K A;  2WO2 A;  3WF4 A;  2VQU A;  3LPF A;  4XZU G;  3W5N A;  1SG3 A;  2W92 A;  3GXU A;  3WNK A;  3C7F A;  4KI5 M;  3LEK A;  3HNY M;  3T08 A;  1GOG A;  2VZT A;  4UOJ A;  3EYP A;  3IDA A;  4CU6 A;  2HLE A;  4OZO A;  4KMQ A;  2J1V A;  2J1A A;  3K46 A;  2VMD A;  2VCC A;  2J1E A;  3OB8 A;  2ZEY A;  2WQ8 A;  3CZU A;  2B4K A;  4XUO A;  4XUT A;  2ZXQ A;  1GOH A;  3OBA A;  1OD3 A;  3ZM8 A;  4DEQ A;  1JZ2 A;  1H6Y A;  2JDA A;  2VZP A;  3CQO A;  5IHR A;  2VC9 A;  2C9K A;  3A23 A;  4DUX A;  3K4D A;  3T0D A;  3A7Q A;  3I2G A;  5DPN A;  3LQC A;  2Z4F A;  4A3Z A;  3FN9 A;  2BGP A;  2QBX A;  2YFU A;  4QDQ A;  1O8P A;  2VOT A;  4YPJ A;  4QB6 A;  1L7R A;  4DEV A;  4OUE A;  4QDR A;  2WBK A;  1OT5 A;  2J1U A;  4DUV A;  5F7U A;  5JUV A;  3C7H A;  1CZT A;  3P6B A;  3ACH A;  2WDB A;  1W9S A;  5EJ1 B;  2DCK A;  4QX0 A;  3K75 B;  1LNS A;  4ZZ8 A;  2EIB A;  4KWU A;  3DYM A;  3C8X A;  3CDZ B;  4P00 B;  4A4A A;  4PT6 A;  3NNG A;  2BZD A;  3DYP A;  1SHW B;  1JI6 A;  3AC0 A;  1GNY A;  1IQD C;  4DUW A;  2W91 A;  2LW8 A;  2W47 A;  1OH4 A;  3ETP A;  3I2H A;  3U37 A;  3VD4 A;  1PX3 A;  2WN2 A;  4CU7 A;  2J7M A;  4BJ0 A;  2YG0 A;  3WQB A;  4QDS A;  3OGS A;  1PX4 A;  4A42 A;  1KEX A;  4ZXE A;  5C70 A;  3I3B A;  3A21 A;  1JHJ A;  3HJR A;  2WO3 A;  4LHS A;  2VZ3 A;  2YC2 A;  4RN5 A;  1UX7 A;  2JD9 A;  5JXI A;  1JZ8 A;  1K12 A;  3PUH A;  2L9L A;  1TG7 A;  2W87 A;  5C71 A;  2W1W A;  1UY0 A;  5IFT A;  4LQR A;  1OF3 A;  1UY1 A;  3FHA A;  1XPW A;  2Y6K A;  1O59 A;  2WZ8 A;  1JZ3 A;  3VD9 A;  3OGR A;  4JKM A;  3WNO A;  2XOM A;  4OYU A;  3MBW A;  4UI9 L;  2E26 A;  1D7P M;  3CIH A;  1JZ4 A;  2E31 A; 
#chains in the Genus database with same CATH topology
 1LGN A;  3WZ1 A;  1ND3 A;  4AHY A;  1AR6 1;  1H4G A;  2PHW A;  1VBD 3;  1RUJ 3;  3O0W A;  1UN1 A;  2XJP A;  5DAQ A;  2JG8 A;  4JKL A;  2IFW A;  4JRL A;  4X6Q B;  5F5I A;  3PUS A;  2LM3 A;  1N1T A;  1XNK A;  2IXH A;  2UY9 A;  3AKS A;  2P37 A;  4Q8L A;  3ZPY A;  4RQP C;  1XB9 A;  2QZ3 A;  2BTV C;  4GB3 1;  4L0P A;  3IWZ A;  3RSJ A;  3VDC A;  1L7L A;  2YPD A;  1JUH A;  3UJQ A;  1G9C A;  2BOJ A;  3AMM A;  3MF6 A;  2R04 2;  2WN3 A;  2ZAC A;  5LCW L;  5GLT A;  3CJI B;  3VBF A;  2YUE A;  5GJ6 A;  4Y20 A;  4ZXK A;  2DVD A;  2Y26 A;  4UT5 A;  3M2M A;  1ULO A;  1OSG A;  2XLF A;  1NKG A;  3F95 A;  4PQQ A;  4LNV A;  4QQO A;  2XJV A;  1NLS A;  3CKH A;  5FK7 A;  1NX9 A;  2IXL A;  4Y1V A;  2VMC A;  2YBK A;  3FBY A;  1V0A A;  3PUQ A;  2ZX3 A;  4DY3 A;  1IS5 A;  2A71 A;  5C8C A;  1X8E A;  5KHI A;  3OY8 A;  4M3C B;  4NID A;  1O6U A;  5IJR A;  3SC7 X;  2HWC 3;  2ARB A;  2BJS A;  2DCY A;  3JB8 A;  1JU3 A;  3KWV A;  4JDO A;  3AFG A;  5A6X A;  1UOG A;  5A33 A;  5CKN A;  3HPN A;  1YQ5 A;  3E6C C;  4LJH A;  3ZOI A;  1AHS A;  1F9K A;  3ZMO A;  4GWI A;  1W6N B;  3QLQ A;  4IE4 A;  4IE7 A;  1MZE A;  5FYB A;  1UXX X;  4AEK A;  4YM0 A;  5DAW A;  5B4X A;  3KF5 A;  3WDU A;  2WO7 A;  3WT3 A;  4JQR A;  4FT8 A;  1CIW A;  3HAG A;  5F5A A;  2O8O A;  4WVM B;  5BY5 A;  3WP5 A;  3AKR A;  4JDM A;  5DZF A;  2ZA9 A;  4C0B A;  3AVS A;  3HMY A;  5BNP A;  3T4V A;  1F5J A;  2EAA A;  5LB6 A;  4OI1 A;  5LBF A;  1RHI 1;  3NJZ A;  1W2O A;  5KXD A;  3LOB A;  3OG2 A;  4QX8 A;  2WNV C;  2HWE 1;  2IUW A;  5E8A A;  1ENS A;  4C1W A;  1H9P A;  1OLR A;  5D2A A;  5FMO S;  3LE0 A;  5C3O A;  2VMI A;  3LIG A;  1QDO A;  4K8F A;  2C26 A;  2JWP A;  4L9B A;  5FPU A;  1R08 3;  5A7S A;  2ZHL A;  5AC9 1;  5JOW A;  3VDD C;  1UU4 A;  4Q29 A;  4LO7 A;  4IEV A;  1OOP A;  3MF9 A;  3E6B A;  1W8F A;  4D69 A;  3QAC A;  2B46 X;  3WNX A;  2DU0 A;  4A6O A;  4AFD A;  5GZF A;  3WCR A;  2PHD A;  2ZX4 A;  1VBE 1;  1K45 A;  1OKO A;  3MPP G;  1WUV A;  1C1F A;  1KS4 A;  4L2N A;  5K0U A;  3ZXD A;  3J7H A;  1UKR A;  5FZ6 A;  1UU6 A;  5T5O A;  4TLG A;  5LA0 A;  2W95 A;  3LDK A;  2RV9 A;  4P9I A;  5FQ0 A;  4Q4Y 3;  5C8C B;  1H1M A;  2EF6 A;  3MV1 1;  3O5S A;  4DO0 A;  2NQY A;  1WBL A;  1EV1 1;  3TNP B;  5APA A;  4ES8 A;  2XWJ B;  3WDW A;  3VBO A;  3WNL A;  1R64 A;  2ZEZ A;  4ZS3 A;  3MIG A;  3TEW A;  1SFY A;  1N3O A;  4P08 A;  1SPP B;  5JPN B;  4HN0 A;  2VVE A;  4BQW A;  1GUI A;  2KM2 A;  1WCQ A;  1NLR A;  1RUN A;  4Y4Y A;  4HMZ A;  1MVE A;  4FFG A;  1C8M 3;  5A1L A;  1RJ8 A;  3DKW A;  4KQ7 A;  2VZU A;  3WSO A;  4NRO A;  5FKC A;  3X29 B;  4GA9 A;  1AYN 1;  2WS9 3;  3DEC A;  3HBK A;  5J48 A;  4YW6 A;  3MUZ 1;  2BFU S;  1V6M A;  4R52 A;  4CCK A;  1YEW A;  1UX6 A;  4XQ4 A;  1JYN A;  2P3J A;  4V2V A;  3IDC B;  1STM A;  5LW9 A;  4LPL A;  2XDV A;  3BKZ A;  4QPG C;  1JH5 A;  5T50 A;  2R07 3;  5KXE A;  2C5D A;  2F4P A;  5E16 A;  5DAP A;  5FZI A;  2ARX A;  1UW8 A;  2JEN A;  2Y8K A;  3NV4 A;  4IL7 A;  1QQP 3;  3TOJ A;  2VME A;  4RFT 0;  5FTT C;  5FXZ A;  3PVN A;  4JZR A;  4OUM A;  1WZX A;  1MQT C;  1W04 A;  2R16 A;  4CA9 A;  1SAC A;  2GP3 A;  4RS5 A;  4G3Y C;  5A7W B;  2FDJ A;  1QDC A;  4YZ1 A;  1D0H A;  4EE2 A;  2J1S A;  2DCJ A;  3SKJ E;  1OKQ A;  1SLB A;  2GNM A;  2AEN A;  5FYZ A;  1UU5 A;  1UO9 A;  2ZHM A;  4JC1 A;  2JDP A;  2QQU A;  3K2O A;  3ZXL A;  2ZPX A;  1BQP A;  5FY5 A;  3WVJ A;  1YFX A;  5J96 B;  1U5I A;  3RMY A;  3OBZ A;  2K0G A;  1TMF 3;  2PMW B;  2R04 1;  3ZDS A;  1O3R A;  1B35 B;  1ZA4 A;  5JXG A;  5IK7 A;  3RZL A;  1O7F A;  1YJL A;  3ZFE A;  1EPZ A;  2RM2 2;  4B7E A;  1AL2 2;  3WNM A;  3G7D A;  4QXK A;  1UAI A;  3DPR A;  3LDB A;  2R32 A;  5GLZ A;  2PAE A;  1GQP A;  3DXU A;  2FCV A;  4CUB A;  1RL3 A;  3TN9 2;  4BQ4 A;  1LHV A;  1UCX A;  3HWJ A;  4N9H A;  3S7I A;  3WNP A;  2O0O A;  5I0R A;  1DGW A;  3ZXK A;  4ZKT B;  4R9A A;  3DYO A;  3M3C A;  3M3I A;  4D6Q A;  2WNO A;  5JSP A;  3NAP C;  5JR7 B;  4XAE A;  3SNM A;  3RZK A;  1S2B A;  1UNB A;  4YZ5 A;  1VRB A;  5LY1 A;  2YY1 A;  3UL2 A;  1W8H A;  4FO9 A;  2G9Z A;  2W1Q A;  3AM2 A;  4XJA A;  5CFD B;  1VAM A;  3AMH A;  3M1H A;  4IEU A;  1MS0 A;  4LHK A;  4GAZ A;  4JGZ A;  5EYY A;  4XPV A;  2SLI A;  3GHN A;  2FZ1 A;  1HRI 3;  3VKO A;  3KVB A;  1RUG 3;  3J7L A;  3H1Y A;  1PMJ X;  1UZV A;  3UGG A;  2ET1 A;  1ONA A;  1N1S A;  2KD7 A;  2RS3 2;  2YC4 A;  3ZKU A;  2V4V A;  5L7O B;  3LCP A;  2E32 A;  1GQG A;  1UF2 C;  1W6O A;  3JB4 C;  2E9Q A;  4H2A A;  4IV3 C;  3VKL A;  5K9Y A;  4XUQ A;  2OKX A;  1XNB A;  4IET A;  3CU7 A;  3I4I A;  2ZAA A;  1LED A;  3NW4 A;  1BEV 2;  3LOI A;  1ODN A;  4NPL A;  4QPI B;  1QHD A;  4CVU A;  2PAM A;  1XBF A;  3KLS A;  3E97 A;  5A7N A;  1ZRI A;  1CZS A;  4DIQ A;  3HBZ A;  2VCB A;  2F4L A;  3AZW A;  3O1U A;  3ETQ A;  1LAJ A;  1C4R A;  5LK7 B;  3FHI B;  2D43 A;  3VBU A;  2Y0O A;  3VBS C;  2VY0 A;  1AF9 A;  1UY2 A;  3OGG A;  1GP5 A;  3SIS A;  3L9J T;  3S5A A;  1G7Y A;  1X9P A;  4QX2 A;  4IV1 A;  4CDW B;  3RMX A;  4CP9 A;  1JYW A;  1AR8 2;  1R1A 3;  5FUI A;  1YI7 A;  3JQW A;  3BUC A;  2ZOE B;  3POG A;  2O14 A;  2VZR A;  1JYV A;  1RIR A;  1WD3 A;  1O4Y A;  4XUN A;  1RB8 G;  1HRV 3;  4QB1 A;  1WCU A;  4QU1 A;  3ABZ A;  1HLC A;  1HB1 A;  1ST8 A;  3PLQ A;  4BU2 A;  4FPJ A;  4JCK A;  2Y6H A;  3OBR A;  2H0V A;  3ZFF B;  1Z7S 3;  3HIF A;  4CZS A;  2LRP A;  1LGC A;  2VUA A;  3V64 A;  1QH6 A;  3QD6 A;  3JQX A;  5JMO A;  3ZXA C;  3CL1 A;  4QGL A;  4EJR A;  2BBA A;  4GZ9 A;  1DQ0 A;  3WY6 A;  1BYH A;  3T0A A;  4G9S B;  3ITQ A;  3HT1 A;  4XFH A;  1XSR A;  1NE4 A;  3B69 A;  4K3U A;  2VM9 A;  3IN9 A;  4LBL A;  1SLA A;  4I30 A;  1OLM A;  3OD4 A;  2DUR A;  2EXH A;  4I3G A;  5FIX A;  3HNM A;  5HCA A;  4QKB A;  3DKQ A;  4E8C A;  4NOT A;  3KSC A;  3SEP A;  5C9A A;  1PO1 3;  1TE1 B;  1WMF A;  5F8P A;  3KM5 A;  3ZVX A;  2BFU L;  1HB4 A;  3WP6 A;  2H6B A;  4BPZ A;  5C4W C;  4HK9 A;  3I3D A;  4Z2A A;  3INA A;  4CDX C;  3ATG A;  1UOF A;  5DG2 A;  4A2U A;  3RZM A;  1NLQ A;  2A6Z A;  4JKK A;  2ZGL A;  1YRZ A;  2RR1 2;  3IAP A;  5FYV A;  4GIQ A;  1ASJ 1;  1HIX A;  3M3E A;  5DDJ 2;  3NKT A;  4QGM A;  2IXI A;  2WFF 2;  4DRV A;  5LRS A;  3AP5 A;  3LSD A;  4OI0 A;  3VBH B;  1UMI A;  4A41 A;  3KT1 A;  5EQU A;  3CZJ A;  3V0B A;  3B9C A;  4AED C;  1GU3 A;  4AOC A;  2TUN A;  1W9T A;  3WP4 A;  1O91 A;  1JYX A;  1JYI A;  4NWW A;  3GJB A;  1GP6 A;  4XW3 A;  1EAH 2;  5LA1 A;  4I01 A;  1VRH 2;  3WW2 A;  2WO2 A;  3OYW A;  4XXP A;  4NHX A;  2XKP A;  4XTP A;  3WW4 A;  1LKN A;  2EVX A;  2RM2 1;  3S5Q A;  2YXS A;  5A3L A;  4YG3 A;  3W5N A;  2C1F A;  5FMC A;  4K8R B;  2R6Q A;  1ND3 B;  2P5B A;  1RC6 A;  4AQT A;  1H4H A;  1Q8Q A;  2WSV A;  3L2Y A;  3TN9 1;  1RUI 3;  2R06 2;  3PME A;  1PMI A;  4MET A;  5F3I A;  5FP4 A;  3C7F A;  4KI5 M;  4LBQ A;  2JG8 B;  4AEM A;  3R4S A;  3QCW A;  1AJK A;  4CCD A;  1DG6 A;  5FK8 A;  1H9W A;  1OBN A;  2PHX A;  5A32 A;  3IDB B;  2QE3 A;  1IZ3 A;  3PIJ A;  4YM3 A;  2VZT A;  2LRO A;  3EYP A;  2HLE A;  4AYU A;  3AKT A;  2ZGT A;  1RGS A;  2Z2S B;  4RD7 A;  1EYB A;  1HXS 3;  1S2E A;  2PHT A;  3KV6 A;  1FMD 1;  4Q1R A;  3C2U A;  3VBF B;  2UWA A;  4Y20 B;  1S0I A;  1AR7 2;  2NLR A;  5DZE A;  4N53 A;  3ZXF A;  3JD7 2;  4XUO A;  4ZON A;  5F32 A;  1GNH A;  4XUT A;  5K4L A;  2RS3 1;  4D94 A;  3VZL A;  4IEW A;  1OD3 A;  4GUL A;  1JZ2 A;  4FP3 A;  4AR2 A;  2GC1 A;  3OY8 B;  3D5O A;  5FZO A;  3CQO A;  5IHR A;  1QOT A;  4OQ9 A;  1UIK A;  5DAX A;  3O14 A;  3AMQ A;  3Q9O A;  4GJZ A;  3K4D A;  4QHZ A;  4EZH A;  4E2G A;  3T0D A;  3U07 A;  2GMM A;  3AL6 A;  5CKQ A;  1ZZ8 A;  3A7Q A;  5A33 B;  4LUK A;  3LQC A;  4QM9 A;  4N7U A;  4WVV A;  3PVO A;  4NAM A;  3LF7 A;  4CDU A;  3V65 A;  4M0N A;  1KXG A;  2X53 S;  4FXK B;  4LBJ A;  4A3Z A;  4E2Q A;  4R9B A;  3FN9 A;  4KU7 A;  4PIY A;  2VBP A;  4UFH A;  2JD4 A;  2YFU A;  4QDQ A;  2QJV A;  4MGK E;  4PJY A;  4P9Y A;  5FXW A;  4CEW C;  4EV0 A;  2RS1 2;  3VB9 A;  2VNR A;  3THT A;  4OUE A;  2K46 A;  4LR4 A;  4CPB D;  1XNC A;  5F7U A;  2AC1 A;  5JUV A;  1AR8 1;  1CZT A;  1MS1 A;  2FCU A;  5FBJ A;  3ZFG A;  1HW5 A;  2PLV 3;  4Y26 A;  2D5F A;  4QX0 A;  5FFO C;  2D3P A;  2DBN A;  1KJR A;  3MW3 A;  1AR9 2;  4HVO A;  1PO2 3;  1CON A;  4QX5 A;  2WII B;  5BNO B;  4V2W A;  3ILR A;  4BH9 A;  3CDZ B;  1OOP B;  1OFN A;  2A75 A;  1XJA A;  1QJX 2;  2X8K A;  3EXU A;  4HLT A;  3SHR A;  3NNG A;  5FWE A;  1W2U A;  2Z42 A;  4YAR A;  3MPB A;  4Q4W 3;  3DYP A;  4NPM A;  3I54 A;  3AC0 A;  1GNY A;  5K0U B;  2RHP A;  1OQ1 A;  2RMU 3;  5FY0 A;  3AXE A;  5A3T A;  4JTN A;  4J6G A;  2W47 A;  4LO6 B;  5HCF A;  1I1E A;  1AYM 1;  3VBR A;  3R4U A;  1NA1 C;  2JG9 A;  1SDW A;  5FQ0 B;  1PX3 A;  2WZP P;  5A80 A;  1RUE 1;  1QNY A;  3NV1 A;  1PM4 A;  4ISQ A;  1ULE A;  3ME2 A;  4CUG A;  4Q4V 3;  5FPZ A;  4JTO A;  3VBO B;  1O3S A;  4XMA A;  4DMI A;  1QJY 3;  1POV 3;  3OGS A;  4K6B A;  4QPY A;  5C8C C;  3VKN A;  1I6X A;  2VMG A;  3H8R A;  1H1I A;  2IXK A;  3FC0 A;  4M00 A;  4TSV A;  1GV9 A;  3AVR A;  3RG0 A;  4DOU A;  4BXF A;  1KEX A;  4C0H A;  2YGM A;  3Q8F A;  2QTW B;  2RR1 1;  2X5I A;  3ZLI A;  3ZYH A;  4AGR A;  4YYO A;  5DDJ 1;  1S0G A;  1ZBA 1;  4UW6 A;  1QKQ A;  1JHJ A;  1OA2 A;  3NO8 A;  3TB0 A;  2CV6 A;  4TTG A;  5F3C A;  1M4W A;  4WM8 A;  4CCN A;  3KCY A;  1R09 2;  2YC2 A;  4RN5 A;  2R0F A;  1SEF A;  5JXI A;  1X9T A;  5JOX A;  5LK5 A;  3LFM A;  1HB3 A;  1OUX A;  4TLF A;  5C71 A;  1AZD A;  2BV4 A;  2W1W A;  1EAH 1;  1UY0 A;  2XLG A;  3MIF A;  1OF3 A;  1FI2 A;  1VRH 1;  2VOX A;  1Q3E A;  2ZKL A;  4LTA A;  3SCF A;  4IE0 A;  4B4Q A;  1XPW A;  2YRO A;  2Y6K A;  4N43 C;  3K3O A;  1MEC 3;  4R4Z A;  5BXX A;  4OHV A;  4JKM A;  3ILN A;  3KV9 A;  3DV8 A;  2XOM A;  3WCS A;  4OYU A;  4RS5 B;  2WNU A;  3C3V A;  2E26 A;  2Q30 A;  2VNV A;  1JBC A;  4XBL A;  1CPM A;  3WDX A;  5A3O A;  2R06 1;  1WLC A;  4Q26 A;  5C5T A;  2OX0 A;  4ET7 A;  1S4C A;  3RWK X;  2QQJ A;  3KT7 A;  2HYX A;  5FV3 A;  1WW5 A;  3OUJ A;  1BVP 1;  2VZ1 A;  2PHR A;  3RYP A;  1ODM A;  2LTN A;  2MEV 3;  4A7Z A;  3BIE A;  5FZK A;  1XU1 A;  1VBB 3;  3IMM A;  4XJ9 A;  2JDN A;  2WWJ A;  1VB4 A;  3PHM A;  1JOJ A;  4HN1 A;  5ANN A;  5EJZ B;  5ACA 1;  1UZZ A;  1V70 A;  2WAB A;  2YMZ A;  4LLO A;  5H9R A;  5BNN A;  2GC3 A;  2LUW A;  3SEE A;  1OVP A;  1YIP A;  2D6K A;  3ZFE B;  5CA6 A;  5IVC A;  3THC A;  2G9F A;  3AJY A;  1LRH A;  3DPR B;  4RR3 B;  5EZW A;  1UMH A;  3JD7 1;  1DIW A;  2BWA A;  2HWD 2;  4QHB A;  4PF1 A;  1B35 C;  1NCQ A;  3GM8 A;  4HVR A;  5I0T A;  2ZX2 A;  2OT7 A;  3GAL A;  1PVC 3;  3LB9 A;  4YW5 A;  5FP9 A;  1W0N A;  1QXR A;  4XF3 A;  4YW4 A;  2HWF 2;  1VMH A;  1W6M A;  4D8M A;  2JIC A;  1I5P A;  1PNF A;  1LHO A;  4XQW A;  5EYX A;  1K3I A;  4NHM A;  4NR1 A;  4A6S A;  2JEM A;  1YCI A;  3APB A;  1UYY A;  3OJB A;  2R7E B;  2P17 A;  4ASK A;  4JGZ B;  1J84 A;  3D82 A;  4BCU A;  4PLO A;  4KU8 A;  5DN2 A;  4P9W A;  3KHB A;  5CFD C;  1W0P A;  3B00 A;  1NY7 2;  1F8V A;  4U2A A;  4F8A A;  3POE A;  1PGL 1;  5IVF A;  1W6O B;  1F35 A;  1UY3 A;  1OUR A;  2RS1 1;  4IDZ A;  5KR7 A;  1DLL A;  1H2M A;  2VZO A;  1OLM E;  2XL7 A;  2R49 A;  3JCI A;  4DFS A;  2E33 A;  5L7O C;  1PMH X;  1WME A;  1Y43 B;  3O1O A;  4CU8 A;  3ST7 A;  4AQ6 A;  5LEK A;  4XTM A;  1GIC A;  4OUL A;  1RVF 3;  4UFL A;  2TBV A;  2OUJ A;  4XYX A;  2D6L X;  3JBG 3;  1NQD A;  4QPI C;  4WM7 A;  4XE9 A;  5KXB A;  3TEY A;  2E7T A;  3HOB A;  4RL7 A;  1MEC 1;  2E6V A;  3ES4 A;  5FY4 A;  5FUP A;  4GWN A;  1KD7 A;  1DBN A;  1AR9 1;  5C6C A;  3DN7 A;  1YC6 1;  1RXF A;  5ISL A;  5FY8 A;  3ECQ A;  4JDN A;  2EIG A;  2PHL A;  3VBU B;  5FOB B;  3UET A;  4ARX A;  1QJX 1;  1RUD 3;  1KQR A;  3RJR A;  5FZ9 A;  2W52 A;  4IUG A;  4NHK A;  1APN A;  5IUQ A;  5IVE A;  1YNA A;  3BYW A;  2NPI A;  4QGN A;  1DGR N;  3CMG A;  1W8N A;  3TRS B;  4CP9 B;  1VBD 2;  1RUJ 2;  1OQD A;  1DGL A;  4ERO A;  4E27 A;  4CDW C;  5JAX A;  2XVK A;  3RVH A;  3U78 A;  4D7S A;  1DCS A;  1GNZ A;  1S0C A;  1D4M 3;  4A7K A;  2BOI A;  2BBV A;  1IS4 A;  1VR3 A;  4M0H A;  5KXC A;  1XND A;  3TAY A;  2WFP A;  4QKD A;  1EUU A;  1E5R A;  4W65 A;  3MO4 A;  3POF A;  1JU4 A;  3I7D A;  1COV 3;  4Y1Y A;  4YVW A;  5LBC A;  5C8W A;  4W4Z A;  1LEM A;  2D6P A;  5A7Q A;  3CBN A;  3RZH A;  3MZH A;  2VE1 A;  3T2P A;  4OUS A;  1OLQ A;  4NRQ A;  2VMH A;  3AP4 A;  4B4R A;  5JCT A;  1OF4 A;  5ABJ A;  4LKS A;  2D6M A;  2JDK A;  2QQO A;  3MUY 1;  2XML A;  4Y24 A;  4YZ2 A;  2ARC A;  4XDO A;  2P6H A;  3VLB B;  2HWC 2;  2F17 A;  1OXC A;  4FPO B;  1LGB A;  3WG3 A;  5C9A B;  3ACF A;  4FFI A;  4YFW A;  1VJ2 A;  2XG3 A;  3IB3 A;  3LA3 A;  4IGO A;  5FY7 A;  4ZU7 A;  3RFR A;  4KWL A;  4DXZ A;  2YU1 A;  2D3S A;  2ZCW A;  5I0D A;  1K42 A;  3VZM A;  1ZM1 A;  4KG8 A;  4E4H A;  4QKF A;  2IXC A;  1XXN A;  2HH9 A;  5LWB A;  5FZ7 A;  4XQD A;  2QDN A;  3O12 A;  5T5J A;  1DFQ A;  5GKA C;  3BIW E;  3GCW A;  1A3K A;  5AFE A;  1G8W A;  1YFY A;  4Q0U A;  4QD2 A;  1RUF 3;  5F6K A;  5FKB A;  3PU8 A;  4LMF A;  3AK0 A;  3SLI A;  5HPO A;  3BU0 A;  4D7T A;  4NIH A;  4UFJ A;  1W90 A;  1RUO A;  3VZN A;  3HN3 A;  3K48 A;  1ALY A;  1HN1 A;  4LHL A;  5HV4 A;  3NRU A;  1US2 A;  2EXI A;  4AAX A;  4LA3 A;  3VZO A;  4O9E A;  1ENX A;  5D8A A;  3VBH C;  1GYK A;  3LKJ A;  3H7Y A;  4OI4 A;  3KGZ A;  2C9A A;  3ASI A;  3HQU A;  4BOW A;  4KH9 A;  2Y38 A;  5LA9 A;  1R08 2;  3U75 A;  4UBG A;  3VDB A;  4FTB A;  4RQP A;  1L7Q A;  2HWD 1;  2RS5 3;  5FZE A;  4EN8 B;  4FPG A;  3NVC A;  5B4N A;  3BTZ A;  2WT1 A;  2V72 A;  4LBQ B;  4OMC A;  4ZHN A;  4NAO A;  5T54 A;  1IOA A;  4QXH A;  1ND3 C;  5A32 B;  2HWF 1;  4LEJ A;  2WLQ A;  4DXT A;  3H42 B;  2BNN A;  3MHZ A;  2JG8 C;  3H3U A;  4Q4Y 2;  2YDE A;  1XC6 A;  3MID A;  4M01 A;  3N9Q A;  4PBP A;  1S1A A;  2DVA A;  5CIR A;  3H50 A;  3M3O A;  1WD4 A;  1NQJ A;  3K4A A;  1QH7 A;  4N53 B;  4ORF A;  4C1X A;  3BN6 A;  1O5U A;  4Y5Z 0;  2V09 A;  2UYB A;  3B93 A;  1NY7 1;  4Q0S A;  3WDV A;  2WA4 A;  4BK5 A;  3VKM A;  3EJK A;  3VBF C;  1PNG A;  4DIN B;  1FOD 3;  2XJT A;  4C91 A;  1SZB A;  1GR3 A;  2OZJ A;  2YHJ A;  1C8M 2;  3BOP A;  1REF A;  3AKP A;  4XIK A;  5D21 A;  2BYV E;  5FY9 A;  4NIG A;  1DQ4 A;  2B42 B;  2A3Y A;  3J7N A;  2WS9 2;  4HBN A;  5AVP A;  1Y9Q A;  4XBQ A;  3UJO A;  2PTM A;  3GNE A;  1I9R A;  3Q8C A;  2VXJ A;  5FZ1 A;  2AEZ A;  4FVV A;  1RMU 1;  3LEM A;  2Y6G A;  1F15 A;  3U10 A;  1MR5 A;  3EQE A;  3POB A;  2VVF A;  4XC9 A;  1C5H A;  5FXX A;  2R07 2;  4CDU B;  3UNP A;  4XFC A;  2XXZ A;  3C7E A;  4B7K A;  4CRQ A;  3ZSL A;  3O1T A;  5FLI A;  1GLH A;  2XVL A;  5JPM B;  1DP0 A;  2J1R A;  1XNT A;  4LOT A;  1F4A A;  1DQ5 A;  2WNV A;  4LE4 A;  3GDB A;  2HWB 1;  1OA3 A;  2X09 A;  2P6C A;  4GD4 A;  1HV1 A;  1TQ5 A;  4HL0 A;  3GCX A;  4B1M A;  4UFM A;  1J83 A;  2WJS A;  3GZA A;  1V6O A;  3MFA A;  4I0A A;  4IE5 A;  5E88 A;  4JGY C;  4U36 A;  1D4V B;  1VBD 1;  1QOO A;  1IS6 A;  5CG8 A;  2VVD A;  1RUJ 1;  3RPQ A;  1P8J A;  4WBB A;  3ZFG B;  2FZ2 A;  4GH4 A;  2AGS A;  1SCR A;  1U5Y A;  1DF0 A;  4A45 A;  3N7J A;  3H3L A;  5JLV A;  3S30 A;  3H9A A;  4E4Z A;  5FPX A;  1MS8 A;  3NNJ A;  1TMF 2;  4QXC A;  4QXB A;  4LKD A;  3I3Q A;  1AL0 G;  2JB8 A;  1K5M A;  2GND A;  4NRM A;  3AL5 A;  1S0E A;  3WW1 A;  5BNO C;  2QNK A;  5DQ0 A;  4OVE A;  1V6I A;  1FXZ A;  2ZGM A;  5KHG A;  1W2T A;  1BMV 1;  1KRI A;  3HT2 A;  4ZU4 A;  3UKV A;  1PK6 C;  4LHN A;  3SIT A;  1CVN A;  3VBR B;  1JYT A;  4QPW A;  5FRA A;  1Z78 A;  3T2Q A;  5JR2 A;  1HJG A;  5K0U C;  1LEC A;  5IK8 A;  5CG9 A;  2HWC 1;  1GZT A;  3NMB A;  4RHV 3;  2C4X A;  1AX2 A;  5FZH A;  4MHU A;  4FTE A;  1VAL A;  3WQ7 A;  1BJQ A;  4HPK A;  1JOD A;  4YVS B;  3U4S A;  1RUG 2;  5A1A A;  4Y1U A;  3C7G A;  2E7Q A;  4XET A;  5FZM A;  1UY4 A;  1Q8S A;  5FYM A;  2E51 A;  2CGP A;  1FPN 3;  4RA0 A;  3GJA A;  2X5I B;  3WW3 A;  4N8M A;  4MHR A;  1LU2 A;  5G05 L;  5IWF A;  3N35 A;  1NUK A;  2W94 A;  1ZRF A;  2B8M A;  3POS A;  2V5D A;  3FFZ A;  4WM8 B;  5JIU A;  1JZ6 A;  2W46 A;  4XJU A;  4C8D A;  3ZXG A;  1BBT 3;  1ASJ 2;  2ARA A;  2XR4 A;  3D3A A;  3OUH A;  1MQT A;  2ZMK A;  4Q27 A;  1BZW A;  4ZY9 A;  4FAG A;  1DQ2 A;  1H6X A;  3MFC A;  3T30 A;  1S0D A;  1VAV A;  2ZZQ A;  1UOJ A;  2VOK A;  4YFZ A;  1ND2 A;  2P34 A;  5L36 A;  1R08 1;  5L9R A;  5FZ8 A;  1VLN A;  3DCQ A;  1NCR A;  2I07 B;  3I2K A;  2WNU B;  4XFI A;  1VBA 3;  5KHK A;  1V00 A;  4Y33 A;  1W8W A;  4YG0 A;  3ZPO A;  5GZE A;  3CJX A;  3T2T A;  5FZ4 A;  2VPV A;  3E5X A;  2XVG A;  3GZU C;  2VU9 A;  5EPA A;  3AMP A;  4BME A;  2XHK A;  3AZX A;  5A3N A;  2QQP A;  5FP8 A;  3TWI A;  4COV A;  4Q4Y 1;  2WL1 A;  3B3Q E;  3KT4 A;  4QU2 A;  1J58 A;  3T08 A;  5BNN B;  1QF3 A;  2YU2 A;  4Z2W A;  3NAP A;  1K5J A;  1JOP A;  1F31 A;  4OZO A;  4S2H A;  1MS9 A;  1TME 3;  3S0M A;  2XJU A;  1QU0 A;  1NCQ B;  3NWK A;  1QIQ A;  4FOY A;  2EXJ A;  1EY2 A;  1CX4 A;  2VMD A;  2VCC A;  1WLD A;  3FX3 A;  3MIH A;  3UYJ A;  4DPN A;  5J3U A;  1G9A A;  1FMD 2;  2ZEY A;  2WQ8 A;  3DPR C;  2ZS6 B;  4RR3 C;  3S6P A;  2B4K A;  1W6M B;  2A73 B;  3AXD A;  1C8M 1;  4BQ1 A;  4O61 A;  4RGK A;  2Q8C A;  1QJU 3;  2WLP A;  3PTR B;  5HCB A;  3OBA A;  2WS9 1;  2CWS A;  3URF A;  1SBD A;  2RJK A;  4IEZ A;  4HXC A;  3SH4 A;  2VZP A;  4NO4 A;  5LZ6 A;  4EYU A;  4FPL A;  4FPC A;  2BPA 2;  1PO1 2;  1ZYB A;  5CFC A;  4UW4 A;  1D2S A;  3KV5 A;  3THP A;  4DUX A;  2R07 1;  4R8H A;  5LY2 A;  1SLC A;  1O4T A;  2OVU A;  2Q5T A;  2DFC A;  4OCT A;  3I2G A;  4TWT A;  5KHH A;  1V6K A;  4JGZ C;  1QQP 1;  3I3M A;  4K21 A;  5A7P A;  4PLM A;  2D6N A;  4K40 A;  4E9K A;  2D93 A;  4W6W A;  5C5U A;  3CEW A;  3ZN6 B;  1G9B A;  1O8P A;  1OH3 A;  1XYN A;  4B3N A;  4QB6 A;  1X82 A;  5H9S A;  3H7J A;  2PHU A;  5L73 A;  3ZN5 A;  1J1T A;  3IDE A;  1Y7B A;  5IW0 A;  4WM7 B;  4PCR A;  1IS3 A;  2W68 A;  1VBC 3;  4MX3 A;  3I8T A;  1SQ4 A;  3T1M A;  2OW4 A;  2P4E A;  3J9S A;  2A5Z A;  2WDB A;  3MW2 A;  1TMF 1;  1U12 A;  2YGL A;  3PJQ A;  4AVA A;  3K75 B;  3J4U H;  4O65 A;  4S2D A;  4XHB A;  3DF0 A;  1JMU B;  1XOY A;  5FPL A;  5IK5 A;  2AR6 A;  1YFU A;  2CAV A;  4XCA A;  1H8T A;  4P9G A;  4ASL A;  3VBU C;  4A4A A;  5KC5 A;  1RUI 2;  1HX6 A;  2BU9 A;  2Q1F A;  4KNC A;  4OHX A;  4PT6 A;  4NWV A;  1XE8 A;  2P3Y A;  3RGB A;  5GAL A;  5F1R A;  1IKP A;  2BZD A;  3HD8 B;  4KBB A;  2BWC A;  5CAZ A;  1O4Z A;  1AL2 3;  1Y9M A;  4CCJ A;  5KC6 A;  3NJY A;  3VL9 A;  4UFI A;  1PIV 3;  4BIO A;  3U4X A;  5IT6 A;  1GZW A;  2CNA A;  1LOG A;  3U37 A;  3USU A;  1AYM 2;  2QZ2 A;  4YVW B;  2D7F A;  1WCS A;  1HXS 2;  3GBW A;  1W8U A;  3POY A;  2ZGK A;  4IGQ A;  4CU7 A;  4BJ0 A;  1RUE 2;  5FO8 B;  1HRI 1;  1N3Q A;  2VUL A;  1BLZ A;  2XBO 3;  1RUG 1;  1QJU 1;  1U5Z A;  1PX4 A;  4MVT A;  4AXO A;  4Y1Z A;  2G19 A;  2ZMN A;  3BCW A;  1MAC A;  4Q0Q A;  4S2F A;  1MZF A;  4MG2 A;  2VW0 A;  5C4W A;  2BRT A;  1GKB A;  5ABJ B;  4LA2 A;  1FAT A;  1W8T A;  4ZXE A;  2RDR A;  2YBP A;  5DAB A;  2TNF A;  5DZG A;  5I93 A;  5FYT A;  1J3Q A;  3HJR A;  4NPR A;  1ZBA 2;  4FP2 A;  4PI2 A;  3CO2 A;  1GZ9 A;  4YSF A;  2FDK A;  3IT8 A;  2JD9 A;  1ZZ6 A;  1IPK A;  3PUH A;  4BLJ A;  3K3N A;  3LIH A;  3R05 A;  1BEV 3;  2FBE A;  5JVV A;  4EN9 B;  3KVA A;  2PXJ A;  3T4H B;  3ZR6 A;  4LQR A;  4DQA A;  1GQH A;  1UY1 A;  4H3W A;  4L8Q A;  4AVB A;  2JEC A;  1ZA7 A;  2W2I A;  1O59 A;  1YO8 A;  3BTA A;  4BHP A;  3NV3 A;  3PUA A;  3MIC A;  3VD9 A;  2V73 A;  3OGR A;  4PIX A;  1CGP A;  1YFW A;  2R1B A;  2O8Q A;  1D7P M;  1R1A 1;  1LHN A;  3OGJ A;  4PLN A;  1FYU A;  4NHY A;  1AX1 A;  4H7M A;  5D8A B;  1FV2 A;  4K7J A;  2PLV 2;  2LS6 A;  3FL7 A;  5A6Q A;  4GMP 3;  1HRV 1;  3NJX A;  1W6P A;  2BDR A;  3AP6 A;  1S0B A;  3ZKY A;  3LDR A;  4BE3 A;  1KDM A;  2ZBJ A;  4ZZ5 A;  1PO2 2;  3SCH A;  5FYH A;  3D6E A;  3GBF A;  1Z7S 1;  3KMH A;  4RQP B;  3AB0 A;  3PIG A;  2KXL A;  1LTE A;  3B7M A;  5ACA 2;  2AUY A;  4Q1P A;  3O1P A;  4CUC A;  5A6Z A;  4LT5 A;  3DXT A;  1BKZ A;  3O0V A;  2ZGN A;  1DYP A;  2OYZ A;  2Q8E A;  1CAU A;  2RMU 2;  2CSG A;  5DXD A;  2W5F A;  4HON A;  4OHY A;  3L2H A;  1E5S A;  3CJI C;  4BB3 A;  2IVI B;  3J26 N;  4NRP A;  4X8P A;  5HBA A;  1YJK A;  4LIT A;  4YZ3 A;  4CDQ A;  3WUC A;  4COY A;  5GLW A;  1V9U 3;  1PO1 1;  1KDK A;  3OBT A;  4Q4V 2;  3RWN A;  5HI0 A;  1W03 A;  5I91 A;  1G9D A;  1Q5O A;  4Q2F A;  3GYD A;  1O5L A;  2DFB A;  4DY5 A;  3TBD A;  1JS9 A;  2A70 A;  1I5Z A;  2WIN B;  5F37 A;  2JDM A;  4D6R A;  1RUC 3;  2YB7 A;  3ZSE A;  3IAQ A;  2BEO A;  2HKX A;  2X29 A;  4XFA A;  5JZG A;  3UKN A;  4LXL A;  4LOS A;  3ELN A;  3W5M A;  4P5Y A;  5J7M A;  3EHK A;  3LSE A;  1PGL 2;  1GZC A;  1UZ0 A;  5FAX A;  2OA2 A;  4A3X A;  4CEW A;  4CP0 A;  3FLR A;  1W2N A;  3EO6 A;  1F2N A;  1MZ6 A;  4HKL A;  1JHN A;  3PTY A;  2WYF A;  3W21 A;  4YW7 A;  5BNP B;  3H8O A;  4AQ2 A;  3M4F A;  2VUC A;  4MH0 E;  3N3H A;  4QWN A;  2NN8 A;  3WHT A;  2WFF 3;  1W28 A;  2QQV A;  4M4R A;  4MGZ E;  2GC0 A;  3AP9 A;  2WNV B;  3B9I A;  3ILF A;  1MEC 2;  4GXL A;  1NZC A;  3RZG A;  1YXW A;  2DVG A;  1Q43 A;  2AZ5 A;  1VIW B;  4NMI A;  3EB7 A;  2ID4 A;  1RUI 1;  4KGQ A;  1XQN A;  2ZGS A;  4AI9 A;  3ZIW A;  3I2I A;  5BYN A;  2JX9 A;  2ZEX A;  2VQT A;  2DUQ A;  1YIF A;  2BGO A;  3IPV A;  3LEG A;  1UXZ A;  1O8S A;  4GH4 B;  2MEV 2;  4JAA A;  5FZG A;  2XJS A;  1Q8V A;  4PHZ A;  2XWB B;  1VBB 2;  5JXH A;  1IQA A;  4K1Y A;  4I0B A;  2JXA A;  1OVS A;  1VB2 A;  1UWW A;  4UF0 A;  1HXS 1;  1NA1 A;  1G9F A;  1K5M B;  2B9V A;  2QQI A;  4ASM B;  1S55 A;  1YQ2 A;  2VTX A;  4K20 A;  2R1D A;  2WZR 3;  4BIS A;  3KCC A;  2JE8 A;  2K9Z A;  2E7A A;  2QQW A;  2R30 A;  3Q8B A;  2VZS A;  2GN7 A;  2XJR A;  2QQN A;  3JZV A;  3F2Z A;  2HBU A;  4E8D A;  2Y6F A;  3SCG A;  4FPK A;  2YFZ A;  3ZYF A;  1AR7 3;  2VO5 A;  2VR4 A;  1NXD 1;  3I2J A;  4AK3 A;  1QXP A;  1XSQ A;  4BQX A;  3VBR C;  3WX5 A;  1ZZ7 A;  2UYA A;  3FFQ A;  4WZF A;  4IE6 A;  2HBT A;  3J8F 3;  4XF1 A;  1S0J A;  2FCT A;  2ZX1 A;  1WA4 A;  3I3E A;  4DB5 A;  4HPK B;  4FFH A;  3PJY A;  4IER A;  3K51 A;  4MOA A;  1A8M A;  4EWE A;  2W0X A;  3R4D B;  3Q8A A;  4BZ4 A;  3E5Q A;  5FLH A;  4YGB A;  1HQN A;  3MV0 1;  3TEX A;  3RYR A;  1CD3 G;  2DV9 A;  4YVS C;  3BAL A;  1SBF A;  5E6H A;  1LEN A;  5CIS A;  1BHG A;  1CIY A;  4XF9 A;  3VGI A;  4BQY A;  1WW7 A;  3ZYJ B;  4A44 A;  2XJQ A;  1YQ6 A;  3D4K A;  3PMS A;  1Y3T A;  2W39 A;  5LAT A;  4MLO A;  4N43 A;  4FAH A;  3O1V A;  2ET7 A;  1MQT B;  2DCZ A;  2PN5 A;  3D0S A;  4AHX A;  2ZGO A;  1OPO A;  1RVF 2;  2WAA A;  1ZZ9 A;  4HVQ A;  1CPN A;  4ATF A;  2VXR A;  1I3H A;  3N9P A;  3JBG 2;  4WM8 C;  2PLV 1;  4NJ4 A;  3NNM A;  1ZBE 3;  1HJF A;  2ENR A;  4Q5O A;  3VD3 A;  1DYK A;  4ZU5 A;  1ND2 B;  2IFR A;  3N9L A;  1PGW 2;  4FFF A;  1PO2 1;  2AEY A;  4CEY A;  2DUP A;  2YC0 A;  2ETE A;  4LBQ D;  1JZ4 A;  2ZKN A;  1NCR B;  2WQ4 A;  2DVF A;  2JIJ A;  3NQH A;  1RUH 3;  5I8Y A;  1X7N A;  3WIN E;  2PAK A;  3N9M A;  3OCP A;  4EN7 B;  1VAK A;  2QQL A;  2WO1 A;  4Q4W 1;  1XYO A;  2PYT A;  1SMV A;  1DZR A;  2WNU C;  2GNB A;  2ZGQ A;  2RMU 1;  4LOR A;  4GKY A;  4LKF A;  5FPV A;  4CUA A;  3KHC A;  4BYY A;  4N7I A;  2OXB A;  1Y9G A;  3AFK A;  4HZF A;  5D1I A;  1WW4 A;  5TSW A;  1D4M 2;  4YZ4 A;  4G4F A;  3I2O A;  2VL4 A;  4P9L A;  3NAP B;  3IMN A;  4Q4V 1;  5EIY B;  1MS4 A;  1LOF C;  1QJY 1;  1POV 1;  5FCC A;  1AXZ A;  3D8C A;  3H8X A;  5A70 A;  5BNN C;  2GZW A;  2VUJ A;  3AP7 A;  2P3K A;  2ZHN A;  4S2G A;  2EA7 A;  2GH8 A;  3KS7 A;  3VDA A;  4ARY A;  4EQV A;  4I2O A;  5CB7 A;  2WYS A;  1DDL A;  3VV1 A;  2NZ9 A;  2WAO A;  3AJZ A;  4IEY A;  1KGY A;  1NCQ C;  3HVD A;  1JZ5 A;  3RI9 A;  1J3P A;  3THD A;  3SXW A;  4I09 A;  2EXK A;  4RYD A;  2ZGP A;  1N3P A;  1OQE A;  1YYN A;  2ZGR A;  4M4P A;  3WOG A;  5CFC B;  2UWC A;  3LPG A;  4XUR A;  1CES A;  4CTE A;  4EN0 A;  3VHO A;  4YLZ A;  2ZTN A;  5L7O A;  2V5Y A;  2XUE A;  2GNT A;  2BNO A;  1ULP A;  2ADE A;  3UES A;  1RMU 2;  1RYY A;  4GJY A;  2ZZJ A;  3IBM A;  3WF0 A;  2Q4S A;  2QQK A;  5JI7 A;  1KFX L;  1VMF A;  4IGP A;  4MGQ A;  2PEL A;  4MV2 A;  4QPI A;  4Q4X 3;  3D0J A;  4XDQ A;  5I0U A;  4CCL A;  5DMY A;  4L97 A;  5L19 A;  1R09 3;  3CNA A;  1RUF 2;  3O7O A;  3H3Z A;  5FPB A;  3I2D A;  4WV8 A;  4XEZ A;  4NIA A;  3B94 A;  2HWB 2;  4Y4R A;  2MEV 1;  4IV1 B;  5EXO A;  4BIF A;  4K1Z A;  1VBB 1;  3PU3 A;  1EP0 A;  1CJD A;  1OHF A;  4AEJ A;  1J1L A;  2WWU A;  1AXY A;  5BNQ A;  2J1T A;  4YRD A;  2KA3 A;  4LK6 A;  5FXV A;  1FAY A;  3A0K A;  4WM7 C;  1BK1 A;  2VTF A;  3BU7 A;  4XIO A;  3VHP A;  4TXW A;  3MDP A;  4XVH A;  2IWG B;  3E5U A;  4Z92 B;  3RDI A;  3O1M A;  2HEW F;  1H8T B;  4HKO A;  4PDW A;  4YNI A;  1AR6 3;  3PUI A;  3OEB A;  1D0G A;  3KGL A;  2WSU A;  1RTV A;  2B45 X;  3ZYB A;  3B02 A;  1CAV A;  1PVC 1;  3PUR A;  1LES A;  2VD7 A;  4CP2 A;  4CCO A;  3ZFF C;  2CDO A;  3IM0 A;  1UYX A;  2DUO A;  2VNO A;  1BMV 2;  2VG9 A;  4GB3 3;  1WCD J;  1FNY A;  1DLC A;  3BI3 A;  3MI8 A;  1GZW B;  4OLL A;  2FMY A;  3USU B;  5C7G A;  5HV0 A;  2Y6J A;  5F9T A;  5LBB A;  4P9J A;  1WMX A;  1CWP A;  2VBB A;  3NJV A;  4MXW A;  3CHX A;  1W8O A;  4COZ A;  3OTF A;  1F4H A;  1PZ7 A;  1SCS A;  4YVW C;  3WF1 A;  3WEZ A;  5A3M A;  1U0A A;  4AI0 A;  1ENR A;  3K4Z A;  2E63 A;  5E1R A;  2NMN A;  3SKV A;  1FOD 2;  4YW3 A;  1O3Q A;  3ACG A;  5LA2 A;  5C4W B;  3O1S A;  5DUU A;  5M0T A;  2A3W A;  2FQP A;  5JXJ A;  2YZ4 A;  1W9W A;  3W9A A;  4DS0 A;  1UOB A;  4XHX A;  2GMP A;  1FV3 A;  5ABJ C;  1OD5 A;  3BPS A;  3UGF A;  4CU9 A;  4UAP A;  4B1L A;  4LO4 B;  1RVF 1;  1DZT A;  2OPK A;  4PF5 A;  3NNL A;  1DQ1 A;  3III A;  1IPJ A;  3JBG 1;  4XFG A;  2Q1M A;  3WHU A;  4L99 A;  5J36 A;  3JXS A;  2MNG A;  1S2K A;  2BUK A;  2Y64 A;  3MIB A;  5IVJ A;  1HN0 A;  2VMF A;  3V0B B;  3ZN4 A;  1PGW 1;  3N7M A;  4M3C E;  5FOJ B;  4PIZ A;  2VAU A;  1HDK A;  3BGA A;  5J1X A;  2EIE A;  2BNM A;  4ISR A;  3KCX A;  3VBH A;  1RUD 1;  2FDH A;  1JTZ X;  1C3H A;  3O0X A;  1JZ7 A;  5L9V A;  1EPW A;  3I2F A;  3OYW B;  1UKG A;  2DBI A;  5FO9 B;  4D0Q A;  3KV4 A;  4O7X A;  4UFK A;  2Q0A A;  1SFN A;  2F6B A;  1WGP A;  3OUI A;  3LPF A;  1L3J A;  1RHI 3;  3RQ0 A;  4AGG A;  3N7K A;  2NM1 A;  1GBG A;  2HWE 3;  2W92 A;  5JIA A;  3TNQ A;  1W6P B;  1W6Q A;  4BM8 A;  1W8Z A;  1M06 G;  5A3U A;  5GZD A;  1DGR A;  1D4M 1;  1TNR A;  3WNK A;  1WMD A;  2Z79 A;  5AC9 3;  5D8A C;  3LEK A;  1LU1 A;  4N9I A;  3HNY M;  3VHN A;  1ZZB A;  1COV 1;  2KR2 A;  1LOD A;  1BVV A;  5JOY A;  1GFF 2;  5E89 A;  5KWR A;  4H55 A;  2VNG A;  4ITC A;  4KMQ A;  1VBE 3;  1CAU B;  2GN3 A;  2J1A A;  3P3P A;  4W6Y A;  2FDF A;  4QQL A;  4AHW A;  1W3V A;  3OB8 A;  3QBQ A;  4HAN A;  2H0B A;  4CDQ B;  3ZSJ A;  2ZXQ A;  1LCL A;  4RHV 2;  1EV1 3;  4NHL A;  3OPW A;  5FZO B;  3DGT A;  1H0B A;  4DEQ A;  2XLA A;  1H6Y A;  1UQX A;  1POV 0;  2D6O X;  2Z5W A;  4AFM A;  1ZRR A;  2C9K A;  2JDH A;  3HN1 A;  4BA6 A;  3A23 A;  3VZK A;  1LB2 A;  1FPN 2;  2HEY F;  4P9X A;  1VE0 A;  5JZG B;  4YGC A;  4YGE A;  4WVZ A;  2JDU A;  3GZT B;  4DNY A;  1RUF 1;  5FZD A;  1QQP 2;  5F3E A;  1AYN 3;  4PQ9 A;  2SBA A;  2CTV A;  1CJP A;  1WBF A;  4QQ2 A;  4CEW B;  3WXP A;  5EP9 A;  1BBT 2;  4LBK A;  4LLF A;  3WQ1 A;  4LBN A;  2D5H A;  4QT6 A;  1L7R A;  3VDD A;  4DEV A;  4JGY A;  4QKN A;  2GU9 A;  1AVB A;  4AFB A;  5BNP C;  4XAB A;  3ACH A;  5LAS A;  1A34 A;  4Z8B A;  2C6S A;  2DCK A;  1VBA 2;  1Z0H A;  2ZHK A;  2RS5 1;  4PI0 A;  1IPS A;  3N7L A;  5DAV A;  4IXL A;  1HB2 A;  4MGI E;  1O3T A;  4FQ4 A;  3G6J B;  1QXJ A;  3B01 A;  4KWU A;  3T1L A;  4AWD A;  3IPV B;  1LJ7 A;  3C8X A;  1VP6 A;  3DYM A;  4GAL A;  3FZ3 A;  3BPZ A;  4P00 B;  1G6N A;  4H7L A;  3VZJ A;  2MPF A;  3FLT A;  5J37 A;  4GKX A;  4EWA A;  5BNO A;  2DVB A;  2N7G A;  1OOP C;  4XIL A;  4HKW A;  4EWD A;  1D2Q A;  4GH4 C;  1YUD A;  5FP3 A;  1PK6 A;  3AZY A;  2R04 3;  1LOC A;  4GQ7 A;  3H8U A;  1S0F A;  5I0S A;  4CCM A;  2JG9 B;  4UF0 B;  1IQD C;  1NA1 B;  2W91 A;  1ZVF A;  5EHD A;  3RS6 A;  3WR0 A;  4BQ2 A;  1H2L A;  1XU2 A;  5F2S A;  1OH4 A;  1WA6 X;  1JXN A;  3ETP A;  3I2H A;  4FOV A;  1TME 2;  2VW2 A;  4D3W A;  2CAU A;  1GP4 A;  1UZY A;  2VBD A;  1A6C A;  2WN2 A;  2VOW A;  1HKD A;  1K5M C;  4ES9 A;  3WD5 A;  3WLU A;  3WQB A;  2XH6 A;  1FOD 1;  4D7Y A;  5J09 A;  4E4D X;  1HRI 2;  3GF6 A;  4XDP A;  3VL8 A;  3VBO C;  1BK0 A;  1FX5 A;  1LUL A;  1QJU 2;  3OPT A;  5T5L A;  3RRD A;  1Q56 A;  4QPG A;  3I59 A;  2CU5 A;  1OI6 A;  1Q8P A;  4CP1 A;  3N9N A;  3UKT A;  2VQ0 A;  1UD1 A;  5C70 A;  5HXV A;  1YWK A;  5GM0 A;  5IVV A;  4WZC A;  4CXY A;  1YLL A;  5FMB A;  3POW A;  5CBL A;  1NOV A;  3U0Z A;  1LOE A;  3V0A A;  2CY6 A;  2WO3 A;  4LHS A;  2VZ3 A;  4ONU A;  5JI9 A;  4AZZ A;  2BP6 A;  5FZB A;  5CVR A;  1N1V A;  5JOZ A;  1K12 A;  5LEJ A;  2WRA A;  4MUV A;  1W2A X;  3ZYP A;  2HYK A;  1TG7 A;  2HJI A;  2WQZ C;  5IK4 A;  4XJ8 A;  2CGO A;  1UZW A;  4N43 B;  5DUW A;  5FBZ A;  5AVA A;  2FHR A;  2Q1Z B;  3FHA A;  3M3Q A;  5DG1 A;  4LE3 A;  3CF6 E;  2XGX A;  3POI A;  2WZ8 A;  3ACL A;  1H30 A;  1QNW A;  4R9C A;  3WNO A;  1SLT A;  5T52 A;  4ZPI A;  4LBM A;  2RDS A;  1VBC 2;  1HQL A;  1IG3 A;  4RS5 C;  5IVY A;  2GSY A;  3LA7 A;  1R1A 2;  5H9P A;  3B5L B;  4NVP A;  4LK7 A;  2E31 A;  2A7A A;  2W87 A;  5T3N A;  2DU1 A;  1JW6 A;  5CU1 A;  4CEY B;  5IAT A;  1QOS A;  2UWB A;  2Q8D A;  5I8T A;  2NYY A;  4JV4 A;  4J1X A;  4XUP A;  1HRV 2;  1WLT A;  2J22 A;  1RIN A;  1ND2 C;  2WR9 A;  3W20 A;  3C7O A;  4COU A;  5JDB A;  1W3X A;  1ZRC A;  2VCA A;  3AKQ A;  2OQ6 A;  4CCE A;  1NCR C;  2EAL A;  3LFI A;  1Z7S 2;  5KBF A;  2OUH A;  3RYK A;  1OUS A;  2XUM A;  5C3P A;  4AE2 A;  3LGR A;  2JB4 A;  5FUN A;  1ACC A;  3ZIX A;  3ZFE C;  2IZW A;  1JYC A;  2B39 A;  2RVA A;  4BDV B;  1CR7 A;  3AZZ A;  1Q8O A;  4AVS A;  4RHV 1;  3EMR A;  4RR3 A;  1PIV 2;  4YWA A;  5LBE A;  4F7Z A;  1AJO A;  2ORZ A;  2W3J A;  4MGS A;  4X6R B;  5IYY A;  5IFP A;  4QB2 A;  5F3G A;  1TVG A;  1ZRD A;  3A22 A;  2PQQ A;  1DYO A;  2XBO 2;  3P5B A;  4IV3 A;  1MS3 A;  1NZI A;  2HEV F;  5T55 A;  2QQM A;  4AI1 A;  1XE7 A;  2GME A;  5CYY A;  5EJ3 A;  3U11 A;  3AX4 A;  1EUT A;  1FPN 1;  4AF9 A;  3PNA A;  5C3S A;  4Z82 A;  2XHN A;  3RZJ A;  4AI8 A;  3I49 A;  2CL2 A;  2EID A;  1OC1 A;  1BXH A;  4DXS A;  3CLP A;  2JDY A;  2CDP A;  3J7M A;  4AFA A;  2VGD A;  4AQS A;  2DCT A;  4W6X A;  3M8L A;  1BBT 1;  3QH7 A;  1LOB A;  4LO8 A;  3UGH A;  4B8E A;  5ERL A;  1C8N A;  3PVE A;  1IGO A;  4XCB A;  1C57 A;  5A3P A;  3WDY A;  4Y22 A;  5FZ0 A;  3VD5 A;  5K7P A;  1C28 A;  1RIT A;  5CFC C;  3VBS A;  4QM8 A;  1DGW X;  1U5X A;  1B09 A;  4OQ8 A;  2MHF A;  2W1S A;  3ACI A;  4TYS A;  2O1Q A;  5A1F A;  2BVB A;  3ON7 A;  5BV6 A;  2FDG A;  1ASJ 3;  3U1X A;  1QWR A;  1ULC A;  1VBA 1;  1QY4 A;  4DXR A;  2B5H A;  4JVA A;  5CZK A;  5FZF A;  1HV0 A;  4P14 A;  4Y5T A;  4XF0 A;  1CX1 A;  1RJ7 A;  3I97 A;  4I0W B;  2UY8 A;  4J25 A;  1WW6 A;  4NII A;  4BQ3 A;  3BTY A;  3OF1 A;  4OI2 A;  1URX A;  5FMO L;  5FZA A;  3KZ4 C;  2DTY A;  4XBN A;  3S7E A;  2G4I A;  4CPB A;  3UT0 A;  2ZEW A;  4IV1 C;  5BUV A;  2UUR A;  3ZSM A;  3FMG A;  1SLL A;  3AMN A;  4TZD A;  3ALQ A;  2GP5 A;  4IND A;  3WF3 A;  2RM2 3;  2VEC A;  1QMJ A;  2YPJ A;  2Q8O A;  4XMI A;  4AFC A;  1TME 1;  3ZR5 A;  4IW3 A;  4LIV A;  4PDW B;  3OPZ A;  4MXV A;  1NG0 A;  1SDD B;  3TN9 3;  3GHM A;  5I8S A;  1RXG A;  1CAV B;  3USS A;  4AVT A;  1OFS A;  1CZV A;  1H8T C;  4SLI A;  4OFG A;  4E2S A;  2BW8 A;  5J98 B;  1W05 A;  1MZ5 A;  3P3N A;  1CAX A;  2FD8 A;  1HQW A;  1ZNP A;  1PGS A;  1YI9 A;  2WUH A;  2EIC A;  4LO5 B;  3N9O A;  2DWR A;  3RZZ A;  5FP7 A;  4CDX A;  1V9U 2;  4P5H A;  4R9D A;  1ZRE A;  5FLJ A;  1NXM A;  1FMD 3;  2PQS A;  4MXW B;  5G04 L;  1R1Z A;  1T6B X;  3HNB M;  3OEA A;  4XF4 A;  2FMD A;  4BK4 A;  3NL1 A;  1UIJ A;  1T2X A;  3LAG A;  4MZU A;  4IQP A;  2Y34 A;  4JRA A;  2RS3 3;  1NAE A;  1RUC 2;  4NE9 A;  3VN4 A;  3U14 A;  4J1W A;  2XKO A;  3JUU A;  2ERF A;  5EWS A;  2QVS B;  3E6D A;  5C9A C;  3NV2 A;  4MO3 M;  4BQ5 A;  3MLJ A;  5AFB A;  1IG0 A;  1LHU A;  3WG1 A;  4AGV A;  2ILM A;  2P3I A;  4L11 A;  4B4P A;  4AED A;  4D6S A;  5C33 A;  4FSJ A;  3WP3 A;  1X33 A;  4HG6 B;  4YM1 A;  1XRU A;  2DF7 A;  2OZ6 A;  2K2S A;  5JSR A;  3A0N A;  1ZZC A;  2E53 A;  4Y5S A;  1QJF A;  5T5P A;  4CXX A;  3NNF A;  4XXA A;  2QUO A;  1VBC 1;  3PVB B;  4QMA A;  1CAW A;  4FXG B;  2W1U A;  4FTS A;  2D3R A;  1W0O A;  1SBE A;  1GWL A;  3LA2 A;  2OQ7 A;  3AYD A;  2PA7 A;  1WKY A;  2BQP A;  2D97 A;  3LZZ A;  4W8J A;  1A8D A;  1KFU L;  4LKE A;  4FPF A;  4P02 B;  5CAD A;  1DQ6 A;  2VUD A;  1FNZ A;  1AR8 3;  1CQ9 A;  3QH6 A;  3VHR A;  2YV8 A;  3FUQ A;  2Y60 A;  2A6V A;  2GAL A;  2H6C A;  1VMJ A;  2WWS A;  1W6Q B;  2VTX J;  2Y0I A;  2I74 A;  4Q4W 2;  4AHZ A;  2ZML A;  4EZ4 A;  1AL2 1;  2C0Z A;  5HXM A;  4I02 A;  3ZDV A;  1CN1 A;  4Z1V A;  4QX1 A;  1PIV 1;  2C24 A;  2ATF A;  2DDU A;  1W9F A;  4FPE A;  4MGT A;  3IIA A;  1SFP A;  2D98 A;  2ARE A;  3RI8 A;  2VOV A;  4FQZ A;  5FMD A;  3CJI A;  3LEI A;  4DRR A;  4OZX A;  3IZO A;  4UBH A;  2XBO 1;  1C1L A;  1AX0 A;  1ULG A;  4BMB A;  2VZV A;  2GDF A;  2WZR 2;  2WZE A;  3E1F 1;  1QJY 2;  2RE9 A;  4IEO A;  2QDR A;  1AYM 3;  1ULD A;  2JKX A;  4BLI A;  4F83 A;  5KHJ A;  4M3C A;  1QEX A;  1LHW A;  4FBF A;  4Q0V A;  5FYC A;  4N53 C;  1H2K A;  1RUE 3;  4KL1 A;  2JE9 A;  2YBS A;  4GWJ A;  4R4X A;  4ZS2 A;  3T3Y A;  3VKF C;  1W9Y A;  4YGD A;  3PDQ A;  4BXS V;  1UMZ A;  2R0H A;  3KD4 A;  2IVJ A;  3J8F 2;  4TN7 A;  4CDQ C;  3AYE A;  2I2S A;  2WT2 A;  1US3 A;  4XAC A;  4LBO A;  4KWK A;  2QFE A;  3ZYI B;  2BVV A;  5CKM A;  1W6N A;  3MLL A;  4YW1 A;  3VD7 A;  4RFR B;  3WUD A;  1BEV 1;  4SBV A;  2RR1 3;  4CYD A;  1E5I A;  2CWM A;  3KB5 A;  5EFU A;  1LOA A;  1GOF A;  3BB6 A;  5DDJ 3;  2Z69 A;  2RDN A;  1ZBA 3;  5FPA A;  4WVM A;  4OMD A;  4A7Y A;  1QJE A;  2X10 A;  4CDU C;  4IES A;  5JZG C;  3FHQ A;  4IEP A;  3WF2 A;  2VZQ A;  5FZ3 A;  3UV9 A;  1UYZ A;  2XL9 A;  1WLW A;  2XON A;  3T2O A;  4AL9 A;  5B2G B;  3R6S A;  2RG4 A;  5FJK A;  3T0B A;  3VDD B;  3ENR A;  2AYH A;  4JGY B;  2G9G A;  1EAH 3;  4GMP 1;  1ZBE 2;  3FWE A;  1YHF A;  4HOO A;  2OII A;  1VRH 3;  4JQT A;  4Y1X A;  1OA4 A;  2BGC A;  4AG4 A;  1XYP A;  3OSD A;  1NYW A;  2NMO A;  3FUO A;  4YM2 A;  5A3W A;  3VUO A;  2WT0 A;  1A78 A;  4MGY E;  4QX3 A;  1RUH 2;  3ZFG C;  4ATE A;  4AW7 A;  4AI2 A;  4MAD A;  4Z07 A;  2R06 3;  5ANQ A;  2CYF A;  4QQH A;  4XAA A;  5FWJ A;  3T09 A;  3GZE A;  1UPI A;  2RJ2 A;  4W50 A;  1QJZ A;  5GZG A;  2Y6L A;  4H14 A;  1E57 A;  3W59 A;  5FYY A;  1JOB A;  2BER A;  1PVC 2;  2WNE A;  3WDT A;  1PK6 B;  1PZ9 A;  2V4A A;  4FI9 A;  4AI3 A;  2A3X A;  5F2W A;  5ACA 3;  1KIT A;  1N1Y A;  2VJX A;  4QQP A;  1V9U 1;  3HEI A;  1UL9 A;  1XNA A;  2A6X A;  4JHT A;  1GWM A;  5DUV A;  2JKB A;  4JX0 A;  2A6Y A;  1YQ8 A;  3JD7 3;  3K77 A;  5IVB A;  4QAW A;  2JG9 C;  1TNF A;  1W06 A;  3FLP A;  4OHW A;  1SPP A;  3GGL A;  2LAL A;  4URA A;  1RUC 1;  3OGV A;  2ZJC A;  4F3J A;  2RDQ A;  2ZAB A;  3HQR A;  1V6N A;  4L92 A;  1UYP A;  2VCM A;  2W9X A;  3TYJ A;  4IEQ A;  3NKG A;  4JHZ A;  3W58 A;  5A7O A;  4AAP A;  4QHO A;  1PHM A;  3ZMN A;  1V6J A;  3A4U A;  4QX7 A;  4WVW A;  4QPG B;  5IAX A;  3SMH A;  1W99 A;  5F5C A;  3WG2 A;  3I59 B;  3KF3 A;  3ES1 A;  3O1R A;  4PBO A;  2JE7 A;  4YVS A;  3P1I A;  4HSJ A;  5F6L B;  5L9B A;  2ORX A;  2IXJ A;  4O9G A;  1MPX A;  3ZXE A;  5C3Q A;  2X5I C;  1POQ A;  4COW A;  3JU9 A;  1GMM A;  3V0A B;  1AUY A;  3DEM A;  4MYE A;  2P2K A;  3BOD A;  3SQO A;  2WFF 1;  2VW1 A;  2XQX A;  4GWM A;  4YG6 A;  5GZC A;  5JMC A;  3MIE A;  2XQR A;  3NST A;  4Q4X 2;  2RS1 3;  2AH2 A;  4FPH A;  2QKD A;  2ZAH A;  3H1W A;  1GAN A;  3FE5 A;  3WNN A;  5A7W A;  1ULF A;  1H2N A;  4LUL A;  4X8N A;  2X05 A;  2CHH A;  1RUD 2;  3LWC A;  3MW4 A;  1X50 A;  2EAK A;  2VH9 A;  3DL3 A;  3ZO0 B;  1NT0 A;  3WF4 A;  2ZX0 A;  3H0O A;  2VQU A;  4XZU G;  2AAC A;  2XB6 C;  3ZSK A;  2OPW A;  1AR9 3;  1SG3 A;  2UU8 A;  1SLI A;  5FYU A;  2B7Y A;  1B35 A;  4FOQ A;  1Y4W A;  1QJX 3;  1WCK A;  5DUX A;  3RJ2 X;  3ZYG A;  5GLV A;  1W39 A;  3GXU A;  4CEY C;  2DYC A;  5FRE A;  3MYX A;  1AXK A;  2WZR 1;  2ADD A;  4URT A;  5K8S A;  1AR6 2;  1GOG A;  1PVX A;  4LIU A;  1REE A;  2VQA A;  4UOJ A;  1COV 2;  1LOF A;  3IDA A;  3SH5 A;  1DU3 D;  4CU6 A;  2FDI A;  1V6L A;  1MVQ A;  3MEP A;  4RGG A;  3QOP A;  3FJS A;  1J59 A;  2PFW A;  2J1V A;  3K46 A;  4GB3 2;  2PHF A;  4HK8 A;  1AR7 1;  2J1E A;  5BPX A;  4UWD A;  3R0R A;  1J3R A;  3HQX A;  4XFF A;  3EBR A;  1RED A;  5CFD A;  1NE6 A;  2ES3 A;  1T6G C;  3CZU A;  3J8F 1;  5EV7 A;  4LUM A;  5JWP A;  3WQ0 A;  1GOH A;  1F5F A;  4MSV A;  3AYA A;  1ENQ A;  1G86 A;  4IV3 B;  3AYC A;  5HCH A;  4HFS A;  3ZM8 A;  4RSU A;  3BVC A;  2JDA A;  5FYS A;  4AVC A;  1IKQ A;  4UYB A;  4OHZ A;  2VC9 A;  3GBG A;  4XFB A;  1PZ8 A;  4KWJ A;  4FOW A;  1TEI A;  1PM7 A;  2G1M A;  4CCC A;  4KBZ A;  5DPN A;  2A6W A;  1TZO A;  3IKW A;  4BWO A;  4EN6 B;  4DZG A;  3SH3 A;  3ROU A;  3N36 A;  2Z4F A;  4YW2 A;  3UK9 A;  2WA3 A;  2TEP A;  3ZX7 A;  4XZP A;  5CNA A;  4C90 A;  2GAU A;  2BGP A;  2JJ6 A;  2QBX A;  4HSL A;  4Y22 B;  2VOT A;  3WV6 A;  1VPH A;  1ZBE 1;  3VBS B;  4Q0P A;  5JSO A;  4YPJ A;  2IC1 A;  1DZQ A;  1ZX5 A;  3ZN6 A;  5FZC A;  3ZXJ A;  1IHM A;  4QDR A;  2WBK A;  1OT5 A;  5F5Q A;  2J1U A;  5FYI A;  4DUV A;  1RUH 1;  4V1P A;  3C7H A;  4KG0 A;  1JUI A;  1WWY A;  3P6B A;  1GWK A;  2B9U A;  1W9S A;  5EJ1 B;  4CDW A;  2Y33 A;  4CE8 A;  3FBM A;  2NP0 A;  1RHI 2;  4UW3 A;  1C5I A;  2RS5 2;  4M3C F;  1LNS A;  1N47 A;  4ZZ8 A;  2EIB A;  2J42 A;  3Q8E A;  4HT1 T;  3BTX A;  2HWE 2;  2WC2 A;  4E4S A;  4KGG A;  4GMP 0;  2I45 A;  5AC9 2;  3ZFF A;  1SHW B;  1JI6 A;  3V56 A;  2HWD 3;  1X8M A;  1YQC A;  2GC2 A;  4I3P A;  4UXA A;  4DUW A;  3HR9 A;  2QCS B;  1KS5 A;  2LW8 A;  4HET A;  1VBE 2;  2A1X A;  4PDW C;  4UW5 A;  3VD4 A;  2HWF 3;  1X36 A;  5SV5 A;  1FT9 A;  5GLU A;  3WG4 A;  1XE0 A;  1CAX B;  2J7M A;  3BOW A;  5SV8 A;  4CXW A;  1DHK B;  2YG0 A;  1JN2 P;  1H8V A;  3M7A A;  2WKK A;  2JIG A;  4B29 A;  1LR5 A;  2P1B A;  3KQ4 B;  4QDS A;  5LRR A;  4AVV A;  4FCA A;  5C3R A;  5FY1 A;  3TEZ A;  1EV1 2;  4CDX B;  5A6Y A;  3LD8 A;  1E5H A;  5FO7 B;  4A42 A;  2JDZ A;  1KJL A;  2GH2 A;  4NUB A;  4IEX A;  2W08 A;  2YYO A;  1OPM A;  5H9Q A;  5CEH A;  3N4M A;  2ZGU A;  2CGN A;  2D44 A;  3I3B A;  4Y3O A;  4XOG A;  1H1A A;  3A21 A;  2XPJ A;  1GSL A;  3POJ A;  4Q4X 1;  4XJW A;  1R09 1;  4N90 A;  3AZV A;  3PL0 A;  1UPS A;  4AED B;  4XJZ A;  1UX7 A;  1AYN 2;  1JZ8 A;  5FJH A;  3RNS A;  3KQR A;  2L9L A;  2OS2 A;  2D40 A;  3OOX A;  4CSW A;  3MLK A;  3MGU A;  1RMU 3;  3M70 A;  5F39 A;  2DTW A;  4NN0 A;  5FDB A;  5IFT A;  1MS5 A;  4RGA A;  2RJL A;  3OD0 A;  4K9S A;  1OMI A;  1CAW B;  3ZYR A;  5FZL A;  1JZ3 A;  5FR3 A;  1BCX A;  3H1M A;  1QGL A;  3MBW A;  4UI9 L;  3S57 A;  4Q8K A;  3ORJ A;  5IAV A;  3DUI A;  3CIH A;  2HWB 3;  4FPY A; 
#chains in the Genus database with same CATH homology
 4ET7 A;  2LS6 A;  2QQJ A;  2HYX A;  3FL7 A;  3NJX A;  2VZ1 A;  4XUP A;  2J22 A;  3C7O A;  4ZZ5 A;  2VCA A;  4JKL A;  5EJZ B;  2WAB A;  4L0P A;  3SEE A;  3VDC A;  4CUC A;  3THC A;  1UMH A;  2WN3 A;  5LCW L;  2RVA A;  4PF1 A;  3GM8 A;  4BDV B;  2W5F A;  2ORZ A;  2W3J A;  1ULO A;  1W0N A;  4PQQ A;  1NKG A;  4MGS A;  5IYY A;  5IFP A;  4D8M A;  4QB2 A;  3CKH A;  1NX9 A;  1TVG A;  1I5P A;  2VMC A;  3A22 A;  1DYO A;  1K3I A;  2QQM A;  5CYY A;  1UYY A;  1EUT A;  2R7E B;  5IJR A;  1J84 A;  2XHN A;  5DN2 A;  2YB7 A;  1JU3 A;  3IAQ A;  2EID A;  3HPN A;  4DXS A;  2CDP A;  3W5M A;  4P5Y A;  4GWI A;  1UY3 A;  1UXX X;  1UZ0 A;  2VZO A;  5B4X A;  2E33 A;  3VD5 A;  1PMH X;  4CU8 A;  2W1S A;  3ACI A;  3HOB A;  4DXR A;  4M4R A;  5CZK A;  3OG2 A;  1CX1 A;  3I97 A;  3ECQ A;  3UET A;  3EB7 A;  3LE0 A;  2ID4 A;  4ARX A;  2C26 A;  3I2I A;  4IUG A;  2ZEX A;  2VQT A;  3LEG A;  2BGO A;  1UXZ A;  1O8S A;  3CMG A;  1W8N A;  2ZEW A;  5JXH A;  3WF3 A;  4A6O A;  1K45 A;  1UWW A;  1SDD B;  3J7H A;  2B9V A;  2QQI A;  1YQ2 A;  5LA0 A;  2W95 A;  2RV9 A;  1CZV A;  1EUU A;  3MO4 A;  2JE8 A;  1JU4 A;  3MV1 1;  4W4Z A;  2VZS A;  2QQN A;  3WNL A;  1R64 A;  2ZEZ A;  3F2Z A;  2WUH A;  2EIC A;  3T2P A;  4E8D A;  2YFZ A;  2VO5 A;  2VR4 A;  4P08 A;  2PQS A;  3I2J A;  1OF4 A;  5G04 L;  3HNB M;  1GUI A;  3OEA A;  4LKS A;  1WCQ A;  3MUY 1;  2QQO A;  4BK4 A;  1T2X A;  3I3E A;  2VZU A;  1NAE A;  3WSO A;  3ACF A;  4MOA A;  3DEC A;  3IB3 A;  4MO3 M;  3MUZ 1;  1JYN A;  3MV0 1;  5I0D A;  1K42 A;  4LPL A;  4HG6 B;  1BHG A;  1CIY A;  4A44 A;  2Y8K A;  2VME A;  5HPO A;  2WAA A;  2W1U A;  3HN3 A;  1HN1 A;  3VD3 A;  3NRU A;  1US2 A;  1WKY A;  2J1S A;  4AAX A;  2DCJ A;  4W8J A;  3SKJ E;  3NQH A;  4P02 B;  2QQL A;  2WO1 A;  3VDB A;  1L7Q A;  5JXG A;  5HXM A;  4CUA A;  5B4N A;  4QX1 A;  3WNM A;  2DDU A;  2V72 A;  4OMC A;  4CUB A;  1GQP A;  3LEI A;  3WNP A;  4DXT A;  2VL4 A;  3DYO A;  5EIY B;  2VZV A;  2WZE A;  3E1F 1;  1XC6 A;  4ARY A;  2W1Q A;  3VDA A;  3K4A A;  2JKX A;  2WYS A;  3BN6 A;  2WAO A;  1KGY A;  4GWJ A;  4BK5 A;  1JZ5 A;  3THD A;  4BXS V;  4RYD A;  1PMJ X;  1US3 A;  2KD7 A;  2YC4 A;  4M4P A;  2V4V A;  2E32 A;  3LPG A;  4XUR A;  3VD7 A;  4XUQ A;  2OKX A;  2Y6G A;  1ULP A;  3UES A;  1RYY A;  3WF0 A;  4CVU A;  1GOF A;  2QQK A;  3UNP A;  4OMD A;  4MGQ A;  3C7E A;  2X10 A;  5DMY A;  3FHQ A;  1CZS A;  3WF2 A;  2VZQ A;  2VCB A;  1DP0 A;  2J1R A;  1UYZ A;  1XNT A;  1F4A A;  2XON A;  3T2O A;  3GDB A;  2X09 A;  3T0B A;  1J83 A;  1UY2 A;  4AG4 A;  1P8J A;  4QX2 A;  2J1T A;  4QX3 A;  4A45 A;  1JYW A;  5FUI A;  2VTF A;  4MAD A;  4TXW A;  4XVH A;  2VZR A;  1JYV A;  4XUN A;  3T09 A;  4QB1 A;  3PUI A;  3OEB A;  2RJ2 A;  4W50 A;  3ABZ A;  2Y6L A;  2Y6H A;  2BER A;  5DQ0 A;  4FI9 A;  5JMO A;  2CDO A;  2VJX A;  1UYX A;  3HEI A;  1XNA A;  2BBA A;  4GZ9 A;  1DLC A;  4JX0 A;  3T0A A;  4QPW A;  5C7G A;  3K77 A;  2Y6J A;  3T2Q A;  5JR2 A;  4QAW A;  3GGL A;  2VM9 A;  3NJV A;  3OGV A;  1W8O A;  2C4X A;  3HNM A;  1F4H A;  4E8C A;  2W9X A;  3WF1 A;  3WEZ A;  4JHZ A;  3K4Z A;  3SKV A;  3SEP A;  5A1A A;  3ACG A;  5LA2 A;  3C7G A;  1UY4 A;  1W99 A;  3I3D A;  4Z2A A;  3P1I A;  5JXJ A;  1W9W A;  2ORX A;  1MPX A;  5G05 L;  4JKK A;  4CU9 A;  4UAP A;  1NUK A;  2W94 A;  1GMM A;  2V5D A;  3IAP A;  3III A;  1JZ6 A;  2W46 A;  3D3A A;  3JXS A;  2Y64 A;  2XQX A;  4TTG A;  4ZY9 A;  1H6X A;  2VMF A;  4A41 A;  1UMI A;  3BGA A;  3CZJ A;  5J1X A;  3WNN A;  2EIE A;  1GU3 A;  1W9T A;  2X05 A;  1JZ7 A;  1JYX A;  3I2F A;  5LA1 A;  4D0Q A;  3I2K A;  2WO2 A;  3WF4 A;  2VQU A;  3LPF A;  4XZU G;  3W5N A;  1SG3 A;  2W92 A;  3GXU A;  3WNK A;  3C7F A;  4KI5 M;  3LEK A;  3HNY M;  3T08 A;  1GOG A;  2VZT A;  4UOJ A;  3EYP A;  3IDA A;  4CU6 A;  2HLE A;  4OZO A;  4KMQ A;  2J1V A;  2J1A A;  3K46 A;  2VMD A;  2VCC A;  2J1E A;  3OB8 A;  2ZEY A;  2WQ8 A;  3CZU A;  2B4K A;  4XUO A;  4XUT A;  2ZXQ A;  1GOH A;  3OBA A;  1OD3 A;  3ZM8 A;  4DEQ A;  1JZ2 A;  1H6Y A;  2JDA A;  2VZP A;  3CQO A;  5IHR A;  2VC9 A;  2C9K A;  3A23 A;  4DUX A;  3K4D A;  3T0D A;  3A7Q A;  3I2G A;  5DPN A;  3LQC A;  2Z4F A;  4A3Z A;  3FN9 A;  2BGP A;  2QBX A;  2YFU A;  4QDQ A;  1O8P A;  2VOT A;  4YPJ A;  4QB6 A;  1L7R A;  4DEV A;  4OUE A;  4QDR A;  2WBK A;  1OT5 A;  2J1U A;  4DUV A;  5F7U A;  5JUV A;  3C7H A;  1CZT A;  3P6B A;  3ACH A;  2WDB A;  1W9S A;  5EJ1 B;  2DCK A;  4QX0 A;  3K75 B;  1LNS A;  4ZZ8 A;  2EIB A;  4KWU A;  3DYM A;  3C8X A;  3CDZ B;  4P00 B;  4A4A A;  4PT6 A;  3NNG A;  2BZD A;  3DYP A;  1SHW B;  1JI6 A;  3AC0 A;  1GNY A;  1IQD C;  4DUW A;  2W91 A;  2LW8 A;  2W47 A;  1OH4 A;  3ETP A;  3I2H A;  3U37 A;  3VD4 A;  1PX3 A;  2WN2 A;  4CU7 A;  2J7M A;  4BJ0 A;  2YG0 A;  3WQB A;  4QDS A;  3OGS A;  1PX4 A;  4A42 A;  1KEX A;  4ZXE A;  5C70 A;  3I3B A;  3A21 A;  1JHJ A;  3HJR A;  2WO3 A;  4LHS A;  2VZ3 A;  2YC2 A;  4RN5 A;  1UX7 A;  2JD9 A;  5JXI A;  1JZ8 A;  1K12 A;  3PUH A;  2L9L A;  1TG7 A;  2W87 A;  5C71 A;  2W1W A;  1UY0 A;  5IFT A;  4LQR A;  1OF3 A;  1UY1 A;  3FHA A;  1XPW A;  2Y6K A;  1O59 A;  2WZ8 A;  1JZ3 A;  3VD9 A;  3OGR A;  4JKM A;  3WNO A;  2XOM A;  4OYU A;  3MBW A;  4UI9 L;  2E26 A;  1D7P M;  3CIH A;  1JZ4 A;  2E31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...