1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
molecule keywords putative xylanase
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
2W92A 2E33A 3WF1A 4AAXA 1GQPA 4P02B 3VD9A 2ORXA 2QQLA 2WYSA 4ARYA 2WO3A 1UMHA 4XUNA 4ZY9A 4E8DA 5JXJA 2BZDA 4KI5M 4RN5A 4BK4A 3LE0A 2RVAA 2Y6JA 4XUQA 4CU8A 1K45A 3GXUA 1KEXA 1L7RA 3VD5A 1W99A 2BBAA 4QX1A 3FL7A 1CX1A 4BK5A 1PX3A 3I3BA 3MUY1 4UOJA 4DUXA 2JD9A 3ECQA 4HG6B 4MADA 1SG3A 3ACGA 3OBAA 4GWIA 2YB7A 3EYPA 4TTGA 1DYOA 1XC6A 3I2FA 1JZ2A 3HNYM 4QB6A 4QX0A 3I2HA 5LA2A 3JXSA 4CU7A 1R64A 3PUIA 1OD3A 1J83A 4BDVB 1GUIA 2VCCA 4LHSA 2JE8A 5FUIA 1TVGA 5JMOA 5B4XA 2W46A 2L9LA 1UMIA 2V4VA 1GOHA 2BERA 4P00B 4ZXEA 1O8PA 2Z4FA 3WNMA 1JZ3A 4XVHA 1F4AA 2WAOA 2X10A 3IIIA 3C7OA 1ULPA 3DYMA 1H6YA 3CQOA 3LQCA 4MGSA 3I2JA 2YG0A 5IJRA 2QQMA 3A7QA 2W5FA 4A4AA 1K3IA 1JYNA 3WF0A 3C7GA 2BGPA 3CZJA 4DUVA 2HYXA 4IUGA 5JXHA 4GZ9A 3T09A 1UWWA 2OKXA 4XUOA 4DEQA 4A44A 1JI6A 3LEKA 1XPWA 1UY4A 1DLCA 4XUTA 1W8NA 1DP0A 5IYYA 1LNSA 4XUPA 3FHQA 2VQUA 3WQBA 2ZEXA 4TXWA 2VL4A 3I97A 1JU3A 2WZEA 2XHNA 4W8JA 2QQKA 2DDUA 5I0DA 2E32A 2J1EA 2CDOA 2W91A 3WF2A 3MV11 2W3JA 3OEAA 4W50A 1CIYA 4ZZ8A 4QX3A 2DCKA 1O8SA 1UYZA 3WNLA 4CVUA 2E31A 3VD3A 1UXZA 1K42A 2Y6HA 1US3A 1JYWA 4GWJA 4BXSV 3HN3A 2VC9A 3THDA 1GNYA 3UESA 1W8OA 5DN2A 4LKSA 3C7FA 2J1RA 1OH4A 3T08A 1L7QA 1W9WA 2VZ1A 2C26A 3DYOA 4QDQA 3T0DA 4QDSA 1MPXA 2EIEA 2ORZA 4PT6A 2QQOA 2W9XA 3OEBA 4CUBA 3I2KA 4Z2AA 1IQDC 3VD4A 5HPOA 4AG4A 5C71A 1H6XA 1JZ6A 2W1SA 1W9TA 4P5YA 1SHWB 1I5PA 4OMDA 3IAPA 4MGQA 1PMHX 3FHAA 1WKYA 2E26A 1JZ5A 4ARXA 2VOTA 3VDCA 3NQHA 3OB8A 2V72A 3A22A 5CZKA 4L0PA 3ACFA 1UYYA 3ETPA 3HNBM 2R7EB 3BGAA 2X09A 4XURA 4KMQA 4A6OA 2XOMA 3UNPA 1PMJX 5IHRA 3BN6A 2W1UA 3HPNA 5JR2A 4JKKA 1YQ2A 2QBXA 1K12A 2Y64A 3UETA 1XNTA 3MUZ1 2XONA 3SEPA 3VDAA 4M4RA 2VO5A 3WF4A 2LW8A 4D8MA 5C7GA 2VZUA 3LPGA 5DPNA 2W87A 3CKHA 4W4ZA 2J7MA 2W47A 4RYDA 4QDRA 5CYYA 3WNPA 2C9KA 2VQTA 2WUHA 4CU6A 3WNKA 2B9VA 5G05L 1BHGA 1F4HA 3DYPA 1SDDB 1JZ4A 1GMMA 4MOAA 2VCAA 3SEEA 2QQJA 1UZ0A 4JKLA 3P6BA 2VZVA 4JHZA 3E1F1 4YPJA 3WNOA 5LA0A 3GDBA 2C4XA 3IAQA 4QAWA 1CZTA 1OF4A 2VTFA 4LPLA 1EUUA 2Y8KA 4PQQA 1UY2A 4OZOA 2YFUA 3OGSA 1GU3A 2WBKA 2Y6GA 3HNMA 3MO4A 2V5DA 4CUCA 1UY3A 2LS6A 2VMDA 2BGOA 1GOGA 2EICA 4QX2A 3ZM8A 3CIHA 2YC2A 4CUAA 4A45A 3WNNA 3K4DA 4DXSA 4ZZ5A 5DMYA 3VDBA 2RV9A 5JXIA 3ABZA 3K4ZA 2EIDA 2W1WA 2ZXQA 3T0AA 3U37A 1J84A 2EIBA 4DXTA 3OGRA 5EIYB 3CZUA 3C7HA 4A41A 1P8JA 3T2QA 1UY0A 3LEIA 3GM8A 1OT5A 5HXMA 3GGLA 3IB3A 5EJ1B 3NJVA 2J1SA 3F2ZA 2VZ3A 3T0BA 2ID4A 5IFPA 2J1VA 3WSOA 4D0QA 2VM9A 2VZPA 5JXGA 3NNGA 3NRUA 1OF3A 1JYXA 5EJZB 3LEGA 4A3ZA 4QB1A 2J1AA 2XQXA 3DECA 2YFZA 4KWUA 4FI9A 2VMCA 3MBWA 1NAEA 2HLEA 3OG2A 1JU4A 3AC0A 2JDAA 1KGYA 4CU9A 4QB2A 3C7EA 1WCQA 1RYYA 2WO1A 1JYVA 4OYUA 3SKJE 3NJXA 3SKVA 3I3EA 3OGVA 5LA1A 4JKMA 4OMCA 4PF1A 3ACHA 3HJRA 2VCBA 3K75B 4M4PA 1JZ8A 1D7PM 3I3DA 4LQRA 3W5MA 2DCJA 1HN1A 4JX0A 2CDPA 1W0NA 3WF3A 3P1IA 3K46A 3T2PA 2QQIA 3HEIA 4QPWA 1JHJA 2VMEA 2W1QA 4DEVA 5F7UA 2WN3A 1O59A 3VD7A 4A42A 3W5NA 1ULOA 2ZEWA 4XZUG 5C70A 2VMFA 4E8CA 3CMGA 2RJ2A 3C8XA 3ACIA 1EUTA 3A23A 5J1XA 2ZEYA 1XNAA 3K77A 1CZVA 3MV01 2W95A 2VZRA 4P08A 2PQSA 4DUWA 4UAPA 2ZEZA 4OUEA 1PX4A 1US2A 2W94A 2KD7A 2VZOA 4BJ0A 1TG7A 3D3AA 2VZQA 2J22A 3FN9A 4MO3M 3EB7A 5IFTA 5LCWL 3WEZA 2VJXA 2Y6LA 1NKGA 2J1TA 3PUHA 5B4NA 3I2GA 1JZ7A 1UYXA 2WDBA 1UY1A 2J1UA 5G04L 2VR4A 4UI9L 2QQNA 3CDZB 2VZSA 1W9SA 3HOBA 3THCA 2WQ8A 1GOFA 2YC4A 1T2XA 2WO2A 2B4KA 3IDAA 2JKXA 5JUVA 1UXXX 2VZTA 2WABA 3I2IA 1CZSA 4ET7A 2Y6KA 2WN2A 3A21A 2WZ8A 4DXRA 5DQ0A 3LPFA 5A1AA 1NX9A 2X05A 3T2OA 3K4AA 1NUKA 3J7HA 1UX7A 2WAAA
chains in the Genus database with same CATH superfamily
1TMF3 2W92A 3HQRA 2RMU2 3WF1A 1NCQA 2D3SA 1OMIA 3GYDA 3PTRB 4IGPA 4MSVA 4RSUA 4AAXA 4Y5Z0 2JG9A 5IK7A 1BK0A 4FBFA 3VD9A 3UT0A 1POV1 5DG2A 4KU7A 1OHFA 1RUE3 1JMUB 3EBRA 4FAHA 5FO9B 5FYYA 5A3MA 1UMHA 2OX0A 3ZMNA 2RS53 1AYN3 1SFNA 5FPLA 5FY0A 4E8DA 5GLTA 5JXJA 3K3OA 4HL0A 1ZZ6A 2A3YA 4RN5A 4BQ2A 2RS31 3LE0A 1VRH1 1YYNA 4UXAA 3N7JA 3WNXA 3SHRA 3P5BA 2WWUA 3NVCA 3FUOA 2JKBA 3W20A 1DZQA 1ND2B 5DDJ1 4JDOA 4YRDA 2LROA 4TWTA 5LW9A 3ST7A 4GD4A 3GALA 4PDWA 4K7JA 1Y3TA 1MEC1 4MZUA 4QX1A 5A3TA 4BK5A 5BUVA 1X9TA 1I3HA 5F1RA 4L9BA 5TSWA 5I8TA 4XBLA 1UX6A 2GP5A 2RR13 2PA7A 1XU2A 3A0NA 3LSDA 4BU2A 4DY5A 3VUOA 1S0GA 2CWSA 3OYWB 3VHOA 4MLOA 4QHBA 1PGW2 2KR2A 1W2NA 1CX4A 1W8TA 2QE3A 3MW3A 4O65A 3H9AA 3OBAA 4GWIA 1NXMA 3I2FA 4R4ZA 3UKTA 4COYA 1UZZA 3AX4A 2EIGA 3MW4A 3E6CC 4BQXA 3NO8A 1ALYA 2HWC3 2O8OA 2V73A 1DCSA 1QDOA 1X7NA 3I2HA 1SBFA 5LRRA 3HT2A 5C4WC 3LZZA 4CU7A 2AC1A 4PI2A 4BM8A 4Q4V1 1OC1A 4W6XA 1YNAA 1CAVA 2UYBA 2ES3A 5FBZA 5J96B 2B46X 1EPWA 4CDUB 4XW3A 3PMSA 1CWPA 3JD73 1SFPA 1N47A 1PGSA 2VAUA 2JE8A 4QWNA 1OFSA 2C5DA 1R1ZA 4Y20B 4AK3A 1UF2C 2YPJA 5J09A 1OQ1A 4FTSA 2DU0A 2VBBA 4ZXEA 2CU5A 3WNMA 3BTXA 2WLQA 4QPIA 3IIIA 4LT5A 5LK7B 3O1OA 1WD4A 1B35C 1FXZA 3VZOA 3GBGA 3ILNA 3TB0A 1KJRA 4KGQA 1ZX5A 4C1XA 3VBSC 4MGSA 3I2JA 1QXPA 2DVDA 4XQDA 5IK4A 4Q4W3 4COWA 5DZGA 3B9IA 1UYPA 1WMFA 3BPZA 1W3VA 1T6BX 3PVBB 1EAH1 2BGPA 3CZJA 3KGLA 1HRV1 1MQTB 2VBPA 2ZABA 4IUGA 1BLZA 3PJQA 3T1LA 3T09A 4AW7A 4XUOA 4DEQA 2YZ4A 1QNWA 1O7FA 1O4TA 2CSGA 3OUIA 3J9SA 3Q8FA 1HN0A 1JI6A 4ES9A 5A32A 3LEKA 1HXS1 4UFJA 2SLIA 1HJGA 5J3UA 1W6OB 4QU2A 1W3XA 4XUTA 3VDDC 1DP0A 1OUXA 5IYYA 3DCQA 5FZ7A 2VW0A 5GZCA 5IVYA 1KDKA 4NRPA 3AVRA 3IM0A 1BXHA 4Y33A 5FY5A 3M7AA 3VHRA 5F3EA 1W8UA 4JGZC 3KV6A 2VQUA 4DFSA 1MVQA 1AR83 4WV8A 2VY0A 4NPRA 5T52A 4TXWA 1O3TA 1V70A 3I97A 2WKKA 3ZDSA 2ZMNA 1PO21 1GR3A 2YBPA 2CDOA 3WP4A 3KCXA 4WZFA 3WF2A 1APNA 4K1ZA 3UKVA 5KXDA 3MV11 1CGPA 2WFF3 1CAWA 2B9UA 3N9LA 4P9LA 4FFHA 2HWC1 4QX3A 1QJY2 1RHI1 2HWF1 4MGKE 4AEDA 3I49A 3VD3A 1UXZA 1QJU2 4GJZA 2TNFA 4OI2A 4CXXA 1W6QB 5A1FA 5FZOA 2QDRA 3HN3A 5LBBA 2PXJA 3AXDA 5K8SA 2FDJA 2ZJCA 4EWAA 1W8OA 1OH3A 4BCUA 1AYM3 1UCXA 1ULEA 2J42A 2JE7A 2WA3A 4JZRA 4LKSA 1IOAA 3C7FA 2XJTA 2DBNA 4S2HA 1N3OA 3D0SA 1MEC3 3J7NA 5K4LA 4L99A 5BNOC 5FPVA 5FY8A 1YO8A 2C26A 1EAH3 4QDQA 2D3RA 4I02A 2EIEA 2ORZA 4PT6A 2QQOA 5FYIA 1ZA4A 1RXGA 2ZGSA 4Y26A 3N4MA 3VD4A 4B1LA 1JZ6A 2I2SA 4JAAA 5APAA 1LHVA 1W06A 2GALA 5F8PA 3AZZA 2LTNA 1Q8QA 1DZTA 5KHKA 1F8VA 4AVCA 3E5QA 1HV0A 2W1SA 2FCVA 1W9TA 5JIUA 2XVLA 3E5XA 5FOJB 4I0WB 1W9FA 1I5PA 2P6HA 4YM1A 5JVVA 3ZLIA 5IAXA 4OMDA 4IERA 4MGQA 2FMYA 3ENRA 2OPKA 4ARXA 1QMJA 1WCSA 5DUVA 3CJIA 4GH4C 1EV11 5L9BA 3OB8A 4AVTA 3TRSB 2CNAA 4LBQA 3OPZA 4O9EA 4BQ4A 1DDLA 1H2NA 2YDEA 3NMBA 5JI7A 2FZ1A 1W28A 1DGWA 2HWF3 1R082 1TMF1 2CGPA 2AR6A 4A6OA 4LITA 5IW0A 4RFRB 3HPNA 1VBC3 4AFCA 3OUJA 5JR2A 1LOCA 4BIFA 2QBXA 5F9TA 1ACCA 1BBT1 3IBMA 4N43B 1BVVA 4XFGA 5LY2A 2XGXA 4K21A 1Q8OA 3GJBA 2Y60A 4RS5C 5E89A 4AEMA 4DO0A 3SEPA 1COV2 3VDAA 1SBDA 2JEMA 4LK6A 2ZGRA 4XBNA 1XNCA 2VO5A 1EPZA 5JR7B 1EV13 1VP6A 3S5QA 2VZUA 3LPGA 4LEJA 5LEJA 5DPNA 2VU9A 1VR3A 2W47A 1KRIA 3O1PA 2DF7A 5CKMA 2Q1MA 3DKQA 1QY4A 2WFPA 5C8WA 5L19A 1UQXA 1UPSA 1A6CA 3WNPA 2VQTA 1AR91 3VKLA 3ZXKA 3WNKA 4IGQA 5G05L 5C9AB 1WD3A 4M3CE 5IVFA 1AX0A 2NM1A 4IGOA 1REFA 4J6GA 1REEA 1EAH2 2XKOA 4P9JA 2HWC2 2QQJA 1SLCA 4CPBD 4CEYB 4CRQA 2FDHA 1V6MA 2RDSA 3SMHA 4IEVA 1YQ8A 1QJEA 1X8MA 3K3NA 2C4XA 2VOWA 4L92A 3SCGA 3ZX7A 3IAQA 4QAWA 3ZN5A 4W6YA 4IV3A 2Q8OA 1WLTA 2BVBA 4PF5A 4WZCA 1OLQA 3AL5A 3JBG2 4A6SA 2O1QA 3EO6A 4NIGA 1POV3 3X29B 2VXRA 5BYNA 3ORJA 2OXBA 5DZEA 3HIFA 1GU3A 1QIQA 4L97A 4EYUA 2G19A 1RTVA 4GB31 1NCRA 4AEKA 3QCWA 1BVP1 4S2FA 1QHDA 3WHTA 2AUYA 2VMDA 3MF6A 1NA1B 3PLQA 4PLOA 5A7QA 5FZ1A 3CIHA 3WY6A 1CR7A 4J1WA 2QFEA 5A7WA 1BMV2 1OOPC 4RGGA 4Q4V2 2ZA9A 1I6XA 3ZN6A 1TZOA 1CAWB 3WG4A 3VZKA 5DMYA 1MS9A 5DAWA 4OI4A 5BNNA 3J8F1 5JLVA 4PDWC 1QJU1 3USSA 1HLCA 3ME2A 2DBIA 1VMHA 5A3NA 1PGL2 3ZSLA 1TNFA 1MACA 3T0AA 1PVXA 5FZBA 4BXFA 5KXEA 2WQZC 3PHMA 3OBTA 3NNJA 1LHOA 1MS8A 3OF1A 2EF6A 2XH6A 3WOGA 3RSJA 4Z2WA 4X8NA 5IVCA 2WC2A 1DQ1A 2WZR3 5FUPA 4EQVA 3WP3A 4Q1PA 2JG8C 4A41A 3T2QA 1IPJA 2ETEA 4H14A 3ZSEA 1WBLA 4UW6A 5ANQA 2W68A 3POYA 4KWJA 3DUIA 4XJZA 1GZCA 3GGLA 3VBUA 5A32B 4CUGA 3ES1A 4QM8A 2DTYA 5DUXA 2RDRA 3DPRC 3NJVA 4ZXKA 5FXZA 2D6MA 4EN6B 1CJPA 1VBB2 1I1EA 4H55A 2X5IB 4LTAA 1YRZA 2ZKLA 3AFKA 4KBBA 3H3UA 4D69A 2BRTA 4TZDA 4UFMA 2XXZA 1X33A 1NLRA 2VM9A 5F6LB 5JXGA 4FPGA 5FZGA 1WLCA 2G9FA 4QXHA 5EJZB 5H9SA 3VZNA 5BNOA 5AC92 4HPKA 3PURA 1IPSA 3B93A 2ZHLA 5HV4A 3V0BB 1M4WA 3SC7X 4QB1A 3AXEA 3ZVXA 1SMVA 1UU5A 1C1LA 2GNTA 3PMEA 4HSJA 3NAPA 2ZGMA 1RVF1 2NPIA 4QQLA 3WR0A 2HLEA 1ND2C 3PJYA 3LOBA 1SPPB 2GC0A 1B35A 2P1BA 5FZHA 2ET1A 3OTFA 2XLGA 4ZU7A 1DFQA 1AL0G 2YBSA 1ZRRA 3VBSA 1ST8A 5KHJA 1D2QA 3C7EA 1YWKA 4GWNA 2R0HA 5JSRA 1XQNA 1ZZ9A 3RG0A 1WCQA 1RUC3 2RDQA 2IXLA 2XUMA 4NWWA 1VBE1 3WW3A 1F15A 1JYVA 3RYPA 3SKJE 3BU0A 3PL0A 2XUEA 1U5YA 1X8EA 4OHZA 3EHKA 3H1WA 4PF1A 4RGAA 4Q0PA 1MZ6A 1OOPB 3ZXAC 5FQ0B 2HWB2 3AP9A 1C8M2 1NY72 4I09A 1I5ZA 3MZHA 3RFRA 1JYIA 4QX8A 1D7PM 2Z42A 2OS2A 4YGDA 3RMYA 1H8TC 2ZACA 2ZGUA 5JPMB 3P1IA 4AGRA 4B1MA 4WM8C 1LOFC 3SCFA 3HT1A 3POFA 3M3CA 2VVEA 4INDA 3BOPA 4RHV3 3ELNA 5C9AA 1AXZA 2D5FA 2DVAA 1V6NA 1FT9A 4ES8A 3O1VA 1RMU1 5I8SA 3FUQA 2VMEA 4R52A 2BNNA 2D6OX 2DCTA 1O4YA 2JDHA 4DEVA 1JYTA 1O59A 4HONA 3LAGA 1B35B 3ZIXA 4X8PA 1CIWA 1PMIA 5A7OA 4UBGA 1RUG2 2JENA 1W2AX 1H1AA 3H1YA 4K9SA 3N35A 4W65A 2ZPXA 1DLLA 2FCTA 2CYFA 1XOYA 1R1A1 1EUTA 4BQ5A 3QH6A 1XYNA 3A23A 4CP2A 5J1XA 1V9U3 2XB6C 4AI2A 1VMJA 4JRLA 4RL7A 5JCTA 3RI9A 4KNCA 3KQ4B 1BQPA 3KV4A 3KVAA 5JDBA 2W95A 4FFGA 1RJ8A 2VZRA 3RWKX 4D6QA 3RZGA 1VRH2 2PQSA 1SCSA 1HB2A 2PN5A 4UAPA 4HT1T 1LGNA 3AP6A 3ZYHA 2W94A 2KD7A 5FLHA 4XTPA 4AEJA 2BFUS 4BE3A 5IFTA 2P5BA 1HRI3 1RMU3 1MEC2 4NOTA 2LRPA 4UFLA 3ZR5A 1AZDA 1N1SA 1H9PA 1JZ7A 4NE9A 3WQ1A 3FX3A 2ZHKA 1UYXA 5C3OA 1BKZA 2RE9A 3N3HA 3POEA 1G86A 1UY1A 1QJX1 3B01A 5HV0A 1OPOA 2R1BA 2DFCA 3QACA 5FIXA 4PQ9A 5I0RA 4OLLA 1HDKA 1JUHA 4FAGA 3B9CA 2JDPA 2MEV1 3WINE 3I59A 2E7QA 4JGYC 3THCA 1GOFA 5A3UA 3LDBA 2DCYA 5CFCC 2WNUB 3B69A 5GM0A 3RGBA 1UO9A 2WO2A 1ZBA2 3IDAA 3OUHA 4XQWA 3RMXA 1UXXX 2R1DA 5JUVA 2Y38A 4C0HA 2GSYA 1TNRA 4YZ4A 1BBT3 3S6PA 3ZYGA 3PVOA 2ZS6B 3B3QE 1J1TA 2WZ8A 1V6IA 5CFCB 3LPFA 3VBHC 1BMV1 1CPNA 4JGYB 3K4AA 2A6YA 4IE7A 1UX7A 3BKZA 4IEQA 5D8AC 2OA2A 3K51A 5FZOB 1OA3A 4YW2A 2XHKA 5FZFA 3M4FA 2NZ9A 2ZHMA 2ORXA 4YM2A 1BYHA 3H3ZA 4BMEA 5C3SA 4ISQA 1COV3 4N7IA 3S0MA 2ZOEB 4ZY9A 4FPJA 1UKGA 2VMHA 1RUG3 1PO13 5HCFA 4D7YA 4PLNA 4DQAA 4YFZA 2VNOA 3FBYA 1NZCA 2WNVB 1Y9QA 1KEXA 4CDXC 3ZXFA 3U11A 2NMOA 2WRAA 1VBE2 1W99A 3TN93 4B7EA 1N1TA 1DG6A 1PX3A 2CY6A 4XEZA 3I3BA 3WCRA 1YJLA 4LO8A 4O7XA 4LMFA 3MUY1 4R9CA 5CVRA 5ABJA 4DUXA 1Q8SA 1CONA 1SDWA 3D6EA 5F5QA 1XYOA 1NT0A 4HG6B 5ERLA 2E53A 4MADA 5C4WA 1IQAA 2B5HA 5FDBA 2PFWA 1LOAA 2GH8A 2P2KA 3OCPA 5FP9A 1FATA 1HQLA 3ZPOA 4YFWA 3Q8CA 2RM22 3SNMA 1ZRIA 4JGZA 3BIWE 4JGZB 4XZPA 4CCOA 5FWJA 4QKBA 3ZFGB 1RHI3 2CWMA 2JE9A 3ZYPA 4MX3A 2R062 2I07B 1RUI2 3O0VA 1ZM1A 3DL3A 3S7IA 1SACA 4M00A 1WUVA 3JXSA 2BWAA 1HV1A 2PMWB 3RJ2X 4EN8B 3POBA 4Y5TA 2FDGA 1GWKA 4Y1XA 5DABA 1YIPA 5IUQA 3NSTA 5FBJA 1AVBA 1BK1A 4Z8BA 1V0AA 5GZGA 5FZ4A 5FZ8A 2VE1A 4OUMA 4COVA 2JJ6A 4Q5OA 2RHPA 2XJPA 1TVGA 1RVF3 3EQEA 4HXCA 2QQWA 5B4XA 2L9LA 3IIAA 3FLTA 1ONAA 1XE7A 4MXVA 4UYBA 4NO4A 1HKDA 1O8PA 1VE0A 2Z4FA 1T6GC 1E5SA 3PIJA 5DAXA 3H8OA 1UPIA 5CADA 3T2TA 4BMBA 1RUOA 1ODMA 5FZEA 1CESA 4AHWA 5F6KA 4RQPB 2R061 4L11A 3LQCA 2FBEA 5DXDA 1UZWA 5BNPB 5IJRA 4ZU4A 3GZAA 2QQMA 4D7SA 3L2HA 3OBRA 4UBHA 3C2UA 1QQP1 5F5IA 3G6JB 1JYNA 4QQHA 3RVHA 3C7GA 2QDNA 4ATFA 5EP9A 3AZVA 1UKRA 4NMIA 3A4UA 3N36A 4ATEA 1FAYA 5FY7A 2OUJA 4IE6A 4QPGB 4COUA 4KU8A 2YV8A 5JOZA 4D6SA 3HR9A 2WZR2 1UY4A 5FLJA 1DLCA 2R32A 3ETQA 4PIXA 1QU0A 2YUEA 1VBD2 4XACA 3VBOA 1LNSA 1STMA 4NR1A 3ITQA 5FP7A 4OI1A 4AFBA 2VMGA 3H42B 4MV2A 1UOBA 5DAQA 3ZSJA 2D5HA 3N9NA 4LO4B 5T54A 2VL4A 4XILA 2VQ0A 3UGFA 1SLTA 5C8CB 4AHXA 2W91A 1HX6A 2XR4A 4UWDA 4DY3A 4XETA 1X36A 4CDUC 1VAMA 2VMIA 1XE0A 4FT8A 4ZZ8A 1PO23 4CCNA 2QJVA 1O8SA 1UYZA 1X50A 2B45X 3AYCA 2R041 3F95A 1AHSA 4NJ4A 5F3IA 3WNLA 4LBNA 1D0GA 3LA3A 4CVUA 1K42A 4QHZA 3VLBB 3N9MA 4OQ9A 2C9AA 1KDMA 2XQRA 1G7YA 4CDQB 1NCQB 3O1SA 4GWJA 4IEOA 4LORA 2WZPP 3THDA 2JWPA 4AI9A 4LO6B 1S2KA 3UESA 1JN2P 4F8AA 2AZ5A 1AR71 4YVSA 3H8UA 5CB7A 1OH4A 2ZX2A 1MQTA 3GHNA 3T08A 1Z7S1 3S30A 2UWCA 3R6SA 1ZRFA 1E5IA 1HRV3 4Q0SA 4E4SA 1RL3A 3KB5A 4LK7A 2NN8A 1MPXA 1QQP3 1MS1A 2W9XA 4CDWB 3RQ0A 4CUBA 4Z2AA 3TEWA 4H7MA 4GH4A 2IUWA 5HPOA 1O5LA 3I8TA 4AG4A 4AOCA 3ZOIA 2D43A 2ARCA 2WNEA 2PAEA 3KV5A 2HKXA 2AEYA 2K2SA 4IV3B 4UT5A 2IVJA 1VRH3 3LSEA 4WVWA 3O1RA 3ZFFB 2RMU1 1WZXA 4QD2A 3UGGA 2EA7A 2EXKA 4IE4A 2HYKA 3FHAA 2GZWA 1JZ5A 1ZZ7A 4AQTA 5C3PA 3U78A 5FRAA 3VDCA 3A22A 4BHPA 3C3VA 1S55A 3JB4C 2KM2A 5CKQA 5CZKA 3WDTA 4WVZA 2VPVA 3ACFA 3MEPA 1XXNA 4IXLA 5L9RA 4HVRA 2DUPA 4OZXA 1RUNA 4MGZE 1JOPA 5CBLA 2PLV1 5JZGA 2R043 4FPEA 3BGAA 4FPHA 1U0AA 2X09A 4XURA 4KMQA 1GZWA 2RS12 4Z92B 5IHRA 1FX5A 4C91A 4I0AA 2W1UA 1E5RA 4FOVA 3V56A 2WINB 1S2EA 1VBC1 3B7MA 2A70A 3CJIC 3Q8EA 3WP5A 4JKKA 5FV3A 3FC0A 1O3SA 4YG6A 5FZAA 1AJOA 1TE1B 1HRV2 2E9QA 1K12A 2VH9A 4AEDC 5BNNC 1QQP2 1AXYA 1MZ5A 2B8MA 2DFBA 4EN0A 1TQ5A 3BTAA 1G9DA 4XIOA 2WNVC 1X82A 2WS93 3UGHA 4GMP3 1ULGA 3WF4A 4D8MA 4COZA 2HEVF 3AZYA 4N43C 4WM8B 5T55A 1RUD2 4PBOA 3CEWA 1WGPA 2ZTNA 3CKHA 1PM7A 3NKTA 1AR63 4JGYA 4W4ZA 5GALA 2XPJA 4B29A 2ZGKA 2Q1FA 3H50A 3O1MA 2ZKNA 5CYYA 2PHLA 1YFWA 2C9KA 3BTYA 2GMPA 1KS5A 4CCMA 4OI0A 2TEPA 3PUSA 3VGIA 4Q4X2 2ZMLA 3DYPA 4CEWA 4IEPA 4UW4A 3KT1A 1GMMA 3MPPG 1VMFA 4V2VA 2Z5WA 1RUF3 3VBUB 3VZLA 2D6LX 3E6BA 3LGRA 5E8AA 1BEV1 1SFYA 3SEEA 3ZR6A 1BBT2 2D3PA 3P6BA 2VZVA 4JHZA 2E63A 5KHIA 1XJAA 1AX2A 4YPJA 3AVSA 4Q4X3 5CNAA 5LA0A 3GDBA 2VUCA 2IFRA 5FZIA 4BIOA 4N9HA 1AYM1 4AI0A 1CZTA 3AJZA 1J59A 1OF4A 1Y9MA 2VTFA 4YGCA 5D1IA 4ZPIA 3DF0A 1OSGA 3H1MA 5LWBA 1R093 2QQUA 4XJ8A 2Y8KA 4WM7B 2WSUA 1WMDA 5A6ZA 3NAPC 2WWSA 3BPSA 4OZOA 2YFUA 2WBKA 2W39A 1OQDA 2NQYA 3A0KA 3MO4A 1AR92 3CF6E 4AFMA 1ENSA 1FMD2 3V0AA 1UY3A 1OA4A 2BV4A 4DMIA 5FZLA 5LBFA 2BGOA 2EICA 1NLQA 1PIV2 2WFF1 4M3CF 4XCBA 3O0XA 3JU9A 2Q0AA 5D2AA 2JDMA 4DINB 4NIIA 2A6ZA 3WNNA 3RZKA 1RUJ1 4ZZ5A 3OOXA 3POSA 1ASJ3 4JQRA 4SLIA 1A34A 3AZWA 2HEYF 5A3OA 1OA2A 4Y5SA 3VDBA 1ODNA 4GKYA 2EIDA 5IVJA 3PNAA 3U37A 2IC1A 2PELA 3Q8AA 5EV7A 4DZGA 1J84A 4E9KA 1PZ8A 1IS6A 2MEV2 3B94A 1N1YA 1PGW1 5E88A 5LASA 4RGKA 1VRBA 1XB9A 2VNGA 1ZNPA 1XE8A 3BVCA 5ACA3 2P6CA 2PLV2 3QH7A 4WM8A 2AREA 1OFNA 1UY0A 5FYBA 3GM8A 4UF0A 2Q1ZB 4LULA 1WCUA 1YHFA 5A3LA 3LDKA 2VUAA 3IB3A 3IDBB 5H9QA 2A6WA 4KG8A 4P9IA 2HWD3 1YEWA 5EJ1B 2XJVA 3U0ZA 2J1SA 2HEWF 2VZ3A 3F2ZA 2V09A 1QJY1 2AACA 4HK9A 1UOFA 1R083 5IFPA 2RJKA 1D4M1 2CGNA 1LAJA 1OF3A 3KCCA 1VB4A 1JYXA 1NZIA 2P34A 1U5XA 3RS6A 1XSRA 3WZ1A 2OPWA 5DUUA 4AZZA 4M3CB 1YCIA 3H7YA 2GP3A 3DPRA 3RZHA 1W8HA 3TBDA 4RA0A 2BBVA 5LK5A 1W8WA 2J1AA 3DECA 5FTTC 4FPFA 4YW7A 4R8HA 3MBWA 4HLTA 3PIGA 1NAEA 3OG2A 4AYUA 1D4VB 5JAXA 1A8DA 5DZFA 2ARBA 4XJ9A 4XJUA 1KGYA 4XJAA 4CU9A 5C4WB 4CZSA 4LO5B 2ZCWA 1SQ4A 1HRI2 1GP4A 4Z1VA 4TLFA 3VKNA 4I01A 4Y3OA 1C1FA 5DAPA 5EHDA 1KS4A 3OGVA 4Y22A 2GN3A 3ZXDA 2FMDA 5IK5A 4IEUA 1GYKA 1B09A 3ACHA 4Q8KA 4IDZA 3HJRA 1FI2A 2Y6FA 3E6DA 3N9OA 2FDIA 4IEWA 1W0OA 4M4PA 1DYKA 3WW4A 1MVEA 2MEV3 4LQRA 3RDIA 5IT6A 2DCJA 5CA6A 1HN1A 1DGLA 1PVC2 3D5OA 1RINA 3IKWA 5HCBA 2JDZA 3VBHB 1C57A 3TYJA 3U4XA 1Q43A 1PZ7A 1FPN3 3AKSA 4XDOA 2UURA 3N7LA 3ZXJA 3GZEA 4WM7A 2QQIA 5GLVA 2D93A 3SH5A 1F5FA 3AKTA 2VXJA 4QPWA 3GNEA 4N53B 4NWVA 2YU2A 2KXLA 3QD6A 5CFDA 3TEZA 3RZJA 4XF9A 1JXNA 5F7UA 1PIV1 2IVIB 2WN3A 1ZA7A 2PAKA 2VUDA 4NHXA 3VD7A 3R0RA 4IE0A 4W6WA 2OW4A 4XZUG 2VMFA 1LULA 5GZFA 1DQ0A 1QH6A 2W2IA 3AKRA 2NLRA 3CMGA 3JZVA 4GWMA 3C8XA 4LKEA 1AYN1 1H0BA 2R073 5A7PA 3NV1A 3ZPYA 2BU9A 1COV1 4D3WA 1W6QA 5FPZA 2YPDA 4YZ5A 1CZVA 1W04A 1R091 1FOD3 4E2QA 1RUE1 5EQUA 4XAEA 1H2KA 5FP3A 1ND2A 5A3PA 4LBKA 3VBOB 1R1A3 3BTZA 3WVJA 4LBQD 1QOTA 2C24A 2NMNA 4AVBA 4E4HA 5GLUA 4YNIA 3PUAA 1H1IA 1NYWA 1US2A 4NAOA 2A7AA 1LB2A 3SISA 5FZ0A 5CISA 3UYJA 3P3NA 2ZMKA 4QQ2A 2VZQA 3KSCA 1WCKA 1PIV3 4YG0A 2P3IA 1UU4A 3MF9A 3AMMA 3EB7A 4CCDA 5LCWL 3ZFGC 2Y6LA 1NKGA 1Q8PA 5B4NA 1H2MA 3KS7A 1RITA 1RUF2 3BUCA 3AB0A 1VBA3 4QXKA 1AR93 2Z2SB 4QMAA 2QUOA 2JG9B 4RS5A 3MFAA 3WX5A 3CU7A 5ACA1 3J7MA 4RQPA 2DWRA 5G04L 4RR3B 3URFA 4YM0A 3RZMA 1J58A 2VR4A 2AH2A 1TME3 4Y4RA 1UN1A 3ES4A 3VBHA 1HB3A 1LOFA 3AMQA 2PHFA 4MHUA 4N90A 1QJX3 1RJ7A 1T2XA 1LJ7A 1XSQA 2B4KA 2DTWA 5FXWA 5EYYA 1O91A 5JZGC 3JQXA 4NRQA 5BY5A 5L7OC 2RM21 2WABA 5E1RA 3I2DA 4F7ZA 2ZZQA 4H7LA 3WUCA 2HWE3 1G8WA 4DXRA 5KC6A 3B5LB 1ZBE1 1URXA 3LF7A 1DQ5A 4PIYA 1NX9A 3ZXGA 1LHWA 2Q30A 1NUKA 3DXTA 1GBGA 1JTZX 3AYAA 5C5TA 4AI8A 1U5IA 2JICA 2VG9A 1GICA 1JHNA 2PAMA 2PLV3 2VVDA 3GBWA 4U36A 1GQPA 1OPMA 1SLLA 3OJBA 4P02B 3DKWA 4GA9A 5FZ3A 4YWAA 4K8FA 1UU6A 1MR5A 1GP6A 2CV6A 2ZGPA 2E7AA 3THPA 4QGMA 2XWJB 2VW1A 1YFUA 1RUE2 2WYSA 1FOD2 2E7TA 2RS52 2WO3A 2OQ7A 3CL1A 2CL2A 2R071 3B02A 4IEXA 1QXRA 5IAVA 2BZDA 2MPFA 1PM4A 5D8AA 2WA4A 4AAPA 2XVKA 4BQ3A 2RVAA 2XLFA 4AVAA 3ZFFC 5C6CA 2Y6JA 5EWSA 4XAAA 3DN7A 4N8MA 2D6KA 5FYVA 1WMXA 5FKBA 5FZ9A 1QJZA 1K45A 2EAKA 3GXUA 1JBCA 5FYUA 2DVBA 4RR3A 4ZONA 3N9QA 1S1AA 1L7RA 3QOPA 1LHNA 4FPOB 4PLMA 3RZZA 2OQ6A 1K5MB 3FL7A 1CX1A 1UL9A 3J4UH 4GQ7A 1MS3A 5LEKA 1O5UA 3PTYA 1JOBA 4UOJA 1JUIA 2JD9A 3ECQA 4R4XA 1OXCA 1N3QA 1C8M3 2K0GA 3PVEA 2A73B 5C8CC 1S4CA 5AFEA 1SG3A 3ACGA 4A7YA 5FR3A 4KQ7A 5CFCA 3ZXEA 1Y9GA 2YB7A 1QNYA 4EROA 1DYOA 2D40A 1C5HA 1H30A 5IVVA 4TTGA 3VKOA 4CDQC 5JPNB 2C0ZA 4XQ4A 4XF1A 3BODA 3TEXA 1ASJ1 4XCAA 2XL9A 4GAZA 4QXCA 1V6KA 3TNQA 1LCLA 3OYWA 5FYHA 3AK0A 1GKBA 2ENRA 3I59B 4QPGC 1OD3A 1EP0A 1J83A 4BDVB 5SV8A 4P14A 4NPLA 4HN0A 4YW3A 1G6NA 2VCCA 4LHSA 3VB9A 1CAXA 2Y33A 2GU9A 5FUIA 2P3KA 1NG0A 2R16A 4BZ4A 3R05A 2P3YA 5BXXA 4JHTA 2V4VA 1GOHA 3AL6A 1G9BA 1AF9A 4XBQA 4UW3A 5T5OA 2BERA 2RR12 4P00B 4TYSA 3T1MA 5JSPA 1ZZCA 1JZ3A 4XVHA 1F4AA 2WQ4A 4MGIE 2X10A 5KWRA 3WHUA 1W6NA 2YGLA 1HQWA 3U1XA 3C7OA 1LHUA 1UAIA 3CQOA 1ASJ2 3KLSA 1OVPA 2YG0A 4IE5A 4J1XA 3A7QA 4F3JA 3LA2A 4A4AA 1RUH3 3WF0A 2EVXA 4BB3A 3TWIA 3VBFB 2H0VA 4GZ9A 4LR4A 5JXHA 4YGEA 1AX1A 4NIHA 1PO12 3BU7A 4A44A 3MIDA 1V00A 3ZSMA 1W6PA 3AMPA 1RXFA 1C4RA 2XLAA 1DF0A 1GNZA 1WLWA 2YMZA 3AP7A 1GANA 1W8NA 4HKOA 4CEYC 1QWRA 2B42B 2QNKA 4XF3A 1OLME 3O1TA 4MYEA 1WWYA 4AF9A 2CAUA 5FPAA 4XUPA 1ZZ8A 1W2TA 5FYSA 2WT0A 1JU3A 3KF3A 1NE4A 4MGYE 5BPXA 2XHNA 2A3WA 4W8JA 2QQKA 4YYOA 2DDUA 2BUKA 1PNFA 1SLIA 1RUJ3 2J1EA 2K9ZA 4WBBA 5I0DA 1G9CA 2HWE2 4E2GA 3T4HB 4URAA 3POIA 2W3JA 3OEAA 4IW3A 1IPKA 1FMD3 4W50A 1CIYA 2ZHNA 1VALA 2JG8A 5F5AA 4AI1A 5A70A 4CYDA 1QJX2 5J7MA 3ZYFA 5IWFA 4QXBA 2Y6HA 1AR81 3V64A 1XNBA 4FSJA 3H7JA 1US3A 2WNVA 2EXHA 1JYCA 5AVPA 3AKQA 4BXSV 3EXUA 2VC9A 2NP0A 5J98B 2C6SA 1VBD1 1YC61 1GNYA 2A6XA 5E16A 3JBG1 2D6PA 5CG8A 1ZYBA 4DPNA 4FQ4A 4XTMA 1YIFA 4UF0B 4EE2A 4IQPA 5JOXA 2J1RA 4LIVA 3AMNA 3ZFEC 1BCXA 4GB32 3AMHA 3K2OA 2CGOA 2AYHA 5FQ0A 4V2WA 1HQNA 1W9WA 3OBZA 3MI8A 2JG9C 2VZ1A 4BA6A 5JOWA 3DYOA 4WVVA 1PO22 3VV1A 3KHCA 4LJHA 4IEYA 4QDSA 1RUH1 5FXVA 3NAPB 5T50A 1RHI2 3I2KA 3JB8A 1YI7A 4ZHNA 4XXPA 4AQSA 1S0DA 2WR9A 4XDPA 4TLGA 5LA9A 4BOWA 5F3CA 2PTMA 5BNQA 1W05A 4P5YA 1ENQA 2UY8A 1CVNA 2HJIA 4DOUA 1CD3G 4CXYA 4EN9B 1PHMA 5JIAA 1SEFA 2BWCA 3IAPA 1PMHX 4LLFA 2E26A 2W52A 1G9AA 3N7KA 4Y1VA 3MGUA 1GP5A 1DHKB 3NQHA 3DGTA 3V0AB 3NJYA 4HZFA 4X6RB 4GMP1 1S0CA 4L0PA 2OVUA 5J36A 4GALA 4AGVA 1UYYA 4I2OA 1GV9A 2GN7A 4I3PA 2R7EB 5FY9A 1H4HA 2F6BA 2WYFA 1LR5A 2XOMA 3UNPA 5KHGA 4N7UA 2FHRA 3ZFEB 3GZUC 4XFBA 3LEMA 1NA1C 2E6VA 3ZYJB 1VBC2 2D98A 1YQ2A 2QZ3A 2CAVA 2Y64A 1ND3A 5L73A 3WDUA 3HD8B 4AE2A 1XNTA 1IKPA 1POV0 3MUZ1 5FXXA 3VHNA 4FTEA 3IDCB 2FDFA 5FCCA 4M4RA 2IXKA 1WA6X 4PBPA 5AVAA 4CCJA 5C7GA 2WJSA 3MICA 3POGA 4K40A 5H9RA 4B3NA 4CPBA 5BNNB 5CU1A 2W87A 2J7MA 1TME1 5K0UA 3V65A 3M8LA 4FFFA 5T5PA 4HOOA 5FUNA 2E51A 4QDRA 1PK6B 2GDFA 3JD72 2R30A 1C5IA 2ET7A 5IK8A 2WUHA 3FFQA 2B9VA 3NV4A 4HSLA 1HW5A 1BHGA 2A5ZA 1QJFA 1YJKA 4Q0UA 2LUWA 5FLIA 4CDWC 5KBFA 2IFWA 3OY8A 2VCAA 4MOAA 4Y22B 4CCLA 4Q4W1 5JSOA 2IXJA 1F31A 2FCUA 4QKDA 4I0BA 1DQ4A 1GWLA 3RRDA 2WL1A 3E1F1 4ISRA 5SV5A 3WNOA 5ABJC 2GNBA 1AR73 5I91A 2YU1A 2JB4A 4HBNA 1PGL1 3JBG3 1J3RA 2ADDA 4GMP0 3RYRA 4FPLA 4YVWA 4DXZA 1VBD3 4AQ2A 5IVBA 5DUWA 1QGLA 4LE3A 4PQQA 5FY4A 1MS4A 3LIGA 4MG2A 1UY2A 2JDKA 3OGSA 3UV9A 4AQ6A 1W6MA 3R4SA 3FBMA 4DS0A 4OHYA 2Y6GA 3HNMA 2V5DA 4CUCA 4YM3A 4FOQA 5F37A 1RGSA 2LS6A 4JTOA 1RIRA 2XL7A 2Y26A 3M1HA 4QX2A 3ZM8A 1LENA 1LOGA 1W6OA 2XG3A 1IS3A 5KHHA 1MS0A 4CEYA 1LESA 2HWE1 2XDVA 3NJZA 5LY1A 3SH4A 3K48A 1AR82 1K5JA 4O9GA 4IETA 3N9PA 1OVSA 2RV9A 4NHMA 2ARXA 1GQGA 5FFOC 4CXWA 2D7FA 4GH4B 5I0SA 5JXIA 3DEMA 4BYYA 2BNOA 4TSVA 5J37A 2EIBA 1CPMA 2YY1A 2A75A 3POWA 4XF4A 4DNYA 5EIYB 2VGDA 2YBKA 4OVEA 3POJA 4XFAA 1SCRA 3O5SA 3W21A 3TOJA 4LIUA 1HXS3 3C7HA 1SPPA 3NV2A 4FTBA 1P8JA 1DYPA 4F83A 3LEIA 4ONUA 1OT5A 4Q4Y1 1VBA1 1U5ZA 4Y1UA 1GSLA 5HXMA 3KMHA 2DVGA 1Y4WA 1YFYA 2PHXA 1HIXA 1W2UA 4Q0QA 1OLMA 3MIFA 1MS5A 5FK8A 5C3QA 4K6BA 2BGCA 3VBFA 4C1WA 4DRRA 2BW8A 1S0IA 2DUQA 1ZRDA 1YFXA 5LBCA 1O6UA 2ID4A 1OQEA 2IZWA 2J1VA 3WSOA 4XMAA 4D0QA 2MNGA 3AYDA 3HVDA 3NNGA 1LEMA 3KVBA 2UU8A 1M06G 2VOXA 2HWB1 1QF3A 4XJWA 3LEGA 4CP9B 4M3CA 1LU2A 4A3ZA 4EWEA 1FOD1 4XMIA 4LBQB 4CDXA 3O14A 4BH9A 2XQXA 2YFZA 3KCYA 4FI9A 4KWUA 5ANNA 2VMCA 3U4SA 4K8RB 1XNDA 4XABA 2PHTA 2JXAA 2OT7A 4L2NA 4IEZA 2ATFA 1JU4A 3VN4A 3DV8A 2ZX0A 1D4M3 2PQQA 2RS11 2ZX1A 3AC0A 3RZLA 1R081 4QB2A 4G9SB 2XJQA 3BYWA 1F35A 4XE9A 5FPUA 1RYYA 4XYXA 3IPVA 2HWD1 3VBRA 5LRSA 1EYBA 4YVWB 3O0WA 3NJXA 4U2AA 3SKVA 5DAVA 4RHV1 5LA1A 1UNBA 4OMCA 5T3NA 4AXOA 2I45A 3FJSA 3BB6A 4AHYA 1KJLA 4XFFA 2VCBA 4HKWA 4XF0A 3VDDB 3VDDA 4EJRA 4ORFA 5BNPA 3LIHA 1DBNA 5C33A 1JZ8A 5A33B 1W6PB 2XVGA 1C8M1 1NY71 5EPAA 1O3RA 5F39A 2CDPA 1FV3A 3P3PA 3SH3A 1W0NA 4AR2A 4LBLA 4AFDA 2Q5TA 1NCRB 4FPYA 1GQHA 2VOVA 4YVSC 3VBRB 1MQTC 3KHBA 4R9DA 4NPMA 4XFIA 3K46A 4A7KA 3MIHA 2GC2A 1W0PA 1S0BA 2ARAA 4FCAA 4S2DA 1K5MA 1PK6A 2ZGTA 3M3EA 4JV4A 2VBDA 1KXGA 3NNLA 5F5CA 4AEDB 2W1QA 4A42A 3I3QA 4FPCA 1PNGA 2P3JA 2HWF2 5LBEA 3SQOA 3W5NA 5FZDA 5FPBA 5C70A 1HXS2 3AP5A 4MGTA 2G4IA 2RJ2A 1I9RA 2B39A 2VUJA 3BOWA 4A2UA 4GB33 5H9PA 1YQCA 4P9WA 3MLJA 2ZEYA 4NIDA 3VL8A 3FFZA 1XNAA 3K77A 5CFDC 1OKOA 2Y0OA 1CAXB 3OPTA 3HQXA 1Q5OA 3QLQA 3ZFGA 2ZAAA 1GFF2 3G7DA 4LNVA 5BV6A 4LKDA 1V9U1 3MFCA 4P08A 2QVSB 2HWB3 4LA2A 3RPQA 4DUWA 3ZFEA 4Q4X1 5FMDA 1CN1A 2ADEA 2VZOA 3ZFFA 2DYCA 2WSVA 4CP0A 4MXWB 1F2NA 1DZRA 3D3AA 3GCWA 3HBKA 5CAZA 2WT1A 1NQJA 1H2LA 2J22A 3FN9A 4IV3C 4URTA 3VBOC 2W0XA 3WD5A 4CEWB 4E4DX 2O14A 2K46A 3WEZA 2VJXA 5I0UA 4AI3A 1ZBE2 2QQVA 5A6XA 4IV1C 2J1TA 3PUHA 3I2GA 4XOGA 2WDBA 3SCHA 3HMYA 1YLLA 1YQ5A 4SBVA 3W9AA 2TBVA 3KWVA 4FQZA 1FV2A 2J1UA 3HWJA 3D82A 1SZBA 1UIKA 1DIWA 3AP4A 5K7PA 4CDUA 5FP8A 2BP6A 1W9SA 5A80A 5FZCA 3WDVA 3HOBA 1SLBA 4ASLA 1RVF2 1KD7A 1V9U2 4OFGA 3M2MA 4YG3A 1UZVA 3ON7A 4Q8LA 3NW4A 5GKAC 3LFIA 3ZN4A 3JCIA 2IXHA 3RI8A 4WM7C 2XJSA 4IV1B 5FZKA 4CDQA 3IWZA 2FQPA 2WS92 1CZSA 3OSDA 5EJ3A 4CEWC 3J8F3 4JDNA 4RS5B 2WN2A 3OGGA 1VBE3 2PHUA 4CCCA 2HWD2 1GZWB 2WNUC 4Q29A 5DQ0A 2F4PA 3HAGA 1LKNA 1AJKA 1OD5A 3ZYIB 3TAYA 2ZX4A 2X05A 5A1AA 2VTXJ 1VBB1 1CAVB 2WIIB 1W6MB 3FLRA 1J1LA 2E33A 3OGJA 4M0NA 3R4DB 4Q0VA 3W59A 3WDWA 4B4RA 3TEYA 3LOIA 3SLIA 1OBNA 4NRMA 4D94A 1GZ9A 1FYUA 1EV12 4YW6A 5FZMA 1V6LA 3THTA 5C5UA 4A3XA 3H3LA 2QQLA 4ARYA 4KBZA 4QU1A 3GBFA 3O7OA 1ZBA1 3EMRA 2BVVA 2OZ6A 4QPYA 1XU1A 3ATGA 3JUUA 1PVC1 3LB9A 4FP3A 4XUNA 5C3RA 1Z0HA 3CO2A 3H8RA 1AUYA 2JB8A 4KI5M 2RS32 3Q9OA 4BK4A 1Z7S2 4HVOA 2XJRA 4B8EA 4OQ8A 1RUI1 4XUQA 1LRHA 3ZXLA 4CDWA 3USUA 1F5JA 4CU8A 2BDRA 1TMF2 3ILRA 4YLZA 1UD1A 3RWNA 1IS4A 1BEV3 1JW6A 3ACLA 4XIKA 3U07A 5HBAA 1VAVA 1NXD1 1AL22 3SITA 3J8F2 4K3UA 3VD5A 4YVSB 3VZMA 1WW6A 4XFCA 2BBAA 2XJUA 2VNRA 3HQUA 1YQ6A 4P9GA 1Z7S3 4Q1RA 4FXGB 4NROA 3UJOA 5CFDB 1H8TB 2VNVA 4HANA 4Q26A 4RQPC 5LATA 2DUOA 4ASMB 5FYTA 4OUSA 2JDUA 2WZR1 5FAXA 4NIAA 5E6HA 5A3WA 4G3YC 3UL2A 1AR61 3VHPA 1ULCA 4RR3C 5ISLA 3T4VA 3KF5A 3BALA 3EYPA 4LXLA 2G9GA 1UMZA 1XC6A 1W90A 4NAMA 4FOYA 3J7LA 5EFUA 1F9KA 1W9YA 2OYZA 2PHDA 5FK7A 5L7OA 5CEHA 3HNYM 1JZ2A 2HBTA 2C1FA 1QJU3 2Z79A 4NN0A 1CQ9A 1S0JA 4QB6A 2H0BA 4QX0A 3KZ4C 4QHOA 5LA2A 3WDXA 5J48A 5C8CA 3CLPA 3DXUA 1RUC1 1U12A 1IHMA 5GZEA 1R64A 4OHXA 1D4M2 3I4IA 3PUQA 5I93A 3PUIA 5A33A 2GNMA 3ZN6B 1S0FA 4D7TA 1H8TA 1GUIA 2PHRA 1CJDA 4QQPA 3H8XA 2BPA2 1Q56A 2Y34A 4YZ2A 1Q3EA 4PI0A 2OUHA 1XBFA 1YXWA 2BOJA 5JMOA 2O0OA 4UW5A 2Q4SA 5FMBA 2W46A 3MYXA 4LHNA 1UMIA 3I7DA 2BJSA 4B4QA 4DRVA 1OLRA 5FO8B 5LZ6A 2WAOA 1Y7BA 3N7MA 5LB6A 2JIJA 3MLKA 1DQ6A 3FZ3A 2MHFA 2X5IC 4BQ1A 3M3QA 4XDQA 2B7YA 1ULPA 3AFGA 3DYMA 1VJ2A 1H6YA 1ULDA 5FYMA 2BFUL 4XHXA 2RDNA 4LE4A 4N53C 4AL9A 4EWDA 3W58A 2FZ2A 1W2OA 4BISA 4Q4W2 2W5FA 3NNMA 4Y20A 1H4GA 1K3IA 1UIJA 4R9BA 4DUVA 2HYXA 4QPIC 4KGGA 1UWWA 2OKXA 1DU3D 4N9IA 4Q4Y3 4FPKA 2TUNA 3I2OA 1E57A 2WNOA 5A6YA 4MHRA 2DU1A 3RYKA 3U14A 2AENA 2X8KA 5T5JA 1XPWA 2JDNA 5GZDA 3MDPA 3WDYA 5B2GB 1N3PA 4LUMA 3QBQA 2ZZJA 1E5HA 5GLWA 5HCHA 2BYVE 3CNAA 1RUD1 1QXJA 5L9VA 2I74A 2IXCA 2X29A 3FMGA 3WUDA 4IV1A 3FHQA 1GNHA 2CHHA 4JC1A 2OZJA 2WS91 3WQBA 2ZEXA 4NUBA 2VQAA 1IGOA 1IG0A 1Y43B 1RUH2 2UWAA 1QKQA 2WT2A 2A6VA 2WZEA 4FO9A 2E32A 4G4FA 5FY1A 4KG0A 1RUC2 4HN1A 1W8FA 4E27A 3ZO0B 2ZX3A 4Q4V3 4NVPA 3WG1A 3ZYRA 1WLDA 2P37A 3CJXA 1SLAA 2DCKA 2ZBJA 5I0TA 1ND3C 5GJ6A 2F17A 3UJQA 2E31A 1FPN2 4LUKA 2ERFA 2BTVC 2QQPA 2BEOA 1IS5A 1D0HA 4ASKA 1JYWA 1J3QA 4EN7B 5KXBA 2O8QA 4WVMB 2WNUA 5L36A 5ABJB 5DN2A 1TEIA 4IESA 1LOEA 3CJIB 2A1XA 5HCAA 3VKMA 4JCKA 3E5UA 3PVNA 3AYEA 1L7QA 3PDQA 3TN91 3Q8BA 4CP1A 4V1PA 1AL21 1D2SA 3KM5A 3T0DA 2VECA 4NHKA 3GJAA 1BEV2 3OEBA 1L7LA 1IQDC 1C28A 1LEDA 1AXKA 1NQDA 2EXJA 4HETA 1AL23 4HMZA 4JVAA 3WW2A 1H6XA 4AFAA 4M01A 2R063 4BQYA 2DVFA 3APBA 4DB5A 5FMCA 2YHJA 2R49A 4FXKB 1R1A2 2R6QA 1QH7A 3VL9A 2RS33 2JIGA 4Q27A 2ZGOA 2ZGNA 4OHVA 5FPXA 2ILMA 1SHWB 5AFBA 1AR62 1RUG1 1RC6A 3BCWA 3KT7A 4XPVA 5KXCA 1LOBA 1C3HA 3OD4A 2RS51 3I54A 1WKYA 5A7WB 4E2SA 1PZ9A 5ACA2 2WLPA 3NKGA 1NA1A 4YZ1A 2VOTA 2UWBA 4HK8A 4JQTA 4UFIA 2V72A 3WLUA 4AVSA 3WW1A 1VAKA 4H3WA 4QGNA 1WMEA 4Q4Y2 4HKLA 3ETPA 3USUB 3IPVB 3JD71 3ZKYA 2YGMA 3HNBM 1BJQA 3L2YA 5JOYA 3ZSKA 1VBB3 1PMJX 2VCMA 4QKFA 3BN6A 4O61A 1WBFA 1CAUA 4LKFA 4M0HA 2NYYA 4OHWA 4CCEA 3ZYBA 3WCSA 1HJFA 1VB2A 2HBUA 4GJYA 3UETA 4E4ZA 3ILFA 1O4ZA 5EYXA 4AVVA 4XFHA 2GH2A 1DGRA 1NCQC 2XONA 3MIGA 4QX5A 2QCSB 2WO7A 4CDXB 1ENRA 1KITA 4AWDA 2VOKA 2D44A 3AZXA 2DURA 1AYN2 5JZGB 2LW8A 3ASIA 4GKXA 3UK9A 2XWBB 4NHYA 1OKQA 5FJKA 1ND3B 2UYAA 2X53S 4C8DA 5HXVA 3VKFC 4CA9A 2EALA 3LCPA 3WQ7A 2V5YA 5F32A 3MHZA 4QX7A 2Q8DA 3S5AA 4RYDA 1REDA 3FHIB 1NLSA 1NOVA 3AJYA 2RMU3 5EXOA 4RD7A 4L8QA 3FLPA 1WA4A 4LBJA 4K20A 4CU6A 1YI9A 2XBO1 1MZEA 1F4HA 4Y1YA 1SDDB 4FP2A 4PJYA 4WVMA 5FKCA 5F3GA 1JZ4A 3EJKA 4UFHA 5FZ6A 3VBUC 1VBA2 3WQ0A 1H1MA 4LHLA 4HVQA 1XYPA 2QKDA 1O3QA 2QZ2A 5DDJ2 4YVWC 2D6NA 1UZ0A 4JKLA 4GXLA 4YW4A 1KQRA 5D8AB 2XKPA 1RUI3 1RUJ2 4QQOA 4ZS2A 1UOGA 3RJRA 5FREA 4Q2FA 2Y0IA 1G9FA 2OIIA 5F2WA 4LPLA 1R092 1YUDA 3D0JA 4YZ3A 3GCXA 5D21A 2P17A 1EUUA 1LGBA 4XC9A 3R4UA 4KWKA 5F2SA 5FMOS 3FWEA 4LA3A 4QT6A 4B7KA 1VIWB 4MXWA 2LM3A 4META 2FDKA 3HN1A 5BNOB 2WFF2 1RB8G 3M70A 1H8VA 2EAAA 4B4PA 5IVEA 1GLHA 4Z07A 1S0EA 3WG3A 1GOGA 3D4KA 4HFSA 1FMD1 3ROUA 3ALQA 5KC5A 1SBEA 2YC2A 4LLOA 2Q8EA 3NWKA 4A45A 4CUAA 1LECA 4ZU5A 3K4DA 4DXSA 2BOIA 4OULA 4X6QB 1W03A 3INAA 3MW2A 1X9PA 4FFIA 3ZKUA 1GWMA 3O12A 5HI0A 5FYZA 5DG1A 1ZRCA 3ABZA 3K4ZA 2W1WA 2ZXQA 4RHV2 4YARA 4AGGA 2R0FA 2PHWA 5C71A 4YGBA 1OOPA 1RUD3 4AHZA 1UW8A 4DXTA 3OGRA 2G9ZA 2GC1A 2QTWB 4CP9A 3CZUA 4GIQA 4RFT0 2R072 3WXPA 3LWCA 1AR72 1LTEA 2RR11 2JX9A 3U75A 2VVFA 4Y24A 2AEZA 1IKQA 2VW2A 2Z69A 3KT4A 5T5LA 3OY8B 4JRAA 4BLJA 5JI9A 4C0BA 4LHKA 2P4EA 1HRI1 2CTVA 3MPBA 2H6CA 3VBSB 4PDWB 5CKNA 5K9YA 5DDJ3 4JDMA 4YSFA 3IT8A 3T0BA 3LKJA 3OPWA 4J25A 5A6QA 3H0OA 3D8CA 4GULA 5FO7B 2XMLA 1CAUB 1OUSA 3JQWA 2VZPA 3L9JT 2LALA 1WW5A 3HBZA 1PO11 3MIEA 4NHLA 4MUVA 3NRUA 4DIQA 3GF6A 2KA3A 1DQ2A 4QKNA 3O1UA 2SBAA 3M3OA 5I8YA 1PVC3 4HPKB 5FMOL 2VTXA 1QEXA 1LGCA 2GMEA 4Y4YA 1N1VA 3VBFC 4CE8A 4CSWA 1ULFA 4KWLA 3SXWA 1JODA 3IN9A 1IZ3A 5IATA 3VBRC 1HB4A 1NCRC 1HB1A 2IWGB 2XBO2 2X5IA 4LOTA 2RJLA 3E97A 3FE5A 4LOSA 3ZIWA 5JWPA 1L3JA 5A7NA 2JDAA 1KFUL 3KQRA 4C90A 4MH0E 2Q8CA 2V4AA 2HH9A 4N53A 1QJY3 4KH9A 1GZTA 3GZTB 3U10A 4D6RA 3LFMA 1ZBE3 2W08A 1LU1A 3OD0A 2WO1A 1J3PA 1ZZBA 2IXIA 4OYUA 2ZGLA 2JD4A 3I3EA 2RM23 2YC0A 3WG2A 1UOJA 2D97A 3IDEA 4JKMA 4LBMA 5C9AC 4MVTA 5AC91 1AYM2 1NE6A 4H2AA 3K75B 3NNFA 3LA7A 3LDRA 1PK6C 3WT3A 3ZMOA 3W5MA 3I3DA 4LO7A 4QPGA 4P9YA 1FNZA 4JX0A 3S57A 1XRUA 1DGWX 4KL1A 3WF3A 3IMMA 1JS9A 4Y1ZA 4QM9A 3MLLA 4QPIB 4YW5A 5A7SA 3MIBA 5M0TA 1JH5A 3GHMA 1VLNA 4R9AA 2FD8A 3T2PA 1A78A 3HEIA 3TN92 1QOSA 1QOOA 4XXAA 5BNPC 3NV3A 1JHJA 2GAUA 4FVVA 1ZVFA 4UFKA 3J26N 4N43A 5A1LA 3WP6A 2N7GA 2A71A 2R042 1S2BA 1ULOA 2ZEWA 1A3KA 3KD4A 2RS13 4FOWA 3VZJA 1MZFA 4E8CA 3V0BA 4LBOA 5FOBB 5FWEA 2YYOA 5GLZA 2EXIA 2WWJA 2ZAHA 3ACIA 4JTNA 4I30A 3DPRB 3IMNA 2AGSA 1JOJA 4P9XA 4CCKA 5KR7A 1K5MC 1ZBA3 1BZWA 1DGRN 1IG3A 3MV01 4TN7A 4ZKTB 4IL7A 3AM2A 1Z78A 3PU8A 2RG4A 3UKNA 3BIEA 2GC3A 2JECA 4OCTA 1Q8VA 3PU3A 2BNMA 1V6OA 2JG8B 4XHBA 2ZEZA 4S2GA 2H6BA 3TNPB 2VD7A 4OUEA 1ENXA 1KFXL 1PX4A 1WCDJ 1WW4A 4A7ZA 1FNYA 4BJ0A 1LODA 1TG7A 1W8ZA 4BWOA 3T30A 1A8MA 3LD8A 2YROA 1W39A 5FYCA 4MO3M 5FP4A 1WW7A 1RUF1 2ZGQA 3CBNA 2JDYA 1RMU2 4EZHA 3WV6A 2F4LA 2XBO3 2VULA 1XNKA 1FPN1 4BPZA 4PHZA 4K1YA 4BLIA 2PYTA 3M3IA 1V6JA 4PCRA 1QDCA 1C8NA 2YXSA 2UY9A 4PIZA 1OURA 1TME2 3B00A 4YW1A 3RNSA 4UI9L 4ITCA 4QGLA 2QQNA 3CDZB 2BQPA 1VPHA 2VZSA 3NL1A 4ZS3A 5FJHA 4BQWA 5K0UC 2WQ8A 4CTEA 2DV9A 1POQA 3S7EA 3I3MA 4I3GA 3KGZA 3T3YA 4EZ4A 5AC93 2YC4A 3CHXA 4P5HA 2A3XA 2JKXA 4Z82A 3BI3A 2VZTA 4EV0A 5CG9A 1EY2A 3I2IA 3AKPA 5EZWA 3ZDVA 5L7OB 4ET7A 2Y6KA 2G1MA 3IZOA 1ZREA 3A21A 2GNDA 1H9WA 3KV9A 5CIRA 5JMCA 2DCZA 3T2OA 1UZYA 5K0UB 1W6NB 1OI6A 3J7HA 2GMMA 2WAAA
chains in the Genus database with same CATH topology
2W92A 2E33A 3WF1A 4AAXA 1GQPA 4P02B 3VD9A 2ORXA 2QQLA 2WYSA 4ARYA 2WO3A 1UMHA 4XUNA 4ZY9A 4E8DA 5JXJA 2BZDA 4KI5M 4RN5A 4BK4A 3LE0A 2RVAA 2Y6JA 4XUQA 4CU8A 1K45A 3GXUA 1KEXA 1L7RA 3VD5A 1W99A 2BBAA 4QX1A 3FL7A 1CX1A 4BK5A 1PX3A 3I3BA 3MUY1 4UOJA 4DUXA 2JD9A 3ECQA 4HG6B 4MADA 1SG3A 3ACGA 3OBAA 4GWIA 2YB7A 3EYPA 4TTGA 1DYOA 1XC6A 3I2FA 1JZ2A 3HNYM 4QB6A 4QX0A 3I2HA 5LA2A 3JXSA 4CU7A 1R64A 3PUIA 1OD3A 1J83A 4BDVB 1GUIA 2VCCA 4LHSA 2JE8A 5FUIA 1TVGA 5JMOA 5B4XA 2W46A 2L9LA 1UMIA 2V4VA 1GOHA 2BERA 4P00B 4ZXEA 1O8PA 2Z4FA 3WNMA 1JZ3A 4XVHA 1F4AA 2WAOA 2X10A 3IIIA 3C7OA 1ULPA 3DYMA 1H6YA 3CQOA 3LQCA 4MGSA 3I2JA 2YG0A 5IJRA 2QQMA 3A7QA 2W5FA 4A4AA 1K3IA 1JYNA 3WF0A 3C7GA 2BGPA 3CZJA 4DUVA 2HYXA 4IUGA 5JXHA 4GZ9A 3T09A 1UWWA 2OKXA 4XUOA 4DEQA 4A44A 1JI6A 3LEKA 1XPWA 1UY4A 1DLCA 4XUTA 1W8NA 1DP0A 5IYYA 1LNSA 4XUPA 3FHQA 2VQUA 3WQBA 2ZEXA 4TXWA 2VL4A 3I97A 1JU3A 2WZEA 2XHNA 4W8JA 2QQKA 2DDUA 5I0DA 2E32A 2J1EA 2CDOA 2W91A 3WF2A 3MV11 2W3JA 3OEAA 4W50A 1CIYA 4ZZ8A 4QX3A 2DCKA 1O8SA 1UYZA 3WNLA 4CVUA 2E31A 3VD3A 1UXZA 1K42A 2Y6HA 1US3A 1JYWA 4GWJA 4BXSV 3HN3A 2VC9A 3THDA 1GNYA 3UESA 1W8OA 5DN2A 4LKSA 3C7FA 2J1RA 1OH4A 3T08A 1L7QA 1W9WA 2VZ1A 2C26A 3DYOA 4QDQA 3T0DA 4QDSA 1MPXA 2EIEA 2ORZA 4PT6A 2QQOA 2W9XA 3OEBA 4CUBA 3I2KA 4Z2AA 1IQDC 3VD4A 5HPOA 4AG4A 5C71A 1H6XA 1JZ6A 2W1SA 1W9TA 4P5YA 1SHWB 1I5PA 4OMDA 3IAPA 4MGQA 1PMHX 3FHAA 1WKYA 2E26A 1JZ5A 4ARXA 2VOTA 3VDCA 3NQHA 3OB8A 2V72A 3A22A 5CZKA 4L0PA 3ACFA 1UYYA 3ETPA 3HNBM 2R7EB 3BGAA 2X09A 4XURA 4KMQA 4A6OA 2XOMA 3UNPA 1PMJX 5IHRA 3BN6A 2W1UA 3HPNA 5JR2A 4JKKA 1YQ2A 2QBXA 1K12A 2Y64A 3UETA 1XNTA 3MUZ1 2XONA 3SEPA 3VDAA 4M4RA 2VO5A 3WF4A 2LW8A 4D8MA 5C7GA 2VZUA 3LPGA 5DPNA 2W87A 3CKHA 4W4ZA 2J7MA 2W47A 4RYDA 4QDRA 5CYYA 3WNPA 2C9KA 2VQTA 2WUHA 4CU6A 3WNKA 2B9VA 5G05L 1BHGA 1F4HA 3DYPA 1SDDB 1JZ4A 1GMMA 4MOAA 2VCAA 3SEEA 2QQJA 1UZ0A 4JKLA 3P6BA 2VZVA 4JHZA 3E1F1 4YPJA 3WNOA 5LA0A 3GDBA 2C4XA 3IAQA 4QAWA 1CZTA 1OF4A 2VTFA 4LPLA 1EUUA 2Y8KA 4PQQA 1UY2A 4OZOA 2YFUA 3OGSA 1GU3A 2WBKA 2Y6GA 3HNMA 3MO4A 2V5DA 4CUCA 1UY3A 2LS6A 2VMDA 2BGOA 1GOGA 2EICA 4QX2A 3ZM8A 3CIHA 2YC2A 4CUAA 4A45A 3WNNA 3K4DA 4DXSA 4ZZ5A 5DMYA 3VDBA 2RV9A 5JXIA 3ABZA 3K4ZA 2EIDA 2W1WA 2ZXQA 3T0AA 3U37A 1J84A 2EIBA 4DXTA 3OGRA 5EIYB 3CZUA 3C7HA 4A41A 1P8JA 3T2QA 1UY0A 3LEIA 3GM8A 1OT5A 5HXMA 3GGLA 3IB3A 5EJ1B 3NJVA 2J1SA 3F2ZA 2VZ3A 3T0BA 2ID4A 5IFPA 2J1VA 3WSOA 4D0QA 2VM9A 2VZPA 5JXGA 3NNGA 3NRUA 1OF3A 1JYXA 5EJZB 3LEGA 4A3ZA 4QB1A 2J1AA 2XQXA 3DECA 2YFZA 4KWUA 4FI9A 2VMCA 3MBWA 1NAEA 2HLEA 3OG2A 1JU4A 3AC0A 2JDAA 1KGYA 4CU9A 4QB2A 3C7EA 1WCQA 1RYYA 2WO1A 1JYVA 4OYUA 3SKJE 3NJXA 3SKVA 3I3EA 3OGVA 5LA1A 4JKMA 4OMCA 4PF1A 3ACHA 3HJRA 2VCBA 3K75B 4M4PA 1JZ8A 1D7PM 3I3DA 4LQRA 3W5MA 2DCJA 1HN1A 4JX0A 2CDPA 1W0NA 3WF3A 3P1IA 3K46A 3T2PA 2QQIA 3HEIA 4QPWA 1JHJA 2VMEA 2W1QA 4DEVA 5F7UA 2WN3A 1O59A 3VD7A 4A42A 3W5NA 1ULOA 2ZEWA 4XZUG 5C70A 2VMFA 4E8CA 3CMGA 2RJ2A 3C8XA 3ACIA 1EUTA 3A23A 5J1XA 2ZEYA 1XNAA 3K77A 1CZVA 3MV01 2W95A 2VZRA 4P08A 2PQSA 4DUWA 4UAPA 2ZEZA 4OUEA 1PX4A 1US2A 2W94A 2KD7A 2VZOA 4BJ0A 1TG7A 3D3AA 2VZQA 2J22A 3FN9A 4MO3M 3EB7A 5IFTA 5LCWL 3WEZA 2VJXA 2Y6LA 1NKGA 2J1TA 3PUHA 5B4NA 3I2GA 1JZ7A 1UYXA 2WDBA 1UY1A 2J1UA 5G04L 2VR4A 4UI9L 2QQNA 3CDZB 2VZSA 1W9SA 3HOBA 3THCA 2WQ8A 1GOFA 2YC4A 1T2XA 2WO2A 2B4KA 3IDAA 2JKXA 5JUVA 1UXXX 2VZTA 2WABA 3I2IA 1CZSA 4ET7A 2Y6KA 2WN2A 3A21A 2WZ8A 4DXRA 5DQ0A 3LPFA 5A1AA 1NX9A 2X05A 3T2OA 3K4AA 1NUKA 3J7HA 1UX7A 2WAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W92 A;  2E33 A;  3WF1 A;  4AAX A;  1GQP A;  4P02 B;  3VD9 A;  2ORX A;  2QQL A;  2WYS A;  4ARY A;  2WO3 A;  1UMH A;  4XUN A;  4ZY9 A;  4E8D A;  5JXJ A;  2BZD A;  4KI5 M;  4RN5 A;  4BK4 A;  3LE0 A;  2RVA A;  2Y6J A;  4XUQ A;  4CU8 A;  1K45 A;  3GXU A;  1KEX A;  1L7R A;  3VD5 A;  1W99 A;  2BBA A;  4QX1 A;  3FL7 A;  1CX1 A;  4BK5 A;  1PX3 A;  3I3B A;  3MUY 1;  4UOJ A;  4DUX A;  2JD9 A;  3ECQ A;  4HG6 B;  4MAD A;  1SG3 A;  3ACG A;  3OBA A;  4GWI A;  2YB7 A;  3EYP A;  4TTG A;  1DYO A;  1XC6 A;  3I2F A;  1JZ2 A;  3HNY M;  4QB6 A;  4QX0 A;  3I2H A;  5LA2 A;  3JXS A;  4CU7 A;  1R64 A;  3PUI A;  1OD3 A;  1J83 A;  4BDV B;  1GUI A;  2VCC A;  4LHS A;  2JE8 A;  5FUI A;  1TVG A;  5JMO A;  5B4X A;  2W46 A;  2L9L A;  1UMI A;  2V4V A;  1GOH A;  2BER A;  4P00 B;  4ZXE A;  1O8P A;  2Z4F A;  3WNM A;  1JZ3 A;  4XVH A;  1F4A A;  2WAO A;  2X10 A;  3III A;  3C7O A;  1ULP A;  3DYM A;  1H6Y A;  3CQO A;  3LQC A;  4MGS A;  3I2J A;  2YG0 A;  5IJR A;  2QQM A;  3A7Q A;  2W5F A;  4A4A A;  1K3I A;  1JYN A;  3WF0 A;  3C7G A;  2BGP A;  3CZJ A;  4DUV A;  2HYX A;  4IUG A;  5JXH A;  4GZ9 A;  3T09 A;  1UWW A;  2OKX A;  4XUO A;  4DEQ A;  4A44 A;  1JI6 A;  3LEK A;  1XPW A;  1UY4 A;  1DLC A;  4XUT A;  1W8N A;  1DP0 A;  5IYY A;  1LNS A;  4XUP A;  3FHQ A;  2VQU A;  3WQB A;  2ZEX A;  4TXW A;  2VL4 A;  3I97 A;  1JU3 A;  2WZE A;  2XHN A;  4W8J A;  2QQK A;  2DDU A;  5I0D A;  2E32 A;  2J1E A;  2CDO A;  2W91 A;  3WF2 A;  3MV1 1;  2W3J A;  3OEA A;  4W50 A;  1CIY A;  4ZZ8 A;  4QX3 A;  2DCK A;  1O8S A;  1UYZ A;  3WNL A;  4CVU A;  2E31 A;  3VD3 A;  1UXZ A;  1K42 A;  2Y6H A;  1US3 A;  1JYW A;  4GWJ A;  4BXS V;  3HN3 A;  2VC9 A;  3THD A;  1GNY A;  3UES A;  1W8O A;  5DN2 A;  4LKS A;  3C7F A;  2J1R A;  1OH4 A;  3T08 A;  1L7Q A;  1W9W A;  2VZ1 A;  2C26 A;  3DYO A;  4QDQ A;  3T0D A;  4QDS A;  1MPX A;  2EIE A;  2ORZ A;  4PT6 A;  2QQO A;  2W9X A;  3OEB A;  4CUB A;  3I2K A;  4Z2A A;  1IQD C;  3VD4 A;  5HPO A;  4AG4 A;  5C71 A;  1H6X A;  1JZ6 A;  2W1S A;  1W9T A;  4P5Y A;  1SHW B;  1I5P A;  4OMD A;  3IAP A;  4MGQ A;  1PMH X;  3FHA A;  1WKY A;  2E26 A;  1JZ5 A;  4ARX A;  2VOT A;  3VDC A;  3NQH A;  3OB8 A;  2V72 A;  3A22 A;  5CZK A;  4L0P A;  3ACF A;  1UYY A;  3ETP A;  3HNB M;  2R7E B;  3BGA A;  2X09 A;  4XUR A;  4KMQ A;  4A6O A;  2XOM A;  3UNP A;  1PMJ X;  5IHR A;  3BN6 A;  2W1U A;  3HPN A;  5JR2 A;  4JKK A;  1YQ2 A;  2QBX A;  1K12 A;  2Y64 A;  3UET A;  1XNT A;  3MUZ 1;  2XON A;  3SEP A;  3VDA A;  4M4R A;  2VO5 A;  3WF4 A;  2LW8 A;  4D8M A;  5C7G A;  2VZU A;  3LPG A;  5DPN A;  2W87 A;  3CKH A;  4W4Z A;  2J7M A;  2W47 A;  4RYD A;  4QDR A;  5CYY A;  3WNP A;  2C9K A;  2VQT A;  2WUH A;  4CU6 A;  3WNK A;  2B9V A;  5G05 L;  1BHG A;  1F4H A;  3DYP A;  1SDD B;  1JZ4 A;  1GMM A;  4MOA A;  2VCA A;  3SEE A;  2QQJ A;  1UZ0 A;  4JKL A;  3P6B A;  2VZV A;  4JHZ A;  3E1F 1;  4YPJ A;  3WNO A;  5LA0 A;  3GDB A;  2C4X A;  3IAQ A;  4QAW A;  1CZT A;  1OF4 A;  2VTF A;  4LPL A;  1EUU A;  2Y8K A;  4PQQ A;  1UY2 A;  4OZO A;  2YFU A;  3OGS A;  1GU3 A;  2WBK A;  2Y6G A;  3HNM A;  3MO4 A;  2V5D A;  4CUC A;  1UY3 A;  2LS6 A;  2VMD A;  2BGO A;  1GOG A;  2EIC A;  4QX2 A;  3ZM8 A;  3CIH A;  2YC2 A;  4CUA A;  4A45 A;  3WNN A;  3K4D A;  4DXS A;  4ZZ5 A;  5DMY A;  3VDB A;  2RV9 A;  5JXI A;  3ABZ A;  3K4Z A;  2EID A;  2W1W A;  2ZXQ A;  3T0A A;  3U37 A;  1J84 A;  2EIB A;  4DXT A;  3OGR A;  5EIY B;  3CZU A;  3C7H A;  4A41 A;  1P8J A;  3T2Q A;  1UY0 A;  3LEI A;  3GM8 A;  1OT5 A;  5HXM A;  3GGL A;  3IB3 A;  5EJ1 B;  3NJV A;  2J1S A;  3F2Z A;  2VZ3 A;  3T0B A;  2ID4 A;  5IFP A;  2J1V A;  3WSO A;  4D0Q A;  2VM9 A;  2VZP A;  5JXG A;  3NNG A;  3NRU A;  1OF3 A;  1JYX A;  5EJZ B;  3LEG A;  4A3Z A;  4QB1 A;  2J1A A;  2XQX A;  3DEC A;  2YFZ A;  4KWU A;  4FI9 A;  2VMC A;  3MBW A;  1NAE A;  2HLE A;  3OG2 A;  1JU4 A;  3AC0 A;  2JDA A;  1KGY A;  4CU9 A;  4QB2 A;  3C7E A;  1WCQ A;  1RYY A;  2WO1 A;  1JYV A;  4OYU A;  3SKJ E;  3NJX A;  3SKV A;  3I3E A;  3OGV A;  5LA1 A;  4JKM A;  4OMC A;  4PF1 A;  3ACH A;  3HJR A;  2VCB A;  3K75 B;  4M4P A;  1JZ8 A;  1D7P M;  3I3D A;  4LQR A;  3W5M A;  2DCJ A;  1HN1 A;  4JX0 A;  2CDP A;  1W0N A;  3WF3 A;  3P1I A;  3K46 A;  3T2P A;  2QQI A;  3HEI A;  4QPW A;  1JHJ A;  2VME A;  2W1Q A;  4DEV A;  5F7U A;  2WN3 A;  1O59 A;  3VD7 A;  4A42 A;  3W5N A;  1ULO A;  2ZEW A;  4XZU G;  5C70 A;  2VMF A;  4E8C A;  3CMG A;  2RJ2 A;  3C8X A;  3ACI A;  1EUT A;  3A23 A;  5J1X A;  2ZEY A;  1XNA A;  3K77 A;  1CZV A;  3MV0 1;  2W95 A;  2VZR A;  4P08 A;  2PQS A;  4DUW A;  4UAP A;  2ZEZ A;  4OUE A;  1PX4 A;  1US2 A;  2W94 A;  2KD7 A;  2VZO A;  4BJ0 A;  1TG7 A;  3D3A A;  2VZQ A;  2J22 A;  3FN9 A;  4MO3 M;  3EB7 A;  5IFT A;  5LCW L;  3WEZ A;  2VJX A;  2Y6L A;  1NKG A;  2J1T A;  3PUH A;  5B4N A;  3I2G A;  1JZ7 A;  1UYX A;  2WDB A;  1UY1 A;  2J1U A;  5G04 L;  2VR4 A;  4UI9 L;  2QQN A;  3CDZ B;  2VZS A;  1W9S A;  3HOB A;  3THC A;  2WQ8 A;  1GOF A;  2YC4 A;  1T2X A;  2WO2 A;  2B4K A;  3IDA A;  2JKX A;  5JUV A;  1UXX X;  2VZT A;  2WAB A;  3I2I A;  1CZS A;  4ET7 A;  2Y6K A;  2WN2 A;  3A21 A;  2WZ8 A;  4DXR A;  5DQ0 A;  3LPF A;  5A1A A;  1NX9 A;  2X05 A;  3T2O A;  3K4A A;  1NUK A;  3J7H A;  1UX7 A;  2WAA A; 
#chains in the Genus database with same CATH topology
 1TMF 3;  2W92 A;  3HQR A;  2RMU 2;  3WF1 A;  1NCQ A;  2D3S A;  1OMI A;  3GYD A;  3PTR B;  4IGP A;  4MSV A;  4RSU A;  4AAX A;  4Y5Z 0;  2JG9 A;  5IK7 A;  1BK0 A;  4FBF A;  3VD9 A;  3UT0 A;  1POV 1;  5DG2 A;  4KU7 A;  1OHF A;  1RUE 3;  1JMU B;  3EBR A;  4FAH A;  5FO9 B;  5FYY A;  5A3M A;  1UMH A;  2OX0 A;  3ZMN A;  2RS5 3;  1AYN 3;  1SFN A;  5FPL A;  5FY0 A;  4E8D A;  5GLT A;  5JXJ A;  3K3O A;  4HL0 A;  1ZZ6 A;  2A3Y A;  4RN5 A;  4BQ2 A;  2RS3 1;  3LE0 A;  1VRH 1;  1YYN A;  4UXA A;  3N7J A;  3WNX A;  3SHR A;  3P5B A;  2WWU A;  3NVC A;  3FUO A;  2JKB A;  3W20 A;  1DZQ A;  1ND2 B;  5DDJ 1;  4JDO A;  4YRD A;  2LRO A;  4TWT A;  5LW9 A;  3ST7 A;  4GD4 A;  3GAL A;  4PDW A;  4K7J A;  1Y3T A;  1MEC 1;  4MZU A;  4QX1 A;  5A3T A;  4BK5 A;  5BUV A;  1X9T A;  1I3H A;  5F1R A;  4L9B A;  5TSW A;  5I8T A;  4XBL A;  1UX6 A;  2GP5 A;  2RR1 3;  2PA7 A;  1XU2 A;  3A0N A;  3LSD A;  4BU2 A;  4DY5 A;  3VUO A;  1S0G A;  2CWS A;  3OYW B;  3VHO A;  4MLO A;  4QHB A;  1PGW 2;  2KR2 A;  1W2N A;  1CX4 A;  1W8T A;  2QE3 A;  3MW3 A;  4O65 A;  3H9A A;  3OBA A;  4GWI A;  1NXM A;  3I2F A;  4R4Z A;  3UKT A;  4COY A;  1UZZ A;  3AX4 A;  2EIG A;  3MW4 A;  3E6C C;  4BQX A;  3NO8 A;  1ALY A;  2HWC 3;  2O8O A;  2V73 A;  1DCS A;  1QDO A;  1X7N A;  3I2H A;  1SBF A;  5LRR A;  3HT2 A;  5C4W C;  3LZZ A;  4CU7 A;  2AC1 A;  4PI2 A;  4BM8 A;  4Q4V 1;  1OC1 A;  4W6X A;  1YNA A;  1CAV A;  2UYB A;  2ES3 A;  5FBZ A;  5J96 B;  2B46 X;  1EPW A;  4CDU B;  4XW3 A;  3PMS A;  1CWP A;  3JD7 3;  1SFP A;  1N47 A;  1PGS A;  2VAU A;  2JE8 A;  4QWN A;  1OFS A;  2C5D A;  1R1Z A;  4Y20 B;  4AK3 A;  1UF2 C;  2YPJ A;  5J09 A;  1OQ1 A;  4FTS A;  2DU0 A;  2VBB A;  4ZXE A;  2CU5 A;  3WNM A;  3BTX A;  2WLQ A;  4QPI A;  3III A;  4LT5 A;  5LK7 B;  3O1O A;  1WD4 A;  1B35 C;  1FXZ A;  3VZO A;  3GBG A;  3ILN A;  3TB0 A;  1KJR A;  4KGQ A;  1ZX5 A;  4C1X A;  3VBS C;  4MGS A;  3I2J A;  1QXP A;  2DVD A;  4XQD A;  5IK4 A;  4Q4W 3;  4COW A;  5DZG A;  3B9I A;  1UYP A;  1WMF A;  3BPZ A;  1W3V A;  1T6B X;  3PVB B;  1EAH 1;  2BGP A;  3CZJ A;  3KGL A;  1HRV 1;  1MQT B;  2VBP A;  2ZAB A;  4IUG A;  1BLZ A;  3PJQ A;  3T1L A;  3T09 A;  4AW7 A;  4XUO A;  4DEQ A;  2YZ4 A;  1QNW A;  1O7F A;  1O4T A;  2CSG A;  3OUI A;  3J9S A;  3Q8F A;  1HN0 A;  1JI6 A;  4ES9 A;  5A32 A;  3LEK A;  1HXS 1;  4UFJ A;  2SLI A;  1HJG A;  5J3U A;  1W6O B;  4QU2 A;  1W3X A;  4XUT A;  3VDD C;  1DP0 A;  1OUX A;  5IYY A;  3DCQ A;  5FZ7 A;  2VW0 A;  5GZC A;  5IVY A;  1KDK A;  4NRP A;  3AVR A;  3IM0 A;  1BXH A;  4Y33 A;  5FY5 A;  3M7A A;  3VHR A;  5F3E A;  1W8U A;  4JGZ C;  3KV6 A;  2VQU A;  4DFS A;  1MVQ A;  1AR8 3;  4WV8 A;  2VY0 A;  4NPR A;  5T52 A;  4TXW A;  1O3T A;  1V70 A;  3I97 A;  2WKK A;  3ZDS A;  2ZMN A;  1PO2 1;  1GR3 A;  2YBP A;  2CDO A;  3WP4 A;  3KCX A;  4WZF A;  3WF2 A;  1APN A;  4K1Z A;  3UKV A;  5KXD A;  3MV1 1;  1CGP A;  2WFF 3;  1CAW A;  2B9U A;  3N9L A;  4P9L A;  4FFH A;  2HWC 1;  4QX3 A;  1QJY 2;  1RHI 1;  2HWF 1;  4MGK E;  4AED A;  3I49 A;  3VD3 A;  1UXZ A;  1QJU 2;  4GJZ A;  2TNF A;  4OI2 A;  4CXX A;  1W6Q B;  5A1F A;  5FZO A;  2QDR A;  3HN3 A;  5LBB A;  2PXJ A;  3AXD A;  5K8S A;  2FDJ A;  2ZJC A;  4EWA A;  1W8O A;  1OH3 A;  4BCU A;  1AYM 3;  1UCX A;  1ULE A;  2J42 A;  2JE7 A;  2WA3 A;  4JZR A;  4LKS A;  1IOA A;  3C7F A;  2XJT A;  2DBN A;  4S2H A;  1N3O A;  3D0S A;  1MEC 3;  3J7N A;  5K4L A;  4L99 A;  5BNO C;  5FPV A;  5FY8 A;  1YO8 A;  2C26 A;  1EAH 3;  4QDQ A;  2D3R A;  4I02 A;  2EIE A;  2ORZ A;  4PT6 A;  2QQO A;  5FYI A;  1ZA4 A;  1RXG A;  2ZGS A;  4Y26 A;  3N4M A;  3VD4 A;  4B1L A;  1JZ6 A;  2I2S A;  4JAA A;  5APA A;  1LHV A;  1W06 A;  2GAL A;  5F8P A;  3AZZ A;  2LTN A;  1Q8Q A;  1DZT A;  5KHK A;  1F8V A;  4AVC A;  3E5Q A;  1HV0 A;  2W1S A;  2FCV A;  1W9T A;  5JIU A;  2XVL A;  3E5X A;  5FOJ B;  4I0W B;  1W9F A;  1I5P A;  2P6H A;  4YM1 A;  5JVV A;  3ZLI A;  5IAX A;  4OMD A;  4IER A;  4MGQ A;  2FMY A;  3ENR A;  2OPK A;  4ARX A;  1QMJ A;  1WCS A;  5DUV A;  3CJI A;  4GH4 C;  1EV1 1;  5L9B A;  3OB8 A;  4AVT A;  3TRS B;  2CNA A;  4LBQ A;  3OPZ A;  4O9E A;  4BQ4 A;  1DDL A;  1H2N A;  2YDE A;  3NMB A;  5JI7 A;  2FZ1 A;  1W28 A;  1DGW A;  2HWF 3;  1R08 2;  1TMF 1;  2CGP A;  2AR6 A;  4A6O A;  4LIT A;  5IW0 A;  4RFR B;  3HPN A;  1VBC 3;  4AFC A;  3OUJ A;  5JR2 A;  1LOC A;  4BIF A;  2QBX A;  5F9T A;  1ACC A;  1BBT 1;  3IBM A;  4N43 B;  1BVV A;  4XFG A;  5LY2 A;  2XGX A;  4K21 A;  1Q8O A;  3GJB A;  2Y60 A;  4RS5 C;  5E89 A;  4AEM A;  4DO0 A;  3SEP A;  1COV 2;  3VDA A;  1SBD A;  2JEM A;  4LK6 A;  2ZGR A;  4XBN A;  1XNC A;  2VO5 A;  1EPZ A;  5JR7 B;  1EV1 3;  1VP6 A;  3S5Q A;  2VZU A;  3LPG A;  4LEJ A;  5LEJ A;  5DPN A;  2VU9 A;  1VR3 A;  2W47 A;  1KRI A;  3O1P A;  2DF7 A;  5CKM A;  2Q1M A;  3DKQ A;  1QY4 A;  2WFP A;  5C8W A;  5L19 A;  1UQX A;  1UPS A;  1A6C A;  3WNP A;  2VQT A;  1AR9 1;  3VKL A;  3ZXK A;  3WNK A;  4IGQ A;  5G05 L;  5C9A B;  1WD3 A;  4M3C E;  5IVF A;  1AX0 A;  2NM1 A;  4IGO A;  1REF A;  4J6G A;  1REE A;  1EAH 2;  2XKO A;  4P9J A;  2HWC 2;  2QQJ A;  1SLC A;  4CPB D;  4CEY B;  4CRQ A;  2FDH A;  1V6M A;  2RDS A;  3SMH A;  4IEV A;  1YQ8 A;  1QJE A;  1X8M A;  3K3N A;  2C4X A;  2VOW A;  4L92 A;  3SCG A;  3ZX7 A;  3IAQ A;  4QAW A;  3ZN5 A;  4W6Y A;  4IV3 A;  2Q8O A;  1WLT A;  2BVB A;  4PF5 A;  4WZC A;  1OLQ A;  3AL5 A;  3JBG 2;  4A6S A;  2O1Q A;  3EO6 A;  4NIG A;  1POV 3;  3X29 B;  2VXR A;  5BYN A;  3ORJ A;  2OXB A;  5DZE A;  3HIF A;  1GU3 A;  1QIQ A;  4L97 A;  4EYU A;  2G19 A;  1RTV A;  4GB3 1;  1NCR A;  4AEK A;  3QCW A;  1BVP 1;  4S2F A;  1QHD A;  3WHT A;  2AUY A;  2VMD A;  3MF6 A;  1NA1 B;  3PLQ A;  4PLO A;  5A7Q A;  5FZ1 A;  3CIH A;  3WY6 A;  1CR7 A;  4J1W A;  2QFE A;  5A7W A;  1BMV 2;  1OOP C;  4RGG A;  4Q4V 2;  2ZA9 A;  1I6X A;  3ZN6 A;  1TZO A;  1CAW B;  3WG4 A;  3VZK A;  5DMY A;  1MS9 A;  5DAW A;  4OI4 A;  5BNN A;  3J8F 1;  5JLV A;  4PDW C;  1QJU 1;  3USS A;  1HLC A;  3ME2 A;  2DBI A;  1VMH A;  5A3N A;  1PGL 2;  3ZSL A;  1TNF A;  1MAC A;  3T0A A;  1PVX A;  5FZB A;  4BXF A;  5KXE A;  2WQZ C;  3PHM A;  3OBT A;  3NNJ A;  1LHO A;  1MS8 A;  3OF1 A;  2EF6 A;  2XH6 A;  3WOG A;  3RSJ A;  4Z2W A;  4X8N A;  5IVC A;  2WC2 A;  1DQ1 A;  2WZR 3;  5FUP A;  4EQV A;  3WP3 A;  4Q1P A;  2JG8 C;  4A41 A;  3T2Q A;  1IPJ A;  2ETE A;  4H14 A;  3ZSE A;  1WBL A;  4UW6 A;  5ANQ A;  2W68 A;  3POY A;  4KWJ A;  3DUI A;  4XJZ A;  1GZC A;  3GGL A;  3VBU A;  5A32 B;  4CUG A;  3ES1 A;  4QM8 A;  2DTY A;  5DUX A;  2RDR A;  3DPR C;  3NJV A;  4ZXK A;  5FXZ A;  2D6M A;  4EN6 B;  1CJP A;  1VBB 2;  1I1E A;  4H55 A;  2X5I B;  4LTA A;  1YRZ A;  2ZKL A;  3AFK A;  4KBB A;  3H3U A;  4D69 A;  2BRT A;  4TZD A;  4UFM A;  2XXZ A;  1X33 A;  1NLR A;  2VM9 A;  5F6L B;  5JXG A;  4FPG A;  5FZG A;  1WLC A;  2G9F A;  4QXH A;  5EJZ B;  5H9S A;  3VZN A;  5BNO A;  5AC9 2;  4HPK A;  3PUR A;  1IPS A;  3B93 A;  2ZHL A;  5HV4 A;  3V0B B;  1M4W A;  3SC7 X;  4QB1 A;  3AXE A;  3ZVX A;  1SMV A;  1UU5 A;  1C1L A;  2GNT A;  3PME A;  4HSJ A;  3NAP A;  2ZGM A;  1RVF 1;  2NPI A;  4QQL A;  3WR0 A;  2HLE A;  1ND2 C;  3PJY A;  3LOB A;  1SPP B;  2GC0 A;  1B35 A;  2P1B A;  5FZH A;  2ET1 A;  3OTF A;  2XLG A;  4ZU7 A;  1DFQ A;  1AL0 G;  2YBS A;  1ZRR A;  3VBS A;  1ST8 A;  5KHJ A;  1D2Q A;  3C7E A;  1YWK A;  4GWN A;  2R0H A;  5JSR A;  1XQN A;  1ZZ9 A;  3RG0 A;  1WCQ A;  1RUC 3;  2RDQ A;  2IXL A;  2XUM A;  4NWW A;  1VBE 1;  3WW3 A;  1F15 A;  1JYV A;  3RYP A;  3SKJ E;  3BU0 A;  3PL0 A;  2XUE A;  1U5Y A;  1X8E A;  4OHZ A;  3EHK A;  3H1W A;  4PF1 A;  4RGA A;  4Q0P A;  1MZ6 A;  1OOP B;  3ZXA C;  5FQ0 B;  2HWB 2;  3AP9 A;  1C8M 2;  1NY7 2;  4I09 A;  1I5Z A;  3MZH A;  3RFR A;  1JYI A;  4QX8 A;  1D7P M;  2Z42 A;  2OS2 A;  4YGD A;  3RMY A;  1H8T C;  2ZAC A;  2ZGU A;  5JPM B;  3P1I A;  4AGR A;  4B1M A;  4WM8 C;  1LOF C;  3SCF A;  3HT1 A;  3POF A;  3M3C A;  2VVE A;  4IND A;  3BOP A;  4RHV 3;  3ELN A;  5C9A A;  1AXZ A;  2D5F A;  2DVA A;  1V6N A;  1FT9 A;  4ES8 A;  3O1V A;  1RMU 1;  5I8S A;  3FUQ A;  2VME A;  4R52 A;  2BNN A;  2D6O X;  2DCT A;  1O4Y A;  2JDH A;  4DEV A;  1JYT A;  1O59 A;  4HON A;  3LAG A;  1B35 B;  3ZIX A;  4X8P A;  1CIW A;  1PMI A;  5A7O A;  4UBG A;  1RUG 2;  2JEN A;  1W2A X;  1H1A A;  3H1Y A;  4K9S A;  3N35 A;  4W65 A;  2ZPX A;  1DLL A;  2FCT A;  2CYF A;  1XOY A;  1R1A 1;  1EUT A;  4BQ5 A;  3QH6 A;  1XYN A;  3A23 A;  4CP2 A;  5J1X A;  1V9U 3;  2XB6 C;  4AI2 A;  1VMJ A;  4JRL A;  4RL7 A;  5JCT A;  3RI9 A;  4KNC A;  3KQ4 B;  1BQP A;  3KV4 A;  3KVA A;  5JDB A;  2W95 A;  4FFG A;  1RJ8 A;  2VZR A;  3RWK X;  4D6Q A;  3RZG A;  1VRH 2;  2PQS A;  1SCS A;  1HB2 A;  2PN5 A;  4UAP A;  4HT1 T;  1LGN A;  3AP6 A;  3ZYH A;  2W94 A;  2KD7 A;  5FLH A;  4XTP A;  4AEJ A;  2BFU S;  4BE3 A;  5IFT A;  2P5B A;  1HRI 3;  1RMU 3;  1MEC 2;  4NOT A;  2LRP A;  4UFL A;  3ZR5 A;  1AZD A;  1N1S A;  1H9P A;  1JZ7 A;  4NE9 A;  3WQ1 A;  3FX3 A;  2ZHK A;  1UYX A;  5C3O A;  1BKZ A;  2RE9 A;  3N3H A;  3POE A;  1G86 A;  1UY1 A;  1QJX 1;  3B01 A;  5HV0 A;  1OPO A;  2R1B A;  2DFC A;  3QAC A;  5FIX A;  4PQ9 A;  5I0R A;  4OLL A;  1HDK A;  1JUH A;  4FAG A;  3B9C A;  2JDP A;  2MEV 1;  3WIN E;  3I59 A;  2E7Q A;  4JGY C;  3THC A;  1GOF A;  5A3U A;  3LDB A;  2DCY A;  5CFC C;  2WNU B;  3B69 A;  5GM0 A;  3RGB A;  1UO9 A;  2WO2 A;  1ZBA 2;  3IDA A;  3OUH A;  4XQW A;  3RMX A;  1UXX X;  2R1D A;  5JUV A;  2Y38 A;  4C0H A;  2GSY A;  1TNR A;  4YZ4 A;  1BBT 3;  3S6P A;  3ZYG A;  3PVO A;  2ZS6 B;  3B3Q E;  1J1T A;  2WZ8 A;  1V6I A;  5CFC B;  3LPF A;  3VBH C;  1BMV 1;  1CPN A;  4JGY B;  3K4A A;  2A6Y A;  4IE7 A;  1UX7 A;  3BKZ A;  4IEQ A;  5D8A C;  2OA2 A;  3K51 A;  5FZO B;  1OA3 A;  4YW2 A;  2XHK A;  5FZF A;  3M4F A;  2NZ9 A;  2ZHM A;  2ORX A;  4YM2 A;  1BYH A;  3H3Z A;  4BME A;  5C3S A;  4ISQ A;  1COV 3;  4N7I A;  3S0M A;  2ZOE B;  4ZY9 A;  4FPJ A;  1UKG A;  2VMH A;  1RUG 3;  1PO1 3;  5HCF A;  4D7Y A;  4PLN A;  4DQA A;  4YFZ A;  2VNO A;  3FBY A;  1NZC A;  2WNV B;  1Y9Q A;  1KEX A;  4CDX C;  3ZXF A;  3U11 A;  2NMO A;  2WRA A;  1VBE 2;  1W99 A;  3TN9 3;  4B7E A;  1N1T A;  1DG6 A;  1PX3 A;  2CY6 A;  4XEZ A;  3I3B A;  3WCR A;  1YJL A;  4LO8 A;  4O7X A;  4LMF A;  3MUY 1;  4R9C A;  5CVR A;  5ABJ A;  4DUX A;  1Q8S A;  1CON A;  1SDW A;  3D6E A;  5F5Q A;  1XYO A;  1NT0 A;  4HG6 B;  5ERL A;  2E53 A;  4MAD A;  5C4W A;  1IQA A;  2B5H A;  5FDB A;  2PFW A;  1LOA A;  2GH8 A;  2P2K A;  3OCP A;  5FP9 A;  1FAT A;  1HQL A;  3ZPO A;  4YFW A;  3Q8C A;  2RM2 2;  3SNM A;  1ZRI A;  4JGZ A;  3BIW E;  4JGZ B;  4XZP A;  4CCO A;  5FWJ A;  4QKB A;  3ZFG B;  1RHI 3;  2CWM A;  2JE9 A;  3ZYP A;  4MX3 A;  2R06 2;  2I07 B;  1RUI 2;  3O0V A;  1ZM1 A;  3DL3 A;  3S7I A;  1SAC A;  4M00 A;  1WUV A;  3JXS A;  2BWA A;  1HV1 A;  2PMW B;  3RJ2 X;  4EN8 B;  3POB A;  4Y5T A;  2FDG A;  1GWK A;  4Y1X A;  5DAB A;  1YIP A;  5IUQ A;  3NST A;  5FBJ A;  1AVB A;  1BK1 A;  4Z8B A;  1V0A A;  5GZG A;  5FZ4 A;  5FZ8 A;  2VE1 A;  4OUM A;  4COV A;  2JJ6 A;  4Q5O A;  2RHP A;  2XJP A;  1TVG A;  1RVF 3;  3EQE A;  4HXC A;  2QQW A;  5B4X A;  2L9L A;  3IIA A;  3FLT A;  1ONA A;  1XE7 A;  4MXV A;  4UYB A;  4NO4 A;  1HKD A;  1O8P A;  1VE0 A;  2Z4F A;  1T6G C;  1E5S A;  3PIJ A;  5DAX A;  3H8O A;  1UPI A;  5CAD A;  3T2T A;  4BMB A;  1RUO A;  1ODM A;  5FZE A;  1CES A;  4AHW A;  5F6K A;  4RQP B;  2R06 1;  4L11 A;  3LQC A;  2FBE A;  5DXD A;  1UZW A;  5BNP B;  5IJR A;  4ZU4 A;  3GZA A;  2QQM A;  4D7S A;  3L2H A;  3OBR A;  4UBH A;  3C2U A;  1QQP 1;  5F5I A;  3G6J B;  1JYN A;  4QQH A;  3RVH A;  3C7G A;  2QDN A;  4ATF A;  5EP9 A;  3AZV A;  1UKR A;  4NMI A;  3A4U A;  3N36 A;  4ATE A;  1FAY A;  5FY7 A;  2OUJ A;  4IE6 A;  4QPG B;  4COU A;  4KU8 A;  2YV8 A;  5JOZ A;  4D6S A;  3HR9 A;  2WZR 2;  1UY4 A;  5FLJ A;  1DLC A;  2R32 A;  3ETQ A;  4PIX A;  1QU0 A;  2YUE A;  1VBD 2;  4XAC A;  3VBO A;  1LNS A;  1STM A;  4NR1 A;  3ITQ A;  5FP7 A;  4OI1 A;  4AFB A;  2VMG A;  3H42 B;  4MV2 A;  1UOB A;  5DAQ A;  3ZSJ A;  2D5H A;  3N9N A;  4LO4 B;  5T54 A;  2VL4 A;  4XIL A;  2VQ0 A;  3UGF A;  1SLT A;  5C8C B;  4AHX A;  2W91 A;  1HX6 A;  2XR4 A;  4UWD A;  4DY3 A;  4XET A;  1X36 A;  4CDU C;  1VAM A;  2VMI A;  1XE0 A;  4FT8 A;  4ZZ8 A;  1PO2 3;  4CCN A;  2QJV A;  1O8S A;  1UYZ A;  1X50 A;  2B45 X;  3AYC A;  2R04 1;  3F95 A;  1AHS A;  4NJ4 A;  5F3I A;  3WNL A;  4LBN A;  1D0G A;  3LA3 A;  4CVU A;  1K42 A;  4QHZ A;  3VLB B;  3N9M A;  4OQ9 A;  2C9A A;  1KDM A;  2XQR A;  1G7Y A;  4CDQ B;  1NCQ B;  3O1S A;  4GWJ A;  4IEO A;  4LOR A;  2WZP P;  3THD A;  2JWP A;  4AI9 A;  4LO6 B;  1S2K A;  3UES A;  1JN2 P;  4F8A A;  2AZ5 A;  1AR7 1;  4YVS A;  3H8U A;  5CB7 A;  1OH4 A;  2ZX2 A;  1MQT A;  3GHN A;  3T08 A;  1Z7S 1;  3S30 A;  2UWC A;  3R6S A;  1ZRF A;  1E5I A;  1HRV 3;  4Q0S A;  4E4S A;  1RL3 A;  3KB5 A;  4LK7 A;  2NN8 A;  1MPX A;  1QQP 3;  1MS1 A;  2W9X A;  4CDW B;  3RQ0 A;  4CUB A;  4Z2A A;  3TEW A;  4H7M A;  4GH4 A;  2IUW A;  5HPO A;  1O5L A;  3I8T A;  4AG4 A;  4AOC A;  3ZOI A;  2D43 A;  2ARC A;  2WNE A;  2PAE A;  3KV5 A;  2HKX A;  2AEY A;  2K2S A;  4IV3 B;  4UT5 A;  2IVJ A;  1VRH 3;  3LSE A;  4WVW A;  3O1R A;  3ZFF B;  2RMU 1;  1WZX A;  4QD2 A;  3UGG A;  2EA7 A;  2EXK A;  4IE4 A;  2HYK A;  3FHA A;  2GZW A;  1JZ5 A;  1ZZ7 A;  4AQT A;  5C3P A;  3U78 A;  5FRA A;  3VDC A;  3A22 A;  4BHP A;  3C3V A;  1S55 A;  3JB4 C;  2KM2 A;  5CKQ A;  5CZK A;  3WDT A;  4WVZ A;  2VPV A;  3ACF A;  3MEP A;  1XXN A;  4IXL A;  5L9R A;  4HVR A;  2DUP A;  4OZX A;  1RUN A;  4MGZ E;  1JOP A;  5CBL A;  2PLV 1;  5JZG A;  2R04 3;  4FPE A;  3BGA A;  4FPH A;  1U0A A;  2X09 A;  4XUR A;  4KMQ A;  1GZW A;  2RS1 2;  4Z92 B;  5IHR A;  1FX5 A;  4C91 A;  4I0A A;  2W1U A;  1E5R A;  4FOV A;  3V56 A;  2WIN B;  1S2E A;  1VBC 1;  3B7M A;  2A70 A;  3CJI C;  3Q8E A;  3WP5 A;  4JKK A;  5FV3 A;  3FC0 A;  1O3S A;  4YG6 A;  5FZA A;  1AJO A;  1TE1 B;  1HRV 2;  2E9Q A;  1K12 A;  2VH9 A;  4AED C;  5BNN C;  1QQP 2;  1AXY A;  1MZ5 A;  2B8M A;  2DFB A;  4EN0 A;  1TQ5 A;  3BTA A;  1G9D A;  4XIO A;  2WNV C;  1X82 A;  2WS9 3;  3UGH A;  4GMP 3;  1ULG A;  3WF4 A;  4D8M A;  4COZ A;  2HEV F;  3AZY A;  4N43 C;  4WM8 B;  5T55 A;  1RUD 2;  4PBO A;  3CEW A;  1WGP A;  2ZTN A;  3CKH A;  1PM7 A;  3NKT A;  1AR6 3;  4JGY A;  4W4Z A;  5GAL A;  2XPJ A;  4B29 A;  2ZGK A;  2Q1F A;  3H50 A;  3O1M A;  2ZKN A;  5CYY A;  2PHL A;  1YFW A;  2C9K A;  3BTY A;  2GMP A;  1KS5 A;  4CCM A;  4OI0 A;  2TEP A;  3PUS A;  3VGI A;  4Q4X 2;  2ZML A;  3DYP A;  4CEW A;  4IEP A;  4UW4 A;  3KT1 A;  1GMM A;  3MPP G;  1VMF A;  4V2V A;  2Z5W A;  1RUF 3;  3VBU B;  3VZL A;  2D6L X;  3E6B A;  3LGR A;  5E8A A;  1BEV 1;  1SFY A;  3SEE A;  3ZR6 A;  1BBT 2;  2D3P A;  3P6B A;  2VZV A;  4JHZ A;  2E63 A;  5KHI A;  1XJA A;  1AX2 A;  4YPJ A;  3AVS A;  4Q4X 3;  5CNA A;  5LA0 A;  3GDB A;  2VUC A;  2IFR A;  5FZI A;  4BIO A;  4N9H A;  1AYM 1;  4AI0 A;  1CZT A;  3AJZ A;  1J59 A;  1OF4 A;  1Y9M A;  2VTF A;  4YGC A;  5D1I A;  4ZPI A;  3DF0 A;  1OSG A;  3H1M A;  5LWB A;  1R09 3;  2QQU A;  4XJ8 A;  2Y8K A;  4WM7 B;  2WSU A;  1WMD A;  5A6Z A;  3NAP C;  2WWS A;  3BPS A;  4OZO A;  2YFU A;  2WBK A;  2W39 A;  1OQD A;  2NQY A;  3A0K A;  3MO4 A;  1AR9 2;  3CF6 E;  4AFM A;  1ENS A;  1FMD 2;  3V0A A;  1UY3 A;  1OA4 A;  2BV4 A;  4DMI A;  5FZL A;  5LBF A;  2BGO A;  2EIC A;  1NLQ A;  1PIV 2;  2WFF 1;  4M3C F;  4XCB A;  3O0X A;  3JU9 A;  2Q0A A;  5D2A A;  2JDM A;  4DIN B;  4NII A;  2A6Z A;  3WNN A;  3RZK A;  1RUJ 1;  4ZZ5 A;  3OOX A;  3POS A;  1ASJ 3;  4JQR A;  4SLI A;  1A34 A;  3AZW A;  2HEY F;  5A3O A;  1OA2 A;  4Y5S A;  3VDB A;  1ODN A;  4GKY A;  2EID A;  5IVJ A;  3PNA A;  3U37 A;  2IC1 A;  2PEL A;  3Q8A A;  5EV7 A;  4DZG A;  1J84 A;  4E9K A;  1PZ8 A;  1IS6 A;  2MEV 2;  3B94 A;  1N1Y A;  1PGW 1;  5E88 A;  5LAS A;  4RGK A;  1VRB A;  1XB9 A;  2VNG A;  1ZNP A;  1XE8 A;  3BVC A;  5ACA 3;  2P6C A;  2PLV 2;  3QH7 A;  4WM8 A;  2ARE A;  1OFN A;  1UY0 A;  5FYB A;  3GM8 A;  4UF0 A;  2Q1Z B;  4LUL A;  1WCU A;  1YHF A;  5A3L A;  3LDK A;  2VUA A;  3IB3 A;  3IDB B;  5H9Q A;  2A6W A;  4KG8 A;  4P9I A;  2HWD 3;  1YEW A;  5EJ1 B;  2XJV A;  3U0Z A;  2J1S A;  2HEW F;  2VZ3 A;  3F2Z A;  2V09 A;  1QJY 1;  2AAC A;  4HK9 A;  1UOF A;  1R08 3;  5IFP A;  2RJK A;  1D4M 1;  2CGN A;  1LAJ A;  1OF3 A;  3KCC A;  1VB4 A;  1JYX A;  1NZI A;  2P34 A;  1U5X A;  3RS6 A;  1XSR A;  3WZ1 A;  2OPW A;  5DUU A;  4AZZ A;  4M3C B;  1YCI A;  3H7Y A;  2GP3 A;  3DPR A;  3RZH A;  1W8H A;  3TBD A;  4RA0 A;  2BBV A;  5LK5 A;  1W8W A;  2J1A A;  3DEC A;  5FTT C;  4FPF A;  4YW7 A;  4R8H A;  3MBW A;  4HLT A;  3PIG A;  1NAE A;  3OG2 A;  4AYU A;  1D4V B;  5JAX A;  1A8D A;  5DZF A;  2ARB A;  4XJ9 A;  4XJU A;  1KGY A;  4XJA A;  4CU9 A;  5C4W B;  4CZS A;  4LO5 B;  2ZCW A;  1SQ4 A;  1HRI 2;  1GP4 A;  4Z1V A;  4TLF A;  3VKN A;  4I01 A;  4Y3O A;  1C1F A;  5DAP A;  5EHD A;  1KS4 A;  3OGV A;  4Y22 A;  2GN3 A;  3ZXD A;  2FMD A;  5IK5 A;  4IEU A;  1GYK A;  1B09 A;  3ACH A;  4Q8K A;  4IDZ A;  3HJR A;  1FI2 A;  2Y6F A;  3E6D A;  3N9O A;  2FDI A;  4IEW A;  1W0O A;  4M4P A;  1DYK A;  3WW4 A;  1MVE A;  2MEV 3;  4LQR A;  3RDI A;  5IT6 A;  2DCJ A;  5CA6 A;  1HN1 A;  1DGL A;  1PVC 2;  3D5O A;  1RIN A;  3IKW A;  5HCB A;  2JDZ A;  3VBH B;  1C57 A;  3TYJ A;  3U4X A;  1Q43 A;  1PZ7 A;  1FPN 3;  3AKS A;  4XDO A;  2UUR A;  3N7L A;  3ZXJ A;  3GZE A;  4WM7 A;  2QQI A;  5GLV A;  2D93 A;  3SH5 A;  1F5F A;  3AKT A;  2VXJ A;  4QPW A;  3GNE A;  4N53 B;  4NWV A;  2YU2 A;  2KXL A;  3QD6 A;  5CFD A;  3TEZ A;  3RZJ A;  4XF9 A;  1JXN A;  5F7U A;  1PIV 1;  2IVI B;  2WN3 A;  1ZA7 A;  2PAK A;  2VUD A;  4NHX A;  3VD7 A;  3R0R A;  4IE0 A;  4W6W A;  2OW4 A;  4XZU G;  2VMF A;  1LUL A;  5GZF A;  1DQ0 A;  1QH6 A;  2W2I A;  3AKR A;  2NLR A;  3CMG A;  3JZV A;  4GWM A;  3C8X A;  4LKE A;  1AYN 1;  1H0B A;  2R07 3;  5A7P A;  3NV1 A;  3ZPY A;  2BU9 A;  1COV 1;  4D3W A;  1W6Q A;  5FPZ A;  2YPD A;  4YZ5 A;  1CZV A;  1W04 A;  1R09 1;  1FOD 3;  4E2Q A;  1RUE 1;  5EQU A;  4XAE A;  1H2K A;  5FP3 A;  1ND2 A;  5A3P A;  4LBK A;  3VBO B;  1R1A 3;  3BTZ A;  3WVJ A;  4LBQ D;  1QOT A;  2C24 A;  2NMN A;  4AVB A;  4E4H A;  5GLU A;  4YNI A;  3PUA A;  1H1I A;  1NYW A;  1US2 A;  4NAO A;  2A7A A;  1LB2 A;  3SIS A;  5FZ0 A;  5CIS A;  3UYJ A;  3P3N A;  2ZMK A;  4QQ2 A;  2VZQ A;  3KSC A;  1WCK A;  1PIV 3;  4YG0 A;  2P3I A;  1UU4 A;  3MF9 A;  3AMM A;  3EB7 A;  4CCD A;  5LCW L;  3ZFG C;  2Y6L A;  1NKG A;  1Q8P A;  5B4N A;  1H2M A;  3KS7 A;  1RIT A;  1RUF 2;  3BUC A;  3AB0 A;  1VBA 3;  4QXK A;  1AR9 3;  2Z2S B;  4QMA A;  2QUO A;  2JG9 B;  4RS5 A;  3MFA A;  3WX5 A;  3CU7 A;  5ACA 1;  3J7M A;  4RQP A;  2DWR A;  5G04 L;  4RR3 B;  3URF A;  4YM0 A;  3RZM A;  1J58 A;  2VR4 A;  2AH2 A;  1TME 3;  4Y4R A;  1UN1 A;  3ES4 A;  3VBH A;  1HB3 A;  1LOF A;  3AMQ A;  2PHF A;  4MHU A;  4N90 A;  1QJX 3;  1RJ7 A;  1T2X A;  1LJ7 A;  1XSQ A;  2B4K A;  2DTW A;  5FXW A;  5EYY A;  1O91 A;  5JZG C;  3JQX A;  4NRQ A;  5BY5 A;  5L7O C;  2RM2 1;  2WAB A;  5E1R A;  3I2D A;  4F7Z A;  2ZZQ A;  4H7L A;  3WUC A;  2HWE 3;  1G8W A;  4DXR A;  5KC6 A;  3B5L B;  1ZBE 1;  1URX A;  3LF7 A;  1DQ5 A;  4PIY A;  1NX9 A;  3ZXG A;  1LHW A;  2Q30 A;  1NUK A;  3DXT A;  1GBG A;  1JTZ X;  3AYA A;  5C5T A;  4AI8 A;  1U5I A;  2JIC A;  2VG9 A;  1GIC A;  1JHN A;  2PAM A;  2PLV 3;  2VVD A;  3GBW A;  4U36 A;  1GQP A;  1OPM A;  1SLL A;  3OJB A;  4P02 B;  3DKW A;  4GA9 A;  5FZ3 A;  4YWA A;  4K8F A;  1UU6 A;  1MR5 A;  1GP6 A;  2CV6 A;  2ZGP A;  2E7A A;  3THP A;  4QGM A;  2XWJ B;  2VW1 A;  1YFU A;  1RUE 2;  2WYS A;  1FOD 2;  2E7T A;  2RS5 2;  2WO3 A;  2OQ7 A;  3CL1 A;  2CL2 A;  2R07 1;  3B02 A;  4IEX A;  1QXR A;  5IAV A;  2BZD A;  2MPF A;  1PM4 A;  5D8A A;  2WA4 A;  4AAP A;  2XVK A;  4BQ3 A;  2RVA A;  2XLF A;  4AVA A;  3ZFF C;  5C6C A;  2Y6J A;  5EWS A;  4XAA A;  3DN7 A;  4N8M A;  2D6K A;  5FYV A;  1WMX A;  5FKB A;  5FZ9 A;  1QJZ A;  1K45 A;  2EAK A;  3GXU A;  1JBC A;  5FYU A;  2DVB A;  4RR3 A;  4ZON A;  3N9Q A;  1S1A A;  1L7R A;  3QOP A;  1LHN A;  4FPO B;  4PLM A;  3RZZ A;  2OQ6 A;  1K5M B;  3FL7 A;  1CX1 A;  1UL9 A;  3J4U H;  4GQ7 A;  1MS3 A;  5LEK A;  1O5U A;  3PTY A;  1JOB A;  4UOJ A;  1JUI A;  2JD9 A;  3ECQ A;  4R4X A;  1OXC A;  1N3Q A;  1C8M 3;  2K0G A;  3PVE A;  2A73 B;  5C8C C;  1S4C A;  5AFE A;  1SG3 A;  3ACG A;  4A7Y A;  5FR3 A;  4KQ7 A;  5CFC A;  3ZXE A;  1Y9G A;  2YB7 A;  1QNY A;  4ERO A;  1DYO A;  2D40 A;  1C5H A;  1H30 A;  5IVV A;  4TTG A;  3VKO A;  4CDQ C;  5JPN B;  2C0Z A;  4XQ4 A;  4XF1 A;  3BOD A;  3TEX A;  1ASJ 1;  4XCA A;  2XL9 A;  4GAZ A;  4QXC A;  1V6K A;  3TNQ A;  1LCL A;  3OYW A;  5FYH A;  3AK0 A;  1GKB A;  2ENR A;  3I59 B;  4QPG C;  1OD3 A;  1EP0 A;  1J83 A;  4BDV B;  5SV8 A;  4P14 A;  4NPL A;  4HN0 A;  4YW3 A;  1G6N A;  2VCC A;  4LHS A;  3VB9 A;  1CAX A;  2Y33 A;  2GU9 A;  5FUI A;  2P3K A;  1NG0 A;  2R16 A;  4BZ4 A;  3R05 A;  2P3Y A;  5BXX A;  4JHT A;  2V4V A;  1GOH A;  3AL6 A;  1G9B A;  1AF9 A;  4XBQ A;  4UW3 A;  5T5O A;  2BER A;  2RR1 2;  4P00 B;  4TYS A;  3T1M A;  5JSP A;  1ZZC A;  1JZ3 A;  4XVH A;  1F4A A;  2WQ4 A;  4MGI E;  2X10 A;  5KWR A;  3WHU A;  1W6N A;  2YGL A;  1HQW A;  3U1X A;  3C7O A;  1LHU A;  1UAI A;  3CQO A;  1ASJ 2;  3KLS A;  1OVP A;  2YG0 A;  4IE5 A;  4J1X A;  3A7Q A;  4F3J A;  3LA2 A;  4A4A A;  1RUH 3;  3WF0 A;  2EVX A;  4BB3 A;  3TWI A;  3VBF B;  2H0V A;  4GZ9 A;  4LR4 A;  5JXH A;  4YGE A;  1AX1 A;  4NIH A;  1PO1 2;  3BU7 A;  4A44 A;  3MID A;  1V00 A;  3ZSM A;  1W6P A;  3AMP A;  1RXF A;  1C4R A;  2XLA A;  1DF0 A;  1GNZ A;  1WLW A;  2YMZ A;  3AP7 A;  1GAN A;  1W8N A;  4HKO A;  4CEY C;  1QWR A;  2B42 B;  2QNK A;  4XF3 A;  1OLM E;  3O1T A;  4MYE A;  1WWY A;  4AF9 A;  2CAU A;  5FPA A;  4XUP A;  1ZZ8 A;  1W2T A;  5FYS A;  2WT0 A;  1JU3 A;  3KF3 A;  1NE4 A;  4MGY E;  5BPX A;  2XHN A;  2A3W A;  4W8J A;  2QQK A;  4YYO A;  2DDU A;  2BUK A;  1PNF A;  1SLI A;  1RUJ 3;  2J1E A;  2K9Z A;  4WBB A;  5I0D A;  1G9C A;  2HWE 2;  4E2G A;  3T4H B;  4URA A;  3POI A;  2W3J A;  3OEA A;  4IW3 A;  1IPK A;  1FMD 3;  4W50 A;  1CIY A;  2ZHN A;  1VAL A;  2JG8 A;  5F5A A;  4AI1 A;  5A70 A;  4CYD A;  1QJX 2;  5J7M A;  3ZYF A;  5IWF A;  4QXB A;  2Y6H A;  1AR8 1;  3V64 A;  1XNB A;  4FSJ A;  3H7J A;  1US3 A;  2WNV A;  2EXH A;  1JYC A;  5AVP A;  3AKQ A;  4BXS V;  3EXU A;  2VC9 A;  2NP0 A;  5J98 B;  2C6S A;  1VBD 1;  1YC6 1;  1GNY A;  2A6X A;  5E16 A;  3JBG 1;  2D6P A;  5CG8 A;  1ZYB A;  4DPN A;  4FQ4 A;  4XTM A;  1YIF A;  4UF0 B;  4EE2 A;  4IQP A;  5JOX A;  2J1R A;  4LIV A;  3AMN A;  3ZFE C;  1BCX A;  4GB3 2;  3AMH A;  3K2O A;  2CGO A;  2AYH A;  5FQ0 A;  4V2W A;  1HQN A;  1W9W A;  3OBZ A;  3MI8 A;  2JG9 C;  2VZ1 A;  4BA6 A;  5JOW A;  3DYO A;  4WVV A;  1PO2 2;  3VV1 A;  3KHC A;  4LJH A;  4IEY A;  4QDS A;  1RUH 1;  5FXV A;  3NAP B;  5T50 A;  1RHI 2;  3I2K A;  3JB8 A;  1YI7 A;  4ZHN A;  4XXP A;  4AQS A;  1S0D A;  2WR9 A;  4XDP A;  4TLG A;  5LA9 A;  4BOW A;  5F3C A;  2PTM A;  5BNQ A;  1W05 A;  4P5Y A;  1ENQ A;  2UY8 A;  1CVN A;  2HJI A;  4DOU A;  1CD3 G;  4CXY A;  4EN9 B;  1PHM A;  5JIA A;  1SEF A;  2BWC A;  3IAP A;  1PMH X;  4LLF A;  2E26 A;  2W52 A;  1G9A A;  3N7K A;  4Y1V A;  3MGU A;  1GP5 A;  1DHK B;  3NQH A;  3DGT A;  3V0A B;  3NJY A;  4HZF A;  4X6R B;  4GMP 1;  1S0C A;  4L0P A;  2OVU A;  5J36 A;  4GAL A;  4AGV A;  1UYY A;  4I2O A;  1GV9 A;  2GN7 A;  4I3P A;  2R7E B;  5FY9 A;  1H4H A;  2F6B A;  2WYF A;  1LR5 A;  2XOM A;  3UNP A;  5KHG A;  4N7U A;  2FHR A;  3ZFE B;  3GZU C;  4XFB A;  3LEM A;  1NA1 C;  2E6V A;  3ZYJ B;  1VBC 2;  2D98 A;  1YQ2 A;  2QZ3 A;  2CAV A;  2Y64 A;  1ND3 A;  5L73 A;  3WDU A;  3HD8 B;  4AE2 A;  1XNT A;  1IKP A;  1POV 0;  3MUZ 1;  5FXX A;  3VHN A;  4FTE A;  3IDC B;  2FDF A;  5FCC A;  4M4R A;  2IXK A;  1WA6 X;  4PBP A;  5AVA A;  4CCJ A;  5C7G A;  2WJS A;  3MIC A;  3POG A;  4K40 A;  5H9R A;  4B3N A;  4CPB A;  5BNN B;  5CU1 A;  2W87 A;  2J7M A;  1TME 1;  5K0U A;  3V65 A;  3M8L A;  4FFF A;  5T5P A;  4HOO A;  5FUN A;  2E51 A;  4QDR A;  1PK6 B;  2GDF A;  3JD7 2;  2R30 A;  1C5I A;  2ET7 A;  5IK8 A;  2WUH A;  3FFQ A;  2B9V A;  3NV4 A;  4HSL A;  1HW5 A;  1BHG A;  2A5Z A;  1QJF A;  1YJK A;  4Q0U A;  2LUW A;  5FLI A;  4CDW C;  5KBF A;  2IFW A;  3OY8 A;  2VCA A;  4MOA A;  4Y22 B;  4CCL A;  4Q4W 1;  5JSO A;  2IXJ A;  1F31 A;  2FCU A;  4QKD A;  4I0B A;  1DQ4 A;  1GWL A;  3RRD A;  2WL1 A;  3E1F 1;  4ISR A;  5SV5 A;  3WNO A;  5ABJ C;  2GNB A;  1AR7 3;  5I91 A;  2YU1 A;  2JB4 A;  4HBN A;  1PGL 1;  3JBG 3;  1J3R A;  2ADD A;  4GMP 0;  3RYR A;  4FPL A;  4YVW A;  4DXZ A;  1VBD 3;  4AQ2 A;  5IVB A;  5DUW A;  1QGL A;  4LE3 A;  4PQQ A;  5FY4 A;  1MS4 A;  3LIG A;  4MG2 A;  1UY2 A;  2JDK A;  3OGS A;  3UV9 A;  4AQ6 A;  1W6M A;  3R4S A;  3FBM A;  4DS0 A;  4OHY A;  2Y6G A;  3HNM A;  2V5D A;  4CUC A;  4YM3 A;  4FOQ A;  5F37 A;  1RGS A;  2LS6 A;  4JTO A;  1RIR A;  2XL7 A;  2Y26 A;  3M1H A;  4QX2 A;  3ZM8 A;  1LEN A;  1LOG A;  1W6O A;  2XG3 A;  1IS3 A;  5KHH A;  1MS0 A;  4CEY A;  1LES A;  2HWE 1;  2XDV A;  3NJZ A;  5LY1 A;  3SH4 A;  3K48 A;  1AR8 2;  1K5J A;  4O9G A;  4IET A;  3N9P A;  1OVS A;  2RV9 A;  4NHM A;  2ARX A;  1GQG A;  5FFO C;  4CXW A;  2D7F A;  4GH4 B;  5I0S A;  5JXI A;  3DEM A;  4BYY A;  2BNO A;  4TSV A;  5J37 A;  2EIB A;  1CPM A;  2YY1 A;  2A75 A;  3POW A;  4XF4 A;  4DNY A;  5EIY B;  2VGD A;  2YBK A;  4OVE A;  3POJ A;  4XFA A;  1SCR A;  3O5S A;  3W21 A;  3TOJ A;  4LIU A;  1HXS 3;  3C7H A;  1SPP A;  3NV2 A;  4FTB A;  1P8J A;  1DYP A;  4F83 A;  3LEI A;  4ONU A;  1OT5 A;  4Q4Y 1;  1VBA 1;  1U5Z A;  4Y1U A;  1GSL A;  5HXM A;  3KMH A;  2DVG A;  1Y4W A;  1YFY A;  2PHX A;  1HIX A;  1W2U A;  4Q0Q A;  1OLM A;  3MIF A;  1MS5 A;  5FK8 A;  5C3Q A;  4K6B A;  2BGC A;  3VBF A;  4C1W A;  4DRR A;  2BW8 A;  1S0I A;  2DUQ A;  1ZRD A;  1YFX A;  5LBC A;  1O6U A;  2ID4 A;  1OQE A;  2IZW A;  2J1V A;  3WSO A;  4XMA A;  4D0Q A;  2MNG A;  3AYD A;  3HVD A;  3NNG A;  1LEM A;  3KVB A;  2UU8 A;  1M06 G;  2VOX A;  2HWB 1;  1QF3 A;  4XJW A;  3LEG A;  4CP9 B;  4M3C A;  1LU2 A;  4A3Z A;  4EWE A;  1FOD 1;  4XMI A;  4LBQ B;  4CDX A;  3O14 A;  4BH9 A;  2XQX A;  2YFZ A;  3KCY A;  4FI9 A;  4KWU A;  5ANN A;  2VMC A;  3U4S A;  4K8R B;  1XND A;  4XAB A;  2PHT A;  2JXA A;  2OT7 A;  4L2N A;  4IEZ A;  2ATF A;  1JU4 A;  3VN4 A;  3DV8 A;  2ZX0 A;  1D4M 3;  2PQQ A;  2RS1 1;  2ZX1 A;  3AC0 A;  3RZL A;  1R08 1;  4QB2 A;  4G9S B;  2XJQ A;  3BYW A;  1F35 A;  4XE9 A;  5FPU A;  1RYY A;  4XYX A;  3IPV A;  2HWD 1;  3VBR A;  5LRS A;  1EYB A;  4YVW B;  3O0W A;  3NJX A;  4U2A A;  3SKV A;  5DAV A;  4RHV 1;  5LA1 A;  1UNB A;  4OMC A;  5T3N A;  4AXO A;  2I45 A;  3FJS A;  3BB6 A;  4AHY A;  1KJL A;  4XFF A;  2VCB A;  4HKW A;  4XF0 A;  3VDD B;  3VDD A;  4EJR A;  4ORF A;  5BNP A;  3LIH A;  1DBN A;  5C33 A;  1JZ8 A;  5A33 B;  1W6P B;  2XVG A;  1C8M 1;  1NY7 1;  5EPA A;  1O3R A;  5F39 A;  2CDP A;  1FV3 A;  3P3P A;  3SH3 A;  1W0N A;  4AR2 A;  4LBL A;  4AFD A;  2Q5T A;  1NCR B;  4FPY A;  1GQH A;  2VOV A;  4YVS C;  3VBR B;  1MQT C;  3KHB A;  4R9D A;  4NPM A;  4XFI A;  3K46 A;  4A7K A;  3MIH A;  2GC2 A;  1W0P A;  1S0B A;  2ARA A;  4FCA A;  4S2D A;  1K5M A;  1PK6 A;  2ZGT A;  3M3E A;  4JV4 A;  2VBD A;  1KXG A;  3NNL A;  5F5C A;  4AED B;  2W1Q A;  4A42 A;  3I3Q A;  4FPC A;  1PNG A;  2P3J A;  2HWF 2;  5LBE A;  3SQO A;  3W5N A;  5FZD A;  5FPB A;  5C70 A;  1HXS 2;  3AP5 A;  4MGT A;  2G4I A;  2RJ2 A;  1I9R A;  2B39 A;  2VUJ A;  3BOW A;  4A2U A;  4GB3 3;  5H9P A;  1YQC A;  4P9W A;  3MLJ A;  2ZEY A;  4NID A;  3VL8 A;  3FFZ A;  1XNA A;  3K77 A;  5CFD C;  1OKO A;  2Y0O A;  1CAX B;  3OPT A;  3HQX A;  1Q5O A;  3QLQ A;  3ZFG A;  2ZAA A;  1GFF 2;  3G7D A;  4LNV A;  5BV6 A;  4LKD A;  1V9U 1;  3MFC A;  4P08 A;  2QVS B;  2HWB 3;  4LA2 A;  3RPQ A;  4DUW A;  3ZFE A;  4Q4X 1;  5FMD A;  1CN1 A;  2ADE A;  2VZO A;  3ZFF A;  2DYC A;  2WSV A;  4CP0 A;  4MXW B;  1F2N A;  1DZR A;  3D3A A;  3GCW A;  3HBK A;  5CAZ A;  2WT1 A;  1NQJ A;  1H2L A;  2J22 A;  3FN9 A;  4IV3 C;  4URT A;  3VBO C;  2W0X A;  3WD5 A;  4CEW B;  4E4D X;  2O14 A;  2K46 A;  3WEZ A;  2VJX A;  5I0U A;  4AI3 A;  1ZBE 2;  2QQV A;  5A6X A;  4IV1 C;  2J1T A;  3PUH A;  3I2G A;  4XOG A;  2WDB A;  3SCH A;  3HMY A;  1YLL A;  1YQ5 A;  4SBV A;  3W9A A;  2TBV A;  3KWV A;  4FQZ A;  1FV2 A;  2J1U A;  3HWJ A;  3D82 A;  1SZB A;  1UIK A;  1DIW A;  3AP4 A;  5K7P A;  4CDU A;  5FP8 A;  2BP6 A;  1W9S A;  5A80 A;  5FZC A;  3WDV A;  3HOB A;  1SLB A;  4ASL A;  1RVF 2;  1KD7 A;  1V9U 2;  4OFG A;  3M2M A;  4YG3 A;  1UZV A;  3ON7 A;  4Q8L A;  3NW4 A;  5GKA C;  3LFI A;  3ZN4 A;  3JCI A;  2IXH A;  3RI8 A;  4WM7 C;  2XJS A;  4IV1 B;  5FZK A;  4CDQ A;  3IWZ A;  2FQP A;  2WS9 2;  1CZS A;  3OSD A;  5EJ3 A;  4CEW C;  3J8F 3;  4JDN A;  4RS5 B;  2WN2 A;  3OGG A;  1VBE 3;  2PHU A;  4CCC A;  2HWD 2;  1GZW B;  2WNU C;  4Q29 A;  5DQ0 A;  2F4P A;  3HAG A;  1LKN A;  1AJK A;  1OD5 A;  3ZYI B;  3TAY A;  2ZX4 A;  2X05 A;  5A1A A;  2VTX J;  1VBB 1;  1CAV B;  2WII B;  1W6M B;  3FLR A;  1J1L A;  2E33 A;  3OGJ A;  4M0N A;  3R4D B;  4Q0V A;  3W59 A;  3WDW A;  4B4R A;  3TEY A;  3LOI A;  3SLI A;  1OBN A;  4NRM A;  4D94 A;  1GZ9 A;  1FYU A;  1EV1 2;  4YW6 A;  5FZM A;  1V6L A;  3THT A;  5C5U A;  4A3X A;  3H3L A;  2QQL A;  4ARY A;  4KBZ A;  4QU1 A;  3GBF A;  3O7O A;  1ZBA 1;  3EMR A;  2BVV A;  2OZ6 A;  4QPY A;  1XU1 A;  3ATG A;  3JUU A;  1PVC 1;  3LB9 A;  4FP3 A;  4XUN A;  5C3R A;  1Z0H A;  3CO2 A;  3H8R A;  1AUY A;  2JB8 A;  4KI5 M;  2RS3 2;  3Q9O A;  4BK4 A;  1Z7S 2;  4HVO A;  2XJR A;  4B8E A;  4OQ8 A;  1RUI 1;  4XUQ A;  1LRH A;  3ZXL A;  4CDW A;  3USU A;  1F5J A;  4CU8 A;  2BDR A;  1TMF 2;  3ILR A;  4YLZ A;  1UD1 A;  3RWN A;  1IS4 A;  1BEV 3;  1JW6 A;  3ACL A;  4XIK A;  3U07 A;  5HBA A;  1VAV A;  1NXD 1;  1AL2 2;  3SIT A;  3J8F 2;  4K3U A;  3VD5 A;  4YVS B;  3VZM A;  1WW6 A;  4XFC A;  2BBA A;  2XJU A;  2VNR A;  3HQU A;  1YQ6 A;  4P9G A;  1Z7S 3;  4Q1R A;  4FXG B;  4NRO A;  3UJO A;  5CFD B;  1H8T B;  2VNV A;  4HAN A;  4Q26 A;  4RQP C;  5LAT A;  2DUO A;  4ASM B;  5FYT A;  4OUS A;  2JDU A;  2WZR 1;  5FAX A;  4NIA A;  5E6H A;  5A3W A;  4G3Y C;  3UL2 A;  1AR6 1;  3VHP A;  1ULC A;  4RR3 C;  5ISL A;  3T4V A;  3KF5 A;  3BAL A;  3EYP A;  4LXL A;  2G9G A;  1UMZ A;  1XC6 A;  1W90 A;  4NAM A;  4FOY A;  3J7L A;  5EFU A;  1F9K A;  1W9Y A;  2OYZ A;  2PHD A;  5FK7 A;  5L7O A;  5CEH A;  3HNY M;  1JZ2 A;  2HBT A;  2C1F A;  1QJU 3;  2Z79 A;  4NN0 A;  1CQ9 A;  1S0J A;  4QB6 A;  2H0B A;  4QX0 A;  3KZ4 C;  4QHO A;  5LA2 A;  3WDX A;  5J48 A;  5C8C A;  3CLP A;  3DXU A;  1RUC 1;  1U12 A;  1IHM A;  5GZE A;  1R64 A;  4OHX A;  1D4M 2;  3I4I A;  3PUQ A;  5I93 A;  3PUI A;  5A33 A;  2GNM A;  3ZN6 B;  1S0F A;  4D7T A;  1H8T A;  1GUI A;  2PHR A;  1CJD A;  4QQP A;  3H8X A;  2BPA 2;  1Q56 A;  2Y34 A;  4YZ2 A;  1Q3E A;  4PI0 A;  2OUH A;  1XBF A;  1YXW A;  2BOJ A;  5JMO A;  2O0O A;  4UW5 A;  2Q4S A;  5FMB A;  2W46 A;  3MYX A;  4LHN A;  1UMI A;  3I7D A;  2BJS A;  4B4Q A;  4DRV A;  1OLR A;  5FO8 B;  5LZ6 A;  2WAO A;  1Y7B A;  3N7M A;  5LB6 A;  2JIJ A;  3MLK A;  1DQ6 A;  3FZ3 A;  2MHF A;  2X5I C;  4BQ1 A;  3M3Q A;  4XDQ A;  2B7Y A;  1ULP A;  3AFG A;  3DYM A;  1VJ2 A;  1H6Y A;  1ULD A;  5FYM A;  2BFU L;  4XHX A;  2RDN A;  4LE4 A;  4N53 C;  4AL9 A;  4EWD A;  3W58 A;  2FZ2 A;  1W2O A;  4BIS A;  4Q4W 2;  2W5F A;  3NNM A;  4Y20 A;  1H4G A;  1K3I A;  1UIJ A;  4R9B A;  4DUV A;  2HYX A;  4QPI C;  4KGG A;  1UWW A;  2OKX A;  1DU3 D;  4N9I A;  4Q4Y 3;  4FPK A;  2TUN A;  3I2O A;  1E57 A;  2WNO A;  5A6Y A;  4MHR A;  2DU1 A;  3RYK A;  3U14 A;  2AEN A;  2X8K A;  5T5J A;  1XPW A;  2JDN A;  5GZD A;  3MDP A;  3WDY A;  5B2G B;  1N3P A;  4LUM A;  3QBQ A;  2ZZJ A;  1E5H A;  5GLW A;  5HCH A;  2BYV E;  3CNA A;  1RUD 1;  1QXJ A;  5L9V A;  2I74 A;  2IXC A;  2X29 A;  3FMG A;  3WUD A;  4IV1 A;  3FHQ A;  1GNH A;  2CHH A;  4JC1 A;  2OZJ A;  2WS9 1;  3WQB A;  2ZEX A;  4NUB A;  2VQA A;  1IGO A;  1IG0 A;  1Y43 B;  1RUH 2;  2UWA A;  1QKQ A;  2WT2 A;  2A6V A;  2WZE A;  4FO9 A;  2E32 A;  4G4F A;  5FY1 A;  4KG0 A;  1RUC 2;  4HN1 A;  1W8F A;  4E27 A;  3ZO0 B;  2ZX3 A;  4Q4V 3;  4NVP A;  3WG1 A;  3ZYR A;  1WLD A;  2P37 A;  3CJX A;  1SLA A;  2DCK A;  2ZBJ A;  5I0T A;  1ND3 C;  5GJ6 A;  2F17 A;  3UJQ A;  2E31 A;  1FPN 2;  4LUK A;  2ERF A;  2BTV C;  2QQP A;  2BEO A;  1IS5 A;  1D0H A;  4ASK A;  1JYW A;  1J3Q A;  4EN7 B;  5KXB A;  2O8Q A;  4WVM B;  2WNU A;  5L36 A;  5ABJ B;  5DN2 A;  1TEI A;  4IES A;  1LOE A;  3CJI B;  2A1X A;  5HCA A;  3VKM A;  4JCK A;  3E5U A;  3PVN A;  3AYE A;  1L7Q A;  3PDQ A;  3TN9 1;  3Q8B A;  4CP1 A;  4V1P A;  1AL2 1;  1D2S A;  3KM5 A;  3T0D A;  2VEC A;  4NHK A;  3GJA A;  1BEV 2;  3OEB A;  1L7L A;  1IQD C;  1C28 A;  1LED A;  1AXK A;  1NQD A;  2EXJ A;  4HET A;  1AL2 3;  4HMZ A;  4JVA A;  3WW2 A;  1H6X A;  4AFA A;  4M01 A;  2R06 3;  4BQY A;  2DVF A;  3APB A;  4DB5 A;  5FMC A;  2YHJ A;  2R49 A;  4FXK B;  1R1A 2;  2R6Q A;  1QH7 A;  3VL9 A;  2RS3 3;  2JIG A;  4Q27 A;  2ZGO A;  2ZGN A;  4OHV A;  5FPX A;  2ILM A;  1SHW B;  5AFB A;  1AR6 2;  1RUG 1;  1RC6 A;  3BCW A;  3KT7 A;  4XPV A;  5KXC A;  1LOB A;  1C3H A;  3OD4 A;  2RS5 1;  3I54 A;  1WKY A;  5A7W B;  4E2S A;  1PZ9 A;  5ACA 2;  2WLP A;  3NKG A;  1NA1 A;  4YZ1 A;  2VOT A;  2UWB A;  4HK8 A;  4JQT A;  4UFI A;  2V72 A;  3WLU A;  4AVS A;  3WW1 A;  1VAK A;  4H3W A;  4QGN A;  1WME A;  4Q4Y 2;  4HKL A;  3ETP A;  3USU B;  3IPV B;  3JD7 1;  3ZKY A;  2YGM A;  3HNB M;  1BJQ A;  3L2Y A;  5JOY A;  3ZSK A;  1VBB 3;  1PMJ X;  2VCM A;  4QKF A;  3BN6 A;  4O61 A;  1WBF A;  1CAU A;  4LKF A;  4M0H A;  2NYY A;  4OHW A;  4CCE A;  3ZYB A;  3WCS A;  1HJF A;  1VB2 A;  2HBU A;  4GJY A;  3UET A;  4E4Z A;  3ILF A;  1O4Z A;  5EYX A;  4AVV A;  4XFH A;  2GH2 A;  1DGR A;  1NCQ C;  2XON A;  3MIG A;  4QX5 A;  2QCS B;  2WO7 A;  4CDX B;  1ENR A;  1KIT A;  4AWD A;  2VOK A;  2D44 A;  3AZX A;  2DUR A;  1AYN 2;  5JZG B;  2LW8 A;  3ASI A;  4GKX A;  3UK9 A;  2XWB B;  4NHY A;  1OKQ A;  5FJK A;  1ND3 B;  2UYA A;  2X53 S;  4C8D A;  5HXV A;  3VKF C;  4CA9 A;  2EAL A;  3LCP A;  3WQ7 A;  2V5Y A;  5F32 A;  3MHZ A;  4QX7 A;  2Q8D A;  3S5A A;  4RYD A;  1RED A;  3FHI B;  1NLS A;  1NOV A;  3AJY A;  2RMU 3;  5EXO A;  4RD7 A;  4L8Q A;  3FLP A;  1WA4 A;  4LBJ A;  4K20 A;  4CU6 A;  1YI9 A;  2XBO 1;  1MZE A;  1F4H A;  4Y1Y A;  1SDD B;  4FP2 A;  4PJY A;  4WVM A;  5FKC A;  5F3G A;  1JZ4 A;  3EJK A;  4UFH A;  5FZ6 A;  3VBU C;  1VBA 2;  3WQ0 A;  1H1M A;  4LHL A;  4HVQ A;  1XYP A;  2QKD A;  1O3Q A;  2QZ2 A;  5DDJ 2;  4YVW C;  2D6N A;  1UZ0 A;  4JKL A;  4GXL A;  4YW4 A;  1KQR A;  5D8A B;  2XKP A;  1RUI 3;  1RUJ 2;  4QQO A;  4ZS2 A;  1UOG A;  3RJR A;  5FRE A;  4Q2F A;  2Y0I A;  1G9F A;  2OII A;  5F2W A;  4LPL A;  1R09 2;  1YUD A;  3D0J A;  4YZ3 A;  3GCX A;  5D21 A;  2P17 A;  1EUU A;  1LGB A;  4XC9 A;  3R4U A;  4KWK A;  5F2S A;  5FMO S;  3FWE A;  4LA3 A;  4QT6 A;  4B7K A;  1VIW B;  4MXW A;  2LM3 A;  4MET A;  2FDK A;  3HN1 A;  5BNO B;  2WFF 2;  1RB8 G;  3M70 A;  1H8V A;  2EAA A;  4B4P A;  5IVE A;  1GLH A;  4Z07 A;  1S0E A;  3WG3 A;  1GOG A;  3D4K A;  4HFS A;  1FMD 1;  3ROU A;  3ALQ A;  5KC5 A;  1SBE A;  2YC2 A;  4LLO A;  2Q8E A;  3NWK A;  4A45 A;  4CUA A;  1LEC A;  4ZU5 A;  3K4D A;  4DXS A;  2BOI A;  4OUL A;  4X6Q B;  1W03 A;  3INA A;  3MW2 A;  1X9P A;  4FFI A;  3ZKU A;  1GWM A;  3O12 A;  5HI0 A;  5FYZ A;  5DG1 A;  1ZRC A;  3ABZ A;  3K4Z A;  2W1W A;  2ZXQ A;  4RHV 2;  4YAR A;  4AGG A;  2R0F A;  2PHW A;  5C71 A;  4YGB A;  1OOP A;  1RUD 3;  4AHZ A;  1UW8 A;  4DXT A;  3OGR A;  2G9Z A;  2GC1 A;  2QTW B;  4CP9 A;  3CZU A;  4GIQ A;  4RFT 0;  2R07 2;  3WXP A;  3LWC A;  1AR7 2;  1LTE A;  2RR1 1;  2JX9 A;  3U75 A;  2VVF A;  4Y24 A;  2AEZ A;  1IKQ A;  2VW2 A;  2Z69 A;  3KT4 A;  5T5L A;  3OY8 B;  4JRA A;  4BLJ A;  5JI9 A;  4C0B A;  4LHK A;  2P4E A;  1HRI 1;  2CTV A;  3MPB A;  2H6C A;  3VBS B;  4PDW B;  5CKN A;  5K9Y A;  5DDJ 3;  4JDM A;  4YSF A;  3IT8 A;  3T0B A;  3LKJ A;  3OPW A;  4J25 A;  5A6Q A;  3H0O A;  3D8C A;  4GUL A;  5FO7 B;  2XML A;  1CAU B;  1OUS A;  3JQW A;  2VZP A;  3L9J T;  2LAL A;  1WW5 A;  3HBZ A;  1PO1 1;  3MIE A;  4NHL A;  4MUV A;  3NRU A;  4DIQ A;  3GF6 A;  2KA3 A;  1DQ2 A;  4QKN A;  3O1U A;  2SBA A;  3M3O A;  5I8Y A;  1PVC 3;  4HPK B;  5FMO L;  2VTX A;  1QEX A;  1LGC A;  2GME A;  4Y4Y A;  1N1V A;  3VBF C;  4CE8 A;  4CSW A;  1ULF A;  4KWL A;  3SXW A;  1JOD A;  3IN9 A;  1IZ3 A;  5IAT A;  3VBR C;  1HB4 A;  1NCR C;  1HB1 A;  2IWG B;  2XBO 2;  2X5I A;  4LOT A;  2RJL A;  3E97 A;  3FE5 A;  4LOS A;  3ZIW A;  5JWP A;  1L3J A;  5A7N A;  2JDA A;  1KFU L;  3KQR A;  4C90 A;  4MH0 E;  2Q8C A;  2V4A A;  2HH9 A;  4N53 A;  1QJY 3;  4KH9 A;  1GZT A;  3GZT B;  3U10 A;  4D6R A;  3LFM A;  1ZBE 3;  2W08 A;  1LU1 A;  3OD0 A;  2WO1 A;  1J3P A;  1ZZB A;  2IXI A;  4OYU A;  2ZGL A;  2JD4 A;  3I3E A;  2RM2 3;  2YC0 A;  3WG2 A;  1UOJ A;  2D97 A;  3IDE A;  4JKM A;  4LBM A;  5C9A C;  4MVT A;  5AC9 1;  1AYM 2;  1NE6 A;  4H2A A;  3K75 B;  3NNF A;  3LA7 A;  3LDR A;  1PK6 C;  3WT3 A;  3ZMO A;  3W5M A;  3I3D A;  4LO7 A;  4QPG A;  4P9Y A;  1FNZ A;  4JX0 A;  3S57 A;  1XRU A;  1DGW X;  4KL1 A;  3WF3 A;  3IMM A;  1JS9 A;  4Y1Z A;  4QM9 A;  3MLL A;  4QPI B;  4YW5 A;  5A7S A;  3MIB A;  5M0T A;  1JH5 A;  3GHM A;  1VLN A;  4R9A A;  2FD8 A;  3T2P A;  1A78 A;  3HEI A;  3TN9 2;  1QOS A;  1QOO A;  4XXA A;  5BNP C;  3NV3 A;  1JHJ A;  2GAU A;  4FVV A;  1ZVF A;  4UFK A;  3J26 N;  4N43 A;  5A1L A;  3WP6 A;  2N7G A;  2A71 A;  2R04 2;  1S2B A;  1ULO A;  2ZEW A;  1A3K A;  3KD4 A;  2RS1 3;  4FOW A;  3VZJ A;  1MZF A;  4E8C A;  3V0B A;  4LBO A;  5FOB B;  5FWE A;  2YYO A;  5GLZ A;  2EXI A;  2WWJ A;  2ZAH A;  3ACI A;  4JTN A;  4I30 A;  3DPR B;  3IMN A;  2AGS A;  1JOJ A;  4P9X A;  4CCK A;  5KR7 A;  1K5M C;  1ZBA 3;  1BZW A;  1DGR N;  1IG3 A;  3MV0 1;  4TN7 A;  4ZKT B;  4IL7 A;  3AM2 A;  1Z78 A;  3PU8 A;  2RG4 A;  3UKN A;  3BIE A;  2GC3 A;  2JEC A;  4OCT A;  1Q8V A;  3PU3 A;  2BNM A;  1V6O A;  2JG8 B;  4XHB A;  2ZEZ A;  4S2G A;  2H6B A;  3TNP B;  2VD7 A;  4OUE A;  1ENX A;  1KFX L;  1PX4 A;  1WCD J;  1WW4 A;  4A7Z A;  1FNY A;  4BJ0 A;  1LOD A;  1TG7 A;  1W8Z A;  4BWO A;  3T30 A;  1A8M A;  3LD8 A;  2YRO A;  1W39 A;  5FYC A;  4MO3 M;  5FP4 A;  1WW7 A;  1RUF 1;  2ZGQ A;  3CBN A;  2JDY A;  1RMU 2;  4EZH A;  3WV6 A;  2F4L A;  2XBO 3;  2VUL A;  1XNK A;  1FPN 1;  4BPZ A;  4PHZ A;  4K1Y A;  4BLI A;  2PYT A;  3M3I A;  1V6J A;  4PCR A;  1QDC A;  1C8N A;  2YXS A;  2UY9 A;  4PIZ A;  1OUR A;  1TME 2;  3B00 A;  4YW1 A;  3RNS A;  4UI9 L;  4ITC A;  4QGL A;  2QQN A;  3CDZ B;  2BQP A;  1VPH A;  2VZS A;  3NL1 A;  4ZS3 A;  5FJH A;  4BQW A;  5K0U C;  2WQ8 A;  4CTE A;  2DV9 A;  1POQ A;  3S7E A;  3I3M A;  4I3G A;  3KGZ A;  3T3Y A;  4EZ4 A;  5AC9 3;  2YC4 A;  3CHX A;  4P5H A;  2A3X A;  2JKX A;  4Z82 A;  3BI3 A;  2VZT A;  4EV0 A;  5CG9 A;  1EY2 A;  3I2I A;  3AKP A;  5EZW A;  3ZDV A;  5L7O B;  4ET7 A;  2Y6K A;  2G1M A;  3IZO A;  1ZRE A;  3A21 A;  2GND A;  1H9W A;  3KV9 A;  5CIR A;  5JMC A;  2DCZ A;  3T2O A;  1UZY A;  5K0U B;  1W6N B;  1OI6 A;  3J7H A;  2GMM A;  2WAA A; 
#chains in the Genus database with same CATH homology
 2W92 A;  2E33 A;  3WF1 A;  4AAX A;  1GQP A;  4P02 B;  3VD9 A;  2ORX A;  2QQL A;  2WYS A;  4ARY A;  2WO3 A;  1UMH A;  4XUN A;  4ZY9 A;  4E8D A;  5JXJ A;  2BZD A;  4KI5 M;  4RN5 A;  4BK4 A;  3LE0 A;  2RVA A;  2Y6J A;  4XUQ A;  4CU8 A;  1K45 A;  3GXU A;  1KEX A;  1L7R A;  3VD5 A;  1W99 A;  2BBA A;  4QX1 A;  3FL7 A;  1CX1 A;  4BK5 A;  1PX3 A;  3I3B A;  3MUY 1;  4UOJ A;  4DUX A;  2JD9 A;  3ECQ A;  4HG6 B;  4MAD A;  1SG3 A;  3ACG A;  3OBA A;  4GWI A;  2YB7 A;  3EYP A;  4TTG A;  1DYO A;  1XC6 A;  3I2F A;  1JZ2 A;  3HNY M;  4QB6 A;  4QX0 A;  3I2H A;  5LA2 A;  3JXS A;  4CU7 A;  1R64 A;  3PUI A;  1OD3 A;  1J83 A;  4BDV B;  1GUI A;  2VCC A;  4LHS A;  2JE8 A;  5FUI A;  1TVG A;  5JMO A;  5B4X A;  2W46 A;  2L9L A;  1UMI A;  2V4V A;  1GOH A;  2BER A;  4P00 B;  4ZXE A;  1O8P A;  2Z4F A;  3WNM A;  1JZ3 A;  4XVH A;  1F4A A;  2WAO A;  2X10 A;  3III A;  3C7O A;  1ULP A;  3DYM A;  1H6Y A;  3CQO A;  3LQC A;  4MGS A;  3I2J A;  2YG0 A;  5IJR A;  2QQM A;  3A7Q A;  2W5F A;  4A4A A;  1K3I A;  1JYN A;  3WF0 A;  3C7G A;  2BGP A;  3CZJ A;  4DUV A;  2HYX A;  4IUG A;  5JXH A;  4GZ9 A;  3T09 A;  1UWW A;  2OKX A;  4XUO A;  4DEQ A;  4A44 A;  1JI6 A;  3LEK A;  1XPW A;  1UY4 A;  1DLC A;  4XUT A;  1W8N A;  1DP0 A;  5IYY A;  1LNS A;  4XUP A;  3FHQ A;  2VQU A;  3WQB A;  2ZEX A;  4TXW A;  2VL4 A;  3I97 A;  1JU3 A;  2WZE A;  2XHN A;  4W8J A;  2QQK A;  2DDU A;  5I0D A;  2E32 A;  2J1E A;  2CDO A;  2W91 A;  3WF2 A;  3MV1 1;  2W3J A;  3OEA A;  4W50 A;  1CIY A;  4ZZ8 A;  4QX3 A;  2DCK A;  1O8S A;  1UYZ A;  3WNL A;  4CVU A;  2E31 A;  3VD3 A;  1UXZ A;  1K42 A;  2Y6H A;  1US3 A;  1JYW A;  4GWJ A;  4BXS V;  3HN3 A;  2VC9 A;  3THD A;  1GNY A;  3UES A;  1W8O A;  5DN2 A;  4LKS A;  3C7F A;  2J1R A;  1OH4 A;  3T08 A;  1L7Q A;  1W9W A;  2VZ1 A;  2C26 A;  3DYO A;  4QDQ A;  3T0D A;  4QDS A;  1MPX A;  2EIE A;  2ORZ A;  4PT6 A;  2QQO A;  2W9X A;  3OEB A;  4CUB A;  3I2K A;  4Z2A A;  1IQD C;  3VD4 A;  5HPO A;  4AG4 A;  5C71 A;  1H6X A;  1JZ6 A;  2W1S A;  1W9T A;  4P5Y A;  1SHW B;  1I5P A;  4OMD A;  3IAP A;  4MGQ A;  1PMH X;  3FHA A;  1WKY A;  2E26 A;  1JZ5 A;  4ARX A;  2VOT A;  3VDC A;  3NQH A;  3OB8 A;  2V72 A;  3A22 A;  5CZK A;  4L0P A;  3ACF A;  1UYY A;  3ETP A;  3HNB M;  2R7E B;  3BGA A;  2X09 A;  4XUR A;  4KMQ A;  4A6O A;  2XOM A;  3UNP A;  1PMJ X;  5IHR A;  3BN6 A;  2W1U A;  3HPN A;  5JR2 A;  4JKK A;  1YQ2 A;  2QBX A;  1K12 A;  2Y64 A;  3UET A;  1XNT A;  3MUZ 1;  2XON A;  3SEP A;  3VDA A;  4M4R A;  2VO5 A;  3WF4 A;  2LW8 A;  4D8M A;  5C7G A;  2VZU A;  3LPG A;  5DPN A;  2W87 A;  3CKH A;  4W4Z A;  2J7M A;  2W47 A;  4RYD A;  4QDR A;  5CYY A;  3WNP A;  2C9K A;  2VQT A;  2WUH A;  4CU6 A;  3WNK A;  2B9V A;  5G05 L;  1BHG A;  1F4H A;  3DYP A;  1SDD B;  1JZ4 A;  1GMM A;  4MOA A;  2VCA A;  3SEE A;  2QQJ A;  1UZ0 A;  4JKL A;  3P6B A;  2VZV A;  4JHZ A;  3E1F 1;  4YPJ A;  3WNO A;  5LA0 A;  3GDB A;  2C4X A;  3IAQ A;  4QAW A;  1CZT A;  1OF4 A;  2VTF A;  4LPL A;  1EUU A;  2Y8K A;  4PQQ A;  1UY2 A;  4OZO A;  2YFU A;  3OGS A;  1GU3 A;  2WBK A;  2Y6G A;  3HNM A;  3MO4 A;  2V5D A;  4CUC A;  1UY3 A;  2LS6 A;  2VMD A;  2BGO A;  1GOG A;  2EIC A;  4QX2 A;  3ZM8 A;  3CIH A;  2YC2 A;  4CUA A;  4A45 A;  3WNN A;  3K4D A;  4DXS A;  4ZZ5 A;  5DMY A;  3VDB A;  2RV9 A;  5JXI A;  3ABZ A;  3K4Z A;  2EID A;  2W1W A;  2ZXQ A;  3T0A A;  3U37 A;  1J84 A;  2EIB A;  4DXT A;  3OGR A;  5EIY B;  3CZU A;  3C7H A;  4A41 A;  1P8J A;  3T2Q A;  1UY0 A;  3LEI A;  3GM8 A;  1OT5 A;  5HXM A;  3GGL A;  3IB3 A;  5EJ1 B;  3NJV A;  2J1S A;  3F2Z A;  2VZ3 A;  3T0B A;  2ID4 A;  5IFP A;  2J1V A;  3WSO A;  4D0Q A;  2VM9 A;  2VZP A;  5JXG A;  3NNG A;  3NRU A;  1OF3 A;  1JYX A;  5EJZ B;  3LEG A;  4A3Z A;  4QB1 A;  2J1A A;  2XQX A;  3DEC A;  2YFZ A;  4KWU A;  4FI9 A;  2VMC A;  3MBW A;  1NAE A;  2HLE A;  3OG2 A;  1JU4 A;  3AC0 A;  2JDA A;  1KGY A;  4CU9 A;  4QB2 A;  3C7E A;  1WCQ A;  1RYY A;  2WO1 A;  1JYV A;  4OYU A;  3SKJ E;  3NJX A;  3SKV A;  3I3E A;  3OGV A;  5LA1 A;  4JKM A;  4OMC A;  4PF1 A;  3ACH A;  3HJR A;  2VCB A;  3K75 B;  4M4P A;  1JZ8 A;  1D7P M;  3I3D A;  4LQR A;  3W5M A;  2DCJ A;  1HN1 A;  4JX0 A;  2CDP A;  1W0N A;  3WF3 A;  3P1I A;  3K46 A;  3T2P A;  2QQI A;  3HEI A;  4QPW A;  1JHJ A;  2VME A;  2W1Q A;  4DEV A;  5F7U A;  2WN3 A;  1O59 A;  3VD7 A;  4A42 A;  3W5N A;  1ULO A;  2ZEW A;  4XZU G;  5C70 A;  2VMF A;  4E8C A;  3CMG A;  2RJ2 A;  3C8X A;  3ACI A;  1EUT A;  3A23 A;  5J1X A;  2ZEY A;  1XNA A;  3K77 A;  1CZV A;  3MV0 1;  2W95 A;  2VZR A;  4P08 A;  2PQS A;  4DUW A;  4UAP A;  2ZEZ A;  4OUE A;  1PX4 A;  1US2 A;  2W94 A;  2KD7 A;  2VZO A;  4BJ0 A;  1TG7 A;  3D3A A;  2VZQ A;  2J22 A;  3FN9 A;  4MO3 M;  3EB7 A;  5IFT A;  5LCW L;  3WEZ A;  2VJX A;  2Y6L A;  1NKG A;  2J1T A;  3PUH A;  5B4N A;  3I2G A;  1JZ7 A;  1UYX A;  2WDB A;  1UY1 A;  2J1U A;  5G04 L;  2VR4 A;  4UI9 L;  2QQN A;  3CDZ B;  2VZS A;  1W9S A;  3HOB A;  3THC A;  2WQ8 A;  1GOF A;  2YC4 A;  1T2X A;  2WO2 A;  2B4K A;  3IDA A;  2JKX A;  5JUV A;  1UXX X;  2VZT A;  2WAB A;  3I2I A;  1CZS A;  4ET7 A;  2Y6K A;  2WN2 A;  3A21 A;  2WZ8 A;  4DXR A;  5DQ0 A;  3LPF A;  5A1A A;  1NX9 A;  2X05 A;  3T2O A;  3K4A A;  1NUK A;  3J7H A;  1UX7 A;  2WAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...