1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative xylanase
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
5EIYB 1DYOA 1JYNA 2WZEA 4OUEA 4DEQA 2BBAA 3A7QA 3WNKA 1UY2A 2QBXA 2Y6LA 3VD4A 4W8JA 3T2PA 2ID4A 2VZRA 3DYPA 2BGOA 2W95A 3MO4A 2YC2A 3MUZ1 2X09A 2J22A 3LQCA 3I2JA 5JMOA 1CZTA 2QQMA 1SDDB 5FUIA 4BJ0A 3SEPA 1JI6A 3I3BA 4CU6A 5JXIA 4A45A 3WNPA 4GWIA 4UOJA 2WO2A 4ET7A 3OGRA 1GMMA 2W1SA 1UYXA 3LPFA 1H6YA 3MBWA 4JKLA 3IAPA 3CZJA 2EICA 1JZ5A 2WAOA 3T0BA 5CYYA 3WNMA 2W87A 4JHZA 4ZZ8A 2W46A 4MO3M 4KMQA 3IAQA 2Y6KA 4CUAA 3WNNA 5IFPA 2VZSA 2V5DA 1JHJA 2VZUA 3IDAA 2VMEA 4BK4A 3VD7A 3U37A 3UESA 3VD9A 1HN1A 2QQLA 2VQTA 2B4KA 3FL7A 3GXUA 3EB7A 3HOBA 1OF4A 4FI9A 1L7RA 3P6BA 3I3DA 2VZQA 3CIHA 3E1F1 2W3JA 4BXSV 3OEAA 3ACGA 3P1IA 3HPNA 4QB2A 4XURA 1GU3A 1NUKA 3BN6A 2EIEA 5IYYA 4DXSA 5F7UA 1TVGA 1DP0A 2LW8A 2W91A 1F4AA 4DUXA 2Y6GA 5DPNA 4ZY9A 1JZ6A 1UY3A 4CUCA 3THDA 1OF3A 1OT5A 3JXSA 4MGSA 2J7MA 4DEVA 3FN9A 4P00B 4PF1A 3GDBA 1UYYA 4MADA 2X05A 3K75B 1NX9A 2VR4A 2VMFA 3PUHA 2YFZA 2J1EA 3HNYM 2RV9A 1J83A 2V72A 3W5NA 2ZEXA 1WCQA 1OH4A 3VD3A 3BGAA 3VDCA 1EUUA 1W8OA 1JYVA 1UWWA 3WSOA 2PQSA 3A23A 3I2GA 2Y64A 4QB6A 4QX0A 2QQJA 4CU9A 3CQOA 5B4NA 4LQRA 3SKJE 2V4VA 3VD5A 3CDZB 3I97A 3ACFA 1EUTA 2E26A 2ORZA 4Z2AA 2Z4FA 1JZ8A 2YB7A 4TXWA 2WO3A 2WZ8A 4QDSA 2WABA 3WF3A 2JDAA 2DCKA 3C7FA 1UZ0A 3HEIA 1GQPA 1PMJX 4UAPA 4UI9L 1OD3A 2WUHA 1BHGA 1NKGA 3C8XA 2DDUA 4XUQA 3SEEA 4JKMA 2XQXA 1UY4A 2W5FA 2VMDA 4DUVA 1KGYA 1UXZA 1JZ4A 2Y6JA 3D3AA 3T2QA 1P8JA 2HLEA 2QQNA 1JYWA 2ZEYA 2BERA 3WF2A 1US3A 1JYXA 2ZEWA 5JXGA 1CZVA 4W4ZA 5IHRA 2XONA 3I2HA 1US2A 5EJ1B 5IJRA 4DXTA 5JXJA 5B4XA 1W9TA 5C71A 2VCCA 3A22A 3IIIA 2W94A 3NQHA 3WF1A 2VC9A 2ZEZA 4XZUG 1O59A 4DUWA 2WQ8A 1UY1A 2JD9A 3F2ZA 4XUPA 3W5MA 3HN3A 4DXRA 4QDRA 5A1AA 4P5YA 2VZOA 3K46A 1CZSA 1DLCA 2VZTA 2J1VA 1JZ3A 2QQKA 2J1TA 2VQUA 4ZZ5A 2YG0A 2ZXQA 3OEBA 1I5PA 5HXMA 3WQBA 3MV11 3MUY1 4QX2A 3WF0A 3WNLA 4JX0A 4AG4A 4XUNA 1J84A 1GUIA 1JU3A 1H6XA 1KEXA 1W8NA 2C9KA 2VOTA 2C4XA 4CVUA 1F4HA 1ULOA 2RJ2A 4MOAA 2CDPA 3PUIA 3SKVA 3C7EA 5I0DA 3OG2A 3OGSA 4RYDA 3ABZA 2VJXA 3VDBA 5C7GA 3WNOA 1T2XA 4HG6B 4L0PA 3THCA 2VZ1A 3A21A 2J1UA 3CMGA 3HJRA 4GWJA 2W1QA 4YPJA 3ACIA 1MPXA 3NNGA 3CKHA 5HPOA 2LS6A 3K4AA 1K3IA 3WF4A 1YQ2A 2VTFA 4W50A 4OZOA 4CU7A 1GOHA 1CIYA 2Y8KA 2VZPA 4A42A 1O8PA 2WO1A 5G04L 2WYSA 3VDAA 4PT6A 2W9XA 2R7EB 1UMHA 1W0NA 1XNTA 2WN2A 3ETPA 1R64A 2EIDA 2C26A 3HNBM 4BK5A 2VO5A 1GOGA 3IB3A 2HYXA 4KWUA 3T09A 4A4AA 1NAEA 3C7HA 3OBAA 1IQDC 1WKYA 4XUTA 2E32A 1XNAA 4MGQA 5LA2A 2WAAA 3ACHA 5JUVA 2YC4A 5EJZB 2E31A 3GGLA 4LPLA 3C7GA 3I3EA 3DYMA 3CZUA 3LE0A 3K77A 4QAWA 3K4ZA 2W47A 2EIBA 5LA0A 2W92A 3EYPA 1UXXX 4A6OA 3ZM8A 2VZVA 4QX3A 4ARYA 4A41A 2E33A 2XHNA 3UNPA 3FHAA 2DCJA 4E8DA 3J7HA 4TTGA 4AAXA 1XC6A 3NJXA 2ORXA 5LA1A 3NRUA 2WBKA 4IUGA 3I2KA 1UX7A 5CZKA 2OKXA 3T08A 4CU8A 5JR2A 4LHSA 1K12A 1O8SA 2XOMA 4QPWA 3AC0A 2J1AA 2VM9A 3T0DA 2JKXA 1JZ7A 1XPWA 4P08A 1UY0A 2BGPA 1L7QA 2Y6HA 1SG3A 4OMDA 4M4RA 3K4DA 1UMIA 4RN5A 1GOFA 1GNYA 5IFTA 5JXHA 4JKKA 3OGVA 3UETA 1CX1A 3WEZA 1LNSA 5G05L 3I2FA 2VCAA 2J1SA 1K42A 3DECA 2VZ3A 2B9VA 4GZ9A 2QQIA 3HNMA 3ECQA 3LEKA 2WDBA 4KI5M 4QDQA 3LPGA 4OYUA 4D8MA 1UYZA 4M4PA 3LEGA 2L9LA 4XUOA 4ARXA 1SHWB 4QB1A 4OMCA 2W1WA 2X10A 4BDVB 4ZXEA 2CDOA 1PMHX 1TG7A 3T2OA 4CUBA 1PX4A 5DMYA 1PX3A 4E8CA 2J1RA 4XVHA 1W9WA 4PQQA 5DN2A 4D0QA 4A3ZA 4P02B 3GM8A 5LCWL 3LEIA 3MV01 2QQOA 5C70A 1K45A 1JU4A 4A44A 3NJVA 5DQ0A 3T0AA 2BZDA 2VMCA 1D7PM 2JE8A 1JZ2A 2W1UA 2YFUA 5J1XA 1ULPA 1RYYA 3DYOA 3C7OA 4QX1A 1W99A 3FHQA 4LKSA 2KD7A 3I2IA 2VCBA 2VL4A 2RVAA 3OB8A 1W9SA 2WN3A
chains in the Genus database with same CATH superfamily
5EIYB 3BPZA 1D4M3 3IBMA 4OHXA 2BBAA 1JN2P 5IWFA 3SH5A 5IVCA 3A7QA 4FPYA 1YCIA 2GSYA 1UY2A 2QBXA 5JCTA 3VD4A 2BOJA 4XF0A 3BOWA 5FR3A 4N43A 4FTSA 2IUWA 4W6XA 2ZS6B 2BNOA 2XJSA 4Q0UA 1BXHA 3R0RA 4XF4A 4LBLA 2XGXA 4YFWA 3LDKA 2N7GA 2NN8A 3MO4A 3VDDB 2JDKA 4Y22A 1AYN3 1AR61 2X09A 1R1A1 2RM22 3LQCA 3I2JA 3PVNA 4LBJA 4Q5OA 5BNPB 3PMSA 3KZ4C 5FYVA 4BHPA 2QQMA 3RRDA 5FUIA 4MV2A 4QX7A 1S0DA 3ZYBA 4M3CA 1JI6A 1E5RA 1Y7BA 3KQ4B 3WOGA 1Z78A 4PI2A 1TZOA 5I93A 3WNPA 3ZLIA 3S7EA 4Z8BA 2HWB1 1RITA 3MLKA 4NE9A 1HRI1 3I2DA 4XFIA 1QJX1 5B2GB 4ET7A 2WNEA 5HCAA 3WCRA 2WZR1 4LOSA 4D6QA 1H6YA 1BLZA 3IAPA 4OI2A 2XUEA 2OUJA 3CZJA 4IV1B 1JZ5A 1LB2A 1IPKA 4LHKA 1JUIA 1AHSA 1RUD1 1V70A 1W2TA 3PNAA 1IQAA 4RGGA 5T50A 4H55A 4AQ6A 5CYYA 3T1LA 3WNMA 5KR7A 4JHZA 1TQ5A 1QJEA 1W8HA 3M7AA 4EN9B 3IAQA 4OHWA 4CUAA 5FXXA 2YBKA 1E5SA 4CCKA 3SHRA 5IFPA 5KHJA 2V5DA 5I8YA 1OA3A 2A75A 4MUVA 4ONUA 3K3NA 4YNIA 5GZFA 1BK1A 2GN7A 2Y33A 4FQZA 3IDAA 4BK4A 1S0BA 4CPBA 3U37A 1QU0A 2KM2A 4NAOA 4YGEA 3DV8A 4EWDA 1KDKA 5I0UA 3OOXA 3I7DA 3PTRB 3VLBB 2ZHNA 1VBC1 3HOBA 2VNOA 4V2VA 1W39A 3I3DA 4LHLA 3E1F1 4ATEA 1WWYA 4G4FA 1HLCA 4HANA 1URXA 2WIIB 5KBFA 1RUC1 5F37A 3P1IA 4XJ9A 3EQEA 3IDCB 3PUSA 1GU3A 4IDZA 5F32A 4XTPA 4MH0E 4WVWA 1PO12 2VE1A 4N9HA 2HJIA 4LKDA 2ATFA 1JBCA 2W91A 3RPQA 3AZZA 5CFCA 4RFT0 2NP0A 3HQUA 1OF3A 1S0EA 1YQCA 4MGSA 2J7MA 5A70A 2BWAA 1ND2C 3EO6A 1DGRN 3NKTA 1DIWA 3VKMA 2FDJA 4Q8LA 3Q9OA 2VAUA 1Q8SA 4KGQA 1S55A 1XB9A 2JWPA 4TSVA 1QIQA 1TME3 4XETA 1OURA 2RV9A 4AHYA 1SBDA 1J83A 2V72A 4B3NA 3W5NA 2R0HA 3WUCA 5A7NA 4Y4RA 2RM21 3VDCA 2EAKA 3WW1A 3I3QA 2BEOA 4AQTA 5FY7A 3IIAA 4LMFA 1X9PA 5ACA3 1WBFA 1JYVA 1ZBE3 2ZGLA 3SNMA 4FT8A 1V6JA 3U10A 2PFWA 4EE2A 4Q1PA 5FBJA 4JGYC 2QQJA 5FZGA 4CP0A 2JB8A 2YY1A 2JIGA 4XJUA 1RVF2 4Y1XA 3I2OA 2PHXA 3I97A 3JQXA 2DWRA 1IG0A 5KXCA 2RR12 1EUTA 2VPVA 2YU2A 2FMYA 4WVMB 5A6ZA 1ENQA 3UGFA 2YB7A 3IM0A 1UZVA 2VOWA 4KU8A 1IKPA 1YQ5A 2WZ8A 4CEYC 5CISA 1MVEA 2D6PA 2JG8C 4XZPA 2DCKA 1WLWA 3C7FA 4YVSA 3HEIA 3GF6A 1LR5A 2DVAA 1UU6A 3FLTA 5A6YA 3TEXA 1B35B 5FPZA 5FP4A 2WT1A 5LW9A 4YG0A 1QWRA 1H8TB 2MEV3 2Y0IA 1OD3A 2G1MA 3V64A 1V6KA 3EXUA 3QACA 1NYWA 1PIV1 3MIDA 1S4CA 3SEEA 3TOJA 4JKMA 3O12A 1VBA2 1QQP3 2XQXA 5CBLA 5FY0A 4BXFA 2W5FA 2D3PA 4R9DA 5L7OB 2R6QA 4NRMA 1WCUA 1UXZA 1JZ4A 4GKXA 1O6UA 4Q26A 2A71A 3TAYA 3B5LB 5LY2A 4D69A 4RHV2 2WO7A 1FAYA 1PO23 2H6CA 4Q4Y2 3BYWA 2LM3A 2H0BA 1REDA 1CIWA 1AR63 2CNAA 1R1A3 4PJYA 3VBSA 2HLEA 1HQWA 1PO11 1D2SA 2ZPXA 2ZEYA 1WUVA 4IEXA 5E6HA 3LDRA 3E97A 4CCCA 2X29A 2YUEA 4CCDA 3S0MA 5FREA 4GWNA 1VIWB 2HWB3 2ZEWA 4Q0SA 5JMCA 1HRI3 2C1FA 1W2UA 2JD4A 1APNA 2VG9A 4GB32 3T4HB 1IS3A 4K7JA 3WLUA 4L2NA 1US2A 2AREA 2FHRA 2DTYA 1H2NA 4M0NA 4MHRA 3RZMA 5C71A 2YBPA 1IPSA 5KHHA 1HQLA 3WW4A 4AE2A 1PK6A 3A22A 2RDQA 3FHIB 1QOOA 4XW3A 1PZ7A 4HBNA 5ABJC 4QQHA 2NM1A 3LKJA 4I01A 2XUMA 3BTXA 3MW3A 1DGRA 2IC1A 4QU2A 1W28A 1NOVA 2WQ8A 5F3EA 4Q4X2 3VGIA 4K1ZA 4MZUA 3VZOA 3HIFA 2TUNA 3B7MA 3HN3A 2D93A 1QH6A 4OHZA 4B8EA 3OBTA 2B42B 4CDQB 3E6BA 1UOBA 1RVF1 2OPWA 2OVUA 4HN0A 5JPNB 5FXVA 2WJSA 2X5IA 2XPJA 5FZOA 4QX5A 1CZSA 2VZTA 2J1VA 3THPA 4BZ4A 2RR11 4PIYA 2G9FA 2OZ6A 2ZX2A 1VBC3 4WM7B 2VQUA 3R4UA 2YG0A 1DQ2A 4O9GA 5BY5A 2FDKA 2PYTA 2OIIA 1Z7S3 3QH7A 4JAAA 2QFEA 3WNLA 3NAPC 1PMIA 2BOIA 3AL6A 1XE0A 3JB4C 1YIFA 3ZXGA 2B7YA 1FATA 2WKKA 1JOBA 4FPCA 3U4SA 1FOD2 2JXAA 1IS6A 1O3QA 1RIRA 3N9OA 3FE5A 2VOTA 1Y4WA 2ENRA 1YFXA 3ZXLA 1H8VA 5TSWA 3JD73 4DINB 2XMLA 2ADEA 4K40A 2LRPA 2YXSA 3M3OA 3ZYRA 3ZYHA 1VBA1 1LOGA 4XBNA 4N9IA 4AW7A 1KXGA 2BFUS 2RJ2A 4Q0QA 5D8AC 5FPLA 1WA4A 1ACCA 3C7EA 3H42B 3W59A 2IXIA 3RNSA 2BQPA 4LBNA 4Q1RA 4RHV1 5IAVA 5JOXA 2PAMA 2GC0A 1TNRA 3H0OA 4Q4Y1 5JOZA 3TN92 2VJXA 2QQVA 1I9RA 1N47A 4U2AA 3ZFGA 2RM23 1ZZ6A 1J58A 1T2XA 1REFA 2EAAA 5ANQA 4DRRA 4YG6A 2O0OA 4L0PA 3RDIA 3THCA 5CAZA 1W8TA 3A21A 3VBUA 3UKNA 4CEWA 3LF7A 1WW5A 3CMGA 1XOYA 1AX0A 2FCTA 2SBAA 3H7YA 3MIBA 3U78A 2JG9B 3CHXA 3HWJA 3ACIA 5FPAA 3WXPA 1GZWA 1X8EA 2CAVA 1YRZA 4Q4V3 2PMWB 4LORA 1UKRA 1DCSA 1XNDA 1R1ZA 1K3IA 2C0ZA 4XF3A 4URTA 3USUA 1ND3A 1XQNA 2VTFA 4W50A 3BI3A 1GOHA 2RS32 3J8F2 4XDQA 5T5JA 1AX2A 1FNYA 4KGGA 1CIYA 4XE9A 3UJQA 1QOSA 4A42A 3ZXJA 2BVVA 5JAXA 5DDJ1 4AVBA 2WO1A 3O1MA 3KV5A 1RJ8A 3OBRA 4GMP3 4Q4X1 3SH4A 4AFCA 1R64A 1XBFA 4YYOA 1WW6A 5L9RA 3HNBM 3KVBA 3RG0A 4NN0A 3CJIB 5E89A 1ZZ7A 5ERLA 2D5HA 2HYXA 3HBKA 3GBFA 1NAEA 4ISRA 4KWUA 3I59B 3VBHA 2BTVC 2IVJA 2ZGNA 1IQDC 2JB4A 3APBA 1GWMA 5FLHA 1ZZCA 4JRAA 4GH4B 4OVEA 5C8CB 1V6OA 4MGQA 5LA2A 2XH6A 3VHNA 4DOUA 2TBVA 4KU7A 4TWTA 4UFKA 4XXAA 5C3OA 4COZA 5JUVA 1QXRA 2YC4A 4I02A 4O9EA 4LPLA 4F3JA 3ATGA 5FZ4A 5BNPA 4BH9A 1JHNA 4CDWC 4X8NA 1W04A 3DYMA 4UW6A 4LOTA 1MS3A 1L7LA 3OPWA 5FPVA 2XLFA 2VBBA 3LE0A 3ZKUA 3K77A 3WDWA 1LHWA 3K4ZA 3O1RA 1FOD1 3SCHA 3UYJA 5FWJA 1SQ4A 3O5SA 2WA3A 3JBG2 1I3HA 1I5ZA 1X33A 2W92A 2XJQA 5CB7A 5FZ0A 3RZZA 3ZSLA 1UXXX 3OTFA 3USSA 2YBSA 5IUQA 4GKYA 1MACA 2RE9A 3MGUA 1LHOA 2ZCWA 1NCQC 1Q8VA 4YGDA 4JTOA 4ITCA 3B9IA 1XE8A 5IW0A 3VHPA 1HQNA 5FK7A 1OA2A 2XHNA 4AEDA 1JOJA 3POIA 3ZPYA 1UZZA 3OY8B 3TN91 1YQ8A 4LBMA 4E8DA 2ZOEB 1UU4A 1MS0A 1MR5A 4TTGA 2R062 4AAXA 2FCVA 2ORXA 3NRUA 4FPGA 4NWVA 1JYCA 2WBKA 4IUGA 1CESA 3PIJA 4CU8A 1SACA 3VL9A 2P6CA 1K5MC 2XG3A 1H2KA 4QPWA 5BNOC 2MPFA 2P3KA 3WQ1A 4HSJA 2C24A 5FYZA 1G9DA 1JZ7A 1PNGA 1F15A 3MIGA 4IV3C 5A1LA 2QVSB 5EYXA 2EA7A 2HWD2 1GNZA 2RR13 1ST8A 1X50A 2WQ4A 4LIVA 2AENA 4QPIC 2XDVA 5LY1A 1WD4A 2DVDA 4FXKB 2RS31 3J8F1 4AHXA 2PLV2 3VKFC 4M4RA 3K4DA 2ZGUA 1GOFA 2WNUA 1PVXA 3RGBA 4AI0A 4AVTA 4JKKA 1O3TA 4DZGA 1F5FA 2DF7A 1KFUL 4GA9A 4W65A 4QXHA 5CFDA 2WFPA 4YVWC 3WEZA 3ZXFA 5LEKA 5F6KA 1QEXA 1CX1A 3I2FA 3WUDA 2J1SA 1STMA 4OCTA 1QH7A 2VW0A 4BYYA 5C33A 3N7KA 3BKZA 1G86A 5FJKA 2XLAA 4ZKTB 1MZ6A 5FZBA 2XBO2 5SV8A 3POFA 2BNMA 3ECQA 3H1WA 1VBA3 5L36A 5AFEA 2JDUA 4BQXA 1ULGA 3ZN4A 1UOJA 4Y1YA 1SDWA 2B8MA 1PGL2 4LHNA 4EN0A 1VBD2 5C4WB 2L9LA 3ST7A 4RHV3 2GP5A 3LAGA 3ZKYA 3WG4A 4QB1A 1RTVA 1YHFA 2UYBA 3KVAA 2HBUA 4C1XA 1KS5A 1ZZ9A 2W1WA 3VBRA 4YM3A 5GLUA 1QHDA 2YGLA 3JBG1 1IS5A 1XU2A 1PMHX 1IKQA 3N3HA 3PURA 5H9QA 2AH2A 3T2OA 4CUBA 3LIGA 5FP9A 4MXWB 4YW3A 3OGJA 3QD6A 1R082 4IE5A 5JI7A 2VY0A 4AR2A 4E8CA 4XACA 1T6GC 3V0AA 4WVMA 1W8FA 4GB33 4L8QA 4CXWA 2WZPP 4JC1A 1LEDA 2OA2A 4DIQA 1UAIA 4QQPA 2QE3A 4LO7A 3KCXA 5LCWL 1AUYA 5FK8A 5FOJB 4OFGA 5JDBA 2QQOA 4NOTA 4LBQD 3LD8A 5DZEA 2HYKA 4PDWA 4WVZA 2BPA2 1W90A 1ODMA 1B35A 2BZDA 5EXOA 1XSQA 2R061 1J3QA 2VMCA 4LUMA 1D7PM 4N43C 2JE8A 4Q4X3 1TNFA 2GN3A 5FYHA 2D6NA 5J1XA 3H9AA 1ZRCA 3DYOA 3VV1A 4QX1A 3OSDA 3SXWA 1ALYA 1O3RA 2C6SA 4KBBA 4IETA 2UY9A 2X8KA 3ZN6B 2RVAA 3AL5A 3WDUA 2PQQA 5JIUA 4NWWA 5A80A 1QJY2 2HWD1 3D82A 1RC6A 1GWLA 1YYNA 4OUEA 1G6NA 2BP6A 2PLV1 4Y5TA 1UIJA 5E16A 1Y3TA 2CHHA 2VMIA 5GLTA 4D94A 4MGTA 4Y33A 2Z79A 1CAUA 1SLTA 2TNFA 2G9ZA 3T2PA 1Y9GA 4CTEA 4BIFA 1ZBA2 5DZFA 2BGOA 2OT7A 1W8ZA 2XVKA 1FOD3 2B46X 2EXKA 3WDTA 4FAHA 2YC2A 3R6SA 1H1IA 1WMXA 3PVBB 2R042 3N9PA 1LESA 1CZTA 1H1MA 2XBO1 5FMCA 5GJ6A 4BJ0A 5BXXA 2D44A 3I3BA 4JTNA 4OQ9A 1ENSA 2DVGA 2UY8A 2G4IA 1O5UA 4XF9A 4QXKA 4ASLA 2VQ0A 1XYOA 4PBPA 2WO2A 1UF2C 1W2AX 3HQXA 1BEV2 3NW4A 3RZJA 1GMMA 3POGA 3WW2A 1VBD1 1EAH2 2A70A 4IEYA 4O61A 4ZXKA 1UYXA 3LPFA 4QKBA 1HB4A 4CZSA 4JKLA 1O7FA 3TN93 5EWSA 1AZDA 3MPBA 2WAOA 4R8HA 1PHMA 1EY2A 1BMV2 4S2GA 4CDQA 3KV6A 1OPOA 1NG0A 2JICA 3X29B 2O1QA 3Q8BA 4K3UA 4KMQA 1R081 4WZFA 2VUDA 2E53A 3I3MA 1VE0A 4Q2FA 2PHRA 3OYWB 5BNNC 2A3WA 2UWBA 4Y1UA 3VUOA 3M70A 3FFQA 5FIXA 5CFCC 5JZGB 2EXJA 2ZGPA 4Q27A 1Q8QA 2QQUA 4E4DX 2DVBA 1HV1A 2O8OA 2K9ZA 4XXPA 2RS33 3VD9A 3MYXA 3KQRA 2GAUA 3AP7A 1AR83 3A0KA 2EF6A 2P17A 1DBNA 2BVBA 4K8RB 1CAWB 1L7RA 1AXZA 3Q8AA 4LBQB 1OFNA 1NT0A 4NRPA 3OGGA 4DS0A 3JUUA 5K0UA 5FV3A 2ILMA 4LO8A 4PCRA 2JDYA 4YFZA 4KBZA 1NUKA 5DUXA 1UN1A 1VJ2A 5CVRA 5IYYA 4XMIA 1OLME 1H4GA 1WA6X 2K46A 2LW8A 4GULA 3RWNA 3WW3A 3NJZA 1O3SA 1F4AA 1QJY1 3GCWA 1JW6A 1ASJ2 1KITA 2E51A 3DN7A 4CUCA 5FZKA 1JZ6A 1POQA 2OQ6A 5APAA 4ES8A 2BDRA 2JEMA 2CSGA 3THTA 2B5HA 3LSDA 2QUOA 1VB4A 3UJOA 3W9AA 4AEJA 4C0HA 1H2LA 3KWVA 2ZHLA 4KWLA 3VZNA 3AP4A 4QXBA 1ZBA1 5LWBA 2J1EA 4AEMA 5IVFA 1RMU2 3HNYM 4IE6A 4QHZA 2P2KA 2JG9A 5AC92 5FYYA 1ENXA 4RL7A 4TN7A 2ZEXA 1C8M1 4LJHA 4S2FA 2GH2A 3MI8A 2WT0A 2R041 4YVSC 4YARA 1UWWA 4DMIA 3I2GA 3OUHA 3RYPA 1UCXA 1QNWA 2HWC2 4QB6A 3MDPA 1W0OA 2GC2A 4OLLA 3FC0A 1DGWX 4QX0A 1FV2A 4XIKA 5FZ8A 3MICA 4A6SA 2P3YA 3KB5A 3LIHA 4CU9A 2JX9A 2Y0OA 4LQRA 3V65A 2V4VA 5GLVA 3UKVA 1EAH1 3VD5A 3GALA 3SISA 2GC3A 3AXEA 3CDZB 4CXYA 2QDRA 5A1FA 3ACFA 2VW2A 3O1OA 3VB9A 2R063 3P3PA 1BMV1 4Z2AA 2Z4FA 1RUC2 5FMBA 2CWMA 4AI3A 3WDYA 3M3IA 5EFUA 1YLLA 3HVDA 4QDSA 4Q8KA 1FXZA 1RUJ2 2AGSA 1OH3A 2A6XA 5FYSA 4META 5T5OA 5C8CA 3VBSC 1H0BA 5DZGA 3BPSA 3A4UA 1DLLA 1FX5A 2DFCA 4YZ4A 2W08A 2DUQA 2ZABA 1S2EA 4AI8A 3KLSA 1CAVB 2BUKA 4YM1A 2HWD3 4XIOA 1GP6A 3L9JT 1BHGA 2NLRA 1Q56A 3B69A 2EXIA 4IXLA 3GBWA 1OLRA 4EN7B 3D0SA 1CWPA 4WM8B 5IK8A 4SLIA 4M3CE 3KM5A 2D40A 3IKWA 1OFSA 2ZHKA 4HSLA 3ENRA 3BALA 2Y6JA 3D3AA 1PK6C 5F6LB 3T2QA 4DY5A 1BYHA 1P8JA 4NIHA 1AR91 4JGYB 3CO2A 4MLOA 4V1PA 2GNMA 2XBO3 5F8PA 2RS52 1OKQA 2BERA 2MHFA 4AGVA 3TNQA 2VBDA 1ASJ1 3WF2A 2CGPA 4P9JA 2H6BA 2ZMKA 2DCTA 1XYNA 3MFAA 2Q8CA 3GHMA 2CWSA 3AYAA 2WC2A 2X5IC 4CEYB 1G9FA 3I2HA 5C3PA 5EJ1B 4PI0A 2GDFA 1NXD1 1WLTA 2JG8B 4YM0A 4AFAA 3PVEA 1VBB3 3FX3A 1RMU1 2D97A 1FMD2 1NLRA 3FLRA 2BYVE 1O91A 1SCSA 3IIIA 4AAPA 2VNGA 5AC91 5CA6A 5JVVA 2VC9A 2C9AA 1U5XA 3AFGA 3POEA 2WSUA 5CKMA 2OYZA 5KXEA 3ILFA 4XFGA 1O59A 4DUWA 1R083 2MNGA 4OULA 2ZKNA 1KDMA 1UY1A 3KT4A 4LBOA 4XUPA 3TWIA 2HWC1 1W6MB 4CP2A 4CP9A 1PIV2 5FY9A 5FYTA 5A1AA 4BB3A 4XILA 3CF6E 5LEJA 1VRH2 2VZOA 4XDOA 4BMEA 3FZ3A 4UFMA 1UU5A 5EZWA 3BTAA 1DLCA 1VBE2 1V00A 3WY6A 4MXVA 3ZN5A 5J3UA 1JZ3A 3ZSEA 4UFIA 3ZIXA 3N4MA 1C4RA 3B01A 2ZXQA 1I5PA 5LK5A 1LGBA 5T55A 1LGNA 1ULFA 1SCRA 1W6PB 3WQBA 3O0VA 2RHPA 3BOPA 4J1WA 5FQ0B 5CKNA 1RUJ1 1UZWA 4P9YA 1N3PA 3OBZA 3RFRA 3ZFGC 4AG4A 3RJ2X 3DEMA 1NXMA 1W6QA 5A3WA 1J84A 1JU3A 5J7MA 1H6XA 2VNRA 1KEXA 3M8LA 1W8NA 4XOGA 4CRQA 2C9KA 3VBUC 4CEWC 3EHKA 2Y34A 1QJY3 2A6VA 3PTYA 3GZEA 2XXZA 4CVUA 4E4ZA 1D4VB 3PU3A 1F4HA 5JR7B 4YGBA 1U0AA 1ULOA 5KHGA 2FCUA 3MHZA 5DUVA 3NKGA 5EQUA 1SLBA 4N53B 1ND3C 1ZBA3 3ZFEC 3OG2A 3I54A 4MXWA 1A78A 1WGPA 2VQAA 4NMIA 4RYDA 4AZZA 1LOCA 3QOPA 2VOKA 2Q8DA 1G9CA 4EJRA 3VDBA 1VMHA 3POYA 1NA1B 2IVIB 4IERA 4QGNA 3ZFFA 1RUE1 3DPRB 2R043 3B3QE 3O0WA 4HL0A 4K6BA 1XU1A 3GNEA 4Y4YA 5FZ9A 1S0IA 2RS51 1ULEA 3KGZA 4Y1ZA 2J1UA 2WINB 4Y24A 5FZIA 1NCRB 3PJYA 3KHBA 4H7MA 1ZRFA 3VN4A 2VBPA 1UKGA 2W1QA 1XNBA 4FOVA 1BEV3 1JTZX 2GP3A 1UPSA 1MZFA 3DF0A 3VBHC 3HR9A 4ISQA 4I3GA 3E5XA 1SPPA 3I8TA 4A7ZA 2LS6A 3K4AA 1GICA 1JUHA 2ARBA 3NAPB 3R4DB 2JECA 3T4VA 3WF4A 2WLPA 1YQ2A 2RMU3 5FUPA 4RQPB 2TEPA 1FMD1 4AF9A 2IFWA 4FTBA 2Y8KA 1VLNA 1ZNPA 3ZN6A 3C3VA 3OPTA 3POWA 3M1HA 2D6MA 5A7WB 2WYSA 4DQAA 5CADA 3NO8A 1H4HA 1UMHA 3ETQA 4LT5A 4AFDA 2WN2A 3FBMA 4GQ7A 4N8MA 1ZVFA 4QU1A 2ZJCA 5DG2A 2X53S 4XBQA 3FMGA 5D8AB 4DFSA 3IB3A 5FY5A 5JSRA 3DGTA 4HVRA 4A4AA 5F1RA 4CA9A 1VRH1 2BV4A 1LODA 1VBE1 1FV3A 5A32B 2E32A 3SCFA 2FDFA 1Q8OA 3NNMA 4XDPA 4ZU4A 1SFPA 3ZMNA 4ZS2A 3GGLA 1RJ7A 5KHKA 4XYXA 4XQ4A 3AKRA 3PLQA 4G3YC 4AEDC 4I0AA 2WRAA 1GNHA 3FUQA 4FFIA 1HJFA 5FY1A 1AJOA 4XFHA 3S30A 1KD7A 5IVBA 3CZUA 4GMP0 1V9U1 3VBOA 5FRAA 2QKDA 3INAA 5C9AB 3VZMA 3LGRA 3NV4A 1ZYBA 1QJX3 5LA0A 1LGCA 1ASJ3 3UGGA 1A34A 1EPZA 1WLCA 2ZZQA 2WZR3 5E1RA 5E88A 1GBGA 2DURA 2JE7A 2R32A 3AP5A 1LU2A 3JB8A 2VZVA 4GJZA 4QX3A 1ZA7A 5L9VA 5FOBB 4ARYA 5I91A 1RUD3 5LK7B 5JLVA 4OUSA 4FOWA 1HKDA 1RMU3 1VAKA 1YO8A 5DDJ2 3UKTA 1Y9MA 4NROA 3ZYFA 5AC93 1YXWA 2DCJA 5FO9B 2VOVA 4HOOA 1K5JA 4JDMA 4OUMA 2WNUC 3OYWA 2JDPA 3B02A 5AFBA 3BIWE 2WYFA 2W2IA 4FFGA 4CDUB 3NJXA 5FXZA 3GJAA 3ZR6A 5LA1A 1YEWA 5JZGA 5CFDC 1UL9A 4TLGA 1KS4A 2W52A 3LOIA 2HWC3 1DGLA 4OHVA 1S1AA 3POBA 4INDA 3O1PA 2HEVF 3N35A 4I2OA 3AC0A 2J1AA 3GBGA 1S0FA 3T0DA 1AL22 5FYIA 5C3RA 3D4KA 2Q1MA 1XPWA 4CDWB 2ZGKA 4LBQA 2BGPA 1W2NA 4WBBA 2GNTA 3ZSJA 1UX6A 3D0JA 5A33B 5FYMA 2Q8OA 3BU7A 2Y6HA 4AGRA 4AVVA 1RUC3 2ZMNA 5FY4A 3V56A 1OOPB 1SG3A 1MS4A 3AZXA 3K48A 2Q30A 4M01A 2ZZJA 5ANNA 1UMIA 4PIZA 5F5AA 1RUJ3 5JXHA 1VMJA 1OA4A 1WZXA 2D5FA 2RDNA 2XL7A 3VBRC 4O65A 4P9WA 3GCXA 1MQTB 4YW7A 4FBFA 3TRSB 5IT6A 4BIOA 4WV8A 3S6PA 3O1VA 1NCQB 4XFFA 1PM4A 1UYPA 1YI7A 3HT1A 3DECA 4RS5C 4CXXA 3SQOA 2XKOA 3RI8A 4A3XA 4JQTA 4W6YA 4ZPIA 3UT0A 3HNMA 4KI5M 2VH9A 1H1AA 4LA2A 3F95A 5FO7B 2KR2A 5HCHA 1CGPA 4M4PA 4RA0A 4PDWC 4YLZA 3VZJA 4XUOA 2FZ2A 5DUUA 2WNOA 4QKNA 1SBEA 1SHWB 1K5MB 4JVAA 2RG4A 4IEWA 4X6RB 2RJLA 4CDXA 1W6OA 4BDVB 4GD4A 5I0TA 4ZXEA 1V6IA 1ZZBA 2Q4SA 2RS53 3Q8FA 4IV3B 3DKQA 2CDOA 2ZX0A 1TG7A 2E63A 4OZXA 1PX4A 3AKPA 5LRRA 2ADDA 4QPIB 1XNKA 4XVHA 3ZDVA 2QQPA 2WNVB 1ZRDA 3PVOA 5BV6A 5F3GA 1GKBA 3VBFA 5FKCA 4BLIA 2BJSA 3TEYA 4RR3A 3GM8A 1C3HA 5GZCA 4PQ9A 4ZONA 2ZGTA 4HPKA 3NNFA 2FDIA 1NQDA 3AJYA 4CE8A 4YVWB 3TYJA 1QKQA 5LB6A 3FJSA 2D6OX 5DQ0A 2CAUA 2B39A 3IN9A 4COUA 1BQPA 4MHUA 1XE7A 4IEZA 2ZX1A 4KG8A 4XFAA 1EV12 2WA4A 4X6QB 5FYCA 3MZHA 1H9WA 5T5LA 3UK9A 2PHTA 1QMJA 4QKFA 1PIV3 1V6LA 2JJ6A 1FPN2 4OI4A 4Z92B 4AVSA 4WM8A 3ZR5A 2FD8A 2XWBB 4QKDA 1AL21 2VCBA 2YZ4A 1GP4A 1GYKA 3OB8A 3RSJA 4YW4A 1JOPA 1MVQA 4Q4W1 1VBE3 3VDDA 3ZYIB 5F3CA 5JPMB 1JYNA 4FPEA 3LSEA 1M06G 1JS9A 1RUH2 4YGCA 3EJKA 3AKSA 3WNKA 4EYUA 5T52A 1PO13 4YRDA 5GM0A 4DO0A 3K2OA 2FBEA 2ID4A 2VZRA 3DYPA 1QXPA 3QH6A 3H7JA 5LBBA 3HBZA 4RD7A 2Y26A 4OI1A 4COVA 5LBFA 5J96B 1MS1A 4YWAA 3ZYJB 4IV1A 4ZU7A 1AXKA 2DU0A 1DU3D 2J22A 3LDBA 3H3LA 5JMOA 4L92A 1XRUA 5BYNA 2AACA 2XHKA 4DY3A 3SEPA 4AVCA 2JE9A 2XJTA 4A45A 2V09A 5FKBA 4GWIA 4N43B 3KSCA 4XCBA 4GAZA 4UOJA 4D7TA 3SH3A 4YZ2A 2W1SA 4B1LA 2HWE2 5I0SA 4F8AA 2CGOA 3WG3A 4CCLA 2E7AA 3MIHA 4Y22B 2XVLA 2EXHA 4QPGC 1OLQA 4IL7A 2D43A 1RL3A 3V0BB 2Q8EA 5HV4A 4XCAA 4CCEA 1H9PA 5K0UC 2W87A 4UT5A 2W46A 2ZKLA 5FLIA 1G7YA 1XSRA 2Y6KA 1RVF3 2J42A 3WNNA 3MIFA 2UURA 2AC1A 3B00A 5IAXA 2VZSA 4HT1T 4F83A 2VZUA 2P1BA 1R092 1BBT2 1IPJA 2NMOA 5DXDA 1W6PA 3MIEA 5D21A 5T3NA 5KC6A 2P5BA 5FQ0A 3VD7A 5CKQA 3D6EA 2I2SA 2Y38A 1HN1A 5EJ3A 1WCKA 4FCAA 2VQTA 3FL7A 2DCYA 1IG3A 3EB7A 1OF4A 1RXFA 1L3JA 3P6BA 2Y6FA 4AYUA 1EV11 1MS9A 1OI6A 4R9CA 2WS92 1WD3A 4S2DA 5IVJA 5KXDA 3OEAA 1D4M2 2WLQA 3FBYA 1N3QA 4BM8A 4HETA 3S57A 2GNDA 1QNYA 3HPNA 1CJDA 1FPN1 3H8UA 4LA3A 3H1YA 3BN6A 2AEYA 3AJZA 3H3UA 4AI1A 4CCOA 2DFBA 4P9XA 2QZ2A 2IXHA 4DXSA 4ASKA 1TVGA 1DP0A 1YJKA 3UGHA 1CPNA 2A7AA 4N53A 5CG9A 2ZAAA 3KV9A 1UY3A 4RGKA 4HZFA 1W0PA 2NYYA 1U12A 2ETEA 4Q4Y3 4P00B 4DEVA 1NA1A 4PF1A 1AYN2 1NLSA 1RUH1 1UYYA 3GDBA 3DPRA 2PA7A 3K75B 2VR4A 3WHUA 3CLPA 1UD1A 5D1IA 4EROA 4Q29A 2DBIA 2YFZA 1NCRA 2Z2SB 4FPKA 2VD7A 4Z1VA 1YFWA 3AVSA 4NIGA 1YQ6A 5BNNB 1AJKA 1Y9QA 1POV0 1WCQA 5KWRA 1OH4A 2FQPA 5CFCB 3BGAA 1EUUA 3IPVB 4LE3A 3WSOA 3CU7A 4CYDA 1LU1A 2NMNA 4RQPA 2GMMA 2Y64A 1WBLA 3FUOA 4Y5SA 1W03A 3VZKA 4E27A 4LK6A 1X8MA 3CQOA 4FPJA 3AKTA 5DDJ3 2HWE1 4FPHA 3URFA 1PZ8A 1RHI2 3H1MA 1H8TA 1SFNA 3HMYA 1O4YA 4LXLA 2ORZA 3VL8A 4NPRA 5D8AA 1JZ8A 3RZHA 4X8PA 4BQ4A 4EV0A 5DAQA 2WABA 3WF3A 3N9NA 5L7OA 2XR4A 1JODA 3IT8A 5A32A 3CJXA 1OUXA 2VULA 3C2UA 4I3PA 1H2MA 1AL23 1GZCA 1SEFA 1GQPA 1IOAA 2VXJA 4UAPA 1R091 5LBCA 1BBT1 2WT2A 1S2KA 3U11A 2WUHA 5IK5A 3C8XA 1GZTA 1GLHA 1NKGA 2IXJA 2BWCA 2DDUA 4K20A 5DAVA 1OMIA 3E5UA 4LO4B 2UWCA 3DXTA 4QMAA 1CX4A 5C9AA 1BK0A 4LEJA 2VMDA 4DUVA 1KGYA 4YVSB 3T30A 1ENRA 1DYPA 2WS91 1C8M2 5J48A 1OPMA 1BJQA 1D4M1 1MS8A 3B94A 2JDMA 3ZOIA 1PNFA 4QQ2A 3AXDA 4QM8A 1XJAA 4JGZB 5FYBA 2RDRA 3VKLA 3IWZA 2YGMA 4XMAA 5DAPA 1TME2 4FAGA 2BBVA 1DGWA 1US3A 1OVSA 1JYTA 5JXGA 4P9LA 5FJHA 2AEZA 2GNBA 2NQYA 4YW2A 1AYN1 1QDOA 5FO8B 4W4ZA 4CDUA 3GZAA 3N7LA 4HKOA 1J59A 1GV9A 2XONA 3AMNA 1A8DA 3W58A 1ZBE2 4P9IA 1HRV2 4SBVA 5EV7A 3WQ0A 4NHKA 5B4XA 2IXLA 4B1MA 4DXTA 1VAVA 4BCUA 1N1VA 3H8RA 2E7QA 2VCCA 1HDKA 2YROA 4AK3A 2R072 2ZAHA 5DAWA 5F2WA 1CQ9A 1WLDA 4L97A 3WF1A 4UXAA 4IEUA 3IDEA 1OC1A 2AUYA 4WM7A 2UWAA 3L2YA 2ZEZA 4HK8A 3ZXDA 3IDBB 4XZUG 3O1UA 5F39A 4Y1VA 2ZX3A 2JD9A 5FZAA 3AB0A 3ACLA 5EPAA 1HV0A 4EZHA 2C5DA 3W5MA 1C57A 5FPXA 1OOPA 1QGLA 4XQWA 4DXRA 3J8F3 2Q5TA 4FQ4A 1LOAA 5EYYA 3ASIA 1DQ1A 3HT2A 4R4ZA 3AZYA 4J6GA 1F2NA 3P3NA 1E5HA 4P5YA 1MEC2 1TEIA 4QGLA 1W3VA 5A7SA 1W9FA 4Z07A 5IVEA 1DQ6A 1HB3A 4FPLA 1RHI1 3SC7X 3K46A 3ORJA 3UL2A 5F9TA 3LA7A 1XYPA 1MQTA 4PHZA 1HB1A 1X82A 3ZIWA 2J1TA 1NCQA 5KXBA 1WMEA 4ZZ5A 3RWKX 1F8VA 1EV13 4R9AA 4UW4A 1AR92 4QQOA 2ARAA 3MV11 3MUY1 4FO9A 3PHMA 3WF0A 1OSGA 4JX0A 4XBLA 4JDNA 3L2HA 3ZFFC 2F17A 3MW2A 4TLFA 1BVP1 3H3ZA 4AVAA 4ES9A 1GP5A 2PHUA 4AOCA 2SLIA 4IE4A 2X5IB 4DB5A 5FZEA 4D7YA 1VAMA 1PO22 2YC0A 5FWEA 4RFRB 4HN1A 1K5MA 1QJZA 5FP8A 4M3CF 3IMNA 5FPBA 1RUH3 4I30A 3VZLA 4IQPA 4ASMB 3MF9A 3O7OA 1W8UA 4IV3A 3AVRA 2AYHA 2CDPA 3PUIA 3SKVA 1RUI2 1W2OA 3POSA 5F5QA 3JBG3 3U4XA 5I0DA 3G7DA 2ZACA 4NUBA 1BZWA 2WR9A 4AI2A 4E9KA 1OBNA 3AZVA 1G9BA 1IHMA 3ABZA 3ZPOA 2WNVA 3CEWA 4KL1A 2VMHA 5I0RA 2D98A 3WNOA 3RJRA 1ULDA 2QNKA 3U14A 5DABA 3WDXA 2VZ1A 1TME1 4LR4A 1LCLA 1HW5A 4FFHA 2GH8A 4EN6B 4GWJA 4PLMA 2G9GA 3KS7A 4YW1A 3ZDSA 1MPXA 3NNGA 3CKHA 4NAMA 3RI9A 2HWE3 3I49A 2GC1A 1N1TA 5F3IA 1ZBE1 5T54A 1HRV1 3CJIA 1N3OA 3ZFGB 3T3YA 4PF5A 3I59A 1UMZA 4OZOA 3WV6A 2R071 3N9QA 2Z42A 4QWNA 4GH4A 2VZPA 4CEWB 2OUHA 1ND2B 2XVGA 1W6NB 5FUNA 4HK9A 2ZGQA 3VDAA 2W9XA 2R7EB 1W0NA 1XNTA 1RUF2 1AYM2 3BTYA 3VBOC 2ARCA 4B7EA 2EIDA 3JQWA 1R093 2VO5A 1BBT3 3RYRA 1YNAA 4JV4A 4BLJA 1Z7S2 2PLV3 1FNZA 4HONA 1AL0G 2ZHMA 1O4TA 3T09A 1ND3B 1MEC1 4XHBA 3USUB 3ZFEB 3C7HA 2XKPA 3WHTA 4UYBA 3OBAA 1WKYA 1CR7A 1VRBA 4XUTA 3U75A 4L9BA 5J36A 1OXCA 3ZSKA 5EJZB 3C7GA 2WS93 3M3EA 3JD72 1WMDA 2YHJA 4I09A 4A7YA 1RUE2 3HN1A 4AGGA 3KHCA 3WD5A 2GMPA 4XHXA 1QJU2 1QQP1 5C8WA 3PDQA 2EALA 5JZGC 3VBHB 1YUDA 2CY6A 3OY8A 2EIBA 2Q1ZB 2XJRA 1A8MA 1SBFA 1VBD3 2OS2A 1PO21 1Q5OA 4CP1A 5M0TA 4A6OA 1JXNA 4NPMA 4R52A 4R9BA 5JOWA 1HJGA 2KXLA 3V0BA 3MPPG 4HKLA 4UF0B 1RUI1 4A41A 2E33A 5L19A 4ZU5A 5KC5A 4LKFA 2P3IA 4V2WA 2VOXA 3GZTB 1JMUB 4P9GA 1UO9A 4BISA 4F7ZA 2GMEA 2B9UA 2VECA 3GYDA 1AXYA 2RDSA 5FCCA 1XC6A 1C28A 4Q4V2 2VNVA 3WR0A 1NE4A 3LEMA 3I2KA 3VKNA 1UX7A 5CZKA 2OKXA 3T08A 2XQRA 5GLWA 3ZYGA 4CSWA 2VCMA 1DFQA 4QM9A 4BE3A 1O8SA 2XOMA 4C90A 4AQ2A 5A3PA 4COWA 4MGIE 2A6ZA 1J3RA 5JI9A 4AEDB 3MLJA 3N36A 3VHOA 1RHI3 1UY0A 1L7QA 2B45X 1OVPA 4QD2A 4AI9A 1PZ9A 3AX4A 1QOTA 1W06A 2I74A 2LROA 1SMVA 3KD4A 4C8DA 1V9U2 3AYCA 5FY8A 1LULA 3SMHA 1YFUA 1GNYA 5IFTA 1EPWA 1TMF2 3LFMA 4LTAA 4Q0VA 3PUQA 3T1MA 1J3PA 3UETA 1I1EA 1RUF1 1AYM1 1DQ4A 2NPIA 4CDXC 4XEZA 5C4WA 1QF3A 3M3QA 5E8AA 1DF0A 5G05L 1WMFA 2VCAA 1K42A 1Z7S1 3GZUC 5DG1A 1C1FA 1LENA 4Y20B 4NHLA 5L73A 2R0FA 3NV1A 5ABJB 1V6MA 5EHDA 1U5ZA 4JDOA 4UWDA 3VBFC 3EMRA 4IGOA 1HX6A 1LOFA 2WNUB 4RR3C 4RGAA 3KF3A 5FBZA 5GLZA 5BNNA 3OUIA 3AMHA 1CVNA 3JCIA 2QQWA 1C8M3 5CFDB 3CBNA 3LEGA 2XWJB 2W39A 3JD71 3IPVA 4I0WB 1LRHA 1QJU1 5C3QA 1HIXA 3UV9A 4FFFA 4HVOA 3TBDA 3DKWA 3NV2A 2QCSB 4PIXA 2V5YA 3T2TA 1SLLA 3FWEA 3LA2A 4LE4A 4YW5A 5DMYA 4B4RA 1PX3A 1EAH3 3QBQA 1NY72 2O8QA 4WM8C 3WT3A 2J1RA 3ZXEA 3O1SA 1W9WA 4Y5Z0 3TEWA 5FZHA 4E4SA 1BCXA 4XAEA 2F4PA 3AK0A 4P02B 4M0HA 3VDDC 1HRV3 4G9SB 4D7SA 3MV01 4B7KA 5BNPC 5JSOA 2P34A 5FYUA 3NL1A 3VBRB 4BA6A 4YZ3A 3H50A 2R073 4YSFA 4A44A 2DTWA 3NJVA 2P4EA 2BU9A 3WP5A 2DV9A 4RS5B 4RSUA 4AHZA 4Q4V1 3ZYPA 1JZ2A 1WW4A 1ULPA 3W20A 1BKZA 1RYYA 3V0AB 1A3KA 4AFMA 3C7OA 1CONA 1S0GA 1NLQA 4IV1C 1VALA 2KA3A 2HWF2 4LKSA 1AR72 2KD7A 1MEC3 4E4HA 3HAGA 2ZGMA 2VL4A 4L11A 4GMP1 4P5HA 4AHWA 4ATFA 3N9LA 4PDWB 2VTXJ 4PBOA 5IK7A 5FMOS 5GZEA 2WN3A 4B4PA 5FPUA 5JWPA 5LRSA 2YU1A 1DYOA 5F5IA 2VU9A 3ILRA 4FPFA 2WZEA 5LATA 4DEQA 4JGZA 4CUGA 4ZHNA 1IGOA 1AR93 1MZEA 2P6HA 2XB6C 4JHTA 1AVBA 4XFBA 4NIIA 3LCPA 3ZMOA 2WWJA 5FZ1A 2Y6LA 3LFIA 3ILNA 3LWCA 4NVPA 4W8JA 5A3MA 1TMF1 1DG6A 1FYUA 1KQRA 1RB8G 5FXWA 4PLOA 5HCFA 2ZGSA 2W95A 3A0NA 3ZO0B 2YMZA 1CPMA 3J26N 3ME2A 1UIKA 3NMBA 2UYAA 3MUZ1 3O14A 1Y43B 3IZOA 4NRQA 1QDCA 3AMPA 3AYDA 1PM7A 1RXGA 1SDDB 4BQWA 2A5ZA 4K9SA 1F31A 3PL0A 3VKOA 5JXIA 3E5QA 2BNNA 4IEVA 4XPVA 4CU6A 3FLPA 1G9AA 2HH9A 1CAUB 1EYBA 5C3SA 4LNVA 2A3YA 1X7NA 1COV2 1RUI3 1W8WA 1TE1B 4ORFA 4YZ1A 5L9BA 5F5CA 3OGRA 3DXUA 4NJ4A 4KG0A 1N1YA 4QHBA 3Q8CA 4YM2A 2CL2A 5BUVA 2XL9A 2PTMA 3MBWA 3E6DA 4NHXA 2EICA 4EN8B 1C1LA 3H8XA 3T0BA 4FOQA 1FT9A 1RUG2 2R49A 2ERFA 2OX0A 3D5OA 2RS12 4ZZ8A 4XJWA 4MO3M 1NY71 1CAWA 5A6QA 3BUCA 1DZTA 4C1WA 2JDNA 4Q4W2 4DRVA 4MG2A 3KT7A 1JHJA 5A3TA 3PU8A 4N53C 3EBRA 3SCGA 4MGYE 5C5UA 4FXGB 1J1TA 5C5TA 2VMEA 1CAXB 3AP6A 4XF1A 5H9SA 3UESA 2QQLA 1NA1C 3J7MA 4FPOB 2B4KA 3DPRC 3GXUA 3KT1A 3NSTA 4H3WA 4IESA 5K4LA 3NVCA 5LBEA 3MF6A 1MS5A 4FI9A 4ZS3A 2WWSA 5A3UA 1S0CA 2VZQA 3CIHA 1NCRC 4KQ7A 1RUF3 1AYM3 2W3JA 4LBKA 4NO4A 4BXSV 1UZYA 1VB2A 1UW8A 2DBNA 1WCSA 1NQJA 3ACGA 1KRIA 4QB2A 3IMMA 4XURA 3ZVXA 5HI0A 4XTMA 3WX5A 2HWF1 2EIEA 1AR71 4MX3A 5F7UA 3MEPA 4BQ5A 2Z69A 4RQPC 1SFYA 4PLNA 4DUXA 3RZGA 2Y6GA 5FFOC 5DPNA 4MVTA 4ZY9A 3THDA 1OT5A 3JXSA 3WZ1A 2W0XA 4QPGB 3FN9A 1RUNA 2I45A 4MADA 1B35C 3LA3A 2X05A 5BNOB 5K0UB 1NX9A 1OHFA 1RUE3 1H8TC 2P37A 2VMFA 3GHNA 3PUHA 1QJU3 2QTWB 4IE0A 1DQ0A 2ZA9A 5EP9A 3B9CA 2WQZC 2H0VA 2AR6A 2XJUA 1QY4A 2D6LX 2E9QA 1Q3EA 2EIGA 3RQ0A 1UOGA 2D3RA 4HLTA 3VD3A 5L7OC 2ZGRA 4HMZA 2OW4A 5FZ7A 4J1XA 1OQ1A 1H30A 1SLAA 1W8OA 4BOWA 4B29A 4EWAA 4EWEA 5J37A 2PQSA 2ZTNA 3A23A 5JSPA 1PVC2 1FMD3 1X9TA 2V4AA 1COV1 1HXS2 1LOEA 1ND2A 2LUWA 3ON7A 5B4NA 1W6NA 1GQGA 3S5QA 3SKJE 5HBAA 3O1TA 3KMHA 1GFF2 3WP3A 2WSVA 3J4UH 3BTZA 1CAVA 3MLLA 3WP6A 4CPBD 5C9AC 4GB31 1UPIA 4IEOA 4COYA 2E26A 4FVVA 4D3WA 1RUG1 2Y60A 2RS11 4TXWA 3ZFEA 1F35A 2FMDA 2HKXA 2WO3A 4J25A 1KJRA 4K8FA 4LO5B 1VRH3 4AEKA 1NZCA 4YZ5A 2JDAA 4LKEA 4WZCA 1UZ0A 1AR82 2CTVA 2XJVA 2GALA 4A2UA 1JYIA 1GANA 4OHYA 5LASA 1X36A 1U5IA 1LAJA 3Q8EA 1PMJX 4UI9L 5FP3A 4CCJA 4XJAA 4N7IA 2PAEA 2R1DA 1QXJA 3BB6A 4JGYA 1B09A 3BIEA 5SV5A 1DZRA 4XUQA 2DCZA 2OQ7A 2OPKA 4CDUC 1GZ9A 1OD5A 2V73A 5FZDA 1UY4A 1OQEA 1V9U3 2YPDA 4QT6A 2IWGB 2VUAA 1TMF3 4CDQC 3CNAA 3AFKA 1DZQA 4FP2A 1LHNA 2YYOA 5I8TA 4CEYA 4AWDA 1D0GA 2ET1A 2JG8A 4IE7A 4WM7C 4NR1A 3M2MA 2VVDA 3JU9A 3RS6A 1VPHA 2QQNA 4UF0A 1JYWA 2PHLA 5DAXA 2A73B 1Z0HA 1OOPC 1C8NA 1JYXA 3J9SA 2D7FA 3OCPA 1CZVA 5FP7A 4QX8A 3U1XA 1U5YA 2VUCA 2OZJA 3S7IA 2Q0AA 1W6MA 4H14A 5IHRA 5JIAA 1G8WA 1O5LA 4IEQA 3ES1A 5IJRA 5A6XA 4JQRA 1MQTC 4QQLA 1YJLA 1W9TA 2Z5WA 4UBHA 5FMOL 5JXJA 1GWKA 4M3CB 1E5IA 4P14A 5D2AA 4Q0PA 2W94A 3NQHA 4BQ3A 5T5PA 3RVHA 4C91A 4HXCA 1I6XA 1Q8PA 1S2BA 3OD4A 3WQ7A 4R4XA 2CV6A 1ZREA 2PELA 3ZXKA 1D0HA 2BGCA 3F2ZA 1OQDA 2WFF2 2IXCA 2VW1A 2CYFA 4UFLA 5KHIA 4H7LA 3RZKA 1PVC1 4A7KA 4QDRA 1KFXL 2A3XA 1HXS1 4EQVA 4KWJA 3ROUA 4LIUA 5J98B 3HD8B 5H9PA 3AMMA 5FDBA 2HEYF 4LLOA 1O4ZA 4N90A 2QQKA 1BVVA 4QXCA 2JG9C 4HKWA 3OEBA 5I8SA 5HXMA 1W3XA 4E2QA 1ODNA 3H8OA 2VVFA 2DUOA 4Y20A 1RINA 2IFRA 2Q1FA 5K8SA 5ABJA 1DHKB 2WNVC 1NZIA 1V6NA 4QX2A 2OXBA 4CP9B 4WVVA 5K9YA 4Z2WA 1AR81 2HWF3 2BW8A 4XUNA 4FTEA 1GUIA 1AR73 4BMBA 2D6KA 2A6YA 2AZ5A 1LHVA 2DYCA 3TEZA 1GR3A 3K51A 4HFSA 3BODA 3N7MA 4DPNA 4KWKA 1OKOA 1VMFA 5ISLA 1QJFA 1POV1 2C4XA 1SZBA 2YPJA 3ITQA 3LZZA 4HVQA 3KCYA 1W9YA 5FZCA 1ZZ8A 3OD0A 4XJZA 5HCBA 3WINE 4M00A 4TZDA 3D8CA 5A7QA 3ALQA 5J09A 4MOAA 3CJIC 4LLFA 3W21A 4NHMA 3QLQA 2G19A 1W6QB 1Q43A 3NV3A 3BCWA 3OGSA 3VHRA 2VXRA 1PGW2 4Y3OA 2DUPA 3M4FA 5C8CC 4GH4C 3NAPA 1REEA 2WWUA 5C7GA 2PN5A 1W05A 2ZMLA 4NHYA 1ZRIA 3WCSA 4HG6B 3S5AA 2E7TA 3POJA 5AVPA 4AL9A 3OPZA 4BQYA 1VBB2 3QCWA 3RYKA 1LTEA 5DUWA 3G6JB 1JH5A 3ELNA 5A7WA 3ZSMA 4K1YA 3HJRA 2XJPA 5GKAC 3RZLA 1COV3 2RJKA 4YPJA 4K21A 4RS5A 4IEPA 5LA9A 2PHDA 5CG8A 2A6WA 2VGDA 4QGMA 4XC9A 5HPOA 4TYSA 1YI9A 2JKBA 4NPLA 3LOBA 1HB2A 1ZM1A 2IZWA 3AYEA 1EP0A 1M4WA 2YV8A 3ZFFB 3WP4A 4CU7A 1RUG3 3AZWA 1DQ5A 5HXVA 3WNXA 2E6VA 2YDEA 5A3NA 2K2SA 2PXJA 2PAKA 2RS13 2ES3A 3NNLA 1O8PA 2DVFA 5G04L 3LB9A 4DNYA 3BU0A 4PT6A 4Q4W3 1AX1A 1LKNA 2WFF1 4C0BA 5CU1A 2BFUL 3ETPA 4IGQA 4LUKA 2C26A 3ZXAC 3N9MA 4XJ8A 1SPPB 1SLIA 4BK5A 1GOGA 2JENA 1A6CA 3N7JA 1FI2A 2ET7A 2O14A 1GSLA 4UW3A 3BVCA 1XNCA 2CU5A 4FOYA 1IS4A 4MGKE 4D6RA 4GJYA 4XFCA 3DL3A 1XNAA 5FMDA 4JRLA 2WAAA 1YFYA 3KF5A 3ACHA 4H2AA 4XAAA 4BQ1A 5FAXA 2E31A 1ZA4A 3O0XA 5FZFA 4FSJA 3J7LA 3I3EA 4UFJA 4URAA 2NZ9A 4NIAA 1VP6A 2DU1A 3RMYA 5GZGA 1OUSA 4QAWA 2W47A 5A3LA 1UNBA 1CJPA 2GU9A 3EYPA 2A1XA 2HBTA 2VMGA 1KJLA 5ACA2 2WL1A 3E6CC 3ZM8A 1YC61 2GZWA 1DYKA 5JOYA 4BQ2A 1ZRRA 2I07B 1VR3A 4QHOA 3VBSB 1ZX5A 5A7PA 5HV0A 2FDHA 3WG2A 4BWOA 1MZ5A 4S2HA 2FDGA 4Z82A 3VBOB 1PGSA 1PGW1 4CDWA 5CEHA 3K3OA 3UNPA 2ARXA 3FHAA 1J1LA 3I4IA 2IXKA 1PGL1 1CD3G 2VTXA 3J7HA 5A33A 3OUJA 3OJBA 1S0JA 4GXLA 4B4QA 1CAXA 3DUIA 2R16A 1YWKA 5C4WC 1VBB1 5JR2A 3PIGA 4YW6A 2RMU2 1UQXA 2PHWA 4IGPA 2W68A 1PVC3 1K12A 4LHSA 4LULA 4AFBA 1PK6B 4MYEA 4NIDA 4QPYA 4E2SA 2ZGOA 2ZBJA 1HXS3 1WW7A 4N7UA 2VM9A 1DDLA 5FZ3A 2JKXA 4CCMA 4OQ8A 5BPXA 3B93A 2R30A 4P08A 2XLGA 3MFCA 4GIQA 3U07A 2P3JA 1F5JA 2BRTA 1LOFC 2MEV2 3PJQA 1XXNA 4GALA 1LOBA 1WCDJ 4BU2A 3PUAA 3RMXA 2LALA 5LZ6A 1FPN3 3TB0A 4OMDA 5IK4A 2CGNA 1QQP2 3JZVA 4RN5A 3DCQA 5IVYA 3HQRA 1CN1A 4O7XA 5H9RA 5GALA 3P5BA 2F6BA 2HEWF 3OGVA 1T6BX 1SLCA 4GWMA 4IW3A 4UBGA 5FTTC 5FZOB 1LNSA 4Y26A 5CIRA 4QPGA 3OF1A 5BNOA 1AR62 1R1A2 2VZ3A 4AQSA 1POV3 3SITA 2B9VA 1IZ3A 4GZ9A 2ZX4A 2QQIA 3LEKA 4QDQA 4XABA 2WDBA 5A7OA 2QJVA 1N1SA 1UOFA 4AXOA 4DXZA 5FZMA 3LPGA 4OYUA 4KH9A 2VUJA 2QDNA 4QPIA 5C6CA 5K7PA 4D8MA 1HN0A 2HWB2 1HRI2 1QJX2 1V0AA 5F2SA 1UYZA 1D2QA 3KV4A 2WZR2 1LEMA 4E2GA 5GZDA 4OI0A 4ARXA 3ZX7A 3AKQA 1OLMA 1ULCA 4D6SA 1F9KA 4U36A 1LJ7A 3NWKA 5IATA 2K0GA 4OMCA 2X10A 3R4SA 3WVJA 4XQDA 4YVWA 1AF9A 4YG3A 1RUD2 3NJYA 3R05A 4L99A 4LK7A 4UW5A 1YIPA 5FLJA 3CL1A 5ACA1 4LO6B 5A3OA 2F4LA 4JZRA 3AP9A 4PQQA 3NNJA 5DN2A 4KNCA 4D0QA 3GJBA 3KCCA 4A3ZA 4MSVA 4UFHA 3TNPB 3LEIA 3AMQA 4FP3A 3VBUB 5C70A 1LECA 4CDXB 4JGZC 1K45A 1W6OB 3M3CA 1JU4A 1C5IA 1ONAA 1BEV1 1E57A 1NE6A 3J7NA 4I0BA 2D3SA 2LTNA 2QZ3A 2UU8A 3PMEA 4JCKA 3T0AA 3WG1A 3WDVA 1VBC2 3FFZA 5AVAA 1GZWB 4W6WA 4CCNA 2W1UA 3AM2A 2YFUA 1C5HA 3U0ZA 2WFF3 4EZ4A 2RMU1 1GQHA 5FZLA 3VBFB 5FZ6A 5BNQA 1RUOA 1W99A 2JDZA 2R1BA 2PHFA 3FHQA 1RGSA 3MW4A 4RR3B 2FZ1A 2JDHA 3ES4A 4HPKB 3I2IA 5CNAA 2VVEA 4LITA 5IVVA 3SLIA 1W9SA 3KGLA 2JIJA 4BPZA 1LHUA 2MEV1 4MGZE 2EVXA
chains in the Genus database with same CATH topology
5EIYB 1DYOA 1JYNA 2WZEA 4OUEA 4DEQA 2BBAA 3A7QA 3WNKA 1UY2A 2QBXA 2Y6LA 3VD4A 4W8JA 3T2PA 2ID4A 2VZRA 3DYPA 2BGOA 2W95A 3MO4A 2YC2A 3MUZ1 2X09A 2J22A 3LQCA 3I2JA 5JMOA 1CZTA 2QQMA 1SDDB 5FUIA 4BJ0A 3SEPA 1JI6A 3I3BA 4CU6A 5JXIA 4A45A 3WNPA 4GWIA 4UOJA 2WO2A 4ET7A 3OGRA 1GMMA 2W1SA 1UYXA 3LPFA 1H6YA 3MBWA 4JKLA 3IAPA 3CZJA 2EICA 1JZ5A 2WAOA 3T0BA 5CYYA 3WNMA 2W87A 4JHZA 4ZZ8A 2W46A 4MO3M 4KMQA 3IAQA 2Y6KA 4CUAA 3WNNA 5IFPA 2VZSA 2V5DA 1JHJA 2VZUA 3IDAA 2VMEA 4BK4A 3VD7A 3U37A 3UESA 3VD9A 1HN1A 2QQLA 2VQTA 2B4KA 3FL7A 3GXUA 3EB7A 3HOBA 1OF4A 4FI9A 1L7RA 3P6BA 3I3DA 2VZQA 3CIHA 3E1F1 2W3JA 4BXSV 3OEAA 3ACGA 3P1IA 3HPNA 4QB2A 4XURA 1GU3A 1NUKA 3BN6A 2EIEA 5IYYA 4DXSA 5F7UA 1TVGA 1DP0A 2LW8A 2W91A 1F4AA 4DUXA 2Y6GA 5DPNA 4ZY9A 1JZ6A 1UY3A 4CUCA 3THDA 1OF3A 1OT5A 3JXSA 4MGSA 2J7MA 4DEVA 3FN9A 4P00B 4PF1A 3GDBA 1UYYA 4MADA 2X05A 3K75B 1NX9A 2VR4A 2VMFA 3PUHA 2YFZA 2J1EA 3HNYM 2RV9A 1J83A 2V72A 3W5NA 2ZEXA 1WCQA 1OH4A 3VD3A 3BGAA 3VDCA 1EUUA 1W8OA 1JYVA 1UWWA 3WSOA 2PQSA 3A23A 3I2GA 2Y64A 4QB6A 4QX0A 2QQJA 4CU9A 3CQOA 5B4NA 4LQRA 3SKJE 2V4VA 3VD5A 3CDZB 3I97A 3ACFA 1EUTA 2E26A 2ORZA 4Z2AA 2Z4FA 1JZ8A 2YB7A 4TXWA 2WO3A 2WZ8A 4QDSA 2WABA 3WF3A 2JDAA 2DCKA 3C7FA 1UZ0A 3HEIA 1GQPA 1PMJX 4UAPA 4UI9L 1OD3A 2WUHA 1BHGA 1NKGA 3C8XA 2DDUA 4XUQA 3SEEA 4JKMA 2XQXA 1UY4A 2W5FA 2VMDA 4DUVA 1KGYA 1UXZA 1JZ4A 2Y6JA 3D3AA 3T2QA 1P8JA 2HLEA 2QQNA 1JYWA 2ZEYA 2BERA 3WF2A 1US3A 1JYXA 2ZEWA 5JXGA 1CZVA 4W4ZA 5IHRA 2XONA 3I2HA 1US2A 5EJ1B 5IJRA 4DXTA 5JXJA 5B4XA 1W9TA 5C71A 2VCCA 3A22A 3IIIA 2W94A 3NQHA 3WF1A 2VC9A 2ZEZA 4XZUG 1O59A 4DUWA 2WQ8A 1UY1A 2JD9A 3F2ZA 4XUPA 3W5MA 3HN3A 4DXRA 4QDRA 5A1AA 4P5YA 2VZOA 3K46A 1CZSA 1DLCA 2VZTA 2J1VA 1JZ3A 2QQKA 2J1TA 2VQUA 4ZZ5A 2YG0A 2ZXQA 3OEBA 1I5PA 5HXMA 3WQBA 3MV11 3MUY1 4QX2A 3WF0A 3WNLA 4JX0A 4AG4A 4XUNA 1J84A 1GUIA 1JU3A 1H6XA 1KEXA 1W8NA 2C9KA 2VOTA 2C4XA 4CVUA 1F4HA 1ULOA 2RJ2A 4MOAA 2CDPA 3PUIA 3SKVA 3C7EA 5I0DA 3OG2A 3OGSA 4RYDA 3ABZA 2VJXA 3VDBA 5C7GA 3WNOA 1T2XA 4HG6B 4L0PA 3THCA 2VZ1A 3A21A 2J1UA 3CMGA 3HJRA 4GWJA 2W1QA 4YPJA 3ACIA 1MPXA 3NNGA 3CKHA 5HPOA 2LS6A 3K4AA 1K3IA 3WF4A 1YQ2A 2VTFA 4W50A 4OZOA 4CU7A 1GOHA 1CIYA 2Y8KA 2VZPA 4A42A 1O8PA 2WO1A 5G04L 2WYSA 3VDAA 4PT6A 2W9XA 2R7EB 1UMHA 1W0NA 1XNTA 2WN2A 3ETPA 1R64A 2EIDA 2C26A 3HNBM 4BK5A 2VO5A 1GOGA 3IB3A 2HYXA 4KWUA 3T09A 4A4AA 1NAEA 3C7HA 3OBAA 1IQDC 1WKYA 4XUTA 2E32A 1XNAA 4MGQA 5LA2A 2WAAA 3ACHA 5JUVA 2YC4A 5EJZB 2E31A 3GGLA 4LPLA 3C7GA 3I3EA 3DYMA 3CZUA 3LE0A 3K77A 4QAWA 3K4ZA 2W47A 2EIBA 5LA0A 2W92A 3EYPA 1UXXX 4A6OA 3ZM8A 2VZVA 4QX3A 4ARYA 4A41A 2E33A 2XHNA 3UNPA 3FHAA 2DCJA 4E8DA 3J7HA 4TTGA 4AAXA 1XC6A 3NJXA 2ORXA 5LA1A 3NRUA 2WBKA 4IUGA 3I2KA 1UX7A 5CZKA 2OKXA 3T08A 4CU8A 5JR2A 4LHSA 1K12A 1O8SA 2XOMA 4QPWA 3AC0A 2J1AA 2VM9A 3T0DA 2JKXA 1JZ7A 1XPWA 4P08A 1UY0A 2BGPA 1L7QA 2Y6HA 1SG3A 4OMDA 4M4RA 3K4DA 1UMIA 4RN5A 1GOFA 1GNYA 5IFTA 5JXHA 4JKKA 3OGVA 3UETA 1CX1A 3WEZA 1LNSA 5G05L 3I2FA 2VCAA 2J1SA 1K42A 3DECA 2VZ3A 2B9VA 4GZ9A 2QQIA 3HNMA 3ECQA 3LEKA 2WDBA 4KI5M 4QDQA 3LPGA 4OYUA 4D8MA 1UYZA 4M4PA 3LEGA 2L9LA 4XUOA 4ARXA 1SHWB 4QB1A 4OMCA 2W1WA 2X10A 4BDVB 4ZXEA 2CDOA 1PMHX 1TG7A 3T2OA 4CUBA 1PX4A 5DMYA 1PX3A 4E8CA 2J1RA 4XVHA 1W9WA 4PQQA 5DN2A 4D0QA 4A3ZA 4P02B 3GM8A 5LCWL 3LEIA 3MV01 2QQOA 5C70A 1K45A 1JU4A 4A44A 3NJVA 5DQ0A 3T0AA 2BZDA 2VMCA 1D7PM 2JE8A 1JZ2A 2W1UA 2YFUA 5J1XA 1ULPA 1RYYA 3DYOA 3C7OA 4QX1A 1W99A 3FHQA 4LKSA 2KD7A 3I2IA 2VCBA 2VL4A 2RVAA 3OB8A 1W9SA 2WN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIY B;  1DYO A;  1JYN A;  2WZE A;  4OUE A;  4DEQ A;  2BBA A;  3A7Q A;  3WNK A;  1UY2 A;  2QBX A;  2Y6L A;  3VD4 A;  4W8J A;  3T2P A;  2ID4 A;  2VZR A;  3DYP A;  2BGO A;  2W95 A;  3MO4 A;  2YC2 A;  3MUZ 1;  2X09 A;  2J22 A;  3LQC A;  3I2J A;  5JMO A;  1CZT A;  2QQM A;  1SDD B;  5FUI A;  4BJ0 A;  3SEP A;  1JI6 A;  3I3B A;  4CU6 A;  5JXI A;  4A45 A;  3WNP A;  4GWI A;  4UOJ A;  2WO2 A;  4ET7 A;  3OGR A;  1GMM A;  2W1S A;  1UYX A;  3LPF A;  1H6Y A;  3MBW A;  4JKL A;  3IAP A;  3CZJ A;  2EIC A;  1JZ5 A;  2WAO A;  3T0B A;  5CYY A;  3WNM A;  2W87 A;  4JHZ A;  4ZZ8 A;  2W46 A;  4MO3 M;  4KMQ A;  3IAQ A;  2Y6K A;  4CUA A;  3WNN A;  5IFP A;  2VZS A;  2V5D A;  1JHJ A;  2VZU A;  3IDA A;  2VME A;  4BK4 A;  3VD7 A;  3U37 A;  3UES A;  3VD9 A;  1HN1 A;  2QQL A;  2VQT A;  2B4K A;  3FL7 A;  3GXU A;  3EB7 A;  3HOB A;  1OF4 A;  4FI9 A;  1L7R A;  3P6B A;  3I3D A;  2VZQ A;  3CIH A;  3E1F 1;  2W3J A;  4BXS V;  3OEA A;  3ACG A;  3P1I A;  3HPN A;  4QB2 A;  4XUR A;  1GU3 A;  1NUK A;  3BN6 A;  2EIE A;  5IYY A;  4DXS A;  5F7U A;  1TVG A;  1DP0 A;  2LW8 A;  2W91 A;  1F4A A;  4DUX A;  2Y6G A;  5DPN A;  4ZY9 A;  1JZ6 A;  1UY3 A;  4CUC A;  3THD A;  1OF3 A;  1OT5 A;  3JXS A;  4MGS A;  2J7M A;  4DEV A;  3FN9 A;  4P00 B;  4PF1 A;  3GDB A;  1UYY A;  4MAD A;  2X05 A;  3K75 B;  1NX9 A;  2VR4 A;  2VMF A;  3PUH A;  2YFZ A;  2J1E A;  3HNY M;  2RV9 A;  1J83 A;  2V72 A;  3W5N A;  2ZEX A;  1WCQ A;  1OH4 A;  3VD3 A;  3BGA A;  3VDC A;  1EUU A;  1W8O A;  1JYV A;  1UWW A;  3WSO A;  2PQS A;  3A23 A;  3I2G A;  2Y64 A;  4QB6 A;  4QX0 A;  2QQJ A;  4CU9 A;  3CQO A;  5B4N A;  4LQR A;  3SKJ E;  2V4V A;  3VD5 A;  3CDZ B;  3I97 A;  3ACF A;  1EUT A;  2E26 A;  2ORZ A;  4Z2A A;  2Z4F A;  1JZ8 A;  2YB7 A;  4TXW A;  2WO3 A;  2WZ8 A;  4QDS A;  2WAB A;  3WF3 A;  2JDA A;  2DCK A;  3C7F A;  1UZ0 A;  3HEI A;  1GQP A;  1PMJ X;  4UAP A;  4UI9 L;  1OD3 A;  2WUH A;  1BHG A;  1NKG A;  3C8X A;  2DDU A;  4XUQ A;  3SEE A;  4JKM A;  2XQX A;  1UY4 A;  2W5F A;  2VMD A;  4DUV A;  1KGY A;  1UXZ A;  1JZ4 A;  2Y6J A;  3D3A A;  3T2Q A;  1P8J A;  2HLE A;  2QQN A;  1JYW A;  2ZEY A;  2BER A;  3WF2 A;  1US3 A;  1JYX A;  2ZEW A;  5JXG A;  1CZV A;  4W4Z A;  5IHR A;  2XON A;  3I2H A;  1US2 A;  5EJ1 B;  5IJR A;  4DXT A;  5JXJ A;  5B4X A;  1W9T A;  5C71 A;  2VCC A;  3A22 A;  3III A;  2W94 A;  3NQH A;  3WF1 A;  2VC9 A;  2ZEZ A;  4XZU G;  1O59 A;  4DUW A;  2WQ8 A;  1UY1 A;  2JD9 A;  3F2Z A;  4XUP A;  3W5M A;  3HN3 A;  4DXR A;  4QDR A;  5A1A A;  4P5Y A;  2VZO A;  3K46 A;  1CZS A;  1DLC A;  2VZT A;  2J1V A;  1JZ3 A;  2QQK A;  2J1T A;  2VQU A;  4ZZ5 A;  2YG0 A;  2ZXQ A;  3OEB A;  1I5P A;  5HXM A;  3WQB A;  3MV1 1;  3MUY 1;  4QX2 A;  3WF0 A;  3WNL A;  4JX0 A;  4AG4 A;  4XUN A;  1J84 A;  1GUI A;  1JU3 A;  1H6X A;  1KEX A;  1W8N A;  2C9K A;  2VOT A;  2C4X A;  4CVU A;  1F4H A;  1ULO A;  2RJ2 A;  4MOA A;  2CDP A;  3PUI A;  3SKV A;  3C7E A;  5I0D A;  3OG2 A;  3OGS A;  4RYD A;  3ABZ A;  2VJX A;  3VDB A;  5C7G A;  3WNO A;  1T2X A;  4HG6 B;  4L0P A;  3THC A;  2VZ1 A;  3A21 A;  2J1U A;  3CMG A;  3HJR A;  4GWJ A;  2W1Q A;  4YPJ A;  3ACI A;  1MPX A;  3NNG A;  3CKH A;  5HPO A;  2LS6 A;  3K4A A;  1K3I A;  3WF4 A;  1YQ2 A;  2VTF A;  4W50 A;  4OZO A;  4CU7 A;  1GOH A;  1CIY A;  2Y8K A;  2VZP A;  4A42 A;  1O8P A;  2WO1 A;  5G04 L;  2WYS A;  3VDA A;  4PT6 A;  2W9X A;  2R7E B;  1UMH A;  1W0N A;  1XNT A;  2WN2 A;  3ETP A;  1R64 A;  2EID A;  2C26 A;  3HNB M;  4BK5 A;  2VO5 A;  1GOG A;  3IB3 A;  2HYX A;  4KWU A;  3T09 A;  4A4A A;  1NAE A;  3C7H A;  3OBA A;  1IQD C;  1WKY A;  4XUT A;  2E32 A;  1XNA A;  4MGQ A;  5LA2 A;  2WAA A;  3ACH A;  5JUV A;  2YC4 A;  5EJZ B;  2E31 A;  3GGL A;  4LPL A;  3C7G A;  3I3E A;  3DYM A;  3CZU A;  3LE0 A;  3K77 A;  4QAW A;  3K4Z A;  2W47 A;  2EIB A;  5LA0 A;  2W92 A;  3EYP A;  1UXX X;  4A6O A;  3ZM8 A;  2VZV A;  4QX3 A;  4ARY A;  4A41 A;  2E33 A;  2XHN A;  3UNP A;  3FHA A;  2DCJ A;  4E8D A;  3J7H A;  4TTG A;  4AAX A;  1XC6 A;  3NJX A;  2ORX A;  5LA1 A;  3NRU A;  2WBK A;  4IUG A;  3I2K A;  1UX7 A;  5CZK A;  2OKX A;  3T08 A;  4CU8 A;  5JR2 A;  4LHS A;  1K12 A;  1O8S A;  2XOM A;  4QPW A;  3AC0 A;  2J1A A;  2VM9 A;  3T0D A;  2JKX A;  1JZ7 A;  1XPW A;  4P08 A;  1UY0 A;  2BGP A;  1L7Q A;  2Y6H A;  1SG3 A;  4OMD A;  4M4R A;  3K4D A;  1UMI A;  4RN5 A;  1GOF A;  1GNY A;  5IFT A;  5JXH A;  4JKK A;  3OGV A;  3UET A;  1CX1 A;  3WEZ A;  1LNS A;  5G05 L;  3I2F A;  2VCA A;  2J1S A;  1K42 A;  3DEC A;  2VZ3 A;  2B9V A;  4GZ9 A;  2QQI A;  3HNM A;  3ECQ A;  3LEK A;  2WDB A;  4KI5 M;  4QDQ A;  3LPG A;  4OYU A;  4D8M A;  1UYZ A;  4M4P A;  3LEG A;  2L9L A;  4XUO A;  4ARX A;  1SHW B;  4QB1 A;  4OMC A;  2W1W A;  2X10 A;  4BDV B;  4ZXE A;  2CDO A;  1PMH X;  1TG7 A;  3T2O A;  4CUB A;  1PX4 A;  5DMY A;  1PX3 A;  4E8C A;  2J1R A;  4XVH A;  1W9W A;  4PQQ A;  5DN2 A;  4D0Q A;  4A3Z A;  4P02 B;  3GM8 A;  5LCW L;  3LEI A;  3MV0 1;  2QQO A;  5C70 A;  1K45 A;  1JU4 A;  4A44 A;  3NJV A;  5DQ0 A;  3T0A A;  2BZD A;  2VMC A;  1D7P M;  2JE8 A;  1JZ2 A;  2W1U A;  2YFU A;  5J1X A;  1ULP A;  1RYY A;  3DYO A;  3C7O A;  4QX1 A;  1W99 A;  3FHQ A;  4LKS A;  2KD7 A;  3I2I A;  2VCB A;  2VL4 A;  2RVA A;  3OB8 A;  1W9S A;  2WN3 A; 
#chains in the Genus database with same CATH topology
 5EIY B;  3BPZ A;  1D4M 3;  3IBM A;  4OHX A;  2BBA A;  1JN2 P;  5IWF A;  3SH5 A;  5IVC A;  3A7Q A;  4FPY A;  1YCI A;  2GSY A;  1UY2 A;  2QBX A;  5JCT A;  3VD4 A;  2BOJ A;  4XF0 A;  3BOW A;  5FR3 A;  4N43 A;  4FTS A;  2IUW A;  4W6X A;  2ZS6 B;  2BNO A;  2XJS A;  4Q0U A;  1BXH A;  3R0R A;  4XF4 A;  4LBL A;  2XGX A;  4YFW A;  3LDK A;  2N7G A;  2NN8 A;  3MO4 A;  3VDD B;  2JDK A;  4Y22 A;  1AYN 3;  1AR6 1;  2X09 A;  1R1A 1;  2RM2 2;  3LQC A;  3I2J A;  3PVN A;  4LBJ A;  4Q5O A;  5BNP B;  3PMS A;  3KZ4 C;  5FYV A;  4BHP A;  2QQM A;  3RRD A;  5FUI A;  4MV2 A;  4QX7 A;  1S0D A;  3ZYB A;  4M3C A;  1JI6 A;  1E5R A;  1Y7B A;  3KQ4 B;  3WOG A;  1Z78 A;  4PI2 A;  1TZO A;  5I93 A;  3WNP A;  3ZLI A;  3S7E A;  4Z8B A;  2HWB 1;  1RIT A;  3MLK A;  4NE9 A;  1HRI 1;  3I2D A;  4XFI A;  1QJX 1;  5B2G B;  4ET7 A;  2WNE A;  5HCA A;  3WCR A;  2WZR 1;  4LOS A;  4D6Q A;  1H6Y A;  1BLZ A;  3IAP A;  4OI2 A;  2XUE A;  2OUJ A;  3CZJ A;  4IV1 B;  1JZ5 A;  1LB2 A;  1IPK A;  4LHK A;  1JUI A;  1AHS A;  1RUD 1;  1V70 A;  1W2T A;  3PNA A;  1IQA A;  4RGG A;  5T50 A;  4H55 A;  4AQ6 A;  5CYY A;  3T1L A;  3WNM A;  5KR7 A;  4JHZ A;  1TQ5 A;  1QJE A;  1W8H A;  3M7A A;  4EN9 B;  3IAQ A;  4OHW A;  4CUA A;  5FXX A;  2YBK A;  1E5S A;  4CCK A;  3SHR A;  5IFP A;  5KHJ A;  2V5D A;  5I8Y A;  1OA3 A;  2A75 A;  4MUV A;  4ONU A;  3K3N A;  4YNI A;  5GZF A;  1BK1 A;  2GN7 A;  2Y33 A;  4FQZ A;  3IDA A;  4BK4 A;  1S0B A;  4CPB A;  3U37 A;  1QU0 A;  2KM2 A;  4NAO A;  4YGE A;  3DV8 A;  4EWD A;  1KDK A;  5I0U A;  3OOX A;  3I7D A;  3PTR B;  3VLB B;  2ZHN A;  1VBC 1;  3HOB A;  2VNO A;  4V2V A;  1W39 A;  3I3D A;  4LHL A;  3E1F 1;  4ATE A;  1WWY A;  4G4F A;  1HLC A;  4HAN A;  1URX A;  2WII B;  5KBF A;  1RUC 1;  5F37 A;  3P1I A;  4XJ9 A;  3EQE A;  3IDC B;  3PUS A;  1GU3 A;  4IDZ A;  5F32 A;  4XTP A;  4MH0 E;  4WVW A;  1PO1 2;  2VE1 A;  4N9H A;  2HJI A;  4LKD A;  2ATF A;  1JBC A;  2W91 A;  3RPQ A;  3AZZ A;  5CFC A;  4RFT 0;  2NP0 A;  3HQU A;  1OF3 A;  1S0E A;  1YQC A;  4MGS A;  2J7M A;  5A70 A;  2BWA A;  1ND2 C;  3EO6 A;  1DGR N;  3NKT A;  1DIW A;  3VKM A;  2FDJ A;  4Q8L A;  3Q9O A;  2VAU A;  1Q8S A;  4KGQ A;  1S55 A;  1XB9 A;  2JWP A;  4TSV A;  1QIQ A;  1TME 3;  4XET A;  1OUR A;  2RV9 A;  4AHY A;  1SBD A;  1J83 A;  2V72 A;  4B3N A;  3W5N A;  2R0H A;  3WUC A;  5A7N A;  4Y4R A;  2RM2 1;  3VDC A;  2EAK A;  3WW1 A;  3I3Q A;  2BEO A;  4AQT A;  5FY7 A;  3IIA A;  4LMF A;  1X9P A;  5ACA 3;  1WBF A;  1JYV A;  1ZBE 3;  2ZGL A;  3SNM A;  4FT8 A;  1V6J A;  3U10 A;  2PFW A;  4EE2 A;  4Q1P A;  5FBJ A;  4JGY C;  2QQJ A;  5FZG A;  4CP0 A;  2JB8 A;  2YY1 A;  2JIG A;  4XJU A;  1RVF 2;  4Y1X A;  3I2O A;  2PHX A;  3I97 A;  3JQX A;  2DWR A;  1IG0 A;  5KXC A;  2RR1 2;  1EUT A;  2VPV A;  2YU2 A;  2FMY A;  4WVM B;  5A6Z A;  1ENQ A;  3UGF A;  2YB7 A;  3IM0 A;  1UZV A;  2VOW A;  4KU8 A;  1IKP A;  1YQ5 A;  2WZ8 A;  4CEY C;  5CIS A;  1MVE A;  2D6P A;  2JG8 C;  4XZP A;  2DCK A;  1WLW A;  3C7F A;  4YVS A;  3HEI A;  3GF6 A;  1LR5 A;  2DVA A;  1UU6 A;  3FLT A;  5A6Y A;  3TEX A;  1B35 B;  5FPZ A;  5FP4 A;  2WT1 A;  5LW9 A;  4YG0 A;  1QWR A;  1H8T B;  2MEV 3;  2Y0I A;  1OD3 A;  2G1M A;  3V64 A;  1V6K A;  3EXU A;  3QAC A;  1NYW A;  1PIV 1;  3MID A;  1S4C A;  3SEE A;  3TOJ A;  4JKM A;  3O12 A;  1VBA 2;  1QQP 3;  2XQX A;  5CBL A;  5FY0 A;  4BXF A;  2W5F A;  2D3P A;  4R9D A;  5L7O B;  2R6Q A;  4NRM A;  1WCU A;  1UXZ A;  1JZ4 A;  4GKX A;  1O6U A;  4Q26 A;  2A71 A;  3TAY A;  3B5L B;  5LY2 A;  4D69 A;  4RHV 2;  2WO7 A;  1FAY A;  1PO2 3;  2H6C A;  4Q4Y 2;  3BYW A;  2LM3 A;  2H0B A;  1RED A;  1CIW A;  1AR6 3;  2CNA A;  1R1A 3;  4PJY A;  3VBS A;  2HLE A;  1HQW A;  1PO1 1;  1D2S A;  2ZPX A;  2ZEY A;  1WUV A;  4IEX A;  5E6H A;  3LDR A;  3E97 A;  4CCC A;  2X29 A;  2YUE A;  4CCD A;  3S0M A;  5FRE A;  4GWN A;  1VIW B;  2HWB 3;  2ZEW A;  4Q0S A;  5JMC A;  1HRI 3;  2C1F A;  1W2U A;  2JD4 A;  1APN A;  2VG9 A;  4GB3 2;  3T4H B;  1IS3 A;  4K7J A;  3WLU A;  4L2N A;  1US2 A;  2ARE A;  2FHR A;  2DTY A;  1H2N A;  4M0N A;  4MHR A;  3RZM A;  5C71 A;  2YBP A;  1IPS A;  5KHH A;  1HQL A;  3WW4 A;  4AE2 A;  1PK6 A;  3A22 A;  2RDQ A;  3FHI B;  1QOO A;  4XW3 A;  1PZ7 A;  4HBN A;  5ABJ C;  4QQH A;  2NM1 A;  3LKJ A;  4I01 A;  2XUM A;  3BTX A;  3MW3 A;  1DGR A;  2IC1 A;  4QU2 A;  1W28 A;  1NOV A;  2WQ8 A;  5F3E A;  4Q4X 2;  3VGI A;  4K1Z A;  4MZU A;  3VZO A;  3HIF A;  2TUN A;  3B7M A;  3HN3 A;  2D93 A;  1QH6 A;  4OHZ A;  4B8E A;  3OBT A;  2B42 B;  4CDQ B;  3E6B A;  1UOB A;  1RVF 1;  2OPW A;  2OVU A;  4HN0 A;  5JPN B;  5FXV A;  2WJS A;  2X5I A;  2XPJ A;  5FZO A;  4QX5 A;  1CZS A;  2VZT A;  2J1V A;  3THP A;  4BZ4 A;  2RR1 1;  4PIY A;  2G9F A;  2OZ6 A;  2ZX2 A;  1VBC 3;  4WM7 B;  2VQU A;  3R4U A;  2YG0 A;  1DQ2 A;  4O9G A;  5BY5 A;  2FDK A;  2PYT A;  2OII A;  1Z7S 3;  3QH7 A;  4JAA A;  2QFE A;  3WNL A;  3NAP C;  1PMI A;  2BOI A;  3AL6 A;  1XE0 A;  3JB4 C;  1YIF A;  3ZXG A;  2B7Y A;  1FAT A;  2WKK A;  1JOB A;  4FPC A;  3U4S A;  1FOD 2;  2JXA A;  1IS6 A;  1O3Q A;  1RIR A;  3N9O A;  3FE5 A;  2VOT A;  1Y4W A;  2ENR A;  1YFX A;  3ZXL A;  1H8V A;  5TSW A;  3JD7 3;  4DIN B;  2XML A;  2ADE A;  4K40 A;  2LRP A;  2YXS A;  3M3O A;  3ZYR A;  3ZYH A;  1VBA 1;  1LOG A;  4XBN A;  4N9I A;  4AW7 A;  1KXG A;  2BFU S;  2RJ2 A;  4Q0Q A;  5D8A C;  5FPL A;  1WA4 A;  1ACC A;  3C7E A;  3H42 B;  3W59 A;  2IXI A;  3RNS A;  2BQP A;  4LBN A;  4Q1R A;  4RHV 1;  5IAV A;  5JOX A;  2PAM A;  2GC0 A;  1TNR A;  3H0O A;  4Q4Y 1;  5JOZ A;  3TN9 2;  2VJX A;  2QQV A;  1I9R A;  1N47 A;  4U2A A;  3ZFG A;  2RM2 3;  1ZZ6 A;  1J58 A;  1T2X A;  1REF A;  2EAA A;  5ANQ A;  4DRR A;  4YG6 A;  2O0O A;  4L0P A;  3RDI A;  3THC A;  5CAZ A;  1W8T A;  3A21 A;  3VBU A;  3UKN A;  4CEW A;  3LF7 A;  1WW5 A;  3CMG A;  1XOY A;  1AX0 A;  2FCT A;  2SBA A;  3H7Y A;  3MIB A;  3U78 A;  2JG9 B;  3CHX A;  3HWJ A;  3ACI A;  5FPA A;  3WXP A;  1GZW A;  1X8E A;  2CAV A;  1YRZ A;  4Q4V 3;  2PMW B;  4LOR A;  1UKR A;  1DCS A;  1XND A;  1R1Z A;  1K3I A;  2C0Z A;  4XF3 A;  4URT A;  3USU A;  1ND3 A;  1XQN A;  2VTF A;  4W50 A;  3BI3 A;  1GOH A;  2RS3 2;  3J8F 2;  4XDQ A;  5T5J A;  1AX2 A;  1FNY A;  4KGG A;  1CIY A;  4XE9 A;  3UJQ A;  1QOS A;  4A42 A;  3ZXJ A;  2BVV A;  5JAX A;  5DDJ 1;  4AVB A;  2WO1 A;  3O1M A;  3KV5 A;  1RJ8 A;  3OBR A;  4GMP 3;  4Q4X 1;  3SH4 A;  4AFC A;  1R64 A;  1XBF A;  4YYO A;  1WW6 A;  5L9R A;  3HNB M;  3KVB A;  3RG0 A;  4NN0 A;  3CJI B;  5E89 A;  1ZZ7 A;  5ERL A;  2D5H A;  2HYX A;  3HBK A;  3GBF A;  1NAE A;  4ISR A;  4KWU A;  3I59 B;  3VBH A;  2BTV C;  2IVJ A;  2ZGN A;  1IQD C;  2JB4 A;  3APB A;  1GWM A;  5FLH A;  1ZZC A;  4JRA A;  4GH4 B;  4OVE A;  5C8C B;  1V6O A;  4MGQ A;  5LA2 A;  2XH6 A;  3VHN A;  4DOU A;  2TBV A;  4KU7 A;  4TWT A;  4UFK A;  4XXA A;  5C3O A;  4COZ A;  5JUV A;  1QXR A;  2YC4 A;  4I02 A;  4O9E A;  4LPL A;  4F3J A;  3ATG A;  5FZ4 A;  5BNP A;  4BH9 A;  1JHN A;  4CDW C;  4X8N A;  1W04 A;  3DYM A;  4UW6 A;  4LOT A;  1MS3 A;  1L7L A;  3OPW A;  5FPV A;  2XLF A;  2VBB A;  3LE0 A;  3ZKU A;  3K77 A;  3WDW A;  1LHW A;  3K4Z A;  3O1R A;  1FOD 1;  3SCH A;  3UYJ A;  5FWJ A;  1SQ4 A;  3O5S A;  2WA3 A;  3JBG 2;  1I3H A;  1I5Z A;  1X33 A;  2W92 A;  2XJQ A;  5CB7 A;  5FZ0 A;  3RZZ A;  3ZSL A;  1UXX X;  3OTF A;  3USS A;  2YBS A;  5IUQ A;  4GKY A;  1MAC A;  2RE9 A;  3MGU A;  1LHO A;  2ZCW A;  1NCQ C;  1Q8V A;  4YGD A;  4JTO A;  4ITC A;  3B9I A;  1XE8 A;  5IW0 A;  3VHP A;  1HQN A;  5FK7 A;  1OA2 A;  2XHN A;  4AED A;  1JOJ A;  3POI A;  3ZPY A;  1UZZ A;  3OY8 B;  3TN9 1;  1YQ8 A;  4LBM A;  4E8D A;  2ZOE B;  1UU4 A;  1MS0 A;  1MR5 A;  4TTG A;  2R06 2;  4AAX A;  2FCV A;  2ORX A;  3NRU A;  4FPG A;  4NWV A;  1JYC A;  2WBK A;  4IUG A;  1CES A;  3PIJ A;  4CU8 A;  1SAC A;  3VL9 A;  2P6C A;  1K5M C;  2XG3 A;  1H2K A;  4QPW A;  5BNO C;  2MPF A;  2P3K A;  3WQ1 A;  4HSJ A;  2C24 A;  5FYZ A;  1G9D A;  1JZ7 A;  1PNG A;  1F15 A;  3MIG A;  4IV3 C;  5A1L A;  2QVS B;  5EYX A;  2EA7 A;  2HWD 2;  1GNZ A;  2RR1 3;  1ST8 A;  1X50 A;  2WQ4 A;  4LIV A;  2AEN A;  4QPI C;  2XDV A;  5LY1 A;  1WD4 A;  2DVD A;  4FXK B;  2RS3 1;  3J8F 1;  4AHX A;  2PLV 2;  3VKF C;  4M4R A;  3K4D A;  2ZGU A;  1GOF A;  2WNU A;  1PVX A;  3RGB A;  4AI0 A;  4AVT A;  4JKK A;  1O3T A;  4DZG A;  1F5F A;  2DF7 A;  1KFU L;  4GA9 A;  4W65 A;  4QXH A;  5CFD A;  2WFP A;  4YVW C;  3WEZ A;  3ZXF A;  5LEK A;  5F6K A;  1QEX A;  1CX1 A;  3I2F A;  3WUD A;  2J1S A;  1STM A;  4OCT A;  1QH7 A;  2VW0 A;  4BYY A;  5C33 A;  3N7K A;  3BKZ A;  1G86 A;  5FJK A;  2XLA A;  4ZKT B;  1MZ6 A;  5FZB A;  2XBO 2;  5SV8 A;  3POF A;  2BNM A;  3ECQ A;  3H1W A;  1VBA 3;  5L36 A;  5AFE A;  2JDU A;  4BQX A;  1ULG A;  3ZN4 A;  1UOJ A;  4Y1Y A;  1SDW A;  2B8M A;  1PGL 2;  4LHN A;  4EN0 A;  1VBD 2;  5C4W B;  2L9L A;  3ST7 A;  4RHV 3;  2GP5 A;  3LAG A;  3ZKY A;  3WG4 A;  4QB1 A;  1RTV A;  1YHF A;  2UYB A;  3KVA A;  2HBU A;  4C1X A;  1KS5 A;  1ZZ9 A;  2W1W A;  3VBR A;  4YM3 A;  5GLU A;  1QHD A;  2YGL A;  3JBG 1;  1IS5 A;  1XU2 A;  1PMH X;  1IKQ A;  3N3H A;  3PUR A;  5H9Q A;  2AH2 A;  3T2O A;  4CUB A;  3LIG A;  5FP9 A;  4MXW B;  4YW3 A;  3OGJ A;  3QD6 A;  1R08 2;  4IE5 A;  5JI7 A;  2VY0 A;  4AR2 A;  4E8C A;  4XAC A;  1T6G C;  3V0A A;  4WVM A;  1W8F A;  4GB3 3;  4L8Q A;  4CXW A;  2WZP P;  4JC1 A;  1LED A;  2OA2 A;  4DIQ A;  1UAI A;  4QQP A;  2QE3 A;  4LO7 A;  3KCX A;  5LCW L;  1AUY A;  5FK8 A;  5FOJ B;  4OFG A;  5JDB A;  2QQO A;  4NOT A;  4LBQ D;  3LD8 A;  5DZE A;  2HYK A;  4PDW A;  4WVZ A;  2BPA 2;  1W90 A;  1ODM A;  1B35 A;  2BZD A;  5EXO A;  1XSQ A;  2R06 1;  1J3Q A;  2VMC A;  4LUM A;  1D7P M;  4N43 C;  2JE8 A;  4Q4X 3;  1TNF A;  2GN3 A;  5FYH A;  2D6N A;  5J1X A;  3H9A A;  1ZRC A;  3DYO A;  3VV1 A;  4QX1 A;  3OSD A;  3SXW A;  1ALY A;  1O3R A;  2C6S A;  4KBB A;  4IET A;  2UY9 A;  2X8K A;  3ZN6 B;  2RVA A;  3AL5 A;  3WDU A;  2PQQ A;  5JIU A;  4NWW A;  5A80 A;  1QJY 2;  2HWD 1;  3D82 A;  1RC6 A;  1GWL A;  1YYN A;  4OUE A;  1G6N A;  2BP6 A;  2PLV 1;  4Y5T A;  1UIJ A;  5E16 A;  1Y3T A;  2CHH A;  2VMI A;  5GLT A;  4D94 A;  4MGT A;  4Y33 A;  2Z79 A;  1CAU A;  1SLT A;  2TNF A;  2G9Z A;  3T2P A;  1Y9G A;  4CTE A;  4BIF A;  1ZBA 2;  5DZF A;  2BGO A;  2OT7 A;  1W8Z A;  2XVK A;  1FOD 3;  2B46 X;  2EXK A;  3WDT A;  4FAH A;  2YC2 A;  3R6S A;  1H1I A;  1WMX A;  3PVB B;  2R04 2;  3N9P A;  1LES A;  1CZT A;  1H1M A;  2XBO 1;  5FMC A;  5GJ6 A;  4BJ0 A;  5BXX A;  2D44 A;  3I3B A;  4JTN A;  4OQ9 A;  1ENS A;  2DVG A;  2UY8 A;  2G4I A;  1O5U A;  4XF9 A;  4QXK A;  4ASL A;  2VQ0 A;  1XYO A;  4PBP A;  2WO2 A;  1UF2 C;  1W2A X;  3HQX A;  1BEV 2;  3NW4 A;  3RZJ A;  1GMM A;  3POG A;  3WW2 A;  1VBD 1;  1EAH 2;  2A70 A;  4IEY A;  4O61 A;  4ZXK A;  1UYX A;  3LPF A;  4QKB A;  1HB4 A;  4CZS A;  4JKL A;  1O7F A;  3TN9 3;  5EWS A;  1AZD A;  3MPB A;  2WAO A;  4R8H A;  1PHM A;  1EY2 A;  1BMV 2;  4S2G A;  4CDQ A;  3KV6 A;  1OPO A;  1NG0 A;  2JIC A;  3X29 B;  2O1Q A;  3Q8B A;  4K3U A;  4KMQ A;  1R08 1;  4WZF A;  2VUD A;  2E53 A;  3I3M A;  1VE0 A;  4Q2F A;  2PHR A;  3OYW B;  5BNN C;  2A3W A;  2UWB A;  4Y1U A;  3VUO A;  3M70 A;  3FFQ A;  5FIX A;  5CFC C;  5JZG B;  2EXJ A;  2ZGP A;  4Q27 A;  1Q8Q A;  2QQU A;  4E4D X;  2DVB A;  1HV1 A;  2O8O A;  2K9Z A;  4XXP A;  2RS3 3;  3VD9 A;  3MYX A;  3KQR A;  2GAU A;  3AP7 A;  1AR8 3;  3A0K A;  2EF6 A;  2P17 A;  1DBN A;  2BVB A;  4K8R B;  1CAW B;  1L7R A;  1AXZ A;  3Q8A A;  4LBQ B;  1OFN A;  1NT0 A;  4NRP A;  3OGG A;  4DS0 A;  3JUU A;  5K0U A;  5FV3 A;  2ILM A;  4LO8 A;  4PCR A;  2JDY A;  4YFZ A;  4KBZ A;  1NUK A;  5DUX A;  1UN1 A;  1VJ2 A;  5CVR A;  5IYY A;  4XMI A;  1OLM E;  1H4G A;  1WA6 X;  2K46 A;  2LW8 A;  4GUL A;  3RWN A;  3WW3 A;  3NJZ A;  1O3S A;  1F4A A;  1QJY 1;  3GCW A;  1JW6 A;  1ASJ 2;  1KIT A;  2E51 A;  3DN7 A;  4CUC A;  5FZK A;  1JZ6 A;  1POQ A;  2OQ6 A;  5APA A;  4ES8 A;  2BDR A;  2JEM A;  2CSG A;  3THT A;  2B5H A;  3LSD A;  2QUO A;  1VB4 A;  3UJO A;  3W9A A;  4AEJ A;  4C0H A;  1H2L A;  3KWV A;  2ZHL A;  4KWL A;  3VZN A;  3AP4 A;  4QXB A;  1ZBA 1;  5LWB A;  2J1E A;  4AEM A;  5IVF A;  1RMU 2;  3HNY M;  4IE6 A;  4QHZ A;  2P2K A;  2JG9 A;  5AC9 2;  5FYY A;  1ENX A;  4RL7 A;  4TN7 A;  2ZEX A;  1C8M 1;  4LJH A;  4S2F A;  2GH2 A;  3MI8 A;  2WT0 A;  2R04 1;  4YVS C;  4YAR A;  1UWW A;  4DMI A;  3I2G A;  3OUH A;  3RYP A;  1UCX A;  1QNW A;  2HWC 2;  4QB6 A;  3MDP A;  1W0O A;  2GC2 A;  4OLL A;  3FC0 A;  1DGW X;  4QX0 A;  1FV2 A;  4XIK A;  5FZ8 A;  3MIC A;  4A6S A;  2P3Y A;  3KB5 A;  3LIH A;  4CU9 A;  2JX9 A;  2Y0O A;  4LQR A;  3V65 A;  2V4V A;  5GLV A;  3UKV A;  1EAH 1;  3VD5 A;  3GAL A;  3SIS A;  2GC3 A;  3AXE A;  3CDZ B;  4CXY A;  2QDR A;  5A1F A;  3ACF A;  2VW2 A;  3O1O A;  3VB9 A;  2R06 3;  3P3P A;  1BMV 1;  4Z2A A;  2Z4F A;  1RUC 2;  5FMB A;  2CWM A;  4AI3 A;  3WDY A;  3M3I A;  5EFU A;  1YLL A;  3HVD A;  4QDS A;  4Q8K A;  1FXZ A;  1RUJ 2;  2AGS A;  1OH3 A;  2A6X A;  5FYS A;  4MET A;  5T5O A;  5C8C A;  3VBS C;  1H0B A;  5DZG A;  3BPS A;  3A4U A;  1DLL A;  1FX5 A;  2DFC A;  4YZ4 A;  2W08 A;  2DUQ A;  2ZAB A;  1S2E A;  4AI8 A;  3KLS A;  1CAV B;  2BUK A;  4YM1 A;  2HWD 3;  4XIO A;  1GP6 A;  3L9J T;  1BHG A;  2NLR A;  1Q56 A;  3B69 A;  2EXI A;  4IXL A;  3GBW A;  1OLR A;  4EN7 B;  3D0S A;  1CWP A;  4WM8 B;  5IK8 A;  4SLI A;  4M3C E;  3KM5 A;  2D40 A;  3IKW A;  1OFS A;  2ZHK A;  4HSL A;  3ENR A;  3BAL A;  2Y6J A;  3D3A A;  1PK6 C;  5F6L B;  3T2Q A;  4DY5 A;  1BYH A;  1P8J A;  4NIH A;  1AR9 1;  4JGY B;  3CO2 A;  4MLO A;  4V1P A;  2GNM A;  2XBO 3;  5F8P A;  2RS5 2;  1OKQ A;  2BER A;  2MHF A;  4AGV A;  3TNQ A;  2VBD A;  1ASJ 1;  3WF2 A;  2CGP A;  4P9J A;  2H6B A;  2ZMK A;  2DCT A;  1XYN A;  3MFA A;  2Q8C A;  3GHM A;  2CWS A;  3AYA A;  2WC2 A;  2X5I C;  4CEY B;  1G9F A;  3I2H A;  5C3P A;  5EJ1 B;  4PI0 A;  2GDF A;  1NXD 1;  1WLT A;  2JG8 B;  4YM0 A;  4AFA A;  3PVE A;  1VBB 3;  3FX3 A;  1RMU 1;  2D97 A;  1FMD 2;  1NLR A;  3FLR A;  2BYV E;  1O91 A;  1SCS A;  3III A;  4AAP A;  2VNG A;  5AC9 1;  5CA6 A;  5JVV A;  2VC9 A;  2C9A A;  1U5X A;  3AFG A;  3POE A;  2WSU A;  5CKM A;  2OYZ A;  5KXE A;  3ILF A;  4XFG A;  1O59 A;  4DUW A;  1R08 3;  2MNG A;  4OUL A;  2ZKN A;  1KDM A;  1UY1 A;  3KT4 A;  4LBO A;  4XUP A;  3TWI A;  2HWC 1;  1W6M B;  4CP2 A;  4CP9 A;  1PIV 2;  5FY9 A;  5FYT A;  5A1A A;  4BB3 A;  4XIL A;  3CF6 E;  5LEJ A;  1VRH 2;  2VZO A;  4XDO A;  4BME A;  3FZ3 A;  4UFM A;  1UU5 A;  5EZW A;  3BTA A;  1DLC A;  1VBE 2;  1V00 A;  3WY6 A;  4MXV A;  3ZN5 A;  5J3U A;  1JZ3 A;  3ZSE A;  4UFI A;  3ZIX A;  3N4M A;  1C4R A;  3B01 A;  2ZXQ A;  1I5P A;  5LK5 A;  1LGB A;  5T55 A;  1LGN A;  1ULF A;  1SCR A;  1W6P B;  3WQB A;  3O0V A;  2RHP A;  3BOP A;  4J1W A;  5FQ0 B;  5CKN A;  1RUJ 1;  1UZW A;  4P9Y A;  1N3P A;  3OBZ A;  3RFR A;  3ZFG C;  4AG4 A;  3RJ2 X;  3DEM A;  1NXM A;  1W6Q A;  5A3W A;  1J84 A;  1JU3 A;  5J7M A;  1H6X A;  2VNR A;  1KEX A;  3M8L A;  1W8N A;  4XOG A;  4CRQ A;  2C9K A;  3VBU C;  4CEW C;  3EHK A;  2Y34 A;  1QJY 3;  2A6V A;  3PTY A;  3GZE A;  2XXZ A;  4CVU A;  4E4Z A;  1D4V B;  3PU3 A;  1F4H A;  5JR7 B;  4YGB A;  1U0A A;  1ULO A;  5KHG A;  2FCU A;  3MHZ A;  5DUV A;  3NKG A;  5EQU A;  1SLB A;  4N53 B;  1ND3 C;  1ZBA 3;  3ZFE C;  3OG2 A;  3I54 A;  4MXW A;  1A78 A;  1WGP A;  2VQA A;  4NMI A;  4RYD A;  4AZZ A;  1LOC A;  3QOP A;  2VOK A;  2Q8D A;  1G9C A;  4EJR A;  3VDB A;  1VMH A;  3POY A;  1NA1 B;  2IVI B;  4IER A;  4QGN A;  3ZFF A;  1RUE 1;  3DPR B;  2R04 3;  3B3Q E;  3O0W A;  4HL0 A;  4K6B A;  1XU1 A;  3GNE A;  4Y4Y A;  5FZ9 A;  1S0I A;  2RS5 1;  1ULE A;  3KGZ A;  4Y1Z A;  2J1U A;  2WIN B;  4Y24 A;  5FZI A;  1NCR B;  3PJY A;  3KHB A;  4H7M A;  1ZRF A;  3VN4 A;  2VBP A;  1UKG A;  2W1Q A;  1XNB A;  4FOV A;  1BEV 3;  1JTZ X;  2GP3 A;  1UPS A;  1MZF A;  3DF0 A;  3VBH C;  3HR9 A;  4ISQ A;  4I3G A;  3E5X A;  1SPP A;  3I8T A;  4A7Z A;  2LS6 A;  3K4A A;  1GIC A;  1JUH A;  2ARB A;  3NAP B;  3R4D B;  2JEC A;  3T4V A;  3WF4 A;  2WLP A;  1YQ2 A;  2RMU 3;  5FUP A;  4RQP B;  2TEP A;  1FMD 1;  4AF9 A;  2IFW A;  4FTB A;  2Y8K A;  1VLN A;  1ZNP A;  3ZN6 A;  3C3V A;  3OPT A;  3POW A;  3M1H A;  2D6M A;  5A7W B;  2WYS A;  4DQA A;  5CAD A;  3NO8 A;  1H4H A;  1UMH A;  3ETQ A;  4LT5 A;  4AFD A;  2WN2 A;  3FBM A;  4GQ7 A;  4N8M A;  1ZVF A;  4QU1 A;  2ZJC A;  5DG2 A;  2X53 S;  4XBQ A;  3FMG A;  5D8A B;  4DFS A;  3IB3 A;  5FY5 A;  5JSR A;  3DGT A;  4HVR A;  4A4A A;  5F1R A;  4CA9 A;  1VRH 1;  2BV4 A;  1LOD A;  1VBE 1;  1FV3 A;  5A32 B;  2E32 A;  3SCF A;  2FDF A;  1Q8O A;  3NNM A;  4XDP A;  4ZU4 A;  1SFP A;  3ZMN A;  4ZS2 A;  3GGL A;  1RJ7 A;  5KHK A;  4XYX A;  4XQ4 A;  3AKR A;  3PLQ A;  4G3Y C;  4AED C;  4I0A A;  2WRA A;  1GNH A;  3FUQ A;  4FFI A;  1HJF A;  5FY1 A;  1AJO A;  4XFH A;  3S30 A;  1KD7 A;  5IVB A;  3CZU A;  4GMP 0;  1V9U 1;  3VBO A;  5FRA A;  2QKD A;  3INA A;  5C9A B;  3VZM A;  3LGR A;  3NV4 A;  1ZYB A;  1QJX 3;  5LA0 A;  1LGC A;  1ASJ 3;  3UGG A;  1A34 A;  1EPZ A;  1WLC A;  2ZZQ A;  2WZR 3;  5E1R A;  5E88 A;  1GBG A;  2DUR A;  2JE7 A;  2R32 A;  3AP5 A;  1LU2 A;  3JB8 A;  2VZV A;  4GJZ A;  4QX3 A;  1ZA7 A;  5L9V A;  5FOB B;  4ARY A;  5I91 A;  1RUD 3;  5LK7 B;  5JLV A;  4OUS A;  4FOW A;  1HKD A;  1RMU 3;  1VAK A;  1YO8 A;  5DDJ 2;  3UKT A;  1Y9M A;  4NRO A;  3ZYF A;  5AC9 3;  1YXW A;  2DCJ A;  5FO9 B;  2VOV A;  4HOO A;  1K5J A;  4JDM A;  4OUM A;  2WNU C;  3OYW A;  2JDP A;  3B02 A;  5AFB A;  3BIW E;  2WYF A;  2W2I A;  4FFG A;  4CDU B;  3NJX A;  5FXZ A;  3GJA A;  3ZR6 A;  5LA1 A;  1YEW A;  5JZG A;  5CFD C;  1UL9 A;  4TLG A;  1KS4 A;  2W52 A;  3LOI A;  2HWC 3;  1DGL A;  4OHV A;  1S1A A;  3POB A;  4IND A;  3O1P A;  2HEV F;  3N35 A;  4I2O A;  3AC0 A;  2J1A A;  3GBG A;  1S0F A;  3T0D A;  1AL2 2;  5FYI A;  5C3R A;  3D4K A;  2Q1M A;  1XPW A;  4CDW B;  2ZGK A;  4LBQ A;  2BGP A;  1W2N A;  4WBB A;  2GNT A;  3ZSJ A;  1UX6 A;  3D0J A;  5A33 B;  5FYM A;  2Q8O A;  3BU7 A;  2Y6H A;  4AGR A;  4AVV A;  1RUC 3;  2ZMN A;  5FY4 A;  3V56 A;  1OOP B;  1SG3 A;  1MS4 A;  3AZX A;  3K48 A;  2Q30 A;  4M01 A;  2ZZJ A;  5ANN A;  1UMI A;  4PIZ A;  5F5A A;  1RUJ 3;  5JXH A;  1VMJ A;  1OA4 A;  1WZX A;  2D5F A;  2RDN A;  2XL7 A;  3VBR C;  4O65 A;  4P9W A;  3GCX A;  1MQT B;  4YW7 A;  4FBF A;  3TRS B;  5IT6 A;  4BIO A;  4WV8 A;  3S6P A;  3O1V A;  1NCQ B;  4XFF A;  1PM4 A;  1UYP A;  1YI7 A;  3HT1 A;  3DEC A;  4RS5 C;  4CXX A;  3SQO A;  2XKO A;  3RI8 A;  4A3X A;  4JQT A;  4W6Y A;  4ZPI A;  3UT0 A;  3HNM A;  4KI5 M;  2VH9 A;  1H1A A;  4LA2 A;  3F95 A;  5FO7 B;  2KR2 A;  5HCH A;  1CGP A;  4M4P A;  4RA0 A;  4PDW C;  4YLZ A;  3VZJ A;  4XUO A;  2FZ2 A;  5DUU A;  2WNO A;  4QKN A;  1SBE A;  1SHW B;  1K5M B;  4JVA A;  2RG4 A;  4IEW A;  4X6R B;  2RJL A;  4CDX A;  1W6O A;  4BDV B;  4GD4 A;  5I0T A;  4ZXE A;  1V6I A;  1ZZB A;  2Q4S A;  2RS5 3;  3Q8F A;  4IV3 B;  3DKQ A;  2CDO A;  2ZX0 A;  1TG7 A;  2E63 A;  4OZX A;  1PX4 A;  3AKP A;  5LRR A;  2ADD A;  4QPI B;  1XNK A;  4XVH A;  3ZDV A;  2QQP A;  2WNV B;  1ZRD A;  3PVO A;  5BV6 A;  5F3G A;  1GKB A;  3VBF A;  5FKC A;  4BLI A;  2BJS A;  3TEY A;  4RR3 A;  3GM8 A;  1C3H A;  5GZC A;  4PQ9 A;  4ZON A;  2ZGT A;  4HPK A;  3NNF A;  2FDI A;  1NQD A;  3AJY A;  4CE8 A;  4YVW B;  3TYJ A;  1QKQ A;  5LB6 A;  3FJS A;  2D6O X;  5DQ0 A;  2CAU A;  2B39 A;  3IN9 A;  4COU A;  1BQP A;  4MHU A;  1XE7 A;  4IEZ A;  2ZX1 A;  4KG8 A;  4XFA A;  1EV1 2;  2WA4 A;  4X6Q B;  5FYC A;  3MZH A;  1H9W A;  5T5L A;  3UK9 A;  2PHT A;  1QMJ A;  4QKF A;  1PIV 3;  1V6L A;  2JJ6 A;  1FPN 2;  4OI4 A;  4Z92 B;  4AVS A;  4WM8 A;  3ZR5 A;  2FD8 A;  2XWB B;  4QKD A;  1AL2 1;  2VCB A;  2YZ4 A;  1GP4 A;  1GYK A;  3OB8 A;  3RSJ A;  4YW4 A;  1JOP A;  1MVQ A;  4Q4W 1;  1VBE 3;  3VDD A;  3ZYI B;  5F3C A;  5JPM B;  1JYN A;  4FPE A;  3LSE A;  1M06 G;  1JS9 A;  1RUH 2;  4YGC A;  3EJK A;  3AKS A;  3WNK A;  4EYU A;  5T52 A;  1PO1 3;  4YRD A;  5GM0 A;  4DO0 A;  3K2O A;  2FBE A;  2ID4 A;  2VZR A;  3DYP A;  1QXP A;  3QH6 A;  3H7J A;  5LBB A;  3HBZ A;  4RD7 A;  2Y26 A;  4OI1 A;  4COV A;  5LBF A;  5J96 B;  1MS1 A;  4YWA A;  3ZYJ B;  4IV1 A;  4ZU7 A;  1AXK A;  2DU0 A;  1DU3 D;  2J22 A;  3LDB A;  3H3L A;  5JMO A;  4L92 A;  1XRU A;  5BYN A;  2AAC A;  2XHK A;  4DY3 A;  3SEP A;  4AVC A;  2JE9 A;  2XJT A;  4A45 A;  2V09 A;  5FKB A;  4GWI A;  4N43 B;  3KSC A;  4XCB A;  4GAZ A;  4UOJ A;  4D7T A;  3SH3 A;  4YZ2 A;  2W1S A;  4B1L A;  2HWE 2;  5I0S A;  4F8A A;  2CGO A;  3WG3 A;  4CCL A;  2E7A A;  3MIH A;  4Y22 B;  2XVL A;  2EXH A;  4QPG C;  1OLQ A;  4IL7 A;  2D43 A;  1RL3 A;  3V0B B;  2Q8E A;  5HV4 A;  4XCA A;  4CCE A;  1H9P A;  5K0U C;  2W87 A;  4UT5 A;  2W46 A;  2ZKL A;  5FLI A;  1G7Y A;  1XSR A;  2Y6K A;  1RVF 3;  2J42 A;  3WNN A;  3MIF A;  2UUR A;  2AC1 A;  3B00 A;  5IAX A;  2VZS A;  4HT1 T;  4F83 A;  2VZU A;  2P1B A;  1R09 2;  1BBT 2;  1IPJ A;  2NMO A;  5DXD A;  1W6P A;  3MIE A;  5D21 A;  5T3N A;  5KC6 A;  2P5B A;  5FQ0 A;  3VD7 A;  5CKQ A;  3D6E A;  2I2S A;  2Y38 A;  1HN1 A;  5EJ3 A;  1WCK A;  4FCA A;  2VQT A;  3FL7 A;  2DCY A;  1IG3 A;  3EB7 A;  1OF4 A;  1RXF A;  1L3J A;  3P6B A;  2Y6F A;  4AYU A;  1EV1 1;  1MS9 A;  1OI6 A;  4R9C A;  2WS9 2;  1WD3 A;  4S2D A;  5IVJ A;  5KXD A;  3OEA A;  1D4M 2;  2WLQ A;  3FBY A;  1N3Q A;  4BM8 A;  4HET A;  3S57 A;  2GND A;  1QNY A;  3HPN A;  1CJD A;  1FPN 1;  3H8U A;  4LA3 A;  3H1Y A;  3BN6 A;  2AEY A;  3AJZ A;  3H3U A;  4AI1 A;  4CCO A;  2DFB A;  4P9X A;  2QZ2 A;  2IXH A;  4DXS A;  4ASK A;  1TVG A;  1DP0 A;  1YJK A;  3UGH A;  1CPN A;  2A7A A;  4N53 A;  5CG9 A;  2ZAA A;  3KV9 A;  1UY3 A;  4RGK A;  4HZF A;  1W0P A;  2NYY A;  1U12 A;  2ETE A;  4Q4Y 3;  4P00 B;  4DEV A;  1NA1 A;  4PF1 A;  1AYN 2;  1NLS A;  1RUH 1;  1UYY A;  3GDB A;  3DPR A;  2PA7 A;  3K75 B;  2VR4 A;  3WHU A;  3CLP A;  1UD1 A;  5D1I A;  4ERO A;  4Q29 A;  2DBI A;  2YFZ A;  1NCR A;  2Z2S B;  4FPK A;  2VD7 A;  4Z1V A;  1YFW A;  3AVS A;  4NIG A;  1YQ6 A;  5BNN B;  1AJK A;  1Y9Q A;  1POV 0;  1WCQ A;  5KWR A;  1OH4 A;  2FQP A;  5CFC B;  3BGA A;  1EUU A;  3IPV B;  4LE3 A;  3WSO A;  3CU7 A;  4CYD A;  1LU1 A;  2NMN A;  4RQP A;  2GMM A;  2Y64 A;  1WBL A;  3FUO A;  4Y5S A;  1W03 A;  3VZK A;  4E27 A;  4LK6 A;  1X8M A;  3CQO A;  4FPJ A;  3AKT A;  5DDJ 3;  2HWE 1;  4FPH A;  3URF A;  1PZ8 A;  1RHI 2;  3H1M A;  1H8T A;  1SFN A;  3HMY A;  1O4Y A;  4LXL A;  2ORZ A;  3VL8 A;  4NPR A;  5D8A A;  1JZ8 A;  3RZH A;  4X8P A;  4BQ4 A;  4EV0 A;  5DAQ A;  2WAB A;  3WF3 A;  3N9N A;  5L7O A;  2XR4 A;  1JOD A;  3IT8 A;  5A32 A;  3CJX A;  1OUX A;  2VUL A;  3C2U A;  4I3P A;  1H2M A;  1AL2 3;  1GZC A;  1SEF A;  1GQP A;  1IOA A;  2VXJ A;  4UAP A;  1R09 1;  5LBC A;  1BBT 1;  2WT2 A;  1S2K A;  3U11 A;  2WUH A;  5IK5 A;  3C8X A;  1GZT A;  1GLH A;  1NKG A;  2IXJ A;  2BWC A;  2DDU A;  4K20 A;  5DAV A;  1OMI A;  3E5U A;  4LO4 B;  2UWC A;  3DXT A;  4QMA A;  1CX4 A;  5C9A A;  1BK0 A;  4LEJ A;  2VMD A;  4DUV A;  1KGY A;  4YVS B;  3T30 A;  1ENR A;  1DYP A;  2WS9 1;  1C8M 2;  5J48 A;  1OPM A;  1BJQ A;  1D4M 1;  1MS8 A;  3B94 A;  2JDM A;  3ZOI A;  1PNF A;  4QQ2 A;  3AXD A;  4QM8 A;  1XJA A;  4JGZ B;  5FYB A;  2RDR A;  3VKL A;  3IWZ A;  2YGM A;  4XMA A;  5DAP A;  1TME 2;  4FAG A;  2BBV A;  1DGW A;  1US3 A;  1OVS A;  1JYT A;  5JXG A;  4P9L A;  5FJH A;  2AEZ A;  2GNB A;  2NQY A;  4YW2 A;  1AYN 1;  1QDO A;  5FO8 B;  4W4Z A;  4CDU A;  3GZA A;  3N7L A;  4HKO A;  1J59 A;  1GV9 A;  2XON A;  3AMN A;  1A8D A;  3W58 A;  1ZBE 2;  4P9I A;  1HRV 2;  4SBV A;  5EV7 A;  3WQ0 A;  4NHK A;  5B4X A;  2IXL A;  4B1M A;  4DXT A;  1VAV A;  4BCU A;  1N1V A;  3H8R A;  2E7Q A;  2VCC A;  1HDK A;  2YRO A;  4AK3 A;  2R07 2;  2ZAH A;  5DAW A;  5F2W A;  1CQ9 A;  1WLD A;  4L97 A;  3WF1 A;  4UXA A;  4IEU A;  3IDE A;  1OC1 A;  2AUY A;  4WM7 A;  2UWA A;  3L2Y A;  2ZEZ A;  4HK8 A;  3ZXD A;  3IDB B;  4XZU G;  3O1U A;  5F39 A;  4Y1V A;  2ZX3 A;  2JD9 A;  5FZA A;  3AB0 A;  3ACL A;  5EPA A;  1HV0 A;  4EZH A;  2C5D A;  3W5M A;  1C57 A;  5FPX A;  1OOP A;  1QGL A;  4XQW A;  4DXR A;  3J8F 3;  2Q5T A;  4FQ4 A;  1LOA A;  5EYY A;  3ASI A;  1DQ1 A;  3HT2 A;  4R4Z A;  3AZY A;  4J6G A;  1F2N A;  3P3N A;  1E5H A;  4P5Y A;  1MEC 2;  1TEI A;  4QGL A;  1W3V A;  5A7S A;  1W9F A;  4Z07 A;  5IVE A;  1DQ6 A;  1HB3 A;  4FPL A;  1RHI 1;  3SC7 X;  3K46 A;  3ORJ A;  3UL2 A;  5F9T A;  3LA7 A;  1XYP A;  1MQT A;  4PHZ A;  1HB1 A;  1X82 A;  3ZIW A;  2J1T A;  1NCQ A;  5KXB A;  1WME A;  4ZZ5 A;  3RWK X;  1F8V A;  1EV1 3;  4R9A A;  4UW4 A;  1AR9 2;  4QQO A;  2ARA A;  3MV1 1;  3MUY 1;  4FO9 A;  3PHM A;  3WF0 A;  1OSG A;  4JX0 A;  4XBL A;  4JDN A;  3L2H A;  3ZFF C;  2F17 A;  3MW2 A;  4TLF A;  1BVP 1;  3H3Z A;  4AVA A;  4ES9 A;  1GP5 A;  2PHU A;  4AOC A;  2SLI A;  4IE4 A;  2X5I B;  4DB5 A;  5FZE A;  4D7Y A;  1VAM A;  1PO2 2;  2YC0 A;  5FWE A;  4RFR B;  4HN1 A;  1K5M A;  1QJZ A;  5FP8 A;  4M3C F;  3IMN A;  5FPB A;  1RUH 3;  4I30 A;  3VZL A;  4IQP A;  4ASM B;  3MF9 A;  3O7O A;  1W8U A;  4IV3 A;  3AVR A;  2AYH A;  2CDP A;  3PUI A;  3SKV A;  1RUI 2;  1W2O A;  3POS A;  5F5Q A;  3JBG 3;  3U4X A;  5I0D A;  3G7D A;  2ZAC A;  4NUB A;  1BZW A;  2WR9 A;  4AI2 A;  4E9K A;  1OBN A;  3AZV A;  1G9B A;  1IHM A;  3ABZ A;  3ZPO A;  2WNV A;  3CEW A;  4KL1 A;  2VMH A;  5I0R A;  2D98 A;  3WNO A;  3RJR A;  1ULD A;  2QNK A;  3U14 A;  5DAB A;  3WDX A;  2VZ1 A;  1TME 1;  4LR4 A;  1LCL A;  1HW5 A;  4FFH A;  2GH8 A;  4EN6 B;  4GWJ A;  4PLM A;  2G9G A;  3KS7 A;  4YW1 A;  3ZDS A;  1MPX A;  3NNG A;  3CKH A;  4NAM A;  3RI9 A;  2HWE 3;  3I49 A;  2GC1 A;  1N1T A;  5F3I A;  1ZBE 1;  5T54 A;  1HRV 1;  3CJI A;  1N3O A;  3ZFG B;  3T3Y A;  4PF5 A;  3I59 A;  1UMZ A;  4OZO A;  3WV6 A;  2R07 1;  3N9Q A;  2Z42 A;  4QWN A;  4GH4 A;  2VZP A;  4CEW B;  2OUH A;  1ND2 B;  2XVG A;  1W6N B;  5FUN A;  4HK9 A;  2ZGQ A;  3VDA A;  2W9X A;  2R7E B;  1W0N A;  1XNT A;  1RUF 2;  1AYM 2;  3BTY A;  3VBO C;  2ARC A;  4B7E A;  2EID A;  3JQW A;  1R09 3;  2VO5 A;  1BBT 3;  3RYR A;  1YNA A;  4JV4 A;  4BLJ A;  1Z7S 2;  2PLV 3;  1FNZ A;  4HON A;  1AL0 G;  2ZHM A;  1O4T A;  3T09 A;  1ND3 B;  1MEC 1;  4XHB A;  3USU B;  3ZFE B;  3C7H A;  2XKP A;  3WHT A;  4UYB A;  3OBA A;  1WKY A;  1CR7 A;  1VRB A;  4XUT A;  3U75 A;  4L9B A;  5J36 A;  1OXC A;  3ZSK A;  5EJZ B;  3C7G A;  2WS9 3;  3M3E A;  3JD7 2;  1WMD A;  2YHJ A;  4I09 A;  4A7Y A;  1RUE 2;  3HN1 A;  4AGG A;  3KHC A;  3WD5 A;  2GMP A;  4XHX A;  1QJU 2;  1QQP 1;  5C8W A;  3PDQ A;  2EAL A;  5JZG C;  3VBH B;  1YUD A;  2CY6 A;  3OY8 A;  2EIB A;  2Q1Z B;  2XJR A;  1A8M A;  1SBF A;  1VBD 3;  2OS2 A;  1PO2 1;  1Q5O A;  4CP1 A;  5M0T A;  4A6O A;  1JXN A;  4NPM A;  4R52 A;  4R9B A;  5JOW A;  1HJG A;  2KXL A;  3V0B A;  3MPP G;  4HKL A;  4UF0 B;  1RUI 1;  4A41 A;  2E33 A;  5L19 A;  4ZU5 A;  5KC5 A;  4LKF A;  2P3I A;  4V2W A;  2VOX A;  3GZT B;  1JMU B;  4P9G A;  1UO9 A;  4BIS A;  4F7Z A;  2GME A;  2B9U A;  2VEC A;  3GYD A;  1AXY A;  2RDS A;  5FCC A;  1XC6 A;  1C28 A;  4Q4V 2;  2VNV A;  3WR0 A;  1NE4 A;  3LEM A;  3I2K A;  3VKN A;  1UX7 A;  5CZK A;  2OKX A;  3T08 A;  2XQR A;  5GLW A;  3ZYG A;  4CSW A;  2VCM A;  1DFQ A;  4QM9 A;  4BE3 A;  1O8S A;  2XOM A;  4C90 A;  4AQ2 A;  5A3P A;  4COW A;  4MGI E;  2A6Z A;  1J3R A;  5JI9 A;  4AED B;  3MLJ A;  3N36 A;  3VHO A;  1RHI 3;  1UY0 A;  1L7Q A;  2B45 X;  1OVP A;  4QD2 A;  4AI9 A;  1PZ9 A;  3AX4 A;  1QOT A;  1W06 A;  2I74 A;  2LRO A;  1SMV A;  3KD4 A;  4C8D A;  1V9U 2;  3AYC A;  5FY8 A;  1LUL A;  3SMH A;  1YFU A;  1GNY A;  5IFT A;  1EPW A;  1TMF 2;  3LFM A;  4LTA A;  4Q0V A;  3PUQ A;  3T1M A;  1J3P A;  3UET A;  1I1E A;  1RUF 1;  1AYM 1;  1DQ4 A;  2NPI A;  4CDX C;  4XEZ A;  5C4W A;  1QF3 A;  3M3Q A;  5E8A A;  1DF0 A;  5G05 L;  1WMF A;  2VCA A;  1K42 A;  1Z7S 1;  3GZU C;  5DG1 A;  1C1F A;  1LEN A;  4Y20 B;  4NHL A;  5L73 A;  2R0F A;  3NV1 A;  5ABJ B;  1V6M A;  5EHD A;  1U5Z A;  4JDO A;  4UWD A;  3VBF C;  3EMR A;  4IGO A;  1HX6 A;  1LOF A;  2WNU B;  4RR3 C;  4RGA A;  3KF3 A;  5FBZ A;  5GLZ A;  5BNN A;  3OUI A;  3AMH A;  1CVN A;  3JCI A;  2QQW A;  1C8M 3;  5CFD B;  3CBN A;  3LEG A;  2XWJ B;  2W39 A;  3JD7 1;  3IPV A;  4I0W B;  1LRH A;  1QJU 1;  5C3Q A;  1HIX A;  3UV9 A;  4FFF A;  4HVO A;  3TBD A;  3DKW A;  3NV2 A;  2QCS B;  4PIX A;  2V5Y A;  3T2T A;  1SLL A;  3FWE A;  3LA2 A;  4LE4 A;  4YW5 A;  5DMY A;  4B4R A;  1PX3 A;  1EAH 3;  3QBQ A;  1NY7 2;  2O8Q A;  4WM8 C;  3WT3 A;  2J1R A;  3ZXE A;  3O1S A;  1W9W A;  4Y5Z 0;  3TEW A;  5FZH A;  4E4S A;  1BCX A;  4XAE A;  2F4P A;  3AK0 A;  4P02 B;  4M0H A;  3VDD C;  1HRV 3;  4G9S B;  4D7S A;  3MV0 1;  4B7K A;  5BNP C;  5JSO A;  2P34 A;  5FYU A;  3NL1 A;  3VBR B;  4BA6 A;  4YZ3 A;  3H50 A;  2R07 3;  4YSF A;  4A44 A;  2DTW A;  3NJV A;  2P4E A;  2BU9 A;  3WP5 A;  2DV9 A;  4RS5 B;  4RSU A;  4AHZ A;  4Q4V 1;  3ZYP A;  1JZ2 A;  1WW4 A;  1ULP A;  3W20 A;  1BKZ A;  1RYY A;  3V0A B;  1A3K A;  4AFM A;  3C7O A;  1CON A;  1S0G A;  1NLQ A;  4IV1 C;  1VAL A;  2KA3 A;  2HWF 2;  4LKS A;  1AR7 2;  2KD7 A;  1MEC 3;  4E4H A;  3HAG A;  2ZGM A;  2VL4 A;  4L11 A;  4GMP 1;  4P5H A;  4AHW A;  4ATF A;  3N9L A;  4PDW B;  2VTX J;  4PBO A;  5IK7 A;  5FMO S;  5GZE A;  2WN3 A;  4B4P A;  5FPU A;  5JWP A;  5LRS A;  2YU1 A;  1DYO A;  5F5I A;  2VU9 A;  3ILR A;  4FPF A;  2WZE A;  5LAT A;  4DEQ A;  4JGZ A;  4CUG A;  4ZHN A;  1IGO A;  1AR9 3;  1MZE A;  2P6H A;  2XB6 C;  4JHT A;  1AVB A;  4XFB A;  4NII A;  3LCP A;  3ZMO A;  2WWJ A;  5FZ1 A;  2Y6L A;  3LFI A;  3ILN A;  3LWC A;  4NVP A;  4W8J A;  5A3M A;  1TMF 1;  1DG6 A;  1FYU A;  1KQR A;  1RB8 G;  5FXW A;  4PLO A;  5HCF A;  2ZGS A;  2W95 A;  3A0N A;  3ZO0 B;  2YMZ A;  1CPM A;  3J26 N;  3ME2 A;  1UIK A;  3NMB A;  2UYA A;  3MUZ 1;  3O14 A;  1Y43 B;  3IZO A;  4NRQ A;  1QDC A;  3AMP A;  3AYD A;  1PM7 A;  1RXG A;  1SDD B;  4BQW A;  2A5Z A;  4K9S A;  1F31 A;  3PL0 A;  3VKO A;  5JXI A;  3E5Q A;  2BNN A;  4IEV A;  4XPV A;  4CU6 A;  3FLP A;  1G9A A;  2HH9 A;  1CAU B;  1EYB A;  5C3S A;  4LNV A;  2A3Y A;  1X7N A;  1COV 2;  1RUI 3;  1W8W A;  1TE1 B;  4ORF A;  4YZ1 A;  5L9B A;  5F5C A;  3OGR A;  3DXU A;  4NJ4 A;  4KG0 A;  1N1Y A;  4QHB A;  3Q8C A;  4YM2 A;  2CL2 A;  5BUV A;  2XL9 A;  2PTM A;  3MBW A;  3E6D A;  4NHX A;  2EIC A;  4EN8 B;  1C1L A;  3H8X A;  3T0B A;  4FOQ A;  1FT9 A;  1RUG 2;  2R49 A;  2ERF A;  2OX0 A;  3D5O A;  2RS1 2;  4ZZ8 A;  4XJW A;  4MO3 M;  1NY7 1;  1CAW A;  5A6Q A;  3BUC A;  1DZT A;  4C1W A;  2JDN A;  4Q4W 2;  4DRV A;  4MG2 A;  3KT7 A;  1JHJ A;  5A3T A;  3PU8 A;  4N53 C;  3EBR A;  3SCG A;  4MGY E;  5C5U A;  4FXG B;  1J1T A;  5C5T A;  2VME A;  1CAX B;  3AP6 A;  4XF1 A;  5H9S A;  3UES A;  2QQL A;  1NA1 C;  3J7M A;  4FPO B;  2B4K A;  3DPR C;  3GXU A;  3KT1 A;  3NST A;  4H3W A;  4IES A;  5K4L A;  3NVC A;  5LBE A;  3MF6 A;  1MS5 A;  4FI9 A;  4ZS3 A;  2WWS A;  5A3U A;  1S0C A;  2VZQ A;  3CIH A;  1NCR C;  4KQ7 A;  1RUF 3;  1AYM 3;  2W3J A;  4LBK A;  4NO4 A;  4BXS V;  1UZY A;  1VB2 A;  1UW8 A;  2DBN A;  1WCS A;  1NQJ A;  3ACG A;  1KRI A;  4QB2 A;  3IMM A;  4XUR A;  3ZVX A;  5HI0 A;  4XTM A;  3WX5 A;  2HWF 1;  2EIE A;  1AR7 1;  4MX3 A;  5F7U A;  3MEP A;  4BQ5 A;  2Z69 A;  4RQP C;  1SFY A;  4PLN A;  4DUX A;  3RZG A;  2Y6G A;  5FFO C;  5DPN A;  4MVT A;  4ZY9 A;  3THD A;  1OT5 A;  3JXS A;  3WZ1 A;  2W0X A;  4QPG B;  3FN9 A;  1RUN A;  2I45 A;  4MAD A;  1B35 C;  3LA3 A;  2X05 A;  5BNO B;  5K0U B;  1NX9 A;  1OHF A;  1RUE 3;  1H8T C;  2P37 A;  2VMF A;  3GHN A;  3PUH A;  1QJU 3;  2QTW B;  4IE0 A;  1DQ0 A;  2ZA9 A;  5EP9 A;  3B9C A;  2WQZ C;  2H0V A;  2AR6 A;  2XJU A;  1QY4 A;  2D6L X;  2E9Q A;  1Q3E A;  2EIG A;  3RQ0 A;  1UOG A;  2D3R A;  4HLT A;  3VD3 A;  5L7O C;  2ZGR A;  4HMZ A;  2OW4 A;  5FZ7 A;  4J1X A;  1OQ1 A;  1H30 A;  1SLA A;  1W8O A;  4BOW A;  4B29 A;  4EWA A;  4EWE A;  5J37 A;  2PQS A;  2ZTN A;  3A23 A;  5JSP A;  1PVC 2;  1FMD 3;  1X9T A;  2V4A A;  1COV 1;  1HXS 2;  1LOE A;  1ND2 A;  2LUW A;  3ON7 A;  5B4N A;  1W6N A;  1GQG A;  3S5Q A;  3SKJ E;  5HBA A;  3O1T A;  3KMH A;  1GFF 2;  3WP3 A;  2WSV A;  3J4U H;  3BTZ A;  1CAV A;  3MLL A;  3WP6 A;  4CPB D;  5C9A C;  4GB3 1;  1UPI A;  4IEO A;  4COY A;  2E26 A;  4FVV A;  4D3W A;  1RUG 1;  2Y60 A;  2RS1 1;  4TXW A;  3ZFE A;  1F35 A;  2FMD A;  2HKX A;  2WO3 A;  4J25 A;  1KJR A;  4K8F A;  4LO5 B;  1VRH 3;  4AEK A;  1NZC A;  4YZ5 A;  2JDA A;  4LKE A;  4WZC A;  1UZ0 A;  1AR8 2;  2CTV A;  2XJV A;  2GAL A;  4A2U A;  1JYI A;  1GAN A;  4OHY A;  5LAS A;  1X36 A;  1U5I A;  1LAJ A;  3Q8E A;  1PMJ X;  4UI9 L;  5FP3 A;  4CCJ A;  4XJA A;  4N7I A;  2PAE A;  2R1D A;  1QXJ A;  3BB6 A;  4JGY A;  1B09 A;  3BIE A;  5SV5 A;  1DZR A;  4XUQ A;  2DCZ A;  2OQ7 A;  2OPK A;  4CDU C;  1GZ9 A;  1OD5 A;  2V73 A;  5FZD A;  1UY4 A;  1OQE A;  1V9U 3;  2YPD A;  4QT6 A;  2IWG B;  2VUA A;  1TMF 3;  4CDQ C;  3CNA A;  3AFK A;  1DZQ A;  4FP2 A;  1LHN A;  2YYO A;  5I8T A;  4CEY A;  4AWD A;  1D0G A;  2ET1 A;  2JG8 A;  4IE7 A;  4WM7 C;  4NR1 A;  3M2M A;  2VVD A;  3JU9 A;  3RS6 A;  1VPH A;  2QQN A;  4UF0 A;  1JYW A;  2PHL A;  5DAX A;  2A73 B;  1Z0H A;  1OOP C;  1C8N A;  1JYX A;  3J9S A;  2D7F A;  3OCP A;  1CZV A;  5FP7 A;  4QX8 A;  3U1X A;  1U5Y A;  2VUC A;  2OZJ A;  3S7I A;  2Q0A A;  1W6M A;  4H14 A;  5IHR A;  5JIA A;  1G8W A;  1O5L A;  4IEQ A;  3ES1 A;  5IJR A;  5A6X A;  4JQR A;  1MQT C;  4QQL A;  1YJL A;  1W9T A;  2Z5W A;  4UBH A;  5FMO L;  5JXJ A;  1GWK A;  4M3C B;  1E5I A;  4P14 A;  5D2A A;  4Q0P A;  2W94 A;  3NQH A;  4BQ3 A;  5T5P A;  3RVH A;  4C91 A;  4HXC A;  1I6X A;  1Q8P A;  1S2B A;  3OD4 A;  3WQ7 A;  4R4X A;  2CV6 A;  1ZRE A;  2PEL A;  3ZXK A;  1D0H A;  2BGC A;  3F2Z A;  1OQD A;  2WFF 2;  2IXC A;  2VW1 A;  2CYF A;  4UFL A;  5KHI A;  4H7L A;  3RZK A;  1PVC 1;  4A7K A;  4QDR A;  1KFX L;  2A3X A;  1HXS 1;  4EQV A;  4KWJ A;  3ROU A;  4LIU A;  5J98 B;  3HD8 B;  5H9P A;  3AMM A;  5FDB A;  2HEY F;  4LLO A;  1O4Z A;  4N90 A;  2QQK A;  1BVV A;  4QXC A;  2JG9 C;  4HKW A;  3OEB A;  5I8S A;  5HXM A;  1W3X A;  4E2Q A;  1ODN A;  3H8O A;  2VVF A;  2DUO A;  4Y20 A;  1RIN A;  2IFR A;  2Q1F A;  5K8S A;  5ABJ A;  1DHK B;  2WNV C;  1NZI A;  1V6N A;  4QX2 A;  2OXB A;  4CP9 B;  4WVV A;  5K9Y A;  4Z2W A;  1AR8 1;  2HWF 3;  2BW8 A;  4XUN A;  4FTE A;  1GUI A;  1AR7 3;  4BMB A;  2D6K A;  2A6Y A;  2AZ5 A;  1LHV A;  2DYC A;  3TEZ A;  1GR3 A;  3K51 A;  4HFS A;  3BOD A;  3N7M A;  4DPN A;  4KWK A;  1OKO A;  1VMF A;  5ISL A;  1QJF A;  1POV 1;  2C4X A;  1SZB A;  2YPJ A;  3ITQ A;  3LZZ A;  4HVQ A;  3KCY A;  1W9Y A;  5FZC A;  1ZZ8 A;  3OD0 A;  4XJZ A;  5HCB A;  3WIN E;  4M00 A;  4TZD A;  3D8C A;  5A7Q A;  3ALQ A;  5J09 A;  4MOA A;  3CJI C;  4LLF A;  3W21 A;  4NHM A;  3QLQ A;  2G19 A;  1W6Q B;  1Q43 A;  3NV3 A;  3BCW A;  3OGS A;  3VHR A;  2VXR A;  1PGW 2;  4Y3O A;  2DUP A;  3M4F A;  5C8C C;  4GH4 C;  3NAP A;  1REE A;  2WWU A;  5C7G A;  2PN5 A;  1W05 A;  2ZML A;  4NHY A;  1ZRI A;  3WCS A;  4HG6 B;  3S5A A;  2E7T A;  3POJ A;  5AVP A;  4AL9 A;  3OPZ A;  4BQY A;  1VBB 2;  3QCW A;  3RYK A;  1LTE A;  5DUW A;  3G6J B;  1JH5 A;  3ELN A;  5A7W A;  3ZSM A;  4K1Y A;  3HJR A;  2XJP A;  5GKA C;  3RZL A;  1COV 3;  2RJK A;  4YPJ A;  4K21 A;  4RS5 A;  4IEP A;  5LA9 A;  2PHD A;  5CG8 A;  2A6W A;  2VGD A;  4QGM A;  4XC9 A;  5HPO A;  4TYS A;  1YI9 A;  2JKB A;  4NPL A;  3LOB A;  1HB2 A;  1ZM1 A;  2IZW A;  3AYE A;  1EP0 A;  1M4W A;  2YV8 A;  3ZFF B;  3WP4 A;  4CU7 A;  1RUG 3;  3AZW A;  1DQ5 A;  5HXV A;  3WNX A;  2E6V A;  2YDE A;  5A3N A;  2K2S A;  2PXJ A;  2PAK A;  2RS1 3;  2ES3 A;  3NNL A;  1O8P A;  2DVF A;  5G04 L;  3LB9 A;  4DNY A;  3BU0 A;  4PT6 A;  4Q4W 3;  1AX1 A;  1LKN A;  2WFF 1;  4C0B A;  5CU1 A;  2BFU L;  3ETP A;  4IGQ A;  4LUK A;  2C26 A;  3ZXA C;  3N9M A;  4XJ8 A;  1SPP B;  1SLI A;  4BK5 A;  1GOG A;  2JEN A;  1A6C A;  3N7J A;  1FI2 A;  2ET7 A;  2O14 A;  1GSL A;  4UW3 A;  3BVC A;  1XNC A;  2CU5 A;  4FOY A;  1IS4 A;  4MGK E;  4D6R A;  4GJY A;  4XFC A;  3DL3 A;  1XNA A;  5FMD A;  4JRL A;  2WAA A;  1YFY A;  3KF5 A;  3ACH A;  4H2A A;  4XAA A;  4BQ1 A;  5FAX A;  2E31 A;  1ZA4 A;  3O0X A;  5FZF A;  4FSJ A;  3J7L A;  3I3E A;  4UFJ A;  4URA A;  2NZ9 A;  4NIA A;  1VP6 A;  2DU1 A;  3RMY A;  5GZG A;  1OUS A;  4QAW A;  2W47 A;  5A3L A;  1UNB A;  1CJP A;  2GU9 A;  3EYP A;  2A1X A;  2HBT A;  2VMG A;  1KJL A;  5ACA 2;  2WL1 A;  3E6C C;  3ZM8 A;  1YC6 1;  2GZW A;  1DYK A;  5JOY A;  4BQ2 A;  1ZRR A;  2I07 B;  1VR3 A;  4QHO A;  3VBS B;  1ZX5 A;  5A7P A;  5HV0 A;  2FDH A;  3WG2 A;  4BWO A;  1MZ5 A;  4S2H A;  2FDG A;  4Z82 A;  3VBO B;  1PGS A;  1PGW 1;  4CDW A;  5CEH A;  3K3O A;  3UNP A;  2ARX A;  3FHA A;  1J1L A;  3I4I A;  2IXK A;  1PGL 1;  1CD3 G;  2VTX A;  3J7H A;  5A33 A;  3OUJ A;  3OJB A;  1S0J A;  4GXL A;  4B4Q A;  1CAX A;  3DUI A;  2R16 A;  1YWK A;  5C4W C;  1VBB 1;  5JR2 A;  3PIG A;  4YW6 A;  2RMU 2;  1UQX A;  2PHW A;  4IGP A;  2W68 A;  1PVC 3;  1K12 A;  4LHS A;  4LUL A;  4AFB A;  1PK6 B;  4MYE A;  4NID A;  4QPY A;  4E2S A;  2ZGO A;  2ZBJ A;  1HXS 3;  1WW7 A;  4N7U A;  2VM9 A;  1DDL A;  5FZ3 A;  2JKX A;  4CCM A;  4OQ8 A;  5BPX A;  3B93 A;  2R30 A;  4P08 A;  2XLG A;  3MFC A;  4GIQ A;  3U07 A;  2P3J A;  1F5J A;  2BRT A;  1LOF C;  2MEV 2;  3PJQ A;  1XXN A;  4GAL A;  1LOB A;  1WCD J;  4BU2 A;  3PUA A;  3RMX A;  2LAL A;  5LZ6 A;  1FPN 3;  3TB0 A;  4OMD A;  5IK4 A;  2CGN A;  1QQP 2;  3JZV A;  4RN5 A;  3DCQ A;  5IVY A;  3HQR A;  1CN1 A;  4O7X A;  5H9R A;  5GAL A;  3P5B A;  2F6B A;  2HEW F;  3OGV A;  1T6B X;  1SLC A;  4GWM A;  4IW3 A;  4UBG A;  5FTT C;  5FZO B;  1LNS A;  4Y26 A;  5CIR A;  4QPG A;  3OF1 A;  5BNO A;  1AR6 2;  1R1A 2;  2VZ3 A;  4AQS A;  1POV 3;  3SIT A;  2B9V A;  1IZ3 A;  4GZ9 A;  2ZX4 A;  2QQI A;  3LEK A;  4QDQ A;  4XAB A;  2WDB A;  5A7O A;  2QJV A;  1N1S A;  1UOF A;  4AXO A;  4DXZ A;  5FZM A;  3LPG A;  4OYU A;  4KH9 A;  2VUJ A;  2QDN A;  4QPI A;  5C6C A;  5K7P A;  4D8M A;  1HN0 A;  2HWB 2;  1HRI 2;  1QJX 2;  1V0A A;  5F2S A;  1UYZ A;  1D2Q A;  3KV4 A;  2WZR 2;  1LEM A;  4E2G A;  5GZD A;  4OI0 A;  4ARX A;  3ZX7 A;  3AKQ A;  1OLM A;  1ULC A;  4D6S A;  1F9K A;  4U36 A;  1LJ7 A;  3NWK A;  5IAT A;  2K0G A;  4OMC A;  2X10 A;  3R4S A;  3WVJ A;  4XQD A;  4YVW A;  1AF9 A;  4YG3 A;  1RUD 2;  3NJY A;  3R05 A;  4L99 A;  4LK7 A;  4UW5 A;  1YIP A;  5FLJ A;  3CL1 A;  5ACA 1;  4LO6 B;  5A3O A;  2F4L A;  4JZR A;  3AP9 A;  4PQQ A;  3NNJ A;  5DN2 A;  4KNC A;  4D0Q A;  3GJB A;  3KCC A;  4A3Z A;  4MSV A;  4UFH A;  3TNP B;  3LEI A;  3AMQ A;  4FP3 A;  3VBU B;  5C70 A;  1LEC A;  4CDX B;  4JGZ C;  1K45 A;  1W6O B;  3M3C A;  1JU4 A;  1C5I A;  1ONA A;  1BEV 1;  1E57 A;  1NE6 A;  3J7N A;  4I0B A;  2D3S A;  2LTN A;  2QZ3 A;  2UU8 A;  3PME A;  4JCK A;  3T0A A;  3WG1 A;  3WDV A;  1VBC 2;  3FFZ A;  5AVA A;  1GZW B;  4W6W A;  4CCN A;  2W1U A;  3AM2 A;  2YFU A;  1C5H A;  3U0Z A;  2WFF 3;  4EZ4 A;  2RMU 1;  1GQH A;  5FZL A;  3VBF B;  5FZ6 A;  5BNQ A;  1RUO A;  1W99 A;  2JDZ A;  2R1B A;  2PHF A;  3FHQ A;  1RGS A;  3MW4 A;  4RR3 B;  2FZ1 A;  2JDH A;  3ES4 A;  4HPK B;  3I2I A;  5CNA A;  2VVE A;  4LIT A;  5IVV A;  3SLI A;  1W9S A;  3KGL A;  2JIJ A;  4BPZ A;  1LHU A;  2MEV 1;  4MGZ E;  2EVX A; 
#chains in the Genus database with same CATH homology
 5EIY B;  1DYO A;  1JYN A;  2WZE A;  4OUE A;  4DEQ A;  2BBA A;  3A7Q A;  3WNK A;  1UY2 A;  2QBX A;  2Y6L A;  3VD4 A;  4W8J A;  3T2P A;  2ID4 A;  2VZR A;  3DYP A;  2BGO A;  2W95 A;  3MO4 A;  2YC2 A;  3MUZ 1;  2X09 A;  2J22 A;  3LQC A;  3I2J A;  5JMO A;  1CZT A;  2QQM A;  1SDD B;  5FUI A;  4BJ0 A;  3SEP A;  1JI6 A;  3I3B A;  4CU6 A;  5JXI A;  4A45 A;  3WNP A;  4GWI A;  4UOJ A;  2WO2 A;  4ET7 A;  3OGR A;  1GMM A;  2W1S A;  1UYX A;  3LPF A;  1H6Y A;  3MBW A;  4JKL A;  3IAP A;  3CZJ A;  2EIC A;  1JZ5 A;  2WAO A;  3T0B A;  5CYY A;  3WNM A;  2W87 A;  4JHZ A;  4ZZ8 A;  2W46 A;  4MO3 M;  4KMQ A;  3IAQ A;  2Y6K A;  4CUA A;  3WNN A;  5IFP A;  2VZS A;  2V5D A;  1JHJ A;  2VZU A;  3IDA A;  2VME A;  4BK4 A;  3VD7 A;  3U37 A;  3UES A;  3VD9 A;  1HN1 A;  2QQL A;  2VQT A;  2B4K A;  3FL7 A;  3GXU A;  3EB7 A;  3HOB A;  1OF4 A;  4FI9 A;  1L7R A;  3P6B A;  3I3D A;  2VZQ A;  3CIH A;  3E1F 1;  2W3J A;  4BXS V;  3OEA A;  3ACG A;  3P1I A;  3HPN A;  4QB2 A;  4XUR A;  1GU3 A;  1NUK A;  3BN6 A;  2EIE A;  5IYY A;  4DXS A;  5F7U A;  1TVG A;  1DP0 A;  2LW8 A;  2W91 A;  1F4A A;  4DUX A;  2Y6G A;  5DPN A;  4ZY9 A;  1JZ6 A;  1UY3 A;  4CUC A;  3THD A;  1OF3 A;  1OT5 A;  3JXS A;  4MGS A;  2J7M A;  4DEV A;  3FN9 A;  4P00 B;  4PF1 A;  3GDB A;  1UYY A;  4MAD A;  2X05 A;  3K75 B;  1NX9 A;  2VR4 A;  2VMF A;  3PUH A;  2YFZ A;  2J1E A;  3HNY M;  2RV9 A;  1J83 A;  2V72 A;  3W5N A;  2ZEX A;  1WCQ A;  1OH4 A;  3VD3 A;  3BGA A;  3VDC A;  1EUU A;  1W8O A;  1JYV A;  1UWW A;  3WSO A;  2PQS A;  3A23 A;  3I2G A;  2Y64 A;  4QB6 A;  4QX0 A;  2QQJ A;  4CU9 A;  3CQO A;  5B4N A;  4LQR A;  3SKJ E;  2V4V A;  3VD5 A;  3CDZ B;  3I97 A;  3ACF A;  1EUT A;  2E26 A;  2ORZ A;  4Z2A A;  2Z4F A;  1JZ8 A;  2YB7 A;  4TXW A;  2WO3 A;  2WZ8 A;  4QDS A;  2WAB A;  3WF3 A;  2JDA A;  2DCK A;  3C7F A;  1UZ0 A;  3HEI A;  1GQP A;  1PMJ X;  4UAP A;  4UI9 L;  1OD3 A;  2WUH A;  1BHG A;  1NKG A;  3C8X A;  2DDU A;  4XUQ A;  3SEE A;  4JKM A;  2XQX A;  1UY4 A;  2W5F A;  2VMD A;  4DUV A;  1KGY A;  1UXZ A;  1JZ4 A;  2Y6J A;  3D3A A;  3T2Q A;  1P8J A;  2HLE A;  2QQN A;  1JYW A;  2ZEY A;  2BER A;  3WF2 A;  1US3 A;  1JYX A;  2ZEW A;  5JXG A;  1CZV A;  4W4Z A;  5IHR A;  2XON A;  3I2H A;  1US2 A;  5EJ1 B;  5IJR A;  4DXT A;  5JXJ A;  5B4X A;  1W9T A;  5C71 A;  2VCC A;  3A22 A;  3III A;  2W94 A;  3NQH A;  3WF1 A;  2VC9 A;  2ZEZ A;  4XZU G;  1O59 A;  4DUW A;  2WQ8 A;  1UY1 A;  2JD9 A;  3F2Z A;  4XUP A;  3W5M A;  3HN3 A;  4DXR A;  4QDR A;  5A1A A;  4P5Y A;  2VZO A;  3K46 A;  1CZS A;  1DLC A;  2VZT A;  2J1V A;  1JZ3 A;  2QQK A;  2J1T A;  2VQU A;  4ZZ5 A;  2YG0 A;  2ZXQ A;  3OEB A;  1I5P A;  5HXM A;  3WQB A;  3MV1 1;  3MUY 1;  4QX2 A;  3WF0 A;  3WNL A;  4JX0 A;  4AG4 A;  4XUN A;  1J84 A;  1GUI A;  1JU3 A;  1H6X A;  1KEX A;  1W8N A;  2C9K A;  2VOT A;  2C4X A;  4CVU A;  1F4H A;  1ULO A;  2RJ2 A;  4MOA A;  2CDP A;  3PUI A;  3SKV A;  3C7E A;  5I0D A;  3OG2 A;  3OGS A;  4RYD A;  3ABZ A;  2VJX A;  3VDB A;  5C7G A;  3WNO A;  1T2X A;  4HG6 B;  4L0P A;  3THC A;  2VZ1 A;  3A21 A;  2J1U A;  3CMG A;  3HJR A;  4GWJ A;  2W1Q A;  4YPJ A;  3ACI A;  1MPX A;  3NNG A;  3CKH A;  5HPO A;  2LS6 A;  3K4A A;  1K3I A;  3WF4 A;  1YQ2 A;  2VTF A;  4W50 A;  4OZO A;  4CU7 A;  1GOH A;  1CIY A;  2Y8K A;  2VZP A;  4A42 A;  1O8P A;  2WO1 A;  5G04 L;  2WYS A;  3VDA A;  4PT6 A;  2W9X A;  2R7E B;  1UMH A;  1W0N A;  1XNT A;  2WN2 A;  3ETP A;  1R64 A;  2EID A;  2C26 A;  3HNB M;  4BK5 A;  2VO5 A;  1GOG A;  3IB3 A;  2HYX A;  4KWU A;  3T09 A;  4A4A A;  1NAE A;  3C7H A;  3OBA A;  1IQD C;  1WKY A;  4XUT A;  2E32 A;  1XNA A;  4MGQ A;  5LA2 A;  2WAA A;  3ACH A;  5JUV A;  2YC4 A;  5EJZ B;  2E31 A;  3GGL A;  4LPL A;  3C7G A;  3I3E A;  3DYM A;  3CZU A;  3LE0 A;  3K77 A;  4QAW A;  3K4Z A;  2W47 A;  2EIB A;  5LA0 A;  2W92 A;  3EYP A;  1UXX X;  4A6O A;  3ZM8 A;  2VZV A;  4QX3 A;  4ARY A;  4A41 A;  2E33 A;  2XHN A;  3UNP A;  3FHA A;  2DCJ A;  4E8D A;  3J7H A;  4TTG A;  4AAX A;  1XC6 A;  3NJX A;  2ORX A;  5LA1 A;  3NRU A;  2WBK A;  4IUG A;  3I2K A;  1UX7 A;  5CZK A;  2OKX A;  3T08 A;  4CU8 A;  5JR2 A;  4LHS A;  1K12 A;  1O8S A;  2XOM A;  4QPW A;  3AC0 A;  2J1A A;  2VM9 A;  3T0D A;  2JKX A;  1JZ7 A;  1XPW A;  4P08 A;  1UY0 A;  2BGP A;  1L7Q A;  2Y6H A;  1SG3 A;  4OMD A;  4M4R A;  3K4D A;  1UMI A;  4RN5 A;  1GOF A;  1GNY A;  5IFT A;  5JXH A;  4JKK A;  3OGV A;  3UET A;  1CX1 A;  3WEZ A;  1LNS A;  5G05 L;  3I2F A;  2VCA A;  2J1S A;  1K42 A;  3DEC A;  2VZ3 A;  2B9V A;  4GZ9 A;  2QQI A;  3HNM A;  3ECQ A;  3LEK A;  2WDB A;  4KI5 M;  4QDQ A;  3LPG A;  4OYU A;  4D8M A;  1UYZ A;  4M4P A;  3LEG A;  2L9L A;  4XUO A;  4ARX A;  1SHW B;  4QB1 A;  4OMC A;  2W1W A;  2X10 A;  4BDV B;  4ZXE A;  2CDO A;  1PMH X;  1TG7 A;  3T2O A;  4CUB A;  1PX4 A;  5DMY A;  1PX3 A;  4E8C A;  2J1R A;  4XVH A;  1W9W A;  4PQQ A;  5DN2 A;  4D0Q A;  4A3Z A;  4P02 B;  3GM8 A;  5LCW L;  3LEI A;  3MV0 1;  2QQO A;  5C70 A;  1K45 A;  1JU4 A;  4A44 A;  3NJV A;  5DQ0 A;  3T0A A;  2BZD A;  2VMC A;  1D7P M;  2JE8 A;  1JZ2 A;  2W1U A;  2YFU A;  5J1X A;  1ULP A;  1RYY A;  3DYO A;  3C7O A;  4QX1 A;  1W99 A;  3FHQ A;  4LKS A;  2KD7 A;  3I2I A;  2VCB A;  2VL4 A;  2RVA A;  3OB8 A;  1W9S A;  2WN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...