1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
molecule keywords putative xylanase
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
3T08A 2JDAA 2J1UA 1JYNA 5EIYB 4UI9L 3LE0A 2VM9A 3K4AA 4W8JA 1H6XA 1YQ2A 3MUZ1 2YB7A 4D8MA 2CDOA 1K12A 4QDQA 4XUTA 3WF4A 1JZ5A 2C26A 1UYYA 4JX0A 3PUHA 2WN2A 4JKKA 1UYZA 2J1VA 1OH4A 2Z4FA 1XPWA 3HN3A 1OD3A 1W0NA 1UY2A 4RN5A 5C7GA 3W5NA 4P00B 3LQCA 2J7MA 3WF1A 4MADA 1OF3A 1DYOA 4A6OA 4QPWA 3EB7A 3CZUA 4P5YA 2WYSA 2J1AA 4IUGA 2HLEA 2QQMA 3BN6A 1UY4A 3A22A 3SEPA 3AC0A 4BJ0A 1R64A 2QQNA 2VQTA 3NRUA 3U37A 4DXSA 1JHJA 3OBAA 3D3AA 2LS6A 1T2XA 2X10A 2X05A 3I2IA 4QB1A 3F2ZA 2VTFA 3E1F1 4ZZ5A 1EUUA 3ECQA 1UMHA 4KWUA 1GU3A 3CMGA 2BGPA 3DYPA 2VMCA 2W9XA 3UESA 4QB6A 1DLCA 3VDAA 1UXXX 3SKVA 1XNTA 2OKXA 2W5FA 1JZ7A 3IB3A 4HG6B 2XQXA 2YFZA 3NJVA 2YC4A 3IIIA 1W9TA 2VCBA 2VZTA 1SG3A 3C7FA 3VD3A 2VQUA 3I2KA 2Y6JA 3MUY1 5B4XA 3ACIA 2X09A 4JKLA 1W9SA 2VZUA 5LCWL 3I2JA 1TVGA 4RYDA 3FL7A 2RV9A 1GOGA 4QX2A 4CUAA 2V4VA 2WQ8A 4KI5M 2W91A 2WZ8A 2W94A 4QDRA 1CZSA 1IQDC 2W87A 4QX1A 4Z2AA 3HPNA 3LEGA 3CZJA 2BBAA 4A4AA 1W8OA 5C70A 3T0DA 3ACFA 2V5DA 3A21A 3MBWA 4OZOA 4D0QA 5J1XA 2HYXA 1JZ3A 1K45A 4QDSA 1WCQA 3WNMA 2WAOA 1US2A 2VZ1A 3CKHA 3WNLA 4XUNA 1MPXA 2DCKA 3OGRA 4ET7A 4FI9A 3DYOA 4LPLA 4KMQA 4YPJA 4XZUG 5JXIA 4AAXA 3LEKA 2VR4A 2Y6KA 1P8JA 2XHNA 3WF2A 2VCAA 3OG2A 1JYWA 1KGYA 4MOAA 3THCA 5DN2A 2ID4A 1UZ0A 2VOTA 5JXHA 1BHGA 3P6BA 3I3EA 3OGVA 4DUXA 4PF1A 3CIHA 1CIYA 2VJXA 4BK4A 3C7OA 3UNPA 4XUPA 1UWWA 3EYPA 1UY1A 1L7RA 2E31A 1UMIA 2ZEXA 3MV11 3VD9A 2ZXQA 1O8PA 4GZ9A 2VZ3A 2YC2A 4DXTA 3VD7A 5JMOA 4ZXEA 3T0BA 3PUIA 4UOJA 4GWJA 1GQPA 5C71A 4PQQA 2W1QA 4W50A 4OMCA 2C4XA 5JUVA 2QQOA 4QX0A 3MV01 5LA1A 3P1IA 1JZ2A 1D7PM 1F4HA 1US3A 1NKGA 3WNKA 2WDBA 2VZRA 2WABA 4ZZ8A 2QQKA 3T2PA 4CU8A 4CVUA 1GUIA 1TG7A 2YFUA 3CDZB 3NQHA 3WNNA 1GNYA 1ULOA 2WN3A 1CX1A 3HNMA 3I3DA 3WF3A 2W47A 2EICA 1PX3A 5JXJA 2ZEWA 2VMFA 2ZEYA 3WEZA 1PMJX 4JHZA 1XC6A 3NNGA 4BXSV 4TXWA 4A3ZA 3W5MA 2PQSA 4JKMA 3OEBA 2VO5A 2E33A 2KD7A 2VCCA 3A7QA 3I97A 2BGOA 3FHQA 1ULPA 4DEVA 3GM8A 4W4ZA 1SHWB 2QQIA 2QQLA 1XNAA 1CZVA 4P02B 1PMHX 4XURA 3VDCA 1SDDB 1NUKA 4ARYA 5EJ1B 3JXSA 2R7EB 2J22A 4OMDA 5FUIA 4DUVA 4CU7A 2VL4A 4A42A 3J7HA 2XOMA 2WZEA 3DYMA 4XUOA 2JE8A 1W9WA 1F4AA 2W1WA 1O59A 4E8DA 3VDBA 2VC9A 1I5PA 4MO3M 1JYVA 5IFTA 2WUHA 4CU9A 1JI6A 4BK5A 3THDA 3FHAA 3WSOA 4CU6A 2Y64A 4LHSA 3ZM8A 2VMEA 1JZ6A 2Y6LA 1LNSA 2JD9A 1K3IA 2QBXA 2DDUA 1GOHA 3ETPA 5G05L 5LA2A 2W92A 2W1SA 3UETA 1GOFA 2EIBA 2J1TA 3A23A 3K77A 4LKSA 1JZ8A 2WO2A 1UY3A 5CZKA 4M4PA 5LA0A 1H6YA 4XUQA 1JYXA 5JXGA 4A45A 3K75B 3I3BA 1OT5A 3K4ZA 4BDVB 2W95A 3MO4A 3SEEA 2RVAA 2ORZA 1W99A 3OB8A 5IFPA 1OF4A 2VMDA 2BZDA 1RYYA 5CYYA 2DCJA 1PX4A 1DP0A 4CUCA 2J1SA 4ZY9A 4DUWA 4L0PA 5IYYA 3HJRA 3HNBM 3K4DA 3FN9A 5EJZB 4MGSA 2CDPA 2JKXA 2W3JA 2Y6HA 3GDBA 1NAEA 3CQOA 4DEQA 2VZVA 1J84A 2WO3A 4ARXA 1KEXA 3VD4A 2VZOA 5G04L 3ACGA 1L7QA 1UXZA 5IHRA 1UY0A 3LEIA 5HPOA 2VZPA 2YG0A 3C8XA 2EIDA 3GGLA 3WQBA 1HN1A 3ABZA 3T2QA 5F7UA 2W46A 4DXRA 5A1AA 3ACHA 2J1RA 4E8CA 2WBKA 2QQJA 2RJ2A 2Y8KA 5IJRA 3T2OA 4P08A 2B9VA 1W8NA 1EUTA 3C7EA 2BERA 5HXMA 3BGAA 3HOBA 3OEAA 3DECA 4CUBA 3IAQA 2E32A 5DPNA 2EIEA 3LPFA 2VZSA 1CZTA 5I0DA 4QAWA 3I2FA 2J1EA 3C7HA 1JZ4A 3T09A 3T0AA 4QB2A 1O8SA 4A41A 4TTGA 4A44A 2B4KA 3K46A 5B4NA 3HNYM 1K42A 5DMYA 1WKYA 3C7GA 5JR2A 2E26A 2W1UA 3LPGA 4UAPA 3SKJE 2V72A 2WO1A 3WF0A 4AG4A 2XONA 4MGQA 3I2GA 3IAPA 4OUEA 3VD5A 3HEIA 1JU4A 2WAAA 2L9LA 1J83A 1UX7A 1UYXA 4PT6A 3GXUA 4M4RA 3I2HA 2VZQA 2LW8A 1JU3A 4GWIA 3IDAA 4LQRA 3WNPA 1GMMA 3WNOA 4XVHA 5DQ0A 2Y6GA 2ZEZA 4QX3A 4OYUA 3OGSA 1NX9A 2C9KA 2ORXA 3NJXA
chains in the Genus database with same CATH superfamily
1RITA 2J1UA 4G3YC 3SC7X 1QJX1 5A3PA 3M3OA 5LWBA 3RZHA 1GP4A 2A6XA 1D4M2 1RUD2 3NV4A 3TAYA 4FPEA 5I0SA 2WS92 1LHUA 1FXZA 5ERLA 4L8QA 5AC91 4CPBA 2YBSA 4OLLA 4N53B 4B1MA 1AYN1 1GWLA 2VM9A 3KQRA 3T30A 2YGLA 5CG9A 1SLBA 1V6NA 1NA1B 3MPBA 3MUZ1 4AI2A 4CCMA 4YW1A 2VTXJ 4D8MA 4TYSA 3WDVA 4WVWA 5FP9A 3T3YA 3N4MA 3HWJA 3WF4A 5C3RA 5FO8B 1DU3D 1S4CA 1CESA 4HT1T 4CEYB 4B4PA 3OGJA 2WQZC 5ACA3 2J1VA 1TMF1 4MHUA 1XPWA 4LXLA 4PF5A 5L36A 1BKZA 3AKPA 4QT6A 1A8DA 4Y1YA 3AB0A 3LQCA 2ZHKA 2BJSA 3CHXA 1HB4A 4UFJA 2PTMA 3DXTA 1W06A 1W6MA 4HXCA 4GD4A 1O6UA 4A7YA 1RUI3 2WINB 3U1XA 1I6XA 1DYKA 1PZ7A 5T5OA 4CDWB 3MLJA 1H1AA 1H4HA 5FMBA 4AQSA 3RZKA 4BJ0A 4ASLA 2UURA 1N1TA 2QE3A 5A33B 2VQTA 3NRUA 3LAGA 1FMD1 3PUAA 1W8FA 3OBAA 4IV1A 3RNSA 3PVBB 3ZFEC 1ENXA 5FY1A 2FDKA 1A78A 3ACLA 1T2XA 1YQ5A 1RUD3 3AKSA 1Y9QA 5FJKA 5CAZA 1GWMA 5HV4A 3J4UH 1LHNA 2HKXA 3M70A 4GJYA 3FFZA 1DGWX 4KGGA 5A3MA 3E1F1 2DBNA 5FZ1A 5CFDC 4LTAA 2XJTA 3ECQA 2H0BA 2FDFA 1AR63 4MYEA 4AE2A 3UESA 2YY1A 2XH6A 1DLCA 1QQP1 2UYBA 4Y1VA 1IOAA 4IE7A 3WCRA 1YHFA 2D3SA 3VDAA 5C4WB 1EPZA 1ZYBA 4YM2A 5J98B 1QXJA 5I91A 4Z92B 1UOGA 3SCGA 5H9QA 4HG6B 1CAUB 2XQXA 1LU2A 1RUC2 2Q1FA 5FYBA 1OQEA 5DUVA 5EV7A 4F8AA 3KV9A 5HCAA 4NUBA 5GKAC 1SG3A 2A75A 3C7FA 3GCXA 4YFZA 1ENQA 2WKKA 1DGLA 1U0AA 1IZ3A 1WA4A 2PAMA 2VBBA 5CIRA 5DG1A 3FLTA 4BZ4A 4CCOA 2RS31 3J9SA 3UGHA 1FPN3 1QDOA 2XQRA 1BK0A 3UKTA 5EFUA 2QFEA 1Z78A 3ZXLA 2VZUA 3LB9A 1EV13 4RYDA 5F1RA 3NV2A 4LHNA 4N43C 4QX2A 4UFHA 1DQ4A 4CUAA 3JU9A 5C5TA 1MZEA 4PJYA 3WX5A 2WQ8A 1JODA 1YWKA 3POGA 5C6CA 3O1VA 1PGSA 2E6VA 4XETA 4NMIA 2R073 1R1A1 2WJSA 3POJA 1R1ZA 1WCDJ 1YEWA 2EXIA 2ZGQA 1AL21 1RJ8A 3OCPA 5HXVA 5GZCA 2W87A 3OY8A 2JG9A 1IS3A 3WP4A 2W39A 4AOCA 4BLIA 4CRQA 4N9HA 4QKNA 4E2GA 5FYZA 2VUJA 4A4AA 1G9DA 2RG4A 2Y38A 2R16A 5FWJA 1LOCA 3ACFA 1QH7A 3FUOA 4MZUA 2GC2A 3GZUC 3JBG1 5FY7A 2ZAAA 1RUOA 1ALYA 4CP1A 4MGTA 4OI0A 4D0QA 5CBLA 1JZ3A 1UPIA 4D3WA 1OUXA 4R9DA 5I0TA 2F17A 3PMSA 2P5BA 4PCRA 2R061 2D7FA 2ZGSA 3PIGA 1UX6A 4M0NA 4MGYE 5LEJA 5FY0A 1G86A 5FYTA 2QQPA 3D0JA 3ZFEA 3IIAA 1F31A 4IEPA 5JSRA 4WZFA 1AX1A 2ETEA 3TN93 3B94A 2YHJA 1UPSA 5H9PA 2GSYA 3VBFC 1ND2A 4KMQA 4YPJA 2GDFA 2IFWA 1PK6B 4PI2A 4DXZA 3VBSC 2K2SA 3KM5A 1DQ6A 3AP4A 2SBAA 4QGLA 2GMPA 5BNNA 5DZGA 2IC1A 4FPCA 2ZMKA 3POEA 2XHNA 1FX5A 5HBAA 3N9PA 3OG2A 4ZPIA 5CVRA 5LBCA 2VGDA 5BPXA 4LKEA 4DINB 3WDYA 3ZFFC 2G9ZA 1PK6C 1UZ0A 1W90A 2ZS6B 2VOTA 3KCYA 3RSJA 3UKNA 4NIHA 1QJY1 2OIIA 1EP0A 3OGVA 1RUJ3 1CIYA 4ORFA 4H7LA 5ABJB 1TMF3 1V6LA 2DF7A 2VNGA 4TLFA 5FZ9A 5LRSA 4XUPA 3W59A 3SH4A 2HWC2 4W65A 1MS0A 5FXVA 1L7RA 3NW4A 1UMIA 2A3WA 5A7WB 2R041 1CQ9A 4I3PA 2AACA 3O12A 3KF5A 1HXS3 4P9JA 4IDZA 4Y33A 4QU1A 2VZ3A 3WW3A 1NLRA 2BEOA 1HQWA 4IEUA 2ET1A 1JH5A 4MGKE 5CKMA 5A7QA 3VD7A 4GA9A 5IVVA 5JMOA 4CP9A 4ZXEA 1DQ5A 1XNCA 2Q1ZB 2YBPA 4BH9A 4GWJA 1OSGA 2WNVA 3WDTA 1OD5A 1F15A 1RXFA 3VDDC 1BYHA 4UF0B 2W1QA 3N9MA 5I8TA 2XVGA 5E6HA 1W2UA 2EAKA 1POV3 1RUH1 5FY4A 1H0BA 1B35B 4Y22B 1JMUB 1D7PM 2ET7A 4COYA 3H50A 5AFEA 4LBNA 3O1PA 3VHPA 1US3A 3CBNA 3VDDA 4FPHA 4AAPA 3WNKA 2X5IA 5FXZA 3W9AA 2A73B 1VB4A 1UKGA 2WABA 4YRDA 3WY6A 3DUIA 4JV4A 1U5XA 1WW4A 3WP6A 2RMU2 4M3CE 2MEV1 4BQYA 1K5JA 2ZX4A 3DCQA 1ZA4A 3N7JA 2D93A 3NKTA 1HRV1 5E1RA 1GUIA 3MIFA 3V64A 4D6QA 1JUHA 1GNYA 1V6MA 5KBFA 4EROA 4DUVA 1ASJ1 1X7NA 1Q8VA 1S2EA 3B93A 2OA2A 3KSCA 2WFF3 1TZOA 4XW3A 5H9RA 1STMA 1NA1C 3KQ4B 3RRDA 2BPA2 3ZYGA 2QQVA 4CP9B 2YROA 4WZCA 5C5UA 5C4WC 4Y5SA 5LRRA 2VMFA 1GWKA 2XJUA 1XC6A 4I30A 1CWPA 2UY9A 1REEA 1HIXA 3W5MA 3KCCA 5M0TA 4OHWA 2C9AA 4B29A 3HQUA 3WW4A 4AR2A 1CAVB 4FFHA 4NIGA 2VO5A 5D1IA 1HX6A 3M2MA 3VDDB 3UGGA 2KD7A 2VG9A 3BALA 2R071 2EAAA 1AUYA 1EV12 3BTYA 3FHQA 4LO8A 1RHI2 4NO4A 3GM8A 4MUVA 4FBFA 5GZGA 2W0XA 1WW7A 2QQIA 3AFKA 4F3JA 5AVAA 2D3RA 1PMHX 1RVF1 4XURA 2UWBA 4YW3A 1H9WA 4E9KA 4ASKA 2RMU1 1ZZCA 3JBG3 4DY3A 4LJHA 4ARYA 4K1ZA 2Z69A 4D7YA 1H8TB 4LUMA 4XF4A 1OVPA 1CPNA 1UD1A 1S0DA 3RS6A 4B4RA 3I2OA 1S2BA 1HKDA 2TNFA 1LODA 3J8F3 4JGYA 4CDXC 4SBVA 4FPOB 4O9EA 1YI9A 3J7HA 4V1PA 2WZEA 4ZXKA 1VMJA 4QPYA 1F4AA 5GZFA 1WWYA 1CJDA 5A3WA 3O0WA 4DNYA 2VC9A 5A3UA 3TN91 3BYWA 4AEDB 1OURA 4R9CA 1OVSA 4CCKA 1JYVA 3ZYJB 2WNOA 1J3PA 4P9XA 2DCYA 4YSFA 4CU9A 1OLRA 1JN2P 4K3UA 1JI6A 1SQ4A 4LORA 1PMIA 1QJEA 4FTSA 1J58A 5T5LA 5KHIA 4GIQA 2JIGA 5FOBB 3BIEA 2RM23 2DDUA 2XDVA 2ZAHA 3AX4A 2HWD3 1H8TA 4DB5A 4JTNA 1FOD3 5F5IA 5EXOA 1NA1A 2RS12 3EJKA 2G9FA 1J59A 1QOOA 1DGRN 4HK9A 5LA0A 3OF1A 1JYXA 3ZSMA 1S0BA 4XFBA 5FMOS 2PLV3 3ZDVA 4LK6A 4MSVA 4HK8A 1AHSA 2LUWA 3OPWA 4WM7C 1VE0A 2ORZA 3IN9A 2HWF1 1BEV1 4S2DA 2X5IC 2CWSA 1W99A 2HYKA 2O8QA 3OB8A 4JGYB 5IFPA 2O0OA 2G4IA 3PVEA 4XILA 2CV6A 2VMDA 4Q4X1 1RYYA 5EP9A 5F3GA 1H2MA 4RGGA 1DP0A 1GP6A 2JDZA 5CADA 2ZABA 1QF3A 5KHKA 3ZX7A 3ASIA 2DTYA 5D2AA 3FMGA 3ZIWA 4G4FA 3O1UA 1UU6A 4L0PA 4CEYC 4FPJA 3MLLA 4AEKA 4X6RB 1NCQC 5DDJ2 5IYYA 3HJRA 3KS7A 2A7AA 4CDWC 4XEZA 2BRTA 1V6IA 1VBC2 2WC2A 5FQ0B 1VIWB 5A33A 3MICA 4CE8A 4D7TA 1E5HA 5K7PA 3V0AA 4IEOA 2VNVA 2Y6HA 4B7EA 3GDBA 3NMBA 4L99A 1O3QA 1MS8A 4XXPA 2WLQA 4IE4A 3NJZA 1HJGA 2WZPP 1L7QA 1J1TA 3B5LB 2PAKA 2Y34A 2NMNA 2VZPA 3A4UA 4V2VA 5FZMA 2D6NA 1W03A 3JBG2 2VULA 5LATA 2Z79A 3C8XA 3VKFC 3WQBA 5BNQA 3ABZA 4IETA 1OMIA 2ES3A 2PA7A 1RUI2 2Y0OA 5F7UA 2XWBB 2NP0A 2XJVA 3B02A 1YIPA 3WDUA 3ACHA 3ZN4A 1GV9A 2J1RA 2WO7A 4CDQB 2HWF2 2B39A 4M3CB 1WMFA 5C3PA 2P6CA 2Y8KA 4G9SB 4AFBA 4OHXA 3ILRA 1W28A 2B9VA 3THPA 1G9AA 4PLOA 5BY5A 3VKOA 3ZFFA 4CXYA 1G9CA 1PM7A 3JD71 4BU2A 2XL9A 4KH9A 5HXMA 5JPMB 5K9YA 2YUEA 3N3HA 2HWB3 1W3XA 4Y1UA 1Y7BA 1UCXA 2IXLA 1HB3A 3HBKA 4LHKA 4UWDA 1VBD1 3IKWA 3KGZA 4IQPA 1NOVA 4WVZA 3U14A 3D4KA 3ALQA 4CP2A 1C8M3 2FMYA 3LPFA 2YZ4A 4FPKA 2AEZA 1HQLA 5FPXA 2DTWA 2R32A 1RUNA 3TN92 1EPWA 5KC5A 3T09A 3T0AA 1CONA 2VQ0A 3VZMA 1H9PA 1VBA3 3LFMA 4DQAA 2RMU3 4A44A 4A6SA 2VECA 4HPKB 1PIV3 3PURA 4QPGB 4LIUA 2QUOA 1UOJA 2AZ5A 4HVOA 1SCRA 5BNNB 1AR83 3B9IA 5BNPC 3T4HB 4COZA 3WQ7A 1EYBA 2YU2A 3M8LA 1VAVA 4NWVA 3L9JT 3LPGA 1OI6A 4B4QA 2DUPA 4UAPA 3RYPA 3MW3A 2A71A 4JGZA 2WO1A 4AG4A 2ZOEB 4FP3A 3ELNA 4W6XA 4OUEA 4QKBA 3VD5A 3HEIA 1ENRA 1HJFA 2WAAA 4CEWC 1H2NA 4DS0A 1YQ8A 2AR6A 2OYZA 3W20A 3SITA 5C9AC 1OPMA 1DHKB 4GJZA 3BU7A 2R072 3CL1A 3AZYA 3H1MA 1ODMA 2VD7A 1RJ7A 3ZMNA 4XQDA 2QQWA 3I2HA 5IVBA 3AMMA 3WOGA 5A70A 4HPKA 5I93A 1NLSA 4LA2A 3IDAA 4LQRA 4NHXA 3M4FA 1LHWA 4UW5A 3JD72 1URXA 2E7QA 3Q8CA 3T2TA 2A6WA 2Z42A 5A7SA 4GULA 4PHZA 2LALA 2ZEZA 4Q2FA 4QPGC 5FBZA 2XVKA 5J7MA 4WM8A 2W2IA 3S30A 3T08A 2A6VA 4EYUA 1LOGA 5GZDA 4HN0A 1AL23 1X82A 3AP9A 1NCQB 2DCTA 4GWNA 2VTXA 1YI7A 1Q3EA 3AYDA 3MI8A 3MW4A 2VXJA 5FYYA 5C7GA 1UN1A 3TEXA 3MF9A 2VOWA 2MHFA 4OVEA 1ZX5A 3OSDA 5LBFA 3AL6A 4PQ9A 4YW5A 4QD2A 1HRV2 1WW6A 2XG3A 5I0RA 3VBRC 1RTVA 3APBA 1SDWA 3MIDA 1W04A 4YWAA 2FDIA 2JB4A 3S5AA 1UYYA 1N3PA 1VRH3 4P5HA 1QJX2 1BCXA 4YZ2A 3IDEA 2I07B 1IS6A 1EY2A 4JGYC 2D5FA 4JRAA 3RZMA 5JOWA 2Z4FA 3LA3A 3WHTA 3ZFGA 4NJ4A 2F4PA 1W0NA 1YFUA 2LM3A 5FPBA 4BLJA 4BISA 1POV1 1RUH3 1ULEA 2QZ3A 4NHYA 4CDUB 4KGQA 4P00B 3GZTB 1WD3A 4BM8A 4AVAA 3K51A 2ZMLA 4CUGA 1S0FA 1W3VA 3CZUA 2ZHLA 4HZFA 3ZPYA 2J1AA 1XNBA 2PHXA 2RR11 2HLEA 2QQMA 5F3EA 2GMMA 3VZLA 1JOJA 3P3PA 4BYYA 3Q9OA 3AC0A 5IUQA 1XNKA 1NZCA 2ZGPA 5TSWA 2SLIA 2FDGA 1T6BX 4BOWA 1QHDA 2HBUA 3KMHA 3GZEA 1ASJ3 4URTA 1VB2A 2XVLA 4CTEA 5DAPA 3U37A 1JHJA 2WFF1 4Q4V2 4Y4RA 4DXSA 1BEV2 1O3TA 2LS6A 2RS11 3SCFA 4FAGA 4D7SA 2D6PA 2VNOA 5T55A 2OT7A 3I2IA 4EZ4A 2XJPA 1ZZ9A 1RUF3 1EUUA 1JUIA 5C4WA 5FDBA 1RUJ2 4KWUA 1DQ2A 5FTTC 1GU3A 4NE9A 3DYPA 4YYOA 5IK7A 2W9XA 4QB6A 1ZA7A 5A1FA 2C1FA 4K7JA 1Q43A 5A6XA 1MS9A 4FT8A 4AGGA 1QJY2 3I49A 2Q4SA 4PBPA 3IB3A 2IXIA 3OD4A 1RB8G 1CPMA 1GP5A 2H6BA 4BXFA 3ZFGB 4BQ2A 3NJVA 5DAVA 2YC4A 4JDNA 3IIIA 4WM7B 1DZQA 1UW8A 2VCBA 4YVSA 5FWEA 1UO9A 3FLRA 4CDUA 4LT5A 2VQUA 2I2SA 3I2KA 1W2TA 3MUY1 4MXVA 3T1LA 1GZWA 5CU1A 4ZU4A 5H9SA 1S2KA 3ZDSA 4WV8A 2CTVA 3N7MA 4EN8B 1ZNPA 4K40A 2ZGTA 4ZONA 2JECA 5F39A 1KJLA 5LCWL 5IK5A 1TVGA 2R062 4XDOA 3BI3A 3LIGA 1J3QA 5IW0A 1AR82 1F5FA 1WD4A 2EALA 4Q4W2 4GKXA 5J09A 4N90A 2DVBA 1AR61 2ZGLA 4UYBA 5A7WA 2WZ8A 3H1YA 1GICA 5F5AA 4N43B 2RS51 3JQWA 1VBA2 4XFFA 1ZRFA 2W94A 1ULCA 3VBUA 5IVYA 1CZSA 1IQDC 1OUSA 2VNRA 5AVPA 4Z2AA 4OUMA 4QU2A 1LOBA 3O14A 3CZJA 3M1HA 3U11A 1FI2A 1DZTA 1RHI1 3IM0A 3KB5A 4K9SA 3D5OA 3V0BB 3E5QA 4LO4B 2V5DA 1OBNA 4ZU7A 1R1A2 3RGBA 2RS33 2XB6C 3IPVA 4OZOA 1BBT2 1BJQA 1AR72 1VBB3 2FD8A 4XOGA 4OULA 1ENSA 3HR9A 1K45A 4QDSA 1Z0HA 1WCQA 2BOIA 1PNGA 5KR7A 2WAOA 5A3LA 5CFCC 4EJRA 1BXHA 4GXLA 4L2NA 1RUE2 2WNEA 1DGRA 4B8EA 4JVAA 3L2HA 1QNYA 3CKHA 3WNLA 2N7GA 5A7PA 4RSUA 1PK6A 1MPXA 3OYWB 1ZZ6A 1XYPA 5CNAA 5J3UA 3S57A 3OGRA 2DCZA 4M0HA 5FXXA 5FYUA 3BIWE 3T1MA 3KV4A 3PJYA 5A32B 5L73A 4XZUG 3DV8A 4AAXA 3KD4A 3N9NA 2WZR2 3KHBA 1O5UA 2VOXA 3CJIB 3LEKA 3MFAA 4UFMA 2QNKA 4Q4X3 2HBTA 1REDA 2MPFA 5L19A 1WCUA 1LCLA 1KGYA 4MOAA 1KFUL 2ID4A 1JW6A 4RQPB 5FO9B 4NPLA 2ZA9A 1D4M3 1AR92 1MVQA 1IKPA 1OQ1A 4P9YA 4KWLA 4RS5B 4AI8A 1QJZA 4DUXA 4JZRA 3VBRA 4ITCA 1IS4A 2VJXA 1KXGA 1AZDA 1VBC3 3C7OA 3AZWA 3RWNA 4X6QB 3BU0A 1XE0A 3THTA 1H8VA 4H3WA 3VN4A 3UNPA 1FNZA 1N47A 5F5QA 1SEFA 4CCDA 1LRHA 1YQ6A 4ZHNA 3D82A 2XGXA 2ZEXA 4LA3A 3E97A 1ZBA3 5DZEA 1O8PA 4GAZA 3VD9A 2NPIA 2R042 4QQLA 4WM8C 3D8CA 2PMWB 4QPIA 5DUUA 4Q1PA 4QPGA 2ZHNA 3J7MA 1X8EA 3PUQA 4IV3B 4UF0A 4DXTA 3NO8A 4BQ3A 2BP6A 4DOUA 4HSLA 4GKYA 4NPMA 4RQPA 4YM3A 3PUIA 5D8AC 4UOJA 5DABA 1HV1A 1Z7S3 1WGPA 3C3VA 3RMXA 5HI0A 4JDMA 5IK8A 3ROUA 5C71A 3GCWA 2PAEA 5CFDB 5SV5A 4W50A 4Y20A 3LSEA 4EN6B 2XR4A 3MV01 4N53A 1X9TA 3LA7A 4Z1VA 3P1IA 5FBJA 3FWEA 1JZ2A 5F3CA 2PHLA 3AJZA 3HAGA 1O7FA 3OUIA 1NKGA 3TOJA 4LK7A 2VZRA 1BEV3 1W2AX 4FOWA 4P14A 4BQXA 2PHFA 1BBT1 4ZZ8A 3T2PA 4IERA 1R083 2VUCA 3MGUA 4RHV1 2ZGRA 2WWUA 1YFYA 3M3EA 4FXGB 3LIHA 4CVUA 3AP5A 5F2SA 4BMEA 5T50A 4EN0A 3LKJA 1AYN2 4COVA 5JWPA 1CX1A 4C1WA 3HNMA 1U5YA 4IV3A 3S7EA 5FZGA 3EHKA 5EJ3A 5IATA 3I3DA 5AC92 4NIDA 2JE7A 1PX3A 2WA3A 2XBO1 3POFA 1VLNA 2ZGUA 1ZRIA 2ZEYA 3RZLA 2KXLA 2JDMA 4PDWA 4YVSB 1V6OA 3QH7A 5C8CC 5T5PA 1UKRA 1AYM2 1C5HA 4AFAA 2PQSA 2P3IA 3A0NA 4IV1C 4AFDA 4E4DX 2AYHA 2JKBA 2E33A 3BTXA 3AFGA 5FK7A 2CGPA 3LDRA 3DKQA 3LDBA 1HRI2 1VRH2 4HSJA 3FBMA 1S0JA 4A2UA 5C33A 1UOBA 2XL7A 2BFUL 2AUYA 2B45X 2DU1A 4XF0A 1FYUA 3FC0A 2XJQA 1HRV3 5F6KA 3JCIA 4W4ZA 5LBBA 5J48A 2QQLA 1I5ZA 1LECA 1MS1A 2GU9A 1CZVA 1MZ6A 1PVC1 5FMCA 2XKPA 4CSWA 5FP3A 5FY8A 5SV8A 1SDDB 4QKFA 1NUKA 1ZZ7A 2HEWF 2XUMA 3GHMA 5EJ1B 5JMCA 1W2OA 2R7EB 3GALA 2VY0A 2J22A 3GBWA 2LTNA 4OMDA 5E88A 4AVTA 4B3NA 3Q8EA 4Q0UA 1LOFA 2VVDA 4IXLA 3ZXEA 5FY5A 4CU7A 5C9AB 4XDPA 2QJVA 4LEJA 3FFQA 3VKNA 1HDKA 2QCSB 1UQXA 3U78A 1VJ2A 4Y3OA 4LBOA 1DG6A 4LO5B 4AFMA 4BPZA 5FREA 3AKQA 3HIFA 1UZVA 5HCBA 2W1WA 4R4ZA 2VW0A 4AZZA 3VDBA 1I5PA 1AXKA 5A6QA 2YYOA 4MO3M 1W6PB 3PNAA 2CYFA 4URAA 1LKNA 4HVRA 1B35A 4L97A 4NRMA 1SPPA 1H4GA 3VBOC 2XLAA 4P9GA 1RXGA 3VZJA 5FOJB 3SH5A 1V9U2 3VZNA 3FHIB 1S0GA 2YDEA 1QGLA 1KFXL 1UMZA 2NYYA 3THDA 1MZFA 1ZBE2 2JB8A 2X8KA 4CU6A 1POV0 3WW1A 1CJPA 1JZ6A 2CL2A 3HN1A 2GN7A 2Y6LA 1LNSA 2ZACA 1BK1A 5FKCA 1K3IA 2QBXA 1MQTC 1PO23 1QJU2 2VH9A 4JCKA 4NR1A 5GZEA 2W1SA 1GOFA 1SCSA 3ENRA 1SZBA 5KHHA 2P34A 1Q8OA 3A23A 4Y4YA 2ADEA 2EXKA 3K77A 4TZDA 2WO2A 1AX0A 5CZKA 1C57A 5KXCA 4IGQA 4QQOA 4J1XA 2VPVA 3I8TA 4QXCA 4UFLA 5KWRA 2VVEA 4XUQA 2YPDA 1LEMA 1MS4A 2Q8EA 5FZ8A 1R092 5JXGA 1RIRA 4X8PA 3K75B 4A45A 1EAH3 1DYPA 2EA7A 2W95A 1PO11 3LCPA 3R4DB 4MGZE 3RJRA 3DPRB 3TB0A 2RVAA 3ZYFA 2JG8C 2OPWA 3V56A 3ZPOA 4H7MA 5IWFA 1DQ1A 3OBTA 5CG8A 1OF4A 2BZDA 3N9OA 4UW3A 5CYYA 3RZGA 4B7KA 4HKOA 4XJWA 3FLPA 5IVJA 1AXYA 4CUCA 1RUG2 4PIZA 1HV0A 5LY1A 4RFRB 3PL0A 1YYNA 3NV1A 2HH9A 4QM9A 2ZTNA 5FZIA 4DUWA 3VZOA 4KBZA 1JOBA 4P9WA 2G9GA 1OPOA 1TMF2 5L7OC 1MEC1 3FN9A 3CJIA 3AYEA 3JD73 3G7DA 4MGSA 1RUF1 3BPZA 3N7LA 3NVCA 3ZXGA 1OKQA 1OH3A 4A7ZA 1GANA 4LNVA 4DEQA 1SMVA 1C28A 1KEXA 2DBIA 2HWB1 2WA4A 3A0KA 3R4SA 4K21A 3RVHA 3VD4A 3PMEA 4C90A 3B01A 3DPRA 3ACGA 4XF1A 5IHRA 1UY0A 1C8M1 1I9RA 4LKDA 5HPOA 5JAXA 3SNMA 1TNRA 1R081 3KV6A 4PLMA 2EIDA 3GGLA 3R0RA 4RHV3 4J25A 3UKVA 3WQ1A 3T2QA 1PO12 4CXXA 5A1AA 1R091 1AX2A 4KNCA 4BE3A 1N1VA 2DVAA 2PHRA 5A80A 1UYPA 2JX9A 2MNGA 1WLWA 3ON7A 4CA9A 5IJRA 1O4TA 4P08A 1W05A 3VLBB 4JC1A 1XXNA 1CAXB 1OOPB 2QVSB 2YPJA 3J8F1 4I01A 5D21A 5JSOA 2RDRA 4RD7A 5FYVA 1QQP3 3HOBA 5L9BA 4DIQA 1GLHA 4R8HA 4YG6A 3UGFA 4KBBA 1DLLA 3WV6A 5F6LB 4AEDC 1AJKA 4FFGA 2VZSA 4Z07A 4YW6A 5A3NA 3K48A 3VHRA 4BQWA 3IMNA 2ZX0A 5JI9A 4AVSA 4Q26A 1ZBE1 4RS5A 4QB2A 5J96B 1H1MA 4H55A 1O8SA 5FXWA 5AFBA 2JDPA 1AJOA 3I59B 4I0AA 2A70A 1DIWA 3AVSA 2RM21 1ZM1A 2NZ9A 3TWIA 3H7YA 1VBD2 2OZJA 1OC1A 3K46A 5F5CA 3BB6A 5B4NA 5BNOB 4CUBA 2D5HA 3RZJA 4LOSA 5FYMA 2HEYF 2OZ6A 4FQ4A 4EV0A 2E26A 2W1UA 1KS5A 1LENA 3SKJE 1OOPC 3HT2A 3O0VA 1VBD3 3B7MA 5BXXA 1H2KA 1ND2B 3IAPA 3JB4C 2QZ2A 2WYFA 3IWZA 3E6CC 4DPNA 2JWPA 4BQ5A 1ZZ8A 1J83A 1UX7A 3P3NA 1RVF3 3DL3A 1HRI1 3SQOA 1I1EA 2VCMA 1IPKA 3EBRA 1XU1A 3KVBA 3USUB 4XQ4A 2XMLA 2VZQA 4C1XA 3I59A 4ATFA 3AZXA 5CFCB 1NT0A 3GF6A 4NN0A 3WNPA 5EYYA 1XOYA 4NRQA 5DQ0A 2Y6GA 1RINA 2VOVA 3FE5A 4KWKA 3POBA 1UU5A 4QHOA 2XBO2 3ZMOA 3OGSA 1NX9A 4NHKA 2IVJA 4Q4W3 3ZIXA 2ORXA 2VQAA 4O65A 1YQCA 2DUOA 3NJXA 5LB6A 1D0HA 1S1AA 1W6QB 1XB9A 3VL8A 1QEXA 4FPYA 1ZRRA 4M00A 2K9ZA 5DDJ1 2XKOA 3ZXAC 1WLDA 1XE7A 1RVF2 3IZOA 4UI9L 4W6YA 3VUOA 3H8RA 4UFIA 2DVDA 1PGW2 3CEWA 3J7NA 5A3TA 5L7OB 4LLOA 2D40A 3LE0A 2Q8CA 1QXRA 3O1TA 3UT0A 3VHNA 1JS9A 1ZBA1 4QX7A 4W8JA 4GMP3 4Q8KA 2ILMA 2W08A 3GZAA 2FDJA 1GZCA 2ZZQA 1HQNA 2CDOA 4QDQA 3NV3A 4XBNA 5LBEA 3ZXFA 1BMV1 2WNVB 3S0MA 2C26A 4JX0A 4O61A 4HLTA 5K4LA 3HBZA 4IEQA 4S2HA 2GC1A 4GH4C 1OH4A 1CAUA 5JZGC 1X33A 1OD3A 4PIXA 4FFIA 3K2OA 1QXPA 2C5DA 1UY2A 2Q0AA 3S5QA 1W6QA 5EYXA 1AXZA 3WF1A 4Q4Y3 4MADA 1OF3A 4WVVA 1DYOA 2Z2SB 1HB2A 3KT4A 2GNTA 3EO6A 4A6OA 3EB7A 4HONA 2JDHA 4P5YA 1HXS1 2WYSA 3BN6A 3A22A 4EWEA 3TYJA 5LK5A 4W6WA 1S0CA 4QWNA 1MS5A 1XYOA 1KDKA 1GNZA 3ORJA 3ES4A 1RUG1 5FV3A 4I3GA 5ABJA 2WS93 3W58A 5LW9A 1R64A 4NOTA 2PXJA 5L9RA 4CCNA 4YG3A 3L2YA 4YLZA 2V09A 2YXSA 3D3AA 1C8NA 3LF7A 1NE6A 1D2QA 2X10A 2X05A 1N1YA 3WQ0A 4AI0A 2DWRA 3ZLIA 1AR91 1NE4A 2XLGA 4E2SA 5FPLA 4AEMA 2E51A 4TWTA 1G6NA 2WR9A 3CMGA 2Q1MA 1Q8PA 1YFWA 2VMCA 2JG9C 4BIOA 4UBGA 1SBEA 3VB9A 3M3CA 4RGAA 2UY8A 5FLHA 1W0PA 3OYWA 3SKVA 1SFPA 2OKXA 2RJLA 2W5FA 1JZ7A 1NQDA 3V0AB 4NROA 1H1IA 3RYKA 4HMZA 5JR7B 2NN8A 1RHI3 5JOZA 2VZTA 3QOPA 3VD3A 1COV1 1S0EA 4QKDA 5FK8A 3IDBB 5FMOL 3ACIA 2D3PA 4JKLA 1LEDA 1WCKA 2V5YA 3ZFFB 2B8MA 1KRIA 1GBGA 3B9CA 1W9SA 1NYWA 3OD0A 3U10A 4L11A 3AXDA 3AYAA 4E2QA 4Y5TA 3FL7A 1G9BA 2FQPA 5FZ7A 1Q56A 2RV9A 1GOGA 4XIOA 3HVDA 1LAJA 3O1MA 2ERFA 1XNDA 5ANQA 4CZSA 1S55A 4KI5M 4YGBA 1DCSA 2IXHA 4YZ1A 2VMHA 4KQ7A 4QDRA 1X8MA 5B2GB 1GR3A 1LJ7A 2A5ZA 1GSLA 2JE9A 4QX1A 3ZKYA 2FZ2A 5D8AA 3LZZA 4KWJA 3HPNA 4YVWC 3USSA 4GQ7A 2BBAA 1W8OA 1PVXA 5FZ6A 5K0UA 5C70A 1Y4WA 2O14A 1ULGA 3T0DA 1L7LA 2PHWA 5CFDA 3SH3A 2VBDA 1E5IA 1VBA1 3NNLA 1C1FA 1VMHA 1WBLA 3NAPB 4AQ6A 1SBFA 3BCWA 1VRH1 1N3OA 3NJYA 5E16A 1KS4A 4HL0A 5E89A 3ES1A 4XQWA 5A7OA 1JTZX 5BUVA 2FCUA 4AEDA 2D6MA 3INAA 1OFNA 3O5SA 1YC61 1X9PA 4Q4W1 4XE9A 4ET7A 2I74A 1C3HA 1TME1 3DYOA 5KXEA 4LBLA 3ZSKA 5GLVA 3I3MA 4BWOA 5JXIA 1XQNA 3EQEA 4YM1A 3H9AA 2D6LX 4BQ1A 3FJSA 3MW2A 4Z8BA 3IBMA 1PGL2 2ZHMA 2Y6KA 2ARXA 3NNJA 4R52A 2VCAA 4PDWB 4ES9A 5FP4A 2E9QA 3NNMA 4N7UA 4XF3A 4JQRA 4TSVA 3THCA 4XTPA 1OFSA 3LWCA 2R0FA 5FPUA 1UNBA 3NAPA 1IG0A 4COWA 1H30A 3P6BA 1DDLA 3I3EA 4QGMA 3H3LA 1FATA 2LRPA 3AMHA 4PF1A 5JZGA 2P37A 3CIHA 5K0UB 5FZ3A 4BK4A 3CU7A 4XIKA 1MEC3 1N3QA 5ACA1 2CNAA 3DPRC 1ZREA 2HWE3 4E4SA 3EXUA 4UT5A 1GYKA 4CDXB 4EE2A 1JXNA 5EWSA 1RMU2 4RA0A 4JTOA 2XWJB 1BQPA 1COV2 3PU3A 2D43A 1F35A 2NM1A 3O0XA 2XXZA 3JZVA 4KG8A 3VZKA 3MV11 1QU0A 4JQTA 5GJ6A 4FAHA 1OLME 1UIKA 2ZXQA 5F8PA 5JVVA 2YU1A 4GZ9A 3CJXA 2AC1A 1Q8QA 1RUG3 2YC2A 4LULA 4FTBA 2C0ZA 1CIWA 2EXJA 3KLSA 4QQ2A 1W39A 3T0BA 4J6GA 2JICA 2YC0A 4Y26A 1GQPA 1FMD3 4QQHA 1W0OA 2ZX3A 3DF0A 4OFGA 1F2NA 4YGCA 3H42B 3WP5A 2H6CA 3OGGA 3PU8A 4OMCA 5JUVA 1UZWA 2Q5TA 4Q0PA 4I0WB 1DF0A 4QX0A 5FPVA 1D4VB 5LA1A 4GMP0 4XC9A 1XSQA 1W6PA 2O1QA 1FMD2 2IXKA 3B69A 3X29B 3WXPA 2ZGMA 3PHMA 2Y33A 2R6QA 2RR13 2WDBA 4SLIA 2PN5A 2XJSA 4WM8B 4DRRA 1GNHA 3FX3A 4FOQA 4HETA 2C6SA 1C8M2 5T3NA 2TUNA 2WT0A 1TG7A 3CDZB 2YFUA 3NQHA 2WSVA 1LU1A 1MQTA 1YFXA 2WZR3 2YV8A 1ULOA 2V73A 4XJ9A 4CDUC 2WN3A 1DBNA 1MACA 4I09A 3VBHA 5C3SA 1CAWB 1A34A 4Q0SA 1HN0A 1VBB1 4IEWA 1G7YA 5F9TA 4FQZA 1FPN1 2ZEWA 3WEZA 1KJRA 4A3XA 3AVRA 5BNNC 4OHYA 2ATFA 4OI1A 5KXDA 4BXSV 1GQGA 1B35C 5LZ6A 1XYNA 4CCCA 2WLPA 3RMYA 3U75A 3WT3A 4Y24A 3NNFA 3WR0A 3WNNA 1GZ9A 3OEBA 4JGZB 3AKTA 1BMV2 2VVFA 1FOD2 3Q8BA 3E6DA 1K5MB 5LA9A 3WG1A 1A6CA 2EIGA 3DKWA 2X29A 5FFOC 2X5IB 1BBT3 4KU7A 4QX5A 4CP0A 5FIXA 2P3YA 2RS32 1HW5A 4DEVA 3MLKA 1OKOA 1NLQA 4C0HA 5A1LA 3ITQA 4BMBA 4AGRA 2PYTA 2WRAA 2BNNA 2DVGA 5GM0A 3DXUA 1RUC1 2RS52 4E4HA 3T4VA 5FLJA 2ZPXA 5T54A 5A6ZA 2OS2A 2CU5A 4Y20B 3IMMA 5JOYA 2BWAA 1CAWA 2D98A 2XBO3 3B00A 3JXSA 1A8MA 1AR62 2LROA 2GP5A 2Y0IA 4M3CA 5FUIA 5IT6A 3R4UA 1AR81 3R6SA 4LLFA 1N1SA 2VL4A 4ISQA 2BV4A 4FO9A 2XOMA 3DYMA 4XUOA 4IEZA 2JE8A 4LBQA 4RR3A 1ND2C 3LD8A 3N7KA 3VBFA 4CXWA 4EWDA 5KHJA 3WP3A 3PIJA 5FRAA 4FFFA 1TME3 2R1BA 1OA4A 2B42B 1W8UA 2NLRA 4OHZA 4Q29A 2WUHA 3WW2A 3LOIA 4PDWC 1ND3A 1W8ZA 2HJIA 1LR5A 3WNXA 4EN9B 1BVP1 3F95A 2JEMA 3WSOA 4YZ5A 2Y64A 1AYN3 4LHSA 4S2GA 1TNFA 3ZM8A 4TN7A 4ASMB 2XPJA 4IV3C 3ILNA 1QJFA 1M06G 1YJKA 4EWAA 4LE4A 4YVWA 5FZAA 2VMIA 2JD9A 4HANA 4DRVA 5IVEA 1LTEA 5GLZA 5JDBA 4OI4A 5LEKA 5G05L 3HD8B 5LA2A 2AGSA 1RUE3 2CGNA 2BOJA 5IK4A 1HLCA 2EIBA 2J1TA 1YUDA 4LKSA 5FUNA 1Y9GA 5FZEA 4ARXA 5J37A 1DGWA 1UY3A 1UZZA 1V0AA 3VBHC 4BB3A 4JHTA 3LSDA 4AHYA 4WVMB 2RM22 2HWE1 3NWKA 1IG3A 5FY9A 3MPPG 1IHMA 3I3BA 4YG0A 1OT5A 2VBPA 4LBKA 3POWA 1NQJA 3I2DA 3MO4A 2CY6A 3M7AA 4XJ8A 2FBEA 4QX8A 4JDOA 1WW5A 4ISRA 1PVC2 5FZ0A 3TEYA 1Z7S2 1CR7A 3ZN6B 1VALA 1X36A 2K46A 2RR12 3LDKA 4FPGA 3RG0A 4ZKTB 2DCJA 4HKWA 3ZFEB 4FPLA 4AW7A 1PX4A 3M3QA 1XU2A 2OX0A 4IE6A 4XMIA 3VL9A 4I2OA 3N9LA 1NCRB 5IAVA 3VBRB 5JOXA 4XFCA 5C9AA 4XAEA 1JHNA 4F7ZA 1VBE2 3RJ2X 1PO21 3RPQA 2AH2A 5FZKA 1IS5A 4AHZA 4AWDA 4QPIC 4FXKB 1TME2 3D6EA 4PI0A 3K4DA 4XBLA 3J8F2 1QOTA 2PQQA 5FMDA 3GHNA 5KHGA 2GH2A 4COUA 1QKQA 4L9BA 2OW4A 3GBGA 4NPRA 2CDPA 5FPZA 1VBE1 1EAH1 4BIFA 1JBCA 3MHZA 3AMPA 1PO13 1QJX3 2BNMA 2WO3A 3KZ4C 3U07A 4IGPA 2VZOA 5G04L 3G6JB 2VUAA 1UXZA 3WUCA 4D6RA 4AF9A 2Q8DA 1ULDA 3LEIA 4Y22A 4XCBA 1APNA 3ZXJA 2JD4A 4XDQA 5F37A 2FZ1A 1XBFA 3B3QE 3MYXA 2JDYA 5HCHA 2MEV3 1V9U3 2RE9A 1PVC3 2DYCA 5T52A 4N7IA 1O91A 4DZGA 2W46A 4DXRA 4ATEA 5A3OA 2HWE2 4WBBA 4XJUA 1O5LA 5APAA 3CLPA 2FCTA 2WBKA 3D0SA 1OQDA 2GNDA 2GH8A 2CAVA 4FOYA 4MX3A 1O3SA 4LIVA 1LGBA 1EUTA 1M4WA 2BERA 3C7EA 3HMYA 3VHOA 4QPIB 4QMAA 4Q4V3 3V0BA 4MHRA 3BGAA 4GH4A 3H1WA 4N8MA 5I8SA 4META 3IAQA 2E32A 2IUWA 3OOXA 3K3NA 4Q1RA 4XTMA 3SLIA 4DO0A 3PVOA 5DPNA 2EIEA 5BNPB 2FHRA 2IWGB 2R0HA 3U0ZA 3ZYHA 1YLLA 3KCXA 3TEWA 2B5HA 1UAIA 2ZGOA 3BOWA 4BCUA 3WG2A 3I2FA 4BQ4A 2G1MA 2J1EA 3AP6A 3UJQA 5A6YA 4XFHA 1AF9A 4QXHA 1JZ4A 5ANNA 1PM4A 2CAUA 4A41A 3RZZA 1GKBA 1O4YA 3DN7A 2KA3A 1GFF2 2DVFA 4D6SA 4TTGA 2CGOA 2VMGA 4XJZA 5FP7A 2B4KA 1KD7A 1RC6A 5CA6A 4M3CF 5KXBA 4LBQD 2JENA 3HNYM 3GJAA 4IE0A 1ND3B 4FP2A 5C8CA 2BBVA 4MH0E 4UFKA 3H8UA 2NMOA 4YW7A 5FZLA 4KU8A 3H3UA 2XJRA 5CB7A 2XONA 2ZMNA 2OQ6A 5A7NA 3VKLA 5C3QA 5JSPA 1K5MA 1YCIA 2Y60A 5CKNA 2R49A 3QACA 3PLQA 2VUDA 4GB33 4EQVA 3H8XA 2BQPA 2L9LA 3N35A 3ZKUA 3V65A 5GALA 2Q30A 1JYIA 4XYXA 4LUKA 1UYXA 4NVPA 4PT6A 4IV1B 1R082 3IDCB 2VAUA 1W9YA 1QH6A 1G8WA 2LW8A 2P6HA 2QKDA 3M3IA 1JU3A 2P3JA 4GWIA 4YVSC 3RYRA 3DEMA 1D0GA 1ACCA 1GMMA 2IXCA 1QJY3 3BVCA 3DGTA 4JRLA 4XVHA 2QDRA 1RUE1 2A3XA 3JQXA 4Z2WA 3ZSLA 1Y3TA 4OYUA 5LK7B 4ONUA 2DFCA 2WNUA 4NIIA 3ZYPA 4RQPC 3OPTA 2JDAA 3OUHA 3H8OA 5JPNB 2E53A 2XHKA 3UL2A 1JYNA 5EZWA 3N9QA 4LHLA 5EIYB 3MF6A 5FYSA 1FPN2 1SACA 2PHTA 4DMIA 5CEHA 3AL5A 1NY72 2Z5WA 3ZYBA 5F3IA 3GNEA 4XBQA 4LBQB 1NCRC 3S6PA 3SISA 3WCSA 3K4AA 4C91A 3MIGA 1H6XA 1YQ2A 5FPAA 2YB7A 4ZS3A 3VBOB 4B1LA 1K12A 2P1BA 4RR3C 4GALA 4XUTA 1XRUA 2KM2A 1D4M1 3AKRA 1JZ5A 4NRPA 3PUHA 5CISA 1YXWA 1GZTA 2WN2A 4A7KA 4AI9A 1AYM1 3ZYIB 4JKKA 1YNAA 1UYZA 3UV9A 1VBC1 3HN3A 1CGPA 4Q8LA 5BV6A 4S2FA 4RN5A 4AVVA 1RUH2 3W5NA 4CCLA 5ABJC 1LOAA 1SLTA 1WUVA 2J7MA 2ZGKA 4N9IA 1O3RA 2VU9A 5DDJ3 3KGLA 1ZZBA 4QPWA 5FYHA 3WD5A 3URFA 3WVJA 4IUGA 4C8DA 4IGOA 1ZRCA 2WT2A 1PO22 1QJU3 1UY4A 3TNQA 1W6NB 5DG2A 1LESA 1ODNA 4HFSA 5BYNA 2B7YA 3SEPA 2P4EA 2QQUA 3Q8FA 3LOBA 1BZWA 2RDQA 2QQNA 1ZBE3 2QDNA 1COV3 1VMFA 5FZHA 2WFPA 1Z7S1 3WLUA 1DZRA 1NG0A 4E27A 4MVTA 4YW2A 1RUJ1 5DZFA 1MQTB 3QBQA 2PLV2 5T5JA 3WF0A 1LULA 4AL9A 4AVCA 4QB1A 1J1LA 2ARAA 4K1YA 1W9FA 2VTFA 3BODA 3F2ZA 4UXAA 1SFNA 4ZZ5A 1CN1A 5FLIA 1UMHA 5DXDA 3CJIC 2BGPA 4Q4V1 4MG2A 2ZGNA 4NAMA 4OQ8A 1UXXX 2GC3A 2R043 4I02A 2X53S 1XNTA 4Z82A 2ZZJA 2GZWA 2R30A 1OA2A 2JDNA 3J26N 2YFZA 5HV0A 4Q0QA 2CSGA 3WHUA 3JB8A 5IVFA 3WINE 1W9TA 5FZ4A 4IE5A 2RHPA 5I8YA 2DU0A 3VBUC 2F6BA 2Y6JA 3KVAA 5B4XA 4NWWA 2X09A 1J3RA 4XCAA 1ZRDA 4AXOA 4QQPA 1QIQA 3PJQA 2JG8A 1VPHA 1WA6X 4FCAA 4CDQA 2GP3A 3I2JA 1U5ZA 2A3YA 4YZ3A 2E63A 4AYUA 2V4VA 3ZO0B 3PUSA 1W6OB 4Q5OA 3ZXDA 3OY8B 3AMNA 3O1OA 5D8AB 1AVBA 1V00A 2W91A 1CD3G 2WL1A 3K3OA 4JGZC 5DUWA 4QHZA 1WZXA 4MV2A 4DFSA 3E6BA 2BYVE 4LOTA 4H14A 2BFUS 3H7JA 1Q8SA 1AL0G 4J1WA 5IAXA 1NXD1 3LEGA 2YBKA 2OXBA 2O8OA 2PHUA 5AC93 3VBFB 1CAXA 1NY71 1OOPA 2I45A 4X8NA 5FKBA 1B09A 1W8WA 3U4XA 3A21A 3OBZA 3OBRA 3MBWA 4V2WA 2ZJCA 3I3QA 5FAXA 4IEYA 3KT7A 3VBOA 3POSA 2UYAA 4K8FA 1GZWB 3MFCA 2YGMA 5J1XA 2HYXA 3AM2A 4AQ2A 1EV11 4D69A 3ZR6A 3WNMA 3PDQA 4NHLA 4MXWA 1FOD1 1US2A 1TQ5A 5EQUA 4Q4Y2 4HVQA 1RUF2 4RS5C 2VZ1A 3NAPC 4XUNA 1TEIA 1SLCA 1VBB2 1SPPB 3N36A 2DCKA 2IXJA 1AR71 4R4XA 1FV3A 4FI9A 3I7DA 3UJOA 1LOFC 4LPLA 3C2UA 1UU4A 1F8VA 3U4SA 3AP7A 5I0UA 2MEV2 2Q8OA 1CVNA 5C8CB 2UWCA 2BVVA 2BW8A 2VR4A 1P8JA 3WF2A 3ZYRA 4GWMA 2ARBA 3KF3A 2E7AA 1QQP2 1JYWA 4HOOA 3RI8A 1U12A 4CPBD 1F5JA 5DN2A 3IT8A 3IPVB 2AREA 3VBSA 5JXHA 3NSTA 2D6OX 5BNOC 4EN7B 1BHGA 4Q27A 4YFWA 4L92A 3ZFGC 2R063 5FZDA 2Y26A 3WG3A 3QLQA 1AYM3 2RDNA 1VAMA 1PZ9A 2DFBA 5FZBA 4ES8A 2H0VA 2WQ4A 4YARA 1X50A 4OI2A 3LEMA 5LASA 1VBE3 4AVBA 1UWWA 2JJ6A 3O1SA 2GC0A 3EYPA 4FPFA 2F4LA 1YJLA 3EMRA 1UY1A 4P9LA 1QNWA 2E31A 3POIA 5K0UC 1SLAA 4XAAA 2VE1A 4NAOA 1E5SA 2BVBA 2PELA 3TBDA 4AI1A 1NXMA 4O7XA 3WUDA 3GBFA 4CEYA 1C4RA 4LE3A 1V9U1 1RMU1 4R9BA 2A6YA 1Y43B 1DFQA 2FMDA 2XLFA 3VBSB 3VV1A 3BUCA 2EVXA 2R1DA 2AENA 4BHPA 1JYTA 4PQQA 4IEXA 2C4XA 2BTVC 2QQOA 4M01A 4WM7A 5C3OA 2ZKLA 4YNIA 5JIUA 4IL7A 4XHBA 1I3HA 1VP6A 5GLWA 1F4HA 4N43A 2BU9A 3SXWA 3OPZA 4LO6B 4XXAA 4K20A 1FV2A 3NKGA 4XJAA 5FZOA 3RFRA 3VBUB 4AGVA 1PGL1 1ONAA 1OLMA 2QQKA 3J7LA 5F32A 1LGCA 2WS91 2FCVA 4CU8A 3CO2A 1E57A 5GLTA 1H8TC 5JI7A 2VW2A 4EZHA 2P2KA 4LMFA 5FCCA 1LHVA 5KC6A 4D94A 2V4AA 5A32A 3WDWA 1R093 2KR2A 4OCTA 4RL7A 2QTWB 5JZGB 4BA6A 4UW6A 3WF3A 2W47A 1T6GC 2EICA 4XABA 1XE8A 1WBFA 1SFYA 5JXJA 1L3JA 1RUD1 4RFT0 3KHCA 1PMJX 4JHZA 2XUEA 1HB1A 1RGSA 2Y6FA 3NNGA 3OTFA 2BDRA 4TXWA 1C1LA 1U5IA 4XHXA 2GAUA 5F2WA 4A3ZA 4QHBA 3S7IA 4XFAA 1BVVA 5JCTA 4YW4A 4JKMA 1OHFA 2DUQA 3POYA 2D97A 3TNPB 3ZN6A 2GNBA 2VCCA 5FUPA 2B9UA 3A7QA 2RS53 3I97A 3KWVA 2BGOA 4INDA 2NQYA 3H3ZA 3QCWA 3BKZA 5FZOB 1IPJA 1ULPA 4CDXA 3RDIA 4Q4X2 3BTAA 1LHOA 1SHWB 1XNAA 1AL22 1Y9MA 3QH6A 2ZX2A 4P02B 5J36A 3TEZA 5BNOA 2D6KA 2HWC3 4RHV2 3VDCA 3SMHA 2A6ZA 4QM8A 5C8WA 3WDXA 2PFWA 5JLVA 1OLQA 4F83A 4AHWA 4OQ9A 2AEYA 3GYDA 4A42A 1QWRA 4ZS2A 3FUQA 2VXRA 2WSUA 3AK0A 3MEPA 2WWSA 1A3KA 4LBMA 4MGIE 1ZVFA 1SLLA 1W9WA 3PTYA 2JG9B 2OUJA 1KDMA 3AZVA 2IZWA 3FBYA 5L9VA 1O59A 4Y5Z0 4K6BA 2GN3A 4E8DA 2J42A 2PLV1 2WWJA 1LB2A 1AR73 3AZZA 4OZXA 4H2AA 4XF9A 5HCFA 3AJYA 3TRSB 1OXCA 5FYIA 2ZCWA 2WT1A 5IFTA 2WNUB 1E5RA 1W6OA 3LFIA 2TBVA 1HRI3 1DQ0A 5IVCA 2E7TA 2BUKA 2RJKA 4BK5A 4CCJA 2P17A 3FHAA 3SHRA 1RUC3 3UYJA 3VKMA 3ZSEA 5FZCA 2VMEA 3RI9A 2FDHA 1KQRA 4GB32 3ZVXA 1MZ5A 5K8SA 1VAKA 1GOHA 3ETPA 2DV9A 2W92A 2IVIB 3UETA 1YIFA 5DUXA 4CCEA 3RWKX 2W68A 4OHVA 1JZ8A 2UWAA 2HEVF 1PIV2 2JXAA 4M4PA 3UK9A 4CDWA 5CKQA 1H6YA 1NCQA 1WMDA 1W8TA 1W2NA 3WZ1A 5DAWA 5DAXA 3E5UA 1V6JA 3JUUA 1REFA 3K4ZA 3ZSJA 4BDVB 1W6MB 4HKLA 3SEEA 2BGCA 2JDKA 3MIHA 2OPKA 4HN1A 4GH4B 2A1XA 3HT1A 4P9IA 3AMQA 1LGNA 1FNYA 1WCSA 4OUSA 5EPAA 1QDCA 4GMP1 2BNOA 5FYCA 1VRBA 2WNVC 4Y1ZA 4CDQC 2WZR1 2HWB2 1Q5OA 2OQ7A 4N53C 2D44A 1JOPA 1RMU3 5DAQA 5ISLA 2DURA 2J1SA 2PHDA 4PLNA 4ZY9A 4PIYA 3SCHA 3WG4A 4IW3A 4CEWB 3VGIA 1HXS2 2ENRA 2JDUA 4XPVA 3HNBM 3MIEA 2GMEA 1MEC2 3P5BA 3ST7A 3O7OA 4U2AA 5EJZB 2GNMA 1V6KA 5GLUA 5EHDA 4NIAA 4AI3A 4E4ZA 2JKXA 1ND3C 2W3JA 4Q4Y1 4IEVA 4LBJA 1NAEA 3CQOA 5JIAA 2VZVA 1J84A 3ZR5A 1LOEA 1PZ8A 1PNFA 3OUJA 1RUI1 5FR3A 1ASJ2 1MVEA 2P3KA 3KV5A 3O1RA 1YO8A 1ZBA2 2VOKA 3ATGA 1FAYA 3BTZA 3GJBA 1PHMA 3AYCA 2YG0A 4UW4A 3CF6E 1QMJA 2ZBJA 4CYDA 2C24A 1IPSA 1HN1A 5LY2A 4XFGA 3RQ0A 4MXWB 4AHXA 1WLCA 2JIJA 2TEPA 1BLZA 3HQXA 4TLGA 3H0OA 4KG0A 3BOPA 1EAH2 1IQAA 3CNAA 1PGW1 4E8CA 1UZYA 5FO7B 3ETQA 1PIV1 2QQJA 2RJ2A 4MLOA 3T2OA 1VR3A 4YVWB 2EF6A 1AR93 4AFCA 4U36A 1W8NA 1KITA 2CHHA 3ZOIA 4YGEA 3BPSA 4I0BA 1G9FA 2RDSA 4YZ4A 3FZ3A 3OEAA 3PTRB 4QXKA 4YGDA 2K0GA 3DECA 2BWCA 4XFIA 1W8HA 2B46X 2GALA 4JAAA 4LITA 1QOSA 3MZHA 4LKFA 1CAVA 4WVMA 1QJU1 1MR5A 1CZTA 5FP8A 4GB31 4FSJA 3LGRA 3ZXKA 2W52A 4AEJA 1SLIA 4AK3A 3HQRA 5I0DA 4QAWA 3W21A 2G19A 2JG8B 3C7HA 4QGNA 4XZPA 3I4IA 3LA2A 3OJBA 3ME2A 5FQ0A 2HWC1 3USUA 1NZIA 3E5XA 2YMZA 5CFCA 2WIIB 4UBHA 4QXBA 3KT1A 4Q0VA 2RS13 1WMXA 2HWD1 1FT9A 4HBNA 1QY4A 1NCRA 4FOVA 5ACA2 1SBDA 5L7OA 1K42A 3MIBA 1F9KA 5DMYA 2HWD2 3I54A 4KL1A 1WKYA 1ST8A 3C7GA 4IESA 4LO7A 5JR2A 4FTEA 1CX4A 1R1A3 1W6NA 2V72A 1UIJA 2VW1A 3Q8AA 4K8RB 4R9AA 4MGQA 3I2GA 5FZFA 4XMAA 1UF2C 2ADDA 3R05A 2WNUC 1S0IA 2ZKNA 3ILFA 4PBOA 1YRZA 4FVVA 1JU4A 2WFF2 4RR3B 2OUHA 4C0BA 2HWF3 2ZX1A 3PVNA 2EXHA 3ZN5A 3NL1A 1D2SA 3AXEA 4O9GA 2OVUA 2IFRA 1GQHA 1TE1B 1MS3A 1WMEA 4YM0A 4RGKA 4NHMA 1IKQA 1OA3A 3GXUA 2CWMA 4M4RA 4XACA 1XSRA 5FJHA 2ARCA 5E8AA 4Y1XA 4CEWA 1POQA 1RL3A 1ULFA 3QD6A 4ZU5A 3WNOA 4AQTA 1H2LA 1O4ZA 1XJAA 3VBHB 4DY5A 1JYCA 1UOFA 1C5IA 1WLTA 4LR4A 1IGOA 4QX3A 1UL9A 1V70A 2UU8A 2C9KA 1K5MC 5BNPA 3MDPA
chains in the Genus database with same CATH topology
3T08A 2JDAA 2J1UA 1JYNA 5EIYB 4UI9L 3LE0A 2VM9A 3K4AA 4W8JA 1H6XA 1YQ2A 3MUZ1 2YB7A 4D8MA 2CDOA 1K12A 4QDQA 4XUTA 3WF4A 1JZ5A 2C26A 1UYYA 4JX0A 3PUHA 2WN2A 4JKKA 1UYZA 2J1VA 1OH4A 2Z4FA 1XPWA 3HN3A 1OD3A 1W0NA 1UY2A 4RN5A 5C7GA 3W5NA 4P00B 3LQCA 2J7MA 3WF1A 4MADA 1OF3A 1DYOA 4A6OA 4QPWA 3EB7A 3CZUA 4P5YA 2WYSA 2J1AA 4IUGA 2HLEA 2QQMA 3BN6A 1UY4A 3A22A 3SEPA 3AC0A 4BJ0A 1R64A 2QQNA 2VQTA 3NRUA 3U37A 4DXSA 1JHJA 3OBAA 3D3AA 2LS6A 1T2XA 2X10A 2X05A 3I2IA 4QB1A 3F2ZA 2VTFA 3E1F1 4ZZ5A 1EUUA 3ECQA 1UMHA 4KWUA 1GU3A 3CMGA 2BGPA 3DYPA 2VMCA 2W9XA 3UESA 4QB6A 1DLCA 3VDAA 1UXXX 3SKVA 1XNTA 2OKXA 2W5FA 1JZ7A 3IB3A 4HG6B 2XQXA 2YFZA 3NJVA 2YC4A 3IIIA 1W9TA 2VCBA 2VZTA 1SG3A 3C7FA 3VD3A 2VQUA 3I2KA 2Y6JA 3MUY1 5B4XA 3ACIA 2X09A 4JKLA 1W9SA 2VZUA 5LCWL 3I2JA 1TVGA 4RYDA 3FL7A 2RV9A 1GOGA 4QX2A 4CUAA 2V4VA 2WQ8A 4KI5M 2W91A 2WZ8A 2W94A 4QDRA 1CZSA 1IQDC 2W87A 4QX1A 4Z2AA 3HPNA 3LEGA 3CZJA 2BBAA 4A4AA 1W8OA 5C70A 3T0DA 3ACFA 2V5DA 3A21A 3MBWA 4OZOA 4D0QA 5J1XA 2HYXA 1JZ3A 1K45A 4QDSA 1WCQA 3WNMA 2WAOA 1US2A 2VZ1A 3CKHA 3WNLA 4XUNA 1MPXA 2DCKA 3OGRA 4ET7A 4FI9A 3DYOA 4LPLA 4KMQA 4YPJA 4XZUG 5JXIA 4AAXA 3LEKA 2VR4A 2Y6KA 1P8JA 2XHNA 3WF2A 2VCAA 3OG2A 1JYWA 1KGYA 4MOAA 3THCA 5DN2A 2ID4A 1UZ0A 2VOTA 5JXHA 1BHGA 3P6BA 3I3EA 3OGVA 4DUXA 4PF1A 3CIHA 1CIYA 2VJXA 4BK4A 3C7OA 3UNPA 4XUPA 1UWWA 3EYPA 1UY1A 1L7RA 2E31A 1UMIA 2ZEXA 3MV11 3VD9A 2ZXQA 1O8PA 4GZ9A 2VZ3A 2YC2A 4DXTA 3VD7A 5JMOA 4ZXEA 3T0BA 3PUIA 4UOJA 4GWJA 1GQPA 5C71A 4PQQA 2W1QA 4W50A 4OMCA 2C4XA 5JUVA 2QQOA 4QX0A 3MV01 5LA1A 3P1IA 1JZ2A 1D7PM 1F4HA 1US3A 1NKGA 3WNKA 2WDBA 2VZRA 2WABA 4ZZ8A 2QQKA 3T2PA 4CU8A 4CVUA 1GUIA 1TG7A 2YFUA 3CDZB 3NQHA 3WNNA 1GNYA 1ULOA 2WN3A 1CX1A 3HNMA 3I3DA 3WF3A 2W47A 2EICA 1PX3A 5JXJA 2ZEWA 2VMFA 2ZEYA 3WEZA 1PMJX 4JHZA 1XC6A 3NNGA 4BXSV 4TXWA 4A3ZA 3W5MA 2PQSA 4JKMA 3OEBA 2VO5A 2E33A 2KD7A 2VCCA 3A7QA 3I97A 2BGOA 3FHQA 1ULPA 4DEVA 3GM8A 4W4ZA 1SHWB 2QQIA 2QQLA 1XNAA 1CZVA 4P02B 1PMHX 4XURA 3VDCA 1SDDB 1NUKA 4ARYA 5EJ1B 3JXSA 2R7EB 2J22A 4OMDA 5FUIA 4DUVA 4CU7A 2VL4A 4A42A 3J7HA 2XOMA 2WZEA 3DYMA 4XUOA 2JE8A 1W9WA 1F4AA 2W1WA 1O59A 4E8DA 3VDBA 2VC9A 1I5PA 4MO3M 1JYVA 5IFTA 2WUHA 4CU9A 1JI6A 4BK5A 3THDA 3FHAA 3WSOA 4CU6A 2Y64A 4LHSA 3ZM8A 2VMEA 1JZ6A 2Y6LA 1LNSA 2JD9A 1K3IA 2QBXA 2DDUA 1GOHA 3ETPA 5G05L 5LA2A 2W92A 2W1SA 3UETA 1GOFA 2EIBA 2J1TA 3A23A 3K77A 4LKSA 1JZ8A 2WO2A 1UY3A 5CZKA 4M4PA 5LA0A 1H6YA 4XUQA 1JYXA 5JXGA 4A45A 3K75B 3I3BA 1OT5A 3K4ZA 4BDVB 2W95A 3MO4A 3SEEA 2RVAA 2ORZA 1W99A 3OB8A 5IFPA 1OF4A 2VMDA 2BZDA 1RYYA 5CYYA 2DCJA 1PX4A 1DP0A 4CUCA 2J1SA 4ZY9A 4DUWA 4L0PA 5IYYA 3HJRA 3HNBM 3K4DA 3FN9A 5EJZB 4MGSA 2CDPA 2JKXA 2W3JA 2Y6HA 3GDBA 1NAEA 3CQOA 4DEQA 2VZVA 1J84A 2WO3A 4ARXA 1KEXA 3VD4A 2VZOA 5G04L 3ACGA 1L7QA 1UXZA 5IHRA 1UY0A 3LEIA 5HPOA 2VZPA 2YG0A 3C8XA 2EIDA 3GGLA 3WQBA 1HN1A 3ABZA 3T2QA 5F7UA 2W46A 4DXRA 5A1AA 3ACHA 2J1RA 4E8CA 2WBKA 2QQJA 2RJ2A 2Y8KA 5IJRA 3T2OA 4P08A 2B9VA 1W8NA 1EUTA 3C7EA 2BERA 5HXMA 3BGAA 3HOBA 3OEAA 3DECA 4CUBA 3IAQA 2E32A 5DPNA 2EIEA 3LPFA 2VZSA 1CZTA 5I0DA 4QAWA 3I2FA 2J1EA 3C7HA 1JZ4A 3T09A 3T0AA 4QB2A 1O8SA 4A41A 4TTGA 4A44A 2B4KA 3K46A 5B4NA 3HNYM 1K42A 5DMYA 1WKYA 3C7GA 5JR2A 2E26A 2W1UA 3LPGA 4UAPA 3SKJE 2V72A 2WO1A 3WF0A 4AG4A 2XONA 4MGQA 3I2GA 3IAPA 4OUEA 3VD5A 3HEIA 1JU4A 2WAAA 2L9LA 1J83A 1UX7A 1UYXA 4PT6A 3GXUA 4M4RA 3I2HA 2VZQA 2LW8A 1JU3A 4GWIA 3IDAA 4LQRA 3WNPA 1GMMA 3WNOA 4XVHA 5DQ0A 2Y6GA 2ZEZA 4QX3A 4OYUA 3OGSA 1NX9A 2C9KA 2ORXA 3NJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T08 A;  2JDA A;  2J1U A;  1JYN A;  5EIY B;  4UI9 L;  3LE0 A;  2VM9 A;  3K4A A;  4W8J A;  1H6X A;  1YQ2 A;  3MUZ 1;  2YB7 A;  4D8M A;  2CDO A;  1K12 A;  4QDQ A;  4XUT A;  3WF4 A;  1JZ5 A;  2C26 A;  1UYY A;  4JX0 A;  3PUH A;  2WN2 A;  4JKK A;  1UYZ A;  2J1V A;  1OH4 A;  2Z4F A;  1XPW A;  3HN3 A;  1OD3 A;  1W0N A;  1UY2 A;  4RN5 A;  5C7G A;  3W5N A;  4P00 B;  3LQC A;  2J7M A;  3WF1 A;  4MAD A;  1OF3 A;  1DYO A;  4A6O A;  4QPW A;  3EB7 A;  3CZU A;  4P5Y A;  2WYS A;  2J1A A;  4IUG A;  2HLE A;  2QQM A;  3BN6 A;  1UY4 A;  3A22 A;  3SEP A;  3AC0 A;  4BJ0 A;  1R64 A;  2QQN A;  2VQT A;  3NRU A;  3U37 A;  4DXS A;  1JHJ A;  3OBA A;  3D3A A;  2LS6 A;  1T2X A;  2X10 A;  2X05 A;  3I2I A;  4QB1 A;  3F2Z A;  2VTF A;  3E1F 1;  4ZZ5 A;  1EUU A;  3ECQ A;  1UMH A;  4KWU A;  1GU3 A;  3CMG A;  2BGP A;  3DYP A;  2VMC A;  2W9X A;  3UES A;  4QB6 A;  1DLC A;  3VDA A;  1UXX X;  3SKV A;  1XNT A;  2OKX A;  2W5F A;  1JZ7 A;  3IB3 A;  4HG6 B;  2XQX A;  2YFZ A;  3NJV A;  2YC4 A;  3III A;  1W9T A;  2VCB A;  2VZT A;  1SG3 A;  3C7F A;  3VD3 A;  2VQU A;  3I2K A;  2Y6J A;  3MUY 1;  5B4X A;  3ACI A;  2X09 A;  4JKL A;  1W9S A;  2VZU A;  5LCW L;  3I2J A;  1TVG A;  4RYD A;  3FL7 A;  2RV9 A;  1GOG A;  4QX2 A;  4CUA A;  2V4V A;  2WQ8 A;  4KI5 M;  2W91 A;  2WZ8 A;  2W94 A;  4QDR A;  1CZS A;  1IQD C;  2W87 A;  4QX1 A;  4Z2A A;  3HPN A;  3LEG A;  3CZJ A;  2BBA A;  4A4A A;  1W8O A;  5C70 A;  3T0D A;  3ACF A;  2V5D A;  3A21 A;  3MBW A;  4OZO A;  4D0Q A;  5J1X A;  2HYX A;  1JZ3 A;  1K45 A;  4QDS A;  1WCQ A;  3WNM A;  2WAO A;  1US2 A;  2VZ1 A;  3CKH A;  3WNL A;  4XUN A;  1MPX A;  2DCK A;  3OGR A;  4ET7 A;  4FI9 A;  3DYO A;  4LPL A;  4KMQ A;  4YPJ A;  4XZU G;  5JXI A;  4AAX A;  3LEK A;  2VR4 A;  2Y6K A;  1P8J A;  2XHN A;  3WF2 A;  2VCA A;  3OG2 A;  1JYW A;  1KGY A;  4MOA A;  3THC A;  5DN2 A;  2ID4 A;  1UZ0 A;  2VOT A;  5JXH A;  1BHG A;  3P6B A;  3I3E A;  3OGV A;  4DUX A;  4PF1 A;  3CIH A;  1CIY A;  2VJX A;  4BK4 A;  3C7O A;  3UNP A;  4XUP A;  1UWW A;  3EYP A;  1UY1 A;  1L7R A;  2E31 A;  1UMI A;  2ZEX A;  3MV1 1;  3VD9 A;  2ZXQ A;  1O8P A;  4GZ9 A;  2VZ3 A;  2YC2 A;  4DXT A;  3VD7 A;  5JMO A;  4ZXE A;  3T0B A;  3PUI A;  4UOJ A;  4GWJ A;  1GQP A;  5C71 A;  4PQQ A;  2W1Q A;  4W50 A;  4OMC A;  2C4X A;  5JUV A;  2QQO A;  4QX0 A;  3MV0 1;  5LA1 A;  3P1I A;  1JZ2 A;  1D7P M;  1F4H A;  1US3 A;  1NKG A;  3WNK A;  2WDB A;  2VZR A;  2WAB A;  4ZZ8 A;  2QQK A;  3T2P A;  4CU8 A;  4CVU A;  1GUI A;  1TG7 A;  2YFU A;  3CDZ B;  3NQH A;  3WNN A;  1GNY A;  1ULO A;  2WN3 A;  1CX1 A;  3HNM A;  3I3D A;  3WF3 A;  2W47 A;  2EIC A;  1PX3 A;  5JXJ A;  2ZEW A;  2VMF A;  2ZEY A;  3WEZ A;  1PMJ X;  4JHZ A;  1XC6 A;  3NNG A;  4BXS V;  4TXW A;  4A3Z A;  3W5M A;  2PQS A;  4JKM A;  3OEB A;  2VO5 A;  2E33 A;  2KD7 A;  2VCC A;  3A7Q A;  3I97 A;  2BGO A;  3FHQ A;  1ULP A;  4DEV A;  3GM8 A;  4W4Z A;  1SHW B;  2QQI A;  2QQL A;  1XNA A;  1CZV A;  4P02 B;  1PMH X;  4XUR A;  3VDC A;  1SDD B;  1NUK A;  4ARY A;  5EJ1 B;  3JXS A;  2R7E B;  2J22 A;  4OMD A;  5FUI A;  4DUV A;  4CU7 A;  2VL4 A;  4A42 A;  3J7H A;  2XOM A;  2WZE A;  3DYM A;  4XUO A;  2JE8 A;  1W9W A;  1F4A A;  2W1W A;  1O59 A;  4E8D A;  3VDB A;  2VC9 A;  1I5P A;  4MO3 M;  1JYV A;  5IFT A;  2WUH A;  4CU9 A;  1JI6 A;  4BK5 A;  3THD A;  3FHA A;  3WSO A;  4CU6 A;  2Y64 A;  4LHS A;  3ZM8 A;  2VME A;  1JZ6 A;  2Y6L A;  1LNS A;  2JD9 A;  1K3I A;  2QBX A;  2DDU A;  1GOH A;  3ETP A;  5G05 L;  5LA2 A;  2W92 A;  2W1S A;  3UET A;  1GOF A;  2EIB A;  2J1T A;  3A23 A;  3K77 A;  4LKS A;  1JZ8 A;  2WO2 A;  1UY3 A;  5CZK A;  4M4P A;  5LA0 A;  1H6Y A;  4XUQ A;  1JYX A;  5JXG A;  4A45 A;  3K75 B;  3I3B A;  1OT5 A;  3K4Z A;  4BDV B;  2W95 A;  3MO4 A;  3SEE A;  2RVA A;  2ORZ A;  1W99 A;  3OB8 A;  5IFP A;  1OF4 A;  2VMD A;  2BZD A;  1RYY A;  5CYY A;  2DCJ A;  1PX4 A;  1DP0 A;  4CUC A;  2J1S A;  4ZY9 A;  4DUW A;  4L0P A;  5IYY A;  3HJR A;  3HNB M;  3K4D A;  3FN9 A;  5EJZ B;  4MGS A;  2CDP A;  2JKX A;  2W3J A;  2Y6H A;  3GDB A;  1NAE A;  3CQO A;  4DEQ A;  2VZV A;  1J84 A;  2WO3 A;  4ARX A;  1KEX A;  3VD4 A;  2VZO A;  5G04 L;  3ACG A;  1L7Q A;  1UXZ A;  5IHR A;  1UY0 A;  3LEI A;  5HPO A;  2VZP A;  2YG0 A;  3C8X A;  2EID A;  3GGL A;  3WQB A;  1HN1 A;  3ABZ A;  3T2Q A;  5F7U A;  2W46 A;  4DXR A;  5A1A A;  3ACH A;  2J1R A;  4E8C A;  2WBK A;  2QQJ A;  2RJ2 A;  2Y8K A;  5IJR A;  3T2O A;  4P08 A;  2B9V A;  1W8N A;  1EUT A;  3C7E A;  2BER A;  5HXM A;  3BGA A;  3HOB A;  3OEA A;  3DEC A;  4CUB A;  3IAQ A;  2E32 A;  5DPN A;  2EIE A;  3LPF A;  2VZS A;  1CZT A;  5I0D A;  4QAW A;  3I2F A;  2J1E A;  3C7H A;  1JZ4 A;  3T09 A;  3T0A A;  4QB2 A;  1O8S A;  4A41 A;  4TTG A;  4A44 A;  2B4K A;  3K46 A;  5B4N A;  3HNY M;  1K42 A;  5DMY A;  1WKY A;  3C7G A;  5JR2 A;  2E26 A;  2W1U A;  3LPG A;  4UAP A;  3SKJ E;  2V72 A;  2WO1 A;  3WF0 A;  4AG4 A;  2XON A;  4MGQ A;  3I2G A;  3IAP A;  4OUE A;  3VD5 A;  3HEI A;  1JU4 A;  2WAA A;  2L9L A;  1J83 A;  1UX7 A;  1UYX A;  4PT6 A;  3GXU A;  4M4R A;  3I2H A;  2VZQ A;  2LW8 A;  1JU3 A;  4GWI A;  3IDA A;  4LQR A;  3WNP A;  1GMM A;  3WNO A;  4XVH A;  5DQ0 A;  2Y6G A;  2ZEZ A;  4QX3 A;  4OYU A;  3OGS A;  1NX9 A;  2C9K A;  2ORX A;  3NJX A; 
#chains in the Genus database with same CATH topology
 1RIT A;  2J1U A;  4G3Y C;  3SC7 X;  1QJX 1;  5A3P A;  3M3O A;  5LWB A;  3RZH A;  1GP4 A;  2A6X A;  1D4M 2;  1RUD 2;  3NV4 A;  3TAY A;  4FPE A;  5I0S A;  2WS9 2;  1LHU A;  1FXZ A;  5ERL A;  4L8Q A;  5AC9 1;  4CPB A;  2YBS A;  4OLL A;  4N53 B;  4B1M A;  1AYN 1;  1GWL A;  2VM9 A;  3KQR A;  3T30 A;  2YGL A;  5CG9 A;  1SLB A;  1V6N A;  1NA1 B;  3MPB A;  3MUZ 1;  4AI2 A;  4CCM A;  4YW1 A;  2VTX J;  4D8M A;  4TYS A;  3WDV A;  4WVW A;  5FP9 A;  3T3Y A;  3N4M A;  3HWJ A;  3WF4 A;  5C3R A;  5FO8 B;  1DU3 D;  1S4C A;  1CES A;  4HT1 T;  4CEY B;  4B4P A;  3OGJ A;  2WQZ C;  5ACA 3;  2J1V A;  1TMF 1;  4MHU A;  1XPW A;  4LXL A;  4PF5 A;  5L36 A;  1BKZ A;  3AKP A;  4QT6 A;  1A8D A;  4Y1Y A;  3AB0 A;  3LQC A;  2ZHK A;  2BJS A;  3CHX A;  1HB4 A;  4UFJ A;  2PTM A;  3DXT A;  1W06 A;  1W6M A;  4HXC A;  4GD4 A;  1O6U A;  4A7Y A;  1RUI 3;  2WIN B;  3U1X A;  1I6X A;  1DYK A;  1PZ7 A;  5T5O A;  4CDW B;  3MLJ A;  1H1A A;  1H4H A;  5FMB A;  4AQS A;  3RZK A;  4BJ0 A;  4ASL A;  2UUR A;  1N1T A;  2QE3 A;  5A33 B;  2VQT A;  3NRU A;  3LAG A;  1FMD 1;  3PUA A;  1W8F A;  3OBA A;  4IV1 A;  3RNS A;  3PVB B;  3ZFE C;  1ENX A;  5FY1 A;  2FDK A;  1A78 A;  3ACL A;  1T2X A;  1YQ5 A;  1RUD 3;  3AKS A;  1Y9Q A;  5FJK A;  5CAZ A;  1GWM A;  5HV4 A;  3J4U H;  1LHN A;  2HKX A;  3M70 A;  4GJY A;  3FFZ A;  1DGW X;  4KGG A;  5A3M A;  3E1F 1;  2DBN A;  5FZ1 A;  5CFD C;  4LTA A;  2XJT A;  3ECQ A;  2H0B A;  2FDF A;  1AR6 3;  4MYE A;  4AE2 A;  3UES A;  2YY1 A;  2XH6 A;  1DLC A;  1QQP 1;  2UYB A;  4Y1V A;  1IOA A;  4IE7 A;  3WCR A;  1YHF A;  2D3S A;  3VDA A;  5C4W B;  1EPZ A;  1ZYB A;  4YM2 A;  5J98 B;  1QXJ A;  5I91 A;  4Z92 B;  1UOG A;  3SCG A;  5H9Q A;  4HG6 B;  1CAU B;  2XQX A;  1LU2 A;  1RUC 2;  2Q1F A;  5FYB A;  1OQE A;  5DUV A;  5EV7 A;  4F8A A;  3KV9 A;  5HCA A;  4NUB A;  5GKA C;  1SG3 A;  2A75 A;  3C7F A;  3GCX A;  4YFZ A;  1ENQ A;  2WKK A;  1DGL A;  1U0A A;  1IZ3 A;  1WA4 A;  2PAM A;  2VBB A;  5CIR A;  5DG1 A;  3FLT A;  4BZ4 A;  4CCO A;  2RS3 1;  3J9S A;  3UGH A;  1FPN 3;  1QDO A;  2XQR A;  1BK0 A;  3UKT A;  5EFU A;  2QFE A;  1Z78 A;  3ZXL A;  2VZU A;  3LB9 A;  1EV1 3;  4RYD A;  5F1R A;  3NV2 A;  4LHN A;  4N43 C;  4QX2 A;  4UFH A;  1DQ4 A;  4CUA A;  3JU9 A;  5C5T A;  1MZE A;  4PJY A;  3WX5 A;  2WQ8 A;  1JOD A;  1YWK A;  3POG A;  5C6C A;  3O1V A;  1PGS A;  2E6V A;  4XET A;  4NMI A;  2R07 3;  1R1A 1;  2WJS A;  3POJ A;  1R1Z A;  1WCD J;  1YEW A;  2EXI A;  2ZGQ A;  1AL2 1;  1RJ8 A;  3OCP A;  5HXV A;  5GZC A;  2W87 A;  3OY8 A;  2JG9 A;  1IS3 A;  3WP4 A;  2W39 A;  4AOC A;  4BLI A;  4CRQ A;  4N9H A;  4QKN A;  4E2G A;  5FYZ A;  2VUJ A;  4A4A A;  1G9D A;  2RG4 A;  2Y38 A;  2R16 A;  5FWJ A;  1LOC A;  3ACF A;  1QH7 A;  3FUO A;  4MZU A;  2GC2 A;  3GZU C;  3JBG 1;  5FY7 A;  2ZAA A;  1RUO A;  1ALY A;  4CP1 A;  4MGT A;  4OI0 A;  4D0Q A;  5CBL A;  1JZ3 A;  1UPI A;  4D3W A;  1OUX A;  4R9D A;  5I0T A;  2F17 A;  3PMS A;  2P5B A;  4PCR A;  2R06 1;  2D7F A;  2ZGS A;  3PIG A;  1UX6 A;  4M0N A;  4MGY E;  5LEJ A;  5FY0 A;  1G86 A;  5FYT A;  2QQP A;  3D0J A;  3ZFE A;  3IIA A;  1F31 A;  4IEP A;  5JSR A;  4WZF A;  1AX1 A;  2ETE A;  3TN9 3;  3B94 A;  2YHJ A;  1UPS A;  5H9P A;  2GSY A;  3VBF C;  1ND2 A;  4KMQ A;  4YPJ A;  2GDF A;  2IFW A;  1PK6 B;  4PI2 A;  4DXZ A;  3VBS C;  2K2S A;  3KM5 A;  1DQ6 A;  3AP4 A;  2SBA A;  4QGL A;  2GMP A;  5BNN A;  5DZG A;  2IC1 A;  4FPC A;  2ZMK A;  3POE A;  2XHN A;  1FX5 A;  5HBA A;  3N9P A;  3OG2 A;  4ZPI A;  5CVR A;  5LBC A;  2VGD A;  5BPX A;  4LKE A;  4DIN B;  3WDY A;  3ZFF C;  2G9Z A;  1PK6 C;  1UZ0 A;  1W90 A;  2ZS6 B;  2VOT A;  3KCY A;  3RSJ A;  3UKN A;  4NIH A;  1QJY 1;  2OII A;  1EP0 A;  3OGV A;  1RUJ 3;  1CIY A;  4ORF A;  4H7L A;  5ABJ B;  1TMF 3;  1V6L A;  2DF7 A;  2VNG A;  4TLF A;  5FZ9 A;  5LRS A;  4XUP A;  3W59 A;  3SH4 A;  2HWC 2;  4W65 A;  1MS0 A;  5FXV A;  1L7R A;  3NW4 A;  1UMI A;  2A3W A;  5A7W B;  2R04 1;  1CQ9 A;  4I3P A;  2AAC A;  3O12 A;  3KF5 A;  1HXS 3;  4P9J A;  4IDZ A;  4Y33 A;  4QU1 A;  2VZ3 A;  3WW3 A;  1NLR A;  2BEO A;  1HQW A;  4IEU A;  2ET1 A;  1JH5 A;  4MGK E;  5CKM A;  5A7Q A;  3VD7 A;  4GA9 A;  5IVV A;  5JMO A;  4CP9 A;  4ZXE A;  1DQ5 A;  1XNC A;  2Q1Z B;  2YBP A;  4BH9 A;  4GWJ A;  1OSG A;  2WNV A;  3WDT A;  1OD5 A;  1F15 A;  1RXF A;  3VDD C;  1BYH A;  4UF0 B;  2W1Q A;  3N9M A;  5I8T A;  2XVG A;  5E6H A;  1W2U A;  2EAK A;  1POV 3;  1RUH 1;  5FY4 A;  1H0B A;  1B35 B;  4Y22 B;  1JMU B;  1D7P M;  2ET7 A;  4COY A;  3H50 A;  5AFE A;  4LBN A;  3O1P A;  3VHP A;  1US3 A;  3CBN A;  3VDD A;  4FPH A;  4AAP A;  3WNK A;  2X5I A;  5FXZ A;  3W9A A;  2A73 B;  1VB4 A;  1UKG A;  2WAB A;  4YRD A;  3WY6 A;  3DUI A;  4JV4 A;  1U5X A;  1WW4 A;  3WP6 A;  2RMU 2;  4M3C E;  2MEV 1;  4BQY A;  1K5J A;  2ZX4 A;  3DCQ A;  1ZA4 A;  3N7J A;  2D93 A;  3NKT A;  1HRV 1;  5E1R A;  1GUI A;  3MIF A;  3V64 A;  4D6Q A;  1JUH A;  1GNY A;  1V6M A;  5KBF A;  4ERO A;  4DUV A;  1ASJ 1;  1X7N A;  1Q8V A;  1S2E A;  3B93 A;  2OA2 A;  3KSC A;  2WFF 3;  1TZO A;  4XW3 A;  5H9R A;  1STM A;  1NA1 C;  3KQ4 B;  3RRD A;  2BPA 2;  3ZYG A;  2QQV A;  4CP9 B;  2YRO A;  4WZC A;  5C5U A;  5C4W C;  4Y5S A;  5LRR A;  2VMF A;  1GWK A;  2XJU A;  1XC6 A;  4I30 A;  1CWP A;  2UY9 A;  1REE A;  1HIX A;  3W5M A;  3KCC A;  5M0T A;  4OHW A;  2C9A A;  4B29 A;  3HQU A;  3WW4 A;  4AR2 A;  1CAV B;  4FFH A;  4NIG A;  2VO5 A;  5D1I A;  1HX6 A;  3M2M A;  3VDD B;  3UGG A;  2KD7 A;  2VG9 A;  3BAL A;  2R07 1;  2EAA A;  1AUY A;  1EV1 2;  3BTY A;  3FHQ A;  4LO8 A;  1RHI 2;  4NO4 A;  3GM8 A;  4MUV A;  4FBF A;  5GZG A;  2W0X A;  1WW7 A;  2QQI A;  3AFK A;  4F3J A;  5AVA A;  2D3R A;  1PMH X;  1RVF 1;  4XUR A;  2UWB A;  4YW3 A;  1H9W A;  4E9K A;  4ASK A;  2RMU 1;  1ZZC A;  3JBG 3;  4DY3 A;  4LJH A;  4ARY A;  4K1Z A;  2Z69 A;  4D7Y A;  1H8T B;  4LUM A;  4XF4 A;  1OVP A;  1CPN A;  1UD1 A;  1S0D A;  3RS6 A;  4B4R A;  3I2O A;  1S2B A;  1HKD A;  2TNF A;  1LOD A;  3J8F 3;  4JGY A;  4CDX C;  4SBV A;  4FPO B;  4O9E A;  1YI9 A;  3J7H A;  4V1P A;  2WZE A;  4ZXK A;  1VMJ A;  4QPY A;  1F4A A;  5GZF A;  1WWY A;  1CJD A;  5A3W A;  3O0W A;  4DNY A;  2VC9 A;  5A3U A;  3TN9 1;  3BYW A;  4AED B;  1OUR A;  4R9C A;  1OVS A;  4CCK A;  1JYV A;  3ZYJ B;  2WNO A;  1J3P A;  4P9X A;  2DCY A;  4YSF A;  4CU9 A;  1OLR A;  1JN2 P;  4K3U A;  1JI6 A;  1SQ4 A;  4LOR A;  1PMI A;  1QJE A;  4FTS A;  1J58 A;  5T5L A;  5KHI A;  4GIQ A;  2JIG A;  5FOB B;  3BIE A;  2RM2 3;  2DDU A;  2XDV A;  2ZAH A;  3AX4 A;  2HWD 3;  1H8T A;  4DB5 A;  4JTN A;  1FOD 3;  5F5I A;  5EXO A;  1NA1 A;  2RS1 2;  3EJK A;  2G9F A;  1J59 A;  1QOO A;  1DGR N;  4HK9 A;  5LA0 A;  3OF1 A;  1JYX A;  3ZSM A;  1S0B A;  4XFB A;  5FMO S;  2PLV 3;  3ZDV A;  4LK6 A;  4MSV A;  4HK8 A;  1AHS A;  2LUW A;  3OPW A;  4WM7 C;  1VE0 A;  2ORZ A;  3IN9 A;  2HWF 1;  1BEV 1;  4S2D A;  2X5I C;  2CWS A;  1W99 A;  2HYK A;  2O8Q A;  3OB8 A;  4JGY B;  5IFP A;  2O0O A;  2G4I A;  3PVE A;  4XIL A;  2CV6 A;  2VMD A;  4Q4X 1;  1RYY A;  5EP9 A;  5F3G A;  1H2M A;  4RGG A;  1DP0 A;  1GP6 A;  2JDZ A;  5CAD A;  2ZAB A;  1QF3 A;  5KHK A;  3ZX7 A;  3ASI A;  2DTY A;  5D2A A;  3FMG A;  3ZIW A;  4G4F A;  3O1U A;  1UU6 A;  4L0P A;  4CEY C;  4FPJ A;  3MLL A;  4AEK A;  4X6R B;  1NCQ C;  5DDJ 2;  5IYY A;  3HJR A;  3KS7 A;  2A7A A;  4CDW C;  4XEZ A;  2BRT A;  1V6I A;  1VBC 2;  2WC2 A;  5FQ0 B;  1VIW B;  5A33 A;  3MIC A;  4CE8 A;  4D7T A;  1E5H A;  5K7P A;  3V0A A;  4IEO A;  2VNV A;  2Y6H A;  4B7E A;  3GDB A;  3NMB A;  4L99 A;  1O3Q A;  1MS8 A;  4XXP A;  2WLQ A;  4IE4 A;  3NJZ A;  1HJG A;  2WZP P;  1L7Q A;  1J1T A;  3B5L B;  2PAK A;  2Y34 A;  2NMN A;  2VZP A;  3A4U A;  4V2V A;  5FZM A;  2D6N A;  1W03 A;  3JBG 2;  2VUL A;  5LAT A;  2Z79 A;  3C8X A;  3VKF C;  3WQB A;  5BNQ A;  3ABZ A;  4IET A;  1OMI A;  2ES3 A;  2PA7 A;  1RUI 2;  2Y0O A;  5F7U A;  2XWB B;  2NP0 A;  2XJV A;  3B02 A;  1YIP A;  3WDU A;  3ACH A;  3ZN4 A;  1GV9 A;  2J1R A;  2WO7 A;  4CDQ B;  2HWF 2;  2B39 A;  4M3C B;  1WMF A;  5C3P A;  2P6C A;  2Y8K A;  4G9S B;  4AFB A;  4OHX A;  3ILR A;  1W28 A;  2B9V A;  3THP A;  1G9A A;  4PLO A;  5BY5 A;  3VKO A;  3ZFF A;  4CXY A;  1G9C A;  1PM7 A;  3JD7 1;  4BU2 A;  2XL9 A;  4KH9 A;  5HXM A;  5JPM B;  5K9Y A;  2YUE A;  3N3H A;  2HWB 3;  1W3X A;  4Y1U A;  1Y7B A;  1UCX A;  2IXL A;  1HB3 A;  3HBK A;  4LHK A;  4UWD A;  1VBD 1;  3IKW A;  3KGZ A;  4IQP A;  1NOV A;  4WVZ A;  3U14 A;  3D4K A;  3ALQ A;  4CP2 A;  1C8M 3;  2FMY A;  3LPF A;  2YZ4 A;  4FPK A;  2AEZ A;  1HQL A;  5FPX A;  2DTW A;  2R32 A;  1RUN A;  3TN9 2;  1EPW A;  5KC5 A;  3T09 A;  3T0A A;  1CON A;  2VQ0 A;  3VZM A;  1H9P A;  1VBA 3;  3LFM A;  4DQA A;  2RMU 3;  4A44 A;  4A6S A;  2VEC A;  4HPK B;  1PIV 3;  3PUR A;  4QPG B;  4LIU A;  2QUO A;  1UOJ A;  2AZ5 A;  4HVO A;  1SCR A;  5BNN B;  1AR8 3;  3B9I A;  5BNP C;  3T4H B;  4COZ A;  3WQ7 A;  1EYB A;  2YU2 A;  3M8L A;  1VAV A;  4NWV A;  3L9J T;  3LPG A;  1OI6 A;  4B4Q A;  2DUP A;  4UAP A;  3RYP A;  3MW3 A;  2A71 A;  4JGZ A;  2WO1 A;  4AG4 A;  2ZOE B;  4FP3 A;  3ELN A;  4W6X A;  4OUE A;  4QKB A;  3VD5 A;  3HEI A;  1ENR A;  1HJF A;  2WAA A;  4CEW C;  1H2N A;  4DS0 A;  1YQ8 A;  2AR6 A;  2OYZ A;  3W20 A;  3SIT A;  5C9A C;  1OPM A;  1DHK B;  4GJZ A;  3BU7 A;  2R07 2;  3CL1 A;  3AZY A;  3H1M A;  1ODM A;  2VD7 A;  1RJ7 A;  3ZMN A;  4XQD A;  2QQW A;  3I2H A;  5IVB A;  3AMM A;  3WOG A;  5A70 A;  4HPK A;  5I93 A;  1NLS A;  4LA2 A;  3IDA A;  4LQR A;  4NHX A;  3M4F A;  1LHW A;  4UW5 A;  3JD7 2;  1URX A;  2E7Q A;  3Q8C A;  3T2T A;  2A6W A;  2Z42 A;  5A7S A;  4GUL A;  4PHZ A;  2LAL A;  2ZEZ A;  4Q2F A;  4QPG C;  5FBZ A;  2XVK A;  5J7M A;  4WM8 A;  2W2I A;  3S30 A;  3T08 A;  2A6V A;  4EYU A;  1LOG A;  5GZD A;  4HN0 A;  1AL2 3;  1X82 A;  3AP9 A;  1NCQ B;  2DCT A;  4GWN A;  2VTX A;  1YI7 A;  1Q3E A;  3AYD A;  3MI8 A;  3MW4 A;  2VXJ A;  5FYY A;  5C7G A;  1UN1 A;  3TEX A;  3MF9 A;  2VOW A;  2MHF A;  4OVE A;  1ZX5 A;  3OSD A;  5LBF A;  3AL6 A;  4PQ9 A;  4YW5 A;  4QD2 A;  1HRV 2;  1WW6 A;  2XG3 A;  5I0R A;  3VBR C;  1RTV A;  3APB A;  1SDW A;  3MID A;  1W04 A;  4YWA A;  2FDI A;  2JB4 A;  3S5A A;  1UYY A;  1N3P A;  1VRH 3;  4P5H A;  1QJX 2;  1BCX A;  4YZ2 A;  3IDE A;  2I07 B;  1IS6 A;  1EY2 A;  4JGY C;  2D5F A;  4JRA A;  3RZM A;  5JOW A;  2Z4F A;  3LA3 A;  3WHT A;  3ZFG A;  4NJ4 A;  2F4P A;  1W0N A;  1YFU A;  2LM3 A;  5FPB A;  4BLJ A;  4BIS A;  1POV 1;  1RUH 3;  1ULE A;  2QZ3 A;  4NHY A;  4CDU B;  4KGQ A;  4P00 B;  3GZT B;  1WD3 A;  4BM8 A;  4AVA A;  3K51 A;  2ZML A;  4CUG A;  1S0F A;  1W3V A;  3CZU A;  2ZHL A;  4HZF A;  3ZPY A;  2J1A A;  1XNB A;  2PHX A;  2RR1 1;  2HLE A;  2QQM A;  5F3E A;  2GMM A;  3VZL A;  1JOJ A;  3P3P A;  4BYY A;  3Q9O A;  3AC0 A;  5IUQ A;  1XNK A;  1NZC A;  2ZGP A;  5TSW A;  2SLI A;  2FDG A;  1T6B X;  4BOW A;  1QHD A;  2HBU A;  3KMH A;  3GZE A;  1ASJ 3;  4URT A;  1VB2 A;  2XVL A;  4CTE A;  5DAP A;  3U37 A;  1JHJ A;  2WFF 1;  4Q4V 2;  4Y4R A;  4DXS A;  1BEV 2;  1O3T A;  2LS6 A;  2RS1 1;  3SCF A;  4FAG A;  4D7S A;  2D6P A;  2VNO A;  5T55 A;  2OT7 A;  3I2I A;  4EZ4 A;  2XJP A;  1ZZ9 A;  1RUF 3;  1EUU A;  1JUI A;  5C4W A;  5FDB A;  1RUJ 2;  4KWU A;  1DQ2 A;  5FTT C;  1GU3 A;  4NE9 A;  3DYP A;  4YYO A;  5IK7 A;  2W9X A;  4QB6 A;  1ZA7 A;  5A1F A;  2C1F A;  4K7J A;  1Q43 A;  5A6X A;  1MS9 A;  4FT8 A;  4AGG A;  1QJY 2;  3I49 A;  2Q4S A;  4PBP A;  3IB3 A;  2IXI A;  3OD4 A;  1RB8 G;  1CPM A;  1GP5 A;  2H6B A;  4BXF A;  3ZFG B;  4BQ2 A;  3NJV A;  5DAV A;  2YC4 A;  4JDN A;  3III A;  4WM7 B;  1DZQ A;  1UW8 A;  2VCB A;  4YVS A;  5FWE A;  1UO9 A;  3FLR A;  4CDU A;  4LT5 A;  2VQU A;  2I2S A;  3I2K A;  1W2T A;  3MUY 1;  4MXV A;  3T1L A;  1GZW A;  5CU1 A;  4ZU4 A;  5H9S A;  1S2K A;  3ZDS A;  4WV8 A;  2CTV A;  3N7M A;  4EN8 B;  1ZNP A;  4K40 A;  2ZGT A;  4ZON A;  2JEC A;  5F39 A;  1KJL A;  5LCW L;  5IK5 A;  1TVG A;  2R06 2;  4XDO A;  3BI3 A;  3LIG A;  1J3Q A;  5IW0 A;  1AR8 2;  1F5F A;  1WD4 A;  2EAL A;  4Q4W 2;  4GKX A;  5J09 A;  4N90 A;  2DVB A;  1AR6 1;  2ZGL A;  4UYB A;  5A7W A;  2WZ8 A;  3H1Y A;  1GIC A;  5F5A A;  4N43 B;  2RS5 1;  3JQW A;  1VBA 2;  4XFF A;  1ZRF A;  2W94 A;  1ULC A;  3VBU A;  5IVY A;  1CZS A;  1IQD C;  1OUS A;  2VNR A;  5AVP A;  4Z2A A;  4OUM A;  4QU2 A;  1LOB A;  3O14 A;  3CZJ A;  3M1H A;  3U11 A;  1FI2 A;  1DZT A;  1RHI 1;  3IM0 A;  3KB5 A;  4K9S A;  3D5O A;  3V0B B;  3E5Q A;  4LO4 B;  2V5D A;  1OBN A;  4ZU7 A;  1R1A 2;  3RGB A;  2RS3 3;  2XB6 C;  3IPV A;  4OZO A;  1BBT 2;  1BJQ A;  1AR7 2;  1VBB 3;  2FD8 A;  4XOG A;  4OUL A;  1ENS A;  3HR9 A;  1K45 A;  4QDS A;  1Z0H A;  1WCQ A;  2BOI A;  1PNG A;  5KR7 A;  2WAO A;  5A3L A;  5CFC C;  4EJR A;  1BXH A;  4GXL A;  4L2N A;  1RUE 2;  2WNE A;  1DGR A;  4B8E A;  4JVA A;  3L2H A;  1QNY A;  3CKH A;  3WNL A;  2N7G A;  5A7P A;  4RSU A;  1PK6 A;  1MPX A;  3OYW B;  1ZZ6 A;  1XYP A;  5CNA A;  5J3U A;  3S57 A;  3OGR A;  2DCZ A;  4M0H A;  5FXX A;  5FYU A;  3BIW E;  3T1M A;  3KV4 A;  3PJY A;  5A32 B;  5L73 A;  4XZU G;  3DV8 A;  4AAX A;  3KD4 A;  3N9N A;  2WZR 2;  3KHB A;  1O5U A;  2VOX A;  3CJI B;  3LEK A;  3MFA A;  4UFM A;  2QNK A;  4Q4X 3;  2HBT A;  1RED A;  2MPF A;  5L19 A;  1WCU A;  1LCL A;  1KGY A;  4MOA A;  1KFU L;  2ID4 A;  1JW6 A;  4RQP B;  5FO9 B;  4NPL A;  2ZA9 A;  1D4M 3;  1AR9 2;  1MVQ A;  1IKP A;  1OQ1 A;  4P9Y A;  4KWL A;  4RS5 B;  4AI8 A;  1QJZ A;  4DUX A;  4JZR A;  3VBR A;  4ITC A;  1IS4 A;  2VJX A;  1KXG A;  1AZD A;  1VBC 3;  3C7O A;  3AZW A;  3RWN A;  4X6Q B;  3BU0 A;  1XE0 A;  3THT A;  1H8V A;  4H3W A;  3VN4 A;  3UNP A;  1FNZ A;  1N47 A;  5F5Q A;  1SEF A;  4CCD A;  1LRH A;  1YQ6 A;  4ZHN A;  3D82 A;  2XGX A;  2ZEX A;  4LA3 A;  3E97 A;  1ZBA 3;  5DZE A;  1O8P A;  4GAZ A;  3VD9 A;  2NPI A;  2R04 2;  4QQL A;  4WM8 C;  3D8C A;  2PMW B;  4QPI A;  5DUU A;  4Q1P A;  4QPG A;  2ZHN A;  3J7M A;  1X8E A;  3PUQ A;  4IV3 B;  4UF0 A;  4DXT A;  3NO8 A;  4BQ3 A;  2BP6 A;  4DOU A;  4HSL A;  4GKY A;  4NPM A;  4RQP A;  4YM3 A;  3PUI A;  5D8A C;  4UOJ A;  5DAB A;  1HV1 A;  1Z7S 3;  1WGP A;  3C3V A;  3RMX A;  5HI0 A;  4JDM A;  5IK8 A;  3ROU A;  5C71 A;  3GCW A;  2PAE A;  5CFD B;  5SV5 A;  4W50 A;  4Y20 A;  3LSE A;  4EN6 B;  2XR4 A;  3MV0 1;  4N53 A;  1X9T A;  3LA7 A;  4Z1V A;  3P1I A;  5FBJ A;  3FWE A;  1JZ2 A;  5F3C A;  2PHL A;  3AJZ A;  3HAG A;  1O7F A;  3OUI A;  1NKG A;  3TOJ A;  4LK7 A;  2VZR A;  1BEV 3;  1W2A X;  4FOW A;  4P14 A;  4BQX A;  2PHF A;  1BBT 1;  4ZZ8 A;  3T2P A;  4IER A;  1R08 3;  2VUC A;  3MGU A;  4RHV 1;  2ZGR A;  2WWU A;  1YFY A;  3M3E A;  4FXG B;  3LIH A;  4CVU A;  3AP5 A;  5F2S A;  4BME A;  5T50 A;  4EN0 A;  3LKJ A;  1AYN 2;  4COV A;  5JWP A;  1CX1 A;  4C1W A;  3HNM A;  1U5Y A;  4IV3 A;  3S7E A;  5FZG A;  3EHK A;  5EJ3 A;  5IAT A;  3I3D A;  5AC9 2;  4NID A;  2JE7 A;  1PX3 A;  2WA3 A;  2XBO 1;  3POF A;  1VLN A;  2ZGU A;  1ZRI A;  2ZEY A;  3RZL A;  2KXL A;  2JDM A;  4PDW A;  4YVS B;  1V6O A;  3QH7 A;  5C8C C;  5T5P A;  1UKR A;  1AYM 2;  1C5H A;  4AFA A;  2PQS A;  2P3I A;  3A0N A;  4IV1 C;  4AFD A;  4E4D X;  2AYH A;  2JKB A;  2E33 A;  3BTX A;  3AFG A;  5FK7 A;  2CGP A;  3LDR A;  3DKQ A;  3LDB A;  1HRI 2;  1VRH 2;  4HSJ A;  3FBM A;  1S0J A;  4A2U A;  5C33 A;  1UOB A;  2XL7 A;  2BFU L;  2AUY A;  2B45 X;  2DU1 A;  4XF0 A;  1FYU A;  3FC0 A;  2XJQ A;  1HRV 3;  5F6K A;  3JCI A;  4W4Z A;  5LBB A;  5J48 A;  2QQL A;  1I5Z A;  1LEC A;  1MS1 A;  2GU9 A;  1CZV A;  1MZ6 A;  1PVC 1;  5FMC A;  2XKP A;  4CSW A;  5FP3 A;  5FY8 A;  5SV8 A;  1SDD B;  4QKF A;  1NUK A;  1ZZ7 A;  2HEW F;  2XUM A;  3GHM A;  5EJ1 B;  5JMC A;  1W2O A;  2R7E B;  3GAL A;  2VY0 A;  2J22 A;  3GBW A;  2LTN A;  4OMD A;  5E88 A;  4AVT A;  4B3N A;  3Q8E A;  4Q0U A;  1LOF A;  2VVD A;  4IXL A;  3ZXE A;  5FY5 A;  4CU7 A;  5C9A B;  4XDP A;  2QJV A;  4LEJ A;  3FFQ A;  3VKN A;  1HDK A;  2QCS B;  1UQX A;  3U78 A;  1VJ2 A;  4Y3O A;  4LBO A;  1DG6 A;  4LO5 B;  4AFM A;  4BPZ A;  5FRE A;  3AKQ A;  3HIF A;  1UZV A;  5HCB A;  2W1W A;  4R4Z A;  2VW0 A;  4AZZ A;  3VDB A;  1I5P A;  1AXK A;  5A6Q A;  2YYO A;  4MO3 M;  1W6P B;  3PNA A;  2CYF A;  4URA A;  1LKN A;  4HVR A;  1B35 A;  4L97 A;  4NRM A;  1SPP A;  1H4G A;  3VBO C;  2XLA A;  4P9G A;  1RXG A;  3VZJ A;  5FOJ B;  3SH5 A;  1V9U 2;  3VZN A;  3FHI B;  1S0G A;  2YDE A;  1QGL A;  1KFX L;  1UMZ A;  2NYY A;  3THD A;  1MZF A;  1ZBE 2;  2JB8 A;  2X8K A;  4CU6 A;  1POV 0;  3WW1 A;  1CJP A;  1JZ6 A;  2CL2 A;  3HN1 A;  2GN7 A;  2Y6L A;  1LNS A;  2ZAC A;  1BK1 A;  5FKC A;  1K3I A;  2QBX A;  1MQT C;  1PO2 3;  1QJU 2;  2VH9 A;  4JCK A;  4NR1 A;  5GZE A;  2W1S A;  1GOF A;  1SCS A;  3ENR A;  1SZB A;  5KHH A;  2P34 A;  1Q8O A;  3A23 A;  4Y4Y A;  2ADE A;  2EXK A;  3K77 A;  4TZD A;  2WO2 A;  1AX0 A;  5CZK A;  1C57 A;  5KXC A;  4IGQ A;  4QQO A;  4J1X A;  2VPV A;  3I8T A;  4QXC A;  4UFL A;  5KWR A;  2VVE A;  4XUQ A;  2YPD A;  1LEM A;  1MS4 A;  2Q8E A;  5FZ8 A;  1R09 2;  5JXG A;  1RIR A;  4X8P A;  3K75 B;  4A45 A;  1EAH 3;  1DYP A;  2EA7 A;  2W95 A;  1PO1 1;  3LCP A;  3R4D B;  4MGZ E;  3RJR A;  3DPR B;  3TB0 A;  2RVA A;  3ZYF A;  2JG8 C;  2OPW A;  3V56 A;  3ZPO A;  4H7M A;  5IWF A;  1DQ1 A;  3OBT A;  5CG8 A;  1OF4 A;  2BZD A;  3N9O A;  4UW3 A;  5CYY A;  3RZG A;  4B7K A;  4HKO A;  4XJW A;  3FLP A;  5IVJ A;  1AXY A;  4CUC A;  1RUG 2;  4PIZ A;  1HV0 A;  5LY1 A;  4RFR B;  3PL0 A;  1YYN A;  3NV1 A;  2HH9 A;  4QM9 A;  2ZTN A;  5FZI A;  4DUW A;  3VZO A;  4KBZ A;  1JOB A;  4P9W A;  2G9G A;  1OPO A;  1TMF 2;  5L7O C;  1MEC 1;  3FN9 A;  3CJI A;  3AYE A;  3JD7 3;  3G7D A;  4MGS A;  1RUF 1;  3BPZ A;  3N7L A;  3NVC A;  3ZXG A;  1OKQ A;  1OH3 A;  4A7Z A;  1GAN A;  4LNV A;  4DEQ A;  1SMV A;  1C28 A;  1KEX A;  2DBI A;  2HWB 1;  2WA4 A;  3A0K A;  3R4S A;  4K21 A;  3RVH A;  3VD4 A;  3PME A;  4C90 A;  3B01 A;  3DPR A;  3ACG A;  4XF1 A;  5IHR A;  1UY0 A;  1C8M 1;  1I9R A;  4LKD A;  5HPO A;  5JAX A;  3SNM A;  1TNR A;  1R08 1;  3KV6 A;  4PLM A;  2EID A;  3GGL A;  3R0R A;  4RHV 3;  4J25 A;  3UKV A;  3WQ1 A;  3T2Q A;  1PO1 2;  4CXX A;  5A1A A;  1R09 1;  1AX2 A;  4KNC A;  4BE3 A;  1N1V A;  2DVA A;  2PHR A;  5A80 A;  1UYP A;  2JX9 A;  2MNG A;  1WLW A;  3ON7 A;  4CA9 A;  5IJR A;  1O4T A;  4P08 A;  1W05 A;  3VLB B;  4JC1 A;  1XXN A;  1CAX B;  1OOP B;  2QVS B;  2YPJ A;  3J8F 1;  4I01 A;  5D21 A;  5JSO A;  2RDR A;  4RD7 A;  5FYV A;  1QQP 3;  3HOB A;  5L9B A;  4DIQ A;  1GLH A;  4R8H A;  4YG6 A;  3UGF A;  4KBB A;  1DLL A;  3WV6 A;  5F6L B;  4AED C;  1AJK A;  4FFG A;  2VZS A;  4Z07 A;  4YW6 A;  5A3N A;  3K48 A;  3VHR A;  4BQW A;  3IMN A;  2ZX0 A;  5JI9 A;  4AVS A;  4Q26 A;  1ZBE 1;  4RS5 A;  4QB2 A;  5J96 B;  1H1M A;  4H55 A;  1O8S A;  5FXW A;  5AFB A;  2JDP A;  1AJO A;  3I59 B;  4I0A A;  2A70 A;  1DIW A;  3AVS A;  2RM2 1;  1ZM1 A;  2NZ9 A;  3TWI A;  3H7Y A;  1VBD 2;  2OZJ A;  1OC1 A;  3K46 A;  5F5C A;  3BB6 A;  5B4N A;  5BNO B;  4CUB A;  2D5H A;  3RZJ A;  4LOS A;  5FYM A;  2HEY F;  2OZ6 A;  4FQ4 A;  4EV0 A;  2E26 A;  2W1U A;  1KS5 A;  1LEN A;  3SKJ E;  1OOP C;  3HT2 A;  3O0V A;  1VBD 3;  3B7M A;  5BXX A;  1H2K A;  1ND2 B;  3IAP A;  3JB4 C;  2QZ2 A;  2WYF A;  3IWZ A;  3E6C C;  4DPN A;  2JWP A;  4BQ5 A;  1ZZ8 A;  1J83 A;  1UX7 A;  3P3N A;  1RVF 3;  3DL3 A;  1HRI 1;  3SQO A;  1I1E A;  2VCM A;  1IPK A;  3EBR A;  1XU1 A;  3KVB A;  3USU B;  4XQ4 A;  2XML A;  2VZQ A;  4C1X A;  3I59 A;  4ATF A;  3AZX A;  5CFC B;  1NT0 A;  3GF6 A;  4NN0 A;  3WNP A;  5EYY A;  1XOY A;  4NRQ A;  5DQ0 A;  2Y6G A;  1RIN A;  2VOV A;  3FE5 A;  4KWK A;  3POB A;  1UU5 A;  4QHO A;  2XBO 2;  3ZMO A;  3OGS A;  1NX9 A;  4NHK A;  2IVJ A;  4Q4W 3;  3ZIX A;  2ORX A;  2VQA A;  4O65 A;  1YQC A;  2DUO A;  3NJX A;  5LB6 A;  1D0H A;  1S1A A;  1W6Q B;  1XB9 A;  3VL8 A;  1QEX A;  4FPY A;  1ZRR A;  4M00 A;  2K9Z A;  5DDJ 1;  2XKO A;  3ZXA C;  1WLD A;  1XE7 A;  1RVF 2;  3IZO A;  4UI9 L;  4W6Y A;  3VUO A;  3H8R A;  4UFI A;  2DVD A;  1PGW 2;  3CEW A;  3J7N A;  5A3T A;  5L7O B;  4LLO A;  2D40 A;  3LE0 A;  2Q8C A;  1QXR A;  3O1T A;  3UT0 A;  3VHN A;  1JS9 A;  1ZBA 1;  4QX7 A;  4W8J A;  4GMP 3;  4Q8K A;  2ILM A;  2W08 A;  3GZA A;  2FDJ A;  1GZC A;  2ZZQ A;  1HQN A;  2CDO A;  4QDQ A;  3NV3 A;  4XBN A;  5LBE A;  3ZXF A;  1BMV 1;  2WNV B;  3S0M A;  2C26 A;  4JX0 A;  4O61 A;  4HLT A;  5K4L A;  3HBZ A;  4IEQ A;  4S2H A;  2GC1 A;  4GH4 C;  1OH4 A;  1CAU A;  5JZG C;  1X33 A;  1OD3 A;  4PIX A;  4FFI A;  3K2O A;  1QXP A;  2C5D A;  1UY2 A;  2Q0A A;  3S5Q A;  1W6Q A;  5EYX A;  1AXZ A;  3WF1 A;  4Q4Y 3;  4MAD A;  1OF3 A;  4WVV A;  1DYO A;  2Z2S B;  1HB2 A;  3KT4 A;  2GNT A;  3EO6 A;  4A6O A;  3EB7 A;  4HON A;  2JDH A;  4P5Y A;  1HXS 1;  2WYS A;  3BN6 A;  3A22 A;  4EWE A;  3TYJ A;  5LK5 A;  4W6W A;  1S0C A;  4QWN A;  1MS5 A;  1XYO A;  1KDK A;  1GNZ A;  3ORJ A;  3ES4 A;  1RUG 1;  5FV3 A;  4I3G A;  5ABJ A;  2WS9 3;  3W58 A;  5LW9 A;  1R64 A;  4NOT A;  2PXJ A;  5L9R A;  4CCN A;  4YG3 A;  3L2Y A;  4YLZ A;  2V09 A;  2YXS A;  3D3A A;  1C8N A;  3LF7 A;  1NE6 A;  1D2Q A;  2X10 A;  2X05 A;  1N1Y A;  3WQ0 A;  4AI0 A;  2DWR A;  3ZLI A;  1AR9 1;  1NE4 A;  2XLG A;  4E2S A;  5FPL A;  4AEM A;  2E51 A;  4TWT A;  1G6N A;  2WR9 A;  3CMG A;  2Q1M A;  1Q8P A;  1YFW A;  2VMC A;  2JG9 C;  4BIO A;  4UBG A;  1SBE A;  3VB9 A;  3M3C A;  4RGA A;  2UY8 A;  5FLH A;  1W0P A;  3OYW A;  3SKV A;  1SFP A;  2OKX A;  2RJL A;  2W5F A;  1JZ7 A;  1NQD A;  3V0A B;  4NRO A;  1H1I A;  3RYK A;  4HMZ A;  5JR7 B;  2NN8 A;  1RHI 3;  5JOZ A;  2VZT A;  3QOP A;  3VD3 A;  1COV 1;  1S0E A;  4QKD A;  5FK8 A;  3IDB B;  5FMO L;  3ACI A;  2D3P A;  4JKL A;  1LED A;  1WCK A;  2V5Y A;  3ZFF B;  2B8M A;  1KRI A;  1GBG A;  3B9C A;  1W9S A;  1NYW A;  3OD0 A;  3U10 A;  4L11 A;  3AXD A;  3AYA A;  4E2Q A;  4Y5T A;  3FL7 A;  1G9B A;  2FQP A;  5FZ7 A;  1Q56 A;  2RV9 A;  1GOG A;  4XIO A;  3HVD A;  1LAJ A;  3O1M A;  2ERF A;  1XND A;  5ANQ A;  4CZS A;  1S55 A;  4KI5 M;  4YGB A;  1DCS A;  2IXH A;  4YZ1 A;  2VMH A;  4KQ7 A;  4QDR A;  1X8M A;  5B2G B;  1GR3 A;  1LJ7 A;  2A5Z A;  1GSL A;  2JE9 A;  4QX1 A;  3ZKY A;  2FZ2 A;  5D8A A;  3LZZ A;  4KWJ A;  3HPN A;  4YVW C;  3USS A;  4GQ7 A;  2BBA A;  1W8O A;  1PVX A;  5FZ6 A;  5K0U A;  5C70 A;  1Y4W A;  2O14 A;  1ULG A;  3T0D A;  1L7L A;  2PHW A;  5CFD A;  3SH3 A;  2VBD A;  1E5I A;  1VBA 1;  3NNL A;  1C1F A;  1VMH A;  1WBL A;  3NAP B;  4AQ6 A;  1SBF A;  3BCW A;  1VRH 1;  1N3O A;  3NJY A;  5E16 A;  1KS4 A;  4HL0 A;  5E89 A;  3ES1 A;  4XQW A;  5A7O A;  1JTZ X;  5BUV A;  2FCU A;  4AED A;  2D6M A;  3INA A;  1OFN A;  3O5S A;  1YC6 1;  1X9P A;  4Q4W 1;  4XE9 A;  4ET7 A;  2I74 A;  1C3H A;  1TME 1;  3DYO A;  5KXE A;  4LBL A;  3ZSK A;  5GLV A;  3I3M A;  4BWO A;  5JXI A;  1XQN A;  3EQE A;  4YM1 A;  3H9A A;  2D6L X;  4BQ1 A;  3FJS A;  3MW2 A;  4Z8B A;  3IBM A;  1PGL 2;  2ZHM A;  2Y6K A;  2ARX A;  3NNJ A;  4R52 A;  2VCA A;  4PDW B;  4ES9 A;  5FP4 A;  2E9Q A;  3NNM A;  4N7U A;  4XF3 A;  4JQR A;  4TSV A;  3THC A;  4XTP A;  1OFS A;  3LWC A;  2R0F A;  5FPU A;  1UNB A;  3NAP A;  1IG0 A;  4COW A;  1H30 A;  3P6B A;  1DDL A;  3I3E A;  4QGM A;  3H3L A;  1FAT A;  2LRP A;  3AMH A;  4PF1 A;  5JZG A;  2P37 A;  3CIH A;  5K0U B;  5FZ3 A;  4BK4 A;  3CU7 A;  4XIK A;  1MEC 3;  1N3Q A;  5ACA 1;  2CNA A;  3DPR C;  1ZRE A;  2HWE 3;  4E4S A;  3EXU A;  4UT5 A;  1GYK A;  4CDX B;  4EE2 A;  1JXN A;  5EWS A;  1RMU 2;  4RA0 A;  4JTO A;  2XWJ B;  1BQP A;  1COV 2;  3PU3 A;  2D43 A;  1F35 A;  2NM1 A;  3O0X A;  2XXZ A;  3JZV A;  4KG8 A;  3VZK A;  3MV1 1;  1QU0 A;  4JQT A;  5GJ6 A;  4FAH A;  1OLM E;  1UIK A;  2ZXQ A;  5F8P A;  5JVV A;  2YU1 A;  4GZ9 A;  3CJX A;  2AC1 A;  1Q8Q A;  1RUG 3;  2YC2 A;  4LUL A;  4FTB A;  2C0Z A;  1CIW A;  2EXJ A;  3KLS A;  4QQ2 A;  1W39 A;  3T0B A;  4J6G A;  2JIC A;  2YC0 A;  4Y26 A;  1GQP A;  1FMD 3;  4QQH A;  1W0O A;  2ZX3 A;  3DF0 A;  4OFG A;  1F2N A;  4YGC A;  3H42 B;  3WP5 A;  2H6C A;  3OGG A;  3PU8 A;  4OMC A;  5JUV A;  1UZW A;  2Q5T A;  4Q0P A;  4I0W B;  1DF0 A;  4QX0 A;  5FPV A;  1D4V B;  5LA1 A;  4GMP 0;  4XC9 A;  1XSQ A;  1W6P A;  2O1Q A;  1FMD 2;  2IXK A;  3B69 A;  3X29 B;  3WXP A;  2ZGM A;  3PHM A;  2Y33 A;  2R6Q A;  2RR1 3;  2WDB A;  4SLI A;  2PN5 A;  2XJS A;  4WM8 B;  4DRR A;  1GNH A;  3FX3 A;  4FOQ A;  4HET A;  2C6S A;  1C8M 2;  5T3N A;  2TUN A;  2WT0 A;  1TG7 A;  3CDZ B;  2YFU A;  3NQH A;  2WSV A;  1LU1 A;  1MQT A;  1YFX A;  2WZR 3;  2YV8 A;  1ULO A;  2V73 A;  4XJ9 A;  4CDU C;  2WN3 A;  1DBN A;  1MAC A;  4I09 A;  3VBH A;  5C3S A;  1CAW B;  1A34 A;  4Q0S A;  1HN0 A;  1VBB 1;  4IEW A;  1G7Y A;  5F9T A;  4FQZ A;  1FPN 1;  2ZEW A;  3WEZ A;  1KJR A;  4A3X A;  3AVR A;  5BNN C;  4OHY A;  2ATF A;  4OI1 A;  5KXD A;  4BXS V;  1GQG A;  1B35 C;  5LZ6 A;  1XYN A;  4CCC A;  2WLP A;  3RMY A;  3U75 A;  3WT3 A;  4Y24 A;  3NNF A;  3WR0 A;  3WNN A;  1GZ9 A;  3OEB A;  4JGZ B;  3AKT A;  1BMV 2;  2VVF A;  1FOD 2;  3Q8B A;  3E6D A;  1K5M B;  5LA9 A;  3WG1 A;  1A6C A;  2EIG A;  3DKW A;  2X29 A;  5FFO C;  2X5I B;  1BBT 3;  4KU7 A;  4QX5 A;  4CP0 A;  5FIX A;  2P3Y A;  2RS3 2;  1HW5 A;  4DEV A;  3MLK A;  1OKO A;  1NLQ A;  4C0H A;  5A1L A;  3ITQ A;  4BMB A;  4AGR A;  2PYT A;  2WRA A;  2BNN A;  2DVG A;  5GM0 A;  3DXU A;  1RUC 1;  2RS5 2;  4E4H A;  3T4V A;  5FLJ A;  2ZPX A;  5T54 A;  5A6Z A;  2OS2 A;  2CU5 A;  4Y20 B;  3IMM A;  5JOY A;  2BWA A;  1CAW A;  2D98 A;  2XBO 3;  3B00 A;  3JXS A;  1A8M A;  1AR6 2;  2LRO A;  2GP5 A;  2Y0I A;  4M3C A;  5FUI A;  5IT6 A;  3R4U A;  1AR8 1;  3R6S A;  4LLF A;  1N1S A;  2VL4 A;  4ISQ A;  2BV4 A;  4FO9 A;  2XOM A;  3DYM A;  4XUO A;  4IEZ A;  2JE8 A;  4LBQ A;  4RR3 A;  1ND2 C;  3LD8 A;  3N7K A;  3VBF A;  4CXW A;  4EWD A;  5KHJ A;  3WP3 A;  3PIJ A;  5FRA A;  4FFF A;  1TME 3;  2R1B A;  1OA4 A;  2B42 B;  1W8U A;  2NLR A;  4OHZ A;  4Q29 A;  2WUH A;  3WW2 A;  3LOI A;  4PDW C;  1ND3 A;  1W8Z A;  2HJI A;  1LR5 A;  3WNX A;  4EN9 B;  1BVP 1;  3F95 A;  2JEM A;  3WSO A;  4YZ5 A;  2Y64 A;  1AYN 3;  4LHS A;  4S2G A;  1TNF A;  3ZM8 A;  4TN7 A;  4ASM B;  2XPJ A;  4IV3 C;  3ILN A;  1QJF A;  1M06 G;  1YJK A;  4EWA A;  4LE4 A;  4YVW A;  5FZA A;  2VMI A;  2JD9 A;  4HAN A;  4DRV A;  5IVE A;  1LTE A;  5GLZ A;  5JDB A;  4OI4 A;  5LEK A;  5G05 L;  3HD8 B;  5LA2 A;  2AGS A;  1RUE 3;  2CGN A;  2BOJ A;  5IK4 A;  1HLC A;  2EIB A;  2J1T A;  1YUD A;  4LKS A;  5FUN A;  1Y9G A;  5FZE A;  4ARX A;  5J37 A;  1DGW A;  1UY3 A;  1UZZ A;  1V0A A;  3VBH C;  4BB3 A;  4JHT A;  3LSD A;  4AHY A;  4WVM B;  2RM2 2;  2HWE 1;  3NWK A;  1IG3 A;  5FY9 A;  3MPP G;  1IHM A;  3I3B A;  4YG0 A;  1OT5 A;  2VBP A;  4LBK A;  3POW A;  1NQJ A;  3I2D A;  3MO4 A;  2CY6 A;  3M7A A;  4XJ8 A;  2FBE A;  4QX8 A;  4JDO A;  1WW5 A;  4ISR A;  1PVC 2;  5FZ0 A;  3TEY A;  1Z7S 2;  1CR7 A;  3ZN6 B;  1VAL A;  1X36 A;  2K46 A;  2RR1 2;  3LDK A;  4FPG A;  3RG0 A;  4ZKT B;  2DCJ A;  4HKW A;  3ZFE B;  4FPL A;  4AW7 A;  1PX4 A;  3M3Q A;  1XU2 A;  2OX0 A;  4IE6 A;  4XMI A;  3VL9 A;  4I2O A;  3N9L A;  1NCR B;  5IAV A;  3VBR B;  5JOX A;  4XFC A;  5C9A A;  4XAE A;  1JHN A;  4F7Z A;  1VBE 2;  3RJ2 X;  1PO2 1;  3RPQ A;  2AH2 A;  5FZK A;  1IS5 A;  4AHZ A;  4AWD A;  4QPI C;  4FXK B;  1TME 2;  3D6E A;  4PI0 A;  3K4D A;  4XBL A;  3J8F 2;  1QOT A;  2PQQ A;  5FMD A;  3GHN A;  5KHG A;  2GH2 A;  4COU A;  1QKQ A;  4L9B A;  2OW4 A;  3GBG A;  4NPR A;  2CDP A;  5FPZ A;  1VBE 1;  1EAH 1;  4BIF A;  1JBC A;  3MHZ A;  3AMP A;  1PO1 3;  1QJX 3;  2BNM A;  2WO3 A;  3KZ4 C;  3U07 A;  4IGP A;  2VZO A;  5G04 L;  3G6J B;  2VUA A;  1UXZ A;  3WUC A;  4D6R A;  4AF9 A;  2Q8D A;  1ULD A;  3LEI A;  4Y22 A;  4XCB A;  1APN A;  3ZXJ A;  2JD4 A;  4XDQ A;  5F37 A;  2FZ1 A;  1XBF A;  3B3Q E;  3MYX A;  2JDY A;  5HCH A;  2MEV 3;  1V9U 3;  2RE9 A;  1PVC 3;  2DYC A;  5T52 A;  4N7I A;  1O91 A;  4DZG A;  2W46 A;  4DXR A;  4ATE A;  5A3O A;  2HWE 2;  4WBB A;  4XJU A;  1O5L A;  5APA A;  3CLP A;  2FCT A;  2WBK A;  3D0S A;  1OQD A;  2GND A;  2GH8 A;  2CAV A;  4FOY A;  4MX3 A;  1O3S A;  4LIV A;  1LGB A;  1EUT A;  1M4W A;  2BER A;  3C7E A;  3HMY A;  3VHO A;  4QPI B;  4QMA A;  4Q4V 3;  3V0B A;  4MHR A;  3BGA A;  4GH4 A;  3H1W A;  4N8M A;  5I8S A;  4MET A;  3IAQ A;  2E32 A;  2IUW A;  3OOX A;  3K3N A;  4Q1R A;  4XTM A;  3SLI A;  4DO0 A;  3PVO A;  5DPN A;  2EIE A;  5BNP B;  2FHR A;  2IWG B;  2R0H A;  3U0Z A;  3ZYH A;  1YLL A;  3KCX A;  3TEW A;  2B5H A;  1UAI A;  2ZGO A;  3BOW A;  4BCU A;  3WG2 A;  3I2F A;  4BQ4 A;  2G1M A;  2J1E A;  3AP6 A;  3UJQ A;  5A6Y A;  4XFH A;  1AF9 A;  4QXH A;  1JZ4 A;  5ANN A;  1PM4 A;  2CAU A;  4A41 A;  3RZZ A;  1GKB A;  1O4Y A;  3DN7 A;  2KA3 A;  1GFF 2;  2DVF A;  4D6S A;  4TTG A;  2CGO A;  2VMG A;  4XJZ A;  5FP7 A;  2B4K A;  1KD7 A;  1RC6 A;  5CA6 A;  4M3C F;  5KXB A;  4LBQ D;  2JEN A;  3HNY M;  3GJA A;  4IE0 A;  1ND3 B;  4FP2 A;  5C8C A;  2BBV A;  4MH0 E;  4UFK A;  3H8U A;  2NMO A;  4YW7 A;  5FZL A;  4KU8 A;  3H3U A;  2XJR A;  5CB7 A;  2XON A;  2ZMN A;  2OQ6 A;  5A7N A;  3VKL A;  5C3Q A;  5JSP A;  1K5M A;  1YCI A;  2Y60 A;  5CKN A;  2R49 A;  3QAC A;  3PLQ A;  2VUD A;  4GB3 3;  4EQV A;  3H8X A;  2BQP A;  2L9L A;  3N35 A;  3ZKU A;  3V65 A;  5GAL A;  2Q30 A;  1JYI A;  4XYX A;  4LUK A;  1UYX A;  4NVP A;  4PT6 A;  4IV1 B;  1R08 2;  3IDC B;  2VAU A;  1W9Y A;  1QH6 A;  1G8W A;  2LW8 A;  2P6H A;  2QKD A;  3M3I A;  1JU3 A;  2P3J A;  4GWI A;  4YVS C;  3RYR A;  3DEM A;  1D0G A;  1ACC A;  1GMM A;  2IXC A;  1QJY 3;  3BVC A;  3DGT A;  4JRL A;  4XVH A;  2QDR A;  1RUE 1;  2A3X A;  3JQX A;  4Z2W A;  3ZSL A;  1Y3T A;  4OYU A;  5LK7 B;  4ONU A;  2DFC A;  2WNU A;  4NII A;  3ZYP A;  4RQP C;  3OPT A;  2JDA A;  3OUH A;  3H8O A;  5JPN B;  2E53 A;  2XHK A;  3UL2 A;  1JYN A;  5EZW A;  3N9Q A;  4LHL A;  5EIY B;  3MF6 A;  5FYS A;  1FPN 2;  1SAC A;  2PHT A;  4DMI A;  5CEH A;  3AL5 A;  1NY7 2;  2Z5W A;  3ZYB A;  5F3I A;  3GNE A;  4XBQ A;  4LBQ B;  1NCR C;  3S6P A;  3SIS A;  3WCS A;  3K4A A;  4C91 A;  3MIG A;  1H6X A;  1YQ2 A;  5FPA A;  2YB7 A;  4ZS3 A;  3VBO B;  4B1L A;  1K12 A;  2P1B A;  4RR3 C;  4GAL A;  4XUT A;  1XRU A;  2KM2 A;  1D4M 1;  3AKR A;  1JZ5 A;  4NRP A;  3PUH A;  5CIS A;  1YXW A;  1GZT A;  2WN2 A;  4A7K A;  4AI9 A;  1AYM 1;  3ZYI B;  4JKK A;  1YNA A;  1UYZ A;  3UV9 A;  1VBC 1;  3HN3 A;  1CGP A;  4Q8L A;  5BV6 A;  4S2F A;  4RN5 A;  4AVV A;  1RUH 2;  3W5N A;  4CCL A;  5ABJ C;  1LOA A;  1SLT A;  1WUV A;  2J7M A;  2ZGK A;  4N9I A;  1O3R A;  2VU9 A;  5DDJ 3;  3KGL A;  1ZZB A;  4QPW A;  5FYH A;  3WD5 A;  3URF A;  3WVJ A;  4IUG A;  4C8D A;  4IGO A;  1ZRC A;  2WT2 A;  1PO2 2;  1QJU 3;  1UY4 A;  3TNQ A;  1W6N B;  5DG2 A;  1LES A;  1ODN A;  4HFS A;  5BYN A;  2B7Y A;  3SEP A;  2P4E A;  2QQU A;  3Q8F A;  3LOB A;  1BZW A;  2RDQ A;  2QQN A;  1ZBE 3;  2QDN A;  1COV 3;  1VMF A;  5FZH A;  2WFP A;  1Z7S 1;  3WLU A;  1DZR A;  1NG0 A;  4E27 A;  4MVT A;  4YW2 A;  1RUJ 1;  5DZF A;  1MQT B;  3QBQ A;  2PLV 2;  5T5J A;  3WF0 A;  1LUL A;  4AL9 A;  4AVC A;  4QB1 A;  1J1L A;  2ARA A;  4K1Y A;  1W9F A;  2VTF A;  3BOD A;  3F2Z A;  4UXA A;  1SFN A;  4ZZ5 A;  1CN1 A;  5FLI A;  1UMH A;  5DXD A;  3CJI C;  2BGP A;  4Q4V 1;  4MG2 A;  2ZGN A;  4NAM A;  4OQ8 A;  1UXX X;  2GC3 A;  2R04 3;  4I02 A;  2X53 S;  1XNT A;  4Z82 A;  2ZZJ A;  2GZW A;  2R30 A;  1OA2 A;  2JDN A;  3J26 N;  2YFZ A;  5HV0 A;  4Q0Q A;  2CSG A;  3WHU A;  3JB8 A;  5IVF A;  3WIN E;  1W9T A;  5FZ4 A;  4IE5 A;  2RHP A;  5I8Y A;  2DU0 A;  3VBU C;  2F6B A;  2Y6J A;  3KVA A;  5B4X A;  4NWW A;  2X09 A;  1J3R A;  4XCA A;  1ZRD A;  4AXO A;  4QQP A;  1QIQ A;  3PJQ A;  2JG8 A;  1VPH A;  1WA6 X;  4FCA A;  4CDQ A;  2GP3 A;  3I2J A;  1U5Z A;  2A3Y A;  4YZ3 A;  2E63 A;  4AYU A;  2V4V A;  3ZO0 B;  3PUS A;  1W6O B;  4Q5O A;  3ZXD A;  3OY8 B;  3AMN A;  3O1O A;  5D8A B;  1AVB A;  1V00 A;  2W91 A;  1CD3 G;  2WL1 A;  3K3O A;  4JGZ C;  5DUW A;  4QHZ A;  1WZX A;  4MV2 A;  4DFS A;  3E6B A;  2BYV E;  4LOT A;  4H14 A;  2BFU S;  3H7J A;  1Q8S A;  1AL0 G;  4J1W A;  5IAX A;  1NXD 1;  3LEG A;  2YBK A;  2OXB A;  2O8O A;  2PHU A;  5AC9 3;  3VBF B;  1CAX A;  1NY7 1;  1OOP A;  2I45 A;  4X8N A;  5FKB A;  1B09 A;  1W8W A;  3U4X A;  3A21 A;  3OBZ A;  3OBR A;  3MBW A;  4V2W A;  2ZJC A;  3I3Q A;  5FAX A;  4IEY A;  3KT7 A;  3VBO A;  3POS A;  2UYA A;  4K8F A;  1GZW B;  3MFC A;  2YGM A;  5J1X A;  2HYX A;  3AM2 A;  4AQ2 A;  1EV1 1;  4D69 A;  3ZR6 A;  3WNM A;  3PDQ A;  4NHL A;  4MXW A;  1FOD 1;  1US2 A;  1TQ5 A;  5EQU A;  4Q4Y 2;  4HVQ A;  1RUF 2;  4RS5 C;  2VZ1 A;  3NAP C;  4XUN A;  1TEI A;  1SLC A;  1VBB 2;  1SPP B;  3N36 A;  2DCK A;  2IXJ A;  1AR7 1;  4R4X A;  1FV3 A;  4FI9 A;  3I7D A;  3UJO A;  1LOF C;  4LPL A;  3C2U A;  1UU4 A;  1F8V A;  3U4S A;  3AP7 A;  5I0U A;  2MEV 2;  2Q8O A;  1CVN A;  5C8C B;  2UWC A;  2BVV A;  2BW8 A;  2VR4 A;  1P8J A;  3WF2 A;  3ZYR A;  4GWM A;  2ARB A;  3KF3 A;  2E7A A;  1QQP 2;  1JYW A;  4HOO A;  3RI8 A;  1U12 A;  4CPB D;  1F5J A;  5DN2 A;  3IT8 A;  3IPV B;  2ARE A;  3VBS A;  5JXH A;  3NST A;  2D6O X;  5BNO C;  4EN7 B;  1BHG A;  4Q27 A;  4YFW A;  4L92 A;  3ZFG C;  2R06 3;  5FZD A;  2Y26 A;  3WG3 A;  3QLQ A;  1AYM 3;  2RDN A;  1VAM A;  1PZ9 A;  2DFB A;  5FZB A;  4ES8 A;  2H0V A;  2WQ4 A;  4YAR A;  1X50 A;  4OI2 A;  3LEM A;  5LAS A;  1VBE 3;  4AVB A;  1UWW A;  2JJ6 A;  3O1S A;  2GC0 A;  3EYP A;  4FPF A;  2F4L A;  1YJL A;  3EMR A;  1UY1 A;  4P9L A;  1QNW A;  2E31 A;  3POI A;  5K0U C;  1SLA A;  4XAA A;  2VE1 A;  4NAO A;  1E5S A;  2BVB A;  2PEL A;  3TBD A;  4AI1 A;  1NXM A;  4O7X A;  3WUD A;  3GBF A;  4CEY A;  1C4R A;  4LE3 A;  1V9U 1;  1RMU 1;  4R9B A;  2A6Y A;  1Y43 B;  1DFQ A;  2FMD A;  2XLF A;  3VBS B;  3VV1 A;  3BUC A;  2EVX A;  2R1D A;  2AEN A;  4BHP A;  1JYT A;  4PQQ A;  4IEX A;  2C4X A;  2BTV C;  2QQO A;  4M01 A;  4WM7 A;  5C3O A;  2ZKL A;  4YNI A;  5JIU A;  4IL7 A;  4XHB A;  1I3H A;  1VP6 A;  5GLW A;  1F4H A;  4N43 A;  2BU9 A;  3SXW A;  3OPZ A;  4LO6 B;  4XXA A;  4K20 A;  1FV2 A;  3NKG A;  4XJA A;  5FZO A;  3RFR A;  3VBU B;  4AGV A;  1PGL 1;  1ONA A;  1OLM A;  2QQK A;  3J7L A;  5F32 A;  1LGC A;  2WS9 1;  2FCV A;  4CU8 A;  3CO2 A;  1E57 A;  5GLT A;  1H8T C;  5JI7 A;  2VW2 A;  4EZH A;  2P2K A;  4LMF A;  5FCC A;  1LHV A;  5KC6 A;  4D94 A;  2V4A A;  5A32 A;  3WDW A;  1R09 3;  2KR2 A;  4OCT A;  4RL7 A;  2QTW B;  5JZG B;  4BA6 A;  4UW6 A;  3WF3 A;  2W47 A;  1T6G C;  2EIC A;  4XAB A;  1XE8 A;  1WBF A;  1SFY A;  5JXJ A;  1L3J A;  1RUD 1;  4RFT 0;  3KHC A;  1PMJ X;  4JHZ A;  2XUE A;  1HB1 A;  1RGS A;  2Y6F A;  3NNG A;  3OTF A;  2BDR A;  4TXW A;  1C1L A;  1U5I A;  4XHX A;  2GAU A;  5F2W A;  4A3Z A;  4QHB A;  3S7I A;  4XFA A;  1BVV A;  5JCT A;  4YW4 A;  4JKM A;  1OHF A;  2DUQ A;  3POY A;  2D97 A;  3TNP B;  3ZN6 A;  2GNB A;  2VCC A;  5FUP A;  2B9U A;  3A7Q A;  2RS5 3;  3I97 A;  3KWV A;  2BGO A;  4IND A;  2NQY A;  3H3Z A;  3QCW A;  3BKZ A;  5FZO B;  1IPJ A;  1ULP A;  4CDX A;  3RDI A;  4Q4X 2;  3BTA A;  1LHO A;  1SHW B;  1XNA A;  1AL2 2;  1Y9M A;  3QH6 A;  2ZX2 A;  4P02 B;  5J36 A;  3TEZ A;  5BNO A;  2D6K A;  2HWC 3;  4RHV 2;  3VDC A;  3SMH A;  2A6Z A;  4QM8 A;  5C8W A;  3WDX A;  2PFW A;  5JLV A;  1OLQ A;  4F83 A;  4AHW A;  4OQ9 A;  2AEY A;  3GYD A;  4A42 A;  1QWR A;  4ZS2 A;  3FUQ A;  2VXR A;  2WSU A;  3AK0 A;  3MEP A;  2WWS A;  1A3K A;  4LBM A;  4MGI E;  1ZVF A;  1SLL A;  1W9W A;  3PTY A;  2JG9 B;  2OUJ A;  1KDM A;  3AZV A;  2IZW A;  3FBY A;  5L9V A;  1O59 A;  4Y5Z 0;  4K6B A;  2GN3 A;  4E8D A;  2J42 A;  2PLV 1;  2WWJ A;  1LB2 A;  1AR7 3;  3AZZ A;  4OZX A;  4H2A A;  4XF9 A;  5HCF A;  3AJY A;  3TRS B;  1OXC A;  5FYI A;  2ZCW A;  2WT1 A;  5IFT A;  2WNU B;  1E5R A;  1W6O A;  3LFI A;  2TBV A;  1HRI 3;  1DQ0 A;  5IVC A;  2E7T A;  2BUK A;  2RJK A;  4BK5 A;  4CCJ A;  2P17 A;  3FHA A;  3SHR A;  1RUC 3;  3UYJ A;  3VKM A;  3ZSE A;  5FZC A;  2VME A;  3RI9 A;  2FDH A;  1KQR A;  4GB3 2;  3ZVX A;  1MZ5 A;  5K8S A;  1VAK A;  1GOH A;  3ETP A;  2DV9 A;  2W92 A;  2IVI B;  3UET A;  1YIF A;  5DUX A;  4CCE A;  3RWK X;  2W68 A;  4OHV A;  1JZ8 A;  2UWA A;  2HEV F;  1PIV 2;  2JXA A;  4M4P A;  3UK9 A;  4CDW A;  5CKQ A;  1H6Y A;  1NCQ A;  1WMD A;  1W8T A;  1W2N A;  3WZ1 A;  5DAW A;  5DAX A;  3E5U A;  1V6J A;  3JUU A;  1REF A;  3K4Z A;  3ZSJ A;  4BDV B;  1W6M B;  4HKL A;  3SEE A;  2BGC A;  2JDK A;  3MIH A;  2OPK A;  4HN1 A;  4GH4 B;  2A1X A;  3HT1 A;  4P9I A;  3AMQ A;  1LGN A;  1FNY A;  1WCS A;  4OUS A;  5EPA A;  1QDC A;  4GMP 1;  2BNO A;  5FYC A;  1VRB A;  2WNV C;  4Y1Z A;  4CDQ C;  2WZR 1;  2HWB 2;  1Q5O A;  2OQ7 A;  4N53 C;  2D44 A;  1JOP A;  1RMU 3;  5DAQ A;  5ISL A;  2DUR A;  2J1S A;  2PHD A;  4PLN A;  4ZY9 A;  4PIY A;  3SCH A;  3WG4 A;  4IW3 A;  4CEW B;  3VGI A;  1HXS 2;  2ENR A;  2JDU A;  4XPV A;  3HNB M;  3MIE A;  2GME A;  1MEC 2;  3P5B A;  3ST7 A;  3O7O A;  4U2A A;  5EJZ B;  2GNM A;  1V6K A;  5GLU A;  5EHD A;  4NIA A;  4AI3 A;  4E4Z A;  2JKX A;  1ND3 C;  2W3J A;  4Q4Y 1;  4IEV A;  4LBJ A;  1NAE A;  3CQO A;  5JIA A;  2VZV A;  1J84 A;  3ZR5 A;  1LOE A;  1PZ8 A;  1PNF A;  3OUJ A;  1RUI 1;  5FR3 A;  1ASJ 2;  1MVE A;  2P3K A;  3KV5 A;  3O1R A;  1YO8 A;  1ZBA 2;  2VOK A;  3ATG A;  1FAY A;  3BTZ A;  3GJB A;  1PHM A;  3AYC A;  2YG0 A;  4UW4 A;  3CF6 E;  1QMJ A;  2ZBJ A;  4CYD A;  2C24 A;  1IPS A;  1HN1 A;  5LY2 A;  4XFG A;  3RQ0 A;  4MXW B;  4AHX A;  1WLC A;  2JIJ A;  2TEP A;  1BLZ A;  3HQX A;  4TLG A;  3H0O A;  4KG0 A;  3BOP A;  1EAH 2;  1IQA A;  3CNA A;  1PGW 1;  4E8C A;  1UZY A;  5FO7 B;  3ETQ A;  1PIV 1;  2QQJ A;  2RJ2 A;  4MLO A;  3T2O A;  1VR3 A;  4YVW B;  2EF6 A;  1AR9 3;  4AFC A;  4U36 A;  1W8N A;  1KIT A;  2CHH A;  3ZOI A;  4YGE A;  3BPS A;  4I0B A;  1G9F A;  2RDS A;  4YZ4 A;  3FZ3 A;  3OEA A;  3PTR B;  4QXK A;  4YGD A;  2K0G A;  3DEC A;  2BWC A;  4XFI A;  1W8H A;  2B46 X;  2GAL A;  4JAA A;  4LIT A;  1QOS A;  3MZH A;  4LKF A;  1CAV A;  4WVM A;  1QJU 1;  1MR5 A;  1CZT A;  5FP8 A;  4GB3 1;  4FSJ A;  3LGR A;  3ZXK A;  2W52 A;  4AEJ A;  1SLI A;  4AK3 A;  3HQR A;  5I0D A;  4QAW A;  3W21 A;  2G19 A;  2JG8 B;  3C7H A;  4QGN A;  4XZP A;  3I4I A;  3LA2 A;  3OJB A;  3ME2 A;  5FQ0 A;  2HWC 1;  3USU A;  1NZI A;  3E5X A;  2YMZ A;  5CFC A;  2WII B;  4UBH A;  4QXB A;  3KT1 A;  4Q0V A;  2RS1 3;  1WMX A;  2HWD 1;  1FT9 A;  4HBN A;  1QY4 A;  1NCR A;  4FOV A;  5ACA 2;  1SBD A;  5L7O A;  1K42 A;  3MIB A;  1F9K A;  5DMY A;  2HWD 2;  3I54 A;  4KL1 A;  1WKY A;  1ST8 A;  3C7G A;  4IES A;  4LO7 A;  5JR2 A;  4FTE A;  1CX4 A;  1R1A 3;  1W6N A;  2V72 A;  1UIJ A;  2VW1 A;  3Q8A A;  4K8R B;  4R9A A;  4MGQ A;  3I2G A;  5FZF A;  4XMA A;  1UF2 C;  2ADD A;  3R05 A;  2WNU C;  1S0I A;  2ZKN A;  3ILF A;  4PBO A;  1YRZ A;  4FVV A;  1JU4 A;  2WFF 2;  4RR3 B;  2OUH A;  4C0B A;  2HWF 3;  2ZX1 A;  3PVN A;  2EXH A;  3ZN5 A;  3NL1 A;  1D2S A;  3AXE A;  4O9G A;  2OVU A;  2IFR A;  1GQH A;  1TE1 B;  1MS3 A;  1WME A;  4YM0 A;  4RGK A;  4NHM A;  1IKQ A;  1OA3 A;  3GXU A;  2CWM A;  4M4R A;  4XAC A;  1XSR A;  5FJH A;  2ARC A;  5E8A A;  4Y1X A;  4CEW A;  1POQ A;  1RL3 A;  1ULF A;  3QD6 A;  4ZU5 A;  3WNO A;  4AQT A;  1H2L A;  1O4Z A;  1XJA A;  3VBH B;  4DY5 A;  1JYC A;  1UOF A;  1C5I A;  1WLT A;  4LR4 A;  1IGO A;  4QX3 A;  1UL9 A;  1V70 A;  2UU8 A;  2C9K A;  1K5M C;  5BNP A;  3MDP A; 
#chains in the Genus database with same CATH homology
 3T08 A;  2JDA A;  2J1U A;  1JYN A;  5EIY B;  4UI9 L;  3LE0 A;  2VM9 A;  3K4A A;  4W8J A;  1H6X A;  1YQ2 A;  3MUZ 1;  2YB7 A;  4D8M A;  2CDO A;  1K12 A;  4QDQ A;  4XUT A;  3WF4 A;  1JZ5 A;  2C26 A;  1UYY A;  4JX0 A;  3PUH A;  2WN2 A;  4JKK A;  1UYZ A;  2J1V A;  1OH4 A;  2Z4F A;  1XPW A;  3HN3 A;  1OD3 A;  1W0N A;  1UY2 A;  4RN5 A;  5C7G A;  3W5N A;  4P00 B;  3LQC A;  2J7M A;  3WF1 A;  4MAD A;  1OF3 A;  1DYO A;  4A6O A;  4QPW A;  3EB7 A;  3CZU A;  4P5Y A;  2WYS A;  2J1A A;  4IUG A;  2HLE A;  2QQM A;  3BN6 A;  1UY4 A;  3A22 A;  3SEP A;  3AC0 A;  4BJ0 A;  1R64 A;  2QQN A;  2VQT A;  3NRU A;  3U37 A;  4DXS A;  1JHJ A;  3OBA A;  3D3A A;  2LS6 A;  1T2X A;  2X10 A;  2X05 A;  3I2I A;  4QB1 A;  3F2Z A;  2VTF A;  3E1F 1;  4ZZ5 A;  1EUU A;  3ECQ A;  1UMH A;  4KWU A;  1GU3 A;  3CMG A;  2BGP A;  3DYP A;  2VMC A;  2W9X A;  3UES A;  4QB6 A;  1DLC A;  3VDA A;  1UXX X;  3SKV A;  1XNT A;  2OKX A;  2W5F A;  1JZ7 A;  3IB3 A;  4HG6 B;  2XQX A;  2YFZ A;  3NJV A;  2YC4 A;  3III A;  1W9T A;  2VCB A;  2VZT A;  1SG3 A;  3C7F A;  3VD3 A;  2VQU A;  3I2K A;  2Y6J A;  3MUY 1;  5B4X A;  3ACI A;  2X09 A;  4JKL A;  1W9S A;  2VZU A;  5LCW L;  3I2J A;  1TVG A;  4RYD A;  3FL7 A;  2RV9 A;  1GOG A;  4QX2 A;  4CUA A;  2V4V A;  2WQ8 A;  4KI5 M;  2W91 A;  2WZ8 A;  2W94 A;  4QDR A;  1CZS A;  1IQD C;  2W87 A;  4QX1 A;  4Z2A A;  3HPN A;  3LEG A;  3CZJ A;  2BBA A;  4A4A A;  1W8O A;  5C70 A;  3T0D A;  3ACF A;  2V5D A;  3A21 A;  3MBW A;  4OZO A;  4D0Q A;  5J1X A;  2HYX A;  1JZ3 A;  1K45 A;  4QDS A;  1WCQ A;  3WNM A;  2WAO A;  1US2 A;  2VZ1 A;  3CKH A;  3WNL A;  4XUN A;  1MPX A;  2DCK A;  3OGR A;  4ET7 A;  4FI9 A;  3DYO A;  4LPL A;  4KMQ A;  4YPJ A;  4XZU G;  5JXI A;  4AAX A;  3LEK A;  2VR4 A;  2Y6K A;  1P8J A;  2XHN A;  3WF2 A;  2VCA A;  3OG2 A;  1JYW A;  1KGY A;  4MOA A;  3THC A;  5DN2 A;  2ID4 A;  1UZ0 A;  2VOT A;  5JXH A;  1BHG A;  3P6B A;  3I3E A;  3OGV A;  4DUX A;  4PF1 A;  3CIH A;  1CIY A;  2VJX A;  4BK4 A;  3C7O A;  3UNP A;  4XUP A;  1UWW A;  3EYP A;  1UY1 A;  1L7R A;  2E31 A;  1UMI A;  2ZEX A;  3MV1 1;  3VD9 A;  2ZXQ A;  1O8P A;  4GZ9 A;  2VZ3 A;  2YC2 A;  4DXT A;  3VD7 A;  5JMO A;  4ZXE A;  3T0B A;  3PUI A;  4UOJ A;  4GWJ A;  1GQP A;  5C71 A;  4PQQ A;  2W1Q A;  4W50 A;  4OMC A;  2C4X A;  5JUV A;  2QQO A;  4QX0 A;  3MV0 1;  5LA1 A;  3P1I A;  1JZ2 A;  1D7P M;  1F4H A;  1US3 A;  1NKG A;  3WNK A;  2WDB A;  2VZR A;  2WAB A;  4ZZ8 A;  2QQK A;  3T2P A;  4CU8 A;  4CVU A;  1GUI A;  1TG7 A;  2YFU A;  3CDZ B;  3NQH A;  3WNN A;  1GNY A;  1ULO A;  2WN3 A;  1CX1 A;  3HNM A;  3I3D A;  3WF3 A;  2W47 A;  2EIC A;  1PX3 A;  5JXJ A;  2ZEW A;  2VMF A;  2ZEY A;  3WEZ A;  1PMJ X;  4JHZ A;  1XC6 A;  3NNG A;  4BXS V;  4TXW A;  4A3Z A;  3W5M A;  2PQS A;  4JKM A;  3OEB A;  2VO5 A;  2E33 A;  2KD7 A;  2VCC A;  3A7Q A;  3I97 A;  2BGO A;  3FHQ A;  1ULP A;  4DEV A;  3GM8 A;  4W4Z A;  1SHW B;  2QQI A;  2QQL A;  1XNA A;  1CZV A;  4P02 B;  1PMH X;  4XUR A;  3VDC A;  1SDD B;  1NUK A;  4ARY A;  5EJ1 B;  3JXS A;  2R7E B;  2J22 A;  4OMD A;  5FUI A;  4DUV A;  4CU7 A;  2VL4 A;  4A42 A;  3J7H A;  2XOM A;  2WZE A;  3DYM A;  4XUO A;  2JE8 A;  1W9W A;  1F4A A;  2W1W A;  1O59 A;  4E8D A;  3VDB A;  2VC9 A;  1I5P A;  4MO3 M;  1JYV A;  5IFT A;  2WUH A;  4CU9 A;  1JI6 A;  4BK5 A;  3THD A;  3FHA A;  3WSO A;  4CU6 A;  2Y64 A;  4LHS A;  3ZM8 A;  2VME A;  1JZ6 A;  2Y6L A;  1LNS A;  2JD9 A;  1K3I A;  2QBX A;  2DDU A;  1GOH A;  3ETP A;  5G05 L;  5LA2 A;  2W92 A;  2W1S A;  3UET A;  1GOF A;  2EIB A;  2J1T A;  3A23 A;  3K77 A;  4LKS A;  1JZ8 A;  2WO2 A;  1UY3 A;  5CZK A;  4M4P A;  5LA0 A;  1H6Y A;  4XUQ A;  1JYX A;  5JXG A;  4A45 A;  3K75 B;  3I3B A;  1OT5 A;  3K4Z A;  4BDV B;  2W95 A;  3MO4 A;  3SEE A;  2RVA A;  2ORZ A;  1W99 A;  3OB8 A;  5IFP A;  1OF4 A;  2VMD A;  2BZD A;  1RYY A;  5CYY A;  2DCJ A;  1PX4 A;  1DP0 A;  4CUC A;  2J1S A;  4ZY9 A;  4DUW A;  4L0P A;  5IYY A;  3HJR A;  3HNB M;  3K4D A;  3FN9 A;  5EJZ B;  4MGS A;  2CDP A;  2JKX A;  2W3J A;  2Y6H A;  3GDB A;  1NAE A;  3CQO A;  4DEQ A;  2VZV A;  1J84 A;  2WO3 A;  4ARX A;  1KEX A;  3VD4 A;  2VZO A;  5G04 L;  3ACG A;  1L7Q A;  1UXZ A;  5IHR A;  1UY0 A;  3LEI A;  5HPO A;  2VZP A;  2YG0 A;  3C8X A;  2EID A;  3GGL A;  3WQB A;  1HN1 A;  3ABZ A;  3T2Q A;  5F7U A;  2W46 A;  4DXR A;  5A1A A;  3ACH A;  2J1R A;  4E8C A;  2WBK A;  2QQJ A;  2RJ2 A;  2Y8K A;  5IJR A;  3T2O A;  4P08 A;  2B9V A;  1W8N A;  1EUT A;  3C7E A;  2BER A;  5HXM A;  3BGA A;  3HOB A;  3OEA A;  3DEC A;  4CUB A;  3IAQ A;  2E32 A;  5DPN A;  2EIE A;  3LPF A;  2VZS A;  1CZT A;  5I0D A;  4QAW A;  3I2F A;  2J1E A;  3C7H A;  1JZ4 A;  3T09 A;  3T0A A;  4QB2 A;  1O8S A;  4A41 A;  4TTG A;  4A44 A;  2B4K A;  3K46 A;  5B4N A;  3HNY M;  1K42 A;  5DMY A;  1WKY A;  3C7G A;  5JR2 A;  2E26 A;  2W1U A;  3LPG A;  4UAP A;  3SKJ E;  2V72 A;  2WO1 A;  3WF0 A;  4AG4 A;  2XON A;  4MGQ A;  3I2G A;  3IAP A;  4OUE A;  3VD5 A;  3HEI A;  1JU4 A;  2WAA A;  2L9L A;  1J83 A;  1UX7 A;  1UYX A;  4PT6 A;  3GXU A;  4M4R A;  3I2H A;  2VZQ A;  2LW8 A;  1JU3 A;  4GWI A;  3IDA A;  4LQR A;  3WNP A;  1GMM A;  3WNO A;  4XVH A;  5DQ0 A;  2Y6G A;  2ZEZ A;  4QX3 A;  4OYU A;  3OGS A;  1NX9 A;  2C9K A;  2ORX A;  3NJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...