1NAEA

Structure of cscbm6-3 from clostridium stercorarium in complex with xylotriose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
GGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative xylanase
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains
pubmed doi rcsb
source organism Clostridium stercorarium
total genus 29
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1naeA00
3T2OA 1JHJA 4CVUA 1UY2A 1KGYA 3GGLA 3VD9A 2C26A 4QPWA 4DXRA 3DYMA 3T0DA 3A21A 3LEGA 3ACGA 1UXZA 3ETPA 3OGVA 2VMFA 4KI5M 3WEZA 5G05L 2QQMA 2EIEA 3IAQA 4XURA 1TVGA 3BGAA 3MUZ1 1OH4A 2LS6A 1JYNA 2CDOA 3I2JA 1GUIA 3EB7A 3MO4A 2XOMA 1GMMA 3GXUA 2ID4A 3I2IA 3LPFA 5IFTA 3THDA 2WBKA 1GNYA 2E33A 4XUOA 4W8JA 4A3ZA 5EJZB 2VZRA 2ZEZA 3T08A 1CX1A 1PMJX 3CQOA 4QB1A 4ZZ5A 4OZOA 1JU4A 2W1SA 2WAAA 1OT5A 3I97A 2VZSA 3SKJE 3ABZA 2WO3A 5J1XA 1UXXX 2VZOA 1JYXA 3CKHA 1GOHA 3CZUA 3NQHA 1UY1A 4ET7A 2VO5A 1NAEA 2WYSA 3T0AA 1KEXA 1YQ2A 2C9KA 3A7QA 3LEKA 2QQOA 2J22A 4A42A 3LEIA 2LW8A 4JKLA 4AAXA 2J1EA 2XQXA 2V5DA 3WQBA 4UOJA 2VTFA 1RYYA 1CZVA 4BJ0A 3T2PA 3SEEA 1W8NA 3F2ZA 2DCJA 5IJRA 5JMOA 2HYXA 2ZXQA 3LE0A 2RJ2A 2KD7A 1UX7A 2J1AA 2VQUA 1H6XA 3A22A 4P00B 4XUTA 3JXSA 3K4DA 3A23A 1OF3A 1IQDC 5I0DA 3FHAA 3K77A 2B9VA 3I3BA 1BHGA 4RN5A 1JZ6A 2RVAA 3DYPA 1XNTA 3W5NA 2QBXA 1W9SA 3THCA 5HXMA 2BZDA 4DUWA 5JXGA 2JDAA 5EJ1B 2Y6JA 3AC0A 4BK5A 2X05A 2WN2A 4QX0A 4DXSA 2VZVA 2QQJA 2VCAA 1MPXA 4LKSA 5JR2A 5CZKA 3FHQA 4GWIA 3OGSA 4BXSV 1D7PM 5IHRA 4MOAA 2VZ1A 4MADA 3MV01 3I2KA 1W8OA 1WCQA 5JUVA 3HPNA 2X10A 4HG6B 4TXWA 3CMGA 3K46A 2ZEXA 2J1TA 4XUNA 2J1SA 1NX9A 3J7HA 3E1F1 1NKGA 5DN2A 2V4VA 3MV11 1P8JA 2W3JA 1O59A 1K45A 4DEVA 2EIDA 4QDQA 1W9TA 3OBAA 3LPGA 1R64A 5LA0A 1SG3A 2Y6HA 3C7OA 4MGSA 1DYOA 4QB2A 5JXIA 2BBAA 1SDDB 2L9LA 3HNMA 1US2A 3DECA 1JZ3A 2E31A 2VZQA 2EICA 3K4AA 4QAWA 2VC9A 4UAPA 2VZUA 4PQQA 1NUKA 4E8CA 4ARYA 2W92A 3VD4A 2J7MA 2VCCA 4L0PA 5G04L 2VOTA 3FL7A 3I2FA 2W87A 4A41A 3C7HA 1XC6A 1CZSA 3T2QA 4P08A 4JX0A 2J1RA 5FUIA 4P02B 1JZ7A 3WF1A 5B4XA 2VZPA 3HOBA 4JKKA 1O8PA 2OKXA 2WZEA 2W1UA 5IYYA 3CIHA 5F7UA 1EUUA 4UI9L 4BDVB 3IAPA 1GQPA 5C70A 4W50A 5DQ0A 3EYPA 4DUVA 4CU6A 4CU7A 1GU3A 4BK4A 3WF2A 4QX1A 3C8XA 2JKXA 4QX2A 3P6BA 3WF4A 1TG7A 2YB7A 2Y6LA 2JE8A 2YC4A 3WSOA 4QDSA 4QB6A 4MO3M 2YFZA 4CU9A 1PMHX 2QQKA 2R7EB 4E8DA 3ZM8A 3OGRA 5DMYA 2E26A 2VR4A 2BGPA 2W5FA 4XVHA 4DUXA 4XUPA 2QQLA 1L7RA 4LPLA 4A45A 1OF4A 4QDRA 4LQRA 1UY3A 4CUAA 3NJVA 2Z4FA 2VJXA 4YPJA 4ARXA 1GOFA 2ORZA 1JZ4A 5A1AA 1CIYA 2DDUA 3WNKA 3UETA 3OG2A 2QQIA 2J1UA 3I2HA 4CU8A 5C71A 3VD5A 2VMCA 3BN6A 1XPWA 2YFUA 3VD3A 1ULOA 2WQ8A 1K42A 4CUBA 4ZXEA 4OUEA 1UMIA 1J83A 2WN3A 3NNGA 3T0BA 1UYYA 4M4RA 2Y64A 2YG0A 4GZ9A 4JHZA 1UZ0A 3I2GA 1HN1A 1H6YA 4QX3A 2WZ8A 2DCKA 4D0QA 4AG4A 2JD9A 2VMDA 4ZZ8A 3P1IA 1CZTA 3C7FA 3K75B 1ULPA 1LNSA 3C7GA 4PT6A 3K4ZA 3WNOA 3HEIA 4A44A 5IFPA 3UESA 1T2XA 3OEAA 1UYZA 2W94A 2ZEYA 3ACFA 1PX4A 2WUHA 4ZY9A 1UY4A 5LCWL 5DPNA 3MUY1 3WNNA 3C7EA 3DYOA 3GDBA 2VQTA 3VDCA 1JZ2A 3SEPA 1F4AA 2VMEA 3CZJA 5LA2A 4A4AA 1SHWB 3VDAA 1JZ8A 1JZ5A 2BERA 1US3A 3I3EA 4CUCA 1I5PA 3PUIA 3D3AA 2Y8KA 2X09A 1WKYA 3GM8A 3HN3A 2PQSA 2W1WA 3NJXA 4Z2AA 1W0NA 2XHNA 4RYDA 2W91A 1K12A 3CDZB 4D8MA 4FI9A 2CDPA 4M4PA 2XONA 5JXHA 1EUTA 2QQNA 3PUHA 1J84A 2VM9A 1JU3A 2Y6GA 1DLCA 2J1VA 3WF0A 1GOGA 3IIIA 2E32A 2WABA 2WDBA 3VD7A 2B4KA 1W9WA 3ECQA 3HJRA 3SKVA 5LA1A 4PF1A 2W47A 5HPOA 3OB8A 1L7QA 1O8SA 4DXTA 1UYXA 5B4NA 1F4HA 2C4XA 2WO2A 5C7GA 1UY0A 4W4ZA 2VL4A 2W46A 4JKMA 1JYWA 3UNPA 2W95A 5CYYA 2V72A 4OYUA 3U37A 2EIBA 4MGQA 2WAOA 1K3IA 1PX3A 1DP0A 2VZ3A 2ZEWA 5JXJA 1W99A 3LQCA 2BGOA 1UMHA 3W5MA 3IDAA 2YC2A 4DEQA 3WNPA 1JI6A 2RV9A 2HLEA 2W1QA 3WF3A 3HNYM 3FN9A 3IB3A 4GWJA 2ORXA 4XUQA 3MBWA 3OEBA 3WNMA 3ACIA 4KMQA 3T09A 4A6OA 4TTGA 4OMDA 2W9XA 3HNBM 1OD3A 4KWUA 4IUGA 4LHSA 2VZTA 1UWWA 4OMCA 3ACHA 2VCBA 5EIYB 2WO1A 3I3DA 3NRUA 1JYVA 3VDBA 4XZUG 4P5YA 2Y6KA 3WNLA 1XNAA
chains in the Genus database with same CATH superfamily
2KM2A 3WOGA 5IK4A 3POIA 2UYAA 4XCBA 3T2OA 1OFNA 1UY2A 3KGZA 5SV8A 1C8M1 4QPWA 1LODA 1U12A 5KXEA 3ES1A 3G6JB 4K1YA 4CDQA 3KM5A 4FAGA 3H1WA 4Q29A 3ZXJA 1UXZA 3ETPA 5K0UC 5FTTC 1WGPA 4YW5A 1AR71 2PAMA 1FYUA 2QQMA 4IV1A 2A6VA 2VNGA 3IAQA 4WM8C 4XURA 1JW6A 3J7MA 4P9YA 1LOAA 3HT2A 1OH4A 1GWKA 2C1FA 1FPN2 3UK9A 5KR7A 1TME1 3VBOA 1GUIA 3DCQA 4A2UA 1MZ5A 2YUEA 3Q8BA 1MS5A 3I2IA 5IFTA 2BV4A 2E33A 4W8JA 4A3ZA 3ME2A 2VZRA 3WW1A 5A1FA 5K0UB 2WZR1 1XB9A 4JVAA 1CX1A 1R082 1LKNA 4F3JA 2XLFA 4XIKA 3M3QA 4N53A 1MZEA 4WM8B 5DUUA 5GZDA 3ZFGC 4B7KA 3NMBA 3HN1A 2D3RA 2WAAA 2VZSA 4RR3C 1ZNPA 4XDOA 2KXLA 5AC91 3B5LB 2VG9A 3DXUA 1ENSA 1QQP2 5J1XA 4LK6A 4M3CB 3VKLA 5A3MA 1UXXX 2XJUA 3B01A 3CEWA 1LECA 3AMMA 5DDJ3 2WWJA 3BPSA 3CZUA 5IVBA 3TEZA 5DZGA 3RI8A 1WD4A 4RFRB 2VO5A 2G4IA 1AR83 3LA7A 4FOVA 4O9GA 1IKQA 2ZKLA 4IEZA 5M0TA 1X82A 3N35A 5A3LA 3LEKA 1CX4A 3U4XA 5J36A 1KDKA 3ACLA 3ZFGB 1MQTB 5ACA2 1ENXA 2VNOA 4N9IA 4JHTA 4QPIA 1B35B 1RGSA 1YIFA 5JLVA 2WIIB 1UOFA 3H3LA 4KU8A 4AI9A 5H9SA 1AR91 4FQZA 2KR2A 2XBO1 2F17A 4UOJA 1W3XA 2YZ4A 3AFKA 2GSYA 1Y9QA 2XJVA 1POV1 3ALQA 3VUOA 4Y33A 4GULA 3M3EA 1U0AA 3F2ZA 1NCQC 2DCJA 3WP5A 1UCXA 4X8PA 3VKNA 3ZFFA 1Q43A 2JG9C 5F9TA 3LE0A 3NVCA 2J1AA 1WMDA 2CU5A 4BQXA 1H6XA 2VGDA 4Q4Y2 4BOWA 1YCIA 4XUTA 2JD4A 4NPMA 3K4DA 2VPVA 3A23A 2FCTA 4HMZA 1APNA 3MF9A 3K77A 4RN5A 2ZMKA 3KT7A 1RUF1 3BTYA 1GLHA 3U11A 3W5NA 1XU2A 2QBXA 3UKTA 1W9SA 3AMPA 3JBG1 1YFXA 2GNDA 5L73A 3ZYHA 3N9NA 4DUWA 5FYVA 3M1HA 2W52A 4IXLA 3AC0A 1KRIA 2WNEA 1XE0A 1REFA 5GLUA 4QQPA 4DXSA 3FFQA 1DQ4A 2MEV2 1O3TA 1OBNA 2VUCA 5LK5A 3FHQA 4ISRA 2VH9A 3N9LA 1WLCA 5KHIA 3OGSA 3TNPB 1A34A 2ET1A 4XMAA 5IHRA 4MOAA 3M3OA 1MS9A 2VZ1A 4YVSB 2ARCA 4QM8A 2NM1A 4MADA 3RYRA 5IK5A 3MLKA 5JOYA 3ZN6B 1HB3A 3PVEA 1W8OA 1WCQA 2DCYA 1EP0A 2X10A 2PLV3 3K46A 5ABJC 1TQ5A 3MEPA 3ZIXA 1REDA 1WCUA 4GMP1 4YVWA 1MS1A 3HQUA 4P14A 1NX9A 2K0GA 3ENRA 4ATFA 4COUA 3J7HA 2LRPA 2R1DA 3E1F1 5FY7A 5IUQA 2B46X 4XAAA 1RUJ3 3PU3A 2BDRA 1P8JA 5FP9A 3J26N 3AXEA 2HEWF 3O0WA 1K45A 3CU7A 4S2FA 4RHV3 4DS0A 4DEVA 4AF9A 1QXPA 1R64A 3MICA 4OI1A 4MGSA 1YC61 2FDFA 3I54A 5ABJB 1CVNA 2ZHMA 5FFOC 1DYOA 5GZFA 4D7TA 1F9KA 1FXZA 1NLRA 3I59B 3KT1A 2BP6A 2HWD2 4P9XA 3KV6A 2BBAA 1SDDB 2WYFA 4UFMA 3VKMA 1HB4A 1ZBA3 2GC1A 3KVAA 4XTPA 5GALA 4RS5B 1QJX3 2RS32 1ZZ9A 3UGGA 4PHZA 2P34A 1PO12 1H2NA 2QQWA 1YWKA 3ZXFA 3GZTB 2BNMA 4HLTA 1UPSA 4MXVA 4PQQA 5FXWA 3RYPA 4ARYA 2C9AA 4Q26A 3MIBA 4M0NA 3MIHA 1LGBA 2PAEA 2RR12 3T1MA 2ZGQA 5JVVA 2W87A 1HB1A 4YG3A 3AZVA 2JDPA 3RMYA 3WQ7A 3SNMA 1ZVFA 1VAKA 1AXYA 5FUIA 1C4RA 2WT0A 1AYM2 4PLOA 1JZ7A 1LENA 2ZX3A 2ZOEB 4JKKA 4NWVA 4EYUA 4DPNA 2A5ZA 2AH2A 2O14A 1PVC1 4PIYA 3RPQA 5A7OA 4EN7B 1ND3A 4B4QA 5IYYA 2GALA 3CIHA 1J3QA 3EJKA 5J48A 3OPWA 1UF2C 2VXJA 4M3CE 4F7ZA 4BH9A 3BYWA 1EUUA 3T1LA 3IAPA 5EYYA 2PHUA 2GNBA 5JPMB 2Q5TA 3I8TA 5F5IA 1H4GA 4CU6A 3RZMA 1RVF1 5GZCA 4CU7A 1W0PA 4MXWA 4ORFA 2ZZQA 1MS3A 2R0HA 1D4M3 3WF2A 2FDIA 1YI7A 3C8XA 4CDXA 4PI0A 3P6BA 4YG0A 1G6NA 1BEV1 1W6NA 4LHLA 2YB7A 4QHZA 3TBDA 4C0HA 4DRVA 2YBKA 2JE8A 1UW8A 2YC4A 5FZBA 3VBRA 1DQ1A 4QB6A 5LZ6A 5HXVA 4AYUA 2YFZA 2RM21 1AYM1 1GQHA 1PMHX 1RUC2 2NN8A 2QQKA 5A32B 4NJ4A 2AACA 4JQRA 3POWA 2FDJA 1YHFA 4LLFA 2ZX1A 4I0BA 4LIUA 1IS6A 1I3HA 3ILNA 2BGPA 2CWSA 2W5FA 4FOQA 3RG0A 2GC2A 2WFF2 1QOTA 2DURA 4JTNA 5BNPA 2QQLA 3IZOA 4AHWA 1L7RA 1Y9GA 3E5QA 5E8AA 1AUYA 1GZCA 4A45A 2VMHA 3KD4A 1FOD2 1YQ5A 4JZRA 1LGCA 3O14A 4CUAA 3POGA 2WS93 3BODA 4Z82A 2BOJA 2HWC2 1V6IA 2GN7A 3TN91 1A78A 1J58A 4ARXA 2ORZA 1T6BX 5C3OA 1JZ4A 3JZVA 5A1AA 3BTZA 4EN9B 1QJZA 3DGTA 1CIYA 3LSDA 2D6KA 4LBJA 3O1OA 5A1LA 2ZHLA 4QWNA 1G9FA 1MEC2 1Y9MA 2XVLA 5FAXA 2QQIA 4GB33 3I2HA 4NMIA 5D1IA 1UKRA 3TEXA 3VZMA 1LU2A 1W6QB 1W9YA 4I02A 4UW6A 2IUWA 1UZWA 3RDIA 1O7FA 4MV2A 1PZ9A 5FY1A 3VD3A 2BVVA 2YFUA 5FXVA 1W2UA 1BVVA 4XE9A 5CBLA 2R061 4K6BA 5KWRA 3NKTA 4KNCA 5FZLA 4BA6A 2VUDA 1HDKA 4GMP0 1ENRA 4XFFA 4N7IA 2WQ4A 4ZXEA 1GWMA 1UMIA 2D5HA 4OUEA 1RHI3 5K0UA 1TZOA 4LO6B 5A3OA 1J83A 1VE0A 1IOAA 4ZHNA 4KWJA 4NWWA 4WM8A 1ZBE2 3ZSJA 2BW8A 3J8F2 1LU1A 3SH4A 2Y64A 3GNEA 3K2OA 5LASA 4QX3A 4M3CA 5LATA 4UXAA 2WZ8A 1AYN2 4LK7A 3L2HA 3HWJA 4NR1A 1BBT1 2FZ2A 2JD9A 3VZKA 1G7YA 3SCGA 3K75B 2E9QA 1MR5A 5FPVA 5CISA 4R8HA 4L11A 5K8SA 1W05A 3H8XA 3HEIA 4A44A 3ROUA 5E6HA 4L97A 4B4RA 5IFPA 2HWB2 4YW3A 1W6MB 5FZIA 2GMPA 5J98B 3ZFGA 3KHBA 1MQTA 2RMU1 5DPNA 3MUY1 5F6KA 3RZJA 4ISQA 1B35A 3IIAA 4K20A 4UYBA 2RS52 1IS5A 4I3GA 5IAXA 4LBQD 2VMEA 3PU8A 4NAMA 3WCSA 4CP0A 3ZYGA 3DEMA 1IZ3A 2B9UA 1JZ5A 1EAH3 3ZXAC 3KCXA 1JYIA 2CGPA 3EMRA 1G9CA 4CUCA 4LT5A 3MGUA 1I5PA 3PUIA 3D3AA 4FPFA 3WUDA 3TEWA 3VHRA 1NY72 3GM8A 1Q8SA 2W1WA 1RUH1 5FK7A 5GM0A 3OPZA 2X8KA 1REEA 4QKDA 2VOVA 2VOKA 1VAVA 3ZYBA 4D6SA 3T4VA 5F2SA 3H8RA 1V00A 4YLZA 4LKFA 1QY4A 1JODA 4Q4X1 1LHWA 4D8MA 4EWAA 1UU6A 1W90A 3M8LA 5BY5A 3ZMOA 3D8CA 4B7EA 3N9MA 1V6MA 2DU0A 1VBE3 4QX7A 3S5QA 3O0XA 4PBPA 2XONA 2HWF1 3NNFA 4EV0A 4HN0A 4B3NA 4L2NA 3WG2A 5EJ3A 4K3UA 1W2AX 3OY8B 1HKDA 3H8UA 5EV7A 3VBUC 2K46A 1JU3A 4AWDA 5BYNA 2PFWA 2Y6GA 5D2AA 4XFAA 2XJSA 1ULCA 3SMHA 2WDBA 4I09A 2B4KA 2ZACA 1S0JA 2XJQA 5FZEA 3SKVA 2AREA 1HRI3 2BU9A 1AL22 3JU9A 1WW5A 3N7KA 4OZXA 5FBZA 4PF1A 1PIV3 1ND2C 3OB8A 1O8SA 2MPFA 4P5HA 3J7LA 2NQYA 1F4HA 2C4XA 3GBFA 3ITQA 3KCCA 4Q4V3 1TNFA 2IXJA 1NYWA 1UOGA 5JMCA 1OXCA 1UY0A 3E5UA 1J3RA 2WRAA 3ZN6A 1SLIA 1XYOA 2W46A 1WLTA 1JYWA 2VMGA 3WD5A 4LOSA 2W95A 3VBUB 4QT6A 5CYYA 4C8DA 1IG3A 5EYXA 1S2KA 3JQWA 4CDUA 2V72A 4FPJA 5CB7A 4DZGA 2O8OA 1XRUA 3R4SA 4Q4W3 3UT0A 4K40A 5FY8A 2ZX4A 4JGZB 1K3IA 2GNMA 5FZHA 5L7OC 4Q8LA 3AL6A 4IGOA 4UFIA 1JXNA 2D7FA 3S6PA 5JXJA 5APAA 2BGOA 1ZRFA 4GJYA 3W5MA 5CKQA 1VRH2 2Q30A 4LUMA 2PTMA 4LJHA 4WM7B 1XNKA 1GNHA 1JI6A 1VB4A 2RV9A 3KF5A 4W6YA 5ABJA 1HX6A 1QWRA 2V5YA 3I59A 1HRV1 4NRPA 2GNTA 2G9GA 5BNOC 2DVGA 3IB3A 2Q8OA 4P9LA 1DBNA 2IXIA 4SBVA 4AL9A 5L7OB 3AFGA 4LHNA 4RS5A 5JIUA 2GC0A 4QHBA 3OEBA 3BI3A 1NA1C 3ACIA 4KMQA 4UW5A 1RUE2 1V9U2 1CONA 2XH6A 1NOVA 1XYNA 1OQEA 2JDNA 3LWCA 4A6OA 5HCFA 4CCMA 1TMF3 3X29B 3WHTA 4LO5B 1UWWA 2ZHNA 3ACHA 3I3DA 1Z7S2 4BIFA 2CGOA 4WZCA 1UN1A 2RS11 4XZUG 2VU9A 5BNOB 1BMV1 3WNLA 5KXBA 3FFZA 1N3OA 2ZGKA 1UYPA 3BTAA 4X6QB 1NA1B 4CVUA 3V0AB 3EO6A 1PVXA 1KGYA 5LEJA 3DYMA 4XBQA 3POJA 1AR61 4DO0A 2WJSA 2JE9A 1UZZA 2CWMA 1LOGA 3BB6A 4KGGA 4UFKA 2EIEA 2XVGA 3UKVA 5T52A 5A7SA 3ZXDA 4AR2A 1TVGA 5EPAA 3ZX7A 1JYNA 4AOCA 2IZWA 2RHPA 5F3CA 1AF9A 1G9DA 3EB7A 3MO4A 4Y1ZA 3GXUA 4AGRA 5I0SA 4FP2A 2ID4A 4BISA 4XCAA 5A6ZA 1QJFA 2PXJA 1DYKA 1ZREA 4IGQA 5EJZB 2VQ0A 5JZGB 5JOWA 2ZHKA 4GA9A 1CGPA 1UZYA 1QXRA 2ZEZA 3QOPA 4PJYA 3T08A 1FMD2 4QB1A 3AP7A 4OZOA 2ADEA 1JU4A 4ZPIA 1HV0A 1ODNA 4AQTA 1YFYA 4YW4A 5ANNA 1R091 3LB9A 2W1SA 5IK8A 4XJ9A 5FBJA 1R1A3 1VBC2 4LXLA 3FJSA 1UOJA 5A32A 5CFDB 1JHNA 4B4PA 1BXHA 1AHSA 1T6GC 1DYPA 3CKHA 1GOHA 1VBB3 2VMIA 3OUJA 3FC0A 1VBD1 3MW2A 3NQHA 3AP6A 3PMSA 3D5OA 5JSRA 1QOOA 1UMZA 2C5DA 2R042 3MIGA 1LRHA 1NAEA 3LKJA 3T0AA 3N7JA 1RUG3 4QX8A 1IHMA 2C9KA 3E6DA 3W21A 1EV11 3USUB 2JKBA 2XJPA 2QQOA 3J9SA 2SLIA 3UJOA 3OSDA 3LEIA 4JKLA 2JIJA 1WLDA 4JTOA 3WDXA 4E2QA 4SLIA 1KS4A 4XFGA 4AFAA 5FPUA 1RMU1 3WP6A 1PO23 2P6CA 1OVPA 1D0HA 1W04A 2DCTA 4FPOB 2HEVF 1HXS1 5CADA 1O3QA 4PF5A 2PHTA 3TYJA 2XLAA 3MYXA 3POSA 1ASJ1 3UJQA 2ZGTA 4AFBA 4XQDA 1CZVA 1COV3 2E7AA 5EHDA 3T2PA 2JECA 3I3QA 1JYTA 2R073 4L99A 1S2EA 3ZFEB 5JMOA 1MVEA 3O1MA 1RUI2 1IG0A 2HYXA 4XACA 2AYHA 2KD7A 2OZ6A 4MUVA 3U14A 3WP3A 3SHRA 5LW9A 4PIZA 1W6QA 3QLQA 1YFWA 3KLSA 2N7GA 1RUD2 2VUAA 5T5OA 3JXSA 5DZFA 2AC1A 4XBLA 5H9RA 3MPBA 1IQDC 1X36A 3FHAA 4LUKA 2OYZA 4QPGC 3I3BA 4O7XA 3OGGA 2VCMA 3DYPA 1QJU3 1DFQA 3WDUA 4FFFA 4HANA 1H2KA 1CQ9A 5F1RA 1SMVA 1N47A 2GAUA 4BQ5A 5CVRA 1QJY1 1C8M2 5FZAA 3OF1A 4V2VA 4DY3A 5D21A 3BU0A 1GV9A 2VZVA 4Y24A 2VCAA 5CZKA 1XOYA 3B7MA 1AR72 1VBA3 4Y1YA 2RDSA 3B3QE 1FV2A 2B42B 5AFBA 5FXZA 1OKOA 2ES3A 1H8VA 4B1LA 2Z42A 5BPXA 1TME2 3MV01 5CAZA 3KS7A 5EFUA 2G9ZA 3WQ0A 2WINB 2YC0A 5B2GB 5JUVA 1M06G 5IATA 4R9CA 4JDNA 5I0RA 2D43A 5CKMA 2OUHA 1W6MA 4LKEA 2ZEXA 2FCVA 3FZ3A 3APBA 1O5LA 1PK6C 1WCSA 2VE1A 3GBWA 2VQAA 4PDWB 2WZR2 2VBPA 4NRQA 1QF3A 5KHJA 3H9AA 3MV11 1MVQA 1S0GA 1DQ0A 1RJ8A 1RB8G 4URTA 4YZ5A 5AC92 2BTVC 4DB5A 4AK3A 2FQPA 3KCYA 1OOPB 4IV3C 4YGCA 2VNRA 1JMUB 4WBBA 1HIXA 4I0WB 2EIDA 4QDQA 5I8SA 4QHOA 3OBAA 4CCKA 3LPGA 1LJ7A 2R16A 1QEXA 1OLQA 2OPKA 2QCSB 3C7OA 4MSVA 1JYCA 2HWE3 3J7NA 5FZ0A 3AX4A 5GZEA 4LBLA 4CCCA 4EJRA 4QB2A 5CG9A 2A3YA 2EF6A 1PK6B 3VDDB 5GKAC 5JXIA 1SEFA 1QOSA 1C28A 3N4MA 2ZGOA 5DDJ1 1MACA 4UBGA 2VULA 4UWDA 4D7YA 3NO8A 1AR81 1JZ3A 2G19A 2VZQA 5GLZA 2QJVA 1GZTA 1D4VB 4H14A 4CA9A 5KBFA 1FV3A 1LOFC 2EICA 1ACCA 4FOYA 2ARBA 2ENRA 1BKZA 2DTWA 4IV3B 4Y20B 1B09A 2WT2A 3R05A 4YZ1A 3RGBA 1AR92 2CV6A 4QQOA 2UYBA 2XBO2 1H8TC 2ADDA 5H9QA 3ZDVA 5C3SA 3OY8A 4A7YA 2OT7A 2YV8A 2WNUC 2ZBJA 2J7MA 3N36A 5G04L 1D2QA 2HKXA 4BYYA 3RZGA 5DUWA 3WP4A 2LUWA 2QNKA 4A41A 4XHXA 1OH3A 3MIDA 3FBMA 5JPNB 3C7HA 4KWKA 1CZSA 1DGRA 5I91A 4CCDA 4NO4A 5BNQA 2HH9A 2WWSA 4P02B 1OQDA 2PHXA 3WF1A 1Q8PA 1V6NA 3HOBA 4OHXA 1O8PA 5FREA 3ZOIA 1H8TB 1UX6A 3JD73 3INAA 1ZZ6A 2AR6A 4YW7A 2OKXA 2WZEA 4Y1VA 1PMIA 3VBUA 3B94A 1S0EA 1RUF2 4G3YC 2ZGLA 1S1AA 3GZEA 4IEPA 4QPYA 4IEXA 5A3TA 2JJ6A 4RR3B 5HV4A 4FPKA 4XIOA 1QHDA 3JBG2 3H3UA 4CXXA 4HN1A 1XXNA 4JGZA 4UI9L 4XDQA 5DG1A 2D97A 1H1MA 5DQ0A 4MHUA 2XWBB 4JQTA 5CEHA 1SFPA 4BCUA 2I45A 1GP4A 4N43C 2BWCA 4JGYC 2RDRA 1WBFA 2JKXA 2R6QA 3WQ1A 1TG7A 2Y6LA 1Q8OA 2YXSA 4WM7A 3UKNA 3WSOA 1DQ6A 2MNGA 4MO3M 2BRTA 2P6HA 1IQAA 2ZAHA 3OBRA 4E8DA 2XGXA 2YHJA 1CJDA 5L7OA 4PBOA 4EZ4A 2Z5WA 2V73A 4Y1XA 3GCWA 5F6LB 5FZ6A 3WZ1A 3VHNA 2XQRA 4JGYB 2VR4A 2PLV1 1CPNA 3I7DA 4C90A 1NCQB 3C2UA 4XVHA 1NQJA 2JG9B 1PGL1 1BYHA 1J3PA 1CESA 4NOTA 3AMHA 1FPN3 1OF4A 4GKXA 3ZPYA 5FCCA 4QDRA 1AX2A 1UY3A 3HT1A 2W68A 1RUJ1 5GLVA 2ZZJA 5BNOA 2ETEA 2OQ6A 3OD4A 3AK0A 3FLTA 1KDMA 4YPJA 1GOFA 1NA1A 1DHKB 1SBEA 2BOIA 4RHV1 3V0AA 1WUVA 2WR9A 3QACA 3ZKUA 4B1MA 1R083 1LAJA 3N9OA 1GICA 5A6YA 2XJRA 2FDGA 1A6CA 4J25A 3V0BB 4NIGA 2J1UA 1OI6A 2W0XA 5E89A 1BQPA 1ZBA1 4XMIA 4AEJA 5C71A 3VD5A 1QQP3 4OI0A 1C1FA 1QJX1 2VMCA 2PQQA 2FMYA 4UW3A 1OLME 2FD8A 1LESA 1EYBA 4E4DX 5LEKA 4RL7A 1CN1A 3WXPA 4BQ4A 4MX3A 3WDYA 2DU1A 3TRSB 2WQ8A 3PVNA 1XE8A 2VW0A 2R1BA 2CYFA 3N7LA 2VOWA 5JZGA 4IEYA 4QKNA 5LBEA 4IEUA 3ZIWA 5ACA3 2AGSA 2WN3A 4HZFA 4NUBA 5J3UA 1UYYA 1ZRRA 2YG0A 1JBCA 2QVSB 4IE5A 4YW2A 1CAWB 4JHZA 3WX5A 3B9IA 2WLQA 3P5BA 4OI2A 5LB6A 5CFDA 5CA6A 5F37A 1HN1A 1S0CA 3PDQA 4IETA 3WW4A 1PVC2 5ISLA 2DCKA 4P9WA 4YZ3A 4JC1A 3I4IA 5EZWA 2H0VA 4EWDA 5JIAA 2WNOA 3C7GA 3LEMA 2D98A 2WLPA 3WNOA 3KSCA 4GXLA 4Q4Y3 3USUA 1PX4A 1RVF2 2WUHA 3UGFA 4Q8KA 3IDBB 4LKDA 4I01A 5A3UA 5FZGA 2ET7A 4KL1A 2A73B 4AVAA 1W2NA 2VQTA 1BEV2 1LCLA 4RQPC 4AHYA 3E6CC 3QCWA 3AM2A 3KV9A 1GSLA 4GJZA 3AVSA 4RSUA 3SEPA 4GWMA 4CPBA 1SHWB 1O3SA 2BERA 4FO9A 1D4M1 3G7DA 2EAKA 1US3A 3LDKA 2NYYA 2FCUA 2RM22 3ILRA 3I3EA 2PHFA 2PAKA 1R1ZA 1LEDA 5FZOB 3IDCB 1LOBA 5CFCC 1UIKA 2GC3A 3FBYA 3ZFEA 3HN3A 1FATA 5F3GA 3VHPA 3HMYA 2MEV3 4XF1A 4H7LA 4D3WA 1ULDA 4LE3A 5IVFA 2JDHA 1BK1A 1Q3EA 2C24A 1E5RA 2VW2A 4LTAA 3H3ZA 1YQ6A 1UPIA 2XHNA 4RYDA 2W91A 3VBFC 2DVBA 2LROA 2BQPA 4HSJA 3PIJA 4Q0UA 3DN7A 3EXUA 4KG8A 3OCPA 4DNYA 5DAPA 4R9AA 1JOBA 1W8ZA 2CDPA 2WSUA 4RD7A 2BEOA 4KBBA 4UBHA 2OW4A 5AVAA 5JXHA 5DAQA 3IPVB 3TN92 4MZUA 3KWVA 3VZLA 2FZ1A 1NQDA 5FZ7A 3PUHA 2WS91 1J84A 3BOPA 3BCWA 4QGLA 2VM9A 3NAPC 5EQUA 1N1SA 2J1VA 5FV3A 3WF0A 2B7YA 3AP4A 1NG0A 5T5LA 3VBFB 4E2GA 3VD7A 4IEVA 4R4ZA 4E4HA 4DY5A 1XYPA 4Q0PA 4PLMA 5JAXA 5LA1A 1PHMA 1X50A 2W47A 4HL0A 2BGCA 1H30A 4AVBA 4GB31 4ES9A 4W4ZA 1GZWB 1NZIA 2QQUA 3ZSLA 4JKMA 4YFZA 3O1PA 2R062 4XBNA 4LHKA 2HWD3 3KHCA 3NAPB 4CYDA 5JI9A 4QXHA 4QGNA 3U75A 2PA7A 4MGQA 4PDWA 2PMWB 3A0KA 2RS33 4NROA 5FMOL 1XSRA 1S0FA 4Q0QA 2BJSA 1GFF2 3MFCA 1WCKA 4QX5A 1PO13 5I93A 2NLRA 2R30A 4D7SA 1RHI1 4YNIA 3F95A 2ILMA 2FBEA 2ATFA 5T55A 3WUCA 4BM8A 3URFA 4PQ9A 1OOPA 1OHFA 3IDAA 2B8MA 2R0FA 5FY4A 4ZU7A 1SBDA 3AP9A 4K1ZA 2JDZA 3CF6E 1BBT2 1U5IA 2RR13 3NNMA 4C91A 2D5FA 4FAHA 1YIPA 3WF3A 4BMBA 1PK6A 3VDDA 4G9SB 2UU8A 2YGLA 1C8NA 3BVCA 4L92A 1OVSA 1PNFA 5C9AC 4Y1UA 4GWJA 5HCHA 4FSJA 2DCZA 4HPKB 1DIWA 1AYM3 2RMU2 3FUOA 3Q8FA 2GP3A 2P3JA 4GIQA 4L8QA 1OMIA 3VBSC 4XOGA 4IV3A 2RE9A 4Y20A 3VB9A 4YGEA 1AVBA 3MI8A 4FOWA 4OCTA 5GJ6A 3OUIA 4FPCA 4IUGA 3LF7A 1Y43B 2VZTA 4LHSA 3DL3A 1GQGA 1W6PB 2VCBA 2WO1A 5HV0A 5FJKA 1WWYA 2ZX2A 3D0SA 4YRDA 2Q8EA 1TEIA 4H55A 4YZ2A 5FO8B 3BOWA 2WZPP 4HK8A 1WW6A 4HONA 3VDBA 2WA4A 2Y6KA 4DXZA 2CSGA 3W58A 1EAH1 5C9AB 4UW4A 2ZA9A 1RUH2 3ZYFA 1W39A 1JHJA 2YBSA 2LALA 3J4UH 3VD9A 4DXRA 2H0BA 4TN7A 3PTYA 1SLBA 2UURA 1JTZX 3H7YA 1FAYA 2VMFA 4Q4X2 5J96B 2NP0A 4GH4C 2IFWA 3AYAA 5FYZA 2C0ZA 4I30A 1X33A 1RUC3 3MUZ1 1ALYA 4OUMA 1JUIA 4RR3A 3MW3A 4BE3A 2HWF2 2CDOA 1ODMA 4Q5OA 4HKOA 5FXXA 5BUVA 1GMMA 4CCOA 2OPWA 1VBE1 3MLJA 1FNYA 3AYDA 5FPBA 2YPDA 4IE4A 1GNYA 4XUOA 1N1VA 3LDRA 2WFF3 4CXWA 2O1QA 4CDQC 3LGRA 1DQ5A 3PVOA 5F5QA 5KHGA 2ZGSA 1H9PA 3OBZA 3ETQA 1PMJX 3CQOA 1Y7BA 1FOD3 3FLPA 1WCDJ 4GH4B 3HIFA 4TWTA 5T5PA 4ZZ5A 3KT4A 1KD7A 1UO9A 2E7QA 1CAXB 1OT5A 2DBNA 2HWC3 1HRI1 3I97A 4UFJA 2A6ZA 1WMFA 2W39A 5FZ3A 3SCHA 1PIV1 2Q1MA 3VBOC 4LA3A 2GDFA 3WCRA 3NV3A 5FZFA 4Q4V1 4AW7A 1JUHA 5KHKA 1X7NA 2EIGA 4RGGA 4YGBA 5A70A 3D4KA 4XPVA 1XNBA 4ET7A 4JGYA 2Q4SA 1MEC3 4QXBA 2V09A 2ZCWA 1DZRA 4NIIA 4HVQA 1UIJA 1NCQA 2AUYA 1GBGA 2JG9A 4FT8A 4Z07A 1CIWA 3NL1A 4C1WA 5FOJB 4KH9A 4Q4W1 3DV8A 1OPOA 2J22A 4A42A 2P3KA 2JDKA 4XILA 3CJXA 3CJIC 5L9BA 3CNAA 3FLRA 5IVYA 2XQXA 3ASIA 3VBOB 4QU1A 3KMHA 1YQ8A 3VGIA 3I2OA 2V5DA 3THPA 4FFIA 2VTFA 4LLOA 3ST7A 2D93A 1HRV2 1NCRC 1QDOA 1QGLA 2CHHA 3FE5A 1UAIA 3QBQA 1DGWA 2QKDA 4FP3A 1H1AA 4YM1A 5FZDA 4BJ0A 1Q8QA 3SEEA 1O4ZA 3N9QA 4TYSA 2V4AA 3BU7A 5IJRA 1XNCA 1ZBE3 5DABA 3V0BA 4EN8B 3J8F3 5FUPA 2OIIA 2ZXQA 5JSPA 1W8UA 2RJ2A 4IL7A 3AL5A 4R9BA 4YM0A 5C5TA 1UX7A 5K9YA 2P5BA 3O1TA 4FTBA 2VQUA 2QDRA 3VL8A 2E53A 3A22A 4P00B 3CJIB 3U10A 5AFEA 1W03A 1AYN3 1U5YA 4B29A 2GH8A 1DGWX 2JDYA 1OUXA 1H1IA 2E6VA 2TBVA 1NE6A 2WC2A 5E88A 2JG8C 3HQXA 1X8EA 5FZ1A 3U4SA 1BHGA 1ND2B 2YROA 3KQRA 4HFSA 1NCRB 1TMF1 2RS12 3BUCA 1BMV2 3LSEA 3MPPG 2HWB3 2PN5A 4CP2A 4HBNA 3PUAA 5HXMA 2BZDA 5T3NA 2GZWA 5JXGA 2Y6JA 3MHZA 1MS8A 4BK5A 2RS53 3RFRA 2WN2A 4QX0A 1AR62 1MPXA 1URXA 1VIWB 3NNLA 1CAUB 2J42A 4R4XA 3WG3A 3WNXA 1CAWA 1F31A 3ZMNA 1DQ2A 4GWIA 5ANQA 3W20A 2UY8A 5GLTA 4BXSV 4RGAA 2XMLA 2JG8B 4I2OA 1D7PM 1TE1B 5FY0A 1I6XA 2CAUA 5EXOA 3ELNA 3T2TA 1ZZ7A 4J1XA 3D82A 4Q1PA 5T54A 4ZS3A 2OVUA 4HG6B 2GN3A 4TXWA 3RMXA 3CMGA 4D94A 3UL2A 2Y34A 2ZAAA 3B69A 2B5HA 3TEYA 2EALA 1NZCA 4LMFA 3ZDSA 3EQEA 5A3WA 2Q8CA 1N3QA 1OLRA 4S2HA 2H6CA 5FZKA 2DVAA 1G9AA 5FYSA 2V4VA 1L3JA 3PUQA 1V6OA 1PGW1 1NLSA 1R092 4E9KA 3OYWB 3WINE 5FO7B 3WDWA 3ZVXA 5FP8A 2JENA 4QQLA 2W3JA 4WVWA 2D6MA 2QDNA 3HAGA 4CRQA 2A6WA 5FZOA 1HQNA 3ZYIB 4KU7A 5CIRA 1YFUA 5LBFA 4DQAA 1W9TA 2ZABA 5LA0A 3I49A 2RG4A 1R1A1 2NPIA 4FVVA 5A3NA 1VBD2 1SFNA 4KBZA 1IPJA 4IEWA 2O0OA 4YVWC 1AZDA 2ZGUA 1STMA 1AL23 1VBB1 3KF3A 4H7MA 2Y33A 5FKBA 4YG6A 2ZJCA 1EV12 4LBNA 1VALA 3H0OA 5LBBA 4F8AA 3S57A 2E31A 1RUG1 2LTNA 1RMU2 1SFYA 2ZPXA 3D6EA 3SC7X 3IDEA 3AZYA 1QU0A 3K4AA 4AQSA 2VC9A 4TLFA 1HXS2 3DUIA 3IPVA 1NUKA 4BQYA 4I0AA 3RQ0A 4GQ7A 3R4DB 4BQ2A 2XL9A 1ASJ2 1PO21 2QTWB 5F3EA 4AEDC 3S5AA 2HJIA 4L0PA 3ZPOA 2VOTA 2JIGA 2BVBA 3I2FA 4CP1A 1PM7A 4QXKA 3PNAA 4Y5Z0 5E16A 3WV6A 2Y6FA 3SH3A 1UL9A 1XC6A 4XYXA 1COV1 1W2TA 4BQ3A 3T2QA 5DZEA 2R071 1S0IA 2Q8DA 1OURA 1Q5OA 1VRH3 2J1RA 3POFA 4MG2A 3ORJA 1N1TA 4NVPA 5FY9A 1IPSA 3LOBA 4INDA 1GZWA 4OHZA 3W59A 1CD3G 4K8RB 3MDPA 2EAAA 5IW0A 1RUNA 2ZTNA 4UF0B 4UFLA 3NAPA 2E63A 1N3PA 3AXDA 4MVTA 3LDBA 4QMAA 4XJZA 4AEDB 4DMIA 1H4HA 1YEWA 3NW4A 1S55A 5DAWA 1C5HA 4BDVB 4LEJA 4YWAA 1GQPA 4W50A 1QJY2 1RUE3 1QJU1 1V9U3 1W8HA 2IVIB 2OQ7A 3K51A 2LM3A 5DAVA 5A7PA 3U07A 3ZXEA 5FK8A 2PHDA 4DUVA 5GLWA 1DDLA 3VN4A 4BQWA 2NMOA 3E97A 1GU3A 3O12A 2EXHA 4COYA 4M00A 1HN0A 3BALA 1VRBA 4QX2A 5TSWA 1Z7S3 5F3IA 2X5IC 2IXCA 1OSGA 3GHMA 5FYYA 5C5UA 1CR7A 3AKRA 3RWNA 5FPXA 4QDSA 1ND3C 1VBA1 3S7IA 4AQ2A 3I2DA 1C5IA 4LNVA 2GMEA 1BVP1 2VBDA 1NXMA 3CL1A 3ZM8A 5DMYA 2HBUA 4HPKA 4FPLA 1EPZA 4IEQA 1GNZA 4CPBD 1UU5A 2UWBA 3WW2A 2DUPA 4Y3OA 3USSA 2WNVC 3H42B 2D3SA 1GYKA 2X5IB 5A80A 3VBRC 1W6PA 2JB8A 1WW7A 3OGJA 4QD2A 1RITA 1IPKA 4AHZA 5FZMA 4OFGA 3NJVA 3P3NA 4C1XA 4Z8BA 3BIEA 4YFWA 1XJAA 2Z4FA 4M0HA 5C9AA 1HQWA 1KS5A 1AX1A 2VOXA 3ZSKA 2VJXA 4V2WA 1O4TA 4QPGB 1PM4A 1O3RA 1GZ9A 1V6JA 1QH7A 2D6NA 2I2SA 2JICA 2ZGMA 1FMD3 1FX5A 4XXAA 5DDJ2 4X6RB 3UETA 2OS2A 1BCXA 2HWE1 2RJKA 1KJRA 1JN2P 2DWRA 2ZS6B 1YI9A 2WNVB 1AR82 1VLNA 1SLLA 4XF3A 4HKLA 5T5JA 3U78A 4NPRA 1VBC3 2YYOA 3VBRB 1GP5A 1IS4A 2A3WA 4IE0A 2XVKA 1QNWA 3S30A 4AFMA 4ZKTB 3BN6A 4CCLA 4COWA 4IERA 2EXKA 2P17A 1XPWA 4E4ZA 5KC5A 1W9FA 3Q8AA 5HBAA 1QXJA 1NXD1 4XW3A 4URAA 2R043 4K21A 3TNQA 3PLQA 1NLQA 2HYKA 4CUBA 1OKQA 2Q1ZB 5FDBA 1E57A 2ZMNA 1K5JA 2A6XA 4GH4A 2B45X 5FPAA 3M70A 1CJPA 5BNNC 3OTFA 1XNDA 3NNGA 3T0BA 2WA3A 3B93A 2VXRA 1CAXA 1LOEA 1A8DA 4GZ9A 3ZXGA 1BZWA 2ERFA 2X53S 2JE7A 3MIFA 3O5SA 4AQ6A 2RJLA 1H6YA 1WW4A 2P4EA 3NNJA 5DUXA 3GCXA 2XLGA 1YNAA 1VMJA 3A0NA 4Q2FA 3WLUA 3WT3A 5IVVA 5L9VA 3MZHA 4ONUA 1YJLA 3P1IA 3JD71 3M3IA 4ZZ8A 1RUI3 4E4SA 2ZMLA 4HVOA 1LNSA 2BUKA 4PT6A 5L9RA 3K4ZA 2IXKA 5D8AC 4XC9A 2ARAA 3DPRC 3JUUA 3UESA 1T2XA 3OEAA 1UYZA 2W94A 4IW3A 4OLLA 4TLGA 1IGOA 3ACFA 3FMGA 4Y5SA 1OA3A 1RUD3 4IGPA 3WVJA 5BNNB 5KC6A 1UY4A 4LITA 5LCWL 4NIDA 5C33A 3C7EA 3NWKA 4AGVA 1SBFA 3DYOA 4XEZA 2P2KA 4O9EA 3NV2A 3GDBA 1VMFA 4YYOA 4CP9B 3OD0A 3VDCA 3V64A 3HQRA 1ZRCA 5LA2A 4AI0A 1W3VA 1W2OA 3CZJA 4A4AA 4JCKA 4XETA 1PNGA 2PYTA 3L2YA 1RL3A 2OUJA 1OFSA 1KFUL 4LBOA 3MLLA 4IESA 4FTSA 2YPJA 1Q56A 3NKGA 5D8AB 3ZSEA 1C8M3 1LHNA 1WKYA 2X09A 3DPRB 4P9IA 2VVFA 2WNUB 1MQTC 3NJXA 2F6BA 2PLV2 1AR73 4GWNA 1B35C 1I5ZA 1W0NA 1ONAA 3AVRA 3CJIA 4JRLA 1K12A 4BXFA 1F15A 1PGL2 3QH7A 1FT9A 4RFT0 3RZZA 2A75A 4BWOA 4W6XA 2PELA 5KXCA 3O1RA 1ND2A 1TME3 3VL9A 4FI9A 1NCRA 1RUJ2 2UWCA 4XABA 1NE4A 4FPYA 1SPPB 1FPN1 3VHOA 5DXDA 2BPA2 3T30A 5FLHA 4RHV2 3VLBB 3T3YA 4AVCA 4V1PA 2WZR3 3OOXA 3IMNA 4FPEA 1CAUA 2TNFA 4EWEA 2WABA 1JH5A 4Q0SA 1CAVB 4ATEA 4EROA 3ZSMA 5AC93 2TUNA 4XF0A 4YARA 2DTYA 2ARXA 1QIQA 5F5AA 1R081 1ZBA2 2JG8A 4LIVA 5LBCA 5HPOA 5IVCA 4CEWC 4DXTA 2EXJA 5L36A 3HBKA 1UYXA 5IK7A 4N43B 1QJX2 2QFEA 1S4CA 3FHIB 5FZ4A 5FWEA 3CBNA 4GAZA 2VL4A 1BK0A 2DFBA 3IKWA 1DCSA 1LR5A 3IWZA 3VZOA 1QQP1 1SLCA 4Q1RA 1V70A 4W6WA 3UNPA 3KV5A 4NPLA 4LORA 2CTVA 2P37A 4OYUA 2WQZC 2ZKNA 3U37A 4XF9A 2W2IA 3M4FA 3BPZA 3VZJA 4Y22B 4ES8A 3D0JA 2C6SA 4K9SA 1FNZA 5C8WA 2VZ3A 2ZEWA 3N3HA 3ZYPA 1W99A 3LQCA 3OYWA 4CEWB 5FWJA 2H6BA 4XQWA 4YVSC 1K5MC 5ACA1 1AR93 2XBO3 1OQ1A 4KG0A 4NHYA 3AKQA 2R49A 2R32A 2YC2A 4DEQA 5F39A 1DGRN 1POV3 2DBIA 4XHBA 5A33B 5IAVA 4NAOA 1W0OA 2HLEA 4LOTA 4LO7A 1SACA 3AB0A 4CDUC 4MHRA 2K2SA 3JCIA 2F4LA 3WDTA 5FYCA 5J37A 2F4PA 4A6SA 3WW3A 4AXOA 3BTXA 1W6OB 3V65A 1DZTA 4XFHA 5A7QA 4XUQA 3MBWA 2P3YA 2PHWA 3RZKA 1RIRA 3SXWA 1E5HA 3O1UA 1K5MB 4D6QA 1W28A 4Y4YA 1SQ4A 5F32A 4Q4Y1 5FZCA 1Z0HA 2G1MA 1JS9A 3LA2A 4OMDA 2W9XA 2YBPA 3HNBM 4BIOA 1OD3A 1RUF3 1Y4WA 4KWUA 2XG3A 3GZAA 1X9PA 5C6CA 5DAXA 1D4M2 3RRDA 3VBHC 5JWPA 2FDHA 5EIYB 4XXPA 4AVTA 3NRUA 3JBG3 4CDUB 5FJHA 2GMMA 4FXKB 4LBMA 3S7EA 1FI2A 2RDNA 4CEYC 4MGYE 3FWEA 1XNAA 1H0BA 2Y0OA 3ZR6A 4RS5C 3HBZA 4D69A 3RYKA 2P3IA 1GWLA 2MHFA 4UT5A 4YM3A 5DUVA 3KQ4B 5H9PA 3GGLA 2C26A 3NJYA 5FP7A 3K48A 1YJKA 3K3OA 3T0DA 2XUMA 3A21A 1ST8A 2MEV1 3LEGA 4WV8A 3ACGA 5CU1A 3OGVA 4KI5M 5FYMA 1HQLA 1UOBA 5G05L 3WEZA 5C3PA 3CHXA 2D6OX 3AKTA 4UF0A 3VBHB 1O91A 1OA2A 3O7OA 4NHMA 1D0GA 2VUJA 3IN9A 4AEDA 3BGAA 2LS6A 1CWPA 4AVVA 1O5UA 4CEYB 4CCJA 1RC6A 2EVXA 3DF0A 1AXZA 1QJEA 3I2JA 3R0RA 2QE3A 4GMP3 3UV9A 4DOUA 4YM2A 2FHRA 2WS92 2XOMA 3SLIA 4YSFA 1RXFA 3LPFA 3MW4A 2K9ZA 2WBKA 3THDA 1LHOA 2D40A 2VW1A 4A3XA 4B8EA 2JWPA 2IFRA 2FMDA 2QQPA 2PHRA 1H2LA 2A71A 2XXZA 3JQXA 5FUNA 5C8CC 5C4WC 2UY9A 4FPHA 2GH2A 2QUOA 3JB4C 4GB32 4KQ7A 4Z92B 3SKJE 2WSVA 4P9GA 3SISA 3ABZA 1G9BA 1OC1A 3LAGA 3WG4A 4RQPB 3LCPA 4FTEA 2WO3A 2WT1A 2CGNA 2VZOA 1OPMA 2XUEA 2GU9A 1JYXA 2Q1FA 2IVJA 2JXAA 3PTRB 2WFPA 4OHVA 2AZ5A 3PJQA 5A3PA 4AFDA 4HVRA 5KHHA 1UY1A 1QKQA 4HT1T 4NHXA 3ON7A 4XDPA 2HWD1 2WYSA 4ASKA 5CFCB 1KEXA 1YQ2A 5L19A 5CG8A 5LK7B 3TAYA 3KB5A 2X5IA 2CNAA 3A7QA 5C8CB 5C4WB 1RHI2 2RS31 4NIAA 1PGSA 4L9BA 4MYEA 1ZM1A 2LW8A 5FLIA 5FYHA 1OA4A 1POQA 1W8WA 4FQ4A 4AAXA 2J1EA 5FLJA 4D6RA 1J59A 1PO11 1SZBA 1WD3A 3MIEA 4E27A 2WWUA 3MFAA 1OLMA 4WVMB 2HBTA 1XU1A 4MGIE 3WQBA 3PUSA 1MZ6A 4QM9A 3M2MA 4QPGA 1MZFA 4OI4A 4XJAA 4LBKA 2QZ3A 3RS6A 1RYYA 3AP5A 4META 2RR11 1YUDA 1W8NA 2PHLA 3O0VA 3QH6A 5CNAA 4QXCA 2WNVA 4YGDA 5FP3A 1SLAA 1LHVA 1U5XA 4CDWC 3RWKX 3RVHA 2E7TA 4X8NA 1PVC3 1POV0 2Y0IA 4HETA 2VD7A 2XDVA 3IM0A 3KVBA 4N8MA 1OF3A 1LEMA 5I0DA 5JR7B 4OHYA 5FMBA 2B9VA 1JZ6A 3NV1A 4S2GA 3BIWE 2A1XA 3AYEA 2GP5A 1TNRA 1XNTA 2RVAA 2DVFA 4JDOA 3H1MA 1EAH2 5J7MA 1A8MA 2XWJB 3SH5A 3THCA 4BPZA 2IXHA 4U2AA 2VTXA 1RVF3 1S0DA 2AEYA 5LY2A 4XJWA 2JDAA 1UZVA 5EJ1B 4DFSA 1ZRIA 4YZ4A 1WA6X 4CDWB 2X05A 1BEV3 2D6PA 2QQJA 5JR2A 1EY2A 3HR9A 4LKSA 2EXIA 3AZWA 5JSOA 2JDUA 5K4LA 4QGMA 1V0AA 1ZYBA 2RM23 3HVDA 4ASMB 3GF6A 1QDCA 4N9HA 5A6XA 4CSWA 4LO8A 5IVJA 1BLZA 5EWSA 3I2KA 2EA7A 2OA2A 1RUC1 5FRAA 3HPNA 1VBE2 4IDZA 3NJZA 1WMEA 1YO8A 2A3XA 4ITCA 2J1TA 3RI9A 5BNNA 4XUNA 3KGLA 4PI2A 4TTGA 2BFUL 2D44A 2J1SA 3Q8EA 3VZNA 4OHWA 1G86A 5FZ8A 1AJKA 4CP9A 1VR3A 1NKGA 5DN2A 2WFF1 1HW5A 3GALA 1KJLA 4XF4A 5LA9A 2VVDA 5BV6A 2XJTA 3P3PA 1AJOA 1HRI2 1LOFA 2XR4A 2YU1A 4EQVA 3VBSB 1FOD1 1PIV2 2A6YA 3S0MA 1O59A 3RJRA 3TN93 2RDQA 1XSQA 5FQ0B 5D8AA 4Q4V2 3DPRA 2HWC1 1H8TA 1KFXL 3SITA 4EN6B 1SG3A 2Y6HA 3PVBB 4LO4B 1KXGA 3V56A 4AEMA 4BLJA 2WNUA 4OVEA 4TSVA 4A7ZA 5A7WB 4XZPA 5I0UA 4LBQB 1GKBA 4CZSA 2E51A 3FX3A 4OUSA 2YGMA 4KWLA 2L9LA 1RUOA 4WVZA 3HNMA 4Q4W2 4JRAA 1US2A 1HV1A 3DECA 1MEC1 3POBA 3ZR5A 4CUGA 3ZYJB 5E1RA 2WKKA 2R063 4F83A 4BLIA 4QAWA 3ZKYA 1SPPA 1WA4A 4PLNA 4QQ2A 5FZ9A 4MGKE 3SQOA 4UAPA 2VZUA 3PURA 4IV1C 1YYNA 4E8CA 3UGHA 1LTEA 2W92A 3VD4A 1DG6A 1F2NA 4H3WA 2ZGNA 2VCCA 5F8PA 1JOJA 3AJZA 3FL7A 1HJGA 4AI1A 3ZN4A 3E6BA 1VP6A 4J1WA 1CAVA 4ZONA 5HCAA 4GKYA 1LOCA 3R6SA 3H8OA 3N9PA 4JDMA 2OZJA 1DZQA 2VBBA 4P08A 1ZBE1 3OPTA 4GALA 4IEOA 4JX0A 4N43A 3J8F1 4CDQB 4WZFA 5B4XA 1BBT3 1GP6A 1YQCA 2VZPA 4AHXA 2D6LX 1VB2A 3ES4A 3RZHA 4IV1B 4AI2A 5LWBA 4RGKA 4N53C 2FDKA 1TMF2 1AYN1 2IC1A 2W1UA 1GANA 1DGLA 2Y60A 4KGQA 3T4HB 4Y22A 1VPHA 5F7UA 2RMU3 3PL0A 4ZU5A 4AGGA 3ATGA 3WHUA 4AI3A 4BMEA 1F35A 4MGZE 3EYPA 5C70A 2HWB1 3U1XA 4CEWA 1H2MA 5BXXA 3O1VA 3GBGA 4AI8A 4XJ8A 1XQNA 4Z2WA 3CLPA 3KZ4C 4ZXKA 1ZA4A 5LRRA 3ZXLA 2NZ9A 1LULA 4QX1A 4BK4A 1AXKA 3OUHA 2RS51 3LFIA 3WF4A 2Z69A 4M3CF 4QKFA 3BKZA 5GZGA 4N53B 3JB8A 5A33A 1W06A 4U36A 4QPIC 5FPZA 4PIXA 5T50A 3M7AA 2YU2A 1ENQA 1RUH3 4CU9A 3POEA 4CCEA 1W6OA 2BYVE 2R7EB 4HKWA 4HOOA 4JGZC 4MH0E 1ULEA 3LIGA 3VV1A 3OGRA 2VVEA 1C3HA 3AMNA 3H1YA 3ZN5A 5FPLA 1NY71 3OJBA 4BZ4A 3PIGA 2E26A 2Y38A 3GHNA 4G4FA 3MF6A 5FMOS 1W8TA 1RINA 1ZZ8A 1ZZBA 2ZGRA 5C3RA 1K5MA 3K3NA 1C57A 4P9JA 1AX0A 4Q4X3 4NN0A 4BHPA 5A6QA 3ZO0B 4W65A 1MS4A 1H9WA 2CL2A 4AVSA 2I07B 3PMEA 2AEZA 3ZFFC 1A3KA 1I9RA 1PGW2 4O61A 4XUPA 5C3QA 4DUXA 5FOBB 3IMMA 1UU4A 2ZGPA 4LPLA 4WM7C 3IT8A 3ZYRA 3LZZA 2HWF3 4LE4A 4K7JA 4QPIB 4LQRA 3WR0A 2G9FA 2DYCA 5JOXA 1Q8VA 4MLOA 2NMNA 3VKFC 1R1A2 4LA2A 1LHUA 1X9TA 1HB2A 5F2WA 3RZLA 2HEYF 2DVDA 5K7PA 1WBLA 1W8FA 1SCRA 4QQHA 1VBB2 3RSJA 3VKOA 2DDUA 3W9AA 3AKPA 3WNKA 5F5CA 3OG2A 1F5JA 4LULA 3L9JT 1UNBA 3ZFFB 4FFHA 4TZDA 4K8FA 1DU3D 3VBHA 1VJ2A 1AL21 1RUG2 4CU8A 4EZHA 1YLLA 2DUQA 4R9DA 1G8WA 5FMCA 3I3MA 2W08A 3AJYA 3B9CA 5CKNA 3PHMA 4A7KA 3GZUC 4CEYA 4Q0VA 2BFUS 4M01A 3AYCA 3LFMA 4XAEA 1PO22 1ULOA 1N1YA 4AAPA 2WL1A 3NV4A 5IT6A 1X8MA 4Z1VA 4AZZA 1K42A 3GJAA 5IWFA 3GJBA 3FUQA 1COV2 4CTEA 3IBMA 2JDMA 1F8VA 2R072 1OUSA 1E5IA 2P1BA 2XL7A 3TB0A 5IVEA 5JDBA 4M4RA 2CAVA 4PCRA 5J09A 4BU2A 1IKPA 4RQPA 1UZ0A 3I2GA 3EHKA 4E2SA 4DIQA 3U0ZA 1HRV3 1VRH1 2Z2SB 2CY6A 4COZA 1U5ZA 4D0QA 1GR3A 3AKSA 1PZ7A 2A7AA 2XKPA 4FXGB 3WG1A 4AG4A 5HI0A 2VMDA 4NIHA 1CZTA 3C7FA 1WZXA 5JZGC 3ILFA 1ULPA 3LIHA 5FYTA 1J1LA 5CFCA 3ZLIA 3EBRA 1QJU2 5I8TA 4IE7A 4S2DA 2ZEYA 3AZZA 4OQ8A 4O65A 5C8CA 1ZRDA 5AVPA 5C4WA 4DRRA 1CPMA 4WVVA 4ZY9A 4YVWB 1MS0A 3B02A 3WNNA 4C0BA 1YXWA 3Q8CA 2Q0AA 1RUE1 1V9U1 4HSLA 4QKBA 3VBFA 3PJYA 1RTVA 3RNSA 5A7NA 2B39A 5CFDC 2YDEA 2Z79A 1JZ2A 1SLTA 4WVMA 2RS13 3WDVA 1F4AA 4AE2A 5LY1A 1SDWA 3LD8A 3VDAA 1JZ8A 1VBA2 4QU2A 4RA0A 1V6LA 1UQXA 5HCBA 4XFCA 1Z7S1 4J6GA 5JCTA 2BBVA 1D2SA 2Y8KA 4AEKA 4FFGA 1DLLA 4BQ1A 3R4UA 2PQSA 1AR63 1HJFA 2DFCA 4OQ9A 2JEMA 2ZX0A 4Z2AA 1ZZCA 1YRZA 1QMJA 4NE9A 1KITA 5FYBA 2WO7A 3CDZB 1OD5A 2DV9A 4IE6A 2I74A 4XFIA 1UKGA 4LR4A 4FCAA 2BNOA 2XPJA 2VY0A 1C1LA 1RJ7A 4JV4A 5FR3A 3UYJA 4M4PA 5FP4A 2VTXJ 4YVSA 3CO2A 4NRMA 3THTA 1Y3TA 4GD4A 3AMQA 1UD1A 1XBFA 5FMDA 5I0TA 2Y26A 3B00A 3ZFEC 2JB4A 4R52A 1EUTA 1SCSA 3RJ2X 2QQNA 4MGTA 1WMXA 2TEPA 2BNNA 2O8QA 1RXGA 2KA3A 4CDWA 5I8YA 1DLCA 4COVA 2DF7A 3TWIA 3ZXKA 2HWE2 1GOGA 3IIIA 4OULA 2E32A 4ZU4A 3N7MA 1AL0G 1R093 3H7JA 3E5XA 1W9WA 3ECQA 3HJRA 1O6UA 4EN0A 1FMD1 4CCNA 4BB3A 5DG2A 1L7QA 5B4NA 4CXYA 2BWAA 4H2AA 3OBTA 3GYDA 2WO2A 5FYUA 2XB6C 5C7GA 5FO9B 1QH6A 1VBC1 4AFCA 2YY1A 1VBD3 2VAUA 4CDXC 1M4WA 3HD8B 2IWGB 2VNVA 5ERLA 2QZ2A 5SV5A 1LGNA 1ULGA 2IXLA 3AZXA 5JOZA 1ND3B 1EPWA 3DKWA 1EV13 4HK9A 2EIBA 5EP9A 2AENA 5FYIA 1IS3A 2WAOA 1L7LA 2R041 4ASLA 1F5FA 1PX3A 1DP0A 1S2BA 3DKQA 4HXCA 3O1SA 1RMU3 5FKCA 2JX9A 2YMZA 2XKOA 4NHLA 3POYA 4UFHA 1V6KA 4MXWB 3TOJA 3VBSA 3LA3A 1UMHA 3WY6A 1HXS3 4EE2A 5FIXA 4CDXB 5FQ0A 1HLCA 1ASJ3 1W6NB 5BNPC 1E5SA 3M3CA 3WNPA 1S0BA 2A70A 2W1QA 4N7UA 3JD72 5KXDA 5FY5A 5A7WA 1J1TA 4LBQA 1LB2A 4CE8A 2VECA 4PDWC 1ZA7A 4XJUA 4YW1A 2XHKA 3HNYM 3FN9A 4N90A 4Y26A 1WLWA 4IQPA 1JOPA 2ORXA 1Z78A 2D3PA 3QD6A 4FBFA 1XE7A 1RUI1 1ZX5A 2SBAA 3SCFA 3C3VA 4DINB 3WNMA 5LRSA 1O4YA 4ZS2A 4XFBA 5JI7A 1QNYA 3NSTA 4Q27A 4YW6A 4I3PA 3T09A 1OOPC 1VAMA 3Q9OA 3KV4A 4FPGA 1RUD1 4Y4RA 4JAAA 1BJQA 1NT0A 1ULFA 2X29A 5BNPB 1PZ8A 2DUOA 1VMHA 4OMCA 1DF0A 4XQ4A 4XTMA 4NHKA 3A4UA 1JYVA 2OX0A 3H50A 1KQRA 2QQVA 3DXTA 3VDDC 1I1EA 2OXBA 4P5YA 1QJY3 3LOIA 4Y5TA 2UWAA
chains in the Genus database with same CATH topology
3T2OA 1JHJA 4CVUA 1UY2A 1KGYA 3GGLA 3VD9A 2C26A 4QPWA 4DXRA 3DYMA 3T0DA 3A21A 3LEGA 3ACGA 1UXZA 3ETPA 3OGVA 2VMFA 4KI5M 3WEZA 5G05L 2QQMA 2EIEA 3IAQA 4XURA 1TVGA 3BGAA 3MUZ1 1OH4A 2LS6A 1JYNA 2CDOA 3I2JA 1GUIA 3EB7A 3MO4A 2XOMA 1GMMA 3GXUA 2ID4A 3I2IA 3LPFA 5IFTA 3THDA 2WBKA 1GNYA 2E33A 4XUOA 4W8JA 4A3ZA 5EJZB 2VZRA 2ZEZA 3T08A 1CX1A 1PMJX 3CQOA 4QB1A 4ZZ5A 4OZOA 1JU4A 2W1SA 2WAAA 1OT5A 3I97A 2VZSA 3SKJE 3ABZA 2WO3A 5J1XA 1UXXX 2VZOA 1JYXA 3CKHA 1GOHA 3CZUA 3NQHA 1UY1A 4ET7A 2VO5A 1NAEA 2WYSA 3T0AA 1KEXA 1YQ2A 2C9KA 3A7QA 3LEKA 2QQOA 2J22A 4A42A 3LEIA 2LW8A 4JKLA 4AAXA 2J1EA 2XQXA 2V5DA 3WQBA 4UOJA 2VTFA 1RYYA 1CZVA 4BJ0A 3T2PA 3SEEA 1W8NA 3F2ZA 2DCJA 5IJRA 5JMOA 2HYXA 2ZXQA 3LE0A 2RJ2A 2KD7A 1UX7A 2J1AA 2VQUA 1H6XA 3A22A 4P00B 4XUTA 3JXSA 3K4DA 3A23A 1OF3A 1IQDC 5I0DA 3FHAA 3K77A 2B9VA 3I3BA 1BHGA 4RN5A 1JZ6A 2RVAA 3DYPA 1XNTA 3W5NA 2QBXA 1W9SA 3THCA 5HXMA 2BZDA 4DUWA 5JXGA 2JDAA 5EJ1B 2Y6JA 3AC0A 4BK5A 2X05A 2WN2A 4QX0A 4DXSA 2VZVA 2QQJA 2VCAA 1MPXA 4LKSA 5JR2A 5CZKA 3FHQA 4GWIA 3OGSA 4BXSV 1D7PM 5IHRA 4MOAA 2VZ1A 4MADA 3MV01 3I2KA 1W8OA 1WCQA 5JUVA 3HPNA 2X10A 4HG6B 4TXWA 3CMGA 3K46A 2ZEXA 2J1TA 4XUNA 2J1SA 1NX9A 3J7HA 3E1F1 1NKGA 5DN2A 2V4VA 3MV11 1P8JA 2W3JA 1O59A 1K45A 4DEVA 2EIDA 4QDQA 1W9TA 3OBAA 3LPGA 1R64A 5LA0A 1SG3A 2Y6HA 3C7OA 4MGSA 1DYOA 4QB2A 5JXIA 2BBAA 1SDDB 2L9LA 3HNMA 1US2A 3DECA 1JZ3A 2E31A 2VZQA 2EICA 3K4AA 4QAWA 2VC9A 4UAPA 2VZUA 4PQQA 1NUKA 4E8CA 4ARYA 2W92A 3VD4A 2J7MA 2VCCA 4L0PA 5G04L 2VOTA 3FL7A 3I2FA 2W87A 4A41A 3C7HA 1XC6A 1CZSA 3T2QA 4P08A 4JX0A 2J1RA 5FUIA 4P02B 1JZ7A 3WF1A 5B4XA 2VZPA 3HOBA 4JKKA 1O8PA 2OKXA 2WZEA 2W1UA 5IYYA 3CIHA 5F7UA 1EUUA 4UI9L 4BDVB 3IAPA 1GQPA 5C70A 4W50A 5DQ0A 3EYPA 4DUVA 4CU6A 4CU7A 1GU3A 4BK4A 3WF2A 4QX1A 3C8XA 2JKXA 4QX2A 3P6BA 3WF4A 1TG7A 2YB7A 2Y6LA 2JE8A 2YC4A 3WSOA 4QDSA 4QB6A 4MO3M 2YFZA 4CU9A 1PMHX 2QQKA 2R7EB 4E8DA 3ZM8A 3OGRA 5DMYA 2E26A 2VR4A 2BGPA 2W5FA 4XVHA 4DUXA 4XUPA 2QQLA 1L7RA 4LPLA 4A45A 1OF4A 4QDRA 4LQRA 1UY3A 4CUAA 3NJVA 2Z4FA 2VJXA 4YPJA 4ARXA 1GOFA 2ORZA 1JZ4A 5A1AA 1CIYA 2DDUA 3WNKA 3UETA 3OG2A 2QQIA 2J1UA 3I2HA 4CU8A 5C71A 3VD5A 2VMCA 3BN6A 1XPWA 2YFUA 3VD3A 1ULOA 2WQ8A 1K42A 4CUBA 4ZXEA 4OUEA 1UMIA 1J83A 2WN3A 3NNGA 3T0BA 1UYYA 4M4RA 2Y64A 2YG0A 4GZ9A 4JHZA 1UZ0A 3I2GA 1HN1A 1H6YA 4QX3A 2WZ8A 2DCKA 4D0QA 4AG4A 2JD9A 2VMDA 4ZZ8A 3P1IA 1CZTA 3C7FA 3K75B 1ULPA 1LNSA 3C7GA 4PT6A 3K4ZA 3WNOA 3HEIA 4A44A 5IFPA 3UESA 1T2XA 3OEAA 1UYZA 2W94A 2ZEYA 3ACFA 1PX4A 2WUHA 4ZY9A 1UY4A 5LCWL 5DPNA 3MUY1 3WNNA 3C7EA 3DYOA 3GDBA 2VQTA 3VDCA 1JZ2A 3SEPA 1F4AA 2VMEA 3CZJA 5LA2A 4A4AA 1SHWB 3VDAA 1JZ8A 1JZ5A 2BERA 1US3A 3I3EA 4CUCA 1I5PA 3PUIA 3D3AA 2Y8KA 2X09A 1WKYA 3GM8A 3HN3A 2PQSA 2W1WA 3NJXA 4Z2AA 1W0NA 2XHNA 4RYDA 2W91A 1K12A 3CDZB 4D8MA 4FI9A 2CDPA 4M4PA 2XONA 5JXHA 1EUTA 2QQNA 3PUHA 1J84A 2VM9A 1JU3A 2Y6GA 1DLCA 2J1VA 3WF0A 1GOGA 3IIIA 2E32A 2WABA 2WDBA 3VD7A 2B4KA 1W9WA 3ECQA 3HJRA 3SKVA 5LA1A 4PF1A 2W47A 5HPOA 3OB8A 1L7QA 1O8SA 4DXTA 1UYXA 5B4NA 1F4HA 2C4XA 2WO2A 5C7GA 1UY0A 4W4ZA 2VL4A 2W46A 4JKMA 1JYWA 3UNPA 2W95A 5CYYA 2V72A 4OYUA 3U37A 2EIBA 4MGQA 2WAOA 1K3IA 1PX3A 1DP0A 2VZ3A 2ZEWA 5JXJA 1W99A 3LQCA 2BGOA 1UMHA 3W5MA 3IDAA 2YC2A 4DEQA 3WNPA 1JI6A 2RV9A 2HLEA 2W1QA 3WF3A 3HNYM 3FN9A 3IB3A 4GWJA 2ORXA 4XUQA 3MBWA 3OEBA 3WNMA 3ACIA 4KMQA 3T09A 4A6OA 4TTGA 4OMDA 2W9XA 3HNBM 1OD3A 4KWUA 4IUGA 4LHSA 2VZTA 1UWWA 4OMCA 3ACHA 2VCBA 5EIYB 2WO1A 3I3DA 3NRUA 1JYVA 3VDBA 4XZUG 4P5YA 2Y6KA 3WNLA 1XNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2O A;  1JHJ A;  4CVU A;  1UY2 A;  1KGY A;  3GGL A;  3VD9 A;  2C26 A;  4QPW A;  4DXR A;  3DYM A;  3T0D A;  3A21 A;  3LEG A;  3ACG A;  1UXZ A;  3ETP A;  3OGV A;  2VMF A;  4KI5 M;  3WEZ A;  5G05 L;  2QQM A;  2EIE A;  3IAQ A;  4XUR A;  1TVG A;  3BGA A;  3MUZ 1;  1OH4 A;  2LS6 A;  1JYN A;  2CDO A;  3I2J A;  1GUI A;  3EB7 A;  3MO4 A;  2XOM A;  1GMM A;  3GXU A;  2ID4 A;  3I2I A;  3LPF A;  5IFT A;  3THD A;  2WBK A;  1GNY A;  2E33 A;  4XUO A;  4W8J A;  4A3Z A;  5EJZ B;  2VZR A;  2ZEZ A;  3T08 A;  1CX1 A;  1PMJ X;  3CQO A;  4QB1 A;  4ZZ5 A;  4OZO A;  1JU4 A;  2W1S A;  2WAA A;  1OT5 A;  3I97 A;  2VZS A;  3SKJ E;  3ABZ A;  2WO3 A;  5J1X A;  1UXX X;  2VZO A;  1JYX A;  3CKH A;  1GOH A;  3CZU A;  3NQH A;  1UY1 A;  4ET7 A;  2VO5 A;  1NAE A;  2WYS A;  3T0A A;  1KEX A;  1YQ2 A;  2C9K A;  3A7Q A;  3LEK A;  2QQO A;  2J22 A;  4A42 A;  3LEI A;  2LW8 A;  4JKL A;  4AAX A;  2J1E A;  2XQX A;  2V5D A;  3WQB A;  4UOJ A;  2VTF A;  1RYY A;  1CZV A;  4BJ0 A;  3T2P A;  3SEE A;  1W8N A;  3F2Z A;  2DCJ A;  5IJR A;  5JMO A;  2HYX A;  2ZXQ A;  3LE0 A;  2RJ2 A;  2KD7 A;  1UX7 A;  2J1A A;  2VQU A;  1H6X A;  3A22 A;  4P00 B;  4XUT A;  3JXS A;  3K4D A;  3A23 A;  1OF3 A;  1IQD C;  5I0D A;  3FHA A;  3K77 A;  2B9V A;  3I3B A;  1BHG A;  4RN5 A;  1JZ6 A;  2RVA A;  3DYP A;  1XNT A;  3W5N A;  2QBX A;  1W9S A;  3THC A;  5HXM A;  2BZD A;  4DUW A;  5JXG A;  2JDA A;  5EJ1 B;  2Y6J A;  3AC0 A;  4BK5 A;  2X05 A;  2WN2 A;  4QX0 A;  4DXS A;  2VZV A;  2QQJ A;  2VCA A;  1MPX A;  4LKS A;  5JR2 A;  5CZK A;  3FHQ A;  4GWI A;  3OGS A;  4BXS V;  1D7P M;  5IHR A;  4MOA A;  2VZ1 A;  4MAD A;  3MV0 1;  3I2K A;  1W8O A;  1WCQ A;  5JUV A;  3HPN A;  2X10 A;  4HG6 B;  4TXW A;  3CMG A;  3K46 A;  2ZEX A;  2J1T A;  4XUN A;  2J1S A;  1NX9 A;  3J7H A;  3E1F 1;  1NKG A;  5DN2 A;  2V4V A;  3MV1 1;  1P8J A;  2W3J A;  1O59 A;  1K45 A;  4DEV A;  2EID A;  4QDQ A;  1W9T A;  3OBA A;  3LPG A;  1R64 A;  5LA0 A;  1SG3 A;  2Y6H A;  3C7O A;  4MGS A;  1DYO A;  4QB2 A;  5JXI A;  2BBA A;  1SDD B;  2L9L A;  3HNM A;  1US2 A;  3DEC A;  1JZ3 A;  2E31 A;  2VZQ A;  2EIC A;  3K4A A;  4QAW A;  2VC9 A;  4UAP A;  2VZU A;  4PQQ A;  1NUK A;  4E8C A;  4ARY A;  2W92 A;  3VD4 A;  2J7M A;  2VCC A;  4L0P A;  5G04 L;  2VOT A;  3FL7 A;  3I2F A;  2W87 A;  4A41 A;  3C7H A;  1XC6 A;  1CZS A;  3T2Q A;  4P08 A;  4JX0 A;  2J1R A;  5FUI A;  4P02 B;  1JZ7 A;  3WF1 A;  5B4X A;  2VZP A;  3HOB A;  4JKK A;  1O8P A;  2OKX A;  2WZE A;  2W1U A;  5IYY A;  3CIH A;  5F7U A;  1EUU A;  4UI9 L;  4BDV B;  3IAP A;  1GQP A;  5C70 A;  4W50 A;  5DQ0 A;  3EYP A;  4DUV A;  4CU6 A;  4CU7 A;  1GU3 A;  4BK4 A;  3WF2 A;  4QX1 A;  3C8X A;  2JKX A;  4QX2 A;  3P6B A;  3WF4 A;  1TG7 A;  2YB7 A;  2Y6L A;  2JE8 A;  2YC4 A;  3WSO A;  4QDS A;  4QB6 A;  4MO3 M;  2YFZ A;  4CU9 A;  1PMH X;  2QQK A;  2R7E B;  4E8D A;  3ZM8 A;  3OGR A;  5DMY A;  2E26 A;  2VR4 A;  2BGP A;  2W5F A;  4XVH A;  4DUX A;  4XUP A;  2QQL A;  1L7R A;  4LPL A;  4A45 A;  1OF4 A;  4QDR A;  4LQR A;  1UY3 A;  4CUA A;  3NJV A;  2Z4F A;  2VJX A;  4YPJ A;  4ARX A;  1GOF A;  2ORZ A;  1JZ4 A;  5A1A A;  1CIY A;  2DDU A;  3WNK A;  3UET A;  3OG2 A;  2QQI A;  2J1U A;  3I2H A;  4CU8 A;  5C71 A;  3VD5 A;  2VMC A;  3BN6 A;  1XPW A;  2YFU A;  3VD3 A;  1ULO A;  2WQ8 A;  1K42 A;  4CUB A;  4ZXE A;  4OUE A;  1UMI A;  1J83 A;  2WN3 A;  3NNG A;  3T0B A;  1UYY A;  4M4R A;  2Y64 A;  2YG0 A;  4GZ9 A;  4JHZ A;  1UZ0 A;  3I2G A;  1HN1 A;  1H6Y A;  4QX3 A;  2WZ8 A;  2DCK A;  4D0Q A;  4AG4 A;  2JD9 A;  2VMD A;  4ZZ8 A;  3P1I A;  1CZT A;  3C7F A;  3K75 B;  1ULP A;  1LNS A;  3C7G A;  4PT6 A;  3K4Z A;  3WNO A;  3HEI A;  4A44 A;  5IFP A;  3UES A;  1T2X A;  3OEA A;  1UYZ A;  2W94 A;  2ZEY A;  3ACF A;  1PX4 A;  2WUH A;  4ZY9 A;  1UY4 A;  5LCW L;  5DPN A;  3MUY 1;  3WNN A;  3C7E A;  3DYO A;  3GDB A;  2VQT A;  3VDC A;  1JZ2 A;  3SEP A;  1F4A A;  2VME A;  3CZJ A;  5LA2 A;  4A4A A;  1SHW B;  3VDA A;  1JZ8 A;  1JZ5 A;  2BER A;  1US3 A;  3I3E A;  4CUC A;  1I5P A;  3PUI A;  3D3A A;  2Y8K A;  2X09 A;  1WKY A;  3GM8 A;  3HN3 A;  2PQS A;  2W1W A;  3NJX A;  4Z2A A;  1W0N A;  2XHN A;  4RYD A;  2W91 A;  1K12 A;  3CDZ B;  4D8M A;  4FI9 A;  2CDP A;  4M4P A;  2XON A;  5JXH A;  1EUT A;  2QQN A;  3PUH A;  1J84 A;  2VM9 A;  1JU3 A;  2Y6G A;  1DLC A;  2J1V A;  3WF0 A;  1GOG A;  3III A;  2E32 A;  2WAB A;  2WDB A;  3VD7 A;  2B4K A;  1W9W A;  3ECQ A;  3HJR A;  3SKV A;  5LA1 A;  4PF1 A;  2W47 A;  5HPO A;  3OB8 A;  1L7Q A;  1O8S A;  4DXT A;  1UYX A;  5B4N A;  1F4H A;  2C4X A;  2WO2 A;  5C7G A;  1UY0 A;  4W4Z A;  2VL4 A;  2W46 A;  4JKM A;  1JYW A;  3UNP A;  2W95 A;  5CYY A;  2V72 A;  4OYU A;  3U37 A;  2EIB A;  4MGQ A;  2WAO A;  1K3I A;  1PX3 A;  1DP0 A;  2VZ3 A;  2ZEW A;  5JXJ A;  1W99 A;  3LQC A;  2BGO A;  1UMH A;  3W5M A;  3IDA A;  2YC2 A;  4DEQ A;  3WNP A;  1JI6 A;  2RV9 A;  2HLE A;  2W1Q A;  3WF3 A;  3HNY M;  3FN9 A;  3IB3 A;  4GWJ A;  2ORX A;  4XUQ A;  3MBW A;  3OEB A;  3WNM A;  3ACI A;  4KMQ A;  3T09 A;  4A6O A;  4TTG A;  4OMD A;  2W9X A;  3HNB M;  1OD3 A;  4KWU A;  4IUG A;  4LHS A;  2VZT A;  1UWW A;  4OMC A;  3ACH A;  2VCB A;  5EIY B;  2WO1 A;  3I3D A;  3NRU A;  1JYV A;  3VDB A;  4XZU G;  4P5Y A;  2Y6K A;  3WNL A;  1XNA A; 
#chains in the Genus database with same CATH topology
 2KM2 A;  3WOG A;  5IK4 A;  3POI A;  2UYA A;  4XCB A;  3T2O A;  1OFN A;  1UY2 A;  3KGZ A;  5SV8 A;  1C8M 1;  4QPW A;  1LOD A;  1U12 A;  5KXE A;  3ES1 A;  3G6J B;  4K1Y A;  4CDQ A;  3KM5 A;  4FAG A;  3H1W A;  4Q29 A;  3ZXJ A;  1UXZ A;  3ETP A;  5K0U C;  5FTT C;  1WGP A;  4YW5 A;  1AR7 1;  2PAM A;  1FYU A;  2QQM A;  4IV1 A;  2A6V A;  2VNG A;  3IAQ A;  4WM8 C;  4XUR A;  1JW6 A;  3J7M A;  4P9Y A;  1LOA A;  3HT2 A;  1OH4 A;  1GWK A;  2C1F A;  1FPN 2;  3UK9 A;  5KR7 A;  1TME 1;  3VBO A;  1GUI A;  3DCQ A;  4A2U A;  1MZ5 A;  2YUE A;  3Q8B A;  1MS5 A;  3I2I A;  5IFT A;  2BV4 A;  2E33 A;  4W8J A;  4A3Z A;  3ME2 A;  2VZR A;  3WW1 A;  5A1F A;  5K0U B;  2WZR 1;  1XB9 A;  4JVA A;  1CX1 A;  1R08 2;  1LKN A;  4F3J A;  2XLF A;  4XIK A;  3M3Q A;  4N53 A;  1MZE A;  4WM8 B;  5DUU A;  5GZD A;  3ZFG C;  4B7K A;  3NMB A;  3HN1 A;  2D3R A;  2WAA A;  2VZS A;  4RR3 C;  1ZNP A;  4XDO A;  2KXL A;  5AC9 1;  3B5L B;  2VG9 A;  3DXU A;  1ENS A;  1QQP 2;  5J1X A;  4LK6 A;  4M3C B;  3VKL A;  5A3M A;  1UXX X;  2XJU A;  3B01 A;  3CEW A;  1LEC A;  3AMM A;  5DDJ 3;  2WWJ A;  3BPS A;  3CZU A;  5IVB A;  3TEZ A;  5DZG A;  3RI8 A;  1WD4 A;  4RFR B;  2VO5 A;  2G4I A;  1AR8 3;  3LA7 A;  4FOV A;  4O9G A;  1IKQ A;  2ZKL A;  4IEZ A;  5M0T A;  1X82 A;  3N35 A;  5A3L A;  3LEK A;  1CX4 A;  3U4X A;  5J36 A;  1KDK A;  3ACL A;  3ZFG B;  1MQT B;  5ACA 2;  1ENX A;  2VNO A;  4N9I A;  4JHT A;  4QPI A;  1B35 B;  1RGS A;  1YIF A;  5JLV A;  2WII B;  1UOF A;  3H3L A;  4KU8 A;  4AI9 A;  5H9S A;  1AR9 1;  4FQZ A;  2KR2 A;  2XBO 1;  2F17 A;  4UOJ A;  1W3X A;  2YZ4 A;  3AFK A;  2GSY A;  1Y9Q A;  2XJV A;  1POV 1;  3ALQ A;  3VUO A;  4Y33 A;  4GUL A;  3M3E A;  1U0A A;  3F2Z A;  1NCQ C;  2DCJ A;  3WP5 A;  1UCX A;  4X8P A;  3VKN A;  3ZFF A;  1Q43 A;  2JG9 C;  5F9T A;  3LE0 A;  3NVC A;  2J1A A;  1WMD A;  2CU5 A;  4BQX A;  1H6X A;  2VGD A;  4Q4Y 2;  4BOW A;  1YCI A;  4XUT A;  2JD4 A;  4NPM A;  3K4D A;  2VPV A;  3A23 A;  2FCT A;  4HMZ A;  1APN A;  3MF9 A;  3K77 A;  4RN5 A;  2ZMK A;  3KT7 A;  1RUF 1;  3BTY A;  1GLH A;  3U11 A;  3W5N A;  1XU2 A;  2QBX A;  3UKT A;  1W9S A;  3AMP A;  3JBG 1;  1YFX A;  2GND A;  5L73 A;  3ZYH A;  3N9N A;  4DUW A;  5FYV A;  3M1H A;  2W52 A;  4IXL A;  3AC0 A;  1KRI A;  2WNE A;  1XE0 A;  1REF A;  5GLU A;  4QQP A;  4DXS A;  3FFQ A;  1DQ4 A;  2MEV 2;  1O3T A;  1OBN A;  2VUC A;  5LK5 A;  3FHQ A;  4ISR A;  2VH9 A;  3N9L A;  1WLC A;  5KHI A;  3OGS A;  3TNP B;  1A34 A;  2ET1 A;  4XMA A;  5IHR A;  4MOA A;  3M3O A;  1MS9 A;  2VZ1 A;  4YVS B;  2ARC A;  4QM8 A;  2NM1 A;  4MAD A;  3RYR A;  5IK5 A;  3MLK A;  5JOY A;  3ZN6 B;  1HB3 A;  3PVE A;  1W8O A;  1WCQ A;  2DCY A;  1EP0 A;  2X10 A;  2PLV 3;  3K46 A;  5ABJ C;  1TQ5 A;  3MEP A;  3ZIX A;  1RED A;  1WCU A;  4GMP 1;  4YVW A;  1MS1 A;  3HQU A;  4P14 A;  1NX9 A;  2K0G A;  3ENR A;  4ATF A;  4COU A;  3J7H A;  2LRP A;  2R1D A;  3E1F 1;  5FY7 A;  5IUQ A;  2B46 X;  4XAA A;  1RUJ 3;  3PU3 A;  2BDR A;  1P8J A;  5FP9 A;  3J26 N;  3AXE A;  2HEW F;  3O0W A;  1K45 A;  3CU7 A;  4S2F A;  4RHV 3;  4DS0 A;  4DEV A;  4AF9 A;  1QXP A;  1R64 A;  3MIC A;  4OI1 A;  4MGS A;  1YC6 1;  2FDF A;  3I54 A;  5ABJ B;  1CVN A;  2ZHM A;  5FFO C;  1DYO A;  5GZF A;  4D7T A;  1F9K A;  1FXZ A;  1NLR A;  3I59 B;  3KT1 A;  2BP6 A;  2HWD 2;  4P9X A;  3KV6 A;  2BBA A;  1SDD B;  2WYF A;  4UFM A;  3VKM A;  1HB4 A;  1ZBA 3;  2GC1 A;  3KVA A;  4XTP A;  5GAL A;  4RS5 B;  1QJX 3;  2RS3 2;  1ZZ9 A;  3UGG A;  4PHZ A;  2P34 A;  1PO1 2;  1H2N A;  2QQW A;  1YWK A;  3ZXF A;  3GZT B;  2BNM A;  4HLT A;  1UPS A;  4MXV A;  4PQQ A;  5FXW A;  3RYP A;  4ARY A;  2C9A A;  4Q26 A;  3MIB A;  4M0N A;  3MIH A;  1LGB A;  2PAE A;  2RR1 2;  3T1M A;  2ZGQ A;  5JVV A;  2W87 A;  1HB1 A;  4YG3 A;  3AZV A;  2JDP A;  3RMY A;  3WQ7 A;  3SNM A;  1ZVF A;  1VAK A;  1AXY A;  5FUI A;  1C4R A;  2WT0 A;  1AYM 2;  4PLO A;  1JZ7 A;  1LEN A;  2ZX3 A;  2ZOE B;  4JKK A;  4NWV A;  4EYU A;  4DPN A;  2A5Z A;  2AH2 A;  2O14 A;  1PVC 1;  4PIY A;  3RPQ A;  5A7O A;  4EN7 B;  1ND3 A;  4B4Q A;  5IYY A;  2GAL A;  3CIH A;  1J3Q A;  3EJK A;  5J48 A;  3OPW A;  1UF2 C;  2VXJ A;  4M3C E;  4F7Z A;  4BH9 A;  3BYW A;  1EUU A;  3T1L A;  3IAP A;  5EYY A;  2PHU A;  2GNB A;  5JPM B;  2Q5T A;  3I8T A;  5F5I A;  1H4G A;  4CU6 A;  3RZM A;  1RVF 1;  5GZC A;  4CU7 A;  1W0P A;  4MXW A;  4ORF A;  2ZZQ A;  1MS3 A;  2R0H A;  1D4M 3;  3WF2 A;  2FDI A;  1YI7 A;  3C8X A;  4CDX A;  4PI0 A;  3P6B A;  4YG0 A;  1G6N A;  1BEV 1;  1W6N A;  4LHL A;  2YB7 A;  4QHZ A;  3TBD A;  4C0H A;  4DRV A;  2YBK A;  2JE8 A;  1UW8 A;  2YC4 A;  5FZB A;  3VBR A;  1DQ1 A;  4QB6 A;  5LZ6 A;  5HXV A;  4AYU A;  2YFZ A;  2RM2 1;  1AYM 1;  1GQH A;  1PMH X;  1RUC 2;  2NN8 A;  2QQK A;  5A32 B;  4NJ4 A;  2AAC A;  4JQR A;  3POW A;  2FDJ A;  1YHF A;  4LLF A;  2ZX1 A;  4I0B A;  4LIU A;  1IS6 A;  1I3H A;  3ILN A;  2BGP A;  2CWS A;  2W5F A;  4FOQ A;  3RG0 A;  2GC2 A;  2WFF 2;  1QOT A;  2DUR A;  4JTN A;  5BNP A;  2QQL A;  3IZO A;  4AHW A;  1L7R A;  1Y9G A;  3E5Q A;  5E8A A;  1AUY A;  1GZC A;  4A45 A;  2VMH A;  3KD4 A;  1FOD 2;  1YQ5 A;  4JZR A;  1LGC A;  3O14 A;  4CUA A;  3POG A;  2WS9 3;  3BOD A;  4Z82 A;  2BOJ A;  2HWC 2;  1V6I A;  2GN7 A;  3TN9 1;  1A78 A;  1J58 A;  4ARX A;  2ORZ A;  1T6B X;  5C3O A;  1JZ4 A;  3JZV A;  5A1A A;  3BTZ A;  4EN9 B;  1QJZ A;  3DGT A;  1CIY A;  3LSD A;  2D6K A;  4LBJ A;  3O1O A;  5A1L A;  2ZHL A;  4QWN A;  1G9F A;  1MEC 2;  1Y9M A;  2XVL A;  5FAX A;  2QQI A;  4GB3 3;  3I2H A;  4NMI A;  5D1I A;  1UKR A;  3TEX A;  3VZM A;  1LU2 A;  1W6Q B;  1W9Y A;  4I02 A;  4UW6 A;  2IUW A;  1UZW A;  3RDI A;  1O7F A;  4MV2 A;  1PZ9 A;  5FY1 A;  3VD3 A;  2BVV A;  2YFU A;  5FXV A;  1W2U A;  1BVV A;  4XE9 A;  5CBL A;  2R06 1;  4K6B A;  5KWR A;  3NKT A;  4KNC A;  5FZL A;  4BA6 A;  2VUD A;  1HDK A;  4GMP 0;  1ENR A;  4XFF A;  4N7I A;  2WQ4 A;  4ZXE A;  1GWM A;  1UMI A;  2D5H A;  4OUE A;  1RHI 3;  5K0U A;  1TZO A;  4LO6 B;  5A3O A;  1J83 A;  1VE0 A;  1IOA A;  4ZHN A;  4KWJ A;  4NWW A;  4WM8 A;  1ZBE 2;  3ZSJ A;  2BW8 A;  3J8F 2;  1LU1 A;  3SH4 A;  2Y64 A;  3GNE A;  3K2O A;  5LAS A;  4QX3 A;  4M3C A;  5LAT A;  4UXA A;  2WZ8 A;  1AYN 2;  4LK7 A;  3L2H A;  3HWJ A;  4NR1 A;  1BBT 1;  2FZ2 A;  2JD9 A;  3VZK A;  1G7Y A;  3SCG A;  3K75 B;  2E9Q A;  1MR5 A;  5FPV A;  5CIS A;  4R8H A;  4L11 A;  5K8S A;  1W05 A;  3H8X A;  3HEI A;  4A44 A;  3ROU A;  5E6H A;  4L97 A;  4B4R A;  5IFP A;  2HWB 2;  4YW3 A;  1W6M B;  5FZI A;  2GMP A;  5J98 B;  3ZFG A;  3KHB A;  1MQT A;  2RMU 1;  5DPN A;  3MUY 1;  5F6K A;  3RZJ A;  4ISQ A;  1B35 A;  3IIA A;  4K20 A;  4UYB A;  2RS5 2;  1IS5 A;  4I3G A;  5IAX A;  4LBQ D;  2VME A;  3PU8 A;  4NAM A;  3WCS A;  4CP0 A;  3ZYG A;  3DEM A;  1IZ3 A;  2B9U A;  1JZ5 A;  1EAH 3;  3ZXA C;  3KCX A;  1JYI A;  2CGP A;  3EMR A;  1G9C A;  4CUC A;  4LT5 A;  3MGU A;  1I5P A;  3PUI A;  3D3A A;  4FPF A;  3WUD A;  3TEW A;  3VHR A;  1NY7 2;  3GM8 A;  1Q8S A;  2W1W A;  1RUH 1;  5FK7 A;  5GM0 A;  3OPZ A;  2X8K A;  1REE A;  4QKD A;  2VOV A;  2VOK A;  1VAV A;  3ZYB A;  4D6S A;  3T4V A;  5F2S A;  3H8R A;  1V00 A;  4YLZ A;  4LKF A;  1QY4 A;  1JOD A;  4Q4X 1;  1LHW A;  4D8M A;  4EWA A;  1UU6 A;  1W90 A;  3M8L A;  5BY5 A;  3ZMO A;  3D8C A;  4B7E A;  3N9M A;  1V6M A;  2DU0 A;  1VBE 3;  4QX7 A;  3S5Q A;  3O0X A;  4PBP A;  2XON A;  2HWF 1;  3NNF A;  4EV0 A;  4HN0 A;  4B3N A;  4L2N A;  3WG2 A;  5EJ3 A;  4K3U A;  1W2A X;  3OY8 B;  1HKD A;  3H8U A;  5EV7 A;  3VBU C;  2K46 A;  1JU3 A;  4AWD A;  5BYN A;  2PFW A;  2Y6G A;  5D2A A;  4XFA A;  2XJS A;  1ULC A;  3SMH A;  2WDB A;  4I09 A;  2B4K A;  2ZAC A;  1S0J A;  2XJQ A;  5FZE A;  3SKV A;  2ARE A;  1HRI 3;  2BU9 A;  1AL2 2;  3JU9 A;  1WW5 A;  3N7K A;  4OZX A;  5FBZ A;  4PF1 A;  1PIV 3;  1ND2 C;  3OB8 A;  1O8S A;  2MPF A;  4P5H A;  3J7L A;  2NQY A;  1F4H A;  2C4X A;  3GBF A;  3ITQ A;  3KCC A;  4Q4V 3;  1TNF A;  2IXJ A;  1NYW A;  1UOG A;  5JMC A;  1OXC A;  1UY0 A;  3E5U A;  1J3R A;  2WRA A;  3ZN6 A;  1SLI A;  1XYO A;  2W46 A;  1WLT A;  1JYW A;  2VMG A;  3WD5 A;  4LOS A;  2W95 A;  3VBU B;  4QT6 A;  5CYY A;  4C8D A;  1IG3 A;  5EYX A;  1S2K A;  3JQW A;  4CDU A;  2V72 A;  4FPJ A;  5CB7 A;  4DZG A;  2O8O A;  1XRU A;  3R4S A;  4Q4W 3;  3UT0 A;  4K40 A;  5FY8 A;  2ZX4 A;  4JGZ B;  1K3I A;  2GNM A;  5FZH A;  5L7O C;  4Q8L A;  3AL6 A;  4IGO A;  4UFI A;  1JXN A;  2D7F A;  3S6P A;  5JXJ A;  5APA A;  2BGO A;  1ZRF A;  4GJY A;  3W5M A;  5CKQ A;  1VRH 2;  2Q30 A;  4LUM A;  2PTM A;  4LJH A;  4WM7 B;  1XNK A;  1GNH A;  1JI6 A;  1VB4 A;  2RV9 A;  3KF5 A;  4W6Y A;  5ABJ A;  1HX6 A;  1QWR A;  2V5Y A;  3I59 A;  1HRV 1;  4NRP A;  2GNT A;  2G9G A;  5BNO C;  2DVG A;  3IB3 A;  2Q8O A;  4P9L A;  1DBN A;  2IXI A;  4SBV A;  4AL9 A;  5L7O B;  3AFG A;  4LHN A;  4RS5 A;  5JIU A;  2GC0 A;  4QHB A;  3OEB A;  3BI3 A;  1NA1 C;  3ACI A;  4KMQ A;  4UW5 A;  1RUE 2;  1V9U 2;  1CON A;  2XH6 A;  1NOV A;  1XYN A;  1OQE A;  2JDN A;  3LWC A;  4A6O A;  5HCF A;  4CCM A;  1TMF 3;  3X29 B;  3WHT A;  4LO5 B;  1UWW A;  2ZHN A;  3ACH A;  3I3D A;  1Z7S 2;  4BIF A;  2CGO A;  4WZC A;  1UN1 A;  2RS1 1;  4XZU G;  2VU9 A;  5BNO B;  1BMV 1;  3WNL A;  5KXB A;  3FFZ A;  1N3O A;  2ZGK A;  1UYP A;  3BTA A;  4X6Q B;  1NA1 B;  4CVU A;  3V0A B;  3EO6 A;  1PVX A;  1KGY A;  5LEJ A;  3DYM A;  4XBQ A;  3POJ A;  1AR6 1;  4DO0 A;  2WJS A;  2JE9 A;  1UZZ A;  2CWM A;  1LOG A;  3BB6 A;  4KGG A;  4UFK A;  2EIE A;  2XVG A;  3UKV A;  5T52 A;  5A7S A;  3ZXD A;  4AR2 A;  1TVG A;  5EPA A;  3ZX7 A;  1JYN A;  4AOC A;  2IZW A;  2RHP A;  5F3C A;  1AF9 A;  1G9D A;  3EB7 A;  3MO4 A;  4Y1Z A;  3GXU A;  4AGR A;  5I0S A;  4FP2 A;  2ID4 A;  4BIS A;  4XCA A;  5A6Z A;  1QJF A;  2PXJ A;  1DYK A;  1ZRE A;  4IGQ A;  5EJZ B;  2VQ0 A;  5JZG B;  5JOW A;  2ZHK A;  4GA9 A;  1CGP A;  1UZY A;  1QXR A;  2ZEZ A;  3QOP A;  4PJY A;  3T08 A;  1FMD 2;  4QB1 A;  3AP7 A;  4OZO A;  2ADE A;  1JU4 A;  4ZPI A;  1HV0 A;  1ODN A;  4AQT A;  1YFY A;  4YW4 A;  5ANN A;  1R09 1;  3LB9 A;  2W1S A;  5IK8 A;  4XJ9 A;  5FBJ A;  1R1A 3;  1VBC 2;  4LXL A;  3FJS A;  1UOJ A;  5A32 A;  5CFD B;  1JHN A;  4B4P A;  1BXH A;  1AHS A;  1T6G C;  1DYP A;  3CKH A;  1GOH A;  1VBB 3;  2VMI A;  3OUJ A;  3FC0 A;  1VBD 1;  3MW2 A;  3NQH A;  3AP6 A;  3PMS A;  3D5O A;  5JSR A;  1QOO A;  1UMZ A;  2C5D A;  2R04 2;  3MIG A;  1LRH A;  1NAE A;  3LKJ A;  3T0A A;  3N7J A;  1RUG 3;  4QX8 A;  1IHM A;  2C9K A;  3E6D A;  3W21 A;  1EV1 1;  3USU B;  2JKB A;  2XJP A;  2QQO A;  3J9S A;  2SLI A;  3UJO A;  3OSD A;  3LEI A;  4JKL A;  2JIJ A;  1WLD A;  4JTO A;  3WDX A;  4E2Q A;  4SLI A;  1KS4 A;  4XFG A;  4AFA A;  5FPU A;  1RMU 1;  3WP6 A;  1PO2 3;  2P6C A;  1OVP A;  1D0H A;  1W04 A;  2DCT A;  4FPO B;  2HEV F;  1HXS 1;  5CAD A;  1O3Q A;  4PF5 A;  2PHT A;  3TYJ A;  2XLA A;  3MYX A;  3POS A;  1ASJ 1;  3UJQ A;  2ZGT A;  4AFB A;  4XQD A;  1CZV A;  1COV 3;  2E7A A;  5EHD A;  3T2P A;  2JEC A;  3I3Q A;  1JYT A;  2R07 3;  4L99 A;  1S2E A;  3ZFE B;  5JMO A;  1MVE A;  3O1M A;  1RUI 2;  1IG0 A;  2HYX A;  4XAC A;  2AYH A;  2KD7 A;  2OZ6 A;  4MUV A;  3U14 A;  3WP3 A;  3SHR A;  5LW9 A;  4PIZ A;  1W6Q A;  3QLQ A;  1YFW A;  3KLS A;  2N7G A;  1RUD 2;  2VUA A;  5T5O A;  3JXS A;  5DZF A;  2AC1 A;  4XBL A;  5H9R A;  3MPB A;  1IQD C;  1X36 A;  3FHA A;  4LUK A;  2OYZ A;  4QPG C;  3I3B A;  4O7X A;  3OGG A;  2VCM A;  3DYP A;  1QJU 3;  1DFQ A;  3WDU A;  4FFF A;  4HAN A;  1H2K A;  1CQ9 A;  5F1R A;  1SMV A;  1N47 A;  2GAU A;  4BQ5 A;  5CVR A;  1QJY 1;  1C8M 2;  5FZA A;  3OF1 A;  4V2V A;  4DY3 A;  5D21 A;  3BU0 A;  1GV9 A;  2VZV A;  4Y24 A;  2VCA A;  5CZK A;  1XOY A;  3B7M A;  1AR7 2;  1VBA 3;  4Y1Y A;  2RDS A;  3B3Q E;  1FV2 A;  2B42 B;  5AFB A;  5FXZ A;  1OKO A;  2ES3 A;  1H8V A;  4B1L A;  2Z42 A;  5BPX A;  1TME 2;  3MV0 1;  5CAZ A;  3KS7 A;  5EFU A;  2G9Z A;  3WQ0 A;  2WIN B;  2YC0 A;  5B2G B;  5JUV A;  1M06 G;  5IAT A;  4R9C A;  4JDN A;  5I0R A;  2D43 A;  5CKM A;  2OUH A;  1W6M A;  4LKE A;  2ZEX A;  2FCV A;  3FZ3 A;  3APB A;  1O5L A;  1PK6 C;  1WCS A;  2VE1 A;  3GBW A;  2VQA A;  4PDW B;  2WZR 2;  2VBP A;  4NRQ A;  1QF3 A;  5KHJ A;  3H9A A;  3MV1 1;  1MVQ A;  1S0G A;  1DQ0 A;  1RJ8 A;  1RB8 G;  4URT A;  4YZ5 A;  5AC9 2;  2BTV C;  4DB5 A;  4AK3 A;  2FQP A;  3KCY A;  1OOP B;  4IV3 C;  4YGC A;  2VNR A;  1JMU B;  4WBB A;  1HIX A;  4I0W B;  2EID A;  4QDQ A;  5I8S A;  4QHO A;  3OBA A;  4CCK A;  3LPG A;  1LJ7 A;  2R16 A;  1QEX A;  1OLQ A;  2OPK A;  2QCS B;  3C7O A;  4MSV A;  1JYC A;  2HWE 3;  3J7N A;  5FZ0 A;  3AX4 A;  5GZE A;  4LBL A;  4CCC A;  4EJR A;  4QB2 A;  5CG9 A;  2A3Y A;  2EF6 A;  1PK6 B;  3VDD B;  5GKA C;  5JXI A;  1SEF A;  1QOS A;  1C28 A;  3N4M A;  2ZGO A;  5DDJ 1;  1MAC A;  4UBG A;  2VUL A;  4UWD A;  4D7Y A;  3NO8 A;  1AR8 1;  1JZ3 A;  2G19 A;  2VZQ A;  5GLZ A;  2QJV A;  1GZT A;  1D4V B;  4H14 A;  4CA9 A;  5KBF A;  1FV3 A;  1LOF C;  2EIC A;  1ACC A;  4FOY A;  2ARB A;  2ENR A;  1BKZ A;  2DTW A;  4IV3 B;  4Y20 B;  1B09 A;  2WT2 A;  3R05 A;  4YZ1 A;  3RGB A;  1AR9 2;  2CV6 A;  4QQO A;  2UYB A;  2XBO 2;  1H8T C;  2ADD A;  5H9Q A;  3ZDV A;  5C3S A;  3OY8 A;  4A7Y A;  2OT7 A;  2YV8 A;  2WNU C;  2ZBJ A;  2J7M A;  3N36 A;  5G04 L;  1D2Q A;  2HKX A;  4BYY A;  3RZG A;  5DUW A;  3WP4 A;  2LUW A;  2QNK A;  4A41 A;  4XHX A;  1OH3 A;  3MID A;  3FBM A;  5JPN B;  3C7H A;  4KWK A;  1CZS A;  1DGR A;  5I91 A;  4CCD A;  4NO4 A;  5BNQ A;  2HH9 A;  2WWS A;  4P02 B;  1OQD A;  2PHX A;  3WF1 A;  1Q8P A;  1V6N A;  3HOB A;  4OHX A;  1O8P A;  5FRE A;  3ZOI A;  1H8T B;  1UX6 A;  3JD7 3;  3INA A;  1ZZ6 A;  2AR6 A;  4YW7 A;  2OKX A;  2WZE A;  4Y1V A;  1PMI A;  3VBU A;  3B94 A;  1S0E A;  1RUF 2;  4G3Y C;  2ZGL A;  1S1A A;  3GZE A;  4IEP A;  4QPY A;  4IEX A;  5A3T A;  2JJ6 A;  4RR3 B;  5HV4 A;  4FPK A;  4XIO A;  1QHD A;  3JBG 2;  3H3U A;  4CXX A;  4HN1 A;  1XXN A;  4JGZ A;  4UI9 L;  4XDQ A;  5DG1 A;  2D97 A;  1H1M A;  5DQ0 A;  4MHU A;  2XWB B;  4JQT A;  5CEH A;  1SFP A;  4BCU A;  2I45 A;  1GP4 A;  4N43 C;  2BWC A;  4JGY C;  2RDR A;  1WBF A;  2JKX A;  2R6Q A;  3WQ1 A;  1TG7 A;  2Y6L A;  1Q8O A;  2YXS A;  4WM7 A;  3UKN A;  3WSO A;  1DQ6 A;  2MNG A;  4MO3 M;  2BRT A;  2P6H A;  1IQA A;  2ZAH A;  3OBR A;  4E8D A;  2XGX A;  2YHJ A;  1CJD A;  5L7O A;  4PBO A;  4EZ4 A;  2Z5W A;  2V73 A;  4Y1X A;  3GCW A;  5F6L B;  5FZ6 A;  3WZ1 A;  3VHN A;  2XQR A;  4JGY B;  2VR4 A;  2PLV 1;  1CPN A;  3I7D A;  4C90 A;  1NCQ B;  3C2U A;  4XVH A;  1NQJ A;  2JG9 B;  1PGL 1;  1BYH A;  1J3P A;  1CES A;  4NOT A;  3AMH A;  1FPN 3;  1OF4 A;  4GKX A;  3ZPY A;  5FCC A;  4QDR A;  1AX2 A;  1UY3 A;  3HT1 A;  2W68 A;  1RUJ 1;  5GLV A;  2ZZJ A;  5BNO A;  2ETE A;  2OQ6 A;  3OD4 A;  3AK0 A;  3FLT A;  1KDM A;  4YPJ A;  1GOF A;  1NA1 A;  1DHK B;  1SBE A;  2BOI A;  4RHV 1;  3V0A A;  1WUV A;  2WR9 A;  3QAC A;  3ZKU A;  4B1M A;  1R08 3;  1LAJ A;  3N9O A;  1GIC A;  5A6Y A;  2XJR A;  2FDG A;  1A6C A;  4J25 A;  3V0B B;  4NIG A;  2J1U A;  1OI6 A;  2W0X A;  5E89 A;  1BQP A;  1ZBA 1;  4XMI A;  4AEJ A;  5C71 A;  3VD5 A;  1QQP 3;  4OI0 A;  1C1F A;  1QJX 1;  2VMC A;  2PQQ A;  2FMY A;  4UW3 A;  1OLM E;  2FD8 A;  1LES A;  1EYB A;  4E4D X;  5LEK A;  4RL7 A;  1CN1 A;  3WXP A;  4BQ4 A;  4MX3 A;  3WDY A;  2DU1 A;  3TRS B;  2WQ8 A;  3PVN A;  1XE8 A;  2VW0 A;  2R1B A;  2CYF A;  3N7L A;  2VOW A;  5JZG A;  4IEY A;  4QKN A;  5LBE A;  4IEU A;  3ZIW A;  5ACA 3;  2AGS A;  2WN3 A;  4HZF A;  4NUB A;  5J3U A;  1UYY A;  1ZRR A;  2YG0 A;  1JBC A;  2QVS B;  4IE5 A;  4YW2 A;  1CAW B;  4JHZ A;  3WX5 A;  3B9I A;  2WLQ A;  3P5B A;  4OI2 A;  5LB6 A;  5CFD A;  5CA6 A;  5F37 A;  1HN1 A;  1S0C A;  3PDQ A;  4IET A;  3WW4 A;  1PVC 2;  5ISL A;  2DCK A;  4P9W A;  4YZ3 A;  4JC1 A;  3I4I A;  5EZW A;  2H0V A;  4EWD A;  5JIA A;  2WNO A;  3C7G A;  3LEM A;  2D98 A;  2WLP A;  3WNO A;  3KSC A;  4GXL A;  4Q4Y 3;  3USU A;  1PX4 A;  1RVF 2;  2WUH A;  3UGF A;  4Q8K A;  3IDB B;  4LKD A;  4I01 A;  5A3U A;  5FZG A;  2ET7 A;  4KL1 A;  2A73 B;  4AVA A;  1W2N A;  2VQT A;  1BEV 2;  1LCL A;  4RQP C;  4AHY A;  3E6C C;  3QCW A;  3AM2 A;  3KV9 A;  1GSL A;  4GJZ A;  3AVS A;  4RSU A;  3SEP A;  4GWM A;  4CPB A;  1SHW B;  1O3S A;  2BER A;  4FO9 A;  1D4M 1;  3G7D A;  2EAK A;  1US3 A;  3LDK A;  2NYY A;  2FCU A;  2RM2 2;  3ILR A;  3I3E A;  2PHF A;  2PAK A;  1R1Z A;  1LED A;  5FZO B;  3IDC B;  1LOB A;  5CFC C;  1UIK A;  2GC3 A;  3FBY A;  3ZFE A;  3HN3 A;  1FAT A;  5F3G A;  3VHP A;  3HMY A;  2MEV 3;  4XF1 A;  4H7L A;  4D3W A;  1ULD A;  4LE3 A;  5IVF A;  2JDH A;  1BK1 A;  1Q3E A;  2C24 A;  1E5R A;  2VW2 A;  4LTA A;  3H3Z A;  1YQ6 A;  1UPI A;  2XHN A;  4RYD A;  2W91 A;  3VBF C;  2DVB A;  2LRO A;  2BQP A;  4HSJ A;  3PIJ A;  4Q0U A;  3DN7 A;  3EXU A;  4KG8 A;  3OCP A;  4DNY A;  5DAP A;  4R9A A;  1JOB A;  1W8Z A;  2CDP A;  2WSU A;  4RD7 A;  2BEO A;  4KBB A;  4UBH A;  2OW4 A;  5AVA A;  5JXH A;  5DAQ A;  3IPV B;  3TN9 2;  4MZU A;  3KWV A;  3VZL A;  2FZ1 A;  1NQD A;  5FZ7 A;  3PUH A;  2WS9 1;  1J84 A;  3BOP A;  3BCW A;  4QGL A;  2VM9 A;  3NAP C;  5EQU A;  1N1S A;  2J1V A;  5FV3 A;  3WF0 A;  2B7Y A;  3AP4 A;  1NG0 A;  5T5L A;  3VBF B;  4E2G A;  3VD7 A;  4IEV A;  4R4Z A;  4E4H A;  4DY5 A;  1XYP A;  4Q0P A;  4PLM A;  5JAX A;  5LA1 A;  1PHM A;  1X50 A;  2W47 A;  4HL0 A;  2BGC A;  1H30 A;  4AVB A;  4GB3 1;  4ES9 A;  4W4Z A;  1GZW B;  1NZI A;  2QQU A;  3ZSL A;  4JKM A;  4YFZ A;  3O1P A;  2R06 2;  4XBN A;  4LHK A;  2HWD 3;  3KHC A;  3NAP B;  4CYD A;  5JI9 A;  4QXH A;  4QGN A;  3U75 A;  2PA7 A;  4MGQ A;  4PDW A;  2PMW B;  3A0K A;  2RS3 3;  4NRO A;  5FMO L;  1XSR A;  1S0F A;  4Q0Q A;  2BJS A;  1GFF 2;  3MFC A;  1WCK A;  4QX5 A;  1PO1 3;  5I93 A;  2NLR A;  2R30 A;  4D7S A;  1RHI 1;  4YNI A;  3F95 A;  2ILM A;  2FBE A;  2ATF A;  5T55 A;  3WUC A;  4BM8 A;  3URF A;  4PQ9 A;  1OOP A;  1OHF A;  3IDA A;  2B8M A;  2R0F A;  5FY4 A;  4ZU7 A;  1SBD A;  3AP9 A;  4K1Z A;  2JDZ A;  3CF6 E;  1BBT 2;  1U5I A;  2RR1 3;  3NNM A;  4C91 A;  2D5F A;  4FAH A;  1YIP A;  3WF3 A;  4BMB A;  1PK6 A;  3VDD A;  4G9S B;  2UU8 A;  2YGL A;  1C8N A;  3BVC A;  4L92 A;  1OVS A;  1PNF A;  5C9A C;  4Y1U A;  4GWJ A;  5HCH A;  4FSJ A;  2DCZ A;  4HPK B;  1DIW A;  1AYM 3;  2RMU 2;  3FUO A;  3Q8F A;  2GP3 A;  2P3J A;  4GIQ A;  4L8Q A;  1OMI A;  3VBS C;  4XOG A;  4IV3 A;  2RE9 A;  4Y20 A;  3VB9 A;  4YGE A;  1AVB A;  3MI8 A;  4FOW A;  4OCT A;  5GJ6 A;  3OUI A;  4FPC A;  4IUG A;  3LF7 A;  1Y43 B;  2VZT A;  4LHS A;  3DL3 A;  1GQG A;  1W6P B;  2VCB A;  2WO1 A;  5HV0 A;  5FJK A;  1WWY A;  2ZX2 A;  3D0S A;  4YRD A;  2Q8E A;  1TEI A;  4H55 A;  4YZ2 A;  5FO8 B;  3BOW A;  2WZP P;  4HK8 A;  1WW6 A;  4HON A;  3VDB A;  2WA4 A;  2Y6K A;  4DXZ A;  2CSG A;  3W58 A;  1EAH 1;  5C9A B;  4UW4 A;  2ZA9 A;  1RUH 2;  3ZYF A;  1W39 A;  1JHJ A;  2YBS A;  2LAL A;  3J4U H;  3VD9 A;  4DXR A;  2H0B A;  4TN7 A;  3PTY A;  1SLB A;  2UUR A;  1JTZ X;  3H7Y A;  1FAY A;  2VMF A;  4Q4X 2;  5J96 B;  2NP0 A;  4GH4 C;  2IFW A;  3AYA A;  5FYZ A;  2C0Z A;  4I30 A;  1X33 A;  1RUC 3;  3MUZ 1;  1ALY A;  4OUM A;  1JUI A;  4RR3 A;  3MW3 A;  4BE3 A;  2HWF 2;  2CDO A;  1ODM A;  4Q5O A;  4HKO A;  5FXX A;  5BUV A;  1GMM A;  4CCO A;  2OPW A;  1VBE 1;  3MLJ A;  1FNY A;  3AYD A;  5FPB A;  2YPD A;  4IE4 A;  1GNY A;  4XUO A;  1N1V A;  3LDR A;  2WFF 3;  4CXW A;  2O1Q A;  4CDQ C;  3LGR A;  1DQ5 A;  3PVO A;  5F5Q A;  5KHG A;  2ZGS A;  1H9P A;  3OBZ A;  3ETQ A;  1PMJ X;  3CQO A;  1Y7B A;  1FOD 3;  3FLP A;  1WCD J;  4GH4 B;  3HIF A;  4TWT A;  5T5P A;  4ZZ5 A;  3KT4 A;  1KD7 A;  1UO9 A;  2E7Q A;  1CAX B;  1OT5 A;  2DBN A;  2HWC 3;  1HRI 1;  3I97 A;  4UFJ A;  2A6Z A;  1WMF A;  2W39 A;  5FZ3 A;  3SCH A;  1PIV 1;  2Q1M A;  3VBO C;  4LA3 A;  2GDF A;  3WCR A;  3NV3 A;  5FZF A;  4Q4V 1;  4AW7 A;  1JUH A;  5KHK A;  1X7N A;  2EIG A;  4RGG A;  4YGB A;  5A70 A;  3D4K A;  4XPV A;  1XNB A;  4ET7 A;  4JGY A;  2Q4S A;  1MEC 3;  4QXB A;  2V09 A;  2ZCW A;  1DZR A;  4NII A;  4HVQ A;  1UIJ A;  1NCQ A;  2AUY A;  1GBG A;  2JG9 A;  4FT8 A;  4Z07 A;  1CIW A;  3NL1 A;  4C1W A;  5FOJ B;  4KH9 A;  4Q4W 1;  3DV8 A;  1OPO A;  2J22 A;  4A42 A;  2P3K A;  2JDK A;  4XIL A;  3CJX A;  3CJI C;  5L9B A;  3CNA A;  3FLR A;  5IVY A;  2XQX A;  3ASI A;  3VBO B;  4QU1 A;  3KMH A;  1YQ8 A;  3VGI A;  3I2O A;  2V5D A;  3THP A;  4FFI A;  2VTF A;  4LLO A;  3ST7 A;  2D93 A;  1HRV 2;  1NCR C;  1QDO A;  1QGL A;  2CHH A;  3FE5 A;  1UAI A;  3QBQ A;  1DGW A;  2QKD A;  4FP3 A;  1H1A A;  4YM1 A;  5FZD A;  4BJ0 A;  1Q8Q A;  3SEE A;  1O4Z A;  3N9Q A;  4TYS A;  2V4A A;  3BU7 A;  5IJR A;  1XNC A;  1ZBE 3;  5DAB A;  3V0B A;  4EN8 B;  3J8F 3;  5FUP A;  2OII A;  2ZXQ A;  5JSP A;  1W8U A;  2RJ2 A;  4IL7 A;  3AL5 A;  4R9B A;  4YM0 A;  5C5T A;  1UX7 A;  5K9Y A;  2P5B A;  3O1T A;  4FTB A;  2VQU A;  2QDR A;  3VL8 A;  2E53 A;  3A22 A;  4P00 B;  3CJI B;  3U10 A;  5AFE A;  1W03 A;  1AYN 3;  1U5Y A;  4B29 A;  2GH8 A;  1DGW X;  2JDY A;  1OUX A;  1H1I A;  2E6V A;  2TBV A;  1NE6 A;  2WC2 A;  5E88 A;  2JG8 C;  3HQX A;  1X8E A;  5FZ1 A;  3U4S A;  1BHG A;  1ND2 B;  2YRO A;  3KQR A;  4HFS A;  1NCR B;  1TMF 1;  2RS1 2;  3BUC A;  1BMV 2;  3LSE A;  3MPP G;  2HWB 3;  2PN5 A;  4CP2 A;  4HBN A;  3PUA A;  5HXM A;  2BZD A;  5T3N A;  2GZW A;  5JXG A;  2Y6J A;  3MHZ A;  1MS8 A;  4BK5 A;  2RS5 3;  3RFR A;  2WN2 A;  4QX0 A;  1AR6 2;  1MPX A;  1URX A;  1VIW B;  3NNL A;  1CAU B;  2J42 A;  4R4X A;  3WG3 A;  3WNX A;  1CAW A;  1F31 A;  3ZMN A;  1DQ2 A;  4GWI A;  5ANQ A;  3W20 A;  2UY8 A;  5GLT A;  4BXS V;  4RGA A;  2XML A;  2JG8 B;  4I2O A;  1D7P M;  1TE1 B;  5FY0 A;  1I6X A;  2CAU A;  5EXO A;  3ELN A;  3T2T A;  1ZZ7 A;  4J1X A;  3D82 A;  4Q1P A;  5T54 A;  4ZS3 A;  2OVU A;  4HG6 B;  2GN3 A;  4TXW A;  3RMX A;  3CMG A;  4D94 A;  3UL2 A;  2Y34 A;  2ZAA A;  3B69 A;  2B5H A;  3TEY A;  2EAL A;  1NZC A;  4LMF A;  3ZDS A;  3EQE A;  5A3W A;  2Q8C A;  1N3Q A;  1OLR A;  4S2H A;  2H6C A;  5FZK A;  2DVA A;  1G9A A;  5FYS A;  2V4V A;  1L3J A;  3PUQ A;  1V6O A;  1PGW 1;  1NLS A;  1R09 2;  4E9K A;  3OYW B;  3WIN E;  5FO7 B;  3WDW A;  3ZVX A;  5FP8 A;  2JEN A;  4QQL A;  2W3J A;  4WVW A;  2D6M A;  2QDN A;  3HAG A;  4CRQ A;  2A6W A;  5FZO A;  1HQN A;  3ZYI B;  4KU7 A;  5CIR A;  1YFU A;  5LBF A;  4DQA A;  1W9T A;  2ZAB A;  5LA0 A;  3I49 A;  2RG4 A;  1R1A 1;  2NPI A;  4FVV A;  5A3N A;  1VBD 2;  1SFN A;  4KBZ A;  1IPJ A;  4IEW A;  2O0O A;  4YVW C;  1AZD A;  2ZGU A;  1STM A;  1AL2 3;  1VBB 1;  3KF3 A;  4H7M A;  2Y33 A;  5FKB A;  4YG6 A;  2ZJC A;  1EV1 2;  4LBN A;  1VAL A;  3H0O A;  5LBB A;  4F8A A;  3S57 A;  2E31 A;  1RUG 1;  2LTN A;  1RMU 2;  1SFY A;  2ZPX A;  3D6E A;  3SC7 X;  3IDE A;  3AZY A;  1QU0 A;  3K4A A;  4AQS A;  2VC9 A;  4TLF A;  1HXS 2;  3DUI A;  3IPV A;  1NUK A;  4BQY A;  4I0A A;  3RQ0 A;  4GQ7 A;  3R4D B;  4BQ2 A;  2XL9 A;  1ASJ 2;  1PO2 1;  2QTW B;  5F3E A;  4AED C;  3S5A A;  2HJI A;  4L0P A;  3ZPO A;  2VOT A;  2JIG A;  2BVB A;  3I2F A;  4CP1 A;  1PM7 A;  4QXK A;  3PNA A;  4Y5Z 0;  5E16 A;  3WV6 A;  2Y6F A;  3SH3 A;  1UL9 A;  1XC6 A;  4XYX A;  1COV 1;  1W2T A;  4BQ3 A;  3T2Q A;  5DZE A;  2R07 1;  1S0I A;  2Q8D A;  1OUR A;  1Q5O A;  1VRH 3;  2J1R A;  3POF A;  4MG2 A;  3ORJ A;  1N1T A;  4NVP A;  5FY9 A;  1IPS A;  3LOB A;  4IND A;  1GZW A;  4OHZ A;  3W59 A;  1CD3 G;  4K8R B;  3MDP A;  2EAA A;  5IW0 A;  1RUN A;  2ZTN A;  4UF0 B;  4UFL A;  3NAP A;  2E63 A;  1N3P A;  3AXD A;  4MVT A;  3LDB A;  4QMA A;  4XJZ A;  4AED B;  4DMI A;  1H4H A;  1YEW A;  3NW4 A;  1S55 A;  5DAW A;  1C5H A;  4BDV B;  4LEJ A;  4YWA A;  1GQP A;  4W50 A;  1QJY 2;  1RUE 3;  1QJU 1;  1V9U 3;  1W8H A;  2IVI B;  2OQ7 A;  3K51 A;  2LM3 A;  5DAV A;  5A7P A;  3U07 A;  3ZXE A;  5FK8 A;  2PHD A;  4DUV A;  5GLW A;  1DDL A;  3VN4 A;  4BQW A;  2NMO A;  3E97 A;  1GU3 A;  3O12 A;  2EXH A;  4COY A;  4M00 A;  1HN0 A;  3BAL A;  1VRB A;  4QX2 A;  5TSW A;  1Z7S 3;  5F3I A;  2X5I C;  2IXC A;  1OSG A;  3GHM A;  5FYY A;  5C5U A;  1CR7 A;  3AKR A;  3RWN A;  5FPX A;  4QDS A;  1ND3 C;  1VBA 1;  3S7I A;  4AQ2 A;  3I2D A;  1C5I A;  4LNV A;  2GME A;  1BVP 1;  2VBD A;  1NXM A;  3CL1 A;  3ZM8 A;  5DMY A;  2HBU A;  4HPK A;  4FPL A;  1EPZ A;  4IEQ A;  1GNZ A;  4CPB D;  1UU5 A;  2UWB A;  3WW2 A;  2DUP A;  4Y3O A;  3USS A;  2WNV C;  3H42 B;  2D3S A;  1GYK A;  2X5I B;  5A80 A;  3VBR C;  1W6P A;  2JB8 A;  1WW7 A;  3OGJ A;  4QD2 A;  1RIT A;  1IPK A;  4AHZ A;  5FZM A;  4OFG A;  3NJV A;  3P3N A;  4C1X A;  4Z8B A;  3BIE A;  4YFW A;  1XJA A;  2Z4F A;  4M0H A;  5C9A A;  1HQW A;  1KS5 A;  1AX1 A;  2VOX A;  3ZSK A;  2VJX A;  4V2W A;  1O4T A;  4QPG B;  1PM4 A;  1O3R A;  1GZ9 A;  1V6J A;  1QH7 A;  2D6N A;  2I2S A;  2JIC A;  2ZGM A;  1FMD 3;  1FX5 A;  4XXA A;  5DDJ 2;  4X6R B;  3UET A;  2OS2 A;  1BCX A;  2HWE 1;  2RJK A;  1KJR A;  1JN2 P;  2DWR A;  2ZS6 B;  1YI9 A;  2WNV B;  1AR8 2;  1VLN A;  1SLL A;  4XF3 A;  4HKL A;  5T5J A;  3U78 A;  4NPR A;  1VBC 3;  2YYO A;  3VBR B;  1GP5 A;  1IS4 A;  2A3W A;  4IE0 A;  2XVK A;  1QNW A;  3S30 A;  4AFM A;  4ZKT B;  3BN6 A;  4CCL A;  4COW A;  4IER A;  2EXK A;  2P17 A;  1XPW A;  4E4Z A;  5KC5 A;  1W9F A;  3Q8A A;  5HBA A;  1QXJ A;  1NXD 1;  4XW3 A;  4URA A;  2R04 3;  4K21 A;  3TNQ A;  3PLQ A;  1NLQ A;  2HYK A;  4CUB A;  1OKQ A;  2Q1Z B;  5FDB A;  1E57 A;  2ZMN A;  1K5J A;  2A6X A;  4GH4 A;  2B45 X;  5FPA A;  3M70 A;  1CJP A;  5BNN C;  3OTF A;  1XND A;  3NNG A;  3T0B A;  2WA3 A;  3B93 A;  2VXR A;  1CAX A;  1LOE A;  1A8D A;  4GZ9 A;  3ZXG A;  1BZW A;  2ERF A;  2X53 S;  2JE7 A;  3MIF A;  3O5S A;  4AQ6 A;  2RJL A;  1H6Y A;  1WW4 A;  2P4E A;  3NNJ A;  5DUX A;  3GCX A;  2XLG A;  1YNA A;  1VMJ A;  3A0N A;  4Q2F A;  3WLU A;  3WT3 A;  5IVV A;  5L9V A;  3MZH A;  4ONU A;  1YJL A;  3P1I A;  3JD7 1;  3M3I A;  4ZZ8 A;  1RUI 3;  4E4S A;  2ZML A;  4HVO A;  1LNS A;  2BUK A;  4PT6 A;  5L9R A;  3K4Z A;  2IXK A;  5D8A C;  4XC9 A;  2ARA A;  3DPR C;  3JUU A;  3UES A;  1T2X A;  3OEA A;  1UYZ A;  2W94 A;  4IW3 A;  4OLL A;  4TLG A;  1IGO A;  3ACF A;  3FMG A;  4Y5S A;  1OA3 A;  1RUD 3;  4IGP A;  3WVJ A;  5BNN B;  5KC6 A;  1UY4 A;  4LIT A;  5LCW L;  4NID A;  5C33 A;  3C7E A;  3NWK A;  4AGV A;  1SBF A;  3DYO A;  4XEZ A;  2P2K A;  4O9E A;  3NV2 A;  3GDB A;  1VMF A;  4YYO A;  4CP9 B;  3OD0 A;  3VDC A;  3V64 A;  3HQR A;  1ZRC A;  5LA2 A;  4AI0 A;  1W3V A;  1W2O A;  3CZJ A;  4A4A A;  4JCK A;  4XET A;  1PNG A;  2PYT A;  3L2Y A;  1RL3 A;  2OUJ A;  1OFS A;  1KFU L;  4LBO A;  3MLL A;  4IES A;  4FTS A;  2YPJ A;  1Q56 A;  3NKG A;  5D8A B;  3ZSE A;  1C8M 3;  1LHN A;  1WKY A;  2X09 A;  3DPR B;  4P9I A;  2VVF A;  2WNU B;  1MQT C;  3NJX A;  2F6B A;  2PLV 2;  1AR7 3;  4GWN A;  1B35 C;  1I5Z A;  1W0N A;  1ONA A;  3AVR A;  3CJI A;  4JRL A;  1K12 A;  4BXF A;  1F15 A;  1PGL 2;  3QH7 A;  1FT9 A;  4RFT 0;  3RZZ A;  2A75 A;  4BWO A;  4W6X A;  2PEL A;  5KXC A;  3O1R A;  1ND2 A;  1TME 3;  3VL9 A;  4FI9 A;  1NCR A;  1RUJ 2;  2UWC A;  4XAB A;  1NE4 A;  4FPY A;  1SPP B;  1FPN 1;  3VHO A;  5DXD A;  2BPA 2;  3T30 A;  5FLH A;  4RHV 2;  3VLB B;  3T3Y A;  4AVC A;  4V1P A;  2WZR 3;  3OOX A;  3IMN A;  4FPE A;  1CAU A;  2TNF A;  4EWE A;  2WAB A;  1JH5 A;  4Q0S A;  1CAV B;  4ATE A;  4ERO A;  3ZSM A;  5AC9 3;  2TUN A;  4XF0 A;  4YAR A;  2DTY A;  2ARX A;  1QIQ A;  5F5A A;  1R08 1;  1ZBA 2;  2JG8 A;  4LIV A;  5LBC A;  5HPO A;  5IVC A;  4CEW C;  4DXT A;  2EXJ A;  5L36 A;  3HBK A;  1UYX A;  5IK7 A;  4N43 B;  1QJX 2;  2QFE A;  1S4C A;  3FHI B;  5FZ4 A;  5FWE A;  3CBN A;  4GAZ A;  2VL4 A;  1BK0 A;  2DFB A;  3IKW A;  1DCS A;  1LR5 A;  3IWZ A;  3VZO A;  1QQP 1;  1SLC A;  4Q1R A;  1V70 A;  4W6W A;  3UNP A;  3KV5 A;  4NPL A;  4LOR A;  2CTV A;  2P37 A;  4OYU A;  2WQZ C;  2ZKN A;  3U37 A;  4XF9 A;  2W2I A;  3M4F A;  3BPZ A;  3VZJ A;  4Y22 B;  4ES8 A;  3D0J A;  2C6S A;  4K9S A;  1FNZ A;  5C8W A;  2VZ3 A;  2ZEW A;  3N3H A;  3ZYP A;  1W99 A;  3LQC A;  3OYW A;  4CEW B;  5FWJ A;  2H6B A;  4XQW A;  4YVS C;  1K5M C;  5ACA 1;  1AR9 3;  2XBO 3;  1OQ1 A;  4KG0 A;  4NHY A;  3AKQ A;  2R49 A;  2R32 A;  2YC2 A;  4DEQ A;  5F39 A;  1DGR N;  1POV 3;  2DBI A;  4XHB A;  5A33 B;  5IAV A;  4NAO A;  1W0O A;  2HLE A;  4LOT A;  4LO7 A;  1SAC A;  3AB0 A;  4CDU C;  4MHR A;  2K2S A;  3JCI A;  2F4L A;  3WDT A;  5FYC A;  5J37 A;  2F4P A;  4A6S A;  3WW3 A;  4AXO A;  3BTX A;  1W6O B;  3V65 A;  1DZT A;  4XFH A;  5A7Q A;  4XUQ A;  3MBW A;  2P3Y A;  2PHW A;  3RZK A;  1RIR A;  3SXW A;  1E5H A;  3O1U A;  1K5M B;  4D6Q A;  1W28 A;  4Y4Y A;  1SQ4 A;  5F32 A;  4Q4Y 1;  5FZC A;  1Z0H A;  2G1M A;  1JS9 A;  3LA2 A;  4OMD A;  2W9X A;  2YBP A;  3HNB M;  4BIO A;  1OD3 A;  1RUF 3;  1Y4W A;  4KWU A;  2XG3 A;  3GZA A;  1X9P A;  5C6C A;  5DAX A;  1D4M 2;  3RRD A;  3VBH C;  5JWP A;  2FDH A;  5EIY B;  4XXP A;  4AVT A;  3NRU A;  3JBG 3;  4CDU B;  5FJH A;  2GMM A;  4FXK B;  4LBM A;  3S7E A;  1FI2 A;  2RDN A;  4CEY C;  4MGY E;  3FWE A;  1XNA A;  1H0B A;  2Y0O A;  3ZR6 A;  4RS5 C;  3HBZ A;  4D69 A;  3RYK A;  2P3I A;  1GWL A;  2MHF A;  4UT5 A;  4YM3 A;  5DUV A;  3KQ4 B;  5H9P A;  3GGL A;  2C26 A;  3NJY A;  5FP7 A;  3K48 A;  1YJK A;  3K3O A;  3T0D A;  2XUM A;  3A21 A;  1ST8 A;  2MEV 1;  3LEG A;  4WV8 A;  3ACG A;  5CU1 A;  3OGV A;  4KI5 M;  5FYM A;  1HQL A;  1UOB A;  5G05 L;  3WEZ A;  5C3P A;  3CHX A;  2D6O X;  3AKT A;  4UF0 A;  3VBH B;  1O91 A;  1OA2 A;  3O7O A;  4NHM A;  1D0G A;  2VUJ A;  3IN9 A;  4AED A;  3BGA A;  2LS6 A;  1CWP A;  4AVV A;  1O5U A;  4CEY B;  4CCJ A;  1RC6 A;  2EVX A;  3DF0 A;  1AXZ A;  1QJE A;  3I2J A;  3R0R A;  2QE3 A;  4GMP 3;  3UV9 A;  4DOU A;  4YM2 A;  2FHR A;  2WS9 2;  2XOM A;  3SLI A;  4YSF A;  1RXF A;  3LPF A;  3MW4 A;  2K9Z A;  2WBK A;  3THD A;  1LHO A;  2D40 A;  2VW1 A;  4A3X A;  4B8E A;  2JWP A;  2IFR A;  2FMD A;  2QQP A;  2PHR A;  1H2L A;  2A71 A;  2XXZ A;  3JQX A;  5FUN A;  5C8C C;  5C4W C;  2UY9 A;  4FPH A;  2GH2 A;  2QUO A;  3JB4 C;  4GB3 2;  4KQ7 A;  4Z92 B;  3SKJ E;  2WSV A;  4P9G A;  3SIS A;  3ABZ A;  1G9B A;  1OC1 A;  3LAG A;  3WG4 A;  4RQP B;  3LCP A;  4FTE A;  2WO3 A;  2WT1 A;  2CGN A;  2VZO A;  1OPM A;  2XUE A;  2GU9 A;  1JYX A;  2Q1F A;  2IVJ A;  2JXA A;  3PTR B;  2WFP A;  4OHV A;  2AZ5 A;  3PJQ A;  5A3P A;  4AFD A;  4HVR A;  5KHH A;  1UY1 A;  1QKQ A;  4HT1 T;  4NHX A;  3ON7 A;  4XDP A;  2HWD 1;  2WYS A;  4ASK A;  5CFC B;  1KEX A;  1YQ2 A;  5L19 A;  5CG8 A;  5LK7 B;  3TAY A;  3KB5 A;  2X5I A;  2CNA A;  3A7Q A;  5C8C B;  5C4W B;  1RHI 2;  2RS3 1;  4NIA A;  1PGS A;  4L9B A;  4MYE A;  1ZM1 A;  2LW8 A;  5FLI A;  5FYH A;  1OA4 A;  1POQ A;  1W8W A;  4FQ4 A;  4AAX A;  2J1E A;  5FLJ A;  4D6R A;  1J59 A;  1PO1 1;  1SZB A;  1WD3 A;  3MIE A;  4E27 A;  2WWU A;  3MFA A;  1OLM A;  4WVM B;  2HBT A;  1XU1 A;  4MGI E;  3WQB A;  3PUS A;  1MZ6 A;  4QM9 A;  3M2M A;  4QPG A;  1MZF A;  4OI4 A;  4XJA A;  4LBK A;  2QZ3 A;  3RS6 A;  1RYY A;  3AP5 A;  4MET A;  2RR1 1;  1YUD A;  1W8N A;  2PHL A;  3O0V A;  3QH6 A;  5CNA A;  4QXC A;  2WNV A;  4YGD A;  5FP3 A;  1SLA A;  1LHV A;  1U5X A;  4CDW C;  3RWK X;  3RVH A;  2E7T A;  4X8N A;  1PVC 3;  1POV 0;  2Y0I A;  4HET A;  2VD7 A;  2XDV A;  3IM0 A;  3KVB A;  4N8M A;  1OF3 A;  1LEM A;  5I0D A;  5JR7 B;  4OHY A;  5FMB A;  2B9V A;  1JZ6 A;  3NV1 A;  4S2G A;  3BIW E;  2A1X A;  3AYE A;  2GP5 A;  1TNR A;  1XNT A;  2RVA A;  2DVF A;  4JDO A;  3H1M A;  1EAH 2;  5J7M A;  1A8M A;  2XWJ B;  3SH5 A;  3THC A;  4BPZ A;  2IXH A;  4U2A A;  2VTX A;  1RVF 3;  1S0D A;  2AEY A;  5LY2 A;  4XJW A;  2JDA A;  1UZV A;  5EJ1 B;  4DFS A;  1ZRI A;  4YZ4 A;  1WA6 X;  4CDW B;  2X05 A;  1BEV 3;  2D6P A;  2QQJ A;  5JR2 A;  1EY2 A;  3HR9 A;  4LKS A;  2EXI A;  3AZW A;  5JSO A;  2JDU A;  5K4L A;  4QGM A;  1V0A A;  1ZYB A;  2RM2 3;  3HVD A;  4ASM B;  3GF6 A;  1QDC A;  4N9H A;  5A6X A;  4CSW A;  4LO8 A;  5IVJ A;  1BLZ A;  5EWS A;  3I2K A;  2EA7 A;  2OA2 A;  1RUC 1;  5FRA A;  3HPN A;  1VBE 2;  4IDZ A;  3NJZ A;  1WME A;  1YO8 A;  2A3X A;  4ITC A;  2J1T A;  3RI9 A;  5BNN A;  4XUN A;  3KGL A;  4PI2 A;  4TTG A;  2BFU L;  2D44 A;  2J1S A;  3Q8E A;  3VZN A;  4OHW A;  1G86 A;  5FZ8 A;  1AJK A;  4CP9 A;  1VR3 A;  1NKG A;  5DN2 A;  2WFF 1;  1HW5 A;  3GAL A;  1KJL A;  4XF4 A;  5LA9 A;  2VVD A;  5BV6 A;  2XJT A;  3P3P A;  1AJO A;  1HRI 2;  1LOF A;  2XR4 A;  2YU1 A;  4EQV A;  3VBS B;  1FOD 1;  1PIV 2;  2A6Y A;  3S0M A;  1O59 A;  3RJR A;  3TN9 3;  2RDQ A;  1XSQ A;  5FQ0 B;  5D8A A;  4Q4V 2;  3DPR A;  2HWC 1;  1H8T A;  1KFX L;  3SIT A;  4EN6 B;  1SG3 A;  2Y6H A;  3PVB B;  4LO4 B;  1KXG A;  3V56 A;  4AEM A;  4BLJ A;  2WNU A;  4OVE A;  4TSV A;  4A7Z A;  5A7W B;  4XZP A;  5I0U A;  4LBQ B;  1GKB A;  4CZS A;  2E51 A;  3FX3 A;  4OUS A;  2YGM A;  4KWL A;  2L9L A;  1RUO A;  4WVZ A;  3HNM A;  4Q4W 2;  4JRA A;  1US2 A;  1HV1 A;  3DEC A;  1MEC 1;  3POB A;  3ZR5 A;  4CUG A;  3ZYJ B;  5E1R A;  2WKK A;  2R06 3;  4F83 A;  4BLI A;  4QAW A;  3ZKY A;  1SPP A;  1WA4 A;  4PLN A;  4QQ2 A;  5FZ9 A;  4MGK E;  3SQO A;  4UAP A;  2VZU A;  3PUR A;  4IV1 C;  1YYN A;  4E8C A;  3UGH A;  1LTE A;  2W92 A;  3VD4 A;  1DG6 A;  1F2N A;  4H3W A;  2ZGN A;  2VCC A;  5F8P A;  1JOJ A;  3AJZ A;  3FL7 A;  1HJG A;  4AI1 A;  3ZN4 A;  3E6B A;  1VP6 A;  4J1W A;  1CAV A;  4ZON A;  5HCA A;  4GKY A;  1LOC A;  3R6S A;  3H8O A;  3N9P A;  4JDM A;  2OZJ A;  1DZQ A;  2VBB A;  4P08 A;  1ZBE 1;  3OPT A;  4GAL A;  4IEO A;  4JX0 A;  4N43 A;  3J8F 1;  4CDQ B;  4WZF A;  5B4X A;  1BBT 3;  1GP6 A;  1YQC A;  2VZP A;  4AHX A;  2D6L X;  1VB2 A;  3ES4 A;  3RZH A;  4IV1 B;  4AI2 A;  5LWB A;  4RGK A;  4N53 C;  2FDK A;  1TMF 2;  1AYN 1;  2IC1 A;  2W1U A;  1GAN A;  1DGL A;  2Y60 A;  4KGQ A;  3T4H B;  4Y22 A;  1VPH A;  5F7U A;  2RMU 3;  3PL0 A;  4ZU5 A;  4AGG A;  3ATG A;  3WHU A;  4AI3 A;  4BME A;  1F35 A;  4MGZ E;  3EYP A;  5C70 A;  2HWB 1;  3U1X A;  4CEW A;  1H2M A;  5BXX A;  3O1V A;  3GBG A;  4AI8 A;  4XJ8 A;  1XQN A;  4Z2W A;  3CLP A;  3KZ4 C;  4ZXK A;  1ZA4 A;  5LRR A;  3ZXL A;  2NZ9 A;  1LUL A;  4QX1 A;  4BK4 A;  1AXK A;  3OUH A;  2RS5 1;  3LFI A;  3WF4 A;  2Z69 A;  4M3C F;  4QKF A;  3BKZ A;  5GZG A;  4N53 B;  3JB8 A;  5A33 A;  1W06 A;  4U36 A;  4QPI C;  5FPZ A;  4PIX A;  5T50 A;  3M7A A;  2YU2 A;  1ENQ A;  1RUH 3;  4CU9 A;  3POE A;  4CCE A;  1W6O A;  2BYV E;  2R7E B;  4HKW A;  4HOO A;  4JGZ C;  4MH0 E;  1ULE A;  3LIG A;  3VV1 A;  3OGR A;  2VVE A;  1C3H A;  3AMN A;  3H1Y A;  3ZN5 A;  5FPL A;  1NY7 1;  3OJB A;  4BZ4 A;  3PIG A;  2E26 A;  2Y38 A;  3GHN A;  4G4F A;  3MF6 A;  5FMO S;  1W8T A;  1RIN A;  1ZZ8 A;  1ZZB A;  2ZGR A;  5C3R A;  1K5M A;  3K3N A;  1C57 A;  4P9J A;  1AX0 A;  4Q4X 3;  4NN0 A;  4BHP A;  5A6Q A;  3ZO0 B;  4W65 A;  1MS4 A;  1H9W A;  2CL2 A;  4AVS A;  2I07 B;  3PME A;  2AEZ A;  3ZFF C;  1A3K A;  1I9R A;  1PGW 2;  4O61 A;  4XUP A;  5C3Q A;  4DUX A;  5FOB B;  3IMM A;  1UU4 A;  2ZGP A;  4LPL A;  4WM7 C;  3IT8 A;  3ZYR A;  3LZZ A;  2HWF 3;  4LE4 A;  4K7J A;  4QPI B;  4LQR A;  3WR0 A;  2G9F A;  2DYC A;  5JOX A;  1Q8V A;  4MLO A;  2NMN A;  3VKF C;  1R1A 2;  4LA2 A;  1LHU A;  1X9T A;  1HB2 A;  5F2W A;  3RZL A;  2HEY F;  2DVD A;  5K7P A;  1WBL A;  1W8F A;  1SCR A;  4QQH A;  1VBB 2;  3RSJ A;  3VKO A;  2DDU A;  3W9A A;  3AKP A;  3WNK A;  5F5C A;  3OG2 A;  1F5J A;  4LUL A;  3L9J T;  1UNB A;  3ZFF B;  4FFH A;  4TZD A;  4K8F A;  1DU3 D;  3VBH A;  1VJ2 A;  1AL2 1;  1RUG 2;  4CU8 A;  4EZH A;  1YLL A;  2DUQ A;  4R9D A;  1G8W A;  5FMC A;  3I3M A;  2W08 A;  3AJY A;  3B9C A;  5CKN A;  3PHM A;  4A7K A;  3GZU C;  4CEY A;  4Q0V A;  2BFU S;  4M01 A;  3AYC A;  3LFM A;  4XAE A;  1PO2 2;  1ULO A;  1N1Y A;  4AAP A;  2WL1 A;  3NV4 A;  5IT6 A;  1X8M A;  4Z1V A;  4AZZ A;  1K42 A;  3GJA A;  5IWF A;  3GJB A;  3FUQ A;  1COV 2;  4CTE A;  3IBM A;  2JDM A;  1F8V A;  2R07 2;  1OUS A;  1E5I A;  2P1B A;  2XL7 A;  3TB0 A;  5IVE A;  5JDB A;  4M4R A;  2CAV A;  4PCR A;  5J09 A;  4BU2 A;  1IKP A;  4RQP A;  1UZ0 A;  3I2G A;  3EHK A;  4E2S A;  4DIQ A;  3U0Z A;  1HRV 3;  1VRH 1;  2Z2S B;  2CY6 A;  4COZ A;  1U5Z A;  4D0Q A;  1GR3 A;  3AKS A;  1PZ7 A;  2A7A A;  2XKP A;  4FXG B;  3WG1 A;  4AG4 A;  5HI0 A;  2VMD A;  4NIH A;  1CZT A;  3C7F A;  1WZX A;  5JZG C;  3ILF A;  1ULP A;  3LIH A;  5FYT A;  1J1L A;  5CFC A;  3ZLI A;  3EBR A;  1QJU 2;  5I8T A;  4IE7 A;  4S2D A;  2ZEY A;  3AZZ A;  4OQ8 A;  4O65 A;  5C8C A;  1ZRD A;  5AVP A;  5C4W A;  4DRR A;  1CPM A;  4WVV A;  4ZY9 A;  4YVW B;  1MS0 A;  3B02 A;  3WNN A;  4C0B A;  1YXW A;  3Q8C A;  2Q0A A;  1RUE 1;  1V9U 1;  4HSL A;  4QKB A;  3VBF A;  3PJY A;  1RTV A;  3RNS A;  5A7N A;  2B39 A;  5CFD C;  2YDE A;  2Z79 A;  1JZ2 A;  1SLT A;  4WVM A;  2RS1 3;  3WDV A;  1F4A A;  4AE2 A;  5LY1 A;  1SDW A;  3LD8 A;  3VDA A;  1JZ8 A;  1VBA 2;  4QU2 A;  4RA0 A;  1V6L A;  1UQX A;  5HCB A;  4XFC A;  1Z7S 1;  4J6G A;  5JCT A;  2BBV A;  1D2S A;  2Y8K A;  4AEK A;  4FFG A;  1DLL A;  4BQ1 A;  3R4U A;  2PQS A;  1AR6 3;  1HJF A;  2DFC A;  4OQ9 A;  2JEM A;  2ZX0 A;  4Z2A A;  1ZZC A;  1YRZ A;  1QMJ A;  4NE9 A;  1KIT A;  5FYB A;  2WO7 A;  3CDZ B;  1OD5 A;  2DV9 A;  4IE6 A;  2I74 A;  4XFI A;  1UKG A;  4LR4 A;  4FCA A;  2BNO A;  2XPJ A;  2VY0 A;  1C1L A;  1RJ7 A;  4JV4 A;  5FR3 A;  3UYJ A;  4M4P A;  5FP4 A;  2VTX J;  4YVS A;  3CO2 A;  4NRM A;  3THT A;  1Y3T A;  4GD4 A;  3AMQ A;  1UD1 A;  1XBF A;  5FMD A;  5I0T A;  2Y26 A;  3B00 A;  3ZFE C;  2JB4 A;  4R52 A;  1EUT A;  1SCS A;  3RJ2 X;  2QQN A;  4MGT A;  1WMX A;  2TEP A;  2BNN A;  2O8Q A;  1RXG A;  2KA3 A;  4CDW A;  5I8Y A;  1DLC A;  4COV A;  2DF7 A;  3TWI A;  3ZXK A;  2HWE 2;  1GOG A;  3III A;  4OUL A;  2E32 A;  4ZU4 A;  3N7M A;  1AL0 G;  1R09 3;  3H7J A;  3E5X A;  1W9W A;  3ECQ A;  3HJR A;  1O6U A;  4EN0 A;  1FMD 1;  4CCN A;  4BB3 A;  5DG2 A;  1L7Q A;  5B4N A;  4CXY A;  2BWA A;  4H2A A;  3OBT A;  3GYD A;  2WO2 A;  5FYU A;  2XB6 C;  5C7G A;  5FO9 B;  1QH6 A;  1VBC 1;  4AFC A;  2YY1 A;  1VBD 3;  2VAU A;  4CDX C;  1M4W A;  3HD8 B;  2IWG B;  2VNV A;  5ERL A;  2QZ2 A;  5SV5 A;  1LGN A;  1ULG A;  2IXL A;  3AZX A;  5JOZ A;  1ND3 B;  1EPW A;  3DKW A;  1EV1 3;  4HK9 A;  2EIB A;  5EP9 A;  2AEN A;  5FYI A;  1IS3 A;  2WAO A;  1L7L A;  2R04 1;  4ASL A;  1F5F A;  1PX3 A;  1DP0 A;  1S2B A;  3DKQ A;  4HXC A;  3O1S A;  1RMU 3;  5FKC A;  2JX9 A;  2YMZ A;  2XKO A;  4NHL A;  3POY A;  4UFH A;  1V6K A;  4MXW B;  3TOJ A;  3VBS A;  3LA3 A;  1UMH A;  3WY6 A;  1HXS 3;  4EE2 A;  5FIX A;  4CDX B;  5FQ0 A;  1HLC A;  1ASJ 3;  1W6N B;  5BNP C;  1E5S A;  3M3C A;  3WNP A;  1S0B A;  2A70 A;  2W1Q A;  4N7U A;  3JD7 2;  5KXD A;  5FY5 A;  5A7W A;  1J1T A;  4LBQ A;  1LB2 A;  4CE8 A;  2VEC A;  4PDW C;  1ZA7 A;  4XJU A;  4YW1 A;  2XHK A;  3HNY M;  3FN9 A;  4N90 A;  4Y26 A;  1WLW A;  4IQP A;  1JOP A;  2ORX A;  1Z78 A;  2D3P A;  3QD6 A;  4FBF A;  1XE7 A;  1RUI 1;  1ZX5 A;  2SBA A;  3SCF A;  3C3V A;  4DIN B;  3WNM A;  5LRS A;  1O4Y A;  4ZS2 A;  4XFB A;  5JI7 A;  1QNY A;  3NST A;  4Q27 A;  4YW6 A;  4I3P A;  3T09 A;  1OOP C;  1VAM A;  3Q9O A;  3KV4 A;  4FPG A;  1RUD 1;  4Y4R A;  4JAA A;  1BJQ A;  1NT0 A;  1ULF A;  2X29 A;  5BNP B;  1PZ8 A;  2DUO A;  1VMH A;  4OMC A;  1DF0 A;  4XQ4 A;  4XTM A;  4NHK A;  3A4U A;  1JYV A;  2OX0 A;  3H50 A;  1KQR A;  2QQV A;  3DXT A;  3VDD C;  1I1E A;  2OXB A;  4P5Y A;  1QJY 3;  3LOI A;  4Y5T A;  2UWA A; 
#chains in the Genus database with same CATH homology
 3T2O A;  1JHJ A;  4CVU A;  1UY2 A;  1KGY A;  3GGL A;  3VD9 A;  2C26 A;  4QPW A;  4DXR A;  3DYM A;  3T0D A;  3A21 A;  3LEG A;  3ACG A;  1UXZ A;  3ETP A;  3OGV A;  2VMF A;  4KI5 M;  3WEZ A;  5G05 L;  2QQM A;  2EIE A;  3IAQ A;  4XUR A;  1TVG A;  3BGA A;  3MUZ 1;  1OH4 A;  2LS6 A;  1JYN A;  2CDO A;  3I2J A;  1GUI A;  3EB7 A;  3MO4 A;  2XOM A;  1GMM A;  3GXU A;  2ID4 A;  3I2I A;  3LPF A;  5IFT A;  3THD A;  2WBK A;  1GNY A;  2E33 A;  4XUO A;  4W8J A;  4A3Z A;  5EJZ B;  2VZR A;  2ZEZ A;  3T08 A;  1CX1 A;  1PMJ X;  3CQO A;  4QB1 A;  4ZZ5 A;  4OZO A;  1JU4 A;  2W1S A;  2WAA A;  1OT5 A;  3I97 A;  2VZS A;  3SKJ E;  3ABZ A;  2WO3 A;  5J1X A;  1UXX X;  2VZO A;  1JYX A;  3CKH A;  1GOH A;  3CZU A;  3NQH A;  1UY1 A;  4ET7 A;  2VO5 A;  1NAE A;  2WYS A;  3T0A A;  1KEX A;  1YQ2 A;  2C9K A;  3A7Q A;  3LEK A;  2QQO A;  2J22 A;  4A42 A;  3LEI A;  2LW8 A;  4JKL A;  4AAX A;  2J1E A;  2XQX A;  2V5D A;  3WQB A;  4UOJ A;  2VTF A;  1RYY A;  1CZV A;  4BJ0 A;  3T2P A;  3SEE A;  1W8N A;  3F2Z A;  2DCJ A;  5IJR A;  5JMO A;  2HYX A;  2ZXQ A;  3LE0 A;  2RJ2 A;  2KD7 A;  1UX7 A;  2J1A A;  2VQU A;  1H6X A;  3A22 A;  4P00 B;  4XUT A;  3JXS A;  3K4D A;  3A23 A;  1OF3 A;  1IQD C;  5I0D A;  3FHA A;  3K77 A;  2B9V A;  3I3B A;  1BHG A;  4RN5 A;  1JZ6 A;  2RVA A;  3DYP A;  1XNT A;  3W5N A;  2QBX A;  1W9S A;  3THC A;  5HXM A;  2BZD A;  4DUW A;  5JXG A;  2JDA A;  5EJ1 B;  2Y6J A;  3AC0 A;  4BK5 A;  2X05 A;  2WN2 A;  4QX0 A;  4DXS A;  2VZV A;  2QQJ A;  2VCA A;  1MPX A;  4LKS A;  5JR2 A;  5CZK A;  3FHQ A;  4GWI A;  3OGS A;  4BXS V;  1D7P M;  5IHR A;  4MOA A;  2VZ1 A;  4MAD A;  3MV0 1;  3I2K A;  1W8O A;  1WCQ A;  5JUV A;  3HPN A;  2X10 A;  4HG6 B;  4TXW A;  3CMG A;  3K46 A;  2ZEX A;  2J1T A;  4XUN A;  2J1S A;  1NX9 A;  3J7H A;  3E1F 1;  1NKG A;  5DN2 A;  2V4V A;  3MV1 1;  1P8J A;  2W3J A;  1O59 A;  1K45 A;  4DEV A;  2EID A;  4QDQ A;  1W9T A;  3OBA A;  3LPG A;  1R64 A;  5LA0 A;  1SG3 A;  2Y6H A;  3C7O A;  4MGS A;  1DYO A;  4QB2 A;  5JXI A;  2BBA A;  1SDD B;  2L9L A;  3HNM A;  1US2 A;  3DEC A;  1JZ3 A;  2E31 A;  2VZQ A;  2EIC A;  3K4A A;  4QAW A;  2VC9 A;  4UAP A;  2VZU A;  4PQQ A;  1NUK A;  4E8C A;  4ARY A;  2W92 A;  3VD4 A;  2J7M A;  2VCC A;  4L0P A;  5G04 L;  2VOT A;  3FL7 A;  3I2F A;  2W87 A;  4A41 A;  3C7H A;  1XC6 A;  1CZS A;  3T2Q A;  4P08 A;  4JX0 A;  2J1R A;  5FUI A;  4P02 B;  1JZ7 A;  3WF1 A;  5B4X A;  2VZP A;  3HOB A;  4JKK A;  1O8P A;  2OKX A;  2WZE A;  2W1U A;  5IYY A;  3CIH A;  5F7U A;  1EUU A;  4UI9 L;  4BDV B;  3IAP A;  1GQP A;  5C70 A;  4W50 A;  5DQ0 A;  3EYP A;  4DUV A;  4CU6 A;  4CU7 A;  1GU3 A;  4BK4 A;  3WF2 A;  4QX1 A;  3C8X A;  2JKX A;  4QX2 A;  3P6B A;  3WF4 A;  1TG7 A;  2YB7 A;  2Y6L A;  2JE8 A;  2YC4 A;  3WSO A;  4QDS A;  4QB6 A;  4MO3 M;  2YFZ A;  4CU9 A;  1PMH X;  2QQK A;  2R7E B;  4E8D A;  3ZM8 A;  3OGR A;  5DMY A;  2E26 A;  2VR4 A;  2BGP A;  2W5F A;  4XVH A;  4DUX A;  4XUP A;  2QQL A;  1L7R A;  4LPL A;  4A45 A;  1OF4 A;  4QDR A;  4LQR A;  1UY3 A;  4CUA A;  3NJV A;  2Z4F A;  2VJX A;  4YPJ A;  4ARX A;  1GOF A;  2ORZ A;  1JZ4 A;  5A1A A;  1CIY A;  2DDU A;  3WNK A;  3UET A;  3OG2 A;  2QQI A;  2J1U A;  3I2H A;  4CU8 A;  5C71 A;  3VD5 A;  2VMC A;  3BN6 A;  1XPW A;  2YFU A;  3VD3 A;  1ULO A;  2WQ8 A;  1K42 A;  4CUB A;  4ZXE A;  4OUE A;  1UMI A;  1J83 A;  2WN3 A;  3NNG A;  3T0B A;  1UYY A;  4M4R A;  2Y64 A;  2YG0 A;  4GZ9 A;  4JHZ A;  1UZ0 A;  3I2G A;  1HN1 A;  1H6Y A;  4QX3 A;  2WZ8 A;  2DCK A;  4D0Q A;  4AG4 A;  2JD9 A;  2VMD A;  4ZZ8 A;  3P1I A;  1CZT A;  3C7F A;  3K75 B;  1ULP A;  1LNS A;  3C7G A;  4PT6 A;  3K4Z A;  3WNO A;  3HEI A;  4A44 A;  5IFP A;  3UES A;  1T2X A;  3OEA A;  1UYZ A;  2W94 A;  2ZEY A;  3ACF A;  1PX4 A;  2WUH A;  4ZY9 A;  1UY4 A;  5LCW L;  5DPN A;  3MUY 1;  3WNN A;  3C7E A;  3DYO A;  3GDB A;  2VQT A;  3VDC A;  1JZ2 A;  3SEP A;  1F4A A;  2VME A;  3CZJ A;  5LA2 A;  4A4A A;  1SHW B;  3VDA A;  1JZ8 A;  1JZ5 A;  2BER A;  1US3 A;  3I3E A;  4CUC A;  1I5P A;  3PUI A;  3D3A A;  2Y8K A;  2X09 A;  1WKY A;  3GM8 A;  3HN3 A;  2PQS A;  2W1W A;  3NJX A;  4Z2A A;  1W0N A;  2XHN A;  4RYD A;  2W91 A;  1K12 A;  3CDZ B;  4D8M A;  4FI9 A;  2CDP A;  4M4P A;  2XON A;  5JXH A;  1EUT A;  2QQN A;  3PUH A;  1J84 A;  2VM9 A;  1JU3 A;  2Y6G A;  1DLC A;  2J1V A;  3WF0 A;  1GOG A;  3III A;  2E32 A;  2WAB A;  2WDB A;  3VD7 A;  2B4K A;  1W9W A;  3ECQ A;  3HJR A;  3SKV A;  5LA1 A;  4PF1 A;  2W47 A;  5HPO A;  3OB8 A;  1L7Q A;  1O8S A;  4DXT A;  1UYX A;  5B4N A;  1F4H A;  2C4X A;  2WO2 A;  5C7G A;  1UY0 A;  4W4Z A;  2VL4 A;  2W46 A;  4JKM A;  1JYW A;  3UNP A;  2W95 A;  5CYY A;  2V72 A;  4OYU A;  3U37 A;  2EIB A;  4MGQ A;  2WAO A;  1K3I A;  1PX3 A;  1DP0 A;  2VZ3 A;  2ZEW A;  5JXJ A;  1W99 A;  3LQC A;  2BGO A;  1UMH A;  3W5M A;  3IDA A;  2YC2 A;  4DEQ A;  3WNP A;  1JI6 A;  2RV9 A;  2HLE A;  2W1Q A;  3WF3 A;  3HNY M;  3FN9 A;  3IB3 A;  4GWJ A;  2ORX A;  4XUQ A;  3MBW A;  3OEB A;  3WNM A;  3ACI A;  4KMQ A;  3T09 A;  4A6O A;  4TTG A;  4OMD A;  2W9X A;  3HNB M;  1OD3 A;  4KWU A;  4IUG A;  4LHS A;  2VZT A;  1UWW A;  4OMC A;  3ACH A;  2VCB A;  5EIY B;  2WO1 A;  3I3D A;  3NRU A;  1JYV A;  3VDB A;  4XZU G;  4P5Y A;  2Y6K A;  3WNL A;  1XNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...