1U5YA

Crystal structure of murine april, ph 8.0
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
137
structure length
137
Chain Sequence
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 137
sequence length 137
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5yA00
1WCKA 1IQAA 1TNRA 4MSVA 4KGGA 3AB0A 2X29A 1I9RA 1U5XA 2WNVB 1PK6B 4MXWA 2E7AA 2HEWF 3URFA 4GIQA 1A8MA 5KC6A 2Q1MA 4G4FA 3TYJA 1OQDA 4TWTA 4E4DX 4QQ2A 4RSUA 2OIIA 2JG8B 1D0GA 1RJ7A 3TWIA 4QPYA 3MI8A 5L36A 2RJLA 2JG9A 2WNUC 3K48A 2RJKA 4MXVA 5KC5A 2AZ5A 4OUMA 3ALQA 2QDNA 2WNVC 1PK6C 2O0OA 3L9JT 4NN0A 3QD6A 3B9IA 2ZJCA 1D2QA 4MXWB 3LKJA 5KWRA 5TSWA 3K51A 5HBAA 1XU1A 4DB5A 5BNQA 1OQEA 2R30A 2ZPXA 2HEYF 4KG8A 4F3JA 4QQOA 2JG9B 1JTZX 2WNUA 2Z5WA 2HEVF 1U5ZA 1GR3A 3QBQA 3FC0A 5L19A 1C3HA 5CIRA 3V56A 3WD5A 4TSVA 4QQLA 2QE3A 1O91A 1RJ8A 2R6QA 1U5YA 2JG8C 4EN0A 3B93A 4HT1T 3IT8A 2JG9C 1ALYA 4KGQA 2TUNA 2R32A 1C28A 2TNFA 1KD7A 2RE9A 2WNUB 1S55A 2KA3A 1KXGA 1OSGA 1JH5A 1DU3D 2WNVA 1PK6A 4D7YA 3B94A 1D4VB 2Q8OA 4DOUA 4J6GA 4G3YC 4OUSA 1XU2A 4QQHA 4OULA 4QQPA 1TNFA 2JG8A 3ME2A 4E4SA 1DG6A 4N90A
chains in the Genus database with same CATH superfamily
1JXNA 3K2OA 1YEWA 4BYYA 3NJZA 1CVNA 2JDZA 1BMV2 4XBLA 2OW4A 3S30A 3WR0A 2WZEA 5HXMA 4M3CB 3ETQA 3KGLA 3DXTA 3UESA 5EYXA 1EAH2 1RUD1 2VVFA 2JXAA 1MZFA 1SACA 1K5JA 1GZWB 2JD4A 4JDNA 3KCCA 3OBZA 2X5IC 3KHBA 1PGL2 4PIYA 1GQHA 4W6YA 1LJ7A 1OVSA 4QKDA 3TNQA 4CEWC 2CGPA 1CJPA 1RUE2 4I3GA 1JHJA 4OYUA 5IK8A 5DXDA 2E6VA 1IGOA 5FZBA 1IKPA 1RJ7A 2YZ4A 4JQTA 5J36A 4CDUC 3RZZA 1JBCA 1L7RA 3AKPA 3WQBA 5FZHA 2DU1A 2VJXA 3U14A 2VOXA 2QVSB 2ZAHA 3RRDA 3X29B 2EA7A 4AAXA 3O1PA 5FQ0A 4Y5SA 2VZVA 4AHWA 3E6BA 5FPVA 1AR61 5FY5A 1OOPB 1OVPA 2VTXA 4B8EA 4AEMA 3OJBA 2W87A 1J59A 3U75A 1H0BA 3WSOA 1GWKA 4PIZA 4OI4A 5FZGA 3S5QA 1BYHA 1UKGA 4JKKA 4JGYC 1APNA 3ZKYA 1UN1A 5CEHA 4UW6A 2I07B 2VNVA 3CZJA 4M3CE 3D6EA 2ZX4A 4DZGA 3FL7A 4KG8A 3NL1A 2BTVC 2ET7A 1RVF1 1TME1 3POWA 4A6SA 3EQEA 4QXKA 2D6KA 3EB7A 1UY4A 2JECA 4PDWC 1W6QA 1AYN1 1JMUB 4WVZA 2FZ2A 1YQ8A 1OLRA 1QOOA 2B39A 4XBQA 4AEDB 3I59A 5GZGA 3ZSEA 1X8MA 1H2MA 3C7OA 1NY71 4ONUA 4YW5A 4FPJA 2A73B 4RYDA 1PO13 4QQLA 4BMEA 1VBA3 4OZOA 5DPNA 3HBKA 1WMXA 3WDTA 4ASLA 4COZA 3BU0A 1UYPA 4OMDA 1CPMA 1H4GA 1FMD3 5IVYA 3POBA 4I02A 1YQ5A 2KXLA 1U5YA 2YFZA 4MGKE 1V9U1 1W8OA 2P1BA 4R9AA 4EN0A 3N9LA 3I3DA 3H3ZA 5IVVA 4LULA 2JE8A 2XVLA 3U4SA 2AR6A 4Q2FA 2YXSA 3C7HA 1DQ5A 5L9VA 3RNSA 1SZBA 3V0BB 2ZHMA 1DP0A 1KD7A 1FPN3 4FFGA 4WZFA 2GN3A 5DAPA 2ORZA 2BGPA 1TQ5A 5EFUA 2ARXA 3Q8BA 2A6WA 4N8MA 3WDWA 1PK6A 5JXIA 1C4RA 4MGSA 4GH4A 5A6YA 3B7MA 2XMLA 5J1XA 3RG0A 1BBT2 4CCJA 4MHRA 2VOWA 4OUSA 1F15A 1XU2A 4L97A 3I2OA 1FOD2 3LF7A 3OBTA 4LKSA 5BUVA 4LKFA 4DNYA 3T2OA 4Y20B 1QJU2 2VM9A 2ZHKA 2PLV1 4ISRA 1FYUA 2V4VA 2XL9A 4NRPA 4Y1VA 3AYCA 3E1F1 4FCAA 4IEYA 4Q0SA 4CCOA 1Q8QA 3KD4A 1ZRDA 2BRTA 3MYXA 1WA6X 3HR9A 2V5DA 4LMFA 4P9WA 3ROUA 4GJYA 3VBRB 4EN8B 1JZ8A 4FOQA 1JS9A 1UZVA 3VLBB 2FDIA 4MADA 2WWUA 3WP5A 3TEWA 1QJY2 1W6MB 1PIV2 2WO7A 4PBOA 4WM7C 4RS5B 1PVC1 4MXWA 4R52A 4W65A 1OQ1A 5J98B 2FQPA 4P02B 4E4DX 2HWE3 3K77A 3UYJA 3A7QA 2CY6A 2RM23 1V70A 1PX4A 1UOJA 4AOCA 4BCUA 3TWIA 4UFMA 2DTYA 1CESA 1AL21 1DQ1A 1HW5A 1VBB3 2CAVA 2RJLA 1RUC2 1A6CA 2Y38A 4KBZA 1QY4A 3G7DA 4GWMA 4AW7A 3S57A 1GV9A 4BPZA 1JYNA 3JB8A 5FZLA 4DY3A 1WLDA 4CP2A 1S0BA 2AZ5A 4G9SB 4JV4A 4PF5A 5EZWA 4D6RA 2IFRA 1K5MC 3LDBA 3CF6E 3WHUA 2BZDA 3HN1A 1GFF2 3DPRC 3MHZA 4EE2A 2RMU1 1YNAA 3WV6A 1D4M2 1O4YA 1E57A 2ZMKA 3ORJA 4AE2A 3PUIA 1N3PA 1BK1A 1I3HA 2WFPA 1FT9A 1L7LA 3LGRA 3DL3A 3CJIC 1L7QA 3WG1A 4QQOA 4AFMA 1FPN1 5FPAA 3MBWA 3MIEA 3H1YA 4BQ3A 3P1IA 1IPSA 2DVAA 1S2KA 1JYXA 4Q5OA 1WZXA 2P3YA 4CRQA 2RDNA 5JOWA 2EVXA 1F4AA 1IHMA 1OKOA 3KZ4C 5F5QA 1TMF1 2XBO3 4TN7A 5FZ8A 3O1OA 3QACA 4BHPA 2BWAA 1XB9A 4AQTA 1REFA 3VD3A 3FN9A 1YHFA 4AK3A 3RWKX 1UX6A 2BFUS 1VBC3 3MF9A 4J25A 4Y33A 3M70A 3VBSB 3OUIA 3WCSA 5FMBA 1LU2A 3KV6A 5ABJB 5L7OC 2WZ8A 3ZN6A 1HRI2 5IFTA 1UWWA 4YM2A 1IOAA 1UCXA 5K0UB 2B9VA 1S0GA 4HL0A 3RZKA 2EF6A 3RYKA 1KXGA 4BJ0A 4LOTA 3DYPA 3WX5A 3I3EA 1UOGA 3AK0A 5LA1A 2ZX2A 3OYWA 1W04A 1S0EA 1J1LA 1ZBE3 3JBG3 4Q4W2 3ASIA 3ZX7A 4BA6A 5JI9A 3B94A 1RMU2 1HV1A 1V6NA 1W2NA 5LW9A 1FV2A 2K9ZA 4YW6A 3WW2A 3MDPA 3ZXKA 5I91A 2ID4A 3LA2A 2D40A 2X5IB 3CL1A 4QQPA 1D0HA 2Q0AA 3SCHA 4D8MA 3H8OA 2A6XA 5CZKA 1W6OB 4IV3A 5LY1A 3ZFGC 1O8SA 1RVF2 5T55A 5C5UA 4N53A 1YCIA 4L8QA 4CDUB 1SMVA 1DQ2A 4XTMA 5BXXA 2ZBJA 4OI1A 5FK7A 2H6CA 1YRZA 1KS4A 4Q4Y3 1CAWA 3PTYA 3ZIWA 2IXJA 3ZXGA 2G9ZA 3I97A 5LRRA 1NY72 1S0JA 1VBE2 2IXIA 4CCKA 4EQVA 5FKCA 1JZ6A 2HEWF 3IBMA 4GMP0 1XJAA 4IGPA 2OYZA 4ASMB 1W6NB 2GNMA 4P9IA 4WV8A 2VUAA 3AKSA 4X8NA 5KXDA 4META 1RL3A 4TZDA 2G9GA 4BH9A 4H7MA 3DN7A 1UF2C 5LEKA 3LIGA 3MI8A 3MLKA 4XOGA 4ZZ5A 3ZPYA 4MXVA 5FZ4A 4ZU5A 3U11A 3I2IA 1KJLA 2ETEA 2VMHA 2WNVC 3VBOC 1W9YA 2IC1A 5A6QA 2H0BA 3QD6A 4PDWB 5C3PA 3NV2A 1LEMA 1ND2C 4D7SA 5CAZA 5E88A 4AZZA 1WUVA 2YC2A 1POQA 1LHVA 1LENA 1QNWA 4CTEA 4Z92B 3GBWA 1RUI1 4W8JA 4LHLA 3ZR6A 1MQTC 4HN1A 3KVAA 2HBTA 3A0NA 3FX3A 3VBUC 5ACA3 3AP9A 2YC0A 2C9AA 1DLLA 3OY8B 2A5ZA 1AHSA 5JR2A 4Q4X1 1GNYA 1BVP1 1B35A 2WNUA 4YZ1A 4JCKA 3T1LA 2EXJA 4MGZE 4XJWA 2ZEYA 1D2SA 1C5IA 1ZBE1 4JGZC 3MW2A 3IDAA 1AVBA 1AXZA 4N43B 1G9DA 4CCNA 4UF0A 4BOWA 4CUGA 4XFGA 3LA3A 4K9SA 3I4IA 5C9AC 1KQRA 4GWIA 3E6DA 3WW1A 5FV3A 4LA3A 2ZOEB 1IS5A 1KS5A 1YI7A 2RR11 5K4LA 2P3IA 4Y1UA 4BWOA 3MFAA 1YQCA 5IAVA 2RJ2A 5A32B 2P2KA 3DKQA 3KCYA 1EPWA 4I01A 4RA0A 2QQPA 4YVSC 4NROA 3ZXFA 3M7AA 4NPLA 4GALA 4JHZA 5A80A 1CIYA 1HXS3 5FXXA 5DAQA 2Y64A 3RYPA 1VP6A 1N1VA 2WLPA 2KA3A 2B8MA 1UPIA 5EQUA 4QWNA 3M3OA 4MGYE 3ZXDA 3DF0A 1PO12 3EJKA 2RMU2 5G04L 1VBA2 1LGBA 4AWDA 3MFCA 3T08A 4K3UA 3PHMA 1FMD2 3J9SA 4OHWA 5A3PA 3C7FA 1H9WA 4WM7B 3ZYPA 1E5RA 5IUQA 1PMIA 4BZ4A 2RV9A 1WLTA 3OPWA 4LO6B 1ULPA 3SXWA 1S4CA 5FYIA 3DXUA 2AEZA 2DCZA 3FHQA 4A3ZA 1OUXA 5C8WA 1FPN2 5D21A 1BK0A 1IG0A 1SQ4A 4OHYA 2VUCA 1J3PA 1H9PA 3C8XA 4YW7A 3SKJE 4LORA 4E4HA 1G6NA 1H1IA 4JTOA 4PQQA 3SH4A 1VMHA 4DINB 2GMPA 4Q4V1 4O61A 4UFJA 2DFBA 3OOXA 3CJXA 4E27A 4QU1A 2FDFA 2ZEZA 3KSCA 4FOWA 1MS0A 3DPRB 2W91A 3ES4A 3TN91 1XE8A 1B09A 4H55A 3VGIA 4CDXA 4D69A 1JW6A 3W5MA 1CR7A 2O8QA 4LK7A 1ZRIA 3KQRA 3M1HA 5FMDA 2G1MA 1MZ6A 5FWEA 4WVWA 1Z78A 2Y33A 3D8CA 3AKQA 1FXZA 2YG0A 1QDCA 1WWYA 3N9MA 4NRMA 4XETA 4GB31 3A4UA 5GLUA 3CJIB 4AGRA 3MGUA 5C33A 1W0OA 4A3XA 1NA1A 4OUMA 1EP0A 3ALQA 4JDMA 4B7EA 3WQ0A 1QF3A 4HOOA 1PK6C 4C1XA 1VB4A 4FTBA 1W03A 4GH4C 5DN2A 5IVCA 3GYDA 2JX9A 4NHKA 3VN4A 3AVRA 4GMP1 2D43A 3LDKA 4XF0A 2WZR3 3FHAA 2OQ7A 4YM0A 2HWE2 2RM22 3Q8AA 1CAUB 2UYAA 3MUY1 4OUEA 5A33B 2ZMLA 2RS13 3HMYA 4GZ9A 2EXHA 2BPA2 2JDYA 2BFUL 4D3WA 2NMOA 5EYYA 1SLAA 4I0AA 4IEXA 5FMOS 1UU6A 2CTVA 4YG6A 2WYSA 3LD8A 1W3VA 5L7OB 5JMOA 2VZ1A 2R1BA 3GXUA 3PIGA 5LK7B 1UPSA 2BVVA 1U5ZA 4UYBA 4QPGA 1TE1B 4LKEA 2JD9A 4Y22A 5HI0A 4C0BA 5FK8A 4LE4A 3UGGA 5L19A 3A0KA 2A6VA 2KD7A 4LBNA 3ZFFA 2VMDA 3BPSA 4KL1A 5DMYA 1COV3 3RDIA 2QQKA 1H6YA 3RMXA 4BQ2A 1RJ8A 1RUJ1 2Y34A 3MW3A 1ZX5A 5FZAA 3GHNA 4QXBA 3T30A 3T0AA 3UKNA 5LWBA 3I3MA 1W8UA 3RJRA 2JB4A 3AYDA 1VBD1 2D98A 3IT8A 1W28A 4YGCA 5F3CA 5JDBA 3QOPA 5FZ1A 4K1ZA 3OTFA 3TRSB 3ZFGB 2YROA 4LIUA 4OHXA 3AMQA 4XF9A 3FUOA 3MW4A 3W21A 1LR5A 3LEGA 2XBO2 1AR73 4BMBA 4COVA 2CAUA 3BN6A 3I8TA 1DU3D 2UWAA 2YBKA 4MV2A 1PHMA 1EAH1 1VBC2 5T52A 2QQLA 2EIGA 3LOBA 1W3XA 4E2QA 4YW3A 4QDQA 3FJSA 2TBVA 1PGL1 2PXJA 2QBXA 1AL0G 1MVQA 2VL4A 1VB2A 1RUE1 3WW3A 2JG8A 1NE4A 5DZEA 1JUIA 4H3WA 2ZXQA 5CYYA 4K40A 5BNNA 5BNPB 1K3IA 1IQAA 2WKKA 4Q4X2 4COUA 1REEA 1IZ3A 5IK5A 2ERFA 1GZCA 3NAPA 4Y4RA 1ZREA 3I3QA 4AEDC 4FT8A 1WKYA 4LNVA 3WNKA 5A3TA 1FV3A 1ZBE2 3O0XA 3O1UA 2RVAA 2DVDA 2P4EA 2QDRA 1ONAA 2WNVB 3VBOB 2RS51 5GLTA 3Q8EA 1C8M3 3I2KA 2BQPA 1ND2B 4GIQA 4NE9A 3RI9A 1UYZA 3ZR5A 4MHUA 3CMGA 2BWCA 5DG2A 2Y0IA 4IE5A 3U1XA 1SLBA 1TG7A 3MF6A 1UX7A 4MYEA 2W0XA 2XQRA 4RFRB 1MQTB 3UJOA 1QJFA 1NXD1 5JSPA 5L36A 4OHZA 1VAMA 4EV0A 2D6PA 1OLMA 4KH9A 4Q4Y2 3AMNA 5EXOA 2E31A 5FZKA 2D6NA 2JJ6A 1HB4A 4FQ4A 4AVCA 5I0UA 4NN0A 3ZDVA 3B9IA 2J1VA 1EY2A 3GZTB 4PLNA 3WVJA 4QM8A 3H8RA 3RZGA 3I2HA 3MZHA 1AYM3 4LBOA 4TLGA 5FO8B 2VZTA 3J8F3 3PJYA 2YY1A 2K46A 5F5CA 1S2EA 3WDUA 1PX3A 4OQ9A 4IV3C 5JIAA 3ZN4A 4JZRA 5CB7A 4E9KA 3O1TA 3RZLA 4Y5TA 2VZPA 3H9AA 1YUDA 3GCXA 2CDPA 5DZFA 2WA4A 3DYOA 1CJDA 1JYCA 3Q9OA 4XYXA 1QJZA 1VPHA 3K4DA 4Y5Z0 3M4FA 3NV3A 1GU3A 5E16A 3TBDA 4CPBD 2WABA 5BY5A 1HLCA 1J3QA 3U07A 4U2AA 1PNGA 5FQ0B 2FDHA 1QU0A 4NIAA 3TNPB 4FPFA 3ZYRA 2VVDA 3THCA 2R49A 4L11A 2RS33 2Y6HA 2MEV3 5LRSA 2A70A 4AQ6A 3B9CA 1YJKA 2E32A 2DVGA 3AJYA 2MNGA 1OD5A 2JDUA 2AC1A 4FQZA 4IETA 4NUBA 5FYTA 3RPQA 3BTAA 2Q8DA 4XHXA 5ACA2 1FOD1 2PHTA 3ZDSA 4XJ8A 5IHRA 1N3OA 1ASJ1 5CA6A 4CPBA 2FDGA 3ZSLA 4YZ2A 2BERA 1SCRA 2D6LX 4GB32 4ZU7A 4OQ8A 2R0FA 4XMAA 1F5JA 1X36A 2LRPA 4HFSA 5L73A 4L2NA 1SEFA 4GULA 3H1WA 1WMDA 1W6QB 4YARA 1GSLA 1MS4A 1POV3 1A78A 2YDEA 1LNSA 1GANA 1QJY1 3L2HA 3OGVA 5L9RA 4A41A 5C7GA 4XXPA 3SCFA 5M0TA 4IEWA 4W4ZA 1PIV1 2NLRA 1QH7A 1UO9A 5CFCA 1R093 2BOIA 5FOBB 2P34A 5K8SA 2EIEA 4K6BA 1GKBA 2VMGA 2WAAA 2CWMA 1EYBA 2AACA 3PNAA 2XGXA 1HN1A 1JOBA 1VRH3 2ZGQA 4HMZA 1HXS2 5EJ3A 4AAPA 3TB0A 4F83A 2VUDA 4E4ZA 1PGSA 2ZCWA 1ZRRA 1RUC1 3RI8A 2CDOA 2VCCA 5I8YA 4PI0A 1C1LA 4FXGB 2WNEA 2HYKA 4KWKA 2D5HA 1P8JA 3ACFA 5FZ0A 1I9RA 1VJ2A 1UD1A 1UQXA 2Z42A 4JC1A 4MH0E 3ES1A 1S0DA 4FFIA 1ACCA 1PK6B 1J3RA 1W6PA 1WCUA 1XXNA 4GH4B 3VBSC 5CFDA 3GZUC 4YW4A 3HNBM 5F6KA 2BOJA 3H0OA 1D4M1 2WC2A 2DCKA 3HNMA 3PUAA 5ABJC 1ST8A 1XE0A 3C7GA 4LR4A 1D0GA 1D7PM 3CU7A 5C3QA 4XVHA 2QQMA 2ZGLA 4U36A 4IEQA 4OCTA 1YJLA 5A1AA 3MO4A 2BU9A 4NJ4A 1EV13 3AMPA 4XBNA 5FBZA 3WXPA 4ES8A 3ZLIA 2R071 4B4PA 1ODNA 5FMOL 5I0TA 2B5HA 1GOHA 2LALA 3BIWE 4O7XA 2F17A 2WWJA 3BTXA 3EMRA 3HOBA 4M3CF 4XHBA 1LGNA 1LECA 2Q1ZB 3POGA 4B1MA 4XC9A 4CVUA 1J1TA 1NCRA 1R64A 4MXWB 5E1RA 5KWRA 3WF0A 4YG3A 4LKDA 5FWJA 1VALA 2V72A 4XILA 2PAKA 3VBFA 3FBYA 2WSUA 4DB5A 2R041 2YPJA 4NHLA 2R30A 2ZPXA 3MIBA 4YGDA 1QIQA 2NYYA 4QGNA 4R9DA 1KJRA 4GD4A 2BNMA 2ARCA 5JOZA 3LCPA 3WDXA 4W6WA 5K7PA 4W6XA 1HRI1 4IW3A 1CZVA 2J1SA 3PMSA 4LO4B 4Q8LA 2ZGRA 1G7YA 1XBFA 3N9NA 3WF2A 3LA7A 1LESA 1GR3A 3PU8A 5FY0A 3VD9A 5LA2A 3CIHA 4DPNA 5FUNA 3T09A 2WZR2 5JSOA 3OSDA 3FC0A 3FZ3A 1C3HA 5CKNA 2RS52 4S2HA 5CIRA 4LLFA 4Q4W1 2A75A 1ZBA3 2WUHA 3HJRA 4HVOA 1RMU1 2RS12 1UYXA 1K12A 1RINA 2UY8A 1QQP3 1YI9A 2E7QA 4P9GA 2EICA 5J96B 5T5OA 4GXLA 1UOBA 2YU2A 1E5IA 3OUJA 1N1SA 3W59A 4B4RA 1ULCA 5FYCA 1NA1C 3I2GA 2PHXA 1X9TA 4YYOA 4F7ZA 4LLOA 3K4ZA 1HV0A 3POFA 5C4WA 3H8XA 2OT7A 3AVSA 3BKZA 4UFLA 5GJ6A 3ZYJB 4AI3A 4UW5A 5EWSA 3RMYA 1COV2 2ZACA 4JHTA 4HVQA 1HQWA 3RZHA 1ODMA 1Q8VA 4NIGA 3ZSJA 1HB3A 3VD5A 1VBE1 1YIPA 2GNDA 1D4VB 5FPLA 3B02A 1CD3G 2BNNA 2O1QA 1NUKA 3HD8B 3OD4A 3U10A 1ZYBA 2LW8A 4OULA 1H2KA 2WLQA 1XYPA 4EYUA 4RR3A 2OS2A 4Q26A 1AR83 3BOWA 2Q8CA 4ARYA 5IK4A 3ZN6B 2VQTA 3FLPA 4A7KA 3PJQA 1W8FA 1Y9GA 2VNOA 3KT1A 2UY9A 5A7NA 1NT0A 1AR72 2XJVA 3A21A 5D8AC 3IM0A 3ACHA 3ZSMA 2BUKA 3ILNA 5J48A 3UGHA 3I49A 4N43C 3T4HB 1RITA 3LSDA 3ZFFC 3SCGA 4AQ2A 1V6KA 5JXHA 3ON7A 3OYWB 1GP6A 3MIGA 2WN3A 2NQYA 3ACGA 2GNTA 2J1EA 4OI0A 1A8MA 1W39A 1YWKA 2VAUA 4AXOA 2XQXA 2J1UA 2H6BA 5EJZB 2DDUA 3ZYIB 1F5FA 4RHV3 4HKOA 2ORXA 1AJOA 1DLCA 4LBMA 4IV3B 1ASJ2 4DIQA 3I54A 5FYZA 1O3TA 1UOFA 1HB2A 3ATGA 5AC93 3VKOA 1XPWA 1LOAA 1XC6A 4N53B 2PQSA 4IUGA 2D7FA 5HCHA 4FOYA 5IYYA 2XL7A 1DDLA 2SLIA 1AX1A 3O5SA 1DGRA 4PQ9A 5GKAC 4LO7A 5IW0A 4Y1YA 5DQ0A 1CAWB 4XJAA 3AKTA 1C8M2 4QT6A 2ZJCA 1D2QA 2GNBA 2R063 4EWAA 5FXVA 3ZMNA 3H50A 4BQ5A 1NOVA 4QX2A 4I3PA 3TEZA 1NKGA 4DEVA 4CDWA 2WRAA 5BNQA 1X50A 3CDZB 4DS0A 1SLLA 4XFIA 5AFBA 1CONA 3HNYM 4I30A 4BQ4A 2AH2A 5FYYA 2BEOA 5DG1A 2WT1A 4CYDA 5FYVA 1MACA 3ENRA 1IQDC 3NAPC 4BIFA 2F6BA 3MUZ1 5GZFA 3P6BA 1ZNPA 1CAVA 1DGLA 4GKXA 1W06A 2DBIA 2XJTA 3LQCA 2WN2A 3ST7A 1G9FA 2W47A 1AYM2 1PO11 5GALA 4XW3A 2VZ3A 1VBA1 2YYOA 4XUPA 4HVRA 4CUBA 1H2NA 1W2UA 2GAUA 3NNJA 4CDQA 4D0QA 3TEYA 1FMD1 4Q0UA 1ULEA 1UXZA 4ASKA 1TVGA 1ZZBA 4COWA 4DXRA 4URAA 4LTAA 2W39A 2GH8A 2ZGOA 4HKLA 3GJBA 2W3JA 1RHI3 1SLIA 5FYSA 4KGQA 3A22A 3AP6A 2RG4A 2R32A 5F3GA 1AR93 3WDYA 4QM9A 1GP5A 1ZRFA 2R072 3E97A 3ECQA 4XQ4A 5FCCA 1B35B 2VU9A 2WNUB 3GM8A 2FD8A 3H8UA 1I5ZA 2RS32 2VZUA 4FPKA 4IGOA 3IIIA 1XNBA 3K75B 1JH5A 4ZU4A 3ZVXA 3LFIA 4XDPA 1W2AX 4E8DA 1O3RA 1E5SA 4YW1A 4C0HA 1NX9A 2XOMA 1JHNA 4R8HA 4K7JA 4UF0B 1R083 3AYAA 5FXZA 4NPRA 2HWC3 2ARBA 3PTRB 3WF4A 3VUOA 3MIDA 1YFUA 2R042 3WNXA 2Q30A 5CBLA 3GZAA 2AYHA 5CISA 5T3NA 1JYVA 1IS4A 4QGMA 4KMQA 3AKRA 3OG2A 4IEPA 4OI2A 1DYPA 4QKBA 3S6PA 3USSA 4E4SA 4TXWA 3CO2A 1WCKA 3H42B 5BYNA 3MV11 3NJXA 3O0VA 4BXFA 5I0DA 3KS7A 4A6OA 4NHYA 4COYA 1F2NA 1YO8A 3KMHA 4LHSA 2A1XA 2A3YA 2ZEXA 3PL0A 3P3NA 1O5LA 4EWDA 4XFHA 4IEZA 4Q0VA 2OZ6A 4UFHA 3ZXEA 1UL9A 1XNCA 3OEAA 1V6JA 3JUUA 3HWJA 1MS9A 1WW6A 1J83A 1R092 3DEMA 3USUA 4AFCA 5FZDA 5LA0A 4SLIA 3WP3A 3OPTA 2PAMA 2UU8A 3BYWA 4PLOA 5FZ7A 1N3QA 4QX1A 3D0JA 4RL7A 3SQOA 4RQPA 3BPZA 2XUEA 1OQDA 2HWE1 4Q29A 5FREA 5FIXA 5FZFA 3VHNA 1W9TA 2RM21 2CV6A 2C9KA 3HT1A 1VRH2 3VBHA 2HWF3 4CCDA 1GOFA 3AP5A 3LDRA 4NO4A 4AL9A 1VBB1 3BB6A 4K1YA 2HYXA 3I3BA 2V4AA 1F9KA 4XAEA 2W92A 4YZ3A 1DZTA 3K48A 2LM3A 1YQ2A 3DKWA 1YFXA 3GCWA 4L0PA 5F39A 2VNGA 4BQ1A 1M06G 3D0SA 4JKMA 2HWB3 2O0OA 3FE5A 4ATFA 4IL7A 1J84A 4QGLA 1V00A 1SG3A 2K2SA 5CFCC 2XJSA 4CU8A 1CPNA 5J09A 1JZ4A 2H0VA 5J3UA 4CDXB 3O14A 5JPMB 1OH3A 5JLVA 1GZTA 1OQEA 4P5YA 2BGCA 5KXEA 1LOGA 3HIFA 3SHRA 4I09A 4DUWA 2A7AA 2VULA 4DRRA 1EV12 5BNPC 4QKNA 3RS6A 1ENRA 2DURA 5CKQA 4ZXEA 3OB8A 1STMA 1S0IA 4NRQA 1JYWA 4XTPA 1IPJA 3RJ2X 3SLIA 4HZFA 2V09A 2HJIA 4QPWA 4A7YA 1A3KA 2ENRA 4Z2AA 1NA1B 4I2OA 5LATA 1WW5A 3OBAA 3DUIA 5KHHA 3B5LB 2XBO1 4FVVA 1XQNA 1ZZCA 2ZMNA 3ETPA 1RUH3 2QQIA 5FY9A 5CFDC 1VBC1 2VH9A 3GJAA 2FCVA 5D2AA 5LBBA 4ET7A 4QX0A 2JDAA 1NCQA 2VZRA 2LROA 5EP9A 4HN0A 4J1WA 2MPFA 3I2DA 3WQ1A 3B93A 3O0WA 1C8NA 4TYSA 5CU1A 2BBVA 2XR4A 3OGRA 1PM7A 3K4AA 4HXCA 3WEZA 1YYNA 5BNOA 1O5UA 5FTTC 4IGQA 4CP1A 1S1AA 4NIIA 4Z07A 2G4IA 3VKNA 5I0RA 3AMMA 3TAYA 3NJVA 5D8AB 4QPGB 1ND3A 2R7EB 3JBG1 4Y22B 1ZBA2 3KV4A 4XJUA 1LTEA 4XUTA 5T5LA 1SDDB 5JVVA 3VDDA 1QQP2 3IPVA 3VBFC 3WCRA 3ILFA 1YQ6A 3ZFFB 3J7MA 4X8PA 4J6GA 3BODA 3NNFA 4AF9A 1WLWA 1QDOA 3IMMA 3LSEA 1SFPA 2N7GA 3J26N 2WS93 3E6CC 1BZWA 1CIWA 1LHNA 1DFQA 1RXFA 4DUVA 5BV6A 5IAXA 3K3NA 1Y43B 3LIHA 5HCBA 4ZHNA 2YV8A 4LBQD 4DRVA 2J1RA 1UZWA 2VUJA 4GJZA 1LOBA 4XABA 4Q4Y1 1I5PA 3V64A 2DF7A 3J7NA 4LHNA 3VHRA 5A3MA 2JIJA 3ZFEA 1AX2A 2DFCA 1UU5A 1Y4WA 4BXSV 2HH9A 4XF4A 3JQWA 4MZUA 4XIOA 1R1A3 2QNKA 1FAYA 3ITQA 4B1LA 4EWEA 1AR82 1OUSA 2CYFA 1OA4A 1U0AA 1WBLA 3VDCA 1Q5OA 4XJZA 2UWBA 2JG8B 3QH6A 4LBQA 2A6ZA 1H8VA 3P5BA 5LK5A 5E6HA 5DDJ3 2W95A 2WZPP 4UAPA 2ZX0A 2ZX1A 5BNNB 1QJX3 1O4ZA 2JG9A 2LS6A 5C4WC 3U37A 1FATA 3MIHA 4R4ZA 1HN0A 3J7HA 2E53A 3WT3A 4QX5A 4AEKA 3M3QA 1PO23 3NAPB 1HRV3 1IS3A 2IVIB 1MS3A 1AF9A 3R4DB 2KR2A 1BCXA 3KM5A 5FP9A 1UYYA 1YLLA 2ZZJA 5E89A 4QX8A 4DO0A 2PN5A 1W9FA 2VE1A 2OQ6A 2LUWA 1SCSA 3ZIXA 1U5IA 3S7EA 1DZQA 3BU7A 4RHV2 4RR3C 5HBAA 1XU1A 3HPNA 3QH7A 4V2VA 4CEWA 4NAOA 5AC92 5ACA1 1VLNA 4CP0A 3IKWA 1US2A 2DYCA 5SV8A 4Y1XA 3SEEA 1JTZX 4YSFA 4IXLA 4KQ7A 2FCTA 3EBRA 3HEIA 3RSJA 4EZ4A 5HCAA 1QMJA 3JB4C 1PMHX 5FZIA 1NE6A 1LHWA 2W1QA 4FI9A 3UGFA 2J1AA 1NYWA 1DCSA 1H1MA 4WM8A 1VMJA 3QBQA 5KHGA 3KF5A 3NW4A 1EPZA 2GC0A 1YFWA 1IPKA 2WO2A 3HAGA 3LE0A 4FP3A 4UBHA 2DVFA 4KWJA 3NVCA 3SITA 5JIUA 3AX4A 4IDZA 4S2FA 1UMHA 3ZMOA 5A3NA 1O91A 2SBAA 1W9WA 2WS91 1BHGA 4XURA 4AGGA 2DWRA 4RFT0 3SKVA 3KWVA 4JGYA 1Q56A 4Y1ZA 1SFYA 4HT1T 4A42A 1N1YA 1VBB2 1NLSA 1LODA 3RZMA 4TTGA 3GBFA 2BNOA 1GQGA 2XXZA 4QB6A 5FZ3A 2VNRA 5C5TA 1HXS1 3N4MA 5FPXA 1DGRN 4S2GA 3R4UA 2ARAA 5FYBA 2F4LA 4YM1A 5GLWA 3VZJA 1UZZA 2DCTA 5B4NA 4LEJA 5DUWA 4XZUG 2VMFA 3T2PA 2W68A 2WNOA 3GHMA 2ZZQA 2HLEA 4QB2A 4IESA 3KGZA 2V73A 1RUF3 4FOVA 1FX5A 4INDA 4DOUA 4CDWC 1LB2A 1DBNA 1RB8G 2HWD3 4NPMA 1UU4A 1A34A 1RIRA 2PA7A 2GU9A 1RHI2 1OURA 1TNFA 3VZMA 5FO7B 1AR92 1SPPA 3OY8A 2VOKA 4LBKA 2ZAAA 4EN7B 5FPZA 1U12A 4CCCA 2WQ4A 2EIBA 4EZHA 1XNAA 5T5PA 1V6IA 2Y0OA 2ZGPA 3G6JB 1WD4A 1AXYA 1UXXX 5JR7B 1JZ2A 2BW8A 4P9XA 4CDQC 4QKFA 3WF3A 4CCLA 4DFSA 3HBZA 1NLQA 3LPFA 5JOYA 1H8TA 1RC6A 2FMYA 4ORFA 5CFCB 1NXMA 5F37A 5KC6A 5D1IA 1XYOA 2C26A 2VXJA 1GNHA 5F7UA 2CGNA 2VR4A 5IWFA 3WP6A 2ET1A 2GC1A 3B01A 4RSUA 4LUMA 2WJSA 3NSTA 3C2UA 5FZOA 4WVVA 5LY2A 1Y3TA 4W50A 2D3RA 2RHPA 4ZY9A 4R9BA 1WW4A 5A7OA 2VBBA 5C70A 2RDQA 5KC5A 2NP0A 3PUQA 1DHKB 3OF1A 1OBNA 4AR2A 3JBG2 3AMHA 2FDKA 2VW1A 1MZ5A 4JAAA 3WNNA 4XE9A 1HB1A 2WZR1 1OKQA 2OZJA 1X33A 4XUOA 2WAOA 3IWZA 1W6PB 2CWSA 5F1RA 3IMNA 2G9FA 4XUQA 3H3LA 3POYA 2ZGUA 1F35A 2HWF2 2RS11 5CFDB 1BBT3 3JD73 3EYPA 4H2AA 3ZYFA 2HEYF 2BBAA 2JE9A 1QWRA 1WBFA 4KU7A 4MLOA 5F2SA 1CGPA 1O6UA 2JDKA 2E7TA 5H9QA 2W08A 1QJU3 2IXCA 2UYBA 1AJKA 5IT6A 4NMIA 2R1DA 5KHJA 4YGEA 2IUWA 3OCPA 2HWB2 3Q8CA 1WCDJ 2HEVF 3VKLA 1OI6A 5FFOC 5FXWA 1OLQA 3LFMA 1K5MA 1JU4A 1JOPA 3OPZA 5JWPA 2VTFA 3OD0A 3OEBA 4MO3M 3V56A 1COV1 3V0AA 4BU2A 1RUG3 1VE0A 2XLGA 3F95A 4RQPC 3KLSA 4X6RB 3LOIA 4XXAA 3PUHA 1YFYA 3J7LA 4QDSA 4XCBA 2EIDA 3VBHC 1QOSA 3VBFB 4BIOA 1UY0A 4YM3A 4Z1VA 3THTA 2AEYA 1F4HA 2W1UA 2JDHA 4FO9A 3FUQA 5JAXA 4N53C 2QQUA 1CAXA 4AVSA 2X05A 3WUCA 1URXA 5H9SA 5FUIA 1RTVA 4AVAA 3Q8FA 5FZ6A 3WOGA 1W2TA 3T0DA 3BVCA 2QJVA 2QTWB 1NQJA 1AR71 1S55A 2XJQA 5LBCA 1CWPA 4MGIE 4RGKA 4IERA 4ITCA 1RUH2 3E5UA 1N47A 3ABZA 4XF1A 4FPGA 3DYMA 3LEMA 4XMIA 1NQDA 3N35A 2VY0A 1CAUA 2ZGTA 3MV01 3PVBB 2ZTNA 2GSYA 3WNOA 1Z7S3 3UK9A 3CQOA 4ISQA 1UIKA 4CXWA 2WFF3 3L2YA 3OGGA 4O65A 1PM4A 2GP3A 3KV9A 3T4VA 1W2OA 2IXKA 5FJHA 4AI8A 2XJUA 4P5HA 3NV4A 4FFHA 3N3HA 3BTZA 5GZCA 1SHWB 4D6QA 1MR5A 3H3UA 1GWMA 1TNRA 3DGTA 3NRUA 5C4WB 4M01A 3V65A 3VZNA 4FTSA 4XFCA 2B45X 2P6CA 3THDA 5DAXA 3I59B 3R4SA 1RUD3 2JENA 1C8M1 1YIFA 3GALA 1NCQC 2YGMA 2VO5A 2BP6A 5T50A 4WBBA 2WS92 3T1MA 5ANNA 3W20A 1DF0A 2Y6JA 4FAHA 3AYEA 1W90A 3PVOA 3ZYHA 2PQQA 2NZ9A 2C24A 5FAXA 5HXVA 1XOYA 4K8RB 4RR3B 1GOGA 1BVVA 4YPJA 5BNOC 1OHFA 1NG0A 1LAJA 3IIAA 5LASA 1B35C 2WNUC 4XUNA 3PURA 2VGDA 1ND3C 4QX3A 3O1MA 1Q8PA 3VDBA 1I1EA 1AR63 4N9IA 5FLHA 5FP8A 1R1A2 1UY2A 3AC0A 3LZZA 1OPMA 2CGOA 4Q0QA 1AYM1 5A7QA 4DXSA 2I74A 5FR3A 1GP4A 1UIJA 3J8F1 3LKJA 2W5FA 1LCLA 4OZXA 1W0NA 5TSWA 3AP7A 2B7YA 3WG4A 2P3KA 1F31A 2IZWA 3UNPA 4DQAA 4FSJA 1A8DA 4Y26A 3RVHA 4CEYA 3VL8A 2WL1A 5DDJ2 1DQ0A 2DTWA 4LO5B 4XDQA 1BKZA 2VC9A 1SLCA 1JN2P 2DCYA 3OGSA 3GGLA 3SNMA 3VL9A 3O1SA 5C8CA 1W8ZA 3NNGA 1RVF3 1TME3 4Z2WA 1HRV2 3DECA 4HANA 4LITA 4RGGA 1QH6A 1O8PA 3T0BA 3ZFEC 1QXJA 2ATFA 4IEUA 1H30A 1AYN3 3VBOA 2RS31 2MEV1 4SBVA 4NWVA 1JZ5A 3BCWA 1OFNA 3ELNA 5JXJA 4ZKTB 1UMZA 1QXRA 1Z0HA 3AJZA 5KXCA 1GICA 1OXCA 2R6QA 3JXSA 2D3PA 4MOAA 1GLHA 3NWKA 5DABA 5H9RA 2C0ZA 4CDWB 4GQ7A 3HT2A 3MPBA 1V9U3 2OKXA 1LEDA 5J37A 2JG9C 3VBUA 2XKOA 2RDSA 1X82A 4FPCA 3BUCA 2ZGNA 3AM2A 3H7YA 4YW2A 2GALA 2QQWA 5A3WA 1R1ZA 1UY3A 1POV1 1CAVB 5EHDA 1H4HA 2PAEA 2VOTA 1VMFA 4JRAA 3ACIA 4QB1A 1OSGA 1TZOA 2G19A 1JYIA 4AI1A 1BEV3 3GBGA 3I2FA 4JGZA 4RGAA 4Y4YA 3POIA 2Q1FA 1R091 2PHDA 4FP2A 4CDXC 4AVBA 1MS1A 1MPXA 2Q8OA 4IV1A 3WY6A 1LU1A 1NLRA 1QXPA 5FBJA 4CDQB 2EALA 1Q3EA 2VMEA 3WLUA 2VW2A 2PTMA 3HN3A 2L9LA 2XONA 4QQHA 3ZO0B 5C9AA 1Y9QA 2A71A 2D6OX 2V5YA 2YB7A 1VRH1 3CHXA 4DXTA 2ZHNA 2PLV3 2MHFA 4DXZA 2JEMA 2UURA 4YVSA 2WDBA 4NWWA 1CQ9A 2AGSA 3QLQA 4LA2A 2IXLA 4UI9L 1QHDA 2VZSA 4WM8C 2X09A 1CN1A 4RN5A 2XLFA 1LOFA 4KGGA 4MG2A 1KFUL 4C90A 5CKMA 3HQUA 1RUF2 2VD7A 1DYKA 4YVWA 3GZEA 1WCQA 2HWD2 3EO6A 1G9BA 2E7AA 5J7MA 2ZS6B 1PVC3 2WR9A 2JKBA 4HPKA 1MS8A 3NV1A 4NOTA 2Q1MA 1Q43A 3JCIA 3ZKUA 4ATEA 3M3EA 1SFNA 2DV9A 4AFDA 4LOSA 4WVMA 2BDRA 4DUXA 5CADA 5FDBA 2P17A 2B42B 2QQOA 3OGJA 4TLFA 1VIWB 3INAA 1ZA4A 1ZA7A 2VECA 2GC3A 3T2TA 3VDAA 1EV11 1DQ6A 5LCWL 1F8VA 3AXEA 1JOJA 1AL23 1QNYA 4YRDA 2B9UA 2Z69A 3IZOA 4QPGC 5FLJA 3O1RA 1M4WA 2IVJA 2QDNA 3N7KA 4XQDA 4UT5A 2WYFA 3GNEA 5T5JA 4QHBA 5IVJA 1MS5A 2QZ3A 2Y6LA 4XAAA 2Y6KA 1BJQA 3USUB 2ZGMA 2ES3A 2RMU3 3PIJA 3SEPA 3RWNA 1X7NA 4CUCA 5F3IA 2VMCA 1OH4A 4R4XA 1AZDA 4RQPB 5A7WA 4AHZA 2JIGA 4GWNA 4CP9A 1KITA 3ZXJA 3WG3A 4MUVA 3VBHB 1OT5A 3IAPA 5F5AA 2XWBB 5A7PA 2CNAA 1V0AA 5EPAA 4K8FA 2P37A 2W46A 2NM1A 5FP7A 4CCEA 5JZGA 4P9JA 3CZUA 3HQRA 4XQWA 4Z8BA 1WA4A 4XIKA 4AG4A 4QHZA 2Z5WA 3VKMA 4ZZ8A 1BEV1 2XB6C 1OA2A 4IE4A 5DUXA 5AFEA 2WO3A 4M00A 2GN7A 1H8TC 2WWSA 3P3PA 1ZBA1 2YPDA 1TMF3 2ILMA 3SISA 5I8TA 3JD72 5I8SA 1QQP1 4QPIA 1DGWA 2QQJA 2C1FA 4HSJA 3H1MA 3NQHA 4KWUA 4YNIA 2JKXA 5FRAA 4UXAA 3BIEA 2JG8C 4QD2A 1UAIA 2BYVE 3FLRA 2QFEA 3N7JA 5BNNC 3LPGA 3N7LA 2PHFA 3N9PA 5A1FA 2YMZA 5JCTA 2DU0A 4JX0A 4ARXA 5FYMA 4UBGA 4FPHA 1LOCA 4UW3A 3PVEA 3WZ1A 4M0NA 4M3CA 4JQRA 5IJRA 3SC7X 3R05A 4NHMA 2FZ1A 1LHUA 4BDVB 2OPWA 1QGLA 3E5XA 4UW4A 3FHIB 3KF3A 4V1PA 1KFXL 5GM0A 1RUG2 4UFIA 1GZWA 1VAVA 5A3LA 3VHOA 2QZ2A 2XJRA 2VZOA 3J8F2 3UKVA 3WDVA 2BGOA 4LT5A 5FZEA 3NMBA 1HQNA 4O9EA 4E2GA 1NCQB 1XYNA 3MLJA 2OA2A 2E51A 2VQ0A 1AR81 1AXKA 3H7JA 4IE0A 5APAA 5FKBA 1JZ7A 4UFKA 1DG6A 2ZA9A 3LEKA 4CUAA 1DQ4A 2O14A 1E5HA 1PGW2 5BNOB 4FPLA 3J4UH 4QAWA 1S0CA 3WINE 3AZXA 2XHNA 3AB0A 4N7UA 5ANQA 4IEOA 3DV8A 2X29A 4A45A 1JYTA 1ND3B 2MEV2 4CU6A 1JZ3A 1OOPA 3QCWA 4BE3A 1V6MA 1YC61 4AVTA 4AVVA 1H1AA 4GA9A 3VZKA 1CZTA 2W1WA 3WHTA 4PJYA 3VDDB 1XSQA 3IPVB 2XG3A 1Z7S2 3URFA 4EN9B 1FI2A 2W52A 1K42A 4G4FA 4LHKA 3EHKA 5A7SA 2WFF2 2P5BA 4TWTA 2XPJA 4RHV1 3RYRA 2O8OA 5CNAA 3HVDA 2BV4A 5FY7A 2D6MA 1ZRCA 2OIIA 3POEA 2VBPA 1T6BX 5AC91 2PFWA 1GYKA 5JMCA 4UWDA 1ZVFA 1BLZA 1C57A 1UNBA 2I2SA 3O12A 5FYUA 3AXDA 1RGSA 4JKLA 5DUVA 3VZLA 3IDEA 2PMWB 3NNLA 2XWJB 1RUD2 4AEDA 1ZZ8A 3VD7A 3WQ7A 1T2XA 3L9JT 1CX1A 3ZFEB 4CCMA 2R061 4YGBA 4KG0A 4OFGA 2WO1A 3PVNA 2CSGA 2OXBA 4Y3OA 3U4XA 4KI5M 5FMCA 4HETA 2HKXA 1RUI3 4JVAA 5FUPA 2R16A 3C3VA 5EV7A 3BGAA 4AHYA 3SMHA 3ZSKA 2QKDA 1WW7A 4LBQB 3KB5A 2Z2SB 5JXGA 4CZSA 3V0BA 2JG9B 3FWEA 2BJSA 3KT7A 4Q4X3 3ILRA 4CXYA 1VRBA 4OVEA 1XNKA 5AVPA 4CU9A 1AR62 4FTEA 4XFBA 3RQ0A 1S2BA 1J58A 4X6QB 3HQXA 2JWPA 2D44A 5GZDA 5IVBA 1IG3A 4OMCA 4AYUA 2WQ8A 1LRHA 4YFWA 2VZQA 3M3CA 2F4PA 4JDOA 3VB9A 4LXLA 3NJYA 4PF1A 4Y20A 5HCFA 1GWLA 4CEWB 2K0GA 2RR13 4LUKA 1WMFA 1RHI1 1TME2 3KV5A 5C3RA 5FZMA 4ZXKA 2XDVA 4AFBA 1AR91 1ALYA 4P00B 3W5NA 1KRIA 1XE7A 1OC1A 4B3NA 3VBRA 2GMMA 4NVPA 2D97A 2TNFA 5KBFA 1AYN2 1Q8OA 2ZGSA 4HONA 2RDRA 4IE6A 4AI2A 2A3XA 2AREA 4GAZA 1W6MA 4PCRA 2ZHLA 2YBSA 2JDNA 3N9OA 2PHUA 5KR7A 4WM8B 2D3SA 3MPPG 4YZ4A 5E8AA 3BI3A 2EAKA 4RS5A 1R081 1H6XA 1DIWA 2HWC1 1ULGA 2IWGB 4EN6B 2OX0A 3DCQA 3F2ZA 4CEYC 2QCSB 3ACLA 5HPOA 2VMIA 4CXXA 3D4KA 1V9U2 2E63A 3KCXA 4FPOB 3PU3A 3AFGA 4HSLA 2DUOA 4JGYB 1FNZA 1NAEA 3AZVA 4N90A 5C8CC 2IXHA 5LBFA 3GDBA 3O1VA 3THPA 1ENXA 3B3QE 1DGWX 3IN9A 4UOJA 2R0HA 1BEV2 1Q8SA 1SBDA 5EJ1B 2FCUA 4JTNA 4Q4V3 1S0FA 3WW4A 2GDFA 5I0SA 5LZ6A 1JODA 1MEC3 1X8EA 1NCRC 2JDMA 3WNMA 3BTYA 2VBDA 2ZGKA 4GWJA 4HK8A 4ZS2A 5B4XA 3TN93 1XRUA 4B7KA 2C5DA 2HWF1 5I93A 1XNDA 2PLV2 4CE8A 2NPIA 4PHZA 1SPPB 3AFKA 1G8WA 1JI6A 2YUEA 4PI2A 2Z4FA 2AENA 4DMIA 5A1LA 5A70A 1OPOA 5K9YA 3IDCB 2GC2A 4GB33 4YG0A 1Y9MA 4C91A 1IKQA 1RYYA 1OFSA 2HWB1 3CKHA 4BISA 2VOVA 4O9GA 2E26A 2NMNA 3MICA 4IE7A 4LJHA 1GNZA 4BQWA 4D6SA 1LULA 1PVC2 4IV1C 4HLTA 1PNFA 4GKYA 2CHHA 2Y26A 2OUJA 4QXHA 4GMP3 4XZPA 3VD4A 2QUOA 1H8TB 4XPVA 2PYTA 4WZCA 2VXRA 3VBSA 4N7IA 2WSVA 3RZJA 3PDQA 5ABJA 3FBMA 4QDRA 1FNYA 1AL22 3MLLA 1SBFA 1JU3A 5FZOB 1G9AA 1JUHA 5LEJA 1TEIA 2GMEA 1ZZ6A 2FBEA 4YLZA 5K0UA 1LOFC 4YFZA 4L9BA 4BLJA 1SBEA 1US3A 1V6OA 2WINB 2D93A 4IQPA 4A44A 4K21A 5IATA 1ZZ9A 4YVWC 4R9CA 5F6LB 4AFAA 1RUH1 2I45A 1XSRA 3FFZA 3TEXA 5AVAA 3S0MA 2DUQA 2Q4SA 4QHOA 1IS6A 5G05L 4ES9A 3S5AA 1ENSA 2QQNA 1OD3A 2J42A 2X5IA 2FHRA 4NHXA 1RUJ3 5BPXA 4MVTA 3RFRA 4BQYA 4NR1A 2YHJA 1QKQA 1W6OA 2QQVA 4IEVA 5JI7A 2JICA 4FPYA 4QX7A 3IB3A 1VBD3 3B69A 3LEIA 2GP5A 3VHPA 2TUNA 1C28A 4ZS3A 4CDUA 4AEJA 4YZ5A 1NZCA 3SH3A 3T3YA 1V6LA 1MEC1 1W8WA 2EAAA 4LO8A 1TMF2 2R062 5FJKA 3E5QA 4OLLA 1K5MB 1HJGA 5F8PA 5FZ9A 4D7YA 3V0AB 3ZYBA 4P9YA 1EAH3 4H14A 1AUYA 3APBA 1NZIA 2WA3A 5IVFA 4J1XA 2VCAA 4Y24A 1W6NA 1YXWA 5IVEA 3OBRA 3PUSA 1ZM1A 2YGLA 2NN8A 3AL5A 4B4QA 1W9SA 3LB9A 3ME2A 1RUE3 2J1TA 3T2QA 5C71A 5JZGC 2W9XA 4MGQA 1C1FA 4P14A 2WIIB 3MEPA 3CBNA 1CAXB 3B00A 1KDKA 3ZM8A 3VV1A 3N9QA 1W99A 5JPNB 4FXKB 4HKWA 3UL2A 4QU2A 3ZPOA 2PHWA 3D5OA 4PDWA 5LB6A 2DCJA 2LTNA 1REDA 5DAWA 1O4TA 2XH6A 2XUMA 1BQPA 4MX3A 3KT4A 4OHVA 1R1A1 4QPIC 1G9CA 5FY8A 2RS53 1OF4A 1HKDA 4LPLA 4XACA 4BM8A 2E33A 3TYJA 1KGYA 5IK7A 1OLME 3LWCA 4P9LA 1KDMA 3S7IA 5DDJ1 3PLQA 4QPYA 1QJX1 4HG6B 2J22A 5FY1A 5CG9A 2RJKA 3UETA 5KHKA 4A7ZA 1PO21 1HRV1 3W58A 5D8AA 1LKNA 2YBPA 2Y60A 3AZYA 4N43A 2A6YA 2IFWA 4HK9A 1CZSA 1KEXA 4L99A 1R082 4NAMA 3CLPA 5DAVA 1VAKA 1K45A 3ZOIA 2HWC2 2XJPA 4BQXA 4M0HA 1PZ8A 3K3OA 1LHOA 4K20A 4XF3A 3ZXLA 4AQSA 2ZKNA 4PBPA 2HBUA 2Y8KA 3K51A 2P3JA 4LBJA 2VG9A 2WT2A 5F2WA 5FY4A 5A32A 4F8AA 4NIHA 1O3QA 4BLIA 4L92A 4F3JA 2Y6FA 2YFUA 1WGPA 2W1SA 2ZKLA 1BMV1 4H7LA 3M2MA 4E2SA 3O7OA 5L9BA 3UV9A 4FBFA 4D94A 1SLTA 4RD7A 2GZWA 3POSA 5A3OA 1PZ7A 4D7TA 4N9HA 1OOPC 3WF1A 5CG8A 3D3AA 5ISLA 2J7MA 2DBNA 2P6HA 1GUIA 5JOXA 5GLVA 2FDJA 3UKTA 3WD5A 4E8CA 2XKPA 4WM7A 2QE3A 3PMEA 5EIYB 1ENQA 1RUI2 5FO9B 1QEXA 1WMEA 2W2IA 4Q1PA 5DZGA 2XHKA 4M4PA 2ZABA 2X8KA 4CEYB 3FLTA 4BK5A 1Y7BA 1VR3A 1FOD3 4LBLA 1W8TA 1HIXA 2B46X 3ZYGA 1ASJ3 5C8CB 5FLIA 2FMDA 2OUHA 4A4AA 1OF3A 1ULFA 1HDKA 3C7EA 3IAQA 1HJFA 4YWAA 2VPVA 3ZN5A 5A6ZA 5FYHA 1WCSA 2JDPA 4XEZA 3R6SA 1POV0 1QJY3 3JU9A 2TEPA 3BALA 4LK6A 1RUF1 2D5FA 3DPRA 4FAGA 1G86A 1PIV3 2UWCA 4Q8KA 2HWD1 5C3OA 1NCRB 3NO8A 1WLCA 2PHRA 1UZYA 4EROA 2RR12 2B4KA 3EXUA 1RUNA 4CU7A 4HBNA 3CEWA 2ZEWA 4BB3A 1UMIA 2JE7A 4AI9A 4QXCA 1O59A 3VBUB 2X10A 1RUOA 2OVUA 3CJIA 3I7DA 4I0BA 4XCAA 3RGBA 4A2UA 5FPBA 1RUC3 2EXIA 3R0RA 4MSVA 4C8DA 5JUVA 1MZEA 2OPKA 2XVGA 3N7MA 3VKFC 4ZONA 4JRLA 2WBKA 2PELA 4BK4A 5F3EA 1PZ9A 1SDWA 3A23A 1RXGA 1U5XA 3N36A 1QOTA 4JGZB 4QMAA 3LAGA 4AGVA 2BVBA 3TOJA 3WUDA 1HX6A 3U78A 4IV1B 4XDOA 3FFQA 5IFPA 5SV5A 4LE3A 2DUPA 3JZVA 5A33A 5C9AB 2EXKA 4QQ2A 3AP4A 2WQZC 1D4M3 5JSRA 1UZ0A 3M8LA 1LOEA 3WNPA 5FOJB 1HQLA 1UW8A 3VBRC 2XVKA 3UJQA 4M4RA 4Q1RA 2VW0A 4ZPIA 5L7OA 4YVSB 2CL2A 4URTA 3KVBA 5C3SA 2ADDA 3AL6A 4CA9A 2YU1A 3IDBB 1W05A 1W8HA 2R073 4PLMA 4Q4V2 1ZZ7A 3NKGA 1DZRA 1I6XA 1MEC2 3AZZA 3KHCA 3GF6A 5LBEA 1O3SA 4RS5C 3WNLA 1MVEA 1DYOA 4DY5A 3SH5A 4NIDA 2VCBA 3ZXAC 3W9AA 3TN92 1BXHA 4YVWB 5ERLA 5FP3A 4P08A 1H2LA 1GBGA 2ADEA 5F5IA 1WD3A 3UT0A 4KNCA 4HPKB 4LQRA 1BBT1 4Q0PA 5FPUA 3JD71 2VQUA 3CNAA 3NNMA 4V2WA 2W94A 2Z79A 2R043 1ULDA 3K46A 4WVMB 1QJU1 5KHIA 1GMMA 3FMGA 5CVRA 2C6SA 4XFFA 3ZFGA 5F9TA 3D82A 4S2DA 4XJ9A 4CSWA 2YC4A 4MGTA 1HRI3 3KQ4B 3POJA 5C6CA 4C1WA 1T6GC 1L3JA 5DUUA 3NKTA 3WG2A 5HV4A 1ULOA 2VQAA 2VTXJ 4AI0A 5T54A 1W8NA 3MIFA 5A6XA 1RUG1 2GH2A 3VDDC 1X9PA 4TSVA 2CU5A 4Q4W3 2Q8EA 4DEQA 2VCMA 1CX4A 4Q27A 3I2JA 1EUUA 1GQPA 5LA9A 1RMU3 1W0PA 5A7WB 4PIXA 3BOPA 5B2GB 1XNTA 2E9QA 2Q5TA 3M3IA 2WT0A 1PVXA 4CP9B 2X53S 3U0ZA 1AX0A 2ZX3A 1UKRA 1QJX2 5KXBA 4EJRA 5BNPA 5F32A 4LIVA 1PMJX 2PHLA 5JZGB 5GZEA 5HV0A 1PO22 1PGW1 2RE9A 1GZ9A 1UY1A 4FPEA 1QJEA 2KM2A 4I0WB 4KWLA 1C5HA 2C4XA 1O7FA 5GLZA 3VZOA 4Z82A 1OA3A 2WNVA 1LGCA 1EUTA 2XLAA 4FFFA 3JQXA 3OUHA 3WP4A 2Y6GA 4AHXA 2VVEA 4KBBA 4B29A 1N1TA 1ND2A 1RUJ2 1VBE3 5FP4A 4G3YC 5A3UA 4QPIB 2JB8A 1Z7S1 5H9PA 2A3WA 3AZWA 2WFF1 4KU8A 1VBD2 1OMIA 5FZCA 2AUYA 4XFAA 4PT6A 1MQTA 2DVBA 5K0UC
chains in the Genus database with same CATH topology
1JXNA 4BYYA 3NJZA 1CVNA 2JDZA 1BMV2 4XBLA 2OW4A 3S30A 3WR0A 4M3CB 3ETQA 3KGLA 5EYXA 1EAH2 1RUD1 2VVFA 2JXAA 1MZFA 1SACA 2JD4A 1GZWB 4JDNA 3KCCA 2X5IC 1PGL2 4PIYA 1GQHA 4W6YA 1LJ7A 2CGPA 3TNQA 4CEWC 1CJPA 1RUE2 4I3GA 5IK8A 5DXDA 2E6VA 1IGOA 1IKPA 1RJ7A 2YZ4A 5J36A 4CDUC 3RZZA 1JBCA 3AKPA 2DU1A 2VOXA 2QVSB 2ZAHA 3RRDA 3X29B 2EA7A 5FQ0A 4AHWA 3E6BA 1AR61 1OOPB 4B8EA 4AEMA 3OJBA 1J59A 1H0BA 4PIZA 4OI4A 1BYHA 1UKGA 4JGYC 1APNA 1UN1A 4UW6A 2I07B 4DZGA 4M3CE 3D6EA 2ZX4A 4KG8A 3NL1A 2BTVC 2ET7A 1RVF1 1TME1 3POWA 3EQEA 4QXKA 2D6KA 2JECA 4PDWC 1W6QA 1AYN1 4WVZA 2FZ2A 4XBQA 1OLRA 1QOOA 2B39A 4AEDB 3I59A 5GZGA 3ZSEA 1X8MA 1H2MA 1NY71 4ONUA 4YW5A 4FPJA 2A73B 1PO13 4QQLA 4BMEA 1VBA3 4ASLA 3WDTA 4COZA 1CPMA 1H4GA 1FMD3 4I02A 2KXLA 1U5YA 4MGKE 4R9AA 1V9U1 4EN0A 3H3ZA 4LULA 2XVLA 2AR6A 4Q2FA 2YXSA 1DQ5A 3RNSA 3V0BB 2ZHMA 1KD7A 1FPN3 4WZFA 2GN3A 1TQ5A 5EFUA 2ARXA 2A6WA 3WDWA 1PK6A 1C4RA 4GH4A 3B7MA 3RG0A 1BBT2 2VOWA 4OUSA 1XU2A 4L97A 1FOD2 3OBTA 5BUVA 4DNYA 4Y20B 1QJU2 2ZHKA 4ISRA 2PLV1 4Y1VA 1FYUA 2XL9A 3AYCA 4FCAA 4IEYA 4Q0SA 1Q8QA 3KD4A 1ZRDA 3MYXA 3HR9A 3VBRB 3ROUA 4P9WA 4EN8B 4FOQA 3VLBB 3WP5A 1QJY2 1W6MB 1PIV2 4PBOA 4WM7C 4RS5B 1PVC1 4MXWA 4R52A 4W65A 1OQ1A 5J98B 2FQPA 4E4DX 2HWE3 2CY6A 2RM23 1V70A 4BCUA 3TWIA 2DTYA 1CESA 1AL21 1DQ1A 1HW5A 1VBB3 2CAVA 2RJLA 1RUC2 1A6CA 2Y38A 1QY4A 3G7DA 4GWMA 4AW7A 1GV9A 4BPZA 3JB8A 4DY3A 1WLDA 4CP2A 1S0BA 2AZ5A 4G9SB 4JV4A 4PF5A 5EZWA 2IFRA 1K5MC 3CF6E 3WHUA 3HN1A 1GFF2 3DPRC 2RMU1 1YNAA 3WV6A 1D4M2 1O4YA 1E57A 2ZMKA 4AE2A 1N3PA 1BK1A 1I3HA 2WFPA 1FT9A 3LGRA 3DL3A 3CJIC 3WG1A 4QQOA 4AFMA 1FPN1 3MIEA 3H1YA 2DVAA 1S2KA 4CRQA 5JOWA 2EVXA 1IHMA 3KZ4C 5F5QA 1TMF1 2XBO3 3QACA 4BHPA 2BWAA 4AQTA 1REFA 1YHFA 4AK3A 1UX6A 2BFUS 1VBC3 3MF9A 3M70A 3VBSB 3WCSA 1LU2A 5ABJB 5L7OC 3ZN6A 1HRI2 4YM2A 1IOAA 1UCXA 5K0UB 4HL0A 1S0GA 2EF6A 3RYKA 1KXGA 3WX5A 3AK0A 2ZX2A 3OYWA 4Q4W2 1S0EA 1J1LA 1ZBE3 3JBG3 3ZX7A 3ASIA 4BA6A 5JI9A 3B94A 1RMU2 1HV1A 1V6NA 1FV2A 2K9ZA 3WW2A 3MDPA 3ZXKA 5I91A 3LA2A 2D40A 2X5IB 3CL1A 4QQPA 1D0HA 2Q0AA 3SCHA 2A6XA 1W6OB 4IV3A 3ZFGC 1RVF2 5T55A 4N53A 1YCIA 4L8QA 4CDUB 1SMVA 1DQ2A 4XTMA 5BXXA 2ZBJA 4OI1A 2H6CA 1YRZA 1KS4A 4Q4Y3 1CAWA 3PTYA 3ZIWA 2IXJA 3ZXGA 5LRRA 1NY72 1S0JA 1VBE2 2IXIA 2HEWF 3IBMA 4GMP0 4ASMB 2OYZA 1W6NB 2GNMA 4P9IA 4WV8A 2VUAA 3AKSA 4X8NA 5KXDA 4META 1RL3A 4TZDA 2G9GA 4BH9A 4H7MA 3DN7A 1UF2C 5LEKA 3MI8A 3MLKA 4XOGA 3ZPYA 4MXVA 4ZU5A 3U11A 1KJLA 2ETEA 2VMHA 2WNVC 3VBOC 2IC1A 2H0BA 3QD6A 4PDWB 3NV2A 1LEMA 1ND2C 4D7SA 5CAZA 5E88A 1WUVA 1LHVA 1LENA 1QNWA 4CTEA 4Z92B 3GBWA 1RUI1 4LHLA 1MQTC 4HN1A 3A0NA 3FX3A 3VBUC 5ACA3 3AP9A 2YC0A 2C9AA 1DLLA 3OY8B 2A5ZA 1AHSA 4Q4X1 1BVP1 1B35A 2WNUA 4YZ1A 4JCKA 3T1LA 2EXJA 4MGZE 4XJWA 1D2SA 1C5IA 1ZBE1 4JGZC 3MW2A 1AVBA 1AXZA 4N43B 1G9DA 4BOWA 4XFGA 3LA3A 4K9SA 3I4IA 5C9AC 1KQRA 3E6DA 3WW1A 4LA3A 2ZOEB 1IS5A 1KS5A 1YI7A 2RR11 4BWOA 2P3IA 4Y1UA 3MFAA 5A32B 2P2KA 3KCYA 1EPWA 4I01A 4RA0A 2QQPA 4YVSC 3ZXFA 3M7AA 4GALA 1HXS3 3RYPA 1VP6A 1N1VA 2WLPA 2KA3A 2B8MA 1UPIA 3M3OA 4MGYE 3ZXDA 3DF0A 1PO12 3EJKA 2RMU2 1VBA2 1LGBA 4AWDA 3MFCA 4K3UA 3PHMA 1FMD2 3J9SA 4OHWA 1H9WA 4WM7B 3ZYPA 5IUQA 4BZ4A 1PMIA 1WLTA 4LO6B 3SXWA 2DCZA 5C8WA 1FPN2 4OHYA 1SQ4A 1J3PA 1H9PA 1G6NA 1H1IA 4JTOA 3SH4A 4DINB 2GMPA 4Q4V1 2DFBA 3CJXA 4E27A 3KSCA 4FOWA 1MS0A 3DPRB 3ES4A 3TN91 4CDXA 1XE8A 1B09A 4H55A 3VGIA 4D69A 1JW6A 1CR7A 2O8QA 3M1HA 3KQRA 1MZ6A 4WVWA 1Z78A 3D8CA 3AKQA 1FXZA 1QDCA 4XETA 4GB31 3A4UA 5GLUA 3CJIB 4AGRA 3MGUA 5C33A 1W0OA 4A3XA 1NA1A 4OUMA 1EP0A 3ALQA 4JDMA 4B7EA 3WQ0A 1QF3A 1PK6C 4C1XA 1VB4A 4FTBA 4GH4C 3GYDA 2JX9A 4NHKA 3VN4A 4GMP1 2D43A 4XF0A 2WZR3 4YM0A 2HWE2 2RM22 1CAUB 2UYAA 5A33B 2ZMLA 2RS13 3HMYA 2EXHA 2BPA2 2BFUL 4D3WA 2NMOA 5EYYA 1SLAA 4I0AA 4IEXA 5FMOS 1UU6A 2CTVA 4YG6A 5L7OB 2R1BA 5LK7B 1UPSA 2BVVA 1U5ZA 4QPGA 1TE1B 4Y22A 5HI0A 4C0BA 4LE4A 5L19A 3A0KA 2A6VA 4LBNA 3ZFFA 4KL1A 1COV3 3RDIA 3RMXA 1RJ8A 1RUJ1 3MW3A 1ZX5A 3UKNA 3GHNA 3RJRA 3AYDA 1VBD1 2D98A 3IT8A 4YGCA 5JDBA 3QOPA 4K1ZA 3OTFA 3TRSB 3ZFGB 2YROA 4OHXA 3AMQA 4XF9A 3FUOA 3MW4A 1LR5A 2XBO2 1AR73 4BMBA 4COVA 2CAUA 3I8TA 1DU3D 2UWAA 4MV2A 1PHMA 1EAH1 1VBC2 5T52A 2EIGA 3LOBA 4E2QA 4YW3A 3FJSA 2TBVA 1PGL1 1AL0G 1MVQA 1VB2A 1RUE1 3WW3A 2JG8A 1NE4A 5DZEA 1JUIA 4H3WA 4K40A 5BNNA 5BNPB 1IQAA 2WKKA 4Q4X2 4COUA 1REEA 1IZ3A 5IK5A 2ERFA 1GZCA 3NAPA 1ZREA 4AEDC 4FT8A 4LNVA 1FV3A 1ZBE2 3O0XA 2DVDA 2QDRA 1ONAA 2WNVB 3VBOB 2RS51 5GLTA 1C8M3 2BQPA 1ND2B 4GIQA 3RI9A 5DG2A 2BWCA 2Y0IA 1SLBA 3MF6A 4MYEA 2W0XA 1MQTB 3UJOA 5JSPA 1NXD1 5L36A 4OHZA 1VAMA 4EV0A 2D6PA 4KH9A 4Q4Y2 3AMNA 5EXOA 2D6NA 2JJ6A 4FQ4A 4AVCA 5I0UA 4NN0A 3B9IA 1EY2A 3GZTB 4PLNA 3WVJA 4QM8A 3MZHA 1AYM3 4LBOA 5FO8B 3J8F3 3PJYA 2YY1A 3WDUA 4IV3C 5JIAA 3ZN4A 5CB7A 4E9KA 3H9AA 1YUDA 5DZFA 2WA4A 1CJDA 1JYCA 3Q9OA 4XYXA 1QJZA 4Y5Z0 5E16A 3M4FA 3NV3A 3TBDA 5BY5A 1HLCA 1J3QA 3U07A 4U2AA 1PNGA 5FQ0B 1QU0A 3TNPB 4FPFA 3ZYRA 2VVDA 2R49A 4L11A 2RS33 2MEV3 5LRSA 2A70A 4AQ6A 3B9CA 1YJKA 2DVGA 3AJYA 2MNGA 1OD5A 4IETA 4FQZA 3RPQA 3BTAA 4XHXA 5ACA2 1FOD1 2PHTA 3ZDSA 4XJ8A 1N3OA 1ASJ1 5CA6A 3ZSLA 4YZ2A 1SCRA 2D6LX 4GB32 4ZU7A 2R0FA 4XMAA 1F5JA 1X36A 4HFSA 5L73A 4L2NA 1SEFA 4GULA 3H1WA 1WMDA 1W6QB 4YARA 1GSLA 1MS4A 1POV3 1A78A 2YDEA 1QJY1 1GANA 3L2HA 4XXPA 3SCFA 4IEWA 1PIV1 2NLRA 1QH7A 5CFCA 1R093 5FOBB 2P34A 5K8SA 4K6BA 1GKBA 2VMGA 2CWMA 1EYBA 3PNAA 2XGXA 1VRH3 2ZGQA 4HMZA 5EJ3A 1HXS2 4F83A 3TB0A 4E4ZA 1PGSA 2ZCWA 1ZRRA 1RUC1 3RI8A 5I8YA 1C1LA 4FXGB 2WNEA 2HYKA 4KWKA 2D5HA 1I9RA 1VJ2A 1UD1A 2Z42A 4JC1A 4MH0E 3ES1A 1S0DA 1PK6B 1J3RA 1W6PA 1XXNA 4GH4B 3VBSC 5CFDA 3GZUC 4YW4A 5F6KA 3H0OA 1D4M1 2WC2A 2DCKA 5ABJC 4LR4A 1D0GA 3CU7A 2ZGLA 4U36A 4IEQA 1YJLA 4ES8A 1EV13 3AMPA 4XBNA 5FBZA 3WXPA 2R071 4B4PA 5FMOL 5I0TA 2B5HA 2LALA 3BIWE 4M3CF 4XHBA 1LGNA 1LECA 2Q1ZB 1J1TA 1NCRA 4MXWB 5E1RA 5KWRA 4YG3A 1VALA 4XILA 2PAKA 3VBFA 3FBYA 2WSUA 4DB5A 2R041 2YPJA 4NHLA 2R30A 2ZPXA 3MIBA 4YGDA 2NYYA 4QGNA 4R9DA 1KJRA 2BNMA 5JOZA 3LCPA 3WDXA 4W6WA 5K7PA 4W6XA 1HRI1 3PMSA 4LO4B 4Q8LA 2ZGRA 1G7YA 3LA7A 1LESA 1GR3A 4DPNA 2WZR2 5JSOA 3FC0A 3FZ3A 1C3HA 2RS52 4S2HA 5CIRA 4LLFA 4Q4W1 2A75A 1ZBA3 4HVOA 1RMU1 2RS12 1RINA 2UY8A 1QQP3 1YI9A 2E7QA 4P9GA 5J96B 5T5OA 4GXLA 1N1SA 3W59A 4B4RA 1ULCA 1NA1C 2PHXA 4YYOA 4F7ZA 4LLOA 1HV0A 5C4WA 5GJ6A 3ZYJB 4AI3A 4UW5A 5EWSA 3RMYA 1COV2 2ZACA 4HVQA 1HQWA 1Q8VA 3ZSJA 1VBE1 1YIPA 2GNDA 1D4VB 3B02A 1CD3G 2BNNA 2O1QA 3HD8B 3OD4A 3U10A 1ZYBA 4OULA 1H2KA 2WLQA 1XYPA 4RR3A 4Q26A 1AR83 3BOWA 5IK4A 3ZN6B 3FLPA 4A7KA 3PJQA 2VNOA 3KT1A 2UY9A 1AR72 2XJVA 5D8AC 3IM0A 3ZSMA 2BUKA 3ILNA 5J48A 4N43C 1RITA 3LSDA 3ZFFC 3SCGA 4AQ2A 1V6KA 3OYWB 3MIGA 2NQYA 2GNTA 4OI0A 1A8MA 1W39A 1YWKA 4AXOA 2H6BA 3ZYIB 1F5FA 4RHV3 4HKOA 1AJOA 4LBMA 4IV3B 1ASJ2 1O3TA 3I54A 3ATGA 5AC93 3VKOA 1LOAA 4N53B 2D7FA 4FOYA 2XL7A 1DDLA 2SLIA 1AX1A 3O5SA 1DGRA 4PQ9A 5GKAC 4LO7A 4Y1YA 1CAWB 4XJAA 3AKTA 1C8M2 4QT6A 2ZJCA 1D2QA 2GNBA 2R063 4EWAA 3ZMNA 3H50A 1NOVA 4I3PA 4CDWA 5BNQA 1X50A 4DS0A 1SLLA 4XFIA 5AFBA 1CONA 4I30A 2AH2A 2BEOA 5DG1A 2WT1A 4CYDA 1MACA 3ENRA 3NAPC 4BIFA 2F6BA 5GZFA 1ZNPA 1CAVA 1DGLA 4GKXA 2XJTA 3ST7A 1G9FA 1AYM2 1PO11 5GALA 4XW3A 2YYOA 1VBA1 4HVRA 1H2NA 1W2UA 2GAUA 4CDQA 1FMD1 4Q0UA 1ULEA 4COWA 1ZZBA 4LTAA 2W39A 2GH8A 2ZGOA 4HKLA 1RHI3 1SLIA 4KGQA 3AP6A 2R32A 3WDYA 1AR93 4QM9A 1ZRFA 2R072 3E97A 3ECQA 4XQ4A 5FCCA 1B35B 2VU9A 2WNUB 3H8UA 1I5ZA 2RS32 4FPKA 1XNBA 4ZU4A 1JH5A 3ZVXA 1O3RA 4YW1A 4C0HA 1JHNA 4R8HA 4K7JA 1R083 3AYAA 4NPRA 2HWC3 2ARBA 3VUOA 3MIDA 1YFUA 2R042 3WNXA 2Q30A 5CBLA 3GZAA 2AYHA 5T3NA 1IS4A 4QGMA 4E4SA 3AKRA 4IEPA 4OI2A 1DYPA 3S6PA 3USSA 3CO2A 1WCKA 5BYNA 3O0VA 3KS7A 4COYA 1F2NA 1YO8A 3KMHA 2A3YA 3P3NA 1O5LA 4EWDA 4XFHA 4IEZA 4Q0VA 2OZ6A 3ZXEA 1UL9A 1XNCA 1V6JA 3JUUA 3HWJA 1MS9A 1WW6A 1R092 3USUA 4AFCA 4SLIA 3WP3A 2PAMA 2UU8A 4PLOA 1N3QA 3D0JA 4RL7A 4RQPA 3BPZA 5FREA 1OQDA 2HWE1 4Q29A 3VHNA 2RM21 2CV6A 3HT1A 1VRH2 3VBHA 2HWF3 3AP5A 4NO4A 1VBB1 3BB6A 4K1YA 1F9KA 4YZ3A 1DZTA 3K48A 2LM3A 3DKWA 1YFXA 2VNGA 4BQ1A 1M06G 3D0SA 2HWB3 2O0OA 3FE5A 4ATFA 4IL7A 4QGLA 1V00A 2K2SA 5CFCC 2XJSA 1CPNA 5J09A 2H0VA 5J3UA 4CDXB 3O14A 5JPMB 5JLVA 1OQEA 2BGCA 5KXEA 1LOGA 3HIFA 3SHRA 4I09A 2A7AA 2VULA 4DRRA 1EV12 5BNPC 3RS6A 1ENRA 2DURA 1S0IA 4XTPA 1IPJA 3RJ2X 3SLIA 4HZFA 2V09A 2HJIA 4A7YA 1A3KA 2ENRA 1NA1B 4I2OA 1WW5A 5KHHA 3DUIA 3B5LB 2XBO1 4FVVA 1XQNA 1ZZCA 2ZMNA 1RUH3 5CFDC 1VBC1 2VH9A 1NCQA 4HN0A 4J1WA 2MPFA 3I2DA 3WQ1A 3B93A 3O0WA 1C8NA 4TYSA 5CU1A 2BBVA 1PM7A 1YYNA 5BNOA 1O5UA 5FTTC 4CP1A 1S1AA 4Z07A 2G4IA 3VKNA 5I0RA 3AMMA 3TAYA 5D8AB 4QPGB 1ND3A 3JBG1 4Y22B 1ZBA2 4XJUA 1LTEA 5T5LA 5JVVA 3VDDA 1QQP2 3IPVA 3VBFC 3WCRA 3ILFA 3ZFFB 4X8PA 4J6GA 3BODA 4AF9A 1WLWA 1QDOA 3LSEA 2N7GA 3J26N 2WS93 3E6CC 1BZWA 1CIWA 1LHNA 1DFQA 5BV6A 1Y43B 5HCBA 2YV8A 4LBQD 4DRVA 2VUJA 1LOBA 4Q4Y1 3V64A 2DF7A 4LHNA 3VHRA 5A3MA 3ZFEA 1AX2A 2DFCA 1UU5A 4XF4A 3JQWA 4MZUA 4XIOA 1R1A3 2QNKA 1FAYA 4EWEA 1AR82 2CYFA 1OA4A 1U0AA 1WBLA 1Q5OA 4XJZA 2UWBA 2JG8B 3QH6A 4LBQA 2A6ZA 1H8VA 5LK5A 5DDJ3 2WZPP 2ZX0A 2ZX1A 5BNNB 1QJX3 1O4ZA 2JG9A 5C4WC 1FATA 3MIHA 4R4ZA 3WT3A 2E53A 4AEKA 4QX5A 3M3QA 1PO23 3NAPB 1HRV3 1IS3A 1MS3A 1AF9A 3R4DB 1BCXA 3KM5A 1YLLA 2ZZJA 5E89A 2PN5A 2LUWA 1SCSA 3ZIXA 1U5IA 3S7EA 1DZQA 3BU7A 4RHV2 4RR3C 5HBAA 1XU1A 3QH7A 4CEWA 5AC92 5ACA1 1VLNA 4CP0A 3IKWA 2DYCA 5SV8A 4Y1XA 1JTZX 4YSFA 4IXLA 4KQ7A 3EBRA 3RSJA 5HCAA 1QMJA 3JB4C 1NE6A 1LHWA 4WM8A 1NYWA 5KHGA 1H1MA 3QBQA 3NW4A 1EPZA 2GC0A 1YFWA 1IPKA 4FP3A 3HAGA 4UBHA 3SITA 4AI1A 2DVFA 4KWJA 3NVCA 5JIUA 3AX4A 4S2FA 3ZMOA 1O91A 2SBAA 2WS91 4AGGA 2DWRA 4RFT0 4JGYA 1Q56A 4Y1ZA 1SFYA 4HT1T 1N1YA 1VBB2 1NLSA 1LODA 3GBFA 2BNOA 1GQGA 3N4MA 2VNRA 1HXS1 5FPXA 1DGRN 4S2GA 3R4UA 4YM1A 5GLWA 3VZJA 1UZZA 2DCTA 4LEJA 5DUWA 2W68A 3GHMA 2ZZQA 4IESA 3KGZA 2V73A 1RUF3 4FOVA 1FX5A 4INDA 4DOUA 4CDWC 1LB2A 1DBNA 1RB8G 2HWD3 1UU4A 1RIRA 2PA7A 2GU9A 1RHI2 1TNFA 3VZMA 5FO7B 1AR92 3OY8A 2VOKA 4LBKA 2ZAAA 4EN7B 5FPZA 1U12A 2WQ4A 5T5PA 1V6IA 2Y0OA 2ZGPA 3G6JB 1WD4A 1AXYA 5JR7B 2BW8A 4P9XA 4CDQC 4DFSA 3HBZA 5JOYA 1H8TA 1RC6A 2FMYA 4ORFA 5CFCB 1NXMA 5KC6A 5D1IA 1XYOA 1GNHA 2CGNA 3WP6A 2ET1A 2GC1A 3B01A 4RSUA 4LUMA 2WJSA 3NSTA 3C2UA 4WVVA 1Y3TA 2D3RA 2RHPA 4R9BA 1WW4A 5KC5A 2NP0A 1DHKB 3OF1A 3JBG2 3AMHA 2VW1A 1MZ5A 4JAAA 4XE9A 2WZR1 1OKQA 2OZJA 1X33A 3IWZA 1W6PB 2CWSA 5F1RA 3IMNA 2G9FA 3POYA 2ZGUA 2HWF2 2RS11 5CFDB 1BBT3 3JD73 2HEYF 4KU7A 2JE9A 1QWRA 1WBFA 4MLOA 1CGPA 2E7TA 5H9QA 2W08A 1QJU3 2IXCA 2UYBA 1AJKA 5IT6A 2R1DA 5KHJA 4YGEA 3OCPA 2HWB2 1WCDJ 2HEVF 3VKLA 1OI6A 5FFOC 1OLQA 1K5MA 3OPZA 5JWPA 3OD0A 3V56A 3V0AA 1COV1 1RUG3 2XLGA 4RQPC 3KLSA 4X6RB 3LOIA 4XXAA 1YFYA 3VBFB 3VBHC 4Z1VA 1QOSA 4BIOA 4YM3A 3THTA 4FO9A 5JAXA 3FUQA 4N53C 1CAXA 4AVSA 3WUCA 1URXA 5H9SA 1RTVA 4AVAA 3WOGA 2QJVA 1NQJA 1AR71 1S55A 2XJQA 4MGIE 4IERA 4ITCA 1RUH2 3E5UA 1N47A 4XF1A 4FPGA 4XMIA 1NQDA 3N35A 2VY0A 1CAUA 2ZGTA 3PVBB 2ZTNA 2GSYA 1Z7S3 3UK9A 4ISQA 1UIKA 2WFF3 3L2YA 3OGGA 2IXKA 4AI8A 2XJUA 4P5HA 3NV4A 3N3HA 5GZCA 1MR5A 3H3UA 1TNRA 3DGTA 5C4WB 4M01A 3V65A 3VZNA 4FTSA 4XFCA 2B45X 3I59B 3R4SA 1RUD3 2JENA 1C8M1 1YIFA 3GALA 1NCQC 2YGMA 3T1MA 5T50A 4WBBA 2WS92 1DF0A 4FAHA 3AYEA 3PVOA 2PQQA 2NZ9A 5FAXA 5HXVA 4RR3B 1BVVA 5BNOC 1OHFA 1NG0A 3IIAA 1B35C 2WNUC 2VGDA 1ND3C 1Q8PA 1I1EA 1AR63 4N9IA 5FLHA 1R1A2 3LZZA 1OPMA 2CGOA 4Q0QA 1AYM1 2I74A 3J8F1 1UIJA 3LKJA 1LCLA 4OZXA 5TSWA 3AP7A 2B7YA 3WG4A 2P3KA 1F31A 2IZWA 4DQAA 4FSJA 1A8DA 4Y26A 4CEYA 3VL8A 2WL1A 5DDJ2 1DQ0A 2DTWA 4LO5B 4XDQA 1BKZA 1SLCA 1JN2P 2DCYA 3SNMA 3VL9A 5C8CA 1RVF3 1TME3 4Z2WA 1HRV2 4HANA 4RGGA 1QH6A 3ZFEC 1QXJA 2ATFA 4IEUA 1H30A 1AYN3 3VBOA 2RS31 2MEV1 4SBVA 4NWVA 3BCWA 1OFNA 3ELNA 4ZKTB 1UMZA 1QXRA 1Z0HA 3AJZA 5KXCA 1GICA 2R6QA 2D3PA 1GLHA 3NWKA 5H9RA 2C0ZA 4CDWB 4GQ7A 3HT2A 3MPBA 1V9U3 1LEDA 5J37A 2JG9C 3VBUA 2XKOA 1X82A 4FPCA 2ZGNA 3AM2A 3H7YA 4YW2A 2GALA 1R1ZA 1POV1 1CAVB 1H4HA 2PAEA 4JRAA 1OSGA 1JYIA 1BEV3 3GBGA 4RGAA 4JGZA 4Y4YA 1R091 2PHDA 4FP2A 4CDXC 4AVBA 1MS1A 2Q8OA 4IV1A 3WY6A 1LU1A 1NLRA 1QXPA 4CDQB 2EALA 1Q3EA 3WLUA 5C9AA 2VW2A 2PTMA 4QQHA 3ZO0B 1Y9QA 2A71A 2D6OX 2V5YA 1VRH1 2ZHNA 2PLV3 2MHFA 4DXZA 2JEMA 2UURA 4YVSA 4NWWA 1CQ9A 2AGSA 3QLQA 4LA2A 2IXLA 1QHDA 4WM8C 1CN1A 2XLFA 1LOFA 4KGGA 1KFUL 4C90A 1RUF2 1DYKA 4YVWA 2HWD2 3EO6A 1G9BA 2E7AA 5J7MA 2ZS6B 1PVC3 4NOTA 2JKBA 4HPKA 1MS8A 3NV1A 2Q1MA 1Q43A 3JCIA 4ATEA 3M3EA 1SFNA 2DV9A 4AFDA 4WVMA 5CADA 5FDBA 2P17A 2B42B 4TLFA 3OGJA 1VIWB 3INAA 1ZA4A 2VECA 3T2TA 2GC3A 1F8VA 1EV11 1DQ6A 3AXEA 1JOJA 1AL23 1QNYA 4YRDA 2B9UA 2Z69A 4QPGC 5FLJA 1M4WA 3N7KA 2QDNA 4XQDA 5T5JA 3GNEA 4QHBA 1MS5A 2QZ3A 3USUB 1BJQA 2ZGMA 2ES3A 2RMU3 3RWNA 1X7NA 4AHZA 4R4XA 1AZDA 4RQPB 4GWNA 1KITA 3ZXJA 3WG3A 4MUVA 3VBHB 2XWBB 2CNAA 4K8FA 2P37A 2NM1A 5JZGA 4P9JA 4XQWA 4Z8BA 1WA4A 4XIKA 4AG4A 2Z5WA 3VKMA 1BEV1 2XB6C 1OA2A 5DUXA 5AFEA 4M00A 2GN7A 1H8TC 2WWSA 3P3PA 1ZBA1 1TMF3 2ILMA 3SISA 5I8TA 3JD72 5I8SA 1QQP1 4QPIA 1DGWA 2C1FA 4HSJA 3H1MA 4YNIA 5FRAA 4UXAA 2JG8C 4QD2A 1UAIA 2BYVE 3FLRA 2QFEA 3N7JA 5BNNC 3N7LA 2PHFA