1U5YA

Crystal structure of murine april, ph 8.0
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
137
structure length
137
Chain Sequence
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor
total genus 26
structure length 137
sequence length 137
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5yA00
2WNVB 4TWTA 2Q1MA 2Z5WA 3B9IA 2O0OA 3AB0A 3TYJA 4OUMA 2JG8B 2HEVF 4EN0A 3QD6A 1XU2A 2RE9A 1IQAA 5BNQA 4DB5A 3MI8A 3B93A 4KGQA 3V56A 5L19A 2QE3A 4QQ2A 2HEYF 2WNUB 1C28A 1TNRA 4J6GA 1KD7A 1S55A 4MXWB 3URFA 4QPYA 3L9JT 5KC6A 1PK6B 2RJLA 3K51A 4D7YA 5KC5A 3B94A 4NN0A 1U5XA 3IT8A 2QDNA 3WD5A 1D0GA 5CIRA 2JG9A 2ZJCA 4F3JA 4QQOA 4MXVA 1A8MA 1KXGA 4QQLA 4TSVA 1TNFA 1ALYA 1JTZX 4OULA 4QQHA 3ME2A 5TSWA 2Q8OA 1U5YA 2R32A 2WNUA 1GR3A 4HT1T 1RJ7A 5L36A 2KA3A 4G3YC 2WNVA 4KG8A 1PK6A 4E4DX 1DU3D 1XU1A 2JG8A 1O91A 2R30A 1RJ8A 3TWIA 2WNVC 4KGGA 2TNFA 2ZPXA 2JG9C 1JH5A 2RJKA 4OUSA 2X29A 2E7AA 2JG9B 3ALQA 1D4VB 2AZ5A 4RSUA 4DOUA 4G4FA 5HBAA 5KWRA 1OSGA 2TUNA 1OQDA 4MXWA 1D2QA 1WCKA 4N90A 2WNUC 1C3HA 1I9RA 4GIQA 4QQPA 3QBQA 1OQEA 3LKJA 2HEWF 2OIIA 4MSVA 1DG6A 3FC0A 3K48A 1PK6C 1U5ZA 4E4SA 2JG8C 2R6QA
chains in the Genus database with same CATH superfamily
2ZTNA 5L9VA 1IG0A 2YUEA 4OQ8A 2LUWA 2WSUA 5C3PA 4Y5TA 4IEVA 1VBB1 1X9TA 4BQWA 1MEC2 2WIIB 3T0DA 2J1TA 5F5AA 1H6YA 3NJVA 5BNNA 3SKVA 1WLWA 2GZWA 2UY8A 1UZYA 3PU8A 4P02B 1GP6A 4PLOA 3HT2A 4EZHA 1QNWA 4Q0UA 1QKQA 2GMMA 5FZCA 1RUI3 3NW4A 3PVOA 2DVGA 1HDKA 2ZXQA 1RL3A 1YXWA 3ZFEB 4RR3C 2IFRA 3O7OA 1V6IA 2ZKNA 1VBB3 3FLPA 4OLLA 5FZ1A 5H9SA 3DYOA 4N43A 5LY1A 3K46A 3LFMA 1PIV1 3N35A 1B09A 4CA9A 3TB0A 4A4AA 4BQXA 3T2PA 1NLRA 2VR4A 4WM7A 4XVHA 4CUBA 5BYNA 2VOWA 1QHDA 5JOYA 2VZTA 4EN6B 1LJ7A 4HONA 1X36A 3LFIA 3SNMA 5IW0A 4ARXA 2BGCA 2V5DA 1PMIA 1J3QA 5F5CA 4UYBA 4AI1A 1QJU2 2ZA9A 1XXNA 4LUKA 5IUQA 2B5HA 1MQTC 3NNFA 3VD5A 3LOBA 4QT6A 1PIV3 4JDOA 2LS6A 4YW5A 2V73A 2VNVA 5F3GA 3ZXLA 5IVCA 3VDCA 1OA2A 1UPIA 2IXIA 4HT1T 4X8NA 1GFF2 2UYAA 1DGRN 2VNRA 3F95A 1RJ7A 3WY6A 1ZRCA 1PX3A 2E33A 2QJVA 3LGRA 3IKWA 4RHV1 3O14A 2WNVA 4ZZ5A 4E2SA 1GQPA 4BXFA 4ITCA 3J9SA 1JOPA 3AL5A 1W2TA 2QDRA 4XFCA 5F7UA 4QD2A 5T5LA 1GZWB 1NCRC 2WA3A 3JCIA 2GAUA 4HLTA 4C91A 1QY4A 1UX7A 4FPYA 1N3OA 3A21A 4FFFA 2GC1A 1BMV2 1QDCA 1AYM1 2K2SA 3JD71 5FY4A 1SFNA 4QHZA 4ET7A 4C0BA 1V0AA 4RHV3 1AUYA 2EALA 1XNBA 4HOOA 4Q4Y2 5EXOA 3O1RA 3D82A 4D6RA 4NHYA 3I59A 2AZ5A 4G4FA 3JBG2 5A3UA 4NMIA 2YGMA 4NIHA 2W94A 4R9CA 1H4GA 1AR72 3C7GA 3D5OA 3J7HA 2WN3A 4H3WA 4FAHA 4M3CB 1A34A 1RUF2 4FPCA 5FPVA 3CJIB 3OSDA 1W90A 4XZPA 3RYKA 3SLIA 1AYM3 4HKWA 3JD73 2L9LA 1ZZ8A 4HANA 4M4RA 4Z07A 1OLRA 1SLTA 3KSCA 2B9VA 2ET1A 4COVA 4NO4A 3LD8A 4E4SA 3ZX7A 2RS32 5CFCA 2ETEA 2FHRA 2R041 1SPPB 4PLMA 2XJPA 1LGNA 3N36A 3NL1A 2JDMA 3N7KA 1V00A 3OEAA 4N53B 1GLHA 4GB31 4XIOA 1MS8A 2ZS6B 5FY5A 4Q0SA 3VBFA 3I8TA 3R4DB 4IV3C 4S2HA 2O1QA 5LK5A 3VD3A 2K9ZA 3P3NA 1K3IA 5F2SA 2B42B 4DB5A 1W2AX 4ASKA 4NRPA 3TNPB 5HV4A 1T6BX 1HX6A 4L99A 1AL22 4U2AA 1E5RA 3MUY1 4AVVA 1T2XA 2JICA 5IVEA 2O8OA 2VZ3A 2R043 3TEWA 1VE0A 1SMVA 2H0VA 3LSDA 4META 2V4AA 3WW4A 1N1VA 4C1WA 1GU3A 1C8M2 1KD7A 4CPBA 3ZFGA 4GB33 3I3DA 4Q4V2 3CMGA 1VBC2 4AZZA 3U0ZA 3ACFA 2ADEA 3OGVA 1EUTA 2Q8DA 2EXHA 1JMUB 4B29A 4D7YA 4NN0A 4BQ1A 5JIAA 5I0DA 5CIRA 1QDOA 2J1VA 2JG9A 2W3JA 4CEWA 3KV6A 2UWAA 4E8CA 4RFRB 3ZDSA 2RMU1 3WP5A 1SBFA 3CKHA 4GJYA 4JHZA 4LEJA 4XFIA 4LO6B 4CP9A 3WW1A 4N7UA 1UL9A 2BBAA 3VKNA 3TN92 4Z2WA 1I5PA 3H3UA 1BBT1 4K6BA 5BNNC 4A45A 5FO7B 4QQHA 2WS92 4UW4A 1VBD1 3JU9A 4RD7A 4E9KA 2BBVA 2WSVA 1OHFA 1LHNA 3H1YA 2IVJA 1RC6A 5T3NA 4HVOA 5F37A 4NHXA 1EYBA 1ZRRA 3OGSA 1UCXA 2VW1A 4ZZ8A 5E1RA 1TZOA 3I2DA 3VBHB 4IV1A 1NY71 3ZN6A 2NM1A 4AEDA 1YC61 5FLJA 2RMU3 1XJAA 2PA7A 2IUWA 1WLDA 2G9ZA 4AK3A 4XUOA 4N43C 1IHMA 5JI7A 2DF7A 1BBT3 2ZGMA 2R30A 4CDXB 1O59A 3WCSA 4JHTA 1VBD3 2VTXA 1KGYA 3I3EA 3O1UA 5FY8A 2R1BA 2VOKA 1N3QA 3J8F1 4YRDA 2WINB 3EYPA 4NPRA 4WM7C 3RFRA 4BA6A 5IK4A 2PHFA 2DYCA 1UD1A 2JE8A 2YBKA 3ZN4A 3OBRA 4OCTA 5HV0A 4XCBA 1Z78A 4HL0A 4JGZB 1JZ8A 5IK5A 3OUJA 4DIQA 5CA6A 4XE9A 1BVP1 4JTNA 5EJZB 1VRH2 1GZCA 2P3YA 3R0RA 4DOUA 4TLGA 1LAJA 1F9KA 3S57A 2RR12 4QX3A 3Q8AA 4YW3A 2UU8A 4DQAA 4CCNA 1F5JA 3AFGA 3J8F3 3NMBA 4UFHA 3POYA 2ENRA 4UWDA 3M3CA 3V0BB 5FZBA 5FV3A 1ZBA2 4LHLA 1D7PM 3ZSJA 3AKPA 3M7AA 2ARXA 2GNBA 1J1TA 1U5ZA 4AR2A 2R1DA 5GLZA 1HJGA 3AP9A 3NJXA 3WEZA 4XPVA 2C0ZA 3B9CA 5FZ8A 1LHOA 1OLQA 4FFIA 2ZX3A 3NV1A 1VB2A 5A7OA 4HETA 5FIXA 4FP2A 1QIQA 3KQRA 5GZEA 3I54A 1XYOA 3VBUA 1FI2A 1R1A1 1JZ3A 2W5FA 2HWD2 1B35B 2RDQA 5GLTA 1DCSA 4XEZA 3ZYFA 3H7YA 4WVMB 4JRLA 3NNLA 5F32A 3AVRA 5FZFA 4XQDA 3SC7X 1ULCA 4UW6A 5FREA 1TMF1 2IC1A 2P4EA 1C28A 1GZWA 3MPBA 5F3IA 4BOWA 1W8TA 5ACA2 3WNLA 1JYNA 2ZGOA 4E27A 3POFA 4XF3A 1S0GA 4I3GA 3CJXA 3A0KA 2PHXA 5L9RA 5JSRA 1FATA 1XNDA 2XUEA 5K4LA 1R1A3 5ABJA 1H4HA 4C8DA 1S0JA 2VZOA 3WG3A 4XETA 5KHGA 3KT4A 1X82A 5CFCC 3H50A 1W0NA 5T52A 2FZ2A 4XJ9A 3S6PA 4CUAA 3I2FA 3UGHA 2YFZA 1UZ0A 1SLAA 1TMF3 1CX1A 5LATA 1Q8PA 1RMU1 2UWBA 1H8TA 4YNIA 5FFOC 5FY7A 4M3CA 5FPAA 3CJIA 3D0SA 4CXXA 1I6XA 1QJEA 1WBFA 5EPAA 2Q8OA 3H8XA 4Z82A 1W2UA 4I3PA 1QJX1 2OS2A 1HRI1 2YHJA 3W21A 4UW5A 5D8AB 4ZU5A 4RR3B 5A7WB 3VDAA 2F4PA 3LEKA 2EXIA 2PYTA 4JAAA 5FYSA 5LA2A 1SPPA 4AGRA 1RMU3 4MHRA 4MLOA 3ZFGC 4CU8A 1CZTA 3VN4A 1BKZA 1XE8A 4N53A 4LBLA 4Y1XA 4IETA 4L8QA 4QB6A 1DGLA 2R071 4BCUA 4NIGA 5B4NA 4UF0B 5LEKA 5FXZA 1WA6X 4CEWC 1HJFA 2JG9C 2XJUA 1W8WA 2XKOA 1Y43B 4Y26A 1QJX3 5FUNA 1HRI3 2P2KA 3AZVA 3K2OA 5C5TA 3P1IA 4L11A 2YU2A 3BIEA 1G8WA 4WZCA 4Z8BA 1IS3A 1O5LA 1MQTB 3BODA 3HEIA 3KGLA 4W50A 3PTRB 4BIOA 5A7QA 2VMIA 1RUH1 1VBE2 2Q0AA 2D6LX 1W9YA 5CU1A 3M70A 5CAZA 2JDZA 2WQ8A 2JENA 1W8ZA 3HQRA 4ZS3A 5BUVA 1OLME 1Z7S1 3RRDA 3ZPYA 4FPLA 1POV1 2R073 1LULA 3GBWA 4K8FA 2A70A 1S0FA 2WAOA 5LW9A 3ZSLA 1ZZBA 2E26A 2RS12 3OPZA 3NNJA 2BOJA 4GMP0 4IV1C 1NCQA 4KL1A 1YI9A 4OZOA 3RI9A 1NCRB 3K4DA 1O3TA 4I0WB 3NNGA 1M06G 4IXLA 4XC9A 2VW2A 2VBBA 2X05A 5EWSA 4TN7A 4AYUA 5ISLA 3POGA 1RUH3 4ZY9A 4A7YA 1Y4WA 4LE3A 3O0VA 3RI8A 2HEVF 4R52A 4XHBA 1Z7S3 3BKZA 1POV3 4EN8B 3WOGA 2HWF2 2WFF2 2EF6A 1OF3A 2WNOA 1F8VA 2AR6A 1V70A 1FPN1 4MGQA 3VBHA 4DPNA 5L19A 3I4IA 2D3SA 4YG3A 2GNMA 1RUC1 4XJAA 5CISA 1GANA 2XLGA 3O5SA 1EV11 1LU1A 1XE7A 4KWKA 4MADA 4PQQA 3WNNA 2HWB1 3ASIA 1VAMA 4CDXA 2HYKA 1UIKA 4IERA 3KZ4C 2VJXA 4D6QA 3LDBA 2J1UA 1WMXA 1SACA 1QMJA 2BU9A 3APBA 3RPQA 4TZDA 3A22A 3AYDA 3K51A 1FPN3 1L7LA 2ADDA 3FX3A 3IT8A 1XRUA 1N1TA 3N9OA 4ORFA 4QXKA 4CTEA 1HXS2 4JGZA 3AP6A 1RUC3 2P3KA 4JDNA 5CG8A 3QOPA 4CCJA 4FOWA 3N3HA 3AMPA 1OA4A 5K8SA 4YZ1A 1EV13 4IV3B 4ATFA 2W95A 4LNVA 2HWB3 2BZDA 2VZSA 4QM9A 5JXHA 5FPLA 1UMHA 1YI7A 3VBUC 1LODA 3I2OA 4D94A 4HPKB 2EAKA 4AVSA 4JDMA 4M00A 4QX5A 1E5IA 3AYAA 4I01A 2HH9A 3AMNA 4XILA 1U5YA 4NJ4A 2ZX2A 3USSA 2R32A 3FJSA 3AXEA 1WCQA 4ZS2A 1CAUB 3RZKA 1URXA 3WX5A 4GWNA 3BIWE 2HWC2 4XF1A 2W1WA 1XNAA 5BXXA 1RUD2 2DDUA 1ODNA 1ST8A 1RB8G 4IUGA 4ASMB 2OUJA 3SCFA 3CZJA 1GOHA 1QWRA 5LB6A 5FMCA 1U5IA 3VD9A 3DF0A 1F4HA 1YFXA 1MZEA 1JN2P 2BVVA 2W1UA 4NIIA 3T0BA 1MZ5A 4AVBA 5C4WA 1F5FA 5ABJC 3TWIA 1JYXA 4Q0PA 1LOEA 3AX4A 1QJY1 2QZ2A 4XTPA 2Y6HA 4MX3A 5FMBA 1ND2B 4DY3A 1MEC1 2RJKA 3G7DA 2P3JA 4WVMA 5CADA 4OI2A 1W3XA 1WLTA 1CVNA 1QH7A 4XZUG 1GWKA 5BNNB 5LY2A 4AFBA 1ENSA 3KGZA 2CL2A 1CJPA 1DYKA 1UN1A 1H8TC 2XJQA 2ZGUA 4BK4A 4DZGA 4LKSA 1C4RA 2FBEA 1CD3G 1KJLA 2CWSA 3CJIC 4IEZA 4XUPA 3LCPA 4YZ2A 4HSJA 4DO0A 2ERFA 3CL1A 4LE4A 4D7SA 1W6MB 2PQSA 3DL3A 5FOBB 2D44A 5DDJ1 2XLFA 2YU1A 1KDMA 1QJY3 1MS3A 4L0PA 1CZSA 5KBFA 1MEC3 3WHTA 3HWJA 4XXPA 2WYSA 4D0QA 1YIFA 4JKLA 2RDSA 2FDHA 4IGQA 2G19A 3FLRA 5EJ1B 1W28A 2GMPA 4QKDA 3GJAA 5EYYA 1IS6A 1O4YA 2IVIB 2WL1A 2O0OA 4YSFA 2ZEZA 4ZHNA 4WM8A 1NKGA 1RUG2 5I8TA 3A7QA 4M4PA 5A3LA 1XBFA 1H2NA 2ZEYA 3AXDA 3DUIA 1AF9A 5DDJ3 1SLIA 1R082 3H1WA 2MHFA 2FZ1A 1ONAA 1WD3A 5KHJA 2OT7A 2JE7A 1IKQA 2C9AA 5D8AA 3PVEA 5APAA 1ENRA 1OMIA 1QQP1 1QXRA 3N7MA 2R7EB 1BEV1 2W47A 5A7WA 4XMIA 3BALA 5CB7A 1RVF2 3PU3A 2LALA 3BU0A 5BPXA 3POBA 5JXIA 1OI6A 3RJ2X 2J1RA 3BI3A 5FYYA 1OOPA 2EA7A 2XQRA 4AEKA 2F6BA 1AX1A 3IN9A 2R062 2Y33A 4LTAA 4J6GA 4MXWB 3GJBA 1WCUA 4BLJA 4I0BA 3ZMNA 3POEA 1NCQC 4A7KA 2GP5A 2QTWB 5A3MA 2PAEA 5KC5A 3OBAA 1QQP3 1IS5A 3OGJA 1BEV3 2Z4FA 1W6NA 1KQRA 5K9YA 2YZ4A 2DCYA 2E51A 3TRSB 5F9TA 5IAVA 5FWJA 4CCOA 1LHVA 4CP1A 2C1FA 3DV8A 3ZN6B 1DF0A 5FTTC 4BMEA 4Q4Y1 4V1PA 1OT5A 4AVCA 2BEOA 3DXTA 4H55A 5K0UA 1A6CA 2EIDA 1WCDJ 2PMWB 3IM0A 3JBG1 4LR4A 2ZCWA 5JCTA 1LGCA 4O9EA 2WNUA 2WZPP 3RS6A 3ZFFC 1HV0A 5A6ZA 4CCDA 1UOBA 3SMHA 4BE3A 5FPXA 2R0HA 5JUVA 4IESA 5DAQA 3AP7A 3IDCB 2VCMA 4CRQA 4YLZA 2JXAA 4CDXC 1O4ZA 4XDQA 1DLCA 4LK6A 3GZUC 2CAVA 1EAH1 3LPGA 4FQ4A 1ZBE1 4XHXA 1KS4A 3HPNA 3RMYA 4MGZE 3ZYPA 4Q4Y3 2RS31 4XABA 4IW3A 2RM22 4CYDA 4XUQA 3R6SA 5CFCB 1CR7A 2LM3A 1V6OA 1OD3A 3JBG3 3WDTA 2VNOA 1FMD2 2GSYA 1K42A 4JGZC 4XFGA 2E32A 3S0MA 2YV8A 3MIDA 4GJZA 2YYOA 4LKEA 1REDA 2E7AA 3LA3A 4NAOA 4CCCA 1NG0A 5B4XA 5D2AA 1MPXA 5IVYA 4GKXA 5CBLA 2GN3A 3ACGA 2DU1A 2CHHA 3NV4A 5DAVA 5FRAA 2VOXA 1EAH3 2WNEA 3K3OA 4JVAA 1ZBE3 5HBAA 1YQCA 1AL21 3TOJA 5AVPA 2XONA 2RS33 3H8RA 3RWNA 2BGOA 1OQEA 5LZ6A 2FDGA 5FLHA 4AG4A 3BOPA 2ZHKA 2VPVA 5IVBA 5D21A 1UY2A 2VZQA 4QX8A 1SEFA 4Y4YA 3OEBA 1H0BA 3GZAA 1AR61 1DGRA 1OH3A 3V0AA 4GALA 1Q8OA 4RFT0 3TEXA 2OXBA 2P17A 5C8CB 3A4UA 2ES3A 4EN7B 1MR5A 4IV3A 4AHZA 1IPKA 5C4WC 2FDKA 4CEWB 1OKQA 1AL23 2ZHNA 1MZ6A 2WQZC 4HPKA 4N8MA 4W8JA 2RDRA 3GF6A 2AENA 3OTFA 2WO2A 4YFWA 5FZDA 2UY9A 1JOJA 3D4KA 4QB1A 3RGBA 4QKNA 3TN91 3QD6A 4GQ7A 4RL7A 2XJSA 1CAUA 4LKFA 2CV6A 3LA7A 2PHWA 3PJQA 1AR63 1VALA 1UU4A 2QE3A 3USUB 2JD4A 1YQ2A 5JMCA 3PTYA 4RYDA 1ULPA 2Z42A 4ZU7A 3MICA 3CEWA 2CGNA 1TNRA 5FYTA 2RJ2A 4IV1B 3MIHA 2GP3A 5A1FA 3SH3A 2R0FA 2WQ4A 2XQXA 2Q1ZB 5IYYA 1PZ8A 4NAMA 5M0TA 2WABA 1W39A 3TN93 1ND2A 3ZXDA 5F6LB 2P1BA 1WW4A 2RJLA 3W59A 2ZEXA 5JPNB 2OW4A 3IMMA 3ZM8A 5GLVA 5KHHA 3WNXA 2P34A 3WD5A 1S0IA 4CCMA 5E88A 4BLIA 2OUHA 3AC0A 2ZGRA 1W6OA 5AC92 3NJZA 3PUSA 3BPSA 4QXHA 4QXBA 4QPGB 4WM8C 1FXZA 3SQOA 4QQOA 1US3A 4AI3A 3FWEA 4H7LA 5LBCA 2X8KA 1TE1B 4OI0A 1JTZX 5J48A 1W6MA 3ST7A 4FSJA 1GICA 4IL7A 5IVVA 1WMEA 5D8AC 4CXWA 3WNMA 1F2NA 1VBA1 3T08A 4P9JA 5EQUA 4LO4B 5DXDA 1UOGA 4LOSA 4A3XA 3WNPA 3KT7A 2WZR1 1R092 2ARAA 4D7TA 1U0AA 2D6KA 1OOPC 2Y0OA 1OFSA 2ARCA 1AVBA 1W99A 2LRPA 3E1F1 2I2SA 3CU7A 4FXKB 2RG4A 1DQ4A 1SG3A 3WP4A 5JDBA 4W6YA 2D3RA 5LCWL 5FQ0B 2KXLA 4AFMA 3NV2A 1NXD1 2CSGA 1VBA3 2VM9A 2ZX1A 1IPJA 1HRV2 2QVSB 1VMJA 1TME2 3T1MA 3L2HA 2WZR3 1UXXX 4H14A 3VBSB 4B7KA 3CDZB 3VBUB 1KITA 1NZCA 1YRZA 4E2QA 5A33B 2HWD1 1CAVB 5L9BA 1YWKA 2A73B 2PXJA 3PLQA 4MXWA 4LBKA 5ANQA 5FXXA 5K0UC 2LROA 1AYN2 1D2QA 1H2LA 2OQ6A 1AXKA 3PMEA 4O7XA 2WNUC 4NPLA 4GIQA 5A6YA 2W1SA 3DCQA 4YM0A 1MS5A 2WZEA 4LMFA 1G9FA 2BFUL 2HEWF 3NWKA 3VKMA 3WHUA 3OPWA 4XFFA 3VDDB 1L3JA 4K20A 4FOVA 5FOJB 3RZMA 2DVDA 2OZJA 1RUNA 5ABJB 3RNSA 4OVEA 2HWD3 3T30A 2GNDA 5JSOA 1RHI1 3VBRB 1NUKA 3ECQA 1LECA 1QH6A 3BN6A 1N1SA 3WP3A 2W87A 2B8MA 4Y1ZA 5FZLA 2VUCA 2XR4A 1H8TB 4GXLA 2IXLA 4LORA 4QPIC 3PUQA 2ZAAA 3VLBB 3MEPA 3OBZA 4JKKA 5KHKA 2R49A 1KFXL 1ASJ2 1WW5A 1NX9A 2JDHA 5C5UA 1LESA 2VBPA 3ZKUA 1RHI3 1Q8QA 4G9SB 1NLQA 5A1LA 2BOIA 2VC9A 2QQWA 3CZUA 5DG2A 4OI1A 5EIYB 5LRRA 1X7NA 5CFDB 2C4XA 3U11A 4EWEA 2BW8A 4CEYB 2GH8A 3WQ1A 5H9PA 3IPVA 3KF3A 1NE4A 5I91A 2VBDA 4YW1A 5FYZA 2FCUA 2WO1A 2WN2A 2IXCA 4LITA 4AI9A 4LBQB 4BXSV 3PUHA 4HG6B 5DUXA 3BPZA 2ZJCA 2PAMA 4B8EA 2PHLA 4JTOA 3HQXA 5HI0A 5BNOB 1A8MA 1CX4A 2O14A 2WFPA 1EP0A 2QCSB 3FE5A 4JV4A 1TNFA 1PGSA 2BP6A 4XDOA 4LJHA 2XKPA 3UJQA 2QZ3A 1H6XA 2MNGA 3M3QA 2XVLA 1V6KA 4LHNA 5FO9B 5D1IA 2B4KA 2PLV2 2CY6A 1OD5A 2PHUA 3OUIA 3HR9A 5FPZA 5DMYA 4NIAA 5C8CA 1GQHA 5CG9A 2VQTA 2YPDA 1PO22 2VQAA 2C5DA 2RHPA 1ZRIA 2RS11 3FLTA 5FY1A 5J09A 4LOTA 1NCQB 1DU3D 1H8VA 1LGBA 1MVEA 1MS4A 1ND2C 2MEV1 3WP6A 4AQTA 1SFYA 5AFBA 4FTEA 3PUIA 1LOAA 1SBDA 2VQUA 3OCPA 5FK7A 3VZJA 2CU5A 2H6BA 3D6EA 4LO8A 4CU6A 1SCSA 4QGLA 1VB4A 1PM7A 1RGSA 3MLJA 1DZRA 2WKKA 2XJRA 5DAWA 5J98B 3WDUA 3L2YA 4Q1PA 2X29A 3LIGA 3USUA 2AUYA 4XF0A 4FAGA 1JYIA 3W58A 3WZ1A 4HFSA 2HWF1 2G4IA 3N7JA 3FL7A 1D4VB 2RS13 3NKGA 1OURA 3RZLA 1SDDB 2A6WA 2MPFA 4AHXA 4YW7A 4J1XA 3ZFFB 5B2GB 3RZGA 2MEV3 3HN1A 4AOCA 2Y8KA 3P6BA 3E5QA 4QQPA 4AW7A 1COV2 2JJ6A 1DDLA 1JHJA 5A3WA 3PMSA 3J7NA 4KWUA 4UFIA 2W46A 2XVKA 3I3MA 1A8DA 1K5JA 3K48A 2BWAA 1QXJA 4QPGA 1GNZA 2HWF3 1ZX5A 2CDOA 2FQPA 1YIPA 3FHQA 4YZ4A 1CWPA 3PIGA 4K1ZA 4B4PA 1HIXA 3A0NA 2UYBA 5HCHA 1UAIA 1AR81 3U37A 3WUCA 1RUI2 4TXWA 2HLEA 3FUOA 1WUVA 1YYNA 1UNBA 2BFUS 2V5YA 4M01A 2WLQA 5G04L 5FZKA 3KV4A 4QDSA 4SLIA 1PGW2 3U78A 3MIEA 3N9MA 4BHPA 4GKYA 4CPBD 4ES9A 3MI8A 4AFCA 2FDJA 2VMHA 1E57A 2G9FA 5C3QA 5JOWA 4AQ2A 3LF7A 4X8PA 3VHRA 4PCRA 1DFQA 2WUHA 4KQ7A 5FP8A 3M8LA 4AEDC 5IATA 5JIUA 1AR83 4PI0A 3MF9A 1V6JA 4FXGB 1XNTA 3ROUA 5BNPB 5FQ0A 1RUD1 3O1MA 4PHZA 3HNMA 3IZOA 2JDKA 1QOTA 1NA1B 5KHIA 3W5MA 3L9JT 2Z2SB 3VL8A 1RXGA 2C24A 4NR1A 1O3QA 4HMZA 3JXSA 2W0XA 1OLMA 4XXAA 4IEQA 2AC1A 1U5XA 4UAPA 2FMDA 5C4WB 3AZXA 2VUJA 3VBSA 5A33A 2WO3A 3HOBA 4F3JA 4Y22A 4I09A 1CAVA 4YGDA 4YPJA 2JIGA 2XOMA 2OVUA 2VOVA 4IE5A 3WCRA 1OH4A 4LO7A 2X5IB 4OHYA 3E97A 3NQHA 1EY2A 2GDFA 1RUD3 2HWE1 3EQEA 3KMHA 4NROA 4OULA 1V9U1 2XBO1 1IKPA 4LXLA 3AM2A 1Q8SA 1PHMA 3SISA 4Z1VA 3MBWA 5T50A 2QQKA 4QAWA 2VXJA 1ENQA 3Q8BA 3VDDA 3LEIA 4K21A 3ILFA 2ZGTA 1XB9A 2WWJA 3GDBA 4I2OA 4FPHA 3OUHA 1MS1A 3H3LA 3M3EA 4QKBA 5GZCA 1I5ZA 2KM2A 4UW3A 1VR3A 4BMBA 2ZZQA 1T6GC 4PF5A 3VBRA 3HT1A 4N9IA 3ZYHA 1Y9QA 1IGOA 2HWE3 3J26N 2ZMNA 5FZ4A 1V9U3 3I49A 2WJSA 2XBO3 2GC0A 1W05A 2F4LA 1OC1A 4AI2A 4AFDA 3W5NA 4WM8B 5FUPA 5F3CA 3Q8EA 4FFGA 1Y3TA 2YY1A 3NO8A 4AXOA 2X10A 4F83A 1LU2A 4OMCA 1AYM2 3LEMA 3ALQA 2JB4A 5F2WA 1FYUA 1CIWA 3H3ZA 3MGUA 2D43A 1AJKA 1QJZA 2GN7A 4IDZA 1GP5A 1W0OA 1LRHA 5C33A 5CFDA 1BZWA 3C3VA 4W6XA 1AR92 3RYRA 4CEYA 3O1VA 1C3HA 1ZNPA 1OOPB 4O9GA 5ERLA 5IK8A 3KD4A 1WW6A 4QPWA 5DAPA 3SCHA 4AVTA 5C8CC 4XBLA 4GD4A 1QU0A 1YO8A 3SH5A 3N4MA 4LBQA 3EO6A 4A3ZA 3BU7A 1BK0A 3FC0A 4FCAA 5FZ0A 1REEA 3NNMA 1O3RA 5BNOA 4BJ0A 4KU8A 3PUAA 4GH4B 4P14A 1A78A 5F39A 3U07A 4YM3A 2A6ZA 1OF4A 2Z5WA 1UW8A 2P6HA 5KXEA 1V6LA 1W6NB 2D97A 3DKWA 1SFPA 2O8QA 2VZRA 5FZ7A 1HB4A 1ZYBA 4XFHA 4YW6A 1AXYA 1XSQA 5FXVA 5FKBA 1QEXA 2I74A 1KS5A 3B02A 4KG0A 4QX2A 1D0HA 4S2DA 3BTAA 5DAXA 5C8WA 1L7RA 4N9HA 4QWNA 2BNNA 1IQDC 2NQYA 3ILRA 5A1AA 5K0UB 3PJYA 3JB8A 5DABA 4JGYA 2WA4A 2SBAA 2BTVC 2WNUB 3LDRA 3DXUA 4RN5A 2QBXA 5FBZA 4FBFA 1YJKA 2QQMA 1G9CA 4ZU4A 4HK9A 1DQ2A 5KR7A 1NAEA 5FP7A 2ZGNA 5E8AA 4AI0A 5L73A 3VB9A 3FN9A 1BJQA 1M4WA 1S0CA 5JOZA 4OFGA 4H7MA 3BTYA 4Y4RA 2BDRA 3LDKA 1W9FA 2E63A 3B7MA 3GYDA 5DQ0A 3LAGA 4QPGC 2RM21 3S5QA 1D0GA 2DFCA 3T2QA 3VKLA 4OHVA 3HBZA 4R9BA 5FMDA 3QH6A 1BK1A 2QKDA 2VU9A 3VDBA 3ZXFA 4CCKA 1JZ4A 4NHKA 3RWKX 4ASLA 5DPNA 3DPRA 3ZFFA 4C0HA 4B1LA 4YGBA 4L9BA 2DCZA 2B46X 5J7MA 1W8UA 5EFUA 2RMU2 3S7IA 2J1EA 1CPNA 2YMZA 4LBMA 4QPIB 5T5PA 4WZFA 5FZIA 1ZREA 4P9GA 1BBT2 4Q4W1 2V09A 1GOGA 1MVQA 3CIHA 4QHBA 2RM23 3I2KA 5C9AB 3BTXA 1UYZA 2GH2A 3ZXJA 2KA3A 4GA9A 2EXKA 2W92A 4KBZA 4XUNA 3HVDA 5A3OA 4P9WA 4Q8KA 2DWRA 3EMRA 1R1ZA 3M3OA 4AI8A 4E8DA 1NY72 3KHCA 4QDQA 3T4VA 2VCCA 3V0AB 2D6NA 2ZGSA 3S5AA 4BQ2A 1UYXA 4RS5B 1PVXA 4JRAA 3MIBA 5EHDA 2YG0A 4YGCA 4Q4W3 3VBSC 4W65A 1JU4A 2DURA 2P37A 4FPGA 4S2FA 3VHOA 4XBNA 5LBFA 1CQ9A 5L7OA 5LBBA 3THCA 3U4SA 1PNFA 4M3CE 3PVNA 4HXCA 2PFWA 1JU3A 3B01A 3K75B 3J8F2 4Q8LA 2SLIA 4FPKA 4A6SA 5F8PA 3T4HB 4NWVA 5FYIA 2IFWA 5BNPA 1JYCA 1PVC1 5EJ3A 1F35A 2A6XA 2EICA 3WW3A 3DGTA 4M3CF 5J37A 2UURA 1NA1A 1OPOA 2YXSA 1RUE1 4I0AA 4NHMA 3TNQA 2XXZA 3U4XA 1PNGA 3VDDC 2NPIA 4HKLA 4YG6A 4W6WA 2A75A 1CAWB 1CONA 3IMNA 3POJA 4ZONA 3PVBB 1DZTA 4PBOA 4Q4X2 2ZMKA 2R16A 4MYEA 2ET7A 4PDWA 4P08A 5GKAC 4LA2A 2W39A 4D69A 1GBGA 3UL2A 3VBRC 1WMFA 1DGWA 3I3QA 5FO8B 1JXNA 3ACLA 1UMZA 2X5IA 3B9IA 5FMOS 1PVC3 4DEVA 3AB0A 2B39A 4A44A 1RIRA 1W6OB 4EN0A 4OHWA 1RUE3 4Y1YA 4Z92B 2Q5TA 3ENRA 2RE9A 3PDQA 3O12A 3V65A 3E5UA 3FBMA 1ZZ9A 1GZ9A 5LEJA 4YGEA 5FZ3A 4BQ3A 5BNQA 1ZZ7A 2DUOA 3VKFC 2ZGQA 1HKDA 5LA1A 3AYEA 2EVXA 1VMFA 2ILMA 1VRBA 3P5BA 4CU7A 5GM0A 2AACA 3LSEA 1CJDA 4BIFA 1G86A 1ND3B 5CFDC 4AQ6A 2GU9A 2E53A 4CEYC 2CWMA 1KDKA 5FBJA 4YZ3A 1SZBA 5T54A 4CDQB 1E5HA 2JEMA 2JX9A 2Y38A 3JB4C 4X6RB 4YVWA 4DFSA 1LOFC 5HXVA 3VGIA 4COUA 3KCCA 4KH9A 4OHZA 1Y9GA 1F31A 2BV4A 5BNOC 4YWAA 1HB3A 4E4ZA 3GALA 5A3NA 1LEDA 1QJU1 3AKSA 1G9DA 4BZ4A 1TME1 2YDEA 5FDBA 4I02A 4OYUA 4A2UA 3O1TA 1W9TA 1DHKB 4K1YA 3AMHA 1PGL2 2D3PA 5IVFA 1LCLA 3ME2A 4IQPA 1CIYA 3B5LB 1RMU2 2JWPA 2K0GA 1G7YA 1ZRFA 3GHMA 3ZYIB 5BV6A 4JGYC 2ZX4A 4C1XA 5HXMA 3CBNA 2Q8CA 1NXMA 2B7YA 2QFEA 1POV0 3UV9A 4BISA 4YM1A 5J36A 2EIEA 1AJOA 1Q43A 4GH4A 4AWDA 2JDPA 1QJU3 2VVFA 1HRI2 3IIAA 4GWMA 1LHWA 4KG8A 1TME3 4P9XA 5JOXA 5LWBA 3WLUA 4YZ5A 1ULFA 1BCXA 5E6HA 1BMV1 3Q8FA 4RGKA 3WSOA 4MGSA 4K3UA 4Y1UA 2WLPA 1PM4A 4W4ZA 5ANNA 1S1AA 3P3PA 4UFKA 4RQPB 3HIFA 2TNFA 3I2JA 4XUTA 1S2KA 3ZXAC 4BQYA 1NOVA 1JH5A 4AAXA 5FYHA 3ZXEA 3HBKA 2R072 2TEPA 4UFJA 4QU1A 3I97A 3DPRC 3QACA 4Q26A 1AR71 4FPEA 4DRVA 1SLCA 2VNGA 3IB3A 1LKNA 1N1YA 2XMLA 1RUF1 3FFZA 4RSUA 4EN9B 1YFWA 1UF2C 3ZOIA 1ZZCA 1W03A 1MACA 3M4FA 3T2OA 1OUSA 4LBNA 2QQJA 5FLIA 2VGDA 2NP0A 4Y1VA 3AP5A 1LHUA 4AGGA 4UBHA 1NE6A 4PIXA 3FUQA 1LENA 4XBQA 2VXRA 5LA9A 2C9KA 1ULOA 1Z7S2 1UYPA 1IS4A 4UBGA 5H9RA 1UY1A 2HBTA 2XJTA 4FFHA 3IPVB 1S2EA 4JQTA 1AR73 1VP6A 2W68A 4KNCA 5CKNA 2EIBA 3ZXGA 1RUF3 2Q1MA 4DUXA 3WF4A 4EJRA 5E16A 3JQWA 4QPIA 1LTEA 3LOIA 3R05A 1W8NA 4Y5Z0 1REFA 2ZGPA 3AMQA 2VQ0A 5FCCA 3WV6A 3RSJA 5L7OC 5GLWA 2VZUA 4DXZA 1STMA 3ELNA 1XOYA 1IQAA 3K3NA 5C9AA 1EPZA 2VZ1A 4QMAA 4HK8A 1QJFA 1DIWA 3KCYA 5C3RA 5IFPA 5JR2A 2Y6GA 5BNPC 2PLV1 1C8M1 1DYOA 3ZDVA 1LNSA 1FPN2 2AEYA 4Q4V1 1XQNA 1LOCA 1NA1C 1K5MB 1NT0A 4NPMA 1VBC1 2PTMA 3RG0A 4Z2AA 4FTSA 2CGPA 5JZGA 1L7QA 1RUC2 3X29B 5F6KA 1PO21 3WG1A 1Q56A 3VBOB 4RS5A 1QOSA 3ITQA 4QPYA 1UYYA 5KC6A 2Q30A 3VUOA 3WQBA 4CUCA 4DUWA 2HWB2 4PDWC 2ZBJA 1RYYA 3B94A 1GUIA 3UKVA 3BVCA 5A32B 5LRSA 2GALA 3GBGA 3IAQA 4GWIA 4I30A 2X5IC 4CSWA 2PLV3 1C8M3 4PBPA 4BWOA 4L2NA 2WS91 3ETPA 2PQQA 3MPPG 2J1AA 2E6VA 3OF1A 2CNAA 1UY0A 1VIWB 4Q4V3 4UOJA 4URTA 5FYBA 5KXDA 2Y26A 1VBC3 1ULEA 3VHNA 2EAAA 4LUMA 1PO23 3T3YA 3SCGA 5C71A 1WCSA 2VAUA 3RZZA 5TSWA 3WF2A 3SEEA 4C90A 3N9QA 3VZKA 3HN3A 2A6YA 3N7LA 1CAWA 2D5HA 4IGPA 1Q3EA 2D6MA 4HSLA 4Q2FA 2W1QA 3ZYRA 2XPJA 3TAYA 4YW2A 2VMFA 4NUBA 4PJYA 2VOTA 3R4SA 3KB5A 4BB3A 1COV1 2YB7A 1W2NA 5JVVA 3VL9A 4DXRA 1US2A 4FVVA 2OPWA 2Y6LA 2WS93 1VPHA 4Y33A 1PK6A 2E31A 3S30A 3PNAA 4ES8A 2YROA 1RUJ2 3CQOA 4PLNA 3FFQA 3U1XA 4COWA 2BNOA 3LIHA 1FNZA 1WKYA 4YVWC 1CN1A 4FP3A 1OKOA 3LWCA 4IEYA 4XW3A 2LW8A 2BUKA 2I45A 3MHZA 4EQVA 3H1MA 2BNMA 4K8RB 3S7EA 4Q0VA 5A6XA 4OUSA 4INDA 2A5ZA 5FP9A 5GZFA 3RYPA 1VRH1 4FT8A 5JXJA 1GWLA 1OXCA 3HD8B 1QJY2 2YC4A 2AEZA 1COV3 1PO12 1PGW1 4YM2A 5CZKA 3NV3A 2RR11 1ND3A 2DCTA 3GCXA 4HBNA 4LIVA 3MLKA 2DTYA 4XURA 1PX4A 4XYXA 2H6CA 2JB8A 1AHSA 4CDQA 3JQXA 5A7SA 3CLPA 1WLCA 3HJRA 3I2HA 4XQWA 1ZBA1 4AVAA 1FOD2 3QBQA 3ZSMA 2DBNA 5FY9A 3WDYA 3J7LA 3OD4A 3WG2A 1UPSA 5I0SA 3H8UA 3AL6A 4QXCA 3UKNA 2HBUA 4GH4C 1VRH3 4JX0A 4R9AA 5DDJ2 4EROA 5IVJA 3M2MA 2D40A 3DECA 3PHMA 5C3SA 2XDVA 2ORZA 2RR13 2NN8A 2VMGA 4UFMA 2W08A 2W52A 1HN1A 2PAKA 2RS52 1TVGA 2EIGA 2EXJA 4FQZA 5IAXA 4ZXKA 4Y22B 2NMOA 2Q8EA 3MFAA 3SH4A 5FP4A 4CP2A 1W0PA 2DVBA 2W2IA 1ZBA3 4QX0A 4YW4A 5KXCA 4TTGA 5KXBA 4Q1RA 3U14A 4MGTA 4AEMA 2XG3A 5ACA1 5DZGA 1QOOA 4KGQA 3WXPA 4P00B 2UWCA 3AZWA 2A1XA 5JR7B 4LPLA 1IG3A 4GWJA 4MO3M 1QQP2 1MS0A 1YLLA 2J42A 3AMMA 1BEV2 3DN7A 3H0OA 4Q29A 5DUWA 1OVPA 4JQRA 4J25A 3VKOA 1GOFA 5CKMA 3MDPA 3OG2A 1Q8VA 4EWAA 2D5FA 4RQPA 3GBFA 1UMIA 1FT9A 2AH2A 1HN0A 1WD4A 1FAYA 3WVJA 2Y60A 1FNYA 1YQ5A 4R4XA 4XCAA 4XQ4A 3OYWB 1W6QB 5ACA3 4A7ZA 1UQXA 3IDBB 3DKQA 4QDRA 3ON7A 2WO7A 4FOYA 4QM8A 4XFAA 3BUCA 5SV5A 2WWUA 4ATEA 3KVBA 4CXYA 3BTZA 2VCAA 2YFUA 1QNYA 3OY8B 2KR2A 4L92A 5G05L 1ALYA 1BYHA 3ZYBA 2VULA 2Z79A 4AL9A 2RV9A 1W3VA 4EV0A 1GZTA 4MGIE 5FYVA 3INAA 5C9AC 5FP3A 2CYFA 1YQ8A 5JAXA 4NHLA 4B4RA 1XNCA 2IWGB 3KQ4B 5FZEA 1FX5A 3NRUA 1AR91 3PIJA 1H1AA 4LO5B 3Q9OA 4YG0A 3QCWA 1UZZA 3ZKYA 5JZGC 3KV5A 2ZGKA 4DEQA 1XU1A 4E4DX 3MFCA 1J1LA 3AKQA 3MV01 4JZRA 4KWJA 4RS5C 1WGPA 2NMNA 5JSPA 2OZ6A 1KJRA 1DQ6A 4XJUA 2XLAA 5FZOA 2B45X 2VUDA 1EAH2 1ZBE2 4KGGA 4DUVA 1HQWA 3VZOA 2HYXA 2J7MA 4LT5A 1JODA 4QU2A 5DN2A 1UWWA 3LB9A 1GNHA 2J22A 2XB6C 3NJYA 3UKTA 4DY5A 1AR93 5FZ9A 1DBNA 1VBE1 1VAKA 3I2IA 5FZMA 5I93A 4B7EA 5FJHA 2BGPA 5I0TA 3H9AA 4PI2A 1OBNA 1K5MA 4B1MA 2XJVA 1H2MA 2AYHA 5E89A 4PF1A 3IIIA 4BPZA 4YARA 5KWRA 1OQDA 2E9QA 2G9GA 2VCBA 3VBOA 4JGYB 3POIA 4P9LA 2AREA 1UU5A 1DQ0A 4D8MA 1CAXB 2VUAA 1ZRDA 1I9RA 4UI9L 1UOJA 1YUDA 5H9QA 4MZUA 1H1MA 4XJZA 3ZSEA 3ZXKA 1GYKA 1QXPA 2VG9A 4H2AA 1W8OA 5C70A 2BYVE 3AP4A 2P6CA 3F2ZA 4Y5SA 4YVSA 2OIIA 5DZFA 5A32A 2Y6KA 3RZJA 4CDUB 2Y64A 1VBE3 3AJYA 4LBOA 3CNAA 1PK6C 2CAUA 3ZPOA 1AX0A 1O7FA 1GMMA 5A3TA 4EZ4A 4Y20B 3WNOA 1O8PA 1NQDA 3WUDA 1LOGA 5BY5A 2ZHMA 3DYPA 1AR62 3MYXA 4OUMA 1OA3A 2VVDA 2WFF1 2JD9A 4HN1A 2ZMLA 4PT6A 2JKBA 4IE0A 1ULDA 3WDVA 4CDWC 5A80A 3AVSA 3DPRB 3E6DA 5JWPA 5CKQA 5CYYA 1GSLA 1D4M2 2DCJA 1PZ7A 1CZVA 4NIDA 4PIYA 2X09A 2PN5A 4CZSA 2ZEWA 4AHYA 4WVWA 3V56A 1ND3C 2WWSA 5LA0A 1W9WA 4Y24A 2A3WA 4ZXEA 1KRIA 5FXWA 5EP9A 2FCTA 4NRMA 2JDUA 3TEYA 3KT1A 1VJ2A 4IEWA 5FYCA 1JUHA 4CDQC 2A7AA 1YCIA 4ISQA 4ZKTB 1W6PA 4Y3OA 2WFF3 1OFNA 2OQ7A 4GMP1 2FDFA 3LPFA 5LBEA 4A41A 4QGMA 1J84A 3IAPA 2WT0A 1HXS1 3E5XA 4Q5OA 3GGLA 1Y9MA 4XF4A 5I0RA 4IE7A 2XUMA 2FCVA 3OD0A 2VD7A 2GC3A 4RGAA 3UETA 3OPTA 2YPJA 1ZZ6A 4MVTA 3GZTB 4FOQA 4MUVA 5GLUA 4HKOA 2W9XA 3UGFA 1HV1A 1VBB2 3UJOA 3ES4A 3PURA 1YFYA 2QQIA 2QQUA 3T0AA 4F7ZA 4HVQA 4Q27A 1UU6A 2Y6FA 1EUUA 5L7OB 3KM5A 4QQLA 4DXTA 4HN0A 2XWJB 1BLZA 4WBBA 1H9WA 1OUXA 4K40A 4GMP3 1GQGA 1J58A 1HXS3 2HWC1 4JC1A 5FZAA 2YBSA 3NAPB 2ZGLA 1HLCA 2HJIA 3TEZA 3ZFEA 1WZXA 1U12A 4PIZA 4D6SA 2WYFA 4P5HA 1RITA 1VBA2 4TLFA 1Z0HA 2PHRA 2B9UA 2Y6JA 3KLSA 4ISRA 4K7JA 4IEXA 2WZR2 1PIV2 4Q4X1 1NLSA 2V4VA 4B4QA 4CE8A 2Q4SA 4PDWB 3AKRA 4RQPC 1LEMA 3J7MA 2WZ8A 3C8XA 3AKTA 2JKXA 2YC2A 3H8OA 2WNVC 4M0HA 3U10A 1EPWA 2HWC3 1S2BA 1C5IA 3EBRA 1PMJX 1WA4A 2D6OX 2WBKA 1HB1A 1S0BA 3HNYM 4FPJA 4IEOA 4XTMA 4TYSA 4IEUA 1H1IA 2C6SA 3ES1A 3OOXA 3QLQA 3T1LA 4GULA 4YYOA 5JMOA 4ARYA 4OUEA 3B3QE 2XL9A 3WW2A 4DXSA 4LLFA 5AFEA 1F4AA 4O65A 5HPOA 5FAXA 3IDEA 3KV9A 2D98A 4NE9A 4Q4X3 5CNAA 1OSGA 1AL0G 2LTNA 3AFKA 2WRAA 4LHKA 1PZ9A 4XDPA 1DQ1A 5IWFA 1J83A 1WCKA 2GMEA 5JI9A 3ZR6A 3LA2A 3O0XA 1X9PA 4RHV2 3Q8CA 4F8AA 3ZVXA 1G9BA 3M1HA 3OYWA 1W6QA 3FZ3A 4LLOA 2QQNA 1CESA 2BERA 1O5UA 4EWDA 5HCAA 4E4HA 4DRRA 2FD8A 1POQA 1O6UA 1SCRA 3ZSKA 1RUG1 1X8EA 3MW4A 4YVWB 3W9AA 2XVGA 4XFBA 2R6QA 1DZQA 4AFAA 3GHNA 2VO5A 3OY8A 4NVPA 5HCFA 1F15A 1R081 3AZZA 2OPKA 3N9PA 2JG8B 3JD72 5EZWA 4AE2A 3QH7A 3NKTA 3RJRA 5K7PA 3LZZA 3NSTA 1RHI2 1XU2A 1RVF1 2DVFA 3I7DA 5IFTA 5SV8A 3TBDA 1HQLA 3J4UH 4LBJA 1PGL1 2QNKA 1APNA 5FMOL 3NVCA 1Q5OA 4QX7A 1TG7A 4A6OA 3POSA 3HMYA 5EYXA 1K5MC 4QQ2A 2R061 1RUG3 1LOBA 4OZXA 3VBFC 3WF3A 3SKJE 1DQ5A 1UZVA 3VBOC 3WDWA 1LOFA 5DUVA 1R083 1HW5A 1IZ3A 2VW0A 3SXWA 4UT5A 4IE6A 4K9SA 2A71A 3I2GA 4YVSC 3U75A 2E7QA 1UKGA 1RVF3 1ODMA 2JDAA 3KCXA 5FK8A 1NYWA 2CGOA 4FO9A 4P9YA 3V64A 2QDNA 2R042 1VLNA 1W9SA 3EB7A 3UYJA 4EE2A 1GP4A 4QHOA 2R063 3B69A 2PHTA 4L97A 4D3WA 1JI6A 2GNTA 4GB32 2WC2A 5C6CA 2VVEA 1KXGA 1LR5A 2DVAA 2QQLA 3C2UA 4Q0QA 3SHRA 1O8SA 3VZMA 1NZIA 1H9PA 1YEWA 1CAXA 1LB2A 2HKXA 2G1MA 1PMHX 4FPOB 5LASA 4XOGA 2XHNA 4V2WA 1AZDA 1V6MA 5C3OA 1OVSA 3MUZ1 1JZ7A 1SBEA 3ZYJB 1S0DA 5F1RA 4CDUA 3O1PA 3UK9A 4MH0E 2CTVA 1DP0A 3ABZA 1RINA 5T5OA 1BHGA 1YNAA 2DV9A 3KF5A 4Y20A 4P5YA 3IBMA 3ORJA 3UGGA 4B3NA 2VL4A 5FZGA 2IXHA 4MOAA 4RGGA 1FMD1 5FPBA 5I8SA 1G6NA 3K4AA 3ZN5A 1YFUA 1FV2A 5IHRA 4FTBA 1JOBA 1HB2A 4GAZA 2Z69A 1I3HA 1O3SA 2VTXJ 1UO9A 3AK0A 2MEV2 4LULA 5A3PA 5IK7A 1UZWA 1UKRA 2YBPA 2C26A 2K46A 1SDWA 4R9DA 4XJ8A 3WF0A 1G9AA 1VBD2 5CEHA 2I07B 4LBQD 3I3BA 3WINE 3RDIA 4QB2A 1S4CA 1N47A 1FMD3 2RVAA 5JLVA 1A3KA 2DU0A 5GALA 2OX0A 4OQ9A 2DBIA 1QF3A 4N90A 1DGWX 2W91A 2VZVA 3E6CC 3BB6A 3N9LA 4WVVA 5C7GA 3ZFEC 5FZ6A 4OI4A 1KEXA 1OPMA 2XWBB 3RQ0A 5JZGB 1JZ6A 3LKJA 2IXJA 1JZ2A 1CGPA 4MSVA 3HAGA 4SBVA 3THPA 1MS9A 4P9IA 5FYMA 4J1WA 3B00A 3FHAA 1K45A 1N3PA 2XGXA 1WMDA 1UOFA 3C7OA 3UESA 1OQ1A 3TYJA 5F5IA 1BVVA 3IDAA 3WG4A 2QUOA 4FPFA 1IOAA 5FKCA 3IWZA 3NAPA 3MIGA 4AEJA 3OBTA 5IJRA 4CCLA 1AR82 2DFBA 1W04A 2D6PA 2BJSA 2JE9A 3C7FA 5CVRA 3WNKA 1NQJA 1MZFA 4LIUA 3ZO0B 2ID4A 3C7EA 1ZA7A 4KI5M 4M0NA 4DINB 2WAAA 2P3IA 2FDIA 1ENXA 2P5BA 3H42B 5AVAA 1UY4A 3ZIWA 3OB8A 3WR0A 5F3EA 3KHBA 2ZACA 4CUGA 3ZLIA 3HQUA 1SLBA 1H2KA 1ZA4A 4KU7A 3V0BA 5DG1A 1WWYA 2D93A 5DUUA 5FJKA 5FWEA 2BQPA 1PK6B 1SQ4A 2JDNA 1RUJ1 5T55A 3BOWA 4IEPA 5AC91 4BK5A 1RUOA 4XAEA 2BPA2 4NOTA 2VECA 3PL0A 1DYPA 4JKMA 1E5SA 3MZHA 1UY3A 1I1EA 2JDYA 1C57A 4CDWB 2DCKA 2DTWA 4YFZA 4MXVA 2D7FA 3OGRA 4TSVA 1R1A2 1PO11 4AAPA 2ATFA 1GWMA 3FMGA 1B35A 2WDBA 3AYCA 4PQ9A 3MIFA 4LKDA 4ZPIA 5FZHA 4AGVA 1H30A 3ZYGA 1GV9A 1R091 1GNYA 1ULGA 1RUJ3 1CPMA 3RZHA 1DLLA 5AC93 4LA3A 2HWE2 3LEGA 1GR3A 3ETQA 5GZDA 1TMF2 5I0UA 1V9U2 4URAA 4MHUA 2XBO2 4OHXA 5JPMB 5L36A 2BWCA 1FOD1 3WQ7A 4G3YC 2DUQA 3WDXA 4HVRA 3EXUA 3DYMA 1Y7BA 3BYWA 1GKBA 4GZ9A 1AXZA 3WT3A 4AHWA 3VV1A 1RXFA 3VHPA 2JG8A 2NZ9A 1PO13 1HRV1 3AJZA 3ZMOA 4XJWA 1RJ8A 2TBVA 4N43B 5EV7A 1JYVA 4E2GA 2FMYA 1R093 4BQ4A 4XACA 2RS51 2ZHLA 2ZPXA 4WVZA 1C1FA 3K77A 1X33A 3D8CA 2KD7A 4N53C 2A3YA 3GCWA 4MG2A 2RDNA 1FOD3 3EJKA 1J3PA 4WM7B 1JS9A 2J1SA 1JUIA 4XIKA 2VH9A 1AYN1 3FHIB 3FBYA 1J3RA 1UX6A 4LHSA 3MV11 1JYWA 2QQPA 3EHKA 2TUNA 4XF9A 1HRV3 3WF1A 1QJX2 4COYA 4WV8A 2ZKLA 4MV2A 3MW3A 4RR3A 3UNPA 1JW6A 2NYYA 1SHWB 2VMEA 1W8HA 1BQPA 2ZABA 3LQCA 4DNYA 4CDUC 2RS53 1W06A 3SEPA 5A70A 3MLLA 3SITA 1K12A 1XYNA 2BVBA 4RA0A 3HNBM 5A7NA 3W20A 3WQ0A 1AX2A 4U36A 2QQOA 1AYN3 2YC0A 2WNVB 3OGGA 3LE0A 4TWTA 4ONUA 3T2TA 2WT1A 3CF6E 5GJ6A 1X8MA 4UF0A 5A6QA 1BXHA 2ARBA 1J59A 4QX1A 2WT2A 2XL7A 3RMXA 3RVHA 5GZGA 1X50A 1TQ5A 1YJLA 3E6BA 3M3IA 4NWWA 5I8YA 3D0JA 5J96B 2N7GA 4JCKA 3VZLA 4EYUA 5J1XA 3KS7A 1MQTA 1ASJ1 2OA2A 3R4UA 4N7IA 2VMCA 4LK7A 1RUH2 3ACIA 3B93A 2PELA 4V2VA 2HEYF 3KWVA 3O0WA 2ZX0A 4MGYE 4CCEA 2A6VA 3JZVA 2E7TA 2XHKA 3T09A 3I59B 3VD7A 1XPWA 3VBHC 3DEMA 3ZIXA 1S55A 1C1LA 3URFA 4IE4A 1NCRA 3MO4A 3POWA 5IT6A 5A7PA 1S0EA 1ASJ3 2IZWA 2ZOEB 5F5QA 3ATGA 5FZOB 2ZZJA 1C8NA 2AGSA 4OMDA 5FR3A 3ACHA 2VY0A 2IXKA 2X53S 4UXAA 3THDA 2GC2A 2VTFA 3VD4A 5FY0A 3MF6A 3ZR5A 3H7JA 2OKXA 4AQSA 2XH6A 3NAPC 2VMDA 1HQNA 5FYUA 1V6NA 1XE0A 1YQ6A 4KWLA 3K4ZA 4O61A 2JECA 2PHDA 2JIJA 3GXUA 2Q1FA 3VBFB 1VAVA 2NLRA 4UFLA 4NRQA 4BYYA 3GNEA 3AZYA 1D2SA 2CDPA 2OYZA 1XYPA 1EV12 5JXGA 4KMQA 1XNKA 4IGOA 2VZPA 3BGAA 3GZEA 4Q4W2 4X6QB 5FPUA 2DUPA 1XC6A 1UXZA 2A3XA 3A23A 5T5JA 3OJBA 4QKFA 3MW2A 1KFUL 4YVSB 5J3UA 1W8FA 4BH9A 5DZEA 2V72A 1TEIA 2Y0IA 4DMIA 1FV3A 2QQVA 1UIJA 4CU9A 1VMHA 1IPSA 1O91A 3D3AA 2Y34A 2YGLA 5FUIA 2ORXA 3ZFGB 3C7HA 3N9NA 4R8HA 3UT0A 2ZAHA 4FI9A 4CP0A 3CHXA 1ZVFA 1W2OA 2F17A 4R4ZA 3VZNA 3ILNA 1JBCA 2JG9B 4KBBA 1WW7A 4MGKE 4XMAA 3O1SA 1D4M1 1P8JA 1QGLA 1ACCA 4CVUA 4S2GA 1B35C 5HCBA 4CP9B 4BQ5A 1JHNA 4LQRA 1YHFA 1JYTA 1ZM1A 3CO2A 4HZFA 4QGNA 2BRTA 4COZA 3JUUA 1PVC2 2H0BA 3KVAA 4DS0A 4BDVB 3O1OA 1W6PB 1SLLA 1C5HA 2VE1A 4BM8A 5LK7B 4A42A 1RUE2 3GM8A 4XAAA 4AF9A 4BU2A 1DG6A 1JZ5A 1RTVA 1XSRA 2WR9A 1WBLA 3G6JB 3THTA 4CDWA 1RUI1 4AEDB 3BCWA 1R64A 1O4TA 1D4M3 2JG8C
chains in the Genus database with same CATH topology
2ZTNA 2YUEA 2LUWA 2WSUA 4IEVA 1VBB1 1MEC2 2WIIB 5BNNA 1WLWA 2GZWA 2UY8A 1UZYA 4PLOA 3HT2A 1QNWA 4Q0UA 1QKQA 2GMMA 1RUI3 3NW4A 3PVOA 2DVGA 1HDKA 1RL3A 1YXWA 3ZFEB 4RR3C 2IFRA 3O7OA 1V6IA 2ZKNA 1VBB3 3FLPA 4OLLA 5H9SA 4N43A 1PIV1 3N35A 1B09A 3TB0A 1NLRA 4WM7A 5BYNA 2VOWA 1QHDA 5JOYA 4EN6B 1LJ7A 1X36A 3SNMA 2BGCA 1PMIA 1J3QA 4AI1A 1QJU2 2ZA9A 1XXNA 4LUKA 5IUQA 2B5HA 1MQTC 3LOBA 4QT6A 1PIV3 4JDOA 4YW5A 2V73A 3ZXLA 1OA2A 1UPIA 2IXIA 4HT1T 4X8NA 1GFF2 2UYAA 1DGRN 2VNRA 3WY6A 1RJ7A 1ZRCA 2QJVA 3LGRA 3IKWA 4RHV1 3O14A 2WNVA 4E2SA 4ITCA 3J9SA 2QDRA 4XFCA 4QD2A 5T5LA 1GZWB 1NCRC 2WA3A 3JCIA 2GAUA 4HLTA 4C91A 1QY4A 4FPYA 1N3OA 2GC1A 1BMV2 1QDCA 1AYM1 2K2SA 3JD71 1SFNA 4C0BA 4RHV3 1AUYA 2EALA 1XNBA 4Q4Y2 5EXOA 3D82A 3I59A 2AZ5A 4G4FA 3JBG2 2YGMA 4R9CA 1H4GA 1AR72 3D5OA 4FAHA 4M3CB 1RUF2 4FPCA 3CJIB 4XZPA 3RYKA 3SLIA 1AYM3 4HKWA 3JD73 1ZZ8A 4HANA 4Z07A 1OLRA 1SLTA 3KSCA 2ET1A 4COVA 4NO4A 4E4SA 3ZX7A 2RS32 5CFCA 2ETEA 2FHRA 2R041 4PLMA 2XJPA 1LGNA 3N36A 3NL1A 3N7KA 1V00A 4N53B 1GLHA 4GB31 4XIOA 1MS8A 2ZS6B 4Q0SA 3VBFA 3I8TA 3R4DB 4IV3C 4S2HA 2O1QA 5LK5A 2K9ZA 3P3NA 2B42B 4DB5A 3TNPB 1HX6A 4L99A 1AL22 4U2AA 4AVVA 2JICA 2O8OA 2R043 1SMVA 2H0VA 3LSDA 4META 3WW4A 1N1VA 4C1WA 1KD7A 1C8M2 3ZFGA 4GB33 4Q4V2 1VBC2 3U0ZA 2EXHA 4B29A 4D7YA 4NN0A 4BQ1A 5JIAA 5CIRA 1QDOA 2JG9A 4CEWA 2UWAA 3ZDSA 2RMU1 3WP5A 1SBFA 4LEJA 4XFIA 4LO6B 3WW1A 4N7UA 1UL9A 3VKNA 3TN92 4Z2WA 3H3UA 1BBT1 4K6BA 5BNNC 5FO7B 4QQHA 2WS92 4UW4A 1VBD1 3JU9A 4RD7A 4E9KA 2BBVA 2WSVA 1OHFA 1LHNA 3H1YA 1RC6A 5T3NA 4HVOA 1EYBA 1ZRRA 1UCXA 2VW1A 5E1RA 3I2DA 3VBHB 4IV1A 1NY71 3ZN6A 2NM1A 4AEDA 5FLJA 2RMU3 2PA7A 1WLDA 4AK3A 4N43C 1IHMA 5JI7A 2DF7A 1BBT3 2ZGMA 2R30A 4CDXB 3WCSA 1VBD3 2R1BA 2VOKA 1N3QA 3J8F1 4YRDA 2WINB 4NPRA 4WM7C 5IK4A 4BA6A 2PHFA 2DYCA 1UD1A 3ZN4A 3OBRA 5IK5A 1Z78A 4HL0A 4JGZB 5CA6A 4XE9A 1BVP1 4JTNA 1VRH2 1GZCA 3R0RA 4DOUA 1F9KA 2RR12 4YW3A 2UU8A 4DQAA 1F5JA 3AFGA 3J8F3 3POYA 2ENRA 3M3CA 3V0BB 1ZBA2 4LHLA 3ZSJA 3AKPA 3M7AA 2ARXA 2GNBA 1J1TA 1U5ZA 2R1DA 5GLZA 3AP9A 4XPVA 2C0ZA 3B9CA 1LHOA 1OLQA 2ZX3A 3NV1A 1VB2A 4HETA 4FP2A 3KQRA 5GZEA 3I54A 1XYOA 3VBUA 1FI2A 1R1A1 2HWD2 1B35B 5GLTA 4XEZA 3H7YA 4WVMB 4JRLA 4XQDA 1ULCA 4UW6A 5FREA 1TMF1 2IC1A 4BOWA 1C28A 1GZWA 3MPBA 5ACA2 2ZGOA 4E27A 4XF3A 1S0GA 4I3GA 3CJXA 3A0KA 2PHXA 5JSRA 1FATA 1XNDA 1R1A3 5ABJA 1H4HA 1S0JA 3WG3A 4XETA 5KHGA 3KT4A 1X82A 5CFCC 3H50A 2FZ2A 5T52A 4XJ9A 3S6PA 1SLAA 1TMF3 1Q8PA 1RMU1 2UWBA 1H8TA 4YNIA 5FFOC 4M3CA 3CJIA 3D0SA 1I6XA 1WBFA 2Q8OA 4Z82A 1W2UA 4I3PA 1QJX1 1HRI1 2YHJA 4UW5A 5D8AB 4ZU5A 4RR3B 2F4PA 2EXIA 2PYTA 4JAAA 4AGRA 1RMU3 3ZFGC 4MLOA 3VN4A 1BKZA 1XE8A 4N53A 4LBLA 4Y1XA 4IETA 4L8QA 1DGLA 2R071 4BCUA 5LEKA 4CEWC 2JG9C 4Y26A 2XJUA 2XKOA 1Y43B 1QJX3 1HRI3 2P2KA 3AZVA 4L11A 1G8WA 4WZCA 4Z8BA 1IS3A 1O5LA 1MQTB 3BODA 3KGLA 4BIOA 2VMIA 1RUH1 1VBE2 2Q0AA 2D6LX 5CU1A 3M70A 5CAZA 2JDZA 2JENA 5BUVA 3ZPYA 1Z7S1 3RRDA 4FPLA 1POV1 2R073 1LULA 3GBWA 4K8FA 2A70A 1S0FA 3ZSLA 1ZZBA 2RS12 3OPZA 4IV1C 4KL1A 3RI9A 4GMP0 4AEDC 1NCQA 1YI9A 1O3TA 1NCRB 4I0WB 1M06G 4IXLA 2VW2A 5EWSA 4AYUA 1RUH3 4A7YA 4LE3A 3O0VA 3RI8A 2HEVF 4R52A 4XHBA 1Z7S3 1POV3 4EN8B 3WOGA 2HWF2 2WFF2 2EF6A 1F8VA 2AR6A 1V70A 1FPN1 3VBHA 4DPNA 5L19A 3I4IA 2D3SA 4YG3A 2GNMA 1RUC1 4XJAA 1GANA 2XLGA 3O5SA 1EV11 1LU1A 1XE7A 4KWKA 4CDXA 2HWB1 3ASIA 1VAMA 2HYKA 1UIKA 4IERA 3KZ4C 1SACA 1QMJA 3APBA 4TZDA 3RPQA 3AYDA 3K51A 1FPN3 3IT8A 4ORFA 3FX3A 4QXKA 1XRUA 1N1TA 4CTEA 1HXS2 4JGZA 3AP6A 1RUC3 2P3KA 4JDNA 5CG8A 3QOPA 4FOWA 3N3HA 3AMPA 1OA4A 5K8SA 4YZ1A 1EV13 4IV3B 4ATFA 4LNVA 2HWB3 4QM9A 1YI7A 3VBUC 1LODA 4D94A 4HPKB 2EAKA 4AVSA 4JDMA 4M00A 4QX5A 4I01A 3AYAA 3AMNA 4XILA 1U5YA 3USSA 2ZX2A 2R32A 3FJSA 3AXEA 1CAUB 1URXA 3WX5A 4GWNA 3BIWE 2HWC2 4XF1A 5BXXA 1RUD2 1RB8G 4ASMB 2OUJA 3SCFA 1QWRA 1U5IA 3DF0A 1YFXA 1MZEA 1JN2P 2BVVA 1MZ5A 4AVBA 5C4WA 1F5FA 5ABJC 3TWIA 4Q0PA 1LOEA 3AX4A 1QJY1 2QZ2A 4XTPA 4MX3A 1ND2B 4DY3A 1MEC1 2RJKA 3G7DA 2P3JA 4WVMA 5CADA 4OI2A 1WLTA 1CVNA 1QH7A 5BNNB 4AFBA 1ENSA 3KGZA 2CL2A 1CJPA 1DYKA 1UN1A 1H8TC 2XJQA 2ZGUA 4DZGA 1C4RA 1CD3G 2CWSA 1KJLA 2FBEA 3CJIC 4IEZA 4YZ2A 3LCPA 4HSJA 2ERFA 3CL1A 4LE4A 4D7SA 1W6MB 3DL3A 5FOBB 2D44A 5DDJ1 2XLFA 1KDMA 1QJY3 1MS3A 5KBFA 1MEC3 3WHTA 3HWJA 4XXPA 1YIFA 3FLRA 2GMPA 5EYYA 1IS6A 1O4YA 2WL1A 4YSFA 2O0OA 4WM8A 1RUG2 5I8TA 5A3LA 1H2NA 3AXDA 3DUIA 1AF9A 5DDJ3 1SLIA 1R082 3H1WA 2MHFA 2FZ1A 1ONAA 1WD3A 5KHJA 2JE7A 1IKQA 2C9AA 5D8AA 3PVEA 1ENRA 1OMIA 1QQP1 1QXRA 3N7MA 5CB7A 1BEV1 4XMIA 3BALA 1RVF2 2LALA 5BPXA 1OI6A 3RJ2X 1OOPA 2EA7A 4AEKA 2F6BA 1AX1A 3IN9A 2R062 4LTAA 4J6GA 4MXWB 4BLJA 4I0BA 3ZMNA 1NCQC 4A7KA 5A3MA 2PAEA 5KC5A 1QQP3 1IS5A 3OGJA 1BEV3 1W6NA 1KQRA 5K9YA 2YZ4A 2DCYA 2E51A 3TRSB 5F9TA 1LHVA 4CP1A 2C1FA 3DV8A 3ZN6B 1DF0A 5FTTC 4BMEA 4Q4Y1 4V1PA 4AVCA 2BEOA 4H55A 5K0UA 1A6CA 3IM0A 1WCDJ 3JBG1 4LR4A 2ZCWA 5JCTA 1LGCA 4O9EA 2WNUA 2WZPP 3RS6A 3ZFFC 1HV0A 3SMHA 4BE3A 5FPXA 2R0HA 4IESA 4CRQA 3AP7A 3IDCB 4YLZA 2JXAA 4CDXC 1O4ZA 4XDQA 3GZUC 2CAVA 1EAH1 4FQ4A 1ZBE1 4XHXA 1KS4A 3RMYA 4MGZE 3ZYPA 4Q4Y3 2RS31 2RM22 4CYDA 3R6SA 5CFCB 1CR7A 2LM3A 1V6OA 3JBG3 3WDTA 2VNOA 1FMD2 2GSYA 4JGZC 4XFGA 3S0MA 2YV8A 3MIDA 2YYOA 1REDA 2E7AA 3LA3A 1NG0A 5CBLA 4GKXA 2GN3A 2DU1A 3NV4A 5FRAA 2VOXA 1EAH3 2WNEA 4JVAA 5HBAA 1ZBE3 1AL21 3TOJA 5AVPA 2RS33 3RWNA 1OQEA 5FLHA 4AG4A 3BOPA 2ZHKA 2VPVA 1SEFA 4Y4YA 1H0BA 3GZAA 1AR61 1DGRA 3V0AA 4GALA 1Q8OA 4RFT0 5C8CB 2P17A 3A4UA 2ES3A 4EN7B 1MR5A 4IV3A 4AHZA 1IPKA 5C4WC 4CEWB 1OKQA 1AL23 2ZHNA 1MZ6A 2WQZC 4HPKA 3GF6A 2AENA 3OTFA 4YFWA 2UY9A 1JOJA 3D4KA 3TN91 3QD6A 4GQ7A 4RL7A 2XJSA 1CAUA 2CV6A 3LA7A 2PHWA 3PJQA 1AR63 1VALA 1UU4A 2QE3A 3USUB 2JD4A 5JMCA 3PTYA 2Z42A 4ZU7A 3MICA 3CEWA 2CGNA 1TNRA 4IV1B 3MIHA 3SH3A 2R0FA 2WQ4A 2Q1ZB 1PZ8A 3TN93 1W39A 1ND2A 3ZXDA 5F6LB 3W59A 1WW4A 2RJLA 5JPNB 2OW4A 5GLVA 5KHHA 3WNXA 2P34A 3WD5A 1S0IA 5E88A 4BLIA 2OUHA 2ZGRA 1W6OA 5AC92 3NJZA 4QPGB 4WM8C 1FXZA 4QQOA 4AI3A 3FWEA 4H7LA 2X8KA 1TE1B 4OI0A 1JTZX 5J48A 1W6MA 3ST7A 4FSJA 1GICA 4IL7A 1WMEA 5D8AC 1F2NA 1VBA1 4P9JA 4LO4B 5DXDA 4A3XA 3KT7A 2WZR1 1R092 4D7TA 1U0AA 2D6KA 1OOPC 2Y0OA 1OFSA 1AVBA 2I2SA 3CU7A 4FXKB 1DQ4A 3WP4A 5JDBA 4W6YA 2D3RA 5FQ0B 2KXLA 4AFMA 3NV2A 1NXD1 1VBA3 2ZX1A 1IPJA 1HRV2 2QVSB 1TME2 3T1MA 3L2HA 2WZR3 4H14A 3VBSB 4B7KA 3VBUB 1KITA 1NZCA 1YRZA 4E2QA 5A33B 2HWD1 1CAVB 1YWKA 2A73B 3PLQA 4MXWA 4LBKA 5K0UC 1AYN2 1D2QA 1H2LA 1AXKA 3PMEA 2WNUC 4GIQA 4YM0A 1MS5A 1G9FA 2BFUL 2HEWF 3NWKA 3VKMA 3WHUA 4XFFA 3VDDB 1L3JA 4K20A 4FOVA 5FOJB 2DVDA 2OZJA 1RUNA 5ABJB 3RNSA 4OVEA 2HWD3 2GNDA 5JSOA 1RHI1 3VBRB 3ECQA 1LECA 1QH6A 1N1SA 3WP3A 2B8MA 4Y1ZA 1H8TB 4GXLA 2IXLA 4QPIC 2ZAAA 3VLBB 3MEPA 5KHKA 2R49A 1KFXL 1ASJ2 1WW5A 1LESA 1RHI3 1Q8QA 4G9SB 5DG2A 4OI1A 5LRRA 1X7NA 5CFDB 3U11A 4EWEA 2BW8A 4CEYB 2GH8A 3WQ1A 5H9PA 3IPVA 1NE4A 5I91A 4YW1A 2IXCA 4LBQB 5DUXA 3BPZA 2ZJCA 2PAMA 4B8EA 2PHLA 4JTOA 3HQXA 5HI0A 5BNOB 1A8MA 1CX4A 2WFPA 1EP0A 2QCSB 3FE5A 4JV4A 1TNFA 1PGSA 3UJQA 2XKPA 2QZ3A 2MNGA 3M3QA 2XVLA 1V6KA 4LHNA 5FO9B 5D1IA 2PLV2 2CY6A 1OD5A 2PHUA 3HR9A 5FPZA 5C8CA 1GQHA 5CG9A 1PO22 2VQAA 2C5DA 2RHPA 2RS11 3FLTA 5J09A 1NCQB 1DU3D 1H8VA 1LGBA 1MVEA 1MS4A 1ND2C 2MEV1 3WP6A 4AQTA 1SFYA 5AFBA 4FTEA 1LOAA 1SBDA 3OCPA 3VZJA 3D6EA 2H6BA 4LO8A 1SCSA 4QGLA 1VB4A 1PM7A 1RGSA 3MLJA 1DZRA 2WKKA 2XJRA 5J98B 3WDUA 3L2YA 4Q1PA 2X29A 3USUA 4FAGA 2AUYA 4XF0A 1JYIA 3W58A 3WZ1A 4HFSA 2HWF1 2G4IA 3N7JA 1D4VB 2RS13 3NKGA 2A6WA 2MPFA 4AHXA 4J1XA 3ZFFB 5B2GB 2MEV3 3HN1A 3E5QA 4QQPA 4AW7A 1COV2 2JJ6A 1DDLA 3PMSA 2XVKA 1A8DA 3K48A 2BWAA 1QXJA 4QPGA 1GNZA 2HWF3 1ZX5A 2FQPA 1YIPA 4YZ4A 4K1ZA 4B4PA 1HIXA 3A0NA 2UYBA 1UAIA 1AR81 3WUCA 1RUI2 3FUOA 1WUVA 1YYNA 2BFUS 2V5YA 4M01A 2WLQA 4SLIA 1PGW2 3MIEA 4BHPA 4GKYA 4ES9A 3MI8A 4AFCA 2VMHA 1E57A 2G9FA 5JOWA 4AQ2A 4X8PA 3VHRA 4PCRA 1DFQA 4KQ7A 5JIUA 3M8LA 1AR83 3ROUA 3MF9A 1V6JA 4FXGB 5BNPB 5FQ0A 1RUD1 1QOTA 1NA1B 5KHIA 3L9JT 2Z2SB 3VL8A 1O3QA 4NR1A 4HMZA 2W0XA 4XXAA 4IEQA 1U5XA 2FMDA 5C4WB 3AZXA 2VUJA 3VBSA 5A33A 4F3JA 4Y22A 4I09A 1CAVA 4YGDA 2OVUA 2VOVA 3WCRA 4LO7A 2X5IB 4OHYA 3E97A 1EY2A 2GDFA 1RUD3 2HWE1 3EQEA 3KMHA 4OULA 1V9U1 2XBO1 1IKPA 3AM2A 1Q8SA 1PHMA 3SISA 4Z1VA 5T50A 1ENQA 3VDDA 4K21A 3ILFA 2ZGTA 4I2OA 4FPHA 1MS1A 3M3EA 5GZCA 1I5ZA 2KM2A 4UW3A 1VR3A 4BMBA 2ZZQA 1T6GC 4PF5A 3VBRA 3HT1A 4N9IA 1Y9QA 1IGOA 2HWE3 3J26N 2ZMNA 1V9U3 2WJSA 2XBO3 2GC0A 4AI2A 4AFDA 4WM8B 1Y3TA 2YY1A 3NO8A 4AXOA 4F83A 1LU2A 1AYM2 3ALQA 1FYUA 1CIWA 3H3ZA 3MGUA 2D43A 1AJKA 1QJZA 2GN7A 1W0OA 1LRHA 5C33A 5CFDA 1BZWA 3C3VA 4W6XA 1AR92 3RYRA 4CEYA 1C3HA 1ZNPA 1OOPB 4O9GA 5IK8A 3KD4A 1WW6A 4AVTA 3SCHA 5C8CC 4XBLA 1QU0A 1YO8A 3SH5A 3N4MA 4LBQA 3EO6A 3BU7A 3FC0A 4FCAA 1REEA 1O3RA 5BNOA 4KU8A 4GH4B 4P14A 1A78A 3U07A 4YM3A 2A6ZA 2Z5WA 1UW8A 5KXEA 1V6LA 1W6NB 2D97A 3DKWA 2O8QA 1ZYBA 4XFHA 1AXYA 2I74A 1KS5A 3B02A 4KG0A 1D0HA 4S2DA 3BTAA 5C8WA 4N9HA 2BNNA 2NQYA 3ILRA 5K0UB 3PJYA 3JB8A 4JGYA 2WA4A 2SBAA 2BTVC 2WNUB 5FBZA 4FBFA 1YJKA 1G9CA 4ZU4A 4HK9A 1DQ2A 2ZGNA 5E8AA 4AI0A 5L73A 1BJQA 1M4WA 1S0CA 5JOZA 4OFGA 4H7MA 2E63A 3B7MA 3GYDA 3LAGA 4QPGC 2RM21 1D0GA 2DFCA 3VKLA 4OHVA 3HBZA 4R9BA 3QH6A 1BK1A 2QKDA 2VU9A 3ZXFA 4NHKA 4ASLA 3DPRA 3ZFFA 4C0HA 4YGBA 4L9BA 2DCZA 2B46X 5J7MA 5EFUA 2RMU2 3S7IA 4QPIB 1CPNA 2YMZA 4LBMA 5T5PA 4WZFA 1ZREA 4P9GA 1BBT2 4Q4W1 2V09A 1MVQA 4QHBA 2RM23 5C9AB 2GH2A 3ZXJA 2KA3A 4GA9A 2EXKA 4P9WA 4Q8KA 2DWRA 1R1ZA 3M3OA 4AI8A 1NY72 3V0AB 2D6NA 2ZGSA 4RS5B 1PVXA 4JRAA 3MIBA 4YGCA 4Q4W3 3VBSC 4W65A 2DURA 4FPGA 2P37A 4S2FA 3VHOA 4XBNA 1CQ9A 5L7OA 1PNFA 4M3CE 3PVNA 2PFWA 3B01A 3J8F2 4Q8LA 2SLIA 4FPKA 4NWVA 2IFWA 5BNPA 1JYCA 1PVC1 5EJ3A 2A6XA 3WW3A 3DGTA 4M3CF 5J37A 2UURA 1NA1A 1OPOA 2YXSA 1RUE1 4I0AA 4NHMA 3TNQA 3U4XA 1PNGA 3VDDC 2NPIA 4HKLA 4YG6A 4W6WA 2A75A 1CAWB 1CONA 3IMNA 3PVBB 1DZTA 4PBOA 4Q4X2 2ZMKA 2R16A 4MYEA 2ET7A 4PDWA 5GKAC 4LA2A 2W39A 4D69A 1GBGA 3UL2A 3VBRC 1WMFA 1DGWA 5FO8B 1JXNA 3ACLA 1UMZA 2X5IA 3B9IA 5FMOS 1PVC3 3AB0A 2B39A 1RIRA 1W6OB 4EN0A 4OHWA 1RUE3 4Y1YA 4Z92B 2Q5TA 3ENRA 2RE9A 3V65A 3O12A 5LEJA 3E5UA 3FBMA 1ZZ9A 1GZ9A 4YGEA 5BNQA 1ZZ7A 2DUOA 3VKFC 2ZGQA 1HKDA 3AYEA 2EVXA 2ILMA 5GM0A 3LSEA 1CJDA 4BIFA 1G86A 1ND3B 5CFDC 4AQ6A 2GU9A 2E53A 4CEYC 2CWMA 1KDKA 4YZ3A 5T54A 4CDQB 2JEMA 2JX9A 2Y38A 3JB4C 4X6RB 4YVWA 4DFSA 1LOFC 5HXVA 3VGIA 4COUA 3KCCA 4KH9A 4OHZA 1F31A 5BNOC 4E4ZA 3GALA 1LEDA 1QJU1 3AKSA 1G9DA 4BZ4A 1TME1 2YDEA 5FDBA 4I02A 4A2UA 1DHKB 4K1YA 3AMHA 1PGL2 2D3PA 1LCLA 3ME2A 4IQPA 3B5LB 1RMU2 2K0GA 1G7YA 1ZRFA 3GHMA 3ZYIB 5BV6A 4JGYC 2ZX4A 4C1XA 1NXMA 2B7YA 2QFEA 1POV0 3UV9A 4YM1A 5J36A 1AJOA 1Q43A 4GH4A 4AWDA 3IIAA 1QJU3 2VVFA 1HRI2 5JOXA 4GWMA 1LHWA 4KG8A 1TME3 4P9XA 3WLUA 4YZ5A 1ULFA 1BCXA 1BMV1 4K3UA 4Y1UA 2WLPA 1S1AA 3P3PA 4RQPB 3HIFA 2TNFA 1S2KA 3ZXAC 1NOVA 1JH5A 3ZXEA 2R072 2TEPA 3DPRC 3QACA 4Q26A 1AR71 4FPEA 4DRVA 1SLCA 2VNGA 1LKNA 1N1YA 3FFZA 1RUF1 4RSUA 4EN9B 1YFWA 1UF2C 1ZZCA 1MACA 3M4FA 4LBNA 5FLIA 2VGDA 2NP0A 4Y1VA 3AP5A 1LHUA 4AGGA 4UBHA 1NE6A 4PIXA 3FUQA 1LENA 4XBQA 2VXRA 1Z7S2 1IS4A 4UBGA 5H9RA 2XJTA 3IPVB 1AR73 1VP6A 2W68A 4KNCA 3ZXGA 1RUF3 2Q1MA 4EJRA 5E16A 3JQWA 4QPIA 1LTEA 3LOIA 3R05A 4Y5Z0 1REFA 2ZGPA 3AMQA 2VQ0A 5FCCA 3WV6A 3RSJA 5L7OC 5GLWA 4DXZA 3ELNA 1IQAA 5C9AA 1EPZA 4QMAA 4HK8A 1DIWA 3KCYA 5BNPC 2PLV1 1C8M1 1FPN2 4Q4V1 1XQNA 1LOCA 1NA1C 1K5MB 4FTSA 1VBC1 2PTMA 3RG0A 2CGPA 5JZGA 1RUC2 3X29B 5F6KA 1PO21 3WG1A 1Q56A 3VBOB 4RS5A 1QOSA 4QPYA 3VUOA 5KC6A 2Q30A 2HWB2 4PDWC 2ZBJA 3B94A 3UKVA 5A32B 5LRSA 2GALA 3GBGA 4I30A 2X5IC 2PLV3 1C8M3 4PBPA 4BWOA 4L2NA 2WS91 2PQQA 3MPPG 2E6VA 3OF1A 2CNAA 1VIWB 4Q4V3 5KXDA 4URTA 2Y26A 1VBC3 1ULEA 3VHNA 2EAAA 4LUMA 1PO23 3SCGA 1WCSA 3RZZA 5TSWA 4C90A 3VZKA 2A6YA 3N7LA 1CAWA 2D5HA 1Q3EA 2D6MA 4HSLA 4Q2FA 3ZYRA 2XPJA 3TAYA 4YW2A 4PJYA 3R4SA 3KB5A 1COV1 5JVVA 3VL9A 4FVVA 2WS93 1PK6A 3S30A 3PNAA 4ES8A 2YROA 1RUJ2 4PLNA 3FFQA 4COWA 2BNOA 1FNZA 4YVWC 1CN1A 4FP3A 3LWCA 4IEYA 4XW3A 2BUKA 2I45A 3H1MA 2BNMA 3S7EA 4Q0VA 4OUSA 4INDA 2A5ZA 5GZFA 3RYPA 1VRH1 4FT8A 3HD8B 1QJY2 1COV3 1PO12 1PGW1 4YM2A 3NV3A 2RR11 1ND3A 2DCTA 4HBNA 3MLKA 2DTYA 4XYXA 2H6CA 1AHSA 4CDQA 3JQXA 3CLPA 1WLCA 4XQWA 1ZBA1 4AVAA 1FOD2 3QBQA 3ZSMA 3WDYA 3OD4A 3WG2A 1UPSA 5I0SA 3H8UA 3UKNA 4GH4C 1VRH3 4R9AA 5DDJ2 4EROA 3M2MA 2D40A 3PHMA 2RR13 2NN8A 2VMGA 2W08A 2W52A 2PAKA 2RS52 2EIGA 2EXJA 4FQZA 4ZXKA 4Y22B 2NMOA 3MFAA 3SH4A 4CP2A 1W0PA 2DVBA 1ZBA3 4YW4A 5KXCA 5KXBA 4Q1RA 4AEMA 2XG3A 5ACA1 5DZGA 1QOOA 4KGQA 3WXPA 2UWCA 3AZWA 5JR7B 1QQP2 1MS0A 1YLLA 3AMMA 3DN7A 1BEV2 3H0OA 4Q29A 5DUWA 4JQRA 3VKOA 3MDPA 1Q8VA 4EWAA 2D5FA 4RQPA 3GBFA 1FT9A 2AH2A 1WD4A 1FAYA 3WVJA 1FNYA 4R4XA 4XQ4A 3OYWB 1W6QB 5ACA3 4A7ZA 4XFAA 3IDBB 4QM8A 4FOYA 5SV5A 4ATEA 1QNYA 3OY8B 4L92A 1ALYA 1BYHA 2VULA 2Z79A 4EV0A 4MGIE 3INAA 5C9AC 2CYFA 5JAXA 4NHLA 4B4RA 1XNCA 2IWGB 1FX5A 1AR91 1H1AA 4LO5B 3Q9OA 4YG0A 3QCWA 1UZZA 5JZGC 2ZGKA 4E4DX 1XU1A 3MFCA 1J1LA 3AKQA 4KWJA 4RS5C 1WGPA 2NMNA 5JSPA 2OZ6A 1KJRA 1DQ6A 4XJUA 2XLAA 2B45X 1EAH2 1ZBE2 4KGGA 1HQWA 3VZOA 4LT5A 4QU2A 3LB9A 1GNHA 3UKTA 2XB6