2FDJA

Crystal structure of alkb in complex with fe(ii) and succinate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
207
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase
total genus 49
structure length 207
sequence length 207
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdjA00
3I49A 3I3MA 3RZJA 4QKNA 3RZGA 4NIGA 4ZS3A 3T3YA 4O7XA 3RZMA 4OCTA 5DABA 3T4VA 3H8RA 4IDZA 4IE4A 3LFMA 3O1MA 4JHTA 4RFRB 3H8XA 4NPLA 3S5AA 3I2OA 3T4HB 3RZKA 2FDGA 4QKDA 4IE0A 3O1VA 3BTXA 3BTYA 4NIDA 4IE6A 3RZHA 4NIHA 4NPMA 4NJ4A 4QHOA 4IE7A 4NRMA 3RZLA 3BKZA 3BI3A 4QKFA 4NRQA 2FDHA 3KHCA 4O61A 3O1TA 4NIIA 3BTZA 2FDJA 4IE5A 3KHBA 3I3QA 3S57A 3BUCA 4QKBA 2IUWA 4ZHNA 3O1SA 3O1PA 4CXYA 4NRPA 3BIEA 3O1OA 2FDIA 2FDKA 4CXWA 4CXXA 5F8PA 3H8OA 4MGTA 4ZS2A 3O1UA 3BU0A 2FDFA 4NROA 4MG2A 2FD8A 3O1RA
chains in the Genus database with same CATH superfamily
1TQ5A 2CSGA 1U0AA 2FCTA 5FY9A 2HWE2 2Y6LA 2Y26A 4LORA 3MUZ1 4YZ3A 4DEVA 3ELNA 4CP9B 3LDKA 1PO12 3VKMA 4DO0A 3P6BA 4YW6A 3RFRA 3KHCA 2YHJA 4BQXA 3AKSA 1PMHX 3CEWA 1W2AX 4QMAA 1TMF3 5B4XA 4RYDA 5SV8A 5JCTA 1J59A 3X29B 3WDWA 1W9WA 4Q0PA 4P9YA 1QU0A 4QB6A 3UKVA 3LCPA 5IAXA 5FZFA 5A80A 2BTVC 4FPCA 1KDMA 4XHXA 1GZTA 2WNOA 3M3IA 2PA7A 3NQHA 4G9SB 4BQ4A 3VBFB 1LGNA 5AFEA 4IEOA 1GQPA 3IPVA 5A3MA 3KT4A 5F6LB 3IIAA 1OA3A 1UZYA 1XJAA 1ZX5A 1MPXA 1BK0A 3KM5A 4IV1C 2RS12 2VNRA 2X5IB 3VD3A 4Q8KA 4FTEA 1OSGA 3LDRA 4INDA 1PK6B 4Z1VA 3NWKA 2YPDA 1C8M1 3EYPA 2WAOA 3TAYA 5IK7A 1RITA 5JMCA 1WLTA 4IQPA 4LXLA 1GSLA 1JOPA 3IMMA 1FMD3 1LRHA 1H1IA 3J4UH 3LA2A 5C8CA 3RS6A 1Q8SA 1ENQA 4GB32 4BMEA 5I93A 3QLQA 1SDDB 1HB4A 2R073 1IKQA 5IVCA 1KXGA 1CZSA 1PZ9A 2ZOEB 1PIV1 3H1WA 4EZHA 1RUD2 5D8AA 5FZOB 1UPIA 1LGBA 3MFCA 4MOAA 2WZR1 5JAXA 1HQLA 4GWNA 5ABJA 1BZWA 1FATA 3I2HA 3PHMA 3VB9A 4RR3C 1O8PA 5IVBA 1HRV1 1SACA 1V6KA 2V73A 1JZ8A 4Y3OA 3CBNA 4Q8LA 4HVRA 4GD4A 1RVF2 5T5OA 3A4UA 4AVTA 4HZFA 1OHFA 1W8TA 1F5JA 3BODA 4FOVA 4FP3A 1GV9A 1LESA 5CISA 3ZXEA 4XDQA 3KVBA 4Q4V1 4B7EA 3B3QE 1WMFA 1W2UA 2UWCA 4YW7A 4AEJA 4ET7A 4EWEA 2VR4A 3DXTA 4YG3A 3O1PA 1W28A 3I3DA 2YBPA 4M3CE 4QHBA 5CKQA 4YWAA 3ZXJA 5A1FA 1RUE3 4LLFA 2VZVA 4GXLA 1GP5A 1W8WA 5D1IA 4P5HA 1LOEA 4DEQA 2RM22 5LEKA 3N7JA 1BK1A 4NHLA 5FYBA 1WLDA 3W5MA 3IDCB 3ZKUA 2B5HA 1TME2 2KA3A 4K1YA 4XZPA 1F2NA 2D6NA 3IPVB 5EWSA 5FY1A 5GLZA 3ZXFA 2B4KA 1K45A 1HB1A 3NNLA 4R9AA 1AF9A 1YRZA 3H8OA 1XB9A 1ALYA 1GMMA 4V2VA 4UOJA 1ULGA 4RFT0 2EVXA 3ZR5A 3BU0A 4MG2A 2DCTA 2QZ2A 2QQPA 3WP6A 5FZ6A 5KR7A 3HQRA 4WM7A 1XE0A 2GZWA 1OH4A 3MEPA 2Q8DA 4LBKA 3NKGA 2PHDA 3L2HA 4XOGA 5H9QA 5C8CB 2JKBA 4GJZA 2MEV2 1H9PA 2CNAA 4NHXA 5BNNC 1YHFA 4BHPA 4C90A 3D5OA 2RHPA 3QBQA 2P17A 5A3UA 3T3YA 4XUNA 4XJAA 4QHZA 1W8UA 3MLKA 3B00A 1VBA3 2DVDA 1Z7S1 3E6DA 4QPIA 4BWOA 2VOVA 2W95A 1AYN1 3AVRA 4LBNA 4XEZA 4V1PA 1V9U3 4JAAA 4I0AA 4IE4A 1W8ZA 1Y9QA 2WLQA 3FE5A 2WR9A 4H55A 4OYUA 2Q4SA 4PLMA 4YNIA 3VLBB 4HN1A 2Y6FA 5CG9A 5FXXA 5C8WA 4XFFA 1QH7A 5F9TA 3RG0A 1RUG3 3ILFA 4FP2A 2B39A 4ZZ8A 2WNVA 2Z5WA 1PNFA 2HWC2 3WDXA 4PJYA 5L9RA 5I0SA 1G9FA 4JKMA 4PDWC 1JZ4A 5CFDC 2GC2A 5DPNA 2BQPA 4QB2A 5A7OA 2QQUA 3ZOIA 1CZVA 1QDOA 3O0XA 5JOYA 4BM8A 1OOPA 1UY2A 4YARA 4NJ4A 2V5YA 5JXHA 4QHOA 2WSVA 1YLLA 1VBD1 1PX3A 2VCAA 2Y6GA 3FJSA 3T2QA 2BU9A 4AVCA 1GP4A 5C3PA 2J42A 3GF6A 2VZQA 4ISRA 4ORFA 1XE8A 2D97A 5EFUA 4HBNA 4AI1A 5IJRA 4AGVA 4BH9A 2YPJA 1BQPA 3CNAA 5FZMA 5E1RA 3U07A 4TTGA 1J58A 1EV13 2YV8A 2ZGRA 3B02A 2QE3A 5A6QA 4RS5C 1NOVA 3ZIXA 1ND2C 2WZPP 5BNPC 1DZRA 4AAPA 2FZ2A 1XRUA 3ETPA 4QXCA 3KCCA 2RR11 1YQ2A 4FFGA 5F32A 3FHAA 4YFWA 3JXSA 3WDVA 2DTWA 2HWD1 1LECA 3IIIA 4WM7B 2ARCA 3VBFC 4J1WA 4GH4A 2WT2A 4I2OA 1ODNA 4AEMA 4P14A 2BOJA 1YFUA 3I2KA 1JZ3A 3T0AA 4IETA 3U4XA 4MZUA 4BK5A 1TG7A 4HN0A 4RHV3 3RPQA 1W3VA 1VBC1 1VMFA 2B46X 3J9SA 2CAUA 1VB2A 4K1ZA 5DAQA 1DCSA 2P6HA 4YM1A 4PF5A 2W52A 2B9UA 4N90A 3UV9A 4KWJA 3AP6A 4S2FA 3GCWA 3K3OA 2ZGMA 1E5RA 4UBHA 2ET7A 3JB4C 4YVSA 3DKQA 5CB7A 3I59B 4XAAA 3MIHA 2VNOA 4PIZA 4W6WA 1XNKA 2SLIA 3VDBA 1XNTA 5BNOA 5AC92 4YG0A 3TN91 2YBKA 1KEXA 1ULPA 3FL7A 1MZ5A 2YC0A 2ZX2A 3IWZA 4B29A 1CONA 4FOWA 1MS4A 3OPTA 3AMHA 1PX4A 2VO5A 5JR7B 3ZKYA 3OOXA 4OHWA 5HCHA 2WRAA 4WVZA 2Y0OA 2ZA9A 1NQJA 5DN2A 2ZHNA 4QGMA 3RSJA 2AC1A 2ZAHA 3LB9A 2GNTA 2PHFA 3KD4A 1C3HA 5F5AA 5DDJ3 1AR93 4LO8A 4PLOA 4OQ9A 4GQ7A 2EIGA 1MS1A 3WT3A 4D69A 1ZBE3 4XF4A 4NPRA 1W8FA 4XJZA 3U10A 4IEQA 1LOFC 4GJYA 2BFUL 1HN0A 4JVAA 4P9XA 2XBO2 4LNVA 1UZWA 1RIRA 1OURA 1GZWB 3SNMA 2HKXA 1D4M3 2F17A 2V72A 4BYYA 3LOIA 5FZ3A 1URXA 2XLFA 3PUAA 3T30A 5J36A 2AH2A 4KG8A 3ZYFA 1JODA 4HKLA 3ZR6A 2JD9A 2Q1MA 3H8XA 4CU8A 1IPKA 2Y33A 1OQ1A 2W92A 3ATGA 4QX3A 1PGL2 4MH0E 4PI0A 1GOHA 1JN2P 2JDZA 4CEYA 3I2OA 3WG4A 2BNMA 1NQDA 3VL9A 1RMU2 2WT1A 1BYHA 1ZZCA 2TBVA 1DGRA 1L7LA 3VHPA 1SLAA 2P5BA 3LEMA 2JG9A 1J84A 3HBZA 3RZHA 2AUYA 5JPNB 3POYA 4FPKA 4OUSA 1FOD2 1RUNA 3SCGA 3OGGA 1VMHA 1W3XA 4XFIA 1RJ7A 4YW4A 3OCPA 2XQXA 1CPMA 1W9SA 3W59A 3UK9A 3RYPA 2ZPXA 3K4ZA 2VQTA 2XJVA 2XKPA 1PO21 1O6UA 5FP4A 2GNDA 5F3IA 4HETA 5BNOB 1WCQA 4GMP0 1ND3A 3GDBA 4X8NA 4B4RA 4FPLA 3B69A 1B35A 2H6CA 2ZGTA 4AEKA 4LBQB 1IS6A 3QACA 1WLCA 1VJ2A 2P6CA 5LA1A 4IE5A 3KHBA 2D6PA 1DF0A 2LROA 1ZM1A 2IXHA 3JB8A 3CO2A 3TB0A 1DYOA 4YVWB 1RUC2 5L7OA 1QF3A 2A75A 1UY3A 2XWJB 5FUIA 5GM0A 1G9AA 5FIXA 1KS4A 4LBOA 1WKYA 3UYJA 1MZEA 4LLOA 2OIIA 1NA1C 1OKOA 2W91A 4RL7A 1ST8A 2PLV2 2WO1A 2B8MA 1GQHA 1KITA 5FWEA 1FPN1 2C5DA 2DUQA 5FYZA 3AXDA 4AL9A 1PVXA 1QQP3 3ZYHA 3USUB 1NY72 3ORJA 2IXIA 1PM7A 2QQIA 4GA9A 4ZU5A 1QJY2 2MHFA 2UY9A 1VBB2 3V56A 3VKFC 2EAAA 3H50A 4XCAA 1LULA 4MGZE 2YZ4A 1O5UA 1QEXA 3N35A 1NYWA 3BB6A 4CEYB 1S0EA 2VTXA 1JZ5A 3WG2A 2WT0A 1AR83 4L99A 3FFQA 5EIYB 3CQOA 4AHXA 4BMBA 1NCRA 1W6MB 1TMF1 1KJRA 2HYXA 3DYPA 1ZYBA 4JKLA 5CNAA 3NJXA 2FD8A 2D98A 4LJHA 3WOGA 1LODA 1WCUA 3VHNA 3MI8A 1SHWB 1EAH2 5DZEA 3FBYA 5FZGA 1OPMA 1OKQA 3AMMA 4EN8B 5C9AA 3I2FA 3ETQA 4XF0A 2Q8CA 5FMDA 4K9SA 2YU2A 1R1A1 5C3SA 3N9MA 4ZS3A 3ZFEC 2PAEA 4GMP1 3WW4A 5KXBA 2PAKA 4O7XA 3OUIA 4CE8A 5G05L 2PQQA 1UWWA 2CWSA 4OCTA 4CCLA 1AX0A 1GR3A 1S55A 4L2NA 1ND3B 1A8DA 1GANA 1PO13 5IVFA 5T55A 2QQOA 5H9PA 1HW5A 3UGFA 1B35B 3VDAA 4KWUA 5A3NA 4AGGA 4COWA 3ZPOA 1RUH2 3I2IA 5A32B 2W47A 3OPWA 1W39A 1PMIA 1F35A 4XJUA 1FMD1 3LFIA 4NOTA 2A1XA 4Y1VA 1RUI3 4RQPC 1RUOA 1APNA 3CDZB 4Y1UA 3WEZA 2R071 1TE1B 1UU6A 3M70A 2ARBA 1EYBA 4LO7A 5FPZA 1C5IA 3MLJA 4CUBA 2G4IA 2JDNA 4UBGA 3J8F2 4Q4Y2 2RS13 4S2GA 3U1XA 3WW1A 3THCA 1CPNA 2QJVA 3O0VA 4AQ2A 1YIFA 3NAPC 2YXSA 3WQ7A 2RMU1 1LOGA 1YJLA 2G9GA 3CJIA 2EICA 2ID4A 5IATA 1AR62 2BYVE 2VW1A 4MXWB 2DV9A 4UWDA 1WLWA 1JYTA 4NRQA 1SQ4A 3GZEA 3AKTA 3VBRB 1H0BA 2WFF2 4QX1A 1GP6A 2PFWA 5K7PA 4BQ2A 4GB33 2BZDA 4XHBA 1W9FA 2DDUA 4LO5B 1GU3A 5FZHA 1UU4A 2ZGLA 4D6QA 1VRH1 1RYYA 1UKRA 5EYYA 5I8YA 4GWJA 4IEYA 2WSUA 3LPGA 1T6BX 1SBEA 4UI9L 1DFQA 1RJ8A 2BP6A 2WS93 3ZSMA 3VBSC 1RUE1 2C1FA 2JB8A 1UZ0A 2RJLA 3KS7A 5F5QA 4M4PA 3A23A 2HBUA 3WUDA 5C9AB 1WD3A 2HWB2 4HVOA 3IAQA 3N9NA 5LBBA 4K40A 3GZAA 1RVF3 1SCRA 2JDAA 4JV4A 2PELA 5FZ0A 3CJXA 4XDPA 3POSA 2ZABA 5A1LA 2XONA 4BISA 3AZWA 3TEYA 2GN3A 1DQ5A 3UGHA 1QXJA 3CZJA 2YB7A 5A3LA 2E7TA 2ZKNA 3BOWA 4FXKB 3USSA 2NP0A 3VDDA 2ORZA 1R64A 1BHGA 2WO2A 4HSLA 5EZWA 3KQ4B 1UMZA 4N9IA 3VBUB 4CXXA 2JJ6A 4CDQC 2RM23 3WNMA 4EZ4A 1Q8VA 3B5LB 3AP7A 5EHDA 4DPNA 4BE3A 3PU8A 1G9BA 1JYIA 2EA7A 3AZYA 1TME3 2WDBA 4EJRA 2DFCA 4XFBA 4BA6A 4F7ZA 1HQWA 3PUHA 4JTOA 2BDRA 5DG1A 1CN1A 4J1XA 1MVEA 4U2AA 3LPFA 4B8EA 4DUVA 1VBA1 2RS52 4DXTA 4FPYA 2VQ0A 3NV4A 4CDUC 1AR71 5JZGC 1AZDA 2UWAA 5FWJA 4Q4X1 3HT2A 2VTXJ 5A6XA 5KHKA 3P3PA 2LM3A 5F7UA 1KD7A 3AM2A 2WYFA 3OBZA 3DYMA 3AFGA 4QT6A 1XBFA 1ASJ2 1U12A 4X8PA 1RUG1 3ZFFA 2J1UA 1IKPA 2MEV3 3TBDA 1E57A 3EBRA 3HVDA 3OD4A 4PQ9A 3DXUA 3BGAA 4Z2WA 4XFGA 3D8CA 3ZXAC 1V0AA 5BXXA 2QQKA 3GM8A 1JUIA 2FBEA 3KZ4C 2E51A 4A4AA 3JU9A 3MO4A 4JQRA 4CEWC 5BUVA 3J7MA 2Q0AA 1GOGA 2UYAA 1RUF3 2WWSA 2KM2A 2ZZJA 4FPEA 2MPFA 4I0WB 5TSWA 5IT6A 2YROA 3DL3A 3H1MA 4MVTA 2DVGA 3WHTA 1N1YA 2EXHA 3IDAA 4P9JA 2BOIA 1G9CA 4HVQA 3VZKA 4XTMA 1CZTA 2A6YA 2BBAA 4GKYA 3VDDB 2HYKA 2BBVA 4NRMA 4FT8A 3RZLA 2WINB 1S2KA 2IFRA 4J25A 5BNNA 4YFZA 2FDHA 1W6PB 3WXPA 5FZLA 5DUVA 4K7JA 2JDKA 3LQCA 4HFSA 1LCLA 4RHV1 4X6RB 4OMDA 4DNYA 3EJKA 4Z2AA 2DTYA 1UOJA 2XVGA 3PNAA 2VMIA 1O8SA 1BVP1 2ORXA 3AJZA 1QKQA 2OT7A 4NO4A 4E27A 4A3XA 3POBA 1R091 1ZZBA 1LOCA 2JB4A 3GBWA 3C3VA 5CFCC 3DPRA 1CAXA 4JRAA 2NPIA 4C0BA 2ZX3A 1NZCA 2A7AA 1PGSA 4LITA 4W65A 1VRBA 2IXKA 1RHI2 3WF0A 5BPXA 1DYPA 4R52A 5FP9A 4DXRA 1MEC2 1DZTA 5A7NA 3GJAA 3S30A 2RDSA 2W68A 1AYM2 2VMFA 3O14A 4D7TA 2BV4A 1BVVA 2CV6A 2DBNA 4LKEA 3ZFFB 4YM3A 4CXYA 2JDPA 3AL6A 2VZOA 1YUDA 4OLLA 2ZGQA 4LHNA 5FREA 3SKVA 3ACIA 1F31A 3GHNA 3H7YA 4KL1A 3QD6A 4XF1A 3N7LA 5FXWA 3TNQA 2FDKA 2B7YA 2A6ZA 5T5JA 1YQ6A 5FZ9A 4ZU7A 2QBXA 1E5SA 2WIIB 3H7JA 3VBRC 3WNLA 4AR2A 3AKPA 5B4NA 1MR5A 4N7IA 1W9YA 1LGCA 3GBGA 1JUHA 1O91A 4LE4A 4ZS2A 2ZEZA 3B9CA 1LOAA 3J26N 1YXWA 3P1IA 3VD4A 2AEYA 4MGKE 1ZBE1 2VXRA 5J96B 4ZXEA 3S6PA 2WO3A 2J1VA 4CP0A 1ND2A 2WUHA 2BW8A 5LK5A 4CU9A 5AC93 1UN1A 2XB6C 2ZHLA 1W6NB 5FQ0B 5FKCA 4JC1A 1LU1A 1CAWA 3UKNA 4CCEA 4XACA 4F3JA 4QKNA 4ONUA 4META 4CDWA 3WQ0A 3CKHA 4QQPA 4TZDA 4LKDA 1U5ZA 2RG4A 1C8M2 1OLME 4Q27A 4BQYA 3T0DA 5J7MA 4HKOA 4C0HA 1W90A 3PL0A 2F4PA 3ZYPA 3WNXA 3CMGA 2X09A 3ILNA 1N1TA 3OY8A 1W0PA 4ITCA 4YPJA 2RS31 1Y9GA 2QDNA 1V6MA 4XJ8A 2VW0A 3K46A 4ES8A 1ULEA 3BPZA 2GALA 2I45A 1NE4A 3B9IA 4JRLA 1UAIA 2D93A 2XBO3 2XHNA 3DPRB 4WVMA 5FZ8A 1PGW1 5T54A 3LIGA 5J48A 4D94A 3T4HB 3MDPA 4QDQA 2WZR2 5JPMB 2W5FA 5LATA 4B4PA 4DRRA 1EUTA 1HRV2 2LRPA 3H3ZA 1IS5A 3R4SA 1SFPA 5FYHA 4O65A 1ZRDA 1V6NA 2BRTA 5LK7B 2P3YA 1RMU3 3ECQA 3ZFGC 2WQ8A 4CUGA 1HRI1 2EXJA 1I3HA 2OA2A 4AGRA 4AHYA 1O5LA 1HDKA 2XL7A 4Q4V2 3VBOB 4UW3A 1CAVB 2Y60A 1LHNA 3P3NA 2VVEA 1PM4A 2VZUA 2UU8A 5DAPA 1O4YA 3LE0A 1FOD3 3JCIA 2RJKA 4HPKA 3HMYA 4AXOA 5FZDA 1HIXA 1DIWA 4EN9B 1LB2A 1UOBA 5JSRA 1IS4A 1ZRRA 3AZZA 3O1TA 1UW8A 3MIDA 3MW4A 4MX3A 3T1MA 1ULCA 5AFBA 1LOBA 3ZSKA 2K2SA 4BZ4A 1RUJ3 1POV0 2DUPA 4N43C 3WINE 2VL4A 4K20A 1NZIA 2VZSA 4MHRA 1CAWB 4XVHA 5FJHA 1H4GA 1QQP1 1JHNA 5C4WC 1WMXA 3HNYM 3VBHA 3WD5A 5FYSA 1FNYA 4SLIA 2XHKA 1FI2A 3LEIA 2WQ4A 5CYYA 4QPGC 1E5HA 5T50A 1XYOA 2P2KA 3WF3A 3IDBB 2ZCWA 2A3YA 1DGLA 4E4ZA 1IPSA 1IG0A 4IV3A 2XWBB 4EROA 4AVAA 4LUKA 1LHOA 3KCYA 1UZZA 4N53C 5E6HA 4A6OA 4AVSA 1G9DA 3ZMOA 5JVVA 3NMBA 5GZDA 2PLV3 2K46A 4WV8A 5K0UA 1UY0A 5DXDA 5A7WA 3I2JA 4A44A 4HT1T 4I3GA 4COVA 4QXBA 3LWCA 2BWAA 4NHYA 4U36A 4ES9A 1Z7S2 2FDFA 1XPWA 1AYN2 1QJY3 3LEGA 3WW3A 1QHDA 1ENSA 1VBB3 2P3KA 5DAXA 4CZSA 3I2DA 3QOPA 1VAVA 5CU1A 1X7NA 5C3RA 1HJFA 3RRDA 2JICA 5GZCA 5DZFA 3GGLA 1MQTC 4LO4B 2P3IA 4AEDA 1FAYA 2VUDA 1JOBA 2AENA 2PHTA 2Z69A 3DECA 4C8DA 5CADA 4NIGA 1D0GA 2I74A 2RDRA 1K5MC 4G3YC 2P37A 4UFHA 2AZ5A 1X33A 3WW2A 4HPKB 1U5YA 1VBE1 1RUI1 5IFTA 3KV5A 3OBRA 4JGYA 4HG6B 2WYSA 2ZAAA 4XCBA 2HJIA 3WG1A 3I3EA 2TUNA 1MZ6A 1POV1 1VBD2 2BGCA 3FLTA 2P3JA 3WF1A 1HXS1 1PVC1 5FDBA 2RS11 3KT7A 4NPLA 4XXPA 4XFAA 1QNWA 3ZDVA 3WF2A 2Q8EA 1FX5A 3OGVA 2QQJA 4LOSA 3NSTA 2PAMA 3VBHB 1YEWA 4GWMA 2OVUA 3N4MA 1RUH3 2HWF1 3MPBA 3RZKA 4E9KA 1OUSA 1L3JA 3EMRA 3LA7A 5EQUA 4D8MA 4F83A 3RYRA 1KRIA 3W58A 1H8TA 2W1UA 2X10A 2XJSA 3BTYA 1NKGA 1UF2C 4L92A 4TWTA 4ZXKA 3SLIA 4GB31 4IE6A 5ACA3 3H8UA 3T2PA 1AXKA 2XJPA 5D8AB 2GC0A 2VVFA 2JG8C 1JH5A 1WD4A 4NAOA 4IV3B 2C0ZA 2VULA 3ACGA 5ABJB 2H0BA 4YM0A 4PHZA 2R061 2HLEA 3DGTA 2XLAA 2A3WA 2WS91 1XU2A 4TLGA 1VBC2 5FR3A 3CLPA 3HAGA 4OI0A 1HQNA 2ZMKA 3J8F3 4Q4Y3 3FMGA 4L8QA 4UFMA 4KH9A 1MACA 1D0HA 1QOTA 3U14A 1F9KA 1AR63 2CGNA 1I5ZA 1RVF1 4Z8BA 3R6SA 3ZLIA 3V0BA 3HD8B 3POEA 5IFPA 1R081 2WFF3 3U4SA 1YQ5A 4OI4A 1V6LA 3QH7A 3WP5A 1REEA 2C6SA 4YZ2A 3BIWE 2DU0A 1PHMA 4AEDB 1UYXA 5C71A 1GBGA 4M4RA 5FPLA 4A45A 4B7KA 1QJU3 1A3KA 4LBQD 4B1LA 2R6QA 2V09A 4ZU4A 1S0GA 1AL0G 1DQ0A 2RM21 3MF9A 3HPNA 1W8HA 1N47A 5FCCA 2WABA 3HNMA 3H3LA 5I8SA 3K75B 3PUSA 2FHRA 3POFA 2NM1A 3B01A 4UXAA 5LA9A 4BQ5A 4EWAA 2P1BA 1A34A 1SLBA 2BEOA 3Q8BA 4Y5SA 5JWPA 2W1WA 3LKJA 4AWDA 4GZ9A 1YI9A 3GBFA 2VC9A 3POJA 4BCUA 4AFBA 1Z0HA 5FZKA 3AYCA 3PU3A 4R8HA 3OGJA 4XJ9A 3OBAA 2VZRA 2QKDA 2X5IC 3GZUC 4NROA 5EXOA 2R042 5FP7A 1PK6C 3PVEA 3G6JB 1JYXA 1H8TB 3T0BA 2G1MA 5FZ7A 4E4DX 5BV6A 3MPPG 2VU9A 1BEV1 1T2XA 4DFSA 3ES1A 3E6BA 1C1LA 4FPHA 4QPIB 4AFMA 3RZJA 3RZGA 2KR2A 2XH6A 5E88A 2JE7A 4KNCA 3VD7A 2DVAA 2RS53 3FLPA 3N9PA 1N3OA 3VD9A 4FPFA 3Q8AA 1Q56A 2EALA 2D5HA 5F3EA 3D6EA 4Q4W1 2J1EA 2WFPA 4WM8A 3LDBA 5JOWA 1RUF1 1H1MA 2K9ZA 2YFZA 5A7SA 2XDVA 1DQ4A 1OA4A 3I8TA 2YG0A 1J3PA 2WNVB 5EJZB 4YGDA 1K5JA 1AL22 2RVAA 2ZGNA 3AB0A 3CZUA 4JX0A 4P9WA 4RFRB 4PF1A 1I1EA 3E5UA 5FK7A 5A3OA 5GLVA 2A5ZA 2VUAA 1PO22 2AYHA 3NL1A 1ZVFA 3UKTA 5KC5A 3M3OA 2ADDA 4TN7A 2E9QA 2FMDA 1OOPB 1U5IA 2Y64A 2FDGA 2L9LA 1TVGA 4NE9A 1XQNA 3SH5A 2E7QA 4MGYE 2W9XA 3BTXA 4AOCA 4XAEA 1KGYA 3ACFA 3OB8A 5FAXA 1V6OA 3RI8A 5FO8B 4CDXA 2FMYA 3VDCA 2DYCA 1CWPA 5FPXA 4NWWA 1X9TA 5F2SA 1A8MA 2EXIA 4Q0QA 1W03A 4CDUA 5HCAA 5IVEA 5JZGA 1BLZA 4QKFA 2ZGPA 4W4ZA 1SDWA 4GH4B 5IWFA 4KI5M 4RD7A 3MF6A 4P08A 1QGLA 5IVJA 1WW7A 2Z42A 1RTVA 3SEEA 3PDQA 1FPN2 4BJ0A 3TNPB 4CCOA 2OXBA 1BMV2 4XW3A 1T6GC 5F5IA 1RL3A 1IQDC 1IGOA 4DXSA 5A33A 1XC6A 2UWBA 4YM2A 1HLCA 2UURA 4QQOA 1CAUA 2BFUS 2XG3A 2VW2A 2BNNA 3JD73 3JUUA 4S2DA 5C8CC 2IWGB 2GMPA 3BUCA 1Y43B 2R16A 1DGWX 2IFWA 3A21A 3IT8A 1XXNA 2D40A 1VLNA 3KB5A 3IKWA 4JGZA 5FMOS 4YVSB 2VM9A 1MS3A 3H42B 5K9YA 2R30A 4K3UA 1TMF2 1TZOA 2EAKA 1OQEA 1H30A 4QQHA 4NIAA 4ASKA 3DKWA 1YCIA 1DDLA 4WM8B 1WA6X 2VXJA 2BERA 1N1VA 3SISA 2WL1A 1H6XA 4URAA 1IQAA 2VY0A 1RHI3 2ZX4A 2SBAA 1KS5A 1MEC3 3V65A 1SCSA 1N3PA 3IB3A 1WW5A 2Y6HA 3T2TA 3W20A 3DEMA 1EY2A 2VBPA 4DRVA 1R1A2 3VKLA 4CXWA 4KG0A 4R9BA 4LHSA 2JDMA 3C7OA 2WNUA 4H14A 4GWIA 4LBJA 4Z82A 1OF3A 3ZXDA 3UESA 4WVWA 5FXZA 5CIRA 1LU2A 3RI9A 1QJEA 1QOSA 4AAXA 1U5XA 1QH6A 4LBLA 4ATEA 3MV11 5E89A 4ARXA 2E32A 4XBQA 3SEPA 2B45X 3WSOA 1BCXA 4PIXA 2W39A 3O1RA 4ZY9A 1RXGA 2D6LX 2OQ7A 3LA3A 1BKZA 1ULOA 2XJTA 1G8WA 2YC2A 1W2NA 4DY3A 1FMD2 1W8NA 5T5LA 3KLSA 2CGPA 2WNEA 1W0NA 4JDMA 2DU1A 3ITQA 4MGIE 1GWKA 3E5QA 2R072 5FY7A 2Q1ZB 3AJYA 3MFAA 2LALA 2DURA 2WWUA 3OJBA 2E31A 3KV9A 4IERA 3T4VA 3H8RA 2YUEA 4YZ5A 4BDVB 5FZIA 4DY5A 3AK0A 3DYOA 3ZN6A 1QXPA 5LEJA 1X50A 4KGGA 5FJKA 3WNOA 2JE9A 4DZGA 3B93A 2RMU2 4LHKA 1C8M3 1I5PA 2O8QA 3I97A 2YFUA 3KF3A 4XJWA 1PGL1 1JYNA 4RGGA 4DQAA 1F8VA 1BXHA 4WM7C 4A3ZA 1KFUL 1NCQA 2JG9B 5A33B 1BBT3 4N8MA 3S5AA 4IGPA 1RMU1 3JBG3 3WX5A 2IXJA 4QGNA 3PJQA 1Y4WA 3TRSB 1OH3A 2XQRA 4BQWA 2GH8A 3DUIA 3SHRA 3MICA 3WP4A 3IZOA 1VRH2 1ZREA 3ZN4A 2EF6A 1FOD1 4NN0A 2OKXA 1QOOA 5FZCA 4GIQA 2VH9A 5FPVA 2HWE3 3O0WA 2GSYA 4PCRA 1DG6A 4E2SA 1UOGA 2WZR3 1HX6A 1VAKA 1Q5OA 4Q5OA 3QCWA 4XBLA 5LZ6A 3POWA 4BPZA 1HRV3 4QB1A 1SBDA 1RUJ1 1VR3A 3DV8A 4IGOA 1QXRA 5EP9A 1VE0A 3SCFA 1X9PA 3U37A 2YMZA 4BIFA 1US3A 4FQ4A 4CP2A 2VQUA 4KGQA 5FZBA 5L7OB 5IHRA 1PNGA 1YO8A 5DUWA 4K8RB 1QJX2 2XUEA 1Y7BA 3WY6A 3NNFA 4LE3A 4TXWA 3ZPYA 3AP4A 4D7YA 3SITA 1JW6A 4QQLA 2VVDA 2XGXA 4ASLA 4GKXA 4H7LA 4QX7A 5JSPA 1OVSA 4XUTA 5CAZA 5KWRA 3HN3A 4ISQA 1DQ1A 2WWJA 3KT1A 1UX6A 2PLV1 2PN5A 2ZGUA 3OG2A 4LUMA 3ZIWA 4AQTA 1NUKA 3OF1A 4D0QA 4KBZA 4A7KA 4CCJA 1W9TA 4IEWA 2YYOA 2Z2SB 3NJZA 1VBA2 1OXCA 4NR1A 5LA0A 2HH9A 1DLLA 3MIBA 2VOWA 1AR72 4P9GA 3ZN6B 1XYNA 2ZGSA 4Q4X2 4XDOA 4HOOA 5A6YA 4M0HA 1NX9A 1VBB1 4YZ1A 5DUXA 2FDIA 1NCRB 2D5FA 1UQXA 4EV0A 4IEUA 3WVJA 1RUD3 3S0MA 2CU5A 2AREA 3FUOA 1NCQB 1HB3A 2A70A 4GH4C 1V70A 5F8PA 3SH3A 2PHXA 1OA2A 2YGLA 1C8NA 3OBTA 4R4XA 4GAZA 5GLUA 1RXFA 4DMIA 3OGRA 3OTFA 4NVPA 4YW1A 1ZA4A 1ODMA 3PUIA 1H9WA 3R4UA 1DP0A 3HBKA 1O3RA 1S2BA 4IV1A 4UFLA 2W0XA 1Z7S3 2HEVF 4JKKA 1IZ3A 1AYN3 5EV7A 4TYSA 2VUCA 1SPPA 1OLMA 2JE8A 4N43A 3OGSA 3RZMA 3HQUA 4YVSC 2VCCA 5C3OA 3MW2A 1F4HA 1XNDA 2LTNA 3MW3A 4NMIA 1SLTA 1ULDA 3IMNA 5BNOC 2VE1A 1RUH1 5KHIA 1C5HA 2F6BA 4LA2A 4PLNA 4EWDA 5SV5A 1O4ZA 2R1BA 2XMLA 1LEMA 1COV2 3M3QA 5HXVA 5ACA1 3KGLA 1ZBA2 3R4DB 3U11A 4QPYA 3ZYIB 1QY4A 1S0IA 4Y1ZA 3OEAA 3NV2A 3E97A 4DUXA 4FPOB 4N53A 4OVEA 5CBLA 5CVRA 4NHMA 5IVVA 3K48A 4RR3A 4AVBA 1V9U1 4M00A 4W6XA 1VBD3 4XXAA 4YVWC 3WCRA 4QD2A 3SXWA 3CJIB 4EYUA 1NLQA 1L7QA 3J8F1 3A0NA 1O4TA 5IK8A 3ZSJA 1CVNA 3C7GA 1S1AA 3AKQA 4NIDA 2PYTA 4W6YA 1R092 3OEBA 3WHUA 3C7EA 5FZ1A 4IW3A 5APAA 1Q3EA 4AE2A 3NW4A 4JDOA 1GNHA 4LMFA 5GKAC 1RC6A 1UXZA 1KJLA 2RJ2A 2WFF1 4OULA 1ZZ7A 5FK8A 4L97A 3BI3A 4CSWA 2PMWB 3AP9A 5FBJA 1UZVA 4A7ZA 1LHWA 1NXMA 5K4LA 2ZACA 4JCKA 4E2GA 2Y8KA 3WCSA 3UETA 1LAJA 4AQ6A 3K4DA 3N7MA 4YW3A 1QJU1 4CEYC 4YYOA 3JQXA 2R1DA 3VHOA 2BJSA 2DCYA 3NVCA 5JUVA 1EUUA 2ZEYA 4IV1B 1EV11 2X29A 4AQSA 1JZ6A 5AVAA 1UMIA 5J37A 5FXVA 3MIFA 1CJDA 1NAEA 1RGSA 2PHUA 3ENRA 2XJQA 1FNZA 3IM0A 4XTPA 3T08A 5ISLA 1H2LA 2HWC3 1K12A 4CRQA 4FXGB 2XVKA 1OLRA 2R32A 4N9HA 4QDSA 1GNYA 4EN0A 4ZHNA 4CCNA 2ARXA 1C1FA 2V4AA 3AYAA 5K8SA 3RVHA 3B7MA 5FP8A 4I0BA 1O59A 2EIEA 4NRPA 3LF7A 4AF9A 3BIEA 3LGRA 4CVUA 2EIDA 2WLPA 3PTYA 3S5QA 1C57A 2ZKLA 4Y22A 4CU6A 5I0RA 1ND3C 4MADA 3PVBB 4UF0A 3PIGA 3H0OA 3CHXA 2VBDA 2X53S 4XUQA 5C33A 2A6VA 5FOBB 1B35C 2CHHA 2ZMLA 4X6QB 3IBMA 1P8JA 4O9EA 5BNQA 4BOWA 3NKTA 1V6JA 1GWMA 1S0DA 3OSDA 1AX1A 3TEXA 1JXNA 3I54A 4Q0SA 4RR3B 1V6IA 3GALA 2FZ1A 2VMCA 1GKBA 2RS32 1JZ2A 4YSFA 4L0PA 4QU2A 4AFAA 1W8OA 3TEZA 3S7EA 3F95A 2E63A 5CG8A 3Q8CA 4M3CA 1ULFA 4DOUA 4PI2A 3J7HA 4XABA 1XYPA 1ENRA 2ET1A 1O3QA 2GNMA 4FOYA 2G9ZA 2R043 2KXLA 1TNRA 1PGW2 2QZ3A 4PDWA 4Q26A 4IEXA 5CFDA 2PQSA 3FN9A 4QPWA 3W5NA 4HSJA 2CTVA 2R49A 3M3CA 5T3NA 2WA4A 3PMSA 4XQWA 5LRSA 2O14A 3RGBA 3KV6A 2D3RA 1E5IA 4FVVA 4E2QA 1WZXA 4XQ4A 1OF4A 3A22A 2BPA2 3AZVA 2X05A 5DDJ1 1AR91 5J1XA 5FYUA 3ALQA 4UFIA 2IVJA 4HXCA 5DUUA 1HRI2 3LFMA 3ZYBA 4CPBA 3O1MA 4OHVA 3P5BA 1MZFA 2IVIB 4G4FA 4H2AA 5FYIA 2JKXA 5BNPA 4RS5A 1GNZA 1UY1A 3VGIA 3LEKA 4Y24A 4ATFA 4YGCA 2F4LA 1W04A 2DCJA 4CCCA 2GDFA 1AL23 1D4M1 4KBBA 3VBFA 5C9AC 2WO7A 3AL5A 1JHJA 1UMHA 5CKNA 1H2MA 1PO23 1S0BA 5FBZA 4A2UA 1DYKA 3AMPA 5BNNB 2X5IA 1YJKA 4NIHA 1O3SA 1SFNA 5LY1A 1UXXX 4Y22B 2DVBA 1H4HA 4UF0B 1LEDA 2QNKA 3ZM8A 3BKZA 3MIGA 3SH4A 2ENRA 5DAWA 5IK5A 3U78A 1F4AA 1QDCA 2J1AA 5JLVA 3OUHA 2Z79A 1W05A 2BWCA 1C28A 2VZ3A 3JD71 3VBUC 1CAXB 1PIV2 4LA3A 5C5UA 4A41A 3VZOA 5FLJA 2E7AA 4LHLA 4A7YA 5L9VA 3R05A 1FT9A 4MGSA 4A6SA 3GHMA 3BYWA 5FZOA 3ZX7A 4M3CB 3IDEA 2VECA 4BXFA 4PT6A 3LSEA 4UT5A 1OFNA 2XVLA 3A0KA 4R4ZA 1FPN3 1MEC1 5F6KA 3WDYA 4AI2A 3FZ3A 3U75A 4FAHA 5KXEA 1H6YA 1ZRIA 3AYDA 3NJYA 4PDWB 4EN6B 5CFDB 2IUWA 3AMQA 4R9DA 1AX2A 1JOJA 4QGLA 4XBNA 3BOPA 3UGGA 5KHGA 2R0FA 1UD1A 1CIWA 4Y26A 3RWNA 3WNNA 3TOJA 1NLRA 2CL2A 2BGPA 4XETA 1NE6A 4LKSA 2VJXA 3N9LA 3NNGA 3POIA 2VMEA 1LOFA 3R0RA 5BNPB 1MS0A 4RS5B 1GZ9A 1ND2B 1JTZX 2QQLA 4LIUA 5A6ZA 2Y6KA 2WJSA 3VKNA 1RINA 3ILRA 2JX9A 1VBE2 1RUI2 4LTAA 5FPAA 4CDWB 2LUWA 5H9SA 1R1A3 1WGPA 2FCUA 2PHWA 2NYYA 3MGUA 1J3QA 4LK6A 1J3RA 4GMP3 4WZCA 2W3JA 3NNMA 1QNYA 4OI2A 4E8CA 4LT5A 2A6XA 1WW6A 1UYZA 2DCKA 1HXS2 1PVC2 4XUPA 5LASA 4XPVA 1RUC3 2DUOA 4FQZA 3GCXA 5HI0A 1UYYA 3K2OA 3OY8B 4OI1A 3AXEA 4UW4A 1AR81 2W2IA 3IAPA 5JMOA 5JXIA 3UJQA 1WWYA 4YGEA 4CCMA 5JOXA 1A6CA 2HWF2 3VDDC 1ACCA 3W21A 3WQBA 4Y20A 4BLIA 1BBT1 4YW2A 5HV4A 2D3PA 4BQ3A 4AHZA 3JBG1 3RNSA 3KV4A 1S0CA 3NV1A 4MYEA 1SLCA 4WVMB 4COUA 1HV1A 2D44A 3ACLA 1OT5A 3VZJA 1Q43A 4EE2A 2ETEA 3WP3A 1RB8G 1OI6A 1M06G 4QDRA 2VGDA 4HMZA 2R062 4AI8A 4MUVA 1TNFA 2WS92 2HWE1 3WNKA 5CEHA 3GXUA 4WZFA 2DWRA 1PO11 1YQ8A 3LAGA 4CA9A 1UCXA 2RMU3 3HJRA 3UJOA 4QKDA 2V5DA 5ANNA 3TEWA 3FBMA 5A3PA 5JOZA 1HJGA 2XKOA 1GWLA 1IPJA 2VNVA 3KWVA 4IE0A 4B3NA 1VAMA 1NT0A 5F1RA 3O1VA 1ZRCA 1CX4A 2XLGA 1EAH3 3LIHA 4JHZA 1QWRA 1R082 4P9LA 4IESA 1OUXA 2NLRA 2GC3A 4PQQA 5FMBA 3WUCA 4BQ1A 2A6WA 3ZFFC 4CU7A 2XL9A 1VRH3 1FV3A 2OQ6A 3FUQA 3KGZA 4QAWA 1NA1A 4YRDA 1SG3A 5FZEA 1IG3A 1O3TA 3IN9A 4C1WA 4I02A 4M0NA 4ZKTB 4FO9A 3VHRA 4CUAA 4FFIA 5I0DA 2W94A 1YFWA 4FFFA 2D6KA 3OUJA 1LTEA 2WC2A 3RJ2X 3ZYJB 4B1MA 1WMEA 2P4EA 1WCDJ 3I4IA 2QDRA 4QX5A 4I3PA 5F37A 3PUQA 4DINB 5HCFA 4DUWA 1IOAA 1DLCA 2RR12 5GALA 5FRAA 2HWD2 1Q8OA 4Q0VA 4FSJA 3I3QA 4QXKA 1QJX3 3NV3A 2X8KA 1AXYA 2IXLA 4SBVA 2GU9A 2I07B 2Z4FA 1K3IA 1RUD1 4AYUA 2IXCA 4Y20B 5ERLA 5C5TA 4OZXA 4CCDA 5FYTA 3JQWA 5K0UB 5A7WB 3WQ1A 1WBFA 3MLLA 3O1OA 1BEV2 1Q8QA 3T1LA 1M4WA 3ZFEA 4IL7A 1UY4A 5FYVA 1W0OA 3HEIA 1I9RA 3PTRB 2ZEWA 1AR73 2C9KA 5LWBA 3I2GA 4Q4W2 1G86A 4Q4X3 4XIOA 1IHMA 3DPRC 4BIOA 2GP3A 2H0VA 1RUF2 1OMIA 1QMJA 1KFXL 3HIFA 3I59A 4UFJA 3TN92 3WDTA 5C6CA 5KXDA 4FTSA 2RDNA 4K8FA 3THDA 1AJOA 2JEMA 4QWNA 3U0ZA 2D3SA 4L9BA 3SCHA 2VBBA 4RQPA 5D21A 5B2GB 3I49A 1S4CA 5DMYA 4KWLA 4JGYB 1SMVA 4QXHA 3LD8A 2OPWA 2HWB3 3PIJA 5IW0A 1TME1 4Z92B 5LBCA 2GMMA 4D6RA 3J7LA 1NA1B 1LKNA 1MVQA 3H3UA 2OUJA 4AFCA 3M7AA 5JI9A 3POGA 3VBOC 1W2OA 5L36A 3NAPA 1PMJX 4ASMB 1UYPA 3HT1A 2PHLA 4AZZA 3PVOA 3EQEA 5FOJB 5AVPA 1H8VA 2LS6A 5KXCA 1UIJA 4JHTA 5JSOA 4FTBA 4HKWA 3BPSA 5E8AA 1AVBA 1UX7A 3UT0A 4LIVA 4B4QA 2MEV1 3K77A 4XF9A 3MHZA 4Y4YA 5HCBA 2YU1A 3N3HA 1GZWA 1ZNPA 4XE9A 1OD5A 5GZFA 4ZZ5A 2Y0IA 3LSDA 1SZBA 2NZ9A 3D0JA 1COV3 3DN7A 4MO3M 3ZXGA 1LNSA 4CTEA 5KHJA 4K6BA 4CDWC 1ZBA3 5GLTA 3VBSA 5J09A 2BUKA 4WBBA 2ZJCA 3DF0A 3E5XA 2W87A 3ZVXA 5HBAA 2A71A 2J1TA 3RJRA 4QX2A 3L2YA 5F3GA 3ZXLA 3ZFEB 2AR6A 3J7NA 4V2WA 3HN1A 1EPZA 2WZEA 4Q29A 1US2A 2C9AA 4AI0A 3V0BB 1IS3A 1ASJ3 2FCVA 3AC0A 3MBWA 4Y5TA 1R093 2W1QA 1YC61 1S0FA 5F2WA 1DU3D 2WN2A 5A7QA 5JXGA 2WQZC 4ZPIA 5FYYA 2HWC1 4BU2A 5LW9A 2OS2A 4HONA 3EHKA 2VUJA 4XQDA 4OQ8A 4MLOA 5FPUA 5IK4A 4RN5A 2XPJA 2WAAA 4CDQA 3CIHA 4Y1YA 2GP5A 4RQPB 2QQNA 2NQYA 2PHRA 4KWKA 5IVYA 3S57A 2ZGOA 2E33A 2A73B 3CU7A 4QKBA 3DCQA 3KMHA 3KQRA 4HK9A 4LBQA 4FCAA 4IXLA 5A7PA 2WA3A 1BJQA 2AEZA 3KCXA 2TEPA 3M3EA 3W9AA 1Q8PA 1WBLA 3NAPB 2C4XA 1GICA 2GAUA 4YVWA 3ACHA 1DQ6A 2ZXQA 4I09A 4Q1RA 4YW5A 1JMUB 3VN4A 1OPOA 4LEJA 4QM9A 5JDBA 3CL1A 4P02B 3I7DA 4XF3A 2GH2A 2OPKA 3BU7A 2D43A 2CYFA 2VG9A 1JZ7A 2ZTNA 3UL2A 1MS5A 1QIQA 4EN7B 1DZQA 2VZPA 1D2SA 4AK3A 5FMOL 2R041 5A70A 2EXKA 2RV9A 3USUA 3ZSEA 2VMGA 3ASIA 2NMOA 3VBHC 4UYBA 3VZLA 2J7MA 1JYCA 1XSQA 3SKJE 4OFGA 3VBSB 3AZXA 3PJYA 2PTMA 3C8XA 2BVBA 2HBTA 1MS9A 1REDA 3D3AA 3APBA 3ES4A 1UPSA 1XNBA 1XNCA 2Q5TA 2VZTA 5I8TA 5D8AC 5H9RA 2RS33 4RA0A 3RDIA 1W6MA 3FWEA 5FLHA 3HNBM 5DG2A 1XNAA 1GQGA 2LW8A 4IV3C 4XILA 5ABJC 3NRUA 5EYXA 5IAVA 1AYM3 1WA4A 5FFOC 5FLIA 5FYMA 5JIUA 5AC91 1UU5A 3INAA 4COZA 5DABA 5T52A 4HLTA 4RSUA 5K0UC 5GZEA 3AVSA 2JECA 1AL21 3MUY1 4JZRA 3N7KA 4IDZA 1ZZ8A 5LB6A 2ZGKA 5IUQA 2JIJA 1HV0A 3TYJA 1JS9A 1WCSA 2ZBJA 1KDKA 4CDQB 1JYVA 3N9QA 5HV0A 1UKGA 5BY5A 2AGSA 4DIQA 1AXZA 1RUJ2 2R7EB 3EB7A 4UFKA 5FV3A 1G6NA 2JD4A 4J6GA 1S2EA 4DS0A 1OLQA 2VOXA 4CDXB 1FYUA 2A3XA 1HRI3 2ZX1A 3GYDA 3D82A 1R1ZA 4L11A 2UY8A 5A32A 4AEDC 4CCKA 4DB5A 1CJPA 1H2NA 4MHUA 4TSVA 4CDUB 5CFCA 5JZGB 3E6CC 1A78A 3C7FA 1D7PM 4D7SA 2XBO1 3RWKX 4HK8A 3BTAA 1XSRA 1VALA 4MSVA 4A42A 2ERFA 4IUGA 3BALA 1DQ2A 5C3QA 4JGYC 1ONAA 3E1F1 2ZZQA 1X36A 2G9FA 1JYWA 2WZ8A 3M1HA 3M2MA 3FLRA 1ZZ9A 2VOKA 2YC4A 2QCSB 4FPJA 5EPAA 5CA6A 3THPA 3D0SA 2NMNA 2VPVA 3JZVA 2CDPA 3K3NA 4FOQA 4M01A 1LHUA 2CWMA 2Q8OA 1CAUB 3KVAA 1BMV1 3WR0A 1VIWB 4MXWA 1DBNA 1B09A 3AMNA 2Y34A 4GALA 4OHZA 4CEWB 2NN8A 4JGZB 1Y3TA 3VBRA 4AFDA 4Z07A 2QVSB 3CF6E 1ENXA 2QQMA 4IGQA 1TEIA 2FDJA 1H8TC 2G19A 5C70A 3BVCA 1PIV3 2ES3A 5L73A 2B9VA 1W6OA 2VZ1A 4TLFA 4CEWA 1RUE2 2ATFA 2C26A 3VD5A 1EPWA 2QQVA 3ZO0B 4QPIC 3EXUA 4BLJA 5C7GA 5HPOA 3ZYGA 5J98B 5JIAA 3BN6A 1J1LA 4ARYA 3O1SA 3AP5A 3V64A 3VZMA 5CZKA 2YDEA 2WNUB 3WZ1A 2OW4A 1XOYA 3I3BA 5E16A 4QM8A 3EO6A 2VOTA 3ME2A 4CUCA 3O12A 2BGOA 2W46A 3WF4A 4YLZA 4C1XA 4XMAA 1QJZA 1JU3A 2QFEA 4Q4V3 4OHXA 4OMCA 3ST7A 1EP0A 2WNVC 2ARAA 1HN1A 2OUHA 5DZGA 1DGWA 4PBOA 2ADEA 5LRRA 1SFYA 1YI7A 1YFYA 3WV6A 4AI9A 1X8EA 1ZZ6A 1RUC1 1WCKA 2AACA 2J1RA 3SC7X 5FZAA 3WG3A 2EIBA 1LENA 3ZN5A 2VQAA 3VKOA 2BVVA 4BXSV 2XOMA 1W06A 3G7DA 4XFCA 1OOPC 4LK7A 2GNBA 2QTWB 4PBPA 1X82A 3VBUA 5CFCB 1NG0A 2TNFA 5F39A 3VV1A 5ACA2 3C7HA 1VBE3 5I91A 3RMYA 3GZTB 4FPGA 4LPLA 5KBFA 2VMHA 1NY71 2I2SA 3S7IA 2XR4A 1QJY1 1PZ8A 2ZS6B 3KF5A 2FQPA 1CQ9A 1F15A 1POV3 1V9U2 1AJKA 5LCWL 1HXS3 1PVC3 2BNOA 2OZ6A 4MGQA 1REFA 3PMEA 3ZFGA 3ZSLA 1DGRN 1X8MA 4WVVA 3GJBA 4Y4RA 1RUG2 1O7FA 3AKRA 1W6QA 2HWF3 3FX3A 3HOBA 4XC9A 1WW4A 4QU1A 3M4FA 5I0UA 2JIGA 1UOFA 1EAH1 2VCBA 4YG6A 3Q8FA 4W50A 5HXMA 4GULA 5JXJA 5KC6A 1W6OB 3FFZA 1UO9A 1Z78A 2B42B 4Y33A 2R063 4H7MA 3C2UA 3HR9A 1QJU2 2GC1A 4LO6B 1GUIA 4IEPA 4KU7A 2H6BA 1DHKB 2N7GA 3BCWA 3FC0A 2XJUA 5I0TA 5C4WA 3WLUA 2E6VA 1EV12 4NPMA 2WBKA 1LR5A 3PLQA 4WM8C 3ZDSA 3A7QA 5FY0A 4RGKA 1JU4A 1OQDA 1OBNA 4OUEA 4XURA 4CYDA 3RMXA 1H1AA 2K0GA 4AW7A 1YWKA 2HEYF 3NNJA 2CGOA 4QPGA 1JI6A 2VNGA 1CIYA 1R083 1SLIA 2ZHKA 4IEVA 3VZNA 2VD7A 4AG4A 4UW5A 1NLSA 3VUOA 2Q30A 1QJX1 1I6XA 1GLHA 1KQRA 2ZX0A 2XUMA 1HKDA 5F3CA 1VP6A 4PIYA 4RHV2 4XUOA 4D3WA 2OX0A 4OZOA 5FY5A 3Q9OA 4QQ2A 4Q4Y1 1CGPA 4UW6A 4AI3A 2CDOA 1W6PA 4M3CF 4E4HA 1FXZA 2ILMA 3RQ0A 1AUYA 1LJ7A 2JWPA 2P34A 2VAUA 4KQ7A 1UIKA 2QUOA 1D4VB 2D7FA 1AR61 4I30A 4CDXC 1WMDA 1H2KA 5FO7B 3Q8EA 5IYYA 2RR13 3ON7A 1FV2A 1OVPA 2D6MA 1GFF2 1Y9MA 2HWD3 2VMDA 3LOBA 2RDQA 3N9OA 2J1SA 3ZYRA 2J22A 4P9IA 4QX0A 1MQTA 1QJFA 3ZFGB 4MV2A 3V0AA 1GYKA 4FBFA 1JBCA 2V4VA 2GMEA 2Y38A 2ZHMA 1K5MA 2YGMA 5LA2A 1G7YA 1W6QB 1OC1A 3VL8A 1VMJA 1VBC3 2HEWF 2JDHA 2XXZA 4P00B 2ZMNA 5LBFA 3MZHA 1VB4A 1CD3G 4FI9A 1SBFA 2KD7A 4LULA 2DFBA 4HL0A 2DVFA 1BEV3 3F2ZA 1HB2A 4E4SA 3M8LA 2HWB1 5FUNA 2D6OX 2JG9C 1J83A 3O1UA 1AHSA 3RZZA 4UAPA 4CPBD 5DDJ2 3OD0A 1AR92 1S0JA 5KHHA 1SPPB 4N43B 3O7OA 4JGZC 4O9GA 4D6SA 1ZBE2 2E53A 2GN7A 4Q4W3 3WDUA 5J3UA 3I3MA 2W1SA 3OYWA 5C4WB 3HQXA 5FUPA 1N3QA 5A3TA 4LQRA 1CR7A 3K51A 4Y5Z0 2O0OA 3TN93 4F8AA 3T2OA 2Q1FA 5GJ6A 1NXD1 5GLWA 3L9JT 3WNPA 1D4M2 4QPGB 3B94A 5A1AA 2YY1A 2WKKA 3MIEA 4LR4A 1W2TA 1W6NA 4JQTA 4N7UA 4NUBA 4NWVA 5FQ0A 4Q0UA 5DQ0A 2JG8A 5GZGA 2OZJA 4HANA 4EQVA 2WNUC 4YZ4A 2YBSA 4N53B 1MS8A 1SEFA 1COV1 4XFHA 4XIKA 3RYKA 4Y1XA 5FTTC 2WN3A 1ZBA1 2DBIA 2RS51 5L7OC 1ZA7A 4LKFA 5FP3A 1GZCA 4BK4A 5JR2A 2IC1A 4XMIA 3ZXKA 3N36A 4FAGA 5M0TA 1CX1A 5D2AA 3H9AA 4IEZA 1K42A 2PXJA 4RGAA 2R0HA 5FY8A 3JD72 3D4KA 1ZRFA 3SQOA 4E8DA 3K4AA 2DCZA 2QQWA 4AVVA 4C91A 1XE7A 4JDNA 2CY6A 2UYBA 2JDUA 1ASJ1 3OPZA 5FPBA 2JXAA 4FFHA 4URTA 3UNPA 4Q1PA 3PVNA 3HWJA 1MQTB 3V0AB 4I01A 3AX4A 1SLLA 1L7RA 4NHKA 3ZMNA 4CP9A 2CAVA 4IE7A 1K5MB 3THTA 5CKMA 1PZ7A 2Y6JA 2JDYA 5EJ1B 3AYEA 4XZUG 1F5FA 2XJRA 1CESA 2IZWA 1UNBA 2O1QA 1NCRC 2ZEXA 2W08A 4COYA 5G04L 1YNAA 5BYNA 4O61A 5ANQA 4P5YA 1D2QA 1NCQC 3TWIA 3ABZA 4K21A 5FYCA 4BB3A 3GNEA 4NIIA 2VCMA 3VBOA 4XYXA 1CAVA 3ROUA 3FHIB 4JTNA 4R9CA 3O5SA 4LBMA 5JI7A 1STMA 2JENA 1POQA 1YYNA 1C4RA 3NO8A 4MXVA 3KSCA 3BTZA 3FHQA 3OYWB 5FMCA 4KMQA 1OD3A 2DF7A 1PK6A 1OFSA 2MNGA 4YGBA 2O8OA 4OUMA 5F5CA 1QQP2 3H1YA 1GOFA 4H3WA 3URFA 1VPHA 1UL9A 2JG8B 4S2HA 3MV01 4AHWA 1W99A 2VTFA 4LOTA 5T5PA 1N1SA 3NJVA 3PURA 4NAMA 4KU8A 4W8JA 2RE9A 5LY2A 1AR82 4DXZA 5DAVA 5LBEA 3SMHA 3AFKA 4QX8A 1J1TA 5L9BA 5FZ4A 1BBT2 4MGTA 1RHI1 3JBG2 4ZONA 5FY4A 1LHVA 3T09A 4OHYA 5FO9B 1WUVA 2C24A 1YQCA 1V00A 5FKBA 1AYM1 5EJ3A 5A3WA 3QH6A 5L19A 3LZZA 2OYZA 2E26A 3CJIC 4Q2FA 1YFXA 1YIPA 4CP1A 1XU1A 3MYXA
chains in the Genus database with same CATH topology
3I49A 3I3MA 3RZJA 4QKNA 3RZGA 4NIGA 4ZS3A 3T3YA 4O7XA 3RZMA 4OCTA 5DABA 3T4VA 3H8RA 4IDZA 4IE4A 3LFMA 3O1MA 4JHTA 4RFRB 3H8XA 4NPLA 3S5AA 3I2OA 3T4HB 3RZKA 2FDGA 4QKDA 4IE0A 3O1VA 3BTXA 3BTYA 4NIDA 4IE6A 3RZHA 4NIHA 4NPMA 4NJ4A 4QHOA 4IE7A 4NRMA 3RZLA 3BKZA 3BI3A 4QKFA 4NRQA 2FDHA 3KHCA 4O61A 3O1TA 4NIIA 3BTZA 2FDJA 4IE5A 3KHBA 3I3QA 3S57A 3BUCA 4QKBA 2IUWA 4ZHNA 3O1SA 3O1PA 4CXYA 4NRPA 3BIEA 3O1OA 2FDIA 2FDKA 4CXWA 4CXXA 5F8PA 3H8OA 4MGTA 4ZS2A 3O1UA 3BU0A 2FDFA 4NROA 4MG2A 2FD8A 3O1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I49 A;  3I3M A;  3RZJ A;  4QKN A;  3RZG A;  4NIG A;  4ZS3 A;  3T3Y A;  4O7X A;  3RZM A;  4OCT A;  5DAB A;  3T4V A;  3H8R A;  4IDZ A;  4IE4 A;  3LFM A;  3O1M A;  4JHT A;  4RFR B;  3H8X A;  4NPL A;  3S5A A;  3I2O A;  3T4H B;  3RZK A;  2FDG A;  4QKD A;  4IE0 A;  3O1V A;  3BTX A;  3BTY A;  4NID A;  4IE6 A;  3RZH A;  4NIH A;  4NPM A;  4NJ4 A;  4QHO A;  4IE7 A;  4NRM A;  3RZL A;  3BKZ A;  3BI3 A;  4QKF A;  4NRQ A;  2FDH A;  3KHC A;  4O61 A;  3O1T A;  4NII A;  3BTZ A;  2FDJ A;  4IE5 A;  3KHB A;  3I3Q A;  3S57 A;  3BUC A;  4QKB A;  2IUW A;  4ZHN A;  3O1S A;  3O1P A;  4CXY A;  4NRP A;  3BIE A;  3O1O A;  2FDI A;  2FDK A;  4CXW A;  4CXX A;  5F8P A;  3H8O A;  4MGT A;  4ZS2 A;  3O1U A;  3BU0 A;  2FDF A;  4NRO A;  4MG2 A;  2FD8 A;  3O1R A; 
#chains in the Genus database with same CATH topology
 1TQ5 A;  2CSG A;  1U0A A;  2FCT A;  5FY9 A;  2HWE 2;  2Y6L A;  2Y26 A;  4LOR A;  3MUZ 1;  4YZ3 A;  4DEV A;  3ELN A;  4CP9 B;  3LDK A;  1PO1 2;  3VKM A;  4DO0 A;  3P6B A;  4YW6 A;  3RFR A;  3KHC A;  2YHJ A;  4BQX A;  3AKS A;  1PMH X;  3CEW A;  1W2A X;  4QMA A;  1TMF 3;  5B4X A;  4RYD A;  5SV8 A;  5JCT A;  1J59 A;  3X29 B;  3WDW A;  1W9W A;  4Q0P A;  4P9Y A;  1QU0 A;  4QB6 A;  3UKV A;  3LCP A;  5IAX A;  5FZF A;  5A80 A;  2BTV C;  4FPC A;  1KDM A;  4XHX A;  1GZT A;  2WNO A;  3M3I A;  2PA7 A;  3NQH A;  4G9S B;  4BQ4 A;  3VBF B;  1LGN A;  5AFE A;  4IEO A;  1GQP A;  3IPV A;  5A3M A;  3KT4 A;  5F6L B;  3IIA A;  1OA3 A;  1UZY A;  1XJA A;  1ZX5 A;  1MPX A;  1BK0 A;  3KM5 A;  4IV1 C;  2RS1 2;  2VNR A;  2X5I B;  3VD3 A;  4Q8K A;  4FTE A;  1OSG A;  3LDR A;  4IND A;  1PK6 B;  4Z1V A;  3NWK A;  2YPD A;  1C8M 1;  3EYP A;  2WAO A;  3TAY A;  5IK7 A;  1RIT A;  5JMC A;  1WLT A;  4IQP A;  4LXL A;  1GSL A;  1JOP A;  3IMM A;  1FMD 3;  1LRH A;  1H1I A;  3J4U H;  3LA2 A;  5C8C A;  3RS6 A;  1Q8S A;  1ENQ A;  4GB3 2;  4BME A;  5I93 A;  3QLQ A;  1SDD B;  1HB4 A;  2R07 3;  1IKQ A;  5IVC A;  1KXG A;  1CZS A;  1PZ9 A;  2ZOE B;  1PIV 1;  3H1W A;  4EZH A;  1RUD 2;  5D8A A;  5FZO B;  1UPI A;  1LGB A;  3MFC A;  4MOA A;  2WZR 1;  5JAX A;  1HQL A;  4GWN A;  5ABJ A;  1BZW A;  1FAT A;  3I2H A;  3PHM A;  3VB9 A;  4RR3 C;  1O8P A;  5IVB A;  1HRV 1;  1SAC A;  1V6K A;  2V73 A;  1JZ8 A;  4Y3O A;  3CBN A;  4Q8L A;  4HVR A;  4GD4 A;  1RVF 2;  5T5O A;  3A4U A;  4AVT A;  4HZF A;  1OHF A;  1W8T A;  1F5J A;  3BOD A;  4FOV A;  4FP3 A;  1GV9 A;  1LES A;  5CIS A;  3ZXE A;  4XDQ A;  3KVB A;  4Q4V 1;  4B7E A;  3B3Q E;  1WMF A;  1W2U A;  2UWC A;  4YW7 A;  4AEJ A;  4ET7 A;  4EWE A;  2VR4 A;  3DXT A;  4YG3 A;  3O1P A;  1W28 A;  3I3D A;  2YBP A;  4M3C E;  4QHB A;  5CKQ A;  4YWA A;  3ZXJ A;  5A1F A;  1RUE 3;  4LLF A;  2VZV A;  4GXL A;  1GP5 A;  1W8W A;  5D1I A;  4P5H A;  1LOE A;  4DEQ A;  2RM2 2;  5LEK A;  3N7J A;  1BK1 A;  4NHL A;  5FYB A;  1WLD A;  3W5M A;  3IDC B;  3ZKU A;  2B5H A;  1TME 2;  2KA3 A;  4K1Y A;  4XZP A;  1F2N A;  2D6N A;  3IPV B;  5EWS A;  5FY1 A;  5GLZ A;  3ZXF A;  2B4K A;  1K45 A;  1HB1 A;  3NNL A;  4R9A A;  1AF9 A;  1YRZ A;  3H8O A;  1XB9 A;  1ALY A;  1GMM A;  4V2V A;  4UOJ A;  1ULG A;  4RFT 0;  2EVX A;  3ZR5 A;  3BU0 A;  4MG2 A;  2DCT A;  2QZ2 A;  2QQP A;  3WP6 A;  5FZ6 A;  5KR7 A;  3HQR A;  4WM7 A;  1XE0 A;  2GZW A;  1OH4 A;  3MEP A;  2Q8D A;  4LBK A;  3NKG A;  2PHD A;  3L2H A;  4XOG A;  5H9Q A;  5C8C B;  2JKB A;  4GJZ A;  2MEV 2;  1H9P A;  2CNA A;  4NHX A;  5BNN C;  1YHF A;  4BHP A;  4C90 A;  3D5O A;  2RHP A;  3QBQ A;  2P17 A;  5A3U A;  3T3Y A;  4XUN A;  4XJA A;  4QHZ A;  1W8U A;  3MLK A;  3B00 A;  1VBA 3;  2DVD A;  1Z7S 1;  3E6D A;  4QPI A;  4BWO A;  2VOV A;  2W95 A;  1AYN 1;  3AVR A;  4LBN A;  4XEZ A;  4V1P A;  1V9U 3;  4JAA A;  4I0A A;  4IE4 A;  1W8Z A;  1Y9Q A;  2WLQ A;  3FE5 A;  2WR9 A;  4H55 A;  4OYU A;  2Q4S A;  4PLM A;  4YNI A;  3VLB B;  4HN1 A;  2Y6F A;  5CG9 A;  5FXX A;  5C8W A;  4XFF A;  1QH7 A;  5F9T A;  3RG0 A;  1RUG 3;  3ILF A;  4FP2 A;  2B39 A;  4ZZ8 A;  2WNV A;  2Z5W A;  1PNF A;  2HWC 2;  3WDX A;  4PJY A;  5L9R A;  5I0S A;  1G9F A;  4JKM A;  4PDW C;  1JZ4 A;  5CFD C;  2GC2 A;  5DPN A;  2BQP A;  4QB2 A;  5A7O A;  2QQU A;  3ZOI A;  1CZV A;  1QDO A;  3O0X A;  5JOY A;  4BM8 A;  1OOP A;  1UY2 A;  4YAR A;  4NJ4 A;  2V5Y A;  5JXH A;  4QHO A;  2WSV A;  1YLL A;  1VBD 1;  1PX3 A;  2VCA A;  2Y6G A;  3FJS A;  3T2Q A;  2BU9 A;  4AVC A;  1GP4 A;  5C3P A;  2J42 A;  3GF6 A;  2VZQ A;  4ISR A;  4ORF A;  1XE8 A;  2D97 A;  5EFU A;  4HBN A;  4AI1 A;  5IJR A;  4AGV A;  4BH9 A;  2YPJ A;  1BQP A;  3CNA A;  5FZM A;  5E1R A;  3U07 A;  4TTG A;  1J58 A;  1EV1 3;  2YV8 A;  2ZGR A;  3B02 A;  2QE3 A;  5A6Q A;  4RS5 C;  1NOV A;  3ZIX A;  1ND2 C;  2WZP P;  5BNP C;  1DZR A;  4AAP A;  2FZ2 A;  1XRU A;  3ETP A;  4QXC A;  3KCC A;  2RR1 1;  1YQ2 A;  4FFG A;  5F32 A;  3FHA A;  4YFW A;  3JXS A;  3WDV A;  2DTW A;  2HWD 1;  1LEC A;  3III A;  4WM7 B;  2ARC A;  3VBF C;  4J1W A;  4GH4 A;  2WT2 A;  4I2O A;  1ODN A;  4AEM A;  4P14 A;  2BOJ A;  1YFU A;  3I2K A;  1JZ3 A;  3T0A A;  4IET A;  3U4X A;  4MZU A;  4BK5 A;  1TG7 A;  4HN0 A;  4RHV 3;  3RPQ A;  1W3V A;  1VBC 1;  1VMF A;  2B46 X;  3J9S A;  2CAU A;  1VB2 A;  4K1Z A;  5DAQ A;  1DCS A;  2P6H A;  4YM1 A;  4PF5 A;  2W52 A;  2B9U A;  4N90 A;  3UV9 A;  4KWJ A;  3AP6 A;  4S2F A;  3GCW A;  3K3O A;  2ZGM A;  1E5R A;  4UBH A;  2ET7 A;  3JB4 C;  4YVS A;  3DKQ A;  5CB7 A;  3I59 B;  4XAA A;  3MIH A;  2VNO A;  4PIZ A;  4W6W A;  1XNK A;  2SLI A;  3VDB A;  1XNT A;  5BNO A;  5AC9 2;  4YG0 A;  3TN9 1;  2YBK A;  1KEX A;  1ULP A;  3FL7 A;  1MZ5 A;  2YC0 A;  2ZX2 A;  3IWZ A;  4B29 A;  1CON A;  4FOW A;  1MS4 A;  3OPT A;  3AMH A;  1PX4 A;  2VO5 A;  5JR7 B;  3ZKY A;  3OOX A;  4OHW A;  5HCH A;  2WRA A;  4WVZ A;  2Y0O A;  2ZA9 A;  1NQJ A;  5DN2 A;  2ZHN A;  4QGM A;  3RSJ A;  2AC1 A;  2ZAH A;  3LB9 A;  2GNT A;  2PHF A;  3KD4 A;  1C3H A;  5F5A A;  5DDJ 3;  1AR9 3;  4LO8 A;  4PLO A;  4OQ9 A;  4GQ7 A;  2EIG A;  1MS1 A;  3WT3 A;  4D69 A;  1ZBE 3;  4XF4 A;  4NPR A;  1W8F A;  4XJZ A;  3U10 A;  4IEQ A;  1LOF C;  4GJY A;  2BFU L;  1HN0 A;  4JVA A;  4P9X A;  2XBO 2;  4LNV A;  1UZW A;  1RIR A;  1OUR A;  1GZW B;  3SNM A;  2HKX A;  1D4M 3;  2F17 A;  2V72 A;  4BYY A;  3LOI A;  5FZ3 A;  1URX A;  2XLF A;  3PUA A;  3T30 A;  5J36 A;  2AH2 A;  4KG8 A;  3ZYF A;  1JOD A;  4HKL A;  3ZR6 A;  2JD9 A;  2Q1M A;  3H8X A;  4CU8 A;  1IPK A;  2Y33 A;  1OQ1 A;  2W92 A;  3ATG A;  4QX3 A;  1PGL 2;  4MH0 E;  4PI0 A;  1GOH A;  1JN2 P;  2JDZ A;  4CEY A;  3I2O A;  3WG4 A;  2BNM A;  1NQD A;  3VL9 A;  1RMU 2;  2WT1 A;  1BYH A;  1ZZC A;  2TBV A;  1DGR A;  1L7L A;  3VHP A;  1SLA A;  2P5B A;  3LEM A;  2JG9 A;  1J84 A;  3HBZ A;  3RZH A;  2AUY A;  5JPN B;  3POY A;  4FPK A;  4OUS A;  1FOD 2;  1RUN A;  3SCG A;  3OGG A;  1VMH A;  1W3X A;  4XFI A;  1RJ7 A;  4YW4 A;  3OCP A;  2XQX A;  1CPM A;  1W9S A;  3W59 A;  3UK9 A;  3RYP A;  2ZPX A;  3K4Z A;  2VQT A;  2XJV A;  2XKP A;  1PO2 1;  1O6U A;  5FP4 A;  2GND A;  5F3I A;  4HET A;  5BNO B;  1WCQ A;  4GMP 0;  1ND3 A;  3GDB A;  4X8N A;  4B4R A;  4FPL A;  3B69 A;  1B35 A;  2H6C A;  2ZGT A;  4AEK A;  4LBQ B;  1IS6 A;  3QAC A;  1WLC A;  1VJ2 A;  2P6C A;  5LA1 A;  4IE5 A;  3KHB A;  2D6P A;  1DF0 A;  2LRO A;  1ZM1 A;  2IXH A;  3JB8 A;  3CO2 A;  3TB0 A;  1DYO A;  4YVW B;  1RUC 2;  5L7O A;  1QF3 A;  2A75 A;  1UY3 A;  2XWJ B;  5FUI A;  5GM0 A;  1G9A A;  5FIX A;  1KS4 A;  4LBO A;  1WKY A;  3UYJ A;  1MZE A;  4LLO A;  2OII A;  1NA1 C;  1OKO A;  2W91 A;  4RL7 A;  1ST8 A;  2PLV 2;  2WO1 A;  2B8M A;  1GQH A;  1KIT A;  5FWE A;  1FPN 1;  2C5D A;  2DUQ A;  5FYZ A;  3AXD A;  4AL9 A;  1PVX A;  1QQP 3;  3ZYH A;  3USU B;  1NY7 2;  3ORJ A;  2IXI A;  1PM7 A;  2QQI A;  4GA9 A;  4ZU5 A;  1QJY 2;  2MHF A;  2UY9 A;  1VBB 2;  3V56 A;  3VKF C;  2EAA A;  3H50 A;  4XCA A;  1LUL A;  4MGZ E;  2YZ4 A;  1O5U A;  1QEX A;  3N35 A;  1NYW A;  3BB6 A;  4CEY B;  1S0E A;  2VTX A;  1JZ5 A;  3WG2 A;  2WT0 A;  1AR8 3;  4L99 A;  3FFQ A;  5EIY B;  3CQO A;  4AHX A;  4BMB A;  1NCR A;  1W6M B;  1TMF 1;  1KJR A;  2HYX A;  3DYP A;  1ZYB A;  4JKL A;  5CNA A;  3NJX A;  2FD8 A;  2D98 A;  4LJH A;  3WOG A;  1LOD A;  1WCU A;  3VHN A;  3MI8 A;  1SHW B;  1EAH 2;  5DZE A;  3FBY A;  5FZG A;  1OPM A;  1OKQ A;  3AMM A;  4EN8 B;  5C9A A;  3I2F A;  3ETQ A;  4XF0 A;  2Q8C A;  5FMD A;  4K9S A;  2YU2 A;  1R1A 1;  5C3S A;  3N9M A;  4ZS3 A;  3ZFE C;  2PAE A;  4GMP 1;  3WW4 A;  5KXB A;  2PAK A;  4O7X A;  3OUI A;  4CE8 A;  5G05 L;  2PQQ A;  1UWW A;  2CWS A;  4OCT A;  4CCL A;  1AX0 A;  1GR3 A;  1S55 A;  4L2N A;  1ND3 B;  1A8D A;  1GAN A;  1PO1 3;  5IVF A;  5T55 A;  2QQO A;  5H9P A;  1HW5 A;  3UGF A;  1B35 B;  3VDA A;  4KWU A;  5A3N A;  4AGG A;  4COW A;  3ZPO A;  1RUH 2;  3I2I A;  5A32 B;  2W47 A;  3OPW A;  1W39 A;  1PMI A;  1F35 A;  4XJU A;  1FMD 1;  3LFI A;  4NOT A;  2A1X A;  4Y1V A;  1RUI 3;  4RQP C;  1RUO A;  1APN A;  3CDZ B;  4Y1U A;  3WEZ A;  2R07 1;  1TE1 B;  1UU6 A;  3M70 A;  2ARB A;  1EYB A;  4LO7 A;  5FPZ A;  1C5I A;  3MLJ A;  4CUB A;  2G4I A;  2JDN A;  4UBG A;  3J8F 2;  4Q4Y 2;  2RS1 3;  4S2G A;  3U1X A;  3WW1 A;  3THC A;  1CPN A;  2QJV A;  3O0V A;  4AQ2 A;  1YIF A;  3NAP C;  2YXS A;  3WQ7 A;  2RMU 1;  1LOG A;  1YJL A;  2G9G A;  3CJI A;  2EIC A;  2ID4 A;  5IAT A;  1AR6 2;  2BYV E;  2VW1 A;  4MXW B;  2DV9 A;  4UWD A;  1WLW A;  1JYT A;  4NRQ A;  1SQ4 A;  3GZE A;  3AKT A;  3VBR B;  1H0B A;  2WFF 2;  4QX1 A;  1GP6 A;  2PFW A;  5K7P A;  4BQ2 A;  4GB3 3;  2BZD A;  4XHB A;  1W9F A;  2DDU A;  4LO5 B;  1GU3 A;  5FZH A;  1UU4 A;  2ZGL A;  4D6Q A;  1VRH 1;  1RYY A;  1UKR A;  5EYY A;  5I8Y A;  4GWJ A;  4IEY A;  2WSU A;  3LPG A;  1T6B X;  1SBE A;  4UI9 L;  1DFQ A;  1RJ8 A;  2BP6 A;  2WS9 3;  3ZSM A;  3VBS C;  1RUE 1;  2C1F A;  2JB8 A;  1UZ0 A;  2RJL A;  3KS7 A;  5F5Q A;  4M4P A;  3A23 A;  2HBU A;  3WUD A;  5C9A B;  1WD3 A;  2HWB 2;  4HVO A;  3IAQ A;  3N9N A;  5LBB A;  4K40 A;  3GZA A;  1RVF 3;  1SCR A;  2JDA A;  4JV4 A;  2PEL A;  5FZ0 A;  3CJX A;  4XDP A;  3POS A;  2ZAB A;  5A1L A;  2XON A;  4BIS A;  3AZW A;  3TEY A;  2GN3 A;  1DQ5 A;  3UGH A;  1QXJ A;  3CZJ A;  2YB7 A;  5A3L A;  2E7T A;  2ZKN A;  3BOW A;  4FXK B;  3USS A;  2NP0 A;  3VDD A;  2ORZ A;  1R64 A;  1BHG A;  2WO2 A;  4HSL A;  5EZW A;  3KQ4 B;  1UMZ A;  4N9I A;  3VBU B;  4CXX A;  2JJ6 A;  4CDQ C;  2RM2 3;  3WNM A;  4EZ4 A;  1Q8V A;  3B5L B;  3AP7 A;  5EHD A;  4DPN A;  4BE3 A;  3PU8 A;  1G9B A;  1JYI A;  2EA7 A;  3AZY A;  1TME 3;  2WDB A;  4EJR A;  2DFC A;  4XFB A;  4BA6 A;  4F7Z A;  1HQW A;  3PUH A;  4JTO A;  2BDR A;  5DG1 A;  1CN1 A;  4J1X A;  1MVE A;  4U2A A;  3LPF A;  4B8E A;  4DUV A;  1VBA 1;  2RS5 2;  4DXT A;  4FPY A;  2VQ0 A;  3NV4 A;  4CDU C;  1AR7 1;  5JZG C;  1AZD A;  2UWA A;  5FWJ A;  4Q4X 1;  3HT2 A;  2VTX J;  5A6X A;  5KHK A;  3P3P A;  2LM3 A;  5F7U A;  1KD7 A;  3AM2 A;  2WYF A;  3OBZ A;  3DYM A;  3AFG A;  4QT6 A;  1XBF A;  1ASJ 2;  1U12 A;  4X8P A;  1RUG 1;  3ZFF A;  2J1U A;  1IKP A;  2MEV 3;  3TBD A;  1E57 A;  3EBR A;  3HVD A;  3OD4 A;  4PQ9 A;  3DXU A;  3BGA A;  4Z2W A;  4XFG A;  3D8C A;  3ZXA C;  1V0A A;  5BXX A;  2QQK A;  3GM8 A;  1JUI A;  2FBE A;  3KZ4 C;  2E51 A;  4A4A A;  3JU9 A;  3MO4 A;  4JQR A;  4CEW C;  5BUV A;  3J7M A;  2Q0A A;  1GOG A;  2UYA A;  1RUF 3;  2WWS A;  2KM2 A;  2ZZJ A;  4FPE A;  2MPF A;  4I0W B;  5TSW A;  5IT6 A;  2YRO A;  3DL3 A;  3H1M A;  4MVT A;  2DVG A;  3WHT A;  1N1Y A;  2EXH A;  3IDA A;  4P9J A;  2BOI A;  1G9C A;  4HVQ A;  3VZK A;  4XTM A;  1CZT A;  2A6Y A;  2BBA A;  4GKY A;  3VDD B;  2HYK A;  2BBV A;  4NRM A;  4FT8 A;  3RZL A;  2WIN B;  1S2K A;  2IFR A;  4J25 A;  5BNN A;  4YFZ A;  2FDH A;  1W6P B;  3WXP A;  5FZL A;  5DUV A;  4K7J A;  2JDK A;  3LQC A;  4HFS A;  1LCL A;  4RHV 1;  4X6R B;  4OMD A;  4DNY A;  3EJK A;  4Z2A A;  2DTY A;  1UOJ A;  2XVG A;  3PNA A;  2VMI A;  1O8S A;  1BVP 1;  2ORX A;  3AJZ A;  1QKQ A;  2OT7 A;  4NO4 A;  4E27 A;  4A3X A;  3POB A;  1R09 1;  1ZZB A;  1LOC A;  2JB4 A;  3GBW A;  3C3V A;  5CFC C;  3DPR A;  1CAX A;  4JRA A;  2NPI A;  4C0B A;  2ZX3 A;  1NZC A;  2A7A A;  1PGS A;  4LIT A;  4W65 A;  1VRB A;  2IXK A;  1RHI 2;  3WF0 A;  5BPX A;  1DYP A;  4R52 A;  5FP9 A;  4DXR A;  1MEC 2;  1DZT A;  5A7N A;  3GJA A;  3S30 A;  2RDS A;  2W68 A;  1AYM 2;  2VMF A;  3O14 A;  4D7T A;  2BV4 A;  1BVV A;  2CV6 A;  2DBN A;  4LKE A;  3ZFF B;  4YM3 A;  4CXY A;  2JDP A;  3AL6 A;  2VZO A;  1YUD A;  4OLL A;  2ZGQ A;  4LHN A;  5FRE A;  3SKV A;  3ACI A;  1F31 A;  3GHN A;  3H7Y A;  4KL1 A;  3QD6 A;  4XF1 A;  3N7L A;  5FXW A;  3TNQ A;  2FDK A;  2B7Y A;  2A6Z A;  5T5J A;  1YQ6 A;  5FZ9 A;  4ZU7 A;  2QBX A;  1E5S A;  2WII B;  3H7J A;  3VBR C;  3WNL A;  4AR2 A;  3AKP A;  5B4N A;  1MR5 A;  4N7I A;  1W9Y A;  1LGC A;  3GBG A;  1JUH A;  1O91 A;  4LE4 A;  4ZS2 A;  2ZEZ A;  3B9C A;  1LOA A;  3J26 N;  1YXW A;  3P1I A;  3VD4 A;  2AEY A;  4MGK E;  1ZBE 1;  2VXR A;  5J96 B;  4ZXE A;  3S6P A;  2WO3 A;  2J1V A;  4CP0 A;  1ND2 A;  2WUH A;  2BW8 A;  5LK5 A;  4CU9 A;  5AC9 3;  1UN1 A;  2XB6 C;  2ZHL A;  1W6N B;  5FQ0 B;  5FKC A;  4JC1 A;  1LU1 A;  1CAW A;  3UKN A;  4CCE A;  4XAC A;  4F3J A;  4QKN A;  4ONU A;  4MET A;  4CDW A;  3WQ0 A;  3CKH A;  4QQP A;  4TZD A;  4LKD A;  1U5Z A;  2RG4 A;  1C8M 2;  1OLM E;  4Q27 A;  4BQY A;  3T0D A;  5J7M A;  4HKO A;  4C0H A;  1W90 A;  3PL0 A;  2F4P A;  3ZYP A;  3WNX A;  3CMG A;  2X09 A;  3ILN A;  1N1T A;  3OY8 A;  1W0P A;  4ITC A;  4YPJ A;  2RS3 1;  1Y9G A;  2QDN A;  1V6M A;  4XJ8 A;  2VW0 A;  3K46 A;  4ES8 A;  1ULE A;  3BPZ A;  2GAL A;  2I45 A;  1NE4 A;  3B9I A;  4JRL A;  1UAI A;  2D93 A;  2XBO 3;  2XHN A;  3DPR B;  4WVM A;  5FZ8 A;  1PGW 1;  5T54 A;  3LIG A;  5J48 A;  4D94 A;  3T4H B;  3MDP A;  4QDQ A;  2WZR 2;  5JPM B;  2W5F A;  5LAT A;  4B4P A;  4DRR A;  1EUT A;  1HRV 2;  2LRP A;  3H3Z A;  1IS5 A;  3R4S A;  1SFP A;  5FYH A;  4O65 A;  1ZRD A;  1V6N A;  2BRT A;  5LK7 B;  2P3Y A;  1RMU 3;  3ECQ A;  3ZFG C;  2WQ8 A;  4CUG A;  1HRI 1;  2EXJ A;  1I3H A;  2OA2 A;  4AGR A;  4AHY A;  1O5L A;  1HDK A;  2XL7 A;  4Q4V 2;  3VBO B;  4UW3 A;  1CAV B;  2Y60 A;  1LHN A;  3P3N A;  2VVE A;  1PM4 A;  2VZU A;  2UU8 A;  5DAP A;  1O4Y A;  3LE0 A;  1FOD 3;  3JCI A;  2RJK A;  4HPK A;  3HMY A;  4AXO A;  5FZD A;  1HIX A;  1DIW A;  4EN9 B;  1LB2 A;  1UOB A;  5JSR A;  1IS4 A;  1ZRR A;  3AZZ A;  3O1T A;  1UW8 A;  3MID A;  3MW4 A;  4MX3 A;  3T1M A;  1ULC A;  5AFB A;  1LOB A;  3ZSK A;  2K2S A;  4BZ4 A;  1RUJ 3;  1POV 0;  2DUP A;  4N43 C;  3WIN E;  2VL4 A;  4K20 A;  1NZI A;  2VZS A;  4MHR A;  1CAW B;  4XVH A;  5FJH A;  1H4G A;  1QQP 1;  1JHN A;  5C4W C;  1WMX A;  3HNY M;  3VBH A;  3WD5 A;  5FYS A;  1FNY A;  4SLI A;  2XHK A;  1FI2 A;  3LEI A;  2WQ4 A;  5CYY A;  4QPG C;  1E5H A;  5T50 A;  1XYO A;  2P2K A;  3WF3 A;  3IDB B;  2ZCW A;  2A3Y A;  1DGL A;  4E4Z A;  1IPS A;  1IG0 A;  4IV3 A;  2XWB B;  4ERO A;  4AVA A;  4LUK A;  1LHO A;  3KCY A;  1UZZ A;  4N53 C;  5E6H A;  4A6O A;  4AVS A;  1G9D A;  3ZMO A;  5JVV A;  3NMB A;  5GZD A;  2PLV 3;  2K46 A;  4WV8 A;  5K0U A;  1UY0 A;  5DXD A;  5A7W A;  3I2J A;  4A44 A;  4HT1 T;  4I3G A;  4COV A;  4QXB A;  3LWC A;  2BWA A;  4NHY A;  4U36 A;  4ES9 A;  1Z7S 2;  2FDF A;  1XPW A;  1AYN 2;  1QJY 3;  3LEG A;  3WW3 A;  1QHD A;  1ENS A;  1VBB 3;  2P3K A;  5DAX A;  4CZS A;  3I2D A;  3QOP A;  1VAV A;  5CU1 A;  1X7N A;  5C3R A;  1HJF A;  3RRD A;  2JIC A;  5GZC A;  5DZF A;  3GGL A;  1MQT C;  4LO4 B;  2P3I A;  4AED A;  1FAY A;  2VUD A;  1JOB A;  2AEN A;  2PHT A;  2Z69 A;  3DEC A;  4C8D A;  5CAD A;  4NIG A;  1D0G A;  2I74 A;  2RDR A;  1K5M C;  4G3Y C;  2P37 A;  4UFH A;  2AZ5 A;  1X33 A;  3WW2 A;  4HPK B;  1U5Y A;  1VBE 1;  1RUI 1;  5IFT A;  3KV5 A;  3OBR A;  4JGY A;  4HG6 B;  2WYS A;  2ZAA A;  4XCB A;  2HJI A;  3WG1 A;  3I3E A;  2TUN A;  1MZ6 A;  1POV 1;  1VBD 2;  2BGC A;  3FLT A;  2P3J A;  3WF1 A;  1HXS 1;  1PVC 1;  5FDB A;  2RS1 1;  3KT7 A;  4NPL A;  4XXP A;  4XFA A;  1QNW A;  3ZDV A;  3WF2 A;  2Q8E A;  1FX5 A;  3OGV A;  2QQJ A;  4LOS A;  3NST A;  2PAM A;  3VBH B;  1YEW A;  4GWM A;  2OVU A;  3N4M A;  1RUH 3;  2HWF 1;  3MPB A;  3RZK A;  4E9K A;  1OUS A;  1L3J A;  3EMR A;  3LA7 A;  5EQU A;  4D8M A;  4F83 A;  3RYR A;  1KRI A;  3W58 A;  1H8T A;  2W1U A;  2X10 A;  2XJS A;  3BTY A;  1NKG A;  1UF2 C;  4L92 A;  4TWT A;  4ZXK A;  3SLI A;  4GB3 1;  4IE6 A;  5ACA 3;  3H8U A;  3T2P A;  1AXK A;  2XJP A;  5D8A B;  2GC0 A;  2VVF A;  2JG8 C;  1JH5 A;  1WD4 A;  4NAO A;  4IV3 B;  2C0Z A;  2VUL A;  3ACG A;  5ABJ B;  2H0B A;  4YM0 A;  4PHZ A;  2R06 1;  2HLE A;  3DGT A;  2XLA A;  2A3W A;  2WS9 1;  1XU2 A;  4TLG A;  1VBC 2;  5FR3 A;  3CLP A;  3HAG A;  4OI0 A;  1HQN A;  2ZMK A;  3J8F 3;  4Q4Y 3;  3FMG A;  4L8Q A;  4UFM A;  4KH9 A;  1MAC A;  1D0H A;  1QOT A;  3U14 A;  1F9K A;  1AR6 3;  2CGN A;  1I5Z A;  1RVF 1;  4Z8B A;  3R6S A;  3ZLI A;  3V0B A;  3HD8 B;  3POE A;  5IFP A;  1R08 1;  2WFF 3;  3U4S A;  1YQ5 A;  4OI4 A;  1V6L A;  3QH7 A;  3WP5 A;  1REE A;  2C6S A;  4YZ2 A;  3BIW E;  2DU0 A;  1PHM A;  4AED B;  1UYX A;  5C71 A;  1GBG A;  4M4R A;  5FPL A;  4A45 A;  4B7K A;  1QJU 3;  1A3K A;  4LBQ D;  4B1L A;  2R6Q A;  2V09 A;  4ZU4 A;  1S0G A;  1AL0 G;  1DQ0 A;  2RM2 1;  3MF9 A;  3HPN A;  1W8H A;  1N47 A;  5FCC A;  2WAB A;  3HNM A;  3H3L A;  5I8S A;  3K75 B;  3PUS A;  2FHR A;  3POF A;  2NM1 A;  3B01 A;  4UXA A;  5LA9 A;  4BQ5 A;  4EWA A;  2P1B A;  1A34 A;  1SLB A;  2BEO A;  3Q8B A;  4Y5S A;  5JWP A;  2W1W A;  3LKJ A;  4AWD A;  4GZ9 A;  1YI9 A;  3GBF A;  2VC9 A;  3POJ A;  4BCU A;  4AFB A;  1Z0H A;  5FZK A;  3AYC A;  3PU3 A;  4R8H A;  3OGJ A;  4XJ9 A;  3OBA A;  2VZR A;  2QKD A;  2X5I C;  3GZU C;  4NRO A;  5EXO A;  2R04 2;  5FP7 A;  1PK6 C;  3PVE A;  3G6J B;  1JYX A;  1H8T B;  3T0B A;  2G1M A;  5FZ7 A;  4E4D X;  5BV6 A;  3MPP G;  2VU9 A;  1BEV 1;  1T2X A;  4DFS A;  3ES1 A;  3E6B A;  1C1L A;  4FPH A;  4QPI B;  4AFM A;  3RZJ A;  3RZG A;  2KR2 A;  2XH6 A;  5E88 A;  2JE7 A;  4KNC A;  3VD7 A;  2DVA A;  2RS5 3;  3FLP A;  3N9P A;  1N3O A;  3VD9 A;  4FPF A;  3Q8A A;  1Q56 A;  2EAL A;  2D5H A;  5F3E A;  3D6E A;  4Q4W 1;  2J1E A;  2WFP A;  4WM8 A;  3LDB A;  5JOW A;  1RUF 1;  1H1M A;  2K9Z A;  2YFZ A;  5A7S A;  2XDV A;  1DQ4 A;  1OA4 A;  3I8T A;  2YG0 A;  1J3P A;  2WNV B;  5EJZ B;  4YGD A;  1K5J A;  1AL2 2;  2RVA A;  2ZGN A;  3AB0 A;  3CZU A;  4JX0 A;  4P9W A;  4RFR B;  4PF1 A;  1I1E A;  3E5U A;  5FK7 A;  5A3O A;  5GLV A;  2A5Z A;  2VUA A;  1PO2 2;  2AYH A;  3NL1 A;  1ZVF A;  3UKT A;  5KC5 A;  3M3O A;  2ADD A;  4TN7 A;  2E9Q A;  2FMD A;  1OOP B;  1U5I A;  2Y64 A;  2FDG A;  2L9L A;  1TVG A;  4NE9 A;  1XQN A;  3SH5 A;  2E7Q A;  4MGY E;  2W9X A;  3BTX A;  4AOC A;  4XAE A;  1KGY A;  3ACF A;  3OB8 A;  5FAX A;  1V6O A;  3RI8 A;  5FO8 B;  4CDX A;  2FMY A;  3VDC A;  2DYC A;  1CWP A;  5FPX A;  4NWW A;  1X9T A;  5F2S A;  1A8M A;  2EXI A;  4Q0Q A;  1W03 A;  4CDU A;  5HCA A;  5IVE A;  5JZG A;  1BLZ A;  4QKF A;  2ZGP A;  4W4Z A;  1SDW A;  4GH4 B;  5IWF A;  4KI5 M;  4RD7 A;  3MF6 A;  4P08 A;  1QGL A;  5IVJ A;  1WW7 A;  2Z42 A;  1RTV A;  3SEE A;  3PDQ A;  1FPN 2;  4BJ0 A;  3TNP B;  4CCO A;  2OXB A;  1BMV 2;  4XW3 A;  1T6G C;  5F5I A;  1RL3 A;  1IQD C;  1IGO A;  4DXS A;  5A33 A;  1XC6 A;  2UWB A;  4YM2 A;  1HLC A;  2UUR A;  4QQO A;  1CAU A;  2BFU S;  2XG3 A;  2VW2 A;  2BNN A;  3JD7 3;  3JUU A;  4S2D A;  5C8C C;  2IWG B;  2GMP A;  3BUC A;  1Y43 B;  2R16 A;  1DGW X;  2IFW A;  3A21 A;  3IT8 A;  1XXN A;  2D40 A;  1VLN A;  3KB5 A;  3IKW A;  4JGZ A;  5FMO S;  4YVS B;  2VM9 A;  1MS3 A;  3H42 B;  5K9Y A;  2R30 A;  4K3U A;  1TMF 2;  1TZO A;  2EAK A;  1OQE A;  1H30 A;  4QQH A;  4NIA A;  4ASK A;  3DKW A;  1YCI A;  1DDL A;  4WM8 B;  1WA6 X;  2VXJ A;  2BER A;  1N1V A;  3SIS A;  2WL1 A;  1H6X A;  4URA A;  1IQA A;  2VY0 A;  1RHI 3;  2ZX4 A;  2SBA A;  1KS5 A;  1MEC 3;  3V65 A;  1SCS A;  1N3P A;  3IB3 A;  1WW5 A;  2Y6H A;  3T2T A;  3W20 A;  3DEM A;  1EY2 A;  2VBP A;  4DRV A;  1R1A 2;  3VKL A;  4CXW A;  4KG0 A;  4R9B A;  4LHS A;  2JDM A;  3C7O A;  2WNU A;  4H14 A;  4GWI A;  4LBJ A;  4Z82 A;  1OF3 A;  3ZXD A;  3UES A;  4WVW A;  5FXZ A;  5CIR A;  1LU2 A;  3RI9 A;  1QJE A;  1QOS A;  4AAX A;  1U5X A;  1QH6 A;  4LBL A;  4ATE A;  3MV1 1;  5E89 A;  4ARX A;  2E32 A;  4XBQ A;  3SEP A;  2B45 X;  3WSO A;  1BCX A;  4PIX A;  2W39 A;  3O1R A;  4ZY9 A;  1RXG A;  2D6L X;  2OQ7 A;  3LA3 A;  1BKZ A;  1ULO A;  2XJT A;  1G8W A;  2YC2 A;  1W2N A;  4DY3 A;  1FMD 2;  1W8N A;  5T5L A;  3KLS A;  2CGP A;  2WNE A;  1W0N A;  4JDM A;  2DU1 A;  3ITQ A;  4MGI E;  1GWK A;  3E5Q A;  2R07 2;  5FY7 A;  2Q1Z B;  3AJY A;  3MFA A;  2LAL A;  2DUR A;  2WWU A;  3OJB A;  2E31 A;  3KV9 A;  4IER A;  3T4V A;  3H8R A;  2YUE A;  4YZ5 A;  4BDV B;  5FZI A;  4DY5 A;  3AK0 A;  3DYO A;  3ZN6 A;  1QXP A;  5LEJ A;  1X50 A;  4KGG A;  5FJK A;  3WNO A;  2JE9 A;  4DZG A;  3B93 A;  2RMU 2;  4LHK A;  1C8M 3;  1I5P A;  2O8Q A;  3I97 A;  2YFU A;  3KF3 A;  4XJW A;  1PGL 1;  1JYN A;  4RGG A;  4DQA A;  1F8V A;  1BXH A;  4WM7 C;  4A3Z A;  1KFU L;  1NCQ A;  2JG9 B;  5A33 B;  1BBT 3;  4N8M A;  3S5A A;  4IGP A;  1RMU 1;  3JBG 3;  3WX5 A;  2IXJ A;  4QGN A;  3PJQ A;  1Y4W A;  3TRS B;  1OH3 A;  2XQR A;  4BQW A;  2GH8 A;  3DUI A;  3SHR A;  3MIC A;  3WP4 A;  3IZO A;  1VRH 2;  1ZRE A;  3ZN4 A;  2EF6 A;  1FOD 1;  4NN0 A;  2OKX A;  1QOO A;  5FZC A;  4GIQ A;  2VH9 A;  5FPV A;  2HWE 3;  3O0W A;  2GSY A;  4PCR A;  1DG6 A;  4E2S A;  1UOG A;  2WZR 3;  1HX6 A;  1VAK A;  1Q5O A;  4Q5O A;  3QCW A;  4XBL A;  5LZ6 A;  3POW A;  4BPZ A;  1HRV 3;  4QB1 A;  1SBD A;  1RUJ 1;  1VR3 A;  3DV8 A;  4IGO A;  1QXR A;  5EP9 A;  1VE0 A;  3SCF A;  1X9P A;  3U37 A;  2YMZ A;  4BIF A;  1US3 A;  4FQ4 A;  4CP2 A;  2VQU A;  4KGQ A;  5FZB A;  5L7O B;  5IHR A;  1PNG A;  1YO8 A;  5DUW A;  4K8R B;  1QJX 2;  2XUE A;  1Y7B A;  3WY6 A;  3NNF A;  4LE3 A;  4TXW A;  3ZPY A;  3AP4 A;  4D7Y A;  3SIT A;  1JW6 A;  4QQL A;  2VVD A;  2XGX A;  4ASL A;  4GKX A;  4H7L A;  4QX7 A;  5JSP A;  1OVS A;  4XUT A;  5CAZ A;  5KWR A;  3HN3 A;  4ISQ A;  1DQ1 A;  2WWJ A;  3KT1 A;  1UX6 A;  2PLV 1;  2PN5 A;  2ZGU A;  3OG2 A;  4LUM A;  3ZIW A;  4AQT A;  1NUK A;  3OF1 A;  4D0Q A;  4KBZ A;  4A7K A;  4CCJ A;  1W9T A;  4IEW A;  2YYO A;  2Z2S B;  3NJZ A;  1VBA 2;  1OXC A;  4NR1 A;  5LA0 A;  2HH9 A;  1DLL A;  3MIB A;  2VOW A;  1AR7 2;  4P9G A;  3ZN6 B;  1XYN A;  2ZGS A;  4Q4X 2;  4XDO A;  4HOO A;  5A6Y A;  4M0H A;  1NX9 A;  1VBB 1;  4YZ1 A;  5DUX A;  2FDI A;  1NCR B;  2D5F A;  1UQX A;  4EV0 A;  4IEU A;  3WVJ A;  1RUD 3;  3S0M A;  2CU5 A;  2ARE A;  3FUO A;  1NCQ B;  1HB3 A;  2A70 A;  4GH4 C;  1V70 A;  5F8P A;  3SH3 A;  2PHX A;  1OA2 A;  2YGL A;  1C8N A;  3OBT A;  4R4X A;  4GAZ A;  5GLU A;  1RXF A;  4DMI A;  3OGR A;  3OTF A;  4NVP A;  4YW1 A;  1ZA4 A;  1ODM A;  3PUI A;  1H9W A;  3R4U A;  1DP0 A;  3HBK A;  1O3R A;  1S2B A;  4IV1 A;  4UFL A;  2W0X A;  1Z7S 3;  2HEV F;  4JKK A;  1IZ3 A;  1AYN 3;  5EV7 A;  4TYS A;  2VUC A;  1SPP A;  1OLM A;  2JE8 A;  4N43 A;  3OGS A;  3RZM A;  3HQU A;  4YVS C;  2VCC A;  5C3O A;  3MW2 A;  1F4H A;  1XND A;  2LTN A;  3MW3 A;  4NMI A;  1SLT A;  1ULD A;  3IMN A;  5BNO C;  2VE1 A;  1RUH 1;  5KHI A;  1C5H A;  2F6B A;  4LA2 A;  4PLN A;  4EWD A;  5SV5 A;  1O4Z A;  2R1B A;  2XML A;  1LEM A;  1COV 2;  3M3Q A;  5HXV A;  5ACA 1;  3KGL A;  1ZBA 2;  3R4D B;  3U11 A;  4QPY A;  3ZYI B;  1QY4 A;  1S0I A;  4Y1Z A;  3OEA A;  3NV2 A;  3E97 A;  4DUX A;  4FPO B;  4N53 A;  4OVE A;  5CBL A;  5CVR A;  4NHM A;  5IVV A;  3K48 A;  4RR3 A;  4AVB A;  1V9U 1;  4M00 A;  4W6X A;  1VBD 3;  4XXA A;  4YVW C;  3WCR A;  4QD2 A;  3SXW A;  3CJI B;  4EYU A;  1NLQ A;  1L7Q A;  3J8F 1;  3A0N A;  1O4T A;  5IK8 A;  3ZSJ A;  1CVN A;  3C7G A;  1S1A A;  3AKQ A;  4NID A;  2PYT A;  4W6Y A;  1R09 2;  3OEB A;  3WHU A;  3C7E A;  5FZ1 A;  4IW3 A;  5APA A;  1Q3E A;  4AE2 A;  3NW4 A;  4JDO A;  1GNH A;  4LMF A;  5GKA C;  1RC6 A;  1UXZ A;  1KJL A;  2RJ2 A;  2WFF 1;  4OUL A;  1ZZ7 A;  5FK8 A;  4L97 A;  3BI3 A;  4CSW A;  2PMW B;  3AP9 A;  5FBJ A;  1UZV A;  4A7Z A;  1LHW A;  1NXM A;  5K4L A;  2ZAC A;  4JCK A;  4E2G A;  2Y8K A;  3WCS A;  3UET A;  1LAJ A;  4AQ6 A;  3K4D A;  3N7M A;  4YW3 A;  1QJU 1;  4CEY C;  4YYO A;  3JQX A;  2R1D A;  3VHO A;  2BJS A;  2DCY A;  3NVC A;  5JUV A;  1EUU A;  2ZEY A;  4IV1 B;  1EV1 1;  2X29 A;  4AQS A;  1JZ6 A;  5AVA A;  1UMI A;  5J37 A;  5FXV A;  3MIF A;  1CJD A;  1NAE A;  1RGS A;  2PHU A;  3ENR A;  2XJQ A;  1FNZ A;  3IM0 A;  4XTP A;  3T08 A;  5ISL A;  1H2L A;  2HWC 3;  1K12 A;  4CRQ A;  4FXG B;  2XVK A;  1OLR A;  2R32 A;  4N9H A;  4QDS A;  1GNY A;  4EN0 A;  4ZHN A;  4CCN A;  2ARX A;  1C1F A;  2V4A A;  3AYA A;  5K8S A;  3RVH A;  3B7M A;  5FP8 A;  4I0B A;  1O59 A;  2EIE A;  4NRP A;  3LF7 A;  4AF9 A;  3BIE A;  3LGR A;  4CVU A;  2EID A;  2WLP A;  3PTY A;  3S5Q A;  1C57 A;  2ZKL A;  4Y22 A;  4CU6 A;  5I0R A;  1ND3 C;  4MAD A;  3PVB B;  4UF0 A;  3PIG A;  3H0O A;  3CHX A;  2VBD A;  2X53 S;  4XUQ A;  5C33 A;  2A6V A;  5FOB B;  1B35 C;  2CHH A;  2ZML A;  4X6Q B;  3IBM A;  1P8J A;  4O9E A;  5BNQ A;  4BOW A;  3NKT A;  1V6J A;  1GWM A;  1S0D A;  3OSD A;  1AX1 A;  3TEX A;  1JXN A;  3I54 A;  4Q0S A;  4RR3 B;  1V6I A;  3GAL A;  2FZ1 A;  2VMC A;  1GKB A;  2RS3 2;  1JZ2 A;  4YSF A;  4L0P A;  4QU2 A;  4AFA A;  1W8O A;  3TEZ A;  3S7E A;  3F95 A;  2E63 A;  5CG8 A;  3Q8C A;  4M3C A;  1ULF A;  4DOU A;  4PI2 A;  3J7H A;  4XAB A;  1XYP A;  1ENR A;  2ET1 A;  1O3Q A;  2GNM A;  4FOY A;  2G9Z A;  2R04 3;  2KXL A;  1TNR A;  1PGW 2;  2QZ3 A;  4PDW A;  4Q26 A;  4IEX A;  5CFD A;  2PQS A;  3FN9 A;  4QPW A;  3W5N A;  4HSJ A;  2CTV A;  2R49 A;  3M3C A;  5T3N A;  2WA4 A;  3PMS A;  4XQW A;  5LRS A;  2O14 A;  3RGB A;  3KV6 A;  2D3R A;  1E5I A;  4FVV A;  4E2Q A;  1WZX A;  4XQ4 A;  1OF4 A;  3A22 A;  2BPA 2;  3AZV A;  2X05 A;  5DDJ 1;  1AR9 1;  5J1X A;  5FYU A;  3ALQ A;  4UFI A;  2IVJ A;  4HXC A;  5DUU A;  1HRI 2;  3LFM A;  3ZYB A;  4CPB A;  3O1M A;  4OHV A;  3P5B A;  1MZF A;  2IVI B;  4G4F A;  4H2A A;  5FYI A;  2JKX A;  5BNP A;  4RS5 A;  1GNZ A;  1UY1 A;  3VGI A;  3LEK A;  4Y24 A;  4ATF A;  4YGC A;  2F4L A;  1W04 A;  2DCJ A;  4CCC A;  2GDF A;  1AL2 3;  1D4M 1;  4KBB A;  3VBF A;  5C9A C;  2WO7 A;  3AL5 A;  1JHJ A;  1UMH A;  5CKN A;  1H2M A;  1PO2 3;  1S0B A;  5FBZ A;  4A2U A;  1DYK A;  3AMP A;  5BNN B;  2X5I A;  1YJK A;  4NIH A;  1O3S A;  1SFN A;  5LY1 A;  1UXX X;  4Y22 B;  2DVB A;  1H4H A;  4UF0 B;  1LED A;  2QNK A;  3ZM8 A;  3BKZ A;  3MIG A;  3SH4 A;  2ENR A;  5DAW A;  5IK5 A;  3U78 A;  1F4A A;  1QDC A;  2J1A A;  5JLV A;  3OUH A;  2Z79 A;  1W05 A;  2BWC A;  1C28 A;  2VZ3 A;  3JD7 1;  3VBU C;  1CAX B;  1PIV 2;  4LA3 A;  5C5U A;  4A41 A;  3VZO A;  5FLJ A;  2E7A A;  4LHL A;  4A7Y A;  5L9V A;  3R05 A;  1FT9 A;  4MGS A;  4A6S A;  3GHM A;  3BYW A;  5FZO A;  3ZX7 A;  4M3C B;  3IDE A;  2VEC A;  4BXF A;  4PT6 A;  3LSE A;  4UT5 A;  1OFN A;  2XVL A;  3A0K A;  4R4Z A;  1FPN 3;  1MEC 1;  5F6K A;  3WDY A;  4AI2 A;  3FZ3 A;  3U75 A;  4FAH A;  5KXE A;  1H6Y A;  1ZRI A;  3AYD A;  3NJY A;  4PDW B;  4EN6 B;  5CFD B;  2IUW A;  3AMQ A;  4R9D A;  1AX2 A;  1JOJ A;  4QGL A;  4XBN A;  3BOP A;  3UGG A;  5KHG A;  2R0F A;  1UD1 A;  1CIW A;  4Y26 A;  3RWN A;  3WNN A;  3TOJ A;  1NLR A;  2CL2 A;  2BGP A;  4XET A;  1NE6 A;  4LKS A;  2VJX A;  3N9L A;  3NNG A;  3POI A;  2VME A;  1LOF A;  3R0R A;  5BNP B;  1MS0 A;  4RS5 B;  1GZ9 A;  1ND2 B;  1JTZ X;  2QQL A;  4LIU A;  5A6Z A;  2Y6K A;  2WJS A;  3VKN A;  1RIN A;  3ILR A;  2JX9 A;  1VBE 2;  1RUI 2;  4LTA A;  5FPA A;  4CDW B;  2LUW A;  5H9S A;  1R1A 3;  1WGP A;  2FCU A;  2PHW A;  2NYY A;  3MGU A;  1J3Q A;  4LK6 A;  1J3R A;  4GMP 3;  4WZC A;  2W3J A;  3NNM A;  1QNY A;  4OI2 A;  4E8C A;  4LT5 A;  2A6X A;  1WW6 A;  1UYZ A;  2DCK A;  1HXS 2;  1PVC 2;  4XUP A;  5LAS A;  4XPV A;  1RUC 3;  2DUO A;  4FQZ A;  3GCX A;  5HI0 A;  1UYY A;  3K2O A;  3OY8 B;  4OI1 A;  3AXE A;  4UW4 A;  1AR8 1;  2W2I A;  3IAP A;  5JMO A;  5JXI A;  3UJQ A;  1WWY A;  4YGE A;  4CCM A;  5JOX A;  1A6C A;  2HWF 2;  3VDD C;  1ACC A;  3W21 A;  3WQB A;  4Y20 A;  4BLI A;  1BBT 1;  4YW2 A;  5HV4 A;  2D3P A;  4BQ3 A;  4AHZ A;  3JBG 1;  3RNS A;  3KV4 A;  1S0C A;  3NV1 A;  4MYE A;  1SLC A;  4WVM B;  4COU A;  1HV1 A;  2D44 A;  3ACL A;  1OT5 A;  3VZJ A;  1Q43 A;  4EE2 A;  2ETE A;  3WP3 A;  1RB8 G;  1OI6 A;  1M06 G;  4QDR A;  2VGD A;  4HMZ A;  2R06 2;  4AI8 A;  4MUV A;  1TNF A;  2WS9 2;  2HWE 1;  3WNK A;  5CEH A;  3GXU A;  4WZF A;  2DWR A;  1PO1 1;  1YQ8 A;  3LAG A;  4CA9 A;  1UCX A;  2RMU 3;  3HJR A;  3UJO A;  4QKD A;  2V5D A;  5ANN A;  3TEW A;  3FBM A;  5A3P A;  5JOZ A;  1HJG A;  2XKO A;  1GWL A;  1IPJ A;  2VNV A;  3KWV A;  4IE0 A;  4B3N A;  1VAM A;  1NT0 A;  5F1R A;  3O1V A;  1ZRC A;  1CX4 A;  2XLG A;  1EAH 3;  3LIH A;  4JHZ A;  1QWR A;  1R08 2;  4P9L A;  4IES A;  1OUX A;  2NLR A;  2GC3 A;  4PQQ A;  5FMB A;  3WUC A;  4BQ1 A;  2A6W A;  3ZFF C;  4CU7 A;  2XL9 A;  1VRH 3;  1FV3 A;  2OQ6 A;  3FUQ A;  3KGZ A;  4QAW A;  1NA1 A;  4YRD A;  1SG3 A;  5FZE A;  1IG3 A;  1O3T A;  3IN9 A;  4C1W A;  4I02 A;  4M0N A;  4ZKT B;  4FO9 A;  3VHR A;  4CUA A;  4FFI A;  5I0D A;  2W94 A;  1YFW A;  4FFF A;  2D6K A;  3OUJ A;  1LTE A;  2WC2 A;  3RJ2 X;  3ZYJ B;  4B1M A;  1WME A;  2P4E A;  1WCD J;  3I4I A;  2QDR A;  4QX5 A;  4I3P A;  5F37 A;  3PUQ A;  4DIN B;  5HCF A;  4DUW A;  1IOA A;  1DLC A;  2RR1 2;  5GAL A;  5FRA A;  2HWD 2;  1Q8O A;  4Q0V A;  4FSJ A;  3I3Q A;  4QXK A;  1QJX 3;  3NV3 A;  2X8K A;  1AXY A;  2IXL A;  4SBV A;  2GU9 A;  2I07 B;  2Z4F A;  1K3I A;  1RUD 1;  4AYU A;  2IXC A;  4Y20 B;  5ERL A;  5C5T A;  4OZX A;  4CCD A;  5FYT A;  3JQW A;  5K0U B;  5A7W B;  3WQ1 A;  1WBF A;  3MLL A;  3O1O A;  1BEV 2;  1Q8Q A;  3T1L A;  1M4W A;  3ZFE A;  4IL7 A;  1UY4 A;  5FYV A;  1W0O A;  3HEI A;  1I9R A;  3PTR B;  2ZEW A;  1AR7 3;  2C9K A;  5LWB A;  3I2G A;  4Q4W 2;  1G86 A;  4Q4X 3;  4XIO A;  1IHM A;  3DPR C;  4BIO A;  2GP3 A;  2H0V A;  1RUF 2;  1OMI A;  1QMJ A;  1KFX L;  3HIF A;  3I59 A;  4UFJ A;  3TN9 2;  3WDT A;  5C6C A;  5KXD A;  4FTS A;  2RDN A;  4K8F A;  3THD A;  1AJO A;  2JEM A;  4QWN A;  3U0Z A;  2D3S A;  4L9B A;  3SCH A;  2VBB A;  4RQP A;  5D21 A;  5B2G B;  3I49 A;  1S4C A;  5DMY A;  4KWL A;  4JGY B;  1SMV A;  4QXH A;  3LD8 A;  2OPW A;  2HWB 3;  3PIJ A;  5IW0 A;  1TME 1;  4Z92 B;  5LBC A;  2GMM A;  4D6R A;  3J7L A;  1NA1 B;  1LKN A;  1MVQ A;  3H3U A;  2OUJ A;  4AFC A;  3M7A A;  5JI9 A;  3POG A;  3VBO C;  1W2O A;  5L36 A;  3NAP A;  1PMJ X;  4ASM B;  1UYP A;  3HT1 A;  2PHL A;  4AZZ A;  3PVO A;  3EQE A;  5FOJ B;  5AVP A;  1H8V A;  2LS6 A;  5KXC A;  1UIJ A;  4JHT A;  5JSO A;  4FTB A;  4HKW A;  3BPS A;  5E8A A;  1AVB A;  1UX7 A;  3UT0 A;  4LIV A;  4B4Q A;  2MEV 1;  3K77 A;  4XF9 A;  3MHZ A;  4Y4Y A;  5HCB A;  2YU1 A;  3N3H A;  1GZW A;  1ZNP A;  4XE9 A;  1OD5 A;  5GZF A;  4ZZ5 A;  2Y0I A;  3LSD A;  1SZB A;  2NZ9 A;  3D0J A;  1COV 3;  3DN7 A;  4MO3 M;  3ZXG A;  1LNS A;  4CTE A;  5KHJ A;  4K6B A;  4CDW C;  1ZBA 3;  5GLT A;  3VBS A;  5J09 A;  2BUK A;  4WBB A;  2ZJC A;  3DF0 A;  3E5X A;  2W87 A;  3ZVX A;  5HBA A;  2A71 A;  2J1T A;  3RJR A;  4QX2 A;  3L2Y A;  5F3G A;  3ZXL A;  3ZFE B;  2AR6 A;  3J7N A;  4V2W A;  3HN1 A;  1EPZ A;  2WZE A;  4Q29 A;  1US2 A;  2C9A A;  4AI0 A;  3V0B B;  1IS3 A;  1ASJ 3;  2FCV A;  3AC0 A;  3MBW A;  4Y5T A;  1R09 3;  2W1Q A;  1YC6 1;  1S0F A;  5F2W A;  1DU3 D;  2WN2 A;  5A7Q A;  5JXG A;  2WQZ C;  4ZPI A;  5FYY A;  2HWC 1;  4BU2 A;  5LW9 A;  2OS2 A;  4HON A;  3EHK A;  2VUJ A;  4XQD A;  4OQ8 A;  4MLO A;  5FPU A;  5IK4 A;  4RN5 A;  2XPJ A;  2WAA A;  4CDQ A;  3CIH A;  4Y1Y A;  2GP5 A;  4RQP B;  2QQN A;  2NQY A;  2PHR A;  4KWK A;  5IVY A;  3S57 A;  2ZGO A;  2E33 A;  2A73 B;  3CU7 A;  4QKB A;  3DCQ A;  3KMH A;  3KQR A;  4HK9 A;  4LBQ A;  4FCA A;  4IXL A;  5A7P A;  2WA3 A;  1BJQ A;  2AEZ A;  3KCX A;  2TEP A;  3M3E A;  3W9A A;  1Q8P A;  1WBL A;  3NAP B;  2C4X A;  1GIC A;  2GAU A;  4YVW A;  3ACH A;  1DQ6 A;  2ZXQ A;  4I09 A;  4Q1R A;  4YW5 A;  1JMU B;  3VN4 A;  1OPO A;  4LEJ A;  4QM9 A;  5JDB A;  3CL1 A;  4P02 B;  3I7D A;  4XF3 A;  2GH2 A;  2OPK A;  3BU7 A;  2D43 A;  2CYF A;  2VG9 A;  1JZ7 A;  2ZTN A;  3UL2 A;  1MS5 A;  1QIQ A;  4EN7 B;  1DZQ A;  2VZP A;  1D2S A;  4AK3 A;  5FMO L;  2R04 1;  5A70 A;  2EXK A;  2RV9 A;  3USU A;  3ZSE A;  2VMG A;  3ASI A;  2NMO A;  3VBH C;  4UYB A;  3VZL A;  2J7M A;  1JYC A;  1XSQ A;  3SKJ E;  4OFG A;  3VBS B;  3AZX A;  3PJY A;  2PTM A;  3C8X A;  2BVB A;  2HBT A;  1MS9 A;  1RED A;  3D3A A;  3APB A;  3ES4 A;  1UPS A;  1XNB A;  1XNC A;  2Q5T A;  2VZT A;  5I8T A;  5D8A C;  5H9R A;  2RS3 3;  4RA0 A;  3RDI A;  1W6M A;  3FWE A;  5FLH A;  3HNB M;  5DG2 A;  1XNA A;  1GQG A;  2LW8 A;  4IV3 C;  4XIL A;  5ABJ C;  3NRU A;  5EYX A;  5IAV A;  1AYM 3;  1WA4 A;  5FFO C;  5FLI A;  5FYM A;  5JIU A;  5AC9 1;  1UU5 A;  3INA A;  4COZ A;  5DAB A;  5T52 A;  4HLT A;  4RSU A;  5K0U C;  5GZE A;  3AVS A;  2JEC A;  1AL2 1;  3MUY 1;  4JZR A;  3N7K A;  4IDZ A;  1ZZ8 A;  5LB6 A;  2ZGK A;  5IUQ A;  2JIJ A;  1HV0 A;  3TYJ A;  1JS9 A;  1WCS A;  2ZBJ A;  1KDK A;  4CDQ B;  1JYV A;  3N9Q A;  5HV0 A;  1UKG A;  5BY5 A;  2AGS A;  4DIQ A;  1AXZ A;  1RUJ 2;  2R7E B;  3EB7 A;  4UFK A;  5FV3 A;  1G6N A;  2JD4 A;  4J6G A;  1S2E A;  4DS0 A;  1OLQ A;  2VOX A;  4CDX B;  1FYU A;  2A3X A;  1HRI 3;  2ZX1 A;  3GYD A;  3D82 A;  1R1Z A;  4L11 A;  2UY8 A;  5A32 A;  4AED C;  4CCK A;  4DB5 A;  1CJP A;  1H2N A;  4MHU A;  4TSV A;  4CDU B;  5CFC A;  5JZG B;  3E6C C;  1A78 A;  3C7F A;  1D7P M;  4D7S A;  2XBO 1;  3RWK X;  4HK8 A;  3BTA A;  1XSR A;  1VAL A;  4MSV A;  4A42 A;  2ERF A;  4IUG A;  3BAL A;  1DQ2 A;  5C3Q A;  4JGY C;  1ONA A;  3E1F 1;  2ZZQ A;  1X36 A;  2G9F A;  1JYW A;  2WZ8 A;  3M1H A;  3M2M A;  3FLR A;  1ZZ9 A;  2VOK A;  2YC4 A;  2QCS B;  4FPJ A;  5EPA A;  5CA6 A;  3THP A;  3D0S A;  2NMN A;  2VPV A;  3JZV A;  2CDP A;  3K3N A;  4FOQ A;  4M01 A;  1LHU A;  2CWM A;  2Q8O A;  1CAU B;  3KVA A;  1BMV 1;  3WR0 A;  1VIW B;  4MXW A;  1DBN A;  1B09 A;  3AMN A;  2Y34 A;  4GAL A;  4OHZ A;  4CEW B;  2NN8 A;  4JGZ B;  1Y3T A;  3VBR A;  4AFD A;  4Z07 A;  2QVS B;  3CF6 E;  1ENX A;  2QQM A;  4IGQ A;  1TEI A;  2FDJ A;  1H8T C;  2G19 A;  5C70 A;  3BVC A;  1PIV 3;  2ES3 A;  5L73 A;  2B9V A;  1W6O A;  2VZ1 A;  4TLF A;  4CEW A;  1RUE 2;  2ATF A;  2C26 A;  3VD5 A;  1EPW A;  2QQV A;  3ZO0 B;  4QPI C;  3EXU A;  4BLJ A;  5C7G A;  5HPO A;  3ZYG A;  5J98 B;  5JIA A;  3BN6 A;  1J1L A;  4ARY A;  3O1S A;  3AP5 A;  3V64 A;  3VZM A;  5CZK A;  2YDE A;  2WNU B;  3WZ1 A;  2OW4 A;  1XOY A;  3I3B A;  5E16 A;  4QM8 A;  3EO6 A;  2VOT A;  3ME2 A;  4CUC A;  3O12 A;  2BGO A;  2W46 A;  3WF4 A;  4YLZ A;  4C1X A;  4XMA A;  1QJZ A;  1JU3 A;  2QFE A;  4Q4V 3;  4OHX A;  4OMC A;  3ST7 A;  1EP0 A;  2WNV C;  2ARA A;  1HN1 A;  2OUH A;  5DZG A;  1DGW A;  4PBO A;  2ADE A;  5LRR A;  1SFY A;  1YI7 A;  1YFY A;  3WV6 A;  4AI9 A;  1X8E A;  1ZZ6 A;  1RUC 1;  1WCK A;  2AAC A;  2J1R A;  3SC7 X;  5FZA A;  3WG3 A;  2EIB A;  1LEN A;  3ZN5 A;  2VQA A;  3VKO A;  2BVV A;  4BXS V;  2XOM A;  1W06 A;  3G7D A;  4XFC A;  1OOP C;  4LK7 A;  2GNB A;  2QTW B;  4PBP A;  1X82 A;  3VBU A;  5CFC B;  1NG0 A;  2TNF A;  5F39 A;  3VV1 A;  5ACA 2;  3C7H A;  1VBE 3;  5I91 A;  3RMY A;  3GZT B;  4FPG A;  4LPL A;  5KBF A;  2VMH A;  1NY7 1;  2I2S A;  3S7I A;  2XR4 A;  1QJY 1;  1PZ8 A;  2ZS6 B;  3KF5 A;  2FQP A;  1CQ9 A;  1F15 A;  1POV 3;  1V9U 2;  1AJK A;  5LCW L;  1HXS 3;  1PVC 3;  2BNO A;  2OZ6 A;  4MGQ A;  1REF A;  3PME A;  3ZFG A;  3ZSL A;  1DGR N;  1X8M A;  4WVV A;  3GJB A;  4Y4R A;  1RUG 2;  1O7F A;  3AKR A;  1W6Q A;  2HWF 3;  3FX3 A;  3HOB A;  4XC9 A;  1WW4 A;  4QU1 A;  3M4F A;  5I0U A;  2JIG A;  1UOF A;  1EAH 1;  2VCB A;  4YG6 A;  3Q8F A;  4W50 A;  5HXM A;  4GUL A;  5JXJ A;  5KC6 A;  1W6O B;  3FFZ A;  1UO9 A;  1Z78 A;  2B42 B;  4Y33 A;  2R06 3;  4H7M A;  3C2U A;  3HR9 A;  1QJU 2;  2GC1 A;  4LO6 B;  1GUI A;  4IEP A;  4KU7 A;  2H6B A;  1DHK B;  2N7G A;  3BCW A;  3FC0 A;  2XJU A;  5I0T A;  5C4W A;  3WLU A;  2E6V A;  1EV1 2;  4NPM A;  2WBK A;  1LR5 A;  3PLQ A;  4WM8 C;  3ZDS A;  3A7Q A;  5FY0 A;  4RGK A;  1JU4 A;  1OQD A;  1OBN A;  4OUE A;  4XUR A;  4CYD A;  3RMX A;  1H1A A;  2K0G A;  4AW7 A;  1YWK A;  2HEY F;  3NNJ A;  2CGO A;  4QPG A;  1JI6 A;  2VNG A;  1CIY A;  1R08 3;  1SLI A;  2ZHK A;  4IEV A;  3VZN A;  2VD7 A;  4AG4 A;  4UW5 A;  1NLS A;  3VUO A;  2Q30 A;  1QJX 1;  1I6X A;  1GLH A;  1KQR A;  2ZX0 A;  2XUM A;  1HKD A;  5F3C A;  1VP6 A;  4PIY A;  4RHV 2;  4XUO A;  4D3W A;  2OX0 A;  4OZO A;  5FY5 A;  3Q9O A;  4QQ2 A;  4Q4Y 1;  1CGP A;  4UW6 A;  4AI3 A;  2CDO A;  1W6P A;  4M3C F;  4E4H A;  1FXZ A;  2ILM A;  3RQ0 A;  1AUY A;  1LJ7 A;  2JWP A;  2P34 A;  2VAU A;  4KQ7 A;  1UIK A;  2QUO A;  1D4V B;  2D7F A;  1AR6 1;  4I30 A;  4CDX C;  1WMD A;  1H2K A;  5FO7 B;  3Q8E A;  5IYY A;  2RR1 3;  3ON7 A;  1FV2 A;  1OVP A;  2D6M A;  1GFF 2;  1Y9M A;  2HWD 3;  2VMD A;  3LOB A;  2RDQ A;  3N9O A;  2J1S A;  3ZYR A;  2J22 A;  4P9I A;  4QX0 A;  1MQT A;  1QJF A;  3ZFG B;  4MV2 A;  3V0A A;  1GYK A;  4FBF A;  1JBC A;  2V4V A;  2GME A;  2Y38 A;  2ZHM A;  1K5M A;  2YGM A;  5LA2 A;  1G7Y A;  1W6Q B;  1OC1 A;  3VL8 A;  1VMJ A;  1VBC 3;  2HEW F;  2JDH A;  2XXZ A;  4P00 B;  2ZMN A;  5LBF A;  3MZH A;  1VB4 A;  1CD3 G;  4FI9 A;  1SBF A;  2KD7 A;  4LUL A;  2DFB A;  4HL0 A;  2DVF A;  1BEV 3;  3F2Z A;  1HB2 A;  4E4S A;  3M8L A;  2HWB 1;  5FUN A;  2D6O X;  2JG9 C;  1J83 A;  3O1U A;  1AHS A;  3RZZ A;  4UAP A;  4CPB D;  5DDJ 2;  3OD0 A;  1AR9 2;  1S0J A;  5KHH A;  1SPP B;  4N43 B;  3O7O A;  4JGZ C;  4O9G A;  4D6S A;  1ZBE 2;  2E53 A;  2GN7 A;  4Q4W 3;  3WDU A;  5J3U A;  3I3M A;  2W1S A;  3OYW A;  5C4W B;  3HQX A;  5FUP A;  1N3Q A;  5A3T A;  4LQR A;  1CR7 A;  3K51 A;  4Y5Z 0;  2O0O A;  3TN9 3;  4F8A A;  3T2O A;  2Q1F A;  5GJ6 A;  1NXD 1;  5GLW A;  3L9J T;  3WNP A;  1D4M 2;  4QPG B;  3B94 A;  5A1A A;  2YY1 A;  2WKK A;  3MIE A;  4LR4 A;  1W2T A;  1W6N A;  4JQT A;  4N7U A;  4NUB A;  4NWV A;  5FQ0 A;  4Q0U A;  5DQ0 A;  2JG8 A;  5GZG A;  2OZJ A;  4HAN A;  4EQV A;  2WNU C;  4YZ4 A;  2YBS A;  4N53 B;  1MS8 A;  1SEF A;  1COV 1;  4XFH A;  4XIK A;  3RYK A;  4Y1X A;  5FTT C;  2WN3 A;  1ZBA 1;  2DBI A;  2RS5 1;  5L7O C;  1ZA7 A;  4LKF A;  5FP3 A;  1GZC A;  4BK4 A;  5JR2 A;  2IC1 A;  4XMI A;  3ZXK A;  3N36 A;  4FAG A;  5M0T A;  1CX1 A;  5D2A A;  3H9A A;  4IEZ A;  1K42 A;  2PXJ A;  4RGA A;  2R0H A;  5FY8 A;  3JD7 2;  3D4K A;  1ZRF A;  3SQO A;  4E8D A;  3K4A A;  2DCZ A;  2QQW A;  4AVV A;  4C91 A;  1XE7 A;  4JDN A;  2CY6 A;  2UYB A;  2JDU A;  1ASJ 1;  3OPZ A;  5FPB A;  2JXA A;  4FFH A;  4URT A;  3UNP A;  4Q1P A;  3PVN A;  3HWJ A;  1MQT B;  3V0A B;  4I01 A;  3AX4 A;  1SLL A;  1L7R A;  4NHK A;  3ZMN A;  4CP9 A;  2CAV A;  4IE7 A;  1K5M B;  3THT A;  5CKM A;  1PZ7 A;  2Y6J A;  2JDY A;  5EJ1 B;  3AYE A;  4XZU G;  1F5F A;  2XJR A;  1CES A;  2IZW A;  1UNB A;  2O1Q A;  1NCR C;  2ZEX A;  2W08 A;  4COY A;  5G04 L;  1YNA A;  5BYN A;  4O61 A;  5ANQ A;  4P5Y A;  1D2Q A;  1NCQ C;  3TWI A;  3ABZ A;  4K21 A;  5FYC A;  4BB3 A;  3GNE A;  4NII A;  2VCM A;  3VBO A;  4XYX A;  1CAV A;  3ROU A;  3FHI B;  4JTN A;  4R9C A;  3O5S A;  4LBM A;  5JI7 A;  1STM A;  2JEN A;  1POQ A;  1YYN A;  1C4R A;  3NO8 A;  4MXV A;  3KSC A;  3BTZ A;  3FHQ A;  3OYW B;  5FMC A;  4KMQ A;  1OD3 A;  2DF7 A;  1PK6 A;  1OFS A;  2MNG A;  4YGB A;  2O8O A;  4OUM A;  5F5C A;  1QQP 2;  3H1Y A;  1GOF A;  4H3W A;  3URF A;  1VPH A;  1UL9 A;  2JG8 B;  4S2H A;  3MV0 1;  4AHW A;  1W99 A;  2VTF A;  4LOT A;  5T5P A;  1N1S A;  3NJV A;  3PUR A;  4NAM A;  4KU8 A;  4W8J A;  2RE9 A;  5LY2 A;  1AR8 2;  4DXZ A;  5DAV A;  5LBE A;  3SMH A;  3AFK A;  4QX8 A;  1J1T A;  5L9B A;  5FZ4 A;  1BBT 2;  4MGT A;  1RHI 1;  3JBG 2;  4ZON A;  5FY4 A;  1LHV A;  3T09 A;  4OHY A;  5FO9 B;  1WUV A;  2C24 A;  1YQC A;  1V00 A;  5FKB A;  1AYM 1;  5EJ3 A;  5A3W A;  3QH6 A;  5L19 A;  3LZZ A;  2OYZ A;  2E26 A;  3CJI C;  4Q2F A;  1YFX A;  1YIP A;  4CP1 A;  1XU1 A;  3MYX A; 
#chains in the Genus database with same CATH homology
 3I49 A;  3I3M A;  3RZJ A;  4QKN A;  3RZG A;  4NIG A;  4ZS3 A;  3T3Y A;  4O7X A;  3RZM A;  4OCT A;  5DAB A;  3T4V A;  3H8R A;  4IDZ A;  4IE4 A;  3LFM A;  3O1M A;  4JHT A;  4RFR B;  3H8X A;  4NPL A;  3S5A A;  3I2O A;  3T4H B;  3RZK A;  2FDG A;  4QKD A;  4IE0 A;  3O1V A;  3BTX A;  3BTY A;  4NID A;  4IE6 A;  3RZH A;  4NIH A;  4NPM A;  4NJ4 A;  4QHO A;  4IE7 A;  4NRM A;  3RZL A;  3BKZ A;  3BI3 A;  4QKF A;  4NRQ A;  2FDH A;  3KHC A;  4O61 A;  3O1T A;  4NII A;  3BTZ A;  2FDJ A;  4IE5 A;  3KHB A;  3I3Q A;  3S57 A;  3BUC A;  4QKB A;  2IUW A;  4ZHN A;  3O1S A;  3O1P A;  4CXY A;  4NRP A;  3BIE A;  3O1O A;  2FDI A;  2FDK A;  4CXW A;  4CXX A;  5F8P A;  3H8O A;  4MGT A;  4ZS2 A;  3O1U A;  3BU0 A;  2FDF A;  4NRO A;  4MG2 A;  2FD8 A;  3O1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...