2FDJA

Crystal structure of alkb in complex with fe(ii) and succinate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
207
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB
total genus 49
structure length 207
sequence length 207
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdjA00
4CXWA 3BTXA 4QKDA 3KHCA 4QKFA 3BI3A 3O1SA 4NROA 3T3YA 4O7XA 3I2OA 4NIGA 3I49A 4RFRB 3BKZA 4CXYA 3T4HB 3BIEA 4MG2A 4ZS3A 3BU0A 2FDIA 3RZJA 3BTYA 3O1RA 4MGTA 2FDJA 2IUWA 3O1VA 2FD8A 4JHTA 3BTZA 3RZHA 3RZKA 4NIIA 3I3QA 4IE5A 5F8PA 3O1OA 3O1TA 4NPLA 4NRPA 4IE7A 3RZMA 4NIDA 4IE6A 4IE4A 3O1MA 4NIHA 3LFMA 4OCTA 3I3MA 3RZLA 3KHBA 4CXXA 4IE0A 4QKNA 3O1PA 3H8RA 2FDKA 2FDFA 3H8OA 3O1UA 3S5AA 2FDGA 4ZS2A 3S57A 4QHOA 3RZGA 4NJ4A 4NRQA 4NRMA 4NPMA 4QKBA 3T4VA 3BUCA 2FDHA 4IDZA 5DABA 3H8XA 4ZHNA 4O61A
chains in the Genus database with same CATH superfamily
4AHZA 2QTWB 2OW4A 2YB7A 1K5MA 3LEIA 1FYUA 1G7YA 3FFZA 5FYUA 3ZKUA 2DCJA 1QJY2 3I2JA 4RD7A 1GOFA 4RFRB 5FYSA 5C9AC 4CXYA 2EIGA 2FCUA 3HJRA 3J8F2 2Y0IA 1GWMA 1R093 3P3PA 3RWNA 4LHKA 1KDMA 3MHZA 3ZYJB 3JD72 3VBOA 3KGZA 1VAMA 2JE8A 3I3QA 3VGIA 4W8JA 1ZBA3 4Y3OA 5CFDB 1RHI2 4GB33 1DQ2A 1NX9A 4LORA 5FAXA 3WW1A 5ABJC 1G6NA 3IMMA 3VZJA 4KBBA 1D7PM 2KXLA 3ACLA 2DUPA 2IFRA 3ZSMA 4IV1A 5I0TA 2PA7A 3RS6A 2ETEA 3FN9A 3K4DA 1V70A 4Q4W3 4Y1ZA 3T2PA 4HVQA 5AC93 4QWNA 2P2KA 2VOVA 1Q5OA 5FZHA 2QNKA 2WO2A 1JXNA 3PLQA 4ASMB 5K4LA 2XKOA 4DMIA 5J7MA 1R091 4EQVA 5FLIA 4AAXA 1LRHA 1VBA1 3NJYA 3D6EA 1RHI3 3CIHA 1RUG3 2B8MA 2JKXA 4I0AA 3WHUA 2CAUA 4AVVA 1MS4A 1PO11 2OIIA 3ZFFA 1HKDA 4QDSA 1RVF2 2ZEZA 1QJEA 1X33A 3ME2A 4YVSB 1UCXA 5C4WA 5FRAA 1QMJA 4Q4W2 1HJFA 4CDUB 5A3UA 1WD3A 1POV3 3BIWE 2IFWA 5C6CA 1JZ8A 1O8SA 1IKQA 3M8LA 3SKJE 2ILMA 1UZYA 2VOWA 3H8OA 3H8XA 3ZDSA 4HANA 1NLQA 5IVEA 5LA9A 4MO3M 2CL2A 4YM1A 1G86A 3J7LA 1FOD2 3DXUA 3P6BA 1RUG2 3WQ7A 2R041 4MZUA 5F9TA 3D3AA 4LBOA 1UD1A 5IHRA 1DZTA 1FX5A 3S5QA 2ATFA 4DY3A 5JVVA 3MV01 2B9UA 5E88A 1C5IA 3Q8EA 1F31A 4LR4A 4XMIA 3MW2A 3N35A 5E1RA 4CDXC 4CXXA 4I30A 4YW6A 5FZBA 4R8HA 5HPOA 1E57A 3S5AA 2VJXA 1US2A 3GDBA 4WM7A 3IBMA 1O5LA 3LFIA 1QDOA 1W6PB 3QLQA 2JDAA 5I0UA 3WG3A 3ELNA 3AZVA 4P5HA 4B4PA 1FOD3 2Q1ZB 4AF9A 3E5UA 2W1WA 2RHPA 1AL0G 1NCRA 4CA9A 2WT0A 5C3OA 3HT2A 3POJA 2YDEA 4QPGB 2FBEA 4EN8B 5FY1A 1XNAA 1B35A 3SITA 4CU8A 1VRH3 1JW6A 2R043 5F5QA 5BV6A 3U0ZA 5LBBA 4F83A 3K46A 5FP8A 1DGWA 3ASIA 4AZZA 4WVMA 3HVDA 2GN7A 1IS6A 1CAXB 2YGMA 3USSA 4LOSA 4OCTA 2VZOA 5GZDA 4IEXA 3MPPG 3QOPA 4YVSC 4CDUC 2GU9A 3AP6A 3WQ0A 1YQCA 4U2AA 4Q26A 5CKNA 2C4XA 1ZBE3 3G7DA 4P5YA 4XF1A 3AL5A 4AEDB 1O5UA 5FKBA 3WDTA 5A33A 2Y38A 1DYOA 3VHNA 3C7FA 4BK4A 2UYBA 2UY8A 2O8OA 3OOXA 5HV0A 3DEMA 4AG4A 2DVFA 5IK7A 1CAVA 1SLLA 3C2UA 4HKWA 2G1MA 1VR3A 2W1SA 3GZUC 2OKXA 1OD3A 4QGNA 1N1VA 5FXZA 4B7EA 5IVJA 2WSVA 4WVVA 1C3HA 1A6CA 3VD5A 3V64A 2Q30A 3NNLA 1AHSA 1QXPA 1UPIA 2D43A 4KWKA 3WLUA 4FOVA 4NJ4A 4QKBA 3IKWA 3WW3A 5LEKA 1RXFA 4HZFA 3ZX7A 2GDFA 2DVDA 2WNVB 1AXZA 3U1XA 4E9KA 1PIV3 5C3RA 1YQ5A 2XHNA 5LA2A 1NLSA 2BGOA 4QU2A 1OPOA 2JD9A 3ZFFB 1RL3A 2PHRA 1ZREA 2D44A 5BNOA 2P6HA 4Q8LA 1TME1 2WZ8A 2XVKA 1H2NA 4A4AA 1ZZ9A 4NWWA 5JXGA 5KR7A 5H9SA 1LGCA 3EHKA 5FBZA 4NMIA 1QJZA 4E8CA 2VUCA 2GMPA 2R0HA 3ZSEA 1RB8G 3HT1A 1S1AA 2PHTA 1MEC2 1TZOA 2V4AA 3H1WA 4LULA 4WBBA 3KVAA 2RS13 4RFT0 1DBNA 2VH9A 2XWBB 1CAXA 3NNJA 1UAIA 2KM2A 2W52A 3WT3A 5AC91 4EYUA 4LBJA 1F35A 2WQ4A 4EJRA 1IQAA 5DAWA 4OUEA 1N1YA 4Q4V2 3LA2A 3RYRA 4NROA 4NOTA 4XDOA 2WSUA 3TYJA 3UKVA 3WR0A 2P3JA 3LDKA 4B4RA 2VBPA 5ISLA 2XKPA 1RYYA 2XVGA 4E4HA 3BGAA 5KWRA 2E7TA 1W6PA 2BRTA 4WVWA 1MEC3 4N43C 5FLJA 3C7OA 3UV9A 1GANA 1O4TA 1U5IA 2RS12 3AKQA 1B35C 4FFHA 1LULA 3FZ3A 2BERA 2ID4A 3ZIXA 1OFSA 3NJZA 2Y6LA 1NA1C 1YI9A 2ZGQA 4Y24A 4AOCA 1T2XA 1V6MA 1EP0A 1J1LA 2YV8A 4IGPA 3WNLA 2E6VA 2DDUA 4XBLA 1JODA 1RXGA 3B5LB 5LWBA 1ODNA 2CTVA 2P1BA 4P9JA 1WMEA 5ANNA 2R062 5IK4A 1XYPA 4BZ4A 1RJ8A 1W6NB 4ZONA 5IUQA 4ISRA 2K9ZA 4ZU4A 2EICA 2ZKLA 2RMU2 2W1UA 3SXWA 4XFAA 2RM23 1GUIA 3AP5A 2P3KA 3S57A 1JUHA 4NHXA 4C1WA 1VAVA 4LJHA 2WQ8A 1ALYA 5T5JA 5JZGC 2Q1MA 2JICA 1X50A 4M3CF 3WOGA 2KD7A 2D7FA 5JSOA 5GLZA 1LU1A 1YC61 2CGPA 3VBRB 1DFQA 1VRH1 2DU0A 3DL3A 4S2GA 4UOJA 2E51A 3WZ1A 3V65A 1QQP2 2AC1A 4CUGA 3OG2A 4LQRA 2QFEA 4HG6B 1CESA 3J4UH 2RMU3 1JYWA 2LTNA 5B4XA 2RM22 1O3SA 2CYFA 1DHKB 1S0GA 3MF6A 1GQGA 1PMHX 2D6KA 1U5ZA 5EHDA 2ZGMA 3DCQA 4MGQA 1COV2 3VBHA 1POV1 2OZJA 2HWC3 2UWBA 4BQ2A 3TEYA 1OD5A 1W9SA 4MYEA 4HETA 3RGBA 1FXZA 4GWNA 5FZGA 1NA1B 1NQJA 3POWA 4YGCA 4Y22A 4PIXA 1ZRFA 3PVNA 3U4XA 2XMLA 5BXXA 4AI0A 2VOXA 1EPWA 3E6BA 3HNMA 2P17A 1TNFA 4FPOB 4QPIA 1WLTA 4DINB 4KI5M 1CONA 2JDHA 4PF5A 2ORZA 2CU5A 1W8ZA 3NV2A 4KG0A 4O9EA 1AR61 4CEYB 3EO6A 5FUNA 5FYTA 4FQZA 1ZRCA 4MGZE 5FQ0B 4N53A 3EMRA 4YZ4A 5I93A 4PI2A 1H8VA 5JZGB 1S2EA 3KV4A 2HWC2 5ACA1 2QE3A 4K7JA 3HIFA 5EPAA 4YW5A 5FMBA 3RFRA 2QQVA 5KC5A 3W21A 1AYN3 1GP4A 2HWF3 2UWAA 3I97A 5FR3A 3IIIA 1NUKA 1SBFA 4FOYA 2DBNA 1LJ7A 2XQRA 1CAUB 1HV0A 4ORFA 3KHCA 2VTXJ 4QX1A 1C28A 3I2IA 5CKQA 1S2KA 3BIEA 1EV12 2XHKA 4FOQA 1H8TB 2BGPA 1P8JA 4MGTA 3A21A 3OYWB 1EUUA 4P9WA 4Z1VA 4HOOA 1QNYA 1UNBA 2VMIA 5FZKA 2W92A 3WDUA 2X05A 1NZCA 3O1MA 2HWF2 4UF0A 5FPZA 3CZUA 1UY3A 4FP3A 1FNYA 4Z07A 1N3QA 4MGIE 1WCQA 1QJX3 2J1RA 4Q0SA 1LODA 3R05A 2DU1A 3H9AA 1REEA 2JG8C 2XJRA 4K40A 2D3PA 2MHFA 1RUJ2 4XF0A 2XL9A 4QB2A 5SV8A 3I49A 4JDOA 1WW5A 2BVVA 1BLZA 1OMIA 1VBE1 5J3UA 1IHMA 4JGYC 3IDBB 3KVBA 4IXLA 2LS6A 4L11A 4MHRA 5A3OA 2YMZA 3UJQA 4CCDA 4LEJA 4NPLA 1LU2A 5JPNB 2Q8CA 1ZRRA 1MEC1 2O1QA 3FE5A 2XDVA 4N9IA 5IWFA 4PI0A 2LUWA 1Z7S2 5D8AB 1UYYA 2A70A 3VHPA 1POQA 4QXHA 4QHOA 4JDMA 4A3XA 1CAVB 4NRQA 4E4SA 5C3PA 2P3IA 1KQRA 1U0AA 1YRZA 2VNGA 1QXRA 1IQDC 4FXKB 1RUC2 5FZ6A 1ASJ3 1HRV3 2UWCA 1E5IA 2PFWA 5I0SA 3BB6A 1Q8SA 2WQZC 2Y0OA 3H50A 3NKGA 2Q8DA 1YIPA 4JHTA 1DYKA 3QBQA 5FCCA 2P5BA 4AL9A 1OUXA 4LTAA 3SEPA 3U10A 1JZ2A 2ADEA 2WZPP 2BPA2 3WP4A 2ARBA 2VR4A 4Z2AA 1BMV2 2ES3A 1V0AA 5FV3A 4MUVA 4N9HA 2LW8A 4IGOA 1RUI1 1HRV2 5FYCA 5FJHA 4M01A 1LAJA 1GZTA 4FAGA 3VKOA 2ZZJA 2QQMA 3MFAA 3PTRB 1FT9A 4QHZA 4IV3B 3O0WA 3EQEA 5FOJB 4V2WA 2RS52 1EAH1 5IVFA 2PAMA 3WG2A 4D69A 3FLTA 1EPZA 5CEHA 1WCSA 2A75A 3M3CA 4JQRA 2FDJA 1RMU1 1TE1B 1ZBA2 5FFOC 1RUF2 4LO6B 2NYYA 2ZEYA 3OPWA 4ARYA 4BH9A 4HMZA 2RMU1 4LNVA 4GB31 1JHNA 1REFA 5L9RA 1BBT2 1SMVA 2A6XA 3SCHA 4DXRA 3WXPA 2JG9A 3UETA 4BQ1A 3KZ4C 3O1PA 3ZXLA 4XETA 3IWZA 3N9MA 5GALA 4KU8A 2AREA 4IEWA 4Y20B 5IVYA 5A3WA 3ZIWA 4A6SA 4ATEA 1JYXA 4LLOA 3IDCB 2AACA 1MZ6A 3BCWA 4GWIA 1JYIA 2OQ6A 3NAPB 3URFA 1ZNPA 3T30A 3J8F1 1BYHA 1SZBA 4LO4B 3UGHA 4Y5SA 4QKFA 4MSVA 4BK5A 1KEXA 3AMPA 3TOJA 2W5FA 2V09A 2WAOA 1RUF3 4FI9A 3K75B 2VUJA 3WF1A 5BNOC 1RHI1 1GU3A 1ZZ7A 3HQXA 4XMAA 2RV9A 1RVF3 2BU9A 4NIDA 3AM2A 3J7MA 3TEZA 3N4MA 2XJSA 4GIQA 2C6SA 2WNVA 4IE0A 4ZZ5A 5ACA3 1GQPA 2GC1A 2D98A 3T09A 2RJKA 1W03A 4Z82A 5FYYA 4KWJA 3DYMA 1JZ4A 2YFZA 4XJAA 1D4VB 1AXYA 4ASLA 2VZTA 4UW3A 2Z5WA 4BU2A 3N9NA 1QQP3 3POBA 4X8PA 4QQ2A 5FZ1A 3IN9A 1TQ5A 4YGBA 4GD4A 4EWDA 2BYVE 4YVWC 2GN3A 2AUYA 1CN1A 4U36A 5D1IA 1IZ3A 3I2FA 5C5UA 4LHSA 5CIRA 1VBC1 5D2AA 4LO7A 3DPRB 4J6GA 4W6WA 2OS2A 1RUH1 1MACA 1OI6A 4FFIA 4QXCA 4CDWC 3NV1A 4RS5B 4B29A 5CG8A 4YVWB 4QQHA 3FLRA 1IG3A 1DQ1A 1SLAA 5FY0A 1VB2A 3CQOA 1LOBA 2J1VA 2YPJA 4QB1A 3VBFB 4COZA 4CCMA 2FDHA 1TNRA 4FBFA 1FOD1 2SLIA 1I9RA 1SFPA 4CCEA 1W2OA 2SBAA 3SCGA 1BHGA 4Q0QA 4CPBD 2JD4A 4UFIA 1DYPA 3GBGA 3OBAA 3M70A 5LRRA 2D6MA 5CZKA 1PNGA 1IKPA 1N1SA 5FZMA 4OI2A 2UY9A 5DDJ1 5AC92 4XF9A 2VU9A 2K0GA 3RZMA 2NMOA 3VBRA 3VDAA 4L0PA 4XQDA 4HN0A 1BXHA 2JDZA 1AYN2 1WMXA 5A32B 3OBZA 4IEVA 1G9DA 4LHLA 3BPZA 3ZR6A 5ABJB 3A22A 2LM3A 1JUIA 1PZ9A 1RUJ1 1CJPA 3IIAA 2HBUA 3AX4A 2VQ0A 2HWB3 1G9FA 2GC0A 2VC9A 4L92A 2CDPA 1Q8PA 1YQ6A 2PYTA 4O7XA 4XYXA 1W6NA 3IM0A 5A6ZA 4JRAA 1Q43A 5C7GA 1C5HA 5HCBA 3W59A 3B93A 3K51A 4JGZC 1UN1A 3MIEA 3ILRA 3PVEA 3OTFA 4IERA 4MX3A 4Y22B 5H9RA 3MEPA 2QKDA 3DGTA 3CJIA 4RQPB 5E16A 3W20A 2VMEA 2GNBA 1UXZA 3LFMA 2GC3A 4DRVA 2XUEA 1EYBA 3H8RA 5A3LA 4K9SA 1GZWA 4FTBA 4I02A 4UW4A 4XCBA 4BOWA 2EIBA 4BQYA 1EUTA 4PQQA 1LNSA 1VAKA 3NV3A 1BEV3 4M4RA 5FTTC 2RVAA 3V0BB 4NN0A 4I3GA 1W0NA 1OLRA 3I3DA 4YARA 2PELA 1RUOA 3WUDA 1XB9A 2VOTA 3LSDA 2GP5A 2VQTA 2DFCA 1PMJX 1QJY1 1VBE3 2XBO2 1XQNA 3K3NA 1IPKA 4YLZA 3MUZ1 3VZMA 2C26A 1NCQC 4NIIA 1H2KA 1FV2A 3B9CA 2QQPA 4LT5A 2ZA9A 5FK7A 1IPJA 2J22A 5KHGA 4A42A 3OYWA 5J48A 1F2NA 2HKXA 3MZHA 4P9IA 2DCKA 1MS1A 3ACGA 3GXUA 3DV8A 4H3WA 1F5FA 3RYPA 4HN1A 4AK3A 4YZ1A 2YG0A 3J8F3 4J25A 5KC6A 3D82A 1CGPA 2WA4A 4ONUA 1GP6A 3JD73 3N7KA 2VBDA 3W58A 3DPRA 5LY2A 1D0GA 2DUQA 1OPMA 2QQLA 2B4KA 1O6UA 2VVFA 5D21A 1UIJA 2BDRA 2BWAA 5LCWL 2LRPA 1QJFA 1W3XA 2EXHA 4IE7A 3M3QA 2B5HA 3AL6A 5FYMA 2ZKNA 1Q8QA 2ZXQA 4PBOA 4XZPA 1DIWA 3VZNA 2FDKA 1JU3A 1PK6B 4QX3A 2G9FA 1ULPA 4AQSA 3L2YA 4PDWC 1PO12 4IEQA 3S7IA 3HPNA 5F39A 1V9U1 1LTEA 3PIJA 2JE9A 4FPYA 2RS53 3Q8CA 4Q4V1 1JYTA 1W99A 3N9QA 1KJRA 2JDPA 3CEWA 3LOIA 3OCPA 3VDDB 1UL9A 5C5TA 5FP4A 3WW2A 3SHRA 5LEJA 2GNDA 2WNUC 2ZGOA 3D0SA 5GLTA 2O8QA 2NLRA 1WW7A 2IXLA 3ZMNA 2W46A 2E53A 3ZFEB 1BBT3 1AL21 1YJKA 2VPVA 4OUSA 5CADA 4ZZ8A 2ENRA 1AUYA 1J3QA 3QH6A 1BVP1 1JTZX 5DUWA 5EJZB 3I4IA 4HPKB 3ZVXA 2DYCA 1DGRA 2K46A 3PUIA 2WT2A 4KGQA 1AXKA 3ETQA 1CQ9A 4AI1A 5IFTA 1UY1A 1UY2A 4BMEA 2HBTA 2WUHA 1W8WA 2ZACA 4S2FA 4CP9A 1DCSA 1GP5A 4PQ9A 4D6SA 1HDKA 2WKKA 2ZCWA 3LWCA 4UFJA 4GKXA 2JKBA 5FK8A 5FMCA 2QQJA 3M7AA 1O4ZA 3MIHA 2RS31 4W6YA 3POIA 3A4UA 5DG1A 1WCKA 3VD3A 3OGSA 2V4VA 4KH9A 4MGKE 2YY1A 2GSYA 1XE7A 5EQUA 1URXA 1UF2C 3LA3A 1CPMA 1GV9A 1POV0 4WM8C 1UYPA 1D2SA 2VCAA 1IOAA 4B8EA 1RUD1 3ZO0B 1TEIA 2ZTNA 3VHOA 2HLEA 1NAEA 3BPSA 3KMHA 4EN0A 5IVVA 1UY4A 5JI9A 1V6NA 3A7QA 3AP4A 5JOZA 1VRH2 4DPNA 3BODA 1RTVA 4YW3A 1G9CA 1QQP1 2F4LA 3WNNA 5BY5A 2W68A 1OUSA 1SLCA 3GZAA 1GNYA 2YU1A 3I8TA 5FZ4A 1JZ5A 1AR63 1I3HA 4YW1A 4Q4X1 3O0VA 2VECA 3WV6A 2JE7A 5F37A 2Q0AA 1XU2A 4R9AA 1QDCA 1HRI1 3LIGA 2FQPA 4LLFA 1AYM3 1NCRB 4RGAA 5EYXA 4ZXEA 4CP2A 1Q3EA 3ZFEA 4HKLA 4XJ9A 1CZVA 3GALA 1R1ZA 3JB8A 4WM7C 5BNPB 3TNPB 2VZQA 4N43B 2WZEA 3SMHA 2GC2A 1KS5A 4W65A 4CDQC 3HQUA 4A3ZA 2YPDA 4M3CB 2H6CA 1PMIA 2DBIA 3I3EA 2NPIA 4BQ3A 1CZSA 5FZ0A 2D5FA 2WL1A 4FFFA 2HJIA 4ZS3A 2FDIA 1AR62 1HB3A 4JX0A 1LB2A 3AYEA 3WNMA 1DGRN 1ZX5A 4GWJA 3VBFA 3ZPOA 3WNKA 2IVJA 2Z4FA 4RGKA 5ANQA 1OVPA 1HXS3 4FPGA 3SISA 4GH4C 3POYA 2AZ5A 4EWAA 3POSA 1TME2 2CV6A 2AR6A 1ONAA 4NHLA 3KHBA 5FPBA 1O3QA 1W8FA 2Y6HA 4LHNA 4XE9A 3UGGA 5FIXA 5A3TA 4OMCA 2HEVF 5L9VA 2HWB2 1R64A 1PIV2 1H8TA 2XQXA 1DGWX 2DCZA 1XRUA 2G9GA 3DF0A 1VE0A 4OLLA 4A6OA 3ACFA 4NUBA 1S0FA 3J7NA 4GA9A 1UZZA 4Y26A 3F2ZA 3T3YA 3VKMA 3QCWA 4UF0B 4CUCA 2EF6A 1WCDJ 1B09A 5A32A 3VUOA 4KQ7A 1BKZA 1XSQA 1Z0HA 4IV1C 3OPTA 5IK5A 4K1ZA 4EE2A 3Q8BA 3RZKA 4PT6A 3LKJA 4RN5A 1Z7S3 4IE5A 3NMBA 3ACHA 4UW6A 1HXS1 1W8UA 3ZYGA 2J1UA 1OH3A 1Y3TA 3IMNA 5CISA 3NW4A 1V00A 5JOXA 2IZWA 3GBFA 5DUVA 4OQ9A 1MS3A 4H7LA 1ND2B 2J42A 2WYFA 5JXJA 2H6BA 1T6GC 4LPLA 4FP2A 5EV7A 4HLTA 1XPWA 4Q4V3 2VMCA 1QOSA 4N90A 3VKNA 2OPKA 4RL7A 1OKOA 1ND3B 1OT5A 2FCTA 3LEMA 4O61A 4XUOA 1L7LA 1SCRA 2JJ6A 3JQWA 3MICA 4GMP1 1UX7A 5EXOA 1VBE2 1H1AA 4QAWA 3U07A 2VZVA 3ZN4A 4INDA 3AJZA 4LKSA 1VBB2 4Q29A 5FXXA 1GNZA 2FCVA 4XZUG 5FZOB 2YHJA 4CUAA 1W05A 3WY6A 5FYBA 2YC4A 4AVBA 3Q9OA 3B7MA 4DXSA 1HB2A 1WMDA 5C4WB 1YCIA 3WNXA 3UJOA 4DO0A 3IPVA 2ADDA 1K5MB 1KJLA 3N7LA 3ZFGA 4IEUA 2A6VA 4YG0A 5JR7B 3SH3A 2HWD1 3IDAA 5CB7A 2WWUA 4COYA 2ZHMA 4QGLA 4DNYA 3UKTA 1CX1A 3KV6A 3VDBA 4UFKA 3VL9A 1GQHA 4PF1A 1ZM1A 3H0OA 5IVCA 2ZZQA 1W6QA 1OQEA 1VBB3 2K2SA 2VCCA 4KU7A 3AVRA 4YGDA 4LBLA 3RQ0A 1MQTA 1JYCA 3RWKX 3UGFA 4J1WA 4PDWA 4QPIC 4XXAA 1C8M2 1YUDA 2V5YA 4LE4A 4XACA 3VZKA 2E33A 1NQDA 2NM1A 4CPBA 5A6QA 3V0BA 1LOCA 1UOFA 3DUIA 3MLLA 1YIFA 2Z42A 4E2SA 1VLNA 4OUMA 4OI4A 5GLVA 5FOBB 4N43A 4HL0A 1NT0A 3AKRA 1ENQA 4IUGA 4UBHA 1K12A 2VTFA 3OPZA 4PCRA 4CDWA 4L8QA 4YW2A 3EXUA 4AFMA 4XIKA 5I91A 2CY6A 2RJ2A 2P4EA 4K21A 5FZAA 3FBMA 2JENA 3OEBA 1LESA 3B01A 3N36A 3N3HA 1AJKA 4GAZA 2XOMA 1WW4A 5C70A 3R4DB 4XOGA 4COWA 1RGSA 4XHBA 3ZN5A 5A1LA 2EXKA 4QX8A 3C7HA 4C0BA 2D97A 2XG3A 5J1XA 3PIGA 3TNQA 5FO9B 4AFAA 4MVTA 5DAPA 2JEMA 1J3RA 3NAPA 4W4ZA 4RHV1 5J96B 2L9LA 1PM7A 1AL23 1R081 1ST8A 3ZXFA 5A33B 2D3SA 2ZEXA 3THTA 2GH8A 1H9PA 4XQWA 4Y1YA 1COV3 4JTNA 1RUNA 4D94A 1W8TA 1UWWA 3I3MA 1AYM1 4NIHA 5GZCA 1YQ2A 3RZZA 2DF7A 2QZ3A 4GZ9A 2HWC1 4XVHA 1QH6A 5C33A 1LHOA 1YFYA 2XJVA 3PHMA 4C8DA 5ERLA 4YM3A 3ZFGB 1E5RA 5A3MA 4NIGA 4RS5C 4CDXA 2ZGTA 4WM8B 3D5OA 2E7QA 2ZX0A 1UO9A 5T3NA 4HVOA 1YQ8A 3VDDA 1HQNA 4D3WA 3WD5A 1EV11 4DS0A 3O1TA 4R52A 2ZHNA 5C8CC 1LHUA 1UXXX 1V6IA 4FPFA 4DUXA 2FMYA 3T0BA 3MDPA 3UKNA 2DVBA 1BJQA 4XJZA 4KMQA 3I54A 4O65A 1MR5A 2R1DA 5BNQA 1X8MA 3ZM8A 4E27A 4QPIB 1XXNA 3I59A 2BW8A 3POGA 1YO8A 2EAAA 3OD0A 2QQUA 2D5HA 2DTYA 3C8XA 4JC1A 3T0AA 1SLTA 2YU2A 2D6OX 4MH0E 4N53C 4OFGA 4OZOA 4EV0A 5IYYA 1LOFA 4NVPA 5B2GB 1NE4A 5GKAC 5JIUA 1IS5A 1Q8VA 4PLNA 1ZRIA 5GZFA 1OA4A 3BU0A 3K48A 1JHJA 2P3YA 1F9KA 2IXHA 1VMJA 3OSDA 1RITA 2PTMA 4EROA 3AYCA 1XNBA 3O0XA 3A23A 4YVWA 1ODMA 3WUCA 5F8PA 3ZN6A 5FWEA 5EJ3A 3LD8A 2BJSA 1UY0A 5DAQA 4BXFA 1W2AX 2BUKA 4Y33A 1MQTC 4KWLA 2B42B 2QQWA 1QJX2 2ZAHA 5T50A 2V72A 4Z2WA 1A3KA 3H7YA 4NE9A 2B46X 4A7YA 5FUIA 5FZEA 1RUJ3 3O7OA 1QHDA 3GYDA 4BM8A 5HCHA 2A7AA 3QACA 3G6JB 3M3OA 4LBNA 2RDQA 4XW3A 5F3EA 3FHAA 5F3GA 4PLMA 1RUC1 5FY9A 2A6ZA 2TBVA 4DZGA 1HXS2 2R072 4XFIA 3NNGA 4Q1PA 5DUUA 3OB8A 5EWSA 5A7SA 3HQRA 3GCWA 2TUNA 4LBMA 3LQCA 5LW9A 3WQ1A 5BNNB 2ZHLA 3B69A 1HB4A 4BQXA 1JZ7A 4QKNA 1DGLA 2W9XA 4M3CA 2W91A 4ES9A 5HI0A 4TZDA 4EN6B 1O3RA 1CAWB 1HQWA 2BTVC 4S2HA 3U75A 3MYXA 1VALA 3U4SA 1DZRA 2D6PA 5IT6A 2BWCA 4BYYA 4AEKA 4NWVA 3OGJA 2E63A 3PTYA 4NO4A 5FP9A 4TYSA 1PGL1 2HEWF 3VV1A 1HW5A 3RJRA 4AEJA 4R9BA 3VBUA 4LO5B 3FHQA 4LIVA 1JOPA 3AXDA 3WW4A 1CJDA 1PZ8A 2CSGA 4AYUA 4LXLA 3IDEA 2R16A 3LE0A 2C5DA 2PMWB 4M00A 1UW8A 3HWJA 4JRLA 3HBZA 1C1LA 1RMU2 2UURA 3NQHA 3R0RA 4TN7A 1L3JA 3VDCA 1NY72 3KQ4B 4YSFA 4QDRA 1W6OB 1KFXL 3LF7A 3MIFA 3MV11 4JKMA 1LEMA 5FLHA 3AKTA 2F4PA 2JX9A 2ZABA 1YHFA 2I07B 3FFQA 2PHUA 4V2VA 4IW3A 3KGLA 4LIUA 5F7UA 1OLMA 1DLCA 4CEYC 1W2UA 2VMFA 1HB1A 1C8M1 1TMF3 3ZFGC 2N7GA 3RZJA 4WM7B 1NE6A 5LA0A 3ZYHA 4AVCA 5APAA 5FMOL 1ULOA 1YFWA 1NA1A 4AI9A 1YFXA 2Y8KA 1OQDA 4XDQA 4NAMA 1W9WA 1XNKA 4Y1XA 3RDIA 5BNPA 5IAXA 3FJSA 1PO13 4YZ3A 3AZWA 3N7MA 4MHUA 4AHWA 5F3CA 4LITA 3B94A 4I09A 1S0DA 1H2MA 2CWMA 3LEKA 3W9AA 2HWD3 2RJLA 2P34A 3AVSA 4XUPA 3WF2A 1TMF2 4A41A 1TVGA 5BNNA 3TEWA 4Y4RA 4D6QA 3TWIA 1C8M3 2OXBA 4AEDC 1NZIA 3TN93 3AXEA 2PLV2 5LK5A 4FPJA 3GM8A 4I2OA 2YBKA 1LOGA 2PAEA 2QQKA 1ULCA 2JB8A 4MV2A 4Y20A 5DQ0A 4QQOA 4XCAA 2R061 5F6KA 1W0PA 4XUTA 4QHBA 2ERFA 2VBBA 1SHWB 1MS5A 4BA6A 3FC0A 4KBZA 5KHHA 3ZFEC 5GZGA 4XTPA 2VNVA 1XC6A 3PVOA 5HCFA 3T2QA 3NNMA 1SDDB 4NPRA 5BNOB 2WFPA 5FPUA 4QPGC 1W6OA 2WNEA 3H1MA 1LHWA 5FP7A 5FZIA 3I2OA 4MXVA 3DPRC 1BK1A 1AL22 2JWPA 3FMGA 4CU9A 4Y1UA 3O1VA 3PURA 2R32A 1PNFA 3LEGA 4BLIA 3M1HA 5FYIA 1FATA 2XL7A 4K8RB 5CKMA 4CP1A 3OGVA 5DDJ2 4NIAA 5JPMB 3GGLA 1RUH3 3OGRA 2A5ZA 3ZYIB 1JYVA 5GLUA 3U37A 2VL4A 3CJXA 1SLBA 2RM21 3PNAA 3WDVA 5GLWA 4WV8A 1ENXA 4QM8A 3WF3A 5I8SA 2X10A 2X09A 3JZVA 5LATA 1ZBE1 2ZMNA 3H3UA 3WG4A 1OOPB 2VVDA 1J1TA 3KB5A 1DF0A 2WABA 4QKDA 5K0UA 4SBVA 3AJYA 5HXMA 3KSCA 1PVC1 4H14A 2ZBJA 1YYNA 2DCYA 4W6XA 4QU1A 3APBA 5JOWA 3ZPYA 1GYKA 2D6NA 2OUHA 5JCTA 5A70A 2TNFA 5BUVA 5IVBA 4X8NA 3SNMA 4FCAA 2BNNA 3AP7A 4E8DA 4AHYA 3SQOA 3E5XA 4LK7A 1N3PA 2XVLA 2DWRA 2WAAA 1E5HA 1YI7A 2BFUS 2ZGRA 4UT5A 2BZDA 2Y64A 1VJ2A 4P9YA 1KS4A 4FQ4A 1S4CA 2Y6KA 4AE2A 5F2WA 2X53S 1J83A 2KR2A 5AFBA 3PJQA 4XILA 2JDUA 4KNCA 3VZLA 1SFYA 1WMFA 4P02B 1FMD1 2V73A 3TRSB 1PVC3 2IXIA 2R071 4QX0A 5A7OA 3RSJA 1S0BA 2AEZA 3E6DA 3HR9A 1CZTA 3M3EA 4YPJA 2VMDA 1TME3 4FPLA 4GQ7A 5JLVA 2B39A 1AX1A 5IW0A 3AMQA 5K9YA 4OHYA 4C91A 1VMFA 3T0DA 1U5XA 1D2QA 1DQ6A 4YYOA 3MBWA 2CAVA 1W9FA 4YW7A 4AQ2A 3ZSKA 1F4HA 3FLPA 1BEV2 3ON7A 1KDKA 3KWVA 4K1YA 5L7OA 2I74A 2VZUA 2R30A 3MLKA 1H4GA 2BVBA 2YXSA 1WW6A 1OURA 4RQPA 5KXBA 4FSJA 1V6LA 4LKDA 4L2NA 3CJIC 1S0EA 2WT1A 3AMHA 2G4IA 3I2GA 3GZEA 5DZFA 3WX5A 3H8UA 5DN2A 2XLAA 5FREA 4CCKA 3LDRA 3ZYFA 1Z78A 1ZA4A 3LPFA 1RIRA 2X5IA 4LBQD 5FBJA 5JAXA 2NZ9A 3WG1A 5LY1A 2Y26A 1R1A3 1NCRC 1UU5A 1WA6X 2VCBA 1XSRA 4FTSA 1UOBA 2VG9A 5C3QA 2A6WA 5J37A 3NV4A 3I2KA 2YBPA 1JS9A 2ZGPA 1NKGA 2H0BA 4XAAA 2WDBA 4NPMA 3H42B 1ZZ8A 5DXDA 3MIBA 3PL0A 4BCUA 5C8CA 5KBFA 4CEYA 1WLDA 1PX4A 1SCSA 4XURA 1W9TA 3LZZA 3MI8A 4P9LA 4FOWA 5KHIA 2WNVC 3GJAA 2W1QA 4HONA 3JD71 2WJSA 1RUE1 3A0NA 4WZFA 4I0BA 4NHKA 5FUPA 4LOTA 4BHPA 4QD2A 1MVEA 2XXZA 1OLME 3QD6A 1O8PA 5FKCA 3VB9A 1W8OA 2DFBA 2QJVA 1W04A 4XBNA 4EZHA 3B00A 4GH4A 2ET1A 3GCXA 3PVBB 4B1LA 5JXHA 4IL7A 5CG9A 1H1MA 4QM9A 3INAA 4IEOA 5FXVA 3PMSA 1W90A 2VXJA 4QX7A 5HV4A 3UT0A 5FZ8A 2VY0A 3AZYA 2OZ6A 5A6YA 4HSJA 5EP9A 4CDQB 4D6RA 3T4VA 1V6OA 2NP0A 2C1FA 1H2LA 4R9DA 4Z92B 2Z79A 1ASJ1 5JXIA 1VBD2 1UZWA 3LSEA 3J7HA 4RR3C 4H7MA 1CAWA 1WBFA 2DCTA 1PK6A 2E7AA 4IV1B 1RUE3 2LROA 1XU1A 2VZRA 3IPVB 2YGLA 4LUKA 4AI3A 4D8MA 2XPJA 1PO23 2JDKA 5C8CB 3KV9A 1RVF1 2PHFA 1CAUA 2RS32 1ZBA1 1W6MB 2YBSA 4TLGA 1JOJA 2BGCA 3NSTA 4XFBA 2HWD2 5G05L 2AGSA 2ZEWA 4D7TA 5I0RA 3AKPA 2FDFA 4Q8KA 4URAA 2WN3A 4UFLA 3S30A 5FWJA 3GZTB 4HT1T 5J09A 2FDGA 5CYYA 1IS3A 4G3YC 2DV9A 2VQUA 1MZFA 5LBEA 1RUD2 2PQSA 2XLFA 3THPA 4CCJA 1PVXA 1ZYBA 1QH7A 2E32A 4LBQA 3VBRC 4HPKA 4CU6A 4BISA 2C0ZA 2ZMLA 4P14A 4XPVA 4GJYA 3ZYRA 4CDWB 1PO22 2XONA 4A7ZA 3SH4A 5DZGA 2R1BA 3VBHC 4P00B 4H2AA 4BDVB 5L7OB 5IAVA 5JOYA 2YUEA 1I5PA 1DP0A 2IXJA 4ZPIA 1K5MC 1UKGA 5BNPC 1I6XA 3LA7A 4RYDA 5FZDA 2J1AA 2VM9A 2NQYA 2WNOA 4B7KA 3MFCA 1L7QA 4Z8BA 1HRI2 2OT7A 2WBKA 1O3TA 2OQ7A 4G4FA 4AWDA 5DAXA 3ZXDA 1DU3D 2B9VA 1PGW2 3AMNA 3SLIA 4CRQA 1VMHA 2AH2A 2IC1A 3OD4A 2A3XA 2VGDA 2QBXA 1QJU1 3AB0A 4QQPA 2R49A 4IGQA 2QDRA 2BOJA 1GLHA 4ZXKA 3VZOA 4QB6A 4I01A 5DDJ3 2PXJA 1HN0A 2IWGB 3VKFC 1AYM2 4AFCA 3ALQA 4CZSA 3WP6A 4Q4Y3 3HNYM 2HWE3 1JBCA 4IE4A 4N7IA 4FPHA 4RR3A 4XDPA 5C9AA 5FY5A 2Q8OA 3AZZA 2QUOA 4WM8A 5F2SA 4L9BA 3LB9A 1MPXA 1AX0A 3VD7A 1X8EA 5SV5A 4ARXA 4EN9B 1O4YA 4NHMA 4QX2A 1UIKA 1K5JA 4PLOA 5LZ6A 3Q8AA 3RPQA 4OI0A 5C8WA 3W5NA 2G9ZA 2HWB1 3FUOA 4FPEA 3CBNA 5IJRA 2A71A 2RE9A 5FJKA 5J98B 3V0AA 1DLLA 3K4AA 3BTAA 3NNFA 3LGRA 3HEIA 3JB4C 4YVSA 4CDUA 4R4ZA 3ILNA 3U14A 3I59B 3WDYA 3MIDA 4GKYA 5EIYB 3LIHA 4HBNA 3T1MA 5T54A 1UZ0A 4IV3A 5EFUA 2QCSB 2HWE1 4BIFA 1SEFA 3ZYBA 1VPHA 4ZKTB 2A1XA 5DUXA 4QMAA 2RG4A 4Q1RA 2R6QA 1AYN1 1F4AA 2YROA 3RI8A 3THCA 1OBNA 4JGZA 4HFSA 3UESA 1ULDA 2R7EB 3J26N 4FPCA 4I3PA 4XFCA 1OF4A 1GBGA 3NRUA 4BQ5A 4ET7A 2ZMKA 5C9AB 1IS4A 2HEYF 3O1SA 4XF3A 5A80A 1GFF2 4DUVA 3O14A 3VBSB 1DQ0A 1WKYA 2VAUA 1SBDA 2D93A 2JG8B 2BNOA 1I5ZA 4RA0A 4C90A 1AX2A 3NKTA 1NXD1 3AYAA 3ENRA 4JDNA 1HIXA 2EIDA 1OHFA 1ZZCA 5JMCA 1OA3A 4RSUA 5IATA 5LBFA 2GAUA 1W8HA 5FP3A 3ES4A 3IZOA 2X8KA 3LCPA 3ACIA 5H9PA 2V5DA 2BFUL 5FZFA 2X29A 5FZLA 4PBPA 1US3A 4XJWA 5FPLA 4NR1A 4WVMB 2WWSA 2O0OA 4KGGA 4YFWA 4HVRA 4AGGA 1ZZBA 1HLCA 2DVGA 3HN1A 1A8DA 4HXCA 5HXVA 3DECA 4UFHA 1UU4A 3JBG1 3Q8FA 2EALA 4V1PA 5DZEA 5LB6A 3ZLIA 3VBFC 1X36A 1R1A2 2WWJA 2ZJCA 3VBOC 1MS0A 1DQ5A 1XNCA 5DMYA 2XBO1 3F95A 4GWMA 5LK7B 4OYUA 2E31A 2MEV3 3RVHA 1FPN1 5LASA 2JDNA 1J3PA 2UYAA 3AMMA 4P9GA 3SC7X 3BN6A 3VBOB 2C9AA 4B4QA 1KFUL 4AI2A 1ULGA 1VBD1 3B9IA 1DZQA 1H8TC 3BALA 3I3BA 4M0NA 1YNAA 2BOIA 2G19A 3FL7A 4ASKA 1W28A 3POEA 4WZCA 4CYDA 1XBFA 3HD8B 4QQLA 4AHXA 2B7YA 2JG9C 3X29B 4EN7B 3OGGA 3CO2A 4UYBA 4UFMA 4W50A 1JYNA 1AZDA 4HKOA 2WZR2 3K4ZA 2W95A 3MW4A 4CE8A 3RMXA 2JIJA 1AR72 2JG8A 4BQWA 4D0QA 4ZY9A 2RDRA 5M0TA 4RHV2 1SDWA 3RZLA 1VRBA 5A7PA 4JZRA 3T08A 1X9PA 4JCKA 2X5IB 3RZGA 1MQTB 1E5SA 1YLLA 4D7SA 2Z2SB 4K6BA 1D0HA 1XYNA 3N9PA 4LKEA 1VIWB 2VW0A 4RQPC 3RZHA 4R9CA 3T1LA 1V9U2 2ET7A 3POFA 5LBCA 3CJIB 4MGSA 3LPGA 2CGOA 3TN91 1U5YA 3IAQA 4ATFA 2FZ1A 5AFEA 1GZWB 3M2MA 2RS33 3IB3A 4OMDA 1Q8OA 4QT6A 3NL1A 4XXPA 2YC2A 2VE1A 3DYOA 1Y4WA 2WS91 4IEPA 1D4M2 4OHVA 3ITQA 4MADA 4RHV3 5T5LA 1F5JA 4CDQA 3KF5A 4Q4Y1 2ZGKA 1UMIA 3UK9A 3WSOA 1COV1 1UU6A 3JQXA 1BVVA 2BNMA 4DEQA 2UU8A 4NAOA 2GALA 5CVRA 3BYWA 1REDA 2WO7A 1W9YA 1C8NA 5L36A 4Y5TA 4CCLA 2F17A 5A7WA 4XJ8A 2ZGNA 1MZEA 1YFUA 3ZKYA 1PGW1 4NRMA 1G9AA 4JHZA 2A73B 1LEDA 4AFBA 2DUOA 1SACA 3ZN6B 4JV4A 4COUA 3C7GA 1PGSA 1MZ5A 2PLV1 2ZX2A 3CL1A 4KG8A 3BI3A 1LOFC 1JN2P 1UYXA 2BEOA 4GALA 3N9LA 4QPYA 1JZ6A 2FZ2A 4XABA 1QXJA 2ZX4A 5FMOS 4XBQA 3RJ2X 3AFKA 4BWOA 4COVA 4LBQB 2Y6FA 4YM2A 5FMDA 4YZ5A 2CGNA 2JXAA 3CMGA 2A3YA 3I2HA 4YRDA 5E6HA 5FY4A 5CFCA 2A3WA 5KHJA 2E9QA 3DYPA 1ENSA 3ILFA 4ZS2A 2ZOEB 1NCQB 4FAHA 3BOWA 1NG0A 5E89A 5EYYA 1BCXA 3VL8A 3VDDC 3ZXKA 4UI9L 5FPXA 1GICA 1OKQA 3OEAA 5JZGA 2I45A 2XLGA 1KRIA 1O91A 2I2SA 1H4HA 5KHKA 5T55A 4QPWA 4FTEA 1OOPC 1PK6C 1S55A 3B02A 1IGOA 2BBVA 1QGLA 2ARAA 5FZ9A 2AYHA 3IAPA 1I1EA 2HWE2 3E1F1 4LO8A 3VD4A 5F5CA 1ND3A 2BP6A 1SQ4A 4Q27A 2GNMA 1VBC3 3A0KA 1T6BX 1DG6A 2ZX3A 2GH2A 2VD7A 1F8VA 2Y60A 4YG6A 3OY8A 5CNAA 2JDMA 4OHXA 1TG7A 3VN4A 3KM5A 4Q0UA 3P1IA 5F32A 4JGYA 5I0DA 4XQ4A 3USUA 1PVC2 4E2QA 3TB0A 4UXAA 1CWPA 3M3IA 3PU8A 1W2NA 4CVUA 3EB7A 2R073 2GZWA 2WLQA 2ZPXA 4EWEA 2VCMA 1G9BA 3BKZA 4UBGA 3WEZA 1PGL2 3JBG3 4KWUA 2WR9A 4YWAA 2WNUB 2XJPA 4QX5A 3CNAA 3N7JA 4E4DX 2GMEA 1Z7S1 4QXKA 1J84A 2VQAA 2VZPA 1YJLA 1UYZA 2WO3A 1ZA7A 3CLPA 5T5OA 3SCFA 1A8MA 1GWKA 1Y7BA 3H1YA 2YFUA 4K8FA 4PDWB 4MLOA 4DOUA 1W2TA 1Y43B 1NY71 3OBRA 1CPNA 3AZXA 2EIEA 1CIYA 4FT8A 5GZEA 4AW7A 1STMA 4HK8A 4I0WB 4DFSA 5A1FA 1WBLA 1RINA 4HK9A 1GZ9A 5CU1A 1W8NA 4P08A 5CFCB 1PIV1 4XTMA 3JBG2 4GXLA 4CCNA 4LA3A 3TEXA 4A44A 3MF9A 2XJTA 1YEWA 3OY8B 4AEMA 4BXSV 5CFCC 3MO4A 4LE3A 4LUMA 1QWRA 5D8AC 1GSLA 4UAPA 4CEWA 4DB5A 3P5BA 1RMU3 4SLIA 1ND2A 1X9TA 1SPPB 3S7EA 3JUUA 3DKWA 4BQ4A 1APNA 5JSPA 3WNOA 1OSGA 2WN2A 2JB4A 3KCXA 3VBSA 3ZFFC 4X6RB 5JSRA 2YC0A 3LAGA 1UMZA 4G9SB 4DXTA 4AI8A 1ULEA 4DEVA 1DQ4A 3GNEA 3I7DA 3ST7A 3GBWA 2RS51 4DY5A 2DURA 2BQPA 2MPFA 3WNPA 5IK8A 2VULA 1OQ1A 2WLPA 4CU7A 3TBDA 1SG3A 5FPAA 4UWDA 3M4FA 3UYJA 5CFDA 2XWJB 4XAEA 3BU7A 1TMF1 1UX6A 3H3ZA 4RS5A 1GOHA 4LBKA 3FBYA 1HJGA 2WZR1 2J1EA 4Q5OA 3NWKA 4Q0VA 3ZXJA 3ES1A 1QJY3 3W5MA 1C57A 4B1MA 1AR71 1LGNA 1FAYA 1IG0A 2DTWA 2WS93 1QU0A 1R092 1BBT1 1AR81 1HV1A 3ETPA 1VBA2 1HQLA 2CHHA 3OJBA 4IE6A 5I8TA 5LA1A 1UMHA 1ZRDA 3ECQA 2J1SA 1J59A 4CEWB 2WNUA 4CTEA 2VO5A 1QEXA 4YZ2A 3O1UA 3V0AB 4MOAA 3EYPA 1SFNA 1VBD3 3K77A 1FV3A 3HAGA 5L9BA 4OQ8A 4MXWA 4OVEA 5FDBA 4GH4B 3TN92 4ZHNA 4AVSA 5T5PA 1RUE2 1W06A 2PLV3 2PHWA 4GMP3 4TSVA 3O12A 2OX0A 1GR3A 1ZVFA 5DG2A 5FPVA 2WZR3 3MUY1 2WS92 1D4M1 2XH6A 5L73A 1L7RA 3U11A 2VUAA 3BVCA 1AR73 1XJAA 4AVTA 1RUG1 3MGUA 1C1FA 1GZCA 3V56A 1V6JA 5H9QA 4NRPA 2Y6JA 3RI9A 5K7PA 1UZVA 2PQQA 2R063 3AP9A 1GKBA 2OUJA 5A3PA 4M3CE 5CA6A 5FZ7A 1LHVA 5F1RA 5A1AA 4A7KA 3IT8A 1SPPA 1OVSA 4OZXA 4LKFA 1CVNA 2XB6C 2ZGSA 3MPBA 4FFGA 4XC9A 4CCOA 5IFPA 1OH4A 3FWEA 3MIGA 5C71A 2EA7A 3NJVA 2JIGA 5CBLA 1QOOA 2CWSA 2GNTA 5BPXA 2BBAA 1M4WA 4JVAA 1PHMA 3GHMA 4JKKA 1W6MA 3JCIA 4F7ZA 3KT7A 1Q56A 4XF4A 1MVQA 3PUAA 3O1RA 3ZSJA 3WQBA 2WIIB 5FO8B 2QVSB 1ZZ6A 3R6SA 4Q2FA 3WDXA 2O14A 3WHTA 4C0HA 4Q4X3 3CF6E 1RUH2 1EY2A 3MLJA 1WA4A 1B35B 2QQNA 1HRI3 3AKSA 3KT4A 1R082 2J1TA 1JH5A 3T2TA 3EJKA 4AGVA 2W2IA 2VZ3A 1FI2A 1OA2A 3RG0A 4BB3A 5AVPA 1WGPA 4OHZA 3OUHA 5FZOA 1ULFA 3DKQA 1H0BA 4BPZA 5LRSA 4XHXA 4CCCA 4N53B 4Y4YA 5KXEA 4L99A 3WF4A 4NHYA 1YWKA 3UNPA 3CHXA 4ISQA 3PDQA 2EAKA 1FMD2 2JG9B 2WRAA 1C4RA 4IESA 4E2GA 1W39A 3TAYA 4PJYA 2ZAAA 3ZXGA 2QDNA 3DN7A 2VZSA 1WLCA 2VVEA 3OF1A 2PHXA 4LA2A 3U78A 4RGGA 4PIYA 5A7NA 5K8SA 4ES8A 5CFDC 1RC6A 3VBUB 2P37A 2PHLA 5L7OC 4J1XA 1OFNA 1RJ7A 4XFFA 3T2OA 2VZ1A 4WVZA 5L19A 4FO9A 1K42A 3N9OA 2HYXA 1ND3C 2JDYA 2EXIA 2IXKA 3ZMOA 4CXWA 1BK0A 4DIQA 1NOVA 1Y9GA 2E26A 5A7WB 5ABJA 2VW2A 4RR3B 3HMYA 3WP5A 3CKHA 3BTYA 5F5AA 2DVAA 3PMEA 2B45X 4N7UA 1X82A 4TLFA 1EV13 1XE0A 2IVIB 3JXSA 4JQTA 4Y5Z0 1JI6A 1NCQA 1QIQA 2IXCA 2GP3A 2WFF3 3QH7A 3JU9A 1PZ7A 2KA3A 1H30A 3FHIB 3ZDVA 2WC2A 2C24A 4XIOA 4XFHA 5GJ6A 5BYNA 4N8MA 3BOPA 4D7YA 4DUWA 3S0MA 4F8AA 3GJBA 1LECA 4Y1VA 1LR5A 2PHDA 4OULA 3D0JA 5EZWA 1QJX1 4KL1A 2Q8EA 5C4WC 1M06G 1V6KA 2ARCA 4PIZA 1LKNA 1LOEA 2J7MA 4AAPA 4AFDA 2WO1A 5FY7A 2HYKA 5DPNA 3SEEA 3VLBB 4MGYE 5D8AA 3ABZA 5FZ3A 4AQ6A 4CEWC 1MS8A 3D8CA 1YXWA 2NN8A 1XNDA 2FD8A 4K20A 1G8WA 2EXJA 4CP9B 3AYDA 2OPWA 4K3UA 1N47A 4YM0A 2OVUA 2WFF1 4IV3C 1AR83 4JGYB 2Q5TA 4A45A 3KQRA 1LCLA 2RR12 3EBRA 2CDOA 1CD3G 3KD4A 5A6XA 3HBKA 2XR4A 3KCYA 1WUVA 4YW4A 3E6CC 2QZ2A 2RS11 1XE8A 3VKLA 4O9GA 4IDZA 4AQTA 2FHRA 3L2HA 2GMMA 3WCSA 3ROUA 5FYVA 3ZOIA 1AR93 3VBSC 2MNGA 2W94A 4X6QB 1RUC3 5JMOA 1ASJ2 5FYHA 2HH9A 2CNAA 3GHNA 1AR82 3RNSA 2XGXA 3HNBM 3ZSLA 2RR13 4TTGA 3O1OA 4QPGA 4S2DA 1J58A 4R4XA 3RYKA 2YZ4A 2MEV1 1VB4A 4AGRA 1CIWA 1XNTA 4CDXB 1FPN3 1NLRA 3C7EA 1UOGA 1UKRA 1BZWA 3PJYA 2VXRA 1A78A 4B3NA 1W0OA 4GJZA 1RUI3 4XUQA 3BUCA 4FPKA 1AJOA 1DDLA 3L9JT 4AXOA 4IETA 1ENRA 1F15A 4YGEA 1AR91 2VTXA 1EAH3 3K2OA 3NVCA 1XOYA 1KD7A 3ATGA 4P9XA 2XUMA 1GWLA 3SH5A 1VBA3 2LALA 1PO21 1ND2C 1LENA 1FPN2 1MS9A 5KXDA 2VW1A 3KLSA 1JMUB 5BNNC 1PM4A 2P6CA 1S2BA 2Q1FA 5KXCA 1LHNA 1QF3A 4URTA 1RUI2 5GM0A 2OYZA 3WP3A 1SLIA 2VNRA 3NJXA 4QGMA 2VNOA 3VHRA 1RUD3 4OHWA 1QOTA 1V9U3 4ITCA 1WZXA 1H6YA 1AVBA 1H6XA 1EAH2 2VMGA 3I2DA 1CX4A 5T52A 2ZGUA 2WINB 1SBEA 5HBAA 4LMFA 3VD9A 1KGYA 2JECA 4XUNA 3VBHB 3B3QE 1RUF1 3PUHA 3WF0A 3RRDA 1D4M3 5G04L 2Y33A 1OLQA 3P3NA 1QJU2 4GULA 3LOBA 2BV4A 3BTZA 4GMP0 1UOJA 3PUSA 5CAZA 4META 1BQPA 5JIAA 1HN1A 2RDNA 3WCRA 4EZ4A 3FUQA 3KCCA 4AEDA 1JU4A 4TXWA 2W3JA 4XFGA 4YNIA 2PN5A 4TWTA 5F5IA 2ZHKA 3AFGA 3J9SA 3C3VA 1HX6A 3NAPC 5ACA2 4JTOA 4Q4W1 1FNZA 1NYWA 1OC1A 3O5SA 4JKLA 3S6PA 2YYOA 3OBTA 2Y34A 3KT1A 2W47A 4AR2A 1QJU3 1WLWA 4IEYA 4MG2A 2F6BA 3H7JA 1UPSA 1Y9MA 4QXBA 4Q4X2 4BMBA 4MXWB 1AF9A 4Q4Y2 5J36A 5K0UB 4BIOA 3HN3A 2WA3A 5FY8A 2R042 2X5IC 4L97A 1R083 3AC0A 2Q4SA 3DXTA 1UQXA 1OOPA 2VMHA 1K3IA 3CU7A 4DXZA 5JDBA 4ZU7A 3OUJA 4QDQA 2HWF1 2QQOA 4HSLA 2TEPA 2PAKA 2VOKA 4XJUA 5DABA 2AENA 2ZX1A 4CSWA 2Y6GA 4M4PA 1FMD3 1ZBE2 3CDZB 1QY4A 2ZS6B 3ZXEA 3T4HB 5FO7B 1W3VA 3OUIA 5I8YA 1JZ3A 1S0JA 3KS7A 5JR2A 2XJUA 2A6YA 1VBC2 4LK6A 4Q0PA 3WINE 1QKQA 3PU3A 2OA2A 4DRRA 2ARXA 5JUVA 2W39A 2Z69A 1W6QB 2C9KA 5K0UC 1WCUA 5E8AA 3THDA 1H9WA 1LOAA 4CUBA 4H55A 4BJ0A 2R0FA 2D3RA 4A2UA 2W0XA 1IPSA 1XYOA 1O7FA 5AVAA 5B4NA 1WWYA 3GF6A 1KXGA 1ACCA 2NMNA 1NXMA 3BTXA 3SKVA 2W08A 3ZXAC 4JAAA 1O59A 1KITA 1VP6A 3RMYA 3FX3A 5JWPA 3MW3A 3H3LA 3HOBA 3LDBA 1GOGA 5A3NA 2RDSA 3ZR5A 2WFF2 3AK0A 3KF3A 2IUWA 3WDWA 3USUB 2ZGLA 1N1TA 4CP0A 1U12A 1QNWA 2RR11 5EJ1B 2H0VA 5F3IA 3D4KA 2W87A 1A34A 4JGZB 1N3OA 2FMDA 4XEZA 4DQAA 1R1A1 4IQPA 4PHZA 5HCAA 1LGBA 1GNHA 2D40A 2EVXA 3KV5A 3K3OA 5F6LB 4F3JA 1S0IA 2ORXA 1CR7A 4IEZA 3PUQA 5FXWA 1BMV1 4C1XA 4AVAA 1BEV1 1Y9QA 2WYSA 4FVVA 5FYZA 1HRV1 1PX3A 1OF3A 3CZJA 3R4UA 4ZU5A 5A7QA 4UW5A 1VBB1 1WD4A 3WVJA 3NO8A 1OXCA 4OI1A 4M0HA 5TSWA 1H1IA 2MEV2 1S0CA 4BLJA 5DAVA 2QQIA 2XJQA 3ORJA 2D6LX 2XBO3 3E97A 4YFZA 3E5QA 4FXGB 4BE3A 1X7NA 3VBUC 3UL2A 2AEYA 4GB32 1JOBA 4E4ZA 1GMMA 3ZYPA 3R4SA 5FQ0A 5JI7A 1AR92 5C3SA 1K45A 5FZCA 4YG3A 2VUDA
chains in the Genus database with same CATH topology
4CXWA 3BTXA 4QKDA 3KHCA 4QKFA 3BI3A 3O1SA 4NROA 3T3YA 4O7XA 3I2OA 4NIGA 3I49A 4RFRB 3BKZA 4CXYA 3T4HB 3BIEA 4MG2A 4ZS3A 3BU0A 2FDIA 3RZJA 3BTYA 3O1RA 4MGTA 2FDJA 2IUWA 3O1VA 2FD8A 4JHTA 3BTZA 3RZHA 3RZKA 4NIIA 3I3QA 4IE5A 5F8PA 3O1OA 3O1TA 4NPLA 4NRPA 4IE7A 3RZMA 4NIDA 4IE6A 4IE4A 3O1MA 4NIHA 3LFMA 4OCTA 3I3MA 3RZLA 3KHBA 4CXXA 4IE0A 4QKNA 3O1PA 3H8RA 2FDKA 2FDFA 3H8OA 3O1UA 3S5AA 2FDGA 4ZS2A 3S57A 4QHOA 3RZGA 4NJ4A 4NRQA 4NRMA 4NPMA 4QKBA 3T4VA 3BUCA 2FDHA 4IDZA 5DABA 3H8XA 4ZHNA 4O61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXW A;  3BTX A;  4QKD A;  3KHC A;  4QKF A;  3BI3 A;  3O1S A;  4NRO A;  3T3Y A;  4O7X A;  3I2O A;  4NIG A;  3I49 A;  4RFR B;  3BKZ A;  4CXY A;  3T4H B;  3BIE A;  4MG2 A;  4ZS3 A;  3BU0 A;  2FDI A;  3RZJ A;  3BTY A;  3O1R A;  4MGT A;  2FDJ A;  2IUW A;  3O1V A;  2FD8 A;  4JHT A;  3BTZ A;  3RZH A;  3RZK A;  4NII A;  3I3Q A;  4IE5 A;  5F8P A;  3O1O A;  3O1T A;  4NPL A;  4NRP A;  4IE7 A;  3RZM A;  4NID A;  4IE6 A;  4IE4 A;  3O1M A;  4NIH A;  3LFM A;  4OCT A;  3I3M A;  3RZL A;  3KHB A;  4CXX A;  4IE0 A;  4QKN A;  3O1P A;  3H8R A;  2FDK A;  2FDF A;  3H8O A;  3O1U A;  3S5A A;  2FDG A;  4ZS2 A;  3S57 A;  4QHO A;  3RZG A;  4NJ4 A;  4NRQ A;  4NRM A;  4NPM A;  4QKB A;  3T4V A;  3BUC A;  2FDH A;  4IDZ A;  5DAB A;  3H8X A;  4ZHN A;  4O61 A; 
#chains in the Genus database with same CATH topology
 4AHZ A;  2QTW B;  2OW4 A;  2YB7 A;  1K5M A;  3LEI A;  1FYU A;  1G7Y A;  3FFZ A;  5FYU A;  3ZKU A;  2DCJ A;  1QJY 2;  3I2J A;  4RD7 A;  1GOF A;  4RFR B;  5FYS A;  5C9A C;  4CXY A;  2EIG A;  2FCU A;  3HJR A;  3J8F 2;  2Y0I A;  1GWM A;  1R09 3;  3P3P A;  3RWN A;  4LHK A;  1KDM A;  3MHZ A;  3ZYJ B;  3JD7 2;  3VBO A;  3KGZ A;  1VAM A;  2JE8 A;  3I3Q A;  3VGI A;  4W8J A;  1ZBA 3;  4Y3O A;  5CFD B;  1RHI 2;  4GB3 3;  1DQ2 A;  1NX9 A;  4LOR A;  5FAX A;  3WW1 A;  5ABJ C;  1G6N A;  3IMM A;  3VZJ A;  4KBB A;  1D7P M;  2KXL A;  3ACL A;  2DUP A;  2IFR A;  3ZSM A;  4IV1 A;  5I0T A;  2PA7 A;  3RS6 A;  2ETE A;  3FN9 A;  3K4D A;  1V70 A;  4Q4W 3;  4Y1Z A;  3T2P A;  4HVQ A;  5AC9 3;  4QWN A;  2P2K A;  2VOV A;  1Q5O A;  5FZH A;  2QNK A;  2WO2 A;  1JXN A;  3PLQ A;  4ASM B;  5K4L A;  2XKO A;  4DMI A;  5J7M A;  1R09 1;  4EQV A;  5FLI A;  4AAX A;  1LRH A;  1VBA 1;  3NJY A;  3D6E A;  1RHI 3;  3CIH A;  1RUG 3;  2B8M A;  2JKX A;  4I0A A;  3WHU A;  2CAU A;  4AVV A;  1MS4 A;  1PO1 1;  2OII A;  3ZFF A;  1HKD A;  4QDS A;  1RVF 2;  2ZEZ A;  1QJE A;  1X33 A;  3ME2 A;  4YVS B;  1UCX A;  5C4W A;  5FRA A;  1QMJ A;  4Q4W 2;  1HJF A;  4CDU B;  5A3U A;  1WD3 A;  1POV 3;  3BIW E;  2IFW A;  5C6C A;  1JZ8 A;  1O8S A;  1IKQ A;  3M8L A;  3SKJ E;  2ILM A;  1UZY A;  2VOW A;  3H8O A;  3H8X A;  3ZDS A;  4HAN A;  1NLQ A;  5IVE A;  5LA9 A;  4MO3 M;  2CL2 A;  4YM1 A;  1G86 A;  3J7L A;  1FOD 2;  3DXU A;  3P6B A;  1RUG 2;  3WQ7 A;  2R04 1;  4MZU A;  5F9T A;  3D3A A;  4LBO A;  1UD1 A;  5IHR A;  1DZT A;  1FX5 A;  3S5Q A;  2ATF A;  4DY3 A;  5JVV A;  3MV0 1;  2B9U A;  5E88 A;  1C5I A;  3Q8E A;  1F31 A;  4LR4 A;  4XMI A;  3MW2 A;  3N35 A;  5E1R A;  4CDX C;  4CXX A;  4I30 A;  4YW6 A;  5FZB A;  4R8H A;  5HPO A;  1E57 A;  3S5A A;  2VJX A;  1US2 A;  3GDB A;  4WM7 A;  3IBM A;  1O5L A;  3LFI A;  1QDO A;  1W6P B;  3QLQ A;  2JDA A;  5I0U A;  3WG3 A;  3ELN A;  3AZV A;  4P5H A;  4B4P A;  1FOD 3;  2Q1Z B;  4AF9 A;  3E5U A;  2W1W A;  2RHP A;  1AL0 G;  1NCR A;  4CA9 A;  2WT0 A;  5C3O A;  3HT2 A;  3POJ A;  2YDE A;  4QPG B;  2FBE A;  4EN8 B;  5FY1 A;  1XNA A;  1B35 A;  3SIT A;  4CU8 A;  1VRH 3;  1JW6 A;  2R04 3;  5F5Q A;  5BV6 A;  3U0Z A;  5LBB A;  4F83 A;  3K46 A;  5FP8 A;  1DGW A;  3ASI A;  4AZZ A;  4WVM A;  3HVD A;  2GN7 A;  1IS6 A;  1CAX B;  2YGM A;  3USS A;  4LOS A;  4OCT A;  2VZO A;  5GZD A;  4IEX A;  3MPP G;  3QOP A;  4YVS C;  4CDU C;  2GU9 A;  3AP6 A;  3WQ0 A;  1YQC A;  4U2A A;  4Q26 A;  5CKN A;  2C4X A;  1ZBE 3;  3G7D A;  4P5Y A;  4XF1 A;  3AL5 A;  4AED B;  1O5U A;  5FKB A;  3WDT A;  5A33 A;  2Y38 A;  1DYO A;  3VHN A;  3C7F A;  4BK4 A;  2UYB A;  2UY8 A;  2O8O A;  3OOX A;  5HV0 A;  3DEM A;  4AG4 A;  2DVF A;  5IK7 A;  1CAV A;  1SLL A;  3C2U A;  4HKW A;  2G1M A;  1VR3 A;  2W1S A;  3GZU C;  2OKX A;  1OD3 A;  4QGN A;  1N1V A;  5FXZ A;  4B7E A;  5IVJ A;  2WSV A;  4WVV A;  1C3H A;  1A6C A;  3VD5 A;  3V64 A;  2Q30 A;  3NNL A;  1AHS A;  1QXP A;  1UPI A;  2D43 A;  4KWK A;  3WLU A;  4FOV A;  4NJ4 A;  4QKB A;  3IKW A;  3WW3 A;  5LEK A;  1RXF A;  4HZF A;  3ZX7 A;  2GDF A;  2DVD A;  2WNV B;  1AXZ A;  3U1X A;  4E9K A;  1PIV 3;  5C3R A;  1YQ5 A;  2XHN A;  5LA2 A;  1NLS A;  2BGO A;  4QU2 A;  1OPO A;  2JD9 A;  3ZFF B;  1RL3 A;  2PHR A;  1ZRE A;  2D44 A;  5BNO A;  2P6H A;  4Q8L A;  1TME 1;  2WZ8 A;  2XVK A;  1H2N A;  4A4A A;  1ZZ9 A;  4NWW A;  5JXG A;  5KR7 A;  5H9S A;  1LGC A;  3EHK A;  5FBZ A;  4NMI A;  1QJZ A;  4E8C A;  2VUC A;  2GMP A;  2R0H A;  3ZSE A;  1RB8 G;  3HT1 A;  1S1A A;  2PHT A;  1MEC 2;  1TZO A;  2V4A A;  3H1W A;  4LUL A;  4WBB A;  3KVA A;  2RS1 3;  4RFT 0;  1DBN A;  2VH9 A;  2XWB B;  1CAX A;  3NNJ A;  1UAI A;  2KM2 A;  2W52 A;  3WT3 A;  5AC9 1;  4EYU A;  4LBJ A;  1F35 A;  2WQ4 A;  4EJR A;  1IQA A;  5DAW A;  4OUE A;  1N1Y A;  4Q4V 2;  3LA2 A;  3RYR A;  4NRO A;  4NOT A;  4XDO A;  2WSU A;  3TYJ A;  3UKV A;  3WR0 A;  2P3J A;  3LDK A;  4B4R A;  2VBP A;  5ISL A;  2XKP A;  1RYY A;  2XVG A;  4E4H A;  3BGA A;  5KWR A;  2E7T A;  1W6P A;  2BRT A;  4WVW A;  1MEC 3;  4N43 C;  5FLJ A;  3C7O A;  3UV9 A;  1GAN A;  1O4T A;  1U5I A;  2RS1 2;  3AKQ A;  1B35 C;  4FFH A;  1LUL A;  3FZ3 A;  2BER A;  2ID4 A;  3ZIX A;  1OFS A;  3NJZ A;  2Y6L A;  1NA1 C;  1YI9 A;  2ZGQ A;  4Y24 A;  4AOC A;  1T2X A;  1V6M A;  1EP0 A;  1J1L A;  2YV8 A;  4IGP A;  3WNL A;  2E6V A;  2DDU A;  4XBL A;  1JOD A;  1RXG A;  3B5L B;  5LWB A;  1ODN A;  2CTV A;  2P1B A;  4P9J A;  1WME A;  5ANN A;  2R06 2;  5IK4 A;  1XYP A;  4BZ4 A;  1RJ8 A;  1W6N B;  4ZON A;  5IUQ A;  4ISR A;  2K9Z A;  4ZU4 A;  2EIC A;  2ZKL A;  2RMU 2;  2W1U A;  3SXW A;  4XFA A;  2RM2 3;  1GUI A;  3AP5 A;  2P3K A;  3S57 A;  1JUH A;  4NHX A;  4C1W A;  1VAV A;  4LJH A;  2WQ8 A;  1ALY A;  5T5J A;  5JZG C;  2Q1M A;  2JIC A;  1X50 A;  4M3C F;  3WOG A;  2KD7 A;  2D7F A;  5JSO A;  5GLZ A;  1LU1 A;  1YC6 1;  2CGP A;  3VBR B;  1DFQ A;  1VRH 1;  2DU0 A;  3DL3 A;  4S2G A;  4UOJ A;  2E51 A;  3WZ1 A;  3V65 A;  1QQP 2;  2AC1 A;  4CUG A;  3OG2 A;  4LQR A;  2QFE A;  4HG6 B;  1CES A;  3J4U H;  2RMU 3;  1JYW A;  2LTN A;  5B4X A;  2RM2 2;  1O3S A;  2CYF A;  1DHK B;  1S0G A;  3MF6 A;  1GQG A;  1PMH X;  2D6K A;  1U5Z A;  5EHD A;  2ZGM A;  3DCQ A;  4MGQ A;  1COV 2;  3VBH A;  1POV 1;  2OZJ A;  2HWC 3;  2UWB A;  4BQ2 A;  3TEY A;  1OD5 A;  1W9S A;  4MYE A;  4HET A;  3RGB A;  1FXZ A;  4GWN A;  5FZG A;  1NA1 B;  1NQJ A;  3POW A;  4YGC A;  4Y22 A;  4PIX A;  1ZRF A;  3PVN A;  3U4X A;  2XML A;  5BXX A;  4AI0 A;  2VOX A;  1EPW A;  3E6B A;  3HNM A;  2P17 A;  1TNF A;  4FPO B;  4QPI A;  1WLT A;  4DIN B;  4KI5 M;  1CON A;  2JDH A;  4PF5 A;  2ORZ A;  2CU5 A;  1W8Z A;  3NV2 A;  4KG0 A;  4O9E A;  1AR6 1;  4CEY B;  3EO6 A;  5FUN A;  5FYT A;  4FQZ A;  1ZRC A;  4MGZ E;  5FQ0 B;  4N53 A;  3EMR A;  4YZ4 A;  5I93 A;  4PI2 A;  1H8V A;  5JZG B;  1S2E A;  3KV4 A;  2HWC 2;  5ACA 1;  2QE3 A;  4K7J A;  3HIF A;  5EPA A;  4YW5 A;  5FMB A;  3RFR A;  2QQV A;  5KC5 A;  3W21 A;  1AYN 3;  1GP4 A;  2HWF 3;  2UWA A;  3I97 A;  5FR3 A;  3III A;  1NUK A;  1SBF A;  4FOY A;  2DBN A;  1LJ7 A;  2XQR A;  1CAU B;  1HV0 A;  4ORF A;  3KHC A;  2VTX J;  4QX1 A;  1C28 A;  3I2I A;  5CKQ A;  1S2K A;  3BIE A;  1EV1 2;  2XHK A;  4FOQ A;  1H8T B;  2BGP A;  1P8J A;  4MGT A;  3A21 A;  3OYW B;  1EUU A;  4P9W A;  4Z1V A;  4HOO A;  1QNY A;  1UNB A;  2VMI A;  5FZK A;  2W92 A;  3WDU A;  2X05 A;  1NZC A;  3O1M A;  2HWF 2;  4UF0 A;  5FPZ A;  3CZU A;  1UY3 A;  4FP3 A;  1FNY A;  4Z07 A;  1N3Q A;  4MGI E;  1WCQ A;  1QJX 3;  2J1R A;  4Q0S A;  1LOD A;  3R05 A;  2DU1 A;  3H9A A;  1REE A;  2JG8 C;  2XJR A;  4K40 A;  2D3P A;  2MHF A;  1RUJ 2;  4XF0 A;  2XL9 A;  4QB2 A;  5SV8 A;  3I49 A;  4JDO A;  1WW5 A;  2BVV A;  1BLZ A;  1OMI A;  1VBE 1;  5J3U A;  1IHM A;  4JGY C;  3IDB B;  3KVB A;  4IXL A;  2LS6 A;  4L11 A;  4MHR A;  5A3O A;  2YMZ A;  3UJQ A;  4CCD A;  4LEJ A;  4NPL A;  1LU2 A;  5JPN B;  2Q8C A;  1ZRR A;  1MEC 1;  2O1Q A;  3FE5 A;  2XDV A;  4N9I A;  5IWF A;  4PI0 A;  2LUW A;  1Z7S 2;  5D8A B;  1UYY A;  2A70 A;  3VHP A;  1POQ A;  4QXH A;  4QHO A;  4JDM A;  4A3X A;  1CAV B;  4NRQ A;  4E4S A;  5C3P A;  2P3I A;  1KQR A;  1U0A A;  1YRZ A;  2VNG A;  1QXR A;  1IQD C;  4FXK B;  1RUC 2;  5FZ6 A;  1ASJ 3;  1HRV 3;  2UWC A;  1E5I A;  2PFW A;  5I0S A;  3BB6 A;  1Q8S A;  2WQZ C;  2Y0O A;  3H50 A;  3NKG A;  2Q8D A;  1YIP A;  4JHT A;  1DYK A;  3QBQ A;  5FCC A;  2P5B A;  4AL9 A;  1OUX A;  4LTA A;  3SEP A;  3U10 A;  1JZ2 A;  2ADE A;  2WZP P;  2BPA 2;  3WP4 A;  2ARB A;  2VR4 A;  4Z2A A;  1BMV 2;  2ES3 A;  1V0A A;  5FV3 A;  4MUV A;  4N9H A;  2LW8 A;  4IGO A;  1RUI 1;  1HRV 2;  5FYC A;  5FJH A;  4M01 A;  1LAJ A;  1GZT A;  4FAG A;  3VKO A;  2ZZJ A;  2QQM A;  3MFA A;  3PTR B;  1FT9 A;  4QHZ A;  4IV3 B;  3O0W A;  3EQE A;  5FOJ B;  4V2W A;  2RS5 2;  1EAH 1;  5IVF A;  2PAM A;  3WG2 A;  4D69 A;  3FLT A;  1EPZ A;  5CEH A;  1WCS A;  2A75 A;  3M3C A;  4JQR A;  2FDJ A;  1RMU 1;  1TE1 B;  1ZBA 2;  5FFO C;  1RUF 2;  4LO6 B;  2NYY A;  2ZEY A;  3OPW A;  4ARY A;  4BH9 A;  4HMZ A;  2RMU 1;  4LNV A;  4GB3 1;  1JHN A;  1REF A;  5L9R A;  1BBT 2;  1SMV A;  2A6X A;  3SCH A;  4DXR A;  3WXP A;  2JG9 A;  3UET A;  4BQ1 A;  3KZ4 C;  3O1P A;  3ZXL A;  4XET A;  3IWZ A;  3N9M A;  5GAL A;  4KU8 A;  2ARE A;  4IEW A;  4Y20 B;  5IVY A;  5A3W A;  3ZIW A;  4A6S A;  4ATE A;  1JYX A;  4LLO A;  3IDC B;  2AAC A;  1MZ6 A;  3BCW A;  4GWI A;  1JYI A;  2OQ6 A;  3NAP B;  3URF A;  1ZNP A;  3T30 A;  3J8F 1;  1BYH A;  1SZB A;  4LO4 B;  3UGH A;  4Y5S A;  4QKF A;  4MSV A;  4BK5 A;  1KEX A;  3AMP A;  3TOJ A;  2W5F A;  2V09 A;  2WAO A;  1RUF 3;  4FI9 A;  3K75 B;  2VUJ A;  3WF1 A;  5BNO C;  1RHI 1;  1GU3 A;  1ZZ7 A;  3HQX A;  4XMA A;  2RV9 A;  1RVF 3;  2BU9 A;  4NID A;  3AM2 A;  3J7M A;  3TEZ A;  3N4M A;  2XJS A;  4GIQ A;  2C6S A;  2WNV A;  4IE0 A;  4ZZ5 A;  5ACA 3;  1GQP A;  2GC1 A;  2D98 A;  3T09 A;  2RJK A;  1W03 A;  4Z82 A;  5FYY A;  4KWJ A;  3DYM A;  1JZ4 A;  2YFZ A;  4XJA A;  1D4V B;  1AXY A;  4ASL A;  2VZT A;  4UW3 A;  2Z5W A;  4BU2 A;  3N9N A;  1QQP 3;  3POB A;  4X8P A;  4QQ2 A;  5FZ1 A;  3IN9 A;  1TQ5 A;  4YGB A;  4GD4 A;  4EWD A;  2BYV E;  4YVW C;  2GN3 A;  2AUY A;  1CN1 A;  4U36 A;  5D1I A;  1IZ3 A;  3I2F A;  5C5U A;  4LHS A;  5CIR A;  1VBC 1;  5D2A A;  4LO7 A;  3DPR B;  4J6G A;  4W6W A;  2OS2 A;  1RUH 1;  1MAC A;  1OI6 A;  4FFI A;  4QXC A;  4CDW C;  3NV1 A;  4RS5 B;  4B29 A;  5CG8 A;  4YVW B;  4QQH A;  3FLR A;  1IG3 A;  1DQ1 A;  1SLA A;  5FY0 A;  1VB2 A;  3CQO A;  1LOB A;  2J1V A;  2YPJ A;  4QB1 A;  3VBF B;  4COZ A;  4CCM A;  2FDH A;  1TNR A;  4FBF A;  1FOD 1;  2SLI A;  1I9R A;  1SFP A;  4CCE A;  1W2O A;  2SBA A;  3SCG A;  1BHG A;  4Q0Q A;  4CPB D;  2JD4 A;  4UFI A;  1DYP A;  3GBG A;  3OBA A;  3M70 A;  5LRR A;  2D6M A;  5CZK A;  1PNG A;  1IKP A;  1N1S A;  5FZM A;  4OI2 A;  2UY9 A;  5DDJ 1;  5AC9 2;  4XF9 A;  2VU9 A;  2K0G A;  3RZM A;  2NMO A;  3VBR A;  3VDA A;  4L0P A;  4XQD A;  4HN0 A;  1BXH A;  2JDZ A;  1AYN 2;  1WMX A;  5A32 B;  3OBZ A;  4IEV A;  1G9D A;  4LHL A;  3BPZ A;  3ZR6 A;  5ABJ B;  3A22 A;  2LM3 A;  1JUI A;  1PZ9 A;  1RUJ 1;  1CJP A;  3IIA A;  2HBU A;  3AX4 A;  2VQ0 A;  2HWB 3;  1G9F A;  2GC0 A;  2VC9 A;  4L92 A;  2CDP A;  1Q8P A;  1YQ6 A;  2PYT A;  4O7X A;  4XYX A;  1W6N A;  3IM0 A;  5A6Z A;  4JRA A;  1Q43 A;  5C7G A;  1C5H A;  5HCB A;  3W59 A;  3B93 A;  3K51 A;  4JGZ C;  1UN1 A;  3MIE A;  3ILR A;  3PVE A;  3OTF A;  4IER A;  4MX3 A;  4Y22 B;  5H9R A;  3MEP A;  2QKD A;  3DGT A;  3CJI A;  4RQP B;  5E16 A;  3W20 A;  2VME A;  2GNB A;  1UXZ A;  3LFM A;  2GC3 A;  4DRV A;  2XUE A;  1EYB A;  3H8R A;  5A3L A;  4K9S A;  1GZW A;  4FTB A;  4I02 A;  4UW4 A;  4XCB A;  4BOW A;  2EIB A;  4BQY A;  1EUT A;  4PQQ A;  1LNS A;  1VAK A;  3NV3 A;  1BEV 3;  4M4R A;  5FTT C;  2RVA A;  3V0B B;  4NN0 A;  4I3G A;  1W0N A;  1OLR A;  3I3D A;  4YAR A;  2PEL A;  1RUO A;  3WUD A;  1XB9 A;  2VOT A;  3LSD A;  2GP5 A;  2VQT A;  2DFC A;  1PMJ X;  1QJY 1;  1VBE 3;  2XBO 2;  1XQN A;  3K3N A;  1IPK A;  4YLZ A;  3MUZ 1;  3VZM A;  2C26 A;  1NCQ C;  4NII A;  1H2K A;  1FV2 A;  3B9C A;  2QQP A;  4LT5 A;  2ZA9 A;  5FK7 A;  1IPJ A;  2J22 A;  5KHG A;  4A42 A;  3OYW A;  5J48 A;  1F2N A;  2HKX A;  3MZH A;  4P9I A;  2DCK A;  1MS1 A;  3ACG A;  3GXU A;  3DV8 A;  4H3W A;  1F5F A;  3RYP A;  4HN1 A;  4AK3 A;  4YZ1 A;  2YG0 A;  3J8F 3;  4J25 A;  5KC6 A;  3D82 A;  1CGP A;  2WA4 A;  4ONU A;  1GP6 A;  3JD7 3;  3N7K A;  2VBD A;  3W58 A;  3DPR A;  5LY2 A;  1D0G A;  2DUQ A;  1OPM A;  2QQL A;  2B4K A;  1O6U A;  2VVF A;  5D21 A;  1UIJ A;  2BDR A;  2BWA A;  5LCW L;  2LRP A;  1QJF A;  1W3X A;  2EXH A;  4IE7 A;  3M3Q A;  2B5H A;  3AL6 A;  5FYM A;  2ZKN A;  1Q8Q A;  2ZXQ A;  4PBO A;  4XZP A;  1DIW A;  3VZN A;  2FDK A;  1JU3 A;  1PK6 B;  4QX3 A;  2G9F A;  1ULP A;  4AQS A;  3L2Y A;  4PDW C;  1PO1 2;  4IEQ A;  3S7I A;  3HPN A;  5F39 A;  1V9U 1;  1LTE A;  3PIJ A;  2JE9 A;  4FPY A;  2RS5 3;  3Q8C A;  4Q4V 1;  1JYT A;  1W99 A;  3N9Q A;  1KJR A;  2JDP A;  3CEW A;  3LOI A;  3OCP A;  3VDD B;  1UL9 A;  5C5T A;  5FP4 A;  3WW2 A;  3SHR A;  5LEJ A;  2GND A;  2WNU C;  2ZGO A;  3D0S A;  5GLT A;  2O8Q A;  2NLR A;  1WW7 A;  2IXL A;  3ZMN A;  2W46 A;  2E53 A;  3ZFE B;  1BBT 3;  1AL2 1;  1YJK A;  2VPV A;  4OUS A;  5CAD A;  4ZZ8 A;  2ENR A;  1AUY A;  1J3Q A;  3QH6 A;  1BVP 1;  1JTZ X;  5DUW A;  5EJZ B;  3I4I A;  4HPK B;  3ZVX A;  2DYC A;  1DGR A;  2K46 A;  3PUI A;  2WT2 A;  4KGQ A;  1AXK A;  3ETQ A;  1CQ9 A;  4AI1 A;  5IFT A;  1UY1 A;  1UY2 A;  4BME A;  2HBT A;  2WUH A;  1W8W A;  2ZAC A;  4S2F A;  4CP9 A;  1DCS A;  1GP5 A;  4PQ9 A;  4D6S A;  1HDK A;  2WKK A;  2ZCW A;  3LWC A;  4UFJ A;  4GKX A;  2JKB A;  5FK8 A;  5FMC A;  2QQJ A;  3M7A A;  1O4Z A;  3MIH A;  2RS3 1;  4W6Y A;  3POI A;  3A4U A;  5DG1 A;  1WCK A;  3VD3 A;  3OGS A;  2V4V A;  4KH9 A;  4MGK E;  2YY1 A;  2GSY A;  1XE7 A;  5EQU A;  1URX A;  1UF2 C;  3LA3 A;  1CPM A;  1GV9 A;  1POV 0;  4WM8 C;  1UYP A;  1D2S A;  2VCA A;  1IOA A;  4B8E A;  1RUD 1;  3ZO0 B;  1TEI A;  2ZTN A;  3VHO A;  2HLE A;  1NAE A;  3BPS A;  3KMH A;  4EN0 A;  5IVV A;  1UY4 A;  5JI9 A;  1V6N A;  3A7Q A;  3AP4 A;  5JOZ A;  1VRH 2;  4DPN A;  3BOD A;  1RTV A;  4YW3 A;  1G9C A;  1QQP 1;  2F4L A;  3WNN A;  5BY5 A;  2W68 A;  1OUS A;  1SLC A;  3GZA A;  1GNY A;  2YU1 A;  3I8T A;  5FZ4 A;  1JZ5 A;  1AR6 3;  1I3H A;  4YW1 A;  4Q4X 1;  3O0V A;  2VEC A;  3WV6 A;  2JE7 A;  5F37 A;  2Q0A A;  1XU2 A;  4R9A A;  1QDC A;  1HRI 1;  3LIG A;  2FQP A;  4LLF A;  1AYM 3;  1NCR B;  4RGA A;  5EYX A;  4ZXE A;  4CP2 A;  1Q3E A;  3ZFE A;  4HKL A;  4XJ9 A;  1CZV A;  3GAL A;  1R1Z A;  3JB8 A;  4WM7 C;  5BNP B;  3TNP B;  2VZQ A;  4N43 B;  2WZE A;  3SMH A;  2GC2 A;  1KS5 A;  4W65 A;  4CDQ C;  3HQU A;  4A3Z A;  2YPD A;  4M3C B;  2H6C A;  1PMI A;  2DBI A;  3I3E A;  2NPI A;  4BQ3 A;  1CZS A;  5FZ0 A;  2D5F A;  2WL1 A;  4FFF A;  2HJI A;  4ZS3 A;  2FDI A;  1AR6 2;  1HB3 A;  4JX0 A;  1LB2 A;  3AYE A;  3WNM A;  1DGR N;  1ZX5 A;  4GWJ A;  3VBF A;  3ZPO A;  3WNK A;  2IVJ A;  2Z4F A;  4RGK A;  5ANQ A;  1OVP A;  1HXS 3;  4FPG A;  3SIS A;  4GH4 C;  3POY A;  2AZ5 A;  4EWA A;  3POS A;  1TME 2;  2CV6 A;  2AR6 A;  1ONA A;  4NHL A;  3KHB A;  5FPB A;  1O3Q A;  1W8F A;  2Y6H A;  4LHN A;  4XE9 A;  3UGG A;  5FIX A;  5A3T A;  4OMC A;  2HEV F;  5L9V A;  2HWB 2;  1R64 A;  1PIV 2;  1H8T A;  2XQX A;  1DGW X;  2DCZ A;  1XRU A;  2G9G A;  3DF0 A;  1VE0 A;  4OLL A;  4A6O A;  3ACF A;  4NUB A;  1S0F A;  3J7N A;  4GA9 A;  1UZZ A;  4Y26 A;  3F2Z A;  3T3Y A;  3VKM A;  3QCW A;  4UF0 B;  4CUC A;  2EF6 A;  1WCD J;  1B09 A;  5A32 A;  3VUO A;  4KQ7 A;  1BKZ A;  1XSQ A;  1Z0H A;  4IV1 C;  3OPT A;  5IK5 A;  4K1Z A;  4EE2 A;  3Q8B A;  3RZK A;  4PT6 A;  3LKJ A;  4RN5 A;  1Z7S 3;  4IE5 A;  3NMB A;  3ACH A;  4UW6 A;  1HXS 1;  1W8U A;  3ZYG A;  2J1U A;  1OH3 A;  1Y3T A;  3IMN A;  5CIS A;  3NW4 A;  1V00 A;  5JOX A;  2IZW A;  3GBF A;  5DUV A;  4OQ9 A;  1MS3 A;  4H7L A;  1ND2 B;  2J42 A;  2WYF A;  5JXJ A;  2H6B A;  1T6G C;  4LPL A;  4FP2 A;  5EV7 A;  4HLT A;  1XPW A;  4Q4V 3;  2VMC A;  1QOS A;  4N90 A;  3VKN A;  2OPK A;  4RL7 A;  1OKO A;  1ND3 B;  1OT5 A;  2FCT A;  3LEM A;  4O61 A;  4XUO A;  1L7L A;  1SCR A;  2JJ6 A;  3JQW A;  3MIC A;  4GMP 1;  1UX7 A;  5EXO A;  1VBE 2;  1H1A A;  4QAW A;  3U07 A;  2VZV A;  3ZN4 A;  4IND A;  3AJZ A;  4LKS A;  1VBB 2;  4Q29 A;  5FXX A;  1GNZ A;  2FCV A;  4XZU G;  5FZO B;  2YHJ A;  4CUA A;  1W05 A;  3WY6 A;  5FYB A;  2YC4 A;  4AVB A;  3Q9O A;  3B7M A;  4DXS A;  1HB2 A;  1WMD A;  5C4W B;  1YCI A;  3WNX A;  3UJO A;  4DO0 A;  3IPV A;  2ADD A;  1K5M B;  1KJL A;  3N7L A;  3ZFG A;  4IEU A;  2A6V A;  4YG0 A;  5JR7 B;  3SH3 A;  2HWD 1;  3IDA A;  5CB7 A;  2WWU A;  4COY A;  2ZHM A;  4QGL A;  4DNY A;  3UKT A;  1CX1 A;  3KV6 A;  3VDB A;  4UFK A;  3VL9 A;  1GQH A;  4PF1 A;  1ZM1 A;  3H0O A;  5IVC A;  2ZZQ A;  1W6Q A;  1OQE A;  1VBB 3;  2K2S A;  2VCC A;  4KU7 A;  3AVR A;  4YGD A;  4LBL A;  3RQ0 A;  1MQT A;  1JYC A;  3RWK X;  3UGF A;  4J1W A;  4PDW A;  4QPI C;  4XXA A;  1C8M 2;  1YUD A;  2V5Y A;  4LE4 A;  4XAC A;  3VZK A;  2E33 A;  1NQD A;  2NM1 A;  4CPB A;  5A6Q A;  3V0B A;  1LOC A;  1UOF A;  3DUI A;  3MLL A;  1YIF A;  2Z42 A;  4E2S A;  1VLN A;  4OUM A;  4OI4 A;  5GLV A;  5FOB B;  4N43 A;  4HL0 A;  1NT0 A;  3AKR A;  1ENQ A;  4IUG A;  4UBH A;  1K12 A;  2VTF A;  3OPZ A;  4PCR A;  4CDW A;  4L8Q A;  4YW2 A;  3EXU A;  4AFM A;  4XIK A;  5I91 A;  2CY6 A;  2RJ2 A;  2P4E A;  4K21 A;  5FZA A;  3FBM A;  2JEN A;  3OEB A;  1LES A;  3B01 A;  3N36 A;  3N3H A;  1AJK A;  4GAZ A;  2XOM A;  1WW4 A;  5C70 A;  3R4D B;  4XOG A;  4COW A;  1RGS A;  4XHB A;  3ZN5 A;  5A1L A;  2EXK A;  4QX8 A;  3C7H A;  4C0B A;  2D97 A;  2XG3 A;  5J1X A;  3PIG A;  3TNQ A;  5FO9 B;  4AFA A;  4MVT A;  5DAP A;  2JEM A;  1J3R A;  3NAP A;  4W4Z A;  4RHV 1;  5J96 B;  2L9L A;  1PM7 A;  1AL2 3;  1R08 1;  1ST8 A;  3ZXF A;  5A33 B;  2D3S A;  2ZEX A;  3THT A;  2GH8 A;  1H9P A;  4XQW A;  4Y1Y A;  1COV 3;  4JTN A;  1RUN A;  4D94 A;  1W8T A;  1UWW A;  3I3M A;  1AYM 1;  4NIH A;  5GZC A;  1YQ2 A;  3RZZ A;  2DF7 A;  2QZ3 A;  4GZ9 A;  2HWC 1;  4XVH A;  1QH6 A;  5C33 A;  1LHO A;  1YFY A;  2XJV A;  3PHM A;  4C8D A;  5ERL A;  4YM3 A;  3ZFG B;  1E5R A;  5A3M A;  4NIG A;  4RS5 C;  4CDX A;  2ZGT A;  4WM8 B;  3D5O A;  2E7Q A;  2ZX0 A;  1UO9 A;  5T3N A;  4HVO A;  1YQ8 A;  3VDD A;  1HQN A;  4D3W A;  3WD5 A;  1EV1 1;  4DS0 A;  3O1T A;  4R52 A;  2ZHN A;  5C8C C;  1LHU A;  1UXX X;  1V6I A;  4FPF A;  4DUX A;  2FMY A;  3T0B A;  3MDP A;  3UKN A;  2DVB A;  1BJQ A;  4XJZ A;  4KMQ A;  3I54 A;  4O65 A;  1MR5 A;  2R1D A;  5BNQ A;  1X8M A;  3ZM8 A;  4E27 A;  4QPI B;  1XXN A;  3I59 A;  2BW8 A;  3POG A;  1YO8 A;  2EAA A;  3OD0 A;  2QQU A;  2D5H A;  2DTY A;  3C8X A;  4JC1 A;  3T0A A;  1SLT A;  2YU2 A;  2D6O X;  4MH0 E;  4N53 C;  4OFG A;  4OZO A;  4EV0 A;  5IYY A;  1LOF A;  4NVP A;  5B2G B;  1NE4 A;  5GKA C;  5JIU A;  1IS5 A;  1Q8V A;  4PLN A;  1ZRI A;  5GZF A;  1OA4 A;  3BU0 A;  3K48 A;  1JHJ A;  2P3Y A;  1F9K A;  2IXH A;  1VMJ A;  3OSD A;  1RIT A;  2PTM A;  4ERO A;  3AYC A;  1XNB A;  3O0X A;  3A23 A;  4YVW A;  1ODM A;  3WUC A;  5F8P A;  3ZN6 A;  5FWE A;  5EJ3 A;  3LD8 A;  2BJS A;  1UY0 A;  5DAQ A;  4BXF A;  1W2A X;  2BUK A;  4Y33 A;  1MQT C;  4KWL A;  2B42 B;  2QQW A;  1QJX 2;  2ZAH A;  5T50 A;  2V72 A;  4Z2W A;  1A3K A;  3H7Y A;  4NE9 A;  2B46 X;  4A7Y A;  5FUI A;  5FZE A;  1RUJ 3;  3O7O A;  1QHD A;  3GYD A;  4BM8 A;  5HCH A;  2A7A A;  3QAC A;  3G6J B;  3M3O A;  4LBN A;  2RDQ A;  4XW3 A;  5F3E A;  3FHA A;  5F3G A;  4PLM A;  1RUC 1;  5FY9 A;  2A6Z A;  2TBV A;  4DZG A;  1HXS 2;  2R07 2;  4XFI A;  3NNG A;  4Q1P A;  5DUU A;  3OB8 A;  5EWS A;  5A7S A;  3HQR A;  3GCW A;  2TUN A;  4LBM A;  3LQC A;  5LW9 A;  3WQ1 A;  5BNN B;  2ZHL A;  3B69 A;  1HB4 A;  4BQX A;  1JZ7 A;  4QKN A;  1DGL A;  2W9X A;  4M3C A;  2W91 A;  4ES9 A;  5HI0 A;  4TZD A;  4EN6 B;  1O3R A;  1CAW B;  1HQW A;  2BTV C;  4S2H A;  3U75 A;  3MYX A;  1VAL A;  3U4S A;  1DZR A;  2D6P A;  5IT6 A;  2BWC A;  4BYY A;  4AEK A;  4NWV A;  3OGJ A;  2E63 A;  3PTY A;  4NO4 A;  5FP9 A;  4TYS A;  1PGL 1;  2HEW F;  3VV1 A;  1HW5 A;  3RJR A;  4AEJ A;  4R9B A;  3VBU A;  4LO5 B;  3FHQ A;  4LIV A;  1JOP A;  3AXD A;  3WW4 A;  1CJD A;  1PZ8 A;  2CSG A;  4AYU A;  4LXL A;  3IDE A;  2R16 A;  3LE0 A;  2C5D A;  2PMW B;  4M00 A;  1UW8 A;  3HWJ A;  4JRL A;  3HBZ A;  1C1L A;  1RMU 2;  2UUR A;  3NQH A;  3R0R A;  4TN7 A;  1L3J A;  3VDC A;  1NY7 2;  3KQ4 B;  4YSF A;  4QDR A;  1W6O B;  1KFX L;  3LF7 A;  3MIF A;  3MV1 1;  4JKM A;  1LEM A;  5FLH A;  3AKT A;  2F4P A;  2JX9 A;  2ZAB A;  1YHF A;  2I07 B;  3FFQ A;  2PHU A;  4V2V A;  4IW3 A;  3KGL A;  4LIU A;  5F7U A;  1OLM A;  1DLC A;  4CEY C;  1W2U A;  2VMF A;  1HB1 A;  1C8M 1;  1TMF 3;  3ZFG C;  2N7G A;  3RZJ A;  4WM7 B;  1NE6 A;  5LA0 A;  3ZYH A;  4AVC A;  5APA A;  5FMO L;  1ULO A;  1YFW A;  1NA1 A;  4AI9 A;  1YFX A;  2Y8K A;  1OQD A;  4XDQ A;  4NAM A;  1W9W A;  1XNK A;  4Y1X A;  3RDI A;  5BNP A;  5IAX A;  3FJS A;  1PO1 3;  4YZ3 A;  3AZW A;  3N7M A;  4MHU A;  4AHW A;  5F3C A;  4LIT A;  3B94 A;  4I09 A;  1S0D A;  1H2M A;  2CWM A;  3LEK A;  3W9A A;  2HWD 3;  2RJL A;  2P34 A;  3AVS A;  4XUP A;  3WF2 A;  1TMF 2;  4A41 A;  1TVG A;  5BNN A;  3TEW A;  4Y4R A;  4D6Q A;  3TWI A;  1C8M 3;  2OXB A;  4AED C;  1NZI A;  3TN9 3;  3AXE A;  2PLV 2;  5LK5 A;  4FPJ A;  3GM8 A;  4I2O A;  2YBK A;  1LOG A;  2PAE A;  2QQK A;  1ULC A;  2JB8 A;  4MV2 A;  4Y20 A;  5DQ0 A;  4QQO A;  4XCA A;  2R06 1;  5F6K A;  1W0P A;  4XUT A;  4QHB A;  2ERF A;  2VBB A;  1SHW B;  1MS5 A;  4BA6 A;  3FC0 A;  4KBZ A;  5KHH A;  3ZFE C;  5GZG A;  4XTP A;  2VNV A;  1XC6 A;  3PVO A;  5HCF A;  3T2Q A;  3NNM A;  1SDD B;  4NPR A;  5BNO B;  2WFP A;  5FPU A;  4QPG C;  1W6O A;  2WNE A;  3H1M A;  1LHW A;  5FP7 A;  5FZI A;  3I2O A;  4MXV A;  3DPR C;  1BK1 A;  1AL2 2;  2JWP A;  3FMG A;  4CU9 A;  4Y1U A;  3O1V A;  3PUR A;  2R32 A;  1PNF A;  3LEG A;  4BLI A;  3M1H A;  5FYI A;  1FAT A;  2XL7 A;  4K8R B;  5CKM A;  4CP1 A;  3OGV A;  5DDJ 2;  4NIA A;  5JPM B;  3GGL A;  1RUH 3;  3OGR A;  2A5Z A;  3ZYI B;  1JYV A;  5GLU A;  3U37 A;  2VL4 A;  3CJX A;  1SLB A;  2RM2 1;  3PNA A;  3WDV A;  5GLW A;  4WV8 A;  1ENX A;  4QM8 A;  3WF3 A;  5I8S A;  2X10 A;  2X09 A;  3JZV A;  5LAT A;  1ZBE 1;  2ZMN A;  3H3U A;  3WG4 A;  1OOP B;  2VVD A;  1J1T A;  3KB5 A;  1DF0 A;  2WAB A;  4QKD A;  5K0U A;  4SBV A;  3AJY A;  5HXM A;  3KSC A;  1PVC 1;  4H14 A;  2ZBJ A;  1YYN A;  2DCY A;  4W6X A;  4QU1 A;  3APB A;  5JOW A;  3ZPY A;  1GYK A;  2D6N A;  2OUH A;  5JCT A;  5A70 A;  2TNF A;  5BUV A;  5IVB A;  4X8N A;  3SNM A;  4FCA A;  2BNN A;  3AP7 A;  4E8D A;  4AHY A;  3SQO A;  3E5X A;  4LK7 A;  1N3P A;  2XVL A;  2DWR A;  2WAA A;  1E5H A;  1YI7 A;  2BFU S;  2ZGR A;  4UT5 A;  2BZD A;  2Y64 A;  1VJ2 A;  4P9Y A;  1KS4 A;  4FQ4 A;  1S4C A;  2Y6K A;  4AE2 A;  5F2W A;  2X53 S;  1J83 A;  2KR2 A;  5AFB A;  3PJQ A;  4XIL A;  2JDU A;  4KNC A;  3VZL A;  1SFY A;  1WMF A;  4P02 B;  1FMD 1;  2V73 A;  3TRS B;  1PVC 3;  2IXI A;  2R07 1;  4QX0 A;  5A7O A;  3RSJ A;  1S0B A;  2AEZ A;  3E6D A;  3HR9 A;  1CZT A;  3M3E A;  4YPJ A;  2VMD A;  1TME 3;  4FPL A;  4GQ7 A;  5JLV A;  2B39 A;  1AX1 A;  5IW0 A;  3AMQ A;  5K9Y A;  4OHY A;  4C91 A;  1VMF A;  3T0D A;  1U5X A;  1D2Q A;  1DQ6 A;  4YYO A;  3MBW A;  2CAV A;  1W9F A;  4YW7 A;  4AQ2 A;  3ZSK A;  1F4H A;  3FLP A;  1BEV 2;  3ON7 A;  1KDK A;  3KWV A;  4K1Y A;  5L7O A;  2I74 A;  2VZU A;  2R30 A;  3MLK A;  1H4G A;  2BVB A;  2YXS A;  1WW6 A;  1OUR A;  4RQP A;  5KXB A;  4FSJ A;  1V6L A;  4LKD A;  4L2N A;  3CJI C;  1S0E A;  2WT1 A;  3AMH A;  2G4I A;  3I2G A;  3GZE A;  5DZF A;  3WX5 A;  3H8U A;  5DN2 A;  2XLA A;  5FRE A;  4CCK A;  3LDR A;  3ZYF A;  1Z78 A;  1ZA4 A;  3LPF A;  1RIR A;  2X5I A;  4LBQ D;  5FBJ A;  5JAX A;  2NZ9 A;  3WG1 A;  5LY1 A;  2Y26 A;  1R1A 3;  1NCR C;  1UU5 A;  1WA6 X;  2VCB A;  1XSR A;  4FTS A;  1UOB A;  2VG9 A;  5C3Q A;  2A6W A;  5J37 A;  3NV4 A;  3I2K A;  2YBP A;  1JS9 A;  2ZGP A;  1NKG A;  2H0B A;  4XAA A;  2WDB A;  4NPM A;  3H42 B;  1ZZ8 A;  5DXD A;  3MIB A;  3PL0 A;  4BCU A;  5C8C A;  5KBF A;  4CEY A;  1WLD A;  1PX4 A;  1SCS A;  4XUR A;  1W9T A;  3LZZ A;  3MI8 A;  4P9L A;  4FOW A;  5KHI A;  2WNV C;  3GJA A;  2W1Q A;  4HON A;  3JD7 1;  2WJS A;  1RUE 1;  3A0N A;  4WZF A;  4I0B A;  4NHK A;  5FUP A;  4LOT A;  4BHP A;  4QD2 A;  1MVE A;  2XXZ A;  1OLM E;  3QD6 A;  1O8P A;  5FKC A;  3VB9 A;  1W8O A;  2DFB A;  2QJV A;  1W04 A;  4XBN A;  4EZH A;  3B00 A;  4GH4 A;  2ET1 A;  3GCX A;  3PVB B;  4B1L A;  5JXH A;  4IL7 A;  5CG9 A;  1H1M A;  4QM9 A;  3INA A;  4IEO A;  5FXV A;  3PMS A;  1W90 A;  2VXJ A;  4QX7 A;  5HV4 A;  3UT0 A;  5FZ8 A;  2VY0 A;  3AZY A;  2OZ6 A;  5A6Y A;  4HSJ A;  5EP9 A;  4CDQ B;  4D6R A;  3T4V A;  1V6O A;  2NP0 A;  2C1F A;  1H2L A;  4R9D A;  4Z92 B;  2Z79 A;  1ASJ 1;  5JXI A;  1VBD 2;  1UZW A;  3LSE A;  3J7H A;  4RR3 C;  4H7M A;  1CAW A;  1WBF A;  2DCT A;  1PK6 A;  2E7A A;  4IV1 B;  1RUE 3;  2LRO A;  1XU1 A;  2VZR A;  3IPV B;  2YGL A;  4LUK A;  4AI3 A;  4D8M A;  2XPJ A;  1PO2 3;  2JDK A;  5C8C B;  3KV9 A;  1RVF 1;  2PHF A;  1CAU A;  2RS3 2;  1ZBA 1;  1W6M B;  2YBS A;  4TLG A;  1JOJ A;  2BGC A;  3NST A;  4XFB A;  2HWD 2;  5G05 L;  2AGS A;  2ZEW A;  4D7T A;  5I0R A;  3AKP A;  2FDF A;  4Q8K A;  4URA A;  2WN3 A;  4UFL A;  3S30 A;  5FWJ A;  3GZT B;  4HT1 T;  5J09 A;  2FDG A;  5CYY A;  1IS3 A;  4G3Y C;  2DV9 A;  2VQU A;  1MZF A;  5LBE A;  1RUD 2;  2PQS A;  2XLF A;  3THP A;  4CCJ A;  1PVX A;  1ZYB A;  1QH7 A;  2E32 A;  4LBQ A;  3VBR C;  4HPK A;  4CU6 A;  4BIS A;  2C0Z A;  2ZML A;  4P14 A;  4XPV A;  4GJY A;  3ZYR A;  4CDW B;  1PO2 2;  2XON A;  4A7Z A;  3SH4 A;  5DZG A;  2R1B A;  3VBH C;  4P00 B;  4H2A A;  4BDV B;  5L7O B;  5IAV A;  5JOY A;  2YUE A;  1I5P A;  1DP0 A;  2IXJ A;  4ZPI A;  1K5M C;  1UKG A;  5BNP C;  1I6X A;  3LA7 A;  4RYD A;  5FZD A;  2J1A A;  2VM9 A;  2NQY A;  2WNO A;  4B7K A;  3MFC A;  1L7Q A;  4Z8B A;  1HRI 2;  2OT7 A;  2WBK A;  1O3T A;  2OQ7 A;  4G4F A;  4AWD A;  5DAX A;  3ZXD A;  1DU3 D;  2B9V A;  1PGW 2;  3AMN A;  3SLI A;  4CRQ A;  1VMH A;  2AH2 A;  2IC1 A;  3OD4 A;  2A3X A;  2VGD A;  2QBX A;  1QJU 1;  3AB0 A;  4QQP A;  2R49 A;  4IGQ A;  2QDR A;  2BOJ A;  1GLH A;  4ZXK A;  3VZO A;  4QB6 A;  4I01 A;  5DDJ 3;  2PXJ A;  1HN0 A;  2IWG B;  3VKF C;  1AYM 2;  4AFC A;  3ALQ A;  4CZS A;  3WP6 A;  4Q4Y 3;  3HNY M;  2HWE 3;  1JBC A;  4IE4 A;  4N7I A;  4FPH A;  4RR3 A;  4XDP A;  5C9A A;  5FY5 A;  2Q8O A;  3AZZ A;  2QUO A;  4WM8 A;  5F2S A;  4L9B A;  3LB9 A;  1MPX A;  1AX0 A;  3VD7 A;  1X8E A;  5SV5 A;  4ARX A;  4EN9 B;  1O4Y A;  4NHM A;  4QX2 A;  1UIK A;  1K5J A;  4PLO A;  5LZ6 A;  3Q8A A;  3RPQ A;  4OI0 A;  5C8W A;  3W5N A;  2G9Z A;  2HWB 1;  3FUO A;  4FPE A;  3CBN A;  5IJR A;  2A71 A;  2RE9 A;  5FJK A;  5J98 B;  3V0A A;  1DLL A;  3K4A A;  3BTA A;  3NNF A;  3LGR A;  3HEI A;  3JB4 C;  4YVS A;  4CDU A;  4R4Z A;  3ILN A;  3U14 A;  3I59 B;  3WDY A;  3MID A;  4GKY A;  5EIY B;  3LIH A;  4HBN A;  3T1M A;  5T54 A;  1UZ0 A;  4IV3 A;  5EFU A;  2QCS B;  2HWE 1;  4BIF A;  1SEF A;  3ZYB A;  1VPH A;  4ZKT B;  2A1X A;  5DUX A;  4QMA A;  2RG4 A;  4Q1R A;  2R6Q A;  1AYN 1;  1F4A A;  2YRO A;  3RI8 A;  3THC A;  1OBN A;  4JGZ A;  4HFS A;  3UES A;  1ULD A;  2R7E B;  3J26 N;  4FPC A;  4I3P A;  4XFC A;  1OF4 A;  1GBG A;  3NRU A;  4BQ5 A;  4ET7 A;  2ZMK A;  5C9A B;  1IS4 A;  2HEY F;  3O1S A;  4XF3 A;  5A80 A;  1GFF 2;  4DUV A;  3O14 A;  3VBS B;  1DQ0 A;  1WKY A;  2VAU A;  1SBD A;  2D93 A;  2JG8 B;  2BNO A;  1I5Z A;  4RA0 A;  4C90 A;  1AX2 A;  3NKT A;  1NXD 1;  3AYA A;  3ENR A;  4JDN A;  1HIX A;  2EID A;  1OHF A;  1ZZC A;  5JMC A;  1OA3 A;  4RSU A;  5IAT A;  5LBF A;  2GAU A;  1W8H A;  5FP3 A;  3ES4 A;  3IZO A;  2X8K A;  3LCP A;  3ACI A;  5H9P A;  2V5D A;  2BFU L;  5FZF A;  2X29 A;  5FZL A;  4PBP A;  1US3 A;  4XJW A;  5FPL A;  4NR1 A;  4WVM B;  2WWS A;  2O0O A;  4KGG A;  4YFW A;  4HVR A;  4AGG A;  1ZZB A;  1HLC A;  2DVG A;  3HN1 A;  1A8D A;  4HXC A;  5HXV A;  3DEC A;  4UFH A;  1UU4 A;  3JBG 1;  3Q8F A;  2EAL A;  4V1P A;  5DZE A;  5LB6 A;  3ZLI A;  3VBF C;  1X36 A;  1R1A 2;  2WWJ A;  2ZJC A;  3VBO C;  1MS0 A;  1DQ5 A;  1XNC A;  5DMY A;  2XBO 1;  3F95 A;  4GWM A;  5LK7 B;  4OYU A;  2E31 A;  2MEV 3;  3RVH A;  1FPN 1;  5LAS A;  2JDN A;  1J3P A;  2UYA A;  3AMM A;  4P9G A;  3SC7 X;  3BN6 A;  3VBO B;  2C9A A;  4B4Q A;  1KFU L;  4AI2 A;  1ULG A;  1VBD 1;  3B9I A;  1DZQ A;  1H8T C;  3BAL A;  3I3B A;  4M0N A;  1YNA A;  2BOI A;  2G19 A;  3FL7 A;  4ASK A;  1W28 A;  3POE A;  4WZC A;  4CYD A;  1XBF A;  3HD8 B;  4QQL A;  4AHX A;  2B7Y A;  2JG9 C;  3X29 B;  4EN7 B;  3OGG A;  3CO2 A;  4UYB A;  4UFM A;  4W50 A;  1JYN A;  1AZD A;  4HKO A;  2WZR 2;  3K4Z A;  2W95 A;  3MW4 A;  4CE8 A;  3RMX A;  2JIJ A;  1AR7 2;  2JG8 A;  4BQW A;  4D0Q A;  4ZY9 A;  2RDR A;  5M0T A;  4RHV 2;  1SDW A;  3RZL A;  1VRB A;  5A7P A;  4JZR A;  3T08 A;  1X9P A;  4JCK A;  2X5I B;  3RZG A;  1MQT B;  1E5S A;  1YLL A;  4D7S A;  2Z2S B;  4K6B A;  1D0H A;  1XYN A;  3N9P A;  4LKE A;  1VIW B;  2VW0 A;  4RQP C;  3RZH A;  4R9C A;  3T1L A;  1V9U 2;  2ET7 A;  3POF A;  5LBC A;  3CJI B;  4MGS A;  3LPG A;  2CGO A;  3TN9 1;  1U5Y A;  3IAQ A;  4ATF A;  2FZ1 A;  5AFE A;  1GZW B;  3M2M A;  2RS3 3;  3IB3 A;  4OMD A;  1Q8O A;  4QT6 A;  3NL1 A;  4XXP A;  2YC2 A;  2VE1 A;  3DYO A;  1Y4W A;  2WS9 1;  4IEP A;  1D4M 2;  4OHV A;  3ITQ A;  4MAD A;  4RHV 3;  5T5L A;  1F5J A;  4CDQ A;  3KF5 A;  4Q4Y 1;  2ZGK A;  1UMI A;  3UK9 A;  3WSO A;  1COV 1;  1UU6 A;  3JQX A;  1BVV A;  2BNM A;  4DEQ A;  2UU8 A;  4NAO A;  2GAL A;  5CVR A;  3BYW A;  1RED A;  2WO7 A;  1W9Y A;  1C8N A;  5L36 A;  4Y5T A;  4CCL A;  2F17 A;  5A7W A;  4XJ8 A;  2ZGN A;  1MZE A;  1YFU A;  3ZKY A;  1PGW 1;  4NRM A;  1G9A A;  4JHZ A;  2A73 B;  1LED A;  4AFB A;  2DUO A;  1SAC A;  3ZN6 B;  4JV4 A;  4COU A;  3C7G A;  1PGS A;  1MZ5 A;  2PLV 1;  2ZX2 A;  3CL1 A;  4KG8 A;  3BI3 A;  1LOF C;  1JN2 P;  1UYX A;  2BEO A;  4GAL A;  3N9L A;  4QPY A;  1JZ6 A;  2FZ2 A;  4XAB A;  1QXJ A;  2ZX4 A;  5FMO S;  4XBQ A;  3RJ2 X;  3AFK A;  4BWO A;  4COV A;  4LBQ B;  2Y6F A;  4YM2 A;  5FMD A;  4YZ5 A;  2CGN A;  2JXA A;  3CMG A;  2A3Y A;  3I2H A;  4YRD A;  5E6H A;  5FY4 A;  5CFC A;  2A3W A;  5KHJ A;  2E9Q A;  3DYP A;  1ENS A;  3ILF A;  4ZS2 A;  2ZOE B;  1NCQ B;  4FAH A;  3BOW A;  1NG0 A;  5E89 A;  5EYY A;  1BCX A;  3VL8 A;  3VDD C;  3ZXK A;  4UI9 L;  5FPX A;  1GIC A;  1OKQ A;  3OEA A;  5JZG A;  2I45 A;  2XLG A;  1KRI A;  1O91 A;  2I2S A;  1H4H A;  5KHK A;  5T55 A;  4QPW A;  4FTE A;  1OOP C;  1PK6 C;  1S55 A;  3B02 A;  1IGO A;  2BBV A;  1QGL A;  2ARA A;  5FZ9 A;  2AYH A;  3IAP A;  1I1E A;  2HWE 2;  3E1F 1;  4LO8 A;  3VD4 A;  5F5C A;  1ND3 A;  2BP6 A;  1SQ4 A;  4Q27 A;  2GNM A;  1VBC 3;  3A0K A;  1T6B X;  1DG6 A;  2ZX3 A;  2GH2 A;  2VD7 A;  1F8V A;  2Y60 A;  4YG6 A;  3OY8 A;  5CNA A;  2JDM A;  4OHX A;  1TG7 A;  3VN4 A;  3KM5 A;  4Q0U A;  3P1I A;  5F32 A;  4JGY A;  5I0D A;  4XQ4 A;  3USU A;  1PVC 2;  4E2Q A;  3TB0 A;  4UXA A;  1CWP A;  3M3I A;  3PU8 A;  1W2N A;  4CVU A;  3EB7 A;  2R07 3;  2GZW A;  2WLQ A;  2ZPX A;  4EWE A;  2VCM A;  1G9B A;  3BKZ A;  4UBG A;  3WEZ A;  1PGL 2;  3JBG 3;  4KWU A;  2WR9 A;  4YWA A;  2WNU B;  2XJP A;  4QX5 A;  3CNA A;  3N7J A;  4E4D X;  2GME A;  1Z7S 1;  4QXK A;  1J84 A;  2VQA A;  2VZP A;  1YJL A;  1UYZ A;  2WO3 A;  1ZA7 A;  3CLP A;  5T5O A;  3SCF A;  1A8M A;  1GWK A;  1Y7B A;  3H1Y A;  2YFU A;  4K8F A;  4PDW B;  4MLO A;  4DOU A;  1W2T A;  1Y43 B;  1NY7 1;  3OBR A;  1CPN A;  3AZX A;  2EIE A;  1CIY A;  4FT8 A;  5GZE A;  4AW7 A;  1STM A;  4HK8 A;  4I0W B;  4DFS A;  5A1F A;  1WBL A;  1RIN A;  4HK9 A;  1GZ9 A;  5CU1 A;  1W8N A;  4P08 A;  5CFC B;  1PIV 1;  4XTM A;  3JBG 2;  4GXL A;  4CCN A;  4LA3 A;  3TEX A;  4A44 A;  3MF9 A;  2XJT A;  1YEW A;  3OY8 B;  4AEM A;  4BXS V;  5CFC C;  3MO4 A;  4LE3 A;  4LUM A;  1QWR A;  5D8A C;  1GSL A;  4UAP A;  4CEW A;  4DB5 A;  3P5B A;  1RMU 3;  4SLI A;  1ND2 A;  1X9T A;  1SPP B;  3S7E A;  3JUU A;  3DKW A;  4BQ4 A;  1APN A;  5JSP A;  3WNO A;  1OSG A;  2WN2 A;  2JB4 A;  3KCX A;  3VBS A;  3ZFF C;  4X6R B;  5JSR A;  2YC0 A;  3LAG A;  1UMZ A;  4G9S B;  4DXT A;  4AI8 A;  1ULE A;  4DEV A;  1DQ4 A;  3GNE A;  3I7D A;  3ST7 A;  3GBW A;  2RS5 1;  4DY5 A;  2DUR A;  2BQP A;  2MPF A;  3WNP A;  5IK8 A;  2VUL A;  1OQ1 A;  2WLP A;  4CU7 A;  3TBD A;  1SG3 A;  5FPA A;  4UWD A;  3M4F A;  3UYJ A;  5CFD A;  2XWJ B;  4XAE A;  3BU7 A;  1TMF 1;  1UX6 A;  3H3Z A;  4RS5 A;  1GOH A;  4LBK A;  3FBY A;  1HJG A;  2WZR 1;  2J1E A;  4Q5O A;  3NWK A;  4Q0V A;  3ZXJ A;  3ES1 A;  1QJY 3;  3W5M A;  1C57 A;  4B1M A;  1AR7 1;  1LGN A;  1FAY A;  1IG0 A;  2DTW A;  2WS9 3;  1QU0 A;  1R09 2;  1BBT 1;  1AR8 1;  1HV1 A;  3ETP A;  1VBA 2;  1HQL A;  2CHH A;  3OJB A;  4IE6 A;  5I8T A;  5LA1 A;  1UMH A;  1ZRD A;  3ECQ A;  2J1S A;  1J59 A;  4CEW B;  2WNU A;  4CTE A;  2VO5 A;  1QEX A;  4YZ2 A;  3O1U A;  3V0A B;  4MOA A;  3EYP A;  1SFN A;  1VBD 3;  3K77 A;  1FV3 A;  3HAG A;  5L9B A;  4OQ8 A;  4MXW A;  4OVE A;  5FDB A;  4GH4 B;  3TN9 2;  4ZHN A;  4AVS A;  5T5P A;  1RUE 2;  1W06 A;  2PLV 3;  2PHW A;  4GMP 3;  4TSV A;  3O12 A;  2OX0 A;  1GR3 A;  1ZVF A;  5DG2 A;  5FPV A;  2WZR 3;  3MUY 1;  2WS9 2;  1D4M 1;  2XH6 A;  5L73 A;  1L7R A;  3U11 A;  2VUA A;  3BVC A;  1AR7 3;  1XJA A;  4AVT A;  1RUG 1;  3MGU A;  1C1F A;  1GZC A;  3V56 A;  1V6J A;  5H9Q A;  4NRP A;  2Y6J A;  3RI9 A;  5K7P A;  1UZV A;  2PQQ A;  2R06 3;  3AP9 A;  1GKB A;  2OUJ A;  5A3P A;  4M3C E;  5CA6 A;  5FZ7 A;  1LHV A;  5F1R A;  5A1A A;  4A7K A;  3IT8 A;  1SPP A;  1OVS A;  4OZX A;  4LKF A;  1CVN A;  2XB6 C;  2ZGS A;  3MPB A;  4FFG A;  4XC9 A;  4CCO A;  5IFP A;  1OH4 A;  3FWE A;  3MIG A;  5C71 A;  2EA7 A;  3NJV A;  2JIG A;  5CBL A;  1QOO A;  2CWS A;  2GNT A;  5BPX A;  2BBA A;  1M4W A;  4JVA A;  1PHM A;  3GHM A;  4JKK A;  1W6M A;  3JCI A;  4F7Z A;  3KT7 A;  1Q56 A;  4XF4 A;  1MVQ A;  3PUA A;  3O1R A;  3ZSJ A;  3WQB A;  2WII B;  5FO8 B;  2QVS B;  1ZZ6 A;  3R6S A;  4Q2F A;  3WDX A;  2O14 A;  3WHT A;  4C0H A;  4Q4X 3;  3CF6 E;  1RUH 2;  1EY2 A;  3MLJ A;  1WA4 A;  1B35 B;  2QQN A;  1HRI 3;  3AKS A;  3KT4 A;  1R08 2;  2J1T A;  1JH5 A;  3T2T A;  3EJK A;  4AGV A;  2W2I A;  2VZ3 A;  1FI2 A;  1OA2 A;  3RG0 A;  4BB3 A;  5AVP A;  1WGP A;  4OHZ A;  3OUH A;  5FZO A;  1ULF A;  3DKQ A;  1H0B A;  4BPZ A;  5LRS A;  4XHX A;  4CCC A;  4N53 B;  4Y4Y A;  5KXE A;  4L99 A;  3WF4 A;  4NHY A;  1YWK A;  3UNP A;  3CHX A;  4ISQ A;  3PDQ A;  2EAK A;  1FMD 2;  2JG9 B;  2WRA A;  1C4R A;  4IES A;  4E2G A;  1W39 A;  3TAY A;  4PJY A;  2ZAA A;  3ZXG A;  2QDN A;  3DN7 A;  2VZS A;  1WLC A;  2VVE A;  3OF1 A;  2PHX A;  4LA2 A;  3U78 A;  4RGG A;  4PIY A;  5A7N A;  5K8S A;  4ES8 A;  5CFD C;  1RC6 A;  3VBU B;  2P37 A;  2PHL A;  5L7O C;  4J1X A;  1OFN A;  1RJ7 A;  4XFF A;  3T2O A;  2VZ1 A;  4WVZ A;  5L19 A;  4FO9 A;  1K42 A;  3N9O A;  2HYX A;  1ND3 C;  2JDY A;  2EXI A;  2IXK A;  3ZMO A;  4CXW A;  1BK0 A;  4DIQ A;  1NOV A;  1Y9G A;  2E26 A;  5A7W B;  5ABJ A;  2VW2 A;  4RR3 B;  3HMY A;  3WP5 A;  3CKH A;  3BTY A;  5F5A A;  2DVA A;  3PME A;  2B45 X;  4N7U A;  1X82 A;  4TLF A;  1EV1 3;  1XE0 A;  2IVI B;  3JXS A;  4JQT A;  4Y5Z 0;  1JI6 A;  1NCQ A;  1QIQ A;  2IXC A;  2GP3 A;  2WFF 3;  3QH7 A;  3JU9 A;  1PZ7 A;  2KA3 A;  1H30 A;  3FHI B;  3ZDV A;  2WC2 A;  2C24 A;  4XIO A;  4XFH A;  5GJ6 A;  5BYN A;  4N8M A;  3BOP A;  4D7Y A;  4DUW A;  3S0M A;  4F8A A;  3GJB A;  1LEC A;  4Y1V A;  1LR5 A;  2PHD A;  4OUL A;  3D0J A;  5EZW A;  1QJX 1;  4KL1 A;  2Q8E A;  5C4W C;  1M06 G;  1V6K A;  2ARC A;  4PIZ A;  1LKN A;  1LOE A;  2J7M A;  4AAP A;  4AFD A;  2WO1 A;  5FY7 A;  2HYK A;  5DPN A;  3SEE A;  3VLB B;  4MGY E;  5D8A A;  3ABZ A;  5FZ3 A;  4AQ6 A;  4CEW C;  1MS8 A;  3D8C A;  1YXW A;  2NN8 A;  1XND A;  2FD8 A;  4K20 A;  1G8W A;  2EXJ A;  4CP9 B;  3AYD A;  2OPW A;  4K3U A;  1N47 A;  4YM0 A;  2OVU A;  2WFF 1;  4IV3 C;  1AR8 3;  4JGY B;  2Q5T A;  4A45 A;  3KQR A;  1LCL A;  2RR1 2;  3EBR A;  2CDO A;  1CD3 G;  3KD4 A;  5A6X A;  3HBK A;  2XR4 A;  3KCY A;  1WUV A;  4YW4 A;  3E6C C;  2QZ2 A;  2RS1 1;  1XE8 A;  3VKL A;  4O9G A;  4IDZ A;  4AQT A;  2FHR A;  3L2H A;  2GMM A;  3WCS A;  3ROU A;  5FYV A;  3ZOI A;  1AR9 3;  3VBS C;  2MNG A;  2W94 A;  4X6Q B;  1RUC 3;  5JMO A;  1ASJ 2;  5FYH A;  2HH9 A;  2CNA A;  3GHN A;  1AR8 2;  3RNS A;  2XGX A;  3HNB M;  3ZSL A;  2RR1 3;  4TTG A;  3O1O A;  4QPG A;  4S2D A;  1J58 A;  4R4X A;  3RYK A;  2YZ4 A;  2MEV 1;  1VB4 A;  4AGR A;  1CIW A;  1XNT A;  4CDX B;  1FPN 3;  1NLR A;  3C7E A;  1UOG A;  1UKR A;  1BZW A;  3PJY A;  2VXR A;  1A78 A;  4B3N A;  1W0O A;  4GJZ A;  1RUI 3;  4XUQ A;  3BUC A;  4FPK A;  1AJO A;  1DDL A;  3L9J T;  4AXO A;  4IET A;  1ENR A;  1F15 A;  4YGE A;  1AR9 1;  2VTX A;  1EAH 3;  3K2O A;  3NVC A;  1XOY A;  1KD7 A;  3ATG A;  4P9X A;  2XUM A;  1GWL A;  3SH5 A;  1VBA 3;  2LAL A;  1PO2 1;  1ND2 C;  1LEN A;  1FPN 2;  1MS9 A;  5KXD A;  2VW1 A;  3KLS A;  1JMU B;  5BNN C;  1PM4 A;  2P6C A;  1S2B A;  2Q1F A;  5KXC A;  1LHN A;  1QF3 A;  4URT A;  1RUI 2;  5GM0 A;  2OYZ A;  3WP3 A;  1SLI A;  2VNR A;  3NJX A;  4QGM A;  2VNO A;  3VHR A;  1RUD 3;  4OHW A;  1QOT A;  1V9U 3;  4ITC A;  1WZX A;  1H6Y A;  1AVB A;  1H6X A;  1EAH 2;  2VMG A;  3I2D A;  1CX4 A;  5T52 A;  2ZGU A;  2WIN B;  1SBE A;  5HBA A;  4LMF A;  3VD9 A;  1KGY A;  2JEC A;  4XUN A;  3VBH B;  3B3Q E;  1RUF 1;  3PUH A;  3WF0 A;  3RRD A;  1D4M 3;  5G04 L;  2Y33 A;  1OLQ A;  3P3N A;  1QJU 2;  4GUL A;  3LOB A;  2BV4 A;  3BTZ A;  4GMP 0;  1UOJ A;  3PUS A;  5CAZ A;  4MET A;  1BQP A;  5JIA A;  1HN1 A;  2RDN A;  3WCR A;  4EZ4 A;  3FUQ A;  3KCC A;  4AED A;  1JU4 A;  4TXW A;  2W3J A;  4XFG A;  4YNI A;  2PN5 A;  4TWT A;  5F5I A;  2ZHK A;  3AFG A;  3J9S A;  3C3V A;  1HX6 A;  3NAP C;  5ACA 2;  4JTO A;  4Q4W 1;  1FNZ A;  1NYW A;  1OC1 A;  3O5S A;  4JKL A;  3S6P A;  2YYO A;  3OBT A;  2Y34 A;  3KT1 A;  2W47 A;  4AR2 A;  1QJU 3;  1WLW A;  4IEY A;  4MG2 A;  2F6B A;  3H7J A;  1UPS A;  1Y9M A;  4QXB A;  4Q4X 2;  4BMB A;  4MXW B;  1AF9 A;  4Q4Y 2;  5J36 A;  5K0U B;  4BIO A;  3HN3 A;  2WA3 A;  5FY8 A;  2R04 2;  2X5I C;  4L97 A;  1R08 3;  3AC0 A;  2Q4S A;  3DXT A;  1UQX A;  1OOP A;  2VMH A;  1K3I A;  3CU7 A;  4DXZ A;  5JDB A;  4ZU7 A;  3OUJ A;  4QDQ A;  2HWF 1;  2QQO A;  4HSL A;  2TEP A;  2PAK A;  2VOK A;  4XJU A;  5DAB A;  2AEN A;  2ZX1 A;  4CSW A;  2Y6G A;  4M4P A;  1FMD 3;  1ZBE 2;  3CDZ B;  1QY4 A;  2ZS6 B;  3ZXE A;  3T4H B;  5FO7 B;  1W3V A;  3OUI A;  5I8Y A;  1JZ3 A;  1S0J A;  3KS7 A;  5JR2 A;  2XJU A;  2A6Y A;  1VBC 2;  4LK6 A;  4Q0P A;  3WIN E;  1QKQ A;  3PU3 A;  2OA2 A;  4DRR A;  2ARX A;  5JUV A;  2W39 A;  2Z69 A;  1W6Q B;  2C9K A;  5K0U C;  1WCU A;  5E8A A;  3THD A;  1H9W A;  1LOA A;  4CUB A;  4H55 A;  4BJ0 A;  2R0F A;  2D3R A;  4A2U A;  2W0X A;  1IPS A;  1XYO A;  1O7F A;  5AVA A;  5B4N A;  1WWY A;  3GF6 A;  1KXG A;  1ACC A;  2NMN A;  1NXM A;  3BTX A;  3SKV A;  2W08 A;  3ZXA C;  4JAA A;  1O59 A;  1KIT A;  1VP6 A;  3RMY A;  3FX3 A;  5JWP A;  3MW3 A;  3H3L A;  3HOB A;  3LDB A;  1GOG A;  5A3N A;  2RDS A;  3ZR5 A;  2WFF 2;  3AK0 A;  3KF3 A;  2IUW A;  3WDW A;  3USU B;  2ZGL A;  1N1T A;  4CP0 A;  1U12 A;  1QNW A;  2RR1 1;  5EJ1 B;  2H0V A;  5F3I A;  3D4K A;  2W87 A;  1A34 A;  4JGZ B;  1N3O A;  2FMD A;  4XEZ A;  4DQA A;  1R1A 1;  4IQP A;  4PHZ A;  5HCA A;  1LGB A;  1GNH A;  2D40 A;  2EVX A;  3KV5 A;  3K3O A;  5F6L B;  4F3J A;  1S0I A;  2ORX A;  1CR7 A;  4IEZ A;  3PUQ A;  5FXW A;  1BMV 1;  4C1X A;  4AVA A;  1BEV 1;  1Y9Q A;  2WYS A;  4FVV A;  5FYZ A;  1HRV 1;  1PX3 A;  1OF3 A;  3CZJ A;  3R4U A;  4ZU5 A;  5A7Q A;  4UW5 A;  1VBB 1;  1WD4 A;  3WVJ A;  3NO8 A;  1OXC A;  4OI1 A;  4M0H A;  5TSW A;  1H1I A;  2MEV 2;  1S0C A;  4BLJ A;  5DAV A;  2QQI A;  2XJQ A;  3ORJ A;  2D6L X;  2XBO 3;  3E97 A;  4YFZ A;  3E5Q A;  4FXG B;  4BE3 A;  1X7N A;  3VBU C;  3UL2 A;  2AEY A;  4GB3 2;  1JOB A;  4E4Z A;  1GMM A;  3ZYP A;  3R4S A;  5FQ0 A;  5JI7 A;  1AR9 2;  5C3S A;  1K45 A;  5FZC A;  4YG3 A;  2VUD A; 
#chains in the Genus database with same CATH homology
 4CXW A;  3BTX A;  4QKD A;  3KHC A;  4QKF A;  3BI3 A;  3O1S A;  4NRO A;  3T3Y A;  4O7X A;  3I2O A;  4NIG A;  3I49 A;  4RFR B;  3BKZ A;  4CXY A;  3T4H B;  3BIE A;  4MG2 A;  4ZS3 A;  3BU0 A;  2FDI A;  3RZJ A;  3BTY A;  3O1R A;  4MGT A;  2FDJ A;  2IUW A;  3O1V A;  2FD8 A;  4JHT A;  3BTZ A;  3RZH A;  3RZK A;  4NII A;  3I3Q A;  4IE5 A;  5F8P A;  3O1O A;  3O1T A;  4NPL A;  4NRP A;  4IE7 A;  3RZM A;  4NID A;  4IE6 A;  4IE4 A;  3O1M A;  4NIH A;  3LFM A;  4OCT A;  3I3M A;  3RZL A;  3KHB A;  4CXX A;  4IE0 A;  4QKN A;  3O1P A;  3H8R A;  2FDK A;  2FDF A;  3H8O A;  3O1U A;  3S5A A;  2FDG A;  4ZS2 A;  3S57 A;  4QHO A;  3RZG A;  4NJ4 A;  4NRQ A;  4NRM A;  4NPM A;  4QKB A;  3T4V A;  3BUC A;  2FDH A;  4IDZ A;  5DAB A;  3H8X A;  4ZHN A;  4O61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...