2FDJA

Crystal structure of alkb in complex with fe(ii) and succinate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
207
Chain Sequence
b'EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKENLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase
total genus 49
structure length 207
sequence length 207
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdjA00
5DABA 4NPMA 4ZHNA 3I3QA 3S57A 4IE5A 4IDZA 5F8PA 3O1PA 2FDKA 3RZKA 3BTXA 2FDFA 3KHCA 3I2OA 3BUCA 4OCTA 4O61A 3BI3A 4IE7A 3S5AA 4QKFA 3BIEA 4NIGA 3LFMA 4NIDA 3RZGA 4NPLA 3O1RA 4NIIA 4IE0A 3T4HB 2FDGA 4MGTA 3RZMA 3O1UA 4QKDA 3I49A 3O1MA 3BTYA 4NIHA 3O1SA 4IE4A 3RZHA 3H8OA 2IUWA 4ZS2A 4NRMA 4RFRB 3H8XA 3KHBA 3H8RA 3I3MA 2FDIA 4QKBA 4IE6A 4CXWA 4NRPA 4QKNA 4NROA 4CXYA 4CXXA 2FD8A 4JHTA 4NRQA 2FDJA 4MG2A 2FDHA 4QHOA 3O1OA 3RZJA 4ZS3A 3O1VA 3T4VA 4O7XA 4NJ4A 3T3YA 3BKZA 3BU0A 3BTZA 3O1TA 3RZLA
chains in the Genus database with same CATH superfamily
5FYSA 5FYZA 1PIV2 1U5ZA 4LQRA 3JBG2 4I30A 5HV0A 5EP9A 2R32A 1PVXA 1XNKA 1RVF3 3FJSA 5T5LA 3D8CA 2DWRA 1AR83 3GNEA 4CDQC 2C1FA 4OZOA 1HN0A 4CUGA 3B7MA 2E33A 4GZ9A 1BHGA 2BTVC 2AR6A 2PAKA 4PHZA 1OKQA 2YBKA 5LA0A 2WSVA 3QACA 2KR2A 2BU9A 2UURA 5A70A 1EV13 4PBOA 3BUCA 3KMHA 4EWEA 2HWE3 1RUI3 1GFF2 1GOFA 2VMEA 3KV5A 3LB9A 5A1AA 3NAPA 4UFJA 3H50A 4LBLA 4GH4C 1QJY1 1TEIA 4YYOA 3TWIA 5C8CC 3N7LA 1SBFA 4AK3A 1O4ZA 1AL0G 1GP5A 5CISA 2VY0A 4YVSB 1W6NB 4FPFA 5GLZA 3AKPA 4LMFA 1PGW1 3V0AB 5ERLA 3LIHA 2UWBA 4NO4A 4A3ZA 5ACA1 5BNOB 5GLTA 4MGQA 1AR92 3LFIA 3E1F1 3THPA 2WZR3 1BZWA 3WW3A 2GDFA 3GALA 4RGKA 4PDWC 5K0UA 3O1MA 2VCMA 5FP7A 5JOYA 4K1ZA 2D3PA 4NHMA 4S2GA 1H30A 5HI0A 1S0GA 1IKPA 3A0KA 5F32A 4TTGA 2W08A 3M8LA 3WT3A 4QM9A 1J59A 3BN6A 4IEQA 1AR62 4H2AA 3I59B 4UT5A 1W2AX 1V6NA 2E7AA 4XILA 3LOIA 1POV1 5EV7A 4Y26A 3IBMA 1RUE3 3N9QA 4AW7A 1GWKA 3AMQA 1XNBA 1IPKA 1HXS1 4GMP0 4RHV2 1U5IA 4CCEA 5JPNB 3LOBA 2Q1MA 5DUUA 4CXWA 3P3PA 4D7TA 2YU1A 2WFPA 4NROA 4AEDB 2QQLA 1RUC3 2OS2A 1SLCA 1DZRA 4GAZA 1CAUB 4AE2A 1QOOA 2PYTA 1REFA 3AM2A 2R072 2Z4FA 3HVDA 1NY71 1MEC1 1CQ9A 1WZXA 4XQWA 2ZZQA 1CIWA 1W9YA 3HAGA 2FCUA 5GZDA 3POEA 5CG9A 1UY0A 3WG3A 3WEZA 1ULOA 5JMOA 1LCLA 4UF0A 1QJX2 3BODA 1MR5A 4FFIA 4XIOA 1EPWA 1DQ1A 5DG1A 1Y3TA 2FDHA 1DGWX 4AR2A 1SBDA 1UPIA 2Q1FA 3E6DA 4COWA 1CJDA 2VUDA 3HD8B 2EAAA 2RHPA 5EJ3A 3EO6A 1BEV1 4ES8A 2JEMA 3FUOA 5L7OB 4EN7B 5DDJ2 2WNEA 5CFCC 3JD71 1Z7S1 3MGUA 2DVAA 3QD6A 4KU7A 5ANQA 3U10A 2CDOA 3POIA 3PUIA 3VHPA 3WDTA 1V6KA 1QQP2 2FCVA 5DZFA 3SHRA 3U07A 3BU0A 5CKQA 1LOAA 2R7EB 2XKOA 4Y22B 4E4HA 3EHKA 1W6NA 2CYFA 2XONA 4AG4A 1W99A 2YC0A 2BDRA 1W9TA 3LZZA 2HWB2 1N3PA 5DABA 3VV1A 4NHXA 2KD7A 3ZR6A 1NZCA 2BEOA 5FZIA 3SCHA 1W6QA 4J1XA 3PVBB 4FPYA 5J98B 2ZS6B 4E2QA 4YVWB 3VHNA 1PO11 1W04A 2VM9A 2Y60A 3W59A 1N47A 1RMU1 3CLPA 4NHKA 2VZOA 2BUKA 1DCSA 3L2YA 3WD5A 3ZYIB 1H2KA 5FMBA 4NWVA 4RR3B 4JTNA 4N7IA 1DQ6A 2BWAA 4CDUB 5LATA 5FO9B 1OA2A 4GQ7A 5FP4A 4KWKA 4CU9A 1XYNA 3VHRA 4WM7B 5F3GA 4GD4A 1CJPA 1OOPA 1ZX5A 1MPXA 2E26A 2HEYF 2XBO2 3CQOA 4GWNA 4PIXA 4Y1VA 3AYAA 4HT1T 3ZSMA 2IFRA 3RWKX 1RB8G 2DCJA 3POBA 4LK7A 4Y33A 4EN9B 4Q4W1 1RHI3 4PF5A 3WDVA 1CAUA 4EWDA 1LECA 5AC92 2K2SA 2RS33 3ZFGB 2D6MA 1AR72 1I1EA 4FPCA 1LODA 3E97A 4Y24A 4MGTA 2CSGA 2R16A 3CEWA 4XF1A 4XHXA 5EJ1B 3VDBA 5IT6A 5LEJA 1N1YA 1QWRA 1SZBA 5BV6A 3OUJA 4OYUA 4Y20B 3N4MA 1GOGA 1NE6A 4DEQA 4QX3A 1FATA 2AENA 4CCKA 1WCUA 2VMGA 4FO9A 4GKYA 4M4RA 3DPRC 2RJ2A 3OD0A 4Q1RA 3ACGA 4BQYA 3AYEA 2MHFA 3HPNA 3NV1A 4BOWA 3EXUA 1W3XA 4QXKA 4TLGA 3VLBB 1POQA 1LEMA 1OHFA 1RUH2 4YGBA 1YFWA 3L2HA 1RUD2 1H0BA 5IUQA 1ODNA 3LDRA 1YQ8A 4NR1A 5C3RA 4ZY9A 1NCQB 4PI2A 4E4SA 4S2FA 5IVYA 3DF0A 2VZPA 4QX0A 2CAUA 4A7YA 1VBC1 2LM3A 4XJ8A 1OOPC 2PHLA 3Q8FA 3IZOA 3WNMA 2D97A 3R4UA 4XVHA 2VJXA 2VCAA 5G05L 3UKTA 1AX1A 4GALA 4AHWA 2PXJA 4QX1A 1LOFA 3MI8A 4AYUA 3SEEA 4YVWA 1UY2A 3RS6A 5FOBB 5JSRA 1LB2A 2RM21 2PFWA 2W9XA 4F8AA 4UFMA 1UPSA 5F6KA 2DYCA 5A3WA 4V1PA 1DDLA 1PGSA 2IVIB 3OG2A 3PHMA 1RJ8A 4RR3A 2ZCWA 2VTXJ 2QQVA 1PIV1 3MLJA 2D6PA 1YFYA 3PDQA 3UGHA 3RZGA 5CYYA 2A75A 1H4HA 1O3RA 2Y8KA 4KMQA 1ZBA3 4R9BA 2E7QA 3D4KA 4WM7A 3RFRA 1GNHA 1OI6A 3WF3A 3H1WA 4I2OA 4Q0QA 1UYXA 3N35A 3KQ4B 4ZZ8A 1MQTC 1QJU2 3H1MA 3CHXA 4LJHA 5FYCA 2NYYA 5KHGA 1T2XA 4XYXA 4PI0A 3I2GA 3CO2A 2OIIA 5DZGA 1Q43A 3ZYBA 5C6CA 2QZ2A 4NPMA 3B5LB 2ZXQA 3I3QA 2B5HA 1O5UA 2R062 3ACFA 5KR7A 4XUPA 2GNTA 3FBMA 3VBUB 3B9CA 1A78A 3AX4A 2OQ6A 4AEMA 1ZRFA 1REDA 1WLDA 1KRIA 3WQ1A 5I0UA 3ZSEA 1LOFC 2D6LX 1S0BA 4HVOA 5FZMA 2FDFA 5HPOA 5A7QA 1CAXB 3QOPA 3ITQA 3OF1A 1R081 5CKMA 2W0XA 4BQWA 1JXNA 2XL7A 4KG8A 4NWWA 1AR91 4BZ4A 2Y0OA 1S2BA 5IYYA 1Y4WA 2ZX0A 2HWC2 2ZABA 1LU1A 4XF3A 1IPJA 4D8MA 3JUUA 4OHVA 3VL9A 3UJOA 4LTAA 1Q8VA 3MW4A 1FMD1 3O1RA 1GOHA 4GKXA 3CZUA 1LHOA 1ZRDA 5FUIA 2OUJA 5GZEA 3AJYA 3H3ZA 3T4HB 1SEFA 1W8ZA 1VBD1 5G04L 1UOGA 2WQZC 1UZZA 2WUHA 5A1LA 4GMP1 1S0IA 1GICA 2R1BA 3NNLA 3UJQA 3WV6A 1AX2A 3U75A 3HQXA 3J7NA 1HJGA 3ZR5A 4ARYA 5A3UA 1ASJ1 1XE0A 4DXTA 4H55A 5A3LA 2C9KA 4J25A 1ULDA 3MEPA 1BBT3 2ETEA 2P34A 1XU2A 2YMZA 3GBFA 4IEUA 4P5HA 2JJ6A 4XFHA 5F9TA 4JGYA 2QQPA 1G7YA 3KCYA 1VPHA 2AC1A 2DCTA 1RUG3 1S1AA 2EXIA 3ALQA 3UNPA 1VBE1 4META 3GM8A 5FXWA 4AWDA 1ENXA 3GZTB 2FDIA 3OPWA 1Q8QA 2H6BA 5C8WA 2ZTNA 4FSJA 1SCSA 1SPPA 2JXAA 2WQ4A 4W65A 1Q8PA 2ZX2A 5C9AA 3P6BA 5FQ0A 4AAPA 4YZ3A 4SBVA 3N7JA 3VD7A 1AJOA 5IVVA 5EZWA 4OI1A 1Q3EA 2DU1A 4QXBA 4LO7A 4ISRA 4XUTA 4E27A 4Y1UA 1JZ6A 4OHXA 4ZPIA 2VQTA 2PAEA 2XGXA 2W87A 2VXJA 3PU3A 4EWAA 2NP0A 3KV4A 2AREA 4NIAA 1QDCA 1SDDB 5DAWA 2RMU2 2BRTA 4QQHA 3NV3A 4OMCA 1KEXA 5LA2A 3IPVA 1PVC2 3B93A 1H6XA 3T0DA 4AI3A 3VD4A 3IB3A 3U4SA 3ZFEB 4AFBA 2GN7A 5JOWA 1VRH3 4XJAA 3KGZA 5FJHA 4Q4V1 1RIRA 4MX3A 4GXLA 1AJKA 4JGYC 5DUXA 2X10A 4YWAA 3H8RA 1CZTA 1JOJA 1VAMA 3I2HA 1NLRA 3U1XA 4Q2FA 3IDEA 1OQEA 5BNNB 2Z2SB 2VBDA 5EFUA 4K9SA 5FUPA 3IIAA 4BQXA 3HNBM 2WO7A 2BV4A 4K1YA 4YG6A 3A4UA 3WHUA 1P8JA 2EXKA 4GWMA 3ZFFB 3O0XA 4FFFA 2WNUC 5C9AC 3ST7A 4DRRA 5J09A 2G4IA 2D6OX 4ZU5A 4COZA 2K9ZA 2V73A 3PUAA 4PQ9A 5C70A 2X09A 2ZEYA 3JBG3 3K46A 3AXEA 4MHRA 2ET7A 2Q8OA 1NA1A 1Y7BA 3WQBA 2XR4A 2ZMLA 1IOAA 4CCDA 5AC91 1JYXA 1NKGA 5K7PA 1SBEA 4MUVA 5CB7A 1X9TA 4E8CA 2YBPA 5A3OA 3LEGA 2VC9A 5FMDA 2B4KA 5LK7B 2ZA9A 4CZSA 1OA4A 1L7LA 4B1MA 4NIGA 2VUAA 4YFWA 1S0FA 1COV2 2ZGTA 1I6XA 2GU9A 2P5BA 3FHIB 4JCKA 4YG0A 4YRDA 5L73A 2C26A 2FBEA 2IVJA 2VZ3A 3E5XA 4UFLA 4AGGA 4JRLA 4B4RA 3U4XA 4BH9A 1RUH1 3NKGA 2P1BA 5A3PA 3FFQA 3APBA 1H9PA 1XNAA 2JDNA 4OMDA 2SBAA 3FWEA 5H9RA 3ZXAC 3EQEA 3AP7A 5FYIA 3ZX7A 1EAH1 3POWA 5FPAA 5HCHA 3FE5A 4Z92B 3N9MA 1LOEA 2VNOA 3NRUA 2XLGA 3ILNA 3VBSB 1IS3A 1C4RA 1YO8A 2HWD1 4AVVA 1X33A 3ZVXA 2RS32 1YIFA 2R6QA 3RVHA 5C33A 2ZGPA 2IUWA 1GUIA 3HEIA 3O7OA 3ZFEA 4YM0A 3HN3A 5JXIA 1WW4A 3PU8A 4LBQA 4UW4A 3AMPA 1W2TA 5E1RA 5A7NA 4A45A 3I3BA 3AYCA 1AR63 4CDWA 4NMIA 1KXGA 1WMDA 4QQOA 2PHDA 4JQTA 1UQXA 3OBTA 4JKLA 5FYTA 3ZYRA 1CX1A 1OQ1A 3OGGA 1LHVA 3VZOA 5JXHA 2XDVA 2JB8A 5FZLA 3TEWA 2TNFA 3AC0A 2XWBB 3I8TA 4RHV3 1C8M2 4LT5A 5FZAA 4HKWA 2ARBA 3BALA 4CP9B 4CP0A 1UZWA 5ABJC 2BOJA 3LA2A 3N7MA 2JD9A 3HT2A 3K2OA 3RMYA 4W6XA 2Q8EA 1QOSA 1V6JA 2R073 3SH4A 2UY9A 3NSTA 2YXSA 4AGVA 2VO5A 3GF6A 4CDXB 1LU2A 3MFAA 4LA3A 1KFUL 4YZ2A 1PM7A 5T5OA 2VBBA 1JZ3A 2D6KA 4AZZA 1LR5A 3ZKUA 1QJX3 1BXHA 4ATEA 3A23A 3MFCA 4LORA 1LGBA 3NJZA 2LUWA 4M3CF 4ZZ5A 5JXGA 3OPTA 1QKQA 2ORXA 4COYA 1NQDA 3AKRA 2XLFA 1DYOA 4LBKA 3RNSA 5DDJ3 3BTZA 1K5JA 3OY8A 1OC1A 2O8QA 3AKSA 4WVMB 4Q8KA 5CFDB 1QF3A 3R0RA 4FXGB 4KG0A 4MH0E 5E16A 4V2VA 4CDWC 1CVNA 3VD3A 4AHZA 1QQP3 1JZ2A 1DZTA 2GC2A 4K6BA 4LKDA 3NQHA 5FZDA 2JICA 4XFGA 1RVF1 3CMGA 4AQTA 1O8PA 4RA0A 5IAXA 5FWEA 4DO0A 3MIHA 1AR81 2HWB3 2VECA 3I2FA 3O5SA 2FDKA 5IK5A 3PVOA 3VBSA 1J83A 3LA7A 3RWNA 1OH4A 3VDDA 3AB0A 4ZXEA 4DQAA 3RZKA 4FTSA 5D8AA 3K48A 2X5IA 3KHCA 1LOBA 3VBHB 2CY6A 1PGL1 3IT8A 4YPJA 3PUQA 4AVBA 1EV11 5JI7A 1C1LA 2F6BA 1WW7A 3LDKA 3MYXA 2BYVE 3POFA 2HWE1 1RUI1 2WWJA 4IESA 4O61A 1RUOA 1AYM2 2P3YA 1KS5A 3VBFB 5J48A 3J8F3 4Y4RA 4HSJA 4NOTA 2IWGB 2JIGA 5FMOL 3JB8A 4TXWA 3KT4A 5AVPA 1FNYA 4CVUA 2QQNA 5IATA 1AXZA 4MZUA 2HJIA 3ZPOA 5A7WB 3WW2A 4CE8A 1QJZA 2XBO3 2ET1A 1TZOA 1NLSA 2AUYA 2A71A 2XKPA 1UMIA 2WAAA 5JWPA 1SG3A 3VDCA 1WCSA 4XHBA 1XJAA 2C0ZA 5LA9A 1V6OA 1KFXL 1SFYA 3UGFA 2WL1A 1AR73 2WZR1 5F5IA 1ZZCA 2Q5TA 5I0RA 1FPN2 2Q0AA 1F15A 4EZHA 1ZRCA 1YRZA 1GZWA 4M0NA 3H3UA 1J1TA 1DQ4A 1ULGA 1O7FA 1CGPA 1IG0A 4CU8A 3ZDSA 4CPBD 2E32A 4N43A 1D4M2 3UESA 5FPXA 3VDDC 3HNYM 4XQ4A 1W6PB 2ZGQA 2GNDA 1GU3A 4FOQA 2Q4SA 5D8AC 1E5IA 4XDOA 1RUE1 2X5IC 3KHBA 2VZTA 1MS3A 3GCWA 4FAHA 5J3UA 5FXXA 1JUIA 3WNPA 3PTRB 4QKNA 2Y6HA 2WA3A 5FCCA 1HV1A 5CFDA 1RUD3 2PHXA 1RUC1 1X36A 1X8MA 2WNOA 2VOVA 4YGEA 2JG9A 4JDMA 2JDHA 3ES1A 1ZVFA 3H7YA 2WO3A 3HBZA 5GJ6A 5HCAA 2DCZA 1UF2C 1ACCA 3I54A 4CEYB 1PNGA 2RDRA 2W5FA 1GKBA 4YGDA 3THCA 1XE8A 4JGZC 5FPUA 5GZFA 3RPQA 3H7JA 4LBNA 4QB6A 4Y1ZA 3O1OA 2KA3A 3I3EA 2DUOA 4XBNA 2A3WA 2ZGOA 5FKCA 4Z2AA 2VOKA 1KD7A 3RZJA 3VBHA 5FZBA 4GWJA 4D0QA 2YG0A 3TBDA 3DKQA 3J26N 1OSGA 2PELA 1E5SA 4IGQA 2GSYA 2VZUA 1RITA 4CRQA 4IERA 1IGOA 1SLAA 2BNMA 4N43C 1TG7A 2E51A 3JB4C 1SFPA 5DXDA 4FFGA 3BKZA 4P14A 4RYDA 4OI2A 2IZWA 3MO4A 1ENSA 4E9KA 1K45A 1VALA 2ES3A 4LBJA 4WBBA 1ZRIA 4XBQA 4TWTA 3PUSA 1OF4A 4DXRA 2VVFA 1S2KA 4MXWB 2OKXA 3CZJA 3FUQA 4NHYA 3M2MA 4E2GA 1QJU3 1ZM1A 1ND3A 4TYSA 5CADA 1HB1A 3BYWA 2BVVA 2JG9C 4RQPB 3WSOA 5FO8B 4YG3A 5LRSA 2P2KA 4KGGA 3FMGA 1UXXX 3WNXA 5IK4A 1CZVA 4A4AA 1CN1A 2R063 3KT7A 4RSUA 2B45X 2XUEA 4JAAA 5IFTA 1E5RA 3AJZA 4R9CA 3KCCA 1CWPA 1IZ3A 3BOPA 2JWPA 2ZOEB 4WZFA 1CPNA 2XUMA 2MNGA 3H42B 3M3CA 4KQ7A 5A7PA 3U78A 3WDUA 2EXJA 3ES4A 1F5FA 5SV8A 1VB4A 2VNRA 4P9YA 4C1XA 1N1SA 2VPVA 1WCQA 3FLPA 1OMIA 2J22A 4QXHA 2RS52 1KS4A 5FZEA 4CSWA 1MVEA 2J7MA 5F5CA 3NKTA 1NZIA 4HK8A 5EJZB 1RHI1 3BCWA 2Y26A 5FZGA 4NIIA 4DXSA 4FBFA 1IQAA 4FTBA 2RS31 2HWC3 2PQQA 1T6GC 1VBB2 2XHNA 3PVNA 3AZYA 2RS12 3UK9A 2C24A 2BGOA 3UKVA 1C28A 2VXRA 4NVPA 5EQUA 2K0GA 2R042 4MVTA 3I49A 3WF4A 2BZDA 2A5ZA 1HX6A 1ND3C 1E57A 1QOTA 2YGMA 4L11A 4Z1VA 4LHKA 1AYN1 1TMF2 4QHZA 1KJRA 1HJFA 1BVP1 3NJXA 2JG8A 3V65A 3WLUA 2Y6LA 3HR9A 4XTMA 2ZHKA 3KGLA 2B8MA 3USUB 4Q4Y2 3WZ1A 4COUA 1JYWA 4OVEA 4IEVA 1YC61 4FPKA 2RVAA 1UN1A 4K8RB 1SCRA 2D6NA 3SITA 4D6SA 5JR2A 5KWRA 1UX6A 3WG4A 4BDVB 3ON7A 4UXAA 4CXYA 1CAWB 2VAUA 1XSRA 4JKKA 3PJYA 3NNGA 5I91A 4HFSA 1DQ2A 2HBTA 1SFNA 3WQ7A 3M3EA 4HMZA 2VMDA 1H8VA 3HNMA 1V0AA 4LKFA 4MXWA 1DGRN 3RYPA 3PUHA 3T2TA 4IV1B 5LA1A 3KSCA 2ZX3A 5BUVA 2W52A 3KT1A 2DU0A 4O65A 3VBRA 4C0BA 3LKJA 4QPWA 4MGYE 5C4WA 1O3QA 2A70A 5FLIA 1AX0A 1L7RA 5DZEA 3AZVA 4I0AA 1W2NA 5FK7A 4EE2A 5L9VA 1HW5A 3VKOA 4MGSA 3GZEA 5LCWL 1DF0A 3I2KA 1WA6X 5FY7A 4UBHA 1Y9GA 1ZBE2 5CVRA 3ABZA 3VZJA 3V56A 4ZS3A 5A6XA 4LUKA 5FLJA 5FY4A 1Q8SA 1QGLA 2ZGNA 2BBAA 2G9FA 3ZSKA 3ZXJA 1ZBA1 3NAPC 2MEV2 2RMU3 2Y6JA 4R4ZA 2IXHA 1YLLA 4ARXA 4ZKTB 1PVC3 3TN92 3LSDA 5CZKA 4QGNA 3KLSA 3OUHA 3HMYA 3SKVA 1W39A 2P4EA 3D82A 1W6MB 2LW8A 3B00A 5FO7B 4BCUA 4IUGA 4K7JA 5CNAA 4B3NA 2Z79A 3C8XA 3WP6A 1STMA 4PBPA 1AF9A 1V6IA 3DGTA 5C3PA 4TZDA 1L7QA 1MS9A 5JSPA 4XDPA 5K0UC 3OGRA 4FPJA 4QX5A 5IK8A 1FOD2 3MPBA 2F4PA 3VBRC 3TEYA 5C4WC 1PK6B 2Y64A 2JDZA 2QE3A 1ZZBA 1XSQA 5DG2A 3USUA 3AP9A 4QU1A 1WLCA 4FOWA 1OF3A 1Q8OA 4HK9A 3ZM8A 4QU2A 2CU5A 1IQDC 1W6OB 1JYTA 3GCXA 2HKXA 2WN2A 4FI9A 4YVSA 4N90A 5BNQA 1APNA 4AOCA 2L9LA 4OI0A 1LOGA 2WZ8A 1B35B 5JZGB 5FYYA 2UYAA 2W2IA 1KDMA 4H14A 5BNOA 2ZEXA 2ZKLA 4XUOA 4YM1A 1TNRA 4BM8A 5FZ1A 5GZCA 1OFSA 3QCWA 4XFCA 4N9HA 1D0HA 1COV3 2Y38A 4Y1XA 1DG6A 3UYJA 4DOUA 1UKGA 2OZ6A 1GNYA 1EPZA 4AI8A 3VBOB 3J8F2 4G9SB 4CCCA 3O0WA 4AAXA 3URFA 2B42B 4GB32 2WBKA 3MLKA 3I59A 2V5DA 4MSVA 4XC9A 4Y4YA 2YGLA 1C57A 5DPNA 4NIHA 2JB4A 2V72A 4CPBA 1VBA3 1BBT1 4EQVA 2X29A 2WWUA 2E53A 3QH6A 2R0HA 5FZHA 1LULA 3NNFA 1JS9A 3CL1A 4XABA 2VR4A 2WS92 3A7QA 4FT8A 4YW1A 4LE3A 3TB0A 4AEDA 1PZ8A 1RUG1 3OGSA 4RD7A 2GN3A 4CUAA 1CD3G 4Q0UA 1WWYA 1WBFA 2QZ3A 2A6YA 2SLIA 4LLFA 1NG0A 1YI7A 4Q0SA 3EB7A 3ME2A 4YVSC 4XETA 2V4AA 5IFPA 1UAIA 4MV2A 1XNCA 5JIUA 4JVAA 1J3RA 3MV01 4O9GA 1D2SA 1V70A 4BXSV 5BNOC 4PQQA 3MDPA 4P02B 1PO22 2IXJA 4XBLA 4BWOA 1UZYA 2Y6FA 3E6CC 3AVRA 2I07B 2PAMA 1XC6A 2ZKNA 4DUXA 1QXJA 3POYA 5ISLA 2KM2A 4QQLA 1NCRB 1C8M3 5L7OA 4GJYA 4Z2WA 2JE8A 2A73B 1VB2A 2JDUA 2FZ2A 1W0PA 2GMEA 4FP2A 3OEBA 1DYPA 4INDA 4LBQD 1MVQA 4BLIA 4FQ4A 1F2NA 4WVVA 5C3SA 1W6OA 4Y22A 1GQHA 5DMYA 1VRH1 4MGIE 4YFZA 4LE4A 4S2DA 5T55A 1SQ4A 1GZCA 3IWZA 4GIQA 1B35A 1DQ5A 2XH6A 4D7SA 2JX9A 1ENQA 1QH7A 5FZKA 2ZAHA 1BCXA 1EY2A 5E8AA 3OD4A 4XDQA 4IDZA 2EIBA 4GULA 2GNBA 4BLJA 2B9UA 1TQ5A 1HB3A 2WNVB 4QPGB 3SCGA 1QEXA 4CDUA 3FHAA 2VQ0A 2P3JA 3JBG1 1UO9A 4N8MA 4UW6A 1HN1A 2VW2A 2WN3A 3MZHA 4P9WA 2XJQA 1SHWB 3TEZA 5FZCA 4LBOA 1RUNA 3FZ3A 5FWJA 2A6ZA 3NV4A 3KB5A 2WT0A 4IETA 1W05A 2Y0IA 5FLHA 5J7MA 3BGAA 3ZFGA 3BU7A 3T2OA 1HRI2 1A3KA 3K3OA 4YW4A 3HN1A 3LD8A 3OYWB 3QLQA 1NQJA 3CJXA 4P9IA 2GALA 4HOOA 1AYM3 4Y20A 2XWJB 4PF1A 3VKNA 3CJIB 1FV3A 1M4WA 4TN7A 1WUVA 1PMJX 1PZ9A 2VZSA 2ZACA 2DUQA 2OUHA 2DURA 4DEVA 1OUXA 5DN2A 4KGQA 5B4NA 2R0FA 3VZNA 1UOJA 1M06G 2VMFA 4QKDA 4YVWC 2PMWB 3ZMOA 1NCRA 2WFF2 4ES9A 5KHKA 1BYHA 4EYUA 4OHWA 1OPMA 5L19A 2Y33A 1CIYA 1NLQA 4QWNA 1LNSA 5FZFA 4XPVA 2CDPA 2YFZA 4RR3C 3H8OA 1BMV2 4CDUC 2VTXA 1FPN3 1NCQA 1WKYA 3MUZ1 4ASLA 2BPA2 2ID4A 2D3SA 2AEYA 4RFRB 1HB2A 4WM7C 3NL1A 3NV2A 4KWLA 4QKBA 1VMFA 1D4M3 3E5QA 1AR61 3CNAA 1T6BX 4N53B 4YW2A 3ZYPA 4LLOA 3ZFGC 1S0EA 5CEHA 5E6HA 1RJ7A 3ZMNA 1QMJA 1ZYBA 3NW4A 5JCTA 2VW0A 3N9PA 5H9SA 3G7DA 5JOZA 4RHV1 2FD8A 2VUCA 4I01A 2WT1A 3FN9A 1EYBA 3S30A 1WMFA 4P08A 4W6WA 1S2EA 4EZ4A 3AXDA 4GA9A 5I0TA 2WNVA 3VZLA 4XFIA 3WP5A 2NPIA 2W1QA 2R071 2WLPA 3GJAA 4YGCA 2Q8CA 4EN6B 3DXTA 3HOBA 4X8NA 3ELNA 2KXLA 2ENRA 5A3TA 3ACLA 4W8JA 2HEWF 5I0DA 4CEWB 2OQ7A 1W03A 1RGSA 3L9JT 3INAA 1OLRA 1QJX1 3O1VA 1NXMA 1UW8A 4HBNA 3IDCB 4NHLA 1ULFA 4C91A 4QAWA 1R092 1UNBA 5CIRA 5A80A 2V4VA 1JU4A 1NCQC 2ATFA 5LASA 2N7GA 3LAGA 1VAVA 1OURA 1Y9QA 4ISQA 3B69A 3OYWA 4LULA 1YEWA 4XTPA 5DDJ1 4BK4A 1RXFA 1G6NA 1I3HA 4UYBA 2WYSA 3VBUA 4Q0PA 4Z07A 5KHHA 4DXZA 3O14A 2ORZA 5F2WA 1GANA 3LGRA 1QQP1 3N3HA 3S57A 3NNJA 2FMYA 2VE1A 3O0VA 4NUBA 3T0BA 3PNAA 2BOIA 1BK0A 2VZQA 3C7HA 3ZN6B 2BNOA 2RR12 4XCAA 1CAXA 2RJKA 2ZGUA 3DKWA 3O1PA 5FBZA 1U0AA 2BNNA 2HWB1 4QGMA 2CHHA 4EV0A 2YU2A 3WXPA 1F4HA 5FJKA 5B4XA 3ZIWA 4LOSA 4BXFA 3I2OA 4GWIA 4BQ1A 5LB6A 1K5MB 2HWF2 2UWAA 1MS0A 3JU9A 4BA6A 4YARA 2GC1A 4A7ZA 1UY1A 1W3VA 3LWCA 4L2NA 5LBFA 1JHNA 3I4IA 3DUIA 5FY8A 2VULA 3VKLA 4B29A 1NUKA 1W8TA 3AMMA 3J8F1 2ARCA 3KF5A 3Q8EA 4MLOA 4A6OA 4AQ2A 5T54A 1BLZA 5DAXA 4EJRA 4BB3A 3ZYGA 1UX7A 3HIFA 3CIHA 1W8FA 2W3JA 4IEWA 1JHJA 5BY5A 1I9RA 2P17A 1I5ZA 1QJFA 3VKFC 2XBO1 3UGGA 1WW6A 3ILRA 2RS53 3LIGA 3ZXEA 2YPDA 3MV11 2BVBA 1AXKA 1FAYA 3VBUC 1H2LA 4BMBA 5BNPB 2BGPA 1UKRA 4I0WB 5F39A 2ARAA 1BKZA 1AR71 4DFSA 4MGZE 2DUPA 1VBB3 2W39A 4L9BA 4LEJA 2RS13 5KBFA 1OD5A 1FX5A 5CKNA 4QPIB 2Q8DA 3RZHA 2R043 4R4XA 5DUVA 2WZPP 3BVCA 2A3YA 3T30A 4XJ9A 3VKMA 4K40A 1QJEA 3V0BB 2HYKA 5IJRA 1TMF3 2VZRA 5JVVA 4LIVA 1BJQA 3JQWA 4XFAA 4P9JA 2XL9A 2GC0A 2D43A 1SLIA 1VP6A 1D7PM 3MF6A 4Q4Y3 2XVGA 2P3IA 4UFIA 4BQ3A 4QDRA 2PLV2 4CXXA 1RUD1 5HCBA 5FUNA 1A6CA 2JDAA 5A6ZA 1VBA2 2XQXA 1H8TB 3RYRA 4IXLA 1JMUB 4OHZA 2C5DA 3AFGA 1IKQA 3BPZA 4PLOA 1UMZA 4PIZA 1R1A2 2OPWA 4Y3OA 1LAJA 4M01A 1O91A 3ZN6A 1DBNA 3CF6E 1JYVA 2HH9A 2RDSA 5EHDA 2VOXA 1WA4A 3IMNA 1ZZ7A 4MGKE 1DGWA 3AZZA 4NAOA 4XJZA 5GM0A 1XXNA 3MIGA 1NA1C 5LWBA 4QHOA 4R9AA 4IV3B 2X05A 3FX3A 3JQXA 4M0HA 3D0SA 2EVXA 3B02A 1RUJ2 3WP3A 1K5MA 1HRV2 4Q29A 1V6MA 5FZ8A 5A32B 2FMDA 5F3IA 3MICA 2W92A 4QX8A 2VBPA 4AFCA 3W20A 2XVKA 3ZLIA 3P1IA 5BNNA 2XJRA 2P6CA 1TNFA 1ZBE3 2VCCA 3SXWA 1BK1A 5IVCA 4I3PA 1JI6A 3SLIA 3ZFFA 4DNYA 1GWLA 2ERFA 2HEVF 1MS8A 2PQSA 2VZVA 4ET7A 2MEV3 1JZ7A 5GZGA 1ULCA 3PJQA 3OEAA 3RRDA 3S0MA 1UZVA 1F5JA 2W68A 1R64A 4LKEA 3TN93 2ZGLA 4GJZA 3UL2A 1HQNA 3KD4A 2EAKA 1QJU1 4XZPA 1ULPA 1VBD3 2QQIA 5DAVA 1UIJA 4MADA 3ZYFA 3ZPYA 2CNAA 3M70A 1C5IA 1UU5A 3EBRA 1RINA 1F8VA 3RMXA 1QJY2 4H3WA 2R061 4YZ5A 1ND2B 1SLLA 3AL5A 3MHZA 4AI0A 1YJKA 2GC3A 5IVJA 3RJ2X 1KDKA 3AP4A 3ZSLA 4B4QA 1MS5A 5LK5A 1W2OA 1FOD3 2G9GA 3ZFEC 3FLRA 3ZN5A 2ZMKA 4IE7A 2DDUA 1PGW2 5I93A 1O6UA 3BIEA 5FYVA 3RG0A 2W91A 4XAAA 1ST8A 5LBBA 2VZ1A 4L97A 4NE9A 2HBUA 4HPKB 2DF7A 5FK8A 5ACA2 5K8SA 4JV4A 4WM8B 3IKWA 4XJWA 5FZ3A 1A34A 5F37A 5BNNC 3CDZB 3ZXGA 3T1LA 1H8TA 2LROA 3RJRA 2WWSA 2D93A 2HWC1 4Q5OA 3WF2A 1O8SA 2WO1A 3GHMA 1A8MA 5CG8A 2CL2A 1C5HA 2VOWA 4ONUA 2E7TA 3USSA 2VVEA 2QBXA 3RI9A 2CWSA 3PL0A 4ASKA 2VQAA 4CP2A 1JBCA 2PHRA 3W21A 4XURA 3ASIA 3VHOA 1F9KA 1HXS2 1HV0A 2D44A 4ORFA 4YW5A 3CKHA 2X53S 3ACIA 3GGLA 1HLCA 3D5OA 4YLZA 4GB33 1PZ7A 3KS7A 4NRMA 4A3XA 1OPOA 1NY72 1MEC2 1AVBA 2ZJCA 4QPYA 1UXZA 3T0AA 4RS5B 3I3MA 3GDBA 4OZXA 4H7LA 4TSVA 3C7OA 3HQUA 2QQJA 4CP9A 5C7GA 2BWCA 2WS93 3SISA 1JYCA 2XJSA 1H2MA 5ANNA 5F3EA 5JDBA 1Q5OA 2H0BA 3NMBA 2ZHNA 3T09A 2EIDA 3K4AA 2I45A 2RDNA 4CDXA 2B46X 2C4XA 1JUHA 2QNKA 4JHTA 4CDQB 4UAPA 5KC5A 1JTZX 2EXHA 1XE7A 1Z7S2 1QDOA 3JD72 4XFBA 1U5YA 2QQWA 1UYZA 2NLRA 5JAXA 2DBIA 3VBSC 2YYOA 2OA2A 3SNMA 3R05A 5C71A 1PO23 2LRPA 2Z69A 1ND2A 4PCRA 2B7YA 3Q8CA 2UY8A 1J58A 1XNDA 2I74A 1EUUA 2IXKA 1OVSA 2W46A 2YC2A 3NVCA 4QQPA 5FYMA 3T4VA 4O7XA 4WVMA 1I5PA 2W1UA 2I2SA 1OQDA 5AFBA 2XHKA 3Q8BA 5C8CB 2J1EA 4GH4B 1S0JA 4NPRA 2RMU1 4X8PA 4ASMB 3N36A 3QBQA 3ZOIA 2FZ1A 1PVC1 1W06A 2WINB 3TNQA 1PO12 3OSDA 4U2AA 3ZDVA 1W9FA 3PLQA 1H2NA 1PMIA 1V9U3 2A1XA 4MO3M 2YDEA 4B8EA 2YUEA 1CONA 4IE5A 4UFKA 2NN8A 4XFFA 4YM2A 3WINE 3PMSA 1SDWA 3AVSA 2C9AA 2QVSB 2NZ9A 3GXUA 4PDWB 4QB1A 5HCFA 5EPAA 1K42A 3SQOA 1H6YA 2J1AA 4CDXC 2VW1A 3IDBB 3ILFA 1EAH3 2JD4A 5D1IA 3VBFA 5A7SA 1VIWB 5IW0A 4OCTA 4AVSA 4Q4W2 1GQPA 4YZ1A 1MS4A 1ENRA 1GYKA 3BTAA 1WLTA 3WG1A 5AFEA 2ZX1A 1JZ5A 4RS5A 2JDKA 4YW7A 4LR4A 3I2JA 1ZA7A 3D3AA 5A7WA 3ZKYA 1WW5A 1FNZA 4IQPA 4XQDA 3NJYA 4BQ4A 4NIDA 2HYXA 3JZVA 4DPNA 5CFDC 4RFT0 2ZZJA 3OJBA 5JIAA 2ARXA 1JN2P 4AGRA 2O1QA 4PLNA 1HQWA 3ETQA 4IW3A 3ROUA 3ZXDA 4PLMA 1HRI3 4KU8A 1FV2A 5IAVA 2VVDA 2DVDA 4ZU7A 1COV1 3O1UA 1IS5A 3M1HA 4AHYA 3ZXLA 5M0TA 4DS0A 5CA6A 4OQ8A 1TME3 5H9QA 1W6PA 3B9IA 1BVVA 3VN4A 4PJYA 3H9AA 4LIUA 5FAXA 3VBHC 3VUOA 5FY1A 1VBA1 3K51A 4E2SA 3S6PA 1WCDJ 2WFF3 2AACA 3SCFA 1VBC2 5CFCB 1C8NA 1RYYA 4ZS2A 5GALA 1YQCA 2IXCA 4HANA 4XIKA 3ZXFA 4P9XA 1JYIA 3VBFC 3C2UA 1RL3A 4OI4A 4GH4A 5C8CA 1PNFA 1XRUA 2YB7A 3T1MA 5FRAA 1XPWA 4Y1YA 1YJLA 5IVFA 4R9DA 4CEYA 2XVLA 4JHZA 1U5XA 1NT0A 5H9PA 3PVEA 5L36A 4WV8A 2XQRA 3VZKA 3BPSA 3CBNA 4LHNA 4FPLA 2IC1A 4FXKB 1YCIA 4DRVA 3MF9A 2YY1A 3H3LA 4NRQA 1AUYA 4PDWA 4MG2A 4KBZA 2CV6A 3WW1A 4QX2A 1C8M1 1HKDA 1NXD1 1X50A 1UMHA 3AP5A 4XZUG 1US2A 3GHNA 4AL9A 1DZQA 2RDQA 2Y6KA 4M3CB 4Y5Z0 3ZN4A 5CAZA 1V00A 3KVBA 1GP4A 4UF0B 1LOCA 4KNCA 4YZ4A 2VOTA 4AFDA 2VL4A 3LF7A 5FYBA 4FAGA 4QT6A 3EYPA 4LA2A 5FREA 4Z8BA 5DQ0A 3AZWA 2XJTA 4R8HA 5FKBA 3ATGA 5LW9A 2BQPA 2J1VA 4AI2A 5F6LB 1LHWA 1CESA 3RZLA 1XNTA 2QQMA 3B01A 5A33B 4RQPA 4CCMA 1R093 1N3OA 4ZHNA 1CZSA 3ENRA 4FPGA 1OBNA 4W6YA 4CEYC 4IGPA 1O59A 4AVTA 4CUCA 1R082 5L9BA 2WJSA 3AL6A 1G8WA 4YW3A 1J84A 4A7KA 1G9FA 4URAA 5KHJA 1NYWA 2W47A 3E5UA 3OBAA 2ZPXA 1CPMA 1W6QB 1H4GA 5FZ6A 3DPRB 1UY3A 2E9QA 3MUY1 3R4DB 4IGOA 3DECA 2RR13 2JG8C 5J96B 1K3IA 1PX3A 2O0OA 2A3XA 4P00B 4D69A 5CFCA 1FMD2 1VRBA 1YFUA 2P6HA 4M3CE 4Q4X3 3I2DA 5A6QA 1LGCA 3H0OA 2A6XA 1OH3A 4LO5B 4QKFA 1VBD2 2HWF3 2PHWA 1J1LA 1W8NA 2JENA 3U37A 2GP5A 3U0ZA 1XBFA 3POJA 2EF6A 1N1VA 3SKJE 4HN1A 4KWUA 1OOPB 1ASJ2 4IE0A 4QGLA 3S7EA 5JXJA 3W5MA 1S4CA 1AYM1 5JOXA 5FIXA 2R1DA 2XOMA 1XYPA 3S7IA 1VE0A 3WOGA 1SLBA 4ZONA 3FHQA 3R6SA 4D6RA 4RQPC 2D40A 3IM0A 4RL7A 3V64A 2X8KA 1GV9A 2J1TA 2WRAA 1GWMA 1VBE2 2ZHMA 4M3CA 1VMJA 3F2ZA 1RUF3 4E8DA 4IE4A 3UV9A 3N7KA 1TE1B 3PIJA 4UWDA 1W9SA 2YFUA 4HKOA 5JR7B 4DB5A 2V5YA 3NO8A 1FPN1 4QXCA 4UW3A 1CAWA 4JC1A 3PIGA 4KWJA 3VB9A 4YSFA 1G9BA 3U14A 2AEZA 4IE6A 4QX7A 1DYKA 4MOAA 4F83A 1D4M1 1L3JA 1MQTB 4OUSA 4OHYA 4IV1A 4Q0VA 3C3VA 2O8OA 4B7KA 2NM1A 3AKQA 4LNVA 5A33A 4E4DX 1DGLA 1OLME 2NQYA 5T52A 3RYKA 1WMEA 3K77A 1W28A 5DAQA 1HQLA 5KXDA 2PLV3 2Q30A 3WP4A 2ZBJA 2DVFA 3HT1A 5K9YA 1W2UA 1W8OA 4B1LA 4XXAA 3BOWA 4FOYA 5FDBA 3AK0A 4Q1PA 3DPRA 4UI9L 3SH5A 1R1A3 4Q4V2 5F5QA 1B09A 2DCYA 1AXYA 2XG3A 2WABA 4Q8LA 2QFEA 5HXMA 4Z82A 5FY0A 3AMNA 3THDA 2XJVA 1O3TA 5T5JA 1H1IA 1AL23 5FZ0A 2A6VA 3PMEA 3BIWE 2O14A 1IS4A 1RUJ3 4N9IA 1HRV3 1W6MA 5GLUA 1JOPA 4MYEA 1OLMA 2AYHA 4WZCA 1DFQA 2VQUA 4LXLA 3VGIA 1V6LA 3MIFA 4YM3A 4AXOA 4BMEA 1EUTA 2ZAAA 4JZRA 2ADEA 2PHUA 2LALA 3OB8A 5F3CA 5A3MA 4LHSA 1IHMA 3GZAA 2NMOA 3N9LA 4IV1C 3WR0A 4CU6A 3HBKA 4C8DA 1UOFA 4LO6B 3WUCA 1PK6A 3C7GA 2B9VA 1FYUA 3NNMA 5K4LA 2OW4A 1YQ5A 4N7UA 3WCSA 3MIBA 5JSOA 3J4UH 3MW3A 2MPFA 4HVRA 1KQRA 1F35A 5FYHA 4DY3A 2QQUA 2PN5A 3F95A 1K12A 3RSJA 4AEKA 1AYN3 1V9U2 4JQRA 2ZGRA 4AEDC 2VMIA 4BIOA 4E4ZA 5IVBA 5JZGA 4DMIA 3EMRA 3S5AA 1QJY3 2D3RA 4XMIA 2W1SA 4OUEA 3SMHA 1MQTA 4H7MA 3TYJA 4G3YC 1UU6A 5JPMB 2YZ4A 1D4VB 1EAH2 5EYYA 3FC0A 1GZ9A 1QXRA 4BJ0A 3VBOA 4C90A 5C3QA 5ACA3 2FDGA 1VR3A 4HKLA 4FVVA 4JTOA 2HWD2 4KI5M 2RS51 2HLEA 2BP6A 2WSUA 2JIJA 4XUQA 4FPOB 2RJLA 3WDYA 1H1AA 5L7OC 5E88A 4FTEA 3THTA 2QJVA 3PURA 1QH6A 1VBB1 2VUJA 3OOXA 5FOJB 3BTYA 1ZZ8A 3I97A 2RS11 1PK6C 1A8DA 2QCSB 3EJKA 3HWJA 1QNWA 5EIYB 2XMLA 3WHTA 2GAUA 1POV3 2R041 2GZWA 4HLTA 3ZXKA 1QHDA 2PA7A 2P37A 3B94A 4QB2A 5F1RA 1W9WA 5IK7A 3CU7A 5F2SA 1HXS3 3DN7A 4XJUA 2VD7A 1TMF1 3JCIA 4BPZA 5LRRA 5FPLA 2DTWA 4JGYB 4BK5A 4D6QA 3I7DA 4XF9A 3R4SA 4NRPA 1B35C 5JZGC 2D98A 1J3PA 1MZ5A 4A2UA 5CBLA 5L9RA 1ZZ6A 4Q4Y1 1TME2 5AVAA 1YXWA 3X29B 5FP8A 1MEC3 1Q56A 1SLTA 2TEPA 5FBJA 1X8EA 4BE3A 2F4LA 4I09A 1ONAA 4EN8B 4F3JA 4AI9A 5FP3A 4JDOA 1SPPB 3HQRA 3P3NA 4RGAA 4L8QA 1QU0A 2WNUB 5FQ0B 2PTMA 5C9AB 3VBOC 3T2PA 2FDJA 1US3A 4CCOA 4B7EA 3WDXA 3WCRA 2QQKA 5BXXA 3IMMA 1O3SA 1LJ7A 2DV9A 1BEV3 3DCQA 3SC7X 5FP9A 2AH2A 3OPZA 5A6YA 1MZ6A 3JD73 1Z7S3 1SACA 2VH9A 3WF0A 3IN9A 1UD1A 2OX0A 4LKSA 4QM8A 3A21A 1S55A 4UW5A 2RG4A 4AF9A 2QKDA 1DGRA 4J1WA 3W9AA 3LEIA 3IPVB 3VDAA 1RVF2 1ZBE1 5EYXA 3RI8A 1YIPA 4K8FA 1DLCA 3WW4A 1AR82 1F31A 1UIKA 2YC4A 4JRAA 3D6EA 3SH3A 4JX0A 3M4FA 1ZZ9A 4QPGA 2TBVA 2MEV1 1KJLA 2W94A 1QY4A 4XAEA 5A1FA 3WDWA 1O4TA 4ZXKA 5FPZA 4IEYA 2EIGA 1O4YA 1RC6A 3TN91 1PGL2 1PO13 1EV12 2VGDA 2JECA 2XB6C 3LA3A 1NCRC 5BPXA 2HWE2 1RUI2 1LRHA 1RMU3 3ACHA 3NJVA 4WVWA 4JDNA 4MHUA 1QIQA 2PHTA 3WUDA 1OUSA 4FPEA 2FQPA 2IXIA 3AYDA 1MZFA 4LITA 5FZ7A 5C5UA 2DCKA 2LTNA 1JOBA 4TLFA 3KM5A 1NA1B 2WO2A 4LPLA 3KZ4C 2E63A 1DIWA 2BW8A 3ZIXA 4D7YA 4NAMA 2G19A 3WNNA 1FOD1 3UETA 1GP6A 2WZEA 4QDQA 4FPHA 2VMHA 3M3QA 2B39A 4FQZA 3CJIA 2YROA 3FBYA 4Q4W3 1JH5A 1WBLA 5APAA 1ODMA 4AFAA 2DVBA 5F5AA 2GP3A 3WF1A 2WZR2 5DUWA 4AQ6A 1OXCA 1VAKA 2DVGA 4OUMA 5I8SA 4B4PA 1ZA4A 3FFZA 2F17A 5FYUA 5ABJB 5IHRA 4Q4X2 1H9WA 2G1MA 2JDMA 2WNUA 3H1YA 1ALYA 4X6RB 1VJ2A 2WNVC 3P5BA 1EP0A 2DTYA 4QPGC 4W4ZA 1LESA 5HV4A 1KITA 1MZEA 2GNMA 1UYYA 1RUE2 2YV8A 3ETPA 5FR3A 2Z5WA 1UCXA 2WR9A 5I8TA 3KF3A 4K21A 5T50A 4BQ5A 2LS6A 1F4AA 1WLWA 4LK6A 1MACA 5D2AA 4CA9A 1RUC2 4GB31 1OD3A 4N53A 5T3NA 3ZYJB 5LY1A 3RQ0A 2RV9A 2H6CA 3G6JB 3OUIA 5HBAA 3WNLA 3J7HA 1FI2A 4UFHA 1VBC3 3T2QA 2D7FA 5BYNA 2WS91 3GYDA 4LBQB 1RUF2 1S0DA 3W58A 2QUOA 4CDWB 3CJIC 3HJRA 1PM4A 2H0VA 1FT9A 3POGA 1YWKA 2JE7A 1Y9MA 2IXLA 2WLQA 1LHNA 3MPPG 2AZ5A 4QQ2A 2WDBA 4HXCA 4LHLA 4CEWA 5F7UA 2RM23 2ZGSA 3KV6A 5FXVA 4LO8A 3UT0A 1DQ0A 5E89A 4AI1A 2VTFA 1VLNA 4I0BA 1X9PA 1ZREA 3GBWA 1PO21 1UZ0A 3J9SA 1OT5A 1W8WA 1PIV3 3V0AA 2UU8A 3C7FA 2ZEZA 3DYMA 3Q8AA 4A42A 5C3OA 2XLAA 3WG2A 3DYOA 2WAOA 2J1SA 2K46A 1HB4A 3DYPA 3T3YA 2FHRA 1OLQA 4Q26A 1GSLA 5KXEA 2WQ8A 3AMHA 3ORJA 2GMMA 4KL1A 1AHSA 4N53C 3POSA 2R30A 4QMAA 1IG3A 1X7NA 1PMHX 2ILMA 3RZZA 1VMHA 4Y5TA 3VZMA 2OYZA 2QQOA 3OY8B 4JKMA 3T08A 5ABJA 4HL0A 3K3NA 2YHJA 1V9U1 4YW6A 5KC6A 2BBVA 1G9DA 1UU4A 1OFNA 4BISA 1AL22 3OBZA 3LEMA 2W1WA 2VCBA 1XB9A 4XEZA 5F8PA 1LKNA 3WVJA 4RN5A 1H1MA 4DIQA 3KVAA 1WD4A 3FLTA 1YQ6A 2CWMA 5C5TA 5CU1A 1HDKA 1OKOA 3W5NA 4CEWC 1R083 4XF0A 2OPKA 3DV8A 1D0GA 3KWVA 4OFGA 4QHBA 3S5QA 4DINB 4XUNA 3VDDB 1GR3A 1R1ZA 1AR93 1LGNA 1RHI2 2OVUA 2P3KA 2Y6GA 4LO4B 2G9ZA 5D8AB 2X5IB 4FCAA 1Z0HA 3OCPA 3IIIA 4EN0A 2CGNA 3AZXA 2XJPA 2ZX4A 3LFMA 3RDIA 5A7OA 1ULEA 1JYNA 1N3QA 1FMD3 1W8HA 2V09A 3K75B 3OGJA 4NPLA 5FPBA 3LDBA 3Q9OA 1O5LA 1UY4A 4R52A 5TSWA 4AEJA 1GQGA 4CUBA 4LOTA 3I3DA 2JKBA 4Q27A 1FXZA 1SMVA 2CAVA 4HG6B 5BNPA 4GMP3 3WX5A 3RZMA 1AYN2 1ZRRA 4HZFA 5LEKA 1HRI1 1GLHA 4XF4A 1E5HA 5EWSA 1ASJ3 3TOJA 4CCJA 2DFBA 4QPIA 4W50A 1QXPA 4JGZB 3MBWA 3E6BA 4UBGA 3LPGA 4L99A 4OLLA 5FFOC 5KHIA 1GZTA 1NX9A 2EIEA 3AFKA 1XU1A 3J7MA 3M3OA 3TRSB 1G86A 1Y43B 1G9CA 1TME1 3V0BA 2AGSA 3O1SA 2BJSA 2C6SA 2WA4A 3A22A 3LPFA 1K5MC 1OA3A 3DEMA 5LZ6A 3MW2A 1GZWB 3BB6A 4BU2A 3GBGA 1BQPA 1VBE3 2WFF1 3A0NA 4DUVA 2WT2A 3ZO0B 3H8XA 2BFUS 4N43B 2BFUL 3GZUC 3M3IA 5FY9A 3WNKA 4BYYA 2ZGMA 3C7EA 1W0NA 1GNZA 1UOBA 3K4DA 3OBRA 4S2HA 3KV9A 2DFCA 1BMV1 1YUDA 3MIEA 3KCXA 3ZFFC 3VD9A 2GH8A 4YNIA 4SLIA 1X82A 2XJUA 4UOJA 5FY5A 2D5HA 4K3UA 4P9GA 3IDAA 2WKKA 5FTTC 1D2QA 5IWFA 4QDSA 4AVCA 1JZ4A 4Y5SA 2CTVA 5A3NA 2QDNA 4XACA 3O12A 4M4PA 4IV3A 4IEXA 2JG9B 1GMMA 1CAVB 1POV0 4O9EA 4WVZA 5BNPC 2IFWA 5SV5A 4KBBA 2A6WA 3D0JA 5A32A 4RGGA 1ZBA2 2EICA 3I2IA 3IAQA 1IPSA 3AP6A 3LCPA 4QPIC 4V2WA 4IL7A 4A41A 1N1TA 5I0SA 1YHFA 5GLVA 5HXVA 2E31A 2BGCA 2TUNA 4M00A 3ZYHA 1REEA 1JODA 4Q4V3 5JLVA 2QDRA 3KQRA 2PHFA 2XPJA 1XYOA 4XXPA 4ZU4A 1TVGA 2A7AA 3O1TA 2CGPA 2UYBA 1URXA 1W0OA 1UYPA 5EXOA 4CU7A 4D3WA 1YNAA 4P5YA 3WQ0A 1ZNPA 1BEV2 5FMOS 1WD3A 5DAPA 4L0PA 2JKXA 1H8TC 3WY6A 5J37A 1WGPA 1R091 2WIIB 2CGOA 3NWKA 5J36A 2WYFA 3DL3A 3VD5A 2GMPA 4HONA 5KXBA 4XOGA 5FZOB 4JGZA 4C0HA 2YBSA 4CCNA 1ND3B 4X6QB 4DY5A 1JZ8A 4IV3C 5AC93 3BTXA 3IAPA 2JE9A 2UWCA 2DBNA 4I3GA 2WC2A 4AVAA 3VL8A 3MLLA 3LEKA 1XOYA 2RR11 3ECQA 4HPKA 5I8YA 1YI9A 1DU3D 4HETA 4WM8A 4ITCA 4P9LA 4Q4X1 4XW3A 3BI3A 1PHMA 5FXZA 2ZGKA 2VNVA 2ZHLA 4A6SA 5KXCA 5JUVA 2YPJA 1Z78A 1CR7A 3MIDA 4EROA 5LBEA 2OZJA 2HWF1 1RMU2 3AKTA 5GKAC 3FL7A 1XQNA 3N9NA 4CYDA 4U36A 2Y34A 1RUH3 1LTEA 2E6VA 3GJBA 1HIXA 3H8UA 4COVA 4K20A 5B2GB 4D94A 1WCKA 2RE9A 1BBT2 1WMXA 2BERA 2D5FA 4HSLA 1CAVA 1NE4A 2QTWB 4QD2A 2VG9A 1LENA 4BQ2A 1RUG2 4KH9A 3ZSJA 2J1RA 2HWD3 3LSEA 4G4FA 4CP1A 5LBCA 4F7ZA 1DP0A 1ND2C 2EA7A 2Z42A 3B3QE 1AZDA 4PIYA 5JI9A 3N9OA 1RUF1 4DUWA 4BHPA 5FPVA 4L92A 2EALA 5JMCA 2GH2A 4DZGA 1W90A 4HVQA 1JW6A 4OQ9A 1YQ2A 2FCTA 4LBMA 1G9AA 1RXGA 2JG8B 4MXVA 3NAPB 5T5PA 4BIFA 1J3QA 1UL9A 2VNGA 4AFMA 4FP3A 1RTVA 2NMNA 4IEOA 4WM8C 3U11A 4ATFA 5FMCA 2OXBA 3DXUA 1IS6A 5IVEA 1YFXA 2W95A 1LHUA 1U12A 1W8UA 3RGBA 2ZEWA 1LEDA 1JU3A 4CDQA 2XXZA 2OT7A 1DHKB 1UWWA 5LY2A 4FFHA 1CX4A 5D21A 1C3HA 3TNPB 4CCLA 2JDPA 2J1UA 2VMCA 4URTA 4XCBA 1C1FA 3J7LA 3LE0A 4A44A 3M7AA 4CTEA 1QNYA 2PLV1 2ADDA 2R49A 5FZOA 4C1WA 5J1XA 4XE9A 2ZMNA 3OGVA 4AQSA 1OVPA 5K0UB 3PTYA 1DLLA 4IEPA 3VBRB 4AHXA 1VRH2 5FZ9A 1R1A1 5C4WB 3SEPA 1NOVA 3JXSA 4PT6A 4OULA 3TAYA 5FV3A 1NAEA 2VU9A 4FOVA 5GLWA 1S0CA 2J42A 3K4ZA 1GBGA 4IEZA 1AL21 4NJ4A 1KGYA 4NN0A 1YYNA 4RS5C 1MS1A 1PX4A 4LUMA 1RUJ1 2RM22 4XMAA 2Q1ZB 1HRV1 3OTFA 3LQCA 4HN0A 3TEXA 5FZ4A 3QH7A 4I02A 3WNOA 3UKNA 2JDYA 4J6GA
chains in the Genus database with same CATH topology
5DABA 4NPMA 4ZHNA 3I3QA 3S57A 4IE5A 4IDZA 5F8PA 3O1PA 2FDKA 3RZKA 3BTXA 2FDFA 3KHCA 3I2OA 3BUCA 4OCTA 4O61A 3BI3A 4IE7A 3S5AA 4QKFA 3BIEA 4NIGA 3LFMA 4NIDA 3RZGA 4NPLA 3O1RA 4NIIA 4IE0A 3T4HB 2FDGA 4MGTA 3RZMA 3O1UA 4QKDA 3I49A 3O1MA 3BTYA 4NIHA 3O1SA 4IE4A 3RZHA 3H8OA 2IUWA 4ZS2A 4NRMA 4RFRB 3H8XA 3KHBA 3H8RA 3I3MA 2FDIA 4QKBA 4IE6A 4CXWA 4NRPA 4QKNA 4NROA 4CXYA 4CXXA 2FD8A 4JHTA 4NRQA 2FDJA 4MG2A 2FDHA 4QHOA 3O1OA 3RZJA 4ZS3A 3O1VA 3T4VA 4O7XA 4NJ4A 3T3YA 3BKZA 3BU0A 3BTZA 3O1TA 3RZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAB A;  4NPM A;  4ZHN A;  3I3Q A;  3S57 A;  4IE5 A;  4IDZ A;  5F8P A;  3O1P A;  2FDK A;  3RZK A;  3BTX A;  2FDF A;  3KHC A;  3I2O A;  3BUC A;  4OCT A;  4O61 A;  3BI3 A;  4IE7 A;  3S5A A;  4QKF A;  3BIE A;  4NIG A;  3LFM A;  4NID A;  3RZG A;  4NPL A;  3O1R A;  4NII A;  4IE0 A;  3T4H B;  2FDG A;  4MGT A;  3RZM A;  3O1U A;  4QKD A;  3I49 A;  3O1M A;  3BTY A;  4NIH A;  3O1S A;  4IE4 A;  3RZH A;  3H8O A;  2IUW A;  4ZS2 A;  4NRM A;  4RFR B;  3H8X A;  3KHB A;  3H8R A;  3I3M A;  2FDI A;  4QKB A;  4IE6 A;  4CXW A;  4NRP A;  4QKN A;  4NRO A;  4CXY A;  4CXX A;  2FD8 A;  4JHT A;  4NRQ A;  2FDJ A;  4MG2 A;  2FDH A;  4QHO A;  3O1O A;  3RZJ A;  4ZS3 A;  3O1V A;  3T4V A;  4O7X A;  4NJ4 A;  3T3Y A;  3BKZ A;  3BU0 A;  3BTZ A;  3O1T A;  3RZL A; 
#chains in the Genus database with same CATH topology
 5FYS A;  5FYZ A;  1PIV 2;  1U5Z A;  4LQR A;  3JBG 2;  4I30 A;  5HV0 A;  5EP9 A;  2R32 A;  1PVX A;  1XNK A;  1RVF 3;  3FJS A;  5T5L A;  3D8C A;  2DWR A;  1AR8 3;  3GNE A;  4CDQ C;  2C1F A;  4OZO A;  1HN0 A;  4CUG A;  3B7M A;  2E33 A;  4GZ9 A;  1BHG A;  2BTV C;  2AR6 A;  2PAK A;  4PHZ A;  1OKQ A;  2YBK A;  5LA0 A;  2WSV A;  3QAC A;  2KR2 A;  2BU9 A;  2UUR A;  5A70 A;  1EV1 3;  4PBO A;  3BUC A;  3KMH A;  4EWE A;  2HWE 3;  1RUI 3;  1GFF 2;  1GOF A;  2VME A;  3KV5 A;  3LB9 A;  5A1A A;  3NAP A;  4UFJ A;  3H50 A;  4LBL A;  4GH4 C;  1QJY 1;  1TEI A;  4YYO A;  3TWI A;  5C8C C;  3N7L A;  1SBF A;  4AK3 A;  1O4Z A;  1AL0 G;  1GP5 A;  5CIS A;  2VY0 A;  4YVS B;  1W6N B;  4FPF A;  5GLZ A;  3AKP A;  4LMF A;  1PGW 1;  3V0A B;  5ERL A;  3LIH A;  2UWB A;  4NO4 A;  4A3Z A;  5ACA 1;  5BNO B;  5GLT A;  4MGQ A;  1AR9 2;  3LFI A;  3E1F 1;  3THP A;  2WZR 3;  1BZW A;  3WW3 A;  2GDF A;  3GAL A;  4RGK A;  4PDW C;  5K0U A;  3O1M A;  2VCM A;  5FP7 A;  5JOY A;  4K1Z A;  2D3P A;  4NHM A;  4S2G A;  1H30 A;  5HI0 A;  1S0G A;  1IKP A;  3A0K A;  5F32 A;  4TTG A;  2W08 A;  3M8L A;  3WT3 A;  4QM9 A;  1J59 A;  3BN6 A;  4IEQ A;  1AR6 2;  4H2A A;  3I59 B;  4UT5 A;  1W2A X;  1V6N A;  2E7A A;  4XIL A;  3LOI A;  1POV 1;  5EV7 A;  4Y26 A;  3IBM A;  1RUE 3;  3N9Q A;  4AW7 A;  1GWK A;  3AMQ A;  1XNB A;  1IPK A;  1HXS 1;  4GMP 0;  4RHV 2;  1U5I A;  4CCE A;  5JPN B;  3LOB A;  2Q1M A;  5DUU A;  4CXW A;  3P3P A;  4D7T A;  2YU1 A;  2WFP A;  4NRO A;  4AED B;  2QQL A;  1RUC 3;  2OS2 A;  1SLC A;  1DZR A;  4GAZ A;  1CAU B;  4AE2 A;  1QOO A;  2PYT A;  1REF A;  3AM2 A;  2R07 2;  2Z4F A;  3HVD A;  1NY7 1;  1MEC 1;  1CQ9 A;  1WZX A;  4XQW A;  2ZZQ A;  1CIW A;  1W9Y A;  3HAG A;  2FCU A;  5GZD A;  3POE A;  5CG9 A;  1UY0 A;  3WG3 A;  3WEZ A;  1ULO A;  5JMO A;  1LCL A;  4UF0 A;  1QJX 2;  3BOD A;  1MR5 A;  4FFI A;  4XIO A;  1EPW A;  1DQ1 A;  5DG1 A;  1Y3T A;  2FDH A;  1DGW X;  4AR2 A;  1SBD A;  1UPI A;  2Q1F A;  3E6D A;  4COW A;  1CJD A;  2VUD A;  3HD8 B;  2EAA A;  2RHP A;  5EJ3 A;  3EO6 A;  1BEV 1;  4ES8 A;  2JEM A;  3FUO A;  5L7O B;  4EN7 B;  5DDJ 2;  2WNE A;  5CFC C;  3JD7 1;  1Z7S 1;  3MGU A;  2DVA A;  3QD6 A;  4KU7 A;  5ANQ A;  3U10 A;  2CDO A;  3POI A;  3PUI A;  3VHP A;  3WDT A;  1V6K A;  1QQP 2;  2FCV A;  5DZF A;  3SHR A;  3U07 A;  3BU0 A;  5CKQ A;  1LOA A;  2R7E B;  2XKO A;  4Y22 B;  4E4H A;  3EHK A;  1W6N A;  2CYF A;  2XON A;  4AG4 A;  1W99 A;  2YC0 A;  2BDR A;  1W9T A;  3LZZ A;  2HWB 2;  1N3P A;  5DAB A;  3VV1 A;  4NHX A;  2KD7 A;  3ZR6 A;  1NZC A;  2BEO A;  5FZI A;  3SCH A;  1W6Q A;  4J1X A;  3PVB B;  4FPY A;  5J98 B;  2ZS6 B;  4E2Q A;  4YVW B;  3VHN A;  1PO1 1;  1W04 A;  2VM9 A;  2Y60 A;  3W59 A;  1N47 A;  1RMU 1;  3CLP A;  4NHK A;  2VZO A;  2BUK A;  1DCS A;  3L2Y A;  3WD5 A;  3ZYI B;  1H2K A;  5FMB A;  4NWV A;  4RR3 B;  4JTN A;  4N7I A;  1DQ6 A;  2BWA A;  4CDU B;  5LAT A;  5FO9 B;  1OA2 A;  4GQ7 A;  5FP4 A;  4KWK A;  4CU9 A;  1XYN A;  3VHR A;  4WM7 B;  5F3G A;  4GD4 A;  1CJP A;  1OOP A;  1ZX5 A;  1MPX A;  2E26 A;  2HEY F;  2XBO 2;  3CQO A;  4GWN A;  4PIX A;  4Y1V A;  3AYA A;  4HT1 T;  3ZSM A;  2IFR A;  3RWK X;  1RB8 G;  2DCJ A;  3POB A;  4LK7 A;  4Y33 A;  4EN9 B;  4Q4W 1;  1RHI 3;  4PF5 A;  3WDV A;  1CAU A;  4EWD A;  1LEC A;  5AC9 2;  2K2S A;  2RS3 3;  3ZFG B;  2D6M A;  1AR7 2;  1I1E A;  4FPC A;  1LOD A;  3E97 A;  4Y24 A;  4MGT A;  2CSG A;  2R16 A;  3CEW A;  4XF1 A;  4XHX A;  5EJ1 B;  3VDB A;  5IT6 A;  5LEJ A;  1N1Y A;  1QWR A;  1SZB A;  5BV6 A;  3OUJ A;  4OYU A;  4Y20 B;  3N4M A;  1GOG A;  1NE6 A;  4DEQ A;  4QX3 A;  1FAT A;  2AEN A;  4CCK A;  1WCU A;  2VMG A;  4FO9 A;  4GKY A;  4M4R A;  3DPR C;  2RJ2 A;  3OD0 A;  4Q1R A;  3ACG A;  4BQY A;  3AYE A;  2MHF A;  3HPN A;  3NV1 A;  4BOW A;  3EXU A;  1W3X A;  4QXK A;  4TLG A;  3VLB B;  1POQ A;  1LEM A;  1OHF A;  1RUH 2;  4YGB A;  1YFW A;  3L2H A;  1RUD 2;  1H0B A;  5IUQ A;  1ODN A;  3LDR A;  1YQ8 A;  4NR1 A;  5C3R A;  4ZY9 A;  1NCQ B;  4PI2 A;  4E4S A;  4S2F A;  5IVY A;  3DF0 A;  2VZP A;  4QX0 A;  2CAU A;  4A7Y A;  1VBC 1;  2LM3 A;  4XJ8 A;  1OOP C;  2PHL A;  3Q8F A;  3IZO A;  3WNM A;  2D97 A;  3R4U A;  4XVH A;  2VJX A;  2VCA A;  5G05 L;  3UKT A;  1AX1 A;  4GAL A;  4AHW A;  2PXJ A;  4QX1 A;  1LOF A;  3MI8 A;  4AYU A;  3SEE A;  4YVW A;  1UY2 A;  3RS6 A;  5FOB B;  5JSR A;  1LB2 A;  2RM2 1;  2PFW A;  2W9X A;  4F8A A;  4UFM A;  1UPS A;  5F6K A;  2DYC A;  5A3W A;  4V1P A;  1DDL A;  1PGS A;  2IVI B;  3OG2 A;  3PHM A;  1RJ8 A;  4RR3 A;  2ZCW A;  2VTX J;  2QQV A;  1PIV 1;  3MLJ A;  2D6P A;  1YFY A;  3PDQ A;  3UGH A;  3RZG A;  5CYY A;  2A75 A;  1H4H A;  1O3R A;  2Y8K A;  4KMQ A;  1ZBA 3;  4R9B A;  2E7Q A;  3D4K A;  4WM7 A;  3RFR A;  1GNH A;  1OI6 A;  3WF3 A;  3H1W A;  4I2O A;  4Q0Q A;  1UYX A;  3N35 A;  3KQ4 B;  4ZZ8 A;  1MQT C;  1QJU 2;  3H1M A;  3CHX A;  4LJH A;  5FYC A;  2NYY A;  5KHG A;  1T2X A;  4XYX A;  4PI0 A;  3I2G A;  3CO2 A;  2OII A;  5DZG A;  1Q43 A;  3ZYB A;  5C6C A;  2QZ2 A;  4NPM A;  3B5L B;  2ZXQ A;  3I3Q A;  2B5H A;  1O5U A;  2R06 2;  3ACF A;  5KR7 A;  4XUP A;  2GNT A;  3FBM A;  3VBU B;  3B9C A;  1A78 A;  3AX4 A;  2OQ6 A;  4AEM A;  1ZRF A;  1RED A;  1WLD A;  1KRI A;  3WQ1 A;  5I0U A;  3ZSE A;  1LOF C;  2D6L X;  1S0B A;  4HVO A;  5FZM A;  2FDF A;  5HPO A;  5A7Q A;  1CAX B;  3QOP A;  3ITQ A;  3OF1 A;  1R08 1;  5CKM A;  2W0X A;  4BQW A;  1JXN A;  2XL7 A;  4KG8 A;  4NWW A;  1AR9 1;  4BZ4 A;  2Y0O A;  1S2B A;  5IYY A;  1Y4W A;  2ZX0 A;  2HWC 2;  2ZAB A;  1LU1 A;  4XF3 A;  1IPJ A;  4D8M A;  3JUU A;  4OHV A;  3VL9 A;  3UJO A;  4LTA A;  1Q8V A;  3MW4 A;  1FMD 1;  3O1R A;  1GOH A;  4GKX A;  3CZU A;  1LHO A;  1ZRD A;  5FUI A;  2OUJ A;  5GZE A;  3AJY A;  3H3Z A;  3T4H B;  1SEF A;  1W8Z A;  1VBD 1;  5G04 L;  1UOG A;  2WQZ C;  1UZZ A;  2WUH A;  5A1L A;  4GMP 1;  1S0I A;  1GIC A;  2R1B A;  3NNL A;  3UJQ A;  3WV6 A;  1AX2 A;  3U75 A;  3HQX A;  3J7N A;  1HJG A;  3ZR5 A;  4ARY A;  5A3U A;  1ASJ 1;  1XE0 A;  4DXT A;  4H55 A;  5A3L A;  2C9K A;  4J25 A;  1ULD A;  3MEP A;  1BBT 3;  2ETE A;  2P34 A;  1XU2 A;  2YMZ A;  3GBF A;  4IEU A;  4P5H A;  2JJ6 A;  4XFH A;  5F9T A;  4JGY A;  2QQP A;  1G7Y A;  3KCY A;  1VPH A;  2AC1 A;  2DCT A;  1RUG 3;  1S1A A;  2EXI A;  3ALQ A;  3UNP A;  1VBE 1;  4MET A;  3GM8 A;  5FXW A;  4AWD A;  1ENX A;  3GZT B;  2FDI A;  3OPW A;  1Q8Q A;  2H6B A;  5C8W A;  2ZTN A;  4FSJ A;  1SCS A;  1SPP A;  2JXA A;  2WQ4 A;  4W65 A;  1Q8P A;  2ZX2 A;  5C9A A;  3P6B A;  5FQ0 A;  4AAP A;  4YZ3 A;  4SBV A;  3N7J A;  3VD7 A;  1AJO A;  5IVV A;  5EZW A;  4OI1 A;  1Q3E A;  2DU1 A;  4QXB A;  4LO7 A;  4ISR A;  4XUT A;  4E27 A;  4Y1U A;  1JZ6 A;  4OHX A;  4ZPI A;  2VQT A;  2PAE A;  2XGX A;  2W87 A;  2VXJ A;  3PU3 A;  4EWA A;  2NP0 A;  3KV4 A;  2ARE A;  4NIA A;  1QDC A;  1SDD B;  5DAW A;  2RMU 2;  2BRT A;  4QQH A;  3NV3 A;  4OMC A;  1KEX A;  5LA2 A;  3IPV A;  1PVC 2;  3B93 A;  1H6X A;  3T0D A;  4AI3 A;  3VD4 A;  3IB3 A;  3U4S A;  3ZFE B;  4AFB A;  2GN7 A;  5JOW A;  1VRH 3;  4XJA A;  3KGZ A;  5FJH A;  4Q4V 1;  1RIR A;  4MX3 A;  4GXL A;  1AJK A;  4JGY C;  5DUX A;  2X10 A;  4YWA A;  3H8R A;  1CZT A;  1JOJ A;  1VAM A;  3I2H A;  1NLR A;  3U1X A;  4Q2F A;  3IDE A;  1OQE A;  5BNN B;  2Z2S B;  2VBD A;  5EFU A;  4K9S A;  5FUP A;  3IIA A;  4BQX A;  3HNB M;  2WO7 A;  2BV4 A;  4K1Y A;  4YG6 A;  3A4U A;  3WHU A;  1P8J A;  2EXK A;  4GWM A;  3ZFF B;  3O0X A;  4FFF A;  2WNU C;  5C9A C;  3ST7 A;  4DRR A;  5J09 A;  2G4I A;  2D6O X;  4ZU5 A;  4COZ A;  2K9Z A;  2V73 A;  3PUA A;  4PQ9 A;  5C70 A;  2X09 A;  2ZEY A;  3JBG 3;  3K46 A;  3AXE A;  4MHR A;  2ET7 A;  2Q8O A;  1NA1 A;  1Y7B A;  3WQB A;  2XR4 A;  2ZML A;  1IOA A;  4CCD A;  5AC9 1;  1JYX A;  1NKG A;  5K7P A;  1SBE A;  4MUV A;  5CB7 A;  1X9T A;  4E8C A;  2YBP A;  5A3O A;  3LEG A;  2VC9 A;  5FMD A;  2B4K A;  5LK7 B;  2ZA9 A;  4CZS A;  1OA4 A;  1L7L A;  4B1M A;  4NIG A;  2VUA A;  4YFW A;  1S0F A;  1COV 2;  2ZGT A;  1I6X A;  2GU9 A;  2P5B A;  3FHI B;  4JCK A;  4YG0 A;  4YRD A;  5L73 A;  2C26 A;  2FBE A;  2IVJ A;  2VZ3 A;  3E5X A;  4UFL A;  4AGG A;  4JRL A;  4B4R A;  3U4X A;  4BH9 A;  1RUH 1;  3NKG A;  2P1B A;  5A3P A;  3FFQ A;  3APB A;  1H9P A;  1XNA A;  2JDN A;  4OMD A;  2SBA A;  3FWE A;  5H9R A;  3ZXA C;  3EQE A;  3AP7 A;  5FYI A;  3ZX7 A;  1EAH 1;  3POW A;  5FPA A;  5HCH A;  3FE5 A;  4Z92 B;  3N9M A;  1LOE A;  2VNO A;  3NRU A;  2XLG A;  3ILN A;  3VBS B;  1IS3 A;  1C4R A;  1YO8 A;  2HWD 1;  4AVV A;  1X33 A;  3ZVX A;  2RS3 2;  1YIF A;  2R6Q A;  3RVH A;  5C33 A;  2ZGP A;  2IUW A;  1GUI A;  3HEI A;  3O7O A;  3ZFE A;  4YM0 A;  3HN3 A;  5JXI A;  1WW4 A;  3PU8 A;  4LBQ A;  4UW4 A;  3AMP A;  1W2T A;  5E1R A;  5A7N A;  4A45 A;  3I3B A;  3AYC A;  1AR6 3;  4CDW A;  4NMI A;  1KXG A;  1WMD A;  4QQO A;  2PHD A;  4JQT A;  1UQX A;  3OBT A;  4JKL A;  5FYT A;  3ZYR A;  1CX1 A;  1OQ1 A;  3OGG A;  1LHV A;  3VZO A;  5JXH A;  2XDV A;  2JB8 A;  5FZL A;  3TEW A;  2TNF A;  3AC0 A;  2XWB B;  3I8T A;  4RHV 3;  1C8M 2;  4LT5 A;  5FZA A;  4HKW A;  2ARB A;  3BAL A;  4CP9 B;  4CP0 A;  1UZW A;  5ABJ C;  2BOJ A;  3LA2 A;  3N7M A;  2JD9 A;  3HT2 A;  3K2O A;  3RMY A;  4W6X A;  2Q8E A;  1QOS A;  1V6J A;  2R07 3;  3SH4 A;  2UY9 A;  3NST A;  2YXS A;  4AGV A;  2VO5 A;  3GF6 A;  4CDX B;  1LU2 A;  3MFA A;  4LA3 A;  1KFU L;  4YZ2 A;  1PM7 A;  5T5O A;  2VBB A;  1JZ3 A;  2D6K A;  4AZZ A;  1LR5 A;  3ZKU A;  1QJX 3;  1BXH A;  4ATE A;  3A23 A;  3MFC A;  4LOR A;  1LGB A;  3NJZ A;  2LUW A;  4M3C F;  4ZZ5 A;  5JXG A;  3OPT A;  1QKQ A;  2ORX A;  4COY A;  1NQD A;  3AKR A;  2XLF A;  1DYO A;  4LBK A;  3RNS A;  5DDJ 3;  3BTZ A;  1K5J A;  3OY8 A;  1OC1 A;  2O8Q A;  3AKS A;  4WVM B;  4Q8K A;  5CFD B;  1QF3 A;  3R0R A;  4FXG B;  4KG0 A;  4MH0 E;  5E16 A;  4V2V A;  4CDW C;  1CVN A;  3VD3 A;  4AHZ A;  1QQP 3;  1JZ2 A;  1DZT A;  2GC2 A;  4K6B A;  4LKD A;  3NQH A;  5FZD A;  2JIC A;  4XFG A;  1RVF 1;  3CMG A;  4AQT A;  1O8P A;  4RA0 A;  5IAX A;  5FWE A;  4DO0 A;  3MIH A;  1AR8 1;  2HWB 3;  2VEC A;  3I2F A;  3O5S A;  2FDK A;  5IK5 A;  3PVO A;  3VBS A;  1J83 A;  3LA7 A;  3RWN A;  1OH4 A;  3VDD A;  3AB0 A;  4ZXE A;  4DQA A;  3RZK A;  4FTS A;  5D8A A;  3K48 A;  2X5I A;  3KHC A;  1LOB A;  3VBH B;  2CY6 A;  1PGL 1;  3IT8 A;  4YPJ A;  3PUQ A;  4AVB A;  1EV1 1;  5JI7 A;  1C1L A;  2F6B A;  1WW7 A;  3LDK A;  3MYX A;  2BYV E;  3POF A;  2HWE 1;  1RUI 1;  2WWJ A;  4IES A;  4O61 A;  1RUO A;  1AYM 2;  2P3Y A;  1KS5 A;  3VBF B;  5J48 A;  3J8F 3;  4Y4R A;  4HSJ A;  4NOT A;  2IWG B;  2JIG A;  5FMO L;  3JB8 A;  4TXW A;  3KT4 A;  5AVP A;  1FNY A;  4CVU A;  2QQN A;  5IAT A;  1AXZ A;  4MZU A;  2HJI A;  3ZPO A;  5A7W B;  3WW2 A;  4CE8 A;  1QJZ A;  2XBO 3;  2ET1 A;  1TZO A;  1NLS A;  2AUY A;  2A71 A;  2XKP A;  1UMI A;  2WAA A;  5JWP A;  1SG3 A;  3VDC A;  1WCS A;  4XHB A;  1XJA A;  2C0Z A;  5LA9 A;  1V6O A;  1KFX L;  1SFY A;  3UGF A;  2WL1 A;  1AR7 3;  2WZR 1;  5F5I A;  1ZZC A;  2Q5T A;  5I0R A;  1FPN 2;  2Q0A A;  1F15 A;  4EZH A;  1ZRC A;  1YRZ A;  1GZW A;  4M0N A;  3H3U A;  1J1T A;  1DQ4 A;  1ULG A;  1O7F A;  1CGP A;  1IG0 A;  4CU8 A;  3ZDS A;  4CPB D;  2E32 A;  4N43 A;  1D4M 2;  3UES A;  5FPX A;  3VDD C;  3HNY M;  4XQ4 A;  1W6P B;  2ZGQ A;  2GND A;  1GU3 A;  4FOQ A;  2Q4S A;  5D8A C;  1E5I A;  4XDO A;  1RUE 1;  2X5I C;  3KHB A;  2VZT A;  1MS3 A;  3GCW A;  4FAH A;  5J3U A;  5FXX A;  1JUI A;  3WNP A;  3PTR B;  4QKN A;  2Y6H A;  2WA3 A;  5FCC A;  1HV1 A;  5CFD A;  1RUD 3;  2PHX A;  1RUC 1;  1X36 A;  1X8M A;  2WNO A;  2VOV A;  4YGE A;  2JG9 A;  4JDM A;  2JDH A;  3ES1 A;  1ZVF A;  3H7Y A;  2WO3 A;  3HBZ A;  5GJ6 A;  5HCA A;  2DCZ A;  1UF2 C;  1ACC A;  3I54 A;  4CEY B;  1PNG A;  2RDR A;  2W5F A;  1GKB A;  4YGD A;  3THC A;  1XE8 A;  4JGZ C;  5FPU A;  5GZF A;  3RPQ A;  3H7J A;  4LBN A;  4QB6 A;  4Y1Z A;  3O1O A;  2KA3 A;  3I3E A;  2DUO A;  4XBN A;  2A3W A;  2ZGO A;  5FKC A;  4Z2A A;  2VOK A;  1KD7 A;  3RZJ A;  3VBH A;  5FZB A;  4GWJ A;  4D0Q A;  2YG0 A;  3TBD A;  3DKQ A;  3J26 N;  1OSG A;  2PEL A;  1E5S A;  4IGQ A;  2GSY A;  2VZU A;  1RIT A;  4CRQ A;  4IER A;  1IGO A;  1SLA A;  2BNM A;  4N43 C;  1TG7 A;  2E51 A;  3JB4 C;  1SFP A;  5DXD A;  4FFG A;  3BKZ A;  4P14 A;  4RYD A;  4OI2 A;  2IZW A;  3MO4 A;  1ENS A;  4E9K A;  1K45 A;  1VAL A;  2ES3 A;  4LBJ A;  4WBB A;  1ZRI A;  4XBQ A;  4TWT A;  3PUS A;  1OF4 A;  4DXR A;  2VVF A;  1S2K A;  4MXW B;  2OKX A;  3CZJ A;  3FUQ A;  4NHY A;  3M2M A;  4E2G A;  1QJU 3;  1ZM1 A;  1ND3 A;  4TYS A;  5CAD A;  1HB1 A;  3BYW A;  2BVV A;  2JG9 C;  4RQP B;  3WSO A;  5FO8 B;  4YG3 A;  5LRS A;  2P2K A;  4KGG A;  3FMG A;  1UXX X;  3WNX A;  5IK4 A;  1CZV A;  4A4A A;  1CN1 A;  2R06 3;  3KT7 A;  4RSU A;  2B45 X;  2XUE A;  4JAA A;  5IFT A;  1E5R A;  3AJZ A;  4R9C A;  3KCC A;  1CWP A;  1IZ3 A;  3BOP A;  2JWP A;  2ZOE B;  4WZF A;  1CPN A;  2XUM A;  2MNG A;  3H42 B;  3M3C A;  4KQ7 A;  5A7P A;  3U78 A;  3WDU A;  2EXJ A;  3ES4 A;  1F5F A;  5SV8 A;  1VB4 A;  2VNR A;  4P9Y A;  4C1X A;  1N1S A;  2VPV A;  1WCQ A;  3FLP A;  1OMI A;  2J22 A;  4QXH A;  2RS5 2;  1KS4 A;  5FZE A;  4CSW A;  1MVE A;  2J7M A;  5F5C A;  3NKT A;  1NZI A;  4HK8 A;  5EJZ B;  1RHI 1;  3BCW A;  2Y26 A;  5FZG A;  4NII A;  4DXS A;  4FBF A;  1IQA A;  4FTB A;  2RS3 1;  2HWC 3;  2PQQ A;  1T6G C;  1VBB 2;  2XHN A;  3PVN A;  3AZY A;  2RS1 2;  3UK9 A;  2C24 A;  2BGO A;  3UKV A;  1C28 A;  2VXR A;  4NVP A;  5EQU A;  2K0G A;  2R04 2;  4MVT A;  3I49 A;  3WF4 A;  2BZD A;  2A5Z A;  1HX6 A;  1ND3 C;  1E57 A;  1QOT A;  2YGM A;  4L11 A;  4Z1V A;  4LHK A;  1AYN 1;  1TMF 2;  4QHZ A;  1KJR A;  1HJF A;  1BVP 1;  3NJX A;  2JG8 A;  3V65 A;  3WLU A;  2Y6L A;  3HR9 A;  4XTM A;  2ZHK A;  3KGL A;  2B8M A;  3USU B;  4Q4Y 2;  3WZ1 A;  4COU A;  1JYW A;  4OVE A;  4IEV A;  1YC6 1;  4FPK A;  2RVA A;  1UN1 A;  4K8R B;  1SCR A;  2D6N A;  3SIT A;  4D6S A;  5JR2 A;  5KWR A;  1UX6 A;  3WG4 A;  4BDV B;  3ON7 A;  4UXA A;  4CXY A;  1CAW B;  2VAU A;  1XSR A;  4JKK A;  3PJY A;  3NNG A;  5I91 A;  4HFS A;  1DQ2 A;  2HBT A;  1SFN A;  3WQ7 A;  3M3E A;  4HMZ A;  2VMD A;  1H8V A;  3HNM A;  1V0A A;  4LKF A;  4MXW A;  1DGR N;  3RYP A;  3PUH A;  3T2T A;  4IV1 B;  5LA1 A;  3KSC A;  2ZX3 A;  5BUV A;  2W52 A;  3KT1 A;  2DU0 A;  4O65 A;  3VBR A;  4C0B A;  3LKJ A;  4QPW A;  4MGY E;  5C4W A;  1O3Q A;  2A70 A;  5FLI A;  1AX0 A;  1L7R A;  5DZE A;  3AZV A;  4I0A A;  1W2N A;  5FK7 A;  4EE2 A;  5L9V A;  1HW5 A;  3VKO A;  4MGS A;  3GZE A;  5LCW L;  1DF0 A;  3I2K A;  1WA6 X;  5FY7 A;  4UBH A;  1Y9G A;  1ZBE 2;  5CVR A;  3ABZ A;  3VZJ A;  3V56 A;  4ZS3 A;  5A6X A;  4LUK A;  5FLJ A;  5FY4 A;  1Q8S A;  1QGL A;  2ZGN A;  2BBA A;  2G9F A;  3ZSK A;  3ZXJ A;  1ZBA 1;  3NAP C;  2MEV 2;  2RMU 3;  2Y6J A;  4R4Z A;  2IXH A;  1YLL A;  4ARX A;  4ZKT B;  1PVC 3;  3TN9 2;  3LSD A;  5CZK A;  4QGN A;  3KLS A;  3OUH A;  3HMY A;  3SKV A;  1W39 A;  2P4E A;  3D82 A;  1W6M B;  2LW8 A;  3B00 A;  5FO7 B;  4BCU A;  4IUG A;  4K7J A;  5CNA A;  4B3N A;  2Z79 A;  3C8X A;  3WP6 A;  1STM A;  4PBP A;  1AF9 A;  1V6I A;  3DGT A;  5C3P A;  4TZD A;  1L7Q A;  1MS9 A;  5JSP A;  4XDP A;  5K0U C;  3OGR A;  4FPJ A;  4QX5 A;  5IK8 A;  1FOD 2;  3MPB A;  2F4P A;  3VBR C;  3TEY A;  5C4W C;  1PK6 B;  2Y64 A;  2JDZ A;  2QE3 A;  1ZZB A;  1XSQ A;  5DG2 A;  3USU A;  3AP9 A;  4QU1 A;  1WLC A;  4FOW A;  1OF3 A;  1Q8O A;  4HK9 A;  3ZM8 A;  4QU2 A;  2CU5 A;  1IQD C;  1W6O B;  1JYT A;  3GCX A;  2HKX A;  2WN2 A;  4FI9 A;  4YVS A;  4N90 A;  5BNQ A;  1APN A;  4AOC A;  2L9L A;  4OI0 A;  1LOG A;  2WZ8 A;  1B35 B;  5JZG B;  5FYY A;  2UYA A;  2W2I A;  1KDM A;  4H14 A;  5BNO A;  2ZEX A;  2ZKL A;  4XUO A;  4YM1 A;  1TNR A;  4BM8 A;  5FZ1 A;  5GZC A;  1OFS A;  3QCW A;  4XFC A;  4N9H A;  1D0H A;  1COV 3;  2Y38 A;  4Y1X A;  1DG6 A;  3UYJ A;  4DOU A;  1UKG A;  2OZ6 A;  1GNY A;  1EPZ A;  4AI8 A;  3VBO B;  3J8F 2;  4G9S B;  4CCC A;  3O0W A;  4AAX A;  3URF A;  2B42 B;  4GB3 2;  2WBK A;  3MLK A;  3I59 A;  2V5D A;  4MSV A;  4XC9 A;  4Y4Y A;  2YGL A;  1C57 A;  5DPN A;  4NIH A;  2JB4 A;  2V72 A;  4CPB A;  1VBA 3;  1BBT 1;  4EQV A;  2X29 A;  2WWU A;  2E53 A;  3QH6 A;  2R0H A;  5FZH A;  1LUL A;  3NNF A;  1JS9 A;  3CL1 A;  4XAB A;  2VR4 A;  2WS9 2;  3A7Q A;  4FT8 A;  4YW1 A;  4LE3 A;  3TB0 A;  4AED A;  1PZ8 A;  1RUG 1;  3OGS A;  4RD7 A;  2GN3 A;  4CUA A;  1CD3 G;  4Q0U A;  1WWY A;  1WBF A;  2QZ3 A;  2A6Y A;  2SLI A;  4LLF A;  1NG0 A;  1YI7 A;  4Q0S A;  3EB7 A;  3ME2 A;  4YVS C;  4XET A;  2V4A A;  5IFP A;  1UAI A;  4MV2 A;  1XNC A;  5JIU A;  4JVA A;  1J3R A;  3MV0 1;  4O9G A;  1D2S A;  1V70 A;  4BXS V;  5BNO C;  4PQQ A;  3MDP A;  4P02 B;  1PO2 2;  2IXJ A;  4XBL A;  4BWO A;  1UZY A;  2Y6F A;  3E6C C;  3AVR A;  2I07 B;  2PAM A;  1XC6 A;  2ZKN A;  4DUX A;  1QXJ A;  3POY A;  5ISL A;  2KM2 A;  4QQL A;  1NCR B;  1C8M 3;  5L7O A;  4GJY A;  4Z2W A;  2JE8 A;  2A73 B;  1VB2 A;  2JDU A;  2FZ2 A;  1W0P A;  2GME A;  4FP2 A;  3OEB A;  1DYP A;  4IND A;  4LBQ D;  1MVQ A;  4BLI A;  4FQ4 A;  1F2N A;  4WVV A;  5C3S A;  1W6O A;  4Y22 A;  1GQH A;  5DMY A;  1VRH 1;  4MGI E;  4YFZ A;  4LE4 A;  4S2D A;  5T55 A;  1SQ4 A;  1GZC A;  3IWZ A;  4GIQ A;  1B35 A;  1DQ5 A;  2XH6 A;  4D7S A;  2JX9 A;  1ENQ A;  1QH7 A;  5FZK A;  2ZAH A;  1BCX A;  1EY2 A;  5E8A A;  3OD4 A;  4XDQ A;  4IDZ A;  2EIB A;  4GUL A;  2GNB A;  4BLJ A;  2B9U A;  1TQ5 A;  1HB3 A;  2WNV B;  4QPG B;  3SCG A;  1QEX A;  4CDU A;  3FHA A;  2VQ0 A;  2P3J A;  3JBG 1;  1UO9 A;  4N8M A;  4UW6 A;  1HN1 A;  2VW2 A;  2WN3 A;  3MZH A;  4P9W A;  2XJQ A;  1SHW B;  3TEZ A;  5FZC A;  4LBO A;  1RUN A;  3FZ3 A;  5FWJ A;  2A6Z A;  3NV4 A;  3KB5 A;  2WT0 A;  4IET A;  1W05 A;  2Y0I A;  5FLH A;  5J7M A;  3BGA A;  3ZFG A;  3BU7 A;  3T2O A;  1HRI 2;  1A3K A;  3K3O A;  4YW4 A;  3HN1 A;  3LD8 A;  3OYW B;  3QLQ A;  1NQJ A;  3CJX A;  4P9I A;  2GAL A;  4HOO A;  1AYM 3;  4Y20 A;  2XWJ B;  4PF1 A;  3VKN A;  3CJI B;  1FV3 A;  1M4W A;  4TN7 A;  1WUV A;  1PMJ X;  1PZ9 A;  2VZS A;  2ZAC A;  2DUQ A;  2OUH A;  2DUR A;  4DEV A;  1OUX A;  5DN2 A;  4KGQ A;  5B4N A;  2R0F A;  3VZN A;  1UOJ A;  1M06 G;  2VMF A;  4QKD A;  4YVW C;  2PMW B;  3ZMO A;  1NCR A;  2WFF 2;  4ES9 A;  5KHK A;  1BYH A;  4EYU A;  4OHW A;  1OPM A;  5L19 A;  2Y33 A;  1CIY A;  1NLQ A;  4QWN A;  1LNS A;  5FZF A;  4XPV A;  2CDP A;  2YFZ A;  4RR3 C;  3H8O A;  1BMV 2;  4CDU C;  2VTX A;  1FPN 3;  1NCQ A;  1WKY A;  3MUZ 1;  4ASL A;  2BPA 2;  2ID4 A;  2D3S A;  2AEY A;  4RFR B;  1HB2 A;  4WM7 C;  3NL1 A;  3NV2 A;  4KWL A;  4QKB A;  1VMF A;  1D4M 3;  3E5Q A;  1AR6 1;  3CNA A;  1T6B X;  4N53 B;  4YW2 A;  3ZYP A;  4LLO A;  3ZFG C;  1S0E A;  5CEH A;  5E6H A;  1RJ7 A;  3ZMN A;  1QMJ A;  1ZYB A;  3NW4 A;  5JCT A;  2VW0 A;  3N9P A;  5H9S A;  3G7D A;  5JOZ A;  4RHV 1;  2FD8 A;  2VUC A;  4I01 A;  2WT1 A;  3FN9 A;  1EYB A;  3S30 A;  1WMF A;  4P08 A;  4W6W A;  1S2E A;  4EZ4 A;  3AXD A;  4GA9 A;  5I0T A;  2WNV A;  3VZL A;  4XFI A;  3WP5 A;  2NPI A;  2W1Q A;  2R07 1;  2WLP A;  3GJA A;  4YGC A;  2Q8C A;  4EN6 B;  3DXT A;  3HOB A;  4X8N A;  3ELN A;  2KXL A;  2ENR A;  5A3T A;  3ACL A;  4W8J A;  2HEW F;  5I0D A;  4CEW B;  2OQ7 A;  1W03 A;  1RGS A;  3L9J T;  3INA A;  1OLR A;  1QJX 1;  3O1V A;  1NXM A;  1UW8 A;  4HBN A;  3IDC B;  4NHL A;  1ULF A;  4C91 A;  4QAW A;  1R09 2;  1UNB A;  5CIR A;  5A80 A;  2V4V A;  1JU4 A;  1NCQ C;  2ATF A;  5LAS A;  2N7G A;  3LAG A;  1VAV A;  1OUR A;  1Y9Q A;  4ISQ A;  3B69 A;  3OYW A;  4LUL A;  1YEW A;  4XTP A;  5DDJ 1;  4BK4 A;  1RXF A;  1G6N A;  1I3H A;  4UYB A;  2WYS A;  3VBU A;  4Q0P A;  4Z07 A;  5KHH A;  4DXZ A;  3O14 A;  2ORZ A;  5F2W A;  1GAN A;  3LGR A;  1QQP 1;  3N3H A;  3S57 A;  3NNJ A;  2FMY A;  2VE1 A;  3O0V A;  4NUB A;  3T0B A;  3PNA A;  2BOI A;  1BK0 A;  2VZQ A;  3C7H A;  3ZN6 B;  2BNO A;  2RR1 2;  4XCA A;  1CAX A;  2RJK A;  2ZGU A;  3DKW A;  3O1P A;  5FBZ A;  1U0A A;  2BNN A;  2HWB 1;  4QGM A;  2CHH A;  4EV0 A;  2YU2 A;  3WXP A;  1F4H A;  5FJK A;  5B4X A;  3ZIW A;  4LOS A;  4BXF A;  3I2O A;  4GWI A;  4BQ1 A;  5LB6 A;  1K5M B;  2HWF 2;  2UWA A;  1MS0 A;  3JU9 A;  4BA6 A;  4YAR A;  2GC1 A;  4A7Z A;  1UY1 A;  1W3V A;  3LWC A;  4L2N A;  5LBF A;  1JHN A;  3I4I A;  3DUI A;  5FY8 A;  2VUL A;  3VKL A;  4B29 A;  1NUK A;  1W8T A;  3AMM A;  3J8F 1;  2ARC A;  3KF5 A;  3Q8E A;  4MLO A;  4A6O A;  4AQ2 A;  5T54 A;  1BLZ A;  5DAX A;  4EJR A;  4BB3 A;  3ZYG A;  1UX7 A;  3HIF A;  3CIH A;  1W8F A;  2W3J A;  4IEW A;  1JHJ A;  5BY5 A;  1I9R A;  2P17 A;  1I5Z A;  1QJF A;  3VKF C;  2XBO 1;  3UGG A;  1WW6 A;  3ILR A;  2RS5 3;  3LIG A;  3ZXE A;  2YPD A;  3MV1 1;  2BVB A;  1AXK A;  1FAY A;  3VBU C;  1H2L A;  4BMB A;  5BNP B;  2BGP A;  1UKR A;  4I0W B;  5F39 A;  2ARA A;  1BKZ A;  1AR7 1;  4DFS A;  4MGZ E;  2DUP A;  1VBB 3;  2W39 A;  4L9B A;  4LEJ A;  2RS1 3;  5KBF A;  1OD5 A;  1FX5 A;  5CKN A;  4QPI B;  2Q8D A;  3RZH A;  2R04 3;  4R4X A;  5DUV A;  2WZP P;  3BVC A;  2A3Y A;  3T30 A;  4XJ9 A;  3VKM A;  4K40 A;  1QJE A;  3V0B B;  2HYK A;  5IJR A;  1TMF 3;  2VZR A;  5JVV A;  4LIV A;  1BJQ A;  3JQW A;  4XFA A;  4P9J A;  2XL9 A;  2GC0 A;  2D43 A;  1SLI A;  1VP6 A;  1D7P M;  3MF6 A;  4Q4Y 3;  2XVG A;  2P3I A;  4UFI A;  4BQ3 A;  4QDR A;  2PLV 2;  4CXX A;  1RUD 1;  5HCB A;  5FUN A;  1A6C A;  2JDA A;  5A6Z A;  1VBA 2;  2XQX A;  1H8T B;  3RYR A;  4IXL A;  1JMU B;  4OHZ A;  2C5D A;  3AFG A;  1IKQ A;  3BPZ A;  4PLO A;  1UMZ A;  4PIZ A;  1R1A 2;  2OPW A;  4Y3O A;  1LAJ A;  4M01 A;  1O91 A;  3ZN6 A;  1DBN A;  3CF6 E;  1JYV A;  2HH9 A;  2RDS A;  5EHD A;  2VOX A;  1WA4 A;  3IMN A;  1ZZ7 A;  4MGK E;  1DGW A;  3AZZ A;  4NAO A;  4XJZ A;  5GM0 A;  1XXN A;  3MIG A;  1NA1 C;  5LWB A;  4QHO A;  4R9A A;  4IV3 B;  2X05 A;  3FX3 A;  3JQX A;  4M0H A;  3D0S A;  2EVX A;  3B02 A;  1RUJ 2;  3WP3 A;  1K5M A;  1HRV 2;  4Q29 A;  1V6M A;  5FZ8 A;  5A32 B;  2FMD A;  5F3I A;  3MIC A;  2W92 A;  4QX8 A;  2VBP A;  4AFC A;  3W20 A;  2XVK A;  3ZLI A;  3P1I A;  5BNN A;  2XJR A;  2P6C A;  1TNF A;  1ZBE 3;  2VCC A;  3SXW A;  1BK1 A;  5IVC A;  4I3P A;  1JI6 A;  3SLI A;  3ZFF A;  4DNY A;  1GWL A;  2ERF A;  2HEV F;  1MS8 A;  2PQS A;  2VZV A;  4ET7 A;  2MEV 3;  1JZ7 A;  5GZG A;  1ULC A;  3PJQ A;  3OEA A;  3RRD A;  3S0M A;  1UZV A;  1F5J A;  2W68 A;  1R64 A;  4LKE A;  3TN9 3;  2ZGL A;  4GJZ A;  3UL2 A;  1HQN A;  3KD4 A;  2EAK A;  1QJU 1;  4XZP A;  1ULP A;  1VBD 3;  2QQI A;  5DAV A;  1UIJ A;  4MAD A;  3ZYF A;  3ZPY A;  2CNA A;  3M70 A;  1C5I A;  1UU5 A;  3EBR A;  1RIN A;  1F8V A;  3RMX A;  1QJY 2;  4H3W A;  2R06 1;  4YZ5 A;  1ND2 B;  1SLL A;  3AL5 A;  3MHZ A;  4AI0 A;  1YJK A;  2GC3 A;  5IVJ A;  3RJ2 X;  1KDK A;  3AP4 A;  3ZSL A;  4B4Q A;  1MS5 A;  5LK5 A;  1W2O A;  1FOD 3;  2G9G A;  3ZFE C;  3FLR A;  3ZN5 A;  2ZMK A;  4IE7 A;  2DDU A;  1PGW 2;  5I93 A;  1O6U A;  3BIE A;  5FYV A;  3RG0 A;  2W91 A;  4XAA A;  1ST8 A;  5LBB A;  2VZ1 A;  4L97 A;  4NE9 A;  2HBU A;  4HPK B;  2DF7 A;  5FK8 A;  5ACA 2;  5K8S A;  4JV4 A;  4WM8 B;  3IKW A;  4XJW A;  5FZ3 A;  1A34 A;  5F37 A;  5BNN C;  3CDZ B;  3ZXG A;  3T1L A;  1H8T A;  2LRO A;  3RJR A;  2WWS A;  2D93 A;  2HWC 1;  4Q5O A;  3WF2 A;  1O8S A;  2WO1 A;  3GHM A;  1A8M A;  5CG8 A;  2CL2 A;  1C5H A;  2VOW A;  4ONU A;  2E7T A;  3USS A;  2VVE A;  2QBX A;  3RI9 A;  2CWS A;  3PL0 A;  4ASK A;  2VQA A;  4CP2 A;  1JBC A;  2PHR A;  3W21 A;  4XUR A;  3ASI A;  3VHO A;  1F9K A;  1HXS 2;  1HV0 A;  2D44 A;  4ORF A;  4YW5 A;  3CKH A;  2X53 S;  3ACI A;  3GGL A;  1HLC A;  3D5O A;  4YLZ A;  4GB3 3;  1PZ7 A;  3KS7 A;  4NRM A;  4A3X A;  1OPO A;  1NY7 2;  1MEC 2;  1AVB A;  2ZJC A;  4QPY A;  1UXZ A;  3T0A A;  4RS5 B;  3I3M A;  3GDB A;  4OZX A;  4H7L A;  4TSV A;  3C7O A;  3HQU A;  2QQJ A;  4CP9 A;  5C7G A;  2BWC A;  2WS9 3;  3SIS A;  1JYC A;  2XJS A;  1H2M A;  5ANN A;  5F3E A;  5JDB A;  1Q5O A;  2H0B A;  3NMB A;  2ZHN A;  3T09 A;  2EID A;  3K4A A;  2I45 A;  2RDN A;  4CDX A;  2B46 X;  2C4X A;  1JUH A;  2QNK A;  4JHT A;  4CDQ B;  4UAP A;  5KC5 A;  1JTZ X;  2EXH A;  1XE7 A;  1Z7S 2;  1QDO A;  3JD7 2;  4XFB A;  1U5Y A;  2QQW A;  1UYZ A;  2NLR A;  5JAX A;  2DBI A;  3VBS C;  2YYO A;  2OA2 A;  3SNM A;  3R05 A;  5C71 A;  1PO2 3;  2LRP A;  2Z69 A;  1ND2 A;  4PCR A;  2B7Y A;  3Q8C A;  2UY8 A;  1J58 A;  1XND A;  2I74 A;  1EUU A;  2IXK A;  1OVS A;  2W46 A;  2YC2 A;  3NVC A;  4QQP A;  5FYM A;  3T4V A;  4O7X A;  4WVM A;  1I5P A;  2W1U A;  2I2S A;  1OQD A;  5AFB A;  2XHK A;  3Q8B A;  5C8C B;  2J1E A;  4GH4 B;  1S0J A;  4NPR A;  2RMU 1;  4X8P A;  4ASM B;  3N36 A;  3QBQ A;  3ZOI A;  2FZ1 A;  1PVC 1;  1W06 A;  2WIN B;  3TNQ A;  1PO1 2;  3OSD A;  4U2A A;  3ZDV A;  1W9F A;  3PLQ A;  1H2N A;  1PMI A;  1V9U 3;  2A1X A;  4MO3 M;  2YDE A;  4B8E A;  2YUE A;  1CON A;  4IE5 A;  4UFK A;  2NN8 A;  4XFF A;  4YM2 A;  3WIN E;  3PMS A;  1SDW A;  3AVS A;  2C9A A;  2QVS B;  2NZ9 A;  3GXU A;  4PDW B;  4QB1 A;  5HCF A;  5EPA A;  1K42 A;  3SQO A;  1H6Y A;  2J1A A;  4CDX C;  2VW1 A;  3IDB B;  3ILF A;  1EAH 3;  2JD4 A;  5D1I A;  3VBF A;  5A7S A;  1VIW B;  5IW0 A;  4OCT A;  4AVS A;  4Q4W 2;  1GQP A;  4YZ1 A;  1MS4 A;  1ENR A;  1GYK A;  3BTA A;  1WLT A;  3WG1 A;  5AFE A;  2ZX1 A;  1JZ5 A;  4RS5 A;  2JDK A;  4YW7 A;  4LR4 A;  3I2J A;  1ZA7 A;  3D3A A;  5A7W A;  3ZKY A;  1WW5 A;  1FNZ A;  4IQP A;  4XQD A;  3NJY A;  4BQ4 A;  4NID A;  2HYX A;  3JZV A;  4DPN A;  5CFD C;  4RFT 0;  2ZZJ A;  3OJB A;  5JIA A;  2ARX A;  1JN2 P;  4AGR A;  2O1Q A;  4PLN A;  1HQW A;  3ETQ A;  4IW3 A;  3ROU A;  3ZXD A;  4PLM A;  1HRI 3;  4KU8 A;  1FV2 A;  5IAV A;  2VVD A;  2DVD A;  4ZU7 A;  1COV 1;  3O1U A;  1IS5 A;  3M1H A;  4AHY A;  3ZXL A;  5M0T A;  4DS0 A;  5CA6 A;  4OQ8 A;  1TME 3;  5H9Q A;  1W6P A;  3B9I A;  1BVV A;  3VN4 A;  4PJY A;  3H9A A;  4LIU A;  5FAX A;  3VBH C;  3VUO A;  5FY1 A;  1VBA 1;  3K51 A;  4E2S A;  3S6P A;  1WCD J;  2WFF 3;  2AAC A;  3SCF A;  1VBC 2;  5CFC B;  1C8N A;  1RYY A;  4ZS2 A;  5GAL A;  1YQC A;  2IXC A;  4HAN A;  4XIK A;  3ZXF A;  4P9X A;  1JYI A;  3VBF C;  3C2U A;  1RL3 A;  4OI4 A;  4GH4 A;  5C8C A;  1PNF A;  1XRU A;  2YB7 A;  3T1M A;  5FRA A;  1XPW A;  4Y1Y A;  1YJL A;  5IVF A;  4R9D A;  4CEY A;  2XVL A;  4JHZ A;  1U5X A;  1NT0 A;  5H9P A;  3PVE A;  5L36 A;  4WV8 A;  2XQR A;  3VZK A;  3BPS A;  3CBN A;  4LHN A;  4FPL A;  2IC1 A;  4FXK B;  1YCI A;  4DRV A;  3MF9 A;  2YY1 A;  3H3L A;  4NRQ A;  1AUY A;  4PDW A;  4MG2 A;  4KBZ A;  2CV6 A;  3WW1 A;  4QX2 A;  1C8M 1;  1HKD A;  1NXD 1;  1X50 A;  1UMH A;  3AP5 A;  4XZU G;  1US2 A;  3GHN A;  4AL9 A;  1DZQ A;  2RDQ A;  2Y6K A;  4M3C B;  4Y5Z 0;  3ZN4 A;  5CAZ A;  1V00 A;  3KVB A;  1GP4 A;  4UF0 B;  1LOC A;  4KNC A;  4YZ4 A;  2VOT A;  4AFD A;  2VL4 A;  3LF7 A;  5FYB A;  4FAG A;  4QT6 A;  3EYP A;  4LA2 A;  5FRE A;  4Z8B A;  5DQ0 A;  3AZW A;  2XJT A;  4R8H A;  5FKB A;  3ATG A;  5LW9 A;  2BQP A;  2J1V A;  4AI2 A;  5F6L B;  1LHW A;  1CES A;  3RZL A;  1XNT A;  2QQM A;  3B01 A;  5A33 B;  4RQP A;  4CCM A;  1R09 3;  1N3O A;  4ZHN A;  1CZS A;  3ENR A;  4FPG A;  1OBN A;  4W6Y A;  4CEY C;  4IGP A;  1O59 A;  4AVT A;  4CUC A;  1R08 2;  5L9B A;  2WJS A;  3AL6 A;  1G8W A;  4YW3 A;  1J84 A;  4A7K A;  1G9F A;  4URA A;  5KHJ A;  1NYW A;  2W47 A;  3E5U A;  3OBA A;  2ZPX A;  1CPM A;  1W6Q B;  1H4G A;  5FZ6 A;  3DPR B;  1UY3 A;  2E9Q A;  3MUY 1;  3R4D B;  4IGO A;  3DEC A;  2RR1 3;  2JG8 C;  5J96 B;  1K3I A;  1PX3 A;  2O0O A;  2A3X A;  4P00 B;  4D69 A;  5CFC A;  1FMD 2;  1VRB A;  1YFU A;  2P6H A;  4M3C E;  4Q4X 3;  3I2D A;  5A6Q A;  1LGC A;  3H0O A;  2A6X A;  1OH3 A;  4LO5 B;  4QKF A;  1VBD 2;  2HWF 3;  2PHW A;  1J1L A;  1W8N A;  2JEN A;  3U37 A;  2GP5 A;  3U0Z A;  1XBF A;  3POJ A;  2EF6 A;  1N1V A;  3SKJ E;  4HN1 A;  4KWU A;  1OOP B;  1ASJ 2;  4IE0 A;  4QGL A;  3S7E A;  5JXJ A;  3W5M A;  1S4C A;  1AYM 1;  5JOX A;  5FIX A;  2R1D A;  2XOM A;  1XYP A;  3S7I A;  1VE0 A;  3WOG A;  1SLB A;  4ZON A;  3FHQ A;  3R6S A;  4D6R A;  4RQP C;  2D40 A;  3IM0 A;  4RL7 A;  3V64 A;  2X8K A;  1GV9 A;  2J1T A;  2WRA A;  1GWM A;  1VBE 2;  2ZHM A;  4M3C A;  1VMJ A;  3F2Z A;  1RUF 3;  4E8D A;  4IE4 A;  3UV9 A;  3N7K A;  1TE1 B;  3PIJ A;  4UWD A;  1W9S A;  2YFU A;  4HKO A;  5JR7 B;  4DB5 A;  2V5Y A;  3NO8 A;  1FPN 1;  4QXC A;  4UW3 A;  1CAW A;  4JC1 A;  3PIG A;  4KWJ A;  3VB9 A;  4YSF A;  1G9B A;  3U14 A;  2AEZ A;  4IE6 A;  4QX7 A;  1DYK A;  4MOA A;  4F83 A;  1D4M 1;  1L3J A;  1MQT B;  4OUS A;  4OHY A;  4IV1 A;  4Q0V A;  3C3V A;  2O8O A;  4B7K A;  2NM1 A;  3AKQ A;  4LNV A;  5A33 A;  4E4D X;  1DGL A;  1OLM E;  2NQY A;  5T52 A;  3RYK A;  1WME A;  3K77 A;  1W28 A;  5DAQ A;  1HQL A;  5KXD A;  2PLV 3;  2Q30 A;  3WP4 A;  2ZBJ A;  2DVF A;  3HT1 A;  5K9Y A;  1W2U A;  1W8O A;  4B1L A;  4XXA A;  3BOW A;  4FOY A;  5FDB A;  3AK0 A;  4Q1P A;  3DPR A;  4UI9 L;  3SH5 A;  1R1A 3;  4Q4V 2;  5F5Q A;  1B09 A;  2DCY A;  1AXY A;  2XG3 A;  2WAB A;  4Q8L A;  2QFE A;  5HXM A;  4Z82 A;  5FY0 A;  3AMN A;  3THD A;  2XJV A;  1O3T A;  5T5J A;  1H1I A;  1AL2 3;  5FZ0 A;  2A6V A;  3PME A;  3BIW E;  2O14 A;  1IS4 A;  1RUJ 3;  4N9I A;  1HRV 3;  1W6M A;  5GLU A;  1JOP A;  4MYE A;  1OLM A;  2AYH A;  4WZC A;  1DFQ A;  2VQU A;  4LXL A;  3VGI A;  1V6L A;  3MIF A;  4YM3 A;  4AXO A;  4BME A;  1EUT A;  2ZAA A;  4JZR A;  2ADE A;  2PHU A;  2LAL A;  3OB8 A;  5F3C A;  5A3M A;  4LHS A;  1IHM A;  3GZA A;  2NMO A;  3N9L A;  4IV1 C;  3WR0 A;  4CU6 A;  3HBK A;  4C8D A;  1UOF A;  4LO6 B;  3WUC A;  1PK6 A;  3C7G A;  2B9V A;  1FYU A;  3NNM A;  5K4L A;  2OW4 A;  1YQ5 A;  4N7U A;  3WCS A;  3MIB A;  5JSO A;  3J4U H;  3MW3 A;  2MPF A;  4HVR A;  1KQR A;  1F35 A;  5FYH A;  4DY3 A;  2QQU A;  2PN5 A;  3F95 A;  1K12 A;  3RSJ A;  4AEK A;  1AYN 3;  1V9U 2;  4JQR A;  2ZGR A;  4AED C;  2VMI A;  4BIO A;  4E4Z A;  5IVB A;  5JZG A;  4DMI A;  3EMR A;  3S5A A;  1QJY 3;  2D3R A;  4XMI A;  2W1S A;  4OUE A;  3SMH A;  1MQT A;  4H7M A;  3TYJ A;  4G3Y C;  1UU6 A;  5JPM B;  2YZ4 A;  1D4V B;  1EAH 2;  5EYY A;  3FC0 A;  1GZ9 A;  1QXR A;  4BJ0 A;  3VBO A;  4C90 A;  5C3Q A;  5ACA 3;  2FDG A;  1VR3 A;  4HKL A;  4FVV A;  4JTO A;  2HWD 2;  4KI5 M;  2RS5 1;  2HLE A;  2BP6 A;  2WSU A;  2JIJ A;  4XUQ A;  4FPO B;  2RJL A;  3WDY A;  1H1A A;  5L7O C;  5E88 A;  4FTE A;  3THT A;  2QJV A;  3PUR A;  1QH6 A;  1VBB 1;  2VUJ A;  3OOX A;  5FOJ B;  3BTY A;  1ZZ8 A;  3I97 A;  2RS1 1;  1PK6 C;  1A8D A;  2QCS B;  3EJK A;  3HWJ A;  1QNW A;  5EIY B;  2XML A;  3WHT A;  2GAU A;  1POV 3;  2R04 1;  2GZW A;  4HLT A;  3ZXK A;  1QHD A;  2PA7 A;  2P37 A;  3B94 A;  4QB2 A;  5F1R A;  1W9W A;  5IK7 A;  3CU7 A;  5F2S A;  1HXS 3;  3DN7 A;  4XJU A;  2VD7 A;  1TMF 1;  3JCI A;  4BPZ A;  5LRR A;  5FPL A;  2DTW A;  4JGY B;  4BK5 A;  4D6Q A;  3I7D A;  4XF9 A;  3R4S A;  4NRP A;  1B35 C;  5JZG C;  2D98 A;  1J3P A;  1MZ5 A;  4A2U A;  5CBL A;  5L9R A;  1ZZ6 A;  4Q4Y 1;  1TME 2;  5AVA A;  1YXW A;  3X29 B;  5FP8 A;  1MEC 3;  1Q56 A;  1SLT A;  2TEP A;  5FBJ A;  1X8E A;  4BE3 A;  2F4L A;  4I09 A;  1ONA A;  4EN8 B;  4F3J A;  4AI9 A;  5FP3 A;  4JDO A;  1SPP B;  3HQR A;  3P3N A;  4RGA A;  4L8Q A;  1QU0 A;  2WNU B;  5FQ0 B;  2PTM A;  5C9A B;  3VBO C;  3T2P A;  2FDJ A;  1US3 A;  4CCO A;  4B7E A;  3WDX A;  3WCR A;  2QQK A;  5BXX A;  3IMM A;  1O3S A;  1LJ7 A;  2DV9 A;  1BEV 3;  3DCQ A;  3SC7 X;  5FP9 A;  2AH2 A;  3OPZ A;  5A6Y A;  1MZ6 A;  3JD7 3;  1Z7S 3;  1SAC A;  2VH9 A;  3WF0 A;  3IN9 A;  1UD1 A;  2OX0 A;  4LKS A;  4QM8 A;  3A21 A;  1S55 A;  4UW5 A;  2RG4 A;  4AF9 A;  2QKD A;  1DGR A;  4J1W A;  3W9A A;  3LEI A;  3IPV B;  3VDA A;  1RVF 2;  1ZBE 1;  5EYX A;  3RI8 A;  1YIP A;  4K8F A;  1DLC A;  3WW4 A;  1AR8 2;  1F31 A;  1UIK A;  2YC4 A;  4JRA A;  3D6E A;  3SH3 A;  4JX0 A;  3M4F A;  1ZZ9 A;  4QPG A;  2TBV A;  2MEV 1;  1KJL A;  2W94 A;  1QY4 A;  4XAE A;  5A1F A;  3WDW A;  1O4T A;  4ZXK A;  5FPZ A;  4IEY A;  2EIG A;  1O4Y A;  1RC6 A;  3TN9 1;  1PGL 2;  1PO1 3;  1EV1 2;  2VGD A;  2JEC A;  2XB6 C;  3LA3 A;  1NCR C;  5BPX A;  2HWE 2;  1RUI 2;  1LRH A;  1RMU 3;  3ACH A;  3NJV A;  4WVW A;  4JDN A;  4MHU A;  1QIQ A;  2PHT A;  3WUD A;  1OUS A;  4FPE A;  2FQP A;  2IXI A;  3AYD A;  1MZF A;  4LIT A;  5FZ7 A;  5C5U A;  2DCK A;  2LTN A;  1JOB A;  4TLF A;  3KM5 A;  1NA1 B;  2WO2 A;  4LPL A;  3KZ4 C;  2E63 A;  1DIW A;  2BW8 A;  3ZIX A;  4D7Y A;  4NAM A;  2G19 A;  3WNN A;  1FOD 1;  3UET A;  1GP6 A;  2WZE A;  4QDQ A;  4FPH A;  2VMH A;  3M3Q A;  2B39 A;  4FQZ A;  3CJI A;  2YRO A;  3FBY A;  4Q4W 3;  1JH5 A;  1WBL A;  5APA A;  1ODM A;  4AFA A;  2DVB A;  5F5A A;  2GP3 A;  3WF1 A;  2WZR 2;  5DUW A;  4AQ6 A;  1OXC A;  1VAK A;  2DVG A;  4OUM A;  5I8S A;  4B4P A;  1ZA4 A;  3FFZ A;  2F17 A;  5FYU A;  5ABJ B;  5IHR A;  4Q4X 2;  1H9W A;  2G1M A;  2JDM A;  2WNU A;  3H1Y A;  1ALY A;  4X6R B;  1VJ2 A;  2WNV C;  3P5B A;  1EP0 A;  2DTY A;  4QPG C;  4W4Z A;  1LES A;  5HV4 A;  1KIT A;  1MZE A;  2GNM A;  1UYY A;  1RUE 2;  2YV8 A;  3ETP A;  5FR3 A;  2Z5W A;  1UCX A;  2WR9 A;  5I8T A;  3KF3 A;  4K21 A;  5T50 A;  4BQ5 A;  2LS6 A;  1F4A A;  1WLW A;  4LK6 A;  1MAC A;  5D2A A;  4CA9 A;  1RUC 2;  4GB3 1;  1OD3 A;  4N53 A;  5T3N A;  3ZYJ B;  5LY1 A;  3RQ0 A;  2RV9 A;  2H6C A;  3G6J B;  3OUI A;  5HBA A;  3WNL A;  3J7H A;  1FI2 A;  4UFH A;  1VBC 3;  3T2Q A;  2D7F A;  5BYN A;  2WS9 1;  3GYD A;  4LBQ B;  1RUF 2;  1S0D A;  3W58 A;  2QUO A;  4CDW B;  3CJI C;  3HJR A;  1PM4 A;  2H0V A;  1FT9 A;  3POG A;  1YWK A;  2JE7 A;  1Y9M A;  2IXL A;  2WLQ A;  1LHN A;  3MPP G;  2AZ5 A;  4QQ2 A;  2WDB A;  4HXC A;  4LHL A;  4CEW A;  5F7U A;  2RM2 3;  2ZGS A;  3KV6 A;  5FXV A;  4LO8 A;  3UT0 A;  1DQ0 A;  5E89 A;  4AI1 A;  2VTF A;  1VLN A;  4I0B A;  1X9P A;  1ZRE A;  3GBW A;  1PO2 1;  1UZ0 A;  3J9S A;  1OT5 A;  1W8W A;  1PIV 3;  3V0A A;  2UU8 A;  3C7F A;  2ZEZ A;  3DYM A;  3Q8A A;  4A42 A;  5C3O A;  2XLA A;  3WG2 A;  3DYO A;  2WAO A;  2J1S A;  2K46 A;  1HB4 A;  3DYP A;  3T3Y A;  2FHR A;  1OLQ A;  4Q26 A;  1GSL A;  5KXE A;  2WQ8 A;  3AMH A;  3ORJ A;  2GMM A;  4KL1 A;  1AHS A;  4N53 C;  3POS A;  2R30 A;  4QMA A;  1IG3 A;  1X7N A;  1PMH X;  2ILM A;  3RZZ A;  1VMH A;  4Y5T A;  3VZM A;  2OYZ A;  2QQO A;  3OY8 B;  4JKM A;  3T08 A;  5ABJ A;  4HL0 A;  3K3N A;  2YHJ A;  1V9U 1;  4YW6 A;  5KC6 A;  2BBV A;  1G9D A;  1UU4 A;  1OFN A;  4BIS A;  1AL2 2;  3OBZ A;  3LEM A;  2W1W A;  2VCB A;  1XB9 A;  4XEZ A;  5F8P A;  1LKN A;  3WVJ A;  4RN5 A;  1H1M A;  4DIQ A;  3KVA A;  1WD4 A;  3FLT A;  1YQ6 A;  2CWM A;  5C5T A;  5CU1 A;  1HDK A;  1OKO A;  3W5N A;  4CEW C;  1R08 3;  4XF0 A;  2OPK A;  3DV8 A;  1D0G A;  3KWV A;  4OFG A;  4QHB A;  3S5Q A;  4DIN B;  4XUN A;  3VDD B;  1GR3 A;  1R1Z A;  1AR9 3;  1LGN A;  1RHI 2;  2OVU A;  2P3K A;  2Y6G A;  4LO4 B;  2G9Z A;  5D8A B;  2X5I B;  4FCA A;  1Z0H A;  3OCP A;  3III A;  4EN0 A;  2CGN A;  3AZX A;  2XJP A;  2ZX4 A;  3LFM A;  3RDI A;  5A7O A;  1ULE A;  1JYN A;  1N3Q A;  1FMD 3;  1W8H A;  2V09 A;  3K75 B;  3OGJ A;  4NPL A;  5FPB A;  3LDB A;  3Q9O A;  1O5L A;  1UY4 A;  4R52 A;  5TSW A;  4AEJ A;  1GQG A;  4CUB A;  4LOT A;  3I3D A;  2JKB A;  4Q27 A;  1FXZ A;  1SMV A;  2CAV A;  4HG6 B;  5BNP A;  4GMP 3;  3WX5 A;  3RZM A;  1AYN 2;  1ZRR A;  4HZF A;  5LEK A;  1HRI 1;  1GLH A;  4XF4 A;  1E5H A;  5EWS A;  1ASJ 3;  3TOJ A;  4CCJ A;  2DFB A;  4QPI A;  4W50 A;  1QXP A;  4JGZ B;  3MBW A;  3E6B A;  4UBG A;  3LPG A;  4L99 A;  4OLL A;  5FFO C;  5KHI A;  1GZT A;  1NX9 A;  2EIE A;  3AFK A;  1XU1 A;  3J7M A;  3M3O A;  3TRS B;  1G86 A;  1Y43 B;  1G9C A;  1TME 1;  3V0B A;  2AGS A;  3O1S A;  2BJS A;  2C6S A;  2WA4 A;  3A22 A;  3LPF A;  1K5M C;  1OA3 A;  3DEM A;  5LZ6 A;  3MW2 A;  1GZW B;  3BB6 A;  4BU2 A;  3GBG A;  1BQP A;  1VBE 3;  2WFF 1;  3A0N A;  4DUV A;  2WT2 A;  3ZO0 B;  3H8X A;  2BFU S;  4N43 B;  2BFU L;  3GZU C;  3M3I A;  5FY9 A;  3WNK A;  4BYY A;  2ZGM A;  3C7E A;  1W0N A;  1GNZ A;  1UOB A;  3K4D A;  3OBR A;  4S2H A;  3KV9 A;  2DFC A;  1BMV 1;  1YUD A;  3MIE A;  3KCX A;  3ZFF C;  3VD9 A;  2GH8 A;  4YNI A;  4SLI A;  1X82 A;  2XJU A;  4UOJ A;  5FY5 A;  2D5H A;  4K3U A;  4P9G A;  3IDA A;  2WKK A;  5FTT C;  1D2Q A;  5IWF A;  4QDS A;  4AVC A;  1JZ4 A;  4Y5S A;  2CTV A;  5A3N A;  2QDN A;  4XAC A;  3O12 A;  4M4P A;  4IV3 A;  4IEX A;  2JG9 B;  1GMM A;  1CAV B;  1POV 0;  4O9E A;  4WVZ A;  5BNP C;  2IFW A;  5SV5 A;  4KBB A;  2A6W A;  3D0J A;  5A32 A;  4RGG A;  1ZBA 2;  2EIC A;  3I2I A;  3IAQ A;  1IPS A;  3AP6 A;  3LCP A;  4QPI C;  4V2W A;  4IL7 A;  4A41 A;  1N1T A;  5I0S A;  1YHF A;  5GLV A;  5HXV A;  2E31 A;  2BGC A;  2TUN A;  4M00 A;  3ZYH A;  1REE A;  1JOD A;  4Q4V 3;  5JLV A;  2QDR A;  3KQR A;  2PHF A;  2XPJ A;  1XYO A;  4XXP A;  4ZU4 A;  1TVG A;  2A7A A;  3O1T A;  2CGP A;  2UYB A;  1URX A;  1W0O A;  1UYP A;  5EXO A;  4CU7 A;  4D3W A;  1YNA A;  4P5Y A;  3WQ0 A;  1ZNP A;  1BEV 2;  5FMO S;  1WD3 A;  5DAP A;  4L0P A;  2JKX A;  1H8T C;  3WY6 A;  5J37 A;  1WGP A;  1R09 1;  2WII B;  2CGO A;  3NWK A;  5J36 A;  2WYF A;  3DL3 A;  3VD5 A;  2GMP A;  4HON A;  5KXB A;  4XOG A;  5FZO B;  4JGZ A;  4C0H A;  2YBS A;  4CCN A;  1ND3 B;  4X6Q B;  4DY5 A;  1JZ8 A;  4IV3 C;  5AC9 3;  3BTX A;  3IAP A;  2JE9 A;  2UWC A;  2DBN A;  4I3G A;  2WC2 A;  4AVA A;  3VL8 A;  3MLL A;  3LEK A;  1XOY A;  2RR1 1;  3ECQ A;  4HPK A;  5I8Y A;  1YI9 A;  1DU3 D;  4HET A;  4WM8 A;  4ITC A;  4P9L A;  4Q4X 1;  4XW3 A;  3BI3 A;  1PHM A;  5FXZ A;  2ZGK A;  2VNV A;  2ZHL A;  4A6S A;  5KXC A;  5JUV A;  2YPJ A;  1Z78 A;  1CR7 A;  3MID A;  4ERO A;  5LBE A;  2OZJ A;  2HWF 1;  1RMU 2;  3AKT A;  5GKA C;  3FL7 A;  1XQN A;  3N9N A;  4CYD A;  4U36 A;  2Y34 A;  1RUH 3;  1LTE A;  2E6V A;  3GJB A;  1HIX A;  3H8U A;  4COV A;  4K20 A;  5B2G B;  4D94 A;  1WCK A;  2RE9 A;  1BBT 2;  1WMX A;  2BER A;  2D5F A;  4HSL A;  1CAV A;  1NE4 A;  2QTW B;  4QD2 A;  2VG9 A;  1LEN A;  4BQ2 A;  1RUG 2;  4KH9 A;  3ZSJ A;  2J1R A;  2HWD 3;  3LSE A;  4G4F A;  4CP1 A;  5LBC A;  4F7Z A;  1DP0 A;  1ND2 C;  2EA7 A;  2Z42 A;  3B3Q E;  1AZD A;  4PIY A;  5JI9 A;  3N9O A;  1RUF 1;  4DUW A;  4BHP A;  5FPV A;  4L92 A;  2EAL A;  5JMC A;  2GH2 A;  4DZG A;  1W90 A;  4HVQ A;  1JW6 A;  4OQ9 A;  1YQ2 A;  2FCT A;  4LBM A;  1G9A A;  1RXG A;  2JG8 B;  4MXV A;  3NAP B;  5T5P A;  4BIF A;  1J3Q A;  1UL9 A;  2VNG A;  4AFM A;  4FP3 A;  1RTV A;  2NMN A;  4IEO A;  4WM8 C;  3U11 A;  4ATF A;  5FMC A;  2OXB A;  3DXU A;  1IS6 A;  5IVE A;  1YFX A;  2W95 A;  1LHU A;  1U12 A;  1W8U A;  3RGB A;  2ZEW A;  1LED A;  1JU3 A;  4CDQ A;  2XXZ A;  2OT7 A;  1DHK B;  1UWW A;  5LY2 A;  4FFH A;  1CX4 A;  5D21 A;  1C3H A;  3TNP B;  4CCL A;  2JDP A;  2J1U A;  2VMC A;  4URT A;  4XCB A;  1C1F A;  3J7L A;  3LE0 A;  4A44 A;  3M7A A;  4CTE A;  1QNY A;  2PLV 1;  2ADD A;  2R49 A;  5FZO A;  4C1W A;  5J1X A;  4XE9 A;  2ZMN A;  3OGV A;  4AQS A;  1OVP A;  5K0U B;  3PTY A;  1DLL A;  4IEP A;  3VBR B;  4AHX A;  1VRH 2;  5FZ9 A;  1R1A 1;  5C4W B;  3SEP A;  1NOV A;  3JXS A;  4PT6 A;  4OUL A;  3TAY A;  5FV3 A;  1NAE A;  2VU9 A;  4FOV A;  5GLW A;  1S0C A;  2J42 A;  3K4Z A;  1GBG A;  4IEZ A;  1AL2 1;  4NJ4 A;  1KGY A;  4NN0 A;  1YYN A;  4RS5 C;  1MS1 A;  1PX4 A;  4LUM A;  1RUJ 1;  2RM2 2;  4XMA A;  2Q1Z B;  1HRV 1;  3OTF A;  3LQC A;  4HN0 A;  3TEX A;  5FZ4 A;  3QH7 A;  4I02 A;  3WNO A;  3UKN A;  2JDY A;  4J6G A; 
#chains in the Genus database with same CATH homology
 5DAB A;  4NPM A;  4ZHN A;  3I3Q A;  3S57 A;  4IE5 A;  4IDZ A;  5F8P A;  3O1P A;  2FDK A;  3RZK A;  3BTX A;  2FDF A;  3KHC A;  3I2O A;  3BUC A;  4OCT A;  4O61 A;  3BI3 A;  4IE7 A;  3S5A A;  4QKF A;  3BIE A;  4NIG A;  3LFM A;  4NID A;  3RZG A;  4NPL A;  3O1R A;  4NII A;  4IE0 A;  3T4H B;  2FDG A;  4MGT A;  3RZM A;  3O1U A;  4QKD A;  3I49 A;  3O1M A;  3BTY A;  4NIH A;  3O1S A;  4IE4 A;  3RZH A;  3H8O A;  2IUW A;  4ZS2 A;  4NRM A;  4RFR B;  3H8X A;  3KHB A;  3H8R A;  3I3M A;  2FDI A;  4QKB A;  4IE6 A;  4CXW A;  4NRP A;  4QKN A;  4NRO A;  4CXY A;  4CXX A;  2FD8 A;  4JHT A;  4NRQ A;  2FDJ A;  4MG2 A;  2FDH A;  4QHO A;  3O1O A;  3RZJ A;  4ZS3 A;  3O1V A;  3T4V A;  4O7X A;  4NJ4 A;  3T3Y A;  3BKZ A;  3BU0 A;  3BTZ A;  3O1T A;  3RZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...