2FDJA

Crystal structure of alkb in complex with fe(ii) and succinate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
207
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 49
structure length 207
sequence length 207
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdjA00
4MGTA 4O61A 3KHBA 4QKNA 2FDHA 4MG2A 4CXYA 4NPLA 4NPMA 2FDGA 3BU0A 4IE6A 3T4VA 3O1UA 3I2OA 3H8RA 3BTXA 3I3MA 3O1TA 4IE5A 4QKFA 4NRQA 4QHOA 5F8PA 4IE4A 4OCTA 4CXWA 3BTZA 3RZHA 4NIGA 5DABA 3O1VA 4IDZA 2FDIA 3KHCA 4ZS2A 3I3QA 3RZJA 3BKZA 3O1MA 3O1SA 3T4HB 4NIIA 3RZMA 3O1RA 4IE7A 4NIHA 2FDJA 4NJ4A 4CXXA 4NRMA 2IUWA 4NROA 3BUCA 3RZGA 2FDKA 4O7XA 3O1OA 3S57A 4QKDA 3BI3A 3RZLA 4ZHNA 2FD8A 3H8OA 4QKBA 3T3YA 3BTYA 3BIEA 3I49A 3RZKA 4IE0A 3O1PA 4JHTA 4ZS3A 3LFMA 2FDFA 4NIDA 3H8XA 3S5AA 4RFRB 4NRPA
chains in the Genus database with same CATH superfamily
4O9GA 4Q8LA 5FAXA 4A45A 4IERA 1UY3A 4YPJA 1XE8A 1RXFA 4Y26A 2RR12 4UFKA 1M06G 2HEYF 1XE7A 2JG8B 4BB3A 2JG9B 1FNZA 2ES3A 1CZSA 4HK9A 4L0PA 1YRZA 2J7MA 4XAAA 1JZ6A 5FRAA 4P9GA 4Y1UA 4HPKA 2BEOA 1AR81 3H0OA 3SH5A 5F5AA 1L7LA 1DLLA 3WNXA 2X29A 3WNMA 1A6CA 1WD4A 3HQXA 2BDRA 3U75A 5FZAA 2UYBA 1PMIA 3LKJA 3W5MA 3O14A 5FDBA 3ZFFA 3MF6A 1OA2A 5FMBA 2OX0A 4UFJA 1SCSA 1S0EA 4YZ1A 2Y6HA 4AVBA 1VAMA 1LNSA 3I7DA 4G3YC 5HCFA 2KM2A 4BQ5A 4EWEA 4ZZ8A 3I2OA 1YIPA 4A7KA 5HCBA 4UFMA 4AFAA 2VZOA 1SEFA 5EP9A 1W6MA 1XYOA 5GLWA 3E1F1 2ZJCA 5A3LA 3V64A 1UY2A 2CWSA 2VXRA 1AX0A 1HDKA 1UOGA 1XU1A 4FPCA 2V73A 2PHTA 3PVNA 1XNCA 4RHV3 2PYTA 4RQPB 5C9AC 4JHZA 5IATA 4XJWA 3N9PA 5LA1A 4MH0E 3EO6A 5DAXA 3A23A 5KHHA 3OGGA 3FMGA 3ZSEA 4WVZA 3QH6A 3POJA 3POFA 1K45A 3DYOA 1LOFA 4O65A 3ZYJB 4FT8A 5B4XA 5T5OA 1UOJA 2WYFA 3NMBA 3VKFC 1J1LA 3T0AA 1MS0A 3VV1A 5CU1A 2B45X 3LQCA 2CSGA 2GN7A 3ACIA 4Q4V1 4HONA 3BGAA 1S2EA 3WDWA 3WT3A 2E33A 3PVEA 3MICA 3VDDB 3VKLA 1GANA 1QDOA 1UZWA 3ZSMA 3QACA 1X7NA 2Q8OA 3WNOA 1GZWA 1H1MA 5IK8A 4HZFA 1LAJA 5BYNA 1VBE3 1HX6A 5JR7B 4H14A 1LGBA 1TZOA 1BEV2 2TNFA 4I0WB 2XKOA 5FYSA 1W8HA 5KHKA 1CX1A 2JECA 4FFHA 2Z5WA 5C3SA 5A7PA 4HVRA 4DUWA 2DUPA 3SITA 3BI3A 2RS51 2B39A 2IWGB 1HN0A 1XNBA 4ZPIA 5FY9A 3VUOA 4D0QA 5FYZA 1AYM2 2A6YA 3IN9A 3KT7A 4KWLA 2XJRA 2J1SA 4NHYA 1C5IA 5A1FA 5K0UC 1QQP1 3ILNA 5FO9B 1VBC3 3VBOA 4AK3A 1EV11 1UAIA 4QAWA 2RDRA 1OT5A 5E8AA 3ZFEA 1W6QB 4R4XA 3ZM8A 1DZRA 4COVA 1LEDA 4OMDA 3VD3A 4HK8A 1ODNA 3FC0A 2OVUA 4CTEA 4U36A 1FPN2 3VKNA 1DHKB 4GD4A 4IEVA 3S5AA 2J1RA 4XUTA 3VKMA 1DG6A 2W68A 2R042 2J1AA 2VMFA 1NA1A 4HANA 3Q8AA 4B4QA 3H1WA 2UY9A 5FZFA 5HCHA 1X9TA 4YARA 4P9WA 5J96B 2BZDA 3I2JA 2RS11 3UT0A 4NVPA 1KS4A 4OHXA 4KNCA 2VOWA 3NRUA 1UU6A 2EXIA 3ETQA 4XIKA 1HV0A 3OJBA 5FXVA 3V65A 1C8M2 4K20A 1TME1 1HLCA 3A21A 2RM22 3GYDA 4KGQA 4AVTA 2DTWA 5GLVA 1UZVA 5CFDC 1ZX5A 2ZPXA 4DRRA 4GH4A 4M0NA 3K46A 4OI4A 5DUVA 1OKQA 2GC1A 5F5IA 3TAYA 4EROA 3TOJA 3GHNA 4W50A 2PAEA 3NQHA 4K3UA 3UL2A 1C28A 1R1ZA 4Z07A 2FZ1A 4RFT0 4AHZA 4XQ4A 4AGGA 3ZFGB 4EN0A 4CDXA 4Q4W3 4KWJA 3OPZA 4URAA 3O1TA 4EWAA 4I09A 1YFWA 4M3CF 1CZVA 1IG0A 1NZCA 2OZ6A 4QHOA 3LA3A 2BOJA 4GALA 1OOPA 4HVOA 4XDQA 3S7EA 4EWDA 3D0SA 4PF1A 1LGCA 5C3OA 3T1MA 4LBNA 4BQYA 3PL0A 3ZIWA 2FMDA 1AR92 4ATFA 5FOJB 1HQNA 2A6WA 3D0JA 4BQWA 3PUQA 4Y33A 1ZA7A 1JZ8A 3TEYA 5BNNB 5EJ3A 4P02B 1IS5A 4AAPA 2Y6KA 4CDQB 3IIIA 3PVOA 4UW6A 4E9KA 4LO5B 4DRVA 1LJ7A 4XZUG 4R9CA 4E8DA 3IBMA 1RUI1 3NV4A 1DGRN 1S2BA 1U5ZA 1W3VA 2ZMKA 2R073 3ZKYA 2PHWA 1ZBA1 2Q1FA 1PZ7A 2L9LA 2RJLA 3HAGA 3NNGA 3AKPA 4IE7A 1GV9A 4XETA 3E6BA 4Y4YA 1BBT1 1AL21 1PIV2 3JQXA 5DPNA 3LB9A 3SKJE 2P5BA 2PTMA 3KS7A 1NCRC 5LEKA 4NOTA 4D7YA 4LK6A 5T54A 1RUOA 3IT8A 5F7UA 2YXSA 3TN91 3S57A 5JI7A 4XE9A 2AC1A 4LBQD 3MIHA 4W4ZA 5C5UA 3IMMA 1W2UA 2IZWA 2VZSA 3POSA 2LUWA 2WINB 1HRI1 2F17A 3DPRC 3VBSB 4AGVA 2DVAA 1DGLA 2G19A 3ZIXA 5IVBA 5FYTA 5IJRA 2WN2A 3POGA 4QXKA 1AYN3 3ZYPA 1C1FA 1ULCA 2R061 3JQWA 5K7PA 1LODA 3CJIC 3WCSA 3MIBA 3D5OA 1RHI1 4Q5OA 2YB7A 1VE0A 4QXBA 2MNGA 3I2IA 1H4GA 2R0FA 2NMNA 2HWE2 2WNUA 3CIHA 2G9GA 5FK7A 1VBB3 4RS5C 3ZXGA 2RS32 3LIGA 2W3JA 4XJZA 5K4LA 1ZM1A 5J98B 4CCOA 3T2TA 1RGSA 4JTNA 5F32A 5A70A 2D44A 2JWPA 1RL3A 1FT9A 3NV1A 1V6KA 2SLIA 4N43A 1COV3 2W9XA 2XH6A 1MS9A 2XBO2 5I93A 3UGFA 4AI3A 4CEYC 2BBVA 1BVVA 4DXZA 3A22A 3VDBA 1OVPA 4QHZA 1NUKA 2WDBA 3OEAA 5FP4A 2GMPA 4UI9L 3ORJA 1A34A 4AR2A 3UKVA 2VCBA 4Z92B 4AEDB 4G9SB 4IV1C 3ACGA 1H8TA 4KH9A 4COWA 5LZ6A 1HXS1 2UWAA 3D6EA 1OQEA 4AGRA 4WZFA 2LTNA 1Q8OA 2WRAA 3V0AB 1LENA 1MS3A 1RUD3 2HBTA 3B9CA 3VBUA 3AP6A 3LSDA 4RGGA 4KU7A 2XQXA 4NPLA 1H9PA 1TNFA 1B35A 3AKQA 3N9QA 4LOSA 5LY2A 4CEWB 4ES9A 4FPFA 1ULPA 5D2AA 1NE6A 5FYHA 4XJUA 1S0IA 2B8MA 2ZKLA 4GMP0 2XWJB 4P14A 4Y1ZA 4DINB 4L11A 1G6NA 1WKYA 4W8JA 4K6BA 4K40A 1AJOA 1F15A 1P8JA 4GULA 4CU9A 4D7SA 1OC1A 1JHNA 1OKOA 3HBZA 3W58A 1UQXA 5IVCA 1PGSA 2V4VA 4HSJA 2X05A 3TBDA 3AMHA 4Y5Z0 3CU7A 4P9LA 4Z82A 3TNPB 1Q5OA 3S7IA 4QKFA 1E57A 2D97A 2WUHA 4GJYA 3HEIA 4COUA 4FPYA 3WP4A 4BQ1A 2AUYA 5DG2A 3WQ7A 3PTRB 3MLJA 3ATGA 4QPGA 2VZVA 4BIFA 3MIFA 1KRIA 1LHOA 4YVSA 3MIEA 3MYXA 2OPKA 1YQ2A 4Q4V3 4QPIA 1KITA 1VPHA 1WMEA 2CYFA 5CEHA 3HIFA 4IEZA 1O3QA 4H7LA 5FOBB 4QMAA 1RINA 1QKQA 3ENRA 3OCPA 2PLV2 1XNKA 1C4RA 1SACA 1XSRA 2QZ3A 3M7AA 4HKOA 1KDKA 2B4KA 5GALA 1CAXA 4AOCA 2WT1A 3T2PA 1Z0HA 3H3ZA 3MF9A 3N3HA 4NRMA 4S2HA 2HWB2 3S6PA 2ZGNA 2C24A 3B01A 4LE4A 1YI9A 3DKWA 3P3PA 3PUHA 4QDQA 4RA0A 2RS53 3ZN6B 4HBNA 2ORXA 4QX8A 3VKOA 4C0BA 4LKDA 5FPUA 3SISA 3HD8B 4BXFA 3RZLA 1H6YA 2GALA 4X6QB 3LEMA 1BKZA 3O7OA 2W87A 4PDWC 4QWNA 2R16A 2AEYA 2FD8A 1ENXA 5FYCA 5KXBA 2WS91 3LEIA 1RUF2 1EUTA 2XL7A 5JVVA 1YLLA 4R52A 4YW3A 1EV13 3ZOIA 3MV11 1NY72 1ENRA 4XFCA 3WHUA 3NKGA 1IQAA 5E16A 4IV3A 2XONA 5DDJ2 3SH3A 3E97A 1S0GA 1I5PA 1NAEA 1RUH1 1VLNA 3G7DA 3UK9A 1IPSA 3LFMA 3BU7A 5FQ0B 2VMGA 4DY3A 2CDOA 2WFF2 4LBQB 2P2KA 4HKWA 4R4ZA 5HXMA 3FJSA 5C3PA 4BOWA 1R1A1 1ZBE1 2O0OA 4NHXA 4OUEA 5LEJA 3CO2A 1MPXA 4HFSA 5CFDB 2RS13 3AP7A 4WBBA 5F3CA 1ENQA 2VZUA 1GYKA 4YW6A 3WDUA 4X8NA 4L99A 2QQLA 3CLPA 3WW2A 4E4SA 4FPHA 4UW3A 5C6CA 5CAZA 1GLHA 4M3CE 4YGEA 4HSLA 1UF2C 5FZMA 2W1UA 3BU0A 4HL0A 3POBA 2GZWA 1PO23 3ZFFC 5A3PA 4BZ4A 4ITCA 2VH9A 1UKRA 2JD9A 1QHDA 4GB32 4CCCA 2GAUA 3JCIA 3WW3A 3FWEA 5JIAA 1ZZ9A 5FWJA 1D0HA 1NLQA 5FMCA 4NPMA 1JOBA 2ERFA 2ORZA 2FCVA 3PIGA 4R9BA 3WUCA 2A75A 2ZEZA 5CFCB 1QIQA 3J26N 3RDIA 3V0BA 3DXTA 4OHYA 2A71A 3FBMA 1QJX2 2DVBA 1RVF2 2B9VA 3NJYA 5GM0A 3VGIA 1BMV1 4ARXA 3MW3A 4DXTA 3IAPA 4NHLA 2VMIA 1Z7S2 5FP9A 1FYUA 4LULA 4Q4Y3 5EYXA 3FHAA 1VAVA 2PHDA 2ZEYA 2WBKA 2E32A 5A6YA 2BGOA 1J3QA 4LBLA 2ZGSA 1LOFC 1GNZA 4QU1A 3RNSA 1STMA 1WLTA 3EMRA 5ABJA 5JXIA 1TNRA 1QXPA 2NMOA 3N7KA 4W6XA 2NPIA 2A6XA 5CKNA 4WZCA 1ONAA 4LITA 4RR3A 2GNBA 1TMF1 1AL0G 1S0DA 4I3GA 2TEPA 3I3BA 4UOJA 3H7YA 1RC6A 2K9ZA 3IWZA 1NCRB 1R083 5AVAA 1W39A 3RMXA 3KWVA 1OQDA 1Q8QA 5FYYA 2ZGRA 1RUI3 2WWJA 1WLCA 1FOD2 4JGYB 2QQPA 2DVFA 2Y64A 3I3QA 3I54A 1MACA 2ZGPA 4CUGA 2VOKA 3POWA 5FPBA 1KQRA 1XNAA 5FPAA 3VD4A 3GBWA 2I2SA 4ISQA 4WVMA 1BBT3 2X5IB 1YYNA 4XEZA 2XVLA 3WP3A 2DYCA 1W8TA 3DPRB 2CGNA 2XHKA 3NL1A 4XZPA 1JYCA 1JYNA 2IUWA 2VCAA 5APAA 3PUAA 3T0BA 3C7HA 1ND3B 3HQUA 2MEV1 2VZTA 3AZVA 4ASKA 3RZGA 1UMHA 2A3WA 2BQPA 4RHV1 1RIRA 2ARCA 5EJ1B 1UXXX 1CAVB 3PU8A 2HWF2 4HMZA 1WW7A 4FBFA 1HRI3 3AZWA 3VBOC 2IXLA 4B1MA 2XJSA 3H8OA 1O3RA 2QQUA 3ZN5A 2R063 1FV2A 2G9ZA 3BIWE 4HETA 3ZFEC 3CHXA 4B4RA 5J09A 2WWUA 4NPRA 3RJRA 1RHI3 4MGYE 1D4VB 2DUOA 4TLGA 2RDSA 4Y1YA 1MZ5A 4LUMA 4LO6B 4N53C 1GICA 1RUE2 1D7PM 2VQUA 3BALA 1TVGA 3RPQA 4CEYB 1YCIA 2CDPA 2YPDA 4Y20A 4LR4A 3CNAA 5FZKA 5L9RA 3GNEA 2AR6A 1EAH1 3KD4A 1MZ6A 3AM2A 1T2XA 2ZKNA 3WEZA 2ET1A 5FKCA 2CL2A 3SMHA 4FFFA 5LW9A 2XQRA 1EUUA 4HT1T 4DS0A 3FLPA 4BMBA 4FOQA 1VBE1 4XACA 3K4DA 3EHKA 3T08A 2PHUA 1OMIA 1O8SA 1JS9A 2W5FA 3KCCA 3MUZ1 4C90A 5T3NA 2B5HA 3AP4A 4EZ4A 4MXWA 4XMAA 3WHTA 4UYBA 1SDDB 4XUQA 4ET7A 4DUXA 2Y6FA 5HPOA 2YYOA 4QXCA 2ZGOA 1CX4A 4LA2A 1HXS3 1KJRA 1UCXA 1BLZA 5KC6A 4PI2A 3R6SA 5LBEA 1GZ9A 2F6BA 3I2KA 4GH4C 2EIDA 3MIGA 4MHRA 3KT4A 3VBHC 2OUHA 1VBC1 1LECA 5GZGA 2PN5A 3N9NA 4AI2A 1UW8A 3I4IA 4MGZE 3NJVA 1JXNA 3I2FA 3C7OA 5FZOB 1U0AA 1UL9A 4CDXC 3P3NA 1DP0A 3POYA 5FZIA 1QJU2 5FLHA 1AXKA 2H6CA 2BJSA 3M8LA 3AP5A 1S4CA 3VBRB 3N9OA 1HQWA 1MEC1 1OOPC 5L7OA 1A3KA 5FP7A 4UFHA 2ZABA 4P9YA 4XXAA 1VMHA 2BGPA 3PUIA 2O8QA 1LHVA 2AENA 2VL4A 4JDOA 4EV0A 3Q8BA 3ROUA 1D4M2 1KDMA 5FXXA 1UY4A 2DCZA 3HN3A 4AAXA 1DGWX 1W6OA 2YFZA 3RZHA 4CP9B 1NCQB 2QQOA 2Q4SA 4XABA 2CNAA 1V6LA 4RN5A 3AMNA 3WCRA 1K12A 3MEPA 4A4AA 3W5NA 4C91A 2BFUL 3FUQA 5IUQA 3AX4A 1R64A 1V6IA 3HQRA 2XG3A 3CBNA 1H2LA 5AFEA 1PVC2 1BK0A 3POEA 4H55A 1UU5A 4MZUA 4XC9A 4YGBA 3JU9A 4FI9A 1H8VA 5DQ0A 1OA4A 5A1LA 3ZVXA 2W91A 1LTEA 3SHRA 4Q4X2 3AMPA 3HT2A 5FY0A 4GA9A 1YQ6A 3PMSA 1UX7A 3B9IA 5HV4A 5D21A 1NKGA 1RMU2 4XF1A 2Q1MA 4BK5A 1JZ7A 5FBZA 1WMXA 5FMDA 1EYBA 5DUUA 4WVWA 5BNPB 3KLSA 4NHMA 4O7XA 2YC4A 4BYYA 1OPOA 2XUEA 3OYWB 2JDAA 2ZGMA 1G9FA 1AR72 4QT6A 2VXJA 2WS93 1O8PA 4IEOA 3ACHA 5CB7A 2IVIB 5GLTA 3FLTA 2JENA 3HJRA 5EWSA 1N47A 4DB5A 4FCAA 5I91A 3BODA 4S2GA 3BIEA 1OF3A 3ZXEA 3PMEA 1OUSA 1RTVA 2C0ZA 2UYAA 1JU3A 1EY2A 1ZYBA 2VNRA 1OLRA 3LEKA 4FP2A 4FPOB 4LNVA 5FWEA 4Z2WA 4KBZA 1RUH3 4GKYA 4L97A 1UZZA 4N43C 1W28A 1XNTA 4HXCA 3DUIA 3MHZA 4QPYA 2R071 3MV01 2P4EA 1VALA 2JDUA 1R1A3 1ZBE3 2B9UA 2RDNA 4K8RB 2BYVE 5LBFA 3ZFFB 1VJ2A 2D3SA 3KCYA 1NX9A 2RHPA 2EALA 3M4FA 3OBRA 4I3PA 4JQTA 4Y5SA 4CPBA 2OKXA 1FMD1 1O5UA 5EJZB 4ZXEA 2D3PA 4MGTA 5FK8A 4JVAA 4O61A 4BLJA 2CAVA 5A3TA 1W0PA 3VBUC 3ZR5A 3IDAA 2DWRA 2QVSB 4XUOA 2DU1A 2QNKA 1B35C 1XXNA 3EXUA 3NW4A 2P6HA 2WNEA 5DN2A 4UFIA 4E8CA 4Y22A 4E4HA 3LPFA 1G9CA 1AYN1 3UETA 5J3UA 4C1XA 1LOAA 4ASLA 2YBSA 5JSPA 1RUG3 1OPMA 4MGSA 1WLWA 4Q0PA 1JZ4A 3UJOA 1YUDA 3T2QA 1AX2A 1PGW1 1YO8A 3HWJA 1XYNA 1FNYA 3K48A 2W47A 1YWKA 3M3CA 3SEEA 1KFXL 1NT0A 2WZ8A 3O1UA 2XVKA 4P9IA 1N1TA 4WM8A 1Y3TA 2LROA 1RUJ2 1COV1 2OS2A 2ZAHA 3Q9OA 5T52A 2VUCA 1U5IA 1DYPA 4IE5A 2PHXA 2WAAA 2J1VA 2YMZA 1N3PA 4BPZA 1MQTB 4QPGC 4CCJA 2WR9A 1YHFA 5FJKA 5L19A 1K3IA 1HRV3 2OYZA 5C4WB 4Q1PA 4CXWA 1QJY2 5L36A 3KF5A 5F3IA 1S55A 2DDUA 3ITQA 3LOBA 1TMF3 1RUD1 5JOXA 4SLIA 1AR82 2C9KA 3F2ZA 4AQTA 2YDEA 2FDIA 3ZYBA 5FZ8A 1W6NA 3IDBB 2IFWA 2BNNA 1ZA4A 3OBAA 4XFAA 1DGWA 1W03A 3FN9A 3IKWA 4MGIE 4XW3A 1OD3A 2VZRA 3ZPOA 4BCUA 3KHCA 2PQQA 1SBFA 5HBAA 3WQBA 2I74A 1LR5A 4B7KA 3AVSA 2EIGA 2CGOA 4AL9A 2DCJA 3D3AA 2FZ2A 1CWPA 2MEV3 5HXVA 1VRH3 5C3RA 2QQVA 4N53B 4UBHA 4CP2A 3K3OA 5JI9A 2E63A 4YYOA 3GF6A 1K5MC 2ZGLA 1OURA 1XJAA 1BZWA 3AFGA 4Q0SA 1VMFA 3ON7A 3OBTA 3FL7A 4OUMA 5CBLA 4BMEA 3EYPA 5C8CB 4URTA 4TYSA 2WLPA 1GQPA 3HNBM 3RQ0A 2BWAA 3ALQA 3CF6E 4YVWA 5JSOA 4QGLA 5FYMA 3SXWA 5GKAC 2R1DA 2QJVA 1QJZA 2R1BA 3GM8A 1VBA2 2E9QA 4YRDA 4LA3A 3VBFA 1EAH3 4JHTA 2ZMNA 4CCNA 1O5LA 2HYKA 1DZQA 4CUCA 2GH8A 4K21A 1GNHA 2XVGA 1U5XA 4COYA 1CAWA 1ZZCA 3KV4A 4ORFA 4FAHA 2Q0AA 1H2MA 5D1IA 4KWKA 2ZAAA 4COZA 5A32A 4YM2A 2EIBA 1G9DA 3NJZA 3VBHB 2V72A 3VZJA 2A6VA 2IXKA 1RXGA 5TSWA 1GKBA 1GOHA 2OXBA 2R0HA 3OF1A 2ZA9A 3BB6A 3VDAA 5CKQA 3HPNA 4XQWA 2H0BA 1DQ6A 1C1LA 2GC2A 2XLFA 4FSJA 1X50A 2A6ZA 1SLBA 3VZLA 2OIIA 3GBGA 3KHBA 4I0AA 2IC1A 2QTWB 2W1QA 2ZBJA 2DCTA 3OY8B 2RS52 4KGGA 3QOPA 4OI1A 2VG9A 2BWCA 2LS6A 3EQEA 2JG8A 4JZRA 2A7AA 2EF6A 4AVCA 1OOPB 1FV3A 2JG9A 4DZGA 5CA6A 1DF0A 1EP0A 3FFZA 4D6SA 2HWC2 1XQNA 2P1BA 2VUJA 3ME2A 4E2GA 3KM5A 3VZNA 4FPJA 4CUBA 1SQ4A 2C1FA 1QQP2 3HN1A 4PLMA 3B3QE 3P6BA 3DECA 4DXRA 1LHWA 3J8F3 3FE5A 4IGOA 3T2OA 1OUXA 3GDBA 1UOFA 2OZJA 3KVAA 4QX3A 1IHMA 4R9DA 1QXJA 2A73B 2BERA 4K8FA 1MEC3 4YW2A 5C7GA 3O0WA 3RWKX 1I6XA 2IXCA 4PHZA 4X8PA 2C26A 1L7RA 1AX1A 3C7EA 2TUNA 5DUWA 1Y9GA 4CDUB 5ABJC 3OD0A 3TEXA 4OQ9A 3U14A 3NAPB 3U0ZA 2H6BA 4PIXA 4Q1RA 5HCAA 1SBEA 4XXPA 3WLUA 1AR62 1JYIA 3T30A 5FY7A 1UD1A 3RYKA 1SFNA 4X6RB 5CZKA 5EXOA 4NRQA 4RR3C 2I07B 1PGL1 4XVHA 5JXJA 3AC0A 4YGDA 1F2NA 1VBD3 1S0JA 2XJPA 5FZBA 2RS12 3IAQA 4RQPA 2X10A 4HN1A 1PO21 3E6CC 4NIGA 2YUEA 4ES8A 4QPWA 3N7JA 2DV9A 3WUDA 2JB4A 3GXUA 3OSDA 3USUB 5JLVA 5F9TA 1TME2 3K4AA 2NQYA 5A7QA 4N9IA 4QX7A 4IGPA 3V56A 1REEA 1WUVA 2D93A 4XTMA 5JDBA 1O3TA 3AYAA 5AFBA 1X9PA 2RM21 4A3XA 3RSJA 5F5QA 3ZPYA 4XF9A 3IDCB 2KD7A 5FV3A 4Q26A 3VDDA 2BNMA 1ASJ3 3FLRA 2UURA 4AI9A 2FDJA 2HEWF 1UO9A 1W2OA 2E7AA 3VL9A 4Q4Y1 5ERLA 4LJHA 1GZCA 3OGRA 3N9LA 4AEMA 1GMMA 1XU2A 2QQMA 4EYUA 4YNIA 1F8VA 5FZLA 1OQ1A 1V6NA 3PIJA 1OA3A 4OHVA 1QOTA 1JZ5A 1J3RA 1CZTA 5A3UA 4PCRA 1HB4A 5FZGA 3FBYA 3OEBA 4ZU5A 4XDOA 1HB1A 1R081 3L9JT 1AR91 4QXHA 2AREA 1J59A 5JPNB 4YW7A 3FZ3A 3KSCA 4QGMA 4XF4A 5DXDA 5FY1A 5CG9A 1K42A 5FCCA 3TNQA 4LLOA 4M01A 1W6QA 4XFHA 3VHOA 1B35B 1CIYA 1RUI2 2JDPA 4A41A 2FDFA 4GQ7A 5F5CA 5FLJA 1FMD3 1ZBA2 2UY8A 4JDNA 2VR4A 2OUJA 1AL22 4RFRB 4K1ZA 4P9XA 5FZCA 3ZMNA 2WO2A 4JRLA 3AYEA 1EPWA 4KG8A 2Y6JA 5KHGA 4Q2FA 5KHJA 1PIV1 3TN92 3GGLA 3U11A 2WZR3 5JXHA 1WW6A 5FYUA 3LWCA 3ZDSA 2VNGA 4C1WA 2D7FA 1KGYA 3TEZA 5C8WA 4MXVA 1HRI2 1VB2A 5F6LB 1UN1A 2R062 4LKSA 1VMJA 1HN1A 3AYDA 4QPGB 2BUKA 2RV9A 2XR4A 1W2NA 1HV1A 1RHI2 1DFQA 1L7QA 2JD4A 3AKRA 4IESA 3JBG1 2XOMA 3WDXA 1L3JA 5EZWA 5AVPA 3QBQA 4MLOA 5JWPA 1UY0A 3SCHA 3MW4A 3F95A 3K75B 3PJYA 3LD8A 1ZRFA 4KBBA 4XUNA 3BVCA 3ZFGA 5FYVA 3DF0A 2MHFA 2RS31 3LPGA 2YY1A 2QKDA 5IFTA 1CQ9A 1E5RA 1PO11 3PTYA 5F8PA 2YHJA 2VBBA 4OCTA 4AVAA 3N4MA 1AZDA 5A3MA 2PAMA 2Q1ZB 5DABA 1XOYA 2D6KA 3QH7A 3KCXA 4GWNA 1UU4A 3WQ0A 4UT5A 1GWLA 2YBKA 5BNNA 4V2WA 1PX3A 4NR1A 2VTXJ 1K5MB 4CDQA 1I1EA 3EB7A 1O4YA 4QQOA 2CY6A 4JV4A 2WZEA 5A7WB 1ST8A 4DQAA 1A8DA 1GP5A 2I45A 2Z69A 3PUSA 4GMP3 4CU6A 4G4FA 4DIQA 1G8WA 3NNLA 4ZY9A 1WLDA 1UMIA 1GOGA 2VE1A 5BNOA 2YC2A 1GOFA 4IEYA 3T0DA 3MIDA 5DAVA 2F4PA 5FMOS 3WW4A 1RB8G 1ZREA 1AHSA 1ULEA 2AH2A 2WYSA 3MLKA 5A7OA 3W20A 1MS1A 1YI7A 3WOGA 4TWTA 1QNWA 2WC2A 3M3QA 1FI2A 4XUPA 2A70A 4FOVA 2D6OX 3O0XA 3HNYM 1LHUA 4QKBA 4QQLA 1Z78A 4WM7C 3VZOA 3WF0A 2AZ5A 2ZGTA 1XPWA 1BCXA 2Y6LA 2VD7A 4XFBA 3VBSA 1YIFA 3RZKA 2SBAA 5CG8A 4CDWC 2G9FA 5FJHA 4QQ2A 3TB0A 2BFUS 2VZPA 4P08A 3GCWA 1LOCA 3I2DA 1W04A 2WAOA 1G9AA 5K0UB 4O9EA 5FUNA 3E5XA 3D82A 4FQ4A 1NE4A 1SLCA 1UYPA 5FPXA 3H8XA 2WJSA 4OLLA 4OVEA 5FY5A 1K5JA 4JAAA 5DG1A 3TEWA 1Y9MA 5FZDA 1W9SA 1B09A 1X8EA 1IZ3A 1HIXA 1JUHA 4OZOA 4BH9A 4P00B 1W8FA 3RG0A 4JGZC 3ZXJA 4U2AA 2HWB1 4C0HA 5FP3A 1BQPA 1LGNA 4MX3A 4LO8A 4D7TA 4DPNA 1FAYA 4AEDA 1Q3EA 1UIJA 2FHRA 2JDMA 3ZYRA 5ABJB 3AKTA 1LESA 1UKGA 2ZHKA 3NNJA 4EE2A 4E4ZA 2RDQA 3V0AA 1NQJA 3I3DA 4QQHA 3LE0A 1VB4A 3B7MA 2W46A 2X8KA 4FPKA 3W21A 2H0VA 4LMFA 1QMJA 4CEWA 1QJFA 1YFYA 2YGMA 3ES1A 3WD5A 1LB2A 1RUH2 4FOYA 1UNBA 1KFUL 1W8NA 1JH5A 3RI8A 4Z8BA 3ILFA 1QNYA 1NXD1 1QF3A 2V5YA 3AYCA 4A44A 5FTTC 5F2SA 3DN7A 3RS6A 4XYXA 3THPA 1W0NA 1IS3A 4Y1VA 3UKTA 2VQTA 3W59A 4CU8A 4YM3A 5CNAA 1IOAA 1RUNA 5C33A 1WBFA 3SNMA 2GC0A 1Y9QA 4ZZ5A 3WNLA 5A6QA 3PU3A 4FPLA 1W2TA 1HKDA 3Q8EA 1GUIA 4ONUA 1C57A 1YQ8A 1RUG1 2Y33A 2D6NA 3B00A 4BIOA 2Z79A 4GWMA 5I8TA 4YLZA 5FZ0A 4YFZA 1JHJA 2RM23 1PK6A 3HT1A 4JX0A 1GWMA 3ZN4A 1R091 3JD72 3Q8CA 1HB3A 4OHWA 2Y0OA 5GLUA 3T4HB 1F4HA 3R0RA 3KGZA 5L9VA 4LHSA 2YROA 2HWD1 4TSVA 3R4DB 4NIAA 3OG2A 4QX5A 5B2GB 1BMV2 1ZVFA 3AZYA 5BY5A 3N36A 1QY4A 4W65A 3IIAA 4YVWC 1MZFA 1OVSA 1F31A 3N9MA 1HRV1 1QH6A 3U10A 4E27A 5ACA1 2E7QA 1W6PB 1CAUB 2ZX2A 3ZN6A 1Z7S1 2W0XA 3VBFC 1H9WA 3C2UA 1F4AA 4HVQA 2QQNA 4BU2A 2HKXA 4MUVA 2KXLA 1ALYA 5BV6A 5D8AA 5BUVA 5LCWL 1ULGA 1AR93 4FXGB 2DCYA 4F8AA 2JX9A 3WP6A 3AJZA 1AXYA 3IZOA 1TMF2 2ENRA 2ARXA 2WQZC 3DYMA 3NNMA 4HG6B 3I8TA 5IK4A 5M0TA 4N7UA 1JW6A 1QH7A 2YV8A 5JMCA 2JE7A 3NJXA 5JZGB 3ZR6A 1M4WA 4UAPA 5A1AA 1CONA 4JKKA 3OUIA 3SKVA 1ENSA 3PLQA 1XSQA 3CJIB 4HOOA 5FQ0A 2ETEA 3OUHA 5G04L 2QFEA 4AI8A 4LBQA 1VRH1 2AACA 3WSOA 1GBGA 1V9U1 4BJ0A 4M4PA 4JKLA 1ODMA 1NQDA 5EYYA 2D5HA 2JG8C 2DBNA 1PIV3 4OYUA 2JG9C 4RS5B 1JYTA 3MBWA 4D6RA 3GHMA 4RHV2 3LAGA 4NUBA 3OGJA 2Q8EA 4TZDA 2R49A 3HVDA 5GLZA 5K9YA 2NLRA 2EXHA 3A0KA 5FR3A 1CPNA 5BXXA 4H3WA 5FUIA 4YZ5A 2WT0A 3JBG3 4L92A 2D40A 1NA1C 5FZ6A 4IV1B 1XB9A 4CSWA 1W90A 4BK4A 1UYXA 4AQSA 5KBFA 4JDMA 2DFBA 2VVDA 3BN6A 3LDKA 1RUE1 5FIXA 5CFCA 2C6SA 3THTA 3B5LB 3WZ1A 5DZFA 2HWE3 2EXKA 2P34A 1VBE2 2J1UA 4IE6A 4EN9B 2WSUA 5I0RA 5A80A 2RS33 4LK7A 1E5SA 4Y24A 3H8RA 3C7FA 1PO13 2R7EB 5H9PA 2ZMLA 2WNVA 2W95A 4GJZA 4IETA 1SFPA 4CCDA 5LA0A 1ULOA 5F2WA 1SDWA 1WD3A 4PLOA 2Y0IA 3J4UH 4YG6A 3P1IA 5KWRA 1HB2A 1BHGA 1JTZX 4CYDA 1GFF2 2ZX1A 4OMCA 1W9YA 2VY0A 4LT5A 1DDLA 3WG4A 5FFOC 1US2A 3MUY1 5FYIA 1LHNA 1FX5A 1V00A 3KQRA 2MPFA 3ZKUA 4ARYA 1VBC2 2O8OA 3LA7A 1ZZBA 4UF0A 3J8F1 4WV8A 2DTYA 2IFRA 4GIQA 4IEUA 5BPXA 5E88A 3VDDC 1VP6A 2BVBA 1ZNPA 1XE0A 2AYHA 4XCBA 2VUAA 2VW0A 5A33B 5HI0A 2LW8A 4JCKA 3D8CA 4JGYA 1I5ZA 2ZX4A 3ZXKA 1W8OA 3RYPA 3ECQA 2D43A 2YGLA 1LOGA 1AJKA 4WM7B 1N1SA 1EPZA 1AUYA 3LDBA 2X5IA 1MEC2 2WT2A 3LIHA 4NJ4A 3DPRA 2Y38A 1RUC1 5LA9A 2VMHA 5LB6A 1QJU1 5C9AB 2CU5A 3IPVB 4AVSA 4YGCA 4HN0A 4FFIA 3RYRA 4XFIA 4B3NA 1N1YA 4Q29A 1JOPA 1ND3A 2KA3A 1SPPA 1VBD1 5DUXA 3GJAA 4LOTA 3AZXA 2ZGQA 4M3CA 1H2NA 2ZHMA 4QKDA 4CCEA 1CAVA 4CP1A 1E5IA 3IDEA 3WP5A 1YQCA 5FZ4A 3BTYA 4QD2A 5IW0A 1DQ4A 5AC91 1GQHA 3O0VA 3QCWA 5CIRA 4MYEA 1CR7A 2WIIB 2VULA 3B02A 3WG1A 1F9KA 5FY8A 1Q8VA 4Y22B 2VOTA 2LRPA 4CZSA 4JGZB 3PVBB 4PDWB 3DEMA 4ZS3A 4EN8B 4CEYA 1GP6A 4AEKA 1X33A 1ULDA 1LEMA 4Y4RA 3JXSA 1ASJ1 2OW4A 2PLV3 3INAA 3OD4A 5KXCA 1U5YA 3THDA 3WV6A 1D2QA 1PMJX 1PVC1 3I59B 3VLBB 4Q4W2 2P3IA 2YPJA 1OSGA 1PZ9A 1N3OA 2IXHA 1MR5A 3RWNA 5FYBA 2HWB3 5JPMB 4FTBA 4NAMA 4AYUA 4XBQA 1RMU1 3VHNA 2ZX0A 3NWKA 3KZ4C 5JZGC 4BDVB 2V5DA 5ISLA 3WQ1A 2D3RA 4NHKA 2D98A 2WNUC 5FZEA 4KG0A 1U12A 2P3YA 4HPKB 3PURA 2XHNA 5EIYB 1AR71 5FBJA 1O4ZA 2FDHA 5J7MA 5I0SA 3CZJA 4PIZA 4MSVA 1BJQA 2X53S 4CU7A 4AXOA 5K8SA 4V1PA 5IT6A 1WA6X 2RMU1 5DDJ3 5FZOA 1W6NB 3WVJA 1RJ7A 1PHMA 2R072 3X29B 2PXJA 4AG4A 4YZ2A 1H8TC 4AW7A 1JI6A 1WCQA 4KWUA 5JUVA 3LF7A 3N7MA 4WVVA 3VBRA 2XJUA 1CJPA 1IKPA 3AJYA 1W6MB 1FMD2 4S2FA 5CVRA 2K46A 2BOIA 3ZDVA 2WA4A 3QD6A 1JOJA 1V0AA 3OPTA 3OGVA 4HLTA 3A0NA 1VR3A 2JB8A 2WZR1 2LALA 5A7NA 4OI0A 3VL8A 5BNNC 3AMQA 5LBCA 1OLQA 4KU8A 4CDQC 2Y8KA 3ACLA 4AQ6A 4LKFA 2BGCA 2ZZJA 3KV5A 3NKTA 3B69A 5EQUA 4CP9A 1NCQA 2DFCA 4OQ8A 1AYN2 4ATEA 1VAKA 2PELA 4IDZA 3BPSA 2ATFA 1YJKA 3H8UA 1R093 4GB33 2W08A 4CP0A 2WA3A 1POV0 4QDSA 5L9BA 3VBFB 1QWRA 1PGW2 2HWD3 1VBB2 2BTVC 3O1SA 5FO8B 2W2IA 4GAZA 2W39A 2Q8DA 2JDZA 2V4AA 1CJDA 1GZWB 1YJLA 3S0MA 3O1RA 3J7NA 3NNFA 1CGPA 1COV2 3UNPA 3ZO0B 4NROA 5ACA3 4YVSC 4GXLA 1WCSA 1Z7S3 4QPIC 2OA2A 3FHIB 3PJQA 3URFA 3DGTA 4UWDA 5BNPA 3VBSC 1KJLA 3OB8A 1SLLA 2RR11 1Y4WA 3OYWA 4YM0A 4CE8A 2VMEA 4EQVA 5FPZA 2VBDA 4ZHNA 3ZSLA 1O59A 2JJ6A 3HMYA 1Y7BA 3W9AA 1GP4A 1RUD2 4Y5TA 1QJY1 2VW1A 3APBA 4LIUA 5T55A 4CCMA 5CKMA 3VBOB 3VHPA 4TLFA 3MZHA 4MADA 4RD7A 1ZZ8A 4D3WA 2VCMA 1GWKA 3K51A 5FZ9A 3ZFEB 4AFBA 4Y3OA 5KXDA 4QDRA 1WGPA 1QOOA 1CESA 1FOD3 1H1AA 2VNOA 4GMP1 1V6OA 1YC61 5FUPA 4DEVA 2XMLA 2VZQA 1V9U3 2ZEWA 4GWIA 2P37A 1IQDC 4XHBA 1KS5A 2CAUA 4PQ9A 4NRPA 1NA1B 1RITA 1Y43B 4AEDC 5FY4A 4D8MA 4IEQA 4IV3C 1DZTA 2DVGA 3WNKA 4KQ7A 1ND2A 2GP5A 3TYJA 1SBDA 2ZEXA 4XCAA 3CJXA 4EN7B 1AVBA 4Y1XA 2HWF3 5FLIA 1T6GC 3GZEA 2DF7A 5BNOB 1O3SA 4QB1A 3ETPA 4CEWC 2WO1A 3WNNA 4MG2A 3IM0A 2X09A 2PMWB 2C4XA 2EA7A 4I01A 2D6LX 2E51A 4Q4V2 1SCRA 4Q0QA 2VPVA 4S2DA 4ZONA 4ZKTB 4K1YA 4KL1A 2ZS6B 3M1HA 1O6UA 1NYWA 4AQ2A 5IAXA 2P3KA 4A6SA 1RUE3 3LZZA 4GH4B 1OF4A 4ASMB 2JKBA 3BYWA 1VBA1 2VW2A 3H50A 3VN4A 4E2SA 5C3QA 5SV8A 3MDPA 2XKPA 4GKXA 5A3WA 3S30A 3T4VA 1Q8PA 4CDXB 4BXSV 1BEV1 5JR2A 2K0GA 1O7FA 3ZX7A 4AI1A 1G9BA 3C7GA 1QU0A 4LUKA 1MQTA 3MFCA 3RGBA 2DVDA 5C4WA 1OH4A 2A3XA 1KXGA 4DMIA 5E6HA 2JDNA 2WZPP 1PK6C 2QCSB 4LE3A 3J7HA 3WNPA 4BM8A 3C3VA 1AYM1 2XPJA 1EV12 2XJQA 2J1EA 4CRQA 3WINE 2GNTA 3SC7X 3O1VA 3M3EA 2EAAA 5FPLA 1FATA 2NN8A 2QDRA 2HWC1 2OT7A 5EPAA 5A3NA 1DIWA 3BKZA 2A5ZA 3MW2A 2A1XA 4LTAA 3LOIA 4B29A 1RUC3 1JZ3A 1QJU3 5IAVA 3RRDA 1TE1B 4KI5M 2P17A 1FPN1 4AFCA 1H4HA 5FKBA 4P5HA 2NP0A 2R041 2DUQA 2FBEA 4N53A 5D8AC 4AFMA 3LGRA 1ULFA 1F5JA 2RVAA 3WDTA 1PGL2 1W2AX 3DL3A 4QX2A 4H2AA 3USSA 3QLQA 5BNQA 2ID4A 5J36A 1S0BA 1AR61 3H42B 1D4M3 3OBZA 1XBFA 4UBGA 3FFQA 5GJ6A 4CA9A 5AC93 5C8CA 1DBNA 1PO22 3K77A 1D0GA 1F5FA 1HQLA 2EICA 3JB8A 4BE3A 3OTFA 4D69A 3PNAA 2HJIA 4PT6A 3AP9A 3J7MA 1WZXA 1C8M1 2WNOA 3VDCA 4LPLA 1JMUB 1N1VA 3GCXA 3MPBA 4LO7A 4OZXA 1JODA 3BOWA 3MI8A 5EHDA 4K7JA 1OLME 4M00A 4XBLA 3U1XA 1J84A 5E89A 2DCKA 4IQPA 2RJKA 1PVC3 2WNUB 5B4NA 1WA4A 2ZTNA 3EBRA 4RGAA 4XAEA 4DEQA 4Q4X3 1I9RA 4R9AA 3I3EA 4N43B 4Q4Y2 4FQZA 4Q27A 3SQOA 3OUJA 3SEPA 3VBHA 1GR3A 1RMU3 5JCTA 5H9SA 1ZRIA 1W8UA 4A6OA 3M3IA 2WQ8A 1T6BX 2Y60A 3ABZA 3ELNA 1UPSA 3UGGA 2VTFA 4YWAA 5DMYA 1APNA 1JUIA 2XL9A 4TXWA 1ZZ7A 1H8TB 2OPWA 3OY8A 3R05A 2J1TA 1AR73 3JB4C 4FVVA 5A6XA 4XQDA 3H3LA 3WR0A 2YZ4A 3LEGA 3VBUB 3KVBA 4LEJA 1R082 5CFCC 4CXYA 2YU2A 3RJ2X 2RMU3 2QQIA 3HR9A 1CPMA 2ARBA 2OQ6A 4XDPA 3ILRA 2ZZQA 5DZGA 3ST7A 3WXPA 2XDVA 4MO3M 1RYYA 4AFDA 1BBT2 2WNVC 2WKKA 3AVRA 4NN0A 4W6WA 3VD5A 2B42B 5T5PA 1A8MA 3JZVA 3LSEA 1YEWA 3ZLIA 4TN7A 4AF9A 2W52A 4ZU7A 1XYPA 4CDUA 1YQ5A 2C9AA 2NM1A 4N9HA 4P5YA 1WWYA 4UW4A 3NAPA 4MOAA 1QEXA 3A4UA 3LCPA 5GZFA 4BQ2A 5T50A 1YFUA 4A7ZA 5LY1A 5SV5A 2Z42A 1ACCA 5FREA 4LLFA 5JOZA 3WF4A 2XXZA 3A7QA 4FPEA 1NG0A 1G86A 1S1AA 5LASA 1OFNA 4QU2A 5IK7A 1CN1A 1YFXA 2E6VA 4MVTA 1IG3A 4AHXA 5L7OC 4JGYC 1JYVA 5IK5A 1I3HA 3BOPA 2ZX3A 4YVSB 3FHQA 3RZZA 1W8ZA 4AZZA 2VVEA 3USUA 4QPIB 5LBBA 2X5IC 2XLAA 3MGUA 2BVVA 2ET7A 4JC1A 3KT1A 5FPVA 3JBG2 2D5FA 3RZJA 1GSLA 1NOVA 1LU2A 5JOYA 5H9QA 5T5LA 2HWE1 4E4DX 1CAXB 3RZMA 1ND3C 2JDHA 2VGDA 1H1IA 1UYZA 2BRTA 1DLCA 5DZEA 2F4LA 2FCTA 4NWVA 2G1MA 1C3HA 1UIKA 3WF2A 1VIWB 5J48A 1WW5A 1RUJ3 4XBNA 5IVJA 4CVUA 3ZYIB 3SH4A 2RR13 2XBO1 2JE8A 5IVEA 4LBKA 1IPKA 4FP3A 2EIEA 1SLAA 1PO12 2VCCA 1HXS2 2HEVF 3AB0A 4I02A 2JXAA 4LORA 3WF1A 5GZCA 4LBMA 1QJY3 4F83A 2E7TA 4B4PA 3POIA 4QX1A 4DY5A 2CGPA 3D4KA 1JN2P 4D6QA 2JDYA 2VVFA 2WWSA 4FAGA 2YBPA 3RMYA 3IB3A 4NMIA 3NV3A 5F37A 4IE0A 1AR83 4IV3B 4PQQA 3PHMA 4LHNA 4LIVA 4INDA 5DAQA 1WMDA 2QDNA 4XILA 5I8YA 4IUGA 4TTGA 3NO8A 2VBPA 1XNDA 3VZMA 1REFA 2AEZA 4LQRA 4AE2A 1GNYA 3BPZA 4MGKE 2HBUA 4BQ3A 2W92A 3I97A 1PNFA 5L73A 4F3JA 4YW4A 2O1QA 3N7LA 3RFRA 3DV8A 2IVJA 5CISA 3OOXA 2VMDA 4OFGA 5CADA 4IGQA 5KXEA 3ASIA 2J42A 4XURA 2CV6A 1J1TA 4IEXA 2PHFA 2VJXA 3K4ZA 3AKSA 1WMFA 4JKMA 2YC0A 3P5BA 4GWJA 4NIHA 2P6CA 4DXSA 1REDA 2VO5A 4XHXA 5LK7B 2PA7A 4XPVA 1SFYA 1MVEA 3LDRA 3CDZB 3H1MA 3HBKA 3Q8FA 3E5QA 3UGHA 1VBA3 1W9TA 3GZUC 3VD7A 3VBRC 1OBNA 4D94A 1QDCA 4FO9A 4XOGA 3ZXFA 1LU1A 2Q5TA 3KF3A 3R4SA 4B8EA 1OLMA 4META 2PLV1 4YZ4A 4NWWA 4FFGA 3V0BB 1PK6B 2VZ1A 2FQPA 4JTOA 5JOWA 3WF3A 4CDWA 2ZCWA 1BEV3 1MS4A 2WABA 4RGKA 4AWDA 3GZTB 4A42A 3BTXA 4HKLA 4M4RA 1UPIA 3AL5A 3E5UA 4XJAA 1NCQC 2FMYA 5DAWA 3MO4A 3ZYFA 4H7MA 2JEMA 2WS92 3HNMA 1AYM3 5FXZA 3H3UA 3BTZA 3CMGA 2BW8A 4PJYA 5A7SA 4RYDA 1GU3A 2HH9A 2VQ0A 3MPPG 1SG3A 4RR3B 4WM8C 1BYHA 3ZMOA 1RUF1 2EXJA 5IHRA 2ZGUA 5JSRA 2HWC3 3G6JB 1NY71 5D8AB 2GNMA 4CCKA 4FTEA 1IGOA 4AEJA 1OH3A 1K5MA 1DYKA 1QQP3 1W9WA 2BNOA 2RG4A 3I2HA 5DDJ1 2ZHNA 4XTPA 1OHFA 4UFLA 4YW5A 5C5TA 2D6MA 2QQKA 3H1YA 4WVMB 1R1A2 1ZBE2 5A7WA 3T1LA 1FPN3 1RJ8A 3ES4A 4YFWA 5A6ZA 1X36A 4YSFA 2GN3A 2WFF1 2GDFA 4BISA 4YW1A 5BNPC 5HV0A 2R043 3FUOA 2WSVA 4CXXA 4QB6A 2BBAA 2JKXA 1ZRDA 1LULA 4A7YA 2XWBB 2VZ3A 2CTVA 4LBJA 4N90A 1Q8SA 3BCWA 1PMHX 1GQGA 4Q8KA 1AR63 2VUDA 3JUUA 2PHLA 3M70A 2W1SA 5EFUA 1HW5A 5ANNA 2HLEA 2DURA 2GU9A 4YG0A 4CPBD 2GP3A 4SBVA 1C8M3 5FXWA 4XMIA 2VOXA 4Q0VA 4L8QA 1Q56A 1W3XA 1H30A 2XLGA 3I49A 1RUG2 2BP6A 2ARAA 4GB31 4AVVA 2WN3A 4MV2A 2J22A 1HJFA 2JICA 4L9BA 1YNAA 1TME3 4M0HA 4Y20B 3H7JA 3OGSA 3J7LA 4F7ZA 4DFSA 2R32A 4QHBA 1R092 3CEWA 2B7YA 1X82A 1SLTA 1AF9A 1W99A 1JBCA 1C8NA 4XFFA 1G7YA 1POV1 5K0UA 1QJX1 2HWD2 1RVF1 1UX6A 1POQA 1V70A 2XGXA 3JD71 4QGNA 1ND2C 1WCUA 1CVNA 5LK5A 1CD3G 2A3YA 4OUSA 4Q0UA 4MXWB 3KMHA 2ZXQA 2W1WA 4BHPA 2VECA 1SMVA 4DUVA 1HRV2 5I8SA 5FZ1A 1UMZA 3LFIA 1H0BA 5ACA2 3VD9A 1SHWB 1GZTA 2EVXA 1VRBA 2WNVB 1DQ0A 4XF3A 5C71A 1UZYA 2CHHA 1IKQA 5LWBA 3GBFA 3RVHA 1ZRCA 3KQ4B 2CWMA 3THCA 3NVCA 1JYXA 3NV2A 1W8WA 3ZYGA 4KMQA 4EZHA 2G4IA 2VAUA 2QQWA 4GZ9A 3U4XA 3MLLA 4MHUA 1S0FA 2Z2SB 5E1RA 4XJ8A 4IEWA 3M3OA 4J25A 2GC3A 5LRSA 5JMOA 1FOD1 1QXRA 1W9FA 3AZZA 4J1WA 2QQJA 4UF0B 3VB9A 4OHZA 4AHWA 2HYXA 3U4SA 2Q8CA 4LO4B 3E6DA 2ADDA 4DOUA 3OPWA 5L7OB 1Q43A 1BK1A 1MQTC 2PFWA 2MEV2 1JZ2A 5CFDA 2JE9A 2WO7A 1VRH2 2NZ9A 5C4WC 1ZBA3 1PM7A 1US3A 1BXHA 1PX4A 1V9U2 4LHLA 3I3MA 3KB5A 2DU0A 3KV9A 1AL23 2R6QA 2UWBA 4PBOA 5DAPA 2QUOA 4ZU4A 1QJEA 1WCDJ 3AFKA 5F3GA 1QOSA 4A2UA 5JIUA 2JIJA 2HWF1 4IE4A 3N35A 2VTXA 5JXGA 1W6OB 1W0OA 3TN93 3VHRA 1SPPB 1F35A 4CCLA 4M3CB 2ADEA 1NZIA 2GNDA 4Z2AA 4DNYA 2C5DA 2PHRA 4R8HA 5C70A 3FX3A 5F39A 1CIWA 1EAH2 4RSUA 2Y26A 4IEPA 4YM1A 2XJVA 2VC9A 1PVXA 1UZ0A 1MS8A 4EN6B 3HOBA 2N7GA 4ZS2A 2YG0A 1OD5A 2IXIA 5J1XA 3O1MA 1DGRA 3GZAA 2NYYA 4RQPC 5H9RA 4NIIA 4C8DA 4FPGA 4I0BA 4LBOA 3TRSB 1X8MA 4QM9A 1SZBA 1OI6A 2XBO3 1O4TA 3H9AA 2ILMA 4LXLA 3BUCA 5C8CC 3DCQA 1KD7A 2KR2A 1J3PA 3O12A 2R30A 2FDKA 2GH2A 5CYYA 1KEXA 2ZGKA 3O1OA 1W6PA 1CAUA 3M2MA 3UESA 3ZSKA 2RE9A 5GZDA 1LOBA 3GALA 3WDVA 2ZHLA 3T3YA 3UV9A 1NCRA 1TQ5A 1UXZA 3L2YA 1UYYA 1XC6A 4I30A 3U37A 3ZSJA 1MZEA 1W05A 3O5SA 4YG3A 4ISRA 3KV6A 3WG3A 3ZYHA 4A3ZA 3SLIA 3J8F2 5I0DA 5IFPA 3O1PA 4E2QA 5KHIA 1E5HA 3WX5A 2XB6C 1XRUA 1H2KA 3SCFA 5I0TA 4QX0A 4BQXA 1LCLA 1PM4A 1S2KA 2WLQA 2PQSA 3BTAA 4XFGA 5JZGA 4CDWB 5F1RA 3WY6A 1J83A 5A3OA 5IYYA 3C8XA 3CJIA 5GZEA 3DXUA 1S0CA 4IW3A 4P9JA 2YFUA 1RUC2 1UWWA 1PZ8A 4NAOA 1IS4A 5IVFA 1DU3D 4QB2A 4RS5A 4CUAA 1VBD2 1ZZ6A 2LM3A 5FMOL 2DBIA 2B46X 3U78A 3UYJA 1D4M1 1IPJA 3VZKA 4BLIA 4FTSA 1URXA 4QKNA 2V09A 1NLRA 1IS6A 2Y6GA 4N8MA 4BQ4A 2OQ7A 4L2NA 2O14A 5AC92 2VNVA 5EV7A 3K2OA 2QZ2A 2WFPA 1TG7A 1ZRRA 5IVVA 4W6YA 4XIOA 4N7IA 2D6PA 4UW5A 1V6JA 3PDQA 4IV1A 4J1XA 4B1LA 4CDUC 2FDGA 4PLNA 4PI0A 4ZXKA 5I0UA 2E53A 3LA2A 1UOBA 3NAPC 2GMMA 5G05L 4AI0A 1SLIA 1ASJ2 4MGQA 2ZOEB 4Q4X1 4BWOA 3AK0A 3SCGA 4WM8B 4PF5A 1V6MA 4NO4A 1NXMA 3S5QA 1FXZA 3DKQA 3KGLA 4NE9A 3CQOA 4QM8A 5LATA 3U07A 3ACFA 5FZ7A 4LKEA 2XJTA 2IXJA 1LKNA 4OULA 4LHKA 4Q4W1 3ZXAC 2JIGA 4FOWA 4IXLA 2VM9A 1J58A 1MS5A 3CKHA 3NSTA 1RUF3 5KR7A 3WG2A 1LRHA 1MVQA 3J9SA 5J37A 2BV4A 1H6XA 5T5JA 2VU9A 3CZUA 4J6GA 5F3EA 5JAXA 1N3QA 2E26A 2K2SA 2Y34A 3AMMA 4PBPA 3ZFGC 5FZ3A 4PIYA 2QBXA 5FP8A 3AL6A 5ANQA 1JYWA 3ZXDA 2WFF3 5A33A 2RMU2 5LRRA 4BA6A 3R4UA 2P3JA 2TBVA 1DQ5A 1JU4A 2GMEA 4IL7A 2WQ4A 1DYOA 4WM7A 2QE3A 1NLSA 3DYPA 1WW4A 2JDKA 2UWCA 2W94A 5LA2A 3ZXLA 4QQPA 5C9AA 1WBLA 4JQRA 3IPVA 3B93A 2E31A 2Z4FA 4V2VA 1DCSA 1OXCA 4XJ9A 4EJRA 4Z1VA 4K9SA 3B94A 3I2GA 1A78A 2WZR2 3IMNA 5KC5A 1O91A 2RJ2A 5F6KA 2XUMA 2ZACA 3UJQA 3AXEA 2BU9A 2GSYA 4YVWB 3K3NA 2Q30A 1DQ2A 5FZHA 2VOVA 4UXAA 4B7EA 1ND2B 1D2SA 2AGSA 4I2OA 1PNGA 1TEIA 4XF0A 4YZ3A 5IWFA 4AHYA 5BNOC 2VQAA 1OFSA 4DO0A 2WO3A 4OI2A 3AXDA 3CL1A 1HJGA 4JGZA 4PDWA 1AXZA 3WW1A 3L2HA 1CAWB 2EAKA 2UU8A 1POV3 3EJKA 3MFAA 1QJX3 3WDYA 3RI9A 1RVF3 3JD73 4JRAA 4RL7A 2BPA2 1BVP1 5A32B 5IVYA 5FO7B 1C5HA 1WCKA 2FCUA 2WL1A 3TWIA 4NIDA 1QGLA 3GJBA 1LOEA 1YXWA 1RUJ1 2PAKA 1W06A 3I59A 1VBB1 1DQ1A 2VMCA 2YU1A 4FXKB 3UKNA 3T09A 1UY1A
chains in the Genus database with same CATH topology
4MGTA 4O61A 3KHBA 4QKNA 2FDHA 4MG2A 4CXYA 4NPLA 4NPMA 2FDGA 3BU0A 4IE6A 3T4VA 3O1UA 3I2OA 3H8RA 3BTXA 3I3MA 3O1TA 4IE5A 4QKFA 4NRQA 4QHOA 5F8PA 4IE4A 4OCTA 4CXWA 3BTZA 3RZHA 4NIGA 5DABA 3O1VA 4IDZA 2FDIA 3KHCA 4ZS2A 3I3QA 3RZJA 3BKZA 3O1MA 3O1SA 3T4HB 4NIIA 3RZMA 3O1RA 4IE7A 4NIHA 2FDJA 4NJ4A 4CXXA 4NRMA 2IUWA 4NROA 3BUCA 3RZGA 2FDKA 4O7XA 3O1OA 3S57A 4QKDA 3BI3A 3RZLA 4ZHNA 2FD8A 3H8OA 4QKBA 3T3YA 3BTYA 3BIEA 3I49A 3RZKA 4IE0A 3O1PA 4JHTA 4ZS3A 3LFMA 2FDFA 4NIDA 3H8XA 3S5AA 4RFRB 4NRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGT A;  4O61 A;  3KHB A;  4QKN A;  2FDH A;  4MG2 A;  4CXY A;  4NPL A;  4NPM A;  2FDG A;  3BU0 A;  4IE6 A;  3T4V A;  3O1U A;  3I2O A;  3H8R A;  3BTX A;  3I3M A;  3O1T A;  4IE5 A;  4QKF A;  4NRQ A;  4QHO A;  5F8P A;  4IE4 A;  4OCT A;  4CXW A;  3BTZ A;  3RZH A;  4NIG A;  5DAB A;  3O1V A;  4IDZ A;  2FDI A;  3KHC A;  4ZS2 A;  3I3Q A;  3RZJ A;  3BKZ A;  3O1M A;  3O1S A;  3T4H B;  4NII A;  3RZM A;  3O1R A;  4IE7 A;  4NIH A;  2FDJ A;  4NJ4 A;  4CXX A;  4NRM A;  2IUW A;  4NRO A;  3BUC A;  3RZG A;  2FDK A;  4O7X A;  3O1O A;  3S57 A;  4QKD A;  3BI3 A;  3RZL A;  4ZHN A;  2FD8 A;  3H8O A;  4QKB A;  3T3Y A;  3BTY A;  3BIE A;  3I49 A;  3RZK A;  4IE0 A;  3O1P A;  4JHT A;  4ZS3 A;  3LFM A;  2FDF A;  4NID A;  3H8X A;  3S5A A;  4RFR B;  4NRP A; 
#chains in the Genus database with same CATH topology
 4O9G A;  4Q8L A;  5FAX A;  4A45 A;  4IER A;  1UY3 A;  4YPJ A;  1XE8 A;  1RXF A;  4Y26 A;  2RR1 2;  4UFK A;  1M06 G;  2HEY F;  1XE7 A;  2JG8 B;  4BB3 A;  2JG9 B;  1FNZ A;  2ES3 A;  1CZS A;  4HK9 A;  4L0P A;  1YRZ A;  2J7M A;  4XAA A;  1JZ6 A;  5FRA A;  4P9G A;  4Y1U A;  4HPK A;  2BEO A;  1AR8 1;  3H0O A;  3SH5 A;  5F5A A;  1L7L A;  1DLL A;  3WNX A;  2X29 A;  3WNM A;  1A6C A;  1WD4 A;  3HQX A;  2BDR A;  3U75 A;  5FZA A;  2UYB A;  1PMI A;  3LKJ A;  3W5M A;  3O14 A;  5FDB A;  3ZFF A;  3MF6 A;  1OA2 A;  5FMB A;  2OX0 A;  4UFJ A;  1SCS A;  1S0E A;  4YZ1 A;  2Y6H A;  4AVB A;  1VAM A;  1LNS A;  3I7D A;  4G3Y C;  5HCF A;  2KM2 A;  4BQ5 A;  4EWE A;  4ZZ8 A;  3I2O A;  1YIP A;  4A7K A;  5HCB A;  4UFM A;  4AFA A;  2VZO A;  1SEF A;  5EP9 A;  1W6M A;  1XYO A;  5GLW A;  3E1F 1;  2ZJC A;  5A3L A;  3V64 A;  1UY2 A;  2CWS A;  2VXR A;  1AX0 A;  1HDK A;  1UOG A;  1XU1 A;  4FPC A;  2V73 A;  2PHT A;  3PVN A;  1XNC A;  4RHV 3;  2PYT A;  4RQP B;  5C9A C;  4JHZ A;  5IAT A;  4XJW A;  3N9P A;  5LA1 A;  4MH0 E;  3EO6 A;  5DAX A;  3A23 A;  5KHH A;  3OGG A;  3FMG A;  3ZSE A;  4WVZ A;  3QH6 A;  3POJ A;  3POF A;  1K45 A;  3DYO A;  1LOF A;  4O65 A;  3ZYJ B;  4FT8 A;  5B4X A;  5T5O A;  1UOJ A;  2WYF A;  3NMB A;  3VKF C;  1J1L A;  3T0A A;  1MS0 A;  3VV1 A;  5CU1 A;  2B45 X;  3LQC A;  2CSG A;  2GN7 A;  3ACI A;  4Q4V 1;  4HON A;  3BGA A;  1S2E A;  3WDW A;  3WT3 A;  2E33 A;  3PVE A;  3MIC A;  3VDD B;  3VKL A;  1GAN A;  1QDO A;  1UZW A;  3ZSM A;  3QAC A;  1X7N A;  2Q8O A;  3WNO A;  1GZW A;  1H1M A;  5IK8 A;  4HZF A;  1LAJ A;  5BYN A;  1VBE 3;  1HX6 A;  5JR7 B;  4H14 A;  1LGB A;  1TZO A;  1BEV 2;  2TNF A;  4I0W B;  2XKO A;  5FYS A;  1W8H A;  5KHK A;  1CX1 A;  2JEC A;  4FFH A;  2Z5W A;  5C3S A;  5A7P A;  4HVR A;  4DUW A;  2DUP A;  3SIT A;  3BI3 A;  2RS5 1;  2B39 A;  2IWG B;  1HN0 A;  1XNB A;  4ZPI A;  5FY9 A;  3VUO A;  4D0Q A;  5FYZ A;  1AYM 2;  2A6Y A;  3IN9 A;  3KT7 A;  4KWL A;  2XJR A;  2J1S A;  4NHY A;  1C5I A;  5A1F A;  5K0U C;  1QQP 1;  3ILN A;  5FO9 B;  1VBC 3;  3VBO A;  4AK3 A;  1EV1 1;  1UAI A;  4QAW A;  2RDR A;  1OT5 A;  5E8A A;  3ZFE A;  1W6Q B;  4R4X A;  3ZM8 A;  1DZR A;  4COV A;  1LED A;  4OMD A;  3VD3 A;  4HK8 A;  1ODN A;  3FC0 A;  2OVU A;  4CTE A;  4U36 A;  1FPN 2;  3VKN A;  1DHK B;  4GD4 A;  4IEV A;  3S5A A;  2J1R A;  4XUT A;  3VKM A;  1DG6 A;  2W68 A;  2R04 2;  2J1A A;  2VMF A;  1NA1 A;  4HAN A;  3Q8A A;  4B4Q A;  3H1W A;  2UY9 A;  5FZF A;  5HCH A;  1X9T A;  4YAR A;  4P9W A;  5J96 B;  2BZD A;  3I2J A;  2RS1 1;  3UT0 A;  4NVP A;  1KS4 A;  4OHX A;  4KNC A;  2VOW A;  3NRU A;  1UU6 A;  2EXI A;  3ETQ A;  4XIK A;  1HV0 A;  3OJB A;  5FXV A;  3V65 A;  1C8M 2;  4K20 A;  1TME 1;  1HLC A;  3A21 A;  2RM2 2;  3GYD A;  4KGQ A;  4AVT A;  2DTW A;  5GLV A;  1UZV A;  5CFD C;  1ZX5 A;  2ZPX A;  4DRR A;  4GH4 A;  4M0N A;  3K46 A;  4OI4 A;  5DUV A;  1OKQ A;  2GC1 A;  5F5I A;  3TAY A;  4ERO A;  3TOJ A;  3GHN A;  4W50 A;  2PAE A;  3NQH A;  4K3U A;  3UL2 A;  1C28 A;  1R1Z A;  4Z07 A;  2FZ1 A;  4RFT 0;  4AHZ A;  4XQ4 A;  4AGG A;  3ZFG B;  4EN0 A;  4CDX A;  4Q4W 3;  4KWJ A;  3OPZ A;  4URA A;  3O1T A;  4EWA A;  4I09 A;  1YFW A;  4M3C F;  1CZV A;  1IG0 A;  1NZC A;  2OZ6 A;  4QHO A;  3LA3 A;  2BOJ A;  4GAL A;  1OOP A;  4HVO A;  4XDQ A;  3S7E A;  4EWD A;  3D0S A;  4PF1 A;  1LGC A;  5C3O A;  3T1M A;  4LBN A;  4BQY A;  3PL0 A;  3ZIW A;  2FMD A;  1AR9 2;  4ATF A;  5FOJ B;  1HQN A;  2A6W A;  3D0J A;  4BQW A;  3PUQ A;  4Y33 A;  1ZA7 A;  1JZ8 A;  3TEY A;  5BNN B;  5EJ3 A;  4P02 B;  1IS5 A;  4AAP A;  2Y6K A;  4CDQ B;  3III A;  3PVO A;  4UW6 A;  4E9K A;  4LO5 B;  4DRV A;  1LJ7 A;  4XZU G;  4R9C A;  4E8D A;  3IBM A;  1RUI 1;  3NV4 A;  1DGR N;  1S2B A;  1U5Z A;  1W3V A;  2ZMK A;  2R07 3;  3ZKY A;  2PHW A;  1ZBA 1;  2Q1F A;  1PZ7 A;  2L9L A;  2RJL A;  3HAG A;  3NNG A;  3AKP A;  4IE7 A;  1GV9 A;  4XET A;  3E6B A;  4Y4Y A;  1BBT 1;  1AL2 1;  1PIV 2;  3JQX A;  5DPN A;  3LB9 A;  3SKJ E;  2P5B A;  2PTM A;  3KS7 A;  1NCR C;  5LEK A;  4NOT A;  4D7Y A;  4LK6 A;  5T54 A;  1RUO A;  3IT8 A;  5F7U A;  2YXS A;  3TN9 1;  3S57 A;  5JI7 A;  4XE9 A;  2AC1 A;  4LBQ D;  3MIH A;  4W4Z A;  5C5U A;  3IMM A;  1W2U A;  2IZW A;  2VZS A;  3POS A;  2LUW A;  2WIN B;  1HRI 1;  2F17 A;  3DPR C;  3VBS B;  4AGV A;  2DVA A;  1DGL A;  2G19 A;  3ZIX A;  5IVB A;  5FYT A;  5IJR A;  2WN2 A;  3POG A;  4QXK A;  1AYN 3;  3ZYP A;  1C1F A;  1ULC A;  2R06 1;  3JQW A;  5K7P A;  1LOD A;  3CJI C;  3WCS A;  3MIB A;  3D5O A;  1RHI 1;  4Q5O A;  2YB7 A;  1VE0 A;  4QXB A;  2MNG A;  3I2I A;  1H4G A;  2R0F A;  2NMN A;  2HWE 2;  2WNU A;  3CIH A;  2G9G A;  5FK7 A;  1VBB 3;  4RS5 C;  3ZXG A;  2RS3 2;  3LIG A;  2W3J A;  4XJZ A;  5K4L A;  1ZM1 A;  5J98 B;  4CCO A;  3T2T A;  1RGS A;  4JTN A;  5F32 A;  5A70 A;  2D44 A;  2JWP A;  1RL3 A;  1FT9 A;  3NV1 A;  1V6K A;  2SLI A;  4N43 A;  1COV 3;  2W9X A;  2XH6 A;  1MS9 A;  2XBO 2;  5I93 A;  3UGF A;  4AI3 A;  4CEY C;  2BBV A;  1BVV A;  4DXZ A;  3A22 A;  3VDB A;  1OVP A;  4QHZ A;  1NUK A;  2WDB A;  3OEA A;  5FP4 A;  2GMP A;  4UI9 L;  3ORJ A;  1A34 A;  4AR2 A;  3UKV A;  2VCB A;  4Z92 B;  4AED B;  4G9S B;  4IV1 C;  3ACG A;  1H8T A;  4KH9 A;  4COW A;  5LZ6 A;  1HXS 1;  2UWA A;  3D6E A;  1OQE A;  4AGR A;  4WZF A;  2LTN A;  1Q8O A;  2WRA A;  3V0A B;  1LEN A;  1MS3 A;  1RUD 3;  2HBT A;  3B9C A;  3VBU A;  3AP6 A;  3LSD A;  4RGG A;  4KU7 A;  2XQX A;  4NPL A;  1H9P A;  1TNF A;  1B35 A;  3AKQ A;  3N9Q A;  4LOS A;  5LY2 A;  4CEW B;  4ES9 A;  4FPF A;  1ULP A;  5D2A A;  1NE6 A;  5FYH A;  4XJU A;  1S0I A;  2B8M A;  2ZKL A;  4GMP 0;  2XWJ B;  4P14 A;  4Y1Z A;  4DIN B;  4L11 A;  1G6N A;  1WKY A;  4W8J A;  4K6B A;  4K40 A;  1AJO A;  1F15 A;  1P8J A;  4GUL A;  4CU9 A;  4D7S A;  1OC1 A;  1JHN A;  1OKO A;  3HBZ A;  3W58 A;  1UQX A;  5IVC A;  1PGS A;  2V4V A;  4HSJ A;  2X05 A;  3TBD A;  3AMH A;  4Y5Z 0;  3CU7 A;  4P9L A;  4Z82 A;  3TNP B;  1Q5O A;  3S7I A;  4QKF A;  1E57 A;  2D97 A;  2WUH A;  4GJY A;  3HEI A;  4COU A;  4FPY A;  3WP4 A;  4BQ1 A;  2AUY A;  5DG2 A;  3WQ7 A;  3PTR B;  3MLJ A;  3ATG A;  4QPG A;  2VZV A;  4BIF A;  3MIF A;  1KRI A;  1LHO A;  4YVS A;  3MIE A;  3MYX A;  2OPK A;  1YQ2 A;  4Q4V 3;  4QPI A;  1KIT A;  1VPH A;  1WME A;  2CYF A;  5CEH A;  3HIF A;  4IEZ A;  1O3Q A;  4H7L A;  5FOB B;  4QMA A;  1RIN A;  1QKQ A;  3ENR A;  3OCP A;  2PLV 2;  1XNK A;  1C4R A;  1SAC A;  1XSR A;  2QZ3 A;  3M7A A;  4HKO A;  1KDK A;  2B4K A;  5GAL A;  1CAX A;  4AOC A;  2WT1 A;  3T2P A;  1Z0H A;  3H3Z A;  3MF9 A;  3N3H A;  4NRM A;  4S2H A;  2HWB 2;  3S6P A;  2ZGN A;  2C24 A;  3B01 A;  4LE4 A;  1YI9 A;  3DKW A;  3P3P A;  3PUH A;  4QDQ A;  4RA0 A;  2RS5 3;  3ZN6 B;  4HBN A;  2ORX A;  4QX8 A;  3VKO A;  4C0B A;  4LKD A;  5FPU A;  3SIS A;  3HD8 B;  4BXF A;  3RZL A;  1H6Y A;  2GAL A;  4X6Q B;  3LEM A;  1BKZ A;  3O7O A;  2W87 A;  4PDW C;  4QWN A;  2R16 A;  2AEY A;  2FD8 A;  1ENX A;  5FYC A;  5KXB A;  2WS9 1;  3LEI A;  1RUF 2;  1EUT A;  2XL7 A;  5JVV A;  1YLL A;  4R52 A;  4YW3 A;  1EV1 3;  3ZOI A;  3MV1 1;  1NY7 2;  1ENR A;  4XFC A;  3WHU A;  3NKG A;  1IQA A;  5E16 A;  4IV3 A;  2XON A;  5DDJ 2;  3SH3 A;  3E97 A;  1S0G A;  1I5P A;  1NAE A;  1RUH 1;  1VLN A;  3G7D A;  3UK9 A;  1IPS A;  3LFM A;  3BU7 A;  5FQ0 B;  2VMG A;  4DY3 A;  2CDO A;  2WFF 2;  4LBQ B;  2P2K A;  4HKW A;  4R4Z A;  5HXM A;  3FJS A;  5C3P A;  4BOW A;  1R1A 1;  1ZBE 1;  2O0O A;  4NHX A;  4OUE A;  5LEJ A;  3CO2 A;  1MPX A;  4HFS A;  5CFD B;  2RS1 3;  3AP7 A;  4WBB A;  5F3C A;  1ENQ A;  2VZU A;  1GYK A;  4YW6 A;  3WDU A;  4X8N A;  4L99 A;  2QQL A;  3CLP A;  3WW2 A;  4E4S A;  4FPH A;  4UW3 A;  5C6C A;  5CAZ A;  1GLH A;  4M3C E;  4YGE A;  4HSL A;  1UF2 C;  5FZM A;  2W1U A;  3BU0 A;  4HL0 A;  3POB A;  2GZW A;  1PO2 3;  3ZFF C;  5A3P A;  4BZ4 A;  4ITC A;  2VH9 A;  1UKR A;  2JD9 A;  1QHD A;  4GB3 2;  4CCC A;  2GAU A;  3JCI A;  3WW3 A;  3FWE A;  5JIA A;  1ZZ9 A;  5FWJ A;  1D0H A;  1NLQ A;  5FMC A;  4NPM A;  1JOB A;  2ERF A;  2ORZ A;  2FCV A;  3PIG A;  4R9B A;  3WUC A;  2A75 A;  2ZEZ A;  5CFC B;  1QIQ A;  3J26 N;  3RDI A;  3V0B A;  3DXT A;  4OHY A;  2A71 A;  3FBM A;  1QJX 2;  2DVB A;  1RVF 2;  2B9V A;  3NJY A;  5GM0 A;  3VGI A;  1BMV 1;  4ARX A;  3MW3 A;  4DXT A;  3IAP A;  4NHL A;  2VMI A;  1Z7S 2;  5FP9 A;  1FYU A;  4LUL A;  4Q4Y 3;  5EYX A;  3FHA A;  1VAV A;  2PHD A;  2ZEY A;  2WBK A;  2E32 A;  5A6Y A;  2BGO A;  1J3Q A;  4LBL A;  2ZGS A;  1LOF C;  1GNZ A;  4QU1 A;  3RNS A;  1STM A;  1WLT A;  3EMR A;  5ABJ A;  5JXI A;  1TNR A;  1QXP A;  2NMO A;  3N7K A;  4W6X A;  2NPI A;  2A6X A;  5CKN A;  4WZC A;  1ONA A;  4LIT A;  4RR3 A;  2GNB A;  1TMF 1;  1AL0 G;  1S0D A;  4I3G A;  2TEP A;  3I3B A;  4UOJ A;  3H7Y A;  1RC6 A;  2K9Z A;  3IWZ A;  1NCR B;  1R08 3;  5AVA A;  1W39 A;  3RMX A;  3KWV A;  1OQD A;  1Q8Q A;  5FYY A;  2ZGR A;  1RUI 3;  2WWJ A;  1WLC A;  1FOD 2;  4JGY B;  2QQP A;  2DVF A;  2Y64 A;  3I3Q A;  3I54 A;  1MAC A;  2ZGP A;  4CUG A;  2VOK A;  3POW A;  5FPB A;  1KQR A;  1XNA A;  5FPA A;  3VD4 A;  3GBW A;  2I2S A;  4ISQ A;  4WVM A;  1BBT 3;  2X5I B;  1YYN A;  4XEZ A;  2XVL A;  3WP3 A;  2DYC A;  1W8T A;  3DPR B;  2CGN A;  2XHK A;  3NL1 A;  4XZP A;  1JYC A;  1JYN A;  2IUW A;  2VCA A;  5APA A;  3PUA A;  3T0B A;  3C7H A;  1ND3 B;  3HQU A;  2MEV 1;  2VZT A;  3AZV A;  4ASK A;  3RZG A;  1UMH A;  2A3W A;  2BQP A;  4RHV 1;  1RIR A;  2ARC A;  5EJ1 B;  1UXX X;  1CAV B;  3PU8 A;  2HWF 2;  4HMZ A;  1WW7 A;  4FBF A;  1HRI 3;  3AZW A;  3VBO C;  2IXL A;  4B1M A;  2XJS A;  3H8O A;  1O3R A;  2QQU A;  3ZN5 A;  2R06 3;  1FV2 A;  2G9Z A;  3BIW E;  4HET A;  3ZFE C;  3CHX A;  4B4R A;  5J09 A;  2WWU A;  4NPR A;  3RJR A;  1RHI 3;  4MGY E;  1D4V B;  2DUO A;  4TLG A;  2RDS A;  4Y1Y A;  1MZ5 A;  4LUM A;  4LO6 B;  4N53 C;  1GIC A;  1RUE 2;  1D7P M;  2VQU A;  3BAL A;  1TVG A;  3RPQ A;  4CEY B;  1YCI A;  2CDP A;  2YPD A;  4Y20 A;  4LR4 A;  3CNA A;  5FZK A;  5L9R A;  3GNE A;  2AR6 A;  1EAH 1;  3KD4 A;  1MZ6 A;  3AM2 A;  1T2X A;  2ZKN A;  3WEZ A;  2ET1 A;  5FKC A;  2CL2 A;  3SMH A;  4FFF A;  5LW9 A;  2XQR A;  1EUU A;  4HT1 T;  4DS0 A;  3FLP A;  4BMB A;  4FOQ A;  1VBE 1;  4XAC A;  3K4D A;  3EHK A;  3T08 A;  2PHU A;  1OMI A;  1O8S A;  1JS9 A;  2W5F A;  3KCC A;  3MUZ 1;  4C90 A;  5T3N A;  2B5H A;  3AP4 A;  4EZ4 A;  4MXW A;  4XMA A;  3WHT A;  4UYB A;  1SDD B;  4XUQ A;  4ET7 A;  4DUX A;  2Y6F A;  5HPO A;  2YYO A;  4QXC A;  2ZGO A;  1CX4 A;  4LA2 A;  1HXS 3;  1KJR A;  1UCX A;  1BLZ A;  5KC6 A;  4PI2 A;  3R6S A;  5LBE A;  1GZ9 A;  2F6B A;  3I2K A;  4GH4 C;  2EID A;  3MIG A;  4MHR A;  3KT4 A;  3VBH C;  2OUH A;  1VBC 1;  1LEC A;  5GZG A;  2PN5 A;  3N9N A;  4AI2 A;  1UW8 A;  3I4I A;  4MGZ E;  3NJV A;  1JXN A;  3I2F A;  3C7O A;  5FZO B;  1U0A A;  1UL9 A;  4CDX C;  3P3N A;  1DP0 A;  3POY A;  5FZI A;  1QJU 2;  5FLH A;  1AXK A;  2H6C A;  2BJS A;  3M8L A;  3AP5 A;  1S4C A;  3VBR B;  3N9O A;  1HQW A;  1MEC 1;  1OOP C;  5L7O A;  1A3K A;  5FP7 A;  4UFH A;  2ZAB A;  4P9Y A;  4XXA A;  1VMH A;  2BGP A;  3PUI A;  2O8Q A;  1LHV A;  2AEN A;  2VL4 A;  4JDO A;  4EV0 A;  3Q8B A;  3ROU A;  1D4M 2;  1KDM A;  5FXX A;  1UY4 A;  2DCZ A;  3HN3 A;  4AAX A;  1DGW X;  1W6O A;  2YFZ A;  3RZH A;  4CP9 B;  1NCQ B;  2QQO A;  2Q4S A;  4XAB A;  2CNA A;  1V6L A;  4RN5 A;  3AMN A;  3WCR A;  1K12 A;  3MEP A;  4A4A A;  3W5N A;  4C91 A;  2BFU L;  3FUQ A;  5IUQ A;  3AX4 A;  1R64 A;  1V6I A;  3HQR A;  2XG3 A;  3CBN A;  1H2L A;  5AFE A;  1PVC 2;  1BK0 A;  3POE A;  4H55 A;  1UU5 A;  4MZU A;  4XC9 A;  4YGB A;  3JU9 A;  4FI9 A;  1H8V A;  5DQ0 A;  1OA4 A;  5A1L A;  3ZVX A;  2W91 A;  1LTE A;  3SHR A;  4Q4X 2;  3AMP A;  3HT2 A;  5FY0 A;  4GA9 A;  1YQ6 A;  3PMS A;  1UX7 A;  3B9I A;  5HV4 A;  5D21 A;  1NKG A;  1RMU 2;  4XF1 A;  2Q1M A;  4BK5 A;  1JZ7 A;  5FBZ A;  1WMX A;  5FMD A;  1EYB A;  5DUU A;  4WVW A;  5BNP B;  3KLS A;  4NHM A;  4O7X A;  2YC4 A;  4BYY A;  1OPO A;  2XUE A;  3OYW B;  2JDA A;  2ZGM A;  1G9F A;  1AR7 2;  4QT6 A;  2VXJ A;  2WS9 3;  1O8P A;  4IEO A;  3ACH A;  5CB7 A;  2IVI B;  5GLT A;  3FLT A;  2JEN A;  3HJR A;  5EWS A;  1N47 A;  4DB5 A;  4FCA A;  5I91 A;  3BOD A;  4S2G A;  3BIE A;  1OF3 A;  3ZXE A;  3PME A;  1OUS A;  1RTV A;  2C0Z A;  2UYA A;  1JU3 A;  1EY2 A;  1ZYB A;  2VNR A;  1OLR A;  3LEK A;  4FP2 A;  4FPO B;  4LNV A;  5FWE A;  4Z2W A;  4KBZ A;  1RUH 3;  4GKY A;  4L97 A;  1UZZ A;  4N43 C;  1W28 A;  1XNT A;  4HXC A;  3DUI A;  3MHZ A;  4QPY A;  2R07 1;  3MV0 1;  2P4E A;  1VAL A;  2JDU A;  1R1A 3;  1ZBE 3;  2B9U A;  2RDN A;  4K8R B;  2BYV E;  5LBF A;  3ZFF B;  1VJ2 A;  2D3S A;  3KCY A;  1NX9 A;  2RHP A;  2EAL A;  3M4F A;  3OBR A;  4I3P A;  4JQT A;  4Y5S A;  4CPB A;  2OKX A;  1FMD 1;  1O5U A;  5EJZ B;  4ZXE A;  2D3P A;  4MGT A;  5FK8 A;  4JVA A;  4O61 A;  4BLJ A;  2CAV A;  5A3T A;  1W0P A;  3VBU C;  3ZR5 A;  3IDA A;  2DWR A;  2QVS B;  4XUO A;  2DU1 A;  2QNK A;  1B35 C;  1XXN A;  3EXU A;  3NW4 A;  2P6H A;  2WNE A;  5DN2 A;  4UFI A;  4E8C A;  4Y22 A;  4E4H A;  3LPF A;  1G9C A;  1AYN 1;  3UET A;  5J3U A;  4C1X A;  1LOA A;  4ASL A;  2YBS A;  5JSP A;  1RUG 3;  1OPM A;  4MGS A;  1WLW A;  4Q0P A;  1JZ4 A;  3UJO A;  1YUD A;  3T2Q A;  1AX2 A;  1PGW 1;  1YO8 A;  3HWJ A;  1XYN A;  1FNY A;  3K48 A;  2W47 A;  1YWK A;  3M3C A;  3SEE A;  1KFX L;  1NT0 A;  2WZ8 A;  3O1U A;  2XVK A;  4P9I A;  1N1T A;  4WM8 A;  1Y3T A;  2LRO A;  1RUJ 2;  1COV 1;  2OS2 A;  2ZAH A;  3Q9O A;  5T52 A;  2VUC A;  1U5I A;  1DYP A;  4IE5 A;  2PHX A;  2WAA A;  2J1V A;  2YMZ A;  1N3P A;  4BPZ A;  1MQT B;  4QPG C;  4CCJ A;  2WR9 A;  1YHF A;  5FJK A;  5L19 A;  1K3I A;  1HRV 3;  2OYZ A;  5C4W B;  4Q1P A;  4CXW A;  1QJY 2;  5L36 A;  3KF5 A;  5F3I A;  1S55 A;  2DDU A;  3ITQ A;  3LOB A;  1TMF 3;  1RUD 1;  5JOX A;  4SLI A;  1AR8 2;  2C9K A;  3F2Z A;  4AQT A;  2YDE A;  2FDI A;  3ZYB A;  5FZ8 A;  1W6N A;  3IDB B;  2IFW A;  2BNN A;  1ZA4 A;  3OBA A;  4XFA A;  1DGW A;  1W03 A;  3FN9 A;  3IKW A;  4MGI E;  4XW3 A;  1OD3 A;  2VZR A;  3ZPO A;  4BCU A;  3KHC A;  2PQQ A;  1SBF A;  5HBA A;  3WQB A;  2I74 A;  1LR5 A;  4B7K A;  3AVS A;  2EIG A;  2CGO A;  4AL9 A;  2DCJ A;  3D3A A;  2FZ2 A;  1CWP A;  2MEV 3;  5HXV A;  1VRH 3;  5C3R A;  2QQV A;  4N53 B;  4UBH A;  4CP2 A;  3K3O A;  5JI9 A;  2E63 A;  4YYO A;  3GF6 A;  1K5M C;  2ZGL A;  1OUR A;  1XJA A;  1BZW A;  3AFG A;  4Q0S A;  1VMF A;  3ON7 A;  3OBT A;  3FL7 A;  4OUM A;  5CBL A;  4BME A;  3EYP A;  5C8C B;  4URT A;  4TYS A;  2WLP A;  1GQP A;  3HNB M;  3RQ0 A;  2BWA A;  3ALQ A;  3CF6 E;  4YVW A;  5JSO A;  4QGL A;  5FYM A;  3SXW A;  5GKA C;  2R1D A;  2QJV A;  1QJZ A;  2R1B A;  3GM8 A;  1VBA 2;  2E9Q A;  4YRD A;  4LA3 A;  3VBF A;  1EAH 3;  4JHT A;  2ZMN A;  4CCN A;  1O5L A;  2HYK A;  1DZQ A;  4CUC A;  2GH8 A;  4K21 A;  1GNH A;  2XVG A;  1U5X A;  4COY A;  1CAW A;  1ZZC A;  3KV4 A;  4ORF A;  4FAH A;  2Q0A A;  1H2M A;  5D1I A;  4KWK A;  2ZAA A;  4COZ A;  5A32 A;  4YM2 A;  2EIB A;  1G9D A;  3NJZ A;  3VBH B;  2V72 A;  3VZJ A;  2A6V A;  2IXK A;  1RXG A;  5TSW A;  1GKB A;  1GOH A;  2OXB A;  2R0H A;  3OF1 A;  2ZA9 A;  3BB6 A;  3VDA A;  5CKQ A;  3HPN A;  4XQW A;  2H0B A;  1DQ6 A;  1C1L A;  2GC2 A;  2XLF A;  4FSJ A;  1X50 A;  2A6Z A;  1SLB A;  3VZL A;  2OII A;  3GBG A;  3KHB A;  4I0A A;  2IC1 A;  2QTW B;  2W1Q A;  2ZBJ A;  2DCT A;  3OY8 B;  2RS5 2;  4KGG A;  3QOP A;  4OI1 A;  2VG9 A;  2BWC A;  2LS6 A;  3EQE A;  2JG8 A;  4JZR A;  2A7A A;  2EF6 A;  4AVC A;  1OOP B;  1FV3 A;  2JG9 A;  4DZG A;  5CA6 A;  1DF0 A;  1EP0 A;  3FFZ A;  4D6S A;  2HWC 2;  1XQN A;  2P1B A;  2VUJ A;  3ME2 A;  4E2G A;  3KM5 A;  3VZN A;  4FPJ A;  4CUB A;  1SQ4 A;  2C1F A;  1QQP 2;  3HN1 A;  4PLM A;  3B3Q E;  3P6B A;  3DEC A;  4DXR A;  1LHW A;  3J8F 3;  3FE5 A;  4IGO A;  3T2O A;  1OUX A;  3GDB A;  1UOF A;  2OZJ A;  3KVA A;  4QX3 A;  1IHM A;  4R9D A;  1QXJ A;  2A73 B;  2BER A;  4K8F A;  1MEC 3;  4YW2 A;  5C7G A;  3O0W A;  3RWK X;  1I6X A;  2IXC A;  4PHZ A;  4X8P A;  2C26 A;  1L7R A;  1AX1 A;  3C7E A;  2TUN A;  5DUW A;  1Y9G A;  4CDU B;  5ABJ C;  3OD0 A;  3TEX A;  4OQ9 A;  3U14 A;  3NAP B;  3U0Z A;  2H6B A;  4PIX A;  4Q1R A;  5HCA A;  1SBE A;  4XXP A;  3WLU A;  1AR6 2;  1JYI A;  3T30 A;  5FY7 A;  1UD1 A;  3RYK A;  1SFN A;  4X6R B;  5CZK A;  5EXO A;  4NRQ A;  4RR3 C;  2I07 B;  1PGL 1;  4XVH A;  5JXJ A;  3AC0 A;  4YGD A;  1F2N A;  1VBD 3;  1S0J A;  2XJP A;  5FZB A;  2RS1 2;  3IAQ A;  4RQP A;  2X10 A;  4HN1 A;  1PO2 1;  3E6C C;  4NIG A;  2YUE A;  4ES8 A;  4QPW A;  3N7J A;  2DV9 A;  3WUD A;  2JB4 A;  3GXU A;  3OSD A;  3USU B;  5JLV A;  5F9T A;  1TME 2;  3K4A A;  2NQY A;  5A7Q A;  4N9I A;  4QX7 A;  4IGP A;  3V56 A;  1REE A;  1WUV A;  2D93 A;  4XTM A;  5JDB A;  1O3T A;  3AYA A;  5AFB A;  1X9P A;  2RM2 1;  4A3X A;  3RSJ A;  5F5Q A;  3ZPY A;  4XF9 A;  3IDC B;  2KD7 A;  5FV3 A;  4Q26 A;  3VDD A;  2BNM A;  1ASJ 3;  3FLR A;  2UUR A;  4AI9 A;  2FDJ A;  2HEW F;  1UO9 A;  1W2O A;  2E7A A;  3VL9 A;  4Q4Y 1;  5ERL A;  4LJH A;  1GZC A;  3OGR A;  3N9L A;  4AEM A;  1GMM A;  1XU2 A;  2QQM A;  4EYU A;  4YNI A;  1F8V A;  5FZL A;  1OQ1 A;  1V6N A;  3PIJ A;  1OA3 A;  4OHV A;  1QOT A;  1JZ5 A;  1J3R A;  1CZT A;  5A3U A;  4PCR A;  1HB4 A;  5FZG A;  3FBY A;  3OEB A;  4ZU5 A;  4XDO A;  1HB1 A;  1R08 1;  3L9J T;  1AR9 1;  4QXH A;  2ARE A;  1J59 A;  5JPN B;  4YW7 A;  3FZ3 A;  3KSC A;  4QGM A;  4XF4 A;  5DXD A;  5FY1 A;  5CG9 A;  1K42 A;  5FCC A;  3TNQ A;  4LLO A;  4M01 A;  1W6Q A;  4XFH A;  3VHO A;  1B35 B;  1CIY A;  1RUI 2;  2JDP A;  4A41 A;  2FDF A;  4GQ7 A;  5F5C A;  5FLJ A;  1FMD 3;  1ZBA 2;  2UY8 A;  4JDN A;  2VR4 A;  2OUJ A;  1AL2 2;  4RFR B;  4K1Z A;  4P9X A;  5FZC A;  3ZMN A;  2WO2 A;  4JRL A;  3AYE A;  1EPW A;  4KG8 A;  2Y6J A;  5KHG A;  4Q2F A;  5KHJ A;  1PIV 1;  3TN9 2;  3GGL A;  3U11 A;  2WZR 3;  5JXH A;  1WW6 A;  5FYU A;  3LWC A;  3ZDS A;  2VNG A;  4C1W A;  2D7F A;  1KGY A;  3TEZ A;  5C8W A;  4MXV A;  1HRI 2;  1VB2 A;  5F6L B;  1UN1 A;  2R06 2;  4LKS A;  1VMJ A;  1HN1 A;  3AYD A;  4QPG B;  2BUK A;  2RV9 A;  2XR4 A;  1W2N A;  1HV1 A;  1RHI 2;  1DFQ A;  1L7Q A;  2JD4 A;  3AKR A;  4IES A;  3JBG 1;  2XOM A;  3WDX A;  1L3J A;  5EZW A;  5AVP A;  3QBQ A;  4MLO A;  5JWP A;  1UY0 A;  3SCH A;  3MW4 A;  3F95 A;  3K75 B;  3PJY A;  3LD8 A;  1ZRF A;  4KBB A;  4XUN A;  3BVC A;  3ZFG A;  5FYV A;  3DF0 A;  2MHF A;  2RS3 1;  3LPG A;  2YY1 A;  2QKD A;  5IFT A;  1CQ9 A;  1E5R A;  1PO1 1;  3PTY A;  5F8P A;  2YHJ A;  2VBB A;  4OCT A;  4AVA A;  3N4M A;  1AZD A;  5A3M A;  2PAM A;  2Q1Z B;  5DAB A;  1XOY A;  2D6K A;  3QH7 A;  3KCX A;  4GWN A;  1UU4 A;  3WQ0 A;  4UT5 A;  1GWL A;  2YBK A;  5BNN A;  4V2W A;  1PX3 A;  4NR1 A;  2VTX J;  1K5M B;  4CDQ A;  1I1E A;  3EB7 A;  1O4Y A;  4QQO A;  2CY6 A;  4JV4 A;  2WZE A;  5A7W B;  1ST8 A;  4DQA A;  1A8D A;  1GP5 A;  2I45 A;  2Z69 A;  3PUS A;  4GMP 3;  4CU6 A;  4G4F A;  4DIQ A;  1G8W A;  3NNL A;  4ZY9 A;  1WLD A;  1UMI A;  1GOG A;  2VE1 A;  5BNO A;  2YC2 A;  1GOF A;  4IEY A;  3T0D A;  3MID A;  5DAV A;  2F4P A;  5FMO S;  3WW4 A;  1RB8 G;  1ZRE A;  1AHS A;  1ULE A;  2AH2 A;  2WYS A;  3MLK A;  5A7O A;  3W20 A;  1MS1 A;  1YI7 A;  3WOG A;  4TWT A;  1QNW A;  2WC2 A;  3M3Q A;  1FI2 A;  4XUP A;  2A70 A;  4FOV A;  2D6O X;  3O0X A;  3HNY M;  1LHU A;  4QKB A;  4QQL A;  1Z78 A;  4WM7 C;  3VZO A;  3WF0 A;  2AZ5 A;  2ZGT A;  1XPW A;  1BCX A;  2Y6L A;  2VD7 A;  4XFB A;  3VBS A;  1YIF A;  3RZK A;  2SBA A;  5CG8 A;  4CDW C;  2G9F A;  5FJH A;  4QQ2 A;  3TB0 A;  2BFU S;  2VZP A;  4P08 A;  3GCW A;  1LOC A;  3I2D A;  1W04 A;  2WAO A;  1G9A A;  5K0U B;  4O9E A;  5FUN A;  3E5X A;  3D82 A;  4FQ4 A;  1NE4 A;  1SLC A;  1UYP A;  5FPX A;  3H8X A;  2WJS A;  4OLL A;  4OVE A;  5FY5 A;  1K5J A;  4JAA A;  5DG1 A;  3TEW A;  1Y9M A;  5FZD A;  1W9S A;  1B09 A;  1X8E A;  1IZ3 A;  1HIX A;  1JUH A;  4OZO A;  4BH9 A;  4P00 B;  1W8F A;  3RG0 A;  4JGZ C;  3ZXJ A;  4U2A A;  2HWB 1;  4C0H A;  5FP3 A;  1BQP A;  1LGN A;  4MX3 A;  4LO8 A;  4D7T A;  4DPN A;  1FAY A;  4AED A;  1Q3E A;  1UIJ A;  2FHR A;  2JDM A;  3ZYR A;  5ABJ B;  3AKT A;  1LES A;  1UKG A;  2ZHK A;  3NNJ A;  4EE2 A;  4E4Z A;  2RDQ A;  3V0A A;  1NQJ A;  3I3D A;  4QQH A;  3LE0 A;  1VB4 A;  3B7M A;  2W46 A;  2X8K A;  4FPK A;  3W21 A;  2H0V A;  4LMF A;  1QMJ A;  4CEW A;  1QJF A;  1YFY A;  2YGM A;  3ES1 A;  3WD5 A;  1LB2 A;  1RUH 2;  4FOY A;  1UNB A;  1KFU L;  1W8N A;  1JH5 A;  3RI8 A;  4Z8B A;  3ILF A;  1QNY A;  1NXD 1;  1QF3 A;  2V5Y A;  3AYC A;  4A44 A;  5FTT C;  5F2S A;  3DN7 A;  3RS6 A;  4XYX A;  3THP A;  1W0N A;  1IS3 A;  4Y1V A;  3UKT A;  2VQT A;  3W59 A;  4CU8 A;  4YM3 A;  5CNA A;  1IOA A;  1RUN A;  5C33 A;  1WBF A;  3SNM A;  2GC0 A;  1Y9Q A;  4ZZ5 A;  3WNL A;  5A6Q A;  3PU3 A;  4FPL A;  1W2T A;  1HKD A;  3Q8E A;  1GUI A;  4ONU A;  1C57 A;  1YQ8 A;  1RUG 1;  2Y33 A;  2D6N A;  3B00 A;  4BIO A;  2Z79 A;  4GWM A;  5I8T A;  4YLZ A;  5FZ0 A;  4YFZ A;  1JHJ A;  2RM2 3;  1PK6 A;  3HT1 A;  4JX0 A;  1GWM A;  3ZN4 A;  1R09 1;  3JD7 2;  3Q8C A;  1HB3 A;  4OHW A;  2Y0O A;  5GLU A;  3T4H B;  1F4H A;  3R0R A;  3KGZ A;  5L9V A;  4LHS A;  2YRO A;  2HWD 1;  4TSV A;  3R4D B;  4NIA A;  3OG2 A;  4QX5 A;  5B2G B;  1BMV 2;  1ZVF A;  3AZY A;  5BY5 A;  3N36 A;  1QY4 A;  4W65 A;  3IIA A;  4YVW C;  1MZF A;  1OVS A;  1F31 A;  3N9M A;  1HRV 1;  1QH6 A;  3U10 A;  4E27 A;  5ACA 1;  2E7Q A;  1W6P B;  1CAU B;  2ZX2 A;  3ZN6 A;  1Z7S 1;  2W0X A;  3VBF C;  1H9W A;  3C2U A;  1F4A A;  4HVQ A;  2QQN A;  4BU2 A;  2HKX A;  4MUV A;  2KXL A;  1ALY A;  5BV6 A;  5D8A A;  5BUV A;  5LCW L;  1ULG A;  1AR9 3;  4FXG B;  2DCY A;  4F8A A;  2JX9 A;  3WP6 A;  3AJZ A;  1AXY A;  3IZO A;  1TMF 2;  2ENR A;  2ARX A;  2WQZ C;  3DYM A;  3NNM A;  4HG6 B;  3I8T A;  5IK4 A;  5M0T A;  4N7U A;  1JW6 A;  1QH7 A;  2YV8 A;  5JMC A;  2JE7 A;  3NJX A;  5JZG B;  3ZR6 A;  1M4W A;  4UAP A;  5A1A A;  1CON A;  4JKK A;  3OUI A;  3SKV A;  1ENS A;  3PLQ A;  1XSQ A;  3CJI B;  4HOO A;  5FQ0 A;  2ETE A;  3OUH A;  5G04 L;  2QFE A;  4AI8 A;  4LBQ A;  1VRH 1;  2AAC A;  3WSO A;  1GBG A;  1V9U 1;  4BJ0 A;  4M4P A;  4JKL A;  1ODM A;  1NQD A;  5EYY A;  2D5H A;  2JG8 C;  2DBN A;  1PIV 3;  4OYU A;  2JG9 C;  4RS5 B;  1JYT A;  3MBW A;  4D6R A;  3GHM A;  4RHV 2;  3LAG A;  4NUB A;  3OGJ A;  2Q8E A;  4TZD A;  2R49 A;  3HVD A;  5GLZ A;  5K9Y A;  2NLR A;  2EXH A;  3A0K A;  5FR3 A;  1CPN A;  5BXX A;  4H3W A;  5FUI A;  4YZ5 A;  2WT0 A;  3JBG 3;  4L92 A;  2D40 A;  1NA1 C;  5FZ6 A;  4IV1 B;  1XB9 A;  4CSW A;  1W90 A;  4BK4 A;  1UYX A;  4AQS A;  5KBF A;  4JDM A;  2DFB A;  2VVD A;  3BN6 A;  3LDK A;  1RUE 1;  5FIX A;  5CFC A;  2C6S A;  3THT A;  3B5L B;  3WZ1 A;  5DZF A;  2HWE 3;  2EXK A;  2P34 A;  1VBE 2;  2J1U A;  4IE6 A;  4EN9 B;  2WSU A;  5I0R A;  5A80 A;  2RS3 3;  4LK7 A;  1E5S A;  4Y24 A;  3H8R A;  3C7F A;  1PO1 3;  2R7E B;  5H9P A;  2ZML A;  2WNV A;  2W95 A;  4GJZ A;  4IET A;  1SFP A;  4CCD A;  5LA0 A;  1ULO A;  5F2W A;  1SDW A;  1WD3 A;  4PLO A;  2Y0I A;  3J4U H;  4YG6 A;  3P1I A;  5KWR A;  1HB2 A;  1BHG A;  1JTZ X;  4CYD A;  1GFF 2;  2ZX1 A;  4OMC A;  1W9Y A;  2VY0 A;  4LT5 A;  1DDL A;  3WG4 A;  5FFO C;  1US2 A;  3MUY 1;  5FYI A;  1LHN A;  1FX5 A;  1V00 A;  3KQR A;  2MPF A;  3ZKU A;  4ARY A;  1VBC 2;  2O8O A;  3LA7 A;  1ZZB A;  4UF0 A;  3J8F 1;  4WV8 A;  2DTY A;  2IFR A;  4GIQ A;  4IEU A;  5BPX A;  5E88 A;  3VDD C;  1VP6 A;  2BVB A;  1ZNP A;  1XE0 A;  2AYH A;  4XCB A;  2VUA A;  2VW0 A;  5A33 B;  5HI0 A;  2LW8 A;  4JCK A;  3D8C A;  4JGY A;  1I5Z A;  2ZX4 A;  3ZXK A;  1W8O A;  3RYP A;  3ECQ A;  2D43 A;  2YGL A;  1LOG A;  1AJK A;  4WM7 B;  1N1S A;  1EPZ A;  1AUY A;  3LDB A;  2X5I A;  1MEC 2;  2WT2 A;  3LIH A;  4NJ4 A;  3DPR A;  2Y38 A;  1RUC 1;  5LA9 A;  2VMH A;  5LB6 A;  1QJU 1;  5C9A B;  2CU5 A;  3IPV B;  4AVS A;  4YGC A;  4HN0 A;  4FFI A;  3RYR A;  4XFI A;  4B3N A;  1N1Y A;  4Q29 A;  1JOP A;  1ND3 A;  2KA3 A;  1SPP A;  1VBD 1;  5DUX A;  3GJA A;  4LOT A;  3AZX A;  2ZGQ A;  4M3C A;  1H2N A;  2ZHM A;  4QKD A;  4CCE A;  1CAV A;  4CP1 A;  1E5I A;  3IDE A;  3WP5 A;  1YQC A;  5FZ4 A;  3BTY A;  4QD2 A;  5IW0 A;  1DQ4 A;  5AC9 1;  1GQH A;  3O0V A;  3QCW A;  5CIR A;  4MYE A;  1CR7 A;  2WII B;  2VUL A;  3B02 A;  3WG1 A;  1F9K A;  5FY8 A;  1Q8V A;  4Y22 B;  2VOT A;  2LRP A;  4CZS A;  4JGZ B;  3PVB B;  4PDW B;  3DEM A;  4ZS3 A;  4EN8 B;  4CEY A;  1GP6 A;  4AEK A;  1X33 A;  1ULD A;  1LEM A;  4Y4R A;  3JXS A;  1ASJ 1;  2OW4 A;  2PLV 3;  3INA A;  3OD4 A;  5KXC A;  1U5Y A;  3THD A;  3WV6 A;  1D2Q A;  1PMJ X;  1PVC 1;  3I59 B;  3VLB B;  4Q4W 2;  2P3I A;  2YPJ A;  1OSG A;  1PZ9 A;  1N3O A;  2IXH A;  1MR5 A;  3RWN A;  5FYB A;  2HWB 3;  5JPM B;  4FTB A;  4NAM A;  4AYU A;  4XBQ A;  1RMU 1;  3VHN A;  2ZX0 A;  3NWK A;  3KZ4 C;  5JZG C;  4BDV B;  2V5D A;  5ISL A;  3WQ1 A;  2D3R A;  4NHK A;  2D98 A;  2WNU C;  5FZE A;  4KG0 A;  1U12 A;  2P3Y A;  4HPK B;  3PUR A;  2XHN A;  5EIY B;  1AR7 1;  5FBJ A;  1O4Z A;  2FDH A;  5J7M A;  5I0S A;  3CZJ A;  4PIZ A;  4MSV A;  1BJQ A;  2X53 S;  4CU7 A;  4AXO A;  5K8S A;  4V1P A;  5IT6 A;  1WA6 X;  2RMU 1;  5DDJ 3;  5FZO A;  1W6N B;  3WVJ A;  1RJ7 A;  1PHM A;  2R07 2;  3X29 B;  2PXJ A;  4AG4 A;  4YZ2 A;  1H8T C;  4AW7 A;  1JI6 A;  1WCQ A;  4KWU A;  5JUV A;  3LF7 A;  3N7M A;  4WVV A;  3VBR A;  2XJU A;  1CJP A;  1IKP A;  3AJY A;  1W6M B;  1FMD 2;  4S2F A;  5CVR A;  2K46 A;  2BOI A;  3ZDV A;  2WA4 A;  3QD6 A;  1JOJ A;  1V0A A;  3OPT A;  3OGV A;  4HLT A;  3A0N A;  1VR3 A;  2JB8 A;  2WZR 1;  2LAL A;  5A7N A;  4OI0 A;  3VL8 A;  5BNN C;  3AMQ A;  5LBC A;  1OLQ A;  4KU8 A;  4CDQ C;  2Y8K A;  3ACL A;  4AQ6 A;  4LKF A;  2BGC A;  2ZZJ A;  3KV5 A;  3NKT A;  3B69 A;  5EQU A;  4CP9 A;  1NCQ A;  2DFC A;  4OQ8 A;  1AYN 2;  4ATE A;  1VAK A;  2PEL A;  4IDZ A;  3BPS A;  2ATF A;  1YJK A;  3H8U A;  1R09 3;  4GB3 3;  2W08 A;  4CP0 A;  2WA3 A;  1POV 0;  4QDS A;  5L9B A;  3VBF B;  1QWR A;  1PGW 2;  2HWD 3;  1VBB 2;  2BTV C;  3O1S A;  5FO8 B;  2W2I A;  4GAZ A;  2W39 A;  2Q8D A;  2JDZ A;  2V4A A;  1CJD A;  1GZW B;  1YJL A;  3S0M A;  3O1R A;  3J7N A;  3NNF A;  1CGP A;  1COV 2;  3UNP A;  3ZO0 B;  4NRO A;  5ACA 3;  4YVS C;  4GXL A;  1WCS A;  1Z7S 3;  4QPI C;  2OA2 A;  3FHI B;  3PJQ A;  3URF A;  3DGT A;  4UWD A;  5BNP A;  3VBS C;  1KJL A;  3OB8 A;  1SLL A;  2RR1 1;  1Y4W A;  3OYW A;  4YM0 A;  4CE8 A;  2VME A;  4EQV A;  5FPZ A;  2VBD A;  4ZHN A;  3ZSL A;  1O59 A;  2JJ6 A;  3HMY A;  1Y7B A;  3W9A A;  1GP4 A;  1RUD 2;  4Y5T A;  1QJY 1;  2VW1 A;  3APB A;  4LIU A;  5T55 A;  4CCM A;  5CKM A;  3VBO B;  3VHP A;  4TLF A;  3MZH A;  4MAD A;  4RD7 A;  1ZZ8 A;  4D3W A;  2VCM A;  1GWK A;  3K51 A;  5FZ9 A;  3ZFE B;  4AFB A;  4Y3O A;  5KXD A;  4QDR A;  1WGP A;  1QOO A;  1CES A;  1FOD 3;  1H1A A;  2VNO A;  4GMP 1;  1V6O A;  1YC6 1;  5FUP A;  4DEV A;  2XML A;  2VZQ A;  1V9U 3;  2ZEW A;  4GWI A;  2P37 A;  1IQD C;  4XHB A;  1KS5 A;  2CAU A;  4PQ9 A;  4NRP A;  1NA1 B;  1RIT A;  1Y43 B;  4AED C;  5FY4 A;  4D8M A;  4IEQ A;  4IV3 C;  1DZT A;  2DVG A;  3WNK A;  4KQ7 A;  1ND2 A;  2GP5 A;  3TYJ A;  1SBD A;  2ZEX A;  4XCA A;  3CJX A;  4EN7 B;  1AVB A;  4Y1X A;  2HWF 3;  5FLI A;  1T6G C;  3GZE A;  2DF7 A;  5BNO B;  1O3S A;  4QB1 A;  3ETP A;  4CEW C;  2WO1 A;  3WNN A;  4MG2 A;  3IM0 A;  2X09 A;  2PMW B;  2C4X A;  2EA7 A;  4I01 A;  2D6L X;  2E51 A;  4Q4V 2;  1SCR A;  4Q0Q A;  2VPV A;  4S2D A;  4ZON A;  4ZKT B;  4K1Y A;  4KL1 A;  2ZS6 B;  3M1H A;  1O6U A;  1NYW A;  4AQ2 A;  5IAX A;  2P3K A;  4A6S A;  1RUE 3;  3LZZ A;  4GH4 B;  1OF4 A;  4ASM B;  2JKB A;  3BYW A;  1VBA 1;  2VW2 A;  3H50 A;  3VN4 A;  4E2S A;  5C3Q A;  5SV8 A;  3MDP A;  2XKP A;  4GKX A;  5A3W A;  3S30 A;  3T4V A;  1Q8P A;  4CDX B;  4BXS V;  1BEV 1;  5JR2 A;  2K0G A;  1O7F A;  3ZX7 A;  4AI1 A;  1G9B A;  3C7G A;  1QU0 A;  4LUK A;  1MQT A;  3MFC A;  3RGB A;  2DVD A;  5C4W A;  1OH4 A;  2A3X A;  1KXG A;  4DMI A;  5E6H A;  2JDN A;  2WZP P;  1PK6 C;  2QCS B;  4LE3 A;  3J7H A;  3WNP A;  4BM8 A;  3C3V A;  1AYM 1;  2XPJ A;  1EV1 2;  2XJQ A;  2J1E A;  4CRQ A;  3WIN E;  2GNT A;  3SC7 X;  3O1V A;  3M3E A;  2EAA A;  5FPL A;  1FAT A;  2NN8 A;  2QDR A;  2HWC 1;  2OT7 A;  5EPA A;  5A3N A;  1DIW A;  3BKZ A;  2A5Z A;  3MW2 A;  2A1X A;  4LTA A;  3LOI A;  4B29 A;  1RUC 3;  1JZ3 A;  1QJU 3;  5IAV A;  3RRD A;  1TE1 B;  4KI5 M;  2P17 A;  1FPN 1;  4AFC A;  1H4H A;  5FKB A;  4P5H A;  2NP0 A;  2R04 1;  2DUQ A;  2FBE A;  4N53 A;  5D8A C;  4AFM A;  3LGR A;  1ULF A;  1F5J A;  2RVA A;  3WDT A;  1PGL 2;  1W2A X;  3DL3 A;  4QX2 A;  4H2A A;  3USS A;  3QLQ A;  5BNQ A;  2ID4 A;  5J36 A;  1S0B A;  1AR6 1;  3H42 B;  1D4M 3;  3OBZ A;  1XBF A;  4UBG A;  3FFQ A;  5GJ6 A;  4CA9 A;  5AC9 3;  5C8C A;  1DBN A;  1PO2 2;  3K77 A;  1D0G A;  1F5F A;  1HQL A;  2EIC A;  3JB8 A;  4BE3 A;  3OTF A;  4D69 A;  3PNA A;  2HJI A;  4PT6 A;  3AP9 A;  3J7M A;  1WZX A;  1C8M 1;  2WNO A;  3VDC A;  4LPL A;  1JMU B;  1N1V A;  3GCX A;  3MPB A;  4LO7 A;  4OZX A;  1JOD A;  3BOW A;  3MI8 A;  5EHD A;  4K7J A;  1OLM E;  4M00 A;  4XBL A;  3U1X A;  1J84 A;  5E89 A;  2DCK A;  4IQP A;  2RJK A;  1PVC 3;  2WNU B;  5B4N A;  1WA4 A;  2ZTN A;  3EBR A;  4RGA A;  4XAE A;  4DEQ A;  4Q4X 3;  1I9R A;  4R9A A;  3I3E A;  4N43 B;  4Q4Y 2;  4FQZ A;  4Q27 A;  3SQO A;  3OUJ A;  3SEP A;  3VBH A;  1GR3 A;  1RMU 3;  5JCT A;  5H9S A;  1ZRI A;  1W8U A;  4A6O A;  3M3I A;  2WQ8 A;  1T6B X;  2Y60 A;  3ABZ A;  3ELN A;  1UPS A;  3UGG A;  2VTF A;  4YWA A;  5DMY A;  1APN A;  1JUI A;  2XL9 A;  4TXW A;  1ZZ7 A;  1H8T B;  2OPW A;  3OY8 A;  3R05 A;  2J1T A;  1AR7 3;  3JB4 C;  4FVV A;  5A6X A;  4XQD A;  3H3L A;  3WR0 A;  2YZ4 A;  3LEG A;  3VBU B;  3KVB A;  4LEJ A;  1R08 2;  5CFC C;  4CXY A;  2YU2 A;  3RJ2 X;  2RMU 3;  2QQI A;  3HR9 A;  1CPM A;  2ARB A;  2OQ6 A;  4XDP A;  3ILR A;  2ZZQ A;  5DZG A;  3ST7 A;  3WXP A;  2XDV A;  4MO3 M;  1RYY A;  4AFD A;  1BBT 2;  2WNV C;  2WKK A;  3AVR A;  4NN0 A;  4W6W A;  3VD5 A;  2B42 B;  5T5P A;  1A8M A;  3JZV A;  3LSE A;  1YEW A;  3ZLI A;  4TN7 A;  4AF9 A;  2W52 A;  4ZU7 A;  1XYP A;  4CDU A;  1YQ5 A;  2C9A A;  2NM1 A;  4N9H A;  4P5Y A;  1WWY A;  4UW4 A;  3NAP A;  4MOA A;  1QEX A;  3A4U A;  3LCP A;  5GZF A;  4BQ2 A;  5T50 A;  1YFU A;  4A7Z A;  5LY1 A;  5SV5 A;  2Z42 A;  1ACC A;  5FRE A;  4LLF A;  5JOZ A;  3WF4 A;  2XXZ A;  3A7Q A;  4FPE A;  1NG0 A;  1G86 A;  1S1A A;  5LAS A;  1OFN A;  4QU2 A;  5IK7 A;  1CN1 A;  1YFX A;  2E6V A;  4MVT A;  1IG3 A;  4AHX A;  5L7O C;  4JGY C;  1JYV A;  5IK5 A;  1I3H A;  3BOP A;  2ZX3 A;  4YVS B;  3FHQ A;  3RZZ A;  1W8Z A;  4AZZ A;  2VVE A;  3USU A;  4QPI B;  5LBB A;  2X5I C;  2XLA A;  3MGU A;  2BVV A;  2ET7 A;  4JC1 A;  3KT1 A;  5FPV A;  3JBG 2;  2D5F A;  3RZJ A;  1GSL A;  1NOV A;  1LU2 A;  5JOY A;  5H9Q A;  5T5L A;  2HWE 1;  4E4D X;  1CAX B;  3RZM A;  1ND3 C;  2JDH A;  2VGD A;  1H1I A;  1UYZ A;  2BRT A;  1DLC A;  5DZE A;  2F4L A;  2FCT A;  4NWV A;  2G1M A;  1C3H A;  1UIK A;  3WF2 A;  1VIW B;  5J48 A;  1WW5 A;  1RUJ 3;  4XBN A;  5IVJ A;  4CVU A;  3ZYI B;  3SH4 A;  2RR1 3;  2XBO 1;  2JE8 A;  5IVE A;  4LBK A;  1IPK A;  4FP3 A;  2EIE A;  1SLA A;  1PO1 2;  2VCC A;  1HXS 2;  2HEV F;  3AB0 A;  4I02 A;  2JXA A;  4LOR A;  3WF1 A;  5GZC A;  4LBM A;  1QJY 3;  4F83 A;  2E7T A;  4B4P A;  3POI A;  4QX1 A;  4DY5 A;  2CGP A;  3D4K A;  1JN2 P;  4D6Q A;  2JDY A;  2VVF A;  2WWS A;  4FAG A;  2YBP A;  3RMY A;  3IB3 A;  4NMI A;  3NV3 A;  5F37 A;  4IE0 A;  1AR8 3;  4IV3 B;  4PQQ A;  3PHM A;  4LHN A;  4LIV A;  4IND A;  5DAQ A;  1WMD A;  2QDN A;  4XIL A;  5I8Y A;  4IUG A;  4TTG A;  3NO8 A;  2VBP A;  1XND A;  3VZM A;  1REF A;  2AEZ A;  4LQR A;  4AE2 A;  1GNY A;  3BPZ A;  4MGK E;  2HBU A;  4BQ3 A;  2W92 A;  3I97 A;  1PNF A;  5L73 A;  4F3J A;  4YW4 A;  2O1Q A;  3N7L A;  3RFR A;  3DV8 A;  2IVJ A;  5CIS A;  3OOX A;  2VMD A;  4OFG A;  5CAD A;  4IGQ A;  5KXE A;  3ASI A;  2J42 A;  4XUR A;  2CV6 A;  1J1T A;  4IEX A;  2PHF A;  2VJX A;  3K4Z A;  3AKS A;  1WMF A;  4JKM A;  2YC0 A;  3P5B A;  4GWJ A;  4NIH A;  2P6C A;  4DXS A;  1RED A;  2VO5 A;  4XHX A;  5LK7 B;  2PA7 A;  4XPV A;  1SFY A;  1MVE A;  3LDR A;  3CDZ B;  3H1M A;  3HBK A;  3Q8F A;  3E5Q A;  3UGH A;  1VBA 3;  1W9T A;  3GZU C;  3VD7 A;  3VBR C;  1OBN A;  4D94 A;  1QDC A;  4FO9 A;  4XOG A;  3ZXF A;  1LU1 A;  2Q5T A;  3KF3 A;  3R4S A;  4B8E A;  1OLM A;  4MET A;  2PLV 1;  4YZ4 A;  4NWW A;  4FFG A;  3V0B B;  1PK6 B;  2VZ1 A;  2FQP A;  4JTO A;  5JOW A;  3WF3 A;  4CDW A;  2ZCW A;  1BEV 3;  1MS4 A;  2WAB A;  4RGK A;  4AWD A;  3GZT B;  4A42 A;  3BTX A;  4HKL A;  4M4R A;  1UPI A;  3AL5 A;  3E5U A;  4XJA A;  1NCQ C;  2FMY A;  5DAW A;  3MO4 A;  3ZYF A;  4H7M A;  2JEM A;  2WS9 2;  3HNM A;  1AYM 3;  5FXZ A;  3H3U A;  3BTZ A;  3CMG A;  2BW8 A;  4PJY A;  5A7S A;  4RYD A;  1GU3 A;  2HH9 A;  2VQ0 A;  3MPP G;  1SG3 A;  4RR3 B;  4WM8 C;  1BYH A;  3ZMO A;  1RUF 1;  2EXJ A;  5IHR A;  2ZGU A;  5JSR A;  2HWC 3;  3G6J B;  1NY7 1;  5D8A B;  2GNM A;  4CCK A;  4FTE A;  1IGO A;  4AEJ A;  1OH3 A;  1K5M A;  1DYK A;  1QQP 3;  1W9W A;  2BNO A;  2RG4 A;  3I2H A;  5DDJ 1;  2ZHN A;  4XTP A;  1OHF A;  4UFL A;  4YW5 A;  5C5T A;  2D6M A;  2QQK A;  3H1Y A;  4WVM B;  1R1A 2;  1ZBE 2;  5A7W A;  3T1L A;  1FPN 3;  1RJ8 A;  3ES4 A;  4YFW A;  5A6Z A;  1X36 A;  4YSF A;  2GN3 A;  2WFF 1;  2GDF A;  4BIS A;  4YW1 A;  5BNP C;  5HV0 A;  2R04 3;  3FUO A;  2WSV A;  4CXX A;  4QB6 A;  2BBA A;  2JKX A;  1ZRD A;  1LUL A;  4A7Y A;  2XWB B;  2VZ3 A;  2CTV A;  4LBJ A;  4N90 A;  1Q8S A;  3BCW A;  1PMH X;  1GQG A;  4Q8K A;  1AR6 3;  2VUD A;  3JUU A;  2PHL A;  3M70 A;  2W1S A;  5EFU A;  1HW5 A;  5ANN A;  2HLE A;  2DUR A;  2GU9 A;  4YG0 A;  4CPB D;  2GP3 A;  4SBV A;  1C8M 3;  5FXW A;  4XMI A;  2VOX A;  4Q0V A;  4L8Q A;  1Q56 A;  1W3X A;  1H30 A;  2XLG A;  3I49 A;  1RUG 2;  2BP6 A;  2ARA A;  4GB3 1;  4AVV A;  2WN3 A;  4MV2 A;  2J22 A;  1HJF A;  2JIC A;  4L9B A;  1YNA A;  1TME 3;  4M0H A;  4Y20 B;  3H7J A;  3OGS A;  3J7L A;  4F7Z A;  4DFS A;  2R32 A;  4QHB A;  1R09 2;  3CEW A;  2B7Y A;  1X82 A;  1SLT A;  1AF9 A;  1W99 A;  1JBC A;  1C8N A;  4XFF A;  1G7Y A;  1POV 1;  5K0U A;  1QJX 1;  2HWD 2;  1RVF 1;  1UX6 A;  1POQ A;  1V70 A;  2XGX A;  3JD7 1;  4QGN A;  1ND2 C;  1WCU A;  1CVN A;  5LK5 A;  1CD3 G;  2A3Y A;  4OUS A;  4Q0U A;  4MXW B;  3KMH A;  2ZXQ A;  2W1W A;  4BHP A;  2VEC A;  1SMV A;  4DUV A;  1HRV 2;  5I8S A;  5FZ1 A;  1UMZ A;  3LFI A;  1H0B A;  5ACA 2;  3VD9 A;  1SHW B;  1GZT A;  2EVX A;  1VRB A;  2WNV B;  1DQ0 A;  4XF3 A;  5C71 A;  1UZY A;  2CHH A;  1IKQ A;  5LWB A;  3GBF A;  3RVH A;  1ZRC A;  3KQ4 B;  2CWM A;  3THC A;  3NVC A;  1JYX A;  3NV2 A;  1W8W A;  3ZYG A;  4KMQ A;  4EZH A;  2G4I A;  2VAU A;  2QQW A;  4GZ9 A;  3U4X A;  3MLL A;  4MHU A;  1S0F A;  2Z2S B;  5E1R A;  4XJ8 A;  4IEW A;  3M3O A;  4J25 A;  2GC3 A;  5LRS A;  5JMO A;  1FOD 1;  1QXR A;  1W9F A;  3AZZ A;  4J1W A;  2QQJ A;  4UF0 B;  3VB9 A;  4OHZ A;  4AHW A;  2HYX A;  3U4S A;  2Q8C A;  4LO4 B;  3E6D A;  2ADD A;  4DOU A;  3OPW A;  5L7O B;  1Q43 A;  1BK1 A;  1MQT C;  2PFW A;  2MEV 2;  1JZ2 A;  5CFD A;  2JE9 A;  2WO7 A;  1VRH 2;  2NZ9 A;  5C4W C;  1ZBA 3;  1PM7 A;  1US3 A;  1BXH A;  1PX4 A;  1V9U 2;  4LHL A;  3I3M A;  3KB5 A;  2DU0 A;  3KV9 A;  1AL2 3;  2R6Q A;  2UWB A;  4PBO A;  5DAP A;  2QUO A;  4ZU4 A;  1QJE A;  1WCD J;  3AFK A;  5F3G A;  1QOS A;  4A2U A;  5JIU A;  2JIJ A;  2HWF 1;  4IE4 A;  3N35 A;  2VTX A;  5JXG A;  1W6O B;  1W0O A;  3TN9 3;  3VHR A;  1SPP B;  1F35 A;  4CCL A;  4M3C B;  2ADE A;  1NZI A;  2GND A;  4Z2A A;  4DNY A;  2C5D A;  2PHR A;  4R8H A;  5C70 A;  3FX3 A;  5F39 A;  1CIW A;  1EAH 2;  4RSU A;  2Y26 A;  4IEP A;  4YM1 A;  2XJV A;  2VC9 A;  1PVX A;  1UZ0 A;  1MS8 A;  4EN6 B;  3HOB A;  2N7G A;  4ZS2 A;  2YG0 A;  1OD5 A;  2IXI A;  5J1X A;  3O1M A;  1DGR A;  3GZA A;  2NYY A;  4RQP C;  5H9R A;  4NII A;  4C8D A;  4FPG A;  4I0B A;  4LBO A;  3TRS B;  1X8M A;  4QM9 A;  1SZB A;  1OI6 A;  2XBO 3;  1O4T A;  3H9A A;  2ILM A;  4LXL A;  3BUC A;  5C8C C;  3DCQ A;  1KD7 A;  2KR2 A;  1J3P A;  3O12 A;  2R30 A;  2FDK A;  2GH2 A;  5CYY A;  1KEX A;  2ZGK A;  3O1O A;  1W6P A;  1CAU A;  3M2M A;  3UES A;  3ZSK A;  2RE9 A;  5GZD A;  1LOB A;  3GAL A;  3WDV A;  2ZHL A;  3T3Y A;  3UV9 A;  1NCR A;  1TQ5 A;  1UXZ A;  3L2Y A;  1UYY A;  1XC6 A;  4I30 A;  3U37 A;  3ZSJ A;  1MZE A;  1W05 A;  3O5S A;  4YG3 A;  4ISR A;  3KV6 A;  3WG3 A;  3ZYH A;  4A3Z A;  3SLI A;  3J8F 2;  5I0D A;  5IFP A;  3O1P A;  4E2Q A;  5KHI A;  1E5H A;  3WX5 A;  2XB6 C;  1XRU A;  1H2K A;  3SCF A;  5I0T A;  4QX0 A;  4BQX A;  1LCL A;  1PM4 A;  1S2K A;  2WLQ A;  2PQS A;  3BTA A;  4XFG A;  5JZG A;  4CDW B;  5F1R A;  3WY6 A;  1J83 A;  5A3O A;  5IYY A;  3C8X A;  3CJI A;  5GZE A;  3DXU A;  1S0C A;  4IW3 A;  4P9J A;  2YFU A;  1RUC 2;  1UWW A;  1PZ8 A;  4NAO A;  1IS4 A;  5IVF A;  1DU3 D;  4QB2 A;  4RS5 A;  4CUA A;  1VBD 2;  1ZZ6 A;  2LM3 A;  5FMO L;  2DBI A;  2B46 X;  3U78 A;  3UYJ A;  1D4M 1;  1IPJ A;  3VZK A;  4BLI A;  4FTS A;  1URX A;  4QKN A;  2V09 A;  1NLR A;  1IS6 A;  2Y6G A;  4N8M A;  4BQ4 A;  2OQ7 A;  4L2N A;  2O14 A;  5AC9 2;  2VNV A;  5EV7 A;  3K2O A;  2QZ2 A;  2WFP A;  1TG7 A;  1ZRR A;  5IVV A;  4W6Y A;  4XIO A;  4N7I A;  2D6P A;  4UW5 A;  1V6J A;  3PDQ A;  4IV1 A;  4J1X A;  4B1L A;  4CDU C;  2FDG A;  4PLN A;  4PI0 A;  4ZXK A;  5I0U A;  2E53 A;  3LA2 A;  1UOB A;  3NAP C;  2GMM A;  5G05 L;  4AI0 A;  1SLI A;  1ASJ 2;  4MGQ A;  2ZOE B;  4Q4X 1;  4BWO A;  3AK0 A;  3SCG A;  4WM8 B;  4PF5 A;  1V6M A;  4NO4 A;  1NXM A;  3S5Q A;  1FXZ A;  3DKQ A;  3KGL A;  4NE9 A;  3CQO A;  4QM8 A;  5LAT A;  3U07 A;  3ACF A;  5FZ7 A;  4LKE A;  2XJT A;  2IXJ A;  1LKN A;  4OUL A;  4LHK A;  4Q4W 1;  3ZXA C;  2JIG A;  4FOW A;  4IXL A;  2VM9 A;  1J58 A;  1MS5 A;  3CKH A;  3NST A;  1RUF 3;  5KR7 A;  3WG2 A;  1LRH A;  1MVQ A;  3J9S A;  5J37 A;  2BV4 A;  1H6X A;  5T5J A;  2VU9 A;  3CZU A;  4J6G A;  5F3E A;  5JAX A;  1N3Q A;  2E26 A;  2K2S A;  2Y34 A;  3AMM A;  4PBP A;  3ZFG C;  5FZ3 A;  4PIY A;  2QBX A;  5FP8 A;  3AL6 A;  5ANQ A;  1JYW A;  3ZXD A;  2WFF 3;  5A33 A;  2RMU 2;  5LRR A;  4BA6 A;  3R4U A;  2P3J A;  2TBV A;  1DQ5 A;  1JU4 A;  2GME A;  4IL7 A;  2WQ4 A;  1DYO A;  4WM7 A;  2QE3 A;  1NLS A;  3DYP A;  1WW4 A;  2JDK A;  2UWC A;  2W94 A;  5LA2 A;  3ZXL A;  4QQP A;  5C9A A;  1WBL A;  4JQR A;  3IPV A;  3B93 A;  2E31 A;  2Z4F A;  4V2V A;  1DCS A;  1OXC A;  4XJ9 A;  4EJR A;  4Z1V A;  4K9S A;  3B94 A;  3I2G A;  1A78 A;  2WZR 2;  3IMN A;  5KC5 A;  1O91 A;  2RJ2 A;  5F6K A;  2XUM A;  2ZAC A;  3UJQ A;  3AXE A;  2BU9 A;  2GSY A;  4YVW B;  3K3N A;  2Q30 A;  1DQ2 A;  5FZH A;  2VOV A;  4UXA A;  4B7E A;  1ND2 B;  1D2S A;  2AGS A;  4I2O A;  1PNG A;  1TEI A;  4XF0 A;  4YZ3 A;  5IWF A;  4AHY A;  5BNO C;  2VQA A;  1OFS A;  4DO0 A;  2WO3 A;  4OI2 A;  3AXD A;  3CL1 A;  1HJG A;  4JGZ A;  4PDW A;  1AXZ A;  3WW1 A;  3L2H A;  1CAW B;  2EAK A;  2UU8 A;  1POV 3;  3EJK A;  3MFA A;  1QJX 3;  3WDY A;  3RI9 A;  1RVF 3;  3JD7 3;  4JRA A;  4RL7 A;  2BPA 2;  1BVP 1;  5A32 B;  5IVY A;  5FO7 B;  1C5H A;  1WCK A;  2FCU A;  2WL1 A;  3TWI A;  4NID A;  1QGL A;  3GJB A;  1LOE A;  1YXW A;  1RUJ 1;  2PAK A;  1W06 A;  3I59 A;  1VBB 1;  1DQ1 A;  2VMC A;  2YU1 A;  4FXK B;  3UKN A;  3T09 A;  1UY1 A; 
#chains in the Genus database with same CATH homology
 4MGT A;  4O61 A;  3KHB A;  4QKN A;  2FDH A;  4MG2 A;  4CXY A;  4NPL A;  4NPM A;  2FDG A;  3BU0 A;  4IE6 A;  3T4V A;  3O1U A;  3I2O A;  3H8R A;  3BTX A;  3I3M A;  3O1T A;  4IE5 A;  4QKF A;  4NRQ A;  4QHO A;  5F8P A;  4IE4 A;  4OCT A;  4CXW A;  3BTZ A;  3RZH A;  4NIG A;  5DAB A;  3O1V A;  4IDZ A;  2FDI A;  3KHC A;  4ZS2 A;  3I3Q A;  3RZJ A;  3BKZ A;  3O1M A;  3O1S A;  3T4H B;  4NII A;  3RZM A;  3O1R A;  4IE7 A;  4NIH A;  2FDJ A;  4NJ4 A;  4CXX A;  4NRM A;  2IUW A;  4NRO A;  3BUC A;  3RZG A;  2FDK A;  4O7X A;  3O1O A;  3S57 A;  4QKD A;  3BI3 A;  3RZL A;  4ZHN A;  2FD8 A;  3H8O A;  4QKB A;  3T3Y A;  3BTY A;  3BIE A;  3I49 A;  3RZK A;  4IE0 A;  3O1P A;  4JHT A;  4ZS3 A;  3LFM A;  2FDF A;  4NID A;  3H8X A;  3S5A A;  4RFR B;  4NRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...