4HPKA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium nitrate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
110
Chain Sequence
KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Protein binding
total genus 32
structure length 110
sequence length 113
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hpkA00
2QFEA 4DXZA 1U5IA 1WMDA 1DF0A 2LUWA 1KFXL 4HPKA 1KFUL 5SV5A 4DY5A 1WMEA 4DZGA 3JQWA 4I3GA 2XVLA 1NQJA 2XVKA 3BOWA 4HPKB 5FAXA 3JQXA 1NQDA 1WMFA 3AFGA 2O8OA 4DY3A 4G9SB 1QXPA 3DF0A 5FBZA 2XVGA
chains in the Genus database with same CATH superfamily
2D3PA 2BGCA 2PHFA 1X8EA 3DPRB 2Q0AA 2ZHMA 5A1AA 5IVVA 3IKWA 1GQGA 1HB2A 2DWRA 4E2QA 2KXLA 5KC5A 2D3SA 1EV12 5FDBA 1OOPA 2D6LX 2ZGPA 3N36A 3GNEA 4N7IA 1T6GC 3PTRB 4WZCA 1T6BX 4BZ4A 4GALA 2D6NA 5C5TA 1VRH3 3BOPA 5L9RA 5JI9A 1CVNA 5CADA 3DPRA 3LA2A 3PLQA 3SQOA 4NUBA 1C5HA 1SCSA 3JD72 3NWKA 4HN0A 3H1MA 2VMIA 1I9RA 5C4WB 2GALA 2Y0OA 3D0SA 2W91A 1AUYA 2RV9A 2Y6KA 3KCYA 3O1OA 1UIJA 2ADDA 2YBPA 1UY2A 1XRUA 4AZZA 1MZEA 2OS2A 2TUNA 2YFZA 3DN7A 1OURA 4UFMA 1GFF2 4V1PA 2A73B 4OI1A 4I02A 3K4AA 3ZSJA 1ZBA3 3OUJA 5J1XA 5FXWA 1WWYA 3WNKA 2XONA 1J3PA 2EXKA 3CQOA 2PA7A 4OVEA 4QX3A 2OPKA 1AR72 3NO8A 3OTFA 4LLOA 4Q1PA 2RS13 1AL0G 1VBD1 1VRBA 4K6BA 5FK7A 4ET7A 5J7MA 2XMLA 4N53C 5CIRA 5DDJ1 5C4WA 4LUKA 5J48A 4LORA 4UBHA 2GNMA 1S55A 3WP4A 2P6HA 4W6WA 3DXUA 1UKGA 2D97A 4J6GA 2Z69A 4L92A 3B9IA 2RDNA 2VQTA 1TE1B 4NVPA 1BHGA 1PZ8A 2P5BA 4GB33 5FZ6A 3BYWA 2GH8A 4HLTA 4GA9A 2UYBA 4B7KA 3TAYA 1O4ZA 1ZZBA 2YYOA 3EXUA 4Y1ZA 1JMUB 2VCMA 4QDQA 2DCKA 3ZDVA 3CU7A 5GLUA 1CQ9A 1VBD2 3RFRA 2FCUA 1UZWA 4CU8A 5DDJ2 4CCKA 1DQ6A 3CF6E 4C90A 3R4DB 2R0HA 3LFIA 1UZZA 3T1LA 3BTAA 4LA2A 1UL9A 1EYBA 1D4M2 3LEGA 1XBFA 1C8M1 1Q8OA 4NRMA 4YSFA 4QPYA 1PNGA 1O3SA 1US3A 1LGCA 4AEKA 1Q56A 3H3ZA 1WCDJ 3CL1A 4RQPC 2R071 4QB2A 5LA1A 2SBAA 5FLJA 2OIIA 4AEMA 5GKAC 3RWKX 1NE4A 2MPFA 1DFQA 3WF4A 3WF3A 4H3WA 1LECA 4NPRA 2HLEA 1E5SA 1YQ2A 5F3CA 4CCNA 5JR7B 5A33B 1W04A 4FPEA 1QJX2 1Q8VA 1YI7A 2QJVA 2D5HA 1VMFA 1W6QB 4K8FA 3HD8B 2VZRA 1ZA7A 4I0BA 1C8M2 4DIQA 2WN3A 3GALA 1OUSA 4N53B 1RGSA 1W0PA 4NO4A 4D7YA 5HV4A 4M0HA 2AREA 4CDUC 1QJY1 5HXMA 4LTAA 1X82A 3MZHA 5CYYA 5FO9B 5T52A 4FXKB 1PX3A 5FIXA 4GJZA 2IXJA 1JTZX 1AR83 3N9LA 4ISRA 5FZ8A 5A33A 1H0BA 5IK7A 4QDRA 1F31A 4XHXA 2X8KA 4MHUA 1W6QA 1WD3A 2IXCA 3HT1A 1W0NA 5FZIA 4RFRB 4N53A 2WNUC 3A23A 3LEKA 5F6LB 3V0AB 4P5HA 3VZJA 2WA3A 3NAPC 4OHXA 2XJUA 4DXSA 3I2HA 4JDMA 3AKSA 2ZX1A 3IAPA 3WCSA 4LEJA 5DZFA 4AL9A 5FP8A 3OF1A 4UW6A 2XJRA 3NRUA 4Q2FA 3C2UA 4B4RA 1W8WA 1S0GA 5FYBA 3OBZA 4TYSA 3LE0A 5JMCA 1W39A 5FZ0A 4J1XA 3MO4A 3GDBA 5DPNA 3LIGA 1XE7A 4XZPA 3SCHA 2WYFA 4PIZA 3PMSA 1ULGA 4XYXA 2W87A 2ZCWA 3BN6A 5I8YA 4NPMA 4RQPB 2CGNA 1XSRA 3OEAA 2QQPA 1CX1A 5LBEA 3V0AA 1F5JA 1QF3A 2BOIA 2ZGSA 3NMBA 3VDCA 1J84A 1XNAA 2VL4A 2HYKA 2J1EA 2YU1A 4OHVA 5FYUA 4Y26A 3EBRA 5JZGC 4HSLA 1N1SA 5F8PA 4KWUA 4DMIA 4OI2A 4MGQA 2JDPA 4AEJA 3WG1A 1A6CA 4QQLA 4Q4X1 4LA3A 4GWIA 3EO6A 4D7SA 1YYNA 4GWMA 1AR73 1XNKA 3OGJA 4QGLA 4W8JA 4V2VA 3DL3A 4EN6B 3POSA 2B9VA 4DQAA 1UWWA 2UWAA 1O4TA 4QPGA 1XJAA 4BQ3A 2A5ZA 2ZEXA 4FQZA 4RQPA 4C1XA 2J1AA 4XACA 4BQXA 4BYYA 3D8CA 4I0WB 1DG6A 1W6OB 2GC0A 4CDUB 1V6KA 3VL8A 2ILMA 1KFUL 1FMD1 2RS31 5DXDA 2EVXA 1JYWA 1N3OA 1LHNA 1RTVA 5A7NA 3WNNA 4LKDA 3RZKA 4R4ZA 2VBPA 2CYFA 2P37A 3AP7A 2QQMA 2ZA9A 3E6BA 5HXVA 4K9SA 2FDIA 5B4NA 4LO5B 4Q4X2 2VECA 3AFGA 4UYBA 1LJ7A 1VB2A 2ZX0A 3JZVA 2V72A 4XFAA 3AZVA 2WNUB 3ACGA 1PZ9A 3MW2A 4N7UA 4M01A 4QKBA 3WF1A 2CY6A 3NAPB 3ETPA 2ENRA 2YPDA 2LALA 3WW3A 1JBCA 4A7KA 3AC0A 3UKTA 1W6OA 1C1FA 4CDUA 4UW3A 4CYDA 3GJBA 1JZ3A 1YCIA 5CB7A 1JYCA 4NHKA 4XPVA 3ACFA 1OKOA 1SLCA 3U4SA 4CPBA 1D4M3 1OUXA 2VBBA 1V6NA 4PQ9A 1KRIA 1AJKA 1FMD2 1RMU1 2RS32 3JXSA 3R0RA 4FOYA 3T4VA 4CCOA 3CKHA 3USUB 2GNDA 5FPVA 3IPVB 4XUTA 2JG8C 3IMNA 3U37A 5CKNA 4LITA 4UXAA 2WNUA 3NVCA 3NAPA 2A1XA 5LASA 3ZR5A 3MEPA 3EB7A 1UZYA 1MZ5A 4HOOA 4K40A 2GC2A 4LHLA 4R4XA 2NQYA 4OQ9A 3WD5A 3N4MA 1RVF1 5JZGB 3AYDA 1EAH2 2Q8EA 3H7JA 2ZPXA 1CD3G 1YQ6A 1LULA 3RI9A 1GZ9A 3VBSC 2VZSA 1QJX3 4GKXA 2FMDA 1ZBE3 4J25A 4KGGA 4GMP1 3IPVA 1RMU2 1W8FA 1NA1C 5ACA3 4A2UA 4UW4A 4XJUA 2ZGUA 2VUAA 3LKJA 5IAVA 3ETQA 5JXHA 1F2NA 5D21A 1WBLA 5FUPA 5FPAA 5IJRA 4Q4W3 4EQVA 2QUOA 4DNYA 3J9SA 4ZU7A 3O1UA 2PHTA 1ZZ8A 1VBB1 3J8F1 2E53A 2FD8A 4K1ZA 3KHBA 5FMCA 1NYWA 1RVF2 1C5IA 1COV1 1V6OA 4AW7A 4DS0A 2A75A 3GZAA 1NY71 3DYPA 1BEV1 1VBA2 1RUC1 4PDWC 2QQLA 5I0TA 1A34A 3RSJA 2H0BA 2WRAA 4JRLA 1GWMA 2W94A 3WLUA 3ZYIB 2PHUA 1X9TA 4CEYC 1DZRA 4ZS2A 4HBNA 1MPXA 4QKFA 5FY9A 2D98A 4Y4YA 1VMJA 1WCSA 4UOJA 2LRPA 5E1RA 1IS5A 5EWSA 1HRV1 2ZGRA 4QQ2A 1POV0 2VMHA 2WDBA 3J8F2 1VBB2 1YWKA 5G05L 2QQWA 1IS6A 2PHRA 1COV2 1H6YA 1LHVA 2JG8B 5KXEA 5F6KA 1NY72 1WMFA 1BEV2 3MBWA 1N1VA 5FLIA 1RUJ2 1Y9QA 1WW4A 1LOFA 4LBOA 4CUBA 4XDPA 1CX4A 2VNRA 4LNVA 2P6CA 1QOTA 2V73A 3VV1A 1XE8A 3MW3A 5LB6A 1YLLA 3OD0A 3VBSB 2YPJA 2KD7A 1GLHA 1W6MB 3PUSA 4W6XA 4YW6A 3CBNA 2EAAA 1QNWA 4RL7A 2D44A 2ARCA 2JG8A 4LOTA 3QH6A 2CNAA 1AJOA 4QX7A 3ZN5A 1F5FA 1HQLA 5FYSA 1EP0A 1MS3A 4MYEA 4P9LA 4AVAA 4HPKB 4AOCA 3NV2A 2QTWB 1ONAA 4AE2A 3IB3A 3UJOA 3CLPA 4MGKE 4E27A 5DUXA 1N1YA 1UYZA 3VBSA 3SEPA 4MG2A 1MEC3 1IPKA 3TYJA 1W6MA 3KT1A 4HETA 4LOSA 2VOVA 2B7YA 3PUIA 3RDIA 4PDWB 4D7TA 5ISLA 2WL1A 3WSOA 1UY4A 5CFCC 5C3OA 1V9U3 1PO21 4IL7A 4U2AA 2QQIA 3MHZA 1V6IA 2GDFA 4CEYB 4BISA 3LEIA 1H2LA 4S2FA 4HPKA 3SH3A 1NLQA 2AH2A 3LGRA 3WG4A 2DVDA 2E32A 2C26A 3C7EA 1BCXA 4LBJA 4P08A 1L7LA 3WDXA 3DYMA 1YIFA 1AHSA 1YHFA 2EA7A 4YGDA 1FATA 2AR6A 4IETA 4XCBA 4YW4A 2WIIB 1HKDA 4PBPA 1VJ2A 3KMHA 1VBC1 2VULA 4PDWA 4YRDA 3AZWA 1PM4A 2G4IA 3O1SA 4KU7A 4W4ZA 2OYZA 2ARBA 4MGSA 4CEYA 2BZDA 2XVGA 1LEDA 1D2QA 1KDMA 1Q8PA 3FWEA 2FDGA 4YG6A 2AEZA 2PXJA 2ORXA 2V4VA 4AI2A 1SFNA 2PHDA 4EV0A 5JXJA 5LY1A 4QHOA 5IK8A 2N7GA 2XXZA 4M3CF 5BYNA 4Q4V1 1UN1A 5JSRA 3ZKUA 2VGDA 2B39A 5JPNB 2YROA 4JKLA 1CWPA 4FOWA 1JZ5A 2KR2A 1LGBA 3HQUA 1VBC2 3S57A 3PDQA 1CPNA 1XB9A 1K12A 5A3NA 1AYM1 1XXNA 4PCRA 2R16A 2GMEA 4S2GA 5JOWA 5IYYA 3UGFA 2E51A 4EN0A 1RUD3 1SFYA 3LSDA 4JDNA 3LSEA 3OB8A 1A78A 3POWA 4HFSA 2WS93 4FAGA 4IEOA 5A3UA 1ASJ1 1AR61 2VR4A 2Q8OA 2VZPA 5J37A 3R4SA 4LO6B 3F2ZA 4QU1A 2JICA 1A8MA 1CZSA 3O0VA 3JB8A 4RHV3 1VBA3 4Q4V2 1UZVA 3PVBB 4FPCA 5CFCB 1GYKA 4CCDA 1XNBA 1HB3A 1I5PA 3I2DA 2NYYA 4TLGA 2W1QA 4CRQA 3W58A 5A3MA 2WT2A 1PO13 5E6HA 1RHI1 2CU5A 2DTYA 4BJ0A 1NXMA 1YQ8A 4XJWA 3GCXA 4IE6A 1RUI1 1UX6A 1ENRA 3FHIB 4HXCA 4N8MA 3MFCA 1Y9GA 1UIKA 2W1UA 4YGCA 5DAVA 3WDWA 5FZDA 2XJPA 1AR62 4XMIA 3VDDC 4NHLA 5A70A 1Q8QA 2X5IC 4KG0A 2ZABA 4ZHNA 3KVAA 5GZFA 1LU1A 1XPWA 4E4DX 5CFCA 3H8OA 3LFMA 4OMDA 2RE9A 4L97A 3O1PA 1XYPA 5JIUA 4H2AA 5T55A 1OLMA 3DECA 4FTEA 2JIJA 2E31A 3UKNA 1IQAA 4Q8LA 2A70A 3POGA 4Q4Y1 4A44A 4H14A 1U5YA 1Y9MA 3JQWA 4KGQA 3ILNA 5CBLA 2IFRA 1BJQA 4QT6A 4AHZA 1RUI2 1J3RA 5HV0A 4TZDA 2W39A 1PIV3 1MS5A 3PJQA 2FDJA 4NIAA 1SACA 2FBEA 4RS5C 3L9JT 5FBZA 3FLPA 5IUQA 3FLRA 2EF6A 3BPSA 4DRVA 2RMU3 1OI6A 1APNA 3FE5A 3P3NA 4PIXA 2D6MA 4A3ZA 2WQZC 3IIIA 1QKQA 3LAGA 4AVBA 3GBGA 3TNQA 3JBG1 1STMA 2BOJA 3WW4A 2VUDA 2ZGKA 4G3YC 1KD7A 4YM3A 5I93A 1PZ7A 3HN3A 4MGTA 1KJLA 4OCTA 1ND2C 4NE9A 3WQBA 4E2SA 5JR2A 1YRZA 3KV4A 5F1RA 1R082 3CZJA 3VHNA 3NJZA 2JWPA 4ZU4A 3I3MA 1BBT1 1PHMA 2EIBA 2JKXA 2OPWA 1JXNA 1GZCA 3MIDA 4E4SA 2QQVA 5FPLA 2I74A 5A7WA 5CEHA 1VLNA 5CVRA 1RUG3 3ST7A 3BIWE 1OMIA 2WNVA 1Z0HA 2ADEA 1BYHA 1U0AA 4MHRA 3LDRA 4BOWA 2GNTA 4LBKA 3VDDB 5F9TA 1WW5A 2W08A 2X5IB 2AZ5A 4EWDA 2VE1A 2ZJCA 4XQWA 4AHXA 5FZKA 1JYXA 1SBEA 2WNOA 5FFOC 2Q8CA 2PQSA 1OLQA 2PFWA 2X09A 4RD7A 4HKOA 3N9OA 1CN1A 2PLV2 4MXWB 1K5JA 1OPOA 1BBT2 2VCAA 1PVXA 3KCCA 4PJYA 3RZLA 1VRH1 1PVC3 2BQPA 4ZKTB 4IEQA 2DBNA 2RG4A 4KBBA 5DUUA 2JE8A 1KS4A 3A4UA 3B93A 4FP2A 3RZJA 1CR7A 4QX8A 1GWKA 2D6OX 3VDDA 3TEYA 2X5IA 3B00A 2Y6LA 2BFUS 2R32A 4RS5B 1TG7A 3UL2A 5FMOS 3UNPA 4ASLA 1AZDA 1JW6A 1LOCA 4JZRA 5D8AC 1ZBA1 4LHKA 1H1MA 1YJKA 3I2JA 4MXWA 4D69A 3FBMA 5FPXA 4LBQD 4ARYA 2LM3A 2BWCA 4GH4C 2P3JA 5C3PA 5CG8A 3AYEA 1JYVA 4BK5A 3LD8A 1OQEA 4AXOA 2IXKA 3K4ZA 3VDBA 2QZ2A 3HT2A 4C0BA 2RS11 1VRH2 3OD4A 3WDYA 4YARA 5CISA 2W92A 4PQQA 1W2TA 1LR5A 1DIWA 1P8JA 3WNXA 1UO9A 5C6CA 4RS5A 4B1LA 3H8XA 2JDAA 2W5FA 4JQTA 3AMPA 5FZLA 1BMV1 4SLIA 3FHAA 1POQA 3ROUA 3GF6A 4XBLA 5LK5A 2WLPA 1DQ1A 2V5YA 4GB31 3UV9A 3V56A 4EE2A 1ZBA2 3NKTA 1UU6A 3OOXA 1OA3A 3LWCA 1Q43A 1H8VA 1JHNA 5CFDC 1S0FA 1W9FA 3WXPA 1SQ4A 4MGIE 2RS12 4QAWA 2WO1A 5FYMA 3VBHC 3EQEA 4FSJA 4CXYA 3CIHA 2F4LA 3LB9A 1CAWB 1ZA4A 2RJ2A 4NR1A 3SEEA 3ZIXA 2AENA 4AI9A 2OW4A 3VZKA 2ZEWA 3TNPB 4AHYA 1BMV2 5HCFA 3MV01 1OKQA 1JOBA 2NM1A 2JDUA 2B5HA 4LK6A 3JUUA 1DGLA 4L11A 5GZEA 4GMP0 2Y34A 4P9GA 4BQWA 1ZZ9A 3DXTA 3ZSEA 4MV2A 2EXJA 3ZYHA 1AX0A 1CAWA 5GZDA 3U1XA 4L99A 5D8AB 3VDAA 5DAQA 5L9BA 3TB0A 3J7NA 5EHDA 2QDRA 3B69A 4GH4B 2D93A 4MUVA 2OVUA 3K2OA 1B35C 1DZQA 1H2NA 5A32B 2WQ8A 3KZ4C 4QGMA 5KHHA 5L36A 2AC1A 1F4HA 2H6BA 2PMWB 2R043 2ATFA 3IT8A 1NQDA 1PMIA 1VR3A 1NZIA 3W9AA 3JCIA 5AC93 5LK7B 2B9UA 5IVEA 4CP9B 1CJDA 1R083 4XHBA 4Y1XA 3LEMA 4YNIA 5C4WC 1W6PB 3B3QE 5F39A 3W5MA 1VPHA 3PIGA 3WG3A 4JKMA 2D5FA 5F37A 4LUMA 2XLGA 5CKQA 1GZTA 1IZ3A 2WWSA 5A3LA 4KWJA 1GZWB 4QKDA 4CZSA 1AR81 3HBZA 3KGZA 4GH4A 5JMOA 2CL2A 5A32A 5JWPA 4XC9A 4CCMA 1A8DA 3OBTA 5CFDB 2J42A 2BERA 3H0OA 1WLCA 4QX1A 2UU8A 2D40A 4F8AA 4JVAA 3VBHB 2Q4SA 5FZ9A 4NIGA 4CP9A 2GAUA 3S0MA 1J3QA 2O8QA 2Q30A 1V6MA 3IN9A 1W6PA 4MLOA 4EYUA 1UZ0A 2J1UA 2H0VA 3WQ1A 4Z92B 1ZRRA 2PLV3 1ZRCA 2D6KA 4GD4A 3BTXA 1RYYA 2E63A 2WLQA 1GZWA 3NV1A 2UWBA 5JIAA 2JG9C 1HRI2 1OH4A 1J83A 1XU1A 1AR82 3ZMOA 2Q5TA 1ZM1A 1RXGA 4KU8A 5CFDA 1QY4A 1U5IA 5F2WA 3IDEA 2SLIA 4LKEA 4RR3C 5FZHA 1Y7BA 4XJ8A 3KF5A 3VBHA 2NMOA 2UY9A 2DUPA 3LQCA 2WSUA 4R9BA 1HDKA 2CV6A 3J26N 1YNAA 5L7OC 2RM23 4BIFA 3UKVA 3S5AA 3RI8A 4G4FA 3MLJA 2Q1ZB 1W2OA 4NHXA 2A6VA 4YGBA 2VZ3A 1B35B 1AR71 1OFNA 5D2AA 1JZ4A 5FZ3A 4AQ6A 2VMEA 3VBFC 2ZHLA 1QXJA 4W50A 1OVSA 4A3XA 3OGSA 3ACLA 4XF9A 3HIFA 1EPZA 3FJSA 4HANA 1M06G 3BU7A 4UF0B 1AYN3 1VBE3 2VUCA 2VZVA 4RFT0 4KL1A 4Z1VA 1MS1A 1SG3A 1AXKA 5IVFA 4DO0A 3ZYPA 1IPSA 1JS9A 2HEVF 1RUH3 1YUDA 4FVVA 1REFA 1B35A 1WA6X 3MUY1 2JDYA 2E7QA 3PIJA 3VD7A 2DU0A 4JGZC 3RPQA 4BMEA 1V6LA 2X05A 1LHUA 4DB5A 2YC2A 2FMYA 1G8WA 3AMQA 2I45A 2OZJA 3MLLA 2BWAA 1R1A3 4ARXA 2DVBA 4UF0A 5FUIA 2QE3A 2CGOA 1W99A 4AEDC 4UWDA 2VZTA 5FP7A 2VZUA 1D4M1 5T5OA 2BW8A 3T4HB 3TOJA 3I2KA 4IGPA 2JG9B 3OG2A 4NWVA 4WM8C 1LNSA 5FJKA 2BBVA 1L3JA 2Y0IA 3Q8EA 1JYTA 4IERA 4XTPA 3P1IA 2W2IA 4RR3B 3EJKA 1VALA 5FMBA 4XIKA 1QQP2 5KXDA 5FZAA 1CGPA 2B45X 4KNCA 4PF5A 3H1YA 3ZXDA 4ATFA 1Z78A 1QGLA 3N9MA 4PHZA 3VGIA 5DAWA 5EJ1B 5IFTA 5F5IA 4C1WA 5L7OB 4FFIA 4D6QA 1HX6A 1R64A 1S2KA 3VKFC 2JG9A 1QJX1 4Q0UA 1ZBE1 1BK1A 3AXEA 3VBFB 5ACA1 2OX0A 5FYCA 3WW1A 3ZPYA 4TN7A 1OD5A 4RR3A 3GHMA 2VVDA 2VNVA 1NXD1 2EALA 1HW5A 4QPGC 1SLBA 3B94A 4Q4W1 5IVCA 3CJIC 3EYPA 4PI2A 1V6JA 4ZU5A 1DQ4A 3OUIA 1I3HA 2Q1MA 3WCRA 1UD1A 3RJ2X 5K9YA 3PU3A 5L7OA 3ZLIA 4IEVA 3RJRA 2YC0A 4XXAA 2A6XA 4NJ4A 4JGZB 3W20A 2QKDA 4QX2A 5EJZB 2GH2A 3VBFA 1ZBE2 5A7SA 4M3CB 2PELA 1XNDA 5ACA2 2VAUA 4BWOA 2FQPA 2P3KA 4EN7B 1C1LA 3RMYA 1LOGA 3HN1A 5A7OA 3I49A 5A1LA 2VTFA 4R52A 2CTVA 4AEDB 4Q4W2 4P9JA 3JU9A 4R9AA 3VHPA 3KT7A 3T2OA 4ASMB 4DINB 1RUE3 3RMXA 1O5LA 4GIQA 3VBUC 1XOYA 1G9FA 1DQ0A 4WM8B 5C3SA 1HRI3 2A3WA 4JGZA 4AVSA 4YVSC 1FNZA 2PHLA 1O91A 1QU0A 4MGZE 2BBAA 1REDA 4LLFA 4M4PA 2PYTA 2QCSB 3MIFA 2W68A 4XABA 3QBQA 4M3CA 4IE4A 2J1TA 5FPUA 4LJHA 1W6NB 4EJRA 1ST8A 2K46A 4OHWA 5JPMB 3T2PA 1V00A 4AEDA 4N9HA 2EIDA 2CAUA 2BV4A 2ZHKA 4XQDA 2DBIA 2I2SA 1GWLA 5FYHA 2OZ6A 4BA6A 1LHOA 1W03A 4WM8A 4DXZA 1MQTC 5BUVA 4PBOA 4JHTA 3D5OA 3CJXA 1JOJA 5HBAA 3OGGA 1MS9A 3RYRA 2JB8A 4WV8A 3S7IA 3THCA 4F3JA 1UNBA 4QPGB 5FYIA 1W6NA 3WDUA 3RS6A 3CJIB 4D94A 3VBOC 3HMYA 2DTWA 5CZKA 2RDQA 5FZCA 3FFZA 4BIOA 1RUF3 4XAAA 3E5QA 5FXZA 2Y60A 1K3IA 1MEC1 5DZGA 5FY0A 5C71A 1NCQC 2VD7A 4BCUA 3USSA 1JH5A 5JI7A 4LMFA 3AP9A 1V9U1 3IAQA 2ZKNA 4O9GA 4OFGA 1UYXA 4IQPA 5DAPA 5KR7A 4S2DA 4XFCA 3VZOA 3KV6A 3CJIA 2DV9A 5FZOB 4QHBA 4OHYA 5B4XA 5T50A 3U10A 3OEBA 3M3QA 3MW4A 2JEMA 3M2MA 5H9RA 4COUA 4CSWA 5A1FA 3BVCA 1E5HA 3ZX7A 1MACA 4FPJA 3KQ4B 5T54A 3VBUB 3BALA 4F7ZA 1OLRA 3T2QA 2UYAA 1G9AA 2ZGLA 5BNOA 4YVSB 5BNNC 1MEC2 1GICA 1UXXX 1AXZA 5T3NA 1CIYA 1MS0A 1ULOA 2VQAA 5H9QA 4ZY9A 1QQP3 1YIPA 3H42B 4LR4A 4N43A 3U14A 1V9U2 3AL5A 4Q5OA 3O1RA 3KF3A 4HT1T 4FQ4A 4IUGA 1HN1A 1LENA 5FZOA 4FCAA 2E7TA 3ZYRA 3CEWA 3N35A 3AK0A 5A7PA 3PMEA 5I0RA 1EAH1 1LOFC 5LATA 2W95A 5C33A 1WMDA 4D8MA 3VBUA 4COYA 5IVYA 1OF4A 2EXHA 3FLTA 1MQTB 2V5DA 4MH0E 3HEIA 1LESA 4KBZA 4NHMA 1CAUB 4XFIA 4YVSA 3BIEA 4XUNA 5LZ6A 1RJ7A 2XJVA 2VY0A 3GJAA 4FP3A 2VVFA 4FPOB 1SCRA 4P9XA 4QM9A 2WZ8A 3AYAA 4YM0A 3M1HA 2W1WA 2ZGMA 3ASIA 1MZ6A 4RSUA 3ZPOA 4CCCA 3FL7A 4TLFA 4OI4A 5L73A 4AGGA 1RUD1 3MIHA 3HNBM 3VBOB 1JZ8A 3M7AA 4Z2WA 2WS91 5F5QA 2R49A 4HZFA 4QD2A 4XEZA 5LBFA 1DQ5A 4YW1A 5LCWL 3NL1A 1NCQB 3MIGA 2VU9A 5FV3A 4RHV1 1MQTA 1VBA1 4YG3A 2HWF3 2RS53 1PK6C 1CAUA 2VOTA 2PAMA 1IKPA 3HPNA 1ODMA 2UY8A 2VM9A 3W59A 3RZHA 2WZPP 3NJYA 3E5UA 4D6RA 5GM0A 1PGL1 1IKQA 1PO11 3O7OA 4CA9A 3MI8A 4NIIA 4D3WA 4P9YA 1LKNA 4CP1A 3VBOA 2GSYA 4HMZA 1JN2P 1AF9A 2ARXA 3NV3A 2Z4FA 3ORJA 3Q8CA 5FZGA 4EN8B 2OQ6A 2DURA 1RUD2 2XVLA 4BXFA 4QU2A 3LOIA 5IAXA 1FXZA 2WS92 1FYUA 1RUNA 1NCQA 2WWJA 1HQWA 5FZ1A 1V70A 2C24A 2ZEZA 2O8OA 3NNJA 4AQSA 5BNNB 2OUJA 2ZAHA 4G9SB 4A4AA 4RHV2 5DG2A 1JYIA 3S5QA 5IK4A 2ZGNA 1CAXB 1RUJ1 2IC1A 2XKOA 4HKLA 2YXSA 4OLLA 2XQXA 5J09A 3ZXJA 3ALQA 3MIBA 3H3UA 1PGL2 2B8MA 1PO12 1OSGA 3H8UA 3UGGA 5DN2A 4XF0A 1D4VB 3ZN6B 3VD4A 2YDEA 4KWLA 2TEPA 5CAZA 4CCLA 1Q3EA 4Y1VA 1UAIA 3PURA 5BNNA 5IT6A 1PIV1 2VH9A 2XH6A 4AFDA 3VKNA 1XYOA 4NPLA 5K7PA 2Y6FA 2HWC3 3H50A 3GZUC 2R0FA 1CAXA 3DKQA 2WZR3 2ZACA 5HCBA 1IQDC 3GCWA 3D4KA 3VD3A 2RMU1 2QQUA 5FREA 2CHHA 3VKLA 4BLJA 2V4AA 3ZN6A 4CP0A 1RINA 4OUEA 5JUVA 1WMXA 1PK6B 2VOKA 3PVOA 1QJY3 2K2SA 4JHZA 1Z7S3 3A7QA 5FRAA 1FV3A 2G9ZA 4YZ4A 1HB4A 3SCGA 2RDSA 1PIV2 4JQRA 4KMQA 1X8MA 4AWDA 1XE0A 1YI9A 3N7JA 5GZGA 5L19A 2BU9A 3D6EA 1RUG1 4OMCA 2BFUL 5FZEA 1W0OA 2EXIA 5EXOA 2C1FA 4TTGA 5FMOL 4SBVA 3BTZA 2AYHA 1JOPA 3AYCA 2RMU2 1KGYA 4X6RB 4B7EA 2VQ0A 2KA3A 5LRSA 1SBDA 4ONUA 2W9XA 4XMAA 4LHSA 1LTEA 2GZWA 1PK6A 3UETA 2G9GA 2Y6GA 1OF3A 3P5BA 4QXBA 5FPBA 4DEQA 2J1SA 3E5XA 5AFEA 4MXVA 2D3RA 2BDRA 2RR13 3C7HA 3AZYA 3L2HA 2HH9A 4I3PA 4PI0A 4K1YA 4XAEA 3OCPA 3OJBA 2JKBA 4L8QA 4XCAA 5FP9A 3WEZA 4HVOA 3TN92 1DGRA 3EHKA 2ETEA 1BLZA 4AVTA 1PVC1 1D0HA 3J7HA 1RUG2 1TME3 5EJ3A 1Q5OA 4YW2A 3I8TA 4IEXA 3TBDA 1QOSA 1ZZ6A 1GBGA 2VNOA 4EROA 3KM5A 4GWNA 1ND3A 5APAA 2A6WA 4COWA 1TVGA 3HR9A 1DYPA 4JAAA 2IWGB 1KEXA 1HXS3 3B5LB 4Q29A 2CDPA 3IDBB 5JOXA 1W8UA 5LWBA 2CWMA 4OZXA 1O3TA 3KCXA 1H2KA 3C7OA 3ZIWA 4CUAA 2B46X 5FCCA 3GHNA 2JDHA 3NJVA 4Q1RA 5ERLA 1GMMA 1GQPA 1ALYA 1MS8A 3ZFEC 2VC9A 5DZEA 1J58A 1PVC2 3WVJA 4P00B 5FP4A 3I3BA 1DBNA 1KITA 1OA2A 4Q0SA 3WHUA 2J1VA 4F83A 3GXUA 3K3NA 4IEZA 4A6SA 4HN1A 2P3YA 3WY6A 4AAPA 1S0EA 4YG0A 5M0TA 3I97A 1ZRDA 2Y64A 3QCWA 3WNMA 3BKZA 1RUOA 4B4PA 5FKCA 1DLCA 2Y26A 3POIA 4NIDA 2CDOA 2WNVC 2Y6HA 4HK8A 5F5AA 3SHRA 4UFIA 1H4GA 4AAXA 3KWVA 1SDDB 2ET1A 5AFBA 4ES8A 4CUCA 1DHKB 2DCTA 1XYNA 3VBRC 1DYKA 1Y4WA 2VTXJ 2XLAA 4FPKA 2HYXA 3WNPA 1WCQA 5FY5A 4E8CA 1NT0A 3KS7A 4TXWA 1D7PM 1HLCA 3VB9A 1NCRC 4AFMA 2DCYA 3OPZA 1W2AX 3TEWA 1WW6A 5FKBA 2WN2A 3V64A 3SH4A 4S2HA 4QDSA 3I2IA 1YXWA 1M4WA 1SLTA 1LAJA 4OUMA 2X29A 3WUDA 1N1TA 3VZLA 2BNOA 1R1ZA 2ZX2A 3ZVXA 2HWE3 2W1SA 1BQPA 1WUVA 3I2FA 4AG4A 5FR3A 5FYVA 2R063 4PLOA 2JDZA 1AVBA 5LW9A 3K46A 3HWJA 3HBKA 3ZFEB 1FPN2 4TWTA 1OT5A 2R041 2UWCA 2YV8A 2BVBA 4XUPA 5AC91 2EIEA 4WVWA 5HI0A 1FOD3 3HAGA 4IEWA 1EUUA 1R081 3GBFA 5J96B 3RYKA 4PF1A 2BUKA 4IGOA 1QH7A 3O1MA 3E6CC 4OYUA 3O5SA 3TRSB 3MICA 3POYA 4Z07A 2LS6A 2ORZA 4JC1A 1RUC3 3GZTB 5A7WB 3OSDA 3ZFEA 3SH5A 2PHWA 2WNVB 3ZR6A 4DXTA 2VUJA 5F3EA 5D1IA 2IXIA 5ABJC 5IWFA 2HKXA 2R042 1ZX5A 3MF9A 1SLLA 2R6QA 5EZWA 3VBRB 1R092 1GOGA 5AC92 4K20A 2IUWA 3NKGA 5FK8A 2WR9A 3UESA 2MEV3 2WFPA 1AX1A 1O5UA 2PLV1 3OY8B 3Q8AA 2VBDA 3Q8BA 2VMCA 1NCRB 1UOJA 3TN93 4BE3A 4QPWA 5JOYA 1C4RA 4IEPA 4YZ1A 3P6BA 3U4XA 5JDBA 3ILFA 4YFWA 4AFAA 3MLKA 2FDKA 4HG6B 3ZMNA 3AMMA 1DP0A 3IM0A 4HL0A 3THDA 5FOJB 1HV0A 4MX3A 4CVUA 5KHIA 3VBRA 2XPJA 3I4IA 3SISA 4JX0A 2YZ4A 5JCTA 3KHCA 5EIYB 4H55A 1VE0A 2QBXA 1MZFA 2RJKA 2RM21 3OY8A 3T3YA 3K77A 1NCRA 4LK7A 4B8EA 2ID4A 1QDCA 5DG1A 3FUQA 4EWAA 3P3PA 1RL3A 1YFUA 1H9PA 3K51A 1ZRIA 2ZEYA 3URFA 2ZMNA 4JCKA 3VL9A 4W65A 4FPYA 4D0QA 3G7DA 4XTMA 1AL23 1QHDA 1G9DA 1W8NA 2A71A 2DVAA 4QPIB 3VKMA 1AYN1 1VBE1 2WNEA 2AUYA 3WDTA 3ABZA 1GP4A 1F4AA 3FHQA 4QB6A 3OPTA 1W90A 1GKBA 4AI0A 4AI8A 5H9SA 1RUH1 5FMDA 3CHXA 2RM22 2BTVC 3C3VA 4Y20B 2JIGA 2XR4A 3BGAA 4B29A 3H1WA 3IMMA 1GP6A 2ZTNA 3LCPA 4BLIA 5ABJB 5LY2A 1UYPA 3AMHA 3POEA 5FYYA 3WNOA 2P3IA 1VMHA 1R1A1 3ZXKA 4QPIA 4YW7A 1DGWX 3WQ7A 2Y38A 4QHZA 4RYDA 4E4HA 5J3UA 1AYN2 1VBE2 5E88A 1PM7A 3ZFFC 3I2OA 1KJRA 4L9BA 2GC3A 5F5CA 5FBJA 4WBBA 4Y20A 2ZMKA 1RUH2 3ES4A 3C8XA 1H1AA 5FZFA 5ABJA 2DCJA 3O0WA 4LBNA 4LO8A 3QLQA 3ACHA 3I2GA 3PTYA 3B01A 2Z2SB 4WVVA 3BI3A 5AVPA 4FT8A 3SKVA 5CG9A 2VMFA 2ZX4A 3E1F1 3N9NA 1J1TA 1R1A2 1KXGA 3ILRA 3KT4A 5A80A 2YBKA 3WR0A 1QJZA 1DCSA 1GNYA 3AP5A 3CO2A 1FPN3 1YQ5A 5K8SA 4META 4DY3A 1QJFA 2OXBA 3SXWA 1WLWA 1QJEA 1AYM3 3B02A 5FJHA 3WP3A 2JX9A 2J22A 3WZ1A 2JDKA 4GZ9A 3UGHA 1OLME 3S30A 1AX2A 3A0NA 2XWBB 4O61A 4CXXA 1F35A 3DGTA 1ASJ3 4J1WA 3AKTA 3GBWA 3NQHA 4O7XA 2CAVA 4X8PA 1YEWA 1VB4A 3FZ3A 3FUOA 5F3IA 4B1MA 3MV11 5I0UA 1EY2A 1DGWA 2E26A 2XBO3 3DEMA 4YVWC 3V0BB 4Y5Z0 4YZ5A 5C5UA 3NV4A 5E16A 2EICA 2XB6C 3WDVA 4COVA 1HV1A 2XUEA 4CPBD 3WG2A 2P1BA 4R9CA 2HWB2 2GP3A 4XW3A 3AZXA 4FTBA 3H9AA 5F3GA 1RHI3 5HCAA 5G04L 4O65A 1R093 2GN7A 3POBA 5HCHA 4AI3A 5BV6A 5A6XA 4IE0A 1G86A 4XZUG 1HQNA 1D0GA 2ET7A 4U36A 3AJZA 3LZZA 3O12A 1URXA 1RUE1 2YU2A 3ZFFB 4PLNA 4FPHA 4Y24A 2XJSA 3V0BA 5F2SA 1JODA 2QQKA 3J7MA 1HRI1 3LPGA 4CCEA 4XJAA 3SNMA 5KWRA 5FY7A 1J1LA 2DVGA 3ATGA 1F8VA 4QB1A 1VAVA 3NNFA 5GLVA 2GN3A 3VZMA 5JSOA 2DU1A 2BEOA 3NW4A 1ULCA 3MUZ1 5C3RA 1OVPA 1UYYA 2CWSA 4YZ3A 3RZZA 2CSGA 4ITCA 3ZFFA 2F17A 1CPMA 3KV9A 1AR93 3L2YA 5LA0A 5JLVA 1NAEA 1RUE2 1SEFA 2JXAA 1E57A 4KI5M 3GZEA 4IV1C 1IS4A 2HWD3 1KS5A 4XDOA 4LE3A 2BRTA 2A3YA 3ZXEA 4XFHA 1WLDA 5A3WA 3POFA 1XC6A 1WBFA 4PIYA 1LGNA 1X7NA 3RRDA 4BQ5A 2W52A 2BP6A 3K75B 1UW8A 1H4HA 3LF7A 3WX5A 1GQHA 3WINE 1H2MA 4IW3A 3V65A 1G6NA 4H7MA 5I8TA 4LT5A 2R30A 4UT5A 1RUF1 4LKSA 4CE8A 5I91A 1CAVB 4LBLA 1Q8SA 5FXXA 4YVWB 3IBMA 1JU4A 5GJ6A 3AKQA 4Q0QA 1OC1A 1DDLA 3RGBA 4YFZA 5IATA 4YLZA 1E5IA 3HQXA 4LO4B 3ZXGA 3AL6A 2YHJA 5EYYA 1SHWB 1SBFA 4DXRA 2ZZJA 1OXCA 1SLIA 3WNLA 1YQCA 3I7DA 3OGRA 4MGYE 3UYJA 4XETA 2VQUA 3ZSMA 1DU3D 1JUIA 1NX9A 3ZXFA 4A7YA 3X29B 4ZONA 5JSPA 4AF9A 1DZTA 1I6XA 2YBSA 3IDAA 4BHPA 1A3KA 2HEWF 1CAVA 5FWEA 3AZZA 4XF3A 4YVWA 4EN9B 3F95A 2K9ZA 5A6ZA 1RUF2 4BQYA 2J1RA 4OULA 4AGVA 1ZNPA 4LBMA 2YC4A 3RNSA 5FP3A 3AP6A 4C0HA 3ZM8A 1QQP1 4AQ2A 4MVTA 3MDPA 1QJU3 2XUMA 4Y33A 2F4PA 2X53S 1UMZA 5IHRA 5AVAA 3T0AA 1UKRA 5A7QA 4P02B 2XDVA 4BK4A 3CZUA 2VPVA 1GP5A 3N3HA 4NOTA 4NWWA 3SMHA 1ACCA 1W2NA 1C3HA 1YO8A 1S2BA 5KHGA 1GANA 2NPIA 4RN5A 3M3OA 5LBBA 1ULPA 1XNCA 2FCTA 4IV1B 4LIVA 4I30A 2O0OA 2DDUA 1JI6A 3R4UA 2BVVA 4LIUA 2LROA 1UY1A 4NAMA 1MVQA 4K7JA 1L7RA 4KQ7A 3TEZA 3DYOA 1UY0A 4LKFA 3FX3A 4DRRA 2FZ1A 1UU4A 4Q8KA 2KM2A 3T2TA 2VCBA 2J7MA 4UFKA 2HWF1 2RS51 4IV1A 4FAHA 1C8NA 5K4LA 2BYVE 5GLTA 1BK0A 2PN5A 4Y3OA 4YZ2A 2HWB3 1VAKA 4EWEA 4XVHA 1W8ZA 2H6CA 3ZSKA 1I1EA 1HB1A 2IXLA 3U0ZA 3ZDSA 1S0IA 1US2A 4HONA 2OQ7A 4ISQA 4Y5SA 4AYUA 4IEYA 4ZZ5A 4TSVA 3ZXLA 4EZHA 4DUVA 4M0NA 1NG0A 5FYTA 3HQRA 4I0AA 1VIWB 3U78A 4CP2A 3BOWA 1LRHA 1O3RA 2XWJB 3ACIA 4YW3A 5LEKA 2HWF2 1SDWA 2RS52 2XKPA 5FQ0B 1SPPB 1ZZ7A 3LPFA 3ON7A 4P5YA 5K0UC 1W3VA 4N43C 2JD4A 3SITA 1C57A 2WFF3 3H7YA 2R1DA 2C0ZA 3PJYA 3WF0A 4YM1A 3U11A 1I5ZA 3APBA 5CKMA 4E9KA 2DCZA 4COZA 3WP6A 2HEYF 3CMGA 3ZO0B 4N90A 3ENRA 2WT0A 3OGVA 2G19A 1JU3A 2HWC1 1QIQA 1ZVFA 5FQ0A 1SPPA 2WZR1 2VXRA 1H1IA 3HOBA 2VZQA 2E6VA 3KB5A 4CEWC 2ZX3A 2K0GA 1RJ8A 3SC7X 1POV3 2EAKA 4XFFA 2BGPA 3WHTA 5I0DA 3IWZA 4C91A 1CONA 4AQTA 4QX0A 1S0DA 4MSVA 2ERFA 2GC1A 1Z7S1 1MVEA 2R072 1WLTA 1SFPA 2D6PA 4LBQB 2GMPA 3U07A 1TMF3 1J59A 2LUWA 3GM8A 2WO2A 3BTYA 2GMMA 4DPNA 3VUOA 2LW8A 2HWC2 4XURA 2G1MA 4R8HA 2QZ3A 3RQ0A 2WZR2 3MFAA 3EMRA 4INDA 2VO5A 2LTNA 3MPBA 3BU0A 5GZCA 3BCWA 4FXGB 1X33A 1RIRA 4JV4A 4FBFA 4CU6A 2VOWA 2O1QA 1K5MC 1MR5A 1OH3A 4KH9A 1ZZCA 1EV13 2A6ZA 3ZOIA 3QH7A 4FFFA 1XQNA 2A7AA 1UXZA 2RR11 3RYPA 2YB7A 3SKJE 4LBQA 1B09A 1QJY2 1Z7S2 3ES1A 5K0UB 1CZVA 2OT7A 2TNFA 4LULA 4N43B 5I8SA 4K8RB 5FY1A 1DF0A 3JD73 1TME1 1W8TA 3THTA 5ANQA 1S1AA 1UPSA 1W9WA 4CDXC 4QXKA 1G9CA 1LODA 1S2EA 3MGUA 1EPWA 5FZ4A 2Z79A 1NQJA 2WQ4A 1HXS1 1FI2A 2OA2A 4CCJA 2ZZQA 4W6YA 4MO3M 5KXBA 4P14A 1BVP1 5JVVA 2RR12 4CU9A 5K0UA 4CEWB 1FNYA 4LE4A 3AJYA 4ZPIA 4X8NA 1V0AA 1H30A 2EIGA 1HJGA 3HJRA 4ES9A 3R05A 2I07B 4BU2A 5FUNA 4BH9A 4DFSA 1TME2 4A41A 2A6YA 2B42B 1IGOA 4GJYA 1X9PA 5FLHA 1OD3A 5I0SA 1NOVA 2ZMLA 1DQ2A 2V09A 3S6PA 1UPIA 4XXPA 1O8PA 3ZYFA 2IZWA 2VTXA 2GP5A 2XOMA 4YM2A 4QXHA 2WO3A 2FCVA 3BB6A 4Q26A 1HXS2 5F32A 5BNOC 5IK5A 4CEWA 2JJ6A 4XF1A 4Y1YA 3ZKYA 3ZYGA 5BNQA 1WZXA 4XE9A 1Y43B 1T2XA 1IG0A 4KWKA 2WSVA 3J4UH 1ULEA 4BQ1A 4IV3C 1QWRA 1K5MB 5DAXA 1VBD3 5CNAA 4E2GA 1DLLA 4QMAA 1KDKA 5DDJ3 4GAZA 4MZUA 2WINB 5BNPC 5C70A 1GR3A 4OQ8A 2JENA 3PU8A 1FT9A 1UOFA 5TSWA 2ZKLA 4CDWC 4JKKA 5T5LA 3M3IA 2WWUA 5FYZA 2VOXA 2P2KA 4ZZ8A 4XFBA 5DMYA 3DCQA 4BMBA 4JTOA 4UFHA 3VLBB 2NP0A 2WBKA 1GOHA 4CDXB 4B3NA 1VP6A 1K5MA 4LHNA 4H7LA 3JQXA 1E5RA 2YFUA 2DFCA 3N7MA 5FTTC 3PVEA 1W9YA 1CZTA 3KLSA 4UW5A 1G7YA 2W3JA 3M3EA 1NLSA 2HWE1 1ND3C 3OBAA 4BXSV 1YFWA 2FZ2A 5C3QA 5IFPA 4CTEA 4XOGA 5DUWA 3C7GA 4Y4RA 2R061 1CJPA 1W8HA 4ZS3A 4NN0A 3USUA 3INAA 3M70A 3VN4A 1C8M3 5C7GA 4XUQA 2VJXA 1ZYBA 2D7FA 4L2NA 2Y33A 5LA2A 1BZWA 3AFKA 4LQRA 4CDXA 3VHRA 4NMIA 3GYDA 4ZXKA 2YG0A 1FOD1 3QD6A 4M3CE 2WABA 5BXXA 2R073 4QXCA 4ZXEA 5JZGA 3NNMA 1FX5A 5C8CC 1KQRA 1UF2C 5FAXA 2L9LA 4IGQA 2P34A 1GNHA 1K45A 5BNOB 5CA6A 2HWE2 5IVJA 5DUVA 3T1MA 5DQ0A 4NHYA 4AHWA 5FZBA 1LHWA 2R062 4AFBA 2G9FA 5EPAA 2QDNA 3ZFGC 3PHMA 3NNLA 4IV3B 3N9QA 3UJQA 2XQRA 2NZ9A 3VD9A 5KXCA 4YPJA 4UFJA 5BNPB 3BUCA 3O1VA 2C9KA 2RJLA 1FOD2 2MEV1 3N9PA 4JTNA 1NUKA 3T08A 1UOGA 1XSQA 4CDWB 2F6BA 1S0JA 3OPWA 2WAOA 1YC61 3PNAA 1NE6A 4KG8A 1HN0A 2QQNA 3TN91 4DZGA 2QNKA 4JRAA 3K48A 2JD9A 4LPLA 3QACA 5J36A 4XFGA 1RUC2 3O14A 1TNRA 3ZSLA 1O3QA 4IV3A 4UAPA 3H3LA 1UCXA 3ZYBA 2P17A 4OZOA 3AP4A 5A3TA 4WVZA 5BNPA 1GUIA 2VVEA 2ZAAA 4BDVB 3LA3A 1W9TA 1IPJA 1ND3B 2WT1A 2YUEA 3CDZB 4N9IA 4XBQA 2Z5WA 3POJA 1XNTA 4CDWA 4FTSA 4A42A 2ZGOA 4AGRA 2MEV2 1HRV2 1WKYA 4HSJA 4YGEA 1TZOA 3IDCB 1MS4A 3FFQA 4RA0A 1NA1B 2ZXQA 4B4QA 1EUTA 1UOBA 3OBRA 1ODNA 3T0BA 4Q0VA 4HVQA 3IZOA 1OBNA 4GWJA 3LDKA 1REEA 4YW5A 1AL21 5FY4A 1XU2A 4M00A 1ULFA 2JB4A 5EV7A 5C8CB 2VXJA 3N7KA 4NRPA 5JXGA 3GGLA 2WJSA 4ATEA 3W5NA 1U12A 4URAA 1IS3A 3B9CA 1F9KA 4AVCA 3PUQA 3Q8FA 2FHRA 1O6UA 4IXLA 3MYXA 4NRQA 4Q4X3 1NA1A 1W05A 4WZFA 4XQ4A 3ZFGB 1ZREA 5A3PA 2YMZA 2HJIA 3M8LA 1OFSA 5IW0A 1SMVA 4DUWA 5E8AA 1F15A 5FXVA 3H8RA 1LCLA 3W21A 3THPA 4E4ZA 5C8WA 3FBYA 3OUHA 2UURA 4Z82A 5C8CA 3OYWB 1AL22 4Q27A 4XUOA 1BKZA 1W28A 1FMD3 2RS33 4ORFA 1PMHX 2IXHA 3M4FA 5A6QA 3IIAA 5LRRA 3BODA 1PX4A 1X36A 3KD4A 2E7AA 1O8SA 5SV8A 4XF4A 3ZFGA 1RITA 3DKWA 1Y3TA 3S7EA 1PO22 1PNFA 4AR2A 3PUAA 2MHFA 2W46A 4I09A 5FZ7A 3HVDA 4AK3A 3RG0A 1EAH3 1YFXA 1RC6A 4C8DA 2VZ1A 3OYWA 4E8DA 3AVSA 2VMGA 4BM8A 3AXDA 3PVNA 5KC6A 4URTA 1QDOA 1IG3A 3UT0A 2ZBJA 3AM2A 3MPPG 3AB0A 4XJ9A 1RMU3 3SCFA 3AKRA 2CGPA 1JHJA 1FPN1 2DVFA 3T09A 1YFYA 2MNGA 2XVKA 3QOPA 4QX5A 3WV6A 5FWJA 2NMNA 3AKPA 4NROA 3I3QA 4Y5TA 1WD4A 3N7LA 2R7EB 1GNZA 3LDBA 5T5PA 5T5JA 3M3CA 4Y22B 1LEMA 1CIWA 2VNGA 3BPZA 2C4XA 4Z2AA 1JZ7A 1RVF3 2RDRA 4P9IA 2IFWA 2NN8A 1HJFA 3E97A 2VZOA 3LA7A 1QEXA 1NLRA 2PQQA 5EQUA 2BPA2 4RGGA 2VCCA 2XBO1 4ASKA 3WF2A 1BXHA 2JE7A 4O9EA 1WCKA 4FPGA 3CNAA 2PAKA 4GMP3 4HKWA 5SV5A 4DY5A 4FI9A 4K21A 2DF7A 3D3AA 4IE7A 4I3GA 5EFUA 1SZBA 3UK9A 3VKOA 4AFCA 1R091 2XHKA 5BPXA 1AYM2 1O4YA 3VZNA 3FC0A 4Y22A 3WOGA 1OA4A 1W9SA 5GLZA 1AXYA 1ZRFA 1JZ6A 2OUHA 4QPIC 3B7MA 3AMNA 1VBB3 3J8F3 3KSCA 1ASJ2 2NLRA 4A7ZA 3U75A 2ZS6B 4V2WA 2XG3A 1COV3 1UU5A 2Y8KA 4QKNA 4OHZA 3R6SA 2XBO2 4JGYC 1S0BA 1BEV3 1GU3A 4I2OA 3WQ0A 1RUJ3 2BNNA 2VW0A 2QQJA 4YWAA 2JDNA 1NKGA 3D82A 2C5DA 3ECQA 4MADA 3WUCA 2Z42A 1TNFA 2X10A 3HNMA 1RHI2 4MOAA 4XBNA 1TEIA 2WO7A 2R1BA 2XHNA 1HRV3 3A21A 3AX4A 4HK9A 4XJZA 1AR91 5JXIA 1IOAA 2XJTA 3D0JA 2HWD1 1FV2A 1DYOA 1OQDA 2GNBA 1D2SA 1H6XA 3AVRA 2C6SA 2QQOA 4NAOA 1NZCA 3E6DA 3WP5A 3C7FA 2YGLA 5A6YA 5J98B 4Q4Y2 4UBGA 3VHOA 4DEVA 3RVHA 3FN9A 3PL0A 1OPMA 4I01A 3RWNA 2BGOA 4JDOA 4QGNA 5C9AC 1AR92 4AVVA 2XL7A 3DUIA 2AGSA 4CDQC 2HWD2 4BQ4A 5BY5A 3WW2A 4AI1A 2YGMA 2RHPA 4IESA 1QOOA 3RZMA 4NIHA 2XJQA 3WT3A 1G9BA 2JE9A 5LBCA 4GXLA 1VAMA 3K4DA 4HVRA 5KBFA 3KVBA 5EYXA 2ZOEB 3I3EA 3JBG2 2VG9A 3MF6A 3KV5A 4JGYB 3KQRA 1W8OA 1UY3A 2Y6JA 2OKXA 1PO23 1ENSA 2HBTA 2ZHNA 5LA9A 1QJU1 1W2UA 4L0PA 1DGRN 4DUXA 1OQ1A 4P9WA 1GSLA 4WVMB 2DUQA 3T0DA 3I59B 1L7QA 4XDQA 2O14A 1PMJX 1TQ5A 5CU1A 2PTMA 1LB2A 1ENQA 4X6QB 3O0XA 5B2GB 4IEUA 1O59A 2A3XA 2P4EA 4LXLA 4JGYA 3ITQA 2W47A 1VBC3 4OUSA 4CUGA 5HPOA 4FPLA 1C28A 5FZMA 4QQPA 2WUHA 5ANNA 2AEYA 4GQ7A 4RGAA 4WVMA 1PGW1 2ARAA 1QJU2 3I59A 5GLWA 3RZGA 3VD5A 3NJXA 3Q9OA 4IE5A 4A45A 1LU2A 1ND2B 1UX7A 4Q4V3 1LOAA 1QNYA 1SLAA 4YYOA 5C9AB 2FDFA 4M4RA 1N3QA 1JZ2A 1H8TC 1ENXA 4WM7C 1ULDA 2DYCA 1H9WA 2VMDA 2WA4A 4A6OA 2HWB1 2VW1A 4CDQB 1QXPA 1CESA 1BVVA 2BNMA 2ES3A 1WGPA 2XGXA 4D6SA 5JAXA 2WC2A 5DABA 2YY1A 4PLMA 2PHXA 4IDZA 2W0XA 5E89A 2BJSA 4QM8A 2QVSB 1PGW2 1AR63 2ZGTA 3A0KA 2IVJA 1ND2A 3O1TA 4QWNA 3I54A 2FDHA 3MIEA 3ZXAC 5C9AA 1X50A 1RXFA 2WZEA 1PGSA 2WYSA 1UMIA 4XILA 4CDQA 4CXWA 1OOPC 4FPFA 2DUOA 2HBUA 1QXRA 3TEXA 5LEJA 5FY8A 1W3XA 3K3OA 1QH6A 2WFF1 4GB32 1S0CA 4PT6A 4R9DA 4FFHA 3ELNA 4FO9A 3DF0A 3DPRC 3SLIA 3TWIA 1RUI3 3G6JB 2JECA 1FAYA 3KGLA 4QQHA 1JUHA 2QFEA 2TBVA 2E9QA 3A22A 1YJLA 5FO7B 5A3OA 4BB3A 3LIHA 2GU9A 1IHMA 1KFXL 1QMJA 1GOFA 2JDMA 2WKKA 3HNYM 3T30A 5F7UA 5IVBA 5L9VA 1N47A 1S4CA 4XIOA 1OHFA 5GALA 4Y1UA 5FPZA 2Q8DA 1W06A 5JOZA 1WW7A 4Q4Y3 2RVAA 3LOBA 1POV1 1HIXA 1GV9A 1K42A 1JYNA 2XL9A 3NSTA 1WCUA 2WFF2 4CU7A 3I3DA 4GKYA 4LO7A 2VW2A 1H8TB 3JB4C 1RB8G 4WM7B 4Q0PA 3ME2A 3NNGA 4GULA 2AACA 3FMGA 5D8AA 1N3PA 1WA4A 1TMF1 5FO8B 2WAAA 4FFGA 4BPZA 4EZ4A 2DFBA 4RGKA 2D43A 4Z8BA 4FOQA 2C9AA 1O7FA 4UI9L 3ZN4A 1WMEA 1U5ZA 3JBG3 5H9PA 5KHJA 4DOUA 1LOEA 1EV11 1H8TA 4QQOA 4WM7A 5FOBB 2E33A 3J7LA 2B4KA 1UQXA 5KHKA 2XLFA 3DV8A 1OOPB 4K3UA 4OI0A 1BBT3 3PUHA 2PAEA 4FOVA 1U5XA 2ZGQA 4UFLA 5EP9A 1LOBA 2Q1FA 1TMF2 2IVIB 4BQ2A 1UMHA 3ZYJB 3JD71
chains in the Genus database with same CATH topology
2D3PA 2BGCA 2PHFA 1X8EA 3DPRB 2Q0AA 2ZHMA 3IKWA 1GQGA 5KC5A 2DWRA 4E2QA 2KXLA 2D3SA 1EV12 5FDBA 1OOPA 2D6LX 2ZGPA 3N36A 3GNEA 4N7IA 1T6GC 4WZCA 4BZ4A 4GALA 2D6NA 1VRH3 3BOPA 5JI9A 1CVNA 5CADA 3DPRA 3LA2A 3PLQA 1C5HA 1SCSA 3JD72 3NWKA 4HN0A 3H1MA 2VMIA 1I9RA 5C4WB 2GALA 2Y0OA 3D0SA 1AUYA 3KCYA 1UIJA 1XRUA 1MZEA 2TUNA 3DN7A 1GFF2 4V1PA 2A73B 4OI1A 4I02A 3ZSJA 1ZBA3 1J3PA 2EXKA 2PA7A 4OVEA 2OPKA 1AR72 3NO8A 3OTFA 4LLOA 4Q1PA 2RS13 1AL0G 1VBD1 4K6BA 5J7MA 4N53C 5CIRA 5DDJ1 5C4WA 4LUKA 5J48A 4UBHA 2GNMA 1S55A 3WP4A 4W6WA 1UKGA 2D97A 4J6GA 2Z69A 4L92A 3B9IA 1TE1B 4NVPA 1PZ8A 4GB33 2GH8A 4HLTA 4GA9A 2UYBA 4B7KA 3TAYA 1O4ZA 1ZZBA 2YYOA 3EXUA 4Y1ZA 2DCKA 3CU7A 5GLUA 1CQ9A 1VBD2 5DDJ2 1DQ6A 3CF6E 4C90A 3R4DB 2R0HA 1UZZA 3T1LA 3BTAA 4LA2A 1UL9A 1EYBA 1D4M2 1C8M1 1Q8OA 4QPYA 1PNGA 1O3SA 1LGCA 4AEKA 1Q56A 3H3ZA 1WCDJ 3CL1A 4RQPC 2R071 2SBAA 5FLJA 2OIIA 4AEMA 5GKAC 1NE4A 2MPFA 1DFQA 4H3WA 1LECA 4NPRA 5JR7B 5A33B 4FPEA 1QJX2 1Q8VA 1YI7A 2QJVA 2D5HA 1W6QB 4K8FA 3HD8B 4I0BA 1C8M2 3GALA 4N53B 1RGSA 1W0PA 4NO4A 4D7YA 4M0HA 2AREA 4CDUC 1QJY1 4LTAA 1X82A 3MZHA 5FO9B 5T52A 4FXKB 2IXJA 1JTZX 1AR83 4ISRA 5A33A 1H0BA 5IK7A 1F31A 4XHXA 2X8KA 1W6QA 1WD3A 2IXCA 3HT1A 4N53A 2WNUC 5F6LB 3V0AB 4P5HA 3VZJA 2WA3A 3NAPC 4OHXA 2XJUA 4JDMA 3AKSA 2ZX1A 3WCSA 4LEJA 5DZFA 3OF1A 4UW6A 2XJRA 4B4RA 4Q2FA 3C2UA 1S0GA 4TYSA 5JMCA 1W39A 4J1XA 1XE7A 4XZPA 3SCHA 4PIZA 3PMSA 1ULGA 4XYXA 2ZCWA 5I8YA 4RQPB 2CGNA 2QQPA 3V0AA 1F5JA 1QF3A 2ZGSA 2HYKA 4OHVA 4Y26A 3EBRA 5JZGC 4HSLA 1N1SA 4DMIA 4OI2A 4AEJA 3WG1A 1A6CA 4QQLA 4Q4X1 4LA3A 3EO6A 4D7SA 1YYNA 4GWMA 1AR73 1XNKA 3OGJA 4QGLA 3DL3A 4EN6B 3POSA 4DQAA 2UWAA 1O4TA 4QPGA 2A5ZA 4FQZA 4RQPA 4C1XA 4BYYA 3D8CA 4I0WB 1DG6A 1W6OB 2GC0A 4CDUB 1V6KA 3VL8A 2ILMA 1KFUL 1FMD1 2RS31 5DXDA 2EVXA 1N3OA 1LHNA 1RTVA 4R4ZA 3AP7A 2CYFA 2P37A 5HXVA 2ZA9A 3E6BA 4K9SA 4LO5B 4Q4X2 2VECA 3AFGA 1LJ7A 1VB2A 2ZX0A 3JZVA 4XFAA 3AZVA 2WNUB 1PZ9A 3MW2A 4N7UA 4M01A 2CY6A 3NAPB 3WW3A 2ENRA 4A7KA 2LALA 1JBCA 3UKTA 1W6OA 1C1FA 4CDUA 4UW3A 4CYDA 1YCIA 5CB7A 1JYCA 4NHKA 4XPVA 1SLCA 1D4M3 1KRIA 4PQ9A 1V6NA 1AJKA 1FMD2 1RMU1 2RS32 3R0RA 4FOYA 3USUB 2GNDA 3IPVB 2JG8C 3IMNA 4UXAA 2WNUA 3NVCA 3NAPA 3MEPA 1UZYA 1MZ5A 4K40A 4LHLA 2GC2A 4R4XA 3WD5A 2NQYA 3N4MA 1RVF1 5JZGB 3AYDA 1EAH2 3H7JA 2ZPXA 1CD3G 3VBSC 1LULA 3RI9A 1GZ9A 1QJX3 4GKXA 2FMDA 1ZBE3 4KGGA 4GMP1 3IPVA 1RMU2 5ACA3 1NA1C 4A2UA 4UW4A 4XJUA 2ZGUA 2VUAA 3LKJA 3ETQA 1F2NA 1WBLA 4Q4W3 2QUOA 4DNYA 3J9SA 4ZU7A 2PHTA 1ZZ8A 1VBB1 3J8F1 2E53A 4K1ZA 1NYWA 1RVF2 1C5IA 1COV1 1V6OA 4AW7A 4DS0A 2A75A 3GZAA 1NY71 1BEV1 1VBA2 1RUC1 4PDWC 5I0TA 3RSJA 2H0BA 4JRLA 3WLUA 3ZYIB 2PHUA 4CEYC 1DZRA 4HBNA 2D98A 4Y4YA 1WCSA 5E1RA 5EWSA 1IS5A 1HRV1 2ZGRA 4QQ2A 1POV0 2VMHA 3J8F2 1VBB2 1YWKA 1IS6A 2PHRA 1COV2 2JG8B 1LHVA 5KXEA 5F6KA 1NY72 1WMFA 1BEV2 1N1VA 5FLIA 1RUJ2 1Y9QA 1WW4A 1LOFA 4LBOA 1CX4A 2VNRA 4LNVA 1QOTA 2V73A 3VV1A 1XE8A 3MW3A 1YLLA 3OD0A 3VBSB 2YPJA 4W6XA 1GLHA 1W6MB 2EAAA 1QNWA 4RL7A 2D44A 2JG8A 3QH6A 2CNAA 1AJOA 3ZN5A 1F5FA 1HQLA 1EP0A 1MS3A 4MYEA 4P9LA 4AVAA 4HPKB 3NV2A 1ONAA 4AE2A 3UJOA 3CLPA 4MGKE 4E27A 5DUXA 1N1YA 3VBSA 1MEC3 1IPKA 3TYJA 1W6MA 3KT1A 4HETA 2VOVA 2B7YA 3RDIA 4D7TA 4PDWB 2WL1A 5CFCC 1V9U3 1PO21 4IL7A 4U2AA 1V6IA 2GDFA 4CEYB 1H2LA 4S2FA 4HPKA 3SH3A 2AH2A 3LGRA 3WG4A 2DVDA 1BCXA 4LBJA 3WDXA 1YIFA 1AHSA 1YHFA 2EA7A 4YGDA 1FATA 2AR6A 4IETA 4YW4A 2WIIB 1HKDA 4PBPA 1VJ2A 3KMHA 1VBC1 2VULA 4PDWA 4YRDA 3AZWA 2G4IA 4KU7A 2OYZA 2ARBA 4CEYA 2XVGA 1KDMA 1LEDA 1D2QA 1Q8PA 3FWEA 4YG6A 4EV0A 5IK8A 4AI2A 1SFNA 2PHDA 2N7GA 4M3CF 5BYNA 4Q4V1 1UN1A 5JSRA 2VGDA 2B39A 5JPNB 2YROA 4FOWA 1LGBA 1VBC2 1CPNA 1AYM1 1XXNA 4PCRA 2R16A 2GMEA 4S2GA 5JOWA 2E51A 4EN0A 1RUD3 1SFYA 3LSDA 4JDNA 3LSEA 1A78A 3POWA 4HFSA 2WS93 4FAGA 4IEOA 1ASJ1 1AR61 2Q8OA 5J37A 3R4SA 4LO6B 2JICA 1A8MA 3O0VA 3JB8A 4RHV3 1VBA3 4Q4V2 3PVBB 4FPCA 5CFCB 1GYKA 1XNBA 3I2DA 2NYYA 4CRQA 3W58A 5A3MA 2WT2A 1PO13 1RHI1 2DTYA 1NXMA 4XJWA 1RUI1 1UX6A 1ENRA 3FHIB 4YGCA 3WDWA 3MFCA 1UIKA 2XJPA 1AR62 4XMIA 3VDDC 4NHLA 1Q8QA 2X5IC 4KG0A 2ZABA 5GZFA 1LU1A 4E4DX 5CFCA 2RE9A 4L97A 1XYPA 5JIUA 5T55A 4FTEA 3UKNA 1IQAA 4Q8LA 2A70A 4Q4Y1 4H14A 1U5YA 3JQWA 4KGQA 3ILNA 5CBLA 2IFRA 1BJQA 4QT6A 4AHZA 1RUI2 1J3RA 4TZDA 2W39A 1PIV3 1MS5A 3PJQA 1SACA 2FBEA 4RS5C 3L9JT 5FBZA 3FLPA 5IUQA 3FLRA 2EF6A 4DRVA 2RMU3 1OI6A 1APNA 3FE5A 3P3NA 4PIXA 2D6MA 2WQZC 1QKQA 3LAGA 4AVBA 3GBGA 3TNQA 3JBG1 3WW4A 4YM3A 2ZGKA 4G3YC 1KD7A 5I93A 1PZ7A 1KJLA 1ND2C 4E2SA 1YRZA 5F1RA 1R082 3VHNA 3NJZA 4ZU4A 1BBT1 1PHMA 4E4SA 3MIDA 1JXNA 1GZCA 2I74A 1VLNA 5CVRA 1RUG3 3ST7A 3BIWE 1OMIA 2WNVA 1Z0HA 1BYHA 1U0AA 4BOWA 2GNTA 4LBKA 3VDDB 5F9TA 1WW5A 2W08A 2X5IB 2AZ5A 4EWDA 4XQWA 2ZJCA 4AHXA 1SBEA 5FFOC 1OLQA 2PFWA 4RD7A 4HKOA 1CN1A 2PLV2 4MXWB 1OPOA 3KCCA 1BBT2 1PVXA 4PJYA 1VRH1 1PVC3 2BQPA 4ZKTB 4IEQA 5DUUA 4KBBA 3A4UA 1KS4A 3B93A 4FP2A 1CR7A 2D6OX 3VDDA 2X5IA 3B00A 2BFUS 2R32A 4RS5B 3UL2A 5FMOS 4ASLA 1AZDA 1JW6A 1LOCA 5D8AC 1ZBA1 4LHKA 1H1MA 1YJKA 4MXWA 4D69A 5FPXA 3FBMA 4LBQD 2LM3A 2BWCA 4GH4C 2P3JA 5CG8A 3AYEA 1OQEA 4AXOA 2IXKA 2QZ2A 3HT2A 4C0BA 2RS11 1VRH2 3OD4A 3WDYA 4YARA 1LR5A 1DIWA 3WNXA 5C6CA 4RS5A 1BMV1 3AMPA 4SLIA 3ROUA 3GF6A 4XBLA 5LK5A 2WLPA 1DQ1A 2V5YA 4GB31 3UV9A 3V56A 1ZBA2 3NKTA 1UU6A 1OA3A 3LWCA 1Q43A 1H8VA 1JHNA 5CFDC 1S0FA 3WXPA 1SQ4A 4MGIE 2RS12 3VBHC 4FSJA 3EQEA 3LB9A 1CAWB 1ZA4A 4NR1A 3ZIXA 2AENA 2OW4A 3VZKA 3TNPB 4AHYA 1BMV2 5HCFA 1OKQA 2NM1A 2B5HA 3JUUA 1DGLA 4L11A 5GZEA 4GMP0 4P9GA 1ZZ9A 3ZSEA 4MV2A 2EXJA 1AX0A 1CAWA 5GZDA 4L99A 5D8AB 3TB0A 2QDRA 3B69A 4GH4B 2D93A 4MUVA 2OVUA 1B35C 1DZQA 1H2NA 5A32B 3KZ4C 5KHHA 4QGMA 5L36A 2H6BA 2R043 2ATFA 3IT8A 1NQDA 1PMIA 1VR3A 3W9AA 5AC93 3JCIA 5LK7B 2B9UA 1CJDA 1R083 4XHBA 4Y1XA 4YNIA 5C4WC 1W6PB 3B3QE 3WG3A 2D5FA 4LUMA 2XLGA 1IZ3A 2WWSA 5A3LA 4KWJA 1GZWB 4CZSA 1AR81 3HBZA 3KGZA 4GH4A 2CL2A 5A32A 5JWPA 1A8DA 3OBTA 5CFDB 3H0OA 1WLCA 2UU8A 2D40A 4F8AA 4JVAA 3VBHB 2Q4SA 2GAUA 3S0MA 1J3QA 2O8QA 2Q30A 1V6MA 3IN9A 1W6PA 4MLOA 2H0VA 3WQ1A 4Z92B 1ZRRA 2PLV3 1ZRCA 2D6KA 2E63A 2WLQA 1GZWA 3NV1A 2UWBA 5JIAA 2JG9C 1HRI2 1XU1A 1AR82 3ZMOA 2Q5TA 1ZM1A 4KU8A 5CFDA 3TWIA 1QY4A 1U5IA 3IDEA 2SLIA 4RR3C 1Y7BA 4XJ8A 3VBHA 2NMOA 2UY9A 2DUPA 2WSUA 4R9BA 1HDKA 2CV6A 3J26N 1YNAA 5L7OC 2RM23 4BIFA 3UKVA 3RI8A 4G4FA 3MLJA 2Q1ZB 2A6VA 4YGBA 1B35B 1AR71 1OFNA 4AQ6A 3VBFC 2ZHLA 1QXJA 4A3XA 3ACLA 4XF9A 3HIFA 1EPZA 3FJSA 4HANA 3BU7A 1AYN3 1VBE3 4RFT0 4KL1A 4Z1VA 1MS1A 1AXKA 3ZYPA 2HEVF 1RUH3 1YUDA 4FVVA 1REFA 1B35A 2E7QA 2DU0A 4JGZC 3RPQA 4BMEA 1V6LA 1LHUA 4DB5A 2FMYA 1G8WA 3AMQA 2I45A 2OZJA 3MLLA 2BWAA 1R1A3 2DVBA 2QE3A 2CGOA 4AEDC 3TOJA 1D4M1 5T5OA 2BW8A 2JG9B 4NWVA 4WM8C 2BBVA 1L3JA 2Y0IA 4IERA 4XTPA 4RR3B 3EJKA 1VALA 4XIKA 1QQP2 5KXDA 1CGPA 2B45X 4KNCA 4PF5A 3H1YA 3ZXDA 4ATFA 1Z78A 1QGLA 3VGIA 4C1WA 5L7OB 1HX6A 1S2KA 3VKFC 2JG9A 1QJX1 4Q0UA 1ZBE1 1BK1A 3AXEA 3VBFB 5ACA1 3WW1A 3ZPYA 1OD5A 4RR3A 3GHMA 2VVDA 1NXD1 2EALA 1HW5A 4QPGC 1SLBA 3B94A 4Q4W1 3CJIC 4ZU5A 1V6JA 1DQ4A 3WCRA 1I3HA 2Q1MA 1UD1A 3RJ2X 5K9YA 5L7OA 4IEVA 3RJRA 2YC0A 4XXAA 2A6XA 4JGZB 2QKDA 2GH2A 3VBFA 1ZBE2 4M3CB 2PELA 1XNDA 5ACA2 4BWOA 2FQPA 2P3KA 4EN7B 1C1LA 3RMYA 1LOGA 3HN1A 4R52A 2CTVA 4AEDB 4Q4W2 4P9JA 3JU9A 4R9AA 3VHPA 3KT7A 4ASMB 4DINB 1RUE3 3RMXA 1O5LA 4GIQA 3VBUC 1G9FA 1DQ0A 4WM8B 1HRI3 2A3WA 4JGZA 4AVSA 4YVSC 1FNZA 2PHLA 1O91A 1QU0A 4MGZE 1REDA 4LLFA 2PYTA 2QCSB 3MIFA 2W68A 3QBQA 4M3CA 1W6NB 4EJRA 5JPMB 4OHWA 1V00A 4AEDA 4N9HA 2CAUA 2ZHKA 4XQDA 2I2SA 2OZ6A 4BA6A 1LHOA 4WM8A 4DXZA 1MQTC 5BUVA 4PBOA 3D5OA 3CJXA 1JOJA 5HBAA 3OGGA 1MS9A 3RYRA 4WV8A 3S7IA 4F3JA 4QPGB 1W6NA 3WDUA 3RS6A 3CJIB 4D94A 3VBOC 3HMYA 2DTWA 3FFZA 4BIOA 1RUF3 3E5QA 1MEC1 5DZGA 1NCQC 4BCUA 3USSA 1JH5A 5JI7A 3AP9A 1V9U1 4O9GA 2ZKNA 4OFGA 4IQPA 4S2DA 4XFCA 3VZOA 3CJIA 2DV9A 4OHYA 4QHBA 5T50A 3U10A 5H9RA 3M3QA 3MW4A 2JEMA 3M2MA 4COUA 3ZX7A 1MACA 4FPJA 5T54A 3VBUB 3BALA 4F7ZA 1OLRA 2UYAA 1G9AA 2ZGLA 4YVSB 5BNNC 1MEC2 1GICA 1AXZA 5T3NA 1MS0A 2VQAA 5H9QA 1QQP3 1YIPA 4LR4A 4N43A 1V9U2 4HT1T 4FQ4A 3ZYRA 1LENA 4FCAA 2E7TA 3CEWA 3N35A 3AK0A 5I0RA 3PMEA 1LOFC 1EAH1 5C33A 1WMDA 3VBUA 4COYA 2EXHA 3FLTA 1MQTB 4NHMA 4MH0E 1LESA 4YVSA 1CAUB 4XFIA 1RJ7A 2XJVA 2VY0A 4FP3A 4YM0A 2VVFA 4FPOB 1SCRA 4P9XA 4QM9A 4YSFA 3AYAA 3M1HA 3ASIA 2ZGMA 4RSUA 1MZ6A 4TLFA 4OI4A 5L73A 4AGGA 1RUD1 3MIHA 3VBOB 3M7AA 4Z2WA 2WS91 5F5QA 2R49A 4HZFA 4QD2A 4XEZA 1DQ5A 4YW1A 3NL1A 1NCQB 3MIGA 2VU9A 4RHV1 1MQTA 1VBA1 4YG3A 2HWF3 2RS53 1PK6C 1CAUA 2PAMA 1IKPA 2UY8A 3W59A 2WZPP 3E5UA 5GM0A 1PGL1 1IKQA 1PO11 3O7OA 3MI8A 4D3WA 4P9YA 1LKNA 4CP1A 3VBOA 2GSYA 4HMZA 1JN2P 1AF9A 2ARXA 3NV3A 4EN8B 1M06G 2DURA 1RUD2 2XVLA 4QU2A 3LOIA 1RUNA 1FXZA 2WS92 1FYUA 1NCQA 1HQWA 1V70A 2O8OA 4AQSA 5BNNB 2OUJA 2ZAHA 4G9SB 4RHV2 5DG2A 1JYIA 5IK4A 2ZGNA 2XKOA 1CAXB 1RUJ1 2IC1A 4HKLA 2YXSA 4OLLA 5J09A 3ZXJA 3ALQA 3MIBA 3H3UA 1PGL2 2B8MA 1PO12 1OSGA 3H8UA 3ZN6B 4XF0A 1D4VB 2YDEA 4KWLA 2TEPA 5CAZA 1Q3EA 4Y1VA 1UAIA 5BNNA 5IT6A 1PIV1 2VH9A 2XH6A 4AFDA 3VKNA 1XYOA 5K7PA 2HWC3 3H50A 3GZUC 2R0FA 1CAXA 2WZR3 2ZACA 5HCBA 3D4KA 2RMU1 5FREA 3VKLA 4BLJA 3ZN6A 4CP0A 1RINA 1PK6B 2VOKA 3PVOA 1QJY3 2K2SA 5FRAA 1Z7S3 1FV3A 4YZ4A 3SCGA 1PIV2 4JQRA 1X8MA 4AWDA 1YI9A 3N7JA 5GZGA 5L19A 3D6EA 1RUG1 2BFUL 1W0OA 2EXIA 5EXOA 2C1FA 5FMOL 4SBVA 2AYHA 3AYCA 4X6RB 2RMU2 4B7EA 2VQ0A 2KA3A 5LRSA 1SBDA 4ONUA 4XMAA 1LTEA 2GZWA 1PK6A 2G9GA 5AFEA 3E5XA 4MXVA 2D3RA 2RR13 3AZYA 3L2HA 4I3PA 4K1YA 3OCPA 3OJBA 2JKBA 4L8QA 4HVOA 3TN92 1DGRA 3EHKA 2ETEA 4AVTA 1PVC1 1D0HA 1RUG2 1TME3 5EJ3A 1Q5OA 4YW2A 3I8TA 4IEXA 3TBDA 1QOSA 1ZZ6A 1GBGA 2VNOA 4EROA 3KM5A 4GWNA 1ND3A 2A6WA 4COWA 3HR9A 1DYPA 4JAAA 2IWGB 1HXS3 3B5LB 4Q29A 3IDBB 5JOXA 1O3TA 2CWMA 4OZXA 3KCXA 1H2KA 3ZIWA 2B46X 5FCCA 3GHNA 4Q1RA 1MS8A 1ALYA 3ZFEC 5DZEA 1J58A 1PVC2 3WVJA 1DBNA 1KITA 1OA2A 4Q0SA 3WHUA 4F83A 4IEZA 4HN1A 3WY6A 1S0EA 4YG0A 1ZRDA 3QCWA 1RUOA 4B4PA 2Y26A 2WNVC 4HK8A 3SHRA 1H4GA 5AFBA 2ET1A 4ES8A 1DHKB 2DCTA 1XYNA 3VBRC 1DYKA 2XLAA 4FPKA 3KS7A 1HLCA 1NCRC 4AFMA 2DCYA 3OPZA 1WW6A 3V64A 3SH4A 4S2HA 1YXWA 1M4WA 1SLTA 4OUMA 2X29A 3WUDA 1N1TA 3VZLA 2BNOA 1R1ZA 2ZX2A 3ZVXA 2HWE3 1BQPA 1WUVA 4AG4A 2R063 4PLOA 2JDZA 1AVBA 3HWJA 3ZFEB 1FPN2 4TWTA 2R041 2UWCA 2YV8A 2BVBA 5AC91 4WVWA 5HI0A 1FOD3 3HAGA 4IEWA 3GBFA 1R081 5J96B 3RYKA 2BUKA 1QH7A 3E6CC 3TRSB 3O5SA 3MICA 3POYA 4Z07A 4JC1A 1RUC3 3GZTB 3ZFEA 3SH5A 2PHWA 2WNVB 2VUJA 5D1IA 2IXIA 5ABJC 2HKXA 2R042 1ZX5A 3MF9A 1SLLA 2R6QA 5EZWA 3VBRB 1R092 5AC92 4K20A 3NKGA 2MEV3 2WFPA 1AX1A 1O5UA 2PLV1 3OY8B 1NCRB 3TN93 4BE3A 5JOYA 1C4RA 4IEPA 4YZ1A 3U4XA 5JDBA 3ILFA 4YFWA 4AFAA 3MLKA 3ZMNA 3AMMA 3IM0A 5FOJB 4HL0A 1HV0A 4MX3A 5KHIA 3VBRA 2XPJA 3I4IA 3SISA 2YZ4A 5JCTA 4H55A 1MZFA 2RJKA 2RM21 3OY8A 1NCRA 4B8EA 1QDCA 5DG1A 3FUQA 4EWAA 3P3PA 1RL3A 1YFUA 1H9PA 3K51A 3URFA 2ZMNA 4JCKA 3VL9A 4W65A 4FPYA 3G7DA 4XTMA 1AL23 1QHDA 1G9DA 2A71A 2DVAA 4QPIB 3VKMA 1AYN1 1VBE1 2WNEA 2AUYA 3WDTA 1GKBA 4AI0A 4AI8A 5H9SA 1RUH1 2RM22 2BTVC 3C3VA 4Y20B 4B29A 3H1WA 2ZTNA 3LCPA 4BLIA 5ABJB 3AMHA 2P3IA 1R1A1 3ZXKA 4QPIA 1DGWX 3WQ7A 2Y38A 5J3UA 1AYN2 1VBE2 5E88A 1PM7A 3ZFFC 1KJRA 4L9BA 2GC3A 4WBBA 4Y20A 2ZMKA 1RUH2 3ES4A 1H1AA 5ABJA 2DCJA 3O0WA 4LBNA 4LO8A 3QLQA 3PTYA 3B01A 2Z2SB 4WVVA 5AVPA 4FT8A 5CG9A 2ZX4A 1J1TA 1R1A2 1KXGA 3ILRA 3KT4A 3WR0A 1QJZA 3AP5A 3CO2A 1FPN3 5K8SA 4META 4DY3A 3SXWA 1WLWA 1AYM3 3B02A 3WP3A 3WZ1A 2JX9A 3S30A 1AX2A 3A0NA 2XWBB 3DGTA 4J1WA 1ASJ3 3AKTA 3GBWA 4X8PA 2CAVA 3FZ3A 1VB4A 3FUOA 5I0UA 1EY2A 1DGWA 2XBO3 3V0BB 4YVWC 4Y5Z0 4YZ5A 3NV4A 5E16A 3WDVA 2XB6C 4COVA 1HV1A 3WG2A 4R9CA 2HWB2 4XW3A 3AZXA 4FTBA 3H9AA 1RHI3 5HCAA 1R093 2GN7A 4AI3A 5BV6A 1G86A 1HQNA 1D0GA 2ET7A 4U36A 3AJZA 3LZZA 3O12A 1URXA 1RUE1 3ZFFB 4PLNA 4FPHA 4Y24A 2XJSA 3V0BA 1HRI1 4XJAA 3SNMA 5KWRA 1J1LA 2DVGA 3ATGA 1F8VA 1VAVA 5GLVA 2GN3A 3VZMA 5JSOA 2DU1A 2BEOA 3NW4A 1ULCA 4YZ3A 2CWSA 3RZZA 4ITCA 3ZFFA 1CPMA 1AR93 3L2YA 5JLVA 1RUE2 1SEFA 2JXAA 1E57A 4IV1C 1IS4A 2HWD3 1KS5A 4LE3A 2A3YA 3ZXEA 4XFHA 1WLDA 1WBFA 4PIYA 1LGNA 1X7NA 3RRDA 2W52A 1UW8A 1H4HA 3WX5A 1GQHA 3WINE 1H2MA 3V65A 1G6NA 4H7MA 5I8TA 4LT5A 2R30A 1RUF1 5I91A 1CAVB 4LBLA 1Q8SA 4YVWB 3IBMA 5GJ6A 3AKQA 4Q0QA 1DDLA 4YFZA 4YLZA 3HQXA 4LO4B 3ZXGA 5EYYA 2YHJA 1SBFA 2ZZJA 1SLIA 3I7DA 4MGYE 4XETA 3ZSMA 1DU3D 1JUIA 3ZXFA 4A7YA 3X29B 5JSPA 4AF9A 1DZTA 1I6XA 4BHPA 1A3KA 2HEWF 1CAVA 3AZZA 4XF3A 4YVWA 4EN9B 2K9ZA 1RUF2 4OULA 4AGVA 1ZNPA 4LBMA 3RNSA 4C0HA 3AP6A 1QQP1 4AQ2A 4MVTA 3MDPA 1QJU3 2XUMA 2F4PA 2X53S 1UMZA 5AVAA 1UKRA 3SMHA 2VPVA 3N3HA 4NOTA 4NWWA 1C3HA 1YO8A 1S2BA 5KHGA 1GANA 2NPIA 3M3OA 1XNCA 4IV1B 4I30A 2O0OA 3R4UA 2BVVA 1MVQA 4K7JA 4KQ7A 3FX3A 4DRRA 2FZ1A 1UU4A 4Q8KA 2KM2A 3T2TA 2HWF1 2RS51 4IV1A 4FAHA 1C8NA 2BYVE 5GLTA 2PN5A 4YZ2A 2HWB3 1VAKA 4EWEA 2H6CA 3ZSKA 1I1EA 2IXLA 3U0ZA 3ZDSA 1S0IA 4ISQA 4AYUA 4IEYA 4TSVA 3ZXLA 4M0NA 1NG0A 4I0AA 1VIWB 4CP2A 3BOWA 1LRHA 1O3RA 2XWJB 4YW3A 5LEKA 2HWF2 1SDWA 2RS52 2XKPA 5FQ0B 1ZZ7A 5K0UC 4N43C 2JD4A 3SITA 1C57A 2WFF3 3H7YA 2R1DA 2C0ZA 3PJYA 4YM1A 3U11A 1I5ZA 3APBA 4E9KA 2DCZA 4COZA 3WP6A 2HEYF 3ZO0B 4N90A 3ENRA 2WT0A 2HWC1 1ZVFA 5FQ0A 2WZR1 2VXRA 1H1IA 3KB5A 2E6VA 4CEWC 2ZX3A 2K0GA 1RJ8A 1POV3 2EAKA 4XFFA 3WHTA 3IWZA 4C91A 1CONA 4AQTA 1S0DA 4MSVA 2ERFA 2GC1A 1Z7S1 1MVEA 2R072 1WLTA 2D6PA 4LBQB 2GMPA 3U07A 1TMF3 1J59A 2LUWA 2GMMA 4DPNA 3VUOA 2HWC2 3RQ0A 4R8HA 2QZ3A 2WZR2 3MFAA 4INDA 2LTNA 3MPBA 5GZCA 3BCWA 4FXGB 1X33A 1RIRA 4JV4A 4FBFA 2VOWA 2O1QA 1K5MC 1MR5A 4KH9A 1ZZCA 1EV13 2A6ZA 3QH7A 1XQNA 2A7AA 2RR11 3RYPA 4LBQA 1B09A 1QJY2 1Z7S2 3ES1A 5K0UB 2TNFA 4LULA 5I8SA 4N43B 1DF0A 3JD73 1TME1 3THTA 1S1AA 1UPSA 4CDXC 4QXKA 1G9CA 1LODA 3MGUA 1EPWA 2Z79A 1NQJA 2WQ4A 1HXS1 1FI2A 2OA2A 2ZZQA 4W6YA 5KXBA 4P14A 1BVP1 5JVVA 2RR12 5K0UA 4CEWB 1FNYA 4LE4A 3AJYA 4X8NA 1H30A 2EIGA 4ES9A