4HPKA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium nitrate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
110
Chain Sequence
KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Collagenase
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 32
structure length 110
sequence length 113
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hpkA00
1NQJA 4HPKA 1KFXL 4DXZA 4I3GA 4HPKB 5FAXA 1WMFA 3BOWA 2QFEA 2XVLA 3JQWA 2XVKA 5FBZA 1U5IA 5SV5A 1WMEA 1KFUL 1WMDA 4G9SB 3JQXA 2XVGA 4DY3A 4DZGA 1DF0A 3AFGA 4DY5A 2O8OA 1QXPA 3DF0A 1NQDA 2LUWA
chains in the Genus database with same CATH superfamily
1A34A 5LY2A 5A6ZA 3LA2A 1AL0G 1QMJA 2MEV2 3RMXA 5FV3A 1AZDA 5H9PA 1ZRFA 5FTTC 4B7EA 1D2QA 3I2IA 2UWCA 1COV2 2A70A 5JZGA 4CP9B 5JR2A 2RDSA 4RFT0 1W6OB 4CCKA 5IAXA 2EICA 5DN2A 3HVDA 3NNMA 2JG8B 5JWPA 3S57A 1QNWA 4CSWA 2ZHKA 2FDGA 4MGYE 1WBLA 1POQA 4UFMA 1OVSA 3CQOA 4P5HA 3WNKA 5IT6A 5A7PA 4B4QA 1WCQA 5KXCA 1YQ6A 2HWB2 3TB0A 2XKPA 4Q8KA 1QXRA 2XUEA 4O9EA 5IK8A 3EXUA 3MW4A 2X5IC 3OJBA 2VZOA 4O7XA 5EYYA 2A71A 4CDXB 5DUWA 2PHRA 2BPA2 2JE8A 4XUPA 3N7MA 2OZJA 3R0RA 3VLBB 3VZKA 1WMFA 3FHQA 1UZ0A 4BK5A 5KHGA 1HXS2 3T2OA 4FFGA 4UAPA 4J1XA 3VBRA 5DAPA 3NJZA 5E89A 4MGIE 2OPWA 3HD8B 1Q8QA 3VHNA 5C3PA 4WM7B 2WZR2 5JIUA 4BA6A 3O1RA 1DLCA 3I3MA 4I0AA 1GICA 3GZEA 1BVVA 3KV6A 1H9WA 1I6XA 2Q4SA 2B46X 3W20A 4AK3A 4DQAA 1O91A 4S2GA 3VHRA 5L36A 1VBC1 2CTVA 4LJHA 3RZKA 4JTOA 3VD3A 4N43C 1UYPA 3KS7A 2QQLA 2YPDA 4YW7A 4CDQA 1MZEA 3QBQA 4QXHA 3LFIA 2HWC2 5IVVA 1VBB2 1NLQA 4WVMB 5FPAA 1G9FA 1NZCA 3GJAA 1OA2A 2J1RA 4Z8BA 4XJ8A 1PZ8A 2IFRA 4OHXA 3J7HA 4MG2A 2PQQA 1DU3D 1FT9A 1D0HA 2FCTA 2JDYA 2NM1A 3KVAA 5H9SA 4AVCA 1DZQA 3JD72 4G9SB 2RS53 3KT4A 1UAIA 4LBQB 1HN1A 3THCA 4FP2A 2ZGNA 2ZEYA 4OHYA 1OF3A 1QHDA 3E5QA 1QWRA 3C7FA 3AVRA 4R9BA 2CAVA 3OEAA 5FBJA 4ZZ8A 2D3SA 1LHNA 2MPFA 3DXTA 3VBFA 1JMUB 2ZKLA 4AQTA 3ZFFA 5T54A 4IQPA 5FYYA 5BNOC 3U37A 4EN9B 3PJYA 4CZSA 3N9PA 4LEJA 4Y4RA 3OD4A 4RS5A 4WVWA 1APNA 5FR3A 3I49A 3OGJA 4H55A 2ZHLA 1YQ8A 5EJ1B 3RZLA 2ET1A 1Z78A 2XJRA 4JZRA 5T52A 2VZ3A 4M0NA 3ZSKA 5AC91 5KC5A 2PA7A 4ZU7A 1PZ7A 2XQRA 2JE7A 4RFRB 2GP3A 3LOIA 2VUCA 4R4ZA 4N53C 5DZGA 3QACA 4AW7A 2ZGOA 1W6MB 3GM8A 4LUKA 3VZMA 1DZTA 5JLVA 3IIIA 4DRRA 1Z0HA 3ZFGB 1RMU2 1JU3A 1O5LA 2XPJA 1FOD2 3MF9A 4CDUA 5A3WA 3MIEA 1R1A2 4CEWB 3AVSA 1GZWA 3OF1A 4IE7A 5J3UA 1H8TC 1SZBA 1QJU3 3POFA 1Q43A 3QCWA 5CFCA 3ZYJB 2ZOEB 3H3UA 4ISQA 4KG0A 2VW2A 3PMSA 4XFAA 1C8M3 4OUSA 1DDLA 4I30A 2WL1A 3DYMA 4DS0A 1VRBA 1US2A 5LK5A 3NRUA 1GFF2 3KCXA 4CPBD 4QX2A 2EXHA 4Q4V1 4M4PA 2X05A 1CONA 3GYDA 5FREA 2I07B 4YVSB 1RUG2 3RPQA 4N53B 1JYWA 3N9QA 2DTWA 4JHZA 1SLAA 2C6SA 5E1RA 5TSWA 1MQTB 3T0BA 1PZ9A 1BYHA 4YFWA 5FFOC 1W9WA 1LU2A 1TNFA 5JXIA 3WQ1A 1Y9MA 4OQ8A 3PU8A 1D4M3 4OUMA 1YLLA 5JOWA 3BIEA 4GD4A 4UF0A 4CYDA 4Z2WA 4NROA 1ZZ8A 3HNBM 1W6PA 1LODA 2WFF1 3AXEA 4K3UA 3BOPA 3PUSA 3PVBB 3RYKA 2NQYA 3UT0A 4M01A 3AP5A 1JYXA 1LHWA 1WBFA 2AGSA 4PF1A 3RZGA 3DCQA 1LHVA 1PK6A 5L7OB 1WW7A 4BU2A 1H9PA 3RS6A 1JZ2A 1JTZX 2BJSA 2JKXA 3O1VA 4RN5A 1JS9A 3AYEA 5LEKA 3P6BA 4MO3M 4QX8A 2XUMA 3EHKA 1OI6A 1RVF3 4FTSA 2XG3A 1ASJ1 2WNUA 3VBRC 4LTAA 4FFIA 4ZXKA 2PAKA 5JZGB 2AR6A 3BODA 4TZDA 4FOWA 2ARCA 3WF1A 4AFAA 1MS3A 5GLUA 1YRZA 1LRHA 4RHV3 3V0AB 1UOJA 3ZKYA 2W47A 3IAPA 2FBEA 3DEMA 4OULA 2FDHA 1YC61 3CJXA 3FFZA 1I9RA 2X8KA 3FX3A 3B5LB 3ACGA 1JU4A 4AFCA 3H8UA 4BE3A 1JW6A 2JDUA 2K2SA 1ULEA 4A6OA 3OBTA 4CDQC 1QJZA 1X82A 5LWBA 1C1FA 2UWBA 2Y38A 2CWMA 3EYPA 3OYWB 2SBAA 5FY1A 2VZRA 1UN1A 2OKXA 4KH9A 3GBWA 5G05L 2GALA 2VUDA 4QXKA 2BOIA 2BGCA 3EQEA 3I54A 5F6LB 2YROA 2MNGA 4AHXA 4LKFA 3FUOA 2BBAA 4KQ7A 1X8MA 4ES8A 2IXLA 4YZ1A 2RMU1 1RUH1 1RUE2 1NXMA 3JB4C 4XBLA 3UETA 4IEUA 4BMBA 1GBGA 1GOGA 2VR4A 5J09A 1O3RA 4XFFA 4YNIA 3VDDA 2WN3A 3O1SA 3ZOIA 4QKNA 1FPN1 5FP9A 4DMIA 4XUQA 5JSPA 2LS6A 4MGKE 5HPOA 4NE9A 3N4MA 4LO8A 1J58A 3POWA 1PO23 1V9U1 1VBE2 4UWDA 5A3UA 1WUVA 1N3OA 1GP4A 2QZ2A 2ZKNA 2JX9A 3U75A 2IWGB 4BDVB 3AMMA 2WS92 3ZFFC 2D5HA 1NA1A 1PO13 3CLPA 3ES1A 2ZBJA 1OD3A 5GKAC 2A3YA 1UMIA 1RUI2 4C8DA 5HXVA 4MH0E 4RS5C 1VBD1 4UFHA 2X09A 4BPZA 2YG0A 1CAVA 5LZ6A 3A22A 3N9LA 5JOZA 1BBT1 3UJOA 5FK7A 3M3CA 3T08A 4JRLA 4EWDA 5FY8A 4EJRA 4Y22B 3S5QA 1T6BX 1POV0 2HKXA 3A4UA 3DYOA 2FDKA 4ARXA 2D6KA 4RR3A 3S7IA 1PHMA 3WCSA 2VCMA 2Q8DA 3HBZA 2JD9A 1UXZA 5A3NA 3ELNA 4FXKB 4XEZA 4CDUC 1QJY3 2ARBA 2VU9A 2A3XA 3MF6A 2BYVE 3ZXEA 3VBFB 4HPKB 1UY1A 4GB32 1IG3A 4QPGC 1OH4A 4AVBA 2JG9B 1FMD1 2WZEA 5C3QA 1NY72 5IK4A 3MIFA 3VKLA 2W46A 2BBVA 3ZXAC 1WLDA 1S0BA 2R071 2R043 4YGEA 4IV3A 5FLHA 3T1LA 4E4ZA 4O65A 4M3CF 3I3BA 4J1WA 5JMOA 1JI6A 1HQWA 1VBA2 4UT5A 4UOJA 5DABA 3UKTA 1W39A 2TNFA 5LATA 4PI2A 1RL3A 5JXJA 5LRSA 1Q8OA 4R9DA 2DVGA 4ASKA 4CPBA 1U5ZA 3AMPA 3AXDA 1AYN3 2ZX3A 3IMNA 3P5BA 3T2QA 3VBUB 5JI9A 5ABJA 3I7DA 5FLJA 3PMEA 3ZFEB 4DNYA 4FQ4A 3WVJA 5LBCA 2I45A 4HONA 4HT1T 1GZWB 2TUNA 3CJIB 5EV7A 1R64A 1YHFA 2C9AA 4XJ9A 2W39A 2BZDA 1H2KA 2WBKA 4KWJA 5GZEA 1PVXA 1IKPA 5IVEA 3CZJA 3VKNA 3A23A 1ENRA 4RL7A 4MZUA 2EIEA 5T3NA 1QF3A 5FXWA 1OF4A 4QB2A 2VCAA 3SH3A 1ZYBA 1SBEA 1WW5A 3WR0A 4HSLA 1OOPA 4ZY9A 1MEC2 1S0EA 1N1SA 2VMDA 2WNVA 3FBMA 4H7LA 5HV4A 2ARAA 1ZRCA 5GZGA 3AKSA 3UGFA 1C5IA 4A42A 2HWE3 2WNUC 1XYNA 3PUQA 4RD7A 1OPMA 4XAAA 3VZJA 5JSOA 4Q4Y2 4XQ4A 1TMF3 1W8OA 3GCWA 4FOYA 2VZPA 3TNQA 1DZRA 3MLLA 5C5TA 2VMGA 1U5IA 1ONAA 1UD1A 5SV5A 4BQ1A 1YEWA 1UMZA 5FMBA 1PK6B 5DAVA 2NLRA 1FAYA 3MFCA 2PMWB 1MZ6A 2AH2A 4YM2A 5DUXA 2W1UA 1OLRA 5DDJ3 5GLWA 2P1BA 2C24A 3S30A 4B3NA 4U36A 1VJ2A 4XPVA 5EFUA 2WSUA 4LO5B 5FMDA 3VBHB 4CA9A 4V2WA 2LUWA 1TNRA 2OUHA 3ZSEA 4UW5A 3JBG3 5FLIA 4HMZA 4P14A 3MV11 1Q5OA 2W2IA 2J1TA 3ZYFA 5FBZA 3N9NA 5K9YA 1LECA 3HPNA 1MZ5A 4JGZA 3BTYA 1COV3 3WD5A 4CDWB 2DUOA 2HJIA 2WC2A 3JQXA 2R0FA 1DLLA 4IETA 1XNTA 4OCTA 1PVC1 3U78A 4P9XA 3VGIA 2OIIA 3ETPA 2HYXA 4EROA 1KS5A 2PFWA 2P2KA 3LQCA 4XOGA 3BVCA 1PIV2 4B1MA 1RUC2 4QHZA 1DGLA 2WIIB 2ZEZA 2HWB3 3WV6A 2ORZA 2E31A 4FOQA 4D6SA 4DXRA 3GGLA 4DUWA 4URAA 1CAXA 1LHOA 2VTXA 3PUIA 4RQPA 4YZ4A 2QTWB 4I09A 5A80A 4COYA 2XJVA 4Y1UA 3VDDB 1OKQA 1TE1B 3EBRA 4IV1C 1HXS3 1AUYA 3WW4A 5C5UA 3R4DB 3KV4A 1Q8SA 2YC0A 4EQVA 3FLPA 4TXWA 4FPFA 5G04L 4MXVA 2QNKA 2ZAAA 3I2GA 2WZR3 3E6BA 1V70A 2QQNA 3I97A 3WP6A 1SHWB 1UYZA 2JDNA 1REDA 4M4RA 1KGYA 3O1UA 2BP6A 1RC6A 3NWKA 3IMMA 1E5SA 4YZ3A 3DF0A 1NA1B 3B94A 1UZVA 1LEMA 2G9ZA 2WN2A 4A2UA 5FUNA 4BH9A 1KFXL 4D69A 3WEZA 2YHJA 1DQ5A 4IV3C 5KHKA 2P3KA 3OY8B 4HVQA 2HWC3 4H2AA 2CWSA 1VBB3 2UY9A 5FZCA 1HDKA 4K40A 1J3RA 3LDRA 4XW3A 2DVDA 2BNOA 1FNYA 2AENA 4QX0A 1GSLA 2W9XA 5DUVA 2DCZA 5FP8A 1NCQA 1U12A 4RA0A 4RR3B 3W21A 4AI3A 4K1ZA 1XU2A 1HN0A 4NHMA 2YZ4A 3WW2A 2I74A 5F5QA 4FO9A 4LBNA 2VZTA 1N1YA 2IXCA 1J1LA 3JD73 2R16A 3N35A 5D8AB 1NOVA 1W6QA 4C1WA 1MS4A 3TEZA 1BZWA 1HQNA 3POJA 4XF3A 3TN92 4LLOA 1F31A 4D3WA 5FYVA 4QQOA 2HEYF 3WCRA 2JDHA 1O5UA 3ZXLA 4GWJA 2O8QA 4IE6A 3R6SA 2QDNA 4XIKA 4R4XA 5KWRA 4JC1A 5CVRA 2IVJA 5CA6A 5IUQA 3WP5A 4YFZA 2IXKA 3MO4A 3B93A 1AL22 1DGWX 3IDCB 3KSCA 1OOPC 2H0BA 1DQ1A 1Y9QA 3RQ0A 3VL8A 5LEJA 3IBMA 1NLRA 1IOAA 1ULFA 1UW8A 2VTXJ 2WNVC 2QJVA 5FYBA 5LB6A 3ZX7A 4AQ2A 1RYYA 3I2OA 3NAPA 3FHAA 5BNPB 4Y4YA 1W06A 1ND3B 3HT1A 4XZUG 1ZBA2 4BQ4A 1QQP2 3AL6A 1K5MB 2BDRA 4NMIA 5FO8B 5L19A 3X29B 3UGGA 2ZX2A 4GH4A 3THTA 4MGSA 4DINB 2OX0A 2ZMLA 4OYUA 1RMU3 4XE9A 3USSA 3ZO0B 3ZSLA 1G9BA 4XQWA 3BUCA 4IEWA 4BLIA 4AZZA 2VZSA 1R1A3 4PI0A 3NV3A 2VBBA 5EWSA 3NKGA 4QAWA 3AKRA 3K4ZA 4AVVA 1O4TA 4FTEA 1XSRA 1FYUA 3FE5A 4QM8A 4BQ2A 3UL2A 4ZZ5A 4XF4A 3PVOA 5FZ6A 2ZHNA 3VB9A 4DZGA 1AR62 1AYM2 1VMJA 5A3TA 1FV3A 1VB4A 1A78A 3RRDA 2EF6A 3T4VA 1W03A 2OA2A 3BTZA 2CGPA 1NXD1 4N7UA 4NPLA 4MOAA 4BWOA 3L9JT 4EE2A 2Y6JA 3N7LA 4ZKTB 3O1TA 4LIVA 1JYNA 4O9GA 4QPYA 1GKBA 2WAOA 3B3QE 2VQ0A 4HVRA 4WM8B 5FPUA 5C9AC 3HQXA 3HQRA 5CBLA 1JYIA 4QX1A 1D0GA 3NV2A 3M3EA 4LO4B 2FHRA 5A7OA 5A6YA 1PMHX 2EAKA 3Q8BA 1ZA4A 4XHBA 3E5UA 1TQ5A 2DTYA 4JQRA 4YZ5A 1UKRA 1GR3A 1NX9A 1OFNA 2ES3A 1NG0A 2OXBA 3MIHA 3NJXA 5JR7B 2VUAA 2QUOA 4AEDA 4FPEA 2P6HA 3AFGA 4ZHNA 1R092 3AP6A 4DFSA 2Y6FA 3FLTA 3LIGA 3VD7A 4AG4A 5FP7A 2XWJB 4N43A 1YI9A 1MS9A 4NHXA 4RQPC 1AX0A 3L2YA 3OPWA 5GM0A 1IGOA 1MVEA 2HWD2 3TOJA 3AJZA 4COWA 4N8MA 2WUHA 2YU1A 4XILA 3FBYA 2C4XA 4R52A 5FYIA 1KD7A 2FQPA 3T2PA 4P5YA 4JGZB 4AHWA 4YM3A 1SDWA 4UBHA 1RVF1 4IGQA 3T30A 2C5DA 5A33A 1MVQA 1GWLA 3VHOA 4I0BA 3THPA 2Q0AA 2B8MA 1W8WA 2BGOA 4NUBA 1W9TA 4QGNA 2A1XA 1LOEA 3OBAA 4HN1A 4Z1VA 1XBFA 3WF0A 1Y9GA 4CU8A 5SV8A 3EJKA 5IVYA 2LROA 2ZZJA 3PL0A 4DXZA 1V6KA 2VBDA 4TSVA 1YUDA 4WVVA 3TRSB 1JHNA 4TN7A 3WDVA 4I3PA 1NCQC 4I01A 5J7MA 1XB9A 2QDRA 3JZVA 1RUE3 3CIHA 3FFQA 3PJQA 4XJWA 5LA2A 3RMYA 3KCYA 2K9ZA 3VV1A 1PX3A 4I2OA 3R05A 4XDPA 1DQ6A 3VKOA 1W8NA 1YQ2A 5FO9B 2HWE2 3IWZA 1C1LA 1IHMA 1RXFA 2Q1ZB 4PLNA 5FPLA 5FYCA 4ONUA 4D6RA 5HI0A 3MW2A 1VBE3 1VBC2 1VP6A 1YIFA 4BOWA 1OQDA 5A3OA 5JSRA 4URTA 3PUHA 3U07A 3UNPA 1C57A 1QDCA 3NJVA 2Y6GA 4ZXEA 1REFA 4JDNA 5CB7A 2VULA 1RUI3 5FZLA 4CP0A 4GKXA 5CISA 1GOFA 1GQGA 1NCQB 1NCRB 5F37A 4G4FA 1PO11 3NAPC 2R1BA 1SG3A 3A0KA 2CAUA 3B69A 2RS31 4DIQA 1F15A 1W6QB 3K75B 3ABZA 3QH7A 1CVNA 4Y1XA 4D0QA 2YMZA 3RG0A 2XJPA 3DYPA 4GH4C 3VBOB 2XLAA 1AJKA 4IE4A 5FZEA 1YFYA 1BEV2 3RZZA 1W3VA 3WNPA 1LOBA 2YU2A 3LOBA 2JJ6A 4YWAA 1IPJA 4KGGA 3AZVA 2BWAA 2P3YA 4GALA 1UPIA 2XWBB 3AJYA 2RDQA 4FFFA 4GB33 5A6XA 1TVGA 3NJYA 1CZTA 2YBSA 1O8PA 4UFKA 3V65A 4L97A 5KXBA 1QJY1 3WG4A 1CD3G 5BYNA 3SXWA 1ND2B 4GWIA 5JVVA 2A7AA 2CV6A 1Z7S1 1VBA3 1IS3A 1GQHA 5KHHA 3WZ1A 1YO8A 3HNMA 1S0DA 2Y64A 2EXIA 5AC92 4NAMA 1H4GA 1U5XA 3ACHA 3J9SA 3MIBA 1UIJA 4MXWA 1OC1A 5JXHA 3D82A 3HWJA 1QH7A 5BXXA 1SLIA 4CU9A 4AEJA 3IN9A 4RSUA 5CZKA 2OVUA 4OLLA 4CUGA 4K8FA 3NQHA 2Y33A 3AM2A 3T3YA 3R4UA 4ES9A 1WZXA 3GZAA 4CCJA 1B35A 4CVUA 3C8XA 4AEDC 3ST7A 2XHNA 2RJ2A 1GYKA 4P9IA 4QPIA 1UNBA 4OQ9A 3V0BB 3U10A 4L2NA 2Y0IA 5IVJA 4XFBA 2Y26A 2ZGTA 5F5IA 4ISRA 1Q3EA 4GWNA 1LULA 4YW5A 5FYSA 4IERA 3KGLA 3KQ4B 2ENRA 3H7JA 5FPVA 1FV2A 1MEC3 2ZZQA 2VMCA 4P00B 3USUA 4MLOA 2X5IB 1RUJ2 1UU5A 2QQKA 3IDEA 1GNYA 1QNYA 4MHUA 1BCXA 1DQ2A 2GNDA 2RHPA 2VE1A 3LEGA 5GZDA 3RZMA 3I2FA 4Q4Y3 1TZOA 3N7JA 3OGSA 2ARXA 3SCFA 1OA4A 2WFF2 4XFIA 4LHLA 3D5OA 4GMP1 2BVBA 3WDTA 4FPCA 3HBKA 4UFJA 4YVWA 3J4UH 4AOCA 3GALA 5HCBA 1VRH2 3D6EA 1UZYA 1ZZBA 2JE9A 2CYFA 3R4SA 4AI9A 1RGSA 2QQIA 4DY3A 4F7ZA 5A3MA 2B9VA 3K3NA 4IEQA 5JI7A 4N43B 1CPMA 2AUYA 4K1YA 4MX3A 4HL0A 2CNAA 4R8HA 5FZAA 2VOTA 5FCCA 4DPNA 1L3JA 2E33A 2R1DA 2V73A 4XAEA 2OQ6A 3UYJA 5J48A 1YJKA 1I5PA 2E63A 2K46A 3WF3A 1NT0A 3SH4A 1ASJ2 4XACA 2ZGRA 1CGPA 1R081 1MR5A 1RTVA 5CFDC 3V56A 4XFHA 1AX2A 3T2TA 5JIAA 4Q4W1 1H1IA 5DMYA 4YLZA 5J98B 4B4PA 4EN8B 4AI2A 2MEV1 1W9FA 2VO5A 2DUPA 4P9WA 4KBBA 5GZFA 3H50A 2BV4A 1OUSA 1ENSA 3AMHA 3ON7A 1LOGA 4O61A 5AVAA 4C90A 1Y43B 2XLFA 1PIV3 1RUC3 4R9CA 1O6UA 3VN4A 2B9UA 4KWUA 3WX5A 3OD0A 5BNNA 4GZ9A 5A1LA 2XL7A 4QPGA 3I3EA 4QKDA 1EYBA 5BNOB 1XXNA 4KL1A 3W9AA 4E2QA 1IS4A 1H6XA 1LJ7A 4XF1A 3KLSA 2R0HA 1UY3A 2OQ7A 3FZ3A 4X8PA 1UPSA 1CAUA 1RUH2 2RMU2 2F4LA 3OUJA 1DGRN 3BPZA 3OGRA 4TWTA 4BQXA 1W8HA 4RGAA 3BPSA 5FZBA 3SKVA 3H1WA 4JDOA 1FPN2 4NWVA 4K9SA 3VD4A 2VVDA 4CUAA 4AI0A 1ZRDA 4GA9A 4LBMA 2UURA 1N3QA 1S0FA 2DCKA 1V9U2 3SHRA 3VBSC 3P3NA 1GNHA 2ZACA 2XBO1 4FVVA 1W8UA 4HLTA 4KU8A 5F2WA 1N1VA 4GULA 2YGLA 4GJZA 5FZ1A 5I0SA 1DBNA 4BLJA 1H8TB 4BIFA 3DN7A 3JQWA 1LGCA 2QBXA 4A7ZA 3KCCA 1S0IA 2AACA 3RI8A 2WAAA 2ZX1A 4YPJA 1AF9A 2DFBA 1BBT2 3J7MA 1RHI2 3VKFC 3M70A 5I0UA 3C3VA 1W8TA 3SITA 4B4RA 5GJ6A 5A7WA 1S4CA 4M00A 1EAH1 3OPTA 2VGDA 3D0JA 3I3DA 1RUD1 4AGGA 2QQPA 2B5HA 1HRV3 1G9CA 1X33A 2RM21 4Y1ZA 5CFCC 1HRI3 4MADA 3OEBA 1ZZ7A 4BCUA 2H6BA 4A6SA 5ACA1 3JD71 4Q26A 4E4SA 2WWSA 1QXJA 1YFXA 3H1YA 1B35C 3IAQA 4Q1PA 2ZHMA 3SQOA 1CX1A 1G8WA 3I59A 5C8CA 2CY6A 3Q8CA 2PLV2 2VQUA 3ZN6A 4QPIC 1JOPA 5C3OA 1SFPA 5F3GA 2XOMA 4QXBA 4Q4X3 1TME2 2ILMA 4XETA 3VDCA 4YG0A 2VM9A 1AL23 1MPXA 4CCLA 2ZX4A 5C70A 1ZZ9A 1UU4A 1VAVA 5EZWA 3WT3A 3O0XA 2ORXA 2YYOA 1OH3A 5T5PA 3UK9A 3J7LA 5IFTA 5IVBA 1EV11 4UYBA 2WJSA 1ZBA3 1QQP3 1W2AX 1AHSA 4NPMA 1A8MA 5C4WA 1GANA 5DG2A 4NIIA 3DPRC 5F32A 4F8AA 5IK5A 3VBRB 3MUZ1 2P5BA 3N9OA 4HZFA 3VDAA 4QX7A 2RS11 3POYA 4PF5A 2H6CA 3BU7A 4XF0A 1PGL1 2RR12 4UW4A 4YVWC 4Q0VA 3LA7A 3UGHA 3WNOA 5F2SA 3DKQA 2WINB 1H8VA 1FOD1 3AZWA 1DQ4A 1NYWA 2W52A 3VZNA 2I2SA 1RJ7A 3NSTA 4ZONA 5ANNA 3WUDA 1UMHA 4CDQB 2VVEA 3KM5A 3M3QA 4OUEA 4MGZE 3PU3A 5FDBA 4Q2FA 2F4PA 4AFBA 1AR63 4PBOA 1AYM3 3B7MA 1GQPA 1C3HA 4PDWC 5DAQA 3AKPA 4LNVA 1E5IA 1S1AA 2UYBA 4LKSA 1IKQA 1WLTA 4NIAA 5IHRA 1HB3A 1RUG1 2D5FA 1NZIA 3ZYRA 4AGRA 5A32A 2Q1MA 4Z92B 2VBPA 5D2AA 2CSGA 2PHFA 5IJRA 4DB5A 4IV1A 2DVAA 4GIQA 4TLFA 2ZEWA 2X53S 5HCAA 2W3JA 3SEEA 5FMOL 1JZ8A 1DGWA 4QDSA 4I02A 4CTEA 5BNNC 1R093 3QD6A 3AX4A 1W99A 3B02A 3ZFFB 2Z42A 1UY0A 5FQ0A 4LPLA 2VXRA 2VY0A 2WWJA 4FPHA 4GAZA 3HIFA 1VIWB 4RS5B 2HWD3 4LKEA 2WWUA 3KZ4C 3OCPA 5FY4A 2JWPA 1UQXA 1KQRA 4YW2A 4KWKA 3G6JB 4X6QB 4EN0A 4A3XA 3OSDA 2D6OX 2WA3A 1QKQA 2WLQA 3KGZA 1I3HA 1OMIA 3S7EA 3T0AA 3TEXA 4YM0A 1CQ9A 3T4HB 4YG6A 3FJSA 3KV9A 3FLRA 4IXLA 2J1SA 1PVC2 5L9BA 3E97A 1HB1A 1BHGA 1S0CA 5GLVA 1CJDA 3ZYPA 4CDUB 3QLQA 2NP0A 3PTYA 4LE4A 5CFCB 2DF7A 3THDA 4QPGB 4AQ6A 2YBPA 5K7PA 3BI3A 4KMQA 2JECA 3P1IA 4HXCA 3WHUA 2LRPA 3H9AA 3FN9A 3SEPA 2DV9A 1YIPA 3WINE 5C8WA 2D44A 1K5JA 1EP0A 4K8RB 4CXWA 1HW5A 1UOFA 1LESA 3QH6A 2GAUA 1HLCA 1VMHA 1AR71 1QJEA 2EIBA 3BN6A 3TN91 4L0PA 2Q8CA 1RUF1 2ZGQA 2JENA 1XYOA 4GWMA 1QOTA 4META 5J37A 4NPRA 2D6NA 5FJHA 4XBNA 4QXCA 3VHPA 3U4SA 5F3CA 1WW6A 2XKOA 2FDFA 4UF0B 5FWEA 1CAWA 1KEXA 4I0WB 1CIYA 2BU9A 5C8CC 1VBC3 1W6PB 1ZBE2 5FY7A 3POIA 5J1XA 3K46A 4WZFA 5A1AA 3OOXA 4JGYA 4LO7A 2R061 3WDWA 3CNAA 2VQTA 3ILFA 1NUKA 4LITA 1XNAA 3ILRA 2JEMA 2J1EA 5FZKA 5FZ3A 3TYJA 4CRQA 4JDMA 4IGOA 5K0UA 4CEYC 4E27A 2HWF1 2D93A 1DYPA 1HJFA 3CMGA 4S2HA 3NV4A 2WS91 1W2UA 3UKNA 1JOJA 1BMV1 3DXUA 1X36A 3I4IA 4DO0A 1ODMA 4QGMA 3C7EA 3LCPA 1GZTA 1XPWA 3RYPA 1NAEA 2A3WA 3GHNA 5FZ4A 2NMOA 4DUVA 5C4WC 1UCXA 1WA4A 4L99A 4AFDA 4D6QA 2WNUB 1W2NA 1BEV3 3JU9A 4W6XA 1X50A 3DKWA 1QJX1 3NW4A 3PIGA 3ZN6B 2W1WA 2Z69A 3SCHA 4BK4A 1I1EA 3N9MA 5C9AA 3J8F1 2VQAA 4W65A 1MZFA 3KWVA 1X7NA 4Y26A 1XNCA 2ZGLA 5FRAA 4CUBA 3A0NA 1KITA 2YFUA 5CG8A 1BKZA 4H3WA 2WNEA 2D7FA 1K45A 2UU8A 5EJ3A 3KVBA 2XHKA 1XRUA 3DECA 1OPOA 2ZXQA 5FK8A 5FP4A 3POSA 2A6VA 5FKCA 5AC93 3BYWA 1IS5A 3O1MA 1DCSA 3POBA 2FDIA 2WYFA 4AVTA 4BXFA 4QB1A 5FY5A 3OB8A 4QT6A 3APBA 3TWIA 4AI8A 1AR92 1SFYA 3CKHA 1S0GA 3NVCA 2BNMA 5JUVA 5D1IA 4QU2A 3F95A 2QVSB 2O1QA 4FQZA 2E7TA 4LBQD 3O0WA 4HANA 5JDBA 2LTNA 1DP0A 1VB2A 3PVEA 4W6YA 4E4HA 5F9TA 2YPJA 1WMXA 2CHHA 5CKQA 3H3ZA 4Y20A 4XDQA 5M0TA 2VCBA 5FY0A 2Y8KA 4MGQA 4D94A 3WNNA 4Q27A 2HYKA 4NO4A 4Q4V3 4M0HA 1H2NA 1JN2P 1O59A 2AC1A 4HK9A 3UJQA 4A3ZA 4TTGA 2A6YA 1CAVB 1J84A 4AXOA 4QHOA 2ZGPA 5AFBA 1RUJ3 4XCBA 4JVAA 3RFRA 4QPWA 3CU7A 4BM8A 1DYOA 2P37A 1GOHA 4IV1B 2O14A 5L73A 1JZ7A 4DXSA 5I93A 3MICA 1N47A 4GKYA 5FZ7A 5FZ0A 4L92A 1HRV2 2WFF3 4JX0A 4Q4Y1 5FYTA 5A3PA 5HCHA 1QU0A 1W2OA 2IXJA 3E1F1 1HRI2 3WNMA 1BXHA 1VRH3 4E8DA 1UYXA 5BPXA 3ZYIB 1SPPA 1V6OA 2FMDA 2LM3A 4DOUA 3D8CA 3AYAA 5JXGA 2RS51 3HEIA 4IEZA 3SLIA 1XNBA 2PN5A 1AR82 4YSFA 2CDOA 3NNLA 1QDOA 4IV3B 2HBTA 2D3PA 4OI2A 4Q4X2 4LA3A 1SLCA 4IEXA 4SBVA 1PNFA 2BRTA 2ETEA 1AXYA 2OZ6A 1DQ0A 4TYSA 5FXXA 3OTFA 1ASJ3 5F5AA 4P9LA 3LGRA 4QX3A 3INAA 4BQWA 2WQ8A 4E8CA 1OKOA 5AVPA 5EIYB 1P8JA 5ABJB 1OQEA 4JQTA 4KG8A 1UL9A 2DUQA 2V4VA 4OVEA 4A44A 2Q1FA 3E5XA 2Q30A 4PBPA 2Q8OA 1G86A 1H1MA 4K20A 3U0ZA 4MHRA 2A5ZA 1N3PA 1PM4A 2KM2A 3LDKA 4JGYC 5CNAA 5JOXA 1H6YA 4UFIA 2EA7A 2V5YA 2Z4FA 4KNCA 2GC2A 4B29A 2W92A 4W4ZA 4CP9A 5ABJC 5K0UC 1W6OA 3LB9A 5K4LA 1PGW1 5CAZA 2JG8A 3ZXJA 1VR3A 4HETA 5FYUA 4ZPIA 4ASMB 5GLTA 1OOPB 2VMHA 2AZ5A 4YGBA 3AC0A 1QJU1 3RZHA 2UWAA 2ZABA 2IXIA 2RMU3 1RUH3 2WNVB 4XTMA 5BUVA 1C5HA 2UYAA 2VZVA 1C8M1 2W68A 4NWWA 1BK0A 2O8OA 1T2XA 4UFLA 1D2SA 1FPN3 4FCAA 2DCTA 4GMP0 2QQOA 5A3LA 2VPVA 5FP3A 5HCFA 3LSDA 1MACA 1E57A 2D98A 2NYYA 5FZDA 1V9U3 4LIUA 1MS5A 1L7LA 3RSJA 4X8NA 1F4AA 4OHZA 4K7JA 1V00A 2D6PA 4PHZA 4XABA 2NMNA 4WM7A 4Z07A 1LB2A 3P3PA 3GJBA 2RJKA 4AL9A 5EHDA 1YJLA 3SC7X 1D4M1 4PIYA 1U5YA 5FZMA 1GP5A 1D7PM 1GZCA 2WYSA 3GF6A 4X6RB 1SEFA 2WT0A 1BBT3 2C0ZA 1JHJA 1RHI3 3RI9A 5LW9A 4QKBA 1NE6A 3LPFA 1CIWA 4LLFA 5AFEA 1DYKA 2RS32 1BK1A 2JB8A 3ZDVA 2ATFA 5IAVA 1Y4WA 4AE2A 5FPZA 2BOJA 2GC3A 3LEKA 4XHXA 4AHZA 4LO6B 3C7OA 4HK8A 4WVMA 4LQRA 1L7RA 5FAXA 4ZU4A 5IATA 5CKMA 5CU1A 1ALYA 1QY4A 2FCVA 3MEPA 1IS6A 4HSJA 3E6DA 5C9AB 1KJRA 1OVPA 4W50A 1CX4A 4HKLA 1YXWA 2KD7A 4P9JA 3BB6A 3ZSJA 2GSYA 3MLKA 4CXYA 2PLV3 4AGVA 4LBQA 4C0BA 5HBAA 2VJXA 4H14A 5FYZA 4UW3A 1PM7A 1XNKA 1ZVFA 2R073 1TME3 4CCEA 4RHV1 1H1AA 2E53A 3WF2A 3JUUA 1AX1A 2XONA 1W04A 3RDIA 4BQ3A 1RB8G 3ACFA 3AZXA 3ZLIA 2ZGMA 1SMVA 2VNVA 3ZXFA 2AEZA 1YI7A 2VL4A 4W8JA 1CAXB 3Q8AA 3RJRA 4RQPB 5T5LA 3AB0A 2FD8A 3D4KA 2GZWA 3AYCA 4K21A 3OUHA 2E7QA 1WD4A 3MUY1 3WY6A 3WW3A 3M3IA 1SQ4A 2EXKA 1GMMA 1ZBA1 1QQP1 2C26A 1QIQA 4NOTA 2QQVA 4OI1A 5DAXA 2JXAA 2RR13 5CFDA 1SCRA 4PT6A 4BMEA 3TEYA 4XIOA 3H7YA 1S2BA 2VOWA 1SDDB 2EALA 1J3QA 4OZOA 1XE7A 5CADA 3ZFGA 1HKDA 1KDKA 3SCGA 3CHXA 4RYDA 3WQ0A 3MZHA 2ZTNA 4HFSA 4IDZA 4E9KA 4CEWA 1STMA 3AP9A 3VZOA 4Q0UA 4LXLA 1PO21 4FP3A 3ZKUA 3WLUA 4IEOA 4FAHA 3AMNA 1H30A 5BNQA 5I0TA 2MHFA 1ZX5A 2ZJCA 2VZ1A 1ODNA 1YQCA 3NO8A 1AYM1 2WT1A 2W95A 2P6CA 4XDOA 5C6CA 3MPPG 1QEXA 2F17A 2KXLA 2ZGUA 3LWCA 4S2DA 1GWMA 3GNEA 2Z5WA 3O14A 4YW4A 2D6MA 3AYDA 3LFMA 1E5RA 1EPWA 2JICA 2RDRA 3EO6A 1LOCA 4ZS2A 1WA6X 3WG3A 1MQTA 1JZ3A 3W58A 4IEPA 4WVZA 5FXVA 5LA1A 1LKNA 1GNZA 2VXJA 4DUXA 4PCRA 3ZYHA 1IPKA 3RGBA 2B4KA 3VBSA 1LNSA 2JG8C 2VH9A 2VAUA 1XE0A 5JPNB 1OSGA 3C7HA 2AYHA 1U0AA 2ZCWA 2DYCA 2FMYA 5T5OA 5JMCA 1G9DA 5L7OA 1RIRA 3NAPB 1F35A 1R082 2WO7A 2WQ4A 1GU3A 3H1MA 5CIRA 1W8FA 1N1TA 1ZRRA 2D6LX 2WFPA 4F3JA 2R041 4LBKA 2JD4A 1SCSA 3I2JA 4CDXC 3K3OA 4Q4W2 2WRAA 5FOBB 5JAXA 2G19A 5L9RA 4GH4B 4TLGA 3POGA 4E2SA 4OZXA 2YGMA 1J59A 3AP4A 3MLJA 4IEVA 2UY8A 1PVC3 2Z2SB 3WNXA 2OS2A 1AYN1 2A6WA 3WG2A 1UF2C 3D3AA 3ALQA 5LY1A 5FO7B 4WM7C 2GC0A 1JOBA 2WNOA 4AVAA 1ZRIA 3V0AA 5DPNA 1YFUA 2GDFA 2VC9A 2GNBA 4Y24A 5FZFA 2WZPP 1KS4A 2P4EA 5IWFA 4F83A 1W9YA 4UI9L 4AR2A 3POEA 3D0SA 3PHMA 4K6BA 4OMCA 5LRRA 3BGAA 1M06G 5A7SA 3TBDA 2IVIB 3BU0A 2VD7A 3OYWA 2W0XA 3AP7A 1FATA 1LOFA 1YWKA 2EIGA 4Q4V2 3AK0A 4NIGA 3WW1A 3AFKA 4HVOA 2PHWA 2P3IA 1GLHA 4QM9A 2Q8EA 3OBRA 1WCDJ 3O7OA 4Y5Z0 5KXEA 2YUEA 4B7KA 2ZGKA 2W5FA 3DL3A 3ZSMA 3HT2A 4LORA 4WZCA 1V6JA 2G9GA 3DPRA 2XBO2 1ZBE3 5F6KA 2HWE1 4CCMA 1WLCA 4UXAA 1IZ3A 3EB7A 1J3PA 2ET7A 4AAXA 1TMF1 2H0VA 2DWRA 2E7AA 2RG4A 2XVGA 4NR1A 4AEDB 5KHIA 4GQ7A 3H8XA 1K12A 1C4RA 1DF0A 2W1QA 1Q8VA 2DURA 2PELA 2Y6LA 3I3QA 4NJ4A 3ZR6A 4EZ4A 2TEPA 2XDVA 2XGXA 5E8AA 3A7QA 2JDPA 1EAH2 4A4AA 2GN7A 4L9BA 2JIJA 4NVPA 1ZA7A 1RUD2 2VCCA 3ROUA 2GMMA 2QQMA 3GZUC 1UYYA 3K4AA 1V6IA 1W3XA 5DDJ1 3HNYM 2ADEA 2RM22 2WO3A 1DGRA 4LKDA 3PUAA 2XVKA 4PDWA 4LBOA 5ACA2 4JKLA 3LIHA 2J7MA 1O7FA 3ASIA 1WCSA 4Y22A 2VW0A 1PNGA 3I2DA 4BIOA 5A33B 1HJGA 1F2NA 3JBG1 1BEV1 3KV5A 1POV3 1E5HA 1UKGA 4V1PA 1V0AA 3ZFGC 1MS8A 1ULCA 3HN3A 3WXPA 2ID4A 4QWNA 4HBNA 1FXZA 2E51A 3KF5A 4PQ9A 2XJTA 2R49A 4CEWC 4KU7A 5IVFA 1COV1 2FZ2A 1D4VB 3IZOA 5GZCA 4HPKA 4ZU5A 5K8SA 1M4WA 4IGPA 1HX6A 2JG9A 3VD9A 1RUOA 4WV8A 3WDUA 3IPVA 5BV6A 1W05A 3J26N 1EV12 1WWYA 4PJYA 4QMAA 2CU5A 1F9KA 2EXJA 1XJAA 2C9KA 2GNMA 2OPKA 1LR5A 1UX6A 1ST8A 3AZYA 3MPBA 4BYYA 3ME2A 2Y0OA 1HV0A 4KWLA 4LOTA 5LA9A 4MUVA 2HWB1 5F3IA 3BTXA 1AR93 1JH5A 1OUXA 3KD4A 1A8DA 2RS12 4YVSC 5CFDB 3EMRA 1JYCA 3J7NA 2BFUS 1LOAA 1PGSA 1XOYA 4KI5M 1ZREA 3O5SA 1PGL2 1ZM1A 1AXKA 1MQTC 5F5CA 1TG7A 1URXA 2JB4A 2LALA 3VBUA 4DY5A 3ATGA 5CEHA 5IK7A 2QCSB 3ZFEA 3ACLA 4NHYA 1HXS1 5E6HA 1ENQA 2B39A 3CJIA 4MYEA 3S6PA 2EVXA 1ULPA 4INDA 2WZR1 2L9LA 2PAEA 1UY4A 2IFWA 4ARYA 4AVSA 4AHYA 4NRQA 1KRIA 4ITCA 2ZGSA 4MVTA 2ZA9A 1F8VA 1H2MA 3K77A 4YW1A 5L7OC 3ZN5A 1VBD2 2WSVA 4Q8LA 4YW3A 3ZVXA 3IDBB 4QD2A 4NIHA 2J1UA 4LMFA 2HWC1 2X10A 3AZZA 4FPYA 4XMIA 3ZIWA 1C8NA 1VBB1 3LE0A 5FPXA 3E6CC 5B2GB 1RUJ1 1B09A 5T55A 1DG6A 1IQDC 3ACIA 1CJPA 3ENRA 2DVBA 1REEA 5JZGC 5EP9A 3I2HA 3VBSB 1H0BA 2VW1A 2YFZA 5A1FA 1TEIA 3DV8A 4XVHA 1YFWA 1W6NA 3K48A 3U1XA 3PIJA 2RDNA 5EQUA 3RWKX 1AR83 1VRH1 1FMD2 1RXGA 4N90A 3M1HA 4FT8A 4NIDA 1F4HA 1BQPA 5L9VA 1W0OA 4XMAA 2PHXA 2R072 2XQXA 1Q8PA 5A70A 1DHKB 5FZOA 1LOFC 3H3LA 3U11A 5KXDA 1BJQA 4AQSA 4CEYA 3OPZA 4KBZA 1O3TA 3A21A 2WZ8A 3DUIA 4M3CA 2JDKA 3KHCA 2D40A 4LHKA 1VLNA 2XL9A 2W1SA 1PMJX 1VALA 4MXWB 5F1RA 5JPMB 1JUHA 4LULA 2TBVA 1RJ8A 3VBHA 2YXSA 4HN0A 1RITA 4FFHA 2GU9A 2XJQA 2QE3A 3BOWA 1JZ5A 2P3JA 3UKVA 4COUA 4QDRA 5DG1A 1K42A 4LK7A 1W8ZA 1ULDA 4AYUA 4DXTA 1B35B 3VL9A 2VMIA 5FPBA 3K51A 1WMDA 4AAPA 1RUNA 4CDWA 3NNFA 4QPIB 3K2OA 3WSOA 2P17A 3MW3A 4AEKA 1RMU1 4Y1VA 4CUCA 1NE4A 1YYNA 5LBFA 2B7YA 3FUQA 1HV1A 4E4DX 1R1A1 1SACA 2QQJA 3VKMA 2VOXA 3USUB 5KR7A 1AR72 1UO9A 3KMHA 2OT7A 1KDMA 3MGUA 2BEOA 3O0VA 4GJYA 1XU1A 1RUF2 2OW4A 4PLOA 3V64A 4EWAA 1S55A 1SLLA 2W87A 2HH9A 4B8EA 2CGOA 3ILNA 3AKQA 1ULGA 2EIDA 3LEMA 2G9FA 4BHPA 4YZ2A 4Y5SA 4IE5A 2QKDA 2E9QA 3DPRB 3MBWA 1J83A 4OHVA 2Y34A 2XB6C 3T09A 4NHKA 2R7EB 3HN1A 1WMEA 3IB3A 3WUCA 4BISA 2J42A 5H9QA 4COZA 3AMQA 1QJFA 1GZ9A 5JOYA 3Q8EA 3LZZA 3T0DA 2R062 4N9HA 3IDAA 4XUNA 4YYOA 4YVWB 4YRDA 1UIKA 5C7GA 4L8QA 1VAMA 4YGCA 2XMLA 5LASA 4CCNA 2VG9A 2HWF2 4Q0SA 3VBFC 3ZYBA 4HKOA 2RV9A 2HEWF 2DBIA 2JG9C 1SLBA 2WQZC 4M3CE 4COVA 1BMV2 3OGVA 5FY9A 1KXGA 1MS1A 2RS33 5DAWA 5DUUA 3ZDSA 3OY8A 4MSVA 1DIWA 2AEYA 1FI2A 1RHI1 1FNZA 1DFQA 3M7AA 4PDWB 1WW4A 2XR4A 2VNRA 2WO2A 1XQNA 4YGDA 3WF4A 3ZXGA 4FPKA 3WQ7A 3S5AA 2PTMA 5CKNA 3PDQA 4NRPA 1QJX2 1UZZA 1LGBA 3BCWA 4J25A 4CXXA 5I0DA 5FUIA 3VDBA 5HV0A 1XSQA 3I8TA 3LEIA 4D7YA 2JDZA 3VBUC 3ZIXA 4UW6A 4MV2A 4KGQA 3ZMOA 3J8F2 3UV9A 3ZFEC 4PIZA 1UX7A 3U4XA 3JXSA 1OHFA 4XZPA 4HG6B 4XURA 3MV01 5D8AA 3SISA 2K0GA 1X9TA 3CJIC 1GUIA 2BNNA 2E32A 2NN8A 1WGPA 2CGNA 3IKWA 2R32A 2DCYA 4P9GA 5ERLA 1Z7S3 3GBFA 2PLV1 3MYXA 4SLIA 3IPVB 3RYRA 5BNNB 1UOGA 2IC1A 4YARA 1PMIA 2DBNA 5J96B 2W94A 1TME1 5I8TA 2QQWA 4P02B 1ZZ6A 4CU7A 3CL1A 2Y6KA 1OURA 2N7GA 2ZS6B 3H8RA 3MI8A 1JODA 4XJAA 1CAUB 1UWWA 4FPOB 4EN6B 4ASLA 4D7TA 4EN7B 4CCCA 2J1AA 5C3SA 2J22A 4JKMA 1HIXA 3VD5A 5BNPA 1ND3A 3MIDA 2BWCA 1K5MA 1OXCA 3VZLA 1QH6A 3ZPOA 1RUE1 5FZGA 5GALA 3RZJA 3KF3A 3O1OA 3BTAA 2RR11 1LAJA 5T5JA 4XYXA 5J36A 4D8MA 1T6GC 4P9YA 1AJOA 2CL2A 4LK6A 1PK6C 4XQDA 5FXZA 5JCTA 2VOKA 5ANQA 1BLZA 3CEWA 1ACCA 1VBE1 3W5MA 4CE8A 3GBGA 4FBFA 4Z82A 3C2UA 2WLPA 5A7WB 1X9PA 5I91A 1CPNA 3WDXA 4QB6A 5GLZA 2E6VA 5IW0A 2ZPXA 2ZEXA 2DU1A 1SBFA 2V4AA 3ES4A 3MFAA 4QKFA 1RUI1 3VBHC 1CZVA 2DU0A 3PLQA 3WOGA 2WR9A 4QQHA 1CR7A 4GMP3 1S0JA 5B4XA 3SMHA 5IVCA 1W6NB 4WM8A 1OFSA 4LE3A 1H2LA 3ZXDA 1CESA 3I59B 5C8CB 2XVLA 1W0PA 4CDWC 2RS52 3NKTA 5FZ9A 3GDBA 5I8SA 3U14A 4ET7A 5LA0A 1KFUL 4JHTA 2KR2A 2VTFA 2YY1A 2ZAHA 2VZUA 3GHMA 4YM1A 5FZOB 1S2EA 4CEYB 3JCIA 3HR9A 4JRAA 4IW3A 5CG9A 4M3CB 3ZR5A 2VMEA 4FAGA 4GB31 4OMDA 1LCLA 4BJ0A 4XJUA 4IESA 4MGTA 1EPZA 5EJZB 1NY71 1R083 1ENXA 1UXXX 2ZX0A 3HQUA 1XNDA 4XXAA 3TNPB 3VUOA 3M4FA 5KHJA 5C4WB 4DRVA 2P34A 3M2MA 4Q4W3 5A6QA 2GMEA 3OBZA 4A45A 1VBA1 1A3KA 2DFCA 5LBEA 3VDDC 4CP1A 5I0RA 2OUJA 2MEV3 3RJ2X 4LBLA 4LHSA 5DQ0A 4WBBA 5FZIA 2QZ3A 1NKGA 5KC6A 2XXZA 2JDAA 2Y60A 4QU1A 3G7DA 1JXNA 4PQQA 1Y3TA 4DEVA 1G9AA 4FSJA 4EWEA 4Q0PA 2G1MA 3O12A 3OGGA 1PGW2 5LK7B 5F7UA 1NA1C 1OLMA 4JV4A 5DXDA 2RJLA 4AWDA 5F8PA 3BKZA 3HMYA 1HB2A 1QJU2 1OD5A 1W0NA 2BUKA 2JKBA 4FXGB 2FDJA 4XBQA 3AL5A 1C8M2 4C1XA 2DCJA 1OBNA 1WLWA 4LUMA 3CZUA 4EV0A 3CDZB 2YV8A 3WQBA 1WCUA 2GH2A 4AFMA 4FPGA 3NV1A 2HEVF 2R30A 5FMCA 5E88A 4RR3C 1QGLA 3O1PA 1MEC1 5A32B 1UOBA 1CZSA 5F39A 1O3SA 3ORJA 4BZ4A 5C3RA 4JKKA 3B9CA 2ZMKA 4A41A 2XBO3 1A6CA 1HB4A 1OQ1A 2PHUA 3K4DA 5D8AC 4BQYA 4Z2AA 3PTRB 4LT5A 1EY2A 4ATEA 1RINA 1D4M2 5FUPA 2D43A 1Q56A 1ZBE1 1XC6A 3KQRA 2V5DA 1VE0A 1EUTA 4FOVA 1MS0A 4HKWA 3PNAA 5EYXA 1S2KA 2QQUA 4XUOA 5FQ0B 4I3GA 5C33A 4AI1A 4LA2A 5FZHA 1G6NA 2CDPA 1EAH3 4AEMA 5I8YA 5KBFA 3BIWE 3LAGA 5IYYA 1RUD3 4XF9A 4CCDA 2LW8A 2VNGA 1GV9A 4EZHA 2HBUA 1NCRA 2RM23 3LDBA 4HOOA 1IG0A 2W91A 2WABA 3ZYGA 2Q5TA 5BY5A 1PX4A 2PAMA 5LBBA 4C91A 2VVFA 3FMGA 3UESA 1LENA 4ATFA 1YNAA 2ZMNA 5DZFA 5ACA3 1YQ5A 5BNPC 1ND3C 2PHLA 1K5MC 1RVF2 1XYPA 2BQPA 1JBCA 1UZWA 5EPAA 1F5JA 2XJSA 2D3RA 3RVHA 1BVP1 1F5FA 4LBJA 2GNTA 3LSEA 2WKKA 3IIAA 3VBOA 4QQ2A 4J6GA 3HOBA 1W2TA 1OLME 5A7QA 4H7MA 2KA3A 4RHV2 4ORFA 1POV1 4RGKA 4BB3A 2BERA 3ZXKA 3KT1A 1LHUA 1X8EA 3NNJA 3OG2A 4QQLA 4A7YA 3SNMA 1JUIA 5FMOS 5FZ8A 1EV13 1ND2A 2XJUA 1PIV1 1VAKA 1RUC1 4XTPA 5FWJA 2BVVA 3OUIA 4G3YC 2W08A 4CP2A 4QQPA 4B1LA 3B9IA 1OT5A 4EYUA 4OFGA 2RS13 2GP5A 3GXUA 3LF7A 2FZ1A 4Q29A 3LA3A 2YDEA 1YCIA 1LEDA 1LTEA 3N36A 4WM8C 2GH8A 1AR91 1LGNA 1ULOA 1NQJA 4S2FA 1CAWB 2NPIA 1LU1A 4PLMA 4CDXA 3SKJE 3ZM8A 1FOD3 1SBDA 4GXLA 4JGYB 1QOOA 4LHNA 2QFEA 4YW6A 3ZPYA 4E2GA 2F6BA 3W5NA 4XCAA 2DDUA 3WHTA 4N9IA 1V6LA 5K0UB 5LCWL 3PVNA 1PO22 1V6MA 3FHIB 4Q1RA 2HLEA 3IM0A 2PHTA 1VPHA 2E26A 2C1FA 3V0BA 5ISLA 1VBD3 1ZZCA 2JIGA 1PO12 1W9SA 2RVAA 4Y1YA 5F3EA 1JYTA 4FPJA 4FTBA 1RUG3 3RWNA 4ZS3A 5FOJB 4Y33A 3CF6E 3I2KA 5APAA 4R9AA 4C0HA 5IFPA 3TEWA 4JTNA 2OYZA 2A73B 2X5IA 5B4NA 1UY2A 1CN1A 2WA4A 3KHBA 5HXMA 1O3QA 4JGZC 3MIGA 1IQAA 1AVBA 5EXOA 1ZNPA 2PYTA 5CYYA 2WT2A 1SLTA 3M8LA 4FI9A 2A6XA 4Q5OA 2BTVC 3H8OA 1HRV1 2EAAA 4U2AA 2O0OA 2PQSA 1UU6A 4XFCA 5FYHA 4XXPA 1HRI1 4IL7A 5C71A 5FIXA 1FMD3 1H4HA 3N3HA 1C28A 2AREA 3LKJA 1QJY2 4NN0A 5FJKA 3WP3A 3KB5A 3NL1A 4LOSA 2V72A 3L2HA 5T50A 2VOVA 3S0MA 1AR81 3LPGA 3MDPA 1QXPA 1NLSA 2BW8A 1Z7S2 1KJLA 2WDBA 1FX5A 2VECA 3WP4A 4BQ5A 2BFUL 5DZEA 4DEQA 4OHWA 2R042 2XH6A 4Q4X1 2Z79A 4W6WA 3WDYA 3BALA 1AL21 3WNLA 2SLIA 2XLGA 3NNGA 1IPSA 3Q8FA 4V2VA 1K3IA 4QGLA 3CO2A 3TAYA 3ECQA 4XJZA 3FC0A 1AYN2 1R1ZA 4PIXA 4BXSV 3GZTB 4LR4A 4Q0QA 5A7NA 1VMFA 2PXJA 2NZ9A 5H9RA 1V6NA 2YC4A 1CWPA 4N7IA 2GN3A 4XFGA 4Y20B 1W6MA 3ZN4A 4OI0A 1HQLA 1JZ6A 3H42B 2GC1A 2IUWA 4A7KA 2A6ZA 1JZ4A 3FL7A 3GCXA 3ITQA 4FPLA 1AR73 3TN93 3JB8A 1I5ZA 3H0OA 4XUTA 1RUF3 4YG3A 3LD8A 3M3OA 3W59A 3ZMNA 5E16A 1XE8A 1NCRC 1EUUA 1AXZA 4OI4A 2VUJA 2ERFA 1GWKA 5BNOA 2BGPA 2ADDA 2IXHA 2VZQA 3WG1A 1Y7BA 2X29A 3NMBA 1AR61 1GP6A 5FYMA 3ETQA 1W90A 1WCKA 2B42B 3HAGA 4CU6A 2B45X 3DGTA 3VBOC 2YC2A 2R063 2V09A 4YVSA 3F2ZA 1J1TA 3KT7A 3MHZA 3CBNA 4N53A 1TMF2 2FCUA 2VMFA 4UBGA 4QDQA 4QX5A 4IUGA 1SPPB 3QOPA 1O4ZA 2YBKA 4Y5TA 4CCOA 2RE9A 2HWF3 4JAAA 2JDMA 3PURA 4XC9A 5D21A 2WS93 4NRMA 1O4YA 3B00A 1US3A 2IZWA 1O8SA 1W28A 4D7SA 4IEYA 2D97A 4Y3OA 1H8TA 1ND2C 1QOSA 3FWEA 3T1MA 4JCKA 2DVFA 4L11A 5DDJ2 2G4IA 3B01A 1OLQA 3Q9OA 2GMPA 2R6QA 1R091 2A75A 2J1VA 2WO1A 1G7YA 4RGGA 4IE0A 2PHDA 3C7GA 1WD3A 2VNOA 4P08A 2Y6HA 3N7KA 1QJX3 4NAOA 5FKBA 4AF9A 1SFNA 1JYVA 1L7QA 1OA3A 3AKTA 3URFA 2HWD1 3RNSA 3JBG2 4NHLA 4QHBA 3SH5A 3J8F3 1NQDA 2YB7A 1WKYA 3IT8A 3HJRA
chains in the Genus database with same CATH topology
3LA2A 1AL0G 1QMJA 2MEV2 3RMXA 1AZDA 5H9PA 1ZRFA 5FTTC 4B7EA 1D2QA 2UWCA 1COV2 2A70A 5JZGA 4RFT0 1W6OB 2JG8B 5JWPA 1QNWA 2ZHKA 4MGYE 1WBLA 5IT6A 4P5HA 4B4QA 5KXCA 2HWB2 3TB0A 2XKPA 4Q8KA 1QXRA 4O9EA 5IK8A 3EXUA 3MW4A 2X5IC 3OJBA 4CDXB 2A71A 5DUWA 2PHRA 2BPA2 3N7MA 2OZJA 3R0RA 3VLBB 3VZKA 1WMFA 5KHGA 1HXS2 4J1XA 3VBRA 3NJZA 5E89A 4MGIE 3HD8B 1Q8QA 3VHNA 4WM7B 2WZR2 5JIUA 4BA6A 4I0AA 1GICA 1BVVA 1H9WA 1I6XA 2Q4SA 2B46X 4AK3A 5L36A 4DQAA 1O91A 4S2GA 3VHRA 1VBC1 2CTVA 4JTOA 4N43C 3KS7A 4CDQA 1MZEA 3QBQA 2HWC2 1VBB2 4WVMB 1G9FA 1NZCA 1OA2A 4Z8BA 4XJ8A 1PZ8A 2IFRA 4OHXA 2PQQA 1DU3D 1FT9A 1D0HA 2NM1A 5H9SA 4AVCA 1DZQA 3JD72 4G9SB 2RS53 3KT4A 1UAIA 4LBQB 4FP2A 2ZGNA 4OHYA 1QHDA 3E5QA 1QWRA 4R9BA 2CAVA 2D3SA 1LHNA 2MPFA 3VBFA 2ZKLA 4AQTA 3ZFFA 5T54A 4IQPA 5BNOC 4EN9B 3PJYA 4CZSA 4LEJA 3OD4A 4RS5A 4WVWA 1APNA 3OGJA 4H55A 2ZHLA 2ET1A 1Z78A 2XJRA 3ZSKA 5T52A 5AC91 4M0NA 5KC5A 2PA7A 4ZU7A 1PZ7A 2JE7A 3LOIA 4R4ZA 4N53C 5DZGA 3QACA 4AW7A 2ZGOA 1W6MB 4LUKA 3VZMA 1DZTA 5JLVA 4DRRA 1Z0HA 3ZFGB 1RMU2 1O5LA 2XPJA 1FOD2 3MF9A 4CDUA 3MIEA 1R1A2 4CEWB 5J3UA 1GZWA 3OF1A 1H8TC 5CFCA 1QJU3 3QCWA 1Q43A 3ZYJB 2ZOEB 3H3UA 4ISQA 4KG0A 2VW2A 3PMSA 4XFAA 1C8M3 4OUSA 1DDLA 4I30A 2WL1A 4DS0A 5LK5A 1GFF2 3KCXA 2EXHA 4Q4V1 1CONA 3GYDA 5FREA 2I07B 4YVSB 1RUG2 3RPQA 4N53B 2DTWA 1SLAA 5E1RA 5TSWA 1MQTB 1PZ9A 1BYHA 4YFWA 5FFOC 1LU2A 1TNFA 3WQ1A 4OUMA 1D4M3 5JOWA 1YLLA 4CYDA 4Z2WA 1ZZ8A 1W6PA 1LODA 2WFF1 3AXEA 4K3UA 3BOPA 3PVBB 3RYKA 2NQYA 4M01A 3AP5A 1LHWA 1WBFA 2AGSA 1LHVA 1PK6A 5L7OB 1WW7A 1H9PA 3RS6A 1JTZX 3AYEA 5LEKA 2XUMA 3EHKA 1OI6A 1RVF3 4FTSA 2XG3A 1ASJ1 2WNUA 3VBRC 4LTAA 4ZXKA 2PAKA 5JZGB 2AR6A 3BODA 4TZDA 4FOWA 4AFAA 1MS3A 5GLUA 1YRZA 1LRHA 4RHV3 3V0AB 2FBEA 4OULA 3CJXA 3FFZA 1I9RA 2X8KA 3FX3A 3B5LB 4AFCA 4BE3A 3H8UA 1JW6A 2K2SA 1ULEA 3OBTA 4CDQC 1QJZA 1X82A 4I2OA 1C1FA 2UWBA 2Y38A 2CWMA 3OYWB 2SBAA 1UN1A 4KH9A 3GBWA 2GALA 4QXKA 2BGCA 3EQEA 3I54A 5F6LB 2YROA 2MNGA 4AHXA 3FUOA 4KQ7A 1X8MA 4ES8A 2IXLA 4YZ1A 2RMU1 1RUH1 1RUE2 1NXMA 3JB4C 4XBLA 4BMBA 4IEUA 1GBGA 5J09A 1O3RA 4XFFA 4YNIA 3VDDA 1FPN1 4DMIA 5JSPA 4MGKE 3N4MA 4LO8A 1J58A 3POWA 1PO23 1V9U1 1VBE2 1WUVA 1N3OA 2QZ2A 2ZKNA 2JX9A 2IWGB 3AMMA 2WS92 3ZFFC 2D5HA 1NA1A 1PO13 3CLPA 3ES1A 2ZBJA 5GKAC 2A3YA 1RUI2 5HXVA 4MH0E 4RS5C 1VBD1 4BPZA 1CAVA 5JOZA 1BBT1 3UJOA 3M3CA 4JRLA 4EWDA 4EJRA 4Y22B 1POV0 2HKXA 3A4UA 2D6KA 4RR3A 3S7IA 1PHMA 3WCSA 3HBZA 3ELNA 4FXKB 4XEZA 4CDUC 1QJY3 2ARBA 2VU9A 2A3XA 3MF6A 2BYVE 3ZXEA 3VBFB 4HPKB 5CFCC 4GB32 4QPGC 4AVBA 2JG9B 1FMD1 1NY72 5IK4A 3MIFA 3VKLA 2BBVA 3ZXAC 1WLDA 1S0BA 2R071 2R043 4YGEA 4IV3A 5FLHA 3T1LA 4E4ZA 4M3CF 4J1WA 1VBA2 1HQWA 3UKTA 1W39A 2TNFA 1RL3A 5LRSA 1Q8OA 4R9DA 2DVGA 1U5ZA 3AMPA 3AXDA 1AYN3 2ZX3A 3IMNA 3VBUB 5JI9A 5ABJA 3I7DA 5FLJA 3PMEA 3ZFEB 4DNYA 4FQ4A 3WVJA 2I45A 4HT1T 1GZWB 2TUNA 3CJIB 5EV7A 1YHFA 2C9AA 4XJ9A 2W39A 5GZEA 1H2KA 4KWJA 1PVXA 1IKPA 3VKNA 1ENRA 4RL7A 4MZUA 5T3NA 1QF3A 3SH3A 1ZYBA 1SBEA 1WW5A 3WR0A 4HSLA 1OOPA 1MEC2 1S0EA 1N1SA 2WNVA 3FBMA 4H7LA 1ZRCA 5GZGA 3AKSA 1C5IA 2HWE3 2WNUC 1XYNA 4RD7A 1OPMA 3VZJA 5JSOA 4Q4Y2 4XQ4A 1TMF3 4FOYA 3TNQA 1DZRA 3MLLA 2VMGA 1U5IA 1ONAA 1UD1A 5SV5A 4BQ1A 1UMZA 1PK6B 2NLRA 1FAYA 3MFCA 5DUXA 1MZ6A 2AH2A 4YM2A 1OLRA 5DDJ3 5GLWA 4B3NA 3S30A 4U36A 1VJ2A 4XPVA 5EFUA 2WSUA 4LO5B 3VBHB 2LUWA 1TNRA 2OUHA 3ZSEA 4UW5A 3JBG3 5FLIA 4HMZA 4P14A 1Q5OA 5FBZA 5K9YA 1LECA 1MZ5A 4JGZA 1COV3 3WD5A 4CDWB 2DUOA 2HJIA 2WC2A 3JQXA 2R0FA 1DLLA 4IETA 1PVC1 4P9XA 3VGIA 2OIIA 1KS5A 2PFWA 2P2KA 4C1XA 4XOGA 1PIV2 1RUC2 1DGLA 2WIIB 2HWB3 3WV6A 4FOQA 1CAXA 1LHOA 4RQPA 4YZ4A 4I09A 4COYA 2XJVA 4Y1UA 3VDDB 1OKQA 1TE1B 3EBRA 4IV1C 1HXS3 1AUYA 3WW4A 3R4DB 1Q8SA 2YC0A 3FLPA 4FPFA 4MXVA 2QNKA 2ZAAA 4ASLA 2WZR3 3E6BA 1V70A 3WP6A 4EROA 1REDA 1RC6A 3NWKA 4YZ3A 3DF0A 1NA1B 3B94A 4A2UA 1LEMA 4BH9A 1KFXL 4D69A 2YHJA 1DQ5A 4IV3C 5KHKA 2P3KA 3OY8B 4HVQA 2HWC3 2CWSA 1VBB3 2UY9A 1HDKA 4K40A 1J3RA 4XW3A 2BNOA 2DVDA 1FNYA 2AENA 1GSLA 5DUVA 2DCZA 1NCQA 1U12A 4RA0A 4RR3B 4AI3A 4K1ZA 1XU2A 4NHMA 3WW2A 2YZ4A 5ABJC 2I74A 5F5QA 4FO9A 4LBNA 1N1YA 2IXCA 1J1LA 3JD73 2R16A 3N35A 5D8AB 1NOVA 1W6QA 4C1WA 1MS4A 1BZWA 1HQNA 4XF3A 4D3WA 4LLOA 1F31A 4QQOA 2HEYF 3WCRA 1O5UA 3ZXLA 2O8QA 3R6SA 2QDNA 4XIKA 4R4XA 5KWRA 4JC1A 5CVRA 5CA6A 5IUQA 3WP5A 4YFZA 2IXKA 3B93A 1AL22 1DGWX 3IDCB 3KSCA 1OOPC 2H0BA 1DQ1A 1Y9QA 3RQ0A 3VL8A 5LEJA 3IBMA 2WNVC 1IOAA 1NLRA 1ULFA 1UW8A 3ZX7A 2QJVA 4AQ2A 3NAPA 5BNPB 4Y4YA 1ND3B 3HT1A 5FO8B 1ZBA2 1QQP2 1K5MB 5L19A 3X29B 2ZX2A 4GH4A 3THTA 4DINB 2ZMLA 4XE9A 1RMU3 3USSA 3ZO0B 3ZSLA 1G9BA 4XQWA 4IEWA 4BLIA 1R1A3 3NV3A 5EWSA 3NKGA 3AKRA 4AVVA 1O4TA 4FTEA 1FYUA 3FE5A 4QM8A 3UL2A 4XF4A 3PVOA 4DZGA 2ZHNA 1AR62 1AYM2 1FV3A 1VB4A 1A78A 3RRDA 2EF6A 2OA2A 2CGPA 1NXD1 4N7UA 4ZKTB 4BWOA 3L9JT 3N7LA 4O9GA 4QPYA 1GKBA 3B3QE 4HVRA 2VQ0A 4WM8B 5C9AC 3HQXA 5CBLA 1JYIA 1D0GA 3NV2A 3M3EA 4LO4B 2FHRA 2EAKA 1ZA4A 4XHBA 3E5UA 1TQ5A 2DTYA 4JQRA 4YZ5A 1UKRA 1GR3A 1OFNA 2ES3A 3MIHA 1NG0A 5JR7B 4AEDA 2VUAA 2QUOA 4FPEA 3AFGA 1R092 3AP6A 4DFSA 3FLTA 4AG4A 2XWJB 4N43A 1YI9A 1MS9A 4RQPC 1AX0A 3L2YA 5GM0A 1IGOA 1MVEA 2HWD2 3TOJA 3AJZA 4COWA 4XILA 3FBYA 4R52A 1KD7A 2FQPA 4JGZB 4AHWA 4YM3A 1SDWA 4UBHA 1RVF1 2C5DA 5A33A 1MVQA 3VHOA 4I0BA 3THPA 2Q0AA 2B8MA 4QGNA 1LOEA 4HN1A 4Z1VA 5SV8A 3EJKA 2ZZJA 4DXZA 1V6KA 4TSVA 1YUDA 4WVVA 3TRSB 1JHNA 3WDVA 4I3PA 1NCQC 4I01A 5J7MA 2QDRA 3JZVA 1RUE3 3FFQA 3PJQA 4XJWA 3RMYA 3KCYA 2K9ZA 3VV1A 3R05A 1DQ6A 3VKOA 5FO9B 2HWE2 3IWZA 1C1LA 1IHMA 2Q1ZB 4PLNA 5HI0A 4ONUA 3MW2A 1VBE3 1VBC2 1VP6A 1YIFA 4BOWA 1OQDA 5JSRA 4URTA 3U07A 1C57A 1QDCA 1REFA 4JDNA 5CB7A 2VULA 1RUI3 4CP0A 4GKXA 1GQGA 1NCQB 1NCRB 4G4FA 1PO11 3NAPC 2R1BA 3A0KA 2CAUA 3B69A 2RS31 3QH7A 1W6QB 4Y1XA 1CVNA 2YMZA 3RG0A 2XJPA 4GH4C 3VBOB 2XLAA 1AJKA 1YFYA 1BEV2 3RZZA 3LOBA 1LOBA 2JJ6A 1IPJA 4KGGA 3AZVA 2BWAA 4GALA 1UPIA 2XWBB 3AJYA 4GB33 3V65A 4L97A 5KXBA 1QJY1 3WG4A 1CD3G 5BYNA 3SXWA 1ND2B 5JVVA 2A7AA 2CV6A 1Z7S1 1VBA3 1IS3A 1GQHA 5KHHA 3WZ1A 1YO8A 1S0DA 2EXIA 5AC92 1H4GA 1U5XA 3J9SA 3MIBA 1UIJA 4MXWA 3D82A 3HWJA 1QH7A 5BXXA 1SLIA 4AEJA 3IN9A 4RSUA 2OVUA 4OLLA 4K8FA 3AM2A 3R4UA 4ES9A 3GZAA 1B35A 4AEDC 3ST7A 1GYKA 4P9IA 4QPIA 3V0BB 3U10A 4L2NA 2Y0IA 4XFBA 2Y26A 2ZGTA 4ISRA 1Q3EA 4GWNA 1LULA 4YW5A 4IERA 3KGLA 2ENRA 3H7JA 1FV2A 1MEC3 2ZZQA 3USUA 4MLOA 2X5IB 1RUJ2 1UU5A 3IDEA 1QNYA 1BCXA 1DQ2A 2GNDA 2RHPA 5GZDA 4Q4Y3 3N7JA 2ARXA 3SCFA 1OA4A 2WFF2 4XFIA 4LHLA 3D5OA 4GMP1 2BVBA 3WDTA 4FPCA 4YVWA 3J4UH 3GALA 5HCBA 1VRH2 3D6EA 1UZYA 1ZZBA 2JE9A 2CYFA 3R4SA 4DY3A 1RGSA 4F7ZA 5A3MA 4IEQA 5JI7A 4N43B 1CPMA 2AUYA 4K1YA 4MX3A 4HL0A 2CNAA 4R8HA 5FCCA 4DPNA 1L3JA 2V73A 2R1DA 5J48A 1YJKA 2E63A 3SH4A 1ASJ2 2ZGRA 1CGPA 1R081 1MR5A 1RTVA 5CFDC 3V56A 4XFHA 1AX2A 3T2TA 5JIAA 4Q4W1 1H1IA 4YLZA 5J98B 4B4PA 4EN8B 4AI2A 2MEV1 2DUPA 4P9WA 4KBBA 5GZFA 3H50A 1ENSA 3AMHA 4C90A 1LOGA 5AVAA 1Y43B 2XLFA 1PIV3 1RUC3 4R9CA 3VN4A 2B9UA 3WX5A 3OD0A 5BNNA 2XL7A 4QPGA 1EYBA 5BNOB 1XXNA 4KL1A 3W9AA 4E2QA 1IS4A 1LJ7A 4XF1A 3KLSA 2R0HA 3FZ3A 4X8PA 1UPSA 1CAUA 1RUH2 2RMU2 1DGRN 3BPZA 4TWTA 4RGAA 3H1WA 4JDOA 1FPN2 4NWVA 4K9SA 2VVDA 4AI0A 1ZRDA 4GA9A 4LBMA 2UURA 1N3QA 1S0FA 2DCKA 1V9U2 3SHRA 3VBSC 3P3NA 1GNHA 2ZACA 2XBO1 4FVVA 4HLTA 4KU8A 1N1VA 4GULA 2YGLA 5I0SA 1DBNA 4BLJA 1H8TB 4BIFA 3DN7A 3JQWA 1LGCA 4A7ZA 3KCCA 1S0IA 3RI8A 2ZX1A 1AF9A 2DFBA 1BBT2 3VKFC 1RHI2 3M70A 5I0UA 3C3VA 3SITA 4B4RA 5GJ6A 4M00A 1EAH1 2VGDA 3D0JA 2QQPA 1RUD1 4AGGA 2B5HA 1HRV3 1G9CA 1X33A 2RM21 4Y1ZA 1HRI3 1ZZ7A 4BCUA 2H6BA 5ACA1 3JD71 4Q26A 4E4SA 2WWSA 1QXJA 1YFXA 3H1YA 1B35C 4Q1PA 2ZHMA 1G8WA 3I59A 5C8CA 2CY6A 3ZN6A 2PLV2 4QPIC 4Q4X3 1TME2 2ILMA 4XETA 4YG0A 1AL23 2ZX4A 1ZZ9A 1UU4A 1VAVA 5EZWA 3WT3A 3O0XA 2YYOA 5T5PA 3UK9A 1EV11 2WJSA 1ZBA3 1QQP3 1AHSA 5C4WA 1A8MA 1GANA 5DG2A 3DPRC 4F8AA 5IK5A 3VBRB 4HZFA 2RS11 3POYA 4PF5A 2H6CA 3BU7A 4XF0A 1PGL1 2RR12 4UW4A 4YVWC 4Q0VA 3LA7A 2WINB 1H8VA 1FOD1 3AZWA 1DQ4A 1NYWA 2W52A 3VZNA 2I2SA 1RJ7A 3NSTA 4CDQB 3WUDA 2VVEA 3KM5A 3M3QA 4MGZE 5FDBA 4Q2FA 2F4PA 4AFBA 1AR63 4PBOA 1AYM3 3B7MA 1C3HA 4PDWC 3AKPA 4LNVA 1S1AA 2UYBA 1IKQA 1WLTA 1RUG1 2D5FA 3ZYRA 4AGRA 5A32A 2Q1MA 4Z92B 2PHFA 4DB5A 4IV1A 2DVAA 4GIQA 4TLFA 2X53S 5HCAA 5FMOL 1DGWA 4I02A 4CTEA 5BNNC 1R093 3QD6A 3AX4A 3B02A 3ZFFB 2Z42A 5FQ0A 2VXRA 2VY0A 4FPHA 3HIFA 1VIWB 4RS5B 2HWD3 3KZ4C 3OCPA 4YW2A 1KQRA 4KWKA 3G6JB 4X6QB 4EN0A 4A3XA 2D6OX 2WA3A 1QKQA 2WLQA 3KGZA 1I3HA 1OMIA 3S7EA 4YM0A 1CQ9A 4YG6A 3FJSA 3FLRA 4IXLA 1PVC2 3E97A 1S0CA 5GLVA 1CJDA 3ZYPA 4CDUB 3QLQA 3PTYA 4LE4A 5CFCB 2DF7A 4QPGB 4AQ6A 5K7PA 2JECA 3WHUA 3H9AA 2DV9A 1YIPA 3WINE 5C8WA 2D44A 1EP0A 1HW5A 3QH6A 1LESA 2GAUA 1HLCA 1AR71 3TN91 1RUF1 2ZGQA 2JENA 1XYOA 4GWMA 1QOTA 4META 5J37A 4NPRA 2D6NA 4XBNA 3VHPA 2XKOA 1WW6A 1CAWA 4I0WB 5C8CC 1VBC3 1W6PB 1ZBE2 4WZFA 4JGYA 4LO7A 2R061 3WDWA 3CNAA 3ILFA 3ILRA 2JEMA 3TYJA 4E27A 4CRQA 4JDMA 5K0UA 4CEYC 2HWF1 2D93A 1DYPA 4S2HA 3NV4A 2WS91 1W2UA 3UKNA 1JOJA 1BMV1 1X36A 3I4IA 4QGMA 3LCPA 3RYPA 2A3WA 3GHNA 5C4WC 2NMOA 1UCXA 1WA4A 4L99A 4AFDA 2WNUB 1BEV3 3JU9A 4W6XA 1X50A 3DKWA 1QJX1 3NW4A 3ZN6B 2Z69A 3SCHA 1I1EA 5C9AA 3J8F1 2VQAA 4W65A 1MZFA 1X7NA 4Y26A 1XNCA 2ZGLA 5FRAA 3A0NA 1KITA 5CG8A 1BKZA 4H3WA 2WNEA 2D7FA 2UU8A 5EJ3A 2XHKA 1XRUA 1OPOA 3POSA 2A6VA 5AC93 1IS5A 4AVTA 4QT6A 3APBA 3TWIA 4AI8A 1AR92 1SFYA 1S0GA 3NVCA 2BNMA 5D1IA 4QU2A 2QVSB 2O1QA 4FQZA 2E7TA 4LBQD 3O0WA 4HANA 5JDBA 2LTNA 1VB2A 3PVEA 4W6YA 5F9TA 2YPJA 3H3ZA 4Y20A 4XDQA 4D94A 4Q27A 2HYKA 4NO4A 4Q4V3 4M0HA 1H2NA 1JN2P 4HK9A 3UJQA 2A6YA 1CAVB 4AXOA 2ZGPA 5AFBA 1RUJ3 4JVAA 3CU7A 4BM8A 2P37A 4IV1B 5L73A 5I93A 3MICA 1N47A 4GKYA 4L92A 1HRV2 2WFF3 4Q4Y1 1QU0A 2IXJA 1HRI2 1BXHA 1VRH3 5BPXA 3ZYIB 4DOUA 1V6OA 2FMDA 2LM3A 3D8CA 3AYAA 2RS51 4IEZA 3SLIA 1XNBA 2PN5A 1AR82 4YSFA 4IV3B 1QDOA 2D3PA 4OI2A 4Q4X2 4LA3A 1SLCA 4IEXA 4SBVA 1PNFA 2ETEA 1AXYA 2OZ6A 1DQ0A 4TYSA 3OTFA 1ASJ3 4P9LA 3LGRA 3INAA 5AVPA 5ABJB 1OQEA 4KG8A 1UL9A 2DUQA 4OVEA 3E5XA 2Q30A 4PBPA 2Q8OA 1G86A 1H1MA 4K20A 3U0ZA 2A5ZA 1N3PA 2KM2A 4JGYC 5CNAA 5JOXA 2EA7A 2V5YA 4KNCA 2GC2A 4B29A 5K0UC 1W6OA 3LB9A 1PGW1 5CAZA 2JG8A 3ZXJA 1VR3A 4HETA 4ASMB 5GLTA 2VMHA 1OOPB 2AZ5A 4YGBA 1QJU1 2UWAA 2ZABA 2IXIA 2RMU3 1RUH3 2WNVB 4XTMA 5BUVA 1C5HA 2UYAA 4NWWA 1C8M1 2W68A 2O8OA 1D2SA 1FPN3 4FCAA 2DCTA 4GMP0 5A3LA 2VPVA 5HCFA 3LSDA 1MACA 1E57A 2D98A 2NYYA 1V9U3 1MS5A 3RSJA 4X8NA 4OHZA 4K7JA 1V00A 2D6PA 2NMNA 4WM7A 4Z07A 1LB2A 3P3PA 2RJKA 1YJLA 1D4M1 4PIYA 1U5YA 4X6RB 1GZCA 3GF6A 1SEFA 2WT0A 1BBT3 2C0ZA 1RHI3 3RI9A 1NE6A 5AFEA 1CIWA 4LLFA 1DYKA 2RS32 1BK1A 2ATFA 4AE2A 5FPZA 2GC3A 4XHXA 4AHZA 4LO6B 4HK8A 4WVMA 5FAXA 4ZU4A 5CU1A 1ALYA 1QY4A 3MEPA 1IS6A 4HSJA 3E6DA 5C9AB 1KJRA 1CX4A 4HKLA 1YXWA 4P9JA 3BB6A 3ZSJA 2GSYA 3MLKA 2PLV3 4AGVA 4LBQA 4C0BA 5HBAA 4H14A 4UW3A 1PM7A 1XNKA 1ZVFA 2R073 1TME3 4RHV1 1H1AA 2E53A 3JUUA 1AX1A 3RDIA 1RB8G 3AZXA 2ZGMA 1SMVA 3ZXFA 1YI7A 1CAXB 3RJRA 4RQPB 5T5LA 3AB0A 3D4KA 2GZWA 3AYCA 4K21A 2E7QA 1WD4A 3WY6A 3WW3A 3M3IA 1SQ4A 2EXKA 1ZBA1 1QQP1 4NOTA 4OI1A 2JXAA 2RR13 5CFDA 1SCRA 4BMEA 4XIOA 3H7YA 1S2BA 2VOWA 2EALA 1J3QA 1XE7A 5CADA 3ZFGA 1HKDA 1KDKA 3SCGA 3MZHA 3WQ0A 2ZTNA 4HFSA 4E9KA 4CEWA 3AP9A 3VZOA 4Q0UA 1PO21 4FP3A 3WLUA 4IEOA 4FAHA 3AMNA 1H30A 5BNQA 5I0TA 2MHFA 1ZX5A 2ZJCA 3NO8A 1AYM1 2WT1A 5C6CA 3MPPG 2KXLA 2ZGUA 3LWCA 4S2DA 3GNEA 3O14A 2Z5WA 4YW4A 2D6MA 3AYDA 1EPWA 2JICA 3EO6A 1LOCA 3WG3A 1MQTA 3W58A 4IEPA 4WVZA 1LKNA 1GNZA 4PCRA 1IPKA 3VBSA 2VH9A 2JG8C 5JPNB 1OSGA 2AYHA 1U0AA 2ZCWA 2DYCA 2FMYA 5T5OA 5JMCA 1G9DA 5L7OA 1RIRA 3NAPB 1R082 2WQ4A 3H1MA 5CIRA 1N1TA 1ZRRA 2D6LX 2WFPA 4F3JA 2R041 4LBKA 2JD4A 1SCSA 4CDXC 4Q4W2 5FOBB 5JAXA 4E2SA 4GH4B 4OZXA 2YGMA 1J59A 3AP4A 3MLJA 4IEVA 2UY8A 1PVC3 2Z2SB 3WNXA 1AYN1 2A6WA 3WG2A 1UF2C 3ALQA 5FO7B 4WM7C 2GC0A 4AVAA 3V0AA 1YFUA 2GDFA 2GNBA 4Y24A 2WZPP 1KS4A 4F83A 3D0SA 3PHMA 4K6BA 5LRRA 1M06G 3TBDA 3OYWA 2W0XA 3AP7A 1FATA 1LOFA 1YWKA 2EIGA 4Q4V2 3AK0A 3WW1A 3AFKA 4HVOA 2PHWA 2P3IA 1GLHA 4QM9A 3OBRA 1WCDJ 3O7OA 4Y5Z0 5KXEA 2YUEA 4B7KA 2ZGKA 3DL3A 3ZSMA 3HT2A 4WZCA 1V6JA 2G9GA 3DPRA 2XBO2 1ZBE3 5F6KA 2HWE1 1WLCA 4UXAA 1IZ3A 1J3PA 2ET7A 1TMF1 2DWRA 2H0VA 2E7AA 2XVGA 4NR1A 4AEDB 5KHIA 4GQ7A 1C4RA 1DF0A 2NP0A 2PELA 1Q8VA 2DURA 2TEPA 2XGXA 5E8AA 1EAH2 2GN7A 4L9BA 4NVPA 3ROUA 1RUD2 2GMMA 3GZUC 1V6IA 5DDJ1 2RM22 1DGRA 2XVKA 4PDWA 4LBOA 5ACA2 1O7FA 3ASIA 1WCSA 4Y22A 2VW0A 1PNGA 3I2DA 4BIOA 5A33B 1F2NA 3JBG1 1BEV1 1POV3 1UKGA 4V1PA 3ZFGC 1MS8A 1ULCA 3WXPA 4HBNA 1FXZA 2E51A 4PQ9A 2XJTA 2R49A 4CEWC 4KU7A 1COV1 2FZ2A 1D4VB 5GZCA 4HPKA 4ZU5A 5K8SA 1M4WA 1HX6A 2JG9A 1RUOA 4WV8A 3WDUA 3IPVA 5BV6A 3J26N 1EV12 4PJYA 4QMAA 1F9KA 2EXJA 2OPKA 2GNMA 3AZYA 1LR5A 1UX6A 3MPBA 4BYYA 3ME2A 2Y0OA 1HV0A 4KWLA 4MUVA 2HWB1 1AR93 1JH5A 3KD4A 4YVSC 1A8DA 2RS12 5CFDB 1ZREA 1JYCA 2BFUS 1LOAA 1PGSA 3O5SA 1PGL2 1ZM1A 1AXKA 1MQTC 1URXA 2LALA 3VBUA 4DY5A 3ATGA 5IK7A 2QCSB 3ZFEA 3ACLA 1HXS1 1ENQA 2B39A 3CJIA 4MYEA 3S6PA 2EVXA 4INDA 2WZR1 2PAEA 2IFWA 4AVSA 4AHYA 1KRIA 4ITCA 2ZGSA 4MVTA 2ZA9A 1F8VA 1H2MA 4YW1A 5L7OC 3ZN5A 2WSVA 1VBD2 4Q8LA 4YW3A 3ZVXA 3IDBB 4QD2A 2HWC1 3AZZA 4FPYA 5FPXA 4XMIA 3ZIWA 1C8NA 1VBB1 3E6CC 5B2GB 1RUJ1 1B09A 5T55A 1DG6A 1CJPA 3ENRA 2DVBA 1REEA 5JZGC 3VBSB 1H0BA 2VW1A 1TEIA 3DV8A 1YFWA 1W6NA 3K48A 1AR83 1VRH1 1FMD2 4N90A 3M1HA 4FT8A 1BQPA 1W0OA 4XMAA 2PHXA 2R072 1Q8PA 1DHKB 1LOFC 3U11A 5KXDA 1O3TA 1BJQA 4AQSA 4CEYA 3OPZA 3DUIA 4M3CA 2D40A 4LHKA 1VLNA 2XL9A 5F1RA 1VALA 5JPMB 4MXWB 1JUHA 4LULA 2TBVA 1RJ8A 3VBHA 2YXSA 4HN0A 1RITA 2GU9A 2XJQA 2QE3A 3BOWA 2P3JA 3UKVA 4COUA 5DG1A 1ULDA 4AYUA 1B35B 3VL9A 2VMIA 3K51A 1WMDA 1RUNA 4CDWA 4QPIB 4AEKA 2P17A 3MW3A 1RMU1 4Y1VA 1NE4A 1YYNA 2B7YA 3FUQA 1HV1A 4E4DX 1R1A1 1SACA 3VKMA 2VOXA 3USUB 1AR72 3TN92 3KMHA 5EYYA 1KDMA 3MGUA 2BEOA 3O0VA 4PLOA 1XU1A 1RUF2 2OW4A 3V64A