2AYHA

Crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3-1,4-BETA-D-GLUCAN 4-GLUCANOHYDROLASE
publication title Crystal and molecular structure at 0.16-nm resolution of the hybrid Bacillus endo-1,3-1,4-beta-D-glucan 4-glucanohydrolase H(A16-M).
pubmed doi rcsb
source organism Hybrid
molecule tags Hydrolase (glucanase)
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1995-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ayhA00
1JXNA 4R9CA 5F9TA 4LBOA 5FREA 2P37A 5DG2A 3O5SA 1WLWA 1W6MA 1DBNA 5DUVA 4WZFA 1UAIA 1ULFA 1KJRA 5JOZA 1LECA 1QDOA 1S0JA 1Q8QA 3M1HA 2ERFA 2E51A 4M3CF 1AX1A 4LBNA 1HDKA 1Z78A 1LOAA 3FBYA 4FOWA 5T5PA 4D69A 5CAZA 1DZQA 1OFSA 4RL7A 3ENRA 1SLTA 1LGNA 4P9XA 3ZSMA 5E89A 3WCSA 1WW7A 2NYYA 4UW6A 4LBQA 2PHUA 4BMEA 4FOYA 1MS0A 1ONAA 2NMNA 1Y7BA 1MS1A 1MVEA 2YY1A 1AJKA 2CWSA 4FOVA 1HQLA 5H9RA 2DV9A 1ENRA 1ZM1A 4ITCA 4KBBA 1V6NA 1CR7A 3AK0A 3AYEA 4P9WA 2D6NA 2CL2A 2OUJA 1GZWB 1Q56A 4FQ4A 3FFZA 4M3CB 3HMYA 3ZYRA 1QMJA 4AYUA 4XJZA 3LCPA 1DFQA 3D6EA 1QKQA 5GM0A 1WLCA 3AFKA 3Q9OA 5GLZA 2GMPA 1LEMA 1MZ6A 2DUQA 2EXJA 4Y1UA 3V64A 1WW6A 2W39A 1Q8OA 2JECA 4ATFA 3VKMA 3ATGA 4XJWA 1JOJA 1GZWA 1LOEA 3AZZA 3FLTA 4XTPA 1U0AA 1LCLA 4YGBA 5DUUA 2A6VA 1G7YA 4M3CA 2YMZA 3WDVA 2PHXA 2WSVA 1C1LA 1SBEA 3B3QE 3ILNA 1JW6A 3D5OA 5DZGA 3RG0A 2ZHMA 1FAYA 3C2UA 2ZMLA 2DU0A 2ZMKA 3B01A 5T5JA 1S0FA 5IUQA 1N1YA 4FQZA 3WHUA 1LULA 2AGSA 1KDKA 2R1DA 4ZXKA 3SNMA 1SLLA 5IT6A 1Q8PA 5HCFA 1LJ7A 2VXRA 2ES3A 1NXD1 4UW5A 3AP5A 4AWDA 2SBAA 2TEPA 2WQZC 3NV1A 4ATEA 4JC1A 2LTNA 2YZ4A 3PJQA 4M00A 4XILA 4Y24A 4FPHA 3PVEA 4YM1A 3OBRA 4U36A 2WT2A 1AZDA 4R9DA 3KQRA 5JOYA 3T1LA 2DTYA 3ZXJA 2VUAA 3ILRA 3H0OA 1CPMA 2EXHA 3BOPA 4Q2FA 2NZ9A 3W58A 3ZXFA 1A3KA 4PF5A 1BJQA 1F31A 2GN3A 3FUOA 1GICA 1KQRA 1QOSA 5SV8A 4GKXA 4XIOA 4JCKA 2ARBA 4XTMA 2GNTA 2LALA 3BIWE 3FUQA 1MACA 4JRAA 3UJOA 4Y26A 5E8AA 3WG3A 3SLIA 1IS6A 2UWCA 3NV3A 3WDTA 2A7AA 1CJPA 3DUIA 4AGGA 5H9PA 5EYYA 2W68A 2DUPA 5CA6A 2C5DA 2E7TA 1IS5A 1DQ5A 3M3QA 1JUIA 1CQ9A 2KM2A 2YROA 5T5OA 1S0EA 2ZGKA 1DQ2A 2AYHA 4L8QA 3OJBA 4I30A 3WZ1A 1AXZA 1WUVA 5F5QA 2VY0A 1JYIA 2ZGLA 5GLWA 1JYCA 4WVWA 2EXKA 1ENQA 1UMZA 3ZSKA 1QU0A 1G9BA 3HN1A 2ZGQA 3DGTA 4XXPA 3NV2A 1AVBA 1LESA 2WJSA 1YI7A 1W6NB 2GNBA 3AP4A 5GZDA 4DRRA 2B7YA 1MVQA 1O4ZA 2YV8A 3N7LA 2JE9A 4FOQA 2A75A 5DZFA 4SLIA 4YGEA 4K20A 3RRDA 4AGRA 1MZ5A 3JUUA 2WKKA 1QNWA 4FPGA 4Y22B 4PCRA 4R9BA 1F9KA 4YG6A 5FRAA 1DHKB 1IS3A 2A6YA 5BYNA 1OQ1A 4WV8A 2YXSA 2EALA 3WG2A 3GALA 4BQ1A 3RS6A 1GZCA 4ISRA 1SLBA 2WSUA 4YG0A 1LOFA 3M2MA 1GKBA 1LGCA 1PZ8A 2D7FA 5KXEA 3AX4A 1ENSA 2EF6A 1W6NA 4ZKTB 4LBKA 1GV9A 4YGCA 3ZSJA 2CNAA 1A8DA 2NMOA 2UU8A 3N7KA 3AP6A 3WV6A 2CTVA 1W0PA 5GZCA 1JBCA 1IKPA 3GNEA 5AVAA 3N36A 1N3OA 2P2KA 5LK5A 1SLAA 2GNMA 4YW4A 1QOTA 4YW2A 1V6OA 2CYFA 1MS5A 1I3HA 3A4UA 3R4UA 4YM0A 4BOWA 2A3YA 2WLQA 3ASIA 2ZABA 1G9DA 4R9AA 1FATA 3ZXLA 3POYA 2WNEA 4M01A 2ZAAA 1AXYA 1Q8SA 1S0GA 4PQ9A 3AYCA 2W52A 1BZWA 1N3PA 1GNHA 3MW2A 4ISQA 1G9CA 1LHOA 2Q5TA 4YZ5A 2D6PA 3AZXA 5DZEA 4M3CE 1D2SA 3R4SA 1FYUA 1UX6A 4GALA 1RITA 2A3WA 1V6LA 1WD4A 4LBMA 5GJ6A 1LOBA 2FHRA 4NO4A 2AENA 4Y1YA 3WG4A 1WCSA 2A70A 1FNZA 2ZGMA 5JOXA 5GLTA 1LHVA 1DGLA 1IS4A 2JE7A 4XDQA 1KJLA 1SCSA 3W59A 2GN7A 1SCRA 4IQPA 1LOCA 2DVAA 3M3CA 4TYSA 4XBQA 5E88A 5GLVA 5T54A 3RMYA 4YZ3A 3WDUA 3WUDA 3ZPYA 4DRVA 1MS8A 4FPOB 1VAMA 3VV1A 3ZXKA 1W6PB 2E53A 3PVOA 3IMNA 4YFWA 5JOWA 1V6IA 3N35A 2P34A 1H30A 4DFSA 4YG3A 2A6XA 3PVNA 1YYNA 1EPWA 1JHNA 4YW5A 5GALA 4YZ2A 1BXHA 3VKNA 2DVFA 3INAA 4XHXA 1H9PA 2A6WA 3AYDA 1CIWA 1R1ZA 1WD3A 4FPJA 4AVTA 3SISA 3O0XA 2DVGA 3I8TA 3L2YA 1ZA4A 4Y20B 2DTWA 2JKBA 1W6PA 4LBLA 2ZMNA 2SLIA 1DLLA 4TZDA 3AZYA 5CB7A 2ZGNA 3AP9A 4YW3A 1A78A 3B69A 1F5FA 3MW3A 3M3OA 4YM2A 1IKQA 3A0KA 4YGDA 1QOOA 1H9WA 4Q26A 1SBDA 3AZVA 3UK9A 3O12A 2UURA 2D44A 1DQ4A 1LOFC 2VU9A 4XMAA 1QGLA 3B00A 2PELA 1G9FA 2AUYA 2ZGRA 4C1WA 1V6KA 1UZYA 2NP0A 2ARXA 1YRZA 1FX5A 2P3KA 3SITA 1AX2A 4BMBA 3TB0A 1MS3A 2ZACA 1LTEA 1LHUA 1S0IA 1VAVA 2A3XA 2CWMA 3WLUA 1WW5A 1G8WA 1D0HA 2H0BA 4CZSA 4F83A 1BKZA 1MR5A 5DUXA 2DUOA 3BTAA 3ZXEA 1DQ1A 4ASMB 1LHNA 1O4YA 3SH4A 5H9SA 1HQWA 4RA0A 4FPKA 4Q27A 1C1FA 1G86A 1GLHA 4BM8A 3WNXA 4UW4A 1GSLA 2R49A 1RINA 1VALA 4GKYA 2XB6C 4P9YA 2R16A 3M3EA 3OGGA 2PHRA 3USUB 1S0BA 3WOGA 5KXCA 3AXEA 2C9AA 1RIRA 1GYKA 4FPYA 4K1YA 5DG1A 3UJQA 1WBLA 1DYPA 1UL9A 1MS9A 2OUHA 2DWRA 4H55A 4BPZA 1N1TA 2EXIA 1CONA 4PBPA 5EYXA 2PHWA 1LEDA 3ZSLA 2ZGPA 3O0WA 2D3RA 4FP3A 1CN1A 1N1VA 2G4IA 4UW3A 4Y22A 5EWSA 5GLUA 3WCRA 2FMDA 5KXDA 2P3JA 3PMEA 4FP2A 5IK5A 3OBTA 1W6QB 2AH2A 3USUA 4XMIA 1V6MA 2DURA 1IOAA 2JD4A 4FPEA 3ILFA 2WT1A 1SACA 1W0OA 4BLIA 3LSEA 1FV2A 1CVNA 2V73A 3VKLA 4Q8KA 3FLRA 3MEPA 4Q8LA 1QNYA 3APBA 2ZA9A 2GNDA 4P14A 1AX0A 5T50A 2R0FA 3WG1A 3POSA 4WVVA 4XXAA 1X50A 3IN9A 2EAKA 5DXDA 3WVJA 3RMXA 2UWBA 1J1TA 1B09A 1N3QA 1SLIA 1S0DA 2NN8A 1OKQA 2D6MA 4AVVA 1SFYA 1W6QA 2ZGOA 4FVVA 2VW2A 4XJAA 4YW1A 2GALA 1DQ0A 3ZVXA 4XYXA 1AF9A 3OYWB 1C4RA 1UPSA 2JJ6A 3OPZA 4XOGA 2DVDA 3CNAA 4GWNA 1BQPA 1LHWA 1KRIA 1APNA 4YM3A 2D6OX 1Q8VA 2ENRA 3WDYA 4GA9A 2P3IA 4HL0A 4DQAA 2OW4A 3POWA 1HKDA 4FPLA 5CBLA 1ULGA 2UWAA 1XQNA 2VW1A 3MPPG 4U2AA 2E7QA 5HCBA 5JVVA 2A5ZA 1QDCA 1YIFA 4Y1XA 4Y1VA 1ULCA 3WDWA 1ULDA 1DQ6A 1SBFA 3AZWA 3OY8B 4YFZA 2ZBJA 4AVSA 3OYWA 4AGVA 4W65A 3D4KA 2R0HA 4XBNA 1TEIA 1HLCA 2WT0A 4K21A 3T1MA 4Z8BA 2ZGSA 5H9QA 2GMEA 3N7JA 3V65A 1LU2A 1CESA 5T5LA 4FPFA 4PBOA 4LBJA 4XHBA 5CNAA 3V0AB 3FLPA 1LOGA 1GBGA 1N1SA 2GDFA 3OY8A 1LODA 1WBFA 3IKWA 3NWKA 5GZEA 4CTEA 2HYKA 5GZGA 4HANA 3SH5A 1AXKA 5IK7A 2JDZA 3QCWA 1S0CA 2A6ZA 3RSJA 4Q1RA 4Q1PA 1V6JA 1CPNA 3IM0A 1URXA 4DS0A 3JU9A 4YZ1A 1DIWA 3QLQA 1VLNA 4XJUA 1DYKA 1KITA 2CY6A 3I4IA 2AREA 2ZHLA 2D43A 3WUCA 2BQPA 5DUWA 3V0AA 2AR6A 1KDMA 3MW4A 1UKGA 3U4XA 3VKOA 1FNYA 2PHFA 1WLDA 2XG3A 2ZKNA 1C57A 4C1XA 1G9AA 5JLVA 3KM5A 1I1EA 5EXOA 4XIKA 1W6OB 5JDBA 3AXDA 1LU1A 3VKFC 4DPNA 1GZ9A 4Y20A 3WHTA 2NM1A 3ZYPA 3R05A 5HCAA 2PHTA 2GMMA 2W08A 1FV3A 1VIWB 3N7MA 5KXBA 4FPCA 2A71A 3AP7A 2D3PA 2E6VA 1UN1A 3IPVB 3B9CA 4K1ZA 4LBQD 3HR9A 1JN2P 4GWMA 1ULEA 2V5YA 2D6LX 2Z42A 1PZ9A 1GANA 1W6OA 3AJZA 3BODA 5T55A 4YZ4A 2VH9A 3T2TA 4XJ9A 5JMCA 2ZHNA 3V0BB 3UL2A 2I2SA 1MS4A 4BLJA 1LENA 4XE9A 1SLCA 4MYEA 4XZPA 2OVUA 1N47A 2D6KA 5L73A 4Y1ZA 3AJYA 1V00A 4YLZA 3VUOA 5IK4A 3TAYA 1W6MB 2D3SA 1BYHA 2R1BA 2VW0A 2ZGTA 3IPVA 1YO8A 1UZZA 1WW4A 3LSDA 3N3HA 3NV4A 1NLSA 5IK8A 4XJ8A 2DVBA 2DU1A 1QF3A 1LGBA 4GXLA 2ZGUA 3O0VA 1PZ7A 4OZXA 4XBLA 3WDXA 1YXWA 2EIGA 5GZFA 3AYAA 4NOTA 1GNZA 1AJOA 3SH3A 3V0BA 4CRQA 2RHPA 3RQ0A 5T52A 4LBQB 1Z0HA 2ZZJA 1S1AA 2ZHKA 3A0NA 2DYCA
chains in the Genus database with same CATH superfamily
5JZGB 1WCQA 4BQ2A 3VL8A 5DG2A 3O5SA 4TTGA 1MEC2 3K46A 4QPIA 4WZFA 4IV1A 1QDOA 1HW5A 2PTMA 1R091 1NA1B 4N8MA 1Z78A 2VOVA 3POJA 4GMP1 1JUHA 3ZFFA 1T2XA 2JB8A 1DZQA 1O8SA 4QPGC 3KGZA 5F3GA 3J8F2 1FMD1 1ZA7A 1LGNA 1ND3B 2YDEA 1YIPA 2PHUA 4PLOA 1MS0A 1Y7BA 1MS1A 2YY1A 1UY2A 2CWSA 4CCLA 4Q0QA 1HQLA 4OULA 3ZM8A 5FPZA 2DV9A 3OSDA 2G9FA 4LHKA 1S4CA 3Q8AA 4YRDA 5JIAA 3VBFC 1UY3A 3DPRC 3NKTA 5FK8A 4NHYA 5DAWA 2RR13 4DNYA 2XJRA 2Y6KA 3ZYRA 2VZ1A 3FC0A 1AUYA 3LA3A 1RUF1 2FZ2A 3LCPA 3MLKA 1AR92 2YBSA 3RPQA 3D6EA 1RUJ1 5GM0A 4C0HA 5C70A 4IE0A 4AVCA 4QD2A 2GMPA 1DGRA 2BP6A 4HN0A 3V64A 1YWKA 5LBBA 1WWYA 1ZZ7A 3B93A 4ATFA 1OQDA 2RS33 4XJWA 4P9JA 3FLTA 4XTPA 1QEXA 2OA2A 5DUUA 4A42A 5K0UC 5BNPC 2EIDA 1MEC1 2WSVA 1AR82 3ES1A 4Q0PA 2JX9A 2GZWA 3U14A 4QM9A 3PURA 2VUJA 3VBUC 4W6YA 4Z1VA 2VG9A 4RGKA 3LIHA 3J8F1 5B4NA 5F2WA 2ZJCA 2D97A 4FQZA 5LBCA 2YPDA 4IGQA 1KDKA 4XFGA 3ZYHA 3MO4A 4HVOA 3WR0A 1Q8PA 3E5UA 3MIHA 5HCFA 4BZ4A 4BIFA 1YQ8A 3A23A 3ME2A 1VBB3 2WABA 2PAMA 3DYOA 1AYN3 1TVGA 2Y6JA 3S5QA 2QQLA 3IT8A 4BJ0A 2WZ8A 4FPHA 1JZ7A 1D7PM 4AQSA 2K46A 3NJZA 5FWEA 3POGA 5BNNC 5DAXA 5ABJB 1AR91 5A7WB 1F4HA 5E16A 2EXHA 4LQRA 4ES9A 2RS13 4AZZA 1DG6A 1F31A 2JICA 3E6CC 4CCEA 1KQRA 3CJIB 5SV8A 3LB9A 5FP9A 4LOSA 1QJEA 4JCKA 2ARBA 3GHNA 3PUSA 5J09A 1ZZ8A 1CAUB 2LALA 1AR81 1E5HA 4QGLA 1MACA 5LATA 4OYUA 4Y26A 1YHFA 1HB3A 2DDUA 4AI9A 5IVYA 3BB6A 3OB8A 3NV3A 2K0GA 1X7NA 1CJPA 3DUIA 2BOIA 5EYYA 3J26N 4LOTA 2W68A 3H1WA 5CA6A 5J48A 4CCJA 1J3QA 2E63A 2IVJA 4ORFA 3SKJE 5E1RA 4Z82A 1JUIA 1CQ9A 4GZ9A 4QDRA 1XBFA 5FMOL 5JXIA 5KHJA 4ZHNA 2IXCA 5F5CA 2WO7A 1OQEA 3VBRC 1U5YA 1ZZCA 3WZ1A 3PL0A 2X09A 4XFCA 5LBEA 3ZFGA 5FBZA 3RDIA 1OSGA 2AACA 4HKLA 2VZUA 3DV8A 3ZYIB 5B4XA 3WW4A 4AXOA 1PO12 5GLWA 1VB4A 5LEKA 3VZJA 4NWVA 1MQTA 4WVWA 1JHJA 1QU0A 1L7LA 2QQNA 2PAKA 3I2IA 3T08A 3ZN6A 1AVBA 2WJSA 1LRHA 2GNBA 1W6NB 1ZBA2 2Q1ZB 4AQ6A 1MVQA 2QQIA 3BYWA 5CVRA 4MXWA 1TG7A 3CJXA 2W92A 2X5IC 2V5DA 1G6NA 2R32A 5JSRA 4DUXA 5LY1A 4R9BA 4YSFA 2WNUB 1REDA 3QOPA 3ON7A 3RYKA 3CDZB 4WV8A 4UF0B 3GALA 4DIQA 4BQ1A 5C3RA 1GZCA 2RV9A 2QQWA 1W39A 3THDA 5LK7B 5KXEA 2D7FA 1R083 2PFWA 3AFGA 3I97A 3PNAA 2KA3A 1QY4A 2IZWA 4LIVA 4Q4V3 3WNOA 1NZCA 3FHQA 4HKWA 2JE8A 4GB32 4LBKA 3H8UA 4S2GA 4XF1A 4ASKA 5C8WA 4YGCA 1QJFA 4D7TA 1PK6A 2NMOA 3U10A 4AE2A 4JQTA 4CDQA 2Y6HA 3AP6A 3WV6A 2JG8A 1O3QA 1HRV2 5L19A 5GZCA 1ND2A 5FMDA 4AEDC 4XUOA 3N36A 1QHDA 5FZDA 2VNOA 3ZYBA 3ETPA 4M4PA 1SLAA 1BEV2 2GNMA 2PN5A 5FPAA 4FCAA 4COWA 4OI2A 1W9TA 2VE1A 1HQNA 3BPZA 5FY5A 3A4UA 1I3HA 1IHMA 3R4UA 2W3JA 4UFHA 3HNBM 2A3YA 4BOWA 1UCXA 1PO11 2OIIA 2ZABA 4R9AA 1H1AA 2OPKA 5FYHA 2YGMA 4HONA 1I5PA 4AOCA 2BEOA 1PGW2 3VDDA 5C3OA 1BZWA 1ST8A 1TMF2 1SPPB 1W9YA 1ZBA1 2P17A 2HWF3 1LHOA 3HQXA 3K4ZA 1K42A 1FXZA 2BNMA 2OZJA 5FPBA 4Y4RA 3MV01 1FYUA 2HWD3 1H2MA 4OQ9A 3KLSA 4QPGB 4YPJA 2WUHA 3KV6A 1O91A 3OUJA 5HXMA 5GJ6A 2E9QA 4NO4A 3K4DA 4Y1YA 2XJVA 2A70A 3IB3A 2VBBA 3MIBA 1RUD3 1UYPA 2ZGMA 5GLTA 4A2UA 4COUA 4CA9A 3VDBA 1IS4A 4QU1A 3W59A 1KJLA 3ZX7A 4GB31 1H4GA 2GN7A 3PUAA 4Q4W2 5BNOC 3KCXA 2IXJA 2DVAA 3M3CA 4UFKA 5GLVA 3VBFB 1ODNA 2JDPA 3DPRB 3KCYA 3WY6A 3AL6A 3ECQA 4IE6A 1HRV1 1W9WA 3C7GA 2ARAA 4IEVA 2FMYA 1YQCA 3GXUA 3ZXGA 4MGTA 2VCBA 1C3HA 1BEV1 1V6IA 2F4PA 4EWAA 3N35A 2RMU3 4DFSA 3U0ZA 4OMDA 4ONUA 4BISA 5IATA 4D94A 1JHNA 4YW5A 2YBPA 4Z92B 4OLLA 1V9U3 4ZZ5A 2DVFA 1NQDA 1H9PA 2J22A 1R1ZA 2K2SA 3A22A 5LASA 1DYOA 1JYXA 3ZYGA 4IERA 4I02A 4YARA 5K0UB 3VGIA 1PGW1 2VUDA 5BNPB 2DTWA 1LB2A 3VZNA 1DDLA 4HOOA 1VBC2 1QJZA 4EN0A 1PGL2 4KH9A 1DLCA 2J1VA 2VNRA 2Y38A 4YW3A 2XPJA 1IG3A 3MW3A 4YM2A 1IKQA 3VBUB 5ISLA 3DYMA 4KWUA 4AHZA 3AZVA 4QXBA 2VCMA 3JQXA 2W2IA 1QJX3 1DQ4A 1LOFC 3PUQA 4WM8A 1QGLA 4N53A 2KR2A 2PELA 4CPBA 5L7OA 2AUYA 3FMGA 2I74A 1OKOA 4QHBA 4C1WA 4B3NA 2ZX4A 4LEJA 1YRZA 2VPVA 3JXSA 1FX5A 3CZUA 4PI0A 3ZLIA 4AFCA 5A32A 3OD0A 4Q4W1 5FO7B 5KC6A 4UWDA 3CZJA 4P9GA 5A3NA 3VDAA 2P4EA 4EV0A 4N90A 3T3YA 1BCXA 1O8PA 1Y43B 4CP9B 5IWFA 4I3GA 2DUOA 2IWGB 4RGGA 5BNNB 3ZXEA 1H2KA 4L0PA 2ARCA 4QXCA 1UZVA 3MF6A 3PIJA 4NWWA 5CG8A 3SH4A 5H9SA 1HQWA 1WKYA 4BXSV 1HX6A 4RA0A 1OOPA 4TXWA 1DGWX 4UW4A 4W6XA 2R49A 1RUH3 1HXS3 4RQPA 4P9YA 2R16A 2WN3A 3MLJA 2PHRA 3K75B 1VBC1 3WOGA 1PGL1 3AXEA 4L11A 5CFCC 2C9AA 1JYNA 2J1AA 1U12A 1RIRA 1GYKA 3WD5A 4E2SA 3ACIA 2Y60A 1GMMA 2OUHA 4BPZA 4QQOA 1N1TA 4OHVA 3POIA 1UYZA 4QX8A 3UGGA 1LKNA 2ET7A 1CONA 3GGLA 4PBPA 2PHWA 1D0GA 3T2PA 4Q0SA 4QXHA 5JXGA 1B35A 2G4IA 4IEPA 4KNCA 2BNNA 5IVCA 5IK5A 1QH6A 3VBRB 2XQRA 1GQHA 3J7HA 3UKTA 2D5HA 3NAPA 3POBA 4FPEA 2XH6A 1O59A 5FLHA 4XFHA 4M0HA 1EAH3 3GCWA 4B7EA 2VCCA 4TLGA 4D6SA 2V73A 1S2KA 2HH9A 2FDIA 4CUGA 1QNYA 3APBA 2RDRA 4URTA 1X8MA 5T50A 2JWPA 2R0FA 1PMIA 4XXAA 2JKXA 3IN9A 3ZIXA 5CFDC 3WVJA 4LKFA 2RR11 2YPJA 1J1TA 1GFF2 1GOGA 1N3QA 2NN8A 2XXZA 4AVVA 1YC61 3VD5A 2ZGOA 3MZHA 4FVVA 2VW2A 3SQOA 1CIYA 1C8M3 1WMXA 1CD3G 1POV0 2W1SA 1YFWA 4XQWA 4EROA 1AF9A 3OYWB 3JD72 1UPSA 4ZY9A 3CNAA 3B5LB 4GWNA 1LHWA 2XL7A 1APNA 3CKHA 4N43A 2GH2A 2RS12 3RJRA 2ORZA 4R4XA 4LKDA 3ELNA 4GA9A 3VD3A 2QQVA 4AHWA 2JEMA 4JDMA 5CBLA 4META 4NRPA 4U2AA 2YBKA 2CV6A 4IETA 4HK9A 4Y1VA 5E6HA 5FPLA 1DQ6A 5CISA 2GC1A 4AEDB 4CDUA 3LKJA 1W2TA 1Q43A 4AVSA 4CEYA 1W06A 3OUIA 1DCSA 2QZ2A 2R0HA 3AKSA 4NPRA 1HLCA 4AK3A 2AC1A 3LEIA 1OA4A 1IQDC 4W4ZA 2GMEA 3QD6A 1TQ5A 1QQP3 5T5LA 3TNQA 2QUOA 3ZFEA 5K8SA 3THPA 5EZWA 4FPFA 3V0AB 4RR3A 2E7AA 4HKOA 5DAQA 5FKCA 2PQSA 4CTEA 3NWKA 5GZEA 4E27A 5GZGA 3H8XA 5FQ0A 1AXKA 1O6UA 1VMJA 2OT7A 2VO5A 2NQYA 2BVBA 4K3UA 4Q1RA 1HV1A 3RSJA 1LR5A 4CCDA 5K4LA 3MF9A 5FO9B 3QLQA 1WMFA 4IV3C 1O5UA 1VMFA 1DYKA 2DCJA 4IGPA 3TOJA 3I4IA 4V2WA 1ZRIA 2VMEA 3JD71 3P3PA 3H50A 2VMCA 3ZOIA 1RUC3 3FL7A 4AAPA 4G9SB 2RS11 4OZOA 3VDDC 3MW4A 3BALA 1UKGA 4NPLA 5FY8A 3U4XA 4L99A 2PHFA 1UOBA 4E2GA 3MDPA 2VULA 5FP7A 3KM5A 5AC92 4CU9A 1RVF3 2EA7A 4XIKA 5BNOB 2KXLA 1GZ9A 4Y20A 2NM1A 3BTYA 2W08A 1FV3A 1DF0A 1R082 1VIWB 4F8AA 1OLQA 2A71A 2OYZA 1J59A 2V72A 2WNOA 3R0RA 1UN1A 3FN9A 3BUCA 3AKQA 2LW8A 3OPTA 4GWMA 2W95A 4CU8A 3ZXFA 3AJZA 3P1IA 3BODA 4BQXA 1W6OA 1XC6A 3HPNA 4YZ4A 3AKRA 4XJ9A 2WWSA 3G7DA 1NE6A 2Q8DA 3UL2A 3IWZA 1MS4A 2FCUA 4H7LA 4KG8A 4OI4A 2BV4A 4MYEA 5EFUA 5I0TA 1N47A 1COV2 1VRH3 1O4TA 3MICA 4MXVA 3VUOA 2WNVC 1CZTA 1US3A 4CU6A 1UYYA 2VW0A 4PDWA 2ZGTA 2C4XA 3LSDA 1OMIA 1X82A 4XJ8A 4UOJA 3SHRA 2DVBA 3HAGA 2DU1A 1LGBA 4GXLA 1PZ7A 5HCHA 3WDXA 5FUNA 1YFUA 3VZMA 1GNZA 2QTWB 5F1RA 1ZBE3 2RHPA 4PHZA 5FXZA 1UKRA 1Z0HA 4INDA 2ZHKA 3JQWA 4GULA 5L9RA 3NNMA 5AC91 4LBOA 3EBRA 1XOYA 2P37A 4TSVA 4GWIA 1W6MA 1DBNA 2ET1A 1NZIA 1K12A 1UAIA 1ULFA 1KJRA 5CYYA 4CP2A 1S0JA 3KCCA 3K3NA 1Q8QA 4RS5C 2ERFA 1R081 3LD8A 1RUD2 1AX1A 4CCCA 1PVXA 3VZLA 3ZYJB 5CAZA 4FOWA 1H2LA 3Q8CA 4D6RA 4RL7A 3ZXDA 3ENRA 4FFFA 3RI8A 2FBEA 4CU7A 3NJVA 5E89A 3KVBA 3WCSA 1WW7A 3WNNA 3NNJA 4LBQA 3KGLA 5FYUA 2VMDA 2BFUL 4IEOA 3WP5A 4BMEA 2W87A 3WF1A 5JZGA 1MVEA 2VZ3A 1AJKA 4FOVA 4QQHA 1IPJA 1ENRA 1REFA 3AK0A 2Z5WA 3AC0A 1QJY3 5TSWA 1ZRDA 4CXXA 2CL2A 1W8WA 1UYXA 1VB2A 4WM7A 2VOXA 1AL23 1NA1A 3ETQA 2W47A 1COV1 1X8EA 2NPIA 4Q29A 5IVJA 1V9U2 3HMYA 5CFCB 1BBT3 1ND3A 4MHUA 1MPXA 1BVP1 3HD8B 1PM7A 3Q9OA 2FQPA 5KR7A 2DUQA 2EXJA 5EJZB 4AAXA 1Q8OA 2J1EA 1H2NA 2IFRA 4LMFA 1LOEA 2HKXA 3IDEA 1LCLA 2OZ6A 2A6VA 2BGCA 3KWVA 4UFJA 3WDVA 4D8MA 2PHXA 2VJXA 5FBJA 4OUMA 3H7YA 2WZR2 3PVBB 3BVCA 3ILNA 3ZPOA 1NUKA 1RUD1 1FAYA 1PVC2 4KWJA 1GR3A 4AQTA 4QGMA 4HN1A 1O3SA 1JU4A 2VZRA 3BN6A 5CFDB 2O8QA 3KVAA 2E26A 4PLMA 3FHAA 2AGSA 5J1XA 2R1DA 3UGHA 2OQ6A 3IAPA 2C24A 2PLV3 1GP4A 4XAAA 2R073 3VBHC 5IAVA 1I6XA 2ES3A 3ACGA 4PT6A 2QQUA 3AP5A 4AWDA 3HBZA 5F3CA 4A7ZA 2RMU1 2TEPA 4Y33A 5FP3A 2BJSA 1CJDA 4LLOA 1XB9A 3ZXAC 4YVWC 1XXNA 4XILA 3T09A 3VN4A 1V9U1 4YM1A 3OBRA 3M70A 2WZEA 2WT2A 5LA2A 2GC0A 2QNKA 1ACCA 4KG0A 3AMPA 3T1LA 2DTYA 1W9FA 2I45A 1XJAA 3WW3A 3BOPA 2WAOA 1A3KA 4PLNA 1EP0A 5A33B 5FMOS 4AFAA 5LEJA 3FUOA 3IDCB 1UZWA 3GBWA 1HN1A 5AVPA 3KS7A 4XZUG 5J36A 4QPIC 1RGSA 1Y9GA 5F3IA 5BNQA 4FFGA 1EUTA 1STMA 3PIGA 3FUQA 1UOGA 3KF5A 3O1OA 2WZR1 5ABJA 2YGLA 2DBIA 3ZFFC 3K4AA 5FZ0A 5A7WA 2WA3A 2UWCA 5KC5A 4B29A 4AGGA 4JGZB 1J1LA 4F3JA 3E6DA 1AL0G 5FZKA 1EAH2 3GHMA 3M3QA 1DQ5A 4MG2A 2YROA 4AW7A 3W5NA 4QKNA 2BU9A 1DQ2A 4AI1A 3MIFA 4X6RB 1HRI3 4FFHA 4IV3B 5FKBA 1AXZA 5DQ0A 2DCYA 4M0NA 2ZGLA 3BCWA 2EXKA 2XOMA 1QJU3 1TNRA 3VDDB 3ZSKA 2HWC3 1UIJA 4MADA 1C8M2 4DZGA 3HN1A 4C91A 3A7QA 3NV2A 3GDBA 4DRRA 5GZDA 3AP4A 1DP0A 2VZPA 3LOIA 2B8MA 1O4ZA 3MFCA 1UOFA 4QHZA 2PXJA 4NROA 5C71A 2A75A 5HPOA 3TYJA 2FDFA 2J42A 2K9ZA 4GJZA 1PX4A 2JDHA 4HXCA 2WKKA 2IXHA 4FPGA 1OA2A 4PCRA 5FRAA 1DHKB 5ACA3 1IS3A 1WZXA 2ILMA 2QZ3A 4Q5OA 1YQ5A 4I2OA 1XNAA 2AEYA 1KS4A 2X29A 1WLTA 4CEWC 2ADDA 1W28A 3M2MA 1LGCA 3J9SA 3TN92 5D21A 4QDQA 5FZ7A 2EIBA 2EF6A 2JDYA 1W6NA 1W8FA 2NLRA 3AL5A 3U11A 4S2FA 3DYPA 1GV9A 2WWUA 2UU8A 5HBAA 1XSRA 1EAH1 2VM9A 1W0PA 2WNVB 1W3VA 2RVAA 4QKDA 2R6QA 2WNUA 4UAPA 3P3NA 4I0AA 4UF0A 1ODMA 3RJ2X 2QQPA 4K8RB 4X8NA 5FP4A 2VZSA 3OF1A 3URFA 5F7UA 3FE5A 2WQ8A 1MS5A 2VMHA 4AG4A 5LA9A 4RHV3 2WLQA 2XHKA 2VQUA 3H3ZA 3EMRA 2BUKA 1G9DA 4QX2A 5IVEA 1OA3A 1UW8A 3KHBA 2P5BA 1W8NA 3HBKA 3NNFA 2WNEA 5ANQA 2ZAAA 1SHWB 3SCFA 1C8M1 1UY0A 2UYAA 1Q8SA 5FP8A 5FY9A 3AYCA 5D8AC 2J1RA 1VBE3 5F5AA 3MW2A 3OCPA 1RUC2 2Q5TA 2QCSB 4GIQA 2E32A 4BH9A 3LEKA 1AYM2 2JDUA 1RVF2 2VVEA 2F6BA 1NCQA 2VL4A 3N9MA 1WD4A 4HK8A 4NAMA 2XVLA 3ZDSA 3GZUC 2AENA 4AEKA 3WG4A 1FNZA 5BXXA 2Y64A 1K3IA 3TN91 1EV13 1SEFA 4GMP0 4LTAA 2ZTNA 2RJ2A 3EXUA 1SCRA 2P6HA 4D0QA 5DN2A 5T54A 5BY5A 1F35A 3WDUA 4BWOA 2RM23 2ZKLA 5IVBA 1MS8A 4E4HA 1K45A 4QPGA 2L9LA 2VOKA 1W6PB 2VOWA 2WLPA 3CEWA 2WR9A 1GQGA 4GD4A 2YU2A 4E8DA 5A3MA 5JIUA 5FY0A 5LW9A 5FZ6A 4YFWA 3ZFGC 1CAVB 1ZZ9A 4L97A 1H30A 3WNKA 1D4VB 1YYNA 1VRH2 3QH7A 1CAXA 1A6CA 1F2NA 1MQTC 5FZAA 4UI9L 5IVFA 3V56A 3AYDA 1CIWA 4LUKA 3DPRA 4FPJA 4XDOA 3SISA 1QWRA 1HB1A 1XYOA 1ZA4A 1YQ6A 1RUC1 3NJYA 2ZMNA 4LBLA 2SLIA 1JZ2A 5CB7A 1L7QA 1PIV2 3USSA 4CXYA 1S2BA 3BU7A 3M3OA 3NSTA 5I0SA 4YGDA 4CDXC 1AYM1 1UD1A 4R8HA 1PNGA 1RVF1 1W2OA 4L92A 4Q26A 4RD7A 3KZ4C 3ITQA 2UURA 4XMAA 1A8MA 5C9AC 4QT6A 1G9FA 4MX3A 3RVHA 4B4RA 2ARXA 1ASJ3 4IEUA 3VBHB 5BNPA 3VD4A 2MPFA 1GOFA 1W2NA 4BMBA 5AFBA 1RUOA 1MS3A 4XURA 4CDQC 1LTEA 4CUAA 2OXBA 2JG8C 2P1BA 2Q8OA 1LHUA 4LR4A 4K40A 1NLRA 2CWMA 3VBUA 3VL9A 1WW5A 3WLUA 3VD7A 4F83A 1BKZA 4EZ4A 5FWJA 1QJY2 4W50A 5FY4A 1CWPA 2XKPA 2XLGA 1DQ1A 1ULPA 3N9QA 3LGRA 4ASMB 1AL22 4CCOA 5FZOB 1VRH1 3THCA 2WS93 3NQHA 3LIGA 3LDRA 4FPKA 4LK6A 4P02B 2VQ0A 1C1FA 3WW2A 4KWKA 4YNIA 5F32A 3I2OA 3WNXA 1GP5A 1UY1A 3WF2A 5JSOA 3U37A 1RINA 4A7YA 1VALA 3LDKA 2BGOA 4CP9A 3U07A 4OHWA 4NIGA 3USUB 2XQXA 1S0BA 1PIV1 1KEXA 3LPGA 4I01A 1CGPA 3SCHA 3ZFFB 4LE3A 4FPYA 4EN7B 4AHXA 3UJQA 1WBLA 1DYPA 2GH8A 4H55A 4OUEA 2TUNA 2RJLA 1NCRC 3TEYA 1D4M3 2EXIA 1VP6A 1SDDB 2O1QA 2XBO3 5J98B 3T2OA 4TLFA 1RUNA 4QX0A 3HT1A 3UESA 1ENXA 3L2HA 4Q4X3 3C7FA 3ZSLA 2ZGPA 3O0WA 4FP3A 2XGXA 1N1VA 4Y22A 4LIUA 5EWSA 3WDTA 3ZVXA 5A6QA 4LUMA 3PMEA 3OBZA 1EY2A 4FP2A 2W1QA 3W20A 4CYDA 1BHGA 5DAVA 4XMIA 1V6MA 2XL9A 2JD4A 1IOAA 2H6BA 2XR4A 2WT1A 3H3LA 1XE7A 4BLIA 4C8DA 4P00B 3POEA 1YLLA 3F2ZA 1UXXX 2PLV2 1OPOA 2R072 1KXGA 2XWJB 2ZA9A 2HJIA 1QJY1 4P14A 2C1FA 3SEEA 1AX0A 5FZ4A 3WG1A 3ORJA 4WVVA 4XW3A 3VBSC 5DXDA 1AL21 4XVHA 1O5LA 2A1XA 3RMXA 1JOBA 5AFEA 1S0DA 5FZEA 1SFYA 4XJAA 1C28A 1L7RA 1ZREA 2GALA 1QXPA 3RWKX 4JKLA 4F7ZA 1R1A3 4UXAA 4BU2A 4W6WA 1FPN3 3ZDVA 2CGPA 4CEWB 4XABA 2VTXJ 1ZX5A 4KU8A 2BNOA 1Q8VA 2ENRA 3WDYA 2P3IA 2BW8A 4DEQA 3TRSB 2OW4A 3RZMA 4LKEA 3RYRA 4ZPIA 1ULGA 2DFCA 3MIDA 4J1WA 1CX4A 2E7QA 3D82A 5I0UA 2A5ZA 3C7EA 3T30A 4IEWA 3IZOA 1QDCA 4Y1XA 3OEAA 3D0SA 4WM8C 3TEWA 4N53C 1ULDA 1WA6X 3T4VA 3OY8B 1HIXA 2UY8A 2V09A 4KI5M 1PHMA 4XCBA 3OYWA 4ZXEA 3U78A 2VMGA 1UOJA 5EP9A 4XCAA 5GKAC 5FXWA 5LBFA 5FMBA 4Z8BA 3JBG2 2FCVA 2ZGSA 5KHHA 3N7JA 4BCUA 2BRTA 2QBXA 4XUPA 5I8YA 1LU2A 3BU0A 1CESA 5A1FA 4AI8A 2PLV1 1W2AX 1VPHA 2E33A 1HRI2 2R071 1TME3 4B4PA 3T4HB 4XHBA 4OHYA 1AR63 1H4HA 3ACLA 1X9TA 3PHMA 5D8AB 1GBGA 1N1SA 1ALYA 1LODA 2QDRA 4S2DA 3VB9A 4AEDA 3T0BA 1H8TC 2JDZA 3QCWA 4QAWA 1KS5A 1V6JA 2HWC2 5C4WC 4IL7A 2HEYF 3K2OA 3ZR5A 1JU3A 4YZ1A 2DCKA 4IEZA 1VLNA 2Q30A 3MYXA 1OVSA 1KITA 2VTFA 2VNGA 4RQPC 2D43A 2B39A 3O1RA 4NIHA 3EYPA 3V0AA 4XF0A 2WZPP 3T2QA 2FDJA 3I49A 4PIXA 3LFIA 1FNYA 2ZKNA 1WLDA 3DCQA 4QDSA 3VKOA 4C1XA 5ACA2 2B9VA 2EICA 2CDOA 3AMMA 3NVCA 5K9YA 1LU1A 4YVSC 4DPNA 2WWJA 4QB2A 4QPWA 3VHNA 3ZYPA 3R05A 5A6XA 1RUI3 2PHTA 3EJKA 1PMJX 2GMMA 3F95A 5JI9A 3N7MA 1B35C 5FLJA 2Y6LA 4FPCA 5JXHA 2XJUA 2JD9A 3LQCA 1OXCA 4O61A 4URAA 1JI6A 2D40A 2E6VA 4DMIA 4FT8A 3BI3A 3ZFGB 2J7MA 3WF3A 4K1ZA 1DZTA 4RYDA 1W9SA 3JBG1 3HR9A 2EAAA 1ULEA 1MQTB 1K5MC 2V5YA 3L9JT 3JB8A 1PZ9A 1FOD3 1GANA 5T55A 2RR12 2F4LA 3NKGA 2VH9A 4AF9A 5BNOA 1HRI1 4CVUA 2I2SA 3WEZA 5IAXA 2OVUA 4TWTA 3BTZA 4RHV2 3Q8FA 4Y1ZA 3AJYA 1V00A 4YLZA 5C3SA 3H8RA 2ETEA 2R1BA 2FD8A 4XDPA 2Y33A 1YO8A 2HWC1 3N3HA 3NV4A 2RDNA 2OX0A 4GH4C 2J1SA 1EYBA 4LITA 4CDXB 1DZRA 2W46A 1QF3A 2BWCA 2RS32 4OZXA 4XBLA 5JR7B 1YXWA 3PTYA 2IXLA 3VHRA 4N43C 1NYWA 1AJOA 3SH3A 5C9AB 4CRQA 5T52A 1C5IA 5IJRA 4KWLA 3WDWA 2BFUS 1S1AA 2ZZJA 2C26A 2DYCA 5F9TA 4H14A 3VZOA 5ACA1 3O1PA 3CL1A 1ZNPA 2JIGA 3O1TA 1X9PA 4BK4A 2JG8B 1YEWA 3NMBA 1E57A 3M1HA 4CDUC 2E51A 1EV12 1H6YA 3RZKA 1ZVFA 2VVDA 1HDKA 1LOAA 1GZTA 4CEYC 2WO3A 5FYIA 3WP6A 1SLTA 3MV11 4Y4YA 2ZPXA 4JTOA 1TZOA 2NYYA 4UW6A 2B5HA 2RM22 1JMUB 1ONAA 1VBB2 1GOHA 1ZRRA 2NMNA 5CADA 2FDKA 4C0BA 1AYN2 4YWAA 2I07B 3CHXA 1X33A 5FYVA 4ITCA 3CMGA 4KBBA 4RR3C 5H9RA 1V6NA 4P9WA 5I0RA 2X5IB 4GQ7A 4OQ8A 3R6SA 5A3OA 4UFIA 1ULOA 4MOAA 1AR73 1GZWB 1Q56A 3D3AA 4RHV1 3FFZA 3MUZ1 4M3CB 2BGPA 1QMJA 4AYUA 1RHI3 5FZFA 3EQEA 3LWCA 3VBOC 1UMIA 1RUE3 3WT3A 2G1MA 1DFQA 1QKQA 2RS31 1NCRB 1WLCA 1GP6A 3AFKA 4BQ5A 3TWIA 2RE9A 3GZAA 1LEMA 1H0BA 1OLMA 1RUF3 4ZU7A 3JB4C 1OLRA 1WW6A 4EWDA 2JECA 4LE4A 3VKMA 1RUJ3 1GWMA 4BQ3A 2WRAA 3ATGA 3AZZA 1UWWA 1RMU3 1J3RA 1U0AA 4V1PA 3ACFA 2YMZA 4PQQA 1SBEA 2YFUA 1IG0A 1NY72 3B3QE 5CFCA 3D5OA 5DZGA 3RG0A 4CP0A 4D6QA 1EV11 4D3WA 5JMOA 3C2UA 2ZMLA 4B1LA 1UZ0A 1Z7S3 3WNPA 3B01A 2Q4SA 5T5JA 1S0FA 3E5QA 1N1YA 4IGOA 3VBSB 3WHUA 1LULA 2BOJA 2CDPA 4QWNA 4UBHA 3Q8BA 2RM21 4QB1A 3MIEA 4ZXKA 1VBB1 1XNKA 2RG4A 3LPFA 4CDWA 1SLLA 2Z4FA 3DL3A 4FBFA 3KB5A 1AYN1 4Y3OA 5JUVA 1D2QA 2TNFA 1LJ7A 4LNVA 3S6PA 1OD5A 2VXRA 1NXD1 2WIIB 5IYYA 1IZ3A 2JG9C 2WQZC 4XFIA 2VBDA 5C8CC 2PAEA 3NV1A 4ATEA 5JPMB 1JOPA 3S0MA 3SXWA 2LTNA 3S30A 3WXPA 1XU2A 4JGYC 2Q8EA 5A1LA 2GU9A 5CFDA 1AZDA 3HOBA 5FYTA 3KQRA 3TNPB 5JOYA 1NOVA 1OFNA 4DINB 1HV0A 2ZCWA 1VE0A 3ZXJA 2VUAA 3SKVA 2R063 3H0OA 4WM8B 4N53B 2NZ9A 5K7PA 2WYSA 4PF5A 3WF4A 2GN3A 4BXFA 1AR93 3WSOA 4A6SA 3NO8A 5A32B 1GICA 3K77A 5L9BA 4GKXA 4Q4V2 3KV4A 5D1IA 4XTMA 2GNTA 3CQOA 1XNDA 3GZTB 5JR2A 3BIWE 1NY71 3K48A 4K6BA 2C6SA 1PNFA 4JRAA 4Q4X2 4AI3A 4COZA 1ZZBA 4AL9A 3BKZA 5FYZA 4G4FA 5E8AA 2BWAA 2GC3A 3OGJA 4QX3A 3SLIA 3WG3A 4HPKB 3PMSA 1AR83 5JXJA 2A7AA 4D7YA 4BYYA 5A33A 3UV9A 2C5DA 1H8TB 1IS5A 2E7TA 4MGZE 4NHXA 5C6CA 2ATFA 5C4WB 2AYHA 4ET7A 3OJBA 1SG3A 3UT0A 2HBTA 1WUVA 5F5QA 2VY0A 4WM7C 3HEIA 1JYIA 3I2GA 3WQ7A 3IIIA 3T0AA 2VCAA 1ENQA 1UMZA 2HWF2 4NVPA 3O14A 4JGZA 4MSVA 5KHGA 1DU3D 1GU3A 1ND3C 1GUIA 2ZGQA 1Y9QA 3DGTA 5A80A 1R1A2 4XXPA 2Q8CA 1OT5A 1FPN2 2VZQA 2YUEA 3I3EA 2HWD2 4YVSB 2B7YA 2H6CA 4FOQA 4YGEA 4JVAA 1UX7A 4IV3A 5J3UA 4O65A 1B35B 3JUUA 1NX9A 2YC4A 2ZXQA 5BUVA 3POFA 1BMV2 2XJTA 1F9KA 4YG6A 4ZU5A 2B46X 3HJRA 2ZX2A 4EE2A 1VJ2A 5LRSA 3NNLA 4Q4V1 2EALA 2WQ4A 3WG2A 1JYVA 2VMIA 4LHSA 3M3IA 4ISRA 1SLBA 1SMVA 4O9GA 1GWKA 4WVMB 4YG0A 1GKBA 5FUPA 4Q4X1 1K5MB 1KFUL 4FFIA 5DABA 3FX3A 4E4SA 2HLEA 4MGSA 2CNAA 1W8OA 3KT7A 1A8DA 4FAHA 2ZS6B 5A3LA 2XMLA 4J25A 4HBNA 1BK1A 4KQ7A 5IHRA 2CTVA 2RMU2 5FZIA 3H3UA 1IKPA 1NT0A 4MUVA 4J6GA 1TME2 5LK5A 4GH4B 4A44A 4ASLA 1AR62 4YW4A 1QOTA 2XWBB 3I2FA 3MLLA 4YW2A 3TBDA 1V6OA 1YQ2A 2W1UA 2FDHA 4N43B 4WZCA 2G9GA 2X8KA 2E31A 2HWF1 2Y0OA 3POYA 2BZDA 1S0GA 4PQ9A 5FZMA 1R1A1 1OLME 1ZYBA 1PO13 2W52A 1FPN1 2WNVA 4QQLA 1N3PA 2HWD1 3H9AA 4ISQA 5FZLA 2RJKA 3WNLA 5B2GB 4IEYA 5A7NA 4YZ5A 3O1SA 3IMMA 1X36A 3GBFA 1QJX2 2BTVC 4HVRA 1D2SA 1BMV1 1UX6A 4GALA 4PI2A 2DBNA 2A3WA 5LWBA 1IGOA 5J96B 1LOBA 1RUI2 2P3YA 2FHRA 5FPXA 4FTEA 4OI0A 1V70A 5FO8B 5ABJC 2HEVF 5JOXA 1DGLA 4EZHA 4DY3A 2JE7A 4XDQA 2QFEA 4QU2A 3E6BA 2W5FA 3MHZA 4AVAA 3ZIWA 4XBQA 3ZPYA 1BLZA 3UETA 1OUXA 3WUDA 3M8LA 5FQ0B 4DRVA 4DXZA 5CEHA 2JDKA 3LA7A 4QM8A 5FAXA 3U75A 3UYJA 4FPOB 1XNTA 1VAMA 3VV1A 4DY5A 3ZXKA 4IE7A 1U5XA 1TME1 4G3YC 3OPWA 5A3TA 2Y6FA 3VBOB 1AR61 3IMNA 2Y6GA 4MHRA 1HRV3 3K51A 2A6XA 3PVNA 1EPWA 4NRMA 1RUH2 3J7MA 2P6CA 3AKPA 4KMQA 1HXS2 5FPUA 2Z79A 4Z07A 2JIJA 5GALA 3D8CA 4YZ2A 1BXHA 4XAEA 4TN7A 2VQAA 3INAA 3ZN5A 2YYOA 4XHXA 3S5AA 4JRLA 4BHPA 1WD3A 2CGNA 4AVTA 4UFMA 4LXLA 5EQUA 2KD7A 2DVGA 3O0XA 4Y20B 4B4QA 5L36A 2PA7A 3RZLA 2JKBA 1W6PA 4E4ZA 3MIGA 4QHOA 3AP9A 4IV1C 1OHFA 5DDJ3 1QJX1 1CAVA 1VBA3 3B69A 4MGQA 4IDZA 1QOOA 3R4DB 4AEJA 1TMF3 4FO9A 1WCUA 3UK9A 3O12A 3GJAA 1O3TA 1RUI1 2D44A 2O14A 5FZGA 2FDGA 3B00A 4Q0VA 5FYCA 2WO1A 2ZGRA 3PTRB 1V6KA 2IVIB 3KF3A 4MGKE 4XFBA 4H2AA 2P3KA 3CJIA 3BPSA 5A7SA 2BERA 2ZX3A 3VDCA 2BDRA 2JG9B 2PHDA 4BDVB 2ZACA 4FAGA 5C8CB 3HN3A 1NXMA 5FY7A 1CAUA 3NL1A 4HZFA 2WNUC 3IDAA 1JZ3A 3KV9A 1D0HA 1FOD1 4JGYB 4EQVA 4O9EA 1MR5A 4Q4W3 1GNYA 2XHNA 5DUXA 4A3ZA 3BTAA 2J1TA 3OGVA 5CKQA 1LHNA 1W90A 5JAXA 1AR72 5A3WA 5HV4A 3C3VA 1RUH1 4XACA 3RFRA 1HXS1 3ZYFA 3VBHA 1PGSA 3LEGA 1RHI2 3JCIA 1G86A 4Q27A 4A3XA 2D93A 2B9UA 4BM8A 3AB0A 3PU8A 1RUE2 1Y3TA 1SFPA 3I54A 2UY9A 4CP1A 1POV3 2YU1A 1GSLA 3ABZA 4QQPA 1A34A 3AVRA 3VHOA 3OGGA 4IE5A 4JKKA 5FYBA 3BOWA 3A21A 3GCXA 3I59B 5C33A 4DUVA 2QQJA 1RMU2 1NCQC 4NIIA 1MS9A 1VBC3 2JB4A 2W0XA 3FWEA 5A7PA 4K8FA 2QDNA 5F3EA 5BPXA 1W8UA 3OG2A 1WMEA 1CX1A 3EB7A 3THTA 4NAOA 5GLUA 1Z7S2 1QQP2 2JDAA 4LULA 4UW3A 3WCRA 3BIEA 4JX0A 3AMHA 3OBTA 1W6QB 3USUA 2IC1A 4WM7B 3OUHA 1NE4A 1OC1A 1SACA 1W03A 2QJVA 3J4UH 1QIQA 4OFGA 5A3PA 2XUEA 4P9LA 1UQXA 3VKLA 4Q8KA 4JAAA 3FLRA 3MGUA 3MEPA 4JKMA 4NHKA 4RN5A 4LK7A 1FT9A 3HT2A 4XFAA 1X50A 1UY4A 3IIAA 3ZMOA 3B94A 5EJ1B 1AR71 3BGAA 5A1AA 2UWBA 3UKNA 5JPNB 2HWB3 4JHTA 1OKQA 2D6MA 4B7KA 4IEQA 1PO23 2CU5A 3IDBB 1RHI1 4YW1A 3ZKYA 1ZRFA 2XJQA 4XUNA 4NMIA 5ERLA 1RUE1 4RS5B 4XYXA 5CG9A 5ANNA 3OPZA 4LORA 4XOGA 1OD3A 2R062 4DEVA 1BQPA 4YM3A 2D6OX 4DQAA 4FI9A 3PLQA 4NIDA 1JTZX 1OBNA 2G9ZA 4FPLA 1QXRA 2R30A 1RMU1 4LO5B 3UKVA 3I3MA 5JVVA 2LROA 4IEXA 4AFMA 1SPPA 1RJ8A 3HWJA 3HVDA 2CAUA 1SBFA 4QPYA 4KL1A 4YFZA 1TE1B 1Z7S1 1QQP1 4AGVA 3RZHA 2VZVA 3C8XA 4CEWA 3T1MA 1TEIA 4OUSA 4PJYA 1RC6A 1S2EA 3D0JA 3ZMNA 3NRUA 3K3OA 4NR1A 3LOBA 4UBGA 5CNAA 4CUCA 1OURA 4YW7A 1LOGA 1XYNA 3OY8A 4R52A 4DXRA 1UXZA 2VZTA 3VBFA 2HYKA 5IK7A 5FYYA 3SH5A 4XF4A 1J58A 1EUUA 1WCDJ 2A6ZA 2B42B 4Q1PA 1CPNA 3IM0A 1U5IA 3WQ1A 5LA0A 1ZBE2 3JU9A 1DIWA 2R043 4XJUA 4E4DX 1YI9A 2UYBA 1LAJA 2ZHLA 4P08A 2QVSB 5D2AA 3U1XA 2R061 1JH5A 2B4KA 3ST7A 2IXIA 1RTVA 5D8AA 1CAWB 2XG3A 5FOBB 3JD73 1JZ6A 1I1EA 5EXOA 5JDBA 3VKFC 5K0UA 5I93A 3RZJA 3AM2A 1FI2A 3WHTA 5HCAA 1PK6C 1OF4A 4LPLA 4DO0A 3BTXA 1LNSA 4RSUA 4NPMA 4COVA 3AP7A 1ND2C 5JI7A 3IPVB 1F5JA 4YVWB 5LRRA 4Z2AA 3B9CA 3O1MA 5F8PA 3DKWA 4Y5Z0 1JN2P 3IAQA 2VAUA 3P6BA 4HSLA 2D6LX 2Z42A 3T2TA 3V0BB 1WGPA 2ZHNA 5G05L 4CUBA 1XNCA 4J1XA 1BBT2 1HN0A 3GZEA 3S7IA 3FJSA 4BLJA 4XE9A 4E9KA 1YUDA 1HJFA 1KFXL 2Y34A 2D6KA 5BV6A 1IPKA 2WO2A 2D3SA 3WW1A 1BYHA 4HSJA 4QPIB 4IV1B 1I9RA 1K5JA 1UZZA 1WW4A 2QQMA 1NLSA 2VR4A 2ZEYA 3C7HA 2LM3A 5FZBA 1HB2A 1TNFA 1ZBE1 4AR2A 5BNNA 4IESA 3O0VA 4JHZA 5CZKA 1YJLA 2WINB 2EIGA 1QH7A 2XKOA 3LEMA 4HT1T 5A7OA 2QQKA 4NOTA 4HETA 3RQ0A 3NJXA 2D5FA 2YC0A 4XZPA 2V4VA 3A0NA 1JYWA 1JXNA 4R9CA 3HIFA 4MH0E 5FREA 2Z69A 2BYVE 2VVFA 1WLWA 4KBZA 4W8JA 5DUVA 5FLIA 4OI1A 1OPMA 4MGIE 4BQWA 2GP3A 4EN6B 5EIYB 1LECA 4M4RA 5JOZA 4AHYA 2QQOA 4JV4A 4M3CF 4CDXA 4X6QB 4LBNA 5AC93 5FZ1A 5HV0A 2XJPA 3FBYA 5EJ3A 5T5PA 4A6OA 4D69A 4LHNA 1OFSA 1US2A 1SQ4A 3KV5A 3WF0A 3ZO0B 2W94A 2WBKA 4P9XA 3ZSMA 1YFYA 5C9AA 1Q3EA 2Y8KA 4FOYA 4P9IA 1XYPA 4LA2A 4UFLA 2GAUA 2BPA2 5IFTA 1ZM1A 1CR7A 1F4AA 2HYXA 3AYEA 3J7NA 3VBRA 1BK0A 1BBT1 2X05A 2WL1A 2B45X 2D6NA 2G19A 2OUJA 1SZBA 2PHLA 4FQ4A 2VZOA 2XLFA 4A4AA 2PYTA 4I3PA 5C5TA 4XJZA 2RDSA 3VZKA 1WMDA 1XPWA 1OI6A 1VBD3 1COV3 1NCQB 5LA1A 3W9AA 5F6KA 4QQ2A 2MEV3 4RGAA 5GLZA 1POQA 5A3UA 4ZZ8A 4LJHA 4LO4B 4YW6A 5DDJ2 1MZ6A 1VBA2 2X5IA 2ZX1A 4Y1UA 2W39A 5KBFA 4BQYA 5L7OC 1DGRN 1JOJA 1GZWA 4YGBA 1G7YA 4HFSA 4M3CA 5JWPA 3C7OA 4IE4A 1C1LA 1JYTA 1RUG3 2WYFA 1JW6A 2AEZA 3O1VA 2ORXA 2ZHMA 2VECA 4CE8A 5FZCA 4FTSA 3WNMA 1O7FA 3QH6A 1NCRA 2DU0A 2ZMKA 1T6GC 2EIEA 4Q4Y3 4WVZA 5KHKA 3SC7X 4QX1A 5IUQA 1BVVA 4XC9A 1CAXB 2WFF3 5CU1A 3SMHA 1OH4A 3H8OA 3SNMA 3U4SA 1E5SA 5C7GA 4FSJA 4DXTA 5IT6A 1UNBA 5F6LB 1J84A 1QJU2 1OOPC 1UO9A 2D98A 4UW5A 4ES8A 1RXFA 2OPWA 1JZ4A 2SBAA 3LA2A 4PF1A 4RFT0 4N9HA 1S55A 1E5RA 3RZZA 4E8CA 5KHIA 2XVKA 4JC1A 2YZ4A 3GJBA 5EV7A 3PJQA 4M00A 5FPVA 4Y24A 5FFOC 3PVEA 3CLPA 4ZONA 3WX5A 4U36A 3VBSA 5FUIA 3I3QA 4R9DA 1HJGA 4CSWA 5FR3A 3ILRA 1CPMA 2DF7A 2Y26A 2MNGA 2YG0A 3EHKA 4Q2FA 3W58A 3E1F1 5DDJ1 1BJQA 1VBA1 3AMNA 3AVSA 1OVPA 4FXGB 4K9SA 2JDNA 5FK7A 4XPVA 1TMF1 5A7QA 1QOSA 4XIOA 2CSGA 1WA4A 2VMFA 1M06G 3NAPC 4PIYA 4R4ZA 4AI2A 3UJOA 5KWRA 5F5IA 2VXJA 1OF3A 4DUWA 3LF7A 5C5UA 2Q1MA 1XE8A 1IS6A 4NE9A 3RYPA 3SEPA 4UYBA 5DMYA 1NQJA 2OS2A 2AZ5A 2WZR3 3OD4A 4LLFA 5H9PA 3WQBA 4QMAA 3DF0A 2DUPA 2RS53 3ZN6B 5T5OA 1PVC3 2KM2A 1S0EA 2A73B 2ZGKA 5FMCA 1DGWA 4L8QA 4MXWB 2XVGA 2LS6A 4I30A 1QJU1 3CU7A 4MO3M 2CAVA 2HWE3 4QGNA 1T6BX 4LA3A 1OUSA 1VBE2 3VD9A 1HB4A 1JYCA 2HEWF 2HWB2 1PO22 4ZS3A 4HPKA 2LRPA 1NKGA 1AHSA 3LDBA 1G9BA 3N4MA 3MPBA 4I0WB 1POV1 4SBVA 4OMCA 5FDBA 2FZ1A 1H8TA 1LESA 4L9BA 1YI7A 2BVVA 4XUTA 2WC2A 2H0VA 4EN9B 5T3NA 2YV8A 2IUWA 3N7LA 4GWJA 2JE9A 5DZFA 2VD7A 5C4WA 3RGBA 4AQ2A 4SLIA 4K20A 1PK6B 4K7JA 3RRDA 4KGQA 4AGRA 1MZ5A 3KD4A 4Y22B 1QNWA 4CDQB 1ND2B 1I5ZA 2O8OA 3CBNA 5I8TA 1H6XA 3WP4A 2A6YA 5FZ3A 5BYNA 1OQ1A 3LFMA 2XDVA 2YXSA 1YNAA 4LO7A 4OVEA 3RS6A 2WSUA 3LZZA 1LOFA 2CGOA 4XQ4A 1W8HA 1PZ8A 2XJSA 5CKNA 1ZRCA 1R093 3AX4A 1ENSA 5FOJB 4YVSA 4GMP3 3ZFEC 3ZKUA 4ZKTB 3I2DA 3NW4A 4H7MA 4LKSA 5C3QA 1FMD3 3RZGA 1YCIA 3ZSJA 5C3PA 3N7KA 5FZ9A 1Q5OA 1H8VA 2Q1FA 4GJYA 1UU6A 5LB6A 5LZ6A 4I09A 1JBCA 4A7KA 1GWLA 4CDWC 1H1IA 3GNEA 5F39A 5AVAA 1F8VA 1N3OA 2P2KA 2BBVA 2WN2A 3KHCA 4XEZA 3ZN4A 4QKFA 3PUIA 4WVMA 3OGSA 2DCZA 1KD7A 3CF6E 2CYFA 1K5MA 2C9KA 3E5XA 3H1MA 4NJ4A 4P5YA 4KGGA 4YM0A 1VBE1 2ZEZA 2HWB1 3ASIA 4HG6B 4COYA 2VNVA 1FATA 1PO21 4JZRA 4CCNA 3ZXLA 2W91A 4EYUA 5HI0A 4M01A 2R042 2TBVA 3RNSA 1AXYA 5I8SA 3LE0A 3H7JA 4XF9A 1IQAA 3I2KA 2Y0IA 4MVTA 1JS9A 2ZZQA 4KU7A 1GNHA 5J37A 1G9CA 4GH4A 1MZEA 5F2SA 3E97A 3KQ4B 2D6PA 3AZXA 5DZEA 4M3CE 2ZAHA 3MI8A 2GSYA 3R4SA 3PJYA 3QACA 3DECA 1RITA 3OGRA 5JSPA 1V6LA 4AFBA 4EN8B 1ASJ2 4I0BA 4LBMA 4MV2A 1J83A 1MEC3 2JENA 2VGDA 4QX7A 4XQDA 5FXVA 4NIAA 4Z2WA 1YJKA 4PIZA 1WCSA 4CPBD 2PMWB 1WCKA 1LHVA 4FXKB 3WQ0A 4ZU4A 3ACHA 1XNBA 5FYSA 1SCSA 2DFBA 4OHZA 4JQRA 3J8F3 4IQPA 1LOCA 4TYSA 4L2NA 5E88A 1VR3A 1JODA 3RMYA 4YZ3A 3TN93 1J3PA 5A6ZA 4MZUA 4A41A 2WS92 2VC9A 3MFAA 2E53A 3PVOA 4PDWC 1RL3A 4B1MA 5JOWA 2GP5A 1W3XA 2P34A 1O3RA 4YG3A 5L9VA 1RXGA 2WAAA 3UGFA 3JZVA 2WFPA 3TEXA 4LHLA 2YB7A 3WP3A 3QBQA 3VKNA 4JGZC 1EPZA 4BE3A 4V2VA 4ARYA 5FCCA 2A6WA 5L7OB 2R041 2MHFA 3H1YA 4QX5A 2PQQA 4ZS2A 2VOTA 2WA4A 3I8TA 3L2YA 4ARXA 4CCKA 3KT1A 4MLOA 1DLLA 4TZDA 3AZYA 1D4M2 2ZGNA 3VBOA 3HNYM 5FV3A 3CO2A 2XBO2 4IUGA 1A78A 3ROUA 3RWNA 1F5FA 3M7AA 3N9NA 4Q0UA 2VTXA 2Q0AA 3A0KA 3I3BA 2ID4A 5SV5A 5M0TA 4LT5A 1H9WA 1SBDA 4S2HA 1XE0A 2XUMA 3X29B 1ASJ1 5G04L 1PMHX 5JCTA 2VU9A 2XONA 2C0ZA 1AYM3 2ZEXA 3AMQA 1UZYA 1PM4A 2NP0A 3B7MA 5JZGC 5LCWL 1UPIA 3SITA 1OOPB 1AX2A 3TB0A 1CZSA 1SDWA 1CZVA 3RI9A 1VAVA 1S0IA 2A3XA 4QKBA 4JDNA 1F15A 3T0DA 4RQPB 1G8WA 4CZSA 2H0BA 4IW3A 1NA1C 4AFDA 3SCGA 5A6YA 2WS91 4X8PA 5F37A 3H42B 4FTBA 3N9LA 3B9IA 3DEMA 4XETA 1O4YA 5DPNA 2IXKA 2JDMA 4HMZA 2YFZA 4B8EA 2W9XA 1UF2C 3PUHA 4GAZA 1GLHA 3G6JB 2JG9A 5IVVA 5C8CA 1VBD2 3HNMA 2ZOEB 4XFFA 4GKYA 2XB6C 2MEV2 4JGYA 3M3EA 2QKDA 1XU1A 1R64A 3NAPB 2W1WA 1D4M1 1W8ZA 5LY2A 3ZR6A 5KXCA 5FTTC 2XBO1 5EHDA 3VLBB 4HVQA 2XLAA 4K1YA 5DG1A 1IPSA 1UL9A 2DWRA 4NUBA 2BBAA 3OOXA 1PIV3 3B02A 2HBUA 1RUG2 4CCMA 5EYXA 4BB3A 2ADEA 1LEDA 4CXWA 4P5HA 4EJRA 2D3RA 1CN1A 1SFNA 5KXDA 4DOUA 2FMDA 1W04A 2J1UA 2P3JA 3AKTA 4Q4Y2 2AH2A 3WINE 2DURA 2WFF2 3I59A 1W2UA 3ILFA 1YFXA 1W0OA 3PDQA 1NLQA 3LSEA 2X53S 1FV2A 1CVNA 1RJ7A 4NN0A 3VHPA 3UNPA 1W0NA 4Q8LA 2DCTA 3M4FA 2GNDA 3OBAA 3IBMA 1UU5A 3POSA 4AEMA 5FXXA 2EAKA 3J7LA 1KGYA 1B09A 4JTNA 1SLIA 1VRBA 5CIRA 1W6QA 3I2HA 3I7DA 1W99A 2OKXA 1DQ0A 1W05A 3GBGA 1U5ZA 1VBD1 1C8NA 3ALQA 3MUY1 2OQ7A 4Y5SA 4CDUB 1C4RA 2JJ6A 4NHLA 2YHJA 3CIHA 4CEYB 1ZBA3 1UIKA 2DVDA 3N9OA 2MEV1 1KRIA 2Z2SB 5J7MA 2O0OA 3HQRA 2F17A 1QXJA 4RFRB 4HL0A 1P8JA 3POWA 1HKDA 1H1MA 3ZFEB 2UWAA 1XQNA 2VW1A 3MPPG 1XSQA 3O1UA 1JZ5A 4LO8A 5HCBA 1M4WA 4BIOA 1YIFA 3FBMA 4RR3B 5DAPA 4QXKA 5FJKA 1ULCA 1RUG1 2VQTA 1JZ8A 3AZWA 5I91A 5IW0A 4CDWB 4XF3A 4RS5A 1UU4A 2LUWA 2ZBJA 4WBBA 2EVXA 1XRUA 1MZFA 2JXAA 4Y5TA 4W65A 3CJIC 5FY1A 1FOD2 3D4KA 4DB5A 4GB33 4Q4Y1 2R7EB 4XBNA 2WT0A 4K21A 4AI0A 4XUQA 2RS52 2WFF1 3GM8A 5H9QA 3V65A 3OEBA 4OHXA 1NG0A 5FYMA 5APAA 4PBOA 4C90A 4LBJA 3FHIB 4BQ4A 1W8TA 1BEV3 3FLPA 5FJHA 2GDFA 2HWE2 1WBFA 3IKWA 3W21A 4IXLA 4HANA 3GYDA 3FZ3A 4E2QA 1S0CA 5FIXA 2VUCA 4AVBA 3S7EA 4MGYE 1URXA 3ES4A 4DS0A 1L3JA 4EWEA 2CY6A 4N9IA 2AREA 2GC2A 4HLTA 3WUCA 3KSCA 1Y4WA 5A70A 2QE3A 2V4AA 2BQPA 3DKQA 3LAGA 5DUWA 2AR6A 5IFPA 1KDMA 5FZ8A 4N7IA 3TEZA 1C57A 4DXSA 4BA6A 4NRQA 5JLVA 1GQPA 1G9AA 5EPAA 1W6OB 1VAKA 1Y9MA 1ZZ6A 3AXDA 1V0AA 1PX3A 3ZSEA 5KXBA 1VMHA 1R092 2FCTA 3PU3A 3OTFA 3NNGA 4H3WA 1UMHA 1NAEA 4NHMA 1E5IA 2D3PA 1RYYA 3O7OA 4PDWB 1FMD2 3I2JA 3KMHA 3N9PA 2RS51 4LBQD 1CAWA 4O7XA 1PVC1 3P5BA 3DXUA 3Q8EA 2VBPA 4UT5A 1C5HA 3HQUA 4D7SA 5JMCA 3DN7A 2ZEWA 3JBG3 5CKMA 5FZHA 1LENA 4OCTA 1SLCA 2HWE1 2YC2A 5L73A 4YYOA 5IK4A 3TAYA 1W6MB 4N7UA 3KT4A 5I0DA 3IPVA 4LO6B 3W5MA 4YVWA 4JDOA 5IK8A 2WDBA 1REEA 3MBWA 1RUF2 2CHHA 2RDQA 2ZX0A 1RUJ2 2ZGUA 4QB6A 5HXVA 1OH3A 2IFWA 4BK5A 3S57A 2N7GA 3AYAA 5FZOA 3EO6A 2X10A 3V0BA 1RB8G 3FFQA 4A45A 4LBQB 5GZFA 3DXTA 3I3DA 3GF6A
chains in the Genus database with same CATH topology
5JZGB 3VL8A 5DG2A 3O5SA 1MEC2 4QPIA 4WZFA 4IV1A 1QDOA 1HW5A 2PTMA 1R091 1NA1B 1Z78A 2VOVA 4GMP1 1JUHA 3ZFFA 1DZQA 4QPGC 3KGZA 3J8F2 1FMD1 1LGNA 1ND3B 2YDEA 1YIPA 2PHUA 4PLOA 1MS0A 1Y7BA 1MS1A 2YY1A 2CWSA 4Q0QA 1HQLA 4OULA 5FPZA 2DV9A 2G9FA 4LHKA 4YRDA 5JIAA 3VBFC 3DPRC 3NKTA 2RR13 4DNYA 2XJRA 3ZYRA 3FC0A 1AUYA 3LA3A 1RUF1 2FZ2A 3LCPA 3MLKA 1AR92 3RPQA 3D6EA 1RUJ1 5GM0A 4C0HA 4AVCA 4QD2A 2GMPA 1DGRA 4HN0A 3V64A 1YWKA 4ATFA 1ZZ7A 3B93A 1OQDA 2RS33 4XJWA 4P9JA 3FLTA 4XTPA 2OA2A 5DUUA 5K0UC 5BNPC 1MEC1 2WSVA 1AR82 3ES1A 4Q0PA 2JX9A 2GZWA 4QM9A 2VUJA 3VBUC 4W6YA 4Z1VA 2VG9A 3J8F1 2ZJCA 2D97A 4FQZA 1KDKA 4XFGA 4HVOA 3WR0A 1Q8PA 3E5UA 3MIHA 5HCFA 4BZ4A 4BIFA 3ME2A 1VBB3 2PAMA 1AYN3 3IT8A 4FPHA 4AQSA 3NJZA 5BNNC 5ABJB 1AR91 5E16A 2EXHA 4ES9A 2RS13 1DG6A 1F31A 2JICA 3E6CC 1KQRA 3CJIB 5SV8A 3LB9A 4JCKA 2ARBA 3GHNA 5J09A 1ZZ8A 1CAUB 2LALA 1AR81 4QGLA 1MACA 4Y26A 1YHFA 3BB6A 3NV3A 2K0GA 1X7NA 1CJPA 3DUIA 5EYYA 3J26N 2W68A 3H1WA 5CA6A 5J48A 1J3QA 2E63A 4ORFA 5E1RA 4Z82A 1JUIA 1CQ9A 5FMOL 5KHJA 2IXCA 1OQEA 3VBRC 1U5YA 1ZZCA 3WZ1A 4XFCA 3ZFGA 5FBZA 3RDIA 1OSGA 4HKLA 3DV8A 3ZYIB 3WW4A 4AXOA 1PO12 5GLWA 1VB4A 5LEKA 3VZJA 4NWVA 1MQTA 4WVWA 1QU0A 2PAKA 3ZN6A 1AVBA 2WJSA 1LRHA 1W6NB 1ZBA2 2GNBA 2Q1ZB 4AQ6A 1MVQA 5CVRA 4MXWA 3CJXA 2X5IC 1G6NA 2R32A 5JSRA 4R9BA 4YSFA 2WNUB 1REDA 3QOPA 3RYKA 4WV8A 3GALA 4BQ1A 1GZCA 1W39A 5LK7B 5KXEA 2D7FA 1R083 2PFWA 3AFGA 3PNAA 2KA3A 1QY4A 2IZWA 4Q4V3 1NZCA 4HKWA 4GB32 4LBKA 3H8UA 4S2GA 4XF1A 5C8WA 4YGCA 4D7TA 1PK6A 2NMOA 3U10A 4AE2A 4CDQA 3AP6A 3WV6A 2JG8A 1O3QA 1HRV2 5L19A 1ND2A 4AEDC 3N36A 1QHDA 2VNOA 1SLAA 1BEV2 2GNMA 2PN5A 4FCAA 4COWA 4OI2A 1HQNA 3BPZA 3A4UA 1I3HA 1IHMA 3R4UA 4BOWA 2A3YA 1UCXA 1PO11 2OIIA 2ZABA 4R9AA 1H1AA 2OPKA 2YGMA 2BEOA 1PGW2 1BZWA 1TMF2 1ZBA1 2P17A 3HQXA 2HWF3 1LHOA 1FXZA 2BNMA 2OZJA 1FYUA 2HWD3 1H2MA 3KLSA 4QPGB 1O91A 5GJ6A 2E9QA 4NO4A 4Y1YA 2XJVA 2A70A 3MIBA 1RUD3 2ZGMA 5GLTA 4A2UA 4COUA 1IS4A 3ZX7A 3W59A 1KJLA 4GB31 1H4GA 2GN7A 5BNOC 4Q4W2 3KCXA 2IXJA 2DVAA 3M3CA 5GLVA 3VBFB 3DPRB 3KCYA 3WY6A 3ECQA 1HRV1 4IEVA 2FMYA 3ZXGA 1C3HA 1BEV1 1V6IA 2F4PA 4EWAA 3N35A 2RMU3 4DFSA 3U0ZA 4ONUA 4D94A 1JHNA 4YW5A 4Z92B 4OLLA 1V9U3 2DVFA 1NQDA 1H9PA 1R1ZA 2K2SA 3ZYGA 4IERA 4I02A 4YARA 5K0UB 3VGIA 1PGW1 5BNPB 2DTWA 1LB2A 3VZNA 1DDLA 1VBC2 1QJZA 4EN0A 1PGL2 4KH9A 2VNRA 4YW3A 2Y38A 2XPJA 3MW3A 4YM2A 1IKQA 3VBUB 4AHZA 3AZVA 3JQXA 1QJX3 1DQ4A 1LOFC 4WM8A 1QGLA 4N53A 5L7OA 2PELA 2AUYA 3FMGA 2I74A 4QHBA 4C1WA 4B3NA 2ZX4A 4LEJA 1YRZA 2VPVA 4AFCA 1FX5A 5A32A 3OD0A 4Q4W1 5FO7B 5KC6A 4P9GA 4EV0A 4N90A 1BCXA 1Y43B 4I3GA 2DUOA 2IWGB 4RGGA 5BNNB 3ZXEA 1H2KA 3MF6A 4NWWA 5CG8A 3SH4A 5H9SA 1HQWA 1HX6A 4RA0A 1OOPA 1DGWX 4UW4A 4W6XA 2R49A 1RUH3 1HXS3 4RQPA 4P9YA 2R16A 3MLJA 2PHRA 1VBC1 3WOGA 1PGL1 3AXEA 4L11A 5CFCC 2C9AA 1U12A 1RIRA 1GYKA 3WD5A 4E2SA 4BPZA 2OUHA 4QQOA 1N1TA 4OHVA 1LKNA 2ET7A 1CONA 4PBPA 2PHWA 1D0GA 4Q0SA 1B35A 2G4IA 4IEPA 4KNCA 2BNNA 5IK5A 1QH6A 3VBRB 1GQHA 3UKTA 2D5HA 3NAPA 4FPEA 2XH6A 5FLHA 4XFHA 4M0HA 1EAH3 4B7EA 2V73A 1S2KA 1QNYA 3APBA 4URTA 1X8MA 5T50A 2R0FA 1PMIA 4XXAA 3ZIXA 3IN9A 5CFDC 3WVJA 2RR11 2YPJA 1J1TA 1GFF2 1N3QA 2NN8A 4AVVA 3MZHA 2ZGOA 4FVVA 2VW2A 1C8M3 1CD3G 1POV0 4XQWA 1YFWA 4EROA 1AF9A 3OYWB 3JD72 1UPSA 3CNAA 3B5LB 4GWNA 1LHWA 2XL7A 1APNA 4N43A 2GH2A 2RS12 3RJRA 4R4XA 3ELNA 4GA9A 4AHWA 2JEMA 4JDMA 5CBLA 4META 4U2AA 2CV6A 4IETA 4HK9A 4Y1VA 1DQ6A 2GC1A 4AEDB 4CDUA 3LKJA 1Q43A 4AVSA 4CEYA 2QZ2A 3AKSA 2R0HA 4NPRA 4AK3A 1HLCA 1OA4A 2GMEA 3QD6A 1TQ5A 1QQP3 5T5LA 3TNQA 2QUOA 3ZFEA 5K8SA 3THPA 5EZWA 4FPFA 3V0AB 4RR3A 2E7AA 4HKOA 4CTEA 3NWKA 5GZEA 4E27A 5GZGA 5FQ0A 1AXKA 2NQYA 2BVBA 4K3UA 4Q1RA 1HV1A 3RSJA 1LR5A 3MF9A 5FO9B 3QLQA 1WMFA 4IV3C 1O5UA 1DYKA 2DCJA 3TOJA 3I4IA 3JD71 3P3PA 3H50A 1RUC3 4G9SB 2RS11 3VDDC 3MW4A 3BALA 1UKGA 3U4XA 4L99A 2PHFA 4E2GA 3MDPA 2VULA 5AC92 3KM5A 1RVF3 2EA7A 4XIKA 5BNOB 2KXLA 1GZ9A 4Y20A 2NM1A 2W08A 1FV3A 1DF0A 1R082 1VIWB 4F8AA 1OLQA 2A71A 2OYZA 1J59A 3R0RA 1UN1A 3AKQA 4GWMA 3ZXFA 3AJZA 3BODA 1W6OA 4YZ4A 3AKRA 4XJ9A 2WWSA 3G7DA 1NE6A 3UL2A 3IWZA 1MS4A 4H7LA 4KG8A 4OI4A 4MYEA 5EFUA 5I0TA 1N47A 1COV2 1VRH3 1O4TA 3MICA 4MXVA 3VUOA 2WNVC 2VW0A 4PDWA 2ZGTA 3LSDA 1OMIA 1X82A 4XJ8A 3SHRA 2DVBA 3HAGA 2DU1A 1LGBA 4GXLA 1PZ7A 3WDXA 1YFUA 3VZMA 1GNZA 5F1RA 1ZBE3 2RHPA 1UKRA 1Z0HA 4INDA 2ZHKA 3JQWA 4GULA 5AC91 4LBOA 3EBRA 2P37A 4TSVA 1W6MA 1DBNA 2ET1A 1UAIA 1ULFA 1KJRA 4CP2A 1S0JA 3KCCA 1Q8QA 4RS5C 2ERFA 1R081 1RUD2 1AX1A 1PVXA 3VZLA 3ZYJB 5CAZA 4FOWA 1H2LA 4RL7A 3ZXDA 3ENRA 3RI8A 2FBEA 5E89A 3WCSA 1WW7A 4LBQA 4BMEA 3KGLA 2BFUL 4IEOA 3WP5A 5JZGA 1MVEA 1AJKA 4FOVA 4QQHA 1IPJA 1ENRA 1REFA 3AK0A 2Z5WA 5TSWA 1QJY3 1ZRDA 2CL2A 1VB2A 4WM7A 2VOXA 1AL23 1NA1A 3ETQA 1COV1 1X8EA 2NPIA 4Q29A 1V9U2 3HMYA 5CFCB 1BBT3 1ND3A 1BVP1 3HD8B 1PM7A 3Q9OA 2FQPA 2DUQA 2EXJA 1Q8OA 1H2NA 2IFRA 1LOEA 2HKXA 3IDEA 1LCLA 2OZ6A 2A6VA 2BGCA 3WDVA 2PHXA 4OUMA 3H7YA 2WZR2 3PVBB 3ILNA 1RUD1 1FAYA 1PVC2 4KWJA 1GR3A 4AQTA 4QGMA 4HN1A 1O3SA 5CFDB 2O8QA 4PLMA 2AGSA 2R1DA 2PLV3 2R073 3VBHC 1I6XA 2ES3A 3AP5A 4AWDA 3HBZA 4A7ZA 2RMU1 2TEPA 1CJDA 4LLOA 3ZXAC 4YVWC 1XXNA 4XILA 3VN4A 1V9U1 4YM1A 3OBRA 3M70A 2WT2A 2GC0A 2QNKA 4KG0A 3AMPA 3T1LA 2DTYA 2I45A 3WW3A 3BOPA 1A3KA 4PLNA 1EP0A 5A33B 5FMOS 4AFAA 5LEJA 3FUOA 3IDCB 3GBWA 5AVPA 3KS7A 5J36A 4QPIC 1RGSA 5BNQA 3FUQA 2WZR1 5ABJA 2YGLA 3ZFFC 2WA3A 2UWCA 5KC5A 4B29A 4AGGA 4JGZB 1J1LA 4F3JA 3E6DA 1AL0G 1EAH2 3GHMA 3M3QA 1DQ5A 2YROA 4AW7A 1DQ2A 4AI1A 3MIFA 4X6RB 1HRI3 4IV3B 1AXZA 2DCYA 4M0NA 2ZGLA 3BCWA 2EXKA 1QJU3 1TNRA 3VDDB 3ZSKA 2HWC3 1UIJA 1C8M2 4DZGA 3HN1A 4C91A 3NV2A 4DRRA 5GZDA 3AP4A 3LOIA 2B8MA 1O4ZA 3MFCA 2A75A 3TYJA 2K9ZA 2WKKA 2IXHA 4FPGA 1OA2A 4PCRA 5FRAA 1DHKB 5ACA3 1IS3A 2ILMA 2QZ3A 4I2OA 1KS4A 2X29A 1WLTA 4CEWC 3M2MA 1LGCA 3J9SA 3TN92 2EF6A 1W6NA 2NLRA 3U11A 4S2FA 1GV9A 2UU8A 5HBAA 1EAH1 1W0PA 2WNVB 2R6QA 2WNUA 3P3NA 4I0AA 3RJ2X 2QQPA 4X8NA 3OF1A 3URFA 3FE5A 1MS5A 2VMHA 4AG4A 4RHV3 2WLQA 2XHKA 3H3ZA 2BUKA 1G9DA 1OA3A 1UW8A 3SCFA 2WNEA 2ZAAA 1C8M1 2UYAA 1Q8SA 3AYCA 5D8AC 1VBE3 3MW2A 3OCPA 1RUC2 2Q5TA 2QCSB 4GIQA 4BH9A 1AYM2 1RVF2 2VVEA 2F6BA 1NCQA 4HK8A 1WD4A 2XVLA 3ZDSA 3GZUC 2AENA 4AEKA 3WG4A 1FNZA 5BXXA 3TN91 1EV13 1SEFA 4GMP0 4LTAA 2ZTNA 3EXUA 1SCRA 5T54A 5BY5A 3WDUA 4BWOA 2RM23 2ZKLA 1MS8A 4QPGA 3CEWA 2VOKA 1W6PB 2VOWA 2WLPA 5A3MA 1GQGA 5JIUA 4YFWA 3ZFGC 1CAVB 1ZZ9A 4L97A 1H30A 1D4VB 1YYNA 1VRH2 3QH7A 1CAXA 1A6CA 1F2NA 1MQTC 3V56A 3AYDA 1CIWA 4LUKA 3DPRA 4FPJA 3SISA 1QWRA 1XYOA 1ZA4A 1RUC1 4LBLA 2ZMNA 2SLIA 5CB7A 1PIV2 3USSA 1S2BA 3BU7A 3M3OA 3NSTA 5I0SA 4YGDA 4CDXC 1AYM1 1UD1A 4R8HA 1PNGA 1RVF1 4L92A 4Q26A 4RD7A 3KZ4C 2UURA 4XMAA 1A8MA 5C9AC 4QT6A 1G9FA 4MX3A 4B4RA 2ARXA 1ASJ3 4IEUA 3VBHB 5BNPA 2MPFA 4BMBA 5AFBA 1RUOA 1MS3A 4CDQC 1LTEA 2JG8C 2Q8OA 1LHUA 4LR4A 4K40A 1NLRA 2CWMA 3VBUA 3VL9A 1WW5A 3WLUA 4F83A 1BKZA 1QJY2 2XKPA 2XLGA 1DQ1A 4ASMB 3LGRA 1AL22 1VRH1 2WS93 4FPKA 2VQ0A 1C1FA 3WW2A 4KWKA 4YNIA 3WNXA 5JSOA 4A7YA 1RINA 1VALA 3U07A 4OHWA 3USUB 1S0BA 1PIV1 4I01A 1CGPA 3SCHA 3ZFFB 4LE3A 4FPYA 4EN7B 4AHXA 3UJQA 1WBLA 1DYPA 2GH8A 4H55A 2TUNA 2RJLA 1NCRC 1D4M3 2EXIA 1VP6A 2O1QA 2XBO3 5J98B 4TLFA 1RUNA 3HT1A 1ENXA 3L2HA 4Q4X3 3ZSLA 2ZGPA 3O0WA 4FP3A 2XGXA 1N1VA 4Y22A 3WDTA 5EWSA 3ZVXA 5GZCA 4LUMA 3PMEA 4FP2A 1EY2A 4CYDA 4XMIA 1V6MA 2XL9A 2JD4A 1IOAA 2H6BA 2WT1A 4BLIA 1XE7A 1YLLA 2PLV2 1OPOA 2R072 1KXGA 2XWJB 2ZA9A 2HJIA 1QJY1 4P14A 2C1FA 1AX0A 3WG1A 4WVVA 4XW3A 3VBSC 5DXDA 1AL21 1O5LA 3RMXA 5AFEA 1S0DA 1SFYA 4XJAA 1C28A 1ZREA 1QXPA 2GALA 4F7ZA 1R1A3 4UXAA 4W6WA 1FPN3 2CGPA 4CEWB 1ZX5A 4KU8A 2BNOA 1Q8VA 2ENRA 3WDYA 2P3IA 2BW8A 3TRSB 2OW4A 3RYRA 1ULGA 2DFCA 3MIDA 4J1WA 1CX4A 2E7QA 3D82A 5I0UA