2AYHA

Crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (glucanase)
molecule keywords 1,3-1,4-BETA-D-GLUCAN 4-GLUCANOHYDROLASE
publication title Crystal and molecular structure at 0.16-nm resolution of the hybrid Bacillus endo-1,3-1,4-beta-D-glucan 4-glucanohydrolase H(A16-M).
pubmed doi rcsb
source organism Hybrid
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1995-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ayhA00
3D6EA 3WUCA 1CPNA 1F5FA 3SLIA 2A6ZA 2DVAA 3WDTA 1SLBA 2DWRA 1FV3A 3ZSLA 1MZ5A 1CR7A 1CN1A 5GZEA 2WLQA 3OPZA 3VKMA 4Y22B 1ZA4A 2E51A 4W65A 1VLNA 3D5OA 4L8QA 5CNAA 2CL2A 1JBCA 1YXWA 4WVWA 1ULCA 1TEIA 2W39A 2VW2A 5T5PA 2BQPA 4M01A 1V6KA 2V5YA 5GJ6A 5IK5A 1ULDA 1GNHA 3TAYA 3WCSA 5JOWA 1JYIA 3WG2A 2I2SA 2WT0A 1QU0A 4XHBA 5AVAA 4AGGA 1CONA 2SLIA 4Q27A 5DZFA 2ZGKA 1DZQA 4FOYA 1KDMA 1GZCA 5GALA 3UL2A 4H55A 3WCRA 2H0BA 2AR6A 2ERFA 2A3XA 5IK7A 3RMXA 1G9BA 1F31A 3SITA 4YM0A 3AZWA 4D69A 1DIWA 3MEPA 1HKDA 1QDCA 1ENRA 1QF3A 3PVOA 3WVJA 1KRIA 1JUIA 3UK9A 1N1TA 1R1ZA 2RHPA 2YXSA 3WHTA 4XBQA 2JE9A 3ZYRA 4SLIA 1OQ1A 3U4XA 1LU1A 3LSEA 5CA6A 1OFSA 4YW4A 2Q5TA 2WT1A 5JOYA 1HLCA 3SH4A 3ZPYA 1YO8A 3R05A 1BZWA 5H9PA 1GLHA 1N3PA 5H9QA 1ULEA 1LOCA 1IS5A 3KM5A 2A5ZA 5SV8A 1N3QA 1ULGA 5E88A 2GN3A 2ZGSA 2ZGRA 3JU9A 3FUQA 1G9FA 3VKLA 3NV2A 5JLVA 1XQNA 5HCFA 5F5QA 1AX1A 1F9KA 2FHRA 2KM2A 3M2MA 5BYNA 2R49A 1GZWB 1LHUA 3LSDA 2PHRA 2CYFA 1ENQA 4LBQB 3M3CA 5KXBA 4Y1YA 4FQ4A 2ZGUA 2ZMKA 4FOQA 2P34A 4DFSA 3USUA 3AK0A 4JC1A 1AXYA 3M1HA 1LESA 4M3CA 3WG3A 2W08A 4FPFA 1NXD1 4DS0A 5HCBA 4WVVA 3C2UA 4CZSA 4R9CA 5IK4A 4XMIA 2E53A 3NV1A 2AGSA 3ZSMA 3CNAA 4PQ9A 2GMPA 1LOFC 5GZGA 3RRDA 4IQPA 1A78A 3QCWA 1N47A 2D43A 4XJ9A 1AF9A 2GMEA 4K1YA 3WZ1A 1S0BA 2VW0A 3HN1A 3A0NA 1Y7BA 2P2KA 4DRVA 2PHWA 2WQZC 2EIGA 2LALA 4YM1A 3NV3A 3OBTA 4AGVA 3RG0A 4DPNA 1YRZA 4LBOA 2ZBJA 2EXIA 3IN9A 3ZSKA 3ZSJA 4XJAA 5E89A 4Y26A 2R16A 3RMYA 5KXEA 5KXDA 5DUUA 4LBMA 3SH5A 1LU2A 1WLWA 2YZ4A 3O0VA 4FPCA 3SH3A 3FBYA 4YLZA 3ILNA 3T2TA 2NZ9A 1QNWA 4Y1XA 2E6VA 3POSA 1VIWB 1PZ9A 3ILFA 2E7QA 2TEPA 2A71A 2A6VA 3AXEA 2YV8A 4UW5A 3RSJA 1X50A 1LECA 2D6OX 2VXRA 4AGRA 4Z8BA 1W6QA 2JDZA 2D3RA 1MS9A 2OVUA 1A3KA 2WT2A 4ISRA 3ZXLA 1DQ0A 5GZDA 3D4KA 4XJ8A 1DGLA 5GM0A 2V73A 2D3PA 4XTMA 5H9SA 1PZ8A 4Q8KA 3POWA 4XILA 4DRRA 3V0BA 2GNBA 4LBNA 3AFKA 3I8TA 1GYKA 4RL7A 4XBLA 2UURA 3WDUA 4YG3A 1O4YA 3ENRA 4RA0A 2ZGPA 1AXZA 1J1TA 1BJQA 1FV2A 4LBKA 2FMDA 4YZ5A 4YGBA 2XG3A 1DQ6A 3N36A 4P14A 3MW4A 3AP5A 1S1AA 3VUOA 4R9BA 4YZ2A 4FPKA 4XMAA 4Y1UA 4YGEA 3WDXA 2ZHNA 1DQ1A 3HMYA 1SLAA 3B3QE 2UWBA 3T1LA 3USUB 3VKFC 1V6IA 4AVSA 5JMCA 1V00A 1SBEA 1W6PA 2C9AA 3A0KA 3FLRA 4Q8LA 3WHUA 1MR5A 2WKKA 1LHWA 4M3CB 2ARXA 3GNEA 1FX5A 2R0FA 1MS0A 5CB7A 3OY8A 1MS1A 2CWSA 5EYXA 4XDQA 3H0OA 3VKNA 1GANA 1D0HA 4FOVA 4FP2A 4ZKTB 2ES3A 1GBGA 1RITA 1WLDA 2SBAA 3ASIA 2PHFA 3M3EA 3BIWE 3RQ0A 2YY1A 4XHXA 4XYXA 3QLQA 2GMMA 4Y24A 1MVEA 4ITCA 3FLPA 4P9YA 1WBFA 3PVNA 2DUOA 3APBA 4LBLA 5KXCA 4BM8A 2ZHLA 2W68A 1C1FA 4XTPA 2VUAA 1O4ZA 2NM1A 5GLVA 1LEDA 1MS8A 2EF6A 4C1WA 2A6WA 3OYWA 3INAA 4JCKA 1Q8SA 1BQPA 1G7YA 2WSUA 3AX4A 1S0FA 2ARBA 4ASMB 1AJOA 1OKQA 1IS4A 1VALA 1LODA 5LK5A 1IKQA 1QGLA 1S0DA 4TZDA 3IMNA 3WLUA 1BKZA 1WW7A 4GWNA 1JW6A 1N1SA 2GNMA 3WV6A 4YM3A 2A6XA 1GV9A 1N3OA 1LGBA 4LBQD 4XIKA 4XJWA 1S0IA 4PBOA 1FNZA 1LTEA 2D7FA 1DQ4A 1SLLA 1CQ9A 1WW4A 5CAZA 1UZZA 1UN1A 2A3YA 2A75A 1MACA 2W52A 2NYYA 2P3KA 1MS3A 1QOTA 5E8AA 2WSVA 1W6MA 1LENA 2XB6C 1W6QB 2ZGTA 3ZXFA 2ZZJA 4PBPA 4YG0A 1LGNA 1D2SA 4YW1A 2PHUA 3V65A 2GN7A 3V0BB 3AZXA 2NMOA 3GALA 2JE7A 1HQLA 4K20A 1WD3A 4WV8A 1Q8VA 2DTYA 2DTWA 1MS4A 2P3IA 2ZHMA 3N7KA 4U2AA 1IS6A 1AXKA 1LCLA 1FAYA 3IPVA 3T1MA 3Q9OA 3VV1A 4FPEA 1KJRA 1BXHA 1SBDA 1Z0HA 4GALA 1IOAA 4YW5A 1EPWA 1W6NA 2DU0A 5GLUA 4DQAA 1UPSA 1G8WA 1JXNA 1JYCA 1W0PA 1WUVA 1LOBA 2ZHKA 1RINA 2CNAA 2EALA 2D6MA 4Q1PA 4UW3A 2JKBA 1UKGA 1QDOA 1JN2P 1CVNA 3OJBA 2DUPA 2DVDA 2D6KA 3N7JA 3WUDA 2ZGQA 4BMEA 1LGCA 1C57A 5JDBA 2ZABA 1W6PB 4M00A 1ENSA 2R0HA 1DFQA 2A70A 3AYCA 4XBNA 1KQRA 4P9XA 2Z42A 5T5LA 2EXHA 4GWMA 4UW6A 2B7YA 3MPPG 5DZGA 5GZFA 3AP9A 2DVFA 1PZ7A 2R1DA 3OY8B 4Y20A 1DLLA 3B01A 1SFYA 3AP6A 1QOSA 2YMZA 5GLWA 1G9AA 4XXAA 2GALA 5DUWA 1LOAA 1AJKA 1DBNA 2OW4A 3AJZA 3M3OA 3AZZA 4ISQA 1AVBA 4Y1VA 2AREA 2JECA 2ZMLA 4P9WA 3AYDA 2ZGNA 1SLIA 1URXA 3ZXJA 3ATGA 1KJLA 2OUHA 3L2YA 1CJPA 1Q56A 1FYUA 2CY6A 3WG1A 4BOWA 1YI7A 3WDYA 1VAMA 3OYWB 3AXDA 1N1YA 1FATA 3ZYPA 1LOFA 5DUVA 4FPJA 3LCPA 1C1LA 4HL0A 2DUQA 1WD4A 4ATEA 4YGCA 2GNTA 3IM0A 3ZVXA 1GKBA 2ZMNA 1MZ6A 2EXKA 4GKXA 1JHNA 2LTNA 1SCSA 1FNYA 3R4UA 3RS6A 2JJ6A 1MS5A 2UWAA 3FUOA 5GLTA 1I1EA 1IS3A 4GKYA 3W59A 3N7LA 3MW2A 1W6OA 3B00A 1A8DA 4BLIA 4XOGA 3WG4A 1C4RA 4XJZA 2A7AA 2DURA 1LOEA 2JD4A 1HQWA 5IT6A 4U36A 2DVBA 3KQRA 3UJQA 4R9DA 4AYUA 5EXOA 3N7MA 2AYHA 2ZGLA 3ILRA 5T5JA 1S0GA 1CIWA 2A6YA 2NMNA 2GDFA 3MW3A 1APNA 5JOZA 1GSLA 3AP4A 4BMBA 3IPVB 4YFZA 2ZKNA 1WW5A 2D6PA 2UU8A 1UZYA 4YW2A 1W6NB 2PELA 4YGDA 3ZXEA 1LHOA 3OGGA 1H30A 2VU9A 5EYYA 5IUQA 2P3JA 4XXPA 2NP0A 4WZFA 1DYKA 2D6NA 3POYA 4M3CE 1LHNA 1LEMA 1YYNA 4FPYA 2GNDA 4FPGA 2AH2A 4AWDA 5T55A 3SNMA 2PHTA 1U0AA 5DG1A 4K21A 2YROA 2PHXA 3O0WA 4PCRA 5JOXA 1YIFA 3N35A 1CPMA 1V6NA 1IKPA 1UAIA 1WCSA 3HR9A 2VW1A 1S0JA 4Y20B 3WDWA 1UMZA 4R9AA 3R4SA 4XZPA 1SLTA 4ZXKA 4FP3A 1NLSA 3SISA 3NWKA 3WDVA 2NN8A 4BLJA 2EXJA 3AZYA 1V6OA 3NV4A 1S0CA 1Z78A 1QMJA 4FPLA 3V0AA 1GNZA 1UX6A 1DYPA 3AYEA 4BPZA 1BYHA 5T54A 5CBLA 2EAKA 3BTAA 4JRAA 4Q1RA 5JVVA 2P37A 1UL9A 3VKOA 3ZXKA 1SCRA 1AZDA 1S0EA 1LOGA 1ULFA 3JUUA 4CTEA 2AENA 1QNYA 1G86A 4FQZA 1LHVA 2ENRA 2DU1A 3PMEA 2AUYA 3O12A 1H9WA 2HYKA 4Y22A 3FFZA 2ZGOA 3BOPA 2DVGA 1LULA 1WBLA 5DZEA 1V6LA 2G4IA 3AZVA 3O5SA 3PJQA 2CTVA 1W6OB 3A4UA 3B69A 4I30A 3W58A 1DQ5A 5DUXA 5T5OA 2R1BA 1SLCA 1Q8PA 1SBFA 5DG2A 5HCAA 4FOWA 1H9PA 4NOTA 1WLCA 1AX2A 3B9CA 4YW3A 4AVVA 5FREA 4F83A 4UW4A 4FPHA 4YG6A 5GLZA 3DUIA 1WW6A 4BQ1A 5T52A 1N1VA 3I4IA 1ZM1A 1ONAA 1VAVA 1HDKA 1DQ2A 1JOJA 3O0XA 4XJUA 5IK8A 1KDKA 4LBJA 1GICA 2A3WA 2DV9A 3WNXA 1RIRA 1G9DA 4CRQA 3TB0A 3OBRA 4Y1ZA 2OUJA 3PVEA 1QKQA 2D44A 1W0OA 2ZACA 4XE9A 2VY0A 5DXDA 5GZCA 5FRAA 3AJYA 4MYEA 2ZAAA 4TYSA 2UWCA 1B09A 1V6JA 5L73A 1MVQA 4NO4A 4FPOB 4GA9A 1I3HA 3UJOA 2WJSA 4YZ1A 1SACA 1Q8QA 2E7TA 4YFWA 4YZ3A 4HANA 2ZA9A 4Q26A 4K1ZA 1LJ7A 4OZXA 5H9RA 4YZ4A 5T50A 3N3HA 4ATFA 3BODA 1G9CA 2ZGMA 4FVVA 3AYAA 1DHKB 2D6LX 2VH9A 4YM2A 4XIOA 1V6MA 2C5DA 4GXLA 1AX0A 1GZWA 4LBQA 3FLTA 3WOGA 1GZ9A 3V64A 4C1XA 1CESA 1QOOA 4PF5A 3DGTA 2CWMA 4M3CF 5EWSA 3V0AB 4Q2FA 3M3QA 2D3SA 2DYCA 3AP7A 1KITA 3IKWA 4KBBA 1Q8OA 5F9TA 2WNEA 4AVTA 1W6MB
chains in the Genus database with same CATH superfamily
3D6EA 3OBZA 1QJU1 1V9U3 3GYDA 2A6ZA 4XAAA 2JD9A 5CKQA 4AEMA 1ZA4A 2E51A 1VLNA 2Y60A 3DPRC 4L8QA 1XU1A 4NIIA 4BK5A 5CNAA 1RUH2 2CL2A 4WVWA 5BNOC 1ULCA 4JAAA 4BXFA 5T5PA 1YUDA 2V5YA 2GSYA 2RS52 3GXUA 2Y6KA 3PUHA 1FPN2 5LATA 5IK5A 5FOJB 1GNHA 5CFDB 4P9JA 5DAXA 1QU0A 3BN6A 2SLIA 5DZFA 2FQPA 1JHJA 2ZGKA 4FOYA 4Q27A 4CCDA 4D6QA 2ZPXA 4QQ2A 4KU8A 4QB1A 1CX1A 4CVUA 3WCRA 2H0BA 4EV0A 2WO7A 4F7ZA 2WNUB 2CAVA 4NIGA 1I9RA 4CEYB 4GMP0 2R073 1SFNA 3MEPA 4KWUA 1QDCA 4IL7A 2AC1A 3PVOA 3VB9A 4CDQC 4QXHA 2ORZA 4XFIA 4G3YC 3VBHA 1N1TA 3WHTA 3ORJA 1UO9A 1K5MC 4SLIA 5I0DA 2O8OA 1PMHX 5ACA2 1OFSA 5AC92 4YW4A 5CA6A 2EIDA 2F6BA 2XUEA 3JQXA 4I3PA 3ZPYA 2B46X 3WP5A 3ZOIA 3R05A 1N3PA 5H9QA 1O91A 1IQAA 3I2OA 3OPTA 3WNNA 1PVC2 1G9FA 1XNCA 3LDKA 1RUF1 3VKLA 2VNGA 3ECQA 4NHYA 1W2UA 2FHRA 2KM2A 5FPVA 4DUXA 2PHRA 2CYFA 2WRAA 4A7YA 1H4GA 2XKPA 4PIYA 1YJKA 2VQAA 4ASLA 4NHXA 4FQ4A 1GQGA 3MZHA 2XUMA 1PGL2 4LK6A 1UKRA 4DXRA 3QBQA 4DFSA 1BMV2 2VM9A 1YWKA 5DQ0A 4C91A 5LW9A 3M3IA 4MG2A 3U07A 4A44A 3DXTA 5ABJB 1LESA 1JZ6A 2GC1A 2NLRA 2W08A 2HWB2 1NE4A 3B7MA 2XBO2 3C2UA 1IG0A 4CP0A 3LIGA 3G7DA 3OUJA 2VUCA 5DMYA 5IK4A 4XMIA 2RR12 4AEDC 1XYOA 3OBAA 3CNAA 4M0NA 4JVAA 4PQ9A 4R4XA 3THCA 4ZONA 2BV4A 3RZGA 1GOHA 1W03A 1N47A 4Z1VA 4N43A 1QJU3 4JGZA 5DAPA 4BWOA 2LM3A 1UOBA 3HN1A 4NPMA 2P2KA 2ZEXA 3M70A 4QGLA 2WNVC 2VZOA 3C3VA 4DRVA 2WQZC 2WS91 5A33B 2EIGA 3WF3A 3LQCA 3NV3A 1YEWA 1S2BA 2YU2A 2VQUA 3JBG2 3RG0A 2RV9A 3ME2A 1RUG2 1H2KA 1KS4A 1YHFA 2JB4A 2Q1ZB 3KZ4C 3CLPA 3K48A 3MIGA 1D4M2 5FYYA 4XJAA 3MIDA 4CXYA 3RMYA 2XH6A 5KXDA 5F2SA 2J1EA 1LU2A 1T2XA 1AYM3 3OCPA 1ZBE1 4URTA 2W1WA 3T2TA 1PM4A 2VCCA 3RI8A 1VIWB 4LKEA 4B4RA 5FOBB 3NMBA 1OFNA 1JZ7A 1JZ8A 4PLMA 2A6VA 3Q8BA 4EWAA 2V72A 4EZ4A 1GP5A 3AXEA 2WYSA 1SG3A 4Z82A 3RSJA 3J7HA 3TN92 1LECA 4Z8BA 2VXRA 2Z79A 3HNYM 1W6QA 3OB8A 4QHBA 4QU2A 1NT0A 2HH9A 1MS9A 2OVUA 2IXKA 2R32A 3U11A 5C6CA 1DQ0A 2VVFA 5GZDA 3VDDC 5IAVA 2W5FA 3A7QA 3NVCA 4COZA 4RS5C 3EMRA 4XILA 5FZHA 4P9LA 1IG3A 5D8AB 5DAQA 3AFKA 1JOBA 3AM2A 4XBLA 1AR71 3ROUA 3E6BA 5LBBA 4META 3WDUA 1O4YA 3MHZA 4RA0A 2Z2SB 1ZRIA 2FDKA 2VULA 1J1TA 1H1IA 2WZR1 4YZ5A 4CCCA 4QQPA 1UW8A 2C26A 2V5DA 2R061 3PTYA 4F8AA 4NHKA 5FLHA 5KWRA 4CDXC 1KGYA 3U78A 3NSTA 4NR1A 2RS12 2MPFA 1RUF3 4Y1UA 4I01A 3WDXA 5L9VA 5LRSA 2ZHNA 5FZIA 3IDAA 5G05L 3B3QE 2UWBA 5FZBA 3USUB 1UYPA 4XCBA 2XQRA 3ALQA 5I93A 1SBEA 3T30A 4Q8LA 1LHWA 3H3UA 3KHBA 3GNEA 4DO0A 1RUJ2 2WINB 3I49A 2I74A 5JMOA 2VZPA 1MS0A 2BVVA 1MS1A 4ZS3A 4HXCA 1ACCA 3UKVA 4GWJA 1UU4A 3FWEA 5FCCA 2XLAA 3VKNA 3U75A 2HLEA 4FP2A 1HQNA 1RUC1 1GBGA 1I5ZA 1RITA 2ES3A 3ASIA 2PHFA 3ES4A 3BIWE 5FZFA 5FXXA 2FZ1A 4XYXA 4Y24A 5CISA 4WM8B 1XB9A 4P9YA 2DUOA 3APBA 4QD2A 4BM8A 2ZHLA 4OMDA 2RJLA 2W68A 3WW3A 2IUWA 4N53B 1MS8A 1CAXB 3SHRA 3KD4A 2K2SA 5K7PA 1F4HA 1NQJA 1YC61 3JB8A 3ETPA 3INAA 2PLV1 3Q8EA 4LPLA 2YUEA 2W46A 3ZFFA 1G7YA 5IVVA 2MEV1 1S0FA 4UFLA 5CKMA 2DCKA 4ASMB 2CGPA 1OKQA 1VALA 1M06G 1LODA 4HVQA 1ND3A 5LK5A 1QGLA 2WFF2 3UGHA 5F6LB 5FPLA 1BKZA 5J1XA 1WW7A 1N1SA 4CE8A 5C3QA 4HVOA 3ZDVA 5FYSA 2VG9A 1D7PM 2VZRA 1H4HA 1RHI2 4WZCA 1ZX5A 2J7MA 1LTEA 3PURA 1AHSA 2VZSA 1DQ4A 3PDQA 1CQ9A 2WR9A 4IGOA 4MH0E 3UNPA 4K40A 1MACA 3I3DA 4TN7A 2P3KA 1MS3A 2XJSA 2WSVA 3CIHA 1UIKA 3VBSC 1YQ6A 2JB8A 1MQTB 2WWSA 2E9QA 2ZGTA 4JRLA 4LHKA 3ZXFA 3EQEA 4MUVA 3V65A 1LGNA 1RL3A 1ZA7A 3GALA 1HQLA 1R082 1Q8VA 1HV0A 5JI7A 1TMF2 4PI0A 3VHPA 3RZKA 4Q0VA 2W87A 2ZHMA 4U2AA 2PHDA 1IS6A 1LCLA 1US2A 3I2GA 3BU7A 3IT8A 3Q9OA 4MSVA 3JD71 3K3OA 1DZRA 4DQAA 2JG9A 5FZKA 1WUVA 5FPBA 1XSRA 2ZHKA 1RUD2 2JG8C 1X9PA 2WL1A 1J3PA 1QDOA 1JN2P 4URAA 2BEOA 1L7QA 2DUPA 2R063 3N7JA 4LE3A 5LBEA 2ZGQA 1HW5A 1HJGA 4BMEA 2K0GA 4ET7A 2HWD1 2OPKA 3BOWA 4XBNA 4FO9A 2W95A 4GH4A 2B7YA 5JSRA 2JX9A 5JI9A 1PZ7A 5C9AB 4MOAA 4BXSV 2Q8CA 2YMZA 1D0GA 2X10A 3EO6A 4MGIE 4XXAA 5AFBA 1AJKA 4HZFA 1YIPA 3RJRA 4AEKA 1OPOA 1W9TA 1H8VA 3ITQA 3WT3A 4HOOA 1WMXA 2AREA 2HYXA 3DN7A 3IB3A 4P9WA 2P3YA 2KXLA 4AHXA 5IFPA 4LQRA 2CY6A 1ND2C 4BOWA 3WDYA 4IETA 2RDSA 4QX7A 3BKZA 3QH7A 1N1YA 3PMSA 4IGQA 2XOMA 3BALA 4BQ2A 1C1LA 3ACIA 5F7UA 2GNTA 2XL7A 3D82A 4A3ZA 1O3QA 1GKBA 4DIQA 1MZ6A 1BBT3 4UOJA 2LTNA 2PLV3 3KT1A 3R4UA 1PO21 4N9IA 4X8PA 5K8SA 3RS6A 1H8TB 3TNQA 3ACFA 1YLLA 5IATA 2G19A 2Q8EA 3AMQA 4O7XA 5A3OA 4XUQA 5B2GB 3BB6A 1NA1A 5LA2A 3B00A 1PK6B 5FP7A 4GWIA 4ASKA 3WG4A 5IFTA 1C4RA 1VRBA 4I0WB 4KMQA 3RYPA 4QKBA 3CQOA 1HQWA 3VBRB 5APAA 5IT6A 2ARAA 1YFXA 1AYN2 2X53S 3UJQA 4AYUA 2DFCA 1NCQC 5IWFA 2ZGLA 4JZRA 5JXHA 3PUAA 3ILRA 4HBNA 2Q8OA 3MF9A 3ZFEC 5KHIA 4UF0B 1UMHA 4UFHA 3THPA 4XFCA 3VD7A 2QBXA 1U5IA 3BCWA 2BGPA 3BIEA 1DG6A 3I59B 1O3SA 1POQA 4XPVA 1WW5A 4AG4A 5LY2A 5FO9B 1NZIA 1VAKA 3NNMA 3VHRA 1W6NB 3K51A 3KGLA 4XC9A 5IVBA 1H30A 2BZDA 2ET1A 1CIYA 5FR3A 4KWJA 3IDEA 2P3JA 3CF6E 4Q0PA 4NIDA 3U10A 4X8NA 3BTXA 3JD73 5LRRA 2WN3A 4DEQA 3VHNA 5A3NA 5C33A 1OLQA 2AACA 1AR81 2AH2A 4CCEA 3LPGA 5DG1A 1U0AA 4K21A 1QJZA 2YROA 3HNMA 5FAXA 3ACGA 2PHXA 2ET7A 3O0WA 3ZFGC 4O9GA 3N35A 4IV1A 1RUE2 2ZJCA 1UAIA 4UFKA 1J59A 1AL22 2HWF2 5C3PA 4R9AA 3O1UA 2HWD3 4LKSA 5FZ3A 3NAPB 1SLTA 3SISA 3NWKA 4LKDA 5JPMB 1AR92 5F3CA 2VR4A 3AZYA 1VJ2A 1V6OA 4RR3C 1TE1B 3NV4A 4UBHA 1QJX2 1D4VB 3GDBA 1QMJA 4BDVB 5ACA1 2X5IC 1GNZA 3CBNA 4QXCA 2JG9C 5HXMA 4EN7B 4HKOA 1R64A 5T54A 2OQ7A 5BNPA 4Q1RA 3HJRA 3HWJA 4JRAA 4LO6B 4V1PA 4YW7A 5JVVA 1SCRA 1W9SA 3HBZA 1ZZBA 3MV11 4D94A 1S0EA 3WP6A 4CXXA 4CPBA 1QNYA 4NHLA 3KV4A 1FMD3 2DU1A 4Q4V2 2AUYA 1VBB2 4YPJA 1RUH1 1VBC2 2HYKA 5KC5A 3FN9A 3AMHA 1UY0A 2VMFA 4IE4A 2RS51 3WQ7A 1LNSA 1FPN1 3SQOA 3E5UA 4QDQA 1H0BA 1V6LA 4V2WA 2LS6A 3PJQA 2FZ2A 2XMLA 4I30A 5CFDA 1DQ5A 4KH9A 2CGNA 3C8XA 1WGPA 1K42A 2J1RA 2C0ZA 5ANNA 1PO23 5FWJA 5T5OA 1QXPA 1SLCA 1NX9A 5DG2A 4CP2A 4EWEA 1UOFA 4XQDA 2KD7A 2WNUA 3H3LA 3WXPA 4AVVA 3O1TA 3DECA 4JKLA 4CEYA 2WIIB 4CDWB 1N1VA 3I4IA 5BY5A 1ZM1A 4XVHA 1DQ2A 1X82A 2ZAHA 3LE0A 4QPGC 2DV9A 5AC91 3J7LA 4AL9A 1NG0A 3TB0A 5LA0A 2BUKA 2RS33 2OUJA 1H2MA 3DYOA 4E2QA 3BTZA 5IVJA 2ZACA 5DXDA 5LCWL 5FRAA 3BI3A 3AJYA 3IZOA 3QOPA 4MYEA 1O5LA 1PO12 4NAOA 4TYSA 3MLKA 3K46A 4L0PA 1MVQA 3WY6A 4GA9A 3H8RA 4D8MA 1PVC1 3PNAA 2WJSA 1Q8QA 5BNNC 4YZ3A 3AKPA 1G9CA 1C8M3 3BODA 2ZGMA 1Q3EA 1HIXA 4GMP1 2C5DA 1AR83 3ZYJB 3FLTA 1PGL1 4BQ3A 1UXXX 3HAGA 1BMV1 1XE8A 4NRMA 4P08A 4MHUA 5JUVA 2R042 4IEVA 2W1QA 3PIGA 2MHFA 3CJIC 5EWSA 2HWB1 2KA3A 3PHMA 1OOPB 5J48A 3V56A 5ABJA 2G9ZA 2HEVF 3WR0A 4BQ5A 1KITA 4OUSA 1MZEA 4NN0A 3IKWA 1EV12 2OS2A 2RR11 2AZ5A 1HDKA 3O0XA 3PU3A 3OPWA 1YQ2A 4OYUA 4PI2A 5C8CC 1F5FA 3ZSLA 5ACA3 5A3PA 2J22A 1SLBA 1WKYA 1FV3A 3NNJA 2FCVA 3AMPA 3ZIWA 1CR7A 3MIEA 3OGVA 4LOTA 3KV5A 4DOUA 3VKMA 3LDBA 2I45A 4W65A 5FY4A 2OZ6A 4V2VA 3IAPA 4LXLA 1JBCA 1YXWA 2IWGB 2W39A 5T3NA 4MGTA 3B5LB 1X7NA 3JBG1 3QACA 4RN5A 4QM8A 3WQ0A 5I91A 1RUH3 4CCLA 1RUG1 4WBBA 2VOTA 4S2GA 4DXTA 1D4M1 1AR62 5FYBA 2B4KA 5JOWA 2I2SA 2WT0A 2RS53 3DF0A 4XHBA 5AVAA 1FPN3 3BYWA 3ACLA 3E1F1 4H55A 1NLRA 2A3XA 1OA2A 4KQ7A 4LUKA 2LUWA 3NJXA 3O1PA 1IGOA 4PF1A 3SITA 3AZWA 2QQVA 4D69A 4CDUB 1DIWA 4FFGA 3FHIB 4BHPA 5L7OC 3O1RA 1ENRA 1QF3A 3RZJA 1W8TA 3I54A 3WVJA 4KWLA 1Z7S2 2AEZA 2RHPA 1R1ZA 1E5IA 2WYFA 2WA4A 3TN91 2JE9A 1OF4A 3EHKA 4AXOA 3CL1A 4QX2A 4KBZA 2D93A 4AAXA 1GQHA 2GP3A 2ZS6B 4CEWB 3UGFA 1UMIA 2C6SA 2D97A 4QKNA 1BZWA 2G1MA 1GLHA 3CEWA 3I2JA 3W5MA 1WCKA 4O9EA 1LOCA 5D8AA 2A5ZA 1GWLA 3KVBA 2YC0A 1MEC2 5SV8A 4B1LA 2FBEA 5FKBA 1P8JA 3JU9A 1K5JA 2XHKA 5D21A 5ANQA 5C4WB 3U0ZA 3FUQA 1C28A 5FDBA 2WNUC 5BXXA 1JOPA 3DYPA 2PN5A 5HCFA 5JLVA 1PVC3 5FY7A 4IERA 4CEYC 3VDBA 4YVSC 3H7YA 2RS11 5F1RA 3J4UH 1GZWB 3LSDA 1ENQA 3M3CA 1WLTA 3WQ1A 1F5JA 4EJRA 5CZKA 2CHHA 4Q0SA 4C0BA 1X33A 3D0SA 4J25A 2LROA 5FO8B 3W20A 2QVSB 5LEJA 4L99A 5F2WA 3USUA 1F2NA 1AXYA 1UF2C 2WZEA 1DYOA 2Z69A 3KS7A 1BK1A 1F15A 3FBMA 4LHSA 3RZMA 3SCGA 3ZX7A 5HCBA 1XNBA 2YBPA 1WZXA 4CZSA 1JMUB 3POGA 4WM7C 2E53A 4Y4RA 2P1BA 2XPJA 2EICA 4QPIB 1WA4A 4KI5M 5F6KA 5FLJA 3VBFB 4IQPA 1JYVA 2PAEA 2RR13 3QCWA 1NZCA 1AF9A 4OUMA 4WM8A 3WZ1A 4LIVA 5FXVA 3A0NA 2XHNA 3OGJA 4IEOA 4IDZA 3TWIA 2PHWA 3VD9A 3UV9A 1VBA2 3KGZA 4N53A 2E31A 3DCQA 4A6SA 4FTBA 1CAXA 3OBTA 4UBGA 4XUNA 4DPNA 5EQUA 5A7NA 2ZBJA 2EXIA 3Q8CA 5FZOB 3ZSKA 3ZSJA 2IZWA 5E89A 2GC2A 1NY72 4Y26A 5ABJC 5KXEA 5DUUA 4LBMA 3JZVA 4K3UA 5J96B 1DGWA 1ST8A 5CG9A 1D4M3 4AHYA 3GZAA 4YLZA 3ILNA 5FY8A 2NZ9A 1QNWA 3TYJA 3K4AA 3FMGA 1RHI1 2JKXA 2VTXA 4WVMB 1VP6A 4Y1XA 5HXVA 2GH8A 3VGIA 5FMDA 2QJVA 4S2DA 2ZX3A 3IDBB 2HKXA 4QHZA 4Q0UA 5F39A 2F17A 5FQ0B 4IEZA 4ZU5A 5C5TA 2HBUA 3S57A 5K0UC 2DFBA 4GJYA 4INDA 4MO3M 4RGAA 4OQ9A 5FPUA 3LA2A 2D6OX 2R30A 3RVHA 2JDZA 2CSGA 1MQTA 1R081 2D3RA 3E5QA 4DY5A 1A3KA 2KR2A 4QM9A 1TMF1 4XF3A 2EA7A 3D4KA 4W4ZA 4XJ8A 3TN93 3MYXA 2D3PA 5JCTA 5FYVA 3WNLA 4AI8A 1YFWA 2GNBA 3WQBA 1COV2 4LBNA 3KT4A 3I8TA 1GYKA 1QH7A 1UPIA 4RL7A 2WC2A 3THTA 4EN6B 4Q4X2 4EYUA 3TEWA 4GB32 4OHVA 3ENRA 3USSA 3WNPA 3RZLA 4BQYA 4LBKA 3T4HB 2FD8A 3T2PA 3GGLA 5AFEA 2VBBA 4XF0A 2XLFA 1RUD1 3BGAA 4JGYB 4YGBA 5D2AA 3N36A 1K3IA 3K75B 1SPPB 1Y9GA 3EJKA 1W28A 4XMAA 2OX0A 4OI4A 4RQPC 2ZEZA 2P6HA 3T1LA 1SLAA 3VKFC 4NPRA 2PA7A 2TBVA 2RS13 1V6IA 2D5HA 2JWPA 3NNLA 2C9AA 4OCTA 4P00B 3WHUA 4AFCA 4AQTA 1ALYA 4JV4A 5JZGC 4M3CB 1XRUA 2RM21 1FX5A 1UY2A 1QJY2 3ZM8A 1ZBA2 2R0FA 2DCYA 5CB7A 5C9AA 3S7EA 5EYXA 3OTFA 3FHAA 3H0OA 5CADA 1U5ZA 3PU8A 3KF5A 5C70A 3P1IA 4PDWB 4AAPA 4D7TA 1RMU2 4KG8A 4ITCA 4PIZA 2Y6JA 3PVNA 5KXCA 4LO7A 3FE5A 1C1FA 1W2OA 2Q30A 3CZUA 1O4ZA 1DF0A 3DYMA 5GLVA 1LEDA 2EF6A 3BU0A 3RJ2X 1VRH2 2L9LA 4JCKA 4C1WA 4IEWA 4Y3OA 2H6BA 1BCXA 1W3VA 3AX4A 3FZ3A 3J8F2 4EWDA 4AVAA 4K8FA 3RYKA 3M8LA 5DDJ2 5J98B 4JHTA 4JKKA 2RMU2 4OI1A 1H8TA 2XJPA 4LUMA 5F3EA 1JW6A 3UYJA 4ONUA 2AEYA 4ORFA 4YM3A 4XFFA 3VZJA 1S0IA 5CU1A 1PK6A 3LOIA 4AK3A 3H9AA 4X6RB 1HRV2 1SLLA 1WW4A 3B02A 3WV6A 2A75A 1PIV2 5E8AA 2EIEA 2W52A 1WWYA 4RHV2 1Y4WA 5FZ1A 3VBRA 1RUOA 5HV0A 4YVWC 4D0QA 2ZZJA 5E1RA 4PBPA 2D40A 1RVF2 2WLPA 1D2SA 3DXUA 5F37A 3AZXA 3S5QA 3V0BB 2JE7A 3N9QA 1WD3A 1T6BX 4WV8A 4MXVA 4UF0A 2DTWA 5LA1A 2OT7A 1MS4A 3AKTA 4QAWA 1POV0 1R083 3LA3A 5JXIA 4IV3B 4XDPA 1FAYA 5IAXA 1TMF3 3I59A 4AZZA 3FX3A 4FPEA 1KJRA 1BXHA 1Z0HA 5M0TA 1IOAA 1B35B 1X8EA 1SQ4A 1GUIA 1W6NA 2DU0A 4TTGA 1UPSA 4DUVA 1JYCA 2JDNA 3TEYA 2VMHA 1JU4A 3U4SA 4Q1PA 4UW3A 2JKBA 4LEJA 5I8TA 1DGWX 1DLCA 2OQ6A 4GZ9A 3VDAA 1RUD3 1VBD2 3JCIA 4AW7A 4QB2A 2ZABA 4M00A 1T6GC 1UOJA 3GJAA 5LASA 1ENSA 2JDYA 5A6YA 5CFCC 4YWAA 2YC2A 4A7KA 1KQRA 1MQTC 3IBMA 1AL21 2HWF1 4ZHNA 5T5LA 3VZMA 4GWMA 4SBVA 4UW6A 1S2KA 4DXZA 1V0AA 3MPPG 4IE7A 5HBAA 2DVFA 3CZJA 2HJIA 2R1DA 3OY8B 1AR91 4NWWA 3B01A 4FXKB 4NWVA 1QOSA 3NAPA 1G9AA 5DUWA 1QJX1 2RM23 1DBNA 3AJZA 2XONA 3HVDA 4XAEA 3KVAA 3VBUB 4S2HA 2FMYA 1NCRB 2ZGNA 1URXA 1KJLA 2OUHA 1Q5OA 4LE4A 1CJPA 4TXWA 3WG1A 3WW2A 2YG0A 1IPSA 1W8HA 3OEBA 5AVPA 4BB3A 3RPQA 4Q4V1 5FYZA 1VBB1 3SCFA 3AXDA 1XNTA 4CU7A 3ZYPA 1LOFA 5DUVA 3BPSA 2WAOA 3LEMA 3LCPA 3OEAA 5CVRA 1H1MA 1WD4A 3I2HA 3RI9A 2WO1A 3DPRB 3NJZA 1C3HA 3ZVXA 3VD3A 4DZGA 4I3GA 1VR3A 2BNNA 5A7WB 2EXKA 5BNOB 1JHNA 2C4XA 2A1XA 3J7MA 1W9WA 2E32A 2J1UA 4FBFA 2JJ6A 1MS5A 2QDNA 2UWAA 3PUSA 2E33A 5FZMA 1IS3A 2HBTA 3W59A 3N7LA 3X29B 3AVRA 3ZLIA 1A8DA 3PTRB 3FJSA 4NROA 3KSCA 3VBHC 1SZBA 4XJZA 4KGQA 5FK7A 3ZN4A 2VQTA 4I02A 3VHOA 5FTTC 1KXGA 1OT5A 4U36A 2DVBA 3N7MA 1YI9A 3WW4A 4CA9A 4PLOA 3MPBA 5T5JA 3OF1A 4CDQB 2A6YA 4PJYA 2NMNA 4CDWA 4LJHA 4BMBA 1IPJA 1K5MB 5KBFA 1NAEA 3IPVB 4CCMA 3TEXA 2UU8A 1UZYA 4L97A 3UKTA 3ZMNA 5IW0A 1PO11 3OSDA 2JEMA 4YW2A 2PELA 3ZXEA 1LHOA 3CDZB 3PJYA 5EYYA 2BNMA 4GD4A 4JX0A 5IUQA 1X36A 4AI9A 2YGLA 4XXPA 4RYDA 1LAJA 2VMGA 1LEMA 1YYNA 4FPYA 2QQMA 5EP9A 2GU9A 3H50A 4AWDA 2XVGA 4FFIA 2R072 3NL1A 4DUWA 3U37A 2WS93 1V6NA 5F5IA 3CO2A 4HSJA 5FXWA 2R041 4EE2A 4XZPA 1OLMA 1FOD2 2B39A 5FP9A 5I8YA 5FBJA 4ZXKA 5BPXA 2VTFA 1AL23 2HWF3 3VL8A 1CZTA 4QPWA 4BLJA 1TZOA 4PHZA 1S0CA 1Z78A 1ZBE3 3NKGA 1EV11 4N43C 1CAVB 1OOPA 4FPLA 4JGZC 5LWBA 4C0HA 3LOBA 1OBNA 1US3A 3KWVA 1QJX3 4ZZ5A 2X05A 1UL9A 5FZDA 3VKOA 3N9LA 1AZDA 5CKNA 1VBE2 1LOGA 5IVEA 3JUUA 4FFHA 5F32A 2AENA 5KHJA 2OKXA 2CV6A 3NW4A 4CU6A 5LB6A 1LHVA 2IFWA 2JICA 4A2UA 3O12A 1H9WA 4O65A 2ZGOA 4Q4V3 4LORA 4TLGA 3O1SA 3RFRA 2WNVB 4AHWA 4P02B 3D8CA 3J7NA 1AR61 5BUVA 5J37A 2IXCA 4Y5Z0 2Y6HA 3OGSA 2CTVA 1BK0A 1AR73 1W6OB 3W58A 4D7YA 4KNCA 2WZR3 1W39A 2ADEA 1R092 3P5BA 1Q8PA 4I09A 1SBFA 4FOWA 1DCSA 3NO8A 1H9PA 1QXJA 3C7HA 4NOTA 3T2QA 2VNOA 2Y26A 5EZWA 5FZ0A 3B9CA 4IE5A 2RVAA 1YQCA 2QKDA 1S2EA 4M4RA 3VD5A 1XNKA 1OA4A 1PMJX 4GULA 4J1XA 1Z7S1 1RXFA 1W06A 4CDUA 4N90A 5FMOL 1PX3A 4HETA 1REDA 2DBNA 1L3JA 1VAVA 2J1VA 2VMIA 1JOJA 5IK8A 1KDKA 1G9DA 1GICA 4FAGA 1RIRA 4M0HA 3IIIA 5FKCA 1ULOA 4Y1ZA 1W05A 1O8PA 1DP0A 4XE9A 4CEWA 3VDDB 1B09A 1V6JA 4RS5B 1CWPA 1MEC1 1RUC3 2X29A 2HWE2 3LAGA 1PO13 1AYM2 3UJOA 3KCCA 1SACA 1YNAA 4IXLA 2XJQA 3HPNA 4TSVA 4YFWA 5A80A 3J26N 2ZA9A 3N9MA 5C4WA 4K1ZA 4OVEA 5H9RA 5LZ6A 4OQ8A 4ATFA 1W8NA 2JIGA 4AFBA 1UOGA 1HJFA 2QQOA 2UYAA 2W92A 2CDPA 1DHKB 3AYAA 4UI9L 4RFRB 3T08A 3CHXA 1V6MA 1F35A 1VMJA 1GZWA 4GXLA 2XKOA 3AMNA 1OD5A 3K2OA 4MLOA 4CDXB 1QY4A 2MEV3 3A21A 4QQOA 4R8HA 5C5UA 1QOOA 5FPAA 5FYHA 5IHRA 4B7EA 4COVA 2OIIA 4BK4A 4MZUA 4L92A 3H42B 2VZTA 4M3CF 1UQXA 2DCZA 2R043 3V0AB 3ETQA 1OSGA 4LO5B 4P5HA 4Q5OA 5D1IA 4KBBA 2QQUA 3POJA 4CU8A 4EROA 2VBDA 5FJKA 1X8MA 2YPDA 1CPNA 4R4ZA 2BRTA 1EV13 2HWC1 1ZZ6A 2X09A 2DVAA 4YW6A 3SLIA 3POEA 4QXBA 1MZ5A 3GHNA 5K4LA 1UY4A 4QPIA 5A7SA 3S6PA 3T0BA 3U14A 3VBFA 5FUPA 5GZEA 2WLQA 2O14A 3OPZA 3ZFFC 2UY8A 3I97A 2GC3A 1R1A2 5EFUA 5JWPA 1VBA1 4W50A 3EB7A 3S7IA 1ND3C 1RUF2 3K3NA 4JDMA 3KMHA 4XUOA 1QQP1 2GH2A 2VW2A 1BVVA 1DGRN 1V6KA 2Y6LA 2PMWB 3U1XA 2W1SA 1PGSA 1DGRA 3E6DA 3TAYA 3THDA 3WCSA 1W2NA 1NY71 3WF2A 3WG2A 1OQEA 4J1WA 4PLNA 1CONA 2J1SA 4G9SB 5FUIA 5FZOA 1DZQA 1OF3A 4BQWA 1XXNA 1GZCA 4MHRA 2BBVA 3LWCA 1PHMA 2Y34A 1HN0A 2VO5A 5FMBA 3IAQA 2NPIA 4H7MA 5HV4A 3I2IA 2AR6A 2XQXA 2YPJA 5IK7A 4MGQA 3RMXA 5JIAA 2CDOA 1HN1A 4WVMA 2QTWB 1QJEA 4FTSA 5JXGA 5C7GA 2YXSA 2VZ1A 1GQPA 2BGOA 4XBQA 1CZVA 5LA9A 5FQ0A 2VZ3A 3ZYRA 1Z7S3 1OQ1A 1UU6A 3ACHA 5F8PA 3LSEA 1H2LA 2ADDA 3N9NA 4JDNA 4QDRA 3VBSB 3K4DA 2Q5TA 1BHGA 1HLCA 1IQDC 2XVKA 1COV1 4CP9B 1ZRRA 1ULEA 2VZVA 3H8OA 2ZTNA 4Q4X1 5DPNA 1IS5A 3KM5A 1N3QA 1ULGA 3LDRA 4HT1T 4HKLA 4XQWA 5E88A 4QXKA 2BTVC 2ZGSA 2UYBA 1YJLA 3D3AA 1MEC3 4Q29A 3VZKA 4E4ZA 3NV2A 1O3RA 4JGYA 5F5QA 1W0NA 4AFMA 1AX1A 1F9KA 2CU5A 3M2MA 2VCBA 1W8FA 2JG8B 2BYVE 4GH4C 5FO7B 1LHUA 2ZCWA 4LBQB 1SPPA 5FWEA 5A6ZA 3GZEA 4XETA 1XC6A 5FYIA 3T3YA 3ZKYA 2CAUA 2ZMKA 5C3RA 3SMHA 1GR3A 2VPVA 4FOQA 4FI9A 2Y0IA 3E97A 3NNFA 4HK9A 3AK0A 4JC1A 2J42A 3K77A 1QJY1 3GZUC 2DCTA 2K9ZA 1ZZ9A 1ZBA1 4M3CA 1NXD1 4DS0A 4CYDA 3AMMA 4R9CA 1RXGA 4XCAA 4Z2WA 3ABZA 5JR7B 2ATFA 3FFQA 3MIFA 4JTOA 1TME2 3LFIA 1RMU1 1ZNPA 2YU1A 4E8CA 5C4WC 5GZGA 1RUI2 2Y8KA 3RYRA 4QWNA 3I2KA 1ENXA 4PDWA 4BIOA 3R4DB 5HPOA 2GMEA 2HWC3 1S0BA 2VW0A 3Q8AA 2XGXA 2D5FA 4UFJA 1ND2B 5L19A 1QWRA 2R062 2ZZQA 1VRH1 5IVFA 2JDUA 2LALA 2RJKA 2WZ8A 3PLQA 4FFFA 4UWDA 4AVTA 1VPHA 2IFRA 3PL0A 3B94A 4QX1A 3LKJA 4P9IA 2QQIA 2IXJA 4XZUG 1NA1C 1U12A 1QQP3 5DDJ1 1EAH2 4HN0A 2VTXJ 1CX4A 3RWNA 3MUZ1 2JDMA 2RMU1 2VECA 2Y0OA 3SH5A 2O8QA 1J1LA 1PNGA 3O0VA 3SH3A 2QDRA 2QQWA 4Z92B 2E6VA 3POSA 4A4AA 3R0RA 1GU3A 1ZZ7A 2E63A 5LEKA 1HRV1 3VBFC 3ILFA 3WP3A 2E7QA 4HLTA 4QGMA 1ZRDA 5FV3A 1JI6A 4RHV1 1C5HA 2VD7A 5FZAA 5A3WA 2B45X 5ISLA 5BV6A 3F2ZA 2YV8A 2EIBA 2W2IA 1ZRCA 5K9YA 4NHMA 1WCDJ 1RVF1 3NQHA 1O8SA 4AEJA 1NCQB 4LA3A 4QKFA 4XACA 2XBO1 1OUXA 2WT2A 4ISRA 3ZXLA 3AL6A 2WDBA 3ZFEB 4Q8KA 2V73A 4XTMA 5DN2A 3RDIA 3V0BA 1JZ5A 1ODNA 5A7PA 5KHGA 1UWWA 1BBT2 2PLV2 4BU2A 2UURA 4MADA 4IV3A 4YG3A 3ZPOA 4XFGA 3OUIA 1OLME 4IE6A 3WF4A 1BJQA 2FMDA 3AFGA 1B35A 1J84A 2XG3A 4NJ4A 1DQ6A 4IV1C 3LFMA 3MW4A 3AKRA 2WNOA 1XNAA 2I07B 3AP5A 1S1AA 3TBDA 1VBD1 3WF1A 4N7IA 1SEFA 4FSJA 4GJZA 4I0AA 1XJAA 1I6XA 4NPLA 4AQ6A 1S55A 3HMYA 4I2OA 5CYYA 4ARYA 4AI3A 3N4MA 3GBGA 2IXLA 1JZ2A 3VD4A 1VMHA 3ZFGB 1MR5A 3ZO0B 5EIYB 2XXZA 2ARXA 1OI6A 3C7OA 3KF3A 5BNPC 3T4VA 4XFAA 2B42B 1OQDA 5HCHA 2W1UA 4DINB 3OY8A 1ULPA 1U5XA 1QJY3 4UXAA 4XDQA 1GANA 4FOVA 3ZSEA 1POV1 1W9FA 5A3LA 4ZKTB 2SBAA 1HB3A 4RR3B 5CG8A 1UZVA 2VOXA 3VBUA 2GMMA 2X5IB 3PIJA 1MVEA 1WBFA 1KFUL 1NCRA 1OC1A 3SKJE 2PYTA 3RGBA 2W47A 3RZHA 4XTPA 2VUAA 4MGYE 4D7SA 4CCJA 2NM1A 3HT2A 1HB4A 2ZXQA 2N7GA 2PFWA 2A6WA 2QQJA 5AC93 4Q0QA 5CFDC 1Q8SA 1BQPA 1ASJ2 3LD8A 4NUBA 4QQHA 5JSPA 3BVCA 3ZXDA 2ARBA 1VRH3 2GC0A 2ZEYA 1AJOA 1ZZCA 3DPRA 1IS4A 3TRSB 1XYPA 2HWD2 1S0DA 5BNOA 3IMMA 3PUIA 5A7WA 1PGW2 2OXBA 2XJRA 4I0BA 3WLUA 1RJ8A 4TZDA 5DDJ3 3MLJA 1QEXA 2A6XA 2HEWF 3GCXA 4UYBA 1LGBA 2B8MA 1W90A 4XIKA 3ZYBA 4J6GA 1W8WA 1NYWA 1Q43A 1Y9QA 3LB9A 4O61A 2QE3A 3I2DA 4PBOA 1FNZA 1GOFA 3HQRA 4H3WA 1YQ8A 1UZZA 2A3YA 1OHFA 1A34A 1O3TA 1QOTA 4GMP3 4ZZ8A 1HRV3 2BOJA 1W99A 1RUJ1 3CKHA 3K4ZA 3MICA 1GWKA 1FMD2 4BZ4A 2OA2A 2H0VA 3H8UA 5L9BA 4LHNA 4QQLA 4C90A 3BTYA 4YG0A 4MGZE 4OHWA 4XABA 2DCJA 2GN7A 2WA3A 1XE0A 4CDQA 4ES9A 2JDKA 1OUSA 3O1MA 1QXRA 4HKWA 1RVF3 5JR2A 3JXSA 4GQ7A 2P3IA 2HWB3 3N7KA 4QPGB 3VZOA 1AXKA 2XBO3 4BQ4A 1K5MA 1IPKA 3IPVA 4Y4YA 3T1MA 5IYYA 3VV1A 5J36A 1SBDA 1UZWA 5FUNA 2WABA 1KD7A 3AB0A 3MBWA 1HXS2 3HBKA 4M4PA 5DAWA 1G8WA 1JXNA 2QQLA 1W0PA 2XR4A 2CNAA 2PXJA 4LULA 3H1MA 4IW3A 4XURA 1QHDA 3MFAA 3WF0A 5A1LA 2R071 4A7ZA 5BNNB 4HVRA 3WUDA 1JZ3A 1W6PB 2ZOEB 5FPZA 2A70A 3ZKUA 2WFF1 3JBG3 3C7GA 2O1QA 5I8SA 1RUG3 4XF1A 1E5SA 1NXMA 1FOD1 5DZGA 2BDRA 3AP9A 4IEPA 3O14A 4LOSA 1DLLA 1BEV2 2RS32 4DY3A 1NQDA 2BP6A 1XNDA 2VCAA 2LW8A 1LOAA 1GNYA 2YYOA 3CJIB 4XW3A 3M3OA 1WMFA 5I0SA 3ES1A 4ISQA 1AVBA 4HPKB 4Y1VA 1CAVA 3T0DA 2YBSA 2ILMA 3AYDA 1SLIA 5KHHA 3ZXJA 3ATGA 3KQ4B 1VBE1 1POV3 3L2YA 4MGSA 1UX7A 5C8CB 1FYUA 3R6SA 1YI7A 2FDHA 5KHKA 4NAMA 4QHOA 4XEZA 2A73B 1NUKA 3OYWB 1C8M2 4FPJA 2DUQA 3MIHA 1JUHA 4ATEA 4CPBD 3J9SA 2ZMNA 5FJHA 3RZZA 4GKXA 3TNPB 1SCSA 2WNVA 2BPA2 4QMAA 5GLTA 3FUOA 3SKVA 4AVBA 5B4NA 2BBAA 2YFZA 4GKYA 4OLLA 2W94A 3MW2A 1W6OA 3URFA 1TNRA 4NIHA 4OHYA 1R091 4BLIA 2BVBA 3ZDSA 3FC0A 5GKAC 4BQXA 2Y33A 1L7RA 4CUBA 2DURA 3RNSA 1LOEA 5LBCA 1C5IA 1RYYA 2VNRA 3F95A 4RFT0 4B8EA 1TNFA 3KQRA 2VUDA 4XF9A 2AYHA 5I0TA 3E6CC 4QX0A 4XFHA 4QX8A 4YNIA 4AQSA 5L7OB 1S0GA 2VVDA 4A45A 1RTVA 1CIWA 1IHMA 4QB6A 4BH9A 3MW3A 3I3QA 5D8AC 1APNA 1RUJ3 1GSLA 2YDEA 1GMMA 4MV2A 4HN1A 4YYOA 4YFZA 1GFF2 2ZKNA 4NE9A 1AUYA 2PTMA 2D6PA 3UT0A 3FL7A 4K8RB 4NRQA 1OXCA 3OGGA 3ZYGA 2HWE1 3VBOB 3VDDA 1W04A 5FXZA 1AYM1 4RS5A 2NP0A 4AI0A 4WZFA 1DYKA 3POYA 4M3CE 4ZXEA 1RUNA 1LHNA 4Y5SA 3UGGA 4FPGA 4IUGA 3I2FA 3P6BA 5T55A 2WZPP 3SNMA 3MDPA 2Z5WA 1XSQA 5JOXA 3G6JB 4YVSB 1VB2A 1CPMA 4H7LA 5IVCA 5A33A 2BFUL 1S0JA 4CDXA 4R52A 4Y20B 3WDWA 1JYNA 2ID4A 2BWCA 2WFF3 3H3ZA 4MGKE 3WP4A 3WDVA 2VE1A 2NN8A 2FDIA 2EXJA 1FOD3 2VVEA 5A32B 1RJ7A 2Q4SA 2XVLA 1XU2A 3V0AA 1AYN1 1DYPA 3AKQA 1RHI3 4WM8C 2VMCA 5CBLA 2EAKA 3BTAA 5KC6A 2VL4A 3ELNA 2P37A 3I7DA 2Z4FA 3ZXKA 4B3NA 2WWJA 3NJYA 2RJ2A 4WM7B 4N53C 4S2FA 1ULFA 4E8DA 3OG2A 3SEPA 4Q4Y2 4FQZA 4OHZA 5I0RA 1R1A1 3LIHA 1M4WA 1VBE3 3HT1A 1EYBA 2EVXA 4QPYA 3FFZA 3BOPA 2B5HA 1HB2A 3W21A 4DNYA 4B29A 1TQ5A 4COUA 4DXSA 1LULA 1MPXA 5DZEA 2G4IA 4X6QB 2JDHA 3HQUA 4AHZA 3O5SA 3AVSA 3B69A 4PQQA 4NMIA 2Q0AA 5DUXA 2PQSA 4BJ0A 3GF6A 1ODMA 5A1AA 2VZQA 4QDSA 2R1BA 5FZ6A 3CMGA 4OFGA 4RD7A 1AX2A 4FAHA 1R093 1LRHA 1RUE1 3GBFA 4YW3A 5FREA 4F83A 4FPHA 4YG6A 1EUTA 3DV8A 4CP1A 1UNBA 2QQPA 1WW6A 4E4SA 4D6RA 5ERLA 1ONAA 4LBJA 2A3WA 3CU7A 3WNXA 5K0UB 4CRQA 3OBRA 4A42A 2BU9A 3PVEA 1QKQA 3GBWA 3VBSA 2D44A 3WINE 1HRI2 2VY0A 4LNVA 5GZCA 2GAUA 1UD1A 4A6OA 4W8JA 4FXGB 5A1FA 4CP9A 5L73A 2ZKLA 4FPOB 3OD4A 1O59A 2C9KA 3LF7A 4MX3A 1I3HA 4B7KA 5JAXA 3E5XA 5A6XA 2E7TA 2HWE3 1VBC1 4IEUA 2WN2A 3POBA 4Q26A 1GP6A 1O7FA 4OZXA 5LK7B 1KEXA 5T50A 4GAZA 2D6LX 2VH9A 4YM2A 2JG8A 2W0XA 1AX0A 4LBQA 4Q4W2 3WOGA 3ZN6B 1GZ9A 2NQYA 3V64A 1A6CA 4C1XA 1YQ5A 4RQPB 4CXWA 5C9AC 1SMVA 4QGNA 1JZ4A 4PF5A 3DGTA 4ES8A 4C8DA 4IESA 4JHZA 4Q2FA 4LR4A 4QX5A 2D3SA 5JZGB 1SFPA 2DYCA 3AP7A 4JTNA 1V9U2 4CUGA 1Q8OA 2WNEA 2PAMA 4HONA 1TME1 3VLBB 1BVP1 3WUCA 2ZX1A 4AI2A 5FY5A 3WDTA 1CAUB 1AYN3 1RUI1 2DWRA 4ZY9A 4LO4B 4XUTA 1DDLA 4IEQA 2BNOA 4W6XA 1CN1A 2BGCA 5LY1A 4Y22B 1VMFA 3D5OA 4CU9A 3NJVA 2MNGA 1TVGA 1EP0A 1E5RA 2IVJA 1TEIA 1W8UA 1R1A3 1ND2A 3B93A 3KCXA 2WBKA 2BQPA 3H7JA 4M01A 3EXUA 3P3PA 1H8TC 3KV6A 5GJ6A 1D2QA 2WWUA 3ZXAC 3OOXA 1ULDA 4WVZA 5FZEA 1EAH1 1MZFA 5FFOC 4DEVA 4EQVA 5FMOS 1JYIA 4AGGA 1FT9A 3MF6A 3H8XA 1PK6C 2G9FA 1KDMA 5GALA 1UXZA 3D0JA 4LK7A 3UL2A 4H14A 5F5CA 4NRPA 3VBRC 2VOWA 2ERFA 3WW1A 1QH6A 1G9BA 3VDCA 1F31A 1PMIA 4YM0A 4JKMA 3W9AA 3S0MA 1O4TA 1HKDA 1PVXA 1KRIA 1JUIA 3UK9A 1RUE3 3MI8A 4N9HA 4RGGA 3WNMA 5FLIA 5B4XA 2K46A 1ZRFA 4GIQA 1UCXA 3U4XA 1LU1A 4YVWB 2X8KA 1OA3A 2WT1A 1NCQA 5JOYA 3SH4A 1AR93 4YSFA 1YO8A 2TUNA 4L9BA 1BBT1 5H9PA 3ZFEA 1CGPA 4XUPA 1CD3G 5EPAA 4AI1A 1GOGA 1SHWB 3C7EA 4AEDB 2GN3A 1KFXL 2ZGRA 2RDNA 3DKQA 3HD8B 4XF4A 2G9GA 3KLSA 4K7JA 1Y9MA 3C7FA 1XQNA 1OURA 1XPWA 2F4PA 1UY3A 2V4AA 3PVBB 4TLFA 3WEZA 4CUCA 1VBB3 2R49A 4P9GA 5BNQA 4IGPA 4G4FA 1VBC3 5BYNA 3BUCA 1W8ZA 5FZ4A 3AKSA 2R7EB 5KXBA 4Y1YA 5FBZA 4L2NA 1LB2A 3M7AA 2XWBB 2ZGUA 3NAPC 4A3XA 5C3SA 2QZ3A 4BE3A 1CAWB 2P34A 2Q1MA 3NNGA 4LKFA 5FMCA 2BW8A 2JDPA 4CCKA 4CSWA 5CFCB 2VGDA 4FTEA 4MXWB 3ZFGA 3NKTA 4EN8B 3M1HA 3L2HA 3WG3A 5J09A 4FPFA 4WVVA 1IZ3A 2V4VA 1O6UA 4B4PA 1JS9A 3M4FA 5EV7A 3LA7A 3NV1A 5FP3A 2AGSA 2HEYF 3ZSMA 1QJU2 2GMPA 2QZ2A 1LOFC 3RRDA 2H6CA 2RDQA 2P4EA 4Z07A 1A78A 4RR3A 4ZS2A 5FIXA 2D43A 4XJ9A 2W9XA 1TME3 1WMDA 5A7QA 5A3MA 2X5IA 1XE7A 4K1YA 3SC7X 1RUI3 3KHCA 1HB1A 1Y7BA 1YFUA 2RG4A 5J3UA 4YM1A 4CCOA 1AL0G 1ASJ1 3MO4A 4QKDA 4AGVA 1YRZA 2FCUA 4LBOA 3IN9A 1OD3A 2R16A 1PGW1 4IEXA 3UESA 3KT7A 4EN9B 1OMIA 2YGMA 1EAH3 1WLWA 2WAAA 2YZ4A 2BERA 4FPCA 3FBYA 4IE0A 2RM22 1OLRA 1W3XA 1XOYA 1U5YA 4NVPA 1PZ9A 3S30A 1K12A 4LT5A 4CDWC 3VBHB 4W6YA 2TEPA 2A71A 2WO3A 3LGRA 3RWKX 3BPZA 1FMD1 1HX6A 4KGGA 4UW5A 1X50A 5L9RA 1F8VA 4AGRA 3GM8A 2WQ4A 4XQ4A 3MGUA 4BYYA 2VCMA 5GM0A 1DGLA 2O0OA 2VC9A 5H9SA 1PZ8A 4AFDA 3POWA 4DRRA 5A6QA 4KL1A 4DB5A 2VZUA 2RE9A 1W9YA 2FCTA 4K6BA 4BCUA 4QPGA 2C24A 1NLQA 1HXS1 2ZGPA 1REEA 1AXZA 1OH3A 1Y43B 3HOBA 1FV2A 3KCYA 4FT8A 4ZU4A 1W2TA 3O1OA 2ARCA 2E7AA 5FK8A 1RB8G 1OVPA 4P14A 2RDRA 2QCSB 3VUOA 4R9BA 2IXHA 4YZ2A 4FPKA 1A8MA 4YGEA 5A3TA 5FY1A 1DQ1A 4EN0A 5BNNA 5DAVA 1PX4A 4B1MA 4AVSA 2XJVA 2DBIA 1V00A 1W6PA 3FLRA 3A0KA 3GJBA 5SV5A 3W5NA 3O1VA 2WKKA 1AR63 1OOPC 1Y3TA 2R6QA 1WCUA 4F3JA 1JYXA 5FYUA 1BEV1 2RS31 2VMDA 2VOVA 1EY2A 1UY1A 2CWSA 2ORXA 4OZOA 5FP8A 1D0HA 2XJTA 3M3EA 3SXWA 1WLDA 3DKWA 4EZHA 4LMFA 3CJIA 1JODA 3RQ0A 2YY1A 2YC4A 4N43B 4XHXA 3TOJA 3QLQA 4JGZB 2JIJA 3GZTB 3ST7A 4HPKA 3FLPA 4LBLA 1RGSA 2UY9A 3IDCB 3LZZA 4DMIA 4AR2A 5C8CA 1NOVA 1C8M1 3POFA 1LR5A 1RC6A 2WS92 1YCIA 3OYWA 5F5AA 1PM7A 5HI0A 5I0UA 2P5BA 2WSUA 4L11A 4GB31 5KR7A 1H6YA 1J3RA 2GZWA 1ASJ3 4KU7A 1IKQA 2WUHA 2C1FA 3IMNA 4RGKA 2YBKA 3LEIA 2Y6GA 3EBRA 4GWNA 2GNMA 2YFUA 4HG6B 1GV9A 1N3OA 1ZBE2 4CDUC 2W91A 4LBQD 2Q1FA 4XJWA 3VL9A 4P5YA 1WA6X 2D7FA 5CEHA 2IC1A 1JH5A 4K9SA 5CAZA 1UN1A 1O5UA 2NYYA 3B9IA 2ZX0A 3OUHA 4HFSA 3UETA 3JQWA 1W6MA 1LENA 2D98A 1W6QB 2XB6C 5C8WA 5CIRA 3SEEA 5C3OA 1E57A 2FDFA 1CZSA 1JTZX 4CEWC 4YW1A 2PHUA 1XYNA 4OI2A 2XDVA 4Y5TA 2NMOA 4K20A 4N8MA 5L7OA 2WFPA 4UAPA 5A7OA 2DTYA 2VUJA 4LLOA 5FZCA 3HQXA 4PT6A 2IXIA 5C71A 1AR72 4GALA 4YW5A 3WNOA 3I3EA 5FZ7A 3MLLA 1EPWA 1UYYA 5GLUA 4HK8A 3DEMA 2WZR2 3VBOA 1LOBA 1H1AA 1RINA 3A22A 2EALA 4LTAA 1HXS3 2BJSA 1H2NA 2D6MA 2B9VA 3QD6A 4JDOA 4E4HA 5FZ9A 3HEIA 1UKGA 1CVNA 2PQQA 3OJBA 5JDBA 2DVDA 2D6KA 1VBA3 3J8F1 1OKOA 1LGCA 1C57A 3N9PA 3POIA 2PHLA 4OHXA 4OMCA 2R0HA 1I5PA 1DFQA 3AYCA 1LKNA 3AL5A 4P9XA 4H2AA 5JXJA 5LBFA 4AVCA 2Z42A 2PAKA 3H1YA 4YVSA 4E9KA 2EXHA 2QNKA 5GZFA 1UU5A 3HIFA 3LPFA 3GCWA 4KG0A 4Y20A 5FYCA 3UKNA 1SFYA 3AP6A 1W8OA 1J58A 3OD0A 5GLWA 2GALA 1WCQA 3IIAA 4QPIC 1BEV3 2OW4A 4N7UA 3AZZA 4OI0A 1V70A 1PIV1 3CJXA 1E5HA 2ETEA 5A32A 1RUC2 2JECA 2ZMLA 1C8NA 5DABA 2J1AA 4IEYA 1Q56A 1UIJA 2VOKA 1G6NA 4LITA 2Q8DA 1K45A 4Q4Y1 5IVYA 2OZJA 1H6XA 1VAMA 2QQKA 4WM7A 5TSWA 2VJXA 4XFBA 2OYZA 1FATA 2W3JA 4ARXA 3ZFFB 4AOCA 4HL0A 5A70A 4YGCA 3IM0A 4BISA 1ND3B 1GWMA 2MEV2 4LO8A 4LHLA 1COV3 1EUUA 5EJ3A 1FNYA 2XL9A 3ZYIB 4LIUA 4Q4X3 1I1EA 4GB33 2FDGA 1BLZA 3L9JT 3GHMA 1QIQA 4KWKA 2XLGA 4OUEA 4XOGA 3WSOA 2WQ8A 2A7AA 3HN3A 3VN4A 4AE2A 4D3WA 2JD4A 4CCNA 2XJUA 3T2OA 3LEGA 3N9OA 4YARA 1FXZA 1NKGA 4R9DA 5EXOA 1GZTA 2JXAA 4QX3A 2FDJA 4OULA 5FYTA 3EYPA 4Y33A 1JYTA 1YFYA 4E2GA 5FP4A 2GDFA 5JOZA 3AP4A 1CJDA 2JE8A 5E16A 5EJ1B 1F4AA 3I3BA 1ZBA3 5JIUA 4MVTA 3PUQA 1OH4A 5K0UA 1DU3D 1DZTA 1HRI1 5E6HA 3TEZA 1ZZ8A 3S5AA 4D6SA 3FHQA 3ZN5A 5F3GA 2E26A 4FCAA 4YGDA 2JG9B 4JGYC 2VU9A 3JD72 4HMZA 3ON7A 5FZGA 1RMU3 4A41A 2VQ0A 2J1TA 2D6NA 5EHDA 3ZR6A 5G04L 2GNDA 2P6CA 1XBFA 3VZNA 2VBPA 4HSLA 3VZLA 3KV9A 2PHTA 3ZYFA 3WD5A 3ZR5A 5EJZB 5FY0A 5J7MA 4PCRA 1WMEA 4Q4W1 4RSUA 1YIFA 4PIXA 3QH6A 1EPZA 5FPXA 1IKPA 1WCSA 4GH4B 3HR9A 2TNFA 3J8F3 3ZIXA 2VW1A 3ZXGA 1OPMA 3A23A 2F4LA 1UMZA 3ZN6A 3R4SA 5L36A 1S4CA 2P17A 4RQPA 2ZEWA 2CGOA 1NLSA 4FP3A 2VNVA 2VMEA 2RMU3 2EAAA 4UFIA 1REFA 1V9U1 4PDWC 4JQTA 1L7LA 5JZGA 3MIBA 1UX6A 2GP5A 3AYEA 4BPZA 1BYHA 3SCHA 3MFCA 3VBOC 4AFAA 3T09A 1PIV3 4RHV3 4CTEA 4AQ2A 1CAUA 1G86A 4BA6A 1JU3A 2ENRA 3PMEA 4LA2A 4Y22A 4Q4Y3 4TWTA 4BIFA 4E27A 3OGRA 3KB5A 4B4QA 2DVGA 1WBLA 2QUOA 3AZVA 1PO22 2Y64A 3A4UA 1J83A 3ZMOA 1NA1B 3WX5A 5JSOA 2OPWA 3MV01 4W6WA 1ZREA 4ZPIA 1X9TA 2DF7A 4CUAA 5HCAA 4NIAA 1WLCA 1VBD3 1HV1A 1TG7A 3AC0A 4UW4A 1W2AX 2VAUA 5GLZA 2DDUA 1UYZA 1VB4A 3DUIA 4JQRA 2HWC2 3IWZA 5T52A 4BQ1A 1J3QA 2VXJA 1GP4A 4XJUA 4COYA 3JB4C 4IV3C 3I3MA 5FY9A 5FZLA 3LEKA 4YVWA 1KS5A 2YHJA 1B35C 1NE6A 1W0OA 4UT5A 1ZYBA 1QQP2 3HNBM 1SDDB 5FZ8A 2ZAAA 4E2SA 2UWCA 3NRUA 2BFUS 4LLFA 5FYMA 5JPNB 1HRI3 1STMA 4NO4A 1UYXA 3ZYHA 3Q8FA 4YZ1A 4AEDA 2BWAA 4HANA 4QU1A 4COWA 1VE0A 1LJ7A 1UZ0A 4YZ4A 2XWJB 2YB7A 3N3HA 1AR82 4QT6A 2QFEA 4FVVA 2WO2A 4IV1B 4E4DX 1JYWA 5F3IA 2JENA 4XIOA 5A3UA 2Y6FA 2B9UA 4ZU7A 3T0AA 3P3NA 1CESA 2BOIA 3MUY1 4Q4W3 2LRPA 2ZX4A 1PNFA 1ZVFA 3O7OA 1CAWA 2CWMA 2Y38A 3H1WA 5JMCA 1SDWA 2QQNA 3DL3A 1FI2A 5CFCA 4UFMA 3VBUC 4Z2AA 2IVIB 3M3QA 4MXWA 4YRDA 4AF9A 5BNPB 3WNKA 1NCRC 5IJRA 1QJFA 2JDAA 5F9TA 2ZX2A 4XDOA 1W6MB 2V09A 1OVSA
chains in the Genus database with same CATH topology
3D6EA 1QJU1 1V9U3 3GYDA 2A6ZA 4AEMA 1ZA4A 2E51A 1VLNA 4L8QA 3DPRC 1XU1A 5CNAA 1RUH2 2CL2A 4WVWA 5BNOC 1ULCA 4JAAA 5T5PA 1YUDA 2V5YA 2GSYA 2RS52 1FPN2 5IK5A 5FOJB 1GNHA 5CFDB 4P9JA 1QU0A 2SLIA 5DZFA 2FQPA 4Q27A 2ZGKA 4FOYA 2ZPXA 4QQ2A 4KU8A 3WCRA 2H0BA 4EV0A 4F7ZA 2WNUB 2CAVA 1I9RA 4CEYB 4GMP0 2R073 1SFNA 3MEPA 1QDCA 4IL7A 3PVOA 4CDQC 4XFIA 4G3YC 3VBHA 1N1TA 3WHTA 1K5MC 4SLIA 2O8OA 5ACA2 1OFSA 5AC92 4YW4A 5CA6A 2F6BA 3JQXA 4I3PA 3ZPYA 2B46X 3WP5A 3R05A 1N3PA 5H9QA 1O91A 1IQAA 1PVC2 1G9FA 1XNCA 1RUF1 3VKLA 2VNGA 3ECQA 1W2UA 2FHRA 2KM2A 2PHRA 2CYFA 4A7YA 1H4GA 2XKPA 4PIYA 1YJKA 2VQAA 4ASLA 4FQ4A 1GQGA 3MZHA 2XUMA 1PGL2 1UKRA 3QBQA 4DFSA 1BMV2 1YWKA 4C91A 3M3IA 3U07A 5ABJB 1LESA 2GC1A 2NLRA 2W08A 2HWB2 1NE4A 3B7MA 2XBO2 3C2UA 4CP0A 3G7DA 5IK4A 4XMIA 2RR12 4AEDC 1XYOA 3CNAA 4M0NA 4JVAA 4PQ9A 4R4XA 1N47A 4Z1VA 4N43A 1QJU3 4JGZA 4BWOA 2LM3A 3HN1A 2P2KA 3M70A 4DRVA 4QGLA 2WNVC 3C3VA 2WQZC 2WS91 2EIGA 3NV3A 1S2BA 3JBG2 3RG0A 3ME2A 1RUG2 1H2KA 1KS4A 1YHFA 2Q1ZB 3KZ4C 3MIGA 3CLPA 3K48A 1D4M2 4XJAA 3MIDA 3RMYA 2XH6A 5KXDA 1LU2A 1AYM3 3OCPA 1ZBE1 4URTA 3T2TA 3RI8A 1VIWB 4B4RA 5FOBB 1OFNA 4PLMA 2A6VA 4EWAA 3AXEA 4Z82A 3RSJA 3TN92 1LECA 4Z8BA 2VXRA 2Z79A 4QU2A 1W6QA 4QHBA 5C6CA 1MS9A 2OVUA 2IXKA 2R32A 3U11A 1DQ0A 2VVFA 5GZDA 3VDDC 3NVCA 4COZA 4RS5C 4XILA 4P9LA 5D8AB 3AFKA 3AM2A 4XBLA 1AR71 3ROUA 3E6BA 3WDUA 4META 1O4YA 4RA0A 2Z2SB 2VULA 1J1TA 1H1IA 2WZR1 4YZ5A 4QQPA 1UW8A 4F8AA 2R061 3PTYA 4NHKA 5FLHA 5KWRA 4CDXC 3NSTA 4NR1A 2RS12 2MPFA 1RUF3 4Y1UA 4I01A 3WDXA 5LRSA 2ZHNA 3B3QE 2UWBA 3USUB 3ALQA 5I93A 1SBEA 4Q8LA 1LHWA 3H3UA 3GNEA 1RUJ2 2WINB 2I74A 1MS0A 2BVVA 1MS1A 3UKVA 1UU4A 3FWEA 5FCCA 2XLAA 3VKNA 4FP2A 1HQNA 1RUC1 1GBGA 1I5ZA 1RITA 2ES3A 3ASIA 2PHFA 3ES4A 3BIWE 2FZ1A 4XYXA 4Y24A 4WM8B 4P9YA 2DUOA 3APBA 4QD2A 4BM8A 2ZHLA 2RJLA 2W68A 3WW3A 4N53B 1MS8A 1CAXB 3SHRA 3KD4A 2K2SA 5K7PA 1NQJA 3JB8A 3INAA 2PLV1 2YUEA 3ZFFA 1G7YA 2MEV1 1S0FA 2DCKA 4ASMB 2CGPA 1OKQA 1VALA 1M06G 1LODA 4HVQA 1ND3A 5LK5A 1QGLA 2WFF2 5F6LB 1BKZA 1WW7A 1N1SA 4HVOA 2VG9A 1H4HA 1RHI2 4WZCA 1ZX5A 1LTEA 1AHSA 1DQ4A 1CQ9A 4MH0E 4K40A 1MACA 2P3KA 1MS3A 2XJSA 2WSVA 1UIKA 3VBSC 2WWSA 1MQTB 2ZGTA 2E9QA 4JRLA 4LHKA 3ZXFA 3EQEA 4MUVA 3V65A 1LGNA 1RL3A 3GALA 1HQLA 1R082 1Q8VA 1HV0A 5JI7A 1TMF2 3VHPA 4Q0VA 2ZHMA 4U2AA 2PHDA 1IS6A 1LCLA 3BU7A 3IT8A 3Q9OA 4MSVA 3JD71 1DZRA 4DQAA 2JG9A 1WUVA 2ZHKA 1RUD2 2JG8C 2WL1A 1J3PA 1QDOA 1JN2P 2BEOA 2R063 2DUPA 3N7JA 4LE3A 2ZGQA 1HW5A 4BMEA 2K0GA 2HWD1 2OPKA 3BOWA 4XBNA 4FO9A 4GH4A 2B7YA 5JSRA 2JX9A 5JI9A 1PZ7A 5C9AB 2YMZA 1D0GA 3EO6A 4MGIE 4XXAA 5AFBA 1AJKA 4HZFA 1YIPA 3RJRA 4AEKA 1OPOA 1H8VA 3WT3A 2AREA 3DN7A 4P9WA 2KXLA 4AHXA 2CY6A 1ND2C 4BOWA 3WDYA 4IETA 3QH7A 1N1YA 3PMSA 3BALA 1C1LA 2GNTA 2XL7A 3D82A 1O3QA 1GKBA 1MZ6A 1BBT3 2LTNA 2PLV3 3KT1A 3R4UA 1PO21 4N9IA 4X8PA 5K8SA 3RS6A 1H8TB 3TNQA 1YLLA 3AMQA 5B2GB 3BB6A 1NA1A 3B00A 1PK6B 3WG4A 1C4RA 4I0WB 3RYPA 1HQWA 3VBRB 5IT6A 1YFXA 1AYN2 2X53S 3UJQA 4AYUA 2DFCA 1NCQC 2ZGLA 3ILRA 4HBNA 2Q8OA 3MF9A 3ZFEC 5KHIA 3THPA 4XFCA 1U5IA 3BCWA 1DG6A 3I59B 1O3SA 4XPVA 1WW5A 4AG4A 5FO9B 1VAKA 3VHRA 1W6NB 3K51A 3KGLA 1H30A 2ET1A 4KWJA 3IDEA 2P3JA 3CF6E 4Q0PA 3U10A 4X8NA 3JD73 5LRRA 3VHNA 5C33A 1OLQA 2AH2A 1AR81 5DG1A 1U0AA 4K21A 1QJZA 2YROA 5FAXA 2PHXA 2ET7A 3O0WA 3ZFGC 4O9GA 3N35A 4IV1A 1RUE2 2ZJCA 1UAIA 1J59A 1AL22 2HWF2 4R9AA 2HWD3 3NAPB 1SLTA 3SISA 3NWKA 5JPMB 1AR92 3AZYA 1VJ2A 1V6OA 4RR3C 1TE1B 3NV4A 4UBHA 1QJX2 1D4VB 1QMJA 5ACA1 2X5IC 1GNZA 2JG9C 4EN7B 4HKOA 5T54A 5BNPA 4Q1RA 3HWJA 4JRAA 4LO6B 4V1PA 5JVVA 1SCRA 3HBZA 1ZZBA 4D94A 1S0EA 3WP6A 1QNYA 4NHLA 1FMD3 2DU1A 4Q4V2 2AUYA 1VBB2 1RUH1 1VBC2 2HYKA 5KC5A 3AMHA 2RS51 3WQ7A 1FPN1 3E5UA 1H0BA 1V6LA 3PJQA 2FZ2A 4I30A 5CFDA 1DQ5A 4KH9A 2CGNA 1WGPA 2C0ZA 1PO23 5T5OA 1QXPA 1SLCA 5DG2A 4CP2A 4EWEA 4XQDA 2WNUA 4AVVA 3WXPA 4CEYA 2WIIB 4CDWB 1N1VA 3I4IA 5BY5A 1ZM1A 1DQ2A 1X82A 2ZAHA 4QPGC 2DV9A 5AC91 1NG0A 3TB0A 2BUKA 2RS33 2OUJA 1H2MA 4E2QA 2ZACA 5DXDA 5FRAA 3AJYA 4MYEA 3QOPA 4TYSA 1O5LA 1PO12 3MLKA 1MVQA 3WY6A 4GA9A 1PVC1 3PNAA 2WJSA 1Q8QA 5BNNC 4YZ3A 3AKPA 1G9CA 1C8M3 3BODA 2ZGMA 1Q3EA 1HIXA 4GMP1 2C5DA 1AR83 3ZYJB 3FLTA 1PGL1 3HAGA 1BMV1 1XE8A 2R042 4IEVA 2MHFA 3CJIC 5EWSA 2HWB1 2KA3A 3PHMA 1OOPB 5J48A 3V56A 5ABJA 3WR0A 2HEVF 1KITA 4OUSA 1MZEA 4NN0A 3IKWA 1EV12 2RR11 2AZ5A 1HDKA 3O0XA 5C8CC 1F5FA 3ZSLA 5ACA3 3ZIWA 1SLBA 1FV3A 3AMPA 1CR7A 3MIEA 4DOUA 3VKMA 2I45A 4W65A 2OZ6A 5T3NA 1JBCA 1YXWA 2IWGB 2W39A 3B5LB 1X7NA 3JBG1 3QACA 3WQ0A 4QM8A 5I91A 1RUH3 1RUG1 4WBBA 4S2GA 1D4M1 1AR62 5JOWA 2I2SA 2WT0A 2RS53 3DF0A 4XHBA 5AVAA 1FPN3 3ACLA 4H55A 1NLRA 2A3XA 1OA2A 4KQ7A 4LUKA 2LUWA 1IGOA 3SITA 3AZWA 4D69A 4CDUB 1DIWA 4BHPA 3FHIB 5L7OC 1ENRA 1QF3A 3I54A 3WVJA 4KWLA 1Z7S2 2RHPA 1R1ZA 2WA4A 3TN91 2JE9A 3EHKA 4AXOA 3CL1A 2D93A 1GQHA 2ZS6B 4CEWB 2D97A 1BZWA 1GLHA 3CEWA 1WCKA 4O9EA 1LOCA 5D8AA 2A5ZA 5SV8A 2YC0A 1MEC2 2FBEA 3JU9A 2XHKA 5C4WB 3U0ZA 3FUQA 1C28A 5FDBA 2WNUC 5BXXA 5JLVA 2PN5A 5HCFA 1PVC3 4IERA 4CEYC 4YVSC 3H7YA 2RS11 5F1RA 3J4UH 1GZWB 3LSDA 1ENQA 3M3CA 1WLTA 3WQ1A 1F5JA 4EJRA 4C0BA 4Q0SA 1X33A 3D0SA 5FO8B 2QVSB 5LEJA 4L99A 3USUA 1F2NA 1AXYA 1UF2C 2Z69A 3KS7A 1BK1A 3FBMA 3SCGA 3ZX7A 5HCBA 1XNBA 4CZSA 4WM7C 2E53A 2XPJA 5F6KA 4QPIB 1WA4A 5FLJA 3VBFB 4IQPA 2PAEA 2RR13 3QCWA 1NZCA 1AF9A 4OUMA 4WM8A 3WZ1A 3A0NA 3OGJA 4IEOA 3TWIA 2PHWA 3UV9A 1VBA2 3KGZA 4N53A 4FTBA 1CAXA 3OBTA 4UBGA 4DPNA 2ZBJA 2EXIA 3ZSKA 3ZSJA 2IZWA 5E89A 2GC2A 1NY72 4Y26A 5ABJC 5KXEA 5DUUA 4LBMA 3JZVA 4K3UA 5J96B 1DGWA 5CG9A 1D4M3 4AHYA 3GZAA 4YLZA 3ILNA 2NZ9A 1QNWA 3TYJA 3FMGA 1RHI1 4Y1XA 4WVMB 5HXVA 1VP6A 3VGIA 2GH8A 2QJVA 4S2DA 2ZX3A 3IDBB 2HKXA 4Q0UA 5FQ0B 4IEZA 4ZU5A 5K0UC 2DFBA 4INDA 4RGAA 3LA2A 2D6OX 2R30A 2JDZA 1MQTA 1R081 2D3RA 3E5QA 4DY5A 1A3KA 4QM9A 1TMF1 4XF3A 2EA7A 3D4KA 4XJ8A 3TN93 3MYXA 2D3PA 5JCTA 4AI8A 1YFWA 2GNBA 1COV2 4LBNA 3KT4A 3I8TA 1GYKA 1QH7A 1UPIA 4RL7A 2WC2A 3THTA 4EN6B 4Q4X2 4GB32 4OHVA 3ENRA 3USSA 4LBKA 5AFEA 4XF0A 2XLFA 1RUD1 4JGYB 4YGBA 3N36A 3EJKA 4XMAA 4OI4A 4RQPC 3T1LA 1SLAA 3VKFC 4NPRA 2PA7A 2TBVA 2RS13 1V6IA 2D5HA 5JMCA 4AFCA 2C9AA 3WHUA 4AQTA 1ALYA 4JV4A 5JZGC 4M3CB 1XRUA 2RM21 1FX5A 1QJY2 1ZBA2 2R0FA 2DCYA 5CB7A 5C9AA 3S7EA 5EYXA 3OTFA 3H0OA 5CADA 1U5ZA 4PDWB 4D7TA 1RMU2 4KG8A 4ITCA 4PIZA 3PVNA 5KXCA 4LO7A 3FE5A 1C1FA 2Q30A 1O4ZA 1DF0A 5GLVA 1LEDA 2EF6A 3RJ2X 1VRH2 4JCKA 4C1WA 4IEWA 2H6BA 1BCXA 3AX4A 3FZ3A 3J8F2 4EWDA 4AVAA 4K8FA 3RYKA 3M8LA 5DDJ2 5J98B 2RMU2 4OI1A 1H8TA 2XJPA 4LUMA 1JW6A 4YM3A 4ONUA 4ORFA 4XFFA 3VZJA 1S0IA 5CU1A 1PK6A 3LOIA 4AK3A 3H9AA 4X6RB 1HRV2 1SLLA 1WW4A 3B02A 3WV6A 2A75A 1PIV2 5E8AA 2W52A 4RHV2 3VBRA 1RUOA 4YVWC 2ZZJA 5E1RA 4PBPA 2D40A 1RVF2 2WLPA 1D2SA 3V0BB 3AZXA 2JE7A 1WD3A 4WV8A 4MXVA 2DTWA 1MS4A 3AKTA 1POV0 1R083 3LA3A 4IV3B 1FAYA 1TMF3 3I59A 3FX3A 4FPEA 1KJRA 1BXHA 1Z0HA 1IOAA 1B35B 1X8EA 1SQ4A 1W6NA 2DU0A 1UPSA 1JYCA 2VMHA 4Q1PA 4UW3A 2JKBA 4LEJA 5I8TA 1DGWX 1RUD3 1VBD2 3JCIA 4AW7A 2ZABA 4M00A 1T6GC 1ENSA 5CFCC 4A7KA 1KQRA 1MQTC 3IBMA 1AL21 2HWF1 5T5LA 3VZMA 4GWMA 4SBVA 4UW6A 1S2KA 4DXZA 3MPPG 5HBAA 2DVFA 2HJIA 2R1DA 3OY8B 1AR91 4NWWA 3B01A 4FXKB 4NWVA 1QOSA 3NAPA 1G9AA 5DUWA 1QJX1 2RM23 1DBNA 3AJZA 3VBUB 4S2HA 2FMYA 1NCRB 2ZGNA 1URXA 1KJLA 2OUHA 1Q5OA 4LE4A 1CJPA 3WG1A 3WW2A 5AVPA 3RPQA 4Q4V1 1VBB1 3SCFA 3AXDA 3ZYPA 1LOFA 5DUVA 5CVRA 3LCPA 1H1MA 1WD4A 3RI9A 3DPRB 3NJZA 1C3HA 3ZVXA 4DZGA 4I3GA 1VR3A 2BNNA 5BNOB 2EXKA 1JHNA 4FBFA 2JJ6A 1MS5A 2QDNA 2UWAA 1IS3A 3W59A 3N7LA 3X29B 1A8DA 3FJSA 3KSCA 3VBHC 4XJZA 4KGQA 3ZN4A 4I02A 3VHOA 5FTTC 1KXGA 4U36A 2DVBA 3N7MA 1YI9A 3WW4A 4PLOA 3MPBA 5T5JA 3OF1A 4CDQB 2A6YA 4PJYA 2NMNA 4CDWA 4BMBA 1IPJA 1K5MB 5KBFA 3IPVB 2UU8A 1UZYA 4L97A