1CD3G

Procapsid of bacteriophage phix174
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SCAFFOLDING PROTEIN GPD)
publication title The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.
pubmed doi rcsb
molecule tags Virus
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cd3G00
1FPN2 5BNOB 1RUH1 4NWWA 2R061 1COV3 4IV3B 4CDUA 4Q4X3 1PO21 4PDWB 1ND2A 1CJDA 2RS33 1NCQA 5K0UA 4NWVA 1X33A 5JZGB 1RUC3 1POV1 3NAPA 2R042 1NY72 1HRI2 2WZR1 5DDJ3 2RM23 1RB8G 1RUH3 2R063 1PO23 5A33A 5J96B 3VBHC 1BEV1 2GSYA 1WCDJ 1FOD1 1V9U1 1VBC2 2WZR3 4GH4C 1RUE1 1NG0A 3VBUB 1H8TA 4CEWB 1Z7S1 1ASJ2 4RFT0 1W39A 4RS5C 1VB4A 4Z92B 1QJX3 3VBHA 1BEV3 1R081 1VBD2 1FOD3 1EV12 4YVWC 2Y26A 1BMV1 3IDEA 2TBVA 1QJU1 4GH4A 1RUE3 5ACA2 4IV1B 3JD72 3JBG2 4Q4V1 1Z7S3 2HWD2 2QQPA 4CDXB 1RUJ2 4JGZB 3ZXAC 1D4M1 1ZBE2 1C8M1 4WM7C 1R083 1MEC2 4FSJA 4N43C 2GH8A 4YVWA 2HWF2 4N53A 1E57A 3VBRB 1SMVA 4RR3A 1AR61 1QJU3 5BNPA 1VBB3 5ABJB 1ZBA2 5C9AC 1F8VA 4RHV2 4Q4V3 2XBO2 4RQPC 5CFDA 1R1A1 2R072 1D4M3 1RVF2 3DPRC 4WM7A 1RHI2 1AR82 1K5MC 1OPOA 1RUI2 4Q4X2 5K0UB 3VBSA 1PVC1 1VRH2 4N43A 2WWSA 4EJRA 1AR63 1RUD3 4GB32 4CDQC 1AYN2 2RMU1 4RQPA 2RM22 1R1A3 2RS12 1AL21 5A33B 1EAH1 1NOVA 2BPA2 4CDUC 4Q4Y2 5AC92 1RUG2 2HWB1 1RUF2 2RR11 1K5MA 1PGL1 4WM8C 1PVC3 1NCQC 5C4WC 4Q4W3 1HXS2 1FMD2 5FOJB 3NAPC 4CDQA 1AL23 1AUYA 1PIV2 1X36A 5L7OC 2HWB3 1PO11 4QPIC 2RR13 4QPGC 2BFUL 3VBHB 1AR92 2X5IC 4WM8A 2WFF1 5A32A 3J8F1 5LK7B 5C4WA 1BBT1 1QJX2 4YVSA 4JGYC 1M06G 4GH4B 5D8AC 1VBE1 3ZFGC 2WS92 1QJY1 1POV0 4RS5B 5L7OA 1QQP1 4QPIA 4QPGA 1H8TC 2FZ1A 2X5IA 2WFF3 3ZFEC 3J8F3 1RMU1 4AEDC 4LLFA 1BBT3 1R092 4Y5Z0 4YVWB 3CJIC 1ND3C 2DF7A 3VBOC 1PGW2 2MEV2 1POV3 1VBA2 4JGYA 4CEYC 1TMF2 5D8AA 5C8CC 2PLV1 1VBE3 1FPN1 2IZWA 3ZFGA 5CFCB 1QJY3 1VBB2 1NA1C 4WM7B 3ZFEA 3HAGA 4FTEA 1RMU3 4AEDA 1NCRC 4N43B 3CJIA 2HWC2 1ND3A 3VBOA 1HQNA 3VBFC 2R041 1NY71 1V9U3 4CEYA 1HRI1 4N53C 5C8CA 2PLV3 4RR3C 5C9AB 5BNPC 1AYM2 1TME2 2RS52 1B35A 3JB4C 1RUD2 1NA1A 5BNOA 3TN92 3DPRB 2BBVA 5CFDC 3LOBA 1NCRA 3VBFA 3VBSC 2R043 1AR72 1VBC1 1HRV2 4Q4W2 4CDWC 4CDQB 2HWE2 1ASJ1 4Y4YA 4CDUB 4WM8B 1ND2B 1C8M3 4CEWC 5A32B 1NCQB 5C4WB 1VBD1 1COV2 1EV11 1VBC3 3NAPB 2RS32 3S6PA 4CDWA 5ACA1 1MQTC 1RUC2 1HX6A 3JD71 3JBG1 1ASJ3 5DDJ2 4QPIB 4QPGB 1RUH2 1RUJ1 1ZBE1 4IV1C 2X5IB 4CEWA 1VBD3 2R062 1MEC1 1PO22 4CDXC 2XPJA 1EV13 2HWF1 1OOPC 4JGYB 5D8AB 4YVSC 5ACA3 1MQTA 1ZBA1 3ZFGB 3VDDC 1IHMA 3JD73 4RHV1 3JBG3 2RMU3 2WZR2 2XBO1 1H8TB 2R071 1RUJ3 1ZBE3 4IV1A 1EAH3 1RVF1 1RHI1 3ZFEB 1AR81 1MEC3 1RUI1 4Q4X1 4CDXA 3CJIB 4JGZA 1ND3B 1VRH1 2HWF3 1OOPA 4CEYB 5C8CB 1BEV2 1ZBA3 1FOD2 4GB31 3VDDA 1DDLA 4RHV3 1AYN1 1GFF2 1V9U2 2XBO3 2RM21 1NA1B 2R073 2RS11 5ABJA 2ZAHA 1RVF3 4Q4Y1 1RHI3 1RUE2 1RUG1 5AC91 1PO13 1RUF1 4SBVA 1AR83 1RUI3 1NCRB 1Z7S2 1VRH3 3VBFB 1HXS1 1FMD1 4N53B 1R082 4RR3B 5BNPB 4GB33 4FTSA 1F2NA 1AYN3 5BNNC 2VQ0A 2WLPA 1BMV2 2RS13 1PIV1 1QJU2 3ZFFC 2ZTNA 1B35C 4Q4Y3 1RUG3 5AC93 5CFDB 1QQP3 1RUF3 5BNOC 1AR91 4Q4V2 4IV3C 1HXS3 1FMD3 1QJX1 1D4M2 3VBSB 4PDWC 4BCUA 1C8M2 4CDWB 3M8LA 5BNNA 1A6CA 1FPN3 5JZGC 3FBMA 2WS91 1PIV3 1AR62 3ZFFA 4RQPB 1AR93 1K5MB 4IV3A 1R1A2 1R091 4PDWA 1PGW1 2MEV1 1VBA1 5FMOS 1TMF1 1HRI3 1PVC2 1MQTB 1CD3G 5JZGA 2WS93 1VBB1 2FZ2A 4FTBA 5CFCC 2RMU2 4RS5A 3VBUC 1AL22 1R093 5GKAC 1EAH2 2HWC1 1OOPB 1QJZA 2HWB2 2MEV3 1VBA3 2RR12 1PGL2 2ZZQA 1TMF3 4YVSB 1VB2A 2BFUS 3VDDB 1C8NA 1AYM1 1TME1 2RS51 1RUD1 3TN91 2HWD1 5CFCA 5L7OB 3VBUA 2HWC3 1PO12 4JGZC 1AR71 1HRV1 2WFF2 5J98B 3J8F2 4Q4W1 2BUKA 4GMP1 1AYM3 1BBT2 3JB8A 1OHFA 1TME3 2RS53 2HWE1 3VBRC 3TN93 5C9AA 2HWD3 4GMP0 1VBE2 5ABJC 1QJY2 1AL0G 5FMOL 3DPRA 1COV1 4AEDB 1QQP2 1AR73 3VBOB 1ND2C 1HRV3 2RS31 1RMU2 4GMP3 5K0UC 5BNNB 1RUC1 2HWE3 3VBRA 1VAKA 3ZFFB 5DDJ1 1B35B 2PLV2
chains in the Genus database with same CATH superfamily
1FPN2 3OSDA 5BNOB 5FP4A 2D3PA 4KL1A 1PZ7A 3W58A 3IPVA 4R8HA 1COV3 4XQDA 4CCEA 4Q4X3 2ZKLA 5EYXA 1C5IA 5FBZA 4CU8A 2EAAA 3J26N 4YNIA 1CJDA 1HJGA 3GCWA 3DV8A 3O1TA 3OBZA 4NWVA 5FZDA 1DGWX 1DGRA 1X33A 4ZU7A 2ILMA 4M01A 4H3WA 5F7UA 3ZPYA 1POV1 3NAPA 1OD3A 4K40A 4NIHA 5D1IA 3C7EA 3WQ1A 2LUWA 1HRI2 4Q0UA 2PN5A 4L9BA 1WMFA 1YFWA 1RUH3 1W9TA 2Y6JA 4NOTA 5CA6A 3PURA 4YZ2A 1ZZ8A 3RFRA 4MADA 1DFQA 2NLRA 3WQ0A 1FAYA 3JQXA 1OI6A 1PO23 3OGSA 2OPWA 1O59A 2Y6KA 1LU2A 5GZFA 1V6JA 2Y0OA 5IAXA 3HPNA 3P3PA 5C3RA 4Y1ZA 2GSYA 1LHWA 2OIIA 4PCRA 1FOD1 2OQ7A 3NV3A 4XW3A 3MW2A 1XSQA 4AI1A 4AK3A 1REDA 1WW7A 5FZGA 4COVA 4A7KA 1HB4A 4MH0E 4OHZA 1Y7BA 4QX1A 4AAPA 4ASMB 5A3MA 4QD2A 3AM2A 4CP9B 1K3IA 3OBRA 1PX4A 3RWKX 2CYFA 3AP5A 3BYWA 4YARA 4BQ1A 5GLWA 4CCLA 4Y20B 4RS5C 1VB4A 2YG0A 3ZYFA 1QJX3 4YGEA 3T08A 1H2KA 1V00A 1OBNA 1I5PA 1LGNA 1R081 3MIGA 3WR0A 1UY4A 5JCTA 4KBZA 3VUOA 1HN1A 2B7YA 2VCMA 1NZIA 4MHRA 1RTVA 4EZ4A 1BYHA 1BKZA 1ULDA 5KXCA 4L8QA 1JYTA 4PBPA 1SLLA 4R4XA 1O4TA 1RUE3 2AENA 5ACA2 1QH7A 2A75A 3UGGA 4AVBA 1GMMA 4W50A 3KCYA 3JBG2 1Z7S3 2HWD2 4Q1PA 1O3TA 2SBAA 3Q8BA 3NJYA 5FP3A 1A3KA 4WM7C 5FY1A 1H2MA 1JW6A 2X8KA 2ZHMA 3IAPA 4L2NA 2RHPA 4ZU5A 2D6OX 4XFHA 4XIKA 5F2WA 3VBRB 2GMMA 1SMVA 3RZZA 2YGLA 5BNPA 3AFKA 5C3QA 1GP4A 1DYOA 1VBB3 5FMBA 5FZ8A 1SDWA 2JD9A 5ABJB 4DXSA 4P14A 1QOTA 3R6SA 2IVIB 4RHV2 4Q4V3 1N3QA 1X50A 2F4LA 1S55A 5CFDA 4BXSV 2R072 2D98A 1S0IA 1D4M3 4I0BA 3QOPA 5A70A 4MUVA 4WM7A 4EWEA 3Q9OA 2WT0A 1OPOA 5K0UB 1O3SA 3OPWA 4UBHA 4DUVA 1OKQA 1A8DA 1W6MA 5FPBA 3RZKA 3VZLA 2LW8A 4B7EA 2DCTA 1GYKA 4HVQA 2D97A 4XMAA 4ZS3A 3ACHA 3DXTA 2KD7A 2GC0A 4P9JA 3N7JA 1ZREA 3EQEA 3ZYRA 4FPLA 3S5AA 5KXDA 4BPZA 1F5FA 2E53A 4WZFA 2VL4A 1R1A3 4CPBD 5GLZA 3M70A 3ZSMA 1GSLA 1NOVA 5H9RA 4CDUC 5AC92 1G7YA 5FV3A 1X8EA 3EB7A 4IESA 4PLNA 1CZTA 1PGL1 4IUGA 2L9LA 4COWA 4CP2A 1NCQC 1YYNA 2WT2A 3RMYA 4BQYA 5FOJB 1YNAA 4H7LA 2SLIA 2DWRA 2QQUA 4K9SA 1UMIA 1WW6A 4D7SA 4XXAA 1DQ4A 2I2SA 2E7TA 3RZHA 5IW0A 1LB2A 1S0BA 2KXLA 2Q1FA 2VBPA 4B4QA 2XUMA 3MGUA 1X36A 4LBNA 3VZMA 2JB8A 2VNOA 2VZPA 4LBQA 3S30A 4QPIC 3ZYHA 2RR13 3GHMA 2BFUL 5GZGA 4Q2FA 3VBHB 3ETPA 2X5IC 3OF1A 2ZGQA 3UNPA 1J3RA 1HDKA 3AB0A 3PVOA 1JH5A 4K8FA 3ZYPA 3U0ZA 4FI9A 3ZXDA 4A42A 3FLTA 3VHRA 1PNFA 1W0PA 1C57A 1WLCA 4GJZA 4KBBA 4B7KA 2JG8B 2XHNA 5HXVA 3WDWA 3I59A 1ZNPA 3X29B 5H9PA 3AP9A 2YBPA 4QPIA 4UWDA 1UY1A 4D7TA 2X5IA 1W9SA 5FPXA 3ORJA 3ZFEC 4DY5A 3UESA 4AEDC 4QXBA 4I09A 3UETA 1LENA 3I4IA 1K42A 1W06A 1OQDA 3CJIC 4HT1T 1ND3C 3I2IA 5A6XA 4DZGA 4AI3A 1YLLA 2W91A 4OLLA 3U1XA 4LULA 3LPGA 5C8CC 1UKGA 1WA6X 1KD7A 1MS8A 2OUHA 2PLV1 3CEWA 3KVBA 2IZWA 3AKTA 4OQ8A 3B69A 1QJY3 5CFCB 4ZHNA 3RYPA 4RGGA 3V56A 4LBLA 3RQ0A 5D21A 3WF1A 4Z8BA 5LATA 5HXMA 1H0BA 4J1WA 2R1BA 3OB8A 4IGQA 4EWAA 3F95A 4EV0A 1YXWA 1YCIA 3WOGA 3ZFEA 1PMJX 2B4KA 3H9AA 4AEDA 1QEXA 1NCRC 4R52A 2JIGA 2ZGLA 3CJIA 2Y64A 1ND3A 4XC9A 3M3IA 1UF2C 2WFPA 4GIQA 1OVSA 1YC61 3RG0A 3ZN6A 1NY71 4FPKA 5C8CA 3ENRA 3ZLIA 5FQ0A 5JI7A 3SLIA 3IT8A 1D2SA 1UYXA 3LB9A 3RI8A 4AI9A 4J25A 4D8MA 1TME2 5EIYB 3KV9A 1RUD2 4YZ3A 1QDOA 4BZ4A 3M1HA 4QKNA 3A0NA 3VHOA 1L7LA 4BMBA 5A3LA 3RWNA 1NCRA 2OUJA 1LOBA 3PUAA 3OYWA 5AVPA 5T52A 1JU3A 4FAHA 5H9QA 2BYVE 4DB5A 1QJEA 1XB9A 1UU6A 1AR72 3LDRA 5A80A 3KVAA 1ZZ9A 4Y1UA 5IVJA 4Q4W2 2KA3A 4CDWC 1O6UA 5FO8B 1LOGA 4JAAA 4Y3OA 3V0BB 3T2TA 5FO7B 4IXLA 4UF0A 2OKXA 4BDVB 1ASJ1 3LQCA 4Y4YA 3ZSKA 3LF7A 2FDHA 1U5XA 4BM8A 1CAUA 4CP0A 4WM8B 4CEWC 1Q8PA 2IUWA 4XF0A 5CNAA 4LBKA 4Z07A 2W92A 3LPFA 4E8DA 2AREA 2QZ2A 1HV0A 2RS32 2W5FA 5CG8A 5E8AA 4CDWA 2ZGKA 5I0TA 4QX5A 2FBEA 1BQPA 4E9KA 2XMLA 1XE0A 5J37A 1HX6A 5CKNA 4Y24A 1YWKA 5DDJ2 3UKNA 2JG9C 1IS6A 2JDPA 1C3HA 1ZBE1 4HZFA 1YJKA 2FCUA 1A34A 4CEWA 3AMHA 4DO0A 5EZWA 2OYZA 2P6CA 1JN2P 1MEC1 3SCGA 2PAEA 2BGPA 1OURA 4CDXC 4DRRA 2XPJA 1IG0A 3IIAA 2HWF1 2TNFA 3HMYA 4AEMA 2LROA 2BVVA 3K3NA 3ROUA 2MHFA 5D8AB 4YVSC 5ACA3 1VPHA 3ZFGB 3DYMA 1CZSA 1IHMA 3JBG3 4R9CA 1S2BA 3ES1A 1XXNA 3T09A 4O7XA 4XUQA 3SKJE 3T2QA 5A3UA 1SPPA 1S0JA 5F39A 3U78A 5JOWA 1LECA 1JUHA 1WMEA 2VZUA 3GZAA 1XNDA 3H7YA 3OY8B 4S2DA 3PHMA 3BIWE 2H6CA 4CDXA 2UY8A 1ENQA 2VG9A 3MHZA 4UOJA 1VRH1 4NHXA 1UIKA 3CL1A 4HSJA 2IFRA 3O1VA 4ZKTB 4CEYB 3AKSA 4P9WA 3AL5A 3R05A 1NLSA 3VKFC 4LNVA 1FOD2 2DCZA 1W8UA 2ARXA 1DDLA 4QKBA 4RHV3 1AYN1 1GFF2 1W6OA 5HV4A 5DUVA 4L92A 3PUSA 2RM21 3SKVA 2R073 3WP6A 2VH9A 5LRSA 1WUVA 1QGLA 2DUPA 2ZXQA 3NSTA 3FJSA 1EY2A 4Q4Y1 5LEJA 3MUY1 4DFSA 2FMYA 3OEBA 3I2OA 3UJOA 3WSOA 2XGXA 2RVAA 1NT0A 1BK0A 1Y9GA 1BLZA 4NVPA 3HQXA 4NRQA 5F5AA 5C3PA 3NMBA 2RDQA 1R082 4CRQA 4RR3B 4O9EA 3KV5A 3J7NA 4XBQA 3ZPOA 4FTSA 2AACA 3B00A 1U5IA 3D8CA 5BNNC 2VVDA 5DDJ1 5LA2A 3VD9A 5JXHA 3FBYA 3AP7A 3FFZA 3K4ZA 5AC93 2DBIA 1H1AA 5C3OA 3N9NA 2ZEWA 3RZMA 2VQAA 5DZGA 5E89A 5JOYA 4QT6A 4UXAA 1JXNA 3S0MA 4BCUA 5F32A 1RYYA 1ST8A 1NYWA 3AZXA 4FPFA 5A3WA 5SV5A 1YO8A 2WC2A 2WQ4A 2ZGTA 2KR2A 2LM3A 4LK6A 4Y5SA 5FZ6A 4D6QA 5BNNA 3B02A 2TEPA 3RMXA 5DAPA 2DV9A 1NQDA 1ACCA 2YYOA 5IVCA 1FI2A 2YBKA 2XVKA 2Q1ZB 5IVFA 4N8MA 2A6WA 3IDAA 1F35A 3ZIWA 1MVEA 3IDBB 2EIBA 3NV2A 3I49A 4P5YA 2PHLA 5FPZA 1GU3A 1GOHA 4XJ9A 2J1UA 2YC2A 4NAMA 4GQ7A 4XDPA 1HKDA 5CKQA 5I0DA 2BJSA 4X6RB 2PQSA 3U37A 1OT5A 4OVEA 2IXLA 1TMF1 1S0EA 4CUCA 3ZDVA 2WNVC 2WUHA 3TNQA 3AP6A 3ILRA 1IS5A 3B5LB 1W90A 3SH3A 4DS0A 3D0JA 3R4SA 3DKQA 2WNUC 1J84A 3WNOA 1PZ8A 4RGKA 3RSJA 4KU8A 5M0TA 4B8EA 3PUIA 2O8OA 1T6BX 3UKTA 5IHRA 2C4XA 1UXZA 4PI2A 2JDYA 2Y34A 1OA2A 3KWVA 5F2SA 4CVUA 1PGL2 1DYPA 2JECA 4N9HA 5F9TA 3QCWA 4H7MA 4NRMA 4AI0A 3VDDB 1C8NA 2WNVA 1QWRA 1AYM1 1UX6A 2GNTA 2Q4SA 5FZFA 4HETA 1B09A 4K3UA 1OLRA 1V6KA 2XONA 3TN91 1GUIA 3ZX7A 2B39A 2HWD1 4U2AA 5L7OB 1G86A 1OF4A 3MV11 3LD8A 4JQRA 4QQOA 4XF1A 3R0RA 4YW6A 5ERLA 3RI9A 4E4ZA 3S5QA 1RUNA 3GJBA 2BWCA 1GZTA 3AC0A 5FZIA 2MPFA 2ZEYA 3EBRA 1F9KA 2R6QA 5F5CA 1HRV1 2PHDA 4XTPA 4BB3A 5JLVA 5C33A 5LASA 1TME3 3CBNA 5JAXA 1MZ5A 5DZFA 3T4VA 1KFUL 2EF6A 3AZWA 4JKMA 1I5ZA 1XJAA 2ZX0A 4KQ7A 2VMFA 3KQRA 5JUVA 1G6NA 1AXKA 4TLFA 5KHJA 1O3QA 2ZEZA 4P9XA 5FMOL 1W28A 3DPRA 4NMIA 1RUOA 1W6QB 1SLTA 2C5DA 4TWTA 2FMDA 1AR73 3VBOB 2DVFA 1WLWA 4FPEA 5LEKA 1WBFA 2D43A 4UYBA 3I3EA 4YW7A 3TAYA 2E26A 5F5IA 1VMHA 2VOKA 4OHWA 5FZEA 1LEDA 3WCRA 2ZMKA 1P8JA 2Q8CA 3ZSJA 1V6NA 1SLAA 1B35B 2PLV2 4LLOA 2WQ8A 4WV8A 1BVP1 3ZMNA 4LJHA 2WN2A 4YGBA 4CU6A 2Y38A 4HLTA 5DAXA 3K75B 2R061 1FV3A 1IGOA 4IV3B 1W8NA 5D2AA 4D6RA 1JZ7A 1OUSA 4PDWB 1GWLA 2P3KA 2VE1A 2CL2A 3O12A 2JWPA 4S2HA 4AFAA 2RS33 1KS4A 3USUA 4WVVA 4AGRA 5JZGB 3THCA 1UZWA 2YPDA 4W8JA 4ISRA 4EYUA 2AYHA 5KXEA 4BJ0A 1NY72 1HIXA 2WZR1 5DDJ3 4QHZA 4CA9A 5JXGA 3Q8FA 5L9BA 2VZOA 1CPMA 1KFXL 4LKFA 3WP3A 3NO8A 3J4UH 4HG6B 3RRDA 1Q56A 2XJPA 3MV01 3WF0A 4BYYA 3MLJA 5C8WA 4R9AA 4TTGA 1TE1B 3OUIA 4AVSA 4BMEA 2YGMA 3IKWA 2AH2A 1NE4A 1WCDJ 2IFWA 4TN7A 5ANQA 4YW1A 2LS6A 4AFBA 1EPWA 1UNBA 4TZDA 3QACA 2RJKA 1DLCA 1GICA 4GH4C 2QDRA 3OPTA 3HN3A 1GP5A 1PX3A 3VBUB 4AYUA 1WW4A 3C7HA 1H8TA 2VNRA 4OMCA 2W9XA 1ASJ2 4UFIA 1YFXA 1W2AX 1MS1A 3T1LA 1TG7A 3AVRA 3H1YA 3EO6A 4I3GA 3OGJA 3KV6A 3Q8EA 3H0OA 1S2KA 1FOD3 3W21A 5I0SA 4TXWA 4YVWC 4IW3A 2Y26A 3NKGA 2XQXA 4OI4A 1WCSA 3IDEA 4KG8A 1W04A 2J1TA 3ALQA 4N7IA 5GLUA 4GH4A 2EIGA 4OHXA 1KJLA 2DVAA 2J22A 5IK8A 3LEKA 4CCKA 2JXAA 3FUQA 4CU7A 2YXSA 4GXLA 3K48A 4ATEA 2XJQA 4JGZB 1ZBE2 1CX4A 1C8M1 4LBOA 4HKOA 1R083 2A70A 2WKKA 1W6PB 3UGFA 1MEC2 2XJUA 2ZGNA 4FSJA 3UT0A 5DN2A 3INAA 4YVWA 5LWBA 2HWF2 4N53A 4URAA 1ZA7A 2OA2A 4LORA 1JZ4A 5IK7A 1ULCA 4E4DX 4KWJA 4AVAA 3KCXA 3LEMA 1SBEA 4IEUA 1BHGA 2ZBJA 1SEFA 1N1TA 3SITA 1KDMA 5C9AC 4HVRA 4WVMA 4RQPC 5T5LA 5DABA 1W05A 3VKLA 4A3XA 5FK7A 2FCTA 4B4PA 3O5SA 1LOEA 3ZSEA 1S0CA 3BI3A 1Q8OA 4CPBA 4IE0A 5KHKA 1LHVA 3GGLA 2GNBA 3BU7A 2UWAA 2VUDA 3VBSA 3H7JA 4A7YA 3OG2A 3WVJA 1VRH2 3DKWA 1W9FA 2NMOA 4LO5B 4CCNA 1BCXA 1WMDA 3GBFA 4OI1A 2B46X 4U36A 3PJQA 4D69A 3KB5A 1YI7A 2JEMA 5A7QA 1Q8SA 4E4SA 1SG3A 4K7JA 4CDQC 3S57A 1AYN2 1F15A 2RMU1 3ECQA 3ZIXA 4RQPA 2C0ZA 1C28A 2RM22 3WUCA 1AL21 2VJXA 2WNEA 1ENRA 3M3CA 5FZKA 4URTA 3B9CA 4Q4Y2 3QLQA 1OXCA 1H4GA 2HBTA 5L73A 4IEYA 4J6GA 2ZAAA 3IB3A 3I3QA 3AYDA 3N7MA 2ORXA 1Z0HA 2EAKA 4PBOA 5FYTA 2RJLA 1GLHA 4ES9A 1JHJA 3NAPC 3TWIA 4YG6A 3IAQA 4AHYA 4BQ3A 1VLNA 3KV4A 5DUUA 1CESA 4CDQA 5CU1A 5CKMA 2WWUA 4FXGB 1GANA 3O1RA 5G04L 2PHFA 3UK9A 2GC3A 3LCPA 3POSA 4IEQA 4JC1A 3THDA 2VZRA 2WSUA 1PO11 1LHUA 4QPGC 3WT3A 4IETA 5B4XA 1BJQA 2I45A 2WFF1 5FKCA 5TSWA 3CLPA 3J8F1 3GZUC 4UFHA 5FZHA 1NZCA 3MIFA 2G19A 1BBT1 2VECA 3I54A 3WG2A 3KGLA 3WW3A 3ZYGA 3W5MA 1URXA 1ONAA 3A22A 3CU7A 3AMMA 4QMAA 5JI9A 2QQIA 1O5UA 4JHTA 2D6PA 4YM1A 1IPJA 4Y1XA 5A7WA 5BXXA 1M06G 2R1DA 3LIGA 4CXYA 2PFWA 1GR3A 2RE9A 4I01A 1EP0A 2EVXA 3NW4A 4NHYA 4CP1A 1POV0 4E2SA 3N4MA 4Y1VA 4RS5B 4NE9A 3ZOIA 2ZJCA 5EJ1B 5C7GA 4QPGA 3RJRA 4XE9A 2LALA 4IEVA 3UYJA 2VMIA 1DGWA 2GC2A 3C7OA 2W1WA 2K9ZA 2V5DA 3PU8A 5FAXA 4P5HA 1YQ8A 3W59A 1CVNA 2J42A 2XOMA 4FPCA 2JX9A 4YG3A 1LESA 3MFAA 4Y1YA 1TMF2 1ZRIA 4AFMA 2ZKNA 2YZ4A 3KHCA 5CG9A 1OFNA 2ET1A 4LO4B 4OCTA 4FPHA 2BW8A 4AFDA 2O0OA 1N3PA 5FYUA 1W2OA 3BTAA 4AL9A 2RG4A 5I93A 1AVBA 3KCCA 1NA1C 2WWJA 4KMQA 4WM7B 5JXJA 1XYNA 1GQPA 4L97A 2PHXA 5DG1A 2DCJA 4B3NA 4M3CE 2XVGA 1W6MB 2WSVA 3BN6A 2NZ9A 2ID4A 5FFOC 3MIDA 4XF3A 3VBFC 4DOUA 4BQXA 2R041 2VGDA 1QH6A 1V9U3 2R30A 2PLV3 1Q43A 5BNPC 1AYM2 4NIGA 4NO4A 4QQ2A 2ZX2A 2CU5A 1W8FA 2XDVA 4IEOA 4MXVA 4TSVA 1C1LA 4IDZA 5F1RA 5FPUA 1NA1A 5BNOA 4LHSA 3TN92 3VDBA 2R16A 2DU1A 5LK5A 2BBVA 5CFDC 3HBZA 1KQRA 2ZGUA 4XUNA 2OZJA 4GWJA 3WW1A 2RDSA 1AXYA 4UFKA 2XUEA 1OH4A 3HWJA 3ZSLA 2WN3A 2DTYA 3FN9A 2V09A 2IXIA 3USSA 3VBFA 1Z78A 2P2KA 3IN9A 4NUBA 4F8AA 3PVBB 1VBC1 2WNOA 2CV6A 1HRV2 5DG2A 5A7OA 5F3CA 2XLFA 2JKXA 2ERFA 2A71A 2VC9A 2W46A 2HJIA 3E5XA 4WZCA 4ISQA 2ZHLA 2EA7A 3VZOA 2D40A 3H8XA 4QU1A 5LW9A 2DCKA 4CDUB 4LBQB 3WNNA 2CSGA 5FJKA 1ZM1A 1X82A 3OJBA 1CAWA 4XFFA 4I2OA 1LHNA 1XQNA 2VZTA 1JOBA 4C8DA 1ND2B 1RIRA 4XMIA 5DUXA 4CYDA 1NCQB 1ZRDA 2PELA 3KLSA 3T0DA 3O1UA 3WHTA 4ZXEA 1EV11 3OPZA 3MI8A 2DDUA 4NR1A 4BU2A 1ZRCA 1ULPA 1A8MA 4FPGA 4GWMA 1H2NA 2V5YA 2UWBA 2VR4A 4YGDA 3T4HB 1I6XA 1UY3A 4M4RA 3I59B 3CZJA 4I3PA 5FY8A 1X9PA 4AQTA 4B29A 5FYZA 3JD71 5A7NA 4JVAA 4Q8KA 1ASJ3 2NYYA 4KWUA 1W99A 3P3NA 1DQ2A 1UU5A 2BNNA 4QPIB 4B1LA 1L3JA 1RUJ1 5T50A 3RZLA 1YQ2A 1W2UA 1DZQA 1VJ2A 2JB4A 2X5IB 4LHKA 4MO3M 1FX5A 2R062 2WO7A 2WR9A 2BU9A 3KMHA 3MIBA 4Y20A 3BKZA 2BTVC 4AHWA 1ZZBA 1DQ0A 1LRHA 4PIYA 5A3PA 3CDZB 3M4FA 3PU3A 4BK5A 3PUQA 1OOPC 3C3VA 2G9FA 1Q8VA 2P6HA 3WNMA 1XU2A 4LTAA 1ZBA1 1GZ9A 2W3JA 5FYIA 3UGHA 3T2OA 4F3JA 3AKQA 5BV6A 3V65A 5C5UA 4ITCA 1AJOA 4XPVA 2WZR2 4I0WB 4ORFA 2JE8A 4FFGA 1RJ8A 2G9GA 4HFSA 3LGRA 5JIUA 1QNWA 1TQ5A 1ZBE3 1EAH3 4XURA 4LEJA 2QQKA 2QFEA 5FZ9A 1RHI1 3SISA 2W0XA 4W4ZA 3ZFEB 5CADA 1AR81 1MEC3 1RUI1 4Q4X1 4BOWA 3CJIB 4Y22A 4GKYA 1ND3B 4YW4A 3ACFA 2HWF3 1OOPA 2QQMA 4MGKE 3ZN6B 2J1AA 2Y6LA 3I2GA 4AI8A 4V2VA 1U5ZA 3WP4A 4NPLA 2OW4A 3HQRA 5C8CB 1O8SA 1AJKA 2VW2A 3VD5A 1OLQA 2YV8A 4Z82A 3OCPA 4Q0QA 4YZ5A 4YFWA 3VD4A 3ZXFA 2IVJA 1Y3TA 2Y6FA 3VZJA 5ABJA 2B42B 4WBBA 2ZAHA 1GKBA 2JDAA 2CGNA 2BQPA 4LOTA 1RUG1 1JODA 5LZ6A 2BOJA 5CISA 1NCRB 4MSVA 3SH4A 3OYWB 2VUJA 3KF5A 1VRH3 5K4LA 4F7ZA 4JRAA 2GU9A 1D4VB 1GWMA 4A7ZA 1HXS1 1QOSA 2UYBA 3H3LA 1WD4A 1YIPA 4DY3A 5FXVA 1QU0A 1OH3A 1F2NA 3LA2A 4QXCA 4PF5A 3ILNA 1AYN3 3WDTA 4AQ6A 1YIFA 2ZMNA 2QQOA 4OUMA 2D6MA 2V4AA 5GZCA 2FQPA 4UF0B 4BQ2A 3V0AA 4D7YA 2ZTNA 2D6KA 4D3WA 4Q4Y3 4EROA 5KHIA 1W8WA 1QQP3 2D3RA 3O1PA 1CAUB 1JMUB 1AR91 2UWCA 1OMIA 1TNRA 1UYYA 1DHKB 2VQUA 3PTRB 4MGZE 4RD7A 1RJ7A 3VZNA 2ARAA 1RINA 4HXCA 5C3SA 1UOBA 3B01A 1QJX1 4L99A 2Q8EA 1C8M2 2XJRA 4AHXA 2ZMLA 4CDWB 1KRIA 1NAEA 1HN0A 5LRRA 1FPN3 1FXZA 2H0BA 4EQVA 3FBMA 2WS91 3PTYA 2Y6HA 4AXOA 2ES3A 2BGOA 3MLKA 5FR3A 2XHKA 1L7RA 5CYYA 1EYBA 2D7FA 3T0BA 2JG8C 3U4SA 4LR4A 3EJKA 1K5MB 5K7PA 1S2EA 5FP9A 5FZMA 1AF9A 4BISA 3QH6A 1O8PA 5DUWA 1GNYA 5BNQA 5IVVA 1H6YA 3J9SA 3AJYA 1ZX5A 5FMOS 2IXHA 2QQLA 4LA3A 3HVDA 1HRI3 5T3NA 4K1ZA 2B5HA 3LEGA 1CD3G 3U11A 4BK4A 5C70A 5HV0A 2HEYF 5B4NA 2ZGMA 4YW5A 4X8NA 1VBB1 2JG9B 1Y4WA 2D6NA 2VXJA 4P08A 3CMGA 2JG8A 2FZ2A 5CFCC 4OZOA 3PVEA 2RMU2 4R4ZA 4M3CA 3Q8CA 4RN5A 1RITA 2QCSB 4Y4RA 3WQ7A 1AL22 5I8TA 1DQ5A 3ZM8A 4XZUG 3PMSA 5E6HA 5GLTA 3WX5A 4XFAA 4S2FA 3V64A 3AMQA 5FBJA 5T5OA 1TMF3 4YVSB 1F5JA 1VB2A 3K4DA 5BPXA 4XAEA 1W8TA 2DVDA 4PF1A 3OTFA 1JOJA 3WF2A 1E5SA 2HYXA 2N7GA 1XE7A 5KHHA 1JYWA 4E27A 5FTTC 4OI0A 2DBNA 2V72A 2G9ZA 3AZVA 2HEWF 1SACA 4KGGA 1H6XA 3A23A 5CFCA 1OD5A 2H6BA 1XC6A 2CDOA 2DURA 5CEHA 2VTXA 4MXWB 1PO12 2AEZA 2Y60A 4LBJA 2XKOA 4YLZA 5EJ3A 3JQWA 3WF3A 2WFF2 1JUIA 2A1XA 2VTXJ 1UAIA 1WZXA 3HIFA 3J8F2 1KXGA 3LFMA 1O4YA 4HOOA 2BUKA 2Q0AA 1AYM3 1BBT2 5C5TA 2WZ8A 2X53S 3JB8A 3T2PA 2HWE1 5BUVA 3WNKA 2R0HA 4I02A 3TN93 1MZ6A 2HWD3 3J7LA 5FLIA 4HANA 3N9MA 4Z2WA 3NNLA 1W2NA 2VMHA 5AVAA 3NKTA 3C8XA 1HQWA 2IWGB 4RL7A 3WY6A 1L7QA 1J3QA 1WA4A 2PMWB 3N9LA 4C0HA 4CE8A 3OUHA 3M3QA 1POQA 1HRV3 2ADEA 4PHZA 1J83A 5EQUA 1H1MA 5FDBA 1UYPA 1JTZX 2WQZC 1JZ2A 5AFEA 5BNNB 1X7NA 5H9SA 1DBNA 1UU4A 3OD4A 1RUC1 4XBNA 1ODMA 4N9IA 4QQPA 1VP6A 1F31A 1YEWA 3WNPA 1Y9QA 2NN8A 1UD1A 3HNBM 3V0BA 5FMCA 2MNGA 4NWWA 4W65A 4KH9A 2PAKA 2YHJA 1W6NA 1MPXA 1LKNA 3DF0A 5J7MA 5FUNA 3HNYM 3WF4A 3HJRA 3ME2A 1UKRA 5A1FA 2ZS6B 3CJXA 2XXZA 3LFIA 5EWSA 1XNTA 2ADDA 2QTWB 3S7EA 3R4DB 3OD0A 1UQXA 2F4PA 2R042 3GM8A 4JX0A 3LSEA 3S7IA 5LBEA 4CU9A 4NHMA 2K46A 4YG0A 1DYKA 1W9YA 2OX0A 4IEWA 4FBFA 2R063 4NPRA 4D6SA 3I8TA 5T5JA 4QDSA 4ASKA 1FATA 1XYOA 5A33A 1UMZA 3KD4A 3P5BA 5A1LA 2GC1A 4DINB 1U12A 1BEV1 1V6LA 5FO9B 2WNVB 4QGMA 1J1TA 1C4RA 3KT7A 1RXGA 3ASIA 4IE7A 1VBC2 2WZR3 3OBTA 4XTMA 2WNUB 3BOPA 4C90A 4XIOA 1RGSA 4LKSA 2ZHNA 1MS9A 3IMNA 1NG0A 2ET7A 2ARCA 1PVXA 2XKPA 2Z4FA 3HQUA 2VUCA 3BTZA 3DCQA 4XABA 5JSOA 4BLIA 1HB3A 1XE8A 2ZGPA 1W39A 2P37A 4RFT0 2WYFA 1CAVA 5CAZA 3E5UA 4BQ4A 2C24A 4M0NA 1O91A 3OY8A 1KGYA 4NHLA 3TBDA 3ZYJB 4GJYA 3FHAA 1EV12 2OZ6A 2VO5A 3NWKA 1BXHA 4LHNA 2TBVA 1QJU1 4CTEA 2KM2A 4IE5A 3WD5A 3WHUA 1D0GA 3HD8B 1HB2A 2VZSA 1E5HA 2VCAA 4FXKB 4IV1B 5A3TA 2G4IA 3CNAA 2VCBA 3JD72 1XNCA 5LBFA 4FFHA 4XJUA 4LMFA 4QB6A 4P9IA 1NQJA 2D44A 1GP6A 1RUJ2 3ZXAC 3LA3A 3H8RA 1SHWB 1KITA 2CY6A 3PVNA 5FYMA 5IJRA 4JDOA 1QXPA 3FE5A 2C9KA 3BALA 4O65A 4BLJA 3LA7A 4N43C 5A6ZA 5IVEA 4M4PA 5FP7A 5EHDA 4LO8A 3B9IA 1CN1A 3ST7A 4RR3A 2X09A 3KT1A 1AR61 2ZX1A 5FPAA 3BTYA 1ZBA2 3I3MA 1H1IA 1CAXA 1M4WA 1UPSA 1W2TA 1XU1A 2YUEA 3KF3A 4IE4A 4NIDA 1F8VA 1IKQA 4C91A 4XFCA 3CF6E 2FDGA 3VKMA 2H0VA 1IOAA 1SZBA 4XDOA 3O14A 2E9QA 2CWSA 3DPRC 4QU2A 4X8PA 4A3ZA 1RHI2 1PGSA 4H2AA 2J1VA 1AR82 1RUI2 4Q4X2 5A3NA 4OYUA 1LGBA 1H9PA 1IG3A 4LHLA 1PVC1 1X8MA 3WDXA 4N43A 2ZGRA 4QM8A 3POYA 4EJRA 3DUIA 3UL2A 2JDMA 1YUDA 1ZZ6A 1UYZA 2XL9A 4FQZA 4Q0VA 1J59A 2J1SA 3MW3A 3T3YA 4NRPA 1RUD3 3QBQA 1S4CA 2F6BA 1YQ5A 2DUQA 5E1RA 2Y6GA 4ATFA 3F2ZA 2GDFA 4JQTA 4K21A 3SNMA 5JOZA 2BPA2 3NVCA 4KGQA 2HWB1 1RUG2 5FZ3A 4NROA 3MO4A 4DXRA 4JKLA 1SFYA 4ASLA 4OQ9A 1AXZA 5FZ4A 5C4WC 1FNYA 2JENA 2NM1A 5E16A 1E5IA 1G8WA 4Q4W3 1HXS2 1OKOA 2CTVA 2XL7A 4LIVA 3FLPA 4K8RB 3TEZA 5LA9A 2BNMA 1JZ8A 4AGGA 3LKJA 2RDNA 5DMYA 1CX1A 5L9RA 1N47A 1H30A 1AL23 1DF0A 1UO9A 1JI6A 2FDFA 2E51A 4JZRA 2VW1A 2Y33A 5FZBA 5L7OC 1S0DA 1T6GC 2A5ZA 1GOFA 1R1ZA 1UZYA 3HNMA 2O1QA 1AR92 5IAVA 2Y0IA 2E6VA 2VU9A 3I2HA 1NXMA 4AR2A 1SDDB 2EXKA 5A32A 1JYVA 5LK7B 5C4WA 1PZ9A 2PYTA 1UY0A 1QJX2 3NRUA 3MYXA 4ZONA 4P9LA 2QJVA 4QQLA 1GOGA 2JDKA 3UKVA 4XYXA 4ET7A 4JGYC 2Z42A 4EE2A 2YC4A 4GH4B 1WCQA 1GQGA 1O3RA 1VBE1 2VNGA 3VHNA 2WS92 1OFSA 2WO3A 4AHZA 5L7OA 4DEQA 1H8TC 3ZN4A 2QQVA 2FZ1A 2WFF3 3RZGA 3J8F3 1RMU1 1WWYA 3FLRA 3O7OA 1BBT3 4Y5Z0 3ZXEA 2W1SA 4YVWB 4LE3A 3VBOC 1TNFA 4AF9A 5JMOA 1JBCA 1POV3 4JGYA 3TEYA 4L0PA 2BGCA 5FCCA 4PIXA 3VL8A 2BZDA 4YZ1A 1PHMA 1CQ9A 3MIEA 3RS6A 4XOGA 1IQAA 5A7SA 1VBB2 4HMZA 5A7PA 3GBGA 4IQPA 4XZPA 3ZMOA 1UCXA 2WZEA 1GZCA 1W03A 1PMIA 2PHTA 5FK8A 1GZWB 3TEWA 4DMIA 3HAGA 2HKXA 2VOXA 1WLTA 3AZZA 4FTEA 1IPSA 5DAWA 3E6CC 1WGPA 3B3QE 3ABZA 5FZOB 4DUXA 2XWJB 3VBOA 1BZWA 1HQNA 3VD3A 2CGPA 2FCVA 4B1MA 3O1SA 5J09A 4FOQA 2B8MA 4EN8B 2Z2SB 4N53C 4HPKA 1CGPA 5C9AB 1APNA 3SCHA 1DG6A 3I7DA 1LOFC 1B35A 4QX3A 3VN4A 2WL1A 2HH9A 2YPJA 1QMJA 3B93A 3OOXA 3KT4A 1K12A 4BQWA 2VBDA 2QQJA 2GMPA 3WP5A 4Q1RA 2OT7A 4XFGA 3WV6A 2HEVF 5FYBA 3MBWA 4LUMA 4AQ2A 4YZ4A 3VBSC 2R043 4INDA 3HN1A 4CUBA 1G9DA 4PIZA 1ZRRA 4OHVA 4C0BA 4DEVA 4MGTA 4DRVA 4GD4A 3IBMA 2VCCA 4CDQB 5GLVA 1STMA 1JZ3A 2VY0A 3P1IA 1LOFA 1SFPA 4LE4A 2HWE2 3BGAA 2DUOA 2GNMA 2UURA 1CIWA 3IPVB 4XJAA 2X10A 5JR7B 3MUZ1 3AL6A 4LITA 5FYYA 5LBBA 4DNYA 3A0KA 2JDHA 2CAVA 1VBD1 1ZZCA 2W94A 1WKYA 3I3DA 3OBAA 1QHDA 1VBC3 3J7HA 4LT5A 3MFCA 3NAPB 3S6PA 1QIQA 2WRAA 5HPOA 1UW8A 3MZHA 4XUOA 5EFUA 2VULA 4QKDA 1MQTC 3SQOA 1RUC2 4AZZA 3POIA 4A2UA 2FD8A 5CBLA 4OFGA 4GKXA 3W5NA 4QPGB 4XACA 3DYOA 3ITQA 3SXWA 1W9WA 2J7MA 4FCAA 2V73A 1EV13 1QY4A 2EXIA 3O0VA 5L9VA 4MX3A 3WLUA 5DQ0A 1OVPA 3AKRA 4BHPA 2ZPXA 2WA4A 5B2GB 3BIEA 3ZKUA 3AMPA 4TYSA 2FDJA 4FFIA 3RVHA 1MQTA 5FJHA 1VE0A 2E7QA 4JV4A 3JD73 4HKLA 4KNCA 1UXXX 2XBO1 4TLGA 4A6SA 3GDBA 3RJ2X 1RUJ3 1U0AA 2QVSB 2ZABA 1RVF1 4I0AA 1MR5A 2BNOA 2BOIA 2VMEA 2YU1A 4QGLA 4AEJA 1US2A 3T0AA 2UYAA 2QE3A 4FP3A 4JGZA 2CGOA 4MOAA 1W6PA 2RJ2A 3LAGA 4B4RA 1BEV2 2C6SA 5HCBA 1ZBA3 3WNXA 4GB31 4QB2A 4E2GA 1VRBA 3LDBA 2W47A 3TYJA 2GH2A 4ZZ5A 5BYNA 1NA1B 2OXBA 2G1MA 1H8VA 2RS11 2AEYA 2E31A 4QDRA 1JYXA 1HB1A 5IFTA 1RHI3 1RUF1 1DQ6A 2BV4A 1AR83 1RUI3 2AZ5A 2W52A 5DAVA 2Q8OA 1LR5A 2W87A 3POWA 1QF3A 3HOBA 4GA9A 1RL3A 3VBFB 4IGPA 1FMD1 5HCFA 5IWFA 4EN9B 4MVTA 4CCOA 3WW2A 5T55A 4LIUA 4UW3A 2PHRA 3DL3A 4XVHA 5BNPB 2IXCA 5A1AA 1JOPA 2ZCWA 4E4HA 4JCKA 2Q30A 3MDPA 1PMHX 2FDIA 1PK6C 1ULEA 2EALA 1PIV1 1QJU2 2B9UA 2CAUA 1IZ3A 3K51A 3TEXA 3ZFFC 5CFDB 5LCWL 1RUG3 3RZJA 1CAWB 5EP9A 5BNOC 1OA3A 2QKDA 2JICA 1MS3A 2BP6A 2VVFA 3AYAA 5BY5A 4YPJA 2QQNA 5GALA 3ZYBA 1MZEA 2OPKA 4MLOA 2B45X 4KWLA 1G9FA 1HXS3 3WDVA 2GP3A 4UFMA 2WA3A 2PAMA 1DU3D 2ZGOA 5GM0A 2PHWA 3M8LA 5J36A 4F83A 4ZY9A 1A6CA 1QOOA 3QH7A 1PK6A 2VMCA 3JCIA 4P9GA 1AR62 1LCLA 3ZFFA 2WZPP 5KWRA 4RFRB 1Q5OA 3U10A 3WG3A 4CXXA 1AR93 1REEA 3GYDA 3PDQA 3RYRA 4AI2A 2ZHKA 3T30A 5JPMB 1R091 1FNZA 1W3XA 1PGW1 1MVQA 2MEV1 1VBA1 3AXEA 3MPBA 3FX3A 3O0WA 5FY7A 4BH9A 1Y9MA 2CHHA 1PVC2 1LJ7A 5FY9A 3SEEA 2WS93 3TB0A 2XJTA 3G7DA 4CCJA 3PIJA 4Q0SA 1GBGA 5J3UA 2AUYA 1VR3A 3SEPA 2X29A 3LOIA 3K3OA 4YYOA 3ZVXA 1J1LA 1O5LA 2W1UA 5DXDA 2QNKA 1F4HA 2BWAA 3C7FA 4RS5A 3VLBB 1RC6A 3CIHA 3VB9A 5FWJA 1LGCA 4Y22B 3A21A 3TNPB 5FMDA 1IS3A 4YFZA 1D0HA 2HWC1 1OOPB 2OS2A 2HWB2 3FMGA 4UFJA 3VD7A 4NJ4A 3KGZA 2VQTA 1UWWA 2ZZQA 3A7QA 2X05A 4P00B 3ZDSA 4ES8A 3NNGA 1LAJA 1DGRN 2XVLA 4DXZA 4FAGA 1XRUA 4MGQA 5GJ6A 2R49A 4HBNA 3H42B 1BK1A 2RS51 3NV4A 3GJAA 2VD7A 4XDQA 3PMEA 2A6ZA 2PXJA 3ETQA 2DCYA 3H50A 3NNJA 4YGCA 4Q8LA 5IK5A 4OZXA 5FUPA 1YI9A 4CP9A 4MGIE 4ZS2A 5ISLA 3DGTA 3LEIA 4G9SB 1YQCA 2ZEXA 2VTFA 3MW4A 4AVCA 4ZZ8A 5HCAA 4Z1VA 1Y43B 5AFBA 5A3OA 3NJVA 4PI0A 4XBLA 5F3IA 1IQDC 3D4KA 5J98B 2UY9A 2WJSA 3MEPA 4Q27A 2NQYA 4HN1A 4GMP1 4OI2A 3VL9A 4EN7B 2AR6A 3MIHA 4LXLA 4QX8A 3IM0A 3BUCA 4V2WA 1OHFA 3V0AB 4ARXA 2YFUA 3VBRC 4PLOA 1ULFA 4FOVA 1LU1A 3D82A 1YJLA 4FPYA 2XLAA 4GMP0 4IEPA 3WEZA 1VBE2 3W20A 2LTNA 1FV2A 2XLGA 5ABJC 5JDBA 5FZ1A 1WBLA 1AL0G 3CHXA 5DAQA 3M3OA 1EUTA 5CZKA 1VAVA 3N3HA 1COV1 1JU4A 3AX4A 5FYHA 4AEDB 4QX0A 1CPNA 3P6BA 1LEMA 1AX1A 1ND2C 5FUIA 4GALA 1WW5A 5JMCA 2A6YA 1RMU2 4COZA 1UZ0A 1AX0A 5K0UC 4D0QA 2CWMA 4QPWA 2GN3A 4XF4A 4EN6B 4GAZA 5LY1A 1T2XA 2HWE3 5FQ0B 5FPVA 3WDYA 3L2YA 3VBRA 2ZACA 1HQLA 1GWKA 3AVSA 3EYPA 3WINE 3NJZA 1Q3EA 3L2HA 3THTA 4XILA 3WNLA 1RUH1 2D6LX 3BODA 4XJZA 4QHBA 4EWDA 3GXUA 3POJA 3FHQA 4XHBA 4ZXKA 4CDUA 3GALA 1OSGA 1CZVA 1PO21 1DGLA 5IUQA 2XWBB 1TZOA 3D3AA 1QDCA 2P1BA 3H8UA 1LNSA 1ND2A 1SCRA 4O9GA 1JHNA 3LIHA 1NCQA 4AVTA 3O0XA 2VZQA 1XSRA 5K0UA 4IERA 2QBXA 3GBWA 4AW7A 3NV1A 1RUC3 2E7AA 4GZ9A 4FQ4A 4HN0A 1IKPA 3H3UA 4K6BA 3AJZA 4FPOB 4E8CA 2ORZA 2IC1A 2RM23 1G9AA 1RB8G 5IK4A 4YWAA 3VHPA 5FWEA 5GZEA 5FRAA 2D93A 4NPMA 4M3CB 2ZGSA 4LOSA 1HLCA 1ODNA 4XCAA 4AWDA 2VOVA 3IMMA 2BVBA 5HI0A 5J96B 2VUAA 5K9YA 1W0NA 4XETA 3VBHC 1NXD1 5G05L 2OVUA 1UOJA 3ZR5A 3SHRA 3HEIA 2C26A 4KI5M 3EMRA 1GNHA 1V9U1 4NIIA 1DZTA 2A3YA 3JZVA 4FOYA 4OUEA 4XUPA 3THPA 2NP0A 5FY0A 1OA4A 1GQHA 1RUE1 4GWNA 1HJFA 2F17A 3WXPA 5I8SA 4CEWB 1Z7S1 2RDRA 1UZVA 3CQOA 1BVVA 1VMFA 2VMGA 3SC7X 1ALYA 4Z92B 4RGAA 3E6DA 3U14A 3JUUA 3VBHA 4QGNA 3EHKA 1BEV3 1US3A 1VBD2 4RYDA 5FLJA 2A3WA 2O8QA 4OULA 2Y8KA 4LBMA 4I30A 1LULA 5F5QA 1U5YA 2ZA9A 3ZXKA 2GAUA 2JE9A 3M3EA 1BMV1 4A44A 3LSDA 3SMHA 1SCSA 2BBAA 3WUDA 1W8HA 3T1MA 1N3OA 3MPPG 4YM3A 1NLQA 4MG2A 4QPYA 1F4AA 1SPPB 2O14A 4Q4V1 2QQPA 3D5OA 1SQ4A 3H8OA 2WO2A 3IWZA 3POBA 2JE7A 4CDXB 5F37A 1D4M1 3SCFA 3LWCA 4R9DA 1N1VA 1V0AA 3PUHA 2OQ6A 4LKEA 3FZ3A 5J1XA 4NHKA 2FDKA 2P5BA 5KC5A 2A73B 4LO6B 4HL0A 2GH8A 5IVBA 5K8SA 4P02B 2WAOA 2D5HA 2P3IA 1E57A 1QXRA 5FZCA 1W6OB 4CUAA 1E5RA 1QJU3 3APBA 3HT2A 1ENSA 1CR7A 1NKGA 2GN7A 1W8OA 2XR4A 2BRTA 3EXUA 3M7AA 4NAOA 4QX2A 4XAAA 1LHOA 4W6XA 3BB6A 5LBCA 1WMXA 4WVZA 3ZXGA 4AFCA 4Y5TA 2XBO2 1UZZA 4HKWA 1HV1A 1R1A1 1W6NB 3GNEA 2IXJA 3FL7A 1RVF2 5FYVA 1FT9A 3BTXA 2EXJA 2IXKA 2VNVA 4XJWA 1K5MC 5FZ0A 4YSFA 4IL7A 3FHIB 1V6MA 2FHRA 4JDNA 5FXZA 4DUWA 5F6LB 1SBFA 2WWSA 2XG3A 4AOCA 1AR63 4M00A 3URFA 2W08A 4YW2A 1ZZ7A 4GB32 4K1YA 3H3ZA 4JTNA 3FWEA 3BCWA 3E97A 3KZ4C 4CZSA 1QNYA 1XNAA 4UW6A 2RS12 3MLLA 3KQ4B 4COYA 3D6EA 5A33B 1EAH1 5FP8A 3N7KA 4AAXA 1RUF2 1IS4A 2RR11 2W95A 1DP0A 3NQHA 1K5MA 4P9YA 1KJRA 1PNGA 1XBFA 5L36A 4HK9A 2ZX3A 4WM8C 1WCUA 1PVC3 5GZDA 3UJQA 2P3JA 4QKFA 3ACLA 2HLEA 3M2MA 4AVVA 5IVYA 1FMD2 1DQ1A 3C2UA 2W39A 3KHBA 1J3PA 4PLMA 4N7UA 4XUTA 4A45A 3ACIA 4Y33A 3HBKA 4Y26A 2QDNA 3WCSA 2E33A 5I91A 3ATGA 5IYYA 5JOXA 5KR7A 1NLRA 2VZ1A 2JG9A 2VZ3A 5F3EA 1VMJA 2TUNA 4UT5A 1AUYA 4JHZA 1PIV2 2JJ6A 4QDQA 2ZZJA 4QX7A 1CAVB 5F3GA 5L19A 2WT1A 2HWB3 2DU0A 2VOWA 4QM9A 4N90A 4AGVA 2WBKA 1OLME 1K5JA 4WM8A 4CCMA 2W1QA 3Q8AA 4ARYA 1JYIA 4A41A 1LOCA 2CNAA 3FFQA 1ZA4A 4YVSA 1JYCA 4YM2A 3POFA 2E32A 3POGA 5D8AC 1XNKA 2DFBA 3VGIA 2A6XA 4LBQD 3ZFGC 3ZYIB 1JS9A 1QJY1 3CZUA 1DZRA 1ULOA 5EYYA 5I0UA 2YFZA 2GZWA 3D0SA 4RA0A 1QQP1 2JDNA 3ACGA 1C1FA 4FP2A 1IPKA 5SV8A 4CCDA 4MXWA 4LLFA 5FZLA 1R092 2I74A 3POEA 3NNFA 3FC0A 4PJYA 5EXOA 2DF7A 1ZYBA 4AE2A 1PGW2 2MEV2 4CSWA 1VBA2 4A4AA 2B9VA 4OUSA 3ES4A 5LY2A 4YRDA 2VOTA 4CEYC 5D8AA 3ZKYA 1VBE3 3E5QA 1FPN1 1CAXB 2YB7A 3ZFGA 1W8ZA 2CDPA 4UBGA 1S0GA 3DECA 5JXIA 2XH6A 3RGBA 1DCSA 2D3SA 1V6OA 1I3HA 4EZHA 4H14A 4MZUA 2VM9A 1RMU3 2W2IA 4V1PA 3IIIA 5IFPA 3WDUA 3FUOA 3I2DA 4Q29A 2ZOEB 4N43B 5ANNA 3CKHA 2BEOA 2HWC2 4M3CF 4WVWA 4OMDA 3H1MA 1QJFA 1NE6A 2QUOA 3VZKA 3OEAA 2QZ3A 4BIFA 4CEYA 3JXSA 1HRI1 4XQ4A 3L9JT 4MHUA 4QXKA 5EV7A 1G9CA 3DN7A 4CXWA 1NUKA 4RR3C 1UPIA 4DPNA 4UFLA 2HBUA 3K77A 3VKOA 3ILFA 2RS52 3HR9A 3I2JA 5J48A 1C5HA 3JB4C 3ZR6A 5I0RA 2DFCA 2K2SA 3AYCA 3DPRB 2ZX4A 5APAA 3AMNA 3DEMA 3GZTB 3N36A 4C1WA 2DVGA 2PA7A 4D94A 5CVRA 3LOBA 2DVBA 3ON7A 3O1MA 1XYPA 1GV9A 4BWOA 2XJSA 3LDKA 2ENRA 3TOJA 4H55A 1YQ6A 2Z5WA 5FREA 3WG4A 1LTEA 4G4FA 3E6BA 1AHSA 2LRPA 3VV1A 4XEZA 4JDMA 4FPJA 5A6YA 2P4EA 5IT6A 3N9OA 2VMDA 2D5FA 2EICA 3LE0A 1C8M3 5A32B 2A6VA 5FOBB 3USUB 5LA1A 1EUUA 1MACA 1COV2 5T54A 5C4WB 1SLIA 1MS4A 4LK7A 2J1RA 4JRLA 3SH5A 5FXXA 2YBSA 2I07B 1I1EA 4BIOA 4FVVA 2GP5A 4KWKA 3BVCA 1G9BA 3N9PA 1SBDA 2XQRA 3H1WA 5ACA1 1VAMA 1YFYA 4SLIA 4XF9A 3WQBA 3O1OA 3GF6A 4FO9A 2WNUA 3AP4A 2JKBA 3JBG1 4QHOA 1MZFA 5EPAA 1O7FA 5DZEA 4G3YC 1O4ZA 1RUH2 3LZZA 4O61A 4IV1C 3PLQA 3C7GA 4ZU4A 1PM4A 3OUJA 1OQEA 1VBD3 4L11A 1PO22 2EIEA 3ELNA 3OGGA 2Z69A 1XPWA 5FYCA 4JGYB 2WLQA 3ZXJA 1YHFA 2ETEA 1REFA 3VDDC 3CO2A 5JR2A 4RHV1 2RMU3 1SLCA 1H8TB 2R071 3WG1A 4MGYE 4IV1A 1V70A 2WYSA 5CB7A 1TEIA 1OF3A 5EJZB 1ENXA 2AC1A 3N35A 5KHGA 3JU9A 2Q1MA 4IEZA 3E1F1 4JTOA 3N7LA 4EN0A 2JIJA 4HVOA 4ZPIA 4BQ5A 5FLHA 5FYSA 4J1XA 2P34A 3KS7A 3DYPA 1RXFA 1K45A 2GMEA 4NN0A 4HPKB 2UU8A 1N1SA 1H4HA 1UN1A 1OPMA 4XXPA 4K20A 2WAAA 3VDDA 4LO7A 3AKPA 1V9U2 2NMNA 3NJXA 3BU0A 2XBO3 5FY5A 2Z79A 4E2QA 2WO1A 3NNMA 4QAWA 1RVF3 4LA2A 5AC91 1RUE2 1X9TA 3MF9A 1N1YA 1PO13 4IGOA 4SBVA 5JSRA 5JPNB 4DQAA 5HBAA 3ZO0B 4AG4A 5FKBA 1Z7S2 2YC0A 5CIRA 2BERA 3A4UA 4CCCA 1JZ6A 4UI9L 4OHYA 4N53B 4Z2AA 3KSCA 3PL0A 3QD6A 1ULGA 2GNDA 3G6JB 4GB33 3OGVA 1UY2A 2VBBA 2VQ0A 2JD4A 2WLPA 2P3YA 2E63A 2DTWA 4FOWA 1BMV2 3R4UA 2RS13 4DIQA 2GALA 1ZRFA 4WVMB 3DXUA 5JVVA 1B35C 4LKDA 1RUF3 2PQQA 1OLMA 4CUGA 4HK8A 5C71A 4IEXA 4Q4V2 3VKNA 3I3BA 2WABA 2YDEA 3K46A 4IV3C 1W6QA 3U07A 1UOGA 3GZEA 1OC1A 1FMD3 1WD3A 1D4M2 4XFBA 4PDWC 1CJPA 3VBSB 3VDAA 2V4VA 4QWNA 3WZ1A 5KC6A 2VW0A 4PT6A 2VZVA 4XQWA 1VALA 1CIYA 2WIIB 1XNBA 1DIWA 3K4AA 1MS0A 5FZAA 1FYUA 5JZGC 5LA0A 3ZN5A 2K0GA 3AK0A 3BOWA 1DLLA 1PIV3 2QQWA 4RQPB 4GWIA 2R0FA 3PIGA 4Q0PA 5F8PA 4C1XA 4LPLA 1WCKA 2A3XA 4X6QB 1OUXA 3I2FA 1H2LA 3AYEA 1R1A2 3BPSA 1ZVFA 4FFFA 4IV3A 4AQSA 5IATA 3K2OA 4PDWA 4R9BA 1YFUA 5FY4A 2EXHA 2R7EB 5HCHA 1XOYA 3RDIA 2C1FA 2WDBA 5E88A 2ATFA 3UV9A 1V6IA 2VVEA 3IDCB 1MQTB 1Q8QA 4QXHA 2YROA 4YM0A 5JZGA 1OQ1A 1AZDA 1W0OA 2EIDA 1QKQA 3MF6A 4S2GA 3OGRA 4AEKA 4COUA 2XB6C 4XHXA 5JIAA 1TVGA 3W9AA 4FTBA 4GULA 1UMHA 5KBFA 4RSUA 3B94A 1QXJA 4MGSA 4BXFA 1D7PM 4HONA 5F6KA 3VBUC 3VDCA 5GKAC 1R093 1MS5A 3HT1A 1EAH2 2A7AA 1NX9A 1PM7A 4PQ9A 5FXWA 5JWPA 1QJZA 2MEV3 1VBA3 2RR12 4Q5OA 2JDZA 1LODA 1A78A 4FT8A 4DXTA 5A6QA 4XFIA 5KXBA 5JSPA 1UX7A 1W3VA 2BFUS 4W6YA 5A7WB 2PTMA 3WW4A 2YU2A 1UL9A 4HSLA 1VIWB 3RNSA 1HW5A 3GHNA 3MICA 3KM5A 1TME1 1SFNA 4QB1A 2VAUA 2WINB 3AZYA 1RUD1 4KG0A 2YMZA 1YRZA 4UAPA 2W68A 4LUKA 1CWPA 3VBUA 1EPZA 1S0FA 2RV9A 5DPNA 2YY1A 2HWC3 1UOFA 2XJVA 4UW4A 1GZWA 2Q5TA 1S1AA 1UIJA 2NPIA 4JGZC 4BA6A 1AR71 1WLDA 3AXDA 4ONUA 1SLBA 5FZOA 3TRSB 4Q26A 1LOAA 3AFGA 4Q4W1 1CONA 2C9AA 2DYCA 2R32A 2JDUA 1KDKA 1J58A 3PJYA 2RS53 3ZXLA 4MV2A 3BPZA 1KS5A 2P17A 1KEXA 4PQQA 2PHUA 4QQHA 1R64A 5FZ7A 5C9AA 4W6WA 1D2QA 4JKKA 4XJ8A 2J1EA 4BE3A 4MYEA 3RPQA 1QJY2 1JYNA 3NL1A 2HYKA 3IZOA 3I97A 1GNZA 1QQP2 1AX2A 2ARBA 3J7MA 5FPLA 4UW5A 5C6CA 1I9RA 4NIAA 2RS31 5LB6A 5FIXA 3GCXA 1H9WA 4GMP3 4KU7A 4META 3U75A 2BDRA 3U4XA 1JZ5A 3RYKA 2VPVA 1PK6B 4XCBA 4A6OA 4IE6A 4LQRA 4M0HA 3I2KA 2VXRA 5T5PA 3B7MA 1VAKA 2Q8DA 3N9QA 4YW3A 3ZFFB 2AGSA 3PNAA 5I8YA
chains in the Genus database with same CATH topology
1FPN2 5BNOB 2D3PA 4KL1A 1PZ7A 3W58A 3IPVA 4R8HA 1COV3 4XQDA 4Q4X3 2ZKLA 5EYXA 1C5IA 5FBZA 2EAAA 3J26N 4YNIA 1CJDA 3DV8A 4NWVA 1DGWX 1DGRA 1X33A 4ZU7A 2ILMA 4M01A 4H3WA 3ZPYA 1POV1 3NAPA 4K40A 5D1IA 3WQ1A 2LUWA 1HRI2 4Q0UA 2PN5A 4L9BA 1WMFA 1YFWA 1RUH3 4NOTA 5CA6A 4YZ2A 1ZZ8A 1DFQA 2NLRA 3WQ0A 1FAYA 3JQXA 1OI6A 1PO23 5GZFA 1LU2A 1V6JA 2Y0OA 3P3PA 4Y1ZA 2GSYA 1LHWA 2OIIA 4PCRA 1FOD1 3NV3A 4XW3A 3MW2A 4AI1A 4AK3A 1REDA 1WW7A 4COVA 4A7KA 4MH0E 4OHZA 1Y7BA 4ASMB 5A3MA 4QD2A 3AM2A 3OBRA 2CYFA 3AP5A 4YARA 4BQ1A 5GLWA 4Y20B 4RS5C 1VB4A 1QJX3 4YGEA 1H2KA 1V00A 3VUOA 1LGNA 1R081 3MIGA 3WR0A 5JCTA 2B7YA 1RTVA 1BYHA 1BKZA 1ULDA 5KXCA 4L8QA 4PBPA 1SLLA 4R4XA 1O4TA 1RUE3 2AENA 5ACA2 1QH7A 2A75A 4AVBA 3KCYA 3JBG2 1Z7S3 2HWD2 4Q1PA 1O3TA 2SBAA 1A3KA 4WM7C 1H2MA 1JW6A 2X8KA 2ZHMA 4ZU5A 4L2NA 2RHPA 2D6OX 4XFHA 4XIKA 3VBRB 2GMMA 1SMVA 3RZZA 2YGLA 5BNPA 3AFKA 1VBB3 1SDWA 5ABJB 4P14A 1QOTA 3R6SA 4RHV2 4Q4V3 1N3QA 1X50A 1S55A 5CFDA 2R072 2D98A 1S0IA 1D4M3 4I0BA 3QOPA 4MUVA 4WM7A 4EWEA 3Q9OA 2WT0A 1OPOA 5K0UB 1O3SA 4UBHA 1OKQA 1A8DA 1W6MA 3VZLA 4B7EA 2DCTA 1GYKA 4HVQA 2D97A 4XMAA 2GC0A 4P9JA 3N7JA 1ZREA 3EQEA 4FPLA 5KXDA 4BPZA 1F5FA 2E53A 4WZFA 1R1A3 5GLZA 3M70A 3ZSMA 1GSLA 1NOVA 5H9RA 4CDUC 5AC92 1G7YA 1X8EA 4IESA 4PLNA 1PGL1 4COWA 4CP2A 1NCQC 1YYNA 2WT2A 3RMYA 5FOJB 1YNAA 4H7LA 2SLIA 2DWRA 4K9SA 1WW6A 4D7SA 4XXAA 1DQ4A 2I2SA 2E7TA 1LB2A 1S0BA 2KXLA 4B4QA 2XUMA 3MGUA 1X36A 4LBNA 3VZMA 2VNOA 4LBQA 3S30A 4QPIC 5GZGA 2RR13 3GHMA 2BFUL 4Q2FA 3VBHB 2X5IC 3OF1A 2ZGQA 1J3RA 1HDKA 3AB0A 3PVOA 1JH5A 4K8FA 3ZYPA 3U0ZA 3ZXDA 3FLTA 3VHRA 1PNFA 1W0PA 1C57A 1WLCA 4KBBA 4B7KA 2JG8B 3WDWA 5HXVA 3I59A 1ZNPA 3X29B 5H9PA 3AP9A 4QPIA 4D7TA 2X5IA 5FPXA 3ZFEC 4DY5A 4AEDC 4I09A 1LENA 3I4IA 3CJIC 1OQDA 4HT1T 1ND3C 4DZGA 4AI3A 1YLLA 4OLLA 4LULA 5C8CC 1UKGA 2PLV1 1KD7A 1MS8A 2OUHA 3CEWA 2IZWA 3AKTA 3B69A 1QJY3 5CFCB 3RYPA 4RGGA 3V56A 4LBLA 3RQ0A 4Z8BA 1H0BA 4J1WA 2R1BA 4EWAA 4EV0A 1YXWA 1YCIA 3WOGA 3ZFEA 3H9AA 4AEDA 1NCRC 4R52A 2ZGLA 3CJIA 1ND3A 3M3IA 1UF2C 2WFPA 4GIQA 3RG0A 3ZN6A 1NY71 4FPKA 5C8CA 3ENRA 5FQ0A 5JI7A 3SLIA 3IT8A 1D2SA 3LB9A 3RI8A 1TME2 1RUD2 4YZ3A 1QDOA 4BZ4A 3M1HA 3A0NA 3VHOA 4BMBA 5A3LA 3RWNA 1NCRA 2OUJA 1LOBA 5AVPA 3OYWA 5T52A 4FAHA 5H9QA 2BYVE 4DB5A 1UU6A 1AR72 1ZZ9A 4Y1UA 4Q4W2 2KA3A 4CDWC 5FO8B 1LOGA 4JAAA 3V0BB 3T2TA 5FO7B 4IXLA 1ASJ1 4Y4YA 3ZSKA 1U5XA 4BM8A 1CAUA 4CP0A 4WM8B 4CEWC 1Q8PA 5CNAA 4XF0A 4LBKA 4Z07A 2AREA 2QZ2A 1HV0A 2RS32 5CG8A 5E8AA 4CDWA 2ZGKA 5I0TA 4QX5A 2FBEA 1BQPA 4E9KA 5J37A 1HX6A 4Y24A 1YWKA 5DDJ2 3UKNA 2JG9C 1IS6A 1C3HA 1ZBE1 4HZFA 1YJKA 4CEWA 3AMHA 5EZWA 2OYZA 1JN2P 1MEC1 3SCGA 2PAEA 4CDXC 4DRRA 2XPJA 3IIAA 2HWF1 2TNFA 3HMYA 4AEMA 2BVVA 3ROUA 2MHFA 5D8AB 4YVSC 5ACA3 3ZFGB 1IHMA 3JBG3 4R9CA 1S2BA 3ES1A 1XXNA 5JOWA 1S0JA 1LECA 1JUHA 1WMEA 3GZAA 4S2DA 1XNDA 3H7YA 3OY8B 3PHMA 3BIWE 2H6CA 4CDXA 2UY8A 1ENQA 2VG9A 1VRH1 1UIKA 3CL1A 4HSJA 2IFRA 4ZKTB 4CEYB 3AKSA 4P9WA 3R05A 1NLSA 3VKFC 4LNVA 1FOD2 2DCZA 1DDLA 2ARXA 4RHV3 1AYN1 1GFF2 1W6OA 5DUVA 4L92A 2RM21 2R073 3WP6A 2VH9A 5LRSA 1WUVA 1QGLA 2DUPA 3NSTA 3FJSA 1EY2A 4Q4Y1 5LEJA 4DFSA 2FMYA 3UJOA 2XGXA 4NVPA 3HQXA 4CRQA 1R082 4RR3B 4O9EA 4FTSA 4XBQA 3D8CA 3B00A 1U5IA 5BNNC 2VVDA 5DDJ1 3FBYA 3AP7A 3FFZA 5AC93 1H1AA 2VQAA 5DZGA 5E89A 5JOYA 4QT6A 4UXAA 1JXNA 3S0MA 4BCUA 3AZXA 1NYWA 4FPFA 5SV5A 1YO8A 2WC2A 2WQ4A 2ZGTA 2LM3A 5BNNA 3B02A 2TEPA 3RMXA 2DV9A 1NQDA 2YYOA 1FI2A 2XVKA 2Q1ZB 2A6WA 3ZIWA 1MVEA 3IDBB 3NV2A 2PHLA 5FPZA 4XJ9A 4GQ7A 1HKDA 4X6RB 4OVEA 2IXLA 1TMF1 1S0EA 2WNVC 3TNQA 3AP6A 3ILRA 1IS5A 3B5LB 3SH3A 4DS0A 3D0JA 3R4SA 2WNUC 1PZ8A 3RSJA 4KU8A 4B8EA 2O8OA 3UKTA 1OA2A 1PGL2 1DYPA 2JECA 4N9HA 5F9TA 3QCWA 4H7MA 4AI0A 3VDDB 1C8NA 2WNVA 1QWRA 1AYM1 1UX6A 2GNTA 2Q4SA 4HETA 1B09A 4K3UA 1OLRA 1V6KA 3TN91 3ZX7A 2B39A 2HWD1 4U2AA 5L7OB 1G86A 4QQOA 4XF1A 4JQRA 3R0RA 3RI9A 4E4ZA 1RUNA 2BWCA 2MPFA 3EBRA 1F9KA 2R6QA 1HRV1 2PHDA 4XTPA 5JLVA 5C33A 1TME3 5JAXA 1MZ5A 5DZFA 1KFUL 2EF6A 3AZWA 1I5ZA 2ZX0A 4KQ7A 3KQRA 1O3QA 1G6NA 1AXKA 4TLFA 5KHJA 4P9XA 5FMOL 3DPRA 1RUOA 1W6QB 1SLTA 2C5DA 4TWTA 2FMDA 1AR73 3VBOB 1WLWA 2DVFA 4FPEA 5LEKA 1WBFA 2D43A 3TAYA 2VOKA 4OHWA 1LEDA 3WCRA 2ZMKA 3ZSJA 1V6NA 1SLAA 1B35B 2PLV2 4LLOA 4WV8A 1BVP1 3ZMNA 4YGBA 2Y38A 4HLTA 2R061 1FV3A 1IGOA 4IV3B 4PDWB 2P3KA 3O12A 2CL2A 4S2HA 4AFAA 2RS33 1KS4A 3USUA 4WVVA 4AGRA 5JZGB 4ISRA 2AYHA 5KXEA 1NY72 1HIXA 2WZR1 5DDJ3 1CPMA 1KFXL 3WP3A 3NO8A 3J4UH 3RRDA 1Q56A 2XJPA 4BYYA 3MLJA 5C8WA 4R9AA 1TE1B 4AVSA 4BMEA 2YGMA 3IKWA 2AH2A 1NE4A 1WCDJ 2IFWA 4YW1A 4AFBA 1EPWA 4TZDA 3QACA 2RJKA 1GICA 4GH4C 2QDRA 3VBUB 4AYUA 1WW4A 1H8TA 2VNRA 1ASJ2 1YFXA 1MS1A 3T1LA 3H1YA 3EO6A 4I3GA 3OGJA 3H0OA 1S2KA 1FOD3 5I0SA 4YVWC 2Y26A 3NKGA 4OI4A 1WCSA 3IDEA 4KG8A 3ALQA 4N7IA 5GLUA 4GH4A 2EIGA 4OHXA 1KJLA 2DVAA 5IK8A 2JXAA 3FUQA 2YXSA 4GXLA 3K48A 4ATEA 2XJQA 4JGZB 1ZBE2 1CX4A 1C8M1 4LBOA 4HKOA 1R083 2A70A 2WKKA 1W6PB 1MEC2 2XJUA 2ZGNA 4FSJA 3INAA 4YVWA 2HWF2 4N53A 2OA2A 1ULCA 4E4DX 4KWJA 4AVAA 3KCXA 1SBEA 4IEUA 2ZBJA 3SITA 1SEFA 1N1TA 5C9AC 1KDMA 4HVRA 4WVMA 4RQPC 5T5LA 3VKLA 4A3XA 4B4PA 3O5SA 1LOEA 3ZSEA 1S0CA 1Q8OA 5KHKA 1LHVA 2GNBA 3BU7A 2UWAA 3VBSA 3H7JA 4A7YA 3WVJA 1VRH2 3DKWA 2NMOA 4LO5B 1BCXA 1WMDA 3GBFA 4OI1A 2B46X 4U36A 3PJQA 4D69A 3KB5A 1YI7A 2JEMA 1Q8SA 4E4SA 4K7JA 4CDQC 1AYN2 2RMU1 3ECQA 3ZIXA 4RQPA 2C0ZA 1C28A 2RM22 3WUCA 1AL21 2WNEA 1ENRA 3M3CA 4URTA 3B9CA 4Q4Y2 3QLQA 1H4GA 5L73A 4IEYA 4J6GA 2ZAAA 3AYDA 3N7MA 1Z0HA 2EAKA 4PBOA 2RJLA 1GLHA 4ES9A 3NAPC 3TWIA 4YG6A 4AHYA 1VLNA 5DUUA 1CESA 4CDQA 5CU1A 4FXGB 1GANA 2PHFA 3UK9A 2GC3A 3LCPA 3POSA 4IEQA 4JC1A 2WSUA 1PO11 1LHUA 4QPGC 3WT3A 4IETA 1BJQA 2I45A 2WFF1 5TSWA 3CLPA 3J8F1 3GZUC 1NZCA 3MIFA 3ZYGA 1BBT1 2VECA 3I54A 3WG2A 3KGLA 3WW3A 1URXA 1ONAA 3CU7A 4QMAA 3AMMA 5JI9A 1O5UA 2D6PA 4YM1A 1IPJA 4Y1XA 1M06G 5BXXA 2R1DA 2PFWA 1GR3A 2RE9A 4I01A 1EP0A 2EVXA 3NW4A 4CP1A 4E2SA 1POV0 3N4MA 4Y1VA 4RS5B 2ZJCA 4QPGA 3RJRA 4XE9A 2LALA 4IEVA 2VMIA 1DGWA 2GC2A 2K9ZA 3W59A 5FAXA 4P5HA 1CVNA 4FPCA 2JX9A 4YG3A 1LESA 3MFAA 4Y1YA 1TMF2 4AFMA 2ZKNA 2YZ4A 5CG9A 1OFNA 2ET1A 4LO4B 4FPHA 2BW8A 4AFDA 2O0OA 1N3PA 3BTAA 5I93A 1AVBA 3KCCA 1NA1C 4WM7B 1XYNA 4L97A 2PHXA 5DG1A 2DCJA 4B3NA 4M3CE 2XVGA 1W6MB 2WSVA 2NZ9A 5FFOC 3MIDA 4XF3A 3VBFC 4DOUA 2R041 2VGDA 1QH6A 1V9U3 2R30A 2PLV3 1Q43A 5BNPC 1AYM2 4NO4A 4QQ2A 2ZX2A 4MXVA 4IEOA 4TSVA 1C1LA 5F1RA 1NA1A 5BNOA 3TN92 2R16A 2DU1A 5LK5A 2BBVA 5CFDC 3HBZA 1KQRA 2ZGUA 2OZJA 3WW1A 1AXYA 3HWJA 3ZSLA 2DTYA 3USSA 2V09A 2IXIA 3VBFA 1Z78A 2P2KA 3IN9A 4F8AA 3PVBB 1VBC1 5DG2A 2CV6A 1HRV2 2XLFA 2ERFA 2A71A 2HJIA 3E5XA 4WZCA 4ISQA 2ZHLA 2EA7A 3VZOA 2D40A 2DCKA 4CDUB 4LBQB 1ZM1A 1X82A 3OJBA 1CAWA 4XFFA 4I2OA 1LHNA 1XQNA 1ND2B 1RIRA 4XMIA 5DUXA 4CYDA 1NCQB 1ZRDA 2PELA 3KLSA 3WHTA 1EV11 3OPZA 3MI8A 1ZRCA 4NR1A 1A8MA 4FPGA 4GWMA 1H2NA 2V5YA 2UWBA 4YGDA 1I6XA 5IT6A 3I59B 4I3PA 4AQTA 4B29A 3JD71 4JVAA 4Q8KA 1ASJ3 2NYYA 3P3NA 1DQ2A 1UU5A 2BNNA 4QPIB 1L3JA 1RUJ1 5T50A 1W2UA 1DZQA 1VJ2A 2X5IB 4LHKA 1FX5A 2R062 3KMHA 4Y20A 3MIBA 2BTVC 1ZZBA 1DQ0A 1LRHA 4PIYA 3M4FA 1OOPC 3C3VA 2G9FA 1Q8VA 1XU2A 4LTAA 1ZBA1 1GZ9A 4F3JA 5BV6A 3AKQA 3V65A 4ITCA 1AJOA 4XPVA 2WZR2 4I0WB 4ORFA 1RJ8A 2G9GA 4HFSA 3LGRA 5JIUA 1QNWA 1TQ5A 1ZBE3 1EAH3 4LEJA 2QFEA 1RHI1 3SISA 2W0XA 3ZFEB 5CADA 1AR81 1MEC3 1RUI1 4Q4X1 4BOWA 3CJIB 4Y22A 4GKYA 1ND3B 4YW4A 2HWF3 1OOPA 4MGKE 4AI8A 3ZN6B 1U5ZA 3WP4A 2OW4A 5C8CB 1AJKA 2VW2A 1OLQA 2YV8A 4Z82A 3OCPA 4Q0QA 4YZ5A 4YFWA 3ZXFA 1Y3TA 3VZJA 5ABJA 2B42B 4WBBA 2ZAHA 1GKBA 2BQPA 2CGNA 1RUG1 1NCRB 4MSVA 3SH4A 3OYWB 2VUJA 1VRH3 4F7ZA 4JRAA 2GU9A 1D4VB 4A7ZA 1HXS1 1QOSA 2UYBA 1WD4A 1YIPA 4DY3A 1QU0A 1F2NA 3LA2A 4PF5A 3ILNA 1AYN3 3WDTA 4AQ6A 1YIFA 2ZMNA 5GZCA 4OUMA 2D6MA 3V0AA 2FQPA 4D7YA 2ZTNA 2D6KA 4D3WA 4Q4Y3 4EROA 5KHIA 2D3RA 1QQP3 1CAUB 1AR91 2UWCA 1OMIA 1TNRA 4MGZE 1DHKB 4RD7A 1RJ7A 3VZNA 1RINA 3B01A 1QJX1 4L99A 1C8M2 2XJRA 4AHXA 2ZMLA 4CDWB 1KRIA 5LRRA 1FPN3 1FXZA 2H0BA 3FBMA 2WS91 3PTYA 4AXOA 2ES3A 3MLKA 2XHKA 1EYBA 2D7FA 2JG8C 4LR4A 3EJKA 1K5MB 5K7PA 1AF9A 3QH6A 5DUWA 5BNQA 3J9SA 3AJYA 1ZX5A 5FMOS 2IXHA 4LA3A 1HRI3 5T3NA 4K1ZA 2B5HA 3U11A 1CD3G 2HEYF 2ZGMA 4YW5A 4X8NA 1VBB1 2JG9B 2D6NA 2JG8A 2FZ2A 5CFCC 4R4ZA 3PVEA 2RMU2 4M3CA 1RITA 2QCSB 3WQ7A 1AL22 5I8TA 1DQ5A 3PMSA 5GLTA 3WX5A 4XFAA 4S2FA 3V64A 3AMQA 5T5OA 1TMF3 4YVSB 1F5JA 1VB2A 5BPXA 2DVDA 3OTFA 1JOJA 2N7GA 1XE7A 5KHHA 4E27A 5FTTC 4OI0A 3AZVA 2HEWF 1SACA 4KGGA 5CFCA 1OD5A 2H6BA 2DURA 4MXWB 1PO12 4LBJA 2XKOA 4YLZA 5EJ3A 3JQWA 2WFF2 1JUIA 1UAIA 3HIFA 3J8F2 1KXGA 1O4YA 2BUKA 2Q0AA 1AYM3 1BBT2 2X53S 3JB8A 2HWE1 5BUVA 2R0HA 4I02A 3TN93 1MZ6A 2HWD3 5FLIA 4HANA 4Z2WA 2VMHA 5AVAA 3NKTA 1HQWA 2IWGB 4RL7A 3WY6A 1J3QA 1WA4A 4C0HA 3M3QA 1HRV3 1H1MA 5FDBA 1JTZX 2WQZC 5AFEA 5BNNB 1X7NA 5H9SA 1DBNA 1UU4A 3OD4A 1RUC1 4XBNA 4N9IA 4QQPA 1VP6A 1F31A 1Y9QA 2NN8A 1UD1A 3V0BA 2MNGA 4NWWA 4W65A 4KH9A 2PAKA 2YHJA 1W6NA 3DF0A 1LKNA 5J7MA 3ME2A 1UKRA 2ZS6B 3CJXA 5EWSA 3S7EA 3R4DB 3OD0A 2F4PA 2R042 3LSEA 3S7IA 4NHMA 4YG0A 1DYKA 4IEWA 4FBFA 2R063 4NPRA 3I8TA 5T5JA 1FATA 1XYOA 5A33A 1UMZA 3KD4A 2GC1A 4DINB 1U12A 1BEV1 1V6LA 5FO9B 2WNVB 4QGMA 1J1TA 1C4RA 3KT7A 3ASIA 1VBC2 2WZR3 3OBTA 4XTMA 2WNUB 3BOPA 4C90A 4XIOA 1RGSA 2ZHNA 1MS9A 3IMNA 1NG0A 2ET7A 1PVXA 2XKPA 5JSOA 4BLIA 1XE8A 2ZGPA 1W39A 2P37A 4RFT0 5CAZA 1CAVA 3E5UA 4M0NA 1O91A 3OY8A 4NHLA 3TBDA 3ZYJB 1EV12 2OZ6A 3NWKA 1BXHA 4LHNA 2TBVA 1QJU1 4CTEA 2KM2A 3WD5A 3WHUA 1D0GA 3HD8B 4FXKB 4IV1B 2G4IA 3CNAA 3JD72 1XNCA 4XJUA 4P9IA 1NQJA 2D44A 1RUJ2 3ZXAC 3LA3A 1KITA 2CY6A 3PVNA 4JDOA 1QXPA 3FE5A 3BALA 4BLJA 3LA7A 4N43C 4LO8A 3B9IA 1CN1A 3ST7A 4RR3A 3KT1A 1AR61 2ZX1A 1ZBA2 1H1IA 1CAXA 1M4WA 1UPSA 1XU1A 2YUEA 1F8VA 1IKQA 4C91A 4XFCA 3CF6E 3VKMA 2H0VA 1IOAA 3O14A 2E9QA 2CWSA 3DPRC 4QU2A 4X8PA 1RHI2 1PGSA 1AR82 1RUI2 4Q4X2 1LGBA 1H9PA 4LHLA 1PVC1 1X8MA 3WDXA 4N43A 2ZGRA 4QM8A 3POYA 4EJRA 3DUIA 3UL2A 4FQZA 1YUDA 1ZZ6A 2XL9A 4Q0VA 1J59A 3MW3A 1RUD3 3QBQA 2F6BA 5E1RA 2DUQA 4ATFA 2GDFA 4K21A 3SNMA 5JOZA 2BPA2 3NVCA 4KGQA 1RUG2 2HWB1 1SFYA 4ASLA 1AXZA 5C4WC 1FNYA 2JENA 2NM1A 5E16A 1G8WA 4Q4W3 1HXS2 2CTVA 2XL7A 3FLPA 2BNMA 4AGGA 3LKJA 1N47A 1H30A 1AL23 1DF0A 2E51A 5L7OC 2VW1A 1S0DA 1T6GC 2A5ZA 1R1ZA 1UZYA 4AHWA 5JWPA 2O1QA 1AR92 2Y0IA 2E6VA 2VU9A 1NXMA 2EXKA 5A32A 5LK7B 5C4WA 1PZ9A 2PYTA 1QJX2 3MYXA 4P9LA 2QJVA 4QQLA 3UKVA 4XYXA 4JGYC 2Z42A 4GH4B 1GQGA 1O3RA 1VBE1 2VNGA 3VHNA 2WS92 1OFSA 4AHZA 5L7OA