1CD3G

Procapsid of bacteriophage phix174
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
b'MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SCAFFOLDING PROTEIN GPD)
molecule tags Virus
publication title The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.
pubmed doi rcsb
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cd3G00
4CDWA 1PGL1 4CDUB 2WZR2 2HWD1 1RUG3 1NCQA 1AYM2 1R1A3 5BNPA 1RUH3 1ND3C 1VBA3 1AL23 2RS52 1RUE1 1V9U1 5ACA3 3LOBA 2HWB1 4YVWA 1PVC1 4RS5B 1TME1 3TN91 1M06G 1VRH2 1HRI2 1RUC3 1AYM1 2BPA2 5CFCA 1AR91 3VBOA 1FPN1 1RUC2 5BNNA 1VRH3 4PDWA 4CDQA 4Z92B 1B35C 4WM7B 4CDUA 1ZBA2 1COV2 2FZ1A 1FOD1 5ACA2 1AL22 1VBC2 2RS53 4JGZA 1SMVA 3S6PA 1POV0 1VBE2 3JBG1 1MEC3 5BNNC 4WM8B 4GH4C 2RM22 1H8TA 2WZR3 4RHV1 1PO23 2BUKA 1QJY3 4SBVA 1VBB2 1AR72 2GH8A 3CJIC 1PGW1 1POV1 1HRV1 2R063 1AR73 1ND3A 2BFUL 4CDQB 5BNOB 2HWE2 5C9AC 2WFF2 1FOD2 2XBO1 3JB4C 1C8M1 4RS5C 4NWVA 4JGZB 2ZTNA 1AR92 1FMD1 4QPIC 4RHV2 4RFT0 3ZFEA 3VBRB 2Y26A 1COV3 1ZBA3 4GH4A 3VDDB 2RS13 4RHV3 1VBC1 1QJU1 3NAPB 5L7OB 1RVF3 1HRI3 5BNOA 3ZFGC 1WCDJ 1FOD3 2QQPA 1BBT3 2HWD2 5D8AC 2WFF3 1K5MC 4FSJA 2RR13 3VBHB 5CFDC 1VBB1 5CFDA 3CJIB 1VBB3 1QJX1 1AR61 1AYM3 1V9U2 1TMF3 2HWB2 5BNOC 5C9AB 4Q4W3 1RUG2 1RMU2 4AEDC 1NA1B 1TME2 3TN92 1MEC2 4CEWB 1RUE3 5ACA1 4RQPC 3IDEA 1VBC3 3ZFEC 1EV11 1RUJ1 4JGYB 1OOPC 3J8F3 1R092 4NWWA 1ND2C 4CEYC 1W39A 4Q4V3 2MEV1 4YVWB 5GKAC 5C9AA 2XBO3 1QJZA 1VB2A 1NCQC 1AUYA 1RUD2 1PO12 3ZXAC 1R081 1VBA2 4AEDA 3VBHC 1AYN1 5K0UB 1R1A2 4WM7A 1RUF2 1ZBE2 1IHMA 3DPRB 1BBT1 2RMU1 4Y5Z0 1EAH3 4JGYA 5C4WC 1NY72 5DDJ2 5JZGC 1EAH1 4QPGB 1PO11 1GFF2 5ABJC 1B35A 4CDUC 5JZGA 1VBE1 3JBG2 1PVC2 5C8CB 4JGYC 1QQP2 1MQTC 2GSYA 2PLV3 2WS91 5DDJ1 1R083 4CDXB 1ND3B 2HWC2 4N53B 3NAPC 2RMU2 1VBD1 4CEYB 1RUI3 1D4M2 2HWF2 1RB8G 4YVWC 3J8F1 2HWE1 1RHI1 2MEV3 4RR3B 1HX6A 3VBUC 1Z7S1 1RMU1 1PGW2 2R042 1POV3 5A32B 1QJX2 1B35B 1RUJ3 1EV13 3DPRC 4Q4Y3 5CFCB 1NY71 2R073 4CDXA 3ZFFB 4RQPA 2WS93 1HRV2 1VB4A 1NCRA 1VAKA 5BNPB 5ABJA 2WFF1 4N43C 5AC92 1AR82 4N43A 1OOPB 1FPN3 2RR11 1HRI1 1H8TB 4Q4X3 5A32A 4GB32 4CDXC 4CDQC 4N53C 4YVSB 3VBSC 1ND2A 1AR62 5D8AA 1PIV2 1E57A 3VBOB 4LLFA 1COV1 4JGZC 3VBUB 2X5IA 1FMD3 2RS11 4QPIB 3VBFA 1Z7S3 5K0UC 1ZBA1 1BEV2 1RHI3 3JD73 4IV3A 3ZFGA 1C8M3 1VBD3 1ASJ2 1OOPA 1HXS2 4IV1A 1QQP1 4BCUA 4GH4B 3VDDA 3ZFFC 1NG0A 2TBVA 2ZZQA 5D8AB 1CJDA 2BBVA 2R061 2WZR1 1AL0G 2X5IB 5K0UA 2WS92 3VBFC 5FOJB 1HXS3 1AYN2 2WWSA 1PGL2 1NA1C 1BEV3 4IV3B 4RR3C 4Q4X1 4Y4YA 1QJX3 3VBOC 1FMD2 1QJU2 1K5MA 2RS51 1NA1A 2RS33 2DF7A 2RM21 4FTBA 2MEV2 5C8CA 4CEWA 1DDLA 1RVF1 2RS32 4Q4V1 1AL21 4CEYA 1R082 1VBA1 1QJU3 1AR83 4FTSA 4CDWC 4WM8C 4WM8A 5CFDB 1RUG1 4FTEA 4AEDB 4YVSC 3VBSB 1RUI1 5C4WB 1EAH2 1C8NA 1EV12 1TMF1 4QPGC 1HQNA 1BEV1 3FBMA 4RQPB 5A33A 1BMV2 1NCRC 4PDWC 1VBD2 1QJY1 2HWC1 1PO21 1RUD3 1MQTB 3JD72 1CD3G 2WLPA 3VBRA 3VDDC 1Z7S2 2PLV2 4EJRA 1R093 4YVSA 3J8F2 5FMOL 1QQP3 1F2NA 1PIV3 5L7OA 1RUF1 1ZBE1 3ZFGB 5C4WA 5AC91 4CDWB 1AYN3 3VBUA 4GB33 2X5IC 1X36A 3VBFB 5A33B 1FPN2 1RUC1 3VBHA 1TME3 3TN93 5AC93 4GMP3 1PIV1 3HAGA 4IV3C 1MQTA 4RS5A 1V9U3 1AR71 4IV1B 1AR81 1RUH1 1R091 1HRV3 1ASJ3 4CEWC 2RR12 4PDWB 2IZWA 1C8M2 5C8CC 1BBT2 2HWD3 1X33A 2XBO2 3NAPA 1RHI2 1F8VA 2RS31 1RUJ2 1RVF2 5J96B 1H8TC 2HWF1 2ZAHA 5L7OC 4RR3A 4Q4W1 1AR63 2HWF3 4Q4Y1 1K5MB 1VRH1 4Q4X2 1AR93 1HXS1 1ASJ1 4GMP0 1BMV1 1D4M1 2XPJA 5CFCC 4WM7C 1RMU3 1PVC3 4Q4W2 2HWB3 1TMF2 4QPIA 3DPRA 3ZFFA 2HWE3 2R062 4IV1C 1NCRB 1R1A1 2VQ0A 4GMP1 5ABJB 2R072 5BNPC 2PLV1 5DDJ3 2FZ2A 1OPOA 4N43B 3ZFEB 4Q4Y2 2BFUS 3JD71 2RM23 1RUF3 1ZBE3 4GB31 1VBE3 2R043 1ND2B 3VBSA 2RS12 4N53A 1PO13 1NCQB 1D4M3 1RUI2 1A6CA 2RMU3 2HWC3 4Q4V2 5FMOS 3CJIA 4QPGA 1RUD1 3VBRC 1MEC1 5J98B 3JBG3 5JZGB 1OHFA 1RUH2 1NOVA 2R041 3M8LA 1RUE2 3JB8A 5BNNB 5LK7B 1QJY2 2R071 1PO22
chains in the Genus database with same CATH superfamily
4JV4A 3QLQA 1PGL1 4JHTA 1GR3A 2HWD1 3O1RA 1RUG3 3VZJA 1UL9A 2BYVE 1PK6A 4DY5A 1R1A3 5BNPA 1Y43B 3KT1A 5I93A 5CB7A 3WNOA 4URAA 3RZJA 1RUH3 2BQPA 2RS52 1RUE1 3LOBA 3GZAA 2ZBJA 2ZGUA 4BQYA 4RS5B 1AX0A 4WVWA 4AYUA 5FJHA 1F4HA 4P9GA 4YM1A 3ROUA 3U78A 3SH5A 4B4RA 4BOWA 4F8AA 3RWNA 1RUC3 2Q8CA 4JRAA 5A7WB 1M4WA 1RUC2 3LSDA 4PDWA 4AHYA 1GNYA 2IFRA 2OVUA 5I0SA 1B35C 3FHQA 2F4PA 5GLTA 2NQYA 3N3HA 5FAXA 3ZYIB 2GMEA 4N9IA 2W08A 3ZVXA 5ACA2 3T1MA 1VBC2 3ZDSA 2ATFA 2JEMA 1JOPA 1SG3A 2AENA 4XF1A 2D5FA 4BK4A 2FBEA 3J7LA 5KXEA 2WL1A 1OFNA 3EJKA 1ZVFA 2K2SA 3CZUA 4YZ1A 1UXZA 2W1SA 1HB2A 4XAAA 3B93A 2YGMA 1GU3A 1QJY3 2G19A 2VJXA 4SBVA 3TYJA 1VBB2 5DAQA 4UW6A 2GH8A 4XFHA 4FAHA 1CPNA 1W8ZA 2GN3A 4JRLA 5FO7B 3O1UA 5JAXA 3RS6A 1AR73 1DBNA 1REEA 2B39A 1GP4A 3PJQA 4Y1XA 2R6QA 4CDQB 5BNOB 5C9AC 4I2OA 2VZVA 1IPSA 3KCYA 3JB4C 3AZWA 3B69A 4HT1T 3WV6A 4FVVA 2VCBA 2OZ6A 4RS5C 2OYZA 1RXFA 3PUSA 4YW3A 2P17A 4JGZB 4MGZE 3IBMA 2W39A 3FHAA 3FBYA 4QPIC 4QXHA 3RYPA 1H9PA 1UY0A 1NKGA 3ZFEA 1FXZA 1QOTA 1BVVA 3ES1A 4FP2A 4Z2WA 3AP7A 4JHZA 3EQEA 4KU7A 1ZZ8A 5FLIA 4COVA 3W58A 2PHTA 3R4SA 3MFAA 1OH3A 3MPBA 2FCVA 1S2EA 3FWEA 2P3KA 5L7OB 3B00A 1RVF3 1HRI3 5BNOA 5T52A 3ZFGC 4IGPA 4XFBA 3WW4A 2XJQA 1FOD3 4KI5M 4AVSA 1LOBA 2C6SA 4X8PA 1Q56A 1W6MB 4FSJA 4RN5A 3VBHB 4NAOA 4P00B 4OCTA 4AI2A 3I2IA 3WUDA 3VD3A 1REFA 5E1RA 3V56A 1H4HA 4QX5A 3ZOIA 3CJIB 3KVBA 2VZOA 1VBB3 2Q8EA 2J1VA 4W4ZA 1TMF3 4XC9A 2ZABA 3NJXA 4CP9A 4K6BA 5CIRA 1W2UA 4MADA 4AEDC 5FREA 1NA1B 4BMBA 1TME2 1JU3A 4AI1A 4DQAA 1UZ0A 5LBCA 1MEC2 3WQBA 1XNKA 1EYBA 2MPFA 2XONA 2Z2SB 1UYYA 1MPXA 1RUE3 3GYDA 4D7TA 1H2KA 1SPPB 2GMPA 1GUIA 1VBC3 1W2NA 2D97A 5J09A 5L9BA 2W47A 2XGXA 1IS6A 5JOXA 5IK8A 4XJ8A 1FNZA 4JKLA 3AZXA 1WLTA 1G9AA 4OMDA 5A1AA 4LTAA 4B1MA 1OOPC 3J8F3 4CCOA 1OPMA 4LT5A 4PIZA 1ONAA 4NWWA 2UURA 3IPVB 2H0VA 4UYBA 3OD0A 1W03A 4LKDA 2VOWA 2IWGB 4Q4V3 1J83A 1D0GA 2GC1A 4YVWB 5I91A 1YUDA 4P9XA 1PK6C 4CYDA 3WNXA 3I2OA 1DP0A 2SLIA 3C7GA 1QJZA 4Y5SA 4XZUG 1LU1A 1ST8A 4UFKA 4BQ1A 1UZWA 3AKSA 2ET1A 4ZPIA 5IVYA 1R081 2HH9A 2PAMA 2ZMNA 5C71A 1ZRFA 5KC6A 3O0VA 4LITA 3E6DA 1I1EA 1R1A2 3H50A 3KV5A 3B94A 4WM7A 1ZBE2 1UAIA 2OIIA 3DPRB 4JKKA 3A23A 3UGGA 1BBT1 3DYMA 2RMU1 2W2IA 2CSGA 2GC0A 4Y5Z0 5FO9B 1C5IA 1ENSA 2RDSA 3VD9A 5DDJ2 1NQJA 3DYPA 5T55A 1HKDA 1GFF2 1GSLA 1UOGA 2Y38A 3ABZA 1DLLA 4KL1A 2QVSB 1XYNA 4CCNA 3H8RA 3RJRA 2Q8DA 3UL2A 3O14A 1A8MA 1WLDA 4A6SA 3LPGA 4GA9A 4AFCA 1PVC2 3MHZA 3GCWA 1QQP2 1CZVA 2VUDA 4OHXA 2C5DA 2AZ5A 2GSYA 2PLV3 4NE9A 3U1XA 4CDXB 5IFTA 4JC1A 1ND3B 3NAPC 2RMU2 4CEYB 5F5CA 5GZCA 4CUBA 2X10A 2E6VA 4WVMA 5FYMA 4XF4A 1BZWA 1WA4A 4RR3B 3MLJA 2EXHA 2C1FA 4HBNA 2O1QA 3BUCA 2CGPA 2XUMA 4A7KA 4HVQA 2PTMA 5A32B 4Q8LA 5EV7A 1OKOA 1QJX2 3BPZA 1G86A 5FZLA 5JDBA 4P5HA 2XJVA 5EYXA 2EVXA 2TUNA 3DPRC 4Q4Y3 2WNVC 3WDXA 4GWIA 4YZ4A 1X9TA 1HQLA 3W5NA 3OOXA 3N9OA 5C33A 1XNCA 2HKXA 2HJIA 3CHXA 4PIYA 2VU9A 5KHIA 4LOSA 4PI2A 5JI9A 4CDXA 4RQPA 2QQJA 2WS93 2QJVA 1PMHX 1DGRN 2ID4A 4LBMA 5C3OA 4HZFA 5JXHA 4AL9A 5BNPB 2QE3A 5ABJA 3ZXDA 3GDBA 5LK7B 4ASLA 1XRUA 4N43A 1O3SA 2JECA 4YSFA 1CAVB 1HRI1 3RGBA 3WNMA 1IQDC 4Q4X3 5IK7A 1H2MA 4J1WA 3IT8A 4N53C 2D3RA 2BW8A 2ZGOA 2B7YA 3TWIA 4PLMA 4D7YA 3NV3A 1LGCA 3AP6A 1U5ZA 3O1SA 3HEIA 2YG0A 4NPLA 1MS8A 5FXVA 3A22A 1E57A 1COV1 4K8RB 4JGZC 3THCA 3VBUB 4EWDA 5CKNA 2X5IA 2DCYA 3GM8A 4AE2A 1AXKA 4IGQA 1YEWA 2F6BA 2LW8A 1A34A 1Z7S3 3LF7A 5K4LA 3INAA 5GZDA 4NHMA 1NQDA 2J22A 4FPHA 2R16A 5FCCA 1RHI3 2WA4A 3T08A 5FQ0B 2EXKA 2YDEA 4LQRA 1QH7A 3LE0A 1KJLA 1VBD3 3T4HB 1S0CA 4P9IA 4ARXA 5A6ZA 1NE6A 3ZPYA 1TE1B 2Y34A 4GH4B 3ZYRA 2X29A 1NG0A 2NMOA 5JSRA 2TBVA 3O0XA 3MYXA 2A6ZA 4AI0A 5IAXA 2WNUC 4N7UA 1O8PA 5FJKA 1SLBA 4IEXA 1BVP1 3ZO0B 2RE9A 4DXRA 4BISA 5K0UA 2WS92 3VZOA 3ZXEA 3FZ3A 5DAPA 4AQ2A 4K1ZA 3ZMNA 2VXJA 4A44A 3HNBM 4E4SA 1Q3EA 4E4HA 3H3LA 2ARBA 2WWSA 1BXHA 1W8FA 1ODMA 2ZZJA 5IT6A 5A3UA 1YRZA 2ZGMA 3FE5A 3PVOA 1ULPA 4Q4X1 4Y4YA 3B9CA 1QJX3 4P08A 4IERA 4ZS2A 2Y6KA 4UXAA 3V0AA 1I5ZA 1BYHA 1AHSA 2PYTA 4YW6A 1WWYA 1OI6A 3HPNA 5JR7B 2ENRA 1GZWB 1OSGA 2RM21 2V5YA 3PMEA 4XDQA 3S7IA 3ZN5A 2JG8A 2P34A 1DDLA 3I49A 3DECA 1RVF1 3POYA 4QD2A 2RS32 1W8WA 5CVRA 4KQ7A 4YFZA 3NMBA 2QTWB 3AKQA 1UMHA 3IWZA 1QJU3 2JDPA 1AR83 2Y64A 4ZU5A 1QOSA 3N4MA 3E6CC 1ODNA 5LK5A 4FPFA 4Q0UA 4O9EA 4FTSA 4CDWC 5LATA 4I0AA 3JXSA 2VMDA 4GXLA 4RA0A 1GOHA 4WM8A 1PM7A 3TEXA 4R9AA 1W99A 5IUQA 4D3WA 4XFGA 4LO4B 2DCZA 1YFUA 2W1QA 3CLPA 1ENRA 1U5YA 2BNMA 3W21A 1CPMA 3V0AB 1GYKA 2UWCA 3I3QA 5JPNB 3OBTA 4QM8A 5J3UA 5GZEA 4AEDB 2P1BA 2IXKA 2KD7A 4W50A 1C28A 5DG1A 4QPGC 1HQNA 5IVBA 2Y6HA 1I5PA 2VMIA 5EPAA 5A3PA 1JODA 4AK3A 2PHLA 3GNEA 1VRBA 2A3XA 4LXLA 3U10A 1H9WA 3B7MA 1F31A 2ZHMA 1NT0A 1VBD2 2CGNA 5DQ0A 4E4DX 1QJY1 4G3YC 4LK7A 4ORFA 5JIAA 4FOWA 2YPDA 5FYZA 3ME2A 1ULDA 3ACHA 2AYHA 4XBQA 3O1TA 1N47A 1Z7S2 4TLGA 5FP8A 2Y0IA 2EF6A 4FPGA 5C8WA 4WVZA 2J1AA 2QKDA 4YVSA 3IMMA 5FMOL 1YI9A 5F8PA 3W20A 2YXSA 2VUAA 5L7OA 1RUF1 4M0HA 1BK1A 5AC91 1W6NB 2OA2A 4OUSA 5FP9A 5FZDA 1H2LA 3KCCA 4Q5OA 5JWPA 5D1IA 1UPIA 5FZOA 5BPXA 5L9VA 1J84A 1PM4A 1IS3A 1GMMA 3LDRA 1FNYA 3RZZA 3VBHA 5IATA 2PA7A 1X8EA 4OUEA 2O14A 2B4KA 2PQSA 3HBZA 4EZ4A 2JKBA 4UWDA 1W2AX 4IV3C 5JVVA 4B3NA 2A73B 1AR81 3BPSA 5FZFA 1RJ8A 3DF0A 4XMIA 5FZ7A 3ZLIA 2PHXA 5LW9A 1DLCA 2Z42A 3A0NA 2K46A 5C5UA 1N3QA 3I7DA 4OULA 3KLSA 1SDDB 1ULFA 2HWD3 1BBT2 1VLNA 2QDNA 2XBO2 3NAPA 1RHI2 4BZ4A 4MV2A 1F8VA 2ZS6B 1NZCA 4NROA 4WV8A 2RS31 3RSJA 1KFUL 5J96B 1H8TC 2V4AA 3AP9A 3EBRA 4MZUA 3BN6A 1Z0HA 4Q2FA 1LHVA 5HCBA 2ZA9A 4A3XA 2AC1A 4WVMB 3PUIA 3NRUA 4BDVB 2VULA 3ECQA 4QB1A 4W65A 5L7OC 2RDQA 4Q4W1 2WYSA 3MW2A 1FAYA 3K3OA 3NV4A 4XETA 3Q8AA 4Q4Y1 1K5MB 2XOMA 1VRH1 2ZX0A 4Q4X2 1QNWA 1AR93 2X05A 1ZYBA 1UU6A 3ZYHA 1AZDA 4QQPA 3UKNA 5FPUA 3N9PA 3QBQA 2DTWA 2WAAA 3NJYA 4WM7C 3VD5A 4BK5A 1MACA 4AEKA 2WZPP 4AVAA 3HQXA 4QHZA 3KSCA 5JOZA 1QF3A 2XB6C 3BU7A 1UIJA 3HQRA 3M2MA 3NV1A 1OD3A 2R062 3U4SA 5BUVA 5FKCA 3O5SA 3LPFA 1VMFA 4DEQA 3B02A 4LOTA 5ABJB 2CY6A 1OXCA 5BNPC 1Z78A 2QFEA 2D3SA 4KBZA 1AJOA 4IEPA 4N43B 5DDJ3 5FBZA 4Q4Y2 2VO5A 5FYIA 1CAVA 4LA2A 5E88A 3M70A 1ZBE3 1VBE3 2R1DA 4WVVA 4IEVA 4R9DA 1JZ6A 4P9LA 1WGPA 2R043 3AZZA 3POFA 5FY0A 2A71A 2WT1A 5FZIA 5JPMB 1J3PA 2XHNA 2PELA 2XMLA 4PCRA 3D5OA 3VBSA 4AVCA 3OYWA 4LBLA 1NXMA 2W52A 1W6PB 4Y20B 3AFKA 1HJFA 1LULA 2H0BA 2RMU3 3U07A 3ZXKA 1WW4A 2D40A 3PVNA 2LS6A 4KBBA 4Q4V2 3SEEA 4L9BA 4BYYA 1YQCA 1Q8VA 4I3GA 4QPGA 4XFFA 4IEOA 2DVBA 2XG3A 2K0GA 1GZ9A 3POEA 4QU2A 3VBRC 1CIYA 3ZYFA 4BQ4A 3VN4A 1SBEA 3ZYBA 4H3WA 3UT0A 1ZREA 4PI0A 4OMCA 2I07B 1RUH2 1XNDA 4DZGA 1HB1A 4QKDA 4NIIA 1LOEA 1RUE2 2W1WA 2JE9A 4DMIA 4NIDA 1MS4A 1O3RA 4CP2A 4CXXA 1JOBA 4JX0A 3ZFGA 5BXXA 4HONA 1PO22 2PMWB 4CDWA 4CDUB 5IW0A 1D2SA 3RI9A 5G05L 1MZEA 3GZUC 1LEMA 2EICA 4D94A 5BNNB 3ORJA 3MV11 3SKJE 4LE3A 5JR2A 2OPKA 5FYYA 3C7OA 1ND3C 2VVEA 2QCSB 4IXLA 1NE4A 5IAVA 2HWB1 2OW4A 1YFWA 1MS1A 3WSOA 4G9SB 2BV4A 1TME1 1DIWA 1M06G 3FLPA 1VRH2 2WFPA 5F9TA 1KDMA 1F9KA 3GCXA 2BPA2 5CFCA 3PVBB 5BNNA 4CU6A 4ITCA 3AL5A 4YW5A 4CDQA 4EN9B 4D69A 1YNAA 1O5LA 3HN3A 4CDUA 4WBBA 3RI8A 2VNRA 4FPOB 1HV1A 1VAMA 4UFHA 2FZ1A 1FOD1 2QBXA 4LULA 1AL22 3GZEA 1NLSA 4Z82A 4XQWA 2CHHA 4JGZA 1UMIA 4D0QA 3S6PA 1KD7A 1KS5A 3JBG1 1MEC3 5C3PA 1VAVA 4WM8B 4A4AA 1XYPA 3TNPB 2RM22 2OQ6A 3MIBA 1H8TA 2WZR3 1OA3A 2Y6JA 4LBQA 5J36A 5A6QA 5FYUA 4QU1A 5CFDB 3MFCA 3RZMA 1YXWA 2CU5A 3MV01 2A3YA 3CJIC 1PGW1 3THTA 1KGYA 3ZN4A 3E97A 1BQPA 2FHRA 2PAEA 3HOBA 4AI9A 4RFRB 3E5QA 1UY2A 1DQ6A 2BFUL 2HWE2 4QDQA 4GULA 3WLUA 3CMGA 2BNOA 1FOD2 4Y1YA 3VD7A 1UW8A 4H2AA 1XYOA 5F7UA 5H9RA 2E63A 1C8M1 1W6MA 4DXZA 5FXXA 5CYYA 2A7AA 1NXD1 2F4LA 5TSWA 4HG6B 5FOBB 4YG0A 4NRQA 3JU9A 4JDMA 2ZTNA 5B4NA 1CAWA 3QH7A 3AKPA 4QX7A 4GJZA 2A6YA 4CP9B 1XC6A 3FLTA 2IVIB 4BU2A 4HKLA 4H55A 1ACCA 1XE7A 3NNGA 3J7MA 3N9LA 5JMCA 3BTYA 4MXWA 3VDDB 2RS13 2D6KA 4RHV3 4FOQA 2D98A 4MGSA 1VBC1 4DXSA 1O4ZA 1QJU1 3OUIA 1W9SA 4PLOA 4DFSA 3H42B 5HCHA 3ILNA 3GBGA 5K7PA 3MBWA 3P1IA 1DZQA 2FDHA 5GLWA 2WJSA 1UWWA 4KGGA 3W59A 4YZ5A 2QQPA 5D8AC 2WFF3 4E8DA 2FMYA 2SBAA 4L11A 4U36A 5CFDC 1VBB1 1JW6A 1TQ5A 3CF6E 2Y60A 3H1WA 4LEJA 2VGDA 1QJX1 1ZX5A 2ZGKA 3WG1A 4UT5A 2D6LX 4COZA 5FYTA 4O9GA 1V9U2 2NLRA 2HWB2 3H7YA 1TG7A 3AVSA 3GALA 4XOGA 1S2BA 3T09A 3LIHA 2DURA 1UY4A 3TN92 3MF9A 4XVHA 3EO6A 1UOBA 4MGTA 4Q0QA 3I4IA 5LRRA 4CU9A 3OEBA 3WDWA 5ACA1 4M3CE 4Z1VA 4ZXKA 3ASIA 1MR5A 3D8CA 4WZFA 1Q8OA 4E27A 2NMNA 2IXIA 4BMEA 2WN2A 1JZ2A 1EV11 5FKBA 3URFA 5C3QA 3EMRA 2YC4A 1E5RA 2DFCA 3LFMA 4NIAA 4PIXA 1ZZ7A 4XJ9A 2HLEA 3KGLA 5A3NA 1VALA 5DUVA 1JYWA 4NOTA 3UKTA 5A1FA 1RUNA 5GKAC 4QWNA 1UKGA 1KJRA 3SC7X 5M0TA 3K2OA 1VB2A 1E5HA 1NCQC 1AUYA 4HL0A 5JUVA 4CTEA 2JX9A 5F5AA 5A7WA 2VMEA 4HFSA 3WNPA 3JUUA 5JXJA 5LZ6A 3C7HA 1OVSA 4ZY9A 1L3JA 2ORXA 1QY4A 3PU3A 5JOWA 1IHMA 2GAUA 3Q9OA 1EAH3 4LORA 3EXUA 5C4WC 4X8NA 3WXPA 1PO11 1PX4A 1OA2A 3ACLA 4FFFA 2A75A 2V09A 4XTMA 1W0PA 5ABJC 5AVPA 1L7RA 5JZGA 3JBG2 4M3CB 2Y8KA 5J1XA 1DYOA 1GNZA 1VE0A 2H6BA 3BCWA 4JGYC 1WMDA 4J25A 4B4QA 1MQTC 3POSA 3IKWA 3S0MA 3TB0A 2R49A 2WS91 3AYCA 1R083 4OI1A 3SH4A 2AEYA 1RUI3 4FCAA 1RB8G 1S0GA 4YVWC 3IDAA 3WNNA 2HWE1 3P3PA 1S0BA 1YJKA 1QKQA 3VBUC 3APBA 4PQQA 3ETPA 1GQPA 5ANNA 3WY6A 2AR6A 5FWJA 1W9WA 2ZKNA 4JVAA 5I8SA 5J48A 1POV3 2EIGA 2BNNA 2VW0A 2CL2A 1OLQA 2Z69A 3GJAA 4H14A 1G8WA 3WDTA 2H6CA 2QDRA 2Q4SA 1IS5A 1WD3A 4QHOA 2P37A 2IFWA 2VZUA 2LM3A 4XJZA 4BE3A 2ZEWA 4IL7A 1W90A 4LA3A 4PBPA 4COUA 1GQGA 1E5SA 2JG9C 2VAUA 2VXRA 4BB3A 4AGVA 3IN9A 1H1AA 3ZFFB 5LA1A 1XE8A 2UY9A 3E6BA 1HRV2 1O4YA 3ACFA 1W9YA 3LEIA 4L99A 5FMBA 5FZ1A 1W9FA 1KXGA 1VAKA 4FPYA 1A78A 5F3EA 4N43C 5FYBA 4CCKA 2G4IA 3K4AA 2VZSA 3AP4A 5KHKA 5AFEA 1DGLA 2C24A 1POQA 2W87A 5CKQA 1PX3A 2VG9A 4CDXC 5LA2A 5LBBA 1CX4A 3V65A 3VZKA 3VBSC 4C8DA 2D6PA 3O1OA 3I3EA 3WNLA 2BOIA 3TOJA 1SCRA 4YW4A 2WNOA 4LK6A 1PIV2 1O91A 2XKPA 1X82A 2N7GA 1OF4A 3VZNA 2WNVA 3P3NA 3QACA 1SPPA 4CVUA 3C8XA 5IVVA 3WINE 1X50A 1QJFA 4Q26A 1JMUB 1ZBA1 3QH6A 4META 4R4ZA 4B4PA 1MS9A 2BU9A 4NPRA 2P5BA 2WNEA 3HNMA 2AREA 1GQHA 4MLOA 4IEZA 1OOPA 3MIDA 3H0OA 1QQP1 1OT5A 1V70A 3KV6A 5CU1A 5DAXA 5LASA 1OFSA 3T1LA 3T2PA 2R30A 1N1YA 1CJDA 5L36A 4YGEA 4LUKA 2BBVA 2R061 4FPKA 5F39A 5A3MA 1IG0A 1D2QA 3LGRA 1RC6A 3NSTA 2WZEA 2BOJA 2XJUA 4AEMA 4GWNA 2X8KA 3RMYA 2EALA 2Y0OA 3OGRA 3VKMA 4EN7B 5FXWA 4CE8A 1YQ5A 3CNAA 1BEV3 4P9YA 4PF5A 5KC5A 5H9QA 3B5LB 4ASKA 1FMD2 1QJU2 1X7NA 3AK0A 4YG6A 5APAA 2RS51 1RL3A 1ULOA 1V00A 5I0DA 1NA1A 2DWRA 3R4DB 3VLBB 3I2DA 3Q8BA 1DQ0A 1D7PM 2RS33 2YU1A 1K42A 1WLWA 4E9KA 4FTBA 4M0NA 2PHWA 4V1PA 5C8CA 1DGWA 3RMXA 2DCJA 3KMHA 4OLLA 3WQ0A 4DPNA 2XJPA 2D6MA 4XABA 5FPLA 4ARYA 3H3UA 3OGVA 3FFQA 5A7OA 2WO3A 4Y1ZA 3Q8FA 3GBFA 2Q1ZB 1AL21 4CEYA 3I2GA 2QQVA 3FC0A 5JSOA 1AX2A 1RJ7A 1US3A 3CJXA 2ERFA 2CWSA 2WT0A 3ZPOA 3GF6A 1D0HA 4YRDA 2GH2A 1AXYA 3HVDA 2C9AA 4P9JA 5DPNA 5LA0A 2ARCA 2ZMKA 1RUG1 1YQ2A 3U37A 3ZN6A 3CL1A 3H1YA 3KT4A 4OHZA 2GC3A 4CUAA 1VPHA 1Q8PA 2R0FA 5C5TA 4M00A 4AAPA 3OPWA 1C8NA 1GWLA 1IGOA 2Q1FA 4I02A 3ZSMA 2GNDA 1GV9A 4NPMA 1DHKB 4A3ZA 5A33A 1BMV2 2W94A 1R1ZA 2BEOA 3AYDA 3ZSLA 3BOWA 1V6IA 5T5OA 3ENRA 2HWC1 1AXZA 3T2OA 1CAWB 4MX3A 4FOVA 3AMHA 3DKWA 1GNHA 4PLNA 1QXRA 1SHWB 2ZEYA 3JD72 3LEGA 1S0DA 2E9QA 4FP3A 1U0AA 5FDBA 3PJYA 4AW7A 1LESA 2UYAA 5FZGA 4AR2A 1G9BA 2PHUA 4AFAA 1QOOA 3AJZA 3ZN6B 2DTYA 1FX5A 4EN8B 4GZ9A 4BQ5A 1T6BX 5FZ3A 2Y6FA 1PZ7A 5F2SA 5E89A 1UYXA 2QQMA 1AYN3 1LHWA 5A7PA 2YC2A 3H1MA 3VBUA 4GQ7A 5A1LA 3IAQA 1W8NA 1X36A 2X5IC 2XQRA 3M3QA 3VBFB 5A33B 1DQ1A 1RUC1 2FCUA 4NO4A 4TYSA 1JZ7A 4E2GA 2GZWA 3FJSA 3HN1A 1U5XA 4K1YA 1KRIA 2ZPXA 2IC1A 3GZTB 4RS5A 1Y9MA 4IV1B 2UWAA 1RUH1 1R091 2ZGLA 4KWJA 4YM2A 3VL8A 1YWKA 3T0BA 1JTZX 3WG4A 3I2FA 1LJ7A 2RR12 2NYYA 4RGAA 5JOYA 2FDFA 5FUNA 1C8M2 3SHRA 2P3YA 3I54A 1KFXL 4INDA 4IE4A 2DV9A 4ISQA 1UF2C 1H30A 4K40A 3ZXFA 5FZ8A 4AFMA 1LHNA 3AYEA 2JXAA 2W92A 5FZAA 5A6YA 2WYFA 1JN2P 1HB3A 3GHNA 4OYUA 1YCIA 1J1LA 2VTFA 2ZAHA 4W6WA 3SKVA 2YUEA 3WW2A 2NM1A 4COWA 1NUKA 1YIFA 4RGGA 2CV6A 5FTTC 2W91A 4FAGA 4XCAA 3KWVA 2BVVA 5FIXA 4LO7A 1SBDA 3EYPA 3BTAA 3PVEA 2VC9A 4I30A 2JDUA 2A3WA 4LMFA 1HXS1 1S4CA 3WHUA 3LWCA 3NVCA 1ASJ1 1PZ9A 4GMP0 1CAUA 1JUIA 3OBRA 4FFHA 3I59A 4K20A 2XPJA 5CFCC 1SFNA 1RMU3 3FL7A 4CP0A 1PVC3 2QQLA 2DCKA 2J1TA 4W6XA 2HWB3 4OZOA 4XDOA 2ZEZA 3ZFFA 3NJVA 5FYVA 5HBAA 5FZCA 4IE5A 5ANQA 4CCCA 4ISRA 2F17A 2ZX1A 3G7DA 1QXJA 4GMP1 1H8VA 3OD4A 2P6CA 2R072 1DYPA 2HEYF 2VMCA 3Q8CA 5L19A 2FZ2A 1FT9A 1LGNA 1WA6X 3G6JB 4QXCA 3SMHA 2J1EA 3JD71 4QQ2A 3USUA 4QGNA 4XHXA 2Y33A 4IE6A 2ZMLA 4GB31 2VBPA 4LHLA 4XHBA 4LHSA 1ND2B 3QOPA 4Y22A 4CCDA 1PZ8A 2VBDA 1FATA 2RS12 5JI7A 1WBFA 4XQDA 4FI9A 4N53A 3RRDA 3WQ7A 1O6UA 1CJPA 2OPWA 2GNMA 3WDUA 4YW1A 1EPZA 1D4M3 3N7JA 5H9PA 1OUSA 2YC0A 1YO8A 2IUWA 3H3ZA 3SCFA 3VHPA 1ZRRA 4H7MA 2C9KA 4XIOA 4KG8A 3CJIA 5EP9A 3T0AA 2VW2A 1XJAA 4CCJA 4ATFA 5GJ6A 4EQVA 1HN0A 4PBOA 1QWRA 2VBBA 3JZVA 3WUCA 3ZIXA 1RITA 3S7EA 3EB7A 2AEZA 5EYYA 1KS4A 2R041 4YW2A 3DXTA 2JG8B 1H6XA 1N3OA 1LOAA 3JB8A 3N35A 3ELNA 4IW3A 3S30A 1WMEA 1WZXA 2YZ4A 2J7MA 3K77A 4O65A 5EZWA 4UBHA 2O8QA 2KR2A 4NAMA 4C1WA 3MF6A 3S57A 4OHYA 1A8DA 2PFWA 3PUAA 2WZR2 2XLAA 3KM5A 4I01A 1UZVA 1HB4A 2VOTA 4UOJA 3AZYA 5FYCA 1O59A 1QMJA 1BK0A 3NQHA 4A42A 1JU4A 4XILA 3AJYA 2JDZA 1VBA3 1AL23 4OUMA 3W5MA 1V9U1 2OX0A 3L9JT 4B29A 2JD9A 1W06A 3RZHA 2MHFA 3BTXA 1PVC1 3M7AA 5FP3A 1SLAA 5T54A 3TN91 4KMQA 3WG2A 4QT6A 4IQPA 4UI9L 5DN2A 5BY5A 1HRI2 4H7LA 4BQ2A 1AYM1 1J1TA 1AR91 2LUWA 1FPN1 1V6KA 2XHKA 3VBOA 3VHOA 2WC2A 5B2GB 5EIYB 4Z92B 3IIIA 5FUPA 3S5AA 4HPKB 1LHOA 4AI3A 1Y9GA 4C0HA 4LLOA 4RL7A 1ZBA2 1COV2 1YJLA 2OUJA 3B01A 4Z07A 5FZEA 4BWOA 3OG2A 4DRVA 1VP6A 4L2NA 5IJRA 1OQDA 5DZGA 3UKVA 1K45A 4QX8A 1SMVA 2JG9B 5EQUA 2LRPA 2Q5TA 4A41A 3AL6A 1DQ5A 3I2HA 2CDPA 4QM9A 3OEAA 2ZHKA 5BNNC 2OS2A 1LGBA 2OZJA 2BUKA 1HIXA 2HEVF 5C3RA 4PT6A 4GJYA 1AR72 4LJHA 3T30A 4JQTA 3FUQA 2RJLA 5DUXA 5FBJA 5BNQA 2WT2A 3OY8A 1KQRA 5AVAA 3GJBA 2IXLA 2ET7A 3AX4A 5GLVA 1ZA4A 3HBKA 2VUCA 3KQ4B 3K3NA 5FMCA 3U11A 1JZ4A 3VZLA 4CA9A 2HYKA 3PNAA 4NRMA 4YFWA 3OGJA 1CZSA 4KNCA 2D44A 3DYOA 2ZGPA 1LRHA 4ZONA 3ZKUA 1LB2A 1JYNA 5DMYA 2GP3A 2V5DA 4XE9A 2X09A 5CADA 1FMD1 3MUY1 4RFT0 5B4XA 2JWPA 5JCTA 1GICA 3N7MA 3OF1A 4CXWA 2V72A 1H4GA 1XNBA 2DBNA 4GH4A 4XW3A 3BGAA 3LSEA 4E8CA 1L7LA 4LKEA 3LD8A 5FY7A 2XLFA 3M3EA 3BOPA 1VMHA 4PHZA 1JZ3A 1J58A 2JG8C 2C0ZA 1TNRA 2ZKLA 4XQ4A 2E53A 5F3GA 1SLLA 1WCDJ 2E7QA 2E7TA 5LRSA 1UKRA 4HANA 5FLHA 2O8OA 3SCGA 3TBDA 2JJ6A 1ZZ9A 1C3HA 2ADDA 2OXBA 4GAZA 2IXCA 4U2AA 5CFDA 1S55A 3LA2A 5K8SA 1AR61 1AYM3 2C4XA 3P5BA 1K12A 4XDPA 3IAPA 1RUG2 4FO9A 5D2AA 4A45A 1RMU2 4UFMA 4N7IA 1H6YA 4XF0A 5KWRA 1Y4WA 4XUNA 4KWLA 5FZBA 4CEWB 1XU2A 2D6OX 2QQUA 2VMFA 2O0OA 3IDEA 3WOGA 1CN1A 3J7HA 5IVJA 3ZFEC 4ZU4A 5ERLA 2E7AA 1RUJ1 3C3VA 2VY0A 5EFUA 3O0WA 5DXDA 1Y9QA 1J59A 3KS7A 1R092 1ND2C 4B7KA 1JI6A 4MHRA 4TXWA 3ES4A 3DEMA 2WIIB 1TZOA 3NNMA 5A7SA 2Z4FA 4CU8A 4FPLA 3ZXGA 1Q5OA 3V64A 3SNMA 5C9AA 2XVKA 2BWCA 1ZZ6A 1RUD2 1YYNA 2WN3A 5FZHA 4XYXA 1PO12 5A80A 2PXJA 2WKKA 3VL9A 3MW4A 4AQSA 1FV2A 5GLZA 2VPVA 5A70A 3OYWB 4LIUA 1W6PA 4Y20A 4G4FA 2UY8A 5SV5A 4TSVA 5FV3A 2WO1A 4MXVA 1RUF2 4SLIA 5I8TA 1CESA 1MVEA 2VQAA 5FRAA 4AHWA 4LKFA 4JGYA 2HBUA 4MUVA 3ST7A 4C90A 1GBGA 1NY72 4FXGB 2QQWA 1JS9A 2LALA 1EAH1 4QPGB 5IHRA 5CZKA 4ZHNA 2Z5WA 5E6HA 5J7MA 5FK7A 4R52A 1W04A 3K46A 3RYRA 1AVBA 3KV4A 2GALA 4JTOA 1B35A 1OLRA 1W3XA 1HLCA 3OUHA 1FV3A 2QUOA 1DG6A 1K5JA 5LA9A 1GZWA 2W95A 5EJ3A 1OA4A 3VDCA 5LBFA 2JIGA 3ZSJA 2JB8A 1W8HA 3RG0A 2YV8A 2XDVA 3H8UA 4S2FA 1UOFA 2HWC2 1Y7BA 4N53B 1ULCA 5DUWA 4AHZA 5IVFA 1VBD1 4P5YA 1D4M2 4JKMA 4NHYA 3TAYA 3CKHA 4N9HA 1LECA 4YZ3A 4NHKA 4MGKE 2ZACA 5FXZA 3R0RA 1LODA 2MEV3 5FMDA 5FZ9A 3I8TA 3L2YA 1UIKA 4HVRA 4WZCA 1Z7S1 5F5QA 2NZ9A 3UETA 1MS3A 1V6NA 1WCKA 2VZRA 5J37A 2YU2A 3LZZA 4UBGA 3JCIA 1B35B 1JUHA 1G6NA 5CFCB 4ET7A 3I2KA 1YFYA 1V0AA 2R073 1LR5A 2ZGSA 2ARAA 4S2GA 4CRQA 1BJQA 4CCEA 4DUWA 2G9ZA 2WUHA 4Y1UA 1VB4A 5DG2A 1GANA 5D21A 4E2QA 4Q0VA 4EYUA 3MLKA 5AC92 2WFF1 3T4VA 2BGPA 1AR82 2VNVA 4AXOA 3TEZA 3UESA 1OOPB 2EAKA 2KA3A 2FCTA 3K75B 3H8XA 1WMXA 1FPN3 3LKJA 3MI8A 2RR11 4QPYA 1UCXA 5A3TA 4GB32 1SDWA 4CDQC 4OQ8A 4LKSA 1DCSA 3TEYA 1LTEA 4YVSB 1ZRDA 1ND2A 2BZDA 2DCTA 4FQ4A 4EN0A 1PVXA 1AR62 2VMGA 4XBNA 4AOCA 3VBOB 4LLFA 4AFBA 4S2HA 4DEVA 3LDBA 3T0DA 2WLQA 3HR9A 3H8OA 3ACIA 4V2VA 2ARXA 3UGHA 1FMD3 1HN1A 4LUMA 4QPIB 5K0UC 5LEJA 3WG3A 3I3DA 3DKQA 4YGBA 2GNBA 4KWKA 2VOVA 1BEV2 1UU4A 4LO5B 4XFAA 3RQ0A 1H0BA 3ZXJA 2VQTA 1C8M3 4PJYA 5C7GA 4QXKA 1ASJ2 2CAUA 2PAKA 2ZGQA 1WD4A 3PUQA 4AAXA 4FPJA 2ZOEB 1JYIA 4L92A 2B8MA 1EUTA 4Z8BA 3ILFA 3ZFFC 3NL1A 3OGGA 3I3BA 3LOIA 4YNIA 4HLTA 1XNTA 4X6RB 5D8AB 4AZZA 1EY2A 1T6GC 5HCAA 3KHCA 5F32A 1MZ6A 2WZR1 2FMDA 3BVCA 1WW7A 4DO0A 2VTXJ 3FMGA 3V0BA 4Y33A 2DVDA 4YYOA 1DFQA 4J1XA 1O5UA 3VGIA 3M3IA 1N1VA 4XUOA 1PGL2 4HSLA 4XUTA 4DB5A 3BALA 3ZSEA 3K51A 5JIUA 1V6OA 1C57A 5FK8A 4IDZA 3RNSA 3VBOC 2LROA 2WQZC 4QQLA 2R7EB 3JQWA 1CZTA 3WP5A 1LU2A 3VKOA 4QGLA 2OUHA 4IEYA 1HJGA 3SISA 2DFBA 1XE0A 2DF7A 2WO2A 2MEV2 4OI0A 4J6GA 1H1MA 3QD6A 3TNQA 5C6CA 3C7FA 1OF3A 1QNYA 3M4FA 5T5PA 1QJEA 5L9RA 5EHDA 4Q4V1 4YWAA 3SITA 3NW4A 2R32A 4NHXA 2E31A 5FYSA 4IE0A 1TNFA 1VBA1 3S5QA 5FY9A 4HXCA 1DGWX 1LHUA 2RJ2A 1PK6B 5FZMA 5C70A 5CA6A 5T5JA 4MHUA 3ZYGA 1SLTA 3HIFA 1NZIA 3KF5A 3TRSB 2ZJCA 4XUQA 2BP6A 4BHPA 1DQ2A 2KM2A 2VOKA 3OJBA 2VW1A 3B3QE 1QIQA 1U5IA 4LBKA 3T2QA 3SEPA 1LAJA 4BLIA 2E26A 1S1AA 4KG0A 4URTA 1AJKA 1SLIA 2VR4A 3UYJA 4YVSC 3ZR6A 1RUI1 3ZKYA 4BH9A 2VZPA 1EAH2 1PMIA 5C4WB 5FFOC 1RINA 1CR7A 1UQXA 3FBMA 1MVQA 3BU0A 3PUHA 4QX0A 2XH6A 4RQPB 2WBKA 3WQ1A 2JKXA 4XJWA 5EJ1B 2J1RA 3CU7A 4XBLA 4FPEA 4MGQA 3BI3A 2PHRA 4HKOA 4DY3A 4MGIE 1PO21 3CBNA 3KF3A 1GOFA 1RUD3 4GWMA 2P3JA 4UF0A 1MQTB 1YI7A 1OLMA 1CD3G 2WLPA 3OGSA 3VBRA 3R4UA 1I6XA 3VDDC 3LAGA 1CX1A 3H7JA 4NHLA 4XAEA 1LNSA 3N36A 2PLV2 3POGA 1G9CA 1R093 5FPZA 1WMFA 5CG8A 4GWJA 2DUQA 2VTXA 5A3OA 2PN5A 4OFGA 4XACA 3ACGA 1ZBE1 4QMAA 3MIGA 5C4WA 5HI0A 1OQEA 4ZXEA 4CDWB 3LCPA 4I0BA 5FZ4A 1XSRA 2B42B 4UFIA 3M3CA 1ZRCA 2AH2A 1TVGA 3MLLA 3PLQA 4IESA 4BXSV 3BTZA 1NYWA 2VNOA 1NAEA 3PDQA 4M01A 3O1VA 2ZGNA 3TN93 5FQ0A 4QDSA 5AC93 1GP5A 3OB8A 3UK9A 4BXFA 2G1MA 1MQTA 2W3JA 4BQ3A 4DXTA 1V9U3 2B5HA 2G9FA 4O61A 2AUYA 2UWBA 3WF1A 2FDKA 1W8TA 2VZ1A 1ASJ3 4C0BA 3ZYPA 4CEWC 2WABA 2L9LA 3BB6A 3KT7A 3NO8A 4PDWB 2WQ4A 5C8CC 3WP4A 5HV0A 5GZGA 4DNYA 2DU0A 1E5IA 1XB9A 2CGOA 3AXDA 5FP4A 4YGCA 4NIGA 1RUJ2 2NN8A 1N1TA 1MS0A 2E51A 2A5ZA 2VH9A 3J9SA 3KB5A 2ZGTA 2HWF1 3IIAA 1CWPA 1IS4A 4AF9A 1G9FA 3KQRA 1WBLA 2EAAA 4KGQA 1AX1A 4XPVA 5FR3A 1JZ8A 1ZNPA 1HW5A 1AR63 1B09A 1PMJX 3MICA 4AVBA 2YBSA 2HWF3 1ULGA 3KCXA 4YARA 1UZYA 2JDYA 1W6OB 3C2UA 3LEMA 4CU7A 4TN7A 1LEDA 2RHPA 2JICA 1STMA 4A6OA 1BMV1 1D4M1 4XCBA 4Y24A 5LY1A 4I0WB 2RDRA 2K9ZA 4LO6B 4XF3A 3ZSKA 3VB9A 3DUIA 3GGLA 3N9NA 2VCAA 2ZAAA 5EXOA 5E16A 3VKFC 4XF9A 4NRPA 3MIEA 4CPBA 1SACA 4QHBA 1DZTA 1UU5A 2WO7A 3ITQA 2YFUA 1R1A1 2CWMA 4P14A 1O7FA 4YLZA 4IEQA 5F3CA 5DABA 4QGMA 3MUZ1 5T50A 3ZDVA 2QQNA 3ZFEB 3WF4A 2Q1MA 4MSVA 2BFUS 4QQOA 4V2WA 1QEXA 2JE8A 2WQ8A 1PGSA 1RUF3 4ATEA 5JLVA 3KV9A 5BYNA 2WWUA 1YHFA 4JTNA 2YMZA 4M4PA 1XNAA 2D3PA 2WAOA 2YB7A 3HQUA 4AVVA 3WW1A 1CIWA 3CO2A 1U12A 3OTFA 1WUVA 3U4XA 1O3QA 3OBZA 4CUCA 1RUI2 3WR0A 1A6CA 4OZXA 4PQ9A 2HWC3 3O12A 4LHNA 1EP0A 2TEPA 1UZZA 4IEWA 2KXLA 3OPZA 4LPLA 1C1LA 2ZX3A 2XJSA 4YW7A 1RUD1 1S0IA 4YZ2A 4XURA 4MYEA 1UMZA 1J3RA 3O1MA 3D3AA 2DYCA 1W3VA 5DAWA 3JBG3 4LBJA 4RSUA 3AMMA 2P2KA 1CAXB 4W8JA 3RJ2X 3UJQA 5FPXA 2DVAA 5JZGB 2IVJA 1BCXA 1NOVA 2UU8A 4P02B 2WR9A 2XVLA 4F83A 3CZJA 1RGSA 4QX1A 2DBIA 4OVEA 1QJY2 4R8HA 2R071 4HPKA 1IPJA 1W6NA 2XWJB 1IKPA 4QKFA 5FY5A 5KBFA 1OMIA 1NCQA 2BERA 2JE7A 2ZHLA 1AYM2 2GC2A 5FZOB 1QU0A 1ENXA 2JIJA 3VHNA 3Q8EA 3THPA 1V6MA 3JQXA 1UO9A 4ZKTB 2XJRA 3L2HA 1XSQA 2Q0AA 4QX2A 4DINB 5ACA3 4KWUA 4YVWA 3WCSA 4D8MA 1DU3D 3AP5A 1K3IA 4O7XA 3RFRA 5LY2A 4L0PA 5KXBA 3POBA 1VRH3 3AMQA 1RIRA 5T3NA 1V6JA 2A70A 2YGLA 4WM7B 1SQ4A 1OURA 3ZMOA 1WW6A 5KXDA 2RS53 4R9BA 1N1SA 1C5HA 3RYKA 1OLME 1X8MA 3IDBB 1POV0 3OUJA 2JDNA 4YG3A 1VBE2 3BODA 5CEHA 4FT8A 1SZBA 3N7LA 4GH4C 1YIPA 2Q30A 2WSVA 2ES3A 2VM9A 4IE7A 4RHV1 1PO23 3LIGA 2JD4A 3POWA 3WD5A 1JXNA 2P4EA 4QAWA 3NV2A 3LB9A 4Q0PA 4MOAA 1POV1 3J4UH 1ZZBA 1HRV1 2R063 1IQAA 2VD7A 1ND3A 1KEXA 5F5IA 3WP3A 2WFF2 5A6XA 1US2A 3VDBA 1OBNA 5GALA 4Q1RA 4XIKA 4QXBA 5FY1A 2XBO1 2WNUA 5A3WA 1VJ2A 2D7FA 2NP0A 1S0FA 4NWVA 4CZSA 2A6XA 5FZ0A 3VV1A 1DQ4A 3HNYM 5C3SA 3PURA 3SXWA 1MS5A 1AR92 2QQIA 4FOYA 4M3CF 1S0EA 2CDOA 3K4ZA 4RHV2 1CVNA 4L97A 1YFXA 2JENA 2YYOA 4QKBA 3VBRB 2Y26A 3WW3A 1COV3 1ZBA3 4GIQA 4DRRA 1CGPA 5HXVA 3NWKA 3VKLA 1YQ6A 3DCQA 3NNJA 1HDKA 1FYUA 1ZA7A 3NAPB 4K8FA 4QB6A 2QQKA 4Q1PA 3LDKA 2WRAA 5ISLA 1O8SA 1H1IA 3WCRA 1UD1A 1BBT3 2HWD2 3AKRA 2WNUB 5CISA 5IFPA 1K5MC 5JSPA 1D4VB 2RR13 4AGRA 3HWJA 1F4AA 2BVBA 2W68A 3D6EA 2Y6LA 3QCWA 4QPWA 2VOXA 5G04L 1JYXA 5I8YA 3UNPA 2C26A 2IXJA 1NLQA 2PHDA 2ZX2A 3F2ZA 4XEZA 5BNOC 5C9AB 2WA3A 4Q4W3 1X9PA 4AI8A 4JAAA 4XZPA 4TWTA 2FDIA 4X6QB 2AGSA 1REDA 2ZXQA 4QB2A 1SEFA 3OCPA 2V4VA 1W05A 4NJ4A 3ZIWA 2EIBA 3RZKA 1V6LA 4RQPC 2YFZA 1F5JA 3HT1A 5DUUA 5FP7A 4AQ6A 3WX5A 1UXXX 1YC61 5L73A 1F35A 1IZ3A 4XJUA 5GZFA 4CCMA 3OSDA 5BV6A 3ZXLA 5KHJA 4TTGA 3GBWA 4JGYB 4BQWA 4ES8A 3BIEA 2ZEXA 1JYVA 3E5XA 2D43A 2DU1A 3ON7A 3CQOA 3WNKA 5AFBA 4LE4A 2ORZA 3VD4A 4BM8A 4UF0B 4Q8KA 1GKBA 2XVGA 1IOAA 4CEYC 2VCMA 1W39A 5F1RA 2MEV1 5DAVA 1QH6A 4OHWA 4EZHA 1C4RA 2YROA 3AMNA 4OI4A 2J1SA 4AG4A 2XBO3 4YGDA 3IB3A 2CYFA 2XUEA 2YY1A 3ZXAC 4Y22B 3NKGA 2GP5A 3AKTA 1VBA2 4AEDA 3I97A 3LQCA 3VBHC 4HVOA 3THDA 4D7SA 1WCUA 1AF9A 1AYN1 1OUXA 2G9GA 3EHKA 4B8EA 4EROA 5K0UB 1W28A 5T5LA 3VUOA 1JHJA 5LWBA 1I9RA 1W6QB 1MZ5A 3POJA 4DS0A 2J42A 5F37A 2AACA 1CONA 5FWEA 3PMSA 3IMNA 5F2WA 3HJRA 2VZQA 2W5FA 5JZGC 2YHJA 3RWKX 3U75A 3RZLA 2BJSA 3E5UA 1C1FA 1VMJA 3IPVA 4FPCA 4Y3OA 1Q8SA 3ILRA 3NKTA 3AM2A 3W9AA 3BKZA 4HOOA 3U0ZA 4LHKA 4NMIA 2RVAA 1QDCA 4CDUC 1VBE1 5H9SA 1J3QA 3OBAA 4JQRA 2BGOA 3K4DA 5FZ6A 4OQ9A 4S2DA 1S0JA 1UOJA 2EIDA 2XLGA 3HD8B 4ASMB 5C8CB 2DUPA 5I0TA 2BBAA 4XXAA 2XL9A 5DDJ1 4K9SA 2FD8A 5DZEA 1R64A 1GP6A 3SH3A 1L7QA 2E33A 2HWF2 2I2SA 4CPBD 5JXGA 1W6QA 3PIJA 4K21A 3J8F1 3RPQA 3O7OA 4LNVA 4A2UA 1RHI1 4MGYE 2HYXA 3KD4A 1HX6A 3KHBA 3WT3A 4I09A 1G7YA 1RMU1 2VCCA 1PGW2 3PL0A 1ALYA 2R042 1BKZA 1XBFA 2E32A 3MIFA 4LBQD 2BRTA 3ALQA 4TLFA 4NIHA 2ZGRA 3HMYA 1IKQA 1RUJ3 2YPJA 1EV13 1SBFA 1LENA 3A21A 3MIHA 4AWDA 4A7ZA 2WDBA 4LO8A 3IM0A 1NY71 3ZR5A 1DYKA 4DUVA 1PHMA 1W2TA 3WVJA 3MPPG 1OVPA 3D0JA 3FLRA 4UAPA 3NJZA 3TEWA 4FFIA 3DGTA 2Q8OA 2ZHNA 3PHMA 2VQUA 4Y26A 2GMMA 2DVGA 4Y1VA 2R1BA 1NCRA 4MVTA 1JYCA 1XXNA 4CUGA 2EIEA 4XUPA 5CNAA 3N9QA 2MNGA 3OPTA 3WF2A 1H8TB 4LBQB 5A32A 4Q0SA 5A7QA 3MO4A 2BWAA 2W9XA 5KHHA 5FO8B 4BIFA 4MH0E 4D6RA 1WCSA 5D8AA 3GHMA 5LEKA 3KGZA 1W9TA 1ENQA 2P6HA 2RV9A 1F5FA 3OY8B 4EV0A 4UW4A 3V0BB 1URXA 2A6VA 4RYDA 3U14A 2FQPA 4L8QA 2RS11 1LCLA 4BA6A 3VBFA 3LEKA 4DIQA 4HSJA 4YPJA 1UX7A 2LTNA 2PQQA 3JD73 4BIOA 3C7EA 5CG9A 4IV3A 3FUOA 5FPVA 4ZZ5A 2EXIA 2FDJA 2WINB 2D5HA 3A0KA 4LIVA 4PF1A 3ZM8A 2PHFA 3MEPA 3N7KA 2ZCWA 1HXS2 4IV1A 4BCUA 4F7ZA 4N90A 4MXWB 3VDDA 3USUB 3M3OA 5IYYA 1VIWB 1HV0A 1PNGA 2HEWF 3PU8A 2BTVC 4IETA 1RYYA 4XFCA 1GLHA 5HPOA 1Q8QA 2ZZQA 4HK8A 3VZMA 4EE2A 2D93A 5FYHA 2WWJA 4BLJA 3A4UA 2A1XA 4RGKA 4ES9A 1AL0G 2X5IB 4MO3M 5DZFA 3VBFC 5FOJB 1HXS3 4DOUA 3O1PA 2VMHA 3WDYA 5KR7A 5F6LB 1SLCA 3J26N 3IDCB 4QKNA 5GLUA 3WEZA 1AYN2 4HK9A 2HBTA 4IUGA 3M1HA 2XKOA 1NA1C 3PTRB 4K3UA 3NNLA 4IV3B 4E2SA 5KHGA 1XPWA 2X53S 4RR3C 5A7NA 1UX6A 4QDRA 2W46A 5IK5A 3D82A 5FZKA 1O3TA 3F95A 1APNA 3AXEA 2QZ3A 2A6WA 1K5MA 2ADEA 3AYAA 3T3YA 4E4ZA 1XU1A 1CQ9A 5LCWL 1LOGA 2D6NA 1YLLA 3BYWA 1I3HA 1CAUB 2BDRA 4K7JA 5CAZA 3I59B 5FLJA 1H2NA 4CEWA 4LR4A 3SLIA 2B9VA 4XTPA 3WF0A 1OD5A 4AEJA 1UYZA 2GDFA 2B9UA 3LA3A 3N9MA 2B46X 1ZZCA 3WP6A 4D6QA 4UFJA 1W8OA 4ZS3A 2VVFA 2DDUA 2RDNA 1R082 3POIA 1UY3A 3IZOA 2QZ2A 4Q27A 1IG3A 1JHNA 4WM8C 3UGFA 1UY1A 5EJZB 5IVEA 4CCLA 4QQHA 5IWFA 3PIGA 2RJKA 3WDVA 4BQXA 1JH5A 3BIWE 3MDPA 4XJAA 2CNAA 4FBFA 2I45A 3AFGA 5CBLA 1ZRIA 1NLRA 2B45X 2Y6GA 3I2JA 2JDHA 2ETEA 5HCFA 4FTEA 3VBSB 3AVRA 5IK4A 1JYTA 2VECA 1SFPA 2XQXA 1EV12 1TMF1 1BEV1 1KITA 1WKYA 4LBNA 1EUUA 2P3IA 1NCRC 3I3MA 5EWSA 1BLZA 4PDWC 1OC1A 5GM0A 3H9AA 4AFDA 4KH9A 1ULEA 2EA7A 5K9YA 1YQ8A 3ATGA 1GZCA 3ETQA 4GKXA 4R9CA 1XQNA 1JOJA 4A7YA 3MGUA 5FY8A 4EJRA 2JDAA 3WF3A 2XL7A 3J8F2 1LKNA 1QQP3 1F2NA 1DZRA 2GN7A 1PIV3 4NR1A 3FX3A 4AQTA 4B1LA 1GWMA 1A3KA 5F3IA 3VKNA 3ZFGB 1WW5A 2DVFA 2V73A 4BPZA 4Y4RA 5I0RA 1OH4A 2WZ8A 3KVAA 2VNGA 4C1XA 4GB33 4C91A 4DUXA 1T2XA 5A3LA 3AB0A 5E8AA 1FPN2 3R05A 2OKXA 1IPKA 4D6SA 2W0XA 3AC0A 3A7QA 2TNFA 2GNTA 1P8JA 4W6YA 1TME3 1LOCA 2CTVA 3DXUA 1EPWA 3DV8A 1PIV1 3CIHA 3FHIB 3HAGA 3FFZA 4GMP3 5LBEA 2VZ3A 3D4KA 1PNFA 5CKMA 1AR71 3KZ4C 4GALA 1HRV3 3R6SA 3WZ1A 1W6OA 3SCHA 5IVCA 4JDOA 4JCKA 2JDMA 4AHXA 5HV4A 4OHVA 5LB6A 2ZX4A 1OKQA 2IZWA 3NNFA 4XFIA 4ZU7A 1DGRA 4QX3A 1UYPA 4OI2A 1X33A 2J1UA 1OQ1A 2OQ7A 2ILMA 2R0HA 3ZYJB 3UJOA 5F6KA 5FPAA 1SFYA 1QGLA 3FN9A 4KU8A 1RVF2 4LBOA 5HXMA 3T2TA 4COYA 4CXYA 2XJTA 3B9IA 3ZX7A 1QHDA 2JG9A 3PTYA 4GKYA 2QNKA 1LOFC 3HT2A 4RR3A 3MW3A 1DF0A 3P6BA 3CEWA 1W0NA 5FUIA 3VHRA 1KDKA 1QDOA 4MG2A 4EN6B 5JMOA 2FDGA 3USSA 1ZM1A 2IXHA 4HN1A 2BGCA 4NVPA 2JB4A 1Y3TA 3VDAA 4FXKB 4I3PA 2I74A 2JDKA 1W0OA 2Z79A 1G9DA 5JXIA 4JDNA 3LA7A 4IEUA 4JZRA 2WNVB 3GXUA 4EWAA 4Q4W2 1GOGA 3LFIA 2NPIA 4FQZA 1TMF2 1UPSA 4QPIA 3DPRA 5I0UA 2HWE3 3SQOA 1FI2A 1UNBA 1N3PA 4IV1C 4ZZ8A 2W1UA 1VR3A 4YM0A 1NCRB 4TZDA 4HMZA 2VQ0A 4AGGA 1BHGA 4P9WA 4BJ0A 3DN7A 2PLV1 2YBPA 1OPOA 3X29B 4R4XA 3D0SA 2WSUA 1CAXA 2RM23 2XXZA 4Q29A 1GZTA 4EWEA 2XR4A 4F3JA 5KXCA 1JZ5A 3CDZB 1WCQA 4YM3A 2VVDA 1LOFA 2CAVA 1W8UA 4UW3A 4Y5TA 1JBCA 4IGOA 4CSWA 1PO13 2XWBB 2RG4A 3WHTA 3RDIA 4GD4A 1NCQB 2VZTA 4NUBA 1NX9A 4XXPA 1S2KA 5FY4A 1UN1A 5SV8A 2VL4A 3RVHA 4XMAA 5FMOS 1SCSA 4AVTA 4B7EA 4NN0A 3AMPA 2QQOA 4UW5A 1GWKA 2GU9A 2UYBA 1TEIA 4HN0A 1MZFA 4ONUA 1Q43A 1O4TA 3DL3A 1QXPA 1RTVA 1MEC1 2OT7A 2DUOA 3AZVA 4HKWA 4N8MA 5J98B 2EXJA 4Z2AA 3J7NA 3K48A 4HETA 3E1F1 1HQWA 1W2OA 4UFLA 1OHFA 4M3CA 1RXGA 2VUJA 4FFGA 3M8LA 3RZGA 3MZHA 1F15A 3UV9A 4RD7A 2YBKA 1WLCA 1XOYA 4M4RA 1RUOA 2VE1A 5FPBA 4CP1A
chains in the Genus database with same CATH topology
4JV4A 3QLQA 1PGL1 1GR3A 2HWD1 1RUG3 3VZJA 1UL9A 2BYVE 1PK6A 4DY5A 1R1A3 5BNPA 1Y43B 3KT1A 5I93A 5CB7A 1RUH3 2BQPA 2RS52 1RUE1 3LOBA 3GZAA 2ZBJA 2ZGUA 4RS5B 1AX0A 4WVWA 4AYUA 4P9GA 4YM1A 3ROUA 4F8AA 3SH5A 4B4RA 4BOWA 3RWNA 1RUC3 4JRAA 1M4WA 1RUC2 3LSDA 4PDWA 4AHYA 2IFRA 2OVUA 5I0SA 1B35C 2F4PA 5GLTA 2NQYA 3N3HA 5FAXA 3ZYIB 2GMEA 4N9IA 2W08A 3ZVXA 5ACA2 3T1MA 1VBC2 3ZDSA 2ATFA 2JEMA 2AENA 4XF1A 2D5FA 2FBEA 5KXEA 2WL1A 1OFNA 3EJKA 1ZVFA 2K2SA 4YZ1A 3B93A 2YGMA 1QJY3 4SBVA 3TYJA 1VBB2 4UW6A 2GH8A 4XFHA 4FAHA 1CPNA 2GN3A 4JRLA 5FO7B 5JAXA 3RS6A 1AR73 1DBNA 1REEA 2B39A 3PJQA 4Y1XA 4CDQB 2R6QA 5BNOB 5C9AC 4I2OA 3KCYA 3JB4C 3AZWA 3B69A 4HT1T 3WV6A 4FVVA 4RS5C 2OZ6A 2OYZA 4YW3A 2P17A 4JGZB 4MGZE 3IBMA 2W39A 3FBYA 4QPIC 3RYPA 1H9PA 3ZFEA 1FXZA 1QOTA 1BVVA 3ES1A 4FP2A 4Z2WA 3AP7A 5FLIA 3EQEA 4KU7A 1ZZ8A 4COVA 3W58A 2PHTA 3R4SA 3MFAA 3MPBA 3FWEA 2P3KA 5L7OB 3B00A 1RVF3 1HRI3 5BNOA 5T52A 3ZFGC 4XFBA 3WW4A 2XJQA 1FOD3 4AVSA 1LOBA 4X8PA 1Q56A 1W6MB 4FSJA 3VBHB 4AI2A 3WUDA 5A3MA 1REFA 5E1RA 3V56A 1H4HA 4QX5A 3CJIB 1VBB3 1TMF3 2ZABA 4K6BA 5CIRA 1W2UA 4AEDC 5FREA 1NA1B 4BMBA 1TME2 4AI1A 4DQAA 1MEC2 1XNKA 1EYBA 2MPFA 2Z2SB 3GYDA 1RUE3 4D7TA 1H2KA 2GMPA 1VBC3 2D97A 5J09A 2XGXA 1IS6A 5JOXA 5IK8A 4XJ8A 1FNZA 3AZXA 1WLTA 1G9AA 4LTAA 1OOPC 3J8F3 1OPMA 4LT5A 4PIZA 1ONAA 4NWWA 2UURA 3IPVB 2H0VA 3OD0A 2VOWA 2IWGB 4Q4V3 1D0GA 2GC1A 4YVWB 5I91A 1YUDA 4P9XA 1PK6C 4CYDA 3WNXA 2SLIA 1QJZA 1LU1A 4BQ1A 3AKSA 2ET1A 1R081 2PAMA 2ZMNA 1ZRFA 5KC6A 3O0VA 1I1EA 3E6DA 1R1A2 3H50A 3B94A 4WM7A 1UAIA 1ZBE2 2OIIA 3DPRB 1BBT1 2RMU1 4Y5Z0 2GC0A 1C5IA 1ENSA 5DDJ2 1NQJA 5T55A 1HKDA 1GFF2 1GSLA 2Y38A 1DLLA 4KL1A 2QVSB 1XYNA 3RJRA 3UL2A 3O14A 1A8MA 1WLDA 4GA9A 4AFCA 1PVC2 1QQP2 4OHXA 2C5DA 2AZ5A 2GSYA 2PLV3 4CDXB 4JC1A 1ND3B 3NAPC 2RMU2 4CEYB 5GZCA 2E6VA 4WVMA 4XF4A 1BZWA 1WA4A 4RR3B 3MLJA 2EXHA 2C1FA 4HBNA 2O1QA 2CGPA 2XUMA 4A7KA 4HVQA 2PTMA 5A32B 4Q8LA 5EV7A 1QJX2 3BPZA 1G86A 5JDBA 4P5HA 2XJVA 5EYXA 2EVXA 2TUNA 3DPRC 4Q4Y3 2WNVC 3WDXA 4YZ4A 1HQLA 5C33A 1XNCA 2HKXA 2HJIA 4PIYA 2VU9A 5KHIA 5JI9A 4CDXA 4RQPA 2WS93 2QJVA 1DGRN 4LBMA 4HZFA 5BNPB 2QE3A 5ABJA 3ZXDA 4ASLA 1XRUA 4N43A 1O3SA 2JECA 4YSFA 1CAVB 1HRI1 4Q4X3 5IK7A 1H2MA 4J1WA 3IT8A 4N53C 2D3RA 2BW8A 2ZGOA 2B7YA 3TWIA 4PLMA 4D7YA 3NV3A 1LGCA 3AP6A 1U5ZA 1MS8A 1E57A 1COV1 4JGZC 3VBUB 4EWDA 2X5IA 2DCYA 4AE2A 1AXKA 2F6BA 1Z7S3 3INAA 5GZDA 4NHMA 1NQDA 4FPHA 2R16A 5FCCA 1RHI3 2WA4A 5FQ0B 2EXKA 2YDEA 1QH7A 1KJLA 1VBD3 1S0CA 4P9IA 1NE6A 3ZPYA 1TE1B 4GH4B 3ZYRA 2X29A 1NG0A 2NMOA 5JSRA 2TBVA 3O0XA 3MYXA 2A6ZA 4AI0A 2WNUC 4N7UA 1SLBA 4IEXA 1BVP1 3ZO0B 2RE9A 5K0UA 2WS92 3VZOA 3ZXEA 3FZ3A 4AQ2A 4K1ZA 3ZMNA 4E4SA 1Q3EA 2ARBA 2WWSA 1BXHA 2ZZJA 5IT6A 1YRZA 2ZGMA 3FE5A 3PVOA 4Q4X1 4Y4YA 3B9CA 1QJX3 4IERA 4UXAA 3V0AA 1I5ZA 1BYHA 1AHSA 2PYTA 5FO9B 1OI6A 5JR7B 2ENRA 1GZWB 1OSGA 2RM21 2V5YA 3PMEA 4XDQA 3S7IA 3ZN5A 2JG8A 2P34A 1DDLA 1RVF1 3POYA 4QD2A 2RS32 4YFZA 5CVRA 4KQ7A 3AKQA 3IWZA 1QJU3 1AR83 4ZU5A 1QOSA 3N4MA 3E6CC 5LK5A 4FPFA 4Q0UA 4O9EA 4FTSA 4CDWC 4I0AA 4GXLA 4RA0A 4WM8A 1PM7A 4R9AA 5IUQA 4D3WA 4XFGA 4LO4B 2DCZA 1YFUA 3CLPA 1ENRA 1U5YA 2BNMA 3V0AB 1CPMA 1GYKA 2UWCA 5JPNB 3OBTA 4QM8A 5J3UA 5GZEA 4AEDB 2IXKA 1C28A 5DG1A 4QPGC 1HQNA 2VMIA 4AK3A 2PHLA 3GNEA 2A3XA 3U10A 1H9WA 3B7MA 1F31A 2ZHMA 1VBD2 2CGNA 4E4DX 1QJY1 4G3YC 4ORFA 5JIAA 4FOWA 3ME2A 1ULDA 2AYHA 4XBQA 1N47A 1Z7S2 2Y0IA 2EF6A 4FPGA 5C8WA 4WVZA 2QKDA 4YVSA 5FMOL 1YI9A 2YXSA 2VUAA 5L7OA 1RUF1 4M0HA 1BK1A 5AC91 1W6NB 2OA2A 4OUSA 1H2LA 3KCCA 5JWPA 5D1IA 1UPIA 5BPXA 1IS3A 3RZZA 1FNYA 3VBHA 2PA7A 1X8EA 3HBZA 2JKBA 5JVVA 4IV3C 4B3NA 2A73B 1AR81 1RJ8A 3DF0A 4XMIA 2PHXA 2Z42A 3A0NA 1N3QA 3I7DA 4OULA 3KLSA 1ULFA 1BBT2 2QDNA 1VLNA 2XBO2 2HWD3 3NAPA 1RHI2 4BZ4A 4MV2A 1F8VA 2ZS6B 1NZCA 4WV8A 2RS31 3RSJA 1KFUL 5J96B 3AP9A 1H8TC 3EBRA 4MZUA 1Z0HA 4Q2FA 1LHVA 5HCBA 2ZA9A 4A3XA 4WVMB 5L7OC 2VULA 3ECQA 4W65A 4Q4W1 3MW2A 1FAYA 3NV4A 4XETA 4Q4Y1 1K5MB 1VRH1 2ZX0A 4Q4X2 1QNWA 1AR93 1ZYBA 1UU6A 1AZDA 4QQPA 3UKNA 3QBQA 2DTWA 4WM7C 1MACA 4AEKA 2WZPP 4AVAA 3HQXA 3KSCA 5JOZA 1QF3A 2XB6C 3BU7A 1UIJA 3M2MA 3NV1A 5BUVA 2R062 3O5SA 3B02A 5ABJB 2CY6A 5BNPC 1Z78A 2QFEA 2D3SA 5DDJ3 1AJOA 4IEPA 4N43B 5FBZA 5BYNA 4Q4Y2 1CAVA 4LA2A 5E88A 3M70A 1ZBE3 1VBE3 2R1DA 4WVVA 4IEVA 4R9DA 4P9LA 1WGPA 2R043 3AZZA 2A71A 2WT1A 5JPMB 1J3PA 2PELA 4PCRA 3VBSA 3D5OA 4AVCA 3OYWA 4LBLA 1NXMA 2W52A 1W6PB 4Y20B 3AFKA 1LULA 2H0BA 2RMU3 3U07A 3ZXKA 1WW4A 2D40A 3PVNA 4KBBA 4Q4V2 4BYYA 4L9BA 1Q8VA 4I3GA 4QPGA 4XFFA 4IEOA 2DVBA 2XG3A 2K0GA 1GZ9A 4QU2A 3VBRC 3VN4A 1SBEA 4H3WA 1ZREA 1XNDA 1RUH2 2I07B 4DZGA 1LOEA 1RUE2 4DMIA 2JE9A 1MS4A 1O3RA 4CP2A 3ZFGA 5BXXA 1PO22 4CDWA 4CDUB 1D2SA 3RI9A 1MZEA 3GZUC 1LEMA 4D94A 4LE3A 2OPKA 1ND3C 2VVEA 2QCSB 4IXLA 1NE4A 2HWB1 2OW4A 1YFWA 1MS1A 4G9SB 1TME1 1DIWA 1M06G 3FLPA 1VRH2 2WFPA 5F9TA 1KDMA 1F9KA 2BPA2 5CFCA 3PVBB 5BNNA 4ITCA 4YW5A 4CDQA 4EN9B 4D69A 1YNAA 1O5LA 4CDUA 4WBBA 3RI8A 2VNRA 4FPOB 1HV1A 1VAMA 2FZ1A 1FOD1 4LULA 1AL22 1NLSA 4Z82A 4XQWA 4JGZA 3S6PA 1KD7A 1KS5A 3JBG1 1MEC3 1VAVA 4WM8B 1XYPA 3TNPB 2RM22 3MIBA 1H8TA 2WZR3 1OA3A 4LBQA 5J36A 3MFCA 1YXWA 2A3YA 3CJIC 1PGW1 3THTA 3ZN4A 3E97A 1BQPA 2FHRA 2PAEA 3E5QA 1DQ6A 2BFUL 2HWE2 4GULA 3WLUA 2BNOA 1FOD2 4Y1YA 1UW8A 1XYOA 5H9RA 2E63A 1C8M1 1W6MA 4DXZA 2A7AA 1NXD1 5TSWA 5FOBB 4YG0A 3JU9A 4JDMA 2ZTNA 1CAWA 3QH7A 3AKPA 2A6YA 3FLTA 4HKLA 4H55A 1XE7A 5JMCA 4MXWA 3VDDB 2RS13 2D6KA 4RHV3 4FOQA 2D98A 1VBC1 1O4ZA 1QJU1 4PLOA 4DFSA 3ILNA 3GBGA 5K7PA 1DZQA 5GLWA 2WJSA 4KGGA 3W59A 4YZ5A 2QQPA 5D8AC 2WFF3 2FMYA 2SBAA 4L11A 4U36A 5CFDC 1VBB1 1JW6A 1TQ5A 3CF6E 3H1WA 4LEJA 2VGDA 1QJX1 1ZX5A 2ZGKA 3WG1A 4COZA 2D6LX 4O9GA 1V9U2 2NLRA 2HWB2 3H7YA 4XOGA 3GALA 1S2BA 2DURA 3TN92 3MF9A 3EO6A 4Q0QA 3I4IA 5LRRA 3WDWA 5ACA1 4M3CE 4Z1VA 4ZXKA 3ASIA 1MR5A 3D8CA 4WZFA 1Q8OA 4E27A 2NMNA 2IXIA 4BMEA 1EV11 3URFA 2DFCA 4PIXA 1ZZ7A 4XJ9A 3KGLA 1VALA 5DUVA 4NOTA 3UKTA 1RUNA 5GKAC 1UKGA 1KJRA 1VB2A 1NCQC 1AUYA 4HL0A 4CTEA 2JX9A 4HFSA 3JUUA 1L3JA 1QY4A 5JOWA 1IHMA 2GAUA 3Q9OA 1EAH3 3EXUA 5C4WC 4X8NA 3WXPA 1PO11 1OA2A 3ACLA 5ABJC 2A75A 2V09A 4XTMA 1W0PA 5AVPA 5JZGA 3JBG2 4M3CB 1GNZA 2H6BA 3BCWA 4JGYC 1WMDA 4B4QA 1MQTC 3POSA 3IKWA 3S0MA 3TB0A 2R49A 2WS91 3AYCA 1R083 4OI1A 3SH4A 1RUI3 4FCAA 1RB8G 1S0GA 4YVWC 2HWE1 3P3PA 1S0BA 1YJKA 1QKQA 3VBUC 3APBA 3WY6A 2AR6A 2ZKNA 5I8SA 4JVAA 5J48A 1POV3 2EIGA 2BNNA 2VW0A 2CL2A 1OLQA 2Z69A 4H14A 3WDTA 1G8WA 2H6CA 2QDRA 2Q4SA 1IS5A 1WD3A 2P37A 2IFWA 4XJZA 2LM3A 4BE3A 4IL7A 4LA3A 4PBPA 4COUA 1GQGA 2JG9C 2VXRA 4AGVA 3IN9A 1H1AA 3ZFFB 1XE8A 2UY9A 3E6BA 1HRV2 1O4YA 4L99A 1KXGA 1VAKA 4FPYA 1A78A 4N43C 2G4IA 3AP4A 5KHKA 5AFEA 1DGLA 2VG9A 4CDXC 1CX4A 3V65A 3VZKA 3VBSC 2D6PA 3TOJA 1SCRA 4YW4A 1PIV2 1O91A 2XKPA 1X82A 2N7GA 3VZNA 2WNVA 3P3NA 3QACA 3WINE 1X50A 4Q26A 1ZBA1 3QH6A 4META 4R4ZA 4B4PA 1MS9A 4NPRA 2WNEA 2AREA 1GQHA 4MLOA 4IEZA 1OOPA 3MIDA 3H0OA 1QQP1 1V70A 5CU1A 1OFSA 3T1LA 2R30A 1N1YA 1CJDA 5L36A 4YGEA 4LUKA 2BBVA 2R061 4FPKA 1D2QA 3LGRA 1RC6A 3NSTA 2XJUA 4AEMA 4GWNA 2X8KA 3RMYA 2EALA 2Y0OA 3VKMA 4EN7B 3CNAA 1BEV3 4P9YA 4PF5A 5KC5A 5H9QA 3B5LB 1FMD2 1QJU2 1X7NA 3AK0A 4YG6A 2RS51 1RL3A 1V00A 1NA1A 2DWRA 3R4DB 3VLBB 3I2DA 2RS33 1DQ0A 1WLWA 4E9KA 4FTBA 4M0NA 2PHWA 4V1PA 5C8CA 1DGWA 3RMXA 2DCJA 3KMHA 4OLLA 3WQ0A 4DPNA 2XJPA 2D6MA 3H3UA 3FFQA 4Y1ZA 3GBFA 2Q1ZB 1AL21 4CEYA 3FC0A 5JSOA 1AX2A 1RJ7A 3CJXA 2ERFA 2CWSA 2WT0A 3GF6A 1D0HA 4YRDA 2GH2A 1AXYA 2C9AA 4P9JA 3ZN6A 2ZMKA 1RUG1 3CL1A 3H1YA 3KT4A 4OHZA 2GC3A 1Q8PA 2R0FA 4M00A 1C8NA 1IGOA 4I02A 3ZSMA 2GNDA 1GV9A 1DHKB 5A33A 1BMV2 1R1ZA 2BEOA 3AYDA 3ZSLA 3BOWA 1V6IA 5T5OA 3ENRA 2HWC1 1AXZA 1CAWB 4MX3A 4FOVA 3AMHA 3DKWA 1GNHA 4PLNA 1QXRA 3JD72 1S0DA 2E9QA 4FP3A 1U0AA 5FDBA 3PJYA 4AW7A 1LESA 2UYAA 1G9BA 2PHUA 4AFAA 1QOOA 3AJZA 3ZN6B 2DTYA 1FX5A 4EN8B 1PZ7A 5E89A 1AYN3 1LHWA 3VBUA 3H1MA 4GQ7A 2X5IC 1X36A 3M3QA 3VBFB 5A33B 1DQ1A 1RUC1 4NO4A 4TYSA 4E2GA 2GZWA 3FJSA 3HN1A 1U5XA 4K1YA 1KRIA 2ZPXA 2IC1A 3GZTB 4RS5A 4IV1B 2UWAA 1RUH1 1R091 2ZGLA 4KWJA 4YM2A 3VL8A 1YWKA 3WG4A 1JTZX 1LJ7A 2RR12 2NYYA 4RGAA 5JOYA 1C8M2 3SHRA 3I54A 1KFXL 4INDA 4ISQA 2DV9A 1UF2C 1H30A 4K40A 3ZXFA 4AFMA 1LHNA 3AYEA 2JXAA 1JN2P 3GHNA 1YCIA 1J1LA 2ZAHA 4W6WA 2YUEA 3WW2A 2NM1A 4COWA 1YIFA 4RGGA 2CV6A 5FTTC 4FAGA 2BVVA 4LO7A 1SBDA 3BTAA 3PVEA 4I30A 2A3WA 3WHUA 1HXS1 3LWCA 3NVCA 1ASJ1 1PZ9A 4GMP0 1CAUA 1JUIA 3OBRA 4K20A 3I59A 2XPJA 5CFCC 1SFNA 1RMU3 4CP0A 1PVC3 2DCKA 4W6XA 2HWB3 3ZFFA 5HBAA 4ISRA 2ZX1A 3G7DA 1QXJA 4GMP1 1H8VA 3OD4A 2R072 1DYPA 2HEYF 5L19A 2FZ2A 1FT9A 1LGNA 3G6JB 3SMHA 3JD71 4QQ2A 3USUA 4QGNA 4XHXA 2ZMLA 4GB31 4LHLA 4XHBA 1ND2B 3QOPA 4Y22A 1PZ8A 1FATA 2RS12 5JI7A 1WBFA 4XQDA 4N53A 3RRDA 3WQ7A 1CJPA 2GNMA 3WDUA 4YW1A 1EPZA 1D4M3 3N7JA 5H9PA 2YC0A 1YO8A 3H3ZA 3SCFA 3VHPA 1ZRRA 4H7MA 4XIOA 4KG8A 3CJIA 2VW2A 4ATFA 5GJ6A 4PBOA 1QWRA 3JZVA 3WUCA 3ZIXA 1RITA 3S7EA 5EYYA 1KS4A 2R041 4YW2A 2JG8B 1N3OA 3JB8A 1LOAA 3N35A 3S30A 3ELNA 5BNNB 5LK7B 1WMEA 2YZ4A 5EZWA 4C1WA 4OHYA 4UBHA 2O8QA 3MF6A 1A8DA 2PFWA 2WZR2 2XLAA 3KM5A 4I01A 3AZYA 1QMJA 4XILA 3AJYA 2JDZA 1VBA3 1AL23 4OUMA 1V9U1 3L9JT 4B29A 2MHFA 1PVC1 3M7AA 1SLAA 5T54A 3TN91 3WG2A 4QT6A 4IQPA 5BY5A 1HRI2 4H7LA 1AYM1 1J1TA 1AR91 2LUWA 1FPN1 1V6KA 2XHKA 3VBOA 3VHOA 2WC2A 5B2GB 4Z92B 4HPKB 1LHOA 4AI3A 4C0HA 4LLOA 4RL7A 1ZBA2 1COV2 1YJLA 2OUJA 3B01A 4Z07A 4BWOA 4DRVA 1VP6A 4L2NA 1OQDA 5DZGA 3UKVA 1SMVA 2JG9B 2Q5TA 1DQ5A 4QM9A 5BNNC 2ZHKA 1LGBA 2OZJA 2BUKA 1HIXA 2HEVF 1AR72 3FUQA 2RJLA 5DUXA 5BNQA 2WT2A 3OY8A 1KQRA 5AVAA 2ET7A 2IXLA 3AX4A 5GLVA 1ZA4A 3U11A 3VZLA 2HYKA 3PNAA 4YFWA 3OGJA 4KNCA 2D44A 2ZGPA 1LRHA 1LB2A 4XE9A 5CADA 1FMD1 4RFT0 5JCTA 1GICA 3N7MA 3OF1A 1H4GA 1XNBA 4XW3A 4GH4A 3LSEA 2XLFA 3M3EA 3BOPA 1J58A 2JG8C 2C0ZA 1TNRA 2ZKLA 4XQ4A 2E53A 1SLLA 1WCDJ 2E7QA 2E7TA 5LRSA 1UKRA 4HANA 5FLHA 2O8OA 3SCGA 3TBDA 2JJ6A 1ZZ9A 1C3HA 2IXCA 4U2AA 5CFDA 1S55A 3LA2A 5K8SA 1AR61 1AYM3 1RUG2 4FO9A 1RMU2 4N7IA 4XF0A 5KWRA 4KWLA 4CEWB 1XU2A 2D6OX 3WOGA 3IDEA 2O0OA 1CN1A 3ZFEC 4ZU4A 2E7AA 1RUJ1 3C3VA 2VY0A 5EFUA 3O0WA 5DXDA 1Y9QA 1J59A 3KS7A 1R092 1ND2C 4B7KA 3ES4A 2WIIB 4FPLA 3ZXGA 1Q5OA 3V64A 3SNMA 5C9AA 2XVKA 2BWCA 1ZZ6A 1RUD2 1YYNA 4XYXA 1PO12 2WKKA 3VL9A 3MW4A 4AQSA 1FV2A 5GLZA 2VPVA 3OYWB 1W6PA 4Y20A 4G4FA 2UY8A 5SV5A 4TSVA 4MXVA 1RUF2 4SLIA 5I8TA 2VQAA 1CESA 1MVEA 5FRAA 4AHWA 4JGYA 4MUVA 3ST7A 4C90A 1GBGA 1NY72 4FXGB 2LALA 1EAH1 4QPGB 2Z5WA 5J7MA 4R52A 3RYRA