1CD3G

Procapsid of bacteriophage phix174
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SCAFFOLDING PROTEIN GPD)
publication title The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.
pubmed doi rcsb
molecule tags Virus
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cd3G00
2RR13 3CJIA 1AR73 1NY72 5ACA2 5JZGC 1MQTC 1HRI2 1AR62 1K5MB 1RUH1 4RS5B 5CFCB 1ND3B 1VBC3 1VRH3 4GMP0 3IDEA 3ZFGB 5C8CC 1W39A 1EAH2 4JGYC 4Q4W2 1RB8G 4CEYC 3VBHC 4CDXB 1MEC3 4RHV3 5A32B 1QJX1 2RM21 3VBSA 5L7OC 4WM7C 1VBE1 5CFDA 2WS92 1RMU2 3ZFEB 1BEV2 4RR3A 1PIV2 1EV12 4N53B 1RUI1 1TMF1 1RUD2 3DPRC 1RUE2 1AUYA 1NA1A 4QPIB 5C9AC 4CEWB 5BNNA 1RVF2 4EJRA 1FMD3 2XBO3 4YVSA 2RS33 4FTEA 2R041 1ASJ2 5ACA3 1CD3G 2HWB1 4WM8C 1HRI3 3CJIB 4IV3A 1HRV2 2HWD3 2X5IA 1AYN2 4IV1A 5AC91 1VBA1 3VBOC 1FOD1 1VB2A 2ZAHA 4CDQC 1RUC1 4Z92B 1PO21 1B35C 2IZWA 4Q4W3 2FZ2A 5ABJC 4Q4V2 1ZBE3 1F8VA 1VAKA 3ZFFA 2ZTNA 4GMP1 5C4WA 1NCQA 4RFT0 3JB8A 4YVWA 2WS93 1ND3C 1RMU3 1QQP1 5DDJ1 3ZXAC 5CFDB 1BEV3 1POV3 4GB32 2PLV1 3ZFGC 2BFUS 3J8F2 1PIV3 1R1A3 1EV13 1TMF2 2RS12 1ND2A 4RR3B 4GH4A 1RUE3 4QPGC 1MEC2 1NA1B 4RHV2 1RVF3 1COV3 1FPN1 3TN91 1R081 2R073 5BNNB 5FMOL 3ZFEC 1QJY1 1V9U1 1CJDA 2R042 1DDLA 2HWB2 4YVSB 1PGW1 1RUH3 4Q4Y1 1HRV3 1VBA2 4QPIC 5K0UA 4AEDA 2WLPA 2BBVA 2WZR2 2X5IB 4Y5Z0 1VBD1 4IV1B 1HXS2 3VBRA 1BBT1 5D8AA 2WWSA 3NAPB 1AR91 1Z7S1 5BNPA 1RHI2 2RM23 2BUKA 1A6CA 2RMU1 1D4M1 1H8TB 1VBE3 1RUG1 3VBFB 3VDDA 4RQPB 5C4WB 4LLFA 2R061 2HWD2 4GB33 3JB4C 1OOPC 4CDWC 3J8F3 4PDWC 1AL21 1RUI3 1TMF3 2RS13 1QJU1 5FOJB 1ND2B 1R091 4GH4B 1ZBE2 1FPN2 1R082 2R043 5JZGA 1MQTA 5BNOC 3HAGA 2HWB3 4Q4Y2 3JBG1 1VBA3 1R1A2 1AR82 2WZR3 4JGZC 1VBB1 1ZBA1 4Q4X1 4AEDB 5C8CA 2RS51 5K0UB 1HXS3 4CDUA 4JGYA 4CEYA 3VBHA 5BNNC 2MEV1 3VBRB 1COV2 1AL0G 5D8AB 4WM7A 2R072 1RHI3 3LOBA 4GMP3 2RMU2 1PGL1 5BNPB 1RUG2 4N43C 2R062 1RUH2 1GFF2 1IHMA 5DDJ3 1X36A 1NCRC 1VBC1 1VRH1 1RUJ1 3NAPC 3DPRA 5C9AA 2GH8A 1PO11 2HWE1 1POV0 3JD71 2HWC1 1H8TC 2WFF1 1FPN3 1QJX2 2RM22 3TN93 3VBFC 1R083 4RQPC 2QQPA 1K5MC 3S6PA 1VBE2 4RS5C 5CFCC 4WM8A 3VBSB 5JZGB 2HWF1 4Q4Y3 1AYM1 3VBOA 3FBMA 4CDQA 1AR83 1ZBA2 1RUI2 4Q4X2 1B35A 4CDXC 2MEV2 1FMD1 5ABJA 1AR93 4CDUB 4CEYB 3VBHB 1PGL2 1NY71 5ACA1 2RMU3 1HX6A 1ND3A 4WM7B 1RUG3 1AR61 2ZZQA 5FMOS 2R063 4N53C 3VBUA 1RUJ2 5AC92 1FOD2 4IV3B 1AL23 4CEWC 1RUC2 1C8M1 1PO22 1PO12 2HWE2 4QPGA 1EAH1 3JD72 3DPRB 2HWC2 5C9AB 4BCUA 2BPA2 1QJX3 1BMV1 3CJIC 3ZFFB 1QQP2 2HWF2 5DDJ2 1AYM2 1NCQB 1PIV1 4YVWB 4NWVA 2PLV2 4QPIA 5A33A 3JBG3 1EV11 2XPJA 1RUD1 1RUE1 1ZBA3 3VBOB 4Q4X3 2FZ1A 4CDQB 2DF7A 1RVF1 5J98B 1PVC1 1B35B 2MEV3 1X33A 2VQ0A 4FTBA 4SBVA 3TN92 5ABJB 3VBSC 1ASJ1 1QJY2 1V9U2 5CFDC 1HRV1 1TME1 1PGW2 1AYN1 1RUF1 1OOPA 4RR3C 4CDWA 1M06G 1RUJ3 4PDWA 5AC93 1FOD3 1C8M2 3VBUB 1VBD2 1RUC3 1PO23 1NA1C 4CDUC 1PO13 2HWE3 1BBT2 3JD73 4Q4V1 1AR92 2HWC3 4QPGB 1Z7S2 2TBVA 2WFF3 1HQNA 4YVSC 1BMV2 5L7OA 2RR11 1AR71 5J96B 5BNOA 1D4M2 2GSYA 1NG0A 4GB31 4IV3C 1E57A 1QQP3 2HWF3 2X5IC 1AYM3 3J8F1 2PLV3 4IV1C 3VDDB 2RS11 4JGZA 5A33B 1AL22 1QJU2 1MEC1 1PVC2 1R092 1SMVA 1WCDJ 4RHV1 3ZFFC 5C4WC 1QJY3 1V9U3 1NCQC 5LK7B 4N43A 1C8NA 4YVWC 1AR63 1TME2 1RUF2 1MQTB 1NCRA 3JBG2 2WZR1 3NAPA 1VBB2 1ND2C 1HXS1 1OOPB 4GH4C 1C8M3 4CDWB 1VBD3 2RS52 4PDWB 1EAH3 5GKAC 1BBT3 1H8TA 5C8CB 1NOVA 2XBO1 1RHI1 2RS31 3VBFA 1Z7S3 4JGYB 4RQPA 2RR12 1AR72 1K5MA 4RS5A 5CFCA 2BFUL 1D4M3 1F2NA 5L7OB 1HRI1 2HWD1 5BNOB 2Y26A 3VBUC 3ZFGA 1VBC2 4AEDC 5K0UC 1VRH2 1RUD3 4CDXA 5A32A 1QJU3 4JGZB 3VBRC 4Q4W1 5D8AC 1OHFA 1ZBE1 1PVC3 1R093 5BNPC 2WFF2 3ZFEA 1ASJ3 3M8LA 2WS91 1RMU1 3VDDC 1BEV1 1POV1 1VB4A 1TME3 1AYN3 4N53A 1RUF3 4N43B 4WM8B 1R1A1 1AR81 4CEWA 1NCRB 1VBB3 4NWWA 4Y4YA 2RS53 1OPOA 1QJZA 1FMD2 4Q4V3 4FSJA 1COV1 4FTSA 2XBO2 2RS32 2R071
chains in the Genus database with same CATH superfamily
2VQTA 2YBPA 5ACA2 1MQTC 5FZ8A 2IXIA 1W2OA 3M7AA 2QQKA 1HRI2 1FI2A 3BTAA 3EO6A 4KWLA 3P1IA 4S2HA 4Z82A 3T0AA 3WDVA 1PMIA 3OF1A 4QM9A 1BK1A 4QU1A 1ND3B 4TTGA 4URAA 2LALA 4GMP0 3RYRA 5JLVA 2W1SA 4D8MA 4MLOA 5LBFA 3ACHA 2ZGNA 2GNBA 3ZXFA 3IWZA 1EAH2 1GZWB 5A7WB 4L8QA 1MEC3 4RHV3 4NVPA 4E9KA 1XNAA 3NV2A 4Y1VA 4YFZA 1Y43B 3SCGA 2E53A 1KQRA 4LOSA 4MOAA 2VCBA 4YM3A 4H2AA 4JDMA 4WM7C 1ENXA 3B93A 2JE8A 1ENSA 4P9JA 1FT9A 1W9TA 5KWRA 1G9AA 4BHPA 2FBEA 1YI7A 4JDNA 5GALA 3OG2A 3I8TA 4PI2A 3IKWA 1O7FA 4RR3A 1X8EA 1UPSA 1GR3A 2B8MA 3K4DA 2BTVC 1F4HA 3N35A 4J25A 4YSFA 4QX0A 5I0RA 1RUE2 3HIFA 2XR4A 4LKFA 2P34A 4QPIB 5FK8A 4BWOA 4BLJA 3I2FA 4LEJA 2KR2A 4B4RA 1UYZA 3O14A 2YC4A 3KT1A 2EALA 2W52A 4EJRA 5BNNA 1JU3A 5A3LA 4PBPA 3HNMA 3N36A 2JDNA 2YHJA 4YVSA 3WG2A 1UU6A 3Q8EA 4FTEA 1SG3A 1IOAA 3DXTA 1LEDA 1AXKA 3ILFA 4PJYA 5FMCA 1QMJA 4XJZA 4YM1A 3FMGA 1ZRCA 4AQ2A 4WM8C 4IV3A 4QU2A 2D98A 4UW4A 1PZ9A 2VQUA 4FOWA 1Q3EA 4XABA 5A1FA 1JYNA 3VD9A 2FQPA 4FPJA 1HQLA 5LA9A 4Q8LA 4Y1ZA 1VBA1 3I2GA 1FOD1 1VB2A 3D82A 2ZAHA 3KQRA 1GUIA 1X50A 3JCIA 2H0BA 4UF0B 4IQPA 2ZACA 4EV0A 1RUC1 4Z92B 4DQAA 2VZSA 1B35C 1AJKA 5FO7B 2X29A 3ZDVA 4KNCA 4KU8A 4MO3M 3IAQA 4Q4W3 1H2NA 1XBFA 1ZBE3 1UU4A 1GLHA 2DYCA 2MHFA 1OLMA 3GBWA 3QACA 4CSWA 4CUBA 2D5FA 3I3MA 3W5MA 1UOBA 4R8HA 4DRRA 3PVBB 4KG0A 3U1XA 2A71A 1I6XA 2AGSA 3JB8A 2I2SA 4RFT0 3WQ0A 3ZSJA 5KBFA 5DMYA 5DDJ1 1W2NA 3OB8A 1BEV3 1POV3 4MUVA 2UWAA 4GB32 3WP3A 4OQ8A 1FX5A 2PXJA 4N90A 3GALA 4Y33A 5FV3A 1R1A3 1CPMA 4MH0E 2RS12 4IEOA 1AX0A 1FNZA 1K3IA 1ULPA 3O1VA 4X6RB 5A6YA 4QPGC 4R4ZA 4IXLA 1CGPA 3J26N 4XFGA 1W6QA 1RVF3 5CVRA 4D69A 1O59A 1OA4A 1PK6B 2IXCA 3CZUA 2R073 1XYOA 1UY2A 1QWRA 5IUQA 3HNYM 1CJDA 4XQWA 1XNDA 5KHJA 4XBQA 2QQIA 3HQUA 1PGW1 1DGWX 2PYTA 3H42B 3WF2A 4AL9A 3BN6A 3TOJA 1HRV3 4P9LA 1UO9A 2DCZA 2W5FA 2O0OA 3DKQA 3AZZA 1VBA2 2XG3A 4OLLA 5K0UA 2WLPA 3FWEA 4JHZA 2X5IB 1OF4A 4I3PA 4QAWA 2R1DA 5T5LA 3U4SA 2VR4A 2V72A 3NNGA 4UW5A 4K1YA 1H9PA 4FPLA 3VZMA 4UW3A 2WO3A 1Y7BA 2N7GA 3O12A 2G1MA 3D0JA 1Z7S1 5BNPA 1NYWA 1DGLA 3Q8AA 1FXZA 2QZ2A 4KWUA 1UPIA 5KHHA 4XF3A 1OC1A 4AF9A 5KC6A 5FZ3A 4LHSA 3LIGA 1QHDA 1VBE3 1WW7A 4LLOA 3IB3A 5LW9A 4DZGA 1CZVA 1YJLA 4LLFA 2R061 2GAUA 3A4UA 4DUXA 2EAKA 3K4AA 2E31A 3LEGA 4GWMA 3ILNA 4YW4A 1S2BA 4C1XA 5LZ6A 1GV9A 3PNAA 4V2VA 3KM5A 1UN1A 4Q0PA 4C8DA 2D7FA 4LO6B 4AEJA 4AVTA 1GOGA 4ZKTB 2YMZA 4LBQD 5FR3A 4YW2A 4D3WA 1ACCA 1W90A 4HG6B 3H3UA 4DXTA 5F7UA 4GH4B 5JOYA 2WAAA 1O8PA 2CWSA 3ELNA 4ET7A 1ULEA 2OS2A 3F95A 4ZXEA 2O1QA 2ILMA 2OPKA 4Y22A 1CONA 2R043 4P9IA 1YFUA 4BIFA 1URXA 5JZGA 3M3CA 2FDGA 2B45X 4XE9A 3C7FA 3VGIA 3DUIA 1GQGA 4LPLA 5D2AA 3ST7A 3BTXA 3MW3A 2WZEA 3PUHA 5ISLA 1UCXA 2ZX2A 3M3OA 4BOWA 5IVCA 3BIEA 1IS4A 2PHRA 1AR82 2WZR3 1EUUA 1VBB1 2YU2A 1LOFA 5FPAA 2UYBA 3SH4A 3AMMA 2VZUA 2F17A 3ZXEA 1VMFA 1HXS3 2OZJA 4NPRA 5FYZA 3MIEA 1PZ7A 2AH2A 2HH9A 5EJ3A 3VBHA 4AQ6A 2YZ4A 2NYYA 3VBRB 4GWJA 4KG8A 3WP4A 3ZSKA 2GC3A 4ASLA 4CU8A 1DFQA 3AVSA 2WABA 2X8KA 2HBTA 2LS6A 4HKLA 2NMNA 4KL1A 1DIWA 4XEZA 4DRVA 5FY1A 5LA0A 1W9SA 4N43C 3IZOA 4LHKA 4A6OA 2R062 5FJHA 1JZ4A 2UWCA 4AYUA 2VUJA 4RL7A 1QNYA 4XILA 5F3GA 1HQWA 5K9YA 3CMGA 2Y0OA 4BLIA 3AB0A 1IS3A 2Y6HA 2CDPA 3DPRA 3GJAA 4FI9A 5EXOA 4IEYA 4M3CA 4BXSV 5C9AA 4Y20B 1WMXA 1EPZA 1HKDA 2QZ3A 3PU3A 3ENRA 3SMHA 4BU2A 3RZHA 1GU3A 3BB6A 4ASKA 3WD5A 5IVYA 3VBFC 5JMCA 4RQPC 5IWFA 1Q8QA 5FBZA 2WSVA 1K5MC 5FZCA 1HN0A 1Q8SA 1PX3A 1Y9QA 4RS5C 2VVDA 2IXLA 1S55A 5F5AA 4XAAA 4ISRA 4XQ4A 4Y3OA 5D1IA 4A3ZA 3AX4A 4FP2A 1QEXA 1OPMA 3CDZB 4HBNA 3APBA 2JG8A 2B39A 4K8RB 3ZN6B 4H3WA 3NKTA 4Q5OA 4R9CA 5A3NA 5K7PA 5KXEA 4CDXC 3NV3A 3V0AA 4IEXA 3S7EA 3SCHA 3W20A 2D5HA 4LHNA 1R1ZA 2GNMA 2VD7A 4AHYA 1H30A 2IXKA 4M01A 4CDUB 1W3XA 2EXKA 1N1YA 1PMHX 1XJAA 1NY71 2E63A 3DECA 5AVPA 2A3XA 1V6LA 2BQPA 2RMU3 1ND3A 2ZHLA 1RUG3 3WDUA 2P6HA 1N1SA 3PIGA 1SLTA 2XVKA 2ZGSA 5FMOS 2VZ1A 1QOOA 3MBWA 2FCTA 1U5XA 3FJSA 4XF1A 1XU1A 1V70A 3JXSA 5AC92 1W6MA 1ULGA 1C5IA 2WO1A 4CEWC 1W2UA 4YFWA 4CCOA 5DAQA 5A1AA 1GMMA 2BYVE 3A0KA 4FPYA 3RI9A 3E6BA 1FAYA 4EN9B 2A3WA 1QJFA 4UBGA 4BCUA 1O4ZA 5CAZA 2YPJA 1US3A 4Y5SA 3MZHA 1BMV1 2A75A 5I8TA 5FLHA 1C4RA 1GSLA 5F3EA 4MGSA 2WQ8A 4O65A 1T2XA 2XVGA 2I74A 4CYDA 5CKQA 1WLWA 1YQ8A 4QB1A 4YNIA 1PNGA 4QD2A 4BE3A 3VKNA 1SLIA 1NCQB 4HVOA 2A70A 2PLV2 4QPIA 3JBG3 4OQ9A 1LCLA 1NAEA 2GNTA 4NHYA 2R49A 4OZOA 1IPKA 4YM2A 1ZBA3 3VBOB 3PUAA 2G9GA 4CDQB 5T5JA 5JMOA 1RVF1 4QQOA 2W68A 4QX7A 5J98B 1O3SA 2MEV3 2IUWA 3MIBA 2JE7A 3GNEA 2KXLA 3T3YA 3TN92 4COZA 5ABJB 4QX5A 1GNZA 1JS9A 1QJY2 2VZVA 3WQBA 1RL3A 1RJ8A 1H9WA 1NZCA 1W8HA 4BJ0A 4H7MA 4JC1A 3IMNA 1HRV1 2CU5A 4PF5A 1OKQA 2UY9A 3NJVA 4MVTA 2ADEA 3MIFA 4K8FA 4XF0A 4Z8BA 1RJ7A 1SLLA 1DQ5A 1OOPA 4RR3C 3SKVA 2ID4A 1W8WA 3BOPA 1YFWA 5F6KA 1OT5A 1VBD2 5C3OA 2C9AA 4BK4A 2GMPA 2HWE3 1CR7A 3JD73 1TE1B 4NRPA 1NUKA 4Q4V1 1L7QA 1AR92 4GD4A 3OD4A 4HPKA 1ZZ8A 1WD3A 4UFIA 2ZGOA 2EICA 1TZOA 3DXUA 5H9SA 1W0OA 2WFF3 1DQ2A 4YVSC 1XU2A 1BMV2 4UBHA 2WNEA 3CJXA 1AR71 4DXZA 5J96B 4LHLA 1OD5A 3E6DA 1LU1A 3BKZA 5APAA 4XXAA 1IQAA 3CNAA 5GJ6A 1NLRA 3X29B 1UOJA 2EA7A 2XB6C 5FJKA 4IV3C 4CXYA 1QQP3 2DV9A 2BERA 4LITA 3N9MA 3VZLA 2JIGA 2VNRA 3VDDB 2Q8EA 2XJSA 3AYDA 4PIZA 4FPEA 2YC2A 3MHZA 3J7MA 2RG4A 1AL22 1F35A 4IUGA 4MGTA 1QJU2 3DKWA 4FFHA 2LUWA 4Y1YA 5FZAA 2FMYA 4JTNA 4LE4A 1I5PA 4G9SB 1IG0A 1R092 1WCDJ 2WT2A 3C7EA 4LOTA 3MIDA 2AEYA 1DHKB 4GQ7A 1I5ZA 3SITA 4OHYA 2W1WA 4YM0A 2FD8A 4ORFA 4G3YC 1R64A 1KS4A 1DYPA 1N3PA 2WR9A 5LATA 5FZ0A 1C8NA 3LFMA 3ZMNA 2ZCWA 2BGPA 5CA6A 5DN2A 1IKQA 4CUAA 4FPOB 5C7GA 3GCWA 3PU8A 4W65A 3LB9A 2HEWF 2QQOA 2WA4A 1XNKA 2WZR1 3ILRA 5FLJA 4MHUA 2VBDA 4L11A 2DBNA 1HXS1 3OY8A 2GMEA 4CDWB 1C8M3 3BODA 1D2SA 3O1OA 4PDWB 2JDKA 4JKLA 5FYSA 1EAH3 2VGDA 5CIRA 2Y33A 5C8CB 2ZX0A 4IEVA 2XBO1 1I3HA 1S0EA 3H1MA 3BGAA 4MGZE 1GANA 2VOWA 4JGYB 1AR72 2GN7A 4LMFA 5CFCA 3E5QA 4N7IA 1F31A 5F9TA 2QJVA 1D4M3 1MZ6A 3NV1A 4M0HA 5L7OB 5DG2A 5HCBA 2K2SA 1V0AA 1N1VA 4HXCA 3IMMA 1US2A 2YB7A 4OHXA 4LBKA 5FXVA 4EN6B 5K0UC 4JQRA 1YIFA 3VHPA 3TNQA 4KQ7A 1LEMA 3WHUA 2Q8CA 5A32A 2J1UA 4JGZB 3OGSA 4OFGA 3RJ2X 5FQ0B 5FK7A 3N7MA 3TEXA 5KHGA 1SLAA 5FFOC 1OHFA 2WYSA 3HQRA 2RHPA 3ON7A 2JECA 4HFSA 4YRDA 1G8WA 1K12A 4N9IA 4V1PA 1RUOA 5DUUA 5BNPC 4B29A 2GC1A 4NRMA 3SCFA 3DN7A 4CP2A 4P9WA 4OMDA 4CCLA 2BNOA 4E4ZA 4B8EA 4KGGA 4AHWA 1RMU1 5HCHA 1W9YA 4YW7A 1S0CA 3RMYA 1B09A 1VB4A 1TME3 2WUHA 3NL1A 3UJQA 2D93A 2PHXA 4D6SA 4XYXA 1C5HA 2XGXA 3K3OA 3RI8A 3ZLIA 1YLLA 3OSDA 2GZWA 4NWWA 4Y4YA 2FDIA 3H7JA 1TNFA 3DCQA 4LBOA 2VNVA 4XETA 2E7TA 3N7KA 4WVWA 4YZ3A 5C8WA 3ZYGA 2WN3A 1FMD2 5EYXA 2P17A 3NV4A 3N4MA 4FTSA 2XBO2 2VNGA 3POBA 3POWA 3SEPA 2R32A 4HL0A 1JBCA 3IIAA 5A3OA 2JB8A 2BVBA 2J22A 3KCYA 5CU1A 3ZSLA 4LIVA 1STMA 5JZGC 3H9AA 5IK5A 1CX4A 1KD7A 3U37A 4ATFA 1RUH1 3S7IA 3VN4A 4CCNA 4XFHA 1NLQA 3NO8A 4CA9A 4JHTA 4S2GA 3WUDA 1VRH3 4YW3A 4BISA 3ZFGB 1LOFC 3MGUA 1AJOA 2XXZA 1FV2A 2ERFA 3LFIA 3LZZA 1RB8G 3VBHC 1PM7A 2W92A 2VMCA 3LD8A 4O7XA 3ZVXA 5KXBA 3LPFA 1RYYA 1U5IA 4Q1RA 5HXVA 4E8CA 2RM21 4OI2A 2VMDA 4NMIA 3N9NA 1LODA 3QH7A 2XLAA 1PGSA 3CIHA 4XCAA 3HOBA 4W6YA 1RXGA 1RMU2 2BBAA 1Q43A 4C0BA 3AFKA 3PUQA 4JKKA 3VDBA 1HJGA 1TG7A 3DYMA 2X09A 3MLJA 2ZA9A 2GNDA 1EV12 1Q8OA 1BQPA 4N53B 1RUI1 3HBKA 3PMSA 1YC61 1RUD2 3DPRC 4FAGA 3RZLA 2ZKLA 1UWWA 1NA1A 5C9AC 4AG4A 4K40A 4YPJA 2OKXA 1WBFA 5EQUA 2ZGKA 1S1AA 4QX2A 3ZPOA 5H9RA 2XWBB 3PMEA 4CPBD 3T0DA 5HV4A 2C4XA 5F2WA 3WF3A 5JR2A 1ALYA 2OUHA 2WNVB 1W6OA 3AK0A 5DUVA 3VB9A 5LEKA 4MGQA 2VUCA 2I45A 5FUPA 1WA4A 3CJIB 3ZO0B 4YGDA 2ZBJA 4W4ZA 4YLZA 5A70A 1E5RA 2GN3A 2TEPA 1AYN2 4IE4A 4M4RA 3QH6A 1HB3A 1S0FA 3LAGA 4QKNA 2JG8C 3IPVB 2XJRA 4QXCA 4XOGA 4LO5B 1LOCA 4YW6A 5G04L 1G86A 5FZ7A 1YHFA 1SCRA 2WA3A 4QPWA 4BH9A 2D3PA 2R0FA 4QHOA 5GLVA 4IGOA 1KDKA 2L9LA 3MYXA 3O0WA 4QKFA 5F5CA 4RN5A 1SPPB 3AMPA 2JD9A 4YG0A 3T2QA 3WW3A 1VAKA 4MYEA 3I2HA 2ZTNA 2ZX3A 5FY5A 5C4WA 5JIUA 1NCQA 2WS93 1ND3C 3AKSA 1HW5A 3ORJA 1W8FA 1QQP1 3HPNA 1DYKA 1DGWA 2YPDA 4EWDA 5C6CA 2AREA 5CFDB 3OPTA 1AX2A 1ULDA 4N9HA 2Q8DA 1K5JA 5LY2A 5IK7A 3J8F2 2EIBA 1PIV3 3M2MA 4TXWA 4NIHA 3FZ3A 3FL7A 4EE2A 3ZXJA 1GP6A 2Y6FA 4HK9A 1DU3D 3K46A 3ES1A 1UX7A 1J3QA 3GHMA 4AFBA 2JG9B 1XYNA 2P1BA 3AZWA 4D7SA 3THDA 3UNPA 4PIXA 1QOTA 2ZGLA 4LQRA 3N9LA 1NE4A 1ODMA 3QCWA 3VDCA 4ARXA 1GZ9A 3H8OA 1R081 1X8MA 1YFYA 2VBBA 1J3RA 4FPFA 2OXBA 5FMOL 4ZONA 4FFFA 1DDLA 1E5HA 4QGMA 3T1MA 1UF2C 2JWPA 2J1EA 2XHNA 3HBZA 3QOPA 1HV1A 1MS9A 5FAXA 1LR5A 4Q4Y1 3H1WA 1XOYA 5A3WA 3SKJE 3T1LA 1ULOA 4EYUA 4QPIC 3IDBB 5LCWL 3I3QA 4UXAA 3A0NA 2W94A 1V00A 4IV1B 1IQDC 3RJRA 1BXHA 4I0BA 1HIXA 2BOIA 4BQ4A 5FO8B 2WWSA 3NAPB 4RFRB 2C26A 3H3LA 5E89A 3BTZA 3IDCB 4KMQA 4W50A 3O7OA 3DF0A 1KS5A 1YRZA 3MPBA 3V0BB 5F3IA 3UJOA 5FPVA 2BUKA 5FXZA 1A6CA 4AAXA 1D4M1 1H8TB 3ZYBA 3OOXA 4ES8A 3T09A 3VL8A 4DOUA 2C5DA 3VDDA 1DZRA 2WO7A 1LGCA 3I2KA 2VOVA 1LESA 3AYCA 2HWD2 1DQ1A 1SACA 1UZYA 2QQVA 1CAWB 2Z42A 3USUA 2FDJA 4CRQA 4YW1A 5KHIA 1Q5OA 1OOPC 5FBJA 1QXJA 2EXJA 1TMF3 2EIGA 3GBGA 2P37A 3HD8B 4KGQA 4DUVA 3WUCA 1LHVA 1ND2B 1J83A 4Y1XA 5IHRA 2P3IA 5EFUA 2Q4SA 4Z2WA 2DWRA 4JQTA 1R082 2IC1A 2RVAA 4QT6A 4Y5TA 1ENRA 2ORXA 2VTXJ 4JX0A 3AKPA 3KGZA 5FZ6A 3H8UA 2F6BA 2HWB3 4R52A 4BXFA 4IEWA 2W87A 4YZ2A 3I97A 4Q4Y2 2VUDA 1C1FA 5B4NA 3GF6A 4LO7A 4XFAA 4W6XA 2PA7A 1JTZX 3ACIA 2ZGTA 2JE9A 2WN2A 2YROA 2UURA 3R4SA 3WP6A 4B1LA 4K7JA 1SFPA 2AENA 3LGRA 4AEDB 5C8CA 5FYHA 2DCJA 4KH9A 5IFTA 3DGTA 4JGYA 3SLIA 4CEYA 1BVVA 1MS5A 4NHKA 1T6BX 1JZ5A 1COV2 4NRQA 5D8AB 1SBDA 5EIYB 2LROA 3LOBA 1BHGA 1RHI3 2JDZA 3ETQA 4GMP3 4V2WA 4LA2A 4AHXA 1PGL1 2YFZA 2E33A 2OQ6A 1WW4A 2Z4FA 3POGA 3BCWA 4HOOA 2WIIB 3IAPA 1GFF2 2VNOA 4OULA 3POSA 3SQOA 5GZGA 1O6UA 3NWKA 1JYWA 2PTMA 1VRH1 1RUJ1 3OGRA 1UY4A 3C7OA 5FUNA 3N7JA 3GJBA 4XJWA 3POYA 2WWJA 4JKMA 5FWEA 4BZ4A 3QBQA 1OI6A 2KD7A 1E5IA 1POV0 1DCSA 3ASIA 5F8PA 3WNMA 5IK4A 4B7EA 4XPVA 2HWC1 3OUIA 1JN2P 4LBJA 3ACFA 1FPN3 4ISQA 2WBKA 1TNRA 3TN93 2JDHA 1WWYA 1MACA 4UFLA 2XJUA 2ZEYA 3GDBA 5CFCC 4PF1A 3AJYA 3VBSB 3WLUA 5C33A 4OZXA 4Q26A 1FATA 3PJQA 4XJUA 1AYM1 1IS5A 1D4VB 4U36A 3WDTA 3THTA 1AXYA 3FBMA 2WZ8A 1PHMA 2QCSB 5GLWA 2FDKA 3MDPA 2ZHNA 5DAWA 1H0BA 4SLIA 4LJHA 2CL2A 4PLNA 1YXWA 4XJ9A 2R16A 2B42B 4ONUA 2FCUA 4COVA 5H9QA 1AR93 1UY3A 2Q30A 3THCA 4ZXKA 3GGLA 5FKBA 1JXNA 3BPSA 4S2FA 1LRHA 2ZEXA 3ZN5A 5T55A 5KXDA 3G6JB 4HN1A 3B3QE 2VMGA 5FP4A 4WVMB 3GXUA 1PGL2 4I0AA 3AP9A 2AUYA 5FY7A 2NZ9A 2R30A 4WM7B 2C24A 1AR61 2X53S 2ZZQA 4XZUG 1XXNA 1NKGA 4MSVA 1IS6A 4RGKA 1L3JA 1YJKA 1GNYA 2B46X 2VZOA 1RUJ2 1FOD2 3OGVA 2ZMKA 3ZXKA 1AL23 1J1TA 1RUC2 2VZRA 4DINB 2H6CA 3AXDA 1LECA 3WG4A 4XHXA 1OFSA 2QFEA 4CXXA 5EHDA 1XNCA 1ZRIA 2HWC2 3GZUC 1YFXA 4J1XA 2WQZC 3M1HA 1QDCA 1SLBA 2ADDA 3NKGA 1YQ2A 3ECQA 1T6GC 2CY6A 1QJX3 5C3PA 1DQ0A 1OD3A 2R7EB 3PLQA 4JDOA 3IN9A 1QDOA 5CG9A 1OH3A 1YEWA 2J7MA 4LNVA 3ZFFB 2A6XA 2BOJA 4LK6A 5E8AA 1J1LA 2PAEA 4L9BA 4MGYE 5DDJ2 3WW2A 1AYM2 3AKRA 1PIV1 5A33A 5JR7B 5T52A 2ZHMA 3VKFC 2DTYA 1W6NB 3MPPG 1S2KA 3KD4A 5IVBA 3LDRA 2BU9A 2FZ1A 4NO4A 4Q4X3 4DY3A 2Z69A 2IFWA 1UL9A 3U10A 1PVC1 1B35B 1KGYA 2WNVA 4R4XA 3H8RA 1W6PA 2TUNA 4XFIA 2Y6JA 4I01A 5GLTA 3SC7X 3NNLA 2XL7A 3U4XA 3WW4A 4IEUA 1ASJ1 4LT5A 2W08A 1KFXL 4CUGA 5DZFA 3W21A 4NHMA 3U75A 5A1LA 1PGW2 2CDOA 1UD1A 1RUF1 3O0VA 4DIQA 1CAUA 3FLRA 4AQSA 3EQEA 4AZZA 1QNWA 4AE2A 1GBGA 4LBQA 4MXWB 1JODA 2DVDA 3BU7A 3PURA 5EJ1B 3VBUB 2DVAA 3D6EA 3VZNA 3THPA 1PO23 1NA1C 2A6ZA 2XJTA 4CDUC 1PO13 5FPZA 3FLPA 2RJ2A 1XRUA 3KB5A 4EN7B 3HR9A 2YC0A 3ZYFA 4QPGB 2P3YA 1Z7S2 1OSGA 1ZRRA 2E9QA 2TBVA 5JI9A 1LHUA 2VVFA 3R05A 1DQ6A 5BNOA 1U12A 2UY8A 2NMOA 2XDVA 4CP9A 5FP8A 3WDXA 1D0HA 1ZRDA 3RPQA 4QMAA 5CNAA 1TEIA 3EXUA 5LRRA 5FPBA 3M3QA 2HWF3 3PVOA 2MPFA 3FUOA 5JXGA 1UZVA 1CAVB 2CV6A 4AWDA 2W1UA 1DQ4A 3ZYJB 1UAIA 2JG9A 5D21A 1ZNPA 2K0GA 1FYUA 2DVGA 4XDPA 5EP9A 3WZ1A 3ZXLA 1QF3A 4AFMA 1J3PA 2ARBA 2GDFA 3NJZA 1LULA 4IL7A 3WT3A 1MEC1 1PVC2 4RHV1 1W8NA 5FZ1A 2JEMA 2VW0A 5IAVA 3NJXA 4ARYA 3BALA 3HVDA 1UY0A 3E6CC 1MVQA 1WCKA 3INAA 4GJYA 5IVFA 1QXPA 2ARCA 2AACA 4GALA 5C4WC 1JYVA 1V9U3 3FLTA 1NCQC 3OGJA 5LK7B 4CZSA 3I59B 4Y24A 4URTA 2XOMA 5I0UA 1RUF2 4BDVB 2YBSA 4H55A 1OA2A 1H1AA 1NCRA 2CSGA 3E1F1 5LBEA 3T08A 2Y8KA 1PMJX 3CZJA 5LK5A 3I4IA 1W9WA 3NAPA 4XTPA 1D0GA 1VBB2 1W8ZA 5E16A 3TAYA 4B4PA 5LA1A 3BUCA 3O1PA 3C7HA 2EIEA 3MF9A 2CYFA 2BNMA 3O1UA 5A7SA 1SBEA 1BBT3 1H8TA 1W0PA 3ZDSA 1NOVA 2UU8A 4KU7A 1MS3A 1RHI1 3VZKA 4AGVA 1OA3A 1GP5A 2VL4A 1OUXA 5EJZB 1WCSA 2IXHA 3I2JA 3JU9A 2G9ZA 3GBFA 3BPZA 3WNOA 5ANQA 4RSUA 3NJYA 1SBFA 3MV11 1BYHA 5BUVA 5FYUA 1QJEA 4XMAA 1YQ6A 3KSCA 4YZ1A 3SXWA 1LHNA 1GZWA 1RUD3 2GC2A 5I0DA 5A7WA 1YIPA 3FFQA 3WG3A 5EV7A 1JZ7A 3UGHA 5FZOB 4XUTA 4UYBA 5FP7A 1G6NA 1XYPA 4Q4W1 5AVAA 4R9AA 2FHRA 4JCKA 4LORA 1ZBE1 4OI4A 1RIRA 3B01A 2LW8A 4NIIA 5L36A 2G4IA 4QGLA 3M8LA 4DY5A 4YW5A 5HPOA 2BV4A 3CKHA 3VDDC 4BMEA 1BEV1 1POV1 4FO9A 4GZ9A 2E26A 4D6QA 1AYN3 2WQ4A 4N43B 2HYXA 1J84A 2O8OA 2VJXA 3RVHA 2XUMA 1R1A1 3PIJA 3VZJA 4IETA 4OVEA 4TLFA 3V65A 1JYTA 1QU0A 3D5OA 4Q0QA 1W8OA 2DVFA 3AYEA 4HVQA 1DZTA 5BNQA 2RS53 2V5DA 3H3ZA 3ZYHA 4H14A 4FSJA 2EIDA 1K45A 2EVXA 4FVVA 4HETA 2R071 4S2DA 5FIXA 3H8XA 4I3GA 4ZY9A 2RR13 1NY72 5FMBA 5B4XA 5DQ0A 3MV01 5HBAA 2PN5A 2OIIA 4XJ8A 1XPWA 2XHKA 2ZX1A 1K5MB 3M70A 4PCRA 4RS5B 4NE9A 4FOYA 5J36A 2VZTA 4UF0A 4ATEA 3VLBB 2JKBA 5FTTC 1RTVA 4D7YA 3KV4A 4A4AA 4FXGB 2YY1A 1VBC3 3DV8A 3BTYA 4ZU4A 3CBNA 1REEA 3RG0A 5CISA 5C8CC 2W3JA 5GM0A 3U78A 4EN8B 1W39A 3ZKYA 4Q4W2 4JGYC 2DU1A 4CEYC 4CDXB 1LAJA 3VUOA 1NE6A 5JPNB 4M00A 1QJX1 4LTAA 1W8UA 3VBSA 5L7OC 1Z78A 3TEYA 3VV1A 2IXJA 1VBE1 2KM2A 5J48A 3P3NA 1X7NA 4QXBA 1QKQA 3ZFEB 1UIKA 1MZ5A 1BEV2 3WF4A 1ZREA 3KGLA 4HKWA 1CPNA 3WF1A 4DB5A 4QM8A 4XTMA 5F37A 4MHRA 5J37A 5J7MA 1LNSA 5A3MA 1MZFA 3POJA 2V5YA 2XLGA 5FZ9A 3URFA 5FUIA 2B5HA 2FDFA 4D6RA 3N9PA 3PTRB 4XIOA 1PK6A 1PVXA 5CYYA 5FY0A 1W06A 4CEWB 1NQJA 1SHWB 2Y0IA 4HN0A 1RVF2 4IE5A 2PHLA 5C3SA 2K46A 3GZEA 4GAZA 1CZTA 4AEKA 3I3DA 4M3CF 2RS33 4PIYA 2R041 1H6YA 5A7NA 1LB2A 4Q0VA 3AJZA 5A3TA 3AMQA 1CD3G 3ZPYA 4H7LA 2VW2A 5ACA3 3OYWB 4CVUA 3FX3A 3WV6A 4C0HA 1HRI3 3I54A 4QX3A 1HRV2 2HWD3 2OPWA 2X5IA 4N7UA 5HV0A 2ARAA 4E27A 4TWTA 1VMHA 1SFYA 2GC0A 1YCIA 4BQWA 1PO21 3KVAA 1A8DA 1IPJA 2ORZA 4TYSA 1F5JA 4AI0A 3LIHA 3ZR6A 5KHKA 2IZWA 5FZHA 3I2IA 3MICA 3VD4A 1JU4A 2FZ2A 4Q4V2 5L9VA 5BV6A 3RZZA 2HBUA 4BQXA 5FPXA 2ZKNA 3NQHA 1OUSA 1LOBA 3POEA 3ZFFA 2AEZA 3ABZA 5FP9A 1DGRN 2Z5WA 3ALQA 3KWVA 3C3VA 3D4KA 4YGCA 2AZ5A 3ZYRA 4IERA 3ZXAC 3H0OA 1RINA 3O1MA 3OBRA 3ZFGC 4UFKA 4UFHA 1HB4A 2DFCA 2BFUS 5SV5A 5FPUA 4PI0A 3TRSB 2JDAA 2WSUA 2ZGPA 2ZOEB 2B4KA 3M4FA 4RR3B 4GH4A 4WVVA 4Y26A 1SQ4A 5AFBA 1RUE3 5FXWA 2Q1FA 3LDBA 4LKDA 4IE7A 2OX0A 4OCTA 4W6WA 3RYKA 2D6PA 1COV3 5DZGA 3BI3A 1Y3TA 4AI2A 5BNNB 1C3HA 2R042 1V9U1 1QH7A 3HN1A 4D94A 1OLRA 3UESA 3F2ZA 3PVNA 4NAOA 1UQXA 4WZFA 4YVSB 3I2DA 3EBRA 2GALA 3GM8A 3UV9A 4AK3A 1JZ3A 5FZEA 3GCXA 2XH6A 3KMHA 2WINB 4YYOA 3M3EA 1KJLA 1EYBA 4ITCA 2WT1A 2WZR2 4PHZA 4QGNA 4E2SA 2WWUA 1IGOA 3KT7A 4LBMA 1BLZA 5G05L 3OTFA 1WLTA 5CKNA 3TYJA 1HXS2 3RZMA 3VBRA 4QDSA 1BBT1 2ETEA 2VMFA 4XCBA 4NPLA 1VPHA 1IG3A 2WNVC 3PUIA 3PHMA 1REDA 1UOFA 3AL5A 3POFA 3K4ZA 4ASMB 1WZXA 3QD6A 1AVBA 1I9RA 1VRBA 3G7DA 3U0ZA 2RMU1 1YQCA 1LKNA 4LBNA 1HB2A 1O5LA 5CZKA 5FRAA 1RUG1 3O1SA 5FP3A 5HCFA 3W59A 2J1AA 1GZCA 4NROA 4BMBA 3Q8CA 1XE0A 2O14A 4GB33 4MGIE 5KR7A 4FPGA 2JDPA 2Y34A 4Y20A 3E97A 4IE0A 4KI5M 5FY8A 1W3VA 5JSPA 3I3BA 1IZ3A 3O5SA 5E1RA 2YGLA 2RS13 5FOJB 4Z2AA 2B9UA 2JDMA 2DUPA 2VZQA 2WC2A 5EPAA 5T5OA 1H2MA 1O8SA 2Y6GA 1UX6A 1YI9A 1YUDA 3MO4A 5DAPA 1X9PA 4IGQA 1W6QB 2C6SA 3KF3A 5LY1A 2J1RA 4QB2A 5BNOC 4EN0A 3O1RA 3HAGA 3LA3A 4FOVA 4QDRA 3H50A 3AVRA 4FFGA 3ZN6A 3ZMOA 2XJQA 2EAAA 4P14A 2AC1A 3JBG1 3AZXA 2A6VA 1VBA3 2W9XA 5IYYA 2G9FA 1ZBA1 2YFUA 2CWMA 2JG9C 4HK8A 4M4PA 4A7ZA 5IVEA 5K0UB 2RS51 1VE0A 1XQNA 4CDUA 4XXPA 1VIWB 3OPWA 4U2AA 3WDYA 2MEV1 4CCMA 1S0GA 1JW6A 4HSJA 1N3OA 3ZXDA 1AL0G 2JD4A 3B9IA 3HNBM 5JSRA 2QBXA 2RMU2 4QX8A 1A8MA 2VPVA 1O4YA 1HB1A 3KV5A 3MLKA 4FFIA 1RUG2 5I8SA 3U14A 1AHSA 5BNPB 4NR1A 4A42A 3CHXA 1RUH2 3CEWA 5DDJ3 3WINE 3RYPA 4Q29A 4ZS3A 1WW5A 3WG1A 1F4AA 1X36A 1NCRC 1VBC1 4XDOA 3Q8FA 4Q0UA 4ZZ8A 3UYJA 2AR6A 3ME2A 4LA3A 1SCSA 3NAPC 2B9VA 1EPWA 1S2EA 3ACLA 5FYBA 1V6OA 2XJPA 1JOBA 1ZVFA 1F5FA 5FCCA 2PAMA 2GH8A 2HWE1 4BQ3A 4CPBA 1ULCA 3A7QA 4BA6A 3JD71 3FN9A 2DTWA 5DUXA 4JAAA 2V4VA 1U5ZA 1H8TC 1QXRA 2WFF1 4AVSA 3VHRA 2RM22 4XFFA 2QQPA 3BU0A 1CWPA 1ZA4A 5FREA 1ENQA 2HLEA 2WNUB 4AI1A 4JRLA 1YO8A 4TZDA 4Y22B 1CESA 3J9SA 5JZGB 5FXXA 4L99A 3VBOA 2DCYA 3UGGA 1DLCA 4CDQA 2D44A 1AR83 1ZBA2 1RUI2 3L2YA 3LCPA 4MXVA 2ZPXA 1MS1A 2ET1A 4ZU7A 4YG6A 2MEV2 5ABJA 5LA2A 2D6MA 1AF9A 1JH5A 3KZ4C 2PHWA 3IT8A 3V64A 1UMZA 3VBHB 2DUQA 4Q0SA 4FCAA 5ACA1 1N47A 3KHBA 4HANA 2QDRA 4NIGA 1RGSA 4NIDA 1HX6A 3S57A 4X8PA 3K3NA 5F32A 1UNBA 3KV9A 4K21A 4LE3A 2R063 4PLOA 2YUEA 2DUOA 3GZTB 3LA7A 3AC0A 3OEBA 3RFRA 2CGPA 5SV8A 3J7HA 2E7AA 2WL1A 4TLGA 1AZDA 5IT6A 1SDDB 2PFWA 3W58A 2YBKA 5FWJA 5I0SA 1C8M1 2HWE2 3HEIA 1EAH1 2YU1A 3JD72 3DPRB 3PTYA 1BKZA 4A44A 4M3CB 4MX3A 5C9AB 2YXSA 3FUQA 5LASA 1WA6X 3MIHA 2VQAA 3C2UA 5DAVA 2E6VA 1A3KA 1GP4A 3ZSMA 2XVLA 2CAVA 1DBNA 1K42A 3CO2A 4LO4B 1NX9A 2SBAA 4QXHA 5FYVA 1O5UA 4YWAA 4ES9A 1KFUL 3VL9A 1VJ2A 1QQP2 2VMHA 4YVWB 4RD7A 1UKGA 4AI9A 3K2OA 2XPJA 4A41A 1RUE1 5I91A 1VR3A 3TNPB 1YWKA 3I3EA 2NP0A 1OBNA 3FC0A 4XFCA 4BM8A 3CF6E 2DBIA 3V0AB 1X33A 2RE9A 2J42A 2W95A 4XQDA 1W28A 2ZMLA 2VH9A 3OYWA 5F6LB 1LOAA 2D6OX 3VBSC 3J4UH 1D7PM 2ENRA 5T50A 4BK5A 1EP0A 4RGAA 3WXPA 3KS7A 1RITA 2RJLA 4XAEA 1LENA 1TME1 5DPNA 2MNGA 1E5SA 3KCXA 2VW1A 5J3UA 3RNSA 2YG0A 4CDWA 2XKPA 3B94A 4PDWA 5AC93 1UYPA 5JCTA 4F83A 1JUIA 2W2IA 4BQ1A 5HXMA 1C8M2 3ZKUA 2CAUA 1W6MB 5C70A 3HT1A 4R9BA 2WJSA 1PK6C 1HV0A 2ZABA 3OGGA 4BPZA 1XB9A 3ZN4A 1JZ8A 2ZEZA 1G9DA 2K9ZA 2NLRA 5FMDA 4N8MA 3B7MA 1WGPA 5L7OA 4P08A 2ZZJA 3M3IA 1D4M2 1KITA 5F5QA 2Y38A 4AEMA 4CU6A 2WRAA 2Y6LA 5GZEA 4LXLA 4DPNA 4I2OA 4HLTA 4GB31 1W8TA 1XNTA 5KC5A 1MR5A 2D97A 2X5IC 5IJRA 1JYIA 5L19A 2PLV3 3ZM8A 1YNAA 2RS11 2D6LX 4JGZA 3GZAA 5FQ0A 2A73B 1A78A 1P8JA 2VG9A 1PZ8A 4GKXA 4HT1T 5LBCA 2YDEA 3LF7A 4NJ4A 4AAPA 3LPGA 2ZMNA 2F4PA 2LRPA 5JOZA 4AR2A 3CL1A 1GWLA 1V6JA 2CHHA 5H9PA 2Q8OA 1V6KA 3ZFFC 3ZSEA 2OW4A 4NHXA 1QJY3 3UK9A 5FZMA 3WX5A 1JZ6A 3VDAA 1TME2 3OUHA 4XZPA 3C7GA 2V09A 3RWNA 2PHTA 1MQTB 3GHNA 1WCUA 1DP0A 1W2AX 5FYTA 3VKOA 2DFBA 4UOJA 4XJAA 5FY9A 2P3JA 1OOPB 1BJQA 3S30A 1JYXA 4GH4C 4FAHA 4IW3A 1VBD3 2Q1MA 4FQ4A 4I09A 3WNXA 2BGCA 1W9FA 4GJZA 3PDQA 1NXMA 4IE6A 4Y1UA 5L9BA 1AX1A 4XHBA 3UETA 4DS0A 3ES4A 4HPKB 1DYOA 4NN0A 2J1VA 1C1LA 2DURA 4OHVA 2BFUL 2VBPA 1F2NA 1ZM1A 1MS4A 4CP1A 5F1RA 1DF0A 2VZPA 1UZWA 2XJVA 4P9GA 3RRDA 5FZIA 1Q8PA 2Y26A 1EY2A 4TN7A 4CCEA 2WKKA 3VBUC 2XWJB 3ZFGA 4L0PA 5C3RA 1VALA 4LO8A 1VRH2 1WMEA 1RXFA 3VZOA 3TBDA 3MEPA 4Q8KA 4ZZ5A 3LEKA 1QJU3 3VBRC 3AXEA 4NOTA 3IDAA 5T3NA 1O4TA 1R093 4Y4RA 1UOGA 3AMNA 4I30A 3VKLA 2VU9A 3B00A 2VOTA 3WNKA 3K51A 1CJPA 1J58A 3VD5A 1O3TA 1A34A 1KRIA 4XW3A 2WS91 4P00B 1V6NA 4WVZA 4XURA 3UKTA 1CIYA 3AFGA 3FE5A 1JHJA 3T2OA 2RDNA 3EYPA 4C90A 1WCQA 5JXHA 1OMIA 4IGPA 4N53A 4OUSA 2GH2A 3WOGA 1VP6A 2ZX4A 3MI8A 2XUEA 4WM8B 2FDHA 1AR81 3ETPA 5FZBA 5I0TA 5LB6A 4I0WB 3C8XA 4XVHA 3EMRA 2IVIB 2BJSA 1UKRA 4HSLA 1APNA 2O8QA 5FZKA 1CN1A 1CVNA 1G7YA 1OPOA 1WLCA 2JX9A 2VY0A 2W0XA 3HN3A 3OY8B 1QJZA 4Q4V3 2QQJA 1H4HA 3TB0A 3V56A 5IVVA 1RC6A 4UT5A 1GQPA 4ZS2A 2VAUA 1UMHA 3AZYA 3D8CA 3CJIA 1AR73 2WAOA 3FBYA 3MUY1 4G4FA 3P5BA 4UFMA 2QUOA 3OBAA 4K6BA 5HCAA 3U07A 1Y4WA 1AR62 2ZHKA 4FBFA 5CFCB 3IPVA 2W46A 3POIA 4YGEA 1WBLA 3T2TA 3LE0A 4C1WA 4NIAA 2GU9A 2ES3A 4B3NA 5C71A 5CEHA 3KV6A 3IDEA 1SPPA 1CZSA 2NM1A 2CGOA 1KXGA 3KQ4B 4E2GA 4GIQA 5FZDA 4KWKA 3CQOA 4COUA 1W04A 5A32B 2R1BA 1OF3A 2WNUA 3KT4A 1H2LA 4OI1A 4XMIA 1S0IA 3RZKA 1REFA 3IIIA 1ZZ9A 5IW0A 3EJKA 5CFDA 2WS92 5TSWA 4LIUA 1N3QA 5FYYA 3WSOA 5J09A 2Q0AA 2CTVA 4YARA 1S0JA 3LSDA 1VLNA 2QNKA 4A7YA 4INDA 3USSA 4QHBA 5JXJA 2OUJA 4XC9A 1X82A 1L7RA 4UWDA 1U5YA 2LM3A 4JTOA 1PIV2 5L9RA 5JXIA 3HMYA 2TNFA 1ZYBA 1YQ5A 3BYWA 2PMWB 1TMF1 2NN8A 5A7OA 1AUYA 1DZQA 4QX1A 2VM9A 4B1MA 3I49A 1XNBA 2ZXQA 2FCVA 3BVCA 4LBLA 1LOGA 1XC6A 2V73A 1FMD3 1OVPA 5DAXA 5LRSA 2XBO3 2PHDA 2QVSB 3UKVA 1LU2A 1O3QA 2BWCA 2VOXA 1ASJ2 3RZJA 1SFNA 2DCTA 1WD4A 2HWB1 1NXD1 3NSTA 1S4CA 4OUEA 3SISA 1IKPA 3HWJA 2JDUA 3ZIWA 5IFPA 4QQHA 2D40A 1IPSA 1Q56A 2VTFA 1WUVA 3LSEA 2OA2A 3OPZA 4FPCA 2DVBA 4A3XA 4EROA 3FHIB 5LWBA 4IV1A 1OKOA 5A7PA 3VBOC 1V6IA 5AC91 1V6MA 5F39A 4XIKA 4CDQC 1QIQA 1CAXB 2OYZA 3Q9OA 2VUAA 4K1ZA 1D2QA 2UYAA 2RJKA 2A1XA 5ERLA 5GZDA 5CBLA 5HI0A 3V0BA 2E51A 5ABJC 4OUMA 5DABA 1F8VA 1ZA7A 4XBNA 2JKXA 4Q27A 3UT0A 2V4AA 1MS0A 4EZHA 5FO9B 1H1IA 3CU7A 4GMP1 3LOIA 5JIAA 1GQHA 3SHRA 3B69A 5I93A 5JOWA 3RMXA 1LOEA 2X10A 3N9OA 2QQWA 3L2HA 4YVWA 2DU0A 3ZR5A 1CAWA 5FOBB 3NW4A 3VD3A 1RMU3 5J1XA 4ZU5A 4CCJA 3AKTA 4FXKB 1EUTA 2PLV1 2Z79A 1DG6A 1NQDA 2VMIA 2WLQA 2Q5TA 5A7QA 2A6WA 1UZ0A 4OI0A 1U0AA 1EV13 1TMF2 2NPIA 3AP7A 1ND2A 4UW6A 3KF5A 2ATFA 2CNAA 2VOKA 3LDKA 4HVRA 3DL3A 1MPXA 4GULA 1MEC2 1NA1B 4RHV2 4XBLA 2WZPP 4CCKA 1FPN1 1LTEA 1WKYA 2OZ6A 3TN91 2VECA 5EWSA 3ZFEC 3WHTA 2R0HA 2ET7A 1QJY1 1WLDA 2A5ZA 3PL0A 4XUQA 3NNJA 4IEPA 2HWB2 4GXLA 5GLUA 5A6XA 3R0RA 3O1TA 2C0ZA 3EHKA 3P6BA 4E4HA 1CIWA 1HDKA 1RUH3 1W6OB 1XSRA 4ZPIA 5IATA 3TEWA 3S5AA 4IDZA 1TQ5A 3DEMA 2H0VA 4OMCA 4AEDA 1W2TA 4NHLA 5A80A 2BBVA 2RDQA 2RDSA 2Z2SB 4Y5Z0 1VBD1 3DYOA 2PQQA 5D8AA 4AXOA 1AR91 2VCAA 2E7QA 3RDIA 3VHOA 1W03A 1KDMA 2GP3A 4CCCA 3PJYA 1RHI2 3SH3A 2RM23 5FZFA 3E5XA 4E2QA 4QQPA 5BY5A 1N1TA 3VBFB 4YGBA 4RQPB 5C4WB 2D43A 3EB7A 2JICA 2YGMA 4IESA 5LEJA 3N3HA 1PNFA 3JB4C 3TWIA 3WNNA 3AKQA 4OHZA 4FP3A 3N9QA 2VXRA 4F8AA 4BYYA 3J8F3 4M0NA 4CDWC 4PDWC 2ZGUA 3B9CA 1AL21 1RUI3 2QE3A 5C3QA 3LKJA 1QJU1 3NVCA 5FZ4A 4ZHNA 2D6KA 4FPKA 4QPYA 2HJIA 3KCCA 4EQVA 3KVBA 4NAMA 4QWNA 2XQRA 1R091 2PHUA 1ULFA 5K4LA 1OQEA 4PT6A 4AFDA 1QGLA 1ZBE2 1FPN2 3K75B 5F3CA 4O9EA 2VE1A 1GWMA 3AL6A 4XACA 3AP5A 4P5YA 2EXIA 4LK7A 3W9AA 3W5NA 1H6XA 1MQTA 1OLME 3ITQA 3S5QA 2PQSA 4LUKA 4WBBA 4K9SA 2W1QA 3PUSA 1ZX5A 5A6QA 1X9TA 1LJ7A 5IK8A 2LTNA 2PAKA 3HQXA 5JVVA 1G9BA 2JIJA 5BXXA 4JV4A 1XSQA 3WVJA 1R1A2 3FHAA 3K48A 4JGZC 1FNYA 2IWGB 4Q4X1 1M4WA 5DG1A 4PQ9A 4K20A 3HJRA 5T5PA 4W8JA 4BQ2A 5BNNC 2XQXA 1JOPA 4WVMA 3T0BA 3WCRA 2XKOA 5JUVA 4QQLA 1LHWA 3NMBA 4JZRA 4WM7A 2R072 3WR0A 2W39A 3Q8BA 3I2OA 4PQQA 1Z0HA 4A2UA 1OXCA 4JRAA 5FY4A 3WDWA 4B7KA 2CGNA 4MV2A 4GWNA 4AGRA 1OH4A 2WFPA 1IHMA 3UGFA 2WO2A 2YYOA 3D3AA 3WY6A 4RA0A 2ZAAA 4L97A 4B4QA 2XLFA 3VD7A 4COYA 2P2KA 1HLCA 3L9JT 3RQ0A 3BOWA 3AP6A 4WZCA 4Z07A 3SNMA 3JZVA 3B02A 1ZRFA 3USUB 2OQ7A 4LUMA 2AYHA 2VVEA 5JSOA 4KBZA 4DFSA 1PO11 4LKEA 2W91A 1VAVA 1S0DA 3WQ1A 4TSVA 2ZEWA 4AFAA 4GKYA 1Y9MA 1WMFA 4O61A 4HONA 1SZBA 3RWKX 1GOHA 5IAXA 2Y64A 1QJX2 1R083 4XF4A 2E32A 3BIWE 3KLSA 2W47A 3S6PA 1VBE2 3I7DA 2GMMA 5ANNA 4QDQA 4WM8A 5AFEA 2VC9A 3MW2A 4DO0A 4AI3A 2D6NA 4AQTA 1UYYA 4NUBA 4YZ5A 2HWF1 3MUZ1 1W6NA 4Q4Y3 4GA9A 1W05A 2VCCA 4D7TA 1NT0A 4P9YA 5LBBA 1W0NA 4QXKA 2BVVA 4HZFA 1H8VA 4MGKE 3FHQA 4Q4X2 2H6BA 2BW8A 3LQCA 4NPMA 1B35A 3T4VA 4DMIA 3LEIA 3A22A 4Q1PA 3R4DB 3T4HB 5A3UA 1S0BA 3T30A 1JUHA 4COWA 3AZVA 5M0TA 4HKOA 4YZ4A 1FMD1 4CU7A 5DUWA 2VXJA 4CXWA 4KWJA 3ZOIA 3NNFA 5CADA 2A6YA 4CEYB 1OFNA 5IVJA 5CKMA 3T2PA 3B5LB 1W99A 2PHFA 1O91A 1XE8A 3MFCA 5FYIA 2KA3A 4J6GA 3ZX7A 1UU5A 1ZZ7A 5BYNA 4X8NA 3A23A 3AYAA 4UI9L 3OD0A 1O3RA 3MF6A 2UWBA 1HN1A 4D0QA 4MXWA 4N53C 2GP5A 1GNHA 4FT8A 3GYDA 1JOJA 3VBUA 3MLLA 3WEZA 4AI8A 1H2KA 2B7YA 4IV3B 4JVAA 4J1WA 3WCSA 4UFJA 4MG2A 3WP5A 4LR4A 4BQ5A 4YG3A 1PO22 2VCMA 2XL9A 1MS8A 1PO12 2BRTA 4IEQA 1XE7A 4QPGA 4XUOA 2D3RA 3UL2A 1SEFA 4CTEA 3OJBA 5JAXA 4K3UA 4LULA 4WV8A 1GICA 3PVEA 2DCKA 2QTWB 2QKDA 4AHZA 5DZEA 2P6CA 4XFBA 3AMHA 2BPA2 3N7LA 2YV8A 4F3JA 1BZWA 1GZTA 3J7NA 5GZCA 5A6ZA 3CJIC 4C91A 5JI7A 5FZGA 5DXDA 3ZYPA 4Q2FA 2ZGMA 4MZUA 4E4SA 1LGBA 1CAVA 2A3YA 2J1TA 3SEEA 4PBOA 1YYNA 2HWF2 3LA2A 4DXRA 2HYKA 2QQMA 4E8DA 4OYUA 1UIJA 2HEVF 4NWVA 1CX1A 1OLQA 3JQWA 4CUCA 1EV11 2J1SA 5JOXA 5FPLA 1RUD1 2C9KA 3P3PA 3KHCA 2OVUA 2P4EA 4Z1VA 1DLLA 5JPMB 3WNPA 2DF7A 4KBBA 4M3CE 4AVBA 1POQA 2RV9A 2VQ0A 4XF9A 4X6QB 5T54A 3UKNA 2P5BA 2WNUC 3LWCA 4FTBA 1LGNA 2EF6A 3H1YA 4SBVA 2R6QA 3I59A 1G9FA 2BNNA 3IBMA 3AP4A 1V9U2 5BPXA 5CB7A 1BK0A 2HKXA 5CFDC 4E4DX 4XUPA 2BWAA 4OHWA 2BP6A 1AYN1 1CAXA 3OCPA 4QHZA 3WF0A 2BDRA 2PELA 2XMLA 2C1FA 3JQXA 3VKMA 2FMDA 5FKCA 1I1EA 1BVP1 2ZS6B 4DXSA 1RUJ3 1ONAA 1UYXA 5E6HA 1M06G 1FOD3 1OVSA 4P9XA 2XONA 5KXCA 1RUC3 4DUWA 4QKBA 4EZ4A 1C28A 1BBT2 1RUNA 1Y9GA 2BZDA 2F4LA 4HMZA 2SLIA 2HWC3 1JHNA 4DNYA 2ZGRA 1GWKA 3HT2A 5EYYA 5FYMA 1HQNA 4AFCA 1WW6A 4DEVA 5FLIA 2RR11 3E5UA 2A7AA 5C5UA 4AVCA 2GSYA 4XDQA 1HJFA 2QQLA 5GLZA 1NG0A 1LHOA 1ZZCA 2I07B 3K77A 2Y60A 3OEAA 1H4GA 1E57A 3D0SA 4EWAA 4QB6A 1AYM3 1F15A 4RGGA 4AGGA 3J8F1 1GOFA 4UAPA 4IV1C 5FZOA 3FFZA 2JXAA 4O9GA 5GZFA 1UXXX 5A33B 2ARXA 1MVEA 4P5HA 3S0MA 3RS6A 1TVGA 4BB3A 5L73A 2VO5A 4BQYA 5F5IA 2Y6KA 1SMVA 3MIGA 1FV3A 4IEZA 3VHNA 2Q1ZB 3OBTA 2QDNA 3O0XA 1PM4A 3ROUA 2EXHA 2WDBA 4FPHA 5E88A 4CE8A 1W6PB 4BIOA 1QH6A 4CCDA 2WYFA 1ZZ6A 4A6SA 4N43A 4CP0A 4YVWC 3WW1A 1AR63 1GKBA 3ZXGA 1UW8A 2ZJCA 1UY1A 2X05A 5EZWA 1ODNA 3ATGA 5JDBA 5JWPA 2JJ6A 2VMEA 1F9KA 3NNMA 5C5TA 3WNLA 3JBG2 2VTXA 4AW7A 5A3PA 2G19A 3OBZA 1CAUB 1JYCA 1WMDA 3SH5A 1NZIA 1ND2C 4I02A 1L7LA 2JB4A 4A45A 1JI6A 1OQDA 2RS52 4LBQB 5F2SA 5GKAC 3JUUA 1BCXA 1CQ9A 1ZZBA 4MADA 2OT7A 1JZ2A 4FQZA 4DEQA 1UZZA 2RS31 3VBFA 1Z7S3 3WQ7A 1DGRA 4PLMA 4RQPA 5B2GB 1KJRA 1QY4A 2RR12 1K5MA 3AM2A 3OUJA 3RGBA 3CLPA 2DDUA 3IM0A 4RS5A 1SDWA 1OQ1A 2HEYF 4LKSA 1C57A 5I8YA 1HRI1 2WT0A 4L92A 2HWD1 5BNOB 3H7YA 2D3SA 4CP9B 2JENA 3ZIXA 1VBC2 1PX4A 2P3KA 1JMUB 4AEDC 1GYKA 3MW4A 2QQUA 3A21A 3U11A 3ACGA 3RZGA 4CDXA 3TEZA 5FZLA 3ZYIB 4META 2WNOA 4AVVA 2VZ3A 4A7KA 5D8AC 2IFRA 1KEXA 1PVC3 2NQYA 1QOSA 5K8SA 5CG8A 2BEOA 2WFF2 3RSJA 4AOCA 3LEMA 1H1MA 4R9DA 3ZFEA 1OURA 1ASJ3 1VAMA 1Q8VA 4XUNA 4P02B 4F7ZA 2BGOA 1J59A 2IVJA 1SLCA 4GWIA 3DYPA 4L2NA 1RUF3 2QQNA 2ZGQA 3J7LA 4RYDA 4CU9A 1MZEA 1G9CA 1AXZA 1UXZA 2JDYA 4EWEA 1UMIA 4FOQA 4CEWA 1NCRB 2RDRA 4QQ2A 3MFAA 3NRUA 1VBB3 4AVAA 2JG8B 1VMJA 2VULA 4QKDA 3R6SA 1ST8A 1NLSA 5FYCA 1COV1 5FDBA 3QLQA 3R4UA 2RS32
chains in the Genus database with same CATH topology
5ACA2 1MQTC 2IXIA 3M7AA 4Z82A 1HRI2 1FI2A 3BTAA 3EO6A 4KWLA 3WDVA 4S2HA 5J09A 1PMIA 3OF1A 4QM9A 1BK1A 1ND3B 2LALA 4GMP0 3RYRA 5JLVA 4MLOA 2ZGNA 2GNBA 3ZXFA 3IWZA 1EAH2 1GZWB 4L8QA 1MEC3 4RHV3 4NVPA 4E9KA 3NV2A 4Y1VA 4YFZA 1Y43B 3SCGA 2E53A 1KQRA 4YM3A 4JDMA 4WM7C 1ENXA 3B93A 1ENSA 4P9JA 1FT9A 5KWRA 1G9AA 4BHPA 2FBEA 1YI7A 4JDNA 5GALA 3I8TA 3IKWA 1O7FA 4RR3A 1X8EA 1UPSA 1GR3A 2B8MA 3N35A 2BTVC 4YSFA 5I0RA 1RUE2 3HIFA 4QPIB 2P34A 4BWOA 4BLJA 4LEJA 4B4RA 3O14A 3KT1A 5BNNA 2EALA 2W52A 4EJRA 5A3LA 4PBPA 3N36A 2YHJA 4YVSA 3WG2A 1UU6A 4FTEA 1IOAA 3ILFA 1AXKA 1LEDA 4PJYA 1QMJA 4XJZA 4YM1A 3FMGA 1ZRCA 4AQ2A 4WM8C 4IV3A 4QU2A 2D98A 4UW4A 1PZ9A 4FOWA 1Q3EA 2FQPA 4FPJA 1HQLA 4Q8LA 4Y1ZA 1VBA1 1FOD1 1VB2A 3D82A 2ZAHA 3KQRA 1X50A 3ZXLA 3JCIA 2H0BA 4EV0A 4IQPA 2ZACA 1RUC1 4Z92B 4DQAA 1B35C 1AJKA 5FO7B 2X29A 4KNCA 4KU8A 4Q4W3 1H2NA 1ZBE3 2DYCA 1UU4A 1GLHA 2MHFA 3GBWA 3QACA 2D5FA 4R8HA 4DRRA 3PVBB 4KG0A 2A71A 1I6XA 2AGSA 3JB8A 2I2SA 4RFT0 3WQ0A 3ZSJA 5KBFA 5DDJ1 1BEV3 1POV3 4MUVA 2UWAA 4GB32 3WP3A 1FX5A 4N90A 3GALA 1R1A3 1CPMA 4MH0E 2RS12 4IEOA 1AX0A 1FNZA 4X6RB 4QPGC 4R4ZA 4IXLA 1CGPA 3J26N 4XFGA 1W6QA 1RVF3 5CVRA 4D69A 1OA4A 1PK6B 2IXCA 2R073 1XYOA 1QWRA 5IUQA 4XQWA 1CJDA 1XNDA 5KHJA 4XBQA 1PGW1 1DGWX 2PYTA 3TOJA 1HRV3 4P9LA 2DCZA 2O0OA 3AZZA 1VBA2 2XG3A 4OLLA 5K0UA 2WLPA 3FWEA 2X5IB 4I3PA 2R1DA 5T5LA 4UW5A 4K1YA 1H9PA 4FPLA 3VZMA 4UW3A 1Y7BA 2N7GA 3O12A 3D0JA 1Z7S1 5BNPA 1NYWA 1DGLA 1FXZA 2QZ2A 4AF9A 1UPIA 5KHHA 4XF3A 5KC6A 1QHDA 1VBE3 1WW7A 4LLOA 4DZGA 1YJLA 4LLFA 2R061 2GAUA 3A4UA 2EAKA 4GWMA 4YW4A 4C1XA 3ILNA 1S2BA 1GV9A 3PNAA 3KM5A 1UN1A 4Q0PA 2D7FA 4LO6B 4AEJA 4AVTA 4ZKTB 2YMZA 4LBQD 4YW2A 4D3WA 3H3UA 4GH4B 5JOYA 2CWSA 3ELNA 1ULEA 2O1QA 2ILMA 2OPKA 4Y22A 1CONA 2R043 4P9IA 1YFUA 4BIFA 1URXA 5JZGA 3M3CA 2B45X 4XE9A 3VGIA 3DUIA 1GQGA 3ST7A 3MW3A 1UCXA 2ZX2A 3M3OA 4BOWA 1IS4A 2PHRA 1AR82 2WZR3 1VBB1 1LOFA 2UYBA 3SH4A 3AMMA 3ZXEA 2OZJA 1HXS3 4NPRA 3MIEA 1PZ7A 2AH2A 3VBHA 5EJ3A 4AQ6A 2YZ4A 2NYYA 3VBRB 3WP4A 4KG8A 3ZSKA 4ASLA 2GC3A 1DFQA 2X8KA 4HKLA 2NMNA 4KL1A 1DIWA 4XEZA 4DRVA 4N43C 4LHKA 2R062 2UWCA 4AYUA 2VUJA 4RL7A 1QNYA 4XILA 1HQWA 5K9YA 4BLIA 2Y0OA 3AB0A 1IS3A 3DPRA 5EXOA 4IEYA 4M3CA 5C9AA 4Y20B 1EPZA 1HKDA 2QZ3A 3ENRA 3SMHA 3BB6A 3WD5A 3VBFC 5JMCA 4RQPC 1Q8QA 5FBZA 2WSVA 1K5MC 1Q8SA 1Y9QA 4RS5C 2VVDA 2IXLA 1S55A 4ISRA 4XQ4A 5D1IA 3AX4A 4FP2A 1OPMA 4HBNA 3APBA 2JG8A 2B39A 3ZN6B 4H3WA 3NKTA 4R9CA 5K7PA 5KXEA 4CDXC 3NV3A 3V0AA 4IEXA 3S7EA 3SCHA 2D5HA 4LHNA 1R1ZA 2GNMA 4AHYA 1H30A 2IXKA 4M01A 4CDUB 2EXKA 1N1YA 1NY71 2E63A 5AVPA 2A3XA 2RMU3 1V6LA 2BQPA 1ND3A 2ZHLA 1RUG3 3WDUA 1N1SA 1SLTA 2XVKA 2ZGSA 5FMOS 1QOOA 1U5XA 3FJSA 4XF1A 1XU1A 1V70A 5AC92 1W6MA 1ULGA 1C5IA 4CEWC 1W2UA 4YFWA 2BYVE 3A0KA 4FPYA 3RI9A 3E6BA 1FAYA 4EN9B 2A3WA 4UBGA 4BCUA 1O4ZA 5CAZA 2YPJA 3MZHA 1BMV1 2A75A 5I8TA 5FLHA 1C4RA 1GSLA 2XVGA 2I74A 4CYDA 1WLWA 4BE3A 4YNIA 1PNGA 4QD2A 3VKNA 1SLIA 1NCQB 4HVOA 2A70A 2PLV2 4QPIA 3JBG3 1LCLA 2GNTA 2R49A 1IPKA 4YM2A 1ZBA3 3VBOB 2G9GA 4CDQB 5T5JA 1RVF1 4QQOA 2W68A 5J98B 1O3SA 2MEV3 3MIBA 2JE7A 3GNEA 2KXLA 4COZA 3TN92 5ABJB 4QX5A 1GNZA 1QJY2 1RL3A 1RJ8A 1H9WA 1NZCA 4H7MA 4JC1A 3IMNA 1HRV1 3VHNA 4PF5A 1OKQA 2UY9A 4Z8BA 4MVTA 4K8FA 3MIFA 4XF0A 1RJ7A 1SLLA 1DQ5A 1OOPA 4RR3C 3BOPA 1YFWA 5F6KA 1VBD2 2C9AA 2GMPA 2HWE3 1CR7A 3JD73 1TE1B 4Q4V1 1AR92 3OD4A 4HPKA 1ZZ8A 1WD3A 2ZGOA 5H9SA 1W0OA 2WFF3 1DQ2A 4YVSC 1XU2A 1BMV2 4UBHA 2WNEA 3CJXA 1AR71 4DXZA 5J96B 4LHLA 1OD5A 3E6DA 1LU1A 4XXAA 1IQAA 3CNAA 5GJ6A 1NLRA 3X29B 2EA7A 2XB6C 4IV3C 1QQP3 2DV9A 3VZLA 2VNRA 3VDDB 2XJSA 3AYDA 4PIZA 4FPEA 1AL22 1QJU2 3DKWA 4Y1YA 2LUWA 2FMYA 4JTNA 4LE4A 4G9SB 1R092 1WCDJ 2WT2A 3MIDA 1DHKB 4GQ7A 1I5ZA 3SITA 4OHYA 4YM0A 4ORFA 4G3YC 1KS4A 1DYPA 1N3PA 1C8NA 3ZMNA 2ZCWA 5CA6A 1IKQA 4FPOB 4W65A 3LB9A 2HEWF 2WA4A 2WZR1 1XNKA 3ILRA 5FLJA 4L11A 1HXS1 3OY8A 2GMEA 4CDWB 1C8M3 3BODA 1D2SA 4PDWB 1EAH3 2VGDA 5CIRA 5C8CB 2ZX0A 4IEVA 2XBO1 1I3HA 1S0EA 3H1MA 4MGZE 1GANA 2VOWA 4JGYB 1AR72 2GN7A 5CFCA 3E5QA 4N7IA 1F31A 5F9TA 2QJVA 1D4M3 1MZ6A 3NV1A 4M0HA 5L7OB 5DG2A 5HCBA 2K2SA 1N1VA 4OHXA 4LBKA 4EN6B 5K0UC 4JQRA 1YIFA 3VHPA 3TNQA 4KQ7A 1LEMA 3WHUA 5A32A 4JGZB 4OFGA 3RJ2X 5FQ0B 3N7MA 5KHGA 1SLAA 5FFOC 1OHFA 2RHPA 4HFSA 2JECA 4YRDA 1RUOA 1G8WA 4N9IA 4V1PA 5DUUA 5BNPC 4B29A 2GC1A 3SCFA 3DN7A 4CP2A 4P9WA 4E4ZA 2BNOA 4B8EA 4KGGA 4AHWA 1RMU1 1S0CA 3RMYA 1B09A 1VB4A 1TME3 3NL1A 3UJQA 2D93A 2PHXA 4XYXA 1C5HA 2XGXA 3RI8A 1YLLA 2GZWA 4NWWA 4Y4YA 3H7JA 1TNFA 4LBOA 4YZ3A 4XETA 2E7TA 3N7KA 4WVWA 5C8WA 3ZYGA 1FMD2 5EYXA 2P17A 3NV4A 3N4MA 4FTSA 2XBO2 2VNGA 3POWA 2R32A 4HL0A 1JBCA 3IIAA 3ZSLA 2BVBA 3KCYA 5CU1A 5JZGC 3H9AA 5IK5A 1CX4A 1KD7A 4ATFA 1RUH1 3S7IA 3VN4A 4XFHA 3NO8A 4S2GA 3WUDA 1VRH3 4YW3A 3ZFGB 1LOFC 3MGUA 1AJOA 1FV2A 2ERFA 3LZZA 1RB8G 3VBHC 1PM7A 3ZVXA 5KXBA 1U5IA 4Q1RA 5HXVA 2RM21 4OI2A 1LODA 3QH7A 2XLAA 1PGSA 4W6YA 1RMU2 4C0BA 1Q43A 3AFKA 3MLJA 2ZA9A 2GNDA 1EV12 1Q8OA 1BQPA 4N53B 1RUI1 3PMSA 1RUD2 3DPRC 4FAGA 2ZKLA 1NA1A 5C9AC 4AG4A 4K40A 1WBFA 2ZGKA 1S1AA 5H9RA 2XWBB 3PMEA 1ALYA 2OUHA 2WNVB 1W6OA 3AK0A 5DUVA 5LEKA 2I45A 1WA4A 3CJIB 3ZO0B 4YGDA 2ZBJA 4YLZA 2GN3A 2TEPA 1AYN2 3QH6A 1S0FA 3LAGA 2JG8C 3IPVB 2XJRA 4XOGA 4LO5B 1LOCA 1G86A 1YHFA 1SCRA 2WA3A 4BH9A 2D3PA 2R0FA 5GLVA 1KDKA 3O0WA 3MYXA 3AMPA 4YG0A 3WW3A 1VAKA 4MYEA 2ZTNA 2ZX3A 5C4WA 5JIUA 1NCQA 2WS93 1ND3C 3AKSA 1HW5A 1QQP1 1DYKA 1DGWA 4EWDA 5C6CA 2AREA 5CFDB 1AX2A 1ULDA 4N9HA 5IK7A 3J8F2 3M2MA 1PIV3 3FZ3A 3ZXJA 4HK9A 1DU3D 3ES1A 1J3QA 3GHMA 4AFBA 2JG9B 1XYNA 3AZWA 4D7SA 4PIXA 1QOTA 2ZGLA 1NE4A 3QCWA 1GZ9A 1R081 1X8MA 1YFYA 5FMOL 1J3RA 4FPFA 1DDLA 4QGMA 3T1MA 1UF2C 3HBZA 3QOPA 1HV1A 1MS9A 5FAXA 1LR5A 4Q4Y1 3H1WA 3T1LA 4QPIC 3IDBB 4UXAA 3A0NA 1V00A 4IV1B 3RJRA 1BXHA 4I0BA 1HIXA 5FO8B 2WWSA 3NAPB 5E89A 3IDCB 3O7OA 3DF0A 1KS5A 1YRZA 3MPBA 3V0BB 3UJOA 2BUKA 1A6CA 1D4M1 1H8TB 4ES8A 3VL8A 4DOUA 2C5DA 3VDDA 1DZRA 1LGCA 2VOVA 1LESA 3AYCA 2HWD2 1DQ1A 1SACA 1UZYA 2Z42A 1CAWB 3USUA 4CRQA 4YW1A 5KHIA 1Q5OA 1OOPC 1QXJA 2EXJA 1TMF3 2EIGA 3GBGA 2P37A 3HD8B 4KGQA 3WUCA 1LHVA 1ND2B 4Y1XA 2P3IA 5EFUA 2Q4SA 4Z2WA 2DWRA 1R082 2IC1A 4QT6A 1ENRA 3AKPA 3KGZA 3H8UA 2F6BA 2HWB3 4R52A 4IEWA 4YZ2A 4Q4Y2 1C1FA 3GF6A 4LO7A 4XFAA 4W6XA 2PA7A 1JTZX 2ZGTA 2JE9A 2YROA 2UURA 3R4SA 3WP6A 4K7JA 2AENA 3LGRA 4AEDB 5C8CA 2DCJA 4KH9A 3DGTA 4JGYA 3SLIA 4CEYA 1BVVA 1MS5A 4NHKA 1COV2 5D8AB 1SBDA 3LOBA 1RHI3 2JDZA 3ETQA 4GMP3 1PGL1 4LA2A 4AHXA 1WW4A 3BCWA 2WIIB 1GFF2 2VNOA 4OULA 3POSA 5GZGA 3NWKA 2PTMA 1VRH1 1RUJ1 3N7JA 4XJWA 3POYA 4BZ4A 3QBQA 1OI6A 1POV0 3ASIA 5IK4A 4B7EA 4XPVA 2HWC1 1JN2P 4LBJA 1FPN3 4ISQA 1TNRA 3TN93 1MACA 2XJUA 5CFCC 3AJYA 3VBSB 3WLUA 5C33A 4OZXA 4Q26A 1FATA 3PJQA 4XJUA 1AYM1 1IS5A 1D4VB 4U36A 3WDTA 3THTA 1AXYA 3FBMA 1PHMA 2QCSB 5GLWA 3MDPA 2ZHNA 1H0BA 4SLIA 4PLNA 2CL2A 1YXWA 4XJ9A 2R16A 2B42B 4ONUA 4COVA 5H9QA 1AR93 2Q30A 4ZXKA 1JXNA 4S2FA 3ZN5A 1LRHA 5T55A 5KXDA 3G6JB 4HN1A 3B3QE 2VMGA 1PGL2 4WVMB 4I0AA 3AP9A 2AUYA 2NZ9A 2R30A 4WM7B 2X53S 1AR61 2ZZQA 1XXNA 4MSVA 1IS6A 1L3JA 1YJKA 2B46X 1RUJ2 1FOD2 2ZMKA 3ZXKA 1AL23 1J1TA 1RUC2 4DINB 2H6CA 3AXDA 1LECA 3WG4A 4XHXA 1OFSA 2QFEA 1XNCA 2HWC2 3GZUC 1YFXA 4J1XA 2WQZC 3M1HA 1QDCA 1SLBA 3NKGA 3ECQA 1T6GC 2CY6A 1QJX3 1DQ0A 3PLQA 4JDOA 3IN9A 1QDOA 5CG9A 4LNVA 3ZFFB 2A6XA 5E8AA 2PAEA 1J1LA 4L9BA 4MGYE 5DDJ2 3WW2A 1AYM2 3AKRA 1PIV1 5A33A 5JR7B 5T52A 2ZHMA 3VKFC 2DTYA 1W6NB 3MPPG 1S2KA 3KD4A 4NO4A 4Q4X3 2FZ1A 4DY3A 2Z69A 2IFWA 1UL9A 3U10A 1PVC1 1B35B 2WNVA 4R4XA 1W6PA 2TUNA 4XFIA 4I01A 5GLTA 2XL7A 3U4XA 3WW4A 4IEUA 1ASJ1 4LT5A 2W08A 1KFXL 5DZFA 4NHMA 1PGW2 1UD1A 1RUF1 3O0VA 1CAUA 3FLRA 4AQSA 3EQEA 1QNWA 4AE2A 1GBGA 4LBQA 4MXWB 2DVDA 3BU7A 3VBUB 2DVAA 3D6EA 3VZNA 3THPA 1PO23 1NA1C 2A6ZA 2XJTA 4CDUC 1PO13 5FPZA 3FLPA 1XRUA 3KB5A 4EN7B 3HR9A 2YC0A 4QPGB 1Z7S2 1OSGA 1ZRRA 2E9QA 2TBVA 5JI9A 1LHUA 2VVFA 3R05A 1DQ6A 5BNOA 1U12A 2UY8A 2NMOA 3WDXA 1D0HA 1ZRDA 3RPQA 4QMAA 5CNAA 1TEIA 3EXUA 5LRRA 3M3QA 2HWF3 3PVOA 2MPFA 3FUOA 1CAVB 2CV6A 4AWDA 1DQ4A 3ZYJB 1UAIA 2JG9A 2K0GA 1ZNPA 1FYUA 2DVGA 3WZ1A 1QF3A 4AFMA 1J3PA 2ARBA 2GDFA 3NJZA 1LULA 4IL7A 3WT3A 1MEC1 1PVC2 4RHV1 2JEMA 2VW0A 3BALA 3E6CC 1MVQA 1WCKA 3INAA 1QXPA 4GALA 5C4WC 1V9U3 3FLTA 1NCQC 3OGJA 5LK7B 4CZSA 3I59B 4Y24A 4URTA 5I0UA 1RUF2 4H55A 1OA2A 1H1AA 1NCRA 5LK5A 3I4IA 3NAPA 4XTPA 1D0GA 1VBB2 5E16A 4B4PA 3TAYA 3MF9A 2CYFA 2BNMA 1SBEA 1BBT3 1H8TA 1W0PA 3ZDSA 1NOVA 2UU8A 4KU7A 1MS3A 1RHI1 3VZKA 4AGVA 1OA3A 1WCSA 2IXHA 3JU9A 3GBFA 3BPZA 4RSUA 1SBFA 5BUVA 1BYHA 4XMAA 3KSCA 4YZ1A 3SXWA 1LHNA 1GZWA 1RUD3 2GC2A 3WG3A 1YIPA 3FFQA 5EV7A 1G6NA 1XYPA 4Q4W1 5AVAA 4R9AA 2FHRA 4JCKA 1ZBE1 4OI4A 1RIRA 3B01A 5L36A 2G4IA 4QGLA 3M8LA 4DY5A 4YW5A 4BMEA 3VDDC 1BEV1 1POV1 4FO9A 1AYN3 2WQ4A 4N43B 2O8OA 2XUMA 1R1A1 3VZJA 4IETA 4OVEA 4TLFA 3V65A 1QU0A 3D5OA 4Q0QA 2DVFA 3AYEA 4HVQA 1DZTA 5BNQA 2RS53 3H3ZA 4H14A 4FSJA 2EVXA 4FVVA 4HETA 2R071 4S2DA 4I3GA 2RR13 1NY72 5HBAA 2PN5A 2OIIA 4XJ8A 2ZX1A 2XHKA 1K5MB 3M70A 4PCRA 4RS5B 4FOYA 4ATEA 3VLBB 2JKBA 5FTTC 1RTVA 4D7YA 4FXGB 2YY1A 1VBC3 3DV8A 4ZU4A 1REEA 3RG0A 5C8CC 5GM0A 4EN8B 1W39A 4Q4W2 4JGYC 2DU1A 4CEYC 4CDXB 3VUOA 1NE6A 5JPNB 4M00A 1QJX1 4LTAA 3VBSA 5L7OC 1Z78A 3VV1A 2IXJA 1VBE1 2KM2A 5J48A 3P3NA 1X7NA 1QKQA 3ZFEB 1UIKA 1MZ5A 1BEV2 1ZREA 3KGLA 4HKWA 1CPNA 4DB5A 4QM8A 4XTMA 5J37A 5J7MA 5A3MA 1MZFA 2V5YA 2XLGA 3URFA 2B5HA 4XIOA 1PK6A 1PVXA 4CEWB 1NQJA 2Y0IA 4HN0A 1RVF2 2PHLA 4AEKA 4M3CF 2RS33 4PIYA 2R041 1LB2A 4Q0VA 3AJZA 3AMQA 1CD3G 3ZPYA 4H7LA 2VW2A 5ACA3 3OYWB 3FX3A 3WV6A 4C0HA 1HRI3 3I54A 1HRV2 2HWD3 2X5IA 4N7UA 4E27A 4TWTA 1SFYA 2GC0A 1YCIA 1PO21 1A8DA 1IPJA 4TYSA 1F5JA 4AI0A 5KHKA 2IZWA 3MICA 2FZ2A 4Q4V2 5BV6A 3RZZA 5FPXA 2ZKNA 1LOBA 3ZFFA 1DGRN 2Z5WA 3ALQA 3C3VA 3D4KA 4YGCA 2AZ5A 3ZYRA 4IERA 3ZXAC 3H0OA 1RINA 3OBRA 3ZFGC 2DFCA 2BFUS 5SV5A 3TRSB 2ZGPA 2WSUA 2ZOEB 3M4FA 4RR3B 4GH4A 4WVVA 4Y26A 1SQ4A 5AFBA 1RUE3 4W6WA 3RYKA 2D6PA 1COV3 5DZGA 1Y3TA 4AI2A 5BNNB 1C3HA 2R042 1V9U1 1QH7A 3HN1A 4D94A 1OLRA 3PVNA 4WZFA 4YVSB 4AK3A 3I2DA 3EBRA 2GALA 3UV9A 2XH6A 3KMHA 2WINB 4YYOA 3M3EA 1KJLA 1EYBA 4ITCA 2WT1A 2WZR2 4QGNA 4E2SA 1IGOA 3KT7A 4LBMA 3OTFA 1WLTA 3TYJA 1HXS2 3VBRA 1BBT1 2ETEA 2WNVC 3PHMA 1REDA 4ASMB 3QD6A 1AVBA 1I9RA 3G7DA 3U0ZA 2RMU1 4LBNA 1LKNA 1O5LA 5FRAA 1RUG1 5HCFA 3W59A 1GZCA 4BMBA 4GB33 4MGIE 4FPGA 4Y20A 3E97A 5JSPA 1IZ3A 3O5SA 5E1RA 2YGLA 2RS13 5FOJB 2B9UA 2DUPA 2WC2A 5T5OA 1H2MA 1UX6A 1YI9A