1CD3G

Procapsid of bacteriophage phix174
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.
pubmed doi rcsb
molecule tags Virus
molecule keywords PROTEIN (SCAFFOLDING PROTEIN GPD)
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cd3G00
1ASJ3 1WCDJ 3CJIC 3VBHB 5AC93 1Z7S3 1QQP2 1VBB1 4YVSA 4CDUB 1AYN2 3J8F3 1AL22 4QPIC 1R092 2HWC2 2VQ0A 5DDJ2 4CDXC 1NCQB 2R043 1NOVA 5FMOS 3DPRC 4GMP3 5DDJ3 1AR72 4WM7B 1F8VA 1NCRA 2WFF1 1RUE1 1VBC1 1HRI3 4AEDC 3VBOA 1BEV3 1AR92 1HXS3 4RQPB 1VB2A 1PO13 4CDQC 1NCQA 2RS31 4JGZA 5BNPA 1AR93 1Z7S2 1ASJ2 4CDXA 5J96B 4CDQA 1V9U2 1RUG3 4Q4V2 4GH4B 1ND2A 4GMP0 2XBO1 4LLFA 4AEDA 1AYM1 4N43C 5D8AC 3ZFFA 3JBG3 2RS11 4BCUA 5A33A 2RMU3 4RS5B 2MEV1 1QJX2 4RHV2 4GH4C 3DPRB 1ZBE1 4YVWC 3ZXAC 2WWSA 4RR3B 1HRI2 1POV0 5CFDA 4RQPA 4GB33 2R063 1EAH1 4IV1A 4QPGB 1DDLA 4CDWC 1PO23 4GB31 1K5MB 1NA1A 5A33B 1RVF1 5C4WC 5CFDB 1ND3B 1VB4A 3TN92 1FPN2 1H8TB 1FOD2 2RM23 1VBE1 2R072 4Q4Y1 4CEWC 1R1A3 3VBRB 5ACA1 5JZGC 1RUG1 4AEDB 1QJU1 2HWE1 1RUH2 1PO22 1COV1 3VBHA 1POV3 1PGL2 2HWF1 5ABJC 1NA1C 1FMD2 1ZBA2 5AC92 5K0UA 2BPA2 1HRV1 4IV1C 5BNNB 1VRH3 5BNOC 4Q4W1 1QQP1 1C8M2 1K5MA 3CJIB 1QJX3 3VBHC 1AR81 4Q4W3 1MQTA 2RS13 4CEWA 2HWF3 1PGW1 2R042 5DDJ1 1ND3A 3JB4C 5BNOB 2XBO3 1PVC2 1RUD2 2X5IB 1RUE3 1BMV2 4RR3C 5C4WA 5ACA3 1MEC2 4IV3A 3NAPC 4Y4YA 5BNNA 1TMF3 1PIV1 1R1A1 1RUF3 1QJY2 2RS51 1AL23 5C9AC 1ND2B 4CDWA 1PO11 4JGZC 1B35C 4PDWC 2XPJA 1VBA1 1QJZA 2R061 5K0UB 1EV11 1AR63 1RHI2 4N43B 1Z7S1 4GH4A 4CDUC 5CFCC 4GMP1 1AYN1 3VBOC 2HWE3 1H8TC 2TBVA 1NCRC 1R091 2HWC1 1OOPB 3ZFEA 1RUF2 3VDDC 1V9U1 1VBE3 1R083 5BNPB 3VBOB 2BFUL 4CDWB 1IHMA 1AYM2 1AR71 1TMF1 4IV3B 4RHV1 1VBB3 2WFF2 3ZFGC 3VDDA 1AR91 1HRV2 3CJIA 1EAH2 5L7OB 2HWD2 1VRH1 1QQP3 5A32B 1E57A 5CFCA 4CDUA 3DPRA 1TME2 2RR13 1RUJ2 2R073 2RMU2 1FPN1 2WFF3 1RUC1 3ZFEB 4Q4Y2 4Q4V1 1BEV1 5BNNC 1AUYA 1RMU3 1NY72 1HX6A 5ACA2 1RUG2 4Q4V3 3VBSA 1RUH1 1AR73 3NAPA 5D8AB 1RUI3 2MEV2 4WM8C 4YVSC 1ZBA1 2RR12 1AR83 1NA1B 2DF7A 1V9U3 1C8NA 1MQTC 4Q4X2 1ND3C 1OPOA 4Q4W2 1VAKA 1C8M1 4SBVA 4GB32 4NWVA 1OOPC 1HXS2 1B35A 1K5MC 5BNOA 1AR82 1W39A 1PGW2 5C4WB 1RVF2 3JB8A 1COV3 5C9AA 4RHV3 1BBT1 3TN91 2MEV3 4N53A 4IV1B 4N53C 1ZBE3 1VBE2 2R071 1MQTB 5ABJA 1RMU2 2BFUS 1OOPA 3ZFGB 2HWE2 1OHFA 1PO21 1R1A2 1RUI2 3JBG1 3ZFFB 1PGL1 1VBD1 2PLV3 1PO12 1AR62 3J8F2 5FOJB 1A6CA 1AYN3 1FOD3 1VBA3 4CDXB 3LOBA 1CD3G 5JZGB 4WM8B 4WM8A 2HWB1 1RHI1 3JD72 2WZR2 3VBSC 1NG0A 3VBRC 4RFT0 1M06G 5CFDC 1PIV3 1RUF1 4QPGC 4CEYC 1D4M1 1SMVA 2WS91 1AL21 4WM7A 2PLV2 4QPIB 5A32A 1BMV1 3VBFB 2FZ1A 1MEC1 4Y5Z0 2ZZQA 1R082 4RS5C 2GSYA 1RUH3 4FTEA 3ZFFC 2Y26A 4PDWB 2RM22 1VBD3 1QJY1 2WLPA 3S6PA 1ND2C 5LK7B 1D4M3 2WS93 3VBFC 1RUE2 1X36A 2HWD1 1VBA2 1VRH2 1EV12 1HRV3 1FMD3 2BBVA 3JD73 1POV1 1BBT3 2RS32 4FSJA 2HWB3 5BNPC 1RUJ1 1QJY3 1ASJ1 3VBSB 1VBB2 1RUC2 1QJU3 4EJRA 1BEV2 3VBUA 4N43A 1X33A 3VBUC 1H8TA 4CEYB 5CFCB 2BUKA 4YVWB 4JGYB 2XBO2 1TMF2 1PVC3 1RUD3 3ZFGA 1GFF2 4NWWA 4PDWA 4QPGA 1B35B 4Q4X1 1VBC2 1C8M3 3TN93 1RHI3 4IV3C 5C9AB 4QPIA 1NCQC 1HQNA 4FTSA 3ZFEC 3VBFA 2HWD3 3IDEA 1TME1 2ZTNA 5J98B 4RR3A 1BBT2 2RS33 2RMU1 4CEWB 2QQPA 4RS5A 3VBUB 2RS53 1NY71 1ZBA3 2GH8A 3M8LA 4CEYA 1F2NA 5FMOL 4WM7C 1AL0G 1RUI1 3JBG2 2ZAHA 3FBMA 3HAGA 1VBD2 3VBRA 1AR61 1QJU2 1RUC3 4JGYC 4JGZB 2RR11 1COV2 2RS12 2HWF2 2WZR3 4Q4Y3 5ABJB 1FMD1 2X5IC 1QJX1 1ZBE2 3JD71 2WZR1 1HRI1 4N53B 1HXS1 1NCRB 1TME3 5C8CB 3VDDB 1MEC3 5GKAC 1D4M2 2WS92 2PLV1 5L7OA 4Z92B 2R041 2IZWA 5C8CC 2FZ2A 1CJDA 2X5IA 1PVC1 1RUD1 1RMU1 5K0UC 4FTBA 1R081 1FOD1 4JGYA 2RM21 1RVF3 5C8CA 1FPN3 4YVSB 1AYM3 1R093 2HWC3 4RQPC 3J8F1 5L7OC 1PIV2 4CDQB 2RS52 5JZGA 4YVWA 1VBC3 4Q4X3 1RB8G 2HWB2 5AC91 3NAPB 5D8AA 1RUJ3 1EAH3 2R062 1EV13
chains in the Genus database with same CATH superfamily
2ZJCA 1WCKA 5DAVA 1VMFA 1VBB1 2XJUA 1I9RA 3LDKA 3ZXFA 4CDUB 3ENRA 1LRHA 2HBUA 1R092 2HWC2 3CKHA 1NLRA 3NMBA 3VB9A 2PAMA 2DV9A 4Y1XA 1HDKA 1YWKA 2B45X 1NCQB 3M3EA 2R043 3H42B 5HV4A 2HLEA 3MF9A 4A3ZA 5LY2A 4BIOA 1NE6A 1NXMA 1UYPA 1S0GA 2D43A 4GWIA 1JI6A 5FMOS 1RINA 2R1BA 5DDJ3 1W8OA 4HG6B 4NMIA 2IXKA 1AR72 1ULGA 4B7EA 2ZABA 4UOJA 4IGOA 3WNLA 3HIFA 1V6IA 4KI5M 4O61A 1F8VA 2WQZC 1HRI3 1MZFA 5ANNA 3U0ZA 1UIJA 1BEV3 3POWA 4RQPB 1VB2A 1W90A 3IMMA 4YGDA 4P9IA 4ISQA 5AFEA 3POSA 4CDQC 4MGYE 3HPNA 2VG9A 5I8TA 1UZZA 4ZONA 4QXKA 5FJHA 2XUMA 1W0OA 2Y38A 5JXJA 3KWVA 5IK5A 4JGZA 3RWNA 1PZ7A 1VMHA 3PUSA 4UXAA 1AR93 2XLAA 1Z7S2 3C7HA 3W9AA 1ASJ2 4URAA 5T5OA 3K4DA 1NX9A 5B4XA 2GMMA 2EXJA 4BU2A 1IZ3A 4E2SA 2ZGNA 2WN3A 2FCUA 4E9KA 1X82A 3A0NA 4MXWB 1P8JA 1WD4A 1OA2A 4WVZA 3VZLA 1UWWA 2O8QA 3EMRA 1UMZA 4GMP0 4BPZA 1LAJA 2XBO1 4LUMA 2FQPA 4KG0A 3I3QA 3K4ZA 4AK3A 1O59A 3K3OA 5D8AC 3U4SA 4E4SA 5E88A 2RS11 2XMLA 5FTTC 2NPIA 5C33A 2MEV1 3LDRA 4YVWC 5FJKA 5EZWA 4KWKA 4AEKA 4RR3B 2PHRA 1POV0 2EIEA 2GC1A 2LROA 1UU6A 4DFSA 5IVJA 4RQPA 5DUXA 2E51A 1UY4A 1Q8PA 4KWLA 4YG3A 1SLAA 1EAH1 4FVVA 3GZAA 1C57A 2AC1A 3AM2A 3KQ4B 3LFMA 2LRPA 3POBA 4FFHA 2JB8A 1DDLA 2GP5A 3LDBA 4OHXA 1CIWA 4ONUA 5FZOB 1NA1A 3PVBB 1YFUA 5C4WC 5KBFA 3LSDA 4LUKA 4Y4RA 4QHZA 2VH9A 4PCRA 3ILRA 5IAXA 3I54A 1E5HA 2A73B 3GM8A 1VBE1 2JJ6A 1WMDA 4NIAA 3GZUC 4IL7A 4Q4Y1 1R1A3 3D6EA 3VHPA 4FP2A 4NRMA 4FQ4A 1RUG1 3BGAA 2YFZA 2B8MA 1QJU1 3WF2A 2HWE1 4HZFA 1RYYA 2R32A 3MDPA 3I3EA 1COV1 1W6NA 5EYXA 5F5IA 5JOZA 1PGL2 1REFA 2WYFA 3AZXA 1OF4A 1FMD2 5BNQA 4LBMA 1RXGA 1VAMA 3O1TA 1O4TA 4EROA 5KXBA 1UMIA 4BMEA 3C3VA 4IE5A 1RJ7A 3TNQA 4XF9A 3ZR6A 4NHLA 1WMEA 3Q8CA 3ROUA 2JDMA 5BNNB 3U37A 3I7DA 5F8PA 1QGLA 1ZA4A 1S0DA 3RFRA 3VBHC 1QXPA 1AR81 1YFXA 4IE6A 2VC9A 2WA3A 3A0KA 5GLTA 5IW0A 4CEWA 2R042 3CHXA 5I93A 3S5QA 5BYNA 1W0PA 2DFCA 4CU7A 2JDHA 4EN7B 2PXJA 1RUD2 2PELA 2YGMA 1GNHA 1AXKA 2ZX1A 1RUE3 1BMV2 4OHWA 3O14A 1SCRA 4UFLA 5F2WA 4OYUA 2W5FA 3U07A 5I0RA 3R4UA 4Q1PA 5FY7A 4OMDA 2E63A 1Q43A 2LTNA 2ZEZA 3LF7A 4DXRA 2UY8A 4MADA 5CIRA 4PHZA 4NE9A 4UW4A 1ZZ9A 4CCNA 1G9BA 1F4AA 4ZXEA 2DVDA 3K46A 1TMF3 3PTRB 4BK5A 1U0AA 1NQDA 5FY4A 4Z2AA 2WRAA 2EICA 4IEQA 5FPAA 4MGIE 4RD7A 4MGTA 3V64A 1ZREA 1W8HA 5DAQA 5FFOC 1CPNA 2G4IA 2XPJA 1JOJA 2GH2A 2XJRA 5EJ3A 1SHWB 3HBZA 3WW3A 3KHCA 2VZVA 1WLCA 5C3QA 5HXMA 1Z7S1 2KA3A 4EN9B 2VQUA 5BUVA 4JQRA 4CDUC 3KSCA 1UXZA 4AHXA 1WKYA 4E4ZA 3VBOC 5FXZA 1U5XA 1HJGA 3N9MA 1NCRC 1OQ1A 3IAQA 1UY2A 1Z0HA 3IKWA 5LB6A 2W9XA 4YSFA 4AQSA 3S5AA 5FUNA 4HLTA 1DZTA 3LOIA 4FXGB 4XBLA 3RYPA 2DUPA 1URXA 5FYYA 5FZBA 4AVSA 3VBOB 5BNPB 4OQ9A 1ZRCA 1IPKA 1QOTA 1WCSA 3OD0A 1GMMA 2PAEA 3WG2A 5LEKA 2VGDA 5IYYA 2D3PA 3MFCA 4HSLA 1TMF1 3BB6A 4IV3B 1CAWB 5FO9B 4CP9B 4UF0B 1S0EA 2WFF2 1OQDA 2VZ3A 3ETQA 3I2JA 3P5BA 2UYAA 4XXAA 1AR91 1E5RA 2ZCWA 1BVP1 1VMJA 2E9QA 1EAH2 1QWRA 2JDZA 3T0BA 1OH4A 4TYSA 5J09A 1JYIA 5IK7A 2WT1A 1TNFA 1VRH1 2BGCA 4NIGA 1CZVA 3FJSA 3WY6A 3MGUA 4A41A 3VHRA 1BCXA 1S0FA 1TME2 2YBKA 2YHJA 2KD7A 2WKKA 3ILNA 5FOBB 5CADA 3NV4A 3E97A 5LBCA 1UXXX 5JDBA 2CY6A 4LEJA 3ZFEB 1UOGA 4Q4Y2 5CZKA 5BNNC 1O7FA 2R16A 1NY72 1O5LA 2DFBA 3AFGA 5LBFA 1MS5A 4QGLA 1RUG2 3RMXA 3VBSA 3NAPA 5D8AB 3JXSA 4AFAA 4CCEA 3FX3A 2Y0OA 3BCWA 4YVSC 3HD8B 2VZTA 1QNWA 3KZ4C 2RR12 2YMZA 4E27A 4AFBA 1YHFA 4BB3A 4Q5OA 3OGJA 1NA1B 1JZ3A 2A6WA 1JYWA 4MO3M 3AK0A 1X8EA 5A3UA 4MG2A 2PHDA 3KT7A 3L2HA 2QQNA 4JCKA 1JYNA 3PUAA 3ZXKA 1VAKA 2X05A 4SBVA 2BTVC 5ISLA 3M3QA 1J58A 1AR82 1VAVA 3GNEA 3D0SA 3HNYM 4XF4A 4YZ5A 5C4WB 1RVF2 4ARXA 1LB2A 5C9AA 2F17A 5I0DA 5KC5A 1Q8VA 4RHV3 5A3LA 1PX3A 3J4UH 2BERA 2V72A 1F15A 1CZSA 1CAWA 2Q8DA 5JPNB 1XE8A 3NO8A 5FZKA 1CX1A 1RMU2 3IIIA 5FPLA 1OOPA 1UX7A 1W8WA 3LA2A 1ENSA 3HMYA 3L9JT 5E8AA 3I3BA 3SCGA 1KXGA 1PO21 4AHYA 3EQEA 1OQEA 1MZ6A 4J25A 3LGRA 5EHDA 2ZX0A 1VBD1 2V4VA 4CZSA 4FPOB 1WW5A 2PLV3 3VDAA 4COVA 4MHUA 3ALQA 2DVBA 5FOJB 2IUWA 1FOD3 1QY4A 1XOYA 2ZGKA 2CYFA 4Q29A 3LOBA 4HKOA 1JH5A 4OHZA 5JXGA 2WZR2 4M0NA 1UKGA 2R1DA 3WR0A 2VMHA 4CVUA 2C4XA 1GP4A 1OLMA 3SHRA 5CFDC 5ERLA 4COWA 1S55A 1X7NA 3GHNA 1E5SA 1PIV3 4QPGC 4CEYC 3CL1A 2WS91 2OW4A 4YZ3A 1RL3A 3ZDVA 1QDOA 4Q0SA 2A7AA 1REDA 1ST8A 4PIZA 3TNPB 2JG9A 2MNGA 1LESA 1GOFA 3LEIA 4NIDA 2VCBA 4CP9A 4I30A 3RZMA 4LO6B 2ZZQA 4XW3A 3MPPG 3SNMA 1F31A 3MPBA 1PNGA 4LHNA 2CTVA 4JKKA 4PDWB 2Y34A 1VBD3 2VOWA 3K4AA 4IEPA 3VL9A 4WVMB 1Y9MA 2YGLA 3K2OA 4QGMA 2YU1A 4LKEA 5GZFA 3WQ0A 3R4DB 1D4M3 3S30A 3VBFC 3I3MA 1YC61 2KXLA 1X36A 2E32A 4P02B 3ZR5A 1VBA2 1T6BX 2FD8A 1DYKA 1VRH2 3HR9A 5E6HA 3UT0A 5HV0A 1XBFA 1EV12 2CSGA 3BN6A 5F5QA 3RZGA 1CAUA 4CPBD 3JD73 1GWKA 4HANA 4LBQB 5C6CA 4FSJA 2DDUA 2IXLA 2GALA 2VMCA 1W9SA 2YG0A 1N1SA 4NROA 3WXPA 4CTEA 1HN0A 5BV6A 1QJY3 2B5HA 3ATGA 2YC0A 1ASJ1 4GKYA 4JHZA 5GLVA 3VGIA 4AEMA 3CMGA 1XNCA 1O3SA 1JS9A 2WSVA 4N7UA 5GLUA 3AJYA 3WNOA 1W6NB 1T2XA 3MLKA 3N7MA 3N9QA 5FY9A 4S2GA 5BY5A 3I2DA 1Y7BA 4NPMA 4XETA 4CEYB 4JDMA 2NQYA 3VKOA 4COZA 2GNTA 4BZ4A 1SBDA 2ZKNA 1N1VA 3N36A 5M0TA 4FCAA 2XBO2 4AAPA 2AEZA 3OUHA 3B9CA 2K2SA 5DABA 1V70A 3NVCA 2E7TA 4PDWA 4Y22B 5FAXA 1CONA 1UYXA 3VZKA 1DYOA 1AVBA 2B39A 2Y33A 3T2PA 3ZKUA 3AL5A 4CXWA 3SISA 5IVVA 4SLIA 1ODNA 1UMHA 3NV2A 4K9SA 4LIUA 4Y5TA 1VBC2 2G9GA 2V5DA 3WP4A 1QMJA 2Y60A 2OXBA 2XL7A 3J7NA 4HN0A 4HPKB 4IV3C 4OUMA 5K4LA 5C9AB 1H1MA 2H0BA 3DGTA 1GOGA 4XOGA 4XZPA 4DS0A 2E7QA 1G9FA 4ISRA 4JTNA 3O1VA 1ZRFA 5J98B 2QVSB 2Q8EA 3H8UA 3ZSEA 4OZOA 1H30A 1SBEA 4LQRA 1GKBA 4RR3A 5LA1A 3BU0A 5F2SA 1LOEA 1YNAA 2A6XA 1S1AA 3NNJA 1F35A 4BXFA 3VHNA 5FY1A 3GF6A 1IG0A 4EN8B 4WV8A 1GZWA 1LENA 1NUKA 4DINB 2VL4A 2SLIA 2JENA 3M8LA 4UT5A 1F2NA 3PU3A 4OHVA 4DXTA 3CDZB 3H8OA 2E53A 2ZHLA 4A7YA 3HAGA 1VBD2 1LEMA 1UOFA 3M4FA 1QJU2 1RUC3 4MXWA 3E6CC 4JGYC 1COV2 3T4HB 2WZR3 3M7AA 3ZYBA 2B9VA 1FMD1 2JD4A 2IXJA 1QJX1 4B1LA 5GLZA 2ORZA 1ZBE2 2AYHA 3IIAA 4RGGA 3WP3A 4AGVA 2WZR1 2Q1MA 2OT7A 2Q1FA 4YWAA 1UF2C 3DN7A 1PK6C 2BVBA 3BYWA 5T5PA 1PK6A 5C8CB 4K20A 4W6YA 1GICA 3VDDB 4Y26A 3C7GA 3I49A 2QQJA 2D6LX 2PMWB 1N3PA 1RC6A 2WS92 4XXPA 2PHXA 3T3YA 3ZDSA 1IPSA 1I5PA 1EUTA 5FMBA 4I0BA 4NAOA 2XJPA 3LWCA 1W8NA 5A7SA 2R041 2Q0AA 4NHMA 4KWUA 1SDWA 4HVQA 5F7UA 4NUBA 4CE8A 3AXEA 2K46A 4QM8A 1LR5A 5C8CC 3BOWA 3K77A 1RUD1 1OVSA 2DCTA 4WBBA 1PM4A 1FOD1 3BTYA 4PF1A 5FYVA 2DUOA 1ULFA 4JGYA 1W9TA 4FOVA 2D6KA 5FKBA 2AGSA 2XQRA 3TBDA 1FV2A 4J6GA 4YVSB 2XHNA 5CA6A 5A6XA 1S0BA 2RJKA 1OSGA 1S0IA 2A70A 1GP6A 4KBBA 3AX4A 5JSOA 4MZUA 2G9ZA 2Q4SA 1W99A 2WUHA 3H3ZA 1DG6A 3ZXLA 4ZPIA 1VBC3 2JDNA 3KMHA 3WNNA 2A6VA 2G9FA 4GWJA 4RYDA 1EAH3 1E5IA 4XHXA 3THTA 1ASJ3 2UWAA 3NNFA 5CU1A 3VBHB 1BZWA 1XE0A 4CCOA 3T2TA 4FFGA 1NKGA 4PLNA 4NR1A 1JW6A 3I2KA 4QQLA 1UZYA 5FXVA 3WNMA 3RG0A 3J8F3 1GOHA 1AL22 3D4KA 4XJ9A 2VQ0A 1LOCA 1J84A 5DDJ2 4CDXC 3MW4A 1H6YA 1HKDA 3THCA 5C3PA 5C70A 3H1MA 2FCTA 3WDVA 2CNAA 3LD8A 3BVCA 1WCQA 1SG3A 2VOVA 1W8TA 4META 4FFIA 2BVVA 4K21A 4QMAA 1XRUA 2BOIA 3DPRC 4GMP3 4C0HA 1EPWA 2R30A 5KHIA 2LS6A 4NPLA 1WLDA 1JZ2A 1JBCA 4WM7B 1NCRA 5EFUA 1OLME 2WFF1 5C3SA 3S0MA 1VBC1 5FREA 1RUNA 4UYBA 2E31A 3PMEA 4YW2A 4M3CF 3VBOA 4QDSA 1AR92 4DMIA 2ZGLA 3URFA 2WZEA 3NW4A 3ZMOA 3P6BA 1ZZ6A 2WAAA 3MHZA 4QX0A 3BIEA 2FDFA 1WD3A 4CXXA 1D2QA 5FBJA 4L8QA 1CGPA 2ADDA 1HJFA 4BXSV 2YV8A 2GDFA 4XQWA 5GZGA 2WQ8A 3H8XA 3FUOA 3BUCA 2W2IA 4H14A 1OMIA 1K42A 3UK9A 1QJEA 1PMJX 2BNNA 4JX0A 1WWYA 4XUQA 5E1RA 5A3WA 3MIFA 4I2OA 2NMOA 4U2AA 4QAWA 3SH5A 1NLSA 3OB8A 2BEOA 5A3TA 3N9PA 4FP3A 5FXXA 3SITA 3UV9A 4LO8A 5CYYA 1V9U2 2VVEA 1RUG3 4XFFA 1DGRA 4C1XA 4NJ4A 4CDQA 5H9RA 2GNDA 3FN9A 2JKXA 5LWBA 1SLBA 5CAZA 1C5IA 1W3VA 1S2KA 4K8RB 4LBJA 3BIWE 3MEPA 3ZFFA 1MVEA 3G6JB 1PZ8A 4XFGA 1US2A 4HMZA 2RMU3 4TSVA 4LMFA 3JZVA 5A3OA 2ZX3A 1QJX2 3LQCA 1O5UA 4GH4C 1AX1A 1ZBE1 3ZXAC 1UYYA 4B4PA 5IWFA 5L36A 3IZOA 4BLIA 1V00A 1Q8OA 3KGLA 3OYWB 4XE9A 3KHBA 2XONA 4HVOA 4XACA 5F1RA 4TN7A 5IVYA 3I59B 4A6OA 2W1QA 4IV1A 2JG9B 4CU8A 2R49A 3E5XA 4LBNA 4P9WA 3UKVA 1ZRDA 2D40A 5CEHA 1QNYA 1RVF1 4LOSA 2VD7A 1W6QA 4AI3A 1ND3B 5EJ1B 3GGLA 4YM3A 2NMNA 1FPN2 2XWBB 1FOD2 4BQXA 3EBRA 4YW5A 1XNBA 2OQ6A 3WW4A 4XYXA 5F3IA 3POIA 2C6SA 1OURA 4A42A 2B46X 2J1RA 4YW7A 1C3HA 3D0JA 1VLNA 5LATA 3OF1A 4L9BA 3CEWA 2A3YA 1PO22 2B4KA 3I2HA 2WN2A 5I0UA 1I5ZA 2EVXA 1TG7A 2C5DA 2JDYA 3RNSA 1XC6A 3MBWA 4CUGA 3UNPA 3DV8A 4QU2A 1ZZCA 2DU1A 1OLRA 1G86A 1ZRRA 1YQ2A 4P9XA 4QXCA 4COYA 3BI3A 3NWKA 2BPA2 1HB3A 2WAOA 4IV1C 1W6MB 4H3WA 4HN1A 1VRH3 5K8SA 5DUUA 2OX0A 2PFWA 3ZKYA 3AKQA 1KJRA 1PVXA 2JDAA 3KV9A 3KT4A 3ZN4A 1A8DA 1MQTA 2RS13 5FR3A 1DQ1A 2HWF3 2W39A 4ZU5A 5DDJ1 5HCBA 1XSRA 4GJYA 3B00A 5LZ6A 3G7DA 2XBO3 5A70A 4IGPA 2XGXA 3K3NA 3OCPA 2OYZA 2C0ZA 1W0NA 3ZVXA 3PJQA 3SQOA 3CBNA 4I09A 5A3PA 4K40A 4IEUA 5HXVA 1W8UA 1A34A 3INAA 3N4MA 5L9RA 2CDPA 3NAPC 4Y4YA 4A7ZA 1TVGA 3QCWA 2XKPA 3NV1A 4P5YA 2A5ZA 5J37A 3VZMA 2RS51 2XVGA 2Z2SB 5FYZA 4I01A 5FZ8A 2QJVA 2GN7A 5FP3A 4JGZC 3FC0A 3MUY1 1VBA1 4LHSA 2JXAA 1MS4A 1DLCA 1MS1A 1D2SA 1EV11 1AR63 1UO9A 3AYCA 4YNIA 5T55A 5JI9A 3ZYGA 2JB4A 4GH4A 3WUCA 3PURA 2XXZA 1AYN1 3PLQA 2P34A 2HWE3 1IS5A 1LHWA 3T0AA 5FZIA 5IFPA 1RUF2 1WCUA 2TNFA 1V9U1 2YFUA 2D7FA 2BOJA 2D98A 2EIGA 2Z69A 2C26A 2GN3A 3KT1A 1F5JA 5DZFA 2ORXA 3O0VA 1BXHA 1YFYA 4IEZA 2YROA 5H9SA 4O9EA 5D2AA 1ZZ8A 4X6RB 5FY5A 3RWKX 3CO2A 5G04L 1XE7A 3H3LA 3WG4A 2X53S 1VBB3 1FAYA 3EYPA 4LBLA 3ZFGC 4QWNA 3Q8EA 2FMDA 3AYAA 1LKNA 3OUJA 3USSA 4QDQA 1L7QA 1B09A 2LALA 2V73A 4JRLA 2VW2A 1ODMA 2A3WA 4ZY9A 4FI9A 1G9DA 4YLZA 4CXYA 1QH6A 2YUEA 1QF3A 2TEPA 4PI0A 1U5YA 1UD1A 1HV0A 1FYUA 2KM2A 1QQP3 2D44A 2GP3A 3DYOA 3NNGA 4ES8A 5A32B 1SFNA 1PMIA 4CDUA 1X9PA 2CL2A 2R0FA 1Q8SA 5FYCA 5LASA 1W2NA 3PNAA 1D7PM 1RUJ2 2JE7A 3H1WA 1D0GA 4OULA 1TEIA 5LA9A 1FPN1 5C3OA 1HW5A 3KV6A 4EN0A 4UFKA 3K48A 3SEPA 4AI8A 1BEV1 3U4XA 4QKNA 1OT5A 2J42A 3U14A 3W58A 1WUVA 1XPWA 2HEWF 2OZ6A 2W47A 3OG2A 4ORFA 5F3GA 2ZACA 1AJKA 3KS7A 4F7ZA 2DTYA 1W03A 3M1HA 4LR4A 2JG8B 1S2EA 2VZQA 3RJRA 3VD7A 4OHYA 4IERA 4P5HA 3WDTA 3KGZA 5FZ6A 2DURA 2DYCA 4XJWA 4WM8C 3AYDA 5IVFA 3LAGA 5CB7A 3PU8A 5JUVA 3VLBB 5IVCA 5GALA 1UQXA 1AR83 5JPMB 4IW3A 3T4VA 1OFNA 2XG3A 1GV9A 1MQTC 4HXCA 5IFTA 1IGOA 3BPSA 3Q8AA 2ZS6B 4Q0VA 3QACA 3CF6E 4AVTA 3AVRA 4XJ8A 4GB32 4O65A 3J9SA 4AW7A 5GZEA 1B35A 5HCHA 5FYBA 4CCMA 3AMNA 2G19A 3TRSB 3T30A 1H2KA 1IPJA 1BBT1 4M4RA 3TN91 2JD9A 2MEV3 4IV1B 4N53A 4EYUA 4N53C 4W4ZA 4D3WA 2X29A 2VMFA 1K5JA 4N9IA 3AFKA 3MLJA 4R9DA 2R071 5LBEA 5A80A 2P3JA 4Z8BA 5JMCA 4BK4A 4G9SB 5DAWA 2JIGA 2WNUC 3RZJA 2BZDA 1VR3A 2VPVA 4XMIA 3AL6A 4LK7A 4AE2A 5F39A 3ZFGB 2QQLA 4IEXA 4E8DA 5CG9A 3ZFFB 2P1BA 1UOJA 5IVBA 1XU2A 1UU5A 3PDQA 1U5ZA 2XHKA 3J7LA 1A6CA 2Y6GA 3ZSKA 4LHKA 1VBA3 3ZYPA 4CDXB 5FP9A 1EUUA 3P3NA 3AJZA 1G8WA 2NLRA 4FPYA 3BODA 4QX8A 4W50A 4AI2A 5L19A 4WM8A 4V1PA 2WZPP 2NN8A 3JD72 2QQVA 3RDIA 4D6SA 3WINE 3WW2A 3FHAA 1W3XA 3RZZA 1Y4WA 1NG0A 3WX5A 1NAEA 5FDBA 4YG0A 2BGOA 2DCJA 2X09A 3DCQA 4MVTA 4QB1A 4IE4A 1H1IA 2V4AA 3OGGA 4HSJA 4RFT0 4U36A 4YFWA 5JOWA 4OQ8A 1M06G 4RN5A 3OPZA 1RUF1 3TYJA 4NIIA 5IUQA 1G6NA 1AL21 2W1UA 5A32A 3PMSA 4HBNA 4UWDA 1OC1A 4R9CA 5EV7A 3O1OA 5I91A 4P00B 3POJA 2IFRA 2EF6A 5L9BA 1UKRA 4ET7A 4H7MA 2AEYA 1GU3A 1PGSA 2ENRA 3CJXA 3VBFB 3MW2A 3TEXA 1MEC1 2JEMA 4X8PA 5CISA 3PHMA 4RS5C 1RUH3 1W9YA 3DKQA 4Z1VA 2EAKA 3NJXA 4ZS2A 2Y26A 4EN6B 2RM22 3VHOA 4AFDA 2Z4FA 3MICA 4GD4A 1UL9A 5A7PA 5LK7B 1O8PA 4CPBA 3CIHA 2LW8A 2P37A 2OUHA 4MUVA 2A6YA 3V0AA 2QQMA 4WVWA 1UN1A 4J1XA 5DAPA 4XDOA 4Y20A 3I2IA 4BDVB 4YW1A 4S2FA 3LEKA 4EWAA 4NHKA 3FBYA 2GZWA 4OCTA 1DP0A 3IMNA 2BBVA 4H7LA 2WNVC 3FLPA 4L2NA 5FXWA 5BNPC 1RUJ1 3VL8A 3HEIA 1YLLA 2P3KA 2OS2A 1C28A 2ZAAA 3OBRA 1BEV2 4C1WA 2GU9A 2CGOA 5D21A 3U10A 3VBUC 3BTAA 1OBNA 1H8TA 2W68A 2OPKA 4FAGA 3HVDA 1F4HA 3A7QA 2CHHA 3ST7A 2VM9A 1XB9A 4IE0A 2IXIA 4AGRA 1KFXL 2ZGMA 5FP4A 1RTVA 3IB3A 3MLLA 2PHWA 4QQOA 1K45A 1KITA 1JYXA 3B7MA 3KB5A 4K3UA 4M3CB 4QHOA 1IKPA 3QH6A 5FMCA 1QJFA 4QPGA 5FZFA 3UGFA 4BH9A 4XUPA 4ATFA 5I8YA 1ENXA 1H6XA 3B5LB 3GJBA 1YIFA 1VP6A 2X10A 3OTFA 4B4RA 3EJKA 4YFZA 1KD7A 1RHI3 1J3QA 2VCCA 3GCWA 5ANQA 4R8HA 3VBFA 1H9PA 3ZFEC 4Z2WA 4XAAA 2PN5A 1LHOA 4QKBA 1O4ZA 1BBT2 2RS33 4CRQA 5FLJA 5KHHA 3BTXA 2VTXJ 2WO2A 3RVHA 3HOBA 4M00A 2P2KA 2ZMKA 2XL9A 1V6KA 4RS5A 2WO7A 5FZMA 2WNOA 4INDA 5C5TA 2VCMA 2UWBA 4DY3A 4MGSA 5FPVA 4YM0A 3Q9OA 2GH8A 2PHFA 1KGYA 1TNRA 2DWRA 1MPXA 5A1AA 4MV2A 1AL0G 3Q8BA 4KWJA 1CAVA 2VNVA 4KL1A 4XIOA 3VBRA 3ACGA 3KCCA 3SCHA 4XIKA 4QXBA 1HV1A 2L9LA 3WCSA 3P1IA 4IXLA 5J3UA 4GULA 3VD3A 1J1LA 2WZ8A 5LCWL 2F6BA 1H2LA 4XUTA 1PZ9A 3HBKA 4GXLA 4R52A 3JD71 5FY8A 4WVVA 2H6BA 1LOFC 3OEBA 4LE4A 4EV0A 3ME2A 4JC1A 4OFGA 2BGPA 1XNTA 1HXS1 1QIQA 3RS6A 3N9LA 3UGGA 3UJQA 3VKMA 1H0BA 2YBPA 3ACHA 3WQBA 2QKDA 2CGNA 3AMHA 2WNUA 5L7OA 4JKLA 4FPJA 5FYIA 1BQPA 4L92A 2A71A 2X5IA 3WG3A 3CZJA 4FTBA 2Y6LA 1QXRA 2NZ9A 3KCYA 1H4HA 2Q30A 3ZM8A 1PX4A 2P4EA 4R9AA 3WLUA 1IOAA 2RM21 3W21A 4RL7A 3D5OA 3H8RA 2ARBA 4BWOA 2HWC3 1R093 2EALA 3LKJA 1DLLA 2ZEXA 3ZXEA 2RJ2A 5L7OC 1FNYA 3V56A 4AVVA 5KXDA 1KFUL 2RS52 3M3OA 3N35A 3HNBM 5GM0A 3SKJE 4Q2FA 1UYZA 3OPTA 1JZ5A 3BTZA 3OEAA 4QKFA 5FLIA 4DQAA 2BDRA 4PBOA 4HK8A 4FPHA 3IBMA 4QQHA 1RUJ3 3ZX7A 3MF6A 4CCKA 2GNBA 4E2QA 1HRV2 1JZ7A 1U5IA 1WCDJ 3DECA 1GQHA 3T1MA 4HKLA 4XAEA 1XNKA 1QQP2 3VD4A 3V0BA 1AYN2 1LECA 4F83A 5FZLA 4AHWA 2J1AA 2YZ4A 1OF3A 3APBA 4HK9A 5FYHA 4LBKA 3ZXDA 1KS5A 2AR6A 1VRBA 3ZN5A 4CCDA 2JDUA 4HOOA 1NOVA 3T2OA 1WW4A 4WVMA 2VUDA 2RJLA 4K6BA 4DB5A 4MX3A 2O0OA 3A23A 1KRIA 1U12A 5FIXA 4IEOA 1N1YA 3OPWA 2ZGUA 4LULA 4QQPA 4E2GA 3HN1A 4AEDC 2Q8CA 1CAXA 4MGQA 1JHNA 3IDBB 2NYYA 3TWIA 1F5FA 1CESA 4M3CA 4N90A 3SEEA 2YU2A 4H2AA 4DNYA 2RS31 3POEA 4UFMA 1YJKA 4GAZA 3N3HA 1GZTA 4GWNA 3RJ2X 1CX4A 4AG4A 4XDPA 1CAVB 3ZIWA 4GA9A 5FZHA 2D6NA 4XVHA 4Q0UA 3SH3A 1Q8QA 2C9KA 5IVEA 5DPNA 2FDGA 1OUSA 1RXFA 1AF9A 4G4FA 3VZOA 4KU7A 1LHVA 2VOTA 4AZZA 3THDA 4GH4B 1ND2A 1STMA 1XU1A 2XJQA 3AZZA 4BYYA 4LLFA 3LCPA 1W8FA 2YY1A 1YXWA 4GKXA 1AYM1 4Q27A 2DVFA 3JBG3 3O5SA 3QOPA 5EPAA 2XQXA 1UW8A 3AKTA 5A33A 3NV3A 4YGCA 4BCUA 5JMOA 1MZ5A 3PUHA 5A6YA 5LEJA 4XTMA 4Y1YA 3DPRB 3FMGA 3LFIA 3QH7A 1DQ2A 5FPBA 3V0AB 2XOMA 2WWSA 5CFDA 3F2ZA 2I2SA 2ZEWA 4GB33 1DQ4A 3OBZA 3WNXA 2I07B 4GWMA 3S57A 3U11A 4QPGB 1W2UA 5F9TA 2EIDA 3HQUA 1X50A 4GB31 2WR9A 2W3JA 4LA3A 4LKDA 4LBQD 4XDQA 1DU3D 5K7PA 3W59A 3SCFA 2VOXA 3VD5A 5A33B 3WOGA 4IQPA 2W95A 4AVCA 3TN92 3O1RA 1IKQA 3B3QE 3FFZA 5FCCA 1H8TB 2P17A 4MH0E 1JYVA 1QDCA 2RM23 2YYOA 2VXRA 2WO1A 3ZYFA 2R072 5JR2A 3GCXA 4FPFA 4YZ1A 2J22A 3I2GA 5IAVA 2VZOA 5JZGC 1NE4A 1S4CA 1GNYA 1OI6A 4BE3A 3Q8FA 4AEDB 4TXWA 1RUH2 2XLFA 2F4LA 4ASMB 1POV3 2GMPA 4YG6A 1LOAA 4WZCA 1Y43B 5EWSA 1NA1C 2XDVA 2WO3A 2IC1A 2VUAA 2XR4A 2ILMA 4X6QB 4XBNA 4Y33A 1ZBA2 5DUVA 1UAIA 1YCIA 2C24A 2VOKA 3NJYA 5K0UA 2FCVA 2A6ZA 1K3IA 4PIXA 3T09A 1FI2A 1HRV1 3DXTA 4FO9A 5KXCA 4R4XA 3LB9A 1YEWA 4LPLA 4Y3OA 3FHIB 1CAXB 1QQP1 1C8M2 3WP5A 1ENQA 3KVAA 1DGLA 5A6QA 4D7YA 2B7YA 1K5MA 3JQXA 3CJIB 5I8SA 2K0GA 3OY8B 5A7NA 3RZKA 2XH6A 2OQ7A 5FZGA 1DHKB 1OFSA 2AH2A 1W28A 3MYXA 1ND3A 4QPWA 5HI0A 2A1XA 2CAUA 3D82A 3PVNA 2ARXA 4FT8A 4EE2A 2GC2A 5A7WA 1UX6A 1ENRA 1DCSA 2X5IB 3RYKA 5JI7A 4M3CE 1GUIA 4D0QA 4XHBA 3NNLA 1V6LA 4P9YA 4XC9A 4YM1A 5CVRA 1MEC2 2EIBA 4I02A 2G1MA 2VAUA 4I3GA 4IV3A 4DUWA 1MS9A 4XMAA 4QXHA 2VZRA 5BNNA 3GZTB 1PIV1 1YI9A 4XJAA 2VZSA 4NIHA 4UFIA 5C9AC 1YRZA 2R7EB 3LIHA 3PTYA 4FPEA 5JIAA 3DYPA 3POGA 1GP5A 1MS3A 1B35C 1YJLA 2Y6KA 5EP9A 4PDWC 5FQ0B 4LIVA 4ASKA 1QJZA 1POQA 2R061 2DUQA 4FPCA 1BLZA 4CUBA 5K0UB 4DO0A 1KJLA 1RHI2 5GLWA 1S0JA 4XILA 3IM0A 4FPLA 4NVPA 1CZTA 3MV01 4K1ZA 4IGQA 5CFCC 3FE5A 2GNMA 4D6RA 1H8TC 1KQRA 1DFQA 3HQXA 2J7MA 2ETEA 1RJ8A 1IQDC 1XYOA 2LM3A 1XSQA 3ES4A 2MHFA 1MACA 3FWEA 2B9UA 1CVNA 5KHJA 1CAUB 3ZXJA 2VBBA 3O7OA 4TLGA 3SC7X 5DMYA 2QCSB 2BFUL 1IHMA 2WNVA 4DOUA 1AYM2 1Y9GA 4Q8LA 2HH9A 4R9BA 3VZNA 4Q0QA 5L9VA 4A2UA 1HB2A 3VV1A 1YI7A 2H0VA 4MHRA 2FHRA 3ORJA 2W46A 3AKPA 2ZGRA 1NXD1 1AXYA 2VW0A 3ZMNA 2VQTA 3RQ0A 4LA2A 3WNKA 4YM2A 3CJIA 4QX1A 3IPVA 4NRQA 4XQDA 1UCXA 1YQ8A 2D97A 2FDJA 4K8FA 1O4YA 4NO4A 1LTEA 1E57A 5CFCA 1PHMA 3DPRA 3DXUA 5F32A 2RR13 3GDBA 2R073 1YYNA 2AZ5A 2J1EA 3ZYRA 5FO7B 1CWPA 1GQPA 2WFF3 5JOYA 2W1SA 3WVJA 3ZYIB 1RUC1 3USUB 1WMXA 5I0SA 1UZWA 3AC0A 4Q4V1 1BVVA 1OVPA 2ZHNA 4QHBA 2PYTA 3VUOA 1OA3A 1XYNA 4Q4V3 2DBNA 1O8SA 5E16A 1RUH1 4LO4B 5C7GA 1RUI3 4W65A 4AR2A 2VMIA 5HBAA 3WUDA 1HB4A 5J7MA 3MIEA 3USUA 3HN3A 2DCYA 3ZO0B 5FP8A 3ABZA 1I6XA 1ZBA1 1JZ4A 4AI9A 2AUYA 1WA6X 4PLOA 3ACLA 2ZBJA 5T54A 1OPMA 1V9U3 1SDDB 1GYKA 2HYKA 5CNAA 1O91A 3OD4A 4XFCA 4CSWA 3FHQA 1ND3C 1OPOA 2ZX2A 1SLCA 3JCIA 5FLHA 4YW4A 1JU3A 4BA6A 1C8M1 1ULOA 1R1ZA 3D8CA 1TE1B 1OOPC 1HXS2 2E7AA 1K5MC 2JE9A 3GYDA 1IS6A 4KQ7A 1W39A 5FV3A 2VW1A 3UETA 4AYUA 3AP9A 4IEYA 3TEWA 2WLQA 1COV3 4OZXA 3ZPYA 2XJSA 1CN1A 3ZSMA 2W87A 4A6SA 4JHTA 4QT6A 4UW6A 2JX9A 5BNOA 1CQ9A 1ZBE3 3GBGA 2GAUA 5HCAA 4DRVA 5FRAA 1NLQA 5JIUA 2RV9A 1MQTB 5ABJA 1YIPA 5BPXA 3C7FA 2BFUS 2WNVB 4UW5A 2QTWB 2PQSA 1BJQA 3AYEA 5FYTA 3UKNA 3WNPA 1LHNA 3AP5A 3B01A 2HEYF 2ZZJA 3JBG1 3B02A 3C7OA 2PAKA 3ECQA 1W6MA 1EY2A 1N3QA 1HQLA 4QB2A 3ILFA 1ULDA 5APAA 3HQRA 1IS4A 1HQWA 4FBFA 3V0BB 1AYN3 2VECA 2Y8KA 4ZXKA 1RGSA 5K9YA 2OZJA 2WNEA 2ZHKA 4FPGA 4WM8B 4AI0A 1RHI1 1MS0A 4Q8KA 4LO7A 5F6KA 2DVAA 5I0TA 3VBSC 5J48A 1LOBA 4BQ1A 1O6UA 5LBBA 3VBRC 2IVIB 1GZWB 2HJIA 1NYWA 4D7TA 2C9AA 3J7HA 2Y6FA 2BP6A 1D4M1 5SV8A 4A4AA 5FZ3A 2PLV2 4QPIB 5LY1A 2BU9A 3WZ1A 4BQ2A 1J59A 3VKFC 5IK4A 3LA3A 3AVSA 3H50A 2O14A 1ZYBA 4COUA 1VALA 5FYMA 1NZIA 2FZ1A 1JHJA 1WBFA 2ZGQA 4Y5Z0 1R082 3AP4A 3PUIA 2GSYA 3ETPA 4ES9A 4HPKA 5DAXA 4ATEA 1YQ5A 1XYPA 4KMQA 4EZ4A 1VIWB 2WABA 3FUQA 5A3MA 5DG1A 5A7WB 1QJY1 2DVGA 2EA7A 4KBZA 2D93A 2WS93 4L0PA 1JMUB 2BYVE 2ZA9A 1AZDA 3R0RA 4BQYA 2B42B 4DY5A 1H8VA 2WYSA 3OOXA 3QLQA 4CUAA 4FOYA 1HRV3 4JRAA 1A78A 2AENA 3B94A 3KF3A 2OKXA 4B7KA 4QX2A 4GQ7A 5H9PA 5KHGA 2BW8A 1BBT3 2RS32 5DZGA 2ZXQA 2HWB3 4OVEA 2W91A 3SMHA 1J3RA 4AVBA 3CZUA 1Z78A 4IEWA 5CKMA 4D94A 5FZDA 4MYEA 1Q56A 2VUJA 2ZGSA 3IT8A 3POYA 1QJU3 1RUC2 4EJRA 1JUIA 4V2WA 4CU6A 1MS8A 3VBUA 1PMHX 5FZ0A 2QBXA 2JIJA 3O0WA 4AL9A 1G9AA 4LBQA 4FPKA 4AGGA 2JWPA 1BK0A 4HETA 5FP7A 3OUIA 4LITA 3WCRA 3MIHA 4DXSA 4XEZA 5JSPA 3VDBA 4RSUA 2BWAA 1PVC3 5CG8A 3S7EA 2ZGTA 2XVKA 1GFF2 2WSUA 3OSDA 1IQAA 4JAAA 3DEMA 5LA0A 3NJVA 4PJYA 4CCCA 1UY1A 3ZOIA 3T1LA 4XF0A 5FZ1A 4ZU7A 1B35B 4IDZA 3AB0A 1DQ5A 5DN2A 1C8M3 1JYCA 2OVUA 3H9AA 3OYWA 4QD2A 5L73A 4JV4A 5FBZA 3DKWA 3TN93 4F3JA 2UY9A 4QPIA 2VR4A 3ZYJB 1HQNA 3RI8A 2W0XA 3R6SA 3GHMA 2HWD3 4EQVA 4TZDA 2LUWA 2BBAA 2IXHA 1DQ6A 5FMDA 2A3XA 1ZA7A 2YB7A 3GBWA 1LJ7A 2RMU1 4CEWB 3O1MA 3O1UA 2VVDA 1QOOA 2XJVA 2QQPA 4OI0A 4UBHA 2YBSA 1N47A 4IETA 2WC2A 5DQ0A 5A1LA 5JR7B 2VUCA 3LZZA 1DGWA 2XUEA 1ZBA3 2O1QA 5F3CA 3EXUA 2QZ3A 1DF0A 3VDCA 2F4PA 3VKNA 5J36A 1QKQA 4WM7C 1DGWX 3JBG2 1ZZ7A 4JDOA 1OKQA 2ZAHA 3CLPA 3FBMA 4XF3A 5GJ6A 4QM9A 2WIIB 3O0XA 2I45A 3N7LA 3AZVA 4GALA 5KHKA 4XF1A 4LO5B 1REEA 2VMGA 3HWJA 4GIQA 3AMPA 5ABJB 4Y1UA 3MUZ1 1A8MA 2R0HA 2VZ1A 2PHUA 4P08A 1RITA 2QQWA 3AXDA 4UBGA 5LRSA 2CDOA 4PF5A 1W9WA 2RE9A 4BHPA 4LT5A 1HRI1 2ZPXA 3NSTA 3MV11 4URTA 1NCRB 4D6QA 4NPRA 4HONA 1O3QA 1SQ4A 3AKSA 4UFJA 3M2MA 3AP7A 4IEVA 1MEC3 3TB0A 4QDRA 3KLSA 4XUOA 1D4M2 4DUVA 1W6OA 1QEXA 2CGPA 1SBFA 1W6OB 2ARCA 2PLV1 4NHYA 4Z92B 5FZ9A 3LPGA 4L11A 1GWLA 4AHZA 3H3UA 1ACCA 1W06A 3ELNA 3UGHA 1S0CA 3GALA 2JECA 3GJAA 4QPYA 3WT3A 2ZMNA 3FL7A 3MIGA 2FZ2A 1R64A 1CJDA 4MLOA 3JQWA 1SPPA 1I1EA 3VD9A 2ATFA 5JLVA 4CCJA 1R081 4LHLA 4OLLA 4LNVA 4I0WB 2CU5A 4JVAA 3WDUA 3ZIXA 2Y64A 4MGKE 2VULA 5JVVA 4LOTA 1GR3A 1PK6B 1FPN3 3A4UA 5C8CA 2FBEA 2NP0A 1AYM3 2P3YA 3A22A 3ACFA 2YXSA 1HB1A 2VMDA 1M4WA 2XKOA 3PIGA 4RQPC 5FUPA 3GXUA 3J8F1 3RI9A 5C71A 4W6WA 4GJZA 3TAYA 1PIV2 1UU4A 4XBQA 5JZGA 2J1TA 4YVWA 1O3RA 2ET7A 3L2YA 2RDNA 4Q4X3 2XJTA 4JQTA 4D7SA 1N3OA 2HWB2 4RGAA 5CBLA 2RHPA 4PT6A 2H6CA 3ES1A 3NAPB 5CKQA 1ZNPA 5D8AA 4CP0A 5AC91 1RUOA 1JYTA 2R062 1ZZBA 3M70A 1K12A 3MO4A 2J1SA 3KF5A 3CJIC 5AC93 1Z7S3 4TWTA 1SFPA 4QKDA 1SZBA 5FKCA 4YVSA 4AFMA 3W20A 2OA2A 3O12A 2BWCA 4UFHA 2TUNA 1PM7A 3WF3A 4QPIC 1VPHA 2WL1A 1YQCA 4AQ6A 4BQ5A 2W1WA 3SLIA 1O3TA 3OBTA 5JOXA 4P9GA 3N9OA 4LJHA 3ZYHA 4YARA 1WA4A 1YUDA 5B4NA 1XQNA 1X9TA 3WG1A 4I3PA 4B3NA 2PA7A 4CUCA 2QE3A 2ES3A 1JUHA 3UYJA 3D3AA 2D6OX 4V2VA 1OH3A 1V0AA 5F5AA 5EJZB 4QU1A 1LGNA 1OA4A 1PNFA 4FQZA 5FUIA 5FZCA 3JU9A 3N9NA 3OBAA 4IESA 1RUE1 2YC2A 2VNGA 1MVQA 1ZX5A 3IN9A 3E6DA 3QD6A 5G05L 1HXS3 3WDWA 2XWJB 3PL0A 3S7IA 3THPA 1PO13 2VTXA 1W8ZA 1QU0A 3OY8A 3AMQA 1NCQA 5FYUA 2RG4A 3IWZA 1CPMA 1C4RA 2ARAA 5T3NA 4AAXA 3H7YA 4BJ0A 1AHSA 5BNPA 3DL3A 3I3DA 1H2NA 4N9HA 4ZU4A 2WBKA 4YYOA 1Y3TA 4CDXA 2AREA 3HNMA 4FOQA 4ZS3A 3RYRA 3BKZA 4C0BA 2V5YA 4CP2A 2VY0A 3MIBA 5J96B 2FMYA 4YRDA 1GZ9A 3EO6A 1I3HA 4O9GA 4AOCA 4Q4V2 2VJXA 3R05A 3WHTA 4AEDA 2ZKLA 2RVAA 5IATA 2GC3A 3E5QA 4N43C 4AFCA 1W6QB 3WW1A 4ZZ5A 1LGBA 4XQ4A 4XTPA 5LK5A 3PIJA 4HT1T 1A3KA 4RS5B 4NN0A 4YZ2A 4RHV2 3LPFA 4OUSA 3ZSLA 1KDKA 4G3YC 4CU9A 1HRI2 1LULA 1DQ0A 1YQ6A 1UPIA 2WNUB 5EQUA 4B29A 1DGRN 2R063 3K75B 5IJRA 5LA2A 4CDWC 3ZSJA 1PO23 5KXEA 4Y22A 4F8AA 2VZPA 1HLCA 1K5MB 4KH9A 1DYPA 3IDAA 3PVOA 4AXOA 3I2FA 5KWRA 2Y6HA 3UESA 4EWDA 3NL1A 5CFDB 5H9QA 1VB4A 2P6CA 1X8MA 4M01A 5FPXA 3LEMA 4OI1A 1BHGA 2OPWA 1L3JA 2JDKA 2W94A 4K7JA 1LEDA 3NQHA 4S2HA 5HCFA 3VN4A 2EXIA 2VBPA 3R4SA 3M3IA 4CEWC 1FXZA 1OD5A 3VBRB 4IE7A 2CAVA 2D5HA 2SBAA 5ACA1 2ET1A 5AVAA 3EHKA 5BXXA 3C8XA 2FDHA 4D69A 3VBHA 2HWF1 1RIRA 2EAAA 5F5CA 3ASIA 5ABJC 1FX5A 4JZRA 2VO5A 5D1IA 5T52A 1TZOA 4BOWA 3ZPOA 1WMFA 3C2UA 1APNA 5AC92 2BV4A 1DBNA 3J7MA 1AXZA 4BIFA 1IS3A 1ULPA 1QH7A 3O1SA 4XFHA 4QX5A 5BNOC 4Q4W1 2VZUA 2RDSA 3UL2A 4QX7A 4X8NA 5DUWA 1US3A 1SPPB 3MW3A 4XJZA 1QJX3 4Q4W3 4J1WA 1PGW1 1FNZA 3H1YA 3JB4C 2VCAA 5BNOB 1GBGA 5IK8A 1PVC2 5A7QA 4RR3C 1LOFA 2J1UA 2VNOA 3AZYA 4NAMA 3AMMA 4OMCA 4YGEA 4CYDA 5C4WA 1CJPA 5ACA3 3B9IA 5TSWA 1IG3A 4XJUA 4A45A 4LORA 3OJBA 2D3SA 1H4GA 3JUUA 4B8EA 1OD3A 3BU7A 1RUF3 1R1A1 5EIYB 1QJY2 4MGZE 4XPVA 1UNBA 1AL23 2JE8A 1ND2B 4CDWA 1PO11 2R6QA 2E6VA 4KGGA 4P9JA 3ACIA 1UZ0A 5T5LA 2BQPA 4BLJA 2QQOA 4P9LA 4BM8A 4L97A 3H0OA 5SV5A 3CU7A 4AQTA 4DPNA 1JU4A 2ERFA 2QDRA 1VJ2A 3LIGA 2XB6C 2I74A 3BALA 2AACA 4N43B 4YPJA 3RRDA 4ZKTB 1SLIA 3J26N 4GMP1 4PBPA 3TOJA 2Z79A 4N8MA 2TBVA 2BJSA 1R091 2HWC1 4JKMA 1OOPB 4Q1RA 4Y20B 1LCLA 1N1TA 2C1FA 1TQ5A 1H9WA 1JXNA 3VDDC 3ZFEA 2P6HA 2MPFA 4DIQA 4QB6A 2YC4A 3WDXA 4DEVA 2V09A 4Z07A 1VBE3 5CKNA 1H1AA 2ADEA 1R083 5C8WA 2P5BA 3SH4A 4CDWB 5AFBA 4KGQA 4HL0A 3LA7A 4PQ9A 1ZVFA 1W6PB 2VE1A 1AR71 2K9ZA 4RA0A 4CCLA 4DRRA 4EWEA 4RHV1 1JOBA 4N7IA 1WBLA 3SXWA 3PUQA 3VDDA 1AX0A 3T2QA 5T5JA 1D0HA 4W8JA 5FZ4A 4DEQA 5L7OB 2ZEYA 2HWD2 5GZDA 5FPUA 2RDQA 3A21A 1G7YA 1FV3A 4JTOA 2O8OA 4QX3A 3BPZA 1SCSA 2WFPA 4W6XA 5FZAA 1OKOA 4NOTA 3HT1A 2YPJA 2ZMLA 2Y0IA 4C90A 2RMU2 2JKBA 4Z82A 2JICA 4AEJA 4FAHA 1VE0A 2Q1ZB 3RGBA 1NQJA 4KNCA 2P3IA 3RZHA 1AUYA 3OGRA 1RMU3 4PQQA 1GSLA 4ASLA 4AWDA 2OIIA 4LKSA 1HX6A 2WWJA 5ACA2 5FQ0A 5FZ7A 5JXHA 1AR73 2WQ4A 1V6MA 2BRTA 1V6OA 2WA4A 5FO8B 2VNRA 2IWGB 3KV4A 2VVFA 1C1LA 2MEV2 3PJYA 3UJOA 2IXCA 3IDCB 1XNDA 2Q5TA 3N7KA 1Q3EA 3C7EA 4XFIA 5A7OA 1UPSA 1L7LA 1WZXA 2DF7A 3POFA 4B1MA 1C8NA 4CA9A 2UURA 1W2AX 3I8TA 4Q4X2 5FWJA 3UKTA 4Q4W2 2A75A 2CV6A 2YPDA 3WF1A 1JN2P 2WINB 3NRUA 3VZJA 2IFWA 3KCXA 4NWVA 5FY0A 1JZ8A 1Q5OA 3K51A 4HFSA 2NM1A 1GWMA 1PGW2 2DBIA 4UAPA 3JB8A 1KDMA 3FLRA 3TEYA 4AVAA 3E1F1 2ZHMA 4ITCA 2VU9A 4XCBA 3VKLA 3AP6A 3BOPA 1VBE2 4QGNA 3KV5A 1WLTA 3HT2A 3WF4A 5B2GB 3T0DA 3ON7A 4OI2A 5A1FA 3AZWA 2VXJA 1UIKA 3ZN6B 5F6LB 2HWE2 1OHFA 4CP1A 2JG8A 1W2OA 3U75A 1QXJA 1J83A 1R1A2 1RUI2 5IHRA 1PGL1 1WGPA 4QQ2A 1PO12 1QOSA 1AR62 3J8F2 1SACA 5FK7A 5DZEA 2BNOA 3M3CA 2DCZA 1CD3G 1S2BA 4JDNA 5AVPA 5JZGB 3MZHA 3GBFA 5J1XA 1JTZX 2UWCA 2HWB1 2XLGA 3MI8A 1H2MA 1C5HA 4AI1A 1NZCA 2QQKA 1NT0A 5FYSA 1JOPA 2JDPA 2PTMA 4L99A 3U78A 3NNMA 3OGSA 1EYBA 1SMVA 2YDEA 3KQRA 4LK6A 1GANA 3F95A 5LW9A 3KD4A 1W04A 3IAPA 2ZGPA 1HIXA 4MXVA 4P14A 4WM7A 4LKFA 1BK1A 2QUOA 1BMV1 2QDNA 3E6BA 3MIDA 4BQ3A 1J3PA 3I97A 4YW6A 4KG8A 2WT2A 4DZGA 1XJAA 5FZOA 3P3PA 3QBQA 2PHTA 3U1XA 4FTEA 3ZFFC 5JCTA 3N7JA 5T50A 3ZXGA 1SEFA 2CWSA 1UZVA 2WLPA 4XFAA 3S6PA 1ND2C 1XNAA 2RDRA 4LLOA 3NKTA 3CQOA 1RUE2 1W6PA 3EB7A 3I4IA 4OUEA 4XCAA 1LODA 2HWD1 2X8KA 3WF0A 5HPOA 1GNZA 1FT9A 1GQGA 1ULCA 2WJSA 4FOWA 4LTAA 4ARYA 3GZEA 4BMBA 1WW6A 4AF9A 4RGKA 5IT6A 1FMD3 1WLWA 2PQQA 3FFQA 3DYMA 1UY0A 2Q8OA 1POV1 4LXLA 4XABA 1DZQA 1GZCA 4E4DX 3WQ1A 3DUIA 3B69A 2ID4A 3CNAA 2IVJA 2PHLA 1G9CA 1C1FA 1MZEA 4A7KA 3VBSB 1VBB2 5E89A 4A3XA 5F37A 2QFEA 4TTGA 2D6MA 2DCKA 1ALYA 3KM5A 2HKXA 2OUJA 4LBOA 4N43A 1X33A 2W08A 3MFAA 2WT0A 5CFCB 2BUKA 4OI4A 4YVWB 4JGYB 3E5UA 1LNSA 3PVEA 1LGCA 2HBTA 4MOAA 3RZLA 3T08A 2D6PA 2WDBA 1TMF2 1RUD3 2ZOEB 4XFBA 3ZFGA 4E4HA 2VQAA 3IPVB 3NJZA 4NWWA 4Y1VA 3V65A 1FATA 4XURA 1BYHA 1SLTA 5A3NA 1ZM1A 5C3RA 1ZRIA 4WZFA 3W5NA 4UW3A 5JAXA 4Q4X1 1ONAA 3WD5A 2KR2A 3OGVA 1UY3A 3ZLIA 4FXKB 4XUNA 4ZZ8A 3O1PA 1NCQC 2BNMA 1EPZA 1WW7A 2E26A 4Y24A 5EYYA 1YO8A 4FTSA 5LRRA 3I59A 2VTFA 3IDEA 4UF0A 4B4QA 4FFFA 1TME1 2VBDA 4YZ4A 5GZCA 4HVRA 2ZTNA 4YW3A 4XZUG 1W9FA 2EXKA 3RSJA 4Q26A 4YGBA 2N7GA 1BKZA 4UI9L 1ULEA 5A6ZA 1J1TA 3ITQA 2JG9C 3VBUB 5KR7A 2VMEA 1D4VB 3H7JA 2RS53 3SKVA 1NY71 2FDIA 2UU8A 1SFYA 2ZX4A 2EXHA 4Q0PA 4CEYA 3HJRA 4H55A 4NRPA 4PLMA 3WQ7A 5FMOL 2E33A 4DXZA 4A44A 1RUI1 3WSOA 2DU0A 2GMEA 4R4ZA 4C91A 1V6JA 4EZHA 4DUXA 4PI2A 3LEGA 1AR61 4BISA 3X29B 5JSRA 4JGZB 2XVLA 2QNKA 2RR11 2UYBA 1GLHA 3KVBA 4NHXA 2RS12 2Z5WA 4KU8A 4RFRB 2HWF2 1V6NA 1DZRA 3TEZA 4Q4Y3 3NKGA 2X5IC 3FZ3A 1W05A 2D5FA 1HN1A 5KC6A 4M4PA 1CIYA 4MSVA 1AX2A 1UOBA 3ZN6A 4PIYA 2W52A 4N53B 5DG2A 3LE0A 4AQ2A 1DIWA 1TME3 2CWMA 2QQIA 1SLLA 3W5MA 2JG8C 4O7XA 1LHUA 5FK8A 4GZ9A 5GKAC 1QHDA 1KS4A 2HYXA 2W92A 2D3RA 1JZ6A 1AJOA 5DXDA 1EP0A 3WP6A 4Y1ZA 5EXOA 2WWUA 5F3EA 1JODA 2IZWA 2ZGOA 3WEZA 1LU1A 1F9KA 4BQ4A 1PVC1 5K0UC 1RMU1 2Z42A 4E8CA 3B93A 1CR7A 4M0HA 3WDYA 1MR5A 5JWPA 4TLFA 4BQWA 1Y9QA 2QQUA 1RVF3 4C8DA 3RMYA 2DTWA 2QZ2A 1KEXA 4HKWA 1L7RA 4I0AA 3WV6A 5FWEA 1W2TA 3WHUA 3I2OA 4D8MA 2FDKA 2J1VA 1OUXA 4CDQB 5FPZA 5JXIA 4LE3A 4S2DA 4Y5SA 2GC0A 5C5UA 1RB8G 3DF0A 1LU2A 3LSEA 1OXCA 4IUGA 4K1YA 1LOGA 1OLQA 1YFWA 1T6GC 3FLTA 2HEVF 4ZHNA 5FZEA 1XXNA 3AKRA 2Y6JA 1EV13 3RPQA
chains in the Genus database with same CATH topology
2ZJCA 1WCKA 1VBB1 2XJUA 1I9RA 3ZXFA 4CDUB 3ENRA 1LRHA 1R092 2HWC2 1NLRA 2PAMA 2DV9A 4Y1XA 1HDKA 1YWKA 2B45X 1NCQB 3M3EA 2R043 3MF9A 4BIOA 1NE6A 1NXMA 1S0GA 2D43A 5FMOS 1RINA 2R1BA 5DDJ3 2IXKA 1AR72 1ULGA 4B7EA 2ZABA 3HIFA 1V6IA 1F8VA 2WQZC 1HRI3 1MZFA 3U0ZA 1UIJA 1BEV3 3POWA 4RQPB 1VB2A 4YGDA 4P9IA 4ISQA 5AFEA 3POSA 4CDQC 4MGYE 2VG9A 5I8TA 1UZZA 4QXKA 5IK5A 2XUMA 1W0OA 2Y38A 4JGZA 3RWNA 1PZ7A 4UXAA 1AR93 2XLAA 1Z7S2 3W9AA 1ASJ2 5T5OA 2GMMA 2EXJA 1IZ3A 4E2SA 2ZGNA 4E9KA 1X82A 3A0NA 4MXWB 1WD4A 1OA2A 4WVZA 3VZLA 2O8QA 1UMZA 4GMP0 4BPZA 2XBO1 4LUMA 2FQPA 4KG0A 4AK3A 5D8AC 4E4SA 5E88A 2RS11 5FTTC 2NPIA 5C33A 2MEV1 4YVWC 5EZWA 4KWKA 4AEKA 4RR3B 2PHRA 1POV0 2GC1A 4DFSA 1UU6A 4RQPA 5DUXA 2E51A 1Q8PA 4KWLA 4YG3A 1SLAA 1EAH1 4FVVA 3GZAA 1C57A 1DDLA 3AM2A 4OHXA 1CIWA 4ONUA 1NA1A 3PVBB 1YFUA 5C4WC 5KBFA 3LSDA 4LUKA 2VH9A 4PCRA 3ILRA 3I54A 2A73B 1VBE1 2JJ6A 1WMDA 3GZUC 4IL7A 4Q4Y1 1R1A3 3D6EA 3VHPA 4FP2A 4FQ4A 1RUG1 2B8MA 1QJU1 2HWE1 4HZFA 2R32A 3MDPA 1COV1 1W6NA 5EYXA 5JOZA 1PGL2 1REFA 3AZXA 1FMD2 5BNQA 4LBMA 1VAMA 1O4TA 4EROA 5KXBA 4BMEA 3C3VA 1RJ7A 3TNQA 4XF9A 4NHLA 1WMEA 3ROUA 5BNNB 3I7DA 1QGLA 1ZA4A 1S0DA 3VBHC 1QXPA 1AR81 1YFXA 2WA3A 3A0KA 5GLTA 4CEWA 2R042 5I93A 5BYNA 1W0PA 2DFCA 4EN7B 1RUD2 2PELA 2YGMA 1GNHA 1AXKA 2ZX1A 1RUE3 1BMV2 4OHWA 3O14A 1SCRA 3U07A 5I0RA 3R4UA 4Q1PA 2E63A 1Q43A 2LTNA 2UY8A 5CIRA 4UW4A 1ZZ9A 1G9BA 2DVDA 1TMF3 1U0AA 1NQDA 4IEQA 4MGIE 4RD7A 3V64A 1ZREA 5FFOC 1CPNA 2G4IA 2XPJA 1JOJA 2GH2A 2XJRA 5EJ3A 3HBZA 3WW3A 1WLCA 1Z7S1 2KA3A 4EN9B 5BUVA 4JQRA 4CDUC 4AHXA 4E4ZA 3VBOC 1U5XA 1NCRC 1OQ1A 1Z0HA 3IKWA 4YSFA 4AQSA 4HLTA 1DZTA 3LOIA 4FXGB 4XBLA 3RYPA 2DUPA 1URXA 4AVSA 5BNPB 3VBOB 1ZRCA 1IPKA 1QOTA 1WCSA 3OD0A 3WG2A 2PAEA 5LEKA 2VGDA 2D3PA 3MFCA 4HSLA 1TMF1 3BB6A 4IV3B 1CAWB 5FO9B 1S0EA 2WFF2 1OQDA 3ETQA 2UYAA 4XXAA 1AR91 2ZCWA 1BVP1 2E9QA 1EAH2 1QWRA 2JDZA 4TYSA 5J09A 1JYIA 5IK7A 2WT1A 1TNFA 1VRH1 2BGCA 3FJSA 3WY6A 3MGUA 3VHRA 1BCXA 1S0FA 1TME2 2YHJA 5FOBB 2WKKA 3ILNA 5CADA 3NV4A 3E97A 5JDBA 2CY6A 4LEJA 3ZFEB 4Q4Y2 5BNNC 1O7FA 2R16A 1NY72 3AFGA 1O5LA 2DFBA 1MS5A 4QGLA 1RUG2 3RMXA 3VBSA 3NAPA 5D8AB 4AFAA 3FX3A 2Y0OA 3BCWA 4YVSC 3HD8B 1QNWA 3KZ4C 2RR12 2YMZA 4E27A 4AFBA 1YHFA 3OGJA 1NA1B 2A6WA 3AK0A 1X8EA 2PHDA 3KT7A 3L2HA 4JCKA 3ZXKA 1VAKA 4SBVA 2BTVC 3M3QA 1J58A 1AR82 1VAVA 3GNEA 3D0SA 4XF4A 4YZ5A 5C4WB 1RVF2 1LB2A 5C9AA 5KC5A 1Q8VA 4RHV3 5A3LA 3J4UH 1CAWA 5JPNB 1XE8A 3NO8A 1RMU2 1OOPA 5E8AA 3LA2A 1ENSA 3HMYA 3L9JT 3SCGA 1KXGA 1PO21 4AHYA 3EQEA 1OQEA 1MZ6A 3LGRA 2ZX0A 1VBD1 4CZSA 4FPOB 2PLV3 1WW5A 4COVA 3ALQA 2DVBA 5FOJB 1FOD3 1QY4A 2ZGKA 2CYFA 4Q29A 3LOBA 4HKOA 1JH5A 4OHZA 2WZR2 4M0NA 1UKGA 2R1DA 3WR0A 2VMHA 3SHRA 5CFDC 4COWA 1S55A 1X7NA 3GHNA 1PIV3 4QPGC 4CEYC 3CL1A 2WS91 2OW4A 4YZ3A 1RL3A 1QDOA 4Q0SA 2A7AA 1REDA 4PIZA 3TNPB 2JG9A 2MNGA 1LESA 4I30A 4LO6B 2ZZQA 4XW3A 3MPPG 3SNMA 1F31A 3MPBA 1PNGA 4LHNA 2CTVA 4PDWB 1VBD3 2VOWA 4IEPA 3VL9A 4WVMB 2YGLA 4QGMA 3WQ0A 5GZFA 3R4DB 1D4M3 3S30A 3VBFC 2KXLA 1X36A 1VBA2 1DYKA 1VRH2 3HR9A 1EV12 5F5QA 1CAUA 3JD73 4HANA 4LBQB 5C6CA 4FSJA 2IXLA 2GALA 4CTEA 3WXPA 1N1SA 5BV6A 1QJY3 2B5HA 3ATGA 2YC0A 1ASJ1 4GKYA 5GLVA 3VGIA 4AEMA 1XNCA 1O3SA 2WSVA 4N7UA 5GLUA 3AJYA 1W6NB 3MLKA 3N7MA 5BY5A 4S2GA 3I2DA 1Y7BA 4XETA 4CEYB 4JDMA 2NQYA 3VKOA 4COZA 2GNTA 4BZ4A 1SBDA 2ZKNA 1N1VA 3N36A 4FCAA 2XBO2 3B9CA 2K2SA 1V70A 3NVCA 2E7TA 4PDWA 4Y22B 5FAXA 1CONA 3VZKA 1AVBA 2B39A 3SISA 4SLIA 3NV2A 4K9SA 1VBC2 2G9GA 3WP4A 1QMJA 2XL7A 4HN0A 4HPKB 4IV3C 4OUMA 5C9AB 1H1MA 2H0BA 3DGTA 4XOGA 4XZPA 4DS0A 2E7QA 1G9FA 4ISRA 4JTNA 1ZRFA 5J98B 2QVSB 3ZSEA 3H8UA 4RR3A 1H30A 1SBEA 1GKBA 1LOEA 1YNAA 2A6XA 1S1AA 3VHNA 3GF6A 4EN8B 4WV8A 1GZWA 1LENA 4DINB 2SLIA 2JENA 3M8LA 1F2NA 4OHVA 2E53A 2ZHLA 4A7YA 3HAGA 1VBD2 1LEMA 3M4FA 1QJU2 1RUC3 4MXWA 3E6CC 4JGYC 1COV2 2WZR3 3M7AA 2JD4A 1FMD1 2IXJA 1QJX1 5GLZA 4RGGA 1ZBE2 2AYHA 3IIAA 3WP3A 4AGVA 2WZR1 2Q1MA 1UF2C 3DN7A 1PK6C 2BVBA 5T5PA 1PK6A 5C8CB 4K20A 4W6YA 1GICA 3VDDB 4Y26A 2D6LX 1N3PA 1RC6A 2WS92 4XXPA 2PHXA 3ZDSA 4I0BA 2XJPA 3LWCA 4HVQA 2R041 2Q0AA 4NHMA 1SDWA 3AXEA 4QM8A 1LR5A 5C8CC 3BOWA 1RUD1 2DCTA 4WBBA 1FOD1 2DUOA 1ULFA 4JGYA 4FOVA 2D6KA 2AGSA 3TBDA 1FV2A 4J6GA 4YVSB 5CA6A 1S0BA 2RJKA 1OSGA 1S0IA 2A70A 4KBBA 3AX4A 5JSOA 4MZUA 2Q4SA 3H3ZA 1DG6A 3ZXLA 1VBC3 3KMHA 2A6VA 2G9FA 1EAH3 4XHXA 3THTA 1ASJ3 2UWAA 3VBHB 5CU1A 1BZWA 3T2TA 4PLNA 4NR1A 1JW6A 4QQLA 1UZYA 3RG0A 3J8F3 1AL22 3D4KA 4XJ9A 2VQ0A 1LOCA 5DDJ2 4CDXC 3MW4A 1HKDA 3H1MA 3WDVA 2CNAA 2VOVA 4META 2BVVA 4K21A 4QMAA 1XRUA 3DPRC 4C0HA 4GMP3 1EPWA 2R30A 5KHIA 1WLDA 1JBCA 4WM7B 1NCRA 5EFUA 2WFF1 1RUNA 3S0MA 1VBC1 5FREA 3PMEA 4YW2A 4M3CF 3VBOA 1AR92 4DMIA 2ZGLA 3URFA 3NW4A 3ZMOA 1ZZ6A 1WD3A 1CGPA 1D2QA 4L8QA 2YV8A 2GDFA 4XQWA 5GZGA 3FUOA 4H14A 1OMIA 3UK9A 2BNNA 5E1RA 4I2OA 3MIFA 2NMOA 4U2AA 3SH5A 1NLSA 2BEOA 4FP3A 3UV9A 3SITA 4LO8A 4C1XA 1V9U2 2VVEA 1RUG3 4XFFA 1DGRA 4CDQA 5H9RA 2GNDA 1SLBA 5CAZA 1C5IA 1S2KA 4LBJA 3BIWE 3MEPA 3ZFFA 1MVEA 3G6JB 1PZ8A 4XFGA 4HMZA 2RMU3 4TSVA 3JZVA 2ZX3A 1QJX2 1O5UA 4GH4C 1AX1A 1ZBE1 3ZXAC 4B4PA 5L36A 4BLIA 1V00A 1Q8OA 3KGLA 3OYWB 4XE9A 4HVOA 5F1RA 3I59B 4IV1A 2JG9B 2R49A 3E5XA 4LBNA 4P9WA 3UKVA 1ZRDA 2D40A 1QNYA 1RVF1 1W6QA 4AI3A 1ND3B 4YM3A 2NMNA 1FPN2 2XWBB 1FOD2 3EBRA 4YW5A 1XNBA 3WW4A 4XYXA 2B46X 1C3HA 3D0JA 1VLNA 3OF1A 4L9BA 3CEWA 2A3YA 1PO22 5I0UA 1I5ZA 2EVXA 2C5DA 3RNSA 3DV8A 4QU2A 1ZZCA 1OLRA 1ZRRA 1G86A 2DU1A 4P9XA 4COYA 3NWKA 2BPA2 4IV1C 1W6MB 4H3WA 4HN1A 1VRH3 5K8SA 5DUUA 2PFWA 3AKQA 1KJRA 1PVXA 3KT4A 3ZN4A 1A8DA 1MQTA 2RS13 1DQ1A 2HWF3 2W39A 4ZU5A 5DDJ1 5HCBA 3B00A 3G7DA 2XBO3 2XGXA 3OCPA 2OYZA 2C0ZA 3ZVXA 3PJQA 4I09A 4K40A 4IEUA 5HXVA 3INAA 3N4MA 3NAPC 4Y4YA 4A7ZA 3QCWA 2XKPA 3NV1A 2A5ZA 5J37A 3VZMA 2RS51 2XVGA 2Z2SB 4I01A 2QJVA 2GN7A 4JGZC 3FC0A 1VBA1 2JXAA 1MS4A 1MS1A 1D2SA 1EV11 1AR63 3AYCA 4YNIA 5T55A 5JI9A 3ZYGA 4GH4A 3WUCA 1AYN1 3PLQA 2P34A 2HWE3 1IS5A 1LHWA 1RUF2 2TNFA 1V9U1 2D7FA 2D98A 2EIGA 2Z69A 3KT1A 2GN3A 1F5JA 5DZFA 3O0VA 1BXHA 1YFYA 4IEZA 2YROA 5H9SA 4O9EA 1ZZ8A 4X6RB 3CO2A 1XE7A 3WG4A 2X53S 1VBB3 1FAYA 4LBLA 3ZFGC 2FMDA 3AYAA 1LKNA 3USSA 2LALA 1B09A 2V73A 1G9DA 4JRLA 2VW2A 2A3WA 4YLZA 1QH6A 2YUEA 1QF3A 2TEPA 1U5YA 1UD1A 1HV0A 1FYUA 2KM2A 1QQP3 2D44A 4ES8A 5A32B 1SFNA 1PMIA 4CDUA 2CL2A 2R0FA 1Q8SA 3PNAA 1RUJ2 2JE7A 3H1WA 1D0GA 4OULA 1TEIA 1FPN1 1HW5A 4EN0A 3K48A 4AI8A 1BEV1 3U4XA 3W58A 1WUVA 2HEWF 2OZ6A 4ORFA 2ZACA 1AJKA 3KS7A 4F7ZA 2DTYA 4LR4A 3M1HA 3RJRA 2JG8B 4OHYA 4IERA 4P5HA 3WDTA 3KGZA 2DURA 2DYCA 4XJWA 4WM8C 3AYDA 3LAGA 5CB7A 3VLBB 5GALA 1AR83 5JPMB 1OFNA 2XG3A 1GV9A 1MQTC 1IGOA 2ZS6B 4Q0VA 3QACA 3CF6E 4AVTA 4XJ8A 4GB32 3J9SA 4AW7A 5GZEA 1B35A 3AMNA 3TRSB 1H2KA 1IPJA 1BBT1 3TN91 2MEV3 4N53A 4IV1B 4N53C 4D3WA 2X29A 4N9IA 3AFKA 3MLJA 4R9DA 2R071 4Z8BA 2P3JA 5JMCA 4G9SB 2WNUC 1VR3A 2VPVA 4XMIA 4AE2A 3ZFGB 4IEXA 5CG9A 3ZFFB 1XU2A 1UU5A 2XHKA 1U5ZA 1A6CA 3ZSKA 4LHKA 1VBA3 3ZYPA 4CDXB 3P3NA 3AJZA 1G8WA 2NLRA 4FPYA 3BODA 5L19A 4AI2A 4WM8A 4V1PA 2WZPP 2NN8A 3JD72 3RDIA 3WINE 3WW2A 3RZZA 1NG0A 3WX5A 5FDBA 4YG0A 2DCJA 4MVTA 4RFT0 4U36A 1H1IA 3OGGA 4HSJA 4YFWA 5JOWA 1M06G 3OPZA 1RUF1 3TYJA 5IUQA 1G6NA 1AL21 5A32A 3PMSA 4HBNA 4R9CA 5EV7A 5I91A 2IFRA 2EF6A 1UKRA 4H7MA 1PGSA 2ENRA 3CJXA 3VBFB 3MW2A 1MEC1 2JEMA 4X8PA 3PHMA 4RS5C 1RUH3 4Z1VA 2EAKA 4EN6B 2Y26A 2RM22 3VHOA 4AFDA 3MICA 1UL9A 5LK7B 2P37A 2OUHA 4MUVA 2A6YA 3V0AA 4WVWA 1UN1A 4J1XA 4Y20A 4YW1A 4S2FA 4EWAA 4NHKA 3FBYA 2GZWA 3IMNA 2BBVA 4H7LA 2WNVC 3FLPA 4L2NA 5BNPC 1RUJ1 3VL8A 1YLLA 2P3KA 2ZAAA 1C28A 3OBRA 1BEV2 4C1WA 2GU9A 2CGOA 3U10A 3VBUC 3BTAA 1H8TA 2W68A 2OPKA 4FAGA 3ST7A 2IXIA 4AGRA 1KFXL 2ZGMA 1RTVA 3MLLA 2PHWA 4QQOA 1KITA 3B7MA 3KB5A 4K3UA 4M3CB 1IKPA 3QH6A 4BH9A 4QPGA 5I8YA 4ATFA 1ENXA 3B5LB 3OTFA 1YIFA 1VP6A 4B4RA 3EJKA 4YFZA 1KD7A 1RHI3 1J3QA 4R8HA 3VBFA 1H9PA 3ZFEC 4Z2WA 2PN5A 1LHOA 1O4ZA 1BBT2 2RS33 4CRQA 5FLJA 5KHHA 4M00A 2P2KA 2ZMKA 2XL9A 1V6KA 4RS5A 4INDA 2UWBA 4DY3A 4YM0A 3Q9OA 2GH8A 2PHFA 1TNRA 2DWRA 4MV2A 1AL0G 4KWJA 1CAVA 4KL1A 4XIOA 3VBRA 3KCCA 3SCHA 4XIKA 1HV1A 3WCSA 4IXLA 5J3UA 4GULA 1J1LA 2F6BA 1H2LA 1PZ9A 4GXLA 4R52A 3JD71 4WVVA 2H6BA 1LOFC 4LE4A 4EV0A 3ME2A 4JC1A 4OFGA 1HXS1 3RS6A 3UJQA 3VKMA 1H0BA 2QKDA 2CGNA 3AMHA 2WNUA 5L7OA 4FPJA 1BQPA 4L92A 2A71A 2X5IA 3WG3A 4FTBA 1QXRA 2NZ9A 3KCYA 1H4HA 2Q30A 4R9AA 3WLUA 1IOAA 2RM21 4RL7A 3D5OA 2ARBA 4BWOA 1R093 2HWC3 2EALA 3LKJA 1DLLA 3ZXEA 5L7OC 1FNYA 3V56A 4AVVA 5KXDA 1KFUL 2RS52 3M3OA 3N35A 5GM0A 4Q2FA 5FLIA 4DQAA 4PBOA 4HK8A 4FPHA 3IBMA 4QQHA 1RUJ3 3ZX7A 3MF6A 2GNBA 4E2QA 1HRV2 1U5IA 1WCDJ 3T1MA 1GQHA 4HKLA 1XNKA 1QQP2 3V0BA 1AYN2 1LECA 4F83A 4AHWA 2YZ4A 3APBA 4HK9A 4LBKA 3ZXDA 1KS5A 2AR6A 3ZN5A 1NOVA 1WW4A 4WVMA 2RJLA 4K6BA 4DB5A 4MX3A 2O0OA 1KRIA 1U12A 4IEOA 1N1YA 2ZGUA 4LULA 4QQPA 4E2GA 3HN1A 4AEDC 1CAXA 1JHNA 3IDBB 2NYYA 3TWIA 1F5FA 1CESA 4M3CA 4N90A 4DNYA 2RS31 1YJKA 3N3HA 4GWNA 3RJ2X 1CX4A 4AG4A 1CAVB 3ZIWA 4GA9A 2D6NA 4Q0UA 3SH3A 1Q8QA 3VZOA 1AF9A 4G4FA 4KU7A 1LHVA 4GH4B 1ND2A 1XU1A 2XJQA 3AZZA 4BYYA 4LLFA 3LCPA 2YY1A 1YXWA 4GKXA 1AYM1 4Q27A 2DVFA 3JBG3 3O5SA 3QOPA 4BCUA 5A33A 1UW8A 3AKTA 3NV3A 4YGCA 1MZ5A 5LEJA 4XTMA 4Y1YA 3DPRB 3FMGA 3QH7A 1DQ2A 3V0AB 2WWSA 5CFDA 2I2SA 4GB33 1DQ4A 3WNXA 2I07B 4GWMA 3U11A 4QPGB 1W2UA 5F9TA 4GB31 1X50A 4LA3A 4LBQD 4XDQA 1DU3D 5K7PA 3W59A 3SCFA 2VOXA 5A33B 3WOGA 4IQPA 4AVCA 3TN92 1IKQA 3B3QE 3FFZA 5FCCA 1H8TB 2P17A 4MH0E 1QDCA 2RM23 2YYOA 2VXRA 2R072 4FPFA 4YZ1A 5JZGC 1NE4A 1OI6A 4BE3A 4AEDB 1RUH2 2XLFA 4ASMB 1POV3 2GMPA 4YG6A 1LOAA 4WZCA 1Y43B 5EWSA 1NA1C 2IC1A 2VUAA 4XBNA 2ILMA 4X6QB 1ZBA2 5DUVA 1UAIA 1YCIA 2VOKA 5K0UA 4PIXA 2A6ZA 1FI2A 1HRV1 4FO9A 5KXCA 4R4XA 3LB9A 3FHIB 1CAXB 1QQP1 1C8M2 3WP5A 1ENQA 1DGLA 4D7YA 2B7YA 1K5MA 3JQXA 3CJIB 5I8SA 2K0GA 3OY8B 2XH6A 1DHKB 1OFSA 2AH2A 3MYXA 1ND3A 5HI0A 3D82A 2CAUA 3PVNA 2ARXA 4FT8A 2GC2A 1UX6A 1ENRA 2X5IB 3RYKA 5JI7A 4M3CE 4XHBA 1V6LA 4P9YA 4YM1A 5CVRA 1MEC2 4I02A 4I3GA 4IV3A 1MS9A 4XMAA 5BNNA 3GZTB 1PIV1 1YI9A 4XJAA 5C9AC 1YRZA 3PTYA 4FPEA 5JIAA 1MS3A 1B35C 1YJLA 5FQ0B 4PDWC 1QJZA 4FPCA 2R061 2DUQA 5K0UB 1KJLA 1RHI2 5GLWA 1S0JA 4XILA 3IM0A 4FPLA 4NVPA 4K1ZA 5CFCC 3FE5A 2GNMA 1H8TC 1KQRA 1DFQA 3HQXA 2ETEA 1RJ8A 1XYOA 2LM3A 3ES4A 3FWEA 3KSCA 2MHFA 1MACA 2B9UA 1CVNA 5KHJA 1CAUB 3ZXJA 3O7OA 2QCSB 2BFUL 1IHMA 2WNVA 1AYM2 4Q8LA 4R9BA 3VZNA 4Q0QA 4A2UA 3VV1A 1YI7A 2H0VA 2FHRA 3AKPA 2ZGRA 1NXD1 1AXYA 2VW0A 3ZMNA 3RQ0A 4LA2A