1CD3G

Procapsid of bacteriophage phix174
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN (SCAFFOLDING PROTEIN GPD)
publication title The role of scaffolding proteins in the assembly of the small, single-stranded DNA virus phiX174.
pubmed doi rcsb
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1999-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cd3G00
1H8TC 1R1A3 1ZBA3 1FOD1 4JGYB 1FPN2 5CFCA 5BNPC 1VBC3 2WS92 1PO23 1AYN1 4YVWB 1VBA2 3ZFGA 5L7OC 1HRI3 4Q4Y1 2HWE3 5A32A 2X5IB 2BUKA 1PO13 4YVSB 1RUG1 3VBRC 3JBG3 2RM21 1PIV2 2RS31 1SMVA 4CEYB 1BBT3 2WFF1 5C8CC 2XBO2 2RS51 1BMV2 1RMU2 4RHV3 1AYM1 4N43B 5C9AC 2HWF1 1ZBE1 1NA1B 1FOD3 4RQPB 2WWSA 1RUI1 1C8M1 1MEC2 2HWB1 4Q4W2 3ZXAC 1F8VA 3CJIC 2R061 3NAPC 1AYN3 1RUJ1 5ACA1 1K5MB 4Q4Y3 4N53C 4Q4X1 3ZFEB 3ZFFA 1AR91 1HRV1 1R1A2 1RUG3 1RHI1 1ZBA2 1MQTA 3DPRC 1VB2A 2RS33 4Y4YA 1D4M3 1VBC2 2WFF3 1PO22 2ZZQA 5K0UC 1HRI2 2RS53 2HWE2 4CEWC 5DDJ1 1AYM3 2HWF3 1ZBE3 5A33B 1PO12 2PLV2 1AR61 4JGZC 2HWB3 1C8M3 4WM7A 5FOJB 3JBG2 4QPGA 2R063 4CEYA 1RUJ3 5AC91 5ACA3 1BBT2 4AEDB 4JGYC 2ZTNA 5CFDA 2R071 1AR71 4RHV2 1AR93 1VBB1 4NWWA 1NA1A 1RHI3 3VBFA 4YVWC 1FOD2 2WZR1 2RR11 5C4WA 3HAGA 4PDWC 2Y26A 3VBSC 4WM8B 2X5IC 1AYN2 4Y5Z0 4EJRA 4IV3B 4YVSC 2DF7A 4Q4Y2 5DDJ3 4CDWB 1H8TA 1RUF1 4CEYC 1AR63 1RUG2 5GKAC 3VBUB 3M8LA 2RM22 2RS32 4CDQB 1ND3B 1A6CA 4N43C 5AC93 5BNPA 2WFF2 1NA1C 1NCRC 4RQPC 2FZ2A 5L7OA 2RS52 5K0UB 2R073 2BBVA 1VBB3 4CEWB 1AYM2 2HWF2 5JZGB 1ZBE2 5FMOL 1ASJ1 2RR13 1K5MC 4IV1C 4CDUB 1RUI2 1C8M2 2HWB2 1R083 3ZFEC 3VBRA 2R062 1RUJ2 4RHV1 5ACA2 4GB33 4GMP0 5C8CA 1X36A 4Q4X2 1AR92 1HRV2 1RUF3 5C9AA 4RS5B 1RHI2 3IDEA 1NCQB 5LK7B 5ABJB 1VBE1 2IZWA 4PDWB 3CJIA 3NAPA 3VBSB 3FBMA 4N53A 5DDJ2 4QPIB 5BNOB 2HWC3 3VBOB 1AR62 1ASJ3 5FMOS 4AEDC 1D4M1 3DPRA 1AL21 1B35C 1ND3A 1F2NA 4CDXB 5AC92 2FZ1A 3TN93 5K0UA 1NCRB 5BNNB 2R072 1AR72 4CEWA 1VBB2 4WM8C 4IV3C 3VDDB 4JGZA 2WZR2 2RR12 1VBE3 3JB4C 4IV1B 1DDLA 4CDWC 1E57A 2ZAHA 1W39A 1PGW1 1VB4A 2GSYA 4JGYA 3VBUC 4CDQC 1ND3C 1RUF2 1OOPC 4YVWA 1QQP1 2RS11 1AL23 4PDWA 3VBSA 2X5IA 5JZGC 4GH4B 1AUYA 1EAH1 4YVSA 1RVF3 4CDUC 5BNOA 1PGL1 1ASJ2 1B35B 4N43A 4RS5C 1NCQC 3S6PA 1NCRA 4RQPA 5ABJC 1HXS1 2HWD3 2BPA2 1QJX1 1R081 4BCUA 1QQP3 1K5MA 2RS13 4GB31 4IV1A 1VBE2 1HQNA 3VBHB 4QPIC 3ZFEA 5BNOC 1EAH3 4LLFA 3VBOC 1RUE1 4CDXC 5CFCB 2WS93 1D4M2 3ZFGB 1RB8G 1OOPB 5BNNC 1VRH1 1AL22 3J8F1 1FMD1 5A32B 1V9U1 1C8NA 2HWC1 3JD71 5A33A 3VDDC 1HXS3 1R091 5D8AC 1CD3G 1QJX3 1WCDJ 4FTEA 1NOVA 1RUC1 4AEDA 4Z92B 3TN91 1RUD1 4Q4V1 1B35A 4RR3C 4SBVA 1COV1 2RMU1 1RUE3 1PGW2 2R041 4RFT0 4NWVA 1QJU1 4WM8A 4GH4C 4IV3A 1POV1 1QQP2 2RS12 1VRH3 1TME1 3J8F3 1FMD3 4CDWA 3ZFFB 1RUH1 1Z7S1 1V9U3 4FSJA 3JD73 1EAH2 4FTSA 1MQTB 1QJY1 1R093 2BFUL 3VBUA 1PVC1 1NY71 3JB8A 4CDQA 1RUC3 1PGL2 1OOPA 3LOBA 1GFF2 1RUD3 4Q4V3 1RVF1 1ND2C 1VBD1 1COV3 1QJZA 2RMU3 2PLV3 2XPJA 5JZGA 1BEV1 1OPOA 1TMF1 2R043 1HXS2 4CDUA 4WM7B 3VBHC 1QJU3 1AR81 5D8AB 4QPGB 1QJX2 1R082 1X33A 1POV3 4GB32 1TME3 5CFDB 1RUH3 1Z7S3 2HWD1 2MEV1 5CFCC 4RR3B 2QQPA 4RS5A 3VBFB 1NCQA 1RUE2 1QJY3 2BFUS 3ZFGC 1EV11 1PVC3 5ABJA 5C4WB 2GH8A 1VRH2 1VBD3 1FPN1 1CJDA 4QPIA 3J8F2 1FMD2 1IHMA 1V9U2 1H8TB 2HWC2 1BEV3 3JD72 2WS91 1TMF3 3VBOA 1POV0 1R092 1VBA1 2VQ0A 2RM23 1AR83 4CDXA 5BNPB 1RUC2 2WLPA 3TN92 5J96B 5L7OB 5BNNA 1RUD2 4Q4V2 1COV2 2MEV3 1ND2B 1PIV1 2RMU2 4GMP1 3VDDA 2R042 1EV13 1RUI3 2XBO1 5D8AA 1QJU2 3VBRB 3ZFFC 1BMV1 1RMU1 1MQTC 5C8CB 4Q4X3 1FPN3 1TME2 1MEC1 1HRV3 1RUH2 1Z7S2 1VAKA 4Q4W1 4RR3A 1HX6A 5C9AB 1QJY2 1VBA3 1PVC2 1NY72 5J98B 3CJIB 3NAPB 4GH4A 1R1A1 4FTBA 1ZBA1 1M06G 1RVF2 1VBD2 4N53B 4WM7C 4QPGC 1PIV3 1BEV2 4GMP3 1VBC1 1TMF2 1PO21 3DPRB 1HRI1 2TBVA 2XBO3 1AR82 2HWE1 5CFDC 1RMU3 1OHFA 3VBFC 1PO11 2PLV1 5C4WC 1AR73 1NG0A 1MEC3 4Q4W3 1ND2A 2HWD2 2MEV2 3JBG1 2WZR3 1BBT1 4JGZB 1EV12 1AL0G 3VBHA
chains in the Genus database with same CATH superfamily
2D3PA 1LECA 2R0HA 3NWKA 2JG8C 5A3LA 5A6QA 4UFHA 5I93A 1FOD1 2ZGKA 3N9OA 1KRIA 1Q43A 1O8SA 3VKFC 3ZXEA 1N3QA 5CFCA 1QXPA 5K9YA 5I91A 4O9EA 5A7PA 2CWMA 1HLCA 1VBA2 4YG0A 3ZFGA 1HRI3 2XXZA 2ZHKA 4ATEA 3BPZA 4BE3A 2B4KA 3RPQA 3J7HA 4EN9B 1CZVA 4N8MA 1OUXA 1W9WA 2X5IB 3KHBA 4Q0PA 5FP7A 5KXBA 1O3RA 4D7YA 4LBQA 3WDXA 1VMHA 5F5CA 1SFYA 1F31A 1OKQA 3BOWA 3VL9A 1W6NB 1IPSA 2RM21 2WO2A 4Z07A 1O3QA 1O6UA 3L9JT 4V2WA 4CZSA 3UKNA 5DZGA 3WVJA 2VMEA 4KBBA 2WDBA 3OGGA 2RDNA 4KWJA 1AYM1 5C9AC 1Q8OA 2HWF1 4ZPIA 4FOQA 4F7ZA 4BISA 1NA1B 4AFCA 1X7NA 4CUGA 1UY3A 4NVPA 3WQ0A 1WCUA 4Y22A 2BGPA 3R0RA 1BXHA 1CVNA 4AI3A 5JXJA 4HETA 4Q4W2 4Y33A 3CJIC 3ZSKA 2R061 3NAPC 4HONA 4XYXA 5F5AA 4EE2A 1RUJ1 4DQAA 2UU8A 5A3UA 4P00B 5FXXA 2QQMA 2VUAA 1MS3A 4MADA 4N53C 1I6XA 5K4LA 4Q4X1 4LA3A 4ET7A 4MGKE 3T4VA 4KBZA 2W92A 1HRV1 4MHRA 4XIOA 3D0SA 4GWIA 4E8DA 1MQTA 1ZVFA 4WVMA 2D3RA 2RS33 5AFBA 3VGIA 4Y5TA 4Y4YA 4V1PA 1G8WA 5CAZA 5T54A 3OB8A 4QKFA 1HRI2 4XCAA 4GQ7A 3AXDA 3BOPA 3C3VA 5DZEA 2NN8A 4CEWC 2X05A 5FR3A 5A33B 1UOFA 2XLFA 5CG8A 1HW5A 2VGDA 4ORFA 2ZGLA 5FUPA 5A6XA 4CP9B 3BALA 1H9PA 3EQEA 4DXTA 4QPGA 2BV4A 3LFIA 2DCYA 3POWA 3K4DA 4GKXA 3LA7A 4OUEA 2FCUA 4AOCA 5FQ0A 5LBFA 2A1XA 2HEVF 4FOWA 3RI9A 3ZX7A 2ZTNA 4FPHA 1RGSA 4IEQA 3Q9OA 1XNTA 5CFDA 1AR71 1H1IA 2Q4SA 1RHI3 1RITA 1GLHA 3WG2A 4NMIA 3CHXA 1H2MA 1O7FA 4YARA 4XUPA 3MHZA 4HSJA 2KR2A 2FDFA 5JXIA 4Y5Z0 4FPKA 1W8NA 4YVSC 2E31A 3AP9A 1E5RA 4XACA 5JR7B 4BK4A 5HCFA 3VD9A 1CAUB 1F35A 1C57A 1KITA 1O8PA 4CDWB 5L9VA 1SBFA 4M0NA 1RUF1 4CEYC 2TUNA 3AZVA 4CCEA 1AR63 2ADDA 4FPYA 2Y0IA 3FX3A 4IESA 1DHKB 4NN0A 1SLLA 1WLCA 1V70A 1IKQA 1S0GA 2YMZA 2RS32 4BH9A 1CAVA 1ND3B 4YGDA 3A0KA 2HYKA 2AUYA 1K12A 1UMHA 3UKTA 1NCRC 2UY8A 4BPZA 2FZ2A 4YZ1A 3ZXDA 2WABA 4XIKA 1C28A 2PHUA 5A3OA 2WBKA 4AGRA 4CEWB 5IJRA 3WNLA 5JR2A 3J7LA 1U5IA 4DUWA 1LTEA 3SNMA 2X8KA 5J48A 5L19A 2RR13 1K5MC 3ZN6B 4IV1C 2BJSA 4I02A 5F2WA 3WF4A 3WHTA 1R083 1XRUA 1UN1A 2ZAAA 5FFOC 5A6ZA 3RZZA 4RHV1 2XJQA 3NV2A 3MV11 4GMP0 4JX0A 1K45A 3LEKA 2EIEA 1QH6A 4OYUA 4YFZA 1KJLA 1X36A 4QXBA 4LBOA 2DYCA 5FZAA 1CAWA 1SLBA 3FUQA 1US3A 2X09A 3EHKA 2C24A 4UW4A 4I01A 3N9NA 5FKBA 1IOAA 1RHI2 3U07A 1NCQB 2DVFA 4R4ZA 5ABJB 4TZDA 1QKQA 2Y6FA 1SQ4A 2AEZA 3RZKA 4DPNA 1VBE1 4QKBA 4QDSA 3OEAA 2PHXA 2XGXA 4W6YA 1U5YA 1B09A 3MW2A 4L11A 1OQDA 4FFFA 2C4XA 5FZFA 3DKWA 5DQ0A 2WYSA 2XVLA 4QKDA 3GBGA 4LE4A 4XMAA 4RN5A 3FBMA 1LOFC 2VZSA 3LB9A 5H9PA 1YQCA 2P3IA 3GHMA 3V0AB 1J84A 1U5XA 2V73A 3HIFA 3JCIA 4PCRA 5EJZB 1AR62 2VCBA 2IXCA 4GALA 1D4M1 5FMOS 4AEDC 3U75A 5JOWA 2YC2A 3DPRA 3E5UA 4DZGA 2CYFA 1B35C 4XETA 3NNFA 2XLGA 3DN7A 4PF5A 4LEJA 1QF3A 3OPZA 3DEMA 3MYXA 2ZX0A 1NCRB 5FZMA 2BERA 3B9CA 3KCYA 1ENQA 1UY1A 3ZDSA 4WM8C 3KV5A 5F3CA 3MLKA 4IV3C 2RR12 1H30A 1DCSA 2VL4A 1UZZA 2WO1A 2NMNA 4IV1B 2P1BA 3T30A 5BUVA 2ZAHA 4YYOA 3WDWA 2CY6A 1W39A 2EIBA 4ZXEA 5I8TA 2ZOEB 4P9JA 1BVP1 1UU5A 3VBUC 2ORZA 3BODA 2B39A 3LIGA 3ORJA 5FTTC 2G1MA 2UY9A 4B1MA 2JD9A 4SLIA 4CDQC 2ARCA 5DAPA 1YI7A 4IEYA 1PZ7A 2ZGSA 4JTOA 3K75B 3ZXLA 4CCNA 2DVGA 4FFHA 2OKXA 2HKXA 1UZ0A 3M70A 5KXEA 3RSJA 3OSDA 2VVDA 1AUYA 5JWPA 3I8TA 4G4FA 4PIZA 4XJWA 4CDUC 1CJPA 2DVAA 1N3OA 5BPXA 4S2DA 3GXUA 4JCKA 4NRMA 4DY3A 2GP5A 1S2KA 1PGL1 4BIFA 4QX2A 1GSLA 5EQUA 1HV0A 1SCSA 2ZBJA 1W6QA 3AYEA 3AVSA 2YGMA 1YNAA 5CVRA 1B35B 3USSA 5A1AA 3SCFA 5HI0A 3AFKA 3ZSJA 4Y1UA 4XAEA 2D7FA 2AENA 3AMPA 3GHNA 3IPVB 4Y3OA 1US2A 3K4ZA 2DDUA 3GBFA 1BK0A 2XHNA 5EPAA 1YFWA 4LXLA 3ZYBA 5A7WA 3ZYRA 4HT1T 1RXGA 3NNLA 5LATA 4ZHNA 2OQ6A 5T5JA 2MHFA 2WNVB 2CAUA 3G7DA 4QPIC 3RJ2X 2C0ZA 2EXJA 1TE1B 5F3GA 2WL1A 2OUHA 4HSLA 5FZEA 3ZFEA 4COVA 5BYNA 3SKVA 3VBOC 4AQSA 4PLNA 1RUE1 3TRSB 2WT2A 4F8AA 1L3JA 1W6OA 5FWEA 2JDYA 2VNGA 5CFCB 3POFA 2CDPA 5FYSA 4OFGA 1K5JA 1C1FA 3ZFGB 1FV2A 3IWZA 3VD4A 3DYMA 1Y9MA 1E5HA 3J8F1 3TB0A 1C8NA 2HWC1 1UOBA 3SXWA 4LBQB 2PAKA 1CX1A 4LBQD 4KMQA 1CESA 1CD3G 2W1QA 4A44A 2BOJA 2VCAA 2P3YA 3BU0A 5FZ0A 4D69A 1NOVA 1RUC1 3POIA 3E6DA 4D3WA 5CKNA 5JXGA 1UY4A 3WP5A 3NNMA 1KJRA 3TN91 1PK6C 3MIBA 2Q1ZB 4TLFA 1SG3A 2W52A 4QX1A 3VL8A 2XR4A 4YW4A 1AX2A 2WSUA 4IE4A 4Y22B 5F7UA 5GZFA 1SHWB 5FREA 3VN4A 5CNAA 4FBFA 2RV9A 4ATFA 2GN3A 2EAKA 1AF9A 2XWJB 4LT5A 2P34A 1JUIA 3SH5A 4JRAA 5GLVA 5L9BA 5C33A 3OBAA 3ZOIA 3ZSLA 3U0ZA 5GZEA 2B46X 3VV1A 1H1AA 1Z7S1 2PHWA 4Y20A 3TOJA 4FTSA 3N9MA 2XKOA 1MQTB 3H1YA 3O1VA 4F3JA 3IKWA 4Q27A 1NY71 4NE9A 4WVMB 2YB7A 3ENRA 2MPFA 5H9RA 3LKJA 3POSA 1FT9A 5L73A 1FAYA 4P9LA 5T5PA 2J1TA 4CU6A 1OA4A 2CU5A 4QQOA 3DYPA 4CCMA 3O12A 2ZXQA 2ZEXA 2W47A 4QT6A 1YYNA 1QJZA 4D6SA 1FX5A 2Q1MA 4Q0SA 5JZGA 2XPJA 2FDIA 1NAEA 4UBHA 4R8HA 4M3CF 1IQDC 3I2IA 4FCAA 4H3WA 4LK6A 4QPGB 3R4UA 1Q56A 1STMA 4LOTA 3S57A 4NPMA 5IHRA 3DF0A 4RGKA 4UFKA 3NJVA 1IS5A 3THPA 2NP0A 1V6OA 2VMDA 5CFDB 4OHWA 1AVBA 4IQPA 4QU1A 5E88A 2P6CA 3TYJA 1WBFA 2W08A 4RS5A 2GP3A 5I0SA 5FYBA 2W9XA 3C8XA 5FRAA 3GNEA 3CZUA 3FFZA 2D6PA 1UOJA 2QCSB 2GC2A 3AXEA 2YBSA 4U36A 3J9SA 3ZXGA 5FYIA 3INAA 3PHMA 4UI9L 3T09A 1CWPA 1SLAA 1DQ1A 1OT5A 5FLJA 3SKJE 1OD3A 3N9LA 3LEIA 2WNUC 2JICA 1NLQA 2J42A 3NMBA 4BLIA 5JPNB 4CCJA 1TNFA 1VBA1 1Z78A 4A42A 1XBFA 4B29A 2JDZA 1AR83 1VR3A 2XL7A 1W2NA 1CAVB 4LIVA 4YZ4A 2W0XA 2W46A 2DU1A 2DTWA 3MBWA 1LU2A 2WLPA 2XMLA 5BNNA 3ALQA 1A3KA 3THCA 2MEV3 4LA2A 1JYCA 3WDVA 5IVFA 3NL1A 2IXKA 2BW8A 3AKSA 3LSDA 4QGNA 1RUI3 3UJOA 1UPSA 1JZ6A 3HMYA 3WZ1A 1HQLA 1VE0A 2K0GA 5HBAA 2R16A 1GV9A 1L7LA 4I3PA 4LHLA 5DUWA 4H7MA 5DPNA 3HOBA 1V6KA 1NE6A 4XILA 1LEMA 4XF3A 1CAWB 2PQQA 3M3QA 4P14A 2ZCWA 4Q4W1 1HB1A 5FY4A 1HX6A 4JKMA 4EN6B 4UW3A 4XJZA 4XC9A 4XE9A 2GC0A 4AVVA 1DYKA 2E26A 3OUJA 4GXLA 4XFFA 3E6BA 4LULA 3UKVA 3ZN5A 1G9AA 1W90A 5JIUA 4D8MA 3H3LA 4M3CE 1DF0A 1W8UA 1YEWA 4OI1A 1CZTA 4CA9A 4FTBA 4AK3A 2VM9A 1M06G 1MS1A 5D21A 2WR9A 3PJQA 1RVF2 4WM7C 5F1RA 3KD4A 1V0AA 1ZM1A 5FCCA 2BRTA 1ACCA 1LKNA 1PIV3 5JAXA 2BDRA 4GMP3 3FC0A 3W5NA 1C5HA 1EY2A 4JKLA 1GZWA 2WNUB 3DPRB 4M3CA 3FWEA 1HRI1 5A7OA 1DLCA 5A3MA 1AR82 1GOHA 4NAOA 5JSOA 4NRPA 4Q1PA 3QH7A 1KQRA 1DFQA 2K46A 3JQWA 1J3PA 4PI0A 2XJPA 3GZAA 4WV8A 5F6KA 2MEV2 4G3YC 1HB2A 1W0PA 2YY1A 2YFUA 4X8NA 1W06A 1IZ3A 4TWTA 4KI5M 1GU3A 3EXUA 2Y6LA 1MS5A 3LIHA 4HL0A 5FP8A 2G9FA 5AFEA 3RZJA 5FUIA 1U12A 3IDBB 2ZGOA 3T08A 4GWJA 5CISA 3G6JB 1AL0G 3RMXA 2YBPA 3ZXJA 4BQ1A 4D6QA 5CADA 2OXBA 5JLVA 3TBDA 3N9PA 1QH7A 5F3EA 1IS3A 4MH0E 1R1A3 4L2NA 3C7EA 4ZS2A 1YFXA 4UT5A 3BVCA 1WZXA 4S2HA 2R1BA 3POGA 4PT6A 4YZ3A 4NIAA 2D6LX 4CUAA 5JSPA 2CGPA 3GJAA 5IYYA 5KHGA 5FP4A 5BNPC 4G9SB 3O14A 1SZBA 3GALA 5I8YA 1HB3A 1OA3A 3AZXA 4B7EA 1D7PM 2W94A 4HKOA 3ROUA 5L36A 2C9KA 5FPVA 5DAVA 3M1HA 2F4PA 3ILNA 5J36A 4EQVA 4X6RB 1JZ5A 2DURA 1LGCA 1G9FA 2LROA 4P9XA 4N7UA 4PLMA 1OA2A 5F9TA 2A5ZA 1H2LA 4INDA 1ZA7A 3MIEA 1S55A 4E2SA 2RS31 1AX1A 1PIV2 5FV3A 2ZMNA 1VALA 1W9FA 1I3HA 2V72A 3HD8B 3PMSA 3WOGA 4FPJA 2VJXA 1DQ6A 4KU8A 3IM0A 4Y26A 2BNMA 4M01A 3BKZA 1BMV2 5FK7A 2D93A 3QBQA 4OULA 3I2DA 4O7XA 5F2SA 3O1PA 2WWSA 2BP6A 3ZXAC 1XOYA 2ZPXA 2P6HA 2QQNA 3K4AA 5CBLA 2EALA 1RTVA 4XVHA 4Z82A 1UYZA 5A7WB 1LHUA 1HV1A 3C7HA 4PBPA 2EXHA 4Q4Y3 5FPXA 1KEXA 2VMCA 4QB6A 4TSVA 1JU3A 3ZFEB 2CHHA 1XNDA 4H14A 1H9WA 4XBNA 1XSRA 3ZFFA 4B1LA 3ZXKA 2BYVE 1R1A2 4HVOA 2WZEA 3TNPB 3IIAA 1RHI1 3WINE 5HCAA 5IT6A 1W6OB 2WA4A 1GNYA 1M4WA 1VB2A 2DFCA 1SBEA 3O0XA 1NXMA 3I3EA 2A75A 2UYAA 3WDYA 5M0TA 5DZFA 3JUUA 1NE4A 1WCQA 3I59B 2ZZQA 3NSTA 2UWCA 2J1SA 4BDVB 4XBLA 4XOGA 4OMDA 5DUXA 4XAAA 3ZVXA 4B4RA 4I09A 3IDCB 1O4YA 4JQRA 2PLV2 2E6VA 1AR61 2JDNA 4JGZC 1HN0A 4ZZ5A 2B7YA 1ZRIA 4HKWA 4PLOA 4CEYA 3WDUA 4XF0A 3VHPA 1JH5A 5FPUA 3LPFA 3AP7A 1AXZA 3P1IA 4IEPA 4LORA 3MFCA 1OF4A 3N7MA 1DGWX 1GZ9A 5DG2A 4AHXA 3QLQA 2QKDA 3GDBA 3WQ1A 1BLZA 1QOTA 4AYUA 2NMOA 2QE3A 2FQPA 3LE0A 3AP4A 3P6BA 3OYWB 1DZRA 5JOZA 2RR11 2W68A 3HAGA 3B02A 4AE2A 3VZLA 1NLRA 1XNAA 1KFXL 1MVEA 2E33A 2P2KA 2P3KA 2X5IC 3WNOA 1ZRRA 4EJRA 4DNYA 3F95A 4NIDA 1DQ2A 3OGRA 4HBNA 3TAYA 1F4HA 2DF7A 4Q4Y2 2Q1FA 3P5BA 3BTZA 1IGOA 2ZEYA 1GUIA 5DDJ3 4LBLA 4BQYA 3D6EA 4W50A 1IS6A 4GWMA 1H8TA 2EA7A 4DUVA 4Y20B 5J37A 3WD5A 4AW7A 5GKAC 4XEZA 4JRLA 5EJ3A 2VMIA 3KT7A 1CZSA 3ZLIA 3I2OA 2ZEWA 3B69A 3DCQA 2J22A 3HWJA 1A6CA 1XE0A 2CSGA 1NA1C 2ZHNA 4RSUA 2LM3A 3PJYA 4AFAA 4H55A 3O0VA 4D7SA 3AYAA 4BB3A 5L7OA 1MS8A 4P9GA 4UAPA 4A7ZA 4BQ4A 2RJKA 2VCCA 1DGRA 1V6MA 1EPZA 1SACA 4M4RA 1PMJX 2LRPA 3KWVA 4PQ9A 5JZGB 3DUIA 4IEZA 3VUOA 3WNXA 5F37A 2Q30A 1UOGA 5FMOL 4XJAA 1JZ7A 3A21A 3S7IA 3VBRA 3HNYM 1E5SA 3WUDA 4ARXA 4Q8KA 5FYVA 4YM1A 1OFNA 3CEWA 5GLUA 4DRRA 3FN9A 3O7OA 3ON7A 4GB33 3LD8A 4LJHA 2H6BA 5C8CA 4E4ZA 1UO9A 4CE8A 4CUBA 2JECA 3SCGA 1QY4A 2OA2A 1J59A 1S0EA 4RS5B 1VMJA 3WSOA 2ZKLA 3MO4A 1LNSA 3OPTA 1LENA 4YGCA 1H4HA 1LHWA 3KF5A 2Y6JA 2Q8EA 5EP9A 1GWLA 3ABZA 4Q0VA 4XPVA 4TN7A 1N1VA 3IMMA 2FCTA 1FNZA 4LKSA 4UOJA 4B8EA 4IEWA 5DDJ2 1X8EA 2MNGA 2JKXA 1GMMA 4DXZA 5BNOB 2FMDA 2WA3A 5E8AA 4UBGA 2VMHA 1DBNA 4D0QA 2Y6KA 2WWUA 4MGYE 5DXDA 5HCBA 4F83A 4YFWA 1UX6A 1LOBA 2GZWA 5A1LA 1JZ4A 4IERA 4QKNA 1KXGA 4QX3A 2YV8A 5K8SA 3RYPA 2ZACA 5IVJA 3W5MA 1LR5A 1F2NA 2AYHA 3PVOA 2ZGTA 3CJXA 4BQ2A 2I45A 1N1SA 4QX5A 1I5ZA 4Y1XA 3MF6A 1N1TA 5I0UA 5K0UA 2JE7A 5BNNB 4CU7A 2WQZC 3PMEA 1ULPA 2GALA 2ZABA 1QDOA 1J1LA 3H0OA 5T50A 4K3UA 4CCOA 3MIFA 3K3OA 2WZR2 1RUNA 2AACA 1S0BA 3JB4C 2ZJCA 5C3QA 1DDLA 4CDWC 1LHOA 1O4ZA 1E57A 4I0AA 1ZYBA 3ST7A 5LRSA 2GNDA 1QDCA 5JI9A 1JYWA 3B00A 3D3AA 1Q8QA 4YM3A 2QQWA 2NLRA 2OZJA 1W8HA 2WN2A 3PUHA 4JGYA 4W6XA 4CCCA 5EWSA 4CYDA 1ULFA 3WW4A 3GBWA 1APNA 1ND3C 4XQ4A 1N1YA 2R7EB 3O1MA 1WMEA 3DXUA 4YVWA 4PBOA 5G04L 2XKPA 1QEXA 4MSVA 2CGNA 2I74A 1UD1A 2VOVA 1AL23 3KGLA 4PDWA 5LA1A 4IE0A 1RINA 4XFIA 4XHBA 3VZNA 2VC9A 3ZSMA 1ZX5A 5F39A 3VBSA 5FIXA 5FZ6A 2O14A 1H6YA 3WR0A 2Q8DA 1LOCA 3H3UA 1AHSA 3OY8A 1W2OA 2DUOA 4P08A 4UF0A 2VZRA 4R9BA 1G9CA 4FP2A 1RC6A 1C1LA 4Q0QA 1BKZA 1PM7A 1O3TA 4LBKA 5FZ1A 2ENRA 1REDA 1GZWB 5KHJA 3U4SA 4M3CB 2QQKA 1JOJA 2Z2SB 2E9QA 4LITA 2Q8OA 2OS2A 5FZ9A 4N43A 2D43A 5IK5A 1NCQC 3S6PA 3AJZA 2OPWA 2NQYA 4RQPA 5FZGA 5LASA 5ABJC 1CIYA 2HWD3 1SPPB 2ES3A 2XQXA 1ZZ9A 4N9HA 1TZOA 3WNPA 3MZHA 3ZR6A 4YM0A 1QQP3 2J7MA 1W6PA 2WT1A 2RS13 3IIIA 4COUA 3LFMA 1HQNA 5T5LA 4AI8A 5C5TA 1D2SA 5FMDA 5IAXA 1EAH3 1FATA 1UL9A 3WP4A 4NO4A 4HK8A 1XQNA 2D6MA 1J1TA 2L9LA 4LO4B 4PI2A 4YW7A 5C6CA 4HXCA 4QQ2A 2WS93 2EXIA 3R6SA 1RYYA 5B2GB 1LODA 1XSQA 4K8FA 2EXKA 2C9AA 4GZ9A 3KQ4B 2W1SA 5CU1A 4C8DA 1JHJA 3HT2A 4QDQA 1AL22 1LGBA 3JU9A 5A3NA 1IG3A 2GNTA 4JKKA 5FBJA 2GMPA 1EYBA 2WAAA 3LAGA 4A41A 1HXS3 3I2GA 3MI8A 5D8AC 3BGAA 4LUKA 4FAGA 4AI1A 5B4NA 2XLAA 4KG8A 1Y4WA 5KXDA 2YUEA 4FTEA 2YPJA 4AXOA 4B3NA 4Z92B 3FHIB 2YU2A 2GAUA 4W6WA 1JI6A 3SEPA 4RR3C 3K77A 2VMFA 5FZHA 4P9IA 3WNNA 1PGW2 3I2HA 3Q8EA 3J26N 5FY5A 1N3PA 1VAMA 4NWVA 1BZWA 4NRQA 2Y8KA 1MZ5A 4JC1A 3V56A 3ZMOA 3KHCA 5JPMB 3OOXA 1W2UA 3IDAA 4AFBA 3MIDA 1QQP2 4AAPA 1SFNA 2RS12 4LQRA 5E16A 3LA3A 3RZMA 2CTVA 4YNIA 1CAXA 5C3PA 1OVPA 4AI9A 2Y60A 1OBNA 3ZFFB 3WCSA 4DS0A 3JD73 1EAH2 1HJGA 2W1WA 4J25A 2Z69A 3H8RA 4L9BA 3OG2A 4JDNA 2DWRA 2HBTA 3QH6A 5DAQA 1XB9A 5IUQA 3JB8A 2QNKA 3I97A 1QJEA 3LOIA 1JHNA 1Y7BA 3MPBA 4LO5B 4NPRA 4YGBA 2VU9A 4A7KA 4YW3A 2XG3A 3WQ7A 5FKCA 1OF3A 1GOFA 1OOPA 2RE9A 3DL3A 4HVRA 3Q8CA 5FYZA 3HT1A 3EO6A 2WYFA 1GFF2 1RUD3 3CIHA 5J7MA 1RVF1 3GCXA 2A6ZA 2RMU3 3S0MA 1OPOA 4CCLA 2R043 1HXS2 3H8OA 4LLOA 2Q8CA 2WNVC 3VBHC 2NPIA 1AR81 1KS5A 2J1RA 5D8AB 1R082 5ISLA 2Z4FA 3N7JA 1KD7A 2ETEA 5EYYA 5HV4A 1WMXA 3D4KA 1POV3 3BTYA 5B4XA 1UW8A 4CPBA 2DCJA 5IK7A 2VW2A 4CVUA 4FPEA 2JG9A 1QOSA 5CFCC 4QAWA 2MEV1 2BEOA 4RR3B 3AMQA 2OW4A 1UKRA 5JOXA 5LCWL 5ANNA 3KCCA 1MZEA 2BFUS 3ZFGC 1PVC3 5FYUA 4MX3A 4FT8A 3U78A 4IEXA 5LB6A 3KV6A 1WCKA 4R4XA 3WG3A 1W9YA 3ZMNA 2XUMA 4Z8BA 5KBFA 4LIUA 3UJQA 2BTVC 5FZOA 2XJSA 3BUCA 1LGNA 1VBD3 1CJDA 4MHUA 3AL5A 4NJ4A 3CMGA 1H0BA 1IHMA 5FUNA 1H8TB 1WWYA 2DVDA 3WXPA 1SLIA 3JD72 4QX7A 1TMF3 4XUQA 2XOMA 5FY7A 1CN1A 1YHFA 2RM23 3KB5A 4OLLA 3NJYA 2RVAA 4ISQA 3VD3A 2XONA 4CDXA 3CZJA 1YIPA 1NXD1 1JYTA 3AMNA 1TEIA 4A7YA 1CONA 3A23A 4DXRA 4NHMA 2WRAA 5L7OB 1RUD2 3POBA 4V2VA 1I9RA 3A0NA 5FY0A 1JZ2A 5HCHA 1HB4A 2QQOA 5C8WA 2WQ4A 1PIV1 2RMU2 4OUSA 1YQ8A 5FXWA 5GLTA 3THDA 2J1VA 2WSVA 4GMP1 5DMYA 3VDDA 2R042 1EV13 1C4RA 2YROA 4OUMA 2VUCA 5A7NA 5CEHA 3VBRB 5EIYB 1BMV1 3LZZA 2A3WA 4BQXA 2D6KA 3VKOA 1MQTC 2EICA 4XF4A 4XDOA 1XC6A 5C8CB 4Q4X3 1V6IA 3AM2A 1FPN3 1NX9A 4PHZA 5HXVA 1IPJA 3D8CA 3ZKUA 5IATA 3I2JA 1HRV3 1JU4A 4RYDA 4FPCA 4QXHA 1WGPA 3B7MA 1S0FA 4MZUA 1PVC2 4ZKTB 3ZN4A 3GZUC 4EWDA 5GZCA 3UESA 1AJKA 1PHMA 3HQXA 5CA6A 3PLQA 2DTYA 1W6MA 3T2OA 4GH4A 4DB5A 1ZA4A 3ZXFA 1R1A1 3HN1A 4UFLA 2UYBA 2D3SA 2ZGMA 1EUTA 5LEKA 1VBD2 2VMGA 4XF9A 3U37A 3KMHA 4QPGC 1T6BX 2BGOA 2WNEA 3WF3A 1LCLA 1TMF2 3MF9A 1VLNA 1ONAA 1Q3EA 1V6NA 3QOPA 2XBO3 2TBVA 1WKYA 5CFDC 5FZ7A 4D6RA 1RMU3 4TXWA 5FJKA 1S0IA 3RWKX 3RS6A 2CGOA 2PLV1 3CF6E 1PVXA 4FFGA 4Q0UA 4XUNA 1AR73 1MEC3 3OGSA 1ND2A 4XFGA 3FLPA 3WHUA 2ZX1A 4C90A 1UY2A 2Y6GA 4QPWA 2ZX3A 1YQ2A 5GZDA 1W2TA 1T6GC 4QX0A 1EV12 2HLEA 1XNBA 4FOYA 3PNAA 2QQUA 4ISRA 4XXAA 4AI0A 1BVVA 4BQ3A 4XJUA 4JGYB 4S2GA 1FPN2 4XUTA 1YUDA 4HG6B 1P8JA 1ST8A 4DMIA 5DABA 1PO23 3HN3A 3RFRA 2Q5TA 3BCWA 4YVWB 3ZDVA 4IGQA 2DCTA 4Q4Y1 2HWE3 4YWAA 2XVGA 2F6BA 4N9IA 5LY1A 4Q29A 4RFRB 1UAIA 4W65A 4P9WA 4HPKA 3R05A 3OY8B 4BK5A 4GD4A 3AJYA 1JUHA 2VBBA 4DO0A 2VZVA 2JIGA 2GMEA 1BCXA 4DY5A 1SMVA 1JTZX 2JX9A 1BBT3 1BQPA 5KHKA 3AB0A 3N3HA 5FQ0B 3USUA 3LA2A 4NHXA 3RQ0A 2XBO2 2A6WA 2JDKA 1O3SA 2RDRA 1W8OA 1RUOA 5CZKA 1RMU2 4RHV3 3R4SA 5IAVA 4CP0A 4N43B 2C1FA 2QVSB 5A7QA 2BWCA 3APBA 3WUCA 2QUOA 1GNHA 1WCSA 3H3ZA 4Q5OA 4RQPB 3I3MA 1SEFA 4GWNA 1MEC2 3URFA 2FDKA 1MZ6A 4ZU4A 1X82A 3ETPA 1AYN3 4MO3M 3OCPA 2FBEA 4O9GA 5FY1A 1W6PB 3UL2A 3H1MA 2ZEZA 4L0PA 4LKFA 4IEOA 1O59A 4QQHA 3T0BA 4EZ4A 2A6YA 1PZ8A 2LTNA 2Z5WA 2ZGRA 4P5YA 4KWLA 4Y1YA 1RUG3 2D5FA 1OFSA 4Y5SA 4ZY9A 3B9IA 4HMZA 4RL7A 3DPRC 2DU0A 3FHQA 3IB3A 3KVBA 2QZ3A 2XB6C 2ZHLA 5FYCA 3AMMA 2PA7A 2Z42A 1OLRA 4AVAA 2CAVA 2E51A 3DV8A 1D4M3 4EYUA 2WFF3 1PO22 1LHVA 4RGGA 4KQ7A 3A7QA 3M3IA 3KQRA 4OMCA 2RS53 2HWE2 1A34A 5DDJ1 1ULCA 2VPVA 1WD3A 1ZBE3 4RD7A 3RVHA 3ZIWA 4BM8A 3GF6A 1DQ4A 5SV5A 2ZX2A 1PGSA 4DIQA 2HWB3 1C8M3 2EF6A 5F8PA 2GC3A 1TG7A 2B42B 3S7EA 4QGMA 3PL0A 4LHNA 2PQSA 5ACA3 1BBT2 5FZIA 2HH9A 2H0BA 3IAPA 3PUSA 3KS7A 4QB1A 1ZREA 3SHRA 4JHZA 4PIYA 3B5LB 3T0DA 4XZUG 3V65A 4RHV2 1AR93 1NA1A 4KU7A 1SLCA 2D40A 4J6GA 4OQ9A 1OLQA 3VBFA 4A4AA 4E8CA 2FDHA 3OTFA 2WZR1 2OIIA 5BY5A 4NIIA 4UWDA 1NYWA 5C4WA 5BV6A 2ZGQA 5F5QA 4YSFA 1AYN2 2NYYA 5LRRA 1CAXB 2KA3A 1HN1A 5E89A 1YJLA 4AQ2A 4BQ5A 4NIHA 1V6JA 2RJLA 2JD4A 2OVUA 5FYYA 2JG8A 1RUG2 3N7KA 3PUAA 4QHZA 1RJ8A 3M8LA 1KGYA 2A3XA 4FFIA 2KD7A 3WCRA 5AC93 3UNPA 5A80A 2VVEA 2WFF2 3RJRA 1D0GA 4HOOA 3VD5A 5CYYA 5C71A 2A6XA 5EYXA 2RS52 3MFAA 2R073 2BBVA 1VBB3 3NV1A 3B01A 5IWFA 1GWMA 3D82A 5LW9A 1JZ8A 1NUKA 1GNZA 1ZBE2 3PU3A 4URAA 1VPHA 4ARYA 4ZXKA 4I2OA 3UGHA 3BTAA 1RUI2 1C8M2 2HWB2 4R9CA 4WZCA 1G6NA 4D94A 1HJFA 2JDHA 3ZFEC 4FVVA 3W9AA 1ULGA 2VAUA 2D97A 5ACA2 1TNRA 4Q8LA 4IXLA 1MZFA 1MS9A 2XWBB 3UYJA 1AX0A 1J58A 4LPLA 3FUOA 3CNAA 3MW4A 4OHVA 4J1WA 4DFSA 2JG9B 1KDKA 2G19A 4IE6A 1XYPA 4JTNA 2WT0A 2AH2A 1AR92 1DQ0A 5C70A 5FO9B 5C9AA 1KDMA 5FLIA 4NROA 3N4MA 1LEDA 5C7GA 3IZOA 4JAAA 3EB7A 2WZPP 4K9SA 3AX4A 3N7LA 4EN0A 3KF3A 1JBCA 4FOVA 5FZ4A 1DGLA 3CJIA 2GN7A 5FZ3A 4BLJA 3NAPA 2DUQA 2VBPA 4XW3A 5EJ1B 4MV2A 5ERLA 5FPAA 1Y9GA 2VECA 1CPNA 1JS9A 3I7DA 1UXXX 2E7AA 1RL3A 3LPGA 1CR7A 4N53A 1LOEA 2W95A 3NKTA 3MPPG 1OLME 4XDPA 3WY6A 2QDRA 4Y24A 2HWC3 2D6NA 2P37A 2QTWB 3FL7A 3VKMA 3MICA 4COYA 5CG9A 5GLZA 1XU2A 1YI9A 1ASJ3 3ES1A 4TLGA 4LMFA 1FYUA 3OJBA 3FE5A 4BA6A 2GNBA 1AL21 1ND3A 1U0AA 2JDUA 5KWRA 4CDXB 1W6QB 5AC92 3CBNA 1JYXA 2FZ1A 4XUOA 3TN93 1OLMA 2TNFA 2VZ3A 4NIGA 4IEUA 3RYRA 1GQPA 2R072 3HBZA 3HEIA 1PM4A 3ITQA 1VBB2 4CEWA 3U4XA 4E4HA 2B45X 4JHTA 1XYOA 4MGTA 2O8QA 3K3NA 3VDDB 4LO8A 4E9KA 1RXFA 1Z0HA 2W91A 4ASKA 2ADEA 4PJYA 3UK9A 1YFUA 2VTFA 1GZCA 3J7MA 3OUHA 4AQ6A 2VOKA 3CKHA 3ELNA 3MW3A 4I30A 1PGW1 4XFCA 2GSYA 3T2TA 5ANQA 4AQTA 3KV9A 2CL2A 4FXKB 1D4VB 2W5FA 2DCZA 2JE9A 2ZS6B 1JW6A 4HN0A 4YW6A 3OPWA 5H9QA 5JVVA 3B93A 2YZ4A 3L2YA 1ULEA 3FZ3A 2D6OX 1LRHA 1MR5A 3U1XA 1QQP1 3JQXA 5KHIA 3AYCA 2RS11 1DIWA 3O1RA 2JDMA 1FNYA 4DEVA 2R6QA 2XL9A 2ATFA 1W6MB 3RG0A 5JZGC 1VMFA 4GH4B 1EAH1 4YVSA 1AXKA 2VW1A 4Y4RA 4P5HA 5FY9A 3FBYA 1OURA 3GM8A 3OBZA 3OGJA 3AZZA 4C1WA 4BHPA 2VOXA 2IVJA 2IXJA 3MEPA 3H7YA 3WLUA 4EN7B 2GH2A 4AG4A 4AVTA 1NZCA 4YZ5A 1ASJ2 1REFA 3MDPA 1BYHA 2O1QA 4ASLA 4FP3A 1JYVA 3POEA 1UIKA 4XXPA 3V0BA 3E1F1 4RS5C 1OI6A 1A78A 2A6VA 5FO7B 1NCRA 1HXS1 3LF7A 3NQHA 1BHGA 4JV4A 1IG0A 1UX7A 4FI9A 3HR9A 3PVNA 1R081 3GYDA 3W21A 4URTA 3BPSA 2JXAA 2AEYA 5SV8A 4K1ZA 5AVPA 1K5MA 4I0WB 4MUVA 4IV1A 2PAEA 3BI3A 1HIXA 5L9RA 5LBBA 5BXXA 3RNSA 5BNOC 4P9YA 2GU9A 2I2SA 2QZ2A 3MLJA 4LLFA 3ACFA 1PNFA 2CNAA 3WG1A 2WIIB 4IDZA 3N36A 2E53A 1X9TA 3GZEA 1LOAA 1SFPA 2DUPA 2N7GA 5I0DA 4WVVA 5BNNC 2VZTA 4MG2A 2HJIA 5J1XA 5GALA 1YFYA 3JD71 3J7NA 4HPKB 4YG6A 5T3NA 3O1SA 4EV0A 2VUDA 1LOFA 3I2FA 2JDAA 4CSWA 1QJX3 2RDSA 1D2QA 1WCDJ 3K51A 4R52A 2XJTA 5JIAA 4YM2A 1QMJA 2WO3A 4AEKA 2YBKA 2PHTA 2J1EA 4HFSA 5TSWA 2W3JA 3USUB 4AEDA 4CUCA 1GBGA 5A3TA 5KC5A 1W9TA 2SLIA 1RUD1 1B35A 4SBVA 3ZYPA 1ZNPA 3ZO0B 3KT1A 1YIFA 3W58A 1UIJA 2FCVA 2RMU1 1UMZA 4DOUA 4OHXA 2R041 3IPVA 4RFT0 4E4SA 1UWWA 1EPWA 3ZSEA 4FPLA 3F2ZA 4DUXA 5IK4A 5A70A 4WM8A 2OX0A 2ZMLA 3H8UA 4L92A 4LO7A 4IV3A 1GZTA 1NQJA 1OKOA 1POV1 1UQXA 2K2SA 3GCWA 1PMHX 1L7QA 1VRH3 4XBQA 3W59A 2VZOA 3RZGA 4B4PA 1H4GA 1OQ1A 1V00A 1FMD3 1W99A 5I8SA 3E5QA 1S4CA 4K8RB 5DUUA 1V9U3 2R1DA 2ARXA 5D1IA 5F5IA 2IUWA 1LHNA 1OPMA 2V5YA 5FYHA 5T55A 1GKBA 4AGGA 4FAHA 1LAJA 5LY2A 2FMYA 1R093 2BFUL 1OVSA 4FXGB 5DAWA 1PVC1 2PHRA 3VBUA 1W8WA 4QM9A 3VHRA 1OSGA 4HKLA 4CDQA 1XXNA 3NO8A 2VXRA 2V5DA 2K9ZA 4MXVA 3S5AA 2ID4A 3TEXA 4M00A 3E97A 1WW6A 3D5OA 1O5LA 1WBLA 2Q0AA 1X9PA 3PURA 3WF1A 4BYYA 4Q4V3 3LOBA 1MS0A 1VBD1 5FPBA 2JB4A 1COV3 3WNMA 3CLPA 3VZJA 4W8JA 2GDFA 3VZMA 4HVQA 2VBDA 4A6OA 2JJ6A 1E5IA 5APAA 3H7JA 1TMF1 3A4UA 4QX8A 4O65A 4HZFA 4E2GA 3OGVA 4CDUA 3HNMA 1QJU3 4CU8A 1QJX2 2CWSA 2XUEA 3SMHA 3H1WA 1QXJA 2BQPA 3ETQA 4GB32 2DCKA 1XNCA 1TME3 3DGTA 5T52A 4CXXA 1OMIA 1RUH3 2VD7A 3LSEA 4BQWA 1YO8A 3H8XA 5EXOA 2QQPA 4IE5A 1CQ9A 3ZM8A 3VBFB 2WFPA 1UXZA 1QJY3 4LR4A 2WUHA 2Y0OA 1EV11 4JDOA 4QD2A 4Y1VA 5F3IA 1UYYA 5C4WB 2XJVA 1JOPA 2GH8A 1A8MA 2V09A 5H9SA 3X29B 4AHZA 3LGRA 2YPDA 4ASMB 1GP5A 2OUJA 1VRH2 3EBRA 1W04A 1G9DA 2O8OA 1FPN1 1OUSA 4QPIA 1FMD2 1JODA 3VBHB 5C3SA 2QQVA 3SQOA 1V9U2 3AKRA 4FPFA 3H50A 1BEV3 2YXSA 4A3ZA 2JG8B 3VBOA 1BJQA 1QWRA 3EJKA 1JYIA 4PQQA 1R092 2LUWA 3PIGA 4IE7A 2P17A 1PX4A 2OT7A 5FYTA 4WVWA 4E2QA 1LJ7A 4L8QA 2SBAA 5EZWA 4KL1A 1HQWA 5A1FA 4AVBA 4K6BA 3VHNA 3NNJA 5J96B 1WA4A 4MXWA 4Y1ZA 1NLSA 5DG1A 4Q4V2 4UYBA 1COV2 4NHLA 3T0AA 4B7KA 1OH3A 2VR4A 4LTAA 2EIGA 1W8ZA 4C0BA 2VOTA 4B4QA 4IETA 2QDNA 2XBO1 5FPZA 1QJU2 3ZFFC 1H8VA 1RMU1 5GZGA 1S2EA 3NV3A 5IVYA 2LW8A 3FLTA 4X6QB 4IW3A 1DQ5A 2WNOA 1TME2 4WZFA 1PK6A 1I1EA 1WW5A 1MEC1 5DUVA 1RUH2 5J3UA 1VAKA 2R32A 1UF2C 5C9AB 4AL9A 3EMRA 5FZ8A 5FZCA 1QJY2 2QBXA 3WW3A 3OBRA 5A3PA 1QIQA 2FDGA 1X50A 2G9ZA 5J98B 4H2AA 3CJIB 1YQ6A 3SISA 1DGRN 3NAPB 4MYEA 1VIWB 4XTPA 2AZ5A 2JENA 4LBJA 4O61A 3GGLA 4N53B 2A71A 5IW0A 1QJFA 1LULA 4XFBA 1BEV2 2A73B 4ZONA 1PO21 4UXAA 4XURA 4XFHA 2J1AA 3C2UA 5JMCA 4CP2A 2NM1A 2HWE1 3QACA 3FJSA 3HVDA 4H7LA 5IK8A 5F6LB 3E5XA 3ATGA 3W20A 5LA0A 4CXYA 2R49A 3MUY1 3AC0A 4GKYA 4KGGA 5T5OA 2PTMA 2WC2A 2Y38A 1UZWA 1DU3D 2HWD2 2IXHA 2JDPA 1Y3TA 5KR7A 3PDQA 4E27A 3C7FA 1BBT1 2BNOA 1GICA 3RYKA 3B94A 3SITA 3UGGA 4PF1A 5C5UA 2WO7A 5FAXA 2F4LA 4LHSA 1OXCA 1H8TC 1WA6X 3Q8FA 2VZUA 1DZTA 3GZTB 3FFQA 3I3BA 3AKQA 4K20A 4N7IA 3WP6A 4AR2A 1ZBA3 2VZQA 1UPIA 1QU0A 2ARBA 2ILMA 3HQRA 3WEZA 4L99A 2VOWA 3CL1A 2PELA 3M7AA 2H6CA 4JDMA 2FD8A 1Q8PA 1VBC3 2WS92 1GOGA 3I49A 1AYN1 4QPYA 4AAXA 3I2KA 4AF9A 4QHBA 5L7OC 4LNVA 2VQTA 3SC7X 3OUIA 1RIRA 1F15A 3I4IA 2QQIA 2ZGPA 4MOAA 2JB8A 5A32A 4LO6B 1CGPA 3B3QE 2BUKA 3UETA 1PO13 4YVSB 1RUG1 5FBZA 4OHZA 5C3RA 3K46A 3RGBA 4LE3A 1XE8A 2GC1A 2TEPA 3U14A 2UWAA 1XJAA 3JBG3 3VBRC 4AWDA 4CEYB 3NRUA 2WFF1 2WNUA 1REEA 5C8CC 4FPOB 5C3OA 3TNQA 2E7QA 4A6SA 2RS51 1JN2P 1QXRA 1UZVA 4NPLA 2E32A 3FHAA 2G9GA 3IAQA 3PU8A 1O91A 3V0BB 4WVZA 1ZBE1 5FZBA 1SDWA 1FOD3 2YGLA 2JEMA 2PFWA 1RUI1 1C8M1 2HWB1 1F8VA 3IN9A 5I0RA 3T1LA 3KSCA 5LZ6A 1FXZA 5ACA1 1SLTA 2W39A 2KM2A 2EAAA 4FPGA 1K5MB 1GP4A 3ACLA 2C6SA 5FPLA 2VUJA 1SDDB 3BN6A 5FZDA 2XQRA 5DN2A 1D0HA 4HANA 3MV01 1AR91 2ET1A 4R9DA 4S2FA 4ES8A 3SEEA 2XH6A 1ZBA2 3BTXA 3AVRA 5JOYA 4BWOA 4META 2X29A 3POJA 2XDVA 3LDKA 1PNGA 3H9AA 3ZR5A 3SLIA 1VBC2 2QQLA 1N47A 3JXSA 2BVBA 2KXLA 3IT8A 4E4DX 4BZ4A 5K0UC 1OC1A 2X10A 4CXWA 3U11A 2AC1A 2HEWF 1W03A 2VQAA 4JVAA 1UKGA 1AYM3 3ACIA 2IFWA 1AXYA 2HWF3 1PO12 1UZYA 2D98A 3WV6A 1W2AX 4XHXA 4KG0A 5FO8B 3DXTA 2WAOA 1ULDA 4Q26A 1POQA 4WM7A 3AYDA 2VE1A 3JBG2 4OZOA 3N35A 2PHLA 2R063 5FOJB 2F17A 1RUJ3 3P3NA 5AC91 4OHYA 2HEYF 2W87A 4AEDB 3D0JA 4JGYC 2BWAA 5EHDA 2FHRA 4QB2A 3ZYIB 4DRVA 4EWEA 2R071 1VBB1 4NWWA 3PUQA 4XQWA 2G4IA 3KV4A 3LEGA 1EP0A 4AVSA 2PHFA 1W8FA 4YVWC 5FY8A 2ORXA 1FOD2 3VD7A 1AJOA 4IEVA 1DG6A 2VW0A 4PDWC 2Y26A 5A7SA 2QFEA 2VCMA 1VJ2A 2IC1A 3GJBA 3VBSC 4WM8B 3VKNA 4K7JA 1OD5A 4CRQA 4LBNA 4IV3B 3KT4A 4DINB 2VQUA 4W4ZA 4I3GA 3SCHA 1WUVA 3O0WA 5J09A 2VNVA 3KLSA 1ZZBA 4GJZA 3H42B 3N9QA 3AP6A 2D44A 3M2MA 3P3PA 4R9AA 4GA9A 2PHDA 2GNMA 4GAZA 1JMUB 5BNQA 1W9SA 2CV6A 1KFUL 3LDRA 3TEZA 4AZZA 3VBUB 2OZ6A 4HN1A 1H2NA 4XF1A 2XJRA 2RM22 4GJYA 5A3WA 4CDQB 2IFRA 3I59A 4N43C 5BNPA 1ZZCA 4L97A 2VNRA 3AK0A 4RQPC 5K0UB 1AYM2 1Q8SA 2C26A 2IXLA 2HWF2 4Z1VA 3NJXA 4D7TA 5LWBA 2WLQA 1MS4A 3OD0A 2LALA 5FLHA 3OEBA 1ASJ1 1IQAA 3AFGA 4OI4A 4CDUB 1LU1A 1YQ5A 4NHYA 1YXWA 1UU4A 4RA0A 4UW5A 1ODNA 2R062 4XQDA 3QD6A 3ZYJB 1ZRCA 1RUJ2 4NHKA 3R4DB 5LK5A 1W8TA 3KM5A 5EFUA 3S5QA 4AEJA 4YW2A 3WT3A 4Q4X2 1GP6A 3ME2A 1HRV2 1RUF3 4QGLA 5FK8A 5HXMA 3OYWA 5CIRA 3IDEA 2EVXA 3NVCA 4K40A 5LK7B 3BIWE 1UYXA 1W0OA 5FMBA 2YU1A 5GM0A 4J1XA 3MLLA 2WINB 3ZYGA 2IZWA 2ZGNA 4CCDA 4TTGA 4KWKA 4PDWB 1Q8VA 2B9UA 2E7TA 3NW4A 1ENRA 4OVEA 4XFAA 3VBSB 2O0OA 2H0VA 2PXJA 3WG4A 1F9KA 3OD4A 4XMIA 5GLWA 3VDBA 4UF0B 1WLDA 1DYOA 2RHPA 4QPIB 5FOBB 3LDBA 1WLTA 2DVBA 1G86A 3VBOB 2XHKA 3T4HB 2YC4A 2Y6HA 1S0CA 1ULOA 1WD4A 3ACGA 3J4UH 3WDTA 4LK7A 4EWAA 2Z79A 4COWA 4MLOA 1MPXA 3NNGA 4CP1A 5JDBA 2ZGUA 5FP3A 2ARAA 2P5BA 4BOWA 1UCXA 1GYKA 3CO2A 3RRDA 5JCTA 4MXWB 5JSRA 2LS6A 2PYTA 2VY0A 4AHWA 4AHYA 1AR72 4BJ0A 1UMIA 3UGFA 5JMOA 3S30A 2B8MA 1JYNA 4JGZA 1VRBA 3PTRB 4XZPA 4MGQA 2ZX4A 1VBE3 5CKQA 5FXVA 3ZPYA 3ASIA 4LKDA 1C5IA 5FWJA 3CQOA 4BXFA 4COZA 3O1TA 4PIXA 4BIOA 1VB4A 2WJSA 4BMEA 1R64A 2E63A 3DECA 1PK6B 1DP0A 3VKLA 4YGEA 4XDQA 4HK9A 1W3VA 4YRDA 5A6YA 1J83A 1CX4A 1RUF2 1AZDA 1OOPC 1IPKA 2A7AA 2YHJA 3IBMA 3M4FA 2X5IA 2VTXJ 3WP3A 1GQHA 1WMFA 3QCWA 1RVF3 4AI2A 1WW4A 3O1UA 3KVAA 1S0JA 5BNOA 1W6NA 1ALYA 3T2QA 5LEJA 2UURA 5LBEA 1VP6A 1MVQA 3M3CA 2R30A 3M3EA 3UT0A 4LKEA 2YG0A 4QU2A 2OYZA 2JG9C 4YG3A 2Y33A 4TYSA 3CDZB 2VH9A 2BBAA 2B9VA 5FMCA 2HYXA 1W3XA 2PMWB 3EYPA 4EROA 2BVVA 2BPA2 1SBDA 1QJX1 4CCKA 2A70A 4I0BA 4XCBA 4BCUA 1U5ZA 1PZ9A 1PMIA 2WZ8A 4RGAA 3RDIA 3RWNA 1LB2A 2IVIB 1DLLA 4BMBA 4GB31 1ZRDA 4MGIE 5FJHA 1VBE2 2JKBA 3E6CC 1IS4A 2JE8A 3PVEA 3OF1A 5IVCA 3AZWA 1DGWA 2C5DA 3C7GA 4K21A 1I5PA 3K2OA 4MVTA 3VHOA 1ENXA 4Z2AA 1F5FA 2JWPA 3OBTA 4IGOA 1YC61 4LOSA 3WW2A 3AP5A 1ODMA 4NR1A 3WW1A 3ZIXA 2DBIA 4AEMA 3C7OA 4CDXC 4ZZ8A 3T2PA 1A8DA 1QNYA 3A22A 3I3QA 2ERFA 1D4M2 1J3QA 2AGSA 2WWJA 4LHKA 1OOPB 1RB8G 3AKPA 3BB6A 1VRH1 4CU9A 2YC0A 5K7PA 2OQ7A 4QHOA 3V64A 1L7RA 1O4TA 1FMD1 5A32B 4C91A 1R1ZA 1V9U1 2ZKNA 5IVBA 4AFMA 5A33A 1G9BA 3VDDC 2ZMKA 4ES9A 1NKGA 1DYPA 4XTMA 3T1MA 1R091 4CP9A 3U10A 5HV0A 3TEYA 3WQBA 3AZYA 4YLZA 5FDBA 4LUMA 2BU9A 2QJVA 3AMHA 1Y9QA 2VZPA 4GULA 1YJKA 4YW1A 5GJ6A 5LA2A 1GQGA 2UWBA 4KH9A 4AGVA 4Z2WA 5EV7A 4UFJA 4Q4V1 5LA9A 4CPBD 2VTXA 2ZHMA 1COV1 1YRZA 1SCRA 1W05A 4XJ8A 1O5UA 1LOGA 1UYPA 3IMNA 1RUE3 4A2UA 1XE7A 1ZZ7A 1SPPA 2NZ9A 1X8MA 4FQZA 4P02B 4OQ8A 1LESA 2VXJA 1XU1A 3MGUA 1QJU1 4C1XA 5JUVA 1GR3A 4GH4C 3RMYA 1NT0A 3ILFA 3UV9A 1KS4A 2PAMA 3ECQA 2BNNA 2RJ2A 2ZZJA 3KZ4C 3LEMA 1UU6A 1GANA 3I3DA 5FZOB 1TME1 1CAUA 3J8F3 4CDWA 1NQDA 1CPMA 1RUH1 3LCPA 3HJRA 4LBMA 1XYNA 1H1MA 4YW5A 5IVVA 4FSJA 4A3XA 5IVEA 1QJY1 4KNCA 4EZHA 2W1UA 3RZLA 1GWKA 4HLTA 1S0DA 3TWIA 2VG9A 3CU7A 1RUC3 1PGL2 1K42A 1TVGA 2V4VA 2EIDA 2BOIA 1W28A 3M3OA 1FI2A 1ND2C 3NJZA 4NAMA 2P4EA 5CKMA 2WQ8A 2B5HA 2PLV3 1QGLA 3VZOA 1RJ7A 1BEV1 3POYA 1QOOA 3RZHA 3BU7A 3ZN6A 2DV9A 1G7YA 4DXSA 4WM7B 3WX5A 1W0NA 3ACHA 2IWGB 5IFPA 1X33A 5FXZA 3PIJA 1CIWA 1HKDA 4KWUA 2R0FA 3HPNA 1NZIA 3I54A 3TEWA 2I07B 1Z7S3 2HWD1 3ZYFA 4QXKA 4QQPA 2JIJA 1NCQA 1RUE2 3LWCA 1XNKA 4QM8A 5ABJA 1S2BA 1OH4A 2VO5A 1K3IA 2D5HA 4IGPA 5E1RA 3AL6A 3KCXA 3DKQA 5KC6A 4OI2A 4CTEA 4ZU7A 1YWKA 2VVFA 4MGZE 5F32A 3DYOA 4QWNA 1OQEA 5KHHA 2VNOA 3PTYA 4UW6A 4BU2A 4JZRA 5FP9A 2CDOA 3J8F2 5DAXA 3SH3A 3ES4A 3V0AA 2HWC2 1QHDA 4OZXA 2WS91 4OI0A 1POV0 4Q1RA 3VLBB 4AFDA 2AREA 3K48A 4XABA 4A45A 4AVCA 3Q8BA 5KXCA 2VQ0A 1WW7A 3VDAA 4X8PA 1ZZ6A 4QQLA 5BNPB 3ZYHA 1RUC2 1S1AA 5G05L 1DZQA 1H6XA 2YYOA 4JQTA 2RG4A 3TN92 4QXCA 1IKPA 5CB7A 3MIHA 4ZS3A 2FDJA 1ZZ8A 4NUBA 3LQCA 3THTA 3NKGA 1ND2B 5FZKA 2YFZA 2ZA9A 1JOBA 2BGCA 2OPKA 4GIQA 3O5SA 1J3RA 1WLWA 2DFBA 4KGQA 4MGSA 5FZLA 5JXHA 2DBNA 3KGZA 1VAVA 2Y34A 5D8AA 3BIEA 3VDCA 2Y64A 3MUZ1 3ZKYA 4NOTA 1JZ3A 1Y43B 3HQUA 3MIGA 4N90A 2WKKA 2W2IA 3FLRA 4OCTA 3PVBB 1T2XA 4QMAA 3VZKA 3L2HA 3O1OA 1Q5OA 2V4AA 4IUGA 4UFMA 3WNKA 4UFIA 5FYMA 4DEQA 2GMMA 1Z7S2 4RR3A 2IXIA 4K1YA 2ET7A 3Q8AA 4XJ9A 5E6HA 1URXA 5HPOA 4C0HA 4FO9A 2X53S 1ZRFA 1XPWA 1VBA3 1NY72 1C3HA 1JXNA 5D2AA 5AVAA 4EN8B 1QNWA 2RDQA 5I0TA 2P3JA 1YLLA 1ZBA1 2XJUA 1EUUA 3RI8A 2VZ1A 2VULA 4M0HA 3VB9A 4YPJA 4FQ4A 2YDEA 3AKTA 1MACA 4M4PA 1VBC1 5LBCA 4ZU5A 1HDKA 2BZDA 1UY0A 4Q2FA 4U2AA 3HNBM 4WBBA 1F4AA 2HBUA 1TQ5A 3FMGA 1FV3A 2WN3A 1OHFA 3ILRA 1BK1A 5JI7A 3VBFC 4BXSV 3HBKA 1PO11 1YCIA 3WF0A 4ONUA 1F5JA 3JZVA 2XVKA 5C4WC 1NG0A 2A3YA 4Q4W3 3PUIA 1WMDA 3SH4A 4ITCA 3NV4A 3JBG1 3ZPOA 1PX3A 5IFTA 1H2KA 1V6LA 4IL7A 2WZR3 4YZ2A 4JGZB 3BYWA 2AR6A 2QQJA 3T3YA 1UNBA 2PN5A 3WF2A 2WNVA 3VBHA 2J1UA 4QDRA 1ENSA
chains in the Genus database with same CATH topology
2D3PA 1LECA 2R0HA 3NWKA 2JG8C 5A3LA 5I93A 1FOD1 2ZGKA 1KRIA 1Q43A 3VKFC 3ZXEA 1N3QA 5CFCA 1QXPA 5K9YA 5I91A 4O9EA 2CWMA 1HLCA 1VBA2 4YG0A 3ZFGA 1HRI3 2ZHKA 4ATEA 3BPZA 4BE3A 3RPQA 4EN9B 2X5IB 5KXBA 4Q0PA 1O3RA 4D7YA 4LBQA 3WDXA 1SFYA 1F31A 1OKQA 3BOWA 3VL9A 1W6NB 2RM21 4Z07A 1O3QA 3L9JT 4CZSA 3UKNA 5DZGA 3WVJA 4KBBA 3OGGA 4KWJA 1AYM1 5C9AC 1Q8OA 2HWF1 4FOQA 4F7ZA 1NA1B 4AFCA 1X7NA 4NVPA 3WQ0A 4Y22A 3R0RA 1BXHA 1CVNA 4AI3A 4HETA 4Q4W2 3CJIC 3ZSKA 2R061 3NAPC 4XYXA 1RUJ1 4DQAA 2UU8A 2VUAA 1MS3A 4N53C 1I6XA 4Q4X1 4LA3A 4MGKE 1HRV1 4XIOA 3D0SA 1MQTA 1ZVFA 4WVMA 2D3RA 2RS33 5AFBA 3VGIA 4Y4YA 4V1PA 1G8WA 5CAZA 5T54A 1HRI2 4GQ7A 3AXDA 3BOPA 3C3VA 5DZEA 2NN8A 4CEWC 5A33B 2XLFA 5CG8A 1HW5A 2VGDA 4ORFA 2ZGLA 3BALA 1H9PA 3EQEA 4QPGA 2DCYA 3POWA 4GKXA 3LA7A 5FQ0A 2HEVF 4FOWA 3RI9A 3ZX7A 2ZTNA 4FPHA 1RGSA 4IEQA 3Q9OA 5CFDA 1AR71 1H1IA 2Q4SA 1RHI3 1RITA 1GLHA 3WG2A 1H2MA 1O7FA 4YARA 4HSJA 4Y5Z0 4FPKA 4YVSC 3AP9A 5JR7B 5HCFA 1CAUB 4CDWB 1C57A 1KITA 1SBFA 4M0NA 1RUF1 4CEYC 2TUNA 3AZVA 1AR63 4FPYA 2Y0IA 3FX3A 4IESA 1DHKB 4NN0A 1SLLA 1WLCA 1V70A 1IKQA 1S0GA 2YMZA 2RS32 4BH9A 1CAVA 1ND3B 4YGDA 3A0KA 2HYKA 2AUYA 3UKTA 1NCRC 2UY8A 4BPZA 2FZ2A 4YZ1A 3ZXDA 4XIKA 1C28A 2PHUA 4CEWB 4AGRA 1U5IA 1LTEA 3SNMA 2X8KA 5J48A 5L19A 2RR13 1K5MC 3ZN6B 4IV1C 4I02A 3WHTA 1R083 1XRUA 1UN1A 2ZAAA 5FFOC 3RZZA 4RHV1 2XJQA 3NV2A 4GMP0 4YFZA 1QH6A 1KJLA 1X36A 4LBOA 2DYCA 1CAWA 1SLBA 3FUQA 3EHKA 4UW4A 4I01A 1IOAA 1RHI2 3U07A 1NCQB 2DVFA 4R4ZA 5ABJB 4TZDA 1QKQA 1SQ4A 4DPNA 1VBE1 2PHXA 2XGXA 4W6YA 1U5YA 1B09A 3MW2A 4L11A 1OQDA 3DKWA 2XVLA 3GBGA 4LE4A 4XMAA 3FBMA 1LOFC 3LB9A 5H9PA 2P3IA 3GHMA 3V0AB 3HIFA 1U5XA 2V73A 3JCIA 4PCRA 1AR62 4GALA 2IXCA 5FMOS 1D4M1 4AEDC 5JOWA 3DPRA 3E5UA 4DZGA 2CYFA 1B35C 4XETA 2XLGA 3DN7A 4PF5A 4LEJA 1QF3A 3OPZA 3MYXA 2ZX0A 1NCRB 3B9CA 3KCYA 1ENQA 3ZDSA 4WM8C 3MLKA 4IV3C 2RR12 1H30A 5BUVA 1UZZA 4IV1B 2NMNA 2ZAHA 4YYOA 3WDWA 2CY6A 1W39A 5I8TA 2ZOEB 4P9JA 1BVP1 1UU5A 3VBUC 3BODA 2B39A 5FTTC 2UY9A 4SLIA 4CDQC 1YI7A 4IEYA 1PZ7A 2ZGSA 4JTOA 3ZXLA 2DVGA 2HKXA 3M70A 5KXEA 3RSJA 2VVDA 1AUYA 5JWPA 3I8TA 4G4FA 4PIZA 4XJWA 4CDUC 1CJPA 2DVAA 1N3OA 5BPXA 4S2DA 4JCKA 4DY3A 1S2KA 1PGL1 4BIFA 1GSLA 1HV0A 1SCSA 2ZBJA 1W6QA 3AYEA 5CVRA 2YGMA 1YNAA 1B35B 3USSA 3SCFA 5HI0A 3AFKA 3ZSJA 4Y1UA 2D7FA 2AENA 3AMPA 3GHNA 3IPVB 3GBFA 1YFWA 3ZYRA 4HT1T 5T5JA 2MHFA 2WNVB 2CAUA 3G7DA 4QPIC 3RJ2X 2C0ZA 2EXJA 1TE1B 3VBHB 2WL1A 2OUHA 4HSLA 3ZFEA 4COVA 5BYNA 3VBOC 4AQSA 4PLNA 1RUE1 3TRSB 2WT2A 4F8AA 1L3JA 1W6OA 2VNGA 5CFCB 4OFGA 1C1FA 3ZFGB 1FV2A 3IWZA 3J8F1 3TB0A 1C8NA 2HWC1 3SXWA 4LBQB 2PAKA 4LBQD 1CESA 1CD3G 4D69A 1NOVA 1RUC1 4D3WA 3E6DA 3WP5A 1KJRA 3TN91 1PK6C 3MIBA 2Q1ZB 4TLFA 2W52A 3VL8A 4YW4A 1AX2A 2WSUA 4Y22B 5GZFA 3VN4A 5FREA 5CNAA 4FBFA 4ATFA 2GN3A 2EAKA 1AF9A 2XWJB 4LT5A 2P34A 1JUIA 3SH5A 4JRAA 5GLVA 5C33A 3ZSLA 3U0ZA 5GZEA 2B46X 3VV1A 1H1AA 1Z7S1 2PHWA 4Y20A 3TOJA 4FTSA 2XKOA 1MQTB 3H1YA 4F3JA 3IKWA 4Q27A 1NY71 4WVMB 3ENRA 2MPFA 5H9RA 3LKJA 3POSA 1FT9A 5L73A 1FAYA 4P9LA 5T5PA 1OA4A 4QQOA 3O12A 4QT6A 1YYNA 1QJZA 2XPJA 1FX5A 2Q1MA 4Q0SA 5JZGA 4UBHA 4R8HA 4M3CF 4FCAA 4H3WA 4QPGB 3R4UA 1Q56A 3DF0A 1IS5A 3THPA 2NP0A 1V6OA 5CFDB 4OHWA 1AVBA 4IQPA 5E88A 3TYJA 1WBFA 2W08A 4RS5A 5I0SA 5FRAA 3GNEA 3FFZA 2D6PA 2QCSB 2GC2A 3AXEA 4U36A 3J9SA 3ZXGA 3INAA 3PHMA 1SLAA 1DQ1A 5FLJA 2WNUC 2JICA 4BLIA 5JPNB 1TNFA 1VBA1 1Z78A 4B29A 2JDZA 1AR83 1VR3A 2XL7A 1CAVB 4YZ4A 2W0XA 2DU1A 2DTWA 1LU2A 2WLPA 5BNNA 3ALQA 1A3KA 2MEV3 4LA2A 1JYCA 3WDVA 3NL1A 2IXKA 2BW8A 3AKSA 3LSDA 4QGNA 1RUI3 3UJOA 1UPSA 3HMYA 3WZ1A 1HQLA 2K0GA 5HBAA 2R16A 1GV9A 4I3PA 4LHLA 5DUWA 4H7MA 1V6KA 1NE6A 4XILA 1LEMA 4XF3A 2PQQA 1CAWB 3M3QA 4P14A 2ZCWA 4Q4W1 1HX6A 4EN6B 4UW3A 4XJZA 4XE9A 4AVVA 2GC0A 1DYKA 3UKVA 4GXLA 4XFFA 3ZN5A 3E6BA 4LULA 1G9AA 5JIUA 4M3CE 1DF0A 4OI1A 4FTBA 4AK3A 1M06G 1MS1A 3PJQA 1RVF2 4WM7C 5F1RA 3KD4A 1ZM1A 5FCCA 1PIV3 1LKNA 5JAXA 4GMP3 3FC0A 1C5HA 1EY2A 1GZWA 2WNUB 3DPRB 4M3CA 3FWEA 1HRI1 5A3MA 1AR82 5JSOA 4Q1PA 3QH7A 1KQRA 1DFQA 3JQWA 1J3PA 2XJPA 3GZAA 4WV8A 5F6KA 2MEV2 4G3YC 4X8NA 1W0PA 2YY1A 4TWTA 1IZ3A 3EXUA 5AFEA 1MS5A 4HL0A 2G9FA 1U12A 3IDBB 2ZGOA 3G6JB 1AL0G 3RMXA 3ZXJA 5JLVA 4BQ1A 5CADA 3TBDA 1QH7A 1IS3A 4MH0E 1R1A3 4L2NA 1YFXA 4S2HA 4YZ3A 2R1BA 2D6LX 5JSPA 2CGPA 5KHGA 5BNPC 4G9SB 3O14A 3GALA 5I8YA 1OA3A 3AZXA 4B7EA 4HKOA 5L36A 3ROUA 5J36A 3M1HA 2F4PA 3ILNA 4X6RB 2DURA 1LGCA 1G9FA 4P9XA 4N7UA 4PLMA 1OA2A 5F9TA 2A5ZA 1H2LA 4INDA 3MIEA 1S55A 4E2SA 2RS31 1AX1A 1PIV2 2ZMNA 1VALA 1I3HA 3HD8B 3PMSA 3WOGA 4FPJA 1DQ6A 4KU8A 3IM0A 4Y26A 2BNMA 4M01A 1BMV2 2D93A 3QBQA 4OULA 3I2DA 2WWSA 3ZXAC 2ZPXA 5CBLA 2EALA 1RTVA 4Z82A 1LHUA 1HV1A 4PBPA 2EXHA 4Q4Y3 5FPXA 4TSVA 3ZFEB 1XNDA 4H14A 1H9WA 4XBNA 3ZFFA 3ZXKA 2BYVE 1R1A2 4HVOA 3TNPB 3IIAA 1RHI1 3WINE 5HCAA 5IT6A 1W6OB 2WA4A 1M4WA 1VB2A 2DFCA 1SBEA 3O0XA 1NXMA 2A75A 2UYAA 3WDYA 5DZFA 3JUUA 1NE4A 3I59B 2ZZQA 3NSTA 2UWCA 4XBLA 4XOGA 5DUXA 3ZVXA 4B4RA 4I09A 3IDCB 1O4YA 4JQRA 2PLV2 2E6VA 1AR61 4JGZC 2B7YA 4HKWA 4PLOA 4CEYA 3WDUA 4XF0A 3VHPA 1JH5A 3AP7A 1AXZA 4IEPA 3MFCA 3N7MA 1DGWX 1GZ9A 5DG2A 4AHXA 3QLQA 2QKDA 3WQ1A 1QOTA 4AYUA 2NMOA 2QE3A 2FQPA 3AP4A 3OYWB 1DZRA 5JOZA 2RR11 2W68A 3HAGA 3B02A 4AE2A 3VZLA 1NLRA 2P2KA 1KFXL 1MVEA 2P3KA 2X5IC 1ZRRA 4EJRA 4DNYA 1DQ2A 4HBNA 3TAYA 2DF7A 4Q4Y2 1IGOA 5DDJ3 4LBLA 3D6EA 1IS6A 4GWMA 1H8TA 2EA7A 4Y20B 5J37A 3WD5A 4AW7A 5GKAC 4XEZA 4JRLA 5EJ3A 2VMIA 3KT7A 3B69A 3HWJA 1A6CA 1NA1C 2ZHNA 4RSUA 2LM3A 3PJYA 4AFAA 4H55A 3O0VA 4D7SA 3AYAA 5L7OA 1MS8A 4P9GA 4A7ZA 2RJKA 1DGRA 1V6MA 1EPZA 1SACA 4PQ9A 5JZGB 3VUOA 3DUIA 4IEZA 3WNXA 2Q30A 5FMOL 4XJAA 3S7IA 3VBRA 3WUDA 4Q8KA 4YM1A 1OFNA 3CEWA 5GLUA 4DRRA 4GB33 3O7OA 2H6BA 5C8CA 4E4ZA 2JECA 3SCGA 1QY4A 2OA2A 1J59A 1S0EA 4RS5B 2ZKLA 4YGCA 1LENA 1H4HA 1LHWA 4Q0VA 4XPVA 1N1VA 1FNZA 4B8EA 4IEWA 5DDJ2 1X8EA 2MNGA 4DXZA 5BNOB 2FMDA 2WA3A 5E8AA 4UBGA 2VMHA 1DBNA 4MGYE 5DXDA 5HCBA 4F83A 4YFWA 1UX6A 1LOBA 2GZWA 4IERA 1KXGA 2YV8A 5K8SA 3RYPA 2ZACA 1LR5A 1F2NA 2AYHA 3PVOA 2ZGTA 3CJXA 2I45A 1N1SA 4QX5A 1I5ZA 4Y1XA 3MF6A 1N1TA 5I0UA 5K0UA 2JE7A 5BNNB 2WQZC 3PMEA 2GALA 2ZABA 1QDOA 1J1LA 3H0OA 5T50A 4K3UA 3MIFA 2WZR2 1RUNA 1S0BA 3JB4C 2ZJCA 1DDLA 4CDWC 1LHOA 1O4ZA 1E57A 4I0AA 1ZYBA 3ST7A 5LRSA 2GNDA 1QDCA 5JI9A 3B00A 1Q8QA 4YM3A 2NLRA 2OZJA 4JGYA 4CYDA 4EN8B 4W6XA 5EWSA 1ULFA 3WW4A 3GBWA 1APNA 1ND3C 4XQ4A 1N1YA 1WMEA 4YVWA 4PBOA 2XKPA 4MSVA 2CGNA 2I74A 1UD1A 2VOVA 1AL23 3KGLA 4PDWA 1RINA 4XFIA 4XHBA 3VZNA 3ZSMA 1ZX5A 3VBSA 3WR0A 1LOCA 3H3UA 1AHSA 3OY8A 2DUOA 4R9BA 1G9CA 4FP2A 1RC6A 1C1LA 4Q0QA 1BKZA 1PM7A 1O3TA 4LBKA 2ENRA 1REDA 1GZWB 5KHJA 4M3CB 2Z2SB 1JOJA 2Q8OA 2E9QA 4N43A 2D43A 5IK5A 1NCQC 3S6PA 3AJZA 2NQYA 4RQPA 5ABJC 2HWD3 2ES3A 1ZZ9A 4N9HA 3MZHA 4YM0A 1QQP3 2WT1A 1W6PA 2RS13 4COUA 1HQNA 5T5LA 4AI8A 1D2SA 1EAH3 1FATA 1UL9A 3WP4A 4NO4A 4HK8A 1XQNA 2D6MA 1J1TA 4LO4B 5C6CA 4QQ2A 2WS93 2EXIA 3R6SA 5B2GB 1LODA 4K8FA 2EXKA 2C9AA 5CU1A 3HT2A 1AL22 1LGBA 3JU9A 2GNTA 2GMPA 1EYBA 3LAGA 1HXS3 3MI8A 5D8AC 4LUKA 4FAGA 4AI1A 2XLAA 4KG8A 5KXDA 2YUEA 4FTEA 2YPJA 4AXOA 4B3NA 4Z92B 3FHIB 2GAUA 4W6WA 4RR3C 4P9IA 1PGW2 3J26N 1N3PA 1VAMA 4NWVA 1BZWA 3ZMOA 4JC1A 1MZ5A 3V56A 5JPMB 1W2UA 4AFBA 3MIDA 1QQP2 1SFNA 2RS12 5E16A 3LA3A 2CTVA 4YNIA 1CAXA 3ZFFB 3WCSA 4DS0A 3JD73 1EAH2 2Z69A 4L9BA 4JDNA 2DWRA 3QH6A 5IUQA 3JB8A 2QNKA 3LOIA 4LO5B 1JHNA 1Y7BA 3MPBA 4YGBA 4NPRA 2VU9A 4A7KA 4YW3A 2XG3A 3WQ7A 1OOPA 2RE9A 3DL3A 4HVRA 3HT1A 3EO6A 1GFF2 1RUD3 5J7MA 1RVF1 2A6ZA 2RMU3 3S0MA 1OPOA 2R043 1HXS2 4LLOA 2WNVC 3VBHC 2NPIA 1AR81 1KS5A 5D8AB 1R082 3N7JA 1KD7A 2ETEA 5EYYA 3D4KA 1POV3 1UW8A 2DCJA 5IK7A 2VW2A 4FPEA 2JG9A 1QOSA 5CFCC 2MEV1 2BEOA 4RR3B 3AMQA 2OW4A 1UKRA 5JOXA 3KCCA 1MZEA 2BFUS 3ZFGC 1PVC3 4MX3A 4FT8A 4IEXA 1WCKA 4R4XA 3WG3A 3ZMNA 2XUMA 4Z8BA 5KBFA 3UJQA 2BTVC 2XJSA 1LGNA 1VBD3 1CJDA 1H0BA 1IHMA 1H8TB 2DVDA 3WXPA 1SLIA 3JD72 1TMF3 1CN1A 1YHFA 2RM23 3KB5A 4OLLA 4ISQA 4CDXA 1YIPA 1NXD1 3AMNA 1TEIA 4A7YA 1CONA 4NHMA 5L7OB 1RUD2 1I9RA 3A0NA 5C8WA 2WQ4A 1PIV1 2RMU2 4OUSA 5GLTA 2WSVA 4GMP1 3VDDA 2R042 1EV13 1C4RA 2YROA 4OUMA 3VBRB 1BMV1 3LZZA 2A3WA 2D6KA 3VKOA 1MQTC 4XF4A 5C8CB 4Q4X3 1V6IA 3AM2A 1FPN3 5HXVA 1IPJA 3D8CA 1HRV3 4FPCA 1WGPA 3B7MA 1S0FA 4MZUA 1PVC2 4ZKTB 3ZN4A 3GZUC 4EWDA 5GZCA 1AJKA 1PHMA 3HQXA 5CA6A 3PLQA 2DTYA 1W6MA 4GH4A 4DB5A 1ZA4A 3ZXFA 1R1A1 3HN1A 2UYBA 2D3SA 2ZGMA 5LEKA 1VBD2 2VMGA 4XF9A 3KMHA 4QPGC 2WNEA 1LCLA 1TMF2 3MF9A 1VLNA 1ONAA 1Q3EA 1V6NA 3QOPA 2XBO3 2TBVA 5CFDC 1RMU3 1S0IA 3RS6A 2CGOA 2PLV1 3CF6E 1PVXA 4Q0UA 1AR73 1MEC3 1ND2A 4XFGA 3FLPA 3WHUA 2ZX1A 4C90A 2ZX3A 5GZDA 1T6GC 1EV12 1XNBA 4FOYA 3PNAA 4ISRA 4XXAA 4AI0A 1BVVA 4XJUA 4JGYB 4S2GA 1FPN2 1YUDA 4DMIA 1PO23 2Q5TA 3BCWA 4YVWB 2DCTA 4Q4Y1 2HWE3 2XVGA 2F6BA 4N9IA 4Q29A 4W65A 1UAIA 4P9WA 4HPKA 3R05A 3OY8B 3AJYA 1JUHA 2GMEA 1BCXA 4DY5A 1SMVA 1JTZX 2JX9A 1BBT3 1BQPA 5KHKA 3AB0A 3N3HA 5FQ0B 3USUA 3LA2A 3RQ0A 2XBO2 2A6WA 1O3SA 1RUOA 1RMU2 4RHV3 3R4SA 4CP0A 4N43B 2C1FA 2QVSB 2BWCA 3APBA 3WUCA 2QUOA 1GNHA 1WCSA 3H3ZA 4RQPB 1SEFA 4GWNA 1MEC2 3URFA 1MZ6A 4ZU4A 1X82A 1AYN3 3OCPA 2FBEA 4O9GA 1W6PB 3UL2A 3H1MA 4QQHA 4IEOA 2A6YA 1PZ8A 2LTNA 2Z5WA 2ZGRA 4KWLA 4Y1YA 1RUG3 2D5FA 1OFSA 3B9IA 4HMZA 4RL7A 3DPRC 2DU0A 2QZ3A 2XB6C 2ZHLA 3AMMA 2PA7A 2Z42A 1OLRA 4AVAA 2CAVA 2E51A 3DV8A 1D4M3 2WFF3 1PO22 1LHVA 4RGGA 4KQ7A 3M3IA 3KQRA 2RS53 2HWE2 5DDJ1 1ULCA 2VPVA 1WD3A 1ZBE3 4RD7A 3ZIWA 4BM8A 3GF6A 1DQ4A 5SV5A 2ZX2A 1PGSA 2HWB3 1C8M3 2EF6A 2GC3A 3S7EA 2B42B 4QGMA 4LHNA 5ACA3 1BBT2 2H0BA 3KS7A 1ZREA 3SHRA 4PIYA 3B5LB 3V65A 4RHV2 1AR93 1NA1A 4KU7A 1SLCA 2D40A 4J6GA 3VBFA 1OLQA 3OTFA 2WZR1 2OIIA 5BY5A 5C4WA 1NYWA 5BV6A 2ZGQA 5F5QA 4YSFA 1AYN2 2NYYA 5LRRA 1CAXB 2KA3A 5E89A 1YJLA 4AQ2A 1V6JA 2RJLA 2JD4A 2OVUA 2JG8A 1RUG2 3N7KA 1RJ8A 3M8LA 2A3XA 3WCRA 5AC93 2VVEA 2WFF2 3RJRA 1D0GA 2A6XA 5EYXA 2RS52 3MFAA 2R073 2BBVA 1VBB3 3NV1A 3B01A 3D82A 1GNZA 1ZBE2 4ZXKA 4I2OA 3BTAA 1RUI2 1C8M2 2HWB2 4R9CA 4WZCA 1G6NA 4D94A 3ZFEC 4FVVA 3W9AA 1ULGA 2D97A 5ACA2 1TNRA 4Q8LA 4IXLA 1MZFA 1MS9A 2XWBB 1AX0A 1J58A 3FUOA 3CNAA 3MW4A 4OHVA 4J1WA 4DFSA 2JG9B 1KDKA 1XYPA 4JTNA 2WT0A 2AH2A 1AR92 1DQ0A 5FO9B 5C9AA 1KDMA 5FLIA 3N4MA 1LEDA 4JAAA 2WZPP 4K9SA 3AX4A 3N7LA 4EN0A 4FOVA 1JBCA 1DGLA 3CJIA 2GN7A 4BLJA 3NAPA 2DUQA 4XW3A 4MV2A 2VECA 1CPNA 3I7DA 2E7AA 1RL3A 1CR7A 4N53A 1LOEA 3NKTA 3WY6A 3MPPG 2QDRA 4Y24A 2HWC3 2D6NA 2P37A 4COYA 3VKMA 3MICA 5CG9A 5GLZA 1XU2A 1YI9A 1ASJ3