3QACA

Structure of amaranth 11s proglobulin seed storage protein from amaranthus hypochondriacus l.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
445
structure length
372
Chain Sequence
QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVSVIRRTIEPHGLLLPSFTSAPELIYIEQGNGITGMMIPGCPETYQDQHQKIRHLREGDIFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSNTGNIFRGFETRLLAESFGVSEEIAQKLQAEQDDRGNIVRVEGLHTICSARLAVNVDDPSKADVYTPEAGRLTTVNSFNLPILRHLRLSAAKGVLYRNAMMAPHYNLNAHNIMYCVRGRGRIQIVNDQGQSVFDEELSRGQLVVVPQNFAIVKQAFEDGFEWVSFKTSENAMFQSLAGRTSAIRSLPIDVVSNIYQISREEAFGLKFNRPETTLFRSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of amaranth 11S proglobulin, a major seed storage protein from Amaranthus hypochondriacus L.
rcsb
source organism Amaranthus hypochondriacus
molecule tags Plant protein
molecule keywords 11S globulin seed storage protein
total genus 103
structure length 372
sequence length 445
ec nomenclature
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA01
2GC3A 3OD0A 4DINB 3OCPA 4WVZA 4HMZA 4YSFA 3U11A 2MNGA 2Z2SB 4BYYA 5J3UA 1CAXA 4J1WA 3FX3A 2IXLA 4HVQA 5JAXA 2P17A 3D82A 5KHHA 5BY5A 4KL1A 1NE6A 4JTOA 1CAUB 1J3RA 1EPZA 2XKOA 3LA2A 2XGXA 4I0AA 2BGCA 1DZTA 4NVPA 4IEZA 2ATFA 4D7TA 1O3RA 1WGPA 3IIAA 2BYVE 1NYWA 2VQAA 4Q29A 2PHLA 4FBFA 2FMYA 2QNKA 4QMAA 4XFFA 3IDCB 3I59B 3E97A 4IEWA 4UBHA 2XLAA 3E5UA 1O5LA 3LZZA 3ACLA 1L3JA 4HZFA 4Q0PA 1FT9A 4R52A 4MGYE 1YFXA 2XL7A 2BNNA 5LRRA 4QXKA 2QVSB 3NL1A 5KHGA 2D40A 1DGWA 5KBFA 1O7FA 1VJ2A 4KU7A 3BALA 3OTFA 1YWKA 1SEFA 4PIYA 3BB6A 4WBBA 3PVBB 3S0MA 2QJVA 2MPFA 1FI2A 3CF6E 4QX5A 3KGLA 3DV8A 3WW4A 1NXMA 1ZZ7A 2PTMA 3PNAA 4X6RB 3D0JA 5I91A 4JVAA 4O9EA 1ZZCA 4L11A 4IEVA 2CV6A 3NJZA 1ZRFA 3EQEA 1TQ5A 4I09A 1HW5A 5BV6A 2D93A 2EVXA 4N9IA 1O3QA 3ELNA 4KWKA 4KWLA 2EAAA 3H1YA 4QM8A 3QACA 4MGZE 5LEJA 1CAVB 1UCXA 5FLJA 1Q3EA 4D7SA 4MZUA 1YUDA 3JZVA 1IPKA 2GC2A 3E6DA 3CJXA 4KWJA 4I02A 2CAVA 4LLOA 3EBRA 4META 3BCWA 4YARA 3FHIB 4IEOA 2ETEA 5FPZA 1RGSA 2PQQA 3NSTA 2EA7A 2OYZA 4AVCA 1UPIA 2GZWA 3KCCA 3EHKA 2PAKA 3L2HA 3SHRA 1EYBA 4K8FA 3ZDSA 4N9HA 5FLIA 5I93A 5KHIA 4ZU7A 5JSRA 1QY4A 1JUHA 3DL3A 4MH0E 1RC6A 1RUOA 2I45A 3UKTA 4BIFA 2GAUA 3H3ZA 4XF4A 2VECA 3H1WA 2OZ6A 2Q30A 3LA3A 1CAUA 5BUVA 4PIZA 1OI6A 4RD7A 3FZ3A 4XFCA 3KMHA 3HT2A 5C8WA 1WA4A 4HSLA 4LULA 1O3TA 2MHFA 2IXKA 4IEQA 1PMIA 3I59A 4L2NA 1Y3TA 4MGKE 2BEOA 2XLFA 3GBFA 4ORFA 3HT1A 1OMIA 1YFUA 3LA7A 4LUMA 4P9GA 3M70A 3SCGA 3H3UA 5J48A 1J59A 3SXWA 1YHFA 1O5UA 3U10A 3KGZA 4AQ6A 4IERA 5T3NA 5JSOA 4YNIA 1G6NA 4EWAA 2PA7A 1X8EA 2Z69A 3SCFA 5E1RA 2OPKA 1X7NA 1UD1A 3C3VA 4Q0VA 2VPVA 2PAEA 2XHKA 2ZCWA 3MYXA 4UBGA 4WZCA 3MZHA 3H9AA 3CL1A 3H7JA 3LOIA 2Y0OA 4XF0A 4XF1A 1SQ4A 4OLLA 4BH9A 5I0TA 1O4TA 1ZNPA 4XEZA 2XLGA 1J1LA 2K0GA 2XKPA 3MDPA 4I0BA 3RYKA 3VHRA 4AVBA 3MPBA 4FAGA 4EV0A 3GYDA 2HJIA 2OA2A 4XETA 3CLPA 4QGLA 4LTAA 1UIKA 3RPQA 5JCTA 1DGRA 1OFNA 5F1RA 3H8UA 3IDBB 3LWCA 4PIXA 5I8SA 4HBNA 1XE7A 2B5HA 4H7LA 3IBMA 4XF9A 2F4PA 4LA3A 3E6BA 2O1QA 3ES1A 5FCCA 1ZVFA 2BNMA 4AXOA 4LEJA 1LB2A 2N7GA 1LKNA 1ZREA 3RDIA 1QWRA 2B9UA 3ROUA 4R8HA 2XL9A 2H6CA 3WW3A 2UY9A 3BU7A 1V70A 1ZRCA 3SCHA 4IEXA 4XFBA 1Y9QA 3H7YA 4IEUA 4XFGA 4JTNA 3E5QA 1VR3A 1NZCA 2V09A 3FFQA 4IESA 3BPZA 1SFNA 4EWDA 1J58A 3M3IA 5BXXA 3NW4A 4HSJA 3D0SA 4UXAA 1EY2A 4IEYA 2PYTA 4YYOA 4AVAA 3TNPB 5K8SA 1ZRDA 4OFGA 5I0UA 1GQGA 5KHJA 5I8YA 2FQPA 1QXJA 4E2SA 2ET1A 3H50A 4XF3A 5JSPA 3NVCA 2WFPA 4F7ZA 3KSCA 1GQHA 1UW8A 3S7EA 2CAUA 2QDRA 4PJYA 4E2GA 3I7DA 1CX4A 4ZU5A 3E5XA 4F8AA 3CO2A 4MX3A 1Q43A 1CAWB 4KU8A 1FXZA 5FDBA 4HLTA 5CADA 1J3QA 4IETA 3SMHA 2Q4SA 3OF1A 3ETQA 4MV2A 1I5ZA 1EP0A 4I01A 5I8TA 3ST7A 1XRUA 4IEPA 3I54A 3O14A 3WW1A 4QGMA 3FJSA 3UKVA 3DKWA 1RL3A 2UYBA 5FQ0A 2GC1A 4QM9A 2PFWA 3S7IA 1ZZ9A 5LRSA 1J3PA 2IXHA 1NE4A 1ZZBA 3QOPA 5KHKA 3LAGA 4HVRA 1UIJA 4ONUA 1CAXB 1IPJA 1ZX5A 4XFIA 2GH2A 5LEKA 1VP6A 2ET7A 2D5FA 2K9ZA 2UYAA 3OGJA 3FWEA 3RNSA 4TLFA 4XFHA 3TNQA 3N4MA 1ZRRA 1CGPA 4Q0SA 4I3PA 4AQ2A 5EFUA 3UKNA 4HVOA 2CGPA 4B29A 3USSA 1X8MA 4X6QB 4ZU4A 1RTVA 2O8QA 4YRDA 5FLHA 3NKTA 4EROA 1ZZ8A 3H1MA 2KXLA 5I0SA 4EWEA 2IXCA 4Q0UA 3RYRA 5D1IA 2DCTA 2GC0A 2HKXA 2UY8A 3WW2A 4J1XA 1I6XA 3U0ZA 1O3SA 4GULA 3E6CC 4QGNA 2PAMA 4MGIE 1LRHA 5E16A 1Q5OA 3RZZA 5BPXA 2E9QA 4Z82A 2IXJA 1LR5A 1DZRA 1XE8A 2QCSB 2D5HA 4XFAA 3RYPA 2WC2A 4FT8A 1YLLA 2OZJA 3HIFA 3EO6A 4O9GA 4I2OA 5FPXA 3G7DA 1RUNA 2BNOA 3ES4A 4Q0QA 5CU1A 3CEWA 2H6BA 3B02A 4E2QA 3HQXA 1YFYA 1YFWA 4Z07A 1CAVA 4LA2A 1PM7A 3DN7A 4JV4A 5AVPA 5HI0A 1X82A 4HN1A 3IWZA 4LUKA 4CYDA 1H1MA 2H0VA 2Q0AA 5I0RA 4BHPA 1QXRA 5EZWA 1U12A 2B8MA 1CAWA 1OD5A 3PLQA 2ZKLA 4HN0A 3FE5A 2IC1A 5CVRA 2PHDA 4MUVA 4FAHA 2C0ZA 5J7MA 2IXIA 4A2UA 1WLTA 3R6SA 2GU9A 2Q1ZB 1ZZ6A 5C6CA 1H1IA 5FQ0B 3EJKA 5JR7B
chains in the Genus database with same CATH superfamily
1RUI3 2VQ0A 2GC3A 1TE1B 5FYBA 4DINB 1O6UA 2P37A 4P02B 1DGLA 2CSGA 4JHZA 5IATA 1G8WA 1V6OA 1X9PA 2WR9A 3FX3A 3FC0A 3OBRA 1V0AA 4JGYC 4Q4W1 4XMAA 4YZ4A 1MEC1 3D82A 1US3A 1XBFA 3HQUA 1NE6A 4DEVA 1CAUB 1J3RA 1O4ZA 1OSGA 2B9VA 3FL7A 1S2EA 3PIJA 3T0BA 5AC93 4I0AA 3WNXA 3S5AA 2UURA 3UT0A 2BGCA 2Z79A 5DMYA 4RR3C 4LK6A 2RS52 5HCFA 2P3IA 1GU3A 1E5SA 3ZFGC 1RUH3 1WGPA 2JDAA 1XU2A 1YQCA 2E31A 1YI7A 2FMYA 3T30A 4E8CA 2W91A 3WG4A 1KDMA 1ZBA1 1JBCA 1SFPA 2AC1A 4XFFA 2D3PA 5A7SA 3E97A 4IEWA 3MW4A 1QKQA 3WG2A 2D3SA 4GZ9A 4PF5A 3ZXFA 1RXGA 1FT9A 1POV3 2FHRA 4R52A 1TNFA 4HOOA 1YFXA 5B2GB 5JZGB 2XL7A 1OA2A 2HWD1 3KQ4B 4N43A 3TN91 2ZGOA 4BJ0A 5CG9A 4OVEA 3ASIA 4NWWA 1I1EA 3PDQA 3ZVXA 1HX6A 3K46A 4MSVA 1IHMA 5KHGA 2D40A 4NRQA 1YRZA 1HRV1 1REFA 2CL2A 4TLGA 4IV3C 3N35A 1V6MA 1JOBA 1W28A 2JICA 1W8OA 3OGGA 1LOFC 3AYAA 1QEXA 4UOJA 4D0QA 5FMOL 1TME2 3ACFA 3DV8A 2HWE1 2PTMA 4X6RB 5APAA 1H9PA 1TME3 4JVAA 4MXVA 4O9EA 4IEVA 1JTZX 4Q8LA 4NIAA 2RE9A 3EQEA 1CIWA 4CVUA 3KHBA 5B4NA 1BVVA 2X10A 3IAPA 3ZFEA 3B94A 3OUIA 4XPVA 1BXHA 4YGEA 5FZCA 4RFRB 3VBHA 2E6VA 1UY1A 2ARBA 3PIGA 3R4UA 4KWLA 2EAAA 2YMZA 4QM8A 1X36A 4K8RB 1SZBA 3RMXA 5LEJA 1W9YA 2VMFA 4GB33 4BQ5A 2IWGB 2YBSA 4P9YA 3FBYA 1GLHA 2IVJA 4GMP3 2EIDA 3POYA 5CNAA 2FZ2A 1AXZA 4D7SA 1GZCA 3K4DA 4AEJA 4M0NA 2XBO1 1LJ7A 3E6DA 4YG3A 3ZIXA 4I02A 1R64A 2CAVA 4RGKA 1ND3A 4XDOA 3I49A 1D0HA 1FV2A 1GICA 5L73A 2YHJA 2A7AA 1DQ1A 3EBRA 4META 3BCWA 1C8M3 3AP5A 4QX2A 3FHIB 4DXTA 2WL1A 5FZKA 2VVFA 4LOSA 4Z1VA 3AMNA 3WQ7A 2JKXA 2A73B 4IEOA 5JR2A 2ETEA 2VULA 2VW1A 5FY1A 2A3YA 2VTFA 2FMDA 2RJ2A 4QQOA 5LA9A 1H8VA 5A32B 3R05A 2AEYA 2EA7A 1K45A 2OYZA 4E27A 2ZEWA 1NA1A 4TZDA 3EHKA 2NQYA 2VCCA 4OZXA 3SHRA 1COV3 1ASJ3 4FTEA 4FVVA 4M3CE 5BNOA 4LBQB 1QQP2 3K2OA 1XC6A 3LFMA 1VMJA 4JGZA 5GALA 1MS8A 2FDFA 4HK8A 2BVBA 5FY5A 5EJZB 1RC6A 4GIQA 2JDMA 1Z0HA 3UESA 3FN9A 2VOWA 5HXMA 3USUA 4DUVA 4LE4A 1WMEA 4CDWC 2DCYA 1SPPA 3H1WA 1GNZA 1W2AX 2OZ6A 1H6XA 4M3CF 4DXRA 3DXUA 1XB9A 1XXNA 3ZYRA 2BGOA 2Y8KA 4CEWB 1JYCA 3FZ3A 4OI0A 1F31A 2OIIA 3HT2A 4QX0A 3N36A 2BWCA 4Y22B 1BBT2 4LULA 2MHFA 2RJLA 1ENXA 3PUQA 4TWTA 1PK6C 5L9VA 2IXKA 1HN0A 1ACCA 5DQ0A 1BLZA 1PMIA 3TEZA 4Q2FA 4L0PA 1Y3TA 4MGKE 4QHBA 5CISA 2BEOA 2ZMLA 1M06G 2B39A 2V72A 4ORFA 3TEXA 1HLCA 1BEV3 3LIGA 5CFCC 1OA4A 2JG8C 3J26N 4LMFA 2YGMA 2XWJB 3PVNA 1PNGA 4DRRA 4EZ4A 4MGQA 3W21A 1F35A 5F37A 4CUGA 3FHAA 2RS11 5FMOS 4XDPA 3NJVA 2WFF2 2HWE3 5J98B 1E57A 4BXFA 4IGQA 1JHJA 4ES8A 5J48A 2ZA9A 2BUKA 1RJ7A 1MS3A 5IVVA 5LW9A 2AREA 1AR63 3KGZA 1A3KA 1RUC1 2XG3A 4CDUA 3KQRA 2VVEA 2D6KA 4FQ4A 5F3CA 1G6NA 2CNAA 2VCMA 5FJKA 3N9NA 2X05A 1CPNA 1X8EA 3T08A 5L9RA 1UZ0A 3OUHA 1IS3A 1JYNA 3SCFA 2VQUA 1CQ9A 3J8F3 4Q0VA 2W46A 1YI9A 3NNGA 4XJ9A 1HB4A 4XHBA 3M7AA 4YGCA 4Q4X1 3Q8AA 2XOMA 3I2IA 4AI8A 3MYXA 1FATA 4UBGA 3ZFEB 1H4HA 2UU8A 3TYJA 4DPNA 3H7JA 1GZWA 1QQP3 4LBOA 5KWRA 3IPVA 5CKQA 3AKTA 2ZEXA 4LIUA 1QJX3 4H7MA 4XF1A 2XJUA 4GWMA 5FJHA 4OLLA 3FLTA 3DCQA 5EJ3A 1LOEA 2RR11 3I2HA 3WG1A 2RS13 1SBEA 2YFUA 4XQDA 3H3LA 1PGL2 2X5IB 1JZ2A 1S0FA 4N7IA 4QDRA 1W0PA 3O0XA 1J83A 1VE0A 3J7LA 5C8CA 3GNEA 2BW8A 4UW5A 2NZ9A 5HXVA 3WY6A 2OQ6A 1IS6A 2ZGSA 3RYKA 5A3TA 4EN7B 5FZ6A 3MPBA 1W6QB 3D3AA 5DAPA 4UFKA 3UJOA 3AZVA 5F5QA 2VH9A 4Q4V3 3CLPA 4YPJA 5IW0A 4B8EA 5JMOA 3VUOA 4EJRA 3B9CA 5A32A 4CCCA 5FOJB 1FPN1 1NA1B 4LBLA 2NN8A 2WS91 4AGGA 4B1LA 2WWSA 2OXBA 3H8XA 4XQ4A 5BNOB 4Y5SA 2N7GA 4B4QA 1ZREA 1QWRA 3SKVA 5A80A 3OUJA 1N1TA 2BFUL 2VNRA 4GD4A 4R8HA 4BK5A 2XBO2 4N90A 1ULCA 1AR81 1V70A 3SCHA 1ULEA 1Y9QA 2X53S 3HN3A 2VL4A 4QT6A 4LHNA 4W50A 4PI2A 3KVAA 5A7WA 5IYYA 4YM2A 4BM8A 4IDZA 3LCPA 3E5QA 2UWBA 5TSWA 2VBDA 5FYUA 1MVQA 2E32A 3AYCA 1NY72 2C26A 3VHNA 3D8CA 4J6GA 3BPZA 4IE7A 1SFNA 4M00A 4EWDA 1J58A 4PLOA 4CEWA 4ZS2A 3BYWA 3M3IA 4CPBD 5CFCA 4PBOA 4XABA 5A3UA 4WM8C 1GBGA 1QJX1 3D0SA 1DGRN 1EY2A 2WO3A 4UXAA 1LU2A 4YYOA 1OQEA 5JVVA 3I8TA 2WZ8A 4R9DA 3VDAA 1F5JA 5KXCA 3NNMA 3QBQA 4H14A 4YW3A 1O3RA 1QJEA 2XQRA 4QX1A 1H8TC 2YC4A 1PNFA 4DIQA 5M0TA 2MEV2 1PO12 1TME1 5A3WA 2HYKA 4BIOA 1W04A 1BBT1 3AK0A 2FQPA 3BUCA 4XF3A 3DYMA 1N1VA 3KV9A 1FX5A 1PO23 3FUQA 4B1MA 4F7ZA 3WD5A 5GZEA 3VBRA 1REDA 1UW8A 1W9WA 3PL0A 1QJY2 3KM5A 1CONA 1GNHA 3IMMA 4QHOA 3O1PA 3I7DA 2HWC1 2RDSA 2VOXA 3PUIA 4AFBA 2Y26A 3ZN6B 2B4KA 2BGPA 4IV3A 1UU5A 3CO2A 4NHYA 4Q4W3 2W87A 2GNDA 2VZQA 1AF9A 4HPKB 2Q1MA 1S0BA 4JRLA 4JQTA 4V1PA 4WVWA 1OOPA 1CAWB 4CP2A 4KU8A 1TMF3 1K3IA 2DDUA 2Y64A 3WF2A 2VM9A 4HLTA 5A33A 1TMF2 3FLPA 3K4ZA 3QH7A 4Y5Z0 1ZM1A 1Q8OA 1I3HA 3OF1A 3ETQA 4YM1A 5IVFA 4A3XA 3KCXA 1EP0A 3K4AA 4IE6A 2RMU1 2V73A 3I54A 1OF3A 2R6QA 4FTSA 1B35A 1DBNA 3FJSA 3UKVA 1CX1A 1QJY3 3Q8CA 4OHWA 4PF1A 4CPBA 4QM9A 4XZUG 3VBFA 4OHYA 2W39A 1A34A 4UFIA 3IPVB 1J84A 4YVWA 2IXHA 3GHMA 5KHKA 4B7KA 2X8KA 4HVRA 3I2OA 3M3CA 1AJKA 4XUPA 1XE0A 4ONUA 3TN92 3AMHA 1PO13 1CAXB 1W6OB 4UFLA 3WNKA 5IT6A 4XDQA 5LEKA 2WNVC 1NAEA 2X5IA 4CDXC 3GZTB 2HWC3 1SCRA 4CP9A 2D5FA 5C8CB 4M0HA 4S2HA 5FO8B 3RNSA 4TLFA 2CGOA 4XFHA 3U37A 3WINE 1ZRRA 1L7LA 4Y20B 3DF0A 1IG3A 2Y38A 3I3EA 3VB9A 3VLBB 1UX7A 1G86A 1XNTA 2JDNA 1X33A 5FP7A 2WZPP 1UY3A 4NAOA 5DDJ1 1H30A 5FLHA 1DYKA 3OBTA 3RSJA 2HWF1 2R042 4P9JA 5JUVA 2OUHA 4NAMA 2KXLA 1VBA3 5I0SA 1H8TB 3ORJA 1PM4A 1QH6A 1VAKA 1ULOA 1IOAA 2IXCA 4Q0UA 4BXSV 4UFMA 1DDLA 1FPN3 3RYRA 4NJ4A 1CVNA 1MZ6A 2HWE2 4HXCA 4OHZA 4A7KA 2DCTA 3CBNA 4H55A 4K1ZA 1HJFA 4JC1A 5K0UB 4QU1A 3BOPA 1H2NA 2QQPA 2DCZA 4H2AA 4XIOA 3HR9A 3WNMA 2TUNA 1LRHA 1XNAA 3O12A 1G9AA 4HETA 5J96B 4AAPA 2WQ4A 1QF3A 2J1TA 5BYNA 2ZJCA 4C1WA 1VPHA 2ARXA 3AKSA 3LQCA 1R091 2IXJA 1EV13 4Q1PA 4NMIA 4UF0A 4XXPA 4BDVB 1QDCA 2K46A 4XFAA 4BA6A 5K0UC 3V0AA 3H8RA 3QLQA 4LBJA 1WW5A 3ECQA 3P3PA 1W8FA 1Z7S3 4LQRA 1UMIA 3BTYA 1ZBE3 1RB8G 5C33A 2PMWB 2RS32 5ABJC 1LODA 1QOOA 4V2WA 3QCWA 4C0HA 3OGSA 4AFMA 1RUG2 1WLCA 4JAAA 2R073 3KF5A 4URAA 1RUNA 4I2OA 5ISLA 4LBNA 4Q4X3 5FZMA 5CFDC 2SBAA 3ZYJB 1HQNA 3CEWA 4NHKA 3WP3A 3L9JT 1YFYA 1YFWA 4Q4Y2 4XJAA 4GAZA 4NR1A 5IVBA 1ASJ1 3PUAA 4LA2A 5CIRA 1ODNA 1PM7A 4JV4A 1ASJ2 1VBD1 1FPN2 3A0KA 2IVIB 2RHPA 4XBNA 2BP6A 5FP4A 4LUKA 5A6XA 5BNPB 1VBA1 1QXRA 2P6CA 2P34A 1HJGA 2D98A 1Y9MA 5LCWL 1CAWA 5GLWA 4TYSA 4FFHA 3JB4C 4WM7A 1TMF1 5A33B 3J4UH 2AZ5A 2JB4A 3MO4A 5FZ3A 4D7YA 2EAKA 2FBEA 4CU9A 4P5YA 3NWKA 2YV8A 4MUVA 4D3WA 3N9QA 1NG0A 3OY8A 1G9FA 2YB7A 4Q4Y3 2DU1A 3KV4A 2FCTA 2Q1ZB 3JD71 4AI1A 3PHMA 3A4UA 2IZWA 5T5JA 4I3GA 2HEVF 1WD3A 1VBB3 1ND2A 1OD3A 4NPMA 3OD0A 3WT3A 4D6QA 4WVZA 3ZXJA 4XURA 4FQZA 3RZKA 2BJSA 2IXLA 1YQ2A 1JUIA 4D69A 2ERFA 4FPJA 4CDWA 4FXGB 1WCSA 4KL1A 3MFAA 2VBPA 3GBWA 2CWSA 4CU6A 2ZGMA 4XC9A 2ZGRA 3U07A 3R4DB 1RITA 5E8AA 5EHDA 1BK1A 3OEBA 3T1LA 4HANA 2WS93 4ITCA 4AHXA 2VQAA 1NYWA 3RS6A 2PHLA 4FBFA 3KWVA 5E89A 3BPSA 2XVGA 1MQTB 2VAUA 2WO1A 1LAJA 2Q8CA 5C4WB 4QKDA 5ERLA 3VBOA 3VBSA 1O91A 1CZTA 1BK0A 4CDQC 3I59B 4Q4Y1 5SV8A 2G9ZA 3V64A 2WNEA 3WP5A 1UYZA 4AF9A 2XLAA 1AR71 3ACLA 4HT1T 1D4M3 1L3JA 2DFBA 2VZVA 3UJQA 4AG4A 1XNBA 4Q0PA 4WM8B 2JG8A 1OLME 1DYPA 4MGYE 1K12A 5K0UA 5F5IA 1WMXA 2QQOA 1QXPA 2ZACA 3MV11 1GOHA 1COV1 4FOYA 5G04L 3MI8A 2CDOA 1VRBA 1W3VA 4QXKA 1QDOA 2P1BA 3O0WA 1QOSA 3NL1A 3QD6A 4RHV3 1DGWA 1AX2A 1O7FA 4KU7A 3BALA 3VZJA 3OTFA 1AR62 1YWKA 1SEFA 4PIYA 4FOWA 5IVJA 2A3XA 5FZOB 3BB6A 4WBBA 3PVBB 2F6BA 3LPGA 4UF0B 4CDUC 3VKNA 5GZFA 3S0MA 2QQMA 1KDKA 2QJVA 3V0AB 1OLQA 5A6QA 4Z92B 3R4SA 3OD4A 1FI2A 3CF6E 3WW4A 4DOUA 4OQ9A 4OZOA 4LNVA 5I91A 3DPRB 1ZZCA 3LDKA 4L11A 3SISA 3GJBA 1UOFA 4AK3A 2GDFA 4R9CA 1ZRFA 3OB8A 4AGVA 4I09A 3F2ZA 5BV6A 2D93A 4Q4W2 4DB5A 2EVXA 4IXLA 3NV2A 1XQNA 5CKMA 4JDNA 1YCIA 2Q1FA 2WA3A 1O3QA 3VL9A 3WNLA 4KWKA 1VRH1 2Y6LA 2E26A 4E4HA 4NIGA 5CBLA 3N7KA 2Y60A 3QACA 4FI9A 3I3DA 5LB6A 2XJTA 4EN6B 4UI9L 5DAXA 1UCXA 2HLEA 2RS12 2W08A 1DGWX 3BI3A 5FLJA 5KXEA 4XJUA 2WNVB 4RQPC 3AZYA 3LSDA 2VOTA 3CJIA 3CJXA 4KGQA 4CXWA 5BNPA 1JOJA 1HXS1 2W1QA 4A4AA 4C1XA 3L2YA 4AVSA 3U1XA 4LLOA 2QFEA 3OYWB 4JCKA 1NOVA 5EYYA 3M3OA 4GMP1 4Q4V2 4NHXA 4WM7B 4LPLA 2WYSA 3B69A 4L9BA 2LROA 1XYPA 1LCLA 3AFGA 3K77A 3VBUA 1MVEA 2L9LA 5FPZA 5FZGA 2V4AA 5FK7A 1DG6A 2ZABA 1OLRA 2XH6A 4AVCA 4D6RA 1ULGA 5BNPC 2GZWA 1GWMA 3J7MA 3HN1A 1S0IA 2D97A 1YIFA 3KCCA 1G7YA 5EPAA 1OPMA 3L2HA 5FZEA 1N47A 4LHLA 3ZDSA 5IHRA 1O8SA 2DBNA 5I93A 5KHIA 2R30A 4ZU7A 5FMBA 3ZXEA 4OQ8A 4HK9A 4NO4A 3SH4A 3A7QA 5C3SA 5F6LB 1C8NA 2LTNA 1DLCA 2I07B 1AR82 1PGSA 1JH5A 1WLDA 3GZAA 2GN7A 3GDBA 2WFF3 1WA6X 4CP1A 2ENRA 4XF4A 1KFXL 1PIV3 1JW6A 1N3OA 2VZTA 1CZSA 1LGCA 3VBOC 4XTMA 4ISQA 4AHYA 1KS5A 1Y9GA 1LGBA 1KEXA 3LA3A 5FYTA 1CAUA 4AVTA 1SMVA 4PIZA 1OI6A 5BUVA 4PDWA 1SFYA 4GH4C 5FXZA 1MPXA 1TZOA 4CCOA 1FOD3 4LORA 4UT5A 5FYMA 3KMHA 4QHZA 1V9U2 1QJU2 3RJ2X 3T2OA 3GZEA 2V4VA 2QQKA 2VUCA 3POEA 4LO8A 2GALA 2ZMKA 2R7EB 3J7HA 2Q8DA 5L7OC 2GP3A 4AI9A 5C4WA 5FZ4A 3LSEA 1COV2 4L2NA 1NCRC 2P3JA 1KQRA 2AR6A 2P4EA 1DU3D 4LITA 3GBFA 3RRDA 5IWFA 3WF4A 4CUBA 3U4XA 3MFCA 2WABA 1CJDA 1YFUA 5A70A 2AGSA 4QKNA 5JZGA 5FUPA 4N43C 1HN1A 2A6YA 2D6NA 2EICA 1XPWA 2R16A 2DVDA 3DYPA 5FZBA 4Q8KA 1FMD3 4LKDA 4QPIC 3POJA 3B3QE 2ZX4A 4MO3M 4RQPB 5CG8A 2ZX2A 4ASKA 1YHFA 2GH8A 1O5UA 2HH9A 4XTPA 3AM2A 1ZBE1 2JDZA 4X8PA 3U10A 3ZR5A 5DDJ2 2EALA 4N7UA 5BNNC 1PGW1 3NJXA 5GM0A 4YNIA 1Q8VA 2ZPXA 5DUXA 2PA7A 1AL0G 3Q8FA 5DAVA 1ULDA 2CDPA 5E1RA 1K42A 4FOVA 1X7NA 5JWPA 3ZYHA 5D21A 2ORZA 2ADDA 3ZM8A 2XHKA 4D6SA 1GP4A 1ZYBA 4Q5OA 4WZCA 1SDWA 4YG0A 3ZMNA 2XWBB 3BTZA 2E7QA 1KGYA 1W9TA 2BTVC 2ORXA 3LOIA 4P9IA 2WSVA 4BQ1A 4E8DA 4XF0A 4P00B 1GZTA 3SH5A 1V6KA 2PHFA 4BWOA 2Y6KA 4GWNA 1IPSA 2VXJA 5DN2A 1SLTA 4K40A 3WCRA 1LEDA 1RIRA 1BHGA 1R083 5GLTA 1VBE2 3UK9A 1ZNPA 1JU4A 1W8ZA 1J1LA 2K0GA 2XLGA 2WNVA 2X5IC 4R9AA 1JZ7A 1PO22 2YXSA 5GZCA 5DXDA 2VCAA 5CZKA 3G6JB 5FZ0A 3VHRA 1C1LA 3WVJA 4LOTA 4M3CA 2YPJA 3IAQA 3MIFA 3FMGA 3H8OA 4FAGA 3WSOA 4EV0A 2Q8EA 4XETA 1OVSA 4NPRA 5F9TA 2QQIA 1DGRA 1OFNA 4KG8A 1S0EA 3LWCA 3OBZA 4XJZA 3VBUB 1RUG3 2HEYF 1CN1A 3OJBA 1XE7A 4H7LA 2BBVA 4LA3A 5FY7A 1MS1A 2ARCA 2O1QA 2JG9A 3ES1A 5FCCA 2BNMA 4UW3A 3GM8A 2PN5A 4AXOA 2RDRA 4LEJA 1LB2A 2HWB2 1ZA4A 2J1SA 2WINB 2ZKNA 2IUWA 1MEC2 4LBQA 1WW4A 3VZNA 3ZPYA 5JLVA 3ROUA 1RVF2 2VMDA 3WW3A 2RVAA 3BU7A 2WO2A 2FDIA 4OCTA 4IEXA 4AE2A 1EAH1 3GF6A 5CAZA 3H7YA 2XHNA 4SLIA 4M01A 1KRIA 1AR91 2R062 3CDZB 5FZFA 3SC7X 2JG9C 3WXPA 3NNJA 1NZCA 2V09A 3FFQA 2GMPA 4IESA 4MXWB 5ANNA 2ZGTA 3V65A 1W8NA 1RMU3 4LHKA 3VKMA 1AXKA 5L9BA 3N7LA 3ZXLA 2JD9A 4HSJA 1UXXX 5JXJA 4Y22A 2PYTA 1D4M1 4AVAA 1KJRA 1AX1A 3URFA 1LHNA 3TNPB 4LR4A 1JYVA 4PQQA 3VBSC 1FMD1 5K8SA 1WW7A 2Y6GA 4ARXA 3PU8A 1NCRB 4IE4A 4OFGA 4WVMB 5FYHA 4BZ4A 3ZFEC 2W94A 4TN7A 5A7OA 5DUWA 3ZKUA 2ZOEB 4FPHA 5JSPA 2O8OA 1RUD3 2E63A 3NKGA 4LK7A 1CJPA 1W2TA 2R063 4D8MA 4EQVA 1R1A1 1YJKA 1RUI1 2WFPA 4K20A 3KSCA 5DAWA 3ALQA 4Q26A 2BQPA 4DZGA 3ILFA 1RINA 5LZ6A 4EN0A 1BBT3 2CAUA 3W20A 4PJYA 5LA1A 4X8NA 2ZGKA 4CEYC 5EP9A 5EQUA 2NMOA 4B4PA 1MEC3 2W1UA 4NUBA 4MX3A 3AB0A 1VAMA 4NE9A 2XPJA 4NN0A 4XUNA 2VC9A 1XNDA 3Q8BA 1ZBA3 4H3WA 4ARYA 5FDBA 1W2UA 3WDWA 4BLJA 2WDBA 2NLRA 2R0FA 5LASA 1LHOA 1HDKA 1DIWA 1DF0A 3P3NA 4BCUA 4COVA 5CADA 4IETA 1RUH1 1D4VB 1NLSA 3ZXKA 2C9AA 2WZR2 4GB32 2JE7A 3VV1A 2AEZA 1R093 3NQHA 4LKEA 4MV2A 3BN6A 3ZOIA 2C5DA 5I8TA 4QQPA 2HWD3 2W2IA 3MIDA 1MS0A 1XJAA 2ZX1A 4QGMA 5D8AC 1RL3A 2UYBA 3SEPA 4DRVA 5J36A 3CHXA 4CE8A 1Z7S1 1HRV2 1A6CA 1GZWB 1Q8SA 1QJFA 1UMZA 3GBGA 1ZZ9A 3ZO0B 5LRSA 3TOJA 1NE4A 1ZZBA 2ARAA 2W68A 1POV1 4K21A 2LRPA 1QJU3 1MQTC 3P6BA 5GZDA 1WCDJ 4U36A 3FUOA 2K9ZA 5FYIA 3OGJA 3RZLA 2WZEA 3AX4A 4Y1UA 3TB0A 4OI2A 4M3CB 2W3JA 5EFUA 3UKNA 1W6QA 4COUA 2CGPA 4B29A 1RUD1 3WDXA 2XR4A 3IKWA 2AACA 5A1LA 4BQYA 4IW3A 3THPA 4QDQA 5FYSA 1XYOA 2GSYA 2TNFA 4EROA 1QIQA 4JX0A 4DFSA 3UV9A 4EWEA 1UKRA 1UO9A 4U2AA 5FZ9A 2E51A 2G19A 5IK7A 2VVDA 2JG9B 1IZ3A 5C5UA 4NPLA 4BOWA 3N9OA 3HEIA 3KLSA 4XBLA 3I2KA 5DDJ3 4RR3A 2ZHKA 2GNBA 5H9PA 3U0ZA 1NCQB 4FTBA 4GULA 2J1AA 3BIWE 2DV9A 2PAMA 3MW2A 3NNLA 4QGNA 4F3JA 4CXYA 5LBEA 4XE9A 3AXDA 4KNCA 5JIUA 1VBB2 5E16A 1PVC1 5EYXA 3I4IA 2VNOA 4ZXKA 3PJYA 1VBB1 4RHV2 4XUTA 4YGDA 4CEYB 3UYJA 2E9QA 3WV6A 3T0DA 4MXWA 2FD8A 2XVKA 4FXKB 4ZZ8A 4I0WB 4C0BA 1JYXA 3THTA 2RS33 1MS5A 2VZSA 4UAPA 5IUQA 1SLLA 5CFDB 1XE8A 4AHWA 4YW1A 2QCSB 5CFCB 2V5YA 2ZGUA 4LBQD 4QXBA 4CTEA 1DQ4A 1LECA 4YM3A 5FO7B 4Q27A 2WC2A 3ZSMA 2ZGPA 4FT8A 5ABJB 1RHI2 5FPAA 1QOTA 4YWAA 1EV12 1Q8PA 2HWD2 3X29B 1SBFA 3MIEA 4WV8A 1NCRA 1PZ8A 4WVMA 2OKXA 1HKDA 2W92A 3LDBA 3G7DA 2OW4A 3RFRA 5FPXA 1H4GA 3KCYA 5JDBA 4S2FA 4QU2A 5CU1A 3VZMA 4N8MA 5A3MA 3B02A 2R1DA 3VGIA 3LOBA 1K5MC 1YC61 1JU3A 1CAVA 1V6JA 1R1A3 1OA3A 1E5IA 4UYBA 4KGGA 1W06A 5CKNA 3O1OA 4E9KA 5FPUA 4A6OA 3C7GA 3HPNA 4LT5A 2ZGQA 3CJIC 5FBJA 1UQXA 2QTWB 2WT0A 1DQ0A 5DPNA 1U12A 5BNQA 5JOYA 4HPKA 1ENQA 1UWWA 2B8MA 3OG2A 1QU0A 1SLIA 3PLQA 3OBAA 4XZPA 5EWSA 3O1RA 1HIXA 1A8DA 2ZX0A 5IVCA 1Z7S2 2D44A 3ZXAC 2VW2A 5CVRA 3M1HA 4XJWA 3DXTA 3THCA 5IFTA 3WF3A 4Y33A 5J7MA 3VD9A 2A5ZA 3ZYFA 1WLTA 2RDQA 2WNUA 3WDVA 3WNNA 4COWA 1RUH2 1B35B 1U0AA 2RR12 1AJOA 1H1IA 1URXA 4DNYA 3W59A 5FZ1A 3EJKA 2SLIA 4Y4RA 3VBFB 1UOBA 2PLV3 2WN2A 2XUMA 2WIIB 2ZZQA 4HMZA 4LKSA 1XNKA 3WNOA 1V00A 4MLOA 2Z2SB 1HB2A 3AP9A 1CAXA 1RUF1 1W6OA 5H9SA 2BZDA 1JZ4A 2VG9A 2AYHA 4CDXB 2OVUA 1YQ6A 4LIVA 1H1AA 2RS51 5JAXA 1PK6B 3TBDA 2P17A 5KHHA 5BY5A 2X29A 5F5AA 1EAH3 4JTOA 2Q5TA 4ASLA 1OKOA 1UOJA 4Y20A 1HB3A 5FYVA 1R1A2 4EZHA 5IVEA 1DZTA 4NVPA 4KH9A 4IEZA 1UL9A 2F17A 3IIAA 1QHDA 2BYVE 5FMDA 3VD3A 1W03A 4XMIA 5DAQA 2NMNA 2DVGA 5JI7A 5DZEA 3RI9A 4QMAA 1H8TA 5C4WC 3AKQA 2OPWA 4UBHA 1VBC1 3HBZA 3RI8A 1O5LA 3ZPOA 3DGTA 1W8HA 3ZXGA 1CD3G 3CMGA 3USUB 1LOFA 4MGSA 4B4RA 3O1MA 1XNCA 3ZMOA 1NCQA 4YZ2A 4CCLA 3RZJA 1DLLA 1LOAA 4YGBA 4ATFA 4PCRA 3RWKX 4CZSA 1NY71 2BNNA 4JKLA 1KFUL 5FXWA 3B5LB 2JDPA 1AR92 2R061 3MPPG 4OULA 4Q4V1 4AI3A 1RUE3 1U5XA 4AEDA 5FWJA 2JDKA 1JHNA 4AWDA 1RUI2 1LGNA 1VIWB 1ONAA 2VCBA 1HRI2 2EXKA 2MEV3 4ZS3A 4K3UA 4CCNA 1OC1A 2DWRA 4ZY9A 1LOCA 3RWNA 1S55A 4QB1A 2JKBA 2JDHA 2B46X 3AYDA 2MPFA 4QX5A 3KS7A 2G9FA 2A3WA 1ZZ7A 3D0JA 3W58A 3U75A 5A6YA 3R0RA 4FPOB 5ABJA 2CV6A 3BTAA 3I3BA 2PHXA 3NJZA 2P2KA 1GSLA 3ZX7A 2DTYA 4A7ZA 1JI6A 1IQAA 1UPSA 3VKOA 1RUG1 2PHUA 5F2WA 4GA9A 5FP3A 4A3ZA 2BPA2 1SHWB 5G05L 5FZ8A 3LEGA 1F2NA 4DXSA 5HV0A 4JQRA 4MGZE 5FIXA 3TWIA 1X50A 1CAVB 3AYEA 4K7JA 1VBE3 5F8PA 3B7MA 3MHZA 1EUTA 3WDYA 2JE9A 3N7JA 4MZUA 1GANA 1YUDA 3JZVA 3ACIA 4KWJA 3O5SA 3T2QA 5C3OA 4DUXA 2V5DA 1EPWA 1PZ9A 4AEKA 5BNOC 5CEHA 2E7AA 1T6GC 3LEKA 4JGZC 4OUSA 3RG0A 4JZRA 1RUE2 1PZ7A 4MHRA 4ISRA 3QH6A 4Y1VA 4XUOA 2YU1A 5T54A 1T2XA 2QKDA 5FZIA 4CUCA 2J7MA 3NO8A 2OS2A 1AHSA 1SACA 1XSRA 3WLUA 1RGSA 5A6ZA 3NSTA 3B93A 3VD5A 3AZWA 1UPIA 1XU1A 4XAAA 1WLWA 2ZXQA 2WNUB 1W8UA 1ND3C 2BWAA 4YW2A 1EYBA 3C8XA 4K8FA 1JYWA 1KJLA 3APBA 2O14A 4N9HA 4ZHNA 5FLIA 3AP6A 2XUEA 5JSRA 1ND2B 4OYUA 1LU1A 2R49A 1JUHA 5DUVA 1DHKB 2XJPA 5FPVA 2YY1A 4MH0E 4G3YC 1PO21 3WX5A 1FNYA 1RUOA 4RL7A 2TEPA 3MLLA 3WUCA 1OXCA 2GAUA 1VBE1 3H3ZA 2HBTA 3LEIA 1VBC2 4G9SB 4XCAA 5LBCA 3ZSLA 4A6SA 1PK6A 4HKOA 5GLUA 2Q30A 3IB3A 3U78A 2DVBA 1GOGA 1G9CA 2ZAHA 2X09A 3ETPA 1BVP1 2LS6A 2VMCA 4RD7A 3ZKYA 1PMJX 5AVAA 4CU7A 2ADEA 1VBA2 1O59A 2PXJA 3TN93 5C71A 3K51A 1XYNA 1OH3A 4HSLA 3MLKA 4LO7A 5HCHA 2OT7A 1C4RA 4YW6A 1HRV3 2QQWA 4IEQA 2ZEYA 3VBOB 3VD7A 3MEPA 4Y1XA 3I59A 5A7QA 3OEAA 2OUJA 5CB7A 5GJ6A 4QXHA 4QX3A 2XLFA 1K5JA 3ON7A 1LHWA 2HYXA 1R081 2B42B 2E7TA 4K1YA 3HT1A 5LATA 1DQ2A 2D7FA 1HRI1 4WM8A 4OI1A 2JG8B 3O1VA 3LA7A 4LUMA 5FFOC 3OPZA 4P9GA 4Z2AA 1OF4A 1NQDA 1JYIA 5A3LA 1JYTA 1F8VA 3K3OA 3SCGA 1GMMA 3IDAA 3WEZA 1J59A 3HAGA 1GP5A 4UW6A 1O8PA 3SXWA 5C3RA 3M8LA 3N9LA 1C28A 5F39A 2VE1A 1UYXA 3PMSA 3TRSB 2VZ1A 4AQ6A 1UU4A 5FZOA 4IERA 5T3NA 4Y5TA 5JSOA 1LOGA 1FOD2 3HNYM 1GUIA 1KITA 3MIBA 4BQWA 5LBBA 4WM7C 4RFT0 1CZVA 4P9WA 2WT1A 1B09A 3RVHA 1U5ZA 4AVVA 1S0GA 1IG0A 4HONA 1ST8A 4LBKA 3KB5A 3J7NA 1AX0A 3POWA 2A6XA 4QKFA 1W8TA 1LEMA 2PLV2 3D5OA 4DEQA 2RMU2 4AFAA 1OT5A 5F7UA 3MZHA 1ZA7A 4C8DA 4AW7A 2W1WA 3TEYA 1UY4A 1C8M1 4PT6A 3NNFA 3RGBA 4AFCA 1U5YA 2JIGA 1WCUA 4J25A 2ZEZA 3O1SA 1SLBA 2W52A 4QB6A 4BH9A 5I0TA 1MR5A 2GMMA 1STMA 3DUIA 3IT8A 4CUAA 5I0DA 3S57A 1HXS2 2JWPA 1YQ5A 3EMRA 1PGW2 1RUF2 2DCKA 4XEZA 2W95A 5FKCA 1OLMA 4URTA 3MDPA 1PMHX 5IAVA 1Y43B 3CJIB 4FPKA 3IMNA 5IFPA 1JS9A 3J8F2 4AVBA 3KV5A 3NV4A 2EF6A 1PVC3 1UZZA 4YVWC 4CXXA 1W99A 2WQ8A 3GYDA 2HJIA 2OA2A 5EV7A 4QGLA 4LTAA 3OGRA 3ZYPA 1H6YA 3RPQA 4M4RA 1E5RA 2R0HA 5FBZA 4CCDA 3H8UA 1WKYA 4I30A 3BOWA 2PLV1 4HBNA 5I8SA 1JMUB 1OKQA 3T4VA 1OURA 2Z5WA 3IBMA 4XF9A 1OVPA 2F4PA 3ZN5A 3K3NA 2BU9A 4TXWA 2A6ZA 2VZUA 2QQVA 3ENRA 2DCJA 3UL2A 2RS53 4PBPA 3V56A 2Q8OA 3WG3A 1LKNA 1CIYA 2XONA 3RDIA 2B9UA 2NPIA 1NT0A 1RJ8A 2WAOA 4P9LA 2XL9A 5FYYA 3ZFGB 1HV1A 2H6CA 1UAIA 1WD4A 4AL9A 4DXZA 2YG0A 3I2GA 1TEIA 1ZRCA 5FZAA 1ALYA 4LJHA 4XFBA 2XBO3 1WUVA 2IFWA 2RDNA 1UXZA 4CDQB 2WA4A 4IGPA 3PVEA 2QQJA 3ZSKA 2ZS6B 2J1EA 2EXJA 4BPZA 4GH4B 2AENA 1LHUA 4PDWB 1FOD1 4BE3A 1KXGA 1L7RA 4DY5A 2JDYA 1GFF2 4XYXA 1HRI3 1LULA 5K4LA 3IM0A 1MS4A 1F4AA 4FPFA 3VDCA 2KA3A 3VBRC 3VD4A 3VZKA 3MIGA 3FFZA 2W9XA 3RZMA 3WZ1A 2VD7A 2VZPA 3C7HA 2WS92 2RM23 2I74A 1JN2P 1GQGA 3ME2A 3POGA 4Y3OA 4Y4YA 4B7EA 3WNPA 2VTXJ 4O7XA 4E2SA 2ET1A 3JD73 1BMV1 1QJU1 3GHNA 4M4PA 4LXLA 1ENRA 2ZHMA 2E53A 3NVCA 5EJ1B 5AC91 2VZOA 3K75B 1R1ZA 1LOBA 4IV1B 1UOGA 2W5FA 1W6PA 2MEV1 1GQHA 2VNVA 3POFA 1LNSA 2KD7A 3ZSJA 4AI0A 4E4ZA 2EXIA 2CU5A 3S7EA 2Y6HA 4XACA 4WVVA 3NAPC 4E2GA 1CX4A 4ZU5A 1ENSA 2WYFA 3HBKA 3E5XA 1OPOA 4RQPA 4F8AA 2A1XA 5A1FA 4GKYA 4QAWA 1AYN3 1B35C 2W47A 3A21A 4N53B 1PIV2 1RYYA 5DZFA 4Y24A 4ZXEA 3AZXA 2DVFA 2ES3A 5FZDA 1GOFA 1MACA 1AVBA 1RHI1 2JD4A 4ES9A 3A0NA 4O61A 5FXXA 1J3QA 4A7YA 5GLZA 3SMHA 5JMCA 3FLRA 5T5OA 1VRH2 3LKJA 5ACA3 1KS4A 1PIV1 4YW7A 5F6KA 2OX0A 2LALA 2XDVA 2AUYA 1I5ZA 1W2NA 2JX9A 3H0OA 1OUSA 1XRUA 4IEPA 1XOYA 2QZ2A 1JXNA 3PU3A 4LO5B 1DCSA 2O0OA 2RM21 5SV5A 5DABA 1KD7A 4QD2A 3F95A 2GC1A 2PFWA 4W6WA 1PO11 5F3IA 4RHV1 1AR73 4SBVA 2KR2A 5JOZA 2C6SA 3QOPA 5AFEA 2FCUA 1L7QA 5FYCA 1JZ8A 3BGAA 1F5FA 4Q1RA 3IIIA 4RGAA 5D2AA 2RM22 4YZ5A 4XFIA 3AL6A 4COZA 1QH7A 2GH2A 1IQDC 1RUC2 2YGLA 3NJYA 4Z8BA 2DUPA 1AR61 1F4HA 2UYAA 3MF6A 3POIA 5CYYA 5FOBB 4FP2A 1FMD2 4K6BA 2GP5A 3TNQA 3I2JA 2TBVA 4CU8A 5EIYB 3DECA 3MF9A 4L99A 1YJLA 3Q9OA 4I3PA 4Q0SA 4AQ2A 5LA0A 2YROA 4HVOA 2GNTA 4W6XA 4Z2WA 1JZ3A 4QPGC 2VZRA 2AH2A 1EUUA 3USSA 1NLRA 1X8MA 4ZU4A 5KR7A 3O1UA 2BV4A 1MZ5A 3AMMA 5A1AA 2O8QA 4L92A 4YRDA 1ULFA 2WZR1 3EB7A 1C5IA 4QWNA 4ZONA 4XOGA 5FUNA 4P14A 1AR72 1ZZ8A 5FZ7A 3A22A 4XXAA 2VJXA 2C4XA 3CZUA 2WUHA 2HWF3 2G4IA 2YFZA 5T5LA 4ATEA 5D1IA 1US2A 1VMFA 2JEMA 4KI5M 2C1FA 2HKXA 2UY8A 5H9RA 4CEWC 1VRH3 4JRAA 1O3SA 1I6XA 3VZLA 3N7MA 2UWCA 5GZGA 3IN9A 1IKPA 2QDNA 3ZYBA 2CGNA 2CTVA 4P08A 5FMCA 4CCJA 4YVSA 1M4WA 3S30A 1W6NA 1FAYA 1Q5OA 1N3PA 4CDQA 3RZZA 4QPWA 3BVCA 1W8WA 1AYN2 2DVAA 1TNRA 1H0BA 2WWUA 4B3NA 4XJ8A 2VY0A 4RS5C 5BNNA 1LR5A 3B01A 2VGDA 1DZRA 2VOKA 2D5HA 2GMEA 1GV9A 2ZMNA 1PGL1 3ACHA 1TG7A 4JKMA 2WO7A 3WF1A 1GYKA 2ILMA 1EV11 1YQ8A 3C7EA 2D43A 4JHTA 2G1MA 4YVSC 5C5TA 1WCKA 1YLLA 2EIGA 3NAPA 4KWUA 1QGLA 1QJX2 3JCIA 4YG6A 5DG2A 1W0NA 4C90A 4L8QA 3PURA 4QQ2A 3WUDA 1H2MA 2JIJA 3TAYA 2BNOA 3ES4A 4N53C 4Q0QA 3VBHB 5JOXA 3S5QA 2QQNA 2LM3A 2H6BA 4MYEA 4Q4X2 4YLZA 1K5MB 3VBHC 3HQXA 2WN3A 4Z07A 3ITQA 1W3XA 5FY4A 1W6PB 5LY2A 2Y6JA 3DN7A 5AVPA 5FK8A 2QBXA 3ZSEA 2RMU3 3NMBA 2J42A 4HN1A 3IWZA 4XILA 1LHVA 1H1MA 1S0DA 3JQXA 4XBQA 2H0VA 2HEWF 2Q0AA 4BHPA 4OUEA 5EZWA 5I0RA 1ND3B 1VBD3 3GCXA 3JUUA 4P5HA 1UNBA 4IUGA 4N53A 1GZ9A 5C3PA 1VBD2 1OD5A 2PHRA 1YNAA 3WQBA 1FNZA 2VW0A 2ID4A 2IC1A 1E5HA 3D6EA 4NROA 4YW5A 3OSDA 3SQOA 2PHDA 2QQUA 2XJVA 1VBC3 3JQWA 1QJZA 4UWDA 4PI0A 3ZN4A 3HNMA 4FAHA 5ACA1 3UNPA 3HMYA 2GNMA 5F3GA 5FPLA 3ZFFA 4FPYA 4A2UA 4BMEA 3UGFA 2GU9A 1NA1C 2XVLA 1IGOA 2ZX3A 2VBBA 2JB8A 4KBZA 2JE8A 3VDDC 5C6CA 2BBAA 4AGRA 1AXYA 2Z4FA 4JGZB 5JR7B 3T0AA 3OCPA 4ZZ5A 1EAH2 4AOCA 3Q8EA 4YSFA 4EN9B 1DQ5A 2JECA 2MNGA 3MV01 5GLVA 3U11A 4BYYA 4COYA 5J3UA 1I9RA 2YC2A 4J1WA 3VN4A 4Y1YA 1U5IA 5T52A 4XAEA 2WZR3 2BOIA 5E6HA 4HVQA 1VALA 3HD8B 1SPPB 2EIBA 5K9YA 4QXCA 1W9FA 2FDGA 3BTXA 3PMEA 1H2LA 1AZDA 4QX7A 1EPZA 2XKOA 3LA2A 2XGXA 2IFRA 4BB3A 4GWJA 3POSA 1GWKA 2ZTNA 2ATFA 2JDUA 1V9U1 1C57A 4P9XA 3LGRA 5HCBA 5FRAA 4Q29A 5FV3A 1WMFA 5IK5A 3BKZA 2WNOA 1WMDA 3AKRA 4MGTA 2VQTA 5JOWA 3I97A 2YPDA 4FPCA 3GCWA 2FDKA 2D3RA 2QNKA 5DUUA 3ZR6A 1T6BX 1NKGA 3IDCB 3AL5A 3WP6A 4MG2A 3FHQA 3HNBM 1C1FA 3LE0A 1WWYA 4AYUA 2YDEA 4JKKA 3LZZA 3E5UA 1ZRIA 4R4ZA 5IK8A 4RR3B 4C91A 4HZFA 1S2KA 5T55A 3O1TA 3MICA 1X9TA 1GQPA 1AYM2 3VKLA 5FUIA 1GWLA 5LRRA 3M2MA 3PUHA 1AYM3 2KM2A 3JXSA 1QJY1 4YVSB 3BODA 3T4HB 3ZYIB 3RZGA 1W6NB 1PVC2 1RVF3 2QVSB 2VNGA 4AZZA 4CEYA 5KBFA 1VJ2A 4FFFA 4QX8A 3AFKA 1W39A 4RS5B 1LTEA 4CDUB 4BISA 5BNNB 1W90A 1W05A 5FTTC 5CFDA 5JXIA 1UX6A 3O7OA 2YC0A 3CIHA 5KXBA 1AYN1 3KGLA 4JDMA 2PQSA 1ODMA 1NXMA 3AVRA 5FZLA 3PNAA 4RN5A 3WDTA 5F5CA 2A70A 3AC0A 5FP8A 3MUY1 3AJZA 4O65A 1RHI3 3J8F1 3NAPB 1TQ5A 2C24A 3HVDA 1HW5A 4DQAA 4N9IA 5FR3A 1YO8A 3W5NA 4XQWA 4FOQA 4OI4A 3ELNA 3N9PA 3SLIA 3WF0A 2J1UA 4KG0A 3GXUA 3DKQA 1GNYA 1GP6A 3JU9A 1DZQA 1YEWA 5IK4A 3KHCA 1ULPA 4IV1C 2R32A 2YYOA 1K5MA 3H1YA 5IAXA 1FV3A 1JZ5A 3ZIWA 5J09A 1D2QA 1HXS3 3WR0A 4ASMB 1AL21 2VXRA 2DF7A 1Q3EA 2Y6FA 2DU0A 1IPKA 1NLQA 2GC2A 5KXDA 5KC6A 3IDEA 3T2TA 3KZ4C 2YZ4A 3KVBA 4S2GA 3V0BA 4YZ1A 1OFSA 4YARA 4S2DA 4E4SA 4WZFA 5C3QA 4RYDA 2Y33A 2D6LX 4NRPA 3NV3A 3BIEA 2GN3A 3S6PA 3GALA 1W2OA 2Y0IA 4CCEA 4QQLA 4IE5A 2PQQA 1S0JA 2NP0A 1HQLA 3ZFFB 2A71A 5HCAA 2PAKA 3J9SA 4BQXA 2R1BA 5HV4A 4IL7A 2BVVA 1JZ6A 2WJSA 1SDDB 3DYOA 2JJ6A 4HL0A 1Z78A 2DYCA 2J22A 3WHTA 1QY4A 3LDRA 1UU6A 2HBUA 2WSUA 2YBKA 3DL3A 3RJRA 3TEWA 1DYOA 2BERA 3VBUC 4NRMA 5JPNB 5EXOA 2I45A 3UKTA 2B7YA 2H0BA 2BRTA 3CKHA 4PQ9A 4YFWA 2DTWA 4BIFA 5A7WB 4CDXA 2CYFA 4EYUA 5L7OA 2VECA 1QMJA 4PLMA 4ZKTB 3GZUC 2YUEA 4RGGA 4ZPIA 2WFF1 3ZXDA 3AJYA 4BQ2A 3LFIA 2FDJA 4GJZA 4QPGA 4XFCA 3WHUA 2DBIA 3VHPA 4FO9A 1GR3A 1OHFA 3SKJE 4FPLA 5C8WA 1WA4A 1O3TA 5JPMB 4XIKA 3ZLIA 2QQLA 1JODA 4EE2A 2K2SA 1D2SA 3D4KA 1VAVA 1YYNA 1VB4A 3WP4A 3O0VA 3RZHA 1F15A 2ZBJA 1UZVA 2XXZA 3JD72 4LO4B 4R9BA 1GKBA 3ILNA 2DFCA 2YU2A 1UY2A 3P1IA 1OMIA 3POBA 4LE3A 5IVYA 3WOGA 4NIDA 5LBFA 1A78A 4AR2A 1RUC3 3VBRB 5A3PA 2WLQA 3M70A 4R4XA 3SNMA 3H3UA 3RMYA 4AEDB 3ZN6A 3AMPA 1VLNA 2D6PA 2J1VA 2R072 2WKKA 2ZGNA 4IV3B 4JDOA 5DG1A 3SH3A 5C7GA 1BKZA 4XUQA 4RS5A 3PVOA 4OUMA 1OOPB 4E4DX 3SITA 1RUD2 2A75A 2P3YA 1N1YA 4EWAA 5JZGC 3C7OA 2Z69A 2BDRA 1NX9A 4GKXA 2XB6C 3B00A 3I3QA 2OPKA 2XJQA 1UD1A 1UY0A 3C3VA 3CU7A 3LB9A 5F32A 2JXAA 2VPVA 2PAEA 1UYPA 1SG3A 5LK5A 3PJQA 1UMHA 4GQ7A 4NHMA 5F3EA 5K7PA 3VDBA 4DY3A 2BOJA 4HKWA 2ZCWA 1V6IA 4FCAA 2CY6A 5FP9A 2LUWA 3CL1A 3H9AA 4NIIA 4L97A 2WT2A 2Y0OA 4A42A 3VBFC 4YVWB 1I5PA 1SQ4A 2P3KA 1BCXA 3OGVA 4FSJA 4A41A 4DS0A 1SLAA 5FXVA 1BEV1 4Y26A 2A6WA 3NRUA 4A44A 1W6MA 3K48A 1O4TA 1IS5A 3I3MA 1NXD1 2XKPA 4CP9B 4I0BA 5FZHA 5IJRA 4G4FA 5H9QA 1SLCA 1N1SA 3MGUA 5D8AB 1H2KA 2VZ3A 3U14A 3CQOA 2FZ1A 3V0BB 4RSUA 1OQ1A 3HQRA 3LEMA 4UFHA 2XMLA 2LW8A 4LO6B 1LESA 1UIKA 3ATGA 1BJQA 2F4LA 1S2BA 4YM0A 4RA0A 5FYZA 5FO9B 1JOPA 5JCTA 5L19A 5F1RA 3IDBB 4PIXA 3M4FA 2ZHLA 4QDSA 5A7PA 3AXEA 2VMGA 4ET7A 3JB8A 3VKFC 1NQJA 1HV0A 5B4XA 1YXWA 2B5HA 4W4ZA 2J1RA 3E6BA 1ZVFA 1CR7A 3KV6A 1SBDA 3H42B 4BQ4A 1MS9A 5A3OA 4MHUA 1ND2C 1HQWA 3HOBA 5C9AB 2RJKA 4NIHA 4OHVA 1Y4WA 5FPBA 3W9AA 3SEEA 1UYYA 2XJRA 2C9KA 2UY9A 2RG4A 4FPEA 2DUQA 4AQSA 1CWPA 1ZBE2 4LLFA 2XQXA 5LA2A 2VMHA 4IEUA 4XFGA 1BZWA 1H9WA 1W0OA 4JTNA 4NWVA 4CCMA 5L7OB 3THDA 1BQPA 2NYYA 1VR3A 3T3YA 5C70A 4YFZA 2WBKA 3GGLA 2FCVA 1D4M2 1UF2C 3E1F1 1AYM1 4MOAA 1OQDA 3BU0A 3IZOA 4XCBA 2E33A 2JENA 5C9AC 4QPGB 5BXXA 1C5HA 2QZ3A 3AVSA 2VTXA 3PTRB 3NW4A 2OQ7A 2ZAAA 5FREA 4GALA 2Z42A 4IEYA 4OHXA 1QQP1 2WAAA 4LKFA 1NZIA 4QKBA 1WBLA 3PUSA 1ZBA2 5T50A 4AFDA 3I2DA 1G9DA 1HB1A 3AZZA 1ZRDA 5I0UA 5JI9A 4CA9A 1D0GA 5KHJA 5I8YA 4OMDA 5AC92 1RUJ1 1QXJA 3H50A 3ILRA 2BFUS 1AUYA 2DUOA 1RVF1 5JXGA 1RUJ2 2XJSA 4K9SA 4QPYA 1YIPA 4KQ7A 4TTGA 1MZEA 2VOVA 2B45X 2VUJA 2WLPA 3DPRC 5JIAA 5JXHA 1DFQA 2QDRA 4QPIB 4AI2A 1A8MA 1OUXA 5FY0A 3M3EA 3T1MA 1BYHA 4EN8B 1SCSA 1AL23 1WBFA 1WZXA 3AKPA 5ACA2 1Q43A 2NM1A 1PVXA 4GB31 4D94A 1AL22 2FDHA 1BEV2 1FXZA 5E88A 4CSWA 2ZHNA 5LY1A 2CHHA 3C7FA 5GKAC 2P6HA 5A7NA 2Q4SA 4JGYB 3OY8B 1POV0 4UW4A 4YW4A 3KD4A 1RMU2 5FWEA 4I01A 3GJAA 3ST7A 3O14A 1R092 5DZGA 3HJRA 3WW1A 3ZFFC 5J37A 2UWAA 4FFIA 4GMP0 3DKWA 3VDDA 3WDUA 5FQ0A 1D7PM 1RXFA 1Y7BA 2DURA 4UFJA 4Y1ZA 4PHZA 3S7IA 4A45A 1J3PA 4TSVA 3AMQA 1N3QA 4D7TA 3LAGA 4BU2A 3MW3A 1UIJA 3UGHA 5FY9A 4HG6B 4FP3A 3JBG1 1IPJA 2VU9A 1ZX5A 2I2SA 2QE3A 5FKBA 1W6MB 1S1AA 3JBG2 5C8CC 1VP6A 2ET7A 3VHOA 4CDWB 5KC5A 2W0XA 1LENA 1RUE1 1WCQA 1PX4A 3FWEA 1PX3A 5D8AA 4BMBA 4YZ3A 3AP7A 2QUOA 3AP4A 3CZJA 2VR4A 4MVTA 3P5BA 4KMQA 3N4MA 1CGPA 2RV9A 5FAXA 3LIHA 4IGOA 4X6QB 2WRAA 1RTVA 2HWF2 2R041 1F9KA 1XSQA 4V2VA 3LF7A 4W65A 1Q8QA 1VB2A 3MIHA 5LK7B 1MQTA 3NKTA 3ZYGA 2D6MA 3H1MA 1RUF3 3VBSB 3OOXA 5ANQA 4XVHA 1V6LA 4LBMA 3KF3A 4CRQA 4XHXA 1CESA 1S4CA 1C8M2 2GC0A 1POQA 3EXUA 3MLJA 1NUKA 3B9IA 3WW2A 4DUWA 4J1XA 5C9AA 3ZFGA 1UN1A 3M3QA 4NHLA 3E6CC 1BMV2 4MGIE 4HKLA 2CWMA 3LPFA 3PTYA 1VMHA 1V6NA 4N43B 2HWB1 3KT4A 5CA6A 5HBAA 3C2UA 1PHMA 3EYPA 3FBMA 3HWJA 4F83A 1C3HA 4AQTA 3ABZA 2ZZJA 5BPXA 4CP0A 5L36A 5AFBA 3ACGA 1CPMA 1IS4A 4Z82A 4NOTA 4PDWC 4GH4A 2VMIA 3T09A 3U4SA 2WWJA 1QNYA 1RUJ3 3T2PA 1NCQC 3RYPA 1IKQA 4BQ3A 2A6VA 2VUDA 4QQHA 2R071 2Y34A 4AAXA 1FYUA 2R043 2RS31 2P5BA 3DPRA 4LHSA 1P8JA 2OZJA 4AEDC 1APNA 3HIFA 3ZDVA 1J1TA 3OPWA 3RQ0A 3EO6A 4W8JA 1DP0A 3INAA 5FY8A 4GWIA 4O9GA 2EXHA 4BK4A 2VO5A 4GXLA 3WQ1A 3MUZ1 1R082 3WCSA 2PHTA 3VZOA 1AR83 4FFGA 4QB2A 1OH4A 4GJYA 4IQPA 1G9BA 4AEMA 4E2QA 1DQ6A 1S0CA 2HWC2 4IV1A 4MADA 1UKGA 4OMCA 4CCKA 3OPTA 1Q56A 3MBWA 1WW6A 4IE0A 4QPIA 5HI0A 3VL8A 1AR93 1X82A 2YBPA 1MZFA 5J1XA 2G9GA 4CYDA 2VMEA 2W1SA 1REEA 2WNUC 5A3NA 1QNWA 3A23A 3CNAA 3UGGA 1V9U3 4BLIA 1OBNA 2WQZC 5T5PA 1OOPC 4HFSA 4AHZA 3OYWA 4PLNA 2ZKLA 4HN0A 3LD8A 3FE5A 1UZYA 3N3HA 2PHWA 1O4YA 4FPGA 4INDA 3WQ0A 5LWBA 4DO0A 4DMIA 3UETA 3JBG3 4JGYA 5F2SA 2HWB3 3KT7A 1RMU1 5HPOA 2C0ZA 2VUAA 2EIEA 2IXIA 4W6YA 1W9SA 3R6SA 4KBBA 1TVGA 1ZZ6A 4XW3A 3I2FA 2D6OX 1UZWA 3NV1A 2PELA 3VDDB 3N9MA 5FQ0B 3W5MA 3KT1A 2RR13 2ZGLA 3DEMA
chains in the Genus database with same CATH topology
1RUI3 2VQ0A 2GC3A 1TE1B 4DINB 2P37A 1DGLA 1G8WA 1V6OA 3FX3A 4JGYC 4Q4W1 3FC0A 3OBRA 3USUB 4XMAA 4AVSA 4YZ4A 1MEC1 3D82A 1NE6A 1CAUB 1J3RA 1O4ZA 1OSGA 5AC93 4I0AA 3WNXA 2UURA 2BGCA 2Z79A 4RR3C 5HCFA 2RS52 2P3IA 3ZFGC 1RUH3 1WGPA 1XU2A 2FMYA 1YI7A 3WG4A 1KDMA 1ZBA1 1JBCA 4XFFA 2D3PA 3E97A 4IEWA 3MW4A 1QKQA 3WG2A 2D3SA 4PF5A 3ZXFA 1FT9A 1POV3 2FHRA 4R52A 1TNFA 5B2GB 1YFXA 5JZGB 2XL7A 1OA2A 2HWD1 4N43A 3TN91 2ZGOA 5CG9A 4OVEA 3ASIA 4NWWA 1I1EA 3ZVXA 1HX6A 4MSVA 1IHMA 5KHGA 2D40A 1YRZA 1HRV1 1REFA 2CL2A 4IV3C 3N35A 1V6MA 2JICA 3OGGA 1LOFC 3AYAA 5FMOL 1TME2 3DV8A 2HWE1 2PTMA 4X6RB 1H9PA 1TME3 4JVAA 4MXVA 4O9EA 4IEVA 1JTZX 4Q8LA 2RE9A 3EQEA 1CIWA 1BVVA 3ZFEA 3B94A 4XPVA 1BXHA 4YGEA 3VBHA 2E6VA 2ARBA 3R4UA 4KWLA 2EAAA 2YMZA 4QM8A 1X36A 5LEJA 3RMXA 4GB33 2IWGB 4P9YA 3FBYA 1GLHA 5CNAA 4GMP3 3POYA 2FZ2A 1AXZA 4D7SA 1GZCA 4AEJA 4M0NA 2XBO1 1LJ7A 3E6DA 4YG3A 3ZIXA 4I02A 2CAVA 1ND3A 1D0HA 1FV2A 1GICA 5L73A 2YHJA 2A7AA 1DQ1A 3EBRA 4META 3BCWA 1C8M3 3AP5A 3FHIB 2WL1A 2VVFA 4Z1VA 3AMNA 3WQ7A 2A73B 4IEOA 2ETEA 2VULA 2VW1A 2A3YA 2FMDA 4QQOA 1H8VA 5A32B 3R05A 2EA7A 2OYZA 4E27A 1NA1A 4TZDA 3EHKA 2NQYA 4OZXA 3SHRA 1COV3 1ASJ3 4FTEA 4FVVA 4M3CE 5BNOA 4LBQB 1QQP2 4JGZA 5GALA 1MS8A 4HK8A 2BVBA 1RC6A 4GIQA 1Z0HA 2VOWA 3USUA 4LE4A 1WMEA 4CDWC 2DCYA 3H1WA 1GNZA 2OZ6A 4M3CF 3ZYRA 1XXNA 4CEWB 1JYCA 3FZ3A 4OI0A 1F31A 2OIIA 3HT2A 3N36A 2BWCA 4Y22B 1BBT2 4LULA 2MHFA 2RJLA 1ENXA 4TWTA 1PK6C 2IXKA 1PMIA 4Q2FA 1Y3TA 4MGKE 4QHBA 2BEOA 2ZMLA 1M06G 2B39A 4ORFA 1HLCA 1BEV3 5CFCC 1OA4A 2JG8C 3J26N 4DRRA 2YGMA 2XWJB 3PVNA 1PNGA 2RS11 5FMOS 2WFF2 2HWE3 5J98B 1E57A 5J48A 4ES8A 2ZA9A 2BUKA 1RJ7A 1MS3A 2AREA 1AR63 3KGZA 1A3KA 1RUC1 2XG3A 4CDUA 3KQRA 2VVEA 2D6KA 4FQ4A 1G6NA 2CNAA 1CPNA 1X8EA 1IS3A 3SCFA 1CQ9A 3J8F3 4Q0VA 4XJ9A 1YI9A 4XHBA 3M7AA 4YGCA 4Q4X1 4AI8A 3MYXA 1FATA 4UBGA 3ZFEB 1H4HA 2UU8A 3TYJA 4DPNA 3H7JA 1GZWA 1QQP3 4LBOA 5KWRA 3IPVA 3AKTA 4XF1A 1QJX3 4H7MA 2XJUA 4GWMA 4OLLA 3FLTA 5EJ3A 1LOEA 2RR11 3WG1A 2RS13 1SBEA 4XQDA 1PGL2 2X5IB 1S0FA 4N7IA 1W0PA 3O0XA 5C8CA 3GNEA 2BW8A 4UW5A 2NZ9A 5HXVA 3WY6A 1IS6A 2ZGSA 3RYKA 4EN7B 3MPBA 1W6QB 3UJOA 3AZVA 5F5QA 2VH9A 4Q4V3 3CLPA 4B8EA 3VUOA 4EJRA 3B9CA 5A32A 5FOJB 1FPN1 1NA1B 4LBLA 2NN8A 2WS91 4AGGA 2WWSA 4XQ4A 5BNOB 2N7GA 4B4QA 1ZREA 1QWRA 1N1TA 2BFUL 2VNRA 4R8HA 2XBO2 4N90A 1ULCA 1AR81 1V70A 3SCHA 1ULEA 1Y9QA 2X53S 4QT6A 4LHNA 4YM2A 4BM8A 3LCPA 3E5QA 2UWBA 5TSWA 1MVQA 3AYCA 1NY72 3VHNA 3D8CA 4J6GA 3BPZA 4M00A 1SFNA 4EWDA 1J58A 4PLOA 4CEWA 3M3IA 5CFCA 4PBOA 4WM8C 1GBGA 1QJX1 3D0SA 1DGRN 1EY2A 4UXAA 1LU2A 4YYOA 1OQEA 5JVVA 3I8TA 4R9DA 5KXCA 1F5JA 3QBQA 4H14A 4YW3A 1H8TC 1PNFA 2MEV2 1PO12 1TME1 4BIOA 2HYKA 1BBT1 3AK0A 2FQPA 4XF3A 1N1VA 1FX5A 1PO23 3FUQA 4F7ZA 3WD5A 5GZEA 3VBRA 1REDA 1UW8A 1QJY2 3KM5A 1CONA 1GNHA 3I7DA 2HWC1 2VOXA 4AFBA 2Y26A 3ZN6B 4IV3A 1UU5A 3CO2A 4Q4W3 2GNDA 1AF9A 4HPKB 2Q1MA 1S0BA 4JRLA 4V1PA 4WVWA 4CP2A 1OOPA 1CAWB 4KU8A 1TMF3 4HLTA 5A33A 1TMF2 3FLPA 3QH7A 4Y5Z0 1ZM1A 1Q8OA 1I3HA 3OF1A 3ETQA 4YM1A 4A3XA 3KCXA 1EP0A 2RMU1 2V73A 3I54A 2R6QA 4FTSA 1B35A 1DBNA 3FJSA 3UKVA 1QJY3 4OHWA 4QM9A 3VBFA 4OHYA 2W39A 3IPVB 4YVWA 2IXHA 3GHMA 5KHKA 4B7KA 2X8KA 4HVRA 3M3CA 1AJKA 4ONUA 3TN92 5IT6A 3AMHA 1PO13 1CAXB 1W6OB 4XDQA 5LEKA 2WNVC 2X5IA 4CDXC 3GZTB 2HWC3 1SCRA 2D5FA 5C8CB 4M0HA 4S2HA 5FO8B 3RNSA 4TLFA 2CGOA 4XFHA 3WINE 1ZRRA 4Y20B 3DF0A 2Y38A 3VLBB 1G86A 1X33A 2WZPP 5DDJ1 1H30A 5FLHA 1DYKA 3OBTA 3RSJA 2HWF1 2R042 4P9JA 2OUHA 2KXLA 1VBA3 5I0SA 1H8TB 1QH6A 1VAKA 2IXCA 1IOAA 4Q0UA 1DDLA 1FPN3 3RYRA 4OHZA 1CVNA 1MZ6A 2HWE2 4A7KA 2DCTA 4H55A 4K1ZA 4JC1A 5K0UB 3BOPA 1H2NA 2QQPA 2DCZA 4XIOA 3HR9A 2TUNA 1LRHA 3O12A 1G9AA 4HETA 5J96B 2WQ4A 1QF3A 5BYNA 2ZJCA 4C1WA 2ARXA 3AKSA 4XXPA 1R091 2IXJA 1EV13 4Q1PA 1QDCA 4XFAA 4BA6A 5K0UC 3V0AA 3QLQA 4LBJA 1WW5A 3ECQA 3P3PA 1Z7S3 1RB8G 1ZBE3 5C33A 5ABJC 2RS32 1LODA 1QOOA 3QCWA 4C0HA 4AFMA 1RUG2 1WLCA 4JAAA 2R073 4I2OA 1RUNA 4LBNA 4Q4X3 5CFDC 2SBAA 1HQNA 3CEWA 4NHKA 3WP3A 3L9JT 1YFYA 1YFWA 4Q4Y2 4XJAA 4NR1A 1ASJ1 4LA2A 5CIRA 1PM7A 4JV4A 1ASJ2 1VBD1 1FPN2 3A0KA 2RHPA 4XBNA 4LUKA 5BNPB 1VBA1 1QXRA 2P34A 2D98A 1CAWA 5GLWA 4TYSA 3JB4C 4WM7A 1TMF1 5A33B 3J4UH 2AZ5A 4D7YA 2EAKA 2FBEA 3NWKA 2YV8A 4MUVA 4D3WA 1NG0A 3OY8A 1G9FA 4Q4Y3 2DU1A 2Q1ZB 3JD71 4AI1A 3PHMA 3A4UA 2IZWA 5T5JA 4I3GA 2HEVF 1WD3A 1VBB3 1ND2A 3OD0A 3WT3A 4WVZA 3ZXJA 4FQZA 2IXLA 1JUIA 4D69A 2ERFA 4FPJA 4CDWA 4FXGB 1WCSA 4KL1A 3MFAA 3GBWA 2CWSA 2ZGMA 2ZGRA 3U07A 3R4DB 1RITA 5E8AA 1BK1A 3T1LA 4HANA 2WS93 4ITCA 4AHXA 2VQAA 1NYWA 3RS6A 2PHLA 4FBFA 5E89A 2XVGA 1MQTB 5C4WB 3VBOA 3VBSA 1O91A 4CDQC 3I59B 4Q4Y1 5SV8A 3V64A 3WP5A 2WNEA 4AF9A 2XLAA 1AR71 3ACLA 4HT1T 1D4M3 1L3JA 2DFBA 3UJQA 4AG4A 1XNBA 4Q0PA 4WM8B 2JG8A 4MGYE 1DYPA 5K0UA 1QXPA 2ZACA 1COV1 4FOYA 3MI8A 4QXKA 1QDOA 3QD6A 3O0WA 1QOSA 3NL1A 4RHV3 1DGWA 1AX2A 1O7FA 4KU7A 3BALA 3VZJA 3OTFA 1AR62 1YWKA 1SEFA 4PIYA 4FOWA 2A3XA 3BB6A 4WBBA 3PVBB 2F6BA 4CDUC 3VKNA 5GZFA 3S0MA 1KDKA 2QJVA 3V0AB 1OLQA 4Z92B 3R4SA 3OD4A 1FI2A 3CF6E 3WW4A 4DOUA 4LNVA 5I91A 3DPRB 1ZZCA 4L11A 3SISA 4AK3A 1ZRFA 2GDFA 4R9CA 4AGVA 4I09A 5BV6A 2D93A 4Q4W2 4DB5A 2EVXA 4IXLA 3NV2A 1XQNA 4JDNA 1YCIA 2WA3A 1O3QA 3VL9A 4KWKA 1VRH1 5CBLA 3N7KA 3QACA 2XJTA 4EN6B 1UCXA 2W08A 2RS12 1DGWX 5FLJA 5KXEA 4XJUA 2WNVB 4RQPC 3AZYA 3LSDA 3CJIA 3CJXA 4KGQA 5BNPA 1JOJA 1HXS1 4C1XA 3L2YA 4LLOA 2QFEA 3OYWB 4JCKA 1NOVA 5EYYA 3M3OA 4GMP1 4Q4V2 4WM7B 3B69A 4L9BA 1XYPA 1LCLA 3AFGA 3VBUA 1MVEA 5FPZA 1DG6A 2ZABA 1OLRA 2XH6A 4AVCA 1ULGA 5BNPC 2GZWA 3KCCA 3HN1A 1S0IA 2D97A 1YIFA 1G7YA 1OPMA 3L2HA 1N47A 4LHLA 3ZDSA 5I93A 5KHIA 2R30A 4ZU7A 3ZXEA 4HK9A 4NO4A 3SH4A 5F6LB 1C8NA 2LTNA 2I07B 1AR82 1PGSA 1JH5A 1WLDA 3GZAA 2GN7A 2WFF3 4CP1A 2ENRA 4XF4A 1KFXL 1PIV3 1JW6A 1N3OA 3VBOC 1LGCA 4XTMA 4ISQA 4AHYA 1KS5A 3LA3A 1LGBA 4AVTA 1CAUA 5BUVA 1SMVA 4PIZA 1OI6A 4PDWA 1SFYA 4GH4C 1FOD3 3KMHA 1V9U2 1QJU2 3RJ2X 4LO8A 2GALA 2ZMKA 5L7OC 5C4WA 3LSEA 1COV2 4L2NA 1NCRC 2P3JA 1KQRA 2AR6A 1DU3D 3GBFA 3RRDA 3U4XA 3MFCA 1CJDA 1YFUA 2AGSA 5JZGA 4N43C 2A6YA 2D6NA 2R16A 4Q8KA 2DVDA 1FMD3 4QPIC 3B3QE 2ZX4A 4RQPB 5CG8A 2ZX2A 1YHFA 2GH8A 1O5UA 4XTPA 3AM2A 1ZBE1 2JDZA 4X8PA 3U10A 5DDJ2 2EALA 4N7UA 5BNNC 1PGW1 5GM0A 4YNIA 1Q8VA 2ZPXA 5DUXA 2PA7A 1AL0G 1ULDA 5E1RA 4FOVA 1X7NA 5JWPA 2XHKA 1ZYBA 4WZCA 1SDWA 4YG0A 3ZMNA 2XWBB 2E7QA 2BTVC 3LOIA 4P9IA 2WSVA 4BQ1A 4XF0A 4BWOA 3SH5A 1V6KA 2PHFA 4GWNA 1SLTA 4K40A 3WCRA 1LEDA 1RIRA 1R083 5GLTA 1VBE2 3UK9A 1ZNPA 2XLGA 1J1LA 2K0GA 2WNVA 2X5IC 4R9AA 1PO22 2YXSA 5GZCA 5DXDA 3G6JB 3VHRA 1C1LA 3WVJA 4M3CA 2YPJA 3MIFA 3FMGA 4FAGA 4EV0A 4XETA 4NPRA 5F9TA 1DGRA 1OFNA 4KG8A 1S0EA 3LWCA 3VBUB 4XJZA 1RUG3 2HEYF 1CN1A 3OJBA 1XE7A 4H7LA 2BBVA 4LA3A 1MS1A 2O1QA 3ES1A 2JG9A 5FCCA 2BNMA 4UW3A 2PN5A 4AXOA 4LEJA 1LB2A 2HWB2 1ZA4A 2WINB 2ZKNA 4LBQA 3VZNA 1MEC2 3ZPYA 1WW4A 5JLVA 3ROUA 1RVF2 3WW3A 3BU7A 4IEXA 4AE2A 1EAH1 3GF6A 5CAZA 3H7YA 4SLIA 4M01A 1KRIA 1AR91 2R062 2JG9C 3WXPA 1NZCA 2V09A 3FFQA 2GMPA 4IESA 4MXWB 2ZGTA 3V65A 1RMU3 4LHKA 3VKMA 1AXKA 3N7LA 3ZXLA 4HSJA 4Y22A 2PYTA 1D4M1 4AVAA 1KJRA 1AX1A 3URFA 1LHNA 3TNPB 4LR4A 5K8SA 3VBSC 1FMD1 1WW7A 1NCRB 4OFGA 4WVMB 4BZ4A 3ZFEC 5DUWA 2ZOEB 4FPHA 5JSPA 2O8OA 1RUD3 2E63A 3NKGA 1CJPA 2R063 1R1A1 1YJKA 1RUI1 2WFPA 4K20A 3KSCA 3ALQA 4Q26A 2BQPA 4DZGA 3ILFA 1RINA 4EN0A 1BBT3 2CAUA 4PJYA 4X8NA 2ZGKA 4CEYC 4B4PA 2NMOA 1MEC3 4MX3A 3AB0A 1VAMA 2XPJA 4NN0A 1XNDA 1ZBA3 4H3WA 5FDBA 1W2UA 3WDWA 4BLJA 2NLRA 2R0FA 1LHOA 1HDKA 1DIWA 1DF0A 3P3NA 4BCUA 4COVA 5CADA 4IETA 1RUH1 1D4VB 1NLSA 3ZXKA 2C9AA 2WZR2 4GB32 2JE7A 3VV1A 1R093 4MV2A 2C5DA 5I8TA 4QQPA 2HWD3 3MIDA 1MS0A 2ZX1A 4QGMA 5D8AC 1RL3A 2UYBA 4DRVA 5J36A 1Z7S1 1HRV2 1A6CA 1GZWB 1Q8SA 1UMZA 3GBGA 1ZZ9A 3ZO0B 5LRSA 3TOJA 1NE4A 1ZZBA 2W68A 1POV1 4K21A 1QJU3 1MQTC 5GZDA 1WCDJ 4U36A 3FUOA 2K9ZA 3OGJA 3AX4A 4Y1UA 3TB0A 4OI2A 4M3CB 5EFUA 3UKNA 1W6QA 4COUA 2CGPA 4B29A 1RUD1 3WDXA 3IKWA 3THPA 1XYOA 2GSYA 2TNFA 4EROA 4DFSA 3UV9A 4EWEA 1UKRA 4U2AA 2E51A 5IK7A 2VVDA 2JG9B 1IZ3A 4BOWA 4XBLA 3KLSA 5DDJ3 4RR3A 2ZHKA 2GNBA 5H9PA 3U0ZA 1NCQB 4FTBA 4GULA 3BIWE 4QGNA 2DV9A 2PAMA 3MW2A 4F3JA 4XE9A 3AXDA 4KNCA 5JIUA 1VBB2 5E16A 1PVC1 5EYXA 3I4IA 2VNOA 4ZXKA 3PJYA 1VBB1 4RHV2 4YGDA 4CEYB 2E9QA 3WV6A 4MXWA 2XVKA 4FXKB 4I0WB 4C0BA 3THTA 2RS33 1MS5A 5IUQA 1SLLA 5CFDB 1XE8A 4AHWA 4YW1A 2QCSB 5CFCB 2V5YA 2ZGUA 4LBQD 4CTEA 4YM3A 1DQ4A 1LECA 5FO7B 4Q27A 2WC2A 3ZSMA 2ZGPA 4FT8A 5ABJB 1RHI2 1QOTA 1EV12 1Q8PA 2HWD2 3X29B 1SBFA 3MIEA 4WV8A 1NCRA 1PZ8A 4WVMA 1HKDA 5FPXA 3G7DA 2OW4A 1H4GA 3KCYA 5JDBA 4S2FA 4QU2A 5CU1A 3VZMA 5A3MA 3B02A 2R1DA 3VGIA 3LOBA 1K5MC 1CAVA 1V6JA 1R1A3 1OA3A 4KGGA 4E9KA 4LT5A 2ZGQA 3CJIC 2WT0A 1DQ0A 5BNQA 1U12A 5JOYA 4HPKA 1ENQA 2B8MA 1QU0A 1SLIA 3PLQA 4XZPA 5EWSA 1HIXA 1A8DA 2ZX0A 1Z7S2 2D44A 3ZXAC 2VW2A 5CVRA 3M1HA 4XJWA 5J7MA 2A5ZA 4COWA 1WLTA 2WNUA 3WDVA 1RUH2 1B35B 1U0AA 2RR12 1AJOA 1H1IA 1URXA 4DNYA 3W59A 3EJKA 2SLIA 3VBFB 2PLV3 2XUMA 2WIIB 2ZZQA 4HMZA 1XNKA 1V00A 4MLOA 2Z2SB 3AP9A 1CAXA 1RUF1 1W6OA 5H9SA 2VG9A 2AYHA 4CDXB 2OVUA 1H1AA 2RS51 5JAXA 1PK6B 3TBDA 2P17A 5KHHA 5BY5A 2X29A 1EAH3 4JTOA 2Q5TA 4ASLA 4Y20A 1R1A2 1DZTA 4NVPA 4KH9A 4IEZA 1UL9A 3IIAA 1QHDA 2BYVE 4XMIA 2NMNA 2DVGA 5JI7A 5DZEA 3RI9A 4QMAA 1H8TA 5C4WC 3AKQA 4UBHA 1VBC1 3HBZA 3RI8A 1O5LA 3DGTA 3ZXGA 1CD3G 1LOFA 4B4RA 1XNCA 3ZMOA 1NCQA 4YZ2A 1DLLA 1LOAA 4YGBA 4ATFA 4PCRA 4CZSA 1NY71 2BNNA 1KFUL 3B5LB 3MPPG 1AR92 2R061 4OULA 4AI3A 4Q4V1 1RUE3 1U5XA 4AEDA 1JHNA 4AWDA 1RUI2 1LGNA 1VIWB 1ONAA 1HRI2 2EXKA 2MEV3 4K3UA 2DWRA 1LOCA 3RWNA 1S55A 2JKBA 2B46X 3AYDA 2MPFA 4QX5A 3KS7A 2G9FA 2A3WA 1ZZ7A 3D0JA 3W58A 3R0RA 4FPOB 5ABJA 2CV6A 3BTAA 2PHXA 3NJZA 2P2KA 1GSLA 3ZX7A 2DTYA 4A7ZA 1IQAA 1UPSA 3VKOA 1RUG1 2PHUA 4GA9A 2BPA2 1F2NA 4JQRA 4MGZE 3TWIA 1X50A 1CAVB 3AYEA 4K7JA 1VBE3 3WDYA 3B7MA 2JE9A 3N7JA 4MZUA 1GANA 1YUDA 3JZVA 4KWJA 3O5SA 1EPWA 1PZ9A 4AEKA 5BNOC 2E7AA 1T6GC 4JGZC 3RG0A 4OUSA 1RUE2 1PZ7A 4ISRA 3QH6A 4Y1VA 5T54A 2QKDA 3NO8A 1AHSA 1SACA 3WLUA 1RGSA 3NSTA 3B93A 3AZWA 1UPIA 1XU1A 1WLWA 2WNUB 1ND3C 2BWAA 4YW2A 1EYBA 4K8FA 1KJLA 3APBA 4N9HA 5FLIA 3AP6A 5JSRA 1ND2B 1LU1A 2R49A 1JUHA