3QACA

Structure of amaranth 11s proglobulin seed storage protein from amaranthus hypochondriacus l.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
445
structure length
372
Chain Sequence
QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVSVIRRTIEPHGLLLPSFTSAPELIYIEQGNGITGMMIPGCPETYQDQHQKIRHLREGDIFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSNTGNIFRGFETRLLAESFGVSEEIAQKLQAEQDDRGNIVRVEGLHTICSARLAVNVDDPSKADVYTPEAGRLTTVNSFNLPILRHLRLSAAKGVLYRNAMMAPHYNLNAHNIMYCVRGRGRIQIVNDQGQSVFDEELSRGQLVVVPQNFAIVKQAFEDGFEWVSFKTSENAMFQSLAGRTSAIRSLPIDVVSNIYQISREEAFGLKFNRPETTLFRSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords 11S globulin seed storage protein
publication title Structure of amaranth 11S proglobulin, a major seed storage protein from Amaranthus hypochondriacus L.
rcsb
source organism Amaranthus hypochondriacus
total genus 103
structure length 372
sequence length 445
ec nomenclature
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA01
4TLFA 4YYOA 3SCHA 5T3NA 4QGLA 1O4TA 4H7LA 1ZVFA 1YFUA 3LAGA 2O8QA 4XFCA 4ONUA 4HZFA 2OZJA 3LA7A 3G7DA 1HW5A 4OLLA 3S7IA 4J1WA 4N9HA 1CAWB 3ES4A 2H0VA 3UKNA 2BNNA 4GULA 1VR3A 3PLQA 4QGMA 5CVRA 1ZX5A 2MHFA 4XF3A 1WA4A 4AXOA 2EAAA 3OF1A 4HVRA 4HN1A 4QX5A 5E16A 5JCTA 1ZRFA 4UXAA 4MX3A 5C8WA 4EWAA 1RUNA 3PVBB 1ZZ7A 2D5FA 3H9AA 2PHLA 3DKWA 2XL7A 2WFPA 3E5QA 4PIXA 3BPZA 4XFIA 1ZREA 4IEZA 4LTAA 3EHKA 4A2UA 3GBFA 3I54A 4X6RB 1J3RA 5CADA 3CJXA 1ZRDA 1XE7A 3H1YA 3H3UA 1CAVA 3LA2A 2GC0A 3E5UA 4PJYA 1NE4A 2OYZA 4Q0PA 1WGPA 4B29A 2C0ZA 1ZZCA 2PAKA 2Y0OA 3E6BA 2IXCA 4JV4A 4MV2A 1DGWA 3DV8A 3FWEA 3S0MA 3WW2A 3H1MA 4KL1A 4E2QA 4I0AA 4FAHA 3E97A 4AVAA 5I8TA 5D1IA 3E5XA 2ATFA 4PIYA 1RC6A 2Q4SA 1CAXB 4XFFA 4IEWA 3I59B 1VJ2A 3CLPA 4XF1A 1NE6A 4MGYE 4LUMA 5FLHA 4AQ2A 5I93A 4KU8A 2PA7A 3LA3A 2OA2A 4DINB 2BGCA 2GC1A 2XLGA 2B9UA 5I0UA 1J3QA 2ETEA 4ZU7A 1I5ZA 1UPIA 2FQPA 3H3ZA 5BUVA 2BNMA 2XLAA 1GQHA 2Q0AA 3H8UA 2BNOA 3M70A 3MPBA 3CF6E 4ORFA 2Q30A 2GH2A 5JSPA 4K8FA 5FDBA 4MGIE 4I02A 1O3SA 1YFWA 2PFWA 4KWLA 3ROUA 3NJZA 2ZCWA 4ZU4A 3ACLA 4LULA 1LRHA 2IXLA 4QMAA 4XF9A 2PQQA 1O5LA 2Z69A 3FHIB 3FX3A 4N9IA 3SCFA 3C3VA 1X8MA 1U12A 2PAMA 4L11A 4P9GA 3RYPA 4HN0A 3SXWA 3CEWA 4BHPA 1QXJA 2UY9A 2CAVA 3EQEA 3E6CC 3KMHA 4JTOA 3CL1A 1O3RA 2Q1ZB 3HT2A 1H1MA 3TNPB 1J1LA 5BV6A 1YLLA 2PAEA 1OMIA 1DZTA 4OFGA 4EROA 4YSFA 1DGRA 4IETA 2UY8A 3MYXA 1IPKA 4QM9A 1ZNPA 1NYWA 2VECA 4KWJA 4ZU5A 4YRDA 2ET7A 4XFGA 4IESA 2OZ6A 1CAXA 1YHFA 3FJSA 3H7JA 3I59A 3QOPA 4WZCA 4D7SA 1EPZA 4AVCA 1PM7A 3H7YA 5J3UA 5KHIA 4WBBA 2K0GA 2DCTA 4NVPA 5FQ0A 4Z07A 5I8SA 4FBFA 1CX4A 3CO2A 3FFQA 2VPVA 2CGPA 1TQ5A 2IXIA 5J48A 5HI0A 1ZRRA 2H6CA 4IEUA 1YFYA 2CAUA 2IXKA 4LLOA 1SFNA 2XHKA 3OCPA 2V09A 1I6XA 4FAGA 4MH0E 5KHHA 3RPQA 3EBRA 5K8SA 4I3PA 2EVXA 3R6SA 4MUVA 1H1IA 1SEFA 5KBFA 2QNKA 3ST7A 4O9EA 1CAUA 2Z2SB 5I8YA 4KU7A 1G6NA 4Q0VA 4UBGA 2B8MA 4IEQA 5KHGA 1FXZA 1YUDA 3LZZA 3U0ZA 1J59A 2I45A 4LA2A 2XKPA 5I91A 3KSCA 1UW8A 3IDBB 3KGZA 4F8AA 4JVAA 2GC2A 1FT9A 4MGZE 3B02A 3BALA 4IEPA 2OPKA 3M3IA 4Q0UA 1GQGA 4HVQA 3BCWA 3MZHA 2GZWA 4J1XA 3EO6A 3D0JA 1O5UA 1J3PA 4QM8A 1CAWA 3VHRA 5E1RA 4XFBA 3E6DA 4UBHA 3I7DA 5FCCA 5BXXA 2E9QA 5I0TA 2UYAA 3JZVA 5JR7B 2P17A 4MGKE 2O1QA 2XKOA 3KCCA 2BEOA 2VQAA 1OI6A 4QGNA 4IEXA 2BYVE 4BH9A 5LRSA 5JAXA 4PIZA 5CU1A 2MNGA 3NL1A 4E2SA 3NSTA 3L2HA 4IEOA 2H6BA 4Q29A 1X82A 2XLFA 5LRRA 4XETA 2K9ZA 1EP0A 3WW3A 1EY2A 1ZZBA 1UIJA 2GAUA 4YARA 1YWKA 2ZKLA 1LB2A 1ZZ9A 4HBNA 3OD0A 1CAVB 4HMZA 1NXMA 5F1RA 4IERA 3GYDA 1O3TA 1QWRA 3PNAA 2B5HA 3MDPA 4BYYA 4LUKA 1OD5A 1YFXA 2ET1A 3HIFA 3O14A 4RD7A 1RUOA 4R52A 3IWZA 1LKNA 2PYTA 3WW1A 4Q0QA 3IIAA 4I2OA 1UCXA 1DZRA 3LOIA 1Y9QA 5BPXA 4XFHA 2EA7A 1RGSA 3FE5A 3RYKA 5C6CA 1OFNA 2XL9A 4EWDA 3H50A 4Z82A 3N4MA 4I09A 4LA3A 1ZZ6A 5LEKA 2KXLA 3BB6A 1WLTA 3BU7A 1PMIA 3IDCB 1LR5A 1CGPA 5BY5A 2IXHA 5J7MA 2CV6A 1UIKA 3RYRA 2MPFA 4HLTA 4EV0A 2D40A 3IBMA 4JTNA 1X8EA 3ETQA 4O9GA 3NVCA 1V70A 4IEVA 3D82A 3RZZA 1IPJA 1NZCA 3U10A 1L3JA 1Q3EA 3ZDSA 4MZUA 1RTVA 1Q43A 4HVOA 4XEZA 2PTMA 2HKXA 1EYBA 1ZRCA 3SMHA 1UD1A 4I01A 3TNQA 5KHJA 1Q5OA 3UKTA 5FPXA 3QACA 4BIFA 1FI2A 5LEJA 4XF4A 1RL3A 1QY4A 3H1WA 3UKVA 4YNIA 4X6QB 4R8HA 3HQXA 3S7EA 4HSJA 2QCSB 1X7NA 3DL3A 1O3QA 2XGXA 5FLJA 4Q0SA 2F4PA 2PHDA 4HSLA 1QXRA 1VP6A 2D93A 5I0SA 3EJKA 1ZZ8A 4F7ZA 3NW4A 3RDIA 4XFAA 4QXKA 2GC3A 4FT8A 2QDRA 3WW4A 3ES1A 3HT1A 2N7GA 1XRUA 1Y3TA 3OGJA 3SHRA 5AVPA 2GU9A 4XF0A 5FQ0B 5EZWA 3SCGA 1SQ4A 2QVSB 3DN7A 2D5HA 3RNSA 3ELNA 4KWKA 3KGLA 2IXJA 2IC1A 4E2GA 1JUHA 4META 4D7TA 4L2NA 3FZ3A 3U11A 2WC2A 3NKTA 3OTFA 5JSOA 5KHKA 4IEYA 3D0SA 4CYDA 2HJIA 1XE8A 4I0BA 4LEJA 4AVBA 2FMYA 2QJVA 5FLIA 2UYBA 1CAUB 5FPZA 4AQ6A 4EWEA 5JSRA 4WVZA 3USSA 3LWCA 1J58A 1O7FA 5I0RA 5EFUA
chains in the Genus database with same CATH superfamily
2E7TA 3PIJA 5HPOA 4CP2A 4BK4A 2V5YA 4Q4Y2 1AR62 4TLFA 3MW4A 1POQA 4YYOA 3SCHA 5T3NA 1JTZX 1W3VA 2XUEA 1QJZA 3J7HA 1REEA 5FYSA 4COYA 4DXSA 4P08A 4AHZA 4BXFA 4E8CA 4Q26A 5JOXA 4FPKA 3FN9A 3R4DB 2JG9C 3AK0A 1AYM3 1AYM1 3LA7A 4HZFA 3H8XA 2YV8A 4V2VA 1OUSA 3NJYA 1WCDJ 1RVF3 1RVF1 3OUIA 1PIV2 2CHHA 4N9HA 4NN0A 2PLV3 1DCSA 2PLV1 4HANA 2G4IA 2XJPA 1R1A2 1YJKA 1SBEA 2VOTA 3B5LB 4GMP3 4GMP1 1PGL1 4XPVA 1HXS2 1VR3A 3MICA 4HKWA 5H9RA 4TZDA 2MHFA 2P3IA 3ZFEA 1JYCA 3MGUA 4OMCA 1O91A 1WA4A 1XSRA 4GKYA 4JDNA 3RSJA 1UMZA 1CONA 1LHNA 2JICA 3AZZA 4YVWB 1LGNA 4HVRA 4HN1A 4Q1RA 1W8NA 5JPMB 3DPRC 1ZRFA 5L19A 3VBUA 2JECA 5D8AA 2NN8A 2HYKA 2Y33A 4BJ0A 1DF0A 2OX0A 4BIOA 3HD8B 5FZHA 3PVBB 4FFFA 5AVAA 2Y6KA 5FUNA 3KM5A 3H9AA 1AX0A 1HJGA 1K5MA 3MW2A 2P37A 2PHFA 2ZEZA 5BNNA 1ZREA 3CZUA 2XDVA 4ISRA 4IEZA 4XQDA 4LTAA 4H2AA 4A2UA 2OQ7A 1QEXA 1ZRDA 3H1YA 1DGRN 1HIXA 3TEXA 4SBVA 4CXXA 4PF5A 5GZCA 4IE0A 1W6MA 4R4XA 5FY8A 1XSQA 1YIPA 4JHZA 1UXXX 3RQ0A 4YM3A 1NA1B 1DIWA 4AQTA 3WQBA 4A7KA 2FCVA 4UT5A 4TN7A 1WGPA 4B29A 3N7LA 2BUKA 1YJLA 2PAKA 1W6PA 2BERA 4P9WA 1UNBA 3E6BA 4NRQA 1VB2A 1RUD2 2CWSA 4QXCA 1DQ4A 3N9LA 4FFHA 4NIAA 2YU2A 3WNXA 4CDWC 5FWJA 4GKXA 1FPN1 1FPN3 4N7IA 5FZBA 2PN5A 2Y60A 3S0MA 3O1VA 5J09A 4E2QA 3USUA 1RUJ3 1RUJ1 2WJSA 4INDA 4LXLA 1BBT1 1BBT3 1YCIA 3K51A 4AVAA 2H0BA 2I2SA 1F4HA 3LQCA 1LHWA 2RS33 2RS31 4AFMA 2ATFA 3PVOA 4RGKA 3KVAA 2B46X 1RC6A 1W0NA 1UOJA 2VZOA 3HQRA 4HPKA 2KD7A 4NHXA 4XF1A 4ITCA 2O8OA 3IB3A 4KG0A 4MGYE 4FO9A 2BGOA 4NAMA 3ZXAC 4KU8A 2QUOA 5EP9A 5L73A 5H9PA 3BN6A 3RJRA 3RZKA 2GC1A 2KM2A 3WV6A 5K7PA 5FY5A 3SISA 3ILFA 2R32A 1I5ZA 2JDKA 3B7MA 4UOJA 3GCXA 2XLAA 4QQOA 3HAGA 5GZGA 1UZVA 2Q0AA 2XOMA 3H8UA 3FUQA 4R4ZA 5JZGB 2VCAA 2WWUA 3MPBA 4LO6B 5FZOA 2VZ3A 1E5RA 1UY1A 1X50A 2WNUB 2RS11 2RS13 2AUYA 4N53A 3WG4A 3WOGA 4M3CF 2GH2A 3KHCA 2VW1A 3IMMA 3NJXA 4QT6A 3VZOA 1OH4A 5F3IA 3WD5A 5AFEA 3NJZA 2W52A 1V00A 4CDUB 2W87A 2ZCWA 2FDKA 3OD4A 2CDPA 2VVFA 3S5QA 1CJDA 5E88A 2CSGA 2Y6HA 4FQ4A 4FPFA 3FUOA 4GH4B 2F17A 5D8AC 5DXDA 3V0BA 1QJU1 1QJU3 5C70A 4YW7A 1TG7A 4QXHA 4IV1A 4YW2A 3SCFA 4B8EA 3ATGA 1U12A 1PX3A 4QPWA 5FZ3A 4LKSA 4P9GA 2VOWA 3ZYPA 2NM1A 3SXWA 2TNFA 4NHKA 4MXWB 1UKGA 3GBWA 5LA0A 2D6PA 4NR1A 3JBG2 3PVNA 4RQPB 5EJ3A 2CAVA 3OJBA 4BHPA 3PMSA 1GWLA 2ADDA 1UZWA 4AAXA 3WF0A 2JG9B 1DBNA 3PUSA 4FPHA 1H1MA 1OKOA 3TNPB 1ENXA 4AHXA 3VHOA 3DGTA 3POFA 1YLLA 4YLZA 4OFGA 4DXRA 4AGVA 3GCWA 1OC1A 1VBA2 2VNVA 4AHWA 4K3UA 1PVXA 5A6YA 4XW3A 2MEV1 2MEV3 3J8F3 3J8F1 1X33A 4QM9A 1RUF2 1SLBA 1ZNPA 2VZTA 4ASKA 2X5IC 3CNAA 3AYCA 4ZU5A 4YRDA 3RFRA 1BZWA 3DPRB 5JMCA 1UX6A 3JB8A 3AYDA 5LBFA 1JBCA 3IAQA 4D7SA 2RM22 5I0DA 1EPZA 4F3JA 1DGWX 1RMU2 1C1LA 5F6KA 3H7YA 1WLDA 4OUSA 3K3OA 3VBSC 4C8DA 4D6QA 3DEMA 1GZTA 5FPLA 2E33A 2DCTA 3LPFA 4NVPA 4PI0A 5ABJC 3CIHA 2ZGRA 3AP6A 2Y6GA 4Z07A 3VUOA 2D43A 4WVWA 5I8SA 2JXAA 2XJQA 1QOTA 4BCUA 4FBFA 1NLQA 1CX4A 2ZGUA 2GNMA 4JKKA 5LCWL 3AFKA 5JOYA 1ZRRA 1ZBE1 1ZBE3 1PNFA 1KFUL 2CAUA 2XR4A 1OT5A 1H8TA 5E8AA 4Q4V1 4Q4V3 4DUXA 1MZ6A 3FLPA 5L7OC 1NCRA 2J1VA 1UZ0A 1KGYA 2ZHLA 3HVDA 4QX8A 4XBNA 3K4ZA 1NKGA 1GICA 1YYNA 1GNYA 2YYOA 3KF5A 4MH0E 4CXWA 3RZGA 2LS6A 1DFQA 3I2KA 2WSVA 3C7EA 4CDWB 2WA4A 1QH6A 5CKQA 3MLJA 2JIGA 1UYXA 4OYUA 1XYOA 3VL9A 4DQAA 4A41A 5C71A 3UKNA 3ST7A 4JRAA 2JD4A 2Z2SB 4O9EA 3PUHA 4QPGC 3SH5A 1K12A 4FTEA 1G6NA 5A7WA 5IFPA 1FXZA 3LZZA 1AHSA 1J84A 2X8KA 2VW2A 3I2FA 3WR0A 1OF4A 3MO4A 4IV1C 4XJZA 3DYPA 1RHI1 1RHI3 1XNTA 2WO3A 3F95A 5I91A 1BVVA 2Q1FA 3H8OA 1VBD2 2RJ2A 2DUQA 1BEV1 1BEV3 2K46A 5B4NA 5JI9A 3VDBA 1E57A 1K5JA 1H6YA 2VMHA 2WNVA 1YRZA 5A7SA 3N9NA 2ARAA 4CE8A 2HWD2 3B02A 2OPKA 3G6JB 3M3IA 4Q0UA 3SNMA 4OQ9A 1GZ9A 2GSYA 2ZXQA 4XXPA 5FP9A 3AM2A 4LBJA 4HONA 3CJIA 2P6CA 4QM8A 1CAWA 3VHRA 5E1RA 4GZ9A 5FZ0A 3O1RA 1OFSA 3WHUA 2OQ6A 4GJYA 2XKOA 4QB1A 4UW4A 4A7YA 2VQAA 5FBJA 4OHWA 1BYHA 1WWYA 4IEXA 1UU4A 4BH9A 2R49A 4PIZA 3UT0A 2E53A 4XUPA 4DMIA 3ZXJA 4RFRB 3L9JT 5LK7B 5CU1A 2VE1A 4LOTA 1OQ1A 1V9U3 1V9U1 3D8CA 5D8AB 2F4LA 2VQTA 1WMDA 2PHWA 2RDSA 3T0BA 2VCBA 2VBDA 1DQ1A 1LOAA 1JI6A 1X82A 2DVDA 3ON7A 4XETA 1JZ2A 3IZOA 1H6XA 5GLVA 3JQXA 1BMV1 2VZSA 5KWRA 2QTWB 2NLRA 2YBSA 2VMDA 4XABA 4AAPA 4KNCA 1HQWA 4I0WB 4LE4A 2ZKLA 1ZZ9A 1Q8QA 4LHLA 3VZNA 1SLLA 2QQMA 2A6XA 2WQZC 4N43C 1W6MB 3RMXA 2BTVC 1NXMA 3A22A 5F1RA 2P34A 3QH6A 4CCCA 2RR11 2RR13 1QDOA 1SG3A 2HYXA 4JQTA 4CSWA 4EN7B 4IXLA 1W6PB 3MBWA 4FPEA 4LKFA 3I8TA 5CG8A 2DBIA 3NJVA 2IFRA 3LOBA 2HWC1 2HWC3 2R30A 3GZUC 5T54A 2WT1A 1HN0A 2X5IB 4P00B 4LO5B 5IVBA 4AOCA 3GZTB 3U75A 1W9TA 4BE3A 1RINA 3USUB 4YM0A 2ZABA 3OBRA 4I3GA 4MYEA 1SLIA 4ZXEA 1LKNA 4A45A 2PYTA 4MO3M 5FXWA 3WW1A 3NO8A 1ASJ1 5BNQA 1CVNA 3VBSB 1DZRA 1Z7S3 1Z7S1 3AMNA 1D0GA 3VKNA 3CU7A 2WUHA 4HPKB 4UFKA 4AFAA 4LE3A 4MVTA 5HCFA 2OIIA 3KV6A 1H4HA 1NY71 5J36A 4IE4A 3SKJE 4CDQA 1TME2 5F3GA 5FYCA 3B00A 5J96B 3LDBA 3AL5A 4BM8A 2WNVC 2JB4A 2WSUA 3H50A 1RUI2 4I30A 4XDPA 3OY8B 4Z82A 1HV0A 3VBFA 2A7AA 1Y7BA 1H30A 1FMD1 1FMD3 2ZMKA 1JYNA 1AR92 1B35A 1R093 1R091 2KXLA 2SLIA 2YPJA 5L7OB 1TZOA 2QQLA 3N9OA 4NHLA 3MIFA 4XUTA 4IQPA 2JDYA 5ANQA 5FZOB 4AVTA 1UWWA 1XJAA 5BY5A 1JYVA 2YMZA 5FXZA 4BOWA 5JXJA 3EMRA 1ENRA 4KWUA 5GALA 4X6RB 1K42A 1NXD1 1ULGA 3ECQA 1DHKB 2MPFA 3BOWA 3IBMA 3ALQA 5FP7A 1IG3A 2YFUA 3TBDA 2BU9A 1LHVA 4IEVA 3THCA 4QPIA 4QPGB 3D82A 3ZM8A 5FZCA 3RZZA 1CZSA 2VJXA 5JLVA 3S30A 4Y5Z0 3V0BB 1NZCA 1AR73 1AR71 3U10A 2W94A 4IV1B 4NHMA 2Y6JA 4ET7A 2OW4A 1T2XA 4ES8A 1Q8OA 2R1DA 1URXA 3ZDSA 2XJVA 2ZGNA 3WHTA 2OUJA 1Q43A 3MV01 3IIIA 1UMIA 2PTMA 5F2SA 1EYBA 2DV9A 2C1FA 4CEWA 1UD1A 5A1FA 2R0FA 1UZZA 3KCYA 1W6NB 5DAPA 4DOUA 2DVBA 4LLFA 1FI2A 4EYUA 4CCNA 3H1WA 3N7JA 3AMMA 2XVKA 3RZHA 4O61A 4R8HA 1W03A 3KV9A 5GLWA 3P6BA 1O3QA 3N9MA 4FTSA 5FLJA 2IZWA 2F4PA 4W4ZA 2QQIA 4OCTA 5FMCA 4BPZA 4COZA 1W9WA 4UW3A 3APBA 1UU6A 5FK7A 1QXRA 1W05A 2YU1A 4QDSA 1LCLA 2DVGA 5I0SA 3DUIA 2RJKA 5K4LA 3SLIA 2RS52 4Y22B 2FZ1A 5JI7A 4F7ZA 1COV2 3I3EA 4QX0A 3WDTA 1LAJA 5CADA 1CQ9A 1I9RA 3K46A 4IV3C 5F32A 4XFAA 1IKQA 2CYFA 2GC3A 4QXKA 5LA2A 1W8OA 1SLCA 4JC1A 5IVFA 1IS6A 2QDRA 5T5PA 1XU1A 3HT1A 5FPUA 1Y3TA 3OGJA 3OYWB 3O12A 4YGDA 1DQ2A 2ZOEB 2V73A 4ATFA 1OOPC 1VBE2 2EXKA 4GWIA 5CEHA 3MIGA 2JG8C 4N43B 1XC6A 4OI0A 2D5HA 1H9WA 2G9ZA 1HLCA 2VCCA 3AMQA 4GQ7A 2VY0A 4CUCA 2W1UA 2DF7A 3GJAA 3ZXGA 1NCRB 3C7HA 4FCAA 1ND3C 4D7TA 1A78A 2QQVA 3ORJA 3NKTA 1S1AA 4CU7A 1OVSA 2GP5A 4YGEA 3OEAA 4A3ZA 1W28A 4DY3A 5FO9B 1RVF2 1XE8A 2W1QA 3AZWA 1OPMA 4AVBA 2QJVA 1D4M2 3RMYA 4UFHA 2UYBA 4QPIC 5LY2A 4XCAA 5A7WB 3I3MA 1JZ4A 3P5BA 5ISLA 5EFUA 1RUG2 1FNZA 4GA9A 1YQ8A 3BODA 2ZKNA 5FYTA 1VPHA 4BA6A 1RJ7A 4EN6B 3OPWA 3POIA 3IT8A 4NAOA 4H7LA 4LO7A 1X36A 2WNVB 1C1FA 1ZVFA 3VN4A 4EE2A 5KC5A 3A0NA 1WMEA 3ACHA 4HG6B 1JU3A 2R7EB 5ERLA 3I2IA 1XPWA 3K4DA 4XHBA 4PBOA 4CEWC 3MLKA 3G7DA 3FLTA 1HW5A 4OLLA 3HEIA 3S7IA 4J1WA 1W9YA 1CAWB 5LA9A 3ES4A 2VQ0A 1NUKA 1H9PA 3ABZA 2BBVA 4GULA 4S2HA 5FZ9A 1YEWA 2UWBA 4PDWC 2C5DA 4DUVA 1O59A 1WLCA 4QGMA 3TRSB 2ZX2A 3AP7A 5KR7A 1QOSA 4AXOA 3I3DA 3T2PA 1MS1A 2R1BA 5LBCA 1HB2A 5E16A 5JCTA 2ZBJA 2BJSA 2G9GA 3ZFFA 5C8WA 4QU1A 4EWAA 3TN91 3TN93 4YVWC 3GZAA 4PHZA 3BTYA 1PMJX 2GP3A 3DKWA 2XL7A 3IM0A 3VGIA 2AEYA 2WFPA 2AH2A 4PIXA 4CUBA 2QQWA 4DS0A 4UAPA 4FTBA 1S55A 1KQRA 1LULA 3EHKA 4DEVA 1OQEA 2Y34A 2C9KA 2ZAHA 3GBFA 3I54A 1J3RA 1PK6A 3J4UH 1WCSA 1HKDA 1ZBA1 1S0DA 1XE7A 1ZBA3 2HBTA 2RS32 3CJXA 4RSUA 3THPA 4NRMA 2NP0A 3H3UA 5A70A 3CQOA 1V6OA 3HWJA 2GC0A 1WD3A 3E5UA 5FUPA 4PJYA 4JDMA 2EALA 1CZVA 1NE4A 3D6EA 4BWOA 2CWMA 4D0QA 4BQ3A 4Q0PA 4ZS3A 5IATA 4FOQA 2WQ4A 3VV1A 2VD7A 4TLGA 2NYYA 5T55A 4DXZA 5A6QA 2WABA 4XQ4A 3JD73 3JD71 4UFLA 3V0AA 3WNMA 2ZGTA 3THTA 3DV8A 4OZOA 2ZGPA 1PO12 2RMU3 2OT7A 2RHPA 2RMU1 3H1MA 5EWSA 3UJOA 1Q56A 2R042 4KMQA 2ZEWA 3D5OA 3KV4A 3E97A 2RS12 3T0DA 3HR9A 3AVRA 3H0OA 3GHMA 4XAAA 2P6HA 3E5XA 4K1ZA 1LOFC 5K0UA 2BV4A 5FP4A 4XXAA 2VUJA 3ZSKA 4XFFA 3I59B 4C91A 1VJ2A 1ND2A 4OHYA 3OPZA 5FK8A 1NE6A 1HB4A 1OOPB 1GUIA 4LUMA 1DZQA 3HMYA 3POEA 2JDPA 4W65A 5FLHA 1NCQA 1KEXA 2PA7A 2OA2A 2JG8B 1G9AA 3PTRB 2B9UA 5I0UA 3VZLA 3BKZA 1HX6A 3B93A 1LENA 3NMBA 1ENSA 4YM2A 1LESA 2WAOA 2BNMA 5JPNB 2AEZA 1GQHA 1DQ5A 2VL4A 4ZZ5A 2BNOA 4H55A 2X05A 3M4FA 1ND3B 1L7LA 1JZ7A 4ORFA 2WAAA 1C4RA 5GZDA 3RG0A 3MF9A 4FOYA 4XAEA 5L36A 5FDBA 3DXTA 5JZGC 4CCOA 5ACA1 5ACA3 5LA1A 1AR82 5FY4A 2ZA9A 4EN8B 4QPIB 4XTMA 2WZPP 4XUNA 3ILRA 1YI9A 3NNFA 4IUGA 1VBC3 1VBC1 4UF0A 5FXVA 3VZKA 1ONAA 2PQQA 3J8F2 4B1LA 2WYFA 4N9IA 2BRTA 3C3VA 4TWTA 2V72A 1O6UA 2JE9A 1CIYA 5B4XA 3RYPA 1SMVA 2BZDA 1AVBA 5FZ8A 2ZMLA 4C1WA 4CCKA 4QQLA 4FP3A 4LKEA 5JOZA 3E6CC 5C5TA 1SBFA 4FFIA 4CEWB 3K2OA 1MQTA 3KMHA 4Q4W3 4Q4W1 3WG1A 4OHZA 5A32A 3ACGA 2X29A 4QD2A 4RQPC 1J1LA 2D98A 2P3JA 3JB4C 5D2AA 1S0FA 2PAEA 2BPA2 2XH6A 3EB7A 5F2WA 1REFA 4Y1ZA 4YSFA 2WT2A 1IGOA 4IETA 4PDWB 3T3YA 1LU1A 4AI0A 4FPOB 1NX9A 2EXIA 3M3QA 5CG9A 2UY8A 3MYXA 2GNDA 1KRIA 1EAH1 1IPKA 1EAH3 2WFF2 1RUC2 5FJHA 1EV11 1EV13 2QZ3A 3OEBA 4LITA 4Q4V2 3PIGA 2VECA 5BNOC 4NROA 5IVVA 1IQDC 1N3PA 1N1TA 1DDLA 5HBAA 3OBTA 4IESA 4SLIA 1CAXA 2VVDA 1FOD2 4CDXC 1GP6A 2JDUA 1HRV3 1HRV1 1C8M3 1C8M1 1QJX3 1QJX1 1PM7A 2G19A 5K0UC 1MEC3 1MEC1 1V6MA 5GKAC 4Z8BA 3O0VA 5GZFA 4WBBA 3DCQA 2W47A 5FP8A 2K0GA 1Y9GA 2W0XA 2J1RA 2RDRA 1JZ8A 3MFCA 3VBOA 1H8VA 4KGGA 2JJ6A 3DECA 3OGRA 4FOWA 1OVPA 3K3NA 2XPJA 5FYZA 3FFQA 1PM4A 2A6YA 2D6OX 3AKTA 5IK7A 4XJWA 3NV1A 1RHI2 1LHOA 3V56A 2B7YA 2CY6A 4Q5OA 4OI1A 4BK5A 5FV3A 2XVGA 4DRVA 1SHWB 1BEV2 1SFNA 1XBFA 4HL0A 3VHPA 3GNEA 4AEKA 3ASIA 5F39A 1AJKA 4BQ4A 3FBYA 2ZHKA 1AJOA 4XE9A 4COUA 4YG0A 4F83A 3RPQA 2HWE3 2HWE1 4I3PA 1O8SA 3R6SA 4E4SA 1X9TA 5A7PA 1H1IA 4QHBA 2QZ2A 3INAA 4XJ9A 1N3OA 5FZEA 2BDRA 3JCIA 3U1XA 5EV7A 2FDHA 1GV9A 3K48A 4G3YC 2XBO2 2DTYA 5I8YA 2ZZQA 4YZ3A 1MS4A 2DUOA 4UBGA 2B8MA 2PHUA 4IEQA 1DYPA 1ZA7A 4LBOA 3WCRA 4OUEA 1TMF1 1TMF3 2VQUA 5FREA 3U07A 3U0ZA 2I45A 2XWBB 4LA2A 4NWVA 2XKPA 3TEYA 3KSCA 1V9U2 4AEMA 4DO0A 1WA6X 1UW8A 3FMGA 4YFZA 5CFCA 1K3IA 3IDBB 3KGZA 3ZKUA 2GC2A 2TBVA 5A3PA 1FT9A 2FDJA 4MGZE 1WCUA 1QU0A 1FV3A 4IEPA 4R9BA 4AL9A 1RB8G 4RA0A 1MQTC 3EO6A 1BMV2 4ZONA 5H9SA 5LASA 3J26N 1Q8PA 3BIWE 4XURA 3J9SA 2Y64A 2BOIA 2R16A 3VD4A 1QJEA 4ATEA 2E9QA 5FBZA 3IPVA 5FRAA 3U37A 4CCMA 1NLSA 2P17A 3OSDA 2XB6C 3WQ1A 2BEOA 1OI6A 1CESA 4QGNA 3WX5A 4LIUA 3NWKA 2BYVE 4XIOA 2R061 2R063 4BISA 1RXFA 1GSLA 5J1XA 4NIGA 3VZJA 3POBA 4YVSA 3UNPA 2MNGA 3NL1A 1GP5A 3ZFEC 4E2SA 4WM8A 2HEYF 3NSTA 1CPMA 2AR6A 2ZHNA 2H6BA 4Q29A 3PURA 5LRRA 3GALA 4CEYA 3VBUC 4Q4X3 4Q4X1 1E5IA 5A3TA 1GYKA 4IGOA 5JDBA 3WF2A 3NKGA 4AEDA 1K5MC 4Q8LA 1YWKA 1PK6B 4GAZA 2DURA 5DG1A 5BNNC 3JU9A 1Z7S2 4GJZA 4E4DX 5LBEA 4FPJA 4Y26A 5FMBA 4YGCA 5LK5A 4DUWA 4QX1A 2QQPA 1UMHA 4IERA 3M2MA 2JB8A 4BQ5A 2E7QA 2C9AA 3A4UA 3GYDA 3ZN6A 3LIHA 3URFA 1IG0A 5CZKA 1ZYBA 4R9DA 1QWRA 2EIEA 3A21A 4Y20B 5T5JA 2B5HA 1KJLA 3MDPA 3ZYHA 4BYYA 1BLZA 1VMJA 2HWF1 1YFXA 2HWF3 2VR4A 3HN3A 4NE9A 1FMD2 2OKXA 5BNOB 1HQLA 3V0AB 1W2NA 4RS5A 1GKBA 1R092 3TEZA 4RD7A 3LB9A 4AGGA 5KC6A 5FY0A 3WXPA 5T5LA 4XQWA 3BU0A 4WVMA 4OHXA 2BFUS 3A0KA 2V4VA 4CDXB 3Q8CA 5DDJ3 5DDJ1 5K0UB 1UCXA 3OBAA 3LOIA 1FAYA 4C0HA 1HRI1 1HRI3 2W68A 1WLWA 1H2MA 2VTXA 4Q8KA 2A3YA 2F6BA 2EA7A 5CFCC 1PZ8A 3FE5A 1NCQB 3VDDA 2QBXA 3RYKA 3MUY1 5C6CA 3S6PA 1OFNA 4QPYA 5JIAA 3SH4A 3ZO0B 3ZPYA 2J7MA 4EWDA 1OSGA 1D7PM 4AI2A 1ZZ6A 5JOWA 4BQXA 4N90A 5LEKA 4XIKA 3W5MA 5C9AA 1UY0A 2D7FA 1N1VA 1WLTA 1M4WA 2BQPA 3BU7A 3GBGA 5C5UA 3IDCB 1F31A 4KGQA 3I2OA 1QGLA 1U5YA 2VMEA 1AR61 5A3OA 4D69A 2HH9A 2R072 1UIKA 1QNYA 3HQUA 4J25A 1OURA 2D40A 3AFGA 2QKDA 2XXZA 3ME2A 4P9XA 3ETQA 2CTVA 4N53C 1ZRIA 4P9LA 4QQ2A 3OB8A 3PUQA 5F6LB 3NNGA 2E26A 1XXNA 4L9BA 4XUQA 1JZ3A 5FPAA 2VUCA 1JOBA 4XZPA 4AEJA 2A70A 1WUVA 4NIIA 3TAYA 5FYVA 2WR9A 3ZLIA 3T4VA 3U4SA 1MS3A 1RTVA 1UAIA 4FQZA 1REDA 4HVOA 4XEZA 2YC4A 1OUXA 2HKXA 4AEDC 1PVC2 4LK6A 4XOGA 1ZRCA 3SMHA 1MQTB 4M0NA 4YW5A 5A32B 3UKTA 2BFUL 2BWAA 4NWWA 2XUMA 2ZGOA 4L92A 5DAQA 5FPBA 4RHV1 4RHV3 5LEJA 4XF4A 3B01A 2WDBA 4YNIA 3C7FA 3KT1A 2WA3A 3HQXA 1KXGA 1SFYA 3VKLA 1QNWA 2A71A 2WZR2 3KWVA 3NAPA 4MG2A 2XGXA 2A6ZA 4Q0SA 1G8WA 4HSLA 4XYXA 1JYTA 2EIBA 3I3QA 1QIQA 1UXZA 3ZX7A 4DZGA 5FZMA 2FMDA 5CFDA 2Q5TA 3ZFEB 1RYYA 4Z2AA 3I2DA 5C4WA 3NNLA 1SZBA 2WIIB 1VAVA 2WO2A 2XHNA 1V0AA 2DVFA 4B3NA 4ASMB 1MR5A 3VBUB 3S57A 3WW4A 2JDHA 2ZGKA 3AKPA 3Q8AA 3SHRA 5AVPA 3BVCA 4OMDA 4XF0A 3SCGA 5EZWA 3ZVXA 2FDFA 1OLMA 1K5MB 1RUD3 1RUD1 2WLPA 1FYUA 1XNDA 5BNNB 1W04A 5JR2A 1P8JA 4AHYA 2ZZJA 4YW6A 3PMEA 1ULEA 4FP2A 4KWKA 1UOFA 2JDAA 2QQOA 3KGLA 2IXJA 3PDQA 1NAEA 2IC1A 3W21A 4META 1YI7A 1WZXA 2Q8CA 3MEPA 3EXUA 1VRH2 2E32A 4XHXA 5GLTA 3FZ3A 1H8TC 2I74A 2WC2A 3SEEA 1VMHA 2Y6FA 3AC0A 3OTFA 3IAPA 4IEYA 1NCRC 1EUUA 4CYDA 4FXKB 5JUVA 3T1MA 1BHGA 4QB2A 2LW8A 3LDKA 3WG2A 3LDRA 2CGNA 3DYOA 2ZGQA 4LEJA 1QQP2 1GFF2 2P1BA 2XJTA 3MLLA 5FLIA 5G05L 3VBRA 4UFJA 1U5ZA 4AQ6A 1W8WA 4EWEA 2W08A 2WKKA 4DPNA 3USSA 2DU1A 2CDOA 2VH9A 1J58A 1O7FA 3LWCA 3PUIA 5I0RA 4UI9L 2FCTA 2WBKA 4BB3A 5IT6A 2UWCA 2VW0A 2XWJB 2ZAAA 1KS5A 3RGBA 5FOJB 2HWB3 1WBFA 2D3SA 2HWB1 4OULA 1ASJ3 1CPNA 3WZ1A 5CFCB 2VGDA 1O4TA 1WW6A 3TN92 4BZ4A 5FYUA 4DRRA 2VOVA 4L99A 1YFUA 4ZKTB 3PHMA 5IWFA 3UGFA 3LE0A 3S5AA 2GMEA 4XFCA 4M01A 4ONUA 4CUAA 2ORZA 1S0IA 4LJHA 4D3WA 5IVEA 1HQNA 1GOFA 4ISQA 4E4HA 4NIHA 1RUE1 1RUE3 2P2KA 4COWA 3CMGA 4MHUA 4LKDA 4AVVA 4N8MA 1OA3A 3WP5A 2VTFA 2BNNA 4UYBA 5EQUA 1ZBA2 3RS6A 3WVJA 3IPVB 3ZYRA 2VM9A 3CJIC 3ZYGA 3PLQA 3I4IA 1PHMA 2OUHA 3NAPC 4IGQA 2Y8KA 5FYHA 4MADA 2Y38A 3BPSA 1G86A 2EAAA 2AACA 2JDMA 4LBMA 4LMFA 3ZR6A 3JBG1 3JBG3 4N53B 3AB0A 5FMOS 3W58A 4QX5A 2QE3A 3T4HB 1POV0 2X09A 3AP4A 4UXAA 1V6JA 5FO8B 5A1LA 2CU5A 4LBQA 1TNRA 2YC2A 3POYA 4LOSA 4ZZ8A 4IL7A 3E5QA 5EJZB 1QJFA 5LBBA 4RFT0 3OGGA 5J98B 3BPZA 5EPAA 4A4AA 1MS9A 2GN7A 3GDBA 4P14A 4P9IA 4PLMA 4AEDB 1LOCA 4AFDA 3C7OA 1SLTA 3TOJA 5C8CA 3RVHA 1IQAA 3O7OA 1RUH1 1RUH3 4GB33 3AZYA 4GB31 4B7KA 1SDWA 3BI3A 1Z0HA 4YZ1A 1CAVA 1YNAA 2G1MA 4YZ2A 1OLRA 1XYPA 3CHXA 3O0WA 3RZLA 4R9CA 5H9QA 1GOGA 2OYZA 1DQ6A 2RM23 2RM21 3ZN6B 3PUAA 4K20A 3O5SA 5JIUA 2C0ZA 2YXSA 4CU9A 5FKBA 2Y0OA 2IXCA 4JV4A 5FZDA 1PGW1 1QJY2 2BW8A 1BCXA 3NQHA 1DGWA 2DBNA 3KV5A 1QF3A 1UF2C 4A44A 3FWEA 3T2QA 3WW2A 3TB0A 3VL8A 4KL1A 4E4ZA 4MXVA 4I0AA 1FV2A 4A3XA 3UYJA 2XJRA 4QX7A 3VBRC 1S0GA 5F5QA 1GANA 1W6QA 5D1IA 5AFBA 2FDGA 3QH7A 4IGPA 4PIYA 4ZS2A 4AWDA 3KD4A 2Q4SA 5ACA2 1LODA 4XMAA 2XONA 2FHRA 2WRAA 4IEWA 3WEZA 3VLBB 3V64A 5DZEA 4FI9A 5I93A 5DMYA 1XNAA 2CL2A 3FC0A 1HB1A 2VMFA 1VBB2 3I3BA 1JH5A 4Y3OA 5FYBA 2BOJA 1SACA 2BGCA 3OGSA 5FMOL 3ZXFA 2XLGA 1DP0A 1J3QA 1J1TA 1XNBA 3BIEA 1UPIA 4RYDA 4CDQC 1T6BX 3W5NA 3J7LA 1QOOA 5C9AB 1N47A 5FO7B 2B9VA 5IFTA 4LHKA 4JGYA 4NPMA 4YG3A 4XMIA 3CF6E 3VBFC 3ZYBA 2Q30A 1H8TB 4HETA 1B35C 3QBQA 5SV8A 5KXEA 1YQ2A 2QQKA 2IVIB 4Q4W2 3UESA 5JSPA 1XNCA 4PQQA 1O3SA 3LFMA 2YBPA 2PFWA 1V6NA 2W46A 4KWLA 4YZ4A 2JEMA 3ROUA 2RJLA 5FZFA 3T2TA 4RGGA 1AXYA 1R081 1AYM2 1R083 1STMA 2J42A 5EYXA 4DY5A 4ZU4A 3ACLA 3HJRA 1W0OA 1ENQA 2ZS6B 4PT6A 5D21A 1LEDA 5DUUA 1LRHA 2IXLA 2JE7A 3LSEA 4XF9A 1EAH2 2PLV2 5E89A 4HKLA 5EHDA 1PGL2 2GMMA 1EV12 3SITA 3B94A 1A8MA 2E7AA 3KHBA 3RWNA 2VNRA 3RWKX 3SQOA 1X8MA 4DIQA 2VU9A 4L11A 3AP9A 3LIGA 1UPSA 4PI2A 3D4KA 1WD4A 2VNOA 5FXXA 1QXJA 2XJSA 3EQEA 5C8CC 1KDMA 1H0BA 1NA1A 5DUXA 3THDA 4CU6A 2Q1ZB 1G9CA 3HT2A 4Y4RA 4QQPA 4W6XA 4CA9A 5BV6A 5A3LA 1OMIA 1DZTA 3HBKA 3FHAA 1LOGA 1DGRA 2DCJA 2DFCA 2RDNA 4NOTA 4CP9A 2VBPA 3CJIB 1C57A 2YGLA 3NAPB 3WINE 1MZEA 1DLLA 1NZIA 1M06G 2WNOA 1OF3A 3ZXKA 5EJ1B 1O4YA 1NYWA 3VBOC 4KWJA 2HEVF 2GALA 1BK0A 5A6XA 1HN1A 3VHNA 3VD9A 4NHYA 2OZ6A 4RGAA 4KG8A 4CCLA 1YHFA 4TXWA 3LF7A 1LECA 3QOPA 1KS4A 1LJ7A 2HWE2 3FLRA 4WZCA 4XACA 4A42A 3TEWA 2GH8A 2WZEA 4AFBA 1RITA 1W99A 3ZPOA 5KHIA 2Y26A 5C3QA 4QKFA 4QXBA 4WV8A 3WG3A 5FQ0A 3DXUA 2W92A 4XTPA 1FPN2 1LNSA 2J1EA 5A3NA 1QMJA 3HNBM 1DYKA 1TMF2 3LEIA 4LBLA 1RUJ2 4EJRA 5SV5A 3OPTA 1BBT2 4IEUA 1OHFA 2IXKA 5DAVA 2ZX3A 2WNUA 2YPDA 4PF1A 4JGYC 4Y1XA 2IVJA 2XHKA 2DTWA 3M8LA 4S2GA 3B69A 3MI8A 2WN3A 4Y1UA 5F5CA 4FAGA 4XJUA 4AR2A 1BQPA 1MACA 1S0EA 1T6GC 3FFZA 5FY7A 5KHHA 1PGSA 5K8SA 2EVXA 3ENRA 3MW3A 5KXDA 1UN1A 5IVJA 1TME3 1TME1 1W2OA 1Z78A 2JKBA 3WCSA 3X29B 4AF9A 1W6OA 4PCRA 4ASLA 2NQYA 1C3HA 1CAUA 3VBRB 5LW9A 1G9DA 4KU7A 3FBMA 4ARYA 5CYYA 4Q0VA 3ZMOA 4RN5A 2ADEA 3ZYIB 2BP6A 5JWPA 5KHGA 1ULCA 1UYZA 2JKXA 4MXWA 4PBPA 2R062 1OA4A 4K8RB 4G9SB 1Y9MA 3EYPA 1FNYA 5LZ6A 3ZXEA 4DB5A 2JG9A 1TEIA 4WVVA 4JGZA 3CBNA 3AP5A 2O14A 2LROA 2VOKA 4BQ1A 5ANNA 1NOVA 4CDQB 5IW0A 4ZHNA 4BQYA 1MS0A 3T1LA 3D0JA 1O5UA 1QJU2 1W9SA 3CDZB 1J3PA 3Q8FA 3ZN4A 2WS93 2WS91 3WY6A 3ZSMA 2TEPA 5FCCA 2K2SA 3ZSLA 3VBFB 4OZXA 3T30A 1B35B 4IE6A 2UYAA 2E31A 4ES9A 4MGKE 1POV1 1POV3 3KCCA 3ZMNA 2XJUA 2Y6LA 3DPRA 2DUPA 1NLRA 3PU8A 5FPVA 1S2EA 1KDKA 2QQJA 4WM7A 2WO1A 1NG0A 3UL2A 4YM1A 4FPYA 2ZACA 3MV11 3AZXA 4LBQB 2HWF2 2Q8EA 2LUWA 1SLAA 1CX1A 1VB4A 5F8PA 2LALA 3H8RA 3AMHA 3GJBA 2HEWF 3ZFFC 3B3QE 2YDEA 4LHSA 2PQSA 1W2TA 1HJFA 1Y43B 2DCKA 2MEV2 1L7QA 1ZZBA 2EXJA 5CNAA 4AVSA 2GAUA 1IOAA 3GM8A 4YARA 4RL7A 1DU3D 5DDJ2 5C3RA 3V65A 5C8CB 1LB2A 3M1HA 3AKQA 4HBNA 5A80A 4CUGA 5IHRA 5C33A 3OD0A 1WMXA 1CAVB 4HMZA 2IWGB 1HRI2 2ZPXA 4L97A 5L9BA 4BMBA 4AYUA 3VKFC 4BMEA 1US3A 4OVEA 4CTEA 3OBZA 4KI5M 1PK6C 1COV3 1COV1 2UURA 1J83A 3AJYA 1TNFA 4U36A 4CDWA 4EN9B 3OG2A 3W59A 5C3SA 3WF4A 4C1XA 4LUKA 1AL21 1AL23 3GXUA 1OD5A 1MZFA 3BUCA 3HIFA 3O14A 3N7KA 2XG3A 2W95A 1U5XA 1UY3A 3WNOA 3LGRA 4AFCA 5C3OA 4JDOA 3ZFGA 1ZBE2 2FBEA 3E1F1 2XVLA 3O1TA 2PHRA 3ZSJA 3I49A 4GALA 4QQHA 2J1AA 2WQ8A 1C5HA 1SCSA 1VLNA 2NMOA 1UYPA 2ORXA 2R6QA 1W6QB 1DYOA 2VAUA 4QX3A 1YC61 4Q0QA 3IIAA 3WT3A 2BVVA 1YO8A 4I2OA 2ZX4A 4IDZA 3HOBA 1Y9QA 3QCWA 4CP1A 1JN2P 3C2UA 2YBKA 3KQ4B 4UW6A 4IE5A 1MVEA 4JGZC 1JUIA 1ND2C 4E9KA 5F9TA 1KJRA 1ODNA 4LA3A 3N4MA 2PHXA 1NCQC 3NNMA 1D4M3 1AYN3 1AYN1 1D4M1 3P3PA 4JAAA 3MHZA 4GWMA 3O1MA 4JGYB 2D44A 1PMIA 5HCBA 3BYWA 4FOVA 1CGPA 2C6SA 2IXHA 1RUG3 1RUG1 4LBKA 4AK3A 2CV6A 3K75B 1JXNA 5HCHA 4YFWA 3OUJA 2B4KA 5EXOA 5T50A 4GD4A 5IAVA 5A3WA 4A6OA 2D6KA 1CJPA 1SDDB 1PO23 1PO21 1CZTA 2W91A 3GF6A 4HLTA 3VZMA 4RHV2 4EV0A 1D4VB 4URTA 2FDIA 4O9GA 5CKNA 4WZFA 4WM7C 1F2NA 1BXHA 2GN3A 2FD8A 5DUWA 4AI8A 4QB6A 5F5IA 1VMFA 4CPBA 1JZ5A 1IPJA 4EZHA 1L3JA 3F2ZA 3OUHA 1S2KA 1S0CA 2J1TA 4CP0A 3AKRA 2VZ1A 2YGMA 4UFIA 4MZUA 4Z92B 2WO7A 2V5DA 1OLME 3N9PA 5K9YA 5G04L 4A7ZA 3AZVA 4QDQA 2XQXA 1XB9A 3LKJA 3RZMA 4QAWA 4I01A 4BQ2A 1QDCA 2Q8OA 1CD3G 1LOEA 4QKBA 4Y5TA 4AI3A 4CZSA 1V6IA 4LK7A 1QY4A 2P3YA 5CA6A 4M3CE 2Z79A 1SCRA 4CP9B 4HSJA 2X5IA 4A6SA 3R4SA 5BNPA 4YG6A 2CGPA 4K6BA 2PHDA 5BYNA 1G7YA 4QHZA 1JS9A 4B4RA 5DG2A 5GLZA 1VP6A 4V2WA 3MIHA 3ZFGC 2D93A 4JKMA 4AE2A 2AYHA 1N3QA 3O1OA 3I97A 1BKZA 3NNJA 3EJKA 1ZZ8A 3VBSA 2RR12 3VD7A 3RDIA 3J7NA 3BTXA 2DVAA 5ABJA 1CIWA 4MHRA 1LGCA 2C4XA 5FY9A 5IUQA 4P02B 3B9IA 4QKNA 3ZFFB 5AC91 5AC93 5CBLA 2ZJCA 1ULDA 1TVGA 3ES1A 4S2DA 2N7GA 1XRUA 2AC1A 2HWC2 2ARXA 5FQ0B 3RI9A 3WP3A 4M4PA 4O7XA 3WF1A 2GDFA 2NZ9A 3OY8A 1KD7A 4QU2A 1JOPA 1RXGA 2HBUA 2YY1A 4Z1VA 2J1SA 3Q8BA 5L7OA 3UK9A 1V6LA 1PO13 1PO11 2JIJA 3M3EA 3RNSA 2ES3A 1F35A 2DCYA 4Y5SA 4YPJA 5A3UA 2R041 2HWB2 2R043 4JQRA 1ASJ2 4BU2A 2BBAA 2O0OA 4YW3A 5LB6A 1OBNA 1KFXL 4COVA 1US2A 2VZRA 5FMDA 4XJAA 4DEQA 2YUEA 2ZGSA 5CB7A 1NT0A 1DG6A 2BVBA 4L2NA 3RRDA 1NY72 5HV4A 4D8MA 3U11A 1G9BA 2ZMNA 1UZYA 5JSOA 5KHKA 2P3KA 1DQ0A 4QPGA 1O4ZA 3B9CA 1RUE2 4D7YA 5JXIA 2W5FA 2YC0A 2VMIA 1WW4A 2HLEA 3C8XA 3WDUA 1W6OB 4HOOA 1RJ8A 3JUUA 3MIDA 2EXHA 2OXBA 1CAUB 1D2QA 1WW5A 1YQ6A 2IFWA 2XMLA 5FPZA 4WVZA 1H4GA 1LEMA 4CVUA 4CCJA 2ERFA 2GMPA 1PZ7A 1GOHA 4O65A 4P9YA 2G9FA 2AREA 5IK4A 1F5JA 3GHNA 3O0XA 5FZ7A 3ZYJB 3PTYA 3WNKA 4Y4YA 4QGLA 4YW1A 4JGZB 1GZWA 2W1WA 1SPPA 1F9KA 1ND2B 1UL9A 1W6NA 2ILMA 2VBBA 2W2IA 3LAGA 2O8QA 3WDVA 4N7UA 4OUMA 1AR81 1AR83 1QH7A 5FIXA 1BK1A 2FCUA 2OZJA 1VALA 3N36A 4UW5A 1LGBA 1AR72 1VAKA 3LFIA 4LIVA 1YQ5A 2UU8A 4LO8A 4PQ9A 3SH3A 1PNGA 1H2KA 2H0VA 2DU0A 4XC9A 5DN2A 3W9AA 2TUNA 2VMGA 1Q8SA 1RUH2 3VDCA 3VDAA 4GB32 3WDXA 1I3HA 3ITQA 1UY2A 3NV4A 4NJ4A 3ZXDA 2WYSA 5CVRA 1ZX5A 3KB5A 4QWNA 4XF3A 5BNPC 1W2UA 1ULFA 2JDNA 2A3WA 3CKHA 3POWA 4XDQA 4Y22A 4B4QA 1OA2A 1MVQA 2YB7A 1WCQA 3OF1A 3U78A 3WQ0A 4Q4Y1 3AMPA 1AR63 4H3WA 4Q4Y3 3KZ4C 3PJYA 4WM7B 2CNAA 5CIRA 4XBQA 5A1AA 2DWRA 2Z5WA 4MX3A 4XZUG 1RUNA 1AZDA 1PGW2 2A1XA 5LATA 3OYWA 2D3RA 1ZZ7A 1QKQA 2D5FA 4LT5A 1D0HA 4YVSC 5JMOA 2PHLA 3AYAA 2W39A 3LSDA 4QHOA 4WM8C 4XFIA 3JXSA 4UF0B 4W50A 3N35A 3I2GA 4N43A 1Q8VA 1PIV1 1PIV3 5JXHA 2WFF1 2WFF3 4CEYC 1RIRA 1RUC1 1RUC3 4AGRA 1R1A3 1R1A1 3LEGA 5J37A 1JHJA 4LPLA 1HXS1 1HXS3 5KXCA 4UFMA 5FWEA 3H3LA 3LA2A 2WNEA 1W0PA 2DDUA 3TYJA 5CAZA 3ZN5A 2X10A 1S2BA 2E63A 4JRLA 1FOD1 1FOD3 1GR3A 2VTXJ 4AQSA 1IS5A 5HXMA 5EYYA 2VXJA 2VXRA 3POGA 3WNLA 1ZZCA 1UY4A 2YG0A 4MV2A 3AYEA 4RR3A 4ZPIA 4E8DA 2ARCA 3ZFGB 3A23A 5IAXA 3UETA 1UOBA 2P5BA 1OPOA 2YFZA 4Z2WA 4FAHA 4K1YA 1I1EA 4B1MA 1GNHA 4S2FA 4RS5C 5IK8A 3POSA 4HK8A 5A33A 5I8TA 2SBAA 2JE8A 2EIDA 1CAXB 2VMCA 2ZEYA 4KH9A 4R9AA 2VULA 3N3HA 1R082 5TSWA 3CLPA 5JXGA 1IS3A 2VZUA 2ZX1A 1IHMA 4AQ2A 3P3NA 1UU5A 3MIBA 4BXSV 2NPIA 2A73B 3LA3A 4DINB 5FKCA 3T0AA 1JW6A 2PHTA 2Y0IA 2B39A 2RV9A 3AXEA 2J1UA 2ETEA 4ZU7A 4FPGA 3K77A 4M0HA 1W2AX 3VBOB 4FSJA 2FQPA 2VNGA 3H3ZA 4MSVA 4DXTA 5BUVA 3FHQA 3VDDC 3ZDVA 2XBO1 2XBO3 4K21A 1IPSA 3A7QA 4H7MA 4GWJA 2A3XA 5FOBB 3M70A 1NQJA 5C9AC 3GGLA 2XQRA 3KCXA 4K8FA 4P5YA 4M3CA 3HN1A 4MGIE 4I02A 5B2GB 4DNYA 2QDNA 1YFWA 4M00A 5APAA 3SEPA 2JENA 4Q2FA 5T5OA 3N7MA 3KT7A 1TE1B 3FL7A 4XDOA 4FPCA 1EPWA 2EIGA 3KQRA 4W6WA 4LULA 4QMAA 1WBLA 1X9PA 4LNVA 5CISA 1NQDA 3AJZA 1O5LA 2Z69A 4FVVA 3FHIB 4Y33A 3FX3A 3VKOA 2VCMA 1ULOA 2PAMA 1W06A 1GLHA 1GP4A 4HN0A 2D6LX 5FZGA 3NRUA 2VO5A 1B09A 4NMIA 5DABA 3RZJA 3ILNA 1JU4A 2OVUA 3CEWA 2UY9A 3R4UA 3WDYA 4XJ8A 2GNBA 3LCPA 1L7RA 1AXZA 4JTOA 3CL1A 1O3RA 1G9FA 3VD5A 3DF0A 1W39A 3PU3A 1EUTA 5C7GA 1OXCA 3HPNA 2YHJA 4EROA 1GU3A 4CCEA 1E5SA 3QD6A 3WUDA 3ACIA 5BNPB 2B42B 3MIEA 3VBHA 1WKYA 4BQWA 4LBNA 1LOBA 4URAA 4CPBD 3JQWA 4RR3C 4IV3A 4NPRA 4B7EA 5AC92 5CKMA 3HNMA 2ET7A 4XFGA 4H14A 4LO4B 1OKQA 3FJSA 3H7JA 3MUZ1 3UJQA 3I59A 4BLJA 1UKRA 4HT1T 1JYXA 5ABJB 2ARBA 4AVCA 4YVSB 5CFDC 1OOPA 2PMWB 3VB9A 3WSOA 3WQ7A 5J3UA 4WM8B 2Q1MA 5C4WC 1HB3A 2JG8A 1AX2A 3M7AA 4LR4A 1ALYA 3JD72 2VUDA 1PX4A 1JYWA 2KR2A 5FZAA 2D6NA 4CEYB 3ACFA 3SC7X 4D6RA 4ZY9A 2RMU2 4PLOA 3CO2A 2VPVA 2WZ8A 1TQ5A 2IXIA 3T2OA 1V6KA 4AI9A 5IVCA 5HI0A 5J48A 1VBA3 1VBA1 4X8NA 2H6CA 2VC9A 1ND3A 1YFYA 2A6VA 2KA3A 1PMHX 2A75A 5A7OA 2L9LA 1RUF3 1RUF1 3MFAA 1XNKA 4HFSA 1W8TA 4LLOA 3MF6A 3Q9OA 1GMMA 3OCPA 2CGOA 2J22A 2V09A 3MPPG 2EICA 4OI2A 1I6XA 1D2SA 4Y24A 4P9JA 5FJKA 5FP3A 3ZKYA 1N1SA 4QDRA 3EBRA 1ZA4A 4X8PA 5F7UA 2BWCA 1UOGA 1RMU3 1RMU1 4MUVA 1VAMA 2WS92 5FY1A 4D94A 1SEFA 2PELA 3WP4A 2I07B 2D6MA 3R05A 5KBFA 2QNKA 4MGTA 3OOXA 2IUWA 4GXLA 5FR3A 4RS5B 3U14A 1ZM1A 3UGHA 1GNZA 2AENA 2AGSA 3Q8EA 1W8UA 1YUDA 3GZEA 2E51A 1S4CA 4YWAA 1QHDA 2DCZA 5FYIA 1J59A 3L2YA 4WVMB 4OQ8A 1GWMA 3OGVA 3WDWA 3ZSEA 4P5HA 3WP6A 4AI1A 1IZ3A 1U5IA 1C28A 3IDAA 4F8AA 2R073 2R071 2VG9A 1GZWB 4JVAA 5DAXA 3WF3A 4AZZA 1SPPB 4EZ4A 1BJQA 4TSVA 5FZIA 2JX9A 3BALA 2V4AA 3MZHA 1GQGA 4HVQA 3BCWA 3VDDB 2GZWA 4J1XA 4TYSA 2FZ2A 3ZIXA 4PDWA 1VBC2 3AKSA 1SBDA 1WMFA 5A6ZA 4XFBA 3E6DA 1DLCA 4UBHA 3I7DA 1HDKA 5IJRA 5BXXA 1R64A 3LEMA 5I0TA 4L0PA 2LRPA 2C24A 1AX1A 3JZVA 5JR7B 1W3XA 2EAKA 1SFPA 2O1QA 4C0BA 4Q27A 4Y1YA 1CN1A 1R1ZA 1WW7A 3I2JA 3VBHC 5GJ6A 5FTTC 5LRSA 1A34A 4GMP0 5FZ1A 5JAXA 4YVWA 4NUBA 5FZ6A 1PVC3 1PVC1 4JKLA 5GM0A 1BVP1 3ZOIA 1UYYA 5F5AA 4EN0A 1VBD1 1VBD3 4K40A 2OPWA 1CR7A 3L2HA 1AL22 3NV3A 4IEOA 4YW4A 3KT4A 4NIDA 1UQXA 2QFEA 3AVSA 5DZGA 2HWD1 2HWD3 2D3PA 1H2NA 2XLFA 4BDVB 4D6SA 4IW3A 3LEKA 2K9ZA 3DKQA 5LY1A 2ZGLA 1EP0A 2C26A 1AUYA 3WW3A 1EY2A 2WZR1 2WZR3 4NO4A 5GLUA 1GZCA 2RVAA 1IS4A 4B4PA 5M0TA 5IK5A 2A6WA 5LWBA 1UIJA 5KXBA 3KF3A 3BTZA 5L9RA 2W3JA 3T08A 1F8VA 1OD3A 4V1PA 1HRV2 1C8M2 1QJX2 3T09A 4CRQA 1MS8A 1PZ9A 4AW7A 5F37A 1MEC2 2PXJA 3J7MA 4GWNA 1O3TA 3AXDA 4OHVA 4CXYA 1GQPA 4MGQA 3PNAA 4BLIA 4L8QA 1XE0A 1YIFA 4XCBA 4AG4A 3ZR5A 2ET1A 5IVYA 4EQVA 5EIYB 5DZFA 1AYN2 4PLNA 4RR3B 2W1SA 5FZ4A 4ZXKA 1FX5A 3WLUA 3WUCA 2JWPA 1XQNA 1LOFA 4NPLA 4R52A 3IDEA 1FATA 1RUOA 1QXPA 3IWZA 2Q8DA 1A8DA 1K45A 3HBZA 5FFOC 3ZIWA 3AX4A 3TWIA 2RDQA 3HNYM 4CU8A 5A33B 5CFDB 5L9VA 1XYNA 4OI4A 3WNPA 1PO22 5FZKA 1E5HA 2VOXA 5C4WB 2ZGMA 3IN9A 4HK9A 1MS5A 5BPXA 1W90A 1VRH1 1VRH3 3DYMA 1LTEA 4XFHA 5FZLA 1S0JA 2X53S 1N1YA 1CWPA 1RGSA 4W8JA 1UO9A 2ENRA 2XL9A 5DQ0A 2AZ5A 2ZX0A 4IE7A 4I09A 2QQNA 1QQP1 1QQP3 2NMNA 3IKWA 3N9QA 3UKVA 1H2LA 2WLQA 3CZJA 1C8NA 3BB6A 4HKOA 2ID4A 5JZGA 1LR5A 4C90A 2WINB 1MZ5A 1XOYA 3ETPA 5J7MA 1F4AA 2JDZA 2JD9A 1OLQA 2VUAA 2YROA 1LHUA 1GBGA 4M3CB 4DFSA 3KLSA 3RJ2X 3RYRA 4K7JA 2E6VA 2D97A 1W9FA 1S0BA 2WWSA 2UWAA 1X8EA 4JTNA 4CDUA 3NVCA 3SKVA 1V70A 3QLQA 2ZEXA 1JOJA 1XU2A 3PVEA 5A3MA 1W8HA 2WWJA 2Z42A 4GH4A 3NV2A 5FUIA 2WT0A 1JZ6A 1Q3EA 1U0AA 1AXKA 2A5ZA 4LQRA 1I5PA 1AL0G 5FAXA 1RUI3 1RUI1 4ARXA 3R0RA 1APNA 1OH3A 2BGPA 3POJA 4MLOA 2OS2A 2WL1A 1AR91 1AR93 1H1AA 1WCKA 4XVHA 1IKPA 1HV1A 4LORA 5DAWA 4KBZA 4RQPA 5A7NA 1JHNA 1C5IA 3BTAA 1UX7A 3I2HA 4XILA 1O8PA 1OQDA 3U4XA 2VVEA 3TNQA 1ST8A 5KHJA 1Q5OA 2YZ4A 5FPXA 4UWDA 4XUOA 4Y20A 2R0HA 1MPXA 2RE9A 5HV0A 3QACA 4KBBA 4BIFA 3PL0A 4JZRA 1ACCA 1NA1C 1W8ZA 1RL3A 4NRPA 1YXWA 1VIWB 2LM3A 4G4FA 3D3AA 4Q4X2 2QQUA 4X6QB 5T52A 3S7EA 5BNOA 4TTGA 2QCSB 4FPLA 1X7NA 1F15A 3BGAA 4MOAA 3DL3A 3KS7A 3VBHB 4YZ5A 3ZYFA 4E27A 4K9SA 2LTNA 2ZHMA 4CDXA 1VE0A 4IV3B 4LHNA 5FYYA 5F3EA 3K4AA 2B45X 4GIQA 5HXVA 3UGGA 4JCKA 3NW4A 1YQCA 3M3CA 1KITA 3BOPA 4JHTA 4XBLA 3H42B 3RI8A 3VD3A 4FT8A 5IYYA 4KQ7A 2ZTNA 3O1SA 2DFBA 1F5FA 3O1UA 2GU9A 4M4RA 5HCAA 1ODMA 1JODA 4JX0A 4W6YA 1QJY3 1QJY1 4Y1VA 1SQ4A 3VKMA 4YGBA 1W8FA 1DGLA 5JVVA 2W9XA 4QKDA 3P1IA 1A6CA 5A7QA 2QVSB 3DN7A 5C3PA 3ELNA 1A3KA 1AF9A 3ZXLA 1LU2A 5F3CA 5GZEA 5DPNA 1Y4WA 4E2GA 1JUHA 3W20A 4FFGA 2VZQA 4U2AA 2EF6A 5FYMA 3IMNA 4FXGB 2RS53 2RS51 3KVBA 3WNNA 2RG4A 2WN2A 3C7GA 2WNUC 2DYCA 1JYIA 4Q1PA 3D0SA 4CCDA 2HJIA 2VZVA 4QX2A 1VBB1 1VBB3 3UV9A 4I0BA 5DUVA 1VRBA 3O1PA 4CDUC 4HXCA 2FMYA 2VZPA 4MGSA 3LPGA 4LBQD 4J6GA 3PJQA 1JMUB 1VBE3 1VBE1 2GNTA 4GH4C 2Z4FA 5JSRA 3AL6A 3M3OA 3LD8A 2P4EA 1ULPA 1GWKA 5E6HA
chains in the Genus database with same CATH topology
2E7TA 4CP2A 2V5YA 4Q4Y2 1AR62 4TLFA 3MW4A 4YYOA 3SCHA 5T3NA 1JTZX 1QJZA 1REEA 4COYA 4AHZA 4Q26A 5JOXA 4FPKA 3R4DB 4HZFA 2JG9C 3AK0A 1AYM3 1AYM1 3LA7A 2YV8A 4N9HA 1WCDJ 1RVF3 1RVF1 4NN0A 1PIV2 3UKNA 2PLV3 2PLV1 4HANA 2G4IA 2XJPA 1R1A2 1YJKA 1SBEA 3B5LB 4GMP3 4GMP1 1PGL1 4XPVA 1HXS2 1VR3A 3MICA 4HKWA 5H9RA 4TZDA 2MHFA 2P3IA 3ZFEA 1JYCA 3MGUA 1O91A 1WA4A 4GKYA 4JDNA 3RSJA 1UMZA 1CONA 1LHNA 2JICA 3AZZA 4YVWB 1LGNA 4HVRA 4HN1A 4Q1RA 5JPMB 3DPRC 1ZRFA 5L19A 3VBUA 2JECA 5D8AA 2NN8A 2HYKA 1DF0A 4BIOA 3HD8B 3PVBB 5AVAA 3KM5A 3H9AA 1AX0A 1K5MA 3MW2A 2P37A 2PHFA 5BNNA 1ZREA 4ISRA 4XQDA 4IEZA 4LTAA 4A2UA 1ZRDA 3H1YA 1DGRN 1HIXA 4SBVA 4PF5A 5GZCA 1W6MA 4R4XA 1YIPA 3RQ0A 4YM3A 1NA1B 1DIWA 4AQTA 4A7KA 1WGPA 4B29A 3N7LA 2BUKA 1YJLA 2PAKA 1W6PA 4P9WA 3E6BA 1VB2A 1RUD2 2CWSA 1DQ4A 3WNXA 4CDWC 4GKXA 1FPN1 1FPN3 4N7IA 2PN5A 3S0MA 5J09A 4E2QA 3USUA 1RUJ3 1RUJ1 2WJSA 4INDA 1BBT1 1BBT3 1YCIA 3K51A 4AVAA 2H0BA 2I2SA 4AFMA 1LHWA 2RS33 2RS31 2ATFA 3PVOA 2B46X 1RC6A 4HPKA 4XF1A 4ITCA 2O8OA 4KG0A 4MGYE 4FO9A 3ZXAC 4KU8A 2QUOA 5L73A 3RJRA 5H9PA 2GC1A 2KM2A 3WV6A 5K7PA 3SISA 3ILFA 2R32A 1I5ZA 3B7MA 2XLAA 4QQOA 3HAGA 5GZGA 2Q0AA 3H8UA 3FUQA 4R4ZA 5JZGB 4LO6B 3MPBA 1X50A 2WNUB 2RS11 2RS13 2AUYA 4N53A 3WG4A 3WOGA 4M3CF 2GH2A 2VW1A 4QT6A 3VZOA 3WD5A 5AFEA 3NJZA 2W52A 1V00A 4CDUB 2ZCWA 3OD4A 2VVFA 1CJDA 5E88A 4FQ4A 4FPFA 3FUOA 4GH4B 5D8AC 5DXDA 3V0BA 1QJU1 1QJU3 4IV1A 4YW2A 3SCFA 4B8EA 3ATGA 1U12A 4P9GA 2VOWA 3ZYPA 2NM1A 3SXWA 2TNFA 4NHKA 4MXWB 1UKGA 3GBWA 2D6PA 4NR1A 3JBG2 3PVNA 4RQPB 5EJ3A 2CAVA 3OJBA 4BHPA 3PMSA 2JG9B 1DBNA 4FPHA 1H1MA 3TNPB 1ENXA 4AHXA 3VHOA 3DGTA 4YLZA 1YLLA 4OFGA 4AGVA 1VBA2 4AHWA 4K3UA 1PVXA 4XW3A 2MEV1 2MEV3 3J8F3 3J8F1 1X33A 4QM9A 1RUF2 1SLBA 1ZNPA 2X5IC 3CNAA 3AYCA 4ZU5A 4YRDA 1BZWA 3DPRB 5JMCA 1UX6A 3JB8A 3AYDA 1JBCA 4D7SA 2RM22 1EPZA 4F3JA 1DGWX 1RMU2 1C1LA 5F6KA 3H7YA 1WLDA 4OUSA 3VBSC 2DCTA 4NVPA 5ABJC 4Z07A 2ZGRA 3AP6A 3VUOA 2D43A 4WVWA 5I8SA 2JXAA 2XJQA 1QOTA 4BCUA 4FBFA 1CX4A 2ZGUA 2GNMA 3AFKA 5JOYA 1ZRRA 1ZBE1 1ZBE3 1PNFA 1KFUL 2CAUA 1H8TA 5E8AA 4Q4V1 4Q4V3 1MZ6A 3FLPA 5L7OC 1NCRA 2ZHLA 4XBNA 1GICA 1YYNA 2YYOA 4MH0E 1DFQA 2WSVA 4CDWB 2WA4A 1QH6A 3MLJA 3VL9A 1XYOA 4DQAA 3ST7A 4JRAA 2JD4A 2Z2SB 4O9EA 4QPGC 3SH5A 4FTEA 1G6NA 1FXZA 3LZZA 1AHSA 2X8KA 2VW2A 3WR0A 4IV1C 4XJZA 1RHI1 1RHI3 5I91A 1BVVA 1VBD2 2DUQA 1BEV1 1BEV3 5JI9A 1E57A 2VMHA 2WNVA 1YRZA 2HWD2 3B02A 2OPKA 3G6JB 3M3IA 4Q0UA 3SNMA 1GZ9A 2GSYA 4XXPA 3AM2A 4LBJA 3CJIA 4QM8A 1CAWA 3VHRA 5E1RA 1OFSA 3WHUA 2XKOA 4UW4A 4A7YA 2VQAA 4OHWA 1BYHA 4IEXA 1UU4A 4BH9A 2R49A 4PIZA 2E53A 4DMIA 3ZXJA 3L9JT 5LK7B 5CU1A 1OQ1A 1V9U3 1V9U1 3D8CA 5D8AB 1WMDA 2PHWA 1DQ1A 1LOAA 1X82A 2DVDA 4XETA 5GLVA 3JQXA 1BMV1 5KWRA 2NLRA 4KNCA 1HQWA 4I0WB 4LE4A 2ZKLA 1ZZ9A 1Q8QA 4LHLA 3VZNA 1SLLA 2WQZC 2A6XA 4N43C 1W6MB 3RMXA 2BTVC 1NXMA 5F1RA 2P34A 3QH6A 2RR11 2RR13 1QDOA 4EN7B 4IXLA 1W6PB 4FPEA 3I8TA 5CG8A 3LOBA 2IFRA 2HWC1 2HWC3 2R30A 3GZUC 5T54A 2WT1A 2X5IB 4LO5B 3GZTB 4BE3A 1RINA 3USUB 4YM0A 2ZABA 3OBRA 4I3GA 4MYEA 1SLIA 1LKNA 2PYTA 3WW1A 3NO8A 1ASJ1 5BNQA 1CVNA 3VBSB 1DZRA 1Z7S3 1Z7S1 3AMNA 1D0GA 3VKNA 3CU7A 4HPKB 4AFAA 4LE3A 4MVTA 5HCFA 2OIIA 1H4HA 1NY71 5J36A 4CDQA 1TME2 3B00A 5J96B 4BM8A 2WNVC 2WSUA 3H50A 1RUI2 4I30A 4Z82A 3OY8B 1HV0A 3VBFA 2A7AA 1Y7BA 1H30A 1FMD1 1FMD3 2ZMKA 1AR92 1B35A 1R093 1R091 2KXLA 2SLIA 2YPJA 5L7OB 4NHLA 3MIFA 4IQPA 4AVTA 5BY5A 2YMZA 4BOWA 1ENRA 5GALA 4X6RB 1NXD1 1ULGA 3ECQA 1DHKB 2MPFA 3BOWA 3IBMA 3ALQA 3TBDA 1LHVA 4IEVA 4QPIA 4QPGB 3D82A 3RZZA 5JLVA 3S30A 4Y5Z0 3V0BB 1NZCA 1AR73 1AR71 3U10A 4IV1B 4NHMA 2OW4A 4ES8A 1Q8OA 2R1DA 1URXA 3ZDSA 2XJVA 2ZGNA 3WHTA 2OUJA 1Q43A 2PTMA 1EYBA 2DV9A 2C1FA 4CEWA 1UD1A 2R0FA 1UZZA 3KCYA 1W6NB 4DOUA 2DVBA 4LLFA 1FI2A 3H1WA 3N7JA 3AMMA 2XVKA 4R8HA 5GLWA 1O3QA 4FTSA 5FLJA 2IZWA 2F4PA 4BPZA 4COZA 4UW3A 3APBA 1UU6A 1QXRA 1LCLA 2DVGA 5I0SA 3DUIA 2RJKA 3SLIA 2RS52 4Y22B 2FZ1A 5JI7A 4F7ZA 1COV2 3WDTA 5CADA 1CQ9A 1I9RA 4IV3C 4XFAA 1IKQA 2CYFA 2GC3A 4QXKA 1SLCA 4JC1A 1IS6A 2QDRA 5T5PA 1XU1A 3HT1A 1Y3TA 3OGJA 3OYWB 3O12A 4YGDA 1DQ2A 2ZOEB 2V73A 4ATFA 1OOPC 1VBE2 2EXKA 3MIGA 2JG8C 4N43B 4OI0A 2D5HA 1H9WA 1HLCA 3AMQA 4GQ7A 2VY0A 2DF7A 3ZXGA 1NCRB 4FCAA 1ND3C 4D7TA 1A78A 3NKTA 1S1AA 4YGEA 4DY3A 5FO9B 1RVF2 1XE8A 3AZWA 1OPMA 4AVBA 2QJVA 1D4M2 3RMYA 2UYBA 4QPIC 5EFUA 1RUG2 1FNZA 4GA9A 3BODA 2ZKNA 4BA6A 1RJ7A 4EN6B 3IT8A 4H7LA 4LO7A 1X36A 2WNVB 1C1FA 1ZVFA 3VN4A 5KC5A 3A0NA 1WMEA 4XHBA 4PBOA 4CEWC 3MLKA 3G7DA 3FLTA 1HW5A 4OLLA 3S7IA 4J1WA 1CAWB 3ES4A 2VQ0A 2BBVA 1H9PA 4GULA 4S2HA 2UWBA 4PDWC 2C5DA 3TRSB 1WLCA 4QGMA 2ZX2A 3AP7A 1QOSA 4AXOA 1MS1A 2R1BA 5E16A 5JCTA 2ZBJA 2G9GA 3ZFFA 5C8WA 4EWAA 3TN91 3TN93 4YVWC 3GZAA 3DKWA 2XL7A 3IM0A 3VGIA 2WFPA 2AH2A 4PIXA 4DS0A 4FTBA 1S55A 1KQRA 1LULA 3EHKA 1OQEA 2ZAHA 3GBFA 3I54A 1J3RA 1PK6A 3J4UH 1WCSA 1HKDA 1ZBA1 1S0DA 1XE7A 2RS32 1ZBA3 3CJXA 3THPA 4RSUA 2NP0A 3H3UA 1V6OA 3HWJA 2GC0A 1WD3A 3E5UA 4BWOA 4PJYA 4JDMA 1NE4A 2EALA 3D6EA 5AC92 2CWMA 4Q0PA 4FOQA 2WQ4A 3VV1A 4DXZA 2NYYA 5T55A 4XQ4A 3JD73 3JD71 3V0AA 2ZGTA 3THTA 3DV8A 2ZGPA 1PO12 2RMU3 2RHPA 2RMU1 3H1MA 5EWSA 3UJOA 1Q56A 2R042 3D5OA 3E97A 2RS12 3HR9A 3H0OA 3GHMA 3E5XA 4K1ZA 1LOFC 5K0UA 4XXAA 2VUJA 3ZSKA 4XFFA 3I59B 4C91A 1VJ2A 1ND2A 4OHYA 3OPZA 1NE6A 1OOPB 4LUMA 5FLHA 1DZQA 3HMYA 4W65A 1NCQA 2PA7A 2OA2A 2JG8B 1G9AA 2B9UA 5I0UA 3VZLA 1HX6A 3B93A 1LENA 1ENSA 4YM2A 1LESA 2BNMA 5JPNB 1GQHA 1DQ5A 2BNOA 4H55A 3M4FA 1ND3B 4ORFA 1C4RA 5GZDA 3RG0A 3MF9A 4FOYA 5L36A 5FDBA 5JZGC 5ACA1 5ACA3 1AR82 2ZA9A 4EN8B 4QPIB 4XTMA 2WZPP 3ILRA 1YI9A 1VBC3 1VBC1 3VZKA 1ONAA 2PQQA 3J8F2 4N9IA 3C3VA 4TWTA 2JE9A 3RYPA 1SMVA 1AVBA 2ZMLA 4C1WA 4QQLA 4FP3A 5JOZA 3E6CC 1SBFA 4CEWB 3WG1A 1MQTA 3KMHA 4Q4W3 4Q4W1 5A32A 4OHZA 4QD2A 2X29A 4RQPC 1J1LA 2D98A 2P3JA 3JB4C 1S0FA 2PAEA 2BPA2 2XH6A 1REFA 4Y1ZA 4YSFA 2WT2A 1IGOA 4IETA 4PDWB 1LU1A 4AI0A 4FPOB 2EXIA 3M3QA 5CG9A 2UY8A 3MYXA 2GNDA 1KRIA 1EAH1 1IPKA 1EAH3 2WFF2 1RUC2 1EV11 1EV13 2QZ3A 5BNOC 4Q4V2 2VECA 1N3PA 1N1TA 1DDLA 5HBAA 3OBTA 4IESA 4SLIA 1CAXA 2VVDA 1FOD2 4CDXC 1HRV3 1HRV1 1C8M3 1C8M1 1QJX3 1QJX1 1PM7A 5K0UC 1MEC3 1MEC1 1V6MA 5GKAC 4Z8BA 3O0VA 5GZFA 4WBBA 2K0GA 2W0XA 3MFCA 3VBOA 1H8VA 4KGGA 2JJ6A 4FOWA 2XPJA 3FFQA 2A6YA 2D6OX 3AKTA 5IK7A 4XJWA 3NV1A 1RHI2 1LHOA 3V56A 2B7YA 2CY6A 4OI1A 2XVGA 4DRVA 1BEV2 1SFNA 4HL0A 3VHPA 3GNEA 4AEKA 3ASIA 1AJKA 3FBYA 2ZHKA 1AJOA 4XE9A 4COUA 4YG0A 4F83A 3RPQA 2HWE3 2HWE1 4I3PA 3R6SA 4E4SA 1H1IA 4QHBA 2QZ2A 3INAA 4XJ9A 1N3OA 3JCIA 5EV7A 1GV9A 3K48A 4G3YC 2XBO2 2DTYA 5I8YA 2ZZQA 4YZ3A 1MS4A 2DUOA 4UBGA 2B8MA 2PHUA 4IEQA 1DYPA 3WCRA 4LBOA 3U07A 1TMF1 1TMF3 5FREA 3U0ZA 2I45A 2XWBB 4LA2A 4NWVA 2XKPA 3KSCA 1V9U2 4AEMA 4YFZA 5CFCA 1UW8A 3FMGA 3IDBB 3KGZA 2GC2A 2TBVA 1FT9A 4MGZE 1QU0A 1FV3A 4IEPA 4R9BA 1RB8G 4RA0A 1MQTC 3EO6A 1BMV2 5H9SA 3J26N 1Q8PA 3BIWE 3J9SA 2R16A 4ATEA 2E9QA 5FBZA 3IPVA 5FRAA 1NLSA 2P17A 2XB6C 3WQ1A 2BEOA 1OI6A 1CESA 4QGNA 3WX5A 3NWKA 2BYVE 4XIOA 2R061 2R063 1GSLA 3VZJA 4YVSA 2MNGA 3NL1A 3ZFEC 4E2SA 4WM8A 2HEYF 3NSTA 1CPMA 2AR6A 2ZHNA 2H6BA 4Q29A 5LRRA 3GALA 4CEYA 3VBUC 4Q4X3 4Q4X1 1GYKA 5JDBA 3NKGA 4AEDA 1K5MC 4Q8LA 1YWKA 1PK6B 2DURA 5DG1A 5BNNC 3JU9A 1Z7S2 4E4DX 4FPJA 4Y26A 4YGCA 5LK5A 2QQPA 4IERA 3M2MA 2E7QA 2C9AA 3A4UA 3GYDA 3ZN6A 3URFA 1ZYBA 4R9DA 1QWRA 4Y20B 5T5JA 2B5HA 1KJLA 3MDPA 4BYYA 2HWF1 1YFXA 2HWF3 1FMD2 3V0AB 5BNOB 1HQLA 4RS5A 1GKBA 1R092 4RD7A 3LB9A 4AGGA 5KC6A 3WXPA 5T5LA 4XQWA 4WVMA 4OHXA 2BFUS 3A0KA 4CDXB 5DDJ3 5DDJ1 5K0UB 1UCXA 3LOIA 1FAYA 4C0HA 1HRI1 1HRI3 2W68A 1WLWA 1H2MA 4Q8KA 2A3YA 2F6BA 2EA7A 5CFCC 1PZ8A 3FE5A 1NCQB 3VDDA 3RYKA 5C6CA 3S6PA 1OFNA 4QPYA 5JIAA 3SH4A 3ZO0B 3ZPYA 4EWDA 1OSGA 4AI2A 5JOWA 1ZZ6A 5LEKA 4N90A 4XIKA 5C9AA 2D7FA 1N1VA 1WLTA 1M4WA 2BQPA 3BU7A 3GBGA 3IDCB 1F31A 4KGQA 1QGLA 1U5YA 1AR61 4D69A 2R072 1UIKA 1QNYA 2D40A 4P9XA 3AFGA 2QKDA 3ME2A 3ETQA 2CTVA 4N53C 4P9LA 4QQ2A 5F6LB 1XXNA 4L9BA 4XZPA 4AEJA 2A70A 1WUVA 3TAYA 1MS3A 1RTVA 1UAIA 4FQZA 1REDA 4HVOA 4XEZA 2HKXA 4AEDC 1PVC2 4XOGA 1ZRCA 3SMHA 1MQTB 4M0NA 4YW5A 5A32B 3UKTA 2BFUL 2BWAA 4NWWA 2XUMA 2ZGOA 4L92A 5LEJA 4RHV1 4RHV3 4XF4A 3B01A 4YNIA 3KT1A 2WA3A 3HQXA 1KXGA 1SFYA 3VKLA 1QNWA 2A71A 2WZR2 3NAPA 2XGXA 2A6ZA 4Q0SA 1G8WA 4HSLA 4XYXA 3ZX7A 4DZGA 2FMDA 5CFDA 2Q5TA 3ZFEB 3I2DA 5C4WA 2WIIB 1VAVA 2DVFA 4B3NA 4ASMB 1MR5A 3VBUB 3WW4A 2ZGKA 3AKPA 3SHRA 5AVPA 4XF0A 3SCGA 5EZWA 3ZVXA 1K5MB 1RUD3 1RUD1 2WLPA 1FYUA 1XNDA 5BNNB 4AHYA 2ZZJA 3PMEA 1ULEA 4FP2A 4KWKA 3KGLA 2IXJA 2IC1A 4META 1YI7A 3MEPA 3EXUA 1VRH2 4XHXA 5GLTA 3FZ3A 1H8TC 2I74A 2WC2A 3OTFA 4IEYA 1NCRC 4CYDA 4FXKB 3T1MA 3WG2A 2CGNA 4LEJA 2ZGQA 1QQP2 1GFF2 5FLIA 2XJTA 3MLLA 3VBRA 1U5ZA 4AQ6A 4EWEA 2W08A 2WKKA 4DPNA 3USSA 2DU1A 2VH9A 1J58A 1O7FA 3LWCA 5I0RA 5IT6A 2UWCA 2VW0A 2XWJB 2ZAAA 1KS5A 5FOJB 2HWB3 1WBFA 2D3SA 2HWB1 4OULA 1ASJ3 1CPNA 3WZ1A 5CFCB 2VGDA 1O4TA 1WW6A 3TN92 4BZ4A 4DRRA 2VOVA 4L99A 1YFUA 4ZKTB 3PHMA 2GMEA 4XFCA 4M01A 4ONUA 1S0IA 4D3WA 1HQNA 4ISQA 1RUE1 1RUE3 2P2KA 4COWA 4AVVA 1OA3A 3WP5A 2BNNA 1ZBA2 3RS6A 3WVJA 3IPVB 3ZYRA 3CJIC 3ZYGA 3PLQA 3I4IA 1PHMA 2OUHA 3NAPC 2Y38A 1G86A 2EAAA 4LBMA 3JBG1 3JBG3 4N53B 3AB0A 5FMOS 3W58A 4QX5A 2QE3A 1POV0 3AP4A 4UXAA 1V6JA 5FO8B 4LBQA 1TNRA 3POYA 4IL7A 3E5QA 4RFT0 3OGGA 5J98B 3BPZA 1MS9A 2GN7A 4P14A 4P9IA 4AFDA 4AEDB 1LOCA 1SLTA 3TOJA 5C8CA 1IQAA 3O7OA 1RUH1 1RUH3 4GB33 3AZYA 4GB31 4B7KA 1SDWA 1Z0HA 4YZ1A 1CAVA 1YNAA 4YZ2A 1OLRA 1XYPA 3O0WA 4R9CA 5H9QA 2OYZA 1DQ6A 2RM23 2RM21 3ZN6B 4K20A 3O5SA 5JIUA 2C0ZA 2YXSA 2Y0OA 2IXCA 4JV4A 1PGW1 1QJY2 2BW8A 1BCXA 1DGWA 1QF3A 1UF2C 3FWEA 3WW2A 3TB0A 3VL8A 4KL1A 4E4ZA 4MXVA 4I0AA 1FV2A 4A3XA 2XJRA 3VBRC 1S0GA 5F5QA 1GANA 1W6QA 5D1IA 5AFBA 3QH7A 4PIYA 4AWDA 3KD4A 2Q4SA 5ACA2 1LODA 4XMAA 2FHRA 4IEWA 3VLBB 3V64A 5DZEA 5I93A 2CL2A 3FC0A 1VBB2 1JH5A 1SACA 2BGCA 3ZXFA 5FMOL 2XLGA 1J3QA 1J1TA 1XNBA 1UPIA 4CDQC 1QOOA 5C9AB 1N47A 5FO7B 4LHKA 4JGYA 4YG3A 4XMIA 3CF6E 3VBFC 2Q30A 1H8TB 4HETA 1B35C 3QBQA 5SV8A 5KXEA 4Q4W2 5JSPA 1XNCA 1O3SA 2PFWA 1V6NA 4KWLA 3ROUA 4YZ4A 2JEMA 3T2TA 2RJLA 4RGGA 1AXYA 1R081 1AYM2 1R083 5EYXA 4DY5A 4ZU4A 3ACLA 1W0OA 1ENQA