3QACA

Structure of amaranth 11s proglobulin seed storage protein from amaranthus hypochondriacus l.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
445
structure length
372
Chain Sequence
QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVSVIRRTIEPHGLLLPSFTSAPELIYIEQGNGITGMMIPGCPETYQDQHQKIRHLREGDIFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSNTGNIFRGFETRLLAESFGVSEEIAQKLQAEQDDRGNIVRVEGLHTICSARLAVNVDDPSKADVYTPEAGRLTTVNSFNLPILRHLRLSAAKGVLYRNAMMAPHYNLNAHNIMYCVRGRGRIQIVNDQGQSVFDEELSRGQLVVVPQNFAIVKQAFEDGFEWVSFKTSENAMFQSLAGRTSAIRSLPIDVVSNIYQISREEAFGLKFNRPETTLFRSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of amaranth 11S proglobulin, a major seed storage protein from Amaranthus hypochondriacus L.
rcsb
source organism Amaranthus hypochondriacus
molecule tags Plant protein
molecule keywords 11S globulin seed storage protein
total genus 103
structure length 372
sequence length 445
ec nomenclature
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA01
4A2UA 2WFPA 4KU7A 4TLFA 2CV6A 3UKVA 3M70A 4XF3A 3H3ZA 3OTFA 1U12A 2IXCA 4E2SA 2MHFA 4MH0E 3WW4A 4XETA 3ETQA 2GU9A 2OZJA 4LA2A 3S0MA 3DKWA 4FBFA 3BCWA 4XF4A 2PHDA 2XHKA 3BALA 3H7YA 5FPZA 1RUNA 3CEWA 4L2NA 4BYYA 1X82A 5LRSA 4B29A 4E2GA 3MYXA 3H1MA 4MGZE 1I6XA 1DGRA 2QVSB 4Z07A 4PIZA 1IPKA 1QXJA 3WW1A 1WLTA 1ZZCA 4ZU4A 3I59A 3ELNA 3H8UA 5C6CA 4Q0UA 2QCSB 2C0ZA 4IEQA 4IESA 3KGLA 4I0BA 3RDIA 5I8YA 3E5XA 4BHPA 1O5UA 2PTMA 4LA3A 4HVRA 3H1WA 1SEFA 1QY4A 1ZX5A 3EJKA 1QWRA 1CAVB 1O3SA 2IC1A 1UIJA 4PJYA 5BV6A 3IBMA 5BY5A 1LR5A 1GQGA 3HIFA 5FQ0B 2OA2A 2IXJA 2B5HA 4IEVA 4I2OA 3E6BA 5J7MA 1ZZ7A 1NE4A 2ATFA 2GC0A 3S7EA 3U11A 4AVAA 1NE6A 4EWAA 2BEOA 2Q0AA 4JTOA 4KWKA 1G6NA 1H1MA 3FHIB 3PNAA 1YLLA 5KHHA 1VP6A 2XLFA 1NZCA 3N4MA 2EA7A 5EFUA 1ZZBA 1YUDA 5J48A 3U0ZA 1XE7A 3BPZA 3SHRA 4XFHA 1PMIA 3LA7A 4IEZA 1RC6A 4HBNA 3E6DA 3MZHA 3LA3A 3OD0A 4PIXA 1DGWA 4HMZA 4QXKA 5D1IA 5FDBA 1CAVA 2OPKA 4LUMA 3S7IA 1IPJA 3CF6E 4WVZA 1O4TA 4FT8A 3OF1A 4Z82A 1ZREA 1EY2A 3HT1A 1J3PA 2VPVA 3WW2A 4FAGA 4KWJA 4RD7A 2F4PA 1LKNA 2XLGA 4QM8A 5I0UA 3EQEA 4MZUA 4L11A 4IEWA 1FI2A 4ZU7A 4LUKA 2CAVA 1RGSA 2B9UA 3QACA 2OYZA 1Q3EA 4BIFA 4XF9A 1TQ5A 2PQQA 4AQ6A 2K9ZA 2CGPA 2XL7A 1ZZ9A 2XLAA 5LEJA 4H7LA 5K8SA 3NVCA 3B02A 4HN1A 4QGMA 2ZCWA 4ZU5A 3FX3A 3U10A 3LOIA 4JV4A 3NSTA 1PM7A 3USSA 2EAAA 4FAHA 5FQ0A 3ST7A 4F8AA 2HJIA 1ZRRA 3I59B 4YRDA 1O7FA 5JSPA 1ZRCA 4Q0QA 3CL1A 1LB2A 1QXRA 3GBFA 4LTAA 1UD1A 2GC1A 2IXLA 5JAXA 5AVPA 4Q0SA 4XFGA 3UKNA 2HKXA 4MX3A 1X8EA 2N7GA 1DZRA 3CJXA 1X7NA 2GH2A 3MDPA 4O9EA 3CO2A 4X6QB 5I93A 2H0VA 3HQXA 4I3PA 1SQ4A 2ZKLA 1NXMA 1CAUB 2D5FA 2GC2A 4YNIA 1OFNA 4IEUA 3I7DA 3HT2A 3NKTA 4HVQA 1Q43A 1Y3TA 4XFFA 5I8SA 3WW3A 1CAWB 3JZVA 1J1LA 4LULA 3FWEA 4J1WA 2UYAA 3NJZA 3RYKA 3E6CC 2FQPA 5KHGA 5LRRA 1O3TA 3NW4A 4D7TA 3ZDSA 2K0GA 4AQ2A 5JCTA 3EHKA 3BB6A 4XFIA 3RNSA 1J3RA 2OZ6A 1OI6A 3H7JA 4IEXA 3LAGA 1CAUA 5CU1A 2VQAA 4HLTA 1RTVA 4NVPA 2IXHA 3D82A 3D0SA 5I0SA 4JTNA 1HW5A 2QDRA 4MV2A 2XKOA 2PAEA 3FE5A 4XFBA 3SXWA 1V70A 4MUVA 5KHKA 3KGZA 2PHLA 2KXLA 4QGLA 3IDCB 4LEJA 3BU7A 5I0RA 3LZZA 3G7DA 1LRHA 2UY9A 2GAUA 2O1QA 2BNMA 4MGIE 4Q0PA 3RYPA 5BPXA 3OCPA 1YFWA 3ES1A 1YFUA 1VR3A 4QM9A 2Q1ZB 4YYOA 2FMYA 3FZ3A 3SMHA 2O8QA 4IEYA 4WZCA 1JUHA 1X8MA 4JVAA 3IIAA 4D7SA 4IETA 3FFQA 2ETEA 3E5UA 2GZWA 4AXOA 1FT9A 2VECA 1CGPA 3LA2A 4UBHA 1ZVFA 3C3VA 3DL3A 4XF0A 3L2HA 1RL3A 4IEOA 5KBFA 1ZRDA 4OLLA 4X6RB 3LWCA 4I0AA 5E1RA 1WA4A 1EYBA 1GQHA 1XE8A 1CAXB 1SFNA 1EPZA 4MGKE 4IEPA 2PFWA 2UY8A 4I01A 1J58A 2PA7A 4QMAA 4YARA 5FLHA 3SCGA 1CX4A 2XL9A 2D93A 1XRUA 3EO6A 2UYBA 1ZZ6A 5JR7B 2BNNA 4META 2V09A 3H3UA 4EV0A 4R8HA 1UIKA 3M3IA 4CYDA 4O9GA 1J59A 2B8MA 2Y0OA 3H9AA 5BUVA 1O5LA 2PYTA 3TNPB 3E97A 4N9IA 3SCHA 3CLPA 3RYRA 5EZWA 2ET1A 3ROUA 1FXZA 2XGXA 3MPBA 4P9GA 3IWZA 3KSCA 5JSRA 3FJSA 1WGPA 4WBBA 5CADA 4J1XA 4QGNA 4N9HA 4XFCA 4XFAA 1OD5A 4UBGA 5FCCA 4K8FA 4HSLA 2PAKA 2BYVE 3OGJA 3PLQA 5LEKA 2BGCA 4I02A 2D5HA 5FPXA 1UPIA 4UXAA 2Q30A 4DINB 2MNGA 2ET7A 2QNKA 5CVRA 4KWLA 5F1RA 1VJ2A 3H1YA 1L3JA 3IDBB 5E16A 4I09A 4BH9A 1O3RA 1UCXA 1Y9QA 1OMIA 1J3QA 2Z69A 5KHJA 1YWKA 5I8TA 4XEZA 3RPQA 5I91A 1UW8A 3D0JA 4LLOA 3TNQA 1ZZ8A 1CAWA 1O3QA 2EVXA 4F7ZA 3O14A 4AVBA 2DCTA 1ZRFA 3H50A 2IXKA 4HZFA 2E9QA 2WC2A 5BXXA 4Q0VA 3KMHA 4QX5A 3VHRA 2H6CA 2CAUA 3UKTA 5J3UA 3DV8A 5C8WA 3KCCA 4HSJA 1YFYA 2PAMA 2IXIA 3GYDA 3EBRA 4R52A 4EWDA 4IERA 5I0TA 4ONUA 3SCFA 2QJVA 4OFGA 3NL1A 3R6SA 4YSFA 5HI0A 5KHIA 4MGYE 2XKPA 2Z2SB 1EP0A 2P17A 5FLIA 2BNOA 3PVBB 5T3NA 1NYWA 4ORFA 1CAXA 2MPFA 4AVCA 4HN0A 2D40A 2Q4SA 1YFXA 4PIYA 4Q29A 4KL1A 1I5ZA 5JSOA 4EROA 4EWEA 3ES4A 2I45A 4GULA 3ACLA 4XF1A 1RUOA 3E5QA 3RZZA 4E2QA 2H6BA 4KU8A 3QOPA 1Q5OA 3I54A 1YHFA 3DN7A 1DZTA 1ZNPA 4HVOA 2GC3A 1H1IA 5FLJA
chains in the Genus database with same CATH superfamily
2AEZA 2BWCA 1N47A 1LU2A 4QX1A 2CV6A 4WM8A 4FPKA 2VZ3A 4GALA 1JZ5A 3SISA 5FY5A 5BNPC 5BNNA 2JG9A 2VMFA 1XBFA 4MH0E 3OGGA 2JX9A 3IKWA 5APAA 1BXHA 5E89A 4K6BA 1SBEA 5BNPA 1V6IA 2ZGQA 1FMD2 3CJIC 4NJ4A 1PNFA 1H2NA 1N1SA 3R4UA 3ZPOA 3DKWA 5FZ1A 2ZBJA 3BCWA 4YFZA 1YCIA 2YBKA 4QDRA 3LIHA 2PHDA 1Y4WA 4A7ZA 5HV4A 1RUG3 4L0PA 4LBNA 1SLIA 5FYYA 2FDFA 5HCAA 1RUNA 2DBNA 5FYVA 5A7PA 4AR2A 1X9TA 5FPVA 3H8RA 1X82A 1G9CA 5LRSA 2VULA 4E2GA 1MZFA 2UU8A 5FZLA 3WCSA 2R6QA 4NAMA 2Y26A 1AXZA 1PVC3 4UFHA 1DGRA 2CTVA 4COYA 4DNYA 4Z07A 1SG3A 3K4AA 1T6GC 1C57A 5GKAC 3UGHA 2GNTA 1AUYA 2VD7A 1W6OB 1WBLA 2YUEA 3VHNA 3JD73 1WD3A 3ENRA 3I59A 1PMJX 1KITA 3A23A 2PHFA 3ELNA 3K3OA 1Q8OA 2NMNA 1OD3A 1RUE2 4YW6A 5JXJA 1K42A 3IIIA 5FZOB 4IESA 4FFIA 4IGOA 3GCXA 5JI7A 3RDIA 2OQ6A 1LOCA 2BJSA 2EXIA 4CXWA 4CCEA 2E26A 1MVEA 2WS91 3O1TA 3ZO0B 1IGOA 3RSJA 3T1LA 1WBFA 3TRSB 3K4ZA 1OBNA 1W2NA 3H1WA 3K48A 2J42A 4XUNA 1QY4A 5FZGA 1G9AA 4MVTA 1W90A 3EJKA 2ZMKA 5T52A 4AEDB 4EN0A 4IW3A 1MVQA 3KVBA 4TN7A 1ZA7A 3J7HA 2JE9A 4BQ2A 3D5OA 1NCRC 3IBMA 4BJ0A 1RUC1 5BV6A 5BY5A 3NNFA 1RUC2 3SEPA 5C3OA 3HIFA 2HWF2 1PK6B 3ZFFB 2HWF1 2IXJA 1UX6A 2WFF1 4R9AA 5KC5A 2C5DA 4L8QA 1D4M3 4DXTA 4HFSA 1DQ5A 4QX2A 1EV11 1ZBA3 5CB7A 1HB3A 1XE0A 1C8NA 5FY4A 4TZDA 2VVEA 5GZEA 2PN5A 3LKJA 1SLTA 2ARBA 3HR9A 4YZ3A 1G6NA 1LODA 4XJUA 3AJZA 4QX3A 3HN3A 2OUJA 3PNAA 2A6ZA 4PF5A 1BYHA 2QQLA 4HG6B 1ULGA 1LTEA 2RR12 2Z42A 4AI0A 1ST8A 5C3PA 1VP6A 5FZ4A 1RUE3 1SACA 4QWNA 1GP5A 4MLOA 4AHXA 5CG8A 3ZXKA 4JQTA 2JIGA 1ND2B 5EHDA 3PUAA 4MHUA 2GSYA 4KGGA 4ZXEA 3CZUA 4IEZA 2UWBA 4HBNA 1PGL2 4XZUG 4Q4X2 1APNA 3LOBA 4UAPA 4PIXA 1AR92 1D0GA 3CMGA 1B09A 3VL8A 3THPA 1JZ6A 1OC1A 1QJX2 4HMZA 4B3NA 5FUIA 2RDRA 1H6XA 3DGTA 3RWNA 5ERLA 1CAVA 2OPKA 5CYYA 4IE5A 5IWFA 4TTGA 3S7IA 1GLHA 1IPJA 4FFHA 3ZYIB 3RVHA 1US2A 3ECQA 3WW2A 2VY0A 3THTA 4R9CA 3A22A 4CXXA 3AZVA 1VBC1 1LEDA 4FCAA 1R1A2 1FI2A 4LO4B 4ARXA 1BBT1 1KXGA 2D97A 3POBA 1NOVA 5L73A 3WQ1A 1AVBA 2XVGA 4GJYA 4GAZA 1QOOA 1AR71 2MEV1 2ZHLA 3QACA 3ZLIA 2GP3A 3IAPA 4QU1A 5J96B 3O1OA 1PX3A 3I3BA 4FPEA 4ARYA 4BIFA 2PQQA 4AQ6A 1AXYA 4E4SA 2E51A 2RM21 1W6PA 1RXGA 1ZZ9A 4J25A 2ZABA 3R4SA 1S0DA 1ENQA 3VBUC 1FX5A 3N7KA 3THCA 1J1TA 4HL0A 4YM2A 1DQ4A 5EYYA 4RA0A 1QKQA 4CDUC 5ABJC 1BZWA 4LE3A 1T2XA 2E53A 1N3PA 5FMOL 2DWRA 2JDKA 1DYOA 1TG7A 5KXCA 1VRBA 2ZCWA 3U10A 2GMMA 4JV4A 3MFAA 5A6ZA 1ENRA 2HWC1 1Z7S3 4NPRA 5LY2A 1LENA 2EAAA 2WQZC 4PQ9A 5DUXA 4FAHA 1RHI1 3ST7A 1OA3A 1VBB2 4F8AA 1HXS2 1ZRRA 4MGSA 3PUIA 4GKXA 4AL9A 1SHWB 1ZRCA 1YI7A 2QQVA 2ORXA 2BW8A 1PMHX 1QXRA 5FZ6A 4AF9A 1IKPA 5LA1A 4BISA 3MIGA 1REDA 4IE7A 3KCXA 4AZZA 4UW6A 1XYNA 2ZZQA 2PELA 2IXLA 4YLZA 4UFLA 4ET7A 5C8CB 4UW3A 3JD72 2EXHA 3WF0A 4ATFA 3T3YA 1CZSA 3JD71 2DUOA 4MX3A 4QB1A 4LBKA 2QQOA 5DZFA 1WWYA 5FR3A 1RB8G 2WA4A 1X8EA 3KS7A 4QHBA 3T4HB 4JDNA 3SKJE 3JU9A 1D4M1 3ZSEA 4F3JA 5FPLA 1W6PB 4C0BA 1U5IA 4P08A 3PIGA 3DCQA 4KWUA 5L9RA 1HN1A 2RS51 2XG3A 2XJPA 3V64A 4C91A 4EN9B 4ATEA 2WZR3 3ORJA 4AI1A 3RWKX 4RQPB 3AP5A 4Q8LA 4BM8A 1GQPA 3AMQA 3OJBA 5EJ1B 1AJOA 4QB6A 3I7DA 4ASKA 1NCRB 3BN6A 3N3HA 4GQ7A 2X09A 4C1WA 3VD7A 4YGEA 2JDPA 5FIXA 1AR61 3EXUA 4A44A 4EZHA 5F9TA 1A3KA 2WN2A 3MLKA 3WHTA 4N43B 1CAWB 3JZVA 1J1LA 1W6NB 1H9PA 3I3QA 2HH9A 5LATA 3C7FA 4Y20B 3NJZA 4AGRA 4PBOA 1CWPA 4L97A 3H8XA 2A75A 5LRRA 4V1PA 2BDRA 2HEVF 3NW4A 3VBFB 2E32A 2TEPA 3FFZA 2P3IA 1UYZA 4XDPA 2K0GA 2D3PA 1HRI3 4QQPA 2PLV3 3VBFC 1S0JA 1MZ5A 4QHZA 3EHKA 5C5TA 4FOYA 3BB6A 2Q1FA 5LY1A 1LAJA 2OX0A 4QPGB 2WUHA 1VE0A 2BFUL 3LAGA 4HK9A 3VBFA 2QFEA 4BQYA 1CAUA 1ULFA 1YQ8A 1YIFA 4FQ4A 2L9LA 4YW2A 3U4SA 4JGZC 2QUOA 4B4PA 4GMP0 1H8VA 4CP2A 3MIFA 2C6SA 4CUBA 5F8PA 5K4LA 4QKNA 3FE5A 3VBRC 1TMF3 3ZYJB 4QXBA 3LDRA 5FYSA 4COZA 1VLNA 4LKSA 1S0FA 5IHRA 4JKMA 3WCRA 4JRAA 3RZMA 2KXLA 1SLCA 4CDQA 3Q8CA 5GZCA 1UPSA 3OUIA 4BZ4A 1UX7A 5DN2A 4XQDA 2A3YA 2AC1A 1BLZA 1D0HA 1G7YA 3KLSA 4JGYC 3VZKA 2RS53 4M3CE 3QLQA 3ZXEA 4DY5A 5GLZA 3ALQA 3WF2A 2ARXA 1OH4A 1G9BA 3HWJA 4GWMA 5FP8A 1W0NA 4JQRA 4YGCA 3CZJA 3ZYBA 1UY0A 2ZGSA 3VKOA 2VUDA 2W5FA 1H8TB 3WUDA 1PO22 1BKZA 3VKMA 2Y6LA 3FZ3A 4RHV2 1G86A 4AFCA 1JODA 1WMFA 5FUNA 5D21A 3BVCA 4UI9L 1COV2 3E5UA 2GZWA 1G9FA 1JOJA 4E4DX 2Q1MA 1NY72 5DXDA 4UBHA 1JZ8A 1GWMA 4SLIA 4AI9A 2OQ7A 3W5NA 2UWAA 1YQ6A 5KBFA 1QJU1 1OOPC 4KNCA 3B94A 4AHYA 2WNUB 4LKDA 3O7OA 1HRV3 3ZIXA 3BTXA 1F5JA 3T0DA 1CAXB 2DCKA 1WCUA 3LPFA 4IEPA 2PFWA 1DG6A 5DDJ2 4FTBA 3ZSKA 2LS6A 2DTWA 2WNUA 1AR81 2XVKA 1CX4A 5DG2A 1UOGA 3K77A 3WF3A 3O0VA 2RVAA 5FZ3A 2B42B 1CZVA 3CKHA 3W21A 5IK4A 3ZX7A 4HKOA 2A6VA 1BBT2 4RR3A 1S55A 3OY8A 1W8UA 1OVPA 4LR4A 3B00A 3J7NA 1K45A 2VUAA 4AI2A 2UWCA 1ASJ1 3H9AA 3BODA 5C4WB 1TMF1 2VTXJ 4IUGA 1H8TA 3AFKA 4QX7A 1JS9A 5FO7B 1SPPA 1NCQB 3CLPA 4E4ZA 3PL0A 5EZWA 2Y0IA 3J7LA 5FY7A 2FZ1A 4M3CA 3ROUA 1KDMA 4BMEA 1E5RA 2WO3A 5C4WA 1OLRA 2XGXA 3RZHA 4YG3A 4Q4X3 1N1TA 3NNLA 3APBA 5BNNC 3H8OA 5JSRA 3H3LA 5F6LB 1WGPA 1YO8A 2BRTA 4QQHA 1FAYA 4CCCA 4LO6B 4QGNA 4XJ9A 1XU1A 2R30A 2V72A 2XB6C 4IV3A 4XFCA 5A32A 4PDWC 2AYHA 1VMFA 4M00A 2ERFA 2IFRA 5A7NA 3RMXA 2BYVE 3AB0A 3PLQA 5KXBA 5LEKA 1D4VB 4QD2A 4MXWB 4PDWA 3VN4A 3OSDA 5FZ9A 5LW9A 1H9WA 4UXAA 1I5PA 1HDKA 2Q30A 3RQ0A 4DINB 5JZGB 4RFT0 2ET7A 2QNKA 5CVRA 2Y8KA 4NR1A 4OHVA 4Y1VA 3NQHA 1VBD3 2RG4A 5ACA2 2QQUA 2DTYA 3JQXA 4BLIA 4LBQB 5IK8A 2J1RA 3T30A 4OUMA 5A3LA 3GZTB 3WOGA 3UETA 2Z69A 1RINA 3AP7A 5FZEA 4HPKA 1BK0A 2WLPA 3N9QA 2HEWF 3URFA 2KA3A 3RPQA 3EB7A 2QKDA 3M1HA 5JUVA 2R1BA 1VBB1 1ZZ8A 3TNQA 2EVXA 3SH3A 1UY2A 3WXPA 2VG9A 5LA2A 4AVBA 4YZ2A 5AFEA 1ZRFA 4WZFA 2Y60A 3H50A 1EAH1 4FPGA 1E5SA 1JZ3A 2BTVC 3TOJA 1W3VA 3WG4A 4XJ8A 3P1IA 3WHUA 5BXXA 1ENSA 3JUUA 1WCQA 5GLWA 3KMHA 4RSUA 4FQZA 4AVTA 4GZ9A 2J1TA 1H4HA 5J3UA 3DV8A 3RJRA 1RUE1 3HBZA 2CGNA 2YHJA 1NLSA 1Q8PA 4NOTA 2ZPXA 3J8F3 5I0TA 3VDAA 5ACA3 3LB9A 1NZIA 4D6QA 3VBOB 2QJVA 4XJWA 4L92A 2O14A 4KH9A 4N53C 5KR7A 1W0OA 5GM0A 1OA4A 5CKMA 1TME3 2Z2SB 4N53A 2P17A 1F4AA 4QKBA 5C7GA 3VBOA 1QNYA 3ZM8A 4CU8A 3GJAA 4K20A 2Q8CA 2VZSA 3R0RA 3VBSC 1UWWA 2XBO2 5FYHA 1LECA 1CAXA 2VAUA 2OIIA 1HQWA 3NJVA 4K9SA 3WR0A 2VMIA 2Q4SA 4IL7A 4HPKB 2YV8A 3GJBA 4KL1A 5K0UA 1I5ZA 4RGAA 2WQ8A 2VUJA 1XYOA 4YVWB 3K51A 4GJZA 1BEV1 2ZGNA 5A80A 4GULA 5ABJB 1OSGA 3PVOA 1LULA 5CAZA 2WN3A 2XWBB 3QOPA 5LA0A 5IATA 3I54A 1GWLA 3ILNA 4DY3A 4KBZA 4BK5A 2XXZA 5FLJA 5EWSA 4A2UA 1AR91 1G8WA 4YG6A 2J1EA 4BK4A 1S4CA 3HNYM 3UKVA 4BOWA 2W1WA 1OUXA 1Q56A 2VZOA 3UL2A 1HRI2 4XF3A 1V6LA 4YM1A 3POWA 4NIDA 3OTFA 3Q9OA 3TEZA 5A1AA 1QOSA 4FFGA 1VALA 2A3XA 5CBLA 1Q8VA 3ZXAC 4CDWA 1JU4A 4IV3C 5KXEA 2ZGKA 4XETA 4P9JA 3ZFGB 2KD7A 3AZZA 4XILA 3GDBA 3TBDA 3NWKA 2J1UA 3F95A 1OKOA 3LDBA 4XPVA 1QJY2 1MZ6A 3B01A 4NMIA 2E7QA 4CDQC 4PT6A 4TLGA 5H9QA 1S0IA 2WT2A 3VDDA 4L2NA 2CSGA 4XTMA 3UJOA 4O61A 1AL21 1GSLA 1Z78A 3DECA 4Y4YA 5CISA 4EQVA 5DUUA 3MYXA 2W95A 2WZR1 3Q8EA 3VZMA 3JBG3 3ILRA 3LD8A 2VW2A 3SH5A 3MLJA 3J4UH 1NLRA 2JDYA 4PIZA 4YW5A 3M3EA 2D43A 4YW7A 1LOBA 4RN5A 2QBXA 4BPZA 2VMGA 3AJYA 3TN92 4FOVA 2Y64A 4CRQA 4ZU4A 3I4IA 3ZXGA 3H8UA 4AGVA 4XE9A 2EXJA 1YNAA 2D3RA 4AEKA 1PHMA 2C9AA 5C5UA 2C0ZA 3AM2A 4XQWA 4HKWA 2R062 5CFCC 2J22A 4Z2AA 1CONA 2CGOA 5DQ0A 4YW1A 1O5UA 2PTMA 2BZDA 4DS0A 4S2GA 3KF3A 3WT3A 1UKGA 2DFCA 4IXLA 3VD3A 4COWA 1OOPA 1ZX5A 2OPWA 4ASMB 1QWRA 2NMOA 1CAVB 2IC1A 5IT6A 2ZMNA 4PJYA 3I97A 1RMU1 2R041 1F15A 4AVSA 2BFUS 2WSVA 4BXSV 1GQGA 2BBVA 4JGZB 1QXPA 2RMU3 1DHKB 1GZWA 2XUEA 2P3YA 5LBFA 2DVGA 1HV1A 1FV3A 1W8NA 2IZWA 5D8AA 4AQTA 1AYN2 1QJZA 2LALA 2RMU1 4XHBA 1OUSA 1EPWA 3E6BA 5D8AC 1R64A 5F3GA 4NE9A 1NE4A 5IFTA 4YW3A 5T5OA 2WA3A 1W6QA 5SV5A 2B7YA 3SQOA 5D8AB 3VBOC 3U11A 4NROA 5F3CA 1S0BA 3LFMA 3POFA 4GKYA 4JTOA 2DUQA 1F8VA 5ACA1 1H1MA 1HLCA 2JWPA 3ZR5A 1Y9MA 2DV9A 2WSUA 2VO5A 4W65A 2Q5TA 1CVNA 1BVVA 3ZPYA 1MS3A 4FTEA 1W6MB 3MW4A 1AF9A 4PLNA 1NZCA 3T0AA 3LQCA 5EFUA 1ZZBA 1ZBE3 2GDFA 5IFPA 3PMEA 1QJEA 1XE7A 2VBPA 4P02B 4YVSC 5HXVA 4NPLA 1PMIA 2P1BA 4FXGB 1WKYA 2R0HA 1KQRA 4ZONA 4Y22A 5C71A 3OD0A 3MZHA 1UL9A 2B39A 4GWIA 1DGWA 5HV0A 1SLLA 5D1IA 5ANQA 1VRH1 3I2HA 4BQ4A 1IQAA 1RJ8A 2WIIB 4NHKA 5FDBA 2EIEA 3C7EA 5IVJA 4LUMA 1XOYA 5FPUA 4LXLA 4P5HA 1EY2A 1QJU3 1LHNA 2JG8A 4CU7A 3QH6A 2R32A 4N8MA 4AGGA 4ZS3A 1HRV1 3B3QE 5EV7A 5I0UA 1QH6A 3ASIA 1JHNA 2AENA 4YFWA 1K5MA 3EQEA 4IE0A 5JMOA 3NJXA 4MZUA 4ZU7A 3NKGA 5GJ6A 3AVRA 4LUKA 4FPCA 1O8PA 1AR83 2PMWB 5F3EA 2YC4A 3BIWE 1VBE2 2OYZA 3LIGA 1GYKA 4QPWA 4ZPIA 4CEYB 1DYPA 3ZYPA 3VDDC 1NUKA 3ZXJA 4NRMA 4QAWA 2J1VA 1LGCA 3AKTA 2WDBA 4XUTA 1F4HA 4D6RA 3TYJA 3VDBA 1LJ7A 1FPN3 4LNVA 1NG0A 1QQP1 5LEJA 4AEJA 1JYVA 5FMOS 1JU3A 2WT0A 4RL7A 1TVGA 1US3A 4GB31 2DVBA 1WCKA 1NXD1 1PK6A 1WMXA 1Z7S2 4Q4V3 3ZFFA 3I2DA 3NNJA 3WY6A 2WINB 4LLFA 5DZGA 2Y6KA 2HWF3 4HN1A 1W03A 4LHKA 2IWGB 4QGMA 1R093 1UZZA 4ZU5A 2VOKA 3C7HA 1PK6C 2YG0A 3LOIA 3NV1A 4O7XA 3ZFFC 2QZ3A 2ZGUA 1WW4A 5LK5A 2CYFA 2R0FA 3A7QA 4XC9A 5FZFA 4H14A 2I07B 4DZGA 3ZN6B 2OUHA 3C8XA 3SKVA 1PVXA 2GALA 2XOMA 3T2QA 4RQPA 1RUF2 3WQ0A 1DGWX 2ZTNA 1O7FA 1XJAA 4IE6A 5F2SA 3CL1A 1LB2A 1L7LA 1QHDA 2ZMLA 1CX1A 2JE7A 5FKCA 1WA6X 3GZEA 4EN8B 1NCRA 1W6MA 3N9OA 3OYWB 1WW5A 1HQLA 5FWJA 5GLUA 3GBFA 2B46X 3KT1A 5FP4A 4AYUA 2XJVA 3KV4A 4DB5A 5JAXA 2R16A 1C28A 5AVPA 4Q0SA 4K7JA 3TWIA 3WD5A 2WYFA 3KZ4C 3M2MA 3MIEA 5FYBA 3WDUA 2WFF2 1Q8SA 4XMIA 4ISRA 2VM9A 2ZGOA 2E7TA 5FMCA 1QJU2 3CJXA 3KT7A 4X6QB 5C3SA 3ZXLA 5E8AA 5BNOA 1VBC2 3A0NA 5EJ3A 1R1A1 2K46A 5FBZA 4W6YA 5KWRA 1CAUB 2XH6A 1TZOA 1O4ZA 1SPPB 2GC2A 4G3YC 4JCKA 1MS5A 3VUOA 5KHIA 2VNOA 4OYUA 3VBRB 2AH2A 2NLRA 1Q43A 1LOEA 4PCRA 1CQ9A 2JG9B 3AP6A 4NHLA 4NRQA 1QJFA 1RUD2 3ZYGA 5GZDA 4FP3A 3WW3A 5C9AB 3FUOA 3BYWA 2VOVA 2R063 4LULA 2VCBA 1VBE3 4WM8C 1PGW2 4J1WA 2Q8EA 1FMD3 2UYAA 2VH9A 5JI9A 2R061 3SXWA 3WUCA 3ZFEA 2CDOA 2V4VA 3R4DB 1O3TA 2A6YA 2ZKNA 1LGNA 1DZQA 3ZDSA 2V73A 3TEWA 1WCDJ 4OULA 3ZFEC 3MI8A 4AQ2A 1AYM1 2WR9A 1EV13 1ZBA1 1J3RA 4XFIA 1HB2A 1ZBA2 2D7FA 3RNSA 2FCVA 1OVSA 4AFMA 5C3QA 1WZXA 4IEXA 5JMCA 1E5HA 2OXBA 3KVAA 4FOQA 4XAEA 3P5BA 4YWAA 2VQAA 2AZ5A 4PHZA 5FP7A 5A70A 4M4RA 4YVSB 3D0SA 4YGDA 3VBSB 5I0SA 2WWUA 1HW5A 5F39A 4GB33 2BPA2 1SCSA 2G9GA 1UY4A 2GH8A 3A21A 3KM5A 4XJAA 1JZ7A 5GZFA 5KHKA 1UU4A 4Y1XA 4PBPA 3R05A 4YG0A 3ZXDA 4QPIA 3CQOA 3L9JT 1QEXA 1QIQA 5L9BA 3OBZA 2HBTA 5I0RA 1Y9GA 3LZZA 1BQPA 3G7DA 4LBMA 2UY9A 3U1XA 5FYCA 4CZSA 2XBO3 2DF7A 5C33A 1RVF3 2TUNA 2C26A 3OBTA 3RYPA 1QMJA 5BPXA 3ES1A 2ZA9A 3MICA 2IUWA 4COVA 1VR3A 1RUF3 4QM9A 4JDOA 3JB8A 1DQ1A 3SMHA 4FTSA 2XJUA 3AZXA 2YPJA 4NPMA 2ID4A 1BBT3 4D7SA 1AX1A 5DAWA 2VVFA 1B35A 3FMGA 4AXOA 1FT9A 4A3ZA 1CGPA 3LA2A 1AYN1 2X8KA 4DEQA 1C4RA 2GN3A 1SDWA 3AXEA 1LEMA 1DQ2A 4XF0A 5F32A 3USUA 3VKNA 4YPJA 4CP1A 2NQYA 4P00B 5GLVA 1Y7BA 3O12A 1YEWA 2GP5A 1V9U2 2F4LA 2PXJA 2R072 1WA4A 3J9SA 1FOD3 1IS5A 1EYBA 4QX8A 1OA2A 3I8TA 1EPZA 4MGKE 3OBRA 4CP9B 1JZ4A 4LT5A 1DGLA 4UFJA 1HIXA 4CUAA 2PHUA 1J58A 4IV1A 3WVJA 4XCAA 3UJQA 4LKFA 3VDCA 1DFQA 2D93A 4E4HA 3U07A 1ZZ6A 3LDKA 3B7MA 1DGRN 1IHMA 4DUVA 5KXDA 3MLLA 2WAAA 1LCLA 3H3UA 4R8HA 2Y6HA 1UIKA 5DUWA 4ZZ5A 4NHXA 4G9SB 3M3IA 5JWPA 1KJLA 4HKLA 1EAH2 2B8MA 1BEV2 3AL6A 1MPXA 4UW5A 5FXVA 4K40A 2LUWA 3HEIA 5BUVA 3RFRA 1RUJ3 3MBWA 2H0BA 3E97A 4N9IA 3IDEA 3SCHA 2BUKA 5A7WB 3RYRA 3WSOA 1W6OA 4UFIA 1CESA 4Q4W2 3HNMA 4XIOA 1FXZA 2VQTA 4P9GA 5CFDB 1GZ9A 3AP9A 1AX2A 4C0HA 3IM0A 2WS92 1LESA 2PQSA 1HRI1 2RS32 4N9HA 1V9U3 2R073 2TNFA 4OZOA 4Q26A 5H9PA 1N3OA 2XHNA 2VTXA 4BA6A 2BBAA 1YXWA 2JG9C 1RMU3 1QJX1 1W8TA 2BGCA 2R043 2D5HA 2NPIA 5FPXA 2XBO1 5FJKA 2MNGA 2PHXA 2VBDA 2WKKA 5A3OA 1WW7A 2CDPA 3AYDA 1U5XA 4A41A 5FUPA 1AR73 1FOD1 2MEV3 2DDUA 2VOXA 4QQOA 5T50A 5T5PA 3WP3A 2ZEWA 3WNOA 4A4AA 5LZ6A 1J83A 2VZ1A 1TE1B 5E16A 4MGQA 4NRPA 5A7SA 2XMLA 2VUCA 1EV12 2ZX0A 3G6JB 1AYN3 4Y3OA 1O3RA 2VZTA 1UCXA 1Y9QA 4LBJA 4LQRA 5FYTA 1MR5A 5FWEA 3USUB 5JPNB 1W2TA 1O4YA 2A1XA 1VB4A 5FFOC 3BUCA 3SLIA 3WQ7A 5KHJA 4MO3M 2ZJCA 1N1YA 5I8TA 4XEZA 4Y5TA 1QQP3 3D0JA 4LLOA 2B9VA 1TNFA 2Y38A 3SH4A 1O3QA 1W8ZA 1BJQA 1PM4A 1RUF1 4LBOA 2DCTA 4UWDA 2IXKA 4BE3A 4LBQD 1BCXA 4PQQA 4IE4A 2E9QA 3DPRB 5IK7A 2F17A 1OOPB 2SLIA 1GP6A 1JMUB 3VKLA 1K5JA 4N7UA 3BPSA 1RUG1 3ZVXA 4B1LA 5A3UA 2IVIB 1SLAA 5HCHA 1ODMA 2KR2A 4XUPA 2DCJA 5FY8A 3ABZA 3I2KA 1U5YA 1PGW1 2RE9A 3KHBA 4AOCA 5J37A 4B1MA 2VCAA 1LGBA 4AFAA 4H7MA 4R52A 3AYEA 3GHMA 4UFKA 4CCNA 4EWDA 1KRIA 5ANNA 1VBD2 4OFGA 2VXJA 3CBNA 3NL1A 3S6PA 3RZKA 4YSFA 3NJYA 2AEYA 4XBQA 1ND2A 1VAVA 4AVVA 3NRUA 1H2KA 4ITCA 2DBIA 1RMU2 2R042 2DVFA 2XJRA 3J26N 3KF5A 4OI4A 5FZ7A 4WM7B 5IVEA 1NYWA 3T1MA 1UMIA 5FYIA 2VZVA 1VAKA 3T2TA 1UAIA 4BMBA 1QJY3 4YZ1A 2D40A 4K21A 4PIYA 1N3QA 5AC93 2LTNA 1UXZA 3ZFGA 4EWEA 3O1SA 3ES4A 5C3RA 2CWSA 4XF1A 1RUOA 2YU2A 1RUH2 3RZZA 3TB0A 3N36A 5JDBA 1JZ2A 2PHRA 4I0WB 4Q4Y3 2H6BA 1BHGA 4AWDA 1S0CA 4E8DA 1R091 2W47A 5SV8A 1I3HA 1YHFA 4XVHA 3K3NA 4W50A 2BVVA 2JIJA 2X29A 1H1IA 4COUA 3MUZ1 3MW3A 4RHV3 5A1FA 1HV0A 4KU7A 4TLFA 2RS11 3PU8A 4CCDA 2WFF3 4Q8KA 1XU2A 3M70A 3BOWA 4QU2A 4NN0A 1POV1 3LEMA 1U12A 3GGLA 1LOFA 2P2KA 1JH5A 2JG8C 4NUBA 3WW4A 4A7KA 5ISLA 2JDHA 2ARAA 4XAAA 1UXXX 1ONAA 3ETQA 2GU9A 1LHWA 1VRH2 2OZJA 4WV8A 5A7OA 5I0DA 3WF1A 2X5IB 3PURA 4FFFA 1K12A 4AE2A 3S0MA 2A7AA 3GBWA 4FBFA 5GZGA 5FZKA 1IKQA 4MG2A 5IAXA 2D44A 1S0EA 3H7YA 4LOSA 2WO7A 1GFF2 2QQKA 5FPZA 3WINE 2RDQA 3CEWA 4P14A 1M4WA 1GNHA 2YY1A 4U2AA 3KQ4B 5J36A 2WNVA 3UK9A 4B29A 1X50A 1VPHA 2V5DA 1VB2A 2VTFA 4EYUA 1AR62 5F5QA 3P3PA 4MGZE 2FD8A 1HX6A 1I6XA 2HWD2 2QVSB 4FI9A 5CEHA 1BEV3 3DF0A 1IPKA 1ZZCA 3GBGA 3GCWA 3UESA 2PLV2 4R9DA 4N53B 1QDCA 1H4GA 3CDZB 2VZUA 4QXHA 1A8DA 5C6CA 4LITA 4BIOA 2QCSB 3SEEA 4IEQA 1A34A 2WJSA 2D6PA 3KGLA 3OPZA 4M0HA 4CU6A 1HQNA 3ACIA 2C1FA 4I0BA 4TWTA 2ILMA 4FPOB 1DYKA 3IN9A 5I8YA 5CKNA 1UMHA 3E5XA 4W6WA 1UY3A 4RS5B 4BHPA 4Q27A 4BB3A 1C8M2 1YQ2A 1C8M1 3AMPA 3LPGA 4V2WA 3LSEA 3C7OA 3OUHA 3MV01 2BGOA 3PUQA 1UN1A 2VZRA 4MHRA 4XACA 4D3WA 4XHXA 1W2UA 1CPMA 2CNAA 1UIJA 3WLUA 1JYCA 1LR5A 4FVVA 3VV1A 5LK7B 1GUIA 4SBVA 1VBA1 2RJLA 5HBAA 3B9CA 5JOZA 3EMRA 2OA2A 3PUHA 4CUCA 4I2OA 4AHWA 1NA1B 5CG9A 1AR93 3O1UA 4KQ7A 5FBJA 2W92A 4DOUA 2ATFA 1FPN2 3S7EA 1L7QA 1L7RA 3B9IA 4XUOA 2HWE1 1QJY1 1OLMA 1NE6A 2CHHA 3VL9A 1MEC2 4KWKA 2WLQA 2D3SA 4XYXA 1NA1A 4DO0A 5LWBA 3FHIB 1RXFA 3JQWA 4YW4A 5KHHA 1UZVA 1M06G 5JPMB 5A1LA 3N4MA 2EA7A 4RGGA 3SNMA 1YUDA 5J48A 5C4WC 4XABA 3BPZA 4CDXB 1AX0A 1W99A 4DFSA 5FOJB 1NKGA 4WM7C 3WX5A 4Q4X1 1KGYA 3UV9A 1HJFA 4NWWA 3THDA 1CPNA 1D2SA 3LWCA 4CDXC 2Y34A 3VBRA 2HWD3 1XNDA 2ZX2A 3I3EA 4O65A 4Y24A 4CDXA 1COV1 1NX9A 1REEA 2WO2A 5FP3A 5J09A 3CJIA 4HETA 4JDMA 5FPBA 3W5MA 1AYM2 4WVZA 2ZGRA 3RMYA 3ZN4A 4A6SA 1O4TA 5FPAA 2J7MA 3OF1A 4N43A 1ZREA 3HT1A 2VPVA 3LEKA 4FAGA 4KWJA 3BKZA 3GXUA 3RGBA 5T54A 3HD8B 2P3KA 2F4PA 5A6QA 2WZEA 5C70A 1LKNA 1VBD1 2XLGA 4Y1YA 2ARCA 2OW4A 2DVDA 2HBUA 2YMZA 4IEWA 2P34A 4CEWB 4C90A 5AVAA 2CAVA 1RGSA 1AHSA 4OMDA 1UKRA 5DMYA 2B9UA 3OGRA 2JD9A 2OS2A 1OPMA 4GH4B 1K5MB 2A73B 4GIQA 4UFMA 4OHZA 1ODNA 1TQ5A 4XF9A 5IVYA 2K9ZA 2BOJA 1NT0A 3I2FA 3U75A 3I49A 2CGPA 1QOTA 3B93A 2VW0A 3BTAA 1RUI3 4FPFA 3V65A 3WDVA 5A3NA 1RITA 1SZBA 3HBKA 5A3WA 3PTRB 1C5HA 1YYNA 2X5IC 3LCPA 4X8PA 5CFCB 2NM1A 2DVAA 3NVCA 5FZBA 4URTA 4D8MA 3O1PA 5J98B 3DXTA 1DLCA 3HMYA 5FZMA 3I3DA 3FX3A 3GNEA 3FC0A 4K1YA 4IGQA 4XURA 3NSTA 1PM7A 3P3NA 2HWC2 1X33A 2LM3A 1OHFA 2ZS6B 4P9XA 3USSA 1OKQA 5CFCA 3FBYA 5FQ0A 5A33A 3U37A 3POYA 2HJIA 3Q8BA 4NO4A 5FK8A 5CKQA 4XIKA 4YRDA 5JSPA 1XC6A 4AAXA 1C8M3 4CPBD 3RZLA 2R49A 3Q8FA 1ZYBA 4LHSA 4OUSA 3WNKA 3GALA 2GMPA 1ZRIA 3NV2A 1SDDB 4UYBA 4XBNA 3UYJA 4QPGC 3IT8A 1H1AA 5FKBA 1UU5A 4LTAA 2ZAHA 4ZKTB 1UD1A 1ND2C 2J1SA 1HN0A 1TME1 3GZAA 1FV2A 4X8NA 4EN6B 2BGPA 4TYSA 2E31A 1UOFA 3UKNA 2HKXA 1PNGA 3T09A 4RYDA 4OI1A 1W04A 4KBBA 2N7GA 1DZRA 3OOXA 1AL0G 1X7NA 2DURA 2X53S 3MDPA 3KT4A 3CO2A 4EN7B 5BNQA 1V9U1 1JBCA 2R071 5I93A 4JKLA 2D6NA 2DU1A 2H0VA 3QCWA 3CJIB 1SQ4A 2HYXA 2NZ9A 3KV5A 2C24A 4LPLA 3OBAA 3PUSA 1ENXA 4GMP3 1NXMA 2W94A 2HWD1 4UF0B 2D5FA 2WZ8A 5BNOC 1RVF1 1NA1C 1OFNA 3GF6A 1UZYA 4PLMA 1ULEA 5FP9A 4CTEA 5BNOB 1ACCA 5A6XA 3NKTA 4HVQA 1NAEA 2WNEA 1Y3TA 3ZR6A 4WVWA 4XFFA 2C9KA 4Q1PA 4BXFA 4UOJA 5I8SA 4MXVA 2I74A 3ZXFA 1WCSA 3MGUA 2IVJA 3DKQA 3FWEA 1ND3A 2W3JA 3W59A 1IZ3A 3RYKA 3I2GA 3HNBM 1Z7S1 4LBLA 1F35A 4YVWA 3WNMA 2E63A 1ND3C 3KHCA 4D7TA 5A3PA 3WDWA 1CN1A 1OLME 4CPBA 3MF6A 3T4VA 5FZDA 5JCTA 5L9VA 4LHNA 2YBPA 4CCLA 1WW6A 3JCIA 1UF2C 5JOYA 2OZ6A 1OI6A 3H7JA 2EXKA 2QTWB 4L9BA 4DUXA 2ZHNA 4KI5M 4Z8BA 4HLTA 2HWC3 3OPWA 2IXHA 4Q5OA 1JYIA 5FYMA 5HCBA 1RYYA 1W9WA 1W39A 1R082 2VJXA 4CP0A 4K3UA 1BVP1 1QH7A 4B8EA 4Y33A 4QPYA 4W8JA 4E8CA 5DAXA 1AL23 3M7AA 5BNNB 2JICA 4MUVA 4A45A 1GBGA 2PHLA 4CCKA 4LIVA 1BMV2 4QGLA 1BMV1 3TAYA 3IDCB 1DCSA 3IDAA 2RM23 5TSWA 3BU7A 1YRZA 2BERA 3QD6A 5FZ8A 4XJZA 2G19A 3HN1A 1ZA4A 1IS6A 2GAUA 2GNBA 2O1QA 3OGVA 2BNMA 5FV3A 1QU0A 4MGIE 4Q0PA 3UNPA 3BI3A 3I2OA 4Q4W3 1YJLA 1YFWA 1LHVA 1XYPA 5L36A 2JEMA 1MQTC 5C8CC 5IVBA 1PGSA 1X9PA 1NLQA 2FMDA 4Y5Z0 1MQTA 2FCUA 4XTPA 2O8QA 4IEYA 1OFSA 2LROA 2VMHA 4RHV1 4WZCA 3PU3A 1JUHA 4NIAA 1FNYA 1X8MA 2QQNA 2YU1A 4IETA 3FFQA 4BDVB 2ETEA 1OQ1A 2JDZA 1WUVA 2ZX1A 3GM8A 2Y6FA 2B45X 1NQJA 2JDUA 2VECA 3M4FA 5A33B 1ZVFA 1NY71 3C3VA 4TXWA 4OHYA 3AMNA 5FJHA 3TEXA 2EIDA 1RL3A 3O1RA 2ZGLA 2WQ4A 1KD7A 1B35B 1RUG2 5LASA 5FK7A 1ZRDA 4OLLA 4W4ZA 3ZN5A 5FY0A 2RS33 1GQHA 5L19A 3WF4A 3HAGA 4CCJA 2G1MA 3LFIA 1W28A 3WP5A 2UY8A 3RRDA 2PA7A 2ZHKA 3VBHC 3POJA 3UGGA 1C5IA 1AR82 1V6KA 2ZX3A 3D3AA 1IOAA 4QXCA 5CNAA 2EICA 1XRUA 4CDQB 3EO6A 4PI2A 5JR7B 1MEC3 1KS4A 1COV3 4META 3AFGA 4CA9A 1F2NA 2V09A 4A3XA 2TBVA 5IVFA 3OEBA 1HB4A 1D7PM 3N9LA 1JN2P 3WV6A 4CYDA 3PMSA 1FYUA 4XUQA 1ASJ2 4JHTA 4UW4A 3MFCA 3OPTA 4KGQA 1XQNA 1K3IA 1O5LA 4LE4A 3KV9A 1GMMA 5H9SA 2VW1A 5IJRA 3TNPB 1JYWA 4AHZA 4S2HA 3FN9A 1CJPA 1STMA 3K4DA 2VNGA 1GNZA 1V6MA 5DAVA 4QPIB 4BQXA 4M4PA 3RZJA 3KSCA 4GMP1 3ACGA 1XNTA 4CU9A 1XSQA 4WBBA 4A6OA 4DQAA 4C8DA 2E33A 4W6XA 1OT5A 4B4QA 4NHYA 4XFAA 3BTZA 5FCCA 1RHI2 4K8FA 3OGJA 4RR3B 4P5YA 1POQA 3OY8B 4M3CF 3POIA 2FDJA 4BCUA 1TME2 1V6NA 1VBA3 4B7EA 1MS0A 1W9SA 2PHTA 3N7JA 3ZYFA 1DDLA 1VJ2A 3DEMA 2G9FA 3SITA 4CE8A 4OVEA 4YM3A 2HWB2 1JYTA 1D4M2 1L3JA 5JOXA 1UYPA 3IDBB 1XNCA 5H9RA 1MS1A 2AREA 3HPNA 4Z2WA 3RI8A 5DABA 3CIHA 4PI0A 4FPYA 1OMIA 2YFUA 1POV0 1YQ5A 2ZACA 3MIBA 1RUC3 4Q4Y2 4MADA 4XMAA 5DZEA 3DYMA 2JDAA 5AFBA 1SFPA 3ACFA 4BWOA 1VAMA 4R9BA 4TSVA 2YGMA 1V0AA 3FL7A 3I2IA 4N7IA 3POGA 4GA9A 2RS52 1UW8A 3OEAA 3IPVA 3VDDB 1CAWA 1UYXA 4F7ZA 2QE3A 1W6NA 3O14A 5E6HA 4DIQA 2PHWA 4P9IA 5A3TA 4RS5A 1CIWA 4BQ5A 1CD3G 4X6RB 4FP2A 4YM0A 1XB9A 2VNVA 2JB8A 1PIV1 4YZ5A 1DU3D 4OZXA 4QT6A 3CNAA 4RQPC 3UGFA 5JXHA 5EXOA 2PLV1 2QDNA 3IAQA 3PDQA 5JXGA 3BGAA 5K0UB 1T6BX 2H6CA 3ZSMA 3AYCA 3UKTA 4QPGA 1I9RA 3KCCA 3EYPA 5FY1A 5C8WA 5FO8B 1YFYA 3DPRA 2PAMA 1C1FA 1LHOA 3MPPG 1UOJA 3J8F1 3WEZA 3J8F2 2P3JA 2YZ4A 1XNKA 3GYDA 3EBRA 4V2VA 3VZNA 4GWNA 4CEYC 5JVVA 3PJQA 1MS4A 5JOWA 4IERA 4GWJA 4ONUA 4AAPA 3SCFA 4WVMA 3ZSLA 2QZ2A 3ON7A 3N7MA 4XQ4A 4HONA 5JR2A 2XJQA 3R6SA 3WG3A 1JXNA 3BIEA 2VMEA 3AZWA 5IVCA 3AVSA 3WP6A 4MGYE 4CEWC 3K75B 5CFDA 2OKXA 5FY9A 3VZOA 5A6YA 3ZKUA 2JXAA 1LHUA 1JI6A 2BNOA 4WVMB 1H2MA 3B5LB 5FREA 5CFDC 1JOPA 2CU5A 4GH4C 3MIHA 2VZQA 2YBSA 4KMQA 4U36A 2MPFA 5DDJ3 3S5AA 3LEGA 4XDOA 1W8OA 1XNBA 5JIUA 1RUD3 1X36A 3CU7A 4HN0A 1E5IA 5FYUA 2RV9A 1YFXA 1C1LA 2A3WA 3PVNA 4Q29A 3VKFC 1O8SA 2WWJA 3FHAA 4AEDC 1QQP2 4D7YA 5JSOA 1VRH3 2ZZJA 1JW6A 4JZRA 3VBHB 2D6KA 3ACLA 1FNZA 2W1QA 4FSJA 2JDNA 1S2KA 3E5QA 2W46A 1DBNA 3PJYA 2BU9A 2VGDA 4LO8A 4D94A 5L7OB 1GP4A 2W87A 4FXKB 1R083 1Q5OA 5L7OC 2RJKA 3O1VA 2VMCA 2DCZA 4NWVA 5JZGC 3NMBA 1QNWA 3AZYA 3NNGA 3S5QA 1ZNPA 4HANA 4OQ8A 3B69A 2WFPA 2WNVB 5JZGA 3VHPA 2XDVA 4LHLA 2GNMA 4JX0A 4P9WA 2BQPA 4ZY9A 3RG0A 1MACA 1RUD1 5JXIA 1OQDA 3H3ZA 1VBA2 2IXCA 5B4NA 4E2SA 2MHFA 1TNRA 1BK1A 2X05A 1PZ7A 3I2JA 1DLLA 2G9ZA 4ZXKA 4QQ2A 2YC2A 4XZPA 3T0BA 4LA2A 1FPN1 4AQSA 1DQ0A 1PX4A 3WDYA 5T55A 4XF4A 3D8CA 2XHKA 2V4AA 2W91A 3BALA 4NHMA 2YFZA 4QPIC 1UOBA 4FPLA 4XCBA 4M01A 4BYYA 3I3MA 1AL22 4HT1T 2J1AA 5FMBA 4NAOA 1IG3A 4OHWA 3HOBA 2WZR2 3ZKYA 2LW8A 2YPDA 3H1MA 1URXA 3WNPA 5F6KA 3FLPA 4S2FA 4JKKA 1UMZA 4CCOA 3NV4A 1PO21 5T5LA 1OLQA 4MGTA 1LOGA 4ASLA 4JGYA 1GZWB 1QXJA 1GKBA 1SBFA 1IPSA 1WLTA 3WW1A 1PO23 1YIPA 4AI3A 4LO5B 4P9LA 3TN91 3HVDA 3ZDVA 4DXZA 1OH3A 2Q8OA 5FXZA 1UY1A 3VGIA 4Q0UA 3VHOA 1HB1A 2X10A 4OI2A 4PLOA 1W6QB 5LB6A 1DF0A 4AEMA 4QX0A 3GHNA 2ZEYA 1WMEA 4LORA 3IMMA 1AZDA 1V00A 4LA3A 3JBG1 4HVRA 3WG2A 1UYYA 3A4UA 1SEFA 2QQWA 3MV11 3WP4A 3PHMA 3Q8AA 5F3IA 1O3SA 2ZXQA 2RS12 4H3WA 4EZ4A 2DU0A 1IQDC 3N35A 1PIV3 2UURA 5FQ0B 3W9AA 2K2SA 4NIGA 1W0PA 4FPJA 1NQDA 2I2SA 1OXCA 1VBC3 2RMU2 4IV1C 3VBSA 5B2GB 1RUJ2 1W05A 4LBQA 4Q4V1 3VD5A 2B5HA 4IEVA 2ADDA 3RI9A 4R4XA 4M0NA 1EAH3 2RS13 3U14A 4CEWA 5HPOA 1ZZ7A 5DAPA 5J7MA 2VL4A 2GC0A 4WVVA 3AP4A 5FZ0A 4A7YA 2A5ZA 5K0UC 1GOGA 4FO9A 5FTTC 4Z92B 4AVAA 3PVEA 4DRRA 4EWAA 2BEOA 2Q0AA 1NCQC 2ENRA 3O0WA 2WBKA 1VMJA 2JG8B 5FYZA 1YLLA 3NV3A 4XXPA 4MOAA 2XLFA 2YROA 5J1XA 3WQBA 4IV3B 5A32B 3SC7X 2P37A 2BOIA 3ZMNA 1KS5A 2GN7A 4R4ZA 3U0ZA 1CIYA 4PF1A 3PTYA 3BOPA 1AXKA 1GV9A 4XFHA 3SHRA 3TN93 4CDWB 2W68A 3LA7A 3V0BA 3ME2A 1RC6A 1WMDA 3E6DA 4LMFA 3DYOA 3LA3A 5LBBA 2ZOEB 4QXKA 4IGPA 2EIGA 3JXSA 2QQMA 3V0BB 1RIRA 3BU0A 4N90A 1UNBA 2VU9A 1POV3 2VNRA 4AFDA 3HQRA 4Q4W1 2VCMA 1DIWA 1PIV2 2Y33A 2OT7A 1QJX3 5DPNA 3CF6E 1GICA 1PO13 3E1F1 4FT8A 3IMNA 3T08A 5C9AA 2ORZA 4Z82A 2FDIA 2WWSA 4AK3A 1J3PA 2A70A 1S1AA 1A8MA 3ZIWA 4RD7A 5E88A 5C9AC 2P6HA 4I3GA 4BQ3A 2RS31 3POEA 4QM8A 4RGKA 2KM2A 2XUMA 2ES3A 4DXSA 4I30A 1R081 4L11A 4ES9A 4Q4Y1 2WNVC 1RVF2 2RDSA 1HKDA 3AC0A 3OB8A 3KQRA 5FOBB 1ULDA 1Q3EA 3KD4A 1W9TA 2A71A 3ZMOA 3VBUA 2XL7A 1FOD2 1ULPA 5FZOA 4Q2FA 2G4IA 3CHXA 3M3OA 1D2QA 1KDKA 2DFBA 1S2BA 2XLAA 1YC61 5ABJA 4H7LA 3O1MA 1F9KA 2XJSA 3L2YA 2WRAA 5K8SA 1GZTA 2W9XA 2DYCA 2W39A 2HWE2 2W08A 5F5AA 4GB32 4RS5C 2W1SA 3B02A 3RS6A 5IUQA 1UO9A 4UT5A 4H55A 3N7LA 1RUH3 4DXRA 3T2PA 2YDEA 3H0OA 3I59B 2VQUA 3DPRC 2NP0A 3INAA 1CR7A 1C3HA 4UF0A 5EYXA 4CXYA 4Q0QA 5FRAA 4AI8A 4XW3A 2VOTA 1OQEA 2XQRA 4CEYA 5BNPB 2YC0A 3N9NA 3AL5A 3WZ1A 2BP6A 1QGLA 3NAPB 4J6GA 5F5CA 2FDKA 4DRVA 4A42A 3VB9A 5T5JA 3FBMA 2GC1A 2VCCA 3ATGA 5F5IA 1J84A 2ZGTA 4QDSA 1W2AX 4XFGA 3HJRA 2WYSA 1ND3B 5F7UA 1MS8A 1MS9A 3LSDA 4JC1A 4CDUB 1MZEA 4EJRA 2BWAA 2EALA 4K8RB 2ZAAA 2GH2A 4K1ZA 4O9EA 3VBUB 3BTYA 1S2EA 2RR11 2VMDA 3AXDA 3MEPA 3P6BA 2RHPA 3DUIA 2WNUC 3HQXA 1LOAA 4XXAA 4I3PA 1MEC1 2AGSA 4XDQA 1EUTA 4LJHA 3ZFGC 4OMCA 5DDJ1 1ZM1A 2ZKLA 3RZGA 4YNIA 4AW7A 4C1XA 1EUUA 1JHJA 4IEUA 1W9FA 1ULOA 3LGRA 3HT2A 3O0XA 3POSA 3D4KA 5A3MA 1P8JA 1SMVA 4IV1B 3AKSA 5JIAA 4WM7A 2D6OX 5GLTA 4QDQA 1H2LA 2JD4A 1W8HA 3MO4A 3M3QA 2XQXA 2VE1A 2XWJB 1REFA 5F2WA 2RR13 3OG2A 4B7KA 3E6CC 2FQPA 5KHGA 1MQTB 1OF3A 1PZ8A 2ZEZA 4LOTA 4INDA 1R1A3 2O0OA 1LOFC 4ES8A 3LF7A 4N43C 5K9YA 2JENA 4CVUA 1VBB3 3ETPA 4MYEA 4JAAA 4JGZA 5CU1A 1K5MC 4E27A 1RTVA 3FLRA 2WABA 4NVPA 1AR72 2C4XA 2MEV2 3D82A 5DAQA 3JBG2 2F6BA 2JJ6A 5DUVA 5HCFA 4CDWC 3MIDA 4OHXA 1PZ9A 4JTNA 4KG8A 4EE2A 4OI0A 4QHOA 2QDRA 1KJRA 2XKOA 2PAEA 1FATA 2YGLA 4MV2A 1RUJ1 4Q4V2 1FMD1 4XFBA 1GANA 1V70A 1QF3A 4Y1ZA 5JLVA 1CZTA 2XVLA 4XBLA 3AMMA 3KGZA 1WLCA 1V6JA 3MF9A 2WT1A 2ZHMA 1KFXL 3VLBB 2QQJA 5D2AA 5C8CA 3ITQA 2CL2A 1RUH1 4HOOA 4LEJA 1WLDA 3KV6A 2O8OA 1ZBE2 5FXXA 4H2AA 3VD4A 2FDHA 5CZKA 1LRHA 2HWB1 2QQIA 1W2OA 1WLWA 3ZN6A 2GNDA 4GD4A 3MUY1 3OGSA 2YB7A 2RDNA 3WNXA 2B4KA 1O91A 3OCPA 3ZOIA 1YFUA 3N9MA 1ULCA 1HXS1 4CCMA 3N9PA 4CDUA 2HLEA 1OPOA 1GZCA 2Q1ZB 4YYOA 2FMYA 3T2OA 1YQCA 1HXS3 2BVBA 1ALYA 3LEIA 1W8FA 2VZPA 2YXSA 3ILFA 4KG0A 5FMDA 2D6LX 1YI9A 1W3XA 1W9YA 1SLBA 4BQWA 4JVAA 3IIAA 5FZHA 2FDGA 4DUWA 2Z79A 2P5BA 3IPVB 2NYYA 4Y4RA 2IFWA 4OCTA 4MSVA 1R1ZA 5G05L 4DMIA 1G9DA 3DL3A 1H30A 1CJDA 2VOWA 3L2HA 1U0AA 2AR6A 5A7QA 4IEOA 4D0QA 3C2UA 1JTZX 1RUI1 2ZGPA 5IYYA 1RUI2 4I0AA 3O5SA 5E1RA 3VD9A 4FOWA 4D69A 3IB3A 5IK5A 3UT0A 1XE8A 2YYOA 1SFNA 3NAPA 1GWKA 4OUEA 5IVVA 1GOFA 3WNNA 5B4XA 3AMHA 5K7PA 3WDXA 3KCYA 4ZS2A 2VR4A 3VZJA 1E57A 1OURA 3MHZA 3NAPC 3JB4C 4I01A 4LK6A 4Y26A 3AKQA 4QMAA 3W20A 5FLHA 3SCGA 4YARA 1VMHA 4Q1RA 3WNLA 1DQ6A 2XL9A 4L99A 4URAA 1H0BA 4OQ9A 3U78A 3VBHA 4RR3C 3C7GA 2UYBA 2XPJA 4S2DA 2BNNA 3AX4A 3V0AB 2JKBA 4HK8A 3AKPA 4EV0A 1RJ7A 3ZFEB 1Q8QA 1JUIA 1H8TC 2Y0OA 1PO11 4O9GA 1J59A 2HWB3 1PO12 1PVC1 3QBQA 4LKEA 1PVC2 1AYM3 4ISQA 5EPAA 2DCYA 2PYTA 5HXMA 2JE8A 2XONA 2A6WA 1AR63 3K46A 4QKFA 2Y6JA 4NIIA 5FO9B 2ET1A 2E7AA 1JYXA 4NIHA 5CIRA 2ADEA 4CP9A 1I1EA 3MPBA 4YZ4A 5LCWL 4IQPA 3GZUC 3S57A 3IWZA 1RHI3 5G04L 1Y43B 1UU6A 3V56A 5AC91 5AC92 2AUYA 2VBBA 2W52A 3FJSA 3A0KA 4JRLA 5IW0A 5CADA 1O59A 1JYNA 4J1XA 2CWMA 2R7EB 4LO7A 1HRV2 2V5YA 3IZOA 3QH7A 2WS93 5FZAA 1U5ZA 4Y20A 2VC9A 1F5FA 3DXUA 5FXWA 1OD5A 4UBGA 2AACA 2PAKA 4HSLA 2FZ2A 2JDMA 4YGBA 4I02A 5FZCA 5IAVA 1UPIA 3ZSJA 4Y22B 1VBE1 1Z0HA 4B4RA 1IS4A 2P6CA 2VQ0A 2WAOA 4KWLA 2JB4A 2QQPA 3D6EA 5F1RA 1WD4A 1H6YA 3KB5A 3H1YA 5EJZB 5A7WA 1XPWA 2E6VA 2OVUA 3LE0A 4I09A 4GXLA 2HYKA 2Z5WA 4BH9A 2W2IA 3OD4A 4IDZA 3V0AA 1LU1A 4RFRB 3FUQA 1TEIA 3MW2A 2WZPP 1KFUL 1IS3A 2NN8A 3J7MA 4AFBA 4F83A 3PIJA 4Z1VA 4ZZ8A 2X5IA 1J3QA 1VIWB 1A78A 4XOGA 3OUJA 4LK7A 2FBEA 1YJKA 3VZLA 3U4XA 1S0GA 1YWKA 3FHQA 1PGL1 1N1VA 2A6XA 1XNAA 3HQUA 5I91A 2EAKA 1IG0A 3M3CA 4HXCA 5GALA 4AG4A 4CUGA 4BQ1A 1F31A 2WL1A 5EIYB 2CY6A 1UZWA 2ZEXA 4MXWA 4PDWB 2D6MA 2GMEA 2EIBA 2ZGMA 1OF4A 1LNSA 2VVDA 1XXNA 3NO8A 1W06A 4HZFA 1V6OA 1B35C 1O6UA 1UQXA 2WC2A 5CA6A 4E9KA 4Q0VA 2Y6GA 4QX5A 1HJGA 3VHRA 5LBCA 3NNMA 2VXRA 2CAUA 3W58A 4QKDA 3H42B 2R1DA 4HSJA 3S30A 2JECA 1QDOA 1GR3A 2IXIA 3F2ZA 1ASJ3 3AYAA 3AK0A 4Y1UA 5KC6A 3ACHA 2WNOA 3KWVA 3TEYA 1UZ0A 5LBEA 5F37A 4ZHNA 5HI0A 2WO1A 2W0XA 1JOBA 3RJ2X 4QQLA 4Y5SA 3WDTA 2XKPA 3ZYRA 2FCTA 4BLJA 1KEXA 1EP0A 2RJ2A 2SBAA 4DPNA 4LIUA 5FLIA 3ZYHA 1DP0A 1GNYA 2HEYF 2XR4A 3PVBB 4QB2A 5DG1A 1GOHA 2FHRA 3DYPA 5T3NA 2DUPA 3WG1A 4ORFA 5BYNA 2JKXA 3OYWA 1NCQA 1W8WA 5FZIA 4FPHA 4AVCA 4DEVA 3M8LA 2Z4FA 4M3CB 4GH4A 2LRPA 2Q8DA 2RM22 1XSRA 4BU2A 4JHZA 4EROA 1SBDA 2I45A 4CSWA 2ZX4A 3X29B 4AEDA 2EF6A 2W1UA 1TMF2 1SFYA 5EQUA 3FLTA 4E2QA 4G4FA 4P9YA 1ZBE1 4JGYB 2XJTA 1R092 3AKRA 4KU8A 3K2OA 4WM8B 5LA9A 5M0TA 5FAXA 1SCRA 1GU3A 3DN7A 4D6SA 2D98A 5EP9A 2HWE3 4YVWC 2BV4A 1DZTA 5L7OA 2P4EA 4HVOA 2GC3A 4YVSA 1AJKA 1A6CA
chains in the Genus database with same CATH topology
2BWCA 1N47A 1LU2A 2CV6A 4WM8A 4FPKA 4GALA 3SISA 5BNPC 5BNNA 2JG9A 4MH0E 3OGGA 2JX9A 3IKWA 1BXHA 5E89A 4K6BA 1SBEA 5BNPA 1V6IA 2ZGQA 1FMD2 3CJIC 1PNFA 1H2NA 1N1SA 3R4UA 3DKWA 2ZBJA 3BCWA 4YFZA 1YCIA 2PHDA 4A7ZA 1RUG3 4LBNA 1SLIA 5HCAA 1RUNA 1X82A 1G9CA 5LRSA 2VULA 4E2GA 1MZFA 2UU8A 3WCSA 2R6QA 2Y26A 1AXZA 1PVC3 4DNYA 1DGRA 2CTVA 4COYA 4Z07A 1T6GC 1C57A 5GKAC 2GNTA 1AUYA 3VHNA 1W6OB 1WBLA 2YUEA 3JD73 1WD3A 3ENRA 3I59A 3ELNA 1KITA 2PHFA 1Q8OA 2NMNA 1RUE2 4IESA 5JI7A 3RDIA 1LOCA 2EXIA 1MVEA 2WS91 3ZO0B 1IGOA 3RSJA 3T1LA 1WBFA 3TRSB 3K48A 3H1WA 1QY4A 1G9AA 4MVTA 4AEDB 3EJKA 2ZMKA 5T52A 4EN0A 1MVQA 2JE9A 3D5OA 1NCRC 3IBMA 5BV6A 1RUC1 5BY5A 1RUC2 3HIFA 2HWF2 1PK6B 3ZFFB 2HWF1 2IXJA 1UX6A 2WFF1 4R9AA 5KC5A 2C5DA 4L8QA 1D4M3 4HFSA 1DQ5A 1EV11 1ZBA3 5CB7A 1C8NA 4TZDA 2VVEA 5GZEA 2PN5A 3LKJA 1SLTA 2ARBA 3HR9A 4YZ3A 1G6NA 1LODA 4XJUA 3AJZA 2OUJA 3PNAA 2A6ZA 4PF5A 1BYHA 1ULGA 1LTEA 2RR12 2Z42A 4AI0A 1VP6A 1RUE3 1SACA 4MLOA 4AHXA 5CG8A 3ZXKA 1ND2B 2GSYA 4KGGA 3LOBA 4IEZA 2UWBA 4HBNA 1PGL2 4Q4X2 1APNA 4PIXA 1AR92 1D0GA 1B09A 3VL8A 3THPA 1QJX2 4HMZA 4B3NA 3DGTA 3RWNA 1CAVA 2OPKA 3S7IA 1GLHA 1IPJA 3ZYIB 3ECQA 3WW2A 2VY0A 3THTA 4R9CA 3AZVA 1VBC1 1LEDA 4FCAA 1R1A2 1FI2A 4LO4B 1BBT1 1KXGA 2D97A 1NOVA 5L73A 3WQ1A 1AVBA 2XVGA 1QOOA 1AR71 2MEV1 2ZHLA 3QACA 5J96B 4FPEA 4BIFA 4E4SA 2PQQA 4AQ6A 1AXYA 2E51A 2RM21 1W6PA 1ZZ9A 2ZABA 3R4SA 1S0DA 1ENQA 3VBUC 1FX5A 3N7KA 1J1TA 4HL0A 4YM2A 1DQ4A 5EYYA 4RA0A 1QKQA 4CDUC 5ABJC 1BZWA 4LE3A 2E53A 5FMOL 1N3PA 2DWRA 5KXCA 2ZCWA 3U10A 2GMMA 4JV4A 3MFAA 1ENRA 2HWC1 1Z7S3 4NPRA 1LENA 2EAAA 2WQZC 4PQ9A 5DUXA 4FAHA 1RHI1 3ST7A 1OA3A 1VBB2 4F8AA 1HXS2 1ZRRA 4GKXA 1ZRCA 1YI7A 2BW8A 1QXRA 4AF9A 1IKPA 3MIGA 1REDA 3KCXA 4UW6A 1XYNA 2ZZQA 2PELA 2IXLA 4YLZA 5C8CB 4UW3A 3JD72 2EXHA 4ATFA 3JD71 2DUOA 4MX3A 4LBKA 5DZFA 1RB8G 2WA4A 1X8EA 3KS7A 4QHBA 4JDNA 3JU9A 1D4M1 3ZSEA 4F3JA 1W6PB 4C0BA 1U5IA 4C91A 3V64A 2RS51 2XG3A 2XJPA 4EN9B 4ATEA 2WZR3 4AI1A 4RQPB 3AP5A 4Q8LA 4BM8A 3AMQA 3OJBA 1AJOA 3I7DA 1NCRB 3N3HA 4GQ7A 4C1WA 4YGEA 1AR61 3EXUA 5F9TA 1A3KA 3MLKA 3WHTA 4N43B 1CAWB 3JZVA 1J1LA 1W6NB 1H9PA 4Y20B 4AGRA 3NJZA 4PBOA 4L97A 2A75A 5LRRA 4V1PA 2HEVF 3NW4A 3VBFB 2TEPA 3FFZA 2P3IA 2K0GA 2D3PA 1HRI3 4QQPA 2PLV3 3VBFC 1S0JA 1MZ5A 3EHKA 4FOYA 3BB6A 4QPGB 2BFUL 3LAGA 4HK9A 3VBFA 2QFEA 1CAUA 1ULFA 1YIFA 4FQ4A 4YW2A 4JGZC 2QUOA 4B4PA 4GMP0 1H8VA 4CP2A 3MIFA 3FE5A 3VBRC 1TMF3 3ZYJB 4COZA 1VLNA 1S0FA 3WCRA 4JRAA 2KXLA 1SLCA 4CDQA 5GZCA 1UPSA 4BZ4A 4XQDA 2A3YA 1D0HA 1G7YA 3KLSA 4JGYC 3VZKA 2RS53 4M3CE 3QLQA 3ZXEA 4DY5A 5GLZA 3ALQA 2ARXA 1G9BA 3HWJA 4GWMA 4JQRA 4YGCA 2ZGSA 3VKOA 1H8TB 3WUDA 1PO22 1BKZA 3VKMA 3FZ3A 4RHV2 1G86A 4AFCA 1WMFA 1COV2 3E5UA 2GZWA 1G9FA 1JOJA 4E4DX 2Q1MA 1NY72 5DXDA 4UBHA 4SLIA 2UWAA 5KBFA 1QJU1 1OOPC 4KNCA 3B94A 4AHYA 2WNUB 3O7OA 1HRV3 3ZIXA 1F5JA 1CAXB 2DCKA 4IEPA 2PFWA 1DG6A 5DDJ2 4FTBA 3ZSKA 2DTWA 2WNUA 1AR81 2XVKA 1CX4A 5DG2A 3O0VA 2B42B 5IK4A 3ZX7A 4HKOA 2A6VA 1BBT2 4RR3A 1S55A 3OY8A 4LR4A 3B00A 2VUAA 4AI2A 2UWCA 1ASJ1 3H9AA 3BODA 5C4WB 1TMF1 1H8TA 3AFKA 5FO7B 1NCQB 3CLPA 4E4ZA 5EZWA 2Y0IA 2FZ1A 4M3CA 3ROUA 1KDMA 4BMEA 5C4WA 1OLRA 2XGXA 4YG3A 4Q4X3 1N1TA 5BNNC 3APBA 5JSRA 5F6LB 1WGPA 1YO8A 4QQHA 1FAYA 4LO6B 4QGNA 4XJ9A 1XU1A 2R30A 2XB6C 4IV3A 4XFCA 5A32A 4PDWC 2AYHA 4M00A 2ERFA 2IFRA 3RMXA 5KXBA 2BYVE 3AB0A 3PLQA 5LEKA 1D4VB 4QD2A 4MXWB 4PDWA 3VN4A 1H9WA 4UXAA 2Q30A 1HDKA 3RQ0A 4DINB 5JZGB 4RFT0 2ET7A 2QNKA 5CVRA 4OHVA 4NR1A 4Y1VA 1VBD3 5ACA2 2DTYA 3JQXA 4BLIA 4LBQB 5IK8A 4OUMA 5A3LA 3GZTB 3WOGA 2Z69A 1RINA 3AP7A 4HPKA 2WLPA 2HEWF 3URFA 2KA3A 3RPQA 2QKDA 3M1HA 2R1BA 1VBB1 1ZZ8A 3TNQA 2EVXA 3SH3A 4AVBA 3WXPA 2VG9A 4YZ2A 5AFEA 1ZRFA 4WZFA 3H50A 1EAH1 4FPGA 2BTVC 3TOJA 3WG4A 4XJ8A 3WHUA 5BXXA 1ENSA 3JUUA 5GLWA 3KMHA 4RSUA 4FQZA 4AVTA 1H4HA 5J3UA 3DV8A 3RJRA 1RUE1 3HBZA 2CGNA 2YHJA 1NLSA 1Q8PA 4NOTA 2ZPXA 3J8F3 5I0TA 5ACA3 3LB9A 3VBOB 2QJVA 4XJWA 4L92A 4KH9A 4N53C 1W0OA 5GM0A 1OA4A 1TME3 2Z2SB 4N53A 2P17A 3VBOA 1QNYA 4K20A 3VBSC 3R0RA 2XBO2 1LECA 1CAXA 2OIIA 1HQWA 4K9SA 3WR0A 2VMIA 2Q4SA 4IL7A 4HPKB 2YV8A 4KL1A 5K0UA 1I5ZA 4RGAA 4YVWB 2VUJA 1XYOA 3K51A 1BEV1 2ZGNA 4GULA 5ABJB 1OSGA 3PVOA 1LULA 5CAZA 2XWBB 3QOPA 3I54A 3ILNA 4DY3A 5FLJA 5EWSA 4A2UA 1AR91 1G8WA 4YG6A 4BOWA 3UKVA 1Q56A 3UL2A 1HRI2 4XF3A 1V6LA 4YM1A 3POWA 3OTFA 3Q9OA 1QOSA 1VALA 2A3XA 5CBLA 1Q8VA 3ZXAC 4CDWA 4IV3C 2ZGKA 4XETA 4P9JA 3ZFGB 3AZZA 4XILA 3TBDA 3NWKA 4XPVA 1QJY2 1MZ6A 3B01A 2E7QA 4CDQC 5H9QA 1S0IA 2WT2A 3VDDA 4L2NA 4XTMA 3UJOA 1AL21 1GSLA 1Z78A 4Y4YA 5DUUA 3MYXA 2WZR1 3VZMA 3JBG3 3ILRA 2VW2A 3SH5A 3MLJA 3J4UH 1NLRA 4PIZA 4YW5A 3M3EA 2D43A 1LOBA 4BPZA 2VMGA 3AJYA 3TN92 4FOVA 4CRQA 4ZU4A 3I4IA 3ZXGA 3H8UA 4AGVA 4XE9A 2EXJA 1YNAA 2D3RA 4AEKA 1PHMA 2C9AA 2C0ZA 3AM2A 4XQWA 4HKWA 2R062 5CFCC 1CONA 2CGOA 4YW1A 1O5UA 2PTMA 4DS0A 4S2GA 3WT3A 1UKGA 2DFCA 4IXLA 4COWA 1OOPA 1ZX5A 4ASMB 1QWRA 2NMOA 1CAVB 2IC1A 5IT6A 2ZMNA 4PJYA 1RMU1 2R041 4AVSA 2BFUS 2WSVA 2BBVA 1GQGA 4JGZB 1QXPA 2RMU3 1DHKB 1GZWA 2DVGA 1HV1A 1FV3A 2IZWA 5D8AA 4AQTA 5KXEA 1AYN2 1QJZA 2LALA 2RMU1 4XHBA 1EPWA 3E6BA 5D8AC 1NE4A 4YW3A 5T5OA 2WA3A 1W6QA 2B7YA 5D8AB 3VBOC 3U11A 1S0BA 4GKYA 4JTOA 2DUQA 1F8VA 5ACA1 1H1MA 1HLCA 2DV9A 2WSUA 4W65A 2Q5TA 1CVNA 1BVVA 3ZPYA 1MS3A 4FTEA 1W6MB 3MW4A 1AF9A 4PLNA 1NZCA 5EFUA 1ZZBA 1ZBE3 2GDFA 3PMEA 1XE7A 5HXVA 4YVSC 1PMIA 4FXGB 2R0HA 1KQRA 3MZHA 4Y22A 3OD0A 1UL9A 2B39A 1DGWA 1SLLA 5D1IA 1VRH1 1IQAA 1RJ8A 2WIIB 4NHKA 5FDBA 4LUMA 4P5HA 1EY2A 1QJU3 1LHNA 2JG8A 3QH6A 2R32A 4AGGA 1HRV1 3B3QE 5EV7A 5I0UA 1QH6A 3ASIA 1JHNA 2AENA 4YFWA 1K5MA 3EQEA 4MZUA 4ZU7A 3NKGA 5GJ6A 4LUKA 4FPCA 1AR83 3BIWE 1VBE2 2OYZA 1GYKA 4CEYB 1DYPA 3ZYPA 3VDDC 3ZXJA 1LGCA 3AKTA 3TYJA 1LJ7A 1FPN3 4LNVA 1NG0A 1QQP1 5LEJA 4AEJA 5FMOS 2WT0A 4RL7A 4GB31 2DVBA 1WCKA 1NXD1 1PK6A 1Z7S2 4Q4V3 3ZFFA 3I2DA 3WY6A 2WINB 4LLFA 5DZGA 4LHKA 2HWF3 4HN1A 4QGMA 4ZU5A 2IWGB 4YW4A 1R093 1UZZA 3VZLA 2VOKA 3LOIA 1PK6C 3NV1A 3ZFFC 2QZ3A 2ZGUA 1WW4A 5LK5A 2CYFA 2R0FA 4H14A 2I07B 4DZGA 3ZN6B 2OUHA 1PVXA 2GALA 3WQ0A 4C1XA 4RQPA 1RUF2 1DGWX 2ZTNA 1O7FA 3CL1A 1LB2A 1QHDA 2ZMLA 2JE7A 4EN8B 1NCRA 1W6MA 3OYWB 1WW5A 1HQLA 5GLUA 3GBFA 2B46X 3KT1A 4AYUA 2XJVA 4DB5A 5JAXA 2R16A 1C28A 5AVPA 4Q0SA 4K7JA 3TWIA 3WD5A 3KZ4C 3M2MA 3MIEA 3WDUA 2WFF2 1Q8SA 4XMIA 4ISRA 2ZGOA 2E7TA 1QJU2 3CJXA 3KT7A 4X6QB 3ZXLA 5E8AA 5BNOA 1VBC2 3A0NA 5EJ3A 1R1A1 5FBZA 4W6YA 5KWRA 1CAUB 2XH6A 2GC2A 1O4ZA 4G3YC 4JCKA 3VUOA 1MS5A 2VNOA 3VBRB 2AH2A 2NLRA 1Q43A 1LOEA 4PCRA 1CQ9A 2JG9B 3AP6A 4NHLA 1RUD2 3ZYGA 5GZDA 4FP3A 3WW3A 5C9AB 3FUOA 2VOVA 2R063 4LULA 1VBE3 4WM8C 1PGW2 4J1WA 1FMD3 2UYAA 2VH9A 5JI9A 2R061 3SXWA 3WUCA 3ZFEA 3R4DB 1O3TA 2A6YA 2ZKNA 1LGNA 1DZQA 3ZDSA 2V73A 1WCDJ 4OULA 3ZFEC 3MI8A 4AQ2A 1AYM1 4XFIA 1EV13 1ZBA1 1J3RA 3RNSA 1ZBA2 2D7FA 4AFMA 4IEXA 5JMCA 4FOQA 2VQAA 2AZ5A 4YVSB 3D0SA 4YGDA 3VBSB 5I0SA 1HW5A 4GB33 2BPA2 1SCSA 2G9GA 2GH8A 3KM5A 4XJAA 5GZFA 5KHKA 1UU4A 4Y1XA 4PBPA 3R05A 4YG0A 3ZXDA 4QPIA 3L9JT 5I0RA 3LZZA 1BQPA 3G7DA 4LBMA 2UY9A 4CZSA 2XBO3 2DF7A 5C33A 1RVF3 2TUNA 3OBTA 3RYPA 1QMJA 5BPXA 3ES1A 2ZA9A 3MICA 4COVA 1VR3A 1RUF3 4QM9A 4JDOA 3JB8A 1DQ1A 3SMHA 4FTSA 2XJUA 3AZXA 2YPJA 1BBT3 4D7SA 1AX1A 2VVFA 1B35A 3FMGA 4AXOA 1FT9A 1CGPA 3LA2A 1AYN1 2X8KA 1C4RA 2GN3A 1SDWA 3AXEA 1LEMA 1DQ2A 4XF0A 3USUA 3VKNA 4CP1A 2NQYA 5GLVA 1Y7BA 3O12A 3J9SA 3LWCA 1V9U2 2R072 4X6RB 1WA4A 1FOD3 1IS5A 1EYBA 1OA2A 3I8TA 1EPZA 4MGKE 3OBRA 4LT5A 1DGLA 1HIXA 2PHUA 1J58A 4IV1A 3WVJA 3UJQA 1DFQA 2D93A 1ZZ6A 3B7MA 1DGRN 1IHMA 5KXDA 3MLLA 3H3UA 1LCLA 5DUWA 4R8HA 1UIKA 4G9SB 3M3IA 5JWPA 1KJLA 4HKLA 1EAH2 2B8MA 1BEV2 4UW5A 4K40A 2LUWA 5BUVA 1RUJ3 2H0BA 3E97A 4N9IA 3IDEA 3SCHA 2BUKA 3RYRA 1W6OA 1CESA 4Q4W2 4XIOA 1FXZA 4P9GA 5CFDB 1GZ9A 3AP9A 1AX2A 4C0HA 3IM0A 2WS92 1LESA 1HRI1 2RS32 4N9HA 1V9U3 2R073 2TNFA 4Q26A 5H9PA 1N3OA 4BA6A 1YXWA 2JG9C 1RMU3 1QJX1 2R043 2BGCA 2D5HA 2NPIA 5FPXA 2XBO1 2MNGA 2PHXA 2WKKA 1WW7A 3AYDA 1U5XA 5T5PA 1AR73 1FOD1 2MEV3 4QQOA 2VOXA 5T50A 3WP3A 1TE1B 5E16A 3G6JB 1EV12 2ZX0A 1O3RA 1AYN3 1UCXA 1Y9QA 4LBJA 1MR5A 5JPNB 3USUB 1O4YA 1VB4A 5FFOC 3SLIA 3WQ7A 5KHJA 2ZJCA 1N1YA 5I8TA 4XEZA 1QQP3 3D0JA 4LLOA 3SH4A 1TNFA 2Y38A 1O3QA 1BJQA 1RUF1 4LBOA 2DCTA 2IXKA 4BE3A 4LBQD 1BCXA 2E9QA 3DPRB 5IK7A 1OOPB 2SLIA 3VKLA 4N7UA 3ZVXA 1RUG1 1SLAA 2DCJA 1U5YA 1PGW1 2RE9A 5J37A 1LGBA 4AFAA 4H7MA 4R52A 3AYEA 3GHMA 4EWDA 1KRIA 1VBD2 4OFGA 3NL1A 3S6PA 4YSFA 4XBQA 1ND2A 1VAVA 4AVVA 1H2KA 4ITCA 1RMU2 2R042 2DVFA 2XJRA 3J26N 4OI4A 4WM7B 1NYWA 3T1MA 1VAKA 3T2TA 1UAIA 4BMBA 1QJY3 4YZ1A 2D40A 4K21A 4PIYA 1N3QA 5AC93 2LTNA 3ZFGA 4EWEA 3ES4A 2CWSA 4XF1A 1RUOA 1RUH2 3RZZA 3TB0A 3N36A 5JDBA 2PHRA 4I0WB 4Q4Y3 2H6BA 4AWDA 1S0CA 1R091 5SV8A 1I3HA 1YHFA 2BVVA 2X29A 1H1IA 4COUA 3MW3A 4RHV3 1HV0A 4KU7A 4TLFA 2RS11 2WFF3 4Q8KA 1XU2A 3M70A 3BOWA 4QU2A 4NN0A 1POV1 1U12A 1LOFA 2P2KA 1JH5A 2JG8C 3WW4A 4A7KA 1ONAA 3ETQA 2GU9A 1LHWA 1VRH2 2OZJA 4WV8A 2X5IB 3S0MA 4AE2A 2A7AA 3GBWA 4FBFA 5GZGA 1IKQA 2D44A 1S0EA 3H7YA 1GFF2 5FPZA 3WINE 3CEWA 4P14A 1M4WA 1GNHA 2YY1A 4U2AA 5J36A 2WNVA 3UK9A 4B29A 1X50A 1VB2A 1AR62 5F5QA 3P3PA 4MGZE 1HX6A 1I6XA 2HWD2 2QVSB 1BEV3 3DF0A 1IPKA 1ZZCA 3GBGA 2PLV2 4R9DA 4N53B 1QDCA 1H4GA 1A8DA 5C6CA 2QCSB 4IEQA 2WJSA 2D6PA 3KGLA 3OPZA 4M0HA 1HQNA 4I0BA 2C1FA 4TWTA 2ILMA 4FPOB 1DYKA 3IN9A 5I8YA 3E5XA 4W6WA 4BHPA 4RS5B 4Q27A 1C8M2 1C8M1 3AMPA 3LSEA 1UN1A 4D3WA 4XHXA 1W2UA 1CPMA 2CNAA 1UIJA 3WLUA 1JYCA 1LR5A 4FVVA 5LK7B 4SBVA 1VBA1 2RJLA 5HBAA 3B9CA 5JOZA 2OA2A 4I2OA 4AHWA 1NA1B 5CG9A 1AR93 4KQ7A 4DOUA 2ATFA 1FPN2 3S7EA 3B9IA 2HWE1 1QJY1 3VL9A 1NE6A 1MEC2 4KWKA 2WLQA 2D3SA 4XYXA 1NA1A 3FHIB 3JQWA 5KHHA 1M06G 5JPMB 3N4MA 2EA7A 4RGGA 3SNMA 1YUDA 5J48A 5C4WC 3BPZA 4CDXB 1AX0A 4DFSA 5FOJB 4WM7C 3WX5A 4Q4X1 3UV9A 4NWWA 1CPNA 1D2SA 4CDXC 3VBRA 2HWD3 1XNDA 2ZX2A 4Y24A 4CDXA 1COV1 1REEA 5J09A 3CJIA 4HETA 4JDMA 1AYM2 4WVZA 2ZGRA 3RMYA 3ZN4A 1O4TA 3OF1A 4N43A 1ZREA 3HT1A 2VPVA 4FAGA 4KWJA 5T54A 3HD8B 2P3KA 2F4PA 1LKNA 1VBD1 2XLGA 4Y1YA 2OW4A 2DVDA 2YMZA 4IEWA 2P34A 4CEWB 4C90A 5AVAA 2CAVA 1RGSA 1AHSA 1UKRA 2B9UA 1OPMA 4GH4B 1K5MB 2A73B 4GIQA 4OHZA 4XF9A