3QACA

Structure of amaranth 11s proglobulin seed storage protein from amaranthus hypochondriacus l.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
445
structure length
372
Chain Sequence
b'QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVSVIRRTIEPHGLLLPSFTSAPELIYIEQGNGITGMMIPGCPETYQDQHQKIRHLREGDIFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSNTGNIFRGFETRLLAESFGVSEEIAQKLQAEQDDRGNIVRVEGLHTICSARLAVNVDDPSKADVYTPEAGRLTTVNSFNLPILRHLRLSAAKGVLYRNAMMAPHYNLNAHNIMYCVRGRGRIQIVNDQGQSVFDEELSRGQLVVVPQNFAIVKQAFEDGFEWVSFKTSENAMFQSLAGRTSAIRSLPIDVVSNIYQISREEAFGLKFNRPETTLFRSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11S globulin seed storage protein
publication title Structure of amaranth 11S proglobulin, a major seed storage protein from Amaranthus hypochondriacus L.
rcsb
source organism Amaranthus hypochondriacus
molecule tags Plant protein
total genus 103
structure length 372
sequence length 445
ec nomenclature
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qacA01
4AVCA 1J3PA 2XLFA 3C3VA 4Q0QA 4PIYA 4AVBA 1FT9A 2OYZA 3H9AA 1ZX5A 5C6CA 2Q4SA 3U10A 4XF4A 5I91A 4BIFA 4BYYA 1OI6A 5I8TA 4IESA 1O3SA 4HLTA 3I59B 3LOIA 4IETA 5FQ0A 3ES1A 3USSA 4BHPA 4JTOA 1QWRA 3SMHA 3O14A 5E16A 2IXHA 2O8QA 2F4PA 4XF3A 2H6BA 3OD0A 4YRDA 3CLPA 5CADA 1EY2A 3H1MA 4KL1A 3LA3A 4LUMA 3CJXA 2B9UA 1NE4A 1YFYA 3E6BA 3U0ZA 2XKPA 4WZCA 3B02A 2IXLA 4LA2A 1NZCA 4QGMA 3RYKA 3EO6A 3PVBB 2D5FA 2CAUA 5JR7B 3ETQA 3HIFA 2PFWA 2B5HA 4I09A 4QGLA 4FBFA 2H0VA 1DZRA 5KHGA 4R52A 4EWEA 1V70A 2BYVE 2PAEA 2V09A 1ZZ7A 4Z82A 5FPXA 3RDIA 5KHKA 2XL7A 5FDBA 5LEKA 4FAGA 1RC6A 3D82A 1HW5A 4GULA 4MGKE 4QXKA 3MYXA 1ZVFA 3N4MA 2D5HA 4J1XA 3H1YA 2FMYA 3FHIB 2ET1A 3ACLA 3VHRA 3IDCB 4I3PA 4BH9A 3RZZA 3WW3A 4HSLA 1G6NA 1WA4A 4MH0E 4OLLA 1CX4A 5FCCA 2D93A 2E9QA 1LKNA 4TLFA 1FXZA 4MZUA 3EJKA 3DL3A 2PAMA 4UXAA 1UPIA 1X8EA 4EWDA 3TNPB 4MV2A 2P17A 3H7YA 2BNMA 3FE5A 5EFUA 3E5QA 2CV6A 3PLQA 1ZRCA 1J3QA 5I0UA 4META 1ZREA 5CU1A 3SCHA 1CAVB 3M3IA 2ETEA 2PTMA 1YFUA 1RTVA 3ELNA 3L2HA 5BXXA 4ZU4A 2MHFA 1O3RA 1ZRDA 4HBNA 4I02A 1PM7A 5LEJA 2CAVA 5D1IA 3RYRA 3FJSA 3R6SA 5AVPA 4EV0A 4I0BA 4L2NA 2PHDA 3OTFA 4E2QA 4HN1A 3WW1A 4XF9A 4N9HA 4HN0A 1CAVA 1L3JA 1IPJA 1ZZ9A 1RGSA 1EPZA 1IPKA 3PNAA 3IWZA 4D7TA 3EHKA 4IEWA 4OFGA 3I54A 3I7DA 2D40A 1I5ZA 1RUOA 1O5LA 3NW4A 4IEPA 3OF1A 4XFHA 4H7LA 2OPKA 5JSRA 3CEWA 3OGJA 1YFXA 2KXLA 1Y3TA 2IXKA 4XEZA 3CF6E 4IEYA 1XE7A 4XFIA 4UBGA 5HI0A 3H8UA 4N9IA 1WGPA 2EA7A 2XL9A 1J59A 3SXWA 3HT1A 1UIKA 4IEXA 5E1RA 5K8SA 4KWLA 5I8YA 3KCCA 4MGYE 5T3NA 2WC2A 2FQPA 3DKWA 2CGPA 1J58A 3RPQA 3E5UA 2IXIA 5BY5A 2XKOA 3JZVA 4KU7A 5FPZA 5EZWA 1DGWA 4P9GA 5J7MA 2XLAA 3BALA 4MGZE 4AQ6A 1Q3EA 1O7FA 3BU7A 4R8HA 2B8MA 2K9ZA 2QDRA 2K0GA 3BB6A 4LLOA 3UKVA 2GC3A 2UYAA 4QGNA 4E2GA 2O1QA 4YARA 5I0SA 1CAUB 2GU9A 5I8SA 4F7ZA 4IEZA 3EQEA 4IERA 3LZZA 4HVOA 1NE6A 1H1MA 3S7IA 3KGLA 4Q0PA 4AXOA 4XFGA 3H7JA 2BNOA 2EVXA 4NVPA 1QXJA 1X7NA 4UBHA 1YUDA 3WW4A 3DV8A 1CAUA 3QOPA 1J1LA 4Q0UA 4F8AA 2Z2SB 3ES4A 5JCTA 3GBFA 1LR5A 4KWKA 4XFCA 1EYBA 3BPZA 1CAXB 1Y9QA 3CO2A 4XF0A 1PMIA 1U12A 4IEQA 1UCXA 3M70A 5I0RA 5J3UA 5FLJA 1SEFA 2UYBA 4X6RB 4KU8A 1ZRFA 4PIXA 1YLLA 2QNKA 3U11A 4K8FA 1YHFA 1GQHA 1SQ4A 4AVAA 5BPXA 1X82A 4YNIA 3LA2A 3E5XA 1CAXA 4WVZA 1NYWA 4Z07A 4ZU7A 3RYPA 2VECA 3DN7A 3KGZA 3IDBB 4MX3A 1UIJA 2EAAA 1DGRA 5JAXA 1OMIA 3RNSA 3ROUA 1DZTA 4YSFA 2HJIA 4LA3A 1ZZ8A 2N7GA 1CAWB 2VQAA 4IEVA 3H1WA 1ZZCA 2UY8A 4EROA 4Q29A 4KWJA 4XFBA 4L11A 2I45A 3D0SA 2QJVA 4YYOA 4MUVA 3OCPA 1O5UA 2BNNA 2ZKLA 2PYTA 2XLGA 4EWAA 5I0TA 4HMZA 1H1IA 2DCTA 2H6CA 3KSCA 1NXMA 2C0ZA 1VR3A 1O3QA 4PJYA 1CAWA 4HZFA 3UKNA 3IBMA 5KHIA 4I01A 3GYDA 3HT2A 4RD7A 1I6XA 3TNQA 2VPVA 3LA7A 1GQGA 1OFNA 4I0AA 1XE8A 3EBRA 1SFNA 2XHKA 1VJ2A 5KHJA 4HSJA 2MNGA 2Q1ZB 3MZHA 1LB2A 4MGIE 4FT8A 1EP0A 4QM9A 4AQ2A 3D0JA 1QY4A 3LWCA 1OD5A 4XF1A 5FLHA 4HVQA 2IXCA 4JVAA 5J48A 4LEJA 4B29A 2Z69A 3LAGA 3MDPA 3NJZA 4HVRA 3E6CC 3FFQA 2ATFA 5F1RA 3E97A 3G7DA 1X8MA 2PQQA 1LRHA 4D7SA 3I59A 3BCWA 4LULA 4CYDA 2Y0OA 1YFWA 3NVCA 3KMHA 1RUNA 1JUHA 3NL1A 2GC2A 4WBBA 4DINB 2BEOA 4XETA 4O9GA 2PA7A 2IXJA 3ZDSA 4XFFA 4LUKA 4FAHA 3H3UA 4QX5A 3MPBA 4QMAA 1XRUA 4I2OA 4ORFA 2GAUA 1Q5OA 2GC0A 4O9EA 4JV4A 5KHHA 5JSOA 5BV6A 4IEUA 1CGPA 5C8WA 1FI2A 3H3ZA 2UY9A 5I93A 3UKTA 2PAKA 4Q0SA 4QM8A 5LRRA 3SCGA 5LRSA 3H50A 4J1WA 4XFAA 4LTAA 1RL3A 3NKTA 5CVRA 3FWEA 1QXRA 1UD1A 2PHLA 2ZCWA 3S7EA 3CL1A 2BGCA 2MPFA 4X6QB 5JSPA 1ZZBA 4Q0VA 2GH2A 4E2SA 1J3RA 2ET7A 1Q43A 4JTNA 2OZ6A 2GZWA 3FX3A 1YWKA 2GC1A 5BUVA 1VP6A 1WLTA 4PIZA 2QVSB 2WFPA 2HKXA 2XGXA 3NSTA 2IC1A 5FLIA 4ZU5A 3QACA 2OA2A 3IIAA 1ZZ6A 2QCSB 1TQ5A 2Q30A 4ONUA 1ZNPA 3WW2A 3SCFA 1UW8A 3HQXA 1O4TA 1ZRRA 2Q0AA 3SHRA 3E6DA 4IEOA 5FQ0B 2OZJA 5KBFA 4A2UA 3FZ3A 3ST7A 3S0MA 1O3TA
chains in the Genus database with same CATH superfamily
5ACA3 4MADA 1OC1A 3HJRA 5CG9A 4OI0A 3C3VA 2GMEA 5KXCA 1MQTA 4PIYA 5FP4A 3HOBA 1GZ9A 4YW1A 4C1XA 2ZMNA 1H6YA 3SH3A 3BTYA 1FT9A 4XHBA 2OYZA 5A3LA 2ZGKA 3H9AA 3O1PA 1UX7A 2HWF3 5C6CA 4M4PA 3ZYIB 4AFDA 4XF4A 2JG9A 2DUOA 4FPEA 5LA1A 5GZDA 4ASKA 1NQDA 2WIIB 1RUE1 2ZXQA 4HLTA 2W47A 1C3HA 3I59B 5DUVA 3ES1A 2LS6A 2RJLA 3VZLA 4CXWA 5JXJA 3O14A 4CXYA 2O8QA 2F4PA 3OBZA 1LTEA 4H7MA 4XF3A 3VBUA 5A1AA 4COYA 4Y26A 4XAAA 2H6BA 3DPRB 3BVCA 3CLPA 1LEMA 2WUHA 3KT7A 3VBHC 1Y9GA 4AFBA 1RUD1 1W90A 5HBAA 5GZFA 4JRAA 3S5AA 1PGL2 3THPA 3E6BA 2AUYA 2XKPA 3M3EA 5FYMA 3LFMA 4LA2A 1G9BA 2A73B 1QGLA 3W58A 5CNAA 3AMPA 4GXLA 4AHYA 4CP1A 3GCXA 3EO6A 4CEWC 4K7JA 1T6GC 3PVBB 2W52A 5FY1A 5HXMA 3WV6A 3NJYA 2ZAHA 4E27A 3ETQA 5C5UA 4YG0A 3JD73 4AI2A 5C9AC 4N7UA 5CEHA 2YPJA 3JCIA 3DPRA 3WF3A 2AH2A 1UMZA 3ITQA 1HJGA 1W9FA 3NAPB 1V70A 2BYVE 2JWPA 1WMEA 5T5JA 3V65A 2D6PA 2WWUA 3LPFA 3S6PA 1ZA7A 1BEV1 1PIV1 3J7NA 2XL7A 2DCKA 1F5JA 1PK6C 1UY4A 5IAXA 1CQ9A 4NWWA 5LEKA 1MZ6A 3MEPA 2QE3A 3D82A 4MGKE 4L97A 3AKPA 4MHRA 2KA3A 3ZN4A 3WG4A 1AR73 3ME2A 1KFUL 2D5HA 5EJ3A 5F5CA 4BXFA 2VUCA 1OPOA 4OI1A 1UZYA 1UYZA 4AI1A 4Q1RA 2WL1A 5IFTA 1W0PA 2DCYA 3QCWA 3AL5A 2HYKA 4MHUA 3WW3A 5E8AA 5JUVA 3NAPA 4BB3A 1S2EA 3GBGA 4HETA 1YQ8A 1WMFA 3CJIC 5LA0A 1G86A 4CSWA 3C7HA 1RUG2 2QQPA 2Y6JA 3PMEA 3B94A 4OLLA 1N1TA 3DEMA 1W3XA 2E9QA 1Q56A 3FBMA 1AYN2 5D21A 3HWJA 4K20A 4HKWA 1MVQA 3LIHA 1C8M3 2PHTA 4WZFA 2FZ2A 5DG1A 2O8OA 3RZMA 4NJ4A 3VKLA 4D6SA 1QJX3 3IT8A 2C5DA 2VTFA 1W6MB 5H9QA 1HKDA 5CIRA 3BIEA 1TZOA 4JGZC 3J7MA 2RS11 3WDTA 3B3QE 2VMGA 1OSGA 1UOJA 3IIIA 2VVEA 2EALA 3RWKX 4CPBD 4OUSA 4P5YA 1JU4A 3K77A 1V0AA 1X9TA 2RMU2 4IUGA 4META 5DABA 5GJ6A 3O0XA 3MICA 4C1WA 3WX5A 3AMHA 4LKEA 1WCKA 5FREA 4CUAA 2GP5A 3WNKA 2PTMA 1WCUA 2A7AA 2ZMLA 3GXUA 1AX2A 2R043 1YFUA 3RI9A 1YRZA 4ZZ5A 4P14A 1MEC1 2P3KA 1TVGA 5BXXA 1AXKA 1W6MA 5C33A 1LAJA 3E1F1 4AL9A 5A7NA 5LEJA 2CAVA 2JXAA 1QJU2 3ATGA 1SLAA 2JE7A 3RYRA 1PO23 5HXVA 3R6SA 2ZGRA 4I0BA 4L2NA 5L73A 3MLLA 1HRI2 4A45A 3ZKUA 4XF9A 2W3JA 4N9HA 1LCLA 3PUAA 1RXFA 1WLCA 5JOYA 4NIAA 3JXSA 3WF2A 1EPZA 3K48A 4QKNA 4D7TA 2YC2A 4IEWA 2R32A 1JI6A 3O5SA 3GCWA 4DY5A 5AVAA 3VBHB 1R081 5ABJB 1S0FA 2D40A 2ZGMA 4Y33A 3MIDA 3GHMA 4ZHNA 4QX1A 5T55A 3RMXA 2YMZA 2A3YA 1QNYA 2CWMA 5JSRA 3CEWA 3OGGA 1GP5A 1REFA 1W0OA 1YFXA 2QQMA 2BWAA 1SG3A 4RYDA 3VBSB 2IXKA 4L92A 2ZA9A 4XEZA 1VRH2 2HH9A 3CF6E 3DCQA 1H9WA 4P02B 5FZOB 2JDHA 1JZ3A 1OLRA 5HI0A 1A6CA 4N9IA 1WGPA 2EA7A 4NWVA 3VKMA 5BNOC 3BI3A 1J59A 3N36A 2YB7A 5CFCB 1OF4A 1UIKA 2GNBA 2HWE2 3PJQA 4CDXC 3H8OA 1HB3A 3VBHA 4KWLA 2WT2A 4LORA 4URTA 5ABJA 3KQRA 2C6SA 3LPGA 4BU2A 2WC2A 2FQPA 2Q5TA 3SITA 5JOWA 2CGPA 2IZWA 2GN7A 2RM21 3AKQA 3OY8B 4M3CA 3RPQA 3POJA 5F37A 2EAKA 2TUNA 3VBSA 4P9GA 4INDA 3KV4A 4UFKA 5FZOA 3VKNA 5K0UC 3AYEA 1W28A 2B39A 3BIWE 4Y20B 2VJXA 4AAPA 3ZXLA 4AI8A 2A6XA 5C9AA 1I1EA 1H4GA 2LALA 5CFCA 2B8MA 4BQWA 3KB5A 4JHZA 3VDAA 4C0HA 4E2GA 5I0SA 2F17A 2O1QA 1L7RA 1LGBA 1QNWA 4W50A 4F7ZA 3NMBA 3WNMA 1WD3A 1BK1A 1OH3A 1ULDA 1YO8A 3A7QA 2PMWB 1Q8VA 4UI9L 1UQXA 4SBVA 3TN92 3OY8A 3LZZA 1O4ZA 1W6NB 4ET7A 3HPNA 3LSDA 5FPUA 3KQ4B 2G4IA 3GHNA 4Q0PA 1VRBA 2HWD3 3KVBA 2WO2A 5HCFA 4Y20A 1TME1 4ES9A 4Q4W1 1W9SA 2ID4A 4JGZB 2XDVA 4LHNA 4UFLA 3WW4A 2YPDA 1EV11 3PL0A 3K51A 4ZS3A 4RQPC 4RHV1 1AF9A 2Z2SB 4UFJA 4E8DA 3WP3A 2VZ1A 2JIJA 1W3VA 1AL0G 3ES4A 5JCTA 3GBFA 5LB6A 2WS93 4KWKA 4XBLA 1GP4A 2VTXJ 1HQNA 3P3NA 2YROA 3PJYA 3ENRA 4AEMA 4AEDB 1RUE3 1Y9QA 5FKCA 1W6NA 3NJVA 1K12A 4FP3A 5GZGA 4CTEA 5CKNA 4MO3M 4IEQA 4Q4Y1 4GB32 4EYUA 3RZKA 4UT5A 1QEXA 5H9RA 2ADDA 3POWA 3I3BA 3IZOA 5J3UA 1H8VA 4JGZA 4YGEA 4X6RB 2R063 2RR12 1I9RA 3UETA 1KGYA 1PZ9A 3KCYA 5FMDA 4PIXA 1IHMA 1WZXA 5IYYA 1TEIA 3D8CA 2JB8A 1LECA 3KCXA 4K8FA 1SQ4A 1RUF2 2WT1A 2J1SA 4AVAA 1X82A 1SACA 3DECA 4AEDA 4WVZA 1IOAA 2AZ5A 4JRLA 3QH7A 2VECA 4QQLA 2HWB1 1O8SA 3DN7A 1S2BA 2V73A 2WYFA 2X05A 1FV2A 4ZPIA 1EAH1 2XJTA 5FY0A 3WSOA 2WWSA 5FYIA 3RVHA 3T3YA 5B4XA 3ZYGA 3EXUA 3T2OA 2EAAA 5FUIA 1DGRA 5FZFA 4EQVA 5LK5A 1OMIA 4UF0B 4GIQA 1PVC2 3J8F1 1DZTA 3DYMA 3HVDA 5SV5A 3AYDA 4LA3A 3CZJA 1DLLA 3RFRA 4FTEA 4ZXEA 2CGOA 1BEV3 2JKXA 3W59A 4EROA 3VD5A 1DFQA 4Q29A 3LB9A 4RN5A 2ZGPA 4L11A 2JE9A 1POQA 2W91A 4XMIA 2CGNA 5C3OA 2QJVA 2WBKA 3OCPA 3WUDA 5LWBA 1AHSA 3WF4A 3OD4A 1WW7A 1XYNA 1OVSA 3D4KA 4FP2A 4XDQA 3SISA 2D3RA 1CZTA 3UV9A 1HJFA 1PMJX 1P8JA 1MVEA 3VDCA 2AYHA 1ODNA 2VM9A 3KSCA 4GWNA 4UF0A 1VR3A 4XILA 5C3PA 5BNPC 4IE7A 1O3QA 3FLRA 5IW0A 3IPVB 2WNUC 1XNTA 4LPLA 4NUBA 3JU9A 3WDVA 1Y4WA 1V6MA 2WNEA 2X10A 3MIBA 5J09A 4CDWC 4CDUC 1KD7A 2ZABA 1QJY1 3GYDA 2DVFA 4LHKA 1FOD1 5LCWL 1VBD1 3TNQA 3OUIA 4ARYA 4EN7B 2VPVA 3LA7A 1OFNA 1H4HA 3ZFEC 1VMHA 3EBRA 3B93A 2XHKA 5FZMA 4CDXA 1VJ2A 1EPWA 3AVRA 4LBKA 1G9FA 2MNGA 3J26N 1BQPA 1C1FA 3POFA 2OX0A 1IKQA 3JBG2 1SFPA 4FVVA 2VBBA 4A6OA 3OPZA 4H55A 1COV1 1AL22 2WAOA 4QM9A 2R071 2BOIA 3IPVA 3OUJA 1OD3A 2Z4FA 4YW4A 1UU5A 2QZ3A 4M4RA 4XAEA 2VOVA 3AZVA 4NROA 4OHXA 4HVQA 3W20A 3LE0A 1ASJ1 5K0UA 5IT6A 3QH6A 2BZDA 5A7SA 4A44A 4CUBA 2Z69A 4DQAA 1C57A 2W0XA 1APNA 2WT0A 2X5IC 4FOWA 3T1MA 1YNAA 2XUEA 1AX0A 1V9U3 4YGCA 2BFUL 3E97A 3I49A 1JTZX 2OXBA 3G7DA 2GNTA 4NO4A 2BPA2 5CAZA 3B9IA 3Q9OA 3S57A 2BJSA 3WG3A 4D7SA 2YBPA 4B4PA 2VUAA 3D6EA 2RS51 1U5ZA 1SLIA 2WQZC 1RUJ2 1MZ5A 2Y0OA 2Y6KA 3M3OA 3NVCA 4XXPA 2J1AA 1JUHA 1QQP3 2GC2A 1VAMA 2WR9A 2BEOA 1U0AA 3NO8A 4ES8A 4GWJA 2OS2A 3KF5A 1QDOA 5FFOC 4XFFA 2X29A 4LUKA 4PBOA 3SLIA 5FJKA 4Q4X1 3TRSB 5J36A 1SBFA 2ZGQA 1E57A 3H3UA 5ACA1 1UXZA 1D0HA 1GNHA 3K46A 3LOBA 4QMAA 3N7MA 2LROA 3IN9A 5IK4A 5IK5A 3MIHA 3JB4C 2ARBA 2D6NA 2GAUA 4MGTA 1UZWA 2GC0A 4LHLA 1HX6A 1UZVA 4E9KA 2YGMA 3MIGA 5IJRA 3LF7A 5KHHA 5FTTC 2HWF1 4IEUA 2R0HA 5EYXA 5FYCA 4R4XA 1CGPA 2WQ4A 1FI2A 1U5XA 2QQIA 5KXEA 4PI2A 3UKTA 1VAKA 2GDFA 2AEYA 1FAYA 2P3JA 4ITCA 3P1IA 5LRSA 3ZPYA 2MEV2 4D6QA 5FYVA 4K6BA 3AZXA 4LKFA 3TEXA 4YW6A 1JUIA 5IVJA 4YZ3A 2EICA 1REDA 4GH4B 1XB9A 5J96B 3W5NA 1F9KA 3FWEA 5FWEA 2WJSA 4YW3A 5AC93 1IG3A 4Z82A 1LOCA 4IGQA 2PHLA 3ILRA 3CL1A 3WDUA 2RM23 5T52A 2QQNA 4CP2A 3V0AB 1L7QA 5FMCA 3TEYA 3QBQA 2FCTA 3VHPA 2OQ6A 3RGBA 2KM2A 4JTNA 2GZWA 2QTWB 3MW4A 3AP4A 3OB8A 5K4LA 3WQBA 3O1VA 1WLTA 2XH6A 2I07B 3EB7A 4H14A 3ZFGC 5FMOL 5IVYA 3WCSA 5DAQA 5FY9A 2QVSB 2HKXA 4AQSA 2DV9A 2RV9A 4GH4A 2Y38A 2WNUB 1SDDB 1H8TB 5FLIA 4FQZA 1WMXA 2VMIA 4OHVA 5T5PA 1UWWA 5FMOS 1FMD2 1W9TA 3IIAA 2A75A 2WDBA 3V0AA 3WP6A 1TQ5A 3HNMA 1RHI2 1RUC1 4YG3A 1O59A 1W06A 2FDIA 2A6WA 3AMNA 1TME3 2EXIA 1TMF1 4RGAA 5FWJA 4P08A 4Q4W3 1ENXA 3ZN5A 1QJZA 2BBAA 4O7XA 3LCPA 5KBFA 1AR71 3ST7A 3PMSA 5IK8A 4N53B 1O3TA 1SCSA 4RHV3 2WNUA 2CY6A 2HBTA 1H8TA 2CYFA 4LBOA 2XLFA 1LENA 2JX9A 5IVFA 1YQ6A 1F4HA 4HANA 5F5IA 4AVBA 4CDUA 4IV1B 2CHHA 4OZXA 2XUMA 4IXLA 1UX6A 3RMYA 4BQXA 1A8MA 1Z0HA 4JC1A 1NLQA 3U78A 1TE1B 3CBNA 3MW3A 4XJUA 4BISA 4LO6B 1US2A 3ZDVA 4FFIA 4BIFA 5C3QA 2FDFA 4LBQD 3TBDA 1JZ6A 2JECA 1HRV3 1AXYA 2XJUA 4IESA 5FY5A 2DWRA 2O14A 5E6HA 4AFAA 3SMHA 1ULCA 5E16A 4LJHA 2IXHA 1C28A 4N53A 1WBFA 1YCIA 4HL0A 3HMYA 3SNMA 1JYVA 2RS32 1EUTA 2W08A 4IV1A 4XBNA 1JOBA 3OD0A 2Y6LA 1E5HA 4LBMA 4YRDA 5CADA 4DXTA 2DVGA 3H1MA 5F5QA 5DMYA 3CJXA 2VC9A 2B9UA 1NE4A 4ISRA 3ZYJB 5F32A 1ZBA2 1VE0A 3DUIA 3GJAA 1Z7S2 3O0WA 1NZCA 2B42B 2RVAA 5L9BA 3T1LA 4OYUA 1QOOA 1BJQA 4Y24A 1D4M1 5FPAA 3A21A 4LK7A 5HPOA 1PNFA 4BQ2A 2VH9A 1VMJA 4QGLA 2B5HA 2G9FA 2H0VA 4KG0A 3WP5A 4ASMB 4KQ7A 1XNBA 3R0RA 4EWEA 4LBLA 3W9AA 2XBO3 4EN0A 1DQ6A 3OGVA 4MLOA 1LU1A 1NCRB 3MIFA 2VBDA 2FCUA 3V64A 5A70A 4BXSV 3G6JB 3N3HA 1HN0A 4WVWA 3THDA 3LEKA 1XNDA 5FPBA 1R1A1 3PDQA 4J1XA 4PT6A 3UT0A 1MZFA 5FP8A 3FHIB 2QQKA 5DDJ3 3BTXA 5BNNC 2WYSA 1YQ5A 2W87A 4YG6A 1F35A 4W6YA 4KBBA 4BH9A 1LOFC 1FOD3 1X33A 2PHUA 5A80A 4XHXA 4MH0E 1ULPA 3KD4A 1NCRA 4NRPA 3LGRA 4KMQA 3OGSA 4QQPA 1CX4A 3T4VA 1C8M2 4LLFA 4IGPA 3AYCA 5C3SA 2JDAA 4TLFA 1YQCA 1FXZA 1VBA2 1QJX2 3NJXA 5J37A 1ENSA 2PAMA 2E51A 2J1VA 1X8EA 2V4VA 4GJZA 4PCRA 2Q1MA 2R073 3MIEA 2P17A 3MFAA 4DY3A 2BNMA 1UKRA 3VB9A 3BOWA 3R4UA 3OBRA 1ASJ3 1F4AA 4LQRA 4LO5B 3SEEA 3E5QA 3PLQA 5FZCA 3IB3A 1UOBA 4Y1UA 3WCRA 3ZFGA 4QHOA 5I0UA 2R042 5ANNA 4K3UA 1MR5A 2G1MA 4AGVA 1W2TA 4Y5SA 1CAVB 4CDQC 3RZJA 2P2KA 1AYM2 1V6JA 2L9LA 3I3QA 4TTGA 3WQ7A 3ELNA 3L2HA 1C1LA 2JD4A 1Q8QA 4A3XA 4GD4A 2WZR2 4R9CA 4KNCA 1NT0A 2ILMA 3IDAA 1JYWA 3MFCA 2W39A 1VBC3 2JG9B 4YVSB 5GLVA 3MO4A 4K9SA 4QKFA 1AR82 4PBPA 5D1IA 2C9AA 3I2IA 4P9IA 3VD9A 4HXCA 3FJSA 1OURA 1JOJA 1GYKA 3AJYA 5FXXA 2J1RA 1UU4A 3BN6A 5CFDC 2PHDA 4XJZA 4M3CF 2HWD1 2ZEZA 3N9PA 3VV1A 4E2QA 3KT1A 2WZ8A 2VZOA 3VBUB 1CAVA 1BVP1 2J7MA 4HKLA 4EZHA 2Y60A 1KRIA 1H2MA 1LU2A 4RR3C 1IPJA 1OQDA 4WM8B 1IPKA 2UWAA 1NCQC 1RMU1 1PX4A 3B5LB 4B4QA 3IWZA 2CTVA 4UFIA 2X09A 2JDYA 3RWNA 4DFSA 4PLOA 2D7FA 2PLV3 2WS91 2E33A 1RYYA 2XJQA 3PIJA 2VW2A 4YVSA 1NOVA 4IE6A 1QJEA 2OPKA 2VCCA 1BBT3 3OGJA 4R4ZA 4JAAA 2GMMA 4QDSA 1N1VA 5LASA 3GGLA 4UBGA 5DAVA 4A6SA 4BK5A 5GLZA 3H8UA 3D3AA 4XJAA 1UOGA 3TWIA 2AEZA 1RVF2 4WM8A 2R061 3LD8A 2VMEA 1FX5A 1W9WA 2WSUA 3HT1A 5LBEA 2YC4A 3TOJA 1XQNA 1W8ZA 2VQUA 2D44A 4IEXA 1F2NA 4QT6A 4Q4V2 5FUPA 5K8SA 3ACFA 2JDKA 4QPGB 2HWC2 2VQ0A 3DYPA 3A0KA 4MGYE 1XU1A 4KWUA 4QXHA 3WDWA 3WDYA 5FOBB 4QU2A 1AR62 1OKQA 4AQTA 3VDDC 3O1MA 5FYHA 4AVTA 2E7QA 4KU7A 5EZWA 5GKAC 2F4LA 3AL6A 3ASIA 2IFRA 5LBFA 4XC9A 1Y7BA 4KG8A 3O0VA 5FZGA 3MV01 4MGZE 3LKJA 3ZSKA 2R6QA 2BGOA 2WRAA 5BNNB 2NN8A 2EIDA 3KM5A 3ZO0B 2W1QA 2K9ZA 2QDRA 2K0GA 3BB6A 4LLOA 5FP9A 2UYAA 3K2OA 4I30A 4QKDA 4YARA 1CAUB 2D3PA 5ISLA 1RUC3 2V5YA 4QPGA 3SKVA 4Z1VA 2DBNA 1CPNA 1K5MB 3EQEA 4FPGA 3PUHA 4QX0A 4EN8B 1R091 1TMF3 3ACIA 1ULOA 3B9CA 3JUUA 3FLPA 5FZEA 3O1OA 2DVAA 1NKGA 1SDWA 4MXWB 3MUY1 2WA4A 4XFGA 4DMIA 3H7JA 2BNOA 4N43C 5BNNA 4AEJA 3POYA 2VU9A 3VLBB 3PU3A 1LOFA 2JKBA 5FP3A 3UYJA 2XJPA 4A7YA 3DV8A 1CAUA 4UW3A 4F8AA 4BLIA 1K5MA 1PX3A 4BM8A 1N3QA 1NY71 2VL4A 2WO3A 1N1YA 1E5IA 4OZOA 4TN7A 4IV3C 1E5RA 3BPZA 4FQ4A 1KDKA 4UW4A 1CAXB 4MG2A 4CDQB 1LHOA 1WUVA 1W6PB 2IUWA 1XNAA 1B35C 1PMIA 4AEKA 5J1XA 4MXWA 3WQ1A 1DYKA 4XCAA 1QHDA 4XQ4A 4NN0A 3VBRC 4IE5A 5I0RA 2OUJA 3N7JA 1H0BA 1RUD2 1SEFA 3THTA 4QXCA 3VZJA 1UZZA 1V6KA 3A22A 3R05A 4X8PA 2OUHA 3POIA 3CMGA 1IPSA 4FXGB 3QLQA 2QNKA 4QB1A 3TAYA 3U11A 5FO7B 1DCSA 3RJ2X 4FOQA 1IS5A 1GQHA 4QPIB 3VZNA 2QQVA 2WSVA 3I3MA 4YNIA 2BP6A 3POBA 3LA2A 2GMPA 1CAXA 1KS4A 4CDQA 1NYWA 4RR3B 4Z07A 1W6PA 4ZU7A 3APBA 3HBKA 1DQ1A 1V9U1 1NCQB 1OPMA 4JCKA 1D4M3 1US3A 2WQ8A 3Q8EA 4LE4A 4BCUA 4GALA 3NRUA 5FO9B 1UOFA 1Z78A 2V4AA 1S0DA 3KGZA 3HN1A 3ILFA 5IWFA 3ZYFA 3GDBA 4MYEA 4MX3A 3S30A 4DUXA 1CPMA 4FPOB 1BEV2 1UIJA 5FK7A 1PIV2 2ES3A 2P5BA 5FMBA 4C90A 1XE0A 4XTMA 2B45X 1DG6A 3ROUA 4YSFA 3KVAA 2HJIA 5KC6A 4QDQA 2N7GA 1OOPC 2Q1FA 3GZTB 4IEVA 3KV5A 5CFDA 1MS9A 4CRQA 1QJFA 4QPIA 1K45A 1QQP1 2J1TA 3PVOA 2R30A 1DYPA 2I45A 3D0SA 5K7PA 3ZXKA 4RR3A 4YYOA 3T4HB 1BK0A 4XDOA 1NCQA 1RUH2 4EWAA 2PYTA 2BWCA 1SCRA 2WO7A 4FTBA 4WM7C 4NHKA 4PQ9A 2XPJA 1R1A3 4I0WB 2ADEA 4WV8A 3IAQA 1FPN2 5FXZA 4Y5Z0 5FZBA 1H1IA 2J1UA 3A0NA 3C7OA 2D43A 3HNBM 1GKBA 2C26A 2DCTA 2Y6GA 3CNAA 2C0ZA 3I3EA 1OLME 1VBE2 4M3CB 4P9YA 4XIOA 3FUOA 4XZPA 4HZFA 4CEWB 2VQTA 4GWMA 3WVJA 2PN5A 4AK3A 3AXEA 1I3HA 2GNMA 4I01A 3WNPA 4JDMA 1JW6A 1W6OB 4W65A 5JVVA 5LK7B 4XBQA 2VULA 4CE8A 5C9AB 1DQ2A 2ZGLA 1C5IA 4XQWA 1XYOA 1YI9A 5KHJA 2RS12 1X50A 4D6RA 4AW7A 1VALA 5AC91 1LB2A 3RJRA 2YY1A 4MGIE 1PK6B 1VAVA 3N9MA 3U14A 4CCJA 4D3WA 5L36A 1BMV2 1EP0A 3CQOA 4XUPA 5C8CC 3D0JA 2WAAA 3VBOC 1QY4A 4CEWA 2VMHA 2NQYA 1NA1C 2VOKA 1CD3G 1ONAA 1GZWB 5CISA 1YIPA 5IVBA 1W6OA 2DBIA 1MEC2 3FMGA 3LAGA 3OBTA 3GZUC 3NJZA 4N43B 3O1SA 3L9JT 4V2WA 4XQDA 3E6CC 2SBAA 3ZMOA 5F1RA 2RR11 1POV0 1OUSA 3CJIB 2VNGA 2Y0IA 4OHWA 2RE9A 3H3LA 4LBNA 2FDGA 4DEVA 1LRHA 2ZX0A 5GLUA 2VMCA 1PK6A 2ZZQA 2WO1A 3BCWA 1UU6A 3AP7A 5DG2A 1OT5A 5DQ0A 4FO9A 4GMP3 1EUUA 4WVMB 4CCCA 4CYDA 4BMBA 1H2LA 1GZTA 3W5MA 3USUB 1YJKA 2VCMA 4P9WA 3N7KA 3WR0A 5FKBA 3PVEA 1GZWA 3J7LA 2D6LX 2WFF2 3NL1A 4DINB 2XMLA 4LO4B 4DS0A 4LT5A 4QX8A 5FY7A 2PA7A 4N43A 5DZEA 2QUOA 3ZDSA 1R082 3MGUA 1H9PA 1RMU3 3KF3A 4DXSA 1S4CA 4FAHA 3BPSA 1ZRIA 3U4SA 4ISQA 3CJIA 4BWOA 3MPBA 3VZKA 1AR91 4YW7A 4QB6A 1D0GA 4NAMA 1Q5OA 4JV4A 4PF5A 4AZZA 2YUEA 4WVMA 4LOSA 4NE9A 5BV6A 1OF3A 5DXDA 3USUA 4AR2A 1MS4A 3WG2A 5K9YA 5LA9A 2ZZJA 2BQPA 2UY9A 5DAWA 1SBDA 1DHKB 3AZWA 4YW2A 3U75A 2CDOA 5I93A 1WA6X 3I4IA 1RITA 3VBRA 1HRV1 1V6OA 1RUI1 2R16A 3H50A 2IFWA 3U37A 3ZSEA 4WVVA 2WLPA 3C8XA 2VCAA 3T08A 1ACCA 2EXJA 3SH4A 2DFBA 2HLEA 2RM22 1OOPB 4R9DA 2DTYA 1PGW1 4N8MA 4XURA 1GNYA 3FBYA 1UD1A 3S7EA 4I3GA 2BGCA 2MPFA 3U4XA 1TNRA 5A7OA 2VTXA 4X6QB 4ATEA 2JJ6A 4QX7A 4OI4A 4P9XA 5A1FA 5JXHA 1AYN3 4IL7A 1ZZBA 2Y34A 3M2MA 4YM0A 3MLJA 3PURA 2GH2A 1OH4A 2W1WA 2VW1A 1UY2A 4UWDA 1J3RA 3KLSA 2AACA 1Q43A 1YEWA 2VZRA 4ZXKA 1QF3A 3K4DA 1DQ4A 3JBG1 2G19A 2D6KA 3S5QA 4QPWA 4BIOA 3U07A 4L0PA 1OOPA 3DGTA 3DXTA 4XMAA 1JODA 3NNJA 5F6KA 4NPLA 5FZIA 1R093 2RMU3 2VW0A 3KT4A 4ZONA 5EJ1B 3RI8A 1ZZ6A 3ZYHA 5JMCA 2XBO1 5BNOB 2VNVA 4B7EA 5F3GA 4ONUA 4Q4W2 1K42A 3CIHA 3R4SA 5LA2A 3SCFA 4LHSA 4WM7A 4CDXB 1ZRRA 2ZS6B 1EV12 4EJRA 5JPMB 3SHRA 1DGLA 3E6DA 5FJHA 4RHV2 2DUQA 1U5IA 1NG0A 2DYCA 5FQ0B 4CCNA 3V0BB 4PLMA 4Q8LA 4YZ4A 3S0MA 5F7UA 2JG8C 2W68A 3JQXA 5DDJ1 4AVCA 4Y1YA 4BPZA 1CONA 2WA3A 2VXJA 4Q0QA 3WQ0A 5K0UB 5CKMA 1JS9A 2EXKA 1HRI3 4Q4Y2 5JI7A 5BNOA 4BZ4A 3AP6A 3MPPG 4TWTA 3OG2A 4LR4A 2ZX2A 1ND2C 5I91A 4HK9A 4BQ1A 3HQRA 2AGSA 2G9GA 2YZ4A 4IETA 5FQ0A 4RL7A 3RSJA 3USSA 4BHPA 3V0BA 4M00A 5C7GA 5AFBA 1OVPA 1UO9A 3I97A 1GNZA 1NA1A 4U2AA 1YQ2A 1XU2A 1UY0A 1LNSA 2VG9A 3N9LA 1VRH3 2BERA 4H3WA 2HWB2 4CU7A 1WLDA 1W2NA 5SV8A 4XVHA 1EAH2 1EY2A 2E32A 3MW2A 4XOGA 4LUMA 3WNXA 1IQAA 4JQTA 2EIBA 1QDCA 2YXSA 4KI5M 1XOYA 1CJPA 4RQPB 4WZCA 3U0ZA 3B02A 3J8F2 2AR6A 1JN2P 2HWE3 2HEYF 4N7IA 5A7WB 3LIGA 3P3PA 3AXDA 4DIQA 1W8TA 2ENRA 2VE1A 3K3NA 3RYKA 4AHXA 2DURA 2RG4A 1G8WA 1VLNA 1KQRA 1VMFA 2D5FA 4XUNA 4G4FA 2FDKA 2WKKA 2ZTNA 1STMA 2VOWA 1VBC1 2PFWA 4O65A 3ZKYA 3WD5A 4DB5A 4FBFA 4AHZA 3NV2A 1VIWB 3EYPA 5D8AC 4R52A 5LW9A 2PAEA 4PI0A 3N9OA 4YLZA 5L19A 3IM0A 4MGQA 2V09A 1XPWA 1IS4A 3GNEA 3OUHA 1MPXA 2Z42A 1GFF2 3FUQA 1PO12 1K5JA 4QQ2A 4RQPA 3RDIA 5FDBA 5FPXA 4QB2A 3C2UA 2VUDA 5A7WA 4FAGA 3HQUA 4NPRA 1HW5A 1MS3A 4QXKA 4MVTA 2OQ7A 4NMIA 4MOAA 4IGOA 1ZBE1 4OULA 4Q5OA 1QJY2 2BDRA 3N4MA 3TN93 1BKZA 5HCAA 1FOD2 3H1YA 2DVBA 2FMYA 1VBD2 4OHZA 2PLV1 1LESA 2ET1A 3ZM8A 1HLCA 2ARCA 3VHRA 2XB6C 3IDCB 3O7OA 3ZXEA 3TEZA 4I3PA 3RG0A 2TEPA 5A7QA 1BBT1 1HB4A 1KXGA 1G6NA 3FC0A 3NV4A 4EN9B 5JXIA 2P6CA 2XXZA 1VBB1 1COV2 4LITA 5T5OA 2D93A 3PHMA 1LKNA 2R072 2A5ZA 2D98A 4MZUA 1GICA 3DL3A 3WINE 4XTPA 5LATA 4EWDA 1ASJ2 4MV2A 5JDBA 2BOJA 4M0HA 2TBVA 2P3YA 4PLNA 1NXD1 3I2JA 5A32B 1MS0A 3I2FA 4OCTA 3I8TA 5A6ZA 3JB8A 3F95A 4QDRA 1GUIA 4TXWA 4Y4YA 4COUA 5KXBA 4RFRB 3UGHA 1G9DA 2NMNA 1QOTA 2P3IA 4YM2A 1NLSA 4M01A 3ON7A 1J3QA 2E31A 5BNPB 2YGLA 3C7FA 2RR13 2J42A 4S2HA 5CU1A 5IVCA 3CU7A 3SCHA 1KEXA 2YV8A 3VKOA 5GM0A 5F9TA 2RS52 2ZHNA 3ACHA 3M3IA 2A6VA 2TNFA 4CDWB 4CDUB 3VBFC 3K75B 1RTVA 4QX3A 1JZ5A 2Y26A 5C4WC 1AJOA 4Q27A 1A3KA 2YFZA 2MHFA 4KGGA 4CPBA 1O3RA 3ZFEB 4V2VA 3AFGA 4HBNA 4X8NA 4HK8A 1N47A 1TG7A 3U1XA 5A32A 4DNYA 5KR7A 4Q4X2 1ND2B 3BODA 1PM7A 4TSVA 1SLBA 1PMHX 5DAPA 2WN3A 1JYXA 1XSRA 5ACA2 3UJOA 1PZ8A 5DZGA 3BGAA 4MXVA 1G9AA 1S0EA 5BNPA 5FK8A 1NAEA 3OTFA 1BLZA 4UFMA 4LIVA 4HN1A 3WW1A 4BQ4A 2AENA 1PVC3 4HN0A 2XR4A 1AR93 4YGDA 5JIUA 2HWF2 2ZGNA 4UW6A 4CDWA 1ZZ9A 1ODMA 1RGSA 4TZDA 4BQ3A 2ZEWA 2CSGA 2VZSA 2OW4A 2EXHA 4Q26A 1F15A 5FYUA 2X5IB 4DRVA 3A23A 3I7DA 3ZFEA 4AGGA 1SBEA 4P9JA 2V5DA 1RUOA 1ND2A 1GZCA 1W0NA 3AZYA 5FXVA 4ATFA 4CCMA 4IEPA 2VVDA 3OF1A 2XQRA 1CR7A 4QHBA 3ZXJA 5JZGC 1RUI3 2KXLA 5A3TA 1Y3TA 2E53A 4OUEA 3ZYPA 3UGGA 5A3WA 5HV4A 1XE7A 4FFFA 3BTAA 4XFIA 3V56A 4AWDA 4NRMA 5FPVA 2VY0A 2XG3A 4B1LA 4FOVA 4AVSA 1XXNA 1MS1A 2I2SA 5DAXA 4HPKB 1RXGA 3ORJA 1ZYBA 3SXWA 4XCBA 4C8DA 4AOCA 2X5IA 5FO8B 5E1RA 4N90A 5I8YA 1GWKA 2ZAAA 5T3NA 1BZWA 2VAUA 4CXXA 2CDPA 1URXA 3DKWA 4LXLA 4E4HA 2EIGA 4COVA 3E5UA 1CZSA 2ARAA 1CN1A 2BW8A 2XKOA 3JBG3 3JD72 5FPZA 3RRDA 1DGWA 5J7MA 3MBWA 2XLAA 1AL23 4UW5A 1W8HA 2PHWA 3N9NA 1Q3EA 3AKTA 5EJZB 1GLHA 4B4RA 5A1LA 1OA2A 4XUOA 1RUC2 2DCZA 5A6QA 4HPKA 1F8VA 3AP9A 2QQLA 3AM2A 5D8AA 1LODA 1U5YA 3IMMA 2GC3A 3OEAA 4FPLA 4QGNA 3ZXGA 3BUCA 5FUNA 1LGCA 2GU9A 1TMF2 3ZR5A 1AXZA 2DFCA 3Q8AA 3ZSMA 2XQXA 1AR72 1NZIA 1W2AX 2OPWA 1I5PA 2ZGTA 4IERA 2ZX4A 1NE6A 1H1MA 4A7ZA 1RJ7A 3BU0A 3S7IA 4LO8A 2YU2A 2W1UA 5H9PA 5FZAA 5FZ0A 4K40A 4QX2A 5ERLA 1OLQA 3DPRC 4FPFA 1C4RA 1QXJA 3HAGA 4KBZA 3SH5A 3UESA 1WW5A 4YGBA 4HFSA 2HEVF 5C3RA 4YZ1A 3LFIA 1WLWA 3WXPA 2JDMA 2G9ZA 4A4AA 4TLGA 3ZFGB 3O1UA 2IVIB 1LR5A 2VZVA 4XFCA 4G3YC 1HXS1 1SLTA 5JIAA 2FMDA 4DUWA 3PUSA 1PNGA 4XF0A 1DP0A 4PF1A 4AFCA 1LOAA 2RJ2A 3ZXAC 3ZX7A 3ZIXA 4CP0A 1UCXA 2A3XA 1Q8SA 5LZ6A 3ZSJA 2FDJA 2PXJA 3DXUA 1ZRFA 2AREA 4H2AA 1IG0A 3OOXA 4RFT0 3UL2A 1YLLA 1W9YA 4BDVB 2MEV3 2VVFA 4GZ9A 5BPXA 1D4M2 3AP5A 3LEGA 4NPMA 3VD3A 2B46X 3Q8FA 1GOGA 4BLJA 4B7KA 2WZPP 3LEIA 2H0BA 2C4XA 3IMNA 4DRRA 3VZOA 2UWBA 5F3IA 1PO22 1Y43B 3OEBA 3RS6A 3KHBA 4FPKA 3C7EA 4S2FA 3AB0A 2QQJA 1JZ4A 1PGL1 3M3QA 4GMP1 5JAXA 5F8PA 3RNSA 5JMOA 3KWVA 5EHDA 1BXHA 3VHOA 1JZ7A 4NRQA 4RS5C 3AC0A 2Z5WA 4QQHA 2GP3A 5GZEA 5JLVA 1SLLA 4CP9B 4DXRA 4KWJA 1VB2A 1J84A 4D69A 3LSEA 1R1A2 4FPCA 4CCLA 2RDNA 2QQOA 4YZ5A 4HT1T 3RZGA 1WWYA 2B7YA 4PHZA 4OUMA 1ZBE3 1D2SA 3I2GA 3T2QA 4CCOA 4EE2A 1YIFA 2C24A 5JOZA 1FMD3 4GWIA 1HB2A 3TYJA 5CBLA 3FFZA 1WW6A 5EV7A 1QXPA 5FAXA 1RHI3 4OMDA 1JYTA 1JOPA 2J22A 5JZGA 2GSYA 2BU9A 5BYNA 3UKNA 3SC7X 1VBB3 5GLTA 1H30A 3IBMA 4CP9A 5KHIA 4DOUA 2FHRA 4ZKTB 3BTZA 4GKXA 3I2OA 2DU0A 4QXBA 5G05L 4GQ7A 4I0AA 3QD6A 2QQUA 2F6BA 1YXWA 4LIUA 5B4NA 1F5FA 1BHGA 4C91A 1O3SA 1IS6A 1RUG1 5C5TA 3OPWA 1V6IA 3ZYBA 4FT8A 1CX1A 4Y1XA 5FY8A 1W03A 3NWKA 1CIYA 4AQ2A 4CA9A 1B09A 1AYN1 4FFGA 1LOBA 2YDEA 4JZRA 3LWCA 4XF1A 2YHJA 4QPIC 2JDZA 2D6OX 4BMEA 2IXCA 4JVAA 3HN3A 4LEJA 4QAWA 4HVRA 2XJSA 3I2DA 1QKQA 2YC0A 3WG1A 1O6UA 1YYNA 2RS33 2ATFA 2ZHKA 3FFQA 5ABJC 1W8NA 1AZDA 2WINB 3NV1A 1YI7A 4PQQA 4XJ9A 5CYYA 1AX1A 1X8MA 2DVDA 5IAVA 1M06G 3I2KA 3LDRA 2PQQA 1GWMA 4OMCA 1ZRCA 2OIIA 3I59A 2RMU1 2VR4A 3VBSC 3AX4A 2HWD2 1ZBA3 2Y6FA 5LY1A 5FY4A 3K4AA 1LHWA 5F3CA 1Z7S3 5A7PA 2D3SA 1RMU2 1W8WA 5FV3A 1O91A 4DZGA 5JXGA 1RUNA 4WBBA 4PDWC 4XETA 2C1FA 2WLQA 5CFCC 4C0BA 3ZOIA 2PHRA 1JBCA 5A33B 3WNOA 2WS92 3PTYA 3FLTA 1QJU1 2ZKNA 5HCBA 1D7PM 4YW5A 3R4DB 1RUE2 5KC5A 1XRUA 2BBVA 3B00A 3ZXDA 4I2OA 5FPLA 4XJWA 5IATA 1HRI1 4B3NA 4Q8KA 5FBZA 3KHCA 3AVSA 5JSOA 1YC61 1UF2C 1NQJA 4FTSA 2Y6HA 3T30A 3WHUA 5C8WA 4AE2A 2R062 3H3ZA 2W95A 3B01A 1VB4A 1W8UA 1RUH1 3I2HA 5FYSA 2VD7A 4HKOA 4LOTA 1HDKA 1JU3A 2ZHMA 4Q0SA 4QM8A 5LRRA 2JDNA 4B8EA 1ND3C 5A33A 4A3ZA 1FPN1 4JKMA 4Y5TA 2W2IA 3C7GA 5HCHA 2FCVA 4LTAA 5GLWA 5HV0A 1VBE1 5CFDB 1O8PA 1RL3A 4RS5B 5CVRA 4AGRA 2QDNA 1VRH1 2W92A 2YBSA 2WZEA 5EPAA 2ZCWA 5EYYA 2Y33A 1S2KA 1UPSA 4AI9A 2YBKA 1KS5A 1G7YA 3PUIA 1IKPA 5JPNB 1VBA3 3M7AA 2QBXA 1GP6A 5T54A 4E2SA 2BGPA 2HBUA 2ZEYA 1MACA 2HWE1 4IW3A 4L99A 3FX3A 1YWKA 2GC1A 1J1TA 2LUWA 2JD9A 4L9BA 3T0AA 3WDXA 5JI9A 4EN6B 1DQ5A 1UAIA 5ANQA 3NNGA 3AMQA 1R092 2QZ2A 2R0FA 3H42B 3ZLIA 2ZGOA 1XJAA 3NSTA 1C8NA 2YYOA 4RS5A 1ALYA 2IC1A 4AEDC 4XDPA 3K4ZA 4AI0A 1BCXA 4NHXA 5FZ8A 4CU6A 1OHFA 1LJ7A 1WKYA 2Q30A 1AYM3 1ZNPA 2CNAA 2VNRA 2NZ9A 4W6WA 4DPNA 1UW8A 1O4TA 3NNLA 1LEDA 3PU8A 2Q8CA 1K3IA 2Q0AA 5A3OA 4IEOA 2E26A 1HQLA 3CDZB 2WZR3 5LBBA 5FZ7A 2K2SA 2OZJA 4FPHA 2X8KA 1NY72 1FNYA 2UURA 3M8LA 2CWSA 5FZDA 1Q8PA 2Z79A 5FZHA 1AR83 4LE3A 1UYPA 3TN91 3VDDB 4AHWA 2DCJA 2CL2A 1J3PA 2RDSA 4AG4A 4CU9A 1UKGA 3DF0A 4P9LA 5GZCA 2WWJA 1REEA 3J4UH 4NR1A 1HXS3 1KFXL 1S0IA 1W05A 1Y9MA 4FFHA 4LBQB 2WNVC 2WFF1 3EMRA 1ZX5A 3UNPA 4NHMA 3GM8A 1X9PA 2Q4SA 3U10A 2NLRA 5A3UA 1CIWA 4S2GA 4XUQA 1JMUB 4BYYA 1OI6A 5F5AA 5I8TA 3W21A 3LOIA 4JTOA 1QWRA 3VDDA 3M3CA 2GNDA 3K3OA 3THCA 4A7KA 2UWCA 5L9VA 1DU3D 1PHMA 5CKQA 1V9U2 1JZ8A 4QQOA 4GB31 4LBQA 2P1BA 4PDWB 2ZGUA 3T2PA 4GKYA 4LO7A 4KL1A 3LA3A 5T50A 4L8QA 3ETPA 2WNOA 2CU5A 1YFYA 1IZ3A 1RVF3 4ZY9A 3I3DA 4UYBA 3WLUA 1GU3A 5FZKA 1XBFA 1ULEA 4OVEA 2IXLA 4NOTA 2OKXA 3WNNA 5JR2A 4QGMA 3MF6A 4Q4V3 4RA0A 1W99A 2HWC3 5A6YA 1RUF1 4IV3B 4A41A 5IFPA 3GZAA 4NIDA 1QQP2 1GOFA 1AR63 2DU1A 2CAUA 5JR7B 4ARXA 5E88A 3VDBA 1B35B 1QH6A 3HIFA 4FXKB 1GSLA 4I09A 4IQPA 2JDPA 3ZFFC 5F3EA 1DZRA 1T2XA 4RGKA 4EZ4A 5C70A 1LOGA 4LNVA 3NV3A 3HD8B 4PDWA 4XABA 3OPTA 3OGRA 3VBRB 5KHGA 1GWLA 3NKGA 4FPYA 1ND3B 1ZZ7A 1FYUA 1RJ8A 2YFUA 1WMDA 5KHKA 2KR2A 2ZBJA 1A78A 1PVC1 2NMOA 1RC6A 2WN2A 3GJBA 3WF1A 4FPJA 1KDMA 2JDUA 4GULA 3ZXFA 3AYAA 4BE3A 1UXXX 3M4FA 3MYXA 2Q8DA 1XC6A 4IV3A 3ZYRA 5C71A 1W8FA 1ZVFA 5EWSA 2RHPA 2A6YA 1D4VB 2VOXA 5L9RA 3MLKA 4LBJA 3SEPA 1B35A 3ACLA 4JDOA 4Y1ZA 2NPIA 1OA4A 3RZZA 1A34A 2ZX3A 4HSLA 1ND3A 2DDUA 1WA4A 5AC92 3ILNA 4Y3OA 5FCCA 5H9SA 3OYWB 3WOGA 1N1SA 3GF6A 4HOOA 3UK9A 1RUG3 2VNOA 3VN4A 3EJKA 3VZMA 3J9SA 1R1ZA 2ERFA 1XNCA 1UN1A 1UPIA 2P37A 4RGGA 4UXAA 5TSWA 3TNPB 2DF7A 4HG6B 3O1RA 3RZLA 2VOTA 3H7YA 4G9SB 4M0NA 5FZ9A 4AF9A 3FE5A 3INAA 4K21A 4WM7B 3BKZA 3RQ0A 3VGIA 3DKQA 4XYXA 2A1XA 2XVGA 1POV1 2GN3A 2VZQA 2LW8A 5EFUA 4BQ5A 1KJRA 2UU8A 3KS7A 2SLIA 2BV4A 4LK6A 2CV6A 2R49A 4Z92B 4YFWA 4CZSA 2VZTA 3HBZA 3T2TA 3H8RA 1AL21 1RUD3 1MZEA 1ZREA 4BOWA 1ST8A 1DLCA 1SPPB 3VL8A 3H8XA 1OBNA 5FOJB 3OYWA 1T6BX 2A71A 2K46A 1XNKA 5F6LB 3WHTA 4OQ8A 3GZEA 2ETEA 2VUJA 1GOHA 1CESA 1S0CA 3ZPOA 1WCDJ 5G04L 2WNVB 3POSA 1TME2 2W9XA 3KZ4C 2LM3A 4QPYA 2R1DA 2E7AA 4ZU4A 3WP4A 5A3MA 1ZRDA 1LHNA 4OQ9A 2VMFA 2NM1A 1UY1A 4I02A 5F39A 5FYZA 3VD7A 1N3PA 5EXOA 1E5SA 4DUVA 3SQOA 1AR92 1W6QB 3OSDA 5AVPA 3ACGA 3ZR6A 4BQYA 4GH4C 4A2UA 4UFHA 4EV0A 1ENQA 5DN2A 1QJU3 4AYUA 1OA3A 1PIV3 2EF6A 3VKFC 3WY6A 1SPPA 3VBOB 1V6NA 1S0GA 1NA1B 1L3JA 4DXZA 1H2NA 3GBWA 1RUJ1 1CWPA 2BRTA 1N3OA 2A6ZA 3B69A 3FN9A 3N35A 4Z2AA 4J6GA 3PNAA 3AZZA 3P5BA 5DPNA 4COWA 4W8JA 3UJQA 2WNVA 3EHKA 4Q2FA 4OFGA 3UGFA 2QKDA 3I54A 5GALA 4V1PA 5KWRA 1HRV2 1RUI2 1DGWX 1UZ0A 1I5ZA 1O5LA 4FOYA 3NW4A 1RUH3 3BOPA 4J25A 1PO11 5L7OC 4JHTA 4GA9A 4H7LA 4XFHA 1W6QA 1FPN3 1J83A 1PGW2 3JQWA 2ORZA 1JHJA 1H8TC 1HIXA 1X36A 4IEYA 2ZMKA 5IUQA 5IVEA 3VBOA 1LOEA 2LTNA 5EQUA 5CA6A 2IWGB 1VBE3 2XONA 2HEWF 2KD7A 4COZA 1CVNA 2R1BA 2XVKA 3ZFFB 2XL9A 1DQ0A 1S0JA 3A4UA 2EIEA 3AKRA 3NQHA 5FXWA 3WF0A 3NNMA 1OFSA 2DTWA 2MEV1 3KCCA 4A42A 3J7HA 2JIGA 1BMV1 2XJRA 1OLMA 1V00A 4YVWC 1JZ2A 2D97A 1J58A 5DUWA 3IKWA 1OUXA 2RS13 4N53C 2IXIA 2VZPA 3N9QA 3JZVA 1WD4A 5BY5A 2ARXA 1M4WA 1WCQA 2W1SA 1XSQA 3BALA 3ZIWA 3AFKA 4AQ6A 4CUGA 4IV1C 2JB4A 2XBO2 3POEA 1O7FA 3BU7A 2YG0A 3OBAA 3ZSLA 4R8HA 3ZFFA 1UMIA 1S1AA 3UKVA 4K1YA 4D8MA 4YWAA 1MEC3 5CG8A 5I8SA 2ZACA 1RIRA 4IEZA 4F83A 3ZVXA 1BYHA 3LQCA 2C9KA 1OXCA 1RINA 4NIIA 2BFUS 1JXNA 5DDJ2 3CZUA 2VO5A 4HVOA 4KH9A 4NIGA 2XOMA 1OKOA 3NNFA 3KGLA 5C8CB 3MF9A 1FMD1 2OT7A 4CCEA 2Y64A 4AXOA 2EVXA 5DZFA 4NVPA 1RHI1 4CU8A 1X7NA 1NX9A 4UBHA 1YUDA 2ZGSA 4QWNA 5LY2A 1NUKA 4UOJA 4Z2WA 2WFF3 3KV9A 3SKJE 1W04A 1J1LA 3QOPA 4Q0UA 3WZ1A 4ZZ8A 1R083 2ORXA 2PHXA 3PUQA 3Q8BA 4URAA 5CB7A 1AVBA 4XUTA 4P00B 4CEYC 4BK4A 1EYBA 2AC1A 1HQWA 2RDRA 4LKDA 1HV1A 2IVJA 4K1ZA 3CO2A 4NIHA 1QU0A 5I0DA 1UY3A 1U12A 5C8CA 3H0OA 1AJKA 2P4EA 5FYTA 3M70A 4IDZA 2LRPA 5FZ1A 3PIGA 5T5LA 1MS5A 3O12A 4JGYC 5FZ4A 1WCSA 2VZUA 2XVLA 4KGQA 5FLJA 3VUOA 2UYBA 4GB33 4KU8A 1QOSA 4CCKA 1NCRC 3DYOA 3URFA 1D2QA 2Q8EA 1SMVA 5KXDA 4E8CA 2XJVA 1WBLA 5AFEA 1YHFA 3MI8A 2JG8B 4R9AA 4YM3A 3X29B 3FHQA 2A70A 3E5XA 5FBJA 1GMMA 4XW3A 5FZLA 3CKHA 2VMDA 3RYPA 1VBC2 2RS31 1RUF3 1PZ7A 5JWPA 1FATA 3PVNA 3VHNA 3IDBB 1LHUA 4DO0A 5EIYB 3AMMA 4CVUA 1JYNA 1ZBA1 2A3WA 3FL7A 1Z7S1 4DEQA 3MHZA 2XHNA 5L7OB 2FDHA 4GAZA 1ZZ8A 2ZPXA 1CAWB 1VPHA 5FR3A 2VQAA 2O0OA 4QD2A 4GJYA 1ULFA 3JD71 2JG8A 1ZZCA 2UY8A 2W5FA 3AK0A 3ABZA 3H1WA 4MSVA 1ZBE2 3ALQA 4NAOA 4XFBA 4CUCA 3RZHA 4Z8BA 1GQPA 3T0BA 4YZ2A 4MUVA 2PLV2 4JKLA 5IHRA 2I74A 4LMFA 5LBCA 1O5UA 2BNNA 2ZKLA 5EP9A 2XLGA 5I0TA 2PQSA 2P34A 4JX0A 4AVVA 1S55A 1BBT2 1W39A 1ZA4A 1G9CA 1AUYA 1O4YA 4HMZA 3OJBA 4NHLA 1VBB2 3GALA 2H6CA 3VL9A 1NXMA 5L7OA 1MS8A 2BTVC 4YVWB 4HONA 1EV13 1CZVA 4PJYA 2RJKA 1CAWA 5DUXA 3MV11 1MQTC 3D5OA 1WW4A 3HT2A 5F2WA 1DF0A 4S2DA 1C5HA 4RD7A 1I6XA 1H6XA 3IAPA 1IS3A 3L2YA 2JE8A 3F2ZA 2FD8A 2JICA 4UAPA 1GQGA 5D8AB 1XE8A 2R7EB 1SFNA 4QKBA 4SLIA 4OI2A 4W6XA 4AFMA 4Q4Y3 2JG9C 1DGRN 1W2UA 1KJLA 1CJDA 4HSJA 4YVSC 1FV3A 2Q1ZB 5M0TA 3MZHA 4XACA 4YPJA 1F31A 1HN1A 1Q8OA 1POV3 2WABA 4IE0A 4MGSA 1C8M1 4YVWA 1HB1A 3MUZ1 4ASLA 3WUCA 3B7MA 4D7YA 1OQ1A 2D6MA 5FRAA 1QIQA 3VBUC 1VBA1 1QJX1 1TNFA 2B4KA 1OD5A 2VXRA 5FLHA 5FP7A 1IGOA 3HNYM 2E7TA 5J48A 1QMJA 4WM8C 1LULA 3VD4A 4B29A 2X53S 3ZMNA 3MDPA 3T0DA 5JOXA 1LHVA 3N7LA 2HYXA 3HR9A 3M1HA 2B9VA 2Q8OA 5A3PA 2HWB3 1UNBA 1NLRA 4AAXA 1EAH3 1JH5A 3LDBA 3WT3A 4U36A 1DDLA 2ZX1A 3KV6A 2VGDA 2R041 4LULA 4CEYB 2PHFA 1PGSA 3J8F3 4FI9A 1AYM1 1S0BA 2NP0A 1UL9A 1YFWA 1GR3A 3AJZA 1JYIA 3KMHA 4IE4A 3WNLA 1GV9A 3CHXA 3ZN6B 2W94A 4O9GA 3AKSA 1SLCA 1RUJ3 1R64A 1SFYA 1PO21 2E63A 2IXJA 2PELA 2WZR1 1H1AA 4JGYB 4W4ZA 2FZ1A 3BYWA 4QPGC 3ECQA 1UYXA 4TYSA 5A6XA 1AR81 2P6HA 5FZ3A 4QX5A 1JYCA 2QFEA 3TB0A 4GMP0 4Q1PA 4OHYA 4Y1VA 1LGNA 4ORFA 1GANA 4XZUG 2BVVA 3TEWA 4CEYA 1PO13 4O9EA 1DYOA 1PM4A 4CCDA 4F3JA 1RB8G 5APAA 2VBPA 3Q8CA 5E89A 4BA6A 2NYYA 3VBFB 4D94A 5BNQA 1BVVA 2FBEA 2GH8A 5C4WB 1DBNA 1ULGA 4XIKA 2OVUA 3ZN6A 2PAKA 5CZKA 3O1TA 1QJY3 3T09A 3NAPC 4O61A 1W8OA 5J98B 4JGYA 3SCGA 4XE9A 2VCBA 2E6VA 5FIXA 1VBD3 3WEZA 4BJ0A 4D0QA 1PVXA 2ZJCA 4J1WA 4E4DX 4YFZA 1KITA 4LKSA 3PTRB 4XFAA 3P6BA 1K5MC 4FSJA 2ZHLA 1SZBA 1ENRA 1DIWA 3IDEA 4XPVA 2VZ3A 3NKTA 5IK7A 2YU1A 4E4SA 1QXRA 4K8RB 1COV3 4R9BA 4RSUA 3VBFA 5JSPA 2JENA 4QHZA 2DUPA 1RVF1 5C4WA 4ZS2A 4Q0VA 4Y22B 1FNZA 3POGA 4E4ZA 1QH7A 4YM1A 5A3NA 2ET7A 5B2GB 4XXAA 2OZ6A 4Q4V1 1UMHA 1YJLA 4B1MA 2RDQA 5BUVA 2ZEXA 1VP6A 2HWC1 1GBGA 1IQDC 2BUKA 4PIZA 4QU1A 2BVBA 1W2OA 3HEIA 1AR61 1A8DA 4FCAA 5JZGB 2WFPA 4Y4RA 2W46A 1JHNA 2XGXA 4JKKA 4XJ8A 4AI3A 4P5HA 2ZOEB 1MQTB 1SHWB 4ZU5A 2JEMA 3QACA 2V72A 2OA2A 5IVVA 2XWJB 1DZQA 1UYYA 2QCSB 4JDNA 1V6LA 5FYBA 4NHYA 2RS53 1XYPA 3WW2A 5D2AA 4JQRA 5DUUA 1H2KA 4Y22A 1ZM1A 3HQXA 5FZ6A 3FHAA 5F2SA 1L7LA 3LEMA 1OQEA 2XWBB 2QQWA 2Y8KA 2J1EA 3FZ3A 4Q4X3 5FYYA 3LDKA 4M3CE 1HXS2 1HV0A 2GALA
chains in the Genus database with same CATH topology
5ACA3 4OI0A 5CG9A 3C3VA 2GMEA 5KXCA 1MQTA 4PIYA 4YW1A 1GZ9A 4C1XA 2ZMNA 3SH3A 1FT9A 4XHBA 2OYZA 5A3LA 2ZGKA 3H9AA 2HWF3 5C6CA 3ZYIB 4AFDA 4XF4A 2JG9A 2DUOA 4FPEA 5GZDA 1NQDA 2WIIB 1RUE1 1O3SA 4HLTA 3I59B 1C3HA 5DUVA 3ES1A 2RJLA 3VZLA 3O14A 2O8QA 2F4PA 1LTEA 4H7MA 4XF3A 3VBUA 4COYA 4Y26A 2H6BA 3DPRB 3CLPA 1LEMA 3KT7A 3VBHC 4AFBA 1RUD1 5HBAA 5GZFA 4JRAA 1PGL2 3THPA 3E6BA 2AUYA 2XKPA 3M3EA 4LA2A 1G9BA 2A73B 1QGLA 3W58A 5CNAA 3AMPA 4GXLA 4AHYA 4CP1A 3EO6A 4CEWC 4K7JA 1T6GC 3PVBB 2W52A 3WV6A 2ZAHA 4E27A 3ETQA 4YG0A 3JD73 4AI2A 5C9AC 4N7UA 2YPJA 3JCIA 3DPRA 2AH2A 1UMZA 3V65A 3NAPB 1V70A 2BYVE 5T5JA 1WMEA 2D6PA 3S6PA 1BEV1 1PIV1 2XL7A 2DCKA 1F5JA 1PK6C 5LEKA 1CQ9A 4NWWA 1MZ6A 3MEPA 2QE3A 3D82A 4MGKE 4L97A 3AKPA 2KA3A 3ZN4A 3WG4A 1AR73 3ME2A 1KFUL 2D5HA 5EJ3A 1OPOA 4OI1A 1UZYA 4AI1A 4Q1RA 2WL1A 1W0PA 2DCYA 3QCWA 2HYKA 3WW3A 5E8AA 3NAPA 4HETA 3GBGA 1WMFA 3CJIC 1G86A 2QQPA 1RUG2 3PMEA 3B94A 4OLLA 1N1TA 2E9QA 3FBMA 1Q56A 1AYN2 3HWJA 4K20A 4HKWA 1MVQA 1C8M3 2PHTA 4WZFA 2FZ2A 5DG1A 2O8OA 3VKLA 1QJX3 3IT8A 2C5DA 5H9QA 1W6MB 1HKDA 5CIRA 4JGZC 2RS11 3WDTA 3B3QE 2VMGA 1OSGA 2VVEA 2EALA 1ZRCA 4OUSA 1BMV1 2RMU2 4META 5GJ6A 3O0XA 3MICA 4C1WA 3WX5A 3AMHA 1WCKA 5FREA 2PTMA 2ZMLA 2A7AA 1AX2A 2R043 1YFUA 3RI9A 1YRZA 4P14A 1MEC1 2P3KA 5BXXA 1AXKA 1W6MA 5C33A 5LEJA 2CAVA 2JXAA 1QJU2 3ATGA 1SLAA 2JE7A 3RYRA 1PO23 5HXVA 3R6SA 2ZGRA 4I0BA 4L2NA 5L73A 3MLLA 1HRI2 4XF9A 4N9HA 1LCLA 1WLCA 5JOYA 1EPZA 3K48A 4D7TA 4IEWA 2R32A 3O5SA 4DY5A 5AVAA 3VBHB 1R081 5ABJB 1S0FA 2D40A 2ZGMA 3MIDA 3GHMA 5T55A 3RMXA 2YMZA 2A3YA 1QNYA 2CWMA 5JSRA 3CEWA 3OGGA 1REFA 1W0OA 1YFXA 2BWAA 3VBSB 2IXKA 4L92A 2ZA9A 4XEZA 1VRH2 3CF6E 1H9WA 1OLRA 5HI0A 1A6CA 4N9IA 1WGPA 2EA7A 4NWVA 3VKMA 5BNOC 1J59A 3N36A 5CFCB 1UIKA 2GNBA 2HWE2 3PJQA 4CDXC 3VBHA 4KWLA 2WT2A 4URTA 5ABJA 3KQRA 2WC2A 2FQPA 2Q5TA 3SITA 5JOWA 2CGPA 2IZWA 2GN7A 2RM21 3AKQA 3OY8B 4M3CA 3RPQA 2EAKA 2TUNA 3VBSA 4P9GA 4INDA 3VKNA 5K0UC 3AYEA 2B39A 3BIWE 4Y20B 3ZXLA 4AI8A 2A6XA 5C9AA 1I1EA 1H4GA 2LALA 5CFCA 2B8MA 3KB5A 4C0HA 4E2GA 5I0SA 2O1QA 1QNWA 1LGBA 4F7ZA 1WD3A 1BK1A 1ULDA 1YO8A 1Q8VA 4SBVA 3TN92 3OY8A 3LZZA 1O4ZA 1W6NB 3LSDA 2G4IA 3GHNA 4Q0PA 2HWD3 5HCFA 4Y20A 1TME1 4ES9A 4Q4W1 4JGZB 4LHNA 3WW4A 1EV11 3K51A 4RQPC 4RHV1 1AF9A 2Z2SB 3WP3A 3ES4A 1AL0G 5JCTA 3GBFA 2WS93 4KWKA 4XBLA 3P3NA 1HQNA 2YROA 3PJYA 3ENRA 4AEMA 4AEDB 1RUE3 1Y9QA 1W6NA 5GZGA 4FP3A 4CTEA 4IEQA 4Q4Y1 4GB32 5H9RA 3POWA 5J3UA 1H8VA 4JGZA 4YGEA 4X6RB 2R063 2RR12 1I9RA 1PZ9A 3KCYA 4PIXA 1IHMA 1TEIA 3D8CA 1LECA 3KCXA 4K8FA 1SQ4A 1RUF2 2WT1A 4AVAA 1X82A 1SACA 4AEDA 4WVZA 1IOAA 2AZ5A 4JRLA 3QH7A 2VECA 4QQLA 2HWB1 3DN7A 1S2BA 2V73A 1FV2A 1EAH1 2XJTA 2WWSA 3ZYGA 3EXUA 2EAAA 1DGRA 5LK5A 1OMIA 4GIQA 1PVC2 3J8F1 1DZTA 5SV5A 3AYDA 4LA3A 1DLLA 4FTEA 2CGOA 1BEV3 3W59A 4EROA 1DFQA 4Q29A 3LB9A 2ZGPA 4L11A 2JE9A 4XMIA 2CGNA 2QJVA 3OCPA 3WUDA 1AHSA 3OD4A 1WW7A 1XYNA 3D4KA 4FP2A 4XDQA 3SISA 2D3RA 3UV9A 1MVEA 2AYHA 3KSCA 4GWNA 1VR3A 4XILA 5BNPC 1O3QA 3FLRA 3IPVB 2WNUC 3WDVA 3JU9A 1V6MA 2WNEA 3MIBA 5J09A 4CDWC 4CDUC 1KD7A 2ZABA 1QJY1 3GYDA 2DVFA 4LHKA 1FOD1 1VBD1 3TNQA 4EN7B 2VPVA 3LA7A 1OFNA 1H4HA 3ZFEC 3EBRA 3B93A 2XHKA 4CDXA 1VJ2A 1EPWA 4LBKA 1G9FA 2MNGA 3J26N 1BQPA 1C1FA 1IKQA 3JBG2 4FVVA 3OPZA 4H55A 1COV1 1AL22 4QM9A 2R071 3IPVA 4YW4A 1UU5A 2QZ3A 2VOVA 3AZVA 4OHXA 4HVQA 1ASJ1 5K0UA 5IT6A 3QH6A 4DQAA 2Z69A 1C57A 2W0XA 1APNA 2WT0A 2X5IC 4FOWA 3T1MA 1YNAA 1AX0A 1V9U3 4YGCA 2BFUL 3E97A 1JTZX 3G7DA 2GNTA 4NO4A 2BPA2 5CAZA 3B9IA 3Q9OA 3WG3A 4D7SA 4B4PA 2VUAA 3D6EA 2RS51 2WQZC 2Y0OA 1U5ZA 1RUJ2 1MZ5A 1SLIA 3M3OA 3NVCA 4XXPA 5FOJB 1JUHA 1QQP3 2GC2A 1VAMA 2BEOA 1U0AA 3NO8A 4ES8A 5FFOC 1QDOA 3SLIA 4XFFA 2X29A 4LUKA 4PBOA 3TRSB 4Q4X1 5J36A 1SBFA 2ZGQA 1E57A 3H3UA 5ACA1 1D0HA 1GNHA 3LOBA 4QMAA 3N7MA 3IN9A 5IK4A 5IK5A 3MIHA 3JB4C 2ARBA 2D6NA 2GAUA 2GC0A 4LHLA 1HX6A 4E9KA 2YGMA 3MIGA 5KHHA 5FTTC 2HWF1 4IEUA 2R0HA 5EYXA 4R4XA 1CGPA 2WQ4A 1FI2A 1U5XA 5KXEA 3UKTA 1VAKA 2GDFA 1FAYA 2P3JA 4ITCA 5LRSA 3ZPYA 2MEV2 4K6BA 3AZXA 1JUIA 4YZ3A 1REDA 4GH4B 5J96B 1F9KA 3FWEA 2WJSA 4YW3A 5AC93 1LOCA 2PHLA 3ILRA 3CL1A 3WDUA 2RM23 5T52A 4CP2A 3V0AB 3QBQA 3VHPA 2KM2A 4JTNA 2GZWA 3MW4A 3AP4A 1WLTA 2XH6A 2I07B 4H14A 3ZFGC 5FMOL 3WCSA 2QVSB 2HKXA 4AQSA 2DV9A 4GH4A 2Y38A 2WNUB 1H8TB 5FLIA 4FQZA 2VMIA 4OHVA 5T5PA 5FMOS 1FMD2 3IIAA 2A75A 3V0AA 3WP6A 1TQ5A 1RHI2 1RUC1 4YG3A 2A6WA 3AMNA 1TME3 2EXIA 1TMF1 4RGAA 4Q4W3 1ENXA 3ZN5A 1QJZA 5KBFA 3LCPA 1AR71 3ST7A 3PMSA 5IK8A 4N53B 1O3TA 1SCSA 4RHV3 2WNUA 2CY6A 1H8TA 2CYFA 4LBOA 2XLFA 1LENA 2JX9A 4HANA 4AVBA 4CDUA 4IV1B 4OZXA 2XUMA 4IXLA 1UX6A 3RMYA 1A8MA 1Z0HA 4JC1A 1TE1B 3MW3A 4XJUA 4LO6B 4BIFA 4LBQD 3TBDA 2JECA 1HRV3 1AXYA 2XJUA 4IESA 2DWRA 4AFAA 3SMHA 1ULCA 5E16A 2IXHA 1C28A 4N53A 1WBFA 1YCIA 4HL0A 3HMYA 3SNMA 2RS32 2W08A 4IV1A 4XBNA 3OD0A 4LBMA 4YRDA 5CADA 2DVGA 3H1MA 5F5QA 3CJXA 4ISRA 2B9UA 1NE4A 3ZYJB 1ZBA2 3DUIA 1Z7S2 3O0WA 1NZCA 2B42B 3T1LA 4Y24A 1QOOA 1BJQA 1D4M1 1PNFA 2VH9A 4QGLA 2B5HA 2G9FA 2H0VA 4KG0A 3WP5A 4ASMB 4KQ7A 1XNBA 3R0RA 4EWEA 4LBLA 3W9AA 2XBO3 4EN0A 1DQ6A 4MLOA 1LU1A 1NCRB 3MIFA 3V64A 3G6JB 3N3HA 4WVWA 1XNDA 1R1A1 4J1XA 1MZFA 3FHIB 5DDJ3 5BNNC 4YG6A 4W6YA 4KBBA 4BH9A 1LOFC 1FOD3 1X33A 2PHUA 4XHXA 4MH0E 3KD4A 1NCRA 3LGRA 4QQPA 1CX4A 1C8M2 4LLFA 3AYCA 4TLFA 1FXZA 1VBA2 1QJX2 5J37A 1ENSA 2PAMA 2E51A 1X8EA 4PCRA 2Q1MA 2R073 3MIEA 2P17A 3MFAA 4DY3A 2BNMA 1UKRA 3BOWA 3R4UA 3OBRA 1ASJ3 4LO5B 3E5QA 3PLQA 4Y1UA 3WCRA 3ZFGA 5I0UA 2R042 4K3UA 1MR5A 4AGVA 1CAVB 4CDQC 2P2KA 1AYM2 1V6JA 3WQ7A 3ELNA 3L2HA 1C1LA 2JD4A 1Q8QA 4A3XA 2WZR2 4R9CA 4KNCA 2ILMA 3MFCA 2W39A 1VBC3 2JG9B 4YVSB 5GLVA 4K9SA 1AR82 4PBPA 5D1IA 2C9AA 4P9IA 3FJSA 1JOJA 1GYKA 3AJYA 5CFDC 1UU4A 2PHDA 4XJZA 4M3CF 2HWD1 3VV1A 4E2QA 3KT1A 3VBUB 1CAVA 1BVP1 4HKLA 1KRIA 1H2MA 1LU2A 4RR3C 1IPJA 1OQDA 4WM8B 1IPKA 2UWAA 1NCQC 1RMU1 3B5LB 4B4QA 3IWZA 2CTVA 3RWNA 4DFSA 4PLOA 2D7FA 2PLV3 2WS91 2XJQA 4YVSA 2VW2A 1NOVA 2OPKA 1BBT3 3OGJA 4R4ZA 4JAAA 2GMMA 1N1VA 4UBGA 5GLZA 3H8UA 4XJAA 3TWIA 1RVF2 4WM8A 2R061 1FX5A 2WSUA 3HT1A 3TOJA 1XQNA 4IEXA 2D44A 1F2NA 4QT6A 4Q4V2 5K8SA 4QPGB 2HWC2 2VQ0A 3A0KA 4MGYE 1XU1A 3WDWA 5FOBB 3WDYA 4QU2A 1AR62 1OKQA 4AQTA 3VDDC 4AVTA 2E7QA 4KU7A 5EZWA 5GKAC 3ASIA 2IFRA 1Y7BA 4KG8A 3O0VA 4MGZE 3LKJA 3ZSKA 2R6QA 5BNNB 2NN8A 3KM5A 3ZO0B 2K9ZA 2QDRA 2K0GA 3BB6A 4LLOA 4YARA 2UYAA 4I30A 1CAUB 2D3PA 1RUC3 2V5YA 4QPGA 4Z1VA 1CPNA 1K5MB 3EQEA 4FPGA 4EN8B 1R091 1TMF3 3B9CA 3JUUA 3FLPA 2DVAA 1SDWA 4MXWB 2WA4A 4XFGA 4DMIA 3H7JA 2BNOA 4N43C 5BNNA 4AEJA 3POYA 2VU9A 3VLBB 1LOFA 2JKBA 2XJPA 4A7YA 3DV8A 1CAUA 4UW3A 4F8AA 4BLIA 1K5MA 4BM8A 1N3QA 1NY71 1N1YA 4IV3C 3BPZA 4FQ4A 4UW4A 1KDKA 1CAXB 4CDQB 1LHOA 1WUVA 1W6PB 1B35C 1PMIA 4AEKA 4MXWA 3WQ1A 1DYKA 1QHDA 4XQ4A 4NN0A 3VBRC 5I0RA 2OUJA 3N7JA 1H0BA 1RUD2 1SEFA 3THTA 3VZJA 1UZZA 1V6KA 3R05A 4X8PA 2OUHA 3TAYA 4FXGB 3QLQA 2QNKA 3U11A 5FO7B 3RJ2X 4FOQA 1IS5A 1GQHA 4QPIB 3VZNA 2WSVA 4YNIA 3LA2A 2GMPA 1CAXA 1KS4A 4CDQA 1NYWA 4RR3B 4Z07A 1W6PA 4ZU7A 3APBA 1DQ1A 1V9U1 1NCQB 1OPMA 4JCKA 1D4M3 4LE4A 4BCUA 4GALA 5FO9B 1Z78A 1S0DA 3KGZA 3HN1A 3ILFA 4MYEA 4MX3A 3S30A 1CPMA 4FPOB 1BEV2 1UIJA 1PIV2 2ES3A 4C90A 4XTMA 2B45X 1DG6A 3ROUA 4YSFA 2HJIA 5KC6A 2N7GA 1OOPC 3GZTB 4IEVA 5CFDA 1MS9A 4CRQA 4QPIA 1QQP1 3PVOA 2R30A 1DYPA 2I45A 3D0SA 5K7PA 3ZXKA 4RR3A 4YYOA 1NCQA 1RUH2 4EWAA 2PYTA 2BWCA 1SCRA 4FTBA 4WM7C 4NHKA 4PQ9A 2XPJA 1R1A3 4I0WB 4WV8A 1FPN2 4Y5Z0 1H1IA 3A0NA 2D43A 1GKBA 3CNAA 2DCTA 2C0ZA 1VBE2 4M3CB 4P9YA 4XIOA 3FUOA 4XZPA 4HZFA 4CEWB 4GWMA 3WVJA 2PN5A 4AK3A 3AXEA 1I3HA 2GNMA 4I01A 4JDMA 1JW6A 1W6OB 4W65A 5JVVA 5LK7B 4XBQA 2VULA 5C9AB 1DQ2A 2ZGLA 1C5IA 4XQWA 1XYOA 1YI9A 5KHJA 2RS12 1X50A 4AW7A 1VALA 5AC91 1LB2A 3RJRA 2YY1A 4MGIE 1PK6B 1VAVA 1BMV2 4D3WA 5L36A 1EP0A 3D0JA 3VBOC 1QY4A 4CEWA 2VMHA 2NQYA 1NA1C 2VOKA 1CD3G 1ONAA 1GZWB 1YIPA 1W6OA 1MEC2 3FMGA 3LAGA 3OBTA 3GZUC 3NJZA 4N43B 3L9JT 4XQDA 3E6CC 2SBAA 3ZMOA 5F1RA 2RR11 1POV0 3CJIB 2VNGA 2Y0IA 4OHWA 2RE9A 4LBNA 1LRHA 2ZX0A 5GLUA 1PK6A 2ZZQA 3BCWA 1UU6A 3AP7A 5DG2A 4FO9A 4GMP3 4WVMB 4CYDA 4BMBA 1H2LA 3USUB 1YJKA 4P9WA 3N7KA 3WR0A 3PVEA 1GZWA 2D6LX 2WFF2 3NL1A 4DINB 4LO4B 4LT5A 4DS0A 2PA7A 4N43A 5DZEA 2QUOA 3ZDSA 1R082 1H9PA 1RMU3 4FAHA 4ISQA 3CJIA 4BWOA 3MPBA 3VZKA 1AR91 1D0GA 1Q5OA 4JV4A 4PF5A 2YUEA 4WVMA 5BV6A 5DXDA 3USUA 1MS4A 3WG2A 2ZZJA 2BQPA 2UY9A 5I93A 1SBDA 1DHKB 3AZWA 4YW2A 3I4IA 1RITA 3VBRA 1HRV1 1V6OA 1RUI1 2R16A 3H50A 2IFWA 3ZSEA 4WVVA 2WLPA 2EXJA 3SH4A 2DFBA 2RM22 1OOPB 4R9DA 2DTYA 1PGW1 3FBYA 1UD1A 3S7EA 4I3GA 2BGCA 2MPFA 3U4XA 1TNRA 4ATEA 5C8CC 4X6QB 2JJ6A 4OI4A 4P9XA 1AYN3 4IL7A 1ZZBA 4YM0A 3M2MA 3MLJA 2GH2A 2VW1A 1J3RA 3KLSA 1Q43A 4ZXKA 1QF3A 1DQ4A 3JBG1 2D6KA 4BIOA 3U07A 1OOPA 3DGTA 4XMAA 5F6KA 1R093 2RMU3 2VW0A 3KT4A 5K9YA 3RI8A 1ZZ6A 5JMCA 2XBO1 5BNOB 4B7EA 4ONUA 4Q4W2 3R4SA 3SCFA 4CDXB 4WM7A 1ZRRA 2ZS6B 1EV12 4EJRA 5JPMB 3SHRA 1DGLA 3E6DA 4RHV2 2DUQA 1U5IA 1NG0A 2DYCA 5FQ0B 3V0BB 4PLMA 4Q8LA 4YZ4A 3S0MA 2JG8C 2W68A 3JQXA 5DDJ1 4AVCA 4Y1YA 4BPZA 1CONA 2WA3A 4Q0QA 3WQ0A 5K0UB 2EXKA 4Q4Y2 1HRI3 5JI7A 5BNOA 4BZ4A 3AP6A 3MPPG 4TWTA 4LR4A 2ZX2A 1ND2C 5I91A 4HK9A 4BQ1A 2AGSA 2G9GA 2YZ4A 4IETA 5FQ0A 4RL7A 3RSJA 3USSA 4BHPA 3V0BA 4M00A 5AFBA 1GNZA 1NA1A 4U2AA 1XU2A 2VG9A 1VRH3 4H3WA 2HWB2 1WLDA 5SV8A 4XOGA 1EAH2 1EY2A 3MW2A 4LUMA 3WNXA 1IQAA 1QDCA 2YXSA 1CJPA 4RQPB 4WZCA 3U0ZA 3B02A 3J8F2 2AR6A 1JN2P 2HWE3 2HEYF 4N7IA 3P3PA 3AXDA 2ENRA 3RYKA 4AHXA 2DURA 1G8WA 1VLNA 1KQRA 2D5FA 4G4FA 2WKKA 2ZTNA 2VOWA 1VBC1 2PFWA 4DB5A 4FBFA 3WD5A 4AHZA 3NV2A 1VIWB 5D8AC 4R52A 2PAEA 4YLZA 5L19A 3IM0A 2V09A 1IS4A 3GNEA 4Z82A 2Z42A 5FPXA 1GFF2 3FUQA 1PO12 3RDIA 4QQ2A 4RQPA 5FDBA 3C2UA 4FAGA 4NPRA 1HW5A 1MS3A 4QXKA 4MVTA 1ZBE1 4OULA 1QJY2 3N4MA 3TN93 1BKZA 5HCAA 1FOD2 3H1YA 2DVBA 2FMYA 1VBD2 4OHZA 2PLV1 1LESA 2ET1A 3ZXEA 1HLCA 3VHRA 2XB6C 3IDCB 3O7OA 4I3PA 3RG0A 2TEPA 1BBT1 1KXGA 1G6NA 3FC0A 3NV4A 4EN9B 1VBB1 1COV2 5T5OA 2D93A 3PHMA 1LKNA 2R072 2A5ZA 2D98A 4MZUA 1GICA 3DL3A 3WINE 4XTPA 4EWDA 1ASJ2 4MV2A 5JDBA 4M0HA 2TBVA 4PLNA 1NXD1 5A32B 1MS0A 3I8TA 3JB8A 4Y4YA 4COUA 5KXBA 1G9DA 2NMNA 1QOTA 2P3IA