1NQJA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.0 angstrom resolution in absence of calcium
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
96
Chain Sequence
ATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords class 1 collagenase
publication title A bacterial collagen-binding domain with novel calcium-binding motif controls domain orientation
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 25
structure length 96
sequence length 100
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nqjA00
2XVGA 1NQDA 4HPKB 1WMDA 2XVLA 4DZGA 4I3GA 4DY5A 1KFUL 3AFGA 3BOWA 1QXPA 2XVKA 4G9SB 1WMEA 2LUWA 3DF0A 2QFEA 3JQWA 4DXZA 4DY3A 1KFXL 1U5IA 2O8OA 1WMFA 1NQJA 4HPKA 5FBZA 5SV5A 3JQXA 1DF0A 5FAXA
chains in the Genus database with same CATH superfamily
2NM1A 1LGCA 4AEJA 2DUQA 1O3RA 5FY4A 2VULA 1ENXA 2ADEA 3KWVA 4ASMB 3CZUA 3K3NA 3VDDC 4PBPA 4Z1VA 1RUF1 4OHVA 5FZFA 4FVVA 4KI5M 4N43C 2O8QA 5JSRA 4QGLA 5FYVA 4LBQB 3RFRA 4TLGA 1TMF3 4YRDA 1PMJX 3AJZA 1JOPA 5JXHA 1XNDA 1SFPA 1V6IA 2WR9A 5HV4A 3E5XA 1DHKB 1SLTA 1ZM1A 3T2TA 1FPN1 1IHMA 4XFHA 4XFAA 5JPNB 5JZGC 4TLFA 3CJIC 3OF1A 3WHTA 1COV3 2YPDA 1WLCA 4E4HA 5JXIA 4COUA 4INDA 4HN0A 3OBTA 2C24A 4FOWA 5A3WA 1XNCA 3TN93 2J1UA 3N7LA 4JCKA 4AVTA 4HT1T 5L9BA 3BTXA 3CJXA 3KV6A 1K12A 5F2SA 1LOEA 4NE9A 1LTEA 2Q4SA 5IVJA 3FFZA 5EJZB 3HBZA 4FPHA 2W5FA 1X50A 2ARXA 5CZKA 1WW4A 1YFWA 1FAYA 4ZU4A 3KM5A 4GJZA 4M01A 2BEOA 2D98A 4YW5A 3N35A 3FX3A 5IAVA 1RB8G 2VR4A 1BKZA 3MUY1 3UESA 2EAAA 4NHKA 2P37A 2FMDA 2W1UA 3IPVA 4FT8A 1VRH2 4Q2FA 4YW3A 5FP8A 4AI3A 5IATA 2A7AA 1SLCA 1UY1A 5E1RA 2MEV3 1G86A 2XUMA 5FZOA 2BWAA 2QQOA 2HWB2 2ZGNA 5T5PA 2ZGOA 3VL9A 1J3RA 5BNOB 1EP0A 1RUI3 2WL1A 4GJYA 4XJ9A 2ZXQA 2XH6A 3VDDB 4B8EA 4LBNA 3N9NA 4QPIA 4N43B 3O1PA 3H42B 2E63A 3O12A 3GHMA 4NRMA 4XXAA 1IKQA 5CNAA 5FBJA 5F3EA 5CFCC 2HWD3 4LXLA 4YZ5A 1OLMA 4NHXA 1GWKA 4KU7A 4LIUA 1W6MB 4Y20A 4NPRA 3ZKYA 1CONA 5FZBA 1S0JA 4BQXA 4AE2A 3VN4A 1OD5A 5JZGB 5C33A 3CJIB 4LR4A 3IMMA 3ZM8A 1IG0A 2J1EA 3WEZA 3GJBA 4EWEA 2ARAA 4MXVA 1LESA 4OZXA 4DINB 2B42B 4M0HA 2CGPA 1U5XA 1U5ZA 4UFJA 1PVC2 4Z2WA 3Q8BA 4XW3A 3S5QA 1EV12 3MPPG 3C7OA 1WBLA 2ZX4A 1W8FA 4QKNA 1NZIA 1TE1B 2RR11 4RSUA 3K46A 1JU4A 5IK7A 1LKNA 1NCQC 3ZYJB 5H9RA 2ZTNA 1HXS2 4LUMA 1QQP2 4FQZA 4PF1A 4AI1A 3MLJA 4A6SA 4LJHA 4PLMA 4CPBA 3HN3A 5BNNA 5JOXA 1K42A 4BK5A 1MQTC 3VBOC 2DCYA 3AP6A 2XKOA 1QOOA 1XOYA 4O61A 3N9PA 1KEXA 3QACA 3K4ZA 5F7UA 3FLRA 5HCAA 3ZLIA 4AGRA 2R062 1YC61 2EIGA 4EN8B 1XPWA 3U11A 4YG6A 3ATGA 1RUNA 3WG3A 1STMA 2VMHA 2XQXA 3JD73 1W6NA 3R0RA 1RUC3 2WA3A 1OA4A 3C7GA 2R16A 4XJAA 4BJ0A 1N1YA 1QJFA 1UYXA 2VQAA 1BK1A 3B9CA 5A3LA 5CFCB 3ZN5A 1S0BA 2WNUA 1UKGA 2YBKA 2R30A 3OB8A 4LBQD 1D0HA 1DF0A 1O8SA 2BQPA 2ZHKA 1UX7A 1T2XA 3B9IA 3ACLA 5CYYA 2R1BA 4ZZ5A 2H0VA 3OG2A 2RM21 5E6HA 1NOVA 1YQ2A 2VUAA 3JBG1 4JQTA 4OYUA 4S2GA 4RGGA 3PVNA 2UWAA 3DKQA 1DGWX 4AAPA 4FPOB 4GQ7A 2GZWA 4CP0A 4LBMA 3ROUA 1HB1A 4XPVA 4GULA 3HEIA 5DAWA 1JZ3A 2AC1A 3FL7A 2DU0A 5I8TA 4XIKA 1ZBA3 3I3EA 4WZCA 3JXSA 2IVIB 3FMGA 5FMOS 5AC92 1PGSA 4GA9A 2VTXJ 3CU7A 4XUTA 2WQ8A 2E51A 5F1RA 4BM8A 1YFXA 2EAKA 2JG9C 1W9TA 4YVWA 4QX2A 2ZAHA 2XMLA 1ZZ6A 4UF0B 1QDCA 1XSRA 1QXJA 2RS31 2ES3A 1A8DA 1NCQB 4OLLA 1QNWA 5FIXA 4YYOA 2Q8DA 3E5QA 4RFT0 2GC1A 5FZ7A 4GB33 2JE8A 1KS4A 2RJ2A 4FFIA 5T55A 2UY9A 3UNPA 1EPZA 5FP7A 4RHV1 1MQTB 4Y26A 3VBOB 2AENA 3AZYA 3T08A 2XUEA 1TG7A 3BI3A 3D0JA 4MUVA 1MEC2 2P3IA 4LO7A 3KGLA 4AFBA 4HK8A 2DTYA 4I2OA 4NPMA 1GV9A 1VB4A 1X9TA 5EP9A 3MUZ1 5F3GA 2R0HA 4QXHA 4NWVA 3IAQA 1CJDA 3WXPA 1KFXL 5DAXA 1GQGA 5C4WC 3AZVA 5FO7B 3MDPA 1J3PA 2HBTA 3SCFA 1S2KA 1QJZA 2PHUA 4XF0A 2OS2A 1C5HA 5FV3A 3VBSA 1F35A 2X5IC 1SHWB 4LKDA 4PJYA 2TEPA 5KHHA 3POIA 4CP1A 5LA1A 2GH2A 2A3XA 1H2LA 2BNMA 1OXCA 1RUE2 2Z4FA 1UMIA 1BZWA 4Y5TA 5KHIA 4IQPA 1GKBA 1I9RA 4KWKA 4NIGA 2JE7A 3AFGA 1W0PA 4DS0A 2PN5A 4FXKB 3VZKA 3EBRA 1LU2A 1RUG2 3KF3A 2WFF2 2XJSA 3O5SA 3O1UA 3NJVA 3OSDA 4QU1A 1DZRA 3OYWA 3I49A 4BQ3A 2ZGSA 2DU1A 1CVNA 5IK5A 5F39A 2XG3A 1VIWB 2JDPA 1NLQA 2A6WA 3PVOA 2QCSB 3RYRA 4K21A 2O0OA 1X9PA 5F32A 1BEV2 3NSTA 1JW6A 1UPIA 4CVUA 3KHCA 4HPKB 2Z5WA 2VAUA 1OKQA 3THPA 1VE0A 3J7NA 1IQDC 3OBRA 4FFFA 1JYNA 1HW5A 1YHFA 2JG8C 3PIGA 3SITA 5LY1A 3VBUA 3WUDA 2W68A 1CZSA 1OBNA 1QXPA 3SISA 2K46A 1W8WA 1W9SA 3SEPA 5I91A 3KT4A 3ASIA 4PHZA 1GZCA 1YJLA 2BGCA 1JZ8A 2FBEA 2VQUA 2XJQA 4PIYA 1G9FA 3MICA 1ZRDA 3RPQA 5FPLA 3AYDA 3CBNA 5J1XA 3WG1A 4M4PA 5FY0A 4TTGA 5C4WB 2J1VA 5FXZA 1Y4WA 1BQPA 1DQ4A 1AL23 1W9FA 2XHKA 4MYEA 5T3NA 1UN1A 4ZY9A 2IXIA 2HWB1 2X5IB 3WW2A 5A1LA 4AI0A 4Y1UA 2WBKA 1J1TA 2VUJA 5SV8A 2ZEZA 2B7YA 3SQOA 4AW7A 4EZHA 3LDKA 4QX7A 1IS6A 4MXWA 5A6YA 4ZXEA 1CZVA 1OVSA 2QUOA 3J9SA 4AVAA 1G9DA 1B35C 3KT1A 3J8F2 5DUVA 1PO12 1RUF3 1H6XA 1GNZA 1OPOA 2HEYF 2R042 2VMFA 2YROA 3L2YA 3WV6A 1YCIA 4C1XA 1LENA 3ZR5A 2W91A 3GHNA 4AEDA 4TYSA 1LOAA 3T4VA 1U0AA 1OOPC 1ZRFA 2J22A 4DEQA 1QMJA 3C3VA 3V56A 4CCCA 1KRIA 3POJA 1WUVA 4IV1B 3LIGA 4NR1A 1W8OA 2BU9A 4QDRA 2QQMA 5LA2A 2ZGRA 3AVSA 1PVC1 4OHZA 2PXJA 2PTMA 5EYYA 1RUJ2 4OFGA 2CTVA 3BB6A 4LULA 4RS5C 4L92A 3QCWA 5JR7B 2JG8B 2JECA 4CTEA 4HKOA 2PHRA 5D8AC 3ZFFC 5IVFA 5FYCA 3N9OA 2PA7A 1DYPA 2LTNA 3BTAA 4OMDA 1YQCA 1VMFA 4BQ1A 5A70A 3KCYA 3LGRA 1QQP1 3TBDA 2XWJB 5FZ3A 5FCCA 4A7KA 5M0TA 3D6EA 4RGAA 1GWLA 1H1AA 3ABZA 5JSPA 2QQUA 1K5MC 4GB32 3CLPA 1US3A 5DXDA 3ZIWA 2BGPA 2J1AA 1W8UA 1E5SA 1WCDJ 2L9LA 2PHDA 2R061 2WNVC 4CEWC 2XWBB 1W28A 2VBPA 1MS1A 4A3ZA 1R091 2VZVA 1RITA 3A4UA 5FZ6A 4YM2A 2CDOA 4AVCA 5K8SA 1QOTA 4BK4A 1TME2 3FUOA 4YFZA 4PIXA 2ETEA 4A42A 2QZ3A 2FDFA 2RMU1 3M3QA 2RDNA 3AZWA 1B35B 2A6XA 5FYTA 5F5CA 3JZVA 3VBFC 1LNSA 3AP7A 3RMXA 4A6OA 5AVPA 3USUB 2RS12 2ZZQA 4BLJA 4UBHA 1XNTA 4KNCA 1JYVA 3O1SA 5FREA 1V6KA 2RS52 2HJIA 1OOPB 4UFIA 1WLTA 2BV4A 5A7QA 4Q0QA 4XQ4A 2UWCA 3BYWA 2J1TA 4LUKA 5IK4A 1GOFA 5CIRA 4UFLA 1G6NA 2YXSA 3AMPA 1V6OA 3OGVA 5A7PA 4R9BA 1W2UA 2WZ8A 5AC91 4XFCA 4RS5B 1H8VA 1RVF2 2HWF2 2MNGA 4WVMA 3KT7A 3OTFA 3S6PA 5D8AB 2WN3A 3ZFFB 1Q3EA 3LCPA 1NE4A 4NAOA 3VBRC 4BH9A 2EALA 1WA4A 3WW1A 3LKJA 1H9PA 4ITCA 1J58A 1DU3D 2CWSA 4CEYA 2RR13 4Q4W2 2RJLA 3HNBM 3WNPA 3RQ0A 1HRV1 5BNPC 4Y22A 1WMDA 4EROA 2V4VA 4B4RA 4CDUA 2TBVA 2JIGA 3SH4A 1YQ8A 1MEC1 4CDWA 1AX0A 1H6YA 1WA6X 4UOJA 2RE9A 2AREA 2WNVB 4YPJA 4CEWB 2ZS6B 5GM0A 2P3KA 5F8PA 2Q1FA 1IPJA 1ULDA 4RFRB 1JYIA 1DYKA 2A6YA 4LKFA 2D3PA 1CIYA 1VBE2 3OPWA 3HWJA 1GICA 3OOXA 2P5BA 2Z2SB 2GNMA 3KV4A 1NY72 3FLTA 5FUIA 2EXKA 3HT2A 5BV6A 3VBFB 1UF2C 4GWNA 1Y7BA 3APBA 3RG0A 4BB3A 1RUE1 4E9KA 5DG1A 4LHLA 4OHWA 4WM7A 2YYOA 4GIQA 4R52A 3NKTA 4JRLA 1CAVA 1CQ9A 3CL1A 2RM23 4N7IA 3MF9A 3ZXKA 3JBG3 3BTYA 1RUG1 3VHNA 3EO6A 5E89A 3WF0A 4Y1ZA 2XGXA 2LUWA 1L7RA 2GMEA 4S2HA 3ILFA 1W8TA 3DPRA 3AMNA 3J7LA 4YG0A 4AZZA 3HAGA 2HH9A 4BWOA 4CCMA 3NAPC 4UW4A 5KXBA 2IFWA 3SKJE 1BEV1 3GM8A 5ABJA 5LRRA 1OUXA 3NVCA 1BYHA 1FPN2 5FWEA 3ZXLA 3TEWA 3Q8EA 3OGGA 1NT0A 2EXIA 2VVDA 2WLPA 2WO1A 1Y9MA 4L99A 4ZPIA 3JB8A 5I0SA 3GZTB 2Y8KA 4YW4A 5BNPB 2CY6A 2RS33 3IN9A 1Y43B 2YBSA 5A7WB 3WUCA 5DAQA 3U75A 4P02B 2ZMKA 3EQEA 2LROA 1ZBE2 1IPKA 3BGAA 3KB5A 4JV4A 4AFMA 1IGOA 4RHV3 4G3YC 1SDWA 1Z78A 2BVVA 4CP9B 3CF6E 4Q1PA 2VXRA 5FP4A 4B7KA 5IFTA 1DDLA 2ORXA 4ONUA 3H1MA 1V00A 3H0OA 2BNNA 4FCAA 4ZU5A 2Y33A 5CADA 2A1XA 1AR92 3MHZA 4AL9A 4XHBA 5EYXA 3P5BA 4L97A 1SACA 2XVGA 3AB0A 1HQNA 4W6XA 5FZ0A 3NV3A 2CAVA 4IGOA 4LO6B 5FKCA 2Y6LA 2CNAA 3RI8A 3V65A 4XIOA 5A6XA 2R6QA 3WW3A 1C28A 3RZZA 2ZX2A 3J8F1 4FTSA 2W46A 2WAOA 1PO11 4QX1A 1Z7S1 2DFCA 2R041 2XBO2 4AG4A 1DP0A 1A6CA 3LEMA 3VBHA 1C8M2 4QXCA 1SBDA 2ET7A 2VECA 4Q1RA 3RZKA 5C8WA 4IEYA 1V70A 3K51A 5F6KA 3BTZA 3AKQA 4YVSA 5IJRA 3NAPB 4Y5SA 1JZ2A 5F6LB 4QX5A 2YC0A 5FAXA 2BERA 1LGNA 3AP5A 1VPHA 4LLOA 3IDBB 1W2OA 4XXPA 1GBGA 4XTPA 2CWMA 5JLVA 4I09A 3MFCA 4ZS2A 1FATA 2VW1A 3A7QA 5EHDA 3SNMA 2LM3A 4FTBA 5C3QA 1O3TA 4XJWA 4JGYA 5KXCA 4IW3A 3HN1A 2RV9A 1S0EA 4XUQA 5DZFA 5C7GA 1WBFA 3PUSA 1DLCA 1MVEA 4FPLA 4DXZA 1GOHA 5A1FA 1A78A 1XQNA 2VY0A 5JAXA 4MGTA 2D6OX 1HB3A 1QU0A 2D5FA 4QM8A 3RZMA 1ULGA 1PO22 4KQ7A 4XF9A 3BU7A 2WNUC 3WY6A 3E6DA 3I2FA 3SH3A 4LA3A 2OPWA 2VE1A 2JD9A 3DYOA 5I0UA 4KGQA 1YUDA 3O1OA 4QQOA 5A1AA 3H8RA 3T30A 2GALA 1VRH3 1UYYA 1L7LA 4TXWA 3ZYHA 4COVA 2P1BA 4J1WA 5IK8A 2CV6A 2X05A 1S4CA 3LE0A 4GMP1 1GZWA 1QIQA 1FV2A 1TME1 4P00B 2DCZA 5GALA 4DXSA 5LEKA 4Y4YA 5I8YA 1H1MA 2HWB3 2YFZA 2WDBA 1CD3G 2XKPA 3MIEA 3O0VA 4I0WB 4NROA 1O4TA 3D5OA 4AI2A 3ACIA 1DQ1A 1HIXA 3LFMA 3NWKA 2IVJA 2WUHA 3W5MA 3MIGA 1UXXX 4P9IA 1H4HA 4Q4X2 1UU4A 2RS11 4YVWC 1ZX5A 5HXVA 5A7SA 4OI1A 1Q8PA 3UGFA 2VCMA 1ZNPA 1NKGA 4JZRA 4MOAA 3DYMA 3U4SA 1I3HA 1ULEA 2RS51 5LASA 1HJGA 4P9YA 2VBDA 5FFOC 3GXUA 4UI9L 3ZXJA 1QY4A 2YUEA 3IDCB 4DOUA 4QB6A 1SDDB 4FO9A 4NUBA 4O7XA 1OLRA 2AUYA 4FFHA 3VUOA 3I3MA 3MW4A 1YNAA 2VGDA 1RVF1 2HWF1 5LA9A 1W8NA 1PVC3 1Q8OA 4QAWA 3AMHA 4FAHA 1GQHA 3HOBA 4NRQA 3U78A 1LU1A 2ZGUA 3A0NA 5FQ0A 1W6NB 3I8TA 4P9XA 3M8LA 5CG8A 5E88A 4NHYA 5JUVA 1F31A 3AZXA 4Q4W1 5HI0A 3MV01 1FX5A 3HNMA 2NQYA 3VBSC 3GF6A 3WDTA 4CCEA 1RINA 1HXS3 2YZ4A 4JDOA 4IE5A 2CGNA 2BVBA 5DPNA 3O1VA 1QQP3 3T0BA 5G04L 3PNAA 2V5YA 4BE3A 2Y0OA 1H9WA 1Q56A 4JDMA 1O91A 4FPCA 1OA2A 5CAZA 2SBAA 2Z42A 3PVEA 1VBE1 2R063 3M3OA 3MW3A 1R093 1RJ7A 2WS91 1PM4A 3H7JA 3THTA 5BXXA 2BTVC 3WZ1A 4NVPA 1PX4A 4HK9A 1BMV1 2H6BA 4LKSA 2ID4A 2VZ3A 3RZLA 4LE3A 2P3YA 3NJXA 1QKQA 3R4DB 4YVWB 1ND3A 2I74A 5A3UA 2DBNA 5L9VA 3B93A 3GALA 1NXD1 2E7QA 3K2OA 2AEZA 3OEAA 5FOJB 2VW2A 3POWA 3VBUC 4AHYA 4D6SA 2WA4A 2XVKA 1UZYA 3LB9A 4SLIA 1GFF2 4UAPA 1PVXA 2ZEXA 2CHHA 3ZFEA 4TWTA 3ALQA 2BNOA 2F6BA 2JIJA 4P5YA 1REDA 2A71A 1DFQA 4W6WA 4Q8KA 5AC93 4DQAA 4GD4A 4O9EA 1NQJA 4HVOA 4LHKA 2A70A 1IQAA 2W87A 1LHNA 3S0MA 1ST8A 4YG3A 2P6CA 4XC9A 3LDRA 5DAPA 2B39A 4IL7A 4YLZA 1W03A 4PDWA 5DABA 1EYBA 3VBSB 2IZWA 1OF3A 3MW2A 1FNZA 4XMAA 1W99A 1ZBE1 4YW7A 2QQVA 3ELNA 2H6CA 3DL3A 2OQ6A 4GWIA 1XJAA 3RDIA 4UT5A 1HB2A 3EMRA 3K4DA 4V1PA 2PAEA 3RSJA 1KDKA 1MEC3 1VBD2 4UYBA 1KDMA 2VZRA 3ZSKA 1HQWA 5T5LA 4BQ5A 1AR91 1UYPA 1R1A1 2E33A 1V9U2 4F3JA 1N1TA 1CAXA 4MGIE 3OYWB 3ZSMA 1JTZX 2QQNA 4D6QA 2G19A 4AEDC 1ZVFA 3M4FA 1JHJA 3DXUA 4HOOA 4NIAA 3E6CC 4EN7B 2HEVF 2G9GA 1HKDA 4JKKA 1G9CA 2YHJA 1PNGA 2OW4A 2PQSA 4RQPA 4DY5A 5GLTA 3VD5A 1NUKA 4YFWA 1HV1A 4AFCA 1RUE3 2EXJA 1K5JA 2IFRA 2XBO1 2ZGPA 3JUUA 4JX0A 4MGYE 5C8CC 4MH0E 1C8M1 3BPZA 3BIEA 2AYHA 5FYHA 3VBUB 4LNVA 2W92A 3DF0A 3ZSEA 1KGYA 3PUAA 4QX0A 1RUG3 4CYDA 1UU5A 2ENRA 2WFF3 1V6NA 3D82A 2WO7A 3HPNA 1UZ0A 1H2MA 3RYKA 3TWIA 4EN0A 4IESA 5CFDC 5JOYA 5KWRA 5K0UA 4R9CA 1C5IA 3KD4A 5L19A 3CMGA 3EHKA 4PCRA 4D8MA 2WKKA 1BEV3 3K75B 2EA7A 1LOFA 2G9ZA 3AKPA 1WGPA 1SLBA 3J26N 4KWUA 3S7EA 2JD4A 3WT3A 3POSA 2CSGA 3T2OA 2FDIA 3IZOA 4RGKA 4XETA 3A21A 1NXMA 4K20A 3UJQA 2AZ5A 3ITQA 4FOQA 5FY8A 1AJKA 4JTOA 2HEWF 4ZS3A 3J4UH 2WSVA 1S2BA 5H9PA 4BOWA 1V6LA 2H0BA 2V5DA 1PO21 4DO0A 3NMBA 1TNFA 2W1QA 3U07A 4U2AA 1LHVA 2OA2A 4QKBA 4SBVA 1YJKA 1QOSA 1F4AA 2YGLA 4AEDB 1JZ7A 1DLLA 3NV2A 1LR5A 3PUHA 2UY8A 3AL6A 5GZDA 4J1XA 2QZ2A 5GLUA 3LZZA 5FY1A 4ASLA 2ZGMA 4ET7A 4HONA 1UKRA 1C1LA 1WZXA 3OEBA 4CDXA 3LEGA 5JI9A 1WLDA 4OI2A 1VAMA 3KS7A 3P3PA 3C7EA 3NRUA 1PMIA 3POBA 3O1TA 2WT1A 1Y9QA 1R092 1VBB2 1K3IA 2GC3A 1RJ8A 2Q0AA 5C8CB 3I2OA 4Q4X1 5IFPA 3NQHA 2ZBJA 3J8F3 3MIDA 1PO13 2VZPA 2RMU2 2YU2A 2A75A 2R043 2V72A 5A33B 2GNDA 5FBZA 4CEYC 1J1LA 3FHQA 5CFDB 4HN1A 4QDSA 1WCKA 2ZJCA 2FZ2A 1O59A 1Q5OA 1W6PB 1GANA 2YV8A 1IS5A 1PZ9A 3WNXA 2VNRA 4GMP0 2ARCA 5D1IA 3OUHA 4QXBA 3H50A 3NNMA 3K77A 4CDUC 2XQRA 3RGBA 4CDWC 4ASKA 3KV9A 4WBBA 1RGSA 3U10A 4E27A 1JZ5A 4G4FA 3SMHA 2BPA2 4XE9A 4LTAA 1H0BA 3N9MA 5IVCA 1RUJ3 1H8TA 4JGZA 3ZX7A 4QT6A 2W1WA 2OZ6A 1UOGA 1F4HA 1S0DA 3MIFA 2FDKA 1FMD2 2X10A 2LALA 2WN2A 1H2NA 2A3YA 2D6LX 2ZGQA 3DEMA 4XFIA 2J1SA 1K45A 2ZHMA 3HIFA 1JYXA 4HFSA 3W20A 1PHMA 5JVVA 1W6QA 1OFNA 3I97A 4AQTA 1DQ2A 4WM7C 1W3VA 1HRV2 1LGBA 1MS9A 1RUD2 4LIVA 4Y1VA 3R4UA 1KS5A 1GMMA 1FYUA 1WW5A 2XJRA 2DV9A 4XFBA 4ZKTB 1A3KA 2BOJA 3KQ4B 4XQWA 2B46X 4BMBA 4GMP3 4FI9A 3VZNA 2XR4A 4LHSA 1ZREA 1TME3 4XACA 1SZBA 3H3LA 1UY3A 5C9AA 4QQPA 4LLFA 2GU9A 1U5IA 3B7MA 3V64A 2VUCA 2EIBA 4HETA 2RDSA 5ABJC 3TYJA 1AR82 2FMYA 2JDYA 1AR72 3W9AA 3NV1A 5E16A 2D5HA 2RVAA 2CAUA 3EJKA 4M3CA 2RS13 4CCLA 4CEYB 3ZFGA 4PQ9A 3HT1A 2D44A 3MFAA 4I3GA 4LBQA 1UAIA 2UYAA 4XVHA 2RS53 1JUIA 3OBAA 1N1VA 1MPXA 1PK6A 2D6NA 3VHPA 4CDUB 1WCQA 2W9XA 4UW5A 3ZVXA 3KCCA 4QX8A 4LMFA 4CDWB 4Z82A 4D7SA 1YI9A 2O1QA 2VQTA 1XU2A 4JKMA 1JH5A 4EN9B 4YWAA 2Z79A 3KCXA 1AVBA 1UPSA 2JDMA 3WR0A 1RVF3 2HWF3 3CO2A 5ISLA 3AJYA 2XOMA 1JMUB 1WLWA 2KD7A 2VW0A 1J59A 5LK5A 4NN0A 5SV5A 4GKXA 1WD4A 2AH2A 2JG9B 1MS4A 3ES1A 3RZHA 2PQQA 3ZYIB 1AYM2 5JWPA 5KR7A 3NV4A 1O3QA 4Q4W3 3ACFA 3BKZA 2IUWA 1J83A 4BQYA 3UK9A 4BPZA 3LA3A 2PHLA 3JCIA 5IVBA 4QD2A 1D4VB 2DFBA 2Y38A 2RG4A 3QH7A 1VBD1 1F15A 3FC0A 1UIJA 5FMBA 5FP3A 3RWNA 4QGNA 1HRI2 1UOJA 3GZAA 4GZ9A 3VBHC 3F2ZA 1V9U1 3FWEA 4K9SA 2ZX3A 1OT5A 4QPGA 5FPXA 3ILRA 1NCRA 1VBE3 2D3SA 5FRAA 4NIDA 3SCHA 5C70A 5A6QA 1H1IA 1UZWA 1TEIA 3NNFA 2WQZC 2PYTA 2XLGA 4AHWA 5ABJB 1EAH2 1PM7A 2HKXA 1UMZA 4EN6B 4KU8A 5BNOA 5C3OA 5IHRA 1E5RA 2ZMLA 5DDJ2 5DG2A 2C26A 5FWJA 1UXZA 3UGGA 4ZXKA 2VNVA 3MBWA 5HV0A 3MI8A 4I0AA 4G9SB 2D7FA 3TRSB 1YI7A 4LHNA 5FDBA 1GSLA 1ND2A 4Q4V2 4DMIA 1Z7S2 3GJAA 4PLNA 1WKYA 1LB2A 3ZXEA 1S55A 3H8UA 5JZGA 1D4M2 3CJIA 1WMFA 3OY8A 2BZDA 2VD7A 1WW7A 3IAPA 3NL1A 1PGW2 1ZA4A 3H1WA 4XEZA 4EYUA 3WD5A 4ZHNA 4LQRA 1FPN3 2VNOA 4S2DA 5JIUA 2JKXA 1QDOA 1OSGA 3I59A 3V0BA 2E7TA 4EE2A 4XUOA 4ES9A 5A7NA 1ULCA 3TNPB 2I45A 3I4IA 4N8MA 1QEXA 2HWE2 1L7QA 4DB5A 4ES8A 1OFSA 3I2HA 3V0AB 2DBIA 1Q8QA 1AX2A 1ZBE3 3DECA 4IGPA 3O1RA 5JOWA 1A8MA 4RA0A 4WVZA 3H3ZA 4YGBA 3Q8CA 1POQA 3VBHB 1RC6A 3M3EA 4C8DA 5BYNA 1ASJ2 4R4ZA 2W52A 2YBPA 5GKAC 2V73A 3PJYA 3JQXA 1H30A 5A3NA 2VL4A 1AR93 5LK7B 1KJRA 4D69A 4KWLA 4CA9A 1XNBA 3OD0A 4XMIA 1ODNA 3CQOA 4I30A 1X33A 1ZZ8A 2BFUL 2CGOA 5DN2A 5C3SA 4LORA 4ZZ8A 4DIQA 4B4QA 2XB6C 3ECQA 1VBB1 5F5IA 5FMCA 3WDXA 3GNEA 4CCDA 1ZZ7A 4LO5B 2WAAA 3SLIA 1XBFA 4K8RB 4BYYA 1Q8VA 1WW6A 1YFYA 4PLOA 3RS6A 3UKTA 4IE7A 2WZPP 1GQPA 3VD3A 2HWC1 2LRPA 1R1ZA 2IXJA 4META 4OCTA 4LT5A 2XBO3 4A7YA 2BGOA 4C90A 4QXKA 1C8M3 3WF1A 1DGLA 4FQ4A 5KXDA 1CAUB 1MS3A 4MGQA 2DWRA 4M3CF 2E26A 5EFUA 3RI9A 1W6OA 2XLAA 1LOGA 4QHBA 1WMXA 3GYDA 2D97A 5F9TA 3TB0A 4XDOA 2GH8A 1YLLA 1XYOA 2KR2A 4C1WA 4CU8A 2XHNA 3PJQA 1GWMA 2BOIA 2R49A 2X53S 1SCRA 4J25A 4JKLA 1OQDA 3BODA 2Q5TA 2QBXA 3GZEA 4MV2A 3CEWA 4KH9A 4CCJA 1OLQA 4AFAA 1BK0A 1R082 2AGSA 5FZMA 5BUVA 2G1MA 3IKWA 2VTXA 1FOD2 1E5HA 2VU9A 3DUIA 4LBOA 4NWWA 1F8VA 4BZ4A 1F9KA 1DGWA 1FMD1 1LECA 3POEA 4UF0A 3ZOIA 1WCUA 5J09A 3J7HA 2EIDA 1TNRA 1NCQA 3HMYA 4AAXA 3E5UA 3ZKUA 4BQ2A 3PU8A 2DCKA 4KGGA 1QJY2 5DQ0A 1V6JA 1PO23 4AVSA 1LAJA 1IZ3A 5GLZA 4CRQA 4B1LA 4LPLA 5IW0A 1W9WA 1MQTA 3VBOA 1RUD1 1PZ8A 3AL5A 1X8MA 1QJU2 3R05A 4QPWA 3TAYA 3SHRA 4GH4A 1CZTA 3WQ0A 1W04A 4N9IA 2NP0A 3PUIA 5L7OA 1K5MB 3RZJA 2P2KA 1O3SA 4XJ8A 4R8HA 5CU1A 1O5UA 1O4YA 5FLHA 3B5LB 3H1YA 4XCAA 2YB7A 4BIOA 4IV3A 4PBOA 3ZIXA 1W0NA 2NYYA 2B4KA 3K4AA 4A3XA 1CAWA 2FDGA 4JHTA 1VRBA 4CU6A 1YQ5A 2Y6FA 1JHNA 1X36A 2D6MA 1AR81 2WS92 1AR71 3ACGA 4PI0A 2GMMA 2FQPA 2Q30A 1BMV2 4Q4X3 1GOGA 1GP4A 1NG0A 1JOBA 1RHI2 5GZEA 3WCRA 5FK8A 5I0DA 3BUCA 1C1FA 2W0XA 3VKNA 2VH9A 5L36A 1SBEA 3BALA 4PDWC 2XVLA 4OQ9A 2Q8OA 3E1F1 1HLCA 4XFFA 4XABA 1B09A 4LBJA 3IB3A 4O65A 4FTEA 5K9YA 2QE3A 2UURA 3B69A 4R9DA 2LS6A 3S57A 4X6QB 2JDAA 4IEOA 5FZKA 1UZVA 2VCCA 3VD4A 3LA7A 2BWCA 4GAZA 1QGLA 2J7MA 3PIJA 4XQDA 5E8AA 3VZMA 3WQ1A 2DYCA 3WDWA 4E2SA 3AKSA 2VOTA 1P8JA 5FPUA 4HPKA 5FZAA 3BIWE 5JSOA 1AYM1 1SPPB 4UFKA 4B29A 3H9AA 3VBRB 5B2GB 5LB6A 4OMCA 4XAEA 3I3BA 4LE4A 4RQPC 3LSDA 3TEZA 1CPNA 3WF4A 1QH7A 1UCXA 5FZ8A 2OVUA 3QBQA 1KD7A 4QB2A 1NE6A 2DVGA 2A73B 3C2UA 1MZ6A 1RUH2 3GBGA 4XAAA 1ULFA 3WINE 5F2WA 4AHXA 2ZGTA 4LA2A 5F37A 5CISA 2B9VA 1HRI1 4R4XA 1REFA 1YFUA 4W4ZA 2BJSA 4QPIC 4JAAA 2WZR2 3DV8A 3VKMA 3DXTA 3IBMA 1SFNA 5FZ9A 5K0UC 5L9RA 2JDHA 4QHZA 3BN6A 4WVVA 4YW1A 3A23A 1R1A2 2G4IA 5T50A 5KXEA 1AR62 1EAH1 3ON7A 1JYCA 3UKNA 5HPOA 1O7FA 4FP2A 4XF3A 5FYUA 1CX4A 3ETQA 4Q0UA 4TSVA 1YO8A 2NN8A 4XILA 1LOFC 5DDJ1 2VQ0A 4F7ZA 1YQ6A 2AR6A 5C71A 3ZMNA 4PDWB 2ARBA 3B02A 2XJTA 5BPXA 3WQ7A 3BCWA 3QD6A 1DBNA 3HD8B 2RHPA 4IEVA 4YGEA 3BVCA 4EWDA 3UKVA 2OX0A 4Q4V1 3VDAA 2JICA 3WHUA 5LRSA 1S0IA 3U0ZA 1UU6A 4YZ3A 5FZ1A 4E2GA 5FKBA 1VBA2 2DUOA 1LHWA 3T0AA 1D4M1 5A3MA 3WX5A 4RR3A 1UY4A 1W39A 1PGW1 4K7JA 3VLBB 4XOGA 4A44A 4IV1A 3ACHA 4HVRA 1CAXB 3O14A 1O5LA 2Y60A 3DN7A 5T54A 1NQDA 2WINB 2XJPA 2JB4A 3KVAA 4FFGA 3P3NA 4UW3A 4B1MA 5BNNC 2WLQA 3SKVA 1QH6A 2PELA 3FZ3A 3IPVB 4N9HA 5FTTC 2VG9A 4XTMA 2XXZA 4CDXC 2C6SA 2HWE1 2VZQA 5FYYA 5T5JA 3ETPA 2WRAA 2GNBA 4RQPB 2OKXA 1IKPA 2ZKNA 1XYPA 4K6BA 5FZOB 5J98B 3UJOA 3C7FA 3LOIA 4LO4B 4COYA 1HN1A 2MPFA 4V2VA 4C91A 4FAGA 2ADDA 4KMQA 4A45A 4FPKA 1N3OA 1KITA 1BBT2 4QPIB 1ASJ1 1VBD3 4AXOA 5FXVA 1SMVA 2R072 4ORFA 1TZOA 3URFA 4GALA 4WVWA 4TN7A 1V9U3 3PU3A 4LOTA 4Z92B 3U14A 1C3HA 1TVGA 4Y20B 3NW4A 4DUXA 3OGSA 2JJ6A 4COZA 2Q8EA 5JOZA 2VJXA 2K9ZA 3H7YA 4A41A 3BU0A 1CJPA 5J7MA 3PURA 3T0DA 1URXA 1OMIA 2WWUA 2ZAAA 3A0KA 4ISRA 1MS0A 1AXKA 3WNOA 3OD4A 5HCHA 4AQ6A 4XZPA 1OPMA 4AK3A 1B35A 3IT8A 1JOJA 4JGZC 5T5OA 3HQUA 2F17A 5C6CA 2C4XA 1J84A 5FUPA 3FHAA 3USUA 1CIWA 1BLZA 4IGQA 1UOFA 5HCBA 5F5QA 4MSVA 3Q9OA 4K1YA 1DG6A 5FXWA 1C8NA 4B3NA 4D7YA 4DXRA 2HLEA 5JPMB 1EPWA 4P9JA 1ENQA 3WG4A 4XDPA 2WWJA 3AM2A 1C57A 3E97A 2DVAA 4IETA 4NOTA 3VDCA 5IAXA 3U37A 2I07B 2QDRA 4WM8A 3WP4A 2XJUA 2Q8CA 2CYFA 5BNNB 1SLIA 4C0HA 4UWDA 1JBCA 1ZA7A 1R081 4MLOA 1CGPA 1FOD1 4CDXB 5CVRA 1JYWA 1RL3A 1ACCA 4GXLA 5FUNA 1FNYA 4PT6A 3ZXFA 3O0WA 1DZQA 3KSCA 2ZEWA 4H2AA 4IEWA 3GBWA 4CUAA 5C9AC 2R1DA 3ZYPA 4XYXA 2JDUA 3VHOA 3RWKX 4MG2A 4M0NA 1QJY1 5FYIA 4E4ZA 4H55A 1Y9GA 2YGMA 4L0PA 2NPIA 1QJU1 2WNUB 5EWSA 5FMDA 3ZFGC 1HJFA 2WNEA 4EQVA 4GWMA 4URAA 1W8HA 2WNVA 3N7JA 4CEWA 3THDA 1PK6C 1VAKA 2W39A 4FP3A 1GNYA 4BU2A 1JS9A 3L2HA 4C0BA 2WO2A 3VL8A 2JE9A 3W59A 2VMIA 4Q4Y2 3VZJA 2V4AA 1C4RA 1O8PA 2V09A 2ZGKA 1VBB3 3UV9A 2OPKA 4JGZB 1AHSA 2D3RA 2VOVA 1RHI1 2VZ1A 2RMU3 1XU1A 2VZOA 4AHZA 5ACA2 3WNLA 4Z8BA 1S1AA 3S30A 4IEPA 3UT0A 3T4HB 2VPVA 1NA1A 3VHRA 2WSUA 4A7ZA 2Y64A 3ZPYA 1W6QB 3WF3A 4EZ4A 4RL7A 4ISQA 5EQUA 3M1HA 1UWWA 4Q26A 2ZGLA 3LWCA 5FZCA 2A3WA 4R9AA 1N1SA 2JB8A 3TOJA 5FO8B 2GN3A 2W47A 3PMEA 4MHRA 2ZEYA 2EF6A 2QFEA 4Q0PA 2X29A 4NIIA 4QPGC 3U4XA 3MIBA 1NCRC 4HKWA 4Q0SA 4N7UA 2MHFA 1MVQA 2QQIA 3OGJA 1FMD3 4FPYA 4OZOA 1PIV2 5FJHA 5GZFA 5I0RA 2ZA9A 3FBYA 1D2QA 3CZJA 4FPJA 3JB4C 3O0XA 4W50A 5A7WA 3WOGA 5AFEA 5BNOC 1RUOA 4D94A 4M3CB 2GMPA 1H2KA 2ORZA 3BOPA 3ZFGB 1RUH1 1W2AX 3POFA 3OUIA 3ME2A 1OLME 1HRV3 1RUD3 1AXYA 4CP9A 3LFIA 1PK6B 4Z2AA 2WZR1 2ZHNA 3FN9A 3GDBA 2ZHLA 4CDQA 4IERA 1ND2C 5FYSA 3TEXA 3LOBA 3FE5A 3IM0A 3NJZA 2JX9A 4U36A 2KM2A 1TQ5A 2F4PA 2PHTA 2W3JA 1PZ7A 3NNGA 1AR61 3VGIA 4IXLA 1VLNA 1JODA 4OUEA 4BXFA 1SLAA 3PDQA 2VZSA 2ZPXA 2VMDA 4DEVA 1L3JA 1S2EA 3N9QA 1BJQA 2WWSA 3B01A 4LOSA 1W90A 2EICA 4RYDA 1AR83 3T2PA 4M00A 1AR73 3OUJA 3WLUA 3P1IA 4ZONA 3WF2A 2F4LA 1XB9A 2A5ZA 1GYKA 3PL0A 3CIHA 1QJX2 1AYN1 5LY2A 3M7AA 3T1MA 2PMWB 3ZR6A 3KLSA 4EV0A 4DUVA 1JN2P 5A32A 1G9BA 4MGKE 4CU7A 4ARYA 1RIRA 2J1RA 1X8EA 1S0FA 3RVHA 4ARXA 1GUIA 1ODMA 2ATFA 1ZRRA 2Q1MA 2XLFA 4FXGB 1DGRA 1VBA1 1ENRA 1F2NA 1GNHA 5A6ZA 3NAPA 3O7OA 3THCA 2ZABA 1I5PA 3X29B 3AMMA 4CXWA 4CPBD 4DXTA 3CNAA 3J7MA 4QPGB 2VVFA 4AEMA 1S0CA 5FYZA 1NCRB 5BY5A 4QU2A 5LBFA 1NLSA 2YDEA 1XNAA 3OGRA 4Q5OA 4F8AA 2DDUA 3POGA 1X82A 3AXEA 3IMNA 1DCSA 1FXZA 1AYM3 2CDPA 2O14A 4XJUA 2XPJA 3LAGA 5FZDA 2WC2A 5IYYA 5FYMA 3RNSA 1LHOA 3ST7A 1XC6A 4W8JA 1VBC2 1MACA 1SG3A 3WSOA 1U5YA 2VNGA 3FFQA 3ZYGA 4MXWB 1BBT1 4CUGA 2QTWB 1UX6A 2R071 4I02A 4XF4A 1ND2B 2FDJA 3A22A 1HRI3 2FCVA 3PHMA 2UYBA 5C5UA 1LODA 2KXLA 4NRPA 2GP5A 1HB4A 5FP9A 3OY8B 3I2IA 2WQ4A 4XJZA 1YIPA 1SQ4A 3POYA 4UFHA 5FPBA 3ZYRA 4HVQA 3OPZA 4HANA 4QQLA 4ATFA 4H3WA 1EAH3 3ILNA 5BNQA 2JENA 3D8CA 5FZLA 2D43A 5JCTA 4AVVA 3MIHA 3I59B 4L2NA 3RMYA 1E5IA 3WNMA 2VTFA 3WQBA 5LWBA 5DDJ3 1ZRIA 3V0BB 3Q8AA 5CG9A 2BBVA 3AYCA 3MYXA 1BVVA 4RD7A 1U12A 2GC2A 3AKTA 1SCSA 2WIIB 4WV8A 1EY2A 5CKMA 4YM1A 4QPYA 1US2A 2HWC2 4Q4V3 3VV1A 1BXHA 2P3JA 5IVYA 4BQWA 1Z7S3 2DVBA 3IIIA 3PMSA 5FY7A 3WDYA 3AMQA 1N47A 1D4M3 3ZN6A 3B3QE 4DPNA 4XDQA 4KG8A 3HR9A 1PGL2 1E57A 1DQ6A 3NNLA 5FXXA 4A4AA 3NO8A 4CXXA 4DZGA 2GN7A 4GH4C 1WCSA 4UBGA 5L7OC 4IEZA 1UOBA 2D6PA 2DUPA 4IE0A 1RMU2 3DYPA 4PIZA 4FPEA 1S0GA 3IWZA 1AJOA 1W05A 3CKHA 4IV3C 1DQ0A 2HWE3 5FPZA 4M3CE 1QF3A 3OJBA 5H9QA 4CCNA 4W6YA 1VALA 2WNOA 2FD8A 4HKLA 2X8KA 1SEFA 2RDQA 3RYPA 2VM9A 2PLV2 5GLVA 2LW8A 2VO5A 2EIEA 3EXUA 5AVAA 1ASJ3 2Y0IA 5C3RA 4W65A 3C7HA 1W6OB 5TSWA 3ORJA 3AFKA 2Y6HA 5A80A 4LITA 1FI2A 1Q8SA 1TMF2 2ILMA 1UO9A 2BUKA 4EWAA 3Q8FA 5JR2A 4Q4Y1 2IWGB 3PLQA 1MZFA 3OBZA 5F3CA 5FK7A 2B5HA 1OQEA 4YZ2A 3LQCA 4CU9A 3DPRC 4HSLA 2PFWA 2YU1A 3WP5A 3MLLA 4BDVB 1IG3A 5EXOA 1COV2 4N53A 3DCQA 1QJEA 3I54A 4NHMA 2QQJA 3MV11 1OQ1A 4LK7A 4WVMB 3QOPA 5ACA1 5F5AA 3T2QA 4LBKA 1O6UA 1RYYA 3ZXDA 1UY2A 3TN92 1NLRA 2IXKA 5CKNA 1HX6A 3KVBA 2GP3A 3ZYBA 5CEHA 2WYFA 4NMIA 5ERLA 3G7DA 5I8SA 3ZDSA 1OH3A 5IVVA 5FY9A 5B4XA 4Y22B 5FZHA 1F5JA 1W3XA 5DMYA 1XSQA 4GH4B 4YARA 2DCJA 4AQSA 5L7OB 1N3PA 2QNKA 2BRTA 2C0ZA 3HBKA 1W06A 2VCAA 3QH6A 4WZFA 1R083 3VKLA 4IV3B 1FOD3 1XE7A 5DAVA 3SXWA 1CAWB 2NMNA 5GJ6A 5J96B 1PIV1 4L9BA 3LDBA 1POV1 4XBQA 1H4GA 4D6RA 1VP6A 2MEV2 4JTNA 1ALYA 1QJY3 1T6GC 1UYZA 3IIAA 4PQQA 3KQRA 3VD7A 3PVBB 1OD3A 3KZ4C 3JU9A 2IC1A 1CESA 3ENRA 3R4SA 1RUI2 5LBBA 1QJU3 5FMOL 4AWDA 4XHXA 4WM7B 3VZOA 4JRAA 2E31A 4P9LA 4X8PA 2FCUA 4NO4A 2VMEA 2HWD2 1CAVB 4NHLA 4PI2A 5LBEA 3ZSJA 4ATEA 4V2WA 3ZDVA 1UQXA 4XUNA 4P5HA 1ENSA 4RR3C 1UL9A 2ZX0A 4CUCA 4YZ4A 4JQRA 4MVTA 3DPRB 4IV1C 4LKEA 4YVSC 4E8DA 3SC7X 1QNYA 2WS93 3I2KA 1KQRA 2B9UA 2C9AA 1CPMA 2QQLA 4BCUA 3OPTA 1RHI3 4PF5A 1QJX1 5C3PA 3WDVA 2YPJA 4AFDA 4CCOA 3INAA 4AR2A 1YEWA 5LW9A 1I5ZA 3VDDA 3HVDA 3IDEA 4K1ZA 4N43A 1QXRA 2BFUS 1HN0A 5JDBA 2OXBA 4JDNA 4QMAA 1FV3A 1G8WA 1OURA 4FPFA 2E32A 4JGYC 4NAMA 4YSFA 3T3YA 4N90A 2NLRA 3KF5A 1ZZBA 5FJKA 3ZPOA 1OVPA 1X7NA 4H7LA 4O9GA 1W6MA 2X09A 2VBBA 4Y5Z0 5DZGA 3D4KA 3PUQA 5EJ3A 1APNA 5FZIA 4IDZA 5FZ4A 3MZHA 1VRH1 4F83A 1CWPA 5FOBB 1JU3A 2GNTA 1OUSA 4BIFA 5JI7A 4OHXA 5FR3A 5GLWA 2YC2A 1GR3A 2R7EB 4UFMA 4Q0VA 1LOCA 4X8NA 5FLIA 4DRVA 2W94A 3UYJA 3BOWA 1VBC1 3JD72 1RUC2 2Y6GA 1JZ6A 2A6VA 4XBLA 1RUH3 2EVXA 1LEMA 2GDFA 3DKWA 1XE0A 4BHPA 2E9QA 3MGUA 1KJLA 2WZR3 2Y34A 4CUBA 2WABA 4DUWA 1JZ4A 5FPAA 4RR3B 2W1SA 3U1XA 4YVSB 1AR63 1R1A3 4WM8C 2I2SA 4AQ2A 1SLLA 2AEYA 5I93A 2E53A 2YG0A 2RDRA 3LA2A 1KFUL 1EV11 1ZBA2 2W2IA 1VMHA 2Y6KA 5C8CA 1W9YA 1CR7A 3M3CA 5A3OA 1W8ZA 2BBAA 3AYAA 1HV0A 1AYN3 2WZEA 5A33A 4BISA 5CFCA 4JGYB 3AK0A 3ZSLA 4DY3A 5J3UA 4D0QA 5KHJA 1HXS1 5CFDA 4YM0A 2VVEA 4QX3A 5IUQA 1W6PA 3WG2A 1VBA3 3ZXGA 1UW8A 2JDZA 5J48A 3UETA 1MS5A 1PGL1 5KHGA 3FHIB 3C8XA 2ZCWA 3HJRA 2JEMA 3R6SA 1OI6A 3OCPA 3TEYA 3QLQA 1BCXA 3B00A 3LEIA 4X6RB 1RMU1 5A3PA 5JMOA 3DGTA 4FSJA 5AFBA 4IEUA 3LEKA 4P08A 2GC0A 3FBMA 1GZ9A 1GZWB 2ET1A 4XURA 5T52A 4CXYA 1LJ7A 3O1MA 3NKGA 1UMHA 2PLV1 1AX1A 4MO3M 4CCKA 1REEA 2QDNA 5JXJA 1AXZA 3WW4A 1YWKA 3T1LA 1OC1A 1BBT3 2BDRA 2N7GA 2R073 3MF6A 3MO4A 4AGGA 2QQKA 1ND3C 1DQ5A 2ZKLA 1NZCA 2VC9A 5D21A 1AF9A 2OIIA 4QGMA 1NA1C 3KGZA 4MGZE 3I3DA 5LZ6A 2YY1A 2YC4A 3H3UA 5JMCA 1TMF1 3PTRB 1LHUA 1AZDA 4WM8B 3WNKA 4AI8A 4COWA 4QWNA 4TZDA 4Z07A 2TUNA 3CDZB 3GGLA 3FJSA 1V0AA 2FDHA 1VR3A 3PTYA 5DZEA 1IS3A 1OHFA 1VJ2A 2JDKA 3N36A 2ZMNA 5FY5A 1COV1 3ZFEC 3VKFC 3TNQA 3H8OA 2QVSB 3VDBA 1I6XA 1YXWA 4LK6A 3D3AA 4FOVA 4OVEA 2NZ9A 1PX3A 5FQ0B 3TN91 4I0BA 4BLIA 2FZ1A 2R32A 3LPFA 1J3QA 2D93A 2DURA 2VOXA 1LRHA 2D6KA 1V6MA 4CZSA 2ZOEB 3WCSA 4QB1A 3VB9A 4IEQA 2GSYA 5EV7A 2PHXA 1R64A 5LCWL 2K0GA 4XBNA 4Y4RA 4XFGA 4Y33A 4B4PA 4P14A 2VOWA 3AXDA 1F5FA 2OT7A 4CDQC 2W08A 2C1FA 4QKDA 2JDNA 1I1EA 5EIYB 2VMGA 4GKYA 4URTA 5FZEA 3ZYFA 4MHUA 4CE8A 5HCFA 4H7MA 1XXNA 2QJVA 1ZZCA 2JG9A 3LIHA 3NJYA 5IWFA 2VCBA 4AGVA 1AL22 5ANQA 2MEV1 5ANNA 2OZJA 3UL2A 1G9AA 3AZZA 2UU8A 1M06G 4HSJA 1Z0HA 2VXJA 4BA6A 1RUI1 2VMCA 5APAA 4AF9A 1ND3B 2WT0A 1UY0A 3D0SA 4YGCA 1NA1B 1Q43A 5C5TA 1OA3A 4HG6B 1QWRA 3I2GA 2WFF1 1HDKA 2HWD1 2SLIA 3F95A 4FOYA 1RUF2 4YM3A 1PMHX 1JI6A 4YGDA 1M4WA 1UD1A 4KWJA 4KBZA 3M3IA 3LD8A 4IUGA 4Q8LA 2XJVA 5DUWA 3P6BA 4Q4Y3 4LEJA 2XL9A 4Y24A 1POV0 5C4WA 4KBBA 3ZFEB 3T09A 1QHDA 1UNBA 3GBFA 3MPBA 2E6VA 2OQ7A 2IXCA 3ZMOA 4KG0A 4E4DX 4D3WA 1XE8A 4Y3OA 4JVAA 4MZUA 2X5IA 5DUUA 1OH4A 4E8CA 1LOBA 4QKFA 2JWPA 5ACA3 2OUJA 2D40A 1BHGA 3I2JA 5A3TA 5K7PA 4RN5A 3N9LA 5K4LA 2UWBA 2PHFA 4J6GA 3ES4A 2WO3A 3EB7A 1IPSA 4EJRA 1AYN2 1BVP1 4IEXA 4XZUG 2YFUA 3M70A 1DYOA 4OI4A 3RJRA 3H8XA 4ZU7A 1DZTA 3JQWA 5CKQA 5I0TA 1UZZA 4Y1XA 4CDQB 1CN1A 1T6BX 5G05L 2R0FA 4OQ8A 1RTVA 3S5AA 1NYWA 1MS8A 4D7TA 3FUQA 4YW6A 1ULPA 4IE6A 1YRZA 1MZEA 1ULOA 4A2UA 3RZGA 5LEJA 1PIV3 3I3QA 3LSEA 1GZTA 4I01A 5LA0A 3SCGA 1POV3 1EUTA 2CU5A 5JIAA 4AI9A 2HYKA 5FYBA 4QHOA 4E4SA 1GLHA 3JD71 3SH5A 2JG8A 3V0AA 1RUC1 4HLTA 1CX1A 4QDQA 2AACA 4QQHA 4QQ2A 4MGSA 5FZGA 5KC6A 2QKDA 2PHWA 1WMEA 2XL7A 5A32B 4CSWA 2W95A 5B4NA 3RRDA 1ONAA 4YW2A 2QQPA 3GZUC 2RJKA 5FO9B 5DUXA 3HNYM 1RXGA 4HBNA 4Q29A 4M4RA 2O8OA 2FHRA 4AYUA 3W5NA 5FLJA 3ZN4A 1NX9A 3S7IA 2IXHA 1Y3TA 5H9SA 4UW6A 3AYEA 3AKRA 4H14A 5EPAA 4L11A 1VB2A 2G9FA 4XCBA 3WDUA 3I2DA 5K0UB 1SFYA 4OHYA 2GAUA 1WWYA 1JYTA 1ZZ9A 1OKOA 1RUJ1 3ZO0B 1ZBA1 5LBCA 1W0OA 2P34A 4GWJA 1W2TA 2CL2A 4FBFA 1YIFA 3EYPA 5EZWA 1XNKA 1LULA 1QJX3 2B8MA 2ERFA 2DVDA 2A6ZA 5D2AA 3K3OA 1H8TC 4K3UA 3KMHA 1D7PM 1CAUA 1OF4A 2WJSA 1G7YA 2XONA 4NPLA 3M2MA 1KXGA 4HMZA 4OULA 2DF7A 2PAKA 5L73A 1UIKA 2RR12 3G6JB 1HQLA 2IXLA 4MADA 1D0GA 3MLKA 1AUYA 4Q27A 3LF7A 4GB31 4AVBA 4OI0A 3AC0A 4HZFA 3W58A 1VAVA 1MZ5A 1OOPA 1YYNA 2JXAA 3CHXA 4QM9A 3AVRA 1VMJA 2VZTA 3WNNA 2ZZJA 4NJ4A 4AEKA 4HL0A 1N3QA 3USSA 2Y6JA 3B94A 4BMEA 3UGHA 4IE4A 2ZX1A 1W2NA 1GP6A 3NNJA 4RS5A 1WD3A 2P6HA 4L8QA 4AOCA 1NAEA 2ZACA 3SEEA 4I3PA 1IOAA 4K8FA 4NIHA 4OUMA 3N3HA 2VUDA 5D8AA 5LATA 3BPSA 3ZFFA 2WT2A 4CP2A 5KHKA 1ZYBA 1VBC3 2VOKA 4HXCA 1LEDA 4KL1A 4DRRA 5JXGA 3WP3A 3HQRA 1LCLA 3HQXA 4N53C 2K2SA 4Y1YA 3VZLA 3KHBA 2DTWA 5CA6A 3ZXAC 2Z69A 3LPGA 1DIWA 5HBAA 3AP4A 3K48A 3L9JT 4JC1A 5A7OA 3N4MA 4BXSV 3N7MA 4JHZA 1JXNA 1K5MA 2YMZA 2TNFA 1EUUA 3ZN6B 3FLPA 2RM22 3KV5A 4P9WA 3WVJA 3JBG2 5IT6A 4S2FA 5J36A 5FPVA 2C9KA 2BYVE 3VD9A 2BP6A 2JKBA 2WFPA 2P17A 1IS4A 4LBLA 5KBFA 2FCTA 2BW8A 4YNIA 2E7AA 5HXMA 2DVFA 4XUPA 1EV13 4K40A 2VZUA 1H8TB 5CB7A 3VKOA 2HYXA 3VBFA 4DFSA 3MEPA 4XF1A 3N7KA 1O4ZA 2HWC3 5GZCA 4P9GA 5IVEA 1GP5A 2KA3A 2XDVA 1ZRCA 5KC5A 2QQWA 2RS32 2OUHA 2P4EA 4OUSA 1A34A 2OYZA 2HBUA 1FT9A 4B7EA 1DGRN 3W21A 1JUHA 4E2QA 2Y26A 1GU3A 2J42A 5EJ1B 2Q1ZB 4UXAA 2EXHA 3RJ2X 4RHV2 5CBLA 5GZGA 4BQ4A 2DCTA 1RMU3 3GCWA 1MR5A 1XRUA 1RXFA 3IDAA 2B45X 1D2SA 4FPGA 4YZ1A 4LO8A 1PNFA 2C5DA 1NY71 3WP6A 3GCXA 5J37A 1AL21 1SPPA 2NMOA 1XYNA 3VBRA 2PAMA 3AX4A 3I7DA 5C9AB 5F3IA 4N53B 3AP9A 4MX3A 4DNYA 1AL0G 2WYSA 1SBFA 3E6BA 2PLV3 5BNPA
chains in the Genus database with same CATH topology
2NM1A 1LGCA 4AEJA 2DUQA 1O3RA 2VULA 1ENXA 4ASMB 3VDDC 4PBPA 4Z1VA 1RUF1 4OHVA 5JSRA 4FVVA 4N43C 2O8QA 4QGLA 4LBQB 1TMF3 4YRDA 3AJZA 1XNDA 1V6IA 3E5XA 1DHKB 1SLTA 1ZM1A 1FPN1 1IHMA 4XFHA 4XFAA 5JPNB 5JZGC 4TLFA 3CJIC 3OF1A 3WHTA 1COV3 1WLCA 4COUA 4INDA 4HN0A 3OBTA 4FOWA 1XNCA 3TN93 3N7LA 4JCKA 4AVTA 4HT1T 3CJXA 1LOEA 1LTEA 2Q4SA 3FFZA 3HBZA 4FPHA 1X50A 2ARXA 1WW4A 1YFWA 1FAYA 4ZU4A 3KM5A 4YW5A 4M01A 2BEOA 2D98A 1RB8G 3N35A 3FX3A 1BKZA 2EAAA 4NHKA 2P37A 2FMDA 3IPVA 4FT8A 1VRH2 4Q2FA 4YW3A 4AI3A 2A7AA 1SLCA 5E1RA 2MEV3 1G86A 2XUMA 2BWAA 2HWB2 2ZGNA 5T5PA 2ZGOA 3VL9A 1J3RA 5BNOB 1EP0A 1RUI3 2WL1A 4XJ9A 2XH6A 3VDDB 4B8EA 4LBNA 4QPIA 4N43B 3O12A 2E63A 5CFCC 3GHMA 4XXAA 1IKQA 5CNAA 2HWD3 4YZ5A 4KU7A 4Y20A 1W6MB 4NPRA 1CONA 1S0JA 4AE2A 3VN4A 1OD5A 5JZGB 5C33A 3CJIB 4LR4A 4EWEA 4MXVA 1LESA 4OZXA 4DINB 2B42B 4M0HA 2CGPA 1U5XA 1U5ZA 4Z2WA 1PVC2 4XW3A 1EV12 3MPPG 1WBLA 2ZX4A 1TE1B 2RR11 4RSUA 5IK7A 1LKNA 1NCQC 3ZYJB 5H9RA 2ZTNA 1HXS2 4LUMA 1QQP2 4FQZA 4AI1A 3MLJA 5JOXA 4PLMA 5BNNA 1MQTC 3VBOC 2DCYA 3AP6A 2XKOA 1QOOA 3QACA 5HCAA 3FLRA 4AGRA 2R062 2EIGA 4EN8B 3U11A 1RUNA 4YG6A 3ATGA 3WG3A 2VMHA 3JD73 1W6NA 3R0RA 1RUC3 2WA3A 1OA4A 2R16A 4XJAA 1N1YA 5CFCB 2VQAA 1BK1A 3B9CA 5A3LA 3ZN5A 1S0BA 2WNUA 1UKGA 2R30A 4LBQD 1D0HA 1DF0A 2BQPA 2ZHKA 3B9IA 3ACLA 2R1BA 2H0VA 2RM21 1NOVA 2VUAA 3JBG1 4S2GA 4RGGA 3PVNA 2UWAA 1DGWX 4FPOB 4GQ7A 2GZWA 4CP0A 4LBMA 3ROUA 4XPVA 4GULA 5I8TA 2DU0A 4XIKA 1ZBA3 4WZCA 3FMGA 5FMOS 5AC92 1PGSA 4GA9A 3CU7A 2E51A 5F1RA 4BM8A 1YFXA 2EAKA 2JG9C 4YVWA 2ZAHA 1ZZ6A 1QDCA 1QXJA 2RS31 2ES3A 1A8DA 1NCQB 4OLLA 1QNWA 4YYOA 3E5QA 4RFT0 2GC1A 4GB33 1KS4A 5T55A 2UY9A 1EPZA 4RHV1 1MQTB 4Y26A 3VBOB 2AENA 3AZYA 3D0JA 4MUVA 1MEC2 2P3IA 4LO7A 3KGLA 4AFBA 4HK8A 2DTYA 4I2OA 1GV9A 1VB4A 2R0HA 4NWVA 1CJDA 3WXPA 1KFXL 1GQGA 5C4WC 3AZVA 5FO7B 3MDPA 1J3PA 3SCFA 1S2KA 1QJZA 2PHUA 4XF0A 1C5HA 3VBSA 2X5IC 4PJYA 2TEPA 5KHHA 4CP1A 2A3XA 2GH2A 1H2LA 2BNMA 4AVSA 1RUE2 1BZWA 5KHIA 4IQPA 1GKBA 1I9RA 4KWKA 2JE7A 3AFGA 1W0PA 4DS0A 2PN5A 4FXKB 3VZKA 3EBRA 1LU2A 1RUG2 3O5SA 2WFF2 2XJSA 1DZRA 3OYWA 2ZGSA 2DU1A 1CVNA 5IK5A 2XG3A 1VIWB 2A6WA 3PVOA 2QCSB 3RYRA 4K21A 2O0OA 1BEV2 3NSTA 1JW6A 1UPIA 4HPKB 2Z5WA 1OKQA 3THPA 3OBRA 1HW5A 1YHFA 2JG8C 3SITA 3VBUA 3WUDA 2W68A 1QXPA 3SISA 5I91A 3KT4A 3ASIA 1GZCA 1YJLA 2BGCA 2FBEA 2XJQA 4PIYA 1G9FA 3MICA 1ZRDA 3RPQA 3AYDA 3WG1A 5C4WB 1BQPA 1DQ4A 1AL23 5T3NA 2XHKA 4MYEA 1UN1A 2IXIA 2HWB1 2X5IB 3WW2A 4AI0A 4Y1UA 1J1TA 2VUJA 5SV8A 2B7YA 4AW7A 1IS6A 4MXWA 2QUOA 3J9SA 4AVAA 1G9DA 1B35C 3KT1A 3J8F2 5DUVA 1PO12 1RUF3 1GNZA 1OPOA 2HEYF 2R042 2YROA 3L2YA 3WV6A 1YCIA 4C1XA 1LENA 3GHNA 4AEDA 4TYSA 1LOAA 1U0AA 1OOPC 1ZRFA 1QMJA 3C3VA 3V56A 1KRIA 1WUVA 4IV1B 4NR1A 2ZGRA 1PVC1 4OHZA 2PTMA 5EYYA 1RUJ2 4OFGA 2CTVA 3BB6A 4LULA 4RS5C 4L92A 3QCWA 5JR7B 2JG8B 2JECA 4CTEA 4HKOA 2PHRA 5D8AC 3ZFFC 2PA7A 1DYPA 2LTNA 3BTAA 4BQ1A 3KCYA 3LGRA 1QQP1 3TBDA 2XWJB 5FCCA 4A7KA 3D6EA 4RGAA 1H1AA 5JSPA 4GB32 1K5MC 3CLPA 5DXDA 3ZIWA 2PHDA 2WNVC 1WCDJ 2R061 4CEWC 2XWBB 1MS1A 1R091 1RITA 3A4UA 5K8SA 4YM2A 4AVCA 1QOTA 1TME2 3FUOA 4YFZA 4PIXA 2ETEA 2QZ3A 2RMU1 3M3QA 3AZWA 1B35B 2A6XA 3JZVA 3VBFC 3AP7A 3RMXA 5AVPA 3USUB 2RS12 2ZZQA 4BLJA 4UBHA 4KNCA 5FREA 1V6KA 2RS52 1OOPB 2HJIA 1WLTA 4Q0QA 4XQ4A 2UWCA 4LUKA 5IK4A 5CIRA 1G6NA 2YXSA 3AMPA 1V6OA 4R9BA 1W2UA 5AC91 4XFCA 4RS5B 1H8VA 1RVF2 2HWF2 2MNGA 4WVMA 3KT7A 3OTFA 3S6PA 5D8AB 3ZFFB 1Q3EA 3LCPA 1NE4A 3VBRC 4BH9A 2EALA 1WA4A 3WW1A 3LKJA 1H9PA 4ITCA 1J58A 1DU3D 2CWSA 4CEYA 2RR13 4Q4W2 2RJLA 5BNPC 3RQ0A 1HRV1 4Y22A 1WMDA 4EROA 4B4RA 4CDUA 2TBVA 3SH4A 1MEC1 4CDWA 1AX0A 2RE9A 2AREA 2WNVB 4CEWB 2ZS6B 5GM0A 2P3KA 1IPJA 1ULDA 1JYIA 1DYKA 2A6YA 2D3PA 1VBE2 3HWJA 1GICA 2GNMA 1NY72 3FLTA 2EXKA 3HT2A 5BV6A 3VBFB 1UF2C 4GWNA 1Y7BA 3APBA 3RG0A 1RUE1 4E9KA 5DG1A 4LHLA 4OHWA 4WM7A 2YYOA 4GIQA 4R52A 3NKTA 4JRLA 1CAVA 1CQ9A 3CL1A 2RM23 4N7IA 3MF9A 3ZXKA 3JBG3 1RUG1 3VHNA 3EO6A 5E89A 4Y1ZA 2XGXA 2LUWA 2GMEA 4S2HA 3ILFA 3DPRA 3AMNA 4YG0A 3HAGA 4BWOA 3NAPC 4UW4A 5KXBA 2IFWA 1BEV1 5ABJA 5LRRA 3NVCA 1BYHA 1FPN2 3ZXLA 3OGGA 2EXIA 2VVDA 2WLPA 4L99A 5I0SA 3JB8A 3GZTB 4YW4A 5BNPB 2CY6A 2RS33 3IN9A 1Y43B 3WUCA 2ZMKA 3EQEA 1ZBE2 1IPKA 4AFMA 3KB5A 4JV4A 1IGOA 4RHV3 4G3YC 1SDWA 1Z78A 2BVVA 3CF6E 4Q1PA 2VXRA 4B7KA 1DDLA 4ONUA 3H1MA 1V00A 3H0OA 2BNNA 4FCAA 4ZU5A 5CADA 1AR92 4XHBA 5EYXA 4L97A 1SACA 2XVGA 3AB0A 1HQNA 4W6XA 3NV3A 2CAVA 4LO6B 2CNAA 3RI8A 3V65A 4XIOA 2R6QA 3WW3A 1C28A 3RZZA 2ZX2A 3J8F1 4FTSA 1PO11 1Z7S1 2DFCA 2R041 2XBO2 4AG4A 1A6CA 3VBHA 1C8M2 1SBDA 2ET7A 2VECA 4Q1RA 5C8WA 4IEYA 1V70A 3K51A 5F6KA 3AKQA 4YVSA 3NAPB 5F6LB 4QX5A 2YC0A 5FAXA 1LGNA 3AP5A 4LLOA 3IDBB 4XXPA 1GBGA 4XTPA 2CWMA 5JLVA 4I09A 3MFCA 1FATA 2VW1A 3SNMA 2LM3A 4FTBA 1O3TA 4XJWA 4JGYA 5KXCA 3HN1A 1S0EA 5DZFA 1WBFA 1MVEA 4FPLA 4DXZA 1A78A 1XQNA 2VY0A 5JAXA 2D6OX 1QU0A 2D5FA 4QM8A 1ULGA 1PO22 4KQ7A 4XF9A 3BU7A 2WNUC 3WY6A 3E6DA 3SH3A 4LA3A 5I0UA 4KGQA 1YUDA 4QQOA 2GALA 1VRH3 4COVA 4J1WA 5IK8A 2CV6A 4GMP1 1GZWA 1FV2A 1TME1 2DCZA 5GALA 5LEKA 4Y4YA 5I8YA 1H1MA 2HWB3 1CD3G 2XKPA 3MIEA 3O0VA 4I0WB 1O4TA 3D5OA 4AI2A 1DQ1A 1HIXA 3NWKA 3MIGA 4P9IA 1H4HA 4Q4X2 1UU4A 2RS11 4YVWC 1ZX5A 5HXVA 4OI1A 1Q8PA 1ZNPA 1I3HA 1ULEA 2RS51 4P9YA 5FFOC 3ZXJA 1QY4A 2YUEA 3IDCB 4DOUA 4FO9A 1OLRA 2AUYA 3VUOA 3MW4A 1YNAA 2VGDA 1RVF1 2HWF1 1PVC3 1Q8OA 3AMHA 4FAHA 1GQHA 1LU1A 2ZGUA 3A0NA 5FQ0A 1W6NB 3I8TA 4P9XA 3M8LA 5CG8A 5E88A 1F31A 3AZXA 4Q4W1 5HI0A 1FX5A 2NQYA 3VBSC 3GF6A 3WDTA 1RINA 1HXS3 2YZ4A 4JDOA 2CGNA 2BVBA 1QQP3 3PNAA 2V5YA 4BE3A 2Y0OA 1H9WA 1Q56A 4JDMA 1O91A 4FPCA 1OA2A 5CAZA 2SBAA 2Z42A 3PVEA 2R063 1VBE1 3M3OA 3MW3A 1R093 1RJ7A 2WS91 3H7JA 3WZ1A 3THTA 5BXXA 2BTVC 4NVPA 4HK9A 1BMV1 2H6BA 4LE3A 1QKQA 3R4DB 4YVWB 1ND3A 2I74A 3B93A 3GALA 1NXD1 2E7QA 5FOJB 2VW2A 3POWA 3VBUC 4AHYA 2WA4A 2XVKA 1UZYA 3LB9A 4SLIA 1GFF2 1PVXA 3ZFEA 4TWTA 3ALQA 2BNOA 2F6BA 4Q8KA 1REDA 2A71A 1DFQA 4W6WA 5AC93 4DQAA 4O9EA 1NQJA 4HVOA 4LHKA 2A70A 1IQAA 3S0MA 1LHNA 4YG3A 2B39A 4IL7A 4YLZA 4PDWA 1EYBA 3VBSB 2IZWA 3MW2A 1FNZA 4XMAA 1ZBE1 3ELNA 2H6CA 3DL3A 3RDIA 4V1PA 2PAEA 3RSJA 1KDKA 1MEC3 1VBD2 1KDMA 3ZSKA 1HQWA 5T5LA 4F3JA 1AR91 1R1A1 1V9U2 1N1TA 1CAXA 4MGIE 3OYWB 3ZSMA 1JTZX 4AEDC 1ZVFA 3M4FA 3E6CC 4EN7B 2HEVF 2G9GA 1HKDA 1G9CA 2YHJA 1PNGA 2OW4A 4RQPA 4DY5A 5GLTA 1HV1A 4AFCA 1RUE3 2EXJA 2IFRA 2ZGPA 2XBO1 4MGYE 3JUUA 5C8CC 4MH0E 1C8M1 3BPZA 2AYHA 3VBUB 4LNVA 3DF0A 3ZSEA 1RUG3 4CYDA 1UU5A 2ENRA 2WFF3 1V6NA 3D82A 3RYKA 3TWIA 1H2MA 5JOYA 5CFDC 4EN0A 4IESA 5KWRA 5K0UA 4R9CA 1C5IA 3KD4A 5L19A 3EHKA 4PCRA 2WKKA 1BEV3 2EA7A 1LOFA 3S7EA 3AKPA 1WGPA 1SLBA 3J26N 3WT3A 2JD4A 3POSA 4XETA 1NXMA 4K20A 3UJQA 2AZ5A 4FOQA 1AJKA 4JTOA 2HEWF 3J4UH 2WSVA 1S2BA 5H9PA 4BOWA 1V6LA 2H0BA 1PO21 1TNFA 3U07A 4U2AA 1LHVA 2OA2A 4SBVA 1YJKA 1QOSA 2YGLA 4AEDB 1DLLA 3NV2A 1LR5A 2UY8A 5GZDA 4J1XA 2QZ2A 3LZZA 4ASLA 2ZGMA 1UKRA 1C1LA 4CDXA 5JI9A 1WLDA 4OI2A 1VAMA 3KS7A 3P3PA 1PMIA 2WT1A 1Y9QA 1R092 1VBB2 2GC3A 1RJ8A 2Q0AA 5C8CB 4Q4X1 2ZBJA 3J8F3 3MIDA 1PO13 2RMU2 2A75A 2R043 5A33B 2GNDA 5FBZA 4CEYC 1J1LA 5CFDB 4HN1A 1WCKA 2ZJCA 2FZ2A 1W6PB 1Q5OA 3WNXA 1GANA 2YV8A 1IS5A 1PZ9A 2VNRA 4GMP0 5D1IA 4CDUC 3H50A 4CDWC 4WBBA 3U10A 1RGSA 4E27A 4G4FA 3SMHA 2BPA2 4XE9A 4LTAA 1H0BA 1RUJ3 1H8TA 4JGZA 3ZX7A 4QT6A 2OZ6A 1S0DA 3MIFA 1FMD2 2LALA 1H2NA 2A3YA 2D6LX 2ZGQA 4XFIA 2ZHMA 3HIFA 4HFSA 1PHMA 5JVVA 1W6QA 1OFNA 4AQTA 1DQ2A 4WM7C 1HRV2 1LGBA 1MS9A 1RUD2 4Y1VA 3R4UA 1KS5A 1FYUA 1WW5A 2XJRA 2DV9A 4XFBA 4ZKTB 1A3KA 4XQWA 2B46X 4BMBA 4GMP3 3VZNA 1ZREA 1TME3 5C9AA 4QQPA 4LLFA 2GU9A 1U5IA 3B7MA 3V64A 4HETA 5ABJC 3TYJA 1AR82 2FMYA 1AR72 3W9AA 3NV1A 5E16A 2D5HA 2CAUA 3EJKA 4M3CA 2RS13 4CEYB 3ZFGA 4PQ9A 3HT1A 2D44A 3MFAA 4I3GA 4LBQA 1UAIA 2UYAA 2RS53 1JUIA 1N1VA 1PK6A 3VHPA 2D6NA 4CDUB 4UW5A 3ZVXA 3KCCA 4D7SA 4CDWB 4Z82A 1YI9A 2O1QA 1XU2A 1JH5A 4EN9B 2Z79A 3KCXA 1AVBA 1UPSA 3WR0A 1RVF3 2HWF3 3CO2A 3AJYA 1WLWA 2VW0A 1J59A 5LK5A 4NN0A 5SV5A 4GKXA 1WD4A 2AH2A 2JG9B 1MS4A 3ES1A 2PQQA 3ZYIB 1AYM2 5JWPA 3NV4A 1O3QA 4Q4W3 3UK9A 4BPZA 3LA3A 2PHLA 3JCIA 4QD2A 1D4VB 2DFBA 2Y38A 3QH7A 1VBD1 3FC0A 1UIJA 3RWNA 3VBHC 4FAGA 4QGNA 1HRI2 3GZAA 1V9U1 3FWEA 4K9SA 2ZX3A 4QPGA 5FPXA 3ILRA 1NCRA 1VBE3 2D3SA 5FRAA 3SCHA 1H1IA 1TEIA 2WQZC 2PYTA 2XLGA 4AHWA 5ABJB 1EAH2 1PM7A 2HKXA 1UMZA 4EN6B 4KU8A 5BNOA 2ZMLA 5DDJ2 5DG2A 4ZXKA 3MI8A 4I0AA 4G9SB 2D7FA 3TRSB 1YI7A 4LHNA 5FDBA 1GSLA 1ND2A 4Q4V2 4DMIA 1Z7S2 4PLNA 1LB2A 3ZXEA 1S55A 3H8UA 5JZGA 1D4M2 3CJIA 1WMFA 3OY8A 1WW7A 3NL1A 1PGW2 1ZA4A 3H1WA 4XEZA 3WD5A 1FPN3 2VNOA 4S2DA 5JIUA 1QDOA 1OSGA 3I59A 3V0BA 2E7TA 4ES9A 1ULCA 3TNPB 2I45A 3I4IA 4DB5A 2HWE2 4ES8A 1OFSA 3V0AB 1Q8QA 1AX2A 1ZBE3 5JOWA 1A8MA 4RA0A 4WVZA 3H3ZA 4YGBA 3VBHB 1RC6A 3M3EA 5BYNA 1ASJ2 4R4ZA 2W52A 5GKAC 2V73A 3PJYA 3JQXA 1H30A 1AR93 5LK7B 1KJRA 4D69A 4KWLA 1XNBA 3OD0A 4XMIA 4I30A 1X33A 1ZZ8A 2BFUL 2CGOA 4B4QA 2XB6C 3ECQA 1VBB1 3WDXA 3GNEA 1ZZ7A 4LO5B 3SLIA 4BYYA 1Q8VA 1WW6A 1YFYA 4PLOA 3RS6A 3UKTA 2WZPP 2HWC1 4META 1R1ZA 2IXJA 4LT5A 2XBO3 4A7YA 4C90A 4QXKA 1C8M3 1DGLA 4FQ4A 5KXDA 1CAUB 1MS3A 2DWRA 4M3CF 5EFUA 3RI9A 1W6OA 2XLAA 1LOGA 4QHBA 3GYDA 2D97A 5F9TA 3TB0A 2GH8A 1YLLA 1XYOA 4C1WA 3PJQA 5GLUA 2X53S 2R49A 4YFWA 1SCRA 1OQDA 3BODA 2Q5TA 4MV2A 3CEWA 4KH9A 1OLQA 4AFAA 1R082 2AGSA 5BUVA 3IKWA 1FOD2 2VU9A 4LBOA 3DUIA 4NWWA 1F8VA 4BZ4A 1F9KA 1DGWA 1FMD1 1LECA 5J09A 1TNRA 1NCQA 3HMYA 3E5UA 2DCKA 4KGGA 1QJY2 1V6JA 1PO23 1IZ3A 5GLZA 4CRQA 1MQTA 3VBOA 1RUD1 1PZ8A 1X8MA 1QJU2 3R05A 3TAYA 3SHRA 4GH4A 3WQ0A 4N9IA 2NP0A 5L7OA 1K5MB 1O3SA 2P2KA 4XJ8A 4R8HA 5CU1A 1O5UA 1O4YA 5FLHA 3B5LB 3H1YA 4BIOA 4IV3A 4PBOA 3ZIXA 2NYYA 1CAWA 1JHNA 1X36A 2D6MA 1AR81 2WS92 1AR71 2GMMA 2FQPA 2Q30A 1BMV2 4Q4X3 1NG0A 1RHI2 5GZEA 3WCRA 1C1FA 2W0XA 3VKNA 2VH9A 5L36A 1SBEA 3BALA 4PDWC 2XVLA 2Q8OA 1HLCA 4XFFA 1B09A 4LBJA 5K9YA 2QE3A 2UURA 3B69A 4R9DA 4X6QB 4IEOA 3LA7A 2BWCA 5E8AA 1QGLA 4XQDA 3VZMA 3WQ1A 2DYCA 3WDWA 4E2SA 3AKSA 4HPKA 3BIWE 5JSOA 1AYM1 4B29A 3H9AA 3VBRB 5B2GB 4LE4A 4RQPC 3LSDA 1CPNA 1QH7A 1UCXA 2OVUA 3QBQA 1KD7A 1NE6A 2DVGA 2A73B 3C2UA 1MZ6A 1RUH2 3GBGA 3WINE 1ULFA 4AHXA 2ZGTA 4LA2A 1HRI1 4R4XA 1REFA 1YFUA 4QPIC 4JAAA 2WZR2 3DV8A 3VKMA 3IBMA 1SFNA 5K0UC 4WVVA 4YW1A 1AR62 5KXEA 1R1A2 2G4IA 5T50A 1EAH1 3UKNA 1JYCA 1O7FA 4FP2A 4XF3A 1CX4A 3ETQA 4Q0UA 4TSVA 1YO8A 2NN8A 4XILA 1LOFC 5DDJ1 2VQ0A 4F7ZA 2AR6A 3ZMNA 4PDWB 2ARBA 3B02A 2XJTA 5BPXA 3WQ7A 3BCWA 3QD6A 1DBNA 3HD8B 2RHPA 4IEVA 4YGEA 4EWDA 3UKVA 4Q4V1 2JICA 3WHUA 5LRSA 1S0IA 3U0ZA 1UU6A 4YZ3A 4E2GA 1VBA2 2DUOA 1LHWA 5A3MA 1D4M1 3WX5A 4RR3A 1W39A 1PGW1 4K7JA 3VLBB 4XOGA 4IV1A 4HVRA 1CAXB 3O14A 1O5LA 3DN7A 5T54A 1NQDA 2WINB 2XJPA 5BNNC 3P3NA 4UW3A 2WLQA 1QH6A 2PELA 3FZ3A 3IPVB 4N9HA 5FTTC 2VG9A 4XTMA 4CDXC 2HWE1 5T5JA 2GNBA 4RQPB 1IKPA 2ZKNA 1XYPA 4K6BA 5J98B 3UJOA 3LOIA 4LO4B 4COYA 2MPFA 4C91A 4FPKA 1N3OA 1KITA 1BBT2 4QPIB 1ASJ1 1VBD3 4AXOA 1SMVA 2R072 4ORFA 3URFA 4GALA 4WVWA 4Z92B 1V9U3 1C3HA 4Y20B 3NW4A 2JJ6A 4COZA 5JOZA 2K9ZA 3H7YA 1CJPA 5J7MA 1URXA 1OMIA 2ZAAA 3A0KA 4ISRA 1MS0A 1AXKA 3OD4A 4AQ6A 4XZPA 1OPMA 4AK3A 1B35A 3IT8A 1JOJA 4JGZC 5T5OA 5C6CA 3USUA 1CIWA 5HCBA 5F5QA 4MSVA 3Q9OA 4K1YA 1DG6A 1C8NA 4B3NA 4D7YA 5JPMB 1EPWA 4P9JA 1ENQA 3WG4A 3AM2A 1C57A 3E97A 2DVAA 4IETA 4NOTA 2I07B 2QDRA 4WM8A 3WP4A 2XJUA 2CYFA 5BNNB 1SLIA 4C0HA 1JBCA 4MLOA 1R081 1CGPA 1FOD1 4CDXB 5CVRA 1RL3A 4GXLA 1FNYA 3ZXFA 3O0WA 1DZQA 3KSCA 4IEWA 3GBWA 5C9AC 2R1DA 3ZYPA 4XYXA 3VHOA 4M0NA 1QJY1 4E4ZA 4H55A 2YGMA 2NPIA 1QJU1 2WNUB 5EWSA 3ZFGC 2WNEA 4GWMA 2WNVA 3N7JA 4CEWA 1PK6C 1VAKA 2W39A 4FP3A 3L2HA 4C0BA 3VL8A 2JE9A 3W59A 2VMIA 4Q4Y2 3VZJA 1C4RA 2V09A 2ZGKA 1VBB3 3UV9A 2OPKA 4JGZB 1AHSA 2D3RA 2VOVA 1RHI1 2RMU3 1XU1A 4AHZA 5ACA2 4Z8BA 1S1AA 3S30A 4IEPA 2VPVA 1NA1A 3VHRA 2WSUA 4A7ZA 3ZPYA 1W6QB 4RL7A 4ISQA 3M1HA 4Q26A 2ZGLA 3LWCA 2A3WA 4R9AA 1N1SA 3TOJA 5FO8B 2GN3A 3PMEA 2EF6A 2QFEA 4Q0PA 2X29A 3U4XA 4QPGC 3MIBA 1NCRC 4HKWA 4Q0SA 4N7UA 2MHFA 1MVQA 3OGJA 1FMD3 4FPYA 1PIV2 5GZFA 5I0RA 2ZA9A 3FBYA 1D2QA 4FPJA 3WOGA 3JB4C 3O0XA 5AFEA 5BNOC 1RUOA 4D94A 4M3CB 2GMPA 1H2KA 3BOPA 3ZFGB 1RUH1 3ME2A 1HRV3 1RUD3 1AXYA 1PK6B 2WZR1 2ZHNA 2ZHLA 4CDQA 4IERA 1ND2C 3LOBA 3FE5A 3IM0A 3NJZA 2JX9A 4U36A 2KM2A 1TQ5A 2F4PA 2PHTA 3VGIA 1PZ7A 1AR61 4IXLA 1VLNA 1SLAA 2ZPXA 1L3JA 1BJQA 2WWSA 3B01A 1AR83 4M00A 1AR73 3WLUA 2A5ZA 1GYKA 1QJX2 1AYN1 3M7AA 3T1MA 4EV0A 5A32A 3KLSA 1G9BA 1JN2P 4MGKE 1RIRA 1X8EA 1S0FA 2XLFA 2Q1MA 1ZRRA 2ATFA 4FXGB 1DGRA 1VBA1 1ENRA 1F2NA 1GNHA 3NAPA 3O7OA 2ZABA 3X29B 3AMMA 3CNAA 4QPGB 2VVFA 4AEMA 1S0CA 1NCRB 5BY5A 4QU2A 1NLSA 2YDEA 4F8AA 1X82A 3AXEA 3IMNA 1FXZA 4XJUA 1AYM3 2XPJA 3LAGA 2WC2A 3RNSA 1LHOA 3ST7A 1VBC2 1MACA 1U5YA 2VNGA 3FFQA 3ZYGA 4MXWB 1BBT1 2R071 1UX6A 4I02A 4XF4A 1ND2B 1HRI3 3PHMA 2UYBA 1LODA 2KXLA 3OY8B 2WQ4A 4XJZA 1YIPA 1SQ4A 3POYA 3ZYRA 4HVQA 3OPZA 4HANA 4QQLA 4ATFA 4H3WA 1EAH3 3ILNA 5BNQA 2JENA 3D8CA 2D43A 5JCTA 4AVVA 3MIHA 3I59B 4L2NA 3RMYA 5CG9A 3V0BB 5DDJ3 2BBVA 3AYCA 3MYXA 1BVVA 4RD7A 1U12A 2GC2A 3AKTA 1SCSA 2WIIB 4WV8A 1EY2A 4YM1A 4QPYA 2HWC2 4Q4V3 3VV1A 1BXHA 2P3JA 1Z7S3 2DVBA 3PMSA 3WDYA 3AMQA 1N47A 1D4M3 3ZN6A 3B3QE 4DPNA 4XDQA 4KG8A 3HR9A 1PGL2 1E57A 1DQ6A 4DZGA 3NO8A 2GN7A 4GH4C 1WCSA 4UBGA 5L7OC 4IEZA 2D6PA 2DUPA 1RMU2 4PIZA 4FPEA 1S0GA 3IWZA 1AJOA 4IV3C 1DQ0A 2HWE3 5FPZA 4M3CE 1QF3A 3OJBA 5H9QA 4W6YA 1VALA 4HKLA 2X8KA 1SEFA 3RYPA 2PLV2 5GLVA 3EXUA 5AVAA 2Y0IA 1ASJ3 4W65A 5TSWA 1W6OB 3AFKA 1FI2A 1Q8SA 1TMF2 2ILMA 2BUKA 4EWAA 4Q4Y1 2IWGB 3PLQA 1MZFA 2B5HA 1OQEA 4YZ2A 3DPRC 4HSLA 2PFWA 3WP5A 3MLLA 5EXOA 1COV2 4N53A 3I54A 4NHMA 1OQ1A 4WVMB 3QOPA 5ACA1 4LBKA 3ZXDA 3TN92 1NLRA 2IXKA 1HX6A 3ZDSA 3G7DA 5I8SA 4Y22B 1F5JA 4GH4B 4YARA 2DCJA 4AQSA 5L7OB 1N3PA 2QNKA 2C0ZA 3QH6A 4WZFA 1R083 3VKLA 4IV3B 1FOD3 1XE7A 3SXWA 1CAWB 2NMN