1FOD1

Structure of a major immunogenic site on foot-and-mouth disease virus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
b'TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGGLLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRYSRNAVPNLRGDLQVLAQKVARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOOT AND MOUTH DISEASE VIRUS
molecule tags Virus
source organism Foot-and-mouth disease virus
publication title Structure of a major immunogenic site on foot-and-mouth disease virus.
pubmed doi rcsb
total genus 40
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1993-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fod100
2R073 3ZFGA 1K5MB 1ASJ2 4YVWC 4GH4A 1OPOA 4Q4V1 4RR3A 2HWE1 4CDQA 3DPRC 1H8TC 1PO23 4PDWB 2XPJA 5BNNB 1ND3C 5LK7B 4AEDB 2Y26A 3ZFEB 1A6CA 2RS52 3J8F2 1X36A 1MEC2 5DDJ2 1QJX1 1AR91 3TN93 4CEWB 1RHI1 5J96B 1RUJ1 4N43A 1VB4A 4QPIB 1VRH2 1PVC1 1VBE1 1PO22 5C8CC 1R082 4RR3C 2RMU3 1R1A1 1RUH1 1E57A 4N53B 4FTEA 1EV13 4YVSB 2GSYA 1W39A 3VBUA 1R1A3 1RUH3 5A33A 1RUJ2 2GH8A 1BEV2 1RUD3 4Q4Y2 1C8NA 1PGL1 4CDUB 1AYM3 2WFF3 1VBE2 2BUKA 3JBG3 4CDWA 4QPGA 4FTBA 1MEC3 4WM7B 3CJIB 5AC93 1RMU3 2HWD1 2RM22 1D4M2 1RUC1 2QQPA 3FBMA 1TME1 4CEYC 1HRI3 2WS93 4BCUA 1BBT3 1FMD2 1ASJ3 3ZXAC 1AL0G 3CJIA 1PGW1 4IV1C 2HWB1 1COV2 2BPA2 4CDWB 4RQPC 3JBG1 4CDUA 1VBE3 5CFDB 1HRV3 1QJU2 1BMV2 2R063 1V9U3 4FSJA 1VBA2 5D8AC 1VBD2 4QPIC 1RUG1 2RR13 4CDXB 2RM23 5C8CB 1AL22 2HWE3 3VBSC 1EV11 1QJY2 1TMF3 2BFUS 5JZGC 3VBHC 1AR62 4WM8C 4Q4W2 3VBUC 5AC92 4CEWA 1PVC2 2TBVA 5CFDA 1RHI3 1B35C 1VB2A 1R081 1VBB3 2HWD2 1NA1B 1V9U2 2RM21 1NY71 1ND2C 4CDXA 3VBRA 4Q4X1 5BNNA 1PIV3 1MQTA 1PO11 2X5IB 1RUE1 1ZBE3 5BNOC 1QQP1 4GMP3 1AR63 4RR3B 1K5MA 2RS12 5JZGA 1IHMA 1RVF1 3VBOC 2R042 1OOPA 2HWF1 5C9AC 4CDWC 1RUG2 1OHFA 5CFDC 1RUE2 1RVF3 2RS33 2X5IA 2BFUL 4RHV2 3JB8A 1K5MC 4YVWB 1COV3 4CDXC 3VBRB 2XBO1 4YVSA 2FZ2A 2HWF2 2WWSA 5C4WB 4IV3C 4PDWC 1POV1 2R061 1AYM2 1F8VA 1VBC2 4IV1A 1GFF2 1RUF1 2HWD3 1ZBA3 5ACA1 5A33B 1QJX3 4FTSA 3S6PA 1VBB1 1VBD1 3VBUB 2HWC1 1R083 4RFT0 4Q4V2 1PO12 1AYN2 2HWB3 2PLV2 1RB8G 1Z7S2 4IV1B 2ZTNA 5DDJ3 1TMF2 1EV12 1QJY1 4CEWC 3VDDA 1HRI1 4RQPB 1PIV1 1RUF2 4N43B 1BEV3 1RUD2 4Q4Y3 5FMOL 4Z92B 3ZFGC 1AR72 1AR93 1C8M1 1NOVA 4GB33 4JGZB 2ZAHA 1FPN2 2FZ1A 1X33A 3JBG2 4N53C 4QPGC 1RUG3 4YVSC 4CDQB 2RMU1 2MEV3 1RUE3 4AEDA 1V9U1 1QJX2 1H8TB 1NY72 4GMP0 1FOD1 1OOPB 2WLPA 2RS51 5JZGB 1VBA3 2WFF2 3ZFFC 1RUD1 2WZR3 1HXS1 2HWE2 2ZZQA 1RUI1 1BBT2 4GH4B 1QQP3 1MQTB 3VDDC 5L7OB 4Q4W1 1NA1C 5ABJC 2RS53 1D4M3 5CFCA 4RQPA 4Q4W3 3TN92 2HWC2 1RMU1 2RS32 1Z7S3 5BNPC 4JGYA 1NG0A 1PGL2 1VAKA 1MEC1 1VBD3 5A32B 4RHV1 4QPIA 2WZR1 2RR12 5FMOS 1RUF3 1TME3 3J8F3 1FPN1 1HRV1 3VBFA 1RUC3 2R062 1ZBA2 2RS11 3ZFEA 1VRH3 5K0UC 2RS13 1F2NA 5ACA3 2RR11 1CD3G 1BEV1 4Q4Y1 2PLV1 2WFF1 3J8F1 1EAH1 1RUI2 1AR82 1OOPC 4IV3B 1RUJ3 4JGYC 1PIV2 5D8AA 1BMV1 5DDJ1 4RHV3 1AR92 1RHI2 3NAPC 1QJU1 4RS5A 3HAGA 4GMP1 3VBSA 1ZBE2 1AL21 2RS31 1FMD3 1ND3B 1D4M1 1RUC2 4GH4C 3VBFC 1VBC3 1EAH2 2DF7A 1FMD1 4WM7A 5AC91 1AR61 1COV1 1HRV2 1NA1A 1QJU3 1HRI2 1ZBE1 1ZBA1 3VBOB 5C9AB 5GKAC 1AR71 1C8M2 2HWF3 3VBHB 3LOBA 5J98B 3NAPA 3TN91 5BNOA 1B35A 5ABJA 1AUYA 1QJZA 1HQNA 2IZWA 1SMVA 5CFCC 2MEV2 4CDUC 5C8CA 1TME2 3VBRC 1R091 1PO13 2HWB2 1QJY3 1R093 1HXS2 3JD73 4WM7C 3CJIC 2R041 1M06G 2X5IC 4JGYB 5BNOB 1C8M3 4GB31 5BNPB 3NAPB 4Q4V3 4WM8B 2WS91 3VBHA 2R071 1VBA1 4CEYB 5C9AA 4SBVA 3ZFEC 1NCQB 4PDWA 5L7OA 1POV0 5K0UA 2XBO3 1ND3A 1NCRA 4EJRA 3ZFGB 3ZFFA 1R1A2 1RUH2 4JGZC 1HXS3 5FOJB 4RS5B 4CEYA 1RVF2 2VQ0A 2WS92 1AYN1 4QPGB 1NCRB 4WM8A 4CDQC 5D8AB 1H8TA 3JD72 4IV3A 5C4WC 3M8LA 2MEV1 1TMF1 1AL23 3DPRB 3VBSB 1NCQA 4NWWA 4JGZA 1ND2A 2HWC3 4Q4X2 4N53A 2XBO2 5BNPA 1ASJ1 5BNNC 1QQP2 1WCDJ 1AR81 1MQTC 4AEDC 3VDDB 1AYM1 1VBC1 5L7OC 1POV3 5ABJB 1AYN3 1AR83 1B35B 2BBVA 1FOD2 3VBFB 2RMU2 2R072 1VBB2 1ND2B 1HX6A 4Y5Z0 3VBOA 1Z7S1 1PGW2 3DPRA 5A32A 1DDLA 1BBT1 4Y4YA 3JB4C 1PVC3 1FPN3 1EAH3 5C4WA 1R092 4Q4X3 2PLV3 1NCQC 1CJDA 1PO21 4YVWA 1RUI3 3ZFFB 1VRH1 2R043 4LLFA 1RMU2 5K0UB 5ACA2 3JD71 4GB32 1AR73 2WZR2 3IDEA 4N43C 4NWVA 4RS5C 5CFCB 1FOD3 1NCRC
chains in the Genus database with same CATH superfamily
2D5FA 5IW0A 2R073 2WNVC 3BYWA 2YBSA 3WG1A 4YVWC 1ASJ2 3A0NA 3H1YA 1SACA 4GH4A 2E51A 4RR3A 1JUIA 4E4DX 4FAGA 2YPJA 3AZZA 4H55A 1ZVFA 2VMEA 4LE3A 1ENSA 4NIAA 4LHLA 4D8MA 1HJFA 4NOTA 5FYMA 4YG3A 3WG4A 4TLGA 3CIHA 3ZDVA 3VHRA 1C3HA 4J6GA 2GNTA 1US2A 2PYTA 1V6LA 4D3WA 2G9FA 2IVJA 3KVAA 2ARCA 3LA7A 2RJ2A 1QNYA 5CKNA 5GZFA 4LUKA 3RQ0A 4OHXA 3U14A 1W8ZA 3KCCA 3ZIXA 1A6CA 4FXGB 4NR1A 4C0HA 3PMEA 3THPA 1QJX1 3FUQA 2BOIA 2G9GA 3FMGA 4QB1A 5FZAA 1VRBA 1AX0A 4N43A 2TUNA 5I8TA 2AUYA 1HB3A 3DCQA 2R1BA 4LXLA 1XYPA 5GALA 2OX0A 2R16A 3B9CA 3T3YA 1PVC1 1UL9A 4LITA 5C8CC 3E6DA 2DDUA 2O0OA 1F5FA 5FZMA 3AMNA 1UOBA 2VTFA 1RUH1 1O5UA 1QNWA 1E57A 2UURA 4MXWA 4N53B 1G6NA 3GJBA 1EV13 1O4ZA 2HYXA 2F6BA 3KSCA 4BQ5A 2GSYA 1CVNA 5DXDA 3WNPA 1UOFA 4IE0A 1OUSA 5FY9A 5F2WA 3PDQA 2ARAA 3ZSLA 4AOCA 3NL1A 2XJSA 5FY8A 4Q4Y2 5IVYA 3ZSJA 5BY5A 4QB6A 1C8NA 5T5OA 4BYYA 4ASMB 4NROA 1S0EA 1L7QA 4UOJA 1NYWA 1W6NA 1G9AA 4HLTA 2ZJCA 4JDOA 4QQ2A 1HN1A 2VC9A 4QPGA 1OFSA 4L2NA 3H7JA 1LAJA 1TG7A 3AMMA 1MEC3 3O1UA 4AFDA 1W05A 5LASA 2VW0A 3ME2A 1W0OA 4PQQA 4XUPA 2YU2A 4E8CA 1ZZ6A 3VKOA 4B29A 1V6IA 1POQA 1WLTA 4XFFA 3SNMA 1YXWA 4XW3A 5IVFA 4XHBA 3VZNA 1RUC1 4QX1A 2YHJA 4TTGA 2IXKA 3ITQA 3OBZA 4DB5A 1V00A 1HRI3 1LKNA 1FMD2 4QX5A 1W2OA 3M3CA 2V72A 2ZMLA 4DINB 1I9RA 1EPWA 3MIGA 1ZREA 1OQDA 2UYBA 4CDWB 2BBAA 3EMRA 3L9JT 4URTA 2EALA 1QY4A 1SBEA 3JBG1 3N3HA 4NN0A 2WR9A 5H9PA 2V4AA 3RI9A 1VBE3 4XZUG 1CIWA 1HRV3 5FZEA 1XNCA 1LGCA 4BIOA 1WMEA 2UY9A 3RZKA 1V9U3 4FSJA 4Y1VA 1ZZ9A 2X53S 2PAMA 3PUQA 4QPIC 4UWDA 5EJZB 1VP6A 2ZKNA 3QBQA 3OD0A 3GF6A 3O0VA 5DQ0A 1G9BA 3MW4A 4FOVA 3VBSC 4D7TA 1EV11 1DYOA 2X29A 4DMIA 4DUXA 3AJZA 3BTAA 3QACA 5EWSA 1V6MA 2VOVA 3M7AA 2JDYA 1DIWA 2OKXA 3ZM8A 2BGPA 4Y5SA 4O9GA 2WBKA 3VBHC 2VCBA 3LPFA 1LULA 2FMYA 4XAEA 2VBBA 2VY0A 5FCCA 1AHSA 3PHMA 5LBCA 3TNPB 5IK4A 5CKQA 1PVC2 2TBVA 4LA2A 1B35C 4AZZA 5DAPA 4HPKB 3ILFA 4MGSA 1GSLA 3FFQA 3MF9A 2CV6A 3O14A 3ZVXA 5C3RA 1XNAA 2ILMA 2VJXA 4JZRA 1GANA 2HWD2 1APNA 1V9U2 2RM21 4DQAA 3WQ1A 4FPLA 3VBRA 5GZCA 4CXYA 4TN7A 4UFIA 5JI7A 3HT1A 1Q3EA 5C70A 2DWRA 2NYYA 5F7UA 2XONA 4EV0A 3O5SA 1GYKA 1GUIA 3I97A 1WBLA 3NKGA 2E7TA 3PUAA 4HZFA 1MQTA 1WW7A 1PO11 3BCWA 2VZPA 4MADA 3H3ZA 1SHWB 4OHVA 1QQP1 1QGLA 2FQPA 1F4HA 3BU0A 2RS12 1S2BA 2Y6LA 5F6KA 5CISA 1FX5A 1AF9A 3LIGA 3OGVA 4N90A 1UZ0A 1JZ5A 3KCYA 4IGPA 4CCNA 4XACA 4HK9A 2FCUA 2B7YA 2VUDA 1DQ2A 4L9BA 1US3A 1QXJA 3APBA 4HBNA 4OZOA 4YARA 1QDOA 2WO2A 4RHV2 1S0CA 1KS5A 3BOWA 4FPJA 1H2NA 1K5MC 4BHPA 3MFAA 1E5SA 1X8EA 1UMZA 5JIAA 1JZ2A 1UCXA 3VBRB 5A6QA 5T52A 5FWEA 5FMDA 3E6CC 1L3JA 4LO5B 3ETQA 4BXFA 2JJ6A 2D3RA 4PDWC 5JOXA 3UGHA 3WX5A 4BH9A 2DFCA 1W9SA 1GFF2 2OQ7A 2RJLA 2VECA 3OBAA 4HKWA 4AE2A 3K3NA 2NMNA 2GN3A 2JG8B 4B1MA 4NIHA 1QJX3 2Q30A 2UWBA 5FV3A 1VBB1 3VBUB 4K1YA 2WNOA 5D1IA 5EJ3A 1W8NA 4M00A 1V0AA 2QDRA 2DV9A 4E2GA 3WP6A 1RB8G 1Z7S2 2ZGRA 5SV8A 1TMF2 2A75A 2QVSB 1JYXA 1EV12 1ULFA 5FMCA 4DZGA 1OVSA 2P17A 1CAXA 1HRI1 4XEZA 3T1MA 4KG0A 4CCEA 4LKDA 4BK5A 2D6OX 3B93A 5FPAA 2ZHLA 3W20A 1H9PA 3BVCA 5FK8A 1N1VA 5JCTA 4N43B 4Q4Y3 4XILA 4XJ8A 5FMOL 2BP6A 3D6EA 5JPMB 1DGLA 4CUAA 4OZXA 3A0KA 3LD8A 1T6BX 1C8M1 3EYPA 4GB33 3WNOA 3ZFGC 3O1TA 5A6ZA 2ZAHA 4QQPA 2FZ1A 1X33A 3VD3A 4RSUA 5T3NA 4XXAA 1RUG3 2VZTA 2FCVA 4EN7B 1TZOA 2MEV3 1UKGA 1V9U1 2JDAA 2LS6A 2F17A 1QJX2 1H8TB 1T6GC 3A7QA 3OB8A 2WLPA 4GMP0 4YGCA 5T54A 4A44A 5JMCA 3U75A 2A1XA 3S30A 1QOOA 5JZGB 2ZEZA 5LA1A 1VBA3 2E53A 1NKGA 2WFF2 2IUWA 2OQ6A 1XSRA 4K21A 1UZVA 3ZFFC 1PNFA 2VW1A 1LU2A 4LHKA 3SISA 3ZR6A 2WZR3 4YFWA 1YJKA 3BIEA 3ABZA 2HWE2 3I2GA 1RUI1 1DGWA 5A3MA 1KS4A 4GH4B 2ZGOA 2XL9A 3RS6A 1KEXA 3KCXA 3VZJA 3VDDC 5L7OB 1NE6A 2UWAA 1XXNA 1QMJA 1NA1C 4HG6B 1CAWA 2WT1A 2JB8A 2YDEA 1XOYA 1QOTA 2K0GA 3CZJA 1X50A 2ZACA 4R4ZA 5F8PA 3AZWA 2RDRA 4Q4W3 1LGBA 4IDZA 5KXEA 1RMU1 2RS32 3B02A 5ANQA 3CO2A 2BW8A 5FUPA 4COWA 3ZSMA 5C3PA 3SLIA 5CYYA 2IXCA 2VOWA 2GNMA 2XVKA 1TNFA 4UW5A 3TEZA 4RHV1 2B4KA 1WKYA 2MNGA 4OI1A 4EWAA 4OI0A 1J59A 1H1IA 5GLTA 5LEJA 1OQ1A 1RUF3 4P14A 2DCKA 2G9ZA 2JD4A 2ZEWA 4LKEA 3AL5A 5A3UA 5FLJA 3LE0A 3LDBA 4XBNA 1SDDB 4KU8A 4P9XA 3GHMA 4YG0A 3ZFEA 5T5JA 1KGYA 2DYCA 2JD9A 3ENRA 4JKKA 3VZMA 4BOWA 3ON7A 4M0NA 3LSDA 3KB5A 4DXRA 3Q8AA 4I3PA 1R64A 5DUVA 5A1LA 1HDKA 2VUCA 3W9AA 4YW7A 2CL2A 2P6CA 1BEV1 1CD3G 2OPWA 4MGIE 3N9QA 1W6OA 1N3OA 2WWUA 4SLIA 4TLFA 1WW4A 2TNFA 3SHRA 3V56A 4NVPA 2ZX3A 1L7RA 4B4RA 2RVAA 1KFUL 4GULA 1RHI2 1JBCA 2EXJA 1QJU1 4IL7A 4CU7A 1DG6A 1HQLA 4E9KA 2XJRA 4PLNA 4BDVB 5BNNA 1PGSA 5FZFA 4H2AA 1D4M1 3VBFC 1REEA 4UAPA 4Q0UA 4OCTA 1NX9A 1LOCA 3RDIA 5G04L 5CU1A 4MGTA 1AXYA 1GQPA 2QQMA 3RFRA 2XHKA 2WZPP 5JWPA 3DV8A 1Q8VA 3KZ4C 1AR61 1NA1A 1QH7A 5ANNA 4HETA 2NP0A 3WT3A 3KV6A 4UW6A 3V0BB 4GWMA 5DAWA 3MICA 2DBIA 3LWCA 1IKQA 3VZLA 1O4YA 4XQDA 1I6XA 3RWKX 1JTZX 2MPFA 4LKSA 5C9AB 4CP0A 2Y33A 3EO6A 1ZRCA 2X05A 3X29B 4AGGA 4HXCA 3UJOA 4IEOA 1UY1A 5J98B 2CNAA 2WN3A 4AVAA 1UU6A 3E6BA 4DRRA 3VDBA 1WD3A 3T0DA 1GQHA 1S0FA 2DURA 4HOOA 2WYFA 3KV4A 4NO4A 2ZMNA 3WDXA 3C7FA 2XQRA 1V70A 3VD4A 1GNHA 1TME2 5F37A 1R091 1DF0A 1PHMA 4UW4A 2WAAA 3IAQA 1OQEA 2JDNA 2ZAAA 2GN7A 2B5HA 1QJY3 2XG3A 3CLPA 4L0PA 4V2WA 1QJFA 1DZQA 1Z0HA 3WXPA 4LBQD 4KWJA 1CAVA 4WVZA 1SFPA 2R041 2WZ8A 4ZXKA 1C4RA 5A7QA 3T4VA 3SEEA 2D6LX 4IUGA 4CXWA 4QPWA 4UFHA 4AI1A 1K12A 1BZWA 4OI4A 4XE9A 3I49A 1URXA 3RSJA 2J1AA 2R071 2WT0A 4M3CA 3VBHA 1R1ZA 5E89A 1VBA1 3MIDA 4AFCA 4EZ4A 5C9AA 4Z82A 3ZFEC 4ONUA 3POBA 1DYKA 3MHZA 4UT5A 4I3GA 1XNKA 4C8DA 1UY4A 1XBFA 3CEWA 3B5LB 3NNJA 2P37A 1JMUB 5T50A 1NCRA 4YM3A 4Y1YA 3IKWA 3OUHA 2Z5WA 2QZ2A 4OQ8A 3ACFA 4D6QA 3AXEA 4D69A 3T2QA 4CEYA 5FYTA 1UD1A 2J42A 4P9LA 4QPGB 5FZ9A 3J7MA 1D4VB 3ZKYA 4JHTA 3TEWA 2EF6A 2JG9C 2YYOA 2A6ZA 3CBNA 1YFWA 5A6XA 1BQPA 4AF9A 2O14A 2H0BA 2PQQA 1UZYA 2LROA 3VBSB 1SG3A 1CZSA 4BXSV 4ISQA 5IAVA 1BHGA 3DUIA 3Q8FA 1KFXL 4JGZA 1ULDA 4OUMA 1JN2P 4GD4A 3H9AA 2YFUA 4LBNA 1K3IA 5BNNC 1RINA 1QQP2 1WCDJ 1ZA4A 3M2MA 1K5JA 1MQTC 4P08A 3LSEA 4W4ZA 4OHZA 4AEDC 3ZN6B 1VBC1 2VNVA 1W6OB 2VZUA 1UO9A 1AYN3 1B35B 4PI2A 4UYBA 4A3XA 4MGYE 3VHNA 5JUVA 2BBVA 2TEPA 4ZU5A 3HNYM 4CU8A 4LLOA 1DLLA 1HB2A 3H8OA 2K46A 1XC6A 2W47A 4LMFA 5JXJA 1ZM1A 2FDHA 5D21A 3MUY1 4ITCA 1E5RA 4XUQA 4Y22B 3ZDSA 3ZPYA 4BPZA 1BCXA 5L36A 4YFZA 1MS8A 4AHYA 4TYSA 4AWDA 3H0OA 4MHUA 1R092 3D3AA 1H30A 5FIXA 2BU9A 4FPHA 1NLQA 3T2OA 4XF1A 2WNVA 4UXAA 4YVWA 4AI2A 3POYA 1M4WA 2UWCA 3IAPA 1BK1A 1VRH1 3KHBA 4BQXA 4DPNA 2DU0A 1JZ4A 1QDCA 5HCHA 3AMQA 4Y3OA 4X6QB 3ES4A 5K0UB 3RJRA 3JD71 3VZKA 5F2SA 3I2DA 4C1WA 2EIBA 4GKYA 4WVVA 3RMYA 5CFCB 2CHHA 5F5IA 1NCRC 2PFWA 1OD3A 5A3NA 1S0DA 2XH6A 3ZFGA 2J22A 1K5MB 5GZGA 4A4AA 1CIYA 1OPOA 4Q4V1 2CGPA 3PU3A 2VCMA 2E7AA 2JENA 1U5YA 4D6RA 2PN5A 1PVXA 3DPRC 3CMGA 4MGQA 5FUNA 1PO23 1BK0A 4Q0PA 1REDA 3MW3A 3T0AA 4PDWB 4XFHA 3FBYA 2W9XA 4QHZA 1HKDA 1BKZA 2PHUA 4IE5A 4XQ4A 1LENA 2JG8C 3PVOA 4XFGA 1GOGA 3USUA 3R0RA 2Y26A 3H3LA 5E88A 5E8AA 5FYVA 1W6QB 2Q5TA 4XF9A 3OUJA 2CYFA 1WD4A 2XKOA 2XVGA 3GM8A 4MYEA 4QGMA 5LA2A 3TN93 3ZXEA 2VQTA 1C1LA 2E32A 3K4AA 1RHI1 4ZONA 3O1SA 4WVMA 3AZYA 4NPMA 5BPXA 1OBNA 2ZS6B 2UU8A 2XLGA 4BM8A 2VTXJ 5LEKA 1PO22 3I2FA 3WCSA 5A3OA 1XNTA 1N1SA 2SBAA 1O91A 2PMWB 3LDRA 4PBOA 2RMU3 1XSQA 5FPLA 4QT6A 2KD7A 1LESA 3NWKA 1OVPA 3QH7A 5FPBA 4D94A 1JZ6A 1CPNA 3WOGA 3MYXA 2EXIA 4P02B 2W92A 1RUH3 1PX3A 2BWCA 1UPIA 5FZ4A 5A33A 2GH8A 1ULPA 3WINE 5KR7A 3MBWA 1W28A 3N7LA 3O0XA 4CDUB 3LGRA 4XYXA 4D7YA 1WCSA 1OF4A 4GWNA 1W9TA 5LA9A 3ZMOA 4E2SA 1FXZA 2JKXA 3I3MA 2VVDA 2J1SA 4M01A 4CP9B 2VUJA 5J09A 1Y43B 3GZTB 1YFXA 3NV2A 3T0BA 5B2GB 4CCJA 3MPBA 2QQLA 5FPVA 2A6XA 5I0UA 1WA4A 2PHXA 3WF1A 2QQPA 2DVFA 1LOEA 2E31A 5FY5A 1TME1 4BCUA 1BBT3 2BTVC 4BISA 5BYNA 5FDBA 5I0RA 2JDPA 2K2SA 2HWB1 3ZSKA 4LO8A 3U07A 2BPA2 4J1WA 2P6HA 4COUA 4KNCA 3VGIA 1ULGA 5BXXA 4RQPC 3LFIA 1H4HA 3FN9A 5FZOB 3D8CA 4CDUA 1Q56A 2AR6A 4INDA 5FP7A 4OULA 1QJU2 4LBQB 4ARXA 3THCA 1BMV2 3HBZA 2ZOEB 3H1WA 1XB9A 1VBA2 3ZXKA 5GLWA 4Y24A 3SEPA 4OYUA 2UY8A 1WUVA 2ZX4A 5IVCA 1RUG1 4AGVA 5FXXA 2Q8DA 5J36A 4CDXB 1PK6A 4E4HA 1DZTA 3UETA 4QWNA 2WRAA 2ATFA 3ZXDA 3OPWA 2HWE3 3MFCA 4I09A 3PVBB 3ZMNA 2WNUC 3IN9A 2XKPA 3FHQA 3MLKA 2Z4FA 4PT6A 5DZEA 4FP3A 4A45A 1H1AA 3K51A 2JE9A 3OPZA 4AVSA 1TMF3 4CUGA 2SLIA 4QHOA 2LM3A 3FE5A 1ODNA 3IPVA 2GH2A 4ISRA 1AR62 2A73B 4NPRA 2WO1A 1IKPA 3Q8CA 2KXLA 4JAAA 4WVMB 1OKOA 3LB9A 4Q4W2 1YO8A 4RYDA 1DGWX 1U5XA 2VH9A 5A7PA 1BXHA 3VD7A 4CEWA 2JDHA 5AC92 4EQVA 2V5YA 4JKLA 2G4IA 3PVEA 4FP2A 3SKVA 2VNOA 4RGAA 3CU7A 1W6QA 2Q8OA 4XFIA 4CUBA 3RMXA 1W2NA 4CDXA 4KQ7A 4P9GA 2RG4A 3GDBA 4QKDA 1T2XA 4OLLA 1PZ8A 4MO3M 4LBQA 1JYCA 1JOJA 1UY3A 5DAVA 4QGLA 1SLLA 2VVEA 1S0GA 4YWAA 2IXLA 2OYZA 2ET1A 3G7DA 3MGUA 4K3UA 4RFRB 4W6XA 1RUE1 3LEGA 5ERLA 4EWEA 2B45X 3AYAA 4KU7A 1YCIA 1ZBE3 1LHNA 3OGSA 1JYTA 1CQ9A 1D0HA 1OLMA 1AR63 5FZ7A 1YQ2A 5H9QA 1ZRFA 1K5MA 4QDSA 3HQRA 4W65A 4EN9B 5JZGA 1IHMA 2VMFA 3R6SA 2R042 5C9AC 4CTEA 2W0XA 3NO8A 4AI3A 4DEQA 4IXLA 1QXRA 4YW1A 4D6SA 2OZJA 5FP3A 5CFDC 1RUE2 3GBWA 3GALA 3R4UA 2RS33 3AVRA 1HLCA 4HPKA 3A23A 5LY2A 4EROA 5CIRA 5C5UA 5FLIA 1UXXX 3JB8A 4CP1A 3HT2A 5KHJA 3MV11 3BN6A 5BV6A 3WG2A 4QM8A 2EAAA 2Q1FA 4AQTA 2XBO1 3H7YA 1D7PM 2D3SA 3V0AA 3LF7A 3IMNA 1POV1 4JRAA 1AYM2 4YW5A 3EB7A 4G3YC 4UI9L 3AP6A 4FFHA 1J3PA 1ENXA 1MZ5A 2WNUA 3HIFA 2W87A 5C5TA 4XZPA 4KBBA 3CQOA 3SH4A 4LBKA 2YGMA 1QIQA 4HVOA 1WW6A 3VL8A 4ASKA 1MS3A 1W8UA 2NLRA 2QQJA 3RI8A 3UKVA 4RFT0 2VOTA 2HWB3 3JUUA 4Q4V2 1JYIA 2DCTA 1FAYA 1JU4A 4I0WB 4CEWC 1LECA 4Q0QA 3MIFA 3I7DA 2RE9A 2VZ1A 3CJXA 4IW3A 4R9CA 4AAXA 3WDTA 4MZUA 3MO4A 1TNRA 1S0BA 1DGRA 3N35A 4I30A 5DZFA 2NN8A 1ZRRA 2OUJA 2DTWA 4Q8LA 1NLRA 1JYNA 2DBNA 2ZGUA 5B4NA 5FJHA 1IPJA 1Z78A 4NUBA 2ARBA 1N47A 3LDKA 1NOVA 2XXZA 1H0BA 4JQTA 4PIYA 4XFAA 4HVQA 1FPN2 5EFUA 2YB7A 1SBDA 5FY4A 1ZNPA 1UX6A 4QPGC 2ETEA 3AP4A 4YVSC 1MVQA 5F39A 3DGTA 1IQDC 4LO7A 4AEDA 2IXHA 1FOD1 2BEOA 2RS51 3LAGA 4G9SB 4PIXA 4DIQA 2ZEXA 5L73A 1S2KA 2Q1MA 3MIHA 1YRZA 4XF0A 2RHPA 4W50A 5FO9B 5LWBA 2ZEYA 1JI6A 1N3PA 1SCRA 1GBGA 4R4XA 1BBT2 5C3QA 1KQRA 3JU9A 3KF5A 1MQTB 5E1RA 4AR2A 1RTVA 2YC2A 1UY0A 2WNVB 2VZRA 3HEIA 4XDOA 3M3OA 3I2IA 3IPVB 1CZVA 4YZ5A 3U37A 4K7JA 3WNNA 4PHZA 5A6YA 2WN2A 3NV4A 5BNPC 4MXVA 1YIFA 4JGYA 1NG0A 3GHNA 2VZ3A 4NHXA 1MEC1 2P3JA 4LUMA 4FOWA 5A32B 5C3OA 2J7MA 3DYMA 3O0WA 2WZR1 4QPIA 5FMOS 3H8RA 1NE4A 2JDZA 4LKFA 2F4PA 5GLZA 3BGAA 1EYBA 1TME3 2JG8A 5DUWA 4LO6B 2WNEA 5FY7A 3J8F3 5JOWA 3FL7A 5FREA 1RUC3 2Z69A 5FFOC 1GWLA 1DFQA 1NXD1 4AFMA 3TEYA 1ZBA2 2BDRA 2YY1A 2VR4A 2ZHKA 4HT1T 4NMIA 1QWRA 2IVIB 3TAYA 2CU5A 1UYPA 1VRH3 1W6PA 2QCSB 2VCCA 4OMCA 5FXVA 5K0UC 3USSA 3O1OA 2D3PA 5F3GA 4F83A 1SEFA 2OIIA 5ACA3 2JX9A 4NRPA 3FFZA 4P9JA 2OZ6A 3I2KA 4GKXA 1JODA 2P1BA 1L7LA 5I0TA 2WFF1 3T2PA 3NRUA 3OEBA 5EV7A 5I8SA 3KVBA 5JLVA 3QLQA 1OOPC 1RUJ3 2EAKA 3PUIA 2NZ9A 4Y20A 5D8AA 1BMV1 3DF0A 2P4EA 5DDJ1 1DLCA 3IDBB 2J1TA 5LRRA 2W3JA 3LZZA 3NAPC 3HN1A 3U0ZA 2PHRA 1PZ7A 1RJ7A 2GC0A 4UFJA 4XPVA 3HAGA 4GMP1 2XDVA 2WLQA 1ZBE2 5F5AA 4QQLA 3HVDA 1SBFA 4UBGA 4P5YA 1FMD3 2D43A 5FKBA 4MVTA 3RRDA 3WP4A 4R9AA 3BUCA 3KV9A 1VBC3 2OA2A 3K75B 5KBFA 2DTYA 1XYNA 3W5MA 1LOFC 1FMD1 1O6UA 1HV0A 2W1SA 4QXHA 1A78A 4WM7A 1D2SA 4BQYA 2CDOA 4TSVA 4X8PA 3AVSA 5AC91 3Q8BA 3VZOA 5EHDA 1COV1 1HRV2 3B94A 4EN6B 4NHYA 1JZ8A 2XL7A 2EIGA 2Y6JA 3WW3A 5LY1A 2ES3A 2WJSA 1ZBE1 4HFSA 3W5NA 4FPGA 1W6MB 2WZEA 1HIXA 1K45A 3T1LA 4CA9A 2GZWA 3POEA 2ZX2A 3WW2A 4D7SA 1G86A 1VALA 3B3QE 4QQHA 3KQRA 3RYPA 3VBOB 2QZ3A 1B09A 3M70A 3NJXA 2DUQA 1AR71 3KGLA 1IS5A 3PNAA 4S2DA 2E7QA 2X10A 3LOBA 1STMA 2BV4A 2W1UA 2YZ4A 3VHPA 5FBJA 3U11A 5CG9A 1LEDA 5IK8A 4QX3A 3NJZA 2W46A 3WF4A 1AUYA 1QJZA 1A8DA 1CESA 1HQNA 1UOJA 3DKQA 2HEYF 1CZTA 3OJBA 3WG3A 1UWWA 3LPGA 4CDUC 2VUAA 3GZUC 1NQJA 3M4FA 1JXNA 2LALA 2CDPA 2HWB2 5GZEA 3VDCA 2AGSA 5A80A 2QQUA 2VW2A 1R093 1HXS2 5I8YA 5FP8A 1GZWB 3UV9A 2HBUA 3B00A 3MLJA 2OS2A 4Z07A 2X5IC 5FZOA 1WCQA 2FDFA 2Q1ZB 3PLQA 1MVEA 4JGYB 4BB3A 3WP3A 1H8VA 5BNOB 1LOGA 3VV1A 1UZZA 4COZA 3USUB 4M3CE 3WUCA 5CB7A 4AFBA 1GOFA 2WS91 1H2KA 2ZX0A 4YW3A 1ENQA 4AEMA 4A7ZA 2O8OA 5IHRA 1J3RA 4SBVA 3W59A 3ACIA 3E5XA 2NM1A 5L7OA 1RUOA 3ZX7A 1POV0 3DKWA 4QKNA 5K0UA 5CADA 1PK6C 3ACLA 5JSRA 2VBPA 2XJQA 1LCLA 4FBFA 3TRSB 4CE8A 1ND3A 3PUHA 4XDPA 2BWAA 5J3UA 1SLTA 2G19A 1GWMA 2YFZA 4JTNA 4JVAA 3P6BA 4ZZ5A 4Q27A 3ZFFA 1RUH2 2GMEA 3LA3A 1HXS3 4FPKA 4JGZC 4RS5B 4JHZA 2PHTA 3EHKA 2WS92 3NQHA 3LIHA 4RGGA 4QKFA 1H8TA 4MGKE 4A3ZA 4IV3A 5BNQA 1OLQA 4K8RB 5C4WC 4W6WA 4P5HA 4YW4A 2MEV1 2IFRA 1AL23 2PHWA 1C28A 4N8MA 2IXJA 4XURA 3OOXA 3R4DB 2AREA 4AHWA 4Q4X2 2WSUA 1GNZA 3Q9OA 4WVWA 4BLJA 1FYUA 4L11A 1LGNA 1ASJ1 3S5AA 4C1XA 4ORFA 5APAA 1AR81 2XHNA 1VAMA 4N9IA 4JDNA 2PELA 4OVEA 5DPNA 1CAXB 2H0VA 3KT1A 4AI8A 1KITA 4CCOA 1WGPA 1BJQA 3TOJA 1CAVB 2MHFA 4B4QA 1JYVA 1FOD2 4AAPA 1NQDA 3VBFB 2RMU2 3U78A 3ELNA 1F35A 1ONAA 2Y6HA 2YV8A 1VBB2 1YIPA 1RUNA 3OGJA 3ORJA 5EYXA 4AW7A 4Y5Z0 2O8QA 3ZR5A 2D6KA 3WF2A 4MUVA 3KT4A 3GZAA 1H2LA 1DDLA 1BBT1 3NVCA 5HCBA 4YLZA 2ZGQA 4AFAA 1VMFA 3WHUA 1GV9A 3WEZA 3P3PA 1SLBA 4Q4X3 1W0NA 2HJIA 2PLV3 4QMAA 3RYRA 1NCQC 4MH0E 1XU2A 5FLHA 2Y8KA 2C5DA 4GWIA 1ULCA 4U2AA 2VZSA 1GZ9A 4D0QA 1W8OA 5DZGA 4ZS2A 3B69A 5F3EA 3HNBM 1LEMA 1UX7A 2IXIA 2ZHMA 3D5OA 3DYOA 2HEWF 1MS9A 2AZ5A 1AR73 2C0ZA 2WZR2 3NKTA 3IDEA 4N43C 2JEMA 4CVUA 3ILRA 4P9YA 4QKBA 1DQ0A 4DY3A 4GJYA 3POWA 3DECA 4OI2A 4PJYA 4A7KA 4DXSA 1PNGA 3OUIA 4TZDA 1VLNA 2W52A 3B9IA 5I0DA 5IYYA 1UQXA 1UPSA 4E8DA 2HWE1 3H1MA 5AVAA 2GALA 2J1EA 4QX8A 4XJZA 1H8TC 2YUEA 3AL6A 3D82A 1OH4A 2WO7A 3DEMA 3POIA 5A3PA 2XR4A 5C8WA 4C90A 4KWLA 4RGKA 2BGOA 5CBLA 2X09A 1UOGA 3WV6A 4XABA 1ND3C 1SPPB 2D7FA 2D6MA 2PAKA 1W6PB 2QNKA 4QU2A 1RXFA 5LK7B 3SC7X 3ZFEB 4A6SA 2VVFA 2HYKA 1WW5A 5LBEA 4AVCA 2BJSA 4XUOA 3HOBA 4M4PA 3KGZA 1QU0A 4GIQA 2RS52 2VE1A 4HANA 1X36A 4BZ4A 5FPUA 4ZU4A 5DDJ2 4CEWB 4JCKA 3C7OA 5J96B 2W1WA 2VAUA 3W58A 2PHDA 2LUWA 2Y34A 2BNMA 4EZHA 3WVJA 1VB4A 3WQ0A 4QPIB 3ZLIA 3GNEA 1OLME 5J37A 1W03A 5IVVA 4RR3C 5C6CA 2XWJB 3N7MA 3IM0A 4PCRA 1A8MA 1R1A1 5FYHA 1GNYA 4HL0A 4COVA 1CJPA 4YVSB 4NIGA 4UFKA 3VBUA 3K4DA 4XTPA 4Q1PA 1IS4A 2VM9A 4YG6A 1YC61 3N4MA 1J3QA 2VU9A 1NT0A 1XE8A 1BEV2 1HB4A 1RUD3 2CGNA 3POFA 5DG2A 1WLWA 4Q2FA 4QM9A 1AYM3 3KS7A 3O12A 1RL3A 5JAXA 3SH3A 2EVXA 3JBG3 4ZXEA 4CDWA 2J1UA 5DABA 3TWIA 3CL1A 4HONA 5FR3A 1OLRA 1ZRIA 3CJIB 1W04A 2V73A 4BQ3A 2ENRA 2XLFA 3T30A 4ES8A 1G7YA 3UJQA 3I3EA 2RDNA 3J9SA 5F6LB 1JZ3A 2HEVF 5CVRA 3FX3A 3SCHA 1D4M2 5D2AA 4LR4A 1S4CA 4XCBA 5FOBB 4CEYC 2CSGA 2WS93 3I59B 3AYEA 3NV1A 4FOYA 4HSLA 3RGBA 3VD5A 1AX1A 4AVBA 5FO8B 3IMMA 1KXGA 3SMHA 1XNDA 2HH9A 1BVP1 1PGW1 2QJVA 1NZIA 3CJIA 4IV1C 3WR0A 1UYZA 3ZXJA 4DEVA 2Y6KA 3G6JB 2VOXA 2BNNA 2W5FA 4IESA 1GWKA 4HK8A 4LK7A 3WNMA 5KC5A 2PQSA 1IG0A 3I2OA 4COYA 1YQ8A 3AYCA 2R6QA 2WA4A 1SLAA 1UMHA 1E5IA 4Y1ZA 4CCKA 4S2HA 1Q8PA 2R063 2C9AA 1NLSA 1GICA 2W1QA 2WO3A 2XLAA 3NNMA 1KD7A 5D8AC 3WF0A 2WKKA 5CA6A 1S1AA 5LRSA 3RG0A 3IIAA 2QE3A 2RR13 5C8CB 3VN4A 3SXWA 1JW6A 5I93A 2E26A 4BQWA 4XBQA 1F4AA 4XUNA 4ZZ8A 5M0TA 1YFYA 1H2MA 4EWDA 1QJY2 5GLUA 4EN0A 3VDAA 3H3UA 3I4IA 1RYYA 2BFUS 4YM1A 2UYAA 2ZGTA 4FI9A 3OY8A 5H9SA 3P5BA 1MPXA 1V6OA 4WM8C 1RITA 3GJAA 4PF5A 2EXKA 1WMDA 3H50A 3UL2A 1MACA 2VCAA 4F3JA 3WDUA 3VBUC 3ZSEA 3ILNA 5AFBA 1W6MA 3POGA 5F3IA 4H3WA 3KLSA 5A7SA 1CR7A 2JKBA 2VGDA 3OGGA 2XWBB 1JOPA 2VQUA 2FMDA 4XCAA 4KL1A 5DAQA 1MZFA 5C3SA 1KJRA 4B4PA 4GZ9A 1DGRN 1OSGA 3PUSA 4Q4X1 2YU1A 3PIJA 4LA3A 4HN0A 4UFLA 4LIUA 2XB6C 4DUWA 4LNVA 1DQ6A 3K2OA 3WQ7A 1SZBA 3O1MA 5K9YA 2XJVA 4LORA 4FPEA 1HJGA 2KR2A 3R05A 2W39A 4IEVA 3RPQA 1XE7A 5CZKA 2GNDA 4IETA 2Y38A 2QFEA 3QOPA 5A3LA 4AGRA 2BNOA 1XQNA 3FLPA 3N9OA 5FKCA 2A3YA 5LB6A 3PL0A 1RVF1 5FAXA 4KGGA 3VBOC 4UF0B 2HWF1 4Q1RA 4ZPIA 4CDWC 4NHLA 5L9VA 4JTOA 2ADEA 4DO0A 5LW9A 1RUG2 2ZGNA 3DN7A 4QB2A 1OHFA 3KT7A 1RVF3 1N1TA 2X5IA 4Q5OA 5A3WA 5HCFA 1AVBA 4K6BA 5I0SA 5FYUA 1UYXA 1DP0A 2E6VA 3GGLA 2H6CA 1EUUA 3FZ3A 4NIIA 1COV3 2VOKA 2QKDA 3S7IA 2WIIB 3FHAA 4LPLA 3RZMA 2W68A 4JX0A 2RDSA 4CPBD 2PAEA 2HWF2 2FDJA 2WWSA 1H9WA 1WMFA 3GZEA 4IV3C 1ODMA 3AP7A 4BJ0A 1F8VA 1VBC2 4IV1A 2C1FA 3ST7A 1IOAA 1RUF1 2YPDA 2ZGPA 2HWD3 1DBNA 1IGOA 1LOAA 1ZBA3 4CU9A 5ACA1 3HD8B 2VNGA 4FTSA 2QQNA 3MUZ1 2D6NA 5IK7A 2HWC1 2XJPA 1O8PA 1LB2A 1GQGA 1PO12 1GP4A 2D93A 2VMGA 2WSVA 1W9YA 1YQCA 3AKTA 5E6HA 2ZTNA 3C8XA 1H1MA 4LJHA 1QJY1 4GJZA 3WQBA 3VDDA 4CCMA 3RZGA 1LJ7A 4RQPB 2FBEA 1PK6B 1O3QA 2ET7A 5L19A 1RUF2 1BEV3 1RUD2 1SPPA 3AFGA 4LHNA 3SITA 4EE2A 5EIYB 4Z92B 3RZLA 4QPYA 2R1DA 3LEKA 1WMXA 1LU1A 1YEWA 4JGZB 3LA2A 5J7MA 3VKLA 2E33A 1U12A 1OURA 3JBG2 4XIKA 1RJ8A 4DXTA 3P1IA 1X9TA 3IWZA 3WDWA 2JWPA 2RMU1 3BOPA 2VZOA 3IDCB 1CONA 4N9HA 4UF0A 2QQWA 1ZZBA 1N1YA 1UU5A 4IEWA 4BWOA 3TBDA 2WQ8A 3AXDA 4JQRA 5A7WB 2CWMA 1OH3A 2VXRA 3IBMA 2D98A 1Q5OA 1RUD1 3UGGA 2FDKA 5CEHA 3BB6A 2GP5A 5FZ0A 2D97A 2B8MA 3URFA 3I3QA 3AKQA 4B7EA 2PA7A 1GP6A 2HBTA 5F32A 4H14A 4IQPA 4LO4B 3S5QA 2B9UA 2C4XA 3ZO0B 1JHNA 2RDQA 5FYIA 2XQXA 1FV2A 1DZRA 4FT8A 2Q8CA 4MOAA 1OFNA 2EXHA 2XJUA 1W2AX 4RQPA 3TN92 4XQWA 5JVVA 4MV2A 4DY5A 3AZXA 1Z7S3 2WWJA 5KHKA 1W8WA 2ZZJA 1PGL2 2C9KA 2VL4A 2DCJA 1CAUA 2X8KA 1JH5A 4PQ9A 1GOHA 1GZWA 3MLLA 1W9FA 2RR12 3HQXA 4WZFA 5JDBA 3UKNA 4S2FA 4MHRA 1IPSA 3Q8EA 4H7LA 3K4ZA 3VBFA 5FZBA 1C1FA 4Q26A 4FPCA 1HQWA 3RWNA 1FNYA 1WBFA 1UW8A 3POSA 2RS11 3PTRB 1HB1A 1UF2C 2ZMKA 5FPZA 5GJ6A 4O61A 5IVBA 3WLUA 1F2NA 2NPIA 2RR11 4FCAA 3THDA 3D0SA 1JU3A 2VG9A 2VQAA 1QXPA 1V6NA 4Q4Y1 1JYWA 1NAEA 5FQ0B 3N9LA 4NE9A 4OUEA 3ZYPA 2XUEA 3I3BA 1RUI2 5F3CA 1YHFA 1GMMA 3C7GA 4BU2A 3V64A 1HN0A 3JQWA 1AR92 1Q43A 5A7NA 1OXCA 4C91A 5FP4A 4LIVA 3T08A 4CXXA 4RS5A 3WY6A 5F1RA 1OPMA 1O8SA 3OCPA 2FD8A 3ZYBA 2RS31 1UKRA 1ND3B 3BIWE 1EPZA 1RUC2 4GH4C 4YW2A 3FLTA 1W6NB 3POJA 4XETA 3I54A 5HXMA 2WINB 2B42B 1GKBA 1GZCA 3HR9A 4HN1A 1SDWA 4Z8BA 1SFYA 3RYKA 2DVDA 3PURA 3J4UH 4I0AA 1PZ9A 4RL7A 4S2GA 2IWGB 5K4LA 4BQ4A 1SLCA 3OGRA 4CSWA 1QJU3 3AB0A 2QTWB 3LFMA 1OA3A 1HRI2 3BU7A 1JHJA 3H8UA 3INAA 3AMPA 4XTMA 4XUTA 3VKFC 1XYOA 1OI6A 5FO7B 1F31A 2ZGLA 1PM7A 1VIWB 2ZGMA 1C8M2 5GKAC 1UIKA 5JR7B 4AHZA 1WLCA 2GNBA 2HWF3 3VBHB 4ZU7A 4CPBA 1Q8SA 4IEXA 3TN91 3RVHA 5BNOA 5IJRA 4Y22A 4IGOA 3E5QA 4R9DA 3GBGA 2CAVA 2WAOA 2AH2A 4FPFA 5I91A 1SMVA 2E9QA 3PJYA 4OHWA 2ZABA 5LA0A 2BQPA 2GC2A 5C8CA 5KHIA 5KXCA 2YBKA 1W3VA 4BK4A 2DVAA 1PO13 4LULA 2ZXQA 3ZN5A 4F8AA 3GYDA 2W08A 3JD73 4AEJA 2K9ZA 3ALQA 1D2QA 3S7EA 2CY6A 1G9FA 3CJIC 2VNRA 3A22A 3U10A 3MEPA 4X8NA 4E27A 5FK7A 1F9KA 1AXZA 1KDMA 3JXSA 3E5UA 5HI0A 1DYPA 4DNYA 1CGPA 1C8M3 4GB31 1X82A 3E97A 5BNPB 4GAZA 1CWPA 4Q4V3 4XAAA 1N3QA 2ZGSA 4XMIA 1Y9MA 4ZHNA 4XMAA 1BLZA 4CEYB 4KI5M 3I2JA 3MZHA 4K20A 1A34A 4E4ZA 4I02A 2LW8A 3JQXA 2XBO3 4M0HA 2VTXA 4HSJA 5HBAA 4BQ1A 4PLMA 1UZWA 4YZ4A 4CCCA 2ERFA 3LQCA 3T2TA 4CCLA 3OSDA 4JDMA 2VMHA 4AQ2A 3U4SA 4AL9A 1OUXA 5T5LA 4ZS3A 1VMHA 2PXJA 3WW1A 1FT9A 4R52A 1O4TA 5EXOA 5DMYA 5LZ6A 4NRMA 1LODA 1NCRB 4WM8A 4CDQC 5D8AB 1QF3A 1YFUA 3AP5A 5C33A 3D4KA 3M1HA 4FFGA 1SLIA 2BVVA 3M8LA 5FWJA 2EIEA 1X7NA 3DPRB 2VBDA 4XJAA 3TB0A 2V5DA 1UN1A 3C7EA 4NWWA 5FZLA 3T09A 4LBOA 2Q4SA 2Y0OA 1TEIA 5A1FA 3O1PA 3IT8A 4N53A 5IAXA 2XBO2 5BNPA 5EP9A 1IQAA 2C6SA 4QDQA 4O9EA 3VL9A 3RNSA 2IC1A 3VLBB 5JMOA 3U4XA 3VKNA 2OPKA 2R7EB 1AYM1 2YROA 4AHXA 1LR5A 1POV3 5ABJB 2ZCWA 1AR83 1OKQA 5KC6A 2XMLA 4OFGA 2JDMA 3UT0A 5H9RA 2R072 1Y4WA 5JOZA 1RC6A 3L2HA 2FHRA 5IT6A 4X6RB 1BVVA 5FTTC 1W06A 3VBOA 1KDKA 1Z7S1 2AENA 3DPRA 5A32A 5KHGA 1RIRA 1Q8QA 4YYOA 3AM2A 4Y4YA 1O5LA 2JDUA 4FPYA 1YQ5A 2ZKLA 1FPN3 1EAH3 2VXJA 3KD4A 4PIZA 4XOGA 1J83A 4CU6A 1NXMA 3PU8A 4YRDA 1W9WA 1LNSA 2W95A 2JIJA 3EBRA 2F4LA 5KHHA 4E4SA 3UNPA 3RZJA 1CJDA 3N7JA 5E16A 3JZVA 4A7YA 4R8HA 1VJ2A 1O3RA 1S0IA 4GXLA 1RUI3 4UBHA 3ZFFB 3FHIB 2BOJA 4DS0A 2V09A 1J1LA 2VO5A 2ZGKA 3BODA 4LEJA 4L97A 4CZSA 5CKMA 4LBLA 4P9IA 4AK3A 1I1EA 1WLDA 2EA7A 4LLFA 1FV3A 2L9LA 2PHLA 2WDBA 5ACA2 4GB32 5F9TA 1SCSA 5IUQA 5IVJA 4R9BA 1FOD3 1V6JA 2ZHNA 3D0JA 3MV01 3CF6E 2XOMA 2JICA 4B7KA 2A6WA 2JG9B 3VB9A 1S2EA 5FXWA 3LEMA 5EYYA 1J58A 3WP5A 4AXOA 1ENRA 4HMZA 3NMBA 1YI7A 4CDQA 1QEXA 1IS6A 2Z79A 5LBFA 3SCFA 5FZIA 2ORXA 5AVPA 4Z1VA 2D44A 3AKRA 3VKMA 2XPJA 2JXAA 4AVVA 5BNNB 2A5ZA 4OUSA 1PX4A 2WA3A 4NAMA 4AEDB 5F5CA 3C2UA 4CRQA 4MX3A 1MS0A 3B7MA 5FQ0A 3J8F2 1MEC2 5IK5A 2A70A 1AR91 4EYUA 2LRPA 5J48A 1AJOA 1G8WA 1RUJ1 1U5ZA 1W90A 2R0HA 2OXBA 3HNMA 2A3XA 5HV0A 2BVBA 2D6PA 3CNAA 4NHMA 1UU4A 2GC1A 3AJYA 1VRH2 3NNGA 4FQZA 1VBE1 4CYDA 5BUVA 1R082 2GP3A 2VULA 3BPZA 2KM2A 2YGLA 4O7XA 4HVRA 3AC0A 1LHOA 4YM2A 4FTEA 4FVVA 2PTMA 3IIIA 2OT7A 4K40A 1W39A 1OD5A 1R1A3 3F95A 1RUJ2 2D5HA 4YGEA 4LE4A 5LCWL 4B8EA 1ZZ8A 1PGL1 4OQ9A 1W8HA 3GBFA 1J84A 2WFF3 5GM0A 1VBE2 4JRLA 2BUKA 1MS4A 3EJKA 3RZZA 1OT5A 1ST8A 2D40A 3WZ1A 3N7KA 3UESA 4FTBA 4KWUA 1S0JA 4WM7B 2OUHA 3GCWA 3AKPA 4Z2AA 1DCSA 5KXDA 4KG8A 3R4SA 4FXKB 5AC93 2JECA 4CCDA 1I3HA 1ALYA 1CX4A 4WZCA 3RZHA 1O3TA 1RMU3 2WC2A 3EXUA 4ATFA 5HCAA 3OG2A 2GAUA 2HWD1 2RM22 3KHCA 3KQ4B 3M3QA 2J1VA 4BMBA 3C7HA 3FBMA 1LHVA 3AKSA 3J7NA 4K9SA 2Q8EA 3J7LA 2WABA 2GDFA 2BERA 3UGFA 1REFA 4M4RA 2A3WA 5FY1A 4A6OA 5DUXA 3ZXAC 1ASJ3 2QQKA 3AFKA 5B4XA 4IGQA 1AL0G 3WHTA 1YI9A 4GQ7A 1COV2 5DG1A 3TEXA 1LHUA 3TYJA 1WCUA 1EY2A 3N9MA 1UIJA 2ADDA 2QDNA 3AX4A 4P00B 2WQZC 4XBLA 4NRQA 5C71A 5CFDB 4Q0SA 1O3SA 1ULEA 2ZPXA 2V4VA 4QXBA 3DXUA 4Y1XA 4IERA 4A41A 1VBD2 1XJAA 4QX0A 4TXWA 1QJEA 4XF3A 1MS5A 1Q8OA 1XNBA 2RM23 4XC9A 4YPJA 1AL22 2QBXA 4Q29A 3I3DA 4Y26A 3ECQA 2QQVA 5G05L 4GALA 3HJRA 3WSOA 4FOQA 4LTAA 5JZGC 1VE0A 2AC1A 4NHKA 4QU1A 3ZPOA 1DQ4A 4FO9A 1CX1A 3QCWA 4UFMA 1W2UA 2NMOA 2AACA 5CFDA 1S55A 2P3IA 5K8SA 1RHI3 1VB2A 1ZYBA 1NZCA 3UYJA 1R081 5L9RA 5FZCA 2ID4A 5JXHA 1VBB3 2VMDA 4Y4RA 1NA1B 1VAVA 1NY71 1ND2C 1W3XA 4LBMA 4RD7A 1H4GA 4Y1UA 4YZ3A 4YW6A 1ZZCA 3BTZA 3BTXA 3BI3A 3JCIA 3OYWB 3M3IA 2H6BA 3K77A 3ZYHA 3ES1A 1PIV3 1KJLA 4TWTA 4FFFA 3I59A 1OC1A 5C7GA 2J1RA 2X5IB 4N7UA 1JZ7A 4M3CF 5DUUA 1UMIA 1FI2A 2DFBA 5BNOC 5KXBA 4GMP3 5CNAA 3H8XA 2YG0A 3A4UA 5LBBA 2DU1A 4RR3B 4OHYA 1XU1A 1XE0A 3HMYA 3WD5A 2HLEA 2I74A 3I2HA 5T55A 1C5HA 3H42B 3KV5A 4QX7A 2KA3A 1LTEA 1OOPA 4RA0A 5FMBA 3U1XA 1XRUA 2A6VA 2C26A 1RGSA 3ACHA 4CUCA 5SV5A 3OTFA 1LHWA 2Z42A 1WWYA 2DUPA 5TSWA 2WL1A 2OVUA 4AVTA 1W99A 2JB4A 2BFUL 1O7FA 5EJ1B 1DQ1A 5IATA 3WDYA 4EN8B 3NNFA 1E5HA 1MS1A 2YMZA 4GA9A 4L99A 4YVWB 4CDXC 4PI0A 1JUHA 1LRHA 3FUOA 5JOYA 2P3YA 2I2SA 5EQUA 5A3TA 3AZVA 3OY8B 2WUHA 1PMJX 2BYVE 2WNUB 4YVSA 2FZ2A 1XPWA 5C4WB 5IFTA 4MXWB 4O65A 4XXPA 2R061 4AEKA 3P3NA 3SKJE 3CDZB 3KWVA 4XJUA 2WQ4A 1UAIA 2DCZA 2YBPA 4LK6A 3NW4A 2Y64A 3KMHA 1W0PA 3QH6A 5AFEA 5A33B 3WCRA 2OW4A 3S6PA 1VBD1 1EUTA 3OPTA 1IZ3A 4J1XA 2VZVA 1R083 3EQEA 1AYN2 1YNAA 1V6KA 2PLV2 3IB3A 4IV1B 5DDJ3 4DFSA 4KWKA 4IE7A 3F2ZA 3O1RA 4YGBA 4PLOA 3ZYIB 3ZN6A 3O1VA 4URAA 2FDGA 4MSVA 3ZN4A 1GU3A 3SH5A 1PIV1 2ARXA 2A7AA 3HWJA 3N9PA 4QQOA 4ARYA 4MG2A 4U36A 4P9WA 4A42A 2GMMA 1K42A 1AR72 1AR93 2GC3A 2P3KA 1TVGA 2Y6GA 4QX2A 1ZZ7A 3FC0A 3HQUA 4LQRA 2XUMA 4N53C 4DXZA 5IFPA 4IEUA 4CDQB 1Y9GA 4BIFA 1RUE3 4Q0VA 5DN2A 5FXZA 1NY72 1VMJA 4QXKA 1OOPB 2R0FA 5A7WA 5JXIA 4IEZA 4MGZE 3UKTA 3L2YA 1MZ6A 2VMIA 5GLVA 4CP9A 2CGOA 4MLOA 1RXGA 3NV3A 2ZA9A 1HXS1 2RV9A 3OBTA 1F5JA 4QD2A 4I01A 4BE3A 2ZZQA 4JV4A 5EPAA 1YYNA 3SCGA 2A6YA 4FPOB 5LK5A 4PBPA 3ATGA 2JG9A 1QQP3 3ZYGA 2B46X 4KGQA 1W2TA 2VD7A 1SQ4A 4FAHA 2R30A 3ACGA 4Q4W1 5ABJC 3OYWA 1BYHA 3UK9A 2RS53 2Q0AA 1D4M3 3OF1A 5CFCA 1OF3A 1A3KA 3K48A 4K8FA 5K7PA 4IEYA 1YJLA 2G1MA 2HWC2 4OMDA 3NJYA 5HPOA 4XF4A 2I45A 4YZ1A 3WDVA 2CAUA 5FPXA 1VAKA 2WFPA 4XFBA 1VBD3 5CG8A 1JOBA 1PMHX 3ZKUA 1Y9QA 2I07B 3O7OA 1G9CA 3MW2A 1DQ5A 2QQIA 4NAOA 1C5IA 2BGCA 3NJVA 4KH9A 2ZBJA 4GWJA 3MIBA 3ZXLA 5FY0A 1FPN1 1HRV1 2QQOA 1QKQA 3GCXA 4I0BA 3B01A 4UW3A 2CTVA 2A71A 4IEPA 5FP9A 4Z2WA 1ACCA 2R062 5KWRA 3ZYFA 1W8FA 4AYUA 4BMEA 3V0AB 4W8JA 4HKOA 4AQ6A 5FYZA 5FRAA 4I2OA 2DUOA 4Y33A 4V1PA 4WBBA 4AI9A 1ZX5A 4AG4A 4LT5A 1MR5A 2RS13 2LTNA 3LEIA 4YNIA 5LATA 4PF1A 2GMPA 2QUOA 1NUKA 5FYBA 4FFIA 4A2UA 3WNLA 4YZ2A 1ZRDA 4RN5A 2PLV1 5GZDA 3J8F1 1EAH1 3LCPA 4BQ2A 4XIOA 3V0BA 1AR82 2VMCA 5HXVA 3KF3A 3MIEA 4IV3B 5FZ3A 4XJWA 3WF3A 5JSPA 4JGYC 1PIV2 3V65A 4QXCA 2AEZA 4RHV3 1G9DA 3PIGA 3N9NA 2W2IA 3CHXA 1OA4A 3HN3A 3NNLA 5JPNB 4CP2A 5FZDA 3OEAA 2JDKA 4YGDA 3ZXFA 3E1F1 3VBSA 1AL21 3W21A 5FYSA 3K3OA 2VZQA 2RJKA 4IE6A 5FZ1A 3MF6A 4Y5TA 3OBRA 1EAH2 2DF7A 1CN1A 2GU9A 3K46A 4META 1UYYA 2N7GA 2FCTA 1VPHA 2P34A 1O59A 4FQ4A 1PMIA 2VPVA 1JS9A 3AK0A 5JSOA 2C24A 4IEQA 1VR3A 4YM0A 3BKZA 3NSTA 4Y20B 2EICA 3PTYA 4N7IA 1ZBA1 4NPLA 1WCKA 3DYPA 1WA6X 4XVHA 2P5BA 2W91A 2NQYA 3PVNA 2Y6FA 1UXZA 1AXKA 1AZDA 4M3CB 1LOBA 3TNQA 2XGXA 4JKMA 3THTA 3NAPA 1FATA 3ZIWA 1B35A 4KMQA 3CZUA 5ABJA 2IZWA 2WYSA 4ZKTB 5CFCC 3ROUA 1PM4A 3MDPA 3AYDA 2HKXA 1J1TA 2MEV2 4HKLA 1YWKA 2BRTA 2B39A 3HPNA 5FYYA 3VBRC 5CAZA 1GP5A 2BZDA 5FUIA 3VD9A 2AYHA 1QOSA 4ATEA 1IPKA 4KBZA 1P8JA 1LOFA 3AMHA 4V2VA 2R32A 5FJKA 4WM7C 1H6YA 4XDQA 1X8MA 5J1XA 1M06G 4ZY9A 3QD6A 5JXGA 2B9VA 3ETPA 2DCYA 2YXSA 2P2KA 3WUDA 5EZWA 3VUOA 4G4FA 2ORZA 3NAPB 1GZTA 3GXUA 4WM8B 1AX2A 1H6XA 5HV4A 3PMSA 3VHOA 3WNXA 4QDRA 4E2QA 4QGNA 4BLIA 2DVBA 1FNZA 3MI8A 1KRIA 2Y0IA 1ULOA 1NCQB 1TE1B 1C57A 4PDWA 4J25A 1WZXA 1GR3A 5FZKA 3SQOA 1MZEA 1Y3TA 2Y60A 2W94A 4ASLA 1U0AA 5IVEA 3WNKA 1U5IA 3KM5A 4NIDA 2XJTA 5A1AA 2ZX1A 4EJRA 4XFCA 3ZFGB 2FDIA 3IZOA 1R1A2 3MPPG 1IG3A 3WW4A 5FOJB 1F15A 1RVF2 2R49A 3S0MA 2VQ0A 5T5PA 1AYN1 3DXTA 3PJQA 3T4HB 5JI9A 2JE8A 2O1QA 1Y7BA 2WT2A 3C3VA 4QHBA 2DVGA 3JD72 4L8QA 4DOUA 3FWEA 1D0GA 1YUDA 2JIGA 5FZ6A 5A70A 5L9BA 4AQSA 1OMIA 1TMF1 4W6YA 3LKJA 4XHXA 1NCQA 3IDAA 5FYCA 1DU3D 3BTYA 1TQ5A 4WV8A 4LBJA 1ND2A 3LOIA 2HWC3 3CKHA 1HV1A 2AEYA 3DL3A 3ZOIA 2IFWA 2YC4A 4IE4A 1W8TA 3VDDB 5L7OC 1IS3A 3ASIA 5F5QA 2YC0A 3S57A 1I5PA 3ZYJB 4B1LA 3BPSA 3FLRA 4L92A 1UY2A 4LHSA 2E63A 2Z2SB 5IWFA 4Q8KA 1ND2B 1HX6A 4XJ9A 2CWSA 5FBZA 3BALA 1EP0A 1ZA7A 4JC1A 1AJKA 1PGW2 1DHKB 2PHFA 5A7OA 3RJ2X 4AI0A 3JB4C 1PVC3 1X9PA 1YLLA 3ZXGA 4K1ZA 5C4WA 4C0BA 5JIUA 3J26N 5FZHA 5ISLA 4YSFA 1YQ6A 5DAXA 1CPMA 4H7MA 1SFNA 1CAWB 3M3EA 1PO21 1HW5A 3ZYRA 4QAWA 1GLHA 4BA6A 5FZ8A 1CAUB 4B3NA 4NJ4A 3I8TA 3A21A 4ET7A 3HBKA 1QHDA 3FJSA 2R043 1RMU2 4LOSA 4ES9A 1I5ZA 3N36A 5JR2A 4DRVA 4DUVA 2EIDA 2JE7A 4NWVA 1QH6A 1UNBA 4RS5C 2XVLA 1OA2A 3OD4A 3J7HA 4LOTA 4F7ZA 5FZGA 3AP9A
chains in the Genus database with same CATH topology
2D5FA 2R073 2WNVC 3WG1A 4YVWC 1ASJ2 3A0NA 3H1YA 1SACA 4GH4A 2E51A 4RR3A 1JUIA 4E4DX 4FAGA 2YPJA 3AZZA 4H55A 1ZVFA 4LE3A 1ENSA 4LHLA 4NOTA 4YG3A 3WG4A 3VHRA 1C3HA 4J6GA 2GNTA 2PYTA 1V6LA 4D3WA 2G9FA 3LA7A 1QNYA 5GZFA 4LUKA 3RQ0A 4OHXA 3KCCA 3ZIXA 1A6CA 4FXGB 4NR1A 4C0HA 3PMEA 3THPA 1QJX1 3FUQA 2G9GA 3FMGA 1AX0A 4N43A 2TUNA 5I8TA 2AUYA 2R1BA 1XYPA 5GALA 2R16A 3B9CA 1PVC1 1UL9A 5C8CC 3E6DA 2O0OA 1F5FA 3AMNA 4MXWA 1RUH1 1O5UA 1QNWA 1E57A 2UURA 4N53B 1G6NA 1EV13 1O4ZA 3KSCA 2F6BA 2GSYA 1CVNA 5DXDA 5BY5A 3ZSLA 3NL1A 2XJSA 3ZSJA 4Q4Y2 1C8NA 5T5OA 4BYYA 4ASMB 1S0EA 1NYWA 1W6NA 1G9AA 4HLTA 2ZJCA 4JDOA 4QQ2A 4QPGA 1OFSA 4L2NA 3H7JA 3AMMA 1MEC3 4AFDA 2VW0A 3ME2A 1W0OA 1ZZ6A 3VKOA 4B29A 1V6IA 1WLTA 4XFFA 3SNMA 1YXWA 4XW3A 4XHBA 3VZNA 1RUC1 2YHJA 2IXKA 4DB5A 1V00A 1HRI3 1LKNA 1FMD2 4QX5A 3M3CA 2ZMLA 4DINB 1I9RA 1EPWA 3MIGA 1ZREA 1OQDA 2UYBA 4CDWB 3L9JT 4URTA 2EALA 1QY4A 1SBEA 3JBG1 3N3HA 4NN0A 5H9PA 3RI9A 1VBE3 1CIWA 1HRV3 1XNCA 1LGCA 4BIOA 1WMEA 2UY9A 1V9U3 4FSJA 4Y1VA 1ZZ9A 2X53S 2PAMA 4QPIC 1VP6A 2ZKNA 3QBQA 3OD0A 3GF6A 3O0VA 1G9BA 3MW4A 4FOVA 3VBSC 4D7TA 1EV11 2X29A 4DMIA 3AJZA 3BTAA 3QACA 5EWSA 1V6MA 2VOVA 3M7AA 1DIWA 3VBHC 4O9GA 1LULA 2FMYA 2VY0A 5FCCA 1AHSA 3PHMA 3TNPB 5IK4A 1PVC2 2TBVA 4LA2A 1B35C 4HPKB 3ILFA 1GSLA 3FFQA 3MF9A 2CV6A 3O14A 3ZVXA 2ILMA 1GANA 2HWD2 1APNA 1V9U2 2RM21 4DQAA 3WQ1A 4FPLA 3VBRA 5GZCA 5JI7A 3HT1A 1Q3EA 2DWRA 2NYYA 5BNNA 4EV0A 3O5SA 1GYKA 1WBLA 3NKGA 2E7TA 4HZFA 1MQTA 1WW7A 1PO11 3BCWA 3H3ZA 4OHVA 1QQP1 1QGLA 2FQPA 2RS12 1S2BA 5F6KA 1FX5A 1AF9A 4N90A 3KCYA 4HK9A 2B7YA 4L9BA 1DQ2A 1QXJA 3APBA 4HBNA 4YARA 1QDOA 4RHV2 1S0CA 1KS5A 3BOWA 4FPJA 1H2NA 1K5MC 4BHPA 3MFAA 1X8EA 1UMZA 5JIAA 1UCXA 3VBRB 5T52A 3E6CC 1L3JA 4LO5B 3ETQA 2JJ6A 2D3RA 4PDWC 5JOXA 3WX5A 4BH9A 2DFCA 2VECA 1GFF2 2RJLA 4HKWA 4AE2A 2NMNA 2GN3A 2JG8B 1QJX3 2Q30A 2UWBA 1VBB1 3VBUB 4K1YA 5D1IA 5EJ3A 4M00A 2QDRA 2DV9A 3WP6A 1RB8G 1Z7S2 2ZGRA 5SV8A 1TMF2 2A75A 2QVSB 1EV12 1ULFA 4DZGA 2P17A 1CAXA 1HRI1 4XEZA 3T1MA 4KG0A 2D6OX 3B93A 2ZHLA 1H9PA 1N1VA 5JCTA 4N43B 4Q4Y3 4XILA 4XJ8A 5FMOL 3D6EA 5JPMB 1DGLA 4OZXA 3A0KA 3ZFGC 1C8M1 4GB33 2ZAHA 4QQPA 2FZ1A 1X33A 4RSUA 5T3NA 4XXAA 1RUG3 4EN7B 2MEV3 1UKGA 1V9U1 4MSVA 1QJX2 1H8TB 1T6GC 4GMP0 4YGCA 4YRDA 2WLPA 5T54A 5JMCA 3S30A 1QOOA 5JZGB 1VBA3 2E53A 2WFF2 4K21A 3ZFFC 1PNFA 2VW1A 1LU2A 4LHKA 3SISA 2WZR3 4YFWA 1YJKA 2HWE2 1RUI1 1DGWA 5A3MA 1KS4A 4GH4B 2ZGOA 2XL9A 3RS6A 3KCXA 3VZJA 3VDDC 5L7OB 1NE6A 2UWAA 1XXNA 1QMJA 1NA1C 1CAWA 2WT1A 2YDEA 1QOTA 2K0GA 1X50A 2ZACA 4R4ZA 3AZWA 4Q4W3 1LGBA 5KXEA 1RMU1 2RS32 3B02A 3CO2A 2BW8A 4COWA 3ZSMA 3SLIA 2IXCA 2VOWA 2GNMA 2XVKA 1TNFA 4UW5A 4RHV1 2MNGA 4OI1A 4EWAA 4OI0A 1J59A 1H1IA 5GLTA 5LEJA 1OQ1A 1RUF3 4P14A 2DCKA 2JD4A 5FLJA 4XBNA 4KU8A 4P9XA 3GHMA 4YG0A 3ZFEA 5T5JA 2DYCA 3ENRA 3VZMA 4BOWA 4M0NA 3LSDA 3KB5A 4I3PA 5DUVA 1HDKA 3W9AA 2CL2A 1BEV1 1CD3G 4MGIE 1W6OA 1N3OA 4SLIA 4TLFA 1WW4A 2TNFA 3SHRA 3V56A 4NVPA 2ZX3A 4B4RA 1KFUL 4GULA 1RHI2 1JBCA 2EXJA 1QJU1 4IL7A 1DG6A 1HQLA 4E9KA 2XJRA 4PLNA 1PGSA 1D4M1 3VBFC 1REEA 4Q0UA 1LOCA 3RDIA 5CU1A 1AXYA 2XHKA 2WZPP 5JWPA 3DV8A 1Q8VA 3KZ4C 1AR61 1NA1A 1QH7A 4HETA 2NP0A 3WT3A 4UW6A 3V0BB 4GWMA 3MICA 3LWCA 1IKQA 3VZLA 1O4YA 4XQDA 1I6XA 1JTZX 2MPFA 5C9AB 4CP0A 3EO6A 1ZRCA 3X29B 4AGGA 3UJOA 4IEOA 5J98B 2CNAA 4AVAA 1UU6A 3E6BA 4DRRA 1WD3A 1GQHA 1S0FA 2DURA 4NO4A 2ZMNA 3WDXA 1V70A 1GNHA 1TME2 1R091 1DF0A 1PHMA 4UW4A 1OQEA 2ZAAA 2GN7A 2B5HA 3CLPA 1QJY3 2XG3A 1DZQA 1Z0HA 3WXPA 4LBQD 4KWJA 1CAVA 4WVZA 2R041 4ZXKA 1C4RA 2D6LX 4AI1A 1BZWA 4OI4A 4XE9A 1URXA 3RSJA 3VBHA 2R071 2WT0A 4M3CA 1R1ZA 5E89A 1VBA1 3MIDA 4AFCA 5C9AA 4Z82A 3ZFEC 4ONUA 1DYKA 4I3GA 1XNKA 3CEWA 3B5LB 2P37A 5T50A 1NCRA 4Y1YA 3IKWA 2Z5WA 2QZ2A 3AXEA 4D69A 4CEYA 1UD1A 4P9LA 4QPGB 1D4VB 2EF6A 2JG9C 2YYOA 2A6ZA 1YFWA 1BQPA 4AF9A 2H0BA 2PQQA 1UZYA 3VBSB 4ISQA 3DUIA 4JGZA 1KFXL 1ULDA 4OUMA 1JN2P 3H9AA 4LBNA 5BNNC 1RINA 1QQP2 1WCDJ 1ZA4A 3M2MA 1MQTC 4OHZA 3LSEA 4AEDC 3ZN6B 1VBC1 1W6OB 1AYN3 1B35B 4A3XA 2BBVA 4MGYE 3VHNA 2TEPA 4ZU5A 4LLOA 1DLLA 1ZM1A 4ITCA 4BPZA 4Y22B 3ZDSA 3ZPYA 1BCXA 4YFZA 1MS8A 4AHYA 4TYSA 4AWDA 3H0OA 1R092 1H30A 4FPHA 4XF1A 2WNVA 4UXAA 4YVWA 4AI2A 3POYA 1M4WA 2UWCA 1BK1A 1VRH1 4DPNA 2DU0A 1QDCA 3AMQA 4X6QB 3ES4A 5K0UB 3RJRA 3JD71 3VZKA 3I2DA 4C1WA 4WVVA 4GKYA 3RMYA 5CFCB 1NCRC 2PFWA 1S0DA 2XH6A 3ZFGA 1K5MB 5GZGA 2CGPA 1OPOA 4Q4V1 2E7AA 2JENA 1U5YA 2PN5A 1PVXA 3DPRC 1PO23 4Q0PA 1REDA 3MW3A 4PDWB 4XFHA 3FBYA 1HKDA 1BKZA 2PHUA 4XQ4A 1LENA 2JG8C 3PVOA 4XFGA 3USUA 3R0RA 2Y26A 5E88A 5E8AA 1W6QB 2Q5TA 4XF9A 2CYFA 1WD4A 2XKOA 2XVGA 4MYEA 4QGMA 3TN93 3ZXEA 1C1LA 1RHI1 4WVMA 3AZYA 5BPXA 2ZS6B 2UU8A 2XLGA 4BM8A 5LEKA 1PO22 3WCSA 1N1SA 2SBAA 1O91A 4PBOA 2RMU3 4QT6A 1LESA 3NWKA 3QH7A 4D94A 1CPNA 3WOGA 3MYXA 2EXIA 1RUH3 2BWCA 1UPIA 5A33A 2GH8A 3WINE 3N7LA 3O0XA 4CDUB 3LGRA 4XYXA 4D7YA 1WCSA 4GWNA 3ZMOA 4E2SA 1FXZA 2VVDA 4M01A 2VUJA 5J09A 1Y43B 3GZTB 1YFXA 3NV2A 5B2GB 3MPBA 5I0UA 2A6XA 1WA4A 2PHXA 2QQPA 2DVFA 1LOEA 1TME1 4BCUA 1BBT3 2BTVC 5BYNA 5FDBA 5I0RA 2K2SA 2HWB1 3ZSKA 4LO8A 3U07A 2BPA2 4J1WA 4COUA 4KNCA 3VGIA 1ULGA 5BXXA 4RQPC 1H4HA 3D8CA 4CDUA 1Q56A 2AR6A 4INDA 4OULA 1QJU2 4LBQB 1BMV2 3HBZA 2ZOEB 3H1WA 1VBA2 3ZXKA 5GLWA 4Y24A 2UY8A 1WUVA 2ZX4A 5L36A 1RUG1 4AGVA 5J36A 4CDXB 1PK6A 1DZTA 2ATFA 3ZXDA 2HWE3 3MFCA 4I09A 3PVBB 3ZMNA 2WNUC 3IN9A 2XKPA 3MLKA 4AVSA 5DZEA 4FP3A 1H1AA 3K51A 2JE9A 3OPZA 1TMF3 2SLIA 2LM3A 3FE5A 3IPVA 4ISRA 2GH2A 1AR62 2A73B 4NPRA 1IKPA 2KXLA 4JAAA 4WVMB 3ZO0B 3LB9A 4Q4W2 1YO8A 4ES8A 1DGWX 1U5XA 2VH9A 5AC92 1BXHA 4CEWA 2V5YA 2G4IA 3PVEA 4FP2A 2VNOA 4RGAA 3CU7A 1W6QA 2Q8OA 4XFIA 3RMXA 4CDXA 4KQ7A 4P9GA 4OLLA 1PZ8A 4LBQA 1JYCA 1JOJA 4QGLA 1SLLA 2VVEA 1S0GA 2IXLA 2OYZA 2ET1A 3G7DA 3MGUA 4K3UA 4W6XA 4EWEA 1RUE1 2B45X 3AYAA 4KU7A 1YCIA 1ZBE3 1LHNA 1CQ9A 1D0HA 1AR63 5H9QA 1ZRFA 1K5MA 4W65A 4EN9B 5JZGA 1IHMA 3R6SA 2R042 5C9AC 4CTEA 2W0XA 3NO8A 4AI3A 4IXLA 1QXRA 4YW1A 2OZJA 5CFDC 1RUE2 3GBWA 3GALA 3R4UA 2RS33 4HPKA 1HLCA 4EROA 5CIRA 5FLIA 3JB8A 4CP1A 5KHJA 3HT2A 5BV6A 3WG2A 4QM8A 2EAAA 4AQTA 2XBO1 3H7YA 2D3SA 3V0AA 3IMNA 1POV1 4JRAA 1AYM2 4YW5A 4G3YC 3AP6A 1J3PA 1ENXA 1MZ5A 2WNUA 3HIFA 4XZPA 4KBBA 3SH4A 4LBKA 2YGMA 4HVOA 1WW6A 3VL8A 1MS3A 2NLRA 3RI8A 3UKVA 4RFT0 4Q4V2 2HWB3 3JUUA 1JYIA 2DCTA 1FAYA 4I0WB 4CEWC 1LECA 4Q0QA 3MIFA 3I7DA 2RE9A 3CJXA 4R9CA 3WDTA 4MZUA 1TNRA 1S0BA 1DGRA 3N35A 4I30A 5DZFA 2NN8A 1ZRRA 2DTWA 2OUJA 4Q8LA 1NLRA 2ZGUA 1IPJA 1Z78A 4PIYA 2ARBA 1N47A 1NOVA 4XFAA 1H0BA 4HVQA 1FPN2 5EFUA 1SBDA 1ZNPA 1UX6A 4QPGC 2ETEA 3AP4A 4YVSC 1MVQA 3DGTA 4LO7A 4AEDA 2IXHA 1FOD1 2BEOA 2RS51 3LAGA 4G9SB 4PIXA 5L73A 1S2KA 2Q1MA 3MIHA 1YRZA 4XF0A 2RHPA 5FO9B 1N3PA 1SCRA 1GBGA 4R4XA 1BBT2 1KQRA 3JU9A 1MQTB 5E1RA 1RTVA 2WNVB 3M3OA 3IPVB 4YZ5A 4K7JA 3NV4A 5BNPC 4MXVA 1YIFA 4JGYA 1NG0A 3GHNA 1MEC1 2P3JA 4LUMA 4FOWA 5A32B 4QPIA 3O0WA 2WZR1 5FMOS 1NE4A 2JDZA 2F4PA 5GLZA 1EYBA 1TME3 2JG8A 5DUWA 4LO6B 2WNEA 5JOWA 3J8F3 5FREA 1RUC3 2Z69A 5FFOC 1DFQA 1NXD1 4AFMA 1ZBA2 2YY1A 2ZHKA 4HT1T 1QWRA 3TAYA 1VRH3 1W6PA 2QCSB 5K0UC 3USSA 2D3PA 4F83A 5ACA3 1SEFA 2OIIA 2JX9A 4P9JA 3FFZA 2OZ6A 4GKXA 5I0TA 2WFF1 5I8SA 5EV7A 5JLVA 3QLQA 1OOPC 1RUJ3 2EAKA 4Y20A 2NZ9A 5D8AA 1BMV1 3DF0A 5DDJ1 3IDBB 5LRRA 3LZZA 3NAPC 3HN1A 3U0ZA 2PHRA 1PZ7A 1RJ7A 2GC0A 4XPVA 3HAGA 4GMP1 2WLQA 1ZBE2 4QQLA 4UBGA 1SBFA 1FMD3 2D43A 4MVTA 3RRDA 3WP4A 4R9AA 1VBC3 2OA2A 5KBFA 2DTYA 1XYNA 1LOFC 1FMD1 1HV0A 4WM7A 1A78A 1D2SA 4TSVA 4X8PA 5AC91 3VZOA 4EN6B 1COV1 1HRV2 3B94A 2XL7A 2EIGA 3WW3A 2ES3A 2WJSA 1ZBE1 4HFSA 4FPGA 1W6MB 1HIXA 3T1LA 2GZWA 2ZX2A 3WW2A 4D7SA 1G86A 1VALA 3B3QE 4QQHA 3KQRA 3RYPA 3VBOB 2QZ3A 1B09A 3M70A 4S2DA 2DUQA 1AR71 3KGLA 1IS5A 3PNAA 2E7QA 3LOBA 2YZ4A 3VHPA 3U11A 5CG9A 1LEDA 5IK8A 3NJZA 1AUYA 1QJZA 1A8DA 1CESA 1HQNA 3OJBA 3WG3A 2HEYF 4CDUC 2VUAA 3GZUC 1NQJA 3M4FA 1JXNA 2LALA 2HWB2 5GZEA 2AGSA 2VW2A 1R093 1HXS2 5I8YA 1GZWB 3UV9A 3B00A 3MLJA 4Z07A 2X5IC 2Q1ZB 3PLQA 1MVEA 4JGYB 3WP3A 1H8VA 5BNOB 1LOGA 3VV1A 1UZZA 4COZA 3USUB 4M3CE 3WUCA 5CB7A 4AFBA 2WS91 2ZX0A 1H2KA 4YW3A 4AEMA 1ENQA 4A7ZA 2O8OA 1J3RA 4SBVA 3W59A 3E5XA 2NM1A 5L7OA 1RUOA 3ZX7A 1POV0 3DKWA 5K0UA 5CADA 1PK6C 3ACLA 5JSRA 2XJQA 1LCLA 4FBFA 3TRSB 1ND3A 5J3UA 2BWAA 1SLTA 4JVAA 4JTNA 4Q27A 3ZFFA 1RUH2 2GMEA 3LA3A 1HXS3 4FPKA 4JGZC 4RS5B 2PHTA 3EHKA 2WS92 4RGGA 1H8TA 4MGKE 5BNQA 4IV3A 1OLQA 5C4WC 4W6WA 4P5HA 4YW4A 2MEV1 2IFRA 1AL23 2PHWA 1C28A 2IXJA 3R4DB 2AREA 4AHWA 4Q4X2 2WSUA 1GNZA 3Q9OA 4WVWA 4BLJA 1FYUA 4L11A 1LGNA 1ASJ1 4C1XA 4ORFA 1AR81 1VAMA 4N9IA 4JDNA 2PELA 4OVEA 4E2GA 1CAXB 2H0VA 3KT1A 4AI8A 1KITA 1WGPA 1BJQA 3TOJA 1CAVB 2MHFA 4B4QA 1FOD2 1NQDA 3VBFB 2RMU2 3ELNA 1ONAA 2YV8A 1VBB2 1YIPA 1RUNA 3OGJA 5EYXA 4AW7A 4Y5Z0 2O8QA 2D6KA 4MUVA 3KT4A 3GZAA 1H2LA 1DDLA 1BBT1 3NVCA 5HCBA 4YLZA 2ZGQA 4AFAA 3WHUA 1GV9A 3P3PA 1SLBA 4Q4X3 4QMAA 2HJIA 2PLV3 3RYRA 1NCQC 4MH0E 1XU2A 5FLHA 2C5DA 1ULCA 4U2AA 1GZ9A 5DZGA 3B69A 1LEMA 2IXIA 2ZHMA 3D5OA 2HEWF 1MS9A 2AZ5A 1AR73 2C0ZA 2WZR2 3NKTA 3IDEA 4N43C 2JEMA 3ILRA 4P9YA 1DQ0A 4DY3A 3POWA 4PJYA 4OI2A 4A7KA 1PNGA 4TZDA 1VLNA 2W52A 3B9IA 1UPSA 2HWE1 3H1MA 5AVAA 2GALA 4XJZA 1H8TC 2YUEA 3D82A 5C8WA 4C90A 4KWLA 5CBLA 3WV6A 1ND3C 2D7FA 2D6MA 2PAKA 2QNKA 1W6PB 4QU2A 5LK7B 3ZFEB 2VVFA 2HYKA 1WW5A 4AVCA 3KGZA 1QU0A 4GIQA 2RS52 4HANA 1X36A 4BZ4A 4ZU4A 5DDJ2 4CEWB 4JCKA 5J96B 3W58A 2PHDA 2LUWA 2BNMA 3WVJA 1VB4A 3WQ0A 4QPIB 3GNEA 5J37A 4RR3C 5C6CA 2XWJB 3N7MA 3IM0A 4PCRA 1A8MA 1R1A1 4HL0A 4COVA 1CJPA 4YVSB 3VBUA 4XTPA 4Q1PA 1IS4A 4YG6A 3N4MA 1J3QA 2VU9A 2CGNA 1XE8A 1BEV2 1RUD3 5DG2A 1WLWA 4Q2FA 4QM9A 1AYM3 3KS7A 3O12A 1RL3A 5JAXA 3SH3A 2EVXA 3JBG3 4CDWA 3TWIA 3CL1A 1OLRA 3CJIB 2V73A 2ENRA 2XLFA 1G7YA 3UJQA 3J9SA 5F6LB 2HEVF 5CVRA 3FX3A 3SCHA 1D4M2 4LR4A 5FOBB 4CEYC 2WS93 3I59B 3AYEA 3NV1A 4FOYA 4HSLA 4AVBA 5FO8B 1AX1A 1KXGA 3SMHA 1XNDA 3CJIA 1BVP1 1PGW1 2QJVA 4IV1C 3WR0A 3ZXJA 3G6JB 2VOXA 2BNNA 4IESA 5KC5A 4HK8A 4COYA 3AYCA 2R6QA 2WA4A 1SLAA 4Y1ZA 4S2HA 1Q8PA 2R063 2C9AA 1NLSA 1GICA 2XLAA 5LRSA 1KD7A 5D8AC 2WKKA 5CA6A 1S1AA 3RG0A 3IIAA 2QE3A 2RR13 5C8CB 3VN4A 3SXWA 1JW6A 5I93A 4XBQA 1YFYA 1H2MA 4EWDA 1QJY2 5GLUA 4EN0A 3H3UA 3I4IA 2BFUS 4YM1A 2UYAA 2ZGTA 3OY8A 5H9SA 1V6OA 4WM8C 1RITA 4PF5A 2EXKA 1WMDA 3H50A 3UL2A 1MACA 4F3JA 3WDUA 3VBUC 3ZSEA 3ILNA 5AFBA 1W6MA 4H3WA 3KLSA 1CR7A 2JKBA 2VGDA 3OGGA 2XWBB 2FMDA 4KL1A 1MZFA 1KJRA 4B4PA 1DGRN 1OSGA 4Q4X1 4LA3A 4HN0A 2XB6C 4LNVA 1DQ6A 3WQ7A 5K9YA 2XJVA