1FOD1

Structure of a major immunogenic site on foot-and-mouth disease virus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGGLLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRYSRNAVPNLRGDLQVLAQKVARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOOT AND MOUTH DISEASE VIRUS
publication title Structure of a major immunogenic site on foot-and-mouth disease virus.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Virus
total genus 40
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1993-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fod100
1AL23 1BBT3 1TME1 4CEYB 5BNPA 1EV11 1AYM2 1PGW1 4IV1C 3JD72 3ZFGA 1MEC2 2FZ2A 1FMD2 1HQNA 1K5MA 4PDWB 5ABJC 4FTSA 1NG0A 3VBHC 2RS13 4RHV2 2ZZQA 3JB8A 1RUI1 4RQPC 4FTBA 1PGL2 1COV2 1RUF1 5JZGA 4CDQB 1RUC1 2RS52 1TMF1 4PDWA 5K0UC 1VBC3 2XPJA 1EAH1 2Y26A 1QJX2 1NOVA 5C8CC 1VBE3 3VBRB 1RUE2 1VB2A 1H8TC 1FMD3 1PO11 4CDUB 4JGYC 3TN92 1PIV3 4CDQA 2ZAHA 4N43B 1QJY2 4RHV3 1AR82 1D4M1 5ACA2 2WZR1 2HWE1 1HRV1 1AYN3 3ZFFB 4Q4V1 1COV3 2R071 1NA1C 1VBD3 4IV3A 1OOPC 4CDWA 3VBRA 2XBO1 1POV1 4GMP1 2BFUS 2RS53 4N43A 1Z7S2 2RR11 5A32B 5BNNB 1QJX3 1QQP1 4QPIA 2HWC2 1C8M2 3NAPB 1HRI1 3VDDB 1POV0 2HWB1 4GMP0 1SMVA 1FOD3 1HXS3 5L7OB 2WS92 5CFDB 1B35C 1AYM1 1RHI2 4YVSC 5C4WA 1AR83 2MEV3 4CEYC 3JD71 1MEC1 5ACA3 1QJZA 1E57A 1X33A 3ZXAC 3VBSC 1BMV2 2HWF2 3NAPA 4GH4B 4FSJA 1RUG1 4PDWC 1ZBA1 1AL22 4RS5B 1BBT2 1MQTB 2X5IB 3JBG1 1PGL1 5GKAC 3FBMA 1NY72 1QJU2 2BUKA 2HWC3 1C8M3 1AR73 1OPOA 2RS12 1F2NA 4YVWB 5BNPB 3J8F3 5CFCC 4RS5A 2X5IA 1RUE1 1RUD3 4WM7B 4JGZC 2QQPA 2R043 3TN91 1QJY1 4AEDA 1FPN3 3CJIC 2R061 1ND3B 4CDUC 4Z92B 1RVF3 4YVWA 5DDJ2 4Q4Y2 1NCQC 1VBB2 4SBVA 1NCRB 5D8AB 5JZGB 1VBE2 4WM7A 1QJU3 3ZFFC 5LK7B 2FZ1A 2RM22 1PIV2 4N53B 1Z7S1 1AR92 5AC91 1AUYA 1V9U2 1F8VA 4RR3A 1ND3A 2WFF2 1AYN2 5BNNC 3DPRB 1PO23 2WS91 1NCRA 1PVC1 1VBD2 5D8AA 3NAPC 1ND2C 3VDDC 1RHI1 1ASJ1 1A6CA 1ZBE1 5FMOL 5L7OC 2IZWA 4N53A 5FOJB 5C9AC 3VBFC 4CDXA 5CFDC 4GB31 5DDJ3 1DDLA 4Q4Y3 2HWF1 1BEV1 1VBB3 4Q4X3 1R081 4IV3B 1RUJ1 2VQ0A 4WM8C 4Y5Z0 3DPRA 4CDWB 1FOD2 1AL21 1VBA2 1BBT1 1HXS2 2HWD2 3VBOA 4GH4C 2RM23 4QPGC 1AR93 1V9U3 2MEV2 1MQTC 4Q4W3 4QPIB 2WFF3 3LOBA 1CD3G 2PLV2 2RS11 5BNOA 3M8LA 3VBUA 2RMU3 1R092 1AR63 5C4WB 2RS33 4YVWC 4Y4YA 5BNPC 1C8NA 2GH8A 4WM7C 3ZFGC 1AR72 4IV1B 1VBC1 1RUH3 1TME2 1K5MC 1VBA3 2HWD3 1VB4A 1EV12 1PGW2 3J8F2 5ABJB 1VRH3 1R1A3 3S6PA 4RFT0 3VBHB 1OHFA 1VBE1 1RUD2 1FMD1 2R042 1PIV1 5JZGC 4RQPB 2PLV3 4RHV1 1FPN2 4IV1A 1AL0G 1R093 1RMU3 1CJDA 1RVF2 1AYN1 5ABJA 5K0UB 1COV1 3VBHA 1VBD1 1RUC2 4AEDB 2RS51 1EAH2 1TME3 4RQPA 4CDQC 1QJX1 1H8TB 1EV13 4JGYB 2WWSA 1FOD1 5K0UA 1PO12 1HXS1 1PO22 4IV3C 1D4M2 4CDWC 3VBRC 1AR81 5C8CA 1NA1B 4RR3B 2MEV1 1RUI3 5ACA1 1HRV2 4N43C 1H8TA 1RUF3 4JGYA 1VAKA 4Q4X2 4QPIC 1RUC3 5FMOS 1TMF3 1EAH3 1WCDJ 4CDXB 1NA1A 5C4WC 1OOPA 4Q4W2 1HRI2 1B35B 2DF7A 2HWC1 1C8M1 2HWB2 1AR71 4YVSB 1RB8G 5J98B 1PO13 4FTEA 2RMU2 3VBOB 3J8F1 3VBSB 1D4M3 1AR62 2RS32 2WZR3 1RUD1 2HWE3 1HRV3 2R041 2TBVA 4CEWB 3ZFEB 4Q4V3 2R073 4NWWA 5A33B 5BNOB 1B35A 1BMV1 1FPN1 1W39A 4YVSA 1RUG2 3VBUB 1ZBA2 2XBO3 1POV3 1RUH2 4GMP3 4CEYA 1RVF1 3JBG2 2RR13 3VBSA 1VRH2 1R1A2 2ZTNA 1QQP3 4RS5C 2BBVA 1NY71 2X5IC 1QJU1 5CFCB 1HRI3 2HWB3 4BCUA 4CEWA 3ZFEA 5A33A 1X36A 4JGZB 1HX6A 4AEDC 1AYM3 1RMU2 3JD73 1MEC3 3CJIB 3HAGA 5J96B 1PO21 2R062 5CFCA 1NCQB 1RUG3 1ZBA3 3IDEA 3JBG3 4JGZA 5DDJ1 4RR3C 1ND3C 4Q4Y1 4EJRA 1VBB1 4Q4X1 3CJIA 4CDUA 4LLFA 2RM21 5AC92 1NCRC 5D8AC 1AR91 1NCQA 1V9U1 1RUI2 4Q4W1 1ND2B 4N53C 4NWVA 3ZFFA 2WFF1 1RUE3 4CDXC 1RUF2 3JB4C 1PVC2 3TN93 5C9AB 3VBFB 2RMU1 1QJY3 1ASJ2 1AR61 1ZBE2 3DPRC 2R063 1TMF2 2BFUL 2RS31 5C8CB 2BPA2 3VBOC 4GB32 4WM8B 5A32A 5BNNA 1BEV2 2GSYA 1ND2A 1R082 4QPGB 1RUJ2 3VDDA 5L7OA 1RUH1 4CEWC 3ZFEC 1VBA1 5C9AA 2HWD1 3VBFA 5CFDA 1Z7S3 5BNOC 1IHMA 5AC93 3VBUC 1VRH1 1R1A1 2WZR2 1OOPB 2HWE2 4WM8A 1GFF2 4Q4V2 2R072 4GH4A 2PLV1 2WS93 1PVC3 4QPGA 2XBO2 1R091 1RHI3 1RMU1 1ASJ3 1MQTA 1ZBE3 3ZFGB 4GB33 2RR12 1M06G 1K5MB 2WLPA 1QQP2 1BEV3 2HWF3 1R083 1VBC2 1RUJ3
chains in the Genus database with same CATH superfamily
1OSGA 2ZGMA 1XE7A 3B02A 5LA1A 2IXLA 3VHRA 1EV11 2VXRA 1ACCA 4NIDA 2DVDA 2D43A 2ZACA 3JD72 1MEC2 2R49A 5KHJA 3O14A 4H55A 5JSOA 1G9CA 4AOCA 5ABJC 4XVHA 3V0BB 2DDUA 2JE7A 1UZYA 3VBHC 4RHV2 5EJ1B 2ZZQA 5A6YA 1UPIA 3O1OA 3MIBA 1TNRA 2OQ6A 2VECA 3VZNA 4META 1LOFA 2BOJA 3AYDA 3N9PA 2PAKA 4K7JA 3SCGA 1J3QA 5FZ6A 2VU9A 5CU1A 3ACGA 1ZA7A 5I8SA 1G6NA 1GWLA 3K48A 1Y3TA 3EHKA 3MLLA 4Q1RA 2GNDA 5EZWA 1GYKA 2UURA 4NHLA 1ENXA 1PNFA 3FUOA 1RUC1 4AI3A 4NR1A 3VZJA 1UIKA 1UZ0A 4AFMA 3DCQA 2HJIA 2VH9A 2R16A 4MGZE 4IGPA 2VVDA 4EV0A 3H50A 4CPBA 2RG4A 5A7NA 4E27A 2XH6A 1H4GA 4DMIA 5C8CC 1GICA 3VUOA 3URFA 3TEZA 4NRMA 5F9TA 1O3QA 1JYTA 2ARBA 4XFBA 3RSJA 1UOGA 3ZXEA 2I45A 2Y8KA 4MYEA 4AF9A 1NXD1 5IK5A 4JGYC 3TN92 2NMOA 3AM2A 3OG2A 2ZAHA 4N43B 1GQPA 4RHV3 1AF9A 2ORXA 4KWJA 3NW4A 2YROA 2R0FA 3MW3A 1TZOA 4XAEA 3MIDA 3BTYA 1C3HA 3AB0A 3LFMA 2CAVA 3I2OA 1AYN3 1UQXA 1UOBA 2VNRA 4D7YA 3O1RA 1I5PA 4Q4V1 1SFNA 2VUDA 3KV5A 4BQ1A 5E16A 5ISLA 3ROUA 1YC61 4IV3A 2O8QA 5IAXA 1W8OA 5FLHA 1HQWA 4IXLA 4N43A 1Z7S2 3OD4A 4PBPA 2RR11 3ZYJB 5A32B 3GZUC 1IQAA 2VUAA 1QQP1 3J7MA 2JD9A 4ZZ8A 1YJKA 2A6ZA 2HWC2 3NAPB 4QPIA 4UBGA 1H6XA 1POV0 2HWB1 4LBMA 4AFAA 1CAXB 4D6QA 4UW4A 1ULPA 1WMEA 2XGXA 5L7OB 4ARXA 4L99A 5A7OA 2WS92 1W0OA 2D6LX 4LOTA 4XBNA 3ECQA 4C90A 3LB9A 4UF0A 4HKLA 1B35C 4HG6B 1RHI2 3UGFA 3A0KA 2GZWA 1IS3A 1WLWA 3BOWA 4RSUA 3VZLA 4E4DX 1QJZA 3JXSA 3PLQA 4MSVA 1VP6A 3AMQA 1JODA 1MZ6A 2W92A 3KVAA 5BPXA 2RVAA 3HNYM 3NAPA 2XR4A 1V00A 3GCXA 1CAXA 1YQ5A 1AL22 1BBT2 5T5PA 1OQ1A 2X5IB 4LKEA 5B2GB 5FMDA 1PGL1 3LIHA 2ZX4A 3H8OA 4V2WA 3OYWB 4JX0A 1QOOA 1H1IA 3BALA 3M3EA 3KB5A 1LHVA 5H9SA 2VW1A 2YXSA 2HWC3 4Y20A 1SFPA 1DG6A 4YGBA 3ZXKA 1RUNA 5FLIA 1W9WA 2RS12 5C70A 2CDPA 2EIBA 2G19A 3HWJA 1QWRA 2E51A 2Z5WA 4QM9A 4BIOA 2X5IA 4QB6A 5HV4A 4P5YA 1RUD3 2FCUA 3CJXA 3CL1A 2WRAA 5FY5A 3ZM8A 4JTNA 4AQ6A 2QQPA 3BU0A 1WW6A 2R043 1QNYA 2WAAA 3DYOA 4YM2A 2PHWA 5J3UA 2PHFA 2QCSB 4B7EA 3N4MA 5FWEA 1FPN3 5G05L 1KITA 3BU7A 4IEVA 4QKFA 4AVSA 1OXCA 1QIQA 2DCZA 2C1FA 1IS5A 2FCTA 3E1F1 3NJZA 3OGVA 5DDJ2 5EPAA 1DQ5A 5BV6A 1FV2A 5ACA3 3VDBA 1MS0A 5I93A 5JZGB 4UT5A 4OHWA 1H2MA 1XNCA 1VBE2 2J1AA 3DECA 1K3IA 3PNAA 1GSLA 1PK6B 3H8XA 4UOJA 4G4FA 4YZ5A 2FZ1A 2RM22 4FBFA 1PIV2 5CIRA 2R32A 1AR92 1JUIA 5AC91 4M4PA 1UPSA 1AUYA 1F8VA 1T6BX 3NJVA 3KGLA 4P08A 3UETA 3KV4A 2B7YA 1XE0A 4QQHA 2WNVC 2Z42A 4DFSA 4FP2A 3BVCA 2WABA 5K9YA 3I2DA 5E1RA 3OSDA 5F5AA 5JSPA 4CCDA 1VBD2 5F7UA 2OPKA 3VDDC 3RI9A 4AXOA 4X8PA 1PK6A 1ZBE1 4XC9A 3HIFA 3CZJA 2PELA 5A6XA 1FNYA 2JG8C 3VDCA 4QGLA 2FDIA 2CHHA 4NRPA 5DDJ3 1DDLA 1GP6A 4AVCA 3N7MA 4HETA 4P5HA 3OEAA 1W6QA 1FOD2 3KD4A 2QQUA 3EBRA 3POSA 2XUMA 3C7HA 5KR7A 4FP3A 2RM23 2VUCA 1AR93 4W6YA 2DFBA 5LY1A 2QE3A 4NHMA 1IKPA 1XSQA 4N90A 4R9AA 4Q4W3 5FZ1A 5A3OA 4UFHA 2JICA 2Y38A 4YFZA 4EWEA 5LK5A 5J09A 1XC6A 4QXKA 4B1LA 3QD6A 5BNOA 4W65A 3M8LA 3ZXFA 5JI9A 3GHMA 5DAWA 4BQ3A 5FO7B 3TOJA 3LD8A 4H3WA 1NAEA 1AR63 1SBDA 4FPEA 4K21A 4F83A 5C4WB 2VPVA 3QLQA 4NUBA 4IEWA 2H0BA 4IGOA 4CYDA 4R4XA 1O4ZA 1DGLA 1SQ4A 2QKDA 4HVRA 2GC1A 4L11A 1RJ7A 2ZXQA 3C2UA 5DUWA 2IXKA 1SLIA 4YRDA 4DY3A 4W8JA 3ZR6A 3LPFA 4J6GA 4WM7C 3WNPA 3O1PA 4ZXEA 1AR72 4CVUA 1MZ5A 3DUIA 4YLZA 2CSGA 1K5MC 1PMHX 1RUH3 4M0HA 3HN1A 2ZMNA 3NKTA 2ZGOA 3RZZA 4UYBA 2V09A 2JDPA 5FZIA 4MZUA 2PYTA 4QKDA 5ABJB 1O4TA 2ENRA 5EYXA 4A6SA 4LT5A 2ARCA 2JIGA 3BYWA 3VBHB 1OHFA 1FV3A 3KT1A 5C71A 1F9KA 3M7AA 4XHXA 2ETEA 2XOMA 5LBCA 4AGGA 4I02A 1OA4A 4LMFA 4CP1A 4OZOA 1UZWA 1GKBA 2NLRA 2WIIB 4RD7A 3BTZA 1CJDA 3ZO0B 1CVNA 2CGPA 3Q8EA 4XJZA 1A3KA 1W8ZA 3MGUA 3W59A 4ASLA 5FYTA 5ABJA 1K5JA 3FFQA 5H9QA 2DU0A 2ZHNA 4RGGA 3AP6A 3VBHA 1VMHA 2YV8A 3GBWA 3HD8B 3KWVA 4NHKA 1JH5A 4AEDB 2O1QA 3GXUA 3I2KA 1KS5A 2GP5A 3GCWA 3RQ0A 2WNUC 4LO7A 3UKVA 2IWGB 1W8WA 5FUNA 4JGYB 3SKVA 3SLIA 4DS0A 3MW4A 4XIOA 4ES8A 4A45A 3RZMA 1OD3A 3AK0A 3SCFA 1U5YA 4NROA 4ONUA 1HXS1 4A4AA 4L92A 4YYOA 2G1MA 3OB8A 1SLLA 1D4M2 3H1MA 2EAKA 1C57A 2YHJA 1Q8QA 2W5FA 3M1HA 3MF9A 4HLTA 4XUQA 5HXVA 1PVXA 4RR3B 2MEV1 4XJ8A 4CA9A 5C8CA 5LRSA 4CRQA 1EPWA 1ZZCA 4O9EA 4ES9A 4MHUA 3FE5A 5FKBA 4CUAA 3VN4A 3DYMA 4JGYA 3RGBA 3H9AA 2BGPA 2PHDA 4Q4X2 4HN1A 4BPZA 3WNKA 1U5XA 5FY8A 3UT0A 1X7NA 4V2VA 4BQWA 3TB0A 5E6HA 1XNDA 4LOSA 5CKMA 2KM2A 5FZOB 1GWMA 1LOEA 4XPVA 3PMSA 2QQNA 4FPFA 2OZJA 2IXIA 3OBRA 1YRZA 4LHSA 4FPCA 1B35B 1RB8G 2A6WA 4NN0A 4KWKA 3ZSKA 4BWOA 3K3OA 5JPNB 1CGPA 1DGRN 1S2EA 3LA7A 1V6NA 3AXDA 1KGYA 1D4M3 1TNFA 4JDNA 4L0PA 4QKBA 2RS32 3P1IA 1YWKA 4LKSA 1UU4A 1DZQA 1JOJA 4JKLA 4IW3A 3MV11 1W2UA 2YUEA 5FYBA 2NQYA 2QZ3A 2Q8OA 3WX5A 3WNLA 4HXCA 4YW6A 4NWWA 2OQ7A 2WZEA 5CADA 3Q9OA 1B35A 1EY2A 1RUG2 3WUCA 5JAXA 1ZBA2 3E6DA 4DUXA 2VZSA 2WC2A 3FN9A 2JEMA 1IG0A 3JBG2 4DIQA 1QF3A 1XNAA 1PZ7A 4C8DA 2MNGA 4YWAA 4F8AA 1N47A 1R1A2 2DCKA 2AENA 4UW3A 4K9SA 4ATEA 2JECA 2XJQA 4QHBA 3O1MA 3LF7A 4IDZA 5CAZA 5FZ0A 1DGWA 2HH9A 3I2JA 4P02B 4DRVA 4HMZA 4S2HA 4Y33A 4BH9A 4E4SA 3INAA 3WQ1A 1OF3A 1HX6A 1CPMA 3B69A 1FX5A 5A80A 4ZS2A 1LHOA 3LWCA 3TYJA 3WOGA 3J4UH 2BQPA 2WT0A 5FR3A 2IUWA 4QAWA 2AC1A 3NNLA 1HJGA 1XB9A 4LIUA 1NLRA 3MIGA 3D8CA 1PO21 4XQ4A 2ZHLA 1LHNA 3T30A 5LZ6A 3THDA 5DMYA 4GWMA 1FI2A 1RUG3 3TEWA 1ZBA3 4OVEA 4W6XA 3S0MA 3MEPA 1YFYA 1UU5A 1XNBA 1LGBA 1X8MA 3JBG3 3RMXA 4IEXA 3DKQA 1REFA 1ND3C 3H1WA 4Q4Y1 3ZLIA 1S0DA 4E2QA 4CSWA 2OUJA 5EHDA 3WUDA 2P1BA 3I59B 1ZRRA 2D6PA 2GC2A 2P3IA 3HQUA 2CL2A 2AZ5A 2E7QA 1WCKA 2VGDA 1UKRA 2GN7A 1NCRC 5HCHA 5C6CA 3IB3A 5LEJA 3AYCA 3N7LA 1RUI2 4EE2A 4LUKA 2QZ2A 2Y34A 2VXJA 1AJKA 4N53C 2V4AA 1JMUB 1LRHA 2P4EA 1RUE3 2WFF1 3OF1A 4CDXC 1OA3A 3JB4C 3U4SA 3C7EA 1JYCA 3FZ3A 4YGCA 5FYSA 4XACA 4E8DA 2VZRA 4F7ZA 5FDBA 2I2SA 1H2LA 1QJY3 1W06A 1F4HA 3ZIXA 1UWWA 3IDCB 1L3JA 5IK8A 2WNVA 2BJSA 5F6KA 4YARA 1CIYA 1UMZA 2BRTA 4FFIA 3VBOC 4Q29A 3SXWA 2Q0AA 5FYVA 2PAEA 1CX1A 1TQ5A 4P14A 3POFA 3WDVA 4AG4A 1R082 1UNBA 1RUJ2 5DZFA 3VDDA 3GJAA 3AMHA 4R9DA 3ZFEC 4CEWC 2Y6GA 1UN1A 2JB4A 1WD4A 3FWEA 3JU9A 4ZZ5A 5A3UA 2JG8A 1REDA 1Q8SA 1IHMA 3I2HA 2WL1A 4QMAA 3VBUC 3FLPA 1OLQA 2DUOA 3T2PA 4WVZA 5FYUA 1OOPB 4OULA 3QACA 4EWAA 1ZZ7A 3F95A 4AL9A 2HBTA 3I3DA 3RI8A 1ZNPA 2R072 3RWKX 4CCOA 1IGOA 1ZVFA 4RL7A 4LBOA 1LR5A 2LW8A 3ZYGA 1RMU1 2P6CA 2JXAA 4FT8A 2YU1A 4TLFA 3CO2A 4GALA 4CU8A 5I0DA 3BPZA 2DVFA 5FQ0B 1U0AA 5HI0A 1SBEA 1VALA 1LHUA 1K5MB 2WLPA 4D7SA 1PMJX 3AKQA 1XOYA 3LEMA 1BHGA 1HV1A 5FP8A 1R083 1VBC2 1RUJ3 3ME2A 1GNYA 2VR4A 5GZGA 2XKPA 1WBFA 3KCXA 4AI9A 2C0ZA 2VMHA 3K46A 1Q8OA 1W9SA 2ZGRA 5I91A 2B42B 2B9UA 5JOZA 4L97A 3U4XA 4XE9A 5BUVA 1AYM2 2EXJA 1JZ6A 3U1XA 5JCTA 1CJPA 5DXDA 2YBKA 4KQ7A 3O1SA 2VZ1A 5FQ0A 3PUAA 4V1PA 4Y1YA 3IDAA 1W03A 4Y1XA 3WDXA 3ZSMA 1K5MA 4PDWB 4TTGA 1XQNA 2BU9A 1YNAA 4Y1VA 2DVBA 2WZPP 3JB8A 1J84A 4EN0A 4FPOB 1US2A 2NZ9A 2XJUA 3FL7A 3N36A 1PX3A 3O12A 2VVEA 4Q0QA 3LDKA 2EAAA 2XJPA 3NO8A 5ANNA 1Y9GA 2VNGA 3U10A 1RUF1 3OPZA 1OPMA 1LTEA 2W68A 2YZ4A 1NE6A 3ZIWA 4COWA 5A3LA 2IXHA 2WNUB 3H8UA 3M4FA 4HZFA 1SHWB 5FPZA 1U12A 1WZXA 3BN6A 3PHMA 5DZGA 5AVAA 1A8MA 4FPKA 4YGEA 1TMF1 4PDWA 1F5FA 1VBC3 3LEGA 2XPJA 2D6OX 1HLCA 3VHPA 4KBZA 3OBZA 4CP0A 3NMBA 1JZ3A 1D2QA 2Y26A 1QJX2 2C24A 4BA6A 3VZKA 1NOVA 1WCQA 3KF5A 2EXIA 2GNBA 2XUEA 2XHKA 3AL6A 2XDVA 2WT1A 1L7RA 4GWIA 1F4AA 2HKXA 3AMMA 3CZUA 3D0JA 1JYXA 4IGQA 2WNUA 3I7DA 1V6IA 1FNZA 1DQ4A 4FI9A 3VHOA 4JRAA 1S0FA 5DUVA 4BDVB 3RNSA 2BGOA 1BZWA 3LFIA 1WMXA 2WZR1 2ZGTA 1MR5A 2BWCA 4NE9A 1OLMA 5ACA2 2UY8A 1UZZA 2HWE1 5JOXA 4GD4A 1HRV1 4OHVA 2DV9A 5A6QA 2XJVA 3ZFFB 2BTVC 3ETQA 1W3XA 3VKFC 2BVBA 4QX3A 2XL9A 2DCYA 5C33A 5A7SA 2QQOA 3VD4A 4CDWA 4PHZA 3ZN6B 2XBO1 1POV1 3AJYA 2B8MA 3ZYBA 2DTYA 2WNOA 4KWUA 4Y26A 1KDKA 5A6ZA 2P34A 3AZWA 1J1TA 3MHZA 5A1AA 5BNNB 1QJX3 1OMIA 2JIJA 2AGSA 2C9KA 2JX9A 1CZSA 2YFZA 3A4UA 4LBJA 3ZSJA 5JLVA 3KZ4C 1C8M2 1UKGA 3FC0A 3ACLA 1J1LA 1HRI1 3WV6A 2H0VA 2RDNA 4GMP0 2TUNA 4AEKA 4RYDA 3V64A 4B7KA 2QDRA 2UY9A 1WCUA 5FZ7A 5JR7B 5J36A 3POWA 2BYVE 3ZN6A 5CFDB 5DG2A 5LB6A 4LPLA 5KHKA 4YVSC 1OUSA 1YQ8A 1V6JA 3WF0A 4CEYC 4KH9A 1QDOA 1CAWB 1SLAA 1MEC1 2Y6JA 3JD71 5FZEA 3EXUA 3FFZA 3T1LA 3ZXAC 3I2GA 4CU7A 3AZXA 3P3PA 1SDWA 4GZ9A 4LO6B 5FY0A 4MGKE 3VDAA 3I3EA 3BTXA 4Y22A 4PI2A 4A44A 2HWF2 5FZAA 1BMV2 2F6BA 3IM0A 1D7PM 1XSRA 1KFXL 1MQTB 2WQ4A 4KU8A 3VV1A 1W99A 5GLZA 3CNAA 3LKJA 2FDJA 2LM3A 3TRSB 5CZKA 3FBMA 4IE0A 5I8YA 1XYNA 1CAWA 1C4RA 3V65A 2P6HA 3R4DB 3ATGA 4NRQA 5KXBA 1C8M3 2NPIA 2FDFA 2ET7A 4LBQD 3S5QA 2DURA 3KT4A 4H14A 2JWPA 3MPPG 4CU9A 1ZRDA 4B3NA 3J8F3 5CNAA 3SMHA 3MDPA 3AVRA 5FZDA 2F17A 1YI9A 2K46A 2HBUA 1DYOA 1HKDA 4JGZC 4LORA 3LOIA 1DYKA 3VKMA 3TN91 3EJKA 5FZGA 3X29B 3PVEA 4Q26A 4L2NA 1U5IA 1YUDA 2WYSA 1BCXA 5DPNA 1A8DA 1N1TA 2R061 1ND3B 1L7LA 2GC0A 4W50A 3VKOA 5FMBA 3PTRB 4CDUC 3USUA 2QQVA 1RVF3 2GAUA 3R4SA 1W6MB 4I0AA 1GMMA 4W4ZA 1XNTA 4NOTA 3KM5A 4JQRA 1FAYA 1NCRB 4YNIA 3P5BA 1QOTA 3L9JT 3D3AA 1HJFA 1RITA 4XZPA 3UK9A 1TG7A 3CMGA 4N53B 1Z7S1 1O7FA 1CR7A 4FFFA 5JDBA 1LU1A 2SLIA 1W2AX 2XJRA 4ET7A 3I54A 1ND3A 2DBIA 4UW6A 2WSVA 1QXRA 5BXXA 1LOBA 5EQUA 3WDWA 4OUMA 4UBHA 4BQYA 4XABA 2BGCA 3Q8FA 1W6MA 4FQ4A 1AYN2 2JE9A 4JHZA 1DFQA 1LULA 4KNCA 3SITA 4XUPA 5KHHA 2WS91 1IZ3A 1NCRA 1PVC1 4D0QA 2RJ2A 1QNWA 1RHI1 3AVSA 1ASJ1 4XMAA 1DZRA 5FMOL 3WT3A 4K8RB 1XJAA 2IZWA 3DYPA 3NNMA 4MGYE 4N53A 4DRRA 4EYUA 5FOJB 4YM0A 3VBFC 4CDXA 1HQLA 4N7IA 1IS4A 5FY9A 3LAGA 3SQOA 3WDYA 1S55A 2FHRA 1BEV1 4EQVA 1LNSA 3EYPA 4DXTA 4LBLA 2ADEA 4IV3B 4Y5Z0 2AUYA 2VQ0A 2YDEA 4HFSA 2VMCA 4PIZA 5BY5A 3ACIA 1AL21 1VBA2 1BBT1 1UZVA 3FUQA 4C0HA 2HWD2 2J1RA 3KT7A 4XW3A 3VBOA 5IVEA 4GH4C 2IFRA 2DTWA 5HCBA 5CG8A 1W04A 2VAUA 3HN3A 4P9IA 5I0SA 4K3UA 4QPIB 3I3QA 3LOBA 4AHYA 2VCBA 2C26A 5J1XA 3LQCA 3ZDVA 3N9OA 3UNPA 3ST7A 1CD3G 2PLV2 2RS11 2D97A 4NAMA 5EJZB 3ETPA 5IATA 2JE8A 1AX0A 2RMU3 3VBUA 3PU8A 3PMEA 4UF0B 2ZMKA 2ZZJA 4AQ2A 1UY0A 3G6JB 4NPRA 2V73A 1C5HA 3R05A 1WW4A 3WF2A 4BQ4A 3GZEA 3GZTB 3TWIA 4YVWC 1XRUA 4KGGA 3VL9A 5BNPC 3LA3A 1UXZA 4QDRA 1C8NA 4A2UA 2GH8A 2OT7A 2ZX3A 5J7MA 1QXJA 2BVVA 1JXNA 4ORFA 1ULCA 3ZFGC 1SG3A 4I2OA 2D3RA 1J58A 3U78A 1Q5OA 5APAA 3AXEA 1VBA3 2HWD3 2NMNA 1LU2A 3SH3A 2WQZC 1EV12 1H9WA 2VCMA 3IBMA 1VRH3 1ZREA 2IXCA 4RFT0 3S6PA 1DLCA 1I5ZA 2PQSA 2Q5TA 3K51A 1O5UA 4OUEA 2QQWA 4YW7A 4DY5A 3M2MA 3O1VA 1VBE1 5CG9A 1RUD2 1X9TA 1FMD1 2W95A 4JDMA 2R042 4XF4A 3IT8A 4Y20B 1PIV1 4XTPA 1NZCA 1ULFA 2Q8EA 2PLV3 1AXZA 4XAAA 4ARYA 5F8PA 1G9FA 1FPN2 1EP0A 1H8VA 2B46X 2KXLA 1AL0G 3P6BA 4I3PA 1S2KA 4LTAA 5D1IA 3T09A 4AVVA 1WD3A 1JI6A 4CUBA 1W8HA 4B4QA 4L9BA 4D3WA 3WDTA 5IFPA 3H8RA 1FT9A 1N3QA 1NUKA 1WMDA 1COV1 4PJYA 4XJWA 4COZA 5IW0A 1VBD1 1D0GA 4XTMA 4MADA 1RUC2 5DAXA 2EA7A 2W87A 4QX0A 4S2FA 1H30A 2CDOA 2RS51 2J7MA 1YQ2A 4WZFA 4MGIE 3RRDA 2OPWA 3MLJA 4BZ4A 4CDQC 2BNOA 1S0JA 1EV13 1Y4WA 2FBEA 1DF0A 1QEXA 4Q8LA 2QTWB 2XKOA 4BE3A 4RN5A 1MS9A 4PLMA 1FOD1 4MXVA 3RS6A 4XUTA 1UY2A 2VCCA 4Q0UA 1PZ9A 1EYBA 3OUJA 2GN3A 4CP2A 2VCAA 3ZPOA 5FYCA 1AR81 3VBRC 3WLUA 2ZEZA 5FZCA 2EXHA 1XU1A 3RMYA 4DINB 4EN9B 3AMPA 1JHJA 4PI0A 3I49A 3N7JA 1AHSA 3RYRA 3NJYA 1XYPA 4M3CB 4QDSA 1UX6A 2E9QA 4XQWA 3WW3A 4CE8A 3LA2A 1RUC3 4ASKA 5FBJA 2A6YA 2RHPA 1F35A 4HN0A 1NX9A 1YFUA 1RINA 2C4XA 5FO9B 1YHFA 1WMFA 2E31A 2VZ3A 4LQRA 4S2GA 1I6XA 4Q4W2 4Q2FA 2VY0A 4P00B 3WP6A 2HWB2 4YVSB 1AR71 5J98B 3N9NA 1W6QB 5E89A 2WJSA 4M3CA 2FCVA 5FK8A 3T0AA 3J9SA 3H7JA 1F31A 3PIGA 4XURA 3ZSEA 3ZXGA 2VQTA 2IFWA 4WVMB 4TZDA 4IEOA 1AR62 3POEA 5JOYA 5LA2A 3WF4A 4YW4A 2Y0OA 3MIHA 4GJYA 3GF6A 3ILFA 4Q4V3 5A33B 1WLDA 1UL9A 4ZU4A 1DZTA 1UOFA 5BNOB 1BLZA 3A23A 2QQLA 3ABZA 3PJQA 4YVSA 3WNXA 2XHNA 2PXJA 4FFHA 5F39A 1RUH2 4CEYA 4QU2A 4EWDA 4GXLA 4Z2WA 2CAUA 3OD0A 4DPNA 4XFFA 2XQRA 1T2XA 2RR13 4WVMA 4J25A 4DEVA 2DCTA 1JN2P 1QQP3 1NY71 1QJU1 4KBBA 4IEYA 2HWB3 4GWJA 4LO5B 4FCAA 1ENSA 5CISA 5A33A 3WQ0A 1K42A 1X36A 1POQA 1QHDA 1FYUA 2JDAA 3PDQA 4JGZB 5F5CA 3AKPA 3KHBA 4OCTA 1AJOA 1ZZ8A 2ZEXA 5F3CA 1BQPA 2WUHA 4TSVA 2GMMA 4FVVA 5LA0A 2GH2A 2VZPA 1KEXA 1S0EA 2F4PA 5CA6A 4NMIA 3T0BA 3MIFA 2XXZA 4RGAA 5KC6A 4IEQA 4EROA 3ZYRA 2ZGSA 3NV1A 5IAVA 1HDKA 4YFWA 3IDEA 1X8EA 3FJSA 2AREA 2XLAA 3QH7A 1YEWA 2K9ZA 3DGTA 4JGZA 4LHNA 5E88A 5T54A 4QXBA 3M3QA 4D94A 1VBB1 4Q4X1 2C6SA 2D5HA 1ENRA 1YYNA 4H2AA 4LLFA 1GV9A 1L7QA 3UESA 4CDUA 2VL4A 5HXMA 3H1YA 1VJ2A 4C1WA 5AC92 4GJZA 5DUXA 5JUVA 1MS5A 2RDSA 1V9U1 2P3JA 3LEKA 4ATFA 2YBSA 3Q8AA 3ZYPA 1GZTA 2WO3A 4HK9A 4AEJA 5JSRA 4NIHA 2Z2SB 1N1VA 3JQWA 4E2SA 4OYUA 1SEFA 3VBFB 1G9AA 1CESA 3CLPA 4IETA 4MXWB 1OLME 1ZBE2 1OKOA 5IK7A 3WP3A 2BFUL 3KVBA 1N3OA 2RS31 4YG3A 5T55A 5C8CB 5JIUA 1C5IA 2NP0A 2HYXA 3ZR5A 4PLOA 4WVWA 1UF2C 4XFHA 4CXXA 3SHRA 1YJLA 5CKQA 1JUHA 1RXFA 2R1DA 3A21A 3BIWE 3KF3A 3CF6E 1RIRA 1GZCA 4XJAA 3S7IA 2ET1A 3B5LB 4QM8A 3VBFA 4FFGA 5AC93 4MXWA 5GZEA 5AFBA 1UMIA 1R1A1 3NV3A 4C0BA 2V5DA 1PGSA 1PM7A 3U11A 2WN3A 3O0WA 3UGGA 4XF0A 5FUPA 3THPA 3ALQA 5FPAA 4XUNA 5FYZA 4DZGA 1GFF2 4GULA 3WNNA 4GH4A 1S0CA 1EUUA 4COUA 4BQ5A 1DGWX 4Y1UA 3I3BA 5LEKA 1R091 4LEJA 1BK1A 1ZBE3 4FOWA 3WF3A 4AYUA 2PHTA 3CBNA 4HBNA 4S2DA 3ZFGB 4E8CA 2YU2A 5FAXA 5HBAA 2VVFA 4TXWA 4N7UA 3LDBA 3ZYFA 5C5TA 2ZA9A 1WCSA 1K12A 5FPLA 4Q8KA 1YI7A 2V72A 4MH0E 3UJQA 4DOUA 2OX0A 1SLCA 3RVHA 4PF1A 2J1TA 4AFCA 4B4RA 4QHOA 3N35A 1TME1 3BGAA 4GQ7A 1N1SA 4OI2A 5BNPA 4QGMA 4AAPA 2UYBA 2W1QA 3TAYA 4HSJA 1PGW1 2JD4A 3OPTA 1S0GA 5AVPA 3SCHA 1J83A 3B94A 3ZFGA 1OQDA 2FZ2A 1CWPA 1NXMA 4LO8A 3U75A 2WNEA 1O3RA 3LEIA 3KV9A 3OGJA 4XOGA 5CB7A 1NG0A 1UY1A 3LSEA 5FYIA 4G9SB 4HL0A 3QBQA 4MX3A 4BLJA 1W0PA 4MGSA 1G7YA 2B4KA 1RUI1 5F2SA 5KXEA 5FBZA 3CQOA 1C1LA 3EMRA 1CONA 1LEDA 2CGOA 4EN6B 3IKWA 5ERLA 3MBWA 4CDQB 3VHNA 4NIIA 4XXAA 3TNQA 1WA6X 2RE9A 1JOPA 3VZOA 4QB1A 4DEQA 2W52A 2G9FA 1GOGA 4EZ4A 5K0UC 1XNKA 4I0BA 5FP3A 3H42B 1EAH1 5IT6A 3CHXA 2LALA 2JDHA 5FXVA 3AKRA 1XYOA 2EALA 3MIEA 4MHRA 4Y24A 4JKMA 5DAVA 2WKKA 2WWJA 3R0RA 3LZZA 2D40A 3IIAA 2IVJA 3W5NA 3VBRB 1RUE2 4BU2A 3IMNA 4XCAA 4AFDA 4CCJA 3RZJA 2UWAA 1PO11 3KGZA 1UYZA 5K7PA 3RJ2X 1QDCA 3G7DA 3WNMA 1OFNA 5T50A 4CDQA 4CUGA 4UW5A 3ZKYA 1QJY2 3J7NA 3IAQA 1D2SA 2JDUA 2UWCA 2NN8A 4OI4A 4CPBD 4YW2A 3VZMA 3J7LA 3GGLA 1SCSA 4IE5A 4NAOA 5FK7A 5A7QA 1HV0A 3UYJA 3GALA 3HQRA 1RYYA 3T08A 4YW1A 2R071 1NA1C 2A1XA 3AP5A 4B4PA 1MS4A 2ZGQA 4M00A 3HQXA 3BTAA 1O4YA 2ZS6B 3VBRA 4A7ZA 3NV2A 4COYA 3F2ZA 4GMP1 3RZHA 3PUSA 1UMHA 4LE4A 3N9QA 2XONA 2VQAA 4N8MA 2LUWA 2VUJA 2WNVB 4HPKB 4OMDA 5FYMA 5A7PA 4FPHA 5LY2A 3RFRA 1PX4A 3SKJE 1J59A 4BB3A 2B5HA 4CCKA 2E63A 4XF9A 5C7GA 4BMEA 4WV8A 1WKYA 2AEYA 3VDDB 1APNA 1SMVA 1JYNA 1PNGA 1HXS3 3W5MA 1X50A 1JU4A 2D98A 2ATFA 4LBKA 1GUIA 2JG8B 2UYAA 2ORZA 1AYM1 4R52A 4AW7A 3K75B 2MEV3 3AX4A 4HPKA 1H4HA 2GU9A 1X33A 2XG3A 2QDNA 4RA0A 1NLQA 1OC1A 4K40A 3VBSC 4K1YA 1KS4A 3ZYHA 4AI8A 1JZ4A 2EXKA 3RZKA 3OPWA 3VB9A 1ZA4A 5FZ8A 3I2FA 5IVBA 4QWNA 5IWFA 4MV2A 2D6NA 2PTMA 4J1WA 2VBBA 4I09A 3E6CC 5I0UA 1GQGA 2Z79A 2VOXA 5ANQA 3RJRA 3RZGA 4M0NA 2Z4FA 4R9CA 5GKAC 3OEBA 4FOQA 4J1XA 5T52A 2WT2A 3S7EA 1E5RA 1IG3A 3NSTA 3D82A 4LK7A 2BUKA 4XMIA 5D2AA 1JS9A 2CU5A 1O8PA 2WLQA 5I0RA 2IVIB 2FMYA 1CN1A 4IEZA 1F2NA 2W2IA 3DXUA 1CAUA 3K4AA 1DCSA 3POYA 5HCFA 4ASMB 3H3UA 4AEMA 2W1UA 4HKWA 1FATA 3ZYIB 1BKZA 1GOHA 2VZQA 1GNZA 4WM7B 3GJBA 5IVFA 5C3PA 2MPFA 2DVGA 1HB4A 3LIGA 4JV4A 4XEZA 4BXFA 3UGHA 4FOVA 5FP7A 3MPBA 4GKXA 3CJIC 2ZX2A 1E5HA 1NE4A 3NRUA 2I74A 1G8WA 2WQ8A 3CIHA 3ES1A 3U0ZA 3PUHA 1AXKA 4YZ2A 3ENRA 2OA2A 2YC4A 3ZKUA 5K4LA 2I07B 5JMOA 4P9JA 1NCQC 4Q4Y2 1OA2A 4LITA 5T5LA 3ZSLA 4SBVA 2VULA 4E2GA 1LHWA 1MS1A 4WM7A 2VTXA 1S4CA 1VAMA 4FXGB 3WW1A 5LK7B 2G4IA 5JIAA 2ZBJA 1N3PA 1LECA 3HT1A 2HLEA 4OHZA 1YO8A 3M3OA 2GNMA 4U2AA 2GC3A 4AI1A 1Z78A 3EQEA 5GM0A 3OCPA 2WFF2 1QU0A 3JCIA 3T2QA 3IZOA 4OQ8A 3ILRA 2CNAA 4NIGA 2JDZA 2J1EA 2Q8DA 1PO23 4XFCA 2OYZA 3ACFA 1RL3A 3SEPA 2ZX0A 3NAPC 2FD8A 3H7YA 3KQ4B 4OLLA 1ND2C 1GP5A 5FYYA 3WHTA 2LTNA 1W2OA 1AX2A 5JMCA 2VZTA 5L7OC 1OVPA 1O3TA 4FPJA 3PUQA 4R9BA 1NYWA 2JDMA 2QNKA 2X29A 2ZCWA 4BISA 1LOAA 4GB31 2BEOA 1AVBA 1SDDB 2EIGA 3VD5A 1PZ8A 4Q4Y3 4URAA 4KU7A 2A5ZA 2HWF1 4WM8C 3W20A 5KHGA 2JG9C 4CDWB 2R1BA 1DP0A 1S0IA 2A73B 1SLBA 4QQLA 4BXSV 1U5ZA 4LLOA 2QVSB 1I3HA 2QUOA 4NVPA 3AZVA 3AZZA 1DBNA 4UFIA 4XDPA 4D8MA 1SFYA 1H1MA 2D3PA 3JUUA 4M3CE 4DXSA 2WFF3 3RDIA 1W8TA 3GHNA 4EN8B 1BYHA 1W9TA 3MLKA 3A22A 2R0HA 3WP4A 3CKHA 1ST8A 1GZWB 1OH4A 4LR4A 1KDMA 3HBZA 4CZSA 2BOIA 3ORJA 4QQPA 4E4ZA 4IL7A 4JQTA 1K45A 4LA3A 4NHYA 5IHRA 5GALA 4Y4YA 4LO4B 5K8SA 2RDRA 4LBNA 3HEIA 1X9PA 3QOPA 3B9CA 5FZHA 3HMYA 2W91A 4Y22B 3CU7A 1OQEA 5LASA 4RGKA 3SC7X 4JVAA 3OJBA 4EN7B 3VD7A 4AI2A 5FV3A 3H3ZA 4URTA 4CCEA 4AVTA 5A1FA 3NJXA 1EPZA 1VB4A 1GZWA 3WCSA 5F3IA 3J8F2 2GP3A 5GZDA 3HNBM 2RDQA 4I3GA 3WEZA 2XMLA 4LIVA 3ZPYA 1JHNA 1US3A 5FJKA 2VZOA 5IVCA 2V4VA 2ZPXA 5JZGC 1WW5A 4NPMA 2FQPA 3PU3A 4RHV1 4XUOA 1IPKA 2VOWA 3VGIA 3MW2A 4FPYA 4GKYA 1ONAA 1RMU3 5IK4A 3KMHA 4LUMA 1Y9MA 2A70A 3O1UA 1LOGA 1RVF2 2DU1A 2YMZA 3OBTA 1AYN1 1YQ6A 1XXNA 2Y0IA 2R7EB 4GAZA 5LATA 5F3GA 3TBDA 4C91A 5K0UB 2FDGA 5IUQA 5FKCA 4ZS3A 2YC0A 3B3QE 2D44A 3USSA 5F1RA 3E5XA 4Z82A 4R4ZA 5GZCA 4DO0A 2BP6A 3ITQA 2BNNA 1RTVA 1NQDA 3GBFA 1YXWA 5FZBA 5L73A 3OGRA 3THTA 1BK0A 5IFTA 4ZXKA 4QX2A 3USUB 1W28A 5JI7A 1W0NA 3FHIB 4LE3A 1G9BA 4P9LA 3T4VA 3WHUA 2YG0A 1QJEA 5DZEA 5F37A 5C3SA 3JQXA 2OKXA 4QXHA 1OT5A 5K0UA 2QBXA 4PLNA 3MUY1 1QOSA 4XYXA 1KJRA 4LKDA 1MZEA 1VE0A 3ZN4A 2Q1ZB 2NYYA 1NA1B 1CIWA 4I01A 1UD1A 3N9MA 4MG2A 1HRV2 2ZHMA 3WW4A 1CAVA 1GOFA 4JZRA 4BK4A 1HIXA 1RUF3 3HJRA 3D6EA 2BZDA 1REEA 2CWSA 2YY1A 1VAKA 1NQJA 3AFGA 2XB6C 3LDRA 4KG8A 3VD9A 2HEYF 4OHYA 1KRIA 2D6KA 3B01A 5FTTC 4DXZA 5FMOS 1DQ6A 1TMF3 3FLTA 1WBLA 1SPPB 4R8HA 1SZBA 1V70A 3FX3A 4CDXB 3BB6A 2WINB 1VIWB 3OBAA 1NA1A 3M3CA 2A6VA 4IUGA 4Q0VA 5C4WC 5L9VA 5EXOA 3AKTA 3HR9A 2R6QA 4CCCA 4YZ1A 3BOPA 1HRI2 2NM1A 1UYXA 1HN0A 2HWC1 3PVOA 3UKNA 4A3XA 1O8SA 3WSOA 5FO8B 2WN2A 3OY8B 1J3RA 2RJKA 2J1SA 3D5OA 2VMIA 4PIXA 2RMU2 3VBOB 4RFRB 4TYSA 4AR2A 3IPVB 3M3IA 3VBSB 3I8TA 2W9XA 1SPPA 4UFKA 2WZR3 2VTFA 4GIQA 1RUD1 2HWE3 4UXAA 2EVXA 4Z8BA 1HRV3 2IXJA 2R041 2TBVA 4CEWB 2O14A 3ZFEB 1B09A 2B45X 1MPXA 3IWZA 1WW7A 2ZHKA 1JBCA 1FPN1 3ASIA 3VBUB 4AAXA 2XBO3 2P5BA 1POV3 1S0BA 3IAPA 3OY8A 1WUVA 2Y6LA 1O59A 1W8NA 1WWYA 1KQRA 3NQHA 2B9VA 2XL7A 3KSCA 4HT1T 5KWRA 2TEPA 3L2YA 3IPVA 3POBA 3VBSA 1VRH2 4NIAA 2ZMLA 3MV01 2ZTNA 3OGGA 4O7XA 4RS5C 4HANA 4DNYA 5TSWA 3WCRA 3V0BA 1HRI3 2OXBA 1MACA 2CTVA 3AKSA 5FXXA 4CEWA 3ZFEA 3MI8A 1A78A 3WP5A 2GALA 1EUTA 5SV8A 4NHXA 3UL2A 1DHKB 4AEDC 5A1LA 3TEYA 2PHXA 4YM3A 5EFUA 2WYFA 4BIFA 4PT6A 2YFUA 1UYPA 3JD73 1MEC3 2JENA 4HK8A 3CJIB 3HAGA 1MS8A 1ZM1A 1GZ9A 5GLWA 4MVTA 4JHTA 1LAJA 2K2SA 2UU8A 4XCBA 3NKGA 4XJ9A 2GMEA 2X8KA 5KC5A 3RZLA 3J7HA 1RGSA 2R062 1ZZ6A 1NCQB 2AYHA 3MO4A 2WO2A 4Q1PA 1JW6A 1IPJA 3VLBB 2W0XA 4PF5A 1YIFA 2D6MA 4XJUA 5DDJ1 3BIEA 5F2WA 2DUPA 3C7OA 4RR3C 2PHLA 3PJYA 1XE8A 2PQQA 3D0SA 4EJRA 3R4UA 4B8EA 1Q8VA 1W6PB 2Q4SA 1JTZX 2WA3A 1LGNA 3CJIA 5JR2A 2YC2A 1Q3EA 2CY6A 3GZAA 2VW2A 1VMFA 2W08A 5A7WB 4D69A 2RM21 5D8AC 2P3YA 1AR91 2D5FA 1E5IA 4KWLA 1WLCA 5T5OA 1NCQA 4NO4A 4ITCA 1OI6A 3AP9A 1W2TA 2ID4A 3Q8BA 3HOBA 4Q4W1 4COVA 1ND2B 4NWVA 4QU1A 3PVNA 2JDNA 3LE0A 3E5UA 2UWBA 2W1WA 1W05A 5FJHA 1PVC2 5L9RA 4A7YA 3TN93 1W6PA 1OURA 2E7TA 1AXYA 2V5YA 4PIYA 1ASJ2 4CUCA 1P8JA 1AR61 3WG4A 2W39A 2R063 2VBDA 3DPRC 3B9IA 4XDQA 4BQXA 5EP9A 5A7WA 2BV4A 1STMA 1MVQA 3BKZA 4WM8B 5GZFA 5A32A 2JG9B 4A7KA 2XWBB 3H3LA 4BOWA 4D6SA 4IE7A 2G9ZA 2OUHA 1BEV2 1PHMA 4XF3A 1ND2A 2E33A 5FUIA 4QDQA 2EIDA 5L7OA 1RUH1 2WA4A 3B7MA 5FRAA 2VNVA 5GLTA 3ZXLA 2PN5A 3WQBA 5I0TA 1Z7S3 2KD7A 3PL0A 5LBBA 4XFGA 3WF1A 4FOYA 4OI0A 1IOAA 1H2KA 1DQ1A 2VE1A 2VC9A 4YSFA 1BXHA 2D3SA 2J1UA 4WM8A 5L9BA 2JG9A 4ISQA 3OOXA 1W9YA 3C3VA 1HN1A 3N9LA 4Q4V2 4AHWA 2K0GA 4JC1A 2WS93 1PVC3 5EIYB 2QQMA 4K1ZA 1RHI3 1ASJ3 1F5JA 5FMCA 5KHIA 2A3XA 2PAMA 4PBOA 4A41A 2RR12 3IN9A 1GNHA 4X8NA 3OYWA 1QQP2 2H6CA 1ZRCA 3VKNA 5CYYA 1BEV3 3IDBB 2E6VA 1FXZA 2DWRA 4JDOA 2IC1A 2XLFA 3MICA 1BVP1 5JXGA 1AL23 1BBT3 5IYYA 3NWKA 4CEYB 3FMGA 3POJA 3SNMA 2XQXA 3B00A 3POGA 1MVEA 2LROA 3ZX7A 4LXLA 4IV1C 4A6OA 4XFAA 1VR3A 4L8QA 1ODNA 1C28A 4XHBA 2RJLA 1V6OA 1FMD2 3SEEA 1HQNA 4NPLA 5E8AA 5EV7A 3UV9A 4FTSA 5B4NA 1JYVA 1OF4A 2P3KA 2VMFA 2G9GA 2RS13 4QKNA 5EYYA 4SLIA 5FZ9A 2E53A 5LW9A 3BPSA 3J26N 4IE4A 3R6SA 1VRBA 2ZGNA 2CWMA 5A3PA 2DFCA 4RQPC 3WY6A 4FTBA 1PGL2 1COV2 4KG0A 2SBAA 2J42A 3D4KA 1GBGA 1ENQA 5CVRA 3W58A 5JZGA 4K20A 3PVBB 2YGLA 2KA3A 4N9HA 2EICA 5D21A 4MOAA 1S2BA 5C3QA 4Z07A 4E9KA 2RS52 3T2OA 4XXPA 2WZ8A 1DU3D 4YW3A 4AFBA 4AHZA 3WW2A 1GANA 1W8FA 3NV4A 3WDUA 4A42A 2VOKA 4FAHA 3KCCA 4H7LA 5FZ3A 3OUHA 5FZLA 1LODA 5JPMB 3S30A 1H2NA 4D6RA 1VBE3 1AX1A 1VB2A 1ODMA 3PURA 5C5UA 5A3NA 1HW5A 1QH6A 1H8TC 2X05A 1FMD3 1OFSA 4CDUB 1PIV3 4FAGA 1TVGA 2XLGA 1AR82 1D4M1 2A7AA 1DQ2A 3OUIA 4I30A 1O91A 2BWAA 3SH5A 2CYFA 4XFIA 3AYEA 5T5JA 2ES3A 1C1FA 3S5AA 4YZ4A 2YB7A 1ALYA 5FZMA 3V56A 1PM4A 3ZOIA 1COV3 5I8TA 4Y3OA 1VBD3 3AJZA 4HONA 1OOPC 4Q0SA 4FPLA 2Q1FA 4B1MA 3ZDSA 4AHXA 4EZHA 2BFUS 2RS53 3RYPA 2WR9A 4W6WA 4XBLA 4NJ4A 1R1ZA 1NT0A 3O7OA 4LHLA 1QY4A 2E26A 5IJRA 2X10A 4FPGA 1JZ2A 2FMDA 2P17A 2A75A 1LGCA 3ACHA 3K3NA 1ULDA 2PFWA 1JZ5A 1DGRA 3K77A 3T1MA 3FHAA 4LBQB 2PHUA 3WG3A 1FOD3 4LJHA 5JVVA 5FP9A 3LSDA 4M4RA 1QKQA 2OIIA 3ON7A 5FREA 3DXTA 4X6RB 4Y5SA 2Q8CA 2EF6A 2VD7A 5DABA 5J48A 5C4WA 1AR83 4OZXA 1CQ9A 2EIEA 4Z1VA 4QHZA 1E57A 1YFWA 2YPDA 3AMNA 2FDHA 2WAOA 2ZGLA 1RXGA 4AQSA 3OTFA 1ZZ9A 3I4IA 4GH4B 3E5QA 5M0TA 1LEMA 4FSJA 1XPWA 1RUG1 1UO9A 2Y64A 1WLTA 1ZBA1 4LBQA 4PDWC 4AVAA 1V6MA 4RS5B 1O6UA 1QMJA 3K2OA 5G04L 2X09A 2B39A 2YBPA 3JBG1 3ZXJA 4GA9A 4CDWC 3WNOA 5LRRA 3WINE 1OUXA 5CKNA 4BK5A 4YM1A 1HB2A 2YPJA 1NY72 1QJU2 1SACA 2WDBA 1AR73 4WVVA 3WG1A 5CBLA 4O61A 1VLNA 1OPOA 1RC6A 3DKWA 4UI9L 4KL1A 1V6LA 2VW0A 4YVWB 1JU3A 3CDZB 4Z2AA 4TLGA 2ZKNA 4LKFA 5BNPB 5CFCC 5JXHA 1QJFA 4RS5A 2TNFA 3SISA 4XETA 2WO1A 3RG0A 4BYYA 1ZRFA 1RUE1 3FHQA 1Q43A 3RWNA 4IQPA 4AWDA 4CXWA 2XVKA 4AE2A 1DQ0A 3ILNA 5FLJA 2C5DA 2DVAA 4LA2A 1QJY1 2YYOA 2CGNA 3CEWA 5IVYA 1CPNA 2XWJB 3MYXA 4AEDA 1R64A 5IVVA 3N3HA 4YG0A 3BUCA 1JYIA 4AZZA 4Z92B 3M70A 2DBNA 5EJ3A 3C8XA 2F4LA 4YVWA 1CZVA 4OFGA 4BHPA 5FXWA 2Q30A 3A7QA 5SV5A 1VBB2 4I0WB 5J37A 2FDKA 4IERA 1IPSA 4U36A 5D8AB 4IEPA 4MGTA 3ZFFC 1QJU3 2BDRA 2ZEYA 5DQ0A 3RPQA 3UJOA 3ZMOA 2XVLA 2P37A 2JJ6A 3DEMA 1KXGA 3S57A 3PIJA 1AZDA 3U14A 5FPXA 5JOWA 1V9U2 4RR3A 5T3NA 5F6LB 2D93A 2DYCA 2YGMA 4QX7A 2PHRA 1RUOA 5HV0A 3VD3A 4Q27A 1SLTA 5FZFA 1W2NA 4HOOA 2W94A 3DPRB 5BNNC 1JZ7A 1JZ8A 2J22A 5D8AA 2WSUA 2GMPA 3KQRA 3DL3A 5DAPA 3I2IA 1A6CA 1I9RA 1DIWA 3HBKA 3C7GA 1W6OB 5C3OA 3NNGA 4N9IA 1UXXX 1VPHA 5FZOA 5C9AC 1V6KA 1UAIA 4XF1A 5CFDC 1UOJA 2QQIA 1Y9QA 4IEUA 1SCRA 1UYYA 1J3PA 3THCA 1VBB3 1GQHA 3LPGA 1R081 4Q4X3 1RUJ1 5HPOA 3KLSA 3DPRA 5LBFA 4BM8A 3GM8A 4OMCA 1HXS2 3ELNA 4PQ9A 2A3YA 3ZN5A 2AR6A 3NVCA 5B4XA 4QPGC 1H0BA 5GJ6A 1HB1A 3ZVXA 1V9U3 3NL1A 3EO6A 3AFKA 2MEV2 1W6OA 1MQTC 2ZOEB 5A3WA 1VAVA 2JDYA 2VZVA 3AP4A 4XILA 4QPWA 2BERA 5FZ4A 5AFEA 2JB8A 3AL5A 5HCAA 1PMIA 4CCMA 3POIA 3T0DA 3NNJA 4LULA 1QGLA 1R092 5L19A 4AK3A 5KXCA 2RS33 2VBPA 2MHFA 1G86A 1X82A 3MZHA 1HB3A 2XJTA 3APBA 2A3WA 4PCRA 4ZKTB 2R30A 1D0HA 4INDA 2Y33A 2Y6FA 2VQUA 3GBGA 3LCPA 4FO9A 5LWBA 1G9DA 4CCNA 5C3RA 4OUSA 2J1VA 4IV1B 1VBC1 2ZJCA 1TME2 5F32A 5FY4A 2Y60A 1ZX5A 4QX8A 4FXKB 2HYKA 3H0OA 2QQJA 4XZUG 1PGW2 1S1AA 1R1A3 4Y5TA 4QX1A 4DUWA 1LOFC 1Y43B 2Q1MA 3UKTA 3E6BA 2XJSA 4QQ2A 4CCLA 2H6BA 1JYWA 1F15A 5FP4A 1Y7BA 3MUZ1 5H9RA 4RQPB 4A3ZA 2VMEA 1VMJA 4YZ3A 1KFUL 1URXA 1CAUB 2P2KA 2W46A 2KR2A 4IV1A 4JTOA 1R093 1UY4A 4O65A 5FPVA 2VZUA 4P9GA 4X6QB 1W9FA 4ZONA 4JCKA 2LRPA 4P9XA 3Q8CA 4WBBA 2X53S 1W90A 4IESA 4M01A 4AQTA 5JXJA 4Q5OA 1UCXA 3EB7A 1DYPA 4UFMA 5DUUA 1O3SA 3B93A 3I59A 5FZKA 4P9WA 1T6GC 3VL8A 3WD5A 2AH2A 1EAH2 1TME3 4RQPA 1ZYBA 1QJX1 1H8TB 2AEZA 3JZVA 1KD7A 2PMWB 2LS6A 2ARXA 1H1AA 2E7AA 2WWSA 4LK6A 1GU3A 5LA9A 3RYKA 3AC0A 3GNEA 3ZMNA 3HNMA 5FWJA 1BVVA 3T4HB 1PO12 2DCJA 1ZRIA 1PO22 4XDOA 1BJQA 4M3CF 4O9GA 5F5QA 2E32A 2ZABA 4KMQA 4IV3C 4Y1ZA 5BYNA 4KGQA 2W1SA 1RUI3 1LESA 5ACA1 2QQKA 1UIJA 3BCWA 3PTYA 4DXRA 5A3MA 1OH3A 4N43C 4BMBA 1H8TA 4MLOA 5FXZA 2A71A 1D4VB 1SBFA 4UFLA 3WG2A 1IS6A 5KXDA 3NNFA 2GDFA 3QCWA 1UY3A 4QPIC 4Q0PA 1GLHA 2VOTA 4UAPA 5JXIA 1EAH3 1WCDJ 4ZY9A 4WZCA 2VTXJ 3I3MA 4JAAA 5FY7A 4XIKA 3MFCA 4QQOA 5GLUA 4QB2A 1OOPA 1OKQA 1XU2A 2QFEA 3K4ZA 3MF6A 2DF7A 1CX4A 1C8M1 1GWKA 3FBYA 4DQAA 2O8OA 2XVGA 5A70A 4AVBA 1PO13 5FPUA 4FTEA 5CEHA 1ULEA 3MFAA 1UU6A 1YCIA 2O0OA 2ZGPA 3J8F1 5FOBB 2L9LA 4QD2A 1QH7A 2OVUA 4MO3M 5KBFA 5DAQA 4CP9B 2R073 1H6YA 3KV6A 4JKKA 4XQDA 4B29A 4ZHNA 1O5LA 3WR0A 1BMV1 1XBFA 1YFXA 1W39A 4TWTA 5JWPA 2ZX1A 3WXPA 4ZU5A 2JKBA 4GMP3 1V0AA 2WO7A 2N7GA 1RVF1 4K8FA 4QGNA 2RV9A 4UWDA 5GLVA 3KS7A 4E4HA 1I1EA 2ZGUA 3N7KA 2Z69A 4YPJA 2BW8A 2Y6HA 3VKLA 3WQ7A 3W9AA 4DUVA 2BBVA 3A0NA 2X5IC 1JOBA 4CP9A 4ZU7A 2CV6A 4HKOA 4CTEA 5CFCB 3KHCA 1W3VA 4BCUA 4C1XA 5H9PA 1E5SA 1H9PA 1M4WA 4JRLA 3P3NA 5FIXA 1OLRA 2QJVA 4LNVA 3AP7A 2C9AA 1AYM3 2HEVF 1RMU2 3E97A 1A34A 3HVDA 3O0VA 5DG1A 3T2TA 1WGPA 4QXCA 3T3YA 2ADDA 5J96B 5BNQA 4AI0A 4FQZA 1OVSA 2GNTA 1LCLA 1Q56A 2BNMA 1UX7A 1QXPA 4TN7A 5CFCA 1YIPA 1MZFA 3FLRA 3K4DA 1YQCA 3O1TA 2ZEWA 3WZ1A 4QX5A 4H7MA 1IKQA 4XBQA 3L2HA 5L36A 1OBNA 2ZGKA 5FCCA 1TEIA 4K6BA 3O0XA 1ULGA 4AGRA 3KCYA 2VM9A 3U37A 3SH4A 2PA7A 1WA4A 4AGVA 3GYDA 1W6NB 3DN7A 4ISRA 4OHXA 5IVJA 2DUQA 2Y6KA 4HSLA 4YGDA 1MS3A 3HT2A 2JKXA 1LKNA 2ERFA 3AYAA 4MGQA 3U07A 1PK6C 3GDBA 1NZIA 2HEWF 2ZKLA 1NKGA 4OI1A 3ZFFA 4D7TA 3OGSA 1RUF2 5F3EA 3WVJA 2AACA 1Z0HA 2ARAA 2W47A 5C9AB 1IQDC 2RMU1 5EWSA 2OZ6A 5FYHA 2ILMA 2VMGA 1Q8PA 4CU6A 2BBAA 4F3JA 3IIIA 1TMF2 1W6NA 3DV8A 1CZTA 2BPA2 1GR3A 1NLSA 4KI5M 4GB32 5BNNA 5DN2A 4PQQA 2VMDA 1CAVB 1YLLA 4HVOA 2A6XA 2OW4A 2WFPA 4QT6A 1ZZBA 2VJXA 2GSYA 4QPYA 4QPGB 5FFOC 3V0AB 5FPBA 5A3TA 3ZXDA 3QH6A 4CXYA 3IMMA 3W21A 4LHKA 1VBA1 3TNPB 5C9AA 2HWD1 1GP4A 2OS2A 4ZPIA 5CFDA 5BNOC 5LCWL 4Y4RA 1VRH1 3AZYA 4BLIA 3BODA 3LGRA 3C7FA 2WZR2 4MUVA 1ULOA 2HWE2 2VOVA 2ZAAA 4HVQA 3I97A 2WBKA 2PLV1 1TE1B 5F5IA 4QPGA 3V0AA 4YG6A 3HPNA 4YW5A 2XBO2 3O5SA 1LENA 4GWNA 1MQTA 4IE6A 3BI3A 5FY1A 4DB5A 4P9YA 1LB2A 5C8WA 2JDKA 2VG9A 3ES4A 4UFJA 3DF0A 1KJLA 4GB33 1W8UA 5LBEA 1M06G 4BQ2A 1LOCA 1OD5A 2WWUA 4G3YC 3PUIA 4BJ0A 2HWF3 2VO5A 1LJ7A 1RJ8A 1N1YA 4OQ9A 2W3JA 1DLLA 2D7FA 3TEXA 1UW8A 2VNOA
chains in the Genus database with same CATH topology
1OSGA 2ZGMA 1XE7A 3B02A 2IXLA 3VHRA 1EV11 2VXRA 2DVDA 2D43A 2ZACA 3JD72 1MEC2 2R49A 5KHJA 3O14A 4H55A 5JSOA 1G9CA 5ABJC 3V0BB 2JE7A 1UZYA 3VBHC 4RHV2 2ZZQA 1UPIA 3MIBA 1TNRA 2VECA 3VZNA 4META 1LOFA 3AYDA 2PAKA 4K7JA 3SCGA 1J3QA 2VU9A 5CU1A 5I8SA 1G6NA 3K48A 1Y3TA 3EHKA 3MLLA 4Q1RA 2GNDA 5EZWA 1GYKA 2UURA 4NHLA 1ENXA 1PNFA 3FUOA 1RUC1 4AI3A 4NR1A 3VZJA 1UIKA 4AFMA 2HJIA 2VH9A 2R16A 4MGZE 2VVDA 4EV0A 3H50A 4E27A 2XH6A 1H4GA 4DMIA 5C8CC 1GICA 3VUOA 3URFA 5F9TA 1O3QA 2ARBA 4XFBA 3RSJA 3ZXEA 2I45A 4MYEA 4AF9A 5IK5A 1NXD1 4JGYC 3TN92 2NMOA 3AM2A 2ZAHA 4N43B 4RHV3 1AF9A 4KWJA 3NW4A 2YROA 2R0FA 3MW3A 3MIDA 1C3HA 3AB0A 2CAVA 1AYN3 2VNRA 4Q4V1 4BQ1A 1SFNA 5E16A 3ROUA 4IV3A 2O8QA 5FLHA 1HQWA 4IXLA 4N43A 1Z7S2 3OD4A 4PBPA 2RR11 3ZYJB 5A32B 3GZUC 1IQAA 2VUAA 1QQP1 1YJKA 2A6ZA 2HWC2 3NAPB 4QPIA 4UBGA 1POV0 2HWB1 4LBMA 4AFAA 1CAXB 4UW4A 1WMEA 2XGXA 5L7OB 4L99A 2WS92 1W0OA 2D6LX 4XBNA 3ECQA 4C90A 3LB9A 4HKLA 1B35C 1RHI2 3A0KA 2GZWA 1IS3A 1WLWA 3BOWA 4RSUA 3VZLA 4E4DX 1QJZA 3PLQA 4MSVA 1VP6A 3AMQA 1MZ6A 5BPXA 3NAPA 1V00A 1CAXA 1AL22 1BBT2 5T5PA 1OQ1A 2X5IB 5B2GB 1PGL1 2ZX4A 3OYWB 1QOOA 1H1IA 3BALA 3M3EA 3KB5A 1LHVA 5H9SA 2VW1A 2YXSA 2HWC3 4Y20A 1DG6A 4YGBA 3ZXKA 1RUNA 5FLIA 2RS12 3HWJA 1QWRA 2E51A 2Z5WA 4QM9A 4BIOA 2X5IA 1RUD3 3CJXA 3CL1A 4AQ6A 4JTNA 2QQPA 1WW6A 2R043 1QNYA 4YM2A 5J3UA 2PHWA 2PHFA 2QCSB 4B7EA 3N4MA 1FPN3 1KITA 3BU7A 4IEVA 4AVSA 2DCZA 3NJZA 2C1FA 1IS5A 5BV6A 5DDJ2 1DQ5A 1FV2A 1MS0A 5I93A 5JZGB 4OHWA 1H2MA 1XNCA 1VBE2 3PNAA 1GSLA 1PK6B 4G4FA 4YZ5A 2FZ1A 2RM22 4FBFA 1PIV2 5CIRA 2R32A 1AR92 1JUIA 5AC91 1UPSA 1AUYA 1F8VA 3KGLA 2B7YA 4QQHA 2WNVC 2Z42A 4DFSA 4FP2A 5K9YA 3I2DA 5E1RA 5JSPA 1VBD2 2OPKA 3VDDC 3RI9A 4AXOA 4X8PA 1PK6A 1ZBE1 3HIFA 2PELA 1FNYA 2JG8C 4QGLA 5DDJ3 1DDLA 4AVCA 3N7MA 4HETA 4P5HA 1W6QA 1FOD2 3KD4A 3EBRA 3POSA 2XUMA 4FP3A 2RM23 1AR93 4W6YA 2DFBA 2QE3A 4NHMA 1IKPA 4R9AA 4N90A 4Q4W3 2JICA 2Y38A 4YFZA 4EWEA 5LK5A 5J09A 4QXKA 3QD6A 5BNOA 4W65A 3M8LA 3ZXFA 5JI9A 3GHMA 5FO7B 3TOJA 4H3WA 1AR63 1SBDA 4FPEA 4K21A 4F83A 5C4WB 2VPVA 3QLQA 4CYDA 4IEWA 2H0BA 4D7YA 4R4XA 1O4ZA 1DGLA 1SQ4A 2QKDA 4HVRA 2GC1A 4L11A 1RJ7A 3C2UA 5DUWA 2IXKA 1SLIA 4YRDA 4DY3A 4J6GA 4WM7C 1AR72 1MZ5A 3DUIA 4YLZA 1K5MC 1RUH3 4M0HA 3HN1A 2ZMNA 3NKTA 2ZGOA 3RZZA 2V09A 4MZUA 2PYTA 5ABJB 1O4TA 2ENRA 5EYXA 4LT5A 3VBHB 1OHFA 1FV3A 3KT1A 1F9KA 3M7AA 4XHXA 2ETEA 4AGGA 4I02A 1OA4A 4CP1A 1GKBA 2NLRA 2WIIB 4RD7A 1CJDA 3ZO0B 1CVNA 2CGPA 4XJZA 1A3KA 3MGUA 3W59A 4ASLA 5ABJA 5H9QA 3FFQA 2DU0A 2ZHNA 4RGGA 3AP6A 3VBHA 2YV8A 3GBWA 3HD8B 4NHKA 4AEDB 1JH5A 2O1QA 1KS5A 3RQ0A 3UKVA 2WNUC 4LO7A 2IWGB 4JGYB 3SLIA 4DS0A 3MW4A 4XIOA 4ES8A 3AK0A 3SCFA 1U5YA 4ONUA 1HXS1 4L92A 4YYOA 1SLLA 1D4M2 3H1MA 2EAKA 1C57A 2YHJA 1Q8QA 3M1HA 3MF9A 4HLTA 4CDWC 5C8CA 5HXVA 1PVXA 4RR3B 2MEV1 4XJ8A 5LRSA 4CRQA 1EPWA 1ZZCA 4O9EA 4ES9A 3FE5A 3VN4A 4JGYA 3H9AA 2PHDA 4Q4X2 4HN1A 4BPZA 1U5XA 1X7NA 3TB0A 1XNDA 2KM2A 1LOEA 4XPVA 3PMSA 4FPFA 2OZJA 2IXIA 3OBRA 1YRZA 4FPCA 1B35B 1RB8G 2A6WA 4NN0A 4KWKA 3ZSKA 4BWOA 5JPNB 1CGPA 1DGRN 3LA7A 1V6NA 3AXDA 1D4M3 1TNFA 4JDNA 2RS32 1YWKA 1UU4A 1DZQA 1JOJA 1W2UA 2YUEA 2NQYA 2QZ3A 2Q8OA 3WX5A 4NWWA 5CADA 3Q9OA 1B35A 1EY2A 1RUG2 3WUCA 5JAXA 1ZBA2 3E6DA 2WC2A 2JEMA 3JBG2 1QF3A 1PZ7A 2MNGA 4F8AA 1N47A 1R1A2 2DCKA 2AENA 4UW3A 4K9SA 4ATEA 2JECA 2XJQA 4QHBA 5CAZA 1DGWA 4DRVA 4HMZA 4S2HA 4BH9A 4E4SA 3INAA 3WQ1A 1HX6A 1CPMA 3B69A 1FX5A 1LHOA 3LWCA 3TYJA 3WOGA 3J4UH 2BQPA 2WT0A 1NLRA 3MIGA 3D8CA 1PO21 4XQ4A 2ZHLA 1LHNA 4GWMA 1FI2A 1RUG3 1ZBA3 4OVEA 4W6XA 3S0MA 3MEPA 1YFYA 1UU5A 1XNBA 1LGBA 1X8MA 3JBG3 3RMXA 4IEXA 1REFA 1ND3C 3H1WA 4Q4Y1 4E2QA 1S0DA 2OUJA 3WUDA 3I59B 1ZRRA 2D6PA 2GC2A 2P3IA 2CL2A 2AZ5A 2E7QA 1WCKA 2VGDA 1UKRA 2GN7A 1NCRC 5C6CA 5LEJA 3AYCA 3N7LA 1RUI2 4LUKA 2QZ2A 4N53C 1AJKA 2WFF1 1LRHA 1RUE3 4CDXC 3OF1A 1OA3A 3JB4C 1JYCA 3FZ3A 4YGCA 5FDBA 4F7ZA 2I2SA 1H2LA 1QJY3 3ZIXA 3IDCB 1L3JA 5IK8A 2WNVA 4YARA 5F6KA 1UMZA 3VBOC 4Q29A 3SXWA 2Q0AA 2PAEA 1TQ5A 4P14A 3WDVA 4AG4A 1R082 5DZFA 1RUJ2 3VDDA 4CEWC 3AMHA 4R9DA 3ZFEC 3JU9A 1UN1A 3FWEA 1WD4A 2JG8A 1REDA 1Q8SA 1IHMA 2WL1A 4QMAA 3VBUC 3FLPA 1OLQA 2DUOA 4WVZA 1OOPB 4OULA 3QACA 4EWAA 1ZZ7A 3RI8A 1ZNPA 2R072 1IGOA 1ZVFA 4RL7A 4LBOA 1LR5A 3ZYGA 1RMU1 2JXAA 4FT8A 4TLFA 3CO2A 4GALA 3BPZA 2DVFA 5FQ0B 1U0AA 5HI0A 1SBEA 1VALA 1LHUA 1K5MB 2WLPA 4D7SA 3AKQA 1HV1A 1R083 1VBC2 1RUJ3 3ME2A 5GZGA 2XKPA 1WBFA 3KCXA 2C0ZA 2VMHA 1Q8OA 2ZGRA 5I91A 5JOZA 2B42B 2B9UA 4L97A 3U4XA 4XE9A 5BUVA 1AYM2 2EXJA 5JCTA 1CJPA 5DXDA 4KQ7A 5FQ0A 4V1PA 4Y1YA 3ZSMA 4Y1XA 3WDXA 1K5MA 4PDWB 1XQNA 4Y1VA 1YNAA 2DVBA 2WZPP 3JB8A 4EN0A 4FPOB 2NZ9A 2XJUA 3N36A 3O12A 2VVEA 4Q0QA 2EAAA 2XJPA 3NO8A 2VNGA 3U10A 1RUF1 3OPZA 1OPMA 1LTEA 2W68A 2YZ4A 1NE6A 3ZIWA 4COWA 5A3LA 2IXHA 2WNUB 3H8UA 3M4FA 4HZFA 5FPZA 1U12A 3PHMA 5DZGA 5AVAA 1A8MA 4FPKA 4YGEA 1TMF1 4PDWA 1F5FA 1VBC3 2XPJA 2D6OX 1HLCA 3VHPA 4CP0A 1D2QA 2Y26A 1QJX2 4BA6A 3VZKA 1NOVA 2EXIA 2GNBA 2XHKA 2WT1A 2HKXA 3AMMA 3D0JA 2WNUA 3I7DA 1V6IA 1FNZA 1DQ4A 3VHOA 4JRAA 1S0FA 5DUVA 3RNSA 1BZWA 5ACA2 2WZR1 2ZGTA 1MR5A 2BWCA 5JOXA 2UY8A 1UZZA 2HWE1 4OHVA 1HRV1 2DV9A 2XJVA 3ZFFB 2BTVC 3ETQA 3VKFC 2BVBA 2XL9A 2DCYA 5C33A 4CDWA 3ZN6B 2XBO1 1POV1 3AJYA 2B8MA 2DTYA 4Y26A 1KDKA 2P34A 3AZWA 1J1TA 5BNNB 1QJX3 1OMIA 3A4UA 2AGSA 2JX9A 4LBJA 3ZSJA 5JLVA 3KZ4C 1C8M2 1UKGA 3FC0A 3ACLA 1J1LA 1HRI1 3WV6A 2H0VA 4GMP0 2TUNA 4AEKA 3V64A 4B7KA 2QDRA 2UY9A 5JR7B 5J36A 3POWA 2BYVE 3ZN6A 5CFDB 5DG2A 5KHKA 4YVSC 1V6JA 4CEYC 4KH9A 1QDOA 1CAWB 1SLAA 1MEC1 3JD71 3T1LA 5ACA3 3EXUA 3FFZA 3ZXAC 3AZXA 3P3PA 1SDWA 4LO6B 4MGKE 4Y22A 1BMV2 2HWF2 2F6BA 3IM0A 1KFXL 1MQTB 2WQ4A 4KU8A 3VV1A 5GLZA 3CNAA 3LKJA 2LM3A 3TRSB 3FBMA 5I8YA 1XYNA 1CAWA 1C4RA 3V65A 3R4DB 3ATGA 5KXBA 1C8M3 2NPIA 2ET7A 4LBQD 2DURA 3KT4A 4H14A 3MPPG 1ZRDA 4B3NA 3J8F3 5CNAA 3SMHA 3MDPA 1YI9A 1HKDA 4JGZC 3LOIA 1DYKA 3VKMA 3TN91 3EJKA 3X29B 3PVEA 4Q26A 4L2NA 1U5IA 1YUDA 1BCXA 1A8DA 1N1TA 2R061 1ND3B 2GC0A 3VKOA 4CDUC 3USUA 1RVF3 2GAUA 3R4SA 1W6MB 4I0AA 4NOTA 3KM5A 4JQRA 1FAYA 1NCRB 4YNIA 1QOTA 3L9JT 1RITA 4XZPA 3UK9A 4N53B 1Z7S1 1O7FA 1CR7A 5JDBA 1LU1A 2SLIA 2XJRA 3I54A 1ND3A 3WDWA 4UW6A 2WSVA 1QXRA 5BXXA 1LOBA 4OUMA 4UBHA 2BGCA 1W6MA 4FQ4A 1AYN2 2JE9A 1DFQA 1LULA 4KNCA 3SITA 5KHHA 2WS91 1IZ3A 1NCRA 1PVC1 1QNWA 1RHI1 1ASJ1 4XMAA 1DZRA 5FMOL 3WT3A 2IZWA 4N53A 4MGYE 5FOJB 4YM0A 3VBFC 4CDXA 1HQLA 4N7IA 1IS4A 3LAGA 3WDYA 1S55A 2FHRA 1BEV1 4LBLA 4Y5Z0 4IV3B 2AUYA 2VQ0A 2YDEA 4HFSA 4PIZA 5BY5A 1AL21 1VBA2 1BBT1 3FUQA 4C0HA 2HWD2 4XW3A 3KT7A 3VBOA 4GH4C 2IFRA 2DTWA 5HCBA 5CG8A 4P9IA 5I0SA 4K3UA 4QPIB 3LOBA 4AHYA 3ST7A 1CD3G 2PLV2 2RS11 2D97A 1AX0A 2RMU3 3VBUA 3PMEA 2ZMKA 2ZZJA 4AQ2A 3G6JB 4NPRA 2V73A 1C5HA 3R05A 1WW4A 3GZTB 3TWIA 4YVWC 1XRUA 4KGGA 3VL9A 5BNPC 3LA3A 1C8NA 4A2UA 2GH8A 5J7MA 2ZX3A 1QXJA 2BVVA 1JXNA 4ORFA 1ULCA 3ZFGC 4I2OA 2D3RA 1J58A 1Q5OA 3AXEA 1VBA3 2HWD3 2NMNA 1LU2A 3SH3A 2WQZC 1EV12 1H9WA 3IBMA 1VRH3 1ZREA 2IXCA 4RFT0 3S6PA 1I5ZA 2Q5TA 3K51A 4DY5A 1O5UA 5CG9A 3M2MA 1VBE1 1RUD2 1FMD1 4JDMA 2R042 4XF4A 3IT8A 4Y20B 1PIV1 4XTPA 1NZCA 1ULFA 2PLV3 1AXZA 1G9FA 1FPN2 1EP0A 1H8VA 2KXLA 2B46X 1AL0G 4I3PA 5D1IA 1S2KA 4LTAA 4AVVA 4DRRA 1WD3A 4B4QA 4L9BA 4D3WA 3WDTA 1FT9A 1N3QA 1WMDA 1COV1 4PJYA 4XJWA 4COZA 1VBD1 1D0GA 4XTMA 1RUC2 2EA7A 4S2FA 1H30A 2RS51 3RRDA 4WZFA 4MGIE 3MLJA 4BZ4A 4CDQC 2BNOA 1S0JA 1EV13 2FBEA 1DF0A 4Q8LA 2XKOA 4BE3A 1MS9A 4PLMA 1FOD1 4MXVA 3RS6A 4Q0UA 1PZ9A 1EYBA 4CP2A 2GN3A 3VBRC 1AR81 3WLUA 2EXHA 1XU1A 3RMYA 4DINB 4EN9B 3AMPA 3N7JA 1AHSA 3RYRA 4M3CB 1XYPA 1UX6A 2E9QA 4XQWA 3WW3A 3LA2A 1RUC3 2A6YA 2RHPA 4HN0A 1YFUA 1RINA 5FO9B 1YHFA 1WMFA 4S2GA 1I6XA 4Q4W2 4Q2FA 2VY0A 3WP6A 2HWB2 4YVSB 1AR71 5J98B 1W6QB 5E89A 2WJSA 4M3CA 3J9SA 3H7JA 1F31A 3ZSEA 3ZXGA 2IFWA 4WVMB 4TZDA 4IEOA 1AR62 5JOYA 4YW4A 2Y0OA 3MIHA 3GF6A 3ILFA 4Q4V3 5A33B 1WLDA 1UL9A 4ZU4A 1DZTA 5BNOB 3PJQA 4YVSA 3WNXA 1RUH2 4CEYA 4QU2A 4EWDA 4GXLA 4Z2WA 2CAUA 3OD0A 4DPNA 4XFFA 2RR13 4WVMA 2DCTA 1JN2P 1QQP3 1NY71 1QJU1 4KBBA 4IEYA 2HWB3 4LO5B 4FCAA 1ENSA 5A33A 3WQ0A 1X36A 1QHDA 1FYUA 4JGZB 3AKPA 1AJOA 1ZZ8A 1BQPA 4TSVA 2GMMA 4FVVA 2GH2A 1S0EA 2F4PA 5CA6A 3MIFA 4RGAA 5KC6A 4IEQA 4EROA 3ZYRA 2ZGSA 3NV1A 1HDKA 4YFWA 3IDEA 1X8EA 3FJSA 2AREA 2XLAA 3QH7A 2K9ZA 4JGZA 3DGTA 4LHNA 5E88A 5T54A 3M3QA 4D94A 1VBB1 4Q4X1 2D5HA 1ENRA 1YYNA 4CDUA 4LLFA 1GV9A 3H1YA 1VJ2A 4C1WA 5AC92 5DUXA 1MS5A 1V9U1 2P3JA 4ATFA 3ZYPA 4HK9A 4AEJA 5JSRA 2Z2SB 1N1VA 3JQWA 4E2SA 1SEFA 3VBFB 1G9AA 1CESA 3CLPA 4IETA 4MXWB 1ZBE2 5IK7A 3WP3A 2BFUL 1N3OA 2RS31 4YG3A 5T55A 5C8CB 5JIUA 1C5IA 2NP0A 4PLOA 4WVWA 1UF2C 4XFHA 3SHRA 1YJLA 1JUHA 2R1DA 3BIWE 3CF6E 1RIRA 1GZCA 4XJAA 3S7IA 2ET1A 3B5LB 4QM8A 3VBFA 5AC93 4MXWA 5GZEA 5AFBA 4C0BA 1R1A1 3NV3A 1PGSA 1PM7A 3U11A 3O0WA 4XF0A 3THPA 3ALQA 4DZGA 1GFF2 4GULA 4GH4A 1S0CA 4COUA 1DGWX 4Y1UA 5LEKA 1R091 4LEJA 1BK1A 1ZBE3 4FOWA 4AYUA 2PHTA 4HBNA 4S2DA 3ZFGB 5FAXA 5HBAA 2VVFA 4N7UA 2ZA9A 1WCSA 4Q8KA 1YI7A 3UJQA 4MH0E 4DOUA 1SLCA 4AFCA 4B4RA 3N35A 1TME1 4GQ7A 1N1SA 4OI2A 5BNPA 4QGMA 2UYBA 3TAYA 4HSJA 1PGW1 2JD4A 3SCHA 1S0GA 5AVPA 3B94A 3ZFGA 1OQDA 2FZ2A 1NXMA 4LO8A 2WNEA 1O3RA 3OGJA 4XOGA 5CB7A 1NG0A 3LSEA 4G9SB 4HL0A 3QBQA 4MX3A 4BLJA 1W0PA 1G7YA 5KXEA 1RUI1 5FBZA 1C1LA 1CONA 1LEDA 2CGOA 4EN6B 3IKWA 4CDQB 3VHNA 4XXAA 3TNQA 2RE9A 3VZOA 2W52A 2G9FA 5K0UC 1XNKA 4I0BA 1EAH1 5IT6A 2LALA 3AKRA 1XYOA 2EALA 3MIEA 4Y24A 2WKKA 3R0RA 3LZZA 2D40A 3IIAA 3VBRB 1RUE2 3IMNA 4AFDA 2UWAA 1PO11 3KGZA 5K7PA 3RJ2X 1QDCA 3G7DA 1OFNA 5T50A 4CDQA 4UW5A 1QJY2 1D2SA 2UWCA 2NN8A 4OI4A 4YW2A 3VZMA 1SCSA 1HV0A 3GALA 4YW1A 2R071 1NA1C 3AP5A 4B4PA 1MS4A 2ZGQA 4M00A 3HQXA 3BTAA 1O4YA 2ZS6B 3VBRA 4A7ZA 3NV2A 4COYA 4GMP1 4LE4A 2VQAA 2LUWA 2VUJA 2WNVB 4HPKB 4FPHA 1J59A 2B5HA 2E63A 4XF9A 4BMEA 4WV8A 3VDDB 1APNA 1SMVA 1PNGA 1HXS3 1X50A 2D98A 2ATFA 4LBKA 2JG8B 2UYAA 1AYM1 4R52A 4AW7A 2MEV3 3AX4A 4HPKA 1H4HA 2GU9A 1X33A 2XG3A 2QDNA 4RA0A 4K40A 3VBSC 4K1YA 1KS4A 4AI8A 2EXKA 1ZA4A 4MV2A 2D6NA 2PTMA 4J1WA 4I09A 3E6CC 5I0UA 1GQGA 2Z79A 2VOXA 3RJRA 4M0NA 4R9CA 5GKAC 4J1XA 4FOQA 5T52A 2WT2A 3S7EA 3NSTA 4XMIA 3D82A 2BUKA 2WLQA 5I0RA 2FMYA 1CN1A 4IEZA 1F2NA 1CAUA 3POYA 5HCFA 4ASMB 3H3UA 4AEMA 4HKWA 1FATA 3ZYIB 1BKZA 1GNZA 4WM7B 2MPFA 2DVGA 4XEZA 4JV4A 4FOVA 3MPBA 4GKXA 3CJIC 2ZX2A 1NE4A 2I74A 1G8WA 3ES1A 3U0ZA 1AXKA 4YZ2A 3ENRA 2OA2A 2I07B 4P9JA 1NCQC 4Q4Y2 1OA2A 5T5LA 3ZSLA 4SBVA 2VULA 4E2GA 1LHWA 1MS1A 4WM7A 1VAMA 4FXGB 3WW1A 5LK7B 2G4IA