1NZCA

The high resolution structures of rmlc from streptococcus suis in complex with dtdp-d-xylose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
TENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
total genus 51
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nzcA00
1CAXA 3LA2A 2BNOA 2D93A 2BNNA 5FPXA 2GZWA 1ZZ6A 3HT1A 1GQGA 1H1IA 1ZZ7A 4IEXA 5JSPA 4AQ2A 3HQXA 3RYPA 2WC2A 3TNQA 1Y3TA 3E6DA 1CAUA 2OA2A 5J7MA 3B02A 4YNIA 3SXWA 1EP0A 2H0VA 3H1MA 1SFNA 1U12A 2GC3A 3QACA 2CAUA 1ZX5A 1J59A 1Q3EA 3NL1A 1EPZA 1YWKA 3EO6A 2IXCA 4IEWA 4KL1A 5FLJA 2PHLA 4HMZA 1X8EA 2IXIA 1DGWA 3H7JA 3L2HA 4IESA 4ORFA 4AQ6A 2Z69A 3FFQA 4O9GA 3SHRA 5C8WA 3LAGA 1TQ5A 4YSFA 1LRHA 2QJVA 2GC1A 4MX3A 4QGLA 3ST7A 4FT8A 3IWZA 1UIKA 5I8YA 4HZFA 2OYZA 4F8AA 4P9GA 4N9IA 4PIYA 3FZ3A 3GBFA 3BPZA 3CEWA 1FXZA 1CAWB 4KWLA 1J58A 4Q29A 4I0AA 4HN1A 3I59B 4WZCA 4YRDA 1LKNA 3EJKA 4HBNA 3DKWA 1ZRFA 1J3RA 4LTAA 3EBRA 3E6CC 5BPXA 5LRRA 4XFAA 5KHKA 1WGPA 4TLFA 3NKTA 4X6QB 4GULA 1I6XA 3JZVA 4HSJA 5I93A 1DGRA 2XKPA 4QX5A 1L3JA 3OF1A 5I91A 2H6CA 4MUVA 4XF9A 4CYDA 4PIXA 1V70A 1FI2A 2XL9A 3KGZA 5E16A 1QWRA 1PM7A 1LR5A 4HLTA 2XLFA 3NSTA 2PHDA 2QDRA 5FDBA 4MGKE 4YYOA 3ES4A 1Q5OA 3E5XA 2MPFA 4XF1A 3H9AA 3UKTA 2IXLA 3EHKA 4QXKA 2ZKLA 2BGCA 4FBFA 2PAKA 1ZNPA 1X7NA 5J3UA 4QM9A 3WW4A 4XFCA 4EV0A 3KGLA 5I0SA 1UPIA 2XKOA 4NVPA 2K0GA 4KWKA 1ZRRA 2D5FA 4QGMA 2Z2SB 2EAAA 1CAVB 5BXXA 1RUOA 1O3TA 1NE4A 1YFXA 1OI6A 5KHHA 2VQAA 5FLHA 3KCCA 4O9EA 3RDIA 4BIFA 4QGNA 4L2NA 4L11A 4IEYA 1YFWA 4ZU7A 3TNPB 2ET1A 1WLTA 3M70A 1OD5A 3FX3A 1YHFA 5K8SA 3FHIB 2PYTA 1HW5A 1QY4A 4J1XA 3U10A 5C6CA 3BCWA 3H3ZA 2EVXA 3BB6A 4F7ZA 4MH0E 1ZZCA 5F1RA 4R52A 1XE7A 5BY5A 5I8SA 1UIJA 4EROA 2B5HA 5I8TA 1NYWA 4FAHA 1ZREA 4FAGA 3I54A 1OMIA 4IEUA 4META 4Z82A 4LUKA 3KSCA 4I2OA 3UKNA 5CADA 3S7IA 1PMIA 2IC1A 3DN7A 3FJSA 4BH9A 4Z07A 4I02A 2IXHA 4HVQA 2E9QA 1RTVA 4XFFA 3DV8A 2HJIA 3E6BA 3PNAA 1UCXA 1YUDA 5E1RA 3CF6E 3ES1A 2HKXA 2XGXA 3MDPA 2Q30A 1RUNA 2PTMA 2DCTA 4EWEA 1VJ2A 2Q4SA 3SCHA 2FMYA 4JV4A 1ZZ8A 2Y0OA 3NJZA 2ZCWA 3E97A 3USSA 5JSOA 5KBFA 3QOPA 3PLQA 4WBBA 1CAXB 5I0RA 4HN0A 1XRUA 1O4TA 5LEKA 5KHJA 2K9ZA 3GYDA 3U0ZA 4XETA 1H1MA 4K8FA 4XF3A 2ETEA 1SQ4A 1CAUB 1NXMA 5CVRA 2H6BA 1UW8A 2KXLA 2OPKA 2MHFA 3LOIA 3S0MA 2MNGA 2ET7A 3NW4A 3IBMA 3OD0A 4MGYE 4Q0VA 4HVOA 1J3PA 4Q0QA 3WW2A 1CGPA 2GC2A 2PFWA 2QVSB 3BALA 1O3SA 2UY9A 1I5ZA 4JVAA 4MGZE 3H3UA 1O5UA 4BYYA 3CLPA 3CL1A 2GAUA 3H1WA 4UBGA 3C3VA 3H8UA 3H7YA 3LZZA 5JCTA 1RL3A 4N9HA 4KU7A 5CU1A 2XLGA 4RD7A 3IIAA 1Y9QA 3IDBB 3I7DA 3MPBA 4JTNA 2XL7A 5EFUA 4E2GA 4XFBA 4UBHA 4IETA 1CX4A 5LRSA 4QMAA 5BV6A 4ZU5A 3LWCA 2UY8A 4XEZA 5JSRA 1DZRA 2PA7A 5FPZA 3ROUA 4EWDA 5T3NA 1ZZBA 4I01A 1XE8A 4YARA 3RPQA 1NE6A 3D0JA 1X82A 2OZJA 3HIFA 5JR7B 1ZRDA 2PQQA 2BEOA 3WW3A 1IPJA 3R6SA 4KWJA 4I3PA 2VECA 3D82A 4MZUA 4LA2A 4WVZA 2GU9A 4XFHA 1IPKA 2B9UA 4Q0UA 1FT9A 2GH2A 3WW1A 3CJXA 4AVAA 3G7DA 4PIZA 5FCCA 3OGJA 4AXOA 4LUMA 2XLAA 4LEJA 4KU8A 2BYVE 1X8MA 3H50A 4IEVA 4EWAA 3EQEA 5D1IA 3RZZA 3SCGA 4XF0A 2Q1ZB 3KMHA 2UYBA 1OFNA 2CGPA 2BNMA 2I45A 1VP6A 2PAMA 4Q0SA 1O3RA 2IXKA 5LEJA 5HI0A 1LB2A 5I0TA 1ZZ9A 4AVCA 2FQPA 4HSLA 4X6RB 4D7SA 1G6NA 5FLIA 1CAVA 3LA3A 3D0SA 3NVCA 2D40A 4IEQA 4H7LA 3MZHA 1J3QA 2WFPA 2F4PA 3M3IA 1NZCA 1Q43A 5I0UA 3E5QA 5FQ0A 1EYBA 4IERA 2O1QA 4Q0PA 4DINB 3FWEA 3ACLA 4J1WA 4ZU4A 2OZ6A 1DZTA 1VR3A 2O8QA 3ZDSA 1RGSA 4A2UA 4ONUA 3PVBB 5J48A 1ZRCA 3RYRA 3U11A 4IEZA 3CO2A 2CAVA 4XFGA 3RNSA 4I09A 2C0ZA 3BU7A 3HT2A 4MGIE 4D7TA 1UD1A 5JAXA 2PAEA 4BHPA 3VHRA 2D5HA 5AVPA 3UKVA 3SCFA 2P17A 1RC6A 4E2QA 2Q0AA 2QNKA 2XHKA 4LA3A 3DL3A 3FE5A 5KHIA 2N7GA 1QXRA 4MV2A 1QXJA 3OTFA 2V09A 1WA4A 1YLLA 3IDCB 4HVRA 2EA7A 4I0BA 4LLOA 4XFIA 3S7EA 3O14A 3ELNA 3LA7A 5KHGA 4E2SA 4B29A 1ZVFA 1O7FA 2QCSB 4R8HA 1CAWA 4XF4A 3I59A 1JUHA 4QM8A 5BUVA 4OFGA 2B8MA 3SMHA 4LULA 3E5UA 4JTOA 4UXAA 1YFUA 2UYAA 4OLLA 2IXJA 1O3QA 3N4MA 1EY2A 3MYXA 1YFYA 4IEOA 4PJYA 1J1LA 5EZWA 3H1YA 2GC0A 2VPVA 4AVBA 1GQHA 1SEFA 4IEPA 3RYKA 1O5LA 3ETQA 5FQ0B 2ATFA 3OCPA 2CV6A
chains in the Genus database with same CATH superfamily
3KV6A 1SLCA 1XYPA 3VUOA 1QXPA 1AYM3 3D6EA 1RJ7A 3AC0A 2RJ2A 1O6UA 1W99A 1RHI3 4Q4X2 4CU7A 4Z8BA 2D3SA 1MACA 1U5YA 3ZSLA 1ENSA 1F4HA 3VBRA 5DAPA 1G9DA 2Z79A 4Q4W2 2ZGLA 3H42B 3E6DA 3VD7A 1UNBA 4AEKA 2ZGSA 3GJBA 3H0OA 2AREA 2GDFA 2XG3A 2JG8A 3O1UA 2YBSA 4D6SA 1C8NA 3SEEA 3MIHA 4LHNA 3DF0A 5FZ6A 3USUB 3I4IA 4IV3B 4FOQA 1QJU3 1GSLA 2ZBJA 3M3QA 4BMEA 2JIJA 4BU2A 1ZX5A 4OHYA 1Q56A 2F17A 2WBKA 1H8VA 1RUF1 2CDOA 2ZMLA 1RUC3 3WNPA 4KG0A 5LA1A 1DGLA 1WCDJ 3B9IA 4Y24A 3T4HB 4XILA 1LHOA 1X8EA 1XC6A 4ORFA 4KGGA 3KV4A 5IJRA 1UY1A 3FUOA 4YW5A 3W9AA 1IS3A 3MUY1 5FZIA 4B1MA 3GDBA 1AYN2 3AMMA 1W6PB 5FXZA 4AAXA 1TQ5A 1PNFA 4YSFA 2XJTA 1LRHA 1FPN2 5FFOC 4XTMA 4MHUA 3AYDA 4QGLA 1ND3C 2DWRA 2GN3A 3ST7A 3C2UA 4RGKA 4CCCA 4CU9A 1OQ1A 1VB2A 5CKNA 4HZFA 3WP3A 1VBE2 2OYZA 4F8AA 1RUF3 2VOXA 3DKQA 1PGL2 2HWE1 1PNGA 3ZXAC 3CEWA 3VKNA 2BBAA 2YDEA 4I0AA 4HN1A 4Q29A 4LNVA 3MICA 2ARAA 3DKWA 5DN2A 3RI9A 3AMPA 1ZRFA 4LTAA 1VRH1 3VN4A 1URXA 1W8FA 5BPXA 3SKJE 1UY2A 4QAWA 1UZYA 1FATA 1QJY1 3J26N 1L7QA 4GULA 1I6XA 1CJPA 3JZVA 4QX7A 3VHNA 4QX5A 1UPSA 4XYXA 4AFCA 1W6OB 1GWLA 1L3JA 2LRPA 2VM9A 2W46A 5A7OA 3WP5A 1Y9GA 3WQ0A 3CQOA 1D2SA 2H6CA 4M0NA 5JOWA 3A0NA 2HWE3 1HRV2 1POV3 1W9FA 2ZACA 2XVLA 1V70A 3CHXA 4XXAA 4F3JA 1FI2A 1LESA 3VBRB 3KGZA 4GMP1 4XC9A 5E16A 2NQYA 1KDKA 5AFBA 1VBD3 2GNMA 3RZGA 4OUMA 4COZA 2XLFA 3J8F3 5GZFA 1YQ6A 5LZ6A 5A7WA 4FTEA 2G9GA 2PHDA 2XUMA 3B93A 2JG8B 2QDRA 1U5XA 5FP3A 3KB5A 5FDBA 4MGKE 1AR91 1QJY3 2J7MA 3ES4A 4Y20A 4YYOA 4CE8A 4IV1B 2IUWA 2MPFA 3POSA 3BI3A 2QUOA 4YWAA 1V6OA 5DAWA 1XU1A 3DUIA 4UW6A 3RMYA 1AXZA 2E7QA 2P5BA 1HXS1 2CWSA 2CDPA 2NZ9A 4ARXA 3EHKA 3H8XA 1FAYA 1BK0A 1VB4A 1W8WA 2ADDA 2YUEA 3JXSA 3BODA 4GB32 4LOSA 3WR0A 1W6NB 1BKZA 1DGWX 3MBWA 1X7NA 2G9FA 1OH4A 3O1TA 3ME2A 4MSVA 5FWEA 3ZFGC 2CNAA 5J3UA 3H8RA 4EV0A 2JDAA 1JODA 1VBA1 4GMP3 3RS6A 5SV8A 4YG6A 4YW2A 2OQ6A 2K0GA 4JHZA 5FK8A 1HJFA 1RVF2 3P6BA 4QX3A 5LY2A 4AHXA 2GP3A 1KJLA 3C8XA 1YC61 1MQTA 3DEMA 3OJBA 2VZVA 2JDKA 2WNUA 4XTPA 1EAH2 2W1SA 3NMBA 5FLHA 4EN6B 2VOTA 5BNPC 3APBA 1HXS3 3GF6A 2F4LA 1UZ0A 4YFZA 4H3WA 4UYBA 3JBG3 4ZU7A 2VXRA 4XPVA 3POEA 5IYYA 2E7TA 3AZWA 4AFAA 5LA0A 1HX6A 5DAVA 2P2KA 1RUI1 2AUYA 2LTNA 1YQ5A 1R1A2 5FZ4A 1PGW2 1YHFA 5FWJA 1VBA3 1NOVA 3FHIB 1HW5A 1QY4A 4J1XA 3VD3A 1A34A 1ALYA 2WS93 4PDWC 1QOTA 4XQ4A 2R0HA 3H3ZA 2PHWA 2VW0A 2RR13 4G4FA 3NAPA 3CIHA 5FPAA 3ZSJA 5SV5A 4OI2A 3M3OA 4XCBA 2VW1A 3JU9A 4E9KA 1OA4A 4EROA 3MIFA 2CU5A 3WF2A 2B5HA 1WBFA 2YV8A 5EYYA 4OZXA 3ZIXA 4YM1A 1NYWA 1BCXA 3K4ZA 3I54A 4IEUA 1DYKA 1LODA 4K40A 5FY5A 1PX4A 3M3EA 2RJKA 4MXWA 2VE1A 5FBJA 2CGOA 2VNVA 1LOEA 1ULPA 2BJSA 2HBTA 3CZUA 4XAAA 5A7WB 2DCJA 4Y1ZA 3SQOA 3ZMNA 4Y4YA 3I2IA 3MV01 3FJSA 3T3YA 4CDWC 1ASJ3 4BH9A 2EXKA 1UWWA 4FQ4A 4FO9A 2MEV1 5EYXA 4HKLA 4L8QA 5F7UA 1S0EA 4FPEA 3NJVA 4JDOA 3JB8A 1NAEA 4I02A 5LB6A 3WDVA 3WNLA 1J1TA 4XMAA 3ZN4A 1MEC1 2WSUA 4AI8A 5E8AA 4RGAA 4ITCA 1OKQA 5J98B 2ZX4A 5F2SA 1PHMA 3TYJA 1Y43B 1NCQC 2D6LX 1QQP2 4EE2A 5K0UC 4DOUA 3B7MA 3ES1A 5ANQA 3INAA 5A32A 1LOCA 1WA6X 2HWB1 2HLEA 3ITQA 1MQTB 4XVHA 4YPJA 2GH8A 4Y1VA 5FOJB 1KFUL 4M0HA 1HB2A 4UOJA 1YXWA 2WNUB 2FMYA 5LBFA 1ZZ8A 5CZKA 2Q8EA 4CEWB 1PIV3 4R9DA 3WQ7A 4DB5A 2RM22 1MZEA 2B46X 4Y1YA 3W5NA 4P5HA 3USSA 4RYDA 4W65A 4RL7A 3VDDB 2OX0A 1MEC3 2HH9A 1CAXB 2X5IC 4D3WA 4HN0A 4ARYA 1O4TA 2AYHA 3IT8A 4XZPA 2K9ZA 2C26A 2VBDA 4DRRA 3GYDA 3JD72 4QWNA 2SLIA 4AFBA 4CPBA 2YC0A 5EJ1B 5IHRA 1ODMA 3AX4A 5M0TA 1A8MA 1JZ6A 1WW4A 1GFF2 1K5MA 4W8JA 1CZVA 1JTZX 2HWB3 5A3LA 3VBHA 2H6BA 3VBOB 5HV0A 3FC0A 3LE0A 5JVVA 5C3QA 4ZXEA 3S0MA 2VW2A 3C7HA 1NA1C 1T2XA 4OCTA 4Q2FA 3MV11 2VL4A 3OSDA 4K6BA 4YW3A 1J3PA 4Q0QA 3VL8A 3ZPYA 4CUGA 2GNTA 1UU5A 1UQXA 3BPSA 4UW5A 3OUJA 4D7YA 4DY5A 2HEWF 1LGNA 4KH9A 4MXWB 4R4ZA 1HRI3 1JXNA 4N7UA 4SLIA 4PLOA 5ABJB 4UBGA 1H6XA 4EN7B 1W05A 3RJRA 3V0AA 1RL3A 1YO8A 4N9HA 3SLIA 2WYFA 4KU7A 3HQUA 2FDGA 1KITA 2XLGA 3FHQA 4ASMB 3RWKX 3IIAA 3B69A 3K75B 2J1RA 5C70A 3I7DA 2VD7A 3T0BA 3J9SA 4AVVA 3KQ4B 2WFF1 1IS6A 3PU8A 4GIQA 4E2GA 3S5AA 4XFBA 2D6MA 3DYMA 1CX4A 5LRSA 5BV6A 5CA6A 2X29A 1MS5A 5CFCA 3LWCA 4H2AA 2FDIA 1JU4A 1M06G 1JH5A 1DZRA 1R081 5FOBB 2YGMA 4H7MA 4IUGA 1V6IA 3ROUA 3NV4A 5T3NA 5C9AA 4ZHNA 4FTSA 3TBDA 1LHVA 3CNAA 4JAAA 3NV2A 4NRQA 3UJOA 1XE8A 5I0DA 2NP0A 3AKPA 4FPFA 1C5HA 2X05A 3DPRA 4GZ9A 4YM0A 1WD3A 1XOYA 1X82A 1NY71 4RFRB 3W59A 2OZJA 3O7OA 4Q4Y2 3SEPA 3NKGA 2Y33A 2PQQA 4JKLA 5F6LB 3WW3A 1W0PA 2JDNA 4KWJA 5FO7B 4GMP0 4MZUA 1DLCA 2KD7A 4QU1A 2B9VA 5IVFA 3GHMA 2HWC1 4RN5A 3D5OA 2OW4A 3GZAA 2QFEA 3N9QA 2GMPA 2R072 1O59A 4NHLA 3IN9A 3VD4A 1OHFA 1W6QA 3ZFFC 1ZA7A 2AZ5A 3N9LA 4XBNA 2HWD2 2GH2A 5A6XA 4AVAA 1TVGA 2VNRA 5DZFA 4PIZA 2X53S 2V73A 2RS13 3OGJA 3AMNA 5A3OA 2DVFA 2XLAA 3LEIA 4IE4A 4KU8A 1S0IA 3VLBB 4CU6A 3H50A 3ZYPA 2A6XA 4E8DA 4AI2A 2D98A 3N7MA 3AL5A 1YEWA 2ENRA 5F39A 1S2KA 1OFNA 3BVCA 3GZUC 4BCUA 1H4HA 5IVEA 5C33A 4QX0A 5C7GA 4SBVA 3ILFA 3SKVA 3MPPG 5D8AC 1S2BA 3V0AB 1HQNA 1BEV2 4UAPA 2VY0A 4A4AA 1TME3 1WBLA 4LK6A 3WNKA 5FO9B 1CAVA 5A6QA 1DU3D 3ZFEC 1WLCA 1D0GA 4NHXA 4H7LA 4YVWC 4QDRA 1J3QA 3ZPOA 4FOYA 4OUSA 2F4PA 2A7AA 4LORA 3N9MA 1Q43A 5FYHA 4BQXA 1ND3B 1DLLA 2BP6A 4W4ZA 1LOAA 4MO3M 3T2TA 1LOFA 4PF5A 2WUHA 5AVAA 1NXD1 1FOD1 3B01A 3SITA 4CPBD 1W6MA 2BWCA 2J1AA 4LIUA 2WQ4A 2R061 5E88A 5FJHA 2QZ2A 2VNOA 3THDA 4EN9B 1RGSA 2A3WA 3PVOA 3T1MA 4FVVA 4LBQA 2W87A 1COV2 2WKKA 3U11A 3WDYA 4ASKA 3CO2A 2ZZJA 1AR61 1WD4A 2BGOA 2CAVA 4QT6A 5J37A 2D44A 1ACCA 3N36A 4XFGA 2W91A 4W6XA 5T54A 3HT2A 4MGIE 5T5JA 2C5DA 1HJGA 4LO5B 1IOAA 4RHV2 5H9PA 1BXHA 2PAEA 2XBO2 3WG1A 3VHRA 3RZHA 1JYIA 4Y22B 1US2A 3UKVA 4INDA 4TWTA 3BTYA 3HBKA 2P17A 1UMIA 4E2QA 3ZSMA 3TEZA 1MVEA 1FOD3 1W6QB 4NWWA 4LA3A 2VGDA 3DCQA 2ERFA 1QXRA 5HV4A 2IFRA 2R063 4KGQA 4CCOA 3UV9A 2OXBA 4IE7A 1O8PA 2QE3A 4GKXA 2TEPA 3OPTA 5CKMA 3LDRA 1WA4A 1WMDA 4EN0A 5ACA2 1YLLA 1LHNA 1AR63 3OYWA 2EA7A 2D6OX 4K9SA 2DVAA 1Y7BA 2VH9A 3A0KA 4AQSA 2VUCA 1W8OA 3WUCA 4GH4C 1E5RA 4K20A 3LA7A 3LIHA 1B09A 3VBSA 4FXKB 5FZOA 4EZHA 1G86A 1IHMA 3WF3A 1F9KA 4E2SA 5GZGA 3LQCA 1LAJA 1AZDA 2YBPA 3KT7A 4R8HA 2R30A 2RS32 3AJYA 1CAWA 1QIQA 4XF4A 3PDQA 3PIJA 1EV12 4LBLA 2A6WA 4QM8A 5DQ0A 2B8MA 3SMHA 5GJ6A 1RUH3 1XQNA 1GU3A 1V0AA 4BISA 5JLVA 2ZHKA 5K0UA 3ZFGB 5FRAA 1H2NA 5EJZB 3RSJA 4YZ5A 4FOWA 2IXJA 4AOCA 3N4MA 3MYXA 2Y6LA 3OEBA 2QQVA 4IEOA 1YQ8A 1Q8OA 2R16A 2YBKA 1O4YA 1SEFA 4IEPA 4CCKA 4XXPA 2DTWA 1CZSA 1ZBE3 5JOZA 1IZ3A 1PO21 1RUD1 2NMOA 4LE4A 1ND2C 1QOSA 3UNPA 1W6MB 5BNPB 5FXWA 2WNEA 4IEXA 4DEQA 2PHRA 2X5IA 3SNMA 3K3OA 3ABZA 3POIA 2IVJA 2WC2A 3T2QA 3OY8A 1QH6A 3KCXA 1RIRA 1LHUA 1G9CA 4MOAA 3WT3A 4AYUA 3RMXA 5IAXA 4LLFA 1OF4A 4YNIA 4Y5Z0 4K3UA 3AYCA 2YY1A 5F2WA 4PDWB 1AYM2 3H1MA 1LHWA 2WNOA 1TNRA 1PVC1 2GC3A 3ZXKA 2CAUA 4WM8C 4BZ4A 4FPJA 4LMFA 1JOJA 2ZABA 1PO23 2QQKA 3ORJA 2XB6C 3PU3A 1MS3A 3L2HA 3H7JA 3KS7A 4YGBA 4AQ6A 2DVDA 2Z69A 4B7KA 1QJFA 1SDDB 1PO11 3THCA 2VG9A 3TOJA 4O9GA 3ZN6B 2HEYF 4DNYA 1POQA 2ZZQA 1QJU2 5KXBA 2DUPA 1RUG3 2QJVA 1KD7A 1RUC2 5FYBA 1H30A 2GC1A 4MX3A 2D3RA 3I2GA 5FTTC 5L7OA 1NUKA 2P37A 5F3EA 3MEPA 4FP3A 5CEHA 1OD3A 1UIKA 3HBZA 3WX5A 2BOJA 3ZXJA 1BBT1 3EMRA 4CDWB 5L9RA 5FZOB 3KQRA 2JENA 4PI0A 4N9IA 4PIYA 3FZ3A 3W5MA 4M4RA 3BPZA 1PX3A 4YRDA 1CAWB 4WZCA 5KXDA 1LKNA 3EJKA 4HBNA 3ZKYA 1N1YA 2VVDA 5DG1A 3NAPC 1R093 1NCQB 2DFCA 2DF7A 4DPNA 5K0UB 3E6CC 1WZXA 4X8PA 3ZMOA 1J83A 3AP9A 4OQ9A 1FV2A 2RS51 2SBAA 4XFAA 3UL2A 2DBIA 3WZ1A 1WGPA 2VMIA 1NX9A 2W9XA 4TLFA 3I3MA 1RUF2 2EF6A 4QXCA 4HPKB 4YFWA 1OLQA 1ENXA 1AHSA 3JUUA 2WT2A 3K51A 4D94A 3OF1A 5A7PA 5I91A 4KBBA 1BBT3 4XJ9A 4LOTA 4OI1A 4BPZA 5LWBA 3WLUA 4TXWA 1H2LA 4Y1XA 2ZX3A 2A1XA 4MUVA 4WV8A 1ULEA 1VMFA 2W92A 3GALA 3ZKUA 4CYDA 3FMGA 4PIXA 3WDWA 1RUE1 3MO4A 1XYNA 2XL9A 1SLIA 3JQWA 5IK8A 2X5IB 4K1ZA 1XNKA 2BVBA 4Y1UA 4BWOA 4P9JA 3OY8B 1VIWB 2WJSA 3OUHA 5TSWA 4ZS3A 2X8KA 1UXZA 4R9AA 3RG0A 4ZPIA 2XPJA 2Y6HA 2YU1A 2R7EB 5ANNA 5FP7A 3ZXFA 4BOWA 3ZOIA 4F83A 3TN91 2BFUL 4LHKA 5FZGA 3ZFFA 1Q5OA 1Z78A 2VQ0A 3MHZA 2HWE2 3A22A 4CDQC 4C1WA 5HXVA 3UKTA 1GNHA 4Q8LA 4QKNA 5FR3A 4CXXA 2O8OA 1QOOA 3WSOA 4QXKA 2ZKLA 1VRH2 4JQRA 2DURA 1NA1B 5T5LA 3IPVB 2PAKA 1V6MA 4GWMA 1RHI1 5A3TA 1RUE3 2J1UA 2WT0A 4DXZA 4QM9A 1AF9A 3RZLA 4XFCA 3KGLA 1QJY2 3BGAA 4K21A 5FV3A 4K7JA 2LUWA 4QGMA 4QPWA 1OVSA 1W3XA 3PVEA 1OQDA 1SLLA 3BTAA 5FY9A 4X8NA 5BXXA 1OPMA 3LPGA 3OB8A 4NAMA 2W47A 5JZGA 2YC2A 1CN1A 3QH7A 3TN93 4OHXA 1G9AA 5EP9A 3WNOA 3LSEA 2AEYA 4BIFA 3HEIA 2ZX2A 5FZFA 3ZFEA 1O8SA 4AEJA 5FIXA 1DP0A 2YPJA 1K5MC 4YVWA 3GZEA 1K3IA 1XSQA 5B2GB 2UWCA 3VBHC 3AFGA 5JUVA 4CXYA 1AR92 1KGYA 2FCUA 1IKQA 3DYPA 5DUWA 4AHZA 1DG6A 5K8SA 3MW4A 3CJIC 3BCWA 5CAZA 3PTRB 5FYYA 3BB6A 3G6JB 1HXS2 2Q8CA 4MH0E 3VB9A 1ZZCA 5F1RA 2GSYA 4R52A 1BLZA 1GZTA 1JYNA 5I8SA 2BU9A 1W0OA 2VAUA 5L9BA 1P8JA 4EQVA 1ZA4A 1ZYBA 2WO3A 3MLJA 3O1RA 1UIJA 1UO9A 2L9LA 1BJQA 2BDRA 4JGZA 4LBMA 4FQZA 1GR3A 4NJ4A 5FZ9A 4BIOA 1VBA2 5FKBA 5IUQA 4META 3N9PA 5FY1A 1S0BA 4Z82A 1GICA 3IMNA 4LUKA 4XW3A 3ZSKA 1KS5A 1WKYA 1R1ZA 4YZ2A 2A6VA 4AAPA 4A7ZA 4COWA 5CADA 1ONAA 1GANA 1UMZA 2WQZC 4NWVA 2K46A 3LDBA 4GXLA 5FJKA 2JECA 1WLDA 1T6GC 1SDWA 1XNTA 2D3PA 3T2PA 2OPWA 2WZR3 2XJVA 4QXHA 3ZFFB 2ARBA 5CFCC 4YG3A 2YXSA 4GAZA 2E9QA 2VUAA 2ZEYA 1XNDA 4XFFA 2ZGTA 3FBMA 1AJKA 2BWAA 2Z4FA 1RUI2 2VMGA 2HJIA 4IGOA 4CA9A 5C9AC 3W58A 3E6BA 1AL23 2XJSA 1POV1 3MIGA 2NMNA 1V9U3 3WP6A 4BK4A 1OUXA 1HB4A 4GH4A 1YUDA 4L9BA 1GP6A 3CF6E 2XGXA 2V4AA 5DAQA 1MZFA 3DPRC 1H1AA 1UKRA 2NPIA 1VBD1 2ZHMA 1NCRC 4ET7A 3O12A 4CDUA 3WF1A 3J8F1 4P9LA 4FPCA 4UFMA 4M3CA 3GBWA 2DCTA 3W21A 1OBNA 5D8AB 1VJ2A 2Q4SA 5A6ZA 3LOBA 1HN1A 3BTZA 3ACIA 5GZCA 3K46A 5LATA 1MS9A 3E97A 4J6GA 1OT5A 3BN6A 3ZFEB 3ENRA 4FFFA 2QQJA 2E7AA 4GJYA 4A7YA 4DXSA 5I0RA 3C7GA 4YVWB 1XRUA 5IFPA 5L36A 4CDXC 4PHZA 4UFHA 5KHJA 4FPLA 1O4ZA 1SLAA 1JS9A 4HKWA 4I0WB 5KC6A 1WUVA 2DYCA 5F5AA 1D7PM 5FZLA 4LKFA 4DRVA 4E4ZA 2ETEA 2MEV2 1ND2A 1SQ4A 5JR2A 3O0WA 1GP4A 1UX6A 2QQLA 4XZUG 4MLOA 3GZTB 2ZGKA 3R4UA 2MHFA 1EPWA 1MEC2 1YJKA 2WT1A 2NN8A 2XDVA 3VKFC 5J1XA 4GWIA 3FBYA 2C4XA 2D6NA 4Y5SA 3CU7A 2BGPA 3OD0A 3FHAA 4MGYE 4HVOA 5LY1A 1VBB3 3HN1A 1RXGA 3KVBA 3C7OA 1JYWA 1CGPA 2PFWA 1O3SA 2VMHA 1Z7S1 2AEZA 4LITA 3JBG1 3UT0A 5T5OA 4KNCA 3LGRA 2HWB2 2ZGQA 4MGZE 2W1WA 1AR81 1JOPA 2P3JA 1FMD1 4WM8A 2E63A 1OLME 1W2UA 3H8UA 4EZ4A 3LZZA 5JCTA 2R043 2WS91 1PVXA 3VZKA 5CU1A 4FP2A 4RD7A 1N47A 2DDUA 2RR11 4JGYA 5CG8A 3GNEA 5T5PA 3IDBB 2ZMNA 5FZBA 1LOFC 2WAAA 4V2WA 3KZ4C 5F5CA 1RUJ1 1I9RA 3DXTA 5DABA 2VZSA 1VLNA 4LO8A 4I3GA 4D6RA 4CTEA 1ULDA 1Z7S3 1KJRA 4QDQA 2AC1A 4GH4B 3ZVXA 5FZHA 5FMOL 4B3NA 2J1SA 3KF5A 4JRLA 1UYZA 4XAEA 5FPZA 1AR83 3K2OA 5F5QA 5FZ7A 4EWDA 4LE3A 4A3XA 1FMD3 4XJZA 3H3LA 3MLKA 4I01A 4M3CB 1VRBA 2ZHNA 2JKBA 4NPLA 4A6SA 2IFWA 4BB3A 1DBNA 5IVJA 1ASJ1 1DQ0A 1IKPA 2CL2A 3R05A 1E5IA 5IVVA 3HIFA 4NIGA 1ZRDA 4RS5C 3AK0A 1WW5A 3SXWA 3NV3A 4L0PA 5JIUA 3T0DA 3NNJA 5T52A 1RUJ3 2JG9C 2YC4A 2A6YA 3PL0A 4B8EA 1AJOA 4LA2A 4WVZA 4OHZA 4BQ4A 2GU9A 1LU1A 5A7SA 4CP1A 3LEMA 5CG9A 1X33A 5FZ3A 5FP8A 1BK1A 1QF3A 2UWBA 1ND2B 1IG0A 4IL7A 3WW1A 1HKDA 4NPRA 3IKWA 1G8WA 2W3JA 2WFF2 5LA2A 4OHWA 4AXOA 4JKMA 3O1OA 2VMFA 5D21A 1UN1A 2BYVE 4Y20B 5ERLA 5HCFA 3AJZA 3ETPA 1JOBA 1GUIA 2DU1A 4OUEA 3HWJA 2YZ4A 3VBSC 4P00B 4EWAA 1PIV1 3RZZA 1LGBA 2VUDA 1WCKA 2VBPA 2A5ZA 4PF1A 2X09A 1R082 3M4FA 4TZDA 3AVRA 3OBAA 5FREA 2VZ1A 1JYTA 1C4RA 4XIKA 1OA3A 2J22A 4QKBA 3BIEA 1DFQA 1TMF1 2BNMA 2I45A 3URFA 2PAMA 2G1MA 4Q0SA 2RDSA 2IXKA 5FZMA 4CDQA 1LB2A 1UOGA 2J1VA 3CBNA 3AKTA 5I0TA 4E4DX 3VDAA 4FSJA 4J25A 2CGNA 4AVCA 4HSLA 5JMOA 3RRDA 4X6RB 1NY72 4Q1PA 4CP0A 4A45A 5JXHA 5H9SA 4QHBA 1HB3A 1HB1A 1BVVA 5FMBA 1WCSA 1U0AA 1XBFA 3D0SA 3Q8AA 4FXGB 4WVVA 4GWNA 3POYA 1M4WA 4IEQA 5KWRA 2HYKA 3WDXA 1CX1A 4CCMA 4ATEA 2HWC2 2OKXA 5HCAA 2VMEA 2V72A 4BM8A 1KDMA 3KWVA 1HV1A 1S2EA 5C8CC 3VDBA 1UU6A 1UOFA 4YW4A 1TE1B 2WZPP 4ZU4A 3ACLA 3RZJA 3C7FA 2ZEWA 5LA9A 2VZPA 1TMF3 1HRI1 2ZOEB 4N90A 5FAXA 2HWF1 4A6OA 1E57A 1U5IA 5FYIA 2O8QA 1HRV3 3IDEA 3ILRA 3ZDSA 5C3RA 3OOXA 2E31A 2IZWA 4N7IA 3I8TA 3RYRA 1REDA 3IAQA 2QQOA 4FCAA 4YZ3A 1S0GA 3NAPB 2B45X 1DQ2A 1US3A 4I09A 1B35C 2FZ2A 3BU7A 4AGGA 1W3VA 3I49A 2I2SA 3CJIA 3ZYFA 5JIAA 1C28A 1SBFA 1W04A 2ES3A 3U1XA 3VBFA 2YFUA 1YQCA 5AVPA 3KT1A 5E89A 2ZTNA 2Y38A 1RC6A 2R1DA 1PZ9A 1IG3A 2QNKA 4N8MA 1SCRA 3WQ1A 3ZYHA 1YI9A 2CY6A 2JKXA 4HK8A 2HWF3 2N7GA 3BKZA 4GB33 1DIWA 5FY0A 5L7OC 2P4EA 4NAOA 3I2KA 3OTFA 4S2DA 4B4QA 3GHNA 3LB9A 1F4AA 1W8HA 2ZMKA 2ZGPA 2ZGNA 4HVRA 1REFA 4TN7A 5G04L 1VBC1 4E4SA 5A70A 4NIIA 1POV0 3MF9A 2BV4A 3NRUA 4MHRA 3MFAA 1TNFA 5KC5A 1FOD2 4XHXA 1RMU1 3PURA 2VOKA 2R062 3UETA 1SG3A 5FZ0A 1ST8A 1ZVFA 4B29A 1V6KA 4CDQB 2QCSB 3A7QA 4NOTA 2A70A 2JXAA 4MVTA 4Q1RA 3LSDA 3CMGA 4XUTA 3I59A 5A32B 5JPMB 2ZA9A 5A7NA 5BUVA 3I2DA 4OFGA 1AR62 2H0BA 3BOWA 3KD4A 1H9WA 4JHTA 4JTOA 2VZRA 3NNFA 4CEYC 2RS11 5FO8B 1W9TA 2C6SA 4URTA 2VNGA 1UYPA 2C24A 2QDNA 2UYAA 2WL1A 4OLLA 4AFMA 1EY2A 1NCRA 4NN0A 1YFYA 4URAA 2Q1FA 5EZWA 4N53C 1RYYA 1VBC3 1W8ZA 3TWIA 4AVBA 3ETQA 1ZBA1 1FX5A 2ATFA 1R64A 3KT4A 2JDHA 4M4PA 1RMU3 4BQ1A 3LA2A 3WHTA 3IIIA 1GKBA 3ZYBA 5FPXA 1ZZ6A 1W0NA 1OSGA 3Q8FA 1A3KA 1VE0A 1H1IA 1ZZ7A 4AFDA 5JSPA 3HVDA 1OH3A 3HJRA 1PK6A 3HQXA 1K5MB 4IQPA 4JQTA 4KWUA 3RGBA 1GOGA 3MIBA 3RYPA 4YVSC 4CDXA 5F32A 4ZS2A 1AXYA 1TME1 3VBHB 2VCAA 1CAUA 1HIXA 2XQRA 2YROA 3QLQA 1WMXA 2VBBA 3B02A 4JC1A 4P9IA 4HANA 3WINE 5A6YA 1EUUA 4XJWA 3MW2A 3CJIB 3GBGA 5FZ8A 1AX0A 1SFNA 1U12A 2ILMA 4HK9A 5DZEA 3QACA 2P3YA 5IVCA 2WR9A 1UKGA 4XBQA 1Q3EA 3NL1A 3MFCA 4LBQD 1ZBA3 3KCYA 1EPZA 1YWKA 3EO6A 2IXCA 4IEWA 4KL1A 1D4M1 5CFDA 3K48A 4DIQA 3VBUC 1S1AA 2ZJCA 1F35A 3H8OA 5A80A 4IESA 5K9YA 1C8M1 1CZTA 1ODNA 1SZBA 3TRSB 3FFQA 5AC91 1GMMA 5JZGC 3SHRA 1ULOA 3BYWA 2JDPA 1MR5A 2XOMA 4Q4V1 4UFLA 3ZYGA 4AG4A 1D4VB 3HAGA 5C8WA 5ISLA 4UF0A 4WVWA 5DPNA 4P9WA 1GZWA 1REEA 4BQ3A 1AUYA 1OXCA 5APAA 1LU2A 1W8NA 1PO22 3ECQA 1QMJA 3IWZA 3OPWA 1RUD2 5J36A 2QZ3A 5J96B 3X29B 5BNNC 4CZSA 5KXEA 4COYA 5BNOC 5CFCB 1D4M3 2A6ZA 2RDRA 2B39A 1F31A 3CKHA 1J58A 3I59B 3T1LA 2VVFA 3C7EA 2C9KA 3J7LA 4O7XA 4B4PA 2C1FA 1J3RA 5F5IA 5C9AB 3A21A 1C8M3 3WY6A 1NT0A 1HDKA 3EBRA 3V56A 5AC93 4YGDA 2QQMA 5LRRA 2W52A 1PVC2 1QHDA 3DPRB 1GBGA 4OYUA 4Q4V3 3AXDA 2PHTA 5CBLA 4PBOA 4JGZC 3NJXA 5IWFA 1DGRA 3WG2A 3T4VA 1MS4A 1JZ7A 2WWUA 5FUNA 4BQYA 3N7LA 1YNAA 3VKMA 1PO12 5FZCA 1F2NA 4DZGA 4W6YA 4RS5A 3T2OA 4NPMA 5EQUA 1LEMA 3V64A 2JG9A 2BUKA 3UYJA 3T0AA 2ZGMA 2RG4A 4Y33A 1PM7A 4GWJA 4CDXB 1LR5A 5FPVA 4HLTA 2WSVA 1RUH1 2PMWB 2DVGA 3VD9A 3NSTA 1HLCA 2VCCA 3DECA 2VTXJ 4YM2A 4P5YA 1OA2A 1BBT2 2GMMA 2YPDA 3LIGA 4G3YC 4QB6A 3K4DA 4EYUA 4LIVA 2P3KA 5F3CA 3E5XA 1XPWA 1Q8SA 4AI3A 2DCKA 3RJ2X 3H9AA 1F8VA 2BVVA 4A41A 2IXLA 5FPBA 5A3PA 4O65A 1ZBE1 3PJYA 5FK7A 3IM0A 4KBZA 4ATFA 4CDUC 2JE9A 3ACFA 1NG0A 1ZNPA 4GJZA 4CCNA 5JOXA 5FKCA 2KM2A 2RS52 5I0SA 2DBNA 2JEMA 1PMJX 1UPIA 3I2JA 5JXJA 4YM3A 2XMLA 4Z2WA 1ZRRA 5B4XA 5IK7A 2FBEA 4UF0B 2EAAA 4NRMA 1CAVB 1GZWB 4IGQA 2YB7A 1Q8VA 3AVSA 5FYCA 1AR71 3KHCA 1PGSA 1YFXA 2D97A 2XXZA 5KHHA 2VZQA 3KCCA 2A3YA 1RUE2 3RDIA 4QGNA 3PUQA 1HQWA 1JI6A 2ZGUA 1H9PA 3JCIA 3JQXA 1W90A 4AL9A 5FY7A 1V00A 2Y6JA 4IEYA 3TNPB 2ET1A 4XDOA 1QJX1 4FTBA 5FMDA 1GZ9A 3AMHA 4BXFA 1OD5A 4M00A 2ZXQA 5IW0A 5C8CA 4QPYA 3TN92 1S0CA 3JB4C 2OT7A 4LBQB 3FFZA 3U78A 1DQ6A 2A3XA 3WF4A 5C6CA 1IPSA 2Q5TA 1LULA 2CHHA 3LFMA 4ZONA 1RUG1 3LDKA 4AEDC 4F7ZA 2WNVC 4TTGA 3EYPA 4GD4A 3RQ0A 1AR73 3HNMA 2ARCA 1A78A 1XE7A 2AACA 2LALA 4XE9A 5BY5A 5J7MA 1CQ9A 4CP2A 2Z42A 4WM7C 1RHI2 1GNZA 2WWJA 4BQWA 4PT6A 1K5JA 3RVHA 4RS5B 4CP9A 1LTEA 1S0FA 2DV9A 1B35A 5I8TA 2ARXA 2WA4A 5C5UA 2JG9B 2BERA 1QJX3 4ES9A 2D43A 3R4SA 4QQOA 1NQJA 1WW6A 1GQPA 3M7AA 5DDJ1 4JGYC 1L7LA 5GLTA 5L19A 5FBZA 1R091 2GALA 4I2OA 5F9TA 3O0VA 5JDBA 1PMIA 2IC1A 1SPPA 3ZYJB 4Z2AA 1V6JA 5H9QA 4E8CA 4BE3A 3ACHA 2W2IA 2TBVA 3OYWB 4Z07A 1BEV3 3RWNA 2PN5A 2WYSA 3OG2A 4BJ0A 2IXHA 3CDZB 1QDCA 3VHPA 4HVQA 1ENQA 1OOPC 1QU0A 1UAIA 5LW9A 2O0OA 3VBSB 1LCLA 2PXJA 1U5ZA 4AEMA 2WINB 4QXBA 1TG7A 2UU8A 1W2OA 5E1RA 3IZOA 4ES8A 4OI4A 3U37A 1JMUB 2BW8A 4YZ4A 3WNNA 4LJHA 4QB1A 2OS2A 5DDJ3 1RUNA 3HPNA 3U07A 5C3OA 2EXHA 2PTMA 4O61A 4EWEA 3F2ZA 3EB7A 5A33A 5K7PA 3SCHA 1AL0G 1LNSA 2Y0OA 2ZPXA 1KFXL 2ZCWA 4CEYA 3VZOA 2PELA 4LPLA 5JSOA 5JXGA 3QOPA 1QKQA 1SHWB 3PLQA 2P1BA 3HD8B 3PUHA 4WBBA 1JZ3A 1XXNA 4QQPA 4TLGA 4N53A 4AW7A 5LEKA 5FUIA 3WG3A 4RHV3 3VL9A 4XETA 5IVBA 4HL0A 4K8FA 3WCSA 3VZMA 2FDJA 3ZO0B 3VHOA 4XF3A 5FPUA 2QTWB 4UFJA 4RR3C 1NXMA 5CVRA 1RXFA 2VZTA 1UW8A 1OFSA 3RZMA 2OPKA 2X10A 3N7KA 2B7YA 2VZOA 3LOIA 5BNQA 1H8TC 3ZXDA 1G9BA 1YI7A 4YVSA 3USUA 4IV3A 2ET7A 2YMZA 2PLV1 3WCRA 1N1TA 2D6KA 2ZS6B 2ZX0A 3IBMA 3NV1A 4LXLA 2Q8OA 3WW2A 4DS0A 4CP9B 4AK3A 1B35B 2GC2A 2QVSB 2UY9A 4DFSA 1VBD2 2GN7A 2Y0IA 1YIFA 1I5ZA 3ASIA 3QH6A 4JVAA 3AYAA 3J8F2 4XUQA 3S57A 1O5UA 3CLPA 3PMEA 4ZY9A 2VXJA 4OQ8A 5CIRA 1JYVA 4NE9A 4BA6A 3D3AA 3C3VA 3VBUA 5A3MA 3H7YA 4B1LA 1BMV1 3LD8A 3ACGA 2E26A 1W6PA 4OHVA 2XH6A 1EV13 2AH2A 4IE5A 2W0XA 3WF0A 1Y9QA 4TYSA 5L7OB 4JTNA 5FZEA 2JD4A 2XL7A 5A1FA 5EFUA 3WP4A 2PLV3 1L7RA 3PUIA 4IETA 2Y60A 1IQAA 3P1IA 4QMAA 5BYNA 3M3CA 4XABA 1H6YA 1XJAA 2OUHA 2UY8A 1V6LA 4IDZA 4XEZA 5FYUA 3PIGA 2ZKNA 4QQ2A 1D2QA 1IGOA 3QBQA 5BNNA 5BNOA 2CSGA 1HQLA 4RQPC 1Q8PA 2WLQA 4YARA 3N3HA 5JXIA 1NE6A 4BXSV 4CUAA 1Y9MA 3WUDA 4BMBA 1LEDA 4XDPA 3V0BA 2QQNA 4IXLA 4PQ9A 2WZR1 4C1XA 4MG2A 3R4DB 3VBFC 3TEYA 3ILNA 5JR7B 1Z7S2 3JBG2 3ZSEA 2WZ8A 5EXOA 2XVKA 3R6SA 3U4XA 1W6OA 3D82A 3HQRA 1AR82 3ZX7A 2R6QA 1FMD2 2JX9A 4N53B 1DDLA 4FOVA 3HOBA 1AL21 1FNZA 1V9U1 2UURA 2CYFA 1OLRA 2WS92 1IPKA 1OLMA 1XSRA 2B9UA 4FPYA 3VDCA 2RDQA 4C8DA 2RR12 2GNDA 3IMMA 3SH4A 2WLPA 5C3PA 4QX1A 4IGPA 3GCWA 3NQHA 3G7DA 1LOBA 1W9SA 3Q8CA 1LECA 5FCCA 2E53A 1RUJ2 3ZLIA 3PHMA 4LUMA 1N1VA 1MS8A 1UOBA 3DYOA 4LEJA 2QQIA 1X8MA 4UT5A 1QJEA 4YVSB 4IEVA 5E6HA 2RDNA 3E1F1 3EQEA 4IV1A 4Q27A 3SCGA 1JYXA 5EPAA 5LBEA 3ZYRA 3K3NA 4XF0A 4QB2A 2XWJB 2BQPA 3KMHA 1X9PA 4L92A 4XIOA 4FFIA 4CVUA 1E5SA 3TEWA 2OQ7A 2RMU1 1W6NA 1VP6A 2W68A 4HXCA 2Y34A 1O3RA 4IW3A 4XJAA 1FNYA 4A42A 1ZZ9A 1N3OA 4BDVB 2FQPA 2VCBA 3VBUB 1XNCA 3UGHA 1ASJ2 5CNAA 5JWPA 4N43C 4CCLA 4A44A 2P6CA 4DEVA 2J1EA 1UY3A 2Q1MA 3AZVA 4D7SA 2WQ8A 1BVP1 4QPIC 3N35A 3OPZA 2FD8A 2VOVA 3NNGA 2XQXA 4CUBA 5JPNB 5JZGB 1JHJA 4S2HA 4AGRA 1GV9A 1QEXA 2FCTA 3A23A 1GWMA 2WFPA 1C1LA 2NM1A 1QNYA 2P6HA 3AMQA 3M3IA 3MF6A 1NZCA 4M3CF 3CZJA 3E5QA 1VBB1 2JD9A 5I0UA 3TEXA 3VGIA 5IATA 1PK6C 4NUBA 1YJLA 2O1QA 5F6KA 5GLVA 1CJDA 3AM2A 3GM8A 4J1WA 4LBKA 2B42B 3MI8A 5F3IA 1PMHX 1STMA 2RMU3 2WIIB 5EV7A 5BNNB 3BUCA 4GALA 2E6VA 5BNOB 3WD5A 3AXEA 1UF2C 3N7JA 4E27A 1XB9A 2ID4A 1W06A 4V2VA 4ONUA 5GLZA 4BQ5A 4D6QA 2DU0A 2R041 4W6WA 1DYPA 1PIV2 1C5IA 2WWSA 5J48A 3V0BB 1ZRCA 1OKOA 4BLJA 5GLWA 3MUZ1 1A6CA 1VPHA 2QQWA 2VO5A 5CFDC 1MVQA 2C0ZA 4Y3OA 1LENA 3THPA 4V1PA 3S5QA 4D7TA 1UD1A 2KR2A 1TMF2 4XJ8A 3M8LA 1KXGA 5JAXA 3B3QE 5FPLA 1W28A 4AEDA 4JGZB 2V4VA 2WNVA 4HKOA 2G19A 2QQUA 1OF3A 4ZKTB 3B9CA 3SCFA 2W1UA 1IS5A 3KF3A 2Q0AA 3NNLA 4LO4B 4DUWA 4WM7A 5C4WC 4CXWA 1VRH3 1XE0A 1TZOA 4MV2A 1CVNA 3I2HA 2RVAA 4Q4X1 3PMSA 2V09A 2DVBA 2I07B 4YG0A 5IFTA 2DCZA 2TNFA 4QPGC 2RE9A 4I0BA 2EXJA 4Q4W1 3AZXA 2RHPA 2F6BA 4XFIA 3S7EA 3O14A 1H2KA 1HRI2 1W03A 2ZAAA 5FY4A 3UGFA 2C9AA 2HWF2 5IT6A 5KHGA 3O1VA 1RINA 3SC7X 1X9TA 2RV9A 1XYOA 2Y6KA 4G9SB 4DUXA 2QBXA 1I1EA 1WW7A 1OOPA 2BFUS 2P3IA 4CRQA 2BBVA 1ULGA 2JB4A 4CDUB 3NNMA 1F15A 3UGGA 4AVSA 4Q4X3 1ZM1A 2LM3A 3WHUA 1VAMA 5KR7A 1JZ2A 4OMDA 4CCJA 1AR93 1O3QA 4C0HA 1K42A 1HN0A 1AYN1 3WDTA 4CEWA 3LEGA 2GC0A 4JKKA 2WAOA 4Q4W3 1RJ8A 1GQHA 2ZX1A 1FPN1 1O5LA 2JE7A 3LF7A 3P3NA 2E32A 3OCPA 3VDDA 2VJXA 4QHZA 4QX8A 3K4AA 4S2GA 4UWDA 4DO0A 5LK7B 2W1QA 1CAXA 5FUPA 4B7EA 1W8UA 1OUSA 1RITA 2BNOA 1GOFA 2D93A 2BNNA 2YHJA 2GZWA 3HT1A 2IVIB 5C5TA 1GQGA 1VBE1 1E5HA 1QH7A 1UZZA 2YU2A 1PGL1 4AQ2A 1JZ4A 1J84A 2BZDA 2EALA 1OQEA 1VBC2 4U2AA 3KHBA 3TNQA 4M3CE 1Y3TA 5FYMA 1UL9A 2OA2A 4LT5A 3VBOA 1BYHA 1DQ4A 1SMVA 2FMDA 3OEAA 2XWBB 1RMU2 3Q8EA 4LK7A 4IE6A 4UI9L 1EP0A 5LASA 1DQ5A 3RFRA 1ULCA 2OIIA 2H0VA 3I3DA 4BQ2A 4XUPA 4CUCA 1AYN3 4ASLA 3PJQA 2GP5A 3ZN5A 3THTA 1W9WA 4RR3A 4AEDB 2CWMA 2WNVB 1J59A 1FPN3 5FLJA 1IQDC 3TAYA 1H8TA 5GZEA 3KVAA 2PQSA 2PHLA 2DFBA 3DXUA 3KLSA 1FV3A 4HMZA 4WM7B 2IXIA 1DGWA 4AVTA 2RS12 4QX2A 1RUI3 1LGCA 1VBE3 3O0XA 4WM8B 3POJA 5ABJA 3AYEA 2EIDA 3OGGA 1HRV1 1D0HA 4P9YA 4NO4A 4LQRA 4OULA 3M1HA 3LAGA 3AP5A 2EIEA 4JGYB 4AE2A 1ZBA2 4K8RB 3WV6A 3QD6A 3OGRA 3U14A 4JDNA 4R4XA 4XACA 1VALA 4FT8A 1PZ8A 5FXXA 5AFEA 3AZYA 2OVUA 2VMDA 1I3HA 1QNWA 2J1TA 1VMHA 5I8YA 4P9GA 3K77A 5A33B 3GXUA 4P08A 3P5BA 4NHYA 3GBFA 4QKDA 1JHNA 2I74A 3M2MA 4KWLA 1FXZA 1OOPB 2WN2A 4XUOA 1DQ1A 1TME2 4DXRA 1QDOA 4GB31 4P9XA 4U36A 3WVJA 1WLWA 3ZYIB 3S6PA 2JB8A 4HFSA 4MGQA 3T09A 3FN9A 5GM0A 5KHKA 2FDKA 3NKTA 1BZWA 2UWAA 4X6QB 4AWDA 1RVF1 2MEV3 4RQPA 1D4M2 4HSJA 3UESA 1G7YA 5I93A 5C3SA 1JZ5A 3ZR5A 2XKPA 4KG8A 2BTVC 2V5YA 4D0QA 2OUJA 2FDFA 2AR6A 3OD4A 1BQPA 1C8M2 4XF9A 1EAH1 1GLHA 1AX1A 3O5SA 5AC92 4QQHA 3VD5A 2XJUA 2R1BA 4Q4V2 3POFA 4LO7A 4LBNA 1QWRA 4TSVA 1CIYA 1SBDA 2G9ZA 2YFZA 5FP9A 4COVA 5DUVA 3O1MA 1NKGA 3PUSA 4CU8A 1N3PA 2PHUA 4CSWA 1R1A1 3POBA 1PGW1 3HMYA 2XJPA 1DCSA 2ZAHA 3LFIA 4FFHA 4P02B 1RVF3 4RR3B 1MS0A 2E33A 4XJUA 5HBAA 4MADA 4XF1A 1YYNA 4HONA 3WOGA 3O1SA 1SLBA 5JMCA 1H8TB 2B4KA 3WQBA 4MYEA 3KM5A 2BGCA 1AX2A 3L2YA 2W39A 3ZXEA 4FBFA 1EAH3 2VZ3A 3WW4A 5DMYA 1LOGA 4FPGA 3BOPA 2VQUA 4D69A 2XKOA 4CCEA 2WA3A 4NVPA 4KWKA 4HETA 2D5FA 2A73B 2Z2SB 4CCDA 1DHKB 1A8DA 1H4GA 4LKSA 2YYOA 2ZEZA 4WZFA 1RUOA 1R1A3 1O3TA 1NE4A 3OGSA 4N43A 1OI6A 1DYOA 1RB8G 2VQAA 4LBOA 3GGLA 5HCHA 4QPIA 4O9EA 2D6PA 4YGEA 4L2NA 4L11A 4PCRA 3VZJA 1GYKA 5J09A 1ND3A 4XDQA 2KA3A 3WG4A 5FZAA 4NHKA 4UW3A 1AXKA 1QGLA 1YFWA 4YLZA 1X36A 4PBPA 1RUH2 3P3PA 1CPMA 5KXCA 1GZCA 1BHGA 2Y8KA 1WLTA 2O14A 3M70A 2DCYA 2QKDA 5GLUA 5IVYA 1C57A 3FX3A 1OURA 4LHSA 4B4RA 3WEZA 1WMEA 2PYTA 1QQP1 4I30A 3U10A 4IV3C 5CKQA 2PHFA 4GA9A 2EVXA 1XNAA 3IAPA 1O91A 2AENA 3B00A 4HG6B 4RSUA 4RQPB 3WXPA 1ZBE2 5FZDA 2FCVA 5IK5A 2WFF3 3AFKA 2VOWA 3AKQA 5FMOS 4D8MA 4Y26A 1CPNA 3I97A 4FPHA 3U75A 3VBFB 2WO2A 4Y22A 3J7NA 4K1YA 1CESA 1XU2A 2RM21 5A3WA 3OBZA 4FAHA 1ZREA 4FAGA 1OMIA 5DUUA 1R083 4JZRA 3D8CA 4W50A 5LCWL 2G4IA 5FMCA 2EIGA 3KSCA 5K4LA 5HXMA 3LCPA 1AR72 3UKNA 4DY3A 3JD71 3S7IA 5DUXA 3AKSA 1QQP3 2VR4A 3DN7A 3VV1A 3MLLA 3MIDA 2DUOA 4HT1T 1FYUA 5C4WA 3FLTA 2WDBA 1YQ2A 2Y6GA 2XVGA 3I3QA 1S0DA 3FLPA 2JWPA 4QD2A 4GQ7A 1S55A 2P34A 3FLRA 4KMQA 3MIEA 1CIWA 3UJQA 1QJX2 2WABA 1RTVA 3AZZA 2JE8A 3I3EA 1K45A 2XR4A 2JDMA 3DV8A 4QPGA 5A1AA 5JI9A 1ZRIA 4MXVA 3WDUA 2Y64A 2HEVF 2HWC3 1UCXA 2RM23 3PNAA 3QCWA 5CISA 1ENRA 3MDPA 4XMIA 2HKXA 4OZOA 1ULFA 1RUG2 2Q30A 3B94A 4WVMA 5DZGA 1DF0A 3JD73 2A71A 3ZFGA 4Y4RA 1Q8QA 2LS6A 1UYXA 2Z5WA 4N43B 4FPKA 1NCRB 4UFIA 4JV4A 2ORXA 4C0BA 5DAXA 3PUAA 3NJZA 4QPIB 1GWKA 4QDSA 1LJ7A 2ZGRA 4A7KA 3IDAA 5FZKA 5KBFA 2VCMA 1UU4A 2EAKA 3VZNA 3VBRC 1YCIA 3KV9A 5DDJ2 2VULA 5FY8A 3PVNA 4LKEA 1R092 4R9CA 5JI7A 3N9NA 3DGTA 3U0ZA 4AI0A 2PHXA 3HNYM 1H1MA 5BNPA 3AKRA 1JUIA 1PK6B 4QQLA 3RZKA 2JG8C 5A3NA 5L9VA 1UXXX 2ORZA 1MZ5A 1NLRA 2FZ1A 1KRIA 3U4SA 4IV1C 2VU9A 4QKFA 1CWPA 1CAUB 3MW3A 2NLRA 5T50A 2KXLA 4YW1A 1I5PA 3OBTA 1JN2P 4LBJA 4RGGA 3ZXLA 1GNYA 2MNGA 5D2AA 4PDWA 5IAVA 4PQQA 2CTVA 3NW4A 3GJAA 3HNBM 3KV5A 4LO6B 4NIAA 3ATGA 2A75A 2DUQA 4PI2A 3PTYA 4Q0VA 5CFDB 3OUIA 4Q4Y1 3BALA 4Z1VA 4DUVA 1UZVA 3J7HA 1APNA 4NROA 3HN3A 2W08A 2TUNA 3H3UA 4BYYA 2EXIA 1VMJA 2K2SA 3NO8A 2J42A 3CL1A 1CR7A 2GAUA 3H1WA 4L97A 3L9JT 4OMCA 4DQAA 5GZDA 1F5JA 3ZN6A 5GALA 1MZ6A 5FXVA 2R071 5HPOA 5C4WB 2VC9A 2VMCA 2VZUA 1KEXA 4PLNA 5DG2A 1SFYA 2XJRA 2WRAA 2HWD1 4UW4A 4XBLA 4R9BA 2HYXA 1GP5A 1TEIA 3MPBA 4ISRA 4KQ7A 5FYTA 5G05L 1SLTA 1K12A 4QU2A 4QPGB 2XHNA 4UBHA 4XQWA 5CYYA 1JBCA 1KQRA 2ZEXA 4AI9A 4CDWA 1VAVA 4ZU5A 1NLQA 2Y26A 3I2FA 4Q4Y3 5JSRA 4DXTA 1W2NA 4DMIA 4NIHA 1OVPA 2PA7A 5FZ1A 4ZXKA 3SH3A 4WVMB 3WNMA 5B4NA 5F8PA 1ZZBA 2QQPA 4RFT0 4XUNA 1NCQA 2FHRA 1WMFA 1X50A 1JU3A 2HBUA 3RPQA 4C91A 3D0JA 2R073 4Q8KA 1JZ8A 1NZIA 1JW6A 2PLV2 2Y6FA 5FYZA 1H2MA 1PZ7A 5LK5A 3W20A 1BEV1 5L73A 4HPKA 2W94A 5GKAC 4AGVA 2HWD3 3I2OA 1W2TA 5A1LA 2VQTA 1WCUA 2BEOA 3MGUA 5FYSA 1IPJA 3AP4A 3BIWE 5LBCA 1W9YA 4I3PA 2VECA 1T6BX 2WZEA 4C90A 3EXUA 1UZWA 1YRZA 2ZGOA 5DXDA 4NIDA 1W8TA 4MGSA 4XFHA 3D4KA 4XQDA 1BMV2 1NLSA 5T55A 2AGSA 1WCQA 4NHMA 3F95A 2JDZA 3BTXA 1OPOA 4Q0UA 1FT9A 4LKDA 4A3ZA 3CJXA 1DZQA 2GMEA 1C1FA 2YG0A 3ZDVA 4AR2A 1DGRN 5FYVA 3AL6A 1UMHA 4AHWA 5HCBA 4OI0A 2VUJA 4EN8B 5D1IA 1VAKA 4S2FA 1COV1 4YW7A 4XOGA 4AZZA 1UY4A 2Q1ZB 3Q9OA 3Q8BA 4BK5A 5A3UA 2UYBA 2V5DA 1JYCA 2BOIA 1SBEA 2XJQA 2YGLA 2CGPA 1W39A 2Q8DA 1RUD3 1NA1A 3IPVA 1C3HA 3N9OA 4RHV1 2XBO1 3ZR6A 5F37A 5HI0A 5LEJA 1UOJA 1MQTC 3ALQA 5IK4A 2D7FA 2JICA 5F3GA 2W95A 2LROA 1EUTA 2WZR2 4JRAA 3NWKA 3FUQA 5EIYB 2WNUC 1H0BA 4NRPA 2IWGB 2JIGA 5A7QA 4CEWC 1G6NA 4AF9A 4ZZ5A 5FLIA 1MS1A 3LA3A 3NVCA 4BLIA 2E51A 4UFKA 3VDDC 2D40A 2ADEA 4NR1A 1S4CA 3POWA 2DTYA 4L99A 3OGVA 3MZHA 1AL22 1PVC3 1COV3 4PLMA 1V9U2 5ACA1 3AP7A 2BRTA 3AP6A 1QJZA 3S30A 1IS4A 5FQ0A 1EYBA 2EICA 4IERA 2ZHLA 4Q0PA 4DINB 2LW8A 3FWEA 1SCSA 3LEKA 4AHYA 2OZ6A 1DZTA 1CD3G 4JDMA 2JDYA 2VVEA 2XBO3 1VR3A 4Y5TA 5C71A 1AVBA 2EIBA 1PO13 2JDUA 3OBRA 4LHLA 4QHOA 3VBOC 5C8CB 2GNBA 2FDHA 1MPXA 1UYYA 3VZLA 4A2UA 3ZM8A 3PVBB 4XURA 2RS31 3A4UA 4IEZA 4COUA 1EV11 3TB0A 4YZ1A 3AB0A 4HOOA 3RNSA 1WWYA 1KS4A 1YIPA 3ON7A 3FL7A 1G9FA 4Q26A 4ZZ8A 2RMU2 4E4HA 3SISA 3BU0A 1GOHA 4H14A 4BHPA 5ACA3 5CB7A 5EWSA 2D5HA 1N1SA 3GCXA 5ABJC 4KI5M 4FI9A 3NJYA 1W2AX 2W5FA 5JOYA 2VTXA 3VKLA 3IB3A 4YGCA 2R49A 4FPOB 3VKOA 2XHKA 1Z0HA 3DL3A 3POGA 3FE5A 5KHIA 3R0RA 2R0FA 1UX7A 1QXJA 2WO1A 3I3BA 1SPPB 3LKJA 4P14A 2RS53 3WNXA 2RS33 3IDCB 3LPFA 4NMIA 1VBB2 2WO7A 3ZIWA 5EJ3A 4LLOA 1Y4WA 1S0JA 4GKYA 5H9RA 3B5LB 2BPA2 4MGTA 1SACA 1OC1A 4JX0A 3ELNA 4XCAA 4OVEA 1AYM1 2XUEA 5EHDA 3T08A 3J4UH 1O7FA 1UY0A 4RA0A 3ZXGA 1N3QA 2R042 4YW6A 1XNBA 4H55A 3RI8A 1JUHA 1V6NA 3V65A 4AQTA 1PM4A 4LULA 3E5UA 2XONA 4EJRA 3O1PA 1SFPA 2WN3A 1HV0A 2NYYA 2VTFA 4JCKA 4LR4A 3UK9A 4AI1A 4IE0A 3HR9A 4XHBA 1CONA 1F5FA 1YFUA 4FFGA 4ISQA 1NQDA 4UXAA 5D8AA 5LBBA 3SH5A 3T30A 4Z92B 2RJLA 4PJYA 1J1LA 4Q5OA 1QJU1 3H1YA 4CEYB 2VPVA 2JJ6A 3J7MA 4M01A 3RYKA 5FQ0B 2R32A 1RUC1 5FP4A 2CV6A
chains in the Genus database with same CATH topology
1SLCA 1XYPA 3VUOA 1QXPA 1AYM3 3D6EA 1RJ7A 4Q4X2 4Z8BA 1RHI3 2D3SA 1MACA 1U5YA 3ZSLA 1ENSA 3VBRA 1G9DA 2Z79A 4Q4W2 2ZGLA 3E6DA 4AEKA 2ZGSA 3H0OA 2AREA 2GDFA 2XG3A 2JG8A 1C8NA 3MIHA 4LHNA 3DF0A 3USUB 3I4IA 4IV3B 4FOQA 1QJU3 1GSLA 2ZBJA 3M3QA 4BMEA 4OHYA 1ZX5A 1Q56A 1H8VA 1RUF1 2ZMLA 1RUC3 4KG0A 1DGLA 1WCDJ 3B9IA 4Y24A 4XILA 1LHOA 1X8EA 4ORFA 4KGGA 3FUOA 4YW5A 3W9AA 1IS3A 1AYN2 3AMMA 1W6PB 1TQ5A 1PNFA 4YSFA 2XJTA 1LRHA 1FPN2 5FFOC 4XTMA 3AYDA 4QGLA 1ND3C 2DWRA 2GN3A 3ST7A 3C2UA 1OQ1A 1VB2A 4HZFA 3WP3A 1VBE2 2OYZA 4F8AA 1RUF3 2VOXA 1PGL2 2HWE1 1PNGA 3ZXAC 3CEWA 3VKNA 2YDEA 4Q29A 4I0AA 4HN1A 4LNVA 3MICA 3DKWA 3RI9A 3AMPA 1ZRFA 4LTAA 1VRH1 3VN4A 1URXA 5BPXA 1UZYA 1FATA 1QJY1 3J26N 4GULA 1I6XA 1CJPA 3JZVA 3VHNA 4QX5A 1UPSA 4XYXA 4AFCA 1W6OB 1L3JA 3WQ0A 3WP5A 1D2SA 2H6CA 4M0NA 5JOWA 3A0NA 2HWE3 1HRV2 1POV3 2ZACA 4F3JA 2XVLA 1V70A 4XXAA 1FI2A 1LESA 3VBRB 3KGZA 4GMP1 5E16A 2NQYA 1KDKA 5AFBA 1VBD3 2GNMA 4OUMA 4COZA 2XLFA 3J8F3 5GZFA 4FTEA 2G9GA 2PHDA 2XUMA 3B93A 2JG8B 2QDRA 1U5XA 3KB5A 5FDBA 4MGKE 1AR91 1QJY3 4Y20A 3ES4A 4YYOA 4IV1B 2MPFA 3POSA 2QUOA 1V6OA 1XU1A 3DUIA 4UW6A 3RMYA 1AXZA 2E7QA 1HXS1 2CWSA 2NZ9A 3EHKA 1FAYA 1VB4A 2YUEA 4GB32 3BODA 3WR0A 1W6NB 1BKZA 1DGWX 1X7NA 2G9FA 3ME2A 4MSVA 5J3UA 3ZFGC 2CNAA 4EV0A 4GMP3 3RS6A 1VBA1 5SV8A 4YG6A 4YW2A 2K0GA 1RVF2 4AHXA 1KJLA 1MQTA 3OJBA 2WNUA 4XTPA 1EAH2 5FLHA 4EN6B 5BNPC 3APBA 1HXS3 3GF6A 4YFZA 4H3WA 3JBG3 4ZU7A 2VXRA 4XPVA 2E7TA 3AZWA 4AFAA 1HX6A 2P2KA 1RUI1 2AUYA 2LTNA 1R1A2 1PGW2 1YHFA 1VBA3 1NOVA 3FHIB 1HW5A 1QY4A 4J1XA 1ALYA 2WS93 4PDWC 1QOTA 4XQ4A 2R0HA 3H3ZA 2PHWA 2VW0A 2RR13 4G4FA 3NAPA 3ZSJA 5SV5A 4OI2A 3M3OA 2VW1A 3JU9A 4E9KA 1OA4A 4EROA 3MIFA 2B5HA 1WBFA 2YV8A 5EYYA 4OZXA 3ZIXA 4YM1A 1NYWA 1BCXA 3I54A 4IEUA 1DYKA 1LODA 4K40A 3M3EA 2RJKA 4MXWA 2CGOA 1LOEA 2DCJA 4Y1ZA 3ZMNA 4Y4YA 3FJSA 4CDWC 1ASJ3 4BH9A 2EXKA 4FQ4A 4FO9A 2MEV1 5EYXA 4HKLA 4L8QA 1S0EA 4FPEA 4JDOA 3JB8A 4I02A 3WDVA 4AI8A 1J1TA 4XMAA 3ZN4A 1MEC1 2WSUA 5E8AA 4RGAA 4ITCA 1OKQA 5J98B 2ZX4A 1PHMA 3TYJA 1Y43B 1NCQC 2D6LX 1QQP2 5K0UC 4DOUA 3B7MA 3ES1A 3INAA 5A32A 1LOCA 2HWB1 1MQTB 2GH8A 4Y1VA 5FOJB 1KFUL 4M0HA 1YXWA 2WNUB 2FMYA 1ZZ8A 4CEWB 1PIV3 4R9DA 3WQ7A 4DB5A 2RM22 1MZEA 2B46X 4Y1YA 4P5HA 3USSA 4W65A 4RL7A 3VDDB 1MEC3 1CAXB 2X5IC 4D3WA 4HN0A 1O4TA 2AYHA 3IT8A 4XZPA 2K9ZA 4DRRA 3GYDA 3JD72 2SLIA 4AFBA 2YC0A 3AX4A 1A8MA 1WW4A 1GFF2 1K5MA 1JTZX 2HWB3 5A3LA 3VBHA 2H6BA 3VBOB 3FC0A 5JVVA 3S0MA 2VW2A 1NA1C 4Q2FA 4K6BA 4YW3A 3ZPYA 1J3PA 4Q0QA 3VL8A 2GNTA 1UU5A 4D7YA 4UW5A 4DY5A 2HEWF 1LGNA 4KH9A 4MXWB 4R4ZA 1HRI3 1JXNA 4N7UA 4SLIA 4PLOA 5ABJB 4UBGA 4EN7B 3RJRA 3V0AA 1RL3A 1YO8A 4N9HA 3SLIA 4KU7A 1KITA 2XLGA 4ASMB 3IIAA 3B69A 3I7DA 3J9SA 4AVVA 2WFF1 1IS6A 4E2GA 4GIQA 4XFBA 2D6MA 1CX4A 5LRSA 5BV6A 5CA6A 2X29A 1MS5A 5CFCA 3LWCA 1M06G 1JH5A 1DZRA 1R081 5FOBB 2YGMA 4H7MA 3ROUA 1V6IA 3NV4A 5T3NA 5C9AA 4FTSA 3TBDA 1LHVA 3CNAA 4JAAA 3NV2A 3UJOA 1XE8A 2NP0A 3AKPA 4FPFA 1C5HA 3DPRA 4YM0A 1WD3A 1X82A 1NY71 3W59A 2OZJA 3O7OA 4Q4Y2 3NKGA 2PQQA 5F6LB 3WW3A 1W0PA 4KWJA 5FO7B 4GMP0 4MZUA 3GHMA 2HWC1 3D5OA 2OW4A 3GZAA 2QFEA 2GMPA 2R072 4NHLA 3IN9A 1OHFA 1W6QA 3ZFFC 2AZ5A 4XBNA 2HWD2 2GH2A 4AVAA 2VNRA 5DZFA 4PIZA 2X53S 2V73A 2RS13 3OGJA 3AMNA 2DVFA 2XLAA 4KU8A 1S0IA 3VLBB 3H50A 3ZYPA 2A6XA 4AI2A 2D98A 3N7MA 2ENRA 1S2KA 1OFNA 3GZUC 4BCUA 1H4HA 5C33A 4SBVA 3ILFA 3MPPG 5D8AC 1S2BA 3V0AB 1HQNA 1BEV2 2VY0A 1TME3 1WBLA 5FO9B 1CAVA 1DU3D 3ZFEC 1WLCA 1D0GA 4H7LA 4YVWC 1J3QA 4FOYA 4OUSA 2F4PA 2A7AA 1Q43A 1ND3B 1DLLA 1LOAA 3T2TA 1LOFA 4PF5A 5AVAA 1NXD1 1FOD1 3B01A 3SITA 1W6MA 2BWCA 2WQ4A 2R061 5E88A 4EN9B 2QZ2A 2VNOA 1RGSA 2A3WA 3PVOA 3T1MA 4FVVA 4LBQA 1COV2 2WKKA 3U11A 3WDYA 3CO2A 2ZZJA 1AR61 1WD4A 2CAVA 4QT6A 5J37A 2D44A 3N36A 4XFGA 5T54A 4W6XA 3HT2A 4MGIE 5T5JA 2C5DA 4LO5B 1IOAA 4RHV2 5H9PA 1BXHA 2PAEA 2XBO2 3WG1A 3VHRA 1JYIA 4Y22B 3UKVA 4INDA 4TWTA 2P17A 4E2QA 3ZSMA 1MVEA 1FOD3 1W6QB 4NWWA 4LA3A 2VGDA 2ERFA 1QXRA 2IFRA 2R063 4KGQA 3UV9A 2QE3A 4GKXA 2TEPA 4EN0A 1WA4A 1WMDA 5ACA2 1YLLA 1LHNA 1AR63 3OYWA 2EA7A 2D6OX 4K9SA 2DVAA 1Y7BA 2VH9A 3A0KA 4AQSA 3WUCA 4GH4C 4K20A 3LA7A 1B09A 3VBSA 4FXKB 1G86A 1IHMA 1F9KA 4E2SA 5GZGA 1AZDA 3KT7A 4R8HA 2R30A 2RS32 3AJYA 1CAWA 4XF4A 4LBLA 1EV12 2A6WA 4QM8A 2B8MA 3SMHA 5GJ6A 1RUH3 1XQNA 5JLVA 2ZHKA 5K0UA 3ZFGB 5FRAA 1H2NA 3RSJA 4YZ5A 4FOWA 2IXJA 3N4MA 3MYXA 4IEOA 1Q8OA 2R16A 1O4YA 1SEFA 4IEPA 4XXPA 2DTWA 1ZBE3 5JOZA 1IZ3A 1PO21 1RUD1 2NMOA 4LE4A 1ND2C 1QOSA 1W6MB 5BNPB 2WNEA 4IEXA 2PHRA 2X5IA 3SNMA 2WC2A 3OY8A 1QH6A 3KCXA 1RIRA 1LHUA 1G9CA 3WT3A 4AYUA 3RMXA 4LLFA 4YNIA 4Y5Z0 4K3UA 3AYCA 2YY1A 4PDWB 1AYM2 3H1MA 1LHWA 1TNRA 1PVC1 2GC3A 3ZXKA 2CAUA 4WM8C 4BZ4A 4FPJA 1JOJA 2ZABA 1PO23 2XB6C 1MS3A 3L2HA 3H7JA 3KS7A 4AQ6A 2DVDA 2Z69A 4B7KA 1PO11 2VG9A 3TOJA 4O9GA 3ZN6B 2HEYF 4DNYA 2ZZQA 1QJU2 5KXBA 2DUPA 1RUG3 2QJVA 1KD7A 1RUC2 1H30A 2GC1A 4MX3A 2D3RA 5L7OA 5FTTC 2P37A 3MEPA 4FP3A 1UIKA 3HBZA 3WX5A 3ZXJA 1BBT1 4CDWB 3KQRA 2JENA 4N9IA 4PIYA 3FZ3A 3BPZA 4YRDA 1CAWB 4WZCA 5KXDA 1LKNA 3EJKA 4HBNA 1N1YA 2VVDA 5DG1A 3NAPC 1R093 1NCQB 2DFCA 2DF7A 4DPNA 5K0UB 3E6CC 4X8PA 3ZMOA 3AP9A 1FV2A 2RS51 2SBAA 4XFAA 3UL2A 3WZ1A 1WGPA 2VMIA 4TLFA 1RUF2 2EF6A 4YFWA 4HPKB 1OLQA 1ENXA 1AHSA 3JUUA 2WT2A 3K51A 4D94A 3OF1A 5I91A 4KBBA 1BBT3 4XJ9A 4OI1A 4BPZA 3WLUA 4Y1XA 1H2LA 2ZX3A 4MUVA 4WV8A 1ULEA 4CYDA 3GALA 3FMGA 4PIXA 3WDWA 1RUE1 1XYNA 2XL9A 1SLIA 3JQWA 5IK8A 2X5IB 4K1ZA 1XNKA 2BVBA 4Y1UA 4BWOA 4P9JA 3OY8B 1VIWB 2WJSA 5TSWA 2X8KA 4R9AA 3RG0A 2XPJA 4F83A 3ZXFA 4BOWA 3TN91 2BFUL 4LHKA 3ZFFA 1Q5OA 1Z78A 2VQ0A 2HWE2 4CDQC 4C1WA 5HXVA 3UKTA 1GNHA 4Q8LA 2O8OA 1QOOA 4QXKA 2ZKLA 1VRH2 4JQRA 2DURA 1NA1B 5T5LA 3IPVB 2PAKA 1V6MA 4GWMA 1RHI1 1RUE3 2WT0A 4DXZA 4QM9A 1AF9A 4XFCA 3KGLA 1QJY2 4K21A 4K7JA 2LUWA 4QGMA 3PVEA 1OQDA 1SLLA 3BTAA 4X8NA 5BXXA 1OPMA 5JZGA 3QH7A 1CN1A 3TN93 4OHXA 1G9AA 3LSEA 4BIFA 2ZX2A 3ZFEA 4AEJA 2YPJA 1K5MC 4YVWA 5B2GB 2UWCA 3VBHC 3AFGA 1AR92 5DUWA 5K8SA 1IKQA 4AHZA 1DG6A 3MW4A 3CJIC 3BCWA 5CAZA 3BB6A 3G6JB 1HXS2 4MH0E 1ZZCA 5F1RA 2GSYA 4R52A 5I8SA 1W0OA 1ZA4A 1ZYBA 3MLJA 1UIJA 1BJQA 4JGZA 4LBMA 4FQZA 1GR3A 4BIOA 1VBA2 5IUQA 4META 1S0BA 4Z82A 1GICA 3IMNA 4LUKA 4XW3A 3ZSKA 1KS5A 4YZ2A 1R1ZA 2A6VA 4A7ZA 4COWA 5CADA 1ONAA 1GANA 1UMZA 2WQZC 4NWVA 4GXLA 2JECA 1WLDA 1T6GC 1SDWA 3ZFFB 2D3PA 2WZR3 2XJVA 2ARBA 5CFCC 4YG3A 2YXSA 2E9QA 2VUAA 1XNDA 4XFFA 2ZGTA 3FBMA 1AJKA 2BWAA 1RUI2 2VMGA 2HJIA 5C9AC 3W58A 3E6BA 1AL23 2XJSA 1POV1 3MIGA 2NMNA 1V9U3 3WP6A 4GH4A 1YUDA 4L9BA 3CF6E 2XGXA 1MZFA 3DPRC 1H1AA 1UKRA 2NPIA 1VBD1 2ZHMA 1NCRC 3O12A 4CDUA 3J8F1 4P9LA 4FPCA 4M3CA 3GBWA 2DCTA 5D8AB 1VJ2A 2Q4SA 3LOBA 5GZCA 1MS9A 3E97A 4J6GA 3ZFEB 3ENRA 4A7YA 2E7AA 5I0RA 4YVWB 1XRUA 5L36A 4CDXC 5KHJA 4FPLA 1O4ZA 1SLAA 4HKWA 4I0WB 5KC6A 1WUVA 2DYCA 4DRVA 4E4ZA 2ETEA 2MEV2 1ND2A 1SQ4A 3O0WA 1UX6A 4MLOA 3GZTB 2ZGKA 3R4UA 2MHFA 1EPWA 1MEC2 1YJKA 2WT1A 2NN8A 3VKFC 3FBYA 2D6NA 3CU7A 3OD0A 4MGYE 4HVOA 1VBB3 3HN1A 1CGPA 2PFWA 1O3SA 2VMHA 1Z7S1 3JBG1 5T5OA 4KNCA 3LGRA 2HWB2 2ZGQA 4MGZE 1AR81 2P3JA 1FMD1 4WM8A 2E63A 1W2UA 3H8UA 3LZZA 5JCTA 2R043 2WS91 1PVXA 3VZKA 5CU1A 4FP2A 4RD7A 1N47A 2RR11 4JGYA 5CG8A 3GNEA 5T5PA 3IDBB 2ZMNA 1LOFC 3KZ4C 1RUJ1 1I9RA 1VLNA 4LO8A 4I3GA 4CTEA 1ULDA 1Z7S3 1KJRA 3ZVXA 4GH4B 4B3NA 5FMOL 4JRLA 5FPZA 4EWDA 1AR83 5F5QA 4LE3A 4A3XA 1FMD3 4XJZA 4M3CB 3MLKA 4I01A 2ZHNA 2JKBA 2IFWA 1DBNA 1ASJ1 1DQ0A 1IKPA 2CL2A 3R05A 3HIFA 1ZRDA 4RS5C 3AK0A 1WW5A 3NV3A 5JIUA 5T52A 1RUJ3 2JG9C 2A6YA 4B8EA 1AJOA 4LA2A 4WVZA 4OHZA 2GU9A 1LU1A 4CP1A 5CG9A 1X33A 1BK1A 1QF3A 2UWBA 1ND2B 4IL7A 3WW1A 1HKDA 4NPRA 3IKWA 1G8WA 2WFF2 4OHWA 4AXOA 1UN1A 2BYVE 4Y20B 5HCFA 3AJZA 2DU1A 4EWAA 3HWJA 2YZ4A 3VBSC 1PIV1 3RZZA 1LGBA 1WCKA 2A5ZA 1R082 3M4FA 4TZDA 5FREA 1C4RA 4XIKA 1OA3A 1DFQA 1TMF1 2BNMA 2I45A 3URFA 2PAMA 4CDQA 4Q0SA 2IXKA 1LB2A 5I0TA 3AKTA 4E4DX 4FSJA 2CGNA 4AVCA 4HSLA 3RRDA 4X6RB 1NY72 4Q1PA 4CP0A 5H9SA 4QHBA 1BVVA 1WCSA 1U0AA 3D0SA 4FXGB 4WVVA 4GWNA 3POYA 1M4WA 4IEQA 5KWRA 2HYKA 3WDXA 4ATEA 2HWC2 5HCAA 4BM8A 1KDMA 1HV1A 5C8CC 1UU6A 4YW4A 1TE1B 2WZPP 4ZU4A 3ACLA 1TMF3 1HRI1 2ZOEB 4N90A 5FAXA 2HWF1 1E57A 1U5IA 2O8QA 1HRV3 3IDEA 3ILRA 3ZDSA 2IZWA 4N7IA 3I8TA 3RYRA 1REDA 4FCAA 4YZ3A 1S0GA 3NAPB 2B45X 1DQ2A 4I09A 1B35C 2FZ2A 3BU7A 4AGGA 2I2SA 3CJIA 5JIAA 1C28A 1SBFA 2ES3A 3VBFA 5AVPA 3KT1A 5E89A 2ZTNA 2Y38A 1RC6A 2R1DA 1PZ9A 2QNKA 1SCRA 3WQ1A 1YI9A 2CY6A 4HK8A 2HWF3 2N7GA 4GB33 1DIWA 5L7OC 3OTFA 4S2DA 4B4QA 3GHNA 3LB9A 2ZMKA 2ZGPA 2ZGNA 4HVRA 1REFA 1VBC1 4E4SA 1POV0 3MF9A 3MFAA 1TNFA 5KC5A 1FOD2 4XHXA 1RMU1 2VOKA 2R062 4B29A 1ZVFA 4CDQB 1V6KA 2QCSB 4NOTA 2A70A 2JXAA 4MVTA 4Q1RA 3LSDA 5JPMB 3I59A 5A32B 2ZA9A 5BUVA 3I2DA 4OFGA 1AR62 2H0BA 3BOWA 3KD4A 1H9WA 4JTOA 4CEYC 2RS11 5FO8B 4URTA 2VNGA 2UYAA 2QDNA 2WL1A 4OLLA 4AFMA 1EY2A 1NCRA 4NN0A 1YFYA 3TWIA 5EZWA 4N53C 1VBC3 4AVBA 3ETQA 1ZBA1 1FX5A 2ATFA 3KT4A 1RMU3 4BQ1A 3LA2A 3WHTA 1GKBA 5FPXA 1ZZ6A 1OSGA 1A3KA 5JSPA 1H1IA 1ZZ7A 4AFDA 1PK6A 3HQXA 1K5MB 4IQPA 3RYPA 3MIBA 4YVSC 4CDXA 1AXYA 1TME1 3VBHB 1CAUA 1HIXA 2YROA 3QLQA 4JC1A 4P9IA 3B02A 3WINE 5J7MA 4HANA 4XJWA 3MW2A 3CJIB 3GBGA 1AX0A 1SFNA 1U12A 2ILMA 4HK9A 5DZEA 3QACA 1UKGA 4XBQA 1Q3EA 3NL1A 3MFCA 4LBQD 1ZBA3 3KCYA 1EPZA 1YWKA 3EO6A 2IXCA 4IEWA 4KL1A 1D4M1 5CFDA 3K48A 3VBUC 1S1AA 2ZJCA 4IESA 5K9YA 1C8M1 3TRSB 3FFQA 5AC91 5JZGC 3SHRA 4AG4A 1MR5A 3ZYGA 4Q4V1 5C8WA 1D4VB 3HAGA 4WVWA 4P9WA 1GZWA 1REEA 1AUYA 1LU2A 3ECQA 1PO22 1QMJA 3IWZA 1RUD2 5J36A 2QZ3A 5J96B 3X29B 5BNNC 4CZSA 5KXEA 4COYA 5BNOC 5CFCB 1D4M3 2A6ZA 2B39A 1F31A 1J58A 3I59B 3T1LA 2VVFA 4B4PA 2C1FA 1J3RA 5C9AB 1C8M3 3WY6A 3EBRA 1HDKA 3V56A 5AC93 4YGDA 5LRRA 2W52A 1PVC2 1QHDA 3DPRB 1GBGA 4Q4V3 3AXDA 2PHTA 5CBLA 4PBOA 4JGZC 1DGRA 3WG2A 1MS4A 3N7LA 1YNAA 3VKMA 1PO12 1F2NA 4DZGA 4W6YA 4RS5A 1LEMA 3V64A 2JG9A 2BUKA 2ZGMA 1PM7A 4CDXB 1LR5A 4HLTA 2WSVA 1RUH1 2DVGA 3NSTA 1HLCA 4YM2A 1OA2A 1BBT2 2GMMA 4G3YC 2P3KA 3E5XA 1Q8SA 4AI3A 2DCKA 3RJ2X 3H9AA 1F8VA 2BVVA 2IXLA 1ZBE1 3PJYA 3IM0A 4ATFA 4CDUC 2JE9A 1NG0A 1ZNPA 5JOXA 2KM2A 2RS52 5I0SA 2JEMA 1UPIA 4YM3A 4Z2WA 1ZRRA 5IK7A 2FBEA