1NZCA

The high resolution structures of rmlc from streptococcus suis in complex with dtdp-d-xylose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
TENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Isomerase
total genus 51
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nzcA00
3DV8A 5JSOA 1QXJA 4X6QB 1GQHA 1EYBA 3LOIA 4AQ6A 3ELNA 5LRRA 2PAKA 4IEOA 4EWEA 2BNNA 2BEOA 1O3SA 1SFNA 5LRSA 1V70A 4Q0SA 1IPKA 2VQAA 1OD5A 4LLOA 2OZJA 4KWJA 4YARA 4JTNA 4ZU4A 2OZ6A 4ZU7A 2D93A 4D7SA 3OGJA 1YFUA 2IXCA 2D5HA 1CAUA 2QCSB 2XLFA 2Z2SB 3E5XA 3E6CC 1YHFA 4PIYA 1OI6A 1J3RA 2MPFA 4PIXA 4XFGA 4EV0A 3VHRA 5I8SA 5FLHA 1RC6A 1GQGA 4IEUA 3U11A 1QXRA 1DZTA 2DCTA 3UKNA 4JV4A 4OFGA 4QGNA 4YSFA 1RGSA 4META 1Q43A 3KCCA 2GC3A 4Q0QA 5I0RA 5JCTA 3D0JA 3OD0A 4J1WA 4MX3A 3S0MA 3FWEA 2IC1A 4AQ2A 1CAVA 1Y3TA 5BUVA 5I0TA 3SCFA 3SHRA 5I91A 5T3NA 5I0SA 4I02A 1UD1A 3CEWA 4XF1A 3RPQA 2XLAA 1QY4A 4Z82A 5KHHA 4KU8A 2WFPA 5FPXA 1XE7A 2IXKA 1UIKA 1VR3A 5HI0A 3ST7A 4EROA 4MV2A 4QGMA 1ZRFA 3G7DA 4D7TA 5LEKA 4LULA 4KU7A 2ET1A 4I0BA 4K8FA 4YYOA 5J7MA 1DGWA 2GU9A 3H1MA 4Q0UA 1DZRA 4O9EA 3EHKA 4XFIA 3CF6E 5I0UA 1J59A 4QXKA 4KL1A 1PM7A 4HBNA 2MHFA 2IXIA 3LZZA 1ZZ9A 3USSA 1FI2A 2Q0AA 3RYPA 5FLIA 1O5LA 1UCXA 4RD7A 3WW3A 3ACLA 3NL1A 2K9ZA 2ATFA 3ROUA 2GC0A 1YWKA 1RUOA 3HIFA 4ZU5A 2EA7A 3BB6A 3PVBB 5BPXA 4OLLA 1NYWA 2P17A 2H6BA 3I59A 2BNMA 3WW4A 2PQQA 4ORFA 4LA3A 1FT9A 1J58A 3C3VA 1ZZ6A 4N9HA 4XFAA 3FHIB 2D40A 3KGZA 1TQ5A 2UY9A 4IEQA 3RDIA 4XETA 2XL9A 3N4MA 4Q29A 5I8YA 5FCCA 1J3PA 5FDBA 4WBBA 2IXHA 4L11A 5KHKA 1SQ4A 1LKNA 4HN0A 2WC2A 5I8TA 4LUKA 3MYXA 4AVAA 4JVAA 3RNSA 2UYBA 3H8UA 2OPKA 2VECA 1U12A 4KWLA 3D82A 3FFQA 3HQXA 4MZUA 3IDCB 3O14A 4FAHA 1O7FA 1YFXA 2VPVA 2HKXA 3R6SA 3H1WA 3IIAA 5I93A 5KHJA 4I09A 1Q3EA 3DKWA 3CO2A 5EZWA 3E5QA 4IETA 3DN7A 3E6BA 4XFFA 1O3QA 3RZZA 4N9IA 3SXWA 2Q30A 1J1LA 3EJKA 3M3IA 4R52A 5CADA 3UKVA 4I2OA 4J1XA 1ZVFA 3UKTA 1IPJA 2B8MA 5FQ0A 4IEXA 2GC2A 3GBFA 1YUDA 3H9AA 3WW1A 1NZCA 1WGPA 2PHDA 3OF1A 3L2HA 1JUHA 2N7GA 3CL1A 4L2NA 4QMAA 2O1QA 5J3UA 5FPZA 4BH9A 3IDBB 1O3TA 2QVSB 2GAUA 3M70A 1OFNA 1ZX5A 2UY8A 4I3PA 5E1RA 2EAAA 4LEJA 2B5HA 2BNOA 2V09A 5KHIA 3NJZA 3U10A 5BY5A 4XEZA 3E6DA 4MGYE 3BCWA 2ZCWA 2Q1ZB 4HN1A 2PYTA 1Y9QA 4EWAA 3H3ZA 3H50A 2PAMA 3QACA 3KMHA 3EBRA 4FBFA 5C6CA 3H7YA 3QOPA 4HSJA 1X7NA 4IEZA 1UPIA 4MGZE 4F8AA 1UW8A 2PAEA 1XE8A 2FMYA 2D5FA 4FT8A 3LWCA 1X82A 4EWDA 4IESA 1EP0A 2QDRA 2CV6A 4JTOA 2B9UA 1FXZA 2Z69A 5BXXA 4NVPA 2IXLA 2PTMA 3FE5A 1X8MA 2GH2A 4BHPA 1CAUB 1I6XA 2I45A 4B29A 2ZKLA 3B02A 2MNGA 4YRDA 4E2QA 4HVOA 1ZZCA 5F1RA 3JZVA 3BU7A 3SCHA 3DL3A 4I0AA 4QGLA 3CLPA 2F4PA 3MPBA 2XLGA 4XFBA 3U0ZA 1ZRDA 3NSTA 2ET7A 4UXAA 5FLJA 5E16A 3FJSA 1RL3A 3PNAA 3S7EA 1O5UA 5C8WA 4XF9A 1WA4A 3LA7A 2O8QA 2QNKA 3I7DA 1H1IA 4IEWA 1YLLA 4WZCA 1CAVB 3TNQA 2EVXA 3ETQA 4HMZA 3H3UA 4DINB 4E2GA 3MZHA 4GULA 1J3QA 2PHLA 2H0VA 5K8SA 2XL7A 4TLFA 1CAWB 1YFYA 4UBHA 2PA7A 1O3RA 2BGCA 3NVCA 2OA2A 3H7JA 2XHKA 2OYZA 5JAXA 5KBFA 3SMHA 4BYYA 2GZWA 3HT2A 4MUVA 4HVRA 4LA2A 1ZRRA 3IBMA 1YFWA 5CU1A 1DGRA 3WW2A 1XRUA 1L3JA 4WVZA 4HSLA 4Q0PA 4MH0E 1ZZ7A 3LA3A 1VP6A 2GC1A 3FX3A 4CYDA 3RYRA 2FQPA 4A2UA 1ZZ8A 4MGKE 5KHGA 4XF4A 1NE6A 3BPZA 3NW4A 2HJIA 3CJXA 1OMIA 1HW5A 1RUNA 3SCGA 1CAXB 4XFHA 2ETEA 5J48A 1G6NA 4HZFA 1NE4A 4UBGA 4LTAA 4KWKA 3TNPB 4F7ZA 1UIJA 1WLTA 4Z07A 2XKPA 2QJVA 1CGPA 3I59B 2E9QA 5EFUA 2UYAA 2IXJA 4AVBA 4R8HA 3IWZA 4QM8A 1LR5A 5CVRA 4QM9A 4XFCA 2XKOA 3S7IA 1RTVA 4XF0A 3FZ3A 2PFWA 4O9GA 4XF3A 1CAWA 4LUMA 3OCPA 4YNIA 1X8EA 4HLTA 3EO6A 2KXLA 3ZDSA 4QX5A 2CAUA 5JR7B 3GYDA 4IEVA 2K0GA 4P9GA 3H1YA 4E2SA 5D1IA 1I5ZA 4FAGA 3E97A 3EQEA 3ES1A 3RYKA 2CAVA 3KSCA 2XGXA 4Q0VA 1ZNPA 3NKTA 1Q5OA 4IERA 2CGPA 4H7LA 4IEYA 3ES4A 1VJ2A 1NXMA 3PLQA 2C0ZA 5JSRA 5BV6A 1LRHA 3E5UA 4X6RB 1QWRA 1CX4A 1O4TA 2Y0OA 1EPZA 5AVPA 1ZZBA 4PJYA 4HVQA 4I01A 1ZREA 4ONUA 1LB2A 1CAXA 5FQ0B 5JSPA 3LAGA 3MDPA 1ZRCA 3KGLA 4AVCA 3BALA 2BYVE 4AXOA 2H6CA 1SEFA 4IEPA 3I54A 3D0SA 4PIZA 1H1MA 3LA2A 3HT1A 4BIFA 5LEJA 2Q4SA 1EY2A 4MGIE 3OTFA 1PMIA
chains in the Genus database with same CATH superfamily
3DV8A 1XYNA 3HPNA 1GNYA 2E53A 1R64A 3P5BA 1EYBA 5SV5A 3RVHA 3WP4A 5F37A 3H0OA 4AEDC 1OBNA 2WWSA 3A23A 2YC0A 3C7OA 2BOJA 4S2DA 1O3SA 1ODNA 2W3JA 2P2KA 2XJSA 1C1LA 4J25A 4U2AA 3VBUC 5IVFA 1V70A 2QQVA 2VOVA 1QJU2 4IV3A 3ZN6B 1OKQA 4A6OA 3OD4A 1IPKA 2D44A 5EWSA 3U78A 3K2OA 2OZJA 1QOSA 5BNOC 1TG7A 3ALQA 3PJQA 3I4IA 2RMU2 1DYPA 5FYMA 3KF5A 2YUEA 1I9RA 1OSGA 2QCSB 3E6CC 2XLFA 3ZMOA 5FOJB 1UPSA 4P9LA 4PIYA 4LO4B 4QPGB 3QLQA 2WT0A 4TYSA 1PVC3 1W3XA 3ZFEB 3NAPB 4EV0A 1Z78A 3F2ZA 4HT1T 4FPYA 4XC9A 4ZS3A 4AEDA 5FLHA 1W8TA 2J1RA 3WG4A 1JZ3A 1JYWA 2CU5A 3R0RA 1AJKA 3GALA 4DEVA 3VBUA 4Y24A 3C7FA 4NIIA 3GBGA 2R1BA 3VHPA 4LBNA 5EYXA 2DCTA 5K9YA 5FY1A 3I3MA 4ISRA 4NHMA 3WQ0A 1URXA 4YSFA 1ZBA3 4FPKA 4META 4QX1A 1WW5A 4QQ2A 2HWC1 1PVC2 2D6PA 3N35A 3HOBA 4UFKA 3D8CA 1GV9A 2JENA 4AHYA 1GZWB 4KMQA 1DYOA 1JOJA 1U5IA 2YHJA 5EP9A 3VHNA 1VBD3 1KFXL 1RUH1 1Y3TA 5GZFA 2P3KA 5FZDA 4DFSA 4N53C 1CESA 1HX6A 1SDWA 3JB8A 4WM8C 2CGOA 1UZWA 3C2UA 3WD5A 3WF2A 3B69A 2CDPA 2XLAA 4E4SA 4Y4RA 1ENXA 2VMHA 3AMHA 4AGGA 1DCSA 2WFPA 5FPXA 1PGL2 1NXD1 1OHFA 3IDAA 3CJIB 3WF3A 3K77A 2BDRA 4W65A 3AZXA 1XU2A 2AACA 2GN7A 3ST7A 4GJZA 3B7MA 4MV2A 3VZLA 3C7HA 4XPVA 3LF7A 2PHXA 4I3GA 3ZIWA 2AENA 3HNYM 4D7TA 2A71A 3AP4A 4PI0A 2WA3A 4HPKA 1DQ4A 3LIGA 3PJYA 2LS6A 4LXLA 3P3PA 1PNGA 2JE8A 1AX1A 4ISQA 2JICA 4I0BA 4LBOA 4N53A 5J7MA 4Q2FA 3BYWA 4PLNA 1F2NA 1EAH1 2WZPP 1AXKA 4GB31 4O9EA 4A3ZA 1COV2 2VNVA 2OVUA 3AXDA 4XFIA 3T4HB 3AP5A 3QH7A 4C1WA 4QXKA 3ZYRA 1W8HA 1JMUB 5T50A 4D6SA 4E4DX 1F35A 1ZZ9A 3USSA 5KC6A 5FZ4A 3ME2A 2Q0AA 2JDPA 3RYPA 5FLIA 1SHWB 2LRPA 1YQCA 4B7EA 3I2FA 5ABJC 1H0BA 1OLMA 1AYM3 4LJHA 2HEYF 5FK8A 1XQNA 3K4AA 3THDA 5IAXA 4P00B 4WM7B 1Q56A 2ATFA 4YM0A 2WSVA 3BVCA 1VBA1 3RMYA 1S0BA 3CZUA 4COYA 2GC0A 2BZDA 2RV9A 3AP9A 3RZHA 2DFCA 5FXVA 1AR62 2AREA 1QGLA 1BEV1 2EA7A 5IVCA 4FFFA 1AUYA 2YPJA 1KEXA 1ULFA 2ZGNA 3GBWA 3PVBB 4FOWA 2BQPA 4ZY9A 4C0HA 1A34A 2A6WA 1C8M3 4AEKA 4OYUA 1HIXA 2VZSA 3DPRC 5FYTA 3VUOA 2D6MA 2RDSA 1AYM2 2JE7A 2QKDA 3ZFGC 2Y6LA 1UOFA 4Y5TA 4BXFA 4FPGA 1RUE3 1NLRA 2WQ4A 5DG1A 5IK5A 4LA3A 5H9QA 5ABJA 4RGGA 4N9HA 4XFAA 4K8RB 3VHOA 4RR3C 4MGSA 2JG8C 3RDIA 2Z4FA 1PO11 2XL9A 4IW3A 5L73A 3VKLA 5I8YA 2NPIA 2R071 4CP9B 3JU9A 2O0OA 1GICA 4WZFA 1C8M2 4ASLA 2EXIA 4L11A 1OA4A 3AVSA 3WNPA 1SQ4A 3NRUA 3PTYA 4HN0A 5FKCA 4EN7B 2WC2A 5LBCA 5FYZA 5I8TA 1RUE2 2A75A 4OHZA 2VMFA 4OQ8A 3POIA 3DPRA 4Q4W1 3DXUA 4C91A 5IK8A 1U12A 3ZFGA 3LPFA 5CISA 1EUUA 2DBIA 4YM3A 4KQ7A 5FXWA 5GZDA 1O7FA 1LHVA 1YFXA 2D6OX 4JQRA 1XE0A 4OCTA 2KD7A 3ZXFA 3BTZA 3ZXJA 3R6SA 2ZAHA 5DAPA 5KHJA 1YJLA 2BUKA 1Q3EA 5FZCA 1CQ9A 4LIVA 1WW7A 3CO2A 4LHKA 4NMIA 5FP7A 4IE4A 5EZWA 1W0NA 1RUJ2 5A1LA 3HAGA 2HWF1 4JQTA 4O65A 1XNKA 4WM8B 1WW4A 2A5ZA 3IAPA 5A3PA 4CU8A 2GMEA 1UYPA 1HRI3 1MPXA 1W6PB 1STMA 4YG6A 4FOQA 3RJ2X 4EN6B 1H9PA 1JZ4A 2CTVA 4OQ9A 3AYAA 1W8NA 4V2WA 1IPJA 3ZXLA 1H6XA 1O4ZA 2GC2A 3KQ4B 3NMBA 2Y6HA 4RHV3 4QT6A 5FFOC 5LK5A 3ZIXA 3VB9A 5A1AA 3H9AA 1LHWA 1NZCA 1UY3A 4Y33A 2WINB 5LA0A 2Z79A 2VZRA 5FKBA 2C1FA 2OX0A 3L2HA 4QQLA 4FFGA 1MEC1 1H2LA 4L99A 4L2NA 4XIOA 5IYYA 1VB4A 5HBAA 5FUNA 2IZWA 4AAPA 4OHYA 1DGLA 1HRI2 1X50A 2JDMA 5IHRA 1HDKA 4BH9A 2VZUA 1S2BA 3I97A 1UYXA 5J96B 3IDBB 4AI3A 1I1EA 1DBNA 4FO9A 1YJKA 2E51A 2ZX2A 1OH3A 2UY8A 3JQWA 5E1RA 4YW3A 3VDAA 4YLZA 1AL22 4R9DA 2EAAA 2W08A 4RHV2 1CPMA 3HN1A 2VAUA 4QKDA 2YBPA 3N9NA 4GH4B 4FPLA 1MQTA 3PUSA 3N7JA 2QQPA 3ZN4A 1FV3A 1FPN1 5FYHA 3VDCA 3NO8A 1SG3A 4XXPA 2WS93 1ENSA 2VBDA 4Q8KA 3TOJA 5FO9B 3EBRA 4FBFA 5C6CA 4MGZE 2ARBA 4XHBA 3TEYA 3MIDA 2FMYA 2FDHA 4LOSA 3LWCA 5GLZA 4BLJA 1HQLA 1W8WA 4XJZA 1QJFA 5CG9A 5A1FA 1YYNA 4IESA 1VBC1 4JHTA 4QDRA 1VLNA 4NWVA 3LGRA 2QDRA 4JDMA 3JCIA 1S2KA 1XNAA 2JG9C 2DUQA 2B9UA 4F3JA 4ATFA 4QWNA 4NVPA 2A7AA 2P34A 5EIYB 2V4VA 2YGMA 2W9XA 3M3CA 2WS92 3HMYA 2A6YA 2I45A 2WT2A 4OUSA 2ARXA 1WCUA 3TN91 4NIGA 4RR3B 1CVNA 2BJSA 2FCTA 5FYUA 2JG8B 1NLQA 1T6BX 2PXJA 4IQPA 1WMXA 1RHI1 3HNBM 1X33A 4HVOA 2JIGA 1T6GC 4Q1PA 4WVMB 4JGYC 3BU7A 4ZZ5A 4Y1YA 5A6YA 4I0AA 3J9SA 4QAWA 1LHOA 3CLPA 2F4PA 5FY0A 2NMOA 5FZ7A 1LGNA 2VUCA 3MW4A 3JQXA 1JZ6A 2R041 2JG9A 4KBZA 2OQ6A 5CFDC 2ZEWA 5JDBA 5KC5A 2ET7A 1BLZA 2CDOA 4A3XA 2VR4A 5E16A 3FJSA 2CL2A 2Q8OA 4XBLA 1LGCA 3HBKA 4XF9A 2J1AA 1WA4A 3LA7A 3RI9A 2HWC3 3SKVA 1H1IA 2OKXA 1YLLA 5IUQA 4MHUA 4CRQA 1PGSA 3ZM8A 5E89A 4D7YA 1TVGA 3GXUA 4NHLA 1O8SA 4W6YA 1R081 2QBXA 5GM0A 5C9AB 1RUH3 3KV9A 1MS4A 1UX6A 2FBEA 2VW2A 3I8TA 1N3OA 2GP3A 1XOYA 3POGA 5FO8B 5FMBA 1O3RA 4Q4V2 2WSUA 5JWPA 2ZX1A 4A7YA 1BQPA 1NCRC 5CFDA 4D0QA 4KH9A 1A78A 4XZUG 5T5OA 2XVLA 2DWRA 2Z5WA 2OYZA 1REFA 5A6ZA 5JAXA 3FLPA 1JYCA 2RDQA 3ACHA 1CONA 1REEA 1RUH2 1VIWB 1Y43B 4ZXEA 3WOGA 2D3SA 1NT0A 2D7FA 3GDBA 1YFWA 3OG2A 1HKDA 2ZEYA 5BYNA 2DCYA 2P1BA 2VCBA 3U4XA 3DCQA 3KM5A 4HSLA 5T5JA 4Q0PA 5M0TA 2FDIA 3NNFA 4FTEA 1OOPA 4JGZA 4GB33 2BOIA 3IKWA 2F6BA 3FX3A 4ATEA 4ZKTB 1NCRA 1ZZ8A 2SLIA 2WKKA 2Q8EA 3POJA 2VZTA 4Y4YA 5FOBB 4FSJA 4DZGA 1DQ1A 1XC6A 2J42A 2HJIA 3CJXA 4I0WB 1OMIA 3WNKA 1LOEA 4RQPB 2RMU1 5FREA 1G9AA 3SCGA 2XR4A 2FZ1A 1HQNA 2VXRA 4IDZA 5IAVA 3ACFA 4BMBA 3VBOC 4LK7A 1OLQA 4GJYA 2I74A 1YO8A 1RUG2 1M06G 4TXWA 4C0BA 2VG9A 3LSDA 3TNPB 1E5RA 2JWPA 2ZX4A 5ACA2 2QQNA 2ZHMA 1BEV3 2W94A 1CGPA 2E9QA 3UGFA 2JB4A 2IXJA 4DO0A 4R8HA 5A70A 3TEXA 1LR5A 3N9PA 1US3A 3R4UA 4CDUB 4Y1ZA 3H8XA 4QM9A 3ZXDA 5CNAA 1B09A 1MR5A 1K5MC 1X36A 3AK0A 5E6HA 4CPBA 4N90A 1CAWA 2VL4A 2XVGA 1PVC1 4A42A 4YNIA 2W1QA 1X8EA 2XJQA 4HKOA 1ACCA 1S0FA 3VBOA 2VQUA 2X09A 4KBBA 4B8EA 2W46A 2ZBJA 3HQUA 4UF0A 1BEV2 1J1TA 2KXLA 1SLCA 4QX5A 4COWA 3WUCA 2R073 3S5AA 4B4PA 2D97A 1XBFA 1ENQA 1NZIA 1VB2A 4GWJA 4IEVA 3ZX7A 4IE6A 4MGTA 2P3JA 3JB4C 2XUMA 4BDVB 5D1IA 1I5ZA 5FZ6A 3NNLA 3ES1A 1PGL1 3RYKA 1KQRA 4Q4W3 2WNVC 1LGBA 5FWEA 3HBZA 1K5MA 4Q0VA 4CU6A 3NV2A 1TEIA 3BTYA 3V56A 4AI1A 2A1XA 4HETA 1F15A 1QHDA 3W59A 3ES4A 1VJ2A 2AH2A 4FP3A 4HKLA 4MO3M 2DCZA 4JKMA 2VW0A 4E4HA 5L9VA 2OW4A 2BPA2 5FZ9A 1CZVA 4BOWA 2K46A 3CZJA 3KF3A 1LODA 4XXAA 1O4TA 2HWF3 4RA0A 4HVQA 1UWWA 4RFRB 4Q4W2 1COV1 2WQZC 2WFF3 4M3CA 4Y1XA 5J36A 4HXCA 2G19A 4XE9A 1YQ5A 4FPOB 2MEV1 2JKXA 4N7IA 3MV11 2W1SA 4KGGA 3VGIA 4AVCA 2WNVA 4NR1A 3LOBA 5CBLA 1H2NA 4K21A 3OEAA 2H6CA 2PN5A 2ZEZA 4IEPA 3I2JA 1NCQB 4PIZA 5CEHA 1H1MA 2R1DA 3HT1A 3K3OA 1D0GA 3SLIA 5JZGC 1OVSA 2JDUA 2QQMA 5IW0A 5K0UC 1MEC3 5KXCA 1LHNA 2SBAA 1FMD1 3D5OA 3POYA 1JYVA 2WFF2 5F3CA 5JSOA 3MFCA 4AEMA 2A3WA 2EXHA 4JX0A 3ELNA 1O59A 4QPIC 1AR61 4KI5M 1JZ7A 2B39A 1JYIA 2JDKA 2AC1A 3LPGA 5LRSA 4OZOA 5A3MA 4YW1A 2VXJA 2DVAA 2PHWA 3OGRA 5GALA 5A80A 4LE3A 3SQOA 1GOGA 3AP7A 1GNZA 3QH6A 4YZ3A 1CN1A 1ULOA 3UK9A 2VQAA 1LOFC 1OD5A 1MEC2 2VD7A 3PUAA 5CFCA 2ZZJA 2ORXA 3L2YA 1DGWX 1EV12 1Q8OA 2KA3A 4KWJA 5DUWA 5C3QA 1YI9A 4K6BA 3OGJA 1YFUA 1FPN3 4Y26A 1WLWA 5K0UA 2PHFA 5LBFA 1UXXX 3GM8A 3PU3A 1QOTA 4Q4X3 3ZYHA 3UYJA 3ZFFA 2JE9A 5CKMA 3WNXA 5JOZA 2YBSA 1UMZA 1W28A 3WG3A 5I8SA 4L8QA 5FPUA 3KQRA 1C8M1 1RC6A 2VMCA 4NHKA 5SV8A 1JN2P 4X8PA 3U11A 4PBPA 1UOBA 5FUIA 2JX9A 2NN8A 4EZHA 3O1PA 1LTEA 1OUSA 3B3QE 4GZ9A 1PO21 1ST8A 2DUPA 4PI2A 5FUPA 1LOFA 1NG0A 2HH9A 4QGNA 3VBHB 3VL8A 4AW7A 1CD3G 3B94A 4Q4X2 3WLUA 4QB6A 4NOTA 4WV8A 2Y8KA 4NAMA 5I0RA 3VBSA 1D2QA 1TMF1 1ZRIA 2OUJA 2GP5A 2VOWA 4TN7A 4BQ1A 2VNOA 5IJRA 3TN93 3WQ1A 3ZYBA 1QU0A 1VMJA 5H9SA 1LHUA 2IC1A 4HFSA 4RGKA 1DDLA 4B7KA 2W39A 3BKZA 1JBCA 4AQ2A 1CAVA 1W2UA 1RHI3 3M3QA 1XNDA 2WN3A 3SHRA 5I91A 4LITA 1D4VB 1RUJ1 5T3NA 1WLCA 4C1XA 1YIPA 1UD1A 1J84A 2V73A 1VALA 2ARAA 4XF1A 3RPQA 3KT4A 5BNNB 2ZHLA 1NA1B 2R043 2WT1A 3BI3A 1XE7A 2IXKA 1H8TC 4GXLA 1W9WA 5A33A 3N7MA 1UIKA 4LPLA 3TN92 1ZA7A 3ZSJA 4COVA 5CIRA 5DUUA 4QGMA 1LEDA 1GWLA 4ZHNA 1ZA4A 2BTVC 4YZ4A 4CP2A 3LQCA 3AB0A 5FPLA 3POBA 1ZRFA 1HB4A 5DZGA 1ENRA 1XXNA 2VMGA 4QX7A 3RWNA 1SLIA 5IVVA 1E57A 2DVGA 1IS3A 2ENRA 5FPAA 2C26A 5LBBA 4CCOA 1CX1A 3ZN6A 3VD9A 2A6XA 4AFBA 1SLTA 3RZKA 2XQXA 3BN6A 1UY4A 4Q0UA 4P9WA 1AXZA 1OT5A 3K4ZA 3MICA 4ARXA 4DY5A 4CXYA 1MVQA 4A4AA 1BK1A 3VBRB 1AL21 3AMPA 3CDZB 3GF6A 3T4VA 4DB5A 3MF6A 3DECA 3NAPA 4KL1A 3POSA 4ASMB 5JOYA 4LNVA 1FI2A 3RQ0A 5FZOB 2J1EA 2WWUA 1IG3A 1RUC2 4C90A 2TNFA 2FD8A 5F2WA 2X5IB 1W0PA 2B9VA 1JXNA 2WABA 1N1SA 3ACLA 3AZVA 3MIHA 2PELA 1S2EA 2B7YA 4RL7A 3VLBB 3LDKA 3ATGA 4CDXB 3HD8B 2C9KA 5F3IA 1QOOA 1YWKA 4AFCA 1ND3A 5FYCA 3MIEA 4IV3C 4XMIA 1G86A 4PLMA 3LEMA 5T5LA 4COZA 2DV9A 4AWDA 3J7HA 3DXTA 1GZWA 1V6JA 4QD2A 2XUEA 2H6BA 3I59A 2WAOA 3EMRA 1W2AX 3WCRA 1GU3A 2PQQA 1OF4A 5GLVA 3ON7A 4XUOA 1W6OA 1ONAA 4XDQA 4QU2A 5L7OB 1FT9A 5D21A 2QQUA 3U4SA 2NQYA 3FLTA 5FAXA 4OHVA 1TQ5A 3DEMA 4W6WA 4XILA 5FTTC 5FZLA 1NX9A 1OC1A 3KWVA 3HR9A 1DZQA 4QHOA 5FCCA 1BCXA 4WBBA 2Z42A 1C57A 1S0CA 1D7PM 4D8MA 4ES8A 1FV2A 1LKNA 1V6KA 4LBKA 1YRZA 3D3AA 4LUKA 1ULPA 4JVAA 4AVAA 3IN9A 5DAQA 1WMDA 1Q8QA 5A3UA 3PMEA 2VVEA 3RNSA 3H8UA 3DUIA 4KWLA 1LOCA 3D82A 2ILMA 4PF1A 4QQPA 4UFIA 4MZUA 4BPZA 1F4AA 4YFZA 2PHUA 3M2MA 1OVPA 2QFEA 3H1WA 4RGAA 5I93A 4QKBA 3PVEA 4YGCA 3AP6A 3OYWA 4P02B 1QMJA 1SCRA 4BU2A 3E5QA 2BBVA 1Q8SA 3VV1A 1V00A 5J98B 1ZYBA 4ASKA 1UNBA 3KHBA 3SXWA 1J1LA 5FYYA 1BHGA 3M3IA 4Q4V1 4R52A 3ZMNA 1GP4A 3B93A 2G4IA 5CADA 2XJUA 5HV0A 2VMIA 1XSRA 4AFDA 2B8MA 1E5HA 1EUTA 3GBFA 3NV1A 5LCWL 1UMHA 2GNBA 3I2DA 4OULA 1WGPA 1B35A 4LBQA 2PHDA 4PQQA 3USUB 3OF1A 1XNBA 2YU1A 5GJ6A 3VDDB 1REDA 5C4WB 4YW2A 2ZGOA 4HK8A 3UV9A 5A7SA 3W21A 4LORA 1SBDA 1YXWA 3POWA 4DNYA 3CKHA 5FPZA 4DIQA 4EN8B 5JI9A 3VDBA 1BYHA 1GANA 1WMEA 4LE4A 4XJ8A 1SPPB 4Y3OA 3ZYIB 3AKTA 5A7OA 1COV3 1R092 4I3PA 4LEJA 2MEV3 2XXZA 1YIFA 3VD4A 2JD9A 4IE5A 4ES9A 3KB5A 1UU5A 2WZEA 3ZYGA 1RMU3 2HLEA 4OI2A 3J7LA 4Q26A 1DFQA 2ZA9A 3JUUA 4FPHA 5D8AB 3V0AB 2BBAA 5FY9A 4HN1A 1PK6C 4UFLA 3RG0A 3ZXGA 2V72A 3H50A 4EYUA 1HRV3 2PAMA 3ACIA 1FMD3 4PDWA 2NMNA 3KMHA 2VCCA 3D6EA 4DXRA 3LKJA 1H9WA 3OY8B 3QOPA 1X7NA 3KT7A 3J26N 4HSJA 4IEZA 2FMDA 1RUG1 4CEYC 4F8AA 1XPWA 2MEV2 4NPRA 5ACA1 1AR63 4EWDA 1IQDC 4BQXA 1RMU2 3IPVA 3AKSA 4JDOA 2Q5TA 4QX8A 1GP5A 1JU4A 1PIV1 3N36A 4RS5B 1FXZA 2Z69A 4XDOA 5BXXA 2HBTA 4CU9A 5CKNA 1PNFA 2PTMA 5F5IA 2C9AA 3FE5A 3FC0A 5K7PA 2GH2A 4BHPA 1JYXA 1HRV2 1FMD2 2VQ0A 3NNJA 1I6XA 1WA6X 4V1PA 3UESA 3I2IA 3I2OA 1PK6A 4JKLA 2D6KA 2NP0A 5DUXA 1W6PA 2WZ8A 3SISA 4NN0A 5IK7A 4AEDB 2WZR1 1QDCA 5T54A 5FIXA 1Y4WA 3B02A 2MNGA 3B00A 2VVDA 3LFMA 4CEYA 4NPMA 4XQDA 4E2QA 3L9JT 1OXCA 4KG8A 5LASA 3SH4A 1PVXA 3AC0A 3VBUB 4CVUA 3JZVA 5F1RA 3T2QA 2VM9A 2W47A 1YNAA 4QGLA 2ID4A 1GBGA 4XW3A 3MPBA 1HJFA 2XLGA 5C3RA 1ZRDA 2W1UA 2CSGA 1KDMA 4K40A 5HXMA 4XBQA 5BNOB 1NKGA 1W0OA 3INAA 5FRAA 1X9TA 3MPPG 3MLJA 4FPCA 1PO23 1RL3A 3IM0A 2GNDA 3OUHA 5C8WA 1W6QA 2TBVA 2QZ3A 4DQAA 1FATA 2J1TA 1W6MA 2EIDA 1IS6A 1BXHA 1TMF3 4ZS2A 2VU9A 3FBYA 3ETQA 3H3UA 4XOGA 1LOAA 1QJX1 1MZFA 3JBG1 4XUNA 4I30A 1WCKA 3ENRA 4GULA 1VMFA 2PHLA 1QNWA 2VGDA 2H0VA 3N3HA 3PU8A 4GH4A 5K8SA 1JOPA 1RUJ3 4BIOA 2XL7A 2Y64A 3GCWA 1YFYA 3B9IA 5L9BA 4JDNA 1LECA 4GWNA 1PO22 3KZ4C 4NO4A 1JYNA 4M3CE 1MVEA 2BGCA 4MVTA 2OA2A 2FCUA 5A7WB 2P37A 4DRVA 1AZDA 4CUCA 3VKFC 1TMF2 2XHKA 2E32A 1HN0A 1AL0G 4INDA 4D94A 2TUNA 3SMHA 5KBFA 3TB0A 1UO9A 1JUIA 1W90A 3RGBA 3KD4A 4GKXA 4EN9B 4HPKB 4HVRA 1MS8A 1H30A 1XSQA 4CDWC 1MS5A 1HB1A 3IBMA 5CU1A 5ANNA 5APAA 3O0XA 1NOVA 3ILRA 4N53B 3WW2A 4SLIA 1CJPA 2VMDA 1F31A 2QZ2A 2WFF1 4R4XA 2NLRA 2RMU3 5EPAA 1KRIA 4YGDA 4OI0A 5FP8A 1LU2A 3VL9A 3WSOA 4QQHA 3WNLA 4CCKA 1AYN1 1ND2C 3MIBA 4GWMA 4U36A 1SMVA 1L7QA 2GC1A 3WEZA 5KXBA 4WVWA 3RYRA 1FX5A 4XDPA 4CUAA 1AL23 2LALA 4YM2A 1MQTC 4BLIA 1C28A 2D98A 1H4HA 1G7YA 3TBDA 3IB3A 4JZRA 2WNEA 1RXFA 1DGRN 3NW4A 1SCSA 1EV11 1HW5A 1KS4A 2C5DA 2OQ7A 4TLGA 3WF0A 1PZ7A 4CDWA 3POFA 1CAXB 4K1YA 5F7UA 2LM3A 1PHMA 4GA9A 2ADEA 1L7RA 4LO8A 1R1A1 1YC61 3ETPA 3Q8BA 1NQJA 3K48A 3KVBA 4UBGA 5C70A 2HEVF 3VKOA 4KWKA 4F7ZA 1ND2A 1UIJA 1MS3A 1NUKA 5A3WA 1QQP1 2VOKA 5EFUA 3WXPA 2UYAA 5IVYA 4CCCA 1GLHA 1D4M2 5FZKA 2XKOA 3WT3A 3LEKA 4SBVA 5FPBA 1HV1A 1S4CA 5E8AA 3FZ3A 5ABJB 2PFWA 4O9GA 2RVAA 4Q4X1 1C5HA 1F8VA 1GFF2 1N47A 3T1LA 2VY0A 3CBNA 3H8RA 5GZGA 1YI7A 2W95A 3OCPA 5KXDA 3R05A 5AVAA 2VH9A 3GNEA 3T0DA 3T0BA 4QXHA 1P8JA 2AEZA 4PHZA 4Q4Y3 2CAUA 2YFUA 2JEMA 5JXIA 3AFKA 3I2HA 3GYDA 4AZZA 4DXTA 4LKFA 1JODA 5C7GA 5LWBA 3DPRB 1KITA 5LZ6A 5T52A 4QDSA 3ZFGB 3E97A 2RS51 3EQEA 5FZGA 1FNYA 3KSCA 1HV0A 5JPMB 2R062 5BNPC 1YCIA 5JLVA 1ZNPA 2RR13 3LE0A 1N3QA 3K51A 4IERA 1W6NB 3N7KA 4HG6B 3HN3A 4Q4Y2 2LUWA 1PGW2 1VRH3 4LMFA 3VBFA 1Q8VA 2C0ZA 1BJQA 2R49A 4P14A 1BZWA 4BMEA 1LRHA 3E5UA 1POQA 4Y5SA 1RIRA 5DAWA 1QWRA 3CNAA 2DVDA 4ITCA 4RQPA 3ZXKA 4PJYA 5LA9A 3M1HA 1ZREA 4ONUA 1YEWA 4Q4V3 1LB2A 1JHJA 2EICA 2HBUA 2RR12 4K9SA 1OA2A 4MXWA 2JDAA 1WWYA 3MUZ1 3T08A 5C3OA 4OVEA 3BALA 4IUGA 5BNPA 1VRH2 5IVBA 1ULDA 1RUC1 1SEFA 1UQXA 3UJQA 4QHZA 3D0SA 3T2TA 2PHRA 3LA2A 4BQ2A 4BIFA 5DN2A 2TEPA 4MGIE 4CDUA 2VZOA 1UL9A 2DTWA 3PMSA 1VAMA 1OOPC 1CJDA 3GZUC 4JGZC 1PMIA 1QF3A 4ORFA 1AR71 4X6QB 1UZZA 1GQHA 1UU6A 3HJRA 3FHQA 4B1LA 1YQ2A 3C8XA 3OSDA 5FZIA 4CDQA 3FL7A 5LRRA 3T09A 2PAKA 4IEOA 2J1UA 2BNNA 4OHXA 5JIUA 4DOUA 5G05L 4QXBA 1IHMA 4UW3A 5A32A 2BGOA 3J7NA 1W2OA 3TYJA 3GHNA 4GKYA 3O1TA 3EXUA 3KCXA 5DUVA 3H3LA 3LSEA 3W5MA 4LLOA 3ZR5A 4JC1A 1O6UA 4YARA 4JTNA 4LKDA 1DQ0A 1K3IA 1V9U2 2GSYA 3AMNA 1GYKA 4NJ4A 5DQ0A 4D7SA 5IFTA 2WRAA 4Y5Z0 2IXCA 3J8F1 1CAUA 1W04A 3BOWA 2VTFA 1YHFA 1OI6A 4PIXA 1H8VA 4XFGA 3WQ7A 2R7EB 3VHRA 1RUG3 3DYPA 4LHSA 5ACA3 4K20A 1GOFA 2EIEA 1FAYA 1QJZA 2XWJB 1QXRA 4EZ4A 2ZKNA 1PIV3 1DZTA 1ULEA 1VPHA 4Y22A 2FDFA 4M3CF 4BCUA 2PLV2 1S0GA 2X53S 1QIQA 4JV4A 4OFGA 2WO1A 2VBPA 3GZEA 1RGSA 5AFBA 1Q43A 2YBKA 3KCCA 5LA2A 2CNAA 2GC3A 2VVFA 4Q0QA 2X05A 1Y9GA 4D69A 1BMV2 3D0JA 4FPEA 5A3OA 5F3EA 3ILFA 4IXLA 4XABA 4FFHA 4MX3A 4B3NA 4B4QA 1FOD2 2WZR3 4DXSA 3FWEA 3S0MA 2OXBA 3VZNA 4Z2AA 3P1IA 4QQOA 5JMCA 2WIIB 5FZMA 2Y6KA 2VC9A 5BUVA 5I0TA 1PIV2 4B4RA 3UT0A 2RS12 2JG9B 1HN1A 2XBO2 4I02A 4Y1UA 5ERLA 3CEWA 2RE9A 3O1OA 2XJRA 3RJRA 2E6VA 1RUF2 2P6HA 2KM2A 4ZONA 5KHHA 4R9BA 3EYPA 2VNRA 3DYOA 1WMFA 3A7QA 1ULGA 1VR3A 5HI0A 4EROA 2WZR2 2ZGMA 1VMHA 3WG1A 1JZ5A 3ORJA 1VBE3 1RJ8A 2XPJA 2DF7A 1UU4A 2HYXA 5C8CC 1GOHA 4JGYB 3HWJA 3O1UA 1QJX3 2BW8A 4LULA 3JBG3 4KU7A 1DG6A 2Y0IA 3WG2A 2YZ4A 3LDRA 5AC93 3EB7A 1W2NA 4H7MA 2B4KA 3FBMA 2GU9A 3H1MA 1G9CA 5F5CA 1W9SA 2FCVA 1OURA 5CFDB 2VULA 2VZPA 3ZSEA 4LHNA 2D6NA 1FNZA 1RB8G 3EHKA 1R091 5I0UA 5AFEA 1IOAA 1JZ8A 1J59A 2XJTA 2RS32 5F5AA 3WX5A 1VE0A 5F32A 4XYXA 1JOBA 1BVP1 1D0HA 1W9FA 1VBE2 2JECA 1I5PA 4IL7A 4HK9A 2IXIA 3FN9A 4MOAA 4Z92B 2JDNA 3CQOA 3KT1A 1A3KA 3M3OA 1QJX2 3AMMA 1O5LA 3JBG2 2DFBA 1UCXA 4FXKB 4UFJA 3U1XA 4DXZA 4YZ1A 5AC92 3VN4A 4CEWA 4RD7A 2RDRA 1SBEA 1ZBE1 3AYDA 4N43C 5C8CA 4AQTA 4QB2A 3AL5A 2R0FA 3RWKX 4CCEA 1XU1A 3BU0A 3VBHA 3UNPA 3PL0A 1RJ7A 2WNUC 4P5YA 1PM4A 2Y6GA 5A3TA 1L7LA 4BISA 1NCRB 1US2A 3ECQA 4JAAA 3BIWE 1AYN3 4PBOA 5A7PA 3HIFA 2BERA 4UFMA 1WUVA 3O12A 4ZU5A 1NQDA 1RMU1 3B5LB 3BB6A 5CFCC 4AOCA 2UWAA 1K42A 1NYWA 1BVVA 1W05A 2UURA 3AJYA 4QU1A 2P17A 3JD73 3NV4A 5FZBA 3VZOA 1OLME 3PURA 1HRV1 1EV13 2VTXA 3DYMA 5FBJA 3ZFFC 4YVWC 4QPWA 1E5SA 1NA1A 4N43A 3A0KA 1S0IA 3FHIB 2D40A 2ZGRA 2UY9A 1AYN2 4IEQA 2VUAA 4FQZA 1SACA 2R32A 4CE8A 1EPWA 3N4MA 2CWMA 1R1A3 1HQWA 2WNUA 5K4LA 3T2OA 1WCSA 5L36A 1JH5A 4BJ0A 4PLOA 3W58A 5FDBA 2IXHA 5EJ1B 3ZYFA 2XHNA 3JD72 1QQP3 2WA4A 4RFT0 4CCJA 4BQ3A 3AL6A 3WINE 5FK7A 2P3IA 4O61A 3MYXA 1N3PA 4XJAA 4AI8A 4N8MA 4PQ9A 3VBSC 3VD7A 2XOMA 1MZEA 2UYBA 5IATA 3C7EA 4AHWA 2OPKA 3ZN5A 1OQEA 3VBOB 3OEBA 4YGEA 4COUA 5DPNA 2PMWB 3MBWA 4PF5A 3IDCB 4YM1A 4YVWA 3O14A 4FAHA 1R1A2 5HCBA 1IPSA 3PIJA 3BUCA 5JUVA 1JU3A 3LDBA 2VUDA 1C8NA 2HKXA 4AGVA 4CXWA 4NIDA 1GP6A 2HWB3 4I09A 4YW5A 2RJ2A 2ZGSA 1G9FA 1QQP2 3K46A 2YC2A 5FWJA 3SNMA 3WDXA 4IETA 3DN7A 4H3WA 4IV1C 4N7UA 2QDNA 2X5IA 4N9IA 5C5UA 2XQRA 3EJKA 3M4FA 4CUGA 2BVVA 1IKQA 4UAPA 4OI4A 1K5MB 2W91A 3D4KA 4J1XA 1NAEA 2VJXA 2RS53 4YVSA 1RYYA 1S0JA 1HXS2 3J4UH 1NY72 3K75B 4H55A 4TWTA 3RMXA 3UKTA 4URAA 5FQ0A 4CDXA 4IEXA 3NWKA 2QQLA 4MGQA 1YUDA 3AJZA 3MW2A 5IK4A 2HWB2 3WW1A 5LB6A 3VD3A 2XONA 1H1AA 2N7GA 3CL1A 4QMAA 5E88A 1RUI2 2CGNA 1U0AA 4CSWA 1F9KA 2EAKA 4OUEA 3WDVA 4M3CB 4BA6A 3AYEA 4IV1A 5JXJA 1OQDA 4QPGC 2QVSB 2RS52 2G9GA 2GAUA 1LENA 4IGPA 4TSVA 3NAPC 4Y20B 4UOJA 5JIAA 4K1ZA 4NAOA 3M70A 5JPNB 1ZX5A 2WNVB 3AYCA 4FXGB 5FYSA 2VUJA 1AF9A 5J09A 4AAXA 2B5HA 2DCKA 2JB8A 5KHIA 3NJZA 2LW8A 3AZYA 2VMEA 3UGHA 4YFWA 3U10A 1KD7A 3MIFA 4XEZA 3NJYA 3E6DA 4MGYE 1RUC3 3OPWA 3RZLA 1GQPA 4KG0A 2QQKA 4W4ZA 2ZCWA 2Q1ZB 1H4GA 2PYTA 3RI8A 1Y9QA 3UGGA 5CG8A 3H3ZA 3MV01 1V6LA 3QACA 4FPFA 3RRDA 1ND3C 2W68A 1AR73 4BE3A 1WD3A 5FXXA 2E7QA 2VZ1A 2PAEA 1XE8A 2H0BA 3K3NA 2Y6FA 4HKWA 1ODMA 4QPGA 1X82A 3ZFEA 2AGSA 4LK6A 1GKBA 4Z8BA 3CIHA 4LT5A 2CV6A 4LQRA 2GH8A 1A6CA 3WP6A 5CFCB 1FYUA 1V6NA 1DLCA 1D4M1 4AQSA 1BBT2 2IXLA 4XAEA 5GLUA 5JZGB 3ABZA 1DLLA 1LULA 5HCAA 2QUOA 1GUIA 5A7NA 5K0UB 5CKQA 1V6MA 5LA1A 1AR72 4AK3A 4QX2A 3ZFFB 4DY3A 3J8F3 5CAZA 3NNGA 4LLFA 3SC7X 1LCLA 3SITA 2ZOEB 2AEYA 4QPIB 1ZZCA 2CY6A 2VW1A 4BK4A 2DU1A 4MG2A 3SCHA 4FCAA 4QX0A 3DL3A 4S2GA 3SEEA 5C4WA 3S5QA 2QQWA 4XFBA 2GN3A 5IWFA 3NSTA 3APBA 2G1MA 4UXAA 1RINA 1W03A 1XB9A 4DMIA 3J8F2 1OQ1A 3PNAA 4YZ5A 2R061 1O5UA 1SPPA 2YU2A 3ILNA 3LB9A 2QNKA 3CJIA 3I7DA 3WDUA 4IEWA 2ZGLA 2FDKA 1CAVB 1S0EA 4HOOA 4Q4Y1 5FY8A 1PGW1 1CPNA 5F8PA 4BZ4A 3T1MA 5F2SA 2FDJA 4DINB 1RVF1 1U5YA 3MZHA 1MZ5A 1J3QA 5GLTA 5D2AA 4K7JA 4LBLA 4DPNA 3V0AA 3M8LA 4WM7C 2UWBA 4DUXA 5JVVA 2XB6C 2PA7A 4NRQA 5A33B 4UT5A 5L7OA 1WW6A 2WNOA 4YPJA 2RR11 1XJAA 1ASJ2 4V2VA 5F6KA 4DS0A 3BIEA 2R0HA 4AVTA 3ACGA 3OY8A 4LBQD 1B35C 1UYYA 3FUOA 5C5TA 1CWPA 1SFYA 3S30A 4OHWA 1VRH1 3MGUA 4DEQA 5FYBA 1C4RA 4M0HA 1PZ9A 3GZAA 4BYYA 1O4YA 3HT2A 5HXVA 4MUVA 5KXEA 3AXEA 2HWD3 2R16A 4O7XA 4LA2A 1ZRRA 4M4RA 4RS5A 4XURA 1W06A 2QQJA 3V0BB 4AEJA 1DGRA 2YFZA 1AR81 1XRUA 4UI9L 3T30A 2Q8CA 3MLLA 1HLCA 4WVZA 3ZO0B 4BM8A 3BTXA 1AXYA 1ZZ7A 1I3HA 3LA3A 4WM7A 4JRAA 1H8TB 2WL1A 5LY2A 1VP6A 3O0WA 1R093 2ARCA 1GMMA 1H2MA 5EXOA 4A2UA 5CZKA 4A6SA 2JD4A 4XF4A 4AI9A 4XTPA 4B1MA 3O1MA 2BU9A 2WO3A 1GZCA 1SLBA 2ZGPA 4JKKA 4L0PA 2HWD2 4M00A 2X10A 1WLDA 4GIQA 2DVBA 2V4AA 3BPZA 3VKNA 3TEWA 2VNGA 4PDWC 5JOWA 1V9U1 1JHNA 5HCHA 1W9YA 1RUNA 3W9AA 2HWE1 1ZBE3 4RSUA 5BNOA 2AZ5A 4MXVA 1TNFA 3IMNA 2ZX3A 4CZSA 1K5JA 1ND3B 2DYCA 2ETEA 1G6NA 2F4LA 2KR2A 3AKRA 3R4DB 4HZFA 4P9YA 4ZZ8A 5J48A 1V6OA 2PQSA 2IFRA 1OD3A 4P9JA 1LAJA 1WLTA 2QE3A 1LOBA 4Z07A 2ZHKA 1HJGA 3AFGA 2QJVA 1CZSA 4IGOA 1KJRA 3I59B 3PHMA 2BP6A 4UW6A 4AVBA 4CP9A 5DAVA 2DTYA 4OZXA 5DZEA 1W6OB 3S7IA 2PLV1 1UXZA 1LESA 1RTVA 1ZBE2 3VZKA 3NNMA 4XF0A 4ET7A 1ZBA2 4XF3A 5DXDA 5H9PA 2ZXQA 1BMV1 2QQIA 1POV3 5A7WA 1XYPA 1FOD1 3PUQA 4LO6B 4Q1RA 2QQOA 5DDJ1 2D3RA 3EO6A 4P08A 2G9FA 1VBD2 2ZGKA 4IV3B 5FZAA 3ZDSA 2YV8A 1UY2A 4GAZA 2E7TA 1V0AA 2RS11 5JR7B 2JDZA 2XBO1 3WDWA 1CZTA 3MO4A 4URTA 2K0GA 4P9GA 2W92A 5HV4A 1CIWA 3FUQA 2IUWA 3IAQA 5DZFA 1RUF1 3U75A 5DG2A 3WUDA 4FAGA 1Z7S3 1OLRA 2WYSA 4WM8A 5F39A 4AVSA 3OPTA 2W87A 4JHZA 4ZPIA 3I3BA 4KWUA 5F6LB 2XGXA 1VBB1 3P3NA 3NKTA 4AI0A 2ZGTA 1Q5OA 5CA6A 4OMDA 3A22A 2CGPA 1ALYA 4YGBA 3WHUA 2DURA 4H7LA 4IEYA 4KNCA 3OYWB 1NXMA 3PLQA 4GH4C 3PTRB 1JI6A 1GWMA 2BGPA 3WY6A 4L9BA 3KS7A 3PVOA 2ZHNA 4NRPA 2CHHA 1H2KA 1W39A 1WZXA 5FPVA 3K4DA 4AE2A 1LU1A 2Y0OA 1Z7S2 2RJLA 4AR2A 3N9MA 2XH6A 5AVPA 3N9LA 5J1XA 3ZR6A 3N9OA 4LBMA 2WUHA 2YYOA 3KV6A 5FO7B 1RUD3 2HYKA 3IDEA 1CAXA 5FJKA 5FP4A 2RS31 4CTEA 5JSPA 3LAGA 2BFUS 5A3NA 4GQ7A 2WDBA 4LO7A 2YC4A 5CB7A 3KGLA 1OUXA 4E27A 3THPA 1VBE1 1B35B 2Y26A 4LBQB 2VZVA 5FMOS 2WO2A 4D6RA 1JYTA 1QJEA 2ORZA 2B42B 2GDFA 2W2IA 1MACA 4XHXA 5AC91 4K3UA 1AVBA 1A8DA 1YQ8A 4EN0A 5B4NA 2Q4SA 1EY2A 3NQHA 2VOTA 3OGSA 4YG3A 4Z1VA 2EIGA 2XG3A 1SDDB 3MFAA 4X8NA 3OTFA 1GZTA 5FP3A 2BFUL 4LO5B 5JXGA 1QXJA 3ZYJB 1RUD2 2WWJA 4WVVA 3LOIA 5FY7A 4AQ6A 4XIKA 5FMOL 2ES3A 3I2KA 5LY1A 4EWEA 2DBNA 2NM1A 3KV4A 3OGGA 2BEOA 3ZOIA 1HB3A 3I2GA 1SFNA 1DQ2A 3WF1A 5LW9A 1K12A 3H42B 3HNMA 3BGAA 4Q0SA 1H6YA 1BKZA 2R30A 2CYFA 1NLSA 3ZKYA 4DRRA 4ZU4A 2OZ6A 4ZU7A 4PDWB 2E7AA 2PHTA 2D93A 2UU8A 2JXAA 2Y6JA 2D5HA 2UWCA 2BWAA 2Z2SB 3A0NA 3E5XA 3WHTA 4A7KA 4P9XA 3Q8CA 5DAXA 1J3RA 2MPFA 4UW4A 5A6XA 4G9SB 2A3YA 4E9KA 3SEPA 1KS5A 3IPVB 5JR2A 1LJ7A 4RR3A 2JG8A 4XTMA 1W6NA 1YQ6A 3A21A 4P5HA 5JOXA 3W5NA 1GQGA 3MI8A 4FOVA 4IEUA 4RN5A 1W8ZA 3JD71 3WP3A 5C9AC 1QJY1 2ZPXA 5IFPA 4WVMA 1JTZX 3AZWA 5GKAC 1PX3A 1XNTA 5I0DA 3UKNA 3B9CA 1D4M3 4Q27A 1U5XA 1UMIA 3I49A 2OUHA 1PK6B 1VAKA 4BQYA 3RZGA 4R4ZA 5F9TA 4CUBA 2E26A 1WBFA 2ZTNA 4MADA 5JCTA 4FOYA 5FZ3A 2L9LA 2OPWA 1WBLA 1QKQA 1ULCA 1UOGA 2Y60A 3N7LA 3OD0A 4J1WA 4CEYB 2BWCA 2BV4A 1XNCA 2Y34A 1Y9MA 1BK0A 3Q9OA 1V6IA 2IVJA 1TNRA 3SCFA 2CWSA 4BQ5A 2E31A 5I0SA 2ZMKA 5LK7B 2YMZA 5C9AA 1QY4A 4Z82A 1AHSA 3OBAA 5HCFA 1OPOA 3N9QA 4A41A 2YB7A 3M7AA 4KU8A 1W6QB 2WAAA 2V5YA 1HXS1 1NY71 1W6MB 1APNA 4UFHA 2R063 2VCMA 1KDKA 2DVFA 2GALA 2RM23 2WYFA 3VBFC 4LKEA 3T0AA 4ARYA 1AX2A 2C4XA 2RJKA 2HWB1 1A8MA 1O91A 1TME3 5GLWA 3G7DA 1C5IA 5LEKA 4RQPC 1RUI1 2ET1A 1RVF3 1UZYA 4MHRA 2YY1A 3O7OA 4YG0A 4YYOA 4K8FA 1G9DA 1DGWA 4YW7A 4CU7A 1DZRA 3AX4A 1GR3A 1KGYA 4XMAA 4AFMA 5FYVA 2RDNA 2YXSA 3F95A 3CF6E 4BWOA 4C8DA 4FQ4A 1W8FA 3SH3A 3GJBA 3TEZA 2RM22 4GMP1 4NIHA 4E4ZA 4XQ4A 2D43A 4W50A 3O1RA 1PM7A 2P5BA 2EALA 2MHFA 4HBNA 5B2GB 1TME2 3BODA 3LZZA 4LIUA 4CDUC 2Q1FA 5G04L 4FI9A 4IE7A 2YDEA 2VO5A 1RVF2 2WLQA 3Q8AA 4MLOA 1KFUL 1W8OA 1Q8PA 4AHXA 3WW3A 3NL1A 4L97A 4AG4A 1OH4A 4CDQC 3WNOA 4AGRA 4LOTA 4AFAA 3O1VA 4A7ZA 1UYZA 2K9ZA 5FMDA 1AR83 5EV7A 4NIAA 5A6QA 3ROUA 3I3DA 3HVDA 4QPYA 2A6ZA 4FTSA 3CU7A 2E63A 4G3YC 2VOXA 3POEA 3WV6A 4A44A 4CCNA 1RUOA 2YGLA 2YG0A 5FR3A 3WNMA 1OA3A 2FZ2A 1F4HA 5BPXA 2ERFA 4OLLA 3GZTB 4NHXA 4EE2A 2EXKA 1UKGA 4D3WA 1BBT1 1IS4A 1IG0A 2BNMA 1E5IA 3IIIA 5FP9A 4XVHA 4ZXKA 4CDWB 3WW4A 3VZJA 4BXSV 1IQAA 1AR82 1DU3D 1V9U3 2XMLA 1MS0A 1AR91 1J58A 3C3VA 1SBFA 1ZZ6A 2HWE3 2J1VA 4LKSA 4XCAA 5IVJA 2ZS6B 1DQ5A 3KGZA 1W3VA 4L92A 4TZDA 2E33A 3FFZA 1ND2B 2AR6A 4XETA 1QXPA 1G8WA 3GJAA 4Q29A 1UKRA 2IFWA 1QH7A 3O0VA 1J3PA 1N1YA 1S55A 1MQTB 3OB8A 4QB1A 3FHAA 3W20A 5KHKA 1GSLA 2ZJCA 2EF6A 4D6QA 1SLLA 3OBRA 3GGLA 3WZ1A 1UOJA 3C7GA 5C33A 2GNMA 2OIIA 4JGYA 1HB2A 1R1ZA 2VQTA 3T3YA 2PLV3 2HWE2 2VECA 5FZFA 2G9ZA 3FFQA 4XBNA 2HWC2 3HQXA 5A7QA 3SKJE 4CCDA 4QHBA 1N1TA 5TSWA 3ZDVA 4XJ9A 2VPVA 4Q5OA 2ZABA 2DCJA 3MEPA 1FOD3 3MLKA 1SZBA 1NCQC 3LIHA 5DDJ3 3IIAA 3AMQA 1GWKA 3DKWA 5EQUA 5IVEA 3KHCA 4YW6A 3ITQA 4GWIA 3BPSA 4CXXA 5FZ8A 1KXGA 5B4XA 5CYYA 3E6BA 4XFFA 2RS13 4CPBD 5H9RA 2XBO3 3AM2A 4YWAA 3P6BA 3RZZA 1O3QA 3AKQA 2O8OA 2Q30A 3UL2A 2ZX0A 3UETA 2WLPA 5T55A 2HEWF 4YW4A 1RUF3 3VD5A 4JRLA 3UKVA 1ASJ1 1EAH3 4BK5A 5FZ0A 4I2OA 1QNYA 1ZVFA 1W8UA 3B01A 2ZZQA 2JDHA 1VBB3 4NROA 2ZAAA 3VZMA 1ZM1A 3Q8EA 5DDJ2 3VBFB 2W5FA 2Y38A 1QJU1 1S1AA 4R9CA 5FY5A 4GMP0 1JUHA 2JKBA 3DF0A 1NCQA 4MYEA 2O1QA 5J3UA 2XWBB 1F5JA 4E8DA 1WCQA 2WQ8A 1EAH2 1OF3A 4MXWB 1O3TA 4H14A 4GB32 2YROA 5DMYA 1OFSA 5IT6A 4OUMA 2YPDA 1OFNA 1VBA3 5EYYA 3V64A 1VBB2 2A6VA 5BNPB 2RS33 2DU0A 2XJVA 3PUHA 2BNOA 1DHKB 2V09A 4HONA 1DP0A 4UWDA 4Y1VA 4JCKA 2RHPA 1C3HA 2D6LX 4CEWC 5BY5A 2HWD1 4YZ2A 1D2SA 2OS2A 3BOPA 2FHRA 3OJBA 4AVVA 1PMHX 3TWIA 1RITA 3BCWA 2WJSA 3VBHC 3MHZA 3UJOA 4EWAA 2VE1A 1X9PA 3QD6A 1UF2C 4A45A 4QXCA 4CDQB 3WF4A 4RYDA 2ZMLA 1VBA2 3H7YA 2WO7A 3O5SA 1UPIA 3OUJA 4GALA 1UW8A 1IKPA 1OKOA 2O14A 4S2HA 2D5FA 4FT8A 5FXZA 3ZXAC 5A32B 1DYKA 1PO13 1DQ6A 4AF9A 1EP0A 3ZKUA 3S57A 1K45A 3WP5A 4JTOA 4FP2A 2Q8DA 3X29B 5BNNC 1LNSA 5JXHA 1NA1C 1X8MA 1CAUB 2X29A 1ZBA1 4XACA 1KJLA 5FZHA 2VZ3A 1OOPB 4JGZB 5JMOA 2BRTA 4Q8LA 1SLAA 4PT6A 3CMGA 5HPOA 1CR7A 2GNTA 3PVNA 2ZKLA 4XAAA 4B29A 1MZ6A 3KVAA 4G4FA 5L19A 1PO12 4YRDA 4CP1A 3BTAA 3E1F1 1VBD1 1QDOA 2ZMNA 3PUIA 2ADDA 3RS6A 3HQRA 5FZEA 2R072 4M0NA 2XVKA 3DGTA 5EJ3A 1SFPA 2AYHA 1MS9A 4Y22B 1QJY3 3AZZA 3ZLIA 1W9TA 1W99A 3U0ZA 5GZEA 3THCA 3URFA 2VCAA 4HANA 5GZCA 5FLJA 3I3EA 2DDUA 2I07B 3KV5A 3OGVA 3TAYA 3KLSA 4DUWA 5BNNA 1VAVA 3VBRC 5EHDA 1POV1 3S7EA 5T5PA 3NKGA 4NE9A 3LEGA 4XZPA 4Y20A 2O8QA 4XUQA 2R6QA 1F5FA 3WDYA 2V5DA 4XUTA 3WQBA 4WZCA 3TNQA 2EVXA 4BB3A 1TE1B 1T2XA 1S0DA 4HMZA 2NYYA 3WNNA 2X5IC 4J6GA 4XUPA 5FYIA 1QJY2 4M01A 1WKYA 4E2GA 3IMMA 2W52A 3ZSLA 3IT8A 1WD4A 4MSVA 1Y7BA 4CA9A 2AUYA 2Q1MA 1Z7S1 2HWF2 4TLFA 3RSJA 1CAWB 4M4PA 4QDQA 4YVSC 4UBHA 2JIJA 2J22A 2Y33A 4CDXC 3NVCA 3H7JA 4FPJA 1QEXA 4HL0A 4W8JA 5KWRA 4IE0A 1UY0A 4QX3A 4UF0B 1HXS3 3VBRA 4FFIA 3H8OA 2QTWB 3LCPA 2W1WA 4H2AA 4LBJA 2GZWA 2GMMA 3S6PA 3FMGA 2LTNA 3JXSA 4FVVA 5FZOA 2JJ6A 2WBKA 1AYM1 1M4WA 3THTA 3ZPYA 1RUI3 2X8KA 2ZGQA 5L7OC 5JZGA 3O1SA 2OT7A 4NUBA 1L3JA 3WR0A 2P4EA 1RUD1 2ZGUA 1UN1A 4MH0E 3ZYPA 2A73B 2B45X 1PMJX 3MW3A 4BQWA 5JI7A 3MUY1 2GMPA 3Q8FA 4KGQA 5L9RA 4W6XA 4CYDA 5C3SA 5ISLA 1Z0HA 2FQPA 2ZEXA 3PDQA 4GMP3 3G6JB 4MGKE 1PZ8A 5FJHA 3U07A 4LR4A 4P9IA 4QPIA 5KHGA 4DUVA 3WVJA 2P3YA 1NE6A 1VBC3 2NZ9A 2XDVA 3NV3A 2JDYA 4AI2A 4CEWB 1UY1A 3GHMA 4XQWA 3U37A 4CP0A 4EQVA 5C8CB 3J7MA 1RUE1 3T2PA 1FPN2 3OBZA 5EJZB 4Z2WA 1XYOA 3ZSMA 3ZFEC 4XCBA 4XFHA 3OPZA 4OI1A 2LROA 4OMCA 1NE4A 4QKFA 5FZ1A 4LTAA 3LEIA 5FMCA 2BVBA 2XKPA 4E8CA 1VBC2 2B46X 1U5ZA 3ASIA 3IWZA 4QM8A 5CVRA 3ZVXA 2P6CA 1GNHA 5F3GA 2I2SA 3NJXA 5FV3A 2IWGB 4XFCA 1BBT3 1AJOA 1JS9A 5FBZA 3QCWA 1JW6A 1UZVA 4N43B 4NPLA 3WCSA 3LFIA 4LUMA 2WN2A 1TZOA 1AR93 2VBBA 4HLTA 2WNUB 3DKQA 1GZ9A 1AX0A 3ZXEA 2VTXJ 2WR9A 3KCYA 3OOXA 3LD8A 2XJPA 5C4WC 1RHI2 1POV0 3R4SA 4R9AA 3VDDC 4CCMA 4UW5A 3RZJA 3PIGA 1MS1A 1IZ3A 3RFRA 1R083 4BQ4A 3H1YA 4FTBA 1HRI1 1RXGA 4E2SA 3V0BA 2R042 4TTGA 4CCLA 5KR7A 3CJIC 2CAVA 1AR92 2IVIB 1LEMA 4IGQA 4NWWA 4YVWB 5A3LA 5LATA 4QKNA 3VKMA 3MIGA 5LBEA 4LHLA 3OUIA 1UX7A 4RHV1 2A70A 2J7MA 2A3XA 1H8TA 1OPMA 2ZACA 4AYUA 3FLRA 3V65A 3WDTA 1UZ0A 1VRBA 5ANQA 3SH5A 3CHXA 5D8AC 5JSRA 1C1FA 5BV6A 1QH6A 1R082 3GCXA 1LOGA 5FY4A 3USUA 4S2FA 2W0XA 1CIYA 3VDDA 4X6RB 1CX4A 3OBTA 3AKPA 1EPZA 2C24A 1ZZBA 1JZ2A 4UYBA 4YVSB 4I01A 2FDGA 2D3PA 5F5QA 3VBSB 5BNQA 5C3PA 2EIBA 2RG4A 4AHZA 2K2SA 2J1SA 2RM21 4PCRA 4XJWA 5FQ0B 1ASJ3 3RZMA 3MDPA 5DABA 1ZRCA 1PX4A 5C71A 3MF9A 2C6SA 1IGOA 2F17A 4NHYA 1N1VA 4NRMA 1W2TA 1TME1 1G9BA 3IZOA 3A4UA 2BYVE 1IS5A 1DIWA 1UAIA 4RS5C 1O8PA 4XJUA 3ZSKA 4AXOA 3I54A 4GD4A 1WCDJ 1DF0A 2EXJA 3HEIA 3TRSB 4AL9A 1QJU3 3U14A 5LEJA 3NJVA 3M3EA 2VZQA 3QBQA 4EJRA 4F83A 5D8AA 2WS91 5J37A 3I3QA 3AVRA 4IV1B 1J83A 2DUOA 3ZPOA
chains in the Genus database with same CATH topology
3DV8A 1XYNA 3WP4A 2E53A 5SV5A 1EYBA 3H0OA 4AEDC 2WWSA 2YC0A 4S2DA 1O3SA 2P2KA 2XJSA 1C1LA 3VBUC 4U2AA 1V70A 2VOVA 1QJU2 4IV3A 3ZN6B 1OKQA 3OD4A 1IPKA 2D44A 5EWSA 2OZJA 1QOSA 5BNOC 3ALQA 3PJQA 3I4IA 2RMU2 1DYPA 2YUEA 1I9RA 1OSGA 2QCSB 3E6CC 2XLFA 3ZMOA 5FOJB 1UPSA 4P9LA 4PIYA 4LO4B 4QPGB 3QLQA 2WT0A 4TYSA 1PVC3 3ZFEB 3NAPB 4EV0A 1Z78A 4HT1T 4FPYA 4AEDA 5FLHA 3WG4A 3R0RA 1AJKA 3GALA 3VBUA 4Y24A 3GBGA 2R1BA 3VHPA 4LBNA 5EYXA 2DCTA 5K9YA 4ISRA 4NHMA 3WQ0A 1URXA 4YSFA 1ZBA3 4FPKA 4META 1WW5A 4QQ2A 2HWC1 1PVC2 2D6PA 3N35A 3D8CA 1GV9A 2JENA 4AHYA 1GZWB 1JOJA 2YHJA 1U5IA 3VHNA 1VBD3 1KFXL 1RUH1 1Y3TA 5GZFA 2P3KA 4DFSA 4N53C 1CESA 1HX6A 1SDWA 3JB8A 4WM8C 2CGOA 3WD5A 3C2UA 4E4SA 5F9TA 3B69A 3U4XA 2XLAA 1ENXA 2VMHA 3AMHA 4AGGA 2WFPA 5FPXA 1PGL2 1NXD1 1OHFA 3CJIB 4W65A 3VZLA 3AZXA 1XU2A 2GN7A 3ST7A 3B7MA 4MV2A 4XPVA 2PHXA 4I3GA 3ZIWA 2AENA 4D7TA 2A71A 3AP4A 2WA3A 4HPKA 1DQ4A 3PJYA 3P3PA 1PNGA 1AX1A 4ISQA 2JICA 4I0BA 4LBOA 4N53A 5J7MA 4Q2FA 4PLNA 2WZPP 1F2NA 1EAH1 1AXKA 4GB31 4O9EA 1COV2 2OVUA 3AXDA 4XFIA 3AP5A 3QH7A 4C1WA 4QXKA 3ZYRA 5T50A 4E4DX 1ZZ9A 3USSA 5KC6A 3ME2A 2Q0AA 3RYPA 5FLIA 4B7EA 5ABJC 1H0BA 1AYM3 2HEYF 1XQNA 4WM7B 1Q56A 2ATFA 4YM0A 2WSVA 3RMYA 1VBA1 1S0BA 4COYA 2GC0A 3AP9A 2DFCA 1AR62 2AREA 1QGLA 1BEV1 2EA7A 1AUYA 2YPJA 1ULFA 3PVBB 2ZGNA 3GBWA 4FOWA 4C0HA 2BQPA 2A6WA 1C8M3 4AEKA 1HIXA 3DPRC 3VUOA 2D6MA 1AYM2 2JE7A 2QKDA 3ZFGC 4FPGA 1RUE3 1NLRA 2WQ4A 5DG1A 5IK5A 4LA3A 5H9QA 5ABJA 4RGGA 4N9HA 4XFAA 3VHOA 4RR3C 2JG8C 3RDIA 2XL9A 1PO11 5L73A 3VKLA 5I8YA 2NPIA 2R071 3JU9A 2O0OA 1GICA 4WZFA 1C8M2 4ASLA 2EXIA 4L11A 1OA4A 1SQ4A 3PTYA 4HN0A 4EN7B 2WC2A 5I8TA 1RUE2 2A75A 4OHZA 3DPRA 4Q4W1 4C91A 5IK8A 1U12A 3ZFGA 4YM3A 4KQ7A 5GZDA 1O7FA 1LHVA 1YFXA 2D6OX 4JQRA 3ZXFA 3ZXJA 3R6SA 2ZAHA 5KHJA 1YJLA 2BUKA 1Q3EA 1CQ9A 1WW7A 3CO2A 4LHKA 5EZWA 1RUJ2 3HAGA 2HWF1 1XNKA 4WM8B 1WW4A 2A5ZA 2GMEA 1HRI3 1W6PB 3RJ2X 4YG6A 4FOQA 4EN6B 1H9PA 2CTVA 3AYAA 1IPJA 3ZXLA 1O4ZA 2GC2A 4RHV3 5FFOC 4QT6A 5LK5A 3ZIXA 3H9AA 1LHWA 1NZCA 2WINB 2Z79A 2C1FA 3L2HA 4QQLA 1MEC1 1H2LA 4L99A 4L2NA 4XIOA 1VB4A 5HBAA 2IZWA 4OHYA 1DGLA 1HRI2 1X50A 1HDKA 4BH9A 1S2BA 5J96B 3IDBB 4AI3A 1I1EA 1DBNA 4FO9A 1YJKA 2E51A 2ZX2A 2UY8A 3JQWA 5E1RA 4YW3A 4YLZA 1AL22 4R9DA 2EAAA 2W08A 4RHV2 1CPMA 3HN1A 4GH4B 4FPLA 1MQTA 3N7JA 2QQPA 3ZN4A 1FV3A 1FPN1 3NO8A 4XXPA 2WS93 1ENSA 4Q8KA 3TOJA 5FO9B 3EBRA 4FBFA 5C6CA 4MGZE 2ARBA 4XHBA 3MIDA 2FMYA 3LWCA 5GLZA 4BLJA 1HQLA 4XJZA 5CG9A 1YYNA 4IESA 1VBC1 1VLNA 4NWVA 3LGRA 2QDRA 4JDMA 3JCIA 1S2KA 2JG9C 2DUQA 2B9UA 4F3JA 4ATFA 4NVPA 2A7AA 2P34A 2YGMA 3M3CA 2WS92 3HMYA 2A6YA 2I45A 2WT2A 4OUSA 2ARXA 3TN91 4RR3B 1CVNA 2JG8B 4IQPA 1RHI1 1X33A 4HVOA 4Q1PA 1T6GC 4WVMB 4JGYC 3BU7A 4Y1YA 4I0AA 3J9SA 1LHOA 3CLPA 2F4PA 2NMOA 1LGNA 3MW4A 3JQXA 2R041 2JG9A 5CFDC 5JDBA 5KC5A 2ET7A 4A3XA 5E16A 3FJSA 2CL2A 2Q8OA 4XBLA 1LGCA 3RI9A 4XF9A 1WA4A 3LA7A 2HWC3 1H1IA 1YLLA 5IUQA 4CRQA 1PGSA 5E89A 4D7YA 4NHLA 5GM0A 4W6YA 1R081 5C9AB 1RUH3 1MS4A 1UX6A 2FBEA 2VW2A 3I8TA 1N3OA 5FO8B 1O3RA 4Q4V2 2WSUA 5JWPA 2ZX1A 4A7YA 1BQPA 1NCRC 5CFDA 4KH9A 1A78A 5T5OA 2XVLA 2DWRA 2Z5WA 2OYZA 1REFA 5JAXA 3FLPA 1JYCA 1CONA 1REEA 1RUH2 1VIWB 1Y43B 3WOGA 2D3SA 2D7FA 1YFWA 1HKDA 5BYNA 2DCYA 3KM5A 4HSLA 5T5JA 4Q0PA 4FTEA 1OOPA 4JGZA 4GB33 3IKWA 2F6BA 3FX3A 4ATEA 4ZKTB 1NCRA 1ZZ8A 2SLIA 2WKKA 4Y4YA 5FOBB 4FSJA 4DZGA 1DQ1A 2HJIA 3CJXA 4I0WB 1OMIA 1LOEA 4RQPB 2RMU1 5FREA 1G9AA 3SCGA 2FZ1A 1HQNA 2VXRA 4BMBA 3VBOC 1OLQA 2I74A 1YO8A 1RUG2 1M06G 4C0BA 2VG9A 3LSDA 3TNPB 2ZX4A 5ACA2 2ZHMA 1BEV3 1CGPA 2E9QA 2IXJA 4R8HA 1LR5A 3R4UA 4CDUB 4Y1ZA 4QM9A 3ZXDA 5CNAA 1B09A 1MR5A 1K5MC 1X36A 3AK0A 4N90A 1CAWA 2XVGA 1PVC1 4YNIA 1X8EA 2XJQA 4HKOA 1S0FA 3VBOA 4KBBA 4B8EA 2ZBJA 1BEV2 1J1TA 2KXLA 1SLCA 4QX5A 4COWA 3WUCA 2R073 4B4PA 2D97A 1ENQA 1VB2A 4IEVA 3ZX7A 2P3JA 3JB4C 2XUMA 5D1IA 1I5ZA 3ES1A 1PGL1 3RYKA 1KQRA 4Q4W3 2WNVC 1LGBA 3HBZA 1K5MA 4Q0VA 3NV2A 1TEIA 3V56A 4AI1A 4HETA 1QHDA 3W59A 3ES4A 1VJ2A 2AH2A 4FP3A 4HKLA 2DCZA 2VW0A 2OW4A 2BPA2 4BOWA 1LODA 4XXAA 1O4TA 2HWF3 4RA0A 4HVQA 4Q4W2 1COV1 2WQZC 2WFF3 4M3CA 4Y1XA 5J36A 4XE9A 4FPOB 2MEV1 4N7IA 4KGGA 3VGIA 4AVCA 2WNVA 4NR1A 3LOBA 5CBLA 1H2NA 4K21A 2H6CA 2PN5A 4IEPA 1NCQB 4PIZA 5JZGC 1H1MA 2R1DA 3HT1A 3SLIA 1D0GA 2DUOA 5K0UC 1MEC3 5KXCA 1LHNA 2SBAA 1FMD1 3D5OA 3POYA 2WFF2 5JSOA 3MFCA 4AEMA 2A3WA 2EXHA 3ELNA 4QPIC 1AR61 2B39A 1JYIA 5LRSA 5A3MA 4YW1A 2DVAA 2PHWA 5GALA 4LE3A 3AP7A 3UK9A 1GNZA 3QH6A 4YZ3A 1CN1A 2VQAA 1LOFC 1OD5A 1MEC2 5CFCA 2ZZJA 3L2YA 4KWJA 1DGWX 1EV12 1Q8OA 2KA3A 5DUWA 1YI9A 4K6BA 3OGJA 1YFUA 1FPN3 4Y26A 1WLWA 5K0UA 2PHFA 1QOTA 4Q4X3 3ZFFA 2JE9A 3WNXA 5JOZA 1UMZA 3WG3A 5I8SA 4L8QA 3KQRA 1C8M1 1RC6A 4NHKA 5SV8A 1JN2P 4X8PA 3U11A 4PBPA 2JX9A 2NN8A 1LTEA 3B3QE 1PO21 2DUPA 3VBHB 3VL8A 4AW7A 1LOFA 1NG0A 4QGNA 1CD3G 3B94A 4Q4X2 3WLUA 4NOTA 4WV8A 5I0RA 3VBSA 1D2QA 1TMF1 2OUJA 2VOWA 4BQ1A 2VNOA 3TN93 3WQ1A 1QU0A 5H9SA 1LHUA 2IC1A 4HFSA 1DDLA 4B7KA 2W39A 1JBCA 4AQ2A 1CAVA 1W2UA 1RHI3 3M3QA 1XNDA 3SHRA 5I91A 1D4VB 1RUJ1 5T3NA 1WLCA 4C1XA 1YIPA 1UD1A 2V73A 1VALA 4XF1A 3RPQA 3KT4A 5BNNB 2ZHLA 1NA1B 2R043 2WT1A 1XE7A 2IXKA 1H8TC 4GXLA 5A33A 3N7MA 1UIKA 3ZSJA 3TN92 4COVA 5CIRA 5DUUA 4QGMA 1LEDA 1ZA4A 2BTVC 4YZ4A 4CP2A 3AB0A 1ZRFA 5DZGA 1ENRA 1XXNA 2VMGA 3RWNA 1SLIA 1E57A 2DVGA 1IS3A 2ENRA 3ZN6A 2A6XA 4AFBA 1SLTA 4Q0UA 4P9WA 1AXZA 3MICA 4DY5A 1MVQA 1BK1A 3VBRB 1AL21 3AMPA 3GF6A 4DB5A 3MF6A 3NAPA 4KL1A 3POSA 4ASMB 5JOYA 4LNVA 1FI2A 3RQ0A 1RUC2 4C90A 2TNFA 2X5IB 1W0PA 3ACLA 1JXNA 1N1SA 3AZVA 3MIHA 2PELA 2B7YA 4RL7A 3VLBB 3ATGA 4CDXB 3HD8B 1QOOA 1YWKA 4AFCA 1ND3A 3MIEA 4IV3C 4XMIA 1G86A 4PLMA 4COZA 5T5LA 2DV9A 4AWDA 1GZWA 1V6JA 4QD2A 2H6BA 3I59A 3WCRA 2PQQA 5GLVA 1W6OA 1ONAA 4XDQA 4QU2A 5L7OB 1FT9A 2NQYA 3FLTA 5FAXA 4OHVA 1TQ5A 4W6WA 4XILA 5FTTC 3HR9A 1DZQA 5FCCA 1BCXA 4WBBA 2Z42A 1C57A 1S0CA 4ES8A 1FV2A 1LKNA 1V6KA 4LBKA 1YRZA 4LUKA 4AVAA 4JVAA 3IN9A 1WMDA 1Q8QA 3PMEA 2VVEA 3RNSA 3H8UA 3DUIA 4KWLA 1LOCA 3D82A 2ILMA 4QQPA 4BPZA 4MZUA 4YFZA 2PHUA 3M2MA 2QFEA 3H1WA 4RGAA 5I93A 3PVEA 4YGCA 3AP6A 3OYWA 1QMJA 1SCRA 3E5QA 2BBVA 1Q8SA 3VV1A 1V00A 5J98B 1ZYBA 3SXWA 3ZMNA 1J1LA 3M3IA 4Q4V1 4R52A 3B93A 2G4IA 5CADA 2XJUA 2VMIA 4AFDA 2B8MA 3GBFA 3NV1A 2GNBA 3I2DA 4OULA 1WGPA 1B35A 4LBQA 2PHDA 3USUB 3OF1A 1XNBA 5GJ6A 5C4WB 3VDDB 1REDA 4YW2A 2ZGOA 4HK8A 3UV9A 1SBDA 1YXWA 3POWA 4DNYA 4EN8B 5FPZA 5JI9A 1BYHA 1GANA 1WMEA 4LE4A 4XJ8A 3ZYIB 3AKTA 1COV3 1R092 4I3PA 4LEJA 2MEV3 1YIFA 4ES9A 3KB5A 1UU5A 3ZYGA 1RMU3 4OI2A 4Q26A 1DFQA 2ZA9A 3JUUA 4FPHA 5D8AB 3V0AB 4HN1A 1PK6C 3RG0A 3ZXGA 3H50A 1HRV3 2PAMA 1FMD3 4PDWA 2NMNA 3KMHA 3D6EA 3LKJA 1H9WA 3OY8B 3QOPA 1X7NA 3KT7A 3J26N 4HSJA 4IEZA 2FMDA 1RUG1 4CEYC 4F8AA 2MEV2 4NPRA 5ACA1 1AR63 4EWDA 1RMU2 3IPVA 3AKSA 4JDOA 2Q5TA 4RS5B 1PIV1 3N36A 1FXZA 2Z69A 5BXXA 1PNFA 2PTMA 5K7PA 2C9AA 3FE5A 3FC0A 2GH2A 4BHPA 1HRV2 1FMD2 2VQ0A 1I6XA 4V1PA 2NP0A 1PK6A 2D6KA 5DUXA 1W6PA 3SISA 4NN0A 5IK7A 4AEDB 2WZR1 1QDCA 5T54A 3B02A 2MNGA 3B00A 2VVDA 4CEYA 4XQDA 4E2QA 3L9JT 3VBUB 4KG8A 3SH4A 1PVXA 5F1RA 3JZVA 1YNAA 4QGLA 1GBGA 4XW3A 3MPBA 2XLGA 1ZRDA 1KDMA 4K40A 4XBQA 5BNOB 1W0OA 3INAA 5FRAA 3MPPG 3MLJA 4FPCA 1PO23 1RL3A 3IM0A 2GNDA 5C8WA 1W6QA 2TBVA 2QZ3A 4DQAA 1FATA 1W6MA 1IS6A 1BXHA 1TMF3 2VU9A 3FBYA 3ETQA 3H3UA 4XOGA 1LOAA 1QJX1 1MZFA 3JBG1 4I30A 1WCKA 3ENRA 4GULA 2PHLA 2VGDA 1QNWA 3N3HA 2H0VA 4GH4A 5K8SA 1RUJ3 4BIOA 2XL7A 1YFYA 3B9IA 4JDNA 1LECA 4GWNA 1PO22 3KZ4C 4NO4A 4M3CE 1MVEA 2BGCA 4MVTA 2OA2A 2P37A 4DRVA 1AZDA 3VKFC 1TMF2 2XHKA 1AL0G 4INDA 4D94A 2TUNA 3SMHA 5KBFA 3TB0A 1JUIA 3KD4A 4GKXA 4EN9B 4HPKB 4HVRA 1MS8A 1H30A 4CDWC 1MS5A 3IBMA 5CU1A 3O0XA 1NOVA 3ILRA 4N53B 3WW2A 4SLIA 1CJPA 1F31A 2QZ2A 2WFF1 4R4XA 2NLRA 1KRIA 4YGDA 4OI0A 1LU2A 3VL9A 4QQHA 1AYN1 1ND2C 3MIBA 4GWMA 4U36A 1SMVA 2GC1A 5KXBA 4WVWA 3RYRA 1FX5A 1AL23 2LALA 4YM2A 1MQTC 4BLIA 1C28A 2D98A 1H4HA 1G7YA 3TBDA 2WNEA 1DGRN 3NW4A 1SCSA 1EV11 1HW5A 1KS4A 2C5DA 1PZ7A 4CDWA 1CAXB 4K1YA 2LM3A 1PHMA 4GA9A 4LO8A 1R1A1 1NQJA 3K48A 4UBGA 2HEVF 3VKOA 4KWKA 4F7ZA 1ND2A 1UIJA 1MS3A 1QQP1 2VOKA 5EFUA 3WXPA 2UYAA 1GLHA 1D4M2 2XKOA 3WT3A 4SBVA 1HV1A 5E8AA 5ABJB 3FZ3A 2PFWA 4O9GA 4Q4X1 1C5HA 1F8VA 1GFF2 1N47A 3T1LA 2VY0A 5GZGA 1YI7A 3OCPA 5KXDA 3R05A 5AVAA 2VH9A 3GNEA 4Q4Y3 2CAUA 2JEMA 3AFKA 3GYDA 3DPRB 1KITA 5T52A 3ZFGB 3E97A 2RS51 3EQEA 1FNYA 3KSCA 1HV0A 5JPMB 2R062 5BNPC 1YCIA 5JLVA 1ZNPA 2RR13 1N3QA 3K51A 4IERA 1W6NB 3N7KA 4Q4Y2 2LUWA 1PGW2 1VRH3 3VBFA 1Q8VA 2C0ZA 1BJQA 2R49A 4P14A 1BZWA 4BMEA 1LRHA 3E5UA 1RIRA 1QWRA 3CNAA 2DVDA 4ITCA 4RQPA 3ZXKA 4PJYA 3M1HA 1ZREA 4ONUA 4Q4V3 1LB2A 2RR12 4MXWA 4K9SA 1OA2A 4OVEA 3BALA 5BNPA 1VRH2 1ULDA 1RUC1 1SEFA 3UJQA 3D0SA 3T2TA 2PHRA 3LA2A 4BIFA 2TEPA 4MGIE 4CDUA 1UL9A 2DTWA 3PMSA 1VAMA 1OOPC 1CJDA 3GZUC 4JGZC 1PMIA 1QF3A 4ORFA 1AR71 4X6QB 1UZZA 1GQHA 1UU6A 4CDQA 5LRRA 2PAKA 4IEOA 4OHXA 2BNNA 5JIUA 4DOUA 1IHMA 4UW3A 5A32A 3TYJA 3GHNA 4GKYA 3EXUA 3KCXA 5DUVA 3LSEA 4LLOA 4JC1A 4YARA 4JTNA 1DQ0A 1V9U2 2GSYA 3AMNA 1GYKA 4D7SA 4Y5Z0 2IXCA 3J8F1 1CAUA 3BOWA 1YHFA 1OI6A 4PIXA 1H8VA 4XFGA 3WQ7A 3VHRA 1RUG3 5ACA3 4K20A 1FAYA 1QJZA 2XWJB 1QXRA 2ZKNA 1PIV3 1DZTA 1ULEA 4Y22A 4M3CF 4BCUA 2PLV2 1S0GA 2X53S 4JV4A 4OFGA 1RGSA 5AFBA 1Q43A 3KCCA 4D69A 2CNAA 2GC3A 2VVFA 4Q0QA 1BMV2 3D0JA 4FPEA 3ILFA 4IXLA 4B4QA 4B3NA 4MX3A 3S0MA 1FOD2 2WZR3 3FWEA 3VZNA 4QQOA 5JMCA 2WIIB 5BUVA 5I0TA 1PIV2 4B4RA 2RS12 2JG9B 4I02A 2XBO2 4Y1UA 3CEWA 2RE9A 2XJRA 3RJRA 2E6VA 1RUF2 2KM2A 5KHHA 4R9BA 2VNRA 1WMFA 1ULGA 1VR3A 5HI0A 4EROA 2WZR2 2ZGMA 3WG1A 1VBE3 1RJ8A 2XPJA 2DF7A 1UU4A 5C8CC 4JGYB 3HWJA 1QJX3 2BW8A 4LULA 3JBG3 4KU7A 1DG6A 2Y0IA 3WG2A 2YZ4A 5AC93 4H7MA 3FBMA 2GU9A 3H1MA 1G9CA 5CFDB 2VULA 3ZSEA 4LHNA 2D6NA 1FNZA 1RB8G 3EHKA 1R091 5I0UA 5AFEA 1IOAA 1J59A 2XJTA 2RS32 3WX5A 4XYXA 1BVP1 1D0HA 4IL7A 1VBE2 2JECA 4Z92B 4HK9A 2IXIA 3KT1A 1A3KA 3M3OA 1QJX2 3AMMA 1O5LA 3JBG2 2DFBA 1UCXA 4FXKB 4DXZA 4YZ1A 5AC92 3VN4A 4CEWA 4RD7A 1SBEA 1ZBE1 3AYDA 4N43C 5C8CA 4AQTA 2R0FA 1XU1A 3VBHA 1RJ7A 2WNUC 1NCRB 3ECQA 4JAAA 3BIWE 1AYN3 4PBOA 3HIFA 1WUVA 3O12A 4ZU5A 1NQDA 1RMU1 3B5LB 3BB6A