5D2AA

Bifunctional dendrimers
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fucose-binding lectin
publication title Overcoming antibiotic resistance inPseudomonas aeruginosabiofilms using glycopeptide dendrimers.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5d2aA00
5A3OA 5D2AA 2JDUA 2JDKA 5A6ZA 3DCQA 2JDYA 2JDMA 1OUSA 1OURA 5A6XA 5A70A 2JDHA 2JDPA 2XR4A 5A6QA 5HCHA 2BV4A 2BOJA 1OXCA 1OVSA 2BOIA 4UT5A 4CE8A 2VUDA 2VUCA 2WR9A 2CHHA 1OVPA 1UZVA 4AOCA 5A6YA 1W8HA 2JDNA 2BP6A 1OUXA 2WRAA 2VNVA 1UQXA 1GZTA 3ZDVA 1W8FA
chains in the Genus database with same CATH superfamily
1TMF2 1JUIA 3ZXJA 2LM3A 1YFYA 3I4IA 3PDQA 4QU2A 2XKPA 3ZYJB 2WO2A 2VMIA 5E16A 4AHZA 1UXXX 1GOGA 2HWE3 1BJQA 1PIV2 4GB32 3IT8A 4K40A 1WCUA 3ZYPA 2YFZA 1XNKA 4Q2FA 2GALA 1N47A 5F3EA 3VDBA 3RZJA 2WIIB 4N7UA 1HJFA 1QOOA 1VBA3 1NKGA 3NW4A 4KNCA 5FZOB 4NN0A 5EYXA 1UXZA 5E89A 2Y0IA 4CXWA 2ZGPA 1RUF1 2XUMA 3H3UA 4Y20A 2CGPA 5ANNA 2VNGA 4QGNA 2ZJCA 4R8HA 4RHV2 5DUXA 1BBT2 3T09A 1GZWA 1H2NA 2RS53 4LE3A 4XAAA 2RM21 4NJ4A 4Z2WA 5B4XA 3VGIA 1WUVA 1BEV3 1RUG2 2P5BA 4CDQB 5HCHA 1VAVA 4YVSA 2Y0OA 4LQRA 3S5QA 1Y9GA 4OHYA 2W1UA 4XURA 2W3JA 4OZOA 5FPZA 5K0UC 4O9EA 3MBWA 2BDRA 1VALA 1OF4A 1XYOA 2IXKA 3GHNA 4N8MA 4CUAA 5HXMA 5FV3A 3NQHA 2VCCA 5K8SA 1QOTA 3E5QA 2MEV3 4LULA 5FYUA 4A6SA 3PUSA 4JGYA 2XMLA 1XPWA 3OCPA 1QNYA 2VQUA 5CBLA 5F7UA 1DQ0A 3DPRC 5BNPC 1ZA4A 2W39A 2H0BA 1YIPA 3AZYA 2BTVC 2VNVA 1C8M3 2ERFA 3ELNA 2GC2A 4AZZA 1RUH3 3ZM8A 4QPGB 2AENA 3CBNA 4YNIA 3PHMA 3W5NA 5FYBA 4QKBA 3ZFEB 1OQ1A 5LRSA 1C8NA 1VBC3 4YG3A 5H9SA 5K0UB 3I8TA 4XTMA 4KWLA 4NMIA 1UKRA 1MS3A 4HFSA 1GSLA 4MGSA 3I3MA 2RE9A 4O65A 2GAUA 4WM7A 4D3WA 4YG0A 3PIGA 3WUCA 5FMBA 2XHNA 2VW0A 1R093 2UU8A 4XFAA 2AREA 2PAEA 4MGKE 4UT5A 2A6XA 1UYZA 2JIGA 2VUCA 1XQNA 3OD0A 4AEDC 5F2WA 2BERA 2GZWA 4IV3A 1C3HA 4BK4A 2ZMLA 2D3SA 2G9GA 3HIFA 3MIGA 1DHKB 5FYTA 3VBFA 4XFHA 5IW0A 3APBA 2Q8DA 4D69A 5FY5A 3GYDA 4XUNA 5I0TA 5DUWA 5D8AC 4DQAA 1AL0G 1QJX2 4E2GA 1ONAA 1X8MA 4BPZA 5FJHA 1XNAA 2WAAA 5FY7A 5IT6A 2DFCA 2NYYA 1UN1A 1L7RA 1K12A 4ASKA 3BOWA 4COYA 3VZLA 4N7IA 1MEC3 2P3IA 1UIKA 4DY5A 2IXHA 1RVF2 5CVRA 3MF9A 5EPAA 1W6NB 1S55A 2N7GA 5DZFA 2EICA 2WT0A 1ALYA 2RDRA 2ZEZA 2RDNA 3MIEA 4P9XA 2VBDA 2XLAA 2VZSA 4JC1A 4ZPIA 3T2TA 5F3CA 1ODMA 3V0AA 5IFTA 2GNTA 2R6QA 4XUTA 2WQ8A 4EN0A 1OFNA 3KB5A 1W8NA 1RYYA 4AI1A 2ETEA 3GCXA 3RZHA 4XF0A 2BQPA 2C1FA 3N9MA 4XETA 1V9U3 4NPMA 5AFEA 5LA1A 3N7JA 2HBUA 2Q5TA 4XZPA 5FZ8A 1M4WA 3SH5A 3NV1A 3OGRA 3OGJA 3CMGA 5JZGC 2B39A 4BB3A 3VBSB 4UW5A 4TYSA 2P4EA 4IETA 4MV2A 3WY6A 4DZGA 4EN8B 2WINB 4CDUB 2ZTNA 4GMP1 4QGMA 3VBHB 5F1RA 3LOIA 2Q4SA 2WUHA 4P02B 2VUAA 2VZ3A 4RD7A 3RRDA 2BP6A 3FLRA 5DABA 1GWKA 1NCQC 1PK6B 2DUQA 2XJVA 1V00A 2YROA 4GMP3 1TE1B 2JX9A 1SDDB 4XF3A 1SMVA 3POSA 4YVWC 5FXVA 1NZCA 4FCAA 1PVXA 1HB3A 4HMZA 4LNVA 3ZVXA 1JZ3A 4GALA 3RZMA 4PJYA 5SV5A 3WX5A 4BM8A 2HBTA 5FQ0B 2NN8A 3VBRC 2DTYA 3I2KA 2O8QA 2VECA 2WNUB 1IHMA 3UV9A 5LCWL 3GALA 5C3SA 2QKDA 3H1WA 4CCMA 3H7YA 5CFCA 1HKDA 4GH4B 3VB9A 4CDWB 4AHYA 1YQ5A 4FXGB 1IGOA 5FLJA 4X6QB 2MHFA 2A70A 3AXDA 3ZFGC 2NP0A 4UAPA 1DGRN 4M3CE 1UW8A 3PNAA 3WR0A 2OW4A 4YM0A 5BNQA 1RUI1 1R1A3 3FL7A 3CQOA 1LODA 5FO9B 4SLIA 1RUNA 1RUC3 1C5IA 4CEYA 1XE0A 2FMDA 2JXAA 5FZAA 1SDWA 4NIHA 3WXPA 3OUJA 2ID4A 1CAXA 4NHKA 3RWNA 1PO12 1R083 5F39A 3VZKA 4K8FA 4DOUA 2AACA 5IYYA 3POJA 2LS6A 4QXKA 5EJ3A 1HXS1 3Q8CA 3T3YA 2PXJA 4AF9A 2VMEA 4KMQA 4CE8A 4G9SB 5J3UA 4LO7A 4NPRA 5JR7B 1TZOA 4HVRA 4GQ7A 1QJU2 1ULCA 3M4FA 1HXS3 2ZKLA 3R4DB 2HWF2 4PIXA 4Q0PA 2WT1A 1MS5A 2D6PA 4IESA 4N43B 3SH4A 1W0PA 1CX4A 2VXRA 2EXHA 3D3AA 2H6BA 4I01A 2BU9A 2CWSA 1J1TA 5KC5A 3IDAA 3O0XA 4WBBA 4BYYA 1C57A 2W91A 3FBMA 1O7FA 3N7KA 5JCTA 5ANQA 2WDBA 2E32A 4CDXB 3IDCB 1UU4A 1OOPA 5FLIA 2RR11 4BISA 3OYWB 3WNMA 4B7EA 1JZ2A 3WZ1A 4CA9A 1W6OA 5KBFA 3EJKA 1LGCA 1NX9A 3NAPA 3QOPA 4GJYA 4AAXA 4GXLA 5A32B 3LGRA 4BCUA 3NMBA 4MGZE 1NY71 5CIRA 2WWUA 5FZCA 2XVKA 3HQXA 3VKNA 2WS93 1REDA 5FUNA 4BOWA 1HRI3 3D8CA 2H0VA 3WP3A 5FMOS 5DUVA 1B09A 3C3VA 4YWAA 3ON7A 1JYNA 5FYZA 1PMIA 2P34A 1G8WA 2WLQA 2WBKA 3H7JA 1QOSA 4MXWA 1COV1 5B2GB 2VCMA 1TNRA 4PLMA 1FMD3 3LA7A 3GF6A 4MHRA 2XBO1 4EV0A 5FDBA 4NIDA 1W9SA 2B5HA 4RGKA 1F8VA 3OSDA 2BNNA 1H8TA 1PM7A 3NSTA 4Q4X3 4QQPA 2E7TA 1WMXA 4EZHA 3TOJA 1D0HA 4HL0A 1CAWB 1WWYA 5I93A 2W5FA 2ZGTA 4CPBD 2XBO3 4XXAA 1YCIA 2Y6LA 4NWWA 1AR92 5C3RA 5J48A 2FDJA 4JKMA 1OD5A 2BGOA 1GNYA 2GP5A 1DGRA 3N9OA 4M0HA 3E97A 4O9GA 3WG2A 3KGLA 1FXZA 4LJHA 3GBFA 1GBGA 3UGHA 2AYHA 1NG0A 2YHJA 1ZREA 1YYNA 4EQVA 4KWJA 4LE4A 3TEZA 4RS5C 1W28A 2VCAA 1LOEA 3CDZB 4FOYA 4L11A 5EJZB 5A7PA 4BWOA 2PLV2 3ZXGA 5KHJA 1VP6A 2ZEYA 2JB4A 1RHI1 4XJ9A 3OGVA 2OKXA 5BNOC 4YARA 5JI9A 1ZRFA 2QQNA 1G6NA 3AL6A 4XJWA 4Q5OA 4QB2A 4IE5A 1FOD2 4JZRA 4P08A 1RXGA 5A80A 4B29A 4COZA 4KQ7A 2EALA 3NWKA 1UYYA 1WLWA 3ROUA 4DXZA 3TAYA 1W8HA 4BJ0A 4OLLA 4L92A 3HD8B 1AR61 4BA6A 1RHI3 1GV9A 1PHMA 4WM8C 3NV3A 2C4XA 3W21A 2Z79A 1LHWA 3HN1A 2C6SA 4RR3C 3HVDA 1G9BA 1LEMA 3ZPYA 1C28A 4FFFA 4FPGA 2HWB3 2X5IB 5T5JA 4E8DA 3GNEA 1ULOA 3RYRA 3ENRA 3WG3A 1IOAA 5BNNC 5FRAA 3M2MA 2VOWA 4AEKA 5C9AC 1LHVA 1K5MA 3MDPA 1Q3EA 5FOBB 1H2MA 5CAZA 4CVUA 2YDEA 4Q4W2 5IWFA 2YUEA 2HYKA 3PJQA 4Y24A 3TRSB 3LSDA 3POGA 1P8JA 4CEWA 3PLQA 2AGSA 1CONA 2KD7A 3VDAA 2ZGOA 3M3EA 3WW1A 5A3TA 4Q1RA 4AFBA 4O7XA 4CP9A 1ULFA 5F6LB 5DMYA 3QLQA 5EFUA 3TN91 1LULA 2Y6HA 4ZXKA 4S2FA 3AFKA 4Y5Z0 5DXDA 4A41A 2GH2A 5L7OC 2BBVA 3BIWE 1AL21 4YYOA 3WQ7A 1SFNA 3VDDA 1VMHA 1IQDC 1RMU3 3EXUA 3P1IA 2ENRA 1KGYA 1ZBE1 1BYHA 4QT6A 2WC2A 4RL7A 2VCBA 3AMHA 3GGLA 1MZ5A 1QDCA 1AXYA 2D3PA 2J22A 2W46A 4GWNA 1LHUA 4HLTA 4MH0E 4R9AA 5A1FA 1ULPA 2PAKA 2X29A 3RSJA 1E57A 1PGL1 1O3RA 1ZBA3 4QX5A 2ES3A 2ZAAA 2NQYA 3S7EA 3QBQA 5FP3A 3K3NA 5HV0A 4IEPA 3OG2A 4LKSA 3TB0A 2Z42A 4A42A 2W68A 4AQ2A 1Q8QA 1VE0A 4N53B 4PBPA 4BXFA 5H9QA 4OVEA 1VBE1 4LBLA 2XLGA 2ZEWA 5H9RA 3OBRA 1QNWA 1LOBA 1RXFA 2WZR1 1OMIA 4OHXA 3MW3A 2HWC3 1CAUB 3SQOA 1F4AA 1XSRA 4LK7A 4JHZA 3RJRA 2WAOA 1SLBA 4AGRA 1CQ9A 3CLPA 4LBNA 1VB4A 1W99A 2JDZA 1VRH1 1ZZ8A 2D6OX 2XG3A 4FXKB 2VOVA 4GKXA 3CZUA 5LATA 1X36A 5JAXA 3J8F2 5IK5A 1JTZX 4LMFA 4PBOA 3T2OA 4CXYA 4EWAA 5A3OA 1U5ZA 1Y7BA 3DCQA 2PHDA 5BUVA 2JDAA 3K4ZA 4KG8A 2Q0AA 4DEQA 1VRH3 1YQ8A 3EO6A 3GZUC 2UWCA 3M70A 1YNAA 2W92A 4RFRB 3T30A 4B1LA 3H3LA 4KU8A 1UU5A 1MQTC 3IIIA 4IEXA 3BODA 2JDPA 5FPVA 3LIGA 1W90A 4QPIA 2GP3A 3WNNA 2CNAA 5FFOC 2YC4A 4EZ4A 2YPDA 2JE8A 3THCA 1DQ5A 1H8VA 3IBMA 2B46X 2NZ9A 1SLLA 4LK6A 2VAUA 3VN4A 3BTAA 4KU7A 3M8LA 3BVCA 1TMF3 4K20A 3WNKA 1TME1 4MXVA 5C3OA 4RGGA 4CUBA 3JCIA 3HR9A 2D5FA 2A6VA 3H8OA 3VHOA 4GD4A 4YW2A 2VG9A 3ME2A 2ARBA 3X29B 1PIV3 4GB33 5LASA 4FQZA 4MUVA 1A3KA 3WSOA 3CHXA 3HWJA 3S57A 4QMAA 3EHKA 4X8NA 4FFGA 5EJ1B 2JG8A 1E5IA 3KV9A 3O0VA 3UESA 2VQAA 5GZCA 1GFF2 2JEMA 1H1MA 1N1SA 5A7OA 4P00B 1DZTA 1KJRA 5GKAC 4W6WA 3T0AA 3H9AA 4RHV3 4Y20B 4NHYA 1UY1A 3KS7A 1BBT3 1JXNA 1S2KA 4YW3A 4A3ZA 4EWDA 2AR6A 1EV11 2QQOA 1BXHA 3PJYA 1GZWB 1EAH2 1RUG3 2ZXQA 5I8TA 1MZ6A 4BU2A 4DEVA 4QU1A 4HANA 3J4UH 4YVSB 1LAJA 4LA3A 4LITA 3R6SA 2TBVA 4WVVA 2XQRA 4S2GA 2JICA 4IW3A 4C1XA 1S0BA 5HPOA 1I3HA 3ZFFA 2DWRA 5KHIA 4UFMA 3OEBA 4JGYB 3WDYA 3NVCA 4K3UA 5A3PA 3DUIA 3RYPA 5JXJA 2WLPA 1Q56A 4I0BA 4HKLA 5HCBA 2GN7A 2UYAA 4LA2A 2XLFA 1S0GA 4RYDA 2PHWA 4MG2A 1SPPA 1PGW2 3KV5A 1UIJA 4WM7B 5A7NA 4EE2A 3NJYA 2OZJA 1W8UA 4LIUA 2UY8A 1RUE1 1ULEA 1HB4A 4ITCA 1V6JA 2BGPA 4JTNA 3J7NA 1UYPA 2IFRA 1O3SA 3RG0A 4H7MA 4XF4A 2C9AA 4PI2A 3MV11 5FTTC 4IV3B 5C3PA 1XNTA 2HWD2 1RUE3 3LWCA 2D98A 2WL1A 5JWPA 2QQVA 3LSEA 5BXXA 2R071 4A7ZA 1F35A 4QB6A 2EXJA 2YG0A 2ZOEB 4Y4RA 5FO7B 3VBFB 3WDXA 4LTAA 2XQXA 3GHMA 1D7PM 3H42B 4Q8LA 2IVIB 5GJ6A 2YPJA 5F9TA 1X9TA 1DQ6A 3E6CC 2R7EB 1IZ3A 3R4SA 4QXBA 4CUCA 2R073 1LKNA 1JZ7A 5FMDA 1N1YA 1NT0A 1IS3A 2PELA 2BWCA 3D0SA 3CL1A 4MZUA 4BDVB 1FV2A 4KGQA 3WEZA 3O12A 2XGXA 4QQHA 4C0BA 2G4IA 5CKQA 3WG1A 1PGSA 1UZVA 2I45A 5KHGA 3VLBB 3MIDA 3VKLA 3ZSKA 1J59A 1SLCA 4AFCA 4H14A 3POBA 1B35C 1Z0HA 3V0AB 2DURA 5C4WA 4K21A 4E27A 2BZDA 4BIFA 4ZY9A 1YLLA 5KXDA 3V0BA 3ZR5A 4YGEA 4BQ4A 1KD7A 1X33A 1Y43B 2D7FA 4I0WB 4R52A 2EAKA 1ZZ9A 5IVVA 2VOTA 1LNSA 1KS4A 1QHDA 4XCAA 2MPFA 1US2A 2WNVC 1GP4A 1J1LA 3RDIA 2FZ2A 1AYM1 5LBFA 3FZ3A 3KCYA 4XUQA 3M3IA 3PU8A 4E4SA 3JQXA 2XVGA 3B5LB 1POV0 4PLOA 2VPVA 1WCKA 1QJZA 1O5LA 2JDNA 1NCRC 2YZ4A 4QX8A 5EYYA 1WGPA 1O3TA 1E5HA 1UMIA 4UW4A 3CKHA 5C8CC 3B9IA 2PHXA 2QBXA 3LDBA 3ZXKA 4D6SA 1D4M1 2XB6C 3LAGA 2HLEA 5GZEA 4DNYA 5IVFA 4BQ5A 1YFXA 3POEA 3S7IA 3CZJA 3ZLIA 1SCRA 4N9HA 3RZZA 3AMNA 2DFBA 5CNAA 2W9XA 1ZM1A 1UPSA 1QKQA 5E88A 5FJKA 3I3BA 1CX1A 5EIYB 1NCRB 4Q4Y1 5FYMA 4CEYC 2A1XA 2HEWF 4PDWC 5C8CB 5CFCB 4CCLA 3TEWA 1W6QB 1UY3A 2AEZA 1AR71 2WA3A 3GXUA 5CFDA 4UBGA 4CXXA 2X09A 4IUGA 4JGZA 5FMCA 2QDNA 3KVBA 4CTEA 1MS9A 4XHXA 2YY1A 1LRHA 3IDBB 4KWKA 4OHZA 5AC92 3ZMNA 2FDGA 4AVSA 4M01A 3ZYBA 1JZ5A 1WBFA 5LBBA 3M3CA 1U0AA 2Q8OA 1V6KA 4JX0A 3N9LA 4PF1A 4PIZA 4CU8A 4CEYB 2LALA 2ARXA 1CWPA 5FZIA 1PO13 1WMFA 3AMPA 1CAXB 4QB1A 4QX0A 1DP0A 3U78A 1RUD1 1DLLA 2XJSA 3LF7A 4XFFA 3NNMA 1ULGA 2W2IA 3I3QA 2VE1A 4FFHA 2XVLA 4QD2A 3WDVA 4OQ9A 2TNFA 2ZEXA 2CHHA 4FP3A 2RMU2 2A6ZA 4FVVA 5FUIA 4ZONA 5FPXA 1WBLA 4R4XA 1QJU3 3K4DA 4U2AA 1QQP2 1YRZA 1OOPC 2HWF3 2D6LX 3PVOA 3POWA 2DDUA 5HCFA 3OBTA 4XDQA 3GBWA 3WNPA 3N7LA 2HWE1 5IFPA 3KHCA 1UZZA 3HEIA 5A6ZA 1WLTA 2G19A 3LDKA 4HK9A 3TYJA 3IDEA 5F5IA 2VUJA 3ATGA 3E5XA 1XE7A 3PL0A 1VBA1 1AX2A 1CPNA 1K5JA 2WO7A 3AZZA 4IERA 4QX2A 4E4DX 1D0GA 4GULA 2BJSA 2KXLA 3JB4C 1GQPA 4RN5A 5FP7A 5GLWA 1OOPB 3ACHA 1OPMA 5GM0A 1W6OB 4HT1T 2WFF1 2IVJA 3NAPB 4GA9A 1PO22 4Z07A 4CDQC 2D6KA 5ABJA 2VOKA 3PURA 5JSOA 2RS51 1HJGA 1AR82 2VMCA 3ZXDA 2O8OA 3RI9A 4IE4A 1BEV1 2ZPXA 2R0FA 3A0KA 3T2QA 2WFF3 4HVOA 5GLZA 3LCPA 1DGLA 4MXWB 4CP0A 3AKSA 2MEV1 4TSVA 4B4RA 4COVA 3I3DA 5I8SA 2NLRA 3MI8A 1RJ8A 4QPGC 5LA2A 1GKBA 2R16A 2QQUA 4GWIA 4KWUA 2GC3A 3ZFEC 4C91A 5CEHA 4B4QA 1W6PB 4QPWA 1C8M1 1DQ2A 1QJY1 5F3GA 1FX5A 1YJKA 3URFA 1RUH1 3VZNA 4MO3M 4D6RA 2GC0A 1AR93 1VBC1 1V6OA 4LBQA 4ZU5A 2DCYA 1MS8A 2UWAA 1OHFA 3AP9A 4Y4YA 2CSGA 5DAWA 3UGFA 4HVQA 4MGTA 3ST7A 5K9YA 1QJY3 2KR2A 5KXBA 1OA3A 1R091 3IIAA 3GZAA 3I2OA 3ZKUA 3WNLA 1AXKA 3ZKYA 2XONA 4Y1YA 5FYIA 4BLJA 3O7OA 1W2OA 3OPWA 5I0DA 1HB2A 3NKTA 3BALA 5F6KA 4OI0A 4QHBA 2PLV3 3AJYA 1ASJ2 4OUMA 3JBG2 5A6QA 2R042 1TVGA 3SKJE 2GMPA 3BKZA 2AH2A 2CYFA 2D44A 2C0ZA 2J1EA 2OPKA 2YGMA 3MEPA 1A78A 3MUZ1 3S30A 1EUTA 1G9FA 1O8SA 1W06A 2BNOA 1S0EA 2LTNA 3AVSA 1JOPA 1UZ0A 1MVEA 5FP8A 1WLCA 3WW4A 2CGNA 1UAIA 4EJRA 1FAYA 2EVXA 3SC7X 2X8KA 3ITQA 1UY2A 3OD4A 3FJSA 4QM8A 3DYPA 4MGQA 1SBFA 4J1XA 1MEC1 2EIEA 1JZ8A 4P9WA 3F95A 1NXD1 2VZQA 4I3GA 5JOWA 2B7YA 4BMBA 5C70A 4ZXEA 1MACA 2JDHA 4XIKA 2GH8A 1UOFA 4QDQA 4Q4W3 1DLCA 2LROA 4JDNA 4D7TA 1NLSA 4MLOA 4QX3A 4CCJA 1VBB2 4S2HA 4YLZA 4CEWB 2VO5A 1PVC2 1ODNA 1V9U1 3VBSC 3JD72 2TUNA 1E5RA 3WT3A 4B4PA 4CP9B 5DDJ2 4CDUC 1U5XA 1RTVA 2W1SA 3P5BA 3VBHC 4IV1A 3WF4A 4AAPA 1W8ZA 3I97A 1X9PA 4NUBA 4YFWA 2P2KA 5D2AA 3UK9A 4V2WA 4XVHA 2DCJA 3KWVA 1W2AX 1CN1A 4XJUA 3VDDB 5K4LA 1PK6C 4HPKA 1UU6A 3KF3A 4QX1A 5FKCA 2CGOA 3WUDA 1XU2A 4QQOA 5ERLA 4RQPA 1OKOA 3SITA 3ZYRA 1LCLA 2J1UA 3WF3A 4Z92B 3WCRA 4W4ZA 2CAVA 2WSUA 5IAVA 4PHZA 1ND2A 5IK8A 4WV8A 4BIOA 4L2NA 2JKXA 4JRAA 4NHLA 1ZZ7A 2Y34A 4EN7B 4XYXA 4R4ZA 2WNUC 4WZCA 4FP2A 2VMGA 1XNBA 2YGLA 5E6HA 4ATEA 1JN2P 3ZMOA 4A4AA 1HN0A 4TZDA 1VBD2 1KXGA 2QDRA 2BVBA 2XL7A 3IB3A 1VPHA 1I6XA 1A6CA 4GH4C 3CJIC 1G86A 2G9FA 3AKPA 1H30A 3VD5A 4LORA 3WDWA 1NOVA 3AP5A 5FYSA 4QGLA 5GLTA 3ZYFA 3UETA 1OI6A 5FY1A 2PQSA 1ENQA 1DYOA 2WSVA 3IN9A 5LW9A 2BFUL 2WABA 3OGGA 5DAQA 4NRPA 5FYYA 4W65A 1MZFA 2V72A 5A7WA 3U1XA 1WA4A 3W59A 1GP6A 1FPN2 3RWKX 1R1A1 3CJIB 4QQLA 4QXHA 3EMRA 3JUUA 1RUC1 3J8F3 4LPLA 2ZS6B 1HW5A 2ARAA 3MICA 4I0AA 3NNGA 4TLFA 5LY1A 3O1SA 3HNMA 2VNRA 5FYVA 5CKNA 1R081 4FO9A 1GP5A 2RHPA 2VGDA 2W94A 2DTWA 1TQ5A 1CIWA 2WJSA 3AMQA 3FHQA 3NV4A 5LA9A 5LRRA 3N35A 3N4MA 1JZ6A 4TLGA 2BWAA 1OQEA 3B7MA 3VBOA 1LHNA 1POV3 4ES8A 4HZFA 3HN3A 1HRV2 4Q4V2 2UY9A 4C90A 2JG9A 2DCTA 4AI8A 1NE4A 4N43C 4D6QA 1OXCA 4QPIB 1S0IA 3USSA 1SEFA 4IGOA 2CAUA 3NNFA 5ISLA 1RUJ2 1RUOA 2QJVA 4ZZ8A 5EXOA 3LOBA 5FZ6A 4A3XA 1QGLA 2GN3A 4IEOA 2XPJA 5FYCA 5FWJA 4CDXC 1UQXA 4E9KA 1CZVA 2R062 1AYN2 2CY6A 5ACA2 3AKRA 1OA2A 5T55A 5HXVA 1LOFA 4JKKA 4URTA 3WHUA 3VKMA 1U5IA 5FPAA 3FFZA 3OBZA 2RS32 3LA3A 5J37A 5A33A 4YGDA 1YQ6A 1H6XA 1Z7S2 1F5FA 4Z1VA 2P37A 4QWNA 2WS91 2YV8A 2XL9A 3KD4A 2Q8EA 5HCAA 1HRI1 1JYCA 1KFXL 2AC1A 2DUOA 4XHBA 3NRUA 4Y22A 4CU7A 3VD4A 2JG8B 2ZX2A 3AZWA 4IE6A 4LR4A 4XUPA 4CCEA 1S0JA 1UY4A 4NHXA 4XFCA 4MSVA 2EXKA 2QZ2A 2R1BA 2ZHNA 3H1MA 1FMD1 1GQHA 3ZFFC 1O4TA 4AXOA 1ND3A 2ZAHA 1EAH3 3PVBB 2ZCWA 2VZVA 4Q4X1 2QE3A 3PU3A 1VJ2A 2RDQA 4WVMA 3R05A 3MF6A 5FXZA 5T50A 3ZYIB 4B7KA 1YUDA 3ZN6B 1RGSA 1NA1A 4NO4A 2PMWB 3RVHA 3V65A 2QUOA 1UZYA 2W87A 5FPUA 3K51A 5C5UA 4BZ4A 3ZFFB 1F5JA 3VUOA 1N1VA 3VD7A 2F17A 2OT7A 2RJKA 4AYUA 3S6PA 5C3QA 4GWMA 1MZEA 1WCDJ 2SBAA 3OTFA 1GMMA 2OA2A 3HJRA 1H1AA 2WNOA 1DDLA 2I2SA 5E8AA 3MZHA 1KS5A 1SLAA 1YIFA 5C6CA 4A7KA 3K2OA 1Q8OA 1SPPB 4FPEA 1O3QA 5FZHA 4AI2A 4AL9A 1DGWX 2FCTA 2WWSA 4S2DA 2JKBA 2ORZA 1RUF2 2E26A 2IXIA 3S0MA 2Q30A 5JVVA 4FPKA 2WA4A 5LWBA 4YM1A 2K0GA 4HBNA 1YC61 1GNHA 2ATFA 3AYEA 4HSJA 4LLFA 2C9KA 2RM22 2X5IC 2VVFA 3IAPA 5JSRA 3KV6A 3AYAA 3H0OA 2J42A 3DKWA 4DFSA 5GZGA 2FZ1A 2JIJA 5KR7A 2HWB1 2G1MA 2Y60A 4M0NA 5LZ6A 5A3UA 1FATA 2DVDA 2QQLA 4JDMA 4Q8KA 3FX3A 3WCSA 3J9SA 5K0UA 1S2BA 1EPZA 4AW7A 3JQWA 2CDPA 2A5ZA 1QU0A 1KJLA 2ZKNA 5CG8A 5FBZA 4KBZA 5JLVA 1JU3A 3AVRA 3B9CA 1LU2A 4Q1PA 4URAA 4LOSA 3DPRA 5BNPA 5FR3A 1RL3A 4E4ZA 2PHTA 2Y6FA 4QDRA 1C1FA 3HT1A 2JENA 1WW4A 4PQQA 4QHOA 4H55A 4W6XA 3ZPOA 4LBOA 4NHMA 2JWPA 4AQ6A 4NWVA 3U75A 4FPLA 1ENSA 2RS13 3HQRA 5IUQA 4LBKA 3MGUA 1XOYA 5A1AA 5HV4A 5KC6A 3P3NA 1QEXA 3H8XA 1RMU1 3ZXLA 2X10A 4ZU7A 2Z69A 1OPOA 3M7AA 5DAXA 5C4WB 4XACA 1DYPA 4OZXA 2YBPA 4XIOA 4Q0VA 3SMHA 4CCKA 5IK4A 3V0BB 2WN3A 1X8EA 2OX0A 3NO8A 4H2AA 2I74A 4XTPA 1DU3D 4AEDA 1T2XA 3NL1A 1AX0A 2OUHA 5FY9A 1ZBA1 1VMJA 4XUOA 4HXCA 2IWGB 3ES1A 1XRUA 2BV4A 1MS1A 2C5DA 1ST8A 4ZKTB 2BPA2 4LBJA 3L2YA 1BMV1 2VTXA 3THDA 2ET7A 3SCGA 4AOCA 3MFAA 4YW4A 5D8AA 1C5HA 3THPA 5FZMA 5T5PA 3PVEA 2WYFA 1JUHA 3KM5A 3MLLA 4JV4A 1D2QA 5F5CA 3S5AA 2QNKA 1W0NA 5IVJA 5JPNB 4P9YA 2HWC1 4H7LA 3DN7A 3ZO0B 2E7AA 4RGAA 4Y26A 3C7OA 3AX4A 1SQ4A 2RV9A 3HMYA 1WW6A 4IEWA 4E8CA 2VL4A 1PZ8A 1NYWA 5JDBA 4WVZA 4ASMB 3OB8A 3B94A 4XXPA 3FE5A 1VB2A 3G7DA 2XHKA 3UNPA 5JOZA 3BYWA 4NRQA 3ABZA 5AFBA 3FBYA 3N36A 5DN2A 5BPXA 5JI7A 5CFDB 4JGZB 4LHSA 1KITA 1LJ7A 1YFWA 4FAGA 2VULA 1WKYA 1HQLA 3ZN4A 4CRQA 3SNMA 1NLQA 1XYNA 2DVAA 2YXSA 4L97A 2OQ6A 1E5SA 5JZGA 1KRIA 2C24A 1W39A 1ZZCA 2WNEA 4LIVA 1CD3G 3I2DA 2VD7A 2YYOA 4NOTA 4PQ9A 4Y5TA 1W3XA 2Y6KA 2DYCA 5IVYA 3D82A 1MPXA 1I5ZA 4CCCA 2BW8A 2QQMA 4KH9A 1OLMA 3ALQA 1OC1A 4V1PA 3H8UA 4Q0UA 2BUKA 2WYSA 2PYTA 2ZGRA 1NCQA 3I54A 3IMMA 4UFKA 5JXIA 3RZKA 2L9LA 5DZEA 5DUUA 2VUDA 1TMF1 2RMU3 2UURA 3WDUA 1L7LA 4YVWA 3ZOIA 4OFGA 5I0UA 5A3LA 1U5YA 3K4AA 1L7QA 1QQP3 3A22A 4KGGA 1BZWA 3UL2A 4A6OA 2FBEA 1PNFA 1A8MA 1VR3A 2RG4A 2V5DA 2YC2A 3HOBA 3LIHA 1GANA 3BN6A 1NZIA 3VBRA 2XJRA 1Q8SA 1PIV1 2VZTA 4GB31 4RA0A 5FY8A 1Q5OA 1GWMA 1YO8A 5L9VA 2K46A 5IJRA 2VZOA 3C2UA 4ZZ5A 1NXMA 5F5QA 3UKTA 1R1ZA 4D7YA 4KBBA 1KDKA 4FPJA 5DG2A 5A70A 1KEXA 2QTWB 1WZXA 3O0WA 2OPWA 4Y3OA 1REFA 1RUI2 1OVSA 3KT4A 3ZFGA 2V73A 4CP1A 1PO23 4RHV1 2KA3A 5FPBA 1BBT1 2CDOA 1W9FA 1AR83 4YVSC 5ABJB 3I2FA 1QIQA 2GNMA 3FUOA 1RUG1 2ZGLA 4HKOA 4ATFA 4BHPA 4FTBA 4R9CA 2VMFA 4META 2GC1A 3GZEA 3T4VA 1HXS2 2K9ZA 1LOCA 4XJ8A 5F2SA 4DXSA 1G9DA 1EY2A 4XQ4A 4JGYC 1YFUA 2QZ3A 4XEZA 5T3NA 2ADEA 2OQ7A 4D7SA 1F4HA 1F2NA 1W9TA 3BUCA 4JDOA 5BV6A 3L2HA 1XU1A 5J1XA 4OI2A 4C0HA 3BU7A 3THTA 1S4CA 3DYMA 2E7QA 4WM7C 1GZCA 5GZFA 1J58A 3DXTA 3IMNA 3OY8A 4LBQB 4IXLA 3W20A 3U4XA 4QAWA 4BH9A 3N9NA 3ZSMA 1DGWA 2RR12 3DEMA 5FZ1A 2JDUA 3K46A 4IV3C 4IE7A 3RZGA 1IKQA 1O4ZA 5H9PA 5T5OA 4XJZA 5C33A 1NY72 2DU0A 1ASJ3 5FP9A 2DV9A 2BEOA 3JBG3 3KT1A 2R043 3PUIA 3VBFC 4Y33A 4QKNA 2P6CA 3RMYA 1SLIA 3JZVA 5FYHA 3K3OA 3UGGA 1JHJA 2DCZA 4PLNA 3O1UA 3POYA 1COV2 2HH9A 3AC0A 4IEYA 4IGPA 1QJEA 1Y9MA 1GR3A 1I9RA 1LOGA 1DFQA 4PT6A 2XBO2 1CZTA 1QJX1 5APAA 3TEYA 3ACGA 4NIGA 2FDHA 3LPGA 4YZ1A 1DF0A 3B93A 4MOAA 4OI1A 2Q8CA 4COUA 2QQJA 2D93A 4Y5SA 2JDKA 2AUYA 4BXSV 1YXWA 1LECA 3U14A 3T2PA 4HSLA 5L19A 4AI0A 1QJX3 2PN5A 3K48A 4Q29A 3VD3A 4DIQA 1F31A 5LB6A 1HN1A 3PUHA 3UT0A 2EIGA 4COWA 1UZWA 2PFWA 2VW1A 4K7JA 4IEZA 1JHNA 1VBB3 1RVF3 1QH7A 4QPYA 1GOHA 1PVC3 1W9WA 3QCWA 5FREA 4DXRA 1GLHA 5FZ4A 4RQPC 3U10A 3JD73 5I8YA 1UCXA 3NJVA 1S0CA 4CDWC 4N90A 5DDJ3 3RQ0A 4IL7A 4G3YC 1V6MA 2O14A 1RHI2 4RS5A 3Q8AA 4UW6A 1O4YA 1VMFA 4IV1B 1R64A 1W3VA 1WCQA 1UO9A 3AM2A 2DCKA 5BNOA 3N7MA 4ZS3A 3N9QA 3IZOA 4EWEA 4LT5A 4XW3A 4HPKB 1XXNA 2JDMA 1WLDA 2FQPA 4Z8BA 1Z78A 4AGVA 1AR62 3ZX7A 3CNAA 4RQPB 2P3KA 5CB7A 1UYXA 1UL9A 1BVVA 2W95A 5HBAA 4CCDA 3ES4A 4WM8A 4IEVA 2WR9A 2AZ5A 1FI2A 4YGCA 2XWBB 5FK8A 3ZDSA 4OHVA 1ND2B 1HB1A 3MIBA 2GNBA 1CIYA 4RR3A 4QXCA 2DF7A 1XYPA 4JAAA 4B8EA 3GZTB 5FZ7A 3USUA 1YI9A 1UY0A 1VBD3 3LFMA 1STMA 4AI3A 2QCSB 3U4SA 1W8OA 2XJTA 4YFZA 5BNNA 5CFCC 1LU1A 4UF0A 1QWRA 4XPVA 4DRVA 1LHOA 5C9AA 4LXLA 4ARXA 3HNBM 1CJPA 2OS2A 2QFEA 1EUUA 3P3PA 2ZHKA 2ZACA 4JQRA 1ENRA 1MR5A 2OZ6A 1OQDA 3PMEA 1RINA 4AVBA 1QXRA 2ET1A 4OYUA 5DG1A 4CUGA 1POQA 2F4PA 1W2UA 1X82A 1IPJA 3TN92 3AZVA 4YM3A 1AL22 5A7WB 1G7YA 1GU3A 3JB8A 3OGSA 1FYUA 3INAA 4XILA 4YM2A 3ZYHA 1O6UA 3MUY1 1ZBA2 4AEMA 4DUWA 2VMHA 5A6YA 3A21A 5L7OA 3BTXA 3A4UA 4LO8A 1ULDA 4FPYA 1ZBE2 4P9LA 1PO11 4BE3A 4FOWA 1OBNA 4YG6A 4DB5A 2P6HA 2VZUA 3KT7A 5FPLA 3ZSJA 5F37A 3BU0A 4N53A 1DQ1A 3LDRA 3U11A 4BQXA 4YGBA 5GLVA 1PGL2 1ZA7A 1MS4A 1JI6A 2YB7A 1ZX5A 2DUPA 5FZOA 1IG0A 1HRV3 2ZX4A 4Q4V3 4M3CA 3VBOB 4R9BA 3WF0A 1UMZA 4XABA 3ZYGA 4JKLA 1QJU1 2JG9B 3C7EA 4BQ3A 4NIAA 5AVAA 3RGBA 1DZRA 2HWF1 5FZEA 2E33A 5KXEA 3OEAA 1RUJ3 2B42B 3DKQA 4V2VA 3WP5A 1VBE2 2WZ8A 1OSGA 2R063 1AYN3 4AFMA 5ACA3 2R32A 2WZR2 4EN9B 3O1OA 3LKJA 1Q43A 2EAAA 3AYCA 1BK1A 3D6EA 3NAPC 3BGAA 2WFPA 3AP6A 3ILRA 4X6RB 1JH5A 3POIA 2F4LA 4L0PA 5L73A 1VRH2 2RS33 4XFIA 4CP2A 2GMMA 5A6XA 1Z7S3 5A33B 5FOJB 3N3HA 3I2JA 1OLRA 4G4FA 3FWEA 4OI4A 1GOFA 4GZ9A 1JU4A 4Y22B 3PUQA 3UJOA 2EA7A 2B8MA 1Y3TA 2VY0A 2SLIA 5CYYA 5A7SA 5E1RA 2GMEA 3DECA 3HBZA 1PX3A 1H8TC 4AHWA 2D3RA 3GM8A 1MQTA 1ACCA 5AVPA 1ND3B 2RJ2A 2X53S 3VBUA 2XJUA 2WWJA 1F9KA 1AX1A 3AB0A 2X05A 1K45A 4WVMB 5F32A 1L3JA 2V09A 3AKQA 3AXEA 3NV2A 1W6MA 1AR91 1LGBA 1NA1B 3SHRA 4LO4B 3ZR6A 4YZ5A 1S1AA 1SFYA 1OH4A 1TNFA 1TME2 2WO1A 1H8TB 2OYZA 2WO3A 4AVAA 2HKXA 1X7NA 1CAVA 1JODA 3CEWA 3GCWA 4RFT0 4FBFA 4XMIA 1IS4A 3J7MA 5FZBA 5FO8B 3SEEA 2ZX1A 2J1TA 2PLV1 1EYBA 3SCHA 1AF9A 4FPHA 4IQPA 1JYTA 2YC0A 5LA0A 5JXHA 3GJAA 1CVNA 3D5OA 1PZ9A 2JE7A 2V4VA 3RZLA 1FOD1 1WMEA 1IPSA 2ZMNA 1AUYA 3ORJA 2VQTA 2VTFA 3C7FA 3SKVA 1RUF3 1OUSA 1QXPA 3KV4A 1SACA 2ZABA 5EZWA 4XZUG 3KCCA 3BCWA 2H6CA 3MFCA 3R4UA 1CZSA 1H1IA 5DQ0A 2Z2SB 1EV12 2HYXA 2RM23 2PHRA 2R0HA 3ACIA 1FOD3 2J1VA 1O91A 1JS9A 3VL9A 5T5LA 3I59A 1YQCA 1V6NA 2IXCA 1RITA 4CPBA 5IVEA 3ZIXA 3D4KA 3ZXAC 5FZLA 1K5MC 1UWWA 3EBRA 2D40A 3CO2A 3ZDVA 4LUMA 3WW3A 2J1RA 5LK5A 4LKEA 4B3NA 4W6YA 2ZGSA 4Q4W1 2WZPP 4CEWC 2J1AA 5IVCA 3KMHA 3H8RA 5FK7A 1C4RA 5EQUA 2XWJB 2Y33A 3L9JT 3T0DA 3DPRB 5BNPB 2PTMA 3NKGA 2JD9A 3P6BA 4XE9A 4DXTA 2BOIA 4D0QA 1K5MB 5L9BA 1DIWA 3VDDC 4UFJA 4RSUA 4AHXA 3DGTA 4GIQA 3F2ZA 1I5PA 1PM4A 4PI0A 3BIEA 1US3A 1RUE2 2D6MA 2JD4A 4LO5B 1DBNA 2ADDA 2WRAA 4LOTA 2Y8KA 2YU1A 4BQ1A 1LESA 4EROA 1FT9A 5A3WA 2ARCA 2JB8A 3A7QA 2LUWA 1ZVFA 4KL1A 3FC0A 4Q26A 1G9AA 1H2KA 4FT8A 4AEDB 4DS0A 3BPSA 1HV0A 3VKOA 2R072 4Q0QA 4NIIA 1OLQA 3G6JB 1LGNA 4KI5M 3TEXA 2R1DA 2KM2A 3O1TA 1IKPA 1YHFA 1S0FA 4JQTA 2NMOA 5C8WA 4BK5A 5D8AB 1ZZBA 4OMDA 2XJPA 2E6VA 3I2IA 4MHUA 1DYKA 4I02A 4XDOA 5KWRA 4HOOA 4JTOA 4ASLA 1V0AA 4DRRA 1H4GA 3AKTA 3E1F1 4W50A 1YQ2A 2B9VA 1OFSA 1PNGA 1UF2C 1UKGA 3PVNA 1EP0A 1XJAA 2D97A 2QQKA 3I2GA 3W5MA 2VQ0A 3J8F1 1K42A 4LKFA 4NAOA 1B35A 2OIIA 4IEQA 1UOGA 5FZ0A 1VRBA 3VHPA 3VZMA 5FXWA 4A2UA 1NQJA 2Q1MA 4A45A 1SZBA 4I2OA 1VAKA 1CPMA 3EYPA 3ZXEA 4J1WA 4K1ZA 5G04L 4AR2A 3CIHA 1GUIA 5FBJA 5JSPA 1POV1 4C1WA 1AYM2 3IPVA 4QPIC 2BFUS 4ES9A 5JZGB 1Q8VA 5EP9A 2ZBJA 2WNVA 1JOJA 2DBNA 1HV1A 2PHLA 2J7MA 5KHKA 4L99A 2ZGQA 1N1TA 2WQZC 1O8PA 1NCRA 1LEDA 5LY2A 1NCQB 3KCXA 4FOVA 1D4M2 5C8CA 5FZDA 2IUWA 3QH7A 1W6QA 3ACLA 3I3EA 4YVWB 3BI3A 4DMIA 3AMMA 4YZ2A 3FMGA 4OHWA 3WLUA 1LTEA 2BRTA 3SCFA 3PUAA 1AZDA 1FV3A 3WQ0A 4P9JA 4Q4Y2 3VBRB 4FPOB 4YRDA 3E6BA 3KSCA 4XF9A 2E31A 3MV01 3Q8BA 2NMNA 2JG8C 4OUEA 1O59A 5JIAA 5DAPA 1AR72 2A6WA 2OVUA 4PDWA 1BCXA 2IXJA 3AYDA 4LKDA 1XB9A 4YW7A 1KQRA 4XBQA 4QM9A 1RUI3 1UX7A 2GNDA 5J96B 3ETQA 5LEKA 3ZFGB 1MVQA 2YBKA 5J98B 1CR7A 4HK8A 1GYKA 3V64A 3ZIWA 5T52A 2MNGA 3OUHA 3T1LA 1EAH1 1WW5A 4FI9A 4NRMA 3UYJA 1D4VB 5CU1A 2CWMA 2YFUA 3NNLA 2A71A 2DU1A 4NROA 1RUD2 1YJLA 2VOXA 4AWDA 2Y6JA 1GWLA 2BNMA 1UOJA 1W2TA 2EIBA 2QQWA 2VBPA 3MPPG 1T6GC 4PF5A 3B69A 2LW8A 1N3OA 4CZSA 4QX7A 3O1PA 3LA2A 3WW2A 5G05L 4FOQA 3TNPB 3UJQA 2LRPA 1O5UA 3ZSEA 2TEPA 4GKYA 4AVCA 1JYIA 5GLUA 2A7AA 5C7GA 5C71A 3HAGA 2QQPA 3RYKA 3AJZA 5FMOL 1JYVA 5LEJA 4OQ8A 3CU7A 3ACFA 2HWE2 4PCRA 5T54A 1LR5A 1W9YA 2JJ6A 2XDVA 2Z5WA 4HONA 2ZGUA 4YW6A 4AFDA 5FAXA 1SBEA 2IZWA 3U0ZA 5FZ3A 1WCSA 3I7DA 1X50A 1PZ7A 2XKOA 1S2EA 3OY8B 4LBQD 1PGW1 1VBA2 3AL5A 1J3RA 3MW4A 1T6BX 3NJXA 3TNQA 2RR13 4TWTA 1RJ7A 2P3YA 1KFUL 1C1LA 1VIWB 5A3NA 1LB2A 4QQ2A 5BYNA 3HQUA 4FTSA 1PMHX 4F7ZA 3AP7A 2WFF2 4H3WA 1RIRA 2IFWA 4UXAA 4Z82A 5FP4A 2RS52 3FUQA 3C8XA 5SV8A 4CDQA 2HWD1 4MVTA 2JECA 1W04A 5JIUA 4Y1ZA 4JRLA 1BEV2 1W0OA 2IC1A 2RDSA 1W6PA 1GZ9A 3OOXA 3IAQA 4GAZA 2E63A 5A3MA 4MADA 1COV3 1OVPA 2HWD3 1V6LA 1ZYBA 2VW2A 3A23A 4MX3A 3RI8A 4HN0A 3QD6A 1H4HA 4AE2A 4CYDA 1ZRIA 2MEV2 3Q9OA 5JOYA 4HETA 1WW7A 3LZZA 4Y1UA 4AVTA 2F6BA 3A0NA 4B1MA 3CF6E 4OMCA 2VXJA 1WMDA 2D43A 1RC6A 1C8M2 1ZZ6A 2YU2A 1CESA 1QJY2 3PMSA 4QPGA 1UNBA 1W8WA 3I2HA 4YW5A 1RUH2 3ZFEA 3VL8A 2PHFA 3Q8FA 1VBC2 2D6NA 1NE6A 2DVGA 4O61A 4TXWA 5LK7B 1PX4A 3LEIA 1SCSA 4EYUA 5JMCA 3OBAA 5C4WC 2RS11 2VZPA 3GDBA 3T0BA 1DG6A 1UOBA 5GZDA 1JBCA 1R092 4LHNA 4M3CF 2RJLA 4QHZA 4AGGA 4XAEA 3K75B 3NNJA 3WNXA 3FHIB 4BLIA 2DVFA 1XC6A 3OF1A 4DINB 2ZGMA 4CU9A 4AQTA 4C8DA 5FWEA 1SBDA 1SLTA 3OJBA 4OCTA 1CGPA 4RS5B 3H3ZA 4X8PA 4F8AA 1JW6A 1FNYA 2Q1FA 1QJFA 2VMDA 4M00A 3UKVA 3WDTA 4DPNA 2ZMKA 3RPQA 5BNOB 4Q0SA 4I3PA 4U36A 1AR63 1LENA 1XNDA 2K2SA 2EF6A 2R30A 5FIXA 2A6YA 5A7QA 2A73B 4UW3A 2W0XA 1J84A 4P9GA 1DQ4A 5F8PA 4WM8B 1WD4A 4XDPA 3AP4A 2VZRA 3IM0A 1MEC2 4RR3B 4J25A 1W6NA 3SLIA 4A7YA 4UOJA 1MS0A 3DV8A 3W9AA 2B45X 1AJOA 1I1EA 3USUB 5FZGA 5IATA 3T1MA 4UWDA 3OPZA 4ISRA 4ONUA 5BNNB 5JXGA 2VH9A 4GJZA 5KXCA 4UF0B 2ILMA 5C9AB 5CFDC 5C5TA 3VD9A 1AVBA 3LB9A 3M1HA 4ARYA 4JGZC 2P17A 1ZNPA 4M4RA 1IS5A 1V9U2 2FHRA 5JUVA 3TN93 3J7LA 3WP6A 5AC91 5IHRA 3VBSA 3H50A 3MW2A 1JYWA 4FPCA 4FFIA 2OUJA 4NAMA 4DUVA 1AL23 4KG0A 2PHUA 4CDUA 2W1WA 3VBHA 1G9CA 1IPKA 2JE9A 3WOGA 4R9DA 3KVAA 1OT5A 1DCSA 5L7OB 1ZBE3 2E53A 5AC93 1Y9QA 1K3IA 1PK6A 4GWJA 2FDFA 3HNYM 3GBGA 1UD1A 3DF0A 3LFIA 3MIHA 5FUPA 3AK0A 2VM9A 3LEKA 3FFQA 1J3PA 3WQ1A 2CV6A 2G9ZA 5EHDA 1ENXA 2RMU1 5FQ0A 3E6DA 1IQAA 3M3OA 4M3CB 4Z2AA 1QQP1 1N3PA 2WNUA 1GQGA 3R0RA 4CU6A 4PIYA 3I49A 5LBCA 4K1YA 3U07A 2VC9A 5EV7A 4XQWA 5BY5A 2YBSA 3AFGA 4GH4A 4CDWA 2PQQA 1H9WA 1UMHA 1VBE3 3CJIA 1H9PA 2IXLA 3B00A 3DL3A 2CL2A 1KDMA 3J7HA 2PAMA 4BQYA 2WZR3 5J7MA 2RVAA 2P3JA 2Y38A 3Q8EA 4TN7A 1NQDA 2B9UA 5FXXA 1PMJX 1OA4A 3ETPA 2XOMA 4XF1A 5FLHA 3NJZA 1YI7A 2O1QA 5ABJC 4NE9A 4QKFA 4HKWA 4LEJA 5CA6A 1R1A2 5IVBA 1APNA 2JDYA 1PO21 4JVAA 1RUC2 5I0RA 1H2LA 4OULA 1YEWA 3ZSLA 2BYVE 1AR81 4DY3A 4NVPA 3MO4A 3O14A 5FZ9A 3KF5A 3RS6A 3VBUC 2A3YA 4L9BA 1R082 1Q8PA 4NR1A 3MLJA 3O1VA 4UYBA 4MGYE 2OXBA 1OKQA 2VZ1A 5FCCA 1BKZA 1URXA 4MYEA 5IK7A 2FCVA 3B02A 4MGIE 2EIDA 2B4KA 1MQTB 2Y26A 5B4NA 5KHHA 4IE0A 4NPLA 3VBUB 4N43A 2BBAA 1OF3A 2GU9A 5M0TA 4D94A 1WD3A 1FNZA 3RJ2X 1SG3A 1HDKA 2WZEA 3TBDA 1W03A 4IGQA 4D8MA 1TEIA 3IWZA 1OURA 4Y1XA 1W6MB 4XJAA 3VZOA 5FY4A 3GJBA 4WZFA 1TME3 5D1IA 2XJQA 2UYBA 4CDXA 5EWSA 1Y4WA 2VVEA 3OYWA 4FPFA 1HQWA 1CAVB 2ZHLA 4AVVA 1NAEA 5A32A 1QMJA 4ISQA 4AEJA 1NUKA 2GDFA 5CKMA 5HI0A 3VHRA 3SISA 4AQSA 2ZA9A 1JMUB 3ECQA 2ZGKA 2FDIA 5K7PA 1ASJ1 2WS92 3JBG1 3ZXFA 2R041 3C7HA 5LBEA 4BQWA 1HRI2 4Q27A 5I0SA 3MHZA 3LEGA 3IKWA 4XBNA 3WD5A 3N9PA 1UX6A 2Z4FA 1S0DA 3POFA 1HX6A 2BGCA 2FMYA 3LEMA 4P5YA 4XQDA 5L36A 5FZFA 3ZN6A 3B01A 4K8RB 3O1MA 2Y6GA 2I07B 4HN1A 3K77A 1FMD2 1EV13 2VU9A 4E4HA 1BVP1 1HLCA 1XBFA 1IG3A 4F83A 3JXSA 3KQRA 5L9RA 4Q4X2 3U37A 3VDCA 2A75A 3FHAA 1DZQA 1CAWA 3LQCA 3RNSA 3SH3A 1JYXA 3VZJA 1XE8A 4E2QA 3I59B 1GICA 4XFBA 4F3JA 2ZZJA 1EPWA 5GALA 1OUXA 3LE0A 4LBMA 3VHNA 2C26A 2W08A 3EQEA 1CJDA 1W8TA 5D21A 4AG4A 3PTYA 1AJKA 1BLZA 2HEVF 3WV6A 1REEA 1SHWB 4QDSA 2Q1ZB 4QKDA 1WA6X 2A3WA 1VBB1 2QVSB 1RVF1 3WF2A 1PVC1 1W05A 5FY0A 3BTYA 4IV1C 3HPNA 2BVVA 3JD71 3QACA 1UPIA 3WVJA 1OD3A 1VAMA 2ZGNA 3OUIA 5DDJ1 4XBLA 2O0OA 4ZU4A 3W58A 3RMXA 5CG9A 5J36A 3HBKA 3SXWA 3FN9A 3J26N 4UBHA 1HQNA 4FAHA 3WG4A 1ZRDA 5F3IA 5A1LA 1AXZA 1JZ4A 3O1RA 3T4HB 3PIJA 1M06G 4P14A 4ET7A 4W8JA 2CTVA 1ND2C 1QDOA 2UWBA 3V56A 4A44A 2A3XA 2XUEA 5FZKA 2XH6A 2VTXJ 1D2SA 1YWKA 3JU9A 4ZS2A 2X5IA 3WP4A 2WT2A 1HIXA 2HEYF 3BOPA 3M3QA 4INDA 4XCBA 2HWB2 1RB8G 4ZHNA 4GMP0 2P1BA 4P5HA 4ORFA 4XC9A 2XXZA 3ASIA 4AFAA 2ZX3A 1VBD1 3BPZA 4FQ4A 4YZ4A 3WQBA 4CCOA 2QQIA 2WKKA 1GNZA 1TG7A 1IS6A 3MIFA 5F5AA 3FLTA 4E2SA 2RS12 2PA7A 3VKFC 1N3QA 2ORXA 1XNCA 4BMEA 4K9SA 4L8QA 4Y1VA 1A34A 1ZRCA 4IDZA 4FTEA 5J09A 4I09A 5TSWA 2AEYA 3BTZA 3O5SA 2WN2A 3WINE 1FPN1 4LHLA 1RMU2 1QF3A 5DPNA 1J83A 2XR4A 5JPMB 4UI9L 1AHSA 4TTGA 1B35B 5IAXA 3KQ4B 4IEUA 5DAVA 3UKNA 1H6YA 3E5UA 3FLPA 1FPN3 4I30A 2WQ4A 4XOGA 3VBOC 3B3QE 3TWIA 5JOXA 2FCUA 4YPJA 4K6BA 2JG9C 3ZN5A 1AYM3 4N53C 1GZTA 1HRV1 3KHBA 4LLOA 4Q4V1 4DO0A 3IPVB 2E9QA 1QH6A 2V4AA 2DVBA 2ZX0A 1W2NA 4JCKA 4LHKA 4AI9A 1BMV2 1F15A 5CZKA 2WNVB 3ILFA 4M4PA 5FKBA 3EB7A 4CCNA 5DZGA 3AZXA 2W1QA 1RUJ1 2J1SA 3CJXA 3H1YA 3QH6A 4FSJA 4HG6B 1J3QA 1QY4A 3D0JA 3LPFA 1A8DA 1NLRA 1U12A 1VLNA 4JHTA 3OPTA 4LO6B 4UFIA 1ZRRA 1D4M3 1JOBA 3T08A 3WHTA 4EN6B 4J6GA 2R061 1AYN1 2BOJA 3DXUA 5ACA1 1LOFC 1CAUA 1LOAA 2V5YA 3LD8A 3MLKA 3PTRB 2HWC2 2D5HA 2NPIA 2VBBA 4OUSA 3HT2A 3RFRA 3WF1A 4UFLA 4DUXA 2FD8A 4Q4Y3 5I91A 4XMAA 2RS31 2GSYA 2VJXA 2FDKA 1W8FA 2VVDA 1Z7S1 3MYXA 1OLME 3WNOA 1AR73 3KZ4C 1BK0A 2E51A 5JR2A 1BQPA 4PDWB 4YZ3A 2VNOA 3SEPA 1BHGA 2W52A 1SFPA 2ZZQA 4XFGA 1V70A 2W47A 3DYOA 4CSWA 2VR4A 5JMOA 4SBVA 1ND3C 2EXIA 1H0BA 4BQ2A 3KLSA 3VV1A 4LUKA 1V6IA 2DBIA 2CU5A 2HJIA 2R49A 2Y64A 2YMZA 3MPBA 3KGZA 4P9IA 3BB6A 5CISA 2ZHMA 5CADA 1NA1C 1RUD3 4YSFA 3ILNA 4UFHA 1QXJA 1OH3A 2NM1A 4WVWA 1XSQA 4AK3A 4YW1A 3C7GA 4N9IA
chains in the Genus database with same CATH topology
5A3OA 5D2AA 2JDUA 2JDKA 5A6ZA 3DCQA 2JDYA 2JDMA 1OUSA 1OURA 5A6XA 5A70A 2JDHA 2JDPA 2XR4A 5A6QA 5HCHA 2BV4A 2BOJA 1OXCA 1OVSA 2BOIA 4UT5A 4CE8A 2VUDA 2VUCA 2WR9A 2CHHA 1OVPA 1UZVA 4AOCA 5A6YA 1W8HA 2JDNA 2BP6A 1OUXA 2WRAA 2VNVA 1UQXA 1GZTA 3ZDVA 1W8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A3O A;  5D2A A;  2JDU A;  2JDK A;  5A6Z A;  3DCQ A;  2JDY A;  2JDM A;  1OUS A;  1OUR A;  5A6X A;  5A70 A;  2JDH A;  2JDP A;  2XR4 A;  5A6Q A;  5HCH A;  2BV4 A;  2BOJ A;  1OXC A;  1OVS A;  2BOI A;  4UT5 A;  4CE8 A;  2VUD A;  2VUC A;  2WR9 A;  2CHH A;  1OVP A;  1UZV A;  4AOC A;  5A6Y A;  1W8H A;  2JDN A;  2BP6 A;  1OUX A;  2WRA A;  2VNV A;  1UQX A;  1GZT A;  3ZDV A;  1W8F A; 
#chains in the Genus database with same CATH topology
 1TMF 2;  1JUI A;  3ZXJ A;  2LM3 A;  1YFY A;  3I4I A;  3PDQ A;  4QU2 A;  2XKP A;  3ZYJ B;  2WO2 A;  2VMI A;  5E16 A;  4AHZ A;  1UXX X;  1GOG A;  2HWE 3;  1BJQ A;  1PIV 2;  4GB3 2;  3IT8 A;  4K40 A;  1WCU A;  3ZYP A;  2YFZ A;  1XNK A;  4Q2F A;  2GAL A;  1N47 A;  5F3E A;  3VDB A;  3RZJ A;  2WII B;  4N7U A;  1HJF A;  1QOO A;  1VBA 3;  1NKG A;  3NW4 A;  4KNC A;  5FZO B;  4NN0 A;  5EYX A;  1UXZ A;  5E89 A;  2Y0I A;  4CXW A;  2ZGP A;  1RUF 1;  2XUM A;  3H3U A;  4Y20 A;  2CGP A;  5ANN A;  2VNG A;  4QGN A;  2ZJC A;  4R8H A;  4RHV 2;  5DUX A;  1BBT 2;  3T09 A;  1GZW A;  1H2N A;  2RS5 3;  4LE3 A;  4XAA A;  2RM2 1;  4NJ4 A;  4Z2W A;  5B4X A;  3VGI A;  1WUV A;  1BEV 3;  1RUG 2;  2P5B A;  4CDQ B;  5HCH A;  1VAV A;  4YVS A;  2Y0O A;  4LQR A;  3S5Q A;  1Y9G A;  4OHY A;  2W1U A;  4XUR A;  2W3J A;  4OZO A;  5FPZ A;  5K0U C;  4O9E A;  3MBW A;  2BDR A;  1VAL A;  1OF4 A;  1XYO A;  2IXK A;  3GHN A;  4N8M A;  4CUA A;  5HXM A;  5FV3 A;  3NQH A;  2VCC A;  5K8S A;  1QOT A;  3E5Q A;  2MEV 3;  4LUL A;  5FYU A;  4A6S A;  3PUS A;  4JGY A;  2XML A;  1XPW A;  3OCP A;  1QNY A;  2VQU A;  5CBL A;  5F7U A;  1DQ0 A;  3DPR C;  5BNP C;  1ZA4 A;  2W39 A;  2H0B A;  1YIP A;  3AZY A;  2BTV C;  2VNV A;  1C8M 3;  2ERF A;  3ELN A;  2GC2 A;  4AZZ A;  1RUH 3;  3ZM8 A;  4QPG B;  2AEN A;  3CBN A;  4YNI A;  3PHM A;  3W5N A;  5FYB A;  4QKB A;  3ZFE B;  1OQ1 A;  5LRS A;  1C8N A;  1VBC 3;  4YG3 A;  5H9S A;  5K0U B;  3I8T A;  4XTM A;  4KWL A;  4NMI A;  1UKR A;  1MS3 A;  4HFS A;  1GSL A;  4MGS A;  3I3M A;  2RE9 A;  4O65 A;  2GAU A;  4WM7 A;  4D3W A;  4YG0 A;  3PIG A;  3WUC A;  5FMB A;  2XHN A;  2VW0 A;  1R09 3;  2UU8 A;  4XFA A;  2ARE A;  2PAE A;  4MGK E;  4UT5 A;  2A6X A;  1UYZ A;  2JIG A;  2VUC A;  1XQN A;  3OD0 A;  4AED C;  5F2W A;  2BER A;  2GZW A;  4IV3 A;  1C3H A;  4BK4 A;  2ZML A;  2D3S A;  2G9G A;  3HIF A;  3MIG A;  1DHK B;  5FYT A;  3VBF A;  4XFH A;  5IW0 A;  3APB A;  2Q8D A;  4D69 A;  5FY5 A;  3GYD A;  4XUN A;  5I0T A;  5DUW A;  5D8A C;  4DQA A;  1AL0 G;  1QJX 2;  4E2G A;  1ONA A;  1X8M A;  4BPZ A;  5FJH A;  1XNA A;  2WAA A;  5FY7 A;  5IT6 A;  2DFC A;  2NYY A;  1UN1 A;  1L7R A;  1K12 A;  4ASK A;  3BOW A;  4COY A;  3VZL A;  4N7I A;  1MEC 3;  2P3I A;  1UIK A;  4DY5 A;  2IXH A;  1RVF 2;  5CVR A;  3MF9 A;  5EPA A;  1W6N B;  1S55 A;  2N7G A;  5DZF A;  2EIC A;  2WT0 A;  1ALY A;  2RDR A;  2ZEZ A;  2RDN A;  3MIE A;  4P9X A;  2VBD A;  2XLA A;  2VZS A;  4JC1 A;  4ZPI A;  3T2T A;  5F3C A;  1ODM A;  3V0A A;  5IFT A;  2GNT A;  2R6Q A;  4XUT A;  2WQ8 A;  4EN0 A;  1OFN A;  3KB5 A;  1W8N A;  1RYY A;  4AI1 A;  2ETE A;  3GCX A;  3RZH A;  4XF0 A;  2BQP A;  2C1F A;  3N9M A;  4XET A;  1V9U 3;  4NPM A;  5AFE A;  5LA1 A;  3N7J A;  2HBU A;  2Q5T A;  4XZP A;  5FZ8 A;  1M4W A;  3SH5 A;  3NV1 A;  3OGR A;  3OGJ A;  3CMG A;  5JZG C;  2B39 A;  4BB3 A;  3VBS B;  4UW5 A;  4TYS A;  2P4E A;  4IET A;  4MV2 A;  3WY6 A;  4DZG A;  4EN8 B;  2WIN B;  4CDU B;  2ZTN A;  4GMP 1;  4QGM A;  3VBH B;  5F1R A;  3LOI A;  2Q4S A;  2WUH A;  4P02 B;  2VUA A;  2VZ3 A;  4RD7 A;  3RRD A;  2BP6 A;  3FLR A;  5DAB A;  1GWK A;  1NCQ C;  1PK6 B;  2DUQ A;  2XJV A;  1V00 A;  2YRO A;  4GMP 3;  1TE1 B;  2JX9 A;  1SDD B;  4XF3 A;  1SMV A;  3POS A;  4YVW C;  5FXV A;  1NZC A;  4FCA A;  1PVX A;  1HB3 A;  4HMZ A;  4LNV A;  3ZVX A;  1JZ3 A;  4GAL A;  3RZM A;  4PJY A;  5SV5 A;  3WX5 A;  4BM8 A;  2HBT A;  5FQ0 B;  2NN8 A;  3VBR C;  2DTY A;  3I2K A;  2O8Q A;  2VEC A;  2WNU B;  1IHM A;  3UV9 A;  5LCW L;  3GAL A;  5C3S A;  2QKD A;  3H1W A;  4CCM A;  3H7Y A;  5CFC A;  1HKD A;  4GH4 B;  3VB9 A;  4CDW B;  4AHY A;  1YQ5 A;  4FXG B;  1IGO A;  5FLJ A;  4X6Q B;  2MHF A;  2A70 A;  3AXD A;  3ZFG C;  2NP0 A;  4UAP A;  1DGR N;  4M3C E;  1UW8 A;  3PNA A;  3WR0 A;  2OW4 A;  4YM0 A;  5BNQ A;  1RUI 1;  1R1A 3;  3FL7 A;  3CQO A;  1LOD A;  5FO9 B;  4SLI A;  1RUN A;  1RUC 3;  1C5I A;  4CEY A;  1XE0 A;  2FMD A;  2JXA A;  5FZA A;  1SDW A;  4NIH A;  3WXP A;  3OUJ A;  2ID4 A;  1CAX A;  4NHK A;  3RWN A;  1PO1 2;  1R08 3;  5F39 A;  3VZK A;  4K8F A;  4DOU A;  2AAC A;  5IYY A;  3POJ A;  2LS6 A;  4QXK A;  5EJ3 A;  1HXS 1;  3Q8C A;  3T3Y A;  2PXJ A;  4AF9 A;  2VME A;  4KMQ A;  4CE8 A;  4G9S B;  5J3U A;  4LO7 A;  4NPR A;  5JR7 B;  1TZO A;  4HVR A;  4GQ7 A;  1QJU 2;  1ULC A;  3M4F A;  1HXS 3;  2ZKL A;  3R4D B;  2HWF 2;  4PIX A;  4Q0P A;  2WT1 A;  1MS5 A;  2D6P A;  4IES A;  4N43 B;  3SH4 A;  1W0P A;  1CX4 A;  2VXR A;  2EXH A;  3D3A A;  2H6B A;  4I01 A;  2BU9 A;  2CWS A;  1J1T A;  5KC5 A;  3IDA A;  3O0X A;  4WBB A;  4BYY A;  1C57 A;  2W91 A;  3FBM A;  1O7F A;  3N7K A;  5JCT A;  5ANQ A;  2WDB A;  2E32 A;  4CDX B;  3IDC B;  1UU4 A;  1OOP A;  5FLI A;  2RR1 1;  4BIS A;  3OYW B;  3WNM A;  4B7E A;  1JZ2 A;  3WZ1 A;  4CA9 A;  1W6O A;  5KBF A;  3EJK A;  1LGC A;  1NX9 A;  3NAP A;  3QOP A;  4GJY A;  4AAX A;  4GXL A;  5A32 B;  3LGR A;  4BCU A;  3NMB A;  4MGZ E;  1NY7 1;  5CIR A;  2WWU A;  5FZC A;  2XVK A;  3HQX A;  3VKN A;  2WS9 3;  1RED A;  5FUN A;  4BOW A;  1HRI 3;  3D8C A;  2H0V A;  3WP3 A;  5FMO S;  5DUV A;  1B09 A;  3C3V A;  4YWA A;  3ON7 A;  1JYN A;  5FYZ A;  1PMI A;  2P34 A;  1G8W A;  2WLQ A;  2WBK A;  3H7J A;  1QOS A;  4MXW A;  1COV 1;  5B2G B;  2VCM A;  1TNR A;  4PLM A;  1FMD 3;  3LA7 A;  3GF6 A;  4MHR A;  2XBO 1;  4EV0 A;  5FDB A;  4NID A;  1W9S A;  2B5H A;  4RGK A;  1F8V A;  3OSD A;  2BNN A;  1H8T A;  1PM7 A;  3NST A;  4Q4X 3;  4QQP A;  2E7T A;  1WMX A;  4EZH A;  3TOJ A;  1D0H A;  4HL0 A;  1CAW B;  1WWY A;  5I93 A;  2W5F A;  2ZGT A;  4CPB D;  2XBO 3;  4XXA A;  1YCI A;  2Y6L A;  4NWW A;  1AR9 2;  5C3R A;  5J48 A;  2FDJ A;  4JKM A;  1OD5 A;  2BGO A;  1GNY A;  2GP5 A;  1DGR A;  3N9O A;  4M0H A;  3E97 A;  4O9G A;  3WG2 A;  3KGL A;  1FXZ A;  4LJH A;  3GBF A;  1GBG A;  3UGH A;  2AYH A;  1NG0 A;  2YHJ A;  1ZRE A;  1YYN A;  4EQV A;  4KWJ A;  4LE4 A;  3TEZ A;  4RS5 C;  1W28 A;  2VCA A;  1LOE A;  3CDZ B;  4FOY A;  4L11 A;  5EJZ B;  5A7P A;  4BWO A;  2PLV 2;  3ZXG A;  5KHJ A;  1VP6 A;  2ZEY A;  2JB4 A;  1RHI 1;  4XJ9 A;  3OGV A;  2OKX A;  5BNO C;  4YAR A;  5JI9 A;  1ZRF A;  2QQN A;  1G6N A;  3AL6 A;  4XJW A;  4Q5O A;  4QB2 A;  4IE5 A;  1FOD 2;  4JZR A;  4P08 A;  1RXG A;  5A80 A;  4B29 A;  4COZ A;  4KQ7 A;  2EAL A;  3NWK A;  1UYY A;  1WLW A;  3ROU A;  4DXZ A;  3TAY A;  1W8H A;  4BJ0 A;  4OLL A;  4L92 A;  3HD8 B;  1AR6 1;  4BA6 A;  1RHI 3;  1GV9 A;  1PHM A;  4WM8 C;  3NV3 A;  2C4X A;  3W21 A;  2Z79 A;  1LHW A;  3HN1 A;  2C6S A;  4RR3 C;  3HVD A;  1G9B A;  1LEM A;  3ZPY A;  1C28 A;  4FFF A;  4FPG A;  2HWB 3;  2X5I B;  5T5J A;  4E8D A;  3GNE A;  1ULO A;  3RYR A;  3ENR A;  3WG3 A;  1IOA A;  5BNN C;  5FRA A;  3M2M A;  2VOW A;  4AEK A;  5C9A C;  1LHV A;  1K5M A;  3MDP A;  1Q3E A;  5FOB B;  1H2M A;  5CAZ A;  4CVU A;  2YDE A;  4Q4W 2;  5IWF A;  2YUE A;  2HYK A;  3PJQ A;  4Y24 A;  3TRS B;  3LSD A;  3POG A;  1P8J A;  4CEW A;  3PLQ A;  2AGS A;  1CON A;  2KD7 A;  3VDA A;  2ZGO A;  3M3E A;  3WW1 A;  5A3T A;  4Q1R A;  4AFB A;  4O7X A;  4CP9 A;  1ULF A;  5F6L B;  5DMY A;  3QLQ A;  5EFU A;  3TN9 1;  1LUL A;  2Y6H A;  4ZXK A;  4S2F A;  3AFK A;  4Y5Z 0;  5DXD A;  4A41 A;  2GH2 A;  5L7O C;  2BBV A;  3BIW E;  1AL2 1;  4YYO A;  3WQ7 A;  1SFN A;  3VDD A;  1VMH A;  1IQD C;  1RMU 3;  3EXU A;  3P1I A;  2ENR A;  1KGY A;  1ZBE 1;  1BYH A;  4QT6 A;  2WC2 A;  4RL7 A;  2VCB A;  3AMH A;  3GGL A;  1MZ5 A;  1QDC A;  1AXY A;  2D3P A;  2J22 A;  2W46 A;  4GWN A;  1LHU A;  4HLT A;  4MH0 E;  4R9A A;  5A1F A;  1ULP A;  2PAK A;  2X29 A;  3RSJ A;  1E57 A;  1PGL 1;  1O3R A;  1ZBA 3;  4QX5 A;  2ES3 A;  2ZAA A;  2NQY A;  3S7E A;  3QBQ A;  5FP3 A;  3K3N A;  5HV0 A;  4IEP A;  3OG2 A;  4LKS A;  3TB0 A;  2Z42 A;  4A42 A;  2W68 A;  4AQ2 A;  1Q8Q A;  1VE0 A;  4N53 B;  4PBP A;  4BXF A;  5H9Q A;  4OVE A;  1VBE 1;  4LBL A;  2XLG A;  2ZEW A;  5H9R A;  3OBR A;  1QNW A;  1LOB A;  1RXF A;  2WZR 1;  1OMI A;  4OHX A;  3MW3 A;  2HWC 3;  1CAU B;  3SQO A;  1F4A A;  1XSR A;  4LK7 A;  4JHZ A;  3RJR A;  2WAO A;  1SLB A;  4AGR A;  1CQ9 A;  3CLP A;  4LBN A;  1VB4 A;  1W99 A;  2JDZ A;  1VRH 1;  1ZZ8 A;  2D6O X;  2XG3 A;  4FXK B;  2VOV A;  4GKX A;  3CZU A;  5LAT A;  1X36 A;  5JAX A;  3J8F 2;  5IK5 A;  1JTZ X;  4LMF A;  4PBO A;  3T2O A;  4CXY A;  4EWA A;  5A3O A;  1U5Z A;  1Y7B A;  3DCQ A;  2PHD A;  5BUV A;  2JDA A;  3K4Z A;  4KG8 A;  2Q0A A;  4DEQ A;  1VRH 3;  1YQ8 A;  3EO6 A;  3GZU C;  2UWC A;  3M70 A;  1YNA A;  2W92 A;  4RFR B;  3T30 A;  4B1L A;  3H3L A;  4KU8 A;  1UU5 A;  1MQT C;  3III A;  4IEX A;  3BOD A;  2JDP A;  5FPV A;  3LIG A;  1W90 A;  4QPI A;  2GP3 A;  3WNN A;  2CNA A;  5FFO C;  2YC4 A;  4EZ4 A;  2YPD A;  2JE8 A;  3THC A;  1DQ5 A;  1H8V A;  3IBM A;  2B46 X;  2NZ9 A;  1SLL A;  4LK6 A;  2VAU A;  3VN4 A;  3BTA A;  4KU7 A;  3M8L A;  3BVC A;  1TMF 3;  4K20 A;  3WNK A;  1TME 1;  4MXV A;  5C3O A;  4RGG A;  4CUB A;  3JCI A;  3HR9 A;  2D5F A;  2A6V A;  3H8O A;  3VHO A;  4GD4 A;  4YW2 A;  2VG9 A;  3ME2 A;  2ARB A;  3X29 B;  1PIV 3;  4GB3 3;  5LAS A;  4FQZ A;  4MUV A;  1A3K A;  3WSO A;  3CHX A;  3HWJ A;  3S57 A;  4QMA A;  3EHK A;  4X8N A;  4FFG A;  5EJ1 B;  2JG8 A;  1E5I A;  3KV9 A;  3O0V A;  3UES A;  2VQA A;  5GZC A;  1GFF 2;  2JEM A;  1H1M A;  1N1S A;  5A7O A;  4P00 B;  1DZT A;  1KJR A;  5GKA C;  4W6W A;  3T0A A;  3H9A A;  4RHV 3;  4Y20 B;  4NHY A;  1UY1 A;  3KS7 A;  1BBT 3;  1JXN A;  1S2K A;  4YW3 A;  4A3Z A;  4EWD A;  2AR6 A;  1EV1 1;  2QQO A;  1BXH A;  3PJY A;  1GZW B;  1EAH 2;  1RUG 3;  2ZXQ A;  5I8T A;  1MZ6 A;  4BU2 A;  4DEV A;  4QU1 A;  4HAN A;  3J4U H;  4YVS B;  1LAJ A;  4LA3 A;  4LIT A;  3R6S A;  2TBV A;  4WVV A;  2XQR A;  4S2G A;  2JIC A;  4IW3 A;  4C1X A;  1S0B A;  5HPO A;  1I3H A;  3ZFF A;  2DWR A;  5KHI A;  4UFM A;  3OEB A;  4JGY B;  3WDY A;  3NVC A;  4K3U A;  5A3P A;  3DUI A;  3RYP A;  5JXJ A;  2WLP A;  1Q56 A;  4I0B A;  4HKL A;  5HCB A;  2GN7 A;  2UYA A;  4LA2 A;  2XLF A;  1S0G A;  4RYD A;  2PHW A;  4MG2 A;  1SPP A;  1PGW 2;  3KV5 A;  1UIJ A;  4WM7 B;  5A7N A;  4EE2 A;  3NJY A;  2OZJ A;  1W8U A;  4LIU A;  2UY8 A;  1RUE 1;  1ULE A;  1HB4 A;  4ITC A;  1V6J A;  2BGP A;  4JTN A;  3J7N A;  1UYP A;  2IFR A;  1O3S A;  3RG0 A;  4H7M A;  4XF4 A;  2C9A A;  4PI2 A;  3MV1 1;  5FTT C;  4IV3 B;  5C3P A;  1XNT A;  2HWD 2;  1RUE 3;  3LWC A;  2D98 A;  2WL1 A;  5JWP A;  2QQV A;  3LSE A;  5BXX A;  2R07 1;  4A7Z A;  1F35 A;  4QB6 A;  2EXJ A;  2YG0 A;  2ZOE B;  4Y4R A;  5FO7 B;  3VBF B;  3WDX A;  4LTA A;  2XQX A;  3GHM A;  1D7P M;  3H42 B;  4Q8L A;  2IVI B;  5GJ6 A;  2YPJ A;  5F9T A;  1X9T A;  1DQ6 A;  3E6C C;  2R7E B;  1IZ3 A;  3R4S A;  4QXB A;  4CUC A;  2R07 3;  1LKN A;  1JZ7 A;  5FMD A;  1N1Y A;  1NT0 A;  1IS3 A;  2PEL A;  2BWC A;  3D0S A;  3CL1 A;  4MZU A;  4BDV B;  1FV2 A;  4KGQ A;  3WEZ A;  3O12 A;  2XGX A;  4QQH A;  4C0B A;  2G4I A;  5CKQ A;  3WG1 A;  1PGS A;  1UZV A;  2I45 A;  5KHG A;  3VLB B;  3MID A;  3VKL A;  3ZSK A;  1J59 A;  1SLC A;  4AFC A;  4H14 A;  3POB A;  1B35 C;  1Z0H A;  3V0A B;  2DUR A;  5C4W A;  4K21 A;  4E27 A;  2BZD A;  4BIF A;  4ZY9 A;  1YLL A;  5KXD A;  3V0B A;  3ZR5 A;  4YGE A;  4BQ4 A;  1KD7 A;  1X33 A;  1Y43 B;  2D7F A;  4I0W B;  4R52 A;  2EAK A;  1ZZ9 A;  5IVV A;  2VOT A;  1LNS A;  1KS4 A;  1QHD A;  4XCA A;  2MPF A;  1US2 A;  2WNV C;  1GP4 A;  1J1L A;  3RDI A;  2FZ2 A;  1AYM 1;  5LBF A;  3FZ3 A;  3KCY A;  4XUQ A;  3M3I A;  3PU8 A;  4E4S A;  3JQX A;  2XVG A;  3B5L B;  1POV 0;  4PLO A;  2VPV A;  1WCK A;  1QJZ A;  1O5L A;  2JDN A;  1NCR C;  2YZ4 A;  4QX8 A;  5EYY A;  1WGP A;  1O3T A;  1E5H A;  1UMI A;  4UW4 A;  3CKH A;  5C8C C;  3B9I A;  2PHX A;  2QBX A;  3LDB A;  3ZXK A;  4D6S A;  1D4M 1;  2XB6 C;  3LAG A;  2HLE A;  5GZE A;  4DNY A;  5IVF A;  4BQ5 A;  1YFX A;  3POE A;  3S7I A;  3CZJ A;  3ZLI A;  1SCR A;  4N9H A;  3RZZ A;  3AMN A;  2DFB A;  5CNA A;  2W9X A;  1ZM1 A;  1UPS A;  1QKQ A;  5E88 A;  5FJK A;  3I3B A;  1CX1 A;  5EIY B;  1NCR B;  4Q4Y 1;  5FYM A;  4CEY C;  2A1X A;  2HEW F;  4PDW C;  5C8C B;  5CFC B;  4CCL A;  3TEW A;  1W6Q B;  1UY3 A;  2AEZ A;  1AR7 1;  2WA3 A;  3GXU A;  5CFD A;  4UBG A;  4CXX A;  2X09 A;  4IUG A;  4JGZ A;  5FMC A;  2QDN A;  3KVB A;  4CTE A;  1MS9 A;  4XHX A;  2YY1 A;  1LRH A;  3IDB B;  4KWK A;  4OHZ A;  5AC9 2;  3ZMN A;  2FDG A;  4AVS A;  4M01 A;  3ZYB A;  1JZ5 A;  1WBF A;  5LBB A;  3M3C A;  1U0A A;  2Q8O A;  1V6K A;  4JX0 A;  3N9L A;  4PF1 A;  4PIZ A;  4CU8 A;  4CEY B;  2LAL A;  2ARX A;  1CWP A;  5FZI A;  1PO1 3;  1WMF A;  3AMP A;  1CAX B;  4QB1 A;  4QX0 A;  1DP0 A;  3U78 A;  1RUD 1;  1DLL A;  2XJS A;  3LF7 A;  4XFF A;  3NNM A;  1ULG A;  2W2I A;  3I3Q A;  2VE1 A;  4FFH A;  2XVL A;  4QD2 A;  3WDV A;  4OQ9 A;  2TNF A;  2ZEX A;  2CHH A;  4FP3 A;  2RMU 2;  2A6Z A;  4FVV A;  5FUI A;  4ZON A;  5FPX A;  1WBL A;  4R4X A;  1QJU 3;  3K4D A;  4U2A A;  1QQP 2;  1YRZ A;  1OOP C;  2HWF 3;  2D6L X;  3PVO A;  3POW A;  2DDU A;  5HCF A;  3OBT A;  4XDQ A;  3GBW A;  3WNP A;  3N7L A;  2HWE 1;  5IFP A;  3KHC A;  1UZZ A;  3HEI A;  5A6Z A;  1WLT A;  2G19 A;  3LDK A;  4HK9 A;  3TYJ A;  3IDE A;  5F5I A;  2VUJ A;  3ATG A;  3E5X A;  1XE7 A;  3PL0 A;  1VBA 1;  1AX2 A;  1CPN A;  1K5J A;  2WO7 A;  3AZZ A;  4IER A;  4QX2 A;  4E4D X;  1D0G A;  4GUL A;  2BJS A;  2KXL A;  3JB4 C;  1GQP A;  4RN5 A;  5FP7 A;  5GLW A;  1OOP B;  3ACH A;  1OPM A;  5GM0 A;  1W6O B;  4HT1 T;  2WFF 1;  2IVJ A;  3NAP B;  4GA9 A;  1PO2 2;  4Z07 A;  4CDQ C;  2D6K A;  5ABJ A;  2VOK A;  3PUR A;  5JSO A;  2RS5 1;  1HJG A;  1AR8 2;  2VMC A;  3ZXD A;  2O8O A;  3RI9 A;  4IE4 A;  1BEV 1;  2ZPX A;  2R0F A;  3A0K A;  3T2Q A;  2WFF 3;  4HVO A;  5GLZ A;  3LCP A;  1DGL A;  4MXW B;  4CP0 A;  3AKS A;  2MEV 1;  4TSV A;  4B4R A;  4COV A;  3I3D A;  5I8S A;  2NLR A;  3MI8 A;  1RJ8 A;  4QPG C;  5LA2 A;  1GKB A;  2R16 A;  2QQU A;  4GWI A;  4KWU A;  2GC3 A;  3ZFE C;  4C91 A;  5CEH A;  4B4Q A;  1W6P B;  4QPW A;  1C8M 1;  1DQ2 A;  1QJY 1;  5F3G A;  1FX5 A;  1YJK A;  3URF A;  1RUH 1;  3VZN A;  4MO3 M;  4D6R A;  2GC0 A;  1AR9 3;  1VBC 1;  1V6O A;  4LBQ A;  4ZU5 A;  2DCY A;  1MS8 A;  2UWA A;  1OHF A;  3AP9 A;  4Y4Y A;  2CSG A;  5DAW A;  3UGF A;  4HVQ A;  4MGT A;  3ST7 A;  5K9Y A;  1QJY 3;  2KR2 A;  5KXB A;  1OA3 A;  1R09 1;  3IIA A;  3GZA A;  3I2O A;  3ZKU A;  3WNL A;  1AXK A;  3ZKY A;  2XON A;  4Y1Y A;  5FYI A;  4BLJ A;  3O7O A;  1W2O A;  3OPW A;  5I0D A;  1HB2 A;  3NKT A;  3BAL A;  5F6K A;  4OI0 A;  4QHB A;  2PLV 3;  3AJY A;  1ASJ 2;  4OUM A;  3JBG 2;  5A6Q A;  2R04 2;  1TVG A;  3SKJ E;  2GMP A;  3BKZ A;  2AH2 A;  2CYF A;  2D44 A;  2C0Z A;  2J1E A;  2OPK A;  2YGM A;  3MEP A;  1A78 A;  3MUZ 1;  3S30 A;  1EUT A;  1G9F A;  1O8S A;  1W06 A;  2BNO A;  1S0E A;  2LTN A;  3AVS A;  1JOP A;  1UZ0 A;  1MVE A;  5FP8 A;  1WLC A;  3WW4 A;  2CGN A;  1UAI A;  4EJR A;  1FAY A;  2EVX A;  3SC7 X;  2X8K A;  3ITQ A;  1UY2 A;  3OD4 A;  3FJS A;  4QM8 A;  3DYP A;  4MGQ A;  1SBF A;  4J1X A;  1MEC 1;  2EIE A;  1JZ8 A;  4P9W A;  3F95 A;  1NXD 1;  2VZQ A;  4I3G A;  5JOW A;  2B7Y A;  4BMB A;  5C70 A;  4ZXE A;  1MAC A;  2JDH A;  4XIK A;  2GH8 A;  1UOF A;  4QDQ A;  4Q4W 3;  1DLC A;  2LRO A;  4JDN A;  4D7T A;  1NLS A;  4MLO A;  4QX3 A;  4CCJ A;  1VBB 2;  4S2H A;  4YLZ A;  4CEW B;  2VO5 A;  1PVC 2;  1ODN A;  1V9U 1;  3VBS C;  3JD7 2;  2TUN A;  1E5R A;  3WT3 A;  4B4P A;  4CP9 B;  5DDJ 2;  4CDU C;  1U5X A;  1RTV A;  2W1S A;  3P5B A;  3VBH C;  4IV1 A;  3WF4 A;  4AAP A;  1W8Z A;  3I97 A;  1X9P A;  4NUB A;  4YFW A;  2P2K A;  5D2A A;  3UK9 A;  4V2W A;  4XVH A;  2DCJ A;  3KWV A;  1W2A X;  1CN1 A;  4XJU A;  3VDD B;  5K4L A;  1PK6 C;  4HPK A;  1UU6 A;  3KF3 A;  4QX1 A;  5FKC A;  2CGO A;  3WUD A;  1XU2 A;  4QQO A;  5ERL A;  4RQP A;  1OKO A;  3SIT A;  3ZYR A;  1LCL A;  2J1U A;  3WF3 A;  4Z92 B;  3WCR A;  4W4Z A;  2CAV A;  2WSU A;  5IAV A;  4PHZ A;  1ND2 A;  5IK8 A;  4WV8 A;  4BIO A;  4L2N A;  2JKX A;  4JRA A;  4NHL A;  1ZZ7 A;  2Y34 A;  4EN7 B;  4XYX A;  4R4Z A;  2WNU C;  4WZC A;  4FP2 A;  2VMG A;  1XNB A;  2YGL A;  5E6H A;  4ATE A;  1JN2 P;  3ZMO A;  4A4A A;  1HN0 A;  4TZD A;  1VBD 2;  1KXG A;  2QDR A;  2BVB A;  2XL7 A;  3IB3 A;  1VPH A;  1I6X A;  1A6C A;  4GH4 C;  3CJI C;  1G86 A;  2G9F A;  3AKP A;  1H30 A;  3VD5 A;  4LOR A;  3WDW A;  1NOV A;  3AP5 A;  5FYS A;  4QGL A;  5GLT A;  3ZYF A;  3UET A;  1OI6 A;  5FY1 A;  2PQS A;  1ENQ A;  1DYO A;  2WSV A;  3IN9 A;  5LW9 A;  2BFU L;  2WAB A;  3OGG A;  5DAQ A;  4NRP A;  5FYY A;  4W65 A;  1MZF A;  2V72 A;  5A7W A;  3U1X A;  1WA4 A;  3W59 A;  1GP6 A;  1FPN 2;  3RWK X;  1R1A 1;  3CJI B;  4QQL A;  4QXH A;  3EMR A;  3JUU A;  1RUC 1;  3J8F 3;  4LPL A;  2ZS6 B;  1HW5 A;  2ARA A;  3MIC A;  4I0A A;  3NNG A;  4TLF A;  5LY1 A;  3O1S A;  3HNM A;  2VNR A;  5FYV A;  5CKN A;  1R08 1;  4FO9 A;  1GP5 A;  2RHP A;  2VGD A;  2W94 A;  2DTW A;  1TQ5 A;  1CIW A;  2WJS A;  3AMQ A;  3FHQ A;  3NV4 A;  5LA9 A;  5LRR A;  3N35 A;  3N4M A;  1JZ6 A;  4TLG A;  2BWA A;  1OQE A;  3B7M A;  3VBO A;  1LHN A;  1POV 3;  4ES8 A;  4HZF A;  3HN3 A;  1HRV 2;  4Q4V 2;  2UY9 A;  4C90 A;  2JG9 A;  2DCT A;  4AI8 A;  1NE4 A;  4N43 C;  4D6Q A;  1OXC A;  4QPI B;  1S0I A;  3USS A;  1SEF A;  4IGO A;  2CAU A;  3NNF A;  5ISL A;  1RUJ 2;  1RUO A;  2QJV A;  4ZZ8 A;  5EXO A;  3LOB A;  5FZ6 A;  4A3X A;  1QGL A;  2GN3 A;  4IEO A;  2XPJ A;  5FYC A;  5FWJ A;  4CDX C;  1UQX A;  4E9K A;  1CZV A;  2R06 2;  1AYN 2;  2CY6 A;  5ACA 2;  3AKR A;  1OA2 A;  5T55 A;  5HXV A;  1LOF A;  4JKK A;  4URT A;  3WHU A;  3VKM A;  1U5I A;  5FPA A;  3FFZ A;  3OBZ A;  2RS3 2;  3LA3 A;  5J37 A;  5A33 A;  4YGD A;  1YQ6 A;  1H6X A;  1Z7S 2;  1F5F A;  4Z1V A;  2P37 A;  4QWN A;  2WS9 1;  2YV8 A;  2XL9 A;  3KD4 A;  2Q8E A;  5HCA A;  1HRI 1;  1JYC A;  1KFX L;  2AC1 A;  2DUO A;  4XHB A;  3NRU A;  4Y22 A;  4CU7 A;  3VD4 A;  2JG8 B;  2ZX2 A;  3AZW A;  4IE6 A;  4LR4 A;  4XUP A;  4CCE A;  1S0J A;  1UY4 A;  4NHX A;  4XFC A;  4MSV A;  2EXK A;  2QZ2 A;  2R1B A;  2ZHN A;  3H1M A;  1FMD 1;  1GQH A;  3ZFF C;  1O4T A;  4AXO A;  1ND3 A;  2ZAH A;  1EAH 3;  3PVB B;  2ZCW A;  2VZV A;  4Q4X 1;  2QE3 A;  3PU3 A;  1VJ2 A;  2RDQ A;  4WVM A;  3R05 A;  3MF6 A;  5FXZ A;  5T50 A;  3ZYI B;  4B7K A;  1YUD A;  3ZN6 B;  1RGS A;  1NA1 A;  4NO4 A;  2PMW B;  3RVH A;  3V65 A;  2QUO A;  1UZY A;  2W87 A;  5FPU A;  3K51 A;  5C5U A;  4BZ4 A;  3ZFF B;  1F5J A;  3VUO A;  1N1V A;  3VD7 A;  2F17 A;  2OT7 A;  2RJK A;  4AYU A;  3S6P A;  5C3Q A;  4GWM A;  1MZE A;  1WCD J;  2SBA A;  3OTF A;  1GMM A;  2OA2 A;  3HJR A;  1H1A A;  2WNO A;  1DDL A;  2I2S A;  5E8A A;  3MZH A;  1KS5 A;  1SLA A;  1YIF A;  5C6C A;  4A7K A;  3K2O A;  1Q8O A;  1SPP B;  4FPE A;  1O3Q A;  5FZH A;  4AI2 A;  4AL9 A;  1DGW X;  2FCT A;  2WWS A;  4S2D A;  2JKB A;  2ORZ A;  1RUF 2;  2E26 A;  2IXI A;  3S0M A;  2Q30 A;  5JVV A;  4FPK A;  2WA4 A;  5LWB A;  4YM1 A;  2K0G A;  4HBN A;  1YC6 1;  1GNH A;  2ATF A;  3AYE A;  4HSJ A;  4LLF A;  2C9K A;  2RM2 2;  2X5I C;  2VVF A;  3IAP A;  5JSR A;  3KV6 A;  3AYA A;  3H0O A;  2J42 A;  3DKW A;  4DFS A;  5GZG A;  2FZ1 A;  2JIJ A;  5KR7 A;  2HWB 1;  2G1M A;  2Y60 A;  4M0N A;  5LZ6 A;  5A3U A;  1FAT A;  2DVD A;  2QQL A;  4JDM A;  4Q8K A;  3FX3 A;  3WCS A;  3J9S A;  5K0U A;  1S2B A;  1EPZ A;  4AW7 A;  3JQW A;  2CDP A;  2A5Z A;  1QU0 A;  1KJL A;  2ZKN A;  5CG8 A;  5FBZ A;  4KBZ A;  5JLV A;  1JU3 A;  3AVR A;  3B9C A;  1LU2 A;  4Q1P A;  4URA A;  4LOS A;  3DPR A;  5BNP A;  5FR3 A;  1RL3 A;  4E4Z A;  2PHT A;  2Y6F A;  4QDR A;  1C1F A;  3HT1 A;  2JEN A;  1WW4 A;  4PQQ A;  4QHO A;  4H55 A;  4W6X A;  3ZPO A;  4LBO A;  4NHM A;  2JWP A;  4AQ6 A;  4NWV A;  3U75 A;  4FPL A;  1ENS A;  2RS1 3;  3HQR A;  5IUQ A;  4LBK A;  3MGU A;  1XOY A;  5A1A A;  5HV4 A;  5KC6 A;  3P3N A;  1QEX A;  3H8X A;  1RMU 1;  3ZXL A;  2X10 A;  4ZU7 A;  2Z69 A;  1OPO A;  3M7A A;  5DAX A;  5C4W B;  4XAC A;  1DYP A;  4OZX A;  2YBP A;  4XIO A;  4Q0V A;  3SMH A;  4CCK A;  5IK4 A;  3V0B B;  2WN3 A;  1X8E A;  2OX0 A;  3NO8 A;  4H2A A;  2I74 A;  4XTP A;  1DU3 D;  4AED A;  1T2X A;  3NL1 A;  1AX0 A;  2OUH A;  5FY9 A;  1ZBA 1;  1VMJ A;  4XUO A;  4HXC A;  2IWG B;  3ES1 A;  1XRU A;  2BV4 A;  1MS1 A;  2C5D A;  1ST8 A;  4ZKT B;  2BPA 2;  4LBJ A;  3L2Y A;  1BMV 1;  2VTX A;  3THD A;  2ET7 A;  3SCG A;  4AOC A;  3MFA A;  4YW4 A;  5D8A A;  1C5H A;  3THP A;  5FZM A;  5T5P A;  3PVE A;  2WYF A;  1JUH A;  3KM5 A;  3MLL A;  4JV4 A;  1D2Q A;  5F5C A;  3S5A A;  2QNK A;  1W0N A;  5IVJ A;  5JPN B;  4P9Y A;  2HWC 1;  4H7L A;  3DN7 A;  3ZO0 B;  2E7A A;  4RGA A;  4Y26 A;  3C7O A;  3AX4 A;  1SQ4 A;  2RV9 A;  3HMY A;  1WW6 A;  4IEW A;  4E8C A;  2VL4 A;  1PZ8 A;  1NYW A;  5JDB A;  4WVZ A;  4ASM B;  3OB8 A;  3B94 A;  4XXP A;  3FE5 A;  1VB2 A;  3G7D A;  2XHK A;  3UNP A;  5JOZ A;  3BYW A;  4NRQ A;  3ABZ A;  5AFB A;  3FBY A;  3N36 A;  5DN2 A;  5BPX A;  5JI7 A;  5CFD B;  4JGZ B;  4LHS A;  1KIT A;  1LJ7 A;  1YFW A;  4FAG A;  2VUL A;  1WKY A;  1HQL A;  3ZN4 A;  4CRQ A;  3SNM A;  1NLQ A;  1XYN A;  2DVA A;  2YXS A;  4L97 A;  2OQ6 A;  1E5S A;  5JZG A;  1KRI A;  2C24 A;  1W39 A;  1ZZC A;  2WNE A;  4LIV A;  1CD3 G;  3I2D A;  2VD7 A;  2YYO A;  4NOT A;  4PQ9 A;  4Y5T A;  1W3X A;  2Y6K A;  2DYC A;  5IVY A;  3D82 A;  1MPX A;  1I5Z A;  4CCC A;  2BW8 A;  2QQM A;  4KH9 A;  1OLM A;  3ALQ A;  1OC1 A;  4V1P A;  3H8U A;  4Q0U A;  2BUK A;  2WYS A;  2PYT A;  2ZGR A;  1NCQ A;  3I54 A;  3IMM A;  4UFK A;  5JXI A;  3RZK A;  2L9L A;  5DZE A;  5DUU A;  2VUD A;  1TMF 1;  2RMU 3;  2UUR A;  3WDU A;  1L7L A;  4YVW A;  3ZOI A;  4OFG A;  5I0U A;  5A3L A;  1U5Y A;  3K4A A;  1L7Q A;  1QQP 3;  3A22 A;  4KGG A;  1BZW A;  3UL2 A;  4A6O A;  2FBE A;  1PNF A;  1A8M A;  1VR3 A;  2RG4 A;  2V5D A;  2YC2 A;  3HOB A;  3LIH A;  1GAN A;  3BN6 A;  1NZI A;  3VBR A;  2XJR A;  1Q8S A;  1PIV 1;  2VZT A;  4GB3 1;  4RA0 A;  5FY8 A;  1Q5O A;  1GWM A;  1YO8 A;  5L9V A;  2K46 A;  5IJR A;  2VZO A;  3C2U A;  4ZZ5 A;  1NXM A;  5F5Q A;  3UKT A;  1R1Z A;  4D7Y A;  4KBB A;  1KDK A;  4FPJ A;  5DG2 A;  5A70 A;  1KEX A;  2QTW B;  1WZX A;  3O0W A;  2OPW A;  4Y3O A;  1REF A;  1RUI 2;  1OVS A;  3KT4 A;  3ZFG A;  2V73 A;  4CP1 A;  1PO2 3;  4RHV 1;  2KA3 A;  5FPB A;  1BBT 1;  2CDO A;  1W9F A;  1AR8 3;  4YVS C;  5ABJ B;  3I2F A;  1QIQ A;  2GNM A;  3FUO A;  1RUG 1;  2ZGL A;  4HKO A;  4ATF A;  4BHP A;  4FTB A;  4R9C A;  2VMF A;  4MET A;  2GC1 A;  3GZE A;  3T4V A;  1HXS 2;  2K9Z A;  1LOC A;  4XJ8 A;  5F2S A;  4DXS A;  1G9D A;  1EY2 A;  4XQ4 A;  4JGY C;  1YFU A;  2QZ3 A;  4XEZ A;  5T3N A;  2ADE A;  2OQ7 A;  4D7S A;  1F4H A;  1F2N A;  1W9T A;  3BUC A;  4JDO A;  5BV6 A;  3L2H A;  1XU1 A;  5J1X A;  4OI2 A;  4C0H A;  3BU7 A;  3THT A;  1S4C A;  3DYM A;  2E7Q A;  4WM7 C;  1GZC A;  5GZF A;  1J58 A;  3DXT A;  3IMN A;  3OY8 A;  4LBQ B;  4IXL A;  3W20 A;  3U4X A;  4QAW A;  4BH9 A;  3N9N A;  3ZSM A;  1DGW A;  2RR1 2;  3DEM A;  5FZ1 A;  2JDU A;  3K46 A;  4IV3 C;  4IE7 A;  3RZG A;  1IKQ A;  1O4Z A;  5H9P A;  5T5O A;  4XJZ A;  5C33 A;  1NY7 2;  2DU0 A;  1ASJ 3;  5FP9 A;  2DV9 A;  2BEO A;  3JBG 3;  3KT1 A;  2R04 3;  3PUI A;  3VBF C;  4Y33 A;  4QKN A;  2P6C A;  3RMY A;  1SLI A;  3JZV A;  5FYH A;  3K3O A;  3UGG A;  1JHJ A;  2DCZ A;  4PLN A;  3O1U A;  3POY A;  1COV 2;  2HH9 A;  3AC0 A;  4IEY A;  4IGP A;  1QJE A;  1Y9M A;  1GR3 A;  1I9R A;  1LOG A;  1DFQ A;  4PT6 A;  2XBO 2;  1CZT A;  1QJX 1;  5APA A;  3TEY A;  3ACG A;  4NIG A;  2FDH A;  3LPG A;  4YZ1 A;  1DF0 A;  3B93 A;  4MOA A;  4OI1 A;  2Q8C A;  4COU A;  2QQJ A;  2D93 A;  4Y5S A;  2JDK A;  2AUY A;  4BXS V;  1YXW A;  1LEC A;  3U14 A;  3T2P A;  4HSL A;  5L19 A;  4AI0 A;  1QJX 3;  2PN5 A;  3K48 A;  4Q29 A;  3VD3 A;  4DIQ A;  1F31 A;  5LB6 A;  1HN1 A;  3PUH A;  3UT0 A;  2EIG A;  4COW A;  1UZW A;  2PFW A;  2VW1 A;  4K7J A;  4IEZ A;  1JHN A;  1VBB 3;  1RVF 3;  1QH7 A;  4QPY A;  1GOH A;  1PVC 3;  1W9W A;  3QCW A;  5FRE A;  4DXR A;  1GLH A;  5FZ4 A;  4RQP C;  3U10 A;  3JD7 3;  5I8Y A;  1UCX A;  3NJV A;  1S0C A;  4CDW C;  4N90 A;  5DDJ 3;  3RQ0 A;  4IL7 A;  4G3Y C;  1V6M A;  2O14 A;  1RHI 2;  4RS5 A;  3Q8A A;  4UW6 A;  1O4Y A;  1VMF A;  4IV1 B;  1R64 A;  1W3V A;  1WCQ A;  1UO9 A;  3AM2 A;  2DCK A;  5BNO A;  3N7M A;  4ZS3 A;  3N9Q A;  3IZO A;  4EWE A;  4LT5 A;  4XW3 A;  4HPK B;  1XXN A;  2JDM A;  1WLD A;  2FQP A;  4Z8B A;  1Z78 A;  4AGV A;  1AR6 2;  3ZX7 A;  3CNA A;  4RQP B;  2P3K A;  5CB7 A;  1UYX A;  1UL9 A;  1BVV A;  2W95 A;  5HBA A;  4CCD A;  3ES4 A;  4WM8 A;  4IEV A;  2WR9 A;  2AZ5 A;  1FI2 A;  4YGC A;  2XWB B;  5FK8 A;  3ZDS A;  4OHV A;  1ND2 B;  1HB1 A;  3MIB A;  2GNB A;  1CIY A;  4RR3 A;  4QXC A;  2DF7 A;  1XYP A;  4JAA A;  4B8E A;  3GZT B;  5FZ7 A;  3USU A;  1YI9 A;  1UY0 A;  1VBD 3;  3LFM A;  1STM A;  4AI3 A;  2QCS B;  3U4S A;  1W8O A;  2XJT A;  4YFZ A;  5BNN A;  5CFC C;  1LU1 A;  4UF0 A;  1QWR A;  4XPV A;  4DRV A;  1LHO A;  5C9A A;  4LXL A;  4ARX A;  3HNB M;  1CJP A;  2OS2 A;  2QFE A;  1EUU A;  3P3P A;  2ZHK A;  2ZAC A;  4JQR A;  1ENR A;  1MR5 A;  2OZ6 A;  1OQD A;  3PME A;  1RIN A;  4AVB A;  1QXR A;  2ET1 A;  4OYU A;  5DG1 A;  4CUG A;  1POQ A;  2F4P A;  1W2U A;  1X82 A;  1IPJ A;  3TN9 2;  3AZV A;  4YM3 A;  1AL2 2;  5A7W B;  1G7Y A;  1GU3 A;  3JB8 A;  3OGS A;  1FYU A;  3INA A;  4XIL A;  4YM2 A;  3ZYH A;  1O6U A;  3MUY 1;  1ZBA 2;  4AEM A;  4DUW A;  2VMH A;  5A6Y A;  3A21 A;  5L7O A;  3BTX A;  3A4U A;  4LO8 A;  1ULD A;  4FPY A;  1ZBE 2;  4P9L A;  1PO1 1;  4BE3 A;  4FOW A;  1OBN A;  4YG6 A;  4DB5 A;  2P6H A;  2VZU A;  3KT7 A;  5FPL A;  3ZSJ A;  5F37 A;  3BU0 A;  4N53 A;  1DQ1 A;  3LDR A;  3U11 A;  4BQX A;  4YGB A;  5GLV A;  1PGL 2;  1ZA7 A;  1MS4 A;  1JI6 A;  2YB7 A;  1ZX5 A;  2DUP A;  5FZO A;  1IG0 A;  1HRV 3;  2ZX4 A;  4Q4V 3;  4M3C A;  3VBO B;  4R9B A;  3WF0 A;  1UMZ A;  4XAB A;  3ZYG A;  4JKL A;  1QJU 1;  2JG9 B;  3C7E A;  4BQ3 A;  4NIA A;  5AVA A;  3RGB A;  1DZR A;  2HWF 1;  5FZE A;  2E33 A;  5KXE A;  3OEA A;  1RUJ 3;  2B42 B;  3DKQ A;  4V2V A;  3WP5 A;  1VBE 2;  2WZ8 A;  1OSG A;  2R06 3;  1AYN 3;  4AFM A;  5ACA 3;  2R32 A;  2WZR 2;  4EN9 B;  3O1O A;  3LKJ A;  1Q43 A;  2EAA A;  3AYC A;  1BK1 A;  3D6E A;  3NAP C;  3BGA A;  2WFP A;  3AP6 A;  3ILR A;  4X6R B;  1JH5 A;  3POI A;  2F4L A;  4L0P A;  5L73 A;  1VRH 2;  2RS3 3;  4XFI A;  4CP2 A;  2GMM A;  5A6X A;  1Z7S 3;  5A33 B;  5FOJ B;  3N3H A;  3I2J A;  1OLR A;  4G4F A;  3FWE A;  4OI4 A;  1GOF A;  4GZ9 A;  1JU4 A;  4Y22 B;  3PUQ A;  3UJO A;  2EA7 A;  2B8M A;  1Y3T A;  2VY0 A;  2SLI A;  5CYY A;  5A7S A;  5E1R A;  2GME A;  3DEC A;  3HBZ A;  1PX3 A;  1H8T C;  4AHW A;  2D3R A;  3GM8 A;  1MQT A;  1ACC A;  5AVP A;  1ND3 B;  2RJ2 A;  2X53 S;  3VBU A;  2XJU A;  2WWJ A;  1F9K A;  1AX1 A;  3AB0 A;  2X05 A;  1K45 A;  4WVM B;  5F32 A;  1L3J A;  2V09 A;  3AKQ A;  3AXE A;  3NV2 A;  1W6M A;  1AR9 1;  1LGB A;  1NA1 B;  3SHR A;  4LO4 B;  3ZR6 A;  4YZ5 A;  1S1A A;  1SFY A;  1OH4 A;  1TNF A;  1TME 2;  2WO1 A;  1H8T B;  2OYZ A;  2WO3 A;  4AVA A;  2HKX A;  1X7N A;  1CAV A;  1JOD A;  3CEW A;  3GCW A;  4RFT 0;  4FBF A;  4XMI A;  1IS4 A;  3J7M A;  5FZB A;  5FO8 B;  3SEE A;  2ZX1 A;  2J1T A;  2PLV 1;  1EYB A;  3SCH A;  1AF9 A;  4FPH A;  4IQP A;  1JYT A;  2YC0 A;  5LA0 A;  5JXH A;  3GJA A;  1CVN A;  3D5O A;  1PZ9 A;  2JE7 A;  2V4V A;  3RZL A;  1FOD 1;  1WME A;  1IPS A;  2ZMN A;  1AUY A;  3ORJ A;  2VQT A;  2VTF A;  3C7F A;  3SKV A;  1RUF 3;  1OUS A;  1QXP A;  3KV4 A;  1SAC A;  2ZAB A;  5EZW A;  4XZU G;  3KCC A;  3BCW A;  2H6C A;  3MFC A;  3R4U A;  1CZS A;  1H1I A;  5DQ0 A;  2Z2S B;  1EV1 2;  2HYX A;  2RM2 3;  2PHR A;  2R0H A;  3ACI A;  1FOD 3;  2J1V A;  1O91 A;  1JS9 A;  3VL9 A;  5T5L A;  3I59 A;  1YQC A;  1V6N A;  2IXC A;  1RIT A;  4CPB A;  5IVE A;  3ZIX A;  3D4K A;  3ZXA C;  5FZL A;  1K5M C;  1UWW A;  3EBR A;  2D40 A;  3CO2 A;  3ZDV A;  4LUM A;  3WW3 A;  2J1R A;  5LK5 A;  4LKE A;  4B3N A;  4W6Y A;  2ZGS A;  4Q4W 1;  2WZP P;  4CEW C;  2J1A A;  5IVC A;  3KMH A;  3H8R A;  5FK7 A;  1C4R A;  5EQU A;  2XWJ B;  2Y33 A;  3L9J T;  3T0D A;  3DPR B;  5BNP B;  2PTM A;  3NKG A;  2JD9 A;  3P6B A;  4XE9 A;  4DXT A;  2BOI A;  4D0Q A;  1K5M B;  5L9B A;  1DIW A;  3VDD C;  4UFJ A;  4RSU A;  4AHX A;  3DGT A;  4GIQ A;  3F2Z A;  1I5P A;  1PM4 A;  4PI0 A;  3BIE A;  1US3 A;  1RUE 2;  2D6M A;  2JD4 A;  4LO5 B;  1DBN A;  2ADD A;  2WRA A;  4LOT A;  2Y8K A;  2YU1 A;  4BQ1 A;  1LES A;  4ERO A;  1FT9 A;  5A3W A;  2ARC A;  2JB8 A;  3A7Q A;  2LUW A;  1ZVF A;  4KL1 A;  3FC0 A;  4Q26 A;  1G9A A;  1H2K A;  4FT8 A;  4AED B;  4DS0 A;  3BPS A;  1HV0 A;  3VKO A;  2R07 2;  4Q0Q A;  4NII A;  1OLQ A;  3G6J B;  1LGN A;  4KI5 M;  3TEX A;  2R1D A;  2KM2 A;  3O1T A;  1IKP A;  1YHF A;  1S0F A;  4JQT A;  2NMO A;  5C8W A;  4BK5 A;  5D8A B;  1ZZB A;  4OMD A;  2XJP A;  2E6V A;  3I2I A;  4MHU A;  1DYK A;  4I02 A;  4XDO A;  5KWR A;  4HOO A;  4JTO A;  4ASL A;  1V0A A;  4DRR A;  1H4G A;  3AKT A;  3E1F 1;  4W50 A;  1YQ2 A;  2B9V A;  1OFS A;  1PNG A;  1UF2 C;  1UKG A;  3PVN A;  1EP0 A;  1XJA A;  2D97 A;  2QQK A;  3I2G A;  3W5M A;  2VQ0 A;  3J8F 1;  1K42 A;  4LKF A;  4NAO A;  1B35 A;  2OII A;  4IEQ A;  1UOG A;  5FZ0 A;  1VRB A;  3VHP A;  3VZM A;  5FXW A;  4A2U A;  1NQJ A;  2Q1M A;  4A45 A;  1SZB A;  4I2O A;  1VAK A;  1CPM A;  3EYP A;  3ZXE A;  4J1W A;  4K1Z A;  5G04 L;  4AR2 A;  3CIH A;  1GUI A;  5FBJ A;  5JSP A;  1POV 1;  4C1W A;  1AYM 2;  3IPV A;  4QPI C;  2BFU S;  4ES9 A;  5JZG B;  1Q8V A;  5EP9 A;  2ZBJ A;  2WNV A;  1JOJ A;  2DBN A;  1HV1 A;  2PHL A;  2J7M A;  5KHK A;  4L99 A;  2ZGQ A;  1N1T A;  2WQZ C;  1O8P A;  1NCR A;  1LED A;  5LY2 A;  1NCQ B;  3KCX A;  4FOV A;  1D4M 2;  5C8C A;  5FZD A;  2IUW A;  3QH7 A;  1W6Q A;  3ACL A;  3I3E A;  4YVW B;  3BI3 A;  4DMI A;  3AMM A;  4YZ2 A;  3FMG A;  4OHW A;  3WLU A;  1LTE A;  2BRT A;  3SCF A;  3PUA A;  1AZD A;  1FV3 A;  3WQ0 A;  4P9J A;  4Q4Y 2;  3VBR B;  4FPO B;  4YRD A;  3E6B A;  3KSC A;  4XF9 A;  2E31 A;  3MV0 1;  3Q8B A;  2NMN A;  2JG8 C;  4OUE A;  1O59 A;  5JIA A;  5DAP A;  1AR7 2;  2A6W A;  2OVU A;  4PDW A;  1BCX A;  2IXJ A;  3AYD A;  4LKD A;  1XB9 A;  4YW7 A;  1KQR A;  4XBQ A;  4QM9 A;  1RUI 3;  1UX7 A;  2GND A;  5J96 B;  3ETQ A;  5LEK A;  3ZFG B;  1MVQ A;  2YBK A;  5J98 B;  1CR7 A;  4HK8 A;  1GYK A;  3V64 A;  3ZIW A;  5T52 A;  2MNG A;  3OUH A;  3T1L A;  1EAH 1;  1WW5 A;  4FI9 A;  4NRM A;  3UYJ A;  1D4V B;  5CU1 A;  2CWM A;  2YFU A;  3NNL A;  2A71 A;  2DU1 A;  4NRO A;  1RUD 2;  1YJL A;  2VOX A;  4AWD A;  2Y6J A;  1GWL A;  2BNM A;  1UOJ A;  1W2T A;  2EIB A;  2QQW A;  2VBP A;  3MPP G;  1T6G C;  4PF5 A;  3B69 A;  2LW8 A;  1N3O A;  4CZS A;  4QX7 A;  3O1P A;  3LA2 A;  3WW2 A;  5G05 L;  4FOQ A;  3TNP B;  3UJQ A;  2LRP A;  1O5U A;  3ZSE A;  2TEP A;  4GKY A;  4AVC A;  1JYI A;  5GLU A;  2A7A A;  5C7G A;  5C71 A;  3HAG A;  2QQP A;  3RYK A;  3AJZ A;  5FMO L;  1JYV A;  5LEJ A;  4OQ8 A;  3CU7 A;  3ACF A;  2HWE 2;  4PCR A;  5T54 A;  1LR5 A;  1W9Y A;  2JJ6 A;  2XDV A;  2Z5W A;  4HON A;  2ZGU A;  4YW6 A;  4AFD A;  5FAX A;  1SBE A;  2IZW A;  3U0Z A;  5FZ3 A;  1WCS A;  3I7D A;  1X50 A;  1PZ7 A;  2XKO A;  1S2E A;  3OY8 B;  4LBQ D;  1PGW 1;  1VBA 2;  3AL5 A;  1J3R A;  3MW4 A;  1T6B X;  3NJX A;  3TNQ A;  2RR1 3;  4TWT A;  1RJ7 A;  2P3Y A;  1KFU L;  1C1L A;  1VIW B;  5A3N A;  1LB2 A;  4QQ2 A;  5BYN A;  3HQU A;  4FTS A;  1PMH X;  4F7Z A;  3AP7 A;  2WFF 2;  4H3W A;  1RIR A;  2IFW A;  4UXA A;  4Z82 A;  5FP4 A;  2RS5 2;  3FUQ A;  3C8X A;  5SV8 A;  4CDQ A;  2HWD 1;  4MVT A;  2JEC A;  1W04 A;  5JIU A;  4Y1Z A;  4JRL A;  1BEV 2;  1W0O A;  2IC1 A;  2RDS A;  1W6P A;  1GZ9 A;  3OOX A;  3IAQ A;  4GAZ A;  2E63 A;  5A3M A;  4MAD A;  1COV 3;  1OVP A;  2HWD 3;  1V6L A;  1ZYB A;  2VW2 A;  3A23 A;  4MX3 A;  3RI8 A;  4HN0 A;  3QD6 A;  1H4H A;  4AE2 A;  4CYD A;  1ZRI A;  2MEV 2;  3Q9O A;  5JOY A;  4HET A;  1WW7 A;  3LZZ A;  4Y1U A;  4AVT A;  2F6B A;  3A0N A;  4B1M A;  3CF6 E;  4OMC A;  2VXJ A;  1WMD A;  2D43 A;  1RC6 A;  1C8M 2;  1ZZ6 A;  2YU2 A;  1CES A;  1QJY 2;  3PMS A;  4QPG A;  1UNB A;  1W8W A;  3I2H A;  4YW5 A;  1RUH 2;  3ZFE A;  3VL8 A;  2PHF A;  3Q8F A;  1VBC 2;  2D6N A;  1NE6 A;  2DVG A;  4O61 A;  4TXW A;  5LK7 B;  1PX4 A;  3LEI A;  1SCS A;  4EYU A;  5JMC A;  3OBA A;  5C4W C;  2RS1 1;  2VZP A;  3GDB A;  3T0B A;  1DG6 A;  1UOB A;  5GZD A;  1JBC A;  1R09 2;  4LHN A;  4M3C F;  2RJL A;  4QHZ A;  4AGG A;  4XAE A;  3K75 B;  3NNJ A;  3WNX A;  3FHI B;  4BLI A;  2DVF A;  1XC6 A;  3OF1 A;  4DIN B;  2ZGM A;  4CU9 A;  4AQT A;  4C8D A;  5FWE A;  1SBD A;  1SLT A;  3OJB A;  4OCT A;  1CGP A;  4RS5 B;  3H3Z A;  4X8P A;  4F8A A;  1JW6 A;  1FNY A;  2Q1F A;  1QJF A;  2VMD A;  4M00 A;  3UKV A;  3WDT A;  4DPN A;  2ZMK A;  3RPQ A;  5BNO B;  4Q0S A;  4I3P A;  4U36 A;  1AR6 3;  1LEN A;  1XND A;  2K2S A;  2EF6 A;  2R30 A;  5FIX A;  2A6Y A;  5A7Q A;  2A73 B;  4UW3 A;  2W0X A;  1J84 A;  4P9G A;  1DQ4 A;  5F8P A;  4WM8 B;  1WD4 A;  4XDP A;  3AP4 A;  2VZR A;  3IM0 A;  1MEC 2;  4RR3 B;  4J25 A;  1W6N A;  3SLI A;  4A7Y A;  4UOJ A;  1MS0 A;  3DV8 A;  3W9A A;  2B45 X;  1AJO A;  1I1E A;  3USU B;  5FZG A;  5IAT A;  3T1M A;  4UWD A;  3OPZ A;  4ISR A;  4ONU A;  5BNN B;  5JXG A;  2VH9 A;  4GJZ A;  5KXC A;  4UF0 B;  2ILM A;  5C9A B;  5CFD C;  5C5T A;  3VD9 A;  1AVB A;  3LB9 A;  3M1H A;  4ARY A;  4JGZ C;  2P17 A;  1ZNP A;  4M4R A;  1IS5 A;  1V9U 2;  2FHR A;  5JUV A;  3TN9 3;  3J7L A;  3WP6 A;  5AC9 1;  5IHR A;  3VBS A;  3H50 A;  3MW2 A;  1JYW A;  4FPC A;  4FFI A;  2OUJ A;  4NAM A;  4DUV A;  1AL2 3;  4KG0 A;  2PHU A;  4CDU A;  2W1W A;  3VBH A;  1G9C A;  1IPK A;  2JE9 A;  3WOG A;  4R9D A;  3KVA A;  1OT5 A;  1DCS A;  5L7O B;  1ZBE 3;  2E53 A;  5AC9 3;  1Y9Q A;  1K3I A;  1PK6 A;  4GWJ A;  2FDF A;  3HNY M;  3GBG A;  1UD1 A;  3DF0 A;  3LFI A;  3MIH A;  5FUP A;  3AK0 A;  2VM9 A;  3LEK A;  3FFQ A;  1J3P A;  3WQ1 A;  2CV6 A;  2G9Z A;  5EHD A;  1ENX A;  2RMU 1;  5FQ0 A;  3E6D A;  1IQA A;  3M3O A;  4M3C B;  4Z2A A;  1QQP 1;  1N3P A;  2WNU A;  1GQG A;  3R0R A;  4CU6 A;  4PIY A;  3I49 A;  5LBC A;  4K1Y A;  3U07 A;  2VC9 A;  5EV7 A;  4XQW A;  5BY5 A;  2YBS A;  3AFG A;  4GH4 A;  4CDW A;  2PQQ A;  1H9W A;  1UMH A;  1VBE 3;  3CJI A;  1H9P A;  2IXL A;  3B00 A;  3DL3 A;  2CL2 A;  1KDM A;  3J7H A;  2PAM A;  4BQY A;  2WZR 3;  5J7M A;  2RVA A;  2P3J A;  2Y38 A;  3Q8E A;  4TN7 A;  1NQD A;  2B9U A;  5FXX A;  1PMJ X;  1OA4 A;  3ETP A;  2XOM A;  4XF1 A;  5FLH A;  3NJZ A;  1YI7 A;  2O1Q A;  5ABJ C;  4NE9 A;  4QKF A;  4HKW A;  4LEJ A;  5CA6 A;  1R1A 2;  5IVB A;  1APN A;  2JDY A;  1PO2 1;  4JVA A;  1RUC 2;  5I0R A;  1H2L A;  4OUL A;  1YEW A;  3ZSL A;  2BYV E;  1AR8 1;  4DY3 A;  4NVP A;  3MO4 A;  3O14 A;  5FZ9 A;  3KF5 A;  3RS6 A;  3VBU C;  2A3Y A;  4L9B A;  1R08 2;  1Q8P A;  4NR1 A;  3MLJ A;  3O1V A;  4UYB A;  4MGY E;  2OXB A;  1OKQ A;  2VZ1 A;  5FCC A;  1BKZ A;  1URX A;  4MYE A;  5IK7 A;  2FCV A;  3B02 A;  4MGI E;  2EID A;  2B4K A;  1MQT B;  2Y26 A;  5B4N A;  5KHH A;  4IE0 A;  4NPL A;  3VBU B;  4N43 A;  2BBA A;  1OF3 A;  2GU9 A;  5M0T A;  4D94 A;  1WD3 A;  1FNZ A;  3RJ2 X;  1SG3 A;  1HDK A;  2WZE A;  3TBD A;  1W03 A;  4IGQ A;  4D8M A;  1TEI A;  3IWZ A;  1OUR A;  4Y1X A;  1W6M B;  4XJA A;  3VZO A;  5FY4 A;  3GJB A;  4WZF A;  1TME 3;  5D1I A;  2XJQ A;  2UYB A;  4CDX A;  5EWS A;  1Y4W A;  2VVE A;  3OYW A;  4FPF A;  1HQW A;  1CAV B;  2ZHL A;  4AVV A;  1NAE A;  5A32 A;  1QMJ A;  4ISQ A;  4AEJ A;  1NUK A;  2GDF A;  5CKM A;  5HI0 A;  3VHR A;  3SIS A;  4AQS A;  2ZA9 A;  1JMU B;  3ECQ A;  2ZGK A;  2FDI A;  5K7P A;  1ASJ 1;  2WS9 2;  3JBG 1;  3ZXF A;  2R04 1;  3C7H A;  5LBE A;  4BQW A;  1HRI 2;  4Q27 A;  5I0S A;  3MHZ A;  3LEG A;  3IKW A;  4XBN A;  3WD5 A;  3N9P A;  1UX6 A;  2Z4F A;  1S0D A;  3POF A;  1HX6 A;  2BGC A;  2FMY A;  3LEM A;  4P5Y A;  4XQD A;  5L36 A;  5FZF A;  3ZN6 A;  3B01 A;  4K8R B;  3O1M A;  2Y6G A;  2I07 B;  4HN1 A;  3K77 A;  1FMD 2;  1EV1 3;  2VU9 A;  4E4H A;  1BVP 1;  1HLC A;  1XBF A;  1IG3 A;  4F83 A;  3JXS A;  3KQR A;  5L9R A;  4Q4X 2;  3U37 A;  3VDC A;  2A75 A;  3FHA A;  1DZQ A;  1CAW A;  3LQC A;  3RNS A;  3SH3 A;  1JYX A;  3VZJ A;  1XE8 A;  4E2Q A;  3I59 B;  1GIC A;  4XFB A;  4F3J A;  2ZZJ A;  1EPW A;  5GAL A;  1OUX A;  3LE0 A;  4LBM A;  3VHN A;  2C26 A;  2W08 A;  3EQE A;  1CJD A;  1W8T A;  5D21 A;  4AG4 A;  3PTY A;  1AJK A;  1BLZ A;  2HEV F;  3WV6 A;  1REE A;  1SHW B;  4QDS A;  2Q1Z B;  4QKD A;  1WA6 X;  2A3W A;  1VBB 1;  2QVS B;  1RVF 1;  3WF2 A;  1PVC 1;  1W05 A;  5FY0 A;  3BTY A;  4IV1 C;  3HPN A;  2BVV A;  3JD7 1;  3QAC A;  1UPI A;  3WVJ A;  1OD3 A;  1VAM A;  2ZGN A;  3OUI A;  5DDJ 1;  4XBL A;  2O0O A;  4ZU4 A;  3W58 A;  3RMX A;  5CG9 A;  5J36 A;  3HBK A;  3SXW A;  3FN9 A;  3J26 N;  4UBH A;  1HQN A;  4FAH A;  3WG4 A;  1ZRD A;  5F3I A;  5A1L A;  1AXZ A;  1JZ4 A;  3O1R A;  3T4H B;  3PIJ A;  1M06 G;  4P14 A;  4ET7 A;  4W8J A;  2CTV A;  1ND2 C;  1QDO A;  2UWB A;  3V56 A;  4A44 A;  2A3X A;  2XUE A;  5FZK A;  2XH6 A;  2VTX J;  1D2S A;  1YWK A;  3JU9 A;  4ZS2 A;  2X5I A;  3WP4 A;  2WT2 A;  1HIX A;  2HEY F;  3BOP A;  3M3Q A;  4IND A;  4XCB A;  2HWB 2;  1RB8 G;  4ZHN A;  4GMP 0;  2P1B A;  4P5H A;  4ORF A;  4XC9 A;  2XXZ A;  3ASI A;  4AFA A;  2ZX3 A;  1VBD 1;  3BPZ A;  4FQ4 A;  4YZ4 A;  3WQB A;  4CCO A;  2QQI A;  2WKK A;  1GNZ A;  1TG7 A;  1IS6 A;  3MIF A;  5F5A A;  3FLT A;  4E2S A;  2RS1 2;  2PA7 A;  3VKF C;  1N3Q A;  2ORX A;  1XNC A;  4BME A;  4K9S A;  4L8Q A;  4Y1V A;  1A34 A;  1ZRC A;  4IDZ A;  4FTE A;  5J09 A;  4I09 A;  5TSW A;  2AEY A;  3BTZ A;  3O5S A;  2WN2 A;  3WIN E;  1FPN 1;  4LHL A;  1RMU 2;  1QF3 A;  5DPN A;  1J83 A;  2XR4 A;  5JPM B;  4UI9 L;  1AHS A;  4TTG A;  1B35 B;  5IAX A;  3KQ4 B;  4IEU A;  5DAV A;  3UKN A;  1H6Y A;  3E5U A;  3FLP A;  1FPN 3;  4I30 A;  2WQ4 A;  4XOG A;  3VBO C;  3B3Q E;  3TWI A;  5JOX A;  2FCU A;  4YPJ A;  4K6B A;  2JG9 C;  3ZN5 A;  1AYM 3;  4N53 C;  1GZT A;  1HRV 1;  3KHB A;  4LLO A;  4Q4V 1;  4DO0 A;  3IPV B;  2E9Q A;  1QH6 A;  2V4A A;  2DVB A;  2ZX0 A;  1W2N A;  4JCK A;  4LHK A;  4AI9 A;  1BMV 2;  1F15 A;  5CZK A;  2WNV B;  3ILF A;  4M4P A;  5FKB A;  3EB7 A;  4CCN A;  5DZG A;  3AZX A;  2W1Q A;  1RUJ 1;  2J1S A;  3CJX A;  3H1Y A;  3QH6 A;  4FSJ A;  4HG6 B;  1J3Q A;  1QY4 A;  3D0J A;  3LPF A;  1A8D A;  1NLR A;  1U12 A;  1VLN A;  4JHT A;  3OPT A;  4LO6 B;  4UFI A;  1ZRR A;  1D4M 3;  1JOB A;  3T08 A;  3WHT A;  4EN6 B;  4J6G A;  2R06 1;  1AYN 1;  2BOJ A;  3DXU A;  5ACA 1;  1LOF C;  1CAU A;  1LOA A;  2V5Y A;  3LD8 A;  3MLK A;  3PTR B;  2HWC 2;  2D5H A;  2NPI A;  2VBB A;  4OUS A;  3HT2 A;  3RFR A;  3WF1 A;  4UFL A;  4DUX A;  2FD8 A;  4Q4Y 3;  5I91 A;  4XMA A;  2RS3 1;  2GSY A;  2VJX A;  2FDK A;  1W8F A;  2VVD A;  1Z7S 1;  3MYX A;  1OLM E;  3WNO A;  1AR7 3;  3KZ4 C;  1BK0 A;  2E51 A;  5JR2 A;  1BQP A;  4PDW B;  4YZ3 A;  2VNO A;  3SEP A;  1BHG A;  2W52 A;  1SFP A;  2ZZQ A;  4XFG A;  1V70 A;  2W47 A;  3DYO A;  4CSW A;  2VR4 A;  5JMO A;  4SBV A;  1ND3 C;  2EXI A;  1H0B A;  4BQ2 A;  3KLS A;  3VV1 A;  4LUK A;  1V6I A;  2DBI A;  2CU5 A;  2HJI A;  2R49 A;  2Y64 A;  2YMZ A;  3MPB A;  3KGZ A;  4P9I A;  3BB6 A;  5CIS A;  2ZHM A;  5CAD A;  1NA1 C;  1RUD 3;  4YSF A;  3ILN A;  4UFH A;  1QXJ A;  1OH3 A;  2NM1 A;  4WVW A;  1XSQ A;  4AK3 A;  4YW1 A;  3C7G A;  4N9I A; 
#chains in the Genus database with same CATH homology
 5A3O A;  5D2A A;  2JDU A;  2JDK A;  5A6Z A;  3DCQ A;  2JDY A;  2JDM A;  1OUS A;  1OUR A;  5A6X A;  5A70 A;  2JDH A;  2JDP A;  2XR4 A;  5A6Q A;  5HCH A;  2BV4 A;  2BOJ A;  1OXC A;  1OVS A;  2BOI A;  4UT5 A;  4CE8 A;  2VUD A;  2VUC A;  2WR9 A;  2CHH A;  1OVP A;  1UZV A;  4AOC A;  5A6Y A;  1W8H A;  2JDN A;  2BP6 A;  1OUX A;  2WRA A;  2VNV A;  1UQX A;  1GZT A;  3ZDV A;  1W8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...