5D2AA

Bifunctional dendrimers
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Fucose-binding lectin
publication title Overcoming antibiotic resistance inPseudomonas aeruginosabiofilms using glycopeptide dendrimers.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5d2aA00
2JDPA 1OURA 1OXCA 1UZVA 2CHHA 2VNVA 2JDNA 3DCQA 2JDMA 1W8HA 5A6ZA 5HCHA 1W8FA 1OVPA 1OUSA 2VUCA 5A6YA 2VUDA 2BV4A 5A6XA 2XR4A 4UT5A 4AOCA 2WR9A 5D2AA 2JDHA 1OUXA 2JDUA 2WRAA 2JDYA 1UQXA 4CE8A 2BOJA 2JDKA 1GZTA 5A3OA 1OVSA 5A70A 2BP6A 3ZDVA 5A6QA 2BOIA
chains in the Genus database with same CATH superfamily
3DKWA 2VC9A 1TQ5A 1WCSA 2HEWF 2Y33A 5FUNA 1TE1B 4WM7A 1B35B 1J1TA 3ZFGA 1UWWA 2CGOA 4PLNA 4Q4Y3 1ZBA3 1AX1A 4QU1A 1PX4A 1OQEA 2R49A 5J1XA 1O7FA 3DYMA 3I3DA 4PF5A 4CDUB 5FZ0A 2JDZA 1QDOA 3JD71 2GZWA 2RS52 2PLV1 4JVAA 4AFAA 4COYA 1CJDA 3P3NA 5IFPA 1F4AA 1CESA 3SEEA 1NUKA 3HNBM 2YC0A 3MIBA 2XLAA 3B00A 4GH4C 1VBA2 2X29A 1J58A 1WLTA 2CGNA 5BNOC 1ULOA 5ACA2 2NP0A 5HXVA 3CJIB 1HQNA 4FPJA 3D82A 2ZX1A 4D6RA 3ZXKA 4UW6A 3ZPYA 3VN4A 2EICA 5FP7A 4XQWA 1YQ2A 4COUA 3J9SA 2RS31 2Y0IA 1RUF3 3PTYA 2E51A 3BVCA 3CIHA 4YVWA 1H2NA 5GM0A 4A3ZA 3W21A 2AREA 3FUOA 5FY9A 2YUEA 2G1MA 4OFGA 2DCKA 1QJEA 4JX0A 1X7NA 3NO8A 5DABA 1ND2A 1SHWB 1V9U2 4KWUA 5FMBA 2RMU2 2D5HA 3AFGA 5E89A 1M06G 2WINB 4XFFA 1WMDA 5EZWA 5A1FA 5HCFA 3FBYA 5I0SA 2VD7A 1FMD2 3AP4A 4Q8LA 2GH2A 1LESA 1H1AA 1M4WA 4AEDB 3W5MA 5A7NA 2YMZA 3IN9A 5E1RA 3WUDA 1N1SA 5FYYA 3WF2A 4XMAA 2EXIA 4LEJA 4XETA 2GU9A 2W3JA 2WSVA 4IGPA 4M00A 2PTMA 2C24A 2XBO2 3D6EA 3LSEA 3MHZA 4P5HA 3V65A 3W5NA 3B93A 4MH0E 4Y4YA 1CAVA 2ZMLA 3E5XA 2Y26A 4DUXA 3CLPA 3T09A 1I5ZA 2YV8A 2GNDA 1YUDA 4CCDA 2DTYA 2HWD2 3OUIA 2VOKA 4PIYA 3NV4A 3MZHA 1RL3A 1OBNA 1VBE1 2DVBA 3JQXA 2HEVF 2WA4A 4XBNA 1HDKA 1SCRA 1W6PB 1QOSA 2WYSA 1RJ8A 4Q4V1 3NJYA 3IDEA 2QUOA 1SLBA 3AVSA 4PIZA 5D21A 1WCUA 1NY71 1ZM1A 5FCCA 2QQPA 1SLTA 5F6LB 2QQOA 3I2IA 2BU9A 1UIKA 3ZYJB 3T4HB 1IGOA 3DL3A 3KGZA 3FMGA 1HKDA 3IBMA 3PL0A 1UOGA 1RMU2 1MZ6A 5JXIA 1PVC3 3IZOA 5K0UA 1AYN1 3NNGA 4NPLA 4HL0A 5FIXA 1YIPA 4BISA 4P9IA 5BNPA 3RI8A 5LW9A 1PGL1 3ZDSA 1KD7A 4GKYA 4ES9A 5JAXA 4LXLA 5GKAC 3UL2A 5GZFA 3P5BA 3UETA 3RZHA 1GICA 3JQWA 1FOD3 1UN1A 1XE8A 2NYYA 3NAPA 5A6ZA 1NA1A 2GMMA 5JR7B 3WDUA 3E6CC 4PBPA 4XBQA 4BQ2A 2W5FA 1LOFC 1COV1 1O4ZA 1G6NA 2BEOA 4TYSA 4XAEA 5FZMA 4E4DX 4JC1A 1LKNA 4CU7A 1VBC1 4QWNA 5KBFA 5CFCA 5H9SA 1QKQA 3GBGA 3QCWA 1Q8PA 1UY0A 3N7MA 3WDTA 1OKOA 4Y33A 1K5MA 3H1WA 3NKGA 1H6YA 2HWE3 3ZYFA 3S5AA 2ZHLA 4UW3A 5AFEA 3S6PA 3CO2A 5FZOA 4CPBD 4NUBA 3UJQA 4CCOA 5CA6A 4CCNA 2P4EA 2RR12 3I2HA 4RFRB 3FWEA 3LE0A 4PBOA 3VBUB 3OGJA 4JGZC 1H2LA 1NZCA 4XJUA 2BGCA 2A3WA 2KA3A 1QJU3 3RZKA 1H8TC 4AEDC 1OFNA 4QQLA 3NNJA 1RVF2 4HKLA 4MXWA 4AOCA 4GZ9A 4RGGA 4UBHA 5GLZA 4H3WA 1WW4A 1W0NA 4YG3A 2XLFA 5EHDA 3VZJA 4CXXA 5JSRA 1IG0A 2C6SA 3I3MA 5FPXA 2XQXA 5DQ0A 2RM22 5A7WB 4AFCA 1SACA 4MV2A 4OI0A 3NNMA 3T2QA 1PIV2 2W9XA 2Q1MA 5GZEA 1XSQA 4QKFA 4XPVA 4Y5Z0 3FLPA 4AWDA 3LOBA 4DIQA 3J7NA 2UY8A 2BZDA 1UYPA 2O1QA 4NO4A 4TLFA 3NQHA 4R9CA 1LHOA 4BK4A 1W0PA 4JHZA 3WDVA 4QB1A 2FDGA 1JYWA 4JTNA 1QQP1 2R073 2YROA 3OBAA 4ZS2A 5FK8A 1IQDC 4CCLA 4ZU5A 1Y3TA 3GHMA 1DGWA 5FY8A 3SC7X 4PF1A 4RA0A 4LT5A 4BU2A 5LK5A 3C8XA 3AVRA 2RS12 4JCKA 4QDQA 2FCTA 1IG3A 2XHKA 1W9WA 2W68A 3D5OA 4XABA 1O59A 2CY6A 2ZGQA 5F5AA 4FPGA 3K4AA 4CCEA 3KV9A 2X5IC 1O4YA 1Q8OA 2J7MA 4AI0A 2FCVA 2NZ9A 4S2HA 3SMHA 1OOPB 3MYXA 5JXGA 1QJFA 4NPRA 4D94A 1BK0A 4QPIC 1RHI1 3AYDA 3GM8A 1TNRA 1S4CA 5LB6A 3VDDB 1DU3D 1XJAA 3KCXA 5JVVA 1RUE3 1FAYA 2UWAA 3HQRA 2Y64A 1C57A 3C7HA 2E6VA 3KGLA 4BM8A 3Q8BA 5F5QA 5FPVA 5A3NA 1X9PA 5CISA 2GAUA 5APAA 1G9FA 4YW3A 4CDWB 1QJZA 5IATA 2XVLA 3AKQA 3L2YA 4LORA 4XFGA 2ZTNA 3KQ4B 4RS5C 4Y22A 1JHNA 2GP5A 4LO5B 4JQTA 4YWAA 3PIJA 1SBFA 2L9LA 3E97A 4BIOA 1UY1A 3NNFA 1DG6A 4KNCA 3TWIA 3WNOA 4A6SA 4AL9A 3S30A 2JDPA 2QQJA 2UYAA 4AEKA 4C91A 1BMV2 1C1LA 2JG8C 1UCXA 3W20A 4LBMA 1GQPA 1UU5A 1WKYA 4Y1UA 5DZEA 1RUI3 5DMYA 3E5QA 1IHMA 2DBIA 2HKXA 2LROA 4NE9A 4IEOA 4YW1A 4OQ9A 3SISA 1JMUB 1KS5A 1FPN2 2ZX2A 2D7FA 4F8AA 4W4ZA 2V09A 5K4LA 4OHYA 2IC1A 1NE4A 3EJKA 1OD3A 3JD72 3RRDA 2D6NA 5CZKA 4P9LA 5A7PA 2PLV2 1O3QA 3I49A 2XL7A 4LBJA 1W03A 3ZVXA 4GB31 4QXCA 4QQHA 1K5JA 4QDSA 4AVTA 3IM0A 2K2SA 1BQPA 3APBA 1VPHA 2EF6A 4XQ4A 5C5TA 4EN7B 1PM7A 2BNMA 4NHKA 2NMOA 1QXRA 5CAZA 2YPJA 2ZBJA 2Y6GA 5T5PA 1SQ4A 2A3YA 3ZYBA 5HV0A 3OG2A 1GSLA 1W8TA 1PGW1 4JRLA 4XJ8A 4O9EA 3EBRA 3PUQA 5EPAA 5CFDB 4YG6A 4KQ7A 3ZFEB 3J8F3 1D7PM 2P3IA 3ELNA 1JXNA 1AF9A 4IEUA 4YZ3A 4E4HA 2GN7A 2A7AA 1HRI1 2JWPA 4HLTA 4CEWA 5IK4A 4K8RB 2R16A 4FCAA 4NRPA 1POV1 5J96B 2HLEA 4ZZ5A 1XSRA 2BOIA 4AGRA 4COWA 2FZ1A 2D43A 2PAMA 5CNAA 4AAPA 1AXYA 5FYVA 4AHYA 4IE7A 2ZACA 1DQ2A 5L9BA 2OT7A 5F5CA 4CEYB 1LOCA 4JKLA 5FDBA 2UWBA 1OOPC 2CSGA 4LK7A 5IJRA 5FAXA 5ABJB 1YIFA 1BEV3 2Z42A 4Z1VA 5JPNB 1WW5A 2WZR1 1SBDA 3JUUA 3VDDC 4NWWA 4IE4A 1AR81 1IPSA 4QX3A 3ZKYA 4XURA 3V56A 4AFMA 4J1XA 3T1MA 3P6BA 1NOVA 3WNXA 1QOOA 1WD4A 3ECQA 5ANQA 1Q5OA 4PDWB 4UI9L 1BBT3 4TZDA 3BGAA 2Q8OA 4EWEA 1OQ1A 1VMJA 2ZMKA 1GZCA 1W9YA 1RUG2 1AR73 1UYXA 2D98A 4XFAA 2PFWA 4UOJA 4IW3A 1QJX3 4FBFA 5BNQA 2OKXA 4FTSA 1RTVA 2QZ3A 1DQ1A 2ARCA 2ORXA 4KU7A 4DY5A 1W06A 4MVTA 5FMOS 4YW5A 4A7KA 3DPRA 5I0DA 3SCHA 4B1LA 2VY0A 1TME1 3MF6A 1VP6A 1NCQA 3PHMA 4K3UA 4EV0A 2WO2A 3KZ4C 5F3CA 5M0TA 1W28A 1F35A 3WHTA 1ASJ3 2WQ8A 3D3AA 1YFYA 2MEV1 4N43A 1NY72 1W6NA 4A44A 2DCYA 2D5FA 3SH3A 2V4VA 4KMQA 1AYM3 5F6KA 3WW3A 3H1YA 1J83A 2VTXJ 2X05A 2YC2A 3BPSA 2IVIB 3FN9A 4IV1C 3RG0A 3GYDA 3USUA 1MS5A 4OI4A 3BTYA 4A4AA 5C9AA 1VRH1 3PUIA 4AK3A 3HQXA 4R9DA 1CIYA 1HJGA 1AYN2 4K1ZA 5CG8A 1LGCA 3PMSA 2NN8A 1FNYA 1NXD1 3LPFA 4HONA 5FUPA 5A33A 3VD9A 3V0BA 4Q27A 5LBCA 4CDXA 2QQWA 4YM1A 1HRV2 2A3XA 4ZY9A 3A23A 1WMEA 3HJRA 1E5RA 3Q8FA 1HXS3 2E31A 5A32A 1GLHA 5H9PA 2WQZC 4DUVA 2ZEYA 3EMRA 3AP7A 1YJLA 1LHWA 2WFF2 4LA3A 4RQPC 4IV3B 5CFDC 4LKDA 3RZJA 3M3IA 3AKTA 3CMGA 2R0FA 4IEPA 3OD4A 4P9YA 2CU5A 3OB8A 1VBC2 3PVBB 4PQ9A 4CRQA 1MS8A 2WYFA 4DY3A 3J7MA 5I0RA 4NAMA 3K3NA 2WO3A 4LK6A 4XF9A 2QKDA 4UFKA 4FOVA 3JB4C 1UPIA 2BRTA 2WZEA 4WVMB 5C33A 1OPMA 1E57A 2FBEA 4GMP0 1QJY1 2Q0AA 3DUIA 3T30A 4IEVA 1YJKA 2JB8A 3H0OA 3M8LA 1ZYBA 5FZIA 4BWOA 3LEMA 5FRAA 1RUJ2 3CZJA 3ZOIA 5A3LA 1GU3A 2O14A 3SCGA 1GZWB 4GMP1 4BE3A 1XOYA 3LAGA 1S0JA 4FSJA 1YYNA 2A6VA 1R093 3LD8A 3QH7A 2A70A 4EZ4A 3DKQA 2CTVA 3MUZ1 2VJXA 3AL6A 4LBKA 4LKEA 5FXZA 2QFEA 2VZ3A 3B9CA 1ZX5A 5A70A 1EUTA 3JCIA 1R1A1 4AVAA 1Z7S2 1DGLA 5DAPA 2PQSA 3ZYHA 4NMIA 2CV6A 1AVBA 1XYPA 1S2EA 1T6GC 1IQAA 3WF1A 2I07B 5T5JA 5GZCA 1K12A 4Y1ZA 2XWBB 1H2KA 5C6CA 3IPVA 4CZSA 3TB0A 4BDVB 4KG8A 4QQ2A 4WM7B 3ZFGB 2VCBA 1CX4A 2WS91 3IAPA 2DCJA 3U1XA 3CU7A 4XILA 4XJZA 1XXNA 4OVEA 1Y9GA 1D2SA 3FFZA 1CJPA 1OSGA 5A3MA 3T0DA 2HWB3 4Q4Y1 1JN2P 1IS5A 3POWA 3LDRA 5BUVA 1I6XA 5A7OA 1HB2A 1I3HA 2DV9A 4MLOA 2ZPXA 4XUOA 2OW4A 3H7JA 1VBB3 3LFMA 4UF0A 3TEWA 2D3PA 4QX8A 4JTOA 2JE7A 2B7YA 5LRSA 5A7QA 2YGMA 3WV6A 4CP9A 1I1EA 2QVSB 5F1RA 3GXUA 4IXLA 4BIFA 5JI9A 1GUIA 1AL23 4Q4W2 3RVHA 1EAH2 4D3WA 2VR4A 2VULA 5J37A 1CAXA 4FAHA 1ZRFA 2BVBA 2XJQA 1MZ5A 2EALA 1LOGA 3VBFC 2DVAA 1WA6X 1LOBA 3OJBA 5LA1A 2DU1A 1MVEA 5I93A 1WBLA 5CB7A 3WQ7A 3PU3A 1RUF1 4GXLA 1BZWA 1WD3A 3ZYPA 4MADA 1D4M3 4XUQA 2P34A 2Y6HA 1WUVA 2HWC2 2WL1A 2BW8A 3PDQA 4KBZA 1ULCA 3HQUA 5JMOA 2H6CA 1ENRA 2Q4SA 2EIDA 3ZXJA 3VD7A 1Q8QA 1GQGA 2O0OA 4NOTA 4JRAA 5FZ4A 4OUSA 3A0NA 4A7ZA 2GDFA 4QHOA 4QX2A 1UU4A 1R1ZA 5L7OA 3LOIA 5E6HA 1U5XA 5C5UA 4LKSA 1HN0A 5DXDA 5C3PA 3WOGA 3TN91 1LB2A 2C9AA 1ZZCA 1OH3A 1RUD3 2UYBA 4BQYA 4DFSA 2UY9A 3NMBA 3ZM8A 4RQPA 1PK6B 2VMHA 4LOSA 3ZMNA 2D44A 1UOBA 1UPSA 2ZGPA 3WXPA 1NQDA 2VZSA 2XPJA 2VL4A 2JJ6A 2X10A 4J1WA 2IXLA 3WNMA 1SDWA 2E53A 2WT2A 4CP1A 2WNUC 2LS6A 3FL7A 3EB7A 5E88A 2J22A 5T50A 2JEMA 1G86A 1SFPA 2VW2A 1KJLA 2PHTA 3BTXA 2VZ1A 3TEXA 3MO4A 3O0VA 5LY1A 1L7LA 2QJVA 1PGW2 4QGLA 3U10A 3PMEA 3PVOA 4R52A 3VL8A 5D2AA 4FXGB 5HV4A 2K9ZA 4CDQA 1CZSA 1OUXA 4N7UA 3DYPA 1CD3G 1LECA 3NJXA 5LEJA 1XPWA 5IVFA 1Y4WA 1UKRA 2XJUA 5C4WB 5J7MA 1DGRN 3HNYM 1HRI2 2QTWB 3FE5A 3VL9A 1S0IA 1SLIA 4ZXEA 2P3JA 3WQ0A 3IIIA 1S2KA 1STMA 1DGWX 1SPPA 4LIVA 5BNNA 3UKVA 4BHPA 2XH6A 3RZMA 4FFHA 5FLHA 2WIIB 4DMIA 4LHLA 1GV9A 2JDNA 4CU8A 1ZZ8A 2SBAA 2KXLA 3NJZA 1RJ7A 5K0UB 5FYIA 3FHIB 5FZBA 5BNPB 1JYIA 4Y20B 1AR92 3ENRA 3KT1A 1PVC1 4KGGA 1AR82 1HB1A 2XR4A 4UT5A 3UYJA 3RZLA 3OEAA 5BV6A 2UWCA 2ILMA 4WVVA 3WVJA 4DEQA 2ZEZA 3BOPA 3I2KA 1MZEA 3KF3A 3NAPB 2JB4A 4NIIA 5CEHA 3A22A 4IQPA 3V0AB 4N9HA 4RR3B 4V2WA 1FOD1 3H8UA 1UOFA 1UMHA 1CAUB 2I74A 2J1AA 2Z4FA 2ZAAA 2FQPA 3HPNA 3I3BA 3VZOA 4D69A 1DZQA 3RMXA 4DRVA 5IHRA 5CFCB 3HWJA 1O5LA 2PA7A 1DFQA 1K5MB 3I2FA 1ND3A 2DWRA 4MZUA 5FYBA 3AZXA 2YU2A 3MW2A 1RUC1 5BXXA 3ZPOA 1Q56A 3TBDA 4E2SA 3WCRA 4NIDA 2G9FA 1S0BA 3K4DA 4HKWA 1TME2 1MS9A 3MIHA 2HWE1 4FPLA 2BJSA 4KH9A 4Q0VA 1W99A 5FZOB 1OLQA 5IT6A 4JZRA 5DUUA 2JD9A 4LTAA 2MEV2 3ZR6A 4L97A 2F4PA 3JBG1 1NYWA 3NRUA 2BOJA 2ZX4A 1GBGA 5KWRA 2WC2A 2ARXA 4NIHA 3POSA 1YC61 1LHVA 1WCDJ 2D6PA 3AXDA 1F5JA 3PU8A 4FPFA 4MXWB 1R081 2WO1A 4DINB 3USSA 1PK6C 3G6JB 3GDBA 2JDAA 4OHVA 1RUH2 2R063 4ASKA 4E4ZA 4URTA 2ZAHA 4HK8A 4MSVA 1XNAA 1JU4A 3LDKA 4D7YA 2ZHNA 5DPNA 2VVEA 4XOGA 3UESA 4BPZA 5ISLA 3T4VA 3LA7A 4XCBA 3VBSA 3ACLA 1SMVA 4YGBA 3HBZA 1IS4A 1F15A 4LE3A 1Y43B 1NE6A 4AHZA 4UXAA 5CADA 2KM2A 4YARA 1NLSA 2RS53 1VLNA 5JI7A 4XYXA 4IE5A 4WBBA 5EYYA 2VGDA 2W46A 5C4WC 1U0AA 1BKZA 3UJOA 4KL1A 2D6OX 3T08A 4AEJA 4E2GA 1HIXA 1VBA3 2DCZA 1PZ9A 2Y6KA 2A6WA 4YVSA 5ACA3 1WMXA 4FTEA 1A8DA 2UU8A 2Q8EA 1IPJA 3GGLA 3S7IA 4ZXKA 3C7OA 2A6YA 3VDBA 1PM4A 1N3QA 3W59A 2ETEA 2X53S 2WZ8A 4QKBA 3TOJA 4GQ7A 3KHCA 2P3YA 4KU8A 2VMGA 5FZ3A 5FP4A 1OD5A 3FHAA 3KV4A 5BPXA 1G9BA 2H0VA 2JDUA 4O61A 3HT1A 1P8JA 3THTA 5F2WA 1X8MA 3FLTA 4UWDA 2Y38A 1O4TA 1AXKA 3AZZA 5FZKA 1AJKA 3VBHA 3KCCA 4QU2A 3KMHA 1SCSA 3AL5A 4RR3C 3AYAA 3UNPA 5JZGB 5F32A 1RUE1 4DXTA 4QAWA 1OURA 4FTBA 1PO22 3MW4A 4TWTA 1V9U3 2LTNA 3HVDA 4Y22B 4BK5A 4F7ZA 2RMU3 3I7DA 4XHXA 1DLLA 1L7QA 3NJVA 5F3GA 2DVGA 3D4KA 4XFIA 5FYSA 3OGVA 4B8EA 1RUOA 3VBRA 5DN2A 1JYNA 1DIWA 1HQWA 4UFLA 3ZFFC 2VMIA 4KWKA 4EZHA 2BBVA 3B94A 4A42A 1CWPA 2QCSB 3O0XA 1LODA 2WS92 5A80A 1MPXA 1PZ7A 4TSVA 2E7AA 5LY2A 2DDUA 1OC1A 2VCMA 1RUI1 3CF6E 3RI9A 3NL1A 5HBAA 3SXWA 1MS4A 3DEMA 1OA3A 4W6WA 1H6XA 2XBO3 1QHDA 4JGYC 2JD4A 3HOBA 4AQ6A 4BMBA 1DDLA 1Y7BA 4D0QA 3GZTB 2EIGA 2VH9A 4C0HA 5IK5A 2HWD3 1QXPA 1DGRA 1I9RA 5C3OA 2R1BA 4I0AA 1RXGA 3IT8A 4C1XA 3WQ1A 2JG9A 2HWF2 5TSWA 3ZKUA 2R30A 2A6ZA 4CUCA 1XYNA 4OYUA 4EYUA 3ILRA 4C8DA 1H4GA 1NX9A 3TNPB 1DQ5A 3OUHA 2E26A 4DXSA 5L36A 2QDRA 5KHHA 5AC92 3H7YA 2VTXA 1WW6A 4NVPA 2PXJA 1JYXA 4PHZA 3M1HA 3HBKA 3WR0A 3O1MA 3AYEA 4LE4A 4OULA 3WW2A 1RUF2 4QD2A 3M2MA 1WA4A 3J8F1 4HETA 3HT2A 1RMU3 1EV12 4RFT0 4CCMA 4RGAA 4CEWB 5A3WA 2VNGA 1DQ4A 5FOJB 3Q8CA 4MGIE 2G19A 4I09A 4QPGB 1MQTA 2ZKLA 1C8M2 1GOFA 4IESA 4IUGA 3LDBA 4CU6A 4AFDA 5FREA 5FZ9A 1B35C 2R7EB 3VBOA 2J42A 2PHFA 2VAUA 2ZEWA 4FXKB 1NXMA 3S57A 2WJSA 1ZA4A 4MGYE 3WG3A 4QGMA 1WBFA 4M3CE 3LGRA 4CDUC 4DEVA 5KHIA 2RJ2A 4L92A 1WCQA 1RB8G 1US2A 3TN92 1C1FA 4EQVA 1FYUA 3NW4A 4W6YA 1WMFA 4WM8A 2HYXA 1H8VA 3N9PA 4ZS3A 1UYYA 4L2NA 4DUWA 2RG4A 4LBQA 1WGPA 1J3PA 4Z2WA 4AVSA 1H9WA 5D8AA 2PELA 2ZHKA 3CJIC 1W05A 1UX6A 2A1XA 2YGLA 3NSTA 1O3SA 2LUWA 1EY2A 5FZAA 5C8CB 1VBD2 1W8FA 5K8SA 4GJZA 4ATFA 4HMZA 3QD6A 2RR13 2AR6A 2DCTA 1BBT1 2GNBA 2XHNA 4CUAA 3TEYA 2Q5TA 4XFCA 5EP9A 2E7TA 3WEZA 1NQJA 2CGPA 3WF0A 3NVCA 1ZVFA 4K20A 1AL0G 4YLZA 4BZ4A 3UGGA 5FUIA 3TEZA 5DZGA 2E7QA 1RVF3 5DDJ3 5FZ6A 1YEWA 1NCQB 4NR1A 3H3UA 1MEC2 5FPZA 5L73A 1QU0A 4HSJA 1FV3A 2A6XA 3SCFA 5KC5A 3MPPG 2ZGKA 3IIAA 1CVNA 1W6NB 1UD1A 1W3XA 3WG4A 3WF4A 2RM23 1AR61 1O5UA 3ETPA 4MX3A 3FHQA 1PIV3 2XUMA 4GH4A 3CHXA 4IERA 3ST7A 4XDOA 5BNOA 2FHRA 2ZGLA 5C9AB 4LO8A 1ZRCA 3OTFA 3N36A 1WWYA 2W1UA 1LOEA 5F39A 5A33B 1V00A 1W04A 1POQA 3BODA 3EXUA 1QY4A 5DG1A 4D6SA 1TMF2 1UNBA 4LLFA 4L99A 3RPQA 3U37A 1F8VA 5A32B 3ZXGA 3ZSEA 5JXJA 4GAZA 1OVSA 2RS13 5FZEA 2GP3A 3ZFFA 5B4NA 1HXS1 3RMYA 1LENA 2QZ2A 3OGRA 5GLVA 3I4IA 4O9GA 4ET7A 3JU9A 3U4XA 2W0XA 5LEKA 1W6MB 2BFUL 3ABZA 3VDAA 5C7GA 4DXRA 4B3NA 3AK0A 3OF1A 4GJYA 4XUPA 1RUC2 4XUTA 4JGYA 1RGSA 2XOMA 1UY3A 2ZS6B 1W6QA 4LMFA 4BQ3A 3OOXA 1JODA 4OCTA 1W2AX 1JH5A 2R041 3G7DA 4Q1RA 4U36A 5E16A 3WD5A 4M3CB 2WO7A 2AENA 3JBG2 3N3HA 4LBLA 5LASA 1RYYA 2BGOA 3RFRA 4A3XA 4AQSA 1UKGA 2D93A 4N9IA 4QX1A 3TNQA 3QOPA 5IK7A 4FFIA 1R082 2ZGOA 3VD3A 4MGQA 2CHHA 2IXJA 4ES8A 3NV1A 3MPBA 2Z5WA 4IE6A 3UGFA 5T52A 4AHXA 1K42A 1W2UA 1J3RA 2EAKA 5IW0A 1W2NA 2P3KA 5GZGA 1WW7A 2XXZA 1FPN3 3WHUA 3N4MA 3AP6A 2WRAA 4SBVA 4AQTA 2YBKA 2VZQA 3IMNA 4JDMA 1W8NA 3A0KA 2JIJA 3I59A 4CUBA 3JD73 3NNLA 3BOWA 1QWRA 3R4SA 3IPVB 5F8PA 2QNKA 3PNAA 3WT3A 1J1LA 2C26A 4FFGA 3ORJA 2VO5A 3SH4A 2QQUA 5C3RA 3H3ZA 4NAOA 1YHFA 5T5LA 2D97A 2QE3A 2VZTA 1SFYA 3LIGA 4FI9A 4P08A 3U14A 2WNEA 4YM3A 3Q8EA 5JMCA 4NRQA 1XBFA 4BXSV 4Y3OA 3AX4A 4XUNA 3VBUC 2FDHA 4BQ1A 3RNSA 5FZ8A 3TYJA 3VDCA 2PHLA 2VW0A 4PI0A 1LNSA 3ZYRA 4AE2A 3WNNA 2HWB1 3MUY1 4B4QA 3K75B 5EQUA 1VB2A 2Z2SB 1OH4A 3VHPA 4JQRA 1LULA 3M7AA 4JDNA 4QT6A 3VB9A 1L7RA 1ULPA 1VBB1 1UQXA 3DGTA 4XAAA 3ZXAC 4H7LA 5J98B 3CZUA 3IDBB 3AMHA 5JPMB 1CAXB 1LOFA 1A8MA 3AJYA 2VZUA 1AL21 1IS6A 2VOVA 2VOTA 4MOAA 4AVCA 1JUIA 2PHUA 5JOXA 5ANNA 2OZJA 2VM9A 4E2QA 2JIGA 4QPYA 4FT8A 2VBBA 2IVJA 2MHFA 3AC0A 2RS32 3PVEA 4RHV1 1O8SA 2XJSA 5DZFA 5EYXA 1JZ5A 4Q8KA 4XIOA 2IFRA 3J7LA 5JWPA 1AJOA 1OKQA 2VMEA 1D4M1 3CDZB 3O1SA 1LHNA 1PMHX 1POV0 1W6OA 1AXZA 4HVOA 4JGZA 3RJRA 2DFBA 2VZVA 3CQOA 2N7GA 3LFIA 2OUHA 1QIQA 1H8TA 2YBPA 2D6KA 3IAQA 4R4XA 3T0AA 4AEDA 5L7OB 3S0MA 1KFXL 4YGEA 1JI6A 2JENA 4ZPIA 3LEIA 5A6QA 2Y60A 4WZFA 1W9FA 1K3IA 3X29B 3HNMA 2Y0OA 4N53B 1RUG3 3BB6A 2LRPA 2P5BA 3BIWE 1JW6A 2GC2A 3VUOA 4HSLA 1JYCA 1UYZA 1OA2A 2ARAA 4OMCA 1V6NA 1GQHA 1RUD1 1LEMA 2YBSA 2J1TA 3O7OA 4RD7A 2D3RA 4PCRA 4Q0UA 5FO7B 2WNOA 2C9KA 5IWFA 4S2GA 2VMDA 1ZRRA 4TTGA 4HOOA 2RHPA 4OMDA 1S0DA 2JKBA 3LA2A 4BOWA 4AGGA 2OIIA 1JOPA 4CDWC 5FZ1A 2B8MA 1QMJA 3GBFA 3TAYA 4PIXA 2VXJA 4AR2A 3ZN5A 1UO9A 3ES4A 3UKTA 2UURA 4ISRA 4UFMA 4CDQB 2DUOA 1ZBE1 4CU9A 1KDKA 2VNRA 1YLLA 2LW8A 4FPOB 1ENSA 4DZGA 2IXIA 4A45A 1W39A 1AYN3 5FYUA 2X5IA 1VBE2 1GMMA 1ULFA 1ULDA 4M4RA 1N3PA 4WV8A 2F4LA 1SPPB 4Q4V2 1HRV3 1JZ6A 2B9UA 4YW4A 1H9PA 1PO11 2BBAA 4QPIA 3POGA 2FZ2A 4IEWA 2PAEA 3AZVA 3POBA 2D6LX 1YI7A 4FFFA 2EIEA 4MHRA 1A3KA 2VMFA 2WFF3 1ZRDA 3PUAA 5A3TA 1KJRA 1MZFA 1RUNA 2WNVB 3R0RA 4GWNA 2P2KA 4LO4B 5FYCA 5FYMA 3ZYGA 3H8RA 1QNYA 1VBC3 4QPWA 1NCRB 4I3GA 5A3UA 1KDMA 4XMIA 4YZ5A 3E1F1 2P17A 2OX0A 3AXEA 4N8MA 1GP6A 5FP8A 2G9ZA 4RS5A 1CGPA 1PGL2 3MICA 3WLUA 3OBTA 2GMEA 3T0BA 5IVCA 1H1IA 1GFF2 1HW5A 4YM2A 5FOBB 4XDPA 1JHJA 2W95A 3BALA 3ALQA 2JG8A 2ADDA 1RUJ3 2FCUA 1F9KA 4UW5A 1D2QA 3WQBA 1ND3B 3ZFEC 1KRIA 1COV2 4YZ1A 5IVJA 1BYHA 1IZ3A 3A21A 3BU7A 1BVVA 3I97A 4P5YA 3POFA 1OF3A 3K77A 4AZZA 4Q4X1 3CL1A 1IKPA 5JOZA 4FPHA 4YZ4A 1S1AA 1ENQA 3N9MA 5FZCA 3U75A 3ZLIA 3WNPA 1HJFA 3KT4A 4JAAA 5I8TA 2VNVA 2IWGB 5KHKA 1AR62 3GNEA 4AI2A 1VB4A 1Z7S3 2YXSA 3GALA 4FPKA 5JIAA 4BB3A 2O8QA 4CEYC 4Q26A 1GNHA 1F4HA 2TNFA 2VW1A 1MS3A 4MHUA 5A7WA 3F2ZA 2ADEA 5FYTA 2W39A 2OYZA 4DS0A 2AH2A 3IKWA 5ABJC 1YI9A 1S2BA 1UX7A 1SZBA 3KHBA 3MFCA 4NWVA 1T6BX 2RV9A 2RDQA 2WQ4A 3HIFA 4LR4A 4Y5TA 3SITA 1W2TA 2XL9A 3LCPA 3KV5A 5EWSA 2VECA 4A41A 4MGTA 2BDRA 3VBSB 2YU1A 3DXUA 2XKPA 3C7FA 3OY8A 3PUSA 4PDWC 2I45A 2WLPA 3OGSA 4QB6A 2E33A 5F2SA 4LLOA 4BYYA 1FXZA 1HV0A 1E5HA 2JICA 1N1VA 4XDQA 5GJ6A 3ZR5A 1C5HA 2NPIA 1G7YA 4HG6B 1TZOA 3POJA 4RN5A 2OVUA 3VGIA 3ZMOA 4EN6B 3N35A 1QQP2 1PX3A 3CNAA 4OZXA 3BUCA 4YVSB 4KWLA 1SG3A 2RJLA 3MLKA 1XNDA 3KVAA 4L8QA 1NT0A 1OOPA 4Q4W3 5FFOC 1EAH3 2GN3A 1VBA1 5C3QA 4LNVA 4QQOA 4ZHNA 3VKOA 4AW7A 1YQ5A 4CE8A 2R042 1Z0HA 4NHMA 4PJYA 2XONA 3SKJE 3VDDA 2ZZJA 3W58A 3ON7A 1S55A 4CSWA 3AM2A 4IETA 1QEXA 1W2OA 3RWKX 4E9KA 5BYNA 3WUCA 1ZBA1 2IXCA 1FATA 1EPZA 1EP0A 4K21A 4QHBA 4JV4A 2CYFA 5J09A 2CWMA 3WDXA 3VBHB 2DBNA 5EJ3A 3ILNA 1HB3A 1RHI2 2HWC3 4FP3A 3NV3A 5FWJA 1ALYA 1SDDB 3WP5A 1YNAA 2EXKA 2V73A 1IKQA 4Z82A 1OI6A 1WLWA 3VKNA 5JSOA 3H8XA 1LAJA 3OUJA 4XFBA 4YM0A 3B69A 5FYZA 4IV3C 2BNOA 4QKDA 1Q8SA 4TLGA 1V9U1 3AP9A 2YFUA 4L9BA 3VBRB 4YVWB 2RMU1 1UZ0A 1S0FA 2QQKA 5FKBA 1JZ4A 4LO6B 4OHWA 1DBNA 2WWSA 4YSFA 1L3JA 5HPOA 3H42B 1PMIA 1UXZA 3KD4A 4TN7A 4OI2A 4FP2A 2JE9A 4IV1A 3UGHA 1ZZ9A 1X82A 4AI8A 4XFHA 1ND2B 2YB7A 3T2TA 4XF0A 1CR7A 3OPZA 2HYKA 4G4FA 3H9AA 3N7LA 1U12A 1XRUA 1E5IA 2XBO1 3UT0A 2XVGA 4FO9A 4CVUA 2ZEXA 3KCYA 5HI0A 2JG9B 4UYBA 2J1EA 3J26N 5CFDA 3AKRA 3ZDVA 4GKXA 5FPLA 4GB32 2OPWA 4P9XA 3WDWA 1HRI3 4H55A 1UZVA 3MIDA 5B4XA 4DNYA 2CAVA 3BYWA 5LA9A 4E8CA 2FDJA 5FZLA 2B9VA 5IAVA 1CAWA 3WW4A 1CAVB 2K0GA 2LM3A 3ACFA 3AYCA 1C8NA 1LEDA 2PAKA 4HN1A 3P3PA 4RHV2 4FOYA 5I8YA 4CTEA 4GALA 4X8PA 1UZZA 5IVEA 2TUNA 4YPJA 4PLMA 1EYBA 3D8CA 2W1SA 2YYOA 5CU1A 5LBFA 1TVGA 1EUUA 2GNTA 5I0TA 1R64A 4CEYA 1D4M2 1AR93 4IGOA 4G3YC 1MQTB 4WVWA 1YRZA 3BCWA 1AR83 1YQCA 4HVQA 5J3UA 2WAOA 2RVAA 1DHKB 2VZPA 4WM7C 5DAXA 3HAGA 3ZFGC 1QH6A 3VBOB 1J59A 1UY4A 4G9SB 5T54A 4META 1ODMA 3RYPA 4QX5A 3OBRA 1RINA 2WWUA 4J25A 1H30A 2E32A 1MS1A 3I8TA 4HKOA 4MG2A 2V5DA 2ID4A 2XG3A 1MR5A 5A6YA 1ULEA 1BHGA 5D8AB 5IVVA 2WZR2 1RIRA 4YW6A 4XJAA 2YC4A 5FPAA 1S0EA 3ACIA 1G9DA 1UY2A 3U07A 1TME3 1SBEA 1APNA 2EXHA 4KBBA 4GWJA 1NA1B 4COZA 4AI3A 5E8AA 5FWEA 2XJPA 1NLRA 1OMIA 2MEV3 3EYPA 5FMOL 1C4RA 3JXSA 2RR11 2VUAA 1LJ7A 1ZBE2 4ARYA 2DVFA 5GLTA 2ZGRA 2PHWA 2W47A 1LRHA 4NN0A 2NQYA 1HLCA 3ZIXA 5B2GB 2PHDA 1RUH3 3CBNA 1DZTA 3PIGA 3SHRA 5DDJ1 1OUSA 3DV8A 3KWVA 4W50A 1JYVA 5FP9A 4MGZE 4BQ4A 1G9CA 2HEYF 2F17A 2WBKA 4GH4B 1OFSA 2PN5A 2DURA 5BNOB 1PO12 3WNKA 2RM21 2R32A 2JDYA 1A6CA 4HK9A 3SKVA 3ZYIB 3POYA 2WN2A 2X09A 3WDYA 4B7EA 1K45A 2A73B 3O5SA 5KC6A 3ZXDA 3CKHA 4IEXA 3VBFA 4AXOA 4IV3A 1VRH2 1QJU1 2AZ5A 3TRSB 4QM9A 1U5ZA 2BGPA 3JB8A 5LBEA 3VHOA 2V4AA 4QXBA 4QHZA 3UKNA 1WZXA 2VG9A 3GZAA 4DXZA 1DZRA 2PHRA 2CL2A 1VAMA 2RS11 4HBNA 4M4PA 4WVMA 4XC9A 3I3QA 4GIQA 4JDOA 4QX0A 1ZRIA 3ATGA 3I54A 1XE7A 4GMP3 4B7KA 4DRRA 2VU9A 3WCSA 4Q4X2 1W6QB 3B5LB 4XVHA 2AGSA 3H3LA 4RSUA 3K3OA 4NPMA 4Q1PA 2R071 4I2OA 5FLJA 3WP4A 4IDZA 1U5YA 4Y1YA 4GWMA 4YG0A 3O1RA 2IXHA 4OUMA 3K51A 1CONA 1VALA 1QJY2 1CPMA 2YPDA 4CPBA 1PO23 1YWKA 2CDOA 1V6IA 2QQIA 2WN3A 1LU1A 1AZDA 3ES1A 5K0UC 2WNUA 1UOJA 1FV2A 5BNPC 3JZVA 4BQWA 4M3CF 5AVPA 4C1WA 5C70A 2NMNA 4ZKTB 1N47A 4JHTA 5K7PA 3AKSA 3I2DA 1X8EA 3IDAA 3NAPC 2YG0A 4CCCA 3LZZA 5J48A 1D0HA 2WS93 3AB0A 1JZ3A 3WG2A 4CXWA 2SLIA 3I3EA 1UF2C 1R1A2 2ORZA 2WSUA 4ITCA 5F7UA 1SLCA 1XNBA 3I59B 5FBZA 1FPN1 4B1MA 5CFCC 2WZPP 4IL7A 5DUXA 2ES3A 4EN9B 3LEGA 1JBCA 5H9QA 4YFZA 3R6SA 1K5MC 2ZKNA 4YNIA 3RJ2X 2B39A 4F83A 1KS4A 3A4UA 4WZCA 2G9GA 2W94A 4Y24A 5DAVA 4XIKA 3Q8AA 4HPKA 1FMD3 3DXTA 2HWF3 3VKMA 5SV8A 1HB4A 4NJ4A 1EPWA 3LQCA 1LOAA 4LBNA 4LITA 4SLIA 2BUKA 2ET1A 3RYRA 1GZTA 5IUQA 5AC93 5G05L 4XF1A 5LATA 5IYYA 5A1LA 5FPUA 1GWLA 3FLRA 1X50A 4LHNA 2P6HA 4XZPA 5FBJA 4YYOA 3VV1A 3AP5A 4Q4Y2 1ZBA2 1GWMA 2VQTA 4D7TA 3H50A 5IVYA 4CCJA 2H0BA 2DVDA 4K9SA 4ZU4A 5DG2A 2JE8A 2XUEA 2Q8CA 5IAXA 2FDKA 1EV13 3GF6A 5FO8B 5LWBA 1O91A 2JX9A 3C7GA 4QX7A 2HH9A 1MACA 3H8OA 1C8M3 2RE9A 4M0HA 1PNFA 5FQ0A 5JOWA 3LF7A 4ONUA 4LQRA 4PI2A 5FJHA 1HN1A 4R9AA 3B9IA 3VZNA 5DAWA 1XNKA 3RYKA 2VQUA 1US3A 1YXWA 3M70A 3B3QE 3LSDA 4HN0A 3TN93 3N9QA 5F3IA 1W6OB 3VHRA 4BCUA 3O1PA 2JECA 4JGZB 2H6BA 4UFJA 4E4SA 1UAIA 4QM8A 1N3OA 1H8TB 4PQQA 3ZSJA 5LCWL 5KXEA 3E5UA 2VQAA 1PK6A 4CXYA 2ZX0A 5CKNA 2ZGNA 3ASIA 1JYTA 3FFQA 3J7HA 4W8JA 1AX2A 1VBD3 4K7JA 4W6XA 5KR7A 1JOBA 3ZX7A 4Z8BA 1RXFA 1OA4A 3CEWA 3V64A 4C0BA 3AZWA 4FQZA 1UU6A 5FXVA 2JDKA 1RUG1 2IZWA 1J3QA 5FMDA 4CP2A 1FX5A 1RITA 2XKOA 2ZHMA 4GD4A 5I8SA 1BEV1 3OYWA 1LGNA 4BJ0A 4BXFA 5L9VA 2WFPA 1MEC3 2XLGA 1TNFA 3N7JA 4MO3M 5DUWA 2VOXA 4EWDA 5JZGC 1ONAA 3O1TA 1ZREA 1IS3A 5C4WA 4Q0QA 5C3SA 5C8WA 2ATFA 3MF9A 4EE2A 3K4ZA 2DF7A 2CNAA 4IEQA 5CYYA 3CJXA 3T1LA 3IDCB 1SEFA 3BPZA 3ZIWA 2G4IA 2X5IB 1AR71 1GOHA 4Y4RA 4AEMA 4D7SA 2OZ6A 3DPRB 1BCXA 4CA9A 1JOJA 5HCAA 4E8DA 3B02A 4P9WA 2WLQA 1QJX1 4P02B 3WG1A 3ZN6A 3KV6A 5CVRA 2BPA2 2MPFA 4XACA 1W8WA 3FJSA 1C28A 1TMF3 4KWJA 4OQ8A 4QPIB 4DQAA 4Y20A 1JZ2A 4PT6A 4N43B 5FY7A 1OXCA 1HRV1 2WDBA 1GZ9A 2V5YA 2VBDA 3C7EA 1V6MA 4KG0A 1ASJ1 2VNOA 1CIWA 4HANA 2XJVA 3USUB 4WVZA 4XJ9A 3V0AA 2WFF1 3HMYA 2Z69A 4RR3A 3LKJA 2GH8A 1AYM1 4X8NA 4XE9A 4XCAA 3WW1A 1CAUA 3EQEA 1ULGA 4RS5B 3A7QA 1XU1A 2ZZQA 3V0BB 1PVC2 1RUC3 5FY4A 2Y6FA 4CDXB 3PLQA 2R6QA 4AVVA 3VD4A 3PVNA 4OHXA 3MGUA 2VUJA 1AUYA 1QXJA 1QNWA 2JG8B 1A78A 1FOD2 1CN1A 2BYVE 2R0HA 1QF3A 2W2IA 2W87A 3JBG3 4FOWA 4UAPA 5FZFA 3M4FA 4EJRA 2W1QA 1TEIA 1RUJ1 3N7KA 2ET7A 2GSYA 2B4KA 1R083 1JU3A 4AGVA 4CEWC 4RYDA 2WWJA 3P1IA 5T55A 1REDA 4R4ZA 5DDJ2 5GALA 2I2SA 4QPGC 2QDNA 3BI3A 4KGQA 3O1VA 2HWE2 2BERA 1I5PA 2JDHA 4AG4A 1HV1A 5EFUA 4IEZA 4Q29A 3THDA 1DYKA 2J1SA 2YY1A 4XF3A 5LZ6A 1KQRA 2O8OA 2W52A 1Z7S1 5G04L 4EN0A 2EXJA 3HN1A 4Q2FA 5EJ1B 2A71A 5GZDA 2W91A 3DECA 2C4XA 3FZ3A 2DUQA 3DYOA 3NWKA 2AEZA 1NLQA 4FQ4A 1DQ6A 1QJU2 1XB9A 1WLCA 3ZO0B 1R091 4S2FA 3OY8B 2B5HA 1V6KA 4FOQA 4K8FA 1W9TA 3BKZA 4M01A 2VTFA 1W3VA 5GLUA 5C8CC 1OLMA 5AVAA 1CX1A 2D3SA 3QBQA 3T2OA 5FO9B 2B45X 2RDNA 2AUYA 2ZGSA 2V72A 5T3NA 4HFSA 2W1WA 2XJRA 1DYPA 1UZYA 2ZA9A 5KXBA 3ROUA 3C3VA 3HR9A 5IFTA 3RWNA 3VLBB 1B35A 4AI9A 5IK8A 4W65A 3OPTA 3DPRC 4I30A 3ZN4A 4DO0A 1NKGA 4XQDA 1NCQC 2PLV3 1WLDA 1S0CA 4UFIA 4AHWA 4NIGA 2OA2A 2GALA 2QQLA 1T2XA 2VQ0A 5FLIA 2R072 4CDUA 5KXDA 4V2VA 4K6BA 2Q8DA 3WY6A 4N43C 2GC1A 2Y6JA 3GCXA 4Q4W1 1LGBA 1PVXA 1G9AA 1EAH1 1W8UA 5FTTC 1BK1A 4XXAA 2FMDA 2BVVA 4XTMA 5C9AC 3CJIA 2BTVC 3J4UH 5JZGA 4UF0B 4CYDA 2RS33 4LA2A 3MIGA 2ZCWA 4Z2AA 1XC6A 1UW8A 2GC0A 3GJBA 4CP9B 1ZA7A 4I0BA 4CDXC 4JKMA 1BJQA 4X6QB 4LO7A 1Y9QA 4HVRA 4L11A 4RGKA 4A2UA 4FPEA 5A3OA 1W9SA 1A34A 2HWC1 4AI1A 3I2GA 3MV11 1DQ0A 3F95A 1E5SA 3EHKA 2HBUA 2YFZA 3MLJA 2XGXA 4QMAA 5LRRA 3WINE 4AVBA 1RUE2 2OS2A 5LBBA 1KITA 4LUMA 3N9LA 1KFUL 1UL9A 3VZMA 3M3OA 4C90A 4ARXA 1YFWA 4Q5OA 5A1AA 3VKFC 4MGSA 3O1OA 4IE0A 3O1UA 4R8HA 4IV1B 1ZZ6A 3URFA 4B4RA 1VAVA 4Z92B 2ZGMA 3GJAA 4K1YA 4LBQD 1V6JA 5JXHA 5GLWA 2ZOEB 4LKFA 4QDRA 3AFKA 4I01A 4YRDA 4NHYA 3KB5A 1RUI2 3U4SA 1URXA 2NLRA 4OUEA 4GULA 3AMMA 4QXKA 4H2AA 4Q0SA 1Y9MA 3MFAA 1KXGA 2RJKA 4RQPB 4XXPA 2JXAA 2A75A 2ARBA 4GWIA 5JOYA 1H2MA 4QGNA 1LR5A 1VBE3 2OXBA 2XDVA 4I02A 5EV7A 5FK7A 1XYOA 5EXOA 1ZNPA 1CAWB 4ZONA 4Q4V3 3ITQA 3ACHA 4Q0PA 1MS0A 2XWJB 3HD8B 3T3YA 4QPGA 2A5ZA 1JS9A 1NZIA 1W6PA 4N7IA 4EN8B 3FUQA 1C3HA 3E6BA 3O14A 2Q30A 3ZSMA 2VE1A 4CCKA 2WUHA 4I3PA 3GZEA 4N90A 3AKPA 2VMCA 1X9TA 1H1MA 2OQ6A 3L9JT 3J8F2 5JUVA 3LIHA 4I0WB 4XHBA 4A7YA 3MIFA 3WZ1A 1AR91 5A7SA 1AX0A 2WAAA 4TXWA 2VUCA 1NAEA 2VUDA 2C0ZA 1ENXA 1JTZX 3THCA 5H9RA 4UFHA 5BNNB 1BVP1 2W08A 3MLLA 1WCKA 3ILFA 4FAGA 3KS7A 2B42B 1W8ZA 3IMMA 2YDEA 4U2AA 5C8CA 4Y1XA 1COV3 2E63A 4DB5A 3K2OA 5ERLA 2ERFA 2J1UA 3ETQA 3H1MA 1N1TA 3UV9A 4BLIA 4NHXA 1ST8A 1BEV2 3SQOA 4AYUA 3SEPA 3I2JA 3KSCA 2R1DA 5FY1A 5FZDA 3QH6A 2P1BA 3K46A 1GNYA 4MYEA 2W92A 5HXMA 3THPA 3VZKA 1AR63 1XQNA 5SV5A 1BBT2 2WR9A 1YCIA 4R9BA 3ZXLA 2VXRA 3NV2A 3GZUC 5C71A 5F37A 2DFCA 3VBUA 3O0WA 1AR72 2WT0A 3RSJA 1IOAA 5KHGA 4L0PA 1QJX2 1J84A 4V1PA 1RUH1 1REEA 2BWAA 5JDBA 4LULA 2WA3A 5L7OC 4YGCA 1V6OA 3K48A 3WP3A 4K40A 5I0UA 1VRBA 2Z79A 1JZ8A 1VMHA 3WP6A 1W8HA 2KD7A 2IUWA 4XEZA 5BY5A 5JIUA 4O7XA 1OLRA 1ASJ2 1QDCA 1OVPA 3C2UA 4N53C 4LJHA 2DU0A 3VBFB 1GKBA 3FBMA 1AYM2 2XB6C 1DP0A 4HZFA 2NM1A 2ZMNA 5FXWA 3ZSKA 1PHMA 2QQVA 4XJWA 1B09A 4DOUA 1O3RA 1Q8VA 2CWSA 1QQP3 4BQ5A 5KXCA 1W6MA 1OHFA 4ISQA 2R061 4H7MA 4CUGA 4HXCA 1DLCA 1UZWA 5EIYB 2IXKA 5I91A 1UMIA 4YZ2A 5K9YA 3OBZA 1SLAA 2EVXA 2XQRA 4OI1A 3UK9A 1ACCA 2BNNA 2R043 3OD0A 2EAAA 1HXS2 1VIWB 4ATEA 3BIEA 4FVVA 3WF3A 4CDQC 2CAUA 4QQPA 2OUJA 1XE0A 1QOTA 4LIUA 5FZ7A 3IB3A 4Y26A 4D8MA 4AQ2A 2LALA 1YFUA 4UBGA 1LCLA 1GNZA 4M3CA 3OSDA 2XVKA 4OHZA 2J1RA 3LWCA 3DN7A 1KGYA 2RS51 3PJYA 4IGQA 1RHI3 3RDIA 1ZZBA 4INDA 4LBOA 5BNNC 5FY5A 3EO6A 3LEKA 4PLOA 4ZU7A 5T5OA 4XF4A 2BWCA 1FI2A 2HBTA 4B4PA 5ACA1 4NHLA 5F5IA 1YQ8A 4M0NA 2WNUB 4ASLA 1PO21 4JKKA 2ZABA 3WX5A 4B29A 3WNLA 2WNVC 3MI8A 3R4DB 2FMYA 1IPKA 2DUPA 1O8PA 1NCRC 1OPOA 3MW3A 1DYOA 4J6GA 5FXXA 3ZXEA 4CDWA 1O6UA 2TBVA 3MBWA 3VHNA 4AFBA 3PURA 1R092 2WABA 3OEBA 5FPBA 4LHSA 1ODNA 5F9TA 5F3EA 3R4UA 4BH9A 2QBXA 2ZX3A 5CKMA 1GANA 2VCCA 4DPNA 3S5QA 4COVA 1GP4A 1RC6A 1V6LA 3E6DA 3AMNA 1ND3C 3HN3A 2ENRA 3LA3A 2QQMA 1Z78A 3M3CA 3KQRA 1BXHA 5CIRA 4HPKB 2WT1A 1X36A 4QKNA 3O12A 3KLSA 1Q43A 2B46X 4YW2A 2OPKA 3D0JA 3PJQA 1FMD1 1VE0A 1H4HA 1W8OA 2HWF1 2ZJCA 3OPWA 4GB33 2XMLA 1YQ6A 1UMZA 4BQXA 5JSPA 5LK7B 3AMPA 4FPYA 4MGKE 1XNCA 5IVBA 5LA0A 4XBLA 2BV4A 2RDRA 5AC91 1HQLA 2J1VA 2KR2A 3AJZA 2PMWB 2D40A 3B01A 1VAKA 2HWB2 1HX6A 4RHV3 3U0ZA 2P6CA 3RS6A 3U11A 2P37A 3RZZA 5FP3A 3M3EA 3N9NA 5CG9A 1VBB2 2HWD1 1EV11 2C5DA 1GYKA 3QACA 4OZOA 3VBSC 3ZFEA 5FQ0B 5L19A 4YW7A 3VKLA 4P00B 4Y5SA 5EJZB 1AL22 5AFBA 3RZGA 4AF9A 5FYHA 4X6RB 1C8M1 3DCQA 2JDMA 1VJ2A 4BLJA 1POV3 4UW4A 4P9JA 1LHUA 3FX3A 3ME2A 4P14A 5L9RA 3IWZA 3KM5A 3DF0A 4ASMB 5A3PA 3NKTA 4KI5M 4A6OA 4XZUG 3W9AA 1GR3A 1BLZA 4YVSC 2AACA 4MXVA 2PHXA 1SFNA 1RMU1 2WZR3 4N53A 2Q1ZB 3MV01 2EIBA 3FC0A 1OT5A 3AZYA 4OLLA 5ABJA 3ZSLA 1LTEA 3RQ0A 4ZZ8A 3BU0A 5LA2A 1U5IA 4Z07A 1D0GA 1V0AA 2OQ7A 1VBD1 5J36A 1S0GA 5D1IA 3VD5A 4BA6A 1G8WA 4WM8B 5HCHA 3B7MA 1GP5A 1DF0A 4PDWA 1ZBE3 2YHJA 3OYWB 3VBHC 3OGGA 4LHKA 4IEYA 4LBQB 2VZOA 5JLVA 1RUD2 3D0SA 3GBWA 3U78A 1AHSA 4NRMA 1CZTA 3GCWA 2RDSA 2Y34A 2IFWA 3OCPA 4RL7A 3GHNA 1KEXA 1MEC1 2DTWA 1YO8A 1OLME 1PNGA 3RGBA 3POIA 5FMCA 3S7EA 3PTRB 2HJIA 1PO13 2FDFA 1SLLA 1ZZ7A 2AC1A 4XTPA 3T2PA 1REFA 2GC3A 3PUHA 5JCTA 3VBRC 4YVWC 1D4VB 3WSOA 1LU2A 2ZGTA 2YZ4A 5FKCA 3ZN6B 1XU2A 2CDPA 1VRH3 4F3JA 2WNVA 2VCAA 1VMFA 2Y8KA 1RVF1 4CP0A 4S2DA 1CZVA 1NCRA 2ZXQA 5KHJA 1ND2C 1TMF1 1H0BA 4QXHA 1O3TA 5FR3A 2VVDA 3QLQA 1QH7A 1N1YA 4EWAA 1JUHA 3M3QA 4HT1T 4NROA 5FJKA 2C1FA 1PIV1 2VVFA 4D6QA 3SH5A 1F5FA 2JG9C 3POEA 2D6MA 1PMJX 5CBLA 4FPCA 2PYTA 4E27A 1TG7A 1VR3A 3MDPA 4Q4X3 5HCBA 1PZ8A 4YGDA 4URAA 1YFXA 2VBPA 3MIEA 3ACGA 2Y6LA 2AYHA 4NIAA 3ZFFB 4EROA 1NG0A 4AAXA 1PGSA 5A6XA 1W0OA 2GNMA 1QJY3 2BFUS 3HEIA 4BMEA 1MVQA 3AMQA 5FY0A 2VZRA 4P9GA 5FZGA 3R05A 2MNGA 1UXXX 3LPGA 1CQ9A 3KF5A 3I2OA 3BTZA 4JGYB 2ZGUA 1JZ7A 1MQTC 1FT9A 2DYCA 1XNTA 1GZWA 2X8KA 1OF4A 4Y1VA 3N9OA 1CPNA 4ORFA 2PQQA 3VBOC 2EA7A 5DAQA 3VZLA 4O65A 1GWKA 1QGLA 2JKXA 3KT7A 4LUKA 3SLIA 3ZXFA 3BN6A 1R1A3 5DUVA 2VOWA 4MUVA 2QQNA 2TEPA 4WM8C 5JR2A 2Q1FA 5CKQA 1DCSA 1C5IA 1X33A 2GMPA 2FDIA 3KVBA 2FD8A 2AEYA 4LPLA 2F6BA 2BQPA 4H14A 5D8AC 2VPVA 2XJTA 1OQDA 3BTAA 4XW3A 4YFWA 3MEPA 1GOGA 4QB2A 1V70A 3SNMA 4LOTA 1F2NA 1FNZA 2WKKA 2E9QA 1F31A 1W90A 1UIJA 2R062 2K46A 3Q9OA 3L2HA 5FV3A 1Q3EA 2BP6A 4GA9A 3INAA 1NA1C 5FZHA 1BMV1 3LB9A
chains in the Genus database with same CATH topology
2JDPA 1OURA 1OXCA 1UZVA 2CHHA 2VNVA 2JDNA 3DCQA 2JDMA 1W8HA 5A6ZA 5HCHA 1W8FA 1OVPA 1OUSA 2VUCA 5A6YA 2VUDA 2BV4A 5A6XA 2XR4A 4UT5A 4AOCA 2WR9A 5D2AA 2JDHA 1OUXA 2JDUA 2WRAA 2JDYA 1UQXA 4CE8A 2BOJA 2JDKA 1GZTA 5A3OA 1OVSA 5A70A 2BP6A 3ZDVA 5A6QA 2BOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDP A;  1OUR A;  1OXC A;  1UZV A;  2CHH A;  2VNV A;  2JDN A;  3DCQ A;  2JDM A;  1W8H A;  5A6Z A;  5HCH A;  1W8F A;  1OVP A;  1OUS A;  2VUC A;  5A6Y A;  2VUD A;  2BV4 A;  5A6X A;  2XR4 A;  4UT5 A;  4AOC A;  2WR9 A;  5D2A A;  2JDH A;  1OUX A;  2JDU A;  2WRA A;  2JDY A;  1UQX A;  4CE8 A;  2BOJ A;  2JDK A;  1GZT A;  5A3O A;  1OVS A;  5A70 A;  2BP6 A;  3ZDV A;  5A6Q A;  2BOI A; 
#chains in the Genus database with same CATH topology
 3DKW A;  2VC9 A;  1TQ5 A;  1WCS A;  2HEW F;  2Y33 A;  5FUN A;  1TE1 B;  4WM7 A;  1B35 B;  1J1T A;  3ZFG A;  1UWW A;  2CGO A;  4PLN A;  4Q4Y 3;  1ZBA 3;  1AX1 A;  4QU1 A;  1PX4 A;  1OQE A;  2R49 A;  5J1X A;  1O7F A;  3DYM A;  3I3D A;  4PF5 A;  4CDU B;  5FZ0 A;  2JDZ A;  1QDO A;  3JD7 1;  2GZW A;  2RS5 2;  2PLV 1;  4JVA A;  4AFA A;  4COY A;  1CJD A;  3P3N A;  5IFP A;  1F4A A;  1CES A;  3SEE A;  1NUK A;  3HNB M;  2YC0 A;  3MIB A;  2XLA A;  3B00 A;  4GH4 C;  1VBA 2;  2X29 A;  1J58 A;  1WLT A;  2CGN A;  5BNO C;  1ULO A;  5ACA 2;  2NP0 A;  5HXV A;  3CJI B;  1HQN A;  4FPJ A;  3D82 A;  2ZX1 A;  4D6R A;  3ZXK A;  4UW6 A;  3ZPY A;  3VN4 A;  2EIC A;  5FP7 A;  4XQW A;  1YQ2 A;  4COU A;  3J9S A;  2RS3 1;  2Y0I A;  1RUF 3;  3PTY A;  2E51 A;  3BVC A;  3CIH A;  4YVW A;  1H2N A;  5GM0 A;  4A3Z A;  3W21 A;  2ARE A;  3FUO A;  5FY9 A;  2YUE A;  2G1M A;  4OFG A;  2DCK A;  1QJE A;  4JX0 A;  1X7N A;  3NO8 A;  5DAB A;  1ND2 A;  1SHW B;  1V9U 2;  4KWU A;  5FMB A;  2RMU 2;  2D5H A;  3AFG A;  5E89 A;  1M06 G;  2WIN B;  4XFF A;  1WMD A;  5EZW A;  5A1F A;  5HCF A;  3FBY A;  5I0S A;  2VD7 A;  1FMD 2;  3AP4 A;  4Q8L A;  2GH2 A;  1LES A;  1H1A A;  1M4W A;  4AED B;  3W5M A;  5A7N A;  2YMZ A;  3IN9 A;  5E1R A;  3WUD A;  1N1S A;  5FYY A;  3WF2 A;  4XMA A;  2EXI A;  4LEJ A;  4XET A;  2GU9 A;  2W3J A;  2WSV A;  4IGP A;  4M00 A;  2PTM A;  2C24 A;  2XBO 2;  3D6E A;  3LSE A;  3MHZ A;  4P5H A;  3V65 A;  3W5N A;  3B93 A;  4MH0 E;  4Y4Y A;  1CAV A;  2ZML A;  3E5X A;  2Y26 A;  4DUX A;  3CLP A;  3T09 A;  1I5Z A;  2YV8 A;  2GND A;  1YUD A;  4CCD A;  2DTY A;  2HWD 2;  3OUI A;  2VOK A;  4PIY A;  3NV4 A;  3MZH A;  1RL3 A;  1OBN A;  1VBE 1;  2DVB A;  3JQX A;  2HEV F;  2WA4 A;  4XBN A;  1HDK A;  1SCR A;  1W6P B;  1QOS A;  2WYS A;  1RJ8 A;  4Q4V 1;  3NJY A;  3IDE A;  2QUO A;  1SLB A;  3AVS A;  4PIZ A;  5D21 A;  1WCU A;  1NY7 1;  1ZM1 A;  5FCC A;  2QQP A;  1SLT A;  5F6L B;  2QQO A;  3I2I A;  2BU9 A;  1UIK A;  3ZYJ B;  3T4H B;  1IGO A;  3DL3 A;  3KGZ A;  3FMG A;  1HKD A;  3IBM A;  3PL0 A;  1UOG A;  1RMU 2;  1MZ6 A;  5JXI A;  1PVC 3;  3IZO A;  5K0U A;  1AYN 1;  3NNG A;  4NPL A;  4HL0 A;  5FIX A;  1YIP A;  4BIS A;  4P9I A;  5BNP A;  3RI8 A;  5LW9 A;  1PGL 1;  3ZDS A;  1KD7 A;  4GKY A;  4ES9 A;  5JAX A;  4LXL A;  5GKA C;  3UL2 A;  5GZF A;  3P5B A;  3UET A;  3RZH A;  1GIC A;  3JQW A;  1FOD 3;  1UN1 A;  1XE8 A;  2NYY A;  3NAP A;  5A6Z A;  1NA1 A;  2GMM A;  5JR7 B;  3WDU A;  3E6C C;  4PBP A;  4XBQ A;  4BQ2 A;  2W5F A;  1LOF C;  1COV 1;  1O4Z A;  1G6N A;  2BEO A;  4TYS A;  4XAE A;  5FZM A;  4E4D X;  4JC1 A;  1LKN A;  4CU7 A;  1VBC 1;  4QWN A;  5KBF A;  5CFC A;  5H9S A;  1QKQ A;  3GBG A;  3QCW A;  1Q8P A;  1UY0 A;  3N7M A;  3WDT A;  1OKO A;  4Y33 A;  1K5M A;  3H1W A;  3NKG A;  1H6Y A;  2HWE 3;  3ZYF A;  3S5A A;  2ZHL A;  4UW3 A;  5AFE A;  3S6P A;  3CO2 A;  5FZO A;  4CPB D;  4NUB A;  3UJQ A;  4CCO A;  5CA6 A;  4CCN A;  2P4E A;  2RR1 2;  3I2H A;  4RFR B;  3FWE A;  3LE0 A;  4PBO A;  3VBU B;  3OGJ A;  4JGZ C;  1H2L A;  1NZC A;  4XJU A;  2BGC A;  2A3W A;  2KA3 A;  1QJU 3;  3RZK A;  1H8T C;  4AED C;  1OFN A;  4QQL A;  3NNJ A;  1RVF 2;  4HKL A;  4MXW A;  4AOC A;  4GZ9 A;  4RGG A;  4UBH A;  5GLZ A;  4H3W A;  1WW4 A;  1W0N A;  4YG3 A;  2XLF A;  5EHD A;  3VZJ A;  4CXX A;  5JSR A;  1IG0 A;  2C6S A;  3I3M A;  5FPX A;  2XQX A;  5DQ0 A;  2RM2 2;  5A7W B;  4AFC A;  1SAC A;  4MV2 A;  4OI0 A;  3NNM A;  3T2Q A;  1PIV 2;  2W9X A;  2Q1M A;  5GZE A;  1XSQ A;  4QKF A;  4XPV A;  4Y5Z 0;  3FLP A;  4AWD A;  3LOB A;  4DIQ A;  3J7N A;  2UY8 A;  2BZD A;  1UYP A;  2O1Q A;  4NO4 A;  4TLF A;  3NQH A;  4R9C A;  1LHO A;  4BK4 A;  1W0P A;  4JHZ A;  3WDV A;  4QB1 A;  2FDG A;  1JYW A;  4JTN A;  1QQP 1;  2R07 3;  2YRO A;  3OBA A;  4ZS2 A;  5FK8 A;  1IQD C;  4CCL A;  4ZU5 A;  1Y3T A;  3GHM A;  1DGW A;  5FY8 A;  3SC7 X;  4PF1 A;  4RA0 A;  4LT5 A;  4BU2 A;  5LK5 A;  3C8X A;  3AVR A;  2RS1 2;  4JCK A;  4QDQ A;  2FCT A;  1IG3 A;  2XHK A;  1W9W A;  2W68 A;  3D5O A;  4XAB A;  1O59 A;  2CY6 A;  2ZGQ A;  5F5A A;  4FPG A;  3K4A A;  4CCE A;  3KV9 A;  2X5I C;  1O4Y A;  1Q8O A;  2J7M A;  4AI0 A;  2FCV A;  2NZ9 A;  4S2H A;  3SMH A;  1OOP B;  3MYX A;  5JXG A;  1QJF A;  4NPR A;  4D94 A;  1BK0 A;  4QPI C;  1RHI 1;  3AYD A;  3GM8 A;  1TNR A;  1S4C A;  5LB6 A;  3VDD B;  1DU3 D;  1XJA A;  3KCX A;  5JVV A;  1RUE 3;  1FAY A;  2UWA A;  3HQR A;  2Y64 A;  1C57 A;  3C7H A;  2E6V A;  3KGL A;  4BM8 A;  3Q8B A;  5F5Q A;  5FPV A;  5A3N A;  1X9P A;  5CIS A;  2GAU A;  5APA A;  1G9F A;  4YW3 A;  4CDW B;  1QJZ A;  5IAT A;  2XVL A;  3AKQ A;  3L2Y A;  4LOR A;  4XFG A;  2ZTN A;  3KQ4 B;  4RS5 C;  4Y22 A;  1JHN A;  2GP5 A;  4LO5 B;  4JQT A;  4YWA A;  3PIJ A;  1SBF A;  2L9L A;  3E97 A;  4BIO A;  1UY1 A;  3NNF A;  1DG6 A;  4KNC A;  3TWI A;  3WNO A;  4A6S A;  4AL9 A;  3S30 A;  2JDP A;  2QQJ A;  2UYA A;  4AEK A;  4C91 A;  1BMV 2;  1C1L A;  2JG8 C;  1UCX A;  3W20 A;  4LBM A;  1GQP A;  1UU5 A;  1WKY A;  4Y1U A;  5DZE A;  1RUI 3;  5DMY A;  3E5Q A;  1IHM A;  2DBI A;  2HKX A;  2LRO A;  4NE9 A;  4IEO A;  4YW1 A;  4OQ9 A;  3SIS A;  1JMU B;  1KS5 A;  1FPN 2;  2ZX2 A;  2D7F A;  4F8A A;  4W4Z A;  2V09 A;  5K4L A;  4OHY A;  2IC1 A;  1NE4 A;  3EJK A;  1OD3 A;  3JD7 2;  3RRD A;  2D6N A;  5CZK A;  4P9L A;  5A7P A;  2PLV 2;  1O3Q A;  3I49 A;  2XL7 A;  4LBJ A;  1W03 A;  3ZVX A;  4GB3 1;  4QXC A;  4QQH A;  1K5J A;  4QDS A;  4AVT A;  3IM0 A;  2K2S A;  1BQP A;  3APB A;  1VPH A;  2EF6 A;  4XQ4 A;  5C5T A;  4EN7 B;  1PM7 A;  2BNM A;  4NHK A;  2NMO A;  1QXR A;  5CAZ A;  2YPJ A;  2ZBJ A;  2Y6G A;  5T5P A;  1SQ4 A;  2A3Y A;  3ZYB A;  5HV0 A;  3OG2 A;  1GSL A;  1W8T A;  1PGW 1;  4JRL A;  4XJ8 A;  4O9E A;  3EBR A;  3PUQ A;  5EPA A;  5CFD B;  4YG6 A;  4KQ7 A;  3ZFE B;  3J8F 3;  1D7P M;  2P3I A;  3ELN A;  1JXN A;  1AF9 A;  4IEU A;  4YZ3 A;  4E4H A;  2GN7 A;  2A7A A;  1HRI 1;  2JWP A;  4HLT A;  4CEW A;  5IK4 A;  4K8R B;  2R16 A;  4FCA A;  4NRP A;  1POV 1;  5J96 B;  2HLE A;  4ZZ5 A;  1XSR A;  2BOI A;  4AGR A;  4COW A;  2FZ1 A;  2D43 A;  2PAM A;  5CNA A;  4AAP A;  1AXY A;  5FYV A;  4AHY A;  4IE7 A;  2ZAC A;  1DQ2 A;  5L9B A;  2OT7 A;  5F5C A;  4CEY B;  1LOC A;  4JKL A;  5FDB A;  2UWB A;  1OOP C;  2CSG A;  4LK7 A;  5IJR A;  5FAX A;  5ABJ B;  1YIF A;  1BEV 3;  2Z42 A;  4Z1V A;  5JPN B;  1WW5 A;  2WZR 1;  1SBD A;  3JUU A;  3VDD C;  4NWW A;  4IE4 A;  1AR8 1;  1IPS A;  4QX3 A;  3ZKY A;  4XUR A;  3V56 A;  4AFM A;  4J1X A;  3T1M A;  3P6B A;  1NOV A;  3WNX A;  1QOO A;  1WD4 A;  3ECQ A;  5ANQ A;  1Q5O A;  4PDW B;  4UI9 L;  1BBT 3;  4TZD A;  3BGA A;  2Q8O A;  4EWE A;  1OQ1 A;  1VMJ A;  2ZMK A;  1GZC A;  1W9Y A;  1RUG 2;  1AR7 3;  1UYX A;  2D98 A;  4XFA A;  2PFW A;  4UOJ A;  4IW3 A;  1QJX 3;  4FBF A;  5BNQ A;  2OKX A;  4FTS A;  1RTV A;  2QZ3 A;  1DQ1 A;  2ARC A;  2ORX A;  4KU7 A;  4DY5 A;  1W06 A;  4MVT A;  5FMO S;  4YW5 A;  4A7K A;  3DPR A;  5I0D A;  3SCH A;  4B1L A;  2VY0 A;  1TME 1;  3MF6 A;  1VP6 A;  1NCQ A;  3PHM A;  4K3U A;  4EV0 A;  2WO2 A;  3KZ4 C;  5F3C A;  5M0T A;  1W28 A;  1F35 A;  3WHT A;  1ASJ 3;  2WQ8 A;  3D3A A;  1YFY A;  2MEV 1;  4N43 A;  1NY7 2;  1W6N A;  4A44 A;  2DCY A;  2D5F A;  3SH3 A;  2V4V A;  4KMQ A;  1AYM 3;  5F6K A;  3WW3 A;  3H1Y A;  1J83 A;  2VTX J;  2X05 A;  2YC2 A;  3BPS A;  2IVI B;  3FN9 A;  4IV1 C;  3RG0 A;  3GYD A;  3USU A;  1MS5 A;  4OI4 A;  3BTY A;  4A4A A;  5C9A A;  1VRH 1;  3PUI A;  4AK3 A;  3HQX A;  4R9D A;  1CIY A;  1HJG A;  1AYN 2;  4K1Z A;  5CG8 A;  1LGC A;  3PMS A;  2NN8 A;  1FNY A;  1NXD 1;  3LPF A;  4HON A;  5FUP A;  5A33 A;  3VD9 A;  3V0B A;  4Q27 A;  5LBC A;  4CDX A;  2QQW A;  4YM1 A;  1HRV 2;  2A3X A;  4ZY9 A;  3A23 A;  1WME A;  3HJR A;  1E5R A;  3Q8F A;  1HXS 3;  2E31 A;  5A32 A;  1GLH A;  5H9P A;  2WQZ C;  4DUV A;  2ZEY A;  3EMR A;  3AP7 A;  1YJL A;  1LHW A;  2WFF 2;  4LA3 A;  4RQP C;  4IV3 B;  5CFD C;  4LKD A;  3RZJ A;  3M3I A;  3AKT A;  3CMG A;  2R0F A;  4IEP A;  3OD4 A;  4P9Y A;  2CU5 A;  3OB8 A;  1VBC 2;  3PVB B;  4PQ9 A;  4CRQ A;  1MS8 A;  2WYF A;  4DY3 A;  3J7M A;  5I0R A;  4NAM A;  3K3N A;  2WO3 A;  4LK6 A;  4XF9 A;  2QKD A;  4UFK A;  4FOV A;  3JB4 C;  1UPI A;  2BRT A;  2WZE A;  4WVM B;  5C33 A;  1OPM A;  1E57 A;  2FBE A;  4GMP 0;  1QJY 1;  2Q0A A;  3DUI A;  3T30 A;  4IEV A;  1YJK A;  2JB8 A;  3H0O A;  3M8L A;  1ZYB A;  5FZI A;  4BWO A;  3LEM A;  5FRA A;  1RUJ 2;  3CZJ A;  3ZOI A;  5A3L A;  1GU3 A;  2O14 A;  3SCG A;  1GZW B;  4GMP 1;  4BE3 A;  1XOY A;  3LAG A;  1S0J A;  4FSJ A;  1YYN A;  2A6V A;  1R09 3;  3LD8 A;  3QH7 A;  2A70 A;  4EZ4 A;  3DKQ A;  2CTV A;  3MUZ 1;  2VJX A;  3AL6 A;  4LBK A;  4LKE A;  5FXZ A;  2QFE A;  2VZ3 A;  3B9C A;  1ZX5 A;  5A70 A;  1EUT A;  3JCI A;  1R1A 1;  4AVA A;  1Z7S 2;  1DGL A;  5DAP A;  2PQS A;  3ZYH A;  4NMI A;  2CV6 A;  1AVB A;  1XYP A;  1S2E A;  1T6G C;  1IQA A;  3WF1 A;  2I07 B;  5T5J A;  5GZC A;  1K12 A;  4Y1Z A;  2XWB B;  1H2K A;  5C6C A;  3IPV A;  4CZS A;  3TB0 A;  4BDV B;  4KG8 A;  4QQ2 A;  4WM7 B;  3ZFG B;  2VCB A;  1CX4 A;  2WS9 1;  3IAP A;  2DCJ A;  3U1X A;  3CU7 A;  4XIL A;  4XJZ A;  1XXN A;  4OVE A;  1Y9G A;  1D2S A;  3FFZ A;  1CJP A;  1OSG A;  5A3M A;  3T0D A;  2HWB 3;  4Q4Y 1;  1JN2 P;  1IS5 A;  3POW A;  3LDR A;  5BUV A;  1I6X A;  5A7O A;  1HB2 A;  1I3H A;  2DV9 A;  4MLO A;  2ZPX A;  4XUO A;  2OW4 A;  3H7J A;  1VBB 3;  3LFM A;  4UF0 A;  3TEW A;  2D3P A;  4QX8 A;  4JTO A;  2JE7 A;  2B7Y A;  5LRS A;  5A7Q A;  2YGM A;  3WV6 A;  4CP9 A;  1I1E A;  2QVS B;  5F1R A;  3GXU A;  4IXL A;  4BIF A;  5JI9 A;  1GUI A;  1AL2 3;  4Q4W 2;  3RVH A;  1EAH 2;  4D3W A;  2VR4 A;  2VUL A;  5J37 A;  1CAX A;  4FAH A;  1ZRF A;  2BVB A;  2XJQ A;  1MZ5 A;  2EAL A;  1LOG A;  3VBF C;  2DVA A;  1WA6 X;  1LOB A;  3OJB A;  5LA1 A;  2DU1 A;  1MVE A;  5I93 A;  1WBL A;  5CB7 A;  3WQ7 A;  3PU3 A;  1RUF 1;  4GXL A;  1BZW A;  1WD3 A;  3ZYP A;  4MAD A;  1D4M 3;  4XUQ A;  2P34 A;  2Y6H A;  1WUV A;  2HWC 2;  2WL1 A;  2BW8 A;  3PDQ A;  4KBZ A;  1ULC A;  3HQU A;  5JMO A;  2H6C A;  1ENR A;  2Q4S A;  2EID A;  3ZXJ A;  3VD7 A;  1Q8Q A;  1GQG A;  2O0O A;  4NOT A;  4JRA A;  5FZ4 A;  4OUS A;  3A0N A;  4A7Z A;  2GDF A;  4QHO A;  4QX2 A;  1UU4 A;  1R1Z A;  5L7O A;  3LOI A;  5E6H A;  1U5X A;  5C5U A;  4LKS A;  1HN0 A;  5DXD A;  5C3P A;  3WOG A;  3TN9 1;  1LB2 A;  2C9A A;  1ZZC A;  1OH3 A;  1RUD 3;  2UYB A;  4BQY A;  4DFS A;  2UY9 A;  3NMB A;  3ZM8 A;  4RQP A;  1PK6 B;  2VMH A;  4LOS A;  3ZMN A;  2D44 A;  1UOB A;  1UPS A;  2ZGP A;  3WXP A;  1NQD A;  2VZS A;  2XPJ A;  2VL4 A;  2JJ6 A;  2X10 A;  4J1W A;  2IXL A;  3WNM A;  1SDW A;  2E53 A;  2WT2 A;  4CP1 A;  2WNU C;  2LS6 A;  3FL7 A;  3EB7 A;  5E88 A;  2J22 A;  5T50 A;  2JEM A;  1G86 A;  1SFP A;  2VW2 A;  1KJL A;  2PHT A;  3BTX A;  2VZ1 A;  3TEX A;  3MO4 A;  3O0V A;  5LY1 A;  1L7L A;  2QJV A;  1PGW 2;  4QGL A;  3U10 A;  3PME A;  3PVO A;  4R52 A;  3VL8 A;  5D2A A;  4FXG B;  5HV4 A;  2K9Z A;  4CDQ A;  1CZS A;  1OUX A;  4N7U A;  3DYP A;  1CD3 G;  1LEC A;  3NJX A;  5LEJ A;  1XPW A;  5IVF A;  1Y4W A;  1UKR A;  2XJU A;  5C4W B;  5J7M A;  1DGR N;  3HNY M;  1HRI 2;  2QTW B;  3FE5 A;  3VL9 A;  1S0I A;  1SLI A;  4ZXE A;  2P3J A;  3WQ0 A;  3III A;  1S2K A;  1STM A;  1DGW X;  1SPP A;  4LIV A;  5BNN A;  3UKV A;  4BHP A;  2XH6 A;  3RZM A;  4FFH A;  5FLH A;  2WII B;  4DMI A;  4LHL A;  1GV9 A;  2JDN A;  4CU8 A;  1ZZ8 A;  2SBA A;  2KXL A;  3NJZ A;  1RJ7 A;  5K0U B;  5FYI A;  3FHI B;  5FZB A;  5BNP B;  1JYI A;  4Y20 B;  1AR9 2;  3ENR A;  3KT1 A;  1PVC 1;  4KGG A;  1AR8 2;  1HB1 A;  2XR4 A;  4UT5 A;  3UYJ A;  3RZL A;  3OEA A;  5BV6 A;  2UWC A;  2ILM A;  4WVV A;  3WVJ A;  4DEQ A;  2ZEZ A;  3BOP A;  3I2K A;  1MZE A;  3KF3 A;  3NAP B;  2JB4 A;  4NII A;  5CEH A;  3A22 A;  4IQP A;  3V0A B;  4N9H A;  4RR3 B;  4V2W A;  1FOD 1;  3H8U A;  1UOF A;  1UMH A;  1CAU B;  2I74 A;  2J1A A;  2Z4F A;  2ZAA A;  2FQP A;  3HPN A;  3I3B A;  3VZO A;  4D69 A;  1DZQ A;  3RMX A;  4DRV A;  5IHR A;  5CFC B;  3HWJ A;  1O5L A;  2PA7 A;  1DFQ A;  1K5M B;  3I2F A;  1ND3 A;  2DWR A;  4MZU A;  5FYB A;  3AZX A;  2YU2 A;  3MW2 A;  1RUC 1;  5BXX A;  3ZPO A;  1Q56 A;  3TBD A;  4E2S A;  3WCR A;  4NID A;  2G9F A;  1S0B A;  3K4D A;  4HKW A;  1TME 2;  1MS9 A;  3MIH A;  2HWE 1;  4FPL A;  2BJS A;  4KH9 A;  4Q0V A;  1W99 A;  5FZO B;  1OLQ A;  5IT6 A;  4JZR A;  5DUU A;  2JD9 A;  4LTA A;  2MEV 2;  3ZR6 A;  4L97 A;  2F4P A;  3JBG 1;  1NYW A;  3NRU A;  2BOJ A;  2ZX4 A;  1GBG A;  5KWR A;  2WC2 A;  2ARX A;  4NIH A;  3POS A;  1YC6 1;  1LHV A;  1WCD J;  2D6P A;  3AXD A;  1F5J A;  3PU8 A;  4FPF A;  4MXW B;  1R08 1;  2WO1 A;  4DIN B;  3USS A;  1PK6 C;  3G6J B;  3GDB A;  2JDA A;  4OHV A;  1RUH 2;  2R06 3;  4ASK A;  4E4Z A;  4URT A;  2ZAH A;  4HK8 A;  4MSV A;  1XNA A;  1JU4 A;  3LDK A;  4D7Y A;  2ZHN A;  5DPN A;  2VVE A;  4XOG A;  3UES A;  4BPZ A;  5ISL A;  3T4V A;  3LA7 A;  4XCB A;  3VBS A;  3ACL A;  1SMV A;  4YGB A;  3HBZ A;  1IS4 A;  1F15 A;  4LE3 A;  1Y43 B;  1NE6 A;  4AHZ A;  4UXA A;  5CAD A;  2KM2 A;  4YAR A;  1NLS A;  2RS5 3;  1VLN A;  5JI7 A;  4XYX A;  4IE5 A;  4WBB A;  5EYY A;  2VGD A;  2W46 A;  5C4W C;  1U0A A;  1BKZ A;  3UJO A;  4KL1 A;  2D6O X;  3T08 A;  4AEJ A;  4E2G A;  1HIX A;  1VBA 3;  2DCZ A;  1PZ9 A;  2Y6K A;  2A6W A;  4YVS A;  5ACA 3;  1WMX A;  4FTE A;  1A8D A;  2UU8 A;  2Q8E A;  1IPJ A;  3GGL A;  3S7I A;  4ZXK A;  3C7O A;  2A6Y A;  3VDB A;  1PM4 A;  1N3Q A;  3W59 A;  2ETE A;  2X53 S;  2WZ8 A;  4QKB A;  3TOJ A;  4GQ7 A;  3KHC A;  2P3Y A;  4KU8 A;  2VMG A;  5FZ3 A;  5FP4 A;  1OD5 A;  3FHA A;  3KV4 A;  5BPX A;  1G9B A;  2H0V A;  2JDU A;  4O61 A;  3HT1 A;  1P8J A;  3THT A;  5F2W A;  1X8M A;  3FLT A;  4UWD A;  2Y38 A;  1O4T A;  1AXK A;  3AZZ A;  5FZK A;  1AJK A;  3VBH A;  3KCC A;  4QU2 A;  3KMH A;  1SCS A;  3AL5 A;  4RR3 C;  3AYA A;  3UNP A;  5JZG B;  5F32 A;  1RUE 1;  4DXT A;  4QAW A;  1OUR A;  4FTB A;  1PO2 2;  3MW4 A;  4TWT A;  1V9U 3;  2LTN A;  3HVD A;  4Y22 B;  4BK5 A;  4F7Z A;  2RMU 3;  3I7D A;  4XHX A;  1DLL A;  1L7Q A;  3NJV A;  5F3G A;  2DVG A;  3D4K A;  4XFI A;  5FYS A;  3OGV A;  4B8E A;  1RUO A;  3VBR A;  5DN2 A;  1JYN A;  1DIW A;  1HQW A;  4UFL A;  3ZFF C;  2VMI A;  4KWK A;  4EZH A;  2BBV A;  3B94 A;  4A42 A;  1CWP A;  2QCS B;  3O0X A;  1LOD A;  2WS9 2;  5A80 A;  1MPX A;  1PZ7 A;  4TSV A;  2E7A A;  5LY2 A;  2DDU A;  1OC1 A;  2VCM A;  1RUI 1;  3CF6 E;  3RI9 A;  3NL1 A;  5HBA A;  3SXW A;  1MS4 A;  3DEM A;  1OA3 A;  4W6W A;  1H6X A;  2XBO 3;  1QHD A;  4JGY C;  2JD4 A;  3HOB A;  4AQ6 A;  4BMB A;  1DDL A;  1Y7B A;  4D0Q A;  3GZT B;  2EIG A;  2VH9 A;  4C0H A;  5IK5 A;  2HWD 3;  1QXP A;  1DGR A;  1I9R A;  5C3O A;  2R1B A;  4I0A A;  1RXG A;  3IT8 A;  4C1X A;  3WQ1 A;  2JG9 A;  2HWF 2;  5TSW A;  3ZKU A;  2R30 A;  2A6Z A;  4CUC A;  1XYN A;  4OYU A;  4EYU A;  3ILR A;  4C8D A;  1H4G A;  1NX9 A;  3TNP B;  1DQ5 A;  3OUH A;  2E26 A;  4DXS A;  5L36 A;  2QDR A;  5KHH A;  5AC9 2;  3H7Y A;  2VTX A;  1WW6 A;  4NVP A;  2PXJ A;  1JYX A;  4PHZ A;  3M1H A;  3HBK A;  3WR0 A;  3O1M A;  3AYE A;  4LE4 A;  4OUL A;  3WW2 A;  1RUF 2;  4QD2 A;  3M2M A;  1WA4 A;  3J8F 1;  4HET A;  3HT2 A;  1RMU 3;  1EV1 2;  4RFT 0;  4CCM A;  4RGA A;  4CEW B;  5A3W A;  2VNG A;  1DQ4 A;  5FOJ B;  3Q8C A;  4MGI E;  2G19 A;  4I09 A;  4QPG B;  1MQT A;  2ZKL A;  1C8M 2;  1GOF A;  4IES A;  4IUG A;  3LDB A;  4CU6 A;  4AFD A;  5FRE A;  5FZ9 A;  1B35 C;  2R7E B;  3VBO A;  2J42 A;  2PHF A;  2VAU A;  2ZEW A;  4FXK B;  1NXM A;  3S57 A;  2WJS A;  1ZA4 A;  4MGY E;  3WG3 A;  4QGM A;  1WBF A;  4M3C E;  3LGR A;  4CDU C;  4DEV A;  5KHI A;  2RJ2 A;  4L92 A;  1WCQ A;  1RB8 G;  1US2 A;  3TN9 2;  1C1F A;  4EQV A;  1FYU A;  3NW4 A;  4W6Y A;  1WMF A;  4WM8 A;  2HYX A;  1H8V A;  3N9P A;  4ZS3 A;  1UYY A;  4L2N A;  4DUW A;  2RG4 A;  4LBQ A;  1WGP A;  1J3P A;  4Z2W A;  4AVS A;  1H9W A;  5D8A A;  2PEL A;  2ZHK A;  3CJI C;  1W05 A;  1UX6 A;  2A1X A;  2YGL A;  3NST A;  1O3S A;  2LUW A;  1EY2 A;  5FZA A;  5C8C B;  1VBD 2;  1W8F A;  5K8S A;  4GJZ A;  4ATF A;  4HMZ A;  3QD6 A;  2RR1 3;  2AR6 A;  2DCT A;  1BBT 1;  2GNB A;  2XHN A;  4CUA A;  3TEY A;  2Q5T A;  4XFC A;  5EP9 A;  2E7T A;  3WEZ A;  1NQJ A;  2CGP A;  3WF0 A;  3NVC A;  1ZVF A;  4K20 A;  1AL0 G;  4YLZ A;  4BZ4 A;  3UGG A;  5FUI A;  3TEZ A;  5DZG A;  2E7Q A;  1RVF 3;  5DDJ 3;  5FZ6 A;  1YEW A;  1NCQ B;  4NR1 A;  3H3U A;  1MEC 2;  5FPZ A;  5L73 A;  1QU0 A;  4HSJ A;  1FV3 A;  2A6X A;  3SCF A;  5KC5 A;  3MPP G;  2ZGK A;  3IIA A;  1CVN A;  1W6N B;  1UD1 A;  1W3X A;  3WG4 A;  3WF4 A;  2RM2 3;  1AR6 1;  1O5U A;  3ETP A;  4MX3 A;  3FHQ A;  1PIV 3;  2XUM A;  4GH4 A;  3CHX A;  4IER A;  3ST7 A;  4XDO A;  5BNO A;  2FHR A;  2ZGL A;  5C9A B;  4LO8 A;  1ZRC A;  3OTF A;  3N36 A;  1WWY A;  2W1U A;  1LOE A;  5F39 A;  5A33 B;  1V00 A;  1W04 A;  1POQ A;  3BOD A;  3EXU A;  1QY4 A;  5DG1 A;  4D6S A;  1TMF 2;  1UNB A;  4LLF A;  4L99 A;  3RPQ A;  3U37 A;  1F8V A;  5A32 B;  3ZXG A;  3ZSE A;  5JXJ A;  4GAZ A;  1OVS A;  2RS1 3;  5FZE A;  2GP3 A;  3ZFF A;  5B4N A;  1HXS 1;  3RMY A;  1LEN A;  2QZ2 A;  3OGR A;  5GLV A;  3I4I A;  4O9G A;  4ET7 A;  3JU9 A;  3U4X A;  2W0X A;  5LEK A;  1W6M B;  2BFU L;  3ABZ A;  3VDA A;  5C7G A;  4DXR A;  4B3N A;  3AK0 A;  3OF1 A;  4GJY A;  4XUP A;  1RUC 2;  4XUT A;  4JGY A;  1RGS A;  2XOM A;  1UY3 A;  2ZS6 B;  1W6Q A;  4LMF A;  4BQ3 A;  3OOX A;  1JOD A;  4OCT A;  1W2A X;  1JH5 A;  2R04 1;  3G7D A;  4Q1R A;  4U36 A;  5E16 A;  3WD5 A;  4M3C B;  2WO7 A;  2AEN A;  3JBG 2;  3N3H A;  4LBL A;  5LAS A;  1RYY A;  2BGO A;  3RFR A;  4A3X A;  4AQS A;  1UKG A;  2D93 A;  4N9I A;  4QX1 A;  3TNQ A;  3QOP A;  5IK7 A;  4FFI A;  1R08 2;  2ZGO A;  3VD3 A;  4MGQ A;  2CHH A;  2IXJ A;  4ES8 A;  3NV1 A;  3MPB A;  2Z5W A;  4IE6 A;  3UGF A;  5T52 A;  4AHX A;  1K42 A;  1W2U A;  1J3R A;  2EAK A;  5IW0 A;  1W2N A;  2P3K A;  5GZG A;  1WW7 A;  2XXZ A;  1FPN 3;  3WHU A;  3N4M A;  3AP6 A;  2WRA A;  4SBV A;  4AQT A;  2YBK A;  2VZQ A;  3IMN A;  4JDM A;  1W8N A;  3A0K A;  2JIJ A;  3I59 A;  4CUB A;  3JD7 3;  3NNL A;  3BOW A;  1QWR A;  3R4S A;  3IPV B;  5F8P A;  2QNK A;  3PNA A;  3WT3 A;  1J1L A;  2C26 A;  4FFG A;  3ORJ A;  2VO5 A;  3SH4 A;  2QQU A;  5C3R A;  3H3Z A;  4NAO A;  1YHF A;  5T5L A;  2D97 A;  2QE3 A;  2VZT A;  1SFY A;  3LIG A;  4FI9 A;  4P08 A;  3U14 A;  2WNE A;  4YM3 A;  3Q8E A;  5JMC A;  4NRQ A;  1XBF A;  4BXS V;  4Y3O A;  3AX4 A;  4XUN A;  3VBU C;  2FDH A;  4BQ1 A;  3RNS A;  5FZ8 A;  3TYJ A;  3VDC A;  2PHL A;  2VW0 A;  4PI0 A;  1LNS A;  3ZYR A;  4AE2 A;  3WNN A;  2HWB 1;  3MUY 1;  4B4Q A;  3K75 B;  5EQU A;  1VB2 A;  2Z2S B;  1OH4 A;  3VHP A;  4JQR A;  1LUL A;  3M7A A;  4JDN A;  4QT6 A;  3VB9 A;  1L7R A;  1ULP A;  1VBB 1;  1UQX A;  3DGT A;  4XAA A;  3ZXA C;  4H7L A;  5J98 B;  3CZU A;  3IDB B;  3AMH A;  5JPM B;  1CAX B;  1LOF A;  1A8M A;  3AJY A;  2VZU A;  1AL2 1;  1IS6 A;  2VOV A;  2VOT A;  4MOA A;  4AVC A;  1JUI A;  2PHU A;  5JOX A;  5ANN A;  2OZJ A;  2VM9 A;  4E2Q A;  2JIG A;  4QPY A;  4FT8 A;  2VBB A;  2IVJ A;  2MHF A;  3AC0 A;  2RS3 2;  3PVE A;  4RHV 1;  1O8S A;  2XJS A;  5DZF A;  5EYX A;  1JZ5 A;  4Q8K A;  4XIO A;  2IFR A;  3J7L A;  5JWP A;  1AJO A;  1OKQ A;  2VME A;  1D4M 1;  3CDZ B;  3O1S A;  1LHN A;  1PMH X;  1POV 0;  1W6O A;  1AXZ A;  4HVO A;  4JGZ A;  3RJR A;  2DFB A;  2VZV A;  3CQO A;  2N7G A;  3LFI A;  2OUH A;  1QIQ A;  1H8T A;  2YBP A;  2D6K A;  3IAQ A;  4R4X A;  3T0A A;  4AED A;  5L7O B;  3S0M A;  1KFX L;  4YGE A;  1JI6 A;  2JEN A;  4ZPI A;  3LEI A;  5A6Q A;  2Y60 A;  4WZF A;  1W9F A;  1K3I A;  3X29 B;  3HNM A;  2Y0O A;  4N53 B;  1RUG 3;  3BB6 A;  2LRP A;  2P5B A;  3BIW E;  1JW6 A;  2GC2 A;  3VUO A;  4HSL A;  1JYC A;  1UYZ A;  1OA2 A;  2ARA A;  4OMC A;  1V6N A;  1GQH A;  1RUD 1;  1LEM A;  2YBS A;  2J1T A;  3O7O A;  4RD7 A;  2D3R A;  4PCR A;  4Q0U A;  5FO7 B;  2WNO A;  2C9K A;  5IWF A;  4S2G A;  2VMD A;  1ZRR A;  4TTG A;  4HOO A;  2RHP A;  4OMD A;  1S0D A;  2JKB A;  3LA2 A;  4BOW A;  4AGG A;  2OII A;  1JOP A;  4CDW C;  5FZ1 A;  2B8M A;  1QMJ A;  3GBF A;  3TAY A;  4PIX A;  2VXJ A;  4AR2 A;  3ZN5 A;  1UO9 A;  3ES4 A;  3UKT A;  2UUR A;  4ISR A;  4UFM A;  4CDQ B;  2DUO A;  1ZBE 1;  4CU9 A;  1KDK A;  2VNR A;  1YLL A;  2LW8 A;  4FPO B;  1ENS A;  4DZG A;  2IXI A;  4A45 A;  1W39 A;  1AYN 3;  5FYU A;  2X5I A;  1VBE 2;  1GMM A;  1ULF A;  1ULD A;  4M4R A;  1N3P A;  4WV8 A;  2F4L A;  1SPP B;  4Q4V 2;  1HRV 3;  1JZ6 A;  2B9U A;  4YW4 A;  1H9P A;  1PO1 1;  2BBA A;  4QPI A;  3POG A;  2FZ2 A;  4IEW A;  2PAE A;  3AZV A;  3POB A;  2D6L X;  1YI7 A;  4FFF A;  2EIE A;  4MHR A;  1A3K A;  2VMF A;  2WFF 3;  1ZRD A;  3PUA A;  5A3T A;  1KJR A;  1MZF A;  1RUN A;  2WNV B;  3R0R A;  4GWN A;  2P2K A;  4LO4 B;  5FYC A;  5FYM A;  3ZYG A;  3H8R A;  1QNY A;  1VBC 3;  4QPW A;  1NCR B;  4I3G A;  5A3U A;  1KDM A;  4XMI A;  4YZ5 A;  3E1F 1;  2P17 A;  2OX0 A;  3AXE A;  4N8M A;  1GP6 A;  5FP8 A;  2G9Z A;  4RS5 A;  1CGP A;  1PGL 2;  3MIC A;  3WLU A;  3OBT A;  2GME A;  3T0B A;  5IVC A;  1H1I A;  1GFF 2;  1HW5 A;  4YM2 A;  5FOB B;  4XDP A;  1JHJ A;  2W95 A;  3BAL A;  3ALQ A;  2JG8 A;  2ADD A;  1RUJ 3;  2FCU A;  1F9K A;  4UW5 A;  1D2Q A;  3WQB A;  1ND3 B;  3ZFE C;  1KRI A;  1COV 2;  4YZ1 A;  5IVJ A;  1BYH A;  1IZ3 A;  3A21 A;  3BU7 A;  1BVV A;  3I97 A;  4P5Y A;  3POF A;  1OF3 A;  3K77 A;  4AZZ A;  4Q4X 1;  3CL1 A;  1IKP A;  5JOZ A;  4FPH A;  4YZ4 A;  1S1A A;  1ENQ A;  3N9M A;  5FZC A;  3U75 A;  3ZLI A;  3WNP A;  1HJF A;  3KT4 A;  4JAA A;  5I8T A;  2VNV A;  2IWG B;  5KHK A;  1AR6 2;  3GNE A;  4AI2 A;  1VB4 A;  1Z7S 3;  2YXS A;  3GAL A;  4FPK A;  5JIA A;  4BB3 A;  2O8Q A;  4CEY C;  4Q26 A;  1GNH A;  1F4H A;  2TNF A;  2VW1 A;  1MS3 A;  4MHU A;  5A7W A;  3F2Z A;  2ADE A;  5FYT A;  2W39 A;  2OYZ A;  4DS0 A;  2AH2 A;  3IKW A;  5ABJ C;  1YI9 A;  1S2B A;  1UX7 A;  1SZB A;  3KHB A;  3MFC A;  4NWV A;  1T6B X;  2RV9 A;  2RDQ A;  2WQ4 A;  3HIF A;  4LR4 A;  4Y5T A;  3SIT A;  1W2T A;  2XL9 A;  3LCP A;  3KV5 A;  5EWS A;  2VEC A;  4A41 A;  4MGT A;  2BDR A;  3VBS B;  2YU1 A;  3DXU A;  2XKP A;  3C7F A;  3OY8 A;  3PUS A;  4PDW C;  2I45 A;  2WLP A;  3OGS A;  4QB6 A;  2E33 A;  5F2S A;  4LLO A;  4BYY A;  1FXZ A;  1HV0 A;  1E5H A;  2JIC A;  1N1V A;  4XDQ A;  5GJ6 A;  3ZR5 A;  1C5H A;  2NPI A;  1G7Y A;  4HG6 B;  1TZO A;  3POJ A;  4RN5 A;  2OVU A;  3VGI A;  3ZMO A;  4EN6 B;  3N35 A;  1QQP 2;  1PX3 A;  3CNA A;  4OZX A;  3BUC A;  4YVS B;  4KWL A;  1SG3 A;  2RJL A;  3MLK A;  1XND A;  3KVA A;  4L8Q A;  1NT0 A;  1OOP A;  4Q4W 3;  5FFO C;  1EAH 3;  2GN3 A;  1VBA 1;  5C3Q A;  4LNV A;  4QQO A;  4ZHN A;  3VKO A;  4AW7 A;  1YQ5 A;  4CE8 A;  2R04 2;  1Z0H A;  4NHM A;  4PJY A;  2XON A;  3SKJ E;  3VDD A;  2ZZJ A;  3W58 A;  3ON7 A;  1S55 A;  4CSW A;  3AM2 A;  4IET A;  1QEX A;  1W2O A;  3RWK X;  4E9K A;  5BYN A;  3WUC A;  1ZBA 1;  2IXC A;  1FAT A;  1EPZ A;  1EP0 A;  4K21 A;  4QHB A;  4JV4 A;  2CYF A;  5J09 A;  2CWM A;  3WDX A;  3VBH B;  2DBN A;  5EJ3 A;  3ILN A;  1HB3 A;  1RHI 2;  2HWC 3;  4FP3 A;  3NV3 A;  5FWJ A;  1ALY A;  1SDD B;  3WP5 A;  1YNA A;  2EXK A;  2V73 A;  1IKQ A;  4Z82 A;  1OI6 A;  1WLW A;  3VKN A;  5JSO A;  3H8X A;  1LAJ A;  3OUJ A;  4XFB A;  4YM0 A;  3B69 A;  5FYZ A;  4IV3 C;  2BNO A;  4QKD A;  1Q8S A;  4TLG A;  1V9U 1;  3AP9 A;  2YFU A;  4L9B A;  3VBR B;  4YVW B;  2RMU 1;  1UZ0 A;  1S0F A;  2QQK A;  5FKB A;  1JZ4 A;  4LO6 B;  4OHW A;  1DBN A;  2WWS A;  4YSF A;  1L3J A;  5HPO A;  3H42 B;  1PMI A;  1UXZ A;  3KD4 A;  4TN7 A;  4OI2 A;  4FP2 A;  2JE9 A;  4IV1 A;  3UGH A;  1ZZ9 A;  1X82 A;  4AI8 A;  4XFH A;  1ND2 B;  2YB7 A;  3T2T A;  4XF0 A;  1CR7 A;  3OPZ A;  2HYK A;  4G4F A;  3H9A A;  3N7L A;  1U12 A;  1XRU A;  1E5I A;  2XBO 1;  3UT0 A;  2XVG A;  4FO9 A;  4CVU A;  2ZEX A;  3KCY A;  5HI0 A;  2JG9 B;  4UYB A;  2J1E A;  3J26 N;  5CFD A;  3AKR A;  3ZDV A;  4GKX A;  5FPL A;  4GB3 2;  2OPW A;  4P9X A;  3WDW A;  1HRI 3;  4H55 A;  1UZV A;  3MID A;  5B4X A;  4DNY A;  2CAV A;  3BYW A;  5LA9 A;  4E8C A;  2FDJ A;  5FZL A;  2B9V A;  5IAV A;  1CAW A;  3WW4 A;  1CAV B;  2K0G A;  2LM3 A;  3ACF A;  3AYC A;  1C8N A;  1LED A;  2PAK A;  4HN1 A;  3P3P A;  4RHV 2;  4FOY A;  5I8Y A;  4CTE A;  4GAL A;  4X8P A;  1UZZ A;  5IVE A;  2TUN A;  4YPJ A;  4PLM A;  1EYB A;  3D8C A;  2W1S A;  2YYO A;  5CU1 A;  5LBF A;  1TVG A;  1EUU A;  2GNT A;  5I0T A;  1R64 A;  4CEY A;  1D4M 2;  1AR9 3;  4IGO A;  4G3Y C;  1MQT B;  4WVW A;  1YRZ A;  3BCW A;  1AR8 3;  1YQC A;  4HVQ A;  5J3U A;  2WAO A;  2RVA A;  1DHK B;  2VZP A;  4WM7 C;  5DAX A;  3HAG A;  3ZFG C;  1QH6 A;  3VBO B;  1J59 A;  1UY4 A;  4G9S B;  5T54 A;  4MET A;  1ODM A;  3RYP A;  4QX5 A;  3OBR A;  1RIN A;  2WWU A;  4J25 A;  1H30 A;  2E32 A;  1MS1 A;  3I8T A;  4HKO A;  4MG2 A;  2V5D A;  2ID4 A;  2XG3 A;  1MR5 A;  5A6Y A;  1ULE A;  1BHG A;  5D8A B;  5IVV A;  2WZR 2;  1RIR A;  4YW6 A;  4XJA A;  2YC4 A;  5FPA A;  1S0E A;  3ACI A;  1G9D A;  1UY2 A;  3U07 A;  1TME 3;  1SBE A;  1APN A;  2EXH A;  4KBB A;  4GWJ A;  1NA1 B;  4COZ A;  4AI3 A;  5E8A A;  5FWE A;  2XJP A;  1NLR A;  1OMI A;  2MEV 3;  3EYP A;  5FMO L;  1C4R A;  3JXS A;  2RR1 1;  2VUA A;  1LJ7 A;  1ZBE 2;  4ARY A;  2DVF A;  5GLT A;  2ZGR A;  2PHW A;  2W47 A;  1LRH A;  4NN0 A;  2NQY A;  1HLC A;  3ZIX A;  5B2G B;  2PHD A;  1RUH 3;  3CBN A;  1DZT A;  3PIG A;  3SHR A;  5DDJ 1;  1OUS A;  3DV8 A;  3KWV A;  4W50 A;  1JYV A;  5FP9 A;  4MGZ E;  4BQ4 A;  1G9C A;  2HEY F;  2F17 A;  2WBK A;  4GH4 B;  1OFS A;  2PN5 A;  2DUR A;  5BNO B;  1PO1 2;  3WNK A;  2RM2 1;  2R32 A;  2JDY A;  1A6C A;  4HK9 A;  3SKV A;  3ZYI B;  3POY A;  2WN2 A;  2X09 A;  3WDY A;  4B7E A;  1K45 A;  2A73 B;  3O5S A;  5KC6 A;  3ZXD A;  3CKH A;  4IEX A;  3VBF A;  4AXO A;  4IV3 A;  1VRH 2;  1QJU 1;  2AZ5 A;  3TRS B;  4QM9 A;  1U5Z A;  2BGP A;  3JB8 A;  5LBE A;  3VHO A;  2V4A A;  4QXB A;  4QHZ A;  3UKN A;  1WZX A;  2VG9 A;  3GZA A;  4DXZ A;  1DZR A;  2PHR A;  2CL2 A;  1VAM A;  2RS1 1;  4HBN A;  4M4P A;  4WVM A;  4XC9 A;  3I3Q A;  4GIQ A;  4JDO A;  4QX0 A;  1ZRI A;  3ATG A;  3I54 A;  1XE7 A;  4GMP 3;  4B7K A;  4DRR A;  2VU9 A;  3WCS A;  4Q4X 2;  1W6Q B;  3B5L B;  4XVH A;  2AGS A;  3H3L A;  4RSU A;  3K3O A;  4NPM A;  4Q1P A;  2R07 1;  4I2O A;  5FLJ A;  3WP4 A;  4IDZ A;  1U5Y A;  4Y1Y A;  4GWM A;  4YG0 A;  3O1R A;  2IXH A;  4OUM A;  3K51 A;  1CON A;  1VAL A;  1QJY 2;  1CPM A;  2YPD A;  4CPB A;  1PO2 3;  1YWK A;  2CDO A;  1V6I A;  2QQI A;  2WN3 A;  1LU1 A;  1AZD A;  3ES1 A;  5K0U C;  2WNU A;  1UOJ A;  1FV2 A;  5BNP C;  3JZV A;  4BQW A;  4M3C F;  5AVP A;  4C1W A;  5C70 A;  2NMN A;  4ZKT B;  1N47 A;  4JHT A;  5K7P A;  3AKS A;  3I2D A;  1X8E A;  3IDA A;  3NAP C;  2YG0 A;  4CCC A;  3LZZ A;  5J48 A;  1D0H A;  2WS9 3;  3AB0 A;  1JZ3 A;  3WG2 A;  4CXW A;  2SLI A;  3I3E A;  1UF2 C;  1R1A 2;  2ORZ A;  2WSU A;  4ITC A;  5F7U A;  1SLC A;  1XNB A;  3I59 B;  5FBZ A;  1FPN 1;  4B1M A;  5CFC C;  2WZP P;  4IL7 A;  5DUX A;  2ES3 A;  4EN9 B;  3LEG A;  1JBC A;  5H9Q A;  4YFZ A;  3R6S A;  1K5M C;  2ZKN A;  4YNI A;  3RJ2 X;  2B39 A;  4F83 A;  1KS4 A;  3A4U A;  4WZC A;  2G9G A;  2W94 A;  4Y24 A;  5DAV A;  4XIK A;  3Q8A A;  4HPK A;  1FMD 3;  3DXT A;  2HWF 3;  3VKM A;  5SV8 A;  1HB4 A;  4NJ4 A;  1EPW A;  3LQC A;  1LOA A;  4LBN A;  4LIT A;  4SLI A;  2BUK A;  2ET1 A;  3RYR A;  1GZT A;  5IUQ A;  5AC9 3;  5G05 L;  4XF1 A;  5LAT A;  5IYY A;  5A1L A;  5FPU A;  1GWL A;  3FLR A;  1X50 A;  4LHN A;  2P6H A;  4XZP A;  5FBJ A;  4YYO A;  3VV1 A;  3AP5 A;  4Q4Y 2;  1ZBA 2;  1GWM A;  2VQT A;  4D7T A;  3H50 A;  5IVY A;  4CCJ A;  2H0B A;  2DVD A;  4K9S A;  4ZU4 A;  5DG2 A;  2JE8 A;  2XUE A;  2Q8C A;  5IAX A;  2FDK A;  1EV1 3;  3GF6 A;  5FO8 B;  5LWB A;  1O91 A;  2JX9 A;  3C7G A;  4QX7 A;  2HH9 A;  1MAC A;  3H8O A;  1C8M 3;  2RE9 A;  4M0H A;  1PNF A;  5FQ0 A;  5JOW A;  3LF7 A;  4ONU A;  4LQR A;  4PI2 A;  5FJH A;  1HN1 A;  4R9A A;  3B9I A;  3VZN A;  5DAW A;  1XNK A;  3RYK A;  2VQU A;  1US3 A;  1YXW A;  3M70 A;  3B3Q E;  3LSD A;  4HN0 A;  3TN9 3;  3N9Q A;  5F3I A;  1W6O B;  3VHR A;  4BCU A;  3O1P A;  2JEC A;  4JGZ B;  2H6B A;  4UFJ A;  4E4S A;  1UAI A;  4QM8 A;  1N3O A;  1H8T B;  4PQQ A;  3ZSJ A;  5LCW L;  5KXE A;  3E5U A;  2VQA A;  1PK6 A;  4CXY A;  2ZX0 A;  5CKN A;  2ZGN A;  3ASI A;  1JYT A;  3FFQ A;  3J7H A;  4W8J A;  1AX2 A;  1VBD 3;  4K7J A;  4W6X A;  5KR7 A;  1JOB A;  3ZX7 A;  4Z8B A;  1RXF A;  1OA4 A;  3CEW A;  3V64 A;  4C0B A;  3AZW A;  4FQZ A;  1UU6 A;  5FXV A;  2JDK A;  1RUG 1;  2IZW A;  1J3Q A;  5FMD A;  4CP2 A;  1FX5 A;  1RIT A;  2XKO A;  2ZHM A;  4GD4 A;  5I8S A;  1BEV 1;  3OYW A;  1LGN A;  4BJ0 A;  4BXF A;  5L9V A;  2WFP A;  1MEC 3;  2XLG A;  1TNF A;  3N7J A;  4MO3 M;  5DUW A;  2VOX A;  4EWD A;  5JZG C;  1ONA A;  3O1T A;  1ZRE A;  1IS3 A;  5C4W A;  4Q0Q A;  5C3S A;  5C8W A;  2ATF A;  3MF9 A;  4EE2 A;  3K4Z A;  2DF7 A;  2CNA A;  4IEQ A;  5CYY A;  3CJX A;  3T1L A;  3IDC B;  1SEF A;  3BPZ A;  3ZIW A;  2G4I A;  2X5I B;  1AR7 1;  1GOH A;  4Y4R A;  4AEM A;  4D7S A;  2OZ6 A;  3DPR B;  1BCX A;  4CA9 A;  1JOJ A;  5HCA A;  4E8D A;  3B02 A;  4P9W A;  2WLQ A;  1QJX 1;  4P02 B;  3WG1 A;  3ZN6 A;  3KV6 A;  5CVR A;  2BPA 2;  2MPF A;  4XAC A;  1W8W A;  3FJS A;  1C28 A;  1TMF 3;  4KWJ A;  4OQ8 A;  4QPI B;  4DQA A;  4Y20 A;  1JZ2 A;  4PT6 A;  4N43 B;  5FY7 A;  1OXC A;  1HRV 1;  2WDB A;  1GZ9 A;  2V5Y A;  2VBD A;  3C7E A;  1V6M A;  4KG0 A;  1ASJ 1;  2VNO A;  1CIW A;  4HAN A;  2XJV A;  3USU B;  4WVZ A;  4XJ9 A;  3V0A A;  2WFF 1;  3HMY A;  2Z69 A;  4RR3 A;  3LKJ A;  2GH8 A;  1AYM 1;  4X8N A;  4XE9 A;  4XCA A;  3WW1 A;  1CAU A;  3EQE A;  1ULG A;  4RS5 B;  3A7Q A;  1XU1 A;  2ZZQ A;  3V0B B;  1PVC 2;  1RUC 3;  5FY4 A;  2Y6F A;  4CDX B;  3PLQ A;  2R6Q A;  4AVV A;  3VD4 A;  3PVN A;  4OHX A;  3MGU A;  2VUJ A;  1AUY A;  1QXJ A;  1QNW A;  2JG8 B;  1A78 A;  1FOD 2;  1CN1 A;  2BYV E;  2R0H A;  1QF3 A;  2W2I A;  2W87 A;  3JBG 3;  4FOW A;  4UAP A;  5FZF A;  3M4F A;  4EJR A;  2W1Q A;  1TEI A;  1RUJ 1;  3N7K A;  2ET7 A;  2GSY A;  2B4K A;  1R08 3;  1JU3 A;  4AGV A;  4CEW C;  4RYD A;  2WWJ A;  3P1I A;  5T55 A;  1RED A;  4R4Z A;  5DDJ 2;  5GAL A;  2I2S A;  4QPG C;  2QDN A;  3BI3 A;  4KGQ A;  3O1V A;  2HWE 2;  2BER A;  1I5P A;  2JDH A;  4AG4 A;  1HV1 A;  5EFU A;  4IEZ A;  4Q29 A;  3THD A;  1DYK A;  2J1S A;  2YY1 A;  4XF3 A;  5LZ6 A;  1KQR A;  2O8O A;  2W52 A;  1Z7S 1;  5G04 L;  4EN0 A;  2EXJ A;  3HN1 A;  4Q2F A;  5EJ1 B;  2A71 A;  5GZD A;  2W91 A;  3DEC A;  2C4X A;  3FZ3 A;  2DUQ A;  3DYO A;  3NWK A;  2AEZ A;  1NLQ A;  4FQ4 A;  1DQ6 A;  1QJU 2;  1XB9 A;  1WLC A;  3ZO0 B;  1R09 1;  4S2F A;  3OY8 B;  2B5H A;  1V6K A;  4FOQ A;  4K8F A;  1W9T A;  3BKZ A;  4M01 A;  2VTF A;  1W3V A;  5GLU A;  5C8C C;  1OLM A;  5AVA A;  1CX1 A;  2D3S A;  3QBQ A;  3T2O A;  5FO9 B;  2B45 X;  2RDN A;  2AUY A;  2ZGS A;  2V72 A;  5T3N A;  4HFS A;  2W1W A;  2XJR A;  1DYP A;  1UZY A;  2ZA9 A;  5KXB A;  3ROU A;  3C3V A;  3HR9 A;  5IFT A;  3RWN A;  3VLB B;  1B35 A;  4AI9 A;  5IK8 A;  4W65 A;  3OPT A;  3DPR C;  4I30 A;  3ZN4 A;  4DO0 A;  1NKG A;  4XQD A;  1NCQ C;  2PLV 3;  1WLD A;  1S0C A;  4UFI A;  4AHW A;  4NIG A;  2OA2 A;  2GAL A;  2QQL A;  1T2X A;  2VQ0 A;  5FLI A;  2R07 2;  4CDU A;  5KXD A;  4V2V A;  4K6B A;  2Q8D A;  3WY6 A;  4N43 C;  2GC1 A;  2Y6J A;  3GCX A;  4Q4W 1;  1LGB A;  1PVX A;  1G9A A;  1EAH 1;  1W8U A;  5FTT C;  1BK1 A;  4XXA A;  2FMD A;  2BVV A;  4XTM A;  5C9A C;  3CJI A;  2BTV C;  3J4U H;  5JZG A;  4UF0 B;  4CYD A;  2RS3 3;  4LA2 A;  3MIG A;  2ZCW A;  4Z2A A;  1XC6 A;  1UW8 A;  2GC0 A;  3GJB A;  4CP9 B;  1ZA7 A;  4I0B A;  4CDX C;  4JKM A;  1BJQ A;  4X6Q B;  4LO7 A;  1Y9Q A;  4HVR A;  4L11 A;  4RGK A;  4A2U A;  4FPE A;  5A3O A;  1W9S A;  1A34 A;  2HWC 1;  4AI1 A;  3I2G A;  3MV1 1;  1DQ0 A;  3F95 A;  1E5S A;  3EHK A;  2HBU A;  2YFZ A;  3MLJ A;  2XGX A;  4QMA A;  5LRR A;  3WIN E;  4AVB A;  1RUE 2;  2OS2 A;  5LBB A;  1KIT A;  4LUM A;  3N9L A;  1KFU L;  1UL9 A;  3VZM A;  3M3O A;  4C90 A;  4ARX A;  1YFW A;  4Q5O A;  5A1A A;  3VKF C;  4MGS A;  3O1O A;  4IE0 A;  3O1U A;  4R8H A;  4IV1 B;  1ZZ6 A;  3URF A;  4B4R A;  1VAV A;  4Z92 B;  2ZGM A;  3GJA A;  4K1Y A;  4LBQ D;  1V6J A;  5JXH A;  5GLW A;  2ZOE B;  4LKF A;  4QDR A;  3AFK A;  4I01 A;  4YRD A;  4NHY A;  3KB5 A;  1RUI 2;  3U4S A;  1URX A;  2NLR A;  4OUE A;  4GUL A;  3AMM A;  4QXK A;  4H2A A;  4Q0S A;  1Y9M A;  3MFA A;  1KXG A;  2RJK A;  4RQP B;  4XXP A;  2JXA A;  2A75 A;  2ARB A;  4GWI A;  5JOY A;  1H2M A;  4QGN A;  1LR5 A;  1VBE 3;  2OXB A;  2XDV A;  4I02 A;  5EV7 A;  5FK7 A;  1XYO A;  5EXO A;  1ZNP A;  1CAW B;  4ZON A;  4Q4V 3;  3ITQ A;  3ACH A;  4Q0P A;  1MS0 A;  2XWJ B;  3HD8 B;  3T3Y A;  4QPG A;  2A5Z A;  1JS9 A;  1NZI A;  1W6P A;  4N7I A;  4EN8 B;  3FUQ A;  1C3H A;  3E6B A;  3O14 A;  2Q30 A;  3ZSM A;  2VE1 A;  4CCK A;  2WUH A;  4I3P A;  3GZE A;  4N90 A;  3AKP A;  2VMC A;  1X9T A;  1H1M A;  2OQ6 A;  3L9J T;  3J8F 2;  5JUV A;  3LIH A;  4I0W B;  4XHB A;  4A7Y A;  3MIF A;  3WZ1 A;  1AR9 1;  5A7S A;  1AX0 A;  2WAA A;  4TXW A;  2VUC A;  1NAE A;  2VUD A;  2C0Z A;  1ENX A;  1JTZ X;  3THC A;  5H9R A;  4UFH A;  5BNN B;  1BVP 1;  2W08 A;  3MLL A;  1WCK A;  3ILF A;  4FAG A;  3KS7 A;  2B42 B;  1W8Z A;  3IMM A;  2YDE A;  4U2A A;  5C8C A;  4Y1X A;  1COV 3;  2E63 A;  4DB5 A;  3K2O A;  5ERL A;  2ERF A;  2J1U A;  3ETQ A;  3H1M A;  1N1T A;  3UV9 A;  4BLI A;  4NHX A;  1ST8 A;  1BEV 2;  3SQO A;  4AYU A;  3SEP A;  3I2J A;  3KSC A;  2R1D A;  5FY1 A;  5FZD A;  3QH6 A;  2P1B A;  3K46 A;  1GNY A;  4MYE A;  2W92 A;  5HXM A;  3THP A;  3VZK A;  1AR6 3;  1XQN A;  5SV5 A;  1BBT 2;  2WR9 A;  1YCI A;  4R9B A;  3ZXL A;  2VXR A;  3NV2 A;  3GZU C;  5C71 A;  5F37 A;  2DFC A;  3VBU A;  3O0W A;  1AR7 2;  2WT0 A;  3RSJ A;  1IOA A;  5KHG A;  4L0P A;  1QJX 2;  1J84 A;  4V1P A;  1RUH 1;  1REE A;  2BWA A;  5JDB A;  4LUL A;  2WA3 A;  5L7O C;  4YGC A;  1V6O A;  3K48 A;  3WP3 A;  4K40 A;  5I0U A;  1VRB A;  2Z79 A;  1JZ8 A;  1VMH A;  3WP6 A;  1W8H A;  2KD7 A;  2IUW A;  4XEZ A;  5BY5 A;  5JIU A;  4O7X A;  1OLR A;  1ASJ 2;  1QDC A;  1OVP A;  3C2U A;  4N53 C;  4LJH A;  2DU0 A;  3VBF B;  1GKB A;  3FBM A;  1AYM 2;  2XB6 C;  1DP0 A;  4HZF A;  2NM1 A;  2ZMN A;  5FXW A;  3ZSK A;  1PHM A;  2QQV A;  4XJW A;  1B09 A;  4DOU A;  1O3R A;  1Q8V A;  2CWS A;  1QQP 3;  4BQ5 A;  5KXC A;  1W6M A;  1OHF A;  4ISQ A;  2R06 1;  4H7M A;  4CUG A;  4HXC A;  1DLC A;  1UZW A;  5EIY B;  2IXK A;  5I91 A;  1UMI A;  4YZ2 A;  5K9Y A;  3OBZ A;  1SLA A;  2EVX A;  2XQR A;  4OI1 A;  3UK9 A;  1ACC A;  2BNN A;  2R04 3;  3OD0 A;  2EAA A;  1HXS 2;  1VIW B;  4ATE A;  3BIE A;  4FVV A;  3WF3 A;  4CDQ C;  2CAU A;  4QQP A;  2OUJ A;  1XE0 A;  1QOT A;  4LIU A;  5FZ7 A;  3IB3 A;  4Y26 A;  4D8M A;  4AQ2 A;  2LAL A;  1YFU A;  4UBG A;  1LCL A;  1GNZ A;  4M3C A;  3OSD A;  2XVK A;  4OHZ A;  2J1R A;  3LWC A;  3DN7 A;  1KGY A;  2RS5 1;  3PJY A;  4IGQ A;  1RHI 3;  3RDI A;  1ZZB A;  4IND A;  4LBO A;  5BNN C;  5FY5 A;  3EO6 A;  3LEK A;  4PLO A;  4ZU7 A;  5T5O A;  4XF4 A;  2BWC A;  1FI2 A;  2HBT A;  4B4P A;  5ACA 1;  4NHL A;  5F5I A;  1YQ8 A;  4M0N A;  2WNU B;  4ASL A;  1PO2 1;  4JKK A;  2ZAB A;  3WX5 A;  4B29 A;  3WNL A;  2WNV C;  3MI8 A;  3R4D B;  2FMY A;  1IPK A;  2DUP A;  1O8P A;  1NCR C;  1OPO A;  3MW3 A;  1DYO A;  4J6G A;  5FXX A;  3ZXE A;  4CDW A;  1O6U A;  2TBV A;  3MBW A;  3VHN A;  4AFB A;  3PUR A;  1R09 2;  2WAB A;  3OEB A;  5FPB A;  4LHS A;  1ODN A;  5F9T A;  5F3E A;  3R4U A;  4BH9 A;  2QBX A;  2ZX3 A;  5CKM A;  1GAN A;  2VCC A;  4DPN A;  3S5Q A;  4COV A;  1GP4 A;  1RC6 A;  1V6L A;  3E6D A;  3AMN A;  1ND3 C;  3HN3 A;  2ENR A;  3LA3 A;  2QQM A;  1Z78 A;  3M3C A;  3KQR A;  1BXH A;  5CIR A;  4HPK B;  2WT1 A;  1X36 A;  4QKN A;  3O12 A;  3KLS A;  1Q43 A;  2B46 X;  4YW2 A;  2OPK A;  3D0J A;  3PJQ A;  1FMD 1;  1VE0 A;  1H4H A;  1W8O A;  2HWF 1;  2ZJC A;  3OPW A;  4GB3 3;  2XML A;  1YQ6 A;  1UMZ A;  4BQX A;  5JSP A;  5LK7 B;  3AMP A;  4FPY A;  4MGK E;  1XNC A;  5IVB A;  5LA0 A;  4XBL A;  2BV4 A;  2RDR A;  5AC9 1;  1HQL A;  2J1V A;  2KR2 A;  3AJZ A;  2PMW B;  2D40 A;  3B01 A;  1VAK A;  2HWB 2;  1HX6 A;  4RHV 3;  3U0Z A;  2P6C A;  3RS6 A;  3U11 A;  2P37 A;  3RZZ A;  5FP3 A;  3M3E A;  3N9N A;  5CG9 A;  1VBB 2;  2HWD 1;  1EV1 1;  2C5D A;  1GYK A;  3QAC A;  4OZO A;  3VBS C;  3ZFE A;  5FQ0 B;  5L19 A;  4YW7 A;  3VKL A;  4P00 B;  4Y5S A;  5EJZ B;  1AL2 2;  5AFB A;  3RZG A;  4AF9 A;  5FYH A;  4X6R B;  1C8M 1;  3DCQ A;  2JDM A;  1VJ2 A;  4BLJ A;  1POV 3;  4UW4 A;  4P9J A;  1LHU A;  3FX3 A;  3ME2 A;  4P14 A;  5L9R A;  3IWZ A;  3KM5 A;  3DF0 A;  4ASM B;  5A3P A;  3NKT A;  4KI5 M;  4A6O A;  4XZU G;  3W9A A;  1GR3 A;  1BLZ A;  4YVS C;  2AAC A;  4MXV A;  2PHX A;  1SFN A;  1RMU 1;  2WZR 3;  4N53 A;  2Q1Z B;  3MV0 1;  2EIB A;  3FC0 A;  1OT5 A;  3AZY A;  4OLL A;  5ABJ A;  3ZSL A;  1LTE A;  3RQ0 A;  4ZZ8 A;  3BU0 A;  5LA2 A;  1U5I A;  4Z07 A;  1D0G A;  1V0A A;  2OQ7 A;  1VBD 1;  5J36 A;  1S0G A;  5D1I A;  3VD5 A;  4BA6 A;  1G8W A;  4WM8 B;  5HCH A;  3B7M A;  1GP5 A;  1DF0 A;  4PDW A;  1ZBE 3;  2YHJ A;  3OYW B;  3VBH C;  3OGG A;  4LHK A;  4IEY A;  4LBQ B;  2VZO A;  5JLV A;  1RUD 2;  3D0S A;  3GBW A;  3U78 A;  1AHS A;  4NRM A;  1CZT A;  3GCW A;  2RDS A;  2Y34 A;  2IFW A;  3OCP A;  4RL7 A;  3GHN A;  1KEX A;  1MEC 1;  2DTW A;  1YO8 A;  1OLM E;  1PNG A;  3RGB A;  3POI A;  5FMC A;  3S7E A;  3PTR B;  2HJI A;  1PO1 3;  2FDF A;  1SLL A;  1ZZ7 A;  2AC1 A;  4XTP A;  3T2P A;  1REF A;  2GC3 A;  3PUH A;  5JCT A;  3VBR C;  4YVW C;  1D4V B;  3WSO A;  1LU2 A;  2ZGT A;  2YZ4 A;  5FKC A;  3ZN6 B;  1XU2 A;  2CDP A;  1VRH 3;  4F3J A;  2WNV A;  2VCA A;  1VMF A;  2Y8K A;  1RVF 1;  4CP0 A;  4S2D A;  1CZV A;  1NCR A;  2ZXQ A;  5KHJ A;  1ND2 C;  1TMF 1;  1H0B A;  4QXH A;  1O3T A;  5FR3 A;  2VVD A;  3QLQ A;  1QH7 A;  1N1Y A;  4EWA A;  1JUH A;  3M3Q A;  4HT1 T;  4NRO A;  5FJK A;  2C1F A;  1PIV 1;  2VVF A;  4D6Q A;  3SH5 A;  1F5F A;  2JG9 C;  3POE A;  2D6M A;  1PMJ X;  5CBL A;  4FPC A;  2PYT A;  4E27 A;  1TG7 A;  1VR3 A;  3MDP A;  4Q4X 3;  5HCB A;  1PZ8 A;  4YGD A;  4URA A;  1YFX A;  2VBP A;  3MIE A;  3ACG A;  2Y6L A;  2AYH A;  4NIA A;  3ZFF B;  4ERO A;  1NG0 A;  4AAX A;  1PGS A;  5A6X A;  1W0O A;  2GNM A;  1QJY 3;  2BFU S;  3HEI A;  4BME A;  1MVQ A;  3AMQ A;  5FY0 A;  2VZR A;  4P9G A;  5FZG A;  3R05 A;  2MNG A;  1UXX X;  3LPG A;  1CQ9 A;  3KF5 A;  3I2O A;  3BTZ A;  4JGY B;  2ZGU A;  1JZ7 A;  1MQT C;  1FT9 A;  2DYC A;  1XNT A;  1GZW A;  2X8K A;  1OF4 A;  4Y1V A;  3N9O A;  1CPN A;  4ORF A;  2PQQ A;  3VBO C;  2EA7 A;  5DAQ A;  3VZL A;  4O65 A;  1GWK A;  1QGL A;  2JKX A;  3KT7 A;  4LUK A;  3SLI A;  3ZXF A;  3BN6 A;  1R1A 3;  5DUV A;  2VOW A;  4MUV A;  2QQN A;  2TEP A;  4WM8 C;  5JR2 A;  2Q1F A;  5CKQ A;  1DCS A;  1C5I A;  1X33 A;  2GMP A;  2FDI A;  3KVB A;  2FD8 A;  2AEY A;  4LPL A;  2F6B A;  2BQP A;  4H14 A;  5D8A C;  2VPV A;  2XJT A;  1OQD A;  3BTA A;  4XW3 A;  4YFW A;  3MEP A;  1GOG A;  4QB2 A;  1V70 A;  3SNM A;  4LOT A;  1F2N A;  1FNZ A;  2WKK A;  2E9Q A;  1F31 A;  1W90 A;  1UIJ A;  2R06 2;  2K46 A;  3Q9O A;  3L2H A;  5FV3 A;  1Q3E A;  2BP6 A;  4GA9 A;  3INA A;  1NA1 C;  5FZH A;  1BMV 1;  3LB9 A; 
#chains in the Genus database with same CATH homology
 2JDP A;  1OUR A;  1OXC A;  1UZV A;  2CHH A;  2VNV A;  2JDN A;  3DCQ A;  2JDM A;  1W8H A;  5A6Z A;  5HCH A;  1W8F A;  1OVP A;  1OUS A;  2VUC A;  5A6Y A;  2VUD A;  2BV4 A;  5A6X A;  2XR4 A;  4UT5 A;  4AOC A;  2WR9 A;  5D2A A;  2JDH A;  1OUX A;  2JDU A;  2WRA A;  2JDY A;  1UQX A;  4CE8 A;  2BOJ A;  2JDK A;  1GZT A;  5A3O A;  1OVS A;  5A70 A;  2BP6 A;  3ZDV A;  5A6Q A;  2BOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...