3R6SA

Crystal structure of glxr transcription factor from corynebacterium glutamicum with camp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
225
structure length
225
Chain Sequence
b'GVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcription regulator
publication title Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 76
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r6sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3r6sA01
1ZZ6A 3G7DA 1GQHA 1Z91A 1KU3A 4KDPA 5HLGA 1OFNA 2E9QA 1HW5A 2NYXA 5HDGA 5JR7B 1Z6RA 1YS7A 2HOEA 3HQXA 3C3VA 3FWEA 4KNYA 1ZG1A 1P4WA 3GXOA 1U3EM 2LNBA 3TO7A 4A5NA 1HQCA 2EAAA 3IWZA 4IHSA 2OZJA 1XSXA 2HQRA 1YIOA 2DLLA 3ABTA 3ZN0A 3BROA 4MNUA 2QVSB 4ETSA 5DYMA 2P8TA 1R23A 3K2ZA 1I6XA 1QWRA 3VOEA 3QU6A 3KETA 5BQTA 3WTYC 1WKMA 4ASNA 4B09A 3SCGA 1XE8A 4IJAA 4IHTA 1SFXA 3F72A 3MQ0A 2RVCA 2DT5A 5E17F 1LQ1A 1FNNA 1FY7A 4CO8A 1GXQA 2ZNYA 4KIFA 2AXLA 2HTSA 5HS7A 5KHHA 2MC3A 3P9KA 4X6RB 2XAJA 4HW0A 2LDUA 1FT9A 2LF8A 2WV0A 4A0XA 3G3ZA 4HYEA 4LFUA 4KWLA 1XCBA 1QZYA 3JZVA 2UWMA 1ZZ9A 1K7AA 3KP5A 2MA3A 1CF7A 3I53A 3U0ZA 3Q5FA 3DF8A 4IERA 3LSTA 1T0FA 4BH9A 1LRHA 2WTEA 2ZFWA 1G3YA 4QGNA 4O9EA 3O3KA 4D0PA 3WTXC 2WWYA 4HV5A 1ODDA 1F1ZA 1FBSA 4BQAA 1KGSA 3R0AA 2Z2SB 3PQJA 1IN7A 3ZP5A 1IZ1A 2FNAA 1ZN2A 4IRGA 1RZ4A 2L4MA 2PQQA 1P2FA 2IXJA 3HOSA 1FYKA 1OD5A 2BNMA 4JTNA 5FD5A 3V8KA 4D7TA 1YFXA 5HDNA 2V1UA 4M74A 5DUIA 4XFBA 4R8HA 1OMIA 4Z2YA 2RN7A 1J0RA 2KRFA 1B4AA 3IC7A 2VBWA 4HV6A 1IN8A 3J7AO 4IEOA 3O14A 4YNIA 3WTZA 3E5XA 4MQ9F 3SQNA 3M1EA 3KFWX 5JFRA 2J5OA 4HF2A 1YS6A 3OTFA 5ICEA 3MZYA 5JVTA 4G6DA 3HT2A 3R60A 3HOTA 3LA2A 3FXUA 1HBXG 3S2WA 5DCMA 5J48A 5BOXA 4KN4X 1PDNC 3MAJA 3GVAA 2VPVA 5LEKA 3JAMK 3H7YA 4GGGA 3GF2A 4LULA 4ZYHA 5KVRA 1QZZA 1RI7A 1NHAA 4QXKA 1SFNA 5F64A 3CF6E 4PZJA 4KIGA 1FC3A 4EJVA 1USSA 3WTVC 5EZWA 1TQ5A 4F8AA 1SMYF 1TTYA 3FHIB 2OYZA 2ETHA 3JW4A 2XGXA 4EWEA 4LA3A 1KU2A 4MZUA 4JK1X 1T38A 2DBBA 4KMUX 1E17A 1WSUA 5BPXA 3L9FA 1IRGA 5LHIA 5E1ZB 1DZRA 4BXUA 2Q1ZB 2P5KA 3DEUA 4BHBA 2NRAC 2XUBA 3NW4A 1QXJA 4U0YA 2PMHA 4LGWA 1ZHFA 1CAXB 4ONUA 1DGWA 2BV6A 1H9GA 3Q9SA 4M6YA 2RKHA 4YFNF 3SHFA 1DGRA 4KL1A 2OBPA 3K1PA 1CAVA 4XFIA 1PP8F 1S3JA 4Q29A 3F8CA 5DDGA 3P7NA 4META 1XGMA 2ET7A 3V7SA 5I8SA 3FMSA 2RDPA 1LEAA 3F8FA 4CXFA 4Q4ZF 4FHTA 3S7EA 3LAPA 1DPUA 1BIBA 4X6QB 2K4BA 1MDMA 3KP7A 4YSFA 3HHGA 2D2WA 3WTTC 4FX0A 2B8MA 2XAHA 5HI0A 3EHKA 3RYPA 4LTAA 2P5LC 2PEXA 5BV6A 3O2PE 4HQMA 4LUMA 2E7WA 3CUQC 3FZVA 3H1YA 3MEXA 3MFKA 3EQLF 4L18B 1HSJA 1RGSA 5L3GA 5E16A 3ZMTA 2QDRA 4WF2A 1F4KA 3WW2A 2KIMA 3ACLA 3LQQA 1D5VA 5D6FA 2FXAA 3HT1A 1DP7P 4I7HA 1I5ZA 4ENKA 1HW2A 3SHRA 3BJ6A 2QCSB 1OYWA 5AVPA 1LJ9A 2H27A 3BPXA 2COMA 1IAWA 2MBFA 3TNQA 3L7WA 3ZDSA 2QLZA 4XSZF 1SD7A 1ZZ8A 2XROA 2EV0A 1X8EA 1QNTA 4I0AA 1YFYA 4LB5A 3H3ZA 3COAC 1U78A 4ORFA 4EJWA 4HVOA 2IA0A 1MZBA 4N9IA 4HBNA 4E2GA 4RB2C 3U1DA 3FZ3A 1J58A 3F6OA 3D0JA 4A0YA 3GFMA 5H6QA 1BN5A 4ENJA 2VONA 1IN6A 5K5RA 1RNLA 4WBBA 3HYIA 3I5UA 3H9AA 2QM3A 4LD5A 3TO9A 4BAYA 4EMSA 2NNNA 1WI9A 5JI6A 2OPKA 5HVQC 2DFIA 5BS6A 2V1XA 4XLNF 2PJPA 3ECHA 1G3SA 2IXLA 4BHPA 4XETA 4IEPA 4A12A 4O6JA 3BU7A 3OGJA 4KWKA 3R6SA 2XAQA 3ULQB 1O4TA 4EM2A 3ZMZA 3OF1A 3LAJA 5BMZA 3I54A 1Q43A 4U0VA 2EFQA 4QM9A 1K79A 2YU3A 3M8EA 1RUNA 5BY5A 3TDUC 3E97A 4QGLA 3GWZA 3HRSA 2PFBA 2Y48A 2Y75A 3W6JB 2VOPA 1VJ2A 2D1VA 2H94A 3PQKA 3F8NA 2F5EA 3ZN1A 1WLTA 2MHFA 3IDBB 2A5YB 1WA4A 2X4HA 5FLIA 5C6CA 4M6XA 3FXQA 5TRDA 5J8FA 3E6DA 2CW0F 5CYVA 2WC2A 3NL1A 4XFFA 2PBIA 1IW7F 2Q0AA 3EBRA 4ESFA 1LR5A 1U5TC 4HVQA 2PN6A 2QJVA 3LA7A 4UV9A 2H09A 2ZJ2A 5FD6A 2EA7A 4Q0VA 1H1IA 1Y9QA 1KQ0A 1G3WA 3DQVC 4CICA 4EWAA 4PGHA 2PG4A 4QM8A 3M70A 1MJAA 3H92A 4AIJA 4UV8A 2XKOA 4MGKE 3H3UA 2BNOA 3HTSB 4AVAA 3S7IA 1HXDA 4MUVA 3KCCA 2CG4A 4AVCA 5ERIA 1LVAA 2P7VB 3VEPA 2ISYA 1O7LA 1SFUA 3SXYA 5H6RA 1YW8A 2K27A 2IA2A 5BUVA 3M9AA 5FLXZ 3IWFA 1FBQA 1NE4A 4J1XA 2XAGA 2FA5A 1KU9A 1XMAA 1XMKA 2HGCA 4G6QA 1C0WA 1ZRCA 4IEZA 4XRFA 3BALA 2A6EF 2Q0OA 2XASA 4RGUA 2EA4A 2DK8A 1PUEE 4XFAA 1XDUA 1P6RA 4E2SA 2XVCA 3LWFA 4B8XA 1CAUB 1DDNA 2HKXA 2W25A 5LRSA 3F6VA 2ISZA 1YTYA 1FP2A 1UD1A 2VE8A 2VOOA 2CO5A 2QQBA 3GFJA 3JSPA 3HUGA 1JXSA 5J8CA 3GYDA 5L3CA 3NJZA 3P9CA 3V7RA 2ESHA 5HLHA 3ZMVA 2Z33A 3OOPA 1O57A 1B9NA 1YWKA 2XLFA 2OZUA 3E6MA 2E7XA 1IRFA 4AVPA 3WGGA 2GAUA 2NAZA 4CZZA 2GC1A 2BYVE 2GU9A 1LDKB 4G8XA 1BM9A 4RD7A 3UKTA 5FLXK 3T8TA 3CO2A 2PMUA 4M9SA 4KUMA 4BNCA 5ILSA 1S29A 5E20A 3RTRA 1H9TA 5CVJA 6PAXA 2W57A 5HS8A 2IXIA 1VP6A 1MKMA 2BE5F 2VODA 2GWRA 1K78B 1IF1A 1ZVFA 3BP8A 3FXRA 4JQFA 2GA1A 4Z82A 3J81Z 3RKWA 1KU7A 2O0YA 3PFIA 3U10A 5DD4A 3T5XA 2K9ZA 5FO5A 4Q48A 5H20A 4ZU5A 3LOIA 1ZH5A 4RB1A 3FJSA 4ZYEA 2P17A 2EV5A 4CDGA 3DFGA 4L5IA 2STWA 1G3TA 4JV4A 3CUQB 1LEBA 4OINF 3GLXA 5CADA 1P92A 4KWJA 2O3FA 5LBQA 1IPJA 3ELKA 2CFXA 4PIXA 3M3IA 3JSOA 2BGCA 1V70A 1EH6A 3H8UA 5TJJA 3FFQA 1JHHA 4OU0A 3W6KB 2DW4A 4I02A 1OR7A 2GC3A 3MZHA 1VR3A 3LFKA 4S04A 3LA3A 1TLHB 2F2EA 3NKTA 1S6LA 3I7DA 1TW2A 4CHUA 2HJIA 4UVBA 2CV6A 2K0GA 1TW3A 1FI2A 1ZYRF 2VBYA 3O6BB 3WTWC 2Z99A 5D1IA 4HBLA 3J81K 3BB6A 2YSRA 2VT2A 2JT1A 5L3EA 4A2UA 3K1MA 2O03A 1ON1A 3CTAA 5L3FA 2OD5A 4CGZA 3BJAA 1X7NA 4RGRA 3QP5A 3BY6A 3JTGA 2XL9A 4L2NA 3EETA 4RAYA 2VN2A 1NYWA 2JPCA 2GXBA 1P4AA 3QU3A 1G6NA 5J7MA 3FX3A 3V7CA 4UBHA 1EP0A 1XCVA 2PFWA 2KJBA 3EYYA 2OQGA 3WODF 1B9MA 1YQAA 2UZKA 4S05A 3GFIA 3DXJF 1ULYA 4DQ2A 4I2OA 1VTNC 4KU8A 5E8IA 2FNPA 2P4WA 1SD5A 4EVIA 1S8NA 5FPZA 2K7LA 3IIAA 3TOBA 3FE5A 5LHGA 3NQOA 2M8EA 3M8FA 4GO1A 5HOOA 2E1CA 2D40A 3RKXA 3QPHA 1R1TA 1R36A 5BXXA 3BCWA 1EYBA 3KGLA 5J6XA 2FOKA 4RS8A 1XE7A 4WXCA 4LK1F 2QQAA 1KYZA 1I1GA 4WCGA 5D4RA 4PGGA 5I91A 1P4XA 1J59A 3LQRA 1L3JA 5EEHA 3TKYA 4P5OA 4HSJA 2YPRA 4Q0QA 4YRDA 1W4MA 4M9XA 1ON2A 5ILVA 2DQLA 4I09A 4P9UA 2EK5A 4QGMA 2KIUA 1NZCA 5FGMA 2HFHA 3M7GA 2IXCA 4ZH4F 2KIFA 4HAMA 1H0MA 3IKVA 4KA4A 2VXZA 2UYBA 1U8RA 4MGRA 4HSLA 2Z9OA 4AQ6A 1QO0D 2FBIA 2Q4SA 1PM7A 4IEXA 3I71A 3TQNA 5KHKA 1YYVA 2F5DA 1W7PA 2DAOA 2M1BA 1OPCA 5AIPA 5CVUA 1U5TB 2K02A 1ZRRA 2GH2A 2P7CB 4A5MA 5L3BA 2H6CA 3HRTA 1OKRA 1ZG3A 4EWDA 2PHLA 1RL3A 1ZX5A 2TDXA 5EFUA 4K8FA 2EV6A 5CVIA 1J3PA 1KQ9A 2FQ3A 2B0LA 4Y13A 4QWQA 1V4RA 2GIVA 2L4AA 3CO6C 4YFKF 4MGYE 2QBYB 4ZU7A 1ZLJA 1I27A 4I98B 2XL7A 4KIBA 5T3NA 2HYFA 1S7AA 4Q0UA 1BIAA 4XF0A 2CQKA 1O5UA 3IDCB 2BNNA 4HMZA 2EWNA 3IBMA 5ICCA 2JSCA 2O1QA 3K69A 4GXOA 4O3MA 1JE8A 2ADUA 5KK1A 3GYHX 2DQRA 4LG0B 3QP6A 4KU7A 3B73A 4IRIA 2H0VA 2Q8KA 1BJAA 4F7ZA 1J5YA 3KZZA 4U0WA 1IPKA 3ECOA 5FFXA 3CL1A 4XFHA 2OAZA 3D5LA 3E6BA 1FWZA 4XF1A 3VODA 2RC4A 3LAGA 3TGNA 4IEWA 5LGTA 3PVBB 4MH0E 5D5XB 1T2KA 4PIZA 4KYWA 5ICGA 3OCPA 1UIKA 4LLOA 1V3FA 2LKPA 4LK0F 4UXNA 3HRUA 3I0TA 3WTUC 1GHCA 2D45A 3ML6A 1EH8A 4RGXA 1H1MA 4N9HA 1K6OA 2XKPA 2D5FA 3ZMSA 4PIYA 2DK5A 2A6HF 3TDZC 2W84A 3KP2A 4ENMA 2ETEA 3H7JA 2A07F 1FX7A 1BC7C 1EH7A 3C3WA 4GYIA 2H6BA 1L0OC 5J3UA 1IXRC 3IRRA 1XSDA 1TBXA 3OV8A 1YO5C 3DPTA 3T1BA 1O7FA 5ICFA 4UNOA 4IVNA 3RDIA 1FPQA 4G7HF 1YFHA 1STZA 2ZMEB 3U9GA 1IXCA 4H7LA 2FQPA 4HX4A 1AWCA 1Z6TA 1HW1A 2VQAA 1T39A 1FLIA 1XD7A 4KFCA 4XF3A 4Q0SA 5I8TA 3I59B 4ON0A 1HKTA 4BIFA 4RB0A 3DN7A 2QQ9A 1JGSA 3MPBA 2FBKA 2XLGA 4WX9A 1SD4A 2NS0A 3QACA 5JSOA 2P5VA 4LLLA 2P6SA 3SMHA 3HHHA 1TQPA 2ET1A 4XFCA 3GX4X 2MD5A 4HX7A 1CAUA 1J1LA 4CYDA 3HTUA 4HLYA 5D8KB 3EO6A 1L3LA 5K5OA 3ZMUA 1QXRA 5BPDA 2L02A 2EFWA 1ZLKA 2PAMA 3RNSA 1Y0UA 2HWVA 3EYIA 4L9VA 2R3SA 4I0BA 2PQ8A 4UVAA 4JTOA 2UY8A 1WRJA 2F5FA 2HQNA 1XGOA 5FDBA 3I4PA 4U7DA 3K9TA 1F9NA 2DU9A 1FOKA 3CJXA 4YIFA 4L9NA 3H1WA 4HN0A 3LZZA 5CVRA 3ZQ7A 2HR3A 4M9ZA 4WZCA 2RNJA 1KQ8A 3HSRA 4DINB 1XRUA 1TQIA 4HZFA 1K78A 2CWEA 1FXZA 2IW5A 5I93A 1DPRA 5KHGA 1S7OA 3V8JA 5I0UA 4IEYA 1D3YA 5L3DA 4EROA 1RTVA 3WU0A 4U88A 4OLLA 3EQEA 1SQ4A 1SAXA 1UHMA 1FSHA 4WXDA 4O9GA 3CDHA 4YG2F 2O8QA 2JZYA 4G9YA 3F23A 4AIKA 3GW2A 5JSPA 3GO5A 3TOAA 1QPMA 2ZKZA 3J80Z 4WK8F 4IEUA 1HSTA 3GFLA 1ONVA 2DTRA 4RB3C 3WW1A 2W24A 4LJZF 1CAWB 2IC1A 3ELNA 2PLYA 4EV0A 4O5VA 3VHRA 4P96A 2IPQX 2EFNA 1EV7A 3CLPA 3RPQA 1A04A 3U2RA 5JHUA 5JR3A 2FBHA 1GQGA 3R4KA 1Z9CA 5DCFA 1R58A 2D93A 2FEZA 2UXXA 3REOA 4IEVA 2DCTA 4HOBA 2Q2EA 3BDDA 4MQVA 5BPIA 3SZPA 5LHHA 1GXPA 5AONA 3H1MA 2IXHA 3QOPA 1Z1DA 4D7SA 3GZ5A 4R52A 4AXOA 2FMLA 3C1DA 3C18A 5FQ0B 4GYGA 4HF0A 5KBFA 1FSEA 2YX4A 5D5WB 4HLXA 2IP2A 1G4DA 2KXLA 5K1YA 2JPBA 1ZZ7A 3WW4A 2JTVA 3KEQA 5E1RA 4JBAA 4Y17A 3J80K 4TLFA 3SCHA 1YG2A 3K0LA 2ZNZA 1AOYA 4L0YB 4MGZE 2IA1A 1OYYA 1J9IA 2V1DA 4IPAA 2IJLA 4ESBA 4Q0PA 2ELHA 5HLIA 4RAZA 2ZO4A 2UYAA 4AWXB 1R5GA 3E6CC 3RYKA 4KICA 2HKOA 1XGSA 2I45A 3KP6A 2ZCWA 4MHGA 2MPFA 2R7FA 4KN7X 2IVMA 2RV8A 2FRHA 3R61A 1BOAA 3ST7A 5CVVA 5JCTA 4A6DA 4HVRA 5I0RA 5IT3A 2HYGD 3RJPA 5FB2A 1XN7A 3S0MA 1ZAOA 5DEQA 4FX4A 4EGZA 5D5VB 2XLAA 4OIQF 3I58A 2M45A 1SFEA 4RGSA 2QUFA 2C0ZA 3KEOA 3NVCA 3K1NA 1XB4A 3MWMA 4ZYDA 5D4SA 1FP1D 1CGPA 4QX5A 2VT3A 5A2QZ 4UXAA 1O3SA 2ACJA 4HDUA 1Y3TA 4XF9A 3U11A 1KA8A 1HKQA 4L9JA 1T6SA 2MLKA 3BOQA 2XV4S 3JTHA 2QVOA 4HDVA 3CLOA 5DUKA 2WFPA 3VFZA 2BBYA 3ZMDA 2EA2A 2ZXJA 4IF4A 2L01A 3WU1B 2HEOA 3AAFA 1U5TA 2VC1A 2UY9A 4KT5C 3GUDA 4DNCA 2QENA 2VECA 1Q5OA 2X0LA 5CLSA 3ETQA 3T0YA 3KP3A 3IL2A 4ESJA 4KMFA 2PA7A 1QY4A 4L5JA 2GZWA 1BI3A 3CUOA 4TV7A 3KP4A 3L2CA 4Y15A 1CAXA 5DV5A 2G9WA 4YFXF 2PAKA 3G73A 1ZARA 2FMYA 1DUXC 2QBYA 1R00A 3F3XA 3MDPA 2O8XA 3BZ6A 1BI1A 2VC0A 4AIHA 3F8MA 3JAMZ 3KZYA 3ERED 4K2EA 1NXMA 1J3QA 2P6TA 5E8GA 1RC6A 1R1UA 5A2QK 4MEXF 4LA2A 1IN5A 2MNGA 4HX8A 3ROUA 4LEJA 1NE6A 2OZ6A 5I8YA 1JHFA 3WE3A 2V79A 4LG0A 2A68F 1LB2A 3N97A 2PHDA 1BBYA 2YR2A 2YX7A 3RKYA 3CO7C 3KE2A 1XSVA 5ILUA 3KGZA 3FHZA 3HSEA 4XSXF 2EVXA 2V6CA 2A61A 3KMHA 1ZG5A 4LLGF 3DKWA 4UVCA 1QQIA 2V09A 2ZKLA 4M73A 2PTMA 2G7HA 2IT0A 2GXGA 3F22A 4ZU4A 1YW7A 3GEZA 1R1VA 1WQ2A 1YW9A 5C8WA 1ZZCA 2Y0MA 3FM5A 4G94A 3TNPB 2RQPA 2L3DA 2D5HA 2CAUA 1QBJA 4Z07A 3HRMA 4P9GA 3OD0A 1O5LA 4HA8A 1I1SA 2STTA 2LSOA 4UBGA 1CX4A 2CYYA 1UHWA 4P9FA 2HS5A 1MJ9A 2XAFA 5FLJA 4WWCA 4IXAA 4YIIA 1ZZBA 2M5WA 5FFZA 2EFPA 4FT8A 3B02A 2OA4A 2QYOA 3T8RA 4NVPA 1T98A 1CF7B 3NEUA 5K5QA 1ZGAA 3QRFF 2CAVA 2VE9A 5JSRA 2FSWA 1D8JA 4U7BA 2ZMEA 4OMYA 4XBFA 4XEZA 4MTEA 3WW3A 1LNWA 4A0ZA 4EJOA 2Z69A 5KHJA 4ZYGA 1WWXA 5LGUA 3V8LA 1HKSA 1FYMA 4EJUA 3Q9VA 4A6EA 1FYLA 4OIPF 3DV8A 2AS5F 3I59A 1RIOH 3BJOA 3BPVA 3V4GA 1WGPA 3D82A 4E2QA 1ZNPA 1Z05A 4NQWA 4J1WA 4IRHA 3SZTA 4M72A 4R79A 2IXKA 3WG9A 4MX3A 3WGIA 3UKVA 3MYXA 5LEJA 1FZPB 4PCQA 2DO7A 3RZZA 3N4MA 2Z3YA 2FF4A 1B6AA 2PAEA 4NHJA 4AD9A 1ZRFA 3DL3A 1LKNA 4YARA 4OIRF 3FMQA 4MGIE 2GQQA 2PI0A 4QMAA 1QGPA 3P9IA 4P55A 1J75A 1X3UA 3CJNA 4PDKA 1BI2A 1YFUA 1PMIA 5FLHA 2FE3A 3C7JA 4HF1A 4E70A 4XFGA 2A69F 4MTDA 2M30A 2ATFA 1TNTA 2CSOA 5EEGA 3EJKA 1SD6A 3LWCA 2KJCA 5DCMB 4FAGA 1XGNA 1E2XA 3ISPA 2F4PA 5HDKA 2MLGA 2O61A 5FCCA 5I0SA 4ZZDA 2HZTA 3IHUA 1U2WA 1YLLA 1REPC 3UKNA 4Q5SF 1OI6A 1EPZA 5KHIA 3E5UA 4L0ZB 2GA2A 5E18F 5IT9Z 5LRRA 3QPTA 3L2HA 4WVZA 2K86A 2ZBKA 4EM1A 4HLTA 4LUKA 1W5TA 1BC8C 1UW8A 3SCFA 4OMZA 2M87A 1O3RA 2CGPA 1O3TA 2XRNA 2B5HA 3PNAA 3DP7A 4R1HA 1U12A 2PYTA 2G7UA 1X82A 1TNSA 1IN4A 1W7PB 4HQEA 5E1WA 2VBZA 3FMRA 2QZ8A 2B9UA 2L54A 5CU1A 4WXHA 2DI3A 1U6GA 1B1BA 1XDSA 3CEWA 3R0JA 5CJ9A 4HN1A 4YYOA 1CAWA 3KSCA 3DPLC 1GVJA 3FF5A 1KYWA 3IKTA 1LDJA 3MCZA 1J7KA 2EB7A 4EQQA 3L00A 2N7GA 5FPXA 1CAVB 4G7ZF 2W85A 5K8SA 4M71A 4LB6B 1MD0A 4FBFA 1Q3EA 2NNYA 1YLFA 1F5TA 2OA2A 4Q47A 4EGYA 1J3RA 5E1XA 3USSA 5IT9K 2R7DA 4LMYA 1MDMB 5F1RA 1DZTA 2HDCA 2Z5UA 4I3PA 1USTA 5FQ0A 4ZZLA 4I01A 2BEOA 4G7OF 3VB2A 4JVAA 2DPDA 1IUYA 4L9TA 4OOIA 2GC2A 2V9VA 3IRQA 5LGNA 2RGVA 3H50A 4BHCA 4GULA 4QLCU 3SXWA 1W5SA 4OFGA 3PLQA 3EUHA 3SFZA 3TO6A 1EY2A 2E1NA 1YFWA 2QNKA 3BPZA 3F8BA 2FU4A 1X8MA 1YUDA 2J5PA 3E5QA 1O3QA 2ESNA 1TQMA 4N0BA 3F21A 1UFMA 3KLNA 1R5HA 1R22A 4MV2A 3ES1A 5AIQA 1B59A 1J2XA 4IEQA 5JAXA 4IETA 3WGHA 2XIGA 3RPUA 4FAHA 3L09A 4ENNA 4NB5A 5DD8A 2OU2A 3RI4A 3HIFA 5D8LB 2Y0OA 2DPUA 2GC0A 4EM0B 4UUVA 1OYIA 3D0SA 4AVBA 1LDDA 3ABUA 2F5CA 3CUQA 5D6EA 2MH2A 3BWGA 3NSTA 5F6FA 2A3SA 4LLNA 3HSFA 2D1HA 3E3VA 4OIOF 3NRVA 4UHTA 1ZGJA 1SMTA 2HTJA 1Q1HA 1UCRA 1MJBA 2VBXA 3WE2A 1R7JA 1JUHA 2JRTA 1UPIA 4PJYA 1YHFA 4B29A 1RUOA 1W7PD 5I0TA 3QAHA 1UIJA 1D8KA 1MGTA 3RYRA 1FBUA 5LLQA 5D5UB 4IESA 2UXNA 1ZRDA 2K4JA 2MH9A 3FM3A 3WTSC 4BYYA 1BI0A 2O6GE 3GBFA 4L11A 2Q30A 3EDPA 4H0EA 3GZ6A 3ZPLA 1UB9A 1ZREA 2EJRA 4GCVA 4XLPF 4XF4A 2C6YA 1SEFA 4MEYF 2QWWA 3I64A 1Z7UA 2EFOA 1UCXA 2KKOA 4AQ2A 3RIRA 5HS9A 2IRFG 1IXSB 1PP7U 3ES4A 2LF7A 5ED4A 4EJTA 3KLOA 2OQRA 2XHKA
chains in the Genus database with same CATH superfamily
1ZZ6A 4D6RA 3Q8FA 2XJTA 4KDPA 5FZ3A 3SITA 2V5YA 1OFNA 2E9QA 1HW5A 1CX1A 2M2EA 3VDCA 1WJFA 4CCNA 4LR4A 4RGAA 2LNBA 3TO7A 1HQCA 4MO7A 1FMD3 3PIPF 2LY9A 2YU1A 1JYXA 1H88C 1TWHJ 1XTAA 2OZJA 1XSXA 2VBDA 2ECCA 3ZN0A 1C3HA 3BROA 4QXHA 5FZBA 1N47A 3WV6A 2KISA 3LKJA 5JMCA 2VNOA 5JLWA 3K2ZA 4DBRA 5FMBA 2TRTA 1I6XA 1W8HA 1QWRA 5J4VA 2E19A 3B94A 4LPLA 3RSJA 3OYWB 3JBG1 4ASNA 1AR82 1XE8A 2TNFA 3AFHA 4IHTA 3S3OA 1ZK8A 2D6KA 1LEDA 2RVCA 2DT5A 5E17F 4ZYAA 1JHNA 2CUFA 4C91A 3ZXLA 4KIFA 1GKBA 2YC0A 2AXLA 4M3GA 5JIAA 4YM3A 2EH3A 3ZIXA 3WG2A 1CZSA 2XAJA 3DXUA 2OS2A 3WDXA 1TME1 1W8UA 1JZ3A 2WV0A 4A0XA 3H3VK 4HYEA 4KWLA 1OQDA 1YOVB 3JZVA 1JYTA 1Q8QA 2UWMA 4ZS2A 3K46A 2A3XA 1K7AA 1VBA2 4YM2A 4HNUA 1VIWB 3U0ZA 1JKRC 3DF8A 3LSTA 1MBGA 2FDFA 1G3YA 3O1PA 5KC5A 5A7WA 4O9EA 4D0PA 4HV5A 1ODDA 2GXAA 2X53S 4BQAA 3DCFA 4P02B 1IN7A 4QPIA 2VVDA 3DYPA 3VDDA 4JDNA 1IZ1A 3CC2I 4IRGA 4XLFA 3SFIA 3K4ZA 3HD8B 2DYSH 1OXCA 2KHMA 2FD8A 2M8GX 3H36A 3O1RA 3VLBB 1FYKA 1OD5A 2RS52 3W5NA 2WA0A 3V8KA 1UL9A 5HDNA 2V1UA 4M74A 5DUIA 4R8HA 3JUUA 2RN7A 4AUXA 1CVNA 3Q8BA 1J0RA 2TEPA 4UFLA 3IC7A 4URTA 4HV6A 2A6XA 4IEOA 3O14A 1SFYA 2WQ8A 3WTZA 3E5XA 2WB1N 3SQNA 3K70C 3AL0B 2JWTA 3ZSEA 5FMOS 5ISLA 3GCMA 2F4IA 3Q0WA 3NAUA 1RJ8A 1LEMA 4G6DA 2BY0A 3U1KA 3WR0A 2Q8EA 3FXUA 2L9NA 3KYCB 4LIUA 5DCMA 2VUAA 3ECQA 2KR2A 4Y5SA 5J48A 2LFBA 4CEYC 4CCEA 1NA1A 5LEKA 1YHQI 2XC7A 4ZYHA 2VO5A 1X3WB 3PL0A 2VNGA 1NHAA 3UETA 5LK7B 4NIHA 4KIGA 2JG8B 2A6TA 3HWJA 1AHSA 5IP6A 1D4M1 4F8AA 3D6EA 2A3YA 1ULFA 2QA4I 1F2NA 3PNVA 3JW4A 2XGXA 5B4NA 5FO7B 2QSHX 3AYCA 4LA3A 1H2KA 5GPCA 1JTXA 3BOWA 2DBBA 5BPXA 2OCCH 3MI8A 2QUOA 1DZRA 2Q1ZB 4AWDA 2P81A 1QJFA 3DEUA 1ZBA1 4WV8A 5TGTA 4BHBA 1COV1 2EZLA 2NRAC 3M3CA 4G6TB 3E0JB 3WP4A 1CAXB 4ONUA 1CQTA 1Q56A 2BV6A 1H9GA 3N05A 3D8CA 4AR2A 2RKHA 4LIVA 4KL1A 3GTPJ 1RR8C 4XACA 2CUEA 1S3JA 3A0HC 1K45A 3P7NA 4META 4J25A 4UFJA 4DYRA 1NY72 4YZ2A 5I8SA 1TL8A 3E1F1 2XMLA 1WGXA 5JLVA 3F8FA 5ACA3 4ZHNA 4Q4ZF 1HQNA 3HBLA 3G6JB 4WM8B 4B3NA 3KP7A 1EJ9A 1YQ8A 3WTTC 1VQPI 5DAWA 4FX0A 3CZ6A 4PJLA 4BGDA 3OYCA 3CMMA 5FMCA 1H9WA 4QQOA 2DOAA 4AOCA 4P08A 3O2PE 2ZACA 3BT9A 3A03A 1X2MA 3WU2C 3KM5A 2QDRA 3ACLA 4LBJA 2GMPA 3WNMA 1OCTC 3MKZA 2A05A 1RUC3 2LR8A 1YYNA 4BM8A 2ZZQA 2XB0X 1LJ9A 2H8WA 3TEWA 1H30A 4XUQA 4Y20A 4XCAA 3TNQA 2BGPA 2DJNA 1HXS1 4AI1A 1Z7S2 4LBKA 3AZVA 1FOYA 4XSZF 1SD7A 1ZZ8A 1YJLA 2XROA 4YVSB 1X8EA 2Q5TA 2DBNA 4XTPA 4YVWB 3C7FA 4AFAA 3B01A 2ZX0A 3OG2A 4JDOA 4KH9A 2J1TA 4LO7A 4E2GA 1C5HA 1UHSA 5FP3A 3N7JA 3WHBA 4Q27A 1XE0A 3N7LA 3H0OA 1IN6A 2JDKA 1AVBA 4WBBA 1TG7A 2V9KA 2RV9A 5JHFA 4AEDA 5GTIC 4GA9A 4EMSA 3SLIA 4UY8I 1CWPA 2J1AA 3GF6A 4C3IJ 2JG9C 4AQSA 1SFKA 1BOBA 5EWSA 5A3NA 4XETA 3KHBA 4A12A 3JR9A 3BU7A 2DT6A 3GTJJ 3VBSC 2RQQA 3R6SA 2XAQA 3S6PA 4FPYA 5K7ZA 3O0WA 3ZMZA 4XAAA 2RMU1 3I54A 3THCA 3GALA 1M4WA 4L99A 4E7SA 1G7YA 2IGNA 1RUNA 5BY5A 1WMFA 3M7AA 2YUSA 3C2HA 4GWMA 2Y48A 2Y75A 3W6JB 2XJQA 3S93A 3ITQA 3KX2A 5JOZA 1W0TA 1AU7A 2WAAA 3F8NA 1FMVA 3ZOBA 5IW0A 3OR2C 3AP7A 4ZONA 1JOJA 3AKSA 3IDBB 3I2DA 2DVGA 4N90A 2A73B 5CAZA 5TRDA 1QJY3 3BG5A 3AYAA 4XPVA 5J8FA 1LENA 2WS91 2YROA 1FX5A 2QQUA 3NL1A 2D7FA 3OYEA 3EBRA 3AZZA 4HVQA 2PN6A 3LA7A 1OH3A 1UOGA 2EA7A 4Q0VA 1TMF1 4JKLA 3JRGA 1Y9QA 2H0BA 3K77A 3VL9A 2JDAA 3M70A 4N53B 1WJAA 4PK4A 4JGZB 1MJAA 2VPRA 1BJZA 4UV8A 1G8WA 4GB33 4N8MA 1DQ0A 1WZ2A 2LTNA 3H3UA 1R4MB 3HTSB 1HRI2 1MQTA 2DXIA 1RUJ3 3PSFA 3AYEA 3CF5F 3UV9A 3HN1A 2P7VB 4XRSA 3VEPA 5FZKA 2ISYA 1SFUA 1ZTRA 1TWAJ 3OEAA 4QT6A 2VG9A 2P4EA 3R4UA 2W0XA 1Z21A 4HSTA 2WT0A 4ZZ5A 4G6QA 1ZRCA 1UY4A 3U21A 3BALA 5KAIC 1POV0 2VMDA 1G2HA 4FO9A 2NN8A 2EA4A 1W8TA 5M5YJ 1PK6A 2PHUA 1JKQC 5BNQA 4QU1A 3HG9A 2XVCA 3LWFA 4KGGA 5A1LA 2VMHA 1S0FA 1WCQA 2W25A 5LRSA 1FOXA 3CMEI 1D2QA 4IE0A 2GIZA 3CC7I 2W00A 5BYNA 2XSDC 5L3CA 1WA6X 5JI9A 3T08A 1MSFC 1IS3A 2Z33A 1X1AA 4Q8KA 1IRFA 5C9AB 4I6ZA 4CZZA 1GWMA 2D44A 1LGCA 1PVC1 3UKTA 2G9FA 1Q8SA 3KPHA 5CVJA 2R1DA 4DRVA 1R1A2 1I5PA 2W57A 3M8LA 3OIOA 2DVFA 1OKOA 1SPPB 4IV3B 2ZMEC 3BTAA 3K4DA 3J8F2 3RKWA 1LFUP 1T56A 2DJIA 3T5XA 1ERDA 4LO5B 1C1FA 3OYNA 2K9ZA 5HNFA 3Q0VA 1RUE2 1Y7BA 3FJSA 4ZYEA 5T50A 1HV1A 4L5IA 5IVCA 2WAOA 4JV4A 2LG4A 2VJ4A 3CUQB 1CPMA 1W39A 3GLXA 3VV1A 4KWJA 2O3FA 1SAUA 1HKDA 3QYFA 3JSOA 5TJJA 1HRV3 1JHHA 2JB4A 2A6VA 2DW4A 1OR7A 1W5CC 4J01A 4S04A 2HWF1 4D1QA 2E26A 1C57A 3NKTA 1UYPA 3MIEA 2CV0A 1BMV1 1OOPB 4CZSA 3U78A 4ABZA 1ND2B 2K0GA 5AVAA 2BHZA 1QQP1 2FUG2 3WTWC 5A3TA 4LITA 2VT2A 3DBRB 1C8M2 5L3EA 4BQ1A 4YW1A 1QDCA 3JQWA 2I10A 4FE7A 3FISA 2PLV1 4CGZA 2RS33 2IGKA 2VVFA 1U5ZA 4DOUA 4XORA 1ASJ3 5F9TA 3BY6A 1YJ9I 4L2NA 2VN2A 2JPCA 2GXBA 1P4AA 4P9XA 1G6NA 4UBHA 3T0DA 4AGGA 3BTCA 1ULEA 2Z5WA 2YXSA 2KJBA 3WODF 2OQGA 2IFWA 1B9MA 2K40A 3GFIA 2LROA 1S0IA 5FYVA 1HX6A 1SDDB 4KU8A 1FMD1 2EIDA 2FNPA 2P4WA 2HOSA 2FDIA 1SD5A 2IWGB 2K2SA 1FATA 4EVIA 5FPZA 1ODNA 4IZZA 1K12A 3ZYFA 4GJYA 3FE5A 5A3PA 3BIEA 4C0BA 5C7GA 4IV1A 2JVHA 4GO1A 5HOOA 2E1CA 3LQCA 5C8CA 1R1TA 3BCWA 2NVYJ 2FOKA 4RS8A 5BNGA 1XE7A 4A3MJ 4WXCA 4LK1F 1QGLA 1OLTA 2DA6A 1R64A 2HVSA 4U87A 2JDNA 5BNNA 3CJTB 3LQRA 1L3JA 5EEHA 3TKYA 4HSJA 4IX7A 2YPRA 3LEIA 1NCQA 4JX5A 1S0DA 4M9XA 5ILVA 5I0DA 3ZSLA 4P9UA 5F6KA 3BC8A 4QGMA 4HPQA 2WO7A 5FTTC 2Y2ZA 3MW2A 2HFHA 4MGTA 5GZDA 3FC0A 3OYIA 5A7QA 5F5CA 3IV5A 3EMRA 3IKVA 4XJZA 1AF9A 4HSLA 2Z9OA 1FIPA 4AQ6A 2FBIA 2WABA 2Q4SA 2CS3A 1PM7A 2ZZJA 4NOTA 3I71A 1BL0A 3TQNA 4YM0A 4YGCA 1YYVA 5C4WB 5GAGJ 3VZJA 1ZRRA 3AJZA 5IOZA 2P7CB 4A5MA 5A3MA 2DVAA 3ZVXA 3HRTA 4XR6A 2ZC2A 1OKRA 3CF2A 1R083 5K7PA 3L2VA 3DXTA 4PFOA 3A23A 3GGLA 4EWDA 4AAXA 1ZX5A 3CCRI 5EFUA 1WW6A 2DFHA 3RI9A 4OUSA 5A7WB 2WNUC 2JJ6A 3U4SA 3ZQCA 4Y13A 2GIVA 5EF6A 3TB0A 3Q9OA 3BR6A 4Y3OA 3HL2A 2XGEA 5M3MJ 4XN0A 2WT2A 3Q8CA 2BNNA 3MVPA 2EWNA 5ICCA 3GZTB 1OPMA 2ZPXA 2VZRA 3QP6A 2WAQN 3B73A 4IRIA 4B4RA 2VE1A 4F7ZA 3S1RJ 3KZZA 1Y43B 4Z2AA 5C3PA 3FLRA 3D5LA 1N78A 1EAH2 3V56A 1WLWA 1WMXA 2PHFA 1PYVA 5L19A 1DYPA 3RKQA 5E79C 2RJLA 3UESA 3CJIC 5F5AA 1S2EA 1KS5A 3FBNB 4KYWA 1CZVA 3OCPA 2DTZA 3K51A 5F0FA 2L0KA 4E9KA 3GZAA 4C1XA 2CQ7A 4RGXA 1EH8A 2AH2A 1TNRA 1F15A 3O1OA 2DOEA 5JXGA 3CP2A 2DK5A 1YITI 4NE9A 3KP2A 4ENMA 3WP6A 2ETEA 3NNGA 4YFZA 3H7JA 1W6PB 1R49A 3NRUA 3OS0A 3LE0A 2ZXIA 4YW7A 2IVIB 4OHYA 3Q0UA 4XOTA 3WOGA 4GYIA 2P3KA 2P37A 4B48A 1YIPA 5BNPA 4C3HJ 3TP0A 4ZJZA 1RUF2 1XSDA 1TBXA 4MVTA 5JDBA 2AQEA 4IHYA 3T1BA 2G1MA 3IKWA 3OYFA 1D0GA 3RZLA 4JC1A 5FJHA 5K9YA 1Z6TA 1BQPA 2PHRA 3ZFFB 1T39A 1FLIA 1XD7A 2XVLA 4UT5A 3EUAA 4KFCA 5JR2A 2BY1A 5FYIA 5I8TA 4ON0A 2GNMA 3MKYB 1HKTA 1GP6A 4BE0A 2HOTA 4BIFA 3GJAA 1WJBA 4RB0A 3VWBA 1JGSA 4ZZ8A 3QACA 3PTRB 2VOKA 1P9QC 4LLLA 3IAQA 2L2OA 1VB4A 3NARA 4HNVA 1W04A 3VBRA 4QX0A 4CYDA 1V6LA 3HTUA 4IQ4A 5D8KB 2PQSA 3RWKX 1S1AA 2BVLA 3ZMUA 1T6GC 4DYCA 3KS7A 3RNSA 2HWVA 3EYIA 5JI7A 2R3SA 5FUNA 2QF7A 5LASA 1DYOA 3ONQA 3HOUJ 3AYDA 1FOKA 2VTFA 3CJXA 2W3JA 2TUNA 4COZA 3LZZA 5CVRA 5EXOA 1JI8A 3ZQ7A 1SHWB 2HWD1 4M9ZA 4WZCA 1DGLA 1XRUA 2EINH 5TSWA 4LORA 4Y20B 4TSVA 5HLTA 4A7KA 2BOLA 5KHGA 1VBC1 1D3YA 4NRMA 1SFOJ 2IS4A 1X1CA 1RHI1 1GWLA 3G71I 3IH3A 2O8QA 1SLAA 1GT0C 1ETXA 2OVUA 2P2KA 4UW4A 2WZR1 3RVHA 4YGBA 3GFLA 3OSGA 2VZTA 2Y60A 1QHGA 1ONVA 2DTRA 5CFCC 4RB3C 1YX3A 3WW1A 5C3OA 3ELNA 1MNDA 4MGSA 4NHYA 3VBFA 1LHUA 3AMMA 3JRIA 1EV7A 4CDXC 1A04A 5IVJA 3B00A 3ATGA 1TVGA 1XOYA 2LREA 1Z9CA 1R58A 2D93A 4Y5TA 3REOA 2HQ5A 3QH7A 4HOBA 4D6SA 2Q2EA 4RR3B 4YZ3A 1H2MA 1KJLA 1GXPA 3I2IA 4AVTA 1RINA 2W91A 3PFYA 4FXGB 2MSYA 2X6YA 5FRMA 2IXHA 4LE3A 3J9SA 2CUJA 1F43A 1Z1DA 3FXOA 4AXOA 5FQ0B 4D3WA 3NNLA 2HXIA 1H89C 1FSEA 4Y5Z0 1G4DA 5K1YA 1ZZ7A 5E1RA 4JBAA 3V42A 5GLVA 2VL8A 1QJY1 4GXLA 2QZ3A 1GP5A 2BU9A 3KQ4B 1UN1A 3HOBA 2K9MA 1LFBA 2IA1A 5HCHA 4HPKB 1WBLA 4RGGA 4NUBA 4IPAA 2ZAHA 2A75A 2QQJA 3S32A 1JUIA 4ESBA 4Q0PA 3E6CC 1S72I 4WVMA 4OHZA 1SANA 2FMDA 4QX2A 2MPFA 4Q1PA 3VBOA 2XPVA 4NJ4A 2YYOA 2P3JA 5AC93 3VZMA 1JZ6A 3K2AA 5CVVA 5JCTA 4DY3A 2RREA 1GOGA 4YG0A 2DYRH 1XN7A 2ECBA 3OYHA 2ZA9A 3IMMA 4FX4A 2Y0SN 5D5VB 3AG4H 4OIQF 1RUJ1 5DDJ3 1MBFA 1UZYA 1Y56A 4IHXA 1V6JA 4RGSA 4LHNA 2C0ZA 2R6QA 1XB4A 3MWMA 2WA4A 3BTZA 3C8XA 5IJRA 1AA7A 2ACJA 1PJRA 3U11A 2DUPA 1KA8A 4XYXA 2R071 1T6SA 2MLKA 4HDVA 3CLOA 4P14A 2ZXJA 1RUI2 3RZJA 2P0WA 3GZUC 3WU1B 4AIDA 2HEOA 1AHDP 3AP5A 2KPMA 2QENA 4DNCA 4EE2A 4AHZA 2VUJA 2B9VA 1PK6B 3HNBM 2D98A 3NWSA 4COUA 3I3DA 3H9JA 1VRH2 2V72A 5LZ6A 1SBEA 4RAFA 3EUKL 5DV5A 1GZCA 2W46A 3MN2A 1ZARA 4DXTA 2PX9A 1E0EA 1APNA 4BY1J 2GN7A 4GH4C 3H5AA 4PFPA 1R00A 3WQ0A 3F3XA 1LOBA 5T52A 3K7AJ 3GZNB 1R1UA 4Q1RA 4XHBA 1NE6A 2OZ6A 4IKFA 2ZGRA 1JHFA 5EJZB 4XOGA 3H5RA 1VBE2 4FI9A 3POGA 2A68F 2PHDA 3PO2J 3O0XA 2WSUA 2H1LA 3RKYA 4HT1T 3CO7C 4AFMA 4YPJA 3LMMA 3HKZN 1XSVA 3POEA 4P5YA 3FHZA 1ENXA 4XILA 4BXSV 4A3GJ 3CCSI 4XDOA 4XSXF 2W4SA 3HZJA 2W94A 1QQIA 3VYRB 2V09A 1FAYA 2ZKLA 1J84A 1PVXA 4M73A 2NS8A 2VKDA 4N4NB 1UWWA 2MABA 1WQ2A 1ZZCA 1H8TC 2VCCA 3CCQI 1REDA 1RUH3 2PJRB 3HRMA 4P9GA 5FMOL 4RHV2 2LY1A 1O5LA 3G1MA 3POSA 4C2UA 3SKVA 4PLNA 4UBGA 4EN0A 3A2KA 3LCPA 1YIJI 2C9AA 4B8EA 4P9FA 4XIOA 4X1EA 4OUEA 4UOJA 4YIIA 4JQRA 2M5WA 5FPUA 2EFPA 4AHXA 2OA4A 1WCKA 1HIXA 1CF7B 2WO3A 1ZGAA 3QRFF 2W5FA 1HV0A 1IHMA 4OI1A 5IYYA 5JSRA 3OJBA 1D8JA 1JUPA 2SLIA 4CU8A 2DA4A 4XEZA 3TBIA 2XB5A 1Z0XA 2CU7A 5FXVA 5FYCA 5D2AA 2Q1MA 4XMYA 2JE7A 1RVF3 4D5CA 2JIJA 1MACA 5FMDA 2CFOA 5A7OA 1LFPA 1WGPA 5CFDC 1QDOA 4BJ6C 1ZNPA 1ENSA 3WG9A 3H9GA 5FOBB 4BE1A 3MFCA 1FZPB 4PCQA 4NHMA 3AB0A 2FF4A 2VMFA 2O5RA 2Z16A 4FTEA 1LKNA 3TEYA 3FMQA 1XQNA 5FY5A 2EBIA 1JBCA 2K9LA 3QBQA 3P9IA 4P55A 1X3UA 5JOXA 1YQCA 5FPVA 4DUWA 5FLHA 5LY2A 3SJMA 2OXBA 1FOWA 2F6CA 4GMP0 5BNNB 1NCQB 3PMSA 2RS12 2NZ9A 1SD6A 2VAUA 4W65A 2KLOA 1OISA 4FAGA 1XGNA 1I3HA 1POV3 3B6CA 5FKBA 3HR9A 3SDGA 4ZZDA 3A4UA 2ZFUA 3IHUA 3ILFA 3OYDA 2YFZA 5M5WJ 3UKNA 4Q5SF 2BVVA 2YB7A 3ABKH 3NAPC 1SLTA 5LRRA 3QPTA 5B2GB 4CYCA 3L2HA 2K86A 4EM1A 4Y4RA 4HLTA 2FDHA 4LUKA 1MEC3 2VVEA 2M87A 4XUTA 3O1UA 1PIV3 1O3TA 5IOYA 2XRNA 1GZTA 1U12A 2G7UA 1FMWA 3I4MJ 3PJRA 1P7JA 4DEVA 2NVUB 4AC0A 1MIJA 3NO8A 2RVAA 1FNYA 2QZ8A 1Y1WJ 4MADA 3RSNA 1UJ8A 5CNAA 3MV11 4UW6A 4BJ5C 1JUSA 2XF6A 1JODA 5IYCJ 1HF0A 4AI2A 1WW4A 3KSCA 4XBQA 5E88A 1J7KA 3L00A 5FPXA 3V0BA 4RS5A 2VD7A 2W85A 4YM1A 1IOAA 4M71A 1ZBE3 4LB6B 1ULPA 1X4OA 4PLMA 4XCBA 3M3EA 2NNYA 1H2LA 4J6GA 1VPHA 3WG4A 4LNVA 5HCAA 3WG1A 3CZJA 1WJ5A 1SCSA 5IT9K 4HEA2 4A7YA 5DS9A 3BR1A 3KQRA 2HDCA 2A6ZA 3WG7H 2BOIA 4MGQA 1AX2A 2BEOA 2YBSA 2VH9A 4QPGB 4L9TA 3H50A 4BHCA 4GULA 4BQNA 1A6QA 3EUHA 2JDZA 2WNVB 4M3DA 5D21A 3EXUA 2DFFA 2XWBB 4B3AA 1LCLA 4DY5A 2DDBA 1X8MA 3E5QA 3FK7A 3ZFEA 3I2JA 5FUIA 5A32A 4KWUA 3F21A 1X1DA 1R22A 4UAPA 1AR63 4MV2A 3CDIA 2BUKA 3S16J 5AIQA 2G19A 2KA3A 3V65A 1UX6A 3RZMA 3VB9A 1UOFA 3L09A 5LFAA 1WCSA 2JDUA 1IG0A 3RI4A 3HIFA 4FSJA 1GVDA 1ZELA 2GC0A 3MLJA 3VHPA 4UUVA 1OYIA 3WCSA 4KG0A 1PMJX 2QCOA 4LLNA 1NKGA 1PO22 4UHTA 3EYPA 3ZR6A 4IE6A 5DAPA 3VDAA 4INDA 2VBXA 3DGTA 2LY2A 2E31A 5HODA 4PJYA 2B7EA 3PU3A 4UF0A 2ZGLA 5I0TA 3WD5A 1AR81 5LLQA 1C8NA 3VYSB 5D5UB 4IESA 5E3NA 2R92J 1QOOA 3DPRB 2VTXJ 3BN6A 4CP1A 2YG0A 2HXOA 3CQZJ 3WTSC 3GBFA 2Q30A 3AMQA 2AXTC 2L9RA 2FD5A 2ZXWH 2EJRA 2ARAA 4XF4A 1MEC2 2KKOA 3ES4A 4CUGA 2LK2A 3WLUA 2XHKA 3CJRB 4K3UA 1Z91A 1KU3A 2RG4A 4C0HA 5HLGA 1VBA1 3LSDA 4C3JJ 1NLSA 5HDGA 1WFXA 1MVQA 2WO1A 3OIQA 4FOYA 4II2A 1O8SA 1ZG1A 2V7FA 1OCZH 1U3EM 4QKFA 2BW3B 2VXRA 3IWZA 3H9QA 2VJXA 5CIRA 4LBQA 4XLEA 5A1FA 1YIOA 3WF1A 5F8PA 1O4YA 1PZ9A 3LIHA 2QVSB 4LOTA 4B47A 4ITVA 4ETSA 5DYMA 2R5ZB 2P8TA 3M1HA 5APAA 2F6BA 3TEXA 3VOEA 2BHYA 4M3EA 3SCGA 4IJAA 2CWSA 3F72A 2MFZA 1QVUA 5GLWA 4LK6A 1YI7A 1LQ1A 3CDZB 2LALA 1W6OA 4G3YC 3I3EA 1KITA 4EN6B 5HS7A 1PO11 5KHHA 2MC3A 5K4LA 2MEV2 4FE4A 2C6SA 1BA5A 3P9KA 4X6RB 4HW0A 1FT9A 3VBFB 3VBHB 4GFBA 3G3ZA 4LFUA 4IXLA 1AYN2 2BXZA 1XSRA 4JRAA 4D9JA 4RLQA 1NCRC 2KRHA 4RM3A 1ZZ9A 2E53A 3KP5A 2XJRA 2Q2EB 3K70D 2R062 4HETA 1HJFA 5IFTA 1AKHB 2ZFWA 3KD4A 3CMYA 3GZEA 2YFUA 3CDLA 4XMIA 2L9SA 3AZXA 1SZBA 3ZXSA 3PQJA 4OUMA 3M1CA 2DTWA 4AYUA 4CDUC 1RYYA 2VMGA 5A7SA 3HUGB 3KT1A 4O65A 4JGYA 4IHVA 1OCPA 1RZ4A 4G4FA 3J26N 3VZKA 4CDWC 2Y26A 4BS9A 1XNAA 4S2GA 4D7TA 2XB6C 3WY6A 1LE8A 2WL1A 4AEMA 4ZC3A 2G4IA 1B4AA 2HWB3 2VBWA 3J7AO 4V2VA 5IVYA 2A6YA 5JZGA 4MQ9F 1NY71 3VBOB 3M1EA 3KFWX 1IGNA 2J5OA 2HWC3 4HF2A 3OTFA 3K3NA 1GOHA 3MZYA 4KJZA 5DDJ1 4FPJA 3KZ4C 1HBXG 1NQDA 4JZRA 2BBAA 2PHXA 2Y33A 4KN4X 1EUTA 5D8AA 1RKWA 4WM7C 4LULA 4FQGA 1VQ5I 3KZIC 1RI7A 4KQ7A 5KR7A 3CF6E 1DHKB 4PZJA 5C33A 5EP9A 4XLCA 1USSA 2R7OA 4EJVA 2ZS6B 1I6HJ 2FZ1A 2OYZA 3FHIB 4BEHB 3CMGA 5FY4A 2Z42A 3JRDA 4IGQA 4E7IA 1IC8A 3GTMJ 2ZGSA 3JRCA 1ETVA 2FQ4A 2J1UA 1T38A 4ZKTB 4KMUX 4XK4A 4CP2A 1WSUA 1OC1A 3J7ZI 2CRGA 2BFUS 1HLCA 3ZN6B 3OS1A 1QVTA 4BMEA 4FFGA 3S30A 3L9FA 5DUUA 4LQRA 5K0UA 4TTGA 2P5KA 1Z3YA 4HKLA 2PHWA 1VBB3 3TN93 3BTXA 2XUBA 3NW4A 1UZZA 1D1BA 1EA3A 1E57A 1GANA 1AYM2 1UOBA 4PCRA 4HK9A 1ZHFA 5CKTA 1DGWA 5C4XJ 2BP6A 4XJWA 3Q9SA 4YFNF 4E7JA 3SHFA 3OYJA 1DGRA 1GZWB 3PURA 2GNBA 3K1PA 1CAVA 4XFIA 1FTTA 3CIHA 3ZXGA 3UL2A 1T95A 3BR2A 1APLC 2ET7A 3B3QE 3FHQA 1OQYA 2CH0A 5A3OA 4FHTA 3LFIA 5E6HA 1DPUA 1BIBA 4CH7A 4AYBA 2K4BA 1XPXA 3SZGA 1KFXL 3ACHA 4YSFA 2VULA 1MVEA 4PT6A 5EJ3A 2B8MA 3FXKA 4YZ1A 4LTAA 2P5LC 2UU8A 2PEXA 3VPRA 5FZAA 5DQ0A 4HQMA 1ENRA 3BZCA 3H1YA 3ZQLA 2UWBA 3SKJE 4L18B 2DFEA 1F4KA 5CISA 3WW2A 5FKNA 2W1WA 4LXLA 5L7OB 5FRNA 1G8XA 3L2WA 2QCSB 2VOWA 5AVPA 3PU8A 2LRPA 2COMA 5JXHA 2MBFA 3LF7A 3DWLE 1LGBA 2R4GA 2M7AA 4L8QA 5CPRB 2ME0A 4NHLA 3UGHA 3P5BA 4KGQA 4I0AA 5IK7A 1U78A 3I2FA 3QOEA 1VQ6I 2IA0A 3HPHA 4N9IA 3VUOA 5AFEA 2P3YA 3U1DA 1PUFB 4B7EA 4ES9A 2YGLA 4A0YA 3GFMA 5H6QA 4ENJA 2GP5A 5C71A 2NVTJ 1AR93 3I5UA 3H9AA 2QM3A 4XC9A 4LD5A 1LOGA 3TO9A 5JI6A 2D5VA 2OPKA 5HVQC 4RQPA 3P3PA 2DFIA 4XLNF 1D0YA 3HOXJ 2RDQA 1VAKA 1W9SA 1NZIA 3UYJA 1GNYA 3ON7A 1DZQA 1NUKA 4Q4W3 4BWOA 5IPAA 2W82A 4YRVA 3WNOA 3OF1A 1B8IA 5BMZA 4U0VA 4XOPA 1LOAA 5FYHA 1RMU3 3TDUC 4MO3M 4XUNA 3GWZA 3HRSA 1XNCA 2WQ4A 5FROA 2PFBA 2BRTA 3ZXKA 1VJ2A 2D1VA 2H94A 1HOMA 2JJ7A 3ZRGA 3ZN1A 1DYKA 2MHFA 5FLMJ 2JRMA 2A5YB 3OUIA 2COBA 1V6NA 5FLIA 4XHXA 5C6CA 1QRYA 3LOCA 1GICA 4DGWB 2BJSA 3E6DA 2K3PA 5CYVA 1POV1 4PDWC 3TN92 1IW7F 2Q0AA 2E7AA 3JREA 4NIAA 1W8ZA 1U5TC 1FV2A 3PMEA 2FDKA 1XU1A 4FP3A 4UV9A 5FD6A 1PIV1 4DZGA 4EWAA 3JB4C 1PHMA 4Q4V2 4CYCB 4QM8A 4BUPA 4ASMB 2X6OA 3H92A 4OYUA 3OYWA 2XKOA 2R5YB 5M0TA 1GDTA 3G1LA 2ERFA 3S7IA 2D43A 2FX0A 4NPRA 3K4JA 5KC6A 1R1A1 1N25A 3CJIA 5BNOC 4LBLA 3KCCA 4LKFA 4F52A 4JQTA 3JBG3 4AVCA 1HB3A 3H1CA 3ZCOA 1LVAA 3PTYA 1O7LA 1V9U2 3IAS2 1F5FA 3J8F1 3K4BA 2K27A 3JU9A 1W9YA 3M9AA 2IFRA 4QPYA 1NE4A 3EB7A 4ET7A 1OCCH 2RE9A 4CEYB 1XMKA 1HDPA 4IEZA 4XRFA 5A6QA 1RUE1 2CSGA 1FPN1 4BPZA 2XASA 1TME3 2VXJA 3BG6A 4XFAA 3N7MA 2R1BA 3UJOA 2GLOA 1P6RA 2JD4A 4RGKA 1WCDJ 1U8BA 3CESA 1MS4A 3POBA 1S55A 2VE8A 4JDMA 3PVEA 2QQBA 3GFJA 3JSPA 2X5IC 3R0RA 1JXSA 4PHZA 4YGDA 5J8CA 1ZYBA 3NJZA 3P9CA 1ULDA 2WNOA 1YE9A 1B9NA 1ZKGA 1JT0A 2E7XA 4LKEA 1LTEA 2HEYF 1K5JA 3F2ZA 3WGGA 1VI0A 2GAUA 1OVPA 1Q8PA 4G8XA 2XPJA 5FLXK 3KHCA 1LPQA 4BNCA 1AR61 5E20A 1LU1A 3SEQA 1H9TA 3OYLA 2W2IA 4P9YA 3ZFEB 2IXIA 1BJQA 1W3VA 2BE5F 1VQKI 2ICWG 1AL23 1TE1B 4B7KA 2GWRA 1K78B 3H5NA 1ZVFA 3FXRA 3A21A 1RC9A 2GA1A 1ST8A 4Z82A 5JVVA 5JLXA 1OKQA 5DABA 1KU7A 1POQA 4E7ZA 2O0YA 1PZ7A 3UGFA 2Y31A 4QPQA 2HVRA 2CQQA 2FDGA 5H20A 5E3OA 1G9CA 3D5OA 2EV5A 3H0DA 2RHPA 5L36A 2ZTNA 1G3TA 1B35C 4OINF 1GR3A 3IMNA 5CADA 1IPJA 5A70A 3AVRA 3H8UA 3N9LA 3BIWE 3FFQA 2HWE1 2JG8A 2GC3A 2CGNA 1J1TA 4AE2A 2F2EA 1PX4A 1S6LA 1D4M3 4BQXA 4CHUA 2CV6A 1HDDC 1UMQA 4D94A 4GMP3 2HBUA 1TW3A 1FI2A 1ZYRF 1LODA 2Y9ZA 2Z99A 5D1IA 3J81K 3BB6A 3HMYA 2YSRA 2ELJA 2LKXA 5HV4A 4A2UA 1KXGA 3K1MA 2RDSA 2OD5A 1X7NA 4ZXEA 1COV3 4UW5A 2XL9A 5FPBA 5SV5A 1NYWA 5CFCA 1RUG2 3V7CA 3VL8A 1XCVA 1VQ7I 2PFWA 5GAHJ 4DEQA 5FK7A 2KZVA 4L97A 3DXJF 3S5AA 2ZJPF 4MFEA 1VTNC 3HPNA 3K4NA 5E8IA 3K4CA 2HPMA 1V6MA 1UAIA 1NAEA 3X2QH 2JG9B 2A7AA 4WM8A 3OY8B 2Q8DA 3M8FA 4IOAF 2EXHA 1BBT3 2YC2A 2D40A 3RKXA 1D5YA 3VBSB 5BXXA 1SCRA 1EYBA 1OFSA 5J6XA 2QQAA 4CUBA 1R5ID 5D4RA 1JOBA 1GOFA 2VQLA 1P4XA 2E71A 4BKXA 3ZQFA 1W05A 4YRDA 1W4MA 2MGQA 2DQLA 1OQ1A 4NC7A 2VZUA 4I09A 4CDQC 3TP3A 3POWA 4IQJA 1W90A 3NNJA 1CZTA 4YG3A 1NZCA 4XNFA 1EAH1 1G86A 4QDQA 3CCJI 1R093 5LBFA 2KIFA 5F32A 5CB7A 4UUSB 4NWWA 4KA4A 3RPUD 4TLGA 3CQOA 3I2OA 1MMDA 1U8RA 2A70A 1FIAA 2W92A 4YVSA 2M1BA 1W7PA 4YZ5A 2DUOA 5AIPA 2K02A 1HXS3 4YVWA 1Y1VJ 3AX4A 5L3BA 4DMIA 3LFUA 2AEZA 3ZXJA 4H14A 1ZG3A 2ILMA 2M0MA 5CVIA 4MXVA 2VZSA 3ZFGC 5HXVA 1KQ9A 3ZXFA 2FQ3A 5FZ4A 4CP0A 5FKOA 1V4RA 4UW3A 3WSOA 3CHXA 1ODMA 5KAFC 3HEFA 1W06A 2QBYB 1ZLJA 4AHWA 3FL7A 4E7HA 4COVA 1EV11 5T3NA 2HYFA 1S7AA 4Q0UA 1BIAA 4XF0A 3ZDVA 1O5UA 4DZPA 2V1NA 3BLYA 2WT1A 1GYKA 1DBNA 4SBVA 3AXDA 3K69A 4ZXKA 4O3MA 5KK1A 5LWBA 2DQRA 4LG0B 1ENHA 1LU2A 4FPFA 2BGOA 4DOZA 1UU5A 2Q8KA 4RBOA 1OA2A 5DM6F 3MO4A 2RMU3 1IPKA 1YNAA 3GNEA 3MFAA 1VQ8I 1DQUA 3VODA 3JD72 2RC4A 1MS5A 4AFCA 4QQPA 3KCYA 3LAGA 4IEWA 5LGTA 1FOD1 3AVSA 1H4GA 4MH0E 3OL3A 4ITCA 5FY0A 4FPOB 5KCMA 4GH4A 4CCCA 2OT7A 4LLOA 5EYRA 3DECA 4CPBD 5KXDA 2D97A 3I0TA 3POFA 3ML6A 1K6OA 1YQ5A 2XVGA 1OOPC 3I2HA 2YGMA 2J22A 2D5FA 4GZ9A 1ZBA2 1COV2 1WWYA 5IWFA 2W84A 3C2GA 2DMPA 1WH7A 3HOYJ 4A3IJ 1FX7A 1BC7C 3C3WA 4EEFG 1AJOA 5B3SH 2VI6A 4F3QA 4N53A 2P3IA 4JGZA 3BUCA 1IXRC 4JHTA 3OV8A 1YO5C 3AMNA 1UU6A 1O7FA 4UNOA 4C90A 1YFHA 1STZA 4IHWA 2ZMEB 3U9GA 4H7LA 4HX4A 3BODA 3S8PA 1HW1A 1XNBA 1SEUA 1UKRA 2GOMA 3JCIA 1FNZA 1UZWA 2VJIA 4B1LA 1NLQA 4XJ8A 2ORZA 4Q0SA 2VY0A 4V1PA 2XAUA 3RZDJ 2XLGA 4WX9A 2JMWA 4I30A 2P6SA 5EEAA 1XU2A 3HHHA 1TQPA 4XFCA 1EUUA 3GTOJ 3WUCA 1DGWX 2MD5A 1GV9A 4HX7A 1ALYA 4QD2A 4QB2A 4HLYA 4PI2A 1NG0A 1L3LA 1QXRA 4LE4A 2L02A 1ZLKA 5B5EC 4KITB 2WN3A 4OI4A 3LSJA 1JZ2A 4JTOA 2HQNA 4QPOA 3I4PA 4U7DA 3K9TA 1XS9A 5C9AA 1F9NA 3LSHA 4M3CB 2ES3A 2WFF1 4BB3A 4HN0A 1CIWA 5CFDA 5FZ1A 3K4MA 2RNJA 1N3PA 1FXZA 1SPPA 2LH9A 1CD3G 3W9AA 1N1TA 5I93A 2JUCA 5FZ7A 1DPRA 1S7OA 3M4OJ 1HB1A 3V8JA 1XSQA 3U37A 3J7HA 3ZQGA 1W99A 3C7EA 4IEYA 1LHWA 4IOCF 2VKHA 1RTVA 1XB9A 4OMCA 4OLLA 2VR4A 4QPIC 1UHMA 3CCEI 5A3LA 1JYVA 5E3LA 3VDDC 3DBLB 3CDHA 4YG2F 2JZYA 4G9YA 2DDAA 4W50A 4GJZA 5JSPA 4LKSA 4WK8F 3J80Z 1R71A 3HJRA 2X1CA 2W24A 4LJZF 1CAWB 3VHNA 3VGIA 2IC1A 1AXZA 1MZFA 2Y8KA 4EV0A 1VE0A 3F95A 4P96A 2IPQX 5LA0A 3NV2A 3PIJA 3ZSJA 5IVBA 3THDA 3FKIJ 5EG0B 1QJX2 1Y8RB 5DCFA 1WBFA 2UXXA 4IEVA 2DCTA 3AJYA 1F35A 2IGOA 2YU9J 3AMPA 3SZPA 2WS92 5FFOC 5LHHA 2UV1A 1ND2A 3ESWB 3QOPA 3B69A 4D7SA 4FOQA 3NWKA 4JX4A 2FMLA 4H2AA 2W68A 1X9PA 1T2XA 5D5WB 4HLXA 4MHRA 1LOFA 1NA1C 2IP2A 2KXLA 3J7MA 1FEXA 1TMF2 1RUI1 3WW4A 3VDBA 4P1WA 3OYAA 2R7TA 3KEQA 4YZ4A 1UMIA 3FXMA 5FZ8A 4XRMA 4DXSA 2PLV3 1F36A 4ARYA 3K0LA 2B63J 2WNUB 3MLLA 2QZ2A 1OYYA 4FPGA 3ZKYA 2K85A 2RR12 2IJLA 5K7HA 4K9SA 1TNFA 2UYAA 4AWXB 5JOYA 3RYKA 4E7LA 2HKOA 4W1UA 1W2AX 5JPNB 4OZOA 1UY3A 2IAIA 2R7FA 2IVMA 3R61A 2FRHA 3H3LA 1BOAA 2JA7J 4I3GA 3K6GA 4HVRA 5I0RA 5IT3A 4DW6A 2K9NA 5DEQA 4QHZA 4IE5A 3QD6A 1IQAA 2M45A 3OGRA 3NVCA 3CJIB 5D4SA 1FP1D 4CVUA 1CGPA 2VT3A 5A2QZ 1A35A 3UNGC 4UXAA 5IK8A 4XKVA 4DUVA 5DUXA 1NT0A 1E3HA 4HDUA 1UX7A 2KZGA 4B4CA 1HKQA 2CY6A 2WNEA 3VDXA 2QE3A 3BOQA 2ZX4A 2WFPA 3VFZA 2BBYA 3ZMDA 2VZPA 3MKWB 1UO9A 4YFWA 5C4WA 3AAFA 1WPKA 2XDVA 3E7LA 3URFA 4FISA 2X0LA 3KP3A 4KMFA 2YBKA 4MLOA 1PVC2 3CKHA 4RHV1 4S2HA 5JIUA 4L5JA 1KQRA 1BI3A 2R7XA 4XW3A 2D6PA 3BI3A 3KP4A 4Y15A 4GWIA 4YFXF 3V0AB 1GNHA 4CXWA 1WCMJ 3N36A 3TW7A 3DLLF 2Y34A 1MW7A 1PM4A 2VC0A 3FLPA 3JAMZ 5L9VA 3KYLA 3ERED 1Y9MA 4K2EA 5FV3A 3MMYB 2QKLB 3OD4A 4D5FA 4MEXF 4LA2A 2NPIA 3ROUA 3WE3A 2V79A 2EAKA 3IPVB 5A3WA 1LB2A 1BBYA 3FMGA 3ZIWA 5KWRA 1VAVA 1VMHA 1DU6A 3I49A 3KE2A 2VUMJ 1AL21 1WZXA 3WDWA 1MMAA 1BEV1 2V6CA 3TOJA 2A61A 3FXLA 4LLGF 1PGW2 3DEWA 2HWF2 1SVMA 4GAZA 4AGVA 4AEDC 2PTMA 3JRHA 1M1EB 2IT0A 4ZU4A 2WKKA 3IAM2 2V4JC 4M00A 3FM5A 4G94A 1QQP2 3TNPB 2E33A 2RQPA 1Z67A 2L3DA 5LBEA 1UZCA 5F3EA 3A0BC 3BR0A 2GBYA 3RZGA 3KWVA 3WQ1A 1W36C 3VKNA 2GN3A 4C1WA 4HA8A 2PLV2 3TEDA 1I1SA 2STTA 2ZX3A 3GM8A 1W6PA 5GTHC 2DCKA 4II3A 3S14J 2RS11 1LUJB 2HS5A 1MJ9A 2XAFA 5FLJA 2B39A 2XVKA 5FFZA 2I5UA 2GP3A 3AK0A 5A80A 4GMP1 2VPLA 1SVLA 1N3OA 1NOVA 1JZ8A 3T8RA 3G1OA 1IDYA 2BPA2 1FMD2 3ERMA 2FSWA 4U7BA 3MF9A 5E8AA 5HNHA 1CJDA 4ZY9A 2VOVA 4EJOA 3ZFFA 1F9KA 5KHJA 4XQDA 1WWXA 3V8LA 4EJUA 3G6EI 3ZMOA 2JE9A 4BQOA 2JDYA 1FYLA 1W3XA 4Q4X3 1BK0A 3DV8A 2AS5F 1S0JA 1RIOH 3BPVA 3V4GA 5CFCB 1WCUA 4E4DX 3VZOA 4J1WA 4R79A 1IV6A 4YW5A 2DYCA 1MR5A 1WLCA 2KDOA 4CDXB 2DO7A 1BBT1 1O59A 3THTA 1D1AA 5J40A 2CJJA 4AD9A 3GTGJ 3DL3A 4HL0A 1MQTC 4MGIE 2VUDA 2UUZA 3ZKUA 2EIBA 4M0NA 1BR4A 1PMIA 1SVOA 3ZSKA 4E70A 2A69F 4MTDA 2M30A 1JS9A 2ATFA 5EPAA 3HOWJ 3WNNA 4CDUA 1TT5B 3LWCA 4NR1A 5C3EJ 1E2XA 4IQPA 3JRAA 4A42A 4C9YA 2VKVA 3T30A 4COWA 1R091 5I0SA 1XX5A 1ENQA 1U2WA 1REPC 5H9QA 1ULOA 1EPZA 3LSEA 3W2AA 1PK6C 3R4SA 1BK1A 1SBDA 1W5TA 2YBPA 3ME2A 2HWD3 1E3PA 4JKKA 2A6WA 1IRZA 4V2FA 3WDYA 2B5HA 3J7LA 3DP7A 4JRLA 3PNYA 4YEJA 4AK3A 3O8HA 4RFRB 1IN4A 1W7PB 2NOGA 3SDBA 1Q1VA 1VBC3 2GALA 5JUVA 3W2VA 2HLEA 2XSJC 2B9UA 4WXHA 1RHI3 1U6GA 4YYOA 1S0GA 1GVJA 3S1NJ 2HH9A 2WZR3 1LDJA 3DYOA 2X9DA 4BQ5A 3HNMA 5IUQA 1S4CA 3K4LA 4G7ZF 3GHMA 5K8SA 3CLQA 4QX8A 1UG2A 3HDDA 5B66C 4QU2A 2DUQA 4RR3A 1PO21 4Q47A 2X48A 1KDKA 2DMUA 4ANJA 1J3RA 2P6HA 3K2OA 3WDUA 1MDMB 2GM4A 4BMBA 1DZTA 3CCMI 1ETWA 2Y6GA 3PJQA 2BY2A 1A34A 2Z5UA 1USTA 3NJYA 1S0EA 3POIA 5FQ0A 4G7OF 1IGOA 1OVSA 4OOIA 4XKCA 3RG0A 4QLCU 1W5SA 2IVJA 4YW2A 3PLQA 5J36A 2CMPA 5F5IA 3HGYA 5KHDA 2WWJA 4XUPA 2I8DA 3BPZA 2VOXA 1OR7C 3F8BA 4HPKA 2FU4A 2CDPA 3ZSMA 4GH4B 2LOOA 2FJ1A 3BG9A 1IKQA 1O3QA 2J1RA 3T2TA 2ESNA 4GQ7A 1TQMA 2WY8Q 4N0BA 4DIQA 4E4SA 1UFMA 2DFCA 3BTYA 3G4SI 2QSFX 1HC8A 4XBLA 4K8RB 2HBTA 4ZTJA 5IYBJ 1IS6A 2WQZC 4IEQA 2XIGA 3PSIA 2GMEA 3ZQQA 2R7SA 4FAHA 1HA8A 4ENNA 5A33A 2NQYA 4XZPA 2ID6A 4NROA 2OU2A 3RI8A 2ZXQA 2KDZA 4M3CE 5ACA2 1GZ9A 2Y0OA 1KD7A 3ABUA 2PN5A 3A01A 3BWGA 3LSKA 2A3SA 5F6FA 4AEKA 1XMXA 2D1HA 4OIOF 3WVJA 3ZYBA 3OY9A 1MJBA 2C9KA 1TT0A 3N9NA 1JUHA 2JRTA 4BQ4A 1YHFA 4F83A 4GKXA 4IV1C 1MGTA 4QWNA 2R041 2EPFA 1FBUA 3T4HB 4B4PA 5A6YA 1H8TB 5C8CC 4PF1A 2K46A 4O7XA 1MMNA 2R073 3WXPA 1NXD1 2MH9A 3WF4A 2ZEYA 3FBMA 5EV7A 1RUC2 4AEJA 3EDPA 2ZXHA 5B4XA 2MEV1 3GZ6A 4QPWA 1NCQC 3AP9A 1W0UA 4B4QA 5M5XJ 4GCVA 2NVXJ 3AXEA 2CDOA 2YUEA 1UCXA 3I64A 2EFOA 3KF5A 2HWD2 3RIRA 5ED4A 1AYN1 1U0AA 4EJTA 2OQRA 3G7DA 1GQHA 1CQ9A 2BERA 3MGUA 4FETA 4Q4Y3 1O91A 2VC9A 4CZCA 1AR73 3FWEA 1RHI2 1JUMA 3OB8A 4XM3A 3GXOA 4A5NA 4D8MA 4DJAA 3DKQA 1XC5A 4DXRA 2EAAA 1YI2I 2ME6A 3T0BA 1WJDA 5F08A 5CFDB 2DLLA 3ZPYA 4YW6A 2R7QA 5KNLA 3RMYA 2VB6A 1ITYA 2D3RA 3RQIA 4C8DA 3QU6A 3U07A 3WTYC 1WKMA 4B09A 3JXSA 1SFXA 3BGAA 3MQ0A 2AC1A 2Q1FA 3AG3H 1URXA 2HVQA 4BQ3A 1HDKA 5FP8A 3AKZA 4RA2A 1FNNA 1FY7A 4CO8A 1GXQA 2ZNYA 3ZQHA 4R4XA 2PJRA 4FCYA 4OULA 2XJUA 1WKYA 3I56I 4KBZA 2LF8A 5GALA 2VBPA 2OUMA 1YX5A 5T5LA 2QKDA 1XCBA 2V73A 1WI3A 1QZYA 1QJY2 4HKOA 3B9CA 1MS0A 4NPLA 3C7OA 5A1AA 1CF7A 3NAPB 5EQUA 1CN1A 3ZYHA 3Q5FA 2HPIA 3OYMA 1FTZA 1T0FA 4BH9A 1LRHA 3KV6A 3GCXA 5LA1A 3O3KA 2WWYA 3IIIA 1FBSA 1KGSA 2Z2SB 1ZQ3P 2CUZA 4XXPA 5DPNA 4XKWA 3CU7A 4LBOA 2X8KA 1OLME 1LKXA 2VMCA 3KV9A 1ZM1A 4CCDA 4LMFA 4X0GA 5F3GA 3I4NJ 4RAGA 3VBUC 2VQ0A 4GB32 1X36A 3RJRA 1V5GA 3AG1H 1P2FA 2CHHA 2F4LA 5FD5A 2MYSA 5H9RA 4BQWA 1IZ3A 1RUJ2 4N43C 5BNPC 5C70A 1AYM1 3ZXDA 1STMA 4URAA 5FYUA 4XJUA 4XDPA 4YNIA 1JYNA 5F39A 2UWAA 3J7NA 4PJ0C 4QHOA 1YJNI 3HT2A 3R60A 3HOTA 3LA2A 4A3LJ 1ZRIA 2OQ6A 2W1UA 5A7PA 5EGOA 4XAEA 1O4XA 5BOXA 3PVNA 3MAJA 3GVAA 2VPVA 3VHOA 3JAMK 4I76A 2JVGA 2WINB 4GGGA 3GF2A 2PXJA 4BU2A 5F2WA 4QXKA 1C28A 3PM1A 2RDRA 3MIBA 1D2SA 4C2MJ 3WTVC 4RMNA 5EZWA 4CU7A 1TQ5A 1SMYF 3VBRC 3FFZA 2ETHA 2YU2A 2E2IJ 1KU2A 4MZUA 4JK1X 2DA2A 1E17A 5CQGA 4Z92B 5FKKA 1IRGA 2ZSHB 3I9V2 5LHIA 5E1ZB 1VQ4I 1W8NA 4A6SA 1A8MA 2RM23 2WWSA 4E7KA 1QXJA 4RLFA 2PMHA 5CYYA 4LGWA 2R0HA 3HEIA 4M6YA 3LDRA 2XWJB 1H4HA 3OBZA 4AFBA 1B35A 4Q29A 3F8CA 5DDGA 2B42B 2G9ZA 2ZGOA 1XGMA 1UKGA 3MW3A 2RDPA 1OQEA 1LEAA 2MD0A 2AO9A 4CXFA 1LAJA 4QDRA 1JU3A 3LAPA 3WHTA 2ZHNA 3GTQJ 1K6YA 3HHGA 1SG3A 4XONA 3KT7A 2D2WA 4MOAA 1BW5A 1HRV2 4LKDA 5HI0A 3EHKA 3BQYA 1OLRA 4QPGA 3W59A 4W6XA 3DCQA 3GDBA 5FZDA 1W03A 1Y6IA 2LD5A 3MFKA 3EQLF 1IS4A 1RGSA 5L3GA 3ZMTA 2WNVA 2G9GA 3VBFC 4WF2A 3ZYGA 2KIMA 3LQQA 4HNTA 3DLAA 4EZHA 1L7RA 2FXAA 3HT1A 4I7HA 2A5WA 4ENKA 3THPA 2DU0A 3L2QA 3BJ6A 2LC2A 1OYWA 1I9RA 4CXYA 1X50A 2R7VA 2CV2A 4BLJA 3OPZA 2H27A 3POJA 3BPXA 3CCYA 4UFKA 2RS32 1IAWA 1B09A 4PJJA 5C4JJ 3B9IA 4PJNA 1ASJ2 2VQTA 1S0BA 3L7WA 1QJEA 4FPEA 2XF7A 5GPAA 4CUAA 3NNMA 4FCAA 2EV0A 3GMEA 4RFT0 4LB5A 1YC61 3VYUB 3COAC 1DGWY 1U5YA 4ORFA 4EJWA 1GLHA 2QQKA 4HVOA 1TWCJ 5FYSA 1MZBA 4R9CA 4HBNA 1J58A 3F6OA 5IAVA 1MMGA 3BQZA 3D0JA 1BN5A 1RNLA 1EPWA 4Q4V1 5GZGA 3HYIA 5LCWL 1UU4A 4LK7A 4Q4X1 4K1YA 2VGDA 2NNNA 1WI9A 5FJ8J 2PJPA 3ECHA 2CTVA 4BHPA 4IEPA 2JN6A 3C2BA 5FZFA 4O6JA 3OOUA 1K5MC 3DPRA 5LY1A 2D3PA 3VBOC 1AR83 2EIKH 4COYA 2OUJA 4XQ4A 1GBGA 4QM9A 5LD2C 2YU3A 3IZOA 4QGLA 2OQ7A 4YW4A 2BWCA 1KS4A 4F91B 1JZ5A 2VOPA 1NCRB 4XJAA 1VRBA 3PQKA 1WJCA 3N9OA 1VMFA 3W2WA 4EJRA 1GNZA 4ZPIA 2OTLI 1VBD1 1S5LC 2HU9A 2X4HA 4M6XA 3RMXA 3RQ4A 4M3CF 1V55H 1YEWA 2FBEA 4CDUB 1R082 1VBA3 2WN2A 2WC2A 4XFFA 5DAVA 1YRNB 1GQPA 4BXFA 3VD5A 2WYFA 4PQ9A 2BW3A 1NQJA 4CDWB 2ID3A 2X09A 4HG6B 4F93B 2NVQJ 1G3WA 2QQVA 4CICA 2R5ZA 4PGHA 2E5NA 1U5IA 4AIJA 4QKBA 2LP0A 2BNOA 4G9SB 2X85A 4CE8A 3W6VA 4AVAA 3BCBA 2RS53 1DQ4A 2VMIA 2E36A 5C5UA 2OIIA 5IVEA 4MUVA 3OR1C 2JQ7A 5ERIA 2JKXA 4NRPA 5GP9A 4OHXA 2XQXA 3A02A 1RR7A 2IA2A 5BUVA 3O7OA 1V6IA 4ZDOA 2VOTA 4XDQA 1QMJA 2JA6J 2RJKA 2XAGA 3HQUA 4V2GA 1US2A 1PO13 1XMAA 3VBHA 4MYEA 4WM7B 1UNBA 2A6EF 1IJWC 1LGNA 1PGSA 5FZOB 4XLAA 1OHFA 5C3QA 4E2SA 1AKHA 4B8XA 1B72B 4MHUA 1CAUB 2DCYA 1DDNA 2HKXA 2ZEWA 1RITA 5GLUA 2M3AA 4FVVA 1OFCX 3LDBA 5FYTA 4CXXA 1YTYA 4Y33A 4MXWB 2CO5A 3RWNA 1WMEA 2R7EB 3HUGA 3GYDA 4OI2A 2BVMA 4QSHA 3HAGA 2ESHA 3BU0A 5HLHA 2R93J 5SV8A 1O57A 3MBWA 5JMOA 2AGSA 2NAZA 2ZSIB 2GU9A 1LDKB 4BY7J 4RD7A 5FY1A 3CO2A 4M9SA 3B7MA 5ILSA 1VQOI 3RTRA 4BBSJ 3OS2A 2JECA 3UGGA 1PNGA 2R16A 5GJ6A 4DO0A 1VP6A 1A8DA 1H2NA 4FTSA 1LECA 2DU1A 1W6MB 1RUG1 4CCLA 1W6NB 3BG3A 4JQFA 4Q2FA 2HYKA 1QH7A 3U10A 3PFIA 5HCFA 3H42B 1WMDA 4PJMA 3NQHA 1G9AA 3CC4I 5A33B 5FKMA 3NNFA 4KI5M 5FO5A 4Q48A 4ZU5A 4GIQA 1ZH5A 3QPLA 4AU7A 4RB1A 3FKJA 2YZ4A 3DFGA 3RQ0A 4R9BA 1QJU1 3A01B 4QX1A 4A44A 4AVZA 4AZZA 3LSMA 2DT7B 1UY0A 1XBFA 4N4OB 4YW3A 3QQAA 2CFXA 3T2OA 2ADDA 1DCSA 1EH6A 3DKYA 2X05A 2R7RA 4CA0A 4LJHA 4OU0A 5F7UA 4I02A 3MZHA 1GLNA 1VR3A 2I74A 2VUCA 3LFKA 1F31A 5LA9A 4BEHA 1E5IA 3I7DA 3CNAA 2VNVA 3WZ1A 1TW2A 4UVBA 3IDAA 4LBMA 4LG3A 4JOMA 3ZN6A 2E5ZA 1QA6A 3O6BB 2HEWF 4HBLA 4GRIA 2JT1A 3B93A 1ETKA 2EICA 1V6KA 1ON1A 3CTAA 2WAFA 1W8FA 3QP5A 3JTGA 4RAYA 1C4RA 1Z7S3 1GZWA 2EIMH 2BV4A 3QU3A 3FX3A 4Q4Y1 1EP0A 2KMUA 3D4KA 1AR71 4H4KC 5KXEA 1YQAA 2UZKA 3MIDA 1DQ2A 4S05A 2D6OX 3H8RA 1ULYA 2DDUA 2KIQA 4CSWA 1S8NA 2K7LA 3IIAA 3TOBA 5FY7A 3OYKA 4LO6B 1V54H 4XN3A 2M8EA 4IE7A 3USUB 3QPHA 3A1YA 3KGLA 2DBIA 3GCWA 3A4CA 1PO12 1VLNA 2MC4A 5FR3A 3HBZA 1F4HA 1KYZA 1I1GA 5IYDJ 4PGGA 3C2UA 3IB3A 3SH4A 1POGA 3ABMH 4XURA 4ISRA 1QZEA 5IT6A 1ON2A 4DUXA 5HCBA 5LBCA 2EK5A 4TWTA 4AQTA 4RS5C 5LB6A 4S2DA 1W6QB 5L7OA 2XRLA 3AFGA 2PMZN 4R9AA 3M7GA 2W1OA 3JD71 4ZH4F 1V6OA 1H0MA 1RUD1 4W97A 1J09A 2HDWA 3TMOA 2WB1A 4MGRA 1Z7LA 4PDWB 1QO0D 2NS7A 3NJXA 1G9FA 4IEXA 1IPSA 4NPMA 5F37A 3PUAA 9ANTA 5KHKA 2F5DA 2DAOA 1A78A 4QXCA 1OPCA 1U5TB 5CVUA 4NHKA 4N7UA 2P1BA 3A0KA 3N9MA 2ZEXA 5IP9J 2H6CA 3N9PA 1MBEA 4JX0A 2PHLA 1PUFA 3EUHC 1J3PA 2LM3A 4TZDA 1D0ZA 2B0LA 4XRSG 4QWQA 2GNTA 4CA9A 2L4AA 2BDRA 4YFKF 4JYKA 5AC92 4MGYE 3ZFEC 1OLQA 5BNOB 4I98B 4BQ2A 1Z78A 4QHBA 1MBHA 2G0EA 3IDCB 3O1SA 1U9OA 4HMZA 3WINE 5DDJ2 2O1QA 3MIHA 2F5VA 1Y39A 1GWKA 3KVBA 1HRI3 3ZX7A 5EJCA 5JOWA 4KU7A 2DVBA 4IGOA 3U14A 1IG7A 1E3OC 2VZVA 1AJKA 3W5MA 3D5RC 5FK8A 5FFXA 1ULGA 4BOWA 2OAZA 5H2FC 3MLKA 3E6BA 2YDEA 1YJKA 1UG0A 4NAMA 3TGNA 3CJQB 5J1YA 4XIDA 3PVBB 4SLIA 4MFDA 4NC8A 5D5XB 1T2KA 2ZGMA 1S2KA 5ICGA 1Z3XA 4CU9A 1V3FA 2LKPA 4UXNA 3HRUA 2X5IB 5IK5A