3R6SA

Crystal structure of glxr transcription factor from corynebacterium glutamicum with camp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
225
structure length
225
Chain Sequence
GVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords transcription regulator
total genus 76
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r6sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3r6sA01
3ABTA 1U8RA 2STWA 2D1VA 4WF2A 2Y0OA 1ZARA 3GVAA 4QM8A 2C0ZA 1Q5OA 4AIKA 5IT9K 2HOEA 1X8EA 4BHBA 3L2CA 2VODA 2L54A 3U1DA 1YW9A 2ETEA 1KYWA 1XRUA 2TDXA 1FLIA 1QO0D 3ECHA 1U5TB 2ZCWA 4IF4A 4LLGF 1U2WA 1FZPB 2DQLA 1FYLA 4EJWA 3OV8A 3TDUC 1YFUA 1F4KA 5HDNA 4S04A 4IEZA 4EQQA 2ZXJA 1OPCA 3IWFA 3D0SA 2VT3A 1U5TA 4K8FA 5J7MA 4U0VA 3GFMA 2FRHA 3K69A 4JBAA 3HSEA 3DEUA 1J3PA 1BI2A 4ENMA 3WW3A 1G3YA 2Q1ZB 1ON1A 2BNNA 1FX7A 1EV7A 1FYKA 5KVRA 3O6BB 4N0BA 1TQPA 1I6XA 3H3UA 6PAXA 4LA3A 3BJ6A 4H7LA 4UBGA 4I0BA 1EH7A 1H1IA 1HKTA 2IA1A 4CICA 2H6BA 2RV8A 5BMZA 4LMYA 3DXJF 1DDNA 1FYMA 3HRTA 2XAHA 5FD5A 2PBIA 1TNSA 4XF1A 3F8BA 4RAZA 3OTFA 1IN6A 1OYWA 4MNUA 3PNAA 4I09A 1L3LA 3WTZA 3MDPA 2XGXA 1YLFA 2MPFA 1Z6RA 1TW3A 5E1WA 5KHGA 1ZZ6A 4LK1F 3SHRA 3IBMA 3NVCA 1BI0A 1GHCA 2GA1A 3CO2A 4MHGA 5D5UB 3JTGA 4WZCA 4HN1A 3Q5FA 2NS0A 2ZMEB 1IN4A 3MAJA 5JFRA 2VOOA 1Q43A 5FB2A 3C18A 3RTRA 4RGUA 4DNCA 3LAPA 1UCXA 2PTMA 1TQ5A 2K27A 4ETSA 3T5XA 3H92A 1SQ4A 2MNGA 1STZA 4J1XA 1T39A 4L18B 3ZMZA 5I91A 3O2PE 2MBFA 1ZX5A 4Q48A 1EH8A 4IPAA 3KEQA 3ZMUA 1H0MA 2PMHA 4FHTA 2XKPA 1ZRCA 2PEXA 3TNPB 4HBLA 3D5LA 2JPBA 4L9NA 4AIJA 5I8TA 4UNOA 1BI3A 1YFWA 1MJ9A 4ESJA 3F8NA 1K78A 3DPTA 1QGPA 1YIOA 1SMYF 4AIHA 1K7AA 4A0ZA 3KEOA 1CAWA 3HHGA 4MX3A 1CAUA 2XROA 1IPKA 1ZG3A 2DK5A 2HS5A 1D5VA 2JPCA 2CV6A 4KMFA 1FSEA 1GVJA 2EV0A 2HKXA 3IRRA 2PAMA 3CO7C 4BHPA 2FBKA 3KP7A 4OIPF 4MGIE 3NJZA 1FP1D 2IXJA 3FXRA 4BH9A 5DDGA 2GQQA 2FXAA 1D8JA 4R52A 3KLOA 2O3FA 1CAXA 4I02A 2WWYA 2H94A 3FM5A 1TQIA 5TRDA 2MLGA 2RVCA 3WE3A 5FLXZ 2I45A 1PMIA 3TKYA 3U2RA 2B9UA 1E2XA 1FC3A 3JTHA 5J6XA 2YX7A 1O7FA 4PCQA 2Q0AA 3BZ6A 4MTEA 1F1ZA 2IPQX 4Y13A 3H1WA 4EM0B 3S7IA 4ZU4A 1RGSA 4HVRA 3NSTA 1O7LA 2NNNA 3U0ZA 1ZZ8A 3KE2A 3V7RA 2K4JA 3G3ZA 4K2EA 4EM1A 2PHDA 2GAUA 1OYIA 4G7ZF 3HRUA 4HSLA 3NKTA 5LGUA 3QP6A 1BOAA 3TOBA 1V3FA 4A5NA 2VOPA 4TLFA 1LQ1A 3K1PA 5DD4A 1X8MA 1YFHA 2P7VB 1YO5C 2V1UA 2IXHA 2P5KA 3G7DA 3QPTA 1CX4A 4L5IA 5L3BA 5CADA 5F6FA 4IEPA 1YS7A 5ILVA 1B1BA 2RGVA 4YSFA 3REOA 3CUQB 2CAVA 5I8YA 2HYGD 2Q8KA 3CUQC 4IEYA 4H0EA 1DZRA 3R61A 1VP6A 1NE6A 4L9JA 1CAXB 4L9VA 2KJBA 3U9GA 1LKNA 2R7DA 2L4MA 2IRFG 4M6YA 3TO7A 4I7HA 4BAYA 2M87A 1R5GA 1P4AA 2L01A 4BNCA 1UHMA 1SFUA 2CAUA 2K4BA 4EJVA 4EWDA 2QENA 5E18F 2OYZA 3W6KB 2D93A 5I93A 3CL1A 4I98B 4MH0E 4I01A 4XBFA 2DW4A 1VJ2A 5IT3A 2DLLA 5ICCA 3FX3A 2LSOA 1EP0A 1VTNC 2ISZA 2Z3YA 1GQGA 2JT1A 1PDNC 2ELHA 2ATFA 4P9FA 4B29A 3S7EA 2NRAC 2EA4A 4A5MA 2HEOA 3NRVA 3E5QA 5D6FA 1FSHA 4FX0A 3KP3A 1CAVA 1K79A 4ON0A 3V8LA 2K86A 1ODDA 4ZZLA 3OCPA 5A2QZ 1LDJA 4HF0A 3KP4A 5E8IA 4ASNA 4PIZA 3V7CA 4HF1A 4LEJA 4YRDA 4LA2A 4U7BA 2QDRA 3EQEA 2MD5A 4UVBA 3WGHA 5ICFA 2FE3A 5FFXA 4FAHA 3DQVC 2G7UA 2QCSB 4XFBA 1WA4A 1IPJA 1WGPA 4PGHA 1BM9A 1OKRA 2VBYA 1P92A 3J7AO 2O1QA 2FU4A 3CUQA 4O5VA 2A6HF 1J59A 1FBQA 4XF4A 3KLNA 1S7OA 4MQVA 4BQAA 3ZPLA 1HW1A 2ZBKA 3RPQA 1KU2A 4UV9A 2GC3A 4KU7A 3ST7A 2IP2A 5LGTA 1BIAA 1FWZA 3EUHA 3ES1A 5DUIA 5FGMA 3I64A 2PJPA 2QVSB 5CLSA 2BBYA 3GFLA 1KU7A 2XIGA 4HYEA 2VXZA 4UHTA 1U5TC 3RIRA 3N4MA 4QGLA 2EFQA 4EV0A 2CWEA 4IETA 2Q4SA 5JAXA 4IEXA 1EH6A 5J48A 4P55A 1YUDA 3K1MA 4KMUX 2KXLA 1PP7U 5BXXA 2EAAA 3CLPA 5E16A 1A04A 1JXSA 4HLXA 1SD7A 4HOBA 1XDUA 3PLQA 4GXOA 3W6JB 5L3CA 1OR7A 2QQ9A 3HHHA 3SXWA 2V6CA 3GZ6A 1IN8A 5HLIA 4Q4ZF 4G6QA 4ZU5A 1WKMA 3M3IA 2OZUA 2HYFA 3LWFA 4B09A 4DQ2A 3C3VA 1REPC 1IW7F 1U6GA 4LFUA 5DCFA 4ORFA 3BP8A 4Q0PA 5EEGA 3M8FA 4QGNA 4Q0VA 1YG2A 3DL3A 1KU3A 2XAQA 2KIUA 5JVTA 5CVJA 3EDPA 2FA5A 4YYOA 2AXLA 1B6AA 2A6EF 5J8FA 4EGZA 1MDMB 2J5OA 5HDGA 3QRFF 4S05A 4RB2C 4KA4A 1ZG1A 1K78B 5ICEA 1UPIA 4HW0A 1MZBA 2XV4S 2PLYA 2V1DA 3PVBB 4JQFA 1JUHA 4AQ6A 1QBJA 3T8RA 1YFXA 3TOAA 2DI3A 3FHZA 4A0XA 3O3KA 2EFWA 1J2XA 1AWCA 4PIXA 3HRSA 4LUKA 1EPZA 3L7WA 5A2QK 1ZRFA 3R4KA 3IRQA 1W4MA 2OZJA 3WE2A 4UBHA 3WU1B 4LLOA 2VN2A 1J3RA 1HXDA 4ZYHA 1ZRRA 1WWXA 2ZMEA 3FXUA 4XRFA 2ETHA 3I58A 3F6VA 2G9WA 4MV2A 4HQEA 2E1NA 2QBYA 4X6QB 5LHHA 2RQPA 3DV8A 2A68F 4TV7A 4FAGA 2XASA 2UY9A 5JCTA 1IN5A 4WX9A 3USSA 4IRGA 4WVZA 2O6GE 5D5VB 4Q5SF 2DCTA 1PM7A 4ZYEA 2VBWA 1JHHA 1W7PD 3DKWA 5ILSA 1LNWA 3ISPA 1J75A 3Q9SA 4QLCU 3G73A 1KQ9A 2IXKA 3IC7A 3JAMK 1JHFA 4M9ZA 3E5XA 1YHFA 3CJNA 5D4SA 5DCMB 2V09A 3QP5A 2BNMA 1J5YA 4OIRF 4Q47A 1VR3A 4QX5A 1USTA 3HRMA 3ACLA 4OMYA 3K9TA 4IESA 2Z33A 4D0PA 5ERIA 4EWEA 4KYWA 2P5VA 4LD5A 5K1YA 2E7XA 1O4TA 3RNSA 1HW2A 1J1LA 2MH9A 3EHKA 2HQNA 4KIFA 1QPMA 2DPUA 3I0TA 2WTEA 2M8EA 2DAOA 4G6DA 5KHHA 2LF7A 4HV5A 3KP6A 5HLGA 2IJLA 4RB0A 2IXLA 5FLIA 3KCCA 3J80K 1UFMA 3GFJA 4L2NA 2YPRA 4Y15A 3RKXA 4CHUA 4F8AA 2JSCA 4KFCA 1QQIA 2VC1A 2OD5A 1HSJA 4G9YA 3F23A 5I0SA 5AVPA 1G4DA 2H6CA 3ABUA 3FHIB 3WU0A 4EM2A 3BCWA 5FLJA 4YG2F 4CZZA 1H9GA 1LRHA 1MKMA 2CGPA 1RZ4A 3WW4A 4GYIA 2VPVA 4KL1A 4AD9A 5FPXA 1Y3TA 3QOPA 4ENNA 4J1WA 3M70A 1HQCA 2W57A 1QWRA 3KFWX 5KHKA 4LB6B 1FBSA 2QM3A 3RDIA 5JHUA 3RPUA 3O14A 3COAC 3SCHA 2GC1A 1ZRDA 3QACA 5BUVA 2PAKA 2STTA 1IAWA 3ES4A 3HTUA 1YQAA 2VE9A 3E97A 2D1HA 1E17A 3F8MA 2W85A 3OD0A 5CVRA 5H20A 1Q1HA 1TNTA 1TLHB 4LG0A 3WTWC 1XN7A 4NHJA 4HAMA 2Z69A 4QWQA 4B8XA 4QXKA 2BE5F 3LZZA 2PFWA 4WK8F 3LA3A 4JTOA 3GX4X 3TDZC 1UHWA 1G6NA 3ZP5A 3HQXA 4EVIA 1J3QA 1Z91A 5JI6A 2WC2A 3TO6A 1S3JA 1FY7A 1SMTA 1KYZA 2K7LA 1S29A 3TNQA 3ML6A 3OOPA 3T8TA 2H27A 1ON2A 1BIBA 2PFBA 1DP7P 5FO5A 1W5TA 3PQJA 2OAZA 5LHGA 2D5FA 4KU8A 3SHFA 2GA2A 3I7DA 3BDDA 5L3DA 3ULQB 3R0AA 1XMAA 4EJTA 3KP2A 1LDKB 1YW8A 5DEQA 4A12A 1X82A 4ESFA 2EFPA 4O9EA 2WFPA 4MEYF 4U0YA 3BPZA 3ZMSA 2F5FA 2OU2A 1KGSA 3SQNA 2RNJA 4BHCA 1UIKA 4IEUA 2JTVA 2DU9A 4IXAA 3IDBB 3SMHA 5FLXK 2P6SA 2YR2A 3M8EA 5CVVA 1MDMA 3J80Z 1LVAA 1DPRA 3KZYA 3FMRA 4ZYGA 2FF4A 3KSCA 2RC4A 4Z2YA 1ZZCA 3LFKA 2ZNYA 3UKNA 1CAUB 4Y17A 2Z5UA 5DUKA 1O3TA 4GYGA 2EJRA 5H6QA 4KIBA 2F5CA 1I5ZA 1QXJA 2P17A 4KN7X 4RS8A 2E1CA 3HSFA 5FFZA 1EYBA 4OMZA 1XSVA 3OGJA 2FMYA 3IDCB 1UIJA 4XF0A 2HFHA 2EWNA 3T0YA 1J58A 2BEOA 1D3YA 5L3GA 4MTDA 5CVIA 2Y48A 4META 1ZLKA 3FZVA 1XCBA 1OYYA 3ZN0A 4A6EA 5E17F 4HDUA 1RUOA 4HBNA 4LGWA 4Q0SA 4ZU7A 1V4RA 4KWKA 3H50A 2Z9OA 1RI7A 5K5OA 1DGRA 4MGRA 4OLLA 1LJ9A 2DTRA 2X4HA 1BN5A 3BY6A 1XDSA 5HVQC 5D8LB 2DQRA 3WW2A 4PGGA 1UD1A 3L2HA 5BPDA 1X7NA 1ZNPA 1YWKA 3BJOA 2BV6A 3F22A 1SFNA 4WXHA 4AQ2A 3U10A 2A61A 1HBXG 3GW2A 3P9CA 4YFXF 5D1IA 2O8XA 3EO6A 4U0WA 2E7WA 3WG9A 2KKOA 3LA7A 3BU7A 1PUEE 3IKTA 4MGYE 3CJXA 5K5RA 3FFQA 3V7SA 1P4WA 1H1MA 4LLNA 1IRFA 1YFYA 3H1MA 3RKWA 1CGPA 5FQ0A 4P9GA 2H09A 1XGSA 4LG0B 3BWGA 5FPZA 3FZ3A 4QMAA 4PDKA 4HX4A 4KNYA 1T0FA 3GZ5A 5DYMA 3T1BA 4HX8A 4L11A 3QPHA 4O6JA 1SFXA 2KIFA 4KT5C 5BY5A 1NXMA 1F5TA 4LK0F 3ZMDA 1Z7UA 3MZHA 3B73A 1O3SA 2D40A 2D2WA 3HIFA 4CXFA 5C8WA 4HLTA 2B0LA 4HVOA 2VT2A 4PZJA 4IERA 1ZN2A 5K8SA 1ZZBA 2R3SA 1JE8A 5HS8A 5HDKA 3BROA 2C6YA 3DP7A 5D5XB 2YSRA 4RGXA 2AS5F 4LB5A 5E8GA 1DUXC 3SCFA 4DINB 2MC3A 3K2ZA 1W7PB 4GULA 2YU3A 2GZWA 3C1DA 4MGKE 2NAZA 4EJOA 2CQKA 3MYXA 1OD5A 5L3FA 1S8NA 4XFHA 2FMLA 2PA7A 4ONUA 2XAGA 1XCVA 2JRTA 3F8FA 3MFKA 3C7JA 2FBHA 3VB2A 4HSJA 1ZG5A 1R7JA 2XLAA 1R1UA 2FSWA 4P5OA 3CEWA 3QU3A 1U78A 3NQOA 2HWVA 3DFGA 4XSXF 2ZKLA 3LQRA 1RTVA 1K6OA 1V70A 4MQ9F 3WGIA 5ICGA 5I0RA 5LEKA 1BC8C 3VODA 4I0AA 5DCMA 5J3UA 3FF5A 4HLYA 4HVQA 5LBQA 4RB1A 4IVNA 2KIMA 4L9TA 1S7AA 2FOKA 4LULA 4F7ZA 3KMHA 3J81K 2PN6A 2L4AA 3FM3A 1RUNA 2IVMA 3ZMVA 2OZ6A 1KQ8A 2O8QA 5DD8A 4G8XA 5JSOA 2GXGA 1HW5A 5TJJA 1FOKA 4P9UA 3PFIA 4JV4A 4KWLA 2IT0A 1ZREA 4JK1X 1P2FA 3GF2A 1IN7A 5D5WB 5KK1A 2QBYB 3MCZA 2P7CB 1TQMA 2O61A 1BBYA 2HZTA 4IRHA 3ELNA 3BJAA 1DGWA 3JSOA 2QZ8A 3F8CA 1R1TA 3LSTA 2ESNA 3H9AA 5H6RA 1WI9A 2QWWA 2PQ8A 3FWEA 5FCCA 1X3UA 2A3SA 5T3NA 2NNYA 1ZAOA 3IIAA 4YIFA 3S2WA 3KETA 3CLOA 4XFFA 2M45A 2MH2A 4D7TA 1MD0A 2GIVA 4GO1A 3ZDSA 4XLPF 1O5LA 4PJYA 2BGCA 2KRFA 1SD4A 2DT5A 4AVCA 1T98A 1JGSA 5LRRA 1AOYA 4AWXB 3F3XA 4FX4A 1F9NA 1FP2A 2QQBA 5D4RA 1GXQA 2D45A 2ISYA 5HS9A 2O03A 2M5WA 1DPUA 4KUMA 3L09A 2RKHA 3HOSA 4Q29A 3Q9VA 1CAWB 4OFGA 1IRGA 2UZKA 4HZFA 1FNNA 3WTXC 4OU0A 4KN4X 3JAMZ 1R1VA 1U12A 4I3PA 3I5UA 3HSRA 2ET7A 1KQ0A 1BC7C 3C3WA 3JSPA 2LDUA 1NE4A 2QJVA 2IA2A 4JVAA 4LTAA 1H9TA 4ESBA 4E2GA 3RI4A 3L00A 4CO8A 5DV5A 5E1RA 3HYIA 1ZLJA 1R00A 3VEPA 3ZN1A 3LAGA 5JR3A 3TO9A 2EB7A 3U11A 3OF1A 4R79A 4E70A 4XETA 3V8KA 1USSA 1XGMA 2QQAA 4OINF 5LEJA 1R22A 3I71A 5C6CA 2OBPA 1HSTA 2V1XA 4WBBA 4ENKA 3GWZA 4IHTA 1CF7A 5J8CA 2EA2A 1O3RA 1IXSB 3N97A 1ZVFA 2UY8A 1MGTA 2GWRA 1WLTA 2UWMA 4IJAA 2HR3A 4AVAA 5AIPA 1J0RA 4MEXF 5FD6A 3EBRA 2XLGA 2COMA 1R23A 3SCGA 1O5UA 1W7PA 2P8TA 2DK8A 2MA3A 1RIOH 4O9GA 2ZO4A 1FXZA 2MLKA 4D7SA 5HOOA 2GC0A 4EWAA 2FNAA 4PIYA 4ZH4F 2CSOA 2WV0A 3J81Z 3E6BA 4XF3A 3BOQA 2GXBA 2Q30A 1G3TA 2HTJA 5KHJA 1IZ1A 1XSDA 1C0WA 1WSUA 3HUGA 4X6RB 2LF8A 3E3VA 3BALA 1TBXA 3GLXA 4U88A 3KZZA 4UV8A 1ZH5A 2ESHA 2RN7A 3WW1A 1OMIA 2XVCA 5JSRA 3I4PA 4M71A 4L5JA 3R6SA 3GBFA 2GH2A 1BI1A 2QUFA 2M30A 3RYRA 4YIIA 2BNOA 4FBFA 4RAYA 2MHFA 3MPBA 1NZCA 1L0OC 2F5EA 5IT9Z 3CO6C 1G3SA 1I1GA 2Q0OA 1YS6A 3I54A 5BS6A 3GUDA 4XFIA 4GCVA 2VC0A 2UYAA 1NHAA 3JZVA 1T2KA 1CAVB 3I59B 3IL2A 4G7HF 5BPXA 4XLNF 1FT9A 4YARA 2RDPA 4KDPA 3IKVA 5HS7A 2XHKA 2FQPA 5BV6A 5LRSA 2G7HA 3CUOA 5E1ZB 2OPKA 2VONA 1LEAA 4QGMA 2X0LA 2IXCA 5AIQA 2XRNA 1U3EM 2ET1A 2FBIA 4XEZA 4Z07A 3MWMA 1Z05A 3F6OA 3H7JA 4NVPA 3EETA 1W5SA 3P9KA 1HKSA 4XFAA 4JTNA 5HI0A 2ADUA 4KIGA 5ED4A 2VBZA 5E20A 1NYWA 1Z1DA 5L3EA 1LEBA 3NL1A 1ZHFA 2OA4A 3EYYA 1WRJA 3R0JA 4BXUA 2Z2SB 4M72A 4UVAA 3UKTA 4HA8A 2HGCA 2IXIA 2N7GA 5JR7B 2QLZA 3K0LA 1ONVA 3SZPA 3WGGA 4L0YB 2K9ZA 1HKQA 4G7OF 3HT1A 3HT2A 1R5HA 1KA8A 1B9MA 1L3JA 2OQRA 5F64A 1GQHA 2P4WA 2HKOA 2L02A 3TQNA 3LQQA 2HJIA 1XGOA 4M74A 1T38A 5LGNA 3P7NA 2EFNA 2QVOA 3F21A 2VQAA 1I27A 2CFXA 1YTYA 3EQLF 3LWCA 2VECA 2A5YB 2ZFWA 4CDGA 3QAHA 2UXXA 4HX7A 3FXQA 2P5LC 2L3DA 3RZZA 2LNBA 4A0YA 1EY2A 1RL3A 5LLQA 1R58A 2VE8A 5D8KB 1Y0UA 3SXYA 1KU9A 3V4GA 5BOXA 1XE8A 4Z82A 2PAEA 2Z99A 4KWJA 3FMSA 3V8JA 2PHLA 2XLFA 2H0VA 5BQTA 4ENJA 3E6CC 5I0UA 5CYVA 2CO5A 2R7FA 3MZYA 4WCGA 2A69F 2O0YA 3KP5A 2J5PA 3BPVA 3LA2A 1OFNA 2V9VA 1LR5A 2IC1A 3FJSA 1LDDA 2HQRA 2EA7A 4CYDA 3DPLC 2DFIA 4HMZA 3RYKA 1YLLA 3RYPA 4E2SA 1SAXA 3ERED 4BIFA 2ACJA 4IRIA 3UKVA 2BYVE 1RC6A 4UVCA 4HN0A 1G3WA 1SD5A 3MQ0A 2PMUA 2CG4A 5F1RA 3VFZA 2B8MA 2EK5A 2F5DA 4UXNA 3R60A 2OA2A 1IF1A 4N9IA 4LUMA 1DZTA 1XMKA 5FQ0B 1ZGAA 4YFNF 4AVPA 2PI0A 5KBFA 1I1SA 3L9FA 4LJZF 4I2OA 2EVXA 1Z6TA 3JW4A 3SZTA 2HDCA 4AVBA 4N9HA 2QNKA 2GU9A 5JSPA 2UYBA 2XUBA 5D6EA 3VOEA 3RJPA 3GXOA 2K0GA 1XB4A 3ECOA 5I0TA 3IWZA 2B5HA 3WTYC 3PQKA 1P4XA 2A07F 2PYTA 3LAJA 4EROA 1SFEA 4UXAA 2ZJ2A 1BJAA 4R8HA 4P96A 1QY4A 5CVUA 2W25A 3H3ZA 3H7YA 3E6DA 1ULYA 4EMSA 1QXRA 2OQGA 1IUYA 1TTYA 2Q2EA 3CTAA 5HLHA 3D82A 1PP8F 5KHIA 1UW8A 1Y9QA 4OIOF 4HF2A 1QZZA 4ZZDA 2F4PA 1TW2A 3RKYA 1FPQA 4ZYDA 3AAFA 2UXNA 2EV6A 3H8UA 3GYHX 4MUVA 1XGNA 3VHRA 1UCRA 1P6RA 1LB2A 4HQMA 4HDVA 4RB3C 3ZMTA 3E5UA 4YNIA 2XAFA 5I8SA 1OI6A 2P6TA 3B02A 1J7KA 2M1BA 1XD7A 3I53A 2EFOA 4M73A 1B9NA 2IW5A 4WWCA 3WTSC 4QM9A 3FE5A 3I59A 5EFUA 2JZYA 2W24A 1IXCA 1XSXA 3E6MA 4NB5A 4XFCA 1O3QA 4IEQA 1RNLA 2E9QA 3DF8A 4NQWA 1ZZ9A 1QNTA 4MGZE 3ELKA 3D0JA 3TGNA 4FT8A 5ILUA 3LOIA 1ZYRF 2QYOA 1YW7A 4IEVA 4Q0QA 5EZWA 3WTVC 1MJBA 1D8KA 2VBXA 3QU6A 4GGGA 1O57A 4CGZA 3GYDA 4U7DA 4M9XA 4O3MA 3F72A 2DBBA 1Q3EA 2IA0A 4AXOA 4IEOA 4UUVA 3M9AA 2K02A 4WXDA 4A6DA 3ETQA 4MZUA 5EEHA 4Q0UA 3K1NA 3GFIA 4RGSA 2DPDA 2FEZA 5CU1A 5CJ9A 3FMQA 2CW0F 4XF9A 2DO7A 2W84A 5E1XA 1SEFA 3M1EA 1Z9CA 1WQ2A 2FNPA 2F2EA 4L0ZB 2KJCA 5K5QA 3BB6A 4G94A 2NYXA 2ZKZA 4IEWA 3WTUC 4XFGA 1YYVA 4E2QA 3NEUA 2FQ3A 2XL9A 1B4AA 3P9IA 1CF7B 4OIQF 3EJKA 3WODF 1ZGJA 1ZZ7A 4XSZF 2Y75A 4KICA 1XE7A 1GXPA 1R36A 2EV5A 3NW4A 3M7GA 4LLLA 2D5HA 4RD7A 1FI2A 3EYIA 1UB9A 4M9SA 4RGRA 1SD6A 1MJAA 3GO5A 2HTSA 5FDBA 3H1YA 3SFZA 2ZNZA 3HTSB 3MEXA 2Y0MA 1QZYA 2XKOA 2PG4A 3DN7A 1S6LA 2GC2A 4R1HA 2LKPA 3IHUA 3KGZA 3CDHA 2CYYA 3HOTA 1T6SA 1B59A 1IXRC 3S0MA 5FLHA 3WTTC 3KGLA 4EGYA 2XAJA 4HV6A 2YX4A 1FBUA 5BPIA 4OOIA 3CF6E 3GEZA 5AONA 2XL7A 4A2UA 2PQQA 3ROUA 4BYYA 3ZQ7A 3BPXA 4WXCA 2V79A 4EJUA 4M6XA 5LHIA 4IHSA 4YFKF 1J9IA
chains in the Genus database with same CATH superfamily
3V64A 3ABTA 1U8RA 4XUNA 2VQCA 2Y0OA 5IOYA 3POYA 3TEYA 3K4BA 1ZARA 3CZ6A 3GVAA 2PJRA 2C0ZA 1Z7S3 1UY2A 5JOXA 5IT9K 5BNOC 1X8EA 2Y0IA 5BNOB 4JZRA 2ETEA 4BY7J 2ZZJA 4DXSA 3ECHA 3LSIA 1XG1A 4IF4A 1A31A 5FZ3A 1U2WA 1B8IA 4LO7A 1FZPB 1C8NA 1OCCH 4EJWA 4JX6A 4GJZA 2OXBA 3ZFFB 1OPCA 2JENA 5FAXA 4PQQA 2O7OA 5J7MA 2LROA 3GFMA 3K69A 1PYVA 5A7PA 1LOAA 1OVSA 3WW3A 1G3YA 1W6OA 1ON1A 1GZ9A 3WP5A 1PO13 1FX7A 1L7LA 1FYKA 5FY8A 3O6BB 1I6XA 6PAXA 3N7KA 3BJ6A 2IFRA 4B4QA 1O8PA 2EPFA 3IAS2 2XB0X 1FMD1 4BXSV 4RLFA 4BOWA 1SVOA 3F8BA 4NIHA 4JGYB 5FUIA 4FASD 1ULCA 4PHZA 2ICWG 2HWC2 4DY3A 2GA1A 5D5UB 4XC9A 2WNVB 4KGQA 2GMPA 2D6LX 5T55A 1DU3D 2NS0A 2ZMEB 4QTRA 2VOOA 3ZYFA 4CCMA 4MG2A 4JGZC 3C18A 1Z0HA 4E4ZA 4AU7A 1G2HA 3H92A 4LT5A 1SQ4A 1I39A 5DG1A 1R1A3 2MNGA 2QQOA 2W39A 4L18B 1TZLA 5I91A 3O2PE 2VCCA 1EH8A 2NVUB 2BY0A 4N43B 4IPAA 2KMUA 2XKPA 1ZRCA 4NBQA 1SBEA 3D5LA 1UYYA 5CKNA 1VBE3 4JKLA 2ZTNA 4JHZA 5EHDA 1BI3A 3ZSMA 4ZC3A 3DPTA 1QGPA 3CHXA 4FXGB 4E7HA 1IKQA 4JKMA 2FOWA 4RR3C 2LVSA 3ZQLA 1U5XA 5J98B 2CY6A 2AC1A 2GN7A 4GXLA 5GPAA 2JA7J 4XMAA 2DCYA 1JU3A 2BDRA 1DQ5A 3IRRA 4BHPA 2FBKA 4BB3A 1SVLA 4BH9A 2FXAA 1D8JA 5FY5A 2ZA9A 5TGTA 4N7IA 4EZHA 3U4SA 2K3FA 1TQIA 2MLGA 2RVCA 2B39A 3IT8A 5F04A 2WYFA 2B9UA 5FROA 3JTHA 3QH6A 2D6PA 2YX7A 3VL9A 2HYKA 4CDUB 1JYIA 4YZ1A 4Y13A 3H1WA 1D0XA 2Z42A 3RZGA 4TZDA 2LP0A 1RGSA 1B72B 4HVRA 2WFF1 4HKWA 2VJ5A 3AJZA 3KE2A 3V7RA 2VNRA 1AXZA 1NTCA 3G3ZA 1W8WA 3H3LA 4BQXA 2GAUA 1H2NA 4NE9A 4CXWA 4A44A 1BOAA 5CEHA 4IL6C 1WCUA 2WNEA 1SLIA 5DUWA 3JCUC 4A5NA 3Q0UA 2LTNA 3K1PA 5DD4A 2NVYJ 4Y24A 3RPUD 4DYCA 3SH3A 5IP7J 2ZEYA 2QZ3A 2ZGOA 1VQ4I 1B1BA 4HNUA 3VYUB 1ZA7A 1N75A 5FZGA 4QPGA 4P02B 2HYGD 3CUQC 4H0EA 1S72I 4B44A 1ZK8A 4NRQA 1MH4A 3WNOA 4N53B 3MW2A 1HN0A 3AMPA 3U9GA 1MBJA 2RS32 1LKNA 2IRFG 1O59A 5JUVA 3O0WA 1ERDA 1R5GA 4YM1A 1P4AA 3IV5A 4EJVA 4JRAA 1E5SA 3GMEA 3OL3A 3VBOA 2WBKA 1SLTA 5G05L 3W6KB 1R1A2 1I3HA 5I93A 4QXHA 3D1NI 4I01A 2K2SA 2R7UA 1VJ2A 5L19A 5IT3A 2OTLI 1KEXA 3ZXEA 4B29A 2NRAC 2EA4A 2I2SA 4IHXA 1F4HA 4L5EA 1FSHA 3IMNA 1WCMJ 1D4VB 1ODDA 1AYN1 4C0HA 4J19A 3DEWA 3BU0A 1CPMA 3OCPA 4AI2A 4W65A 4D3WA 4ASNA 3V7CA 4U36A 2YY1A 1SPPA 4B3XA 4L99A 2J1VA 4K20A 4IKFA 5F8PA 3B9IA 4YRDA 3TB0A 4LA2A 2P3JA 4NHMA 3B6AA 2VJJA 1N1TA 4FPKA 5ICFA 2FE3A 1H89C 2VOWA 2ECBA 4V2GA 4N90A 2Y0SN 4CEWB 4KWUA 4PGHA 3EYPA 4KJZA 4CEWC 4NWVA 4JHTA 1BM9A 1OKRA 4OHXA 4W8JA 3I3LA 2XBO1 4QPGC 4QPGB 1R081 2A6HF 4Y5SA 5LATA 1ULEA 3VBFC 1POV1 4XF4A 2ZGLA 1S7OA 3ZPLA 2JKBA 1WZ2A 1OLME 1WPKA 5LK7B 4PI2A 2GC3A 4IE0A 5IWFA 1W90A 1T6BX 2A6YA 4LBMA 3VKLA 2DA6A 5GLVA 5LGTA 2P6HA 4BACA 2W92A 3LEMA 4Q26A 3P5BA 1FWZA 2D6KA 4XBQA 3MUZ1 2QVSB 2XIGA 1N25A 3RIRA 1XTAA 1R5ID 1B72A 1W04A 1LHVA 4H3WA 4M0HA 1TP4A 4BY1J 2LK2A 2DA3A 5J48A 1BXHA 4P55A 1LE8A 1YUDA 2EAAA 3NRUA 1W6QA 1A04A 1JXSA 1SD7A 2IZWA 3ASIA 3PLQA 4JGZB 2GSYA 1R64A 3VZOA 1OR7A 1XNBA 4M01A 2QQ9A 1ZBA3 5SV8A 1LVKA 3M3IA 2OZUA 1LPQA 3ZQQA 1CWPA 4FISA 4W6XA 1HC8A 3VKFC 1REPC 3VDBA 4IZZA 5GZFA 4ORFA 3BP8A 3G2BA 3PJRA 5EEGA 3M8FA 4QGNA 1ND2C 1NA1A 4COYA 5JVTA 2G0EA 2G1MA 2WABA 2J1AA 2AXLA 1RETA 3WDUA 1HB1A 5JOYA 4EGZA 2R1DA 4QPWA 1IPSA 2WS93 2KZGA 3AYCA 3QRFF 3KPHA 4S05A 2K9MA 1ZG1A 3LF7A 2ZZQA 2RMU1 2YHJA 4OHWA 1MZBA 3POFA 1V6JA 1WW5A 4JQFA 1QDCA 1QBJA 3U07A 3MLKA 5IOZA 2O8KA 1YFXA 4BMBA 5D8AB 2DI3A 3FHZA 5J1UA 1W6MA 3K77A 4NPLA 4UT5A 4ZXKA 4YVWA 1EPZA 1ZRFA 2IVIB 4XN0A 3OYMA 3VBSB 3BR5A 1B35A 1WZXA 1HXDA 4MADA 2DU1A 2ETHA 3I58A 2E36A 1K5JA 4HQEA 4AI0A 4JGYC 3Q9OA 4X6QB 1X3WB 4X0GA 5FPLA 2JMWA 3MFAA 4GA9A 2VKVA 5CQEA 3OSDA 4WX9A 2DCZA 5AC92 1BQPA 1KJLA 5LFAA 4FOYA 2DYCA 3N9MA 2O6GE 2XB5A 2CFOA 4Q5SF 3OYCA 2VBWA 3DKWA 4CU8A 5ILSA 1LNWA 1S9HA 3ISPA 1J75A 4LHSA 1TVGA 4R9AA 2ZXWH 5FO7B 4I0WB 3IC7A 2R043 3DPRC 1QZEA 4M9ZA 1YHFA 3C2BA 2C6SA 1UXXX 2BNMA 3PHMA 2HNHA 4Q4V3 1VR3A 3CDLA 2VOXA 2XR4A 5JPMB 4B43A 5DZGA 4J00A 4KYWA 2DOFA 3E7LA 3HKZA 1W6PA 4LD5A 4TLGA 1LFUP 3EHKA 2HQNA 1QPMA 2AEYA 3RZOJ 5KHHA 2IBDA 4HV5A 2ME0A 2VZSA 4RA2A 4XE9A 2XMLA 2YXSA 1HX6A 5FLIA 1ETWA 1C1LA 3K4LA 2G9GA 3GFJA 1W9WA 4L2NA 5BNOA 1N47A 2YPRA 3WSOA 3P3NA 2WY8Q 2B4KA 1QQIA 2VC1A 1UZCA 1K3IA 4Y5Z0 1HSJA 4E7KA 4CDXC 2M4GA 1BBT1 3HDDA 1QJU3 5AVPA 1G4DA 3C2GA 1UKRA 4AFMA 1T2XA 5E3MA 3OSFA 4R4ZA 3O1PA 2QE3A 2ELKA 2V5DA 5FLJA 4YG2F 2DDUA 2YBPA 4AUXA 2IWGB 1Q8SA 4NHYA 3ZN6B 2W00A 5K0UC 4AD9A 1Q8PA 2VOKA 3QOPA 4J1WA 2JG9C 1HQCA 1QWRA 2NPIA 3ZYIB 1OVPA 3BG9A 4XQFA 1FBSA 3KYDB 3BR6A 2FX0A 2J22A 2GMMA 3GM8A 4BA6A 4UB8C 3FISA 4GZ9A 3QACA 2QQPA 4MHUA 2STTA 3WQBA 4PJ0C 1ZYBA 3L2QA 4Q4W1 2ZX4A 5HCAA 2WA4A 2VE9A 3E97A 1EKEA 1E17A 2AEZA 3OIPA 1FOD1 3I2DA 5J4YA 1Q1HA 1TNTA 3HNYM 1TWAJ 5EYXA 3VD4A 5FYBA 4OQ8A 1I5PA 3N36A 4BM8A 3NARA 5FIXA 4QXKA 1ENRA 5F9TA 3HM5A 5JZGC 2BE5F 5EJZB 3LZZA 2XJTA 3OYBA 5D21A 2XRLA 3LA3A 2OQ7A 1AHDP 2XJSA 5HBAA 3ZP5A 1EV12 4Q4Y1 4EVIA 2OF7A 2D3SA 2R0HA 3L2UA 4XUPA 4XDQA 3SDBA 3TO6A 2BW3A 2M3AA 1FY7A 3TOJA 4JDNA 2K7LA 4NJ4A 4CDUA 4PQ9A 1ON2A 4O7XA 3BR1A 2VG9A 1JTYA 5FO5A 4GB32 4AW7A 5GALA 2GA2A 1GV5A 3IKWA 3ULQB 4XJAA 3AKQA 4EJTA 3QPSA 1LDKB 5DEQA 1QJU1 2VKHA 3UKGA 1WGXA 4JQRA 2V4AA 5EZHA 3I55I 1W8TA 5JZGA 2EFPA 4MEYF 1K4SA 3ZMSA 2F5FA 2OU2A 2VO5A 2IGOA 2RNJA 2W1WA 1WJEA 2JTVA 2LALA 4IXAA 4F92B 3M8EA 1S0GA 1FMD2 4N53C 2XWBB 1DPRA 1PO21 3FMRA 3POBA 4ZYGA 4XVHA 2EINH 3Q0WA 4MIMA 2WSVA 4D6QA 2YGLA 3GHMA 3PU3A 3A0NA 4FPJA 4JC1A 2LC2A 4AG4A 1QXJA 2P17A 5E3LA 4RS8A 2E1CA 2VOTA 5FFZA 3V42A 1XSVA 3IDCB 1VAKA 4QKDA 4HPKB 4XF0A 2EWNA 2Z79A 1D3YA 3SJMA 1E3OC 5CVIA 4XK4A 4META 1OYYA 4LGWA 4C2UA 2DA1A 1V4RA 4RSUA 4JQTA 2CQQA 4XKWA 2Z9OA 1DQUA 3AVSA 2VNOA 2WQ4A 1JUSA 2MEV2 1W9YA 1DGRA 4GD4A 3T30A 4MGRA 4OLLA 5L7OB 5JVVA 5F3CA 5FMDA 1QOSA 2X5IA 5BPDA 3BUCA 1ZNPA 1D0GA 4B47A 2B45X 2E32A 1SFNA 3U10A 3I2HA 4C2MJ 3P9CA 1P8JA 1IG7A 3EO6A 4CCCA 1V55H 3AB0A 4OHYA 3LA7A 4BWOA 5TSWA 4MGYE 4ISRA 3V7SA 1P4WA 3VYRB 1QVTA 1TWCJ 1YFYA 3S14J 3CBNA 3H1MA 1QJY3 2JICA 3RZMA 1GWLA 2H09A 4NC7A 1XGSA 1GSLA 1B35C 5FPZA 4F3JA 2D3PA 1RHI2 3O1UA 3OOXA 3GZ5A 2WY7Q 4CCKA 3OYIA 3T1BA 5A7WB 1SFXA 5CBLA 2RREA 1UNBA 1BJZA 3VHNA 1ZR2A 3MLJA 4Y1YA 3MZHA 3B73A 5KXCA 2D2WA 1VBC3 2PLV3 2QEXI 2B0LA 4Z2WA 1AKHB 4QDSA 3BLYA 1S55A 3CMGA 1YRNB 1JJ6C 1R49A 1TWHJ 1N78A 4LE4A 2PELA 3SH5A 2IGMA 5HS8A 4HEA2 2CU7A 2DUOA 3RJRA 2VCMA 1OKQA 3FBIB 1GFF2 1WH7A 2YSRA 1F36A 4DINB 2QUOA 3ZN5A 5FYHA 2WNUC 3K2ZA 1QU3A 2YC4A 2D98A 1JMUB 4KNCA 1IDZA 3PUFA 1TZOA 4M6VA 4FE4A 1LHUA 3ABZA 3O1SA 3MYXA 1G9CA 2R5ZA 1D0HA 1WJFA 2DBNA 3WNPA 4A3DJ 1WCSA 3PVNA 1JOPA 4JX0A 4QXBA 4NROA 1XCVA 3F8FA 1FX5A 4ZZ5A 1FMWA 1MIJA 3VB2A 4P5OA 3P6BA 5FY4A 3CEWA 3ZFGC 3NQOA 4JDMA 4DUXA 4FPLA 4XSXF 1K6OA 1HKDA 3WGIA 4D5CA 4X8PA 2EIGA 1FOD2 3HB9A 3MKLA 3T1LA 5IW0A 2E1OA 5JLVA 5LBQA 4RB1A 4DPNA 1MBFA 4L9TA 3NMBA 4LHLA 3HKZN 2LY2A 2L4AA 4MXVA 1US3A 2M2EA 1RUNA 4Y7NJ 1BR4A 3HOWJ 3RI9A 3GTJJ 2JJ6A 1D1BA 3TMOA 5DD8A 3PIPF 5TJJA 4JK1X 5LY2A 4RM2A 3GF2A 3MIEA 2RS33 1P7JA 3M2MA 2UU8A 5J4VA 2PHWA 3MCZA 1BBYA 4CA9A 1DGWA 2QZ8A 3CJTB 3F8CA 2JK3A 3DYMA 3JBG1 1O91A 3H9AA 5H6RA 3I2IA 1R1A1 1OOPC 3BCBA 1IOAA 2KRHA 2Y26A 2A3SA 1ZAOA 4TSVA 2ZMEC 4YIFA 3S2WA 4L97A 4GMP1 2VULA 2K9SA 2WAEA 3CLOA 5C33A 4D7TA 2O8OA 1MD0A 1O5LA 4XPVA 2BGCA 2Z5WA 1T98A 1N3PA 1MH3A 3W20A 1ZRIA 3NAPB 4XUOA 1G9BA 3QWLA 5FWEA 4XRMA 2EIBA 2KLOA 2M5WA 2LKSA 3J7ZI 4AEKA 1MEC1 1JKQC 2RKHA 2VZPA 4HK9A 3K46A 4ARYA 3HOSA 1XNAA 4XCBA 2JD9A 4GMP0 2M0MA 1FNNA 3WTXC 2HLEA 4QX1A 2KQRA 4LQRA 1GVDA 3E1SA 5L9VA 2CMPA 5KR7A 2LDUA 1PVC2 4PJJA 2FDIA 1ALYA 2JQ7A 1HXS3 1Y6IA 4Y3OA 4YGEA 4MO3M 2CRGA 4G12A 3L00A 3S1RJ 2ZMKA 2GIZA 4ANJA 1R00A 4N4OB 4XORA 4CDXB 4Y1VA 5JR3A 2OX0A 2EB7A 3U11A 4CP1A 3S3NA 3OF1A 3AK0A 1D7PM 1YC61 4AGVA 4JGZA 3H8RA 4UW4A 1GZWB 4YVSA 1YRZA 5DZFA 2QQAA 1DP0A 1R22A 5CZKA 2DVGA 3J9SA 3M4FA 1HSTA 5A70A 1P9QC 2J1RA 1DGRM 3GWZA 4IHTA 3PSFA 1GLHA 4NHLA 3QYBA 1ZVFA 1QDOA 2VZ3A 1MGTA 5IYCJ 3G71I 1E5IA 2A5ZA 1XNKA 4IJAA 3J4UH 3URFA 5AIPA 3EBRA 5FD6A 1XNDA 3RSNA 2W87A 3BTXA 3GCMA 2P8TA 4QKNA 1JYWA 3TP3A 2ZO4A 1ULPA 5KAFC 4Y4YA 4GMP3 4XBLA 2PMZA 5HOOA 5FBZA 1ZBA2 4BL0B 5FBJA 4PIYA 3DYPA 3AMQA 2OJED 5C4WA 2CSOA 2WV0A 3E6BA 3D3AA 3BOQA 2GXBA 1G3TA 5KHJA 2AR6A 3OMYA 1OD3A 2LF8A 4BS9A 1EJ9A 3BALA 2XBO2 4FE7A 4AYBN 3INAA 3GBFA 3S1QJ 2OUJA 1I6HJ 2GH2A 2QUFA 2ZACA 4JRLA 1PGW1 5GTHC 2H1LA 4FBFA 3BYWA 4UFHA 4V2FA 2MHFA 3MPBA 1NZCA 1L0OC 2F5EA 4BQ1A 1YS6A 3U75A 4GCVA 1QA6A 3O0XA 3HVDA 3LQCA 2UWBA 2HVQA 2VQHA 3I59B 2CUJA 4D8MA 1FT9A 4YARA 1VBD1 4KDPA 2NS8A 3FFZA 5BV6A 4NNJA 5A7QA 4LITA 1AR62 4DEVA 4M3GA 4QGMA 2W0XA 1U3EM 1DQ1A 1ENXA 2WSUA 1PUFB 4NPMA 3F6OA 1ZQ3P 3PL0A 3H7JA 4XURA 5FKBA 1HKSA 5HI0A 4JTNA 1G9DA 2ZXQA 3TBDA 4COUA 1AXKA 5ED4A 1HB3A 2VBZA 5E20A 2VVFA 2X6OA 5L3EA 4FETA 3C7EA 1S0IA 3NL1A 2QZ2A 4D6RA 2E1MC 1D5YA 2PLV1 2OA4A 3RFRA 2V4VA 3UKTA 2HGCA 4PF1A 2R7WA 1LE8B 3SZPA 1X4OA 2K9ZA 3DXUA 3I56I 2VL8A 3BPSA 3FHAA 2W9XA 2L9VA 1X2NA 4NIIA 2Y9YA 1VRBA 1NX9A 4M74A 3FL7A 4PDWC 4JX5A 1BLZA 3F21A 2DUQA 1XYPA 3UV9A 2VECA 2ZFWA 4E8CA 3AP5A 4PFPA 1ODMA 1H2KA 1R58A 4DZGA 5D8KB 3VYSB 1Y0UA 1GWMA 3SXYA 3PVOA 1KU9A 5FPAA 2PAEA 3ZIWA 3V8JA 4OVEA 4HG2A 1VBB3 1XPWA 2FCUA 2R7FA 2Y0SA 2A69F 5JHFA 2JJ7A 3BPVA 4QX0A 1DQ6A 2V9VA 3MPPG 5FZ0A 5A80A 5FLMJ 3FJSA 4BXXJ 1LDDA 1OOPB 2M7AA 3Q8BA 2F6BA 2VZTA 4G9SB 4LIVA 2YDEA 2ZGNA 2BY1A 1YLLA 3RYPA 3DBRB 2XVKA 4SBVA 2RJKA 3UKVA 1RC6A 4OMDA 3MQ0A 3THTA 4NIDA 4UXNA 2O5RA 5DDJ2 1IF1A 4LUMA 1DZTA 1ZGAA 5IFTA 4IGPA 2E2JJ 2DA4A 3GJAA 3WP6A 2ID3A 3L9FA 4C9YA 2HWF1 3JW4A 3M3QA 1SFOJ 3KF5A 3GNEA 2RMU3 5CFDB 4HNTA 2XUBA 2WB1N 5D6EA 3AP7A 2HWB1 2QBXA 1XB4A 3GTKJ 2A3YA 4M3CE 3WHTA 2BZDA 2VKDA 4FFHA 2A07F 2JWPA 4QX7A 2W46A 4C1XA 2VW2A 1SFEA 2VH9A 4J6GA 3GZNB 2JIGA 1BJAA 1QY4A 2ECCA 2VZRA 2W25A 1S5LC 3UJOA 1VQ8I 3H3ZA 4MYEA 2D3RA 3E6DA 1TME1 3OS2A 3KLSA 3I49A 2OQGA 5B1AH 1TTYA 3CTAA 3D82A 1D0ZA 3M8JA 3UNGC 1WCKA 1D4M1 1UW8A 2B9VA 5F2WA 4QDQA 3NWTA 5FKLA 3WT3A 2ORXA 2AUYA 1JOJA 1PO22 1FPQA 3H8UA 1JUMA 3LPGA 1XGNA 4COWA 3RZDJ 4I99C 5ISLA 1LB2A 4HDVA 4ET7A 4ZZ8A 3MIDA 1V9U1 4JGYA 4QX3A 1UN1A 2XAFA 5I8SA 3B02A 1T56A 2EFOA 3O1VA 3CCYA 2ZKNA 1SCSA 2JZYA 1IXCA 2YBSA 1REDA 1WKYA 3DPRA 4NQWA 4XKVA 1AXYA 1H8TA 1ZZ9A 2XPWA 1QNTA 4O61A 3WY6A 3WNLA 2JA8J 4PBPA 4AGRA 4MLOA 1WUVA 4A3CJ 1SCRA 3OUIA 5CG8A 1YW7A 4IEVA 4BQ5A 1VAVA 3BR2A 1W2TA 2VBXA 1YQ5A 1MMGA 4O3MA 5LA0A 3U21A 2W47A 1XNTA 4IEOA 2DF7A 2BVVA 3ETQA 4MZUA 3OY8B 4P5YA 4Q0UA 5EEHA 3DCQA 3GFIA 2F4OB 5C4WB 4RGSA 5CU1A 5C4WC 5CJ9A 1PZ8A 2CW0F 4XF9A 4B1LA 2F4LA 4BKXA 1FEXA 5GJ6A 4RN5A 1WQ2A 4L0ZB 3BB6A 2Q1MA 1JZ3A 1XQNA 4HANA 4IEWA 1ETOA 2K9QA 5B1BH 4XFGA 5K9YA 3NEUA 1QJEA 1POGA 2FQ3A 2VUMJ 1CF7B 3VSLA 2VXDA 2ZGPA 1OT5A 3T0BA 1RR8C 4KICA 3ZXLA 3M7GA 4LO8A 4RD7A 4XJZA 3PUSA 4M9SA 2E5NA 3OPZA 2JG9A 5FDBA 4DIQA 4PDWA 3JBG2 2WT1A 5CISA 3SFZA 2Y0MA 1QZYA 1D4M2 5KCMA 1JYVA 1JZ5A 2A6VA 4UY8I 1D2SA 2E71A 3CDHA 1C1FA 3HOTA 3VD5A 1T6SA 4A69C 1B59A 1U9NA 3WCSA 4OMCA 3WTTC 5F08A 2BGPA 1FTTA 3KGLA 1ZM1A 1VBA2 2YX4A 5JLXA 4QPQA 3GEZA 4XQDA 3T08A 1EAH1 4A2UA 1O6UA 2PQQA 3K2OA 1PZ9A 2BOJA 5CPRB 2DTWA 4W97A 1S4CA 4M6XA 1J9IA 5LB6A 1LENA 3KCYA 5J1XA 4WF2A 4YM2A 1AR83 4QM8A 2YUSA 3M8LA 2HOEA 3OPTA 2L54A 1YW9A 4CCJA 2JRMA 3CCEI 1XRUA 1QHDA 5JIUA 1HRV3 4LLGF 4BQOA 3I3EA 5FYIA 1PVEA 3EUHC 2GNTA 3H8XA 3I3DA 1FYLA 3ZO0B 4QKBA 3CKHA 4HETA 2FZ1A 4RAGA 5FR3A 4L0PA 4S04A 4IEZA 1I3QJ 1V6MA 4EQQA 2P4EA 1BW6A 2ZXJA 3IWFA 2VT3A 1U5TA 4N7UA 4K8FA 1Y39A 4U0VA 1HB2A 4H2AA 2FRHA 3FHNA 1QJFA 3DEUA 4QPOA 5DABA 2BNNA 4FPHA 1ZKGA 3LOCA 3V0BA 4UBGA 1H1IA 1W6NB 4CICA 2WDBA 1IZ3A 5BMZA 1FYMA 3HRTA 2E31A 2A3WA 5FJ8J 3KT1A 1XBFA 3B9CA 2BPA2 4MXWB 4RAZA 3OTFA 4EN6B 1OYWA 1MNMC 4MNUA 1ZBE3 3MDPA 1JYXA 1T0FC 2LBFA 5KHDA 3AP9A 2MPFA 5FKCA 4LK1F 3SHRA 1A3KA 3DTKA 5EIYB 3IBMA 2R7QA 1LHNA 2DYRH 4IOCF 3JTGA 4WZCA 4B4PA 2HEYF 4COVA 4HN1A 4K40A 3Q5FA 2CWSA 2XPVA 4F93B 2VZOA 4JOMA 1R092 3T4VA 4CRQA 4LK7A 3BTIA 3WZ1A 1TQ5A 4JAAA 2Q8EA 3DU6A 1Q8OA 4PDWB 2WV1A 3HPHA 4JX4A 3W9AA 1T39A 3CC7I 4FPOB 2MBFA 1ZX5A 4Q48A 2WWSA 3ZMUA 4UI9L 4Q4W3 4IGQA 3AG3H 3ZYJB 4NO4A 5A32B 5E3NA 1COV3 1OLQA 2C4XA 2MD0A 5I8TA 1H6YA 2X6XA 3DCFA 4UWDA 4GH4B 1YIOA 1K7AA 2V9KA 3M1HA 4MO7A 4OI0A 4RFT0 3AXDA 3NJXA 3N9NA 2XJVA 3UGGA 4XYXA 2ZXHA 1CAUA 1PMJX 3NQHA 1ZG3A 2FDGA 5JPNB 1UL9A 3WDXA 3MN2A 4KMFA 1FSEA 3MEPA 1GVJA 2EV0A 2HKXA 2JDHA 2OQ6A 3KP7A 1WW7A 2NVQJ 4OIPF 3ZKYA 2RHPA 3D8CA 4MGIE 4BJ0A 4FQ4A 3NJZA 3M3EA 1MMSA 5A3WA 1FP1D 2A1XA 2GQQA 1UU4A 3S8PA 3ZMNA 3GZAA 1UAAA 4NOTA 1REFA 1FNZA 4AYUA 2XHNA 2WFF3 3T2TA 2WWYA 4HXCA 1UZYA 4IE5A 3S5AA 3JXSA 3TKYA 1E2XA 1FC3A 1VPHA 4HK8A 5J6XA 3TN91 1O7FA 2P3KA 5C3RA 1N1YA 4E4SA 4MTEA 1F1ZA 3JBG3 4C3IJ 4EM0B 4ZU4A 3ZYHA 3JRAA 4XLEA 3U0ZA 2CGNA 1OYIA 1CZSA 1RUC2 1ND3B 3T1MA 1CPNA 5LGUA 3QP6A 2MGQA 1EPWA 4O65A 4Y1ZA 2W91A 5C9AA 2VOPA 4EN7B 5IVFA 2HVSA 3FBYA 1YFHA 1JHNA 4FCAA 3G7DA 4K1YA 3QPTA 1BEV2 1Z78A 1R4MB 5ILVA 2RGVA 5JWPA 4BQ2A 2Q8KA 2MABA 1RUI1 5K7ZA 1VP6A 2HWC3 3TYJA 4L9JA 5L73A 4BISA 5EV7A 2R7DA 2EZKA 3CCLI 5A3NA 1B09A 1K5MC 1UHMA 2WO2A 3O12A 1OA4A 3LFUA 3AG2H 3JRIA 2CV0A 3HOVJ 4A6OA 3HZJA 3ZXDA 1IS3A 1AYN3 2OYZA 5E6HA 3WINE 4AI9A 4NC6A 3OGSA 2DLLA 2DTYA 2LSOA 1EP0A 4ZONA 2ISZA 3VHPA 3ZN6A 2JT1A 2ELHA 2ATFA 4ZXEA 4B3AA 2RS31 1H4GA 5FZBA 3NRVA 2Y6GA 3K4ZA 3KP3A 1I1EA 4ON0A 2K86A 2JB4A 4EATA 3CMMA 4ZZLA 5JXGA 5A2QZ 1LDJA 3KP4A 2IGKA 2WO7A 2OUHA 1G9AA 2QGUA 2EZIA 1GV2A 2QDRA 1QIQA 3PFYA 1OQDA 1WJDA 2HXIA 4AEDB 5IVYA 5FFXA 1VFCA 2QCSB 3VBUA 3MKWB 3W3CA 1WA4A 1WGPA 4YELA 5EPAA 1OQ1A 3T0AA 1P92A 1PIV3 4XTPA 3J7AO 1TME3 4AI8A 2O1QA 3AYEA 1NG0A 4O5VA 2JDMA 1J59A 4D7MA 3FN9A 1GNYA 1MQTC 4BEHB 3GTGJ 1IS4A 3VKMA 3NNFA 4FTEA 3RVHA 2ZBKA 1X33A 3HC7A 4FQGA 3ZX7A 4YW6A 1HDKA 1QJX2 1A36A 1AX2A 4XAAA 5FUPA 3ES1A 3CCJI 3KZ4C 4A7ZA 2PJPA 5CLSA 2BBYA 3GFLA 1RXGA 4HYEA 2VXZA 5BNNB 3JCIA 1RUG3 5BNNC 3ZM8A 2X5IB 2WKKA 5JAXA 2AZ5A 1RVF3 4IEXA 1ZBA1 2R49A 1OJLA 4XW3A 3K1MA 3G4SI 4ZYAA 3CLPA 1G8XA 5J47A 5E16A 3KM5A 3G1LA 1WJBA 4HOBA 4YVSB 2I8DA 1MQTA 4BZ4A 4FPEA 3W6JB 4IOAF 1CIWA 1DF0A 2PMZN 5CG9A 1IN8A 2QQ8A 4Q4ZF 4ZU5A 5KXEA 1EAH2 3F0CA 2HYFA 3W5MA 2KIQA 4B09A 2ZAHA 5FY9A 2R0FA 2GM4A 2KR2A 1JYNA 5DCFA 3B69A 5AC91 4Q0VA 1PX3A 1S2EA 2DJIA 4B4RA 1EA3A 1QNWA 3KVAA 2J5OA 3H0DA 3OJBA 3UJQA 4D7YA 3DBHB 4U87A 5ICEA 2QDNA 2HPMA 4HW0A 2V1DA 1C5IA 1SC7A 4AQ6A 1JZ4A 1OH3A 1CN1A 3TOAA 1HOMA 4A0XA 2OTJI 3O3KA 2EFWA 2VY0A 4Y20B 3O0VA 3OYFA 3BQYA 2WN3A 2Y6LA 3PDQA 1FPN2 3R4KA 5ANNA 3H5RA 4ZDLA 1Y56A 3IAM2 2XGDA 2JG9B 1WWXA 2ZMEA 5JXIA 4MV2A 2E1NA 4WM8B 3BT9A 3DV8A 3A0BC 5C3SA 2UY9A 5JCTA 1IN5A 3USSA 1HQLA 2R5YA 1RUJ1 1UYZA 1ZGWA 2R7XA 4YZ4A 1WW4A 3D4KA 1PM7A 4C8DA 5KXDA 3FIWA 4CCLA 3OBZA 2X09A 4P00B 5T5LA 3MLLA 3JAMK 5C3PA 2CSGA 1LGCA 2ZHNA 1X2MA 1C4RA 2X48A 5IT6A 1IRXA 4QDRA 5DCMB 2VUDA 3QP5A 4P14A 1J5YA 4XCAA 3S2DJ 3IM0A 4ABZA 5EGOB 1W8UA 4G3YC 1USTA 5M5WJ 3S15J 3THPA 2AYHA 4IESA 3JD72 4EWEA 3BCAA 2P5VA 5L36A 2L0KA 2LM3A 1O4TA 4BQQA 1J1LA 2MH9A 3ACFA 4GH4C 2WTEA 1XX5A 4OZXA 4Q4X1 2DAOA 2BY2A 1RB8G 1RUG2 2IXLA 3A03A 1VBB2 3FUOA 3GTQJ 2W52A 3KCCA 3SNMA 1UFMA 3MIHA 2Y6HA 4Y15A 4A3LJ 2E5ZA 1LHWA 1VLNA 2OD5A 4G9YA 3F23A 5F6KA 4FPFA 2H6CA 3ABUA 1LNSA 1JW6A 1PHMA 4KI5M 3TN92 2VQUA 3BCWA 1VBA3 1ST8A 1YJLA 4ZS3A 1RZ4A 2CGPA 4INDA 2VPVA 5JDBA 3CCVI 4YWAA 4H4KC 3SEZA 4UW6A 5FPXA 1TG7A 4ENNA 1V6OA 2A6WA 2ERFA 5KHKA 2QM3A 4LR4A 3POEA 3RDIA 3H35A 4HKOA 4LNVA 4A7KA 2BTVC 3BI3A 2O9LA 1PGL1 5BUVA 2PAKA 2IGNA 1QJX3 4E7ZA 3A23A 1YQAA 3WQ7A 2W85A 3S30A 3HD8B 3OBRA 1XN7A 5BNNA 4HAMA 2JA6J 2XQXA 5E3OA 2Z69A 3K3NA 5FXXA 3BTZA 4FSJA 4B8XA 1CQ9A 2GMEA 1QMJA 1HB4A 4RS5B 4C1WA 2WLQA 2V4JC 2MG4A 2Q8DA 2L2OA 2OVUA 2KA3A 1H9PA 5FKOA 3P3PA 4Y22B 3GX4X 1UHWA 1YJNI 2HZDA 1G6NA 2JKXA 4WM8A 5JI6A 2WC2A 5C3OA 4RGKA 5IK7A 1S3JA 3WEZA 3CJIB 4XJ9A 5M3FJ 5JOWA 1S29A 4XQWA 1RUE1 3WDWA 2H27A 3VZMA 1VMJA 5EP9A 1DP7P 1R091 4AQSA 5FZ1A 4Y20A 3I7DA 2ZHKA 1XMAA 3H0OA 2CV2A 2BHZA 5EEAA 1X82A 4A12A 4O9EA 2WFPA 2VC9A 4U0YA 3O1MA 1KGSA 2EH3A 1OFSA 3APBA 1AL22 2DU9A 3THDA 5FLXK 5HLTA 4M00A 1SPPB 4XTMA 4FTBA 5CVVA 2IUWA 3OGVA 1MDMA 3J80Z 3LE0A 4XLFA 2LY9A 1LVAA 3MUY1 1YQ6A 1LECA 1KZHA 4URTA 4IV1C 4Z2YA 1ZZCA 2KPMA 3WOGA 4YG0A 5IFPA 4B8EA 1NOVA 2DCKA 2Z5UA 4CE8A 1O3TA 4GYGA 3HJRA 1BR1A 2MFZA 1G86A 2ZXIA 1RVF1 1W36D 5IVJA 3HSFA 1F15A 1LGBA 3SKVA 1JKOC 4ASKA 2L9NA 1KITA 2HFHA 5FK8A 4I3GA 3THCA 2EZHA 3T0YA 1J58A 4TTGA 2BEOA 1LUJB 5L3GA 2VMCA 2WAQA 2BP6A 4RL7A 1ZLKA 4QSHA 2WS91 4ATEA 4A6EA 1MQTB 2VMIA 4RDUA 5C3QA 5LK5A 3CCQI 4GIQA 4XBNA 3Q3SA 3T2OA 2LUWA 2R4GA 3W59A 5M5XJ 3J7HA 1BL0A 2JWTA 2Z4FA 1LJ9A 1F35A 2DQRA 4PGGA 3LEKA 2R072 2JX9A 5DUXA 2DDBA 5LW9A 3F22A 4B3NA 1YQ8A 5IYBJ 4DXZA 5C9AB 1GOFA 2W3JA 2A61A 2G9FA 1X9TA 4YFXF 4IE7A 2O8XA 4W4ZA 2QCOA 1U5YA 3LD8A 1PGSA 4ES8A 2E7WA 3WG9A 1RYYA 5EQUA 5J37A 1U8BA 4TXWA 5K5RA 2JVGA 1MVEA 2QKLB 5F3GA 4FP2A 2KT0A 3AP6A 4DEQA 5D8AC 5F0HA 1JGGA 4KG8A 2A05A 2VKEA 2B7YA 4ASLA 4QXCA 4S2HA 4KG0A 1AL23 3FZ3A 2QTWB 4HX4A 4KNYA 1T0FA 4DB5A 5DYMA 3KV6A 5FZLA 2BZTA 4CEWA 1RJ7A 4XOGA 3N05A 1MEC2 4DRRA 4AE2A 1NXMA 4G4FA 4LK0F 2VPRA 2LTPA 4LBNA 1AR93 4LBQB 1FOD3 5B4XA 3A1YA 2HWD3 3BODA 2VT2A 4PZJA 4D7NA 1XS9A 4BLIA 5K8SA 3OB8A 4FFFA 4Q4W2 4UAPA 5HDKA 2XUEA 2JUCA 1GOGA 5FO9B 3ZQCA 3DP7A 2BW8A 4CPBA 2OPTA 3RGBA 2AS5F 4LB5A 1MS3A 3POWA 4BLJA 4HL0A 1RUI3 2HWC1 5FYVA 1SLBA 4GULA 4A3GJ 3VBUC 2Y8KA 2GZWA 2GN3A 1OH4A 4MGKE 5DG2A 2PHXA 5FKNA 1IKPA 2WT0A 1YI2I 4OUEA 5GP9A 4PJLA 2FMLA 5GAGJ 2F6CA 4LBQD 2EQRA 3QODA 3QBQA 2WZ8A 4IUGA 4FTHA 4PBOA 4EYUA 1U9OA 2JDYA 3WNNA 4HSJA 4R4XA 3E1F1 1R7JA 2XPUA 2KD7A 1R1UA 5EF6A 3OYKA 3GHNA 4C0BA 1R4NB 2HI3A 2ZKLA 1RTVA 4IQJA 4CXXA 3S17J 4Q4V1 2EIMH 5I0RA 1BC8C 2WT2A 3LSRA 2YPDA 1UOJA 5DCMA 5J3UA 2KL4A 3LGRA 3ZQHA 2KIMA 2FOKA 4F7ZA 4ZS2A 4GJYA 2RVAA 3HN1A 4IGOA 4C91A 2X10A 3CU7A 2OZ6A 1WH5A 5IP9J 2Y6FA 4FPYA 2O8QA 1LU2A 4M3FA 4OZOA 1HW5A 4P9UA 4YW5A 3FXOA 4KWLA 4NMIA 4XKBA 1P2FA 5D5WB 5KK1A 2QBYB 1I9RA 2P7CB 3KYCB 5D2AA 2HZTA 4IRHA 4IL7A 4CDUC 1N3OA 4XMIA 4PLOA 1RJ8A 3LCPA 3V56A 2W94A 3LSTA 2ESNA 3DEEA 3IMMA 4MVTA 2PQ8A 3FWEA 1WA6X 3IIAA 4Z1VA 1W6MB 1QEXA 3SKJE 1DCSA 3IH3A 2WBMA 2MH2A 1DDLA 3HJEA 4XLPF 2TEPA 3ZDSA 1NLRA 4L92A 3FLPA 2KRFA 3KT7A 2DMNA 1JGSA 1AOYA 4AWXB 4FX4A 3A2KA 5FXWA 1F9NA 3OR1C 3S5QA 5FP7A 2D45A 4NQWB 3L09A 1JTZX 1OBNA 2RS11 4Q29A 2FDKA 1CAWB 1IRGA 4AHYA 2N8GA 4HZFA 4QKFA 4G6TB 3LFIA 5H9QA 4KN4X 5M0TA 2VMHA 1R1VA 5F6LB 4V19K 4IV1B 4I3PA 5C8CB 3HSRA 3GTLJ 2ET7A 1KQ0A 1BC7C 4A3JJ 2DXIA 1JU4A 1XYNA 3C3WA 1NE4A 2HDWA 3LEIA 4LTAA 1H9TA 4YRVA 4UFLA 1LOFC 3RI4A 1CESA 5DMYA 2JDZA 1FPN3 5DM7F 5E1RA 1NG7A 2JG8C 2RMU2 3JB8A 4AFBA 1ZLJA 3LAGA 4DRVA 2CWMA 3OR2C 2AXTC 1EUTA 4E70A 5E8AA 3C2HA 1RINA 3CCSI 2VTFA 1XGMA 2EZLA 5DXDA 2W5FA 1O4ZA 4XDPA 4OINF 4AC0A 3AM2A 2DA5A 5DAPA 2ZMLA 2VUAA 3N7JA 4XUQA 1CF7A 1C57A 1GLNA 3X29B 2UY8A 1BEV1 2GWRA 2K40A 2UWMA 3PNVA 1STMA 2ZABA 2HR3A 3WG4A 4AVAA 4RGGA 4LE3A 2AH2A 4UF0A 5JXJA 2COMA 2NS7A 3SCGA 1O5UA 3B00A 3V0BB 3KB5A 5A33A 4O9GA 1YI9A 1PO23 1FXZA 1MS8A 1H2LA 4Q8KA 4EWAA 4WM7C 2A6XA 5A3MA 4WM7B 1UG2A 5T52A 4AAPA 3J81Z 3S57A 2HTJA 1IZ1A 1XSDA 1QH7A 3HUGA 1ACIA 2GOXB 4AZZA 2DCJA 4PJNA 5C3EJ 4DJAA 1TBXA 2C1FA 3KZZA 5FZKA 4UV8A 2JIJA 2RN7A 1RC9A 5BNGA 2XONA 4BPZA 2H8RA 2VPLA 2M30A 4A3XA 4M4PA 4E7LA 3USUA 1XC6A 4K3UA 1WW6A 3RYRA 4YIIA 3HXLA 1F5JA 3A01A 2XUMA 1YE9A 4RAYA 2XC7A 4Q4X2 1HCRA 4EZ4A 3M7AA 3WDYA 4LKDA 5IT9Z 1QKQA 1G3SA 4OWRB 3G1MA 5BS6A 5CQGA 5IK5A 4CYCA 2VC0A 3BVCA 2UYAA 3JZVA 1IGNA 5DTDA 1CAVB 1FPN1 1WFXA 3JB4C 3N9PA 2LYCA 2XB6C 5DDJ3 4SLIA 3LEGA 2UWCA 2IAIA 3K4AA 5FPUA 5FMOS 5A7OA 1W2AX 4DW6A 4RQPB 2OPKA 1ETYA 2VONA 1V54H 2XH6A 3C7FA 2J7MA 1VQPI 2FQ4A 4CXYA 1H1AA 1MBKA 5IYYA 4XEZA 2QKMB 5CFDC 3MWMA 5AC93 4XM3A 4A3MJ 1RUF2 4GRIA 3WG7H 1QOOA 4MFDA 1GOHA 3TBIA 1NYWA 1Z1DA 1LEBA 1ZHFA 4BXUA 3LDBA 2Z2SB 2W95A 2YMZA 5JR7B 2QLZA 3K0LA 1ONVA 2F4MB 4G7OF 3HT1A 5HPOA 3ITQA 1B9MA 2VJIA 1GQHA 4BUPA 4IE4A 2OIIA 2HKOA 3LQQA 5M3MJ 3P7NA 1U0AA 1WLDA 2EFNA 2CFXA 3JRHA 1BOBA 1YTYA 3FC0A 1SMVA 1PO12 2P81A 3AVRA 3D5RC 4BBRJ 1WLWA 2DA7A 3OYJA 1GR3A 3RZZA 1YYNA 4A0YA 1RL3A 5C4JJ 4IV3A 5IJRA 4AAXA 4YFZA 1MBHA 3V4GA 5BOXA 5FYUA 4Z82A 1ODNA 2Z99A 4KWJA 2OV7A 2R30A 3NV4A 1JH5A 2D6OX 2H0VA 3E6CC 2R7VA 2C26A 2JA5J 5CYVA 2E7QA 1Z7LA 2DFEA 3WHUA 2FD8A 1YCIA 2BQPA 1NCRC 2XXZA 5A7NA 1UHSA 2IC1A 2BV4A 1TL8A 3ZXAC 1GT0C 2HQRA 3DPLC 1MVQA 3RYKA 1AU7A 1OPOA 3SITA 1W0UA 3ERED 3DPRB 2Q8OA 4XOPA 1AR63 3FXJA 2RR12 2CG4A 3R60A 4XXPA 2M4KA 5FQ0B 4XJWA 1XMKA 4YFNF 4AIDA 3M3CA 1I1SA 1NQDA 2XG3A 4LJZF 1UF2C 4YGBA 4E8DA 4IO9F 3CNAA 4N9HA 2QNKA 1WBFA 2UYBA 1MZ6A 5T54A 3P5JA 4CDQB 4P9XA 2E7AA 3GXOA 1FAYA 2B5HA 4MGQA 2WS92 1FOWA 1VQMI 4KQ7A 1P4XA 1NK2P 2FDJA 1HV1A 4EROA 4YLZA 3LSGA 3U37A 2H0BA 4UXAA 1MS4A 1UOFA 4R8HA 4M3DA 1Y8QB 5CVUA 1FOXA 2YYOA 3RS6A 1UMQA 1IO2A 4ARXA 1YQCA 1F2NA 1IUYA 2Q2EA 5HLHA 1JZ2A 1X19A 5KHIA 2Y31A 3QOEA 4B4CA 4N43C 2BU9A 4F91B 1TW2A 2R7TA 3B6CA 4ZYDA 3CC4I 2WNVA 4MUVA 2OS2A 2VJ4A 1POV0 3VHRA 3HOYJ 2QQWA 3NWSA 2I5UA 2GBYA 1Z7S1 3EUKL 5F2SA 1IJWC 1RUF3 3ZMTA 2K9LA 1YX5A 2QQKA 2IS1A 3W6VA 4I6ZA 2TBVA 1UOGA 5SV5A 2XF5A 4EE2A 3DECA 5C8CA 3UT0A 2ZFUA 1S0CA 2XVLA 1QQP1 4M73A 2Q5TA 1JKRC 3I59A 5EFUA 1Y1WJ 3E6MA 4IEQA 3DUIA 4XRSG 2R061 2E9QA 1JJ8C 3DF8A 3AZXA 2D44A 2C9AA 2XWJB 5JZGB 3ELKA 5C5UA 2OKXA 4E4HA 1PX4A 4BJTA 4FT8A 1U0JA 3USUB 5ILUA 2IVJA 3WUCA 3T3YA 4GB33 2ZB9A 4RYDA 5KC6A 1VMHA 4Q0QA 2BFUS 5IHRA 4IX7A 3DLLF 1OCZH 3CMYA 3QU6A 4CGZA 4U7DA 1HRI3 4M9XA 2DBBA 4AXOA 3CJIC 3BOPA 2COBA 3ASNH 4WXDA 4A6DA 1AJKA 3DU5A 1C8M2 2YUEA 4XJ8A 4WM7A 2FEZA 3PUBA 5FMCA 4WV8A 3RQ4A 3SFIA 3H42B 3LSHA 3KV5A 2MYSA 3M1EA 5EDNA 2FNPA 2J1EA 4G94A 5F27A 3J26N 4A4AA 3ENRA 4DGWB 2Q1FA 2HWB2 4DMIA 3GALA 3P9IA 4LG3A 2HWD1 4WVVA 2ZS6B 1ZZ7A 4XSZF 2IEKA 2Y75A 2A70A 5LBBA 1R36A 2D5HA 2RS12 1FI2A 1UB9A 4RGRA 3OUJA 3WP4A 3OYGA 5F7UA 3AL5A 2R0QC 1D1CA 1OKOA 3BZKA 2ZNZA 3VBHC 2XKOA 5AVAA 2OUMA 5IAVA 4R1HA 2LKPA 4IQPA 3KGZA 4Z8BA 2WL1A 3MFCA 3O8GA 4KITB 2KFDA 4IV3C 3VSKA 5FLHA 5FZ9A 2R16A 3BR3A 4E27A 3HEFA 3VZLA 3B01A 1FBUA 5BPIA 4QU2A 3D5SC 2DVBA 1HIXA 2XL7A 1JBCA 3ROUA 2D5VA 4QPIA 1Z77A 5HXVA 2V79A 3C7GA 4IHSA 1RUC3 5HXMA 1OISA 4Y33A 3U14A 2WQ8A 3ORJA 2RS53 1Y4WA 4GB31 5FZFA 3ATGA 1Q5OA 4LBOA 1SDWA 1LGNA 1WMEA 5IK4A 4BHBA 3L2CA 2HWD2 3WV6A 2E34A 3U1DA 5F5AA 4OCTA 1R093 4M3BA 1AVBA 2DMPA 2RAEA 2TDXA 1FLIA 1QO0D 2BBAA 2VR4A 3LKJA 2Z16A 1Y9GA 2NOJB 2DQLA 2X5IC 4CU6A 4R9DA 3OV8A 3TDUC 1VBC1 3OS0A 3WF3A 5HDNA 4OYUA 3AG4H 4BJ5C 1SBDA 3D0SA 4OI1A 1QHHD 1W8FA 1T8IA 4DFSA 4RHV2 1X3ZB 1N1SA 1LOCA 3H1CA 4DOUA 2ZGQA 5DZEA 1HDDC 2D7FA 4AWDA 3PUQA 4MHRA 2W82A 1VBE1 3H5AA 1TQPA 1ZTRA 3JUUA 4LA3A 4I0BA 1HKTA 1A8MA 1EV11 4UF0B 3DXJF 1DDNA 2XAHA 1PIV2 5FD5A 2YC2A 1TNSA 1VALA 3PNAA 4I09A 1L3LA 4GALA 4D69A 2XGXA 5KC5A 3LOBA 5KHGA 1BI0A 1GHCA 1VRH2 2DCEA 4MHGA 2E35A 1WI3A 3ECQA 3ZSKA 2RQQA 3UGFA 3AX4A 1QQP2 5F0FA 2WNVC 4AK3A 3H9JA 3IDEA 1J84A 1IN4A 3MAJA 1Q43A 1V00A 4FPCA 1GZWA 5LBFA 5FRAA 1UOBA 5FB2A 3PMSA 3RTRA 4DNCA 3FK6A 2WFF2 2PTMA 2DURA 1VBE2 4ETSA 4QB6A 3WQ1A 3T5XA 4X8NA 4OQ9A 3VBUB 2ZHMA 4ZJZA 1PK6A 5GM0A 1IHMA 3W2WA 1SG3A 1H0MA 2DODA 3F95A 2AHQA 3OUHA 2JPBA 4L9NA 2WO1A 5K0UB 2DN0A 1D4M3 5EWSA 4YVWC 3SEPA 3WLUA 4ESJA 4CCEA 3AMHA 4HT1T 2V1NA 1NLSA 1JTXA 4AIHA 4W6YA 4A0ZA 3KEOA 1CAWA 3HHGA 3TWIA 5HNFA 3ZYGA 4MX3A 3I4IA 3ETPA 4QPYA 2BOIA 2XROA 1IPKA 1DQ4A 2JPCA 2HWF3 2QKDA 4XZUG 1T6GC 4Q1RA 4IE6A 4E4DX 2PAMA 3CO7C 2HU9A 5AFEA 3VBOB 4ZDPA 5FO8B 2YG0A 1UAIA 1UZZA 1KRIA 1S2KA 2IXJA 3WHCA 2HWE2 4R52A 3O5SA 2LFBA 3KLOA 1CVNA 1HLVA 2LD5A 1TMF2 1VQ5I 1V6NA 4I02A 2ZX2A 3OYEA 3FM5A 3G6JB 5FLXZ 2X1EA 3U2RA 1H8AC 3AP4A 5BNQA 4QIWN 2DT6A 4YG6A 3FDYA 3M4OJ 4PCQA 2Q0AA 3J7NA 1UU6A 2IPQX 2R93J 4QB1A 5DAWA 2V6EA 3NSTA 1O7LA 2WZPP 1QHGA 2NNNA 1ZZ8A 4K2EA 4EM1A 2PHDA 4YZ3A 2X1DA 4V1PA 3SQOA 3HRUA 3NKTA 3TOBA 3LSEA 1V3FA 3JU9A 1V9U3 1IG0A 3ILRA 1LQ1A 5A3UA 2P7VB 4NRMA 2V1UA 2IXHA 5ABJA 2ZJRF 3NAPC 3TP0A 2Y69H 1CX4A 1QU0A 4PLNA 4L5IA 5L3BA 2X85A 2WIIB 5CADA 1WCDJ 5GZDA 4IEPA 1YS7A 2DMTA 4YSFA 1QXPA 3REOA 1HA8A 1VE0A 2C5DA 3CUQB 2CAVA 4UUSB 3ZQGA 1HRV2 1K42A 3VYTB 3R61A 5FKMA 2LW8A 1DYOA 3ACGA 1CAXB 4L9VA 1VQKI 4AVVA 4H55A 4BAYA 2E51A 1RMU2 2EBIA 5APAA 1SFUA 2CAUA 5H9PA 4COZA 2K4BA 1KJRA 1POV3 4ZHNA 1GDTA 2BUKA 3CL1A 4I98B 4XBFA 2ZGKA 5EJCA 3S16J 1PJRA 1GUUA 1VTNC 1GQGA 1H30A 1PDNC 1AR61 4P9FA 3ZR6A 1KONA 5T5JA 2ZEZA 4A5MA 2HEOA 1MACA 1NKGA 5D6FA 4J01A 5F32A 5FUNA 2G4IA 1RITA 3V8LA 4CYCB 2OT7A 5FWJA 5FKKA 3NV3A 3MKZA 3ZFEB 5E8IA 3H5NA 5GKAC 3RRDA 5TISC 5JIAA 2VUCA 4C3JJ 4U7BA 3RZKA 2XJPA 3EQEA 2MD5A 3C2UA 4UVBA 3WGHA 4CH7A 1H8VA 5H2FC 4FAHA 3ILFA 4Q5OA 3KZIC 5FK7A 1WBLA 1IPJA 2ID4A 1QJZA 2NVTJ 3RMYA 1Q1VA 1J1TA 5F5CA 2VBYA 1XOYA 1E3PA 3CUQA 4LKFA 2RS13 1SZBA 1FBQA 3S2HJ 2WR9A 2QQIA 3HR9A 1CQTA 3KLNA 2ZJQF 4BQAA 2P5BA 1HW1A 4P9IA 1KU2A 5GADJ 2YC0A 3CLQA 4RM3A 1TME2 3OEBA 4KU7A 4K8RB 3MGUA 5K7PA 4RHV1 4BE1A 1JT6A 2XAUA 1NLQA 2IP2A 1VQNI 1BIAA 1S0DA 4GKXA 1RUH1 1RR7A 4QHBA 1KU7A 4UHTA 3ASOH 4UW3A 2VTXJ 1U5TC 3N4MA 5L9RA 2EFQA 1MS1A 3Q8FA 2JDNA 4IETA 5A1FA 3WF2A 1EH6A 2CUEA 3ESWB 4KMUX 1K61A 2XF7A 5BXXA 1JKPC 1MMNA 4R9CA 2VXJA 4HLXA 2QQLA 4IHVA 1UMIA 1XDUA 3DLAA 2DT7B 3F9KA 2XQRA 3KV4A 4Q4V2 4CDWA 5L3CA 1AF9A 3S6PA 5DDJ1 2O0OA 5FY7A 1YX3A 1ULGA 3M3YJ 4G6QA 3K3OA 1F31A 2F48A 2P2KA 1UX6A 3FHQA 4DQ2A 2PHTA 2ZEXA 4D5FA 3N9QA 4JKKA 1NCQC 1CZVA 4PK4A 4E7SA 4AFAA 1NCQB 4Q0PA 1UZ0A 2L7KA 1RMU3 2E63A 3DL3A 3VBHB 2B42B 1JYTA 5GTIC 2KIUA 5CVJA 1LEMA 4YYOA 1QNYA 1B6AA 1MZ5A 3GZUC 3U4XA 1AYM2 5JVGF 3AYAA 1WCQA 4KA4A 1K78B 4QAWA 4JDOA 5J96B 3H3VK 1NA1B 2XV4S 3CP8A 4FFIA 2G19A 5IVCA 3O1OA 4ZDOA 3PVBB 3QCWA 1JUHA 2M0CA 1X1PA 1QJY2 4Y1XA 1Q56A 3T8RA 1OPMA 5KXBA 1DQ0A 3VBOC 2OCEA 5LD2C 4BE3A 3SEQA 1J2XA 2F4IA 1GZTA 2CW7A 5B4NA 3IRQA 1W4MA 2OZJA 4UBHA 2VN2A 3GZEA 1NCRA 1ZRRA 3IAPA 4XRFA 2B7EA 2YU1A 4EJRA 2EIJH 1Z21A 2EICA 2L7MP 1ITYA 2PLV2 2YBKA 5ABJC 2QBYA 5LHHA 3POGA 2A68F 4P1WA 4TV7A 4FAGA 2XASA 2WYSA 2X51A 2MEV3 1VQ7I 5D5VB 4YW4A 4RGAA 3DTEA 1BBT3 2DCTA 1N77A 3TN93 3DBLB 1TMF1 1S0BA 3M1CA 5CFCA 2J1SA 3CDZB 3ZXFA 3Q9SA 4QLCU 2J1TA 2IXKA 4AF9A 3ACIA 2K85A 1JHFA 1NUKA 3CJNA 2V09A 2KDOA 2R062 5EXOA 4FXKB 3PIOF 1GBGA 2ARXA 3ALQA 2WLPA 3ACLA 4OMYA 4CCOA 2PQSA 2Z33A 2LLKA 4D0PA 5CA6A 1JOBA 1A6QA 1VF9A 4HONA 4YVWB 4OULA 3RNSA 1HW2A 4KIFA 2M8EA 2DV9A 1APNA 2LF7A 2VZQA 3KP6A 2IJLA 3RQIA 4RB0A 2AQEA 3NJVA 1SFKA 1VBA1 2Y60A 5CFCC 3RKXA 2R5ZB 4CHUA 4NC8A 1O4XA 1EF4A 1LODA 2YFZA 2RS52 1R6RA 3OYNA 4F8AA 2C24A 4UUTA 2EAKA 2YPJA 1R1ZA 1UY3A 4YFWA 3FHIB 3L1PA 2Z1DA 2QQVA 2XF6A 4HPQA 4HOOA 2R041 1H9GA 1MKMA 1QJX1 4TN7A 3H9QA 4YW7A 4E7JA 4YZ2A 3CDIA 4B7KA 2DWRA 1Y3TA 5FXZA 2KRCA 1AKHA 3ZFEC 4K9SA 3MHZA 1UYPA 4C3HJ 4LB6B 1OLTA 2DMQA 1ULFA 1KDMA 3O14A 4CDWB 3K4DA 4CU9A 4IXLA 4II2A 3JRCA 3SCHA 2GOMA 4IHYA 1BVVA 2HYJA 3TL4X 1ZRDA 1OA3A 3NNMA 2NOGA 1IAWA 3OYWA 3IH4A 1K6YA 3WF4A 3HTUA 3GXUA 2D1HA 3F8MA 1DGWX 2ADDA 5CVRA 4AI1A 5H20A 3ZXKA 4CPBD 3K2AA 4WVMB 4XACA 1TLHB 1MS9A 1RUE2 4NHJA 3IB3A 4QWQA 3RSJA 3WUDA 2W1SA 1CJDA 1DIWA 3TEWA 1G59A 1JXNA 2PFWA 2WZR1 4IQ4A 4JTOA 2W1OA 4NN0A 3TDZC 2Y6JA 2EXHA 2VVDA 1XPXA 3VZJA 1J3QA 4XUTA 1Z91A 3OBAA 4UFJA 2OPWA 1HRI1 1HXS2 5CKTA 2WN2A 2Y6KA 5F5QA 1SMTA 1UJ8A 1LULA 1LKXA 3TNQA 4CZSA 1KDKA 2M34A 5FMBA 2PFBA 3JRGA 1APLC 2JN6A 4N4NB 1W5TA 4PJMA 2OAZA 5A1LA 3KQRA 3A02A 4KU8A 3J7LA 3BDDA 5L3DA 4Y52J 3LSMA 1DGWY 1D2QA 1W3XA 1KQRA 2K3PA 4N8MA 1XXNA 4IEUA 4LBLA 3IDBB 5KNLA 3JQXA 3SMHA 2P6SA 4GAZA 1W1WE 1PIV1 4R9BA 3KZYA 3RJ2X 3KSCA 2FF4A 1SDDB 2VMEA 2RC4A 3WD5A 2TCTA 4HFSA 3VD7A 2ZNYA 3BG6A 5E79C 4Y17A 5DUKA 3CZJA 2EJRA 5FXVA 3AJYA 4KN7X 3ZIXA 3CF5F 2VGDA 1EYBA 2TUNA 1Y9MA 3TW6A 1FOYA 2KP6A 3J8F3 2QQUA 1VQ9I 1UZWA 4MTDA 4Y4RA 3AZZA 1OCPA 1XCBA 1RUG1 2RM23 2YU2A 2A7AA 4HDUA 4HBNA 1ULOA 3BTAA 3BGAA 4IDZA 2AGSA 2VQ0A 5FRMA 1MZEA 4UUSA 1XC5A 3VDDA 2WZR3 3ZPOA 1RI7A 1W0NA 2RS51 4PF5A 2DTRA 1VIWB 2X4HA 2FD5A 5GLZA 3I2KA 4EN8B 3LDKA 1X7NA 1YWKA 4D94A 5FV3A 4LBJA 2NXNB 1YIJI 4M3CA 4WXHA 4AQ2A 2QSHX 5FLVA 3PU8A 5ABJB 3GW2A 2CV1A 5D1IA 4AEJA 3N9LA 4XIDA 1F8VA 3HL2A 3DEMA 2KKOA 3BU7A 2F5VA 1PUEE 3IKTA 1AUYA