3R6SA

Crystal structure of glxr transcription factor from corynebacterium glutamicum with camp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
225
structure length
225
Chain Sequence
GVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcription regulator
publication title Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
rcsb
source organism Corynebacterium glutamicum
total genus 76
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r6sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3r6sA01
4E2QA 2F2EA 2QNKA 2FQPA 3MWMA 3GVAA 3R60A 3UKTA 1P4AA 2EFOA 4EMSA 2CO5A 5JSOA 5CU1A 1FBUA 3RKWA 3FXQA 5J3UA 3GFIA 4KUMA 4PDKA 1FYMA 1TQIA 4IEWA 2ZNZA 1J5YA 2BV6A 4HBLA 3HHHA 4QGNA 5E1RA 5LLQA 3WTTC 3ZDSA 2OU2A 1UIKA 3ZN1A 2DW4A 4EM2A 2DU9A 4LULA 2ADUA 4ZU7A 3O6BB 1LDKB 3CUQC 3MZYA 1EPZA 1SFUA 2ET1A 2P6TA 5L3BA 3PLQA 1SD6A 5TRDA 1JHFA 4M9ZA 4EJWA 1KQ8A 1SFXA 1B59A 1ZNPA 2X0LA 2IPQX 4I0BA 3RI4A 1LKNA 2GQQA 2E7WA 1J0RA 3TNPB 1TBXA 2CQKA 3EYYA 4KMUX 1OYWA 2FEZA 3GX4X 2Z5UA 1IAWA 3SZPA 2X4HA 3NEUA 3BPZA 3QPHA 4X6QB 5J8CA 3ZMSA 2FXAA 3EQLF 5J7MA 1CAWA 5FLJA 5K5OA 2FBKA 4I7HA 4PGGA 1ZZBA 2PHDA 2YPRA 4ZZLA 2D2WA 3ECHA 1UHWA 4IHSA 1H1MA 1XCVA 4LG0A 4CICA 1IUYA 3H8UA 3WE3A 2Z2SB 1Y3TA 1FY7A 3M7GA 5HDKA 4IHTA 3LAPA 3OD0A 5K1YA 4WVZA 2D5HA 3O3KA 5J48A 2EV5A 3H9AA 4R52A 4FAGA 3FFQA 3HOSA 3RYRA 3FZ3A 5KHHA 3K1PA 3WTSC 2V1DA 4PJYA 4MEXF 2ZKLA 2D40A 2Y48A 2XAJA 2HTSA 1V70A 2P7VB 2MC3A 4QMAA 2PYTA 2KKOA 3ERED 3T8RA 4B8XA 1TLHB 4AXOA 5D5VB 2MH2A 4H0EA 4IEOA 5KHKA 4XFFA 2WV0A 3LZZA 4WCGA 2ZCWA 3ELNA 1WGPA 1KYZA 4UV8A 4HF1A 2HQRA 1R1UA 2RNJA 4LD5A 2J5OA 2DBBA 4RGUA 3V7CA 2YSRA 4HX8A 2Z33A 5LEJA 2OZUA 2XAHA 3G73A 2PBIA 4MUVA 2D93A 2L01A 3HOTA 4GULA 2PHLA 4HF0A 4LLLA 4ZU5A 1CAWB 2FMLA 2HWVA 4MZUA 4LB5A 3QU3A 2Y0OA 1TQ5A 2XV4S 2KJCA 5E1ZB 2Q0AA 5DCFA 3IIAA 3ES1A 4AIJA 3DKWA 4XFHA 3H50A 3TKYA 1YFXA 4MGKE 4UVBA 3J81K 4P96A 3FJSA 1LDDA 4AIKA 5DUIA 2WFPA 2DAOA 1YTYA 1REPC 2XUBA 5I0UA 3I64A 2RDPA 1XSVA 4LLOA 5BUVA 3GLXA 3DL3A 3OOPA 4IEYA 1DDNA 1O5UA 3K69A 3SXWA 4EQQA 1XN7A 1FYLA 4P55A 3H1MA 4MTDA 3GF2A 4EWAA 3GFJA 1ZZ9A 4HMZA 2PQ8A 1BIBA 5BV6A 1KQ0A 3EBRA 4XSXF 1P2FA 2TDXA 2E7XA 2Q2EA 1Z1DA 2ZMEB 2BGCA 3P9CA 3G7DA 4FAHA 4Q47A 3M8FA 1T38A 4KYWA 2IXJA 3ZMUA 2VOPA 1RL3A 2QJVA 4NHJA 4HA8A 1EYBA 1WLTA 2Y75A 1OMIA 2GH2A 2MHFA 2IA0A 1BI2A 4XFBA 3E5QA 1FP2A 2OA4A 3QPTA 2HKXA 3CJXA 1LDJA 2LF7A 3I71A 4RAZA 3IRQA 1BM9A 3DPLC 4KWKA 2DFIA 4L18B 2EV0A 2D1HA 2VXZA 1X8MA 2EA4A 2FRHA 4EM0B 4XLNF 5H20A 3LAJA 2QM3A 3KEQA 1QY4A 4FT8A 2DT5A 1J7KA 2GWRA 1G3SA 2PTMA 3ABUA 3CO2A 3JZVA 2STTA 4U0VA 2B0LA 3IKVA 1TQPA 3BWGA 5F64A 2XASA 3FMSA 1CAXB 3V7SA 1IRFA 1R5HA 3K1MA 3HSEA 5DV5A 1IRGA 5BQTA 1G4DA 3MFKA 3T5XA 1FOKA 4MGIE 3U11A 2VOOA 4WK8F 2PFWA 3JTGA 3WGGA 5FQ0A 1UHMA 5K5QA 1D3YA 4ENKA 2BNNA 3PNAA 1LR5A 2BNMA 3FHIB 5HVQC 1CX4A 5L3EA 4PIYA 1J3QA 4ORFA 3BP8A 3H92A 4G7HF 4EJVA 1YQAA 1IXCA 3L09A 1RIOH 1ZRCA 2O8QA 2P5LC 3L2HA 3FXUA 1NHAA 2L54A 1CAUA 2EFPA 1L3LA 3U2RA 2QVOA 4XFAA 1XGOA 5FFZA 4DNCA 2M87A 4HSLA 2RVCA 3CEWA 3CF6E 2FF4A 4I02A 3E6MA 4DINB 2NYXA 4HDVA 3WU0A 2COMA 1H9TA 2A6HF 3LWFA 2OD5A 4MV2A 1U78A 3ML6A 3DEUA 3WW2A 1OD5A 3WGIA 2XRNA 3W6JB 1YFYA 3ETQA 1X8EA 3MCZA 2BE5F 2A07F 2BEOA 3ZMZA 1F1ZA 3KP6A 1EH8A 4A12A 2HOEA 4G6QA 5KHGA 4HV5A 1FT9A 2IJLA 2K86A 4FX0A 1X82A 5EFUA 1ZREA 3PFIA 2QZ8A 1HW5A 2KXLA 2MLKA 2E1CA 3SCFA 1U12A 3I0TA 3KCCA 2FNAA 2M8EA 5FQ0B 1NXMA 5KVRA 1WI9A 5CYVA 2DI3A 4O3MA 2D1VA 4D7SA 1FSHA 4LJZF 2IRFG 2V9VA 5I93A 1BJAA 5C6CA 1S7AA 1RC6A 3TQNA 1Y0UA 1TW3A 4ONUA 2ZJ2A 3DP7A 5D6EA 3M3IA 4I98B 1F5TA 3FXRA 3FX3A 3PQJA 1CAUB 4OOIA 2Q4SA 4BHPA 1XGNA 3F72A 3R0AA 5DUKA 3E6CC 1USSA 4CZZA 3HRTA 1Q43A 3L2CA 4NVPA 2OA2A 1K7AA 1IN8A 1DP7P 4KU7A 3GFMA 3S7EA 2FBHA 4Q0UA 2JZYA 4UUVA 1SFEA 3I59A 3FWEA 3TO9A 5ILUA 4XETA 3F21A 4KMFA 4WXHA 3N97A 4L9JA 5H6QA 2EA7A 4LLGF 4ZYHA 4O5VA 4ENJA 2W24A 4KWJA 4HAMA 5FPZA 2XIGA 1LVAA 1S3JA 2YX4A 2GZWA 2QQBA 2M30A 1HSJA 1ZG5A 1Y9QA 2XAQA 3V7RA 2IA1A 5D5XB 5DD4A 4FX4A 2BNOA 3FMRA 3WTXC 3IDBB 3VB2A 3KLOA 2OQGA 3M9AA 5I8SA 3WW4A 4LUKA 3VOEA 2C6YA 2A6EF 2LDUA 2VE8A 5TJJA 4PIXA 1BN5A 2P17A 1NE4A 5FB2A 5D6FA 2PFBA 5AIQA 2CSOA 2K9ZA 3F3XA 3QOPA 4KICA 3SCHA 2HDCA 1SAXA 3R0JA 4CDGA 6PAXA 3NVCA 3MZHA 1P4XA 4I09A 3WW3A 4HSJA 4L0ZB 1W7PA 1UPIA 3QP6A 1DGWA 3I58A 1DZRA 3ELKA 5J8FA 4KIGA 3ZN0A 3ACLA 4I01A 4BH9A 1J59A 3H1WA 3WODF 3QP5A 4WXCA 2AS5F 2EJRA 5LGNA 5AONA 3S7IA 1OI6A 1EV7A 3I59B 1YO5C 3BJ6A 1ZZCA 5FLXZ 2OAZA 2QCSB 1B9MA 2OYZA 2CFXA 1Z7UA 1T2KA 1WA4A 3VODA 3GYDA 1T98A 5IT9K 5KHJA 2H6CA 4QXKA 2F5EA 3CDHA 4GCVA 2KIMA 5E8GA 3MAJA 3B02A 3HHGA 5H6RA 2P6SA 2D5FA 4EGYA 1MKMA 3Q9SA 4MGRA 3FE5A 2QWWA 4IRGA 4XBFA 1YHFA 2O0YA 1LQ1A 3FMQA 2VONA 4LB6B 1ZN2A 3RDIA 3REOA 5D5UB 2W85A 5LRRA 4OIQF 2L3DA 4MEYF 1E17A 3H3ZA 2LF8A 2HYFA 1O4TA 4WZCA 3SFZA 2STWA 1G6NA 4YIIA 4S05A 4BAYA 3BCWA 1H9GA 1ODDA 1W7PB 1OKRA 2KJBA 2K02A 3E5XA 1H1IA 2QUFA 1UCRA 4Q0QA 4CGZA 4HN0A 1P92A 1R00A 5JI6A 4GXOA 2ESNA 4NB5A 3LA3A 1WQ2A 2HQNA 4TV7A 4KFCA 2XVCA 2PN6A 3T8TA 3HTSB 3KE2A 1U5TA 1GQGA 2IT0A 3EJKA 4UV9A 4HVRA 2ATFA 3F8NA 3I4PA 2XKPA 4ASNA 4I3PA 3MEXA 4B29A 3KP4A 3OF1A 3OV8A 5D5WB 3LQRA 3GUDA 1JE8A 3B73A 1SD4A 4XF1A 1U5TC 3VFZA 1SD7A 3CJNA 1B4AA 1QXRA 3BU7A 1PMIA 1HKTA 3DFGA 1ZLKA 3K0LA 1SMTA 3FHZA 1O3RA 1YFUA 4G8XA 2UXNA 3GWZA 5BMZA 3U9GA 4U0WA 1AOYA 3RZZA 2OPKA 4IESA 1MJ9A 2BYVE 3C7JA 1O3TA 2JTVA 2ZMEA 2RGVA 3WTUC 4K2EA 5DYMA 3ZMVA 4HQEA 2QYOA 3JAMK 2HEOA 2XHKA 1YG2A 2ACJA 2RN7A 4AQ6A 2B5HA 3KZZA 1PM7A 1HKSA 3J80K 4XF0A 2RC4A 1KYWA 5C8WA 3G3ZA 4F7ZA 4L2NA 1DPUA 4YFKF 5HI0A 4LLNA 5DD8A 4EVIA 2HKOA 1U5TB 5HLHA 3TOBA 4META 1BI1A 5CJ9A 4OU0A 2DQLA 4KN4X 5DCMB 2AXLA 3QACA 2DTRA 1FWZA 3QRFF 1S8NA 2EV6A 1R5GA 3SHRA 3DV8A 5FGMA 3EETA 2PAEA 3CO7C 3I7DA 1ZYRF 1XGSA 2K0GA 2NS0A 4UXNA 1FSEA 1X7NA 2MLGA 4YRDA 2CYYA 4HOBA 1CAXA 3H3UA 5A2QZ 2JT1A 4MHGA 5LGUA 1DZTA 1PP8F 2DQRA 4RGRA 4HLYA 2Q0OA 1J1LA 3DPTA 4UHTA 1TNTA 3IC7A 1TTYA 1PP7U 3WG9A 3M70A 2FQ3A 1BC8C 3O14A 3TDZC 3LOIA 4RAYA 4Q0VA 5KHIA 4IJAA 2B8MA 4A6DA 1IXRC 1O3QA 3GO5A 1UFMA 2G7UA 4HLTA 2KRFA 1W7PD 1T39A 1G3WA 1K6OA 1V4RA 1IN7A 1QGPA 5JSPA 3COAC 2A3SA 3EYIA 1YS7A 2Q8KA 2VBWA 4JTOA 3K9TA 3KETA 3IKTA 1ZARA 4LUMA 2DO7A 3BB6A 2DPDA 3RNSA 4E70A 5ICGA 1UCXA 4AIHA 1FXZA 1K79A 2UY9A 2O03A 2M45A 3RIRA 3U1DA 2PAMA 3OTFA 4MNUA 4RB3C 4HDUA 4KIBA 3SQNA 3LFKA 1I1SA 1ZZ7A 2XLFA 4HBNA 3WTWC 2QQ9A 1K78A 4MX3A 4LMYA 1I1GA 2CWEA 1Z6TA 2A5YB 2GU9A 3FM5A 4JQFA 1D8JA 1W5TA 2HTJA 4GO1A 4KDPA 2FA5A 3RTRA 5LHIA 4EJTA 4E2SA 3I53A 1ZZ8A 3LSTA 1KGSA 3JW4A 1WWXA 3HTUA 2PLYA 1QZYA 1XB4A 4MQVA 4IEQA 2M1BA 4J1WA 5L3CA 2MPFA 4AVAA 1SEFA 1R23A 1U2WA 3V8KA 3BALA 3BJOA 4RD7A 1JGSA 5E1WA 3CO6C 2IC1A 4YG2F 3WTZA 1IN5A 4A6EA 4IXAA 5FLHA 3RPQA 2ZBKA 4RB2C 3NSTA 4IEXA 2FSWA 3F8FA 1RUNA 1ZRFA 2EWNA 4IEUA 2GC3A 1ZHFA 1J75A 1J3RA 1ZRRA 1FC3A 3ECOA 1QNTA 1OYYA 3KP5A 1BOAA 5IT9Z 2R3SA 2Y0MA 2ZKZA 4WWCA 4WBBA 4U7DA 4JTNA 5LGTA 3UKVA 2H0VA 3ZQ7A 4KT5C 1QZZA 4RS8A 1KQ9A 4ZYGA 3CLPA 3BZ6A 4BNCA 4IF4A 1BC7C 2YX7A 4U7BA 5FCCA 4HW0A 4FHTA 1FP1D 1K78B 3TDUC 2NNNA 4HX7A 2UZKA 2MA3A 4BQAA 4IEVA 1UD1A 1P6RA 2O3FA 1S7OA 2Q30A 4L11A 3NL1A 1XCBA 3RJPA 1LNWA 2FE3A 5HOOA 1YS6A 2GAUA 3TNQA 4ZYDA 2PMHA 1E2XA 2E1NA 5F6FA 5FO5A 1QWRA 5KBFA 4YIFA 1WSUA 2JPBA 1I27A 4OMYA 1DPRA 5LRSA 2KIUA 5EEHA 1CGPA 4U0YA 4PZJA 5D8LB 1UB9A 5D4SA 4ETSA 2W25A 5L3FA 1XDUA 4EV0A 1GQHA 2PEXA 4KIFA 1Z91A 4X6RB 3V4GA 5I91A 4XF4A 4LK0F 4LA2A 5E20A 1Z6RA 2XKOA 3V8LA 2HFHA 4KNYA 3LWCA 4Y17A 3QAHA 3BY6A 2MH9A 4L5IA 5BS6A 4M71A 4MTEA 5I0RA 1U3EM 3NQOA 1Q5OA 2G7HA 3LA2A 2IA2A 4A2UA 4XFIA 1J2XA 1QXJA 4NQWA 1OYIA 3JSPA 4EJOA 3P9KA 3K1NA 1YWKA 4G94A 1FNNA 2VODA 2XL9A 1ZVFA 3UKNA 1J3PA 1B6AA 1HW2A 2UYBA 2LSOA 3E3VA 3TO6A 5HLGA 2UXXA 1WKMA 3F8CA 2ZFWA 3RYPA 5LEKA 3NW4A 3L7WA 2VECA 1LEBA 2VN2A 2EB7A 2XAGA 5K8SA 2Z99A 2PI0A 2H6BA 3HIFA 3N4MA 2EFWA 5JVTA 4PIZA 2I45A 4A5NA 2IXIA 5BPDA 1FLIA 3ABTA 1HW1A 1KA8A 1IW7F 2XLAA 1Q3EA 5CVJA 3BDDA 4N9IA 4HVQA 2Z9OA 4P9GA 2FBIA 3DXJF 3M1EA 4IRIA 3GZ6A 3RKYA 3CUOA 4PCQA 2R7DA 3SHFA 1R1VA 1JHHA 1NYWA 4BYYA 3ST7A 2IXKA 1XDSA 2WC2A 5JAXA 1NE6A 1GHCA 5JCTA 3R61A 1W4MA 5CLSA 4QGLA 3I5UA 4ENNA 3KGLA 4O9GA 3KP2A 1YFWA 2A61A 3F23A 4XF9A 3J81Z 4QM8A 4ON0A 1CF7A 1AWCA 3F8BA 3HRUA 1D8KA 1VTNC 3S2WA 3MQ0A 2WWYA 3LA7A 1FPQA 1RTVA 2DCTA 2IVMA 1DUXC 1XE8A 2JSCA 2K4BA 1ZRDA 3NJZA 3JSOA 1LJ9A 5HS9A 1XSXA 4IEZA 1ULYA 3ISPA 4G9YA 1XSDA 4KU8A 2V6CA 2V1UA 5E18F 3ZMDA 4OMZA 1FBQA 4G7ZF 4FBFA 5L3DA 1C0WA 4WXDA 1IN4A 1YYVA 2ISYA 1MJBA 4BIFA 5E17F 2PAKA 3V8JA 1LB2A 2OQRA 3DF8A 1XE7A 3KP3A 3SZTA 4YNIA 2LNBA 1ZG1A 1L3JA 3PVBB 4S04A 1ZGJA 4LA3A 4Q5SF 1OFNA 4LK1F 1RGSA 1UIJA 1MDMA 2M5WA 2N7GA 2IXLA 1YIOA 2HZTA 2W57A 2UYAA 3CUQA 4OINF 1O5LA 4KWLA 5F1RA 3M8EA 2OZ6A 3BPVA 4BHBA 1HSTA 1TW2A 1Z05A 4WF2A 1DGRA 2H09A 1ON2A 2Q1ZB 4HZFA 3RKXA 3EDPA 4M6XA 3D0JA 2W84A 1CF7B 1XRUA 1QPMA 5CVRA 1JUHA 5BY5A 3NKTA 1BBYA 1JXSA 2K27A 4Q48A 5ED4A 4CXFA 3WTVC 1QBJA 1ZGAA 1SMYF 1ZH5A 2CGPA 3IRRA 3ES4A 4H7LA 2ETEA 4JBAA 4YSFA 2L4AA 4M9XA 2F5FA 1ON1A 5HS7A 1T0FA 2P4WA 3F6VA 5JFRA 4M6YA 2OBPA 4L9TA 5DCMA 3TOAA 3OCPA 3RYKA 1R36A 4LEJA 1FX7A 4UNOA 1I5ZA 4GYIA 5EZWA 4Z82A 4A5MA 1MZBA 4Y13A 4UVAA 4AVCA 4XRFA 5K5RA 3CTAA 1S6LA 1O7LA 4HQMA 5DEQA 1EH6A 2GIVA 2IP2A 1EH7A 1MDMB 4RGSA 5FD6A 3SMHA 4YARA 1I6XA 1FI2A 4Q0PA 5CADA 3EQEA 3CUQB 3MPBA 2XL7A 3F6OA 5JSRA 2O8XA 4RB1A 2EK5A 4GYGA 2CAUA 5I0SA 3ZP5A 3R4KA 3LAGA 1KU9A 1XD7A 3ZPLA 4UVCA 4OIPF 1GXPA 2E9QA 2JPCA 4GGGA 2ETHA 2XROA 4PGHA 2IXCA 2Z69A 3HRSA 3CL1A 2GC1A 1EY2A 2PJPA 4IETA 1FYKA 2XGXA 2DLLA 3OGJA 3H7YA 4YYOA 2RKHA 4QX5A 2HGCA 4IPAA 2EAAA 1BIAA 1RI7A 3HT1A 1B9NA 2CW0F 4EJUA 4XEZA 3P7NA 1IZ1A 3USSA 4HX4A 3F8MA 2VQAA 1G3TA 4D7TA 3L9FA 3H7JA 1U6GA 3I54A 2LKPA 1VR3A 2ZXJA 3CLOA 1EP0A 1HXDA 2WTEA 5L3GA 5E8IA 2ISZA 4I2OA 3ROUA 1MGTA 4N0BA 4A0XA 3WE2A 1IPJA 4LG0B 2V79A 3GBFA 4MGYE 2HR3A 4IRHA 4KL1A 1KU7A 2BBYA 5I0TA 2KIFA 5ICCA 5E16A 4LTAA 4QWQA 1A04A 1IPKA 5HDNA 4JV4A 2IXHA 4M73A 4ZU4A 4Q4ZF 1ZLJA 1ZZ6A 5HS8A 4A0YA 2VBXA 2PG4A 4M72A 2ESHA 2NRAC 1RZ4A 3IHUA 4ZYEA 4M74A 4J1XA 5FLXK 2PQQA 1VP6A 3TO7A 3E5UA 1X3UA 1L0OC 1SQ4A 2QDRA 3BPXA 3ZMTA 3NRVA 2EFNA 3GW2A 4L9VA 4JK1X 4KA4A 5HLIA 3KGZA 3FM3A 2CAVA 4R8HA 1CAVA 4ESBA 3H1YA 3P9IA 3FF5A 4ESJA 3KLNA 1OPCA 3KFWX 3T1BA 2H27A 2ET7A 3ULQB 4XFGA 1YLLA 1YW9A 4QGMA 2VC1A 2NNYA 4P5OA 2GA1A 3HSRA 3EHKA 2XAFA 2Z3YA 3W6KB 3JTHA 4Z2YA 4UBHA 4OIOF 4MH0E 2K4JA 2O61A 4EWDA 5ILVA 4D0PA 5ERIA 1XGMA 4OLLA 3U0ZA 1IXSB 3SXYA 4I0AA 1GVJA 5T3NA 2C0ZA 1USTA 1NZCA 3WTYC 2F5DA 5FDBA 1F4KA 2NAZA 3WU1B 4XFCA 5IT3A 4Z07A 1UW8A 2A68F 1W5SA 4L5JA 5BPIA 5ILSA 5DDGA 5FLIA 2VC0A 4EGZA 3GEZA 3EUHA 4ESFA 1YFHA 1P4WA 2P5KA 1GXQA 1YLFA 4HN1A 2V1XA 4AWXB 4HF2A 4XF3A 4YFXF 4K8FA 3R6SA 4XLPF 2QQAA 2V09A 2L4MA 2MD5A 3MYXA 1SD5A 1Q1HA 2MBFA 2D45A 5D1IA 1R1TA 4LGWA 1MD0A 2VBYA 4Q0SA 3HUGA 2F5CA 3E6DA 1CAVB 3LQQA 2QVSB 3EO6A 1YW8A 2J5PA 5BOXA 3BOQA 2RV8A 5LHGA 2VPVA 4CYDA 4AVPA 3IBMA 3BROA 1HQCA 4QLCU 4R1HA 4IVNA 2OZJA 2ZO4A 1QO0D 5LHHA 1PUEE 5KK1A 1G3YA 1RNLA 3PQKA 1TQMA 2VBZA 1TNSA 4DQ2A 5FPXA 2HJIA 5I8TA 4L0YB 4BXUA 5I8YA 3WW1A 2A69F 5EEGA 4QM9A 2EA2A 2FOKA 2DK8A 2P7CB 4AQ2A 3L00A 1RUOA 4CHUA 2PA7A 1IF1A 1BI0A 3GFLA 1J58A 2FMYA 1J9IA 4O9EA 3D82A 4KN7X 2YR2A 2CV6A 3E6BA 5BXXA 2YU3A 4MQ9F 2RQPA 3DN7A 2GC0A 2EVXA 4B09A 5FD5A 3VEPA 4EWEA 3U10A 4RGXA 4E2GA 4ZH4F 3D0SA 5D4RA 1O3SA 4UBGA 3C1DA 2GXBA 4Y15A 1QQIA 3O2PE 1FZPB 2UY8A 2DPUA 4F8AA 3C18A 4HYEA 5HDGA 1ZAOA 2L02A 2QENA 4HV6A 2DK5A 3S0MA 4N9HA 4P9FA 2VT3A 3QU6A 1S29A 3GXOA 1LRHA 2FNPA 4A0ZA 3D5LA 4ENMA 3J7AO 1MJAA 1XMKA 4XSZF 3IDCB 2P5VA 5AVPA 5A2QK 3RPUA 2PMUA 3MDPA 3HYIA 1OR7A 1IN6A 3KSCA 2GXGA 1BI3A 5JHUA 3IWFA 1WRJA 5J6XA 3FZVA 2QBYA 1O57A 4MGZE 1STZA 2ZNYA 2F4PA 3KZYA 3IWZA 1B1BA 4CO8A 3K2ZA 4EROA 5ICEA 3KEOA 4IERA 4HVOA 3F22A 5JR7B 1LEAA 3AAFA 2HS5A 2GA2A 4BHCA 4P9UA 3JAMZ 3IL2A 3HRMA 3TGNA 3Q9VA 5JR3A 4OFGA 5FFXA 1YW7A 2HYGD 3J80Z 1O7FA 3E97A 1HBXG 3Q5FA 4AD9A 4Q29A 4IEPA 1ZX5A 1Z9CA 4L9NA 2G9WA 4WX9A 3KP7A 1H0MA 3VHRA 4ZZDA 1R22A 3C3WA 2JRTA 4LFUA 4YFNF 3SCGA 1F9NA 1YUDA 5D8KB 3HSFA 4O6JA 4OIRF 2EFQA 2VT2A 5BPXA 2H94A 5CVUA 4G6DA 3KMHA 2R7FA 4TLFA 4G7OF 1D5VA 1U8RA 2GC2A 3T0YA 3HT2A 1PDNC 5AIPA 1R58A 1V3FA 2QBYB 3GYHX 4HLXA 3BJAA 3GZ5A 4U88A 4R79A 1ZG3A 3HQXA 1VJ2A 5CVVA 2O6GE 4JVAA 3DQVC 2QLZA 1R7JA 2ELHA 1SFNA 2P8TA 1ONVA 1KU3A 5ICFA 4UXAA 2IW5A 2UWMA 4EM1A 2K7LA 2B9UA 4M9SA 2FU4A 1HKQA 5E1XA 2O1QA 1FBSA 1T6SA 4AVBA 1XMAA 1KU2A 3C3VA 2XLGA 2CG4A 4RB0A 3WGHA 2VE9A 5LBQA 2MNGA 5CVIA
chains in the Genus database with same CATH superfamily
2F2EA 4W65A 4WM8C 2FQPA 3SZGA 1VQ9I 2X51A 1ND2A 2A5ZA 2WZR1 1F4HA 1T08B 3MGUA 2A6ZA 3HQRA 1J5YA 4HBLA 3X29B 4B1LA 4QGNA 5E1RA 5LLQA 3ZMNA 2LFBA 3AXDA 2RR11 2OU2A 1U9NA 3VD7A 2DODA 2WQ4A 4P9IA 4EM2A 4H2AA 3FLRA 4D69A 2ADUA 4JX4A 1YHQI 1MS8A 3O6BB 2PJRA 3CUQC 3MZYA 4FTSA 2R0QC 2QQ8A 3UNGC 4AHWA 1POV0 5TRDA 1UAIA 4IE4A 1KQ8A 3PO3J 2X0LA 2Y60A 2V7FA 1V9U3 2GQQA 2RQQA 3TNPB 5JXJA 1XTAA 4KMUX 1OYWA 3ZXSA 3GTPJ 1UMIA 4M3DA 2ICWG 3HEIA 3NEUA 4Y4RA 2LROA 4FASD 3EQLF 3HN1A 5J7MA 1CAWA 4I7HA 4PGGA 1RHI1 2YPRA 5FPVA 1YX5A 4XDQA 1AR61 2D2WA 1Z7LA 1UHWA 4HETA 4HANA 4FPEA 1XCVA 1U0AA 1Y3TA 2RM22 2IS4A 2HH9A 4IHTA 3LAPA 3NRUA 1ND2B 3OBRA 4AFMA 1SFKA 4Z1VA 5T5PA 4R52A 4FAGA 1VMFA 3K1PA 4JQTA 3B6CA 1HN1A 2V1DA 1W2OA 1X1BA 3UETA 5HXVA 2D40A 2XB6C 1CPMA 1XYNA 4XURA 2KM2A 3OUIA 3CCMI 4IEOA 2VTXJ 1MBJA 3V64A 2E63A 3CP8A 3LMMA 4HF1A 4IE7A 3GNEA 3K4KA 1W8WA 2JB4A 4LD5A 1O91A 2DBBA 2ZX4A 1AYM3 1JUSA 3UGFA 1G9CA 5EJZB 1VBB3 3RQIA 5LEJA 2OZUA 1DQ5A 2PBIA 4XKBA 2JN6A 4XDOA 4ARXA 3ZQIA 2ZACA 1S5LC 2CNAA 3MD2A 1CAWB 2FMLA 2IVJA 1VF9A 2B7YA 1TQ5A 2V1NA 3W3CA 2KJCA 4M3CA 5FZGA 1ZK8A 1W6QA 5EYYA 3DBLB 4AIJA 4K40A 4ZS2A 3DKWA 1RUH3 1UY4A 3JBG1 2NP0A 3OYDA 3I2DA 5DUIA 2NLRA 4CYCA 5E88A 5FREA 3FBIB 2DN0A 1I5PA 1WW7A 3U07A 1GOGA 3AL5A 4S2HA 3BG7A 1VBA2 1QVTA 1JKOC 1BBT1 5IAXA 3K69A 2UWCA 3FN9A 3RMXA 3SXWA 1FYLA 1XN7A 5GLWA 3UT0A 1VALA 4MTDA 1OCTC 4M3EA 3GF2A 1ZRIA 3WR0A 1ZZ9A 2BJSA 1LESA 5DUWA 1IGNA 3TMOA 2Q2EA 5J1UA 4XJWA 2ZHNA 3G7DA 4GB32 5FZIA 1LVKA 4Q47A 4YGBA 4AC0A 3BG5A 1R1A1 4FOYA 3O1MA 5F0HA 2Y75A 1OMIA 1TME2 2IA0A 5KAFC 3OYFA 4XFBA 3SQOA 3AJYA 3E5QA 2NYYA 4UUSA 1MBFA 3AG1H 1XS9A 1UG0A 1OF4A 1ZBE3 1LU2A 5LATA 4CU8A 3I3DA 3I71A 3KVAA 4AEMA 5FMCA 2FBEA 2EV0A 2PHFA 2VXZA 4EM0B 1W6QB 1QQP3 3P3PA 2QM3A 5IVBA 2VY0A 1W8ZA 2KRHA 3ZOIA 4CYCB 4QPGA 4HKOA 4Y5Z0 3ZGKA 1DQ4A 4B8EA 2ZHLA 2BY1A 4FTBA 2ME0A 2WAOA 3CQOA 2O7OA 2STTA 2B0LA 3WXPA 2XASA 5LW9A 1CWPA 5ANNA 5C4WC 1HJGA 1JHJA 4UOJA 4MGIE 1WW4A 5FXXA 3U11A 3LEIA 2BGPA 2Q2EB 3EUHC 3PNAA 1I6HJ 3ZVXA 4ORFA 3BP8A 3H92A 4G3YC 4EJVA 5F5QA 1EF4A 5IT6A 1ENQA 5GKAC 4BMBA 4UUSB 1RIOH 1ZRCA 5GM0A 2P5LC 2CV2A 5FKMA 2RM21 3HGYA 2RVAA 3U2RA 2WADA 2QVOA 4XFAA 1T2XA 2R061 3L2YA 4N90A 2IWGB 2M87A 4QU2A 5CG9A 3E6MA 5F0CA 5IOYA 2NVQJ 3A21A 3WU0A 1H9TA 3H36A 1U78A 3ML6A 3FBNB 4DO0A 4QPGB 2VQ0A 1OD5A 3W6JB 3ETQA 1X8EA 3MCZA 3T1LA 2BEOA 3UKGA 1UHSA 4A12A 3T30A 3ZO0B 3ZX7A 3ME2A 1X82A 2JG8A 2KXLA 4XN3A 3A0KA 1XYPA 1U12A 4QQOA 4XKVA 3R4UA 5CFDC 2FJ1A 1W3VA 3H35A 3MIEA 1WI9A 4II3A 5CYVA 2DI3A 3I56I 3FBMA 4YWAA 2D1VA 5DG2A 1FSHA 4LJZF 1GLHA 1HLVA 1RUJ2 1GP4A 2RJKA 5C6CA 1ETKA 5F3GA 1FOYA 3TQNA 4G4FA 1W36D 2VZRA 4RMNA 1D2QA 4ONUA 4LLFA 5LBEA 5D6EA 5A3OA 5FUNA 3OOUA 3CCRI 5JPMB 1OQEA 2VKVA 2H8RA 4BHPA 2YU2A 4N43C 3F72A 3R0AA 2V4JC 1HV0A 4OQ8A 2X09A 1VBA1 2OA2A 1SCSA 3DPRB 4Q1RA 4YM2A 2VJ4A 4KU7A 3VV1A 3ZQQA 3WDXA 2JZYA 2ZXHA 3VKFC 2B42B 5ILUA 4XETA 4QAWA 3S15J 4YZ1A 4KMFA 4F55A 4L9JA 2EA7A 2V5YA 4GB31 1R082 4O5VA 1ETQA 2W24A 3GF6A 4CU6A 1VAKA 1GP6A 2JG8B 1PZ7A 5FPZA 1LVAA 2YX4A 1TME1 1B35A 2M30A 4HK8A 2IA1A 1W1WE 1VBE2 2BNOA 1QKQA 4MVTA 3NV1A 4LO6B 3KLOA 2ILMA 3A02A 3BYWA 3OPTA 2OXBA 5I8SA 2C6YA 1Y9GA 3OR1C 3B5LB 3QOEA 3HBKA 5AIQA 2K9ZA 3ZR5A 3ZN4A 1VBD3 3QOPA 2HDCA 3R0JA 6PAXA 4Q5OA 2DDAA 2OCCH 1HDPA 3WW3A 4HSJA 1UPIA 2M7BA 3ACLA 5IYDJ 2F4MB 5H9PA 4BH9A 5CKMA 3WODF 3AVSA 3POYA 1OI6A 2QQUA 4CCKA 3GZNB 4NRMA 4C1XA 2QCSB 4XN0A 1RRJA 1JZ2A 1JKRC 1T2KA 1RUI2 2NQYA 3VODA 3RZLA 3M8LA 1FMD3 4XTPA 3ZR6A 4QXKA 3D5SC 3O5SA 2F5EA 1GLNA 3CDHA 1B35B 3WQBA 3B02A 5F6LB 2P6SA 5FK8A 3V0AA 3FE5A 4IRGA 4XBFA 2EPFA 3JRIA 3REOA 2W85A 1VQ8I 3K4CA 5LRRA 1NCQC 3H3ZA 1RUE3 1T56A 3ZXLA 4OVEA 2WY7Q 3OBTA 2JMWA 4XE9A 1GV2A 1W39A 1X58A 1XPWA 2IS1A 4IQPA 2W46A 5A3MA 1UCRA 1BZWA 2XBO2 3LOBA 4CGZA 1P92A 4OHXA 3OSFA 2W39A 3SH4A 4GXOA 4P1WA 1T95A 2ESNA 1NCRC 2BERA 1C8M2 4NB5A 4A7ZA 1WQ2A 3VYRB 2HQNA 4TV7A 1D0GA 4R9CA 1ZBA2 2WO3A 3HTSB 3KE2A 1JKPC 1RUJ1 2W92A 3EJKA 1ODNA 2ATFA 5F08A 2VZ1A 3T0DA 2VNRA 1UY3A 2XKPA 4CU7A 3MEXA 1AU7A 3PUAA 2HVRA 1JE8A 5FZKA 2JKXA 3AVRA 2L7FP 1IGOA 3HM5A 3AKZA 4ZZ5A 1SMTA 3FHZA 3KT4A 1H0BA 4G8XA 4U0WA 2LC2A 1X2MA 3LL7A 1WH5A 4IESA 2BYVE 5J36A 1O3TA 1H1AA 1KD7A 5EJ1B 2ZMEA 5HCBA 1NTCA 4NC6A 5HCFA 4OYUA 1V5EA 5DAWA 3OOXA 3URFA 4HQEA 2QYOA 2X6YA 1ENSA 5K9YA 2LW8A 2CWMA 1YG2A 1HKSA 1UMQA 3A03A 4XF0A 5FP9A 4U36A 3QQAA 2XJUA 5C8WA 1VBE1 4YM1A 1DPUA 1W36C 2JDKA 5HI0A 3AP5A 2F17A 3TN93 2HKOA 1BI1A 2Y0SA 4LOSA 1MVEA 4XOTA 2EIDA 4C0BA 2AXLA 3QACA 1GNZA 4QPYA 1S8NA 2EV6A 2B4KA 1V6NA 5FGMA 1AXKA 2PAEA 4DYCA 1HB2A 1X7NA 2R0FA 5FZ9A 5F0FA 5JMCA 3I3LA 3U4XA 4ES9A 1IOAA 3IT8A 4II2A 5C4XJ 2Y33A 3T2OA 1OHFA 1W9FA 1US2A 4OCTA 3S8PA 2GH8A 4PDWB 3VL8A 4MHGA 3SJMA 5AFEA 4Y52J 1S0JA 4YZ2A 4HLYA 1NX9A 4FOVA 3DPTA 4Y3OA 3IC7A 1TTYA 3UNPA 3FLPA 3WG9A 4UT5A 2VMDA 1NG0A 3MLLA 3LOIA 3MVPA 4Q0VA 5KHIA 4IJAA 1RUI1 1IXRC 3WDVA 1X4OA 4HLTA 2J1TA 1XC5A 1F8VA 1W7PD 1T39A 4UFLA 2AC1A 1K6OA 3VD3A 1QGPA 2EIKH 5JSPA 4L5EA 2ZZQA 1YJWI 2GNMA 1QPIA 1KQRA 1OVPA 2QQLA 1NLRA 2L7ZA 2DO7A 4M0NA 3BB6A 1ULOA 4E70A 4QPIC 2O03A 4QPOA 5BNPB 3KV6A 2PAMA 3OTFA 4MNUA 1AJOA 2YFZA 2QQIA 2H8WA 4KIBA 1JU3A 1SLBA 1PVC3 2CWEA 5DABA 3OGVA 2ZGSA 2VMEA 1H2MA 3JUUA 4XUPA 4ZXEA 4KDPA 3RTRA 5LHIA 3WG2A 4E2SA 2ARCA 2XBO1 3LSTA 1KGSA 3HTUA 1UMHA 3KQRA 4OHVA 2M1BA 4YW7A 1STMA 3KV5A 4W50A 2YMZA 2VD7A 3BJOA 4RD7A 1C8M1 5E1WA 3HKZA 1JT6A 4YG2F 1AKHA 1QHHD 4E8DA 4C30A 1ZBA1 4RB2C 4IEXA 4JC1A 2E1MB 2OW4A 1ZRFA 2EWNA 1UY1A 1QF3A 4GWNA 4XLCA 4IO9F 5LA9A 4YFZA 1J75A 1HDDC 1HOMA 3AFGA 1LNSA 2IZWA 3D3AA 4A42A 1RXGA 4XCBA 2VPRA 2ZKZA 2Y0MA 4WWCA 5LGTA 1IO2A 4FETA 3FC0A 2YY1A 5FXWA 2E1OA 2P34A 5DZEA 3BR1A 4SLIA 3RSJA 4HW0A 4FHTA 1FP1D 3ZMOA 1IQAA 1ENRA 3MHZA 2ENRA 1YI2I 2NNNA 4C9YA 1MBGA 2MA3A 4BQAA 4GWMA 1UD1A 3VBHA 2FD5A 1V5FA 3NNFA 3K2OA 5DZGA 2PQSA 3RSNA 4L11A 3RJPA 1LNWA 3TNQA 4BQ2A 2WYSA 2L9RA 3RZHA 3CU7A 4CDQA 5F6FA 2D6MA 5DM6F 1AL23 1I27A 3SLIA 3KEYA 5LRSA 4RHV3 2ARAA 2BGOA 1LOFC 5EEHA 1AKHB 1CGPA 4PZJA 2WZ8A 1J83A 3HB9A 5GTHC 5A7PA 1XDUA 4I76A 3WP5A 4Y1YA 5FY7A 4YFWA 3I4NJ 4LK0F 4XUTA 3V8LA 3WDUA 2HFHA 4KNYA 2ZJPF 2X5IA 5FYTA 3BG3A 3HUGB 1HQWA 2CW8A 1DZQA 3DCQA 5C7GA 4B47A 2RJ2A 2NPIA 3CC4I 4XFIA 1H4GA 2WWUA 1X1DA 1K4TA 1QXJA 4Q4W2 3CMMA 3U37A 4EJOA 3I4IA 4JKMA 3DEMA 2XXZA 4C1WA 3AYDA 2A6YA 2UXXA 1WKMA 3GTOJ 1LENA 1YXWA 2ZEYA 1ND3C 2MEV2 5LEKA 5BNGA 4ZJZA 5CISA 4OHWA 1LEBA 2EB7A 2XAGA 5K8SA 2Z99A 3TEYA 3O1SA 3N7JA 2QSFX 2DDUA 4CDQB 3BTJA 3SNMA 5HXMA 1D0XA 1MMAA 2EFWA 1TWGJ 2KDZA 1FLIA 1TWAJ 5IYCJ 1QU0A 3LSIA 3A0NA 4A3LJ 2B63J 2BP6A 1Q3EA 1VAVA 4XZPA 3ZXEA 4CEWA 3S1MJ 2PHTA 5LBBA 3K75B 4XC9A 3WF2A 4QDRA 4DB5A 4IRIA 2FDJA 2G9FA 1ZM1A 1FV2A 2B9SA 5A80A 1YEWA 4ATFA 2K9SA 1XDSA 2WC2A 1IRZA 2ZEXA 1W2UA 5EJCA 1H9PA 3ABKH 1VMJA 3R61A 4QGLA 3I5UA 2GALA 1LTEA 4O9GA 3KP2A 3F23A 3J81Z 4QM8A 1AWCA 3WV6A 2JD4A 5EV7A 1RETA 4A3DJ 1SLIA 3LA7A 1NQJA 2DFHA 1W2AX 5FYHA 2DCTA 2IVMA 3LD8A 3G1OA 5HS9A 1JYVA 5K0UC 3FK6A 2IFWA 5FYVA 4IV1A 1ULYA 4G9YA 2ZAAA 2XJQA 5E18F 3VSLA 3BR5A 2AYHA 1IUFA 2E26A 2XJVA 3J8F2 5L3DA 1IN4A 1B09A 4LK6A 2AQFA 1MJBA 1DLCA 2VOVA 3OSDA 1AA7A 1XE7A 4CEWB 1ZG1A 2XPWA 2Y0IA 5F5AA 5FZFA 4S04A 2W1UA 4Q5SF 2LREA 1RGSA 2ZKNA 1MDMA 1IG7A 4IQ4A 2IXLA 1YIOA 3PIOF 4M4PA 2W57A 4PQ9A 5CQEA 1OQYA 4OINF 4KWLA 1QJY3 5FUPA 3M8EA 2OZ6A 3CHXA 4WF2A 2Q1ZB 1XMXA 5CZKA 4M6XA 2W84A 3MIGA 4PI2A 5CVRA 3KX2A 2K27A 4Q48A 4CXFA 1VQ6I 3VZOA 1ZYBA 4EN0A 4XLEA 2XJPA 4D6SA 1R6RA 2JDNA 2YHJA 1R4NB 5FJ8J 1UOGA 3ZYBA 5L7OA 4JBAA 1V54H 4IV1B 3S6PA 3WU2C 2M4KA 1T0FA 2QQKA 2KL4A 4KBZA 3AG4H 4FE4A 4EATA 5DCMA 1PGL2 1V6OA 3OCPA 2EAKA 4XABA 4XJZA 4UNOA 3BKZA 4QB1A 1DYKA 4GYIA 4PSWA 4OUSA 4Y13A 1MZBA 2IXSA 2GDFA 2QQWA 4XRFA 2PHUA 5K5RA 4NPLA 1O7LA 3WQ7A 3MUZ1 2IP2A 4Q4W1 4E7HA 1KEXA 3DBHB 1EH7A 1MDMB 4JZRA 4X8NA 1V6MA 5FD6A 1PGSA 4OZOA 3ACIA 4YARA 4BE2A 4DXZA 4PSXA 2W95A 5FP8A 4CCMA 3VDCA 3WVJA 4D6QA 2WN3A 2O8XA 4RB1A 2VCBA 5E3MA 4WM7B 4W1UA 3HD8B 3R4KA 3T3YA 4L99A 4LKSA 1XD7A 3ZPLA 4UVCA 4OIPF 3VL9A 4RA2A 4FFIA 4AGGA 3CCQI 1GXPA 2MEV1 5KXCA 1QA6A 1JYCA 4FXGB 4Q1PA 2YU1A 1DHKB 4PGHA 2IXCA 3JRDA 3HRSA 1POV1 1S0CA 5CIRA 4P5YA 1S1AA 2ZHKA 5L7OB 2VXRA 2JEMA 3LDKA 4YYOA 2JA2A 2HGCA 1Z0XA 2EAAA 1GMMA 1YNAA 4EJUA 3U78A 4DXRA 4IHWA 2VQAA 4RGAA 3ZRGA 2DA5A 1G3TA 1FATA 4DBQA 5JWPA 3MEPA 2R042 5FLMJ 1ST8A 1HXDA 2WO1A 3NAPA 4Y1XA 2O8OA 4BPZA 4Y4YA 4AI2A 4I2OA 1MGTA 3WE2A 4F83A 4LG0B 2V79A 2O14A 3GM8A 3E0JB 5ICCA 2D6LX 2GNTA 1GZWA 3U75A 5J4YA 3GDBA 1A04A 3ZFEA 3DYMA 1QOTA 2VZVA 1ZZ6A 3IHUA 1OSGA 3FKJA 4ZYEA 2XHNA 5FZ4A 2R5YA 2J42A 3SDGA 5G04L 1X3UA 2WNUA 3NARA 1UOJA 4OAYA 5IWFA 2QDRA 3BPXA 3FIWA 3ZMTA 2UV1A 2EFNA 2P6CA 2RS32 4E9KA 3EPZA 1O8PA 4EEFG 2YDEA 2LK2A 3J7MA 2VL8A 2VPLA 3J8F1 2HEYF 2D3SA 2R1DA 5FLVA 4ESBA 2KLOA 3P9IA 5LCWL 4LK7A 1OPCA 3ULQB 2BBVA 1YLLA 4X8PA 4C3HJ 4QGMA 3EHKA 2PMZN 2XAFA 1BW6A 3OWTA 3RG0A 3W9AA 1S2BA 3JTHA 1W06A 3WHUA 1WD4A 3QLQA 1FTZA 3VYSB 5ILVA 2BW3A 2QQMA 4ASMB 1OCRH 4UB8C 1GVJA 4NR1A 5T3NA 1LHUA 2C0ZA 5ABJA 4G12A 3ACFA 2JK3A 2QQNA 3UR3C 2FDIA 1F4KA 2NAZA 3WU1B 3THTA 1UW8A 3QPSA 4QX1A 3PVOA 3ZFEB 5DDGA 3AKSA 5FYBA 2ZSHB 1BEV3 5K7PA 3PMSA 4FPOB 1RB8G 2C9KA 3GCXA 2R5YB 2BDRA 1TP4A 1LU1A 4TLGA 2J1VA 2ELKA 4XLFA 1E0EA 2J1EA 5KCMA 2WNUB 4XLPF 4GKXA 2L4MA 2MD5A 3MYXA 1IKPA 5EYXA 1W6NA 3CD6I 1JOJA 3OIQA 4FP3A 1PGL1 2W2IA 2IVIB 2QE3A 1R1TA 2VVFA 3GHNA 1MD0A 2AENA 3FKIJ 5F32A 2R7QA 5GALA 4LO8A 4I6ZA 1XNTA 3GZUC 4IGOA 4R1HA 5CA6A 4M4RA 3OYWA 1QO0D 5JZGC 4XLAA 2NVTJ 4L0PA 5KK1A 2JICA 2V26A 3AMMA 2VKDA 2E31A 4FQGA 1UKGA 1KONA 4A3ZA 1XU2A 3J7HA 5JUVA 2BW3B 5I8TA 5B3SH 3A4UA 2DOEA 3S30A 4DUXA 5C9AC 5I8YA 3WW1A 5ABJB 3TBIA 2VH9A 5JXHA 2EA2A 2FOKA 4EZ4A 2DK8A 4BEHA 2E36A 4INDA 4I3GA 3MW3A 4OI0A 1GV9A 2PA7A 4RBOA 2RAEA 4E7LA 4JRAA 2ORXA 2ZX2A 5CNAA 2FMYA 2UURA 3LPFA 4N53B 2BHZA 1JHNA 5BXXA 2Z16A 4MQ9F 1VFCA 1JOPA 4CUBA 4B4RA 1PMHX 4MGTA 1YRZA 3WUCA 4CXYA 5M5YJ 3B7MA 2CJJA 2DA2A 5CKTA 3D0SA 3WNKA 3HL2A 1W90A 4FOQA 5GAHJ 1ZR4A 4YG6A 5EHDA 2R041 1QQIA 3HGGA 4CDUC 1FZPB 3TAYA 2L02A 3S0MA 1POGA 3PVNA 2QQPA 4P9FA 2VT3A 3QU6A 3VWBA 2FNPA 2JWPA 4AZZA 2HXOA 3D5LA 1W0TA 3J7AO 1W6OA 2ZB9A 4R9DA 4A4AA 1XMKA 1V00A 2VZQA 3VKLA 4C3IJ 4C91A 2NVXJ 1O4YA 3L9JT 2PMUA 3HYIA 4BBRJ 4AQTA 1OR7A 3I4MJ 4J25A 3KSCA 2GXGA 2D6OX 5LWBA 3IWFA 1N1YA 4BB3A 5F04A 2R7SA 2SLIA 5JI7A 3LFUA 3VD5A 1QZEA 2GIZA 1S0BA 4BEHB 5IOZA 4GALA 4MGZE 1A34A 1STZA 1BQPA 3IWZA 1B1BA 4CO8A 3K2ZA 4AEDA 5ICEA 3GZAA 1QEXA 4HVOA 5JR7B 3F2ZA 4XKWA 5CYYA 2HS5A 1UZCA 1JYWA 3MFCA 2GA2A 2ECBA 4P9UA 5EIYB 5FRMA 3H5AA 5JR3A 4OFGA 5FFXA 1YW7A 3GMEA 3NNLA 3HJRA 3E97A 5J96B 4AD9A 3M1CA 3TW7A 4GXLA 1OLMA 1DGLA 5EEAA 3VHRA 3C3WA 2JRTA 3SCGA 5D8KB 3HSFA 4O6JA 1W6OB 2XAUA 5BNOC 4OIRF 3OYBA 2EFQA 5F7UA 4HG2A 2RNGA 5BPXA 4NBQA 2J1UA 1OH4A 2WUHA 1PX3A 3POBA 1TMF2 4G7OF 1MS3A 1SFPA 1U8RA 3T0YA 3HT2A 2DCZA 5AIPA 1R58A 5H9QA 1T6BX 4R79A 4ZONA 1QXPA 2GN3A 2OJED 5CVVA 3DQVC 2P3IA 2KT0A 1R7JA 1IDZA 5FBJA 4FO9A 1RIRA 4V19K 2NS7A 2IW5A 2UWMA 1D0YA 3NJYA 3VBOC 1X9TA 2VW0A 2EH3A 4XQDA 1FBSA 1AR73 2ZMLA 4AVBA 3HVDA 2XF6A 1L7LA 3SKVA 4BJ5C 3LQCA 3NJXA 2A05A 4RB0A 3RQ0A 4WV8A 5GPAA 1JKQC 3WGHA 5A7WA 5LBQA 2WY8Q 4TXWA 3ZYJB 1OA4A 3HBZA 2HWC1 3GVAA 1MW7A 3VKNA 1I1EA 2XPJA 1P4AA 1WI3A 3FXQA 1GQPA 2RS11 4K21A 5J3UA 4IL6C 4KUMA 1FYMA 4ISRA 4IEWA 2ZNZA 3HHHA 4H55A 3WTTC 4GH4A 4KH9A 1JJ8C 5A7OA 4CTEA 3VDXA 4LULA 2JQ7A 4ZU7A 2X1EA 1LDKB 3VLBB 4YZ3A 1M06G 4LE4A 1SFUA 3PLQA 4QKBA 4Q27A 1GSLA 1ZNPA 1PNGA 5IHRA 3GBWA 4D3WA 4DXSA 2E7WA 1J0RA 1FPN3 1TBXA 4RR3C 2CQKA 1RVF2 2K9MA 3EYYA 1QJX3 5K7FA 4CZCA 2Z5UA 3VD4A 2HEWF 3BPZA 3MN2A 2ADDA 3RS6A 3L2QA 3ZMSA 4DYRA 4LBKA 5J40A 1UU6A 2R4GA 1Z3XA 3MLKA 4ZZLA 2M4GA 3PHMA 4QPWA 1JJ6C 2JDZA 1NK2P 5A7WB 5C4JJ 3H8UA 3WE3A 2QKMB 3ZOBA 2WWSA 2Z2SB 2F48A 1Y39A 5IK4A 3EUKL 4GMP3 4NAMA 2VZUA 2B46X 2YXSA 2D5HA 3O3KA 2EV5A 3H9AA 3FXKA 3RYRA 5IW0A 1FYUA 4GH4B 1VBB2 4MEXF 2ZKLA 2Y48A 2JJ6A 3MLJA 1VRH3 2XAJA 1V70A 2GNDA 4BJTA 2P7VB 4QMAA 2PYTA 4HSTA 2RHPA 2KKOA 2XUMA 4IOCF 4B8XA 2W4SA 2PELA 3O8GA 2MH2A 4UFKA 4H0EA 3W21A 4YW6A 1N3PA 2WV0A 4COUA 3ELNA 1KYZA 1YJNI 2J22A 3ZSKA 2IGNA 2J5OA 2X6WA 4HX8A 1MMGA 2VBPA 3FFZA 2VNVA 2Z33A 2K2SA 3MUY1 5FUIA 2FMDA 4MUVA 4CEYC 5A6ZA 4ZU5A 2WNEA 2AZ5A 2YROA 4LB5A 2Y0OA 2DCEA 2XV4S 3LEKA 2BU9A 2VZPA 3O0VA 1VQMI 3W6VA 3ES1A 5LFAA 1OLRA 3TKYA 1YFXA 4MGKE 4UVBA 2LLKA 4UWDA 4P96A 2Z1DA 3H8OA 1LDDA 3J7AY 4AIKA 4D5CA 3ZXFA 2DAOA 1TC3C 1TMF1 5F3IA 2E2JJ 2QGUA 5I0UA 1D7PM 1XSVA 1MEC2 2P5BA 3WF3A 9ANTA 4N4NB 1PIV3 1X50A 3I49A 3LGRA 3K4JA 4QDSA 1DGRN 2J1SA 3MKLA 3H1MA 1ZBE2 2WNVC 3HWJA 4QT6A 2Y6KA 4AR2A 2PQ8A 1BIBA 2JWTA 3KV4A 5BV6A 1P2FA 1I3HA 2BGCA 3P9CA 4FAHA 4B1RA 3M8FA 1T38A 3C2HA 4MO7A 1FJLA 3ZMUA 3BG6A 2E19A 2QJVA 4X1EA 1COV3 1YI7A 1QQP2 1WLTA 4COZA 2GH2A 1BI2A 2WNOA 2LMDA 1IS4A 3UK9A 3LDRA 4HKLA 1ULFA 4Q4X3 4EN9B 3LB9A 1A5JA 2Z42A 4LE3A 3JRGA 3IRQA 1LGBA 3WNXA 5FAXA 3SFIA 5F8PA 1BM9A 4XBLA 1MS9A 3SEZA 3POSA 2D3RA 1X8MA 2P2KA 4BK5A 3NO8A 4XLNF 5H20A 4AFCA 3LAJA 2L0KA 3SH5A 5C4WA 2O0OA 3RCOA 3LPGA 4QKNA 2ZC2A 4FT8A 2ELJA 4NHYA 3OB8A 4A3JJ 2XG3A 2HOTA 4XXPA 5DM7F 4P9JA 4A45A 2PTMA 2M9HA 3CO2A 2OQ6A 2YUEA 3J9SA 5FR3A 5F64A 3AL0C 3FMSA 4BDZA 4PK4A 1OJLA 3V7SA 1CAXB 1IRFA 1N1TA 3QYEA 3IH3A 1BL0A 1ETXA 3K1MA 3HSEA 1IRGA 1QDCA 5BQTA 3OYJA 4M3CF 1RVF1 3K46A 1HRI2 2PFWA 2X8KA 2WN2A 3VHNA 3JTGA 1YJ9I 2KR2A 5FQ0A 2I10A 2XSJC 2JECA 2ZX3A 4A3KJ 3OYIA 4XRSA 1OOPA 1ACIA 1RKWA 2DTZA 1L7QA 5A7QA 3WCSA 1YQAA 3BCBA 2JIGA 1K42A 5APAA 1W8UA 3L09A 3VBUC 2E5NA 1GKBA 5K7ZA 4AG4A 1NHAA 2L54A 2RMU2 3HOUJ 4JCKA 5B1BH 3JREA 1XGOA 3B01A 3EMRA 3T2PA 2LTPA 2DVFA 3CEWA 3CF6E 1LE8A 5F39A 2FF4A 1WW5A 2NYXA 1VBB1 1U5IA 2COMA 1UZZA 5C4WB 1DU3D 3ZCOA 4MV2A 1EV13 4AHXA 3THDA 3VBSC 4IZZA 5DQ0A 3BTCA 1MR5A 2JA5J 2BE5F 1VAMA 1HC8A 3DKXA 2M7AA 2A07F 2I2SA 3ZMZA 1W3XA 4XBQA 2WB1A 5CFDA 5J1YA 2HOEA 5FPUA 4HV5A 3ZLIA 2Q8EA 1FT9A 4MHRA 2W00A 3RZJA 2RR13 1HW5A 5FY8A 3I0TA 2QF7A 2FCVA 2FNAA 5FQ0B 5T5LA 2VZTA 4BY7J 3IDAA 1VZ0A 4O3MA 3O1PA 2BXZA 1OOPB 2V9VA 5LBCA 4AFAA 1BJAA 2R30A 4DEVA 1KITA 5A1AA 3M3IA 1F5TA 3H0DA 2Q4SA 3Q8CA 2CYFA 5DUKA 1MEC1 3AYEA 3TRSB 4CZZA 1LE8B 1Q43A 3ZQGA 3PJYA 2JVHA 1OCZH 1EUTA 1K7AA 1RHI3 4CDWA 2XGDA 4IEJA 4DY5A 1IN8A 3HEFA 1WBFA 4DBRA 3S7EA 1ZBE1 3FLTA 4A3MJ 1MBKA 4UUVA 1SFEA 4CDXA 2X10A 2LBFA 1OCOH 2NOJB 3F21A 3AKPA 2VUDA 3NAUA 4YW1A 5H6QA 4QQLA 1WMXA 3G1LA 4ENJA 2OPTA 4KWJA 3JRCA 3MO4A 2KIQA 1QQP1 2XIGA 2WAAA 4TSVA 2QQBA 1QMJA 1D1CA 5DAPA 1HSJA 3NV2A 1REEA 4RAGA 3UJQA 4M3CE 4XVHA 2A73B 3WTXC 3BCAA 5A33A 2VXJA 5B1AH 5ANQA 2Q1FA 2EXKA 2GLOA 3WW4A 4LUKA 4XNFA 3VOEA 4E7SA 3B93A 3WNOA 4PIXA 1NXD1 2PFBA 3K3OA 2DMTA 3CZ6A 3PSFA 5FZMA 1RUC2 3F3XA 5EZHA 4BA6A 1TT5B 4PT6A 1TWCJ 3N35A 4CDGA 1ULPA 5FZHA 2F6BA 3KIOA 1GZ9A 4BCUA 1P4XA 5HV0A 4I09A 4CDWB 1DGWA 3I58A 1DZRA 3ELKA 5J8FA 4KIGA 2A71A 4YG3A 4RM3A 3Q8BA 2MC4A 1X4PA 3QP5A 2DT6A 3CP2A 4XJ9A 1SVMA 4CDXB 1GP5A 4YGCA 3S7IA 4C2UA 2X29A 1EV7A 2LBFB 1MS0A 5DUXA 1YO8A 2VO5A 1HRI1 1GOFA 1BMV2 5FLXZ 2OAZA 2JG9C 3AG2H 2OYZA 5FTTC 1Y0NA 3MPPG 2D6KA 2ORZA 1RUE2 4MOAA 1BBT3 3IMNA 5IT9K 2IGMA 1FTTA 5E8GA 2R5ZB 1MH4A 1NCQA 1M1EB 1UELB 3HHGA 5A3UA 3VBRA 2P3YA 2D5FA 3Q9SA 4IXLA 2RMU1 3HNMA 3OY8A 5A33B 1WWYA 1LQ1A 2WAFA 4A3FJ 1BA5A 5D5UB 4LXLA 3NV3A 1ZELA 4CP1A 1E17A 4F3QA 1MH3A 2LF8A 4YVWA 5FZ3A 5LY1A 3H8RA 1Y1WJ 1ND2C 3F9KA 4RL7A 4AI8A 1G6NA 4LOCA 3N9QA 4YIIA 3ZSEA 2WFF2 1H9GA 2YGLA 4XCAA 4MXWA 1OKRA 2CHHA 2K02A 1H1IA 3RZMA 1E5RA 4HN0A 4XUOA 5CBLA 1WFXA 1Q8VA 2K9QA 2WAEA 2ZXQA 3AZXA 5JLXA 3FHQA 3O1TA 1HN0A 3FXJA 2CY6A 5LY2A 4FPYA 1K83J 4UW5A 1MSFC 1DF0A 1IHMA 1CJPA 2CTVA 5FYUA 2PMZA 3ASIA 1GQGA 5GJ6A 1OPOA 2IT0A 3EUAA 3HBLA 1UY0A 1BHGA 3F8NA 3I4PA 1YIFA 2IUWA 5LK7B 4URAA 3VBRB 3C2BA 2O9LA 1CESA 3WHTA 4DOZA 4B29A 5D5WB 3AJZA 3OY8B 3GUDA 2DJIA 3LSEA 3MIDA 1IPSA 1PMIA 2L7MP 3DFGA 2WSUA 5E79C 3K0LA 3SYTA 1O3RA 4YVWB 1A36A 3GWZA 3PNVA 4B3NA 5BMZA 2CQ7A 5EF6A 1AOYA 2XPVA 3OYAA 3BTYA 3RZZA 4AWDA 2RM23 4NJ4A 4NUBA 2JKBA 1RYYA 4R4ZA 4LIVA 3WTUC 4MXWB 2VXDA 4AOCA 1OFSA 3JAMK 4AGVA 2XHKA 5C5TA 2ACJA 2B5HA 3QYBA 2Y9ZA 2YBKA 2RC4A 1KYWA 1LOCA 3A0HC 2WJSA 1C3HA 4LLNA 3C2GA 5DD8A 4EVIA 4MHUA 5JLWA 1I3QJ 3TOBA 2L9NA 3CF2A 1OQ1A 5CJ9A 2DQLA 3LFMA 4M0HA 5ACA3 4BK4A 3VZJA 2KD7A 1P8JA 3SHRA 4MFEA 4BMEA 1RUC1 3DV8A 3I7DA 4DQAA 3O1OA 1XGSA 2K0GA 4Q2FA 4HPQA 4C8DA 4XQWA 1FMD1 4YRDA 2CYYA 1LGCA 4HOBA 4IV3A 5A2QZ 1X19A 4N7IA 2KFDA 1KJLA 4RGRA 2LR8A 1J1LA 1DGWX 5KHDA 4U87A 4UHTA 3WSOA 3M4FA 1JZ3A 3N9LA 2EINH 3NNJA 4YW2A 1BMV1 3AP4A 2FQ3A 3ERMA 2VL4A 1V0AA 2B8MA 2HWF2 3I8TA 5C3PA 1NG6A 4B3XA 3GO5A 2G7UA 1RUE1 1VBA3 4QPIA 4BQWA 2CW7A 2D44A 2A3SA 3DECA 4AQSA 2BFUL 2VBWA 4XMIA 4JTOA 1SC7A 3CDIA 3CMYA 2K3PA 5C44J 4IHYA 4GB33 1FXZA 4YG0A 2AUYA 3U1DA 1C5HA 1YC61 2QTWB 1WHUA 1ZTRA 5T55A 4XUQA 4PLMA 5CFCB 3SQNA 3LFKA 1ZZ7A 4RN5A 5F1JA 4Y1VA 4DZGA 1P7IA 5A1LA 1E5SA 2H0BA 5L36A 3N9OA 1PK6A 1UX6A 2WFF1 3ZPYA 4JQFA 4IV3B 1D8JA 1NUKA 2C24A 1W5TA 5FYIA 4NRQA 3ITQA 3PUSA 3AXEA 1Z3YA 4C2TA 1XB4A 5EG0A 4I30A 5L3CA 1UZWA 4AVAA 1K6YA 4LHSA 4P14A 3OYMA 1P9QC 2OPWA 5FXVA 2C4XA 1XOYA 3HJEA 2ZA9A 2ZBKA 3DLLF 3NSTA 2DCJA 4QPIB 4M3BA 2ZJQF 3RZKA 3BTXA 1RUNA 5ISLA 2HOSA 4IEUA 1JS9A 1ZHFA 1J3RA 5M5WJ 3RJ2X 1FC3A 3ECOA 4YW4A 3M3YJ 2XVKA 1QNTA 1LEMA 5E3LA 5CPRB 4A6SA 1WH7A 5IT9Z 3OMYA 4WBBA 1XSQA 3ILNA 2ZGUA 2G9GA 3OL4A 3ZQFA 5IVVA 3AM2A 2O8KA 4EJRA 3LSGA 3C8XA 1AL22 1Y56A 4Y5TA 4IF4A 2QZ2A 2WZR2 4YIRX 4YGDA 2YC2A 5JPNB 3TDUC 5FZAA 3KVBA 2OT7A 3CZJA 3TN91 3DTEA 1PK6B 4IEVA 1SFOJ 2WT2A 1TG7A 3DPRC 5HV4A 4Y20A 1S7OA 2Q30A 1XCBA 2FE3A 5EG0B 1RXFA 1E2XA 1MBEA 5FO5A 4CCLA 1WSUA 2JPBA 3DKYA 2HBTA 4OMYA 1BK1A 1EA3A 3PNYA 2Y6GA 1GDTA 2YG0A 3ECQA 4U0YA 5FO7B 3OR2C 1UOFA 5HCAA 2WQZC 1UZ0A 4P9LA 4KIFA 1Q8OA 2JG8C 5HNFA 2AHQA 3V4GA 2HWE2 5KXBA 4LA2A 1QJU3 1XG1A 1W03A 4CU9A 4Y17A 1ENHA 2OUHA 4CA9A 3ABZA 2NVYJ 4MTEA 4Q4Y3 4A2UA 4NQWA 1OYIA 4S2GA 5AC93 4FISA 1RUJ3 2JE7A 4FP2A 4GAZA 1NAEA 1FNNA 2VODA 1A8DA 3K4BA 2XL9A 1WJDA 1V6LA 1ZVFA 1B6AA 1W28A 3PL0A 4E7JA 2ID4A 2LSOA 5HLGA 3F8CA 3JB8A 3VZKA 5BYNA 2ZFWA 1IS5A 5EZGA 3RYPA 2AO9A 4Y20B 4CP0A 4Y22A 5FZ0A 2OTJI 1N1VA 2VKEA 2HWF1 1MACA 1WJBA 3PL8A 2V73A 1YITI 3LE0A 2HYXA 3KWVA 3L1PA 5M3FJ 3GZTB 5TSWA 4ZXKA 2H6BA 1RUG3 1VPHA 3CJIC 3QWLA 1OURA 4EN6B 4K1ZA 3ABTA 4QXBA 1HW1A 3O0XA 1X1PA 5JHFA 2C5DA 1KA8A 1IW7F 3BDDA 1W9SA 4Z92B 1R083 4B4CA 4P9GA 2FBIA 2A5WA 1U8BA 1GUIA 2PXJA 5FOJB 1F31A 2R7DA 4KBBA 3SHFA 1R1VA 2W1WA 1JHHA 3DXTA 5C3OA 1SVLA 3ST7A 3BTIA 2IXKA 2VQTA 2WS92 2CH0A 5B4XA 4XIDA 2HZDA 4JDNA 1W4MA 4ENNA 1YFWA 2A61A 4TWTA 1WJ5A 4XF9A 3JBG2 1CF7A 4A3GJ 1D8KA 2ZGPA 2D6PA 3VZNA 2DVAA 5FBZA 1JTZX 1W05A 5A7SA 1XE8A 2NVUB 2K4BA 1ZRDA 3ILFA 3G71I 3JSOA 5FOBB 2KP6A 4Q4V2 2YZ4A 3VDDB 4AEKA 5JIUA 1JTXA 4Y22B 2HWB2 4M6VA 3ISPA 4N4OB 3ZYIB 3DEWA 2RG4A 4WZFA 5DG1A 3PNTA 4OMZA 1FBQA 3SDBA 4FBFA 1C0WA 4WXDA 2ZAHA 1AYN3 1YYVA 2TNFA 2ISYA 5T54A 3AZVA 3H5NA 5E17F 4A6OA 1VLNA 2JDYA 2PAKA 3DF8A 4ZPIA 4YNIA 1L3JA 2ZFUA 4QHZA 2LY9A 4LK1F 1UIJA 4XICA 1AL21 1W0UA 4NRPA 2W7NA 3BI3A 4A3BJ 2R7RA 4AI3A 1MPXA 1F35A 3BPVA 1HSTA 1W9WA 1GU3A 4CP9A 1DGRA 4HZFA 3RKXA 3D0JA 4LJHA 3S57A 1CF7B 1QPMA 2ZGTA 4XDPA 4NHKA 1KDMA 2CQNA 1XQNA 4IHXA 1W6MB 1C1LA 2CGPA 5LD2C 2VC9A 2V9PA 1APLC 3S5AA 2GP3A 4A3EJ 4H7LA 3RFRA 2ETEA 2TEPA 4XK4A 4YSFA 2PX9A 4NO4A 4M9XA 4LHLA 2P4WA 5JFRA 4M6YA 2OBPA 3OYNA 2HWE1 3TOAA 5FV3A 5DXDA 3RYKA 1R36A 1H2NA 4FPJA 1I5ZA 3Q8EA 3PUBA 2EZIA 3JRFA 3LKJA 1OISA 4A5MA 4UVAA 4AVCA 2MYSA 5FZBA 4C2MJ 3CDZB 5DAQA 1EH6A 1C8M3 2BUKA 1OLTA 1TT0A 2HDWA 2BHYA 1ZBA3 4DNYA 3SMHA 4Q0PA 4DIQA 5F3EA 4UAPA 5L9VA 1CIWA 3H1CA 3F6OA 5F27A 3IAS2 2R062 1WVRA 1UMZA 4CP9B 5L9BA 3IH2A 1F15A 3PTRB 4AFBA 2E9QA 4LKEA 4HEA2 3WY6A 1HDKA 3ZN6A 4UF0A 1CD3G 4PDWC 2PJRB 4GGGA 4PJMA 4JQRA 2E7TA 1NK3P 4ABZA 4A7KA 3FL7A 2JA8J 1HLCA 2Z69A 4FPGA 1JN2P 2GC1A 3RPUD 3MKZA 4IETA 4QXHA 3OGJA 2F4OB 4QX5A 4IPAA 1BIAA 3HT1A 2VI6A 4XEZA 4OHZA 3P7NA 1N3OA 4FFHA 3E1SA 3PTYA 3F8MA 3ZDVA 4D7TA 1U6GA 3X2QH 4PCRA 5IAVA 2ZGNA 3CLOA 3FXOA 3AKQA 1LHWA 4CZSA 3H0OA 1Z21A 3IPVA 5L3GA 5E8IA 3CC2I 4JKKA 1Y43B 2WS91 3WDTA 1IPJA 3MZ8A 2JDHA 5BNPC 2W91A 1IS3A 5FO8B 5I0TA 2KIFA 5E16A 4QWQA 1REDA 1IPKA 1KS5A 4NHLA 1ITYA 4PLOA 1NLSA 4BQ3A 4XMAA 1ZLJA 1D1BA 1W6PA 4A0YA 2PG4A 4M72A 2NRAC 5FKOA 1RZ4A 2D7FA 3PUHA 1A3KA 5M0TA 5IVEA 4M74A 3RVHA 3V42A 5IYBJ 2PQQA 3ZYHA 4Q4V1 4A93J 1VP6A 4LBLA 3RJRA 3ZN6B 1L0OC 3DLAA 1SQ4A 2DU1A 2HWB1 4UF0B 4LBQA 2WZPP 3POJA 2ZGOA 5JOWA 2P3KA 3KHCA 5HLIA 3CBNA 2BWCA 3KGZA 2IFRA 2CAVA 4R8HA 3IUOA 1ULDA 1Y7BA 3OYCA 3H1YA 3NNMA 2KZVA 2XGCA 1W8TA 4ESJA 1ZKGA 3KFWX 2H27A 2KMUA 4BJ0A 1NKGA 1N3QA 1PZ9A 4FCAA 2VC1A 2E1MC 4P5OA 1QH6A 1WCSA 4UBHA 4MH0E 2JVGA 3IV5A 5LK5A 4H14A 5C71A 1XSRA 4NWVA 2YB7A 2WLQA 2IEKA 1IXSB 4M3CB 3SXYA 1MNDA 1KRIA 1NZCA 4OI2A 3WTYC 4IX7A 1O59A 2YFUA 4D94A 3CJQB 1W5SA 5ILSA 3GEZA 3H0GJ 4W97A 5JOYA 4ESFA 1BVVA 1H4HA 3P1IA 1YLFA 3QCWA 2DTYA 2E2IJ 2VVEA 1OH3A 1SPPA 5JR2A 1XU1A 4XF3A 4YFXF 3R6SA 2QQAA 4LBQB 2XPUA 2R7OA 1HXS2 1DCSA 1EAH3 1PVXA 5JZGA 2D45A 4XACA 5D1IA 1H8AC 3WLUA 1D5YA 4BQQA 3EO6A 5F6KA 3S32A 2R0HA 3ZSLA 5BOXA 3BOQA 2RV8A 4CYDA 3BROA 1WCMJ 4QLCU 4RYDA 2EZLA 5DS9A 4YVSC 4CRQA 4TN7A 4KG8A 2F6CA 4XONA 4DQ2A 1SDDB 4COWA 2Z4FA 2VOXA 4BQ5A 2CWSA 2A69F 1U0JA 1W9YA 4QHOA 2LP0A 1WLDA 4D8MA 4D6RA 2P7CB 4W6XA 3L00A 1RUOA 4XQFA 1K5MA 1IF1A 3U1XA 1BI0A 4BQOA 1T8IA 3RWNA 1J9IA 4O9EA 2VBDA 1FNZA 3D82A 3AKRA 4KN7X 2XF7A 3AFKA 2RDNA 2YU3A 3DN7A 2RQPA 5F2WA 2EVXA 2ZZJA 5FD5A 1SPPB 2DCKA 4OQ9A 4RGXA 4FPLA 3BZKA 4IUGA 2BTVC 4E2GA 2GP5A 4ZH4F 1VNDA 2ZBJA 3T1MA 4UBGA 5JZGB 4WVWA 1QDOA 3O2PE 2A6TA 1VQ5I 2DPUA 4F8AA 3C18A 1R64A 1BOBA 1UX7A 5HDGA 2QENA 1S29A 1UXZA 1TEIA 3MV11 4ENMA 2GNBA 3N3HA 4AEJA 1FV3A 4RS5C 4GRIA 3CLQA 1I39A 5GAGJ 3B3QE 4LMFA 2VJIA 2DFCA 3ZSMA 1ZR2A 2KA3A 1BK0A 3MDPA 3M3CA 2XJRA 5JHUA 3KB5A 1D4M2 3J7LA 5J6XA 4JX0A 2EF6A 3FZVA 2QBYA 4AYBA 4DJAA 4R9AA 2LALA 3A22A 1JXNA 1JZ5A 1K5MB 1QNYA 4QQ2A 1W5CC 3FISA 4CSWA 2F4PA 3KZYA 4AHZA 4LKDA 2CSGA 4ISQA 4F91B 3KEOA 3OYKA 1AUYA 2P6HA 2VQHA 1ASJ2 4B7EA 2V72A 2I07B 2JUGA 3HRMA 3TGNA 1SFYA 3VKOA 2ZEWA 4Z2WA 5BNOA 3J80Z 2HYGD 1HBXG 3ZM8A 2JENA 1RMU2 4PJ0C 2ERFA 2G9WA 3KP7A 1H0MA 3I3EA 1R22A 5IK8A 1TWHJ 5LB6A 4YFNF 4KJZA 3LIHA 4CEWC 4QTRA 1YUDA 4YZ5A 2W5FA 4BWOA 3A01A 3C7OA 3OYHA 2VT2A 4XORA 4AL9A 1WZXA 4G6DA 3IZOA 4BJ6C 3T4HB 2VKHA 4ZDLA 2IS2A 1K4SA 1AR72 4QX2A 3CIHA 4HT1T 2QBYB 1MS5A 4J00A 3VBOA 4OHYA 5KXEA 1Q8PA 4A41A 4XM3A 1PNFA 2HBUA 3POGA 4ES8A 1VJ2A 4CUCA 5FROA 1GICA 4XOGA 3LNQA 2DF7A 2R32A 3T08A 2VCMA 1HXS1 4W6WA 1KU3A 1V6KA 3PUIA 4UXAA 5LZ6A 2K7LA 4ZDPA 1T6SA 1XMAA 3ACHA 4IV1C 1KU2A 5C8CC 4NIDA 2XLGA 4BUPA 2EIEA 1NA1C 2GOXB 2DVBA 4QXCA 3WZ1A 2VE9A 3WG7H 5CVIA 2KIUA 1LPQA 1S2KA 4E27A 3ZFFA 5C3EJ 2FQ4A 3B94A 5F9TA 3MWMA 2DA1A 3MMYB 3R60A 3MIFA 3UKTA 1FX5A 4EMSA 2CO5A 5JSOA 5CU1A 1FBUA 4XJUA 4NN0A 4O61A 3J8F3 2BV6A 3DU5A 2Y38A 3ZDSA 1QJX2 3M8JA 3C2UA 4AVVA 3GGLA 4HNTA 4DYQA 1J84A 4L9BA 4RR3A 5FK7A 1MS4A 5DDJ2 2ET1A 4WM7C 5GLVA 3LDBA 5GLUA 1SD6A 4XAEA 2VMGA 4EJWA 4A44A 3UV9A 1JZ7A 4BY1J 2CUEA 2GBYA 1CQ9A 3BTAA 2R92J 1FOWA 5CQGA 3G6JB 5D21A 3ZYRA 5GZGA 1IAWA 2OKXA 3QPHA 4X6QB 3POEA 4LBNA 5J8CA 2FXAA 3AX4A 5K5OA 2FBKA 1ZZBA 5LA1A 1CX1A 1ORKA 1T0FC 1JH5A 1LAJA 2ID6A 1UG2A 4CICA 1IUYA 2FDKA 3FXLA 1XX5A 4LOTA 3V0AB 3ZN5A 3ZFFB 2R7WA 1JOBA 3AP7A 5T5OA 2CQXA 2XB5A 3FFQA 2MABA 1ZGWA 2HWD2 1YQCA 3FZ3A 3ZIXA 1D4M1 5E89A 3PIGA 2C1FA 4H3WA 4PJYA 5FPLA 2D97A 2NMOA 2HTSA 3W5MA 3N9NA 2BY3A 3OS0A 4AXOA 5D5VB 2LD5A 5KHKA 4YLZA 4CEYA 4XFFA 3LZZA 4WCGA 3UYJA 1WGPA 4DW6A 3CNAA 1R1UA 1AHDP 4RGUA 1ASJ1 2K40A 2XAHA 3G73A 2BFUS 2D93A 4KWUA 3HOTA 3I2FA 4AIDA 2EALA 3M4OJ 4MZUA 1RMU1 1YI9A 1PIV2 3QU3A 2ZGQA 3VKMA 3K4AA 2QBXA 2RS52 5E6HA 2RDRA 1JYIA 5DCFA 3IIAA 4LBJA 4AAPA 5SV8A 4XFHA 4E4DX 1FOD2 3J81K 2B7EA 2WNVA 5EDNA 1YTYA 3RRDA 3K6GA 5IP6A 1REPC 4MG2A 1AR71 3I64A 2RDPA 1DQ0A 3THPA 1I9RA 5LBFA 3OOPA 4IEYA 1DDNA 5IYYA 4V2WA 1R49A 4XPVA 1YQ6A 1XBFA 3ZFEC 4EWAA 1YJLA 4ZTJA 4BACA 1D4VB 4HMZA 3EBRA 2TDXA 2E7XA 1Z1DA 2ZMEB 4WVMA 2LRPA 3KM5A 3CZUA 2IXJA 2VOPA 4HXCA 1RL3A 4NHJA 4M3GA 2DA6A 3M3EA 4CCOA 4XR6A 5JOXA 5IP9J 1OLME 3BQYA 3KLSA 1FP2A 3QPTA 3K4ZA 2HKXA 2HPMA 3WINE 1HIXA 3OG2A 1LDJA 1PGW2 2RS33 3DPLC 1G86A 2VQUA 2HOAA 3SKJE 4L18B 1Z7S2 2WBKA 2D1HA 1PYVA 1MS1A 5J47A 3BOPA 2FRHA 3L2RA 5A70A 4YW3A 1QJX1 4NWWA 2WNVB 4FPFA 5DDJ1 2XWJB 4FI9A 2GWRA 1G3SA 4BS9A 2ECCA 3ORJA 1K61A 4U0VA 3O1VA 3IKVA 3WNNA 1SCRA 1TQPA 3AL6A 5ABJC 4OUMA 2LKXA 4C90A 1YIJI 2K85A 2A6WA 1MMNA 4DRRA 3K3NA 1G4DA 3WF0A 3HDDA 3T5XA 5FXZA 1FOKA 4GMP1 5D8AA 4GFBA 2VOOA 4N53C 3VSKA 2DWRA 4WVMB 1WJCA 2BNNA 2BRTA 1LR5A 5HVQC 3MF6A 5L3EA 1UYXA 4DGWB 4PIYA 2YPJA 4RQPC 2AREA 5GZDA 1J3QA 2E2HJ 2P0WA 3HOWJ 2RDQA 1IXCA 2E51A 2ZMNA 2Y0SN 3OYGA 5FY4A 3L2HA 3FXUA 4PJJA 3V0BA 1CAUA 1UYYA 4ZKTB 4QSHA 2M0MA 3SISA 5D2AA 5H9SA 2KRCA 2HWD1 4A3IJ 4LIUA 2RVCA 3BZCA 3PJQA 1LOEA 3AL0B 4I02A 4HDVA 2A6HF 2AXTC 3CF5F 3LWFA 3RI9A 4J19A 3DEUA 2D98A 3WGIA 4HL0A 1YFYA 1GT0C 4E4HA 1G2HA 1PUFA 1F1ZA 4G6QA 4Y26A 3CCLI 4QB2A 5KHGA 3S3NA 2IJLA 2K86A 5EFUA 1BJZA 3I55I 5D8AB 2V5DA 3AYAA 3KCCA 2M8EA 2NZ9A 1RKTA 2YUSA 3H9JA 2VBBA 1PIV1 3LFIA 1MNEA 2X85A 2IRFG 2RS51 5I93A 1VBC2 2DUPA 1S7AA 2WDBA 1MZFA 1OA2A 1TNRA 3LEGA 1PJRA 2PN5A 3DP7A 4I98B 4LO4B 1FOD1 3V0BB 3FX3A 1CAUB 4OOIA 2MG4A 1TWFJ 1TZOA 2ID3A 1XGNA 3LSKA 4BE0A 1USSA 3S17J 3IB3A 3HRTA 1COV1 3GBGA 3VDAA 4DUWA 1S0GA 3ZXDA 1WLWA 1DP7P 3GFMA 4Q0UA 2FZ2A 3TO9A 1A31A 4XQ4A 1PUFB 4PBPA 4WXHA 2XDVA 3N97A 4LO5B 3VBHB 4ZYHA 3NQHA 4ASKA 4YELA 2EQRA 1N78A 3HKZN 4U2AA 1S3JA 3WF1A 5T5JA 2GZWA 3THCA 1Y9QA 3V7RA 4HNVA 5DD4A 2JIJA 1PGW1 3IDBB 3VB2A 5JXIA 1Z7S1 3BVCA 3T2QA 4IW3A 1FEXA 5DPNA 2MGQA 4D9JA 1BN5A 2P17A 1NE4A 1DYPA 5D6FA 4D5FA 4F92B 1WPKA 1HV1A 2X5IB 1PMJX 2CSOA 3S1NJ 1U5XA 4CA0A 4KICA 3C7EA 3SCHA 1SAXA 3NVCA 2Y69H 3MZHA 1HB3A 3VUOA 3Q0WA 1J1TA 4FFFA 4ITCA 5IY5H 1UN1A 3PO2J 2CDPA 2JG9A 1ENXA 4L0ZB 5JXGA 3G6EI 4UI9L 3QP6A 4IE0A 3ZN0A 3UGGA 3MKWB 4I01A 1UZYA 3H1WA 1J59A 1IKQA 4WXCA 2AS5F 2EJRA 1MBHA 2X05A 5AONA 1UNBA 3PIJA 1VB4A 1E3HA 1YO5C 3O0WA 4FPKA 1B9MA 2CFXA 2Y34A 1I3AA 2PLV3 5DUVA 5FZDA 1Z7UA 5A3PA 1F5JA 3HC7A 4UUTA 2FDFA 3NKGA 3NV4A 1T98A 4XOPA 3WQ1A 2KQRA 4C0HA 3T2TA 5KHJA 2H6CA 2KIMA 3MAJA 3GZEA 2VQCA 5H6RA 1DIWA 2CDOA 4JKLA 2XUEA 2W08A 4NMIA 1MKMA 2MD0A 3CESA 5FKLA 2QWWA 1RUD3 2O0YA 2KISA 1Y6IA 3FMQA 4LB6B 1ZN2A 3WNMA 2GM4A 1H2KA 3RWKX 2L3DA 2Y8KA 1N47A 2AH2A 3WG1A 4KG0A 3AMHA 3SFZA 3DTKA 3G4SI 4HPKA 1POQA 2DA7A 3ZYFA 3J4UH 2EBIA 2RDSA 1ZA4A 2JG9B 4GJZA 2CUZA 4GH4C 1YJKA 2DDBA 3E5XA 1WCUA 4RGGA 5JVVA 2ZPXA 1R9TJ 4Q0QA 2A75A 2HYJA 1U5ZA 1W0PA 2G9ZA 1R00A 3ZYGA 3NJVA 3HN3A 3K48A 3ZIWA 5B4NA 4BISA 3TEWA 2L2OA 3GTMJ 3LA3A 1H9WA 3PURA 1W0NA 4FTHA 4KFCA 2XVCA 2W9XA 3S93A 3T8TA 1VBC1 4UV9A 5IUQA 3DXUA 2I8DA 4ET7A 4XJAA 4I3PA 3WG4A 1RVF3 3ESWB 2ZJRF 4UFIA 5L19A 3OF1A 3OV8A 3CMEI 2R7VA 1O8SA 1WCQA 5FP4A 4LBMA 1SD4A 4XF1A 1U5TC 3PIPF 3CJNA 1B4AA 1QXRA 4B7KA 1HKTA 2GMPA 1ZLKA 2Y31A 4CCCA 4AM3A 4FOWA 4LG3A 1G8XA 4YW5A 4EQVA 3HAGA 4HPKB 1KGYA 2BVMA 4A3CJ 4XXAA 3PVEA 3WP6A 1GWMA 2BY2A 2RGVA 4RM2A 1WW6A 4JX5A 1T33A 4AFDA 5FWJA 5IVFA 5ACA2 3S2HJ 1JI8A 1NLQA 2OUMA 3CJTB 1H8TC 3K10A 1JODA 1W99A 2DXIA 4AQ6A 3RZOJ 1HKDA 3KZZA 1PM7A 5E8AA 1ULGA 4ANJA 2L9VA 4L2NA 4YFKF 5HLHA 3BG9A 1HB1A 4OU0A 5DCMB 2XWBB 1FWZA 1R5GA 4CPBA 1XNCA 1ZYRF 5FJHA 2V4VA 1H8VA 1W8NA 4RLQA 2WV1A 3AKTA 2JDMA 4E4ZA 1R092 1WBLA 2Z79A 2YU9J 3H5RA 2MLGA 1Q56A 1XYOA 3Q8FA 4HNUA 4HKWA 3H3UA 1R4MB 5LGUA 1BVP1 1PP8F 2DQRA 2B45X 2FUG2 4E6KG 5FZ1A 1TNTA 1PP7U 4AGRA 3M70A 1BC8C 3TDZC 4RAYA 1MEC3 3OS2A 1RR8C 3PM1A 3S1QJ 2KRFA 2WRAA 1G3WA 4G9SB 3OD4A 3COAC 3EYIA 1YS7A 1PM4A 1Q8SA 4JP0A 2ADEA 2DA4A 1VB2A 2Q8KA 4XRMA 3HPGA 5EWSA 2XJTA 3ZXJA 4Y1UA 1ZARA 2ZX0A 3N7LA 3UJOA 3HXLA 5ICGA 2E60A 2R49A 3RIRA 2M45A 2UY9A 3AK0A 5A1FA 1RUF2 1C4RA 3ATGA 3NAPB 4LORA 2A70A 2CQQA 5IP7J 2XLFA 1QHDA 2QQ9A 2NOGA 1Q8QA 1I1GA 1DU6A 1Z6TA 2A5YB 2GU9A 3FM5A 1ONAA 3R4DB 4K6BA 2VULA 2QSHX 2VOKA 2HTJA 4GO1A 3D4KA 1GZWB 2F4IA 3VYUB 1DGWY 3VZMA 1WWXA