3R6SA

Crystal structure of glxr transcription factor from corynebacterium glutamicum with camp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
225
structure length
225
Chain Sequence
GVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcription regulator
publication title Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 76
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r6sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3r6sA01
4FX4A 4MGKE 1SMYF 2OBPA 2UY8A 3IKTA 1SFEA 2XAJA 2STWA 3NJZA 1IRFA 1HW1A 4UBGA 4EGZA 3UKNA 1DZTA 2OZ6A 3HOSA 5ILVA 2YPRA 3KEOA 4ZH4F 2BNMA 1PP7U 2XAQA 1XDSA 3LFKA 4M9ZA 1EP0A 1HBXG 4KYWA 1FLIA 3DV8A 2Y0OA 4QMAA 1SAXA 4GYIA 2IA0A 2XAHA 4AVCA 4IEUA 2HKXA 2HQNA 4GULA 1SFXA 3PLQA 1YG2A 4F7ZA 2JSCA 2CAVA 4TV7A 2XROA 2DAOA 1U5TA 4KMUX 1Q43A 3ES1A 5A2QK 4WWCA 4LA2A 1ZX5A 4I7HA 1IW7F 4AVBA 3WGIA 3FE5A 2A6EF 1HKSA 4RS8A 2DI3A 3CJXA 1LJ9A 4Z2YA 4HF1A 1YUDA 2ET1A 3EUHA 1U12A 4CICA 4D7SA 1HSJA 3F22A 4IEQA 1O3RA 1KYZA 1G3YA 2QZ8A 4HBNA 1Q3EA 1T39A 5KHJA 2YR2A 5I0RA 3BB6A 3NQOA 1HKTA 2ISZA 2XAFA 2JTVA 2ETHA 3U9GA 4YSFA 3ZPLA 4HQMA 5FO5A 3NRVA 3WGHA 5LRRA 3LWCA 4A0ZA 2F5EA 1LRHA 5JR7B 2PEXA 1UCRA 4LGWA 4BNCA 4R79A 1LNWA 1P2FA 1MJ9A 3V8JA 5KHIA 2DFIA 1U6GA 1SD5A 3V8KA 3SMHA 4LG0B 4DQ2A 1EYBA 3S7IA 2FBKA 2EFOA 3DPTA 1YFXA 2QVOA 2GU9A 1XB4A 3ERED 4HVOA 2Y48A 4IEWA 4IPAA 3L09A 3TDUC 3BDDA 5FLXZ 1MD0A 2P8TA 1DZRA 3V7CA 4WVZA 2FRHA 2Q0OA 4UXAA 4B29A 2CGPA 2WC2A 3HSFA 3HSEA 1YQAA 1UFMA 2QNKA 3Q9SA 2BE5F 4GYGA 4NHJA 2UWMA 4P55A 2Z2SB 3M7GA 4HX8A 1J7KA 3LZZA 3GF2A 5J7MA 3HOTA 3UKTA 4HLYA 1IZ1A 4Q48A 4XF1A 1BI0A 2Z3YA 2E1NA 3HHHA 3RJPA 1YFHA 4UVCA 3CLPA 3EBRA 3FZVA 3WTVC 1RTVA 1R23A 1FT9A 2VBZA 3BJOA 3FMRA 4HW0A 1STZA 1H0MA 4CHUA 3GZ6A 4I09A 1BI3A 1H9GA 4IEXA 4MTDA 1IUYA 2O0YA 2Z99A 4KU7A 5AVPA 1HXDA 1TLHB 4XFBA 4HBLA 3KP3A 4J1XA 4MUVA 4HLTA 1BBYA 5AIPA 1XSXA 1XDUA 1J5YA 2PTMA 3E5UA 2OA2A 3BY6A 3DF8A 5DEQA 4EJVA 3COAC 2EA7A 3HT1A 4XETA 6PAXA 4MX3A 4QWQA 4GXOA 2F2EA 1HW2A 2ELHA 4LUMA 3ABTA 3P9CA 3GWZA 3RPQA 4YIFA 3F8BA 3JW4A 2ESHA 4P96A 1O3SA 1BIAA 2MD5A 1WRJA 1XE7A 2M87A 5E1ZB 3MEXA 3Q5FA 3IWZA 3K69A 5DD4A 3WE2A 4HDVA 4U0YA 3TQNA 3CL1A 2PHLA 5I0UA 2EFQA 1U2WA 1WLTA 1BC7C 1WA4A 3KFWX 2EAAA 3DN7A 2OYZA 2NYXA 2ADUA 4NVPA 3O14A 4L5IA 4PGHA 1NHAA 5DYMA 4KN4X 1ZVFA 4CZZA 4ESBA 4EJUA 2M30A 4GCVA 4XFHA 2UZKA 3D82A 1OYWA 3ELNA 4H0EA 2XLAA 5T3NA 4MEXF 5JHUA 1EV7A 4D7TA 1X7NA 3ZMVA 4UV8A 4AD9A 1UCXA 2OAZA 2GC1A 2DU9A 4WZCA 3DXJF 1KQ8A 3TGNA 1IXRC 2KIMA 4ZYGA 1X82A 4U7BA 4FAGA 4YG2F 3GLXA 2CQKA 2Q0AA 2PAMA 2P7CB 2VN2A 4L18B 5ERIA 1IN7A 2KIUA 3H1WA 3F6VA 3V8LA 1IPKA 1CF7B 2PMHA 1ONVA 2DQRA 2P17A 2STTA 3C3WA 1R00A 3PVBB 3R61A 5BPIA 3GVAA 1O7FA 2B8MA 3MAJA 4XF4A 3JZVA 1XGSA 2XKPA 1D8KA 5E8IA 2XASA 2HTJA 1Z1DA 2LDUA 2BYVE 2YU3A 3FXQA 3FHZA 3LA7A 4I3PA 5ICCA 3DQVC 5HS9A 5CYVA 3KLOA 1QY4A 4XFIA 1WSUA 5I8TA 3REOA 2GQQA 2HEOA 4KNYA 4GO1A 4IVNA 5FQ0B 3BOQA 2MLKA 3WGGA 4BHCA 4G94A 4CYDA 1D3YA 1ZZCA 3GBFA 1K6OA 1SQ4A 2XL7A 3T0YA 4UV9A 2H6BA 5JVTA 2EV0A 1JE8A 1P4WA 2D93A 1DP7P 4KWLA 3WODF 3IRRA 3ISPA 1GXPA 4EWDA 3U11A 2PQ8A 2D1HA 3GX4X 2IA2A 3H1YA 3G73A 4L2NA 2VPVA 2JZYA 2TDXA 4AQ2A 2P7VB 2MA3A 2LF7A 3VHRA 4PIZA 3GYHX 4CDGA 4IERA 1YIOA 4HSJA 1ZARA 1DDNA 3QP6A 3WU1B 4J1WA 1LKNA 3E5QA 2UXXA 1IN6A 3FM5A 3CJNA 2KXLA 3L7WA 5FLHA 4RGXA 4KU8A 5D5UB 2V79A 5EFUA 1B9NA 4YFXF 2GC3A 3HQXA 2O3FA 4FHTA 4YNIA 2BGCA 4RGUA 4XSZF 2R3SA 2B9UA 1GHCA 3D0SA 2A3SA 3GEZA 1FP1D 2LKPA 2P6SA 4P5OA 4EMSA 1IXSB 5HDKA 2XHKA 5K8SA 3RIRA 3ZP5A 1LR5A 1YHFA 4FT8A 3MZHA 5JFRA 3QAHA 5J6XA 4QX5A 2YSRA 4IRIA 1YLFA 4KN7X 5F64A 3B73A 2RGVA 5LGUA 1H1IA 3FMQA 5ED4A 1XD7A 3CUQA 4YFNF 2IPQX 4AQ6A 4AIJA 2DPDA 3VOEA 1O3TA 2EV6A 3KP6A 1KU7A 2Z9OA 3WTZA 5BOXA 5D4RA 1H1MA 4XF9A 1R5HA 4G7ZF 4AXOA 2P5LC 3WTWC 3SXYA 4IEYA 4OLLA 5DCFA 2MPFA 1PP8F 3EO6A 3H8UA 5J8FA 3C7JA 4ZYEA 1JUHA 4EWEA 2EFPA 1UD1A 4G7OF 3QU6A 4M74A 2D45A 3HRMA 2VE9A 4O3MA 1ZZ7A 1KQ0A 4M72A 3LQRA 4D0PA 1FSHA 1OYYA 3DL3A 2HTSA 4OIQF 3IDBB 1JHFA 3EQLF 2A5YB 3TO6A 2ESNA 3ULQB 3KZYA 5ICFA 2B5HA 5FQ0A 4P9GA 3IBMA 3OCPA 4WF2A 3RYRA 2JRTA 4X6QB 2EA2A 5BV6A 4KIGA 5TJJA 3N4MA 3MQ0A 5ICEA 1EH8A 4QLCU 3BJAA 3SCHA 2XKOA 4K8FA 5JSPA 1RNLA 1G3TA 3V4GA 4WBBA 4A5NA 3E6CC 5CADA 1FBQA 3WU0A 4AWXB 3IL2A 3H3UA 1GQGA 1FNNA 3QU3A 3WW3A 3CF6E 3VFZA 1QGPA 4L5JA 4EM1A 5FB2A 1UW8A 1BOAA 1O57A 1ZZ8A 4KIBA 5ILUA 1YTYA 3NW4A 4UXNA 4HAMA 5BMZA 2QQ9A 1XGOA 3R6SA 4HN0A 2MHFA 2KJBA 4QGNA 1W7PA 5D8LB 2VT2A 4Q0VA 1XMKA 5CLSA 2QYOA 2Y0MA 3T8RA 3JTGA 4B09A 2RQPA 2K86A 3ZMDA 5D5XB 3MWMA 1ZG1A 3RTRA 5E17F 2NAZA 4ZYHA 3EJKA 1L3LA 4MZUA 4U0WA 4E2QA 5BS6A 1P92A 2V09A 4Q0PA 2FBHA 4UBHA 4CGZA 3EDPA 4LULA 2MNGA 4KUMA 2FNPA 4ESJA 3K1MA 4L9NA 2DLLA 5HI0A 4IEVA 4XFAA 1LQ1A 4M9SA 3M3IA 5D1IA 1G4DA 1TQPA 4HQEA 4EM0B 3NVCA 2DK8A 5DCMB 2HOEA 1IRGA 3PNAA 2PYTA 2QENA 5EEHA 4Q4ZF 2FQPA 2WWYA 4A2UA 3TNPB 3HRTA 1OFNA 1FBUA 1CAXA 2K7LA 1ZREA 4U88A 1TQ5A 2UY9A 4L9VA 2O8QA 5FPZA 1FY7A 3FXUA 4Y15A 3TO7A 2DO7A 2DW4A 1R1TA 1P6RA 3FX3A 2GA1A 3O6BB 3WE3A 5A2QZ 3O3KA 1TBXA 4AIHA 1MKMA 4WXCA 1YS6A 3EETA 2VOPA 4RB2C 3O2PE 3DEUA 2QM3A 4OU0A 3I54A 4META 5DD8A 4LK0F 1WGPA 2QVSB 1O5LA 2A6HF 1HQCA 3Q9VA 3TOBA 1E17A 4M71A 2COMA 1L0OC 1WWXA 4HYEA 5L3GA 4OMYA 3H50A 3LSTA 2RC4A 4JQFA 1JXSA 2YX4A 4XF3A 2BBYA 2F5DA 3VB2A 2X0LA 5E18F 4RB1A 2C6YA 2ZKZA 3U1DA 3I53A 2VC0A 3GYDA 2V6CA 3HYIA 3KCCA 1UIJA 5JCTA 5IT9K 4Q5SF 3I64A 3WTTC 1GQHA 5LHIA 5D6FA 3ZMUA 2HR3A 4QGMA 4LD5A 1DGWA 2HYGD 3LAPA 1SD6A 1R1UA 1YWKA 2EJRA 1XGNA 2W57A 1KYWA 4HN1A 3K2ZA 5ILSA 2WFPA 1NZCA 5LHHA 4XFFA 3QRFF 1ZLKA 2C0ZA 2P5VA 1TNTA 2J5PA 2L4MA 1Y0UA 2V1XA 2EFNA 3H7YA 2Q8KA 3RKYA 3MFKA 4WXDA 4XLNF 3F23A 1S29A 1DPRA 4PIYA 1NYWA 4PJYA 4ZU7A 2L4AA 1YYVA 2FE3A 2QDRA 5I93A 2O8XA 5DCMA 5I91A 2PBIA 3KLNA 2M5WA 4EQQA 1B4AA 5TRDA 2DBBA 4M73A 1Z6TA 3F8NA 3MZYA 3HIFA 1K78B 2XAGA 5HDGA 2O61A 5D5VB 2XRNA 3ST7A 2E7XA 2O03A 4UVAA 2QBYB 5HOOA 1S7AA 1OD5A 3OTFA 3ABUA 2PN6A 3BP8A 4Z82A 3GFMA 4G6DA 2HZTA 5LEJA 3F8CA 3SCFA 4M9XA 2CO5A 2LSOA 4LG0A 5D8KB 1WQ2A 4P9FA 4BH9A 2QCSB 1PDNC 3F8FA 4LEJA 3MPBA 2CSOA 4XLPF 4EJWA 1YS7A 5FFXA 4EJOA 3F6OA 2OZJA 1QPMA 3L9FA 2D5FA 2OD5A 5H6RA 3GFIA 3K1PA 1PUEE 2PQQA 4IEZA 2R7DA 1YLLA 4Y13A 4HOBA 5BPDA 1AOYA 3JSPA 3KGLA 4ETSA 1VJ2A 3K0LA 4G7HF 2Z5UA 1Y9QA 4B8XA 4IXAA 4ZU5A 3I4PA 4I01A 5J48A 2LF8A 4OFGA 3LA3A 2DCTA 3ACLA 5JSOA 2RVCA 3H9AA 1U3EM 2OU2A 3ES4A 1P4XA 4A6EA 2IXIA 5C8WA 3C3VA 1ZH5A 1QXRA 2EFWA 2VBXA 3CTAA 5E20A 4L0YB 2K9ZA 5CU1A 5FDBA 2A68F 3U10A 1DGRA 1Z7UA 2H0VA 1ZLJA 1D8JA 3T1BA 4AVPA 2ETEA 4QM9A 2A07F 4MV2A 5CVVA 2UYBA 3BZ6A 4YFKF 3RKWA 1YW8A 4OIOF 2ZXJA 4ON0A 2JT1A 1ZN2A 3DP7A 3RI4A 4UVBA 1XN7A 1XCVA 5FPXA 5BY5A 1X3UA 1RZ4A 1UB9A 3KGZA 3I59B 2PMUA 3MYXA 4RD7A 2EA4A 4ZZDA 3RZZA 2NNNA 3ROUA 3I58A 2Z69A 2WTEA 2H27A 3S7EA 3FM3A 1ZGJA 3J81K 5JAXA 1T2KA 2M8EA 1SMTA 1I6XA 1B6AA 3CUOA 5LGNA 3ETQA 3WTUC 1ODDA 3GO5A 2FEZA 3B02A 5D5WB 2MBFA 3U0ZA 5E1WA 4ORFA 3AAFA 3HRUA 1QBJA 1QQIA 3SHFA 3L2CA 3IWFA 5K5OA 1Z9CA 4IF4A 3RKXA 1TW3A 3ZMZA 3LAGA 3TOAA 1O3QA 1CX4A 4EROA 3I5UA 2K27A 5HLIA 1VTNC 1QNTA 1XGMA 2KIFA 1K7AA 1J2XA 1IN8A 4YRDA 2Q2EA 2KKOA 2IXCA 3BPVA 1TTYA 3J81Z 2BV6A 2MLGA 4L9JA 1KGSA 4BQAA 5K1YA 1IPJA 1YFYA 5F1RA 2EWNA 1FSEA 2XV4S 4XEZA 4LB6B 2ZJ2A 4UHTA 4IRGA 1Z91A 5DV5A 5LLQA 4R1HA 5C6CA 2KRFA 1LEAA 3EQEA 4M6YA 1PMIA 2FF4A 3NL1A 1PM7A 1FC3A 2B0LA 2IRFG 2PJPA 1GVJA 1Z6RA 2W24A 2EV5A 1CAUB 3VODA 4LA3A 3E6BA 1XSDA 3I71A 4E70A 2K0GA 4L9TA 1EY2A 2FOKA 4O9EA 2HS5A 1XCBA 3SZPA 1CF7A 4IEOA 1BM9A 2H94A 2PI0A 2HQRA 1IF1A 4EGYA 2BNOA 3FFQA 2RV8A 2G7HA 1F4KA 4KL1A 1BI2A 2HKOA 3V7SA 2QJVA 3QACA 3KP7A 3RDIA 2DK5A 4U0VA 2IP2A 4FX0A 5KHKA 2OZUA 1Q1HA 4WCGA 4JV4A 4PIXA 1GXQA 3PFIA 1FX7A 3WG9A 4PZJA 1K79A 1OPCA 5JSRA 1LDDA 2EK5A 4H7LA 3SCGA 3CUQC 2HYFA 3F3XA 3BROA 4F8AA 3D5LA 5H20A 4HX7A 1ZNPA 2HWVA 1CAWB 2PAKA 3KZZA 2RKHA 2VECA 3I0TA 4N9IA 4BHPA 3KP5A 1R5GA 4MGRA 4RGSA 4KWJA 3GZ5A 2PHDA 2R7FA 3BWGA 5HS8A 2OQRA 3LWFA 4AIKA 4HDUA 1W7PD 1NXMA 2HFHA 1MZBA 4XSXF 3M1EA 4JK1X 4YARA 2K4BA 2W85A 1LDJA 3E6DA 5CVIA 3QPHA 3QPTA 3BCWA 2DTRA 1FP2A 2RN7A 2ZO4A 3S0MA 5LHGA 1SD7A 4BXUA 2GA2A 5KHGA 1C0WA 1JHHA 1QWRA 1RGSA 3V7RA 1YFWA 5EZWA 1T6SA 4R8HA 5JI6A 2PA7A 4DINB 5D4SA 5KK1A 3WW4A 2W84A 3TDZC 1J9IA 4G6QA 1ZRFA 2OPKA 3TKYA 2IW5A 1F9NA 2PFBA 1XSVA 3IHUA 3JTHA 2XLFA 2P4WA 4ASNA 5KBFA 1MGTA 2XIGA 5EEGA 3CO6C 2IT0A 2Q1ZB 2ZMEB 3E5XA 5L3FA 3DPLC 3IRQA 5E1RA 2HDCA 1ZG3A 4RAYA 3KP4A 3QOPA 5L3CA 1V4RA 3C1DA 1NE6A 3F72A 1IN5A 4UUVA 4M6XA 3ZQ7A 1YFUA 1F1ZA 4LB5A 5E8GA 1LB2A 2Z33A 4LMYA 3H7JA 1J3QA 2GWRA 1NE4A 4KA4A 2ET7A 2QQAA 4MEYF 4HX4A 5FD6A 5HVQC 4WX9A 1CAUA 5HS7A 3RPUA 1F5TA 1J3PA 4OOIA 2GC0A 4KT5C 2VOOA 1KQ9A 4HSLA 2PFWA 2O6GE 5I0TA 1AWCA 2NS0A 5DDGA 2F5CA 2AS5F 5FLXK 4EVIA 1O7LA 3BPZA 4Y17A 3GFLA 1U5TC 1ULYA 3BU7A 4P9UA 4KIFA 4Q47A 1BI1A 1ZZ6A 3RYPA 2IJLA 4EM2A 5K5RA 4IEPA 4PGGA 1I1SA 2L01A 1EH7A 1B59A 3ZMSA 4MQVA 4RAZA 3J80K 2CAUA 2FSWA 3CO2A 4MTEA 3P9IA 1T0FA 5BXXA 5BUVA 2BEOA 4BHBA 5HDNA 4YYOA 1CAWA 4CO8A 1DUXC 2XGXA 2VQAA 4FBFA 3E6MA 1I5ZA 3JAMK 1REPC 3IIAA 5AONA 4BIFA 1QXJA 2ZFWA 1RUOA 4ZYDA 3RNSA 2ACJA 2MH9A 2L3DA 3K9TA 2NNYA 1MDMB 2FQ3A 1W4MA 1R22A 2IXHA 3SHRA 4G8XA 3ZN0A 1L3JA 1R58A 2CFXA 3HSRA 2CWEA 4I2OA 4QXKA 2ZCWA 1FYKA 4HV5A 2F5FA 5CVUA 3WTSC 1ZRDA 1FI2A 2NRAC 3OOPA 4RB3C 1T38A 4EJTA 4LLLA 3LOIA 4CXFA 4N9HA 1YW9A 1LVAA 5CVJA 2VT3A 3BJ6A 4DNCA 4G9YA 5KHHA 4MHGA 3J80Z 3ELKA 1YW7A 1OMIA 2A69F 5FD5A 5FFZA 4AVAA 4XBFA 4EWAA 3OD0A 3WTYC 2X4HA 5FLJA 2M1BA 1D5VA 2EB7A 2Q4SA 3N97A 3WW2A 1USSA 3JAMZ 1HW5A 2D2WA 3TO9A 4L11A 3HTUA 3IKVA 2ZMEA 2MH2A 2PLYA 5CJ9A 4I02A 2KJCA 1WI9A 1S8NA 3NKTA 1Z05A 4WK8F 1CAVB 2E7WA 4I0AA 3OGJA 4LFUA 1U8RA 4X6RB 2L02A 2VXZA 2GIVA 3FMSA 3H1MA 2RNJA 4YIIA 5IT9Z 2XL9A 4PCQA 5HLGA 3I7DA 2VBYA 1RIOH 3H92A 2A61A 2P6TA 2CYYA 2QQBA 3T8TA 5J8CA 1BC8C 2OA4A 2IXJA 4MH0E 5FGMA 3CDHA 1J75A 3W6KB 1SD4A 5FLIA 4KICA 4WXHA 3W6JB 1Y3TA 3PQKA 3GW2A 1W5SA 4JBAA 3HUGA 4IRHA 4R52A 1YO5C 1ZZBA 4E2GA 3FXRA 1KA8A 1SEFA 3L2HA 4HZFA 1ZZ9A 1FXZA 4UNOA 1R7JA 2IVMA 3OF1A 1J58A 1B1BA 1USTA 4L0ZB 4HA8A 5L3BA 4Q0UA 3CLOA 1TW2A 5D6EA 5KVRA 4JTOA 4O5VA 1J1LA 3M8EA 4ESFA 4ONUA 1FWZA 4E2SA 2XUBA 3E97A 1LEBA 3FZ3A 4IETA 3ECHA 3VEPA 4LLOA 4BAYA 2IXKA 1S7OA 2QLZA 1ZHFA 2FBIA 5AIQA 3EYYA 1QO0D 3D0JA 3RYKA 4XF0A 3USSA 2HJIA 2O1QA 3EHKA 1MDMA 3KEQA 3MCZA 1RC6A 3P9KA 1V3FA 2V1UA 4LLGF 1O4TA 4HMZA 2G9WA 4LLNA 2ISYA 1T98A 4ZZLA 1IN4A 4LJZF 3SZTA 1TQMA 1FYLA 1EH6A 3SFZA 3CUQB 4MNUA 3F21A 3GFJA 1UIKA 5LEKA 1OI6A 4HVQA 2CG4A 1X8MA 5FCCA 1MJAA 2K02A 1V70A 3C18A 2D1VA 4GGGA 5I8SA 2VONA 2GZWA 4A12A 2IXLA 4JTNA 2P5KA 2ATFA 1XMAA 5DUKA 2F4PA 1FZPB 1E2XA 3KETA 1B9MA 1QZYA 4LK1F 1W5TA 3R60A 1CAVA 4IJAA 3HT2A 5HLHA 1KU3A 4RB0A 2GC2A 1FPQA 3DKWA 1UPIA 1G6NA 3M9AA 1P4AA 1FBSA 4K2EA 1S3JA 4XRFA 5DUIA 4IHSA 3HRSA 2DT5A 2JPCA 3M70A 4NQWA 2GH2A 3ML6A 1BN5A 2FU4A 4MQ9F 1J0RA 1K78A 1RUNA 2L54A 1U78A 1J59A 3K1NA 2BNNA 1IAWA 3TNQA 1BIBA 1CGPA 4TLFA 2W25A 5E1XA 2QBYA 3R0AA 4ENJA 2UXNA 2PAEA 2M45A 3ZN1A 4ENNA 4PDKA 3EYIA 1XE8A 5BQTA 5J3UA 1J3RA 3L00A 2D40A 1ZYRF 3JSOA 2H6CA 4Q29A 3GXOA 5K5QA 2V9VA 2YX7A 2EVXA 1SFNA 4O9GA 1EPZA 4HV6A 4QM8A 2FMYA 3FWEA 3LQQA 2XLGA 5LGTA 1A04A 3FJSA 4MGYE 1I1GA 4A6DA 3CO7C 1R36A 1G3WA 2VBWA 1W7PB 1XRUA 2FMLA 4I98B 4XFGA 1MJBA 5BPXA 2V1DA 4Z07A 1KU9A 1OKRA 1FOKA 2DQLA 3R0JA 1TNSA 5I8YA 5LBQA 1Q5OA 4NB5A 2Q30A 4XFCA 1ZRCA 1DPUA 4KFCA 3G7DA 1U5TB 2OQGA 2ZNYA 3F8MA 5H6QA 5JR3A 2H09A 3SXWA 4HVRA 2XVCA 1H9TA 5L3DA 3S2WA 2PG4A 1ZRRA 4O6JA 1JGSA 1LDKB 5LRSA 2WV0A 5I0SA 1FYMA 3H3ZA 4KMFA 2QUFA 2DPUA 3WTXC 4MGIE 3HHGA 2ZBKA 1HSTA 1ZGAA 4KWKA 1ON1A 1S6LA 4A0YA 4ENMA 1O5UA 2Y75A 3KE2A 5IT3A 4EV0A 3G3ZA 1ZG5A 2VC1A 4IESA 2ZNZA 1KU2A 2IC1A 2QWWA 1OR7A 3SQNA 1CAXB 4S04A 1IXCA 2RDPA 5L3EA 2AXLA 4OIRF 2GXGA 2FA5A 3M8FA 5ICGA 2K4JA 1TQIA 4OINF 4HF0A 4MGZE 2VODA 1UHMA 3LA2A 2CV6A 1VP6A 4HLXA 4KDPA 2IA1A 3BALA 1R1VA 4N0BA 3R4KA 1RL3A 4S05A 4I0BA 4HF2A 2D5HA 3KMHA 4LUKA 4Q0SA 4A5MA 2JPBA 3NEUA 1G3SA 4IHTA 1WKMA 4A0XA 3KSCA 1RI7A 3I59A 3IDCB 4QGLA 2I45A 3WW1A 4BYYA 3BPXA 3HTSB 1QZZA 3U2RA 5E16A 3ZMTA 3KP2A 3FF5A 4JVAA 5CVRA 3PQJA 3ECOA 2E9QA 1UHWA 3LAJA 3T5XA 1ON2A 2FNAA 3DFGA 2GXBA 3QP5A 1VR3A 2J5OA 3CEWA 3ZDSA 4FAHA 4LTAA 1SFUA 2E1CA 2CW0F 3GUDA 2N7GA 3NSTA 1HKQA 2HGCA 3IC7A 1BJAA 3MDPA 1OYIA 1I27A 4OIPF 2VE8A 2G7UA 4U7DA 5F6FA 3FHIB 4ZU4A 2LNBA 3UKVA 4Q0QA 2FXAA 4ENKA 2GAUA 2ZKLA 4OMZA 3J7AO 2UYAA 3P7NA 2MC3A 1X8EA 3E3VA 3OV8A 4RGRA 1ZAOA
chains in the Genus database with same CATH superfamily
2HXIA 4MGKE 1R091 2OBPA 4Y22A 5DZGA 3NJZA 4UBGA 2KRCA 5T50A 3UKNA 1S0BA 5FO9B 1ZTRA 1PZ9A 2RR11 4XTMA 5LA9A 2LG4A 2BERA 5F32A 4QB1A 4CU6A 1FLIA 3CC4I 4W6WA 3WNXA 4XYXA 3SQOA 1XMXA 4RHV3 3WEZA 4AVCA 1O8SA 1W3XA 4WM7A 2HQNA 2X29A 4OQ8A 3ALQA 2HOSA 2B46X 3PLQA 5BNOC 1LHNA 5FROA 1LHVA 1Q43A 5A2QK 4FP2A 1IW7F 3DUIA 5LBCA 5D8AA 4ZDLA 2DI3A 3PFYA 2IS4A 2JWPA 4NE9A 2ET1A 1X1PA 5IYDJ 4GQ7A 4XKCA 3V42A 1X1CA 4CICA 4LXLA 3USUA 3POBA 4D7SA 1HSJA 3ACIA 4NPRA 3KM5A 1UKGA 5CFCC 3JB4C 5IVYA 3MF9A 4II3A 4ZJZA 3ENRA 1Q3EA 3ZO0B 2YR2A 3BB6A 2ISZA 2R32A 3IH3A 4Y26A 3RFRA 1W2AX 2JG9B 2VMHA 1C8M1 1O4YA 2NPIA 3LWCA 4A0ZA 4RYDA 5J1UA 3CJIA 4LR4A 1UCRA 2QE3A 4LGWA 1HJFA 2AREA 4YM3A 3HNBM 2DFIA 4MO7A 1R083 3SMHA 3V8KA 3MW4A 1POV0 3VBUB 1YFXA 2QGUA 2L9RA 2OT7A 2CV1A 2P4EA 5IFTA 1RR7A 3BR5A 2R041 4HVOA 1S9HA 3GZNB 2G9GA 3TDUC 1SLBA 5FKKA 1JKPC 2TUNA 2BXZA 3KHCA 4GYGA 2OVUA 2PHFA 9ANTA 4KH9A 3FBNB 4LORA 1VQLI 1WH7A 2Z2SB 2XWBB 3M7GA 3CCUI 1J7KA 3I2OA 3GF2A 4DGWB 3UKTA 1DDLA 1VBE1 1PUFA 1ENHA 5BNGA 1UY1A 2Z3YA 4Y5SA 1COV1 3H42B 2IGMA 4NHLA 1ZKGA 3AKZA 4RR3B 4QPIA 3WTVC 1RTVA 4CYCB 3WG2A 3KT4A 1AUYA 4DY5A 4GAZA 1UMQA 4ET7A 4HW0A 2RS33 3GZ6A 3NJVA 2LS6A 1YRNA 5AVPA 4RS5B 2ZX1A 3C7GA 3ZFEA 2YB7A 2LH9A 4XFBA 4J1XA 3CC7I 3J8F2 4HLTA 2P37A 1XSXA 2XOMA 5CISA 4AI3A 3OBTA 1EKEA 4S2FA 5J1YA 2OA2A 2NVXJ 4XIDA 4PLMA 2W7NA 2LBFB 2EA7A 3GTMJ 1U0AA 1W0PA 3I3LA 6PAXA 4XETA 4RAFA 3KZIC 3CF5F 3OYCA 1VQMI 3ZR5A 4GXOA 1N3OA 4LBQB 1MVEA 1MS1A 1UMZA 5HXVA 4CRQA 1Y0NA 4DYQA 2M87A 4A6OA 3S57A 4CE8A 1GQPA 2JDYA 3WE2A 2R7WA 4KGQA 1LGBA 2PHLA 1DP3A 2ZGRA 4PSWA 1UZWA 4FP3A 4PDWB 3JRCA 4N53B 1FMD3 1LUJB 2OYZA 4NVPA 2RAEA 3Q9OA 1IJWC 2KR2A 4KN4X 1BA5A 4CZZA 1F43A 1H2LA 3D82A 4XQWA 5IVCA 1OYWA 5HXMA 4RHV1 3T2QA 5T3NA 4MEXF 3H8OA 2VKDA 4Y33A 4D7TA 3ZMVA 4XLFA 3HOZJ 3LF7A 3I3DA 5A33A 3L2YA 1W8HA 2GC1A 3KLSA 4AK3A 1TMF2 5JR2A 5FK7A 4UT5A 1PVC3 1X82A 2NLRA 4FAGA 2O8OA 3B6AA 2OTLI 2WNUA 2IAIA 1VAKA 2R7ZJ 2LALA 5A1FA 1W9SA 5GKAC 2Q8CA 2AGSA 3OYIA 1DLCA 3BR6A 1YHQI 1ZA7A 5FKCA 5FYIA 5FBZA 1R00A 1TMF3 2JG8A 3AZXA 3JRFA 1OH4A 3T0DA 1W6MB 4FPEA 2HTJA 2LDUA 2YU3A 3FHZA 4BE2A 3LA7A 3BZCA 2WA0A 1K83J 1GP6A 2I07B 5CYVA 1W2OA 3SJMA 2A75A 2X8KA 3VHOA 5FZ9A 4A3CJ 4JKLA 3REOA 2GQQA 3TW7A 1DYOA 4QKNA 4BMEA 5FQ0B 3ZFFA 4AFAA 1GWLA 3Q8BA 2JUCA 1AKHA 4GMP0 3MHZA 3A21A 2DFBA 2X1EA 2EV0A 2D93A 4KWLA 3IRRA 3HKZN 1EAH3 1GXPA 4NHKA 3GX4X 1RVF3 3G73A 5LBBA 2VPVA 3GTQJ 2TDXA 2D3PA 3ZYJB 3GZTB 3ILRA 2R7OA 5BNOB 1DDNA 1QVUA 3B9IA 3QP6A 3S8PA 3WU1B 4PUSA 4A3IJ 2P3JA 3O1PA 4UWDA 2UXXA 4Q2FA 3AVSA 2KXLA 3AXDA 2BXYA 2WN3A 5EFUA 5M3FJ 1B9NA 1T6BX 4ZTJA 3GZEA 4FHTA 4CDQA 1MBKA 3VGIA 1LTEA 4XE9A 2A3SA 1XXNA 1FP1D 2KISA 5HDKA 2XHKA 5K8SA 1KJRA 1LR5A 4F91B 4FT8A 3GCMA 2RS31 2JXAA 5L9BA 1AL0G 2QQOA 3WHUA 2RGVA 1OA2A 4IV1A 3AMQA 1XD7A 4YFNF 3KZ4C 4EZ4A 2DPDA 3VOEA 1DBNA 3O1UA 2R7RA 2HWB3 4RMNA 5IYBJ 3ZOBA 1KU7A 5BOXA 5GZDA 1ND2B 2BOIA 3T1LA 4AFDA 2NQYA 4CTEA 1LOFA 4AXOA 2IUWA 2P5LC 2ID3A 2GH8A 4IEYA 4IGQA 3VYTB 3OYAA 3H8UA 4GH4A 5J8FA 4DZGA 1BJZA 2ZS6B 5IVJA 4ZYEA 3F95A 1JUHA 1UD1A 4P00B 1SFKA 1W8WA 4M74A 4G4FA 2D45A 3S5QA 4YLZA 1XX5A 1FSHA 1PM4A 3IDBB 3VBSA 1HN1A 1AR72 2ESNA 3KZYA 5ICFA 4XOPA 4B4CA 1RJ8A 4P9GA 2WWSA 2NM1A 1FMD1 4WF2A 2JRTA 4HPKA 2VB6A 3KX2A 4AVSA 1GNHA 4ISQA 2W52A 2RREA 4PSXA 3MIDA 4KIGA 4NIIA 3CCRI 2EALA 2VUAA 2XKOA 1UY3A 2BW3B 1RNLA 3V4GA 2Z42A 1REDA 1CR7A 3B9CA 3EUKL 5APAA 3AJYA 5T54A 3IL2A 3I56I 2ME0A 3Q0WA 1R4NB 3WW3A 3TW6A 2I74A 2WZR3 2HWC3 1QGPA 5FPLA 4C30A 4EM1A 2P3YA 5GP9A 3MUZ1 2BVMA 5FB2A 2Y6GA 1ZZ8A 5CPRB 3GTLJ 1KEXA 1PVC1 2VJ4A 5BMZA 5FO7B 4HN0A 1KFUL 2VT2A 1QOSA 3MBWA 2B42B 2NS8A 2WNVA 3N7KA 4B3XA 3RTRA 4ZYHA 4EYUA 2RQQA 3AP6A 3UK9A 3I2FA 1Q1VA 2DWRA 4B4QA 1TMF1 3VDDC 3CF2A 2MD0A 4M3DA 1GDTA 3OUHA 1OFCX 2DYSH 2MNGA 2YMZA 4LO4B 3RRDA 4QIWN 1VIWB 3W20A 3K1MA 1WLWA 3SYTA 2DLLA 1PZ7A 5IP7J 2EPFA 1LQ1A 4AGRA 3HOYJ 5D1IA 1JYWA 3ATGA 4XJ9A 4HQEA 4RFRB 5LY2A 2PYTA 2QENA 4LBNA 4NHMA 4GXLA 4XICA 2H1KA 5FR3A 1QZEA 4B3NA 3T30A 1FPN3 2VGDA 3K2OA 3WY6A 4RM2A 1FBUA 4FE7A 1CPMA 4INDA 4U88A 1TQ5A 4QX2A 3ZKUA 3NKGA 1OOPA 2WSUA 1FY7A 3OB8A 4K21A 4XDOA 1EAH1 4Y15A 2VNVA 2DW4A 2DA4A 1RVF1 4JHTA 1C3HA 4ZXKA 3WE3A 1TBXA 2IZWA 1YS6A 3EETA 1JJ6C 3CCVI 4JC1A 5DD8A 1GV5A 2QVSB 1O5LA 3JD73 5JLWA 2P81A 5FY8A 4EE2A 2NXNB 2YYOA 2I5UA 1IGNA 3H50A 3LSTA 1IQAA 2RC4A 4JQFA 4FFGA 4DRRA 2BBYA 3ASIA 2E2IJ 2X0LA 4JGZB 4Z2WA 3I53A 4AYBA 4A3DJ 1NCQC 1G7YA 4Q4X3 3KCCA 2E19A 3M2MA 3CIHA 4JCKA 5IT9K 4Q5SF 2Y64A 2Y38A 3ZSKA 2CUFA 3ZMUA 3BOWA 4QGMA 4LD5A 4PI2A 5J1RA 3LAPA 1YWKA 2HWB1 3VD9A 1JJ8C 3BR0A 3E1SA 4HN1A 2M0CA 3K2ZA 4CZCA 2EZLA 4AI2A 2WFPA 1NZCA 4XFFA 2ARBA 1PVXA 3W58A 1O6UA 3NAUA 4LK6A 4IUGA 3VHNA 2BZTA 3FMGA 3ZFGC 4Y5Z0 5CBLA 4YW3A 2M34A 1JOBA 4XLNF 1IKPA 4BE3A 1S29A 4PIYA 3TBDA 2LW8A 4GRIA 5IP6A 4JQTA 5GZCA 3LL7A 5DCMA 5I91A 1VFCA 1OISA 4QU1A 3LNQA 2L5QA 1WLDA 1IRXA 2VO5A 4M73A 1Z6TA 4ZPIA 3HIFA 1K78B 3A01A 2O61A 2VULA 4ASMB 4DYRA 1R4MB 2VZ3A 5D5VB 3RQ0A 4JX0A 2R7VA 3AYAA 4UVAA 2NVUB 1S7AA 1J09A 3J7MA 3ABUA 3I97A 3VBRA 3PM1A 1AR71 4MADA 3WQ0A 4KG0A 2WZR1 4Z82A 4JP0A 2HWC1 5LEJA 1XOYA 4M9XA 2CO5A 4P9YA 3D5SC 2ZFUA 1WQ2A 4LLFA 3HQUA 1WCKA 5JOYA 2VU9A 5FIXA 1IGOA 2VZ1A 2KMUA 3MPBA 2CSOA 4EJWA 5FFXA 2OUJA 2ZHNA 1NOVA 3FXJA 3OEAA 4CU8A 5A3PA 4XN3A 5LK7B 1P8JA 2R7DA 1X1BA 1YIJI 1AOYA 1K45A 2ARXA 2Y26A 1BOBA 3VD4A 4G7HF 1GOFA 1Y9QA 1AX2A 4HSTA 5JVGF 3FIWA 2WNOA 4IXAA 1VBC2 1JBCA 5J48A 2LF8A 2DCTA 2RVCA 2VQGA 3C2BA 4LBLA 2OU2A 1UZ0A 4AGVA 5A70A 2M8GX 2IXIA 3C3VA 2DOFA 4LBJA 1FPN1 3PVOA 3OIOA 1X58A 5E20A 3AG4H 1A5JA 1DP0A 2ARAA 1O4XA 2K9ZA 3IIIA 5CU1A 1WMXA 5FMCA 1DGRA 3CU7A 1PMHX 2H0VA 3T4HB 1MNEA 3WDYA 2EZHA 1D8JA 4FI9A 3T1BA 4AVPA 2ETEA 1K5MA 2G4IA 4YZ2A 5CVVA 4NC6A 4AYBN 2ZXJA 5DPNA 4LOCA 4ON0A 5K7HA 2JT1A 3CQZJ 3RI4A 4XMIA 4XAAA 3Q8AA 1X3UA 2DVBA 1IS4A 3J7AY 3ROUA 2CUZA 3I58A 3JD71 2Z69A 3O1TA 4Y4YA 1MS4A 3S7EA 4BQ1A 5A7PA 3J81K 4C0HA 3Q8FA 5C4WA 4Q5OA 1PO23 2C24A 2KL4A 2X5IB 2QKDA 1SMTA 1I6XA 3CUOA 3VDDB 3ETQA 4Q4Y2 3WTUC 4P9LA 1NK3P 4BJ5C 3U0ZA 4ORFA 2Y2ZA 3HRUA 2XMLA 2TEPA 5C3PA 2WSVA 4Z8BA 4Q4X1 1Z9CA 4XOGA 4IF4A 4E7KA 1TW3A 3ZMZA 3GXUA 1NG6A 3I4IA 1O3QA 1CX4A 4EROA 3I5UA 2Y60A 2K27A 5HLIA 4XLEA 2R7EB 4E27A 1UQXA 1J2XA 5A32A 2Q2EA 3M4FA 2IXCA 3CMGA 1TTYA 3T2OA 1AJOA 4JYKA 4K40A 1CD3G 1KGSA 3T08A 4CDUB 5K1YA 1YFYA 5F3IA 5F1RA 2EWNA 1FSEA 2XV4S 4CEYA 1SLCA 4UHTA 4ES9A 4HKOA 2JUGA 3ZYGA 5C6CA 2IS6A 3B6CA 4QDQA 2DMUA 2WR9A 1PM7A 1X50A 1FC3A 4FTBA 4NROA 2B0LA 2BY0A 3FBMA 4XQFA 2PJPA 1I1EA 3VD3A 1Z6RA 1HQNA 3E6BA 1XSDA 2K0GA 1EY2A 3QD6A 2HS5A 1XNDA 3W3CA 3SZPA 1CF7A 3PIPF 1JOPA 4LOTA 2SBAA 3EB7A 1ZM1A 2GN7A 4EGYA 1JZ2A 1E5HA 4KL1A 4A45A 3RI8A 2HKOA 1RUJ3 2QJVA 5K0UC 3QACA 2V72A 1LULA 3O5SA 2ZGKA 1UNBA 1E3HA 3RJ2X 4MLOA 3HOVJ 1FNYA 5KHKA 4IZZA 5K9YA 4FFHA 2CDPA 4WCGA 4XRSG 1GXQA 2PHWA 5IUQA 4PZJA 2LTPA 1K79A 2R0HA 1W6NB 1NCQB 4F83A 5EYYA 2EK5A 3SCGA 4H7LA 3CUQC 4BKXA 3S14J 5J09A 5C3OA 4MGTA 1W9WA 4F8AA 5IT6A 4HX7A 1ZNPA 2XSJC 1CAWB 2VECA 2RKHA 1R5GA 4RGSA 2PHDA 2R7FA 1KDKA 5DS9A 3H9JA 4AIKA 4B7EA 1MZBA 5EJZB 4LPLA 3CCLI 3ZOIA 3M1EA 4JK1X 4YARA 4ZZ5A 2RDSA 5IK8A 2OF7A 1DGRN 3K6GA 2HLEA 3S0MA 3VLBB 3H35A 1SD7A 3ACFA 2R92J 2VMCA 4C3HJ 3ZFGB 1QWRA 3V7RA 1YFWA 3S3OA 1T6SA 2XONA 4DINB 2XJQA 5D4SA 5KK1A 3TDZC 4G6QA 1AR93 4KBZA 1F9NA 2PFBA 1XSVA 2LD5A 1AXZA 2XIGA 5EEGA 1RHI3 3OYLA 2Q1ZB 3I55I 3MEPA 2TBVA 3BZKA 3E5XA 3O0XA 3BCAA 3IRQA 5E1RA 1K3IA 4RAYA 2LR8A 3QOPA 4XK4A 3CC2I 1V4RA 1LU2A 1VBC1 3C1DA 3HEIA 4M6XA 3TYJA 1SCSA 2C5DA 2HH9A 1GANA 4AEJA 5FYVA 1NG7A 1GICA 4FCAA 1NE4A 2WLQA 1MBGA 1W8OA 4QHZA 1XNAA 1R9TJ 4MEYF 4HX4A 1H89C 1CAUA 3BIWE 5HS7A 1F5TA 1J3PA 4WM8A 5E3OA 3W21A 3I4NJ 1WJFA 4HSLA 1WH5A 1KQ9A 1K5JA 3QODA 3LEIA 5A3NA 4JX5A 2ZKNA 4J19A 4Q1RA 3LDRA 2R0QC 2AS5F 3VZMA 5SV5A 4EVIA 1PO21 3BPZA 1OUSA 3TP3A 3CCYA 2NYYA 4XPVA 1A6CA 1F2NA 5BNQA 2LY2A 2OXBA 3OWTA 5FPBA 5D8AC 4EM2A 2C9KA 3L2VA 4QT6A 2ZHKA 1B59A 2ZX4A 3WUCA 3TAYA 3ZMSA 4DMIA 3K77A 1ETYA 5F2WA 4S2DA 4MTEA 3URFA 1JI6A 1Y6IA 2RM22 4BHBA 2VQAA 2TRTA 4RQPA 3G71I 3IIAA 5AONA 1RUOA 2FDKA 3FKJA 3AP4A 1WZXA 4Q4Y1 1MBFA 4KGGA 3JR9A 1UZVA 2FQ3A 4PJLA 5HLTA 1UYYA 4CUAA 1L3JA 2BGPA 4AFCA 5E88A 4A3ZA 2CWEA 4Y1ZA 3IZOA 1LHOA 4LBOA 2GOMA 3PDQA 2F5FA 2V4JC 4RB3C 1T38A 1YQ8A 5BNNA 4N9HA 4MXWB 4YW6A 1ENRA 4DNCA 2OPTA 3NWKA 2IFWA 3KYCB 1YW7A 4K1ZA 5L19A 4F52A 5J4YA 5FFZA 4AVAA 3M3CA 5EXOA 1MMDA 2EB7A 4LG3A 3MPPG 5FJ8J 3H5NA 2ZGQA 1AR82 2JRMA 4E4HA 2WT1A 3IKVA 4YGEA 2E60A 4I02A 2KJCA 1WI9A 2IGOA 2J1RA 2R5YA 4WK8F 1CAVB 2W46A 4FE4A 2X85A 1S1AA 5T55A 2XL9A 1MNMC 5FJKA 5HLGA 3L9JT 4LIVA 1OLQA 2YFUA 3Q0VA 5EG0B 2IXJA 4MH0E 2R7XA 3BR3A 2CU5A 2MEV3 4KI5M 1SD4A 4V2GA 3GW2A 2KD7A 2F17A 1FV2A 4QPIC 4W50A 2ZEXA 4BDYA 2IVIB 4E2GA 2D5VA 3FXRA 1VQOI 2R7QA 4XLAA 4Q1PA 1M06G 5IK7A 3OOXA 4IGOA 4K20A 3ZFEC 1E3PA 4AG4A 1USTA 1W6PB 4KNCA 1FOD2 5CB7A 5L3BA 5A3MA 3OYNA 4NWWA 3CLOA 1X1DA 3AMMA 1KRIA 1TW2A 3VZOA 2XB0X 1BVP1 3BUCA 4FPGA 4GKYA 4PF5A 3S2DJ 1MR5A 1AR91 4HFSA 1S7OA 1ZHFA 5AIQA 3SEQA 2MFZA 1JKOC 1OCOH 4CCEA 4XF0A 1DU6A 5FZBA 1EJ9A 2QQVA 2FOWA 1Z7S2 2K85A 1V3FA 5K0UB 1WZ2A 4XUQA 2VZSA 1M4WA 3OY8A 4ZDPA 3FBIB 2XJRA 4LJZF 1LFPA 1YJ9I 3SZTA 1FYLA 3L2QA 1DQ5A 3CUQB 4BK5A 1QQP2 1OI6A 3DEEA 5M3MJ 1MBEA 4JDMA 4AI9A 2K02A 2BBVA 4A12A 1A78A 2VTXA 1XMAA 2Y30A 2E26A 2BGOA 3RZDJ 1B9MA 1QZYA 4LK1F 2NOGA 4YZ1A 1W5TA 1GLHA 5KHDA 3ZQLA 5JLXA 2O7OA 2J1AA 1Q8VA 2V1NA 2WNUC 3GCWA 3DKWA 1G6NA 1PVEA 3M9AA 1P4AA 3NAPA 4JDNA 2DMPA 4K2EA 1S3JA 5DUIA 2JPCA 1IC8A 4AEDC 4AI8A 1BN5A 3MMYB 3POWA 3U4SA 4ATEA 1J0RA 3OL3A 1T6GC 1U78A 3VD5A 2LOOA 3N05A 1QJY3 1VRH2 2JG8C 2DCKA 1BIBA 3CLQA 2Q1FA 3BYWA 2QBYA 3HBLA 1UU4A 4UUSA 3ZN1A 4ENNA 4PDKA 1L7LA 1J3RA 2H6CA 4A93J 1A8DA 3KF5A 3DEMA 1MMNA 1UG2A 3K75B 5F8PA 1QMJA 1H2MA 4O9GA 2KA3A 1UN1A 1EPZA 4HV6A 2PN5A 2TNFA 4D94A 4OI4A 2HQ5A 1HRV3 3FN9A 3ZFFC 4Y52J 1D4M2 1I1GA 2VTXJ 3CO7C 3LGRA 3IUOA 3L2UA 2P5BA 1OQEA 3PMSA 3BG7A 4Q26A 4HONA 3HXLA 2UU8A 4HEA2 4WVMA 3ASNH 4LBKA 5BPXA 2QSGX 2MGQA 1OT5A 4OUMA 1FOKA 3RG0A 1S0DA 3RMYA 1CONA 3R0JA 4NR1A 5LBQA 2VQCA 5CAZA 5EYRA 2Y8KA 5DAPA 5A6XA 1DPUA 3M3QA 3DTKA 4CU7A 2ZXWH 1IG0A 2KM2A 3VBOA 1JUIA 1IHMA 2PG4A 2VH9A 1EF4A 1ZRRA 1JGSA 4OUSA 1ULDA 4KMFA 2QUFA 3WTXC 4MGIE 2XUMA 3NARA 3KS7A 5B4XA 3U1XA 4ENMA 4CCJA 2D3SA 4IESA 2ZNZA 2J7MA 5FUNA 4S04A 2KDOA 2QQJA 2RDPA 2VOKA 4OIRF 2FA5A 2DCYA 3WQ7A 5ICGA 4E7SA 2CTVA 2KQRA 5ANQA 4FQ4A 2AUYA 1TQIA 4OWRB 2QQ8A 3GCXA 2EINH 1JZ4A 3LA2A 4XQ4A 4KDPA 4IV1C 2IA1A 4S05A 3H8XA 4I0BA 1ULOA 2D5HA 3KMHA 4LUKA 1Q56A 3N36A 1WCSA 3PIJA 5FPUA 1J84A 3G1MA 4QGLA 3ZSEA 3BPXA 1QZZA 3D3AA 4OHZA 4DJAA 2WAEA 3FFZA 2LFBA 1OQDA 5A80A 1UHWA 2C9AA 4GH4C 2FNAA 3RZHA 1N1VA 2GXBA 4YW1A 3G1LA 3QP5A 1BW5A 1S0JA 2E6VA 2LROA 1VR3A 1SAUA 1FOD1 5ACA3 2PJRB 3GDBA 2AHQA 5FYHA 4K7JA 2VE8A 1RC9A 4Q4V2 1GMMA 2LNBA 4Q0QA 2GNDA 3VBSC 3WUDA 3K4ZA 4H7MA 4CVUA 1M1EB 1X1AA 1FOYA 4YVWB 2CMPA 1ZAOA 4XKVA 1ONAA 1SMYF 2ZMNA 1PUFB 3IKTA 2STWA 1HW1A 3C7FA 4C2UA 1X2MA 3B3QE 4PK4A 5ILVA 4A7YA 4ZH4F 3OEBA 5FZ0A 4LITA 1XDSA 2I8DA 1HBXG 2WY8Q 2WBMA 1Z7S1 4MSVA 4QPIB 2WA4A 5JI9A 4YIRX 3MIEA 2IA0A 2FDHA 4HK8A 2XAHA 5C70A 1POV1 1VQ6I 1SPPA 2R072 4LHKA 4GULA 2V9KA 1R64A 1S0GA 4JAAA 2CAVA 1YRNB 4TV7A 3HOBA 2DAOA 1U5TA 2OUMA 4KMUX 4RM3A 2ILMA 1GT0C 2JE8A 4ZTFA 2JSPA 2VI6A 4WWCA 3AKRA 2CS3A 4LA2A 4HG2A 1OCPA 3CHXA 4AVBA 3ZMOA 3FE5A 5F3CA 2A6EF 4YFWA 4QWNA 1ZK8A 2HWD2 1X4OA 2WNVC 4XR6A 2ZJQF 4CP0A 1UMHA 2QQLA 5F5AA 4FASD 1QJY1 3INAA 3HNMA 2XXZA 3DBHB 4HBNA 1T39A 2VG9A 4B44A 5I0RA 3NQOA 4M3EA 1HKTA 2JTVA 2ETHA 5FZ1A 4YSFA 3ZPLA 5F0HA 3T1MA 3NRVA 4HNTA 2A71A 1LRHA 2NN8A 2PEXA 1HRI3 1MJ9A 1HRV1 1RINA 4LG0B 4DQ2A 1EYBA 1BKZA 4A69C 2WLPA 3DPTA 1RETA 5J98B 3SEZA 4C8DA 2QVOA 4E9KA 3W6VA 2GU9A 1G8WA 4XN0A 1ACIA 2E2HJ 4PFOA 2Y48A 4IEWA 4NIHA 4IPAA 1OOPC 3GGLA 3L09A 1S72I 1H6YA 1JKRC 2YU2A 3BDDA 5FLXZ 5DDJ2 2P8TA 3LSRA 2RHPA 5JOXA 3V7CA 3SEEA 1W05A 4B29A 2CGPA 3HSEA 1Z0HA 1YQAA 1UFMA 3OSGA 3Q9SA 2W08A 4W6YA 1S0EA 5LD2C 4NHJA 4MYEA 3LZZA 5J7MA 2WNUB 2LVSA 4BJ6C 4LK7A 5T5LA 1MS5A 5KCMA 2R0FA 5E89A 2CQNA 1OVSA 4XF1A 3B01A 5DDJ3 2ZEZA 4AEDB 4IDZA 3SC7X 3KCYA 2YC0A 3VKMA 4R4XA 1JMUB 4UFMA 2W68A 3CLPA 1EUUA 1UYXA 3ZKYA 2JG8B 2BOJA 1MEC3 4XQDA 1H88C 4CZSA 2VMIA 4NC7A 2WYSA 3ZQFA 3FMRA 1STZA 1H0MA 4CHUA 2O0YA 4KU7A 3UYJA 1HXDA 1XU2A 3DBRB 1TLHB 2K9QA 1ZA4A 4HBLA 4D7MA 1J5YA 1PIV2 3BY6A 3DF8A 2VBPA 5K7ZA 4EJVA 2VKEA 2BY1A 3COAC 1Q8PA 2Q8DA 3VV1A 1TT5B 2F2EA 1QH7A 3L2WA 2PQSA 2OV7A 4A4AA 5SV8A 2YBSA 5ACA1 3ABTA 1W2TA 3GWZA 3NJYA 3RPQA 2VZUA 4CA0A 1MBHA 5L36A 4P96A 3D5RC 2MD5A 1NA1B 5CFDA 1WRJA 1DZQA 4RL7A 1PIV3 5CQGA 3MEXA 3IWZA 5DD4A 2OQ7A 4IKFA 5I0UA 2XRLA 3VBFA 3NNFA 2VZTA 1WA4A 4OI0A 4LO5B 3UJOA 3KFWX 3FXKA 5J40A 1H4HA 4XM3A 2DCEA 3DN7A 2CH0A 2KP6A 4L5IA 1VALA 2E32A 4BE0A 1MZ5A 2JDUA 5B1BH 2FD8A 5C7GA 1ZVFA 4Q4V1 3SISA 4J25A 2M30A 4GCVA 1C1FA 3O0VA 4XFHA 1DU3D 4DYCA 3RS6A 1HV0A 3ELNA 5LASA 1K12A 3VD7A 4G9SB 3VBRC 4AD9A 2WNEA 5KAIC 2DU9A 1B35C 2V5DA 2XF6A 2LRDA 1APNA 3MV01 3TGNA 2L7FP 2KIMA 4ZYGA 4Q4W2 2X09A 4IV1B 2JDHA 2IGKA 2E1OA 3GLXA 2CQKA 2VN2A 1AZDA 1BBT2 1IN7A 5F5QA 3I3BA 3H1WA 3F6VA 3V8LA 2L0KA 5DMYA 3JCIA 1ONVA 1PGL1 3C3WA 4GH4B 3BTIA 1DGLA 5BPIA 1QU3A 2OKXA 1O7FA 1W04A 5A7OA 1YQCA 5B4NA 4Q4W3 2D6PA 2HPIA 3POFA 1BZWA 3APBA 2XKPA 3MW3A 4UAPA 1Z1DA 2W1SA 3AMNA 4CCCA 3MLJA 3S5AA 5ICCA 3IAPA 4GZ9A 3VBSB 3DQVC 3AL0C 3LEMA 1G9BA 4QX3A 1QY4A 3PUAA 4XFIA 1YQ5A 3ZN6A 3WQ1A 5GALA 3N9QA 2DVFA 5C3QA 4CEWA 4GO1A 4ABZA 4BHCA 3LSDA 4CYDA 3HBKA 3E0JB 2L9LA 2LLKA 1ZZCA 1WUVA 3OYHA 3VDXA 2XL7A 5L7OA 2H6BA 4Y1YA 5FZ3A 1P4WA 4QAWA 3PUBA 3ISPA 1AHDP 4YFZA 4EWDA 5LZ6A 3U11A 4NIDA 2PQ8A 2D1HA 3IDAA 2CGOA 4C9YA 3HQRA 2E7QA 2P7VB 2AEYA 3VHRA 4PIZA 2XVKA 3DCFA 3LFIA 4A44A 4DXZA 1VBD2 1RUE3 3KPHA 4HSJA 3RCOA 4FO9A 2DU1A 5E3MA 3HN1A 1DQ4A 5LA2A 4X8NA 2B7EA 1LKNA 2DDAA 3E5QA 4JGYA 3CJNA 5FLHA 1XYOA 3C8XA 4KU8A 2V5YA 4GJYA 2WBKA 5DDJ1 2V79A 2AYHA 2WNVB 5JMOA 1TE1B 4PT6A 3PL0A 2BGCA 5KWRA 4RGUA 4AVVA 2R3SA 1GHCA 1TVGA 4DBRA 1JZ5A 3GEZA 1MEC1 2P6SA 4P5OA 3H5RA 1IXSB 4CCOA 2PELA 4CXYA 5FKMA 4YGDA 1LJ7A 3GLLA 5J6XA 4IRIA 4KN7X 1W99A 4DUVA 2XJVA 2R16A 1OA3A 4P1WA 2M4KA 2QKLB 1R49A 4BUPA 2VOVA 1Y9GA 1O3TA 4PJJA 3KVAA 3VKLA 3M8LA 1GNZA 4W8JA 3HL2A 4XF9A 2VQTA 4N8MA 3T0AA 3SXYA 3ORJA 1XE0A 2E34A 2MPFA 3EO6A 4WVWA 2EIJH 4Q27A 4CEYC 5A1LA 1V6NA 4EWEA 3SH3A 2NMNA 4AEKA 3HRMA 1HLCA 3ZYFA 1OH3A 2OW4A 3DF0A 4MHRA 4O3MA 1MQTA 5F6LB 2AENA 1KQ0A 3LQRA 4D0PA 1G9CA 2XJUA 2ERFA 1OYYA 3A0NA 3A4CA 2HTSA 4UUTA 1CQTA 1PIV1 3E1F1 5FKNA 4BQYA 3TO6A 4XAEA 4JQRA 2LKSA 2B5HA 2LM3A 2HWE3 2L7KA 2YY1A 3RYRA 2R49A 2XSDC 5L9VA 1W8TA 1LFBA 3P5JA 5FLMJ 4QD2A 3N4MA 3MQ0A 4OQ9A 2B63J 4XHXA 1A36A 3BG5A 3E6CC 5CADA 1QJU2 1Z78A 1H1AA 2Z16A 1X4PA 2ICWG 3W5MA 1GQGA 3AYEA 2W1UA 2FCVA 1JH5A 3JRBA 2K40A 1CJPA 1UW8A 1BOAA 5ILUA 1W36C 1RUC2 1BL0A 4M00A 3FHAA 2QQ9A 2XPJA 1W7PA 2OX0A 2HEWF 1XMKA 4YGCA 2QYOA 2Y0MA 3T8RA 3JTGA 2O14A 5D5XB 4HANA 1FNZA 4V2WA 4EN9B 1L3LA 4MZUA 1A3KA 4E2QA 3DECA 4HKWA 4JDOA 1MH4A 5B3SH 4FPYA 5BYNA 3WF0A 5J36A 2V09A 4Q4W1 1SEUA 2Q5TA 4CGZA 1GR3A 4MIMA 3S2HJ 4W4ZA 3PU3A 4D6RA 4AHYA 4JKKA 4QTRA 4L9NA 1WJ5A 2OUHA 4M9SA 3DPRA 4MO3M 2YROA 3NMBA 2H0BA 3NVCA 5DCMB 2VY0A 5CG8A 5F5IA 5EEHA 4Q4ZF 2WFF2 2FQPA 5LATA 3TNPB 3T3YA 1DYPA 1AR63 5AFBA 3P1IA 2K7LA 2QQIA 1UOFA 1V00A 4ZHNA 1KGYA 2ID4A 2UY9A 2XBO3 2PHXA 3PIGA 4CP9B 4FPHA 1A31A 3TO7A 1APLC 5FZLA 2ZGPA 2DMTA 3VBRB 1AYN2 1RUD2 1K4TA 3WNMA 3LD8A 3AJZA 1B35B 2ID6A 2ZX0A 1RUE1 3OBZA 1NTCA 4D5FA 4RB2C 2GIZA 2ZPXA 5FZEA 3VPRA 1RYYA 3I54A 2VNGA 1G9FA 2DOEA 5TISC 3EUHC 2JDKA 5K7FA 1ZBA2 5TSWA 3O1MA 2HOAA 3GTOJ 4R9AA 4AFMA 3BC8A 1WWXA 2M2EA 2XPVA 5L3GA 5ABJA 4XF3A 4LKSA 1VBD1 3GHNA 1LHWA 3VB2A 4N43A 5E18F 3QH6A 3U1DA 1OLTA 3HYIA 3RI9A 3S1NJ 5JCTA 3CJQB 2CJJA 5C4XJ 3KF3A 1DG6A 2XGEA 5CA6A 5LHIA 1R6RA 1XGNA 4Y20B 2NVQJ 2W57A 1BEV3 4BXFA 2QCOA 4RGAA 4FETA 2E7AA 2C0ZA 4IL6C 1W9YA 2EFNA 3H7YA 3NRUA 4LBMA 3KVBA 2Q8KA 3RKYA 1YI7A 2VXRA 3MFKA 4WXDA 2EXIA 1D2QA 1GVDA 3U21A 3K4CA 4OHWA 1TME2 1OFSA 1DPRA 1NYWA 5IVFA 1OCZH 3CDIA 1YYVA 5FZCA 2BPA2 1CVNA 4E4SA 2QDRA 5I93A 1EV13 2IEKA 4C3IJ 1U5XA 3X29B 1RUG2 3LPGA 1SBDA 2HWE1 3F8NA 1VZ0A 3PUSA 2XAGA 4H3WA 3FC0A 3NV2A 1VB2A 3LSEA 3T2PA 2R93J 4H2AA 2E7XA 4IO9F 2VMEA 2JG9A 4GB32 1AX1A 1OD5A 1QJFA 3A23A 3BP8A 2YU9J 5JOWA 2E35A 1G2HA 3POYA 3F8CA 3BOPA 3SCFA 4XBLA 2LSOA 4NO4A 2EIDA 3DLAA 1CJDA 2QCSB 1OCTC 3LFUA 1US2A 3J26N 2DDUA 1RMU2 5LA0A 1IQDC 1YC61 4XLPF 1GZWB 2XF7A 3POGA 2LUWA 5FP7A 3DTEA 4GIQA 2OZJA 5A32B 5T5JA 2Q2EB 1R092 4E7JA 1QPMA 4FQGA 3L9FA 1OHFA 3K1PA 2PQQA 3RQIA 4IEZA 1YLLA 3WCSA 4CEYB 4DOZA 3FHQA 4HOBA 2AZ5A 5BPDA 1S5LC 4ETSA 1FTTA 1VJ2A 3Q8EA 4B48A 2ELKA 2VE1A 1OURA 4BGDA 3OIQA 3H1CA 2A6TA 5D21A 3W5NA 4I01A 4OFGA 5TGTA 3ACLA 1Z67A 1U3EM 1H8AC 1AYM3 2WS93 3QPLA 1P4XA 4A6EA 1JN2P 5C8WA 1H9PA 1QXRA 2EFWA 3QYFA 1AR61 3K4LA 2VBXA 4CYCA 1F4AA 3LE0A 3VYUB 2O8KA 3DKXA 3FXLA 4XIOA 3QYBA 4Q8LA 3WHBA 2XBO1 2BJSA 2F4MB 1ACCA 1JTZX 5AC93 4QM9A 2A07F 4Y1UA 4YFKF 1JGGA 2WYFA 5FXZA 1XTAA 4YZ3A 3DP7A 1DGWY 2A3XA 5L73A 3AXEA 2CQQA 3S1QJ 2XVGA 1UB9A 3I59B 1Q8SA 2DURA 1C8M2 4RD7A 2EA4A 2LBFA 2NNNA 4E6KG 1JODA 1QRYA 3IH2A 1AHSA 1UKRA 3TEZA 2QEXI 4LBQA 4OCTA 1UYZA 4D0QA 4I3GA 2ZMLA 2BVVA 3S30A 3NWSA 4U87A 1ULGA 2M8EA 3V64A 2X6YA 2GP5A 2R042 3JQWA 1ODDA 1D0ZA 2FEZA 5D5WB 2ZHMA 2YPDA 5JMCA 2BQPA 3AAFA 3NAPC 1QBJA 1QQIA 3SHFA 5EHDA 4Y7NJ 4H14A 1URXA 4NHYA 4AAXA 1RKTA 4N53A 3VKFC 3ERMA 1Y39A 4COZA 3LAGA 4FTSA 3G6JB 1VTNC 1QNTA 3HM5A 5E3LA 2RJKA 1ULEA 1XGMA 2KIFA 1K7AA 1BEV1 4YRDA 4Q8KA 1RUH3 1VBE2 3K51A 3J81Z 2BV6A 2MLGA 1U9NA 5IATA 2X48A 1V5FA 1COV2 3AMHA 4LB6B 4XEZA 2H8RA 1VLNA 5DV5A 1JTXA 1LEAA 3EQEA 4M6YA 4D6SA 5LWBA 3I4MJ 4XURA 2X10A 2UWAA 5CIRA 3B5LB 1GVJA 1CAUB 4E70A 2JA6J 4L9TA 1LE8A 4KJZA 5EGOA 4IEOA 3I9V2 1S0CA 2H94A 3VHPA 2JDZA 3LIGA 2F6BA 2BNOA 4S2HA 3V7SA 3L1PA 1W6MA 2O9LA 3KP7A 3RDIA 4XL9A 2DK5A 1TME1 4XHBA 5LBEA 1QPIA 4OHXA 1JKQC 2JWTA 4DXRA 5FZ8A 4JV4A 4RFT0 4UFLA 3GHMA 1JYTA 3WG9A 3V0BA 3UETA 3GBWA 5JSRA 1LDDA 2W0XA 3BROA 4CDWA 2CL2A 3GNEA 1LODA 1PGSA 4FQZA 3O1VA 2HWVA 2FZ2A 3I0TA 3OL4A 4N9IA 4P5HA 1W39A 3WNNA 4A7ZA 3GZ5A 4MHUA 2HXOA 2OQRA 4HDUA 4I30A 1NXMA 2CQ7A 2SLIA 4IOCF 2ME6A 1VRBA 5AVAA 5KXDA 4HSRA 1PK6A 5GTHC 2BHYA 3QPHA 4K3UA 1DQ0A 4IV3C 3BCWA 2ZO4A 1YITI 1UY4A 1LECA 5BNOA 3OUIA 5KHGA 1C0WA 2G0EA 4XNFA 4AQSA 1IDZA 3WG1A 4IQ4A 5JI6A 3HWJA 4JX6A 2W84A 4QPWA 2Z5WA 2EIGA 3ITQA 3TKYA 1AYM1 4LE4A 5FYMA 2D98A 5T5OA 2X9DA 4DW6A 3I2DA 3ZQCA 5A3LA 4AF9A 5L3FA 2HDCA 3KP4A 4V19K 1ODNA 1OF4A 2D6KA 2YGMA 5L3CA 4M3CB 4FPCA 3WP5A 2W47A 4P02B 1NE6A 3F72A 3DCQA 3V0AA 5AC91 2VJ5A 3CJRB 1F1ZA 3ABZA 4NNJA 4LB5A 5E8GA 4OYUA 3FLRA 2OCEA 4LMYA 4EATA 4PQ9A 3LSMA 1AF9A 5FP3A 3MFAA 4RA2A 3THTA 4BBRJ 2GWRA 5JWPA 3PUFA 2BWAA 5FZ6A 1ND2A 2VW0A 1F15A 2ZGLA 2Y9YA 3AZZA 2NVTJ 4KT5C 5GLVA 5KXEA 5FZKA 2O6GE 1R082 5I0TA 5DDGA 2F5CA 5HNHA 5BNPA 5FLXK 2DODA 4HNUA 3IDEA 5H9SA 4QDSA 4Y17A 3GFLA 1IDYA 1U5TC 1ULYA 3BU7A 3LCPA 1JYXA 1VAVA 3QCWA 4K6BA 4KIFA 4YELA 4Q47A 1BI1A 1ZZ6A 2VQ0A 1UO9A 2E1MC 4CPBD 2IJLA 2JE9A 1JT6A 1ENSA 5K5RA 2WWJA 1I1SA 1QJX3 3WP6A 2L01A 1EH7A 1GZ9A 4BQWA 3J80K 2DFEA 4EN0A 3PSIA 2FSWA 3ZQQA 5M0TA 1T0FA 2DUQA 5ANNA 1A34A 4YYOA 4RAGA 3LSKA 3CMAI 3LEGA 3E6MA 1I5ZA 4ZKTB 1QXJA 2QQMA 2L3DA 3DYMA 3K9TA 1RUH1 4CPBA 1L7QA 4G8XA 4DUWA 4BIOA 5F08A 3KV9A 4OMDA 1FYKA 4HV5A 2DA5A 1JZ7A 3I3MA 5CVUA 3WTSC 4XW3A 4AW7A 4X0GA 3OOPA 3BPSA 4EJTA 2BTVC 2LY1A 1KZHA 1YW9A 1LVAA 5CVJA 2VT3A 2A3YA 2QDNA 4G9YA 5JLVA 1C57A 3PUQA 1QJEA 4KWUA 2RS32 3OOUA 1ZELA 3D8CA 2X4HA 3WW2A 2Q4SA 1USSA 3WNOA 1IRZA 3TO9A 4L11A 1SLAA 2LP0A 3HTUA 3R4UA 5CJ9A 3LB9A 1ZGWA 3I2KA 1S8NA 1LEMA 3HKZA 3S1MJ 4E4ZA 2JA8J 1PZ8A 4HG6B 4I0AA 5FLVA 3OGJA 2L02A 5FYTA 3FK6A 3I7DA 2VBYA 1RIOH 3W9AA 3H92A 3W2AA 5FK8A 5LBFA 4OAZA 3ZGKA 3T8TA 4BK4A 5J8CA 2OA4A 5FY4A 3PU8A 3CDHA 4COWA 3FISA 3WXPA 5FLIA 1Y3TA 4WXHA 4HL0A 3HUGA 3KV6A 4R52A 2YS9A 2XGDA 5DAVA 1ZZBA 2ZMKA 2DJNA 4HXCA 3GJBA 3L2HA 4HZFA 4D8MA 3HVDA 3VKOA 1ZZ9A 4OZXA 4UNOA 1MBJA 3N7JA 4M4PA 1FMD2 1J58A 2VMFA 3U78A 2L7ZA 4L0ZB 4HA8A 3AP5A 3GZUC 3CCQI 3BCBA 1ITYA 4Q0UA 2WAQN 4JTOA 3IB3A 1J1LA 1CIWA 4H4KC 4ONUA 5F04A 2CSGA 2XUBA 3AYCA 5DG1A 4UYBA 2J1UA 3JU9A 1VAMA 1AXYA 4TYSA 5CKTA 1XU1A 1NKGA 2IXKA 2QLZA 4AU7A 1NY71 5A7WA 1PVC2 1SVMA 1WJCA 4WVMB 3RYKA 2JA7J 2O1QA 3KEQA 2Y6JA 1RC6A 2WZ8A 3OD4A 2WN2A 3CCJI 4JGZA 4DBQA 5CFDC 3OS2A 5IVBA 2JECA 2DJIA 4NAOA 1O4TA 1W1WE 4N7UA 4P9IA 4LLNA 3A03A 3VBFC 1D2SA 4OZOA 2DMNA 1EH6A 1QIQA 5F6KA 1V54H 1LGCA 3F21A 2HI3A 3CZ6A 2R4GA 1UIKA 5LEKA 4IW3A 3VZNA 1OLRA 3CP8A 5FCCA 2JVGA 1QOOA 3C18A 2YGLA 4GGGA 4IEJA 4ARXA 4JTNA 2P5KA 3CCEI 2F4PA 3NV1A 4FSJA 1GUIA 3R60A 4RGGA 4DO0A 5EJ1B 4IJAA 4IE5A 3AG1H 1KU3A 4IV3B 5EPAA 5FP9A 2KLOA 4CCNA 4PLNA 4Y4RA 3CD6I 2GN3A 1F35A 4K1YA 5DM7F 1V0AA 1EAH2 4L99A 2EQRA 4XDPA 2ZEWA 2ZJRF 1QJX1 2DT5A 3M70A 1RVF2 5HODA 5FKOA 1VQ9I 1NT0A 3K2AA 4C1XA 1K78A 1R081 1Z0XA 1RUNA 2L54A 1XQNA 1LAJA 1J59A 2VM9A 3UT0A 4LE3A 3ZXSA 2R5ZB 2W25A 5CEHA 2UXNA 3OYJA 3L00A 2D40A 3MO4A 4DOUA 4Q29A 3EPZA 3IMMA 2IVJA 3MIGA 1ZR4A 2YU1A 1H8TC 1SFNA 3FWEA 3LQQA 2R1BA 5LGTA 4CEWC 3D4KA 3FXMA 3JRHA 1NG0A 5A3WA 4OHVA 1Z77A 1G3WA 2XR4A 1HXS3 4JRLA 1XRUA 5A7SA 1N3PA 2FMLA 3RGBA 5CZKA 3PNYA 3ZM8A 2VZOA 2DA3A 1LNSA 3AX4A 2K3PA 1O8PA 1H30A 4QX0A 3ZQIA 2HWB2 1SPPB 3OYEA 3A0BC 3C7OA 3LSIA 1UY2A 1TT0A 5CFCB 4XIKA 5C3RA 5C9AC 1BR2A 4DFSA 3G7DA 4I6ZA 1U5TB 2OQGA 2ZNYA 5H6QA 1AX0A 2H09A 4A3MJ 4HVRA 1ZQ3P 3ZMNA 2ZGNA 1H9TA 3S2WA 1GBGA 2E1MB 1DQ2A 2EAKA 4JGYC 3SITA 1PHMA 4E7IA 3DWLE 1EUTA 3HHGA 1HF0A 3RZOJ 1OKOA 4L97A 4DEQA 3M8JA 4LHNA 2HBUA 2DDBA 2BBAA 2Y75A 5IT3A 1UG0A 2OPWA 1KU2A 1OR7A 1CAXB 4L9BA 1Y7BA 5L3EA 2JJ6A 2XPWA 2NP0A 1JW6A 4AFBA 3LFMA 2FDJA 5FZMA 3CP2A 1V5GA 3TMOA 5IK5A 3K10A 1UHMA 1YI9A 1VP6A 2RV9A 4N0BA 1RL3A 1QU0A 2A6YA 4HF2A 4Q0SA 5HCAA 4A5MA 2JPBA 3WF2A 4IHTA 2RDNA 1RI7A 2I45A 2DF7A 2EXKA 4DUXA 1X9PA 3HOXJ 3WV6A 3KP2A 5FZ7A 1WHUA 2VTFA 2WZR2 2RE9A 2HWC2 4L8QA 4JVAA 3OMYA 3PVNA 3PQJA 3ECOA 3SKJE 1ON2A 3DFGA 4IL7A 3CNAA 3UKGA 2VL8A 2VPLA 5E79C 3JQXA 3CEWA 1SFUA 2X5IA 4D6QA 3NSTA 1HKQA 2HGCA 3UJQA 3VDDA 3AK0A 4YGBA 3MDPA 3KYDB 1BCXA 4JOMA 1MQTC 2G7UA 4U7DA 5F6FA 4PJNA 4ZONA 1Y56A 4CU9A 2GAUA 2R6QA 3O0WA 2UYAA 2GP3A 4KISA 3OV8A 1R1A3 3V56A 4FX4A 2WAAA 2WQ8A 4D5CA 1SFEA 2XAJA 5IOYA 4I0WB 1IRFA 2E5NA 4EGZA 3SFIA 2OZ6A 2R7SA 2BNMA 3I3QA 3BQZA 3AG3H 2VNRA 2XJPA 1FIPA 1EP0A 1LOCA 2IXSA 4MFEA 3PURA 3DV8A 1JYIA 4NIGA 3QLQA 1C28A 3RPUD 1W90A 4CDUA 4QMAA 1SAXA 3WG3A 1G9DA 3MKLA 5JI7A 2HKXA 1A6IA 5EEAA 1GP4A 4RGKA 2VBDA 1YG2A 4F7ZA 1FPN2 2JSCA 3S16J 2XROA 4HNVA 3MIHA 4BMBA 1ETVA 3RZKA 2LC2A 4I7HA 1SLTA 1HKSA 2X6WA 4Z2YA 4BB3A 1VQKI 4D3WA 4HF1A 1YUDA 1YRZA 4I99C 1U12A 3NQHA 4GWMA 1SFPA 4V2VA 2Y6LA 2BP6A 3KEYA 1KS4A 4IEQA 1O3RA 4IOAF 1BXHA 4PJMA 1KYZA 4AQTA 1F4HA 1G3YA 2NS7A 1IZ3A 3AP9A 1DF0A 2FZ1A 5FV3A 3JD72 3U9GA 4BS9A 1T8IA 5CFDB 1JZ6A 4HQMA 3ABLH 3DPRC 3HPNA 1W6NA 4R9DA 1CIYA 4KQ7A 4UOJA 2F5EA 5F1JA 2C26A 1MACA 2HDDA 1HB2A 4R79A 1W6QB 1LNWA 3M7AA 1U6GA 1NLRA 4RSUA 3LKJA 3S7IA 1N78A 3J7YJ 2EFOA 2YUSA 3MKWB 1WCMJ 1ALYA 4CXXA 2PMZA 1XB4A 4Q4X2 1HXS1 3BT9A 4QXHA 4DS0A 4ANJA 2UURA 4W65A 1DZRA 3AM2A 1WKYA 2Q0OA 4UXAA 4ASKA 4YW5A 1SACA 2D6OX 3HSFA 3TN93 1S2BA 1W8FA 5LY1A 2BE5F 1W0TA 1JYNA 2M0MA 3ZQHA 3GF6A 2BFUS 5K4LA 4P55A 1V6OA 2LMDA 2F6CA 1DHKB 1H9WA 4HLYA 2ZJPF 2VQLA 3G4SI 4WV8A 3OYFA 4Q48A 3BI3A 1ZBE3 3HHHA 3J7LA 1S2KA 3RJPA 5ABJC 5FZFA 1YFHA 3EBRA 3FZVA 4ITVA 3M3YJ 1NQDA 3C2HA 2RS13 1R23A 5JXIA 2AACA 4TTGA 4DRVA 4N43C 4QPYA 2VBZA 3BJOA 4UB8C 3CQOA 5F3GA 2GXAA 1LOAA 4R9CA 2KT0A 4I09A 1BI3A 4MTDA 4QB2A 4N4OB 2HYJA 2CYFA 3WF4A 1H8TB 5IYYA 3KP3A 4Y5TA 5AIPA 4FFFA 2DA1A 3VDAA 4CEWB 3U75A 2PTMA 3E5UA 2VXJA 1PO13 4D1QA 4CSWA 3HT1A 2JB4A 2DVGA 4QWQA 3VZLA 1IKQA 3N3HA 1T08B 1HW2A 2LY9A 4TSVA 3PUHA 3P9CA 2JA2A 3J9SA 3JW4A 2ESHA 1O3SA 1BHGA 3AP7A 1XE7A 3SNMA 5FPVA 5C9AB 5E1ZB 4AVZA 1HX6A 1I3QJ 4U0YA 1R1A1 1XNBA 4U2AA 2EFQA 1RUI3 4JGYB 2YC4A 5FYBA 2M7AA 2NYXA 2JENA 2ADUA 3OGRA 3O14A 2UUZA 1AL22 4R4ZA 4PGHA 1NHAA 5DYMA 3AKQA 4BJ0A 5HCHA 4NJ4A 2P6CA 4ESBA 5DAWA 1JOJA 2B9VA 1CX1A 3KYLA 3POIA 1TWCJ 4W1UA 4H0EA 2XLAA 1HDDC 1HCRA 4EN6B 1X7NA 1WW4A 2HVSA 4SBVA 2VW1A 1YO8A 4IE0A 4BWOA 4KG8A 1UPSA 3JRAA 1U5IA 5FP4A 4U7BA 4UFIA 2RR13 4XXPA 3AB0A 1AL23 1S7EA 5J4VA 1KITA 1F8VA 3IAS2 2OQ6A 2PAMA 5FYYA 4B7KA 4B8EA 3RQ4A 1IPKA 2WIIB 3RWKX 3RZLA 1REFA 1UZYA 2PMZN 3TEXA 2STTA 3LOCA 3PVBB 3R61A 5DM6F 3GVAA 4E7HA 3THPA 1TWAJ 2IBDA 3MAJA 2X6XA 4IXLA 2DXIA 2XASA 3AYDA 1MQTB 2BYVE 3FXQA 3M07A 1YJKA 1HN0A 1MS0A 4I3PA 5EG0A 5HS9A 3IKWA 1A6QA 1MNDA 4QQPA 3KLOA 4RA0A 4TZDA 1PO22 1WSUA 5DAQA 2HEOA 4KNYA 4IVNA 5EDNA 3WGGA 2MLKA 1I50J 3C2UA 1D3YA 1RIRA 1K6OA 4EEFG 1SQ4A 1R1ZA 3ZPOA 3T0YA 4W6XA 1PNFA 1K6YA 1DP7P 3K4NA 3WODF 5DG2A 4PQQA 1QOTA 1SC7A 2R7UA 4L2NA 4AQ2A 2VOXA 3TN91 2LF7A 3N7LA 3GYHX 4CDGA 3BTYA 1YIOA 4C1WA 3WQBA 3VYSB 1QHHD 4J1WA 1ULPA 5G05L 1VBA3 3WNLA 4RGXA 1ZBE1 5D5UB 4AEMA 2KZGA 2QKMB 2GC3A 3P5BA 3HQXA 4YNIA 1C5IA 4XSZF 2RS11 2HWF3 3D0SA 5K0UA 2XJTA 2LKPA 3BTCA 1K4SA 2GNTA 2QTWB 3RIRA 3ZP5A 3EUAA 3CMYA 3MZHA 5JFRA 4QX5A 1R71A 2WABA 2YSRA 2WZEA 1MZ6A 3S6PA 2CQXA 5F64A 2CNAA 4IHYA 4N53C 5LGUA 3DPRB 1QHGA 1H1IA 3ZSMA 5ED4A 1RUJ2 5C71A 3CUQA 4AQ6A 2JDAA 4AIJA 3JB8A 1V5EA 5F2SA 2LKXA 3WTZA 2C6SA 1C4RA 2B7YA 5D4RA 1PO11 3BODA 4G7ZF 2YPJA 4FPOB 5EJCA 1HV1A 1MW7A 5M5YJ 1IG7A 1F5JA 3P6BA 4BU2A 2BRTA 4YW2A 2ZJCA 1PP8F 1VQ8I 3HOUJ 3C7JA 1N75A 3N7MA 4A42A 3WT3A 3AFKA 1V9U3 2EFPA 1SMVA 4G7OF 3QU6A 2XC7A 3HJEA 2VE9A 3U4XA 3P3NA 4M72A 2VUMJ 1FYUA 5F39A 4OIQF 5FXWA 4H55A 3EQLF 5J47A 4P9JA 4DY3A 2DYCA 4GWJA 5JOZA 4N90A 4AOCA 5LW9A 4AI1A 4XORA 3H3LA 1RUI1 3OGSA 1OLMA 2M9HA 3HR9A 1FX5A 1QKQA 3OCPA 3JREA 3QH7A 4X6QB 1YNAA 2EA2A 2K9SA 2P34A 1E57A 2EIBA 5BV6A 3ZLIA 3IPVB 3TP0A 1GZTA 4RDUA 4URTA 2AR6A 5ICEA 3JBG3 4QLCU 1AR92 5JSPA 2BW8A 1G3TA 3SLIA 1BW6A 4WBBA 4A5NA 4Y1XA 5FZIA 2DUOA 5LCWL 4N43B 3H3UA 3QU3A 3CF6E 1RHI2 1Y43B 2KPMA 2O5RA 1SVOA 4CDWC 4KIBA 1YTYA 1DQ6A 5GTIC 1ETOA 1PJRA 3NW4A 5FZGA 4UXNA 1AL21 5IW0A 2MHFA 2KJBA 3J7NA 4QGNA 1WJDA 4E4DX 3CBNA 4RBOA 4D69A 4Q0VA 3KCXA 5CLSA 4QKFA 4JZRA 3WDUA 1XPWA 4KT6A 2RQPA 2K86A 3A2KA 3MWMA 1ZG1A 3B7MA 2NAZA 4B3AA 2D44A 4DXTA 1ETKA 2WWUA 3EJKA 1PK6C 1JS9A 4U0WA 3KHBA 3VL8A 3TL4X 4ISRA 1P92A 5KXBA 2FBHA 1OVPA 5B2GB 1FEXA 2DTZA 1U5ZA 1OC1A 1LVKA 2QA4I 1LKXA 2FNPA 4ESJA 1UJ8A 4LHSA 1PX4A 4XFAA 1PGW2 3MUY1 3GALA 4EM0B 3AKPA 1V6IA 4PLOA 2HOEA 1IRGA 3OUJA 1V6KA 1RRJA 1IG3A 2WB1A 1N1YA 2ZZQA 1E0EA 3HD8B 4A2UA 2Q8OA 2JKXA 5GLTA 4NMIA 5HPOA 3OSDA 3RZMA 1FMVA 1NQJA 3POSA 5GJ6A 4CCKA 2YC2A 4EZHA 1NZIA 2JE7A 5IHRA 2O8QA 5FPZA 4WM7C 4XLHA 4LMFA 3HGGA 2DO7A 5IVEA 5F37A 1P6RA 2LYCA 4CUCA 3FX3A 2WAOA 2JX9A 3ZSLA 5DXDA 3O6BB 1CQ9A 4TXWA 3O3KA 5J1XA 5F0FA 4AIHA 5GADJ 3A0HC 1IV8A 1MKMA 3VB9A 4L5EA 1ND2C 1G59A 2VOPA 4E7ZA 3DLLF 3O2PE 2QM3A 4OU0A 2A5ZA 1QNWA 1YI2I 3K4AA 5FYCA 2W39A 1WGPA 1KJLA 2ZC2A 1VBA1 1HQCA 3Q9VA 3O7OA 3TOBA 4XUOA 2D97A 2NZ9A 1Y8RB 4Y1VA 4XUPA 2B45X 1XYPA 2DN0A 4AGGA 3LQCA 5BNPC 2PJRA 3BTJA 5FYUA 2VKVA 2HWF1 1MMGA 2F48A 4KMQA 2F5DA 3DKQA 5CG9A 1YJWI 1BMV1 3SH4A 4YVWA 2VC0A 3NO8A 2Y69H 3OYWA 2IWGB 1NLSA 3CJIC 2BWCA 3I64A 1T0FC 2KHMA 4QQOA 2HR3A 1R1UA 1UX7A 4DEVA 1KYWA 5JPNB 4XKBA 5LA1A 1ASJ2 5ILSA 2IGNA 1NK2P 4E8CA 1BK0A 1BVVA 5LHHA 1CWPA 3QRFF 1ZLKA 2MEV2 3N35A 5F7UA 2P5VA 2J5PA 2L4MA 1Y0UA 1HJGA 2V1XA 1V9U1 2XH6A 5EYXA 4AI0A 2VVFA 1RUJ1 1WMFA 5GLUA 5DUVA 2BDRA 4NDLA 4NHXA 3F23A 5FYSA 2L4AA 5F0CA 1HA8A 5JXHA 3BN6A 2FMDA 1ASJ3 1RXGA 2PBIA 2XUEA 3HPGA 3LOBA 3MZYA 4XONA 5HDGA 4JKMA 2JIJA 2VPRA 4WZFA 3I2GA 5JXJA 3JBG1 3TWIA 2XRNA 4NUBA 3QPSA 2VW2A 3J8F3 2A6VA 2BY2A 4HK9A 5KNLA 2HU9A 1WWYA 2PN6A 1POGA 4AR2A 3BLYA 4G6DA 5FMBA 2HZTA 3BKZA 4LG0A 4FVVA 5D8KB 1Z3XA 4P9FA 2E71A 1XNTA 3NNGA 4L0PA 2FD5A 4GA9A 2P6HA 3F8FA 4P9XA 2WB1N 1ETXA 3PJQA 3KV4A 1VMHA 4EJOA 3F6OA 3OJBA 4COYA 2YHJA 4BBSJ 1NXD1 2OD5A 4X6AJ 1YQ2A 1RHI1 2EZIA 3RJRA 4LKEA 4XKWA 3K0LA 2Z5UA 1X19A 3H0GJ 2VUJA 3I4PA 3DTIA 1Z3YA <