4EWEA

Study on structure and function relationships in human pirin with manganese ion
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA01
3EO6A 1J59A 4META 3WW3A 1CAWA 4Q0SA 4OLLA 4HN1A 1VJ2A 3PVBB 4QX5A 2Q0AA 4MUVA 4MGZE 3FFQA 3CLPA 2OZJA 3H1MA 4UXAA 1NZCA 3SMHA 3H9AA 1J3RA 2O8QA 3H1WA 2CGPA 3TNQA 1YFUA 1ZRRA 1SQ4A 3DV8A 3H7JA 3H7YA 3IDCB 2V09A 4Z07A 4AVBA 4XFAA 1WGPA 4FAGA 5KBFA 2B5HA 1O3RA 4F8AA 3BCWA 1RGSA 3KGLA 1GQHA 4GULA 2IXIA 3VHRA 2GH2A 2PAMA 4IEQA 3UKVA 4IEUA 4MX3A 4IESA 1HW5A 2ZKLA 4HLTA 4MV2A 4BYYA 4QGNA 3S0MA 1O5LA 1O5UA 2WFPA 1QY4A 1YHFA 5J7MA 5KHGA 3H1YA 1ZZ8A 3NL1A 2QDRA 3R6SA 1O3TA 5AVPA 3E5QA 1RTVA 3SCHA 3U10A 1ZRCA 2GC1A 1LKNA 3G7DA 1X82A 4TLFA 4Q29A 5I91A 2XL7A 1JUHA 4LLOA 4I01A 1O7FA 2PHDA 4AVAA 3E5UA 3EJKA 5JSRA 4HVRA 1EY2A 4Q0UA 2XGXA 4F7ZA 1U12A 5LEKA 2UY8A 4XF1A 5J48A 2H6CA 1UIJA 4MGKE 3RYKA 5CADA 4IERA 5I0SA 4ZU4A 4WVZA 5JCTA 4AXOA 3FE5A 2ET1A 3WW2A 4AQ6A 3QOPA 2Q30A 2FQPA 3KSCA 2ATFA 1YUDA 3ZDSA 3ETQA 1G6NA 3M3IA 5I8SA 4YYOA 2GU9A 3EQEA 2N7GA 3DN7A 2ZCWA 2Z2SB 3PNAA 4QM8A 5JAXA 1ZZBA 5LRRA 3OGJA 4K8FA 3HT2A 2QNKA 3MPBA 2FMYA 4QM9A 4HMZA 1O3SA 3NKTA 3OD0A 2WC2A 4JVAA 2O1QA 2EA7A 4Q0PA 2IXKA 4XFCA 2K0GA 2PAEA 2KXLA 4WZCA 2PTMA 3ES4A 1WLTA 2BEOA 2I45A 1XE7A 3KMHA 2PYTA 2PHLA 3FZ3A 2OPKA 5BXXA 1J3PA 1NYWA 5I93A 5FCCA 3RPQA 2QVSB 3UKTA 2H0VA 2PFWA 4EWEA 5KHKA 4QXKA 2VECA 4J1WA 1DGWA 5I0RA 3IIAA 4RD7A 1ZRDA 1QXRA 3E6DA 4L2NA 1OFNA 2HKXA 4Q0QA 4FAHA 2IXCA 2OYZA 4QGMA 2XLAA 5I8YA 3LOIA 4IEYA 4XFFA 4E2SA 5J3UA 3OF1A 4IETA 4LUMA 2PQQA 4Q0VA 4WBBA 5C6CA 1UCXA 2XLGA 3RDIA 2Y0OA 3DL3A 5JR7B 4LA2A 1I5ZA 1XE8A 1ZREA 5FLJA 3RYPA 3GYDA 1FI2A 2BNNA 5I0TA 5E16A 1OI6A 4KWLA 4R8HA 4KU7A 4XF4A 5FLHA 3L2HA 5FPXA 1RUNA 3IBMA 4B29A 5BUVA 1CX4A 1H1MA 1VR3A 1FT9A 5T3NA 1ZX5A 1OD5A 4HZFA 2BNMA 4MZUA 3ROUA 1UIKA 2QCSB 2CAUA 1VP6A 3OCPA 4YNIA 1X8MA 3O14A 2IXHA 2H6BA 2IXJA 2VPVA 3TNPB 2Q4SA 2BGCA 4I0BA 5EFUA 4YSFA 3DKWA 3IWZA 2GAUA 4YARA 5D1IA 2D40A 1ZNPA 4PIXA 3HIFA 1YFYA 4I2OA 4PJYA 3FX3A 4HSJA 1YLLA 3CL1A 1DGRA 5FDBA 3RZZA 1YFWA 1TQ5A 4LULA 3SCGA 5BY5A 4H7LA 4MGIE 3ELNA 4J1XA 1RL3A 5FPZA 2CV6A 4O9EA 5BPXA 2E9QA 4YRDA 1O4TA 2IC1A 1H1IA 1GQGA 4HSLA 4IEXA 2DCTA 2UYAA 3NW4A 4MGYE 4O9GA 4D7TA 2D93A 4PIZA 4N9HA 4NVPA 1IPKA 1FXZA 2XLFA 2GZWA 4ONUA 3BPZA 4QGLA 3IDBB 1EP0A 4XF9A 4IEPA 2GC2A 4LUKA 4I0AA 3QACA 4L11A 4D7SA 4E2QA 3SHRA 1RC6A 3MDPA 3GBFA 5I8TA 3CJXA 4ZU7A 1UD1A 4UBGA 1Y3TA 3E6BA 4XFIA 1ZZ9A 5LRSA 3NSTA 3LWCA 2BNOA 4LA3A 3KGZA 1EPZA 3WW1A 1ZVFA 3I59B 4OFGA 2Z69A 3E5XA 3I54A 4EROA 4ZU5A 3EHKA 1DZTA 4XFHA 4FT8A 1UPIA 3H3UA 2GC3A 4KL1A 4BH9A 3I59A 4JV4A 2B8MA 4KU8A 5BV6A 5F1RA 4ORFA 1YWKA 4Z82A 3USSA 5HI0A 3KCCA 3LAGA 3U11A 3C3VA 1X8EA 2B9UA 1V70A 3UKNA 3FHIB 3FWEA 4DINB 2MHFA 5LEJA 3CEWA 1LR5A 2OA2A 1X7NA 4N9IA 3JZVA 1DZRA 3MYXA 4E2GA 2UY9A 5FQ0B 1NE4A 3LA3A 3SXWA 5CU1A 3RYRA 2P17A 1ZRFA 3BALA 5CVRA 1LRHA 3NJZA 4XF0A 1CGPA 3LA2A 2ETEA 4I3PA 3E6CC 1PM7A 3D0SA 3OTFA 3BU7A 5FQ0A 1IPJA 3FJSA 1ZZ7A 5K8SA 1ZZ6A 3LA7A 3ST7A 4IEZA 4HN0A 4KWJA 4MH0E 3M70A 4XFGA 2D5FA 4EWDA 3D82A 1EYBA 1CAXB 4JTOA 4BIFA 1SEFA 3RNSA 2XKPA 1J58A 2ET7A 2GC0A 1Q5OA 2CAVA 4I09A 3MZHA 3BB6A 1J3QA 1QWRA 2Q1ZB 4A2UA 1CAXA 4FBFA 3N4MA 4EWAA 4XEZA 4XETA 3D0JA 4R52A 1YFXA 3CF6E 5JSPA 3U0ZA 4JTNA 5E1RA 3H50A 3LZZA 1O3QA 1CAVB 4KWKA 3E97A 4HVOA 3HQXA 5KHJA 4XF3A 5I0UA 5KHHA 4HVQA 1UW8A 2PAKA 2C0ZA 4HBNA 5C8WA 2MPFA 4IEVA 1ZZCA 5EZWA 1CAVA 4IEWA 2EAAA 1J1LA 2EVXA 4EV0A 1SFNA 2XL9A 2XKOA 3CO2A 2QJVA 2VQAA 1NE6A 4CYDA 1QXJA 4IEOA 4UBHA 2HJIA 2D5HA 4BHPA 3SCFA 4I02A 2BYVE 5JSOA 3PLQA 1LB2A 3HT1A 1Y9QA 3ES1A 5KHIA 4AQ2A 1PMIA 4X6RB 4LTAA 1WA4A 3ACLA 1L3JA 5FLIA 3EBRA 3NVCA 1Q3EA 1OMIA 1CAUB 3WW4A 1RUOA 2K9ZA 4X6QB 1Q43A 3B02A 2UYBA 4LEJA 4PIYA 4P9GA 4XFBA 2F4PA 2XHKA 3S7EA 2IXLA 1XRUA 4QMAA 1CAUA 2MNGA 3H8UA 1CAWB 3H3ZA 1NXMA 3I7DA 1I6XA 2PA7A 2OZ6A 3S7IA 4AVCA
chains in the Genus database with same CATH superfamily
3ZIXA 1AR93 3DPRB 3JXSA 1NQJA 4LO6B 3R4DB 4META 3OGRA 2WA3A 2XG3A 1P8JA 2HWC1 2QTWB 5F32A 5F3IA 3WNXA 1LU1A 1FV3A 1XXNA 1PK6A 1QXPA 1RUD1 5DXDA 3POWA 3H8XA 3GBWA 2XJVA 1XJAA 5JVVA 5DG2A 1POV3 4LITA 4CDUC 1S0GA 1NZCA 1EUUA 1EV13 4GMP1 2D43A 4M0NA 5I93A 2ZZJA 2X29A 2EALA 1ZRRA 5DG1A 3V64A 3WNOA 4IE4A 4MGSA 3DYOA 4X8PA 1H9PA 5FY7A 5LBEA 1UU5A 4CDQA 2CWSA 1PIV3 4PI2A 4Y1VA 4XFAA 1Y7BA 4XUQA 3ZFEB 4COUA 4DZGA 3N3HA 3PHMA 1JS9A 3WQ1A 1O3RA 4EZHA 3BCWA 1OH3A 1HX6A 4NIAA 1OKQA 1GQHA 2DWRA 3H3LA 4AOCA 2JG8A 4CCMA 1RUH1 2J22A 2WYFA 1BVVA 2PQSA 1VAMA 1O59A 2DBNA 2W0XA 4IESA 2VJXA 2ZKLA 1YRZA 3CMGA 2AR6A 3BVCA 4K1ZA 2ZGKA 1O5UA 4KQ7A 2E33A 3MIFA 2JIGA 3NL1A 4ATFA 1IQDC 2G4IA 4QD2A 3C7OA 3LFIA 5ABJA 1DQ2A 2GC1A 5FMDA 5C3QA 1LKNA 2ES3A 1AF9A 4FPYA 1TMF2 2XBO3 1RUE2 4QHBA 5EHDA 1H30A 1AR81 1DP0A 4Q4W1 3ZYBA 5G05L 5BNPA 4CEYA 1DGWX 1NCRA 3PUHA 3OOXA 4GD4A 2SBAA 4AGGA 1O7FA 4LHSA 2PHDA 4CCLA 5IVJA 3LD8A 4Y5SA 4P9LA 3UL2A 5F37A 1QJX2 1VRH2 3EJKA 3I3BA 4FP3A 5JSRA 3IPVB 5FZDA 4O61A 2VOVA 1U12A 1ULGA 2X8KA 1C8M2 2G9FA 4YVWB 5HXVA 2H6CA 2WJSA 5KXEA 3JQXA 5CADA 5FIXA 3LIGA 2VZ3A 1A78A 4IERA 1UN1A 1UYXA 5A80A 5FO9B 5I0SA 4LKDA 4XQWA 2XWBB 2FCTA 3WW2A 1W9TA 4Z8BA 2ZGQA 1VBB2 1Z7S3 3OYWB 5F39A 1YUDA 2W46A 2VQUA 5F5QA 5FO7B 1G6NA 3ZSKA 2RVAA 4GH4B 2NP0A 2E7AA 1ENXA 5FMOS 4Q4X1 4X8NA 2YGMA 2UWCA 2GU9A 2CYFA 1JI6A 2CTVA 3AM2A 3AXEA 3EQEA 4JQRA 3WZ1A 5LWBA 1S4CA 3DN7A 2ADDA 3ECQA 4FXKB 4XHXA 2L9LA 1R092 3LDKA 4CDUA 4BCUA 2RS13 4QDSA 1O6UA 3PNAA 3T2OA 3EYPA 2RM22 2XH6A 3FHAA 3H0OA 3GZAA 2A6YA 4CA9A 4DY3A 2Y6KA 2ZHKA 2J1VA 3TWIA 5A6YA 2QNKA 1AXYA 4LHLA 1APNA 2FMYA 4QM9A 2GN7A 4HMZA 4QAWA 1O3SA 5C4WB 5J37A 1WD3A 2Z5WA 1HRV1 2ZAHA 5EJ1B 5FXZA 1WUVA 3CIHA 3U1XA 1N1VA 3J7LA 4JVAA 2O1QA 3UESA 1IS4A 4FCAA 1CJDA 2EA7A 1H1AA 1SLTA 3U37A 4XJWA 4CDWB 2Q1MA 5HCFA 4W50A 1MS1A 2GN3A 4L99A 5DUVA 3JBG2 3DXUA 4IGOA 4IV3C 3O1SA 2ZX3A 2I45A 3ACFA 1AR92 3BTZA 5KWRA 5LASA 3ZR6A 2PHLA 3ZPYA 4QPIB 4QHZA 4XBNA 4D6QA 5DAQA 2QQIA 4UFKA 3HNMA 1VBD1 1BQPA 3ATGA 1ZA4A 4OZOA 3B3QE 1MQTB 1VBD2 1VBA3 2BFUL 4XDOA 3USUB 4AI0A 5KXDA 2A7AA 1EV12 3BGAA 4EWEA 4QXKA 1AXKA 3A22A 3VBOB 2X10A 3VKMA 1MEC1 1E5HA 3B00A 4XC9A 3IAPA 3NV3A 3J8F1 4IE5A 5LATA 2XR4A 4LK7A 4ZPIA 1SPPA 4LHNA 1FX5A 4QXHA 1OFNA 1UX7A 1PIV2 1RYYA 2HKXA 4I3GA 4UI9L 1CN1A 2FDKA 4ES9A 4JGZC 2OYZA 4N53B 2BRTA 2P3IA 5FUIA 4AHYA 4CU9A 1ULPA 5JMCA 1UO9A 4QGMA 4TN7A 4LKFA 4RHV3 5LBCA 5TSWA 5FOJB 1OQEA 3SISA 1PMHX 3JB8A 5I8YA 3KF5A 4E2SA 4RYDA 2JG9C 4LUMA 2PQQA 4Q0VA 4WBBA 4ATEA 2AENA 1AYM3 4NR1A 3B01A 2HEWF 4QWNA 3T0AA 4NRMA 4YVSB 1LGBA 5EP9A 5CA6A 1QJY1 2PN5A 3MW4A 2YFUA 4EN7B 5F5CA 2ZEXA 1I5ZA 1XE8A 2YDEA 3KF3A 4AW7A 1UKRA 2HWB1 2QQNA 2YBKA 3RYPA 1VRBA 2BBAA 3GYDA 5ERLA 4C1XA 4Y33A 1KS5A 5I0TA 3VDDC 4ASMB 2YGLA 1OLQA 1FYUA 1IS3A 1KQRA 4KU7A 4KWLA 1MVEA 5FZ7A 5GZFA 1SZBA 4BIOA 3IIIA 2OPWA 2JKXA 3IBMA 1CX4A 1W8OA 3A0KA 3SEEA 1WLDA 2OUJA 2WNEA 2Y26A 5J09A 2QQWA 1CONA 1MS4A 1W9SA 3ROUA 3D8CA 5FWJA 3AFKA 3R0RA 2WNUC 2R071 3ZN6A 3P1IA 2FDHA 5JIAA 4IV3A 5A3MA 1DGRN 3ZXLA 1BEV3 5IVFA 3B7MA 4YNIA 1X8MA 3H42B 3FN9A 5H9SA 2DU0A 2IXJA 1OH4A 1QQP1 1W8HA 4F83A 4KGGA 1Z7S2 5F3GA 2Q4SA 1N3OA 5EFUA 3MUY1 3INAA 1QQP2 2NN8A 2ORZA 4DXRA 3LSDA 3IWZA 1W3XA 3ZXGA 3AKQA 4YARA 4KMQA 4R9DA 2OXBA 1YFYA 2AC1A 1RUF1 2ZEWA 4FPOB 3WG2A 4B4QA 3W5MA 4A44A 3RWKX 4PJYA 1GZWA 1UZ0A 1W9WA 1DQ6A 3PTRB 4XAEA 2IVIB 3CL1A 5C9AA 5A3TA 5FDBA 3RZZA 3Q9OA 2JECA 4LULA 3ZVXA 1GKBA 1COV3 1G86A 5BNNB 1W6PB 4PDWC 5JMOA 1OC1A 1JXNA 5A1AA 4BOWA 1R081 2V4VA 1O4TA 2AEYA 4JGZA 3Q8EA 3I2JA 3I3EA 1CR7A 1H1IA 3KT1A 4CTEA 2UYAA 4AI8A 3NW4A 5FXXA 4S2GA 1QOTA 5DAWA 1W2TA 4L8QA 4UAPA 5FZAA 4AFAA 1W03A 3AFGA 4OMCA 2JG9A 4P00B 1FXZA 2WYSA 3WNLA 3LOBA 1K45A 3RI8A 3KQRA 2OUHA 4ONUA 1VLNA 1ACCA 4O7XA 3J4UH 2VNRA 1DZQA 4CXWA 2F17A 3MIEA 4LUKA 3B5LB 3QACA 2VH9A 3MICA 3WOGA 4D7SA 3H8RA 1EPWA 4XBLA 2BZDA 1W6MB 3ZYRA 1KXGA 1QOOA 4RGAA 1E57A 2A70A 3VZJA 3GHMA 1UD1A 4OVEA 2B45X 3VDDA 3NNLA 3W9AA 3ZXEA 4XDQA 2NPIA 3VKNA 1VBA2 1ENRA 1SFYA 3OG2A 4L0PA 4LLFA 5B2GB 1ZZ9A 4NIGA 2Y60A 3LWCA 2BP6A 5F3CA 2CNAA 1VBC1 3HAGA 4FOQA 1EPZA 4Q4Y1 2XPJA 3LEGA 4COZA 4A7KA 5CFDB 5CISA 1OQDA 1B35A 5GALA 4Q4Y2 4OUMA 3E5XA 3I54A 2WNUA 2C24A 3K4DA 3KD4A 1IZ3A 1W8ZA 4XMIA 2JIJA 4LIUA 2J7MA 1QJFA 1PGW2 4FT8A 4YW6A 1LOFC 1J1TA 3UT0A 2XWJB 3VBUB 3LEIA 2PMWB 4LBNA 3AB0A 4UW6A 2YYOA 3GF6A 2B8MA 4OI2A 2R061 5F1RA 1AYM2 1XNKA 4OHYA 3USSA 1UOGA 4OUEA 3T1LA 4K6BA 3WSOA 4RR3C 3LAGA 4LQRA 4UFHA 4MHRA 3C3VA 4Z1VA 2VXRA 1DQ1A 3O1OA 1AJOA 1NCQC 2A6ZA 3WNKA 3N9PA 3UKNA 4FQZA 3AC0A 4EE2A 2ZX4A 3O7OA 4CCNA 1OLME 1VBE3 4IXLA 5LEJA 4PDWA 2AYHA 4RFT0 1W2NA 5FMBA 5K0UB 2A71A 3VL8A 2OW4A 4N9IA 2YUEA 3EB7A 5LCWL 2E32A 1XNTA 4P9YA 5C70A 3I2IA 1SMVA 4AI2A 3S6PA 4YZ1A 4QT6A 1NOVA 4JRLA 5A3LA 1ZA7A 3O0WA 2LROA 4OMDA 1N47A 2WO7A 2WWJA 1CQ9A 1TME3 5CVRA 4Z2AA 3NJZA 1WZXA 1CGPA 3LA2A 3LEKA 3ZR5A 3E6CC 3T2PA 3T0BA 5HPOA 3BUCA 3OBTA 4XJAA 2BTVC 1BEV2 3BU7A 5FQ0A 5IHRA 2WS91 2P6CA 3CJIB 3WUDA 2D44A 1Q8VA 1ZZ6A 3LA7A 5JZGB 2WS92 4IEZA 5CIRA 3ZIWA 3O12A 1C5HA 1PNGA 2QQUA 2LS6A 3E1F1 4XZUG 1GP4A 5GLVA 1HDKA 1W04A 2JD4A 3M3CA 1RMU2 4DNYA 4CU7A 5JXIA 3OGSA 2XJTA 1JHNA 1QGLA 3N9QA 1HB2A 1OFSA 2ZZQA 1PGSA 4OQ8A 3I8TA 2J42A 2ET7A 2GC0A 3QCWA 2A1XA 3JU9A 2CAVA 4FFFA 4Y22B 1UY0A 1ONAA 4Y3OA 2B42B 4Y24A 4DEVA 3MZHA 1J3QA 4PI0A 5IYYA 1CAXA 3LSEA 1PO13 4NUBA 5A32B 3T2TA 1G8WA 3WY6A 1COV2 1MS0A 1OBNA 4AQSA 4R52A 4XHBA 3VDAA 1GANA 4LK6A 1K5MA 4B1LA 5FJHA 5ACA1 3DPRC 2EIDA 5FYBA 5ACA2 5E1RA 3H50A 1RVF3 5LY2A 1W0NA 4A6SA 1S0BA 4QQHA 3PDQA 3T4HB 1LOFA 5FY0A 4RQPB 1W2UA 1QMJA 5AFBA 1ENQA 5KHHA 2FCVA 4UYBA 1MS9A 1OLMA 4PT6A 4PLMA 4XABA 4OHZA 5C8WA 2MPFA 5EZWA 3K77A 5A33B 3IDEA 3K51A 3J7HA 3OGGA 4AI9A 2P3KA 3IDAA 2JXAA 5A3PA 3HWJA 2WLQA 4P5HA 4C91A 4XPVA 4QKNA 4EV0A 2ZACA 1SFNA 4YPJA 2XKOA 2ZS6B 2QJVA 4RR3A 1KFXL 1PO23 2GMMA 3POJA 4ITCA 4PHZA 4PF1A 4K40A 4XJUA 3SC7X 5KXBA 4XMAA 1NCQA 2XJSA 3BIWE 3IM0A 1QXJA 2Y33A 4UBHA 1OURA 5ANNA 3ZFEC 4CYDA 2ID4A 1QJZA 1ALYA 4QX7A 2B9VA 4I02A 5AVAA 1QNYA 3UJOA 1W6OA 5JSOA 3NNMA 4B7EA 3ZN4A 3OPTA 4QX3A 5DDJ3 1KEXA 4AQ2A 4N43B 2XJRA 1HB4A 4RA0A 3ASIA 1WA4A 4K21A 5FLIA 3V0AA 1GR3A 3GJBA 4H2AA 4M4PA 1XSRA 5IVYA 4BISA 4MG2A 1LHWA 5T55A 1W2AX 1CAUB 4PBPA 4UWDA 2K9ZA 4H3WA 3WUCA 3POBA 1GOFA 3B02A 3UETA 2UYBA 1NAEA 5E88A 1DF0A 2GP5A 1R1A3 3GZEA 3ZFFB 5APAA 1AHSA 3B94A 1SLAA 2XHKA 1FPN3 4UF0B 3H8UA 4NPRA 2HWD3 1CAWB 5EJ3A 5CFCB 1NXMA 2OIIA 5A7QA 2HWF3 1C3HA 5FV3A 5FY5A 1RHI3 3ON7A 3UV9A 4CCDA 4ZXKA 3EO6A 3IKWA 1CIWA 2W08A 3K2OA 3AMNA 4XOGA 4LKEA 5JXHA 3ABZA 3C8XA 3HEIA 1BBT3 1CD3G 4YVWC 4A7YA 1LHVA 4HFSA 4MADA 3M2MA 4ZZ8A 5BNOA 4WVMB 1DYOA 1VJ2A 4GA9A 4CUAA 2ZX0A 2GNDA 3IT8A 3PVBB 5FY4A 1RUG1 5FZFA 3THTA 2DFCA 4P02B 4WVWA 4AZZA 1GNZA 2ZEZA 1V9U3 2XHNA 3DPRA 4QDQA 3H1MA 3O1RA 2TEPA 3S5AA 2ZEYA 1J3RA 1QDOA 2E51A 2ZHMA 3KM5A 3VHOA 1FNYA 4GH4C 1PHMA 4E4HA 1TME2 4BWOA 3DV8A 4CXYA 2G19A 1ZBA3 1AR71 5IAVA 2ZGMA 1F4HA 5C5UA 1GBGA 1HRI1 1LGNA 1WBFA 4QX0A 1S0EA 4Z07A 5IVVA 4CDXB 4CCJA 3RZJA 1WGPA 4FAGA 1V6MA 4F8AA 4DEQA 4JGYB 3J9SA 2VMDA 4N7IA 1JODA 2LM3A 4IEQA 1H9WA 5FPUA 2BW8A 4IEUA 1K5JA 4OI0A 2WQ4A 4BQ3A 2WZR3 3ZFEA 5CG8A 2DTWA 5C4WC 2VU9A 1GFF2 1O91A 4P14A 3S0MA 3LQCA 5J7MA 5KHGA 1ZZ8A 3R6SA 2QZ2A 3WCSA 4F3JA 1YIPA 1O3TA 3VD7A 1RTVA 1ULDA 3SCHA 1YI7A 1RJ7A 2DBIA 3U10A 4CDWC 5DPNA 5FYHA 3ZXDA 3I49A 2QQLA 2C26A 4XILA 4GKYA 3G7DA 4GMP3 1X82A 2D3PA 2A3YA 4Q29A 1PO12 3WEZA 5I91A 3ILFA 1C57A 4B3NA 4YM0A 2P1BA 4BPZA 4XUPA 1MZ5A 4LO5B 2X5IB 4FPHA 4AEKA 4E8DA 3JD73 4FP2A 1F8VA 2FZ2A 3OY8A 4QPIC 3E5UA 2YC4A 4HANA 1EY2A 4Q0UA 3ENRA 3WDWA 1X9TA 1RUH3 1XU1A 4XVHA 1OVPA 5LEKA 1OA2A 1MQTC 3I3DA 3VB9A 5J48A 3LDRA 5DZGA 2R0HA 3DGTA 2WAAA 4XXAA 1YQ2A 4NO4A 2RR13 4V1PA 5GZDA 3VBOC 1YXWA 3VD3A 3BI3A 4M3CB 4WM8B 3IPVA 4ZU4A 4P9WA 2CWMA 2IVJA 5JCTA 1ND2B 3D3AA 1IKPA 3O1VA 3M3EA 1PO22 2ET1A 1F5FA 2B4KA 4RL7A 3QOPA 4XJ8A 5SV5A 2D7FA 2WWUA 3KSCA 3WP5A 2ATFA 1YIFA 2VMCA 1PZ8A 4IUGA 4CVUA 2PHUA 4K20A 1ZBE1 3ZYIB 4N53C 2D3SA 2RS51 5FZ4A 5L9RA 2YPJA 4DIQA 1ZBE2 2WWSA 2OS2A 1N1YA 1SBFA 5DDJ2 3ZXAC 3N7KA 4YW4A 1NY71 1XE0A 2AUYA 3OYWA 1POV0 1UU6A 2Y0IA 1QJU1 2R49A 2Z2SB 1NY72 3THPA 4GH4A 1V6KA 4CEWB 5JAXA 4QKDA 2VXJA 1ZZBA 2BERA 5LRRA 1UYPA 4YVSC 3TBDA 4ASKA 3NKTA 1R1A2 3I2FA 3OD0A 3WF4A 4AI1A 1SACA 2QUOA 2VCMA 2WC2A 4AFDA 5CBLA 2WQ8A 2PLV2 2RDSA 5E8AA 3TEYA 3J7NA 4Q8KA 2GNTA 2YY1A 3P5BA 4Q0PA 1Y9GA 2IXKA 3S57A 1TZOA 3P3PA 4OI4A 4XFCA 2YC0A 5FK7A 1AJKA 4QB1A 4DS0A 2FDGA 5C4WA 5HCBA 2HWF2 4FPGA 2PTMA 3ES4A 4JKMA 1D2QA 1EUTA 4NOTA 4YGEA 1GWMA 3VDCA 4D3WA 5HXMA 4JDMA 1V6NA 2VQTA 4CDWA 1F31A 4PBOA 4AEDB 3FZ3A 2OPKA 2ENRA 1S0DA 3PTYA 2WFF2 3BYWA 5BXXA 1KS4A 5FKBA 2QFEA 2VUCA 2Q5TA 3A4UA 3RPQA 5D2AA 1V9U2 1KJLA 3UKTA 3RFRA 4BU2A 3AYCA 5F5IA 3NKGA 3POSA 5FPAA 5J1XA 2VECA 4J1WA 4QPIA 2CU5A 2WT0A 3HBZA 4C8DA 1SLBA 4JDOA 4K7JA 5A3NA 4B4PA 1XC6A 4QXCA 1QXRA 1RXGA 1ZBA2 5JDBA 1CPNA 3ETPA 4YW5A 1MQTA 1GOHA 3USUA 2W68A 2ZHLA 3ZSEA 2FDIA 3PUAA 2IXCA 1LODA 1HN0A 1PVC3 2JWPA 5C3PA 1TNRA 3LOIA 2AEZA 4H7MA 3I2HA 2ZGRA 1W39A 4IEYA 5J3UA 2PHTA 1LOAA 2WZR2 3OF1A 4IETA 4KH9A 5FP3A 5F9TA 3T3YA 1J84A 4N53A 4XIKA 5C6CA 2W94A 3MW3A 3N7JA 1UCXA 4LR4A 1NA1B 2XLGA 3WF0A 3RDIA 3BU0A 2Y0OA 3DL3A 5JR7B 1JW6A 2ZAAA 2NYYA 4LA2A 3V0BB 2E63A 2VTXJ 3N9LA 1JYWA 4A3ZA 1FI2A 1U5XA 1TMF1 1WMDA 1RUE1 2DYCA 2QZ3A 3OPWA 3RG0A 1OI6A 4YVSA 4BXSV 2W87A 5M0TA 3JD72 5LBFA 5KXCA 5FLHA 1C1LA 5FPXA 4JQTA 2DCJA 5GLUA 3U4XA 1H8VA 1CIYA 1XOYA 1BCXA 4JHZA 4HXCA 1FT9A 4FI9A 5T3NA 4DO0A 1J83A 1QJX1 1VRH1 4TZDA 3RJ2X 1OD5A 5A7WB 4MZUA 2WQZC 1JUIA 2CSGA 5DAXA 1JYCA 5FPVA 3K46A 5FP9A 3VDBA 3KT4A 1C8M1 4WM7B 3SEPA 2YHJA 2JDHA 2MEV1 4JRAA 4FPLA 1C28A 1W6QB 1O4YA 2VPVA 1HKDA 5FJKA 3V65A 3ZSLA 2MEV2 5CFDC 1UPSA 2IZWA 2PHRA 3QD6A 4FFHA 1LCLA 2D6KA 1SBEA 2KR2A 3AKPA 4HT1T 1UYYA 1VBB1 1OPOA 4JCKA 3T2QA 2EF6A 4PIXA 4TWTA 3WLUA 1JYNA 1TE1B 1XB9A 4I2OA 3LIHA 1FMD3 3FLTA 2UURA 3MLJA 2R0FA 2GNMA 4XQDA 2VVEA 3VBUC 1GNYA 1RITA 3FX3A 1DFQA 1YLLA 2WZ8A 4HSJA 1A34A 4CZSA 2HWE3 2R043 4YGCA 2DVDA 3MLLA 5C33A 3HQUA 4MGTA 1R091 4FOYA 1YFWA 5IAXA 4XCAA 1SLLA 2J1SA 5EYXA 4CUCA 5CKNA 1NX9A 5FUPA 1POQA 2DFBA 1NLSA 2RM21 3OBAA 4MGIE 4U2AA 4D69A 1QHDA 1G7YA 4IE0A 3I2GA 5KR7A 4YRDA 2VZ1A 4QQLA 1OT5A 4AHXA 4FOVA 4UOJA 3CQOA 3ZYJB 3T0DA 1D4VB 5FRAA 1RB8G 3RZLA 4LHKA 1W28A 1W6PA 5K0UC 4XIOA 2D93A 4PIZA 3WDXA 2JE7A 4N9HA 3VBSB 2VOXA 1LESA 4SLIA 2YB7A 1GWKA 4NVPA 1IPKA 2XLFA 5JOXA 4QDRA 2RV9A 1STMA 2A75A 3IDBB 2Y64A 4FXGB 3PJYA 3JBG1 1DLCA 3OSDA 4XF9A 1RUC3 2NMNA 2GC2A 1NXD1 1Q8PA 1AR91 3R05A 4RS5B 5CNAA 4E2QA 4FTBA 2HYXA 2RDNA 3SHRA 2WZEA 4GIQA 4PLNA 5I8TA 4PF5A 1SLIA 2XXZA 3CJXA 4TSVA 4BZ4A 4ZU7A 1HJGA 3CJIC 4UBGA 2EXJA 3BOWA 3FC0A 4XJZA 5T52A 5A1FA 1AR63 3SNMA 5JZGC 4XACA 1ODNA 4XFIA 2YZ4A 4YW7A 4RGGA 3WG3A 1W2OA 4Y5TA 3DEMA 4OZXA 3NSTA 1POV1 4MOAA 1W6MA 5DAVA 4AAXA 5JPNB 3RZMA 2CDPA 4MO3M 1EV11 3N9MA 5C3OA 4BMBA 3KGZA 1WW6A 4LNVA 3ACHA 3K75B 1LULA 3BKZA 1PNFA 4D6RA 1UYZA 4W6XA 3WG4A 1S55A 2FBEA 2VZPA 4Q8LA 1DZTA 1PVC2 2WR9A 1WLCA 1GOGA 1H0BA 1PIV1 2I74A 2RMU3 3H3UA 5IVCA 1H8TB 4GB33 1H4GA 2WLPA 2GC3A 1DYKA 5CFDA 4KL1A 1AL23 2ARCA 2VQ0A 3VZKA 4BH9A 1QOSA 4Y4RA 4R4ZA 3HNBM 5C3RA 1OF4A 3UK9A 4GZ9A 2BQPA 1PZ7A 4FOWA 5E6HA 5ISLA 2V72A 2DUPA 1YWKA 4ORFA 4R9BA 2V5DA 4Y1XA 4RQPC 1PGL1 3KCCA 5JOWA 5HCHA 3VBUA 4IV1C 2DUQA 3U11A 2FHRA 4A41A 1XU2A 1PGL2 3GJAA 5EIYB 5F3EA 2B9UA 5A7SA 4PLOA 4KNCA 5IFTA 4R4XA 3FHIB 1DU3D 1VBC3 2XBO1 1IHMA 2OX0A 3CEWA 4XW3A 3UGGA 3GBGA 2ZA9A 5C3SA 3URFA 5FYUA 2P4EA 2XBO2 4Y20B 1DZRA 1YO8A 3DKQA 3MIDA 3ZXKA 2W47A 1NE4A 1U0AA 2CL2A 3LA3A 3AZVA 4LJHA 2QQVA 1HN1A 3RYRA 3SXWA 4AFCA 4Q27A 3BALA 5FYTA 1LRHA 5K0UA 4UFMA 2VAUA 2ZHNA 3IMMA 3MIBA 2BFUS 2HLEA 2X53S 2AREA 4N43C 4R9CA 3AXDA 4G4FA 2Y38A 2HH9A 2VW2A 3FJSA 1ZZ7A 2XB6C 2YFZA 5IJRA 4AVSA 4Z2WA 1F4AA 4HN0A 4V2WA 1X33A 3GNEA 2D5FA 3MIGA 1G9FA 2V4AA 1LHOA 1EYBA 1Z7S1 3MBWA 1AUYA 5FKCA 5LW9A 1QDCA 3ZFFC 3CJIA 4ISRA 1FAYA 2XKPA 3RJRA 1J58A 5JZGA 1Q5OA 4YG3A 3RZGA 4OHWA 5CFCC 3RI9A 2QDNA 5GLZA 3I2OA 3BB6A 3BTXA 2R042 1LEMA 4YGBA 3B9CA 3WHTA 4CP9B 2ZX1A 3KV5A 2V5YA 4JC1A 4L9BA 2RS11 3IB3A 4FBFA 2VMGA 2XMLA 5FUNA 4HPKB 3KB5A 2VMEA 4XEZA 2XONA 5LA2A 1YFXA 2RS12 4HONA 4W6YA 4BDVB 5LA1A 5FXVA 4KWUA 4Y22A 4A45A 4Y5Z0 4FVVA 1O3QA 1IQAA 3D6EA 1CAVB 2D3RA 1Q8OA 3AZZA 3E97A 4HVOA 1UZZA 2I07B 4JHTA 3KV4A 3HQXA 2VCCA 5A32A 5KHJA 2GSYA 1LOCA 2RE9A 3W59A 1N3QA 2JE8A 4ARYA 2JENA 1JHJA 4AR2A 4AYUA 4K8RB 4QB2A 1W90A 1CZTA 2TBVA 2XJQA 4YZ3A 4D0QA 1OSGA 2Z79A 3AMPA 2OT7A 4YW2A 3SH5A 1J1LA 4RQPA 3GCWA 2XL9A 1VIWB 3CO2A 3HN3A 4CCEA 5FZ6A 2ORXA 4XURA 5CYYA 1ND3B 2VQAA 3HQRA 3RRDA 3ZO0B 4CDXC 3A21A 5A33A 1A8DA 4FO9A 1OKOA 2AGSA 3SCFA 4JGYC 2ZGPA 3C7GA 3FLRA 3PLQA 3AYDA 3HT1A 1LB2A 1Y9QA 1ZM1A 2FZ1A 2RHPA 2R16A 5EJZB 3KCXA 1XQNA 4X6RB 1VBA1 5ANQA 2O14A 3VBHB 5K7PA 1LECA 2XVGA 3EBRA 1BYHA 1D4M3 3MW2A 3ZMOA 2GALA 1UU4A 1MZFA 1MZEA 2VG9A 3BTAA 4NRQA 4X6QB 1Q43A 3GGLA 1SCRA 4N43A 4PIYA 2QQPA 2R1BA 2RMU2 3AYAA 1N3PA 4L92A 4XE9A 1LHNA 3RZHA 2F4PA 3AP6A 1UAIA 3S7EA 1ASJ3 5FOBB 1AL22 1BK1A 1CAUA 1PGW1 3MV01 3GCXA 2X5IC 3POGA 4LBKA 4RHV2 5EXOA 3VD9A 2OZ6A 5F6KA 3ZFFA 3S7IA 1VE0A 3NV2A 1J59A 1AYM1 5CFCA 3CBNA 4UF0A 1CAWA 2W1UA 2WKKA 4CU6A 4XCBA 1SPPB 1GICA 2QQOA 4OLLA 3T09A 3VZNA 4HN1A 2ERFA 1IS6A 4XZPA 2IWGB 2YU2A 2ZABA 4QX5A 4WM8C 2WNVB 1HQLA 1UOFA 2E6VA 4AG4A 1ND2C 3TN93 3NNJA 1GNHA 1UMZA 3I97A 1QH6A 4Q1PA 2CY6A 4JZRA 4IQPA 3H9AA 4ZS3A 4MVTA 2O8QA 4CCKA 3H1WA 4WVMA 2CGPA 3TNQA 2R32A 1UZWA 5T5OA 5HCAA 3CU7A 3FBMA 5F7UA 4EJRA 3RZKA 2V09A 1Z0HA 5K4LA 2G1MA 3Q8AA 5A6XA 3AVRA 4AVBA 5F6LB 4J6GA 4FTSA 4M3CE 2B5HA 3DF0A 1MS3A 1RGSA 4UW4A 3KGLA 4GULA 4A7ZA 4CEWC 2IXIA 1BEV1 3VHRA 3IZOA 2PAMA 3MV11 3MF6A 1VB4A 2VE1A 2WSVA 3TAYA 3RMXA 3UKVA 2A5ZA 2B39A 3OBZA 3G6JB 1HW5A 1F2NA 4CDXA 4GALA 1O8SA 1AVBA 4MV2A 5J98B 3VBFB 1O5LA 4MHUA 1RMU1 2WFPA 1YHFA 4JGYA 2FMDA 5AC93 4NHKA 1DQ5A 2QDRA 1CX1A 3PIGA 2RJ2A 4QX2A 1YQCA 4QU2A 1PVXA 1JN2P 1US3A 2PELA 3MLKA 4BQ5A 1D7PM 3HOBA 2YU1A 1D2SA 4IE6A 1JZ4A 3ZOIA 1DYPA 2QBXA 2VZQA 5LK5A 3N36A 1YEWA 4NHYA 1FOD3 4FPFA 2VZTA 1AYN3 4LO8A 3WVJA 3NO8A 4GWJA 1COV1 3ZXJA 1WMFA 2JJ6A 3HPNA 4N8MA 4YFWA 4AEDC 2JDPA 2D6PA 4TXWA 3ZFGB 4AVVA 4YW3A 2Z42A 3WDVA 2VZSA 2ZPXA 4HVRA 1TG7A 5LB6A 2ZGSA 5L19A 1WKYA 4F7ZA 1RUI3 2W5FA 3A7QA 4AFBA 2EXIA 2VW1A 2AZ5A 4PQ9A 3LFMA 5A6QA 3NWKA 4AFMA 1JZ3A 4A42A 3MEPA 4MGKE 1UXXX 4CP0A 4AQTA 5FYMA 4EN6B 4BE3A 3GM8A 5C9AB 2VMFA 5K9YA 2C1FA 4I30A 4IV1B 2RS33 4CPBD 1IGOA 1WWYA 4WVZA 3WV6A 4DRVA 4D8MA 1AZDA 2Q30A 2WA4A 2FQPA 3LEMA 1VAVA 2YROA 3ETQA 3ZDSA 3KV9A 3M3IA 1KD7A 3NJVA 4XTPA 5I8SA 1URXA 2K2SA 3VHPA 1UZVA 4M3CA 1EAH3 4WM8A 1GSLA 1UY2A 3NNFA 1ND2A 4AK3A 5L9VA 1RUJ3 2N7GA 5AFEA 1UMIA 3WHUA 2ZCWA 2OKXA 2C6SA 3TEZA 4COVA 4QM8A 3ZSJA 2HBTA 1OUXA 2JB8A 4QX8A 2WO3A 4RGKA 1JU4A 3UNPA 5HV0A 5B4XA 2BUKA 2OVUA 1U5IA 1NA1C 2XOMA 2YPDA 3OGJA 5GJ6A 3HT2A 1NZIA 1GQPA 1TVGA 1IS5A 2WT2A 3POFA 5FREA 4CEWA 1ASJ2 1YYNA 2ARBA 3S5QA 4IW3A 4B1MA 2VULA 2FD8A 2K0GA 3WQBA 3WP6A 1HXS3 1HQWA 1LJ7A 3AL6A 4CSWA 2PAEA 2KXLA 1KRIA 1ENSA 4HKWA 4WZCA 3KWVA 5A7OA 2DU1A 5EYYA 2VR4A 4Q4V3 1XE7A 3OGVA 3DCQA 3KMHA 5IK7A 4Q2FA 1U5YA 2WAOA 1RXFA 3W20A 1UX6A 3AK0A 1UXZA 1YQ5A 5DZEA 4AEMA 2YG0A 2HEYF 1J3PA 1NYWA 1JOJA 3KHBA 1BVP1 2LALA 5IUQA 5FCCA 4WM7C 3TYJA 2DVGA 1CWPA 4Y26A 4NHXA 4GWIA 3SLIA 4UFJA 3TN92 1SG3A 4V2VA 2PFWA 4MYEA 4AEDA 5G04L 1I3HA 1VBE2 3DYMA 1H4HA 2DVBA 5T50A 2Q8CA 5KHKA 1JZ7A 3FBYA 3U75A 4C90A 1ZYBA 3IIAA 4E4ZA 4RD7A 3GXUA 3AMMA 2VOKA 5A3UA 1TME1 3O0XA 1CZSA 4IGPA 4YG0A 3U07A 4FAHA 3ZYPA 1OOPB 2JKBA 3MF9A 1W99A 1REFA 4G3YC 5LA9A 1KGYA 4K3UA 2R30A 4LBQD 2JD9A 2VVDA 1YJLA 1YNAA 3VZLA 1I5PA 1XSQA 4HG6B 4AVTA 3ACIA 4QXBA 5JPMB 1UY3A 5DQ0A 1DIWA 1JTZX 4FQ4A 4NN0A 4YM2A 4GXLA 4XUTA 5AC92 1LU2A 3QLQA 4DPNA 1Q8SA 4NJ4A 3PURA 3MUZ1 1SBDA 2DCYA 4PQQA 3W58A 1HB3A 2HWC3 3DYPA 2Y6LA 2W1SA 1CJPA 2D6OX 3VBRB 3LF7A 4NAOA 3VBSC 1RUD3 4AGRA 1ZREA 1FOD2 1OQ1A 1DBNA 2EAKA 1PO11 1WD4A 1NA1A 2YBSA 3AMQA 5FAXA 3UJQA 1MS8A 4UT5A 2EIGA 4W6WA 4YW1A 1RUNA 4RS5C 4FPEA 3V0BA 1T6GC 5BUVA 1H1MA 1AX2A 4AHWA 1WCUA 4INDA 1JZ5A 1RVF1 4NPMA 2P2KA 3KVAA 4HZFA 1RVF2 2BNMA 1K42A 2JX9A 4NWVA 1OA4A 4DFSA 1UIKA 2VC9A 4D7YA 1XBFA 2RS32 3T08A 2IXHA 4E27A 4QQOA 2BPA2 1L7LA 1D0GA 3NJXA 2BGCA 4I0BA 2Y6HA 1K5MB 5A7WA 1PO21 3PMSA 4YSFA 2GP3A 3DKWA 2GAUA 3OUIA 3PU3A 1K3IA 4WM7A 1OPMA 2VTXA 3O1UA 5L7OB 3HIFA 4YLZA 2Y6FA 3LGRA 1H8TC 1QF3A 1W6QA 3MFAA 4YVWA 4CP2A 4NIDA 3B93A 1MR5A 4M0HA 1V6OA 2B7YA 4CRQA 1DGRA 5DDJ1 5FMCA 1AR83 4K1YA 5FZOB 1G9AA 1W8WA 4Q4W3 1LOBA 3AVSA 1TQ5A 4ZXEA 1XNDA 2W3JA 1LEDA 4QPWA 3SCGA 3U14A 2JDMA 4DMIA 1WCKA 1GUIA 1RL3A 2CGOA 2A6WA 3FUQA 5FPZA 4L97A 5BPXA 3UGHA 3WG1A 4CCOA 5CEHA 4QKBA 2WABA 2IC1A 2HEVF 2P6HA 1GP5A 3AKRA 3LCPA 3POEA 3Q8BA 1FATA 4RFRB 1C8M3 5DAPA 3SKJE 4HSLA 1HIXA 1R1A1 4MGYE 5FZHA 1QNWA 3RVHA 1UWWA 4D7TA 2RJKA 5F5AA 2JDKA 1ULEA 1QJEA 2HYKA 5IVEA 2RG4A 2PLV1 4BXFA 2W1QA 3OJBA 1FPN1 4ZHNA 1OD3A 3BPZA 4QGLA 5BNQA 1FPN2 2EXKA 2HWD2 1S0FA 1EP0A 5FP4A 2HWF1 4O65A 4IEPA 1RHI1 2D6NA 4K9SA 3KCYA 4I0AA 4LOSA 2A6VA 2VVFA 3AZWA 3VBSA 1RHI2 1H6XA 3AL5A 3BN6A 4OQ9A 4HKLA 1RC6A 3MDPA 2A3WA 4Q4X3 1GV9A 4FTEA 1UY1A 2ZGUA 1T6BX 3JUUA 1BBT1 4NIIA 2GNBA 2VMIA 3TEXA 2R7EB 2WFF1 1G9DA 4M01A 3NAPB 5CG9A 1BBT2 2PHFA 2RM23 2ZGNA 4XYXA 2WN3A 1W6NB 3SITA 2DURA 2JDUA 3NRUA 4RS5A 4E4DX 1V9U1 5IATA 5A1LA 3CHXA 5LRSA 2JE9A 3BIEA 4FPKA 2XVLA 2Q8EA 3NV1A 2EXHA 4LA3A 1H2MA 3OPZA 4W8JA 3WW1A 5FZLA 3ZSMA 1ZVFA 3I59B 4OFGA 1DHKB 1NQDA 3C7HA 1HRV3 4QPGB 2Z69A 1Q8QA 1ZBA1 3EHKA 2NLRA 5BNOB 5GLWA 4CP1A 1HV1A 4DB5A 1UPIA 1LAJA 1B09A 3LKJA 5D8AB 3PU8A 1WCSA 1IOAA 4GAZA 4DXZA 1QEXA 4M4RA 4DRRA 1XYNA 1OF3A 4JV4A 3VBOA 1KJRA 2VUDA 4JAAA 1RINA 2OQ6A 1E5RA 5DUWA 1V00A 4P08A 3H8OA 4P9IA 2WZR1 2W9XA 1GYKA 4P9JA 1W0OA 1H8TA 1W9FA 1YJKA 5JLVA 5HI0A 5T54A 2HWC2 2P37A 2ARXA 1X8EA 3OEAA 1S0CA 4LMFA 1RUD2 3AP5A 1VBD3 5EPAA 2W39A 4XBQA 3DXTA 2BJSA 2VZRA 4AHZA 4DINB 5DMYA 2MHFA 1E5IA 1W9YA 2D6MA 1IG0A 1JYVA 1LR5A 1X7NA 3GZUC 3BODA 3VZMA 1XNCA 2VD7A 1Z78A 2VL4A 3JZVA 1CZVA 3GDBA 5FXWA 1X9PA 1MEC3 2E7QA 3WD5A 2BDRA 4RSUA 1ND3C 2UY9A 1T2XA 2PHWA 3JD71 4WVVA 3J8F3 5CU1A 3N9NA 4DUXA 2P17A 1PM4A 3L2YA 3ILRA 4Y20A 4S2FA 1MVQA 1GZ9A 2EIBA 1IG3A 1PM7A 5FMOL 3VBHC 3HJRA 1RUH2 3W21A 4ARXA 3ACGA 3WP3A 2ZX2A 5FYYA 2CGNA 5K8SA 5LA0A 3CZUA 3HR9A 3ST7A 2W52A 2RR11 3VD5A 4KWJA 4MH0E 1AX0A 5J36A 3AYEA 1YQ6A 2EICA 3D82A 2RR12 3FL7A 1WA6X 4LOTA 4MXWB 4ASLA 5DUXA 4H14A 3RSJA 4JTOA 5H9QA 1SEFA 2YC2A 4BIFA 4XTMA 3OY8B 1V6JA 3C2UA 3Q8CA 3V56A 2VW0A 3RNSA 1QJY3 4JX0A 4C0BA 1UF2C 4NIHA 1LGCA 2HWB3 4BK5A 3WDTA 4LBQB 4LPLA 1AR82 1A3KA 1QWRA 2K46A 4Q4W2 4QQ2A 4A2UA 1BJQA 4EZ4A 2ILMA 4EWAA 5JOYA 5FYSA 3AKSA 1JYTA 3KLSA 4XETA 3MO4A 2ZXQA 1JYXA 4N7UA 5JSPA 3U0ZA 2ZTNA 1UMHA 1JOBA 4Q5OA 2JEMA 5FR3A 1HLCA 3J26N 4CP9A 3PUIA 4XUOA 4ES8A 4LBLA 4HPKA 5I0UA 3X29B 5JOZA 1UW8A 2WNVC 2R073 2WL1A 3K4ZA 1BLZA 4ZKTB 2YMZA 1O8PA 1I1EA 4HBNA 2BOIA 4Y1UA 5FYVA 2ZMNA 5D21A 2QQKA 1F35A 2EIEA 1CAVA 4IEWA 1JBCA 1QQP3 3KVBA 4NPLA 2EAAA 1REDA 1NLRA 4DXTA 2WRAA 1V0AA 4LIVA 4YGDA 3NJYA 4Q4X2 3L9JT 5FZIA 5C8CB 4CU8A 2VNGA 1RUF3 5IFPA 5FZ8A 4FFGA 5A6ZA 5JUVA 2BYVE 2VZVA 3B69A 3F2ZA 5FZCA 4YWAA 1ULOA 3OBRA 1SLCA 2Q8OA 1ND3A 5FYIA 2VOTA 4LTAA 3ACLA 3KT7A 1LOEA 1WCQA 1SDDB 5A70A 1L3JA 1C5IA 2J1EA 4ZS2A 1PX3A 1Q3EA 1GZCA 3VBFC 1ODMA 5IK4A 5GZEA 2VM9A 1R083 1OMIA 2F6BA 2Y8KA 3KV6A 4XXPA 3ZYHA 3WW4A 4DUVA 1RUOA 1HRV2 3WF1A 4PCRA 1NLQA 1H2LA 3VBHA 4UW5A 1PX4A 4LKSA 3KHCA 5FZ1A 2ARAA 1AX1A 1PVC1 3I4IA 1KFUL 4BQWA 3C7FA 3HD8B 4URTA 4EN9B 1XRUA 4QMAA 2MNGA 2GH8A 2XUMA 3H3ZA 3HN1A 3RGBA 1I6XA 4G9SB 2JDNA 2PA7A 3SKVA 3U4SA 3WDYA 1PK6B 3WF3A 3ZFGC 5JXGA 4AVCA 1JZ8A 5BYNA 3AJYA 5FPLA 4AAPA 3BTYA 4KI5M 5L73A 4IGQA 3WW3A 3HVDA 2ZGTA 4LBJA 2IUWA 4MLOA 2ADEA 4Q0SA 4AE2A 3ZYFA 1S0JA 2P3JA 2PHXA 5A3OA 3WCRA 3WDUA 4NMIA 2UWAA 5C9AC 1FV2A 1W8UA 1VPHA 2AH2A 2C9AA 5E89A 2WO1A 3M3OA 2VZOA 2Q0AA 4MUVA 1W0PA 3FFQA 3HNYM 4MGZE 4COWA 3CLPA 3T4VA 1YI9A 2OZJA 2E26A 1PZ9A 5CKMA 1MEC2 4B7KA 4UXAA 3PVOA 4CDQB 1BKZA 4S2DA 3SMHA 4Q4Y3 5HV4A 2VZUA 4BJ0A 3J8F2 5FWEA 1HB1A 5DABA 1YFUA 1E5SA 4NRPA 1SQ4A 2JG8B 5CKQA 5A7NA 4AI3A 2WNVA 3EXUA 4HETA 4HOOA 3VKFC 3H7JA 3H7YA 3IDCB 2Y6JA 2PXJA 3WF2A 1UY4A 4TTGA 2TUNA 5KBFA 1QH7A 1L7QA 1AL0G 4YG6A 3W5NA 3WR0A 2WIIB 4AF9A 3MI8A 2GH2A 4TYSA 5ABJB 4NWWA 3LE0A 4QB6A 4MX3A 2D97A 2R063 1QU0A 4P9XA 3U78A 4HLTA 3DECA 3ITQA 3PUSA 5FZ9A 4DY5A 1WCDJ 4BYYA 4QGNA 4BB3A 5A3WA 1QY4A 4W65A 5T5PA 3H1YA 1QJY2 3BOPA 1W3VA 3ZMNA 1X50A 3PMEA 5AVPA 5BNPB 2P5BA 3E5QA 1NCRB 2R6QA 3MGUA 3POYA 4I0WB 4CEYB 5A7PA 2HWB2 5JI7A 1C4RA 1FMD1 4EN0A 3SH4A 4TLFA 4A4AA 1FMD2 3VBFA 2HWE1 2R041 3WT3A 3QH6A 4BK4A 2XL7A 2WO2A 2NZ9A 1JUHA 3IMNA 4FPCA 2GDFA 2HWE2 3M1HA 2W95A 3FFZA 4GJZA 4LLOA 1DQ4A 3CDZB 4I01A 1B35C 2NQYA 3AMHA 1S2KA 4QPYA 4AVAA 2WINB 4OCTA 5FBZA 3NV4A 4EYUA 2GMEA 2KD7A 5BNNC 1QIQA 2WUHA 3JCIA 3UYJA 2XGXA 2R072 2Q1FA 2UY8A 4EQVA 5JR2A 2CHHA 4XF1A 2WS93 3ZYGA 1UIJA 1CPMA 3RYKA 1M4WA 4UFIA 2W92A 4LXLA 4Q26A 1GP6A 1IKQA 1YC61 3ZFGA 4LE3A 1RMU3 5IVBA 1NG0A 3VL9A 4AXOA 3FE5A 4AQ6A 2OQ7A 1G9BA 1X36A 4CDUB 1RUC1 3MPPG 3WQ7A 3TEWA 1DDLA 1BK0A 4LORA 1RUC2 5F2WA 1RUF2 2Y34A 1OOPC 4IV1A 4YYOA 4HL0A 4S2HA 2KM2A 3OUHA 2E31A 3LDBA 1OXCA 2R1DA 1A6CA 1AXZA 2C4XA 4YZ5A 1AR61 1W05A 1UOBA 1ZRCA 3O1PA 1AR62 2O8OA 5FZBA 5ACA3 1R082 3WX5A 4CXXA 1VMFA 2VBDA 3VLBB 4K8FA 1BXHA 3MPBA 3WNPA 3VBRC 3LPGA 4KG0A 4ZZ5A 4IL7A 2NM1A 2WT1A 3M7AA 4H55A 2IFRA 1D0HA 3PVNA 4A3XA 4BQXA 1YQ8A 2RMU1 3GZTB 2H0BA 3T1MA 2W91A 4GB31 1UKGA 4P5YA 4C1WA 4Y4YA 3F95A 1Q56A 1AL21 1OLRA 2W1WA 2A3XA 4GB32 2XUEA 3TOJA 2VNOA 4RHV1 1WLTA 2BEOA 1XNBA 2J1UA 2BV4A 2D6LX 4D94A 1BMV1 5DN2A 2PYTA 1DCSA 5JXJA 2DCZA 2XDVA 1OVSA 1W8NA 2VGDA 4XUNA 1BMV2 2RJLA 2UU8A 2ZMKA 5FY8A 3VZOA 1KITA 3CKHA 1MPXA 4GWMA 3THCA 5GLTA 2A73B 5GKAC 2QVSB 1JOPA 2E7TA 5IT6A 4JKLA 1LHUA 2WNOA 4BA6A 2H0VA 4ISQA 1ST8A 4MGQA 2VNVA 1VBC2 1K5MC 2A6XA 5FZ3A 4LT5A 4HK9A 1DGWA 1RJ8A 2VCBA 3FMGA 5I0RA 1OHFA 2BU9A 1F15A 3LPFA 5BNNA 3KQ4B 5KC6A 3ILNA 3AP9A 3WNMA 3PVEA 5L7OC 1ZRDA 3RMYA 1H2KA 3E6DA 4NROA 2DVFA 1VALA 5FP8A 1REEA 4L2NA 2VOWA 2DV9A 1MZ6A 4Q0QA 4AWDA 3UGFA 4FFIA 2ZGOA 5EWSA 3WINE 2XLAA 5FFOC 4A6OA 5LZ6A 1XYOA 4XFFA 2R062 4UW3A 5BY5A 3GHNA 2WN2A 5FP7A 4ET7A 3J7MA 1LTEA 1GZTA 1WW4A 3ZX7A 4COYA 1HQNA 1OOPA 3O1TA 4AGVA 4XQ4A 5JIUA 2J1RA 3JB4C 3K3NA 4RN5A 3AZXA 5CAZA 4HK8A 4Z92B 3ALQA 5EV7A 2FDFA 1XNAA 3NMBA 4CE8A 3PL0A 5FZMA 3VHNA 2E53A 1RUG3 5FLJA 3RQ0A 3POIA 1V6LA 2Q8DA 4C0HA 2BNNA 3DUIA 5E16A 2X09A 4R8HA 3CZJA 1H6YA 4OI1A 3VBRA 3MIHA 4XF4A 2ZKNA 3L2HA 4TLGA 3ZN6B 4IV3B 2JDAA 1HV0A 2G9GA 3THDA 1R64A 4B29A 4ZONA 1AR73 1VR3A 3KZ4C 3OB8A 1L7RA 3QBQA 4MXVA 1HRI3 3VN4A 1Y4WA 1ZX5A 1S1AA 3NAPC 4OHVA 1K12A 2YXSA 4GQ7A 2YV8A 2BGOA 2QCSB 1W8FA 2CAUA 2VUJA 1VP6A 2Y6GA 3OCPA 4M3CF 5IW0A 1HJFA 1US2A 3K3OA 4OHXA 5H9PA 4B4RA 2X5IA 2VY0A 3O14A 1SFPA 1DLLA 2DDUA 5L9BA 2H6BA 4LO4B 2BWAA 5FK8A 3TNPB 1MS5A 1GZWB 1DG6A 3OUJA 3Q8FA 4JKKA 4QPGC 1LENA 3R4SA 5GM0A 5D1IA 2DVAA 2D40A 1ZNPA 2P34A 3A0NA 3PUQA 5BNOC 1Y9MA 4KGQA 4KBZA 5IWFA 3K4AA 3VKOA 3AJZA 5D8AC 3VD4A 5IK8A 1UQXA 4UFLA 4DOUA 5FO8B 3O5SA 4JGZB 3WQ0A 4CCCA 2SLIA 3A23A 4LBMA 5DZFA 4URAA 2BVBA 3PJQA 5L7OA 4E8CA 4H7LA 1D4M1 3ELNA 4J1XA 4EN8B 3N7MA 1UZYA 2CV6A 2IFWA 2WDBA 4O9EA 2E9QA 2BBVA 2JG9B 1GWLA 1ZRIA 1D4M2 2JDYA 3FLPA 3N7LA 1JMUB 5F2SA 1VMJA 3ZLIA 5LY1A 2DUOA 5FZOA 1GQGA 4IEXA 2DCTA 2DCKA 4AEJA 1O4ZA 4E4SA 4O9GA 2XJUA 1C8NA 1ASJ1 3TRSB 3BPSA 2GZWA 3ZDVA 1H2NA 3I2KA 1WW7A 1TNFA 3P3NA 3VDDB 2FCUA 1N1SA 1U5ZA 2ZMLA 2ZOEB 3AZYA 4FPJA 4U36A 5FZKA 5FYZA 4L11A 1ZBE3 2RDQA 1JH5A 1UNBA 2RS53 2J1TA 3GBFA 3SQOA 1WLWA 3RS6A 4M00A 1UOJA 3EMRA 4BLJA 3D5OA 4LBOA 1DGLA 3T30A 3OEBA 1Y3TA 1QKQA 1GU3A 1B35B 2DTYA 5LBBA 3PIJA 4CUBA 3I3QA 1QJU3 5FBJA 3E6BA 4MSVA 2WNUB 4BQ1A 4GMP0 3M4FA 5CB7A 3TN91 4HKOA 3VV1A 3WXPA 3ZXFA 5FTTC 2F4LA 4YM1A 4NHMA 2BNOA 1VBE1 3OD4A 4J25A 2V73A 5B4NA 5GZCA 4Q1RA 2LW8A 3NAPA 2W2IA 3I2DA 4BQYA 4YFZA 4QKFA 4GWNA 1DQ0A 4CPBA 5L36A 1W6NA 2PLV3 4EROA 2LTNA 4ZU5A 5FPBA 3APBA 2FDJA 5CZKA 5I0DA 4XFHA 3S30A 3CNAA 3IN9A 5T5JA 4KG8A 5FZGA 2O0OA 1NT0A 2VBBA 1LNSA 4BLIA 2XJPA 1F9KA 1MACA 1RIRA 3I59A 1G9CA 5DUUA 2D98A 4BQ2A 4QPGA 4Y1YA 3SH3A 1NUKA 4OUSA 4KU8A 4BMEA 5BV6A 1NKGA 3R4UA 4N90A 4PDWB 4Z82A 1UL9A 2WFF3 5D8AA 2BGPA 1JZ2A 1A8MA 4Y1ZA 5AC91 3VKLA 2X05A 3N9OA 2JB4A 5J96B 5LK7B 1SCSA 1RUG2 1V70A 2ZGLA 4B8EA 3ZN5A 3FWEA 2ZJCA 3AP4A 2P3YA 3MFCA 4NE9A 2OA2A 4LE4A 3ZKUA 5GZGA 1FOD1 1C1FA 1AYN1 3MYXA 4E2GA 1AYN2 3AX4A 5FQ0B 5C8CC 2CDOA 5T5LA 3IAQA 3ZM8A 1AR72 5F8PA 1ZRFA 1HRI2 2XQXA 2BVVA 4NAMA 4XF0A 1VB2A 3MHZA 1CVNA 3B9IA 3WP4A 2ETEA 4I3PA 2DF7A 1RUI1 1SDWA 2LUWA 2VCAA 5EQUA 1S2EA 2WSUA 3D0SA 3OTFA 1RUI2 1IPJA 2NMOA 2XQRA 3NNGA 4JDNA 1IPSA 4SBVA 2RS31 3K48A 3M3QA 3M70A 2AACA 4XFGA 1WMXA 3C7EA 4QQPA 4QX1A 4EWDA 2TNFA 4XDPA 3FHQA 3D4KA 4XAAA 1CAXB 1KDMA 2KA3A 4OULA 3QH7A 2J1AA 4KBBA 2VUAA 1BZWA 1CESA 1EAH1 2QQJA 1GMMA 2WBKA 4I09A 4MXWA 4DQAA 1RUJ1 4CUGA 3AKTA 2JDZA 2Q1ZB 4IE7A 1EAH2 1TMF3 2QKDA 3HMYA 4R9AA 1RUE3 3N4MA 1RUJ2 2QE3A 5FY9A 3O0VA 1PK6C 2VTFA 3HBKA 2WZPP 3D0JA 4IDZA 5C5TA 4QHOA 1M06G 1PMJX 1S2BA 2BWCA 3ZKYA 5H9RA 1JZ6A 1BHGA 3CF6E 5C7GA 1WBLA 4JTNA 4LBQA 4W4ZA 3LZZA 2Z4FA 1TEIA 4KWKA 2G9ZA 5SV8A 4BM8A 5KC5A 1QJX3 1VRH3 4ZY9A 4QU1A 2LRPA 2B46X 5FZ0A 4NHLA 4XF3A 2GMPA 2VMHA 1GLHA 3VUOA 4RR3B 1S0IA 1OUSA 4HVQA 2JICA 2PAKA 2C0ZA 4CDQC 1FNZA 1NCQB 4IEVA 1ZZCA 2MEV3 3AP7A 3TB0A 2C9KA 1HXS1 4YZ2A 4E9KA 2C5DA 4BQ4A 2EVXA 5FY1A 1W6OB 1HXS2 2YBPA 1F5JA 2JG8C 1JU3A 1V6IA 3M8LA 2HWD1 1OA3A 4WZFA 4Q4V1 1VBB3 1N1TA 1XPWA 1KDKA 2RS52 1NE6A 1LOGA 1W8TA 4OYUA 4AL9A 2ZBJA 4IEOA 4DUWA 5FYCA 4Q4V2 3V0AB 4D6SA 3ME2A 3NQHA 2HJIA 4LO7A 2UWBA 2D5HA 4BHPA 1YCIA 2BOJA 2I2SA 3LB9A 5HBAA 1QJU2 4GKXA 3ES1A 5KHIA 3KS7A 2VO5A 5ABJC 1Y43B 1R093 3VGIA 1VAKA 1PMIA 3JQWA 4XJ9A 3P6BA 5C8CA 1R1ZA 3FUOA 1SHWB 1W06A 4FSJA 3NVCA 4YZ4A 1ULCA 3I3MA 2XVKA 1WW5A 5BNPC 5FZEA 4CEYC 1NCRC 4LEJA 2HBUA 3RWNA 5JI9A 3ORJA 4P9GA 3GALA 4XFBA 5C71A 1JYIA 2VBPA 1I9RA 4YM3A 2IXLA 3WNNA 1WMEA 1XYPA 4DXSA 5IK5A 1ULFA 5JWPA 3I7DA 3N35A 3JBG3 4WV8A 1VMHA 2QQMA 3O1MA 4GJYA 3ZPOA 2RDRA
chains in the Genus database with same CATH topology
3ZIXA 1AR93 3DPRB 1NQJA 4LO6B 3R4DB 4META 2WA3A 2XG3A 2HWC1 3WNXA 1LU1A 1FV3A 1XXNA 1PK6A 1QXPA 1RUD1 5DXDA 3POWA 3GBWA 2XJVA 5JVVA 5DG2A 1POV3 4CDUC 1S0GA 1NZCA 1EV13 4GMP1 2D43A 4M0NA 5I93A 2ZZJA 2X29A 2EALA 1ZRRA 5DG1A 3V64A 4X8PA 1H9PA 1UU5A 4CDQA 2CWSA 1PIV3 4Y1VA 4XFAA 1Y7BA 3ZFEB 4COUA 4DZGA 3N3HA 3PHMA 3WQ1A 1O3RA 3BCWA 1HX6A 1OKQA 1GQHA 2DWRA 2JG8A 1RUH1 1BVVA 1VAMA 2W0XA 4IESA 2ZKLA 1YRZA 2AR6A 4K1ZA 2ZGKA 1O5UA 4KQ7A 3MIFA 3NL1A 4ATFA 2G4IA 4QD2A 5ABJA 1DQ2A 2GC1A 1LKNA 2ES3A 1AF9A 4FPYA 1TMF2 2XBO3 1RUE2 4QHBA 1H30A 1AR81 4Q4W1 5BNPA 4CEYA 1DGWX 1NCRA 2SBAA 4AGGA 1O7FA 2PHDA 4P9LA 3UL2A 1QJX2 1VRH2 3EJKA 4FP3A 5JSRA 3IPVB 2VOVA 1U12A 1ULGA 2X8KA 1C8M2 2G9FA 4YVWB 5HXVA 2H6CA 2WJSA 5KXEA 3JQXA 5CADA 4IERA 5I0SA 1A78A 5FO9B 1UN1A 4XQWA 2XWBB 3WW2A 4Z8BA 2ZGQA 1VBB2 1Z7S3 3OYWB 1YUDA 5FO7B 5F5QA 1G6NA 3ZSKA 4GH4B 2NP0A 2E7AA 1ENXA 5FMOS 4Q4X1 4X8NA 2YGMA 2UWCA 2GU9A 2CYFA 2CTVA 3AM2A 3AXEA 3EQEA 4JQRA 3WZ1A 3DN7A 3ECQA 4FXKB 4XHXA 4CDUA 1R092 4BCUA 2RS13 3PNAA 2RM22 2XH6A 3H0OA 3GZAA 2A6YA 4DY3A 2ZHKA 3TWIA 2QNKA 1AXYA 4LHLA 1APNA 2FMYA 4QM9A 2GN7A 4HMZA 1O3SA 5C4WB 5J37A 1WD3A 2Z5WA 1HRV1 2ZAHA 1WUVA 1N1VA 4JVAA 2O1QA 1IS4A 4FCAA 1CJDA 2EA7A 1H1AA 1SLTA 4CDWB 4XJWA 2Q1MA 5HCFA 1MS1A 2GN3A 4L99A 5DUVA 3JBG2 4IV3C 2ZX3A 2I45A 1AR92 5KWRA 2PHLA 3ZPYA 4QPIB 4XBNA 1VBD1 1BQPA 3ATGA 1ZA4A 3B3QE 1MQTB 1VBD2 1VBA3 2BFUL 3USUB 4AI0A 5KXDA 2A7AA 1EV12 4EWEA 4QXKA 1AXKA 3VBOB 3VKMA 1MEC1 3B00A 3NV3A 3J8F1 4LHNA 1FX5A 1OFNA 2HKXA 1PIV2 4I3GA 1CN1A 4ES9A 4JGZC 2OYZA 4N53B 2P3IA 5JMCA 4AHYA 4QGMA 5FOJB 4RHV3 5TSWA 1OQEA 3SISA 3JB8A 5I8YA 4E2SA 2JG9C 4LUMA 2PQQA 4Q0VA 4WBBA 4ATEA 2AENA 1AYM3 4NR1A 3B01A 2HEWF 4YVSB 1LGBA 5CA6A 1QJY1 2PN5A 3MW4A 4EN7B 1I5ZA 1XE8A 2YDEA 4AW7A 1UKRA 2HWB1 3RYPA 3GYDA 4C1XA 5I0TA 1KS5A 3VDDC 4ASMB 2YGLA 1OLQA 1FYUA 1IS3A 1KQRA 4KU7A 4KWLA 1MVEA 5GZFA 4BIOA 3IBMA 1CX4A 3A0KA 1WLDA 2OUJA 2WNEA 2Y26A 5J09A 1CONA 1MS4A 3ROUA 3D8CA 3AFKA 3R0RA 2WNUC 2R071 3ZN6A 5JIAA 4IV3A 5A3MA 1DGRN 3ZXLA 1BEV3 3B7MA 4YNIA 1X8MA 5H9SA 2DU0A 2IXJA 1QQP1 4F83A 4KGGA 1Z7S2 2Q4SA 1N3OA 5EFUA 3INAA 1QQP2 2NN8A 3LSDA 3IWZA 3ZXGA 3AKQA 4YARA 4R9DA 1YFYA 1RUF1 4FPOB 3WG2A 4B4QA 4PJYA 1GZWA 1DQ6A 5C9AA 3CL1A 5FDBA 3RZZA 3Q9OA 2JECA 4LULA 3ZVXA 1GKBA 1COV3 1G86A 1W6PB 4PDWC 1JXNA 4BOWA 1R081 1O4TA 4JGZA 1CR7A 1H1IA 3KT1A 4CTEA 2UYAA 4AI8A 3NW4A 4S2GA 1QOTA 4L8QA 4AFAA 3AFGA 2JG9A 1FXZA 3LOBA 3RI8A 3KQRA 2OUHA 4ONUA 1VLNA 3J4UH 2VNRA 1DZQA 3MIEA 4LUKA 3B5LB 3QACA 2VH9A 3MICA 3WOGA 4D7SA 1EPWA 4XBLA 1W6MB 3ZYRA 1KXGA 1QOOA 4RGAA 1E57A 2A70A 3VZJA 3GHMA 1UD1A 4OVEA 2B45X 3VDDA 3W9AA 3ZXEA 4XDQA 2NPIA 3VKNA 1VBA2 1ENRA 1SFYA 4LLFA 5B2GB 1ZZ9A 3LWCA 2CNAA 1VBC1 3HAGA 4FOQA 1EPZA 4Q4Y1 2XPJA 4COZA 4A7KA 5CFDB 1OQDA 1B35A 5GALA 4Q4Y2 4OUMA 3E5XA 3I54A 2WNUA 3KD4A 1IZ3A 4XMIA 4FT8A 1PGW2 1LOFC 1J1TA 2XWJB 3VBUB 4LBNA 3AB0A 4UW6A 2YYOA 3GF6A 2B8MA 4OI2A 2R061 5F1RA 1AYM2 1XNKA 4OHYA 3USSA 3T1LA 4K6BA 4RR3C 3LAGA 4Z1VA 3C3VA 2VXRA 1DQ1A 1AJOA 1NCQC 2A6ZA 3UKNA 4FQZA 2ZX4A 3O7OA 1VBE3 4IXLA 5LEJA 4PDWA 2AYHA 4RFT0 5K0UB 2A71A 3VL8A 2OW4A 4N9IA 2YUEA 4P9YA 1SMVA 4AI2A 3S6PA 4YZ1A 4QT6A 1NOVA 4JRLA 5A3LA 3O0WA 1N47A 5CVRA 1CQ9A 1TME3 3NJZA 1CGPA 3LA2A 3E6CC 3OBTA 4XJAA 2BTVC 1BEV2 3BU7A 5FQ0A 2WS91 3CJIB 3WUDA 2D44A 1Q8VA 1ZZ6A 3LA7A 5JZGB 2WS92 4IEZA 5CIRA 3ZIWA 3O12A 1C5HA 1PNGA 5GLVA 1HDKA 2JD4A 4DNYA 3M3CA 1RMU2 2XJTA 1JHNA 1QGLA 1OFSA 2ZZQA 1PGSA 3I8TA 2ET7A 2GC0A 3QCWA 3JU9A 2CAVA 4Y22B 1ONAA 2B42B 4Y24A 3MZHA 1J3QA 1CAXA 3LSEA 1PO13 5A32B 3T2TA 1G8WA 3WY6A 1COV2 1MS0A 4AQSA 4R52A 4XHBA 1GANA 5ACA1 1K5MA 3DPRC 5ACA2 5E1RA 3H50A 1RVF3 1S0BA 4QQHA 1LOFA 4RQPB 1W2UA 1QMJA 5AFBA 1ENQA 5KHHA 1MS9A 4PLMA 4OHZA 5C8WA 2MPFA 5EZWA 5A33B 3IDEA 3K51A 3OGGA 2P3KA 2JXAA 3HWJA 2WLQA 4P5HA 4C91A 4XPVA 4EV0A 2ZACA 1SFNA 2XKOA 2ZS6B 2QJVA 4RR3A 1KFXL 1PO23 2GMMA 4ITCA 4K40A 4XJUA 5KXBA 4XMAA 1NCQA 2XJSA 3BIWE 3IM0A 1QXJA 4UBHA 3ZFEC 4CYDA 1QJZA 1ALYA 4I02A 5AVAA 1QNYA 3UJOA 1W6OA 5JSOA 4B7EA 3ZN4A 5DDJ3 4AQ2A 4N43B 2XJRA 4RA0A 3ASIA 1WA4A 4K21A 5FLIA 3V0AA 1GR3A 1LHWA 5T55A 1CAUB 4PBPA 2K9ZA 4H3WA 3WUCA 3B02A 2UYBA 5E88A 1DF0A 1R1A3 3ZFFB 1AHSA 3B94A 1SLAA 2XHKA 1FPN3 5CFCB 3H8UA 4NPRA 2HWD3 1CAWB 5EJ3A 1NXMA 2OIIA 2HWF3 1C3HA 1RHI3 3UV9A 4ZXKA 3EO6A 3IKWA 1CIWA 2W08A 3AMNA 4XOGA 1BBT3 1CD3G 4YVWC 4A7YA 1LHVA 4HFSA 5BNOA 3M2MA 4WVMB 1VJ2A 4GA9A 2ZX0A 2GNDA 3IT8A 3PVBB 3THTA 1RUG1 2DFCA 4WVWA 1GNZA 1V9U3 3DPRA 3H1MA 2TEPA 1J3RA 1QDOA 2E51A 2ZHMA 3KM5A 3VHOA 1FNYA 4GH4C 1PHMA 1TME2 4BWOA 3DV8A 1ZBA3 1AR71 2ZGMA 1GBGA 1HRI1 1LGNA 1WBFA 4Z07A 1S0EA 4CDXB 1WGPA 4FAGA 1V6MA 4F8AA 4JGYB 3J9SA 4N7IA 2LM3A 4IEQA 1H9WA 2BW8A 4IEUA 4OI0A 2WQ4A 2WZR3 3ZFEA 5CG8A 2DTWA 5C4WC 2VU9A 1GFF2 1O91A 4P14A 3S0MA 5J7MA 5KHGA 1ZZ8A 3R6SA 2QZ2A 3WCSA 4F3JA 1YIPA 1O3TA 1RTVA 1ULDA 3SCHA 1YI7A 1RJ7A 3U10A 1ZRCA 4CDWC 3ZXDA 4XILA 4GKYA 3G7DA 4GMP3 1X82A 2D3PA 2A3YA 4Q29A 1PO12 5I91A 3ILFA 1C57A 4B3NA 4YM0A 4BPZA 1MZ5A 4LO5B 2X5IB 4FPHA 4AEKA 3JD73 4FP2A 1F8VA 2FZ2A 3OY8A 4QPIC 3E5UA 4HANA 1EY2A 4Q0UA 3ENRA 3WDWA 1RUH3 1XU1A 5LEKA 1OA2A 1MQTC 5J48A 5DZGA 2R0HA 3DGTA 4XXAA 4NO4A 2RR13 4V1PA 5GZDA 3VBOC 1YXWA 4M3CB 4WM8B 3IPVA 4ZU4A 4P9WA 2CWMA 5JCTA 1ND2B 1IKPA 3M3EA 1PO22 2ET1A 1F5FA 4RL7A 4XJ8A 3QOPA 5SV5A 2D7FA 3KSCA 3WP5A 2ATFA 1YIFA 1PZ8A 2PHUA 4K20A 1ZBE1 3ZYIB 4N53C 2D3SA 2RS51 2YPJA 1ZBE2 2WWSA 1N1YA 1SBFA 5DDJ2 3ZXAC 3N7KA 4YW4A 1NY71 2AUYA 3OYWA 1POV0 1UU6A 2Y0IA 1QJU1 2R49A 2Z2SB 1NY72 3THPA 4GH4A 1V6KA 4CEWB 5JAXA 1ZZBA 5LRRA 4YVSC 3TBDA 3NKTA 1R1A2 3OD0A 4AI1A 1SACA 2QUOA 2WC2A 4AFDA 5CBLA 2PLV2 5E8AA 4Q8KA 2GNTA 2YY1A 4Q0PA 2IXKA 3P3PA 4OI4A 4XFCA 2YC0A 1AJKA 4DS0A 5C4WA 5HCBA 2HWF2 4FPGA 2PTMA 3ES4A 1D2QA 4NOTA 4YGEA 4D3WA 4JDMA 1V6NA 4CDWA 1F31A 4PBOA 4AEDB 3FZ3A 2OPKA 2ENRA 1S0DA 3PTYA 2WFF2 5BXXA 1KS4A 2QFEA 3A4UA 2Q5TA 3RPQA 1V9U2 1KJLA 3UKTA 3AYCA 3NKGA 3POSA 2VECA 4J1WA 4QPIA 2WT0A 3HBZA 1SLBA 4JDOA 4K7JA 4B4PA 1QXRA 1ZBA2 5JDBA 1CPNA 4YW5A 1MQTA 3USUA 2W68A 2ZHLA 3ZSEA 2IXCA 1LODA 1PVC3 1TNRA 3LOIA 4H7MA 2ZGRA 1W39A 4IEYA 5J3UA 2PHTA 1LOAA 2WZR2 3OF1A 4IETA 4KH9A 5F9TA 4N53A 4XIKA 5C6CA 3N7JA 3MW3A 1UCXA 4LR4A 1NA1B 2XLGA 3RDIA 2Y0OA 3DL3A 5JR7B 1JW6A 2ZAAA 2NYYA 4LA2A 3V0BB 2E63A 1FI2A 1U5XA 1TMF1 1WMDA 1RUE1 2DYCA 2QZ3A 3RG0A 1OI6A 4YVSA 3JD72 5KXCA 5FLHA 1C1LA 5FPXA 5GLUA 2DCJA 3U4XA 1H8VA 1BCXA 1FT9A 5T3NA 1QJX1 1VRH1 4TZDA 3RJ2X 1OD5A 4MZUA 2WQZC 1JUIA 1JYCA 3KT4A 1C8M1 4WM7B 2YHJA 2MEV1 4JRAA 4FPLA 1C28A 1W6QB 1O4YA 2VPVA 1HKDA 3V65A 3ZSLA 5CFDC 2MEV2 1UPSA 2IZWA 2PHRA 3QD6A 1LCLA 2D6KA 1SBEA 3AKPA 4HT1T 1VBB1 1OPOA 4JCKA 2EF6A 4PIXA 4TWTA 3WLUA 1TE1B 4I2OA 1FMD3 3FLTA 2UURA 3MLJA 2R0FA 2GNMA 4XQDA 2VVEA 3VBUC 1RITA 3FX3A 1DFQA 1YLLA 4HSJA 4CZSA 2HWE3 2R043 4YGCA 2DVDA 3MLLA 5C33A 1R091 4FOYA 1YFWA 1SLLA 5EYXA 5BY5A 2DFBA 2RM21 1NLSA 4MGIE 4U2AA 4D69A 1QHDA 1G7YA 4YRDA 4QQLA 4AHXA 4FOVA 3ZYJB 1RB8G 1D4VB 5FRAA 4LHKA 1W6PA 5K0UC 4XIOA 2D93A 4PIZA 3WDXA 2JE7A 4N9HA 3VBSB 2VOXA 1LESA 4SLIA 4NVPA 1IPKA 2XLFA 5JOXA 2A75A 3IDBB 4FXGB 3PJYA 3JBG1 4XF9A 1RUC3 2NMNA 2GC2A 1NXD1 1Q8PA 1AR91 3R05A 4RS5B 5CNAA 4E2QA 4FTBA 3SHRA 4GIQA 4PLNA 5I8TA 4PF5A 1SLIA 3CJXA 4TSVA 4BZ4A 4ZU7A 3CJIC 4UBGA 2EXJA 3BOWA 3FC0A 4XJZA 5T52A 1AR63 3SNMA 5JZGC 4XFIA 3WG3A 2YZ4A 4RGGA 5JPNB 4OZXA 3NSTA 1POV1 1W6MA 1EV11 4BMBA 3KGZA 1WW6A 4LNVA 1LULA 1PNFA 4W6XA 3WG4A 1S55A 2FBEA 4Q8LA 1DZTA 1PVC2 1WLCA 1H0BA 2I74A 1PIV1 2RMU3 3H3UA 1H8TB 4GB33 1H4GA 2WLPA 2GC3A 1DYKA 5CFDA 4KL1A 1AL23 2VQ0A 3VZKA 4BH9A 1QOSA 4R4ZA 3UK9A 2BQPA 1PZ7A 4FOWA 4ORFA 2DUPA 1YWKA 4R9BA 4Y1XA 4RQPC 1PGL1 3KCCA 5JOWA 3VBUA 4IV1C 2DUQA 3U11A 2FHRA 1XU2A 1PGL2 2B9UA 4PLOA 4KNCA 4R4XA 3FHIB 1DU3D 1VBC3 2XBO1 1IHMA 4XW3A 3CEWA 3GBGA 2ZA9A 2XBO2 4Y20B 1DZRA 1YO8A 3MIDA 3ZXKA 1NE4A 1U0AA 2CL2A 3LA3A 3AZVA 3SXWA 3RYRA 4AFCA 4Q27A 3BALA 1LRHA 5K0UA 2ZHNA 3MIBA 2BFUS 2X53S 2AREA 4N43C 4R9CA 3AXDA 4G4FA 2Y38A 2VW2A 3FJSA 1ZZ7A 2XB6C 4AVSA 4Z2WA 4HN0A 1X33A 3GNEA 2D5FA 3MIGA 1G9FA 1LHOA 1EYBA 1Z7S1 1AUYA 1QDCA 3ZFFC 3CJIA 4ISRA 1FAYA 2XKPA 3RJRA 1J58A 5JZGA 1Q5OA 4YG3A 4OHWA 5CFCC 3RI9A 2QDNA 5GLZA 3BB6A 2R042 1LEMA 4YGBA 3B9CA 3WHTA 2ZX1A 2V5YA 4JC1A 4L9BA 2RS11 4FBFA 2VMGA 4HPKB 3KB5A 4XEZA 1YFXA 2RS12 4W6YA 4Y22A 4Y5Z0 4FVVA 1O3QA 1IQAA 3D6EA 1CAVB 2D3RA 1Q8OA 3AZZA 3E97A 4HVOA 1UZZA 2I07B 5A32A 3HQXA 5KHJA 2GSYA 2RE9A 1LOCA 3W59A 1N3QA 2JENA 4AYUA 2TBVA 2XJQA 4YZ3A 1OSGA 2Z79A 3AMPA 3SH5A 4YW2A 1J1LA 4RQPA 2XL9A 1VIWB 3CO2A 1ND3B 2VQAA 3RRDA 3ZO0B 4CDXC 5A33A 1A8DA 4FO9A 2AGSA 3SCFA 4JGYC 2ZGPA 3FLRA 3PLQA 1LB2A 3AYDA 3HT1A 1Y9QA 1ZM1A 2FZ1A 2RHPA 2R16A 3KCXA 1XQNA 4X6RB 1VBA1 3VBHB 5K7PA 1LECA 2XVGA 3EBRA 1BYHA 1D4M3 3MW2A 3ZMOA 2GALA 1UU4A 1MZFA 1MZEA 2VG9A 3BTAA 4X6QB 1Q43A 1SCRA 4N43A 4PIYA 2QQPA 2R1BA 2RMU2 3AYAA 1N3PA 4L92A 4XE9A 1LHNA 2F4PA 3AP6A 1UAIA 3S7EA 1ASJ3 5FOBB 1AL22 1BK1A 1CAUA 1PGW1 2X5IC 4LBKA 4RHV2 5EXOA 2OZ6A 5F6KA 3ZFFA 3S7IA 3NV2A 1J59A 1AYM1 5CFCA 1CAWA 2WKKA 1GICA 4OLLA 3VZNA 4HN1A 2ERFA 1IS6A 4XZPA 2IWGB 2ZABA 4QX5A 4WM8C 2WNVB 1HQLA 2E6VA 4AG4A 1ND2C 3TN93 1GNHA 1UMZA 1QH6A 4Q1PA 2CY6A 4IQPA 3H9AA 4MVTA 2O8QA 3H1WA 4WVMA 2CGPA 3TNQA 2R32A 5HCAA 5T5OA 3CU7A 3FBMA 4EJRA 2V09A 1Z0HA 4AVBA 5F6LB 4J6GA 4FTSA 4M3CE 2B5HA 3DF0A 1MS3A 1RGSA 4UW4A 3KGLA 4GULA 4A7ZA 4CEWC 2IXIA 1BEV1 3VHRA 2PAMA 3TAYA 3MF6A 1VB4A 2WSVA 3UKVA 3RMXA 2A5ZA 2B39A 3G6JB 1HW5A 1F2NA 4CDXA 4GALA 1AVBA 4MV2A 5J98B 3VBFB 1O5LA 1RMU1 2WFPA 1YHFA 4JGYA 2FMDA 5AC93 4NHKA 1DQ5A 2QDRA 4QU2A 1PVXA 1JN2P 2PELA 3MLKA 1D2SA 1DYPA 5LK5A 3N36A 1FOD3 4FPFA 3WVJA 1AYN3 4LO8A 3NO8A 1COV1 3ZXJA 1WMFA 2JJ6A 4AEDC 4YFWA 2D6PA 3ZFGB 4AVVA 4YW3A 2Z42A 3WDVA 2ZPXA 4HVRA 2ZGSA 5L19A 4F7ZA 1RUI3 4AFBA 2EXIA 2VW1A 2AZ5A 4PQ9A 3NWKA 4AFMA 3MEPA 4MGKE 4CP0A 4AQTA 4EN6B 4BE3A 5C9AB 5K9YA 2C1FA 4I30A 4IV1B 2RS33 1IGOA 4WVZA 4DRVA 3WV6A 1AZDA 2Q30A 2WA4A 2FQPA 1VAVA 2YROA 3ETQA 3ZDSA 3M3IA 1KD7A 4XTPA 5I8SA 1URXA 2K2SA 3VHPA 4M3CA 1EAH3 4WM8A 1GSLA 4AK3A 1ND2A 1RUJ3 2N7GA 5AFEA 3WHUA 2ZCWA 4COVA 4QM8A <