4EWEA

Study on structure and function relationships in human pirin with manganese ion
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA01
4QMAA 4YNIA 1NZCA 1NYWA 3FFQA 4HBNA 1DZRA 1U12A 4HVQA 5I93A 2CAVA 1OI6A 1RGSA 1H1MA 5K8SA 2D40A 4IEXA 1FXZA 3KSCA 3UKTA 4YYOA 5FDBA 1QY4A 4KU8A 4O9GA 1CAVB 2ET1A 3R6SA 2QVSB 3E5QA 3E6DA 3RYPA 4EV0A 3N4MA 1X7NA 4AVAA 2ZKLA 1WLTA 1WGPA 5I8SA 2HKXA 4ONUA 3E97A 2XL7A 2OYZA 1DZTA 4XF0A 4I3PA 4HSJA 4EWEA 4XFIA 4WZCA 4IEWA 1VR3A 2PA7A 3IDCB 4IEUA 1WA4A 4IERA 4LLOA 3FJSA 5JSOA 2BEOA 3I54A 4XFHA 4I09A 2XLAA 2BYVE 2UYAA 3PVBB 2V09A 5I0TA 3L2HA 4OFGA 1RUOA 1X82A 4MGYE 4GULA 5JCTA 2QNKA 4R8HA 2MNGA 3H3UA 3CJXA 2UY9A 1RUNA 5CVRA 3NL1A 4YARA 1ZZ7A 3S7EA 3LAGA 5I8YA 4KWKA 5J7MA 1QWRA 2Q30A 4HN0A 3DN7A 1OD5A 1DGWA 1EYBA 4PIXA 1Y3TA 4D7TA 4Q0SA 4P9GA 3U0ZA 3ZDSA 3H1YA 4QM8A 5C6CA 5I0UA 4LEJA 1O4TA 3BU7A 2GZWA 3OCPA 3HIFA 2PAMA 5KHJA 5JSRA 1J59A 1ZZ6A 1LB2A 5FLIA 4I0AA 4IEPA 4QX5A 4F8AA 3GYDA 4JTOA 1ZVFA 5BXXA 2IXKA 3U10A 3NKTA 3LA3A 4NVPA 3KMHA 3ES1A 3EO6A 5JAXA 2XKPA 4LA2A 4MGIE 4IETA 4OLLA 3QACA 4Z82A 2PHLA 1SEFA 1Q3EA 1O3RA 3UKNA 2GH2A 2IC1A 3ELNA 2D93A 3RZZA 4IEVA 4LULA 2C0ZA 1VJ2A 1NE6A 5FQ0B 4K8FA 4Q0PA 4KL1A 5KHGA 4YRDA 4ZU4A 2BNNA 4RD7A 2BNOA 1EP0A 3G7DA 2H6BA 2GAUA 2K0GA 3ST7A 3NJZA 2B9UA 4HZFA 1ZZ8A 3JZVA 5FQ0A 1HW5A 1CAXB 1ZRFA 4X6RB 1XE8A 4Z07A 4HSLA 1CAWB 1I5ZA 4AVBA 5BV6A 1NE4A 4BHPA 2PFWA 2BNMA 3TNQA 3MYXA 3QOPA 3H9AA 4IESA 5JR7B 1CAXA 3D0SA 2Q4SA 2DCTA 4XETA 3DKWA 5D1IA 1QXJA 1RC6A 4QM9A 3O14A 1CAWA 4X6QB 3DV8A 2K9ZA 1LR5A 3SMHA 2ETEA 3HT1A 3LA7A 2XGXA 3CO2A 4WBBA 2H0VA 2KXLA 1OMIA 1YHFA 1CAVA 3M3IA 1YFUA 2UY8A 2PAKA 3EBRA 4BIFA 5BY5A 5LRSA 4XF9A 2F4PA 1XRUA 3MPBA 1H1IA 1V70A 3WW1A 3IBMA 2PTMA 3M70A 1ZZCA 4FT8A 4AXOA 4L11A 4AVCA 3TNPB 4MX3A 3EQEA 1O5UA 3E6CC 3H7YA 4E2SA 1YWKA 2O8QA 5HI0A 1O3SA 2XL9A 3BB6A 1PM7A 3HQXA 2XKOA 4AQ6A 5EFUA 3IIAA 2CV6A 1NXMA 2IXJA 2QCSB 4XF1A 1J3PA 2IXIA 2Q0AA 1DGRA 3WW2A 3HT2A 1LKNA 3LA2A 1IPKA 3E6BA 4JVAA 2GC1A 1YFWA 4JTNA 2E9QA 3IWZA 4PJYA 4HLTA 4WVZA 2OPKA 4QGMA 2CAUA 4XEZA 5T3NA 3CEWA 5FPXA 5KHKA 4ORFA 5FCCA 1UIJA 3OTFA 1L3JA 4ZU7A 4BYYA 1X8EA 3B02A 4MUVA 3MDPA 4I01A 4LTAA 3UKVA 3WW4A 2OA2A 4E2GA 3NSTA 4MZUA 4QGNA 3LZZA 3FX3A 5F1RA 4PIYA 1ZNPA 2Q1ZB 4FAGA 1X8MA 4XF3A 1J1LA 4LUKA 1PMIA 4YSFA 4N9IA 1YLLA 2B8MA 2FMYA 4FAHA 1J3RA 2PHDA 2EVXA 5KHHA 4A2UA 4J1WA 3LOIA 5LEJA 2UYBA 1O3QA 4L2NA 3ACLA 3KCCA 2PAEA 3SCHA 4EWDA 4MV2A 3KGLA 4XFFA 3CL1A 1ZX5A 1Y9QA 3BPZA 3WW3A 4B29A 4MGKE 4BH9A 3RYKA 3FE5A 3S7IA 5E1RA 5BUVA 2PQQA 5I0RA 2O1QA 1UCXA 2IXCA 5LRRA 2EA7A 2WC2A 3SHRA 4IEOA 1CAUB 3E5XA 2HJIA 2IXHA 3H1MA 2EAAA 1GQGA 5J48A 2D5FA 1FT9A 4FBFA 3OGJA 2VECA 3USSA 2Z69A 4JV4A 2XLFA 4META 3OF1A 5FPZA 4KU7A 1CAUA 5FLHA 3ETQA 5E16A 1ZZ9A 1RTVA 3LWCA 2GC0A 1I6XA 3H3ZA 3H8UA 4MGZE 3OD0A 4UBHA 5J3UA 3FWEA 5JSPA 4Q0QA 4Q0VA 4QXKA 2MHFA 5I0SA 2D5HA 3FHIB 1FI2A 4KWLA 3E5UA 4HVOA 1YFYA 4H7LA 2N7GA 3S0MA 1CX4A 3C3VA 1VP6A 4XFBA 2VPVA 3RNSA 2P17A 3RYRA 3FZ3A 5EZWA 2Z2SB 2MPFA 2VQAA 3CF6E 2XLGA 3NVCA 4I02A 4EWAA 5I91A 1UPIA 3MZHA 5CADA 2PYTA 1ZZBA 5FLJA 3SCFA 2B5HA 3H1WA 1QXRA 4DINB 2QJVA 1UD1A 1TQ5A 3ROUA 3H7JA 4XFCA 2BGCA 1SQ4A 4E2QA 3BCWA 2GC2A 2CGPA 3SCGA 1J3QA 1UW8A 2ET7A 2OZ6A 4XFGA 4R52A 4QGLA 2QDRA 3NW4A 4EROA 3EJKA 5AVPA 1EPZA 2GU9A 2XHKA 5LEKA 1JUHA 4LA3A 5C8WA 5BPXA 2IXLA 4CYDA 3I59B 3H50A 1Q43A 4KWJA 1O3TA 4MH0E 4IEQA 1ZRCA 3GBFA 1OFNA 4HVRA 5I8TA 1YUDA 2I45A 2ZCWA 1IPJA 4Q0UA 4HN1A 1G6NA 4J1XA 4ZU5A 2H6CA 4XF4A 3PNAA 1XE7A 3I59A 2GC3A 4IEYA 3RDIA 1Q5OA 1SFNA 4N9HA 4UXAA 4I2OA 4I0BA 1O5LA 4O9EA 3D0JA 1GQHA 4IEZA 3SXWA 3VHRA 1LRHA 4PIZA 1RL3A 1ZRRA 2Y0OA 3ES4A 3U11A 4D7SA 3DL3A 3EHKA 5KHIA 5KBFA 4UBGA 1UIKA 2OZJA 3IDBB 1ZREA 1ZRDA 5CU1A 4AQ2A 3CLPA 4TLFA 4Q29A 1O7FA 4F7ZA 3KGZA 3RPQA 1EY2A 1CGPA 4XFAA 3PLQA 3I7DA 4HMZA 1YFXA 2WFPA 1J58A 3D82A 4LUMA 2ATFA 2FQPA 3BALA
chains in the Genus database with same CATH superfamily
4QMAA 2LTNA 2Y0IA 3AKTA 1NZCA 1S2BA 5DDJ1 3RVHA 1EAH3 1DZRA 3J7HA 1U12A 4JGZB 3VDAA 4BWOA 4EN0A 5I93A 2J1VA 5BNQA 4MADA 4RHV2 4Q4V2 2DUPA 1GZ9A 4IV1C 3KSCA 5DZGA 4D8MA 4Z2WA 2AR6A 1QY4A 2XJQA 5L36A 4ITCA 1NCRB 2A71A 4LITA 4BIOA 1KFXL 2YC4A 3PTRB 3Q8BA 1L7LA 1ULPA 1XJAA 4DXSA 4CEYB 5C9AC 1V9U1 1NXD1 1W6OA 3PJYA 4RGAA 1SFPA 3SH5A 4BE3A 4EV0A 4AYUA 3T1MA 1AR81 2ENRA 1WGPA 3D5OA 2HKXA 1QU0A 4ONUA 3E97A 2XL7A 1DZTA 3PUAA 3SC7X 3DUIA 4HSJA 4UF0B 3VDDC 2WT0A 4M3CF 2ZAAA 2ZS6B 2TEPA 1UPSA 2BRTA 1ACCA 2ES3A 2C5DA 2RS13 2DTYA 2WS92 4IEUA 3H0OA 4OMCA 4WM7C 5FP9A 4IERA 4UFKA 1S1AA 3C7EA 2VMCA 2XR4A 3FJSA 5FO9B 3F95A 1OQ1A 1GMMA 4AEDC 4HFSA 5FZ0A 4I09A 2XLAA 3ECQA 1G9DA 1VBE2 2VOVA 2HEYF 3Q9OA 4ZY9A 3C7GA 2Y6JA 5JOYA 4OZOA 2V09A 5I0TA 4C1XA 3C7OA 4AK3A 2NMOA 4GIQA 5EWSA 4Z2AA 3RZHA 3ZXFA 2CHHA 2XWBB 3FLRA 4OUEA 4Q4Y3 1HXS1 2F17A 2JDZA 2J1AA 3AMQA 3LDRA 2WABA 2XJRA 5FWEA 5FYMA 1AHSA 4Y4YA 4YLZA 5KXCA 1V6OA 3LEIA 2PHXA 3CDZB 4FPGA 2C9AA 4IV1A 4S2FA 2HWF1 2GNDA 5J36A 2Q30A 5T5PA 3VBRA 4D69A 5GZEA 4PIXA 1Y3TA 4MGTA 4BQXA 3ZX7A 5HBAA 1BCXA 3AZZA 5A3PA 4Q0SA 2WNVA 3U0ZA 1A6CA 1RUE3 1CGPA 2BVBA 3DYOA 1K5JA 2EXHA 3BIWE 1C8M3 3H1YA 1X36A 5I0UA 2DUOA 1JYCA 2JE9A 4IDZA 3BU7A 4C8DA 4CDXB 2VBBA 3VDDA 5IK8A 1GOGA 2DBNA 1ZZ6A 4DRVA 2VBDA 3FLPA 2VOTA 4OZXA 3ZN6B 2VMDA 4CRQA 2JE7A 1WMFA 1S0IA 2XVKA 1HQLA 1SLBA 4WM7A 1QOTA 5IW0A 1JMUB 5IAXA 5K0UB 1OKQA 3OY8A 1US2A 5LK5A 4AEDA 2O0OA 4IE6A 4ZZ8A 3MW3A 5BXXA 3BIEA 2WBKA 3NKTA 2FCUA 1N1SA 5A7OA 3CIHA 3KMHA 1F2NA 1UMIA 2JDKA 1LJ7A 1PMHX 2VCBA 2XKPA 2WAAA 4LA2A 5A3OA 3ZSLA 1JZ2A 2W52A 5SV5A 3TEWA 1SEFA 4PBPA 4BU2A 4COYA 5IVFA 4MHRA 4COWA 5HPOA 2W1QA 1C4RA 4IEVA 4UW5A 1HB2A 5DUUA 1N47A 1QF3A 1V6IA 2A70A 1RIRA 4RA0A 5BYNA 5KHGA 2VUDA 1JH5A 1OHFA 4RFT0 3VBOC 1B35C 1OOPA 3MFCA 5BNOC 1BBT3 1F31A 1MZEA 2FHRA 3WQ0A 1VRBA 3I2FA 4XQDA 4RS5B 3H8OA 3FHAA 4ZXKA 4OI0A 1EPWA 3NJZA 4EJRA 4FPFA 3AZYA 4N43C 2ZX4A 1GQPA 1VAVA 5JZGB 4P9XA 2BOJA 3ACHA 1WW7A 2WSVA 5DMYA 1WCQA 1XE8A 2B46X 4NR1A 4HSLA 4R9BA 5H9RA 4CUGA 2ORZA 1N3QA 4E8DA 2B39A 1JW6A 4M4RA 1WLCA 4BB3A 1OSGA 4AVBA 2DVFA 3HNMA 2OVUA 1KFUL 1FV3A 1OVSA 2VMFA 4NHYA 5HCFA 1R091 2GP5A 4AGGA 3F2ZA 4IQPA 4YGCA 1VBC2 2XJSA 4QX7A 2DCTA 4XMAA 4JGYA 1XNCA 2WRAA 4HKWA 1W2TA 1K5MB 3NNFA 3P3NA 2HEWF 2Q8DA 3K3NA 1Y7BA 3TYJA 4X6QB 2VMIA 4CDWA 5TSWA 1YQ6A 4ZS2A 3SMHA 4OHYA 1VB4A 3WZ1A 5LB6A 3CO2A 3TN93 2KXLA 5A7QA 1OMIA 5C5TA 3ME2A 1G7YA 2DFCA 1YQCA 2LW8A 4AFAA 4COVA 3EBRA 4OUMA 3U37A 3O1PA 1IOAA 4OHVA 1CD3G 4ASLA 4BIFA 2QQMA 1US3A 1XRUA 2NQYA 4TLGA 3VBOA 5BNOA 1OLRA 1UQXA 4ARXA 2PTMA 3GCXA 1VAMA 2EALA 4Y22A 4LO7A 1JYNA 1YQ5A 3ABZA 1VRH3 3OGVA 1U5IA 5JI7A 1DBNA 4L11A 5FO8B 1AYM3 4AVCA 3OEBA 4MX3A 3EQEA 1EV11 1O5UA 1S0GA 3ZIXA 4CU8A 4DIQA 4FQZA 4Q4X1 5HI0A 1QH7A 2XBO3 4Q4W3 3CZUA 2C1FA 3EMRA 5IWFA 1PO11 3BB6A 1S2EA 4W6YA 3IIAA 2CV6A 2FBEA 4LBNA 3A21A 3ILNA 3V64A 4XF1A 3FBYA 3QBQA 1JZ5A 2R041 3ZFEC 5ABJC 2OPWA 2Q0AA 4TZDA 2DCKA 1FMD1 3DXTA 3WEZA 3HT2A 3P5BA 3RI8A 4D6QA 2HYKA 2CU5A 3ZYRA 1MACA 2WN3A 4BOWA 4ISQA 5A3TA 4XDPA 4LKFA 4QKFA 4FOWA 4AW7A 3WDVA 4JTNA 4JRLA 4Q4V1 4QPGB 5CEHA 4XJ9A 3WP4A 2ZZQA 3GDBA 2P4EA 4QGMA 2FDHA 2CAUA 1EAH1 1H6XA 3CEWA 4G9SB 4B7KA 5FCCA 4NMIA 5FZEA 1L3JA 1W8FA 1OLME 1AYN3 2NMNA 4IE0A 4PQ9A 4D3WA 5FY7A 5HCHA 4MXVA 1WZXA 5ACA2 2GMEA 5H9SA 1PGSA 2ZMKA 2JD4A 2W87A 2XJTA 1ZBE3 3I3EA 1QJX3 5LBEA 4FTEA 3BYWA 4FVVA 2ZJCA 4Y5SA 2OA2A 2WFF3 3UETA 4QGNA 3U14A 2LALA 5APAA 4RN5A 3VL9A 3PUHA 2A1XA 3LPFA 3T4HB 3O7OA 2ZOEB 4QB2A 3WF4A 3I3BA 3IM0A 4R9CA 4YVWC 1MR5A 3LF7A 2W0XA 1V0AA 1QJY2 1RJ7A 3M3CA 4WM8C 5FXVA 2W95A 3O5SA 3LE0A 4H14A 4ATFA 3WNPA 1YLLA 2FMYA 3BGAA 1J3RA 1DZQA 2PHDA 3VL8A 2VZSA 5KHHA 1E57A 1WMXA 1W04A 5FRAA 1COV2 5SV8A 1FOD1 1VBD2 3ZMNA 3CJIA 4OULA 1O3QA 3AM2A 4ZKTB 4GH4C 1JYXA 5AFBA 3HN1A 2R063 3O1MA 4JDNA 4PT6A 3ACIA 4ARYA 4B29A 4OMDA 2RS33 1RXFA 1LESA 1MQTA 1V6LA 1RUG2 1YJLA 1QNWA 2QDNA 5A3LA 2KM2A 3MEPA 4COUA 4Q4Y1 3FE5A 4JAAA 1P8JA 4XDQA 5D21A 4BPZA 1DQ1A 2RS51 1KEXA 5IVYA 1XQNA 1XU2A 5T50A 3PL0A 4CP9B 5EIYB 2O1QA 2YBKA 2JB8A 2YU2A 3I2HA 2RMU1 1VBB3 3VD7A 4AL9A 2OXBA 2X09A 4DZGA 4YM2A 4YPJA 1GZWA 4GJZA 5LK7B 1ULOA 2KR2A 2HJIA 5JXJA 5IUQA 2YPDA 2W1SA 2IXHA 3MHZA 4IGOA 2OKXA 3H1MA 2BBVA 3ZOIA 5J48A 5C8CC 1W03A 1FT9A 4CU6A 3PVNA 4FBFA 5FMOS 1NY71 3VZOA 2WNUC 3USSA 1S55A 2ZMLA 4AGRA 2VU9A 4JV4A 1Z0HA 1W0PA 5EV7A 1RUE1 2XLFA 4DPNA 3B93A 1C8M1 2Y8KA 5FYCA 3OBAA 2R16A 4KU7A 2VMEA 1CAUA 3B3QE 2BW8A 3ETQA 4UT5A 4YW3A 5FLHA 1F8VA 3HMYA 5H9PA 3BOPA 4CUCA 2P3JA 4TN7A 2ADDA 1QIQA 1YRZA 1H0BA 1MPXA 2OX0A 3NNLA 4FPEA 4GWMA 4EN9B 3WDUA 3DPRC 4KG8A 2A3YA 5IVEA 1GU3A 4EZ4A 4UBHA 4GH4A 4M00A 3ZSKA 5JSPA 2WT1A 1A8DA 4Q0VA 5FZ3A 4YG6A 2BV4A 5A1AA 4XBLA 2JIGA 2RV9A 1Q8SA 5BNNB 1IGOA 1W8ZA 1FI2A 1LHNA 1MEC2 1NT0A 1KQRA 1SCRA 3FHIB 3E5UA 5DZFA 4YW7A 3RFRA 2FDJA 2BBAA 4CEWB 4H7LA 2N7GA 3S0MA 1CX4A 3MW4A 4CDUA 4GQ7A 1AXKA 5A80A 3BKZA 3POGA 4BQWA 2VZQA 3C3VA 1D7PM 3AYCA 4Y3OA 1SPPA 1RUH2 4L97A 2P17A 3RYRA 1IS3A 5LCWL 1ODNA 2VXJA 1UYYA 4O7XA 5F2SA 4BISA 3VBFC 4NROA 4AQTA 3RJRA 2VQAA 3CF6E 3NVCA 4I02A 5JIAA 4FXKB 3VBUB 2C26A 4QU1A 3WVJA 1FNYA 5M0TA 1PIV3 2PYTA 1ZZBA 2JJ6A 3LIHA 5C8CA 5IJRA 4K9SA 2B5HA 3SQOA 3T2PA 2VJXA 1UAIA 3H1WA 5ANQA 2WNUA 4L8QA 2CDOA 1UD1A 1F4HA 1TQ5A 3ROUA 3H7JA 1YEWA 4RQPB 1K45A 4WVMA 2BGCA 2J1RA 4E2QA 1WCDJ 5EJ3A 5FTTC 2GC2A 3HWJA 3VZLA 1J3QA 1UW8A 2VOKA 5DDJ3 2IVJA 2OZ6A 3HPNA 2WZEA 3J8F2 3NAPB 4AI0A 1MS5A 1H2LA 3WCSA 1NUKA 4NIGA 2PLV2 2DU1A 1AVBA 1HRV2 2MEV3 1UY2A 2QDRA 5LA1A 1LU1A 3NJVA 2V72A 1GWKA 1BK0A 4TYSA 3PMSA 4LHLA 3RGBA 4A7ZA 5AVPA 1WUVA 3VBSB 2HWD2 1NQDA 1NX9A 5DN2A 2D3SA 3ITQA 1EUTA 4D94A 2AACA 4QDSA 1V9U3 3KCXA 5ISLA 4FPJA 4GWNA 2FDKA 2VBPA 5AVAA 5FY8A 2HWC2 1CQ9A 1Q43A 4V2WA 3RSJA 2A75A 4LO6B 2D44A 2XB6C 5J1XA 1LECA 2E32A 2WIIB 5C71A 2K46A 3VDCA 2Y6HA 1QJU2 3TBDA 2JKXA 1YUDA 5EPAA 5T54A 2ZCWA 2JD9A 1R1A2 5FBJA 1U0AA 1LGCA 2J7MA 3E1F1 4Q0UA 3ZDVA 4HN1A 1G6NA 4J1XA 4DS0A 1GBGA 1AR61 1W6PB 3AKPA 4HKLA 4RR3B 5FUPA 4KMQA 2YB7A 4XCBA 1XE7A 4TWTA 4IEYA 1JZ4A 1SLIA 2GN3A 3I2DA 1IS5A 1SFNA 1VRH1 2CNAA 4KNCA 1PZ7A 4O9EA 2FDGA 1ASJ2 1AYM1 2GDFA 1GQHA 2E6VA 3KV6A 4IEZA 4LO4B 4XMIA 3ILRA 4PIZA 2XDVA 4OVEA 2XBO1 4Q4W1 2VM9A 4BLIA 3THTA 1LULA 5JXGA 2DWRA 1W8TA 3CU7A 2R0FA 2EXIA 1LOCA 2ZTNA 3EHKA 1DGLA 2VR4A 3ZYBA 2VNOA 2PQSA 4LHSA 3RWNA 4K8RB 1VBA2 4URTA 4DMIA 1FPN2 3WNOA 1UU4A 3MIGA 5KC5A 1CX1A 2NZ9A 4AQ2A 2HWF3 1MS0A 3M1HA 4Q29A 1KXGA 2D6PA 4CEYC 4F7ZA 1EY2A 1Z7S2 5D8AA 3ASIA 5DUVA 5A33B 4SLIA 1VALA 4N53C 4AVTA 2HLEA 1LGNA 1W05A 5FFOC 4B4PA 4GKYA 5FJKA 3I7DA 3JBG3 3OD4A 1YCIA 1GP4A 3D82A 3ZYIB 4BXFA 3BN6A 4JRAA 1RHI2 3K4DA 4QQHA 1ULFA 4JKKA 3WT3A 3TEXA 5EJZB 4EQVA 3THDA 2W5FA 3WP3A 1HJFA 1MZFA 4WV8A 1LHWA 1QJZA 1W2AX 1TNFA 5ACA1 1RMU2 3JU9A 1QJEA 3KD4A 1QGLA 3LEKA 4BQ5A 4HVQA 5FZAA 2CAVA 3QH6A 1OI6A 4Y4RA 2WA3A 5K8SA 1RITA 2G1MA 3IPVA 4GZ9A 4MO3M 1G9BA 3LFMA 5FDBA 2R072 5A7SA 2J1EA 1H8TB 1REDA 1VMFA 2FMDA 4IV3C 3MIEA 2ET1A 2W08A 4CU9A 2JG8C 2ZX0A 3W59A 1VAKA 2ZGRA 1JOJA 4RGKA 1ZBE1 1QJX1 1UY1A 3E6DA 2RR12 2ZEWA 5J98B 1C8NA 2WDBA 1GZCA 2WFF1 3I49A 5EXOA 1XXNA 1YI7A 5LA2A 3KF3A 1BEV2 2YFZA 4DEVA 1JI6A 2BWAA 1COV1 4YZ3A 2OYZA 2KA3A 1O6UA 1VBD1 3KQRA 3U1XA 5LBCA 2VVEA 1XSRA 1NAEA 4EWEA 3HD8B 3EYPA 1H8VA 1N1YA 2EF6A 3I2JA 4WZCA 4YW4A 1RUC3 5LY2A 4HPKB 1W9SA 1X33A 2VNGA 4CCDA 4CEYA 3AL5A 1JYTA 1K42A 4GWIA 2PA7A 3VHPA 5CYYA 1K12A 1WA4A 3D3AA 4AOCA 1RUJ1 4BQ4A 3I54A 4YFZA 1W8HA 5CA6A 4K21A 3HEIA 3SH3A 4QKBA 1QOSA 1WCKA 1BYHA 1XBFA 5FO7B 2R061 4E4ZA 5DXDA 4UF0A 2QUOA 2HWE2 1NLQA 3L2HA 2YBSA 4IW3A 5GZFA 5FR3A 4GULA 4QHZA 3PVEA 2QNKA 1C1FA 4RL7A 1UZWA 4XUPA 3R4SA 5EQUA 3H3UA 3RZMA 4YM3A 2TUNA 3A7QA 2ARAA 1WBFA 2UY9A 2WQZC 3RI9A 3ZVXA 4AVSA 2WSUA 3NL1A 5JDBA 1PVXA 1ZZ7A 1XSQA 1UZ0A 3OGGA 1M4WA 1BJQA 4OYUA 3S7EA 4P5YA 5I8YA 1NG0A 1QWRA 3B01A 3OYWB 3WXPA 3WNMA 3DKQA 3IAPA 4QHBA 3ZFGC 1EYBA 3DYPA 1UMHA 2DTWA 4D7TA 1STMA 2WZR3 5K7PA 4W6XA 4NPMA 4QM8A 4LBMA 2QQOA 4LEJA 3ATGA 1IZ3A 2I07B 2XQRA 2ZGTA 1IS4A 3LPGA 3OCPA 3SISA 5KHJA 4C0HA 3PHMA 1LB2A 4B7EA 5A3MA 2A5ZA 1CWPA 1IPSA 3U4XA 3BUCA 1RVF2 4IEPA 4RS5C 2VXRA 4F8AA 1AJOA 2JIJA 1G9FA 3GYDA 4NHKA 1XYOA 1W8UA 2EXJA 3U10A 1RUF2 2E63A 2VCAA 4NVPA 4CDXA 1TMF2 2GP3A 3ES1A 5JAXA 2P3KA 1JHNA 4Q4X3 4L99A 3TOJA 4IXLA 3T30A 3I97A 3AP6A 4IETA 4A44A 3M3OA 3QACA 3ZN6A 5IT6A 4NHXA 2CWMA 4P08A 3VGIA 4FOVA 1Q3EA 2GH2A 2IC1A 3ELNA 4MGSA 2VTXJ 3FFZA 2Z4FA 2DFBA 1PO22 1EUUA 5FQ0B 4K8FA 1AXZA 4KL1A 4CP2A 3KV4A 1MZ6A 5FZCA 4CCMA 4RD7A 5FK7A 3WR0A 2DUQA 3INAA 3G7DA 3VKMA 3TEZA 3WNXA 2K0GA 3D8CA 3MW2A 3MFAA 1ZBA2 3ST7A 5GALA 2VTXA 2VZ1A 3J7LA 5BNPB 4KBZA 4RHV3 3U07A 1G9AA 4Q4V3 1CAXB 2V4VA 5IFTA 2PHTA 1S0BA 1O4YA 3Q8CA 5CFCB 2YDEA 2E26A 4JC1A 2HWD1 3GZAA 5F3IA 5A7WA 3TB0A 2MEV1 2XJUA 4AEMA 1W3XA 1NE4A 4RS5A 5BV6A 3ZXDA 2QZ3A 3H9AA 4FPKA 4JHTA 3ZKYA 3OPWA 1A78A 2RM22 2HWC1 3WUCA 1YIPA 1HRI2 2Q8CA 4L9BA 2W46A 3VBRC 3D0SA 4FPCA 4Y1VA 4ES8A 5JZGA 2V73A 1QJU1 1B09A 4LLFA 1QXJA 1RC6A 2WO7A 4SBVA 1ND3B 3WNNA 2WNVC 3O14A 1JODA 4PLMA 1JYIA 4KH9A 4JKMA 4Q1PA 3K75B 1HLCA 5G05L 2WS93 1MS8A 4OI2A 3QD6A 2XGXA 3KT1A 2QBXA 4WBBA 2PHRA 3VKLA 1YHFA 4CCJA 3VD9A 1CAVA 3M3IA 2EIGA 2PAKA 3W20A 1ASJ1 4RGGA 1YYNA 2F4PA 1K3IA 1VBE3 4E8CA 5LRSA 1K5MA 2VQUA 1WA6X 2XXZA 3HBZA 3QLQA 4NUBA 4S2GA 4TSVA 4KBBA 1HX6A 1FOD3 2P2KA 1R1ZA 3M70A 2WO2A 2ZGNA 4NPLA 3GALA 4U2AA 4X8PA 4AXOA 4CTEA 1WWYA 3LB9A 4H2AA 1PX4A 3E6CC 1HDKA 4E2SA 2Y6GA 2DF7A 1O3SA 1ND2B 1FPN1 1PGL1 3SLIA 4K1YA 3WDWA 3ZR6A 4XJUA 5L9BA 5C3OA 1YI9A 3O12A 2RS53 4LBKA 3UL2A 1W6NB 1KJRA 3N9MA 2OQ7A 1D4M2 5CZKA 2ZMNA 1HV1A 2RMU3 4QKNA 2E7QA 1PK6C 3RMXA 3ACFA 4C0BA 1U5XA 2A6ZA 4W6WA 2YYOA 3A0NA 3WDYA 4P5HA 4AG4A 2RHPA 1DGRA 3WW2A 3OJBA 1LKNA 3ZFFB 3GCWA 1RXGA 3LA2A 1S0DA 3LFIA 5A7PA 2G9ZA 4JVAA 1OOPC 3RS6A 3V0BB 1GWLA 2RS12 4UW3A 3JBG1 3NV4A 5EYXA 5FYYA 2X05A 3BI3A 2EAKA 2IUWA 1UU5A 3J9SA 2D3PA 3I3QA 2A3WA 1IQDC 3R05A 3W5NA 4NIDA 1XOYA 2BGOA 4HLTA 5A32B 1W0OA 2OPKA 5GLTA 4A41A 4XEZA 5KHKA 1H2KA 3GBGA 3WSOA 1L7QA 3PTYA 3TAYA 3USUA 2PXJA 4GAZA 4BQ2A 3D6EA 4NN0A 4XDOA 4ZU7A 2BP6A 1CZSA 1NLSA 3VHNA 1A8MA 5FMDA 1R082 1S0CA 1ZM1A 2VW0A 4DXZA 3B02A 3QCWA 1BEV1 2JG9B 1OLMA 4MXWA 1CIYA 4QPYA 4QQ2A 4QPGA 4I01A 5CKNA 1O59A 4PBOA 1X9TA 4ISRA 3DGTA 3N7LA 2XH6A 2IWGB 3WW4A 5IHRA 1W9TA 4E2GA 1AR71 3AP9A 4JGYC 1NA1B 5F1RA 1SMVA 3UNPA 4QPIB 4FAGA 4XF3A 4YG3A 1J1LA 3OUIA 5FYZA 3M3QA 5FZOB 1UU6A 4CDWC 4MG2A 1AXYA 4CDQB 1HIXA 1DHKB 3FLTA 2B8MA 1PK6A 5AC91 1AX1A 1AR92 1F35A 1RUC1 3FMGA 4XJAA 1UOJA 2VMHA 3VZKA 2HWE1 2AYHA 3LOIA 3VD4A 2RVAA 4OQ9A 3LKJA 4OI4A 2UYBA 2ZGLA 3ZYGA 2ZACA 3ILFA 3T0AA 3WD5A 3ACLA 3BTYA 1QQP2 4MV2A 2PN5A 5T5JA 1D0GA 5KC6A 1ZX5A 3WW3A 3T2TA 1QKQA 4ZONA 2WLPA 4RSUA 3ZXAC 3RYKA 2SBAA 3AL6A 1HQWA 1UO9A 1FATA 3S7IA 1DQ5A 5FZ7A 3A22A 2K2SA 3O1VA 2L9LA 2JDAA 5I0RA 5FZDA 4XYXA 2P34A 1UF2C 1VBC3 5FMCA 2YHJA 3ZSJA 1R64A 2EA7A 1V6NA 2WC2A 2JENA 3DYMA 4GMP0 4DFSA 2Y60A 4DY5A 2PMWB 5EJ1B 2XG3A 3CQOA 1TME2 5T5OA 4FFGA 2EAAA 3NQHA 2PHFA 1GQGA 2VZRA 2D5FA 2D6NA 4XW3A 3WNKA 2WZR1 3OGJA 1KDMA 2VECA 4CP9A 2LS6A 1Y4WA 2QQPA 3AZVA 4YZ1A 4META 3BU0A 4WVWA 3SNMA 3WQ1A 4CXXA 1PMJX 4CXYA 1XE0A 3K51A 4PDWB 3MIFA 3H42B 3VBUC 2A6YA 3W5MA 3OGSA 1ZZ9A 2Z5WA 5DZEA 4A6OA 5HV0A 1LODA 2YC0A 3LWCA 3S30A 1TMF1 1I6XA 1ULGA 4W4ZA 5FY4A 2UU8A 2JDYA 4FFIA 5FK8A 4A45A 3H8UA 4MGZE 4AHXA 2J42A 5B2GB 5IYYA 1TZOA 3AK0A 1AR63 5J3UA 2NPIA 4YWAA 4RQPC 4Q0QA 3TWIA 3RMYA 4LHNA 1ZA7A 5C3RA 2D6KA 2D5HA 1UZVA 2WKKA 3THPA 2F6BA 4B1LA 4XUTA 5F7UA 1JOBA 1SZBA 3PUSA 4GB32 3NAPC 2WQ4A 5GLZA 2BFUL 2VE1A 2W1WA 1DQ6A 4HVOA 1VP6A 4XFBA 3ZYJB 1I5PA 3RNSA 5FYIA 4GXLA 2DVDA 1L7RA 5EZWA 3VBHB 1RB8G 2BZDA 5JOXA 1GANA 4FPLA 2MPFA 1T6GC 4LNVA 5FXXA 3T08A 5JR2A 5BNNA 1AL0G 1LOEA 3TN92 1E5IA 5C33A 5A3WA 4CEWA 1UPIA 3MZHA 5CADA 3BODA 5FLJA 2VO5A 4IV1B 1NQJA 1POQA 1XNAA 3CJIC 1QHDA 1C28A 4DINB 2QJVA 4PF5A 4NHMA 3WLUA 4AWDA 4AHWA 1O8PA 4HANA 1PX3A 3UJQA 1W8NA 5C9AB 1HJGA 4RHV1 2Q5TA 2BDRA 1MQTC 2X29A 5FYBA 1S4CA 3VBUA 2CGPA 4YFWA 5FP8A 3WG1A 4A6SA 5F5IA 2ET7A 4LXLA 5ACA3 3ZPOA 4XFGA 4JZRA 5ERLA 4QGLA 4FPHA 2YPJA 1ENQA 2RDRA 1N1VA 3MIHA 4D6RA 2AGSA 2XOMA 5JMCA 4H7MA 4RQPA 2W2IA 3KB5A 1IS6A 4BMBA 2XHKA 3HQUA 5FZ1A 3URFA 1GOFA 1JUHA 3IMNA 4NE9A 5EHDA 1QJY3 4WM7B 3NAPA 5IK4A 3FC0A 2R6QA 5C3QA 5FUNA 4A4AA 4R9DA 4NIHA 4BA6A 1N1TA 1W9WA 2WWSA 4K40A 3H50A 4HL0A 1COV3 5FV3A 1LHOA 2RDSA 2WS91 4Y33A 4BK5A 1VBD3 5JPMB 1H2NA 4KG0A 3VBSA 2Y34A 3IT8A 4HVRA 4HXCA 4LO8A 1W8WA 1H9WA 2B45X 4CXWA 3UJOA 4COZA 2FCTA 3O0WA 1VBE1 2LM3A 2D97A 1UWWA 4NRPA 4LBQB 2WL1A 4OHWA 4XF4A 1RUG3 1RUJ3 3PNAA 2GC3A 4UAPA 4H55A 3RDIA 4QX2A 4B4RA 2VUAA 4FOQA 4UXAA 4XTMA 3AMHA 4AI2A 4ASMB 4XBNA 5CFDB 5CBLA 4G3YC 2V5DA 3WV6A 1O4ZA 4UW4A 4IUGA 1LRHA 3VKNA 4A42A 1POV0 5LBBA 3NNJA 4IE4A 3VV1A 1ZRRA 2Y0OA 2AEZA 3C7HA 1LENA 5B4XA 2BVVA 4LO5B 4CDUC 1W6PA 4RR3A 1PVC2 1E5RA 5KBFA 4LPLA 1J84A 1ENXA 3IDBB 4QXBA 4YM1A 3T3YA 5CU1A 3CLPA 1FAYA 3KGZA 5JI9A 1DU3D 3U4SA 3OBRA 4XUQA 2W3JA 4S2DA 5KXDA 2BPA2 2VCMA 4DUWA 4IL7A 1AL22 4R9AA 2YU1A 1YC61 3MLJA 1QMJA 4UFMA 3AXDA 3P1IA 4GKXA 2VTFA 1W06A 4YNIA 1R081 3MBWA 1NYWA 4CUBA 3T2OA 1JS9A 2Q1MA 3FFQA 4Y1XA 3HNYM 1AF9A 1SLLA 4HBNA 1DQ0A 5A33A 3BPSA 2VUJA 5IAVA 1PZ8A 4DNYA 5F5QA 1RGSA 1OKOA 1UX7A 2D40A 2DCZA 3KQ4B 2AUYA 5C4WC 1FXZA 1JZ7A 5C3PA 4AE2A 1JUIA 1MEC3 3MF6A 3VKOA 2G19A 4CCLA 3JUUA 3B00A 4P9LA 1VBB2 2QVSB 4MOAA 1RUI2 1RUD2 3T09A 3OBTA 3E5QA 1XC6A 4O65A 1TNRA 3RYPA 1B35B 5FREA 4QWNA 5BNOB 4NJ4A 2VULA 3WDTA 2UWBA 4YZ4A 5F32A 4AAXA 1AR91 1DQ2A 2EIEA 1DGWX 4XIKA 5I8SA 4B3NA 2RJLA 2X5IC 3BTXA 1V6MA 4XF0A 3KF5A 4I3PA 4UYBA 4BCUA 1W6MB 4XHXA 4XTPA 4N43B 4DQAA 3N35A 4CSWA 3VD3A 1HQNA 4FI9A 4IEWA 3P3PA 3RZJA 2HBTA 4LLOA 2CL2A 5FY5A 2FD8A 2BEOA 2VY0A 4XFHA 3CKHA 3C8XA 3PDQA 4QQLA 2BYVE 2WWJA 4E27A 2VZTA 5FYHA 5J37A 5D2AA 4NAOA 3RZLA 4OFGA 1BQPA 3ZXKA 4CE8A 1OA3A 2PLV3 1X82A 3GZEA 4HPKA 5L9VA 1HRV3 4MGYE 4YZ5A 5JCTA 2J1UA 2VOXA 3T4VA 4R8HA 4CZSA 4FCAA 3B94A 4N90A 1CPNA 1OD3A 1Q8VA 1W6QB 3HR9A 3ZKUA 2HWD3 2XQXA 5LASA 4YARA 2GNMA 5C4WA 1YXWA 3KT4A 1VBC1 4J6GA 3N9QA 4M4PA 4AZZA 1SBEA 1PHMA 1Y43B 2OUHA 3A4UA 3WOGA 4YGEA 5JUVA 5F39A 3DN7A 2ID4A 1OD5A 1DGWA 5J96B 4LE4A 2HWC3 5D8AC 4AFBA 1DIWA 3AB0A 5FYUA 3WY6A 3Q8EA 1HN1A 4P9GA 1GICA 1S0FA 4QX0A 1DQ4A 4Y24A 5AC93 1QJU3 4LK7A 3ZDSA 3IMMA 4EN8B 2ILMA 5FYTA 4R4ZA 2X5IA 1R1A3 2OT7A 2RDQA 2ZEYA 2W92A 4DUXA 5IFPA 4GD4A 3OPTA 3S6PA 3OYWA 1PGW2 2GMPA 2NM1A 1J1TA 3ON7A 5FP4A 3HIFA 5C7GA 5JSRA 1J59A 2WYSA 2QQWA 1OH4A 3NNMA 3AZXA 5FOJB 4NPRA 3CHXA 1ASJ3 3W58A 5DDJ2 5FZHA 4CPBD 4I0AA 3LDBA 2XHNA 2FDIA 4JTOA 4DO0A 1ZVFA 3ZFEB 1C57A 5ABJB 2E53A 2IXKA 3EXUA 3LA3A 3P6BA 5B4NA 5JIUA 3B5LB 1BZWA 4ZS3A 3EO6A 2G9FA 5CFCC 4X8NA 2A73B 1VBA3 1REFA 1Z78A 4JGZC 3AVSA 4MHUA 2HYXA 1FPN3 4MGIE 3SITA 3WUDA 1CJPA 1RYYA 2DVGA 2QQJA 1V9U2 1O3RA 3KT7A 4PLNA 3UKNA 1Z7S3 2JICA 2D93A 1H9PA 4INDA 4W50A 4RFRB 5DABA 1AR82 2D6OX 2C0ZA 1NCRC 4P14A 1KDKA 4Q0PA 3T2QA 5DPNA 4LHKA 5FZBA 2Z42A 4YRDA 3ZXLA 5J09A 1RHI3 4NIAA 5HXMA 4LE3A 2BOIA 2DCJA 4ZU4A 1ND3C 3U78A 4TXWA 5FWJA 3PURA 2OIIA 2BNOA 4JQRA 1EP0A 1RMU3 2GAUA 2RE9A 1NKGA 4ZXEA 4XE9A 4LBOA 1NLRA 2ZGOA 4HZFA 1MS3A 1ZZ8A 4O61A 4UOJA 5FQ0A 2R073 2ZX1A 2ZGQA 1CZVA 4X6RB 4Z07A 4YVWB 5FZ9A 2WWUA 5FZMA 3SEEA 4AR2A 1C5IA 4CCNA 1F9KA 1CAWB 3GM8A 4WM8B 1HXS2 5I0DA 1I5ZA 2RR13 4NO4A 5CNAA 3JD72 2EICA 3WQ7A 2PFWA 2QZ2A 4BHPA 3TNQA 1Q8PA 3MYXA 3QOPA 3HAGA 3PUQA 5DG2A 4B8EA 1QJFA 5BNPA 4MVTA 1BEV3 4XZPA 5JR7B 1CAXA 2Q4SA 5F6LB 3KHBA 2DVBA 1QJY1 3ORJA 3ZMOA 3DKWA 3PUIA 4FXGB 5CFCA 4JGZA 1KITA 5D1IA 1AR73 4J25A 3N9PA 1I9RA 4GH4B 4QM9A 4YZ2A 5IVJA 3L9JT 3ETPA 1UZZA 1JZ6A 4HG6B 4PQQA 3DV8A 4PCRA 1XPWA 2K9ZA 5JMOA 1LR5A 2JKBA 4AGVA 2XMLA 2W47A 3JB4C 2D43A 2H0VA 1NCRA 1W9YA 2UY8A 5BY5A 3RG0A 4Q5OA 2P3IA 5FP7A 2D6MA 4OI1A 1WKYA 2HWE3 1H1IA 3MPBA 1UXXX 1V70A 1VMHA 2A6WA 1AX0A 2VOWA 4GMP1 1ND3A 2WT2A 3AMPA 2HWB2 2CTVA 1ZZCA 2YG0A 1NOVA 1RUG1 1UKGA 3C2UA 5E88A 4FT8A 4NIIA 3ZR5A 4MSVA 1G9CA 3M2MA 5FPBA 2VW1A 1APNA 1PVC1 2O8QA 4CDXC 4GJYA 5A1LA 2P37A 2OUJA 2XL9A 1SDDB 2CDPA 4OHZA 5CIRA 5C8CB 2ZX2A 2GNBA 2XJVA 3KS7A 3HQXA 2XKOA 4QKDA 2WINB 1IKPA 1W99A 5EFUA 5K0UC 1JZ3A 1H6YA 3NV3A 2IXJA 2QCSB 4QX3A 1W2OA 3WP6A 2Q1FA 4YW1A 4D7YA 2UWCA 2YROA 3I2KA 3VZMA 2AC1A 1OA4A 2X10A 1ND2A 1OURA 3LQCA 1F5FA 3MO4A 1H2MA 1OQDA 2BWCA 3DPRB 2VL4A 1OPMA 5FYSA 4C90A 2GC1A 3WF1A 4HK9A 3PU8A 1W6NA 2YBPA 3H8RA 4Y20B 1LHUA 5FAXA 2VCCA 3RQ0A 1SACA 3IKWA 1YNAA 1GP5A 1RVF3 1ST8A 4XAAA 1OFSA 4XILA 4XJ8A 3I8TA 4ES9A 5FPXA 4FTSA 1Q8OA 1JBCA 3JCIA 3ZFFA 4BLJA 4AHZA 1WCSA 2SLIA 1RUF3 3WQBA 2RJKA 3MUZ1 2R32A 1SFYA 1TMF3 5CISA 1OUXA 1Q8QA 1WMDA 1MS4A 2VGDA 3BVCA 1MEC1 3VDBA 3O1SA 3VBFB 2Y26A 4MUVA 3MDPA 4PI0A 2VUCA 4LTAA 3UKVA 5A32A 2RJ2A 1LOBA 2AZ5A 4XQWA 4LT5A 4CCOA 2YGLA 3NSTA 1RUH1 4MZUA 3WHUA 3UGGA 2Q8EA 4BZ4A 5JZGC 3WINE 3AP5A 4XVHA 2JDHA 1R092 3HJRA 4NHLA 1LAJA 1S0EA 5KWRA 1X8MA 1N3OA 2ZXQA 4FP2A 4FP3A 4LUKA 3PMEA 4DRRA 5K0UA 4QT6A 1PMIA 4YSFA 3OB8A 4N9IA 5A3NA 4Q8LA 2IVIB 3MLKA 4KQ7A 4A2UA 2X8KA 4J1WA 1OH3A 1W39A 1WW5A 1UYXA 4M01A 3WF0A 1LEMA 4K7JA 1NA1A 1ZBA3 3OOXA 1K5MC 1SLCA 2XVGA 4XXPA 3V0AB 1TEIA 2VG9A 3SCHA 4HT1T 2VNVA 1S0JA 5FZOA 1W28A 3KGLA 5A1FA 3CL1A 4PDWC 3J8F1 2QKDA 4M3CB 1JU4A 2PLV1 1HRV1 3THCA 1DCSA 5FZKA 2UWAA 1KGYA 3K46A 5CG9A 1RINA 5E1RA 1EV12 5DAQA 4F3JA 1Y9GA 1F5JA 1T6BX 4Q4X2 3LSEA 1KRIA 2RM23 1HRI3 1QDCA 2QQIA 2ZZJA 4M3CE 2WQ8A 1UCXA 3CBNA 4IGPA 1PO12 2IXCA 3MICA 2WNOA 1UY3A 4QQPA 2GALA 3SHRA 1TVGA 1ZRIA 4IEOA 3O0VA 3AKQA 3E5XA 4FOYA 2VZVA 1A3KA 3JXSA 4ZZ5A 1G86A 2XVLA 3POWA 4AEKA 4LBLA 5E8AA 1PGW1 2R042 4HETA 2QTWB 2PHUA 2R7EB 5FJHA 2VQ0A 1E5SA 1JHJA 5FXWA 3R4DB 4A3ZA 1FMD2 4Z8BA 3RRDA 1POV1 2IFRA 3OF1A 1SHWB 1KS4A 1URXA 1WW6A 1R1A1 3N36A 1GFF2 3M8LA 2A6VA 1N3PA 3M3EA 5E16A 3WCRA 4LKDA 3POEA 2DBIA 4A7KA 5LBFA 1W2NA 4QX8A 2GC0A 3MV01 2VZUA 5FPAA 4AHYA 2CGOA 3GZTB 3O1TA 5A6ZA 1EAH2 1TG7A 3OD0A 5FZGA 4CP0A 2NLRA 2GNTA 4MLOA 1DYPA 2GMMA 3AYEA 1GP6A 5JPNB 1D2SA 4YW2A 5I0SA 4PDWA 1V6JA 4QPGC 4N53B 4KWLA 1ENSA 3ZXGA 1WD3A 1D4M3 3AFKA 1VBA1 1IG0A 1GV9A 1YFYA 1SBDA 1XNKA 1MS1A 2R1BA 3NKGA 1LOGA 2VPVA 1KJLA 1DYKA 1OXCA 1GNZA 1Z7S1 3HBKA 4U36A 1CIWA 5IATA 2WN2A 1LEDA 2QFEA 2Z2SB 2ZBJA 4CA9A 4CCKA 5FZ6A 4Z1VA 3GHNA 3AKRA 4GWJA 3GZUC 4EWAA 4G4FA 4Q26A 5E89A 1RHI1 4Q2FA 1QDOA 5I91A 1LGBA 2DYCA 5DQ0A 3SCFA 1CPMA 4NRQA 2PELA 4IV3B 4QDQA 5HV4A 1RMU1 3MUY1 3VBHA 2JG8B 1FOD2 1VIWB 2NYYA 2AEYA 2VZOA 5IVCA 3VZNA 1SQ4A 1DLCA 1OUSA 3JD71 3BCWA 3MF9A 1R083 2VNRA 4LOSA 3SCGA 2R071 4R52A 4HOOA 3BTAA 3QH7A 4Q4Y2 5L7OB 4CUAA 2J22A 2RR11 2KD7A 5CFDC 5A70A 4IE5A 2RS52 4C1WA 3EJKA 1V6KA 1EPZA 2ARBA 3Q8FA 4YVSB 4CCCA 5C9AA 1PNGA 2RMU2 5LEKA 3H8XA 3I2OA 1H4GA 2JDNA 2AENA 3JQXA 2WR9A 1ULCA 1VB2A 3I2GA 5C8WA 5BPXA 3AP4A 3ZIWA 2XUMA 5DAWA 5EYYA 3I59B 1AR93 4KWJA 3FN9A 3RWKX 1O3TA 4MH0E 1ZRCA 1NY72 1MS9A 3NJYA 3GJAA 3AX4A 2HWB1 1KD7A 3GBFA 4LOTA 1HN0A 1RUE2 1ULEA 2I45A 1C8M2 1QQP3 3K3OA 3NO8A 2OW4A 4K6BA 1NCQB 4ET7A 4YGDA 2EIBA 1OF3A 4ZU5A 1VPHA 4C91A 1LNSA 1OBNA 3UT0A 2GH8A 3A0KA 4QQOA 3POIA 4B1MA 1O5LA 3D0JA 3R4UA 1OQEA 2QQUA 3SXWA 3ZFGB 1BVVA 3O1UA 1GKBA 1QNYA 4Y1ZA 3RJ2X 1REEA 1RL3A 4JX0A 2G4IA 1H4HA 3NV2A 3OSDA 2ZAHA 5FKBA 4LBJA 3U11A 4D7SA 3FUQA 3G6JB 3WX5A 1BVP1 3Q8AA 3DF0A 4LBQA 5KHIA 4XAEA 2XWJB 1TME3 1W8OA 3IAQA 1UIKA 5CFDA 3TEYA 3POYA 1ZRDA 2FCVA 1LHVA 1O7FA 1UL9A 2YXSA 3GNEA 5DAPA 5K9YA 3RZGA 4P9JA 3U75A 4XXAA 2ZKNA 3NWKA 4I0WB 3PLQA 5FYVA 5A7WB 5BNNC 5JXIA 3N7MA 4DEQA 3KHCA 4CEWC 5KXEA 3KVAA 5GM0A 1YFXA 2WFPA 3N7KA 5HCBA 3VD5A 3OGRA 1J58A 2O8OA 3LDKA 1CESA 2AREA 4LUMA 2VW2A 2ATFA 1TE1B 2FQPA 4LMFA 1LTEA 2VAUA 4PLOA 4XC9A 1BBT2 4YW6A 1SG3A 3BALA 5ANNA 5F5AA 4Y26A 3B9IA 1W6OB 1RVF1 4PF1A 3DEMA 2FZ2A 1XYNA 5GLUA 1H1MA 4IEXA 5K4LA 3ZLIA 1RUF1 4E4DX 4FSJA 5FMBA 5FPVA 4YYOA 3UKTA 4GB33 1OA2A 1IKQA 4AQSA 2ZA9A 3I2IA 4KU8A 5DG1A 3PU3A 1CAVB 4O9GA 4OUSA 3R6SA 4EN6B 4BJ0A 4P00B 1UX6A 3VN4A 3FBMA 4S2HA 1W2UA 2ZGMA 4E9KA 2IZWA 2VMGA 2BU9A 1YIFA 1H1AA 2YFUA 2OS2A 2WA4A 2O14A 3N3HA 5CAZA 3N4MA 5JOWA 1X7NA 4L0PA 4AVAA 4JKLA 2ZPXA 2ZKLA 1WLTA 5F8PA 1DP0A 1PO21 2B42B 3GBWA 4JDOA 1I3HA 4LR4A 4N7UA 1JYWA 4QXCA 4AAPA 4XFIA 4Q8KA 3MLLA 3AVRA 5LWBA 1IHMA 2OQ6A 2YC2A 3VBSC 4BDVB 5C5UA 4H3WA 4LIVA 2BGPA 5LA9A 1FYUA 1VR3A 1VE0A 5CKQA 3RZKA 1B35A 2JEMA 2B4KA 3NJXA 4M0NA 4W65A 2Y33A 3IDCB 4CVUA 2X53S 3AMNA 2Y6KA 1ZBA1 4NRMA 5JSOA 1UOFA 2ZABA 2B7YA 4GA9A 3AC0A 4AFCA 1JTZX 3CMGA 2UYAA 5FPLA 3TRSB 2BTVC 1JOPA 2WNEA 3PVBB 1W6MA 3AXEA 2R30A 3NNGA 4N43A 1AR62 3AFGA 4JCKA 4P02B 3VBRB 2Y6FA 1RUOA 1VRH2 1C5HA 1V00A 2ZGSA 3IIIA 2J1TA 2MNGA 2ZHNA 1AYM2 2E51A 1E5HA 3CJXA 3SKJE 4LKSA 2YZ4A 1NZIA 3B69A 2WNVB 1RUNA 2ZGPA 1I1EA 3H3LA 1ODMA 1DF0A 2RM21 2XBO2 4Q4W2 3IN9A 1HRI1 4RR3C 5CVRA 2WO1A 3LAGA 3OG2A 4XPVA 1UZYA 2FDFA 4KWKA 2VQTA 1GZTA 5G04L 5F3CA 5J7MA 5A7NA 2P1BA 3IDAA 3KVBA 3KWVA 3VDDB 4HN0A 1DFQA 3K4ZA 4GALA 5FZLA 2CWSA 3USUB 2AH2A 1YQ8A 4KWUA 4JQTA 3UYJA 5F3EA 3UESA 1QEXA 5FPUA 1JZ8A 5GZCA 4OQ8A 1W6QA 5T55A 2ERFA 3OY8B 1D4VB 5FZ4A 4LBQD 2YMZA 4QB6A 4QU2A 4AEDB 2P6HA 3DXUA 4MXWB 5C6CA 3KLSA 2BFUS 1O4TA 3ZYPA 5LY1A 2ORXA 4FFFA 2GZWA 1DDLA 3LIGA 2PAMA 1XNTA 4ATEA 2XUEA 1U5YA 4XOGA 1HB3A 1VLNA 5FLIA 2B9VA 4GMP3 1CZTA 1OC1A 2JB4A 4QX5A 4XHBA 2A3XA 3FUOA 3HOBA 2DU0A 3PJQA 1PK6B 1GUIA 4DUVA 5FMOL 2P3YA 4LQRA 4OCTA 1AYN2 4DB5A 3OEAA 1PVC3 1YQ2A 3FHQA 1ONAA 4V1PA 1X50A 4OLLA 1D4M1 1OOPB 4PI2A 4Z82A 2PHLA 3MV11 4AVVA 1ZBE2 1QJX2 4BM8A 3GF6A 2ADEA 3A23A 3IZOA 4MYEA 2WFF2 2V4AA 3AYDA 1LOAA 3ZN5A 3RZZA 1AL23 1H8TC 3KV9A 4LULA 3MIBA 3ZFEA 5ABJA 4WZFA 1VJ2A 1NE6A 1W9FA 2RS11 1XNDA 4Q1RA 5JVVA 5LATA 1O91A 3OUHA 4XJWA 3PVOA 2BNNA 3LSDA 2FZ1A 5A6XA 3LCPA 5F5CA 5A6QA 4UFLA 1UOBA 1J83A 2HH9A 2H6BA 4A3XA 4CPBA 3AKSA 5F37A 3UGHA 5KXBA 3MI8A 5HCAA 1RUJ2 4I30A 4XCAA 2B9UA 3JZVA 3SKVA 1HW5A 4AI3A 2R062 4JGYB 5C70A 1ZRFA 1GR3A 4XQ4A 1BKZA 5FY0A 4BK4A 2RS32 2ARCA 1FV2A 5GLWA 1RUI3 1RUD3 3KZ4C 2A7AA 4CDWB 1T2XA 5FUIA 1GYKA 2JWPA 2YUEA 4XBQA 3M7AA 1CONA 2BNMA 1UYZA 3ACGA 4XIOA 1BHGA 3S57A 3WG4A 4IESA 3HQRA 5F6KA 4XETA 5EP9A 3GHMA 3BTZA 4Y5Z0 4YVWA 3VBOB 1IG3A 1RUH3 2W91A 5L73A 2D98A 1CAWA 2DCYA 4Y22B 4WM8A 2PHWA 3LD8A 4P9YA 5GLVA 4DOUA 1W90A 1LU2A 2ETEA 3HT1A 3LA7A 1JXNA 4E4HA 3VLBB 3S5AA 1H8TA 4UW6A 4YM0A 3VUOA 4ZPIA 4BQ3A 1WLWA 1YFUA 4XF9A 1QQP1 4KI5M 3ZYHA 2ZGUA 4W8JA 4AF9A 4NWWA 3WW1A 3IBMA 4QHOA 4EN7B 1ALYA 5GZGA 2VC9A 3ENRA 1RJ8A 3TNPB 3H7YA 2E33A 1YWKA 4N7IA 3J8F3 1QOOA 3N9OA 4RYDA 2LROA 4JHZA 3N9LA 5DUXA 1W3VA 2YV8A 4L92A 1D0HA 1PM7A 4AQ6A 1F4AA 2VD7A 4WVVA 5DUWA 3W21A 1MVQA 2E7TA 4FPOB 1NXMA 2D3RA 1PNFA 1TME1 2CSGA 3WF3A 1CN1A 3D4KA 1AZDA 1J3PA 4LORA 2IXIA 3DCQA 2P6CA 3C7FA 1BBT1 2HEVF 5IK5A 1C3HA 4QXHA 1HV0A 2DV9A 3ZM8A 1IPKA 3E6BA 4P9WA 5FOBB 2ARXA 1WD4A 1AX2A 1LCLA 4XZUG 2J1SA 2ZEZA 1ENRA 1SBFA 1YFWA 4HONA 1PIV2 3JQWA 1BMV2 1POV3 4FFHA 2E9QA 1JYVA 4XUNA 3UK9A 3IWZA 4PJYA 4KGGA 4WVZA 1OPOA 1PM4A 5E6HA 1W0NA 4HK8A 5T3NA 5T5LA 3WP5A 4ORFA 3KV5A 4K3UA 4LK6A 1UIJA 3OTFA 3DPRA 4LJHA 3I3MA 4Y5TA 4UFHA 3UV9A 2D6LX 3O1OA 2E7AA 5HXVA 3AZWA 4BYYA 1H30A 1HKDA 4GB31 4Y20A 1X8EA 3ZXJA 3AMMA 4DXRA 2TBVA 1XYPA 2F4LA 4PHZA 5LA0A 5CB7A 3SEPA 2WZ8A 2MEV2 4M0HA 5BNPC 3B7MA 2BQPA 5FZIA 4D0QA 2R0HA 5KR7A 4URAA 1AR83 3LZZA 3FX3A 4PIYA 3CJIB 2DVAA 1ZNPA 2Q1ZB 4V2VA 3OUJA 2Y6LA 3IB3A 3WHTA 2JXAA 1DG6A 2CYFA 1XB9A 1UXZA 5FY1A 3TN91 1MVEA 2QE3A 3VBFA 1G8WA 2QQNA 1Q56A 2WJSA 2VVFA 3GJBA 1AJKA 4BXSV 4FAHA 1MQTB 1UOGA 4XJZA 4F83A 2EVXA 2R1DA 2W9XA 5L19A 1YJKA 5IVVA 5F9TA 2R49A 4AI1A 5LEJA 3LGRA 1WMEA 3ZSMA 3LEGA 4QB1A 3AP7A 4L2NA 1YO8A 2VVDA 3KCCA 2PAEA 4FTBA 1SCSA 3N7JA 4EWDA 1GZWB 4XFFA 5CG8A 1Y9QA 3BPZA 3CZJA 4MGKE 1OT5A 4B4QA 4BH9A 3O0XA 4AFMA 2ZGKA 1S2KA 4R4XA 5A6YA 1HXS3 5JXHA 5IK7A 2NN8A 3JD73 2P5BA 2W39A 3X29B 2ZX3A 4AI8A 5BUVA 4BQ1A 2DURA 2PQQA 1CVNA 4LIUA 3V0AA 2RG4A 4QDRA 4CP1A 5A3UA 1DLLA 2BUKA 1PGL2 3POFA 5JWPA 4QX1A 3V65A 4QPWA 3PIJA 5LRRA 2E31A 3ZYFA 3VB9A 1CAUB 3WG3A 5GKAC 3AJYA 3M4FA 1GNYA 2W94A 4M3CA 2YY1A 5FKCA 2ZEXA 3PIGA 3CNAA 4HKOA 1ND2C 5FXZA 2NP0A 2Q8OA 2WUHA 2HWF2 5L9RA 3POSA 4LKEA 2Z69A 2VZPA 5IVBA 3O1RA 1O8SA 3W9AA 4TTGA 1JN2P 1LOFC 2QQVA 4UFIA 4CCEA 4JDMA 3NV1A 1WLDA 5F3GA 3HVDA 3JBG2 5FPZA 5LZ6A 1WBLA 4EE2A 2EIDA 1RTVA 2HWB3 3L2YA 1D2QA 2XONA 5FY9A 1AUYA 2W1UA 2XJPA 3ZPYA 5C3SA 3ZFFC 4CDUB 1AYN1 3H3ZA 2ZHMA 4MGQA 4A7YA 4Z92B 1GWMA 1SPPB 4ZHNA 3OPZA 2JECA 2C9KA 3FWEA 1QXPA 1CJDA 1UN1A 3J4UH 2C4XA 2WYFA 1FNZA 2W68A 4QXKA 1WCUA 2MHFA 2WO3A 3T0DA 2DDUA 2I2SA 3IDEA 3GGLA 4OHXA 1WW4A 4UWDA 5FZ8A 5AFEA 4P9IA 3K4AA 3NMBA 3ZO0B 1DYOA 4DXTA 3I4IA 3J7NA 5L7OC 1BK1A 1OLQA 2A6XA 2WNUB 2YGMA 1AR72 1ZA4A 3FZ3A 2JDUA 3T1LA 1GLHA 1AL21 2BJSA 4YVSC 2ZHKA 4WVMB 1PZ9A 2JG9C 2IFWA 2XLGA 4FO9A 4N53A 4EYUA 3APBA 5H9QA 4XURA 3K77A 1IQAA 4XUOA 5C4WB 1NA1C 3MIDA 1RUC2 5AC92 2VH9A 1QXRA 2QQLA 4Y1UA 4QPIC 1M06G 3AJZA 2RS31 5FP3A 4FPYA 4ASKA 4NOTA 4XFCA 1GOHA 4CDQC 1UY0A 1LOFA 3ALQA 4E4SA 3GXUA 4FQ4A 5JLVA 2GSYA 1NCQC 3WF2A 1VMJA 2D7FA 2WAOA 2H0BA 3N9NA 3ZN4A 5FBZA 1VBB1 2X5IB 3KCYA 2ZHLA 1RUI1 1RUD1 3VHOA 3MPPG 4IV3A 3NW4A 3V0BA 4YGBA 5DAVA 2JG8A 3FL7A 3KM5A 4AEJA 2Y38A 4EROA 3OBZA 1XU1A 3EB7A 1R093 2GU9A 5GJ6A 2JE8A 1GNHA 5GZDA 1Y9MA 1ULDA 3POJA 1MZ5A 2XPJA 2CY6A 1BLZA 2EXKA 4LA3A 3UGFA 4DY3A 1SLAA 1SDWA 1OVPA 1SLTA 4NWVA 2IXLA 4UI9L 3S5QA 3B9CA 2WLQA 4AFDA 4CYDA 5CKMA 3WDXA 4BMEA 5L7OA 2I74A 1UMZA 4IE7A 1PO23 3J7MA 1A34A 1UKRA 4D6SA 2WZR2 4IEQA 4YG0A 4KGQA 4N8MA 1OFNA 5T52A 2WZPP 4XABA 4YVSA 5I8TA 3AYAA 1CR7A 2JG9A 3K48A 2LRPA 1IPJA 2RDNA 1BXHA 1UY4A 2LUWA 5FZFA 2C24A 4I3GA 1DGRN 2H6CA 5F2WA 3BOWA 3NRUA 3I59A 3VZJA 1UYPA 1Q5OA 4I2OA 4N9HA 3HNBM 2V5YA 3I3DA 4I0BA 4K1ZA 4QPIA 4UFJA 1EV13 2UURA 3LOBA 5DAXA 1C1LA 3VHRA 5JOZA 3ZSEA 4CDQA 1U5ZA 1FX5A 2Z79A 3HN3A 4Q27A 5D8AB 2QQKA 1XNBA 4BQYA 1UNBA 3SH4A 1PO13 3ES4A 4Y1YA 3ZXEA 1NCQA 2JDMA 2JDPA 3DL3A 5LW9A 2JX9A 3LEMA 5FIXA 2CGNA 3R0RA 4K20A 4UBGA 3WNLA 1JU3A 3J26N 1F15A 2VZ3A 4IGQA 4XACA 1ZYBA 2OZJA 2GN7A 2R043 2Y64A 1ZREA 4TLFA 2C6SA 4YW5A 3ZFGA 3WG2A 3DECA 3RPQA 1FMD3 4NAMA 1PIV1 2G9GA 4XFAA 3V56A 1BMV1 2TNFA 3K2OA 4CU7A 3POBA 4HMZA 2HBUA 4EZHA 2BERA 3IPVB 4AI9A 3T0BA 1HB4A 1GSLA 3JB8A 3MGUA 1X9PA 1KS5A 4QAWA 1OF4A 4QD2A 1QH6A 3VKFC 3VBHC 1HB1A
chains in the Genus database with same CATH topology
4QMAA 2LTNA 2Y0IA 3AKTA 1NZCA 1S2BA 5DDJ1 1EAH3 1DZRA 4JGZB 1U12A 4BWOA 4EN0A 5I93A 5BNQA 4RHV2 4Q4V2 2DUPA 1GZ9A 4IV1C 3KSCA 5DZGA 4Z2WA 2AR6A 1QY4A 2XJQA 5L36A 4ITCA 1NCRB 2A71A 4BIOA 1KFXL 4CEYB 5C9AC 1V9U1 1NXD1 1W6OA 3PJYA 4RGAA 3SH5A 4BE3A 4EV0A 4AYUA 3T1MA 1AR81 2ENRA 1WGPA 3D5OA 2HKXA 1QU0A 4ONUA 3E97A 2XL7A 1DZTA 3DUIA 4HSJA 3VDDC 2WT0A 4M3CF 2ZAAA 2ZS6B 2TEPA 1UPSA 2ES3A 2C5DA 2RS13 2DTYA 2WS92 4IEUA 3H0OA 4WM7C 4CRQA 4IERA 1S1AA 3FJSA 5FO9B 1OQ1A 4AEDC 4HFSA 4I09A 2XLAA 3ECQA 1G9DA 1VBE2 2VOVA 2HEYF 3Q9OA 5JOYA 2V09A 5I0TA 4C1XA 4AK3A 2NMOA 4GIQA 5EWSA 3ZXFA 4Q4Y3 2XWBB 3FLRA 3WUDA 1HXS1 2JDZA 3AMQA 2XJRA 1AHSA 4Y4YA 4YLZA 5KXCA 1V6OA 2PHXA 4FPGA 2C9AA 4IV1A 4S2FA 2HWF1 2GNDA 5J36A 2Q30A 5T5PA 3VBRA 4D69A 5GZEA 4PIXA 1Y3TA 3ZX7A 5HBAA 1BCXA 3AZZA 4Q0SA 2WNVA 3U0ZA 1A6CA 1RUE3 2BVBA 3BIWE 2EXHA 3H1YA 1C8M3 1X36A 5I0UA 2DUOA 1JYCA 2JE9A 3BU7A 4CDXB 3VDDA 5IK8A 1ZZ6A 4DRVA 3FLPA 4OZXA 3ZN6B 2JE7A 1WMFA 1S0IA 2XVKA 1HQLA 1SLBA 4WM7A 1QOTA 5K0UB 1OKQA 3OY8A 5LK5A 4AEDA 2O0OA 3MW3A 5BXXA 3NKTA 1N1SA 3KMHA 1F2NA 1LJ7A 2XKPA 3ZSLA 4LA2A 2W52A 5SV5A 1SEFA 4PBPA 4COYA 4COWA 1C4RA 4IEVA 4UW5A 5DUUA 1N47A 1QF3A 1V6IA 2A70A 1RIRA 4RA0A 5BYNA 5KHGA 4RFT0 1JH5A 1OHFA 3VBOC 1B35C 1OOPA 3MFCA 5BNOC 1BBT3 1F31A 1MZEA 2FHRA 3WQ0A 4XQDA 4RS5B 4OI0A 4ZXKA 1EPWA 3NJZA 4EJRA 4FPFA 3AZYA 4N43C 2ZX4A 1VAVA 5JZGB 4P9XA 1WW7A 2WSVA 1XE8A 2B46X 4NR1A 4HSLA 4R9BA 5H9RA 1N3QA 2B39A 1JW6A 1WLCA 1OSGA 4AVBA 2DVFA 2OVUA 1KFUL 1FV3A 5HCFA 1R091 4AGGA 4IQPA 4YGCA 1VBC2 2XJSA 2DCTA 4XMAA 4JGYA 1XNCA 4HKWA 3P3NA 1K5MB 2HEWF 1Y7BA 3TYJA 4X6QB 2VMIA 4CDWA 5TSWA 3SMHA 4OHYA 1VB4A 3WZ1A 3CO2A 3TN93 2KXLA 1OMIA 3ME2A 1G7YA 2DFCA 4COVA 4AFAA 3EBRA 4OUMA 1IOAA 4OHVA 1CD3G 4ASLA 4BIFA 1XRUA 2NQYA 3VBOA 5BNOA 1OLRA 2PTMA 1VAMA 2EALA 4Y22A 4LO7A 1VRH3 1U5IA 5JI7A 1DBNA 4L11A 5FO8B 1AYM3 4AVCA 4MX3A 3EQEA 1EV11 1O5UA 1S0GA 3ZIXA 4FQZA 4Q4X1 5HI0A 1QH7A 2XBO3 4Q4W3 2C1FA 1PO11 3BB6A 4W6YA 3IIAA 2CV6A 2FBEA 4LBNA 3ILNA 3V64A 4XF1A 3FBYA 3QBQA 2R041 3ZFEC 5ABJC 2Q0AA 4TZDA 2DCKA 1FMD1 3HT2A 3RI8A 2HYKA 3ZYRA 1MACA 4BOWA 4ISQA 4FOWA 4AW7A 3WDVA 4JTNA 4JRLA 4Q4V1 4QPGB 4XJ9A 3WP4A 2ZZQA 4QGMA 2CAUA 1EAH1 3CEWA 4G9SB 4B7KA 5FCCA 1L3JA 2NMNA 1AYN3 4PQ9A 4D3WA 4MXVA 5ACA2 2GMEA 5H9SA 1PGSA 2ZMKA 2JD4A 4FTEA 2XJTA 1ZBE3 1QJX3 4FVVA 2ZJCA 2OA2A 2WFF3 4QGNA 2LALA 3VL9A 3O7OA 2ZOEB 4R9CA 3IM0A 4YVWC 1MR5A 2W0XA 1QJY2 1RJ7A 3M3CA 4WM8C 3O5SA 4ATFA 4H14A 1YLLA 2FMYA 1J3RA 1DZQA 2PHDA 3VL8A 5KHHA 1E57A 5FRAA 1COV2 5SV8A 1FOD1 1VBD2 3ZMNA 3CJIA 4OULA 1O3QA 3AM2A 4ZKTB 4GH4C 5AFBA 3HN1A 2R063 4JDNA 4B29A 2RS33 1LESA 1MQTA 1V6LA 1RUG2 1YJLA 1QNWA 2QDNA 5A3LA 2KM2A 3MEPA 4COUA 4Q4Y1 3FE5A 4JAAA 4XDQA 4BPZA 1DQ1A 2RS51 1XQNA 1XU2A 5T50A 2O1QA 2RMU1 1VBB3 4DZGA 4YM2A 1GZWA 5LK7B 2HJIA 5IUQA 2IXHA 3H1MA 2BBVA 5J48A 5C8CC 1FT9A 3PVNA 4FBFA 5FMOS 1NY71 3VZOA 2WNUC 3USSA 1S55A 2ZMLA 4AGRA 2VU9A 4JV4A 1Z0HA 1W0PA 5EV7A 1RUE1 2XLFA 4DPNA 3B93A 1C8M1 2R16A 4KU7A 1CAUA 3B3QE 2BW8A 3ETQA 4YW3A 5FLHA 1F8VA 3HMYA 5H9PA 3BOPA 2P3JA 1YRZA 1H0BA 4FPEA 4GWMA 4EN9B 3WDUA 3DPRC 4KG8A 2A3YA 4UBHA 4GH4A 4M00A 3ZSKA 5JSPA 2WT1A 1A8DA 4Q0VA 4YG6A 4XBLA 1Q8SA 5BNNB 1IGOA 1LHNA 1FI2A 1MEC2 1SCRA 3FHIB 1KQRA 5DZFA 3E5UA 4CEWB 4H7LA 2N7GA 3S0MA 1CX4A 3MW4A 4CDUA 4GQ7A 1AXKA 3C3VA 3AYCA 1RUH2 4L97A 2P17A 3RYRA 1IS3A 3VBFC 4AQTA 3RJRA 2VQAA 3CF6E 3NVCA 4I02A 5JIAA 4FXKB 3VBUB 3WVJA 1FNYA 1PIV3 2PYTA 1ZZBA 2JJ6A 5C8CA 4K9SA 2B5HA 3H1WA 1UAIA 2WNUA 4L8QA 1UD1A 1TQ5A 3ROUA 3H7JA 4RQPB 4WVMA 2BGCA 4E2QA 1WCDJ 5EJ3A 5FTTC 2GC2A 3HWJA 3VZLA 1J3QA 1UW8A 2VOKA 5DDJ3 2OZ6A 3J8F2 3NAPB 3T2TA 4AI0A 1MS5A 1H2LA 3WCSA 2PLV2 2DU1A 1AVBA 1HRV2 2MEV3 2QDRA 1LU1A 4A7ZA 4TYSA 3PMSA 4LHLA 5AVPA 1WUVA 3VBSB 1NQDA 2HWD2 2D3SA 4D94A 1V9U3 3KCXA 4FPJA 4GWNA 5AVAA 2HWC2 1CQ9A 1Q43A 3RSJA 2A75A 4LO6B 2D44A 2XB6C 1LECA 2WIIB 1QJU2 3TBDA 1YUDA 5T54A 2ZCWA 1R1A2 1U0AA 1LGCA 4Q0UA 4HN1A 1G6NA 4J1XA 4DS0A 1GBGA 1AR61 1W6PB 3AKPA 4HKLA 4RR3B 1XE7A 4TWTA 4IEYA 1SLIA 2GN3A 3I2DA 1IS5A 1SFNA 1VRH1 2CNAA 4KNCA 1PZ7A 4O9EA 1ASJ2 1AYM1 2GDFA 1GQHA 2E6VA 4IEZA 4LO4B 4XMIA 3ILRA 4PIZA 4OVEA 2XBO1 4Q4W1 4BLIA 3THTA 1LULA 2DWRA 3CU7A 2R0FA 2EXIA 1LOCA 2ZTNA 3EHKA 1DGLA 2VNOA 3RWNA 1VBA2 4URTA 4DMIA 1FPN2 1UU4A 3MIGA 5KC5A 2NZ9A 4AQ2A 2HWF3 1MS0A 3M1HA 4Q29A 1KXGA 2D6PA 4CEYC 4F7ZA 1EY2A 1Z7S2 5D8AA 3ASIA 5DUVA 5A33B 4SLIA 1VALA 4N53C 4AVTA 1LGNA 5FFOC 4B4PA 4GKYA 3I7DA 3JBG3 3OD4A 1YCIA 3D82A 3ZYIB 4JRAA 1RHI2 4QQHA 1ULFA 3WT3A 3WP3A 1MZFA 4WV8A 1LHWA 1QJZA 1TNFA 5ACA1 1RMU2 3JU9A 3KD4A 1QGLA 4HVQA 2CAVA 3QH6A 1OI6A 2WA3A 5K8SA 1RITA 3IPVA 1G9BA 5FDBA 2R072 1H8TB 1REDA 2FMDA 4IV3C 3MIEA 2ET1A 2W08A 2JG8C 2ZX0A 3W59A 1VAKA 2ZGRA 1JOJA 1ZBE1 1QJX1 3E6DA 2RR12 5J98B 1C8NA 1GZCA 2WFF1 5EXOA 1XXNA 1YI7A 1BEV2 2BWAA 1COV1 4YZ3A 2OYZA 2KA3A 1VBD1 3KQRA 2VVEA 4EWEA 3HD8B 4WZCA 1H8VA 1N1YA 2EF6A 4YW4A 5AC93 1RUC3 4HPKB 1X33A 2VNGA 4CEYA 2PA7A 3VHPA 1WA4A 1RUJ1 3I54A 5CA6A 4K21A 3SH3A 1QOSA 1WCKA 1BYHA 5FO7B 4E4ZA 2R061 5DXDA 2QUOA 2HWE2 3L2HA 5GZFA 4GULA 3PVEA 2QNKA 1C1FA 4RL7A 3R4SA 3H3UA 4YM3A 2TUNA 3RI9A 2UY9A 1WBFA 2WQZC 3ZVXA 4AVSA 2WSUA 3NL1A 5JDBA 1PVXA 1ZZ7A 3OGGA 3S7EA 1M4WA 1BJQA 5I8YA 1NG0A 1QWRA 3B01A 3OYWB 3WXPA 4QHBA 3ZFGC 1EYBA 2DTWA 4D7TA 2WZR3 5K7PA 4W6XA 4QM8A 4LBMA 4LEJA 3ATGA 1IZ3A 2I07B 2ZGTA 3SISA 1IS4A 3OCPA 5KHJA 4C0HA 3PHMA 1LB2A 4B7EA 5A3MA 2A5ZA 3U4XA 1RVF2 4IEPA 4RS5C 2VXRA 4F8AA 1AJOA 1G9FA 3GYDA 4NHKA 1XYOA 2EXJA 3U10A 1RUF2 2E63A 4CDXA 4NVPA 1TMF2 3ES1A 5JAXA 2P3KA 1JHNA 4Q4X3 4L99A 3TOJA 4IXLA 3AP6A 4IETA 3M3OA 3QACA 3ZN6A 5IT6A 3VGIA 2CWMA 4FOVA 1Q3EA 2GH2A 2IC1A 3ELNA 3FFZA 2DFBA 1PO22 5FQ0B 4K8FA 1AXZA 4KL1A 4CP2A 1MZ6A 4RD7A 3WR0A 2DUQA 3INAA 3G7DA 3VKMA 3WNXA 2K0GA 3D8CA 3MW2A 3MFAA 1ZBA2 3ST7A 5GALA 5BNPB 4RHV3 3U07A 1G9AA 4Q4V3 1CAXB 2PHTA 1S0BA 1O4YA 5CFCB 2YDEA 4JC1A 2HWD1 3GZAA 3TB0A 2MEV1 2XJUA 4AEMA 5BV6A 1NE4A 4RS5A 3ZXDA 2QZ3A 3H9AA 4FPKA 3WUCA 1A78A 2RM22 2HWC1 1YIPA 1HRI2 4L9BA 3VBRC 3D0SA 4FPCA 4Y1VA 4ES8A 5JZGA 2V73A 1QJU1 1B09A 4LLFA 1QXJA 1RC6A 4SBVA 1ND3B 2WNVC 3O14A 4PLMA 1JYIA 4KH9A 4Q1PA 1HLCA 2WS93 1MS8A 4OI2A 3QD6A 2XGXA 3KT1A 4WBBA 3VKLA 2PHRA 1YHFA 1CAVA 3M3IA 2EIGA 2PAKA 1ASJ1 4RGGA 1YYNA 2F4PA 1VBE3 5LRSA 1K5MA 3QLQA 3HBZA 4S2GA 4TSVA 4KBBA 1HX6A 1FOD3 2P2KA 1R1ZA 3M70A 2ZGNA 3GALA 4U2AA 4X8PA 4AXOA 4CTEA 3LB9A 3E6CC 1HDKA 4E2SA 2DF7A 1O3SA 1ND2B 1FPN1 1PGL1 3SLIA 4K1YA 3WDWA 4XJUA 1YI9A 3O12A 2RS53 4LBKA 3UL2A 1W6NB 1KJRA 1D4M2 2ZMNA 1HV1A 2RMU3 2E7QA 1PK6C 3RMXA 4C0BA 1U5XA 2A6ZA 4W6WA 2YYOA 3A0NA 3WDYA 4P5HA 4AG4A 2RHPA 1DGRA 3WW2A 3OJBA 1LKNA 3ZFFB 3LA2A 1S0DA 3RS6A 4JVAA 1OOPC 3V0BB 2RS12 4UW3A 3JBG1 3NV4A 5EYXA 2EAKA 1UU5A 3J9SA 2D3PA 2A3WA 3R05A 4HLTA 5A32B 1W0OA 2OPKA 5GLTA 4XEZA 5KHKA 1H2KA 3GBGA 3PTYA 3TAYA 3USUA 3D6EA 4NN0A 4ZU7A 1NLSA 3VHNA 1A8MA 1R082 1S0CA 1ZM1A 2VW0A 4DXZA 3B02A 3QCWA 1BEV1 2JG9B 4MXWA 4QPYA 4QQ2A 4QPGA 4I01A 4PBOA 4ISRA 3DGTA 3N7LA 2XH6A 2IWGB 3WW4A 4E2GA 1AR71 3AP9A 4JGYC 1NA1B 5F1RA 1SMVA 4QPIB 4FAGA 4XF3A 4YG3A 1J1LA 3M3QA 1UU6A 4CDWC 1AXYA 4CDQB 1HIXA 1DHKB 3FLTA 2B8MA 1PK6A 5AC91 1AX1A 1AR92 1RUC1 3FMGA 4XJAA 2VMHA 3VZKA 2HWE1 2AYHA 3LOIA 3LKJA 4OI4A 2UYBA 2ZGLA 3ZYGA 2ZACA 3ILFA 3WD5A 3ACLA 1QQP2 4MV2A 2PN5A 5T5JA 1D0GA 5KC6A 1ZX5A 3WW3A 1QKQA 2WLPA 4RSUA 3ZXAC 3RYKA 2SBAA 1HQWA 1FATA 3S7IA 1DQ5A 2K2SA 5I0RA 4XYXA 2P34A 1UF2C 1VBC3 2YHJA 3ZSJA 2EA7A 1V6NA 2WC2A 2JENA 4GMP0 4DFSA 4DY5A 2XG3A 5T5OA 1TME2 2EAAA 2PHFA 1GQGA 2D5FA 2D6NA 4XW3A 2WZR1 3OGJA 1KDMA 2VECA 2QQPA 3AZVA 4YZ1A 4META 4WVWA 3SNMA 3WQ1A 3K51A 4PDWB 3MIFA 3VBUC 2A6YA 1ZZ9A 2Z5WA 5DZEA 1LODA 2YC0A 3LWCA 3S30A 1TMF1 1I6XA 1ULGA 2UU8A 4AHXA 3H8UA 4MGZE 5B2GB 3AK0A 1AR63 5J3UA 2NPIA 4RQPC 4Q0QA 3TWIA 4LHNA 2D6KA 2D5HA 2WKKA 3THPA 2F6BA 4GB32 3NAPC 2WQ4A 5GLZA 2BFUL 4HVOA 1DQ6A 1VP6A 4XFBA 3ZYJB 3RNSA 4GXLA 2DVDA 3VBHB 5EZWA 1RB8G 5JOXA 1GANA 4FPLA 2MPFA 1T6GC 4LNVA 5BNNA 1AL0G 1LOEA 3TN92 5C33A 4CEWA 1UPIA 3MZHA 5CADA 3BODA 5FLJA 4IV1B 1NQJA 3CJIC 1QHDA 1C28A 4DINB 2QJVA 4PF5A 4NHMA 3WLUA 4AWDA 4AHWA 4HANA 3UJQA 5C9AB 4RHV1 2Q5TA 1MQTC 2X29A 3VBUA 2CGPA 4YFWA 3WG1A 2ET7A 5ACA3 4XFGA 4QGLA 4FPHA 2YPJA 1ENQA 1N1VA 3MIHA 2AGSA 5JMCA 4H7MA 4RQPA 3KB5A 1IS6A 4BMBA 2XHKA 3URFA 3IMNA 1JUHA 1QJY3 4WM7B 3NAPA 5IK4A 3FC0A 2R6QA 4R9DA 4BA6A 1N1TA 2WWSA 4K40A 3H50A 4HL0A 1COV3 1LHOA 2WS91 1VBD3 5JPMB 1H2NA 4KG0A 3VBSA 3IT8A 4HVRA 4LO8A 1H9WA 2B45X 3UJOA 4COZA 3O0WA 1VBE1 2LM3A 2D97A 4OHWA 4LBQB 2WL1A 4XF4A 1RUG3 1RUJ3 3PNAA 2GC3A 4H55A 3RDIA 4B4RA 2VUAA 4FOQA 4UXAA 4XTMA 3AMHA 4AI2A 4ASMB 4XBNA 5CFDB 5CBLA 4G3YC 3WV6A 1O4ZA 4UW4A 1LRHA 3VKNA 1POV0 3VV1A 1ZRRA 2Y0OA 1LENA 2BVVA 4LO5B 4CDUC 1W6PA 4RR3A 1PVC2 5KBFA 1ENXA 3IDBB 4YM1A 5CU1A 3CLPA 1FAYA 3KGZA 5JI9A 1DU3D 3OBRA 2BPA2 4S2DA 5KXDA 4IL7A 1AL22 4R9AA 3MLJA 1QMJA 3AXDA 4GKXA 4YNIA 1R081 1NYWA 2Q1MA 3FFQA 4Y1XA 4HBNA 1AF9A 1SLLA 5A33A 1DQ0A 2VUJA 1PZ8A 4DNYA 5F5QA 1RGSA 2DCZA 2D40A 5C4WC 2AUYA 1FXZA 4AE2A 1JUIA 1MEC3 3MF6A 3VKOA 3JUUA 3B00A 4P9LA 1VBB2 2QVSB 1RUI2 1RUD2 3OBTA 3E5QA 1TNRA 3RYPA 1B35B 5FREA 5BNOB 2VULA 3WDTA 2UWBA 4YZ4A 1AR91 1DQ2A 1DGWX 4XIKA 5I8SA 4B3NA 2RJLA 2X5IC 1V6MA 4XF0A 4I3PA 4BCUA 1W6MB 4XHXA 4XTPA 4N43B 4DQAA 3N35A 1HQNA 4IEWA 3P3PA 4LLOA 2CL2A 2BEOA 2VY0A 4XFHA 4QQLA 2BYVE 4E27A 5J37A 4OFGA 1BQPA 3ZXKA 1OA3A 2PLV3 1X82A 4HPKA 1HRV3 4MGYE 4YZ5A 5JCTA 2VOXA 4R8HA 4CZSA 4FCAA 3B94A 4N90A 1CPNA 1Q8VA 1W6QB 3HR9A 2HWD3 4YARA 2GNMA 5C4WA 1YXWA 3KT4A 1VBC1 4J6GA 1SBEA 1PHMA 1Y43B 2OUHA 3A4UA 3WOGA 4YGEA 3DN7A 1OD5A 1DGWA 5J96B 4LE4A 2HWC3 5D8AC 4AFBA 1DIWA 3AB0A 3WY6A 4P9GA 1GICA 1S0FA 1DQ4A 4Y24A 1QJU3 4EN8B 3ZDSA 2ILMA 4R4ZA 2X5IA 1R1A3 3S6PA 3OYWA 1PGW2 2GMPA 2NM1A 1J1TA 3HIFA 5JSRA 1J59A 3AZXA 5FOJB 4NPRA 1ASJ3 3W58A 5DDJ2 4I0AA 4JTOA 1ZVFA 3ZFEB 1C57A 5ABJB 2E53A 2IXKA 3EXUA 3LA3A 5JIUA 3B5LB 1BZWA 3EO6A 2G9FA 5CFCC 4X8NA 2A73B 1VBA3 1REFA 1Z78A 4JGZC 4MGIE 3SITA 1FPN3 1CJPA 2DVGA 1V9U2 1O3RA 3KT7A 4PLNA 3UKNA 1Z7S3 2JICA 2D93A 1H9PA 4INDA 1AR82 2D6OX 2C0ZA 1NCRC 4P14A 1KDKA