4EWEA

Study on structure and function relationships in human pirin with manganese ion
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA01
4O9EA 4I0BA 1OMIA 3MPBA 3S7IA 3BPZA 2H6CA 4OLLA 1ZRCA 2H0VA 5BUVA 1WGPA 1LRHA 4MUVA 3SMHA 4JVAA 1UIJA 3C3VA 2OPKA 3FJSA 4UXAA 2CGPA 4EROA 4RD7A 2XGXA 3KSCA 2E9QA 1EP0A 1ZZ9A 4Q29A 1X8MA 2CV6A 4N9HA 2GC0A 2WFPA 3E97A 2PA7A 3ZDSA 4Q0UA 5D1IA 4I2OA 3IWZA 2PHDA 1ZZ7A 3ACLA 3I7DA 5JR7B 4QGMA 2ET1A 4QXKA 1V70A 3BALA 3S7EA 2HKXA 4B29A 4I09A 5F1RA 1UIKA 1EPZA 1QXJA 2PYTA 4H7LA 5K8SA 5FLJA 3SCFA 5LRRA 4WZCA 4YSFA 2ATFA 3M70A 1RUOA 1VJ2A 5FLIA 1CAUA 4BHPA 2XKPA 4F7ZA 3KMHA 4R8HA 1GQGA 3U0ZA 3EJKA 2IXCA 2ZCWA 4I01A 4EWEA 4IEXA 3WW1A 2Y0OA 3ETQA 1OI6A 1ZX5A 1CAWA 5FQ0B 1NYWA 1O5UA 4J1WA 1ZREA 3NW4A 2XL7A 2MHFA 3GBFA 4QGLA 1XE8A 4LUMA 2O1QA 4AXOA 4HSJA 5KHJA 1X7NA 4YRDA 3RYRA 1O4TA 1ZZCA 4X6QB 1X82A 3R6SA 4HSLA 3UKVA 3NVCA 2EA7A 1ZRRA 5EFUA 4QMAA 4D7TA 4FT8A 1NZCA 3EO6A 4XEZA 4I02A 2MNGA 2VQAA 1X8EA 1ZZ6A 4L2NA 2F4PA 4E2SA 4XF0A 5CU1A 5CVRA 3DN7A 5BV6A 3NJZA 4QM9A 4AVCA 2P17A 2IXJA 3PLQA 3QOPA 2XLAA 4LULA 1O5LA 3PVBB 4LA2A 4MZUA 5J7MA 3CL1A 1J59A 1Y3TA 4MGIE 1YLLA 4AQ2A 2PAKA 2HJIA 2VPVA 2CAVA 5HI0A 3HT1A 3WW2A 4IEOA 3IIAA 3DKWA 4MGKE 3GYDA 4MV2A 2PTMA 4L11A 1VR3A 3LA3A 3H9AA 3H50A 5I0TA 1RC6A 3SCGA 3I59A 4ORFA 4PJYA 4AQ6A 1I6XA 2OA2A 5JSPA 3HIFA 4XF1A 4AVBA 3BB6A 1DGWA 5I93A 2KXLA 4PIXA 2GC3A 3HT2A 4LUKA 4I3PA 4O9GA 1PM7A 1RGSA 2Z69A 3LAGA 2BNMA 5LRSA 4PIYA 4OFGA 5FLHA 3L2HA 1NE6A 2UY9A 1ZZBA 2BGCA 3SHRA 4META 1EY2A 5LEKA 3LA2A 2IXIA 2PAMA 3H3ZA 3IBMA 4ZU5A 4BYYA 3FWEA 3TNQA 2ET7A 4IESA 5T3NA 3H3UA 2QDRA 4R52A 1YUDA 1ZNPA 2O8QA 4J1XA 4A2UA 4BIFA 1CX4A 2IXKA 3UKNA 2D5HA 1NE4A 4HBNA 1J3QA 1GQHA 4KWKA 4HMZA 4IEYA 2IXHA 5J48A 3CJXA 4HZFA 1Q3EA 1SQ4A 4JV4A 2GU9A 3E6DA 2BNNA 2B5HA 3JZVA 4IEPA 5E16A 5LEJA 3DL3A 3RPQA 3IDCB 2VECA 4IEVA 4FAGA 3OF1A 4Q0SA 5I0UA 2UYBA 3TNPB 4X6RB 1XRUA 4XFIA 4Q0QA 1DGRA 3ST7A 1U12A 2Q0AA 3LZZA 4YARA 1CAXB 1SFNA 3CLPA 1WA4A 3H1WA 3PNAA 5KBFA 3UKTA 1RL3A 4D7SA 5KHHA 4BH9A 2Q30A 3SCHA 4XFBA 4YYOA 5JAXA 2PAEA 4HVQA 1CGPA 4MX3A 1IPKA 3CEWA 3RZZA 3NSTA 5JCTA 2FQPA 3N4MA 3H1YA 4EV0A 5BXXA 4WBBA 1LR5A 1CAUB 3O14A 5C6CA 3RNSA 1YFWA 2XHKA 4KU8A 1FT9A 3FZ3A 5I8TA 5KHKA 3H7JA 1CAVA 1CAWB 3E5UA 2OYZA 1I5ZA 3D0SA 2K0GA 2BNOA 3H1MA 2H6BA 2WC2A 2EVXA 1QY4A 4HN0A 1O3TA 4KL1A 1UPIA 3S0MA 1UD1A 3U11A 5I91A 1OFNA 1VP6A 2C0ZA 3RDIA 4E2GA 4AVAA 5J3UA 1Q43A 3M3IA 3OGJA 2MPFA 2N7GA 1DZRA 2ETEA 5JSRA 2BYVE 2XLGA 2XLFA 4Q0PA 2D5FA 5BPXA 1Q5OA 4IEUA 2DCTA 1Y9QA 4LA3A 3EHKA 4IERA 4MH0E 3D82A 3FFQA 3CF6E 3ELNA 1FXZA 3BU7A 3EBRA 1O3RA 2GAUA 2XKOA 3D0JA 3MZHA 4KU7A 3E5QA 1O3SA 1NXMA 2GH2A 1YFXA 5AVPA 1H1MA 4K8FA 3KCCA 4E2QA 1OD5A 3MYXA 5KHIA 3E6CC 1UCXA 3OD0A 4XFCA 5BY5A 4I0AA 4N9IA 1QXRA 4F8AA 2Q1ZB 2QCSB 4UBHA 2BEOA 1YFUA 3LOIA 2IC1A 3OCPA 5FPZA 3VHRA 4PIZA 2PHLA 5FPXA 3ES1A 4LLOA 4ZU7A 3I59B 3DV8A 5FQ0A 1L3JA 1FI2A 4XFHA 3U10A 4HLTA 3RYPA 4XFFA 4DINB 1ZZ8A 4JTNA 1WLTA 5KHGA 4NVPA 1CAXA 2PFWA 1XE7A 1J3PA 4IEWA 2K9ZA 4QGNA 2B9UA 5CADA 5I8SA 4XETA 4XF9A 1O7FA 4XFGA 2PQQA 1ZVFA 1J3RA 5I0SA 1J1LA 1J58A 2UY8A 3LWCA 1IPJA 3SXWA 4MGZE 3NL1A 4P9GA 4UBGA 1YFYA 3ES4A 3EQEA 2IXLA 4MGYE 4QX5A 4LTAA 3ROUA 4IEQA 2B8MA 1TQ5A 3OTFA 3NKTA 4WVZA 2GZWA 3HQXA 4FAHA 2EAAA 4YNIA 5I0RA 1LB2A 1O3QA 2CAUA 2OZ6A 2UYAA 3BCWA 3RYKA 2ZKLA 2QJVA 1QWRA 3USSA 4ZU4A 2Z2SB 3WW4A 1H1IA 2QVSB 3H7YA 5FDBA 4CYDA 4ONUA 1ZRDA 4JTOA 4IETA 5I8YA 2OZJA 4Z07A 4IEZA 4TLFA 2V09A 3MDPA 3FX3A 1SEFA 1G6NA 5JSOA 2GC1A 3WW3A 3G7DA 2GC2A 3FE5A 3H8UA 1JUHA 4HN1A 1PMIA 4KWJA 4Q0VA 1ZRFA 2XL9A 1DZTA 3E6BA 3FHIB 1RUNA 5FCCA 3B02A 5EZWA 1LKNA 2Q4SA 3LA7A 1HW5A 2FMYA 4XF3A 2D93A 1YWKA 4HVRA 3IDBB 3E5XA 3QACA 4KWLA 3I54A 4HVOA 4LEJA 4FBFA 4QM8A 2I45A 2QNKA 4XF4A 4Z82A 3KGZA 1EYBA 3CO2A 4EWAA 1YHFA 1RTVA 1UW8A 1CAVB 4GULA 4XFAA 5C8WA 5E1RA 4EWDA 2D40A 3KGLA
chains in the Genus database with same CATH superfamily
5AC91 1N1TA 3ZFFB 4DUWA 1VBA3 1IKPA 1PVC2 1EUTA 3VBHB 5TSWA 3PHMA 1VAKA 4DRVA 2C4XA 4GXLA 4FFFA 1Q8PA 1IQDC 4IE4A 1GYKA 1PO11 2GP3A 4QKBA 3WNOA 4XURA 4AFDA 1PO21 2ARBA 1QNYA 3J4UH 4K1YA 4JVAA 4YM0A 1Y7BA 4LXLA 4AHZA 2UURA 5FZLA 2CGOA 3FJSA 3ZM8A 5EJ1B 5LW9A 1ZBE2 3AMNA 3KSCA 1W06A 4UWDA 5FYIA 3VKMA 1ZZ9A 4O65A 4P9LA 4BQYA 3O1RA 1W8NA 2RS13 3BODA 5KC6A 3S5QA 1OQDA 1RUF3 3WR0A 2HWF3 4YG6A 3W5NA 1WLWA 1X8MA 3QH7A 4N9HA 4BMEA 3TBDA 3AKQA 4H7MA 1XNBA 1N3OA 2OW4A 3E97A 4XHBA 4Z2WA 3K3NA 1WUVA 3VDBA 5D1IA 2VUAA 4I2OA 3WG3A 2W9XA 2Y6GA 3BGAA 2PHDA 1ZZ7A 4ZKTB 4MXVA 4QQHA 4QHOA 4QXKA 2ET1A 3LIGA 1U0AA 1V70A 3S7EA 4LBQD 1REEA 1RUE3 4NOTA 3I8TA 1UIKA 4HXCA 3RFRA 5IK4A 1S0GA 4M01A 4H7LA 2DFBA 2XWJB 4HFSA 5IJRA 2LS6A 2RS11 1VB2A 2WN3A 2RR12 2HWF1 3LDKA 3KVAA 3MIHA 3VZNA 1BLZA 1KFXL 3ZYFA 3M70A 1OSGA 2X8KA 1VJ2A 4RYDA 4KG8A 5FLIA 1CAUA 4ARXA 1QMJA 1GQGA 1LGNA 2BUKA 3WG4A 5F2WA 4AVVA 2WR9A 2IXCA 5C3SA 4M0NA 5A33B 1D7PM 4RHV2 1H6XA 4MXWA 1Q8SA 1UNBA 3ETQA 3AP6A 4UF0B 1H8TB 3T2QA 1RUE1 1UOFA 5FYZA 2YYOA 4DUXA 3IDEA 4YW1A 1DLLA 5FFOC 3ZX7A 3RMXA 4AW7A 1VALA 3K46A 4CP2A 1WW7A 3VBSC 3BTXA 1ZREA 4QX0A 4DXZA 4ITCA 1AYM3 2D43A 3FBMA 3GBFA 5IUQA 3WEZA 1R1A3 1WCQA 1XE8A 3NJYA 3OYWB 3B94A 1OF4A 3LSEA 4PT6A 5JXGA 2VUJA 1W0OA 1F4AA 2ZBJA 1X7NA 3B9IA 5DQ0A 1XBFA 4LBQA 1WW4A 1UYZA 2R073 4H55A 2DUOA 4XBLA 1ZZCA 4Y1UA 5FZBA 5JXJA 1VBE2 3NJXA 2SBAA 1C8M1 2VZTA 1OQ1A 1OA2A 3VBUB 1LOBA 1KJLA 2J1VA 3AZVA 3ETPA 5FIXA 1YI9A 2ZAAA 5EFUA 1KS4A 2PMWB 3EO6A 1AYM1 1L7RA 1JS9A 1ZZ6A 2WNUA 4UFIA 5T54A 1R1A1 3WDUA 1HIXA 2R043 2RJ2A 4YW3A 1GMMA 1U5IA 1JU4A 5B4XA 1FMD2 2IZWA 2ZX1A 2RJKA 2R071 3VD4A 2P17A 1DGLA 1SCSA 5ABJA 1W8TA 2VNOA 3PLQA 3AVSA 3LEIA 3QOPA 2VNRA 5F3IA 3HR9A 3UV9A 4OCTA 1ULPA 3SQOA 3X29B 3BTZA 1ASJ2 4N7UA 4Y1XA 4Y26A 1IZ3A 3JUUA 3VBOA 4AZZA 3Q8EA 4JRAA 2VZSA 4QHBA 5DZFA 2BERA 1WMEA 3V65A 2VBDA 3P3PA 5C4WB 5SV5A 3JD73 5D2AA 3HT1A 1A8DA 4CCMA 1FNYA 5L7OC 4QDQA 4B7KA 2H0BA 4MGKE 4P9IA 1DP0A 1JZ5A 1GSLA 5FP4A 2R0HA 3MLLA 3ENRA 1QOTA 4L11A 5F6LB 2O14A 4OQ8A 1W2UA 1NLQA 2A7AA 5I0TA 1K5MB 2W92A 4KGQA 1Z0HA 5FTTC 1ENQA 3SCGA 2FDGA 2VMGA 1UZVA 2WSVA 4ORFA 4GWIA 4PJYA 5FXVA 2X10A 1NCRC 1K12A 1SLIA 1ZRIA 3PJYA 1C57A 1LGCA 5IWFA 3BB6A 4G4FA 5J1XA 2KXLA 5BNNB 5BYNA 1RUI3 1AUYA 3JD71 1GNHA 3OUJA 1O91A 5C9AC 2NQYA 5GM0A 4K21A 3VD7A 3HT2A 5BNOB 4QPYA 4DRRA 2RDNA 4OVEA 2UWCA 1AJOA 1REDA 4A6OA 3ZXFA 3VL8A 4O61A 1QJFA 1REFA 1QH7A 1NE6A 3AYEA 3O0VA 3MW3A 5K0UA 2CWSA 1ZZBA 4NHLA 1O4ZA 1TMF3 5FY8A 1XNKA 4BA6A 4LPLA 2AEZA 4N53C 3LA2A 2JE8A 4RL7A 2IXIA 1YO8A 5FUPA 4MGQA 2PAMA 2C24A 4UW3A 3H3ZA 3J8F2 3OEAA 4BIOA 5FZMA 1RUI1 3N9NA 3WY6A 4BYYA 3WF0A 1JZ2A 4YGBA 4XQ4A 4DY3A 3J7HA 2ET7A 5DUWA 3H3UA 1V0AA 5J36A 5F5QA 1LHVA 1ZNPA 2QDNA 1RVF1 3APBA 4AI9A 4FTEA 4BIFA 5JZGC 2D7FA 1F5FA 2UWAA 1CZVA 1TMF1 5FBZA 3CZJA 1JMUB 5D8AB 1APNA 3ZYHA 1AXKA 1U5YA 3OGVA 1W28A 3M3OA 4PBPA 2CNAA 1NE4A 2KD7A 5FY0A 1Q8VA 3ZFGC 2GNMA 4XZUG 4Y4YA 1GQHA 3HBZA 1YQ8A 4HMZA 1QKQA 2IXHA 4AF9A 3WDVA 3OUHA 1SQ4A 1WMDA 4JV4A 3E6DA 3TEWA 1GANA 1MS1A 4YVWC 3MIBA 3DCQA 3O0XA 1DG6A 4LLFA 3TYJA 2B5HA 3M3EA 1YIPA 3JZVA 4TWTA 1MS9A 5LEJA 3RPQA 3GALA 2ZGRA 1EAH3 2ZGLA 5APAA 3VBRB 1W2NA 2VECA 2AC1A 3I97A 5CIRA 3VBUA 1YJLA 2A6YA 1D4M2 2BZDA 4LNVA 3TNPB 4YW5A 4LE3A 2YBKA 3LZZA 2Q0AA 4XAAA 2AENA 2OXBA 3MF6A 2IUWA 2P6HA 3V64A 2YU2A 3PVOA 5FWEA 4CCEA 1CQ9A 4TZDA 3THPA 4MOAA 5FWJA 1ULDA 4NWWA 3UKTA 5EJ3A 3VUOA 1GZWA 4BH9A 1T2XA 2OUJA 5FK7A 4COYA 5JAXA 4KWUA 4CDXB 5GKAC 1I3HA 2VG9A 5A7PA 1D0GA 1EAH1 3OD4A 4FPFA 3IT8A 2VZOA 1LJ7A 3MF9A 4UFMA 1WCDJ 2Y64A 2GMEA 4LIUA 3WHUA 5A3WA 1PHMA 4CP9B 1YEWA 3QLQA 5FY1A 5LA2A 5EJZB 3O1TA 4RQPB 1QNWA 1XC6A 4C1WA 4CEYC 1UKGA 2JE9A 4NRMA 4COZA 1TME2 3PL0A 2DDUA 3ZYIB 5F39A 5FP7A 3ACIA 3JQWA 4K40A 1JOBA 3DF0A 3PVEA 5A7QA 2WSUA 4UFLA 3WSOA 4AFBA 2BOIA 2Y38A 1SFYA 1PGL1 4RA0A 1CAWB 2DFCA 5KXBA 3E5UA 1S1AA 3DUIA 1OF3A 3MICA 4CU8A 4M3CB 5FZ3A 2RJLA 4CPBD 2EVXA 4AFAA 1W0NA 2P2KA 1QY4A 3VDCA 5C3OA 4KMQA 2F17A 1BCXA 5FOBB 1UPIA 4SLIA 3D6EA 1YI7A 3U11A 2HWD3 3B5LB 5DUXA 5BNQA 3WVJA 2VW1A 2C5DA 2VZRA 4JKKA 5DAVA 1K42A 3K48A 5AC92 4DXSA 1A34A 2ZKNA 2C0ZA 3ACFA 4FXKB 4GWNA 4D7YA 4BM8A 3AMHA 5A7SA 2ZZJA 1IKQA 3M3IA 1MEC3 3J7MA 3AP7A 1JYWA 1PO12 3FBYA 1DQ6A 1PO22 4M3CF 1SMVA 2XLFA 4Q0PA 4X8NA 4WM7B 5T52A 4K9SA 4AI3A 4GZ9A 4EZ4A 1Q5OA 2WQ8A 2DCTA 1Y9QA 2HWD1 3M8LA 4Y5Z0 1RXFA 3WV6A 3EHKA 4PF1A 4COUA 2FZ2A 3NQHA 4B3NA 2JG9B 4MH0E 5F5AA 5JMOA 1GWMA 2BV4A 2P1BA 4P5YA 1FXZA 5GZDA 1G9BA 5GZGA 3EBRA 4NIHA 1ZA4A 1WD4A 1RJ8A 4R9AA 4QWNA 3AM2A 2ZXQA 4TSVA 2VMFA 4JKLA 1N1YA 4EN0A 2ZGQA 3AKTA 4AR2A 1MEC1 4IV3C 4JGYA 2GH2A 1DGWX 1BEV3 2QBXA 5I0DA 3IMNA 1KITA 4E2QA 3I2GA 5JVVA 1RJ7A 1S2BA 3M3QA 2TEPA 3E1F1 4CUBA 4AYUA 1DGRN 3AK0A 1QHDA 1RUJ3 1YQ5A 4XFCA 1HRI3 4XXPA 2WFF3 1OOPA 2AR6A 2GN7A 3I3BA 3JCIA 3RWKX 5DDJ1 2VZUA 1G9AA 1BBT3 2IC1A 2RS12 3R4DB 3U14A 1RUF2 4NE9A 4CP0A 3KM5A 2HWF2 1H0BA 3AXDA 4ZY9A 3B69A 3K2OA 3ES1A 2LTNA 1ZM1A 4L99A 5CFCC 2Y26A 1GOFA 1JBCA 4EE2A 5HPOA 5A7WA 1BEV1 3MFAA 5KXEA 3CKHA 1IS6A 4AE2A 2Y6JA 5DAWA 1DFQA 4HLTA 2JD9A 4CCCA 2CL2A 1T6GC 4PLNA 1RUJ1 4NVPA 4OUSA 1HRI1 1RUE2 4E4SA 5JOYA 1HLCA 2WFF1 2E33A 1MPXA 2BGPA 4LK6A 1HJGA 4YZ2A 2VTXJ 4FOYA 3VL9A 1BBT1 2ZABA 1KQRA 3GBWA 1J1TA 1SLLA 4K3UA 5FJKA 2EF6A 2K9ZA 3LPFA 3Q9OA 2QTWB 4QGNA 1DYPA 5C8CB 4LITA 2J22A 5JUVA 1UX7A 1O7FA 2GNDA 3C7OA 2PQQA 4JQTA 1HN0A 3M4FA 4E9KA 1WD3A 3K3OA 4XOGA 4AVTA 3KF5A 3MGUA 2WS93 4IQPA 1LOAA 1C8M2 2YPDA 3LF7A 5FY7A 2UY8A 4GWJA 5LY2A 1XSQA 4KNCA 3JB8A 4DPNA 1IS3A 5J09A 2JENA 4JKMA 2JJ6A 3SXWA 2BRTA 2X29A 3C8XA 4CA9A 3UETA 5K7PA 1GOGA 4Z2AA 1IQAA 1DDLA 4ZHNA 4MHUA 3O1MA 2HYKA 1AYM2 1NQDA 1DQ5A 1V6IA 2ID4A 3JB4C 4NPMA 2IXLA 3HBKA 5IAVA 4MGYE 1R1A2 2TBVA 4LR4A 4D6RA 2RVAA 3D8CA 1LEMA 4LTAA 3ROUA 3NNMA 4IEQA 3OTFA 3RVHA 4AAPA 3U4XA 4M3CA 2R072 1AXZA 3NKTA 2D44A 4WVZA 4AEDC 1ND3A 4AHYA 1FV2A 2WS91 3S6PA 4LQRA 3KV4A 1VMHA 5I0RA 1NT0A 4GMP3 3IB3A 1GP4A 4RN5A 4AWDA 5IT6A 4LE4A 2D97A 4JZRA 4A4AA 2CAUA 4FQ4A 3BCWA 2R0FA 3UGFA 1CX1A 2ZKLA 2V4VA 1YIFA 4ZXEA 1DLCA 5LWBA 5FYVA 2OUHA 1UU6A 3HOBA 3PUIA 2EIBA 3WW4A 3MUY1 5FDBA 3FC0A 4ONUA 2WZR3 2EXJA 4AFMA 5DG2A 5F3EA 5F32A 5I8YA 1CIYA 2O0OA 2CTVA 3W5MA 3LOBA 2VOVA 2V09A 4DOUA 3FX3A 5IFTA 5FPBA 2QFEA 1MVEA 3BOWA 3NV2A 1H8VA 1SBDA 1G6NA 5F2SA 1B35B 3ZFEA 2DV9A 2QQJA 4QDSA 4GMP1 5FUIA 3WW3A 3ZKUA 4CUCA 2JG8A 2XJPA 4YZ5A 2K46A 2VMEA 1JYXA 4HN1A 1PMIA 1W9YA 4KWJA 3VZLA 1ZRFA 2XL9A 5GZCA 4WZFA 4NHKA 5LBCA 1O6UA 4ISRA 2VR4A 3AVRA 1RUNA 1SG3A 1U5ZA 5FCCA 5SV8A 3WF3A 2WZR1 3JD72 2Y6LA 1VMJA 2W39A 1HW5A 2FMYA 2JDYA 4CU6A 4B1LA 4IE5A 4URTA 1ND2A 3WNKA 1AL0G 1XSRA 3AP4A 3DYMA 2Y6FA 3QACA 1AZDA 3L2YA 4H2AA 3WG2A 4K1ZA 1VMFA 5DAXA 2ZGKA 4IL7A 2FHRA 1YJKA 4E4DX 1ULCA 2OPWA 4V1PA 2ZACA 3ASIA 3SEEA 3AMPA 4FFGA 3OGSA 4W65A 5CFDC 5A7OA 1W6MB 2QZ2A 1LHWA 1RUI2 3DGTA 2PHRA 4JGZC 4XFAA 3OY8A 4E4HA 5C8WA 4CEWC 1Z7S3 4A7YA 3RWNA 2D6NA 4BZ4A 4HL0A 3VD3A 2DU1A 2XUMA 2VW2A 2XVGA 2W1UA 4AI8A 1EV13 2VCCA 2ZEYA 1BXHA 1RVF2 4O9EA 4YM1A 1ND3C 2I07B 2Z4FA 1W9WA 3IDAA 1TMF2 4A41A 5LA1A 2YY1A 3FLPA 4FPYA 1MS3A 2E7TA 4PQ9A 2H0VA 4QHZA 4ZZ5A 3B7MA 4RGGA 1NA1C 1PK6C 4XJZA 2DCZA 1HQLA 4YGCA 4NIDA 2BBVA 2R1DA 1AR63 3PDQA 1UMIA 4XCAA 3WP6A 4W6XA 1R1ZA 1A3KA 4GKXA 1VBB3 2FDFA 4UXAA 2VMCA 5L9VA 4MHRA 4XUTA 1GUIA 1HV1A 1Z7S1 5IK7A 3MFCA 2E9QA 3HVDA 5GLZA 3WQ1A 5FO8B 3DPRA 1UF2C 1EV11 4FOWA 4AOCA 2VO5A 5A1AA 5FMCA 4P5HA 3NJVA 4LBJA 1SLCA 3INAA 4RR3B 1JW6A 2WNVC 3GM8A 2E51A 2ZHKA 1POV0 3J7LA 3USUB 3ACLA 4DEVA 1LCLA 1AR61 4XUPA 4QGMA 5E88A 1VBB1 4M3CE 2VZVA 2WINB 5CKQA 3IN9A 3SKJE 1OUSA 3MHZA 5FZFA 5KC5A 1QXJA 2VCAA 3IAQA 2EAKA 1QDOA 3N9LA 4CU9A 4Y1VA 1UMZA 4WZCA 1EAH2 2Y33A 4HANA 2ATFA 4H14A 4QX7A 1RUOA 3RG0A 1C5HA 2WWJA 3ZLIA 3AKSA 4F7ZA 2OVUA 3KMHA 3WCRA 3U0ZA 2Q1FA 1MZ5A 1GP6A 1FATA 2R16A 2W3JA 2ZCWA 2D6LX 3I3DA 3LIHA 4IEXA 4AI2A 3QBQA 1UZZA 4LKSA 2Y0OA 1IG3A 5FP3A 1OI6A 3HNMA 4PDWC 2QQWA 4U36A 3J9SA 3WQ7A 1O5UA 3BKZA 1S55A 3CIHA 4YFZA 2IWGB 1WW6A 1OLMA 2A1XA 2LROA 2O8OA 4PLOA 4N43A 2X05A 3UGGA 3NAPC 4AXOA 1CWPA 4PBOA 4NIAA 2X5IB 3VDDA 1C1FA 4CUAA 2HH9A 1QU0A 2NLRA 3HAGA 1H4HA 2JDMA 2Z42A 3ON7A 3HWJA 2ZGNA 3ZN6B 1OQEA 3OUIA 5EXOA 3ALQA 2VMHA 5HCFA 3DXUA 5GJ6A 2AACA 4EYUA 3NVCA 2EA7A 4UFJA 3I49A 1ZRRA 1KRIA 2BBAA 4LBLA 4AFCA 4QQPA 1BJQA 4XEZA 5A3OA 4BQWA 4I02A 2AREA 2MNGA 4WM8C 5C3RA 1X8EA 1JYCA 2A71A 4L2NA 2RS53 4YW4A 2AZ5A 4QPWA 1LODA 1V00A 3B3QE 4WVMB 4E2SA 5CU1A 3WQBA 3WF2A 1DQ1A 2HWB3 3DN7A 3NJZA 4QM9A 4YW7A 4AL9A 1WZXA 5GLWA 5GLVA 4COVA 4L9BA 4CCJA 1OH3A 2SLIA 4Y33A 4I3GA 2HWD2 1W05A 1Y4WA 1NCRB 5D21A 4LULA 3RZJA 4MZUA 5J7MA 1HXS3 1A8MA 5FMBA 3W20A 1NG0A 1SPPA 5C9AB 5KXCA 4MGIE 2RS51 4AQ2A 1ENXA 2E26A 4NIIA 4ASKA 2R6QA 1OVSA 2RV9A 4L92A 2CAVA 5EYYA 2E31A 4BJ0A 2YXSA 2TNFA 2WQ4A 3DKWA 2VQTA 1MEC2 4FPOB 3MW4A 4IV1C 3R4SA 2QUOA 3I2HA 4YGDA 5B4NA 2XQRA 4QKDA 4XBQA 3GZEA 1SBFA 2Y34A 3MBWA 3H50A 3OJBA 3VKNA 2ORXA 3WDYA 4QQ2A 5A70A 1NCQB 4Y5TA 4FI9A 5FREA 3I59A 4XTPA 4FP2A 4JDMA 1HXS1 4YGEA 2DCJA 1SBEA 5DDJ2 2OA2A 2CY6A 5JSPA 2JIJA 3O5SA 1LTEA 4HKOA 3PVNA 1GU3A 4AVBA 2GC3A 4RR3A 4GAZA 5DZGA 4P9YA 4C91A 3SITA 4N43C 1F31A 1CESA 1RGSA 1GICA 2VBBA 1BEV2 2BNMA 2Z69A 3LAGA 4N8MA 3SEPA 5JZGB 1CJDA 3L2HA 4XW3A 5FLHA 2UY9A 5FAXA 1W8OA 1RUJ2 1HRI2 3LE0A 2WFF2 1EY2A 2RDQA 2NMOA 5LBEA 4OQ9A 3WT3A 2BVVA 4AVSA 4YVSC 3CMGA 1BBT2 3WZ1A 1N3QA 4JQRA 2GH8A 4BQ3A 5J96B 4YVWB 4A7KA 1W8FA 2XR4A 4UW4A 4YM3A 4NJ4A 1QGLA 1CPMA 4IESA 5T3NA 4Y20A 1PNGA 1PGSA 4AEMA 2C9AA 1AHSA 4LKDA 5FZGA 5T50A 3ZVXA 1CX4A 4FPGA 2IXKA 2YZ4A 4HPKA 3UKNA 1OA4A 4D6QA 4DNYA 5C33A 3ZXKA 1S0CA 4P9XA 2Q8EA 4BQ2A 5EV7A 4LOTA 4BQ1A 2DVDA 5JPMB 4Z92B 1OLME 2HEYF 2X53S 5F5IA 4INDA 4E8CA 3ZDVA 3I4IA 5FJHA 3IIIA 5HXMA 3NWKA 4P9WA 5J48A 3N9PA 3K4ZA 3U1XA 2XJQA 1WMXA 5FY5A 3C7FA 2ILMA 1AYN3 2BNNA 5FYHA 3PUQA 4Z8BA 4U2AA 4UW5A 3VZJA 1BK1A 4JHTA 1W3VA 4DEQA 5E16A 3AL6A 3RSJA 1C8M3 2WS92 4ES8A 1W6NB 3C7GA 4QPIC 2P5BA 3HPNA 2PXJA 4GIQA 1JXNA 2BDRA 3MUZ1 2OX0A 4CEYB 4EJRA 1UU4A 1W2OA 2UYBA 2V5YA 2JDHA 2VCMA 3I2KA 4X6RB 1AR93 3MEPA 4XFIA 3VHOA 3CHXA 4QX8A 5FOJB 2J7MA 4YARA 4RFT0 1RITA 5FYTA 1CAXB 4GH4A 2F4LA 2ZX2A 1SFNA 3CLPA 4RSUA 1WA4A 3PNAA 4RGAA 1AYN1 1MQTA 2P37A 4NO4A 1RL3A 5KHHA 2RMU3 4RS5A 3TN93 3VV1A 4R9CA 2PAEA 2QQMA 4HVQA 3OBRA 2RHPA 1CGPA 1W6OB 4CDQA 1ZBA1 4A42A 3VBFA 5HCHA 3CEWA 3CZUA 1SCRA 5A32B 5FXZA 2E7QA 3CJIA 4JAAA 4UAPA 1HJFA 3SCFA 4D94A 3FHQA 1AR91 3UGHA 5IVCA 3HEIA 1JZ4A 3N4MA 4EV0A 4CDUA 1V9U3 3UK9A 3H8RA 1LECA 2WZR2 2XJSA 4IUGA 4YWAA 2ADDA 1KFUL 4XJUA 3O1VA 2R30A 3IPVB 4IGOA 3RNSA 4Y5SA 5EP9A 2CSGA 3SH4A 1GBGA 2RMU1 3GHMA 3OGGA 2VOTA 3Q8AA 4KU8A 2JECA 4A3XA 3TN91 4AQSA 5I8TA 3UNPA 4BWOA 4OYUA 4FPKA 3WHTA 3ZKYA 4CP1A 1I5ZA 1XU1A 2BNOA 1X36A 3S30A 4CXXA 1H9PA 3H1MA 4HK8A 3ZYJB 1BYHA 2WC2A 2WWUA 2YC0A 1U5XA 3AYDA 2ZMLA 2RG4A 1V9U1 3OB8A 3ZFFA 4DQAA 3S0MA 2B7YA 5CNAA 3SLIA 3VBHA 3WNPA 3ZMNA 1H2NA 2R32A 2JD4A 3KT1A 4XBNA 3U37A 5T5PA 2C9KA 1VP6A 3G6JB 3HN1A 4DIQA 2NM1A 2WL1A 4IV3B 3B9CA 2FMDA 4DMIA 4AVAA 2GSYA 1Q43A 4M0HA 3ILNA 2N7GA 5JSRA 3ECQA 1AR73 2BYVE 3T0DA 2XLGA 1LAJA 2P3IA 4XPVA 5DUUA 2JDPA 2YMZA 5ISLA 2V4AA 2DURA 4XDOA 5JXIA 1UO9A 1DYOA 4XE9A 4XQDA 2YB7A 1Z7S2 4IERA 1UL9A 1SACA 3WDTA 3D82A 4CCDA 2Z5WA 1HQNA 3ELNA 1URXA 3LEMA 1MQTC 3OPTA 2WBKA 1VBC3 1EV12 3AL5A 5A6ZA 4IE7A 1RVF3 3D0JA 4LHKA 4RS5C 5CFCB 1O3RA 3WXPA 2J1SA 3OGRA 1DYKA 1O3SA 5M0TA 2ZTNA 4CDQC 3RJRA 1NXMA 4AQTA 1OVPA 4LIVA 5AVPA 3KCXA 1AR71 1CIWA 1W8HA 1WBLA 2RM23 1QH6A 5FZEA 5KHIA 3C2UA 1YCIA 1AR62 1WLCA 3KWVA 2DVBA 1CPNA 2WNUC 2QQVA 1VBB2 2VVEA 2KR2A 4N9IA 1YQ2A 2ZX3A 5H9PA 2NP0A 4FPCA 4L0PA 4ZPIA 5FPVA 1QJEA 1QF3A 4KG0A 5FZ7A 3T4VA 1PZ9A 1VBC1 2GALA 2ZX4A 5A33A 2OKXA 1US3A 5ABJC 4BLJA 3ZXLA 3FHAA 1V6OA 1PGW1 3KT7A 4UF0A 2GMMA 1H8TA 4UI9L 3MW2A 2VGDA 4ZU7A 5DZEA 2ZAHA 4CCNA 5A3PA 1L3JA 3LDBA 4IDZA 2XG3A 1RB8G 1O59A 2RM21 2ZEXA 4XFHA 3VBOC 1UAIA 3RYPA 3NNFA 4DINB 2C6SA 1WLTA 3OYWA 3ZR5A 2WYFA 2VC9A 1LESA 3PMSA 1CAXA 1XE7A 2ARAA 3ZFFC 4NN0A 1GNYA 2CYFA 3VBHC 3POJA 4NHMA 1UZYA 4C0BA 1Y9MA 4NR1A 1WKYA 1J83A 1DZQA 1COV3 2VD7A 5F6KA 3ZYGA 4LBKA 4MYEA 4C8DA 2B9UA 5CADA 1K45A 2Y8KA 4FPEA 4XETA 3RRDA 3TEZA 2YROA 1UMHA 4K7JA 4AEDB 4XFGA 1GZ9A 1F4HA 1ZVFA 2VUCA 2W08A 3VGIA 1J3RA 3WG1A 5I0SA 4OI1A 1J1LA 1MACA 2VZ1A 2ENRA 1GLHA 1W9TA 2J42A 3HN3A 3WF4A 1IPJA 1N47A 4QPGB 3RJ2X 3ZO0B 2GMPA 4MGZE 2XUEA 3NL1A 2IVIB 4P9GA 3TOJA 3ES4A 2J1UA 4Y24A 3D5OA 4YG0A 3WP4A 4CDWB 2D3SA 2LALA 1COV1 3PU3A 1X33A 1UKRA 1K3IA 1AX0A 5LBBA 4XYXA 5K0UC 5IK5A 1F2NA 1TQ5A 3MV11 2FZ1A 5FXWA 3OSDA 5LY1A 1ALYA 2W47A 2FCVA 2JKXA 3HQXA 4W6WA 4FAHA 4G9SB 1BHGA 4R4XA 4RGKA 5H9QA 5C4WA 5HV4A 1NLSA 2L9LA 4HONA 4Y22B 1QQP3 2OZ6A 2UYAA 3OBTA 3HD8B 2W94A 3CQOA 1RHI3 2I74A 4FQZA 2RS52 5LK5A 2NYYA 5IHRA 1IPSA 1QJU3 4JTOA 1ZRDA 4JX0A 4K20A 3RQ0A 3WNNA 4YZ3A 1K5MA 5BNPB 4BISA 2PHFA 4WV8A 2HWB2 2BP6A 3OBZA 2ORZA 2NPIA 2A6VA 1ULOA 1SEFA 1AJKA 5BNNA 2ES3A 2ZZQA 2GC2A 1LENA 1QJY1 5A1FA 1QQP1 1W2TA 3H8UA 5BNOA 1C8NA 4Q0VA 1HXS2 5CAZA 3E6BA 1RHI1 5CFDB 4KBBA 4PCRA 5FUNA 5FZ6A 4GWMA 3BIWE 3DKQA 3P3NA 4CEWB 2ZOEB 1QJU1 2VXRA 2BWAA 3KHCA 5L9RA 2QE3A 3LA7A 5JOZA 2FDJA 4XF3A 2D93A 3VBUC 4EN7B 1NAEA 4OI0A 1PZ8A 3PUSA 3IDBB 1V6NA 3GDBA 1D2QA 4LT5A 3K51A 1G9FA 5FXXA 2EXHA 3KQRA 3WQ0A 1RMU3 1BVVA 3IM0A 4HVOA 3WF1A 2OQ7A 1NA1B 1PK6B 2BVBA 3PUAA 4BQXA 4DXRA 2XXZA 5DDJ3 4XF4A 4EWAA 1DCSA 1N1VA 3JXSA 1YHFA 3ZSMA 4IGPA 3WNLA 1CAVB 4CPBA 4QX2A 3FMGA 3K75B 4Z1VA 3BI3A 2DCKA 5D8AA 3AC0A 2W68A 1FYUA 1GV9A 3MYXA 3VN4A 1S2KA 3DYOA 1UOBA 3O12A 3JQXA 2WNVB 4I0BA 3MPBA 3S7IA 1RMU1 3PUHA 3BPZA 1FX5A 1MZ6A 5C4WC 2ZEZA 3LEKA 1ZRCA 3U78A 1OBNA 2VCBA 4WVWA 4F83A 1VLNA 5BUVA 3SMHA 1V6MA 4Q4V3 3AZXA 1UIJA 2ZEWA 3C3VA 2OPKA 2VMIA 1BVP1 3VBRA 2CGPA 4RD7A 3ATGA 4S2DA 5JI9A 1JODA 2EXIA 2XGXA 3C7EA 5FYBA 5DXDA 1EP0A 1Q8QA 3UYJA 5LA9A 4Q29A 1HX6A 4XMAA 4AGRA 3SKVA 5FRAA 1OPOA 4QB6A 4FOQA 2WFPA 2WT0A 2PA7A 1RYYA 2FDHA 4Q0UA 1LU2A 4ARYA 1WWYA 2Q5TA 3PJQA 3IWZA 2E53A 4FPLA 5A3UA 4PDWB 4ASMB 4Q4V1 3I7DA 3T09A 4QD2A 4CDXA 4DY5A 5DABA 5JR7B 2CDOA 3DXTA 2NMNA 3BALA 4B29A 2HKXA 5FPUA 1HV0A 4I09A 2A6WA 2HBTA 2EALA 2VU9A 3POGA 1AYN2 4CP9A 3N9OA 2PYTA 1PM4A 2J1RA 5J37A 4XZPA 3NAPB 4RQPA 4AI1A 4GQ7A 4KQ7A 4TTGA 3MLKA 2XVLA 2WA4A 4Q4W3 1RIRA 4QXHA 4E8DA 1AR83 1ZBA2 3FUOA 2W52A 4NRPA 1UXZA 4G3YC 3ZYRA 3AKPA 4CU7A 5JR2A 3ZSLA 1AR92 4I01A 5JI7A 5FP8A 2A6XA 4URAA 1A6CA 3WW1A 1OT5A 3GZAA 5JIUA 2W46A 1ZX5A 1OLQA 1CAWA 3ZMOA 1YC61 2WNOA 2XMLA 2Y0IA 5JOWA 5FQ0B 4WM8B 4R4ZA 3N3HA 5FV3A 5AVAA 1RUD3 1OKQA 2XL7A 2Y6KA 2RMU2 2MHFA 3KV6A 5FKBA 4JGYC 3TN92 2WRAA 4Q4W1 1UY3A 4LUMA 2V73A 4LO8A 4QGLA 5T5LA 1AR81 2O1QA 1GZCA 5FZOB 5F37A 2W87A 1UU5A 2A70A 3LEGA 3A7QA 1IG0A 2BQPA 4LO5B 5DN2A 3RYRA 4NRQA 2W0XA 4LO7A 2ZGUA 1OOPC 4MLOA 1TNRA 3VZKA 3ZSEA 1V9U2 1S2EA 1VAVA 5FY4A 3ZIXA 2WO2A 3ZYPA 3R6SA 4LK7A 3UKVA 4XC9A 4FFIA 1C4RA 1RUD1 3D3AA 1NZCA 1SLBA 1W6PB 2OIIA 2VQAA 3BOPA 5JDBA 3KLSA 3LD8A 2MEV3 4WM7A 4IV1B 1KS5A 5BV6A 2WLPA 1VPHA 2JG9A 4AVCA 3R0RA 5HBAA 2AEYA 2IXJA 3JU9A 2E7AA 3POFA 4QAWA 1ENSA 2XLAA 3R4UA 1POQA 1XJAA 3WDWA 3GF6A 1JZ8A 2DTWA 3PVBB 3ITQA 5A80A 4Q8LA 1DHKB 4EZHA 4QQOA 1D0HA 3I3EA 1J59A 1Y3TA 2PAKA 2MEV1 2HJIA 1XNAA 2VPVA 4Y4RA 2E63A 3D4KA 4RQPC 5HI0A 5IVFA 3OPZA 4A3ZA 2XPJA 4IEOA 4OUEA 3IIAA 2ZPXA 5FZHA 5AFEA 2ZGSA 4COWA 4E27A 4ZXKA 2OS2A 4BQ5A 1AR72 1UN1A 4B4RA 1VR3A 5K4LA 2BOJA 5FMOL 2JICA 1O8PA 3THDA 1RC6A 1KGYA 1E57A 3CNAA 3AZWA 4YVSB 3V0AB 3V0BB 2YV8A 4MGSA 2BFUL 1I6XA 1BZWA 1W6QB 1F8VA 2YC4A 3HIFA 1R093 4OHWA 4XF1A 1VBC2 4XVHA 3BUCA 1F35A 1DGWA 5HV0A 2VTFA 1CJPA 2VOKA 1JZ3A 3VB9A 4PIXA 1JUIA 4DFSA 4FO9A 2JB4A 3HNBM 1PM7A 4B4PA 1TG7A 1IS4A 2WWSA 4YPJA 3KV9A 4Q5OA 4ES9A 2RM22 1JI6A 1YXWA 4QU1A 4S2HA 2BGCA 2XDVA 3F95A 3SHRA 4ZZ8A 1W2AX 5C8CA 4META 3OBAA 1JU3A 1M06G 1RUG3 3AFKA 4ZS3A 4YZ1A 2QQUA 1C1LA 1R091 1LOFA 2F6BA 4BMBA 2XOMA 2ZA9A 4ZU5A 3FWEA 3ZFEC 3TNQA 1W0PA 2JG8C 4KI5M 3OOXA 4X8PA 4OHYA 5DUVA 4QPIB 1YUDA 4C1XA 3OPWA 2XH6A 4J6GA 2O8QA 4J1XA 4K8RB 1POV3 3VBSB 3WP5A 1FOD3 4XXAA 5F9TA 4QQLA 1OA3A 3KV5A 2VL4A 2VUDA 1RUG1 2W2IA 2VQ0A 5FP9A 3ACGA 2OT7A 4XUOA 1J3QA 1ND2C 1COV2 4KWKA 4IEYA 3ZPYA 3N7LA 4ZS2A 3CJXA 3AP9A 1Q3EA 4GJYA 4HZFA 2FDIA 3GCXA 5A6YA 4JCKA 4L97A 4P14A 5C3PA 4NMIA 1XYNA 4IEPA 1ULGA 1X50A 2WKKA 3LB9A 1IGOA 1HRV3 3AZYA 3LKJA 1QIQA 5JWPA 2R7EB 3UL2A 1POV1 4IEVA 1FOD1 5JOXA 5IK8A 4Q0SA 1NOVA 5E8AA 5C70A 5I0UA 3T30A 2VMDA 2VAUA 1W6PA 1HB3A 2XJRA 4HG6B 1PGL2 3A0NA 2WA3A 4BU2A 1U12A 4GB33 1OC1A 1B35A 1RXGA 2XBO3 2RDSA 3O1UA 5CG8A 3HQUA 1ONAA 4TYSA 2XJUA 4PF5A 4XHXA 1AL23 5KBFA 4YLZA 4OHZA 2Q30A 5FYUA 4XFBA 2D3PA 1WBFA 2NZ9A 4TLGA 3M3CA 1XNTA 1HRV1 1JH5A 2WDBA 4MX3A 1IPKA 3DECA 1QJY2 2VJXA 3NKGA 5IVYA 2A3XA 1JYNA 1QQP2 1FV3A 3M2MA 1RHI2 4NWVA 2WO3A 1R083 4CXYA 3LFIA 3H1YA 3T1LA 5L7OB 4GB31 1QJU2 4K6BA 2XBO1 3DPRC 4W8JA 3FUQA 4WBBA 1LR5A 1XU2A 3ILFA 1L7QA 1CAUB 1ODNA 1AL21 1IS5A 1YFWA 3KHBA 2YHJA 3B93A 1JYVA 1VIWB 5C5UA 3FZ3A 1UZWA 2VY0A 5FO9B 4YG3A 2DUQA 4MXWB 5KHKA 4QDRA 3OEBA 1KDMA 1LHOA 1W6MA 4FFHA 3UESA 1YNAA 1JOJA 2XVKA 4LO4B 2RE9A 2K0GA 4XIKA 2OYZA 3FL7A 2FD8A 1CN1A 2PHWA 3MV01 4CE8A 5HCAA 3PMEA 3I3MA 1R64A 4LBNA 5FMOS 1R081 1TVGA 2XHNA 3CBNA 3FN9A 3W21A 4KL1A 1O3TA 2DVFA 2R063 4XTMA 2AGSA 1UD1A 3EB7A 1STMA 1GNZA 1MVQA 1NKGA 1W9SA 2BFUS 4PI0A 4LBQB 1RUC3 1E5RA 4SBVA 2HWC3 2VVFA 1GFF2 3AMMA 4I30A 2DYCA 3MLJA 2I2SA 5GZEA 5KWRA 2JEMA 1RMU2 4N53B 5IVVA 2JWPA 1E5SA 2YFUA 3BPSA 5FK8A 4N7IA 5J3UA 1XNDA 2Q8DA 1I9RA 3ZXGA 1DZRA 2ETEA 5FBJA 2W91A 3N36A 2D5FA 5BPXA 2WNEA 4LHSA 3UJQA 2R061 4LA3A 5H9SA 5LB6A 3J7NA 4CZSA 3PURA 3IKWA 1RUC1 4BQ4A 2UU8A 3PTYA 4A7ZA 1L7LA 3VDDC 2HBUA 3AB0A 3BU7A 3USUA 4A6SA 2HWC1 2CGNA 1T6BX 1KJRA 1W3XA 4QU2A 4P00B 2YFZA 3E5QA 1LEDA 4GJZA 3VBSA 1SHWB 5LK7B 5IVBA 4DXTA 1NLRA 3VBOB 3WUCA 3ZFGB 4D69A 1H1MA 3W58A 4K8FA 3KCCA 3NMBA 4Q4V2 5FPLA 4BXFA 4F3JA 1UCXA 3E6CC 3S5AA 3OD0A 3KS7A 1Q56A 1JZ6A 4LORA 1QXRA 1BMV1 2Q1ZB 1LGBA 3N7KA 1JHJA 2BEOA 3LOIA 5C7GA 3TAYA 5LASA 3OCPA 4BXSV 3VHRA 4PIZA 1H2KA 5FPXA 1S0FA 5A3LA 3MIGA 1FI2A 2AH2A 3ORJA 2DBNA 2ZHNA 5GLUA 2Q8OA 3U10A 5H9RA 3S57A 4JC1A 1TZOA 2IVJA 1G8WA 1ODMA 1ZZ8A 1VBA1 3DYPA 2B42B 2VNGA 3SISA 3WD5A 3VZMA 2PFWA 2LM3A 3H3LA 1V6JA 5ANQA 2X5IA 1PNFA 1J3PA 2W95A 3DEMA 1BKZA 4PHZA 3O0WA 2WAAA 3ZN6A 5CEHA 2FCTA 2Z79A 5K0UB 4OHXA 4Q4W2 1F5JA 4Q1PA 5FR3A 1AR82 1OURA 1ZBA3 3ILRA 3WP3A 1UPSA 2HWE3 2E6VA 3LFMA 5FZ9A 5JLVA 4XUQA 4A44A 1RUF1 3ZXEA 1OUXA 3K4AA 1J58A 1DIWA 3T2TA 5HCBA 5L7OA 3LWCA 2B9VA 2V5DA 4WVMA 1IHMA 1MS0A 1VRH3 4KBZA 3A23A 1WCUA 1RUD2 4RR3C 4UBGA 1SLTA 2C26A 1OPMA 5CA6A 1S0EA 3MIFA 3H8OA 2P6CA 4BPZA 1WA6X 3AFGA 2ARXA 5E89A 3WUDA 2EXKA 4Q4Y3 4UYBA 4AHXA 1NCRA 1LOGA 2B8MA 2HWE1 2ZHLA 5F3CA 4OMCA 5FZDA 2GZWA 3NNJA 4UW6A 5FYSA 5C9AA 4NAMA 4QB2A 2EAAA 2R49A 4YNIA 5F5CA 1NZIA 5A7NA 2ZJCA 3ZXAC 4HK9A 1O3QA 1LB2A 2D3RA 1VRH1 1H1AA 1VBD3 1X9TA 2QJVA 1UY2A 4S2GA 3W59A 3USSA 3F2ZA 4LBMA 3TWIA 1OD3A 1TNFA 5A3NA 4FTSA 2QVSB 3BN6A 4LKFA 2MEV2 5FZ0A 4CYDA 4FXGB 2VH9A 4CXWA 4N53A 4Q4Y1 1ZA7A 1Z78A 1NCQA 3I3QA 4B1MA 4Z07A 4LMFA 3RS6A 2XJTA 4TLFA 1H30A 5F7UA 2ZHMA 3FLRA 3T1MA 1MS4A 3L9JT 1HB2A 3KD4A 3KB5A 4Q4X3 5JSOA 3QCWA 4NUBA 5E6HA 3B00A 1VBD1 2B46X 1UYXA 2V72A 5AFBA 1GZWB 5L9BA 2IFWA 1DZTA 2P4EA 4OZXA 4UOJA 2X5IC 4XDPA 4CRQA 5A6QA 3CU7A 5JZGA 4Q26A 3HQRA 1KDKA 4M4RA 1LKNA 4UFKA 3SH3A 2KM2A 1WW5A 1HDKA 2B45X 3ZFGA 2CWMA 3AJYA 5FZ4A 3NV3A 2ZGPA 3VDAA 4M00A 4FCAA 1XNCA 4RFRB 3RI8A 4KGGA 2CU5A 5L19A 1PVXA 4KWLA 4YFWA 1W90A 4YVWA 4Q4X1 5DPNA 1NXD1 5LATA 1NY71 2R041 3KF3A 1W8UA 4UFHA 3GNEA 3I2FA 2I45A 2PELA 2VOWA 4GH4C 3POWA 2QQIA 5FYCA 5FYMA 4QXBA 3VHNA 4Z82A 3KGZA 5DAQA 2XWBB 1HKDA 1R092 1RTVA 3N35A 3RMYA 1FPN3 1UW8A 2RS33 4P02B 3U75A 1DQ2A 1YQ6A 4B7EA 1TE1B 3POSA 5L36A 1EPWA 3WX5A 3VBFC 2VXJA 2VZQA 1M4WA 1XE0A 3KGLA 5LRSA 2AUYA 1UWWA 1W99A 3CJIC 1XYOA 5EHDA 1OMIA 2ZMNA 4CDUC 4D3WA 4CCOA 1H2MA 5ACA3 3WOGA 2H6CA 4OLLA 2VZPA 1RUG2 2JB8A 3GBGA 4ATEA 1WGPA 1LRHA 2GP5A 4MUVA 3RZMA 4YM2A 5EWSA 2ERFA 1QJX3 2NN8A 3T3YA 1HB1A 1FPN1 1WCKA 3FFZA 2RS31 4MSVA 1W6NA 2RDRA 3I2IA 4EROA 3T0AA 4JDNA 2A6ZA 1JHNA 1S0DA 4GALA 4CEYA 1NCQC 4QT6A 3ZIWA 3VKOA 2KA3A 4D0QA 2J1EA 2CV6A 3WCSA 2YG0A 1FOD2 3QD6A 5ACA1 1Y9GA 2GC0A 4NIGA 3ZDSA 3H8XA 1GR3A 4PQQA 2JDNA 2YU1A 2ZGMA 4YW2A 2WO7A 2DBIA 3GGLA 1QJX1 3AXEA 2GNTA 1W6OA 3KT4A 1W03A 5F1RA 5A32A 2D6OX 4DZGA 4JGYB 3RI9A 5C3QA 1EPZA 2G1MA 5C5TA 3GZTB 4DUVA 2WAOA 2LW8A 5T5OA 2EIEA 5K8SA 4DS0A 2J1AA 3RZLA 2JXAA 5FLJA 2VULA 4LO6B 3KVBA 5LRRA 1NX9A 1HRV2 3GJBA 1BK0A 1JN2P 1GOHA 3TRSB 4EQVA 4YSFA 1E5IA 5IATA 2GDFA 3K77A 1PMHX 2FBEA 1KXGA 3RGBA 1OOPB 2XKPA 4BHPA 4D8MA 3IPVA 4H3WA 4R8HA 4XDQA 2YDEA 3EJKA 1QDCA 1E5HA 4CSWA 3N9MA 2G9ZA 4EWEA 3NO8A 4GB32 2WQZC 2XBO2 4IE0A 2XQXA 1NYWA 4J1WA 2YBSA 1AL22 2XONA 2PHXA 3NW4A 5A7WB 5K9YA 3POYA 2R1BA 1DF0A 3I2OA 1WLDA 3ZYBA 2BJSA 1WCSA 3JBG3 5EIYB 5DG1A 1J84A 4HSJA 1F9KA 1QJY3 3M7AA 5KHJA 1US2A 1QOSA 2YC2A 2CDPA 4MVTA 4FPJA 4YRDA 1C5IA 1O4TA 4CVUA 4EN9B 4ET7A 1ACCA 3HJRA 2C1FA 1R082 3T2OA 1H9WA 3OG2A 4MG2A 1CZTA 4GA9A 5ERLA 4XACA 2BTVC 4X6QB 3ACHA 1X82A 4IV3A 3A22A 1SDDB 4HSLA 5T5JA 3MIEA 2W1QA 5CZKA 4D7TA 1HB4A 4QMAA 1H8TC 1O8SA 4FT8A 3WINE 4BE3A 5A3MA 3TEYA 2F4PA 4OUMA 1I1EA 3BU0A 2WN2A 3JBG1 2A75A 4B4QA 2YPJA 3LPGA 2B4KA 4XF0A 5CVRA 5ANNA 4C0HA 1JOPA 1YQCA 1D2SA 1PX4A 5FYYA 5JPNB 2P3YA 1RUH3 4JHZA 3ZN5A 4JGZB 5GLTA 4CUGA 1JYTA 1LHUA 1CR7A 3BTYA 5CFCA 1XOYA 2R062 3AYAA 2J1TA 2E32A 1O5LA 4LA2A 1RUC2 1PMJX 3CL1A 1JTZX 3A21A 1ND3B 2XJVA 4AK3A 4MGTA 2FDKA 2WABA 1S4CA 2HWC2 5FY9A 1UZ0A 1YLLA 4DB5A 4FPHA 2PLV3 5F3GA 3WW2A 2HEWF 1N1SA 3AMQA 1S0JA 1VE0A 3GYDA 3SC7X 3EXUA 2WT1A 4MV2A 1RUH1 1OLRA 2PTMA 4DO0A 1TEIA 1UYYA 4HKWA 3LA3A 2GNBA 3H9AA 3BIEA 1H4GA 4XIOA 2ZS6B 4XILA 1BMV2 2PQSA 3K4DA 4P08A 3T4HB 4AQ6A 4XJ8A 4AG4A 3VHPA 2HEVF 1H2LA 2BW8A 3SH5A 3P1IA 2VBPA 3ZFEB 5B2GB 3MPPG 5I93A 1PIV3 2JG8B 2PLV1 3I2DA 1IOAA 2ZGOA 3LQCA 4NROA 3PU8A 4LUKA 4AEKA 5DMYA 5KXDA 4I3PA 4O9GA 4OMDA 2VVDA 4N90A 4UT5A 2DUPA 2A3YA 2A73B 4PIYA 3QH6A 4OFGA 5FZIA 1PVC3 1VBA2 1W04A 4R9BA 4V2VA 4O7XA 3EYPA 4AEJA 3AYCA 3NV4A 4E4ZA 5IAXA 4AEDA 2HYXA 1OKOA 1ND2B 1K5MC 5LEKA 1S0IA 1ZYBA 1GWKA 4J25A 3ZN4A 1MR5A 2EIGA 4FVVA 1UY1A 3AP5A 3BTAA 4EN6B 3PIGA 3IBMA 2JDKA 3BYWA 3VD9A 1PIV1 2W5FA 1ZBE3 2YGMA 2DU0A 5KR7A 2QZ3A 5BNNC 1YRZA 4QPGA 2LUWA 1SZBA 3GCWA 1JYIA 4V2WA 3T0BA 2W1WA 5BNOC 2QDRA 4R52A 3POIA 4LBOA 4CDWA 4BK4A 2DF7A 4OULA 1PVC1 2JX9A 4A2UA 3OY8B 1G9CA 4FP3A 2QQPA 4NPLA 3GZUC 4AGGA 1CONA 2D5HA 4L8QA 4PI2A 3U07A 3URFA 4HBNA 4QX3A 1DQ4A 1SLAA 1DBNA 1ENRA 2K2SA 5IW0A 1V6KA 1G86A 1Q8OA 2LRPA 1UX6A 4QB1A 3MO4A 2GU9A 4XCBA 4Y1YA 1UYPA 1ZBE1 2X09A 4Y22A 1CD3G 1K5JA 2HWE2 5F8PA 1FNZA 3GJAA 4QKFA 4FSJA 4Q27A 1G9DA 1AX1A 3DL3A 4HOOA 2RR13 2AYHA 2PHUA 3IDCB 5BNPA 4LOSA 3FLTA 4FAGA 1VRH2 1XYPA 3OF1A 4Q1RA 3C7HA 3VKFC 4CCKA 5DAPA 1S0BA 1XRUA 3DPRB 4IGQA 5D8AC 2P34A 4Q0QA 1DGRA 4NHYA 4RHV3 1MZEA 4XABA 3ST7A 2ADEA 4ZONA 1AXYA 4PLMA 4LHNA 4Q4Y2 3P5BA 2WZEA 3H1WA 4OHVA 2GN3A 3W9AA 4D7SA 4JRLA 2OQ6A 4I0WB 5CFDA 4ISQA 3SCHA 4YYOA 3Q8CA 4JGZA 4P9JA 2VZ3A 2RR11 4CEWA 4KH9A 1P8JA 5IVJA 5GALA 2W1SA 3RZZA 1VBD2 4AHWA 3VBRC 3NSTA 3ZOIA 5JCTA 2WUHA 1QEXA 2FQPA 4GMP0 1AF9A 2UWBA 1VBE3 4RHV1 2VM9A 3WNXA 5BXXA 4AI0A 5HXVA 3CDZB 3N7MA 5FPAA 3O14A 4Y3OA 1NA1A 1PK6A 5C6CA 1G7YA 2XHKA 5FZ8A 1JZ7A 1FT9A 3NV1A 1UY0A 1EUUA 4XJAA 2YUEA 4QPGC 4WVVA 3H7JA 2WZPP 1CAVA 2Y60A 4Q4X2 4CDWC 4CDXC 1NY72 1XXNA 2R042 3D0SA 5CB7A 1SFPA 4HETA 1FMD3 4BLIA 2H6BA 5FZCA 3UJOA 3ME2A 1AVBA 5L73A 3MIDA 1VBE1 4HN0A 4HT1T 5A6XA 3EMRA 2IFRA 5T55A 5CKNA 3WNMA 3N9QA 2WNVA 4BK5A 4N43B 1QOOA 1ASJ3 3LCPA 5I91A 2DCYA 3VDDB 1F15A 1OFNA 4XJWA 2Y6HA 2BU9A 4Q2FA 4YW6A 2D6MA 2Q1MA 2HLEA 3RDIA 5IVEA 2G9FA 1MS8A 3I2JA 5FO7B 3THTA 4E2GA 1YYNA 2DVAA 3PIJA 3OGJA 2CHHA 1FMD1 1FAYA 4MADA 3M1HA 2MPFA 5CKMA 2JDUA 1OXCA 2Q8CA 5BNPC 3NNGA 4IE6A 5EPAA 1O4YA 1H6YA 1FPN2 2RS32 2ZMKA 4OI2A 4IEUA 1PGW2 1ASJ1 5FZKA 1OH4A 3SNMA 5EQUA 5JXHA 2BWCA 1NQJA 1LNSA 3ABZA 3FFQA 3CF6E 2XB6C 5CG9A 4PDWA 2GAUA 2XKOA 1XQNA 2P3JA 3MZHA 4KU7A 1KD7A 1D4VB 1N3PA 2EIDA 1UOGA 1LU1A 2JDZA 2B39A 1W8ZA 5ACA2 3HNYM 3KQ4B 1UXXX 1SPPB 1YFXA 3RZGA 3IMMA 5GZFA 1OD5A 3NAPA 1QJX2 3PTRB 4OI4A 5LCWL 5BY5A 5CISA 2DWRA 4I0AA 4WM7C 4AAXA 3J26N 4C90A 3KCYA 3BVCA 4F8AA 2QCSB 4UBHA 1OFSA 1YFUA 3O1PA 4M4PA 4W4ZA 2JG9C 1UY4A 4XJ9A 1KEXA 3J8F3 4QX1A 2PHLA 5FPZA 4CCLA 2QQLA 1GWLA 1ULFA 1BQPA 2VNVA 3AKRA 1ST8A 5FMDA 5J98B 3A0KA 4LLOA 2PHTA 3I59B 3DV8A 4R9DA 5FQ0A 4WM8A 3T2PA 2JDAA 5FZAA 2G19A 1W39A 2FCUA 1Y43B 2TUNA 2YBPA 4EN8B 4XFFA 3RZKA 4B8EA 4JTNA 2ZX0A 3TEXA 2PN5A 5KHGA 2WJSA 5FZOA 1A78A 4NAOA 4Q8KA 3NNLA 5FKCA 4IEWA 1NUKA 3A4UA 2D6KA 1GKBA 4IXLA 4OZOA 1X9PA 4D6SA 1VAMA 3J8F1 5LA0A 4ASLA 3AJZA 5I8SA 2D6PA 2WT2A 2A3WA 4XF9A 2QQNA 3VD5A 1GZTA 1HQWA 2A5ZA 1W8WA 4QXCA 1VRBA 4ATFA 1W9FA 2QQOA 4BCUA 4W50A 5LZ6A 4A45A 5G04L 1C28A 2ARCA 1UOJA 1LULA 4AGVA 1V6LA 4BDVB 4IV1A 3P6BA 1D4M3 3LGRA 3N7JA 2G9GA 1PZ7A 4NHXA 2WO1A 2D98A 5C71A 3LDRA 1YFYA 4Y20B 3EQEA 4XQWA 5CYYA 2JE7A 1LOCA 2WIIB 3JBG2 4QX5A 3AZZA 4HPKB 3V56A 4YZ4A 2BGOA 3U4SA 2QQKA 3O1OA 3GXUA 3HMYA 1DU3D 2VW0A 3ZSJA 5C8CC 1QXPA 1ULEA 2VE1A 4TN7A 3MI8A 3IZOA 2JIGA 3POBA 4FTBA 3O7OA 4LJHA 1GP5A 3GHNA 3H0OA 1LOFC 5FZ1A 2EICA 2VOXA 1D4M1 2VTXA 3B01A 3UT0A 3RYKA 1QWRA 3Q8BA 4S2FA 2BPA2 4ZU4A 1XPWA 2Z2SB 1H1IA 3VLBB 3H7YA 4BB3A 4LKEA 1TME3 3VKLA 3LSDA 4IETA 1QJZA 3T08A 3IAPA 4YVSA 3V0AA 2OZJA 3V0BA 4IEZA 1LOEA 3MDPA 4Y1ZA 1RUH2 2DTYA 1W6QA 4LHLA 1RINA 3ZXJA 1CVNA 4XMIA 2GC1A 4GH4B 2WYSA 2DVGA 3G7DA 3FE5A 2VQUA 3AX4A 4HKLA 3TB0A 4BOWA 2QKDA 3VZOA 1JUHA 1MQTB 3R05A 1HN1A 5JIAA 4RS5B 3ZR6A 4XAEA 1XB9A 3FHIB 3O1SA 4MO3M 1AX2A 5IFPA 1TME1 3B02A 4CDQB 1VB4A 4XUNA 5EZWA 3VBFB 2PLV2 4GKYA 2Q4SA 1B09A 2YGLA 3WDXA 2G4IA 5CBLA 1PX3A 3POEA 4FOVA 3ZXDA 4GD4A 1YWKA 1C3HA 3CJIB 3H42B 3Q8FA 1WMFA 4HVRA 4IW3A 5A1LA 3E5XA 4TXWA 1CZSA 1UQXA 3NRUA 2WNUB 4NPRA 5EYXA 3ZSKA 5AC93 1DQ0A 4CDUB 2WLQA 1LHNA 3I54A 2WZ8A 1MS5A 5IYYA 4CTEA 4QKNA 5LBFA 3ZPOA 4LEJA 3KZ4C 4W6YA 3WLUA 4FBFA 2HWB1 4QM8A 1B35C 5G05L 1GQPA 2QNKA 1PO13 2P3KA 5ABJB 4JDOA 1EYBA 3CO2A 1PO23 4QPIA 2JKBA 4GULA 1OHFA 3THCA 3RZHA 5JMCA 1PIV2 1I5PA 5E1RA 4EWDA 2D40A 1SDWA 5A3TA 2ZGTA 1MZFA
chains in the Genus database with same CATH topology
5AC91 1N1TA 3ZFFB 1VBA3 1IKPA 1PVC2 3VBHB 5TSWA 3PHMA 1VAKA 4DRVA 4GXLA 1Q8PA 1GYKA 1PO11 4AFDA 1PO21 2ARBA 1QNYA 3J4UH 4K1YA 4JVAA 4YM0A 1Y7BA 4AHZA 2UURA 2CGOA 3FJSA 1ZBE2 3AMNA 3KSCA 3VKMA 1ZZ9A 4P9LA 2RS13 3BODA 5KC6A 1OQDA 1RUF3 3WR0A 2HWF3 4YG6A 1WLWA 1X8MA 3QH7A 4N9HA 4BMEA 3TBDA 3AKQA 4H7MA 1XNBA 1N3OA 2OW4A 3E97A 4XHBA 4Z2WA 1WUVA 5D1IA 2VUAA 4I2OA 3WG3A 2PHDA 1ZZ7A 4ZKTB 4MXVA 4QQHA 4QXKA 2ET1A 1U0AA 1V70A 3S7EA 4LBQD 1REEA 1RUE3 4NOTA 3I8TA 1UIKA 5IK4A 1S0GA 4M01A 4H7LA 2DFBA 2XWJB 4HFSA 2RS11 1VB2A 2RR12 2HWF1 3MIHA 3VZNA 1KFXL 3M70A 1OSGA 2X8KA 1VJ2A 4KG8A 5FLIA 1CAUA 1QMJA 1GQGA 1LGNA 2BUKA 3WG4A 4AVVA 2IXCA 4M0NA 5A33B 4RHV2 4MXWA 1Q8SA 3ETQA 3AP6A 1H8TB 1RUE1 2YYOA 3IDEA 4YW1A 1DLLA 5FFOC 3ZX7A 3RMXA 4AW7A 1VALA 4CP2A 1ZREA 1WW7A 3VBSC 4DXZA 4ITCA 1AYM3 2D43A 3FBMA 3GBFA 5IUQA 1R1A3 1XE8A 3OYWB 3B94A 3LSEA 2VUJA 1W0OA 2ZBJA 3B9IA 1X7NA 4LBQA 1WW4A 2R073 4H55A 4XBLA 2DUOA 1ZZCA 4Y1UA 1VBE2 2SBAA 1C8M1 1OQ1A 1OA2A 3VBUB 1LOBA 1KJLA 3AZVA 1YI9A 2ZAAA 5EFUA 1KS4A 3EO6A 1AYM1 2WNUA 1ZZ6A 5T54A 1R1A1 3WDUA 1HIXA 2R043 4YW3A 1U5IA 1FMD2 2IZWA 2ZX1A 2RJKA 2R071 2P17A 1DGLA 1SCSA 5ABJA 2VNOA 3PLQA 3QOPA 2VNRA 3HR9A 3UV9A 3X29B 1ASJ2 4N7UA 4Y1XA 4Y26A 1IZ3A 3JUUA 3VBOA 4JRAA 4QHBA 5DZFA 1WMEA 3V65A 3P3PA 5C4WB 5SV5A 3JD73 3HT1A 1A8DA 5L7OC 1FNYA 4B7KA 2H0BA 4MGKE 4P9IA 1GSLA 2R0HA 3MLLA 3ENRA 1QOTA 4L11A 5F6LB 1W2UA 2A7AA 5I0TA 1K5MB 4KGQA 1Z0HA 5FTTC 1ENQA 3SCGA 2VMGA 2WSVA 4ORFA 4PJYA 1NCRC 1SLIA 3PJYA 1C57A 1LGCA 3BB6A 4G4FA 2KXLA 5BNNB 5BYNA 1RUI3 1AUYA 3JD71 1GNHA 5C9AC 1O91A 2NQYA 5GM0A 4K21A 3HT2A 5BNOB 4QPYA 4DRRA 4OVEA 2UWCA 1AJOA 1REDA 3ZXFA 3VL8A 1REFA 1QH7A 1NE6A 3AYEA 3O0VA 3MW3A 5K0UA 2CWSA 1ZZBA 4NHLA 1O4ZA 1TMF3 1XNKA 4BA6A 4N53C 3LA2A 4RL7A 2IXIA 1YO8A 2PAMA 4BIOA 4UW3A 3H3ZA 3J8F2 1RUI1 3WY6A 4BYYA 4YGBA 4XQ4A 4DY3A 2ET7A 5DUWA 3H3UA 5J36A 5F5QA 1LHVA 1ZNPA 2QDNA 1RVF1 3APBA 4FTEA 4BIFA 5JZGC 2D7FA 1F5FA 2UWAA 1TMF1 5FBZA 5D8AB 1APNA 1AXKA 1U5YA 3M3OA 4PBPA 2CNAA 1NE4A 1Q8VA 3ZFGC 2GNMA 4Y4YA 1GQHA 3HBZA 4HMZA 1QKQA 2IXHA 4AF9A 3WDVA 1SQ4A 1WMDA 4JV4A 3E6DA 1GANA 1MS1A 4YVWC 3MIBA 3O0XA 1DG6A 4LLFA 3TYJA 2B5HA 3M3EA 1YIPA 3JZVA 4TWTA 1MS9A 5LEJA 3RPQA 3GALA 2ZGRA 1EAH3 2ZGLA 3VBRB 3VBUA 2VECA 5CIRA 1YJLA 2A6YA 1D4M2 4LNVA 3TNPB 4YW5A 4LE3A 3LZZA 2Q0AA 2AENA 3MF6A 3V64A 3PVOA 1CQ9A 4TZDA 3THPA 1ULDA 4NWWA 3UKTA 5EJ3A 3VUOA 1GZWA 4BH9A 4COYA 2OUJA 5JAXA 4CDXB 5GKAC 1I3HA 2VG9A 1D0GA 1EAH1 3OD4A 4FPFA 3IT8A 1LJ7A 3MF9A 1WCDJ 2GMEA 3WHUA 1PHMA 3QLQA 4RQPB 1QNWA 4C1WA 4CEYC 1UKGA 2JE9A 4COZA 1TME2 3ZYIB 3JQWA 4K40A 3DF0A 3PVEA 2WSUA 4AFBA 2Y38A 1SFYA 1PGL1 4RA0A 1CAWB 2DFCA 5KXBA 3E5UA 1S1AA 3DUIA 3MICA 4M3CB 2RJLA 2EVXA 4AFAA 2P2KA 1QY4A 1BCXA 5FOBB 1UPIA 4SLIA 3D6EA 1YI7A 3U11A 2HWD3 3B5LB 5DUXA 5BNQA 3WVJA 2VW1A 2C5DA 3K48A 5AC92 2ZKNA 2C0ZA 4FXKB 4GWNA 4D7YA 4BM8A 3AMHA 2ZZJA 1IKQA 3M3IA 1MEC3 3AP7A 1PO12 3FBYA 1DQ6A 1PO22 4M3CF 1SMVA 2XLFA 4Q0PA 4X8NA 4WM7B 5T52A 4K9SA 4AI3A 1Q5OA 2DCTA 1Y9QA 2HWD1 3M8LA 4Y5Z0 3WV6A 4COUA 3EHKA 2FZ2A 4B3NA 2JG9B 4MH0E 1G9BA 1FXZA 5GZDA 5GZGA 3EBRA 1ZA4A 1WD4A 1RJ8A 4R9AA 4TSVA 3AM2A 1N1YA 4EN0A 2ZGQA 3AKTA 1MEC1 4IV3C 4JGYA 1DGWX 2GH2A 1BEV3 3IMNA 1KITA 4E2QA 5JVVA 1RJ7A 1S2BA 3M3QA 2TEPA 4AYUA 1DGRN 3AK0A 1QHDA 1RUJ3 4XFCA 1HRI3 4XXPA 2WFF3 1OOPA 2AR6A 2GN7A 3JCIA 5DDJ1 1G9AA 1BBT3 2IC1A 2RS12 3R4DB 1RUF2 4CP0A 3KM5A 2HWF2 1H0BA 3AXDA 3B69A 3ES1A 2LTNA 1ZM1A 4L99A 5CFCC 2Y26A 1JBCA 1BEV1 3MFAA 5KXEA 1IS6A 4AE2A 1DFQA 4HLTA 2CL2A 1T6GC 4PLNA 1RUJ1 4NVPA 4OUSA 1HRI1 1RUE2 4E4SA 5JOYA 1HLCA 2WFF1 4YZ2A 4FOYA 3VL9A 1BBT1 2ZABA 1KQRA 3GBWA 1J1TA 1SLLA 4K3UA 2EF6A 2K9ZA 3Q9OA 4QGNA 1DYPA 5C8CB 1O7FA 2GNDA 2PQQA 3M4FA 4E9KA 1WD3A 4XOGA 4AVTA 3MGUA 2WS93 4IQPA 1LOAA 1C8M2 2UY8A 4KNCA 3JB8A 4DPNA 1IS3A 5J09A 2JENA 2JJ6A 3SXWA 2X29A 1DDLA 5K7PA 1IQAA 2HYKA 1AYM2 1NQDA 1DQ5A 1V6IA 3JB4C 2IXLA 4MGYE 1R1A2 2TBVA 4LR4A 3D8CA 1LEMA 4LTAA 3ROUA 4IEQA 3OTFA 3U4XA 4M3CA 2R072 1AXZA 3NKTA 2D44A 4WVZA 4AEDC 1ND3A 4AHYA 1FV2A 2WS91 3S6PA 5I0RA 4GMP3 4AWDA 5IT6A 4LE4A 2D97A 2CAUA 4FQ4A 3BCWA 2R0FA 2ZKLA 1YIFA 2OUHA 1UU6A 3WW4A 5FDBA 3FC0A 4ONUA 2WZR3 2EXJA 4AFMA 5DG2A 5I8YA 2O0OA 2CTVA 3LOBA 2VOVA 2V09A 4DOUA 3FX3A 2QFEA 1MVEA 3BOWA 3NV2A 1H8VA 1SBDA 1G6NA 3ZXKA 1B35B 3ZFEA 2DV9A 3WW3A 4GMP1 2JG8A 2XJPA 4YZ5A 4HN1A 1PMIA 4KWJA 3VZLA 1ZRFA 2XL9A 5GZCA 4WZFA 4NHKA 4ISRA 1RUNA 1U5ZA 5FCCA 5SV8A 2WZR1 3JD72 2W39A 1HW5A 2FMYA 4URTA 1ND2A 1AL0G 3AP4A 3QACA 1AZDA 3L2YA 3WG2A 4K1ZA 2ZGKA 4IL7A 2FHRA 1YJKA 4E4DX 1ULCA 4V1PA 2ZACA 3ASIA 3AMPA 4W65A 5CFDC 1W6MB 2QZ2A 1LHWA 1RUI2 3DGTA 2PHRA 4JGZC 4XFAA 3OY8A 5C8WA 4CEWC 1Z7S3 4A7YA 3RWNA 2D6NA 4BZ4A 4HL0A 2XUMA 2DU1A 2VW2A 2XVGA 4AI8A 1EV13 4O9EA 4YM1A 1BXHA 1RVF2 1ND3C 2I07B 1TMF2 2YY1A 3FLPA 4FPYA 1MS3A 2E7TA 4PQ9A 2H0VA 3B7MA 4RGGA 1NA1C 1PK6C 4XJZA 2DCZA 1HQLA 4YGCA 2BBVA 2R1DA 1AR63 3WP6A 4W6XA 1R1ZA 1A3KA 4GKXA 1VBB3 4UXAA 5IK7A 1HV1A 1Z7S1 3MFCA 2E9QA 5GLZA 3WQ1A 5FO8B 3DPRA 1UF2C 1EV11 4FOWA 4P5HA 4RR3B 4LBJA 1SLCA 3INAA 1JW6A 2WNVC 2E51A 2ZHKA 1POV0 3USUB 3ACLA 1LCLA 1AR61 4QGMA 5E88A 1VBB1 4M3CE 2WINB 3IN9A 5KC5A 1QXJA 2EAKA 1QDOA 4Y1VA 1UMZA 4WZCA 1EAH2 4HANA 2ATFA 4H14A 1RUOA 3RG0A 1C5HA 3AKSA 4F7ZA 2OVUA 3KMHA 3WCRA 3U0ZA 1MZ5A 2R16A 1FATA 2ZCWA 2D6LX 4IEXA 4AI2A 3QBQA 1UZZA 2Y0OA 1OI6A 4PDWC 4U36A 3J9SA 3WQ7A 1O5UA 1S55A 4YFZA 2IWGB 1WW6A 2O8OA 4PLOA 4N43A 4AXOA 3NAPC 4PBOA 2X5IB 3VDDA 1C1FA 2NLRA 1QU0A 3HAGA 1H4HA 2Z42A 3ZN6B 3HWJA 2ZGNA 1OQEA 5EXOA 3ALQA 2VMHA 5HCFA 5GJ6A 3NVCA 2EA7A 1ZRRA 1KRIA 4LBLA 4AFCA 4QQPA 1BJQA 4XEZA 4I02A 2AREA 2MNGA 4WM8C 1X8EA 1JYCA 2A71A 4L2NA 2RS53 4YW4A 2AZ5A 1LODA 1V00A 3B3QE 4WVMB 4E2SA 5CU1A 1DQ1A 2HWB3 3DN7A 3NJZA 4QM9A 5GLWA 5GLVA 4COVA 4L9BA 2SLIA 4I3GA 2HWD2 1NCRB 4LULA 4MZUA 5J7MA 1HXS3 1A8MA 1NG0A 5C9AB 5KXCA 4MGIE 2RS51 4AQ2A 1ENXA 2R6QA 4L92A 2CAVA 5EYYA 2YXSA 2TNFA 2WQ4A 3DKWA 1MEC2 4FPOB 3MW4A 4IV1C 3R4SA 2QUOA 4YGDA 4XBQA 1SBFA 3VKNA 3OJBA 3H50A 3WDYA 4QQ2A 1NCQB 5FREA 3I59A 4XTPA 4FP2A 4JDMA 1HXS1 4YGEA 2DCJA 1SBEA 5DDJ2 2OA2A 2CY6A 5JSPA 3O5SA 1LTEA 4HKOA 3PVNA 4AVBA 2GC3A 4RR3A 5DZGA 4P9YA 4C91A 3SITA 4N43C 1F31A 1CESA 1RGSA 1GICA 2Z69A 1BEV2 2BNMA 3LAGA 5JZGB 1CJDA 3L2HA 4XW3A 5FLHA 2UY9A 5FAXA 1RUJ2 1HRI2 2WFF2 1EY2A 2NMOA 3WT3A 2BVVA 4AVSA 4YVSC 5J96B 1BBT2 3WZ1A 1N3QA 4JQRA 2GH8A 4YVWB 4A7KA 4UW4A 4YM3A 1QGLA 1CPMA 4IESA 5T3NA 4Y20A 1PNGA 1PGSA 4AEMA 2C9AA 1AHSA 5T50A 3ZVXA 1CX4A 4FPGA 2IXKA 2YZ4A 4HPKA 3UKNA 1OA4A 5C33A 4DNYA 1S0CA 4P9XA 5EV7A 4BQ1A 2DVDA 5JPMB 4Z92B 2HEYF 2X53S 4INDA 3I4IA 3NWKA 4P9WA 5J48A 2XJQA 2ILMA 1AYN3 2BNNA 4Z8BA 4U2AA 4UW5A 3VZJA 1BK1A 5E16A 3RSJA 1C8M3 2WS92 4ES8A 1W6NB 4QPIC 4GIQA 1JXNA 4CEYB 4EJRA 1UU4A 2V5YA 2UYBA 4X6RB 1AR93 3MEPA 4XFIA 3VHOA 5FOJB 4YARA 4RFT0 1RITA 1CAXB 4GH4A 2ZX2A 1SFNA 3CLPA 4RSUA 1WA4A 3PNAA 4RGAA 1AYN1 1MQTA 2P37A 4NO4A 1RL3A 5KHHA 2RMU3 4RS5A 3TN93 3VV1A 4R9CA 2PAEA 4HVQA 3OBRA 2RHPA 1CGPA 1W6OB 4CDQA 1ZBA1 3VBFA 3CEWA 5A32B 1SCRA 2E7QA 3CJIA 4JAAA 4D94A 1AR91 3N4MA 4EV0A 4CDUA 1V9U3 3UK9A 1LECA 2WZR2 2XJSA 1KFUL 4XJUA 2R30A 3IPVB 3RNSA 3SH4A 1GBGA 2RMU1 3GHMA 3OGGA 4KU8A 2JECA 4A3XA 3TN91 4AQSA 5I8TA 4BWOA 3WHTA 4FPKA 4CP1A 1I5ZA 1XU1A 2BNOA 1X36A 3S30A 1H9PA 3H1MA 4HK8A 3ZYJB 1BYHA 2WC2A 2YC0A 1U5XA 3AYDA 2ZMLA 1V9U1 3ZFFA 4DQAA 3S0MA 2B7YA 5CNAA 3SLIA 3VBHA 3ZMNA 1H2NA 2R32A 2JD4A 3KT1A 4XBNA 5T5PA 3G6JB 1VP6A 3HN1A 2NM1A 2WL1A 4IV3B 3B9CA 2FMDA 4DMIA 4AVAA 2GSYA 1Q43A 4M0HA 3ILNA 2N7GA 5JSRA 3ECQA 1AR73 2BYVE 2XLGA 2P3IA 4XPVA 5DUUA 2YMZA 2DURA 4XE9A 4XQDA 4IERA 1Z7S2 1UL9A 1SACA 3WDTA 3D82A 2Z5WA 1HQNA 3ELNA 1URXA 1MQTC 1VBC3 1EV12 1O3RA 1RVF3 3D0JA 4LHKA 4RS5C 5CFCB 3WXPA 1O3SA 1DYKA 2ZTNA 4CDQC 3RJRA 1NXMA 4AQTA 5AVPA 3KCXA 1AR71 1CIWA 1WBLA 2RM23 1QH6A 5KHIA 3C2UA 1YCIA 1AR62 1WLCA 2DVBA 1CPNA 2WNUC 1VBB2 2VVEA 4N9IA 2ZX3A 5H9PA 2NP0A 4FPCA 1QF3A 4KG0A 1PZ9A 1VBC1 2GALA 2ZX4A 5A33A 5ABJC 4BLJA 3ZXLA 3KT7A 1V6OA 1PGW1 2GMMA 1H8TA 3MW2A 2VGDA 4ZU7A 5DZEA 2ZAHA 1L3JA 2XG3A 1RB8G 2RM21 4XFHA 3VBOC 1UAIA 3RYPA 4DINB 1WLTA 3OYWA 3PMSA 1LESA 1CAXA 1XE7A 3ZFFC 4NN0A 2CYFA 3VBHC 4NHMA 4C0BA 1UZYA 4NR1A 1DZQA 1COV3 5F6KA 3ZYGA 4LBKA 4MYEA 2B9UA 5CADA 4FPEA 4XETA 3RRDA 2YROA 4K7JA 4AEDB 4XFGA 1GZ9A 3VGIA 1ZVFA 2W08A 1J3RA 3WG1A 5I0SA 4OI1A 1J1LA 1MACA 1GLHA 2ENRA 1IPJA 1N47A 4QPGB 3RJ2X 3ZO0B 2GMPA 4MGZE 3NL1A 4P9GA 3TOJA 3ES4A 4Y24A 3D5OA 4YG0A 3WP4A 4CDWB 2D3SA 2LALA 1COV1 1X33A 1UKRA 1AX0A 5IK5A 4XYXA 5K0UC 1F2NA 1TQ5A 2FZ1A 1ALYA 3HQXA 4W6WA 4FAHA 4G9SB 4R4XA 5H9QA 5C4WA 1NLSA 4Y22B 1QQP3 2OZ6A 2UYAA 3OBTA 3HD8B 1RHI3 2I74A 4FQZA 2RS52 5LK5A 2NYYA 1QJU3 1ZRDA 4JTOA 5BNPB 4K20A 3RQ0A 4YZ3A 1K5MA 2PHFA 4WV8A 2HWB2 2NPIA 2A6VA 1SEFA 1AJKA 5BNNA 2ES3A 2ZZQA 2GC2A 1LENA 1QJY1 1QQP1 3H8UA 5BNOA 1C8NA 4Q0VA 1HXS2 5CAZA 3E6BA 1RHI1 5CFDB 4KBBA 4PCRA 4GWMA 3BIWE 3P3NA 4CEWB 2ZOEB 1QJU1 2VXRA 2BWAA 2QE3A 3LA7A 5JOZA 4XF3A 2D93A 3VBUC 4EN7B 4OI0A 1PZ8A 3IDBB 1V6NA 1D2QA 4LT5A 3K51A 1G9FA 2EXHA 3KQRA 3WQ0A 1RMU3 1BVVA 3IM0A 4HVOA 1NA1B 1PK6B 2BVBA 5DDJ3 4XF4A 4EWAA 1N1VA 1YHFA 3ZSMA 1CAVB 3FMGA 4Z1VA 2DCKA 5D8AA 2W68A 1FYUA 1GV9A 3MYXA 3VN4A 1S2KA 3O12A 3JQXA 2WNVB 4I0BA 3MPBA 3S7IA 1RMU1 3BPZA 1FX5A 1MZ6A 5C4WC 1ZRCA 4WVWA 4F83A 1VLNA 5BUVA 3SMHA 1V6MA 4Q4V3 3AZXA 1UIJA 3C3VA 2OPKA 2VMIA 1BVP1 3VBRA 2CGPA 4RD7A 3ATGA 4S2DA 5JI9A 2EXIA 2XGXA 5DXDA 1EP0A 1Q8QA 4Q29A 1HX6A 4XMAA 4AGRA 5FRAA 1OPOA 4FOQA 2WFPA 2WT0A 2PA7A 4Q0UA 1LU2A 4FPLA 2Q5TA 3PJQA 3IWZA 2E53A 4PDWB 4ASMB 4Q4V1 3I7DA 4CDXA 4QD2A 4DY5A 5JR7B 2NMNA 3BALA 4B29A 2HKXA 1HV0A 4I09A 2A6WA 2VU9A 2EALA 1AYN2 2PYTA 5J37A 4XZPA 3NAPB 4RQPA 4AI1A 4GQ7A 4KQ7A 3MLKA 2XVLA 2WA4A 4Q4W3 1RIRA 1AR83 1ZBA2 3FUOA 2W52A 4G3YC 3ZYRA 3AKPA 3ZSLA 1AR92 4I01A 5JI7A 2A6XA 1A6CA 3WW1A 3GZAA 5JIUA 1ZX5A 1OLQA 1CAWA 3ZMOA 2Y0IA 5JOWA 5FQ0B 4WM8B 4R4ZA 3N3HA 5AVAA 1RUD3 1OKQA 2XL7A 2RMU2 2MHFA 4JGYC 3TN92 4Q4W1 4QGLA 4LUMA 2V73A 4LO8A 5T5LA 1AR81 2O1QA 1GZCA 1UU5A 2A70A 4LO5B 2BQPA 3RYRA 2W0XA 4LO7A 2ZGUA 1OOPC 4MLOA 1TNRA 3VZKA 3ZSEA 1V9U2 3ZIXA