4EWEA

Study on structure and function relationships in human pirin with manganese ion
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
b'SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA01
5I0UA 4HMZA 3FFQA 1PMIA 4XFBA 3KMHA 1V70A 2PA7A 4PIXA 4AVAA 3C3VA 4MGKE 1UCXA 3VHRA 4EWAA 2EVXA 3ACLA 4JV4A 1XE7A 2K9ZA 1Q3EA 3HQXA 1EYBA 1XE8A 4O9GA 5BPXA 3I7DA 3H9AA 4HSJA 2XGXA 2Q1ZB 3I59A 4IESA 2QCSB 4FBFA 1DGWA 2XL9A 3SXWA 4YYOA 1PM7A 2GC3A 4A2UA 4MH0E 1QXRA 2IXJA 2GC2A 5CADA 2H6BA 1I6XA 2MPFA 4ORFA 4HZFA 4FT8A 2ET7A 3WW3A 3QACA 5FQ0B 1SFNA 4MGYE 1X8MA 5J7MA 3U10A 3USSA 4QGLA 4WVZA 1NE4A 1LKNA 1OI6A 4LA2A 4D7TA 5JSRA 3NW4A 3RDIA 1EY2A 2Q30A 3PVBB 1FT9A 1RC6A 4EWEA 5FPZA 1UPIA 4I02A 2VQAA 4MV2A 4B29A 2Z2SB 1GQHA 4XETA 3FWEA 2PAKA 3NL1A 3ES4A 3QOPA 2HJIA 3CO2A 1DZRA 4E2GA 1U12A 1IPKA 1LRHA 2CGPA 1CAWB 1VP6A 1EP0A 3NSTA 4XFIA 1VJ2A 2K0GA 2Q0AA 3WW4A 5C6CA 2CAUA 4EROA 1O5LA 2UYBA 4F8AA 2D93A 4MZUA 5D1IA 1FXZA 1ZZ7A 3CF6E 3H7JA 1J3PA 1XRUA 2OZ6A 1X8EA 3H1YA 4Q29A 5I8SA 1ZNPA 2GC1A 5I0SA 3IWZA 3H8UA 4YNIA 1YFUA 4HBNA 3D82A 3H1MA 3LA3A 4MGZE 3MZHA 5LRRA 2XLGA 4AQ2A 3E97A 1YWKA 2KXLA 1YUDA 4QM9A 1YFWA 4XFHA 3DKWA 2H0VA 4LUMA 2GAUA 3HIFA 2BYVE 4QX5A 4UBGA 5JCTA 3E6BA 3EJKA 3PNAA 3S0MA 3RYKA 2ETEA 4XFAA 5K8SA 4IERA 5KHJA 3EO6A 5BV6A 2BEOA 4EWDA 1CAVB 1NXMA 3DL3A 1ZZ9A 3CL1A 2Z69A 1ZRFA 2ET1A 4META 3RYPA 3NJZA 1I5ZA 3ST7A 4R52A 1TQ5A 5FLHA 1OD5A 2N7GA 4KU7A 4I2OA 3CJXA 4IEVA 1J3RA 4XF3A 4UXAA 3OTFA 1ZREA 3LWCA 2IXCA 4QGNA 4FAGA 4HVRA 3SMHA 4XFGA 3G7DA 3RZZA 2IC1A 2Y0OA 4N9IA 3GBFA 2VECA 4HVOA 1RUNA 5FQ0A 4X6RB 3RYRA 1CAUA 5AVPA 1O7FA 5C8WA 2UYAA 1G6NA 3D0JA 3HT1A 2CV6A 2B5HA 2QDRA 1NYWA 2GZWA 2QVSB 5KHGA 1O3RA 3SCHA 4LULA 2BNNA 1NE6A 2PFWA 2ZCWA 3FX3A 4Z07A 4XFFA 2XKPA 2UY9A 2UY8A 1UIKA 3MYXA 3WW1A 1RUOA 5T3NA 3R6SA 5I0RA 4EV0A 4F7ZA 4OLLA 3HT2A 4XF0A 5E1RA 5I8TA 5KHKA 1CAWA 3D0SA 1NZCA 2FQPA 2IXHA 2MHFA 4XF1A 3E5UA 3H3UA 3DV8A 3S7EA 5HI0A 4Q0PA 4AVBA 5FLIA 1CGPA 2E9QA 5I8YA 2ZKLA 1RGSA 2O1QA 3WW2A 5LRSA 5EZWA 3LA7A 4J1XA 3RNSA 5KHIA 1ZZ6A 4XFCA 1X7NA 4Q0QA 2F4PA 4I09A 4FAHA 1FI2A 1LR5A 4HLTA 2VPVA 1J58A 2XLFA 5FLJA 1J3QA 4HVQA 4NVPA 4UBHA 2DCTA 2PYTA 3OD0A 3CLPA 3LAGA 3BPZA 4IEXA 1OFNA 1OMIA 1UW8A 3BCWA 3I54A 1HW5A 4AQ6A 4IEYA 2QJVA 4WZCA 3S7IA 2H6CA 3M70A 1UIJA 2XLAA 1LB2A 3KGZA 4LUKA 2FMYA 3EHKA 2HKXA 2GH2A 5F1RA 4HN1A 3E5XA 1CAXB 5I0TA 4DINB 3FE5A 2WC2A 3MDPA 4CYDA 4Q0UA 3DN7A 2D5HA 4BIFA 1QWRA 3KSCA 4MGIE 4YRDA 3RPQA 2GU9A 1WGPA 4H7LA 4PIZA 1DZTA 4IEQA 4AVCA 2BGCA 1O3QA 3H1WA 4XF4A 4BYYA 5JAXA 1H1IA 2EA7A 3E5QA 1H1MA 3ETQA 4LEJA 4BHPA 3ZDSA 2IXKA 4IEOA 4KL1A 4QMAA 3FZ3A 3OCPA 2BNOA 4OFGA 1GQGA 5LEJA 4IEWA 5JSPA 1UD1A 2OZJA 4QGMA 4WBBA 4JVAA 1Q5OA 3MPBA 5JSOA 4I0BA 4PIYA 1EPZA 1VR3A 2QNKA 4K8FA 3SHRA 4LA3A 5FDBA 3OF1A 4KWKA 1O4TA 4ZU7A 5J3UA 3ELNA 3SCFA 3U0ZA 1Y3TA 3I59B 1ZRDA 2D5FA 3NVCA 4L2NA 4IETA 5KBFA 1IPJA 3EBRA 4Z82A 2EAAA 2PQQA 3N4MA 3UKVA 2PTMA 4N9HA 4HN0A 3KCCA 1QY4A 3JZVA 3NKTA 3BALA 4J1WA 3H50A 3LZZA 1RL3A 1CAUB 3TNPB 4TLFA 3IBMA 1YFYA 4QM8A 3ROUA 3UKTA 5J48A 4I01A 2XL7A 4HSLA 5I93A 2I45A 3M3IA 2XKOA 3UKNA 5KHHA 4XEZA 2OYZA 3BU7A 1O3SA 1WLTA 2PAEA 1YHFA 4L11A 1WA4A 4YARA 2BNMA 4KWLA 4MUVA 2MNGA 2B8MA 1YFXA 2C0ZA 4I0AA 4ONUA 4Q0VA 4Q0SA 5BY5A 5FPXA 4RD7A 2PHDA 3H7YA 4AXOA 4ZU5A 1RTVA 4QXKA 3E6CC 1O5UA 4X6QB 3E6DA 1ZZBA 4KWJA 1ZZCA 2IXLA 2Q4SA 3IDCB 2P17A 1ZVFA 3B02A 2O8QA 3GYDA 5JR7B 1SQ4A 5CU1A 2OPKA 4KU8A 3U11A 4E2SA 3IDBB 4XF9A 2XHKA 4MX3A 3BB6A 3IIAA 4JTNA 4PJYA 2CAVA 2GC0A 1L3JA 5E16A 4GULA 4IEPA 1O3TA 4LLOA 4BH9A 1SEFA 1X82A 3OGJA 2PHLA 5I91A 1CAXA 3FHIB 4IEZA 1YLLA 3LA2A 1J1LA 5BUVA 2PAMA 4P9GA 1CAVA 1ZRRA 4I3PA 5CVRA 4ZU4A 1DGRA 5FCCA 2D40A 1QXJA 1J59A 2ATFA 2B9UA 4O9EA 3TNQA 3SCGA 3L2HA 4D7SA 1JUHA 3EQEA 4E2QA 3PLQA 1Y9QA 4R8HA 3CEWA 2IXIA 3LOIA 4LTAA 4YSFA 3KGLA 1ZX5A 5EFUA 5LEKA 1CX4A 1ZRCA 1ZZ8A 3ES1A 3H3ZA 5BXXA 3FJSA 2V09A 1Q43A 4JTOA 2WFPA 3O14A 4IEUA 2OA2A
chains in the Genus database with same CATH superfamily
5HPOA 5B4NA 1PMIA 1JS9A 1W9SA 1X33A 4IV3A 4OUMA 1FMD3 1NXD1 4XFBA 3RZHA 4JGZA 4PIXA 2XVGA 2WSVA 4MGKE 1VBA1 2FDKA 3WQ7A 2EVXA 1KFXL 5IVEA 4JV4A 1XE7A 4A3XA 4JKKA 3HQXA 3AJYA 1HB3A 1DZQA 5JIUA 3AKRA 5CIRA 1D4M1 2HH9A 4NPRA 3I2GA 5FY4A 1V6KA 4ASKA 4CDQC 2R32A 1LODA 2A3YA 4BQ1A 1AL0G 5FTTC 4H7MA 2QE3A 2AREA 3HPNA 4XURA 2QCSB 3PUAA 1DGWA 1H30A 3S5QA 1DHKB 2XUMA 2XL9A 5JZGC 5ACA2 1PM7A 2VQUA 4LNVA 2IXJA 5LA9A 3WDYA 3QBQA 4C90A 2ZX4A 3FLPA 2IFRA 4OI0A 5C5UA 5CADA 1W04A 3MFCA 1I6XA 3ZYBA 2XDVA 1UU6A 3C7EA 4QQOA 1R082 3U4XA 2FD8A 4XC9A 4ATFA 2PELA 1BEV2 1KGYA 3WEZA 5LZ6A 3I49A 3GZUC 5FY9A 1ASJ3 2ZGPA 1SFNA 3ASIA 5F2WA 5FO7B 4TLGA 2HWD3 2RS11 1CIYA 4WM8B 4JGYA 2DBNA 4RHV3 1OI6A 1O91A 1VBD2 1M06G 4AG4A 1VLNA 4RQPC 1LOGA 1SACA 4Q4X3 1EY2A 2Q30A 3M7AA 2DFCA 3PVBB 2WA4A 1CJDA 1NCQA 5FPZA 1HB1A 4AE2A 3O1UA 5F6LB 3KV9A 2VQAA 2V4VA 2Z2SB 1W6NB 3A7QA 4JC1A 5JUVA 1GQHA 4AI0A 4AW7A 4XTMA 1G7YA 1IGOA 4LBMA 4L97A 5CFCC 2JIJA 3NL1A 3WNPA 2BP6A 3ES4A 3QOPA 3V0BA 4JCKA 2G1MA 2JG8A 5JMCA 3S57A 2CNAA 3MEPA 1MPXA 2YV8A 1MACA 1UZZA 3RG0A 4BQ5A 5KXEA 2CGPA 1GICA 3B94A 1WD4A 1CAWB 1AYN2 3WNNA 1VP6A 3AL5A 2KR2A 3PMEA 3BOPA 4LO4B 5F6KA 3ZN6B 4XFIA 2P5BA 3NJXA 1R093 1O4YA 4QXHA 3AZVA 1C1LA 4COWA 1VJ2A 4EE2A 3QCWA 2R49A 2Q0AA 4M4PA 2R072 2D97A 2RS33 2WIIB 3HWJA 4L0PA 5C3SA 1GFF2 4DQAA 3BIEA 4RR3C 4XJWA 2R063 4LIVA 3WF1A 1L7LA 3KWVA 3H42B 3KVBA 1VMFA 3LEKA 2G9ZA 1TME1 3MUZ1 4JDNA 2JDAA 3WP3A 2BFUL 4RGKA 4EYUA 1UN1A 4GAZA 1V9U3 4AF9A 4NRQA 3CF6E 4PQ9A 4Q8KA 1UXZA 2CDPA 1XRUA 2OZ6A 3H1YA 5I8SA 3T0AA 4GWJA 2VY0A 3HAGA 1RUJ1 3LB9A 1W3XA 3IWZA 1GZCA 1V6NA 3H8UA 4IDZA 4LBOA 3DXUA 3H1MA 1MEC3 4RFT0 3JD73 3SH5A 4MXVA 1LGNA 2RDRA 4Y24A 2WL1A 1X9PA 2WDBA 4UAPA 1EV13 3BI3A 4INDA 2QQWA 4CP9B 1OD3A 3E97A 1AR82 4XW3A 5D8AB 1YRZA 5L9RA 4DOUA 4QM9A 1YFWA 3N9PA 4DEVA 2X10A 3DKWA 1A6CA 2H0VA 4LUMA 2Q1MA 1Y9GA 4N53B 5FZ9A 5IYYA 4PLNA 4FQZA 5H9PA 5A1AA 3VHPA 4E4ZA 2VNVA 3PNAA 2VR4A 3KF3A 3S0MA 3GZTB 2BUKA 4FPGA 2ETEA 1N3PA 1POV1 1VBB2 2EIDA 1K5MB 1LOFC 4XFAA 5K8SA 1QH6A 2WNEA 2E7AA 2SLIA 1QQP2 2BEOA 4D3WA 1AR93 1CAVB 2QTWB 5AVAA 1HIXA 3OGSA 4BLIA 4CEYA 4JHTA 4YM3A 2RG4A 1RITA 4QU2A 5BNOC 1ZRFA 3MV11 5L19A 3RYPA 4FPHA 4L8QA 1RUI2 2RS52 1S2BA 2EAKA 5T5LA 4XUOA 1XQNA 3AP9A 3NQHA 4XIOA 5FJKA 3UL2A 4GB32 3N9MA 5FZ4A 2HEWF 2HYKA 2QKDA 1AL22 1A8DA 1S4CA 2C4XA 2W92A 5EJ1B 2BW8A 4Y4YA 3LOBA 4V2VA 3N9OA 4XBQA 4XTPA 1W0PA 2QBXA 1NZIA 4K7JA 1HV1A 1OSGA 2WWUA 2ADEA 5FZMA 2ZX2A 3SMHA 4EN8B 4Q4V3 3G7DA 1WCKA 1KXGA 1CVNA 1PK6C 1K45A 1TNFA 3GBWA 3RZZA 5A3WA 3FBMA 3WUDA 2ZEWA 5FY0A 3SEEA 5BNQA 3GBFA 1OOPA 4AVTA 2RDSA 1W2TA 1LGCA 1RVF2 3M2MA 3CZUA 2OXBA 4CEWB 1FOD3 4L9BA 3KQRA 1US2A 2P3YA 1QJY3 1FNYA 1G6NA 3D0JA 2CV6A 1JU3A 1QF3A 1RJ7A 2RDNA 4I0WB 4TTGA 4B8EA 1SCRA 3JBG3 5BYNA 5IVVA 4UOJA 3H8XA 4NIDA 3WOGA 2Y6LA 1PO21 1M4WA 1KS5A 1OLRA 3VBUB 4NWWA 1HLCA 1WMEA 4BQ2A 2PHXA 1RUD2 1EUUA 2XOMA 3C8XA 3GHNA 3MYXA 4LQRA 5EHDA 3WW1A 1RYYA 5JLVA 5T3NA 5FZAA 2DTWA 1HRV1 3LIHA 4GMP0 3VBOC 4AI8A 3MW4A 3AJZA 1W6MA 1ZBA2 1D4VB 1O59A 2ZX0A 3HT2A 5E1RA 5I8TA 1DYOA 3FFZA 1CAWA 3M3EA 3ZN6A 1Z7S3 1I1EA 1WKYA 2IXHA 2FQPA 3OYWA 1F31A 2W47A 1KD7A 3LDKA 4G4FA 2MHFA 4ISRA 1APNA 4XF1A 2VTFA 5FXZA 3ZPYA 3E5UA 3QH6A 3I2OA 3LKJA 2GH8A 3DV8A 3RWKX 4QXBA 5F5AA 2E9QA 2XWBB 3ZR6A 2VZSA 5I8YA 3A4UA 4XDPA 5F32A 5FYHA 2JD4A 4W6XA 5IVFA 1K12A 1H6XA 2FBEA 2FZ1A 3J4UH 4UFMA 5BNNC 3LA7A 4GJZA 1XOYA 1RXGA 4P9LA 5T50A 4AEDC 4AI9A 2ZKNA 1RHI3 2JECA 2CGNA 2R1DA 2IZWA 2WQ8A 5DZGA 2Q5TA 1H8TC 4K9SA 1H2MA 1RINA 4Q0QA 2F4PA 5FMBA 1HXS1 1QJZA 3CZJA 1MZEA 2XLFA 1J58A 2XJQA 1HQLA 4NVPA 4UBHA 2PLV3 3CJIB 1HB4A 1WUVA 3ZFGA 1C28A 4IEXA 1OH4A 1UW8A 2WZPP 1POV0 4QPGC 3SEPA 4RL7A 3UGGA 1RUC1 5CB7A 4NWVA 1D0HA 1UY0A 2TNFA 2QJVA 5A32A 1IHMA 4XOGA 1SLAA 5GALA 3S7IA 3Q8BA 3M70A 4D94A 3LF7A 3D8CA 3DYPA 4GWNA 5CKQA 2Z4FA 3TN93 3KGZA 4JQRA 2XBO2 3HN3A 4QX8A 3ETPA 3WF2A 5GLUA 5GLWA 3VBHC 5A3LA 3UNPA 2WFF3 2DF7A 1CQ9A 4XJAA 3T4VA 3W21A 4CDXC 2HKXA 4OMCA 5FWJA 5EWSA 1UNBA 3R4UA 2B4KA 3B01A 3HR9A 1AJKA 4LBKA 3T0DA 1GUIA 3U14A 4M0HA 4W6WA 2ARCA 5JXGA 3RZJA 3VBSC 2WC2A 3MDPA 5DUUA 1MVQA 2EXJA 2YDEA 5EYXA 1OVPA 5IAXA 2G9FA 2QUOA 3DN7A 4H3WA 1VE0A 2D5HA 3GNEA 4BIFA 1QWRA 4OQ8A 5A3UA 4MGIE 3C2UA 1W6PB 2GU9A 2DVFA 3B9IA 3OGVA 5DG2A 4YWAA 5K0UC 4AVCA 5L9BA 2DDUA 2XJVA 3R0RA 1OF4A 2AEYA 1PGW2 4QU1A 2RE9A 3E5QA 3P3PA 4B4RA 1H1MA 4YM0A 4YGBA 1BKZA 4EN7B 4CCDA 3K3OA 2LTNA 1UL9A 4IE4A 3ZFGC 4KGGA 4LBQD 4YVWB 3BTYA 3J7MA 3M1HA 2ADDA 4GH4B 1SFPA 2DVGA 4MYEA 2WRAA 2BNOA 4R9DA 2BOIA 4F3JA 4JX0A 3N7LA 4Y22A 4QB6A 1CONA 5JSPA 5FUPA 1EAH2 3UGHA 1GR3A 4CPBA 1BMV2 2WO1A 5C9AB 1MS4A 4PIYA 5DMYA 1VR3A 4K8FA 4AFDA 3SHRA 3THTA 5ISLA 2GP3A 4K3UA 1RB8G 1JODA 3OF1A 4CEWA 4AQSA 2E53A 2YB7A 4LOTA 5APAA 5A6QA 1S0IA 3I3EA 2ZJCA 5FXWA 1PX4A 2X8KA 1JYCA 5T54A 3ELNA 3GJBA 3W9AA 2A6ZA 1Y3TA 1F4AA 4S2DA 1SLTA 4UFKA 4B4QA 1ZRDA 1AJOA 1F5JA 4QB2A 4DRRA 3IKWA 1UO9A 4IGPA 2JG9B 2DUOA 3OG2A 1CR7A 2D3SA 2BVVA 3Q9OA 5IUQA 3VD7A 1RUF1 2PTMA 5FY5A 1URXA 5T55A 5CKMA 5CG9A 1TG7A 3KCCA 2RJLA 4IE5A 3H50A 1PM4A 3LZZA 2GMMA 3OPTA 3O1SA 5EJZB 1S55A 1TMF3 4QKNA 2VCCA 2R16A 5FYCA 4TLFA 2F17A 3I2IA 1YFYA 2YU2A 4FOQA 4QPIB 3UKTA 2Z5WA 1QH7A 4LO5B 4BOWA 4Z2WA 5F3IA 3KF5A 5J48A 4NHYA 5KXBA 4LT5A 1ENRA 3E1F1 1XYNA 4I01A 1UPSA 2I45A 3M3IA 1F5FA 2XVLA 2ZAAA 3KLSA 5A7OA 3WDTA 3ILRA 5A70A 2OYZA 3CBNA 4NUBA 3NNFA 1DP0A 1OC1A 2JDKA 3ZXJA 3K4ZA 4AK3A 5C4WC 3N7MA 4NPMA 4DRVA 1YHFA 4YARA 1FMD2 2P37A 2WQZC 3L2YA 5JOXA 4KWLA 3ZYFA 2B8MA 2C0ZA 4Q0VA 2YG0A 4XQWA 5ANNA 3C7FA 3LD8A 4AI3A 2VUAA 5IVBA 1DBNA 3OPZA 4KG8A 1W8UA 4LKFA 4WV8A 4YW2A 1QOSA 4ZY9A 4LK7A 1HJGA 4QQHA 1NY71 1PIV1 1SPPA 1O5UA 4K1ZA 1OHFA 2UURA 4CSWA 3J7NA 1DQ5A 3LDRA 4LORA 4FP3A 2XQXA 4Y4RA 2IXLA 3M8LA 2Q4SA 5FBZA 5CNAA 3WCRA 3FUQA 2P17A 1ZVFA 4QX2A 2O8QA 5FZOB 1JTZX 2BOJA 5JR7B 5CU1A 4NROA 4DUWA 2OPKA 1A3KA 4QDSA 4E2SA 2HWE3 3AMPA 4XF9A 1LHOA 2A73B 4FFIA 3ZMOA 4MX3A 4URTA 2WNUA 1JN2P 3VKFC 1LHNA 3IIAA 4BQ4A 5JDBA 1EPWA 1YQ2A 5ANQA 3Q8CA 3LE0A 5IJRA 1LJ7A 3BPSA 5E16A 1XYOA 2XR4A 1WZXA 1O3TA 2Y6JA 4CCKA 5DUVA 1MR5A 2ES3A 1AR73 1C8M2 4PDWC 3TEWA 2PHLA 1FV3A 3B00A 3K4DA 4CDUA 2WZR2 4IEZA 1YLLA 2AEZA 3M3QA 5BUVA 1UZYA 1COV2 4ZKTB 2QZ2A 3ZFFB 3OJBA 4CCCA 2C9KA 1ZRRA 2WQ4A 3F2ZA 4L99A 4NAMA 5CVRA 1A78A 1YO8A 5FCCA 5DN2A 1XU2A 3TBDA 1W9FA 1W8ZA 1QXJA 5DAXA 4FCAA 3NWKA 4QT6A 2D3RA 4Y20A 1JXNA 3L2HA 2Y26A 2GNTA 3JXSA 4FFGA 2VXJA 3A21A 3P1IA 4QHZA 2HWF3 3N36A 2DCJA 5ACA1 1PO13 1XSRA 1PVC3 1ND3B 3KT7A 4CDQB 5EFUA 4GH4A 4XABA 4IQPA 1CX4A 1Q8QA 1DU3D 5T52A 1NQJA 1ST8A 1HN0A 3WDUA 1QDCA 3AKQA 4AFMA 1ZRCA 5F39A 1VBA3 4XUPA 1R081 3FJSA 2K2SA 1BEV1 2V09A 1Q43A 4EQVA 3HQUA 2YHJA 3UYJA 2WFPA 4IEUA 1D4M3 4P9IA 4FPFA 5I0UA 5IFPA 2XJSA 1TNRA 3FFQA 3KMHA 1V70A 3MIEA 1GP5A 3HOBA 1JH5A 2WT0A 1QJEA 3VZKA 2BQPA 1S0JA 2JDZA 4AEMA 3BTXA 4ZS2A 4XUTA 2K9ZA 1AYM1 3KD4A 1DQ6A 2J1SA 4PBPA 4YZ5A 3AFKA 1JMUB 4C91A 4LBLA 1MQTC 3H9AA 2ZEYA 4LO7A 4QAWA 1VAMA 3OBTA 3JD72 4MXWB 5TSWA 1PNFA 4NHKA 2XGXA 3RZLA 3FHAA 1WW7A 4RQPB 4M01A 2B46X 2Q1ZB 5I0DA 3HN1A 4IESA 4CP2A 5IK4A 2C9AA 1QU0A 1WMFA 2VQ0A 3LSEA 1QJX3 3MIGA 5A1FA 3VHNA 2WAAA 3O0WA 4G3YC 2D6OX 4YYOA 3SXWA 2BU9A 2GC3A 4MH0E 1MZ6A 2GC2A 1YC61 2RS13 2WO3A 1AYN1 3Q8FA 3AZZA 4OZXA 3AMNA 3OGRA 2FHRA 1IS3A 2H6BA 2MPFA 4CXXA 1YJLA 4JHZA 1LEMA 2G4IA 5CFCB 3CQOA 2V5DA 3MLJA 2R071 1OUXA 4JRLA 5GLTA 4OI4A 3UESA 4A45A 2LW8A 3LFIA 1WW5A 1JUIA 1YNAA 4XQ4A 5FZDA 4MGYE 3VBRC 1X8MA 3ABZA 2Q8CA 4E27A 4YFWA 3USSA 2O8OA 3ZX7A 1J83A 4OQ9A 1ZYBA 5JR2A 4NRPA 5F3CA 2BFUS 4LHSA 2X5IB 5JSRA 2VOWA 4FFHA 1T6GC 4RR3B 5C7GA 4W4ZA 3WG3A 3ZSKA 2GALA 2L9LA 3NNMA 3ITQA 1BLZA 5JOZA 1UPIA 4GA9A 4KNCA 3OBAA 2Z79A 5E6HA 4MV2A 4RS5B 4N43C 4XETA 3PUQA 1VPHA 4HONA 2D6NA 4M3CA 4S2GA 2XG3A 2VNGA 2PHTA 2Q8DA 5DQ0A 2VW1A 3RS6A 3CO2A 1W8FA 4AHXA 4P02B 4E2GA 1W90A 4YVSA 5CG8A 3WG4A 3AYAA 3MO4A 4NRMA 3IM0A 2SBAA 1TME3 1JOJA 5FR3A 4DXSA 1H2LA 3NSTA 4COZA 2VMIA 1UOFA 1C5HA 2D6PA 3U1XA 5IVJA 5KR7A 3J8F2 2PN5A 3WW4A 4R4ZA 2VO5A 4QPYA 2ZHMA 5BNPB 4EROA 1MS3A 4AAXA 1RUJ3 2VUDA 4GXLA 1O8SA 1Q8PA 4FPCA 2EALA 2ZACA 1WLCA 4B7KA 2ZHNA 1RIRA 5D1IA 1FXZA 1H4HA 1UZ0A 1WBFA 2I2SA 4R9CA 4HXCA 5HV0A 4R4XA 1QNWA 2Q8EA 2HWC2 2VU9A 1NCRA 3MUY1 1QQP1 2YGLA 1BQPA 2WWSA 3NAPB 4Q29A 5IFTA 1NOVA 3ZXEA 2ZGLA 5A7SA 1R64A 2GMEA 4YNIA 1GOHA 2JDMA 4FSJA 4IXLA 2EXKA 3FHQA 4D6QA 1KRIA 1RUI1 2RS51 5GZDA 5FP7A 2VG9A 4AVSA 1BYHA 3I2FA 2AZ5A 4DXTA 4A44A 1RUE1 1BHGA 2WO2A 2XLGA 3TEXA 5C8CC 4AEKA 5JPNB 4H55A 5BNOB 1ACCA 5HCFA 3O1TA 4FTSA 5FKCA 1AL21 3USUA 1OPMA 1GWLA 5FUNA 3ZIXA 4UBGA 3ZFEC 3IMMA 4UWDA 5JCTA 1GKBA 2I07B 4HPKB 4YVSC 4P9YA 1ND3A 2WNVC 1H0BA 1Z7S2 1B35B 2ZGTA 3AMQA 1I9RA 3HQRA 1MZFA 4IGOA 5IVCA 5K7PA 1JBCA 4QHOA 5JOYA 5CFDB 1AXYA 2VD7A 3LGRA 4RSUA 3WDWA 5LW9A 5DDJ2 5FZ8A 1H9WA 2VZ3A 3TWIA 2VM9A 4XHXA 4EWDA 1NXMA 1JOBA 3DL3A 4O61A 1RVF1 4PLOA 2OW4A 1W2OA 2Z69A 4BXSV 3VD4A 5K9YA 4PQQA 3NKGA 1RHI2 3R05A 4LHKA 1HRI2 5GLZA 5C70A 2A7AA 2GP5A 4META 3SH3A 3NJZA 5H9QA 5LBFA 3WY6A 1DDLA 3ST7A 4R52A 1TQ5A 3LEGA 4YGDA 1BBT2 5LCWL 4KMQA 1VBC2 2N7GA 3VDDA 2WA3A 2PLV2 4DNYA 4FP2A 2VH9A 1X50A 4BISA 5T5OA 5A3NA 4IEVA 3BKZA 2ZZQA 1WCSA 2MEV1 1REFA 4MO3M 2W68A 1RUD1 3AX4A 5A6ZA 1XPWA 3KQ4B 4UW6A 4KG0A 5A6YA 1ZREA 2P1BA 3OGGA 1ZBE2 1ZBA1 3LFMA 1ULOA 2RV9A 3I2HA 4QB1A 3W20A 1LESA 1SZBA 1VMHA 1UKGA 5C3PA 3TB0A 5FZBA 1GMMA 1HB2A 2GNDA 2P3JA 3N9NA 4QD2A 5FO9B 2Y0OA 5FY8A 2VECA 2WFF2 4CDWB 4HVOA 5LB6A 3RYRA 1PO23 4Y5TA 1CAUA 1S0DA 4M0NA 4QX1A 4AWDA 5AVPA 1O7FA 3IN9A 5C8WA 1AXZA 3SC7X 1QHDA 2I74A 2WLPA 2J1UA 3U75A 1NYWA 2X5IA 1HRV3 5KHGA 4QX0A 2BNNA 1H2NA 2VGDA 5BNNB 1NA1B 1OBNA 5FZCA 5IK7A 4LOSA 1Y4WA 2AC1A 1GZWB 2LALA 4XFFA 4AEDB 4PHZA 2XONA 1OH3A 1H8TB 4LXLA 3SH4A 2UY9A 1ODNA 1V6IA 3LIGA 4IV3C 4JGZC 3R6SA 1OT5A 2A6YA 4M3CE 1VBE2 1FPN2 3BTAA 1SDWA 4N7UA 4LO8A 4OLLA 3OUJA 3VBFA 3WNXA 2ZHKA 3CHXA 4G9SB 2B42B 3U07A 5LA1A 4QPGB 3HNYM 2FZ2A 1Q8OA 5GZEA 1AHSA 1HXS3 2PQSA 3H3UA 1U5YA 4XBLA 3HNMA 3WT3A 4AVBA 5HI0A 2QQPA 4UF0B 2XBO1 4AQTA 2ZKLA 1RGSA 2O1QA 3DPRA 3KZ4C 3WW2A 1T6BX 5BNPA 5LA0A 2E26A 5FYUA 4Q27A 5E8AA 2YPDA 4J1XA 1OQ1A 5C3QA 3RNSA 4DIQA 1GZTA 3WNKA 4XFCA 4AHYA 1X7NA 1VRH2 5FYYA 3A23A 5A33B 4GMP1 1RUC3 4K1YA 4AOCA 3VBHB 4COUA 1E57A 2VPVA 4NHXA 1N1YA 3T2OA 3VZJA 4CDXB 5FYIA 1W6OA 3OSDA 4HVQA 3JUUA 3CLPA 1UX7A 5FZ7A 5FZ1A 4MG2A 3T1LA 1SG3A 5DAVA 4JGYC 5FYZA 5FOJB 5L7OA 5IT6A 2NP0A 3I54A 4AQ6A 3OOXA 4NO4A 1LHVA 3VBSB 4Z92B 3KV5A 4D8MA 4ISQA 1SMVA 5C3OA 4ZXEA 1PGW1 5F5QA 4XAEA 2H6CA 1NCQC 4YZ1A 5ABJA 1E5RA 1N3QA 1DGWX 1RUH1 2CYFA 2FMDA 1H6YA 3EXUA 5K0UB 4OZOA 1LB2A 3JU9A 1UYXA 3H8RA 1QOTA 3NNGA 2KM2A 1ND2A 2VBBA 2FMYA 4LBQB 3POSA 1TMF2 4WM7B 3WNOA 1PZ9A 2JG8C 3VBFC 1AR62 4LO6B 1B35A 2JKXA 2QZ3A 3BN6A 1K3IA 2BDRA 1EAH1 5CFDA 1BMV1 2BTVC 2ZGKA 1C57A 4HN1A 2GDFA 4LPLA 4Q4Y3 3ZPOA 4BA6A 1CPNA 1PGL1 5I0TA 4DINB 4E8CA 4H2AA 2E32A 1QEXA 4WVMB 2Y0IA 4Y1YA 1YQCA 4ZHNA 3WF0A 2VMDA 3RZKA 1WMDA 2JDHA 3L9JT 3DGTA 5FV3A 4XZPA 2DUPA 3PURA 1PGSA 2PHFA 1PZ7A 4M4RA 4RYDA 3K48A 4FVVA 1YI7A 4YRDA 2VE1A 3CIHA 3D4KA 1WGPA 5M0TA 3ZYRA 1PX3A 2CWMA 1O3QA 4BYYA 3O5SA 4YW3A 1HKDA 2YROA 5LY2A 4BB3A 2YBKA 1YIFA 3U78A 5LY1A 4LEJA 3VHOA 3RZGA 3IMNA 4MVTA 1GV9A 1JZ5A 1JOPA 3RFRA 2VOVA 1D7PM 1WCUA 1IQDC 2B39A 2WJSA 4FPKA 1ULEA 1W6QB 4HG6B 4Z2AA 3OCPA 1G86A 4OFGA 5FP4A 3WDXA 3I4IA 3POEA 3KT4A 1A8MA 4BDVB 1G9CA 2W91A 2A3XA 1UD1A 1Y43B 4QGMA 2FDIA 1XXNA 4IV1B 4JVAA 5DZEA 4YW7A 1Q5OA 5JSOA 4YW5A 3CU7A 1EPZA 2QNKA 3QD6A 3T30A 2AGSA 2XQRA 4LA3A 3VD3A 5FDBA 1C8NA 1S0EA 1W3VA 2BVBA 2R042 1U5IA 2VBDA 4QX7A 1H1AA 1JZ8A 4YM1A 2WAOA 1RMU2 2JICA 4WVVA 1GBGA 3ZYIB 1QKQA 2QQKA 4ZU7A 1O4ZA 4U2AA 4WM8A 1OVSA 1XNDA 2VZ1A 1JZ6A 4PI0A 1WW6A 1W03A 2YFUA 3I59B 3IPVB 1ENQA 1FNZA 4HKWA 1NA1A 4CUBA 3NVCA 3RQ0A 4IETA 5KBFA 3EBRA 1GZWA 1NAEA 5C4WB 2XB6C 5L36A 4CEYC 3DF0A 2ZGRA 1F35A 3GCWA 3G6JB 2PQQA 4L92A 1W6NA 5D21A 4DFSA 1Z78A 2UWAA 3RSJA 4HN0A 3ZXDA 4GKXA 1QY4A 4GALA 3WG2A 4J1WA 5FKBA 2RJ2A 1CPMA 3AZWA 3BALA 4CU8A 3MIFA 5J36A 5LBBA 3WV6A 3GDBA 1GWKA 3DCQA 3IBMA 1REDA 2D43A 5FUIA 3ROUA 2QQLA 3T2QA 2RMU2 1XJAA 5L73A 4IE7A 2Q8OA 3MIDA 2J1AA 4BJ0A 3MV01 4YPJA 2BBAA 1GYKA 4HK8A 4HSLA 2YXSA 2XKOA 3UJQA 5KHHA 1NLQA 3CKHA 4ATEA 2WYFA 2W95A 4AI1A 2V4AA 4AYUA 2G9GA 2HWB1 4OI1A 3WQ0A 1O3SA 2J1TA 3GZAA 4M3CF 3AYDA 5C5TA 4DB5A 1WA4A 3ZR5A 1C8M1 4SLIA 5SV8A 4BQWA 2MNGA 2CWSA 2WZR1 5BY5A 4K40A 2P6CA 1GP6A 1JYIA 1COV1 2YBSA 2CGOA 1OOPC 4OULA 1BCXA 1CN1A 4QXCA 2VNOA 4M00A 3D3AA 3AP4A 5HXVA 2RR12 5LBCA 1DGRN 3ZMNA 4X6QB 1JYXA 2ARXA 3E6DA 4HFSA 4XVHA 2E31A 2JB4A 4KWJA 1ZZCA 1SLIA 2ZTNA 3UETA 2FDJA 1QJX2 2WT1A 4Y26A 5FZ3A 2BZDA 4JKLA 5IAVA 1SQ4A 2BWAA 5DG1A 2EIGA 3KT1A 1ULGA 4KU8A 4CP9A 2XPJA 4UW4A 5D8AA 3NMBA 3D5OA 2XHKA 4IE6A 2D6LX 3N7KA 3BB6A 4A6SA 2R0HA 1R1A2 4N53A 2X53S 1BK0A 4LE4A 4RN5A 1C1FA 4Q1RA 4KWUA 1NUKA 2ZMNA 3N35A 5JVVA 4CCNA 5IW0A 1SCSA 3POJA 4GWIA 1G9DA 2W87A 4LLOA 4BH9A 3PU3A 1SEFA 4BWOA 1K5MA 2OQ6A 3ZN4A 3AKPA 2HBTA 4Y5Z0 3FHIB 3ZXLA 2JXAA 4R9BA 2A5ZA 4OHXA 4YG0A 5ERLA 4V1PA 5SV5A 2HLEA 1CAVA 1FV2A 4I3PA 2BRTA 4AGGA 5ACA3 1J1TA 4Y5SA 1JHJA 2D40A 1OA4A 3JD71 3VL8A 1ENXA 4O9EA 4D7YA 1LEDA 3SCGA 1R083 3I3QA 4D7SA 3ORJA 4E2QA 1BEV3 1AX2A 1CZSA 4HOOA 1MQTB 2VW2A 3CEWA 5FPLA 2EXHA 3KGLA 5EP9A 5LEKA 3NV1A 1YI9A 1W6QA 3POFA 2QQIA 2ZBJA 2ZEZA 5BXXA 3EB7A 4EJRA 2WABA 4JAAA 2KA3A 4AI2A 1AYM3 3VD9A 4BK4A 1H9PA 1UMZA 4ZS3A 5FY7A 5CAZA 4IV1A 1GNZA 2CY6A 2RM22 4HMZA 3ME2A 4N8MA 4P9WA 4ASLA 3T3YA 3ZSMA 3IIIA 3O0VA 3IZOA 4DXZA 1F8VA 4AVAA 3HVDA 3C3VA 4EWAA 3K4AA 3M4FA 1IZ3A 2BWCA 1PHMA 5KC5A 3VBRB 2VULA 3OD4A 1ZRIA 2XVKA 3HBZA 1PVXA 4O9GA 3RWNA 2ZXQA 1AYN3 1P8JA 4COVA 2P4EA 2ZGSA 4P5YA 4QKFA 1LU1A 3O1MA 5AC92 3RI8A 2OVUA 3I59A 1QJU2 2R073 2V73A 3ZXAC 3AVRA 3OBRA 4CU7A 2VVEA 1XBFA 2Z42A 4BMBA 4P00B 2VMGA 2C5DA 1I3HA 4A2UA 3LPFA 3PUHA 2NYYA 5FOBB 3VBUA 2JE9A 1W8NA 2A1XA 4F83A 5FWEA 4HL0A 1OXCA 3VD5A 1QDOA 3O1OA 2DV9A 1ULCA 3J8F1 3LQCA 3B9CA 4MGSA 1IKPA 2ET7A 3RRDA 5A7PA 3WW3A 2DWRA 3O1PA 3R4SA 5FQ0B 4ES8A 3N3HA 1CZTA 5J7MA 1VMJA 2CL2A 2XXZA 1NE4A 4KH9A 2TEPA 4Q4W3 5FZFA 4P9XA 3WP4A 1OFSA 3HMYA 5H9RA 2WS92 5GM0A 2HWC1 3PVOA 2ZGNA 3KCYA 1RC6A 5FYTA 1K5JA 1C4RA 4EWEA 1E5IA 4I02A 3K46A 5EQUA 4XZUG 3UT0A 4ZONA 1RUOA 5LA2A 1NX9A 4YG6A 4KBZA 3FWEA 2VW0A 3RZMA 4XXPA 1LNSA 4C8DA 2HJIA 1W8HA 1U12A 4CEWC 1AX0A 1IPKA 4XJ8A 3VDCA 2W1UA 3CJIA 1XNBA 3OY8B 1V6MA 1OLMA 3JQXA 2JWPA 1V00A 1RUG1 5C6CA 3ZXKA 1QQP3 3P3NA 4Y1ZA 1QGLA 5C8CB 2CAUA 1N3OA 1VAKA 1O5LA 4F8AA 1HQNA 4PF1A 4UW3A 4UW5A 2A71A 4A6OA 2VXRA 2DUQA 4YW4A 1BZWA 3GHMA 2Y60A 3THDA 4O65A 1MS9A 1ZZ7A 3ZFEB 4B1MA 1LCLA 3H7JA 1N47A 1J3PA 2BGPA 2VL4A 5DDJ1 3PL0A 5GJ6A 2YY1A 1X8EA 1RUE3 2WNVB 1ASJ2 2YYOA 1ZNPA 1GZ9A 2JENA 4WVWA 4JRAA 2QQMA 3SKVA 5I0SA 5KC6A 4J25A 2FDHA 3ZVXA 4PF5A 3ZKUA 2HWD2 3BUCA 1AL23 1HRI1 4HBNA 1UF2C 3VV1A 1PNGA 4RHV2 1Y7BA 4Z8BA 4IE0A 4CCJA 2AACA 4Q4X2 1WD3A 1BBT1 3ATGA 1W28A 1VBC1 5LRRA 3ZLIA 3I3MA 3GCXA 4MADA 3RJ2X 3ZYPA 4D7TA 2ZGMA 3VL9A 5DZFA 5GKAC 4OHZA 3UGFA 2LRPA 4C1WA 1IS6A 2GAUA 3HIFA 1UX6A 1W6PA 2BYVE 2TBVA 4XJ9A 4Y1UA 3I2JA 2G19A 3EJKA 5B2GB 2LUWA 1RVF3 1ZBE1 3BIWE 3FN9A 3UK9A 4C0BA 2E33A 1YCIA 1OKQA 3O0XA 5JOWA 3VLBB 4YVWA 1R092 4FOYA 4CP0A 2A3WA 3K3NA 1YEWA 1S0FA 3FL7A 2RS32 3EO6A 4CZSA 2PHUA 3EMRA 1REEA 2PMWB 3MW2A 5JZGB 1LHWA 4BK5A 1KS4A 2R062 1ZZ9A 2XUEA 3CL1A 4MSVA 4CUAA 5G04L 1DG6A 4FTEA 2MEV3 4FPJA 3IDEA 3AB0A 3QLQA 4AFBA 4ZZ8A 2VZOA 1RUD3 5C9AA 1V9U2 1I5ZA 4PCRA 4LKSA 1JZ3A 5FLHA 1NLSA 3WXPA 2WNUC 5CKNA 4R9AA 2IUWA 1VBD1 1ZBA3 4PT6A 4KU7A 4UFJA 5FY1A 5F7UA 2VAUA 4UYBA 1OQDA 3WR0A 5CISA 3CJXA 1OUSA 1W39A 3UV9A 1J3RA 1WCQA 4XF3A 1L7QA 3MI8A 1MEC2 1W2NA 2W2IA 3B5LB 3KVAA 4CDUC 2R0FA 1HV0A 2XJTA 4EZ4A 2H0BA 2GSYA 3OTFA 3PMSA 1GLHA 1EV12 3DXTA 2WO7A 3LWCA 4NHLA 3T1MA 1VBE1 4QGNA 1FPN1 2ZABA 4FAGA 1KITA 1QJFA 3FC0A 4OHVA 4XFGA 4AL9A 4A7KA 1GNHA 2JG9A 1WW4A 4NOTA 4IL7A 5AFBA 4XHBA 2JJ6A 4IV3B 1SBFA 1UY2A 4JGZB 5LASA 1XU1A 2ORXA 4JDOA 4XDOA 2FDGA 1C5IA 1GSLA 2PXJA 1RUNA 5FQ0A 4X6RB 3T4HB 2GMPA 1CWPA 3J9SA 2CHHA 5C71A 1BJQA 5EV7A 2RHPA 2X29A 4QPIA 1UY4A 1DCSA 5F5IA 1E5SA 4Q4Y2 3DYMA 2B5HA 4GH4C 1VRH1 2DU0A 3NO8A 2GZWA 1DYKA 2QVSB 2Y64A 3WUCA 3WQBA 1JZ4A 1LULA 4LULA 3SCHA 4QQPA 1AR92 3DUIA 3FX3A 5LWBA 4Z07A 3ZDVA 3ON7A 5F8PA 4BLJA 1G9AA 1AXKA 1AF9A 3S6PA 2CSGA 4TSVA 2UY8A 1UIKA 3PU8A 4BCUA 4BQXA 1OA2A 3ECQA 1X9TA 2WN3A 3ACFA 4LE3A 3MBWA 5I0RA 4EV0A 2DCKA 5IVYA 5HCAA 1FYUA 4XF0A 2DVAA 1LENA 3V56A 1YQ6A 5KHKA 2VC9A 3D0SA 1AR81 1NZCA 4BMEA 4JGYB 1OQEA 3SLIA 1LOBA 5K4LA 4OCTA 2BPA2 2BGOA 2OQ7A 4GMP3 3POYA 4Q0PA 2VUJA 4FO9A 4Q2FA 5FLIA 1OLME 5FZOA 1TMF1 2R30A 1JZ2A 2VJXA 1NCQB 1AR61 4C0HA 4EN9B 2DTYA 1IPSA 1UZWA 3APBA 3I2KA 4Q4V2 4HT1T 4PLMA 4XAAA 4YZ4A 4YGEA 4ZPIA 5JIAA 3S30A 2ZA9A 1ZZ6A 5CEHA 3HJRA 1VBB1 1Q8SA 3GALA 2AH2A 2JE8A 3V0BB 5FYVA 2JG8B 5FLJA 4NPLA 1DFQA 2DCTA 1FOD2 1XNTA 2PYTA 1UU4A 1L7RA 3NJVA 5FZKA 1CZVA 4QDRA 1QJY2 1IOAA 1RUH3 1OMIA 3BCWA 4CTEA 3AKSA 1U5ZA 1XNAA 2J42A 3JBG2 4K21A 5DAWA 2DURA 3T08A 3ZFFA 1RJ8A 2E6VA 4GB31 4DPNA 2XLAA 5J09A 2ZMLA 2C26A 1POV3 5DXDA 3X29B 1H2KA 3MIHA 1S2KA 3VZLA 4GD4A 4OHYA 4CRQA 4LUKA 1D2QA 3PVNA 4UT5A 3EHKA 1ONAA 4YW6A 2JDYA 4UFHA 3BYWA 2W52A 4LMFA 2X09A 1LHUA 3ZXGA 2ARBA 4CDQA 4YG3A 1TZOA 4GWMA 5FMDA 5F1RA 1HDKA 3E5XA 1CAXB 2VMCA 1SFYA 3POBA 3WF4A 2Y8KA 5JZGA 1FAYA 1PZ8A 4YW1A 3FMGA 2R041 1CX1A 5DUXA 4CYDA 1G9BA 3ZSJA 3JB4C 1NQDA 2HEVF 5EPAA 5IK5A 1RMU1 3S5AA 3H8OA 1QXPA 1MS0A 3N7JA 1DQ4A 3U4SA 5FPBA 4QKBA 5IATA 3KSCA 5J96B 1ALYA 1PK6B 4E4DX 5KXCA 4IEQA 3W59A 5CYYA 3ZXFA 1DIWA 4Q8LA 1WA6X 3H1WA 4I30A 4Y3OA 5GZFA 4K6BA 1NCRC 5JAXA 1WBLA 2OPWA 2EXIA 2D98A 3ZDSA 1VAVA 1V6LA 1FATA 4IEOA 4MXWA 3T2PA 2R7EB 5A6XA 2Y6KA 3WHTA 4ET7A 2W46A 4QMAA 4RQPA 2KD7A 2JD9A 2A70A 2PHRA 3FZ3A 3AZYA 2ID4A 1UQXA 2ORZA 2VOXA 5FFOC 1GQGA 5LEJA 1WWYA 4IEWA 4CEYB 2VZTA 1JYWA 1TE1B 2VTXJ 4Y1VA 2OZJA 3MPPG 5IHRA 4WBBA 5HCBA 3MPBA 1K42A 5FZ6A 4I0BA 2RMU1 2YC4A 4AFCA 3VBOB 5CFCA 3TN92 1ODMA 1OF3A 3GGLA 2XJPA 3B3QE 2XJUA 3UJOA 3ILNA 3JQWA 4TYSA 4GIQA 5DABA 5FAXA 2ZOEB 1O4TA 2X05A 1ND3C 1D2SA 3GM8A 4XQDA 4BU2A 4P9JA 5J3UA 2W1QA 2D3PA 5A3MA 5HXMA 5FMCA 3M3OA 3U0ZA 2JDUA 2VNRA 1LU2A 5FYSA 4LLFA 2D5FA 4RR3A 3WINE 2A6XA 2E7TA 2DVDA 3INAA 4L2NA 4LR4A 3C7GA 4LHLA 4TZDA 1IPJA 5JI7A 3RMXA 4TWTA 2RR11 1BVP1 4S2FA 2EAAA 2EIEA 4OUSA 4OYUA 1W8WA 4RS5A 4E4HA 3KHCA 3N4MA 1J84A 4N9HA 1O8PA 4NAOA 2YPJA 5FMOL 4B3NA 4DMIA 4XMIA 3O7OA 1OOPB 3JZVA 2VZRA 1QJX1 3NKTA 2A75A 3KV6A 1RL3A 2IVJA 4ZZ5A 2HWB3 2JX9A 4OHWA 1V6OA 4XUNA 3TNPB 3VDDC 1JYNA 1SDDB 3N9QA 3V64A 2YBPA 4DY5A 5EXOA 3PTYA 1C8M3 1GQPA 4QWNA 3WCSA 3WP6A 5KHIA 2Y6HA 2Y33A 4XE9A 2WZR3 4EN0A 2W1WA 1W9YA 1R1A1 5I93A 1COV3 1AYM2 5LK7B 2J22A 2WKKA 4BXFA 1F4HA 5B4XA 1YQ5A 2NPIA 1IQAA 2VVDA 3LSDA 3P6BA 3WLUA 4D0QA 3BU7A 5GZGA 2WLQA 5FK7A 3MICA 1QMJA 1WLTA 1YIPA 2PAEA 4BPZA 1W9TA 2BNMA 2QQJA 5AFEA 1XYPA 4MUVA 3AVSA 1UY1A 1YFXA 4Q0SA 2F6BA 5FPXA 4E9KA 1UOGA 2OT7A 1W6MB 3GJAA 2PHDA 3OEAA 1OLQA 4AXOA 3SISA 1RTVA 3NAPA 1A34A 4QXKA 1Y9MA 1UKRA 1KJLA 3E6CC 3OYWB 1LOFA 1ZZBA 2HBUA 2D6MA 3TAYA 1LGBA 2YC2A 3AK0A 4HK9A 4LIUA 3IDCB 2X5IC 1HJFA 1LOEA 3OBZA 3B02A 5FPVA 5FZEA 5A7QA 1UU5A 4FTBA 3WF3A 4JDMA 4NR1A 5FIXA 3U11A 4UI9L 5BNOA 2TUNA 3GF6A 4RS5C 4EZHA 2C1FA 2Y34A 4DUXA 4BQ3A 2ERFA 2QDNA 3MLKA 4ARYA 4DXRA 1S0BA 2W0XA 4QPWA 1W9WA 3D6EA 2CAVA 4HPKA 3VZOA 2P6HA 3MLLA 1DLLA 4Q4W2 3ZFGB 2DU1A 2VUCA 2Y6FA 2ZGUA 3LDBA 3MHZA 2RM21 2JE7A 1X82A 3OGJA 4FOWA 5A3PA 2OS2A 1CAXA 3ZSLA 5A7WB 3BU0A 5E89A 2W94A 1J1LA 5JI9A 5A32B 4P9GA 2VOKA 3DPRC 2W39A 5BNPC 4ZU4A 4CA9A 1HX6A 3VGIA 1DGRA 2NN8A 3HNBM 1SBEA 3THCA 2BBVA 1PK6A 5F5CA 1J59A 3I3DA 1CESA 2YUEA 2VCMA 5AC91 2HYXA 2YZ4A 1QJU1 3EQEA 2LROA 5DAPA 5EYYA 2JB8A 3BODA 3ZYGA 5FREA 3NAPC 1JYTA 3PLQA 3KB5A 5JPMB 2B45X 4KBBA 1V6JA 5DPNA 4EN6B 3LOIA 3KS7A 4FPEA 3H0OA 4YSFA 4P5HA 3O1RA 1ZZ8A 1SHWB 5L7OC 1XB9A 1WLDA 1AX1A 3C7HA 3WQ1A 3AP7A 2UWCA 4JTOA 5FP8A 5LK5A 3JB8A 3O14A 4W65A 2OA2A 3RJRA 2HWE2 3I2DA 2VMHA 2RJKA 2VQTA 4B7EA 5ABJC 3FUOA 1HN1A 4HETA 3FLRA 3VBOA 2PA7A 4XMAA 4FFFA 1RUE2 1UCXA 4N90A 3VHRA 1ND2C 2WS91 3ACLA 1QNYA 4QX3A 4N7IA 4CDWA 2BERA 1Q3EA 1EYBA 1XE8A 4CCOA 5BPXA 1B35C 2WZ8A 2ZZJA 3I7DA 3J26N 4BIOA 4HSJA 1AR72 5CFDC 1RUF3 1FMD1 3J8F3 4A7ZA 4BM8A 5FZIA 4FBFA 4Y1XA 5F2SA 5BNNA 4B4PA 4Y22B 5FPAA 1N1SA 3OEBA 4AEDA 4YZ3A 1QXRA 3VN4A 5L9VA 1X36A 2O14A 2PHWA 2AYHA 1H8TA 4JZRA 5FYMA 5A80A 2DVBA 5D2AA 4ORFA 4A41A 1XNKA 5FZ0A 4HZFA 3K77A 1NLRA 3LPGA 4FT8A 1E5HA 2HWC3 3TRSB 3WNMA 3QACA 2HWF2 3DEMA 4GQ7A 3AMMA 1PO12 4NIHA 1PVC2 4LBJA 4V2WA 3RI9A 1U5XA 5F9TA 3U10A 4NN0A 4Q5OA 4QGLA 4WVZA 2OUHA 4QPGA 1H4GA 4XPVA 4YLZA 1SLBA 1DQ1A 1JHNA 1LKNA 3MIBA 3I3BA 3NV4A 4LA2A 5FYBA 4ASMB 1VBA2 1S0GA 2W5FA 3B69A 3IAQA 3NW4A 4P14A 4UF0A 3RDIA 4FOVA 2JEMA 4IGQA 1FT9A 2ZX1A 4XCAA 4WZFA 1ASJ1 1UAIA 3ACGA 1KQRA 1YJKA 2F4LA 4XDQA 4CCLA 1FX5A 2MEV2 5FP3A 1PIV3 1D4M2 4FQ4A 4B29A 2HWD1 5IWFA 4CUGA 3BTZA 2NZ9A 1B09A 2Q1FA 4LJHA 4RHV1 3O12A 2DFBA 4X8PA 2PAKA 5A33A 1RUG3 3GZEA 3HD8B 4Q4X1 3VBHA 1DZRA 2BV4A 2J1RA 4YGCA 2P3IA 4CDWC 4CDXA 3V65A 3TEZA 2UU8A 5F3GA 5A1LA 1IG0A 1CJPA 1LRHA 1W06A 4LKEA 3HBKA 2DCYA 1KJRA 4CXYA 1EP0A 4PDWB 1AUYA 4AVVA 1SLCA 2JKBA 3J7HA 4HKLA 4WM8C 2K0GA 2R1BA 5DDJ3 1GNYA 3CMGA 3LCPA 1W05A 5LATA 1BVVA 3VBSA 1NA1C 5FRAA 1SBDA 2UYBA 3OUIA 5T5JA 4DUVA 4GKYA 3MFAA 3KM5A 2O0OA 2VTXA 4Q26A 4CE8A 5JXJA 2RS12 2D93A 4MZUA 1HRI3 2J1VA 2Y38A 2VOTA 4KGQA 1R091 5K0UA 1NKGA 3ZN5A 2A6VA 1N1VA 1BBT3 2RS31 3PUSA 4LBQA 4WM7A 1VBC3 2D44A 2GC1A 5JMOA 2R061 3VKNA 4A4AA 4B1LA 1SPPB 4NIAA 1QOOA 3AMHA 4HKOA 4XYXA 1YFUA 1IG3A 3D82A 3IDAA 5A7WA 1WMXA 3LA3A 1V9U1 5CBLA 3ACHA 5CA6A 5FPUA 2YGMA 5FO8B 2ZMKA 4MGZE 3RMYA 1OURA 1RXFA 3MGUA 4WVMA 4X8NA 1ZBE3 1F2NA 5IK8A 3MZHA 5CZKA 4AQ2A 2CTVA 4IUGA 1YWKA 2ZS6B 3BVCA 1YUDA 2KXLA 3GBGA 4ES9A 4XFHA 4AZZA 2BJSA 3AYCA 4MLOA 1MEC1 1JZ7A 2WNUB 4QX5A 1N1TA 2WR9A 1EV11 3E6BA 3IAPA 2DYCA 2P2KA 3N9LA 1XC6A 4QHBA 3URFA 4OVEA 3RYKA 5GZCA 1TME2 5FZGA 3VKOA 2WZEA 4IERA 4CDUB 2AR6A 3CDZB 5KHJA 3AZXA 3WHUA 4CU9A 2GN3A 1WLWA 5BV6A 2OIIA 1VBD3 4NMIA 4TN7A 1W0NA 1RUJ2 2ZX3A 4D6SA 4AGVA 2DBIA 3T09A 2AUYA 2WINB 5D8AC 3W5MA 2ZAHA 2IVIB 3PUIA 1WCDJ 2ET1A 4PBOA 1ZA7A 3PDQA 2B9VA 3THPA 2YFZA 4Q4Y1 3AXEA 3SNMA 4Y20B 2QFEA 4LBNA 1DLCA 4YM2A 2JIGA 4N53C 1OD5A 4WM7C 1G8WA 1VBE3 1FPN3 1AR91 4RFRB 4UFLA 3WVJA 2WYSA 1GOFA 2VVFA 3AM2A 4I2OA 1LTEA 1RUH2 3MW3A 4W8JA 1K5MC 4QDQA 1S1AA 2QQUA 3ENRA 4A7YA 4UXAA 1SLLA 3IPVA 3U37A 2IXCA 3NNJA 3VDBA 3RVHA 4HVRA 1JI6A 3I97A 5C4WA 2QQNA 4AHZA 1DQ0A 1LOAA 3ZM8A 4URAA 3DYOA 2LS6A 4FXGB 4N43B 1ENSA 3FBYA 1PGL2 2C24A 1VRH3 3VB9A 3VKMA 3WZ1A 4NHMA 3ZYHA 1H8VA 2IC1A 3KHBA 4N9IA 1S0CA 4OUEA 2W3JA 1ULDA 2VCAA 4MHRA 3O1VA 3VKLA 5KXDA 3QH7A 5FBJA 4ZXKA 2UYAA 2GNBA 1OKOA 1GOGA 2VBPA 4Q4V1 4YZ2A 3HT1A 5EIYB 1ULPA 1D0GA 4XIKA 3K75B 2QDRA 4Y33A 4QQLA 2V72A 4FXKB 1O3RA 2GN7A 2XJRA 1NE6A 2PFWA 1BXHA 1ZM1A 2ZCWA 1FOD1 4DZGA 2XKPA 1AVBA 1AR83 1QJY1 4IV1C 2V5YA 4CUCA 1KFUL 1DYPA 3TEYA 4NE9A 4ITCA 3T2TA 3LEIA 4DO0A 3ACIA 3NNLA 3JBG1 1STMA 4CPBD 3K51A 4JKMA 4F7ZA 1AR63 1UWWA 3OB8A 4MHUA 1Q56A 4PDWA 4J6GA 2YC0A 2B7YA 4D6RA 1VBB3 1MZ5A 4NIIA 1UXXX 3S7EA 3V0AB 3WD5A 1CGPA 2ILMA 4D69A 2J1EA 4HANA 3A0NA 1OA3A 3PJQA 2DCZA 3AC0A 5LRSA 1DQ2A 2XHNA 5EZWA 4JQTA 2HEYF 3F95A 4LHNA 1PMHX 1Z7S1 2OX0A 3NRUA 1T2XA 3VBUC 4M3CB 2WSUA 1UY3A 2WNOA 4CCEA 1UMHA 4I09A 1RUI3 2RS53 3AP6A 1MS5A 2Y6GA 1FI2A 4FAHA 1LR5A 4H14A 4HLTA 1W8OA 5FJHA 1J3QA 4YVSB 1PO22 1W8TA 4GB33 4TXWA 3OD0A 3LAGA 3BPZA 5LBEA 4DS0A 1RHI1 1OFNA 1UOJA 1HRV2 1HW5A 1W99A 4A42A 3AFGA 1GU3A 4QQ2A 4BZ4A 4IEYA 2FCTA 3DKQA 5A7NA 1UZVA 4WZCA 3EYPA 3ILFA 2PLV1 1UIJA 2WUHA 5FXVA 2WBKA 4SBVA 3MF6A 3ZOIA 1CIWA 2ENRA 1YXWA 4S2HA 3POIA 2CDOA 1NCRB 1US3A 3KV4A 1V0AA 2HWB2 2R043 2QQVA 1F9KA 3M3CA 4Q1PA 1DGLA 1MQTA 1RMU3 2GH2A 4FPYA 4FI9A 3NJYA 5HBAA 3CJIC 4MOAA 1Q8VA 1HXS2 3PTRB 4RA0A 3ZIWA 1QIQA 4XJUA 1I5PA 3TN91 4E4SA 2VMEA 3FE5A 3P5BA 2WFF1 4Q0UA 3JCIA 3WX5A 1S2EA 1PMJX 2JDNA 3USUB 2J7MA 1EUTA 3RPQA 4CCMA 1MS1A 1RUC2 4H7LA 1UYZA 4PIZA 1DZTA 3NV3A 1BK1A 1KDKA 2BGCA 5FK8A 2ZHLA 2K46A 1UOBA 4XF4A 3RGBA 3PIJA 1Z0HA 1H1IA 2EA7A 4E8DA 4YFZA 3VBRA 2ZPXA 3ETQA 5JXHA 3SQOA 4BHPA 3PJYA 3VDAA 4GJYA 2IXKA 2VZPA 1XSQA 5KWRA 2D6KA 2JDPA 2RMU3 4KL1A 1UYPA 3IT8A 2W9XA 5JWPA 5FMOS 4MGTA 3BGAA 1UMIA 3CNAA 3DECA 1C3HA 3FLTA 4AFAA 2LM3A 2EF6A 4AHWA 1KEXA 3BOWA 1IKQA 4ARXA 2ZGOA 4BE3A 4N43A 2VZVA 4NIGA 5A3TA 2W1SA 1IS5A 3HEIA 4KQ7A 5T5PA 3VDDB 4QKDA 3TYJA 4KWKA 4PI2A 4XXAA 5FXXA 2RR13 3H3LA 1KDMA 2NM1A 1XE0A 4YVWC 3SCFA 3Q8AA 3PIGA 4XJZA 3MF9A 2E51A 4BQYA 1W2AX 5DAQA 4Z1VA 4RGGA 1VB4A 4Z82A 5F37A 2YMZA 3R4DB 2IWGB 3POGA 5C3RA 1LOCA 5F3EA 4NJ4A 3UKVA 3B7MA 1JYVA 5C9AC 1R1A3 2IFWA 1HQWA 4KI5M 1GANA 2R6QA 1GWMA 1LECA 1POQA 1TVGA 2FCUA 2GNMA 2XBO3 1GP4A 2NMNA 4FPOB 2FDFA 1CAUB 3VZNA 2ARAA 1MVEA 3A0KA 4K8RB 3OUHA 4QM8A 1AZDA 5FZHA 3OY8A 3VUOA 3V0AA 2YU1A 1NG0A 2RVAA 2XL7A 3UKNA 4XEZA 2FCVA 2VZUA 3J7LA 2P34A 3ZKYA 4CVUA 5C8CA 2QQOA 2VMFA 5E88A 4DEQA 4W6YA 3W58A 3B93A 1W2UA 4Q4W1 2JG9C 1IS4A 4L11A 4IW3A 2XMLA 3POWA 2XWJB 5DUWA 3OPWA 3TOJA 3AKTA 4I0AA 3ZFEA 1TEIA 3PHMA 4ONUA 2OKXA 3Q8EA 4RD7A 2D7FA 3NV2A 3PVEA 1XNCA 4U36A 4AAPA 3H7YA 4ZU5A 4P08A 3VBFB 2WNVA 3AYEA 1CD3G 2NLRA 1VB2A 2P3KA 4XACA 2EICA 3WDVA 1RUF2 4QPIC 1DF0A 2VCBA 3W5NA 5C33A 5JXIA 4LITA 3GYDA 3DPRB 2VZQA 4FPLA 2RDQA 2C6SA 2EIBA 3ZYJB 1O6UA 1VALA 4CP1A 3IDBB 4LKDA 3KCXA 1ZA4A 3K2OA 2RM23 1EAH3 4OMDA 1G9FA 3VZMA 4C1XA 3WG1A 4I3GA 5FP9A 1LAJA 4JTNA 1W6OB 4XBNA 4PJYA 2ZEXA 1NT0A 2GC0A 3SKJE 1L3JA 2E7QA 5FZLA 4GULA 4IEPA 3IB3A 2HWE1 3T0BA 4COYA 1R1ZA 5L7OB 5HCHA 5I91A 2ZGQA 3ALQA 5AC93 4AR2A 3LA2A 3WSOA 3ZSEA 1QJU3 3C7OA 4LK6A 3A22A 5J37A 2PAMA 1JW6A 1UYYA 4A3ZA 4DY3A 1VIWB 2WN2A 2WT2A 1MS8A 4AGRA 5G05L 5A3OA 4GZ9A 1NY72 1OPOA 1PIV2 3AP5A 4CXWA 1W0OA 5ABJB 5J98B 3AL6A 1YQ8A 1AR71 4XUQA 2A6WA 2ATFA 4MGQA 2B9UA 1RUG2 3AXDA 4W50A 3TNQA 4K20A 3WNLA 1ND2B 1JUHA 2UWBA 1F15A 4CU6A 3I8TA 5H9SA 1JU4A 3WP5A 1Y9QA 3SITA 2OUJA 2XH6A 4R8HA 4XILA 2IXIA 2NQYA 2NMOA 4LTAA 5EJ3A 2W08A 2WWJA 1ULFA 1ZX5A 1VRBA 4O7XA 4OI2A 2AENA 4XCBA 4AEJA 3ES1A 3H3ZA 4UFIA 3LEMA 5HV4A 2WS93 5J1XA 4RGAA 5GLVA 3ZO0B 1U0AA 3GXUA 3ZFFC 2HWF1 2E63A 1PO11 1PVC1 1YYNA 2CU5A
chains in the Genus database with same CATH topology
1PMIA 4OUMA 1X33A 4IV3A 4XFBA 1FMD3 1NXD1 4JGZA 4PIXA 2XVGA 2WSVA 4MGKE 1VBA1 3WQ7A 2EVXA 1KFXL 4JV4A 1XE7A 4A3XA 3HQXA 3AJYA 1DZQA 5JIUA 3AKRA 5CIRA 1D4M1 4NPRA 1V6KA 4CDQC 2R32A 1LODA 2A3YA 4BQ1A 1AL0G 5FTTC 4H7MA 2QE3A 2AREA 4CP1A 2QCSB 1DGWA 1H30A 1DHKB 2XUMA 2XL9A 5JZGC 5ACA2 1PM7A 4LNVA 2IXJA 3WDYA 3QBQA 4C90A 2ZX4A 3FLPA 2IFRA 4OI0A 5CADA 3MFCA 1I6XA 1UU6A 4QQOA 3U4XA 1R082 4ATFA 2PELA 1BEV2 3GZUC 1ASJ3 2ZGPA 1SFNA 3ASIA 5FO7B 2HWD3 2RS11 4WM8B 4JGYA 4RHV3 1OI6A 1O91A 1VBD2 1M06G 4AG4A 1VLNA 4RQPC 1LOGA 1SACA 4Q4X3 1EY2A 2Q30A 3M7AA 2DFCA 3PVBB 2WA4A 1CJDA 1NCQA 5FPZA 4AE2A 5F6LB 2VQAA 2Z2SB 1W6NB 4JC1A 1GQHA 4AI0A 4AW7A 4XTMA 1G7YA 1IGOA 4LBMA 4L97A 5CFCC 3NL1A 3ES4A 3QOPA 3V0BA 4JCKA 2JG8A 5JMCA 2CNAA 3MEPA 2YV8A 1MACA 1UZZA 3RG0A 5KXEA 2CGPA 1GICA 3B94A 1WD4A 1CAWB 1AYN2 3ZN6B 1VP6A 3PMEA 4LO4B 3BOPA 5F6KA 4XFIA 1R093 1O4YA 4COWA 3AZVA 1C1LA 1VJ2A 3QCWA 2R49A 2Q0AA 2R072 2D97A 2RS33 2WIIB 3HWJA 1GFF2 4DQAA 4RR3C 4XJWA 2R063 1TME1 4JDNA 3WP3A 2BFUL 1UN1A 4AF9A 1V9U3 3CF6E 4PQ9A 4Q8KA 1XRUA 2OZ6A 3H1YA 5I8SA 2VY0A 3HAGA 1RUJ1 3LB9A 3IWZA 1GZCA 1V6NA 3H8UA 4LBOA 3H1MA 1MEC3 4RFT0 3JD73 3SH5A 4MXVA 1LGNA 4Y24A 2WL1A 1EV13 4INDA 3E97A 4XW3A 1AR82 5D8AB 4DOUA 1YRZA 4QM9A 1YFWA 3DKWA 1A6CA 2H0VA 4LUMA 2Q1MA 4N53B 4PLNA 4FQZA 5H9PA 3VHPA 3PNAA 3S0MA 3GZTB 2BUKA 4FPGA 2ETEA 1N3PA 1POV1 1VBB2 4XFAA 1K5MB 1LOFC 5K8SA 1QH6A 2WNEA 2E7AA 2SLIA 1QQP2 2BEOA 4D3WA 1AR93 1CAVB 5AVAA 1HIXA 4BLIA 4CEYA 4YM3A 1RITA 4QU2A 5BNOC 1ZRFA 5L19A 3RYPA 4FPHA 4L8QA 1RUI2 2RS52 1S2BA 2EAKA 5T5LA 1XQNA 3AP9A 4XIOA 3UL2A 4GB32 2HEWF 2HYKA 2QKDA 1AL22 1A8DA 2BW8A 4Y4YA 3LOBA 4XBQA 4XTPA 1W0PA 4K7JA 1HV1A 1OSGA 2ZX2A 3SMHA 4EN8B 4Q4V3 3G7DA 1WCKA 1KXGA 1CVNA 1PK6C 1TNFA 3GBWA 3RZZA 3FBMA 3WUDA 5BNQA 3GBFA 1OOPA 4AVTA 1LGCA 1RVF2 3M2MA 4CEWB 1FOD3 4L9BA 3KQRA 1QJY3 1FNYA 1G6NA 3D0JA 2CV6A 1QF3A 1RJ7A 4I0WB 4B8EA 1SCRA 3JBG3 5BYNA 3WOGA 1PO21 1M4WA 1KS5A 1OLRA 3VBUB 4NWWA 1HLCA 1WMEA 2PHXA 1RUD2 3MYXA 5JLVA 3GHNA 3WW1A 1RUOA 5T3NA 3VBOC 2DTWA 1HRV1 4GMP0 4AI8A 3MW4A 3AJZA 1W6MA 1ZBA2 1D4VB 2ZX0A 3HT2A 5E1RA 5I8TA 3FFZA 1CAWA 3M3EA 3ZN6A 1Z7S3 1I1EA 2IXHA 2FQPA 3OYWA 1F31A 4ISRA 1KD7A 4G4FA 3ZPYA 2MHFA 4XF1A 1APNA 3E5UA 3QH6A 3LKJA 2GH8A 3DV8A 2E9QA 2XWBB 5I8YA 3A4UA 2JD4A 4W6XA 2FBEA 5BNNC 2FZ1A 3J4UH 3LA7A 5T50A 4P9LA 4AEDC 2ZKNA 1RHI3 2JECA 2CGNA 2R1DA 2IZWA 5DZGA 5KHIA 2Q5TA 1H8TC 4K9SA 1H2MA 1RINA 4Q0QA 2F4PA 1HXS1 1QJZA 1MZEA 2XLFA 1J58A 2XJQA 1HQLA 4NVPA 4UBHA 2PLV3 3CJIB 1WUVA 3ZFGA 1C28A 4IEXA 1UW8A 2WZPP 1POV0 4QPGC 4RL7A 1RUC1 5CB7A 4NWVA 1D0HA 2TNFA 2QJVA 5A32A 1IHMA 4XOGA 1SLAA 5GALA 3S7IA 3M70A 4D94A 3D8CA 4GWNA 3TN93 3KGZA 4JQRA 2XBO2 5GLUA 5GLWA 3VBHC 5A3LA 2WFF3 2DF7A 1CQ9A 4XJAA 4CDXC 2HKXA 5EWSA 3R4UA 3B01A 3HR9A 1AJKA 4LBKA 4M0HA 4W6WA 3VBSC 2WC2A 3MDPA 5DUUA 1MVQA 2EXJA 2YDEA 5EYXA 2G9FA 2QUOA 3DN7A 4H3WA 2D5HA 3GNEA 4BIFA 1QWRA 4MGIE 3C2UA 1W6PB 2GU9A 2DVFA 3B9IA 5DG2A 5K0UC 4AVCA 2XJVA 3R0RA 4B4RA 1PGW2 2RE9A 3E5QA 3P3PA 1H1MA 4YM0A 4YGBA 1BKZA 4EN7B 2LTNA 1UL9A 3ZFGC 4KGGA 4LBQD 4YVWB 3M1HA 4GH4B 2DVGA 4MYEA 2BNOA 4R9DA 4F3JA 3N7LA 4Y22A 1CONA 5JSPA 1EAH2 1BMV2 1GR3A 5C9AB 1MS4A 4PIYA 1VR3A 4K8FA 4AFDA 3SHRA 3THTA 4K3UA 1RB8G 3OF1A 4CEWA 4AQSA 2E53A 1S0IA 2ZJCA 2X8KA 1JYCA 5T54A 3ELNA 3W9AA 2A6ZA 1Y3TA 4S2DA 1SLTA 1ZRDA 4B4QA 1AJOA 1F5JA 4DRRA 3IKWA 2JG9B 2DUOA 1CR7A 2D3SA 2BVVA 3Q9OA 5IUQA 1RUF1 2PTMA 5T55A 1URXA 5CG9A 3KCCA 2RJLA 3H50A 3LZZA 2GMMA 1S55A 1TMF3 2R16A 4TLFA 1YFYA 4QPIB 4FOQA 4BOWA 3UKTA 2Z5WA 1QH7A 4LO5B 4Z2WA 5J48A 5KXBA 4LT5A 1ENRA 1XYNA 4I01A 1UPSA 2I45A 3M3IA 1F5FA 2XVLA 2ZAAA 3KLSA 3WDTA 3ILRA 2OYZA 3ZXJA 4AK3A 5C4WC 3N7MA 4DRVA 1YHFA 4YARA 1FMD2 2P37A 2WQZC 3L2YA 5JOXA 4KWLA 2B8MA 2C0ZA 4Q0VA 4AI3A 4XQWA 2VUAA 1DBNA 3OPZA 4KG8A 4WV8A 4YW2A 1QOSA 4QQHA 1NY71 1PIV1 1O5UA 4K1ZA 1OHFA 2UURA 1DQ5A 4FP3A 2IXLA 3M8LA 2Q4SA 5FBZA 5CNAA 3WCRA 3FUQA 2P17A 1ZVFA 2O8QA 1JTZX 5JR7B 5CU1A 2OPKA 1A3KA 4E2SA 2HWE3 3AMPA 4XF9A 1LHOA 2A73B 3ZMOA 4MX3A 4URTA 2WNUA 1JN2P 3VKFC 1LHNA 3IIAA 5JDBA 1EPWA 1LJ7A 5E16A 1XYOA 1O3TA 5DUVA 1MR5A 2ES3A 1AR73 1C8M2 4PDWC 2PHLA 1FV3A 3B00A 4CDUA 2WZR2 4IEZA 1YLLA 3M3QA 5BUVA 1UZYA 1COV2 4ZKTB 2QZ2A 3ZFFB 3OJBA 2WQ4A 1ZRRA 4L99A 5CVRA 1A78A 1YO8A 5FCCA 1XU2A 3TBDA 1QXJA 4FCAA 3NWKA 4QT6A 2D3RA 4Y20A 1JXNA 3L2HA 2Y26A 2GNTA 2HWF3 3N36A 2DCJA 5ACA1 1PO13 1PVC3 1ND3B 3KT7A 4CDQB 5EFUA 4GH4A 4IQPA 1CX4A 1Q8QA 1DU3D 5T52A 1NQJA 3WDUA 4AFMA 1ZRCA 1QDCA 3AKQA 1VBA3 1R081 3FJSA 2K2SA 1BEV1 2V09A 1Q43A 2YHJA 2WFPA 4IEUA 1D4M3 4P9IA 4FPFA 5I0UA 2XJSA 1TNRA 3FFQA 3KMHA 1V70A 3MIEA 1JH5A 2WT0A 3VZKA 2BQPA 1S0JA 2JDZA 4AEMA 2K9ZA 1AYM1 3KD4A 1DQ6A 4PBPA 4YZ5A 3AFKA 4C91A 4LBLA 1MQTC 3H9AA 4LO7A 1VAMA 3OBTA 3JD72 4MXWB 5TSWA 1PNFA 4NHKA 2XGXA 1WW7A 4RQPB 4M01A 2B46X 2Q1ZB 3HN1A 4IESA 4CP2A 5IK4A 2C9AA 1QU0A 1WMFA 2VQ0A 3LSEA 1QJX3 3MIGA 3VHNA 3O0WA 4G3YC 2D6OX 4YYOA 3SXWA 2GC3A 4MH0E 1MZ6A 2GC2A 2RS13 1AYN1 3AZZA 4OZXA 3AMNA 2FHRA 1IS3A 2H6BA 2MPFA 1YJLA 5CFCB 1LEMA 2G4IA 3MLJA 2R071 4JRLA 5GLTA 4OI4A 1WW5A 1JUIA 1YNAA 4XQ4A 4MGYE 3VBRC 1X8MA 4E27A 4YFWA 3USSA 2O8OA 3ZX7A 1ZYBA 2BFUS 5JSRA 2X5IB 2VOWA 1T6GC 4RR3B 3WG3A 3ZSKA 2GALA 5JOZA 1UPIA 4GA9A 4KNCA 2Z79A 4MV2A 4RS5B 4N43C 4XETA 4M3CA 2D6NA 4S2GA 2XG3A 2VNGA 2PHTA 2VW1A 3RS6A 3CO2A 4AHXA 4E2GA 4YVSA 5CG8A 3WG4A 3AYAA 3IM0A 2SBAA 1TME3 1JOJA 1H2LA 3NSTA 4COZA 2VMIA 2D6PA 1C5HA 3J8F2 2PN5A 3WW4A 4R4ZA 4QPYA 2ZHMA 5BNPB 4EROA 1MS3A 1RUJ3 4GXLA 1Q8PA 4FPCA 2EALA 2ZACA 1WLCA 4B7KA 2ZHNA 1RIRA 5D1IA 1FXZA 1H4HA 1WBFA 2I2SA 4R9CA 4R4XA 1QNWA 2HWC2 2VU9A 1NCRA 2YGLA 1QQP1 1BQPA 2WWSA 3NAPB 4Q29A 1NOVA 3ZXEA 2ZGLA 2GMEA 4YNIA 4FSJA 4IXLA 2EXKA 1KRIA 1RUI1 2RS51 5GZDA 4AVSA 2VG9A 1BYHA 2AZ5A 1RUE1 2XLGA 5C8CC 4AEKA 5JPNB 4H55A 5BNOB 4FTSA 5HCFA 1AL21 3USUA 1OPMA 3ZIXA 4UBGA 3ZFEC 5JCTA 1GKBA 2I07B 4HPKB 4YVSC 4P9YA 1ND3A 2WNVC 1H0BA 1Z7S2 1B35B 2ZGTA 3AMQA 1I9RA 5K7PA 1MZFA 1JBCA 5JOYA 5CFDB 1AXYA 3LGRA 3WDWA 4RSUA 5DDJ2 1H9WA 3TWIA 4XHXA 4EWDA 1NXMA 3DL3A 4PLOA 1RVF1 2OW4A 2Z69A 5K9YA 3NKGA 1RHI2 3R05A 4LHKA 1HRI2 5GLZA 2A7AA 4META 3SH3A 3NJZA 5H9QA 3WY6A 1DDLA 3ST7A 4R52A 1TQ5A 4YGDA 1BBT2 1VBC2 2N7GA 3VDDA 2WA3A 2PLV2 4DNYA 4FP2A 2VH9A 1X50A 5T5OA 4IEVA 2ZZQA 1WCSA 2MEV1 1REFA 2W68A 1RUD1 3AX4A 4UW6A 4KG0A 1ZREA 3OGGA 1ZBE2 1ZBA1 1LESA 1UKGA 3TB0A 2P3JA 2GNDA 4QD2A 5FO9B 2Y0OA 2VECA 2WFF2 4CDWB 4HVOA 3RYRA 1PO23 1CAUA 1S0DA 4M0NA 4AWDA 5AVPA 1O7FA 3IN9A 5C8WA 1AXZA 1QHDA 2I74A 2WLPA 1NYWA 2X5IA 1HRV3 5KHGA 2BNNA 1H2NA 2VGDA 5BNNB 1NA1B 5IK7A 4AEDB 1GZWB 2LALA 4XFFA 1H8TB 3SH4A 2UY9A 1V6IA 4IV3C 4JGZC 3R6SA 2A6YA 4M3CE 1VBE2 1FPN2 3BTAA 1SDWA 4N7UA 4LO8A 4OLLA 3VBFA 3WNXA 2ZHKA 4G9SB 2B42B 3U07A 4QPGB 2FZ2A 1Q8OA 5GZEA 1AHSA 1HXS3 3H3UA 4XBLA 1U5YA 3WT3A 4AVBA 5HI0A 2QQPA 2XBO1 4AQTA 2ZKLA 1RGSA 2O1QA 3DPRA 3KZ4C 3WW2A 5BNPA 4Q27A 5E8AA 4J1XA 1OQ1A 3RNSA 4AHYA 4XFCA 1X7NA 1VRH2 5A33B 4GMP1 1RUC3 4K1YA 3VBHB 4COUA 1E57A 2VPVA 3VZJA 1N1YA 4CDXB 1W6OA 4HVQA 3JUUA 3CLPA 3T1LA 2NP0A 4JGYC 5FOJB 5L7OA 5IT6A 3I54A 4AQ6A 4NO4A 1LHVA 3VBSB 4Z92B 4ISQA 1SMVA 1PGW1 5F5QA 2H6CA 1NCQC 4YZ1A 5ABJA 1N3QA 1DGWX 1RUH1 2CYFA 2FMDA 3EXUA 5K0UB 1LB2A 3JU9A 1QOTA 2KM2A 1ND2A 4WM7B 2FMYA 4LBQB 3POSA 1TMF2 1PZ9A 2JG8C 3VBFC 1AR62 4LO6B 1B35A 2QZ3A 1EAH1 5CFDA 1BMV1 2BTVC 2ZGKA 1C57A 4HN1A 2GDFA 4BA6A 4Q4Y3 1CPNA 1PGL1 5I0TA 4DINB 4WVMB 4Y1YA 2Y0IA 1WMDA 3L9JT 3DGTA 4XZPA 2DUPA 1PGSA 2PHFA 1PZ7A 3K48A 4FVVA 1YI7A 4YRDA 3D4KA 1WGPA 3ZYRA 2CWMA 1O3QA 4BYYA 3O5SA 4YW3A 1HKDA 2YROA 1YIFA 4LEJA 3VHOA 3IMNA 4MVTA 1GV9A 2VOVA 2B39A 4FPKA 2WJSA 1ULEA 1W6QB 3OCPA 1G86A 4OFGA 3WDXA 3I4IA 3KT4A 1A8MA 1G9CA 2A3XA 1UD1A 1Y43B 4QGMA 1XXNA 4IV1B 4JVAA 5DZEA 1Q5OA 5JSOA 4YW5A 3CU7A 1EPZA 2QNKA 3QD6A 2AGSA 4LA3A 5FDBA 1C8NA 1S0EA 2BVBA 2R042 1U5IA 1H1AA 4YM1A 1RMU2 2JICA 4WVVA 1GBGA 3ZYIB 1QKQA 4ZU7A 1O4ZA 4U2AA 4WM8A 1XNDA 1WW6A 3I59B 3IPVB 1ENQA 1FNZA 4HKWA 1NA1A 3NVCA 3RQ0A 4IETA 5KBFA 3EBRA 1GZWA 5C4WB 2XB6C 5L36A 4CEYC 3DF0A 2ZGRA 4L92A 3G6JB 2PQQA 1W6NA 4DFSA 1Z78A 2UWAA 3RSJA 4HN0A 3ZXDA 4GKXA 1QY4A 4GALA 3WG2A 4J1WA 5J36A 3BALA 1CPMA 3AZWA 3MIFA 3WV6A 3IBMA 1REDA 2D43A 3ROUA 2RMU2 5L73A 2Q8OA 3MIDA 4E4ZA 4HSLA 1GYKA 4HK8A 2YXSA 2XKOA 3UJQA 5KHHA 4ATEA 4AI1A 4AYUA 2G9GA 2HWB1 4OI1A 3WQ0A 1O3SA 3GZAA 4M3CF 3AYDA 4DB5A 1WA4A 1C8M1 4SLIA 5SV8A 2MNGA 2CWSA 2WZR1 5BY5A 4K40A 1JYIA 1COV1 2CGOA 1OOPC 4OULA 1BCXA 1CN1A 2VNOA 4M00A 3AP4A 5HXVA 2RR12 1DGRN 3ZMNA 4X6QB 2ARXA 3E6DA 4HFSA 4KWJA 1ZZCA 1SLIA 2ZTNA 1QJX2 2WT1A 4Y26A 1SQ4A 2BWAA 5DG1A 2EIGA 3KT1A 1ULGA 4KU8A 2XPJA 4UW4A 5D8AA 3D5OA 2XHKA 2D6LX 3N7KA 3BB6A 2R0HA 1R1A2 4N53A 2X53S 4LE4A 1C1FA 4Q1RA 2ZMNA 3N35A 5JVVA 1SCSA 1G9DA 4LLOA 4BH9A 1SEFA 4BWOA 1K5MA 3ZN4A 3AKPA 4Y5Z0 3ZXLA 3FHIB 2JXAA 4R9BA 2A5ZA 4OHXA 4YG0A 4V1PA 5SV5A 1CAVA 1FV2A 4I3PA 4AGGA 5ACA3 1J1TA 2D40A 1OA4A 3JD71 3VL8A 1ENXA 4O9EA 4D7YA 1LEDA 3SCGA 1R083 4D7SA 4E2QA 1BEV3 1AX2A 1MQTB 2VW2A 3CEWA 2EXHA 3KGLA 5LEKA 3NV1A 1YI9A 1W6QA 2ZBJA 5BXXA 4EJRA 4JAAA 2KA3A 4AI2A 1AYM3 1H9PA 1UMZA 5CAZA 4IV1A 1GNZA 2CY6A 2RM22 4HMZA 3ME2A 4P9WA 4ASLA 3ZSMA 3O0VA 4DXZA 1F8VA 4AVAA 3C3VA 4EWAA 3M4FA 1IZ3A 2BWCA 1PHMA 5KC5A 3VBRB 2VULA 3OD4A 3RWNA 2XVKA 3HBZA 1PVXA 4O9GA 1AYN3 4COVA 2ZGSA 1LU1A 5AC92 3RI8A 2OVUA 3I59A 1QJU2 2R073 2V73A 3ZXAC 3OBRA 2VVEA 2Z42A 4BMBA 2VMGA 2C5DA 1I3HA 4A2UA 2NYYA 5FOBB 3VBUA 2JE9A 4F83A 4HL0A 1QDOA 2DV9A 1ULCA 3J8F1 3B9CA 1IKPA 2ET7A 3RRDA 3WW3A 2DWRA 3R4SA 5FQ0B 4ES8A 3N3HA 5J7MA 2CL2A 1NE4A 4KH9A 2TEPA 4Q4W3 4P9XA 3WP4A 1OFSA 3HMYA 5H9RA 2WS92 5GM0A 2HWC1 3PVOA 2ZGNA 3KCYA 1RC6A 1C4RA 4EWEA 4I02A 4YG6A 3FWEA 2VW0A 4XXPA 2HJIA 1U12A 4CEWC 1AX0A 1IPKA 4XJ8A 3CJIA 1XNBA 3OY8B 1V6MA 3JQXA 1V00A 1RUG1 5C6CA 3ZXKA 1QQP3 3P3NA 4Y1ZA 1QGLA 5C8CB 2CAUA 1N3OA 1VAKA 1O5LA 4F8AA 1HQNA 4UW3A 4UW5A 2A71A 2VXRA 2DUQA 4YW4A 1BZWA 3GHMA 1MS9A 1ZZ7A 3ZFEB 1LCLA 3H7JA 1N47A 1J3PA 5DDJ1 5GJ6A 2YY1A 1X8EA 1RUE3 2WNVB 1ASJ2 2YYOA 1ZNPA 1GZ9A 2JENA 4WVWA 4JRAA 5I0SA 5KC6A 3ZVXA 4PF5A 2HWD2 1AL23 1HRI1 4HBNA 1UF2C 3VV1A 1PNGA