4EWEA

Study on structure and function relationships in human pirin with manganese ion
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pirin
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eweA01
4MV2A 4I02A 2GU9A 1LB2A 2QJVA 4HSLA 3SCHA 1IPKA 4L11A 1Q5OA 4XF4A 4JTOA 4AQ2A 5C8WA 2PQQA 1WA4A 5KHIA 4MGKE 3H1YA 5T3NA 1X8MA 3RNSA 1CAWA 3EQEA 5E16A 1NE6A 2D40A 1FXZA 4P9GA 4I0AA 3WW2A 4HLTA 1V70A 2PAMA 3LWCA 3OF1A 3RZZA 2K9ZA 4XF9A 1OD5A 5JSPA 4AXOA 1ZZ6A 1XE7A 4EROA 4LLOA 4BYYA 3PVBB 3OD0A 1CX4A 1ZZCA 4Q0QA 3H9AA 5D1IA 3NJZA 1UD1A 4PIXA 3DN7A 4N9IA 3E97A 4K8FA 4PJYA 1CAUA 5KBFA 1UW8A 5CADA 2XLAA 1XRUA 4IESA 4XFIA 5K8SA 3I54A 4HVOA 2BYVE 3JZVA 5KHHA 4HN1A 2VQAA 4HVRA 4IEUA 1QXJA 4YARA 3ROUA 4XFAA 5EFUA 2XGXA 3ELNA 1Q43A 2BNNA 1CAUB 3S0MA 4UBGA 4IETA 3WW4A 3EJKA 2ATFA 1RTVA 1UPIA 2PAEA 5I0SA 2ZCWA 3BB6A 3IWZA 2VPVA 4AVCA 4YYOA 3I59A 4IEVA 4Q0VA 2EVXA 4I2OA 3QOPA 1RL3A 4Q29A 1L3JA 2CV6A 3FZ3A 1O4TA 1YUDA 2B5HA 4JV4A 1YWKA 2UY8A 2IXIA 2GC2A 4OLLA 2H0VA 4FAHA 1J3PA 1O7FA 1Y9QA 1DZTA 3CEWA 2ETEA 5EZWA 4AQ6A 2XL9A 4LUKA 2O8QA 4XETA 4D7TA 1LKNA 1TQ5A 3FE5A 2MPFA 2FMYA 5I0UA 1EY2A 1ZNPA 1J3RA 5FQ0A 3FWEA 4HN0A 5I8TA 3LAGA 3MYXA 1ZZBA 3NVCA 5CU1A 4TLFA 4EWDA 4GULA 2E9QA 3IDBB 4IEPA 4IEQA 2IXJA 4ZU5A 2CAUA 1ZZ7A 1QWRA 4KWJA 2D5HA 4X6QB 1SEFA 4ZU4A 3RPQA 5JR7B 4O9EA 4Q0UA 1J1LA 5FQ0B 3U10A 1UCXA 4WBBA 4AVBA 5FLHA 4XFGA 1VJ2A 3D0SA 2VECA 2ZKLA 4IEWA 3H50A 5BY5A 4Q0PA 4IEOA 3RYKA 3E6DA 4Z07A 2B9UA 3S7IA 1CAXA 1ZRRA 3SCFA 4OFGA 4JVAA 1YFYA 2PAKA 1QY4A 3OCPA 2EAAA 4AVAA 3TNQA 5JSOA 3PNAA 3USSA 4LTAA 3ACLA 5KHKA 2PHDA 3G7DA 4RD7A 4ORFA 3CLPA 2PYTA 1O3RA 3N4MA 5AVPA 1O5UA 4MGYE 2GAUA 2OA2A 5E1RA 4PIYA 2QNKA 1CAVB 3FFQA 1O5LA 2MHFA 2XLFA 5I91A 2OZJA 2XLGA 3NW4A 2QVSB 1RGSA 2UYAA 4X6RB 5I8SA 4UBHA 5FLJA 2XHKA 1J58A 3LA2A 2OYZA 3OTFA 4XEZA 4LA3A 4IEXA 5FPXA 2GC0A 3IBMA 4IEZA 1JUHA 5KHGA 5FCCA 3DKWA 3D82A 4XFBA 4FAGA 3H1WA 2Q1ZB 1UIKA 4J1XA 4KWKA 4EWAA 2F4PA 4HSJA 3B02A 2BGCA 2KXLA 3R6SA 1DGWA 4META 4QGMA 1Q3EA 3E6BA 3H7YA 3ST7A 2GC3A 3HIFA 3IIAA 3TNPB 2CGPA 5FDBA 3HQXA 3I7DA 2IC1A 3RYRA 2XKPA 1H1IA 1Y3TA 1ZZ9A 4I3PA 5HI0A 5J3UA 1NE4A 5C6CA 4QGNA 1ZREA 1O3TA 4MGIE 3PLQA 5BXXA 1QXRA 1HW5A 3QACA 5BPXA 4ZU7A 3DV8A 2WC2A 1EP0A 4R52A 1SQ4A 2XL7A 3KGLA 1PMIA 2I45A 3C3VA 4QMAA 3UKNA 4A2UA 5I93A 3LA7A 2Z69A 3VHRA 4O9GA 2PHLA 4WZCA 2HKXA 1WGPA 3GBFA 2Q0AA 3SXWA 1YFXA 4H7LA 4KWLA 3MPBA 2OZ6A 4I0BA 3E5QA 2Z2SB 2UYBA 4LEJA 1GQHA 3O14A 1RC6A 3EHKA 4MX3A 1YFWA 1OI6A 4E2GA 1FI2A 4XFHA 2GC1A 2BEOA 4MH0E 3D0JA 4QM9A 4HVQA 4IEYA 2C0ZA 5I0RA 3DL3A 4KU7A 3RDIA 2O1QA 4F7ZA 1ZVFA 4YNIA 1LR5A 2Q4SA 1CAWB 1ZRFA 2B8MA 4B29A 4BIFA 2OPKA 1DZRA 2DCTA 3CJXA 3ZDSA 4IERA 2GZWA 5BV6A 1PM7A 5LRSA 1ZRDA 1ZX5A 1FT9A 4HBNA 2UY9A 2P17A 5J7MA 3LZZA 4PIZA 2Q30A 1VR3A 3SHRA 3H8UA 5BUVA 3FHIB 4I09A 4NVPA 4EV0A 1VP6A 2H6BA 4MZUA 4MGZE 1RUOA 3S7EA 2HJIA 2D93A 1X8EA 3CO2A 1YHFA 2K0GA 3LA3A 4N9HA 1J59A 3L2HA 2PTMA 2EA7A 2WFPA 4EWEA 3KGZA 5JSRA 4KU8A 1X7NA 3BPZA 5J48A 3CF6E 3UKTA 4BH9A 4XFCA 1SFNA 3EBRA 4Z82A 1WLTA 3ES1A 4XF3A 2D5FA 2V09A 4MUVA 4L2NA 2BNOA 2IXKA 4YSFA 5LEJA 5JCTA 2GH2A 4QXKA 3I59B 1CGPA 3IDCB 4XFFA 2XKOA 3RYPA 4F8AA 4E2SA 5JAXA 5LRRA 4QX5A 1YFUA 3NSTA 2N7GA 1J3QA 3KSCA 1NXMA 3NL1A 3MDPA 3OGJA 3H3UA 4JTNA 3E6CC 4ONUA 3SCGA 3KCCA 1I6XA 4XF0A 4QGLA 4XF1A 4J1WA 5KHJA 3ES4A 1XE8A 2IXHA 1ZZ8A 1H1MA 3M70A 2PFWA 3H1MA 4I01A 2PA7A 4FT8A 4LULA 2H6CA 5F1RA 5I8YA 3H3ZA 3E5XA 2QCSB 2QDRA 4DINB 2IXLA 3WW1A 3LOIA 1O3QA 3E5UA 4KL1A 1ZRCA 4HZFA 1OMIA 5LEKA 1YLLA 2ET7A 3BALA 3EO6A 1RUNA 1IPJA 3BCWA 3U0ZA 3FX3A 3H7JA 3GYDA 1GQGA 1X82A 1EYBA 3HT1A 4D7SA 1DGRA 1UIJA 3ETQA 2MNGA 4CYDA 5CVRA 3UKVA 1O3SA 3SMHA 3U11A 4Q0SA 3CL1A 3FJSA 4E2QA 5I0TA 2CAVA 3HT2A 4HMZA 1G6NA 4UXAA 1CAXB 1I5ZA 1OFNA 4BHPA 1LRHA 1NYWA 5FPZA 3NKTA 3M3IA 1U12A 4WVZA 1EPZA 4LUMA 1NZCA 3KMHA 4YRDA 4FBFA 4LA2A 2ET1A 2FQPA 4R8HA 3BU7A 3MZHA 2BNMA 1CAVA 3WW3A 5FLIA 4QM8A 2IXCA 2Y0OA
chains in the Genus database with same CATH superfamily
5JZGC 4AQSA 3AKQA 4XUQA 4Y20A 3ILNA 2TUNA 4I02A 1QHDA 2E51A 3PVEA 1JH5A 1RUG3 1YQ2A 2BWAA 1AJOA 1UY0A 2ZAAA 2X5IA 2ZGTA 3B7MA 3DECA 4DUXA 5L19A 1HXS2 4RGKA 4XDOA 4D3WA 3AP9A 2GN7A 1JOPA 2B46X 3UK9A 1BK0A 5GZDA 3FMGA 3WNPA 2XJPA 2LTNA 1VRBA 1YEWA 2GSYA 2P6CA 3VHOA 2R1DA 4JTOA 4AQ2A 1WCDJ 1U5ZA 3JU9A 4C1WA 3H1YA 3KB5A 5JXJA 1LHNA 1F5JA 2AREA 4NIGA 1RHI3 3EQEA 1SCSA 1NE6A 1SLAA 5FZKA 2D40A 1IS5A 4I0AA 5CFDC 3MUY1 1HV0A 2IUWA 1UWWA 1H9PA 2C9KA 2W1SA 4HLTA 3RZHA 1YO8A 2RR11 2AR6A 3RZZA 3LOBA 2JG9C 2YU2A 3SLIA 1H8TB 1WMXA 3PUHA 5CEHA 1SACA 3AVRA 3FL7A 2B45X 4E8DA 5FO8B 3T4HB 1H4HA 4EN7B 1N3OA 1W3XA 1S0GA 1UN1A 3U78A 5LB6A 4HKWA 3PVBB 1W8OA 3OD0A 1ZZCA 4OUSA 2HWC3 3VKMA 3VB9A 2RMU1 2VZTA 2RS11 3JD72 3PTRB 4BMBA 3O1OA 4WV8A 3E97A 3S5AA 4PJYA 1UW8A 4GMP0 4XJ8A 1N1VA 1AR92 1K12A 1PZ7A 2V5DA 2W3JA 2XLAA 4JHTA 5FY9A 2R7EB 4XTMA 3VBFC 3ZR5A 3I54A 1SLTA 3M3CA 2XXZA 4O65A 4XURA 2W1WA 3GJAA 1RUC1 2JIJA 2SBAA 3JZVA 1LOCA 2ZS6B 5FZ1A 4HN1A 1OLRA 3P3PA 4HVRA 4ZZ5A 4Y1VA 3EMRA 4IEUA 3RWKX 4AAPA 4YARA 4IV1B 3NNJA 1V0AA 4AQTA 4DS0A 2RJ2A 1S2KA 1VLNA 3APBA 5DAPA 5EFUA 4NR1A 2WA4A 1NKGA 1DZQA 3PIGA 4IETA 4QKBA 3W5MA 4AHXA 3WNMA 1RTVA 1JYCA 2EAKA 4QPGB 5FTTC 4QX3A 3N9QA 5FMDA 2ZKNA 3IWZA 3HNMA 3VZLA 3TN93 1GOGA 3ZMNA 2PHUA 3HVDA 4IEVA 4AVCA 2DUOA 5FAXA 5CFCB 2CV6A 1E5RA 3FZ3A 2B5HA 1R083 3HNYM 1YWKA 2UY8A 4UAPA 5DPNA 2R1BA 4NPLA 5FZ0A 2D3RA 1D2QA 1O7FA 4FVVA 3M4FA 4A6OA 2HEVF 2BRTA 3TEWA 5C3SA 5HV0A 3CEWA 3KHBA 1RUG2 2XL9A 3Q8AA 4MVTA 4UOJA 3KQ4B 3RRDA 5H9SA 5IYYA 3TB0A 2GN3A 3GZUC 3MHZA 1HDKA 1RUF2 1UX6A 2F4LA 1OFSA 1H30A 2MPFA 2UU8A 2FMYA 1EY2A 1LCLA 2HWE3 1BBT1 3A0KA 5EXOA 5LATA 5BNOC 5CFCA 4PDWC 2VD7A 3RS6A 3WF1A 4EZHA 1NLSA 2CGNA 2NLRA 1W05A 1FATA 3POGA 1XNDA 4XMAA 1NCRA 2VTFA 4RS5C 3NVCA 2A73B 4I3GA 1REEA 2EXKA 1F9KA 2AEZA 4TLGA 4EWDA 2D3PA 5H9RA 3B01A 3RJ2X 5FMCA 5F32A 1JZ8A 5GLUA 4QHOA 3U1XA 1R082 1XSQA 1BVP1 1ZZ7A 2D5HA 2E26A 1SEFA 1GKBA 1BCXA 2DU0A 4Q4W1 1JU3A 1TME2 2ZGMA 4MO3M 2R041 4UFJA 2Z4FA 2ARXA 1HQWA 4QX0A 2PLV3 3D0SA 1SMVA 2VECA 2ZKLA 3HOBA 4LR4A 4GA9A 4NAOA 4RYDA 4XHXA 3WZ1A 5L7OC 3KHCA 1VBC2 1UY3A 2RM22 5BNNB 3VDCA 5A33A 4L9BA 1RMU3 4MHUA 5KXBA 3SCFA 2QTWB 1BEV3 3LEKA 1OD3A 2VR4A 3O0WA 4LO6B 5L73A 5T5JA 2PAKA 1YQ8A 2CWMA 3V56A 2EAAA 1XNTA 3K2OA 4W6YA 3PNAA 1U0AA 5FYBA 4LTAA 1WLWA 2R0HA 3ACLA 5GLWA 1JI6A 1QDOA 3G7DA 4RS5B 4ASKA 4UF0B 2WT1A 3GF6A 1WW4A 3K4ZA 2RR13 5J36A 2PYTA 1OURA 1O3RA 1EUTA 2CHHA 3N4MA 1AL22 5AVPA 1QDCA 1O5UA 1N1TA 2A6XA 4UYBA 2GAUA 5FKBA 4ZY9A 3VZJA 4K9SA 2QZ3A 2OUJA 1H1AA 1RUD2 4XILA 4PIYA 3OUHA 3PU8A 4H7MA 3WINE 1Y9GA 4QDSA 3TRSB 4XXAA 1O5LA 2MHFA 4CPBA 2XLFA 3POYA 5I91A 1R1A1 2OZJA 3GNEA 3KT1A 2Y6HA 3NW4A 1LULA 1RGSA 3LPFA 4HK8A 5EYXA 1RXGA 1RXFA 2WO1A 4NRQA 3MO4A 3MF6A 1G8WA 2HWF1 3DXUA 4B3NA 4UBHA 5FOBB 3ORJA 5DAQA 2HWF2 2LALA 2YFZA 3D5OA 3LB9A 4QXBA 5FY0A 1XYNA 2SLIA 3JD71 1SLBA 4YM0A 4W6WA 2GH8A 2ZGKA 4IEXA 5CKQA 2Q8EA 3TAYA 1H2MA 4GB31 4NO4A 2LROA 1WD4A 3DKWA 3AYEA 3CNAA 2WZ8A 5E89A 3H1WA 4DPNA 1YCIA 1W9SA 4FTBA 2Y6GA 1VBC1 3AMHA 4XXPA 3ECQA 1DDLA 1OKOA 4N8MA 1DGWA 3JUUA 4QGMA 4RGAA 1Q3EA 3KV5A 5FZDA 2ZACA 4QQOA 3ST7A 5TSWA 1JYIA 5BV6A 5FDBA 2DU1A 5D8AC 1D0GA 1E57A 5FV3A 5DUUA 5EPAA 2DDUA 1VBA2 2JB4A 5JPNB 3QH6A 1RUI1 2EF6A 1RIRA 2VVFA 3PVOA 4CDWC 1VIWB 5JI9A 1Y3TA 4AEJA 3N9PA 4OHWA 3IM0A 1DYPA 2FDJA 3WR0A 5FOJB 2VCCA 1KGYA 3K3NA 1PGW1 4QGNA 2JECA 1MZ5A 1RUE2 4MGIE 4NIHA 4GMP1 2QQPA 1HW5A 1YC61 4CPBD 4CCLA 2ILMA 1J84A 2X8KA 3KM5A 1MS4A 3VN4A 4OZOA 2EXHA 3B00A 1SLLA 1Q8PA 4D69A 5C71A 3I3EA 5DZEA 5DXDA 2DV9A 3J26N 2I45A 3C3VA 4HK9A 4QMAA 3PMSA 1GV9A 1JYNA 4PLOA 2RS52 2NPIA 2HKXA 1RUE3 3M3EA 3VKLA 4RHV3 2PHRA 2VOXA 2Q8CA 3J7LA 3U07A 2FDKA 1YFXA 3FUOA 4H7LA 2RDRA 1GLHA 4KWLA 3JB4C 1C5IA 2A6WA 2OW4A 3NAPA 2RDSA 4Y20B 4QAWA 4LKFA 2NZ9A 3O14A 5A3OA 1RC6A 3SC7X 2WT0A 5JI7A 2X5IB 2OS2A 2B9VA 5D2AA 1RUF3 4GIQA 5EIYB 4KBBA 4QM9A 5DQ0A 2WNEA 4V2VA 4R9DA 2QBXA 2MEV3 3PIJA 4IEYA 4HVQA 3RDIA 5IWFA 3J7HA 5FZEA 2HYXA 4S2GA 4DEQA 5A1AA 5H9PA 3LSEA 3OEAA 5A7WA 2P5BA 4BIFA 3AP4A 3MI8A 2DBIA 1DZRA 5HCFA 1I5PA 2BBAA 1H4GA 4IERA 4QX8A 4CXXA 1WLDA 2B7YA 1PM7A 1BJQA 1ONAA 4OQ9A 1Q8QA 3SH3A 1ZX5A 2HWF3 5LZ6A 4HBNA 4COYA 1SHWB 2IWGB 4XUPA 4PIZA 3GHNA 1VR3A 3HN1A 1JZ4A 1ALYA 3SHRA 3MV11 2DFBA 2FZ1A 2G9GA 3P3NA 2ZHNA 3IDEA 5LA2A 1QJY1 2HYKA 5FZ4A 2YXSA 5JDBA 5T54A 2Y6FA 1ND3B 2ZMKA 1OHFA 5LA0A 2XBO3 4A4AA 2E53A 1OH3A 1D4M2 1N1YA 4XCBA 5HV4A 2HWB2 1V6MA 2EXIA 1WBFA 2VBPA 2WZR2 1PNFA 1J59A 5HXVA 5J98B 2PTMA 1VRH1 2EA7A 4CU8A 3I3BA 4WVMA 1XNKA 5DAWA 3I49A 1W99A 5JSRA 2R0FA 4KU8A 2WNOA 1SBDA 5EHDA 3BVCA 4NUBA 1X7NA 1R091 3KWVA 5AVAA 4TTGA 3VBUB 4JKKA 4YFZA 3BTXA 2HWC2 1BEV1 1OUSA 1W6PB 1YRZA 1LHVA 3EBRA 2VMGA 2VMCA 5FUPA 2V72A 2ZZQA 4Q26A 4E27A 3V64A 2GNMA 5FO9B 1QOSA 4NHMA 1U5XA 2DURA 1AR63 3JCIA 5IVVA 1W8HA 1BMV2 2DCKA 2VMFA 1W6QB 4QHBA 4YSFA 1OBNA 5LEJA 2YFUA 3PU3A 2GH2A 2VZOA 5IVJA 1S4CA 1CGPA 1T6BX 5IFPA 2ZHLA 5HPOA 2XKOA 3RYPA 3HJRA 1YQCA 2DVFA 1AVBA 2FDIA 4ZXKA 1IS3A 1O8PA 1JXNA 1NQDA 2DWRA 2EIDA 1YFUA 3NSTA 4UT5A 2OKXA 3UESA 3BIEA 2JEMA 3S57A 3KSCA 2XJQA 4CEWC 1W6OA 3OGJA 2D6PA 2VW0A 3H3UA 1PX3A 3N3HA 1U5IA 4WM7B 3FHAA 4I30A 4XF0A 3SH5A 5C7GA 1DQ5A 4MGTA 3JB8A 3IMNA 1UKRA 3NJXA 4M0NA 4QQHA 3K46A 5FZAA 3PHMA 2IXHA 1IS6A 2JDHA 4JHZA 2PXJA 4IW3A 1E5SA 3I3DA 3UV9A 3H1MA 4HG6B 2PA7A 2FDFA 3M8LA 4FT8A 4UW5A 4XE9A 5F1RA 1UYPA 2H6CA 2D7FA 1RUD3 1BK1A 1MS3A 4LJHA 2E31A 2KR2A 4AF9A 4PBOA 1IZ3A 2WQ8A 3VLBB 4PQQA 2HWE1 2ID4A 1D4M1 3CJIB 2WFF1 1S0CA 1YYNA 1PMJX 2NN8A 3PJQA 4HZFA 1SDDB 2RR12 3BI3A 2ZGQA 3AX4A 2P34A 3ZSJA 2ET7A 4FPCA 2XONA 3EO6A 4QKFA 1K45A 3ZXKA 3U0ZA 4K40A 1DFQA 5DZGA 3GYDA 5J37A 1X9TA 4D7SA 2ZABA 3AYAA 1BEV2 5FUIA 2J42A 3ETQA 2JDZA 2LRPA 5CVRA 4Q8LA 3CJIA 5GKAC 3LDRA 2WDBA 2FCUA 2EALA 4HKLA 1Z7S1 1GZCA 1C5HA 1MACA 3TN92 3VL8A 3ZXGA 3WG2A 2ARCA 4P9XA 1JYXA 1ULCA 3AMPA 1QKQA 5LK5A 2PLV2 3N9LA 5I0TA 1LECA 3ZDVA 5ISLA 2J1RA 1OFNA 3FUQA 3NNMA 2ZMNA 1UZVA 1TME3 1PMHX 1ULOA 4PLNA 4R9CA 3AKPA 4GQ7A 2OQ6A 5FPZA 3O1UA 5DDJ2 1K3IA 2NM1A 5IUQA 1UZZA 1UMIA 2YC4A 4LXLA 3CHXA 5C3PA 1VBB3 3KZ4C 1HRI2 1GNZA 2JDYA 4WVZA 1EPZA 1COV2 1VAMA 1W2OA 3WP6A 2EIEA 4Q4V2 3TEXA 5C8CC 4DRRA 2VOKA 1TEIA 1ZYBA 1SBEA 1POQA 4W6XA 5F3IA 5FP9A 2GDFA 5JR2A 5L7OA 2QQMA 2ZGLA 2PELA 2W95A 1QQP1 4LA2A 4QB6A 4TSVA 1C8M2 2JE7A 4XVHA 2WNUA 1AR93 3BYWA 3X29B 3O1SA 4FPFA 5L9RA 1N3QA 2BNMA 5DUVA 1LOFA 1PM4A 2BWCA 4CVUA 5C3OA 1HRV2 4YZ3A 4M00A 1IG0A 4JDNA 5FLIA 4XJWA 2R32A 3O12A 4NPRA 3SQOA 4ATFA 4AGVA 4XQWA 1EAH2 3N9OA 2CGOA 1D2SA 2QJVA 2BV4A 1W6MA 1IPKA 4DXRA 4CUCA 2PHFA 1IKPA 3OGGA 4QPYA 5KC6A 4JZRA 3VDBA 4Y5SA 3ZPOA 1W6NA 1NY72 2ADEA 1AJKA 1UZWA 5LBCA 5K0UB 3RNSA 1CAWA 5E16A 5FREA 3ZYPA 5LK7B 4P9GA 5GALA 2DF7A 2BZDA 3WW2A 2W1UA 1J83A 2PAMA 3OF1A 2ZHKA 3TBDA 1W9YA 5FYSA 4C1XA 3GDBA 3C7OA 5JSPA 1CZSA 1SCRA 3JBG2 4C90A 3ZO0B 1JZ7A 1W6NB 4BWOA 5FPBA 2RDNA 4LLOA 4AI3A 4BYYA 1PO21 3UGFA 3D3AA 1UOBA 3WX5A 3ZN6B 3AYCA 4YVWC 3VBHB 3WT3A 1HKDA 4CEWB 4D6RA 1CX4A 3CDZB 3R0RA 4Q0QA 3I2HA 4BM8A 2HWD2 3NV2A 4N9IA 4QX2A 3WEZA 2JD4A 2PN5A 1I3HA 4OMDA 3WOGA 1LU1A 3MIDA 5CADA 2XVKA 3HBZA 1SG3A 2O0OA 3VZNA 4BLIA 1B35C 4DIQA 2WRAA 3B9CA 2JD9A 3QLQA 3OBAA 4GB33 4R9BA 1EPWA 2BYVE 3CZUA 3AMQA 4MOAA 1KD7A 1REFA 1W8FA 2D6MA 2VQAA 3LDBA 2Y6JA 4XDPA 5IK4A 4LHNA 1WKYA 2UWCA 5LA9A 1JS9A 3ROUA 3ATGA 3CKHA 1Q43A 3N35A 3OBTA 2W94A 2QQVA 2ATFA 2VMDA 2Y33A 1NCQA 2WNUB 5FZMA 2PAEA 5I0SA 3B9IA 2E7TA 3VBSC 4HOOA 4LBQA 2NMOA 1NA1B 4B1MA 2J1AA 1H2NA 3I59A 1RHI2 5C4WC 1CR7A 4I2OA 4COWA 1CZTA 1RL3A 3U4XA 3GJBA 1L3JA 1SFPA 4Y22A 3C8XA 1VBE3 5E6HA 2ZGOA 4KGGA 1US2A 4Y33A 4CUBA 2CU5A 1HQLA 4HKOA 3IZOA 3WCSA 3OOXA 1J3PA 1GP6A 4EN6B 1HXS3 3MLLA 1DZTA 5FK8A 4GH4C 3SITA 3WD5A 1YQ6A 1UMHA 1JU4A 3J8F2 4AQ6A 5A6QA 4QHZA 2MEV2 3RZKA 2R6QA 1W9FA 2W87A 1NT0A 2VZVA 3UGGA 1XOYA 2VQTA 1F5FA 1MZEA 3FE5A 1XPWA 4XZPA 1OQEA 1ZNPA 2YGMA 1S0JA 5I8TA 5A7NA 1GYKA 2LW8A 2WAAA 1WCSA 5CU1A 2NQYA 1SDWA 1UZ0A 1UZYA 2VZSA 1QQP3 4LITA 1DU3D 4IEPA 4O7XA 4IEQA 2IXJA 2A70A 4WVWA 2CAUA 1R64A 2VUJA 4KWJA 3VD4A 3ZSEA 4X6QB 1ZBA3 4DUVA 1LGBA 4HFSA 1F31A 4ZU4A 1PIV2 1LOBA 1MS1A 1MS9A 4O9EA 4Q0UA 2RJKA 4LO7A 3RPQA 3AYDA 1J1LA 1MQTC 3T3YA 3O0VA 1CD3G 4XFGA 2VZ3A 1WUVA 2WKKA 1ULFA 1MS8A 1NZIA 1CESA 3POEA 4IEWA 2RS31 4Q0PA 4XAAA 5C5UA 4IEOA 4XUNA 3RYKA 3ZVXA 3OYWA 1RUF1 2Q8DA 4LBKA 1AR81 1QJX2 1FAYA 4E8CA 2WQZC 3IAPA 3CJIC 2B9UA 2Q1MA 2WA3A 3DUIA 3CZJA 2YGLA 3R4SA 2Y26A 1XU1A 5LBBA 3WDVA 4OFGA 4A42A 5FPAA 5BNPA 1GWKA 4K7JA 1JOBA 5FZ6A 2D44A 4FI9A 4AVAA 5JSOA 3O1TA 1UYZA 3IKWA 2YDEA 4RFRB 2CSGA 3MICA 3USUB 1QJY3 1PO12 4LBMA 3USSA 1G9BA 3UJOA 1LAJA 3HN3A 2KM2A 2D97A 3A0NA 2C6SA 4RD7A 1S55A 3CLPA 4AFCA 3WXPA 3RFRA 3CU7A 3DCQA 3NWKA 5CAZA 5K7PA 1W0NA 1IPSA 2OA2A 2R042 1G9FA 1QNWA 5FY8A 4AHZA 4Y22B 2C26A 5E1RA 1PVXA 4NIAA 4B4RA 2ZGUA 4Q4X2 5F2WA 1Y43B 2YU1A 5HCBA 5FZOA 2PHWA 3S6PA 5F5AA 2XLGA 2QVSB 1GSLA 4CEYC 1IOAA 1DYKA 3M2MA 4QU2A 4LIUA 5I8SA 4QDQA 1AR73 2KD7A 4N90A 1J58A 2A6VA 2W5FA 3LA2A 4C91A 3I2OA 3OTFA 2Z79A 4QX7A 3WF3A 4CDQB 4Y3OA 4UW6A 5FPXA 3FBYA 1RUC3 2BUKA 1JUHA 4IEZA 1W0OA 2YBPA 4MADA 5CNAA 5FCCA 3LIHA 3D82A 3WVJA 2Y64A 1M06G 2RS12 4IXLA 4LBQD 1U5YA 4FAGA 1REDA 1AL23 4Y5TA 3A4UA 2FHRA 1LJ7A 4UW4A 4RS5A 4CTEA 4WVVA 4DQAA 2V4AA 3BOWA 2KXLA 3JQWA 3LF7A 3H7YA 2R061 2JE8A 1VBD2 3AXDA 1YXWA 3LPGA 3TNPB 4KBZA 3DXTA 4M3CE 1GOFA 3IPVA 1PIV1 2XMLA 3OGVA 3RYRA 3UGHA 3VZMA 1AYN1 2JXAA 1ZRIA 2LS6A 5M0TA 1ZZ9A 5JOXA 5F5QA 1JZ2A 1MEC2 1E5HA 2PHTA 2ZPXA 2JG8A 1RMU2 5HI0A 4G3YC 1C28A 4AGRA 4GALA 3LEGA 2RM23 3NV3A 1ZREA 1UYXA 2VVEA 4P00B 2JICA 2X10A 3PLQA 5FJHA 4Q1RA 4DY5A 4YZ5A 1YQ5A 1UNBA 5BPXA 1UU4A 2W52A 3J7MA 5FYIA 1LGCA 1POV3 3THCA 1W8ZA 4CCOA 2XL7A 5JMOA 5GJ6A 1PMIA 3VDAA 1HJFA 5B4NA 3WDYA 2VQUA 2Z69A 4KGQA 1SLIA 4WZCA 1VMFA 3IMMA 4Q4Y2 3LFIA 2BBVA 1OVPA 3SXWA 3RZMA 2GNBA 5EJ1B 2W0XA 4LBNA 5CIRA 2VVDA 4ITCA 1H6YA 1UPSA 3E5QA 2VG9A 1S2EA 2P6HA 2Z2SB 3RVHA 2UYBA 4URAA 3NNFA 5DG1A 1GU3A 4OI2A 5CKMA 3ZN4A 2W1QA 1A8MA 3EHKA 4MX3A 5FZ8A 2BPA2 5DDJ1 1FI2A 3T09A 2GC1A 2JDKA 1C1LA 2BOIA 1V00A 2ZGSA 4NPMA 1S0BA 2W46A 1UU5A 5DUWA 5GZGA 3BKZA 5IT6A 2OPWA 2C0ZA 2VTXA 4FOVA 1DBNA 1IS4A 2WN2A 1C1FA 4HPKA 4KU7A 4H14A 3RGBA 4COUA 1MR5A 4P5HA 2XUEA 3ZFFC 5FYUA 3VD7A 4CDUC 1CAWB 1N1SA 1NUKA 1F4HA 1R1A3 2BDRA 3HBKA 5G04L 3ZYRA 3ABZA 4P02B 2OPKA 5BNOB 1UF2C 3ZDSA 1XJAA 3M3OA 2GZWA 1GR3A 2CYFA 1O8SA 3B5LB 1KS4A 5FBZA 1I9RA 4EJRA 5DMYA 4GWIA 4C0BA 1AR71 5AFBA 3WG1A 4XW3A 2VCBA 1EV12 2YROA 3ENRA 4K20A 5F39A 1OLQA 4K21A 3KT4A 4NN0A 4AEDC 1OF3A 2XWJB 5C5TA 1JN2P 2RMU2 5J7MA 3LZZA 1AYM3 1JTZX 4UFMA 3WNOA 1UY1A 2ZX0A 1UXXX 5GM0A 3V0BA 4YPJA 3E1F1 2A3XA 1W9WA 3VHPA 4EYUA 3VBHA 1WCUA 2DFCA 4FOQA 1Z7S3 3RG0A 3ZYJB 5BUVA 3NAPB 3FN9A 4P14A 3BN6A 3KQRA 3ZFGA 1PO22 4MZUA 3VBUA 4MGZE 2H0BA 3LCPA 4D7YA 1JZ6A 3VKNA 3S7EA 4CRQA 2D93A 3LD8A 2FMDA 4CUGA 1YHFA 2K0GA 4UF0A 1LODA 2G1MA 5C3QA 4COVA 3KGZA 3BTAA 1R081 3F2ZA 1GZTA 1BKZA 1RUH3 1VALA 2Y60A 4W8JA 2VMHA 4BJ0A 3BPZA 5A7WB 3I2KA 2VUCA 5FIXA 4XFCA 1FMD3 2WS93 4ASLA 3AZXA 2K2SA 2WUHA 1RUD1 1DG6A 4XF3A 3UL2A 1QF3A 2V09A 5F3GA 2IVJA 3ZKUA 1AHSA 1QJEA 1AR83 3O1VA 4Z1VA 2E7QA 3HAGA 3VBOA 5JXHA 4BQ4A 2ARBA 3B93A 2BNOA 3Q8CA 4UFIA 4AEDB 4B7KA 5ACA2 4N53C 2I07B 4IUGA 2W08A 4QKDA 2XUMA 1FPN2 2X09A 3HR9A 1QMJA 3I59B 4BZ4A 5JCTA 2RG4A 3IDCB 4E4SA 5F3CA 4OI0A 1BMV1 5JPMB 1STMA 4CU6A 1JYWA 2VNVA 4AI0A 5L9BA 2QQNA 4E2SA 1PZ9A 3I2GA 4FP3A 3TEYA 2R063 1J3QA 1VMJA 4Q4W2 4YVSA 5C70A 1ND3A 5C9AB 3LFMA 1XYPA 1BBT3 4ONUA 3QD6A 1UXZA 2VL4A 4CCKA 4D6SA 3WSOA 4BLJA 1OLMA 4XF1A 3URFA 3KV6A 3AZVA 4GH4B 3EB7A 5A3LA 1VMHA 1AR61 1H1MA 2J1SA 4L92A 1J1TA 2PFWA 4GJZA 4I01A 1BXHA 2VZQA 2B4KA 5I8YA 1IHMA 5EWSA 3RMXA 4LK7A 2QDRA 4A3ZA 4CCNA 3UT0A 4D6QA 2O8OA 5EYYA 4E9KA 4JCKA 3BOPA 4CSWA 1O3QA 3E5UA 3MIGA 1WD3A 4PBPA 5A3WA 5BNNC 4KL1A 5D8AA 2PMWB 1UY4A 1OMIA 2QUOA 4IGPA 1W03A 1TMF2 2VOVA 3T2QA 1RUNA 4TZDA 2YG0A 1S1AA 4UFLA 1LEDA 4N43C 5A3PA 2ORZA 5F3EA 5I0DA 1VBE1 4YVWA 1RUJ2 5JXIA 3MBWA 4JDOA 3VUOA 1DGRA 2W39A 3BUCA 1ZBE2 2MNGA 3WNKA 4CYDA 3GALA 1OF4A 3OPWA 1AYN3 1EV11 3NNGA 1JW6A 1W8TA 3SMHA 3ZFEA 1UYYA 3WDWA 2YBSA 4Q0SA 3QCWA 1RUI2 1Q8OA 2D6KA 3CL1A 3GCWA 3POWA 4LE3A 4YLZA 1FPN1 3GBGA 5B2GB 2ZGNA 1O6UA 2UWAA 1PHMA 1RUG1 5L7OB 2RS32 2CAVA 3HT2A 4HMZA 1G6NA 1NCQC 2JDUA 3W58A 1N3PA 2DUPA 1LRHA 1LOAA 1K5JA 2NMNA 4MXWB 3H8OA 3NKTA 1TE1B 3K77A 3KS7A 5LBFA 4JQRA 4L97A 3WNXA 1W39A 1U12A 3OPZA 3BU0A 2C4XA 1DQ6A 1OA4A 4QKNA 5JLVA 5CKNA 3KMHA 2BERA 2VH9A 2VC9A 1KJRA 2JG9B 4YRDA 3J8F1 3WV6A 4CDUA 1GNHA 1VE0A 3IT8A 4Y1ZA 5E8AA 1ASJ2 2WLPA 2RV9A 4XHBA 2ET1A 2BOJA 1KEXA 2JJ6A 4JDMA 4DFSA 4ES9A 2HBUA 1RVF3 4R8HA 2YYOA 1X36A 4OHVA 4Q4Y1 4QD2A 5EV7A 1N47A 1XSRA 1Q8SA 2ZX2A 1DCSA 3B94A 1O4ZA 1CPMA 1XC6A 2Y0OA 4QM8A 2D6LX 1S2BA 2BGOA 5A7OA 2WNUC 1NCRB 2GU9A 1AXKA 1GZ9A 2GNTA 3MF9A 3Q8BA 2RE9A 1UY2A 3MW3A 4BISA 5T52A 4HSLA 3H8XA 2D43A 4DNYA 2XJVA 2WBKA 3SCHA 1RUE1 3UYJA 4R9AA 3ZR6A 1UKGA 1Q5OA 2VZRA 3HWJA 3MGUA 1S0DA 4U36A 2JB8A 4M3CA 1WCQA 1PX4A 3VDDA 4XF4A 3HNBM 1ZA7A 2XBO1 5C8WA 2PQQA 1WA4A 5KHIA 4MGKE 1W2AX 1X8MA 1AXYA 3AZZA 4FOWA 4RSUA 3DPRA 5IAVA 3O0XA 4L0PA 1CN1A 1FXZA 4NIIA 4RFT0 2VW1A 2BP6A 2Y6KA 3VL9A 4CP9A 5FR3A 5FMOS 1K5MB 3TEZA 2FD8A 3LWCA 2WABA 3M7AA 4Q8KA 4A41A 3QH7A 3O5SA 3KD4A 4LMFA 4CCDA 3UNPA 2P3KA 4Y1UA 5FZHA 4YZ4A 2BGPA 4XF9A 4QPGC 3PL0A 5BNNA 2CTVA 5FZ3A 4WVMB 5AC92 2A71A 4QPWA 1SPPA 4Q4X3 1WCKA 1A78A 1NXD1 1OSGA 2VXRA 4XBLA 4EROA 3WF2A 5DABA 3T30A 3VZKA 3MW2A 4AEKA 2Y38A 3WF0A 3H9AA 3NJZA 1UD1A 4XYXA 4TYSA 3DN7A 2R073 4Q27A 3T2TA 1WLCA 5KBFA 3ITQA 4QXHA 2J1TA 1YJKA 1PK6C 1RVF2 5FYYA 1NG0A 4AK3A 1PZ8A 3ZKYA 4IESA 2IVIB 2VOTA 4XJUA 4YM1A 3O1MA 4QDRA 1ASJ3 5FXVA 1NCQB 1O59A 1MQTB 1SPPB 4HVOA 1F35A 4J6GA 1C8NA 2WYSA 4MXVA 2J1EA 5KHHA 5LASA 3I4IA 1US3A 2BQPA 4BQ2A 3W59A 2YHJA 1V9U3 4BDVB 1GFF2 2O14A 3R4DB 2E32A 1QXJA 2WSVA 3NMBA 3VBSB 4CDUB 4K1YA 4NROA 5FY7A 5GLTA 1NLRA 1ND2C 4LO8A 4PI0A 4DEVA 1X50A 2XGXA 3ELNA 2BNNA 1E5IA 2NYYA 4UBGA 5SV5A 3WW4A 3S0MA 4N7UA 4FTSA 3GBWA 3CBNA 3EJKA 3J4UH 3LQCA 1LHOA 1UPIA 4LBJA 4PLMA 1QXPA 5CB7A 4N43B 3BB6A 2VCAA 2YPDA 2ZTNA 1MS0A 4IE0A 1V6NA 4LKDA 4YYOA 1HIXA 4BE3A 2EVXA 3PURA 2ZMLA 1AYN2 2AC1A 1JYVA 2ZX3A 3AMNA 1JHNA 1O4TA 4FFFA 4JV4A 4NAMA 5IVYA 2A1XA 1QU0A 2IXIA 4ZONA 1CJDA 2GC2A 1BYHA 2H0VA 4GZ9A 1QQP2 2Q5TA 1UOGA 4FO9A 3AB0A 4X8PA 3OY8B 5FWJA 4NHLA 5F37A 2ETEA 1WBLA 4LUKA 3ZSMA 5IVBA 1DGLA 3POJA 1TMF3 2DBNA 1YIPA 4CP2A 3OBZA 1RJ8A 2P3IA 2WFF3 3TYJA 2GP5A 1LKNA 3K75B 1TQ5A 2J1UA 4AHYA 4BXFA 2ZXQA 5C3RA 1GBGA 5I0UA 2WINB 4URTA 4YVSC 3EXUA 4DUWA 1ZBE1 4CP9B 1NQJA 5FQ0A 2CDPA 2W2IA 4AFDA 3FWEA 2QQOA 5CBLA 1KFUL 1ULDA 4P9IA 1JMUB 1FOD2 4P9JA 2WZEA 1TVGA 2J1VA 1DLCA 2E9QA 4ET7A 3IDBB 4OVEA 2BFUS 3B3QE 3D4KA 4ZU5A 4FOYA 1OQ1A 1QWRA 4LBQB 3IDAA 4XQDA 4NRPA 1V9U1 3MPPG 5JXGA 4JQTA 2WO7A 4CDXA 4CDWB 3PJYA 1APNA 3QBQA 4Q4W3 5CFDA 1MVEA 5FQ0B 3U10A 3AFGA 5BNPB 1UCXA 2OX0A 2VGDA 3MUZ1 4WM7A 4AVBA 1DLLA 1PGSA 4CP1A 5F2SA 5BY5A 2WSUA 3MIFA 4Z8BA 4OYUA 5J1XA 1FPN3 1V6IA 4AR2A 2P2KA 4E4HA 5IVFA 4Z07A 1AZDA 2R071 1JZ3A 2JWPA 1VBB1 4IV3A 4YM2A 5FP4A 4FCAA 2AEYA 1DQ2A 2HLEA 4OZXA 2FZ2A 2GMEA 2A75A 3DKQA 1GMMA 2VNGA 3VBUC 1LHWA 4JVAA 4CDWA 1YI7A 3OCPA 1FMD2 2WS92 2WYFA 3MFAA 1H6XA 4XPVA 4DXSA 5L9VA 4YGCA 2WZPP 3TNQA 2AYHA 5A70A 4IV1C 4Q4V1 1QJU2 4CDXC 4M3CF 5KHKA 4BA6A 5F6KA 3ZYFA 1YI9A 4LHSA 5ABJC 4GWMA 3W20A 3THTA 4UW3A 2BW8A 1XNBA 4LKEA 5FBJA 5GZFA 3O1RA 2VNRA 3JXSA 2ERFA 4AG4A 4CZSA 3NAPC 3AL5A 4KG8A 5FWEA 1D0HA 2CWSA 3OG2A 2QNKA 5F5CA 5A7QA 4FPJA 2PHXA 1OPOA 4GWNA 5G05L 4DO0A 1KRIA 3TN91 3ZXFA 4Y4RA 1AXZA 1Z7S2 4ATEA 1TG7A 3AKRA 1OA2A 2DVBA 1A6CA 1IKQA 2ZZJA 4YW3A 1AYM2 5C33A 4V1PA 4NIDA 2UWBA 2W91A 4H2AA 4A7YA 2YC0A 4AL9A 4AVTA 2BVBA 4UFKA 2VUAA 2DTWA 4XEZA 3ZXDA 5FY4A 3IPVB 1Z78A 2EXJA 4ES8A 2JKXA 4INDA 1OLME 2XPJA 4K3UA 1KS5A 2D3SA 2DTYA 3DEMA 1TZOA 2Q1ZB 5ACA3 4QQPA 2MEV1 3USUA 1UIKA 4KWKA 3MIHA 2YY1A 3U4SA 4U2AA 2F4PA 3C7EA 4HSJA 5LBEA 4CCCA 3KV9A 2L9LA 1KXGA 3B02A 2BGCA 5FYHA 3WQBA 4FFGA 4XIKA 3BODA 1MZ6A 3E6BA 3N7JA 2TBVA 5C8CB 2AZ5A 2GC3A 3HIFA 3IIAA 4PF1A 3VGIA 1PVC1 1OC1A 2D6NA 2HWC1 1W6PA 2IC1A 2W92A 3OEBA 4R4XA 1RUH2 1H1IA 2XKPA 2JIGA 4IE7A 2VY0A 5ANQA 4GJYA 5CYYA 1KITA 4J25A 3VDDC 4AI8A 3ZLIA 1UOFA 5HCAA 3GGLA 3K3OA 5J3UA 3KF3A 5FZIA 4E4ZA 2WNVB 3MW4A 2P3JA 4CEYB 2XJRA 1HXS1 1COV3 2HWB1 2WAOA 1QXRA 3U14A 3C7HA 1VBB2 3QACA 5LA1A 2E63A 3FBMA 3H3LA 4FPHA 1PK6A 4P9YA 4LNVA 3DV8A 1B09A 1ENRA 2WC2A 4FPKA 3ON7A 4OMCA 5A32A 2ZA9A 4A7KA 3AZWA 3ASIA 4Q2FA 1EP0A 3RZLA 1TNRA 1R1ZA 1SQ4A 3AM2A 3C2UA 1VRH3 4R52A 4XDQA 2V5YA 2JE9A 2WQ4A 3OB8A 3UETA 3UKNA 5L36A 4A2UA 3OGSA 4NHYA 2PQSA 1ODNA 3ACGA 4LT5A 3VHRA 3SNMA 3GBFA 2Q0AA 1K5MC 2KA3A 4JGZC 4HPKB 4GXLA 4LPLA 4P9WA 3T0BA 3MPBA 5T5OA 2DUQA 2YUEA 3IB3A 5FYVA 4I0BA 2ZGRA 5LWBA 3ZN6A 1L7QA 2VJXA 1FX5A 1W2NA 3ZOIA 1W3VA 4LEJA 5GZCA 1GQHA 3PUQA 3T0DA 5FP3A 1XNCA 1ULEA 4XIOA 1Y7BA 5BNOA 3D8CA 1NY71 4PI2A 4LLFA 5FP8A 4E2GA 4CU7A 5KWRA 4OI4A 1CIWA 2QQIA 4MH0E 3D0JA 1WMEA 3Q9OA 4YGDA 5A1FA 4KWUA 4PQ9A 5FZ9A 4Q5OA 2Z42A 3TOJA 4FPOB 5I0RA 2QDNA 4BK4A 5IFTA 2O1QA 1ZVFA 3IIIA 1BQPA 1ND2A 4RGGA 2B8MA 3A7QA 4FQ4A 4YW6A 4B29A 3V0BB 1LHUA 3FHQA 4WZFA 5SV8A 2DCTA 3WDUA 1W8NA 4ZKTB 4IE4A 1RUC2 4QPIA 1FNYA 4QXCA 4LORA 5FY1A 1V6KA 3NO8A 1HX6A 1FOD1 2ZAHA 2ARAA 1ZRDA 4NWWA 5IK8A 3ZSKA 4A44A 3NJYA 3MV01 4I0WB 1PGW2 5IAXA 2Y34A 1KDMA 4FPGA 3RI8A 3ZX7A 2RS51 1XQNA 2YPJA 5J96B 1G9DA 1BBT2 4M4PA 1S0FA 2XJSA 4C8DA 5IATA 1C57A 3WF4A 5FZGA 5FYTA 3FHIB 3SISA 4I09A 4NVPA 1GP5A 4EV0A 1VP6A 4AI1A 4EN8B 4Y1XA 4BMEA 2BTVC 1KDKA 4A6SA 1G86A 3HEIA 2HJIA 1X8EA 3CO2A 3POIA 4QU1A 5A6YA 5AFEA 5FJKA 1AR62 1W90A 1OUXA 2RDQA 4NHKA 2WFPA 5CISA 1AX1A 1GWLA 2RHPA 3NKGA 5JMCA 3LIGA 2I2SA 3ZYBA 1QJU3 5F7UA 3SH4A 4XBNA 5DZFA 1ULPA 1IQAA 1XNAA 4HETA 4SBVA 3RSJA 3GCXA 3VV1A 5J48A 2WIIB 3AKTA 3UKTA 3VBSA 1BVVA 5ANNA 3IAQA 1VBD3 1PVC2 1WLTA 3ES1A 3THDA 3ZFEC 1T6GC 5JWPA 3WDXA 2Y0IA 3GHMA 4MUVA 1AYM1 1W6MB 5FUNA 4NMIA 4GWJA 2ZEXA 4TWTA 1XU2A 5FZOB 2WZR3 1X9PA 1QIQA 3POBA 4BQ3A 2VULA 3ME2A 5AC93 2A6ZA 3P6BA 4WM8B 3MFCA 1DIWA 4QXKA 5IK5A 2WWJA 4YZ1A 1G7YA 5F6LB 4IE6A 5EP9A 5K0UA 3AZYA 3WUDA 5FKCA 1FV3A 4EE2A 5LRRA 4B8EA 3DYOA 3LE0A 2OIIA 3WQ1A 1RVF1 3PTYA 1NXMA 3NL1A 4AFBA 4LBOA 3OY8A 4AAXA 1OOPB 4CE8A 3KCCA 1I6XA 1ST8A 4QGLA 4N7IA 2G9ZA 1C3HA 1EUUA 1POV0 3ACIA 2V73A 1RUH1 3N9MA 3OYWB 1DQ0A 5D8AB 3T1LA 4ISQA 4B4QA 3ES4A 3OUJA 1ZZ8A 2D6OX 1F8VA 3T2OA 5KR7A 5C9AC 3M70A 4ZHNA 1ND2B 2QQLA 2OVUA 1MS5A 1W04A 3ZFGC 2QCSB 2QQJA 1F4AA 3T08A 3VBRC 3PVNA 3WQ7A 3WW1A 4IGOA 2ZEZA 3LOIA 4QQ2A 1P8JA 1ZRCA 2XOMA 2ZEWA 3B69A 4S2HA 1F2NA 3ZXLA 1D4VB 5IVCA 1L7LA 1YLLA 3WUCA 5F5IA 1PO13 1ND3C 1QJY2 3PDQA 2EIGA 4SLIA 4AEDA 1JYTA 4RN5A 2VQ0A 3FX3A 3GM8A 2VUDA 2CNAA 4LO4B 4CDXB 2HBTA 2GMPA 3HT1A 1HN1A 3RI9A 1BZWA 4GAZA 4OHYA 3NJVA 5JOZA 1V6OA 4AW7A 1D7PM 4JRLA 3WHUA 5C4WB 2YB7A 2VTXJ 5ABJB 1VBE2 2DYCA 1W28A 1NLQA 1CWPA 4XUOA 1KQRA 4S2DA 5FP7A 2TEPA 3N36A 5FO7B 2XR4A 3SKJE 3ZIWA 1G9CA 3ZFFA 1QH7A 5C9AA 3VBOC 4Q4Y3 4IL7A 2RM21 3BTZA 4XJAA 2RS53 2JG9A 3JQXA 3K48A 2G9FA 2RJLA 5A6ZA 1UU6A 4E2QA 4AVVA 2RS33 3J9SA 2XG3A 1UOJA 4BHPA 3ZIXA 1VAVA 3BGAA 1MZFA 4OUEA 1PIV3 5FYCA 5HBAA 1PNGA 1H8VA 4UI9L 3KV4A 2WJSA 1DP0A 1ZBA2 3CQOA 2JX9A 1UL9A 4LHLA 1HQNA 1V9U2 4LUMA 1B35B 1RUJ3 1NZCA 4IV3C 3ZFFB 5LY1A 2C5DA 1A34A 1WW7A 2GALA 1ACCA 3N7LA 3NQHA 4ZPIA 3WNLA 1XYOA 4H3WA 3ZSLA 4BB3A 4FTEA 2WO3A 1RUJ1 4V2WA 2CL2A 1XBFA 1H0BA 1V6LA 1XB9A 3AXEA 4WM7C 4LK6A 3KLSA 3VDDB 5IW0A 1VBA3 4RQPB 4YVWB 2R072 2VO5A 3VBHC 3WW3A 2XQRA 1HB1A 3I8TA 2IXCA 3LA3A 4XABA 2YV8A 4MV2A 3FLRA 1OOPA 4Y26A 2JDAA 5A3MA 4Q4X1 1LB2A 2LM3A 2Y6LA 2HEYF 1F15A 2J7MA 5FK7A 3V0AA 4CCEA 4L11A 3VZOA 2EIBA 2WN3A 4CCJA 2X05A 3GZEA 3FLTA 5DAVA 3N7MA 5A7PA 4B4PA 1IGOA 1KFXL 1DQ1A 3T4VA 4FXGB 4RQPA 3ZYGA 4BQWA 5T3NA 1QOTA 1W0PA 2A7AA 5CA6A 4ARXA 3PUAA 3ZFGB 2ZX4A 4XCAA 4JC1A 3U37A 4IV1A 1HB3A 3VBRB 3KF5A 1QNYA 4IGQA 4DRVA 1COV1 1V70A 2VMEA 4AEMA 2EICA 1VBA1 3L2YA 1RJ7A 1DYOA 3T2PA 2K9ZA 5JOYA 1QJZA 4MLOA 1OD5A 4MSVA 4AFAA 2Y8KA 1OKQA 1WMDA 4ZS2A 1JOJA 1ZZ6A 1XE7A 3VD3A 4AXOA 5A3UA 5BYNA 4DMIA 3S30A 1AR82 1QJX1 2ENRA 2WR9A 5J09A 2PLV1 3DYPA 3OGRA 2R043 4D8MA 1PVC3 3ZYIB 1HRV1 5D1IA 4PIXA 1AUYA 4Y1YA 1VB2A 1H8TA 1YIFA 4K8FA 3ZXEA 1CAUA 1HB2A 2E6VA 3VBOB 4CEYA 4F3JA 5FPLA 3ZN5A 2ZHMA 3ZMOA 1WW5A 2E33A 1AX2A 1QGLA 1XRUA 4XFIA 5K8SA 4ISRA 4W65A 1O91A 2VW2A 2W47A 1XE0A 3U75A 3POSA 4M0HA 3NV1A 4QT6A 4S2FA 1ZBA1 4BQ1A 1HRI3 4CDQC 1LESA 2VCMA 1PO23 4JKMA 3WP3A 4FFHA 4XJ9A 5A1LA 4XFAA 1K5MA 1NA1C 1QJX3 3FFZA 5AC91 1UMZA 1CAUB 2JG8C 2Z5WA 4LKSA 4GKYA 5IVEA 2OT7A 4XBQA 1GOHA 2QZ2A 1W8WA 3Q8FA 2FBEA 4JKLA 2QQUA 3ILRA 5FZBA 4Z2AA 5DG2A 1DQ4A 4HXCA 2ZCWA 4LIVA 2RMU3 5T5LA 4W4ZA 2XJUA 1FYUA 3LEIA 5LY2A 1PO11 3H42B 2VPVA 1FV2A 2DCZA 2QQKA 4Q0VA 1EV13 2JENA 4R4ZA 4RQPC 3QOPA 4Q29A 2YMZA 3ACFA 4DY3A 1QJU1 1VPHA 1YUDA 4MHRA 3A21A 1CVNA 3K4DA 4K6BA 4OLLA 4XAEA 3T1MA 2JDMA 4FAHA 2X29A 3WG4A 1GQPA 1IQDC 5FYZA 1Y9QA 4GMP3 1OVSA 4QPGA 1PGL2 1C4RA 1OPMA 2R30A 3RJRA 5EZWA 4BPZA 2A6YA 3WDTA 4DZGA 2O8QA 4XETA 4D7TA 2UURA 1MQTA 2AGSA 1AL0G 2WLQA 5DN2A 1H8TC 2WT2A 4AVSA 2VM9A 2HWE2 4YZ2A 3G6JB 4A7ZA 1J3RA 1SLCA 3NV4A 4WM8C 4UFHA 5CFDB 3KCXA 4HN0A 3LAGA 3MYXA 4XOGA 5GZEA 4OI1A 1ZZBA 3OUIA 4QB2A 4HONA 4AI9A 1VB4A 1LTEA 4TLFA 2F17A 3THPA 1HV1A 4AOCA 2P3YA 1QEXA 4GULA 1UAIA 5IHRA 1JBCA 1OQDA 3T0AA 5CZKA 3MIBA 1ULGA 1VAKA 3VD9A 4IV3B 2XH6A 1OXCA 1LOEA 2XDVA 1VRH2 3VD5A 1SFYA 2A3WA 4L8QA 5DDJ3 5JR7B 5EJZB 2XB6C 2B39A 1Z0HA 1VBD1 2FCTA 2I74A 2CY6A 3KT7A 2WO2A 3BIWE 5DUXA 4WBBA 5FXXA 4AZZA 5FLHA 2NP0A 1VJ2A 2XQXA 1URXA 2HEWF 4HT1T 5FMOL 3VKOA 3H50A 4BQXA 4COZA 5JIUA 1L7RA 4GH4A 4MGQA 1LOGA 1XXNA 3MEPA 3E6DA 4FP2A 3HMYA 5BNPC 4K8RB 4YM3A 4RA0A 3W21A 3S7IA 1OA3A 3MLKA 1NCRC 3JBG1 3ILFA 3F95A 1ZBE3 1CAXA 4D0QA 1DGWX 3GZTB 1ZRRA 4YFWA 3BPSA 2GNDA 2C24A 1FMD1 2WS91 4YW5A 4M01A 3HQUA 1YFYA 2CDOA 1M4WA 1QY4A 2FDGA 4FSJA 1GZWA 3SKVA 4BQ5A 4ZZ8A 1RHI1 3AK0A 2HH9A 3MLJA 2HWD1 2AACA 3O7OA 2PHDA 2WWUA 3OD4A 1LGNA 2G4IA 5CG8A 1JZ5A 4Y4YA 1RITA 2IFRA 3H8RA 1GANA 4N53B 1KJLA 4ORFA 4Q1PA 1WA6X 2WWSA 1WMFA 2HWD3 2VU9A 3I3QA 1ENQA 5A33B 5BNQA 2ZX1A 4MGYE 1D4M3 1W06A 4YW2A 2C9AA 3DPRB 2AENA 4KMQA 4CA9A 4D94A 3AP5A 3KVBA 4BOWA 1CAVB 3PMEA 1GZWB 3OJBA 4GKXA 1A3KA 2VOWA 4XZUG 3RQ0A 3FFQA 3JBG3 4P5YA 4DB5A 4B7EA 1RMU1 1TNFA 1T2XA 1X33A 3J7NA 3ZXJA 1W6QA 3CIHA 1OH4A 2UYAA 4YG6A 1YNAA 5GLVA 1AX0A 4P08A 4X6RB 2QKDA 4YWAA 4MXWA 4JRAA 2AH2A 2TNFA 2XHKA 3K4AA 5FLJA 2R062 2OYZA 5JIAA 4RR3B 4LA3A 4FPLA 4OHZA 3BTYA 4XQ4A 2XVLA 2GC0A 3IBMA 4LO5B 5KHGA 4QB1A 4YG3A 2XJTA 4XFBA 2A5ZA 4QX1A 4DOUA 1BLZA 1QOOA 4CU9A 4EN9B 4G9SB 4RR3C 1CZVA 3CMGA 4OULA 1V6JA 4J1XA 5ACA1 4EWAA 1CQ9A 4BK5A 2VNOA 2RVAA 4KNCA 3R6SA 4AGGA 4META 1OOPC 3HQRA 3TWIA 2IZWA 5F8PA 3C7GA 5C4WA 2CGPA 1ODMA 2DCYA 4RL7A 4XJZA 5T55A 1BHGA 3HQXA 3I7DA 4AE2A 1HRV3 2VXJA 4C0HA 5A80A 1WW6A 3I2IA 4DXZA 4L99A 3AVSA 4I3PA 1A8DA 1C8M3 4H55A 3WCRA 2DVGA 3INAA 4XMIA 3WQ0A 1QJFA 1NE4A 3LGRA 5C6CA 5T50A 1O3TA 2HWB3 3AJYA 3O1PA 4M3CB 4N43A 2XBO2 3POFA 4LHKA 5BXXA 1DHKB 1HJGA 5D21A 5JUVA 5HCHA 2ORXA 4PHZA 2QE3A 4CCMA 5FZLA 5FZFA 4YVSB 4ZU7A 2FDHA 1B35A 2W9XA 4FXKB 2R16A 1POV1 3M3QA 4PCRA 5A6XA 1DGRN 3KGLA 3I2DA 1O4YA 1RINA 3D6EA 3RZGA 3HD8B 5K0UC 5KC5A 2ZEYA 5I93A 3LA7A 3SEEA 4BU2A 2YC2A 2PHLA 4O9GA 5E88A 3ZXAC 2JDNA 4BXSV 1PGL1 1WGPA 1AR91 3WP5A 1NAEA 3RWNA 2OUHA 5KXEA 2X5IC 4QPIC 3PUSA 2OZ6A 5FZCA 5A7SA 1FOD3 4KI5M 3Q8EA 1MEC3 4ZXEA 3S5QA 5F9TA 5FRAA 4XC9A 1HRI1 5A3TA 1SBFA 2R49A 4FPEA 1R1A2 5KXCA 2YBKA 3RZJA 2VZPA 2W68A 3ALQA 4JGZB 1YFWA 1OI6A 3VBFB 4XFHA 5FPUA 3V0AB 2BEOA 3WNNA 1UQXA 2WFF2 1YJLA 4EZ4A 3AP7A 2DCJA 2JDPA 2XHNA 3C7FA 3L9JT 4YG0A 1ZM1A 3ETPA 3DL3A 3J8F3 1W2UA 4Y5Z0 4YW1A 3OSDA 1W2TA 2V4VA 3WY6A 4F7ZA 1AL21 1FNZA 4YNIA 1LR5A 2Q4SA 4B1LA 3DF0A 5EQUA 1LU2A 3P1IA 1ZRFA 4XTPA 4RR3A 1W9TA 4CXWA 3ZYHA 5GLZA 1PK6B 2RS13 3VBRA 5IK7A 3CJXA 2ZJCA 4AWDA 2XVGA 4KH9A 3GZAA 3N7KA 3ZFEB 4YW4A 1JUIA 5FXWA 3EYPA 4NWVA 3K51A 4JGZA 4PF5A 5A32B 4AFMA 5LRSA 1Q8VA 1WWYA 4FPYA 1LEMA 3P5BA 3ACHA 5B4XA 2GP3A 1GUIA 4FQZA 4RHV2 1FT9A 1AR72 4OUMA 4X8NA 3I97A 2UY9A 5FFOC 5FPVA 2P17A 5EJ3A 5DAXA 1H2LA 1R092 2Q30A 5JVVA 4TN7A 3MIEA 4PDWA 1Y9MA 5IJRA 5FYMA 4P9LA 4Z92B 2P4EA 3H8UA 4NRMA 5H9QA 1NA1A 2DVAA 4BQYA 1LOFC 3DPRC 3WHTA 4E4DX 3V65A 4IE5A 2H6BA 3R05A 3W9AA 4CDQA 4F83A 4BIOA 1W6OB 1HLCA 5FXZA 4AHWA 1OT5A 2YZ4A 1RUOA 4NOTA 5FY5A 2ZGPA 3OPTA 1JODA 1CIYA 2VMIA 3LDKA 3PUIA 4N9HA 4OQ8A 3KCYA 3A22A 3L2HA 1W8UA 4KG0A 3AP6A 4MGSA 2WNVC 4LOTA 4CXYA 4PDWB 4EWEA 1LENA 4WM8A 5FMBA 2B42B 1HB4A 3GXUA 1GICA 4Z2WA 2BVVA 3CF6E 2D98A 4BH9A 3A23A 4NHXA 1SFNA 1IG3A 1S0EA 1RYYA 4Z82A 5KXDA 1MVQA 3UJQA 4QPIB 2C1FA 5LW9A 2D5FA 5HXMA 4NE9A 4W50A 2BJSA 4L2NA 4OHXA 1GP4A 5K9YA 1G9AA 1K42A 3LSDA 2G19A 2JG8B 2BU9A 3VHNA 3DGTA 4OCTA 2IXKA 4QQLA 1VBC3 3I2JA 4JGYB 2K46A 4FFIA 4XFFA 4QWNA 1CX1A 5CG9A 2ZBJA 2FCVA 2F6BA 1AF9A 4F8AA 2Q1FA 3AJZA 3M1HA 4JX0A 5JAXA 3I3MA 2XWBB 4EQVA 4QX5A 3DYMA 2N7GA 1NX9A 1QH6A 2QQWA 5CFCC 3VBFA 4NJ4A 5ERLA 1ASJ1 3MDPA 4JTNA 5A3NA 4BCUA 1JHJA 4YW7A 3W5NA 2VE1A 3E6CC 2OQ7A 1MEC1 3FLPA 3KVAA 2ZOEB 3SCGA 1R093 3AFKA 1DF0A 2QFEA 3NNLA 4J1WA 5KHJA 1CONA 4ASMB 1XE8A 1TMF1 1CPNA 4LBLA 2WZR1 2ES3A 3LKJA 4XUTA 4A45A 1I1EA 5C8CA 5T5PA 1EAH3 2BFUL 4K1ZA 2VAUA 3H0OA 4HANA 3H3ZA 1ZA4A 3E5XA 4LULA 4JAAA 5K4LA 4DINB 2IXLA 1TME1 2A3YA 2IFWA 5ABJA 4MYEA 1UX7A 3AMMA 2WL1A 5LEKA 2GMMA 4IQPA 4KQ7A 4M4RA 2ADDA 2WNVA 3N9NA 1CJPA 3BALA 4O61A 1IPJA 3BCWA 4A3XA 4EN0A 2VBBA 2X53S 3AL6A 3SEPA 3H7JA 2P37A 1GQGA 1MPXA 1X82A 1EYBA 1S0IA 4Q4V3 1C8M1 2LUWA 3WP4A 3IN9A 1UIJA 1LNSA 4GD4A 3AC0A 4MG2A 4PT6A 3UKVA 1O3SA 2P1BA 3U11A 1Q56A 1EAH1 1Y4WA 4ZS3A 2VZ1A 2E7AA 3NRUA 2JKBA 3WG3A 1UO9A 4CP0A 3R4UA 3I2FA 3FJSA 4UXAA 5JZGA 1CAXB 1I5ZA 3ZM8A 2VZUA 2AUYA 3WLUA 4AI2A 1RUI3 4XACA 1NYWA 2J22A 4LQRA 2VBDA 3M3IA 4LOSA 4ARYA 5FZ7A 1H9WA 1NOVA 3RMYA 2OXBA 4YGEA 3VKFC 1WZXA 1SZBA 3FC0A 4JGYC 4TXWA 1HN0A 5APAA 2Q8OA 1H2KA 5LCWL 3ZPYA 4IDZA 4GB32 4N53A 4DXTA 2DVDA 4YGBA 4LE4A 4FBFA 2FQPA 1GWMA 4JGYA 3AKSA 4AYUA 5JZGB 4RHV1 4UWDA 1RB8G 3BU7A 1GNYA 1ENXA 4HL0A 3MZHA 4CUAA 3OBRA 5JOWA 4Y24A 1CAVA 3JD73 4CEWA 3LEMA 1ENSA 3HPNA 4G4FA
chains in the Genus database with same CATH topology
5JZGC 4AQSA 3AKQA 4Y20A 3ILNA 2TUNA 4I02A 1QHDA 2E51A 3PVEA 1JH5A 1RUG3 2BWAA 2ZAAA 1AJOA 2ZGTA 5L19A 2X5IA 3B7MA 1HXS2 4D3WA 3AP9A 2GN7A 2B46X 3UK9A 5GZDA 3FMGA 2XJPA 2LTNA 2GSYA 3VHOA 2R1DA 4JTOA 4AQ2A 1WCDJ 1U5ZA 3JU9A 4C1WA 3H1YA 3KB5A 1LHNA 1F5JA 2AREA 1RHI3 3EQEA 1SCSA 1NE6A 1SLAA 2D40A 1IS5A 4I0AA 5CFDC 1HV0A 1H9PA 4HLTA 1YO8A 2RR11 2AR6A 3RZZA 3LOBA 2JG9C 3SLIA 1H8TB 1SACA 2B45X 5FO8B 1H4HA 4EN7B 1N3OA 1S0GA 1UN1A 4HKWA 3PVBB 3OD0A 1ZZCA 4OUSA 2HWC3 3VKMA 2RMU1 2RS11 3JD72 4BMBA 4WV8A 3E97A 4PJYA 1UW8A 4GMP0 4XJ8A 1N1VA 1AR92 1PZ7A 2XLAA 3VBFC 4XTMA 3I54A 1SLTA 3M3CA 1RUC1 2SBAA 3JZVA 1LOCA 2ZS6B 4HN1A 1OLRA 3P3PA 4HVRA 4Y1VA 4IEUA 4YARA 4IV1B 4DS0A 4AQTA 1S2KA 1VLNA 3APBA 5EFUA 4NR1A 2WA4A 1DZQA 4IETA 4AHXA 1RTVA 1JYCA 2EAKA 4QPGB 5FTTC 2ZKNA 3IWZA 3VZLA 3TN93 3ZMNA 4AVCA 2PHUA 4IEVA 2DUOA 5FAXA 5CFCB 2CV6A 3FZ3A 2B5HA 1R083 1YWKA 2UY8A 2R1BA 2D3RA 1D2QA 1O7FA 4FVVA 3M4FA 2HEVF 3CEWA 1RUG2 2XL9A 4MVTA 3RRDA 5H9SA 3TB0A 2GN3A 3GZUC 1HDKA 1RUF2 1UX6A 1OFSA 1H30A 2MPFA 2UU8A 2FMYA 1EY2A 1LCLA 2HWE3 1BBT1 3A0KA 5EXOA 5BNOC 5CFCA 4PDWC 3RS6A 1NLSA 2CGNA 2NLRA 1FATA 4XMAA 1XNDA 1NCRA 4RS5C 3NVCA 2A73B 4I3GA 1REEA 2EXKA 1F9KA 4EWDA 2D3PA 5H9RA 3B01A 3RJ2X 5GLUA 1R082 1ZZ7A 1BVP1 2D5HA 1SEFA 1GKBA 1BCXA 2DU0A 4Q4W1 1TME2 2ZGMA 2R041 2ARXA 1HQWA 2PLV3 3D0SA 1SMVA 2VECA 2ZKLA 4LR4A 4GA9A 3WZ1A 4XHXA 5L7OC 1VBC2 2RM22 5BNNB 5A33A 4L9BA 1RMU3 5KXBA 3SCFA 3O0WA 1BEV3 4LO6B 5T5JA 5L73A 2PAKA 2CWMA 3V56A 2EAAA 4W6YA 3PNAA 1U0AA 4LTAA 1WLWA 2R0HA 3ACLA 5GLWA 1QDOA 3G7DA 4RS5B 2WT1A 3GF6A 1WW4A 2RR13 5J36A 2PYTA 1O3RA 3N4MA 1AL22 5AVPA 1QDCA 1O5UA 1N1TA 2A6XA 2GAUA 3VZJA 4K9SA 2QZ3A 2OUJA 1H1AA 1RUD2 4XILA 4PIYA 4H7MA 3WINE 3TRSB 4XXAA 1O5LA 2MHFA 2XLFA 3POYA 5I91A 1R1A1 2OZJA 3GNEA 3KT1A 3NW4A 1LULA 1RGSA 4HK8A 5EYXA 3MF6A 1G8WA 2HWF1 4B3NA 4UBHA 5FOBB 2HWF2 2LALA 3D5OA 3LB9A 1XYNA 2SLIA 3JD71 1SLBA 4YM0A 4W6WA 2GH8A 2ZGKA 4IEXA 3TAYA 1H2MA 4GB31 4NO4A 3DKWA 1WD4A 3AYEA 3CNAA 5E89A 3H1WA 4DPNA 1YCIA 4FTBA 1VBC1 3AMHA 4XXPA 3ECQA 1DDLA 1DGWA 3JUUA 4QGMA 4RGAA 1Q3EA 2ZACA 4QQOA 3ST7A 5TSWA 1JYIA 5FDBA 2DU1A 5D8AC 1D0GA 1E57A 5DUUA 1VBA2 5JPNB 3QH6A 1RUI1 2EF6A 1RIRA 2VVFA 3PVOA 4CDWC 1VIWB 5JI9A 1Y3TA 4AEJA 4OHWA 3IM0A 1DYPA 5FOJB 3WR0A 1PGW1 4QGNA 2JECA 1MZ5A 1RUE2 4MGIE 4GMP1 2QQPA 1HW5A 2ILMA 2X8KA 3KM5A 1MS4A 3VN4A 2EXHA 3B00A 1SLLA 1Q8PA 4D69A 5DZEA 5DXDA 2DV9A 3J26N 2I45A 3C3VA 4HK9A 4QMAA 3PMSA 1GV9A 4PLOA 2RS52 2NPIA 2HKXA 1RUE3 3M3EA 3VKLA 4RHV3 2PHRA 2VOXA 3U07A 1YFXA 3FUOA 4H7LA 1GLHA 4KWLA 3JB4C 1C5IA 2A6WA 2OW4A 3NAPA 4Y20B 2NZ9A 3O14A 1RC6A 2WT0A 5JI7A 2X5IB 1ENSA 1RUF3 4GIQA 4KBBA 4QM9A 2WNEA 4R9DA 2MEV3 4HVQA 4IEYA 3RDIA 4S2GA 5H9PA 3LSEA 4BIFA 3AP4A 3MI8A 5HCFA 1DZRA 1H4GA 4IERA 1WLDA 2B7YA 1PM7A 1BJQA 1ONAA 1Q8QA 3SH3A 1ZX5A 2HWF3 4HBNA 4COYA 2IWGB 4PIZA 3GHNA 1VR3A 3HN1A 1ALYA 3SHRA 2DFBA 2FZ1A 2G9GA 3P3NA 2ZHNA 3IDEA 1QJY1 2HYKA 2YXSA 5JDBA 5T54A 1ND3B 2ZMKA 1OHFA 2XBO3 2E53A 1D4M2 1N1YA 2HWB2 1V6MA 2EXIA 1WBFA 2WZR2 1PNFA 1J59A 5HXVA 5J98B 2PTMA 1VRH1 2EA7A 4WVMA 1XNKA 5JSRA 2R0FA 4KU8A 1SBDA 1X7NA 1R091 5AVAA 3VBUB 4YFZA 2HWC2 1BEV1 3EBRA 1LHVA 1YRZA 1W6PB 2VMGA 2ZZQA 4Q26A 4E27A 3V64A 2GNMA 5FO9B 1QOSA 4NHMA 1U5XA 2DURA 1AR63 3JCIA 1BMV2 2DCKA 4QHBA 1W6QB 4YSFA 5LEJA 2GH2A 1CGPA 2ZHLA 2XKOA 3RYPA 2DVFA 1AVBA 4ZXKA 1IS3A 1JXNA 1NQDA 2DWRA 1YFUA 3NSTA 2JEMA 3KSCA 2XJQA 4CEWC 1W6OA 3OGJA 2D6PA 2VW0A 3H3UA 3N3HA 1U5IA 4WM7B 4I30A 4XF0A 3SH5A 1DQ5A 3JB8A 3IMNA 1UKRA 4M0NA 4QQHA 3PHMA 2IXHA 1IS6A 3UV9A 3H1MA 2PA7A 3M8LA 4FT8A 4UW5A 4XE9A 5F1RA 2H6CA 2D7FA 1RUD3 1BK1A 1MS3A 4AF9A 4PBOA 1IZ3A 3VLBB 2HWE1 1D4M1 3CJIB 2WFF1 1S0CA 1YYNA 2NN8A 3PJQA 4HZFA 2RR12 2ZGQA 3AX4A 2P34A 3ZSJA 2ET7A 4FPCA 3EO6A 3ZXKA 3U0ZA 4K40A 1DFQA 5DZGA 3GYDA 5J37A 4D7SA 3AYAA 2ZABA 1BEV2 3ETQA 2JDZA 5CVRA 4Q8LA 3CJIA 5GKAC 2EALA 4HKLA 1Z7S1 1GZCA 1C5HA 1MACA 3TN92 3VL8A 3ZXGA 3WG2A 4P9XA 1ULCA 3AMPA 1QKQA 5LK5A 2PLV2 5I0TA 1LECA 1OFNA 3FUQA 2ZMNA 1TME3 4PLNA 4R9CA 3AKPA 4GQ7A 5FPZA 5DDJ2 2NM1A 5IUQA 1UZZA 1VBB3 3KZ4C 1HRI2 1GNZA 4WVZA 1EPZA 1COV2 1VAMA 3WP6A 4Q4V2 5C8CC 4DRRA 2VOKA 1TEIA 1ZYBA 1SBEA 4W6XA 5L7OA 2GDFA 2ZGLA 2PELA 4LA2A 1QQP1 4TSVA 1C8M2 2JE7A 2WNUA 1AR93 3X29B 4FPFA 1N3QA 2BNMA 5DUVA 1LOFA 2BWCA 1HRV2 4YZ3A 4M00A 4JDNA 5FLIA 4XJWA 2R32A 3O12A 4NPRA 4ATFA 4AGVA 4XQWA 1EAH2 2CGOA 1D2SA 2QJVA 1W6MA 1IPKA 2PHFA 1IKPA 3OGGA 4QPYA 5KC6A 1W6NA 1NY72 1AJKA 5K0UB 3RNSA 1CAWA 5E16A 5FREA 3ZYPA 5LK7B 4P9GA 5GALA 2DF7A 3WW2A 2PAMA 3OF1A 2ZHKA 3TBDA 4C1XA 5JSPA 1SCRA 3JBG2 4C90A 3ZO0B 1W6NB 4BWOA 4LLOA 4AI3A 4BYYA 1PO21 3WX5A 3ZN6B 3AYCA 4YVWC 3VBHB 3WT3A 1HKDA 4CEWB 1CX4A 3R0RA 4Q0QA 4BM8A 2HWD2 3NV2A 4N9IA 2JD4A 2PN5A 1I3HA 3WOGA 1LU1A 3MIDA 5CADA 2XVKA 3HBZA 4BLIA 2O0OA 3VZNA 1B35C 3B9CA 3QLQA 4GB33 4R9BA 1EPWA 2BYVE 3AMQA 1KD7A 1REFA 2D6MA 2VQAA 5IK4A 4LHNA 2UWCA 3ROUA 3ATGA 1Q43A 3N35A 3OBTA 2ATFA 1NCQA 2WNUB 2PAEA 5I0SA 3B9IA 2E7TA 3VBSC 4LBQA 2NMOA 1NA1B 1H2NA 3I59A 1RHI2 5C4WC 1CR7A 4I2OA 4COWA 3U4XA 1RL3A 1L3JA 4Y22A 1VBE3 2ZGOA 4KGGA 4HKOA 1HQLA 3WCSA 1J3PA 4EN6B 1HXS3 3MLLA 1DZTA 3WD5A 4GH4C 3SITA 3J8F2 4AQ6A 2MEV2 2R6QA 1F5FA 1MZEA 3FE5A 4XZPA 1OQEA 1ZNPA 2YGMA 1S0JA 5I8TA 1GYKA 1WCSA 5CU1A 2NQYA 1SDWA 1UZYA 1QQP3 1DU3D 4IEPA 4IEQA 2IXJA 2A70A 4WVWA 2CAUA 2VUJA 4KWJA 3ZSEA 4X6QB 1ZBA3 1LGBA 4HFSA 1F31A 4ZU4A 1PIV2 1LOBA 1MS1A 1MS9A 4O9EA 4Q0UA 2RJKA 4LO7A 3RPQA 3AYDA 1J1LA 1MQTC 3O0VA 1CD3G 4XFGA 1WUVA 2WKKA 1ULFA 1MS8A 4IEWA 1CESA 4Q0PA 2RS31 4IEOA 3RYKA 3ZVXA 3OYWA 1RUF1 4LBKA 1AR81 1QJX2 1FAYA 2WQZC 3CJIC 2B9UA 2Q1MA 2WA3A 3DUIA 2YGLA 3R4SA 2Y26A 1XU1A 3WDVA 4OFGA 5BNPA 4K7JA 4AVAA 2D44A 5JSOA 3IKWA 2YDEA 1G9BA 3MICA 3USUB 1QJY3 1PO12 4LBMA 3UJOA 2KM2A 2D97A 3A0NA 4RD7A 1S55A 3CLPA 4AFCA 3WXPA 3CU7A 3NWKA 5CAZA 5K7PA 2OA2A 2R042 4AHZA 1G9FA 1QNWA 4Y22B 5E1RA 1PVXA 4B4RA 2ZGUA 4Q4X2 1Y43B 5HCBA 2PHWA 3S6PA 2XLGA 2QVSB 1GSLA 4CEYC 1IOAA 1DYKA 3M2MA 4QU2A 5I8SA 1AR73 4N90A 1J58A 2A6VA 4C91A 3LA2A 3OTFA 2Z79A 4CDQB 4UW6A 5FPXA 3FBYA 1RUC3 2BUKA 1JUHA 4IEZA 1W0OA 5CNAA 5FCCA 3WVJA 3D82A 1M06G 2RS12 4IXLA 4LBQD 1U5YA 4FAGA 1REDA 1AL23 3A4UA 2FHRA 1LJ7A 4UW4A 4RS5A 4CTEA 4WVVA 4DQAA 3BOWA 2KXLA 3JQWA 3H7YA 2R061 1VBD2 3AXDA 1YXWA 3TNPB 4M3CE 3VZMA 3IPVA 1PIV1 3RYRA 1AYN1 2JXAA 1ZZ9A 5JOXA 5F5QA 1MEC2 5HI0A 2PHTA 2ZPXA 2JG8A 1RMU2 4G3YC 1C28A 4AGRA 4GALA 1ZREA 2RM23 3NV3A 2VVEA 2JICA 3PLQA 4Q1RA 4DY5A 4YZ5A 5BPXA 1UU4A 2W52A 1LGCA 1POV3 2XL7A 5GJ6A 1PMIA 3WDYA 2Z69A 4KGQA 1SLIA 4WZCA 4Q4Y2 2BBVA 3SXWA 2GNBA 2W0XA 4LBNA 5CIRA 2VVDA 4ITCA 1UPSA 3E5QA 2VG9A 2Z2SB 2UYBA 5DG1A 4OI2A 3ZN4A 1A8MA 3EHKA 4MX3A 2BPA2 5DDJ1 1FI2A 2GC1A 1C1LA 2ZGSA 1V00A 1S0BA 5DUWA 1UU5A 5GZGA 5IT6A 2C0ZA 4FOVA 1DBNA 1IS4A 4HPKA 1C1FA 4KU7A 4H14A 4COUA 1MR5A 4P5HA 3ZFFC 4CDUC 1CAWB 1N1SA 3ZYRA 1R1A3 2OPKA 5BNOB 1UF2C 3ZDSA 3M3OA 2GZWA 1GR3A 2CYFA 3B5LB 5FBZA 1KS4A 4EJRA 1I9RA 5AFBA 4C0BA 1AR71 3WG1A 4XW3A 1EV12 2YROA 3ENRA 4K20A 1OLQA 4K21A 3KT4A 4NN0A 4AEDC 2XWJB 1JN2P 2RMU2 5J7MA 3LZZA 1AYM3 1JTZX 2ZX0A 5GM0A 3V0BA 2A3XA 3VHPA 5BUVA 3VBHA 2DFCA 4FOQA 1Z7S3 3RG0A 3ZYJB 3NAPB 4P14A 3KQRA 3ZFGA 1PO22 4MZUA 3VBUA 4MGZE 2H0BA 3LCPA 4D7YA 3VKNA 3S7EA 4CRQA 2D93A 2FMDA 1YHFA 2K0GA 1LODA 4COVA 3KGZA 3BTAA 1R081 1BKZA 1RUH3 1VALA 2VMHA 3BPZA 4XFCA 1FMD3 2WS93 4ASLA 3AZXA 2K2SA 1RUD1 1DG6A 4XF3A 3UL2A 1QF3A 2V09A 1AHSA 1AR83 4Z1VA 2E7QA 3HAGA 3VBOA 2ARBA 3B93A 2BNOA 4B7KA 4AEDB 5ACA2 4N53C 2I07B 2W08A 4BZ4A 2XUMA 1FPN2 3HR9A 5JCTA 1QMJA 3I59B 1BMV1 4E4SA 3IDCB 4OI0A 5JPMB 4AI0A 4E2SA 1PZ9A 4FP3A 2R063 1J3QA 4Q4W2 4YVSA 1ND3A 5C9AB 1XYPA 1BBT3 4ONUA 3QD6A 4BLJA 4XF1A 3URFA 3AZVA 4GH4B 5A3LA 1AR61 1H1MA 4L92A 1J1TA 2PFWA 4I01A 1BXHA 5I8YA 1IHMA 5EWSA 3RMXA 2QDRA 2O8OA 5EYYA 4E9KA 4JCKA 3BOPA 1O3QA 3E5UA 3MIGA 1WD3A 4PBPA 5BNNC 4KL1A 5D8AA 1OMIA 2QUOA 1TMF2 2VOVA 1RUNA 4TZDA 1S1AA 1LEDA 4N43C 1VBE1 4YVWA 1RUJ2 4JDOA 3VUOA 1DGRA 2W39A 1ZBE2 2MNGA 4CYDA 3GALA 1AYN3 1EV11 1JW6A 3ZFEA 3SMHA 3WDWA 4Q0SA 3QCWA 1RUI2 1Q8OA 2D6KA 3CL1A 3POWA 4YLZA 4LE3A 1FPN1 3GBGA 5B2GB 2ZGNA 2UWAA 1PHMA 1RUG1 5L7OB 2RS32 2CAVA 3HT2A 4HMZA 1G6NA 1NCQC 3W58A 1N3PA 2DUPA 1LRHA 1LOAA 2NMNA 4MXWB 3NKTA 1TE1B 3KS7A 4JQRA 4L97A 3WNXA 1W39A 1U12A 3OPZA 1DQ6A 1OA4A 5JLVA 3KMHA 2VH9A 4CDUA 1KJRA 2JG9B 4YRDA 3J8F1 3WV6A 1GNHA 3IT8A 4Y1ZA 5E8AA 1ASJ2 2WLPA 4XHBA 2ET1A 4JDMA 4DFSA 2JJ6A 4ES9A 1RVF3 4R8HA 2YYOA 1X36A 4OHVA 4Q4Y1 4QD2A 5EV7A 1N47A 1Q8SA 2ZX2A 3B94A 1O4ZA 1CPMA 2Y0OA 4QM8A 2D6LX 1S2BA 2WNUC 1NCRB 2GU9A 1AXKA 1GZ9A 2GNTA 3MF9A 2RE9A 3MW3A 5T52A 4HSLA 2D43A 4DNYA 2XJVA 3SCHA 1RUE1 4R9AA 1UKGA 1Q5OA 3HWJA 3MGUA 1S0DA 4U36A 4M3CA 3VDDA 4XF4A 2XBO1 5C8WA 2PQQA 1WA4A 5KHIA 4MGKE 1X8MA 1AXYA 3AZZA 4FOWA 4RSUA 3DPRA 3O0XA 1CN1A 1FXZA 4RFT0 2VW1A 3VL9A 5FMOS 1K5MB 3LWCA 3M7AA 4Q8KA 3QH7A 3O5SA 3KD4A 2P3KA 4Y1UA 4YZ4A 4XF9A 4QPGC 5BNNA 2CTVA 4WVMB 5AC92 2A71A 4Q4X3 1WCKA 1A78A 1NXD1 1OSGA 2VXRA 4XBLA 4EROA 3VZKA 4AEKA 3MW2A 2Y38A 3H9AA 3NJZA 1UD1A 4XYXA 4TYSA 3DN7A 2R073 4Q27A 3T2TA 1WLCA 5KBFA 1YJKA 1PK6C 1RVF2 1NG0A 4AK3A 1PZ8A 4IESA 4XJUA 4YM1A 1ASJ3 1NCQB 1MQTB 4HVOA 4J6GA 1C8NA 4MXVA 5KHHA 3I4IA 2BQPA 3W59A 2YHJA 1V9U3 1GFF2 3R4DB 1QXJA 2WSVA 3VBSB 4CDUB 4K1YA 5GLTA 1NLRA 1ND2C 4LO8A 1X50A 2XGXA 3ELNA 2BNNA 2NYYA 5SV5A 4UBGA 3WW4A 3S0MA 4N7UA 4FTSA 3GBWA 3EJKA 4LBJA 3J4UH 5CB7A 1LHOA 1UPIA 4PLMA 1QXPA 4N43B 3BB6A 2ZTNA 1MS0A 1V6NA 4YYOA 1HIXA 4BE3A 2EVXA 2ZMLA 1AYN2 2ZX3A 3AMNA 1JHNA 1O4TA 4JV4A 1QU0A 2IXIA 1CJDA 2GC2A 1BYHA 2H0VA 1QQP2 2Q5TA 4FO9A 3AB0A 4X8PA 3OY8B 4NHLA 2ETEA 1WBLA 4LUKA 3ZSMA 1DGLA 1TMF3 4CP2A 1YIPA 1RJ8A 2P3IA 2WFF3 3TYJA 1LKNA 4AHYA 1TQ5A 1GBGA 5I0UA 2WINB 4URTA 4YVSC 3EXUA 1ZBE1 1NQJA 5FQ0A 4AFDA 3FWEA 5CBLA 1KFUL 1ULDA 4P9IA 1FOD2 4P9JA 2E9QA 3IDBB 4OVEA 2BFUS 3B3QE 3D4KA 4ZU5A 4FOYA 1OQ1A 1QWRA 4LBQB 4XQDA 1V9U1 3MPPG 4CDXA 4CDWB 3PJYA 1APNA 3QBQA 4Q4W3 5CFDA 1MVEA 5FQ0B 3U10A 3AFGA 5BNPB 1UCXA 4WM7A 2VGDA 4AVBA 1DLLA 1PGSA 4CP1A 5BY5A 2WSUA 3MIFA 4Z8BA 1FPN3 1V6IA 2P2KA 4Z07A 1AZDA 2R071 1VBB1 4IV3A 4YM2A 4FCAA 1DQ2A 2FZ2A