2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
molecule keywords GALECTIN-7
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
1B09A 3A0NA 4XBLA 3FUOA 2DVFA 4YG0A 1UL9A 2ZGRA 3AXDA 3KM5A 5DZGA 4YW3A 1SLBA 3VKFC 4D69A 3I8TA 4P9WA 1QOSA 2WKKA 1FAYA 4FPKA 4PQ9A 2D3RA 4FPGA 1DYPA 1TEIA 5GLVA 1UZZA 3O0WA 4U36A 1VIWB 5DG2A 1C4RA 2DVAA 3N36A 1GKBA 2JE9A 1WD3A 2PHFA 3VKNA 1DFQA 4ASMB 3V0BB 3N3HA 1LODA 2R1DA 3WUCA 1W6PA 2ZACA 3NV2A 2WJSA 4ZXKA 5HCFA 3RMYA 2WNEA 2XG3A 4YZ1A 4P9XA 1S0BA 1LGCA 2AH2A 3V0AB 5CB7A 4ATFA 5GJ6A 1HDKA 2DU0A 4YLZA 2JD4A 1DQ5A 1S1AA 2EXJA 2R0FA 2UWCA 1CJPA 3BOPA 4MYEA 5E89A 1GZWB 4AGRA 2ZGPA 1AXKA 1LHUA 4H55A 4XOGA 1W6NB 2ZGMA 2ZKNA 4JRAA 4AYUA 3JU9A 3FLPA 2GNMA 1CVNA 2VW1A 1RINA 2TEPA 4HL0A 3ASIA 1LTEA 3ILNA 2ARXA 4BLIA 3MW4A 4GKYA 5FRAA 4YM0A 3FBYA 1IS5A 2A7AA 5T5OA 1AXYA 2DUPA 2ZHKA 5F9TA 5JLVA 3FUQA 3WV6A 1JUIA 1J1TA 1Q8SA 3N7MA 4XTMA 1N1TA 1MS0A 4XYXA 4XJAA 5JVVA 4Q8KA 1CIWA 4NOTA 3AZYA 3VKOA 1GYKA 4BMEA 1ULCA 4FQZA 1YYNA 1C57A 1W0OA 2GMPA 4DFSA 4LBQB 4CRQA 4CZSA 3AK0A 1LOFC 3NV3A 2A75A 5L73A 1JBCA 2YMZA 3D6EA 2A6VA 2DYCA 5DG1A 1W6QB 2A3WA 5JOWA 1UZYA 1JYIA 2P37A 2WT2A 5HCAA 1WUVA 3SH5A 1LHVA 2V5YA 2GMEA 4YG3A 2AGSA 1FX5A 3AP9A 3NV1A 2W39A 2AR6A 2EIGA 1WBFA 2A6WA 1LGBA 1Z0HA 1LHOA 2HYKA 3RG0A 2YROA 3WG3A 1LOFA 2GN7A 1G8WA 1CQ9A 3VKLA 2WLQA 3D4KA 4PBPA 1IS4A 4R9AA 1LOEA 1SLCA 2P34A 2R1BA 1URXA 5GALA 3RQ0A 2ZGQA 4XJUA 3WDVA 3OY8B 1FNZA 1KJLA 3O5SA 2EXKA 3WLUA 3ZYRA 1A78A 1WLWA 2JDZA 4R9BA 4XMIA 5T54A 1Q8PA 3AX4A 1JYCA 1MR5A 1RITA 2WT1A 4WV8A 5T5JA 1A3KA 3ZXKA 4YFWA 1JW6A 2EXHA 2DVDA 1BKZA 5DZEA 5IK4A 4GKXA 5KXEA 1WBLA 2ZBJA 1AX2A 2WT0A 4Q26A 1LEDA 4UW6A 4L8QA 5GM0A 3RRDA 3UL2A 3PMEA 4AVVA 2UWAA 3V0BA 1LCLA 1W6PB 4FPYA 2A5ZA 3ZXLA 5LK5A 2AENA 3WDWA 1W6OA 2B7YA 2DVBA 3POWA 3ZVXA 1UX6A 4Y22B 1YO8A 4PCRA 2GNBA 1DQ1A 1UAIA 3AJYA 3ENRA 2R49A 4XHBA 1V6LA 3UJOA 1N3QA 3LSEA 4XJ9A 3SISA 3VV1A 2D6PA 3I4IA 4XXAA 1SLAA 1WW6A 4YFZA 3AFKA 2RHPA 1ULEA 1SLLA 4PF5A 3WDTA 3HR9A 1F31A 4DRRA 1W0PA 4AVSA 1GNHA 1DQ0A 1WLCA 1ZA4A 1WW7A 1VAVA 4LBKA 2E6VA 3WG4A 3OBRA 3T1MA 3WDXA 5IK8A 2OUHA 2FHRA 1AX1A 3WCSA 1ULDA 4YM1A 1LHWA 1CR7A 1VLNA 4FPCA 1ENQA 1ONAA 1MS1A 3M3EA 1GICA 2H0BA 2A3YA 5T52A 1LECA 1AJOA 1KQRA 1LOCA 3AYDA 4HANA 4M01A 3O0VA 2AREA 1N1VA 4LBQA 4P14A 4FOYA 3WOGA 2JE7A 1LOAA 1QNWA 1VALA 5KXBA 1UPSA 1MS3A 5HCBA 1GLHA 3AZVA 3CNAA 3Q9OA 4K21A 4Q27A 3INAA 2SBAA 3IMNA 2JKBA 4GA9A 3AZWA 4XIKA 5T55A 1DZQA 1QU0A 2GDFA 3O0XA 5DZFA 3SH3A 1G9AA 4XMAA 2DU1A 2A6XA 1Y7BA 1W6MA 2P2KA 1AJKA 1GBGA 4Q1RA 1PZ9A 2R16A 1V6OA 3HN1A 4XJ8A 5GLTA 3ZSMA 3AXEA 4FP2A 4M3CA 4DQAA 4Z8BA 1O4ZA 1ENSA 1MZ6A 1WLDA 2ZMLA 4Y24A 5E8AA 2NM1A 3B00A 3M2MA 3WVJA 5CBLA 2A6YA 1GZ9A 2PHWA 1S0DA 1SLTA 1LOGA 2PHXA 1CPMA 1R1ZA 4FOVA 1N47A 4DRVA 1HQWA 1BZWA 2SLIA 3AYAA 3W59A 4YM3A 2W08A 1ZM1A 5GLUA 1GV9A 3WCRA 4JC1A 3DUIA 3PVNA 1QGLA 1SLIA 5JOZA 3MW2A 3BODA 2EAKA 2PHUA 4F83A 1LULA 3SH4A 5H9RA 4FOQA 4BMBA 2JECA 2D3SA 1PZ7A 1MS8A 3IPVB 2WSVA 3TB0A 3ILFA 2DTYA 2C5DA 4K1ZA 3WDYA 2D6OX 2ZHLA 2E7QA 1DBNA 4Q8LA 2VXRA 3JUUA 3VUOA 3FFZA 4XIOA 3OPZA 1GSLA 2ZMNA 1MACA 2EALA 2GMMA 5SV8A 3V0AA 1BQPA 2ARBA 2GALA 2KM2A 4YGEA 1Q8OA 1H9WA 1MVQA 4Y20A 3SLIA 1N1YA 3AYCA 2YXSA 1IKQA 2CTVA 1QOTA 3M3CA 3QLQA 1NLSA 3SITA 2OVUA 2BQPA 2DUQA 4YW2A 1LGNA 2CWSA 4FPEA 4Y1XA 4P9YA 4XDQA 4BPZA 3R4UA 1Q8VA 2DWRA 4YGDA 2Q5TA 3MPPG 4FQ4A 4RL7A 1JN2P 1G7YA 1S0CA 3LCPA 4XXPA 4I30A 1RIRA 3SNMA 2A71A 4XZPA 4UW5A 3NV4A 3OJBA 2W68A 1G9FA 4CTEA 1UKGA 4YM2A 3N7LA 3M3QA 2NN8A 5GLWA 3ZXEA 3UJQA 1LHNA 3O12A 3AP5A 4GXLA 3ATGA 3U4XA 4XBQA 1FV2A 5BYNA 3M1HA 3OYWA 1JXNA 4UW4A 5CA6A 2LALA 1SBEA 3PVOA 4BM8A 4Y22A 3WHTA 4LBOA 4XJZA 1QOOA 3L2YA 4Y1YA 1YXWA 4XHXA 4YW4A 1V6MA 4BLJA 1WW4A 4YZ4A 2CL2A 3A0KA 3B01A 4YW5A 1CESA 1SCSA 5GZDA 1PZ8A 1C1LA 3OBTA 1D0HA 4Y1UA 1LESA 1IKPA 1W6MB 1DGLA 4LBMA 4WVWA 4IQPA 4YGBA 2ZHMA 3V64A 2ERFA 1KITA 4JCKA 4LBQD 1LJ7A 2ZMKA 3WG1A 3AZZA 2D44A 3ILRA 2CY6A 2AYHA 5GZGA 3R4SA 4R9DA 3AZXA 1ULFA 3ZXFA 1WW5A 4DPNA 1O4YA 1V6KA 1X50A 2NZ9A 2DV9A 3N35A 3USUB 3RSJA 1HLCA 4YGCA 1DQ6A 1LENA 2UU8A 1CONA 1H9PA 3A4UA 1QDOA 4AWDA 1AX0A 3C2UA 1GNZA 4M3CF 5GLZA 3WNXA 3WZ1A 3OY8A 1DQ2A 2V73A 3ZYPA 1S0FA 3MW3A 5CAZA 5T50A 2G4IA 5EYYA 3TAYA 1LU2A 2WSUA 1G9DA 1WD4A 1DHKB 3AP7A 4ISRA 2AUYA 5DXDA 3VKMA 3ZSJA 1OKQA 1YRZA 4Q2FA 3ZSKA 4NO4A 2D6MA 5IT6A 5H9SA 2EXIA 2ZZJA 3RMXA 3POYA 4XE9A 3R05A 2D6LX 1N1SA 2P3IA 5E88A 4KBBA 2OW4A 1HKDA 4GWMA 4Y20B 1IS3A 1HQLA 4W65A 1MS5A 3FLRA 4BOWA 4Q1PA 4K1YA 4FPFA 1JHNA 4ZKTB 5GZEA 1G9CA 1Z78A 4M3CE 5H9PA 4YZ3A 4BQ1A 2NYYA 4WVVA 3ZSLA 1ENRA 2ZGUA 2Z42A 2UWBA 4GALA 2ZGOA 5DUUA 1I3HA 1V00A 2PHTA 4FVVA 4XTPA 1GANA 1V6NA 4TYSA 3ZXJA 3KQRA 1A8DA 1FATA 5CNAA 4K20A 3M3OA 1YIFA 1W6NA 2A6ZA 3FLTA 4YW1A 4ITCA 5T5PA 4PBOA 1AVBA 4FPOB 5DUXA 3GALA 3PJQA 3AP6A 4LBJA 5DUWA 1BYHA 5DUVA 5IUQA 3AP4A 5GZFA 1DQ4A 2ZGKA 1APNA 3MEPA 5EXOA 5FREA 2ZA9A 1SBFA 3T1LA 1Q8QA 1OQ1A 3AJZA 3B69A 3LSDA 3OGGA 1H30A 5F5QA 5JOXA 2OUJA 4TZDA 2ZGNA 1U0AA 1KRIA 3GNEA 4C1WA 2PELA 3N7KA 1W6OB 2DUOA 1EPWA 1AXZA 2E53A 2CWMA 4Y1ZA 2A70A 2D43A 1UMZA 1CN1A 1C1FA 1IS6A 1QKQA 1N3PA 1S0EA 1XQNA 2UURA 3HMYA 3WG2A 2WQZC 4FPHA 2D6KA 3D5OA 1BJQA 4AVTA 1SFYA 4OZXA 2GNTA 1W6QA 1N3OA 1QF3A 3ZPYA 3V65A 2YZ4A 1G9BA 3N7JA 5JMCA 2ZGLA 4FPJA 1GZWA 2CYFA 1CPNA 4LBLA 2PHRA 3UK9A 5IK5A 2EF6A 1IOAA 1BXHA 4WZFA 4XILA 5H9QA 4M00A 5AVAA 1LEMA 2NMOA 2YV8A 4FPLA 1SCRA 2D7FA 5EWSA 1AF9A 1V6IA 1VAMA 1KDKA 2ENRA 2VW0A 1MVEA 1MS4A 3OYWB 2VH9A 3DGTA 4Y26A 4YG6A 1YI7A 4AGGA 1F5FA 1JOJA 2DVGA 3T2TA 5KXDA 1NXD1 2P3JA 1UN1A 2ZHNA 2VY0A 3BTAA 4U2AA 1DLLA 1QMJA 2R0HA 4Y1VA 1DYKA 1SACA 2LTNA 4R9CA 5KXCA 2I2SA 2ZGSA 3B3QE 1AZDA 4FP3A 2E7TA 1S0IA 3IPVA 1D2SA 1V6JA 5GZCA 5JDBA 2VU9A 3NWKA 4RA0A 1DIWA 2D6NA 4FOWA 4XBNA 5JOYA 1Q56A 3IN9A 3WUDA 3H0OA 4GWNA 1QNYA 5EYXA 4LBNA 2ZAAA 1SBDA 3AYEA 2GN3A 1S0GA 1G86A 2DTWA 2XB6C 4SLIA 3QCWA 4YZ2A 3IM0A 2VW2A 1KJRA 2NP0A 1S0JA 2W52A 2YY1A 3BIWE 2D3PA 1OFSA 1I1EA 3APBA 3RS6A 1FNYA 2JJ6A 2A3XA 3W58A 1QDCA 2FMDA 3IKWA 3USUA 4ATEA 1FYUA 2ZGTA 1FV3A 3WDUA 2ES3A 4YZ5A 4AGVA 2CNAA 4UW3A 1ULGA 2ZABA 2NMNA 4M3CB 3POSA 5T5LA 4DS0A 5IK7A 4XJWA 4C1XA 3PVEA 2GNDA 1F9KA 3B9CA 3WHUA 2C9AA 2DURA 1LOBA 1GZCA 1KDMA 2E51A 2P3KA 4ISQA 2VUAA 1MS9A 1MZ5A 1LU1A 1WCSA
chains in the Genus database with same CATH superfamily
2VZSA 2V4VA 3AXDA 1ZX5A 3NSTA 2EAAA 3BN6A 4L99A 1SLBA 2RV9A 1UZWA 4QPWA 4XF9A 2BOJA 5FO9B 2WN2A 1LNSA 1DYPA 5LBCA 4P9IA 4LNVA 4QX2A 3MIBA 4E27A 3EO6A 4J1XA 3MIDA 5IVBA 1VIWB 2CGPA 2FDFA 4CDQA 4EQVA 1NYWA 3C7OA 2ILMA 5FO7B 2YB7A 3WNLA 1DFQA 4NHLA 4MO3M 3MI8A 3N3HA 4UFIA 1H8TC 2ETEA 2Y6KA 1PO11 3WUCA 4XETA 3KQ4B 2VQ0A 4UBHA 1SFPA 5HXVA 3RMYA 2WNEA 4NRPA 1PMJX 5F5IA 2XG3A 4B4PA 1ZREA 3LD8A 3I2FA 4MOAA 4L11A 3WQBA 2N7GA 5BY5A 4JGZC 1JYVA 4MHRA 2BNMA 4M4RA 1UYPA 2DU0A 1Y9GA 2OX0A 2BRTA 5F2WA 2CSGA 3E5QA 2XWJB 3BOPA 3VZOA 1VRBA 3T2QA 1HXS1 4DO0A 1M06G 4XOGA 1AXKA 4B1MA 5C5UA 1W6NB 4OUMA 4JV4A 4CCLA 3LFMA 3TYJA 2B9VA 3JU9A 3FLPA 2VW1A 4AEKA 4Z2WA 4HL0A 1PX3A 1AR81 2TBVA 1LTEA 3B93A 2ARXA 5LK7B 5FZAA 1WMXA 3AM2A 3RJ2X 5A7WA 1STMA 1OMIA 2E32A 3CZUA 2ZHKA 5JLVA 1OLRA 1RYYA 2LROA 1AYM3 3ZDVA 1R1A3 1MEC3 2VZQA 1ZZ7A 1JUIA 1J1TA 2X5IC 3N7MA 5BNOB 5FIXA 5JVVA 1CIWA 3AZYA 3LGRA 1QJY1 1W28A 2Z5WA 4LJHA 4LKDA 4FQZA 1YYNA 4A6SA 1C57A 4IGOA 4YVSA 5EQUA 4TXWA 3AK0A 4FT8A 4Q4Y3 3AMQA 1LB2A 2XVGA 2A75A 3KF3A 4JX0A 3D6EA 4OCTA 2A6VA 5JOWA 2XJPA 1UZYA 1JYIA 2ZJCA 1AL22 4D0QA 3P3PA 5HCAA 2ZX2A 1CD3G 4M0HA 3WP6A 2O8QA 1VMHA 5APAA 4K6BA 3NV1A 3VBSC 3CBNA 2PA7A 1H6YA 2Y0IA 1RJ7A 5C70A 2PAEA 2BYVE 3I59B 1WMFA 3VKLA 2BW8A 2ID4A 2W46A 1FOD2 4PQQA 2ZEXA 4WZCA 1HRI2 3A22A 1EV13 3I3QA 1RUE3 5GALA 2ZGQA 4IEUA 4OHWA 3WLUA 3ZYRA 4YW6A 3RYKA 4MGTA 1W3VA 3AX4A 2GC2A 3RJRA 2C6SA 4Z92B 4KWUA 4LHSA 4QPGA 5T5JA 5C7GA 5HI0A 2QQWA 3JBG1 4KQ7A 2WFF3 2VZUA 3DEMA 2XKPA 4GKXA 1ZBA1 4AQTA 5KXEA 2VTXJ 1RUF2 2RJLA 4RGAA 4Q26A 1LEDA 5GM0A 4AVVA 4E9KA 3M7AA 1C5HA 2Y60A 2QQPA 4HN1A 2Z4FA 3L9JT 4LK6A 4RHV3 2A5ZA 2VXJA 5FMDA 3H8XA 2HWB3 4XFBA 2OYZA 1UIKA 3IIIA 2WYFA 4QDQA 4Y22B 1YO8A 2QBXA 4JGYA 3CQOA 3ENRA 3DKWA 3DN7A 2BBAA 2J1EA 2A1XA 3UJOA 5F7UA 2E63A 3BYWA 1OF4A 1YJLA 4OULA 2D6PA 2ZKLA 4XXAA 3X29B 3AFKA 1GWLA 1VBC3 4QX0A 2WN3A 3U11A 1J3RA 5IAVA 4AFDA 4OYUA 5FWEA 1EAH2 3GYDA 3JD72 4WBBA 1IPSA 3U10A 1OOPB 3LDBA 3OCPA 3WG4A 1JTZX 3WDXA 3PMSA 2VNGA 5FZMA 1HB2A 2OUHA 2FHRA 2WBKA 5A32A 4YM1A 1LHWA 1NCQA 4Z2AA 4NRQA 2CAUA 3CEWA 4E2QA 2X5IA 1QJU3 4ASLA 3DPRB 4L9BA 3JBG2 4CDWC 4HANA 4M01A 4YW7A 1RXFA 2JIGA 2AEYA 4Q0VA 1N1VA 4FOYA 4NVPA 1UU5A 5IFPA 1LOAA 3P6BA 4HKWA 1TMF3 1UPSA 1MS3A 2PHDA 2ZS6B 3AZVA 5HCBA 4XC9A 1DU3D 4Q27A 3RPQA 3ZN6B 2XDVA 2JKBA 4GA9A 3C7EA 5FLJA 1XU2A 1POV0 2QNKA 2VUCA 3AZWA 3DXTA 3EJKA 2KR2A 3QOPA 4XIKA 3O0XA 3SH3A 4AE2A 5AFBA 3VBOB 2XR4A 1Z7S1 5KC5A 4EYUA 4MG2A 2UY8A 2ZX0A 2YUEA 5L7OC 3S0MA 1SG3A 2P2KA 2D5HA 3JQXA 2QQVA 5I8TA 1EYBA 3TEXA 4EZ4A 4A45A 3ZSMA 4FP2A 4PF1A 3ZXGA 4MHUA 2HWE2 1JUHA 5FZOB 2ZMLA 2RMU3 2EIEA 2NM1A 1XU1A 3JCIA 4Q4X3 5CBLA 2VR4A 1R1A2 2DCJA 3E6DA 3T3YA 4AI2A 5FMBA 1LOGA 2P3YA 1MQTB 1ND2C 2VOVA 4KI5M 3AMPA 1N47A 1GFF2 2FQPA 4QPGC 4MGSA 1BZWA 1YFYA 2SLIA 4YM3A 1LR5A 5GLUA 4CP2A 3WCRA 4OUSA 2VUJA 4D6RA 1OXCA 3MW2A 4LHLA 1WA6X 3TN92 1LULA 4BMBA 4DIQA 3T4HB 4BK5A 2QQMA 5FY0A 1W04A 2QDRA 2DTYA 3OB8A 3DYMA 2W9XA 2JG8C 3D8CA 3LEKA 4Q8LA 1OBNA 2VXRA 3JUUA 5CVRA 5A3OA 5CFCB 3HQRA 2VMIA 5KBFA 3VUOA 5FYVA 1TME1 4XIOA 4N53C 1F4AA 2EALA 5A3WA 2GMMA 1PVC3 2ARBA 3BPSA 1Y3TA 2VNOA 3CO2A 2TNFA 1YQ8A 3FBMA 2FBEA 4IW3A 2QZ2A 2WZPP 1MVQA 1J58A 3SLIA 3H8OA 1HRI3 2WNUC 4PHZA 1YFUA 1HRV3 1QOTA 4XAAA 3ROUA 1NY72 5C4WC 2C24A 3RZJA 2CWSA 2VC9A 2ZEWA 3ACIA 3DYPA 1D4M3 4BPZA 3KMHA 3R4UA 2DWRA 4LO8A 2WZEA 1G7YA 4CCOA 3GCXA 4XFGA 3RWNA 3V56A 3UYJA 4G4FA 5A80A 4CXYA 2WA3A 4OMDA 5FYSA 5I91A 1IHMA 2YHJA 3NV4A 1V9U2 3OPTA 2W68A 2HLEA 5FPXA 2RVAA 1O7FA 1G9FA 4I0WB 3HIFA 4LUMA 1UKGA 2VMHA 3N7LA 2K9ZA 2BEOA 4QKBA 5GLWA 3IWZA 3ES1A 1V9U1 4N7IA 2R7EB 3O12A 3ZFEB 4GXLA 5C3SA 1X8MA 4XBQA 4F8AA 2WO1A 1PO22 4NAOA 4TTGA 3RNSA 1OQDA 2HWB2 4B1LA 4QKDA 3THPA 1SBEA 3I2KA 1RJ8A 4XJZA 3RYRA 2HJIA 3L2YA 2E9QA 4QAWA 4Y1YA 2Y0OA 4IV3A 5K0UC 3E1F1 4XHXA 1CZSA 1UU4A 3KCCA 3EHKA 1QJX3 1HRV1 2IWGB 3B01A 1QJY2 1SCSA 1C1LA 1D0HA 1VP6A 3BTYA 5FXVA 1IGOA 4IV1A 3ZFGB 4AFMA 2JX9A 4LBMA 1UOFA 3V64A 1PVC1 4LBQD 4JCKA 2QJVA 5FPLA 2ZMKA 3VDDA 3KV9A 5CIRA 2D44A 3ILRA 5FUIA 4UFJA 5GZGA 2ZPXA 4JTNA 5FY4A 3JXSA 5JZGA 1HV0A 4IEPA 4LA2A 2K2SA 4QX1A 2ADEA 2Q1FA 4Y3OA 1V6KA 3VHRA 3USUB 2J1VA 3PUIA 4YGCA 1VBA3 4QHZA 3H7YA 2XGXA 3I3EA 3A4UA 4AI1A 3FWEA 5A7SA 1RUD3 3WY6A 2BU9A 3JB4C 4M3CF 5ISLA 3W9AA 2J42A 4YNIA 5FZ3A 5JUVA 3S5QA 2Y38A 5ANNA 2R062 3OY8A 1DQ2A 4OUEA 4RGKA 1XSQA 3U1XA 5LZ6A 5BNOA 2GP5A 3DPRC 4B4QA 3TAYA 3KGLA 2XUEA 4ZU4A 2WSUA 5C6CA 4XQ4A 3HD8B 1UMHA 1WD4A 4ISRA 3GZAA 4LTAA 1J84A 5FK8A 1L7LA 3SKVA 4NPMA 4QXKA 3ZSKA 2XONA 4QQ2A 4YVSB 3WF1A 1AR93 4B7EA 2X09A 5CZKA 2GSYA 1TME2 3NMBA 1JZ4A 2YPJA 4FI9A 1UYXA 3BB6A 3K4ZA 3RMXA 2VCMA 2B8MA 4QDRA 1N1SA 1R083 5E88A 3U14A 1PM7A 1HKDA 5A3PA 1RHI1 3FLRA 4C8DA 1W2UA 1ZZCA 4K1YA 4Q1PA 5BNOC 4GH4A 1QQP1 4ZKTB 5GZEA 3VBUB 1UCXA 2O0OA 2XL9A 3MFCA 1VB4A 1OA4A 4N53B 4X8PA 3AKSA 3PDQA 4GB31 2XLGA 4NPLA 1RUD1 3ZXJA 3VLBB 1A8DA 2FD8A 3WW2A 2WNUB 4KG0A 3N9PA 4QPIA 2C9KA 4Q4W3 1RXGA 4ZS2A 5FUNA 4A41A 3K2OA 4XUNA 5T5PA 4DEQA 1RUC2 1AR62 4QPGB 4W4ZA 2H6BA 1FMD1 3PJQA 1RUG2 5DUWA 2ARAA 4P9JA 1BYHA 1PGSA 2RS12 5DUVA 5K9YA 1DQ4A 3RVHA 5D1IA 1APNA 1KS4A 3MLKA 2X8KA 1W99A 3MO4A 1S2EA 1PVC2 4TZDA 1RUI2 1Z7S2 4H2AA 1ZRDA 4V1PA 4O7XA 1RMU2 5A3NA 3EBRA 4FFIA 1NA1A 1EPWA 1A34A 3ST7A 1VBE2 2CWMA 3PU8A 4Y1ZA 4OI2A 3RFRA 3OOXA 4D6SA 3HN3A 4Q4V2 1HRV2 1DF0A 1QKQA 2HWC1 2P1BA 4IE4A 3RZZA 1N3PA 5IVEA 1XQNA 4Q0QA 3WG2A 2WQZC 2D6KA 3MDPA 1BJQA 4OZXA 1BVP1 2WA4A 2Y26A 2OZJA 1N3OA 4HK8A 3WNNA 4CCNA 2YFZA 5JIAA 3F2ZA 1GZWA 5IK5A 4LBLA 4CCCA 1K5MB 1BXHA 1GQPA 4XILA 4RSUA 5AC93 4NPRA 1TVGA 2QZ3A 1SPPA 3GM8A 1SCRA 3WNPA 4KL1A 1PGW1 2XJTA 5JIUA 4OHZA 2ENRA 2XLAA 2IFWA 1MVEA 1MS4A 3U0ZA 1FOD3 3VHPA 5CKQA 4NAMA 4Y26A 5BNPA 4YG6A 3T2OA 4KH9A 4D7YA 4AGGA 3KV6A 1JOJA 2DVGA 1UN1A 1S4CA 3BTAA 1NCQB 2VVDA 4QKNA 5CKNA 1OT5A 4KNCA 1DYKA 3KCYA 1YFXA 3NJVA 1ZZ9A 3PJYA 4XACA 4JDMA 1T2XA 2ZGSA 4OZOA 2E7TA 1V6JA 4BU2A 4META 4XQDA 4HN0A 3NWKA 5BUVA 2PMWB 5A3TA 3RGBA 4XBNA 4JHZA 2Y33A 5FYCA 3O1MA 1V0AA 1GZTA 5EYXA 2JD9A 1A6CA 2DTWA 3I2DA 2Y6LA 4IEVA 4SLIA 4QHOA 3ZIXA 2VW2A 2W92A 5F37A 5E1RA 4M0NA 3NKTA 4Y5TA 5FJKA 2JB8A 5T3NA 1I1EA 5I93A 2GZWA 5CISA 1W2OA 3J26N 1JZ3A 3WF4A 1SZBA 1X9PA 2VD7A 4XFHA 5BNNB 2CDOA 5LBBA 4AFBA 5KHKA 2RDRA 4AGVA 4MUVA 1RUOA 1VRH2 2NMNA 1C8M2 1NZCA 1PX4A 4LKFA 2ZXQA 2VVFA 1BLZA 3PVEA 2TUNA 3BTXA 1F9KA 1FT9A 1J3QA 3WHUA 2C9AA 1NQJA 1LOBA 4RD7A 1GZCA 1ND3A 2Q1ZB 1V70A 2FZ1A 1RMU1 2VNRA 3CJXA 4ISQA 5FQ0B 3WDWA 4BK4A 3RSJA 2E26A 4RS5C 1UL9A 1EAH3 3KM5A 5FAXA 3VKFC 3ZYJB 3I8TA 4D69A 1QOSA 5L9VA 1CAUA 2W94A 1FOD1 3B5LB 4PQ9A 3VBHA 4FPGA 2RS11 3KHBA 5GLVA 1UZZA 3O0WA 4Z07A 5DG2A 4NIAA 2PHFA 5FPAA 3VKNA 1AL0G 1Q43A 4XFFA 1W6PA 1XC6A 2ET7A 4NUBA 5CFDA 1US2A 1BMV1 4ZXKA 5F5AA 1SDWA 1WCUA 3WF0A 4P9XA 1S0BA 5FYHA 5CB7A 5GJ6A 2W3JA 4ATFA 5LWBA 3M3IA 2WABA 2CGNA 1S1AA 1ZYBA 1OSGA 2BWAA 4N90A 3VGIA 1CJPA 5A3MA 3ZN5A 5DMYA 2G9GA 1C28A 4AGRA 4O9GA 2JXAA 2LS6A 1H1MA 2ZGPA 4FO9A 4RQPA 4BA6A 4H7MA 1U5YA 5J3UA 3IT8A 5IFTA 1F5JA 2JG8A 4H7LA 4I3GA 4N43B 1B35B 4JRAA 5EJZB 2TEPA 1ZA7A 2VO5A 2O1QA 4ZONA 5EHDA 5FTTC 1SMVA 5C3QA 5FZ0A 1VBD2 4BLIA 5KWRA 3VDBA 4GKYA 3NJYA 5IWFA 3BPZA 1IS5A 1KS5A 5IVJA 4IGPA 2R073 2CHHA 5D8AB 4WM7A 3O1UA 3KVAA 4R52A 4A6OA 4TWTA 1PGL2 3WV6A 1BK0A 2BDRA 3VHNA 3I54A 1IZ3A 4XTMA 1N1TA 5LB6A 4XJAA 1OI6A 1VPHA 2LRPA 2V72A 4OLLA 4Q8KA 4NOTA 5FKCA 2WS91 4HONA 2PLV3 4OHYA 4QM9A 2XH6A 4Q0UA 1GYKA 2F6BA 4GB33 2HBUA 3AC0A 4LBQB 1CIYA 4OHVA 4Q4V3 3E6BA 4IV3B 4WM8C 5FZFA 4FXGB 3THCA 3VZMA 1W8ZA 1W9FA 3TBDA 2H6CA 1JBCA 3NJXA 2W91A 5C33A 3I2OA 2CAVA 2WT2A 5FMCA 5KHHA 4BYYA 5A6QA 4CP1A 5I0DA 3SH5A 1RC6A 2I07B 5K4LA 4MXWB 5FUPA 4RHV1 4UYBA 3GJAA 4FBFA 4DINB 1O59A 4QGMA 2W39A 4XCBA 1NCQC 4XZUG 1WBFA 4J6GA 1ODMA 4NHXA 3GCWA 4PIZA 2YROA 3PU3A 2J1AA 1LOFA 4IV3C 5EFUA 5JZGB 3H50A 4DB5A 2WFF1 1MPXA 3D4KA 4PBPA 1IS4A 1JYTA 1CWPA 4CSWA 4R9AA 1HIXA 4W6WA 1LOEA 1SLCA 2FCTA 2RJKA 2P34A 2R1BA 3IB3A 4GWIA 2JDNA 4BDVB 4D7SA 4NIDA 4CUCA 2UYAA 1KJLA 2E33A 5EJ1B 1H2NA 1A78A 1WLWA 4R9BA 4XMIA 5T54A 4A44A 1POQA 1Q8PA 4WV8A 1JYCA 5CU1A 1RITA 2WT1A 1EV11 4RS5A 2PAMA 5JR7B 2VOTA 2QQLA 2QQKA 4Y33A 3VDDC 1JW6A 3ZXKA 4BHPA 2Y6GA 4PDWA 2J22A 5LA2A 3VBHC 3VD3A 4DUXA 5IK4A 3ME2A 4HT1T 4A2UA 4B8EA 1RUH1 4JAAA 1JODA 4UW6A 3RRDA 3SKJE 3UL2A 2MEV2 2UWAA 2VTXA 1UOGA 4CPBD 4H14A 4IEZA 5A3LA 1QJZA 4LIUA 3Q8BA 5LK5A 4XCAA 1WMEA 2YPDA 3FE5A 5JI9A 1NE4A 4Y4RA 4C90A 2HKXA 3I2IA 1VBB1 1D4VB 1UAIA 3G6JB 1DGRN 4ARXA 4XHBA 4C91A 5DAVA 1V6LA 3I2GA 1JMUB 2VBDA 4JDNA 2CV6A 4COZA 5F3IA 4YWAA 3VV1A 1BBT1 1QJY3 3I4IA 3ZM8A 1F2NA 1QXPA 3ZMNA 3PNAA 1ULEA 3LE0A 2OPWA 1F31A 2WR9A 4COUA 1MEC1 4AVSA 4XUOA 5GKAC 1WLCA 2VULA 3D82A 1ZA4A 3E5UA 3QH7A 1VAVA 4LBKA 3MUY1 2E6VA 2VL4A 3NL1A 1IG3A 3OBRA 3DCQA 5IK8A 3KHCA 4CDQB 1AR82 1UXZA 2OXBA 3WCSA 4E4SA 5J7MA 2XHKA 1CR7A 4FPCA 5FBJA 1ONAA 1H0BA 1ZBA2 3MLLA 4EV0A 5KHJA 1GICA 1Q5OA 2B39A 2V09A 3LKJA 4A3XA 1K3IA 1RTVA 2Y64A 4IE5A 1AJOA 3AYDA 5T52A 5L19A 1O5LA 1ASJ1 2W47A 1XNTA 1HXS2 3WXPA 2AREA 2YGMA 1D4M1 4P14A 3WOGA 4DXRA 5FZ4A 4P9LA 1W9WA 2RS31 4R4ZA 4AHYA 3INAA 2SBAA 3W5NA 1HW5A 3VDCA 4LA3A 4E4ZA 4RFT0 1ODNA 5FKBA 1O3SA 3RWKX 1W8OA 2C26A 5FLHA 1MQTC 5DZFA 3VBSA 1G9AA 1NXMA 1IQDC 3D0JA 3L2HA 3WNMA 1JZ8A 2DU1A 2A6XA 4KGQA 4KBZA 5F6KA 4AHZA 1BMV2 1W6MA 2ZTNA 3NNGA 2QE3A 4Q1RA 1PZ9A 2R16A 4QD2A 2UY9A 1XNAA 4XUQA 4QU2A 5L9RA 4DQAA 4A7YA 1OA2A 1O4ZA 5IVCA 2IC1A 1ENSA 1K5MA 4Y24A 5E8AA 4YVWB 3MV11 1DP0A 3M2MA 1BVVA 1AYM2 1UW8A 2A6YA 2X10A 1GZ9A 3ZYFA 4IESA 4I2OA 2PHXA 4DEVA 4CCDA 4PI2A 3N9LA 4LLFA 4FOVA 2PLV2 4DRVA 3HBKA 4XFCA 5FZIA 5JXJA 5LRSA 1O3RA 3S57A 2W08A 1GV9A 4CEYB 2ZEZA 5LY2A 1UPIA 4JC1A 4ZY9A 4J25A 1SLIA 1VRH1 4RR3B 5EPAA 4CP9B 3BODA 1O8PA 1U5IA 3ZR6A 3SH4A 2RMU1 2D3SA 1RHI3 3ZO0B 5J09A 3T0DA 5FK7A 4NIIA 3ILFA 1WCDJ 5CG9A 1A8MA 2C5DA 2VM9A 4K1ZA 4DY3A 3WDYA 2D6OX 2ZHLA 2VUDA 5F1RA 1JZ6A 3KCXA 1JS9A 2QQNA 4CU8A 5FZKA 4JVAA 4JGYC 2DCTA 5HV4A 5JXIA 4UWDA 4ES8A 3V0AA 3GDBA 3GHNA 1F35A 2Q30A 3RI8A 1R093 1OD5A 1Z7S3 5FPBA 2GALA 5C3PA 1Q8OA 4G3YC 1OKOA 3PUAA 4PT6A 3RYPA 1H9WA 2FDKA 4NN0A 4Y20A 1J1LA 3AYCA 2O8OA 4MVTA 5A7NA 4P5HA 1VBE3 1RUE2 4K40A 1IKQA 1CAXB 5JXGA 1CAVA 5BV6A 4DOUA 1TMF1 2BOIA 5TSWA 1GP6A 4YW2A 3WNOA 1LGNA 4Y1XA 1ASJ2 3CMGA 4XDQA 1GNYA 4CRQA 2WAOA 4YGDA 3SQOA 4RL7A 4AI8A 4DMIA 1UMIA 2Y8KA 4I30A 1HB3A 1UOBA 1QIQA 1RUF3 4NR1A 4CTEA 2MEV3 3OGSA 4LQRA 3M3QA 2NN8A 4MH0E 4YM2A 3VZLA 1OPOA 2BV4A 2WZR1 2X29A 4L0PA 3AP5A 1RUF1 4GIQA 3ATGA 5F6LB 3UESA 4A7ZA 4CDWA 5C3RA 5G05L 1JYNA 3OYWA 1JXNA 5CA6A 1OC1A 3T30A 4CDUC 4Y22A 1DDLA 3WHTA 2XJVA 1J3PA 1DG6A 4CDXA 1YXWA 4QB2A 2QVSB 5FXWA 3S5AA 4LPLA 1UY4A 2HWF1 1VBC1 2Y6JA 4YW4A 2VMEA 3QBQA 2NLRA 3TEZA 3HQUA 4YW5A 1ZRCA 1CESA 1PK6A 1PZ8A 4QPIC 3OBTA 1LESA 1XE0A 3CHXA 2VTFA 4JKKA 3NQHA 4UFKA 5FZHA 3R6SA 5A1LA 5JR2A 1NT0A 1Q3EA 1DGLA 3RZKA 4IQPA 4YGBA 1RUNA 1KITA 2VGDA 5IATA 1LJ7A 3WG1A 4LHNA 1TNRA 1YC61 5FP9A 2AYHA 2B46X 4R9DA 2E7AA 2QFEA 3WP4A 4JQTA 1E57A 2JWPA 3LDKA 1FPN2 5ACA3 1U5ZA 1O4YA 1RUH2 3P1IA 3MGUA 4KG8A 1X50A 3H8UA 3Q8CA 3N35A 5LASA 3UKTA 2AC1A 1HLCA 5FZ9A 1DQ6A 1ZBA3 1O5UA 2WDBA 2X5IB 3FX3A 4HZFA 2G9FA 3AKQA 3DPRA 4B3NA 3TEYA 4I0AA 2QQOA 4URTA 1XBFA 2FDHA 4MGIE 3B94A 3T2PA 3WNXA 4UFHA 4CCKA 5D8AA 4EWEA 5FZDA 4Y4YA 2OQ6A 2HWC2 2HEYF 3ETPA 3POEA 1CAWA 3S30A 5CAZA 5FZ6A 4C0BA 4PJYA 4JQRA 4IEOA 1UOJA 5DAPA 1G9DA 3RDIA 5JPMB 3ZSJA 1UX7A 1YRZA 1YI9A 4NJ4A 3J7LA 3ZN4A 5IT6A 1KFUL 3C8XA 3OGRA 5C8CB 3CZJA 5C4WB 5FZ1A 4IE6A 4XE9A 3R05A 2IZWA 3Q8AA 4QM8A 2QQUA 3KS7A 1TZOA 4W65A 4CEWA 1MS5A 4WVMB 2VMGA 4LOTA 3A23A 4FPFA 1JHNA 1G9CA 4HXCA 2OZ6A 4M3CE 1YFWA 1B35C 3CDZB 2XMLA 1AYN2 3LB9A 4JGYB 4YZ3A 5A7OA 3I49A 1VE0A 3ZSLA 4CCMA 2ZGUA 5F5CA 2ZGOA 5FY7A 4D8MA 4EE2A 1X7NA 3RZGA 2XPJA 2WAAA 3KQRA 3WINE 2VZPA 4QU1A 1FATA 4CU6A 4PIXA 3VD7A 4K20A 3M3OA 1YIFA 4MGZE 2W2IA 4FTSA 3JB8A 2X05A 2D98A 4CDUB 1I5ZA 2F4LA 5FYTA 3BU0A 1YQCA 5DDJ3 5I8YA 4PBOA 1AVBA 4AHXA 3WF2A 1NCRB 4AQSA 1RHI2 4FFHA 3J8F2 3AP6A 3O1RA 2XXZA 1WCKA 3AP4A 3K46A 5CFCA 2L9LA 2ZGKA 3ZLIA 2R072 5EXOA 2ZA9A 1H4GA 2GC3A 4MXVA 3B69A 3PUHA 4OI4A 4AQ6A 1WZXA 4IEXA 4LKEA 1H2LA 5JOXA 1R092 2J1SA 3PUQA 3N9NA 2ZGNA 1U0AA 2PELA 4HMZA 4W8JA 2V4AA 2YGLA 1UMZA 3IDCB 1C1FA 2BWCA 4FFFA 2Q1MA 1S0EA 4Q4Y2 5LATA 3HMYA 3PURA 4ZU7A 3J7HA 1O91A 3MICA 3D5OA 4AVTA 3P5BA 5JZGC 2GNTA 2VUAA 1W6QA 3ZPYA 4I01A 3V65A 4BB3A 1UY1A 1OH4A 4Y5SA 2P5BA 1RB8G 4QWNA 2CYFA 3UK9A 3UNPA 3EYPA 5BNQA 1OVPA 1PNFA 4S2HA 1H1AA 5H9QA 4K9SA 4M00A 1NG0A 4HVOA 2YV8A 4FPLA 5AVAA 3ZYBA 5KC6A 5DQ0A 1UIJA 5EWSA 3E5XA 1AF9A 4AEDB 5FR3A 1KDKA 4ZZ8A 2R043 3EXUA 5BPXA 3OSDA 3LPFA 2B5HA 2GH8A 2IVJA 4N7UA 5A70A 1Y9QA 5DAWA 5FPVA 2R0HA 2Z69A 5EV7A 5KXCA 4Q5OA 1QJX2 2FCVA 2I2SA 1JU4A 1AZDA 5GZCA 5K7PA 1C8M1 1S0IA 4UF0A 2VNVA 4RA0A 2WC2A 5JOYA 4D7TA 3IN9A 5JDBA 3KT4A 1VR3A 3H0OA 4EWAA 1XYOA 3LA2A 3NKGA 5FPUA 3J7MA 2ZAAA 1SBDA 2GN3A 2FMYA 4IEWA 1C8NA 1HJFA 3NNMA 4OHXA 3ZYHA 4IETA 2WQ4A 1PO21 3ACGA 3IM0A 3SCHA 1KJRA 4EN8B 1S0JA 4DUVA 1W06A 1ULOA 1W8HA 2W52A 3MZHA 3VBOC 2D3PA 3N9MA 1X8EA 1ZRRA 3APBA 3HQXA 4P9GA 1J83A 4WM7C 1W2AX 2GP3A 2JJ6A 2QTWB 4YARA 2UYBA 4AOCA 3OUJA 2LW8A 2FMDA 3IKWA 3USUA 2ZGTA 1FV3A 1PIV1 3H9AA 3CKHA 1VBA2 1KD7A 2CNAA 2ZABA 3K77A 4JRLA 4UW3A 3POSA 3AKPA 4Q4V1 5FYZA 3BKZA 1D0GA 1OA3A 1XRUA 4TLFA 5I0TA 4C1XA 4UFLA 3LOIA 1WGPA 4AG4A 2VJXA 2DURA 1K42A 2E51A 2JG9B 2R063 5B4NA 1MS9A 1MZ5A 3SISA 4P08A 1B09A 3A0NA 4YG0A 4BZ4A 2ZGRA 4AR2A 4P9WA 4V2WA 2R041 3WP3A 2RM21 2VPVA 2D3RA 4CU7A 2QDNA 1TEIA 1UY0A 3O14A 4LOSA 4GQ7A 5DAXA 4RR3A 1MZEA 4CP9A 4U36A 3WQ1A 2Q0AA 4LULA 2DVAA 3MIFA 3N36A 3ETQA 4CEYC 1GKBA 2JE9A 1O4TA 1ND2A 1DGWX 2IXIA 2VZ3A 4ASMB 3E6CC 1LODA 2R1DA 2ZACA 3POJA 1GOFA 4HVRA 4HK9A 3NV2A 2PAKA 2WJSA 5HCFA 3VBRA 4NIGA 3AMHA 5FBZA 4GH4B 4CU9A 2QQJA 1UY2A 4L97A 4YZ1A 4MX3A 3WT3A 5IJRA 3V0AB 1HN1A 2AH2A 2AZ5A 3B02A 1BCXA 1ZZBA 4YLZA 2R0FA 2EXJA 2UWCA 5IVYA 3I3MA 3NNFA 3HWJA 3GZUC 5E89A 1YEWA 3UGFA 4AI9A 3UKVA 4A42A 1PHMA 4IV1B 4LHKA 1W39A 1S2KA 3POBA 3PTRB 3T4VA 2HYXA 3N4MA 1CVNA 3D3AA 4IDZA 2HWE1 2ZOEB 1RUC3 1AR63 5DABA 1W8NA 1XXNA 2GU9A 3JQWA 2DCZA 3J8F1 2VMCA 2JDYA 3ASIA 3J8F3 4RN5A 4JZRA 4I02A 2RM22 1AR61 2EIBA 2RS13 2HWE3 1HB4A 2Z2SB 3MW4A 5FRAA 4ARYA 4NMIA 2A7AA 4X6QB 2FDGA 3POGA 2DUPA 2LM3A 5HCHA 5FYYA 3FUQA 5CYYA 3WW1A 4AI3A 1EAH1 4AK3A 1W8TA 3HVDA 5FOBB 1JYXA 1Q8SA 4KWJA 4XYXA 1O8SA 1ENXA 1MS0A 5E6HA 1BEV3 3B9IA 1RMU3 1NA1B 1QEXA 3ACHA 3TNPB 4CUAA 3W20A 3VKOA 1W2NA 2QCSB 1ULCA 4BMEA 2GMPA 1XOYA 2YC2A 1M4WA 1VBB3 4LLOA 3CF6E 3NV3A 5FZBA 3HBZA 5L73A 2YMZA 5FFOC 2D5FA 2DYCA 3FJSA 5DG1A 3ALQA 2BGPA 1I6XA 2IXHA 3OGVA 2V5YA 1OOPC 4URAA 4YG3A 2BBVA 2AGSA 1FX5A 3FZ3A 3NAPC 2JEMA 1SFNA 1RL3A 1LGBA 1SPPB 1Z0HA 2J1TA 1LHOA 4YVSC 3SCFA 4BQ4A 4CXWA 1JOBA 4OI0A 2RDSA 2GN7A 3PIGA 4LO6B 1CQ9A 5KHIA 1AR72 2R042 1L7QA 2VMFA 1KXGA 2XQXA 1IG0A 4W50A 4IEYA 3WDVA 2R061 1XPWA 2VCCA 1OFNA 1TE1B 5DN2A 1DZRA 4AFAA 2JDZA 2W5FA 1MR5A 4JHTA 3VZKA 1MQTA 3I7DA 4YFWA 3CLPA 5E16A 2HH9A 3WW4A 2C0ZA 2DVDA 4QPIB 1WCQA 3HPNA 3AVSA 1CX1A 1WBLA 1UKRA 2IXCA 4XW3A 2ZBJA 4XDOA 1JZ5A 3V0BA 2XKOA 1JZ7A 3VL9A 1LCLA 5I0SA 5D21A 5ACA1 3ZFFB 5JCTA 4FPYA 5JXHA 2RS51 3OUHA 1PO23 3ZXLA 1W6OA 1W05A 2B7YA 2DVBA 2VCBA 3FHIB 5C8CA 5I0RA 3ZVXA 4IE7A 5IAXA 3LA3A 4PCRA 2H0VA 2GNBA 4PI0A 1ZBE1 4MLOA 4B7KA 1GP5A 3LIHA 4PLOA 3SEPA 1C8M3 3K4AA 1DCSA 1N3QA 3I3BA 3LSEA 4LEJA 4XJ9A 3S7IA 3TRSB 3T08A 4AFCA 2PLV1 2WS93 4QT6A 1SLAA 4QXCA 3SHRA 1UY3A 5LCWL 2RHPA 4XF3A 1OVSA 3UETA 2RE9A 3LEMA 4IXLA 2FDIA 4DRRA 5ABJB 1QHDA 1GNHA 2WINB 1DQ0A 3O7OA 3O1TA 2XQRA 2XOMA 2IVIB 3AL6A 5J37A 3J7NA 5A7WB 2VVEA 3H1MA 2WZR3 3VBFB 4MGYE 3MF9A 4WM8B 4QX7A 1EUUA 2G1MA 2GC0A 1AX1A 5AFEA 1T6GC 1ULDA 1VLNA 4LK7A 1ENQA 3LFIA 4I3PA 4Q29A 3TN91 3N9QA 3M3EA 3MIHA 4BJ0A 4Q4W1 5LA9A 5LBFA 3NNJA 1LECA 3VD4A 1KQRA 1KGYA 3K3OA 3O0VA 3MF6A 1KFXL 3ZOIA 1QNWA 4OVEA 1VALA 5FZ7A 2PFWA 1GWKA 4LXLA 1X33A 4P02B 1AYN1 4E4DX 4E8DA 1YHFA 1GLHA 4EJRA 2ZZQA 5FZCA 5JSOA 3IMNA 1TG7A 2JDHA 4ZZ5A 1D2QA 5CFDC 4N9HA 3SMHA 2Q8DA 4OFGA 1GWMA 3U75A 1R091 4XMAA 2VZRA 5C5TA 5IW0A 5CFCC 3AVRA 2IUWA 4COVA 2W1QA 2RR11 5FDBA 3BALA 3QACA 2P4EA 3VZNA 1V6OA 1R082 3WSOA 3HN1A 4QX5A 1AR91 1VBD3 3AXEA 4Z8BA 1GOGA 2D40A 3OEBA 3ZFEC 4L92A 1COV1 2OT7A 2XBO1 1UO9A 2I45A 1MZ6A 1WLDA 3H7JA 3IDBB 3POIA 4GULA 2JE8A 3DYOA 3GZTB 2PHWA 3MIGA 4M4PA 4CUGA 5BXXA 3EQEA 1SLTA 5LEJA 2R32A 2DDUA 1RUJ1 1LAJA 4FAGA 1H8TA 2YYOA 4O9EA 1W2TA 5K0UB 2JDAA 2ORXA 4AEDC 1REDA 2E31A 3AYAA 3BGAA 3LA7A 3K75B 1UF2C 1H8VA 2EA7A 2D97A 3R4DB 1QGLA 4UT5A 5FXZA 4F83A 2EAKA 2PHUA 1UQXA 5H9RA 2ZEYA 5DDJ2 2VAUA 4AF9A 3HNYM 3OG2A 1PZ7A 5F2SA 1FPN1 1MS8A 4YPJA 5LW9A 4UF0B 3ZX7A 3IIAA 1RUG3 5FO8B 4JTOA 2E7QA 2P6CA 1RVF2 4LMFA 5L7OB 2IXJA 4HSJA 2ZMNA 3FHQA 3NRUA 1BQPA 3AMMA 3J9SA 4I09A 5HV0A 2KM2A 2VZTA 5A3UA 1AR73 1N1YA 4QQOA 2BFUS 5FXXA 4OI1A 2YXSA 3WW3A 3CIHA 4FTEA 3QLQA 4JGZB 1W3XA 2RS33 3SITA 1XSRA 4XAEA 3C7HA 4N53A 4P9YA 2ZX1A 3W5MA 2VZ1A 3MPPG 4FQ4A 4XVHA 3GBFA 1S0CA 4GWJA 1XNBA 2JICA 3SNMA 2A71A 4N43A 4UW5A 1DGRA 3OJBA 3HAGA 2WNUA 4JKLA 2NP0A 5A32B 4QB1A 2ADDA 3KF5A 5AC92 5L36A 3H3LA 4KGGA 1WMDA 1LHNA 4DXZA 2BNNA 2J1UA 4B29A 3U4XA 1OUSA 1OURA 1NKGA 1E5HA 1FV2A 4XUPA 1JZ2A 2Q4SA 3JD71 5HBAA 1OLME 1UZ0A 2NPIA 5D2AA 1UD1A 2LALA 4WM7B 5LEKA 5JSPA 4K3UA 5A33A 4LBOA 3KV5A 1QOOA 1O3QA 4BQ2A 4PLNA 1HN0A 4MSVA 1ND2B 3P3NA 1K5JA 2J1RA 1SHWB 3VBUC 3ZN6A 2ATFA 2DF7A 1V6MA 2MHFA 4BLJA 4YZ4A 2CL2A 1YLLA 3HNMA 1BBT3 2PQSA 3LF7A 2YBPA 5IVFA 1IQAA 2QUOA 2WS92 4KWLA 4Y1UA 3KZ4C 1WA4A 2JDUA 4S2GA 5F3GA 3THTA 2ARCA 3VZJA 4ZS3A 4QGLA 2GH2A 1F15A 4BCUA 3DF0A 2ERFA 4A4AA 3GBGA 3WF3A 3AZZA 2CY6A 3R4SA 4ZHNA 3CU7A 3ZXFA 1WW5A 4DY5A 2WZR2 4DPNA 2YBSA 3VHOA 1AUYA 1NCRC 4E2SA 4IERA 4IV1C 2XJUA 4AZZA 4LO5B 1LENA 1CONA 3RZHA 2Q8EA 1W0NA 2JDMA 3PLQA 2PTMA 3MLJA 2ORZA 4MGKE 4YVWC 3VBFC 3C2UA 3ZSEA 4AWDA 2YG0A 2Z79A 4RQPC 5GLZA 3U4SA 5CEHA 4UXAA 3ITQA 4EROA 3SC7X 1RUJ3 3QH6A 3ZYPA 3VB9A 1TMF2 2VECA 3I2JA 3WEZA 2G4IA 5EYYA 3POFA 3DL3A 5FY1A 4LE4A 3AP7A 1IPKA 1DHKB 3VKMA 2AUYA 4GH4C 5F8PA 1COV3 1YQ6A 1ZZ8A 1QWRA 2XBO3 4Q2FA 3O1OA 2D6MA 3CJIA 5H9SA 2EXIA 3A7QA 1DZTA 2ZZJA 5F39A 3ZXAC 3POYA 4MZUA 2RR13 3UKNA 2BPA2 2VOXA 3AKTA 3URFA 4GWMA 5I0UA 4R4XA 4XUTA 5FY8A 1VAKA 1QXRA 2CDPA 3IDEA 4NHMA 3ZXDA 3IDAA 3ON7A 2ZX4A 5H9PA 4EWDA 2NYYA 2XVLA 1DYOA 4WVVA 1ENRA 2DFBA 1IPJA 2UWBA 1YJKA 4GALA 2D93A 5DUUA 4AQ2A 2PHTA 1YQ5A 4FVVA 4XTPA 5K8SA 2HEVF 1PNGA 1V6NA 3TNQA 4CVUA 4TYSA 3SXWA 4QKFA 3LOBA 2IFRA 2YC4A 4FTBA 1W03A 1DGWA 1QJU1 1YQ2A 1K5MC 1W6NA 2A6ZA 3AKRA 3FLTA 3PL0A 5FQ0A 3TN93 3ZKUA 4ITCA 3HEIA 4BISA 2R071 4F3JA 2WQ8A 4FPOB 5DUXA 4BWOA 2JENA 2AACA 1QJFA 4LBJA 3S7EA 1CAUB 3VBHB 5GZFA 4D94A 5B2GB 1QH6A 1XE8A 5IHRA 1SBFA 3GXUA 1Q8QA 4W6XA 3T1LA 4AVAA 3AJZA 5F3EA 3T09A 3OGGA 1UYYA 1H30A 5F5QA 5IYYA 2OUJA 1BEV2 5BNNC 5ANQA 4C1WA 1H6XA 1VMFA 3N7KA 1W6OB 2DUOA 4IUGA 4PDWC 5C9AA 2W0XA 1NOVA 1AXZA 2E53A 4XFAA 2PXJA 1QJX1 2A70A 1CAVB 2D43A 1CN1A 4GJYA 1VBB2 1JYWA 4FPHA 1ASJ3 2YC0A 4UOJA 1D4M2 4AAXA 1SFYA 3GZEA 4XABA 5FYUA 1AL23 1QF3A 2YZ4A 1G9BA 1OH3A 3AB0A 3N7JA 5JMCA 2JIJA 2ZGLA 1CJDA 1CPNA 1CZTA 2PHRA 3IAPA 1JOPA 2EF6A 1V9U3 3BCWA 1IOAA 2RS53 4UBGA 3U37A 4WZFA 4AEMA 1JI6A 1LEMA 5A6YA 2D7FA 4EN7B 1XNKA 1V6IA 4FFGA 1H2KA 2JDPA 1SEFA 3OYWB 4AW7A 4NHYA 3OPWA 2DCKA 1YI7A 3MFAA 4YVWA 1ACCA 1EV12 1F5FA 3I97A 4HPKB 3T2TA 5KXDA 1NXD1 2P3JA 4GD4A 4U2AA 4QMAA 1EP0A 1QMJA 5SV5A 1UU6A 4R9CA 1OF3A 4B4RA 3H3ZA 3MUZ1 3FMGA 4KMQA 4S2DA 4FP3A 1PK6B 1QXJA 2VQUA 1D2SA 1U5XA 3IPVA 1OD3A 2VU9A 2WNVA 1W8UA 2WFF2 4AHWA 1RGSA 1DIWA 3GHMA 2D6NA 3HNBM 4FOWA 3VBOA 1J59A 1POV1 4D6QA 5FMOL 4LBNA 1X9TA 5ABJC 3NO8A 1S0GA 1G86A 3CL1A 1NLRA 4AVBA 2XB6C 5FYIA 2OQ7A 2B9UA 2FDJA 4RHV2 4YZ2A 3FFQA 3BIWE 1K45A 3BTZA 4AI0A 2VQAA 1FPN3 3OBZA 4EN6B 1FNYA 2A3XA 2FCUA 2WFPA 2PN5A 1RUH3 4HOOA 4ATEA 1POV3 1FYUA 3RI9A 3WDUA 2ES3A 4X6RB 4YZ5A 4I0BA 5T5LA 1ULGA 4DS0A 5IK7A 4J1WA 1WWYA 2HWD2 2PYTA 3DKQA 3GBWA 1NX9A 3BVCA 1RUD2 3M70A 2JKXA 3B9CA 4XEZA 1KEXA 1X36A 4GMP1 2P3KA 2OS2A 2JB4A 4ZPIA 1VMJA 2CGOA 1BEV1 1LU1A 1XYPA 2YBKA 4E2GA 4XBLA 3FUOA 2DVFA 2YU2A 4ORFA 4YW3A 5DZGA 4Z1VA 4NROA 4HG6B 1E5IA 4XURA 2KD7A 1BK1A 1FAYA 2W1SA 2WKKA 3FN9A 4FPKA 3WD5A 5FJHA 3HT1A 2BGCA 5D8AC 1AR83 1C4RA 5AC91 3HJRA 4FCAA 3TWIA 1WD3A 4O61A 2RR12 3UV9A 1XYNA 5JWPA 3LZZA 3WP5A 4BH9A 1E5RA 1HXS3 4QPYA 1AYN3 1OUXA 1LGCA 3U78A 2QQIA 1HDKA 3SCGA 2JD4A 4OMCA 1DQ5A 5FMOS 3FL7A 2EIDA 2FZ2A 1TQ5A 3PIJA 4NIHA 2XLFA 4MYEA 4DZGA 1GZWB 2Y34A 1RUI1 4H55A 1LHUA 3LAGA 4QDSA 3ACLA 2ZGMA 1NE6A 1PGL1 2ZKNA 4AYUA 2GNMA 2XUMA 5FZLA 1RINA 4QGNA 4QX3A 3KLSA 3MV01 5DAQA 1FMD2 1XJAA 2A73B 2W87A 5A7PA 3ILNA 5AVPA 5DPNA 3ES4A 3MIEA 1W90A 5B4XA 2Y6FA 4YM0A 3FBYA 2RMU2 5T5OA 4K8FA 5FZOA 1AXYA 2DFCA 4GJZA 5F9TA 3BUCA 3H42B 1REEA 2BP6A 4GZ9A 2Y6HA 2XL7A 1RUI3 4QXHA 4X8NA 1QH7A 3MPBA 1D7PM 4LKSA 3OD4A 3OGJA 2Q8CA 4V2VA 1W0OA 4DFSA 3H8RA 4CZSA 4UI9L 3NAPA 3ZFGA 1JHJA 1LOFC 3NJZA 1PIV3 1U12A 4KU7A 4Q0PA 3RZLA 2EICA 4ES9A 1QQP3 1W6QB 2A3WA 4XF4A 2P37A 1NAEA 4TSVA 1WUVA 3LPGA 4CP0A 1LHVA 4BQYA 4E4HA 1R081 2WWSA 2GMEA 5J96B 3AP9A 2OKXA 2G19A 4L2NA 1ULPA 2AR6A 2RS52 5C4WA 4CDXC 2EIGA 1GR3A 2A6WA 3MHZA 1SDDB 1BHGA 1W9TA 2F4PA 2HYKA 4HBNA 3RG0A 3WG3A 2W1UA 1G8WA 2AEZA 5FOJB 3I3DA 2VMDA 4WVZA 4WVMA 2WO2A 2WLQA 4AVCA 5L9BA 3UGHA 3O1SA 1URXA 3RQ0A 4XJUA 1EY2A 3OY8B 1FXZA 1FNZA 3O5SA 2EXKA 5HXMA 5JPNB 1YIPA 4GMP3 4P00B 2HBTA 3BOWA 1A3KA 2OA2A 2EXHA 2XVKA 3A21A 1BKZA 5DZEA 1VBA1 1PGW2 2WNOA 4CEYA 1ALYA 4CDUA 1AX2A 2WT0A 1ZRFA 4L8QA 2VQTA 1AHSA 2I74A 3PMEA 1WLTA 1NCRA 1W6PB 2BVBA 1GUIA 5CFDB 5JMOA 3VBRC 1XE7A 3ZFEA 4QQHA 3MYXA 2AENA 2P17A 3CJIB 2YFUA 1PVXA 2WO7A 3POWA 3WNKA 1OQEA 1UX6A 5FV3A 3KSCA 2B4KA 2MPFA 1C5IA 1K12A 1UYZA 1DQ1A 3KD4A 4DNYA 3AJYA 4R8HA 2R49A 4E8CA 3ACFA 2HWD3 1R64A 3ZDSA 3UT0A 2VZVA 4COWA 1WW6A 4YFZA 2JG9A 3E97A 2JG8B 1ZZ6A 1NUKA 1SLLA 4PF5A 3WDTA 2C1FA 3HR9A 3TOJA 1ZBE2 4S2FA 1CAXA 4LITA 4BXSV 1W0PA 1R1A1 4CUBA 1AYM1 3NVCA 1NZIA 4XQWA 3TEWA 3VDDB 4BE3A 5FP3A 1RVF1 1JU3A 5FP8A 1WW7A 2R6QA 5M0TA 3F95A 4CYDA 4AL9A 3T1MA 5ACA2 3K48A 4Z82A 2WL1A 4EZHA 2XJSA 1HV1A 3C3VA 4ONUA 3Q8EA 4HSLA 4XDPA 5DDJ1 3C7FA 3WX5A 4XF1A 3KT7A 4EN9B 1OLMA 1MS1A 3OEAA 2H0BA 2A3YA 1AL21 4FAHA 1LOCA 4HLTA 2RG4A 4BQ5A 4LIVA 4LBQA 3GJBA 1G6NA 2JE7A 3PHMA 1RUJ2 5F3CA 2HWC3 3O1VA 4RR3C 5J1XA 4GMP0 2WRAA 3ZR5A 5KXBA 5IVVA 3CNAA 3Q9OA 4K21A 3IMMA 3ZFGC 5F32A 3ZKYA 1GQGA 5C9AB 4MXWA 1AR71 5C71A 5T55A 1DZQA 1QU0A 2GDFA 1COV2 1FI2A 2XBO2 3LWCA 5EP9A 1PO13 3T0BA 4BQXA 5EIYB 1AR92 1TNFA 1Y7BA 2WWUA 5I8SA 2Q8OA 5JSRA 2WUHA 1ND3C 1TME3 5LRRA 1AJKA 1GBGA 3N9OA 4AXOA 4F7ZA 4IGQA 3EMRA 1FMD3 1ST8A 3H1WA 5ERLA 1JH5A 4XJ8A 5GLTA 2F17A 4M3CA 1RUG1 2RM23 1GMMA 1W9SA 4NHKA 2JDKA 2XJRA 2WWJA 2IXKA 3ECQA 4QB6A 4ZXEA 4C0HA 3B00A 4ZU5A 4D3WA 3ORJA 3WVJA 3VBUA 3LQCA 1MEC2 2K46A 1S0DA 3IAQA 5FPZA 1PMIA 3ZIWA 4RS5B 3WQ7A 1CPMA 3J4UH 4HETA 1R1ZA 5G04L 1YNAA 4H3WA 2LUWA 1HQWA 1LKNA 4HPKA 4N8MA 1MZFA 3W59A 5KHGA 1ZM1A 2KXLA 4AEJA 3DUIA 3PVNA 4Q4W2 5A7QA 3VDAA 2VE1A 5JOZA 4A3ZA 1Y4WA 4FOQA 3D0SA 2JECA 3PVBB 4HKOA 3BIEA 1QQP2 1F4HA 3IPVB 4CCEA 2WNVB 2WSVA 2WYSA 3TB0A 3JZVA 1VBD1 2BZDA 1UZVA 3MBWA 3DXUA 3I2HA 4IL7A 4P5YA 1DBNA 2XJQA 5FP4A 1ZVFA 2GAUA 3FFZA 4ASKA 2R30A 2P6HA 1ZNPA 3OPZA 3KV4A 1GSLA 5SV8A 1MACA 1YUDA 3RZMA 2BJSA 1P8JA 4YGEA 2WIIB 1EPZA 2KA3A 4YYOA 2BUKA 3VL8A 1XB9A 2VBPA 2NQYA 2X53S 2WNVC 2CTVA 2HWF2 3M3CA 2RJ2A 5FWJA 3W21A 1NLSA 4XPVA 2OVUA 2BQPA 2DUQA 1O3TA 4MADA 3VN4A 4FPEA 4INDA 1HB1A 4LO4B 4OQ8A 1I9RA 1Q8VA 1H1IA 2Q5TA 1JN2P 4W6YA 2PHLA 3LCPA 3OF1A 1NQDA 4XXPA 4BQWA 1RIRA 4XF0A 4BQ3A 4XZPA 1VJ2A 2WZ8A 1L7RA 4OQ9A 3VD5A 5FY5A 4PLMA 3ZYIB 1GOHA 2O14A 3ZXEA 4JDOA 3ZFFA 3UJQA 4DXTA 4BIOA 5CADA 2W1WA 1PK6C 2G9ZA 4MGQA 4BXFA 5BYNA 3M1HA 4UW4A 5FP7A 4KU8A 1QJEA 3PVOA 4BM8A 5BNPB 1SQ4A 2OIIA 1NY71 3AFGA 4K8RB 2W95A 2PQQA 4CA9A 1W9YA 1REFA 1WW4A 4NWVA 3A0KA 1GU3A 2XWBB 3VBSB 4Y5Z0 5GZDA 1YCIA 3GGLA 4TN7A 1NA1C 4QQPA 1IKPA 3ABZA 1PM4A 4CE8A 1W6MB 2YU1A 4RQPB 1GQHA 1ZBE3 3ZYGA 4WVWA 5C8CC 2ZHMA 2BVVA 2VZOA 3JD73 4IE0A 4RGGA 4HKLA 1GP4A 1W8FA 1UWWA 3I59A 2K0GA 1CGPA 4LE3A 2HWB1 3AZXA 1ULFA 5JI7A 3VBFA 2VCAA 3ELNA 2J7MA 1F8VA 3DECA 3THDA 2B42B 1EUTA 1T6BX 2NZ9A 2BFUL 2DV9A 3HT2A 4O65A 4LO7A 4FSJA 2CU5A 5BNNA 2UU8A 2HEWF 5FLIA 5C9AC 2WO3A 1VRH3 3LEIA 4RYDA 1QJU2 1H9PA 3G7DA 4AEDA 1QDOA 1AX0A 3JBG3 1GNZA 1Y9MA 3WZ1A 1XNCA 1US3A 4CCJA 4N9IA 1ND3B 2V73A 3M8LA 3ZPOA 1S0FA 3MW3A 4G9SB 5T50A 1HRI1 3WQ0A 5J98B 1I5PA 1RUE1 1HQNA 1LU2A 1S2BA 3R0RA 4CEWC 2BNOA 4JKMA 5DXDA 1L3JA 4KWKA 1OKQA 4QXBA 5EZWA 4QX8A 1PO12 3C7GA 4NO4A 1OLQA 3KB5A 4QQLA 5FZ8A 2DCYA 3KWVA 3NAPB 1PMHX 5C3OA 5A6ZA 1LRHA 3KVBA 1QY4A 2D6LX 2P3IA 3H3UA 3OTFA 4KBBA 3U07A 2OW4A 1DLCA 5LY1A 4Y20B 1IS3A 1HQLA 4BOWA 2BGOA 2ZX3A 5A1AA 3LDRA 1Z78A 4Q4X2 1H2MA 4Q4Y1 4BQ1A 2DBNA 4HFSA 2Z42A 1H4HA 5A1FA 1I3HA 1O6UA 1V00A 1H8TB 5K0UA 1GANA 1OOPA 3VD9A 4MV2A 3BI3A 4UFMA 5CKMA 4BIFA 4PDWB 5CNAA 3B7MA 5ABJA 2MNGA 4Q4X1 4YW1A 1B35A 4CDWB 3K4DA 2ZAHA 3ZFFC 3GALA 1W8WA 2B45X 1Y43B 5FZEA 1ZRIA 5EJ3A 5IUQA 2GC1A 5L7OA 4WM8A 4LT5A 1RUC1 1RVF3 3MEPA 5FCCA 5FREA 3SEEA 4CDQC 1OQ1A 4CDXB 4QHBA 3WR0A 3H1YA 2ET1A 2VOKA 3LSDA 3LIGA 4NRMA 1OHFA 4YSFA 1S55A 1YWKA 1KRIA 3GNEA 3UGGA 3OD0A 1E5SA 3NNLA 1HX6A 5KR7A 3VBRB 2RDQA 4GB32 4JGZA 2HWF3 2QKDA 2HWD1 4LUKA 1IS6A 2RS32 2UURA 4RFRB 1PIV2 2DBIA 3K3NA 3LEGA 4XFIA 3USSA 4K7JA 5J48A 1CZVA 1XNDA 5FZGA 4FPJA 3FC0A 5C8WA 2C4XA 3AL5A 4LORA 1X82A 5FY9A 2MEV1 1NLQA 2NMOA 5LBEA 4EN0A 1UNBA 2IXLA 1VAMA 2VW0A 3EB7A 3IBMA 2VH9A 3DGTA 5FYMA 4SBVA 4PIYA 2XHNA 2ZCWA 1CX4A 5A33B 4LR4A 2V5DA 3FHAA 3DV8A 4DUWA 1UXXX 2JG9C 2ZHNA 1CAWB 2VY0A 4N43C 4UAPA 5LA0A 1DLLA 4Y1VA 1SACA 2LTNA 2OPKA 1VBE1 1C3HA 3B3QE 4HVQA 4Q0SA 5BNPC 1VB2A 2WLPA 1BBT2 2YDEA 3CJIC 3T0AA 2EVXA 4A7KA 3BU7A 3PTYA 4NWWA 5HPOA 3QD6A 1Q56A 3WUDA 3V0BB 4GWNA 1QNYA 3AYEA 4NE9A 3OBAA 1WKYA 3PUSA 3S6PA 4GAZA 5A6XA 3M4FA 3AMNA 3KGZA 3QCWA 5FYBA 4CEWB 4YRDA 4COYA 5J36A 2YY1A 5CG8A 1OFSA 2VOWA 4IEQA 3K51A 2BTVC 3RS6A 3W58A 4CXXA 3OUIA 3ZMOA 1QDCA 3NW4A 3Q8FA 5JAXA 1HJGA 4TLGA 1OPMA 4M3CB 4DXSA 3GF6A 2RDNA 4XJWA 4ET7A 2GNDA 3KT1A 4FXKB 1KDMA 1VBC2 2VG9A 2BERA 3HOBA 3IZOA 3O1PA 4AAPA 2VBBA 4CPBA 5LA1A 1WCSA
chains in the Genus database with same CATH topology
3AXDA 3NSTA 1ZX5A 2EAAA 4L99A 1SLBA 4XF9A 5FO9B 1DYPA 4P9IA 4LNVA 3MIBA 4E27A 3EO6A 4J1XA 3MIDA 1VIWB 2CGPA 4CDQA 1NYWA 5FO7B 2ILMA 1DFQA 4NHLA 3V0BB 3MI8A 3N3HA 3WUCA 1H8TC 2ETEA 1PO11 4XETA 4UBHA 2VQ0A 5HXVA 3RMYA 2WNEA 1ZREA 2XG3A 4B4PA 4L11A 2N7GA 5BY5A 4JGZC 2BNMA 2DU0A 3E5QA 2XWJB 3BOPA 3VZOA 1HXS1 1M06G 4XOGA 1AXKA 1W6NB 4OUMA 4JV4A 3TYJA 3JU9A 3FLPA 2VW1A 4AEKA 4Z2WA 4HL0A 1AR81 2TBVA 1LTEA 3B93A 2ARXA 5LK7B 3AM2A 3RJ2X 1OMIA 2ZHKA 5JLVA 1OLRA 1AYM3 1R1A3 1MEC3 1ZZ7A 1JUIA 1J1TA 2X5IC 3N7MA 5BNOB 5JVVA 1CIWA 3AZYA 3LGRA 1QJY1 2Z5WA 4FQZA 1YYNA 1C57A 4YVSA 3AK0A 4FT8A 4Q4Y3 3AMQA 1LB2A 2XVGA 2A75A 3D6EA 2A6VA 5JOWA 2XJPA 1UZYA 1JYIA 2ZJCA 1AL22 3P3PA 5HCAA 2ZX2A 1CD3G 4M0HA 3WP6A 2O8QA 4K6BA 3NV1A 3VBSC 2PA7A 2Y0IA 1RJ7A 2PAEA 2BYVE 3I59B 1WMFA 3VKLA 2BW8A 1FOD2 4WZCA 1HRI2 1EV13 1RUE3 5GALA 2ZGQA 4IEUA 4OHWA 3WLUA 3ZYRA 3RYKA 3AX4A 2GC2A 3RJRA 4Z92B 5T5JA 4QPGA 5HI0A 3JBG1 4KQ7A 2WFF3 2XKPA 4GKXA 1ZBA1 4AQTA 5KXEA 1RUF2 2RJLA 4RGAA 4Q26A 1LEDA 5GM0A 4AVVA 4E9KA 3M7AA 1C5HA 2QQPA 4HN1A 3L9JT 4RHV3 2A5ZA 2HWB3 4XFBA 2OYZA 1UIKA 4Y22B 1YO8A 4JGYA 3ENRA 3DKWA 3DN7A 3UJOA 2E63A 1YJLA 4OULA 2D6PA 2ZKLA 4XXAA 3X29B 3AFKA 1VBC3 3U11A 1J3RA 4AFDA 1EAH2 3GYDA 3JD72 4WBBA 3U10A 1OOPB 3OCPA 3WG4A 1JTZX 3WDXA 3PMSA 2VNGA 2OUHA 2FHRA 5A32A 4YM1A 1LHWA 1NCQA 2CAUA 3CEWA 4E2QA 2X5IA 1QJU3 4ASLA 3DPRB 4L9BA 3JBG2 4CDWC 4HANA 4M01A 4Q0VA 1N1VA 4FOYA 4NVPA 1UU5A 1LOAA 4HKWA 1TMF3 1UPSA 1MS3A 2PHDA 2ZS6B 3AZVA 5HCBA 3RPQA 1DU3D 4Q27A 3ZN6B 2JKBA 4GA9A 5FLJA 1XU2A 1POV0 2QNKA 3AZWA 3QOPA 3EJKA 4XIKA 3O0XA 3SH3A 4AE2A 5AFBA 3VBOB 1Z7S1 5KC5A 2UY8A 2ZX0A 2YUEA 5L7OC 3S0MA 2P2KA 2D5HA 3JQXA 5I8TA 1EYBA 3ZSMA 4FP2A 3ZXGA 2HWE2 1JUHA 2ZMLA 2RMU3 2NM1A 1XU1A 3JCIA 4Q4X3 5CBLA 1R1A2 2DCJA 3E6DA 4AI2A 1LOGA 1MQTB 1ND2C 2VOVA 3AMPA 1N47A 1GFF2 2FQPA 4QPGC 1BZWA 1YFYA 2SLIA 4YM3A 1LR5A 5GLUA 4CP2A 3WCRA 4OUSA 2VUJA 3MW2A 4LHLA 3TN92 1LULA 4BMBA 2QDRA 2DTYA 2JG8C 3D8CA 4Q8LA 2VXRA 3JUUA 5CVRA 5CFCB 5KBFA 3VUOA 2VMIA 1TME1 4XIOA 4N53C 2EALA 2GMMA 1PVC3 2ARBA 1Y3TA 2VNOA 3CO2A 2TNFA 3FBMA 2FBEA 2WZPP 2QZ2A 1MVQA 1J58A 3SLIA 1HRI3 2WNUC 1YFUA 1HRV3 1QOTA 3ROUA 1NY72 5C4WC 2CWSA 4BPZA 1D4M3 3KMHA 3R4UA 2DWRA 4LO8A 1G7YA 4XFGA 3RWNA 3V56A 4G4FA 2WA3A 5I91A 1IHMA 2YHJA 3NV4A 1V9U2 2W68A 5FPXA 1O7FA 1G9FA 4I0WB 3HIFA 4LUMA 1UKGA 2VMHA 3N7LA 2K9ZA 2BEOA 5GLWA 3IWZA 3ES1A 1V9U1 4N7IA 3O12A 3ZFEB 4GXLA 1X8MA 4XBQA 4F8AA 1PO22 3RNSA 1OQDA 2HWB2 3THPA 1SBEA 1RJ8A 4XJZA 3RYRA 2HJIA 3L2YA 2E9QA 4Y1YA 2Y0OA 4IV3A 5K0UC 4XHXA 1UU4A 3KCCA 3EHKA 1QJX3 1HRV1 2IWGB 3B01A 1QJY2 1SCSA 1C1LA 1D0HA 1VP6A 1IGOA 4IV1A 3ZFGB 4AFMA 2JX9A 4LBMA 3V64A 1PVC1 4LBQD 4JCKA 2QJVA 2ZMKA 3VDDA 5CIRA 2D44A 3ILRA 5GZGA 2ZPXA 4JTNA 5JZGA 1HV0A 4IEPA 4LA2A 2K2SA 1V6KA 3VHRA 3USUB 4YGCA 1VBA3 3H7YA 2XGXA 3A4UA 4AI1A 3FWEA 1RUD3 3WY6A 3JB4C 4M3CF 3W9AA 4YNIA 2Y38A 2R062 3OY8A 1DQ2A 5BNOA 3DPRC 4B4QA 3TAYA 3KGLA 4ZU4A 2WSUA 5C6CA 4XQ4A 3HD8B 4LTAA 1WD4A 4ISRA 3GZAA 3WP3A 4QXKA 3ZSKA 4QQ2A 4YVSB 1AR93 4B7EA 2GSYA 1TME2 2YPJA 3RMXA 3BB6A 2B8MA 1N1SA 1R083 5E88A 1PM7A 1HKDA 1RHI1 3FLRA 5BNOC 1W2UA 1ZZCA 4K1YA 4Q1PA 4GH4A 1QQP1 4ZKTB 5GZEA 3VBUB 1UCXA 2O0OA 2XL9A 3MFCA 1VB4A 1OA4A 4N53B 4X8PA 3AKSA 4GB31 2XLGA 1RUD1 3ZXJA 3VLBB 1A8DA 3WW2A 2WNUB 4KG0A 4QPIA 4Q4W3 5T5PA 1RUC2 1AR62 4QPGB 2H6BA 1FMD1 3PJQA 1RUG2 5DUWA 4P9JA 1BYHA 1PGSA 2RS12 5DUVA 5K9YA 1DQ4A 5D1IA 1APNA 1KS4A 3MLKA 2X8KA 4TZDA 1PVC2 1RUI2 1Z7S2 1ZRDA 4V1PA 1RMU2 3EBRA 1NA1A 1EPWA 3ST7A 1VBE2 2CWMA 4Y1ZA 4OI2A 4Q4V2 1HRV2 1DF0A 1QKQA 2HWC1 3RZZA 1N3PA 1XQNA 4Q0QA 3WG2A 2WQZC 2D6KA 3MDPA 1BJQA 4OZXA 1BVP1 2WA4A 2Y26A 2OZJA 1N3OA 4HK8A 5JIAA 1GZWA 5IK5A 4LBLA 1K5MB 1BXHA 4XILA 4RSUA 5AC93 4NPRA 2QZ3A 1SCRA 4KL1A 1PGW1 2XJTA 5JIUA 4OHZA 2ENRA 2XLAA 2IFWA 1MVEA 1MS4A 3U0ZA 1FOD3 3VHPA 4Y26A 5BNPA 4YG6A 4KH9A 4D7YA 4AGGA 1JOJA 2DVGA 1UN1A 3BTAA 1NCQB 2VVDA 4KNCA 1DYKA 3KCYA 1YFXA 3PJYA 1ZZ9A 4JDMA 2ZGSA 2E7TA 1V6JA 4META 4XQDA 4HN0A 3NWKA 5BUVA 4XBNA 5EYXA 1A6CA 2DTWA 3I2DA 4IEVA 4SLIA 3ZIXA 2VW2A 5E1RA 4M0NA 3NKTA 5T3NA 1I1EA 5I93A 2GZWA 3J26N 4XFHA 5BNNB 4AFBA 5KHKA 4AGVA 4MUVA 1RUOA 1VRH2 2NMNA 1C8M2 1NZCA 2VVFA 3PVEA 2TUNA 1F9KA 1FT9A 1J3QA 3WHUA 2C9AA 1NQJA 1LOBA 4RD7A 1GZCA 2Q1ZB 1ND3A 1V70A 2FZ1A 1RMU1 2VNRA 3CJXA 4ISQA 5FQ0B 3WDWA 3RSJA 4RS5C 1UL9A 1EAH3 3KM5A 5FAXA 3VKFC 3ZYJB 3I8TA 4D69A 1QOSA 1CAUA 4PQ9A 1FOD1 3B5LB 3VBHA 4FPGA 2RS11 5GLVA 1UZZA 3O0WA 4Z07A 5DG2A 2PHFA 3VKNA 1AL0G 1Q43A 4XFFA 1W6PA 2ET7A 5CFDA 1BMV1 4ZXKA 1SDWA 4P9XA 1S0BA 5CB7A 4ATFA 5GJ6A 3M3IA 2CGNA 1S1AA 1ZYBA 1OSGA 2BWAA 4N90A 3VGIA 1CJPA 5A3MA 3ZN5A 2G9GA 1C28A 4AGRA 4O9GA 2JXAA 2ZGPA 1H1MA 4FO9A 4BA6A 4RQPA 4H7MA 1U5YA 5J3UA 3IT8A 1F5JA 2JG8A 4H7LA 4I3GA 4N43B 1B35B 4JRAA 2TEPA 2O1QA 5FTTC 1SMVA 5KWRA 1VBD2 4BLIA 4GKYA 3BPZA 1IS5A 1KS5A 2R073 5D8AB 4WM7A 4R52A 4TWTA 1PGL2 3WV6A 3VHNA 3I54A 1IZ3A 4XTMA 1N1TA 4XJAA 1OI6A 4OLLA 4Q8KA 4NOTA 2WS91 2PLV3 4OHYA 4QM9A 2XH6A 4Q0UA 1GYKA 2F6BA 4GB33 4LBQB 4OHVA 4Q4V3 4CRQA 4WM8C 3E6BA 4IV3B 4FXGB 3VZMA 3TBDA 2H6CA 1JBCA 5C33A 2CAVA 2WT2A 5KHHA 4BYYA 4CP1A 3SH5A 1RC6A 2I07B 4MXWB 4RHV1 4FBFA 4DINB 4QGMA 2W39A 1NCQC 1WBFA 4J6GA 4PIZA 2YROA 1LOFA 4IV3C 5EFUA 5JZGB 3H50A 4DB5A 2WFF1 3D4KA 4PBPA 1IS4A 4R9AA 1HIXA 4W6WA 1LOEA 1SLCA 4CDUC 2RJKA 2P34A 2R1BA 4D7SA 2UYAA 1KJLA 1H2NA 1A78A 1WLWA 4R9BA 4XMIA 5T54A 1Q8PA 4WV8A 1JYCA 5CU1A 1RITA 2WT1A 1EV11 4RS5A 2PAMA 5JR7B 3VDDC 3ZXKA 4BHPA 1JW6A 4PDWA 5IK4A 3VBHC 3ME2A 4HT1T 4A2UA 4B8EA 1RUH1 4JAAA 4UW6A 3RRDA 3UL2A 2MEV2 2UWAA 4H14A 4IEZA 5A3LA 1QJZA 5LK5A 1WMEA 3FE5A 5JI9A 1NE4A 4C90A 2HKXA 1VBB1 1D4VB 1UAIA 3G6JB 1DGRN 4XHBA 4C91A 1V6LA 4JDNA 2CV6A 4COZA 3VV1A 1BBT1 1QJY3 3I4IA 1F2NA 1QXPA 3ZMNA 3PNAA 1ULEA 1F31A 4COUA 1MEC1 4AVSA 5GKAC 1WLCA 2VULA 3D82A 1ZA4A 3E5UA 3QH7A 1VAVA 4LBKA 2E6VA 3OBRA 3NL1A 5IK8A 4CDQB 1AR82 3WCSA 4E4SA 5J7MA 2XHKA 1CR7A 4FPCA 1ONAA 1H0BA 1ZBA2 3MLLA 4EV0A 5KHJA 1GICA 1Q5OA 2B39A 2V09A 3LKJA 4A3XA 1RTVA 5T52A 5L19A 1AJOA 3AYDA 1O5LA 1ASJ1 3WXPA 1HXS2 2AREA 2YGMA 1D4M1 4P14A 3WOGA 4P9LA 2RS31 4R4ZA 4AHYA 3INAA 2SBAA 1HW5A 4E4ZA 4LA3A 4RFT0 1O3SA 5FLHA 1MQTC 5DZFA 3VBSA 1G9AA 1NXMA 3D0JA 3L2HA 2DU1A 2A6XA 4KGQA 5F6KA 4AHZA 1BMV2 1W6MA 2ZTNA 2QE3A 4Q1RA 1PZ9A 2R16A 4QD2A 2UY9A 4QU2A 4DQAA 4A7YA 1OA2A 1O4ZA 2IC1A 1ENSA 1K5MA 4Y24A 5E8AA 4YVWB 3M2MA 1BVVA 1AYM2 1UW8A 2A6YA 1GZ9A 4IESA 4I2OA 2PHXA 4LLFA 4FOVA 2PLV2 4DRVA 4XFCA 5LRSA 1O3RA 2W08A 1GV9A 4CEYB 1UPIA 4JC1A 1SLIA 1VRH1 4RR3B 3BODA 1U5IA 3SH4A 2RMU1 2D3SA 1RHI3 3ZO0B 5J09A 3ILFA 1WCDJ 5CG9A 1A8MA 2C5DA 4K1ZA 4DY3A 3WDYA 2D6OX 2ZHLA 5F1RA 3KCXA 1WCSA 4JVAA 4JGYC 2DCTA 4ES8A 3V0AA 3GHNA 2Q30A 3RI8A 1R093 1OD5A 1Z7S3 2GALA 1Q8OA 4G3YC 3RYPA 1H9WA 4NN0A 4Y20A 1J1LA 3AYCA 2O8OA 4MVTA 4P5HA 1VBE3 1RUE2 4K40A 1IKQA 1CAXB 1CAVA 5BV6A 4DOUA 1TMF1 5TSWA 4YW2A 1LGNA 4Y1XA 1ASJ2 4XDQA 4YGDA 4RL7A 4AI8A 4DMIA 4I30A 1RUF3 4NR1A 4CTEA 2MEV3 4YM2A 3M3QA 2NN8A 4MH0E 3VZLA 1OPOA 2WZR1 2X29A 5F6LB 3AP5A 1RUF1 4GIQA 3ATGA 4A7ZA 4CDWA 3OYWA 1JXNA 5CA6A 4Y22A 1DDLA 3WHTA 2XJVA 1J3PA 1DG6A 4CDXA 1YXWA 2QVSB 2HWF1 1VBC1 4YW4A 3QBQA 2NLRA 4YW5A 1ZRCA 1CESA 1PK6A 1PZ8A 4QPIC 3OBTA 1LESA 3R6SA 1Q3EA 1DGLA 4IQPA 4YGBA 1RUNA 1KITA 2VGDA 1LJ7A 3WG1A 4LHNA 1TNRA 2AYHA 2B46X 4R9DA 2E7AA 2QFEA 3WP4A 1E57A 1FPN2 5ACA3 1U5ZA 1O4YA 1RUH2 3MGUA 4KG8A 1X50A 3H8UA 3N35A 3UKTA 1HLCA 2X5IB 1DQ6A 1O5UA 1ZBA3 4HZFA 3FX3A 4B3NA 2G9FA 3AKQA 3DPRA 4I0AA 4URTA 4MGIE 3B94A 3WNXA 5D8AA 4EWEA 4Y4YA 2HWC2 2HEYF 3S30A 1CAWA 5CAZA 4C0BA 4PJYA 4JQRA 4IEOA 1G9DA 3RDIA 5JPMB 3ZSJA 1YRZA 1YI9A 3ZN4A 5IT6A 1KFUL 5C8CB 5C4WB 4XE9A 3R05A 2IZWA 4QM8A 3KS7A 4CEWA 4W65A 1MS5A 4WVMB 2VMGA 4FPFA