2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
4FP3A 3JU9A 1IOAA 4RL7A 2P34A 1LODA 4XILA 5JOWA 1SLAA 4P9XA 5AVAA 4FP2A 3L2YA 4WVVA 3WNXA 3OBRA 4ISQA 1ENRA 1S0JA 1GNHA 2NMNA 5DG1A 5JDBA 5FREA 5HCAA 4AGRA 2P37A 4YG3A 2R1DA 2CNAA 4R9BA 4DFSA 3BODA 4FPOB 1FNYA 3WVJA 2UWBA 1LU2A 3UK9A 3WG1A 2D44A 2ZGTA 2GNMA 1Q8QA 3DGTA 3ZSKA 4LBQB 1WD4A 3ZXEA 3ASIA 4GXLA 1PZ7A 1LTEA 2R1BA 3RRDA 2ENRA 2A7AA 1JHNA 2YV8A 1UMZA 1WLWA 1LGBA 3O0WA 2DTWA 3V0BA 1CPNA 2VW2A 4XOGA 1ULFA 1GKBA 3AYDA 1GZ9A 3ZXFA 2ZGRA 3AJYA 2Z42A 1SCSA 4YW3A 2EXIA 4Y20B 4K1YA 2V5YA 1SLIA 4ASMB 3T2TA 4Z8BA 2JE7A 5DUUA 4R9DA 2RHPA 1CR7A 2ARBA 4Q1RA 1QOSA 3T1MA 1DLLA 1BXHA 1MS5A 1LOFA 3AXDA 4F83A 2ZGOA 2AYHA 2WJSA 4LBOA 1SLTA 3ZXKA 4ATFA 5GLUA 2P3KA 1QF3A 2ZGMA 5CB7A 4C1XA 3C2UA 3KM5A 4WZFA 4XJ9A 5GZCA 3IMNA 2PELA 1KQRA 5JOZA 4FPHA 2ZHKA 1N3OA 4FOVA 1WW7A 2CL2A 1W6OA 4GA9A 4Q1PA 4ZXKA 5L73A 4BPZA 3M3QA 5GZFA 5BYNA 3VUOA 4YM0A 1DFQA 1C1LA 1YI7A 3PJQA 5GLVA 2LALA 1N1SA 3RMXA 4HANA 4Y22A 1BZWA 1G9AA 1BJQA 2WQZC 2GALA 4LBKA 1LENA 2EAKA 4YM1A 3GNEA 2FHRA 2ZACA 1AXZA 1W6MB 1AJKA 1CIWA 1HQWA 5JOYA 4OZXA 1C57A 1G8WA 1LOEA 1W6NB 1AXYA 3WLUA 3APBA 4TYSA 4XJ8A 2GMEA 2A6XA 3MW4A 4P14A 4XXPA 3FLRA 3WG4A 3WG2A 5DZFA 1BQPA 1NLSA 1VAVA 2V73A 2A6WA 3N3HA 1F31A 2PHTA 1WW4A 4Q26A 5GALA 2ZGKA 4Q8KA 4YLZA 1UAIA 3AK0A 5GZGA 4GWMA 1GLHA 1SFYA 1MS9A 1LHNA 1DZQA 1FNZA 2DVAA 2VUAA 1V6OA 3BTAA 5E88A 4LBMA 3WDTA 4FPJA 3AZXA 3M3CA 4M3CF 2DURA 4WVWA 5DUXA 3POYA 2VW0A 1G9CA 2KM2A 3SH5A 1APNA 3WDXA 2DVGA 1W6QA 1S1AA 4LBJA 5GZEA 5DG2A 3AYEA 2BQPA 3AX4A 2PHUA 2HYKA 1JN2P 3AZWA 4CZSA 2DVDA 4LBQD 4YZ1A 1LOAA 1XQNA 5KXDA 4H55A 3OY8A 2UWCA 3RQ0A 2WT0A 1URXA 4Y1UA 3FUOA 1FV2A 4FQ4A 2ES3A 1ULCA 5T5JA 5JOXA 2E51A 3RG0A 1QOTA 1LEMA 3LSEA 1D2SA 1UZYA 2ZMNA 5GZDA 1PZ9A 1MVEA 2DUQA 3FUQA 4I30A 4YZ5A 2CWMA 2ZBJA 1DHKB 1KJRA 3NV4A 2D43A 2CYFA 1MS0A 5IK5A 1S0GA 1LOGA 2ZGLA 1N3QA 2JJ6A 4XYXA 3USUA 4Y1YA 3WUDA 2NZ9A 3SH4A 1RIRA 5GJ6A 2ZHLA 1DQ1A 1WW6A 4ISRA 1QU0A 4IQPA 1LHVA 2D6MA 1A78A 1V6NA 2NMOA 3ILRA 1WW5A 3LSDA 2ZZJA 1LOBA 4XHXA 1V6LA 1I3HA 1DIWA 1W0PA 1N1YA 2R0FA 3B01A 3ZSJA 3IPVA 2D6KA 3PMEA 1KDMA 2E53A 3AP5A 5JVVA 3NV3A 5KXBA 1SLLA 3V0AA 3AP9A 2YROA 3LCPA 2H0BA 3IN9A 3O0XA 4AYUA 2NP0A 3HR9A 3B69A 1ULEA 1EPWA 3BOPA 1BKZA 2D6OX 5F9TA 1RITA 4XDQA 1HLCA 1W6OB 3M3EA 1Z0HA 1ZM1A 1JYIA 1UN1A 1QGLA 4U2AA 3H0OA 4PBPA 1JUIA 2EXKA 1UKGA 4PQ9A 2JD4A 4FPGA 3TAYA 2P3IA 3ENRA 1AJOA 4M3CE 2W68A 4P9WA 2A3XA 3TB0A 2ZMLA 2GNTA 2VH9A 4K1ZA 2DVFA 2JECA 2PHWA 4FOWA 5H9SA 4L8QA 4GKXA 3NV2A 4JCKA 1LOFC 2D7FA 3V64A 4XJWA 1AVBA 5EYXA 4UW5A 5H9QA 3WG3A 1VLNA 4K20A 2P2KA 3VKLA 1LJ7A 3PVOA 1QKQA 2GNBA 5HCBA 2EXJA 3ILFA 1CN1A 3WHTA 2GDFA 4DRVA 3B00A 5JMCA 1QDCA 4YZ2A 5T54A 1W6QB 1Q8VA 4CTEA 2DWRA 1LECA 4SLIA 1IKPA 3SITA 4ATEA 1WBFA 3SLIA 1ENSA 1MS3A 4MYEA 3W58A 2P3JA 1YO8A 3ZVXA 1UL9A 5EXOA 2WKKA 3RSJA 3WZ1A 2AENA 4FPKA 1HQLA 4XHBA 1DYPA 1UPSA 3WOGA 3ZYRA 1I1EA 2WT1A 1UZZA 4DPNA 1YXWA 2D6LX 3A0NA 4M01A 2C5DA 3INAA 2ZA9A 3USUB 1AX2A 1U0AA 1Z78A 1WD3A 2I2SA 1GZCA 1MACA 1O4YA 1SLCA 4XIOA 5DXDA 4LBLA 3OBTA 4DRRA 1DQ5A 1ULDA 3NV1A 4W65A 1AXKA 2JE9A 2ZGNA 5F5QA 1PZ8A 1F5FA 3N36A 1WCSA 3POWA 1GBGA 4FOQA 1V6JA 4P9YA 1CVNA 1YYNA 3OPZA 5HCFA 2D3PA 1NXD1 2WSUA 4R9AA 4XZPA 5IK7A 2DU1A 3FBYA 5CBLA 4RA0A 1MZ5A 1GICA 4PCRA 1CONA 5EWSA 2DU0A 3AYCA 2E6VA 2W52A 3D6EA 1SBFA 2WNEA 1CESA 1KITA 4UW6A 4AVVA 1S0EA 2ZABA 4Y24A 4WV8A 3M2MA 1CJPA 3UJOA 2G4IA 5GLTA 1UX6A 2AH2A 3BIWE 4JRAA 2A5ZA 2W08A 4Y20A 2VW1A 1C4RA 3R05A 4YGCA 4K21A 1DYKA 1CQ9A 3UJQA 3M3OA 3V65A 1QNYA 3R4UA 2DUPA 4XJUA 3CNAA 1KRIA 1FATA 4DQAA 1JXNA 1Q8OA 1VALA 1AX0A 5DUVA 3V0BB 4YM3A 1SACA 2JDZA 2R49A 1LESA 2LTNA 4M3CA 3VKOA 2DVBA 2FMDA 2YY1A 2ZHNA 1LCLA 1QDOA 5E89A 4Y1XA 4XBNA 4YM2A 1MZ6A 1IKQA 1V6IA 1W6PA 3AZZA 1ULGA 1F9KA 3WUCA 5H9RA 1LHOA 4AVTA 1D0HA 1BYHA 4PF5A 4YFWA 1LU1A 1YRZA 2XB6C 3IM0A 4XIKA 4XMIA 5H9PA 4XBQA 1SLBA 2AR6A 2A70A 3SH3A 3ZSMA 1GYKA 1S0DA 2OUHA 2A3WA 1GANA 2AREA 1JYCA 2EF6A 2TEPA 3RS6A 1GSLA 3SNMA 2DV9A 4BMEA 2R16A 3OJBA 1IS6A 5T52A 1H9WA 1DQ4A 1LULA 2E7QA 3AXEA 5GM0A 1W6NA 4XE9A 1WLCA 4UW4A 2OW4A 4ITCA 4YGBA 1AZDA 2WSVA 2YZ4A 1GNZA 5DZGA 2GMMA 4FPLA 4FPYA 3D5OA 5GLWA 4YZ3A 1J1TA 1H9PA 1OFSA 2CY6A 4Y22B 2UWAA 3A0KA 5KXCA 3ZPYA 2JKBA 4YZ4A 3ZYPA 1JOJA 1A8DA 1N1TA 1Q56A 3Q9OA 5CNAA 3MPPG 3AZVA 5T5PA 3MEPA 1IS3A 3SISA 1G9FA 3ILNA 4KBBA 4AGGA 1GZWA 3ZXJA 2VU9A 3WDYA 2NM1A 2OVUA 3N7MA 1YIFA 4XJZA 4AGVA 4XTPA 1SCRA 4XTMA 3PVEA 2GN7A 1FV3A 1JW6A 4BOWA 1CPMA 5T50A 2ZGSA 3MW3A 1N3PA 3AP7A 1JBCA 4YW5A 2D3SA 1S0IA 1TEIA 4ZKTB 1N47A 4Q2FA 1MS1A 3A4UA 3AFKA 3N7LA 1GV9A 1ENQA 3PVNA 4YG6A 3WDVA 3POSA 4BM8A 3VKMA 5IT6A 2Q5TA 3U4XA 3NWKA 3R4SA 3T1LA 1S0FA 1MR5A 2GNDA 1KDKA 3O0VA 1DQ2A 3N35A 1VIWB 1HDKA 3JUUA 3VKNA 3FLPA 3OY8B 3GALA 1WBLA 3AZYA 4D69A 3OYWA 3RMYA 1ZA4A 3ATGA 4YGEA 2A6VA 4JC1A 5T5LA 2ZAAA 1H30A 3N7JA 1DQ6A 2EALA 5DUWA 2D6NA 4GWNA 4Q8LA 2AGSA 3VV1A 2YXSA 2ZGPA 1IS5A 2ZKNA 1QOOA 3HN1A 3M1HA 4YW2A 4FPCA 2D6PA 3WCRA 5IK4A 1G9BA 4XMAA 3WDUA 1QMJA 5KXEA 4M3CB 3ZXLA 2C9AA 4DS0A 4FPEA 5EYYA 5JLVA 1V6MA 1WUVA 5GLZA 1W6PB 1MS4A 2UU8A 1OKQA 2VXRA 1V6KA 2DTYA 1R1ZA 3ZSLA 4XBLA 3OGGA 4Y26A 3B9CA 3KQRA 4BQ1A 4BLJA 1G86A 3IPVB 1Y7BA 2AUYA 3O5SA 1MVQA 1G7YA 3QCWA 4YFZA 4LBQA 3V0AB 5SV8A 1LHUA 3O12A 1N1VA 1B09A 3I8TA 3FFZA 4NO4A 3D4KA 4YG0A 4GKYA 2A3YA 4AWDA 1WLDA 1LGCA 4Q27A 1SBEA 1FAYA 4GALA 3AP4A 4BMBA 4Y1VA 3AYAA 4U36A 4FPFA 2SLIA 2R0HA 1LHWA 3AP6A 3UL2A 4XJAA 1IS4A 1LEDA 5CAZA 2EIGA 1OQ1A 3VKFC 2OUJA 2W39A 2VY0A 1LOCA 2ZGQA 1FX5A 3QLQA 4NOTA 3WHUA 3DUIA 5E8AA 1O4ZA 4XXAA 1LGNA 2SBAA 1G9DA 1DBNA 2UURA 1A3KA 1GZWB 3FLTA 2ARXA 1AX1A 2A6YA 2D3RA 4HL0A 3HMYA 2ZHMA 3MW2A 2DUOA 2A71A 4LBNA 2WT2A 3W59A 2A75A 4UW3A 2GN3A 1RINA 1SBDA 4FOYA 1VAMA 2WLQA 4FQZA 4R9CA 3WCSA 1C1FA 1Q8SA 5IK8A 5T5OA 1MS8A 1DQ0A 2CWSA 3N7KA 2CTVA 4AVSA 2PHXA 2ZMKA 2DYCA 2EXHA 2YMZA 5T55A 1ONAA 1W6MA 1FYUA 1HKDA 3IKWA 4YGDA 1S0CA 5CA6A 5IUQA 2NYYA 1V00A 2B7YA 4CRQA 1Q8PA 5DZEA 2PHRA 4TZDA 3OYWB 2GMPA 2E7TA 1X50A 3WDWA 2PHFA 5FRAA 5LK5A 4BLIA 4C1WA 4PBOA 2XG3A 3AJZA 2NN8A 4FVVA 4M00A 4YW1A 3B3QE 1AF9A 2ERFA 2A6ZA 2ZGUA 1QNWA 3WV6A 4YW4A 1W0OA 1DGLA 1KJLA 4Y1ZA 3I4IA 1S0BA
chains in the Genus database with same CATH superfamily
4RL7A 2C26A 1IOAA 3JU9A 5IVFA 3MFAA 1OLQA 3OEBA 2FD8A 3HBKA 2GH8A 5A3NA 4WVVA 3L2YA 1C8M2 1TMF2 1ENRA 5FQ0A 1EV12 4Q4W2 1A6CA 4AGRA 2P37A 5CIRA 4R9BA 4FAGA 4Y3OA 1UPIA 3D0SA 1W8HA 1LU2A 2FDIA 3BKZA 3HQRA 2OA2A 2QFEA 1QQP1 3DGTA 2OQ6A 3ZSKA 3DECA 4KWKA 1RUD1 3S7EA 3ACIA 4DMIA 1HRV2 3B9IA 5ERLA 3ZFGA 2A7AA 1JHNA 5IW0A 1UMZA 1WLWA 3RGBA 1CAVA 1UMIA 2F4LA 1CPNA 3GZEA 3HQXA 3AYDA 4CA9A 3H7JA 1UU5A 4MGQA 2LM3A 4OHXA 3FHQA 4CVUA 2XHNA 1DLCA 4QPYA 4R52A 4Y20B 5LATA 4YARA 4ASMB 2XUEA 4LIVA 5FFOC 3OGVA 4Z8BA 3UKNA 5A3UA 4G3YC 4L2NA 5FZFA 1OHFA 1S4CA 2RHPA 2G9FA 3USSA 4BWOA 4E8DA 2HYXA 2JDAA 4P5HA 1DLLA 1LOFA 5IVEA 5F5IA 3M8LA 1RUH3 1VBC1 4KG0A 3P3NA 1SLTA 1W2UA 5IAVA 1POV1 3ZXKA 1YJKA 5A1LA 5F5AA 1WWYA 1Z7S3 4OUEA 3C2UA 2WBKA 4YVWA 4R8HA 3IMNA 5CFDC 4O61A 5JIUA 2CGOA 4XAEA 2B4KA 2ZHKA 3K46A 4GA9A 2Q8OA 4CEYC 1W6OA 4CDQB 2VECA 2JXAA 4HMZA 4DB5A 5JXIA 1DFQA 1RUOA 3KZ4C 3THDA 4DZGA 5GLVA 2WWSA 1N1SA 4LMFA 4HANA 2VMEA 1JZ4A 4LKSA 4LTAA 1RJ8A 5FLIA 4LBKA 1FOD1 2R043 5HBAA 2ZACA 2J1UA 2FBEA 1CWPA 1CIWA 2BVVA 2XQRA 3TNQA 4OZXA 4EZ4A 2QZ2A 1S2KA 2RS51 1G8WA 1W6NB 2BFUL 4N43A 5HPOA 4XAAA 5FO9B 2GMEA 1GQHA 2A6XA 4UF0B 4XXPA 3RDIA 4Q4Y3 5C8CB 1CAXA 1OH4A 1UOFA 1VAVA 2A6WA 2YGLA 4XC9A 2I45A 4N53A 4O9GA 2PYTA 5GALA 2EAAA 1GLHA 1RUE3 2WNVB 1AR73 2DVAA 3T09A 4CP9A 4MHRA 1EYBA 2PAMA 3M3CA 4UAPA 4HVQA 5AC93 5DUXA 5F3IA 1ZBE3 4EJRA 2JX9A 4OULA 4OUSA 1LKNA 1G9CA 1H1IA 2GP5A 4I3GA 1W6QA 2VZ3A 1POQA 1QJU3 4B4QA 5JXHA 2VNGA 1WCUA 1AL22 1JN2P 2VOXA 4CZSA 1NCRC 3MICA 5FZOB 1RB8G 1COV1 1XQNA 5FZMA 4OI4A 4EWAA 2UWCA 3RQ0A 5C4WC 1URXA 1XPWA 2G19A 5FWEA 1Y43B 2VOTA 1PO21 1ULCA 3UGFA 4IEWA 3VD5A 3O1MA 3KGZA 4QAWA 2E51A 3RG0A 1O8PA 1QOTA 1CAUB 1D2SA 1FPN1 1BVVA 5D1IA 2OKXA 2IZWA 4D0QA 4YZ5A 4MUVA 2CWMA 1DHKB 5F2SA 2D43A 1S0GA 4UFHA 1BK0A 4K8RB 1HQNA 5APAA 4IEYA 1OC1A 2W0XA 1RUNA 4AEDB 2NZ9A 3VD9A 1KS5A 1UYYA 4MGYE 3KWVA 3ZYGA 4OI0A 2RJKA 1DQ1A 2B5HA 5FY5A 4ISRA 4QB2A 3IMMA 1NZCA 1W8ZA 2NMOA 1SFPA 2ET7A 3DYPA 3KF5A 4LITA 1X82A 2VBBA 1WKYA 2RM23 1W0PA 1QJY1 2D97A 5FKCA 1KDMA 2E53A 3AP5A 3G6JB 3NV3A 4Y33A 5JVVA 2FQPA 1OUXA 3SXWA 4AI0A 3V0AA 2BEOA 3O1SA 3ZIWA 2YROA 3LCPA 3T08A 3IN9A 4ET7A 4Z2AA 1FOD2 2FDGA 5ABJC 4QPIB 4RQPA 3HT2A 5F9TA 2LRPA 1X7NA 3B02A 3T3YA 3O1TA 3LAGA 2WA3A 1HLCA 3VZJA 4MGKE 3I2KA 3J8F3 1OBNA 4RSUA 5FPUA 1YFYA 2R063 2QQNA 2EXKA 1EUUA 1YQ6A 2X8KA 1NA1C 1AR83 2HEVF 4JKLA 5L9RA 2WABA 1FT9A 4MO3M 4P9WA 4V2WA 3PUIA 2OIIA 3TB0A 1JU3A 2IVJA 4W6XA 3RZJA 1PM4A 4QPGC 5JWPA 2VH9A 4ZZ8A 1V9U1 1JZ6A 3ZKYA 5A1AA 2PHWA 2XBO1 4PQQA 5A7SA 4AOCA 1XNBA 1W8TA 2BNMA 3V64A 4K7JA 1IPSA 2WZR1 4XUPA 2HWF2 4V1PA 5A3WA 5H9QA 1GOGA 4KBZA 4MX3A 4HPKB 4COYA 1COV2 1LJ7A 3FC0A 1W8UA 3ZYFA 2CGPA 1XNKA 4RR3B 1PO22 2YHJA 1GWLA 3HN3A 2GDFA 4HSJA 1HV0A 2Z69A 5K7PA 4B7KA 4CCEA 1C28A 1FPN2 2J1TA 4CTEA 2DWRA 3GYDA 5EP9A 3DCQA 1OKOA 1HXS3 1OOPB 3OD0A 4CDUC 1VB2A 1SDDB 3E6BA 1HX6A 2WFF3 1RYYA 2OZJA 5EXOA 3RSJA 4L92A 3SCFA 3NMBA 1HQLA 3C7HA 2XVGA 2MEV2 1OSGA 4K6BA 2RMU3 1ND2A 3NKGA 4JTOA 3T0AA 3ZYRA 3LEGA 2IXCA 3NJZA 3KHCA 2VNVA 1QJY2 5C6CA 2HJIA 1GWMA 2Y60A 2VM9A 2ZA9A 3FHAA 4HKOA 3USUB 1AX2A 2HWB1 4NPMA 1WD3A 1HIXA 5IFPA 1W9FA 5FMBA 3N9OA 1XE7A 3PU8A 3PIGA 5HV4A 4EROA 2FCVA 3RYPA 4NWVA 4Y5SA 3DN7A 4W65A 1V0AA 1ZNPA 4BIOA 1NCQB 2ZGNA 3POWA 4LO6B 4FOQA 2VCBA 1UXXX 1K5MC 4IV3C 4KWJA 4AEJA 1YYNA 3BIEA 5JAXA 4BYYA 3N9NA 2R7EB 4QX5A 5KWRA 1GICA 4PCRA 4HBNA 1H4GA 4YVSB 4D94A 2RR12 3D6EA 5EZWA 4NHLA 2WYFA 3IWZA 5LK7B 1JYXA 4Y5TA 4X6QB 5FQ0B 4CDXC 5IVCA 1S0EA 4Y24A 1UXZA 5JZGB 2RJLA 1V9U2 5ISLA 1OFNA 2G4IA 4DXSA 1UX6A 5L7OC 4GMP0 1RUG3 1W0NA 3MPBA 2BJSA 3BYWA 3KVBA 2A5ZA 2W08A 3AVRA 1QJX3 2EIBA 2K2SA 2WA4A 3HNMA 2HEYF 1HV1A 1QNYA 2UY9A 3R4UA 3ZFGB 2DUPA 3E6CC 2E31A 3CNAA 2G1MA 3O7OA 5FTTC 1JXNA 3RZKA 1IG0A 2VQAA 5DUVA 4XFBA 4GD4A 4YM3A 4QX2A 1OLRA 2LTNA 1QHDA 2V5DA 3BTYA 3MGUA 5FZHA 5FZ1A 1LCLA 2K9ZA 4NHYA 4YM2A 1MZ6A 1V6IA 1GQGA 1OPMA 2WRAA 1F9KA 4HFSA 1XJAA 1DGRN 1KEXA 4GAZA 1D0HA 1RVF3 1LU1A 1S2BA 1JYWA 3LIGA 1OA2A 2JDUA 3B7MA 3U11A 2AACA 1GYKA 1QEXA 2VVEA 3ZSMA 4E2GA 1Y4WA 1ZZBA 3U78A 2FDHA 3LFMA 2XJRA 1X8MA 5FMDA 1VBA2 5JIAA 1JHJA 1REDA 2EF6A 1GSLA 1SPPB 2TEPA 3MF9A 4KNCA 3RS6A 5JPMB 2B8MA 2CDOA 2RS11 2J1AA 4TWTA 1QJFA 4OZOA 3RZHA 1LULA 1YQ2A 5GM0A 1C5HA 1VJ2A 2HWB2 1AR92 2QBXA 4ITCA 4JGYC 1REEA 2YZ4A 1REFA 2YBSA 4MXWB 5DZGA 4FPYA 5FMOL 4IETA 3T30A 1BEV1 1H9PA 3ME2A 1OFSA 2CY6A 2GC0A 5LA9A 2ZEXA 3ZFFC 3A0KA 3O1PA 5KXCA 2EIEA 3VDDC 2QQLA 1US2A 1R083 2C6SA 2HKXA 1JOJA 4NVPA 1H1AA 4QDQA 4RS5A 3NQHA 5CNAA 4DUWA 4QU1A 2ILMA 4QXCA 3AZVA 1BBT1 2HWE1 2WN3A 4DOUA 4XVHA 1STMA 4JVAA 3ZFEA 1YC61 2MPFA 1GZWA 3ZXJA 2VU9A 3BCWA 3KVAA 3P6BA 4IEPA 5AVPA 1YIFA 1CAXB 4Q29A 1A8MA 4DUVA 4QX8A 3TEYA 4CP2A 1JW6A 4BOWA 2FZ1A 3HEIA 5SV5A 3Q8CA 3TRSB 5IVVA 2Y8KA 5T50A 1RHI3 1N3PA 3AP7A 5FZAA 1JBCA 4GJZA 1S0IA 1GZTA 3RVHA 1JTZX 1OA4A 5J37A 2WZPP 5F32A 3VKMA 3IAQA 4RGKA 4WM8B 5IT6A 3U4XA 3NWKA 3R4SA 2JIGA 2RS33 1VBB2 3L9JT 1KDKA 3O0VA 1DQ2A 3N35A 3SHRA 4O9EA 2XKPA 5CG8A 1PHMA 2R6QA 1HDKA 2VZPA 5BNOB 1I5PA 2W92A 3GALA 5C70A 4Y5Z0 5L36A 2WNUC 1F2NA 3C3VA 4YPJA 3RMYA 1VBE1 3IT8A 1J3RA 4CCCA 3TN93 4EN7B 1F4AA 3N7JA 4BQ5A 4XFGA 2IWGB 4RHV3 1UYPA 2AGSA 1T6GC 1PO13 3HN1A 3MYXA 4CUBA 4HK8A 3WCRA 1AYM1 3CO2A 3NAPA 4FPCA 2QNKA 3J7MA 1BCXA 4Q4V3 3BOWA 4Z82A 3ZXLA 4DS0A 1GP6A 5FUNA 5HCHA 3DEMA 4CDWB 1WUVA 3KCCA 4P00B 3WF0A 2C24A 1W6PB 3AKRA 1GOHA 1OKQA 3MDPA 2RS12 2R072 1E5RA 1V6KA 5FY0A 4BQXA 1XU2A 2W94A 5C9AA 2BVBA 4Y26A 3B9CA 4P08A 4XF0A 4BQ1A 1O3TA 1R1A3 2XLGA 2J1EA 4LULA 5EPAA 3ZXAC 1XE0A 1GNYA 2ATFA 1BEV2 1G7YA 2WNOA 4XABA 2WR9A 3VBFC 5SV8A 3V0AB 4LO7A 1J84A 2XONA 3AKQA 3I8TA 3ITQA 1VRH3 3JBG1 3O12A 4JZRA 4RYDA 4XFHA 4ZXEA 4GKYA 4A7ZA 2HEWF 3CF6E 3VD4A 4BK4A 4P9GA 2X09A 4ZU7A 5C7GA 2XJSA 2GZWA 3ACGA 4IL7A 4RGGA 2O0OA 1FAYA 1BBT2 5KC6A 1XOYA 3AP4A 3O1OA 3WNNA 3RI8A 1US3A 4Y1VA 1ULOA 4V2VA 1D7PM 4CP0A 2WL1A 3I2FA 3RYRA 5LBEA 5K0UB 3R6SA 1MEC3 4IE4A 1UZWA 1PNGA 2BGCA 2QQOA 3MF6A 2ETEA 4LQRA 4PF1A 5K4LA 3VDCA 5CFCA 4NOTA 3QLQA 2JG8C 2BUKA 1O4ZA 3HBZA 3WP6A 4CDQC 3E6DA 4BXSV 1CX4A 1XC6A 2R30A 2Q30A 1UY1A 5E1RA 3H8RA 3OUHA 2A6YA 5KR7A 4OLLA 3H8XA 2D3RA 5A80A 2Y6JA 4CEWB 2H6BA 1GQPA 4JV4A 2A71A 1P8JA 2PLV1 3NJVA 4ZONA 3W59A 1YFXA 2GN3A 4GB33 1CZTA 2GH2A 4FQZA 1OT5A 1VAMA 3CU7A 4LIUA 4AK3A 4EN8B 1IPKA 1C1FA 4LKEA 2PQSA 3C7OA 2W95A 4A2UA 5T5OA 2CWSA 5FZ9A 3WW3A 4DXZA 3WW4A 5FZ7A 4E2QA 3VN4A 1R64A 1RUI3 3OEAA 1AYM2 5T55A 2JD9A 1FYUA 5FWJA 1XYOA 3IKWA 3LGRA 2VE1A 4B1MA 4LJHA 4INDA 1V00A 3NRUA 2V72A 4TZDA 1GU3A 5C5TA 4LO4B 2JKXA 4GMP1 5D2AA 2GAUA 4TLGA 2VG9A 4UF0A 5FRAA 3WF4A 4BLIA 3AJZA 2VNRA 3B3QE 4AI2A 2ERFA 3N9PA 2A6ZA 4A7YA 1QNWA 3KT4A 4QGNA 2DCTA 1U12A 1KJLA 3I4IA 2Y0IA 5FXZA 3R0RA 1RXFA 1LODA 2P34A 5KHHA 3JBG2 4PLOA 5J98B 3ES4A 3OGSA 1CZSA 5CKMA 3WNXA 3ETPA 4H7MA 3MLKA 4A6OA 5FZOA 4YG3A 4DFSA 1VMHA 2CNAA 2TBVA 2VC9A 2EICA 3GJAA 4FPOB 5A6XA 5CISA 3WP3A 2UWBA 3AKSA 2E7AA 2GNMA 3IAPA 1Q8QA 4UBGA 2VZTA 5FO7B 4E4HA 1JZ7A 1TQ5A 5KHKA 4JHZA 1CAUA 1LTEA 4IE7A 5LASA 3RRDA 2ENRA 2X53S 2OS2A 1KFXL 2DBIA 1ZZCA 1OI6A 1EAH3 1LGBA 1EUTA 3A23A 3CJXA 2C0ZA 2XHKA 3VBSC 1XNDA 1JYTA 4HONA 4AW7A 3KGLA 2IXIA 5FZ6A 2XPJA 4URAA 4AEDA 5C8WA 4JGZA 4LA2A 1YCIA 1RUJ3 2ZGRA 2Z42A 4PDWB 4YW3A 2EXIA 4OI2A 3E5UA 1UY2A 2PLV2 3T2TA 1VBD1 4P5YA 2YBKA 2Y26A 5DUUA 2DCZA 4EZHA 2EIDA 1YIPA 4Q1RA 3VLBB 1UCXA 3T1MA 1MS5A 1H2LA 3GZTB 4ZZ5A 2AYHA 5I0SA 4LR4A 5BNPC 2PFWA 3ELNA 1S2EA 4LBOA 1NQJA 4QGLA 5FZGA 3MLJA 2WS92 1LB2A 1KS4A 2P17A 3J4UH 5CB7A 2VBDA 4WZFA 1ZRDA 1BK1A 4XJ9A 5GZCA 3GJBA 5JOZA 1AHSA 3VL8A 1N3OA 4D6SA 5L73A 2ARCA 3M3QA 2W47A 1PX4A 4LE4A 4QPWA 1BVP1 5GZFA 1X9TA 4FFHA 5IWFA 1H0BA 1YI7A 4LE3A 3X29B 5I8TA 4AHWA 2X5IB 4RD7A 1BJQA 2WQZC 1PIV3 1UZ0A 3GM8A 4Q0QA 3T2QA 3ZKUA 4DEVA 3GNEA 3K3NA 1AXZA 1W6MB 3AL5A 4D7TA 4XCAA 4XZUG 2H0VA 2WZEA 5EJ3A 4CCLA 3U1XA 5BXXA 2XQXA 1C57A 1PGSA 3OSDA 3KSCA 2P6HA 3FHIB 1AXYA 4FXGB 3ZN6A 3APBA 5K9YA 4NIIA 5M0TA 1RUF3 2BV4A 1GWKA 3FLRA 3MW4A 2O14A 2BRTA 1PVC1 4UI9L 4Y4RA 4KQ7A 1R091 1BQPA 5LY2A 1NLSA 2NPIA 2V73A 1AR62 3N3HA 1F31A 1TME1 4Q26A 2CSGA 2HWC2 3HAGA 1C8M3 4HPKA 4YLZA 1TMF3 4Q8KA 4GWMA 5HCFA 2P4EA 1LHNA 1DZQA 1EV13 2VUAA 4Q4W3 3U75A 3WDTA 4FO9A 4LBMA 3ZYIB 4COUA 1AYN2 4RS5B 5D21A 4WVWA 2VW0A 4AI1A 2DCJA 4HXCA 4YWAA 1APNA 3ZFEB 3ZR5A 5CEHA 1PGL2 1ASJ1 2JB8A 4I0WB 4LBJA 2Q1FA 5DG2A 2IXLA 5FP7A 1JU4A 4TTGA 4W4ZA 1OOPA 4XQDA 1MZEA 1UYZA 2JE8A 2W46A 2DVDA 3AZWA 3JD71 3ALQA 3MO4A 2EA7A 4LBQD 5A33A 1X36A 3OY8A 4FT8A 3ZM8A 2BBAA 4Y1UA 3FUOA 4FQ4A 1H8TC 5JOXA 4BK5A 1J59A 4EE2A 2GSYA 4A4AA 5A6YA 1OVPA 2QVSB 2ZMNA 3CQOA 4F7ZA 3P3PA 1PZ9A 3POFA 1IQAA 1XNAA 2ZBJA 5A7QA 3ACHA 4HSLA 1MS0A 4WM7B 5ACA1 2FZ2A 1LOGA 2ZGLA 1N3QA 1MQTB 1PMIA 2JJ6A 1RUC3 3USUA 4LT5A 3SH4A 1RIRA 4FTBA 3C7GA 1ZRRA 4JDOA 4CXYA 1QU0A 1W8FA 2HH9A 1LHVA 4XDOA 2D6MA 1A78A 2JG9B 3SEPA 1NCQA 1WW5A 2W2IA 2D93A 1SQ4A 2VGDA 3DPRA 3DXUA 1LOBA 1VB4A 3ACLA 2ZPXA 4K40A 4D6RA 5ANQA 5FZ4A 2R0FA 3IPVA 3PIJA 5KXBA 2Q8DA 4P02B 5LEKA 4YVSA 1DDLA 3O0XA 2H0BA 2RDSA 4EN6B 3I3DA 1ZBA3 1ULEA 2JB4A 3BOPA 1BKZA 4XFIA 2D6OX 2VL4A 5JZGA 1I6XA 1NUKA 5A70A 1QJZA 5C9AB 1Z0HA 1ZM1A 1QXRA 1U5XA 1UN1A 4COVA 1QGLA 4U2AA 4UWDA 4L99A 3H0OA 4PBPA 3S7IA 1PVC2 4N7UA 3TAYA 3ENRA 1RTVA 1TME2 4M3CE 5J48A 2IC1A 2NLRA 5B4NA 1PMJX 3FJSA 2ZMLA 3A22A 3CJIB 2WO2A 5F3GA 4OHYA 3KCYA 5FY8A 1YQ8A 2DCYA 1UD1A 4K1ZA 2DVFA 4FOWA 5H9SA 2YGMA 1WCDJ 3FMGA 1Q43A 4JCKA 3NV2A 5FYVA 1LOFC 4RFRB 5EQUA 5C3RA 3A21A 2X05A 5EYXA 3WG3A 4FI9A 4FBFA 4QXBA 2D5HA 3JD72 1VP6A 2P2KA 3VBOB 2VO5A 2WWJA 1ND3C 1AL23 3H1WA 2GNBA 4IEVA 4YVWC 5HCBA 5CFCB 5JMOA 5T3NA 1CN1A 4QQOA 1F35A 1WA6X 1QDCA 4YZ2A 4CCOA 1Q8VA 4ZS3A 1W9SA 2I74A 4Q4X3 5FBZA 1SPPA 5ACA2 4XUTA 3SITA 4ATEA 1WBFA 1ENSA 5FXXA 4EN9B 3W58A 1OLME 3VBHB 1RUH1 3WZ1A 2JDKA 4FPKA 3IDBB 4HN0A 4MXWA 4N43C 4XHBA 1Z7S1 5FJHA 3W5MA 3GBWA 3WOGA 3FZ3A 4CSWA 1UOBA 2D6LX 4M01A 2C5DA 2JEMA 4N53C 2CAVA 4H14A 1Y9MA 3I3MA 3U14A 1YJLA 1Z78A 3RJ2X 1WZXA 2I2SA 2JDYA 5F3EA 2J1RA 3NVCA 5FZKA 1GZCA 1O4YA 3E5XA 3UETA 3LA2A 2ZX1A 1ULPA 4IE0A 5DXDA 2R041 1SEFA 4LBLA 2OYZA 5K8SA 3VDBA 2KR2A 1GFF2 4IEXA 1V6JA 5F7UA 4R4XA 2F6BA 3LWCA 1NXD1 2HBUA 3I2JA 4M0NA 3EHKA 5L9BA 3OUJA 3FBYA 5CBLA 2KD7A 4L9BA 1MZ5A 2PQQA 4BQ3A 1QQP2 1TE1B 5FXWA 5BNNB 4Q4Y1 1J83A 3AYCA 2W52A 1RUD2 4CPBA 1SBFA 1CESA 1BHGA 3B5LB 4UW6A 1RUE1 1AR71 3GHMA 1W03A 1J3QA 4WM8A 1ALYA 2Z4FA 5FYTA 2VQUA 2ZS6B 3M2MA 4HKLA 4WV8A 5ANNA 5AC91 4DUXA 5LRSA 4NWWA 3MIGA 5GLTA 3BU7A 2AH2A 1XNCA 5BNOA 4TLFA 4AFAA 5I0DA 1QJU1 2YB7A 4KGGA 2VW1A 3OG2A 2VUDA 4QMAA 2W3JA 3GZAA 3UJQA 2HWF3 2WQ4A 4G4FA 3V65A 3ZMOA 2B9UA 3VZMA 4QD2A 1YQCA 4E27A 1AX0A 3HQUA 1YFUA 2JDZA 2R49A 1LESA 1O7FA 2DVBA 1ACCA 2WQ8A 5IFTA 3I3EA 3FX3A 4FTEA 4XCBA 4JGZB 5KHGA 1QDOA 1VBC2 1XU1A 4Y1XA 4XBNA 4CDWA 2HLEA 4OHVA 1XXNA 1W6PA 1FPN3 1ULGA 3FN9A 1ZRCA 4Z2WA 2Y6GA 4AVTA 2CDPA 1X9PA 1BYHA 3JCIA 4PF5A 4XQ4A 3VBUC 2XB6C 4RQPC 1RL3A 3HD8B 1JI6A 3Q8EA 4JQRA 1JZ3A 1S0DA 2VTXA 4KI5M 3GHNA 2QTWB 3DXTA 1JYCA 3VL9A 1OA3A 3VD3A 1J1LA 2MEV3 1JODA 2RM21 4N7IA 4P9IA 1H9WA 3LZZA 4F8AA 1TVGA 1QWRA 4G9SB 4UW4A 3HWJA 2OW4A 3WNOA 2UY8A 1LNSA 2RS52 2XUMA 2ZCWA 2ZZQA 4BHPA 1GNZA 1H4HA 4NIDA 3D5OA 2R042 4QHOA 4YZ3A 5FY4A 2RG4A 2BGPA 2VMGA 3FE5A 3IIAA 5K0UA 3ECQA 2IVIB 2JKBA 2XJPA 3MHZA 4PIXA 3J8F1 1A8DA 3I59B 4OUMA 3WNLA 4XF3A 3KT1A 5KBFA 3LD8A 3Q9OA 1RMU1 2R061 3MPPG 2J22A 5F6KA 4B8EA 4QKFA 5T5PA 3MEPA 4Q4Y2 2JENA 4MGZE 2JDHA 1AR81 3ZN6B 1G9FA 3PNAA 5EIYB 5FYCA 1RUE2 3W9AA 2NM1A 1AR72 2OVUA 2ZX3A 2RR13 3N7MA 4N9IA 1E5HA 4TN7A 4CEWA 3T0DA 2J42A 3PHMA 4XTMA 3PVEA 1I9RA 2DFBA 4W8JA 2GN7A 4IGOA 2JDPA 5FZ3A 1X33A 3KF3A 3WQ1A 3MUZ1 1QJU2 4CYDA 4YW5A 3UKVA 3Q8AA 1WCKA 3KV4A 4OHZA 1PK6C 3S5QA 3WNKA 3I2HA 4Q2FA 2C4XA 3AFKA 1H2NA 5C33A 4BM8A 4IEZA 3ZDSA 4TXWA 1MR5A 1ND2C 1K45A 4H2AA 1ZRFA 5A33B 3VKNA 3OY8B 3O1UA 4A7KA 4ARXA 1DZRA 4ASLA 4LO8A 4YGEA 5DDJ3 5LY1A 1HXS1 4QDSA 1QIQA 2ZAAA 5T5LA 4UFJA 5JSPA 3QACA 5LBCA 2D6NA 4GWNA 4Q8LA 3KV6A 5FZ0A 3VV1A 2WFF1 2YXSA 2VZQA 3F2ZA 3WQ7A 1QOOA 2X29A 2QQIA 4YW2A 5FKBA 3CZJA 5F6LB 1NE6A 4CXWA 4M3CB 1T2XA 1L7RA 1NT0A 4ZY9A 1W2TA 2UYBA 1V6MA 5FY9A 1B35B 5GLZA 4LLOA 2RMU1 3K77A 1MS4A 2UU8A 1PGW1 2RM22 1OVSA 1VBA3 4NROA 1NE4A 3PDQA 5LEJA 4OQ9A 3DPRB 3WQ0A 1IGOA 5F39A 1U5IA 3E5QA 4BLJA 2B9VA 4IEQA 4LNVA 1AR93 3IPVB 2AUYA 4YFZA 1MVQA 3QCWA 4UFIA 2OPKA 1N1VA 4NO4A 4ONUA 1OQEA 2X10A 3PURA 4DXTA 2A3YA 4Q27A 1RMU2 1SBEA 2R062 3KCXA 3KT7A 2BFUS 3LPFA 1D4VB 4GALA 4PT6A 5DAVA 4AI8A 4CCJA 1AR82 4IV1B 2QQMA 2XBO2 3NSTA 4I0AA 4QM9A 4UT5A 4URTA 3DKWA 4FPFA 3NNGA 5LWBA 4UYBA 4PDWA 3VBRB 2WZR2 4QGMA 3GDBA 5FZIA 3UL2A 3AKTA 4E4DX 5C5UA 4NHXA 3QH7A 3TEWA 2B45X 1OQ1A 2EIGA 3IBMA 2OUJA 4CU8A 1WMDA 4FCAA 2ZGQA 3CHXA 1RUG1 4XXAA 1LGNA 1Y9GA 2J1SA 5DQ0A 4CUGA 4E8CA 4IW3A 4FFGA 1DBNA 5IVBA 1QJX1 3C7FA 4JDNA 4KWLA 1AL0G 2ARXA 4HT1T 4GH4C 1GUIA 3LQCA 3MV11 1GP5A 3THCA 4EYUA 2ZHMA 1W06A 3WEZA 2DUOA 4LBNA 1WGPA 2ET1A 2WT2A 3AMNA 3FL7A 4KL1A 3UT0A 3I2OA 3BVCA 1SZBA 2WO1A 5D8AA 2WO7A 1VBB3 1RINA 3J7LA 4FOYA 2WLQA 4OVEA 2QE3A 1Y9QA 4R9CA 3PUHA 1Q8SA 3AL6A 1WMFA 1HXS2 2ID4A 1EP0A 1W8NA 4JDMA 2X5IA 2WIIB 2BERA 4BU2A 2DYCA 2EXHA 1RVF1 2WUHA 5L7OA 2LW8A 4IGPA 1ONAA 4NRQA 1W6MA 4OFGA 3LFIA 4XW3A 4DY3A 5FPBA 1GOFA 4IEUA 5IUQA 3TWIA 2NYYA 5CA6A 1BMV2 4CRQA 4RS5C 2PN5A 1JZ2A 1EPZA 1DCSA 2RMU2 1X50A 1PGW2 1QH7A 3BALA 2ZAHA 2RJ2A 4B29A 4MADA 4QHZA 3WSOA 4M00A 2NN8A 5J36A 1F5JA 4BCUA 2RS13 2R073 4EQVA 2ZGUA 2QQPA 4W50A 4H7LA 1PNFA 3NJYA 1W0OA 4LXLA 5C3SA 2QQKA 3AFGA 1ENXA 2PTMA 2C9KA 4AHXA 1SLAA 5AVAA 4BJ0A 2GU9A 1R081 3HPNA 3OBRA 4NAMA 5DG1A 1S0JA 1GNHA 5JCTA 3SC7X 2OT7A 5FREA 4ORFA 4AL9A 3BI3A 2R1DA 3GF6A 2KA3A 4NJ4A 1FNYA 4RN5A 1DU3D 2D44A 5B2GB 2VVDA 4AQSA 4LBQB 1JMUB 1RGSA 1WD4A 4XACA 4ASKA 2VZVA 4YW7A 2XOMA 2IXHA 4BIFA 2P3YA 4CCMA 1UF2C 5CFDB 2R1BA 5F5CA 4MSVA 2OXBA 4JGYA 4WM7A 3O0WA 3H42B 1RHI1 4N9HA 2XH6A 5I0UA 1MQTA 4XOGA 5LRRA 3ST7A 1K42A 3NAPC 1GKBA 4HZFA 1FXZA 3SMHA 3D8CA 2GC2A 3ZPOA 3ZXFA 2PHDA 1SCSA 4AI9A 1JOBA 1SFNA 1W2AX 5JSOA 2VMFA 4K1YA 1SLIA 2RS31 2JE7A 2JG9A 4UFLA 3KHBA 3M7AA 2PMWB 4AQ2A 5I91A 1CD3G 2Y6KA 2JICA 1O3SA 1HN1A 1QOSA 4J1WA 5C3PA 5C9AC 1BXHA 3FFQA 3AXDA 4F83A 2ZGOA 3TN91 1TZOA 2Y0OA 3WF1A 4MLOA 1RVF2 2P3KA 4RHV1 2DCKA 1PO11 1UOJA 1W9TA 2ZGMA 3Q8BA 4IERA 4C1XA 5FYHA 1YLLA 4LHLA 4Q4V1 4A3ZA 4FPHA 4ZXKA 2CL2A 4O65A 1OUSA 4LK6A 5BYNA 1NG0A 1XNTA 3PU3A 3LIHA 2O8QA 1C1LA 5LA1A 3PJQA 2IFRA 4LHSA 4QU2A 4QDRA 3RMXA 2BDRA 1BZWA 2GP3A 2Q1ZB 4QT6A 1PM7A 2RVAA 2GALA 4GIQA 1LENA 1NOVA 2BWAA 2EAKA 3WT3A 2WWUA 2FHRA 3RNSA 3RZGA 3J7NA 1AJKA 5C4WB 1UZVA 1W04A 1R1A1 2WNUA 1O6UA 1QY4A 3CJIA 3I2DA 4JX0A 2HWE2 4AG4A 4TYSA 4XJ8A 1VRH1 4YRDA 3OF1A 4P14A 5F8PA 2CAUA 5E6HA 3WG2A 1ZRIA 5DZFA 3OTFA 2PHTA 1WW4A 1UAIA 3UESA 3GBGA 3VBOA 4PLMA 1MS9A 4QX7A 1FNZA 5E88A 1V6OA 4XEZA 5A7PA 4FPJA 3AZXA 3POYA 5JSRA 4BDVB 2ORZA 3WDXA 2DVGA 4RFT0 1MEC1 3OGJA 5EV7A 4CCDA 1S1AA 3LDBA 3OCPA 4SBVA 5GZEA 3AYEA 1W9YA 2PAEA 5LA2A 3P1IA 1W3VA 2DBNA 1LOAA 1C8NA 1QXPA 5KXDA 4H55A 3VBHA 2WT0A 1FV2A 3OB8A 1H2KA 3W5NA 5FYSA 4Y4YA 2HWD3 3H3UA 1VBE2 3LSEA 1QH6A 4LK7A 3ZN5A 5ABJB 5GZDA 4DO0A 1D4M3 1MVEA 4I30A 4FTSA 3ZDVA 1ZVFA 4KU8A 4GB31 5C8CC 3NW4A 2VZUA 2WINB 5BNQA 4XYXA 2WNVC 2VQTA 3DF0A 3K4DA 5CZKA 4QXHA 1H6XA 1NA1B 4YNIA 4E2SA 3VB9A 4YSFA 1DGWX 4B7EA 2XL7A 4RHV2 1WW6A 4IQPA 3ZXDA 2VCCA 1RUI1 3ROUA 2LUWA 4XURA 4Q4V2 1FI2A 2WS93 3U10A 2VMDA 4XHXA 2C1FA 4OMDA 4ES8A 1DIWA 5FBJA 1N1YA 3O14A 1HB1A 2BNNA 3PMEA 4MVTA 2VUJA 2Z5WA 4GWIA 1SLLA 5BNNA 3SKVA 4BQ2A 1ZX5A 3QD6A 2W1SA 1HRI3 3B69A 3WW1A 4PI0A 2VPVA 5JR7B 2XWJB 1RITA 5EHDA 4XDQA 3M3EA 1G6NA 5IYYA 5DAWA 5FMOS 1VRH2 1OH3A 2ZOEB 2QZ3A 5JPNB 1JUIA 4MGSA 3VZOA 4FPGA 4JTNA 4A6SA 4AEDC 2FCUA 2P3IA 4CDUB 3WNPA 1YQ5A 3D0JA 5DAPA 5BPXA 1AR63 1WMXA 3S0MA 2HWC3 1JZ5A 3K2OA 3K3OA 3BTZA 2W91A 3NNLA 5A3OA 1PVXA 1AYN3 4L8QA 5BV6A 4XF1A 1H1MA 3DL3A 1O5UA 1W3XA 2F4PA 3I2GA 1AVBA 3MBWA 4UW5A 3HJRA 4QQ2A 1EAH1 3AVSA 3THPA 2VR4A 4K20A 3VKLA 1OF3A 2QKDA 3BPSA 3PVOA 2O8OA 1QKQA 3ZYHA 4PJYA 4QPIC 2EXJA 3ILFA 1RUJ1 4JHTA 2Q8CA 4JKMA 3WHTA 4NIGA 4DRVA 5BUVA 5FZ8A 4UXAA 5JMCA 4M4RA 4IXLA 4NPLA 2A73B 1Y3TA 1K5MB 4IV3B 1LECA 4SLIA 4PHZA 1IKPA 3SLIA 2ZTNA 4H3WA 3POGA 4NE9A 4AFBA 5FOJB 4MYEA 1UQXA 1U5ZA 3TOJA 2P3JA 2IFWA 1Q3EA 4I3PA 3ZVXA 1UL9A 5D8AB 2WKKA 5FPAA 1CJDA 3LE0A 1JYVA 4NIAA 2AENA 2ORXA 4CCNA 5F2WA 4WVZA 2GC3A 3N4MA 3LPGA 1UW8A 1Q5OA 4P9JA 1ZZ9A 1I1EA 2WT1A 1UZZA 4DPNA 1YXWA 5FMCA 2IXKA 3RWNA 5L7OB 3INAA 3I59A 4NIHA 3AMHA 4NMIA 1U0AA 4RR3C 2Q0AA 3J26N 3LA3A 1MACA 1PIV1 5IVJA 5JXGA 3CMGA 3MIFA 5JI7A 3T4VA 3LEMA 4XF4A 1ULDA 5FY7A 2ZX0A 1EY2A 5F5QA 3CEWA 1PZ8A 2PAKA 4AEMA 4NRMA 3ABZA 1GBGA 5I8SA 4IEOA 3EXUA 2ADDA 1ZZ6A 1OOPC 2D3PA 2QJVA 2VVFA 2WSUA 4R9AA 2DU1A 3VD7A 4IGQA 1OQDA 4QXKA 3VZKA 4XDPA 1RUF1 2XJQA 3MIEA 4RA0A 4XFCA 4BQWA 2VZOA 3EMRA 5EWSA 5F1RA 1CONA 3S57A 2E6VA 2WO3A 3UV9A 2RDQA 3H1YA 1EV11 3EB7A 4Q4W1 2QCSB 3LEKA 2RV9A 2ZABA 3UGHA 3IDEA 2QQWA 4UBHA 1UU4A 1CJPA 1CZVA 2PXJA 1HRV3 1OPOA 4PLNA 3I3BA 5E16A 1K3IA 3BGAA 3BIWE 2XKOA 4GZ9A 4JRAA 2G9ZA 2Y38A 5A3MA 4AHZA 5FPXA 4YGCA 4BA6A 1DYKA 1FMD1 1ZZ8A 1PMHX 3PL0A 3W21A 4AR2A 1XYPA 1U5YA 1VBD2 2VTFA 4GWJA 3CZUA 3C8XA 1NCQC 3JD73 1FATA 4AF9A 4JGYB 1VALA 4DQAA 5A7OA 1RUJ2 3PUQA 4AFCA 3DPRC 4EWEA 4XF9A 5FPLA 1SACA 5A7WB 4M3CA 3SEEA 3VKOA 4IE5A 3RI9A 5A3TA 1JOPA 3ZFFB 4C91A 1B35A 1IZ3A 5E89A 3MLLA 3VDDB 3LB9A 5AFBA 4YVSC 3AZZA 3O1VA 3WUCA 5H9RA 1LHOA 4DNYA 1RUC1 1JH5A 4XIKA 4XMIA 2Y6FA 1MPXA 3FBMA 4XBQA 4CU6A 3SCGA 1OXCA 5JZGC 2A70A 3SH3A 2OUHA 3NKTA 2BWCA 4BISA 2A3WA 1SG3A 4LHNA 2ZXQA 4GULA 1I5ZA 3T2PA 3POEA 3SNMA 3WP4A 3H1MA 2R16A 3OJBA 3PLQA 2G9GA 2WAOA 3ON7A 5T52A 1H8TA 2YU2A 5FZCA 2AZ5A 4XE9A 3ZFGC 1WLCA 1AZDA 2WSVA 4IV1A 4WVMB 2GMMA 4FPLA 5B4XA 1ZBA1 5GLWA 4C90A 1CAWA 3VBRA 5JR2A 4DIQA 2J7MA 1GR3A 1OLMA 2UWAA 1R092 2OQ7A 4CUAA 4FFFA 2LS6A 1N1TA 4QQLA 3JZVA 2VJXA 3OBAA 1RUF2 2WNUB 1VMFA 4QX3A 1OF4A 3I97A 5CADA 1IS3A 3AKPA 3SISA 4AQ6A 3POBA 4KBBA 3ZN4A 5F37A 4AGGA 5I8YA 4AZZA 3LDKA 3WP5A 1QQP3 1YFWA 4E4ZA 1ASJ2 1WLTA 1RUD3 4XTPA 1SCRA 3KS7A 3ZMNA 2XJTA 4S2FA 1FV3A 2XL9A 4CE8A 2ZGSA 5JXJA 3WQBA 1XB9A 2ZJCA 2D3SA 4ZKTB 1FMD2 2YG0A 2ZX4A 3HOBA 2TNFA 5FOBB 3WDVA 4YG6A 1UY4A 1AL21 2Q5TA 4BH9A 1S0FA 2YFUA 5FPVA 3AMPA 2E33A 2Y33A 1VIWB 2P1BA 2XVLA 3JUUA 1UIKA 3FLPA 3TBDA 5I0TA 3VBFB 2ZX2A 1WBLA 2JDNA 3AZYA 4Q4X1 4QX1A 1ZA4A 2QQJA 3ATGA 2A6VA 4JC1A 5HI0A 1DQ6A 1VBC3 2EALA 5G04L 2AEZA 1POV3 1RUC2 1W05A 3PTYA 4Z92B 2ZKNA 5DPNA 3UYJA 3T4HB 4JQTA 4KU7A 4XMAA 5LBBA 2N7GA 2BP6A 4CCKA 5C3OA 2C9AA 4FPEA 5EYYA 5JLVA 3PUSA 2Q4SA 1ND3A 1UNBA 1UWWA 2FDJA 3I54A 2O1QA 3QOPA 4GQ7A 2JG8B 2DTYA 5KHIA 3ZSLA 3H3ZA 4BXFA 1FOD3 4AE2A 4WM8C 1YNAA 3KQRA 3RZLA 3OPTA 3GGLA 3P5BA 1D2QA 5HV0A 1ZBA2 2V4VA 1Y7BA 4NUBA 2RS53 2QQUA 3LOIA 4LBQA 5BNOC 1XSQA 2VCMA 3ZYJB 3HNYM 1KFUL 1YHFA 4B1LA 3FFZA 4LKFA 3D4KA 5CFDA 4A44A 2VOKA 5F3CA 4CEYA 3J7HA 2W1UA 2YDEA 4AWDA 1WLDA 4COWA 1LGCA 3THTA 5LCWL 3S5AA 4BMBA 2WLPA 1ZBE1 5I93A 1CGPA 3PVBB 3AYAA 4U36A 2VQ0A 4X8PA 3S6PA 2SLIA 3S30A 4F3JA 5DMYA 4IDZA 1LHWA 5IAXA 4AEKA 3U0ZA 1KXGA 1IS4A 1LEDA 4CDWC 2KXLA 3VKFC 2WN2A 2VY0A 3GCWA 3N9LA 5GKAC 3NNJA 2VOVA 2Y6LA 5E8AA 3ZO0B 1COV3 2YBPA 1G9DA 5FAXA 2UURA 1A3KA 3FLTA 2HWF1 1PO23 1JZ8A 1AX1A 1DG6A 4AHYA 4HL0A 1TNRA 1RJ7A 2A75A 4UW3A 3EYPA 5A3PA 5TSWA 5HXVA 3BU0A 1SBDA 2XMLA 1RUH2 4Q4X2 3WCSA 3G7DA 1VE0A 3TNPB 4FSJA 4UFKA 5IK8A 1D0GA 1DQ0A 1MS8A 1Z7S2 3U07A 1ST8A 2Y64A 4AVSA 2PHXA 1XSRA 2YMZA 2ZMKA 1NCRA 1NYWA 5K0UC 4K3UA 4MXVA 1HKDA 5C4WA 4XUNA 3PJYA 3IIIA 1S0CA 4E4SA 3N9MA 5FDBA 2CV6A 2ZKLA 1Q8PA 2AC1A 1L3JA 4DXRA 3OYWB 2GMPA 1QJY3 2E7TA 3IDAA 4J1XA 3WDWA 1YEWA 3FWEA 1W90A 2PHFA 5LK5A 1J58A 2MEV1 2Y34A 4PBOA 5IHRA 2XG3A 2ZEWA 4FVVA 3VBSB 1IQDC 2YPDA 4OQ8A 4CEWC 3WV6A 3HVDA 2DDUA 4YW4A 5IATA 1DGLA 2WZ8A 3M70A 4Y1ZA 1S0BA 2YUEA 4FP3A 2BU9A 3IDCB 3EQEA 4KGQA 4XILA 4ES9A 5JOWA 4P9XA 3KB5A 4FP2A 4K9SA 4EV0A 2YPJA 3VBUA 3K48A 4ISQA 5JDBA 3K4ZA 2JWPA 2NMNA 3BTXA 1LRHA 5HCAA 2CHHA 4Q0PA 2FDFA 4L0PA 3EO6A 4IESA 5AC92 3O1RA 3HIFA 1ZBE2 3BODA 3WVJA 3WNMA 3WG1A 5BNPB 1RMU3 1T6BX 2ZGTA 3UK9A 5JUVA 1V9U3 3SCHA 5FUPA 3ZXEA 2XBO3 2BTVC 2RR11 3ASIA 4GXLA 1PZ7A 5ABJA 2WZR3 1HW5A 2VOWA 1TG7A 2YV8A 3QH6A 1NY71 2DTWA 3V0BA 2VW2A 2FCTA 3LA7A 1ULFA 3OPWA 3POIA 3ZYBA 4DEQA 1GZ9A 1GP4A 1NAEA 5A6QA 1NA1A 3AJYA 4I09A 3J9SA 4QX0A 2MNGA 2V5YA 3GCXA 3NO8A 1JYNA 3RFRA 1ZYBA 3VDAA 4QPGA 1HN0A 3KV9A 4R9DA 2QDNA 2K46A 1CR7A 2ARBA 3JQWA 4ZPIA 1OD5A 1XRUA 2V4AA 3KD4A 5DDJ1 4BE3A 3CKHA 1W8WA 2WJSA 2WFPA 4ATFA 1L7QA 4QKDA 1QF3A 2JDMA 3RPQA 3KM5A 1OD3A 1K5JA 2PELA 1KQRA 4PI2A 1RXGA 3JQXA 5I0RA 4FOVA 4Q1PA 4BPZA 1WW7A 3VUOA 1PK6A 4ZHNA 1O3QA 2LROA 4YM0A 4DY5A 3N9QA 2LALA 2HWB3 2VZRA 4COZA 4Y22A 1VBA1 1G9AA 5FR3A 2XJVA 4PDWC 4MGIE 4LUKA 1W9WA 3WX5A 4CDUA 3M4FA 2BOJA 1YI9A 4YM1A 3AM2A 5DN2A 3IZOA 3J8F2 1HQWA 5JOYA 3M3IA 1H8TB 2QQVA 1AR91 3ACFA 5LA0A 1M4WA 1LOEA 2MHFA 5G05L 3UNPA 3VZNA 2VBPA 4MH0E 3WLUA 4EWDA 5J96B 3K75B 3LF7A 1A34A 5J7MA 1O4TA 3F95A 1BLZA 1W8OA 3U37A 1CAWB 3WG4A 2ZGKA 5GZGA 3AK0A 3PMSA 1SFYA 3A7QA 3WDYA 3BTAA 4META 1VMJA 3D82A 4M3CF 4HVOA 2DURA 3MUY1 4RGAA 5D8AC 4D3WA 1XE8A 4JKKA 4AXOA 3H8UA 2QUOA 2KM2A 4UOJA 3SH5A 3CDZB 2BBVA 1OURA 2TUNA 1K5MA 2BQPA 2X5IC 4IV3A 3AX4A 1QXJA 1DP0A 2PHUA 2HYKA 1NY72 3GBFA 4OI1A 3K51A 3H9AA 3TEXA 4YZ1A 4A41A 5FLHA 2XLFA 4CUCA 4MOAA 2ES3A 5T5JA 4IUGA 5FIXA 2GC1A 4NHKA 4A3XA 3DYOA 1LEMA 4Q0VA 4W6WA 5J3UA 1UZYA 2VCAA 5FP9A 3FUQA 4BQ4A 2DUQA 4CDXA 5A32A 5FLJA 1KJRA 3NV4A 4OCTA 3UGGA 2CYFA 1CAVB 1VBB1 2WFF2 3ZX7A 5LW9A 5IK5A 4XQWA 4R4ZA 1MZFA 4HETA 4TSVA 5CG9A 5FUIA 1ODMA 2E26A 4YW6A 3E1F1 5DDJ2 4IE6A 4Y1YA 3AB0A 1O59A 3V56A 5EJ1B 3WUDA 5GJ6A 2ZHLA 2IUWA 4HVRA 1VRBA 1H6YA 3WR0A 4X6RB 4AI3A 3VHOA 1X8EA 1VPHA 1O3RA 2CU5A 5FP8A 2OZ6A 1V6NA 3WXPA 4QQHA 3ZFEC 3ILRA 3LSDA 3R4DB 2ZZJA 1V6LA 1I3HA 3LOBA 3B01A 4LOTA 3ZSJA 4GH4A 2D6KA 3KLSA 3AP9A 4AYUA 2Y6HA 2NP0A 3HR9A 2R071 1ND3B 1BEV3 1EPWA 4YVWB 2AEYA 1UOGA 2EVXA 2I07B 2WDBA 3KV5A 1W6OB 4WM7C 2CGNA 2XVKA 1JYIA 2YFZA 3MFCA 1MQTC 4AAXA 2F17A 2W87A 3GZUC 4HN1A 2BNOA 5A6ZA 1F8VA 3AMQA 1UKGA 1BBT3 2HWE3 2JD4A 4PQ9A 4ZS2A 1AJOA 2W68A 1H8VA 4HG6B 2VMHA 2ZEYA 2B46X 3WF2A 4MGTA 5CKNA 2A3XA 4HLTA 2JG9C 2GNTA 2Z2SB 4CEYB 5FP4A 4FXKB 4LUMA 1RUG2 4OHWA 3WINE 4N43B 2JECA 5A7WA 1ODNA 1HB3A 4QKNA 1QJX2 4GKXA 5BY5A 2D7FA 4OMCA 5FCCA 4XJWA 3ZFFA 1JS9A 1DYOA 3VDDA 1VLNA 2D98A 2W1WA 2YC0A 4N53B 3RZMA 3I3QA 1BMV1 4CP9B 3NNFA 3JXSA 1NZIA 4P9LA 5FZEA 1DF0A 3SKJE 4ZU4A 3WD5A 1UX7A 3MZHA 3B00A 1W28A 3QBQA 5T54A 1W6QB 1WCQA 2ZEZA 5A7NA 4XUQA 1VBE3 3NJXA 2FDKA 2Q1MA 1MS3A 3MIHA 1JUHA 1J3PA 1IG3A 1YO8A 2H6CA 3JB8A 3H7YA 4BQYA 4B4PA 3ETQA 4CU9A 1AYM3 4PIZA 3CJIC 1SMVA 3VHPA 4WVMA 5CVRA 3ZIXA 1DYPA 4GJYA 1IPJA 1YUDA 4NR1A 1UPSA 4J25A 4O7XA 4Z07A 1NCRB 3CBNA 1S55A 4KMQA 3A0NA 5IVYA 3VZLA 4YYOA 3L2HA 3VBOC 3ORJA 2DFCA 1DGRA 2HBTA 5C71A 2E63A 3KQ4B 1HJFA 5CFCC 2IXJA 1SLCA 4JRLA 2WYSA 4XIOA 4DRRA 3OBTA 1DQ5A 2XJUA 2VZSA 3NV1A 4CXXA 1AXKA 2JE9A 1R082 1F5FA 3N36A 1WCSA 4P9YA 3JBG3 3RJRA 1CVNA 2R32A 1AUYA 3DYMA 3OPZA 4NHMA 5IK7A 2YU1A 4XZPA 2Z79A 4L11A 3H8OA 3LDRA 1UKRA 3OOXA 3VBHC 3ZR6A 3GXUA 2DU0A 3I49A 3PUAA 2WNEA 1KITA 3ES1A 4WZCA 4EN0A 3I2IA 4AVVA 3VBUB 2ADEA 2XLAA 4RQPB 1DZTA 3TYJA 2UYAA 2Q8EA 5FY1A 1RHI2 4QKBA 3UJOA 4DINB 5L9VA 3U4SA 4QHBA 3RZZA 3VBFA 4QQPA 1VAKA 1XBFA 4Y20A 5FYBA 1C4RA 3R05A 4D7SA 3POJA 4K21A 5AFEA 1CQ9A 2W1QA 3WF3A 4S2HA 5FO8B 3M3OA 2RS32 2VD7A 3B94A 4C0BA 5DAQA 1ZZ7A 4XJUA 1KRIA 5HXMA 1IHMA 1Q8OA 1W2NA 2PLV3 4W6YA 1NX9A 3SQOA 4AVBA 3V0BB 4LHKA 1E57A 5FYMA 1LAJA 4LORA 2HWD1 2FMDA 3MIDA 2YY1A 3TN92 1UU6A 1D4M1 2ZHNA 4A42A 4LLFA 3H3LA 4LKDA 1IKQA 5BNNC 1O91A 1PO12 1UY3A 3OD4A 3WY6A 4K8FA 2JG8A 2RDNA 1WMEA 2W5FA 3LKJA 4QPGB 4YFWA 2BPA2 1YRZA 1V70A 2VUCA 3HNBM 2YC4A 3IM0A 5H9PA 4CDQA 1SLBA 2AR6A 4HK9A 4L97A 3TEZA 3W20A 4NN0A 1GANA 2VXJA 1GMMA 2WS91 2AREA 4GMP3 2DV9A 4BMEA 2E32A 3MIBA 4AFDA 1IS6A 1C3HA 1DQ4A 2E7QA 2OX0A 3AXEA 5FZBA 3LEIA 1F4HA 1R1A2 1W6NA 1CIYA 3RWKX 3AMMA 4AVAA 2JIJA 4YGBA 5FYYA 1PK6B 1UIJA 3AC0A 3CLPA 3VHNA 4S2DA 4AAPA 2VTXJ 1O8SA 4LEJA 4MHUA 3T2OA 4I01A 4AQTA 4OYUA 1HRI1 1O5LA 1J1TA 4LA3A 4X8NA 5C8CA 4N90A 4Y22B 4JGZC 1ND2B 2BW8A 4Q5OA 3ZPYA 3DV8A 4JAAA 4YZ4A 5C3QA 2WNVA 3ZYPA 5A3LA 4Q0UA 5L19A 1Q56A 4CU7A 5CYYA 1W99A 1POV0 3ILNA 2VZ1A 1OMIA 5J1XA 1CX1A 1HJGA 4FFIA 4XPVA 1MEC2 1UO9A 1AR61 5IJRA 5FYIA 1W39A 2HWC1 3CIHA 4XJZA 4AGVA 1ZREA 3BPZA 2B39A 4S2GA 4LO5B 4XUOA 1CPMA 1AYN1 4XETA 5FPZA 4I0BA 2YYOA 1UY0A 3MW3A 3ZOIA 4A45A 1TEIA 1NLRA 1NXMA 3BUCA 1N47A 1PGL1 1MS1A 3A4UA 4CP1A 3N7LA 3PVNA 1GV9A 1ENQA 1RC6A 4LOSA 5FYUA 3POSA 4PIYA 5LBFA 2K0GA 4B3NA 3ZXGA 5FZDA 4I2OA 1LR5A 4GB32 5EJZB 2GNDA 4ZU5A 3T1LA 1VBD3 5CKQA 1NLQA 1NKGA 2RDRA 2OPWA 2HWD2 1HB2A 3IB3A 3WW2A 4UFMA 1D4M2 4NAOA 5DABA 3OYWA 5GLUA 4D69A 3EJKA 2D40A 1H30A 1RUI2 1UYXA 4KH9A 5DUWA 2NQYA 5JI9A 3VBSA 4CDXB 1QJEA 5A32B 2ZGPA 4QM8A 1IS5A 1C5IA 3M1HA 1G9BA 3UKTA 2D6PA 2YC2A 5FXVA 5IK4A 3WDUA 1QMJA 5KXEA 4N8MA 2WAAA 4QB1A 3ZSEA 3NL1A 4FAHA 5EFUA 1H2MA 4XFFA 4BZ4A 3VHRA 2VXRA 4QPIA 4AFMA 1R1ZA 2BZDA 2J1VA 4XBLA 3OGGA 4J6GA 1SDWA 3DKQA 1DGWA 1WA4A 4AVCA 3K4AA 3HT1A 5CU1A 3NNMA 5BNPA 1G86A 5FK7A 3MI8A 4C0HA 4GH4B 2BGOA 1HRI2 3O5SA 5FK8A 4B4RA 2ARAA 3D3AA 1W2OA 4BB3A 2VMIA 4KWUA 4QWNA 1LHUA 4MZUA 2VAUA 1B09A 4HKWA 5LB6A 4YG0A 1HB4A 1C8M1 1PVC3 2FMYA 1TMF1 1R093 3EBRA 3RYKA 2DF7A 1TME3 4C8DA 3OGRA 2P6CA 5KHJA 1F15A 3CL1A 1XYNA 3BB6A 3OBZA 4I02A 2R0HA 3B93A 3BN6A 2XDVA 3AP6A 4XJAA 1B35C 3MV01 1UMHA 1EAH2 3VGIA 5CAZA 4XFAA 1ASJ3 2L9LA 1HRV1 2W39A 3KMHA 4D7YA 1LOCA 3WHUA 1FX5A 4RR3A 5J09A 2V09A 3DUIA 4Q0SA 1SHWB 4M0HA 1L7LA 2SBAA 5DAXA 4ARYA 1ZA7A 2E9QA 2VULA 4M4PA 1KGYA 1GZWB 3I7DA 2A1XA 4HOOA 4KG8A 4QB6A 1FMD3 2BYVE 3HMYA 3URFA 3MW2A 3Q8FA 2WC2A 5FV3A 3T0BA 4Z1VA 1YWKA 4MV2A 5ACA3 4NRPA 4CPBD 1E5IA 1K12A 2QDRA 5A1FA 2W9XA 2PA7A 4NPRA 3C7EA 4LPLA 4IV1C 2BOIA 3OUIA 3N7KA 2VMCA 2CTVA 3JB4C 4D8MA 3VBRC 1KD7A 2P5BA 1PX3A 4WBBA 1VR3A 2B42B 2XWBB 4YGDA 2D5FA 2VNOA 2RE9A 2B7YA 1TNFA 5DZEA 2PHRA 3H50A 5LZ6A 3ZLIA 5FYZA 2XXZA 2XGXA 1PIV2 1M06G 5KC5A 4D6QA 4C1WA 4MG2A 2PHLA 4YW1A 3PTRB 1E5SA 1AF9A 2XR4A 1NQDA 3NAPB 4E9KA 3E97A 5FJKA 5FP3A 5FZLA
chains in the Genus database with same CATH topology
4RL7A 3JU9A 1IOAA 3MFAA 1OLQA 2GH8A 4WVVA 3L2YA 1C8M2 1TMF2 1ENRA 5FQ0A 1EV12 4Q4W2 1A6CA 4AGRA 2P37A 5CIRA 4R9BA 4FAGA 1UPIA 3D0SA 1LU2A 2OA2A 2QFEA 1QQP1 3DGTA 3ZSKA 4KWKA 1RUD1 3S7EA 4DMIA 1HRV2 3B9IA 3ZFGA 2A7AA 1JHNA 1UMZA 1WLWA 1CAVA 1CPNA 3HQXA 3AYDA 3H7JA 1UU5A 2LM3A 4OHXA 4QPYA 4R52A 4Y20B 4YARA 4ASMB 5FFOC 4Z8BA 3UKNA 4G3YC 4L2NA 1OHFA 2RHPA 2G9FA 3USSA 4BWOA 4P5HA 1DLLA 1LOFA 3M8LA 1RUH3 1VBC1 4KG0A 3P3NA 1SLTA 1W2UA 1POV1 3ZXKA 1YJKA 1Z7S3 3C2UA 4YVWA 4R8HA 3IMNA 5CFDC 5JIUA 2CGOA 4CEYC 2ZHKA 4GA9A 2Q8OA 1W6OA 4CDQB 2VECA 2JXAA 4HMZA 4DB5A 1DFQA 1RUOA 3KZ4C 4DZGA 5GLVA 2WWSA 1N1SA 4HANA 4LTAA 1RJ8A 5FLIA 4LBKA 1FOD1 2R043 5HBAA 2ZACA 2FBEA 1CIWA 2BVVA 3TNQA 4OZXA 2QZ2A 1S2KA 2RS51 1G8WA 1W6NB 2BFUL 4N43A 5FO9B 2GMEA 1GQHA 2A6XA 4XXPA 3RDIA 4Q4Y3 5C8CB 1CAXA 1VAVA 2YGLA 2A6WA 2I45A 4N53A 4O9GA 2PYTA 5GALA 2EAAA 1GLHA 1RUE3 2WNVB 1AR73 2DVAA 1EYBA 2PAMA 3M3CA 4HVQA 5AC93 5DUXA 1ZBE3 4EJRA 2JX9A 4OULA 4OUSA 1LKNA 1G9CA 1H1IA 4I3GA 1W6QA 1QJU3 4B4QA 2VNGA 1AL22 1JN2P 2VOXA 4CZSA 1NCRC 3MICA 1RB8G 1COV1 1XQNA 4OI4A 4EWAA 2UWCA 3RQ0A 5C4WC 1URXA 1Y43B 1PO21 1ULCA 4IEWA 3KGZA 2E51A 3RG0A 1QOTA 1CAUB 1D2SA 1FPN1 1BVVA 5D1IA 2IZWA 4YZ5A 4MUVA 2CWMA 1DHKB 2D43A 1S0GA 1HQNA 4IEYA 2W0XA 1RUNA 4AEDB 2NZ9A 1KS5A 4MGYE 3ZYGA 4OI0A 2RJKA 1DQ1A 2B5HA 4ISRA 1NZCA 2NMOA 2ET7A 1X82A 2RM23 1W0PA 1QJY1 2D97A 1KDMA 2E53A 3AP5A 3G6JB 3NV3A 5JVVA 3SXWA 2FQPA 4AI0A 3V0AA 2BEOA 3ZIWA 2YROA 3LCPA 3IN9A 1FOD2 5ABJC 4QPIB 4RQPA 3HT2A 5F9TA 1X7NA 3B02A 3LAGA 2WA3A 1HLCA 3VZJA 4MGKE 3J8F3 4RSUA 1YFYA 2R063 2EXKA 2X8KA 1NA1C 1AR83 2HEVF 1FT9A 4P9WA 2OIIA 3TB0A 4W6XA 4QPGC 5JWPA 2VH9A 1V9U1 2PHWA 2XBO1 1XNBA 2BNMA 3V64A 4K7JA 2WZR1 2HWF2 4V1PA 5H9QA 4MX3A 4HPKB 4COYA 1COV2 1LJ7A 3FC0A 2CGPA 1XNKA 4RR3B 1PO22 2YHJA 2GDFA 4HSJA 1HV0A 2Z69A 4B7KA 1C28A 1FPN2 4CTEA 2DWRA 3GYDA 1HXS3 1OOPB 3OD0A 4CDUC 1VB2A 3E6BA 1HX6A 2WFF3 2OZJA 5EXOA 3RSJA 4L92A 3SCFA 1HQLA 2XVGA 2MEV2 1OSGA 4K6BA 2RMU3 1ND2A 3NKGA 4JTOA 3ZYRA 2IXCA 3NJZA 1QJY2 5C6CA 2HJIA 1BMV1 2ZA9A 4HKOA 3USUB 4FTBA 1AX2A 2HWB1 1WD3A 1HIXA 1XE7A 4EROA 3RYPA 4NWVA 3DN7A 4W65A 1ZNPA 4BIOA 1NCQB 2ZGNA 3POWA 4LO6B 4FOQA 1K5MC 4IV3C 4KWJA 4AEJA 1YYNA 5JAXA 4BYYA 4QX5A 5KWRA 1GICA 4PCRA 4HBNA 1H4GA 4YVSB 4D94A 2RR12 3D6EA 5EZWA 4NHLA 3IWZA 5LK7B 4X6QB 5FQ0B 4CDXC 1S0EA 4Y24A 5JZGB 2RJLA 1V9U2 1OFNA 2G4IA 1UX6A 5L7OC 4GMP0 1RUG3 3MPBA 2A5ZA 2W08A 1QJX3 2K2SA 2WA4A 2HEYF 1HV1A 1QNYA 2UY9A 3R4UA 3ZFGB 2DUPA 3E6CC 3CNAA 3O7OA 5FTTC 1JXNA 2VQAA 5DUVA 4XFBA 4YM3A 1OLRA 2LTNA 1QHDA 3MGUA 1LCLA 2K9ZA 4YM2A 1MZ6A 1V6IA 1GQGA 1OPMA 1F9KA 4HFSA 1DGRN 1D0HA 1RVF3 1LU1A 1S2BA 1OA2A 3B7MA 3U11A 2VVEA 1GYKA 3ZSMA 4E2GA 1ZZBA 2XJRA 1X8MA 1VBA2 5JIAA 1REDA 2EF6A 2TEPA 1GSLA 3MF9A 3RS6A 5JPMB 4KNCA 2B8MA 2RS11 4TWTA 1LULA 5GM0A 1C5HA 1VJ2A 2HWB2 1AR92 4ITCA 4JGYC 1REEA 2YZ4A 1REFA 5FMOL 4MXWB 5DZGA 4FPYA 4IETA 1BEV1 1H9PA 3ME2A 1OFSA 2CY6A 2GC0A 3ZFFC 3A0KA 5KXCA 3VDDC 1R083 2HKXA 1JOJA 4NVPA 1H1AA 4RS5A 5CNAA 2ILMA 3AZVA 1BBT1 2HWE1 4DOUA 3ZFEA 4JVAA 2MPFA 1GZWA 3ZXJA 2VU9A 3BCWA 4IEPA 5AVPA 1YIFA 1CAXB 4Q29A 1A8MA 4CP2A 1JW6A 4BOWA 2FZ1A 5SV5A 3TRSB 5T50A 1RHI3 1N3PA 3AP7A 1JBCA 1S0IA 1JTZX 1OA4A 5J37A 2WZPP 3VKMA 4WM8B 5IT6A 3U4XA 3NWKA 3R4SA 2RS33 1VBB2 3L9JT 1KDKA 3O0VA 1DQ2A 3N35A 3SHRA 4O9EA 2XKPA 5CG8A 1PHMA 2R6QA 1HDKA 5BNOB 3GALA 4Y5Z0 5L36A 2WNUC 1F2NA 3C3VA 3RMYA 1VBE1 3IT8A 1J3RA 3TN93 4EN7B 3N7JA 4XFGA 2IWGB 4RHV3 2AGSA 1T6GC 1PO13 3HN1A 3MYXA 4HK8A 3WCRA 1AYM1 3CO2A 3NAPA 4FPCA 2QNKA 1BCXA 4Q4V3 3BOWA 4Z82A 3ZXLA 4DS0A 4CDWB 1WUVA 3KCCA 1W6PB 3AKRA 3MDPA 1OKQA 2RS12 2R072 1V6KA 1XU2A 5C9AA 2BVBA 4Y26A 3B9CA 4XF0A 4BQ1A 1O3TA 1R1A3 2XLGA 4LULA 3ZXAC 2ATFA 1BEV2 1G7YA 3VBFC 5SV8A 3V0AB 4LO7A 3AKQA 3I8TA 3JBG1 1VRH3 3O12A 4XFHA 4GKYA 4A7ZA 2HEWF 3CF6E 4P9GA 4ZU7A 2XJSA 2GZWA 4RGGA 4IL7A 2O0OA 1FAYA 1BBT2 5KC6A 3AP4A 3RI8A 4Y1VA 4CP0A 2WL1A 3RYRA 5K0UB 3R6SA 1MEC3 2BGCA 1PNGA 3MF6A 2ETEA 5CFCA 4NOTA 3QLQA 2JG8C 2BUKA 1O4ZA 3HBZA 3WP6A 4CDQC 3E6DA 1CX4A 2R30A 2Q30A 5E1RA 2A6YA 4OLLA 2D3RA 4CEWB 2H6BA 4JV4A 2A71A 2PLV1 3W59A 1YFXA 2GN3A 4GB33 2GH2A 4FQZA 1VAMA 3CU7A 4AK3A 4EN8B 1IPKA 1C1FA 4A2UA 5T5OA 2CWSA 3WW3A 4DXZA 3WW4A 4E2QA 3VN4A 1RUI3 1AYM2 5T55A 1FYUA 1XYOA 3IKWA 3LGRA 4INDA 1V00A 4TZDA 4LO4B 4GMP1 2GAUA 5FRAA 2VG9A 4BLIA 3AJZA 2VNRA 3B3QE 4AI2A 2ERFA 2A6ZA 4A7YA 1QNWA 3KT4A 4QGNA 2DCTA 1U12A 1KJLA 3I4IA 2Y0IA 3R0RA 2P34A 1LODA 5KHHA 3JBG2 4PLOA 5J98B 3ES4A 3WNXA 4H7MA 3MLKA 4YG3A 4DFSA 2CNAA 2TBVA 4FPOB 3WP3A 2UWBA 3AKSA 2E7AA 2GNMA 1Q8QA 4UBGA 5FO7B 1TQ5A 5KHKA 1CAUA 1LTEA 3RRDA 2ENRA 2X53S 1KFXL 1ZZCA 1OI6A 1EAH3 1LGBA 3CJXA 2C0ZA 2XHKA 3VBSC 1XNDA 4AW7A 3KGLA 2IXIA 2XPJA 4AEDA 5C8WA 4JGZA 4LA2A 1YCIA 1RUJ3 2ZGRA 2Z42A 4PDWB 4YW3A 2EXIA 4OI2A 3E5UA 2PLV2 3T2TA 1VBD1 5DUUA 2Y26A 2DCZA 1YIPA 4Q1RA 3VLBB 1UCXA 3T1MA 1MS5A 1H2LA 3GZTB 2AYHA 5I0SA 4LR4A 5BNPC 2PFWA 3ELNA 4LBOA 1NQJA 4QGLA 3MLJA 2WS92 1LB2A 1KS4A 2P17A 3J4UH 5CB7A 4WZFA 1ZRDA 1BK1A 4XJ9A 5GZCA 5JOZA 1AHSA 3VL8A 1N3OA 5L73A 3M3QA 4LE4A 5GZFA 1BVP1 3X29B 1H0BA 1YI7A 4LE3A 5I8TA 4AHWA 2X5IB 4RD7A 1BJQA 2WQZC 1PIV3 4Q0QA 3GNEA 1AXZA 1W6MB 4D7TA 2H0VA 5EJ3A 5BXXA 1C57A 1PGSA 3KSCA 3FHIB 1AXYA 4FXGB 3ZN6A 3APBA 5K9YA 1RUF3 3MW4A 3FLRA 1PVC1 4KQ7A 1R091 1BQPA 1NLSA 2NPIA 2V73A 1AR62 3N3HA 1F31A 1TME1 4Q26A 2HWC2 3HAGA 1C8M3 4HPKA 4YLZA 1TMF3 4Q8KA 4GWMA 5HCFA 1LHNA 1DZQA 1EV13 2VUAA 4Q4W3 3WDTA 3ZYIB 4FO9A 4LBMA 4COUA 1AYN2 4RS5B 4WVWA 2VW0A 4AI1A 2DCJA 1APNA 3ZFEB 1PGL2 1ASJ1 4I0WB 4LBJA 5DG2A 2IXLA 1OOPA 4XQDA 1MZEA 3AZWA 3JD71 2DVDA 4LBQD 3ALQA 2EA7A 5A33A 1X36A 3OY8A 4FT8A 4Y1UA 3FUOA 4FQ4A 1H8TC 5JOXA 1J59A 2GSYA 2QVSB 4F7ZA 2ZMNA 3P3PA 1PZ9A 1IQAA 2ZBJA 4WM7B 4HSLA 1MS0A 5ACA1 2FZ2A 1LOGA 2ZGLA 1N3QA 1MQTB 1PMIA 2JJ6A 1RUC3 3USUA 4LT5A 3SH4A 1RIRA 1ZRRA 4JDOA 1QU0A 1LHVA 2D6MA 1A78A 2JG9B 1NCQA 1WW5A 2D93A 1SQ4A 2VGDA 3DPRA 1LOBA 1VB4A 3ACLA 2ZPXA 4K40A 2R0FA 3IPVA 5KXBA 5LEKA 4YVSA 1DDLA 3O0XA 2H0BA 4EN6B 1ZBA3 1ULEA 3BOPA 1BKZA 4XFIA 2D6OX 5JZGA 1I6XA 1QJZA 5C9AB 1Z0HA 1ZM1A 1QXRA 1U5XA 1UN1A 4COVA 1QGLA 4U2AA 4L99A 3H0OA 4PBPA 3S7IA 1PVC2 4N7UA 3TAYA 3ENRA 1RTVA 1TME2 4M3CE 5J48A 2IC1A 2NLRA 3FJSA 2ZMLA 3CJIB 4OHYA 3KCYA 2DCYA 1UD1A 4K1ZA 2DVFA 4FOWA 5H9SA 2YGMA 1WCDJ 3FMGA 1Q43A 4JCKA 3NV2A 1LOFC 5EYXA 3WG3A 4FBFA 2D5HA 3JD72 1VP6A 2P2KA 3VBOB 1ND3C 1AL23 3H1WA 2GNBA 4IEVA 4YVWC 5HCBA 5CFCB 5T3NA 1CN1A 4QQOA 1QDCA 4YZ2A 1Q8VA 4Q4X3 2I74A 5FBZA 5ACA2 3SITA 4ATEA 1WBFA 1ENSA 4EN9B 3W58A 3VBHB 1RUH1 3WZ1A 4FPKA 3IDBB 4HN0A 4MXWA 4N43C 4XHBA 1Z7S1 3GBWA 3WOGA 3FZ3A 2D6LX 4M01A 2C5DA 2JEMA 4N53C 2CAVA 4H14A 1YJLA 1Z78A 3RJ2X 2I2SA 3NVCA 1GZCA 1O4YA 3E5XA 3LA2A 2ZX1A 2OYZA 5DXDA 5K8SA 2R041 1SEFA 4LBLA 1GFF2 4IEXA 1V6JA 4R4XA 2F6BA 3LWCA 1NXD1 4M0NA 3EHKA 3FBYA 5CBLA 4L9BA 1MZ5A 2PQQA 1QQP2 1TE1B 5BNNB 4Q4Y1 3AYCA 2W52A 1RUD2 1SBFA 1CESA 3B5LB 4UW6A 1RUE1 1AR71 3GHMA 1J3QA 4WM8A 1ALYA 2ZS6B 3M2MA 4HKLA 4WV8A 5AC91 5LRSA 4NWWA 3MIGA 5GLTA 3BU7A 2AH2A 1XNCA 5BNOA 4TLFA 4AFAA 1QJU1 4KGGA 2VW1A 4QMAA 3GZAA 3UJQA 2WQ4A 2HWF3 4G4FA 3V65A 3ZMOA 2B9UA 3VZMA 4QD2A 4E27A 1AX0A 1YFUA 2JDZA 2R49A 1LESA 1O7FA 2DVBA 3FX3A 4FTEA 5KHGA 4JGZB 1QDOA 1VBC2 1XU1A 4Y1XA 4XBNA 4CDWA 4OHVA 1W6PA 1XXNA 1FPN3 1ULGA 1ZRCA 4Z2WA 4AVTA 1BYHA 3JCIA 4PF5A 4XQ4A 3VBUC 2XB6C 4RQPC 1RL3A 3HD8B 4JQRA 1S0DA 3GHNA 1JYCA 3VL9A 1OA3A 1J1LA 2MEV3 2RM21 4N7IA 4P9IA 1H9WA 3LZZA 4F8AA 1QWRA 4G9SB 4UW4A 3HWJA 2OW4A 4BHPA 2UY8A 2RS52 2XUMA 2ZCWA 2ZZQA 1GNZA 1H4HA 3D5OA 2R042 4YZ3A 2VMGA 3FE5A 3IIAA 5K0UA 3ECQA 4PIXA 2JKBA 2XJPA 3J8F1 1A8DA 3I59B 4OUMA 5KBFA 4XF3A 3KT1A 3Q9OA 1RMU1 2R061 3MPPG 5F6KA 4B8EA 5T5PA 3MEPA 4Q4Y2 2JENA