2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
4FOYA 4Q1PA 3ZSLA 2D6KA 2LTNA 4DQAA 5JDBA 3V0AA 3MW2A 3O5SA 1JUIA 4YFZA 2FMDA 2EXJA 2CY6A 3KM5A 5GLWA 1Q8SA 2WQZC 3JU9A 2SBAA 1V6IA 1IS5A 4LBLA 2UWAA 4XYXA 4FOQA 1W6OB 1MVQA 4FPHA 4ASMB 1PZ9A 2VY0A 5T5LA 4Y1XA 1LHVA 4IQPA 1NLSA 2WT0A 1A78A 3SH3A 1CPMA 1OFSA 1W6OA 2TEPA 4FOWA 3B3QE 3RMYA 4CTEA 1YO8A 2Q5TA 1SLIA 4RA0A 5FREA 3FFZA 2A6VA 2DUPA 1DFQA 2D6NA 4NO4A 3ASIA 4W65A 5JOXA 1WLDA 4YGEA 5DUWA 4YZ1A 1DGLA 2D3SA 1V6NA 1O4YA 2AGSA 5DG1A 4M3CF 3O0WA 1WW5A 4FP3A 4H55A 3A0KA 3VUOA 1V00A 1DQ0A 2P3KA 2DVFA 3AZVA 2GNDA 1APNA 1QDOA 2VW0A 1KRIA 2SLIA 3OBRA 4XIKA 4FPYA 3MPPG 1WD3A 2A70A 2EAKA 3C2UA 4GXLA 5HCFA 3WCSA 3WCRA 3B69A 1KITA 1PZ8A 1LU1A 5EWSA 5EYYA 4CZSA 2OUJA 4HANA 4NOTA 4YW1A 5GLUA 4C1WA 2NYYA 2YY1A 3FUQA 1Y7BA 2ZGMA 4UW3A 4LBNA 3A0NA 4ISRA 1WBFA 2A3XA 1GBGA 3TB0A 2W08A 1SLCA 2HYKA 3ZXFA 3U4XA 4LBQB 3LCPA 1MS8A 4AGRA 2DYCA 1ULFA 3AZYA 3SLIA 1DQ6A 2C5DA 5JOZA 1BKZA 4LBQA 3M1HA 2DVBA 3AP9A 4ITCA 4XJAA 5T55A 1JYIA 2WLQA 1S0DA 1IKPA 4Y20B 2ZMKA 1ZA4A 3H0OA 5KXCA 4K20A 1G9FA 2C9AA 1DYPA 4ZXKA 3T1MA 4BLJA 3AK0A 4Y20A 2FHRA 4XJZA 2NN8A 3DGTA 5GZGA 4XJWA 1HLCA 1KJLA 4XBQA 5CNAA 5JLVA 5DXDA 1CQ9A 1LTEA 1LGNA 1DLLA 2ZGTA 2ZMLA 5DUXA 1MS3A 1QDCA 2NM1A 1QKQA 2AYHA 4AYUA 3WG2A 4YG6A 3V0BB 4AGVA 2NP0A 4XDQA 4UW6A 2D7FA 4YZ5A 1MZ5A 3IPVB 1AJOA 2ENRA 4LBJA 3SISA 4GWNA 1FV2A 3V0BA 4DS0A 4LBKA 3WV6A 3AZXA 1V6JA 3UJQA 4I30A 1MS4A 3M3CA 3RG0A 3ZVXA 4P9YA 4XBNA 1LECA 4AWDA 3OY8B 2GMMA 1W6NA 4M01A 4DRRA 1CR7A 1YXWA 4PCRA 3RMXA 1V6OA 2PHRA 3SNMA 3OY8A 3WDXA 4R9BA 3M2MA 4GWMA 4P14A 4XMIA 5EXOA 1IOAA 3MW3A 1CJPA 1ONAA 2V73A 5H9RA 4P9XA 5T50A 3SH4A 4R9DA 2DUOA 3I4IA 1W6MB 3M3QA 1LULA 1O4ZA 1MR5A 1UMZA 2YV8A 1C1FA 3NV2A 5GLZA 1SCRA 3WLUA 1ULDA 3AYAA 5H9PA 4CRQA 5IK5A 1WLWA 1AX1A 2A75A 1W6MA 1LGCA 2E7TA 2CWSA 5DUUA 1LHOA 4TYSA 1IS6A 3ILFA 4AVTA 2DVAA 2NMNA 2XG3A 2VH9A 4L8QA 3AJYA 4FPFA 2AREA 3VKOA 3WVJA 1U0AA 1G9DA 1SBEA 1DHKB 4M3CE 1WCSA 1V6LA 1LOBA 2D6LX 1C57A 3ILRA 1AX2A 5LK5A 1ULCA 1JW6A 2AR6A 5DZFA 1UKGA 1LOEA 4WVVA 1BXHA 1G8WA 3RRDA 5H9QA 3N36A 4BM8A 4K1YA 1N1VA 2D6OX 2ES3A 2R16A 2NZ9A 2P34A 3IKWA 3USUB 3V65A 4Y26A 5DZEA 2A7AA 4XXAA 3ZSKA 3AP6A 3ZYPA 3ZXKA 4AVVA 1DBNA 2GNMA 4XJ9A 4YW4A 3ZYRA 1G9CA 4GALA 2ZBJA 1MS1A 3USUA 1W0PA 4YG0A 2ZHKA 3PMEA 4KBBA 1QGLA 4Y1VA 3GNEA 1QNYA 3BODA 2BQPA 4YG3A 2OW4A 2P37A 2CYFA 3RS6A 1Q8OA 4FPOB 1SLBA 3UL2A 3VKMA 1JHNA 1WLCA 2ZGSA 1QNWA 3APBA 2PHTA 1A3KA 2PHWA 2DU1A 1SACA 3B9CA 1BYHA 4K21A 4U36A 2JDZA 1LESA 1DQ2A 1ENSA 1LHNA 3B00A 3OBTA 4RL7A 3AXEA 5IK8A 3PVEA 1MZ6A 3O0XA 5AVAA 2P3IA 1GANA 1H30A 4ISQA 4PBOA 1JXNA 4YLZA 1ULEA 1XQNA 2A3YA 1DQ1A 1H9WA 3HMYA 4XTPA 3RSJA 1LHUA 1QOTA 2D6PA 2R1DA 3N35A 1IS4A 3ZXJA 4AGGA 5SV8A 5KXBA 2ZMNA 4YZ2A 1Q8QA 5DUVA 1G86A 1G7YA 2EF6A 5KXDA 3INAA 4WZFA 3W59A 1SLLA 5E8AA 2ZGOA 3IM0A 4PF5A 2P3JA 4Y22B 1S0BA 4XHBA 1VAVA 1FAYA 5GALA 1LU2A 2W52A 3FUOA 2DV9A 1CPNA 1F5FA 5T52A 4JC1A 2EALA 2VXRA 1F9KA 2ZZJA 3IMNA 4PBPA 4U2AA 4Y22A 4FPGA 1A8DA 1Q8VA 4FPJA 5T5OA 1GICA 1GLHA 1S0JA 1WW4A 2OUHA 4Y1ZA 1UZZA 2EIGA 3BIWE 4ZKTB 1GSLA 2E51A 2WT2A 4XOGA 3D5OA 4YM1A 2CL2A 2YXSA 2GNTA 4XJUA 2B7YA 4OZXA 3D4KA 1Q8PA 1AXYA 4XZPA 1KDMA 3POWA 5JOYA 1X50A 2VW1A 1MS5A 1CIWA 1JBCA 3R05A 1Q56A 5CBLA 4TZDA 3UK9A 3WNXA 1DQ4A 3WG3A 4XJ8A 2CWMA 5CA6A 2NMOA 2VU9A 1LCLA 2DTYA 5FRAA 3QCWA 4YGBA 2D3PA 1V6MA 3ATGA 1MS9A 4LBQD 1W6NB 1I3HA 1SCSA 1R1ZA 1VIWB 4YFWA 4R9AA 4XMAA 5CAZA 1LEMA 3OPZA 3AFKA 1GV9A 1Z0HA 2EXHA 4WVWA 5H9SA 1FX5A 3AXDA 2UWBA 2JE9A 1GZWB 1CONA 2A6YA 4YZ4A 4DRVA 2XB6C 4LBOA 2ERFA 2D43A 1GZWA 4LBMA 1EPWA 3ZSMA 3ENRA 3N7KA 5GLTA 2DUQA 2VW2A 2UU8A 2YZ4A 1QMJA 1ZM1A 3AP7A 2ZAAA 2ZACA 2D6MA 4Q1RA 1AF9A 5KXEA 5CB7A 1MACA 2JECA 2DU0A 3M3OA 3AP5A 1UAIA 3ZXEA 1S0IA 3AJZA 1N1YA 1GZ9A 2GALA 5DG2A 2OVUA 1NXD1 1LEDA 2JKBA 1S0FA 3T1LA 1AVBA 4PQ9A 1RITA 4XE9A 5E88A 1CESA 2ZHMA 5HCBA 4ATFA 2VUAA 1FYUA 3POYA 4FOVA 2KM2A 1QF3A 2JJ6A 4YW3A 1AZDA 1WW6A 4Q8KA 1B09A 4GKYA 1W0OA 4WV8A 1URXA 4FQZA 1YIFA 1ENRA 1OQ1A 1SLAA 5GJ6A 3NV1A 1UPSA 3HR9A 3JUUA 3PJQA 1VAMA 3BOPA 3L2YA 5DZGA 4YW5A 5T54A 5GLVA 3W58A 1N3QA 2A6ZA 3PVNA 4MYEA 4Z8BA 5JOWA 5IK7A 5GM0A 1DYKA 3VKNA 2DTWA 3VKLA 2A6XA 3WG1A 1WD4A 3I8TA 2GMPA 3WHTA 1CN1A 1N1SA 4Q26A 3WOGA 3N3HA 2ZA9A 3WUCA 2ZKNA 5JMCA 5T5PA 4BMBA 2GN7A 2ZGKA 1GZCA 1HQLA 1N47A 1VALA 2E6VA 1F31A 5BYNA 3VKFC 4BLIA 1HKDA 2PHUA 2ZHLA 4XILA 4XXPA 1FV3A 1N1TA 1GNZA 3M3EA 4Q27A 1SLTA 1DZQA 1C4RA 1GKBA 1KDKA 4FQ4A 1LOFA 5GZCA 4FPKA 4YM2A 1LOAA 3AX4A 1S1AA 4YM3A 3AYCA 2WJSA 3O0VA 5JVVA 1MVEA 3IN9A 3WUDA 1YRZA 1WBLA 2G4IA 3FLPA 1UX6A 3OJBA 1N3OA 1TEIA 2A5ZA 3POSA 1UN1A 2WSVA 1S0EA 1AXKA 3AYDA 2A3WA 3AYEA 3NV3A 3R4UA 2DWRA 4P9WA 3B01A 1BQPA 2R0HA 3BTAA 3KQRA 4UW4A 2D3RA 2I2SA 2DVGA 2E53A 3DUIA 4FPCA 4SLIA 4XHXA 3MEPA 1JYCA 4YGDA 3WZ1A 1OKQA 1PZ7A 3WHUA 1HQWA 2AENA 3OYWB 4Y24A 1MS0A 1N3PA 2Z42A 3T2TA 1HDKA 5IUQA 5F9TA 2PELA 1LENA 4Q8LA 3NWKA 3OGGA 3OYWA 4FP2A 4Q2FA 1QU0A 1W6PB 2WT1A 1KQRA 1D2SA 2CTVA 3D6EA 1UL9A 1C1LA 1SFYA 1D0HA 4GA9A 1AX0A 4Y1UA 4C1XA 1GNHA 1KJRA 1W6PA 3N7JA 3SITA 3CNAA 2YMZA 2H0BA 4FVVA 4M3CB 3TAYA 3WDWA 4BQ1A 4XIOA 4R9CA 3PVOA 1IKQA 1CVNA 2WKKA 4HL0A 2ZGLA 1Z78A 1LGBA 1DIWA 3HN1A 4XTMA 5GZDA 4DFSA 4M3CA 1BJQA 1FNZA 2ZGQA 3FLTA 3N7MA 1H9PA 1YYNA 2RHPA 3AZZA 4M00A 1DQ5A 1V6KA 1FATA 1S0CA 3ILNA 4YZ3A 4BPZA 1S0GA 5EYXA 5HCAA 2ARBA 2R49A 3WDYA 5IK4A 2A71A 3AP4A 1FNYA 4K1ZA 5GZEA 3UJOA 1QOSA 2WSUA 5E89A 1AJKA 2DVDA 2JE7A 1G9BA 2R0FA 3WG4A 3V64A 2DURA 4F83A 1IS3A 1WUVA 1AXZA 2GNBA 2ZABA 2ZHNA 4YM0A 4JRAA 2GDFA 3ZPYA 4FPLA 3A4UA 3ZXLA 4ATEA 5IT6A 4JCKA 3RQ0A 4DPNA 1W6QB 2AH2A 4BOWA 1UZYA 3FLRA 2ZGNA 2JD4A 3O12A 1RINA 2P2KA 4AVSA 1JOJA 1W6QA 1SBDA 2WNEA 1WW7A 3IPVA 4D69A 1LOGA 3LSEA 1LODA 1ENQA 1SBFA 1VLNA 1G9AA 2ARXA 3MW4A 1LJ7A 3WDTA 2UURA 1LHWA 1LOFC 1LOCA 2A6WA 2E7QA 3LSDA 2V5YA 3N7LA 3NV4A 3ZSJA 2GMEA 3VV1A 2AUYA 2PHFA 4GKXA 2D44A 2W68A 3Q9OA 3AZWA 1QOOA 1ULGA 2PHXA 1YI7A 2R1BA 2ZGUA 4XBLA 2EXIA 4Y1YA 3WDUA 2LALA 3FBYA 5T5JA 4UW5A 3WDVA 1JN2P 3R4SA 4YGCA 2UWCA 2W39A 4YW2A 2YROA 3QLQA 1RIRA 5L73A 5GZFA 1I1EA 3V0AB 2CNAA 4BMEA 3GALA 1BZWA 5F5QA 1GYKA 2EXKA 4FPEA 2ZGPA 2ZGRA 2GN3A 1J1TA 3SH5A
chains in the Genus database with same CATH superfamily
4FOYA 3E5XA 2D6KA 3UGHA 1NCRB 3O5SA 4XF4A 3NKTA 1X7NA 2EXJA 2BGCA 3H7YA 4PDWB 3PVBB 5I8YA 3JU9A 5FYSA 5EIYB 1OF3A 5FYCA 2SBAA 2VTFA 4OVEA 1IS5A 4LBLA 4PDWA 2UWAA 1QQP1 4Q4Y1 3U07A 2UYBA 3RWNA 1MVQA 3OBAA 4FPHA 4P00B 2VY0A 2QBXA 2XL7A 3LDBA 1LHVA 2XDVA 2WT0A 4PQQA 4NAMA 5FZ0A 3B02A 2BNOA 1EUUA 1GQGA 1CGPA 4CCCA 3RMYA 2P4EA 1YO8A 3RZGA 1U5IA 1GP4A 2I07B 2R043 1MZEA 1OVSA 2VVDA 3FFZA 2DUPA 1IPKA 1GMMA 3Q8BA 4C0HA 4FTSA 3MV11 1VRBA 1NY71 4NPRA 5CG9A 1LKNA 1DGLA 4BCUA 3MLJA 5AC93 3G7DA 2AGSA 5CG8A 3LA7A 4B8EA 1UX7A 1C8M2 3OPTA 2X5IB 3A0KA 3EJKA 4QX8A 3FL7A 2ORXA 1DQ0A 5CFDB 4YW6A 1J3RA 1APNA 4QPIB 2X5IA 3OBRA 4GB32 3WSOA 2WN3A 3E6BA 3TEXA 5HCFA 5I0DA 4QPIA 3LE0A 4RS5B 4DY3A 4BQ2A 2BEOA 4ARYA 2YY1A 4PIXA 1QEXA 2R30A 4RS5A 3R6SA 4KWLA 4ISRA 5K8SA 4CCMA 4JKKA 3ZXFA 4LBQB 4DUVA 4XUQA 2G9FA 2E26A 1ULFA 3AZYA 1OSGA 3GZAA 4Z07A 1F15A 5FCCA 1DQ6A 5JOZA 5IW0A 3JD71 1XSRA 4LBQA 1OOPC 1CX4A 2RDRA 2BFUL 1IKPA 1AR63 2WRAA 4RGKA 2ZMKA 3OSDA 4ZS2A 5FWJA 4OI4A 5KXCA 1ZZ8A 4IE4A 2PQSA 3BTXA 1PK6C 1OVPA 4ZXKA 3T1MA 3BI3A 3OBZA 3PURA 4QX0A 4XJWA 5LCWL 3VHOA 3J4UH 3RNSA 4S2HA 1PGL1 2RM21 3VBSC 1W3VA 1LTEA 1DLLA 2P17A 1RMU1 1MS3A 1HB4A 2XHNA 1QDCA 2NM1A 3SCGA 1POQA 4HN0A 4P02B 2BNNA 3ITQA 1JYVA 1HB2A 1C28A 4XDQA 4V2VA 3BB6A 2VXJA 1JH5A 4OLLA 4YZ5A 1Y43B 4A6SA 2WS92 1MZ5A 3OB8A 1RUF2 1FMD2 1R091 2HWC1 2HWE2 3WV6A 2W91A 4YARA 2FDFA 4Q0VA 2YDEA 4I30A 1MS4A 2FQPA 3ACFA 1LECA 4M01A 5LZ6A 2JDMA 5FKBA 5FYTA 5FJHA 4D0QA 5FPUA 1YXWA 4LR4A 4M0HA 4LEJA 1WA6X 2DFCA 3ZN6B 2YU2A 2FCUA 3IB3A 3OUIA 5FP7A 2HBUA 1FPN2 2YBPA 3M2MA 2VQAA 4P14A 3ZN6A 2WFF1 3ZFGB 1UZ0A 2JG9C 4GWJA 2IZWA 5FV3A 3EYPA 4ZPIA 5ISLA 1JZ2A 1YIPA 5H9RA 1D2QA 4KGGA 3ZXAC 3ZFGA 1PIV1 1UY4A 2RR11 3I4IA 3A23A 4TLFA 3H8OA 1BEV3 5FZHA 1LNSA 2YV8A 1C1FA 5GLZA 1VBB2 5EP9A 4ZU7A 3AYAA 2Y6FA 3T08A 1AR92 3CEWA 4CP0A 4E2GA 1TMF3 2WYFA 5DUUA 1LHOA 1VMJA 3ZFFB 3TEZA 4QAWA 1IS6A 4HZFA 2VH9A 2WN2A 3B94A 1PX3A 2LS6A 2RMU2 1U0AA 1SBEA 5J7MA 2VO5A 3ZFFA 1V6LA 4EE2A 4BU2A 4FSJA 4RHV1 3WXPA 3ZOIA 2K2SA 2Q1MA 1ULCA 4UYBA 3SCHA 1JW6A 3TOJA 2QNKA 3JQWA 5FMDA 1GWKA 2IWGB 3QD6A 3C7FA 1SZBA 1VBE2 1UXZA 5H9QA 5A3WA 4C90A 1DCSA 4BM8A 2VL4A 3MF9A 2Q1FA 3H3UA 4G9SB 5DZEA 2XL9A 3KCXA 4XXAA 3AP6A 5E6HA 3ZXKA 5CKNA 3S5AA 1GNYA 3ZYRA 1G9CA 4X8PA 5FP4A 2Y8KA 4XUTA 5FPAA 4IE0A 5FP9A 3BVCA 4DXTA 3OUHA 2K9ZA 1OUXA 4YG3A 1ZRFA 1CZVA 1ODMA 3ST7A 1JS9A 4M4PA 4BWOA 1VBC2 1JHNA 4AFDA 5LEKA 5KBFA 1PVXA 1TNFA 1QHDA 1SACA 2OXBA 1VB4A 2MEV1 2JDZA 2VZUA 2CHHA 1LHNA 2WNUB 4QB1A 2WA3A 2WAOA 4BK4A 5C8CC 3OOXA 1VBD2 1XYNA 1PGW1 4Q4X2 4NAOA 2WNUA 1ULEA 2WZR3 2GC1A 4IEUA 4XTPA 1US2A 1QOTA 2D6PA 1YQ6A 3N35A 4OHWA 5SV8A 2KA3A 3R0RA 4MZUA 4G3YC 1Q8QA 1WCUA 4N8MA 2EF6A 5DUVA 4AFBA 4N43C 3INAA 4A42A 2AC1A 2VNGA 2QQOA 4COUA 4R8HA 4PF5A 3KF5A 2QCSB 1J83A 3M4FA 5FYHA 4NRPA 1OHFA 1VAVA 1X8EA 2B8MA 1R64A 2GZWA 4AEJA 4AI0A 2QQWA 5T52A 4JC1A 2EALA 4B4PA 3RZMA 3MDPA 5T5OA 1GICA 4GH4B 3SEPA 5J48A 1ASJ3 2E51A 4XOGA 1MEC2 2Y34A 4H14A 2YFUA 4BIOA 3AL6A 3IT8A 4GH4A 4TWTA 5CKQA 2VMIA 4AVBA 4FAGA 1H8VA 1Q8PA 3I2OA 4QGMA 2JE8A 2IVJA 5HPOA 4XZPA 3POWA 4F3JA 3OTFA 1Z7S2 1F4AA 3ZX7A 1X36A 5CBLA 1IG0A 3K46A 2XOMA 5F32A 3WNXA 5A1LA 5CA6A 2Z2SB 4YGBA 1A34A 1NLRA 2O8QA 2PHLA 1MS9A 2F4PA 2RS53 1W8NA 1W6NB 2D98A 2F17A 1I3HA 5JCTA 1R1ZA 3KCYA 4XMAA 5JSRA 2K46A 3ZYJB 3PIJA 2R073 3PTYA 3AFKA 3OGVA 2EXHA 4GULA 4CCKA 3AMHA 2W95A 1OFNA 1REEA 1SDWA 3AXDA 2KD7A 4WM8B 4Z92B 4HT1T 2JE9A 1GZWB 3GJBA 4PDWC 4YZ4A 4YWAA 4DRVA 5FFOC 1OH3A 1VRH1 2VULA 4MOAA 2X29A 1AR73 4OI0A 4LBOA 1Y3TA 2G9GA 4ZZ5A 2RS12 1AL22 4WM8A 4BQ3A 4CCOA 1GZWA 2HEWF 5A33B 2TUNA 2E9QA 1XNAA 1QJZA 2WO3A 3LB9A 2LM3A 2VOWA 4GMP1 3POBA 2D6MA 4QXKA 5AVPA 5A33A 5C3SA 1J58A 4Q1RA 1AF9A 2OPWA 4Y5TA 4KL1A 5F3GA 4XCBA 4HOOA 3KHBA 4AR2A 1EV11 4IV1B 4PI0A 1UAIA 3ZXEA 1PX4A 1SMVA 4NUBA 1US3A 2ET7A 4NR1A 1N1YA 4XDOA 1R081 2QZ2A 2CAUA 1QQP2 2FD8A 5FZAA 4Q4Y2 4LJHA 2JKBA 1S0FA 4IV1A 1AVBA 4XE9A 5HCBA 1CESA 2ZHMA 3MPBA 2VUAA 2LW8A 1COV1 2X5IC 3NJVA 4QMAA 4YW3A 1WW6A 1T6BX 4AXOA 1B09A 4AF9A 4Q8KA 5AFBA 3ZM8A 3Q8FA 3WP4A 2DCKA 4WV8A 3BTYA 4FQZA 4QPIC 3POGA 4B3NA 1ENRA 4A45A 1OQ1A 1SLAA 3DV8A 1NY72 4ORFA 4NIIA 2JDAA 3SEEA 4E4DX 4O7XA 5A3PA 4QB6A 3P6BA 3HR9A 1RUNA 1RL3A 1FOD3 4H7LA 4OUEA 1PM4A 3BOPA 1H4GA 4N53B 4FTBA 4Q4V1 4FXKB 4EYUA 3OEBA 4RN5A 1YUDA 4N53A 2WABA 1UYPA 4AQSA 3CMGA 2GMPA 3SMHA 1CN1A 4Q26A 5K7PA 3WOGA 2RM23 3VDCA 5JMCA 4UBHA 1E5RA 5JI9A 1J84A 3JXSA 1RMU3 1N47A 4Z82A 3KT7A 2FCTA 4LULA 1XNTA 5CVRA 3VKFC 5C5UA 3NW4A 1TME3 2JKXA 2PLV2 2VZ3A 1FV3A 2C9KA 4HONA 3BUCA 1H6YA 1KDKA 2XH6A 1CAUB 3LZZA 4JDMA 1IQAA 1LOFA 4E2SA 5GZCA 3AX4A 1W90A 1S1AA 3AYCA 2VUCA 3DL3A 5JVVA 4YM3A 2B9VA 3JD72 2G4IA 2VQUA 3OJBA 2J1AA 1TEIA 1UN1A 2WSVA 1NYWA 4QWNA 3AYDA 3FBMA 4HSJA 3NV3A 3I2DA 3R4UA 2BWAA 2DWRA 4KMQA 3B01A 4S2GA 2XONA 4XQ4A 5FP8A 5C7GA 3ZXGA 4WM7B 2D3RA 3QBQA 4K8FA 2I45A 3WZ1A 4NIGA 1W03A 4AOCA 4CU9A 2B42B 2LROA 3OYWB 4WM7A 2A1XA 1YJLA 4Y24A 4K6BA 5FMBA 3JQXA 1N3PA 5DMYA 1GWMA 1HDKA 2PELA 3FN9A 1S2BA 4LK6A 3VLBB 2RR13 4EZ4A 4NN0A 3OGJA 5IFTA 3OYWA 4Q2FA 1QU0A 3VBOC 1JYXA 2YU1A 3RFRA 2RV9A 1KQRA 2O0OA 2CTVA 3E97A 4MHUA 5IAVA 3VBUC 4A3XA 4IESA 3AL5A 4B4RA 1SFYA 2OZ6A 1RJ8A 2VBBA 1R092 2HWC2 5LB6A 1RUC3 3ZFGC 2YMZA 1U12A 4X6RB 1GUIA 2HWD3 4BQ1A 4FT8A 3O1UA 4R9CA 3PVOA 2JDKA 2WKKA 3OEAA 2ZGLA 3KD4A 1AL0G 1FNZA 1UYXA 1RUI1 3FLTA 3MIFA 3T2QA 3I49A 2KR2A 3B9IA 5C3PA 2VTXA 4QKBA 2WNOA 5L9RA 5HCAA 2ARBA 2A71A 3LOBA 1DZRA 1JOPA 2JD9A 4JKLA 4QDRA 4YPJA 3ZFFC 2WFF2 1FT9A 4AHZA 2ZPXA 5E89A 1Q43A 4LO6B 5C70A 5J1XA 1YFWA 2WWSA 2PHDA 3NVCA 2JICA 2R041 1PIV2 1A8MA 4GIQA 4QHZA 4XDPA 3S6PA 1RVF1 3V64A 2W87A 4JHTA 4I09A 1ZBE3 4F83A 1WUVA 1NX9A 2IUWA 2ZHNA 5AC91 4KH9A 1JYNA 4DY5A 1XYOA 3I3BA 3WF1A 4D6SA 4ATEA 3A4UA 3RVHA 2YGMA 2OQ7A 3CU7A 5HXMA 4I0WB 4O61A 4PIZA 4Y5SA 2MEV3 2OPKA 3CBNA 3RQ0A 4TTGA 2AH2A 3K2OA 4XURA 4HXCA 1UZYA 2Y6LA 3PHMA 1XYPA 1UD1A 2JDNA 2LRPA 1SBDA 3E1F1 3IPVA 4AHWA 4O9EA 2Q4SA 1SHWB 5FZMA 3HWJA 3VBOA 3LSEA 3RYKA 1LODA 2C6SA 4Q4W3 2R7EB 5A3OA 1PVC2 5HCHA 1U5YA 3FMGA 3MW4A 4N90A 1LJ7A 2HLEA 2OS2A 1VPHA 1PK6B 2E7QA 1K3IA 3ZSJA 4HN1A 5A7NA 5APAA 5A7OA 2WNUC 3VV1A 2PAMA 3CJXA 3RPQA 3ZDVA 1SDDB 3RZLA 1W8WA 3U14A 5D2AA 4NIAA 1AR61 4YGCA 1W9YA 2YROA 3QLQA 3NNJA 4LUKA 2IFWA 2CNAA 2JX9A 1EAH3 3GALA 3PUQA 5F5QA 1GYKA 1YHFA 2EXKA 1W9SA 2ZGPA 4OFGA 3LKJA 3I2FA 5F6LB 3ZYGA 1PGW2 4LKFA 4DQAA 3I54A 1NE4A 3DYMA 1BK0A 4QKNA 4PI2A 2GC2A 1JUIA 3B5LB 4GJZA 4AFCA 2FMDA 4F8AA 4FBFA 4YFZA 3JBG3 3H1YA 4AHYA 1WKYA 3PU8A 5DAXA 3TN91 1Q8SA 3NNLA 1TZOA 2VCMA 3AMMA 4GH4C 5HBAA 1CZTA 1VBA3 1WLTA 4G4FA 3N9QA 4IGQA 3W21A 2ZX3A 4R52A 4IV3B 4FOQA 4XYXA 3W9AA 2BP6A 1L7QA 4RR3B 4ASMB 1FXZA 4FFIA 4Y1XA 5FAXA 4IEVA 3LA2A 4IV3A 2P1BA 1OC1A 4O9GA 4RR3A 2W1SA 2OIIA 3T3YA 4LUMA 1DFQA 2V09A 4W65A 3ASIA 5JOXA 1WLDA 2D3SA 3BU7A 1XNKA 4RD7A 2ZX2A 1ZX5A 2GC3A 5DG1A 5FBZA 5KHGA 4BJ0A 1NOVA 3S7IA 3WNMA 4LLFA 1V00A 2HWB2 1MQTB 2YBKA 1UU5A 3KVBA 1OKOA 5L7OA 3AKRA 5C71A 1YC61 1BEV1 3Q8AA 1NA1B 3MPPG 1MQTA 4WM8C 2EAKA 4GXLA 5F3CA 5J36A 3POIA 2QFEA 3A22A 1RYYA 2WLPA 1NA1A 1R083 1TMF1 4NOTA 4C1WA 1PO11 3GBFA 3GHNA 3IAPA 4CP2A 1Y7BA 1HJGA 3KWVA 1Y9GA 4FXGB 3MIBA 1QJY1 3A0NA 4CCEA 3AKPA 4IE7A 1PO21 2ZTNA 3LCPA 1WCQA 2HWF2 1TE1B 1XE0A 3RYPA 2AACA 4CDUB 5FMOS 1WMDA 4S2DA 1VRH2 2BGPA 4QX3A 2DVBA 3AP9A 5T55A 3OGSA 4YNIA 5FZ8A 2OZJA 3B93A 3ON7A 4CDUA 2G9ZA 4Y20B 1O5UA 4Y4YA 1KD7A 1G9FA 1CZSA 3LAGA 2J1RA 4QGNA 1RUJ3 1DYPA 4BXSV 3GCWA 4CCNA 4Y20A 1H1AA 3O1MA 4Y3OA 4MGKE 3DGTA 2WNVB 1HLCA 5BPXA 4XBQA 4IXLA 5CNAA 4QU2A 4AI3A 1GQPA 4AE2A 3IAQA 1CQ9A 1BVP1 5DXDA 5FZGA 4CP9B 2WNVA 4P08A 3PL0A 4UFMA 4P9GA 5FUPA 3GHMA 4MXVA 4IEYA 2Q8DA 1W0NA 4RYDA 1Q3EA 2H0VA 2CDOA 4N53C 3WNOA 4QXBA 3PDQA 1COV2 2CAVA 2VUDA 3P3NA 4CUAA 3NSTA 3F95A 3GGLA 1AJOA 1JOBA 1ZRIA 3SISA 2ETEA 4GWNA 3N9LA 4DS0A 4R4ZA 1OI6A 2IC1A 3LEIA 2VG9A 1RB8G 4AQTA 3ZVXA 4XBNA 4A2UA 3A21A 4NROA 3OY8B 3PUSA 4JX0A 5F2WA 3DECA 1M4WA 3H1WA 5KC6A 4ZONA 3CDZB 4UFIA 3OY8A 1S2EA 2WINB 4QX1A 3CKHA 4Q4V2 5FY0A 3SNMA 4MG2A 1I9RA 4CEYB 2ZEWA 5EXOA 4XMIA 2EIDA 2LUWA 2E32A 3MW3A 5A7WB 3JB8A 4CEYA 1X33A 2DCJA 1AYN3 1JUHA 1WMEA 3LDRA 5FK7A 3T2PA 1W6MB 5A7WA 1O4ZA 1MR5A 1UMZA 4COVA 5FO9B 1E5SA 3VD3A 1SCRA 2E7AA 1X9TA 1ULDA 5H9PA 4OYUA 2XBO3 1ASJ1 5SV5A 1W6MA 3CL1A 5IHRA 5JPNB 2DBIA 3W5MA 1YNAA 2QQMA 3KB5A 1R1A2 4WM7C 2J7MA 3ILFA 2ZCWA 3GYDA 3AJYA 5LATA 2AREA 4OCTA 5LBCA 1LRHA 3VDBA 1O91A 3ILRA 2GC0A 2QKDA 2OQ6A 4IERA 1W3XA 4UFJA 4E2QA 4KWJA 1IHMA 1RUI3 1C5HA 2XWJB 3PLQA 4OHXA 2J1VA 2BDRA 2YYOA 3Q8EA 4K1YA 4KG8A 2ES3A 2D6OX 4UWDA 2WL1A 4XF9A 2RS51 2YGLA 3HNMA 3USUB 3V65A 5F2SA 3J8F3 4AVVA 1J59A 4XJ9A 4IEPA 2R071 3U75A 3EXUA 1C8M3 3FHQA 5A3LA 5IYYA 1SEFA 1W0PA 2AEZA 3USUA 3PMEA 1REDA 1ZVFA 3S7EA 3GNEA 3VZKA 1OT5A 4BQWA 2JDPA 2JB4A 1NQJA 3NJXA 1RVF3 3W20A 2VVEA 3BYWA 3G6JB 1AR71 1VP6A 5DN2A 1DF0A 1Q8OA 3LWCA 4FPOB 1SLBA 2W92A 5FZIA 1WLCA 3TNQA 3ELNA 1UQXA 2PHTA 3I3DA 2DU1A 1AYM2 3HBZA 3B9CA 3NJZA 4QKFA 4U36A 5FXZA 5LBBA 3WQ7A 4DEVA 5IK8A 3AXEA 1QJFA 5FK8A 4NPLA 1HRI1 3KS7A 5JXGA 1GANA 3MBWA 2WR9A 3V56A 1JXNA 1T6GC 3RZKA 4CDQB 3RSJA 4LKDA 4Y4RA 1IS4A 3O14A 3MUZ1 4AGGA 5A3NA 1M06G 1NQDA 2ZMNA 2XR4A 4IEOA 1S2KA 3VZNA 4CDQA 1G7YA 5KXDA 2UY8A 1SLLA 4GMP0 3MIEA 2ZGOA 3DXTA 1AR82 2P3JA 1ZA7A 3EB7A 1FAYA 1H8TB 1LU2A 1POV0 3FUOA 1CPNA 2XJUA 3IMNA 4E8CA 4PBPA 4U2AA 5C33A 5AC92 1EYBA 1FOD1 1UY0A 3THTA 1H8TA 4ZZ8A 2F4LA 1S0JA 3AM2A 3H3LA 2OUHA 4RFRB 2TBVA 4JDOA 2WDBA 2W9XA 1RUG3 2WT2A 5ANQA 1Y4WA 2VAUA 2Y6KA 3J7MA 2PYTA 2FMYA 1OBNA 2GNTA 2YXSA 4XJUA 2B7YA 4OZXA 2RS32 1RUH3 3D8CA 4CVUA 1UNBA 1ACCA 1PGSA 2ILMA 3LDKA 4L99A 1D7PM 1YFYA 4L11A 5BNNB 5JOYA 3W5NA 2HEYF 5A80A 4BQXA 5BXXA 2VW1A 1MS5A 4P9IA 1O7FA 4DEQA 1IZ3A 5FLIA 3TN93 4A7KA 5BNNA 1JZ7A 1DQ4A 3WG3A 4XJ8A 4QPGB 2BPA2 1TME1 2VU9A 3ZXDA 1RHI3 4JHZA 4CU8A 5JXHA 1PMIA 2D3PA 3D3AA 1HV1A 2XGXA 3DEMA 5F8PA 1UF2C 5GKAC 3VD7A 1UIJA 4QPGA 3KV6A 4GWIA 1SCSA 3UKTA 4R9AA 5CAZA 5CEHA 4LO4B 4LHSA 5H9SA 4XCAA 1W2AX 2VMCA 3VHNA 1YJKA 3CZJA 2UWBA 4ZXEA 3KZ4C 4W8JA 1W2NA 3VBOB 1AR62 4HSLA 3WNNA 2XB6C 3VBUB 2FDIA 1W2TA 4ET7A 2ERFA 3ZDSA 3HQXA 4MHRA 1DGRA 2Y0OA 1UMIA 3USSA 2HJIA 2ADEA 1VBB3 2XJSA 1EPWA 4IV3C 1BVVA 2VQTA 4LBMA 3VBUA 3THDA 4FI9A 5FYVA 2ORZA 2XQRA 4RR3C 1AR93 5K0UA 2VW2A 1XNDA 1WWYA 1ZM1A 1IGOA 2YZ4A 2XVKA 1D4M3 2ZACA 4LE4A 3O1OA 5KXEA 3GBWA 4XQWA 4E4HA 2RMU3 3DYOA 2HBTA 2DU0A 4XUOA 1JMUB 3HJRA 3AP5A 4WZCA 2BYVE 2BOIA 5J98B 2Y33A 3I97A 4P5HA 5DG2A 3UYJA 1L7LA 2WIIB 3NQHA 2WBKA 3EMRA 1PO13 1HXS3 1RITA 1RUC1 3GZEA 1VBE3 4FOVA 1GZTA 2HWD1 5L7OC 1BHGA 1QJY3 1AZDA 1U5XA 1UCXA 1MQTC 5JUVA 4PJYA 1PO23 4D8MA 5LY1A 2AEYA 4MX3A 3U4SA 3DPRB 1ZZ6A 1NA1C 5A7SA 5JXJA 2VCAA 4IDZA 4XUPA 1OD3A 2JIJA 3P3PA 4I3PA 2XPJA 2X09A 3JUUA 3TYJA 3DPRA 3ZR5A 4OULA 3BPZA 5DZGA 5T54A 1PM7A 4XABA 1N3QA 2A6ZA 4MYEA 5JIUA 3GBGA 3OCPA 3VKNA 1RJ7A 2DTWA 5IVFA 4KU7A 4E8DA 2H6CA 1QJX3 1O4TA 2VBPA 3WHTA 4BIFA 5FYMA 1BEV2 4BYYA 3N3HA 1ZBE1 4CDUC 2ZKNA 4JQRA 3WQBA 1E5IA 2ZGKA 4BMBA 4Y33A 1BBT3 3ZYIB 1TMF2 2VGDA 3GDBA 1F31A 1F8VA 1RXFA 5HXVA 1W8ZA 2PHUA 2ZHLA 2RE9A 3HBKA 4XILA 4BDVB 4COZA 5J96B 1N1TA 1YQ5A 1ST8A 1K5MB 1J3PA 4AI8A 3M3EA 4KGQA 4B1MA 1SLTA 5F39A 2IXLA 5I93A 4NRQA 4I0BA 4CDWB 3WP6A 1SPPB 3UKVA 3O0VA 2WNVC 1MVEA 4YVWB 1K5MA 2BWCA 5FPXA 1WBLA 3OF1A 4UOJA 4CXWA 3FLPA 3BCWA 1UX6A 5A1FA 1LB2A 1N3OA 3AMQA 2W1QA 4CDWA 1SPPA 2VBDA 2QQIA 4NVPA 4Q4W1 4YVWA 1REFA 2A3WA 5FTTC 4F7ZA 1BQPA 3BTAA 3KQRA 4UW4A 3VBHB 1OF4A 2I2SA 3VHPA 2DVGA 4BE3A 5FR3A 2ZX0A 4UFKA 1TG7A 4YGDA 4SLIA 1JYCA 4XF3A 1UO9A 1NZIA 3VBHA 1UU4A 4B7EA 4CYDA 3ORJA 4QHOA 5A6QA 3T2TA 5L9VA 1LENA 4LE3A 1KFXL 4OUMA 3THPA 3UESA 2PA7A 3MFAA 4EZHA 4QHBA 3WX5A 4FO9A 4CUCA 1W6PB 3ZO0B 1OD5A 2C1FA 3D6EA 2J22A 1C1LA 1EAH1 1W9WA 1AX0A 1W8UA 2CU5A 2PXJA 3CJIA 2JIGA 1ZZBA 4L92A 1IQDC 1OLQA 1W6PA 4OQ9A 4CEYC 4BXFA 4EQVA 2W94A 5IJRA 2H0BA 2Y6JA 4FVVA 3TAYA 4XIOA 2WZR2 1CVNA 3K75B 2Q30A 3JBG1 3HN1A 5GZDA 5FZCA 3HT1A 2YBSA 4PT6A 3H8RA 2ZGQA 4I2OA 3N7MA 1YYNA 4M00A 4YZ3A 5FY9A 1S0CA 3ILNA 5KWRA 1VBA1 3ETQA 3H7JA 1S0GA 3WNKA 4IEQA 3WDYA 4DINB 3AP4A 2BTVC 5FKCA 4S2FA 4K1ZA 5EZWA 1AL23 2DVDA 1G9BA 4Q0PA 3ACLA 4LMFA 3ZMOA 1IPSA 2VECA 4QGLA 2DURA 3WQ0A 5FY8A 1F35A 4DXRA 2YC2A 2GNBA 4YM0A 4CP1A 1ASJ2 1D4VB 1UYZA 2GDFA 2NLRA 4JRAA 5LA2A 3K4AA 2EIEA 3URFA 5F3EA 2QQUA 3HIFA 3WF3A 5IT6A 3LFMA 3NNGA 3PTRB 1DDLA 3B7MA 2DCTA 4JCKA 4XEZA 1ND2A 3NNMA 2ZGNA 2JD4A 2F6BA 2VZQA 3O12A 1HRI3 4LHLA 4URAA 3L2HA 1XNCA 1RUD3 1JOJA 1KS4A 2WNEA 1WW7A 4LIUA 2C24A 4D69A 4TLGA 4IEXA 2P5BA 5HV0A 2VJXA 1G9AA 3EO6A 2RS52 3UKNA 1LOCA 1WCKA 2XUMA 2OX0A 1PNGA 4R4XA 5DDJ1 2R072 5FYIA 5JMOA 5FZOB 1XU2A 2PHFA 3P5BA 4GKXA 2D44A 4H7MA 3TEWA 2O1QA 2W68A 3Q9OA 1XJAA 3AZWA 1H2MA 1P8JA 1QOOA 3F2ZA 2N7GA 5FZOA 1AR72 2GH2A 5D21A 4CDQC 2OKXA 4P9LA 3C7OA 4HG6B 3I2IA 3I59B 4Y1YA 2Q8EA 2LALA 3WDUA 3M70A 4DNYA 3WDVA 1JN2P 2UWCA 5KC5A 3H42B 3J7LA 1OMIA 1RUJ1 3X29B 1I1EA 3I59A 3V0AB 3J7NA 3K77A 3U78A 5IATA 2ZGRA 4RQPB 5FUNA 2V4VA 4JQTA 1W8TA 3V0AA 5I8SA 1PNFA 3K3NA 1H8TC 4Q5OA 1K12A 2ZZQA 5FXVA 4DO0A 1QH6A 2QUOA 3JB4C 4RQPA 2CY6A 3TWIA 1D0GA 2WQZC 4LLOA 2W5FA 5C4WC 1U5ZA 4YYOA 1OURA 5F37A 4BHPA 2D97A 2YC0A 3BU0A 5K4LA 1PZ9A 1X8MA 4IQPA 1NLSA 5KHJA 4ZY9A 2QQVA 4UBGA 3S0MA 3FWEA 5KHHA 1H1MA 3MFCA 1MPXA 4XUNA 3T4VA 1X9PA 2Q5TA 5BNNC 1BMV1 3IIAA 3FZ3A 4NO4A 3FE5A 4C91A 4YGEA 4DUWA 1QJU1 1XSQA 5DUWA 3ZKUA 3WY6A 3BIEA 4ONUA 4QPGC 3T30A 5CFCC 4RGAA 2B9UA 4QDQA 5FZ4A 2XKPA 3NJYA 3O0WA 4FP3A 4H55A 4IE5A 4LTAA 4OHVA 2X05A 4A4AA 5D1IA 5DPNA 2VOVA 1W9TA 3QOPA 2K0GA 4CSWA 4MGTA 4LXLA 2DVFA 4CU7A 3AZVA 1AYN1 1V9U3 1YFUA 1QDOA 2RM22 4QU1A 2VW0A 2SLIA 1RMU2 1UZVA 1WD3A 2A70A 2WWUA 3C2UA 4YVSC 4MXWB 1JZ3A 1SFPA 1KGYA 2PTMA 2XBO1 4P5YA 1KITA 1PZ8A 1TME2 2PMWB 5FWEA 5LRRA 3WCRA 5K0UC 5EYYA 4CZSA 2QQKA 4HANA 2NYYA 4MXWA 3NMBA 1ZBA3 4CUGA 2A3XA 4HVOA 4NHMA 1YQ8A 3AVRA 1SLCA 3T09A 4OI2A 3RZHA 4AGRA 2E33A 5LWBA 2DYCA 1NE6A 2CGOA 5FYUA 2E63A 2C5DA 4L9BA 3OPWA 1GWLA 4GD4A 4XACA 3M1HA 3P1IA 4MGZE 4XJAA 5IVJA 3H9AA 3IDEA 1JYIA 1ZREA 1S0DA 4LHKA 2XXZA 3UETA 3VHRA 3I3EA 1ZA4A 3H0OA 4BB3A 3J8F1 4K20A 4CXXA 5C6CA 2C9AA 3ZFEA 5ACA3 3ZN4A 4BLJA 1C8M1 4CCLA 2ZEZA 2NN8A 2RR12 5FZLA 2WWJA 3RYRA 3DPRC 2CDPA 2Q1ZB 1LGNA 2ZMLA 5DUXA 2QE3A 5KR7A 4AZZA 3H3ZA 1QKQA 2AYHA 3WG2A 4YG6A 1JTZX 3O7OA 1HRV3 1NZCA 4AGVA 2QZ3A 2NP0A 1RUC2 1ZZ9A 2HWD2 2VZPA 4QXHA 5JR2A 1UU6A 3O1PA 2XWBB 1PVC3 2ENRA 3IPVB 2PFWA 4LBJA 3ZYFA 4BQ4A 5IVCA 3AZXA 4RHV2 2GU9A 3K4ZA 4TN7A 3UJQA 4I0AA 3RG0A 3LIHA 3SHRA 4P9YA 3AKQA 4KQ7A 2VZ1A 4AWDA 1F5JA 1ALYA 2YFZA 3TEYA 3IMMA 4DRRA 1CR7A 4PCRA 2VMFA 2FDHA 4CEWB 2PHRA 2XQXA 3C7EA 3WDXA 4ARXA 2VZRA 3VL9A 3RGBA 4XW3A 1GP6A 1K5MC 2VZVA 3PUHA 4CEWA 5IWFA 1A6CA 5CZKA 3AKTA 4A41A 5C5TA 4CDWC 1CJPA 4J6GA 1CD3G 1GOGA 2V73A 2W2IA 1ZBE2 4YVWC 5T50A 4BQYA 2Y60A 2DUOA 3M3QA 3ACHA 3MV01 2ZX1A 4HK9A 2QQPA 1O3SA 3WEZA 3KF3A 2OA2A 3KV9A 4CRQA 4JGYB 1WLWA 1RUG1 2MEV2 4AK3A 5A6XA 5A6YA 2FZ1A 3VBHC 3OD4A 1XPWA 4HVRA 3OGRA 1RUH1 1WZXA 3ZMNA 2CGNA 2X53S 2DVAA 5F3IA 4JGYA 3C8XA 4FPFA 3VKOA 3WVJA 1C3HA 2WS91 5C3RA 4M3CE 1DHKB 1I5ZA 1WCSA 1UOBA 4JDNA 4QX2A 5FOJB 1C57A 4Q4W2 1BCXA 4W6XA 4YW7A 1W28A 1F4HA 1JZ5A 5F7UA 1UKGA 3CJIC 2DDUA 4WVVA 3BOWA 1RHI1 3RRDA 1JZ8A 3FC0A 3WW3A 2GH8A 4MGSA 2IXCA 5EQUA 3IKWA 1SG3A 3ZR6A 1HN1A 2A7AA 2R063 2WO1A 1EUTA 1SQ4A 3RZZA 3KGLA 2GNMA 5FPZA 4D3WA 1V0AA 2RG4A 4LORA 4OMCA 1MS1A 3TRSB 2V4AA 2ZHKA 4KBBA 4LQRA 1RTVA 4UF0B 2HWB3 4Y1VA 4IW3A 2O14A 1H0BA 3WNLA 4Z2AA 2L9LA 2CYFA 1UIKA 2W46A 4UF0A 2ZGSA 5EFUA 3UL2A 3VKMA 1NAEA 4HFSA 1EAH2 1VBB1 1ZZ7A 5LW9A 3VBFB 3FJSA 1BYHA 1AR91 3I3QA 5L7OB 1LESA 3ABZA 2VQ0A 2JB8A 3BN6A 1D4M1 3OBTA 2MNGA 1HB3A 5J3UA 5AVAA 2P3IA 3HOBA 3JZVA 4IUGA 3VBFA 3I3MA 1H30A 3JBG2 4ISQA 2RMU1 1DGWX 3LFIA 3HNBM 3HPNA 2NQYA 1DZTA 1DQ1A 3MLLA 3HMYA 1W06A 1XE8A 1VBA2 1STMA 2HWF3 2HYXA 2IXJA 2R1DA 3ZXJA 1YFXA 1ND2C 1VB2A 4HKLA 1HXS1 5DAPA 1VBE1 1G86A 1GOHA 4WZFA 4PHZA 3W59A 2V72A 4LOTA 3IM0A 5DDJ3 1HJFA 3KV5A 1O8SA 1QJEA 1S0BA 2WC2A 4XFGA 5GALA 2B46X 2W52A 2DV9A 3POFA 5EJ3A 3E6DA 1F5FA 1DGRN 4INDA 2VXRA 2ZZJA 1F9KA 2ZXQA 4XZUG 1Y9QA 4ASLA 4AL9A 3GM8A 4FPGA 1C8NA 1POV3 1A8DA 1KEXA 4CUBA 4EN9B 1VBC1 1HB1A 2EIGA 3BIWE 4ZKTB 4YM1A 2CL2A 4A7ZA 3JCIA 5FXWA 4AVCA 4HLTA 1QJX1 3PU3A 2O8OA 1AXYA 5EJ1B 4SBVA 2XMLA 4E4ZA 1EV12 2YG0A 1RUE3 4K3UA 3DYPA 1BBT1 5I91A 4LPLA 1CIWA 1H2KA 1JBCA 1R082 1Q56A 3R05A 4QDSA 3Q8CA 3AB0A 2ID4A 4BA6A 4Q0UA 5JPMB 3DN7A 1PGL2 3RJRA 2EAAA 5EJZB 2NMOA 1WMFA 3O1SA 1J3QA 3QCWA 2B39A 5FRAA 2XJPA 2B5HA 4ES9A 2VZTA 4YRDA 3ATGA 1RUOA 5ABJC 4N7IA 3UGGA 2ZEXA 4JV4A 4FFGA 4Q0SA 4RQPC 4UAPA 2HKXA 2JDHA 3AFGA 3ES1A 1JZ6A 1ODNA 1GV9A 1Z0HA 2DFBA 3HD8B 1JI6A 1XBFA 3NRUA 4LA2A 4WVWA 5LBFA 3S30A 1UOFA 1PHMA 4HPKB 1CONA 4DXSA 3J26N 4K7JA 3ZYBA 5LRSA 1QJU3 2WZPP 2JG8B 3RZJA 2XJTA 3VDDB 1DG6A 4X6QB 4HPKA 3BKZA 1UWWA 4NRMA 3C7HA 3N7KA 1W9FA 3IDAA 2JG8A 3K3OA 3HQRA 3R4DB 1MEC1 4GJYA 4LK7A 2UU8A 4PF1A 1G6NA 1QMJA 3AP7A 2ZAAA 3UT0A 3VDDA 2ATFA 2DCYA 5CB7A 3MLKA 5A3UA 3VD9A 3SXWA 3E6CC 2JECA 3E5UA 5JAXA 1OH4A 1VR3A 5KHIA 3PMSA 5E1RA 3U10A 3D0SA 3M7AA 3NKGA 1NXD1 1OLME 3HNYM 2P6CA 4PQ9A 1EPZA 3EHKA 1UYYA 3POYA 1XB9A 1QF3A 1PMJX 4LOSA 4DB5A 4GKYA 2VOKA 3HVDA 2VMEA 2VMDA 3RWKX 4XQDA 1URXA 2W1UA 4MUVA 2WQ4A 4LT5A 2BBAA 3LA3A 1OXCA 5FDBA 3NV1A 2E31A 4AVAA 3U11A 4L97A 4NIHA 1YEWA 1VAMA 3L2YA 2RDNA 1UW8A 1JU4A 4YW5A 5FPVA 4BQ5A 3WINE 4Z8BA 3RI9A 1AL21 5JOWA 1DYKA 2BNMA 4MO3M 3VKLA 4Q0QA 5J09A 1WD4A 5L9BA 4GQ7A 4KI5M 3DKQA 4XFIA 2WFPA 1N1SA 5C3QA 2W47A 4LA3A 3WW2A 2GAUA 4AHXA 3WUCA 3GJAA 2JENA 4MADA 2XBO2 5T5PA 4M4RA 5IVBA 3RJ2X 4E27A 4GB33 2J1SA 2IXHA 1NCRA 2VOTA 3ZFEC 2WO2A 2CV6A 5B2GB 2VZSA 4XXPA 4RSUA 1GNZA 4UFHA 5I0TA 2YUEA 4Q27A 2I74A 5FLHA 1DZQA 1GKBA 4LO8A 4FQ4A 2XLFA 3I2JA 4JZRA 4YM2A 1LOAA 1RUD1 2AZ5A 2WJSA 2BVBA 1MZFA 1UPIA 1UXXX 2VCBA 2ARCA 2BFUS 2WAAA 3WUDA 1RUI2 3J9SA 1AR83 2BV4A 3CHXA 4P9JA 2Q0AA 4CDXB 4RFT0 4V2WA 2XLGA 3POSA 4NHKA 1S0EA 4W50A 5FQ0B 3UV9A 4P9WA 3J8F2 3MIGA 4CDXA 4QQHA 3ROUA 3DUIA 5FQ0A 4KWKA 4LITA 2R042 5LY2A 1O3QA 2BBVA 4BK5A 2VNRA 4AW7A 4DOUA 4XAAA 1RVF2 5K9YA 2RS33 2Z42A 2FCVA 5M0TA 5IUQA 1O8PA 4JTNA 2VMHA 2BW8A 4KBZA 4Q8LA 5CFDA 1W8OA 1Y9MA 3MZHA 3NWKA 3OGGA 1GU3A 5C4WB 2WT1A 1D2SA 2ZAHA 4W4ZA 3VDAA 4CEWC 5A1AA 4XFHA 4C1XA 4Y1UA 1NT0A 5JI7A 1LR5A 2DBNA 3N7JA 5C4WA 3SITA 3CNAA 2PLV1 2Y0IA 1OLMA 2JDYA 4B1LA 4D6RA 4NIDA 2WS93 5IAXA 4PLMA 1RUF3 1FMD3 1IKQA 2XVLA 4HL0A 3VZOA 2HWE3 1Z78A 1DIWA 4XTMA 3VD4A 1BJQA 4LNVA 1H9PA 2VPVA 5FZBA 1DQ5A 4IGPA 3IIIA 3LPFA 4NHYA 5CFCB 1CIYA 4JGYC 5IK4A 1KFUL 3QH7A 2FDGA 4META 1YLLA 1KXGA 4EV0A 4XPVA 1W8FA 2D93A 5CFCA 1AJKA 2JE7A 1NCQB 2R0FA 3CIHA 1FPN3 1SFNA 2XHKA 2RDQA 3ZLIA 3AKSA 3CZUA 4QKDA 4D94A 4YVSB 3D82A 1NCQA 4FCAA 2BZDA 3ZIWA 1IS3A 1AXZA 2ZABA 3S57A 2XJVA 5JZGB 1RUG2 5K0UB 5A7QA 4Z2WA 2Y6GA 3ZPYA 4YVSA 4FPLA 4M0NA 4PLOA 5F5AA 3ZXLA 5CADA 4IETA 5L19A 1RUH2 3IZOA 1ZNPA 3MO4A 3PUIA 5JZGA 3ETPA 1GR3A 5LEJA 5I0UA 4BOWA 3FLRA 4JVAA 1V9U1 2D5HA 2A73B 1DP0A 5DAWA 3SC7X 3U37A 3WF4A 5HV4A 4ZU5A 3MUY1 3TN92 3MGUA 1L3JA 1S4CA 2BRTA 4D7SA 4A6OA 1RHI2 3N9NA 4QX5A 1GOFA 4HKWA 4JKMA 1SBFA 1VLNA 1VAKA 4QQLA 4XVHA 3WDTA 2UURA 1ZBA1 1LHWA 4TXWA 3VBFC 2FDJA 2A6WA 2V5YA 3LF7A 3N7LA 3EBRA 3LD8A 4D6QA 3WP5A 3WT3A 5I8TA 2AUYA 4MV2A 4XAEA 5EPAA 5T3NA 4AEDB 1H4HA 4HETA 1J1LA 4NWWA 5J37A 2IXIA 2PHXA 2R1BA 1YI7A 2ZGUA 2Z4FA 1W04A 4EN8B 3H8XA 2VTXJ 5C9AB 1CAWB 4AEDA 1S55A 4DZGA 4YW2A 1WA4A 1OPOA 2W39A 2B4KA 2EIBA 1RIRA 5L73A 2Y64A 1VBC3 2JXAA 5DAQA 1K45A 5GZFA 4BMEA 1CAWA 5ACA1 4GAZA 1D4M2 5C9AA 3KCCA 4MSVA 3AC0A 4IEWA 4OQ8A 2P3YA 2GN3A 1J1TA 2R6QA 3SH5A 4Q1PA 3ZSLA 5JDBA 1XXNA 2LTNA 3MYXA 3MW2A 3WF2A 3T0BA 1JYTA 1VMHA 1VBD3 3MICA 3KM5A 4Q4X3 5FYZA 5GLWA 5JSOA 2ZKLA 1HRV1 3PUAA 1W2UA 1PO12 1HXS2 4QX7A 3BGAA 5LA9A 1V6IA 1QJY2 1PVC1 1W6OB 3K48A 2EICA 3THCA 1CJDA 1PO22 1W2OA 2ZOEB 5T5LA 3KQ4B 1A78A 3DXUA 3SH3A 1CPMA 1OFSA 1W6OA 2BJSA 2TEPA 3PJYA 4FOWA 3B3QE 4CTEA 5D8AB 5TSWA 5DAVA 1ZRDA 1SLIA 4RA0A 5FREA 2A6VA 2GSYA 5LASA 1CAXB 2D6NA 3ES4A 1B35B 3LEGA 3ZN5A 5D8AA 4YZ1A 1V6NA 3I7DA 1O4YA 1CAXA 4M3CF 4NHLA 4QQPA 1B35A 1WW5A 1X82A 2OT7A 3NNFA 5BNPB 1QJX2 3VUOA 1Q5OA 3SKVA 3OUJA 3SCFA 2P3KA 1MEC3 3VZLA 4QPYA 4K8RB 4ASKA 2UY9A 2GNDA 2VE1A 2G19A 1O3TA 5FXXA 5BNPA 4NWVA 1BBT2 2VVFA 4XIKA 4B29A 1KRIA 4FPYA 4QXCA 3CJIB 2OYZA 3WCSA 3O1TA 1FI2A 3B69A 1LU1A 2VOXA 2JG8C 1Z7S3 4HKOA 5EWSA 1ND3B 3M3IA 2OUJA 4YW1A 5GLUA 3VDDC 1V70A 2YPJA 3FUQA 1DGWA 2ZGMA 3AVSA 4KNCA 3WP3A 4UW3A 5LA0A 2Q8CA 4LBNA 5FZ7A 3TB0A 1WBFA 4FFHA 1GBGA 1ND3A 1JZ4A 3KHCA 4WBBA 2W08A 2HYKA 5B4XA 3ZPOA 3U4XA 1AUYA 1MS8A 3GF6A 3SLIA 1ZYBA 1HV0A 4V1PA 5JR7B 4BISA 1BKZA 4XETA 3U0ZA 5A32B 1H2NA 3DKWA 4COWA 4ITCA 5BNOB 1UOGA 2WLQA 3ZYHA 3LOIA 3LEMA 3K4DA 2R061 1ULOA 5A32A 2QQLA 1OA2A 1OPMA 4AEMA 5BNOA 5FY7A 1JU3A 2RS13 4OMDA 5JXIA 4OHYA 3AK0A 1L7RA 2XJQA 2FHRA 4XJZA 3NAPB 3J7HA 3VB9A 5GZGA 4N7UA 2HWB1 1KJLA 2ZS6B 5C8WA 5JLVA 3FHAA 1GFF2 2NPIA 3KV4A 5A3TA 1HQNA 2ZGTA 3NAPA 5HI0A 4AYUA 1ND2B 4N9IA 1F2NA 2G1MA 3V0BB 1ZRRA 4COYA 3GCXA 4UW6A 3VBRB 3VD5A 2D7FA 2J1EA 4HBNA 1QQP3 5FBJA 4Q4Y3 3V0BA 3RI8A 3C7GA 1FV2A 5JSPA 2QQJA 5G04L 4LBKA 1V6JA 3VBRA 3M3CA 1NCRC 1JODA 4LIVA 4Y5Z0 1DU3D 1W6NA 2GMMA 2HWF1 2VM9A 5B4NA 2RJKA 3WW1A 4EWAA 3RMXA 2JWPA 1CAVB 1V6OA 3MIDA 5E16A 5FZ6A 5BNQA 3ZSEA 3EQEA 1CWPA 2JEMA 4ZU4A 2D5FA 1TQ5A 5LBEA 5A3MA 5F1RA 3GZTB 4R9BA 3S5QA 2XUEA 4GWMA 1CAVA 4JTOA 1IOAA 3ECQA 2FZ2A 2Y38A 3MIHA 1ONAA 4QD2A 3E5QA 4P9XA 3IBMA 3SH4A 4JRLA 4R9DA 4EWEA 4L2NA 2HEVF 1POV1 4CDXC 1LULA 3NV2A 4J1XA 3I2HA 1XNBA 1XRUA 4L0PA 3SQOA 4B7KA 4AAXA 3WLUA 5BUVA 5IK5A 1AX1A 2A75A 1YCIA 3UGFA 1LGCA 2E7TA 3KLSA 2FDKA 2CWSA 5F5CA 3WR0A 5ABJB 1EP0A 4TYSA 1HRI2 4JGZB 4LKSA 2NMNA 2XG3A 3N9PA 4H2AA 4L8QA 4O65A 4AVTA 1RUD2 1UY3A 2PLV3 1G9DA 1NXMA 5CFDC 2WYSA 5ABJA 1LOBA 3LQCA 1RUE1 2D6LX 4JGZA 4KU8A 4Z1VA 4OHZA 1AX2A 5LK5A 2MHFA 5DZFA 2AR6A 3PIGA 3JD73 1LOEA 1QXRA 3HT2A 1BXHA 1G8WA 4RS5C 3N36A 5FZEA 1N1VA 1TNRA 2R16A 2NZ9A 2P34A 5AFEA 3ZYPA 4Y26A 5CIRA 4CPBD 1O5LA 2Y26A 3U1XA 2VNOA 3ZSKA 5L36A 1DBNA 4YW4A 2UYAA 4GALA 2ZBJA 5DQ0A 4YG0A 2W3JA 2RJLA 3N4MA 1QGLA 4QB2A 5LA1A 3OG2A 1QNYA 2Q8OA 1FOD2 4QQ2A 3BODA 1OLRA 2BQPA 2OW4A 2YPDA 2IXKA 3BTZA 4LHNA 2P37A 3RS6A 1KS5A 4LO7A 1QNWA 3APBA 4Q29A 4E4SA 1A3KA 2PHWA 5FP3A 2Z79A 4K21A 5FOBB 3UNPA 3VN4A 1DQ2A 1ENSA 3B00A 4AAPA 1R1A1 1UZWA 4RL7A 3PVEA 1MZ6A 4XFFA 1NCQC 3O0XA 1R093 2HWC3 4EN0A 4UXAA 5FZKA 4PBOA 1EY2A 4YLZA 3O1RA 2KXLA 4HVQA 3CQOA 4KWUA 1XQNA 2A3YA 1H9WA 1CAUA 4NMIA 3BPSA 4AQ6A 1LHUA 5JZGC 2VD7A 2X8KA 5KXBA 4LO5B 1OQDA 5I0RA 4YZ2A 1W99A 4XFCA 5FLJA 5E8AA 4AFMA 2WFF3 4Y22B 4YSFA 3TBDA 4X8NA 2IVIB 2GP5A 3ZKYA 4XHBA 5A6ZA 1WGPA 2MPFA 4CE8A 5JWPA 4RGGA 2J1TA 3SKJE 1VMFA 4DMIA 4XFAA 2X10A 4Y22A 3FX3A 5F5IA 1PIV3 4AFAA 2V5DA 4CU6A 3ZFEB 1Q8VA 1ULPA 1W05A 4FPJA 5FZ1A 1GLHA 3T0AA 2VC9A 1WW4A 1TVGA 2WA4A 2XJRA 1UZZA 4Y1ZA 5BV6A 4EN7B 4A3ZA 1DLCA 4XF0A 1GSLA 3D5OA 3POJA 1V9U2 1AYM1 2BERA 4W6WA 4AI1A 5C3OA 5IFPA 2VMGA 3D4KA 2C0ZA 1ZRCA 3LGRA 1QY4A 1KDMA 4AEDC 4EWDA 4WVMB 2JDUA 1X50A 4RHV3 4AI2A 4GB31 4DIQA 2BGOA 2R32A 3POEA 4TZDA 4J1WA 2B45X 5FPLA 1IPJA 4WVMA 3UK9A 5C9AC 2CWMA 5A70A 1ZBA2 3N9OA 1LCLA 2DTYA 2VR4A 3HAGA 4MGIE 1V6MA 5FZDA 4UT5A 2WO7A 4LBQD 3WNPA 4XF1A 1VIWB 3OD0A 4YFWA 3CO2A 2VUJA 1AR81 1LEMA 1HX6A 3OPZA 1FX5A 3H50A 5DABA 2DCZA 5EHDA 3CF6E 2A6YA 1E57A 3ALQA 3I2GA 4MGQA 4DUXA 4URTA 4PLNA 5ACA2 2D43A 4BH9A 4UFLA 2BU9A 2QDNA 2VZOA 3NL1A 3ZSMA 3ENRA 5FZ3A 5GLTA 5CISA 1VJ2A 3T0DA 2DUQA 2ZEYA 3LPGA 4NE9A 3CLPA 5EV7A 3WF0A 3FFQA 3T4HB 2YC4A 2RS31 3KT1A 1QH7A 4N9HA 4A44A 2ZX4A 4NHXA 5D8AC 5F6KA 5ERLA 4EROA 1UKRA 1NKGA 1MACA 4EJRA 2IFRA 3M3OA 3MI8A 4CA9A 1HRV2 1OOPB 1UY2A 5CYYA 1BK1A 1S0IA 1B35C 5FO8B 3ACIA 3AJZA 2CGPA 1GZ9A 2GALA 2PN5A 2WZEA 2OVUA 3VL8A 1AHSA 1LEDA 1H6XA 1OOPA 3T1LA 5E88A 4ATFA 1FYUA 5BNPC 2KM2A 2JJ6A 2PAKA 5FYYA 5A7PA 1RUF1 1FMD1 1W0OA 1XC6A 2HWE1 4GZ9A 2J42A 3ME2A 1PK6A 4XC9A 1YIFA 5FJKA 1H2LA 2WQ8A 3VBSB 4BZ4A 2J1UA 3BALA 5GJ6A 1ZZCA 1UPSA 2VCCA 4OZOA 3PJQA 4I01A 4HMZA 1ND3C 3VBSA 2ET1A 3KSCA 3LIGA 5GLVA 3W58A 3PVNA 4CCJA 5IK7A 3I2KA 1K5JA 5GM0A 1FPN1 3IDBB 1H1IA 2A6XA 3VZMA 3WG1A 3I8TA 3KVAA 1RC6A 3L9JT 1XOYA 2D40A 3O1VA 4D7TA 2ZA9A 5ANNA 5IVYA 5FIXA 3HQUA 2Z5WA 2GN7A 2H6BA 1GZCA 1HQLA 1VALA 2E6VA 4MVTA 4J25A 5BNOC 2QVSB 3KT4A 5BYNA 5IVEA 4BLIA 1HKDA 1HW5A 4HK8A 1GQHA 4C8DA 4FTEA 2PAEA 3M8LA 2JG9B 5FZFA 4E9KA 1C4RA 3NAPC 4FPKA 3RDIA 1E5HA 2YB7A 4AG4A 1OA3A 3IN9A 2BVVA 1YRZA 2JG9A 5FY5A 1CX1A 1O59A 5FO7B 2A5ZA 3IDCB 5IVVA 1AXKA 3AYEA 1JHJA 4QQOA 4IL7A 5G05L 1VRH3 3MF6A 2R062 4QPWA 1O3RA 2R0HA 1DYOA 3TNPB 3VBRC 3QH6A 1UOJA 2PQQA 2E53A 1W8HA 4FPCA 4XHXA 5FMCA 2RJ2A 3MEPA 5FY4A 3VGIA 3N9MA 1OKQA 4DXZA 1PZ7A 3WHUA 1HQWA 3KGZA 2AENA 4IEZA 3AMNA 1MS0A 4GMP3 3NO8A 1O6UA 3ZIXA 2TNFA 5F9TA 1VE0A 2Z69A 2P6HA 1QXPA 2ARAA 5FUIA 4FP2A 5FPBA 4NJ4A 2W0XA 4FFFA 1EV13 3LEKA 1YQ2A 2QTWB 2ADDA 2XKOA 1BLZA 3HEIA 1UL9A 1D0HA 1QXJA 4GA9A 4C0BA 2C26A 1GNHA 1KJRA 1K42A 4MH0E 1COV3 4M3CB 3WDWA 2CSGA 4D7YA 2HH9A 3MHZA 1RGSA 1VBD1 2FBEA 1LGBA 4B4QA 4QT6A 4Q4X1 4KG0A 4DFSA 4M3CA 3AZZA 2RHPA 4IV1C 1LAJA 1V6KA 1FATA 2WZ8A 4ZS3A 4BPZA 4OUSA 1I5PA 4LKEA 5EYXA 2R49A 4AQ2A 4XFBA 1T2XA 1FNYA 3C3VA 5DDJ2 5GZEA 3UJOA 1QOSA 3PNAA 1JYWA 1GP5A 4JGZC 1QIQA 4Q4V3 2WSUA 5LK7B 4ZHNA 5JIAA 2QJVA 3FHIB 5C8CB 3AMPA 5BY5A 1UMHA 2QDRA 4JAAA 3WG4A 4MGYE 2ZJCA 3A7QA 4K9SA 4TSVA 2XLAA 5KHKA 5C8CA 2RVAA 1WCDJ 5FY1A 4IGOA 1YQCA 3WQ1A 1RUJ2 2VNVA 4A7YA 4W6YA 5FMOL 3WD5A 1QWRA 4H3WA 4N43B 4CP9A 1PMHX 1UY1A 4DPNA 2QQNA 1W6QB 5I0SA 4UI9L 4I3GA 5FYBA 1R1A3 1W39A 4K40A 4FAHA 1RINA 1RUE2 2DF7A 2P2KA 4N43A 4AVSA 4QM9A 1OUSA 2RDSA 1W6QA 1NG0A 1XU1A 1WMXA 2WZR1 3QACA 1I6XA 4NPMA 3HN3A 3T2OA 1LOGA 4IE6A 4PIYA 3H8UA 1Z7S1 2BUKA 3GZUC 5CU1A 5FZ9A 1ENQA 2WUHA 2ARXA 5CKMA 3DCQA 1C5IA 1LOFC 3LSDA 1IG3A 2EVXA 1NLQA 3NV4A 4WVZA 1HN0A 2GMEA 3GXUA 1HIXA 2YHJA 1BMV2 1OA4A 1NUKA 3DF0A 3IWZA 2W1WA 1YI9A 3D0JA 3VZJA 4MLOA 1XE7A 1ULGA 4XBLA 1QJU2 4CPBA 4OI1A 1RXGA 2EXIA 2GP3A 2XVGA 4I02A 3H1MA 3FBYA 3K51A 5T5JA 4UW5A 4QM8A 3R4SA 4CCDA 4AEKA 2Y6HA 3ACGA 4CXYA 3WW4A 1OQEA 4ES8A 2RS11 1ENXA 1BZWA 2EA7A 4FPEA 1AYN2 1AYM3 2BOJA 4EN6B 3KMHA 1YWKA 2C4XA 4AI9A
chains in the Genus database with same CATH topology
4FOYA 3E5XA 2D6KA 1NCRB 3O5SA 4XF4A 3NKTA 1X7NA 2EXJA 2BGCA 3H7YA 4PDWB 3PVBB 5I8YA 3JU9A 2SBAA 4OVEA 1IS5A 4LBLA 4PDWA 2UWAA 1QQP1 4Q4Y1 3U07A 2UYBA 3RWNA 1MVQA 4FPHA 2VY0A 2XL7A 1LHVA 2WT0A 3B02A 2BNOA 1GQGA 1CGPA 3RMYA 1YO8A 1U5IA 2I07B 2R043 4XF3A 1MZEA 2VVDA 3FFZA 2DUPA 1IPKA 4C0HA 4FTSA 1NY71 4NPRA 5CG9A 1LKNA 1DGLA 4BCUA 3MLJA 5AC93 3G7DA 2AGSA 5CG8A 3LA7A 4B8EA 1C8M2 2X5IB 3A0KA 3EJKA 1DQ0A 5CFDB 1J3RA 1APNA 4QPIB 2X5IA 3OBRA 4GB32 3E6BA 5HCFA 4QPIA 4RS5B 4DY3A 2BEOA 2YY1A 4PIXA 2R30A 4RS5A 3R6SA 4KWLA 4ISRA 5K8SA 3ZXFA 4LBQB 2G9FA 1ULFA 3AZYA 1OSGA 3GZAA 4Z07A 5FCCA 1DQ6A 5JOZA 3JD71 4LBQA 1OOPC 1CX4A 2BFUL 1IKPA 1AR63 2ZMKA 4OI4A 5KXCA 1ZZ8A 1PK6C 4ZXKA 3T1MA 4XJWA 3VHOA 3J4UH 3RNSA 4S2HA 1PGL1 2RM21 3VBSC 1LTEA 1DLLA 2P17A 1RMU1 1MS3A 1QDCA 2NM1A 3SCGA 4HN0A 2BNNA 1C28A 4XDQA 3BB6A 4OLLA 1JH5A 4YZ5A 1Y43B 2WS92 1MZ5A 1RUF2 1FMD2 1R091 2HWC1 2HWE2 3WV6A 4YARA 4Q0VA 2YDEA 4I30A 1MS4A 2FQPA 1LECA 4M01A 1YXWA 4LR4A 4M0HA 4LEJA 3ZN6B 2DFCA 3M2MA 1FPN2 2VQAA 4P14A 3ZN6A 2WFF1 3ZFGB 2JG9C 2IZWA 1YIPA 5H9RA 1D2QA 4KGGA 3ZXAC 3ZFGA 1PIV1 2RR11 3I4IA 4TLFA 1BEV3 2YV8A 1C1FA 5GLZA 1VBB2 4ZU7A 3AYAA 1AR92 3CEWA 4CP0A 4E2GA 1TMF3 5DUUA 3ZFFB 1LHOA 1IS6A 4HZFA 2VH9A 3B94A 2RMU2 1U0AA 1SBEA 5J7MA 3ZFFA 1V6LA 4FSJA 4RHV1 3WXPA 2K2SA 2Q1MA 1ULCA 3SCHA 1JW6A 3TOJA 2QNKA 3JQWA 2IWGB 3QD6A 1VBE2 5H9QA 4C90A 4BM8A 3MF9A 3H3UA 4G9SB 5DZEA 2XL9A 3KCXA 4XXAA 3AP6A 3ZXKA 3ZYRA 1G9CA 4X8PA 2K9ZA 4YG3A 1ZRFA 3ST7A 4BWOA 1VBC2 1JHNA 4AFDA 5LEKA 5KBFA 1PVXA 1TNFA 1QHDA 1SACA 1VB4A 2MEV1 2JDZA 1LHNA 2WNUB 2WA3A 5C8CC 1VBD2 1XYNA 1PGW1 4Q4X2 2WNUA 1ULEA 2WZR3 2GC1A 4IEUA 4XTPA 1QOTA 2D6PA 3N35A 4OHWA 5SV8A 2KA3A 3R0RA 4MZUA 4G3YC 1Q8QA 5DUVA 4AFBA 2EF6A 4N43C 3INAA 2VNGA 4COUA 4R8HA 4PF5A 2QCSB 3M4FA 1OHFA 1VAVA 1X8EA 2B8MA 2GZWA 4AEJA 4AI0A 5T52A 4JC1A 2EALA 4B4PA 3MDPA 5T5OA 1GICA 4GH4B 5J48A 1ASJ3 2E51A 4XOGA 1MEC2 4H14A 4BIOA 3IT8A 4GH4A 4TWTA 2VMIA 4AVBA 4FAGA 1H8VA 1Q8PA 4QGMA 4XZPA 3POWA 4F3JA 3OTFA 1Z7S2 3ZX7A 1X36A 5CBLA 3WNXA 5CA6A 2Z2SB 4YGBA 1NLRA 2O8QA 2PHLA 1MS9A 2F4PA 2RS53 1W6NB 2D98A 5JCTA 1I3HA 1R1ZA 3KCYA 4XMAA 5JSRA 3ZYJB 3PTYA 2R073 3AFKA 2EXHA 4GULA 3AMHA 1OFNA 1REEA 1SDWA 3AXDA 4WM8B 4Z92B 4HT1T 2JE9A 1GZWB 4PDWC 4DRVA 4YZ4A 5FFOC 1VRH1 2VULA 2X29A 1AR73 4OI0A 4LBOA 1Y3TA 2G9GA 2RS12 1AL22 4WM8A 1GZWA 2HEWF 5A33B 2TUNA 2E9QA 1QJZA 3LB9A 2LM3A 2VOWA 4GMP1 4QXKA 2D6MA 5AVPA 5A33A 1J58A 4Q1RA 1AF9A 4KL1A 1EV11 4IV1B 1UAIA 3ZXEA 1SMVA 2ET7A 4NR1A 1N1YA 1R081 2QZ2A 2CAUA 1QQP2 4Q4Y2 2JKBA 1S0FA 4IV1A 1AVBA 4XE9A 5HCBA 1CESA 2ZHMA 3MPBA 2VUAA 1COV1 2X5IC 4QMAA 4YW3A 5AFBA 1WW6A 4AXOA 4Q8KA 1B09A 4AF9A 3WP4A 2DCKA 4WV8A 4FQZA 4QPIC 4B3NA 1ENRA 1OQ1A 1SLAA 3DV8A 1NY72 4ORFA 4E4DX 3HR9A 1RUNA 1RL3A 1FOD3 4H7LA 3BOPA 1H4GA 4N53B 4FTBA 4Q4V1 4FXKB 1YUDA 4N53A 4AQSA 2GMPA 3SMHA 1CN1A 4Q26A 5K7PA 3WOGA 2RM23 5JMCA 4UBHA 5JI9A 1RMU3 1N47A 4Z82A 3KT7A 4LULA 5CVRA 3VKFC 3NW4A 1TME3 2PLV2 1FV3A 1KDKA 2XH6A 1CAUB 3LZZA 4JDMA 1IQAA 1LOFA 4E2SA 5GZCA 3AX4A 1S1AA 4YM3A 3AYCA 3DL3A 5JVVA 3JD72 2G4IA 3OJBA 1TEIA 1UN1A 2WSVA 1NYWA 3AYDA 3FBMA 4HSJA 3NV3A 3I2DA 3R4UA 2BWAA 2DWRA 4S2GA 3B01A 4XQ4A 3ZXGA 4WM7B 2D3RA 3QBQA 4K8FA 2I45A 3WZ1A 2B42B 4WM7A 3OYWB 1PGL2 4Y24A 1YJLA 4K6BA 3JQXA 1N3PA 1HDKA 2PELA 1S2BA 3VLBB 2RR13 4NN0A 3OGJA 3OYWA 4Q2FA 1QU0A 3VBOC 3VBUC 1KQRA 2O0OA 2CTVA 3E97A 4A3XA 4IESA 4B4RA 1SFYA 2OZ6A 1RJ8A 1R092 2HWC2 1RUC3 3ZFGC 2YMZA 1U12A 4X6RB 2HWD3 4BQ1A 4FT8A 4R9CA 3PVOA 2WKKA 2ZGLA 3KD4A 1AL0G 1FNZA 3FLTA 1RUI1 3MIFA 3B9IA 5HCAA 2ARBA 2A71A 3LOBA 1DZRA 3ZFFC 2WFF2 1FT9A 4AHZA 2ZPXA 5E89A 1Q43A 4LO6B 1YFWA 2WWSA 2PHDA 3NVCA 2JICA 2R041 1PIV2 1A8MA 4GIQA 3S6PA 1RVF1 3V64A 4F83A 4I09A 1ZBE3 1WUVA 2ZHNA 5AC91 4KH9A 4DY5A 1XYOA 4ATEA 3A4UA 2YGMA 3CU7A 4I0WB 4PIZA 2MEV3 2OPKA 3RQ0A 2AH2A 1UZYA 3PHMA 1XYPA 1UD1A 1SBDA 3IPVA 4AHWA 4O9EA 2Q4SA 3HWJA 3LSEA 3RYKA 1LODA 4Q4W3 1PVC2 1U5YA 3FMGA 3MW4A 4N90A 1LJ7A 1PK6B 2E7QA 3ZSJA 4HN1A 2WNUC 3VV1A 2PAMA 3CJXA 3RPQA 1AR61 4YGCA 2YROA 3QLQA 4LUKA 2IFWA 2CNAA 2JX9A 1EAH3 3GALA 5F5QA 1GYKA 1YHFA 2EXKA 2ZGPA 4OFGA 3LKJA 5F6LB 3ZYGA 1PGW2 4DQAA 3I54A 1NE4A 4AFCA 4OHYA 4F8AA 2GC2A 1JUIA 3B5LB 4FBFA 2FMDA 4YFZA 3JBG3 3H1YA 4AHYA 3TN91 1Q8SA 3AMMA 4GH4C 5HBAA 1VBA3 1WLTA 4G4FA 3W9AA 2ZX3A 4R52A 4IV3B 4FOQA 4XYXA 4RR3B 4ASMB 1FXZA 4Y1XA 5FAXA 4IEVA 3LA2A 4IV3A 4O9GA 4RR3A 2OIIA 4LUMA 1DFQA 2V09A 4W65A 3ASIA 5JOXA 1WLDA 2D3SA 3BU7A 1XNKA 4RD7A 2ZX2A 1ZX5A 2GC3A 5DG1A 5FBZA 5KHGA 1NOVA 3S7IA 4LLFA 1V00A 2HWB2 1MQTB 1UU5A 5L7OA 3AKRA 1BEV1 1NA1B 3MPPG 1MQTA 4WM8C 2EAKA 4GXLA 5J36A 2QFEA 2WLPA 1NA1A 1R083 1TMF1 4NOTA 4C1WA 1PO11 3GBFA 3GHNA 4CP2A 1Y7BA 4FXGB 3MIBA 1QJY1 3A0NA 3AKPA 1PO21 2ZTNA 3LCPA 2HWF2 1TE1B 3RYPA 4CDUB 5FMOS 1WMDA 4S2DA 1VRH2 2DVBA 3AP9A 5T55A 4YNIA 2OZJA 3B93A 4CDUA 4Y20B 1O5UA 4Y4YA 1KD7A 1G9FA 4QGNA 3LAGA 1RUJ3 1DYPA 4Y20A 1H1AA 4MGKE 3DGTA 2WNVB 1HLCA 5BPXA 4XBQA 4IXLA 5CNAA 4QU2A 4AI3A 4AE2A 5DXDA 1CQ9A 1BVP1 2WNVA 4P9GA 3GHMA 4MXVA 4IEYA 1Q3EA 2H0VA 4N53C 1COV2 2CAVA 3P3NA 3NSTA 3SISA 1AJOA 2ETEA 4GWNA 4DS0A 4R4ZA 1OI6A 2IC1A 2VG9A 1RB8G 4AQTA 3ZVXA 4XBNA 4A2UA 3OY8B 1M4WA 3H1WA 5KC6A 3SNMA 3OY8A 2WINB 4Q4V2 1I9RA 4CEYB 5EXOA 4XMIA 2LUWA 3MW3A 3JB8A 4CEYA 1X33A 2DCJA 1AYN3 1JUHA 1WMEA 1W6MB 1O4ZA 1MR5A 1UMZA 4COVA 5FO9B 1SCRA 2E7AA 1ULDA 5H9PA 2XBO3 1ASJ1 5SV5A 1W6MA 3CL1A 5JPNB 1YNAA 3KB5A 1R1A2 4WM7C 3ILFA 2ZCWA 3GYDA 3AJYA 2AREA 1LRHA 1O91A 3ILRA 2GC0A 2QKDA 4IERA 4E2QA 4KWJA 1IHMA 1RUI3 1C5HA 2XWJB 3PLQA 4OHXA 2YYOA 4K1YA 4KG8A 2ES3A 2D6OX 4XF9A 2WL1A 2RS51 2YGLA 3USUB 3V65A 3J8F3 4AVVA 1J59A 4XJ9A 4IEPA 2R071 5A3LA 3EXUA 1C8M3 1SEFA 1W0PA 3USUA 3PMEA 1REDA 1ZVFA 3S7EA 3GNEA 3VZKA 1NQJA 1RVF3 2VVEA 3G6JB 1AR71 1VP6A 1DF0A 1Q8OA 3LWCA 4FPOB 1SLBA 1WLCA 3TNQA 3ELNA 2PHTA 2DU1A 1AYM2 3HBZA 3B9CA 3NJZA 4U36A 3WQ7A 5IK8A 3AXEA 1HRI1 3KS7A 1GANA 3V56A 1JXNA 1T6GC 4CDQB 3RSJA 1IS4A 3O14A 4AGGA 1M06G 1NQDA 2ZMNA 4IEOA 3VZNA 1S2KA 4CDQA 1G7YA 5KXDA 2UY8A 1SLLA 4GMP0 3MIEA 2ZGOA 1AR82 2P3JA 1FAYA 1H8TB 1LU2A 1POV0 3FUOA 1CPNA 2XJUA 3IMNA 4PBPA 4U2AA 5C33A 5AC92 1EYBA 1FOD1 3THTA 1H8TA 1S0JA 3AM2A 2OUHA 2TBVA 4JDOA 1RUG3 2WT2A 2PYTA 2FMYA 2GNTA 2YXSA 4XJUA 2B7YA 4OZXA 2RS32 1RUH3 3D8CA 1PGSA 2ILMA 4L99A 1YFYA 4L11A 5BNNB 5JOYA 2HEYF 5BXXA 2VW1A 1MS5A 4P9IA 1O7FA 1IZ3A 5FLIA 3TN93 4A7KA 5BNNA 1DQ4A 3WG3A 4XJ8A 4QPGB 2BPA2 1TME1 2VU9A 3ZXDA 1RHI3 1PMIA 2D3PA 1HV1A 2XGXA 1UF2C 5GKAC 1UIJA 4QPGA 1SCSA 3UKTA 4R9AA 5CAZA 4LO4B 5H9SA 3VHNA 1YJKA 2UWBA 3KZ4C 3VBOB 1AR62 4HSLA 2XB6C 3VBUB 2ERFA 3ZDSA 3HQXA 2QQPA 1DGRA 2Y0OA 3USSA 2HJIA 4IV3C 1VBB3 2XJSA 1EPWA 4LBMA 1BVVA 3VBUA 3VBOA 4RR3C 1AR93 5K0UA 2VW2A 1XNDA 2YZ4A 1ZM1A 1IGOA 2XVKA 2ZACA 1D4M3 4LE4A 5KXEA 3GBWA 4XQWA 2RMU3 2DU0A 4WZCA 3AP5A 2BYVE 5J98B 5DG2A 4P5HA 2WIIB 1PO13 1HXS3 1RITA 1RUC1 1VBE3 4FOVA 2HWD1 5L7OC 1QJY3 1AZDA 1U5XA 1UCXA 1MQTC 4PJYA 1PO23 4MX3A 3DPRB 1ZZ6A 1NA1C 3P3PA 4I3PA 2XPJA 3JUUA 3TYJA 3DPRA 4OULA 3BPZA 5DZGA 5T54A 1PM7A 1N3QA 2A6ZA 4MYEA 5JIUA 3GBGA 3OCPA 3VKNA 1RJ7A 2DTWA 4KU7A 2H6CA 1QJX3 1O4TA 3WHTA 4BIFA 1BEV2 4BYYA 3N3HA 1ZBE1 4CDUC 2ZKNA 4JQRA 4BMBA 2ZGKA 1BBT3 3ZYIB 1TMF2 2VGDA 1F8VA 1F31A 5HXVA 2PHUA 2ZHLA 2RE9A 4XILA 4COZA 5J96B 1N1TA 1K5MB 1J3PA 4AI8A 3M3EA 4KGQA 1SLTA 5I93A 2IXLA 4I0BA 4CDWB 3WP6A 3UKVA 3O0VA 2WNVC 1MVEA 4YVWB 1K5MA 2BWCA 5FPXA 1WBLA 3OF1A 3FLPA 3BCWA 1UX6A 1LB2A 1N3OA 3AMQA 4CDWA 4NVPA 4Q4W1 4YVWA 1REFA 2A3WA 5FTTC 4F7ZA 1BQPA 3BTAA 3KQRA 4UW4A 3VBHB 3VHPA 2I2SA 2DVGA 4BE3A 2ZX0A 4YGDA 4SLIA 1JYCA 3VBHA 1UU4A 4B7EA 4CYDA 3T2TA 1LENA 4LE3A 1KFXL 4OUMA 3THPA 2PA7A 3MFAA 4QHBA 3WX5A 4FO9A 1W6PB 3ZO0B 1OD5A 2C1FA 3D6EA 1C1LA 1EAH1