2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
5GLUA 1W6OA 1UPSA 2E7TA 1HKDA 3RQ0A 1N47A 2ZA9A 1G7YA 4BMBA 3FUOA 1FV3A 1DYKA 1KDKA 4XBLA 5CAZA 5JMCA 2EAKA 1A78A 5H9PA 1DZQA 4XJWA 2E53A 1JBCA 3R4UA 1LOAA 4Y1VA 5HCBA 1UKGA 3INAA 3V0BB 3ZXFA 3D6EA 3V0BA 3VKMA 5KXDA 3JU9A 4PQ9A 1J1TA 2C5DA 4XDQA 2CY6A 4GXLA 1G9FA 3AP6A 1LJ7A 1Q8VA 1LHVA 1SBDA 3RS6A 1CQ9A 3WNXA 1GZCA 1I3HA 2A75A 1AXYA 1VAMA 4YGBA 1Z78A 1JUIA 1GBGA 2GN7A 4UW5A 4NOTA 4FPHA 3QCWA 4ZKTB 4LBJA 4GA9A 1MS1A 4UW6A 1MS0A 3A0KA 1UZYA 3V0AB 1H9PA 3V0AA 4XHBA 3T1LA 4FPJA 4XTPA 3RMYA 1VALA 1FYUA 2A71A 4FOYA 2ZACA 5GLVA 2GMMA 5E8AA 4ZXKA 2ZGMA 1G86A 3VUOA 1S0IA 4FP2A 2CTVA 2AUYA 2WT1A 2G4IA 1C57A 1JOJA 5DZGA 2NYYA 2JD4A 3OYWB 1ULFA 4F83A 5BYNA 2WLQA 1EPWA 1V6IA 2SLIA 2ZHLA 4FOWA 2DV9A 2GNDA 4P9XA 5JVVA 2XB6C 1N3QA 2ZZJA 4IQPA 3VKFC 3N7MA 4Q8LA 3SITA 3ZSLA 3FLPA 1GSLA 3HN1A 2CWSA 2A6YA 2PHUA 1GV9A 1LENA 2WSUA 1ZM1A 5EXOA 2OW4A 5KXEA 3FFZA 1PZ9A 3AP4A 3PMEA 2JJ6A 1GZWB 1JHNA 2AGSA 2A6WA 2ZGKA 5CA6A 1LHOA 1WW4A 3POWA 1BYHA 1UL9A 4XJ8A 4Y24A 3I8TA 3GALA 3PVOA 2D6MA 1LGNA 4R9DA 4XBQA 1QOOA 3HMYA 5T54A 1ULEA 5GZDA 1ENSA 4YLZA 5T52A 3ZXEA 2PHFA 1S0CA 1DGLA 1HDKA 1D0HA 3UJQA 1W0PA 4AWDA 1LOCA 1LULA 3RMXA 1YRZA 2ERFA 1LU1A 2EXJA 1IS6A 2D6LX 1HQWA 1V00A 4LBMA 2EXHA 4M3CB 4HANA 5T5PA 1BQPA 5DUVA 1N3OA 3V64A 1DHKB 1VIWB 3ZSKA 4YG3A 4AVSA 5AVAA 2DVFA 3LSEA 4YZ3A 1QU0A 3OGGA 3Q9OA 4M3CF 4YGEA 5LK5A 2DU1A 3D5OA 3R05A 1U0AA 4Y1ZA 3ZVXA 3B00A 5DG2A 1AX0A 1LEMA 2A5ZA 1N1SA 1N1TA 2DVBA 1X50A 4U2AA 1QMJA 2ZMLA 4UW3A 5FREA 4AVTA 1QF3A 2WQZC 5CB7A 1D2SA 4Y20B 3N3HA 2WT2A 4Y20A 1H30A 2AENA 2P2KA 2LALA 4FPGA 2JE7A 3GNEA 5H9SA 3SNMA 4ITCA 1AX1A 2A6XA 5HCAA 4YW1A 2E7QA 1SFYA 1OFSA 1MR5A 4YW5A 1LECA 4MYEA 4YM2A 3SLIA 1ULGA 4D69A 2DUPA 4LBKA 2GN3A 2R16A 4XIKA 1W6NB 1W6NA 5DUUA 3ZSMA 5DZEA 2FMDA 3N35A 1G9AA 1WLWA 3POYA 1WLCA 2PELA 3AP9A 4K21A 3UJOA 5F5QA 1V6NA 1WD4A 2D43A 5H9QA 1F9KA 2FHRA 1IS3A 4ATEA 3JUUA 1S0GA 1W6OB 2ZGLA 5T5JA 4DPNA 5CBLA 2DYCA 1WW7A 3AYCA 4GKXA 2HYKA 1TEIA 2P3IA 2W68A 4P14A 1GZ9A 3SH4A 2PHTA 1AXKA 4XBNA 4XXPA 4Y22A 3OPZA 4CTEA 3LCPA 1DIWA 1KJRA 1SLTA 3ILFA 3WG3A 2AYHA 1OKQA 3AZYA 2A6ZA 3APBA 2AH2A 3KM5A 5IUQA 3FLRA 3N36A 4ISQA 4XOGA 1AXZA 1IS4A 1SLIA 3R4SA 1CIWA 3A0NA 1JXNA 4GALA 4BPZA 2E6VA 1A3KA 1XQNA 3VKLA 3AYAA 1AX2A 3N7JA 2W08A 1S0DA 1CR7A 1V6JA 4RA0A 4P9WA 2OVUA 1F5FA 3LSDA 5T5LA 3IM0A 3M3CA 4FVVA 4Y1UA 1O4YA 4BLIA 1IOAA 1RINA 4Q2FA 4WVVA 1JYIA 1W0OA 1FAYA 1V6OA 1LESA 2GMEA 2YY1A 5E89A 4JC1A 5T5OA 1ENRA 2C9AA 4Q26A 4BM8A 4FPYA 3OBRA 4LBQD 4Q1RA 2D3RA 4ATFA 3B01A 4YGCA 1DQ1A 3MPPG 1QDCA 3WDYA 3M2MA 2NN8A 3ZXKA 1CPNA 1HLCA 3NV2A 1A8DA 4DFSA 4LBLA 1IKQA 2D6NA 4FQ4A 3AXEA 3FLTA 3RG0A 4XXAA 5DG1A 1AVBA 3MW3A 4PCRA 1GANA 2ZBJA 1UZZA 1LODA 2A3XA 5GALA 3WLUA 1SCSA 2P3JA 3MEPA 3ZXJA 1AJOA 1CPMA 1O4ZA 3IKWA 3IN9A 3PJQA 2ZGSA 4W65A 1VAVA 4FOVA 2VW2A 2B7YA 1GLHA 1QNWA 1BKZA 2VW1A 1MZ5A 3ASIA 2DTWA 4R9CA 2D3SA 1LHWA 3MW2A 3MW4A 3ZYRA 1WD3A 4GWMA 3WDUA 1JN2P 1WUVA 5F9TA 5FRAA 1DQ5A 1BJQA 1ULCA 3N7KA 4YM3A 1APNA 3AZWA 4PBOA 1DQ2A 2LTNA 1CN1A 4LBQB 3WG4A 4LBQA 1G9BA 1SCRA 3AP7A 3M3OA 5T50A 1LCLA 2W39A 1ENQA 1YIFA 2UURA 3AZXA 2D6OX 2XG3A 2WJSA 2YV8A 2YXSA 3WDXA 5GZFA 1LOFA 4Q8KA 3ILRA 5H9RA 1CVNA 2ARXA 3WHTA 3N7LA 4FPEA 4M3CE 2A3YA 4R9BA 1MVEA 1AZDA 3SISA 4XIOA 2A70A 2DUOA 2DVAA 2YROA 1DFQA 3OJBA 2ZAAA 3IPVB 1N3PA 3IPVA 4XMIA 2NM1A 3AFKA 1LOEA 2GDFA 4JRAA 1DBNA 2AREA 2DTYA 4R9AA 4L8QA 3VKOA 4Z8BA 1MS4A 4FP3A 1MACA 5SV8A 2ZGTA 2A7AA 3A4UA 2CYFA 1N1YA 3NV3A 1KRIA 4FPFA 2ZGUA 1N1VA 4XILA 3UL2A 4C1WA 1LGCA 1QDOA 1G9CA 3AX4A 5GLWA 1LOFC 3BIWE 1BXHA 1V6LA 2ZHNA 4Q27A 3O0VA 2UWAA 3ILNA 3RSJA 4C1XA 2PHXA 1SLAA 4PBPA 1NXD1 4U36A 4YFWA 2D6KA 2PHRA 3M3EA 5HCFA 1FNZA 4NO4A 3UK9A 3H0OA 4Q1PA 1YI7A 1V6MA 2E51A 2SBAA 2V5YA 1MZ6A 2VH9A 1UMZA 4YG6A 1MS3A 3L2YA 4DRRA 1SBEA 1C1FA 1FATA 3U4XA 1MS8A 1SLCA 5IK5A 3NWKA 1W6QB 1WBLA 3OBTA 1W6QA 3AJZA 3VKNA 5IK8A 4AYUA 2W52A 3B9CA 3BTAA 4YM0A 4ISRA 1WLDA 3C2UA 5GM0A 5KXCA 2Q5TA 2H0BA 2VXRA 4BMEA 4Y22B 1ULDA 3O0XA 3CNAA 4XYXA 3HR9A 4FOQA 3O0WA 1QOTA 2TEPA 2V73A 3NV1A 4WVWA 1ONAA 1UAIA 4XHXA 2D3PA 2P3KA 4XTMA 1DQ4A 4YG0A 1LOGA 1W6MB 2OUJA 5DUWA 1QOSA 1W6MA 1AF9A 2PHWA 4YZ2A 4ASMB 1SLLA 1JYCA 2GALA 2EXIA 1H9WA 2ZGPA 4OZXA 4XE9A 3SH3A 3OY8B 4XZPA 3OY8A 1DQ0A 1KJLA 2I2SA 3WZ1A 4Y1YA 3ATGA 2VUAA 3T2TA 1GKBA 3AYDA 4P9YA 1W6PB 5KXBA 4BQ1A 1W6PA 2P37A 3D4KA 4FPKA 2Z42A 4TZDA 5JOXA 1DYPA 5GLZA 4GKYA 2DURA 2ZGOA 3FUQA 3WVJA 3FBYA 1WCSA 1WW5A 2WNEA 3B3QE 1OQ1A 3V65A 5L73A 2GNBA 2JKBA 3DUIA 3PVNA 1NLSA 4FPCA 4XJZA 1RITA 1YXWA 2DWRA 1IKPA 2D7FA 2AR6A 1DQ6A 2R1BA 1WBFA 3ZPYA 4DRVA 3WUCA 4YZ5A 1JW6A 1C1LA 3USUB 3USUA 4AVVA 1CONA 4M00A 4Y1XA 4M01A 5DUXA 1WW6A 1C4RA 3ZSJA 1GNZA 1PZ8A 5T55A 4KBBA 2UWCA 1MVQA 3PVEA 2WKKA 3W58A 2OUHA 4FQZA 1SLBA 2R49A 2UWBA 4XMAA 2NMNA 1UN1A 2ZHKA 5GZCA 4YW3A 1G9DA 1PZ7A 2P34A 1B09A 3O12A 2DVGA 3I4IA 2R1DA 1UX6A 1Q8QA 4YFZA 3O5SA 1MS9A 3SH5A 4FPLA 1URXA 4BOWA 1LHNA 2DVDA 1LEDA 1Y7BA 2CL2A 2KM2A 2VW0A 5CNAA 3WOGA 1QNYA 5GJ6A 2ZMNA 1GICA 3POSA 4PF5A 5JOWA 2CNAA 1LHUA 2NZ9A 3NV4A 4RL7A 3WHUA 3WV6A 4DQAA 5JOYA 3OYWA 2EXKA 1YO8A 4K1ZA 3WG2A 3AP5A 2ZHMA 3QLQA 1ZA4A 4I30A 5EYXA 1YYNA 1KITA 1R1ZA 5DXDA 1SACA 1S0BA 5EWSA 3RRDA 3BOPA 2JECA 1QKQA 3KQRA 3T1MA 2ZGNA 1AJKA 3AYEA 5EYYA 4K1YA 3VV1A 4AGVA 2A3WA 3WDVA 4JCKA 1Q56A 4YW4A 1LTEA 1KQRA 1LGBA 1GZWA 2RHPA 2EALA 1RIRA 2R0FA 2WSVA 4WZFA 4XJAA 4CRQA 1LU2A 5IK7A 3AK0A 1HQLA 3TB0A 3M3QA 2VU9A 3AXDA 4Y26A 4FPOB 4UW4A 3B69A 1MS5A 4BLJA 1BZWA 4AGGA 2JE9A 1I1EA 4YW2A 3AZVA 2YMZA 5GZGA 4YGDA 3M1HA 1CJPA 1SBFA 2JDZA 1S0FA 1Q8OA 3DGTA 2WT0A 2YZ4A 1GYKA 2CWMA 2ZABA 4SLIA 3ZYPA 2EF6A 4M3CA 1LOBA 3AZZA 4HL0A 1F31A 4K20A 2UU8A 5JLVA 3WUDA 3BODA 2A6VA 4YZ4A 1Q8PA 2ZGRA 4XJ9A 2ZMKA 3WDWA 1Q8SA 1S0EA 4GWNA 5E88A 1G8WA 2GMPA 4YZ1A 4AGRA 2EIGA 2BQPA 1FX5A 4XJUA 2ARBA 2R0HA 2ZGQA 2ENRA 3WCSA 1VLNA 4YM1A 1Z0HA 3WCRA 2GNMA 4TYSA 2ES3A 5GZEA 4WV8A 1KDMA 1DLLA 2NP0A 2GNTA 2ZKNA 3WG1A 2VY0A 3WDTA 5IT6A 2D6PA 1FV2A 4CZSA 1V6KA 4H55A 1S1AA 5JDBA 5JOZA 1FNYA 5GLTA 2DU0A 1QGLA 5DZFA 1IS5A 2NMOA 3ZXLA 3W59A 5IK4A 3TAYA 4LBOA 1GNHA 1CESA 2DUQA 3ENRA 4DS0A 3IMNA 3AJYA 4LBNA 2D44A 1S0JA
chains in the Genus database with same CATH superfamily
4ZZ5A 2WINB 1UPSA 1VJ2A 2E7TA 2F17A 3LOBA 1O7FA 2WS91 2GU9A 3HJRA 1QJEA 4RR3B 1UU4A 3WP3A 4RR3A 4WVZA 2B39A 5DAWA 2VPVA 3BN6A 5JAXA 2RM23 3O14A 4AEDB 4XBLA 5FZLA 5A3LA 2CAVA 2EAKA 1JZ3A 4MHUA 4XJWA 1ZBA3 2XVKA 3K46A 1LOAA 2VZ3A 3NL1A 3R4UA 2LRPA 4LULA 4QU2A 1UKGA 3HNMA 1IPJA 5CEHA 3D6EA 2YFZA 4CCLA 1S2KA 2VZSA 3A7QA 5HBAA 1PMHX 4BQWA 4CYDA 5KHKA 3W5MA 2G9FA 3HBKA 4CA9A 2CY6A 4PQQA 1G9FA 4QQ2A 3LD8A 3RS6A 1US2A 5CIRA 1GZCA 1I3HA 5AFEA 5B2GB 2A75A 3IZOA 2CV6A 1JU3A 1GBGA 2BERA 2WL1A 3DYOA 3B5LB 4OHWA 1PMJX 4RR3C 2XPJA 1RUF3 4Z92B 2XVGA 3T1LA 4IW3A 1BEV2 4XTPA 2VZTA 1MZEA 4XEZA 5GLVA 3EMRA 4ZXKA 3GM8A 4HK9A 4TTGA 2OX0A 1W8OA 3RDIA 1W06A 4I3PA 2KR2A 5FKCA 4P9XA 4CEWA 5JVVA 1AYM3 4XAAA 1UOGA 1N3QA 1DG6A 1NXMA 2ZX0A 2ZZJA 3HN3A 3POEA 4IQPA 3WQ7A 4QKNA 5ANQA 3QBQA 4LOSA 4Q8LA 3ZSLA 2Y0OA 3FE5A 1GSLA 3HN1A 4GQ7A 2VXJA 2WSUA 1GV9A 3H7JA 5KXEA 3WSOA 2FDFA 2OW4A 4Q0VA 4I3GA 3TYJA 4NIDA 2W94A 3HNBM 1JHNA 2VCBA 2WC2A 2X5IB 4HKWA 4MXWB 4LO7A 2ZGKA 4FTSA 5EJ3A 2EIDA 3OEAA 4UWDA 3POWA 1RUE3 1UL9A 3PUQA 3WNLA 2JEMA 4MVTA 4PDWB 4Q0SA 4AOCA 2WFF2 5LEKA 1NQJA 1R1A1 5T54A 1JZ5A 5GZDA 1EV11 2PQSA 1DZRA 4YLZA 3K2OA 2PHFA 3UJQA 1NOVA 4CEWC 1HRI2 2RMU1 1HXS3 3KV5A 2D6LX 4I09A 1BEV3 1HQWA 3LPGA 2HWB3 2Y38A 4LBMA 5I8SA 1MEC1 1KEXA 1SFPA 1O3SA 5DUVA 3BPSA 5B4XA 4Y33A 1UYXA 1VBB2 1NY71 1VIWB 4PLOA 3UGHA 4E4SA 4HONA 5FZIA 1RUNA 4NHKA 3LSEA 1YHFA 4I0AA 1U5IA 3IWZA 5FY0A 4Y1ZA 1OBNA 5FMOS 4K6BA 1K3IA 3MFAA 1DYOA 5DG2A 2VQ0A 3Q8EA 4COWA 4QB2A 2W47A 3T0DA 2ZMLA 2ZZQA 2JB8A 3W20A 1D2SA 4WM7B 2J1UA 2WT2A 4B1MA 4N53A 4D7SA 4FPGA 2VJXA 2JE7A 1QXRA 1NCQA 3ACLA 3GNEA 3I2KA 3LPFA 3OUJA 5F3GA 4QKFA 1OA4A 1R081 2D5HA 5IVYA 4F8AA 1HRV1 1AR81 1GR3A 2V4VA 2E7QA 4YW1A 3RYRA 1OFSA 1MR5A 5HCAA 2J1VA 2DCTA 2WFF3 3KT7A 4YM2A 3LOIA 4D69A 2XUEA 1CX1A 1B35B 1AR71 3JB4C 1O6UA 5FZ1A 2PMWB 5C5UA 3RJ2X 3UYJA 1L3JA 5A3MA 3FX3A 1W0NA 4R4XA 1WLWA 2CGNA 4CU6A 1WCUA 1WLCA 2V72A 3WDXA 1AR63 1XYNA 3NVCA 3ZN4A 4CUCA 1UYYA 2FHRA 1IS3A 4ATEA 3JUUA 2VCAA 3WNNA 5CBLA 2V09A 4H7LA 4Z07A 2HWD3 3JD71 2EIEA 1RXFA 4N53C 2O14A 4S2DA 5CFCB 3TEYA 4EN8B 5CFCA 2PHTA 5A6YA 1AXKA 4XBNA 5FO9B 2PN5A 5FZAA 3PIGA 2D40A 2AC1A 4XETA 1GWLA 2A6ZA 3FLRA 3SKVA 5FJHA 3J7NA 3I54A 3K51A 1B35C 2CDOA 1SLIA 5FDBA 2YDEA 1LAJA 4E4HA 2CDPA 1IG3A 2QUOA 1DLCA 4BPZA 1QQP1 2E6VA 3GHMA 1OPMA 1XQNA 2VQUA 3VKLA 1AX2A 3WINE 1V6JA 1F35A 4J1WA 1F5FA 3IM0A 4FVVA 4AL9A 4Y1UA 2VOVA 4XQWA 4COVA 1PVC2 4MXVA 2WZ8A 4L97A 5CFCC 3T2QA 1FAYA 1RUG1 1LESA 1V6OA 1VP6A 4LHNA 5E89A 5FZDA 1Y4WA 4CPBA 5F7UA 2C9AA 4Q26A 1IQDC 3OBRA 4MSVA 4Q1RA 3KGZA 2D3RA 4LT5A 1D0GA 4BQ2A 1Q5OA 3B01A 4ATFA 1RVF2 1DQ1A 3BCWA 2RM21 1POV3 1RUJ2 4OI1A 4A41A 2RS53 5AC93 4AI8A 3WNPA 4HOOA 4DY3A 1PGW2 1CPNA 3T4VA 1A8DA 1REDA 1H2NA 4XUQA 4FQ4A 4Y4YA 3PTRB 3R6SA 1ASJ2 3RG0A 1VPHA 4XXAA 5JIUA 2IFWA 3O1RA 4A44A 1QWRA 1QJU1 2WWJA 4PCRA 4QX0A 4W6XA 1W9YA 3GHNA 5FYIA 1GZTA 4XF1A 4LKFA 5FYUA 1J3PA 1TVGA 2JG9A 3NJZA 5GALA 5LWBA 2E63A 4QQOA 2P3JA 3I2FA 1CPMA 1O4ZA 3IKWA 3KQ4B 3NO8A 3IN9A 2GC1A 2ZGSA 2XJQA 4HPKB 1VAVA 4FOVA 4W65A 2B7YA 5AFBA 1ULOA 1BKZA 2VW1A 3ASIA 4QGNA 4R9CA 3D8CA 3AKTA 1DCSA 3ACGA 3TNQA 3ZN6A 1OI6A 5F8PA 3MW4A 1WD3A 4Z2WA 4XF4A 4QPWA 3SQOA 4EN9B 1JN2P 4E4DX 3BUCA 1XNTA 2QQKA 1ULCA 3WP6A 5DABA 3AZWA 2RS32 2AEZA 3WQ0A 1G9BA 2Z5WA 3VZNA 1SCRA 5FK7A 2HLEA 2J1TA 2F6BA 3AP7A 1DGRA 3BTYA 2W92A 2JG9C 3UETA 3KMHA 2YXSA 5GZFA 1LOFA 4J6GA 3SKJE 1AYM1 4CP1A 4XFCA 3U37A 1AHSA 3N7LA 1UX7A 3PU3A 4LO6B 2E7AA 4PIZA 1ENXA 3ORJA 1MVEA 3ST7A 3EO6A 5A1FA 1US3A 1ASJ3 2QQVA 5AVPA 1JI6A 2XDVA 2B8MA 1VBD2 2D93A 1VR3A 2D97A 2HWC3 2NM1A 3DL3A 2GDFA 3PUHA 4JRAA 4ASLA 2VMCA 2DTYA 2JDUA 3BU7A 4L8QA 5LK7B 1F4HA 4Z8BA 1KFXL 1MS4A 3P5BA 3O1VA 5SV8A 3ZOIA 2ZGTA 2RS13 3A4UA 4GIQA 3GGLA 3VZLA 2X29A 4C1WA 2FZ1A 2VO5A 1LGCA 1QDOA 1G9CA 4GWJA 2ZJCA 3K77A 1JZ7A 1ZZBA 1LOFC 3BIWE 1W9SA 1KFUL 3M3IA 4JQTA 1HXS1 2HEWF 2HEVF 3T4HB 4YFWA 1BEV1 1SLAA 4C1XA 2J22A 4M4RA 1FNZA 5L7OB 3OPTA 2RS33 1JYNA 3VZKA 5FZ3A 4Q1PA 1V6MA 2VMGA 2XHNA 4B7EA 1MZ6A 2JDYA 1UMZA 1PM7A 4QQPA 4LJHA 5FZMA 1J1LA 4ZU5A 1SBEA 3KHBA 1C1FA 1FATA 3U4XA 1TMF3 3W5NA 4B4PA 4XFAA 3ETQA 3R0RA 4XDPA 3VGIA 2VMIA 3ZSEA 2H6CA 2W52A 3BTAA 3VDAA 4ISRA 1JYTA 3RYPA 4BQYA 2OZ6A 1OPOA 2P6CA 4BMEA 1UNBA 4Y22B 1VBD3 3OUHA 4XYXA 4BIFA 1W8NA 2BGOA 1ZRIA 3O0WA 5K9YA 2TEPA 4ZS2A 2V73A 2ZEZA 2VNVA 2P17A 1UAIA 2O1QA 2WN3A 4M0NA 1AR92 2D3PA 2I74A 5FY1A 1QOSA 2PHWA 2VMHA 3NNLA 2JIJA 3WF4A 4YZ2A 2WFF1 4UBGA 2EXIA 2ZGPA 5C5TA 4QM9A 1KJLA 2J1RA 4Y1YA 3VZOA 4JTNA 3T2TA 3J9SA 2Q1FA 2VR4A 4AG4A 3AYDA 3AMQA 2XJRA 1AR61 3ZXGA 1QJX3 5IVCA 2PQQA 5HI0A 1V0AA 2VMFA 5A6QA 5GLZA 3UT0A 2ZGOA 4G3YC 4Q29A 4A6OA 4LO5B 4A3ZA 3B3QE 5LATA 2VE1A 5L73A 4AAPA 2JKBA 4EQVA 1RMU2 1GQHA 5A80A 4FFIA 1IKPA 4P5HA 4QHOA 1W2NA 2AR6A 3T3YA 4BISA 4DXTA 4L2NA 1Y9QA 1WBFA 1W99A 4WM8B 4QX7A 4WM8A 2BW8A 4W8JA 5JSRA 3WUCA 5FBJA 2DFBA 3LIHA 3O7OA 1C1LA 3OGRA 5FPBA 4AXOA 5FYCA 4XFGA 1TQ5A 1UKRA 5BXXA 4M01A 1W2UA 1UXXX 4K9SA 2JDAA 4KBBA 1AL22 3W58A 2WKKA 2OUHA 3LZZA 4FQZA 1SLBA 1AR93 4XMAA 3I7DA 2WZR2 4EZ4A 5FYYA 3ZYIB 1G9DA 4A4AA 3O12A 3H8OA 2DVGA 2WO1A 2NPIA 2YYOA 3I4IA 3KGLA 4ES8A 4FPLA 1URXA 3VBFB 1LHNA 2VW0A 1UW8A 2ZMNA 3H3UA 5FQ0A 4PF5A 5JOWA 2IVIB 2Q1MA 1NZCA 5C3PA 3DCQA 3OG2A 1WZXA 3KZ4C 3OYWA 4LKEA 3WG2A 5ISLA 4WM8C 3AP5A 1OQDA 4I0WB 4LKSA 3TEZA 1WMFA 1EPZA 4CDWB 1YYNA 1PGL2 1F8VA 4CSWA 1POV1 5ACA3 5AC91 1SACA 1S0BA 2Q30A 2RS51 1K5MA 3KQRA 1CZSA 1K5JA 4NIGA 5EYYA 4FSJA 1RMU3 2A3WA 3RZMA 5FZ0A 1UMHA 4YW4A 1KQRA 1LGBA 3RWKX 2IXCA 2EALA 4BQ3A 1GNYA 4BXFA 5BNOB 5BNOA 1QY4A 4XQDA 4IEQA 3MV11 4FPOB 2XJPA 4N43B 5FIXA 4N43A 3VBFC 3B69A 3TNPB 1AL23 3E97A 3T0BA 4A3XA 4AGGA 2ZEXA 4BLJA 4AAXA 4QGMA 2Q1ZB 1M4WA 4YGDA 4AZZA 4NHLA 2JDZA 4IL7A 3AKSA 2VTXJ 2WQ4A 1OHFA 2YZ4A 2ZABA 3AFGA 4A7YA 4EWDA 4BWOA 4LKDA 2EF6A 3VDDB 4BDVB 5JR2A 3VDDA 1K5MC 3Q8FA 1LOBA 1POV0 1YQ8A 3AZZA 3H1MA 4HL0A 3Q8CA 4N8MA 3WUDA 1X9PA 1XU2A 4YZ4A 2Y64A 4FTEA 2XLGA 3D3AA 1IG0A 2ZMKA 3WDWA 4NAMA 1Q8SA 1S0EA 4GWNA 5E88A 4BCUA 5BNOC 1G8WA 2XJUA 2WNUB 4YVSA 3MPBA 2AZ5A 5KWRA 5FUPA 4LE3A 4FCAA 4Q0UA 2ATFA 4RD7A 1RVF1 4N43C 5F39A 1RUJ1 2ENRA 2VOWA 2G19A 1XE8A 1PGW1 2YBSA 1JZ8A 2R062 2QVSB 5CFDB 5A7NA 4JRLA 2GNMA 4H7MA 1HB3A 4EJRA 1ASJ1 2ES3A 4CP9B 2UYAA 1KDMA 2WBKA 2X53S 1DLLA 3JXSA 3RJRA 4CP9A 1MQTA 2FQPA 3E5XA 4CXWA 5IVBA 4D6RA 2BOIA 2FDIA 3WDTA 4EN7B 1COV2 3VDDC 4LIVA 4DEVA 4KGGA 5C3RA 2YGMA 4ORFA 3VBHA 2VCMA 2JG8B 3O1SA 3ZFGA 5KHJA 1QGLA 2RS11 2Z2SB 5A33B 3P3NA 4FFFA 5A33A 1G6NA 4YVSC 3ZXLA 4E8DA 5IK4A 4K8FA 1VMJA 1SPPB 2YC2A 4H14A 3ENRA 1SPPA 2QQJA 4CDUB 3IMNA 2LUWA 5A7QA 4CDUA 1RUD2 1NE4A 2VMEA 4RGKA 5IW0A 5GLUA 1W6OA 3IDCB 4QU1A 5FZHA 5A1LA 5FJKA 5FYVA 2E9QA 2RS31 3ZYFA 4AI9A 3HQRA 1JZ6A 3LA2A 2PTMA 4RS5B 1N47A 4V1PA 1MQTC 1FV3A 4LK6A 4AW7A 4BXSV 2BVVA 1IZ3A 3DEMA 2B42B 2JXAA 5BV6A 4N9HA 4QWNA 1TMF1 1A78A 3U14A 2RR12 4A45A 5FLIA 1JBCA 1X33A 4LLFA 3VBSB 3ZFGC 4OQ8A 3Q8AA 1ZYBA 3NSTA 3V0BB 3V0BA 2BWCA 5FZ4A 3VKMA 1VBD1 2QBXA 3ZR6A 4PQ9A 1J1TA 1UY3A 2BTVC 1GOFA 2C5DA 3GZTB 2B9UA 4GXLA 3GYDA 4R4ZA 4ARXA 5HXMA 2Q8OA 1FI2A 1LJ7A 4P08A 2E33A 4L99A 4CDUC 1CQ9A 3UGFA 1PIV3 3BOWA 3KV9A 3J7LA 1AXYA 1JUIA 1ND3B 5J48A 3ZDVA 1ND3A 2GN7A 4NOTA 2YUEA 4LBJA 2IC1A 2WQ8A 3E1F1 4MGQA 5FWJA 2XBO2 1MS0A 3A0KA 3R4DB 1R1A3 4IE0A 2QQPA 3VHOA 3T08A 1VALA 2HBUA 1XSRA 2ZACA 2GMMA 2XKOA 3PUSA 2ZGMA 1G86A 5E8AA 4AVBA 3VUOA 2RMU3 2R042 3NKGA 2WT1A 2G4IA 1C57A 4ZS3A 5DZGA 1VBC3 2MNGA 1LR5A 2G9GA 1ULFA 1JU4A 5BYNA 1PK6B 2P4EA 1V6IA 5FXVA 2SLIA 3OGSA 4FOWA 4A2UA 5I0SA 3VKFC 2P1BA 3N7MA 4PF1A 1VB4A 3SITA 3FLPA 1R093 2A6YA 3KF5A 2ZTNA 5EHDA 5DAXA 1ND3C 5FXWA 2BGCA 3FFZA 2GH2A 4GJYA 3S7EA 1ZVFA 2WO3A 3AP4A 3PMEA 1OT5A 3K48A 4XW3A 4COYA 2QZ2A 4IE5A 2ZX2A 2AGSA 3I2IA 4TXWA 3WX5A 5CA6A 2VECA 1AYN3 1RUI2 1LHOA 3JBG2 1BYHA 3GALA 2VVEA 1VRH2 2YHJA 3PVOA 1AR91 2VG9A 4XBQA 3M4FA 2FCTA 4CCKA 4CU8A 3ZFEB 3ZFEA 5T52A 3ZXEA 5FBZA 1DGLA 1HDKA 1PK6C 1LOCA 3RMXA 2XQRA 2XBO3 5LA2A 2ERFA 2A73B 2KD7A 2WA3A 3GJBA 3TN92 3J8F3 4RHV2 2EXHA 4M3CB 5G05L 2BBAA 1CZTA 5EJZB 4HANA 1F2NA 2O8OA 3V64A 4CEYB 1ND2B 2R043 1DHKB 1ND2A 4YG3A 2X8KA 2JKXA 4DNYA 1HV0A 4QPIB 3D5OA 1RMU1 3MHZA 1U0AA 2K2SA 1W9TA 3R05A 2OKXA 3B00A 4HFSA 4FAGA 3JD73 2A5ZA 4L9BA 1LRHA 1N1SA 4Q4X2 2PA7A 3LF7A 4Y5TA 1RHI3 1X50A 5LB6A 3WF0A 1SQ4A 4Q4V2 4QDRA 2D5FA 4U2AA 5FREA 4AQ2A 4LR4A 1QF3A 2CHHA 3ZFEC 2EVXA 1JMUB 5CB7A 4BH9A 1W39A 3AMHA 2C0ZA 4JAAA 4KWLA 2AENA 5ERLA 2LALA 4CUGA 4UFHA 3I3EA 1RUI3 1AL21 1HIXA 1AX1A 3CHXA 3U0ZA 5FPAA 3VDBA 1VRH3 3JQWA 4C8DA 1Y3TA 2J1EA 3D0SA 4YW5A 2WZR1 1T6GC 4MYEA 4MGIE 1ND2C 1C5IA 5HCHA 1JHJA 2R16A 1ZNPA 4QPIC 1NLQA 1GQPA 1H2LA 3FZ3A 1C8M2 4K3UA 1C28A 4K21A 2PELA 1UU5A 1WD4A 4E27A 3MDPA 4UFJA 1QJY2 5K8SA 1W3XA 4HSLA 5DPNA 1S0GA 5T5JA 5I8YA 1PGL1 4GKXA 4KU8A 2HYKA 3MUZ1 1H2KA 5LA0A 4O7XA 4P14A 2DCYA 1ZZ6A 2TNFA 1Q43A 3OPZA 4KWKA 4QMAA 4LA2A 3LCPA 3WP5A 4CTEA 1GFF2 3CJXA 1KJRA 4Q4X3 3S5AA 2OQ7A 1O5UA 3AZYA 1SDWA 2AH2A 3KM5A 4Q4V3 4ISQA 3HBZA 1IS4A 3BYWA 3R4SA 1CIWA 1QJU3 3A0NA 5KHGA 1O3QA 5JI7A 4D8MA 3E5UA 4OHZA 3AL5A 4B4RA 3SEPA 3ZX7A 3AYAA 1S0DA 3USSA 1HJFA 3A22A 2VOXA 1RUH3 5T5LA 2YBKA 1EAH2 2VNRA 1XYOA 1I6XA 1XPWA 3NJVA 4YNIA 4MH0E 3IDEA 1W3VA 2IXIA 2RE9A 1RUOA 4FFHA 3CJIB 4ONUA 4Q2FA 5FP7A 3CJIA 1WMDA 5FP8A 5LY2A 2GMEA 1QJFA 1ENRA 3U4SA 4AQ6A 4CU7A 4XUPA 1XYPA 4LBQD 4LHKA 2Q8EA 3VBRB 3VBRA 5EQUA 4NJ4A 1DGWX 3I2HA 3ECQA 3T2PA 5BNPA 2QQLA 1OD3A 3MPPG 1QDCA 1W2OA 3OTFA 2GH8A 1HLCA 5EIYB 4LHSA 2OYZA 5L9VA 4CEWB 2H0VA 2R061 3AXEA 4GH4A 2O8QA 3GBGA 4KWJA 2W9XA 2ZPXA 4NRPA 1WGPA 2JWPA 1LODA 2A3XA 2X09A 4D7YA 1SCSA 3MEPA 2XONA 1AJOA 3CJIC 1COV1 1HJGA 1PIV1 2WWSA 2XUMA 4AFCA 4CCMA 1CX4A 3DECA 4Y4RA 2DTWA 4B1LA 5F6LB 3O1TA 4OHYA 3BU0A 2MEV2 4L0PA 3VBRC 4AHXA 1W04A 3ZYRA 2RG4A 5BNPC 2QQMA 4GWMA 4GMP1 4AVAA 4D6QA 4YM3A 1APNA 3WG4A 4GH4C 3H8RA 2QKDA 5HV4A 3S0MA 5T3NA 3M3OA 1V9U2 5I8TA 5LCWL 1ENQA 1PO12 5DN2A 3WEZA 1VBC1 2P5BA 3AZXA 1UY1A 2D6OX 2XG3A 3PUAA 1RJ8A 4I2OA 1UY4A 1S4CA 3ILRA 1H4HA 1CVNA 3RYKA 2RJLA 4CDQA 2XJVA 4FPEA 2EICA 4J25A 2QDNA 4TN7A 3MLJA 4W4ZA 3DYPA 4ZU4A 5FLHA 1VBE2 1AZDA 4LHLA 3GZUC 5FMDA 1R091 1GMMA 4Q0PA 3NMBA 2A70A 4XIOA 2RV9A 1IPSA 1GUIA 4FXKB 4TLGA 4ZHNA 3MBWA 1W90A 1JTZX 1X8MA 2ID4A 1E5RA 4GMP0 1AYN1 3TEXA 4DXRA 2Q0AA 3KWVA 1DBNA 2CAUA 2MHFA 2JE8A 4R9AA 5KHIA 1MACA 4N53B 2BUKA 5A7PA 3EHKA 1NCQB 5FXZA 4CP2A 2ZGUA 1N1VA 4O9GA 4XILA 2PFWA 4IE6A 5FMOL 4IGQA 4CCNA 1BXHA 3NRUA 4LA3A 2XBO1 2WA4A 5A3NA 3PVBB 4BU2A 4CDQC 4XUTA 3EYPA 2PXJA 2UWAA 3RSJA 4B7KA 5APAA 1HB4A 1NXD1 3J8F1 3M3EA 2D98A 4NO4A 4CDXA 3H0OA 3ZMOA 4NMIA 4AQSA 3AMMA 1HRI3 3OPWA 2V5YA 2E51A 2SBAA 2R041 4LOTA 2VH9A 2W46A 3THDA 1PO13 1MS3A 4P9JA 2UYBA 1NX9A 4OVEA 4XFHA 4FT8A 5JI9A 5IK5A 3NWKA 2GP5A 1UWWA 1VBB3 3OBTA 3AJZA 4AYUA 5LA1A 4YM0A 4GB32 4B3NA 3TBDA 5A3UA 1UD1A 4FBFA 2PLV2 1RHI1 4A42A 2QQUA 2Q5TA 5A3OA 1NCQC 2VXRA 5JPMB 4DO0A 3OBZA 1ULDA 3O0XA 5FPZA 2C6SA 3HR9A 2LS6A 1REEA 3WF3A 4QPYA 4XPVA 3NV1A 1RUI1 4WVWA 3MF6A 1QXJA 4XTMA 5A7SA 4Q4W2 1VRH1 2OZJA 1W6MB 4Q0QA 5DUWA 1W6MA 4AHZA 4OZOA 1RTVA 3UGGA 1JYCA 4LO8A 2GALA 1PO22 1SG3A 4HKOA 1YIPA 1FMD2 2OS2A 2ZEYA 1DQ0A 2IXKA 5JMOA 2XLAA 3OD0A 3CL1A 4AE2A 1JYXA 1U5YA 1GKBA 3MICA 3TN91 4BQ1A 2XWBB 4XQ4A 1C5HA 4IE4A 5L9RA 1FOD2 2DCJA 2ORZA 2PAMA 2WNEA 4R8HA 1OQ1A 1ST8A 4FPCA 3PVNA 3X29B 1FPN2 1RITA 5FOBB 3CF6E 2DWRA 4QXBA 4BJ0A 3ON7A 5C8WA 2WAOA 4UF0A 4Q4X1 3WF2A 2PLV3 4HBNA 4JKLA 3MI8A 4Q4V1 2WIIB 3RVHA 5FYSA 2AEYA 4AVVA 2HJIA 1CONA 2PHLA 4KNCA 4OI4A 3C7OA 3ZSJA 1ZZ9A 5BY5A 2RJ2A 2JG9B 2W0XA 1QEXA 2XHKA 2R49A 2UWBA 5FAXA 2ZHKA 2XJSA 4Q4W3 3BALA 4YW3A 1PZ7A 1RUH1 1B09A 3HVDA 1UX6A 1Q8QA 4YWAA 1UF2C 1IQAA 1PO23 3FHAA 3O5SA 3SH5A 4E9KA 4UFLA 1OFNA 2RDNA 1LEDA 1W8WA 1W2TA 1Y7BA 5CNAA 3ZN6B 5KC5A 1GICA 2PYTA 2QQOA 1H2MA 4AFDA 1XU1A 2VAUA 3WV6A 4DQAA 1C8M1 5JOYA 3I49A 1SHWB 2EXKA 4ASKA 1YO8A 4OI2A 1VBA2 4K8RB 1PVC3 1UYPA 5E16A 2ZHMA 3PHMA 1ZA4A 3LIGA 3VL8A 4BIOA 2OIIA 4S2HA 1X8EA 1R64A 2QQWA 4IUGA 2RDQA 5JWPA 3AVSA 5EP9A 1ZX5A 5EWSA 2ZGNA 1AJKA 3AYEA 1HV1A 3THTA 4HN1A 4AGVA 2C24A 1LTEA 1QHDA 3J7HA 1RVF3 1GZWA 4WBBA 5BNQA 1RUJ3 2R0FA 1XBFA 4WZFA 1KS4A 2VTFA 4XJAA 3VHRA 4CRQA 4PLMA 3HAGA 1UY2A 1YCIA 3PURA 3I2GA 5FZOA 4UW4A 4MGTA 1GU3A 5A7OA 2K9ZA 1BZWA 1PNFA 2JICA 2JE9A 3T09A 4GZ9A 5GZGA 5L19A 3M1HA 1E5IA 2B46X 4XFBA 1Q8OA 2UY9A 3DGTA 2VZPA 1ZRCA 4SLIA 1PNGA 5D1IA 3C7EA 4AFAA 4O9EA 5JLVA 4HK8A 5F1RA 4MGKE 3SC7X 1Q8PA 4XJ9A 5EZWA 1UU6A 4N90A 5CKQA 5KR7A 1XRUA 4YVWA 5BNNA 2GMPA 4YZ1A 2BP6A 2EIGA 2BQPA 1D4M2 4FO9A 4XUNA 4XJUA 5B4NA 2ARBA 1EP0A 1CAVA 5C33A 5HPOA 3WNOA 1NE6A 4PIYA 4YM1A 5A3PA 3LQCA 2ZAHA 1FT9A 4WV8A 1XXNA 4LNVA 5GZEA 2XH6A 4IESA 3VB9A 4QPGB 3UKNA 1BVVA 3KV4A 4QPGA 2ZKNA 5CU1A 1WCQA 4D94A 1OF4A 2X05A 3ZYBA 1TG7A 4QX8A 4H55A 1S1AA 1W8FA 1FNYA 4XDOA 5GLTA 1O4TA 2DU0A 3IIIA 1UZVA 5F6KA 3KV6A 3M70A 4H3WA 4KI5M 1REFA 4O61A 4YVWC 2MEV1 5BNNC 3W59A 2W1UA 3MIFA 1CESA 3MFCA 3ZN5A 3AJYA 3CIHA 2H6BA 3IAPA 4LBNA 2D44A 2K46A 1UOFA 3CBNA 3AKQA 3L2HA 3SHRA 4EROA 2W1WA 4PI0A 3E6DA 5C70A 1HRI1 2B5HA 2E26A 2WZEA 1UO9A 1V9U1 4BMBA 1PO11 3FUOA 1DYKA 3IAQA 4QPGC 4WZCA 4FI9A 1AUYA 1D7PM 2BFUS 1J58A 5JMCA 2FDHA 2BNNA 3WP4A 3OGJA 4NUBA 1V70A 3RFRA 5GKAC 1DZQA 1SEFA 1VBB1 2IXJA 2E53A 3G7DA 4XABA 2HYXA 5IFTA 2PAEA 5HCBA 1TNRA 1VBE1 4TSVA 2WR9A 4NE9A 5KXDA 4HVQA 3JU9A 3LWCA 3HT2A 5F5IA 1ODNA 1ZRFA 2BFUL 3AP6A 3THCA 1Q8VA 3VHNA 1LHVA 1SBDA 5FY5A 1U5ZA 1VAKA 2ZCWA 3B02A 3I2JA 4COZA 3W9AA 1Z78A 4IXLA 5FP9A 4AF9A 4FPHA 4ZKTB 1HW5A 2K0GA 2VULA 4YPJA 3H42B 4HVRA 3V0AB 3V0AA 4NIIA 1Y43B 3N9LA 4L11A 1RYYA 4XHBA 4FPJA 3RMYA 4N9IA 3WD5A 2A71A 2YBPA 3N9PA 3I3MA 1S0IA 2ZOEB 2CTVA 2AUYA 3Q8BA 5FQ0B 3IDBB 3VHPA 3ZFFA 1J83A 5F37A 3HNYM 2VNGA 4NROA 4NAOA 1PMIA 2NYYA 5DAQA 3OYWB 2Z69A 2ZHLA 5BUVA 4XFIA 2XB6C 5HXVA 1QJZA 4BQXA 4LITA 4OUMA 3L9JT 1YFUA 3KSCA 4AI1A 3AMNA 3E5QA 4PHZA 4UFMA 5FZFA 3UKVA 4TWTA 1K5MB 5LASA 5EXOA 4B29A 1LENA 3H3ZA 1ZM1A 1VRBA 2PLV1 1YQCA 2Y6JA 1PZ9A 3S30A 2VUCA 1H4GA 2W5FA 3FN9A 4XJ8A 1OF3A 5TSWA 1W9WA 1VMFA 2XLFA 4Q4W1 3ZLIA 5KBFA 4EE2A 1QOOA 5JXGA 4RSUA 3C7HA 3HMYA 4JDMA 3EQEA 2W87A 1UIKA 5JUVA 1PO21 1S0CA 2VQTA 5IYYA 1D0HA 3H7YA 4AWDA 2WS92 1LULA 5K7PA 2WZR3 2EXJA 1IS6A 4JHTA 4QXKA 4BK4A 3S7IA 5FWEA 2LM3A 1V00A 3WNKA 4C91A 3RNSA 5T5PA 1BQPA 1PVC1 2Y6GA 1N3OA 2VD7A 3ZSKA 5KHHA 2DVFA 1BBT2 4YZ3A 3N9QA 3Q9OA 4YGEA 4XF0A 3CMGA 4YVSB 5LK5A 4NPLA 3ZVXA 3ME2A 1FPN1 3SISA 1AX0A 1LEMA 2QE3A 2Z79A 3GCXA 4XF3A 1N1TA 1XNDA 2DVBA 1S55A 3MO4A 2IFRA 1J59A 5JPNB 4UW3A 4AVTA 4Z1VA 4QHZA 5IVJA 5J36A 3PIJA 1H8VA 3VD3A 3N3HA 4YARA 1H30A 3RZZA 4BZ4A 1RC6A 1MQTB 5D2AA 4ITCA 4XFFA 4ZZ8A 4AI3A 1JZ2A 3I2OA 3ZMNA 1OUXA 4MHRA 2TUNA 5FPUA 2UY8A 1SFYA 3VBHB 2RDSA 4DB5A 5E1RA 5FTTC 3ZIXA 4LBKA 3ZFGB 2ADDA 2BRTA 4KH9A 3OGVA 1W6NB 5C7GA 1W6NA 2VNOA 3AKPA 4PI2A 4RFT0 2L9LA 5DUUA 4MV2A 5DZEA 3ZSMA 3N35A 2WO2A 3AP9A 3UJOA 4Q4Y2 1HB1A 1T6BX 5H9QA 1F9KA 1VBA1 2BYVE 3POBA 1GQGA 4E4ZA 1W6OB 3RGBA 2DYCA 4IGPA 1WW7A 2VZRA 2P3IA 4BK5A 4HXCA 2HWF2 4XXPA 1UPIA 5A6ZA 2J1AA 3ILFA 3MIEA 4QQLA 4JTOA 3WG3A 4FAHA 2AYHA 1OKQA 3VBHC 2C9KA 5HV0A 5IWFA 2Y26A 4UXAA 3HD8B 3N36A 4MZUA 3PDQA 2R063 1STMA 3NKTA 4RQPB 3M7AA 2GSYA 4RQPA 1EV12 3VLBB 4GD4A 5LEJA 4GALA 2TBVA 2HEYF 3DV8A 1A3KA 4MGZE 5JSOA 1OLRA 3GXUA 3O1OA 3GZEA 5J3UA 4RA0A 1BK1A 3MUY1 1COV3 2WLPA 3PUIA 2VZUA 4WVMA 4ZPIA 3DXUA 3M3CA 1U5XA 4ARYA 4PT6A 2QQNA 4F3JA 2JIGA 5IATA 3WT3A 1M06G 1JYIA 3SCFA 5A1AA 5K0UB 5K0UA 1W0OA 3FJSA 2YY1A 3ZM8A 3UNPA 4GMP3 2HH9A 3MV01 4JC1A 5T5OA 5KC6A 5C3QA 4FPYA 3HQXA 1KGYA 4GJZA 1RUD3 1W9FA 3ALQA 1S2EA 3SMHA 4QGLA 4JGYA 5LBCA 4NHYA 3G6JB 1D4M1 3LB9A 4JV4A 3WDYA 2NN8A 3ZXKA 4RQPC 3KCCA 5C9AA 4DFSA 3K3NA 4Q5OA 2Y34A 1DGRN 2VGDA 4OLLA 4AEKA 5FZ6A 4BB3A 4CP0A 3GF6A 3K75B 3FLTA 5A70A 5DG1A 1AVBA 2IUWA 3PNAA 4KWUA 1HN1A 3MW3A 3BTXA 4YSFA 2ZS6B 1UZZA 3ELNA 2RR13 2VQAA 3VD7A 1HRV2 2IXHA 1AR82 1EUUA 3ACFA 2ZKLA 3WLUA 2Y60A 1UOJA 3RI9A 4KBZA 5K0UC 4XC9A 5IVFA 4IETA 2VW2A 1GLHA 1QNWA 2IVJA 1ZRDA 3TEWA 2XOMA 3OCPA 3MW2A 4JVAA 1TME2 3HOBA 1CZVA 1WKYA 4JGYC 3WDUA 4EN0A 3BKZA 4UFIA 5EV7A 1DQ5A 3N7KA 4UI9L 5FYTA 1JYVA 5C9AC 3ABZA 2LTNA 3OSDA 4LBQB 4LBQA 4DUXA 1QIQA 3I3BA 5JCTA 3IB3A 4OI0A 3ZR5A 1LCLA 2W39A 3POGA 2J42A 4Z82A 4DY5A 1XNCA 3FBMA 1GOGA 2WJSA 1CD3G 4Q8KA 4FTBA 4FXGB 5H9RA 4IERA 4HKLA 2ARXA 1Z7S2 4CCJA 1KS5A 4LO4B 4PLNA 1CJDA 3ZXAC 2A3YA 2I45A 2VTXA 4YW7A 2DUOA 1XC6A 4QX3A 4NN0A 1QQP2 2Y6KA 2JB4A 3NNFA 3OJBA 3WR0A 2WNOA 2ZAAA 4CXXA 2ARAA 1N3PA 4MOAA 4O65A 3AFKA 4JKMA 1ALYA 1LOEA 2YU2A 3BVCA 5DDJ2 1ZA7A 3VKOA 2R7EB 3I3DA 4FP3A 2F4LA 3RWNA 1EY2A 4C90A 3NV3A 1KRIA 1RUG2 2FD8A 4EYUA 3JBG3 3AX4A 5GLWA 3LKJA 1V6LA 2MPFA 4P9GA 2ZHNA 4IEPA 4Q27A 3ILNA 2PHXA 1JS9A 3UK9A 5HCFA 2PHRA 3F95A 4LE4A 2R072 2ADEA 1UCXA 1ZBA2 5IVVA 2BJSA 3I97A 5C3SA 4YG6A 3TN93 5CISA 3AB0A 4RHV3 4IEUA 1H6XA 1NUKA 3C7GA 4DRRA 1C3HA 1NT0A 4X8NA 2KA3A 3DF0A 3QOPA 1WBLA 3D82A 5IK8A 1DDLA 2JDMA 4NR1A 1PX3A 1XNKA 2E31A 2H0BA 4CCDA 1X36A 4IGOA 2X10A 3DKQA 3DN7A 3S5QA 1SFNA 1SDDB 3CNAA 4ZXEA 5I0UA 1QOTA 3KLSA 2DF7A 1SMVA 2VUDA 4NVPA 5EFUA 4DEQA 2FDJA 3MIHA 1RUF2 5FZGA 2VL4A 4XHXA 5DDJ3 5CYYA 2P3KA 4P02B 1DQ4A 2Y6FA 4UOJA 1AF9A 5FYBA 3LA3A 4ASMB 1RUC2 4XE9A 1H9WA 3EBRA 1JUHA 3VBOB 3KVBA 1UYZA 3AM2A 4XZPA 3SCGA 5FY8A 3VBOA 3WQ1A 3FL7A 5DAVA 1I5PA 3ATGA 4QXCA 1NKGA 4HLTA 3A23A 5LY1A 1W6PB 5KXBA 1AYM2 1W6PA 3D4KA 4AEDA 3I2DA 2Z42A 5FZEA 5LRSA 2R073 5JOXA 5JZGB 5JZGA 1DYPA 1F15A 1YFYA 2DURA 3SXWA 1NA1B 1IPKA 1C8M3 1DF0A 1NA1A 2YC4A 1WCSA 3FBYA 3FUQA 3WVJA 1BBT1 3NW4A 3DUIA 1QJY3 3H8UA 4XJZA 3H8XA 1LB2A 5DQ0A 1YXWA 2VZOA 5BNPB 4IDZA 5J1XA 4NRMA 3B7MA 1CAUB 3ZPYA 4XZUG 1CAUA 4DRVA 1RUE2 4INDA 4YZ5A 5F3CA 5J7MA 3USUB 5I93A 4LPLA 3USUA 4GH4B 4Y1XA 5DUXA 1WW6A 1C4RA 4KMQA 1GNZA 3VBOC 4CXYA 3ZKYA 1KD7A 3PVEA 5ABJB 2QTWB 1OH3A 5ABJA 4IEZA 4MO3M 4RGAA 2VOKA 3B94A 3WW3A 2R32A 3MIGA 1HXS2 1UN1A 1UQXA 4AEDC 5GZCA 5IHRA 5JZGC 1W2AX 2HWB2 1YJKA 2R1DA 3T0AA 1RUC3 1NA1C 1MS9A 4LMFA 5A3WA 4ES9A 3PTYA 3WOGA 2DVDA 2CL2A 4BOWA 5FY4A 1Y9GA 1QNYA 2QQIA 2XVLA 2C4XA 1XB9A 2NZ9A 4NHXA 3U75A 3WHUA 3WW1A 1EAH3 3IT8A 3GCWA 2ORXA 4JGZB 4JGZA 4Q4Y1 4K1ZA 5F32A 5LBEA 1BVP1 1D2QA 4A7KA 1RUD1 4I30A 5SV5A 5FXXA 3VL9A 1NYWA 5EYXA 3UKTA 1HN0A 5EJ1B 3KHCA 4DXSA 3POFA 3KCXA 1CGPA 3BOPA 1L7LA 3N9MA 4K1YA 3ZPOA 1ACCA 4JCKA 1Q56A 5E6HA 5ABJC 2FDGA 1EYBA 2CGOA 2P6HA 2HWF1 4MXWA 4AI0A 2RHPA 2X5IA 4IE7A 1Q3EA 1X9TA 3U11A 1RIRA 3K4AA 4CDQB 5FR3A 4YYOA 2QDRA 1LU2A 2XL9A 3HEIA 4KQ7A 3BGAA 2RR11 4IEXA 2VU9A 3AXDA 3GZAA 4PDWA 2BU9A 1HB2A 2BGPA 1O8SA 1WA6X 3WY6A 4CUBA 1EUTA 1MS5A 4M0HA 2XXZA 2RDRA 1I1EA 3AZVA 2YMZA 4ZY9A 4KG0A 5LA9A 4JGZC 4A7ZA 2FZ2A 3GDBA 1DP0A 1SBFA 4PJYA 3OUIA 1VMHA 4LIUA 5FUNA 4MGSA 5FKBA 1GYKA 1TZOA 1AR62 1RB8G 2VVFA 3PU8A 2VC9A 4AFMA 4E2SA 4JQRA 1F31A 2MEV3 4K20A 4AEJA 4BYYA 1DZTA 4EZHA 1GP6A 1MPXA 2HWD2 4OFGA 1YQ5A 2X5IC 4E2QA 5C4WB 5C4WA 1OH4A 4EWEA 1JOPA 4AGRA 4CDXB 5BPXA 1FX5A 4MG2A 1WLTA 2YC0A 4PDWC 2GAUA 2R0HA 2ZGQA 1VLNA 4NHMA 2P3YA 4Z2AA 1V9U3 2IWGB 4QAWA 4OMDA 3S57A 1Z0HA 1SZBA 5G04L 4WM7A 4C0HA 1H1MA 3O1PA 2BNOA 5A3TA 3VZMA 1H1AA 1GP5A 2NP0A 3AMPA 3FHIB 4MADA 1UZ0A 1VBE3 1YNAA 2C26A 4NWVA 2WUHA 2WWUA 1FV2A 4LXLA 5FZ7A 4CUAA 2FMYA 2W1SA 4L92A 1D4VB 1B35A 2Y6HA 2FCVA 3LEGA 5FFOC 1T2XA 3OF1A 1IS5A 4UBHA 5C4WC 2BNMA 3JBG1 1JOBA 1GNHA 1TME1 2V4AA 4YW6A 4CDXC 5J37A 4DS0A 4D0QA 3JCIA 3VD4A 2WABA 5DAPA 1S0JA 3I3QA 5FYMA 4E2GA 2WO7A 1OKOA 5AC92 1XE7A 2RS52 3KCYA 1HKDA 4WM7C 5F3IA 2ET7A 3RQ0A 3NNJA 1RGSA 4TLFA 4D7TA 1ZZ8A 2BEOA 1G7YA 2ZA9A 3NNGA 4IEWA 4MUVA 4RHV1 2XGXA 3GBWA 4KG8A 1KDKA 2WN2A 5CAZA 2AACA 5H9PA 4QT6A 2FBEA 2YG0A 2GC0A 5LBFA 1Z7S1 5J96B 5CG8A 4QQHA 5F5CA 3UESA 2VZ1A 4Y1VA 5FY9A 1J3QA 2EA7A 3INAA 4NIHA 3ZXFA 4OHXA 5F3EA 2XJTA 4S2FA 2ZX4A 3ZDSA 4UF0B 4XDQA 2XR4A 4GB33 3VBUB 3VBUA 3DPRB 4XAEA 5J98B 3DPRA 2PHDA 3N9OA 2CU5A 2Q8DA 3WNXA 1RJ7A 5DDJ1 2C1FA 1VAMA 4YGBA 3FFQA 1OA2A 5FOJB 1VB2A 5FZKA 3HT1A 3CQOA 4R52A 4UW5A 4DIQA 3QCWA 2Y6LA 3O1MA 4GA9A 1MS1A 1NLRA 5FP4A 4UW6A 1UZYA 4AFBA 1H9PA 3MLLA 5D8AB 1XNBA 4LTAA 5D8AA 5FPVA 1FYUA 4KU7A 4FOYA 2BVBA 3OBAA 5IAVA 1FMD3 4FP2A 3UV9A 3RZKA 1JODA 1JOJA 2R071 1JH5A 4NIAA 4QHBA 1ZBA1 2JD4A 4BQ4A 4RN5A 4F83A 2WLQA 1EPWA 1YWKA 2DV9A 2GNDA 3VBUC 1YUDA 1QJY1 3DPRC 2EAAA 5FZ9A 4CCOA 5F2SA 1OURA 1FOD3 5JR7B 3MZHA 2GC3A 3U1XA 2HWC2 2CWSA 2PHUA 3ROUA 2OPKA 2ZXQA 4LUKA 1FPN3 3DXTA 3QD6A 4AI2A 2JJ6A 4HPKA 1GZWB 2RS12 2A6WA 4JX0A 4PIXA 5JXJA 2VBPA 4NWWA 4NPMA 1WW4A 1BK0A 2DCZA 4FFGA 5D8AC 4Y24A 3I8TA 3T30A 4LK7A 1RUF1 5FZOB 5L9BA 2D6MA 1LGNA 4R9DA 3NJXA 3VZJA 3LGRA 5J09A 2W95A 2HWE2 1TE1B 2WNVB 1YI9A 2WNVA 3ZYHA 1K42A 1ULEA 1ENSA 3M8LA 3ZO0B 1NCRB 1RUC1 4BA6A 1NCRA 2VBBA 3ZYJB 1O8PA 1W0PA 2Q8CA 1YRZA 4OMCA 2JX9A 1LU1A 4QKBA 5DMYA 3D0JA 1WA4A 3EXUA 4HVOA 4K7JA 2E32A 3V56A 1EAH1 5L36A 3QACA 1ZZCA 2F4PA 1TMF2 1W03A 3LDRA 4RFRB 5FPLA 1LNSA 2QCSB 4DUWA 3K3OA 4AVSA 3U10A 4QD2A 1E5HA 5AVAA 3MGUA 3J26N 3VD5A 1QU0A 3OGGA 3HIFA 4G4FA 4M3CF 2OQ6A 4Y3OA 1FXZA 4AVCA 1VBA3 4YVWB 5BNNB 2DU1A 1YQ6A 2YFUA 5FYZA 5IJRA 1F5JA 4DOUA 4XURA 1WCKA 2HBTA 1A8MA 3C7FA 4K40A 1CAVB 3KS7A 3RPQA 2WNVC 5K4LA 1QMJA 1RUE1 2WQZC 4NRQA 2ZEWA 3JQXA 1K12A 1NCRC 4Y20B 4Y20A 5M0TA 5F5AA 4V2WA 2P2KA 1UZWA 1W28A 3CZJA 5H9SA 3SNMA 4CE8A 2A6XA 3ACIA 3P1IA 1AL0G 4LORA 1Y9MA 2ILMA 3KD4A 4F7ZA 1LECA 1KXGA 1P8JA 2HWE3 2WAAA 1OA3A 1ULGA 5CKMA 5FP3A 5FY7A 2DUPA 3SLIA 2GN3A 2HWB1 1ZREA 3MIDA 1QJX2 3PMSA 5C8CB 5L7OA 4XIKA 5C8CA 1O3TA 4JKKA 2VZVA 1OQEA 2FMDA 1U12A 2G9ZA 3POYA 5JXHA 5F5QA 1V6NA 4P5YA 2D43A 1CIYA 1A6CA 4CPBD 3NJYA 1DGWA 3KB5A 2V5DA 3EB7A 2ZGLA 3GJAA 5FO7B 3S6PA 4DPNA 2I07B 3JZVA 3AYCA 2W2IA 4JDOA 1TEIA 2BV4A 1OLME 2W68A 1GZ9A 3SH4A 5CADA 4I02A 4Y22A 2ZX3A 5JXIA 3MYXA 3RZJA 1D4M3 1DIWA 1I9RA 1SLTA 3H1WA 4IV3B 5FZ8A 2VUJA 3NAPB 4IV3A 3NAPA 2LROA 3APBA 3MIBA 5IUQA 1O59A 4XOGA 1AXZA 4UAPA 3FHQA 5L7OC 5C8CC 4W6WA 3EJKA 4YRDA 1E57A 4I01A 3WNMA 1JXNA 2W91A 1VE0A 2VZQA 3KF3A 4X6RB 1BLZA 3N7JA 4ET7A 2W08A 3WXPA 1CR7A 4P9WA 2VVDA 4X8PA 2OVUA 4Y5Z0 3LSDA 2JD9A 4OCTA 4Y5SA 1WMXA 4QX1A 1O4YA 3BPZA 1HX6A 1OSGA 3ES1A 1IOAA 4BLIA 2R30A 1RINA 4WVVA 4HZFA 4BQ5A 1CAWB 1CAWA 4QX5A 3WW2A 3ZKUA 3NNMA 5ACA2 2HWD1 4BM8A 5FYHA 2B4KA 5IAXA 4IV3C 4CCCA 3NAPC 2VCCA 4HSJA 4G9SB 4XACA 4DMIA 1UIJA 4YGCA 3BI3A 1J84A 2DDUA 3ACHA 1QH6A 3ZFFB 3PLQA 3M2MA 3BB6A 2JENA 3NV2A 1YQ2A 4LBLA 1IKQA 2D6NA 2LW8A 4M4PA 2JDKA 2JDHA 1ZBE2 2Q4SA 3LEMA 4IEYA 1O3RA 2BDRA 3WQBA 4DUVA 3LAGA 3VN4A 1F4AA 3LFMA 1GANA 2ZBJA 3URFA 3F2ZA 1OC1A 1L7RA 2JDNA 3CKHA 4AHYA 4GB31 1BMV2 3HQUA 3ZXJA 3B93A 3KT1A 2KXLA 3MLKA 3PJQA 4P00B 3E6CC 1MZ5A 4XCAA 3VBFA 2D3SA 1LHWA 1O91A 3N4MA 4KL1A 4CCEA 1UY0A 1ODMA 4H2AA 5F9TA 1WUVA 3BTZA 3H1YA 5FRAA 3ZFFC 4AR2A 1BJQA 1BCXA 4PBOA 1DQ2A 5IFPA 1CN1A 2GC2A 4CDWA 4OQ9A 1FMD1 2VBDA 5T50A 1X7NA 2GZWA 1UMIA 1C8NA 1YIFA 2UURA 4RYDA 3T2OA 2YV8A 2VMDA 1UXZA 2QFEA 3ZXDA 2WRAA 3IBMA 4URTA 3E6BA 1BHGA 2R6QA 4S2GA 3FC0A 4LEJA 4W6YA 2WYSA 1FOD1 3WHTA 3H50A 3WW4A 4M3CE 3RZGA 1A34A 4R9BA 4URAA 5I91A 3SCHA 1UOBA 1ZBE3 2BWAA 2B45X 1YLLA 2DVAA 3TOJA 4X6QB 2YROA 1DFQA 4IEVA 3POIA 3FMGA 2EIBA 5FZBA 3IPVB 1GWMA 4J1XA 3IPVA 4MGYE 5I0DA 4XMIA 4N7IA 2WYFA 4QB6A 3B9IA 1W8UA 2AREA 3DYMA 1OOPB 2QJVA 1HQNA 1OOPA 4CDWC 3AVRA 3J7MA 2A7AA 2CYFA 3MF9A 1N1YA 5IVEA 4FPFA 3AKRA 1H6YA 1W05A 3UL2A 4AEMA 1I5ZA 1X82A 1CAXB 1K45A 1ZZ7A 1CAXA 3DKWA 3GBFA 4OULA 5C71A 5I0RA 4OYUA 3O0VA 4GULA 1O5LA 2WDBA 3CEWA 4PBPA 4U36A 1ZRRA 1J3RA 2D6KA 2WNUA 4V2VA 5LBBA 4META 1JZ4A 4EWAA 1YI7A 2WS93 3H3LA 1GOHA 1XNAA 5FZCA 3L2YA 5CFDA 3J4UH 3RZHA 5ANNA 1PX4A 1MS8A 1SLCA 4AK3A 1W6QB 1GP4A 1OLQA 1W6QA 3VKNA 3W21A 5FPXA 3CLPA 3B9CA 1YEWA 1OOPC 5JIAA 1BBT3 1WLDA 2J7MA 3C2UA 3CO2A 3P3PA 2HWC1 5C6CA 5GM0A 5KXCA 4XVHA 1YC61 1PIV2 2RVAA 2BOJA 3IDAA 2IXLA 1JYWA 2JDPA 2JG8A 4XUOA 4FOQA 4MX3A 3LE0A 4OUSA 1ONAA 2WNUC 1MZFA 3OOXA 4D6SA 4YG0A 1LOGA 2OUJA 5FMBA 1R1A2 3CZUA 3WF1A 5CKNA 2HWE1 5A7WB 3AL6A 1SLLA 5F2WA 5A7WA 5CG9A 1OLMA 4HG6B 4OZXA 4QDSA 3SH3A 3OY8B 5CFDC 2RMU2 3OY8A 3QH7A 3IIAA 3WZ1A 2I2SA 1W8HA 2VUAA 2QZ3A 4WVMB 1VBC2 4RS5A 5A6XA 2W3JA 1MEC2 4GAZA 4P9YA 4XCBA 4D3WA 2DBIA 4QDQA 2YGLA 1TNFA 2DCKA 2P37A 4UT5A 4EN6B 1H0BA 4FPKA 3I59B 1NY72 4TZDA 2BBVA 3I59A 4XF9A 2DBNA 2RJKA 2A1XA 2G1MA 2YPJA 4GKYA 1NAEA 3ZYGA 3K4ZA 1R092 4I0BA 1WW5A 2JG8C 3V65A 3VBSA 4Q4Y3 2GNBA 3CU7A 1ULPA 4IEOA 1NLSA 1OVPA 4DXZA 2VM9A 3KVAA 2D7FA 4JGYB 2XMLA 1DQ6A 2R1BA 3H9AA 1AYN2 3P6BA 2XKPA 1YFXA 2ET1A 2YB7A 5C9AB 3OB8A 4EV0A 1JW6A 1LKNA 2W1QA 3C3VA 1WMEA 3U07A 4ZONA 2HWF3 4M00A 4LUMA 3CDZB 4DINB 1G9AA 1PZ8A 3POJA 5T55A 2FCUA 1MVQA 2UWCA 4JHZA 1L7QA 3TWIA 1R082 4RS5C 3OEBA 3LDKA 2ZX1A 3HPNA 5CZKA 2NMNA 1H1IA 5FK8A 4IV1B 4CU9A 3LEKA 5JSPA 4IV1A 2XWJB 2BZDA 2P34A 1AR72 1EV13 1OVSA 2VOTA 3J8F2 4YFZA 3TRSB 2WZPP 3VD9A 1NG0A 3VBSC 3LEIA 3FWEA 1QJX1 3ITQA 2KM2A 4LQRA 4RGGA 5FV3A 4DZGA 5GJ6A 3POSA 2CNAA 1LHUA 3NV4A 4RL7A 1MEC3 4N7UA 1PK6A 1IGOA 1OXCA 1POQA 1QH7A 3LDBA 1PVXA 1XSQA 3OD4A 4ZU7A 1GWKA 3QLQA 2FDKA 1IHMA 3JB8A 1S2BA 4HN0A 2IZWA 2PAKA 1YJLA 3JD72 5C3OA 1KITA 1R1ZA 5DXDA 1RHI2 1W8TA 5LW9A 2Y33A 2WFPA 3RRDA 2JECA 1QKQA 4HT1T 2DFCA 3T1MA 1PM4A 4UYBA 3VV1A 2Z4FA 3WDVA 3PJYA 3PL0A 1XJAA 3VDCA 5CVRA 4OHVA 5FMCA 4CVUA 4IV1C 2WSVA 3QH6A 5IK7A 3C8XA 3AK0A 2Y8KA 1NQDA 1HQLA 5LRRA 3M3QA 4GWIA 1DU3D 3TB0A 4Y26A 5D21A 4P9LA 5FCCA 4B8EA 1PGSA 3ETPA 1CWPA 2BPA2 1W8ZA 5I0TA 4P9IA 1R083 4YW2A 2Y0IA 1HRV3 1AR83 1WWYA 1CJPA 4BE3A 1S0FA 4QKDA 4BHPA 4C0BA 2OA2A 1AR73 1YFWA 2WT0A 2CWMA 4B4QA 4SBVA 3ZYPA 4M3CA 2YPDA 2O0OA 1QXPA 2ARCA 1H8TB 2HKXA 4E8CA 1H8TA 2UU8A 3NQHA 4JZRA 2ETEA 4A6SA 1RXGA 1WCDJ 3BODA 4CEYA 1TME3 2A6VA 1RL3A 3ZIWA 2ZGRA 5ACA1 3LA7A 4KGQA 5FUIA 3SEEA 5FO8B 4QPIA 4COUA 2B9VA 1OD5A 2RM22 1XE0A 4LLOA 4QXHA 4QB1A 2XQXA 3LFIA 1PHMA 3WCSA 4NPRA 1NZIA 4QX2A 5EPAA 3WCRA 2OPWA 1ZBE1 2OT7A 1QJU2 1E5SA 4TYSA 3RI8A 2NLRA 3HWJA 2GP3A 4MLOA 1Z7S3 2GNTA 3IMMA 2N7GA 3WG1A 3K4DA 3KT4A 2VY0A 4JDNA 5IT6A 3A21A 1RUH2 2D6PA 4CZSA 1BMV1 1V6KA 3U78A 1H8TC 5JDBA 4CEYC 3THPA 5JOZA 1QQP3 3O1UA 1OMIA 4OUEA 4UFKA 4QM8A 4W50A 5DZFA 4AHWA 2OXBA 2YU1A 1OUSA 3N9NA 5FLJA 2NMOA 4AQTA 3RZLA 2CSGA 2QNKA 3TAYA 4LBOA 5LZ6A 2DUQA 3BIEA 2CGPA 4HMZA 1XOYA 3ES4A 2NQYA 2XL7A 3AC0A 5A32B 2J1SA 5A32A 4HETA 1RUG3
chains in the Genus database with same CATH topology
2WINB 1UPSA 1VJ2A 2E7TA 3LOBA 1O7FA 2WS91 2GU9A 4RR3B 1UU4A 3WP3A 4RR3A 4WVZA 2B39A 2VPVA 5JAXA 2RM23 3O14A 4AEDB 4XBLA 5A3LA 2CAVA 2EAKA 4XJWA 1ZBA3 2XVKA 3NL1A 1LOAA 3R4UA 4QU2A 4LULA 1UKGA 1IPJA 3D6EA 1S2KA 5HBAA 4CYDA 5KHKA 2G9FA 2CY6A 1G9FA 4QQ2A 3RS6A 5CIRA 1GZCA 1I3HA 5AFEA 5B2GB 2A75A 2CV6A 1GBGA 2WL1A 3B5LB 4OHWA 4RR3C 2XPJA 1RUF3 4Z92B 2XVGA 3T1LA 1BEV2 4XTPA 1MZEA 4XEZA 5GLVA 4ZXKA 4HK9A 3RDIA 4I3PA 4P9XA 4CEWA 5JVVA 1AYM3 5BY5A 1N3QA 1DG6A 1NXMA 2ZX0A 2ZZJA 4IQPA 3WQ7A 5I8TA 3QBQA 4Q8LA 3ZSLA 2Y0OA 3FE5A 1GSLA 3HN1A 4GQ7A 2WSUA 1GV9A 3H7JA 5KXEA 2OW4A 4Q0VA 4I3GA 3TYJA 4MXWB 1JHNA 2WC2A 2X5IB 4HKWA 4LO7A 2ZGKA 4FTSA 5EJ3A 3POWA 1RUE3 1UL9A 2JEMA 4MVTA 4PDWB 4Q0SA 2WFF2 5LEKA 1NQJA 1R1A1 5T54A 5GZDA 1EV11 1DZRA 4YLZA 2PHFA 3UJQA 1NOVA 4CEWC 1HRI2 2RMU1 1HXS3 2D6LX 4I09A 1BEV3 1HQWA 2HWB3 2Y38A 4LBMA 5I8SA 1MEC1 1O3SA 5DUVA 1VBB2 1NY71 1VIWB 4PLOA 4E4SA 1RUNA 4NHKA 3LSEA 1YHFA 4I0AA 1U5IA 3IWZA 4Y1ZA 5FMOS 4K6BA 3MFAA 5DG2A 2VQ0A 4COWA 2ZMLA 2ZZQA 1D2SA 4WM7B 2WT2A 4N53A 4D7SA 4FPGA 2JE7A 1QXRA 1NCQA 3ACLA 3GNEA 1OA4A 1R081 2D5HA 4F8AA 1HRV1 1AR81 1GR3A 4YW1A 2E7QA 3RYRA 5HCAA 1OFSA 1MR5A 2DCTA 2WFF3 3KT7A 4YM2A 3LOIA 4D69A 1B35B 1AR71 3JB4C 3RJ2X 5A3MA 1L3JA 3FX3A 4R4XA 1G9AA 1WLWA 2CGNA 1WLCA 3WDXA 1AR63 1XYNA 3NVCA 3ZN4A 2FHRA 1IS3A 4ATEA 3JUUA 5CBLA 2V09A 4H7LA 4Z07A 2HWD3 3JD71 4N53C 4S2DA 5CFCB 4EN8B 5CFCA 2PHTA 1AXKA 4XBNA 5FO9B 2PN5A 2D40A 4XETA 2A6ZA 3FLRA 5FDBA 3I54A 3K51A 1B35C 1SLIA 2YDEA 2QUOA 4BPZA 1QQP1 2E6VA 3GHMA 1OPMA 1XQNA 3VKLA 1AX2A 3WINE 1V6JA 4J1WA 1F5FA 3IM0A 4FVVA 4Y1UA 2VOVA 4XQWA 4COVA 1PVC2 4MXVA 4L97A 5CFCC 1FAYA 1RUG1 1LESA 1V6OA 1VP6A 4LHNA 5E89A 2C9AA 4Q26A 3OBRA 4MSVA 4Q1RA 3KGZA 2D3RA 4LT5A 1D0GA 1Q5OA 3B01A 4ATFA 1RVF2 1DQ1A 3BCWA 2RM21 1POV3 1RUJ2 4OI1A 5AC93 2RS53 4AI8A 4DY3A 1PGW2 1CPNA 1A8DA 1REDA 1H2NA 4FQ4A 4Y4YA 3R6SA 1ASJ2 3RG0A 4XXAA 5JIUA 2IFWA 1QWRA 1QJU1 4PCRA 4W6XA 3GHNA 4XF1A 1J3PA 2JG9A 3NJZA 5GALA 2E63A 4QQOA 2P3JA 1CPMA 1O4ZA 3IKWA 3NO8A 3IN9A 2GC1A 2ZGSA 2XJQA 4HPKB 1VAVA 4FOVA 4W65A 2B7YA 5AFBA 1BKZA 2VW1A 3ASIA 4QGNA 4R9CA 3D8CA 3AKTA 3TNQA 3ZN6A 1OI6A 3MW4A 1WD3A 4Z2WA 4XF4A 4EN9B 1JN2P 4E4DX 1ULCA 3WP6A 3AZWA 2RS32 3WQ0A 1G9BA 2Z5WA 3VZNA 1SCRA 3AP7A 2F6BA 1DGRA 2JG9C 3KMHA 2YXSA 5GZFA 1LOFA 4J6GA 1AYM1 4CP1A 4XFCA 1AHSA 3N7LA 4PIZA 4LO6B 2E7AA 1ENXA 3ST7A 1MVEA 3EO6A 1ASJ3 5AVPA 2B8MA 1VBD2 2D93A 1VR3A 2D97A 2HWC3 2NM1A 3DL3A 2GDFA 4JRAA 4ASLA 2DTYA 3BU7A 4L8QA 5LK7B 4Z8BA 1KFXL 1MS4A 5SV8A 2ZGTA 2RS13 3A4UA 4GIQA 3VZLA 2X29A 4C1WA 2FZ1A 1LGCA 1QDOA 1G9CA 2ZJCA 1ZZBA 1LOFC 3BIWE 1KFUL 3M3IA 1HXS1 2HEWF 2HEVF 4C1XA 4YFWA 1BEV1 1SLAA 1FNZA 5L7OB 2RS33 3VZKA 4Q1PA 1V6MA 2VMGA 4B7EA 1MZ6A 1UMZA 1PM7A 4QQPA 1J1LA 4ZU5A 1SBEA 1C1FA 1FATA 3U4XA 1TMF3 4B4PA 4XFAA 3ETQA 3R0RA 3VGIA 2VMIA 3ZSEA 2H6CA 2W52A 3BTAA 4ISRA 3RYPA 2OZ6A 1OPOA 4BMEA 4Y22B 1VBD3 4XYXA 4BIFA 3O0WA 5K9YA 2TEPA 2V73A 4M0NA 2P17A 1UAIA 2O1QA 1AR92 2D3PA 2I74A 1QOSA 2PHWA 2VMHA 4YZ2A 2WFF1 4UBGA 2EXIA 2ZGPA 4QM9A 1KJLA 4Y1YA 3VZOA 4JTNA 3T2TA 3J9SA 4AG4A 3AYDA 3AMQA 2XJRA 1AR61 3ZXGA 1QJX3 2PQQA 5HI0A 5GLZA 2ZGOA 4G3YC 4Q29A 4LO5B 3B3QE 5L73A 2JKBA 1RMU2 1GQHA 1IKPA 4P5HA 2AR6A 4L2NA 1Y9QA 1WBFA 4WM8B 5JSRA 4WM8A 2BW8A 3WUCA 2DFBA 3O7OA 1C1LA 4AXOA 4XFGA 1TQ5A 1UKRA 5BXXA 4M01A 1W2UA 4K9SA 4KBBA 1AL22 3W58A 2WKKA 2OUHA 3LZZA 4FQZA 1SLBA 1AR93 4XMAA 3I7DA 2WZR2 1G9DA 3ZYIB 3O12A 2DVGA 3I4IA 2NPIA 2YYOA 3KGLA 4ES8A 4FPLA 1URXA 3VBFB 1LHNA 2VW0A 1UW8A 2ZMNA 3H3UA 5FQ0A 4PF5A 5JOWA 2Q1MA 1NZCA 3OYWA 3KZ4C 3WG2A 4WM8C 3AP5A 1OQDA 4I0WB 1WMFA 1EPZA 4CDWB 1YYNA 1PGL2 1F8VA 5ACA3 1POV1 5AC91 1SACA 1S0BA 2Q30A 2RS51 1K5MA 3KQRA 4FSJA 5EYYA 1RMU3 2A3WA 4YW4A 1KQRA 1LGBA 2IXCA 2EALA 5BNOB 5BNOA 1QY4A 4XQDA 4IEQA 4FPOB 2XJPA 4N43B 4N43A 3VBFC 3B69A 3TNPB 1AL23 3E97A 4A3XA 4BLJA 4AGGA 4QGMA 2Q1ZB 1M4WA 4YGDA 4NHLA 2JDZA 4IL7A 3AKSA 2WQ4A 2YZ4A 1OHFA 2ZABA 4A7YA 3AFGA 4EWDA 4BWOA 2EF6A 3VDDB 3VDDA 1K5MC 1LOBA 1POV0 3AZZA 3H1MA 4HL0A 3WUDA 1XU2A 4YZ4A 4FTEA 2XLGA 2ZMKA 3WDWA 1Q8SA 1S0EA 4GWNA 5E88A 4BCUA 5BNOC 1G8WA 2XJUA 2WNUB 4YVSA 3MPBA 2AZ5A 5KWRA 4LE3A 4FCAA 4Q0UA 2ATFA 4RD7A 1RVF1 4N43C 1RUJ1 2ENRA 2VOWA 1XE8A 1PGW1 2R062 2QVSB 5CFDB 4JRLA 2GNMA 4H7MA 4EJRA 1ASJ1 2ES3A 2UYAA 1KDMA 2X53S 1DLLA 3RJRA 1MQTA 2FQPA 3E5XA 3WDTA 4EN7B 1COV2 3VDDC 4KGGA 2YGMA 4ORFA 3VBHA 2JG8B 3ZFGA 5KHJA 1QGLA 2RS11 2Z2SB 5A33B 3P3NA 5A33A 1G6NA 4YVSC 3ZXLA 5IK4A 4K8FA 4H14A 3ENRA 4CDUB 3IMNA 2LUWA 4CDUA 1RUD2 1NE4A 5GLUA 1W6OA 3IDCB 2E9QA 2RS31 3LA2A 2PTMA 4RS5B 1N47A 4V1PA 1MQTC 1FV3A 4AW7A 2BVVA 1IZ3A 2B42B 2JXAA 5BV6A 4N9HA 1TMF1 1A78A 2RR12 5FLIA 1JBCA 1X33A 4LLFA 3VBSB 3ZFGC 1ZYBA 3NSTA 3V0BB 3V0BA 2BWCA 3VKMA 1VBD1 4PQ9A 1J1TA 2BTVC 2C5DA 3GZTB 4R4ZA 2B9UA 4GXLA 3GYDA 2Q8OA 1FI2A 1LJ7A 4CDUC 4L99A 1CQ9A 1PIV3 3BOWA 1AXYA 1JUIA 1ND3B 5J48A 1ND3A 2GN7A 4NOTA 2YUEA 4LBJA 2IC1A 2XBO2 1MS0A 3A0KA 3R4DB 1R1A3 2QQPA 3VHOA 1VALA 2ZACA 2GMMA 2XKOA 5E8AA 2ZGMA 1G86A 3VUOA 2RMU3 2R042 3NKGA 2WT1A 2G4IA 1C57A 5DZGA 1VBC3 2MNGA 1LR5A 2G9GA 1ULFA 5BYNA 1PK6B 4A2UA 1V6IA 2SLIA 4FOWA 5I0SA 3VKFC 3N7MA 1VB4A 3SITA 3FLPA 1R093 2A6YA 2ZTNA 1ND3C 2BGCA 3FFZA 2GH2A 3S7EA 1ZVFA 3AP4A 3PMEA 4COYA 3K48A 4XW3A 2QZ2A 2ZX2A 2AGSA 3WX5A 5CA6A 2VECA 1AYN3 1RUI2 1LHOA 3JBG2 1BYHA 3GALA 2VVEA 1VRH2 2YHJA 3PVOA 1AR91 2VG9A 4XBQA 3M4FA 3ZFEB 3ZFEA 5T52A 3ZXEA 5FBZA 1DGLA 1HDKA 1PK6C 1LOCA 3RMXA 2XBO3 2ERFA 2A73B 2WA3A 3TN92 3J8F3 4RHV2 2EXHA 4M3CB 4HANA 1F2NA 2O8OA 3V64A 4CEYB 1ND2B 2R043 1DHKB 1ND2A 4YG3A 2X8KA 4DNYA 1HV0A 4QPIB 3D5OA 1RMU1 3R05A 1U0AA 2K2SA 3B00A 4HFSA 4FAGA 3JD73 2A5ZA 4L9BA 1LRHA 1N1SA 4Q4X2 2PA7A 3UV9A 1RHI3 1X50A 1SQ4A 4Q4V2 4U2AA 2D5FA 4AQ2A 5FREA 4LR4A 1QF3A 3ZFEC 2EVXA 5CB7A 4BH9A 1W39A 3AMHA 2C0ZA 4JAAA 4KWLA 2AENA 2LALA 1RUI3 1AL21 1HIXA 1AX1A 3U0ZA 1VRH3 3JQWA 1Y3TA 4YW5A 3D0SA 2WZR1 1T6GC 4MYEA 4MGIE 1ND2C 1C5IA 2R16A 1ZNPA 4QPIC 3FZ3A 1H2LA 1C8M2 4K3UA 1C28A 4K21A 2PELA 1UU5A 1WD4A 4E27A 3MDPA 5K8SA 1QJY2 4HSLA 1S0GA 5T5JA 5I8YA 1PGL1 4GKXA 4KU8A 2HYKA 1H2KA 4P14A 2DCYA 1ZZ6A 2TNFA 1Q43A 3OPZA 4KWKA 4QMAA 4LA2A 3LCPA 3WP5A 4CTEA 1GFF2 3CJXA 1KJRA 4Q4X3 1O5UA 3AZYA 1SDWA 2AH2A 3KM5A 4Q4V3 4ISQA 3HBZA 1IS4A 3R4SA 1CIWA 1QJU3 3A0NA 5KHGA 1O3QA 5JI7A 3E5UA 4OHZA 4B4RA 3ZX7A 3AYAA 1S0DA 3USSA 2VOXA 1RUH3 5T5LA 1EAH2 2VNRA 1XYOA 1I6XA 4YNIA 4MH0E 3IDEA 1RUOA 2IXIA 2RE9A 3CJIB 4ONUA 4Q2FA 3CJIA 1WMDA 2GMEA 1ENRA 4AQ6A 1XYPA 4LBQD 4LHKA 3VBRB 3VBRA 1DGWX 3ECQA 5BNPA 3MPPG 1QDCA 3OTFA 2GH8A 1HLCA 2OYZA 4CEWB 2H0VA 2R061 3AXEA 4GH4A 2O8QA 3GBGA 4KWJA 2ZPXA 1WGPA 1LODA 2A3XA 4D7YA 1SCSA 3MEPA 1AJOA 3CJIC 1COV1 2XUMA 1PIV1 2WWSA 4AFCA 1CX4A 2DTWA 4OHYA 5F6LB 2MEV2 3VBRC 4AHXA 3ZYRA 5BNPC 4GWMA 4GMP1 4AVAA 4YM3A 1APNA 3WG4A 4GH4C 2QKDA 3S0MA 5T3NA 3M3OA 1V9U2 1ENQA 1PO12 1VBC1 3AZXA 2D6OX 2XG3A 1RJ8A 4I2OA 3ILRA 1H4HA 1CVNA 3RYKA 2RJLA 4CDQA 2XJVA 4FPEA 4ZU4A 2QDNA 3MLJA 5FLHA 1VBE2 1AZDA 4LHLA 3GZUC 3SISA 1R091 4Q0PA 4XIOA 2A70A 4FXKB 1JTZX 1X8MA 4GMP0 1AYN1 2Q0AA 1DBNA 2CAUA 2MHFA 4R9AA 5KHIA 1MACA 4N53B 2BUKA 3EHKA 1NCQB 4CP2A 2ZGUA 1N1VA 4O9GA 4XILA 2PFWA 5FMOL 1BXHA 4LA3A 2XBO1 2WA4A 3PVBB 4CDQC 2UWAA 3RSJA 4B7KA 1NXD1 3J8F1 3M3EA 2D98A 4NO4A 4CDXA 3H0OA 3ZMOA 4AQSA 3AMMA 1HRI3 2V5YA 2E51A 2SBAA 2R041 2VH9A 1PO13 1MS3A 4P9JA 2UYBA 4OVEA 4XFHA 4FT8A 5JI9A 5IK5A 3NWKA 1VBB3 3OBTA 3AJZA 4AYUA 4YM0A 4GB32 4B3NA 3TBDA 1UD1A 4FBFA 2PLV2 1RHI1 2Q5TA 1NCQC 2VXRA 5JPMB 1ULDA 3O0XA 5FPZA 3HR9A 1REEA 4QPYA 4XPVA 3NV1A 1RUI1 4WVWA 3MF6A 1QXJA 4XTMA 4Q4W2 1VRH1 2OZJA 1W6MB 4Q0QA 5DUWA 1W6MA 4AHZA 1RTVA 1JYCA 4LO8A 2GALA 1PO22 4HKOA 1YIPA 1FMD2 1DQ0A 2IXKA 2XLAA 3OD0A 3CL1A 4AE2A 1U5YA 1GKBA