2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
b'VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
3HR9A 4GXLA 1QOOA 1MR5A 2JD4A 4M01A 3SNMA 1LGCA 1G9FA 5T55A 2D43A 1Q8OA 4FOWA 1SLAA 5HCBA 3WDYA 5DUXA 3VKOA 1R1ZA 2B7YA 3A4UA 1WW5A 4XBQA 1SBEA 3IKWA 3O0XA 1G9CA 2P3IA 3LCPA 4FPJA 4BMEA 2E7QA 4C1XA 4YGBA 5KXDA 3I4IA 1S0IA 1S0EA 2WJSA 3FUOA 3ZVXA 1GBGA 1GANA 2ZGQA 4PCRA 5CNAA 1MS9A 2ES3A 3RG0A 3RRDA 2D6NA 4LBNA 3SH5A 2CNAA 1AX1A 1AX2A 1KDMA 1DBNA 4P9YA 5GJ6A 4FOYA 5LK5A 5CA6A 4LBQB 2A75A 3WUDA 2GALA 4ZXKA 2RHPA 2GNTA 3B9CA 1BKZA 2FMDA 2SBAA 1QKQA 3PVOA 1N1YA 2CYFA 2JDZA 2WQZC 1LHNA 4Y1VA 5T5OA 4I30A 5T5LA 1AXKA 1I3HA 1ZM1A 1JOJA 1W6NA 4XJ8A 1W6MA 3WVJA 4L8QA 3AJZA 3FUQA 4FPEA 1MS4A 1UMZA 3VV1A 4AGGA 2A3WA 2CWMA 2VY0A 2R16A 3ENRA 3PVNA 1HQWA 5H9QA 4BM8A 1CIWA 2A6XA 4R9AA 1UPSA 3AX4A 1H30A 4Q8KA 1LEDA 4XXAA 3UK9A 5EYXA 3N7MA 2A6WA 5FREA 3AZZA 2W39A 1Q8PA 3USUA 1SLTA 4JC1A 4AGRA 3OPZA 1W6MB 4XZPA 1YYNA 3FBYA 1DGLA 4K1ZA 1SLLA 1BZWA 4Y1YA 5DXDA 3V64A 2VW0A 3ATGA 1G8WA 1QOSA 1DYPA 3ILNA 1LEMA 1FYUA 4FVVA 4UW3A 4YLZA 1SBDA 2EXIA 3USUB 2SLIA 3PVEA 1JN2P 1N1TA 1DQ6A 4XTMA 5IT6A 4KBBA 1G9BA 5GLTA 1SFYA 2WSUA 2DVAA 2ZGPA 2ZGNA 3AP4A 1C57A 5GZDA 2PELA 1LOAA 1S0CA 2Q5TA 3M1HA 4FPGA 1WUVA 2DUPA 2JE9A 2EXKA 1QOTA 1A8DA 3MW4A 3UJOA 4M3CB 3M3EA 2G4IA 3RSJA 3WUCA 3AK0A 3FLTA 3VUOA 1LHOA 5F5QA 2D44A 2WT0A 1JYCA 3R4UA 2H0BA 2OUHA 1FATA 4YZ2A 4YG3A 5IUQA 1QF3A 3O12A 1G9AA 3IMNA 4Q27A 1JUIA 2ZGLA 4WVVA 4YFZA 1FNYA 1MS0A 3V0AB 2A3YA 2ZMKA 1KITA 4LBLA 1C1FA 1AX0A 1JXNA 1F5FA 5JOZA 1CQ9A 3AP6A 4GALA 1DQ1A 3UL2A 3WV6A 2R49A 3OY8B 1SBFA 1W6QA 2KM2A 4XBLA 2DUQA 2EAKA 1AF9A 3NV4A 3FFZA 2VW1A 1XQNA 3HN1A 4P9XA 1UN1A 2YZ4A 4RA0A 2D3RA 1UL9A 3RQ0A 3ZSKA 4ASMB 3BODA 5IK8A 2EALA 2PHUA 2PHTA 2VH9A 2ZHLA 2ZMNA 3MPPG 2YV8A 4DRRA 2ZGSA 3JU9A 4HANA 4CRQA 1PZ8A 3U4XA 4Y1ZA 5GZEA 1DQ2A 1QDOA 1W6QB 3OYWA 3RS6A 2VXRA 4TYSA 4Q2FA 1LOFA 3SITA 3H0OA 5DUUA 3ZYPA 4C1WA 3W59A 2ZZJA 5CB7A 1WW4A 1H9WA 1NXD1 1V6KA 3AXDA 2GNDA 4WV8A 2ZGTA 2ZABA 4ISQA 1QGLA 3D4KA 3M2MA 2BQPA 3MW2A 2P34A 3AYDA 3N7KA 1VLNA 4NOTA 3ZYRA 1RIRA 4YM0A 2DVDA 1LGBA 4FOVA 4FQ4A 3FLPA 2VW2A 4DFSA 1AJKA 5CBLA 5T52A 4GKYA 2WSVA 1QMJA 5GLVA 1BXHA 2Z42A 4FP2A 1ONAA 3B69A 1KJLA 4Y22A 4YW2A 5EWSA 4BLIA 2JJ6A 4XJ9A 2ZMLA 4MYEA 5BYNA 3V0BA 4HL0A 2EXJA 4FQZA 3IM0A 4XIKA 4WZFA 3AZVA 5IK4A 2E53A 4SLIA 3WHTA 1V6IA 2E51A 3BOPA 4AVVA 4F83A 4PQ9A 2DTYA 3N7LA 4Y22B 1W6PA 1APNA 3WNXA 2PHFA 3R4SA 2ZGRA 2P37A 1CVNA 3V0BB 1UX6A 1VALA 2FHRA 3ASIA 3N7JA 4YGDA 1FV3A 2ZGMA 2E6VA 2EXHA 4XMIA 5AVAA 2YXSA 4GA9A 3WHUA 3SH3A 5JOYA 2UWAA 1FV2A 2ZBJA 1HDKA 2D6KA 2PHRA 1GZ9A 3ZXLA 4BPZA 3D5OA 3OBRA 4XYXA 3WZ1A 4AVTA 4YW4A 2WKKA 3A0NA 3SISA 3AZWA 1ULFA 3NV1A 4R9BA 1RITA 2UURA 4YW1A 1IS3A 1C1LA 2A3XA 4FPHA 4LBKA 5JOXA 1KJRA 1TEIA 3T1LA 1W6NB 5GLZA 1A3KA 1OFSA 2WLQA 1Y7BA 1KRIA 3O5SA 3LSDA 1MS1A 3OJBA 3W58A 4TZDA 4XHXA 3QCWA 1CR7A 2V5YA 2WT2A 1PZ7A 3IPVA 4FP3A 4LBMA 4PBOA 3AYEA 4Q26A 1UZZA 2ZAAA 5GLUA 3ZPYA 3BIWE 4BMBA 2DVBA 1YXWA 2AH2A 1ENRA 1G9DA 1O4ZA 2GDFA 1N1VA 3M3CA 4UW4A 2DURA 2D6LX 4M3CF 5HCFA 5KXBA 4XJAA 1RINA 2P2KA 1ULEA 5JVVA 2W52A 5F9TA 1JYIA 4WVWA 1V6LA 2DVGA 3AFKA 1WD4A 4XHBA 5T50A 1LOBA 3V65A 1A78A 5DZEA 2AGSA 4LBQD 1Q8VA 4YG0A 1S0JA 3WDUA 3APBA 2ZHMA 4FPOB 1KQRA 4ISRA 2R0FA 1CPMA 4BLJA 1LU2A 4GWNA 3ZSMA 1N3PA 3SLIA 4DQAA 4XIOA 3AYCA 4YZ3A 1YI7A 3WOGA 4AGVA 1JW6A 4K1YA 1ENSA 5L73A 1SCRA 4R9DA 4XE9A 2GMPA 3Q9OA 2UU8A 1LHWA 4XMAA 1SLIA 3KQRA 2DV9A 5IK5A 3ZXKA 2XB6C 4YGCA 3AXEA 1DQ0A 1WLCA 2GNMA 3WDTA 3ZXJA 2AYHA 5DZGA 3WDXA 2NMNA 1LU1A 1S0DA 3DUIA 1AJOA 1LOFC 3ZXFA 1J1TA 2ZKNA 3WDWA 3B3QE 3TAYA 1ULCA 2PHXA 4YZ1A 1N3OA 2D6MA 2A5ZA 1IOAA 5GZGA 5KXEA 1Q56A 3AZYA 2DTWA 1YO8A 2VUAA 4YFWA 3N3HA 1N47A 1DLLA 3RMXA 2PHWA 1Q8QA 1IKQA 1AVBA 1BYHA 1WW7A 3LSEA 1CJPA 1V6MA 3TB0A 4ATFA 4YM3A 4ZKTB 3M3QA 5E88A 3QLQA 2EF6A 2NM1A 2LTNA 1GZWA 4IQPA 1QDCA 1LESA 1GICA 2HYKA 2UWBA 1JBCA 3M3OA 2GN7A 4Y20A 4M00A 3WLUA 1HKDA 1V00A 4Q8LA 4XBNA 4AWDA 1IS4A 2ZGUA 3CNAA 3OYWB 3DGTA 4FPKA 5T5JA 2DU0A 1IS5A 2YROA 1V6NA 1ZA4A 4U2AA 4XOGA 1FNZA 1HLCA 1F31A 3O0WA 3PMEA 4UW6A 2JE7A 4JRAA 1VAMA 1GZWB 3IN9A 4FPYA 1CN1A 1LHUA 4K21A 3UJQA 1GV9A 5T54A 1S0BA 4Q1PA 2OVUA 1DQ4A 2OUJA 2ZHKA 5H9PA 3WG2A 2P3KA 1G86A 5IK7A 1D0HA 1HQLA 1MVEA 3NV2A 3T2TA 5CAZA 4DS0A 4U36A 4FPFA 2W68A 4W65A 1ULDA 3AP9A 3I8TA 1LCLA 1MS3A 4FOQA 2AENA 1YRZA 2EIGA 4YZ4A 1WLWA 1G7YA 1LECA 2AR6A 1CPNA 1AXYA 1N3QA 5JMCA 2ARXA 4Q1RA 5GM0A 2NP0A 4UW5A 3A0KA 4YG6A 5EYYA 2ZHNA 5JOWA 1LODA 3POSA 1Z0HA 4LBQA 1GLHA 1MZ6A 2WT1A 3GALA 4FPCA 2NMOA 5KXCA 2DVFA 2CL2A 2DWRA 3POYA 2ARBA 1VAVA 3MW3A 5EXOA 1DZQA 4YW5A 1MACA 2ZA9A 4M3CE 1GKBA 5E8AA 1LOGA 2CY6A 2YY1A 1LHVA 4Y26A 2R1DA 4BOWA 1IKPA 1W6PB 1S0GA 1ULGA 1WLDA 1GYKA 4Y24A 1BJQA 3L2YA 4YW3A 5DUWA 3HMYA 1GNHA 3ZSLA 1LOCA 2LALA 1SCSA 3B01A 2D3PA 5E89A 1S0FA 2GMEA 1Z78A 1CONA 1LOEA 3FLRA 4D69A 2XG3A 3NV3A 4JCKA 2TEPA 3VKFC 1EPWA 1C4RA 1AZDA 3PJQA 1DFQA 4DPNA 1FAYA 4XJWA 5FRAA 4YM2A 2AREA 1DIWA 1UAIA 1WCSA 2NYYA 1VIWB 3SH4A 4FPLA 1W0OA 4CTEA 3OBTA 2R1BA 4OZXA 4DRVA 4R9CA 2OW4A 4AYUA 2CWSA 1CESA 2DUOA 1NLSA 4CZSA 2GMMA 5DUVA 4AVSA 3WCRA 1X50A 5H9SA 2A71A 2NN8A 4P9WA 3IPVB 3GNEA 3BTAA 1JHNA 2R0HA 4LBOA 3ILRA 1SACA 3WDVA 1O4YA 1GNZA 3OGGA 3POWA 3NWKA 3INAA 1SLBA 2YMZA 2W08A 3KM5A 4M3CA 4PF5A 4Z8BA 3AJYA 3B00A 5DG2A 1PZ9A 4PBPA 1WBFA 3N35A 5T5PA 2DYCA 4K20A 4Y1XA 1V6JA 3C2UA 4XJZA 5GALA 2JECA 3ZSJA 1URXA 1N1SA 3R05A 5JLVA 3V0AA 4ITCA 4XTPA 1I1EA 1LENA 1QU0A 4XDQA 2E7TA 2I2SA 3VKLA 2A6ZA 4P14A 1DYKA 1UZYA 2ZGKA 2GNBA 1IS6A 1MS8A 2ZACA 3OY8A 4NO4A 1MS5A 2JKBA 3O0VA 2A70A 1UKGA 5GZCA 5HCAA 2P3JA 1SLCA 1AXZA 1WBLA 3AZXA 5GLWA 3AP5A 5JDBA 5H9RA 3AP7A 2D7FA 1ENQA 1FX5A 2D6OX 3WCSA 3JUUA 5GZFA 4BQ1A 2ENRA 4LBJA 4ATEA 4YM1A 2UWCA 3N36A 4GWMA 3AYAA 1S1AA 1LULA 4GKXA 4RL7A 1MVQA 2NZ9A 3ZXEA 1WD3A 3WG1A 2CTVA 2V73A 1MZ5A 3WG3A 1QNYA 4Y1UA 1H9PA 1BQPA 3T1MA 3ILFA 3VKMA 1D2SA 1GSLA 1WW6A 1F9KA 1W6OA 1YIFA 3D6EA 4H55A 4XXPA 1KDKA 5DG1A 1DHKB 2C9AA 2ERFA 2AUYA 2ZGOA 3MEPA 1GZCA 4XILA 1B09A 4YZ5A 1V6OA 2D6PA 2WNEA 1LGNA 1OQ1A 1LJ7A 4Y20B 3WG4A 5SV8A 5DZFA 2C5DA 1W0PA 2VU9A 2A6YA 1LTEA 4YGEA 1DQ5A 2A7AA 1W6OB 4XJUA 2DU1A 1OKQA 2A6VA 3RMYA 2GN3A 1Q8SA 1U0AA 2D3SA 1QNWA 3VKNA
chains in the Genus database with same CATH superfamily
4GXLA 2JD4A 3RFRA 3SNMA 3CHXA 5LW9A 4EN8B 1JYTA 1G9FA 2C6SA 2XKOA 3J7HA 4AI2A 2A73B 4BYYA 5FOJB 3WDYA 1CX4A 5DUXA 5FZ6A 3H42B 4GH4A 1WW5A 3IKWA 3O0XA 5EJZB 1CAWB 1G9CA 3LCPA 4BQXA 1BHGA 4J1XA 4CCJA 1S0EA 1PO21 3G6JB 1MZEA 4PCRA 4IV1A 3VZKA 2BUKA 2D6NA 4CA9A 2A1XA 1ZRFA 1AX1A 1KDMA 2R042 1DBNA 2Z69A 3NNJA 4A2UA 4FOYA 1IPSA 5DDJ3 3ZIWA 1QQP2 1GUIA 2YDEA 2GALA 2RHPA 4XUOA 5FPZA 1H1MA 1STMA 1TME3 3O7OA 1TQ5A 3ROUA 2XJSA 1QKQA 1YQ6A 5FBZA 5C71A 2CYFA 2OZ6A 2WQZC 2YBPA 2RS52 4WM8C 5A6QA 5JXIA 1GQHA 1ALYA 3KLSA 2RMU1 3UGHA 2KA3A 1HB3A 1OH4A 1UY1A 4FTSA 3IWZA 3WVJA 3AJZA 1SMVA 2FDHA 1MS4A 2A3WA 2CWMA 3ENRA 3MO4A 5CFDC 5K8SA 1HQWA 1H6YA 3WQ0A 5C6CA 3K77A 4BM8A 1EPZA 1K42A 1I5ZA 3HBKA 4LHNA 1US3A 4HSLA 4Q8KA 3UK9A 4XXAA 3VHNA 4CDWA 1EAH3 1MZFA 3AZZA 3DKWA 1YHFA 2C9KA 2VM9A 4IUGA 4QT6A 5A3WA 5JUVA 3RZMA 3OPZA 4B4QA 4XZPA 3FBYA 1DGLA 2B5HA 1DCSA 2XWJB 4Q4X1 3T2QA 3KT4A 4KU7A 1HXS1 1PVC1 5IYYA 1NLRA 2E9QA 5AC92 5FY8A 1G8WA 2MNGA 1UMHA 5I91A 4BQWA 1LEMA 5I0TA 3I3BA 1PMIA 4JZRA 3C7OA 4RQPA 4B29A 2SLIA 4PIYA 2WZR3 4EN6B 3A7QA 1DQ6A 4XTMA 3O1MA 2E31A 4IEUA 3N9OA 3AFGA 2XUMA 2RE9A 5HPOA 2W5FA 5F3EA 3VZJA 4ONUA 3MUY1 4YVWB 2YFUA 3M1HA 3RZHA 4OCTA 1A8DA 1I6XA 1XSRA 3MW4A 1H0BA 4AG4A 3RSJA 3J7LA 3ON7A 2E32A 4BB3A 1LHOA 4MXWA 1UCXA 4YW7A 1JYCA 3R4UA 2RS13 3VZLA 1QHDA 3G7DA 3C7GA 2DFBA 4OI4A 1J58A 3OF1A 3AMPA 2I45A 1ND3A 1RUG2 2RJ2A 3IDEA 3J8F1 1GP6A 4LITA 5FUPA 4WVVA 2VZQA 3ACFA 2B9UA 2R063 1OPOA 3NSTA 5SV5A 4ASLA 1XC6A 4W6YA 3WF3A 5A3MA 1KITA 2BWAA 2Z79A 1YIPA 3U37A 5FZGA 1F5FA 4MXWB 2J1SA 2FDJA 3C3VA 5JIAA 5FLHA 1PGW1 2LM3A 4OMCA 3KV9A 2B42B 1SBFA 1W6QA 3OY8B 2ORZA 1YFYA 2DUQA 1SG3A 1AYN2 4XBLA 4KWJA 1ND3B 1PX3A 2VW1A 1JTZX 1HRI3 1UN1A 2YZ4A 4ASMB 5HCHA 1O3QA 1UQXA 3ZSKA 3BODA 5FQ0A 5J09A 4CCNA 2VH9A 5DQ0A 4CPBD 3MPPG 2P4EA 1US2A 1XNDA 4XEZA 1RMU2 2VOVA 2ZGSA 4DRRA 2JG8C 4A7ZA 2P6CA 4QPIB 4MH0E 3ZYFA 3VBFB 1W6QB 1OF3A 3GZEA 3RS6A 5F6LB 4TYSA 3QH6A 5T3NA 3S6PA 5DUUA 3SITA 4AEDA 3B5LB 1ZZBA 1O6UA 5JIUA 2Q4SA 5CB7A 2OPWA 3AXDA 3GZTB 4CUBA 4LIVA 5FK8A 3KF3A 3IAPA 5F8PA 1RUI1 3FN9A 2ZABA 1W3VA 2CGNA 2XBO2 4QGMA 3ZO0B 3M2MA 4BQ5A 3MW2A 4GH4C 4QXKA 3ZYRA 1RIRA 3AB0A 2FMYA 5A33A 5CFCB 1H2NA 1LGBA 4AEDB 3BI3A 2IXHA 4W4ZA 5AFEA 4GMP0 1AJKA 4MGYE 4IV1C 1QMJA 4GMP3 4CXWA 4FP2A 5FZOA 1QJY1 1RUF3 1UY4A 2ADDA 4MO3M 1KJLA 2IFWA 4YW2A 1K5MA 1V9U3 4BLIA 1AUYA 2FD8A 3RZZA 1MPXA 1W9TA 4LKSA 3POGA 4WZFA 3IMMA 4Q4W3 2Q1MA 1FMD3 4PLOA 1BBT2 3K3OA 4E2QA 1UF2C 3WNPA 5FZOB 4F83A 1UIJA 1MEC2 2W87A 3T0BA 2OIIA 3P5BA 5DDJ1 4URAA 1W6PA 3J4UH 3WNXA 3R4SA 2P37A 1Q3EA 5J37A 4PJYA 2ZGMA 2QQUA 2PA7A 2WQ8A 4TSVA 5FY5A 4M4RA 5FPUA 4CDWC 1ACCA 2RM23 1AR72 3BB6A 3SH3A 1BEV3 3E5UA 1FV2A 2FCUA 2D6KA 2WYFA 2ZBJA 2ET1A 3CLPA 4QQOA 4Y5SA 3K46A 3WZ1A 4B1MA 1DGRA 4CCOA 1OHFA 3AZWA 4NHYA 2YUEA 3SISA 5KHHA 4AQTA 1X9PA 1J3PA 3FJSA 2VZ3A 5E6HA 3VBUB 1IS3A 2VNVA 2ZTNA 2GH8A 3FE5A 3LEGA 4QXCA 4BISA 4TTGA 2CU5A 5FMOS 5JOXA 1POV3 3L9JT 1TEIA 4TWTA 1X33A 4RQPC 2E33A 5GLZA 1Z7S2 1EAH1 2WLQA 1CGPA 2YGMA 3VD7A 1Q43A 3LSDA 1JI6A 2VBPA 3EJKA 4LR4A 2WO1A 4Z92B 2WT2A 4DINB 4ZZ5A 1PZ7A 3VDBA 1XYNA 3AYEA 1ZBA1 5GLUA 4LLFA 1UOFA 2DVBA 5DAVA 2JG9B 1ENRA 2VCAA 1O4ZA 3M3CA 1N1VA 4M3CF 1K3IA 2O14A 2WZR1 3O1VA 1RINA 5HI0A 5IW0A 4QQPA 4FTBA 4YYOA 1WMXA 4RGKA 3WQ1A 4KGGA 5LBEA 3NMBA 4WVWA 3H3LA 3LZZA 3X29B 4XHBA 1VBB2 5FY0A 1UWWA 1CAUB 1A78A 3T2PA 1S0JA 1UNBA 4BQYA 2ZHMA 4AHXA 2FCVA 5FPAA 1LU2A 4GWNA 3ZSMA 1JYWA 1ENXA 4DQAA 3VBSB 3KWVA 2R073 2RS11 5A7PA 3AM2A 5JPNB 4V2WA 2XL9A 3WOGA 3N9QA 4K1YA 1VB2A 5L73A 5FUIA 4XE9A 2VNOA 2WUHA 2R061 4XMAA 3S7EA 5IK5A 2DV9A 1GWLA 3IIAA 4NN0A 4NHLA 2XB6C 2BRTA 3AXEA 1WLCA 2EVXA 4CU8A 2GC2A 3WDTA 2AYHA 5HXMA 2GC1A 2NMNA 5FYIA 4Z1VA 2XDVA 4AF9A 4ZXEA 1YWKA 1J1TA 3BU0A 2RR12 2LUWA 1HRI1 2BOIA 4UFLA 4INDA 3TAYA 1JMUB 1ULCA 2VC9A 3VLBB 2D6MA 1QIQA 2G9GA 3OCPA 3CEWA 3TN92 4CCMA 5BPXA 3U14A 4EV0A 1W8TA 2VUAA 3JXSA 5A3LA 2J22A 4G4FA 1DLLA 2PHWA 3LSEA 4X8NA 1QJX2 1V6MA 2XLFA 1PO12 2VOXA 3NO8A 1Q5OA 3M3QA 5LY2A 4D7SA 1ND2C 5IHRA 2LTNA 1GZWA 4IQPA 1QDCA 1COV2 1JOPA 4Y20A 3ZFEC 2KR2A 4LA2A 3OYWB 3DGTA 5T5JA 3O1PA 2VZOA 4NRQA 3KD4A 1K5MC 3MLKA 4QB2A 4EZ4A 4Q4Y3 1RVF1 5LRSA 3Q8EA 1HLCA 3V56A 3LGRA 1VAMA 1GZWB 2ARAA 4HFSA 5FY4A 1CN1A 1OLME 1SFNA 4UFJA 3ZN6A 4UBGA 2VUJA 2DCTA 2OVUA 4CUGA 4ET7A 1F4AA 4B7KA 3TEXA 1A6CA 3I2GA 1OVSA 2P3KA 1H1AA 3HIFA 1D0HA 2W1UA 1MVEA 2DCZA 3LEIA 3OSDA 5IK7A 1RUF1 2HWF1 4CDQA 1GP5A 2PTMA 2W68A 4N43C 1BCXA 1V9U1 3AP9A 4NWWA 4EE2A 5BY5A 1LCLA 2GH2A 5A7WB 4FOQA 2NQYA 1S4CA 3GZAA 3ZN4A 2AENA 3U10A 4GIQA 4YZ4A 1PO22 3E97A 4Q4W1 1FMD1 4RN5A 4HBNA 4IGQA 4G9SB 3GYDA 3IIIA 5GM0A 1ZRDA 4IEPA 2QZ2A 4UW5A 4JQRA 4YG6A 5JOWA 1Z0HA 3LA2A 4QDSA 4JAAA 5C9AA 4RS5B 1ZYBA 2QDRA 2ETEA 3TWIA 2DVFA 5FMCA 2BERA 4IV3A 2RM21 1MACA 2ZA9A 1BEV1 3GZUC 4OUMA 5HV4A 4BIOA 2R1DA 4XFHA 2RMU2 4CEYB 2QQNA 4KGQA 4WBBA 5F6KA 2VTXJ 3ZIXA 4QX8A 4GWJA 3NW4A 4W50A 4ZHNA 2FZ1A 4D7TA 5FYZA 2RVAA 3QH7A 1CONA 1W05A 1AL0G 1W39A 1X8EA 1POV1 3AKPA 4JCKA 3U07A 2TEPA 3O1TA 4QX5A 2WWSA 5FMOL 1SDWA 3ZM8A 1DFQA 4Q29A 5JCTA 5FRAA 1HV1A 3GF6A 5FWEA 2JDKA 1UAIA 4HN0A 4E8DA 4Q4X2 4FPLA 4UWDA 1REFA 2R1BA 4MLOA 1HXS2 1PVC2 2CWSA 3UKTA 3OPTA 1NLSA 4XAAA 5C5UA 2GMMA 5DUVA 3RJRA 1X50A 5H9SA 1OT5A 1KFXL 1RUE2 2A71A 2BNOA 2WO7A 3ES1A 4P9WA 4W6XA 3VHOA 4ZZ8A 3JQWA 4E4ZA 1HIXA 1EYBA 3BTAA 4MXVA 4IGPA 1JHNA 3WXPA 2R0HA 4UF0B 3WDVA 1GNZA 3AVSA 2ARCA 3NWKA 3B02A 2W08A 1X9TA 1RB8G 4M3CA 4PF5A 1F5JA 3UETA 4Z8BA 1UPIA 1PZ9A 2VZUA 5T5PA 2DYCA 2R071 3DPRA 1YEWA 2Y6GA 4K20A 4CDXB 4XF4A 4XJZA 4CUAA 2HWE2 1UD1A 1N1SA 2HBUA 3R05A 4B4PA 3J8F2 1JZ8A 3CZUA 1I1EA 2Y8KA 2E7TA 2I2SA 2YU1A 3RGBA 4AL9A 1UZYA 2UYBA 5FYUA 5FDBA 4MV2A 3NAPA 2GNBA 3I2KA 4NPRA 4RR3A 5JZGA 3OGSA 2ZACA 2XVGA 3VBHB 1GZTA 1AL22 1PGW2 1QJEA 1U5YA 2Q1ZB 4NO4A 4BH9A 2JKBA 2A70A 1IG0A 2CV6A 2VCCA 5HCAA 2G9ZA 1SLCA 3AVRA 1DGRN 2XVKA 3AP5A 5JDBA 4XQ4A 3PUQA 1FPN3 3LWCA 1FX5A 2D6OX 5FKCA 5FMBA 3MYXA 4BQ1A 2X05A 4XC9A 2JXAA 3VD9A 1W3XA 4XURA 1D4M3 2W46A 4MHRA 5FCCA 3WD5A 1NUKA 2IXIA 2ZX4A 2JDAA 3H3ZA 4KI5M 3LDBA 3ZXEA 5HBAA 3WG1A 1MZ5A 4QWNA 4I02A 4TXWA 2XL7A 1L7RA 3W5MA 4Y1UA 1BQPA 3IDCB 4AEKA 3ZDSA 5EJ3A 1F9KA 1REDA 1W8WA 3D6EA 1AR63 4XXPA 1OFNA 4CDQC 4Y5Z0 2AUYA 2ZGOA 4Q4Y1 2DBNA 4HXCA 4P9LA 1B09A 4QHOA 2GSYA 2WIIB 5C4WB 2J1AA 1V6OA 1LJ7A 3KVAA 4KBZA 2A6YA 5IVBA 1LTEA 3J26N 4XUTA 5FZDA 1RHI3 1ZREA 4FFGA 3DV8A 3JZVA 2WNUA 1O59A 2DU1A 3N4MA 2A6VA 5L36A 2FDGA 1QJY2 3W21A 1Q8SA 2FBEA 5G04L 3ITQA 3DN7A 2HJIA 1U0AA 5C9AC 1QNWA 4NE9A 2ZX2A 1JYXA 5LCWL 1YQ5A 4M01A 1LGCA 2GU9A 3I7DA 3WP5A 3Q8BA 5T55A 1GQPA 2AACA 5L9RA 1Q8OA 4CDUB 1SLAA 4IV3C 1BMV1 2FDIA 1C8NA 2QUOA 3EBRA 3PNAA 1R1ZA 4ZS2A 3A4UA 4NIGA 4XBQA 3J7MA 4BXSV 1W2OA 3E1F1 3KZ4C 4BZ4A 2E7QA 4C1XA 1NA1A 5A6XA 5LATA 4BQ2A 5JI9A 3FUOA 4W6WA 1GANA 1U5ZA 3UKVA 5FZHA 1W28A 1DP0A 2FQPA 3SH5A 4CP2A 3MICA 3HEIA 4N7UA 4QX2A 3CU7A 4NRMA 1AX2A 1VB4A 2XHKA 4P9YA 5D8AA 2RS32 5CA6A 2J42A 4LBQB 3BOWA 2A75A 2Y6JA 4LXLA 3WNOA 3P3PA 4ZXKA 3ZXGA 2Y6FA 2GNTA 4N8MA 1BKZA 3RYKA 1RXGA 2HWC1 2EIDA 1W04A 3U0ZA 3MHZA 1C5HA 1N1YA 1M4WA 5DABA 1LHNA 4Y1VA 4I30A 1NE6A 4LKFA 2H6BA 2WZ8A 5T5LA 1AXKA 1I3HA 1ZM1A 4IDZA 3ZYGA 1TMF3 4Q0VA 4XJ8A 1DGWA 3MDPA 2YB7A 1W6MA 4L8QA 3FUQA 4FPEA 2VY0A 5LA1A 4LK6A 2C4XA 1YQ2A 2V09A 4OFGA 4UI9L 1NAEA 3WW3A 2A6XA 2BU9A 1UPSA 3AX4A 2YPJA 4PHZA 1O4TA 1WMEA 3KQ4B 1ZBA2 4EYUA 5EYXA 3N9LA 2V72A 4PT6A 3USUA 1SLTA 3OUIA 4JC1A 2PAKA 4LOSA 4DIQA 2VD7A 3I3MA 1W6MB 2ATFA 2RDSA 3URFA 3DPRC 1HW5A 1ZA7A 1RUD3 2W0XA 3EO6A 4Y1YA 4KMQA 2VW0A 3ST7A 1BK0A 3ATGA 4O9EA 1QOSA 4WM8B 3E6BA 3F2ZA 4XF3A 1FYUA 4AK3A 4J6GA 2WINB 2Y33A 3USUB 1VMHA 3A23A 4QHBA 1JN2P 3ZKUA 4HN1A 1CAXA 2HEWF 2VVFA 4HZFA 3NAPC 5CFDB 5JZGC 4RR3C 4COZA 1G9BA 1NXMA 2ZGPA 2WSUA 4CP9B 4JDMA 2RS12 5GZDA 4IXLA 1EUTA 2JE9A 3MPBA 4H2AA 4JTNA 2IFRA 3UJOA 3M3EA 2G4IA 3I3EA 3VUOA 3USSA 1O5UA 2X29A 4XFBA 5F5QA 2D44A 3N9PA 3ZYIB 1AR92 1VAKA 5FZ3A 3RDIA 3NRUA 2XXZA 4YZ2A 1FATA 1UY3A 4K40A 1NCRC 3O12A 3WINE 5CKNA 5LA0A 1ZBE1 1VBC3 2ZMKA 3AL6A 4LBLA 2Y26A 1AX0A 5I8YA 4S2HA 1FPN1 1WGPA 4Q0PA 2QE3A 4GALA 3UL2A 3WV6A 1HV0A 1PGL1 1AF9A 2O8QA 2WS93 3FFZA 2HH9A 5LBFA 2WL1A 3RQ0A 1UL9A 5IK8A 4QB6A 1D4M1 3C7EA 1W8ZA 4GULA 4LUMA 2PHUA 2ZHLA 4Q4V3 1OD5A 2V5DA 2YV8A 4QX3A 4C0HA 3JU9A 3K4ZA 5EP9A 1EV13 2JD9A 5AFBA 4HK8A 4CRQA 1PZ8A 2ZXQA 3I2FA 2WNUC 1OUSA 1RUC3 4Y1ZA 2IVIB 1OC1A 1QDOA 1AR61 2VXJA 5DPNA 1YCIA 2VXRA 4TLFA 3O1OA 3H0OA 4JGYA 4C1WA 2ZZJA 1R1A1 1RVF2 2YYOA 4QHZA 2QDNA 4W8JA 1H9WA 3ZFFC 1V6KA 2BOJA 2JG8A 2PHLA 4GAZA 1ST8A 2GNDA 2ZGTA 3OGVA 4KU8A 4QKFA 4LQRA 3PUSA 2IWGB 1QGLA 4F3JA 5J3UA 3D4KA 1R093 1VRH3 1AYM2 1RHI1 2XJRA 5LBBA 2H6CA 1DZTA 4XFCA 2XWBB 3N7KA 4NOTA 5FLIA 3VBOC 1H4GA 3BPSA 3LOBA 3DCQA 2DVDA 4FOVA 2V4VA 1K5JA 2HWF2 1NA1C 2JDYA 2QCSB 2VW2A 3BPZA 4KQ7A 4QXBA 4R4ZA 1UYXA 1V9U2 2DDUA 1S55A 4JGZA 4P5HA 5FPXA 5J48A 5FO7B 1XE0A 2VMEA 2JG8B 5T52A 3ZX7A 4CCKA 3HNMA 3NNMA 1XJAA 1BXHA 1RUOA 4YARA 1ONAA 4BE3A 5D8AC 4CSWA 3B69A 1YFWA 4Y22A 3KCYA 3ACHA 2W2IA 4XW3A 4IEQA 1W0NA 4QX0A 2ZMLA 2VMHA 1PK6A 1X82A 1D0GA 3T08A 3QD6A 1OQEA 2EXJA 3AZVA 2E53A 4SLIA 4Q0SA 2WAOA 4BWOA 4GH4B 3CBNA 4DUVA 2VQ0A 3O1SA 2E51A 4E4SA 5JR7B 2RM22 4LO6B 5FV3A 4Y22B 4AW7A 1BEV2 3PTRB 1W8UA 2IZWA 4E27A 1ODMA 1CVNA 1UX6A 1VALA 4YGDA 4IV1B 3EMRA 3N7JA 1FV3A 2IXKA 1HRV3 2VMGA 3OBAA 3BTZA 2I07B 3VD5A 2P3YA 2J1UA 4GWIA 4NVPA 1AHSA 4BPZA 2PHRA 1GZ9A 3POJA 1TMF1 3D5OA 3OBRA 1F35A 3A0NA 4KWKA 4R9BA 2WC2A 1J1LA 1NLQA 3OG2A 4XUNA 1CAVA 4YW1A 3OGRA 1C1LA 1U5XA 1W03A 4FPHA 2GP3A 5LZ6A 2BFUS 4AI3A 3RI8A 3T1LA 5IFPA 1OFSA 4A3XA 1B35A 2E26A 5HV0A 2HKXA 1MS1A 3LPGA 4NIDA 3W58A 4YNIA 3KGLA 1O7FA 2V5YA 3T4VA 1RUD1 2RJLA 4CPBA 5JMOA 3WF1A 4PBOA 4XDOA 4A6OA 2K46A 4MUVA 4CDWB 3HD8B 3ZPYA 4DMIA 5I0UA 5C3QA 5I8TA 4KNCA 1R64A 4I2OA 5IAXA 1K45A 2GDFA 3ETPA 4UW4A 4E9KA 4YW6A 5ACA3 2VE1A 3SCHA 2P2KA 4LK7A 5JVVA 3ZR6A 2W52A 5FYSA 5LASA 1AR81 1SZBA 4XFAA 2MHFA 2R30A 2DVGA 4IE6A 1WD4A 1OMIA 1ULOA 4XCBA 2YBKA 3K75B 5T50A 1F15A 3ZYJB 5DZEA 1R083 4RQPB 2OKXA 1O3RA 3VZOA 4IEWA 4R4XA 4ZS3A 3WDUA 4R52A 5EPAA 2PFWA 3CJXA 3T09A 4BLJA 1SEFA 4L99A 5DAQA 4NROA 2CDPA 3POFA 4YZ3A 1YI7A 4EN7B 3M3IA 1SCRA 3I3QA 1U12A 1L7LA 2XQXA 3PUHA 2XKPA 1VBC1 2GMPA 4F8AA 5FZMA 1LHWA 1SLIA 4CEWA 5A3NA 1CZVA 5ERLA 3RJ2X 3K4AA 2NPIA 4YGCA 3LEMA 3ZXJA 1S2KA 5EZWA 4AHYA 5DZGA 3ORJA 3QBQA 1S0DA 3PIGA 1AJOA 2PLV2 2WS91 3EYPA 4JGYC 3AKTA 2VULA 2HWB3 2AC1A 2EIEA 2HWD3 2PHXA 1H6XA 1EY2A 3QOPA 1QJZA 4LKEA 5FMDA 3ZFGA 5KXEA 1Q56A 4Q4V1 2VVDA 1KGYA 1H8VA 1QJU2 3JD71 4E4HA 1EV11 2B39A 2XJTA 1ULPA 4P00B 1N47A 2W94A 1RUC1 1IKQA 1AVBA 4ATFA 1WW7A 3TB0A 4LO8A 5E88A 5FQ0B 4OHZA 3DEMA 2EF6A 2NM1A 3QLQA 4JGZC 1LESA 1GICA 3U75A 3BIEA 1XYPA 2GN7A 2X53S 4YPJA 3PUIA 4M00A 4MGTA 5EHDA 4ZU5A 3ZXAC 5CADA 4XZUG 1DYOA 3CNAA 2PXJA 4FPKA 1J3RA 1PMHX 1R091 1VRH1 4RFT0 5FBJA 4AFMA 1IS5A 1OPMA 4XVHA 4CU6A 1ND2A 4WM7A 2BGCA 4HK9A 1FNZA 5FZAA 1F31A 3O0WA 3PMEA 1PK6C 5FKBA 4BXFA 4Z2WA 3JB8A 4FPYA 3VB9A 4YVSC 5FZEA 2MEV3 1UU5A 3ZFEA 5G05L 1J3QA 4Z07A 3BGAA 3H1YA 5H9PA 5CYYA 3GBGA 3ZKYA 5DN2A 3NV2A 3H9AA 3UKNA 1BMV2 4QPYA 5A33B 3CKHA 4DS0A 3WF2A 2RJKA 1ND2B 5FJHA 1ULDA 1REEA 2DBIA 5E1RA 5A3OA 1SDDB 1YRZA 2EIGA 4FXGB 3THDA 3ZFEB 1WLWA 2Y0OA 2AR6A 1UU4A 1VBD2 1CPNA 5FTTC 1AXYA 1PIV2 1Y3TA 2ARXA 1K5MB 2VZPA 2WQ4A 3MIEA 1UY0A 4Q1RA 3BTXA 3HQUA 4N43A 3NL1A 2NP0A 3OEAA 1OA4A 4NAOA 2D93A 1YUDA 2VCBA 1TME1 3POSA 2BP6A 2WT1A 4FPCA 5LBCA 1JZ5A 2VG9A 2G9FA 2CL2A 3POYA 1HRV1 2HWC2 1OA2A 4I09A 3DF0A 3VZMA 2JB4A 1S2EA 2JDUA 2OQ7A 4PQQA 1B35C 1GOHA 1LOGA 2YY1A 2OXBA 5IJRA 5A7SA 3TNQA 4N43B 1W6PB 1S0GA 1ULGA 1A34A 1WLDA 3NNGA 1LR5A 2WFF3 1Y43B 2BBAA 1GYKA 3POEA 1BJQA 1UIKA 1YNAA 1H2LA 4KL1A 3HMYA 5KHIA 3S5AA 1RUH2 1VBE2 2HLEA 3B01A 5E89A 1S0FA 2GMEA 1XNAA 2IXJA 1NE4A 3D0SA 4XPVA 3U78A 1Z78A 3K4DA 5C3OA 2D40A 3FLRA 5JR2A 5LWBA 3VKFC 3SKVA 1T6GC 2CDOA 3KV4A 1JODA 2BFUL 1AZDA 3PJQA 3HOBA 4K9SA 3S57A 4CCLA 2AREA 1VIWB 1VBA2 3OB8A 2RS53 4I3PA 4AYUA 3DYPA 5BUVA 4UFKA 3U4SA 2VZVA 3WCRA 2CSGA 5ACA1 1SHWB 1BVVA 3UYJA 4FT8A 1RUJ2 2NN8A 3VDAA 2QVSB 4N53A 1K12A 1SPPA 5LRRA 1SACA 2DF7A 2VNGA 5F7UA 5J96B 1R081 4QPGC 4CEWC 2DCJA 5LEJA 4LUKA 4KG8A 4NIIA 4LO7A 1VMJA 3T0DA 4FFHA 2QJVA 1ZX5A 3OD4A 4IE4A 4PBPA 3N35A 3SQOA 1RJ8A 1V6JA 3C2UA 5GALA 3RYPA 3ZSJA 2VMCA 1SPPB 3KHCA 3CQOA 1GMMA 3V0AA 4ITCA 3ZFGC 2BEOA 5L7OA 1ZBE2 1LENA 2Y34A 4C8DA 2W1WA 3WW1A 2VMDA 4J25A 2PQQA 2BNNA 2ZGKA 3GXUA 1GP4A 4P08A 4Q0UA 5IVJA 1NG0A 2CAVA 3KSCA 1VR3A 5I0SA 3BTYA 4Y4YA 3FL7A 2P6HA 3WP6A 3OGJA 5GZCA 4ARYA 1AXZA 2J1TA 4JHZA 4A41A 4BHPA 1UYPA 2D7FA 4LNVA 1DZRA 1ENQA 3MIDA 3WCSA 3ZMNA 3ZYBA 5BNPA 3JUUA 4A6SA 3O1RA 5GZFA 1I5PA 2ENRA 2VO5A 3GCXA 4LBJA 1J84A 1YQCA 4WM7C 3H7YA 5A6ZA 2WR9A 4X6QB 5IVYA 4Y33A 1QH6A 2NZ9A 3MBWA 4LLOA 3NNFA 4IEXA 4PIXA 1R1A2 4K8RB 5FYBA 4E4DX 4XFIA 2WN3A 1RC6A 3T1MA 1OXCA 3ILFA 5FLJA 1KDKA 2D97A 5DG1A 3WQBA 2C9AA 2MPFA 1U5IA 3I2IA 5FYMA 1GZCA 4XILA 4YZ5A 4B4RA 1SFPA 5LK7B 2VMFA 1OQ1A 3NKTA 4Y20B 2XMLA 1RMU3 4UT5A 3H8UA 5SV8A 5DZFA 1W0PA 2YPDA 2MEV1 4GMP1 2XR4A 5C8CA 1XNCA 1DQ5A 1GR3A 4KWUA 2W9XA 3CF6E 3EB7A 1ZZ7A 2E63A 5A80A 4AVBA 5A1FA 5FP3A 3ZN5A 4DRVA 3ACLA 4W65A 3WY6A 3ZN6B 1WMDA 3HR9A 4AFCA 1MR5A 3JBG3 3MGUA 2WN2A 5L19A 3UGFA 2TNFA 3BYWA 4L11A 5CISA 1PGSA 4P9GA 5HCBA 1FOD3 1WA4A 5C3SA 1WLTA 2B7YA 4CDQB 5K0UC 1E5IA 3SCGA 2GAUA 2P3IA 3LE0A 1BVP1 2J1RA 2GP5A 4FPJA 3WEZA 1OBNA 4YGBA 4BMEA 1JZ6A 5IVVA 2XGXA 3PURA 1S0IA 2WJSA 3H1WA 3ZVXA 2ZGQA 4RGGA 1XOYA 4RYDA 1NZIA 2IUWA 3E5QA 3RG0A 3RRDA 3SMHA 3WP4A 4LBNA 4QGLA 5GJ6A 3MFCA 5ANQA 2VQTA 4HT1T 5C9AB 5I0DA 2WFF1 3WUDA 3IDBB 1W9WA 1HX6A 5FP9A 2FMDA 2SBAA 3ZDVA 1BBT3 2JDZA 4IV3B 1VP6A 4AFBA 4CP1A 3DYOA 3ACGA 5C70A 5FUNA 3S7IA 1W6NA 2ZOEB 2XH6A 1UMZA 4HKLA 5IVCA 3PVNA 2R16A 4M0NA 4QQLA 4XQDA 4N53C 4ORFA 4I01A 4OHWA 5H9QA 2X5IC 1CIWA 2WZPP 2IXLA 2WNVC 1AR73 2RS51 4LE4A 1XPWA 1OOPC 5FREA 2W39A 3D8CA 4RFRB 5FWJA 2IVJA 2O8OA 4AGRA 3W20A 4JDOA 1YYNA 5F2WA 3CIHA 2UY9A 4K1ZA 1SLLA 5FOBB 3ZYHA 2DFCA 5DXDA 3V64A 4F7ZA 5KHGA 1AR82 1DYPA 5L7OC 1C8M3 2C0ZA 2BDRA 2WO3A 1M06G 3Q8FA 3B9IA 2Q8CA 1SBDA 2EXIA 3PVEA 2WLPA 4OYUA 3WX5A 4FXKB 4KBBA 5GLTA 1SFYA 2DVAA 3AP4A 1C57A 2PELA 1S0CA 2Q5TA 4XQWA 4IETA 2VCMA 2BW8A 2DUPA 4NIHA 5CG9A 2OQ6A 4OQ8A 2ADEA 4M3CB 3R6SA 3TEWA 4LKDA 4XFFA 1CJDA 4EWDA 3FLTA 5FZ1A 2XVLA 3BVCA 5BNPC 3DPRB 1ZZ6A 2DCKA 2VOWA 4JDNA 2H0BA 2OZJA 3I54A 2E7AA 4YG3A 2AEYA 3HT1A 3POIA 5IUQA 3IMNA 1OURA 1UU6A 1JUIA 2PHDA 2ZGLA 3JQXA 1FNYA 1MS0A 2A3YA 4Z2AA 2K0GA 3SCFA 4Y3OA 1C1FA 1GOFA 2QQMA 5JOZA 1CQ9A 3NAPB 5JZGB 4RHV3 3AP6A 4Q4V2 1DQ1A 4RR3B 2R49A 3JD72 1EV12 1NCRA 2KM2A 2XONA 3FWEA 3LA7A 3P6BA 2QNKA 3AMHA 2WAAA 4HVOA 4P9XA 4O7XA 1C5IA 4RA0A 1FI2A 5ABJA 4MADA 2ZMNA 1IQAA 5C8CC 4J1WA 1O3SA 1RUI2 1H1IA 4AHZA 3U4XA 4V2VA 5GZEA 1DQ2A 3T2OA 1NCRB 1JZ3A 4QKNA 2WRAA 2B8MA 1T2XA 3MLLA 2RR13 4Q2FA 1R092 2VZRA 1PM4A 1VRH2 3ZYPA 3W59A 1QXPA 3SKJE 3TN93 1WW4A 1NXD1 4GZ9A 3UGGA 1RMU1 4B1LA 4FFFA 4WV8A 3SXWA 4QKDA 4L9BA 3H7JA 3IDAA 3T30A 4WVMA 1OKOA 1QJX3 2W1QA 1PO13 4CXYA 2K9ZA 1GOGA 1LKNA 1P8JA 4OLLA 1COV3 1IG3A 5ANNA 3KF5A 3ZFFA 4CYDA 5CBLA 2Y0IA 1T6BX 3JBG1 2C1FA 4GKYA 4B3NA 5A32A 1F4HA 2WNUB 2Q30A 3LF7A 1FOD1 3VBOA 2AZ5A 2YGLA 1J83A 3C7HA 5KHJA 3LIHA 5EWSA 3NJXA 4MGQA 3ABZA 1A8MA 2ZPXA 1GWKA 5DDJ2 1NCQC 5IVFA 4MYEA 5BYNA 3V0BA 4HL0A 4IE5A 3ZFFB 4FQZA 5F3GA 1TNFA 1TME2 4XIKA 3HBZA 5IK4A 5A32B 3WHTA 1RXFA 1HRV2 1V6IA 3VBOB 3MIHA 1JZ7A 2W91A 4AVVA 1JS9A 4JX0A 1DG6A 5KBFA 1NA1B 2PN5A 4C0BA 3NNLA 2PHFA 1MQTC 2XHNA 2ZGRA 4QMAA 4CP0A 4DUXA 5JAXA 2FHRA 3V0BB 4NJ4A 5CIRA 5AVPA 1PO23 1XNKA 2E6VA 2EXHA 5AVAA 4GA9A 4LHKA 4BA6A 5D8AB 2JENA 4CU9A 5JOYA 3KHBA 1HB4A 3LDRA 5FIXA 1EAH2 3VBRC 2LRPA 3FHIB 4XYXA 4AVTA 4C90A 2WKKA 3WNLA 4URTA 5JWPA 4AI0A 1OVPA 1ULFA 3NV1A 4NMIA 4MX3A 5FZ0A 1RITA 2Y60A 3HAGA 2UURA 1OLQA 3H3UA 2F6BA 4XACA 3LA3A 5JSOA 2A3XA 4CUCA 1XNBA 2VPVA 1GU3A 1A3KA 1HN0A 4HMZA 5FPBA 1KRIA 3O5SA 5FY7A 4WZCA 2WZR2 4BK5A 3OJBA 4XHXA 2P1BA 2W92A 3QCWA 3M4FA 5CVRA 4DOUA 3I59A 3IPVA 4FP3A 4QU2A 3MF9A 4Q26A 1NY71 2ZAAA 2J1VA 3BIWE 2X8KA 4MGKE 1YFUA 4BMBA 5KWRA 1BK1A 1YXWA 3T3YA 1C8M1 1G9DA 2VOKA 2DURA 2D6LX 1R082 2ZEXA 3FHQA 4XJAA 1Y9QA 3DXUA 2FDKA 3THTA 1O3TA 1UW8A 1NYWA 2QQVA 4QDQA 3I59B 1V6LA 1UOJA 5A1LA 3PUAA 2VBDA 1ZZ9A 3AFKA 1PVC3 1OSGA 2L9LA 4XABA 3RPQA 5I0RA 2JE8A 4LBQD 3GGLA 1WZXA 2R062 2ZEWA 1Q8VA 2QQIA 4QX1A 3VDDA 4YG0A 4C91A 3APBA 2YG0A 5BNOA 1KQRA 3KVBA 1CAXB 4FAGA 3GDBA 2R0FA 1CPMA 1RUE3 4FO9A 1JU3A 3SLIA 3VHPA 4AGVA 3PLQA 2JIJA 3MUZ1 3R0RA 4R9DA 2ZJCA 4BDVB 1HRI2 5ABJC 1F8VA 1W90A 3GM8A 3Q9OA 4UAPA 1JYNA 4IESA 2WBKA 3KQRA 1JHJA 4M0HA 3ZXKA 2Y64A 3WF0A 4EWAA 5FPLA 1DQ0A 2HEYF 2GNMA 4Y5TA 4RHV1 2N7GA 4NWVA 3M70A 5J1XA 2XJPA 1V0AA 2HWE3 3DUIA 2O1QA 3EQEA 4PI2A 2EICA 1W8OA 4A44A 4TN7A 4DB5A 5FZCA 3B3QE 2YHJA 4HETA 3ZOIA 1N3OA 1UX7A 4NHMA 4COUA 4H14A 1IOAA 2BBVA 3AZYA 1POQA 4Z82A 1W06A 2Z2SB 1V70A 3NJVA 3N3HA 4GD4A 1ASJ3 5EJ1B 3RMXA 3RZKA 1AL23 1BYHA 2BWCA 4XETA 1CJPA 3CZJA 4YM3A 2QFEA 1O8SA 3I2HA 1CZTA 1I9RA 4DEVA 4ZKTB 1XE7A 2RDQA 4AQ6A 3TNPB 2HYKA 3LB9A 3M3OA 3TN91 2D98A 4QQ2A 1NQDA 2YBSA 1H8TA 1W2AX 2VUDA 3JB4C 4N90A 4Q8LA 2JEMA 3EHKA 1IS4A 2MEV2 1RL3A 3I97A 2DU0A 3DL3A 1QJX1 2TUNA 1RUF2 2YROA 1V6NA 4JGYB 3SC7X 3MFAA 1CX1A 3CJIC 3AKSA 4MVTA 2TBVA 2JE7A 4JRAA 2F4PA 4IERA 4KH9A 3ZPOA 4ES8A 1COV1 1LHUA 1PMJX 2W47A 3UJQA 3KT1A 5JXGA 5T54A 4A4AA 4Q1PA 4DEQA 3KV5A 4HSJA 1H8TB 4A45A 3LKJA 1DQ4A 4Q4W2 4XF9A 1FMD2 4HVQA 1HQLA 3T2TA 2WA3A 5FP4A 4KWLA 4N7IA 4FPFA 2Y38A 3BU7A 4D6SA 2K2SA 1CAWA 1XE8A 4JGZB 1ZZ8A 4UFIA 1HJFA 4OQ9A 4OI0A 4YVSA 1MS3A 1UOGA 4PLMA 4QKBA 4CCEA 1HJGA 4PDWC 1LECA 3I2JA 1YLLA 1VPHA 3VD4A 2KD7A 2XUEA 3WNMA 1N3QA 1F2NA 3AMNA 1QJY3 3OUJA 3B93A 4QGNA 3GBWA 3TYJA 1PK6B 4QU1A 2QKDA 3NJYA 1LODA 3THCA 1UO9A 3PVBB 4YVSB 3VGIA 1MZ6A 2CHHA 3WQ7A 2WFF2 4LEJA 3LAGA 3GBFA 3B94A 5FZIA 5KXCA 3CDZB 4ZONA 1VAVA 5EXOA 4YW5A 1DZQA 4GB33 1GKBA 2JICA 4M3CE 4Y26A 1YJLA 5GKAC 1LHVA 3W9AA 4K3UA 1IKPA 3W5NA 1XYOA 3T4HB 3RVHA 1QXJA 2NLRA 5D2AA 4YW3A 5A7NA 1BLZA 3CO2A 1NOVA 1GNHA 4QAWA 1LOCA 1SCSA 1OF4A 1OLMA 3K2OA 5JXJA 2WO2A 4LTAA 4WVZA 4D69A 2XG3A 3A21A 4CE8A 1S2BA 4BQ4A 1CWPA 5A3UA 1W8NA 2RS33 2OA2A 4DPNA 3DXTA 5FZKA 1FAYA 4FFIA 1CAVB 1WCSA 2NYYA 3SH4A 4FBFA 3OBTA 1PHMA 3KGZA 2PYTA 3LDKA 4R9CA 3VDDC 1NZCA 1OUXA 2DUOA 5BNNA 2RDRA 1B35B 1X8MA 5BNOC 3GJBA 4X6RB 4A42A 4IGOA 4KG0A 4AHWA 3ZR5A 2VZSA 5BNQA 5IVEA 2O0OA 3PU8A 1PM7A 4I0BA 4UYBA 1W9FA 2R32A 2YC0A 2R072 3GNEA 3H50A 4LBOA 3ILRA 1CD3G 2XOMA 1O4YA 1ZBA3 3OGGA 5CKQA 4YVWA 5BNNB 2ZCWA 2ZEZA 4EROA 3INAA 1SLBA 5C3RA 2YMZA 4MGSA 5FZ9A 4L0PA 3N9NA 3AJYA 1RUE1 1QEXA 1WBFA 4Y1XA 2LS6A 4A3ZA 2OYZA 1URXA 4QQHA 5A3TA 4QPGA 4XTPA 2OT7A 1QU0A 4ES9A 2VECA 1RYYA 1JOBA 3MLJA 3MIGA 4HLTA 2X10A 4IL7A 4P14A 4PI0A 3IBMA 3VKLA 1DYKA 5FR3A 1JYVA 4O9GA 2ET7A 3RI9A 4X8PA 1IS6A 1MS8A 3F95A 5FXWA 4DXSA 3E6DA 3IAQA 3MIBA 1OQDA 2HWE1 3OY8A 3DKQA 1MS5A 5FZ7A 4AQSA 3O0VA 4DY5A 3TOJA 5FO8B 4ZU4A 4QPGB 4CEWB 4MG2A 5FY1A 2LROA 3AZXA 5BXXA 2VJXA 4AFAA 1C28A 3WNKA 5KR7A 1H8TC 5KC5A 4YRDA 1AR93 4LJHA 1EUUA 3PIJA 4NR1A 4QPIA 3CMGA 5FYHA 1ASJ1 5F5AA 4AE2A 1AL21 1WMFA 2GC3A 3VBFA 3H8OA 2PAMA 2HEVF 2UWCA 2Y6LA 3ECQA 3KCXA 4Q4Y2 3BN6A 3KMHA 4RGAA 5LA9A 3ZFGB 1LULA 3C7FA 4GKXA 4RL7A 1GFF2 4BJ0A 2V73A 4QD2A 4DXTA 3WG3A 4A7KA 5JXHA 1J59A 3OBZA 3J9SA 5FYCA 1W6OA 1UOBA 4DXZA 4I0AA 3OEBA 1W9YA 4LO4B 3MEPA 4DY3A 2VQUA 2Q8DA 5F1RA 5CFCA 2RV9A 3VN4A 4NHXA 4MGIE 2D6PA 5FYYA 2WNEA 4GJYA 4JHTA 1XSQA 1WKYA 3JBG2 4YGEA 2DCYA 4PLNA 3S0MA 1W6OB 1UXXX 1OKQA 4WM7B 1WA6X 1FOD2 5K7PA 5D21A 1RVF3 2JDMA 4NHKA 2D3SA 3POWA 4OHXA 1QOOA 2QQKA 4AAPA 4PF1A 5F3CA 3FHAA 1JU4A 2ZX0A 4CVUA 1JZ4A 3OTFA 2D43A 4FOWA 3QACA 1AYM3 1YFXA 2D5HA 3VKOA 3VL9A 5JSPA 3O14A 1FT9A 1SBEA 1IPJA 2BJSA 2EAAA 3AL5A 2HWF3 2UYAA 1GQGA 2VBBA 5KXDA 2BGPA 3I4IA 1E57A 4LORA 1XB9A 3ZXDA 5F5IA 2KXLA 4EWEA 1GBGA 1E5RA 2JDPA 4LE3A 5CNAA 3T0AA 1MS9A 2ES3A 4QB1A 3TEZA 1WCQA 5K0UA 1DLCA 2CNAA 1LB2A 4RD7A 1HB1A 4GB31 4S2GA 4OZOA 5LK5A 4OHVA 5L9VA 2WDBA 1TG7A 3B9CA 1UYZA 1KFUL 3SEPA 3PVOA 3UT0A 2VQAA 2GC0A 5BNNC 2R043 2HYXA 3DECA 1ZRRA 1TVGA 4UOJA 5T5OA 3VBUA 4S2FA 2C24A 4COVA 5K0UB 1QQP3 5ISLA 4FI9A 1JOJA 3TEYA 2RS31 2BVBA 3IT8A 5FK7A 3VV1A 4XF0A 4AGGA 3U11A 4MOAA 2VUCA 5F32A 4R9AA 1POV0 4D7YA 5J36A 4YVWC 1H30A 4OUSA 3VD3A 1LEDA 5KC6A 1NY72 3N7MA 2A6WA 2JG9A 4GQ7A 1Q8PA 3WF4A 4DUWA 2W1SA 1C8M2 2BVVA 4AOCA 5CG8A 2J1EA 2JIGA 2VMIA 2VZ1A 1BZWA 2X5IA 2WNVA 4ZU7A 3GHNA 1VE0A 2JB8A 1NQJA 2YC2A 1OOPA 3MV01 5EQUA 2PAEA 3ILNA 5EV7A 3THPA 4MHUA 5BV6A 4FVVA 1CAUA 1RJ7A 4UW3A 1UYYA 4YLZA 1ODNA 5L9BA 4LULA 1QH7A 5D1IA 5C3PA 4IE7A 1N1TA 4LOTA 5IT6A 4XAEA 5AC93 4N53B 4FAHA 3VBSA 2X5IB 2QZ3A 2ZGNA 2WNVB 4ZY9A 3U1XA 5I8SA 4D0QA 1LOAA 4FPGA 1ND3C 2QQPA 5FO9B 2VGDA 1WUVA 1OOPB 1FXZA 2EXKA 1QOTA 4AAXA 2VL4A 3WUCA 4NIAA 3AK0A 4R8HA 1W8FA 1OI6A 4UXAA 2Q1FA 1FPN2 2WT0A 3WP3A 4OUEA 4QPIC 2OUHA 1E5SA 1PGL2 4K7JA 1YC61 3VBFC 2ZS6B 1QF3A 4NAMA 1HN1A 4RHV2 4LMFA 5K9YA 1G9AA 1KXGA 2HWB1 4Q27A 1TNRA 4YFZA 2HWD1 3OD0A 5E16A 5L7OB 1D4M2 3V0AB 3ES4A 5IFTA 5FXVA 1JXNA 2CAUA 2YFZA 3HN3A 3D82A 1AR91 3PL0A 2PQSA 1RUG3 3POBA 3PTYA 4OULA 2G19A 4YSFA 1AR62 2EAKA 3LEKA 3NV4A 4TLGA 1IGOA 3OUHA 1XQNA 3HN1A 3K48A 3NJZA 2CGPA 2QQJA 2B9VA 2D3RA 2ZZQA 3PU3A 5F2SA 4AEDC 2BYVE 5CFCC 2Q8EA 1UKRA 1W2NA 2EALA 3E5XA 2PHTA 2XPJA 4HANA 5BNPB 1KS4A 1AYN3 2WNOA 4D8MA 4QX7A 1NT0A 1RHI2 2PLV3 3OYWA 4AI9A 4Q0QA 1OA3A 5FZ8A 1LOFA 3KCCA 5FAXA 2CGOA 5FXXA 4AVAA 4HONA 3KB5A 4E8CA 5A3PA 5A1AA 3WR0A 3SEEA 4COWA 1QJU3 4ISQA 4XDPA 1XU1A 4COYA 1NKGA 2ORXA 5F37A 2BQPA 3HQRA 1TZOA 2JX9A 2P34A 1VLNA 2QQWA 3AYDA 3KV6A 4LHLA 4N9HA 4YM0A 5FYVA 4E2SA 4LT5A 2XJQA 1G6NA 4FQ4A 1X36A 2BNMA 3FLPA 4HKOA 4DFSA 4CXXA 2Z4FA 4JVAA 3UESA 5A7WA 2XBO3 4EN0A 4CCCA 5C8CB 2VTFA 2WSVA 5A6YA 3ALQA 5GLVA 1DDLA 4XCAA 2Z42A 2BZDA 1AYM1 1KS5A 3O1UA 1UMIA 4QDRA 1C3HA 2JJ6A 2B46X 2WZEA 4XJ9A 3WW2A 2RG4A 1IQDC 5FZ4A 5IWFA 3IM0A 5FJKA 4JRLA 4RS5A 3AMMA 3M7AA 4L97A 5EFUA 3VBUC 5M0TA 2QTWB 3ZSEA 4XFGA 1QWRA 5FXZA 3BOPA 4RSUA 4PQ9A 2DTYA 3HPNA 2ZKLA 1CZSA 1TMF2 3N7LA 1NCQA 4HVRA 4L2NA 5FZFA 3J7NA 4CEYA 5KHKA 3WSOA 1HQNA 1RTVA 1APNA 1HB2A 5C5TA 5TSWA 2R6QA 3ASIA 4I0WB 4JQTA 4EZHA 1IPKA 4BK4A 3WHUA 4XMIA 3TRSB 1VBD3 2YXSA 1MEC3 2R041 5JPMB 1PIV3 2UWAA 2JG9C 1HDKA 1QQP1 5FZLA 3ZXLA 4CCDA 3ELNA 1NCQB 4G3YC 5A70A 1MQTA 4YW4A 3HJRA 2V4AA 5B4NA 4ARXA 1QJFA 2JWPA 1RUD2 3NKGA 2OX0A 2VZTA 1YJKA 2HWC3 3IZOA 4LBKA 3BCWA 1OD3A 3ZMOA 1YQ8A 1KJRA 1W6NB 3I3DA 3VBRA 4GJZA 3CL1A 1Y7BA 1PNGA 1PNFA 1MQTB 4TZDA 2XLAA 3H8XA 1CR7A 4UBHA 3VBSC 2VVEA 1RUH3 1VBE3 4K8FA 4LBMA 1UZZA 1Z7S3 1KEXA 2GZWA 2YU2A 4UF0A 4D94A 1UY2A 4BU2A 2AH2A 3MIFA 4CDUC 5CEHA 1WWYA 3VBRB 5HCFA 1VMFA 5KXBA 3LFIA 4PIZA 4AEMA 4BCUA 1ULEA 2P17A 5F9TA 5HXVA 5AC91 5LEKA 1JYIA 1VBA3 3GCWA 1NX9A 2IXCA 2R7EB 3P1IA 3WT3A 4AEJA 4CDXA 2W3JA 3PJYA 1OLRA 2C26A 1LOBA 3V65A 2AGSA 1IHMA 1VBC2 2P5BA 2WWUA 4FPOB 1OH3A 4XUPA 4ISRA 4NUBA 2F17A 1RUJ3 1YI9A 4H7MA 4XUQA 1N3PA 3KT7A 5F3IA 1W9SA 1CIYA 3HQXA 3AYCA 1VBB3 4H3WA 4QPWA 4XIOA 5LY1A 4DXRA 1JW6A 2BTVC 1ENSA 2W95A 2WS92 3FFQA 3VBHA 3MI8A 1Y4WA 2XQRA 4P9IA 4K6BA 2XLGA 2UU8A 2FDFA 5CKMA 3FZ3A 1O91A 4ZPIA 4AVCA 1PX4A 2F4LA 3RWNA 4DZGA 1RUG1 1WCUA 3WDXA 4AZZA 4OHYA 1RUC2 1LU1A 2Y6HA 1LOFC 4N9IA 3ZXFA 3C8XA 2WYSA 5JI7A 1ASJ2 3WNNA 4D6QA 2ZKNA 3WDWA 3PHMA 3H8RA 3RZGA 1ZBE3 2LW8A 5FP7A 4YZ1A 3RNSA 2A5ZA 2JKXA 3EXUA 5GZGA 1LNSA 2IC1A 2DTWA 1YO8A 2EIBA 4DO0A 4YFWA 4OMDA 1AYN1 4QM9A 4D6RA 2QBXA 3NQHA 1UZWA 1Q8QA 5DAXA 2QQLA 2PLV1 3MF6A 1QY4A 3BALA 3H1MA 2VNRA 5ABJB 5FY9A 5LB6A 2BPA2 3WW4A 1XNTA 2XJUA 3VHRA 3LQCA 5C4WA 2UWBA 1JBCA 5J7MA 5C7GA 3WLUA 1QJU1 1HKDA 1V00A 2AEZA 1UZVA 1O8PA 2EA7A 3LPFA 4MZUA 4XBNA 5DAWA 3A22A 4JKMA 2ZGUA 4AWDA 2FZ2A 2VR4A 4IEYA 4OVEA 3KS7A 5IAVA 2X09A 2WABA 1ZA4A 4U2AA 4XOGA 5DAPA 2ZEYA 3UNPA 4UW6A 3HNYM 3IN9A 3HWJA 1R1A3 4M4PA 4K21A 5CZKA 4CU7A 1GV9A 5FZBA 4RS5C 2XBO1 1S0BA 3RYRA 2OUJA 1ZRCA 2ZHKA 4WVMB 3WG2A 4CDUA 1G86A 3VZNA 5CAZA 4QM8A 3B7MA 3CJIA 4LA3A 4U36A 3JCIA 4CEYC 1ZVFA 2RDNA 3HNBM 3I8TA 3PMSA 1W2UA 5C8WA 1XXNA 2JDHA 2ZX3A 3HT2A 3P3NA 3E6CC 4LPLA 3BKZA 1G7YA 2JDNA 2Q8OA 4JV4A 4META 5JMCA 4FCAA 2G1MA 4NRPA 3CJIB 1D7PM 1PVXA 4Q5OA 3A0KA 4GB32 5CU1A 5EYYA 4OI2A 2ZHNA 4L92A 5F5CA 4P02B 3OPWA 4LBQA 3I2DA 1GLHA 4P5YA 3GALA 3RZLA 4BIFA 2NMOA 4PDWA 1BBT1 4UFMA 5B2GB 4JKLA 4H7LA 2DWRA 4NPLA 2ARBA 4HPKA 4IW3A 1VBD1 1WCDJ 3MW3A 1O5LA 1MEC1 5EIYB 3LFMA 1PIV1 1Y9MA 3BUCA 5E8AA 2CY6A 1VRBA 1XRUA 1EP0A 3UV9A 1DF0A 1W99A 4FSJA 2ZX1A 1L7QA 1L3JA 4Y24A 3VDCA 1JUHA 3L2YA 5DUWA 3RWKX 3ZSLA 4SBVA 3LIGA 2LALA 4B8EA 5I93A 4PDWB 1AR71 1QXRA 2D3PA 3AMQA 1GNYA 3AKRA 4B7EA 1W2TA 3Q8CA 4HPKB 2H0VA 2RMU3 1X7NA 1LOEA 4HOOA 3S30A 3GHMA 3NV3A 3R4DB 1EPWA 4V1PA 5LA2A 1UXZA 2ZAHA 4Y4RA 5A7OA 5ACA2 1C4RA 1E5HA 1TE1B 3ACIA 3FMGA 3HVDA 4XJWA 4YM2A 1DIWA 3K3NA 1IZ3A 4P9JA 2UY8A 3DYMA 4CDXC 2FCTA 1RUH1 1VBE1 1W0OA 4IE0A 4CTEA 2WA4A 4IEZA 4OZXA 1Z7S1 2OW4A 1CESA 4WM8A 4D3WA 4CZSA 1XU2A 4AVSA 2VTXA 2OPKA 4A7YA 1RUNA 4LIUA 3FBMA 4LHSA 3VL8A 4Q4X3 1W8HA 2D5FA 3NVCA 2J7MA 3IPVB 4AI1A 1LAJA 3AC0A 5CFDA 1HXS3 3GJAA 1VBA1 3VBHC 3LD8A 4CP9A 3D3AA 1GWMA 4LO5B 5K4LA 4AQ2A 4AFDA 2ID4A 5FYTA 1JH5A 3KM5A 3TBDA 1ZRIA 4OI1A 5C33A 1RUJ1 1Y9GA 3OOXA 3B00A 5DG2A 2B45X 3D0JA 4UFHA 1VBB1 1H2KA 2OS2A 1AR83 1VJ2A 2JECA 4O61A 2QQOA 3VDDB 4DNYA 4IEOA 1KD7A 4XF1A 5JLVA 3I49A 2VOTA 4JKKA 5BNOB 2HWB2 3M8LA 2HWD2 4XDQA 4ASKA 4AXOA 2A6ZA 2HBTA 2B4KA 1JZ2A 3PDQA 3J8F3 3AKQA 1SQ4A 4AI8A 2VAUA 3L2HA 3N9MA 3MV11 3ETQA 2Z5WA 4AR2A 1UKGA 2WWJA 4JTOA 2P3JA 1WCKA 1WBLA 2XJVA 5C4WC 5FP8A 5GLWA 4MSVA 5H9RA 3S5QA 3AP7A 5A7QA 2BGOA 4BQ3A 1D2QA 1D4VB 3ME2A 4QXHA 5FPVA 3Q8AA 5B4XA 2RR11 2YC4A 4ATEA 4YM1A 3K51A 3I2OA 1LRHA 3SHRA 3N36A 2ILMA 1DGWX 2Q0AA 3AYAA 4GWMA 1S1AA 4NPMA 4FTEA 2BV4A 1MVQA 1WD3A 2CTVA 1QNYA 1DU3D 2PMWB 1ZZCA 1H4HA 3IB3A 4O65A 1H2MA 1H9PA 3JD73 3VKMA 3LOIA 1YIFA 1D2SA 1GSLA 1WW6A 4H55A 5F39A 1PO11 5J98B 2Y6KA 5APAA 1DHKB 4I3GA 3ZLIA 2ERFA 3FX3A 5IATA 2WFPA 1RGSA 4BOWA 4S2DA 5JSRA 1ZNPA 4HG6B 1LGNA 4EJRA 4EN9B 3WG4A 2I74A 4EQVA 4MGZE 2C5DA 1RUI3 2VU9A 5DMYA 4E2GA 3MZHA 3RZJA 2A7AA 1XBFA 4XJUA 3RMYA 4IEVA 3FC0A 2GN3A 5FFOC 4YWAA 1UZ0A 3VKNA 4HKWA
chains in the Genus database with same CATH topology
4GXLA 2JD4A 3SNMA 4EN8B 1G9FA 2XKOA 4AI2A 4BYYA 5FOJB 2A73B 3WDYA 1CX4A 5DUXA 4GH4A 1WW5A 3IKWA 3O0XA 1G9CA 1CAWB 3LCPA 4J1XA 1S0EA 1PO21 3G6JB 1MZEA 4PCRA 4IV1A 3VZKA 2BUKA 2D6NA 1ZRFA 1AX1A 1KDMA 2R042 1DBNA 2Z69A 4A2UA 4FOYA 5DDJ3 3ZIWA 1QQP2 2YDEA 2GALA 2RHPA 5FPZA 1H1MA 3O7OA 1TME3 3ROUA 1TQ5A 2XJSA 1QKQA 5FBZA 2CYFA 2OZ6A 2WQZC 2RS52 4WM8C 1GQHA 1ALYA 3KLSA 2RMU1 2KA3A 4FTSA 3IWZA 3WVJA 3AJZA 1SMVA 1MS4A 2A3WA 2CWMA 3ENRA 5CFDC 5K8SA 1HQWA 3WQ0A 5C6CA 4BM8A 1EPZA 1I5ZA 4LHNA 4HSLA 4Q8KA 3UK9A 4XXAA 3VHNA 4CDWA 1EAH3 1MZFA 3AZZA 3DKWA 1YHFA 4QT6A 3OPZA 4B4QA 4XZPA 3FBYA 1DGLA 2B5HA 4Q4X1 2XWJB 3KT4A 4KU7A 1HXS1 1PVC1 1NLRA 2E9QA 5AC92 1G8WA 2MNGA 5I91A 1LEMA 5I0TA 1PMIA 4RQPA 4B29A 2SLIA 4PIYA 2WZR3 4EN6B 1DQ6A 4XTMA 4IEUA 3AFGA 2XUMA 2RE9A 3VZJA 4ONUA 4YVWB 3M1HA 1A8DA 1I6XA 3MW4A 1H0BA 4AG4A 3RSJA 1LHOA 4MXWA 1UCXA 1JYCA 3R4UA 2RS13 3VZLA 1QHDA 3G7DA 2DFBA 4OI4A 1J58A 3OF1A 3AMPA 2I45A 1ND3A 1RUG2 3IDEA 3J8F1 4WVVA 2B9UA 2R063 1OPOA 3NSTA 5SV5A 4ASLA 4W6YA 5A3MA 1KITA 2BWAA 2Z79A 1YIPA 1F5FA 4MXWB 3C3VA 5JIAA 5FLHA 1PGW1 2LM3A 3OY8B 2B42B 1SBFA 1W6QA 4XBLA 1YFYA 2DUQA 1AYN2 4KWJA 1ND3B 2VW1A 1JTZX 1HRI3 1UN1A 2YZ4A 4ASMB 1O3QA 3ZSKA 3BODA 5FQ0A 5J09A 2VH9A 3MPPG 4XEZA 1XNDA 4DRRA 1RMU2 2VOVA 2ZGSA 2JG8C 4A7ZA 4QPIB 4MH0E 3VBFB 1W6QB 3RS6A 5F6LB 4TYSA 3QH6A 5T3NA 3S6PA 5DUUA 3SITA 4AEDA 3B5LB 1ZZBA 5JIUA 2Q4SA 5CB7A 3AXDA 3GZTB 1RUI1 2ZABA 2CGNA 2XBO2 4QGMA 3ZO0B 3M2MA 3MW2A 4GH4C 4QXKA 3ZYRA 1RIRA 3AB0A 2FMYA 5A33A 5CFCB 1H2NA 1LGBA 4AEDB 2IXHA 5AFEA 4GMP0 1AJKA 4MGYE 4IV1C 1QMJA 4GMP3 4FP2A 1QJY1 1RUF3 1KJLA 2IFWA 4YW2A 1K5MA 1V9U3 4BLIA 1AUYA 3RZZA 4WZFA 4Q4W3 2Q1MA 1FMD3 4PLOA 1BBT2 4E2QA 1UF2C 4F83A 1UIJA 1MEC2 2OIIA 5DDJ1 1W6PA 3J4UH 3WNXA 3R4SA 2P37A 1Q3EA 5J37A 4PJYA 2ZGMA 2PA7A 4TSVA 4CDWC 2RM23 1AR72 3BB6A 3SH3A 1BEV3 3E5UA 1FV2A 2ZBJA 2D6KA 2ET1A 3CLPA 4QQOA 3WZ1A 1DGRA 1OHFA 3AZWA 3SISA 2YUEA 4AQTA 5KHHA 1J3PA 3FJSA 3VBUB 1IS3A 3FE5A 2ZTNA 2GH8A 5JOXA 5FMOS 1POV3 3L9JT 1TEIA 4TWTA 1X33A 4RQPC 5GLZA 1Z7S2 1EAH1 2WLQA 1CGPA 2YGMA 1Q43A 3LSDA 3EJKA 4LR4A 4Z92B 2WT2A 4DINB 1PZ7A 1XYNA 3AYEA 1ZBA1 5GLUA 4LLFA 2DVBA 2JG9B 1ENRA 1O4ZA 3M3CA 1N1VA 4M3CF 2WZR1 1RINA 5HI0A 4QQPA 4FTBA 4YYOA 3WQ1A 4KGGA 4WVWA 3LZZA 4XHBA 1VBB2 1CAUB 1A78A 1S0JA 2ZHMA 4AHXA 1LU2A 4GWNA 3ZSMA 1ENXA 4DQAA 3VBSB 2R073 2RS11 3AM2A 5JPNB 2XL9A 3WOGA 4K1YA 1VB2A 5L73A 4XE9A 2VNOA 2R061 4XMAA 3S7EA 5IK5A 2DV9A 3IIAA 4NN0A 4NHLA 2XB6C 3AXEA 1WLCA 2EVXA 2GC2A 3WDTA 2AYHA 2GC1A 2NMNA 4Z1VA 4AF9A 1YWKA 1J1TA 2RR12 2LUWA 1HRI1 4INDA 3TAYA 1ULCA 3VLBB 2D6MA 3OCPA 2G9GA 3TN92 3CEWA 5BPXA 4EV0A 2VUAA 5A3LA 4G4FA 1DLLA 2PHWA 3LSEA 4X8NA 1QJX2 1V6MA 2XLFA 1PO12 2VOXA 3NO8A 1Q5OA 3M3QA 4D7SA 1ND2C 2LTNA 1GZWA 4IQPA 1QDCA 1COV2 4Y20A 3ZFEC 4LA2A 3OYWB 3DGTA 5T5JA 3KD4A 1K5MC 3MLKA 4Q4Y3 1RVF1 5LRSA 1HLCA 3V56A 3LGRA 1VAMA 1GZWB 4HFSA 1CN1A 1SFNA 3ZN6A 4UBGA 2VUJA 2DCTA 2OVUA 4B7KA 1A6CA 2P3KA 1H1AA 3HIFA 1D0HA 5IK7A 1MVEA 2DCZA 1RUF1 2HWF1 4CDQA 2PTMA 2W68A 4N43C 1BCXA 1V9U1 3AP9A 4NWWA 5BY5A 1LCLA 2GH2A 4FOQA 2NQYA 3GZAA 3ZN4A 2AENA 3U10A 4GIQA 4YZ4A 1PO22 3E97A 4Q4W1 1FMD1 4HBNA 4G9SB 3GYDA 5GM0A 1ZRDA 4IEPA 2QZ2A 4UW5A 4JQRA 4YG6A 5JOWA 1Z0HA 3LA2A 5C9AA 4JAAA 4RS5B 1ZYBA 2QDRA 2ETEA 3TWIA 2DVFA 4IV3A 2RM21 1MACA 2ZA9A 1BEV1 3GZUC 4OUMA 4BIOA 2R1DA 4XFHA 2RMU2 4CEYB 4KGQA 4WBBA 5F6KA 3ZIXA 3NW4A 2FZ1A 4D7TA 3QH7A 1CONA 1W39A 1AL0G 1X8EA 3AKPA 1POV1 4JCKA 3U07A 2TEPA 4QX5A 2WWSA 5FMOL 1SDWA 1DFQA 4Q29A 5JCTA 5FRAA 1HV1A 3GF6A 1UAIA 4HN0A 4Q4X2 4FPLA 1REFA 2R1BA 4MLOA 1HXS2 1PVC2 2CWSA 3UKTA 1NLSA 2GMMA 5DUVA 3RJRA 1X50A 5H9SA 1KFXL 1RUE2 2A71A 2BNOA 3ES1A 4P9WA 4W6XA 3VHOA 3JQWA 4E4ZA 1HIXA 1EYBA 3BTAA 4MXVA 3WXPA 1JHNA 2R0HA 3WDVA 1GNZA 3NWKA 3B02A 2W08A 1RB8G 4M3CA 4PF5A 1F5JA 4Z8BA 1UPIA 1PZ9A 5T5PA 2DYCA 2R071 3DPRA 4CDXB 4K20A 5KHGA 4XF4A 4XJZA 2HWE2 1UD1A 1N1SA 3R05A 4B4PA 3J8F2 1I1EA 2E7TA 2I2SA 1UZYA 2UYBA 5FDBA 4MV2A 3NAPA 2GNBA 4NPRA 5JZGA 4RR3A 2ZACA 2XVGA 3VBHB 1PGW2 1AL22 1U5YA 4NO4A 2Q1ZB 4BH9A 2JKBA 2A70A 2CV6A 5HCAA 1SLCA 1DGRN 2XVKA 3AP5A 5JDBA 4XQ4A 1FPN3 3LWCA 1FX5A 2D6OX 3MYXA 4BQ1A 2JXAA 1D4M3 5FCCA 3WD5A 2IXIA 2ZX4A 3H3ZA 5HBAA 3ZXEA 3WG1A 1MZ5A 4I02A 2XL7A 4Y1UA 1BQPA 3IDCB 4AEKA 3ZDSA 5EJ3A 1F9KA 1REDA 3D6EA 4XXPA 1AR63 1OFNA 4CDQC 4Y5Z0 2AUYA 2ZGOA 4Q4Y1 4P9LA 1B09A 2GSYA 2WIIB 5C4WB 1V6OA 1LJ7A 2A6YA 1LTEA 3J26N 1RHI3 1ZREA 3DV8A 3JZVA 2WNUA 2DU1A 3N4MA 2A6VA 5L36A 1QJY2 1Q8SA 2FBEA 3DN7A 2HJIA 1U0AA 5C9AC 1QNWA 2ZX2A 4M01A 1LGCA 2GU9A 3I7DA 3WP5A 5T55A 4CDUB 1Q8OA 1SLAA 4IV3C 1BMV1 1C8NA 2QUOA 3EBRA 3PNAA 1R1ZA 3A4UA 4XBQA 3KZ4C 4BZ4A 2E7QA 4C1XA 1NA1A 5JI9A 3FUOA 4W6WA 1GANA 1U5ZA 3UKVA 2FQPA 3SH5A 4CP2A 3MICA 4N7UA 3CU7A 5D8AA 1AX2A 1VB4A 2XHKA 4P9YA 2RS32 5CA6A 4LBQB 3BOWA 2A75A 3ZXGA 3P3PA 4ZXKA 2GNTA 1BKZA 3RYKA 2HWC1 3U0ZA 1C5HA 1N1YA 1M4WA 1LHNA 4Y1VA 4I30A 1NE6A 2H6BA 5T5LA 1AXKA 1I3HA 1ZM1A 3ZYGA 1TMF3 4Q0VA 4XJ8A 1DGWA 3MDPA 1W6MA 4L8QA 3FUQA 4FPEA 2VY0A 2V09A 4OFGA 3WW3A 2A6XA 1UPSA 3AX4A 2YPJA 1O4TA 1WMEA 1ZBA2 5EYXA 3USUA 1SLTA 4JC1A 2PAKA 1W6MB 2ATFA 3URFA 3DPRC 1HW5A 1RUD3 2W0XA 3EO6A 4Y1YA 3ST7A 2VW0A 3ATGA 4O9EA 1QOSA 4WM8B 3E6BA 4XF3A 1FYUA 4AK3A 4J6GA 2WINB 3USUB 4QHBA 1JN2P 4HN1A 1CAXA 2HEWF 2VVFA 4HZFA 3NAPC 5CFDB 5JZGC 4RR3C 4COZA 1G9BA 1NXMA 2ZGPA 2WSUA 4JDMA 2RS12 5GZDA 4IXLA 2JE9A 3MPBA 4JTNA 2IFRA 3UJOA 3M3EA 2G4IA 3VUOA 3USSA 1O5UA 2X29A 4XFBA 5F5QA 2D44A 3ZYIB 1AR92 1VAKA 3RDIA 4YZ2A 1FATA 4K40A 1NCRC 3O12A 3WINE 1ZBE1 1VBC3 2ZMKA 4LBLA 2Y26A 1AX0A 5I8YA 4S2HA 1FPN1 1WGPA 4Q0PA 2QE3A 4GALA 3UL2A 3WV6A 1HV0A 1PGL1 1AF9A 2O8QA 2WS93 3FFZA 2WL1A 3RQ0A 1UL9A 5IK8A 1D4M1 4GULA 4LUMA 2PHUA 2ZHLA 4Q4V3 1OD5A 2YV8A 4C0HA 5AFBA 3JU9A 1EV13 4HK8A 4CRQA 1PZ8A 4Y1ZA 2WNUC 1RUC3 1QDOA 1AR61 1YCIA 2VXRA 4TLFA 3H0OA 4JGYA 4C1WA 2ZZJA 1R1A1 1RVF2 2YYOA 2QDNA 1H9WA 3ZFFC 1V6KA 2JG8A 2PHLA 2GNDA 4KU8A 2ZGTA 2IWGB 1QGLA 4F3JA 5J3UA 3D4KA 1R093 1VRH3 1AYM2 1RHI1 2XJRA 2H6CA 1DZTA 4XFCA 2XWBB 3N7KA 4NOTA 5FLIA 3VBOC 1H4GA 3LOBA 2DVDA 4FOVA 2HWF2 1NA1C 2QCSB 3BPZA 2VW2A 4KQ7A 4R4ZA 5FPXA 1V9U2 4JGZA 1S55A 4P5HA 5J48A 5FO7B 5T52A 2JG8B 3ZX7A 1BXHA 1RUOA 4YARA 1ONAA 4BE3A 5D8AC 3B69A 1YFWA 4Y22A 3KCYA 4XW3A 4IEQA 2ZMLA 2VMHA 1PK6A 1X82A 1D0GA 3QD6A 1OQEA 2EXJA 3AZVA 2E53A 4SLIA 4Q0SA 4BWOA 4GH4B 2VQ0A 2E51A 4E4SA 5JR7B 2RM22 4LO6B 4Y22B 4AW7A 1BEV2 2IZWA 4E27A 1CVNA 1UX6A 1VALA 4YGDA 4IV1B 3N7JA 1FV3A 2IXKA 1HRV3 2VMGA 2I07B 4NVPA 1AHSA 4BPZA 2PHRA 1GZ9A 1TMF1 3D5OA 3OBRA 3A0NA 4KWKA 4R9BA 2WC2A 1J1LA 1CAVA 4YW1A 1C1LA 1U5XA 4FPHA 2BFUS 4AI3A 3RI8A 3T1LA 1OFSA 4A3XA 1B35A 2HKXA 1MS1A 3W58A 4YNIA 3KGLA 1O7FA 2V5YA 1RUD1 2RJLA 4PBOA 4MUVA 4CDWB 3HD8B 3ZPYA 4DMIA 5I0UA 5I8TA 4KNCA 4I2OA 2GDFA 4UW4A 4E9KA 5ACA3 3SCHA 2P2KA 5JVVA 2W52A 1AR81 4XFAA 2MHFA 2R30A 2DVGA 1OMIA 1WD4A 5T50A 3ZYJB 5DZEA 1R083 4RQPB 1O3RA 3VZOA 4IEWA 4R4XA 3WDUA 4R52A 2PFWA 3CJXA 4BLJA 1SEFA 4L99A 4YZ3A 1YI7A 4EN7B 3M3IA 1SCRA 1U12A 2XKPA 1VBC1 2GMPA 4F8AA 1LHWA 1SLIA 4CEWA 3RJ2X 4YGCA 2NPIA 3ZXJA 1S2KA 5EZWA 4AHYA 5DZGA 3QBQA 1S0DA 1AJOA 2PLV2 2WS91 4JGYC 3AKTA 2VULA 2HWB3 2HWD3 2PHXA 3QOPA 1EY2A 3ZFGA 1QJZA 5KXEA 1Q56A 4Q4V1 2VVDA 1QJU2 1H8VA 3JD71 1EV11 2B39A 2XJTA 1N47A 1RUC1 1IKQA 1AVBA 4ATFA 1WW7A 3TB0A 4LO8A 5E88A 5FQ0B 4OHZA 3QLQA 2EF6A 2NM1A 4JGZC 1LESA 1GICA 1XYPA 2GN7A 2X53S 4M00A 3ZXAC 5CADA 3CNAA 4FPKA 1J3RA 1R091 1VRH1 4RFT0 4AFMA 1IS5A 1OPMA 1ND2A 4WM7A 2BGCA 4HK9A 1FNZA 1F31A 3O0WA 3PMEA 1PK6C 4Z2WA 3JB8A 4FPYA 4YVSC 2MEV3 1UU5A 3ZFEA 1J3QA 4Z07A 3H1YA 5H9PA 3GBGA 3NV2A 3H9AA 3UKNA 1BMV2 4QPYA 5A33B 4DS0A 2RJKA 1ND2B 1ULDA 1REEA 5E1RA 1YRZA 2EIGA 4FXGB 3ZFEB 1WLWA 2Y0OA 2AR6A 1UU4A