5LEKA

The transcriptional regulator prfa-g145s mutant from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
total genus 70
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lekA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lekA01
3E6BA 4RB0A 1BJAA 2BBYA 2V1XA 1IN6A 3BPZA 2O03A 5E1ZB 3OTFA 1XGOA 2ET7A 2BNMA 5DCFA 1NE4A 5ILUA 3HSRA 1OPCA 4CYDA 3BP8A 3QPTA 1YYVA 2MC3A 3JAMZ 2Q8KA 1USTA 4N0BA 4O5VA 1EPZA 3OGJA 5FGMA 1W5SA 4BIFA 2L3DA 2JSCA 1F9NA 5H6QA 1QZZA 1TLHB 1O7FA 4L9JA 3Q5FA 4IEQA 4I09A 1YFXA 2QUFA 4AWXB 4I0BA 1LNWA 4L9VA 4CZZA 2HEOA 3WG9A 2ISZA 3H50A 5LHGA 3HT1A 3J80K 2XHKA 5J7MA 2GC2A 2EV6A 3LZZA 2QBYA 4QXKA 3GZ6A 2PQ8A 4M6YA 2EFPA 3PFIA 5LRSA 3KZZA 4A6EA 2CFXA 2PFWA 4IRGA 1TW2A 4EJWA 5H6RA 3H92A 5HI0A 4TV7A 5E18F 4LJZF 4HQMA 1YUDA 1ZRRA 1Z6TA 2IXLA 5BPIA 1DGRA 3PQKA 3DEUA 1IN5A 2PLYA 1R7JA 4JV4A 3KFWX 5BMZA 5DEQA 3TKYA 1UB9A 3HRTA 5A2QK 3HSEA 3BB6A 3RZZA 1Y9QA 2P5LC 2KKOA 3KGZA 3K1PA 3SQNA 3JSOA 1ZLKA 3I4PA 4OLLA 5FLHA 3E5QA 4MGYE 5KHJA 1H9GA 4PZJA 2UXNA 2D93A 3JTHA 4M9XA 3COAC 4JVAA 1YW7A 2PAEA 2JZYA 2P7VB 2A69F 1IF1A 5JR3A 4ESJA 1HW5A 5C6CA 4HW0A 2OPKA 4A0ZA 5D6FA 3WTTC 3WTWC 4KMFA 2P6SA 2PJPA 4TLFA 1GVJA 2M30A 3BZ6A 5ILSA 2QM3A 3F8NA 4OU0A 4HSJA 3U9GA 4EROA 2V79A 4ZU7A 2QQAA 1TQMA 5BQTA 4LLNA 2W57A 1TNSA 3CJXA 2K86A 1OD5A 3RNSA 4Q0SA 4JBAA 3KLNA 4E2QA 4ZYDA 1J59A 4OFGA 2RC4A 3K1NA 1DDNA 4YIFA 4OIRF 2Q2EA 1KA8A 2EJRA 3H8UA 2PMUA 4OINF 1HW1A 3SCGA 1RIOH 4HLYA 1RUOA 4L9TA 3R6SA 4WF2A 2XVCA 4M9SA 1H9TA 2JPBA 5CVVA 2IRFG 1KYWA 5CJ9A 4GGGA 3QAHA 3ES1A 1T2KA 3G3ZA 4BQAA 1BI3A 3GFIA 3ZQ7A 2IW5A 3C3WA 4QMAA 2K4JA 3I59B 3DKWA 2K0GA 2C0ZA 4OIPF 3ELNA 2A68F 4MUVA 2STWA 3LWFA 2P7CB 3SHRA 4P55A 3MZHA 4MGRA 2K02A 4HF2A 5BY5A 3FWEA 1WSUA 5EFUA 5DUIA 2QCSB 4RGSA 1REPC 2DBBA 1U12A 2HS5A 1W7PB 1K79A 2F4PA 4QM8A 5HDNA 4Q4ZF 2VE9A 1OYWA 1QXRA 3IRRA 5FD6A 2DQLA 4KA4A 4UBGA 3R60A 5H20A 2X0LA 3ZMTA 1MJ9A 3J7AO 4MGIE 4OIOF 2Y0OA 2AXLA 4L18B 2GA2A 2V1UA 5E8IA 4UVBA 4G7OF 4KMUX 4GXOA 1BI0A 5FDBA 2FXAA 5FLJA 2G7HA 3T0YA 2DCTA 5HLIA 3BY6A 2KIFA 5FLIA 4FX0A 5HS8A 2VOOA 1NHAA 4A0YA 1FBUA 1O5UA 1BM9A 3VB2A 3F23A 4LA2A 4RS8A 1R1TA 3DF8A 2XLAA 4GO1A 2XAHA 4IEOA 4KWLA 2R7FA 4WXCA 1Z05A 2QVOA 2ETHA 3FMRA 4RAZA 2FNPA 4KN7X 3HTUA 1UHMA 2VBWA 4I2OA 2B8MA 3I7DA 4EJUA 2Z5UA 3L7WA 4E2GA 3CUQB 3GFMA 5FPXA 1LB2A 2P6TA 1ZZCA 1J7KA 3I59A 1P4AA 2M8EA 4OOIA 3LA2A 4I3PA 2A3SA 1FC3A 5EEGA 2DPUA 1Q5OA 5FLXK 3RYKA 3U0ZA 2ZCWA 4G6QA 5JAXA 3HYIA 4U0WA 2GC1A 2XL7A 1XB4A 2RN7A 4UNOA 4HDVA 5K5OA 3FMSA 3SHFA 2OQGA 1W7PA 2ISYA 2HDCA 2DAOA 1U8RA 4HF0A 3W6JB 1HSJA 4HZFA 4YFNF 2NAZA 2OU2A 3DXJF 3K9TA 2OA4A 4Q0UA 2J5OA 5CYVA 1AOYA 3CJNA 1JHHA 4IETA 3OCPA 3EUHA 5J6XA 2FNAA 1XSDA 1GXPA 4IEUA 1GQGA 4MTEA 2F5CA 2HOEA 3CUQC 2ET1A 1KQ0A 4G6DA 1EY2A 2EA4A 2MH2A 3H1WA 3GO5A 5DD8A 1OKRA 1HQCA 4H0EA 1BI1A 1CAUB 4XSZF 1J3RA 4QGNA 3ELKA 4WXDA 2K7LA 1CAXA 3E6MA 1T0FA 1LJ9A 4A2UA 2VONA 2ESHA 5BPXA 5JSRA 3CUQA 2Y48A 4XFCA 4O9EA 2HTJA 1RTVA 5IT9Z 3LQRA 4U7DA 3E6CC 4HLXA 1YFYA 2N7GA 3O2PE 4AD9A 2STTA 2XASA 1TQPA 3W6KB 4KIGA 4XFGA 3QU6A 1A04A 3FFQA 2O61A 2GC3A 5FPZA 1SD6A 3NL1A 5HDGA 2WTEA 3DV8A 5FO5A 4RB2C 4M6XA 3R0AA 4EJTA 1R00A 1NYWA 1MDMB 4BYYA 3WODF 1IN7A 5D4RA 2G9WA 3WTUC 1UHWA 2CV6A 1TW3A 4HQEA 4OIQF 3PVBB 5L3FA 3HTSB 1ZRCA 2OA2A 3IIAA 1WLTA 4NQWA 3LAGA 2QWWA 4B8XA 5I8YA 3GEZA 5JHUA 1XN7A 4L9NA 1ZAOA 3KGLA 4EWAA 1LEAA 1R1VA 2FQPA 3F8MA 3KZYA 4M71A 1J5YA 3EQLF 3DPLC 4O3MA 3O3KA 4LGWA 3TQNA 1PUEE 3FE5A 5HDKA 2JRTA 3BCWA 2A6HF 1V4RA 2HQNA 1HW2A 2Y0MA 2K27A 1OFNA 3KSCA 1I6XA 5E8GA 3REOA 2ESNA 4ESFA 5HLGA 1OYIA 3L2HA 1YW9A 1RI7A 3WU0A 1BI2A 4ZYEA 1E17A 4MTDA 5J3UA 2PG4A 2FBHA 3H1YA 4E2SA 2UWMA 3MAJA 2MLKA 3LOIA 2ZMEB 2HWVA 4KL1A 2VT2A 3PNAA 1VR3A 2O8QA 1XRUA 3BJAA 1YTYA 1ZRFA 3U1DA 2RDPA 2VODA 4ZZLA 1UIKA 5E1RA 2IXKA 3GW2A 3NSTA 2H09A 4Q47A 3WW4A 2Q30A 1BOAA 1SFXA 3MQ0A 2Y75A 5FFXA 3BOQA 2DLLA 1ZG3A 1K6OA 3S2WA 4D7SA 4EM1A 3IDBB 4XFBA 3FM3A 4LK0F 3ZMSA 2P4WA 3D5LA 2Q0OA 3ES4A 5BUVA 3EQEA 2EFNA 1OI6A 1FP2A 2G7UA 3GVAA 1I1SA 4G7HF 1O3SA 3WU1B 3OF1A 1MD0A 2OQRA 4LB5A 1CF7B 1STZA 5KK1A 1FYKA 1Y3TA 2BNNA 4HX8A 4XF9A 4EMSA 3LAPA 3KP6A 4KYWA 5D5VB 1SEFA 1YFWA 2QDRA 3P9KA 1QQIA 2IVMA 4HSLA 1J58A 2B0LA 4KU8A 2A5YB 3UKTA 3WTYC 2B5HA 1FP1D 4HAMA 3V8KA 4G94A 2ZO4A 5ICCA 1J3PA 3AAFA 2Z3YA 1F4KA 4KWKA 2QYOA 2XGXA 4ZU4A 3WW2A 1YG2A 3UKVA 2ZKZA 2IPQX 3M70A 1P6RA 2CQKA 2M5WA 1EH8A 5T3NA 1Z7UA 4JTNA 4BHCA 1PDNC 4A5NA 2Z9OA 5AIQA 2ZMEA 4AVPA 2XKPA 4EJOA 1ZG1A 1BBYA 2C6YA 3ZPLA 1CAWA 4J1XA 1EH7A 1ON2A 1P4WA 1FLIA 4L5IA 2EA2A 2Z99A 1G3SA 1O3RA 4UV8A 1O3QA 2HR3A 2ZXJA 1S3JA 3E97A 6PAXA 1B4AA 1P92A 1QNTA 3G73A 4M72A 3B02A 1YWKA 4NVPA 3SZPA 5KVRA 3CLOA 4HA8A 2P5KA 5LGNA 2DU9A 4M74A 2J5PA 5L3DA 3F8CA 4YYOA 1IUYA 1TNTA 1L0OC 1RNLA 3HSFA 2ZFWA 1SFUA 3FF5A 5DYMA 2EFOA 4LLLA 1CF7A 4DQ2A 3N4MA 2EVXA 5L3CA 2I45A 3CUOA 1ZZ9A 3BJ6A 2CYYA 1H1MA 4B29A 3BWGA 2D1VA 2OZJA 4LFUA 3RPUA 1O5LA 4H7LA 1FPQA 1RC6A 4N9IA 4IF4A 1Q43A 2XLGA 5C8WA 4HMZA 4P9GA 1QO0D 1XDUA 5LHIA 1QZYA 4LULA 2FF4A 1I1GA 3QACA 1YFUA 3V8JA 4Q29A 3WW3A 1IPKA 1SQ4A 3E5UA 1T39A 4BHBA 4LG0A 3HOSA 3SFZA 3T1BA 1RL3A 4YG2F 3GFJA 1KU2A 3I54A 3TO7A 1AWCA 2NYXA 1O7LA 5EZWA 2IXJA 4Q0QA 5AONA 4RB3C 3HOTA 1QXJA 2PTMA 1X8EA 4IEVA 2WWYA 2KRFA 1G3WA 2HFHA 4LEJA 3WTSC 4FT8A 5LHHA 2KJCA 5BOXA 2YX7A 4WZCA 1LDKB 2VC0A 4KIFA 3SXYA 4LTAA 4EVIA 3V8LA 3F8FA 3PQJA 3ZP5A 3MFKA 2AS5F 1DUXC 3CDHA 4WX9A 2VBZA 3KLOA 2LF7A 4L0YB 2VC1A 5E17F 1XSVA 3BDDA 3KEOA 3U2RA 4HVOA 3EBRA 1W7PD 1XDSA 1P4XA 1F1ZA 5I0UA 3J80Z 2XUBA 1FSHA 2KIUA 3I58A 1FZPB 2FQ3A 4QX5A 3SXWA 2DK8A 2P5VA 1S7OA 1PM7A 3LFKA 5KBFA 1FOKA 3UKNA 1XGSA 3M7GA 5K8SA 3GUDA 4YRDA 3QU3A 1WWXA 1BC8C 2GXBA 3WGIA 1ZGJA 4Q0PA 1IXRC 3CLPA 5D5WB 2ATFA 5JSOA 3U11A 4HVRA 1GXQA 1IN4A 1KQ8A 5JSPA 5CVIA 2NNYA 4RGRA 3DQVC 4QGLA 5A2QZ 4J1WA 1ZG5A 3FM5A 4K2EA 3L00A 2HKOA 3SZTA 3MDPA 2IT0A 3IBMA 4HV6A 3C1DA 1ZRDA 3SCHA 3KMHA 2IXCA 4PIYA 1XD7A 4ZU5A 4LLGF 5J8FA 4R79A 4AXOA 1WA4A 1QPMA 1C0WA 2RNJA 2L02A 5KHGA 3I71A 4EV0A 1LKNA 4JQFA 2V6CA 4EGZA 2VECA 4CDGA 3F22A 3BJOA 1ON1A 2DFIA 1JUHA 2R7DA 4Y13A 2VT3A 5D6EA 3HRMA 4B09A 1MJAA 3IWFA 4R1HA 1DZRA 5DCMB 4AIJA 4HYEA 1R23A 4ENJA 3BPVA 1B6AA 4XF1A 5FQ0B 1FNNA 2GAUA 5DV5A 4U88A 3NRVA 4HOBA 5KHKA 2BE5F 2UY8A 1MJBA 1K7AA 5D5XB 2W84A 2FSWA 4HN1A 3QP6A 4GYGA 1EYBA 5E1WA 1R58A 3LA3A 5FCCA 5BXXA 4M9ZA 2GXGA 1YIOA 3LSTA 1CAXB 4MQVA 4L5JA 4GYIA 5EEHA 3NEUA 1IN8A 4EQQA 3FHZA 3MPBA 2FMYA 2FMLA 2RGVA 3TOAA 1UPIA 3WGGA 5ILVA 3HRUA 2PBIA 2IJLA 1H0MA 4IHSA 1XE7A 2LF8A 1SD5A 4ZH4F 4IEWA 4XF3A 4ESBA 4IJAA 3GFLA 3ZN1A 4CGZA 1YS7A 3FXQA 2DPDA 1J75A 4PIXA 2VPVA 1SD4A 1XGNA 3FMQA 3LQQA 3TNQA 1FI2A 1Q1HA 2QZ8A 2PA7A 2B9UA 2O3FA 1WI9A 2OBPA 2HJIA 1ZN2A 4WWCA 1JGSA 1ZGAA 4ENKA 5I91A 4O6JA 2LSOA 1G6NA 3QP5A 3GYHX 2RVCA 2YU3A 2W24A 4MGKE 5K1YA 3IKTA 1QY4A 2V1DA 5DCMA 2MNGA 4WVZA 1LQ1A 3ETQA 1FYMA 4K8FA 2TDXA 4LD5A 3ZMDA 2QENA 4I7HA 4ASNA 4QM9A 3NJZA 3L9FA 3M1EA 5FQ0A 1O3TA 4XFIA 3DN7A 4GCVA 2QJVA 4MQ9F 2UY9A 2BGCA 4P9FA 2XAQA 3MYXA 2GQQA 3IC7A 2YX4A 2MLGA 3VODA 1XCVA 2F5EA 3G7DA 2YSRA 4NB5A 4ETSA 1SFNA 4F8AA 4WXHA 2GIVA 2OZUA 2MHFA 4HVQA 2E9QA 2M1BA 4LA3A 2H94A 2K4BA 2XLFA 4ENMA 3J81K 1EP0A 5ERIA 4FBFA 4LUKA 4IEYA 3LWCA 1ZYRF 5CU1A 1VJ2A 1BIBA 3F6OA 3NW4A 1UIJA 3LA7A 4IRIA 1U5TB 1OR7A 2MPFA 5LRRA 5AIPA 2ETEA 4UXNA 5K5RA 3FZ3A 2K9ZA 1CGPA 3ABUA 1T6SA 1T98A 3WTZA 2MH9A 4L0ZB 5FLXZ 5HLHA 3QPHA 1IW7F 1TQ5A 4CHUA 3EHKA 3WE3A 2FRHA 2ZBKA 4IHTA 4PDKA 5LGTA 4IXAA 3IRQA 2UYAA 4KWJA 5D5UB 4AQ2A 1EH6A 1FBSA 1ZH5A 5I0RA 1LVAA 1XMKA 2FE3A 3CF6E 4PGGA 1UFMA 2PYTA 3MWMA 4CO8A 3N97A 4BHPA 4UUVA 1GHCA 3O6BB 3I5UA 4EM0B 4RGUA 4Q5SF 4KN4X 2V09A 2IC1A 5I0SA 1Q3EA 1KU3A 3CEWA 2Z2SB 1X3UA 2Z33A 1U5TC 2O6GE 4LUMA 1S8NA 3ZN0A 2EWNA 1Z6RA 5E20A 3DP7A 4D0PA 4XBFA 4FAHA 2HYFA 3RDIA 4A6DA 4KDPA 1D8JA 3KEQA 3VFZA 2RKHA 1D8KA 3JAMK 2EFWA 2CG4A 1CAWB 5JR7B 1XE8A 2D45A 1LR5A 4AVBA 5D8LB 2Q0AA 3WW1A 4L11A 1U5TA 4ENNA 4FHTA 1NE6A 4P9UA 3HQXA 3C18A 2HTSA 2IXHA 2COMA 5FFZA 3V7RA 2IA2A 4L2NA 5E16A 3D0SA 2GZWA 2PFBA 3R61A 4MEXF 2Q4SA 4EGYA 1BN5A 3ACLA 4YNIA 3GXOA 2F5DA 4OMYA 3TGNA 1HBXG 4ZZDA 1ZHFA 3QOPA 2HKXA 2A6EF 5ICGA 2IA0A 1RUNA 3VOEA 2R3SA 3ABTA 3KP5A 3L09A 2VBXA 3HUGA 2P8TA 5D1IA 4RB1A 1T38A 3FXRA 1CAVA 3P7NA 2DK5A 3I0TA 1IPJA 3L2CA 3M8FA 4XSXF 3KCCA 1SMTA 5CVUA 3DL3A 1KYZA 3OV8A 5JCTA 3BALA 3HIFA 2E1NA 4P5OA 1TBXA 5ED4A 3EYIA 2O8XA 2WV0A 4UHTA 4LG0B 3RYRA 1ZARA 2P17A 1YS6A 4MV2A 3RKXA 1TQIA 1YLFA 4S04A 4XFHA 3H3ZA 3BPXA 4A0XA 3PLQA 3EETA 1J1LA 4XF4A 1J0RA 4U0VA 3NVCA 2D5HA 3S7EA 4MH0E 1QGPA 2MA3A 2JT1A 5D8KB 4LMYA 3FZVA 4MEYF 2BNOA 3H9AA 2EAAA 4HDUA 2RQPA 3S0MA 1ZLJA 2FEZA 1HXDA 4QWQA 1UCRA 4RAYA 4BAYA 2XRNA 4AQ6A 2VOPA 4HX7A 2DW4A 3R0JA 3EJKA 4BNCA 4JK1X 1V3FA 4PCQA 2PAKA 4E70A 4R52A 1I27A 2F5FA 4OMZA 2QLZA 3RI4A 2XAJA 1S7AA 2A61A 3ISPA 1XMAA 4ONUA 4KICA 2OZ6A 5IT3A 1JHFA 2VQAA 1X8MA 4HV5A 4X6RB 3V7SA 2FOKA 3O14A 4BH9A 1YLLA 3HHGA 3D0JA 4XFFA 3IWZA 4GULA 1YFHA 2FU4A 3IDCB 2VBYA 5I8SA 5CVRA 3H1MA 2PHDA 2YPRA 3KP2A 3RJPA 1Z1DA 2X4HA 1IZ1A 2H6BA 5ICFA 3E6DA 3OD0A 1IXSB 1R5HA 5LEJA 4PJYA 1DGWA 2E7XA 3CO6C 5KHIA 2MD5A 3ECOA 1DPUA 3KETA 2W85A 3P9CA 3F72A 5F1RA 2GWRA 2MBFA 2XAGA 3BROA 3F6VA 3ROUA 2VN2A 1O57A 4YIIA 3M3IA 4KUMA 3MEXA 3BU7A 1OMIA 1CX4A 1FT9A 3MZYA 4LLOA 4HN0A 1JXSA 2ELHA 1U2WA 5I8TA 3B73A 1IXCA 5DDGA 1WGPA 1W4MA 1U3EM 5HVQC 2IA1A 2CO5A 1B9NA 5CADA 3CL1A 2LDUA 1U6GA 1PP8F 4X6QB 3F3XA 1VTNC 5TJJA 4AVAA 2CWEA 4I98B 1IRFA 4Q48A 4M73A 2QVSB 4EWEA 1R5GA 1XCBA 3S7IA 1X7NA 4ORFA 2A07F 4KU7A 3K1MA 1KGSA 3TDUC 1B59A 4IEZA 4NHJA 1ZZBA 4MZUA 4UVCA 2Q1ZB 3FXUA 4QLCU 2EB7A 1ZZ8A 3LAJA 1FSEA 1YQAA 5DUKA 4XEZA 5FB2A 4ON0A 2JTVA 1G3YA 1TTYA 1R1UA 4F7ZA 2QQ9A 5JI6A 5LLQA 3USSA 2L4AA 3DPTA 4Z07A 2CGPA 1EV7A 3RKWA 1L3LA 2HQRA 2DTRA 1J2XA 2FBKA 2D5FA 1L3JA 1K78B 2WFPA 3OOPA 2H27A 2ZKLA 3ZMUA 5HOOA 4KNYA 2F2EA 1DZTA 1W5TA 3SMHA 4LK1F 1GQHA 3TNPB 4IPAA 3ECHA 3M9AA 3MCZA 5FD5A 3F8BA 5BPDA 2L01A 5DD4A 4WK8F 1VP6A 1FX7A 3HHHA 3CTAA 4R8HA 4KIBA 2BEOA 4D7TA 3ML6A 1KU9A 2KJBA 3ST7A 1F5TA 4META 2CAUA 1B1BA 3VEPA 2M87A 1LDDA 4BXUA 2H6CA 4A5MA 1S29A 4N9HA 4I02A 3JW4A 3K69A 2XL9A 4ZYHA 2KXLA 3JTGA 2NRAC 4Q0VA 3Q9SA 4XLPF 1ZNPA 1WRJA 3WGHA 1IRGA 2LKPA 5TRDA 3T8TA 3HRSA 4DNCA 4Z2YA 5IT9K 3ULQB 3FX3A 1X82A 3GF2A 1DPRA 4YSFA 2W25A 5HS7A 2GU9A 3C7JA 1MZBA 3IHUA 2L54A 5LEKA 3P9IA 1QBJA 4RGXA 4WCGA 1YO5C 2LNBA 3TDZC 3WTXC 4O9GA 3ERED 1BIAA 1B9MA 1Y0UA 1I5ZA 2DQRA 2PQQA 1OYYA 4IRHA 4XLNF 2EV5A 1UCXA 1J3QA 2XV4S 4Z82A 1DP7P 2L4MA 2HYGD 2H0VA 2RV8A 1K78A 4HBLA 2EFQA 3NKTA 3T5XA 1MGTA 4AIHA 2NS0A 4MGZE 2CAVA 1HKQA 2D2WA 4LB6B 1NZCA 1USSA 2ADUA 2XROA 4IVNA 1NXMA 2OYZA 3GYDA 3QRFF 5BS6A 1JE8A 1V70A 4IEPA 4QGMA 2JPCA 4PGHA 2UZKA 1FYLA 5L3BA 4XFAA 1QWRA 3U10A 2WC2A 1RGSA 3I64A 1LEBA 3EDPA 4ZYGA 2IP2A 4U0YA 3WE2A 5BV6A 5LGUA 4DINB 3RTRA 1D5VA 4KT5C 1P2FA 5E1XA 2QNKA 3ZMZA 1ZVFA 3JZVA 5KHHA 1YW8A 5I0TA 3NQOA 4MHGA 4AVCA 1XSXA 4IESA 4EM2A 2PI0A 4UBHA 2PAMA 5JFRA 3KP4A 1LRHA 2UXXA 1HKSA 2DO7A 4YFKF 3V4GA 1G3TA 2CSOA 2EK5A 1KU7A 2EV0A 2IXIA 5K5QA 1ZZ7A 2GH2A 1PP7U 5ICEA 4I01A 1FBQA 3V7CA 3H7YA 3HT2A 3F21A 1FWZA 3CO2A 2NNNA 2OAZA 5J48A 3FJSA 4Y17A 3DFGA 3GX4X 3IKVA 1J9IA 2DI3A 3C3VA 2XAFA 1R36A 2QQBA 1YHFA 2BV6A 4UXAA 4IERA 3M8EA 2E7WA 1CAVB 2ZJ2A 3GZ5A 3RIRA 3ZDSA 1MKMA 5F64A 2VE8A 4HBNA 1ZZ6A 2EA7A 5J8CA 2O0YA 3EO6A 1HKTA 4I0AA 2HGCA 4CICA 4JTOA 3IL2A 4UVAA 4FAGA 3R4KA 3K2ZA 4G7ZF 5JVTA 1WQ2A 1D3YA 1H1IA 1UW8A 4AIKA 4PIZA 4A12A 2KIMA 2Z69A 3WTVC 1KQ9A 3EYYA 3E5XA 3I53A 1BC7C 2D40A 4EWDA 3TO9A 1ONVA 1ZX5A 2D1HA 3GWZA 1FXZA 2GA1A 4G9YA 3KE2A 2FA5A 2OD5A 3VHRA 1U78A 2PHLA 3E3VA 1G4DA 3SCFA 2PEXA 3RKYA 2VXZA 5I93A 2M45A 5AVPA 2CW0F 1CAUA 2V9VA 3TO6A 3D82A 4YARA 3J81Z 2YR2A 3KP3A 4XETA 1SAXA 5CVJA 2FBIA 3CO7C 2E1CA 2DT5A 1RZ4A 3ZMVA 3H7JA 5D4SA 3K0LA 1ODDA 3TOBA 5HS9A 4XF0A 4EJVA 1PMIA 4G8XA 4S05A 1WKMA 4Y15A 4HLTA 1FY7A 3H3UA 2PN6A 1E2XA 1LDJA 4KFCA 2GC0A 2UYBA 4XRFA 2HZTA 5CLSA 1HSTA 5F6FA 1MDMA 2QBYB 4HF1A 1S6LA 4U7BA 4MNUA 3KP7A 2BYVE 3RPQA 2XKOA 2PMHA 5LBQA 1O4TA 4MX3A 1R22A 2XIGA 4IEXA 4HX4A 1SD7A 3Q9VA 3FHIB 1SFEA 3RYPA 2ACJA 2O1QA 1XGMA 1Z9CA 1Z91A 3GBFA 2ZNYA 4UV9A 4YFXF 4WBBA 1ZREA 1IAWA 4RD7A 1ULYA 5L3EA 3GLXA 3JSPA 5L3GA 4FX4A 1UD1A 1SMYF 4P96A 3T8RA 2ZNZA 4CXFA
chains in the Genus database with same CATH superfamily
4RB0A 1PZ9A 4QB1A 3HR9A 4CCKA 1H30A 4PDWC 3F0CA 2BRTA 3V0AA 4GMP1 4QPGC 4LQRA 1USTA 5K9YA 1L7RA 4IL7A 1EPZA 2HWD2 5KXEA 2E5ZA 3SDGA 4XIKA 3WXPA 1I3HA 3MICA 1TLHB 1O7FA 5J3LA 3ZFGA 4YGBA 3OJBA 4AWXB 4CYCA 2OJED 4A3IJ 4BPZA 3AP7A 2VPRA 3ZR6A 2GM4A 5FYHA 4OCTA 3HVDA 1GYKA 3T30A 2QBYA 1HB1A 3GZ6A 2D6KA 2DCKA 2RR12 5C3SA 2NYYA 2X6WA 3PFIA 3ME2A 5FO7B 2HWB1 3BVCA 4NROA 5IAVA 3RJ2X 1O8SA 4ES8A 1E3OC 2DFFA 4TV7A 5CKTA 3G1LA 1I1EA 4UB6C 1O6UA 5A6ZA 2VKDA 3BQYA 4XRMA 2MEV1 1IN5A 1CIYA 4PFPA 4PJLA 5HXVA 2WZR1 1LKXA 3TKYA 1UZWA 3HSEA 1AR91 1NA1C 3NWKA 5BNGA 3KS7A 1GKBA 4YGDA 4A69C 1DGRN 2ELKA 3L2VA 2F4IA 1YQCA 3MKWB 2RHPA 3CJIB 2ZKNA 3PUAA 3JTHA 4NHYA 3CP8A 2JZYA 3PUQA 4IOCF 2UWBA 1SCSA 5GTIC 2Z42A 2IUWA 4A0ZA 3BTIA 2LR8A 1XSRA 4KMFA 2P6SA 4CUGA 4XDOA 2PJPA 1HJGA 3BZ6A 4L99A 2QM3A 4OU0A 3A0NA 2R7VA 2EXIA 4BQ4A 2XF6A 2B39A 4DMIA 5JXGA 2CV2A 3CJXA 2VZOA 1TL8A 1SDDB 1RJ7A 1WZ2A 1FMVA 4LOCA 1J59A 3SLIA 5IP9J 4MGTA 3UGHA 1JYWA 1DGRM 1HW1A 1ETVA 4HANA 2VQCA 2JPBA 2V4AA 5CVVA 2IRFG 3CMAI 1KYWA 5CJ9A 2UUZA 3ES1A 4P9YA 1T2KA 5SV5A 4GFBA 3Q8BA 4UFLA 2HWE2 2FD5A 4ZDPA 5DUUA 3ZQ7A 3BR3A 1W90A 3BR0A 1W9YA 1TMF1 2C0ZA 3DTIA 3U37A 2P5BA 3VKLA 4OHVA 2EZLA 2A68F 1W0UA 1MZEA 4QQ2A 5JLVA 2P7CB 3SHRA 4CRQA 2NS8A 3IP4B 4HF2A 1U5IA 2R073 5DUIA 4RGSA 1U12A 4XXPA 3WX5A 2DYCA 4E8DA 3WDVA 2F4PA 2WY7Q 5HDNA 1AJOA 2BP6A 3SH5A 5FD6A 4OI1A 3D5SC 4BJ6C 1PVC1 5FJ8J 1MZ6A 4LHNA 4OIOF 1WJAA 4XZUG 5LFAA 2QSGX 4WZFA 1RC9A 4GXOA 5LZ6A 3S1MJ 2FXAA 5FLJA 3T0YA 3BY6A 1YX3A 5FLIA 2ZS6B 2VOOA 1I39A 4A0YA 2ZOEB 1BM9A 3GZTB 4L9BA 1OKQA 2XLAA 4K7JA 3UGGA 1VQLI 2VASA 3GALA 4WXCA 3H36A 3IH3A 3AZVA 2FNPA 1JYTA 2DA1A 5FZKA 4Y3OA 1VAKA 4QXHA 1V5EA 1LJ7A 2VBWA 4AAXA 5T54A 2Z5UA 3CUQB 3Q0WA 2A6VA 4RR3B 3WQ0A 3GHMA 5J4YA 4OOIA 3LA2A 4I3PA 1ZQ3P 3NJXA 1AKHB 2Y9YA 1ND2C 1FC3A 3AP4A 1OQ1A 4U0WA 2GC1A 3AMQA 4OI0A 2RN7A 2IGMA 1AR81 2YFZA 4HDVA 1MBJA 1I50J 4YLZA 4YZ1A 1HSJA 4YFNF 2XVLA 3ABKH 3DXJF 3O0XA 4NQWB 5GZFA 4YVSB 1JHHA 4IETA 4WM7A 2PHWA 3HEIA 2M2EA 2YC4A 2DA6A 3EUAA 4IEUA 5FK8A 4Q4W2 1EY2A 4AG4A 2LD5A 3HN1A 5JOXA 3AKTA 2DOFA 2JEMA 1KJLA 3H1WA 5DD8A 1HQCA 3K4JA 4PFOA 4XSZF 1YXWA 1PO22 3WDUA 4Y1YA 3K10A 1X3WB 3NV3A 2HWC1 2VONA 2RM21 5BNQA 3CUQA 1W8UA 4COWA 1A6IA 1WH5A 4RR3A 4M3CF 4GWJA 3GTPJ 3M1HA 4LO5B 2VMHA 4U7DA 3E6CC 4HLXA 4AYBA 3VSLA 1AKHA 2J1AA 4IUGA 1QJY1 2XASA 1PM4A 4XFGA 5A33A 1R4NB 2O61A 5A1LA 2DJNA 4Q4V3 3NL1A 2ZPXA 1W6MB 1G9DA 2VJXA 4V2FA 2EXKA 4NHMA 1MDMB 4BYYA 5D4RA 2XAUA 2X8KA 1C5HA 4OIQF 4QTRA 3HTSB 2OA2A 3IIAA 4NQWA 1E5IA 4IV3C 2VUCA 1XN7A 3J7HA 4YVSA 3CCJI 1GNYA 1US2A 1QJU3 2XB6C 1UY3A 4AEMA 1J5YA 1MVEA 3DPLC 2ZGNA 4DEVA 3FE5A 4QDSA 1FATA 5DDJ3 4M4RA 1AR71 1MMSA 2A6HF 2HQNA 2OX0A 1HW2A 2CUZA 3WNNA 1F5FA 4RN5A 2ESNA 1R083 4ESFA 3L2HA 3V0BB 4XOPA 1SMVA 1U5ZA 1E17A 2ICWG 4MTDA 3AYDA 4ASKA 2PG4A 1RMU1 3H1YA 3AM2A 2WNUB 5FRMA 2ZMEB 2HWVA 4V2WA 2VT2A 3PNAA 2J42A 2O8QA 1XRUA 4Y1XA 1ZRFA 4ZZLA 1UIKA 5E1RA 5E8AA 2AC1A 1HRV3 3GCXA 3MQ0A 2Y75A 1MR5A 4BK4A 2NLRA 2X85A 1W6MA 5FLMJ 2BVVA 1Y7BA 1UOGA 4GKYA 1Z7LA 1PX4A 4XFBA 4LK0F 3ZMSA 4UW6A 2GBYA 2XMLA 4BDZA 1NAEA 3ES4A 3BOWA 3V65A 3I4NJ 5LA0A 1OI6A 1Y43B 2D3SA 5LCWL 1R1A1 5FK7A 4GAZA 3NNMA 1I1SA 3OF1A 1YI2I 1MD0A 1CQ9A 4XACA 4LB5A 3A22A 1STZA 5KK1A 1FYKA 2BNNA 3ZYGA 3KP6A 3ZSEA 1K5JA 3VKFC 5M5XJ 2QKMB 1DQ1A 4OAZA 4R4ZA 5DZEA 1HRI1 4IW3A 4KU8A 3DU5A 3OYLA 2R4GA 1M4WA 4R4XA 3ZFGC 1QPIA 5IHRA 4PSXA 1QJX3 1YI7A 4PJNA 4XHBA 1C8NA 2DVGA 1A8MA 2ZKZA 2IPQX 2M5WA 4B1MA 1EH8A 1VRH3 1BL0A 5HNFA 1PIV2 2XBO1 2WNUA 2LK2A 1PDNC 1WD4A 3K51A 5AIQA 2ZMEA 4AVPA 2HWF1 5K0UB 2C6YA 1JU3A 1D0YA 3RZMA 4DEQA 3TEYA 2EA2A 2Z99A 1OUSA 3GTGJ 4B44A 5EP9A 4Q4Y1 1O3RA 4UV8A 1O3QA 2HR3A 1LEMA 2ZXJA 2XJQA 1P92A 1ENQA 4FTBA 4M72A 4R9CA 5E79C 1YWKA 3SZPA 5KVRA 2GMEA 1P7IA 2OUJA 2DU9A 1IDZA 3A4UA 4P5YA 2HOAA 1K61A 3HSFA 3FF5A 2FDKA 1RUI1 1H2LA 2WT1A 5LA9A 2XJRA 3FN9A 5IATA 5L3CA 1V5FA 3CUOA 3I8TA 3Q0VA 4MFEA 5H9QA 2KHMA 1SLTA 2X05A 2D1VA 3HZJA 1IOAA 5FOJB 4IV1B 1XU1A 2X48A 4PI2A 4LR4A 1YFUA 2Y0IA 2DU0A 5H9PA 1T39A 4YPJA 4KG0A 4Z92B 4XUNA 1D1AA 1A35A 4NO4A 4YG2F 4YGEA 3TO7A 3U75A 1UOFA 3BT9A 2DVDA 3TEDA 2IXJA 4CPBA 2LTPA 5AONA 3AK0A 2JQ7A 1XJAA 3CLQA 2C9AA 4ZPIA 4C1XA 2DBIA 2KZVA 2HFHA 3OS0A 2R7SA 1JZ4A 5GAHJ 2HVQA 2KJCA 3X29B 2RDNA 2VC0A 1UYXA 2ZMKA 4WV8A 2ZGQA 2ZAHA 4HRIA 4PLMA 4ABZA 1MBEA 1NQDA 1CIWA 4L0YB 4OUSA 4DQAA 1EUUA 3HOYJ 1VQ9I 2XJVA 3K4CA 3KEOA 3U2RA 2BY1A 3PUFA 4LBJA 4Y24A 3J80Z 5GM0A 5ERLA 2YU1A 1FSHA 4LIUA 4OULA 1FZPB 3X2QH 3ZQLA 1X33A 4UI9L 2UWCA 2Q8OA 1XNBA 2P5VA 2X5IB 5KBFA 2HDWA 2HNHA 1ZR4A 1ZM1A 2HWB2 2DA3A 4LE4A 1W3VA 3ACGA 4H55A 3K7AJ 1OISA 3V42A 4TSVA 4YRDA 3QU3A 4IV1A 5DABA 2CGNA 3WGIA 1QGLA 1V6MA 4FCAA 3CLPA 2MEV2 4B7KA 5EXOA 1Q8VA 3HN3A 1VZ0A 2WZR2 5CVIA 1YE9A 1D4M1 1AR92 4J1WA 1ZG5A 3FM5A 4HKLA 3CD6I 3H9GA 2HKOA 3ATGA 3KCYA 1IKQA 3MDPA 1LOFA 2X1CA 5C3RA 4C0BA 4YM1A 2VQTA 2IGKA 2WQ4A 3C7GA 2Y26A 3KMHA 2IXCA 2VQ0A 1XD7A 4LLGF 5J8FA 2SLIA 1C0WA 3IH4A 5KHGA 4EV0A 2RJKA 2ZGLA 1LKNA 2VECA 5FRAA 5D8AB 2R7DA 1Z0HA 3VBUA 5D6EA 4B09A 2B63J 1MJAA 2F6CA 4R1HA 4XM3A 4YEJA 2JA2A 1S7EA 1DCSA 1R23A 4E7LA 5FZCA 1RUG3 4R9DA 5EGOB 4ISQA 2PMZN 4U88A 4D1QA 4XJAA 3U1KA 3J7NA 2BE5F 1K7AA 5D5XB 4PF5A 2EIMH 4GYGA 4FQZA 4KGQA 2X5IA 2RNGA 1UHSA 1SFOJ 5BXXA 1SLLA 1CZTA 2XGCA 4B43A 1S0EA 5FMOS 1IRZA 3NEUA 2WO2A 3BG3A 4QQHA 1ULEA 4N4NB 1HV0A 3WGGA 5FZ7A 2RR13 1H0MA 4YW2A 4IHSA 3VZNA 1EAH1 1X50A 4XW3A 1S2KA 1XTAA 2V9KA 4WM7C 1TMF2 5BNNB 2KFDA 2QQMA 3K4NA 1ERDA 4CGZA 2EH3A 1GLNA 1J75A 1AL21 4PIXA 2BBVA 2JX9A 2RAEA 5HCBA 3FMQA 4H4KC 4XZPA 4II3A 2NP0A 2B9UA 3AKQA 2O3FA 3I4IA 2JG8A 3JD71 4WWCA 5EYRA 4BK5A 2DFEA 4ENKA 5D8AA 1XPXA 2WAEA 3ILRA 5I91A 1U5YA 2LSOA 1G6NA 3CZJA 2YU3A 1NK2P 3CCUI 1PVC2 3ZXJA 1UZCA 3WHUA 2M8GX 4K8FA 2QENA 4RA2A 4C2UA 3VDAA 3W9AA 2X53S 4XFIA 5K7HA 1QF3A 2JECA 5D2AA 4RR3C 4MQ9F 4P9FA 2XAQA 3IC7A 2YX4A 1W8ZA 2MLGA 3VODA 4EATA 4NIDA 2ECCA 4QXCA 1W6OB 2E9QA 3B3QE 4FCYA 3K70C 2F6BA 2H94A 1WA6X 2XLFA 3J81K 2HQ5A 1H9PA 2HDDA 5GZGA 4O65A 3PUBA 4NC7A 3LA7A 1QVUA 1U5TB 1F8VA 5AIPA 2PX9A 4QDQA 1SVLA 2ETEA 1F4AA 5BNNA 2GN7A 3ZGKA 5K5RA 1CGPA 4AFMA 1OCRH 5GZCA 3VKMA 2WJSA 3EHKA 2QF7A 1HCRA 2ZBKA 2Y38A 3BQZA 1AR82 4BQNA 3BG6A 2UYAA 1H8VA 5J1YA 1EF4A 2WS91 2HWE3 5D5UB 1EH6A 3I3QA 4II2A 3OIOA 2ARXA 1LVAA 2FE3A 4GDFA 1PZ7A 3I3MA 3MWMA 4P9XA 3LOCA 4YW6A 4FTHA 3PJYA 4IGOA 2PELA 5C4XJ 3GDBA 4BE3A 1YIPA 4LT5A 5I0SA 1UY0A 1X3UA 2Z33A 2PLV1 4Y4YA 3ZIXA 1GQPA 3U21A 1W6OA 1WUVA 5E20A 3JB8A 2EZIA 3IAPA 3CCSI 1SZBA 2HYFA 1E5RA 3RDIA 5CEHA 2QEXI 4QX1A 2RKHA 3K4ZA 1GOHA 1BVVA 1W03A 3JAMK 1S0BA 4XBQA 3PM1A 4K3UA 2HWC2 1XE8A 5IP6A 2RM22 5D8LB 1HXS3 1LODA 2R061 3VZOA 1U5TA 4FHTA 2BU9A 1QH7A 2VZPA 2DVBA 1JZ8A 1G86A 3HQXA 4QX0A 3I9V2 1NXD1 2HTSA 3LKJA 2BOLA 5FFZA 2IA2A 5F6KA 1QJY2 1JBCA 3IPVB 2B9SA 5JZGA 4EGYA 3OOXA 2Q8CA 3ACLA 4YNIA 2F5DA 3IKWA 4OMYA 4XOGA 5FZ0A 4YZ5A 2R93J 4C3IJ 2IA0A 2R3SA 3FXKA 4UFJA 3L09A 4RM2A 4GH4C 2V4VA 4FE4A 2E2JJ 4LO8A 5GLUA 1X1PA 3P7NA 2DK5A 2ZEZA 3M8FA 4XSXF 1JI8A 2WL1A 2KM2A 3ZXLA 5JCTA 1K4TA 1MBKA 3AC0A 4AHZA 1TBXA 3KF5A 2XDVA 5ED4A 3POGA 4N53C 2OC6A 1HQWA 2O8XA 2WV0A 3O1SA 5F5IA 2H8WA 3KM5A 1AR72 3ZFFA 2VZ1A 1W28A 3VPRA 4S04A 4DXZA 1ZR2A 3J7MA 3K77A 1MS4A 3PLQA 5BNPA 4LJHA 1U0JA 3NVCA 5K4LA 4MLOA 1RMU2 2GH8A 5CFDA 4MEYF 4BY1J 2BNOA 1V9U1 2EAAA 5J98B 1O4XA 2BJSA 1PNFA 1POV0 3MO4A 3IPVA 1NG7A 3H5RA 3V56A 2R7WA 1DQUA 5IOZA 4BAYA 2XRNA 1B8IB 5J4VA 2K9MA 3EJKA 3SISA 3INAA 1G8WA 5FOBB 1W2NA 3LIGA 2OV7A 1IO2A 3A0BC 1R1A2 2XAJA 2DVAA 2DCEA 3LL7A 4DGWB 4K9SA 1U5XA 3WHCA 4HV5A 3AL5A 1WFXA 2P3IA 4X6RB 3V7SA 1H8AC 2FU4A 1HRI2 2WAQA 1IDYA 1IZ3A 3RG0A 3KP2A 3RJPA 2FDFA 1PGL1 2FX0A 2YFUA 2H6BA 5JLWA 5FLVA 5F0FA 1Z67A 1IXSB 4PBOA 3RQ0A 2MD5A 2P3YA 2XBO2 2W85A 2CQQA 2W68A 3WZ1A 2HWF2 4D0QA 4YRVA 2L0KA 3F6VA 1QH6A 5ACA1 4RGKA 1ZYBA 2C1FA 1Z7S1 2W92A 2NMOA 3M3IA 3MEXA 1N3QA 2I5UA 4AVSA 2ILMA 2KR2A 3BTAA 2E6VA 2WY8Q 4Q4Y2 1VMFA 2VUJA 3B73A 1IXCA 3KT1A 3FBYA 1B8IA 2YZ4A 1LE8B 5J1UA 2WSVA 5KWRA 4XQWA 5CADA 2LW8A 1S0GA 3MLJA 4QKFA 2KQRA 1W9TA 2H1KA 1VTNC 5TJJA 4DO0A 1RUI2 3BCAA 3AL6A 4Q48A 3WEZA 1LOFC 2P81A 1WCMJ 2YU9J 4Y22A 4UW5A 3ESWB 1W3XA 4C90A 1K12A 1YJKA 4NHJA 4BJTA 1ZZBA 2PHFA 4MZUA 2HOTA 4Y52J 4UVCA 4A41A 3WV6A 3VBUC 1LOBA 1ZZ8A 3LAJA 4ATFA 3RSNA 3BG9A 2A73B 4NDLA 4YW4A 5FB2A 4U36A 1Y9MA 4ON0A 2VJIA 5JI6A 2NMNA 4BISA 2AEYA 3DPTA 2CGPA 2DDUA 1L3LA 2HQRA 2DTRA 1ETOA 2FBKA 2D5FA 2PMZA 3OUIA 1PYVA 4XLCA 1LTEA 2ZJQF 1K78B 1GNHA 3OOPA 1W2UA 3ZMUA 3FBMA 2F2EA 1DZTA 3K70D 3O0VA 4Y7NJ 1GQHA 3OBAA 2D44A 2E2HJ 3SKVA 3ECHA 4AGGA 3M9AA 4LOTA 3DGTA 3F8BA 4TXWA 4QHBA 2IGOA 1LE8A 5KNLA 3WP4A 3HHHA 2VJ5A 4XC9A 2MFZA 4R8HA 1DQ6A 5H9SA 5LBCA 3RWNA 5A3LA 2XG3A 4KIBA 4DYRA 3OYMA 2KJBA 1JOPA 2XVKA 3TOJA 3VEPA 5L9BA 1E0EA 4G12A 3OY9A 2H6CA 4YZ4A 4I02A 3PVNA 2AENA 5A3PA 2LROA 2D5VA 4F91B 4BWOA 3HOVJ 3OL3A 1V00A 5TRDA 3T8TA 1DQ0A 4DNCA 4Z2YA 5IT9K 3DEWA 2K3FA 1GBGA 2JG8C 4QPWA 4E6KG 5D21A 1DPRA 2JWPA 4YM3A 3WHBA 5FZHA 3QPLA 2B46X 3EUKL 1T6GC 4QQOA 1GZCA 2TBVA 1EV13 1LNSA 4CXYA 5IVCA 1Y0UA 1I5ZA 4XUQA 2PQQA 4RM3A 1ETKA 2VR4A 4Z82A 1WJ5A 4XCAA 3HJEA 2CTVA 1AYM1 1K78A 2FJ1A 2EFQA 2CV1A 2QE3A 2A75A 1NZIA 4D7MA 4GJZA 1OLME 1WMDA 2CAVA 1FX5A 4LK7A 5K7ZA 2ECBA 1JE8A 1V70A 4IEPA 3I3EA 2UZKA 1YQ8A 4CDWB 2CYFA 1FV3A 2IS1A 1QWRA 2JA5J 1MH3A 3I64A 3UETA 4GMP3 3DKXA 1MBGA 2BVLA 1FYUA 2K9SA 3RI8A 4DINB 1SLBA 2G4IA 3W2WA 2QNKA 2VZVA 3OYEA 2ZAAA 5KHHA 3NAPB 4IE6A 3VKOA 2VCCA 4IQPA 1COV1 3U14A 5J40A 3P5JA 2ID3A 2PI0A 3FLRA 2B7EA 2VTFA 3KHBA 4CUAA 2WT0A 4HETA 4BY7J 2W4SA 2O14A 2VW1A 1OUXA 1B09A 2DO7A 3EMRA 1JZ6A 4JKKA 2CSOA 2EK5A 1PGW1 1N3PA 2M4KA 1UO9A 3H9JA 3SEPA 1EAH2 2J7MA 1ETWA 3PDQA 3OYNA 5J37A 3IDEA 3BR2A 3H0GJ 5I0DA 2NNNA 2ZHMA 3FJSA 4Y17A 3DFGA 3GX4X 1AL22 1KJRA 3WNMA 4DUVA 2MEV3 3C3VA 3H5NA 3HBKA 2CQXA 1RYYA 4IERA 2E35A 3WG4A 3MD2A 3JD72 3GZ5A 3T0AA 1ZZ6A 2EA7A 4M3EA 1HB2A 3K3OA 3WNOA 3IL2A 5FY7A 4BZ4A 3AMHA 3QYFA 1F15A 5JXIA 1OF3A 4G7ZF 2VVEA 4CDWA 1WQ2A 3OMYA 4AIKA 1IGNA 4PIZA 4IQJA 4COUA 3WTVC 3KYDB 1KQ9A 3EYYA 1T8IA 3AVSA 2FHRA 4EWDA 2JE9A 3TO9A 4JRLA 2X10A 2D1HA 2G0EA 3GWZA 1FXZA 3AX4A 3KE2A 2Y2ZA 3TEZA 2OD5A 3NAPA 2PHLA 5JZGC 3CCMI 2J1RA 5I93A 2W9XA 2ADDA 4HL0A 2ZEXA 3D82A 1RUE3 2ZGOA 4YARA 4LKFA 1QRYA 4FETA 1SAXA 5CVJA 1O8PA 2VMDA 3KEYA 4XE9A 4XXAA 1JZ3A 4EEFG 1JKOC 2W1UA 1Z3YA 1S0DA 1PMIA 2RDSA 4S05A 4E7ZA 4QPQA 2O8KA 2BDRA 2VCAA 4FPYA 4KFCA 2GC0A 3S3OA 4QQLA 2UYBA 4UFKA 5HXMA 3ZFFC 4JKLA 2WA3A 5FJKA 1OCZH 1S6LA 1OOPB 2WS92 3T2PA 2K9LA 2CY6A 2VU9A 5BNPC 4DYCA 3K4KA 3UK9A 2CQ7A 4TN7A 4BE2A 3UR3C 3BG5A 5CFDC 5C5TA 5F0HA 3DCFA 5A6YA 1TWHJ 2Y9ZA 1QZEA 2PLV2 5CFCC 2ZEWA 1W99A 2E1MB 2O03A 1PVC3 1XNKA 3HBLA 2ET7A 3FXMA 4SLIA 1XC6A 3MW2A 5ILUA 3HSRA 2VIXA 4CDXB 3BP8A 1YYVA 3CZUA 2WLQA 2L3DA 2JSCA 4Y33A 5H6QA 2R062 1QZZA 3LSGA 4L9JA 1BR1A 3Q5FA 2JDUA 1HQNA 2XWJB 4UY8I 1RUD1 1HDPA 3H50A 3QBQA 4LHKA 5LHGA 3CNAA 2XHKA 4AVZA 3O8GA 1CESA 3HPGA 3S1QJ 2GC2A 5JIAA 3VBOA 1S1AA 3OGVA 3AXEA 1OOPA 3N9MA 1DHKB 1WLCA 2YGLA 2OQ7A 1US3A 2PFWA 4IRGA 4QX7A 3H8RA 3H92A 5A32A 4AI2A 1YUDA 3CCYA 2IXLA 2QGUA 3PQKA 5L9RA 2PLYA 1NOVA 3GJAA 1NUKA 5BMZA 5DEQA 5A2QK 1CZSA 1TZOA 2ZX2A 3RZZA 1Y9QA 2P5LC 2KKOA 3KGZA 5IYCJ 3I4PA 5FLHA 1H9GA 4PZJA 5DAPA 2L9VA 4CDXA 3BTCA 3COAC 4JVAA 1YW7A 2PAEA 1YCIA 2X6OA 3SH4A 2A69F 1IF1A 5JR3A 4J19A 2VTXJ 2ZACA 2RMU1 5C6CA 4HW0A 5HCAA 5FKLA 3POSA 1V9U2 3G1OA 2HXIA 3WTTC 2F5VA 2EIDA 4TLFA 1VAVA 1GVJA 5ILSA 1VBE1 1V6KA 4ZU7A 2QQAA 1E5HA 2E19A 4LBKA 3WVJA 3BTXA 5DM7F 4XLAA 1TNSA 2V6EA 3K4AA 2HWC3 1RUH1 3RNSA 1SBDA 3MEPA 1I3QJ 4Q0SA 2HYJA 1F4HA 3ILFA 4E2QA 4OFGA 2W1SA 1BEV1 4AYUA 2LUWA 3PNYA 2R7UA 2EJRA 3N9LA 2PMUA 4OINF 1RIOH 2OT7A 3EB7A 4HLYA 2KDOA 3S30A 2JE7A 3L2WA 3ON7A 1AU7A 3UGFA 5IY5H 2F4LA 2VKHA 4OI2A 4GGGA 3QAHA 4XORA 3IN9A 3A01B 1I3AA 4BQAA 1R49A 3HWJA 5ABJB 1BI3A 3GFIA 4QMAA 2IW5A 2VGDA 2K9QA 4A3MJ 3I59B 3LDRA 3DKWA 2K0GA 3OPZA 2AQFA 3FLTA 1X1DA 1PGL2 2R7OA 2STWA 2AHQA 1SCRA 5M3FJ 2K02A 4FQGA 5BY5A 4E9KA 4I0WB 1REPC 1JZ5A 3MF6A 1V6LA 1REFA 2QQOA 1B72B 5C70A 1AYN3 4YGCA 2YYOA 1UZVA 2A6WA 3OY8B 4Y1UA 2LY2A 1QXRA 1OYWA 2KA3A 5FJHA 3IRRA 5IFTA 2CNAA 2JJ7A 2DQLA 5ACA2 1Z7S2 3ZMTA 1V6IA 3J7AO 1KS5A 2Y0OA 1WW7A 2AXLA 3ZQHA 3SITA 3S14J 2GA2A 2V1UA 1T08B 5E8IA 4G7OF 1AX2A 5L19A 4CEYB 3ECQA 3J8F1 3CCVI 5A1FA 1RMU3 1O91A 2DCTA 2KIFA 4M3DA 4PSWA 3VZKA 3BR5A 4KWUA 2EBIA 3NV4A 4H3WA 1NHAA 4NC8A 4XRSG 4JDOA 3BTLA 4S2GA 1LHWA 1ETXA 1OSGA 2RG4A 2QSFX 4IEOA 1Z05A 2KL4A 2ETHA 3FMRA 4BMEA 2B8MA 3LCPA 3I7DA 3L7WA 5GKAC 5FPXA 1IS6A 5FYMA 1D1CA 1ZZCA 3I59A 3I2JA 2AXTC 5FLXK 2Q1MA 1SG3A 4DXSA 2ZCWA 5JAXA 2MG4A 3HYIA 2YBPA 1NLQA 3TWIA 2E5NA 4AU7A 5FZFA 4UNOA 2JSPA 3SHFA 1B72A 3WQ7A 2ISYA 1V54H 4E4DX 3THPA 3MIBA 1W8FA 3W6JB 1W5CC 1V6JA 2RS31 4OHZA 5F3EA 2NAZA 2BQPA 3K9TA 4ZKTB 4Q0UA 2BXZA 1LOAA 5A3WA 4TYSA 3W2VA 1UL9A 3FXJA 4XLHA 4XABA 4D7YA 4CEYA 2XPUA 1UOBA 2ARAA 3SH3A 1T0FC 3VBSC 2XBO3 2F5CA 3VYRB 1Y4WA 4EN9B 4G6DA 2OCEA 3OOUA 4XKBA 2DU1A 4IO9F 1LUJB 2EA4A 1RUF1 3VBFB 3ZPYA 2JA7J 1VBA3 3RQIA 1N77A 2HOSA 2LM3A 3B6CA 1N3OA 1OKRA 4H0EA 4F3JA 1J3RA 4Q4Y3 4BQXA 2JKBA 1SACA 2A5WA 3M3YJ 2L9SA 3LEGA 4M3CE 3E6MA 2VNOA 1RB8G 2XJSA 2DTWA 5CPRB 4XFCA 4O9EA 2L7FP 2VQGA 2RS53 1Y9GA 3IDAA 5GADJ 3NAUA 1YFYA 2N7GA 3SFIA 4AD9A 1TQPA 3W6KB 4KIGA 3QU6A 2ID6A 2LBFB 2R041 4CDWC 1URXA 2B42B 1BVP1 5A3TA 1NY71 4UUSB 4M6XA 3P1IA 5B4NA 1NYWA 3H42B 2HXOA 1OURA 1TC3C 3WTUC 2YC2A 2CV6A 2E26A 1HDKA 2VCMA 2A6TA 1HB3A 3PVBB 3CJQB 5L3FA 4B48A 1OQDA 1WLTA 4W50A 1ITYA 3O1MA 3NAPC 1AYM2 2QWWA 2QQJA 4IHVA 4B8XA 3GEZA 3KGLA 1R1VA 3KV6A 1J09A 1H9WA 2FQPA 4B1LA 3F8MA 3WDWA 3KZYA 3W3CA 5FP3A 1AL0G 4O3MA 5LB6A 4AI3A 4LGWA 4AHXA 3NRUA 5HDKA 3B01A 1MNMC 1A6QA 3AMPA 3VBFA 3DU6A 1OFNA 4UFHA 3REOA 3IAM2 4D69A 4KG8A 4QKDA 2A1XA 3CDLA 4HG2A 1RI7A 3WU0A 2E32A 1QEXA 1BI2A 4N90A 2QUOA 5J3UA 1J84A 2DUOA 5JOYA 1G8XA 2FBHA 5JPMB 4E2SA 4E7SA 2ZEYA 3MAJA 3LOIA 1COV2 3LSJA 1FPN1 2A6YA 2JDKA 2BHZA 3H9QA 2VODA 5FZ4A 4A3ZA 2IXKA 2CUFA 1UY2A 5IOYA 1QHDA 2YS9A 1ZBE3 2Q30A 3LB9A 2WSUA 1SFXA 2KISA 3BOQA 3VB9A 1PGW2 4AFCA 3QYEA 3S2WA 4EM1A 1O4YA 3U4XA 4JYKA 3D5LA 4G3YC 1UX6A 4OUEA 2Q0OA 5DUVA 3EQEA 4AHWA 2R7ZJ 2EFNA 3HB9A 4G7HF 1Y1VJ 5FIXA 3DEMA 4BMBA 1TE1B 3T08A 1CF7B 2OCCH 1VBD3 5FY4A 2BV4A 3ZO0B 2VO5A 4HX8A 4XF9A 4EMSA 3LAPA 1CR7A 3AMMA 4AI1A 3ZXDA 2A3WA 3JRIA 4YM2A 2VOVA 1ASJ1 1JKPC 1GP6A 3P9KA 3RZHA 1WVRA 2IVMA 1XYPA 5LY1A 1PO13 2BUKA 1AJKA 1GSLA 2A5YB 3WTYC 2K9NA 4AVTA 4HAMA 3V8KA 4G94A 2DUQA 3A7QA 2ZA9A 3AAFA 2Z3YA 1QA6A 4RBOA 1BK1A 1F4KA 1TME1 5JI7A 3PIGA 4ZU4A 3S3MA 4X6AJ 2LVSA 3CCEI 5FY9A 1N75A 1Z7UA 1BBT1 1WKYA 1Z0XA 2E34A 3VBOC 1YJ9I 4XKWA 3DEEA 2YC0A 3LSEA 3MGUA 1UN1A 2G19A 1X36A 1MPXA 3FKIJ 3ZPLA 1CAWA 4CU9A 1EH7A 1ON2A 1S9HA 4RQPA 1P4WA 2E1OA 2EZKA 3JRDA 1FLIA 4FFHA 3W58A 3T0BA 3HGYA 3S2HJ 3GTOJ 3T1LA 3O1VA 1E5SA 5JXJA 3JRGA 3WF0A 2HU9A 3G73A 2IS6A 3ASNH 5L3DA 1MBHA 3F8CA 3O1UA 1TNTA 2DODA 1L0OC 1SFUA 4XDPA 2E1MC 4LLLA 3OSGA 1HA8A 1MS9A 1CF7A 4DQ2A 2CW7A 3N4MA 2EVXA 1ND3B 3KPHA 2I45A 3A1YA 2RS13 1MZFA 1UMHA 2OZJA 2MW8A 3RPUA 4N9IA 4HMZA 4HKOA 1A31A 1VBC1 2ENRA 1QO0D 1XDUA 5LHIA 1UELB 4LULA 4TTGA 3OGGA 4IL6C 2RREA 1SQ4A 1A36A 4BHBA 1QU3A 2EIEA 4L97A 2DMNA 3KF3A 2A6XA 2CMPA 5A3MA 1KU2A 4AZZA 1O7LA 3DPUA 3POFA 4Q0QA 4YELA 3M4FA 1KEXA 4AFDA 4YFZA 1QXJA 2PTMA 2WWYA 1SLIA 2KRFA 1G3WA 4LEJA 2YUEA 4E7KA 4AGRA 2W1OA 4A4AA 4RHV1 5C8CB 1LDKB 2FDHA 4KIFA 3I2HA 3LEIA 3MFKA 3VDDC 3CDHA 2JJ6A 4WX9A 3CU7A 2VBZA 1RPWA 5FZ3A 2LF7A 3L2QA 3FHAA 5E17F 2PHTA 4CP0A 4CZSA 2RDQA 1RUD2 1ACIA 2ME6A 3AKSA 1W7PD 1DGWX 1HIXA 3VD3A 1P4XA 5I0UA 1LU1A 2KIUA 3WF2A 3PVOA 3H0DA 3ASOH 1H0BA 3B9CA 1ND3A 4JDMA 2OIIA 2VW2A 2DUPA 3LSPA 4N7UA 3ZDVA 1S7OA 1PM7A 2L9NA 1UYZA 2MC4A 2BPA2 1BR4A 5EDNA 4AQSA 4GXLA 1FOD3 3VLBB 2GNDA 1IXRC 1Q8PA 2ATFA 3U11A 1X1BA 3H3VK 4HVRA 1KQ8A 2WS93 2O9LA 3ZYHA 4QGLA 5KC5A 4FTEA 2IAIA 4K2EA 1GZ9A 3OGRA 3L00A 1IS3A 3G1MA 1XNCA 2IT0A 1H2NA 4XUPA 2QQIA 2JN6A 2LREA 1A5JA 4PIYA 4NRQA 4ZU5A 3L2YA 5C8CA 4RS5B 4AXOA 1W04A 2L02A 4YW1A 4EGZA 5DAXA 4YVWB 3F22A 1ON1A 2DFIA 3HG9A 3O12A 2PLV3 1VAMA 5FTTC 4Y13A 2JXAA 4Z6YA 4HPKB 4OVEA 3MFCA 3IWFA 1MSEC 2QQLA 1VBE2 4AIJA 4HYEA 3B94A 3BPVA 2GAUA 3BR6A 1JGGA 3NRVA 3VHPA 3OBRA 5KHKA 4QKNA 1MBFA 3CCLI 2HEWF 3SC7X 2VZUA 2W84A 2WWJA 4Q27A 5FUIA 1YRNB 1RUH2 2FSWA 3QP6A 3AVRA 1EYBA 2CW8A 1BEV2 1MS5A 5FCCA 2UV1A 2F48A 1CAXB 4L5JA 4FP2A 2JDZA 3PSFA 1IN8A 1GR3A 3FHZA 2LRDA 1WW6A 3TOAA 3CQZJ 2LF8A 4C30A 2OS2A 3F9KA 4F93B 4IEWA 4ESBA 2D3PA 5EJZB 1WW4A 2D6LX 3GFLA 2DA4A 3OSDA 2DJIA 3ZN1A 1YS7A 3MBWA 5FZOA 3W20A 2DPDA 2I2SA 4BDVB 3S57A 2VPVA 3LQQA 1LVKA 4CVUA 4RS5A 2AREA 2QZ8A 3DPRA 3KV5A 3GCWA 2OBPA 3AFGA 5CKNA 1ZN2A 3D8CA 4YVWA 3OIQA 3ZRGA 1BXHA 2VUDA 1K42A 3LD8A 5H9RA 1W8NA 3QP5A 1EA3A 5DTDA 3GYHX 5K1YA 4HPKA 1UXZA 5GLZA 4WVZA 1D0HA 4ASNA 3L9FA 1VFCA 1ALYA 4IHWA 1MW7A 4GCVA 3RZOJ 2QJVA 2XC7A 1NCQB 3J8F2 3MYXA 2GQQA 1YRNA 4A3LJ 2YG0A 5F27A 3HOXJ 4OZOA 4NB5A 3AFHA 2Z16A 4F8AA 5HPOA 3HKZA 3MI8A 2OZUA 2J22A 4HVQA 4OHWA 3CDZB 5FWJA 2DN0A 1OA3A 2IFWA 4ZDLA 5F5AA 5IAXA 1EP0A 2QZ3A 2NVTJ 4FBFA 4LUKA 2GDFA 4IEYA 5GAGJ 2XJPA 5CU1A 5BNOA 3BZCA 1BIBA 3NW4A 1UIJA 1D0ZA 4IRIA 5FZEA 5K7FA 1W6PB 4JRAA 1LFBA 1JTYA 4UXNA 1VE0A 3FZ3A 1KONA 3ABUA 2GALA 3WTZA 4P9LA 1H8TA 1IW7F 1QXPA 4PLOA 4QT6A 3VBFC 5C4WC 2WR9A 5LGTA 4A7ZA 2Z5WA 1GV9A 1PHMA 5EJCA 1FBSA 4NUBA 2RS32 4YG3A 5DMYA 3THDA 2PYTA 3WT3A 1GHCA 2YPDA 3EPZA 1NCQA 4EM0B 2V26A 4QPIA 4UFMA 5FYTA 1KU3A 3OPTA 3AZWA 3M07A 1RUF2 4LUMA 5F5QA 1LU2A 3ZN0A 5ACA3 1M06G 1Z6RA 3HOZJ 3ZXEA 4QQPA 4HXCA 4FAHA 1MS1A 4E4ZA 1UAIA 3IMMA 1D8KA 1HDDC 3FMGA 5JVGF 2VI6A 2HYXA 3MZ8A 3G4SI 2Q0AA 3ZYFA 2VB6A 2VM9A 3SEEA 2R7RA 4P9UA 1W6PA 4O7XA 1F5JA 4NN0A 3T4HB 1GVDA 4QX2A 3C18A 1YI9A 5JPNB 4M00A 5E16A 1S5LC 3D0SA 2XXZA 2P34A 4EN7B 2CWMA 2Q4SA 1R64A 1BN5A 1POV1 4CP1A 3RZGA 4ZZDA 1W05A 1ZHFA 3VD4A 1NY72 1VBB3 4NE9A 1RUNA 1XNTA 3VOEA 4IHXA 3ZMNA 5B1BH 3HUGA 2P8TA 4GIQA 3QYBA 3O1PA 4RB1A 1BR2A 2WFF1 2XVGA 1WJDA 1CAVA 3H8OA 1IPJA 1GLHA 3L2CA 3AP6A 3DL3A 1GANA 3JRCA 3ZX7A 4P5OA 4NIAA 1ENSA 1D2QA 4W6YA 3EYIA 4LG0B 5DAQA 4F52A 3RYRA 4ZXKA 4RQPC 4S2DA 2MD0A 2D7FA 1TQIA 2EPFA 1LGNA 4XFHA 4OMCA 3CJTB 4SBVA 3DBRB 5LK5A 2ZGPA 1J1LA 2XOMA 4U0VA 2W1QA 3N35A 4RL7A 1JMUB 2D5HA 3S7EA 2L9RA 4MHRA 4MH0E 5EG0B 5AC91 3OB8A 3R4DB 5D8KB 4E7IA 4LMYA 5L7OB 1OCCH 2JG9B 1JJ6C 2RQPA 1FPN2 4HEA2 4NNJA 5KXBA 1QNYA 2GN3A 4OUMA 1VALA 1HXDA 2V1NA 1W2AX 1WJFA 2BWAA 1FIPA 2YB7A 3BYWA 2VOPA 4HX7A 4EN0A 4NOTA 2R92J 4BNCA 3PIJA 3A4CA 4PCQA 2WNVB 2Y60A 4FPLA 1GP4A 2PAKA 3BPSA 4FTSA 1VMJA 4BQQA 3QQAA 2F5FA 4OMZA 3VZMA 5C71A 2QLZA 3WDXA 1IQDC 2DTYA 1B35B 2A61A 3ISPA 2YHJA 4KICA 4P00B 1GV5A 1ZTRA 1JHFA 1UU6A 1ASJ2 2VNVA 4URAA 1L7QA 3D0JA 1P9QC 2VXRA 1OA2A 1QJU1 5I8SA 3ZYBA 3SNMA 1AZDA 4ASLA 2PHDA 1V0AA 1VB4A 4KMQA 1Z1DA 1AYM3 1IZ1A 4XOTA 5ICFA 3CC4I 3E6DA 1TME2 1R5HA 3S32A 4UFIA 1HX6A 4PJYA 5JIUA 2ID4A 1XBFA 5EG0A 2BW3B 2WB1N 2HBTA 2LLKA 3ECOA 3KETA 1BBT2 4ET7A 3ABMH 5F1RA 2JG9A 2GWRA 2MBFA 1JT6A 2CSGA 4Q2FA 1ND3C 5FMOL 3ROUA 2V5DA 4AOCA 3BCBA 2VN2A 1O57A 4IHYA 3TN93 4I76A 2JKXA 3WF4A 2JIGA 3BU7A 1CX4A 1HJFA 4HK8A 5K7PA 1FT9A 3MZYA 2QQKA 3I2DA 4B4QA 2M0CA 3ASIA 3OS1A 3I3BA 2YDEA 1UKGA 4W4ZA 2IVIB 5FKMA 4PLNA 1U3EM 5HVQC 2IA1A 5IYBJ 3N05A 2FCTA 1COV3 1F31A 4GALA 1R71A 1HRV1 4ITVA 3ZR5A 4X6QB 4CSWA 1U9NA 3F3XA 1ULPA 1B35A 4XBLA 3MIHA 2W46A 4AVAA 3I97A 2WAFA 1W9WA 1LAJA 1TVGA 3OEBA 1R5GA 2R16A 2BBAA 5FYZA 5A3NA 2JIJA 2NVUB 4ORFA 3K1MA 4KBBA 3AL0B 1B59A 3PNVA 4ZC3A 3NNJA 3ZVXA 3GTKJ 5FFOC 2QDNA 2XF5A 4A7YA 3QH7A 3FXUA 3I2IA 3W21A 4QLCU 2EB7A 1V6NA 2JUGA 1FSEA 1JKQC 2QSHX 1N25A 3WP5A 2BY2A 3OYIA 2BW3A 2JTVA 4HONA 3ONQA 4DW6A 4DYQA 5LLQA 5F3GA 3CJIA 3CMYA 3VZJA 2XF7A 3MIEA 1EV7A 1WBFA 3RKWA 3PTRB 3MHZA 4OHXA 4JDNA 4RHV2 2H27A 4IZZA 1QQP1 1VRH1 4KNYA 1H88C 3PMSA 3SMHA 2LY9A 4FOQA 2MSYA 3M2MA 5FXWA 2VNGA 5F32A 4JHZA 3AYEA 3MCZA 2XB5A 4QDRA 4PT6A 3CTAA 4F3QA 4LK6A 1WBLA 5EYXA 4BXSV 4D7TA 1YIJI 1G9BA 4XL9A 1F5TA 2CAUA 1VQ8I 4J00A 4LBMA 1LDDA 2QQPA 2AO9A 4A5MA 4N9HA 3JW4A 4GWMA 1DU3D 4ZYHA 2KXLA 2XL9A 3ZKYA 3MN2A 3C2HA 2NRAC 3Q9SA 4AAPA 2LKPA 3DPRC 3MW3A 2AACA 1M1EB 3FX3A 3ZYPA 3GF2A 1RETA 4YSFA 4FPHA 4PF1A 1SLCA 2GU9A 5FPLA 2VKVA 5E3NA 2CV0A 4H2AA 5DG1A 1WJBA 2EXJA 3IHUA 3ZXAC 2LS6A 1N47A 4WCGA 5DAWA 5F9TA 2WQZC 1S2EA 4O9GA 3POJA 1LULA 4CEWB 2F17A 3OBZA 4BLIA 2DQRA 1GWLA 2ZJPF 2EV5A 1ZK8A 2X29A 2XV4S 2BOIA 4FPGA 1W6QB 1DP7P 2L4MA 4LBQD 2H0VA 2RV8A 4HBLA 4Q1RA 3W6VA 3NKTA 3B7MA 4X0GA 1KDKA 4MGZE 3DYOA 2ADUA 3L1PA 1K5MC 3GYDA 3QRFF 4OQ9A 2KT0A 1OJLA 3TAYA 3D5RC 5KR7A 5EIYB 2TNFA 1W6NB 4XFAA 5BNOC 3D1NI 2FCUA 3U10A 2WC2A 2V9PA 1RGSA 1LEBA 1S0FA 4U0YA 1OFCX 1T2XA 4D7NA 3MMYB 4XUTA 3I3LA 2ZZQA 4LHLA 2LKXA 4RLQA 1D5VA 4KT5C 4IEJA 2DMPA 1P2FA 2IWGB 1YW8A 1H8TC 3DBLB 4CP2A 5I0TA 3K4LA 3NQOA 1RUD3 4Z1VA 1FNZA 1OC1A 4IESA 1AR63 4COZA 4LPLA 3KP4A 5FKOA 4FPKA 5C7GA 2UXXA 1ULDA 1TZLA 1LPQA 2Q1FA 5JR2A 2IXIA 1T56A 3BIWE 1QHHD 2WNOA 4RAFA 1PP7U 2R30A 3VHNA 4H14A 1K3IA 4QPIC 1FWZA 3CO2A 2OAZA 5J48A 2QTWB 3MW4A 2O7OA 5TISC 1W6QA 1J9IA 2DI3A 2BFUS 1FTTA 2Y0SA 2XAFA 4BQ1A 1YHFA 1UWWA 1XSQA 3GJBA 3M8EA 1V55H 3HMYA 5C9AB 5FZMA 1WGXA 3RIRA 4JX4A 2VE8A 4RAGA 5J8CA 5EWSA 1D5YA 1HKTA 3LIHA 1DYOA 2X6YA 4JTOA 3MKYB 4UVAA 3RKQA 3R4KA 1JUIA 3I2KA 5JVTA 3OD4A 3CBNA 4IDZA 1D3YA 1X4OA 1A6CA 2JVHA 3LPFA 2E2IJ 1BW5A 2VMFA 4MHUA 5FXVA 3KIOA 3I53A 1CWPA 2LYCA 4D94A 2P3JA 2GA1A 1RUG1 2FA5A 3VHRA 1U78A 3SCFA 1NQJA 3RKYA 2VXZA 1Q1VA 2PMWB 3U78A 5CQGA 2ZGUA 5T5PA 3M4OJ 3TW6A 3TO6A 1VBE3 4AE2A 3OR1C 4I3GA 1D1BA 3RGBA 1NG0A 2CUJA 3J81Z 4XQFA 2FBIA 1E57A 1WH7A 1UOJA 4CCEA 5IK4A 3H7JA 3OYWB 1RUH3 4PJJA 3ZFEB 3HQUA 4XF0A 5FBJA 1GT0C 1YJNI 2YROA 1GOGA 2WLPA 1TWAJ 3WG2A 4Y15A 3FLPA 2HQAA 4PDWB 3H3UA 2PN6A 2AEZA 4ZJZA 2HZTA 5CLSA 4P14A 2ZJCA 1MDMA 4LHSA 4UB8C 4HF1A 5C9AA 3KP7A 1W8WA 2PMHA 1AXZA 1I9RA 4M3CB 3VKNA 2NXNB 1O4TA 5CG9A 3VGIA 3K4BA 3WDTA 2ORXA 3RYPA 2O1QA 1IPSA 3H0OA 2Y6HA 4OAYA 4B1RA 1RUC3 2AR6A 5DUXA 1N78A 2VC9A 4UV9A 4YFXF 2NQYA 4WBBA 5FYUA 1ZREA 4RD7A 1ULYA 5L3EA 3GLXA 1G9CA 1XE0A 4XJ8A 4DOZA 4FX4A 4AI0A 5F0CA 5FXZA 3MPPG 2IS4A 1BOBA 4P96A 3T8RA 2GP5A 4JC1A 4JX6A 3E6BA 2BBYA 4DJAA 3ZQCA 1XGOA 3V0BA 1YQ5A 2LP0A 1NE4A 1GWMA 2OKXA 1OPCA 4CYDA 4M0HA 3ZMOA 2MC3A 3JAMZ 2Q8KA 1YEWA 4N0BA 1D2SA 5GP9A 1W5SA 4BIFA 3ZFEA 2ZSIB 3WUCA 4IEQA 4I09A 1NLSA 3FBNB 4I0BA 2ISZA 1RVF1 4A3EJ 1OCPA 1IG7A 5J7MA 2EV6A 1GZTA 3HNMA 3LZZA 3POEA 4QXKA 3VDBA 1JHNA 3ZQQA 2I74A 3PHMA 2VY0A 4M6YA 5IP7J 2EFPA 2W52A 4D6RA 2Y34A 2AYHA 4A6EA 5EYYA 1TW2A 4EJWA 1POQA 1JUPA 2WFF2 5HI0A 1VNDA 1MEC1 4CU6A 5E18F 3CIHA 4B47A 3MV01 1BW6A 1BCXA 1SFKA 1BJQA 4KGGA 3QH6A 4NBQA 1H6YA 5JMOA 3PVEA 4W8JA 1DGRA 5AVAA 2FZ2A 3DEUA 2WB1A 3CF5F 1R7JA 4BS9A 3KFWX 1ODMA 3HRTA 3FHNA 3MLLA 1QOSA 5FZAA 3NARA 1OT5A 1WCQA 3RCOA 3K1PA 3SQNA 3JSOA 1ZLKA 1XNAA 1XU2A 4L8QA 4OLLA 5C44J 4MGYE 5KHJA 2OTLI 2XPJA 4L0PA 4CCMA 4ES9A 1ULCA 1W2OA 1XYOA 4YWAA 3LGRA 3PMEA 4U87A 3RVHA 3ALQA 1UPSA 5IVVA 2BZTA 2X51A 5AC92 1B35C 5K0UA 2BTVC 1UG2A 4I99C 5D6FA 2W39A 4DBRA 4GJYA 3WTWC 5L36A 4DY3A 3NV2A 4AEKA 1GUIA 1SHWB 2I10A 2V79A 1HXS1 4NIHA 3M3CA 4QKBA 3POYA 4LLNA 1IQAA 3POWA 1BHGA 4JGZB 3I2OA 1DFQA 1OD5A 4XBNA 2JMWA 4JBAA 3KLNA 4ZYDA 3OYFA 3UKGA 3A02A 4YIFA 2CHHA 3HGGA 3H8UA 1SC7A 4L9TA 2COBA 4WF2A 2XVCA 4M9SA 2HEVF 1H9TA 5HV4A 4NHKA 3CJIC 3K4DA 1WHUA 4CE8A 3WQBA 4WVMB 1SPPB 1N1VA 3KQRA 2O0OA 3C3WA 2K4JA 4BQWA 4BEHB 1QJU2 4ARYA 4OIPF 3ZN6B 3KZIC 3E1F1 3TBIA 4P55A 3S6PA 1X1CA 4MGRA 5JOZA 2ZFUA 2R0QC 5HLTA 2CWSA 1JUSA 5FPUA 1WSUA 2N8GA 4YG6A 5B3SH 2CS3A 2DBBA 2HS5A 1OFSA 1K79A 4QM8A 1UMZA 2C5DA 2V5YA 1DG6A 4DRVA 4UBGA 1ND2B 3R60A 2H1LA 2EIKH 1MJ9A 2QFEA 4L18B 2HLEA 3KD4A 2E36A 2KRCA 5B1AH 4IX7A 4Z2WA 3K6GA 2ZABA 1BK0A 4JGZA 5FZ1A 3A2KA 2R0HA 4C3HJ 4LG3A 1JYCA 4H7MA 5JXHA 1SAUA 3S17J 4FX0A 5HS8A 1CZVA 2XQXA 1T33A 2R32A 1HRV2 4CUCA 4CCLA 1FBUA 1FPN3 4PI0A 2A05A 3PSIA 4LA2A 3LSHA 1R1TA 2HWD3 4GO1A 2DVFA 2XAHA 4RFRB 1DYKA 1HLVA 3KV4A 3GTQJ 3VYTB 4RAZA 3E7LA 4KN7X 4WVMA 1UHMA 3PL0A 4I2OA 4FVVA 2OVUA 4E2GA 5GTHC 4BE0A 3URFA 2P6TA 1J7KA 4BEHA 5EEGA 3RYKA 3J7ZI 2ZB9A 4G6QA 3LDBA 1W39A 2VOWA 1XB4A 2Y69H 1QVTA 1ASJ3 4PBPA 5K5OA 3FMSA 2O8OA 2OQGA 4EYUA 4BQYA 5FYYA 2DAOA 4FXKB 3S15J 4HF0A 3HC7A 1Y1WJ 3OR2C 2HPMA 5FYBA 1LEDA 1S55A 2OA4A 1QQP2 1VRH2 5CYVA 1AOYA 5JLXA 3I55I 2RV9A 5FY1A 3EUHA 1GXPA 2FNAA 5DZFA 2DT7B 4IE0A 1GQGA 4MTEA 1LFPA 1I5PA 3CUQC 2ET1A 5EGOA 1KQ0A 3IM0A 2LFBA 2MH2A 4FPJA 2GMPA 1C5IA 1YRZA 4W6XA 4QXBA 3GO5A 1CPNA 2PHUA 3T4VA 1CAUB 1GZWB 1DLLA 3ELKA 4WXDA 2K7LA 3P3NA 2VD7A 2ESHA 4HKWA 3AXDA 3FFZA 1IRXA 5BPXA 2Y48A 2HTJA 3RZLA 1RTVA 5IT9Z 3LQRA 4I30A 2FUG2 4OYUA 2WNEA 1HQLA 2STTA 3FFQA 1QJFA 5FPZA 3DECA 4XILA 5FZGA 3PU8A 4YVSC 5H2FC 4ARXA 4WVVA 3CC7I 2WTEA 3TYJA 4XJZA 3DV8A 1IG0A 4RB2C 4AYBN 3R0AA 1R00A 1MACA 4D6SA 3ACFA 1T6BX 1IN7A 5KHDA 2G9WA 4UUTA 3IIIA 1TW3A 4HQEA 5F39A 1ZRCA 3LAGA 5ANQA 1BMV1 5I8YA 2VMIA 5JHUA 4MOAA 4L9NA 4EWAA 3ZXGA 1KGYA 2EIGA 2LOOA 4XJ9A 1RRJA 5FPVA 1AX0A 5CISA 3EQLF 5FP9A 2JDHA 3N9OA 3O3KA 1FAYA 3UNGC 2B9VA 4QSHA 5KCMA 4RHV3 1PZ8A 3LOBA 2O5RA 5HLGA 1PVEA 5FKBA 1ULGA 5F7UA 2OUMA 3LNQA 1GZWA 4A45A 4I6ZA 3KLSA 1GICA 3DF0A 4RDUA 4HT1T 3OYAA 3NNFA 3I2GA 4OHYA 4Q26A 3NKGA 2UWMA 1T95A 5FROA 3ITQA 1ZA4A 3RWKX 5GALA 3OYKA 1W06A 1YTYA 3U1DA 3GW2A 4XTMA 3NSTA 5FYVA 3ZFGB 2H09A 4XAAA 1JW6A 4CYCB 4COYA 1LESA 5FFXA 2YBSA 4GB31 4GA9A 2FQ4A 2DLLA 2G9GA 3N7JA 5EJ3A 1ZG3A 1JYIA 3IDBB 2ES3A 3THTA 3FM3A 2P4WA 5DXDA 2PHRA 1OCTC 2D6PA 3DYPA 3T3YA 3A0KA 3UESA 2UURA 3GVAA 1MVQA 1OA4A 2AH2A 3HOBA 3WU1B 5FP4A 4BM8A 3JB4C 1EV11 3EXUA 1XQNA 1Y3TA 4LNVA 3K48A 5FY8A 4KYWA 2QQUA 4U2AA 3TW7A 1GV2A 2QDRA 4RFT0 3FIWA 5ANNA 3BTJA 4HSLA 1W8OA 2WNUC 2ZXQA 1J58A 2B0LA 4FPFA 4EZHA 2ZMEC 3UKTA 2SBAA 2B5HA 2VQUA 1NX9A 3R4UA 1NKGA 2ZO4A 1U9OA 1KQRA 3ZQFA 2VTXA 1H89C 2J1EA 4KWKA 2XGXA 2A5ZA 3MLKA 3T2TA 3WW2A 3UKVA 1AVBA 4B4PA 1RUG2 1LGBA 3M70A 1P6RA 2CQKA 1AUYA 3TB0A 5T3NA 2QKLB 2A6ZA 5DPNA 4BHCA 5CZKA 5IVJA 1KITA 1HV1A 4A5NA 2Z9OA 2XKPA 1ZG1A 3M3QA 1BBYA 3CHXA 4QHOA 1R4MB 1HB4A 4S2HA 4BBRJ 3JR9A 4L5IA 4Q4W3 3E97A 5DM6F 1FOXA 6PAXA 4ZHNA 2ZJRF 5E3MA 1QNTA 1WCUA 1XXNA 4NVPA 2ME0A 3CLOA 1VQKI 1PO23 1UY1A 5LGNA 4M74A 2J5PA 3GTLJ 4FFGA 3WNLA 5EQUA 4GWNA 1RHI1 2E51A 2PXJA 1LOGA 1RNLA 5DYMA 2EFOA 2E53A 2IXSA 4K6BA 1HF0A 1Q8OA 1X9PA 5FZ8A 2VMEA 3PNTA 4LFUA 1FPQA 1RC6A 1MSFC 2XLGA 4IF4A 2DFBA 5C8WA 2HVRA 4AEDB 2R0FA 1JU4A 1QZYA 2FF4A 2P3KA 5JOWA 5K0UC 3V8JA 1C8M1 3WW3A 1IPKA 1J83A 2RJ2A 3VD9A 1NT0A 3SFZA 3C8XA 5JWPA 5CG8A 1RL3A 2GNMA 2VUAA 5FZDA 1AWCA 2NYXA 5E3OA 5EZWA 5DZGA 3OPWA 1OLQA 4NAOA 1X8EA 4W6WA 2DWRA 3GTMJ 2RVAA 2ARCA 5LHHA 1MS0A 3IZOA 2DCJA 2YX7A 4WZCA 5LA1A 2WA4A 1PNGA 4LTAA 1LHVA 5E88A 3Q0UA 4ITCA 4A3JJ 4DXRA 2E71A 2EIBA 2YUSA 1RUE1 1DUXC 2JICA 3KLOA 2A7AA 2VC1A 1XSVA 3BDDA 2DDAA 3H8XA 4LLFA 1RVF2 4IV1C 1OQYA 4NWVA 3BU0A 1DQ5A 1JN2P 4COVA 3I58A 3A0HC 2CJJA 2FQ3A 4QX5A 3SXWA 2IZWA 2DK8A 3RZKA 2AUYA 2E31A 1Z3XA 2ZGTA 1FOKA 3POIA 4YIRX 5HODA 3UKNA 4N43B 1XGSA 1VF9A 4XN0A 3M7GA 3ZM8A 2ZX0A 5K8SA 4AEDA 5EZHA 3LFMA 1MEC2 1WWXA 1BC8C 3A03A 2K46A 4HSTA 1VQ7I 1K83J 5D5WB 5JSOA 5LWBA 3NMBA 1GXQA 1IN4A 4WM8B 3GNEA 1MS8A 4ZS2A 3DKYA 5JSPA 3WY6A 4RGRA 4CCCA 5A2QZ 1WMFA 1WD3A 2W91A 3SZTA 2E7AA 3ABZA 2E7TA 3IBMA 4HV6A 4JGZC 2NOGA 1ZRDA 4Q8LA 5FWEA 3SCHA 4XN3A 4Q8KA 2XGDA 1JYXA 3U4SA 3DWLE 1QPMA 2WO1A 3I71A 2ZGMA 3JU9A 4JQFA 2V6CA 2KPMA 4CDGA 3VDXA 2M7BA 2A3YA 5EZGA 1H4HA 4DZJA 2X5IC 4WM7B 3IMNA 1BJZA 4EN8B 4ANJA 1DZRA 1W9SA 3BI3A 1B6AA 3OEAA 1HXS2 4XF1A 1FNNA 5DV5A 1PIV3 4NAMA 2I8DA 4A3GJ 2UY8A 1XMXA 2WAAA 3DYMA 4HN1A 1CQTA 2KD7A 2C24A 4KISA 3LA3A 4N43A 2PQSA 3LSTA 4MQVA 4P9IA 4N8MA 2QZ2A 4EQQA 2XONA 4YW3A 3C7OA 1POV3 1V6OA 3MF9A 2FMLA 2YV8A 4M6VA 4M3FA 4C9YA 2R5ZB 2WIIB 4WM8A 2PBIA 1ACCA 2IJLA 5A33B 1SD5A 5D8AC 2L9LA 3GZUC 1GU3A 5HV0A 4IJAA 2WFF3 4PQQA 3EUHC 2CDOA 1D4M2 3FXQA 1XPWA 2VH9A 9ANTA 4DFSA 1XGNA 2FDIA 3TNQA 1UYYA 2PA7A 3ACHA 1W0OA 1WI9A 2HJIA 5GZEA 4HNUA 1A78A 1JGSA 3KYCB 4A3KJ 3WP6A 4O6JA 3GM8A 2W24A 2R1BA 3IKTA 1QY4A 5FV3A 2NVXJ