5LEKA

The transcriptional regulator prfa-g145s mutant from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 70
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lekA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lekA01
4KYWA 1J1LA 2RNJA 2IVMA 3BWGA 4HLXA 2DPDA 5E1ZB 2P6TA 3FMRA 2A61A 3E5XA 4KFCA 4Q47A 1YLLA 2H0VA 1QXJA 1U2WA 3SCHA 4MQVA 1V70A 4RGXA 4HYEA 5HVQC 4AD9A 2BYVE 2KKOA 3F23A 3IC7A 2ZJ2A 3RKWA 4CXFA 4HA8A 2O6GE 5ILUA 1NE4A 3WTXC 2PG4A 1E17A 4A12A 4A6DA 1UCRA 1YFWA 5DYMA 3J81K 4MH0E 2EWNA 3R4KA 2DBBA 4PDKA 4JVAA 3I4PA 3ZMZA 2V6CA 1W7PD 3U9GA 3NSTA 4M9ZA 4IVNA 4OMZA 1R1UA 4I3PA 4WF2A 1G3WA 4KIGA 1YS6A 3BJOA 2E7WA 1K7AA 1IXSB 3GLXA 3I71A 4Q4ZF 2A07F 4HX8A 2L01A 1NZCA 4O6JA 4YNIA 2XAGA 4D0PA 5DCMA 5LLQA 4D7TA 2XAFA 5AIQA 3JZVA 1XE8A 4XF4A 4IEUA 2V1DA 4O5VA 3CUQA 3ELKA 2FBIA 4ASNA 3K69A 5HS8A 2MNGA 5ICCA 2A6HF 1SD6A 3Q5FA 1FZPB 3ACLA 1J0RA 3H8UA 3E3VA 5KHJA 2GC1A 4LLOA 1ZAOA 3C3WA 5I0RA 1DPRA 1HXDA 4HX7A 1HKSA 1I1GA 2GC0A 2K27A 4XFBA 4L9VA 2XL9A 3GUDA 4M9XA 2NNYA 5I0TA 3B02A 3P9IA 3KLOA 3ES4A 5FDBA 4KU8A 2HTJA 3CUQB 3SFZA 4NHJA 4HOBA 2R3SA 2VN2A 3F3XA 1BC8C 5J8FA 1CAUB 5EFUA 1W5TA 2ETEA 3PNAA 5JVTA 1K6OA 2DW4A 4OMYA 1FP1D 1GVJA 2Q4SA 3PVBB 4JK1X 3M1EA 2VBXA 3LA7A 5HLIA 3CF6E 2P5LC 3E97A 3GZ6A 1IN4A 3EJKA 3VEPA 1CF7B 1B6AA 1FYKA 1QZYA 4PCQA 3F8BA 4QX5A 4HF0A 4U88A 2Z69A 5ICFA 2RV8A 5LGUA 2QLZA 3QRFF 4NQWA 4M9SA 1RUNA 1K78B 5F6FA 5FPXA 2O8QA 2GXBA 1L3LA 3O14A 4HW0A 1XSXA 2MA3A 3GFJA 5E8IA 2H09A 1OD5A 3GEZA 4A0YA 2RN7A 3ZN0A 3WTZA 3TO7A 1O5LA 2PI0A 3PLQA 4JTOA 1IW7F 2K86A 1OYYA 1CAVB 2RKHA 3IWFA 3T8RA 2FSWA 4ON0A 4XF9A 4BAYA 5CYVA 2HFHA 2WFPA 4IHSA 2AS5F 4IETA 3VB2A 2B5HA 2EK5A 2DTRA 3RTRA 2GC2A 2XASA 3JSPA 1LDJA 3LAPA 3KE2A 5KHHA 1PDNC 2XAHA 2QZ8A 2FQPA 1YTYA 4BH9A 1SAXA 1QQIA 3ROUA 2BNOA 2KIUA 1KYWA 5L3DA 1KGSA 1ZYRF 4BIFA 1Y3TA 4LJZF 1YFUA 3C3VA 3RYPA 4ZYGA 4WXDA 3HTUA 4L2NA 5K5OA 2ZMEB 2LDUA 1Z6RA 4XF1A 1XD7A 4YARA 2LNBA 3V7RA 1PM7A 5AVPA 3TKYA 4QGLA 3VHRA 1FXZA 2IC1A 4LB6B 3FJSA 3KP3A 4BHPA 3TOBA 4LEJA 4UVCA 2NAZA 4ZZLA 1EPZA 3FHIB 4UUVA 1UW8A 5KHGA 3COAC 4KN4X 3EO6A 2QQAA 3NQOA 4OIOF 3IL2A 1T0FA 3NJZA 3CO2A 1RTVA 1X8EA 2FRHA 3BY6A 4M71A 5BS6A 1J75A 4GYIA 5LHIA 3RYKA 4I0BA 4EVIA 4OU0A 3TO6A 5CJ9A 1Z1DA 3N97A 3RIRA 4YIIA 3M7GA 4L5JA 5BPXA 3J7AO 2GU9A 3M3IA 5I8SA 2XKOA 3I7DA 2BNMA 5C6CA 4KU7A 3SXYA 4MEXF 3HYIA 1F4KA 4IEWA 5EEGA 4PIYA 4L18B 4P9GA 2ZNZA 2P8TA 3IKVA 2OZJA 1VJ2A 1CGPA 2A6EF 4R52A 1GHCA 5HS9A 2ZKZA 2UXXA 4G6QA 3FM5A 1K79A 1ZX5A 5FB2A 2Z5UA 4G7OF 1DGRA 4EGZA 2CAVA 5LBQA 3HRMA 1FYLA 1QBJA 2UY9A 2A5YB 2P17A 5DV5A 3KP2A 3HSFA 3MYXA 3M70A 5HOOA 5JSRA 1V3FA 2XUBA 4DNCA 4IEVA 4HAMA 1TLHB 4HBLA 4NB5A 3DKWA 3EYYA 2BGCA 1R1VA 5E20A 4AVBA 1J3RA 1LJ9A 3TNQA 3MZYA 4HF2A 2BNNA 1ZLJA 2P4WA 4AWXB 3ETQA 3IBMA 1L0OC 1OR7A 5D8LB 3WTTC 5D4SA 3F6OA 2HQNA 1JGSA 5BUVA 1KU9A 5LRRA 2V79A 3ABUA 4OIPF 3KCCA 3K0LA 2MH2A 1STZA 4HLTA 2N7GA 2STWA 5I8TA 2UWMA 1UFMA 4Y15A 1UPIA 2GWRA 5D5UB 2ET7A 1WGPA 3HSRA 3SXWA 1BBYA 1R1TA 4BXUA 1D3YA 4ESBA 4CYDA 1T38A 3OV8A 1USSA 3H92A 1YIOA 3FX3A 2V1UA 3KGZA 3L00A 5CVIA 2ET1A 2G7UA 2VXZA 3ST7A 3FXRA 4EJTA 1CX4A 2D2WA 1BI2A 3O6BB 3NKTA 4I01A 2Z33A 1BI1A 2NS0A 2IPQX 2OZ6A 4EM1A 2K4JA 2M87A 2EV5A 4KMUX 5D5VB 5I91A 1BIBA 1MGTA 3BB6A 1T39A 1X82A 2XAQA 4WXHA 4HLYA 5CVUA 2PHLA 2Z3YA 5KHIA 4EJWA 5JFRA 4HZFA 2RDPA 3BOQA 2XLGA 3G3ZA 3IHUA 4BHBA 5DUIA 4Z07A 5ICGA 3GXOA 2PAKA 4RGSA 4A5MA 3KEQA 3GBFA 3WU0A 4XFFA 4F8AA 3GVAA 3I64A 4N0BA 2K02A 1QY4A 3S2WA 3NEUA 5DD8A 4XSZF 2Y0OA 2MPFA 4HSLA 2DO7A 4GGGA 2F5EA 1P92A 1YHFA 1PP8F 4AVPA 2M1BA 1O7LA 4E70A 4EMSA 1HKTA 1MJ9A 1YW7A 1YQAA 2KJBA 2QCSB 4EWEA 1PMIA 1B1BA 4D7SA 2ATFA 2IXJA 3JAMK 3RI4A 4CHUA 4GULA 3CO7C 1TQIA 3U2RA 3DL3A 1RUOA 3N4MA 4IEXA 6PAXA 3TQNA 3K1PA 3F72A 3BDDA 3K9TA 2M8EA 2ZXJA 4ESJA 1YFYA 2BV6A 3WG9A 2QQ9A 1OI6A 4H7LA 3H7JA 3LFKA 5K5QA 4ZYDA 1ZGAA 4KIBA 3LQQA 1IZ1A 3IRRA 5LGNA 3JSOA 4L11A 3H7YA 5LHGA 1H0MA 4RB0A 1E2XA 4YIFA 5DD4A 3C7JA 4I98B 3CUOA 4RGRA 2UXNA 4OINF 4Q48A 4EGYA 4PIZA 2XROA 4XSXF 4B29A 2IXLA 4L9TA 4RB1A 2CYYA 3F8FA 2HKOA 2FOKA 1IUYA 1R23A 5T3NA 3MWMA 3IDBB 4P9FA 4A2UA 2WWYA 2HJIA 1DPUA 4ENNA 3MPBA 4JV4A 3ZN1A 1U78A 1Z7UA 1AOYA 2PFBA 2CAUA 3CLOA 2D40A 2GA1A 3FMQA 1A04A 1Q5OA 2XL7A 3FMSA 2UY8A 2PHDA 1XE7A 3ML6A 1TNTA 4DQ2A 4Q0SA 3FZVA 1JE8A 3L2HA 2GQQA 2J5PA 2Q0OA 1O3TA 1J58A 4WXCA 1S7OA 1ZLKA 4UBHA 3BJAA 1XCVA 1O5UA 3I0TA 1XCBA 3OOPA 4MGRA 3WE2A 3CJXA 1TW2A 2FNAA 3JTHA 1YG2A 3ZMUA 1LQ1A 3MFKA 2PJPA 4EJOA 4BYYA 2MBFA 4M72A 3JAMZ 1MKMA 3H3UA 3ZQ7A 3RKYA 4LK1F 2FNPA 2QUFA 4MHGA 1Z05A 1QO0D 4CZZA 4MV2A 2YX4A 4N9HA 1REPC 4WWCA 4U7DA 1EH6A 4TV7A 4UBGA 4A6EA 4Q0PA 2HYFA 2XKPA 2FEZA 1RC6A 4CGZA 4KT5C 5ICEA 3DN7A 1BIAA 4TLFA 2Y0MA 3T0YA 4Q0QA 2NNNA 4OIQF 4ZU7A 1XDUA 3HSEA 4XBFA 2YSRA 2M45A 1EP0A 1KQ9A 2HOEA 1L3JA 4G6DA 2IP2A 2PN6A 3ZDSA 2VE8A 3BPVA 5JSOA 3HUGA 2HYGD 4ONUA 1TW3A 3GF2A 1JHFA 1CAWB 5D4RA 4MQ9F 1R5GA 3MCZA 4ZZDA 3LOIA 2UYBA 4G9YA 1P4WA 4WBBA 2AXLA 1WSUA 5CU1A 1G6NA 1V4RA 2K0GA 1YUDA 3JW4A 1SEFA 5HDNA 1JHHA 1J9IA 2F2EA 4UXAA 3B73A 3TGNA 4U0VA 4RS8A 3ULQB 1TQ5A 1B59A 3R0JA 4A0ZA 1U5TB 3I59A 1PUEE 2CFXA 2FU4A 4KMFA 1ZGJA 2Q2EA 2ETHA 4R1HA 4MGYE 2STTA 4XFGA 4XEZA 1LDDA 3F8MA 2CW0F 1ZG1A 2VOPA 4OOIA 2FMYA 5CADA 1NXMA 4LFUA 1CAXA 2OQRA 1IN8A 4HN1A 1DZTA 3GWZA 1FBSA 3SCGA 3DF8A 3K1MA 1XGMA 3CJNA 4HF1A 1SQ4A 5FLJA 3W6KB 1MDMA 3FE5A 1R36A 3GX4X 4EJVA 3SMHA 2EFWA 1O4TA 4O9EA 3D5LA 2CSOA 1OMIA 4K2EA 4XFHA 5E8GA 2HTSA 2MLKA 2EFOA 3E6MA 2Q8KA 3BPXA 2DT5A 5E17F 2WC2A 2PTMA 4IEYA 3V8KA 4WCGA 3NW4A 2IXCA 4ZYEA 2XGXA 5FFZA 1GQHA 3DPTA 1LRHA 5KVRA 3GZ5A 2RVCA 1MD0A 1FBUA 1LR5A 1ZG5A 2EV0A 3KFWX 5CVRA 5LEJA 2FE3A 2HS5A 2IXKA 3ABTA 2P5KA 2O03A 1I6XA 2XAJA 2HQRA 3CDHA 4A0XA 1JUHA 2D5FA 3AAFA 1KQ8A 3HHGA 1BJAA 4M74A 1ZG3A 1FWZA 4OIRF 3LWFA 4QGNA 1H1IA 3HRUA 2ISZA 4LUKA 1C0WA 2PAMA 3FZ3A 2DK5A 2EFQA 3V4GA 4RAZA 3WGIA 1SD7A 2H94A 4IXAA 4XF0A 1FSEA 1PP7U 2E7XA 4J1XA 1KU2A 4ZH4F 4L5IA 2FMLA 3M8FA 4KA4A 1T6SA 2VE9A 2ZBKA 3FFQA 3TNPB 2Z99A 4LB5A 1B4AA 1KQ0A 4Y13A 2JPBA 3ZPLA 4XRFA 2VODA 2Y75A 2KIMA 4LGWA 1LVAA 1FBQA 2HZTA 4GO1A 1YWKA 4P9UA 1F9NA 3HOTA 5K1YA 1CF7A 2IW5A 2DU9A 3MDPA 1H9GA 1HQCA 5LHHA 2D5HA 2L4MA 5KHKA 5FCCA 3NL1A 2LF8A 3ELNA 1Y0UA 1YS7A 1QZZA 2MD5A 5CLSA 3CL1A 1XB4A 5ILVA 1K78A 4F7ZA 1S6LA 5HDKA 2YX7A 4EROA 5ILSA 5BXXA 3H3ZA 4UV9A 1EYBA 2FF4A 3REOA 4G8XA 1IN5A 5AIPA 4WZCA 2X4HA 3GO5A 3QPHA 1U5TC 3C18A 1XRUA 5BV6A 4MGIE 3EDPA 4AQ2A 1G3SA 3DXJF 2V9VA 5J48A 4O3MA 4M73A 4IHTA 3QU3A 3H1YA 3K1NA 4KWLA 5D5WB 1FT9A 3S7IA 3PQKA 4IEZA 2IA2A 2OD5A 1X8MA 2ZNYA 2VBYA 3PFIA 2O61A 2DI3A 1ZRFA 2R7FA 4XETA 3ZMDA 1W5SA 2DQRA 2EAAA 5FQ0B 2YU3A 5DCFA 3MZHA 2GC3A 2OBPA 1VP6A 1U6GA 1OFNA 4KWKA 2C6YA 3EBRA 1Z6TA 1FYMA 2EA7A 1Q1HA 1XMAA 1T98A 3MAJA 3KEOA 4IERA 1R7JA 1MJAA 2ZMEA 1W7PA 4YG2F 4ORFA 3J80Z 2OA2A 4QM8A 2KRFA 5L3FA 4KL1A 4FAGA 1SD4A 1B9MA 3I5UA 1G4DA 1D8JA 2R7DA 5KK1A 4ETSA 2DQLA 3HT1A 2O1QA 1FI2A 1J59A 1EY2A 5JR3A 5FLHA 3H50A 1AWCA 2K7LA 4HDUA 1Q3EA 2PFWA 3KZZA 2L02A 2QQBA 1YFHA 1YYVA 4YFXF 3P9CA 3KZYA 3W6JB 2HWVA 2B0LA 4CICA 5DUKA 4QXKA 5FPZA 5JR7B 5J3UA 1F1ZA 4HX4A 3DPLC 2KIFA 1UIKA 2Q0AA 1FP2A 3FM3A 2D1HA 5ERIA 1DUXC 3T8TA 5J6XA 5FGMA 3F22A 3HRSA 1XSDA 3L2CA 4U0WA 3RNSA 1ONVA 3I53A 4XLPF 1NHAA 1USTA 4RAYA 2EA2A 3V7SA 4AQ6A 2A68F 2B8MA 5FD6A 3LA2A 2MC3A 5D6EA 5C8WA 1ZHFA 3SQNA 1H9TA 5D8KB 1OKRA 2CGPA 4PGHA 5HI0A 3WW4A 1BM9A 2VPVA 4I09A 5IT3A 3RZZA 4CO8A 1IPJA 1XMKA 2PQQA 1DGWA 4LULA 2EFPA 1OPCA 2BE5F 4CDGA 3SHFA 2GXGA 3KP4A 4P5OA 2DFIA 2F5FA 1BI0A 5KBFA 4E2QA 3WTYC 4OFGA 3WW2A 2G9WA 1FPQA 3L9FA 1ZRDA 5I0UA 4S05A 4Z2YA 3SZTA 3TO9A 3QACA 2GIVA 1RZ4A 2FBHA 3BZ6A 3UKTA 2VBWA 1HKQA 1X3UA 4ENMA 3TDZC 4HN0A 1F5TA 4KDPA 2QVOA 3R60A 1FSHA 5FQ0A 4FHTA 5J7MA 1NYWA 3MQ0A 1S8NA 2UYAA 3S7EA 3ECOA 1WWXA 2OU2A 1WKMA 3T5XA 3ZMVA 1OYIA 3P9KA 3LA3A 3KGLA 1IXRC 1D5VA 2Y48A 3MEXA 2PAEA 2RC4A 4AIJA 2QDRA 2YPRA 4META 3F8NA 3GFLA 4LG0A 2VT2A 5K5RA 1IAWA 3CTAA 4KIFA 2KXLA 4LA3A 5DEQA 2XLFA 2OPKA 2VC0A 2V1XA 2HEOA 3HQXA 4AVAA 1EH7A 2EJRA 5E1WA 4X6QB 1ZRRA 1RNLA 5BOXA 5DDGA 4A5NA 1J7KA 1IXCA 3RPQA 3F21A 2L3DA 4Q5SF 3SZPA 4KUMA 1UB9A 1U5TA 4HSJA 3SCFA 1BC7C 4QM9A 2A3SA 3WW1A 3ZMSA 1TNSA 2W85A 2O8XA 1H1MA 2MH9A 3I59B 4XF3A 4EM0B 2JTVA 1BN5A 4HVOA 1YO5C 3EUHA 4ENJA 3DP7A 3FXUA 4IRHA 2ZFWA 2JSCA 3R61A 2W24A 2GAUA 1LB2A 1GXQA 3EHKA 3QP6A 3QOPA 3G7DA 1YW9A 1QGPA 1ZN2A 2YR2A 2JZYA 3KMHA 4HQEA 3T1BA 4L9JA 1FC3A 5TJJA 4PZJA 2E1NA 1TTYA 4S04A 1HSJA 3KP7A 1SFEA 4LUMA 2JRTA 3G73A 5BMZA 3ES1A 2TDXA 5BPIA 1I1SA 3KETA 1LKNA 5JSPA 1J3PA 3WGGA 4U7BA 3JTGA 3E5UA 5CVVA 2B9UA 1KU7A 3P7NA 5BQTA 5E18F 4Y17A 1CAVA 2OQGA 1RI7A 2XIGA 4RB3C 2OAZA 1Z9CA 1ZZCA 1CAUA 1ZZ9A 1WLTA 3WE3A 3R0AA 4IRIA 2FQ3A 4KWJA 4WK8F 1TQPA 2LSOA 1MZBA 1ZVFA 4U0YA 2W25A 2A69F 4YFNF 5LGTA 1RL3A 2CV6A 3V8JA 2CO5A 2NRAC 5L3EA 1ZZ7A 1G3TA 2XLAA 4UHTA 1VTNC 3WTUC 2H27A 1IF1A 2QVSB 4ZU4A 3WU1B 4PIXA 3U0ZA 3F8CA 3HIFA 2ELHA 1WRJA 4ZU5A 2P7VB 3TDUC 1NE6A 5ED4A 5BPDA 2EVXA 1XGOA 1KYZA 2HR3A 4MX3A 2EV6A 3WTWC 1QXRA 4GXOA 1UD1A 3WW3A 1O3RA 4R79A 4MTEA 4JBAA 5HDGA 5I93A 5L3CA 3LZZA 3QP5A 5JI6A 4MZUA 4LA2A 2VONA 2GH2A 1SMTA 4KICA 1T2KA 1U8RA 5LRSA 2LKPA 2RGVA 1DP7P 2MLGA 4FX0A 3EQEA 5F64A 1UHMA 1P2FA 2H6BA 4LTAA 2DAOA 4HBNA 3OTFA 1ON1A 4MGZE 2IA0A 4JTNA 2IJLA 5F1RA 4X6RB 3DFGA 4UVAA 1HW1A 1MJBA 4UXNA 5CVJA 2WV0A 3PQJA 3ZP5A 1XDSA 3GYHX 3E6CC 3D0JA 3Q9VA 2QM3A 2O3FA 1Z91A 5L3GA 4FBFA 5FLIA 2GA2A 4L0YB 4KN7X 2C0ZA 1YFXA 4FX4A 4EWDA 1FOKA 3V8LA 3Q9SA 3FHZA 3QAHA 1FX7A 3RDIA 2IT0A 3ISPA 1LEBA 4GYGA 2F5DA 2V09A 4I2OA 4ENKA 1ZZ6A 1TBXA 4DINB 5FFXA 2W84A 4N9IA 3OD0A 3SHRA 1W7PB 3H9AA 3KP6A 5H20A 3NRVA 1EV7A 2KJCA 2VBZA 3E6DA 1IPKA 2XRNA 4QGMA 5H6QA 2PQ8A 3HTSB 1O57A 1ODDA 3D0SA 4L9NA 3FWEA 4LLNA 4WVZA 4HDVA 5E1XA 3OGJA 4IEOA 3H1MA 4LMYA 2QJVA 4MNUA 2JPCA 2NYXA 1IRGA 3DQVC 3E5QA 1ZREA 1O3QA 4O9GA 4H0EA 4J1WA 2PLYA 3RKXA 2ISYA 2J5OA 3I58A 1IN6A 4E2SA 1ZARA 3ZMTA 4PJYA 1JXSA 2IXIA 2F5CA 4BNCA 4ESFA 4YSFA 4LK0F 3CEWA 3UKNA 3IDCB 1ZRCA 4QWQA 4ZYHA 1B9NA 5D5XB 5JHUA 1CAXB 5E1RA 4P96A 5LEKA 1I27A 2COMA 3BP8A 1SD5A 2HDCA 2XVCA 2DPUA 1IRFA 3BALA 4YFKF 1MDMB 3EQLF 2ZCWA 1QPMA 3RPUA 3RJPA 2W57A 3BU7A 4IF4A 2EB7A 2FA5A 4M6XA 3DEUA 1HW2A 4RB2C 4G94A 3IKTA 5IT9Z 3C1DA 4EV0A 3H1WA 1P4AA 1RIOH 1QWRA 2F4PA 1UIJA 2PEXA 2QBYA 2QNKA 4XFCA 4E2GA 2VOOA 1D8KA 3R6SA 1ON2A 5H6RA 1QNTA 1KU3A 2M5WA 2GZWA 4EQQA 3KLNA 1UCXA 3DV8A 3QPTA 5I0SA 3LAJA 3VFZA 5FLXZ 2ESHA 1SFXA 1W4MA 3CO6C 1KA8A 2UZKA 3WODF 5I8YA 1Y9QA 1R5HA 3J80K 5D6FA 3GFMA 2VQAA 5HLGA 3D82A 1I5ZA 5AONA 1CAWA 2P6SA 4MUVA 2FXAA 2K4BA 2D93A 1IN7A 5A2QZ 2I45A 4Q0VA 3CLPA 2PMUA 2H6CA 4QLCU 4HV5A 4G7ZF 2CWEA 1ZZ8A 4M6YA 3WTSC 1DDNA 2FBKA 2ESNA 3IRQA 1ZH5A 5IT9K 3L09A 2VECA 2HGCA 1FY7A 3LSTA 3BPZA 2P5VA 4Z82A 2QENA 2OZUA 5HS7A 2X0LA 3K2ZA 4FAHA 5FD5A 1J2XA 4AIHA 4WX9A 2VC1A 3BJ6A 4R8HA 1ULYA 5TRDA 1YW8A 1XSVA 1UHWA 2PA7A 4EWAA 3BROA 1O7FA 4LG0B 4FT8A 2XHKA 1XGNA 1SFNA 4BQAA 1BI3A 3NVCA 1WQ2A 5HLHA 3WGHA 3LAGA 3OCPA 2ACJA 2D45A 4NVPA 2IRFG 3M8EA 3LWCA 3ECHA 5JAXA 2QYOA 2CQKA 4GCVA 1J5YA 5EZWA 2EA4A 4L0ZB 4AVCA 1FLIA 3IIAA 3BCWA 3KSCA 3V7CA 5L3BA 4B09A 1ZZBA 1VR3A 3FXQA 3GW2A 1R58A 1GQGA 4Q0UA 1HW5A 3IWZA 4LD5A 4MTDA 3VODA 2JT1A 4HQMA 1HBXG 4RGUA 4IEQA 4K8FA 3OF1A 1O3SA 4Q29A 1FNNA 2IA1A 3J81Z 2L4AA 5A2QK 2K9ZA 4AXOA 2M30A 3WTVC 1DZRA 1S3JA 4EM2A 4KNYA 1HSTA 4UV8A 3FF5A 2DK8A 4I7HA 3HOSA 1ZNPA 2OYZA 5FLXK 4PGGA 5E16A 4IRGA 2QBYB 4UVBA 1S29A 3U11A 3HT2A 3GFIA 4YYOA 3GYDA 3LQRA 4HVRA 3E6BA 3HHHA 4P55A 2O0YA 2OA4A 2BEOA 2Q30A 2Z9OA 2D1VA 5DCMB 2MHFA 1R00A 1U12A 4IEPA 2VT3A 4IJAA 4HVQA 1Q43A 4UNOA 3EYIA 2ADUA 2DLLA 4B8XA 4G7HF 1P6RA 5D1IA 2LF7A 1WA4A 1S7AA 4IPAA 5FO5A 2G7HA 4JQFA 3EETA 4MEYF 1G3YA 3CUQC 1SMYF 2QWWA 3TOAA 3U10A 2ZO4A 2WTEA 1RGSA 1TQMA 4XFAA 4HMZA 2P7CB 1WI9A 4XLNF 2Q1ZB 5JCTA 4EJUA 2PYTA 4IESA 2E9QA 3O2PE 1GXPA 2BBYA 1SFUA 2L54A 2PBIA 2RQPA 3RYRA 4XFIA 3VOEA 1LNWA 3U1DA 3I54A 3M9AA 4HV6A 2Z2SB 2XV4S 1LDKB 3KP5A 2CG4A 4BHCA 5EEHA 3QU6A 3ERED 3HRTA 2PMHA 2ZKLA 4RD7A 3O3KA 3UKVA 4OLLA 3F6VA 1R22A 1EH8A 5J8CA 4YRDA 3USSA 3S0MA 5BY5A 4I0AA 4LLGF 4I02A 4AIKA 1OYWA 2HKXA 1U3EM 2IXHA 3L7WA 2EFNA 1YLFA 4LLLA 1X7NA 1BOAA 1XN7A 2E1CA 1J3QA 2DCTA 1XGSA 5K8SA 1LEAA 4MGKE 1P4XA 4QMAA
chains in the Genus database with same CATH superfamily
4KYWA 2PLV3 3BWGA 4HLXA 2ID6A 2P6TA 3FMRA 3VB9A 1LOAA 1MACA 3M3EA 5FZBA 1RUC1 2H0VA 1U2WA 1FOWA 3LNQA 3SCHA 4M3CB 2HPIA 4AD9A 1VAKA 2BQPA 3NQHA 3F23A 2ZJ2A 3RKWA 4MIMA 3BG9A 1D0ZA 4CXFA 1QJFA 5ILUA 2A6YA 4QX0A 1YFWA 2ZGSA 2XPVA 1JTYA 3N3HA 4JVAA 4F3QA 5D21A 4DOZA 5C9AA 3NSTA 3K3OA 5FROA 3OSGA 2GN7A 4QHOA 3LF7A 1IXSB 5C8CC 2M0MA 4B4QA 3MFAA 2L01A 2XAFA 5M0TA 2IUWA 2BXYA 2KT0A 2ECBA 4IEUA 2V1DA 3GTMJ 2GMMA 1VBD1 3CUQA 1COV1 4Y26A 2A6HF 1PX4A 4XBNA 1SD6A 3Q5FA 1FZPB 3FXOA 3SDBA 3H1CA 3H8UA 3H0GJ 2V26A 4UW4A 1LPQA 1ZAOA 1QJU1 1RC9A 3C3WA 2XVLA 3TEWA 2NQYA 2BXZA 2AEYA 3FHNA 1RUI3 4ZZ5A 1HKSA 1I1GA 2GC0A 2K27A 4GWIA 4Z2AA 3OMYA 4KQ7A 5K7HA 3B02A 5GAEJ 5J40A 4NN0A 4Y7NJ 5JZGA 2HTJA 1QU0A 1LFBA 1UU4A 4KG8A 4P9YA 3I3MA 1OHFA 1BC8C 5J8FA 1PGSA 5F0FA 1DQ6A 1YE9A 3OR1C 1K6OA 1ETYA 2K9MA 1MH3A 1JI6A 2E1MC 3M1EA 5HV0A 3LA7A 3CF6E 4RQPB 3GZ6A 1IN4A 3VEPA 2I07B 1JUPA 1F5JA 4WM8C 1H4GA 5FOJB 4HF0A 2Z69A 5ICFA 1ULFA 4QPIC 3QRFF 3G1OA 2R7RA 5GPAA 1RUNA 3KV5A 4E4DX 2O8QA 1DLCA 4HW0A 2WO3A 1S0GA 3GEZA 2QSFX 2RN7A 2XONA 3HPHA 4AGGA 2PI0A 1MSEC 4E9KA 3IWFA 1LEDA 3PURA 4ES8A 2FSWA 4XF9A 1R64A 4COYA 1NG0A 1Z3YA 1ZBA1 2L9VA 3RPUD 3WF4A 4KITB 2AS5F 2GDFA 3VB2A 2WNUC 2K46A 2B5HA 3AG2H 2XASA 2OTLI 1LDJA 3IV5A 4YVSB 3TN92 2WFF1 2QZ8A 2FQPA 1SAXA 2VBBA 2BNOA 2WNEA 1KGSA 1Q8SA 3TN93 1Y3TA 1YFUA 3C3VA 4FTBA 1SAUA 2F4LA 4ZZ8A 2ZMEB 1Z6RA 4XF1A 5KXBA 1SHWB 5IVVA 2E32A 2LNBA 1H8TC 3U1KA 4QGLA 2X1CA 5C8CB 3KP3A 3TOBA 4V2VA 1DZQA 2NAZA 2BY3A 1EPZA 1V5FA 2WV1A 4L92A 2WJSA 3KCYA 3LD8A 1ULPA 3COAC 3PO3J 4KN4X 3EO6A 1AYN3 3NQOA 2WAAA 3CO2A 1OPMA 2DMPA 3ILNA 5JXJA 2WNVB 1I6HJ 4O7XA 1R4NB 4I0BA 2EXKA 1HDDC 4CP0A 3VDCA 2FD8A 1X3WB 4EVIA 3ZFGA 1SDDB 5IVBA 2QQOA 4N7IA 4AVTA 5CJ9A 2R49A 2WIIB 1FPN1 1Z1DA 1RMU3 4AI2A 1VMFA 3N97A 1Z3XA 4CH7A 4YIIA 3K4KA 2ZOEB 1RB8G 4L5JA 3J7AO 2BOJA 3M3IA 1D2SA 5C6CA 2X5IA 1TG7A 1JN2P 2WNVA 3HYIA 4IEWA 4UW6A 2J42A 4XDOA 3DPUA 3IMNA 2P8TA 3OPTA 3JU9A 3MKYB 2A6EF 1GHCA 2UXXA 3FM5A 5JLVA 4A3MJ 4P14A 5FB2A 2DA1A 3VBRA 2Z5UA 4XBQA 2AO9A 2OPWA 2RDRA 3OYDA 3W2AA 2KRCA 4LBJA 4W6YA 4OAYA 3OIOA 2A5YB 3VBHB 4FPOB 4K1YA 3ZFEC 3D1NI 4COUA 2LMDA 1DYOA 2HWE3 3L1PA 3QYBA 2BGCA 1QHHD 4RS5A 1K3IA 1R1VA 2VJIA 1V54H 2VTXA 3JCUC 3TNQA 3CU7A 3MZYA 2BNNA 2PMZN 4D7NA 1YEWA 3HOXJ 2P4WA 3ETQA 2P34A 1W99A 3HQUA 5JZGC 1BQPA 3A0BC 1OR7A 4JX4A 2GXAA 1XNDA 3TEDA 4HSRA 3PO2J 5CBLA 1KU9A 4LPLA 3VBHA 4OIPF 1VLNA 1SDWA 4B3AA 3ZXEA 5FYHA 1UJ8A 2VZQA 3IDEA 2HWD1 1IZ3A 4Q4W2 5I8TA 3INAA 1UPIA 3QBQA 3AVSA 2C6SA 3GHNA 4RMNA 3HSRA 5A33B 3BTAA 2JJ6A 1BBYA 4BXUA 1A78A 1MZ6A 3DPRA 5FMCA 3WVJA 3JD73 3H92A 2V1UA 4GMP3 4JC1A 1DGRN 2VNGA 3L00A 1CQTA 4QPGC 2ET1A 1XXNA 1UOFA 2VXZA 4EJTA 2JUGA 2D6KA 2D2WA 2ZC2A 3S16J 2AZ5A 1P7IA 4A3LJ 1VMJA 3T08A 3O6BB 1PZ9A 4XDQA 4I01A 4CYCA 2B63J 3FN9A 2VUJA 1DHKB 2OZ6A 1GWLA 2HWD2 4BXSV 4EM1A 2K4JA 5I91A 2P5BA 3OGGA 3BB6A 5JIAA 3HGYA 2XAQA 4WZFA 1DYKA 3ASOH 4LIUA 1AXZA 4OMDA 3CNAA 2X09A 5KHIA 5JFRA 3O1TA 4XKBA 2O7OA 3G3ZA 3IHUA 5HV4A 5ICGA 1QEXA 3WU0A 1Y7BA 5FXZA 2OF7A 3GVAA 4KMQA 3ZO0B 1ETWA 3KPHA 5C3SA 2LC2A 3NEUA 4XSZF 2VL8A 4Z6YA 2Y60A 4RFRB 5FP4A 4HSLA 2DO7A 1Z0XA 4GGGA 2R0HA 4SLIA 2M1BA 4NDLA 1O7LA 3B7MA 2ZJPF 1W6NA 4DMIA 2QCSB 4XR6A 3VBRB 4EWEA 2CWSA 1PMIA 4ZS3A 1EV12 1U9NA 1IRXA 1MS8A 1TME3 1PYVA 4IEXA 1Z21A 3OYIA 4Y33A 1LVKA 3F72A 3M3YJ 2R7QA 2M8EA 2ZXJA 4ESJA 4WM7C 3BR5A 5C3OA 1PX3A 3BU0A 1UYZA 4H7LA 3LFKA 5K5QA 2BY2A 3KM5A 2X6WA 2LRPA 1RUG3 4OHXA 4KIBA 2O0OA 3OJBA 4QQPA 2HQ5A 5JHFA 2ZABA 2JKBA 3IRRA 2VZ1A 3JSOA 4L11A 5FREA 1GU3A 4FP2A 4Y24A 5IYBJ 2YY1A 1CN1A 1H0MA 4TZDA 1FTTA 2A6WA 2X5IC 2ICWG 3NWSA 5DD4A 3VL9A 4ASKA 4PHZA 5HNFA 3OYWB 4OINF 2XROA 4B29A 2DCYA 2IXLA 5D2AA 2BV4A 3F8FA 3MD2A 1C57A 4XUNA 2HXIA 2W0XA 1IUYA 1WW6A 1YJ9I 4NBQA 1BEV1 2IWGB 5T3NA 5EYYA 4P9FA 2HWB3 2HJIA 1LAJA 1DU6A 2AXTC 3JRAA 3VL8A 1U78A 2PFBA 1W6QA 3VYRB 3FMQA 2B39A 5DS9A 1Q5OA 5FO7B 4UB8C 2XJQA 4WVMB 1V6IA 1UXXX 2GQQA 2Q0OA 1J58A 3ABLH 4S0HB 2DFBA 4UYBA 3WE2A 3CJXA 2FNAA 1YG2A 5A32B 4BZ4A 3R4DB 2QKLB 3ZYRA 1LESA 2PJPA 4EJOA 4B43A 3K3NA 3H3UA 3ZQ7A 4PK4A 4LK1F 2FNPA 2QQ8A 2EIKH 1Z05A 1QO0D 2BW3A 1T6BX 1YCIA 3HQRA 4XQFA 3V65A 4A6EA 1W8FA 4JGYA 3BOWA 1UL9A 3DLAA 1BIAA 1L7LA 4XNFA 2EZIA 2NNNA 1YIFA 1Z78A 2BW8A 3M3QA 1AX2A 1L3JA 3AYAA 3KWVA 2VE8A 4IDZA 3Q8FA 1P9QC 4A6OA 2HYGD 1QF3A 4ONUA 4DRRA 4MQ9F 4Z1VA 3MCZA 1Y39A 2CV0A 4GIQA 2BVBA 2Q2EB 4BCUA 3JD71 2UYBA 1LOFA 2CYFA 3WX5A 1P4WA 2VNVA 4JRAA 3T4HB 5K0UA 5CFDC 2AXLA 3B9IA 3LSMA 3EXUA 2K0GA 1SEFA 3BT9A 4XRSA 1NH3A 3WG3A 3O1SA 2TEPA 3B73A 3IH2A 4U0VA 2IZWA 2OUMA 1TQ5A 2D3RA 3R0JA 4A0ZA 1U5TB 1C5IA 3PUAA 1R49A 1XNKA 1B35A 2ETHA 4MGYE 4LOCA 2STTA 4XEZA 1LDDA 3F8MA 4XXPA 2TRTA 5FMDA 1O8SA 2LTNA 3FKJA 2LR8A 4YM1A 2VAUA 2HWD3 2IGOA 2P1BA 1H6YA 1HDPA 4BJ5C 2A6XA 4HF1A 3F0CA 4DYQA 4AVZA 3FE5A 1R36A 3GX4X 4EJVA 3SJMA 3D5LA 1RYYA 1AXKA 2DDBA 1HRI1 3W6VA 5J96B 3OUJA 5SV5A 5FPAA 4V19K 4DQAA 5E79C 2VJJA 1XC5A 5A7NA 3AP6A 2DT5A 3JREA 5E17F 1R6RA 3V8KA 1WD4A 4BM8A 5M3FJ 2XB5A 4Q8LA 1H2LA 1JYNA 1VF9A 1LR5A 2EV0A 1PO21 3RFRA 4BY1J 4NRPA 2P5KA 2O03A 4B4RA 1XPWA 2HQRA 3TEZA 3E0JB 4XTPA 3CDHA 2D6NA 5FP8A 1ZG3A 4BY7J 1FWZA 3LWFA 1H1IA 3HRUA 1AUYA 2I8DA 5ANQA 4LUKA 3G2BA 4RAZA 4IQ4A 3H3VK 5FY4A 5JXGA 2LKSA 3C2UA 4EEFG 3ZPOA 4J1XA 1SVLA 2W3JA 1OFCX 5FYUA 3M8FA 5FKOA 3WLUA 2KZVA 1WBFA 3FFQA 3A22A 2JPBA 3ZPLA 4P9WA 5GAGJ 4E7HA 3PVOA 4LHNA 2KIMA 1OF3A 2RS12 2ZGLA 5IT6A 1LVAA 1JOBA 5B1AH 2NVXJ 2ZS6B 4FXKB 4P9UA 4LIVA 3PUBA 3PVEA 4L5EA 3SH5A 1H9GA 1OH4A 2D5HA 5GLVA 3JUUA 4M3CF 3NL1A 1W2NA 1YS7A 1QZZA 2QQLA 3EUAA 3CL1A 2NYYA 3ZFFA 2W82A 5J1XA 1UY0A 2CUJA 1KITA 5BXXA 3GZTB 1OD3A 4UV9A 1EYBA 3REOA 4G8XA 5AIPA 4WZCA 2JVGA 2RR12 4BXFA 3C18A 4BQWA 5A1LA 3ZCOA 3B69A 3DXJF 1EA3A 5G04L 1GOGA 4JZRA 4NOTA 5A7SA 5J48A 1QPIA 3HOWJ 1LHOA 3K1NA 1SPPA 2DUPA 4N43A 3CCJI 3PQKA 4S2GA 2ZNYA 3I9V2 3PFIA 1AR62 4XETA 3EUKL 1W8HA 4CA9A 5ACA2 1AU7A 3IP4B 1ZBE3 2R1BA 2Q8OA 5EEAA 3WG7H 2BVVA 4XLCA 1JT6A 3AL0B 2NPIA 3FDYA 3K46A 2VOXA 1U6GA 1XYPA 2ZTNA 4ZPIA 4IX7A 1POV1 3EBRA 5FZOA 1VQ8I 2NVQJ 2F4MB 2F6CA 3K4NA 3J8F2 4IERA 1GLNA 1T95A 4YG2F 3L2VA 3N9OA 3J80Z 2KRFA 1KJLA 4FAGA 3M8LA 3I5UA 2WRAA 3WP6A 5KK1A 4ETSA 2O1QA 4A3IJ 1J59A 1FMD3 1JYCA 4CZSA 1B35C 1S7EA 2EALA 3WNPA 2K3PA 2CU5A 3FFZA 4M00A 3LPGA 4HDUA 2PFWA 2AENA 2L02A 3CD6I 5E8AA 1Y1WJ 1K5MB 1YYVA 4G6TB 5JUVA 4QXKA 5JR7B 1PO23 4PI0A 4HX4A 2HXOA 4L0PA 4V1PA 4FISA 3FK7A 3VD5A 4AI1A 2M2EA 4KBBA 2WFF2 5FGMA 3HRSA 4JX0A 1VQPI 3OBAA 4L8QA 1ONVA 2MEV2 1NHAA 2DVFA 1USTA 1JKRC 1T8IA 5GM0A 3V7SA 4QPIB 1GOHA 2EZLA 3OYFA 1RIRA 4GXLA 5D6EA 1RUE3 5DZGA 1PVEA 2JX9A 2GNBA 2E1MB 5DDJ3 4NHLA 3ZFEB 2VQCA 3MEPA 3WQBA 1DGWY 1G7YA 2VPVA 4I09A 3IH4A 5IT3A 4CO8A 4LR4A 2JJ7A 4QD2A 3ZRGA 4M0NA 2Y6JA 2JA7J 1MH4A 4KGQA 4XJAA 2JQ7A 2ARXA 3MW2A 4LJHA 3S93A 3VD9A 3KP4A 1JKQC 1OLRA 3OEBA 2F5FA 3MIGA 3VDXA 5EZGA 3VBSA 3AJYA 4OFGA 1I9RA 4HKLA 1FPQA 3L9FA 1ZRDA 4S05A 1AXYA 2AACA 3P3PA 2FBHA 3BZ6A 5DG1A 3BTIA 5ABJB 1V9U2 2VBWA 3TDZC 5H2FC 3I2JA 5FQ0A 2WB1A 1CZVA 4GALA 3OL4A 1MMDA 3MQ0A 4JGYB 4Y22B 3GZAA 2PLV1 2VOTA 3GZNB 3KGLA 3THCA 5EDNA 4PSXA 2OX0A 1FIPA 2PAEA 4AIJA 3ASNH 2N8GA 4YEJA 1G9CA 4XICA 4KIFA 2KXLA 4TN7A 4SBVA 4PFPA 4PLMA 2WFF3 3B9CA 2ZXQA 4LXLA 1FNYA 3HQXA 1N3PA 4XRMA 1JZ4A 1H2NA 1HV0A 5AVAA 3MW3A 2ZHKA 1D4M3 5DDGA 5EP9A 4ASMB 2X48A 4GJZA 3W59A 3RPQA 1IKQA 2L3DA 3K70D 3ZYFA 4KUMA 3VBFC 5FOBB 3G6EI 4BQYA 2W85A 5DUUA 1N75A 1FOXA 2MH9A 3ZN5A 1OOPB 3VBFB 3ZKUA 4IRHA 3N7MA 3PJRA 1AJKA 1PUFB 1YI7A 3R61A 3Q0VA 2WLQA 1N3QA 3U78A 1BLZA 1YW9A 1B8IA 1OOPC 3Q8BA 1LENA 3KMHA 2F48A 3T1BA 4DXSA 3H42B 3MMYB 2E1NA 3ZFGB 4CE8A 4S04A 4LHKA 3S1RJ 4RQPC 3KP7A 1SFEA 1NKGA 2JRTA 3G73A 2WN3A 4G3YC 2D98A 3ZSJA 2V9PA 3SEQA 3B5LB 1J3PA 3OBTA 3E5UA 1TVGA 5F2SA 4PQQA 1BL0A 2B9UA 2QUOA 2HYJA 4DUVA 1PVXA 5A6ZA 3THDA 2IS6A 4MHUA 5F3GA 1F8VA 4ET7A 2OAZA 1ZZCA 3ZPYA 1U5XA 4IRIA 2FQ3A 2HOTA 3S32A 2L7ZA 2BERA 2NMOA 3H3LA 4CEWC 3TBDA 1AL23 1VQ5I 2Y34A 2KD7A 1ZVFA 4Q1RA 4GFBA 2A69F 4YFNF 2CV6A 3AK0A 1WGXA 1ZGWA 5EYRA 4FPGA 5AFBA 2VMFA 2JB8A 2XLAA 3MPPG 3MN2A 1MZ5A 1VTNC 2KISA 3K4JA 3T2OA 5FWEA 3MUZ1 3Q8CA 4EN9B 3F8CA 2P7VB 4QSHA 1NE6A 5ED4A 1KYZA 2HR3A 1SC7A 3PTYA 1AR91 1NZIA 2F4OB 3WTWC 2DBIA 4IL7A 3ZSLA 1UD1A 1SMVA 4X6AJ 2P6CA 4LBQA 1RUJ1 3VBUB 1VMHA 5JI6A 5GP9A 4LA2A 3CDZB 1MS5A 2ZSIB 4LOTA 1HC8A 4BJ0A 2Z79A 2H1LA 5IP6A 5F5AA 1R091 1WJ5A 4RLFA 4EE2A 3WNKA 5BNOA 3NNMA 3I3EA 1UX7A 2H6BA 4RGGA 5ACA1 5J47A 4AI8A 2YBPA 2IA0A 2OC6A 1A5JA 2WZ8A 3DFGA 4UVAA 2GP5A 3U1XA 5CVJA 2WV0A 1FTZA 3ZP5A 1W8OA 1CPNA 4LO7A 1UPSA 1ZBA3 2M9HA 3WNLA 4C1WA 1JMUB 3E6CC 3Q9VA 5FXXA 2E5ZA 2O3FA 2QM3A 2ZFUA 2VR4A 5KC6A 5JOYA 4GD4A 4Q4X2 5IOZA 4FX4A 2UWBA 1FOKA 3LL7A 3LSRA 3FHZA 2XJSA 2HVRA 5FZMA 1S9HA 4GYGA 3H9GA 4I2OA 5IPAA 5C7GA 3ILFA 1HQLA 1W39A 4M3DA 3H9AA 5A1FA 3A23A 3NRVA 1IOAA 1AL22 1OH3A 3VDDB 4JGZC 3BZCA 2VZSA 2R7VA 1H6XA 1ODDA 1IO2A 5A3OA 4N7UA 4HDVA 5E1XA 3OGJA 3H1MA 4AL9A 2R5YA 4L9BA 1HQNA 1IRGA 4BGDA 1AYM2 4QT6A 3JQWA 4H0EA 4J1WA 3T3YA 2SBAA 3RKXA 1W03A 3QPLA 3SC7X 2VMGA 3I58A 1IN6A 4A7ZA 1VQLI 1RHI1 5AFEA 4BNCA 4ZTFA 3UL2A 3K4CA 5T54A 4YSFA 3WOGA 1WW7A 4AI9A 2ZGQA 4QWQA 1B9NA 5D5XB 2RS11 1UYYA 5E1RA 4P96A 3VHOA 1IJWC 2HDCA 2ID3A 1UZZA 1LOEA 4IF4A 4XKCA 2CUEA 5IYCJ 3D4KA 3M07A 3T0BA 4MXWB 3CDIA 3H1WA 1RIOH 1GT0C 1QWRA 3B94A 2F4PA 2RMU3 4S2FA 2PEXA 2QBYA 4E2GA 3ZXSA 3TRSB 1QRYA 2IVIB 2R30A 1D8KA 2JG9B 1OA4A 1QQP1 5M5WJ 4NIIA 1TZLA 2QQJA 3PMEA 4Y4RA 2GZWA 4EQQA 4NPLA 2ARAA 1E5IA 3VFZA 5FLXZ 2ZGRA 5J1RA 1W4MA 1EV13 4CP1A 2VQAA 5HLGA 2QQVA 1I5ZA 3GF6A 1I3QJ 1NLQA 2P6SA 1OISA 3JXSA 4K3UA 4NHYA 2R7UA 5IP9J 2FDIA 1IN7A 2GOXB 3CLPA 4PDWC 3VZOA 4HK8A 4M6YA 1YJLA 1ZH5A 2QKMB 3L09A 1FY7A 2YV8A 3BPZA 1MQTC 2QENA 2OZUA 4QIWN 5HS7A 1J2XA 1GQPA 3CC2I 3DKQA 3BJ6A 1YYNA 4R9DA 1ULYA 5TRDA 1XSVA 1UHWA 4EWAA 4X8NA 3BROA 1O7FA 5CFCC 4K9SA 2WAQA 1WQ2A 5HLHA 3WGHA 1TNFA 5IUQA 1WFXA 1YX5A 3B6AA 1TNRA 1CVNA 4NVPA 2IRFG 1SVMA 3LWCA 2DMUA 3ECHA 3WDVA 3S3MA 2CQKA 1M06G 3I49A 5EZWA 4L0ZB 3TBIA 1Q8VA 4QAWA 1FLIA 3KSCA 3Q8EA 3N36A 2VQ0A 3JD72 1MIJA 3MW4A 4IV1A 4W6XA 1Z67A 3FXQA 1R58A 3S17J 5EYXA 4UT5A 3VODA 4HQMA 3H0OA 1HBXG 2K9SA 3KQRA 5ISLA 4E4HA 1S0BA 2Y31A 2QDNA 2BHYA 3AL0C 4DBRA 1HSTA 4Q4V1 1QJU3 3N05A 4WVMA 3W58A 1UKGA 1Q1VA 3G1MA 4I7HA 3VKLA 1W8WA 3P6BA 4FPJA 1OURA 2QBYB 3KIOA 4ZY9A 3RI9A 3GYDA 2BWAA 3M4FA 3JRGA 3OY8B 3G6JB 3DF0A 2E60A 3H9QA 2LKXA 3CJIB 1R00A 3UYJA 1PZ8A 2XOMA 2WLPA 2YB7A 1RUE2 1V9U3 3AXEA 4YVWA 2OS2A 3C8XA 1TWAJ 3MLJA 1TME2 2VQTA 2G7HA 1NX9A 1N1VA 1RHI2 5ERLA 3BKZA 1J1TA 3FLTA 1QOTA 1AR92 2QWWA 4HONA 3BTCA 4RS5C 2WTEA 2FZ2A 5FZKA 3GNEA 3B3QE 1QDOA 1A6IA 1YRNB 4A45A 2WN2A 4LK6A 2YUSA 3HM5A 1US2A 4W8JA 2BBYA 3WDUA 1JZ3A 2QE3A 3I2FA 1W6MB 2R7EB 1DBNA 3LQCA 2BGPA 5IATA 1EF4A 1W90A 1LDKB 2CG4A 5K7FA 5EEHA 2E35A 1VBA1 2RMU2 4XHBA 3ERED 2B45X 4RDUA 2ZKLA 4RLQA 2CL2A 4II3A 2XAUA 1H8AC 1EH8A 4P08A 4ES9A 4GMP1 3FIWA 1HN0A 4XZUG 4QX7A 4FFGA 4I0AA 1X2MA 4AIKA 2DMTA 1OPOA 2IXHA 3L7WA 2EFNA 4LMFA 5BNPA 1BOAA 2XXZA 4RGAA 1V5EA 1XGSA 1LEAA 2WYSA 4LE3A 3BCAA 1O4XA 1TWHJ 2VASA 5ACA3 1WZ2A 3I2OA 2RNJA 2IVMA 3U07A 2DPDA 5E1ZB 4A7YA 3MHZA 3HB9A 2F17A 1YLLA 2ADEA 2QEXI 4YW4A 3GCMA 1JZ7A 4MQVA 4B7KA 4HYEA 1W8NA 5GAHJ 2X8KA 2KKOA 1WD3A 4C30A 4H7MA 5BNPB 2RR13 2PG4A 2PELA 4HKOA 5F1JA 3R4KA 2DBBA 3ABMH 3ZMZA 2V6CA 1W7PD 4AR2A 2Q8CA 4QDQA 1REEA 4WF2A 1G3WA 4KIGA 3BJOA 3VKNA 2E7WA 1K7AA 3GLXA 3IPVB 3CCEI 3I71A 4E27A 4YNIA 4BBRJ 5LLQA 3HNYM 5IYYA 5C9AC 4YW6A 4XF4A 3MO4A 4O5VA 3CDLA 2FBIA 3ELKA 3HOBA 4ASLA 2MNGA 3NRUA 3PUHA 1AR63 2R071 4E7SA 3BI3A 5KHJA 1UMHA 3R0RA 2GC1A 4KT6A 2L9LA 2YU1A 1QU3A 2VB6A 5I0RA 4XFBA 4L9VA 3GUDA 4M9XA 2NNYA 4RA0A 2VTXJ 2ZXWH 3KLOA 1S2KA 2WT2A 3SFZA 1OR7C 5DG2A 3OIPA 1DGRM 1T0FC 3CCUI 1CAUB 1K42A 3UNGC 4DYRA 4RFT0 5JVTA 5L7OC 2TCTA 1GVJA 4EQVA 1NK3P 2R92J 5EGOA 3PVBB 4JK1X 1AL0G 5F0CA 4CDWA 3E97A 3EJKA 1CF7B 1FYKA 1QNYA 3F8BA 1VI0A 5FXVA 5F39A 2ZX0A 1R081 2RV8A 5LGUA 1GSLA 2RE9A 4NQWA 2P3YA 1EPWA 2KPMA 3Q9OA 2LK2A 5CEHA 1K78B 2XBO2 1YO8A 1SLIA 1XSXA 1FAYA 5C4WB 1TME1 1NY72 1IDZA 1OD5A 2JXAA 2MYSA 2HI3A 4KGGA 1N1SA 4AYUA 3CESA 2JDZA 4N53C 1IW7F 2K86A 1CAVB 4CDXB 2ZXHA 3OEAA 3T8RA 5EWSA 3CQOA 4BAYA 3ZKYA 1FOD1 3E1F1 1RETA 5JPNB 1VBB1 4XJUA 3JSPA 3T4VA 1A34A 5C4WA 3KE2A 4JOMA 3AMMA 1JH5A 4AFBA 1H30A 1PDNC 3BTLA 2XAHA 1BYHA 4HG6B 2XDVA 2L9NA 3ROUA 2R041 4CEYA 5L3DA 3AZXA 2FD5A 4JKLA 3FBMA 4BIFA 3P5JA 4CXYA 5ABJC 3ONQA 4GAZA 2BZTA 3WEZA 4AEKA 1WJBA 4XRSG 4IOAF 4AGRA 3RYPA 4ZYGA 5HCFA 5GTIC 3HTUA 2JE9A 4JGYC 5K5OA 2LDUA 1VQMI 3J7HA 3LFUA 1UAIA 4FFFA 1BOBA 3V7RA 1BEV2 5J98B 3MIFA 4FQ4A 2IC1A 4LB6B 3FJSA 5IP7J 1RUJ2 2QCOA 4XKVA 5CB7A 4C3HJ 4XACA 3FHIB 4NAMA 2QQWA 3PL8A 1UW8A 2BP6A 2BGOA 5A70A 3IL2A 3AP9A 1W6PB 1R5ID 4CPBD 1JJ6C 1PIV2 5BS6A 4GYIA 4Q8KA 2CQXA 4KISA 3ITQA 2ARBA 1N77A 2VCCA 4OU0A 4D7YA 2EQRA 2Z4FA 3RIRA 1HQWA 5DABA 1FOD2 1MNMC 3GCWA 3NV4A 3I7DA 4QPIA 4CDWB 4KU7A 3SXYA 2OKXA 3WP5A 4MEXF 4PIYA 2OTJI 5CKNA 1K4TA 2WBMA 1VJ2A 2VUDA 3HOVJ 2HDWA 4G6QA 1UOBA 2WAOA 1WCSA 4M3FA 2J1UA 1KFXL 4G7OF 5HODA 2CAVA 3HRMA 3MUY1 4OWRB 1QBJA 4DOUA 3POIA 3FBIB 4PSWA 1Y56A 1UY1A 5HOOA 1SACA 2XUBA 4MFEA 4GZ9A 3RJ2X 3DKWA 3EYYA 2R7WA 4CEWB 4WVVA 5FFOC 4HF2A 2VZPA 4AWXB 3IBMA 1L0OC 1AYN1 1WJAA 1X36A 2LD5A 1JGSA 2CU7A 5BUVA 2VIXA 1B72A 4GJYA 1GBGA 5DUXA 1STZA 4HLTA 5JMOA 4W97A 2KA3A 2E26A 3DEWA 1XG1A 3HD8B 4YVSC 4Y15A 3ZVXA 4QXCA 3W9AA 2XB6C 2GWRA 3W3CA 3EYPA 2ET7A 4AI3A 5BYNA 4LO6B 2CV2A 1D3YA 4CA0A 4ESBA 4HNVA 4CYDA 3I3LA 1VQ9I 2FCVA 1T38A 3KQ4B 1YIOA 2QA4I 4PUSA 2PLV2 2ERFA 2G7UA 3ST7A 3FXRA 2L5QA 4XL9A 5IVYA 1BI2A 2W1SA 3TAYA 3CCQI 2AREA 4KMUX 1BIBA 4C2MJ 1T39A 1JTXA 1AR93 1X82A 4H4KC 1PO12 4CCLA 5K0UC 3BIWE 4UFJA 2HWF1 2VCAA 4IHXA 1DG6A 2Z3YA 4EJWA 4HPKA 4HZFA 3DGTA 4GKXA 3AZZA 2XLGA 4BHBA 4Z07A 4RGSA 4A5MA 3GBFA 1IS3A 1ZBE2 4YZ3A 1QY4A 1ONAA 1RINA 3ZXLA 4AFAA 3H5RA 2F5EA 2R7TA 2VKDA 4QPWA 1V6JA 4E70A 1HKTA 3A01A 3HJEA 2JDHA 4B44A 4KG0A 1B1BA 4D7SA 5JLXA 1XNAA 1U5YA 1N78A 2IXJA 3RI4A 4GULA 4C90A 3CO7C 2OT7A 3N4MA 4LKSA 2VCBA 3TQNA 2UV1A 5BNGA 2HOSA 1D0GA 1MS1A 2D97A 3AKRA 1W06A 1YFYA 2X05A 3ZDVA 4YLZA 1HOMA 4ZYDA 1GV5A 3Q3SA 4XN3A 2VL4A 1YJNI 2Y6LA 1SFOJ 2HWE2 1IZ1A 5DN2A 3FUOA 5LGNA 2WDBA 5JZGB 4FCYA 2R7ZJ 3RQ0A 4RB0A 4JDNA 4I98B 1UMIA 2BFUL 1W5CC 4EGYA 4Q48A 2P2KA 3AMQA 4Y1YA 4XSXF 1UY4A 2LG4A 4RB1A 2DYCA 1VBE1 1QMJA 3OR2C 4BJTA 3W20A 2BWCA 2NP0A 4YRVA 1KEXA 1MBGA 4A2UA 2WWYA 3OYKA 1PK6C 3DTIA 2WS92 3MPBA 5EG0A 3ZN1A 1C8M1 2GA1A 1ENRA 2HQAA 2CQQA 3FMSA 2UY8A 5AC91 3ZXJA 4XYXA 1KGYA 2FDFA 2VQUA 3ML6A 3FZVA 1K12A 1JE8A 4OUMA 3L2HA 1SBFA 2J5PA 1O3TA 4WXCA 1S7OA 4UBHA 1WMEA 2CUZA 4FFIA 1O5UA 3UV9A 5APAA 2DVAA 5H9RA 1FNZA 3QH7A 5DMYA 4ZC3A 3OOPA 1TW2A 4YFZA 1OCCH 2WT0A 3JTHA 1AYN2 4Q4Y1 3LSIA 4D1QA 1EUUA 1LQ1A 2DT7B 1B09A 4BYYA 2RS52 2MBFA 3JAMZ 2J1TA 4LBQD 1HB2A 3BVCA 3QCWA 4MHGA 3BTJA 2LM3A 4TWTA 4MV2A 1W6OB 1REPC 1EH6A 4UBGA 3VPRA 2HYFA 4MYEA 1WCMJ 3KZIC 4K7JA 2Y0MA 3RZHA 5BNQA 1X9PA 5IY5H 3IT8A 4NIGA 1SG3A 1XMXA 1W0UA 4LITA 1D1CA 2AH2A 1SLAA 4Y1XA 3VSLA 3ZDSA 4JX6A 2G4IA 4CCKA 3AMHA 3AZYA 1QJX3 3GF2A 1JHFA 4NHKA 4ANJA 1R5GA 3DCFA 2VKEA 3LOIA 4B1RA 3ZYHA 4IKFA 1M1EB 2WSVA 3PU8A 1UWWA 4M3GA 1G6NA 1V4RA 1YUDA 3JW4A 3BLYA 4DUXA 1SZBA 1JHHA 1YJWI 3HN3A 5A3TA 3TGNA 4RS8A 5CFDA 3D6EA 3I59A 1PUEE 4EN6B 2TBVA 3FBNB 4R1HA 4E8CA 4HK9A 3OBRA 2ZGUA 5GZGA 1MVQA 3CJRB 4GB33 2XF5A 2ZB9A 5CADA 2RDQA 2A6TA 4HN1A 3SCGA 3ZQFA 2O8OA 3Q8AA 3R4UA 3DF8A 4P02B 1ACCA 3K1MA 2X1EA 3I4MJ 4Y1VA 5FLJA 3W6KB 4IO9F 1K45A 1DQUA 3C7GA 3SMHA 2WWUA 1UN1A 2CSOA 1BXHA 3U37A 5FZ4A 1OMIA 2HTSA 4YZ4A 2JICA 5FTTC 5T50A 3PL0A 3H5AA 2DV9A 5C9AB 2EIMH 3LEKA 4IEYA 2YU2A 4PJJA 2YC2A 4WCGA 3NW4A 2IXCA 2XGXA 1GQHA 3DPTA 2RVCA 1KQRA 2HYKA 4UY8I 2VJ5A 1ZG5A 5CVRA 5LEJA 2FE3A 2IXKA 3ABTA 1JW6A 1WLDA 1I6XA 2XAJA 4BQNA 1DLLA 1JUHA 1KQ8A 3O0VA 4AHYA 3HDDA 1BJAA 4M74A 2YFUA 4OIRF 3BR6A 4QGNA 2XJRA 3DBHB 4RL7A 2X1DA 3FZ3A 1WHUA 3WF0A 2HOAA 3HG9A 2EF6A 3V4GA 1D4M1 1SD7A 3HOZJ 3VV1A 4IXAA 4ITVA 4A41A 4XF0A 4RAFA 1VE0A 3WHBA 3RZLA 4ZH4F 3THPA 3FHQA 1Y8QB 4KA4A 2QSGX 2XWBB 3MBWA 4FQZA 2VE9A 2ZBKA 4HNTA 3TNPB 4F93B 3O0XA 2FCTA 2EBIA 2GMPA 2LALA 1NA1A 2QQMA 2VGDA 2RJKA 4YZ5A 3NAPC 2W95A 2JKXA 4WV8A 3M7AA 4LGWA 2W9XA 1FBQA 5FJKA 4UFHA 5BNNA 2HZTA 2W92A 5JVVA 5LWBA 3HOTA 3NWTA 1BW6A 5K1YA 3J7YJ 4IOCF 1Q56A 4IUGA 2DU9A 3CMMA 4LBQB 4R9BA 1X33A 5L73A 1HQCA 4B47A 2VO5A 2L4MA 4FOYA 2JUCA 4I76A 2LF8A 4QU1A 2XJTA 4A3JJ 3M2MA 1I5PA 1PIV1 5CFDB 4FETA 4A69C 4D0QA 4V2GA 1VPHA 1S6LA 1UX6A 1ZQ3P 4EROA 3HWJA 4IV1B 1IKPA 3NWKA 2JENA 2KLOA 2X4HA 2HH9A 3QPHA 2A70A 5FZFA 1XRUA 4FPKA 4MGIE 3EDPA 2GLOA 1VBD2 4BDYA 4IHTA 2ZKNA 4B4PA 3ZR6A 2NVUB 5T5PA 1UZVA 4IEZA 1X8MA 2VBYA 2DI3A 2R7FA 3ZMDA 1W5SA 2EAAA 4QQ2A 5JXIA 2J1SA 3MICA 1R1ZA 4AEDA 1SLLA 3GLLA 1OOPA 2OBPA 2DYSH 1GP4A 4U2AA 4KWKA 3I3BA 1X1DA 4XJ8A 2EA7A 1L7RA 1Q1HA 2R5ZA 1RR7A 3SITA 2M7BA 1UO9A 3KEOA 1MJAA 2ZMEA 2NS8A 3GHMA 1W9SA 4DZJA 1G4DA 1I3HA 2IAIA 2R7DA 4UOJA 3DBRB 1FI2A 2DOAA 2A3XA 2Y26A 5JR3A 1JTZX 3A0KA 5F32A 5KWRA 1Q3EA 3KZZA 2QQBA 1A31A 4DY3A 1W0TA 3DXTA 4Q27A 2W87A 3OYGA 4PF5A 3W6JB 4CICA 3IAS2 5DUKA 3GCXA 5TGTA 1F1ZA 5GPCA 3DPLC 3S2DJ 1FP2A 2YPDA 2VTFA 2D1HA 5ERIA 2TNFA 5J6XA 1RUC2 2VQLA 1ULEA 2WY7Q 5LW9A 5FLVA 3L2CA 4U0WA 1YQ6A 5FY8A 3RNSA 3JRIA 4XLPF 1ZM1A 1G9FA 1VB4A 3B93A 2A68F 1IRZA 4M6VA 3GTKJ 1F31A 2B9VA 2PMZA 4IE7A 3FLPA 3ZFFC 3SQNA 1ITYA 2JDUA 5LK5A 5CG9A 3JCIA 4KWUA 1OKRA 4FFHA 4PGHA 3UK9A 4IHVA 5LA9A 1MBKA 2OCEA 3WW4A 4AEMA 1TZOA 2V73A 2EILH 1V6KA 1H9WA 1AYM3 1IPJA 1WJEA 1XMKA 2PQQA 4PJLA 4C9YA 4MVTA 1T33A 2VXJA 1WCQA 4LULA 4TXWA 1UAAA 1OVSA 1BBT1 1OPCA 1WLWA 1YX3A 1OQDA 3TWIA 4LKDA 2Q5TA 4E2QA 4Q1PA 3WW2A 4D6QA 1BR4A 2G9WA 4HFSA 1Y6IA 2XBO1 2DDUA 3QACA 2GIVA 1RZ4A 4N90A 3O1VA 4LE4A 2G9GA 4KDPA 2XVGA 4ARYA 2RM21 1ULOA 5J7MA 3S3OA 2K9NA 1RXFA 1S8NA 2UYAA 3TYJA 2CW8A 1WWXA 1RMU2 1LOGA 4Q5OA 5C71A 3SEPA 4A93J 3WCRA 3WNOA 3ZMVA 1OYIA 1E3PA 4FPCA 3HR9A 1D5VA 3KS7A 3CP2A 2RC4A 5LASA 3GFLA 4LG0A 2JIGA 2EIBA 1IAWA 3I2HA 3CTAA 4LA3A 2PMWB 2XLFA 4AOCA 3HXLA 1W3XA 1AKHA 2ZJCA 2HEOA 2W1WA 4A44A 2X53S 5F37A 1G9DA 1OLME 4DPNA 4AVAA 5E1WA 2EJRA 2NN8A 1UY2A 2FZ1A 3RZMA 4OI0A 3PM1A 2WKKA 4Q5SF 1VRBA 3BTXA 3SZPA 4MFDA 5FZCA 3SCFA 1ETXA 2EIGA 4KI5M 1B35B 1MEC1 2WAQN 2A3SA 5GZCA 2RS32 3I59B 1AX0A 3RG0A 1XYOA 4HVOA 2ZA9A 3H35A 1VQ6I 3FXUA 2BRTA 3VLBB 3BTZA 4IE0A 1IS4A 1A36A 1RUG1 3GTJJ 2W24A 2DJIA 2GAUA 3GXUA 3PU3A 1LB2A 1GXQA 2DA3A 4XORA 2H1KA 4BQOA 1ZN2A 4EN8B 2YR2A 4BK5A 5T5JA 4HQEA 4Q26A 1EAH2 1POV0 1FC3A 1NCQA 1JUMA 3VHPA 1W36C 2X6XA 1TTYA 4NQWB 3WT3A 4LUMA 4LO4B 2DTZA 2BOIA 3ES1A 2TDXA 3KETA 2CH0A 3JTGA 2RJLA 2PX9A 3O8GA 4BKXA 1AR83 5BQTA 3ACGA 5LBFA 3AYCA 2A5WA 2AEZA 4Y17A 1CAVA 4CDXA 2OQGA 4C3JJ 1S1AA 3MKLA 1XC6A 4RB3C 3K10A 4CCOA 3WD5A 1PHMA 1CAUA 1WCUA 4CCCA 3J7AY 2QF7A 1WLTA 3WE3A 3R0AA 1E3HA 3S1QJ 4MXWA 3CQZJ 1OA2A 1OQYA 1UNBA 1UF2C 2QSHX 2E63A 2ZX2A 5F9TA 3POSA 3NKGA 4WK8F 4IZZA 1IC8A 4XHXA 4D5CA 2LSOA 2LBFB 3LSEA 4HOOA 1BR1A 2W25A 4AYBN 4JKKA 3V8JA 1I1EA 3VUOA 1H2MA 5L3EA 1H89C 4AFCA 1ZZ7A 5D8AB 4CEWA 1YRNA 2H27A 2QVSB 3O0WA 4ZU4A 4PIXA 3U0ZA 4PLNA 5FUNA 2G9FA 2ELHA 1LEMA 4U36A 3TDUC 1PGW1 5BPDA 1XGOA 1VBE2 2R4GA 2OVUA 1B72B 1QXRA 4WVWA 4DXZA 5FRMA 4R79A 3DKXA 3VBOA 2VVEA 1QH7A 4MZUA 1KZHA 4AC0A 2W00A 5H9SA 4NC6A 3KT4A 3J8F1 3CBNA 5FRNA 4KICA 2W1UA 1FJLA 2VH9A 2LKPA 4C2UA 2R0FA 2DT6A 3EUHC 1ZRIA 1Y4WA 2MLGA 1W1WE 3SYTA 2CRGA 5F64A 1N25A 1HXS1 2HLEA 3TEYA 4LTAA 3OTFA 2VNRA 1ON1A 2EPFA 2EIEA 1W6NB 5F1RA 4J25A 1C1LA 1XDSA 4Y52J 2CMPA 1VBA2 4M3CA 3GYHX 5A1AA 4IV3A 3D0JA 1W8UA 5C5UA 5L3GA 3V0AA 5FLIA 1VBB3 4D7MA 4KN7X 1YFXA 4NHMA 4EWDA 3V8LA 1KONA 3Q9SA 1HDKA 1MBEA 3QAHA 1PGL1 4I99C 2X85A 2ZGMA 3LFIA 2F5DA 1XNTA 2IGKA 1OF4A 4ENKA 4OHVA 5FFXA 3CCVI 1ND2C 4N9IA 2VJXA 1DF0A 3MIHA 1W7PB 2G9ZA 2XPWA 3AFHA 4UUTA 1IPKA 2JD4A 3HUGB 4LHSA 3D5RC 5H6QA 2I74A 2PQ8A 2VZUA 3W5MA 3SNMA 4YGEA 3KV9A 4LLNA 3VD3A 4WVZA 4Q4X1 3ZQLA 2VMDA 1URXA 4NWWA 2QJVA 2JPCA 2CQNA 3LSHA 3S5AA 4BE1A 2KR2A 1FPN2 2PLYA 4FTEA 1GR3A 1RUG2 3HNMA 5IK4A 1Q8OA 3MF9A 5D8AA 4KH9A 1CJDA 4PJYA 3U75A 5JLWA 1XYNA 1GICA 3H8XA 3V0BA 2XUEA 1A3KA 4FCAA 1TWGJ 3APBA 4BK4A 3CEWA 4JDMA 1W2TA 3CF5F 4QKBA 5FKCA 3OGSA 2JE7A 5C3RA 3K2AA 5EGOB 5FPBA 3VZNA 3EQLF 5KHDA 2ZCWA 2W57A 1NQJA 3BU7A 2HEWF 2AQEA 1OLQA 2VQGA 4RB2C 4G94A 2E2JJ 2HEYF 1SVOA 1P4AA 1YC61 3CJIC 1CONA 5KR7A 2HWC2 2QNKA 5FMOS 1GZWB 1X9TA 1V6NA 3G1LA 3ACHA 1U5ZA 3GZEA 3L2YA 1WBLA 1S0DA 5H6RA 2D44A 3MKZA 4GH4C 1RVF3 3KLNA 2CJJA 1UCXA 1XU2A 4LOSA 2XSJC 1G9BA 1FV2A 1KA8A 1W0NA 2XGCA 3WODF 3V0AB 3FK6A 1Y9QA 4XUQA 2ZMLA 5EHDA 1R5HA 1ULCA 2W2IA 3J80K 2VUCA 2GN3A 3D82A 4CZCA 4LBNA 5AONA 1IS6A 4MUVA 2RDNA 3NNLA 5A2QZ 3A01B 2H6CA 4BB3A 4G7ZF 2Y9YA 1DQ5A 3NAPB 2WA3A 2E2IJ 2FBKA 2JSPA 1GV2A 2VECA 1UXZA 3VBOC 3T0AA 3M8JA 4JP0A 3L2UA 4Z82A 4PDWB 2BY0A 2X0LA 3K2ZA 4FAHA 5FD5A 1W8ZA 4WX9A 2VC1A 4CEYC 2EH3A 4R8HA 4BUPA 1YW8A 4RAGA 5CNAA 4DW6A 1W05A 2CSGA 1XGNA 1SFNA 4BQAA 3ZGKA 1BI3A 1G8WA 1V0AA 5IFTA 1S0FA 3J7ZI 3LAGA 4CRQA 4F3JA 4E7JA 4E7KA 4E4SA 3OCPA 3S1MJ 1GMMA 5CFCB 3DCQA 2D6OX 2JWTA 2M8GX 3I56I 4OI4A 2HWC1 1REDA 2D45A 1VBA3 2YDEA 5JAXA 2E33A 5G05L 3M1HA 3F9KA 5FYVA 2WINB 3W2VA 5LATA 4AVCA 4MO7A 3IIAA 2JA5J 3V0BB 4AAPA 4PFOA 5C3QA 3IAPA 4B09A 3OYAA 2B42B 1FV3A 3POWA 3GW2A 3OPZA 1V6OA 1HW5A 3IWZA 4LD5A 1RUI1 2JT1A 1C4RA 1BZWA 3A21A 3SLIA 3OF1A 4HSTA 4CU7A 2R063 2C5DA 2DA2A 1TC3C 1O3SA 5FKMA 3RZOJ 2R061 1W2AX 4NPMA 2ARCA 1DZRA 2FJ1A 1S3JA 5CKTA 3VZKA 4EM2A 1TMF3 3FF5A 2JA8J 3LOCA 2PXJA 2NVYJ 1CPMA 3U21A 3GTGJ 3HOSA 1ZNPA 3GM8A 3KVAA 4ZDPA 5FZ9A 1UMZA 2R5YB 1VBE3 5E16A 4CXXA 5HNHA 3G71I 1S29A 1S0JA 3HT2A 3GFIA 4H14A 3LQRA 4TYSA 2DVDA 2O0YA 2X51A 3U4SA 1F4AA 3ORJA 4B48A 4IJAA 4HVQA 2VVDA 1MS9A 5B4XA 1Q43A 2KIQA 2ADUA 3ZN6A 1ZYBA 4X0GA 4IGOA 3O7OA 3ZQIA 1G3YA 2A3YA 4GH4B 1FOYA 3ZXFA 3PNTA 3CUQC 1FMD1 3U10A 1S0CA 4MHRA 2ZO4A 1RGSA 2W52A 4IEJA 1MQTA 2L7MP 2LBFA 5DM6F 3VHNA 2P7CB 1WI9A 4XLNF 3K4LA 2WQ8A 5L7OB 4EJUA 1QVUA 3DXUA 4IESA 3S8PA 3O2PE 4LORA 5J4VA 4C0BA 2PBIA 2RQPA 3GTPJ 3VOEA 1WCDJ 4W65A 3U1DA 3I54A 1E5HA 4YGBA 2L7KA 2XQRA 3KP5A 4MGTA 1XS9A 4BHCA 3VD4A 4DEQA 5FUPA 3HRTA 4YM3A 2PMHA 4RD7A 4OLLA 3F6VA 1R22A 4YRDA 3USSA 1MBHA 3OYBA 4COZA 2BHZA 2ENRA 2VY0A 4LLGF 4GWNA 1L7QA 1JT0A 2EZHA 3RSNA 2VMEA 1IV6A 3JBG1 5B66C 3AFKA 4URTA 1X7NA 1W2UA 1YI9A 2LROA 2E1CA 2ZX1A 2DCTA 5FMOL 1IPSA 1P4XA 2A5ZA 1BK0A 1LE8A 1J1LA 4BE3A 2ME6A 2QQNA 1M4WA 2V7FA 3E5XA 1PJRA 5LFAA 4KFCA 2K5CA 2Y33A 5DUVA 1QXJA 2AQFA 1V70A 4CDQB 4RGXA 5HVQC 2MW8A 4BQ3A 3PIJA 1G86A 1NCRA 2O6GE 4GDFA 3WTXC 4BQQA 3EMRA 2VUAA 1UCRA 4TSVA 4XKWA 4MH0E 1JZ8A 2B46X 5J1YA 2O8KA 4HRIA 2DFFA 1HF0A 4CCMA 4N8MA 1R1UA 1YS6A 1Y43B 1HLCA 2YZ4A 3OYMA 1SLCA 3KEYA 2JG8C 4RR3C 1NZCA 4D7TA 2XAGA 3SZGA 5AIQA 1WA6X 3N9NA 1XE8A 1JKOC 4GWJA 3ALQA 4ASNA 3K69A 3OYEA 5LY1A 5HS8A 5ICCA 4FPHA 5KXCA 3T2PA 2E2HJ 1TEIA 3E3VA 3FLRA 3MIDA 1OXCA 4LLOA 3ASIA 1BBT2 2LS6A 1GLHA 4NWVA 1HXDA 3J4UH 2NXNB 2R5ZB 2XL9A 5A7OA 1IQDC 3OGVA 2DFEA 1WWYA 2UWAA 5I0TA 3O1UA 3SDGA 3ES4A 3K7AJ 3GBWA 1ZBA2 4MOAA 1POV3 1QOSA 3CUQB 3RSJA 5JWPA 2ID4A 2ZJQF 4Y20B 2R3SA 3H8RA 2VN2A 3F3XA 2Z1DA 2YGMA 2MSYA 1W5TA 2ETEA 2K9LA 2XR4A 3KV6A 2DW4A 4IL6C 2H8WA 1FP1D 2Q4SA 5T52A 4A3GJ 2PHRA 3CMEI 1JUSA 2P5LC 3MLKA 4UFKA 2NM1A 1ASJ1 5EF6A 4PCQA 3LSGA 2JDNA 2BTVC 3CMGA 1IS5A 1YIPA 4HANA 4XZPA 3NV3A 1UG0A 4XN0A 4U88A 1CZSA 1WMXA 2QLZA 4M3BA 3MFCA 5FZIA 2DFCA 4M9SA 3WHCA 1HX6A 4UF0B 2GXBA 1L3LA 3GFJA 5E8IA 1WMFA 2JWPA 4J6GA 4A0YA 2RM23 2GBYA 5DDJ2 3TO7A 2WAFA 1O91A 3WG1A 4N4OB 1OYYA 2RKHA 5LY2A 4ON0A 1YQ8A 2G1MA 1LOCA 2XUMA 2WA0A 1ENQA 4IETA 2EK5A 2DTRA 5JDBA 2GC2A 1LHUA 3LAPA 1UZYA 2Y6GA 1YTYA 3ZYGA 5FLMJ 2ZHNA 1MPXA 1JZ6A 3AKZA 4H2AA 3AVRA 4LJZF 4GRIA 4YGDA 2W5FA 5A33A 3HC7A 3QYFA 4YARA 1WMDA 3DPRB 1PM7A 2X6OA 3ZSEA 2DCJA 3CF2A 1ETVA 4DS0A 4BHPA 5IK7A 4LEJA 4UVCA 4ZZLA 1WJDA 4JX5A 4CUCA 2EIJH 4XCAA 1QQP2 3ILRA 4AYBA 4W6WA 4CP9A 2XGDA 4OIOF 5FP9A 1W9WA 3WXPA 1X8EA 2FRHA 3UJQA 4XCBA 3BY6A 1J75A 2J1RA 2BZDA 2DU1A 3I2GA 5LHIA 3RYKA 3ME2A 2B7EA 5K7ZA 4NUBA 4CDWC 2ZGOA 1NCRC 2WNVC 3BQYA 3IKWA 4EN7B 2K85A 1HRV3 2BNMA 3ZFGC 1RUD2 1HJGA 2AUYA 1K6YA 5HBAA 5FPLA 2RVAA 1X50A 4P9GA 5FZDA 2NOJB 2ZNZA 1ZELA 2OZJA 2DU0A 2HWB1 1CGPA 4MSVA 3ACFA 4R52A 5HS9A 5A6XA 4RGKA 3P1IA 2LREA 5IVFA 2GM4A 4AFMA 4N53A 4B7EA 1DGRA 2QQIA 4EGZA 5LBQA 4CDUA 2UY9A 4OHWA 1REFA 2P17A 5DV5A 3KP2A 3J7MA 4BOWA 3HSFA 4WM7B 3RMXA 3LIHA 1UOJA 1UU6A 4XE9A 5JSRA 1V3FA 4GQ7A 4DNCA 4HAMA 1TLHB 1QOOA 4NB5A 3PDQA 5E20A 2OIIA 1QKQA 3I4IA 2NLRA 2JEMA 4F91B 3OBZA 4BQ4A 3BG6A 4PLOA 5D8LB 5D4SA 3ZN6B 3ABUA 4WM7A 3KCCA 3K0LA 2MEV3 1U8BA 2Y6KA 2N7GA 2STWA 1X1BA 2VVFA 2VC9A 1SEUA 4LNVA 3VWBA 2UWMA 3RJRA 2CGOA 1UFMA 5FZ1A 4AE2A 1V00A 2OV7A 4LBKA 3SH3A 3ENRA 5D5UB 2XHNA 2ZGTA 3SXWA 1S4CA 2UU8A 3WV6A 1R1TA 4A42A 4Y1UA 5DQ0A 1RUH3 3OS2A 3OV8A 2H8RA 1USSA 3FX3A 4C0HA 3OYHA 1JHJA 5JMCA 1ZKGA 3WCSA 4BQ5A 1MW7A 5CVIA 4FXGB 3S57A 1DQ1A 4R9CA 3RZJA 3CZJA 1W9YA 5K9YA 3DPRC 2XPJA 3ZYJB 1W6QB 1OA3A 4F92B 2Z33A 1BI1A 4QPGB 2VCMA 2NS0A 3HNBM 5FYIA 2VNOA 2M87A 3RMYA 1MGTA 3HEIA 4QKNA 3JB4C 1LULA 2EAKA 3VKOA 5CVUA 4B8EA 2PHLA 3ZIWA 3WNXA 1D4VB 2RDPA 1VFCA 3BOQA 3SKJE 3GXOA 4A3EJ 1OC1A 2PAKA 3N9MA 3KEQA 4XFFA 4CYCB 4IE4A 2IS1A 1WUVA 2K02A 4Z92B 1CX1A 3P5BA 1X2NA 3HVDA 4FASD 1FIAA 3S2WA 1GYKA 4JYKA 2E7QA 3VBRC 3TP3A 4S2DA 3RWKX 4UWDA 2XF7A 4F55A 2DCEA 1LTEA 5C4XJ 1PP8F 1SFYA 5M5XJ 1YW7A 1YQAA 2WZR3 4FO9A 3WP3A 1BW5A 1J09A 3JRHA 3HOUJ 1AR72 2ATFA 3CCLI 4CHUA 4O65A 1TQIA 2JA2A 2WR9A 3DL3A 4M0HA 4Y5SA 4PBOA 2VUMJ 1X1AA 3BDDA 3LPFA 1ND2B 3VBHC 4CUBA 2BV6A 3H7JA 3OS0A 1NY71 1RUH2 1CD3G 1H88C 1ZGAA 1MNEA 1QJX2 4YZ1A 3DYMA 1K5MA 2XVKA 4YWAA 4XOGA 1CIWA 4DUWA 2YBSA 5LHGA 1DGLA 1COV3 4HEA2 4FSJA 1E2XA 3WF1A 4YIFA 2UXNA 1Y9GA 4BS9A 1C8NA 4YVWB 3KYCB 4XIDA 1JJ8C 2BBAA 2E36A 3IAM2 2CYYA 1ZA4A 4EYUA 4A3BJ 4AU7A 2MFZA 1IGOA 1RXGA 4FQGA 5C5TA 3IDBB 1HRV1 1PNGA 2GNDA 2YUEA 2VKVA 4ENNA 1DPUA 4P9JA 3UETA 4JV4A 1AOYA 1Z7UA 5FZ0A 5IHRA 4QU2A 2D40A 2W91A 4BEHB 1JZ2A 3OOXA 2PHDA 5M5YJ 1XE7A 4DQ2A 4Q0SA 1AZDA 1X1CA 1RUF1 1QJEA 3K4MA 1ZLKA 2HVSA 2GNTA 3BJAA 4HKWA 1XCVA 1RMU1 3KHBA 1RUI2 1XCBA 3VD7A 4YW2A 1C3HA 1HIXA 1IHMA 2W68A 3ZMUA 1K83J 3RKYA 2B7YA 5L9BA 5KC5A 4JDOA 2LOOA 2R043 3KD4A 1QJX1 2YX4A 4TV7A 1H4HA 1YRZA 3HBLA 5A3LA 2XKPA 2VBPA 1RC6A 4Y22A 4S2HA 3ZOIA 3VBSC 2NS7A 5ICEA 1JOPA 1R1A2 3DN7A 4Q0QA 1SCSA 2J22A 5T5OA 1DIWA 3FXMA 4RM3A 1MSFC 5LA0A 3I8TA 4XIKA 3PIPF 4XBFA 3HOYJ 1A6CA 1EP0A 4ZDLA 4XLAA 2IP2A 2PN6A 4P1WA 5FKKA 1VQ4I 4UUSA 1QQP3 3BPVA 3C7OA 3HUGA 3O1OA 2MD0A 5D4RA 4B3NA 2DA6A 1X1PA 4XQ4A 4ZZDA 2C26A 1S0IA 1GDTA 2UWCA 4P5YA 4WBBA 2LLKA 1BJQA 5CU1A 5DAPA 3H36A 4YW5A 3IPVA 4CP9B 4HPQA 2F2EA 4UXAA 1JYXA 3HAGA 2M4GA 3ULQB 2K9QA 2DMQA 2BOLA 2CFXA 1XU1A 1T6GC 5LBCA 1WZXA 4LBLA 2FU4A 3EPZA 4KMFA 3ATGA 2KQRA 2Q2EA 4XFGA 5AC93 2ZEXA 3S5QA 1WH7A 3K6GA 3PIOF 2WUHA 2CW0F 1RPWA 2VOPA 3SEZA 4BE2A 1NXMA 4XM3A 1H9PA 2OQRA 1OJLA 5A3NA 1Z7S2 1BMV2 2Q1MA 1FBSA 5K4LA 2WZEA 4ISQA 3CJNA 4FI9A 5FZ3A 2FOWA 4NIHA 3FBYA 2EFWA 1O4TA 1SLBA 1BJZA 3A0NA 4K2EA 5A7QA 4DBQA 2MLKA 2Q8KA 3BPXA 3PUSA 1QHGA 4ZYEA 5FZOB 5KVRA 3GZ5A 1MD0A 2I2SA 5A32A 1KS4A 3KFWX 4F52A 1H1AA 4L97A 3NMBA 3CMAI 2F4IA 4A0XA 1D0HA 3K77A 2EINH 3UKGA 5CKMA 1LNSA 3RVHA 1D7PM 4P9LA 3T2TA 3POYA 2E19A 1E5SA 2PAMA 3K48A 1GP6A 2DK5A 4GB31 2I5UA 2H94A 5IYDJ 2RR11 1FSEA 4C2TA 4QB2A 3PNVA 2E7XA 5K7PA 1OLMA 4ATFA 4L5IA 1WPKA 2DBNA 2JVHA 2FMLA 5KNLA 1DQ2A 5F3IA 4XW3A 1B4AA 5DUWA 1KQ0A 4Y13A 4XRFA 2VODA 4XVHA 2Y75A 1ST8A 5FYSA 5CISA 3ZSKA 1CF7A 4RBOA 2IW5A 5A3UA 1ZR4A 2PHTA 1GVDA 4CCDA 3UESA 1UZ0A 3ZIXA 5LCWL 1NQDA 3HMYA 1DQ0A 4AVVA 1FOD3 2X10A 1SPPB 1XB4A 3KCXA 2Y2ZA 1K78A 1S2BA 1QHDA 1OVPA 5HDKA 2YX7A 3ZQQA 4D6SA 4H3WA 2QQPA 2WQZC 4OZXA 1IN5A 1J83A 1HB4A 3GO5A 2O9LA 1GZTA 2BBVA 3PUFA 3FUQA 4JHTA 3PMSA 1PO22 2DA5A 5BV6A 1BR2A 4AQ2A 2YROA 3OL3A 1AR71 4AQTA 4AG4A 4O3MA 4ZHNA 2UUZA 1RUD1 4KWLA 3O5SA 3S7IA 2IA2A 2OD5A 1WVRA 1UOGA 4NHXA 5FIXA 2HVQA 1C8M3 2DQRA 4Y3OA 4K6BA 4RHV1 1RR8C 2YU3A 5FQ0B 2JG8B 4RR3B 1APLC 5DCFA 1BEV3