5LEKA

The transcriptional regulator prfa-g145s mutant from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 70
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lekA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lekA01
4DQ2A 2XROA 2EA7A 5BOXA 4U88A 4EJWA 3DPLC 3E6DA 3FHIB 4XF0A 3MQ0A 4P5OA 5H6RA 3J80Z 4A2UA 4Q0SA 1RIOH 4R8HA 5DV5A 4EWAA 3OCPA 1Z7UA 1BI1A 1B9NA 3JW4A 4FT8A 4ENKA 3W6KB 4IRIA 5L3EA 4PJYA 4XF3A 1FWZA 4LB6B 2IP2A 3EQEA 4XFBA 1VP6A 4HDVA 2PFBA 1KGSA 4HA8A 1X82A 3LWCA 4UV8A 2EFNA 1DDNA 2DW4A 3HTUA 5CJ9A 1BC7C 2L4AA 2DPDA 3NKTA 5J3UA 3N97A 2CG4A 4F8AA 2B8MA 3QU6A 2BGCA 1B4AA 5L3BA 2D93A 3KP6A 1DP7P 1Q43A 2G7HA 2VPVA 3RKWA 1ULYA 1RUNA 4A12A 5BY5A 1HW1A 3ERED 3R6SA 3C7JA 1OFNA 3WU1B 3BCWA 2OZJA 5BXXA 1O4TA 1R1TA 4CXFA 2PQQA 1ZZCA 5ED4A 5AONA 1K78A 1D3YA 1H9GA 2HQRA 1UD1A 4GCVA 3RPUA 1WSUA 4PCQA 2ET1A 4M74A 5LEKA 4HV5A 3WTYC 3MZHA 5ICGA 4Q0QA 2WC2A 2FEZA 1QQIA 3ZN0A 2CYYA 1UW8A 3V7SA 3IKVA 4ZZLA 3H7JA 3Q5FA 3SZTA 1V70A 4IEWA 1LDJA 3P9KA 4LLGF 3E3VA 4LJZF 1AOYA 4P9GA 4KNYA 3ES4A 3I0TA 3KLNA 3MEXA 4MGKE 5DYMA 4WVZA 1Z9CA 4MGYE 1S7OA 4HZFA 2TDXA 5AIPA 4XFHA 5I91A 5JR3A 2D5HA 2V09A 3D82A 2CAVA 5K5OA 1XE7A 3S7EA 1FBSA 4AIKA 4QLCU 1JHFA 4G7ZF 1G3WA 3MCZA 4ENMA 3I64A 1REPC 1J1LA 2QUFA 4Z07A 2KJBA 5KK1A 1KU9A 1ZNPA 4MQ9F 3ZMDA 1BBYA 4L5JA 2B9UA 2GC0A 5E16A 3CUQC 1I6XA 2P5KA 4AIJA 3ZMTA 4LTAA 5LLQA 1ZG1A 4R52A 1XMAA 2O1QA 3L7WA 5F6FA 2PJPA 1XCVA 2FBKA 4HLTA 1VJ2A 2MNGA 1IN7A 3K9TA 1FYMA 1IPKA 3CUQA 1H9TA 4RGXA 2VBYA 1DPRA 2NAZA 4P9FA 4L9JA 1UHWA 3TKYA 4OU0A 1F1ZA 3BROA 4XEZA 1W7PD 2RQPA 5HVQC 3NJZA 3IWZA 4IPAA 2UWMA 1CAVB 2OQRA 3JAMZ 2VT2A 4OMYA 3RIRA 3WW4A 1HXDA 5D5VB 3ST7A 5FLXZ 1S6LA 5D4RA 5FPXA 1PM7A 3RNSA 4XF9A 1S7AA 4WK8F 1IPJA 4IERA 1ZZ7A 2QVOA 2HGCA 1YW7A 3COAC 1FLIA 1SD6A 2GXGA 2GIVA 2L02A 4A5NA 3H9AA 2V79A 4ZYDA 1J2XA 4X6QB 5EZWA 4PDKA 4O5VA 1B6AA 1S3JA 4YIFA 5ILUA 1ZYRF 1KQ9A 1U5TB 2QQBA 1ZZ9A 4MZUA 2ADUA 1GXPA 1GVJA 1BI2A 4HSJA 1O3QA 1MDMB 1LJ9A 4O6JA 1EYBA 2ZNZA 3IDCB 1T98A 2XUBA 3M8EA 2DK5A 3B02A 1ZRDA 5BS6A 4BIFA 1R1UA 1MZBA 3D5LA 1R23A 2NRAC 5HOOA 2EVXA 2XV4S 1XSVA 1EH8A 3H1WA 2HWVA 4L11A 3I53A 3HRTA 1LEAA 3LAJA 2XRNA 3Q9VA 2GA1A 4G8XA 3WTUC 3LZZA 4MGRA 5EEHA 2YSRA 4WXHA 2BE5F 2P5LC 4ZYEA 5FLIA 2BNMA 1KU2A 1J5YA 1U2WA 2QLZA 4U7BA 2K9ZA 4EJVA 5JHUA 3DKWA 3SMHA 2JRTA 3H3UA 2FA5A 2PN6A 1EH7A 3LWFA 2ISYA 4Q47A 1P92A 1DUXC 1U5TA 3NW4A 4UVBA 2Q0OA 2O6GE 1YQAA 1LB2A 2C0ZA 4PIXA 4FBFA 3PNAA 4QXKA 3OF1A 1Z6RA 3IIAA 5HDNA 2DT5A 2Y48A 3HSFA 4AIHA 2K7LA 1DPUA 1RC6A 5LGNA 1IUYA 1R7JA 2M30A 1FZPB 4WXCA 4S04A 2MPFA 3RPQA 2BNOA 4TV7A 3IDBB 4RD7A 1IXRC 2V1XA 4KU8A 2H27A 3KGLA 2QQ9A 3BP8A 2GC2A 1FP1D 2PQ8A 3ROUA 3DEUA 4A6DA 3MYXA 3BWGA 3K1NA 4EVIA 4IESA 2PLYA 2OA4A 1EY2A 1CAVA 3QAHA 3LAPA 5BQTA 1PP7U 4QGMA 1Z1DA 3KCCA 2RDPA 4XETA 4ZU5A 3RYKA 2FOKA 1MJ9A 4EGYA 3ZMZA 4KWJA 2O8XA 2Y0OA 3SCHA 3NRVA 4KL1A 1BM9A 2PAEA 2XL7A 4QX5A 2ATFA 1IN4A 2P5VA 1IN5A 2STTA 3H7YA 5D8KB 3U10A 3SHFA 2EFPA 1UIJA 1XN7A 3ABTA 1ZGAA 3FWEA 4PGHA 4KA4A 4UUVA 4MUVA 4I0BA 3BY6A 3F22A 5LRSA 5HLGA 4AVPA 2Z99A 4HOBA 2OYZA 3L09A 4YARA 3FXRA 2IXIA 2H94A 2IXHA 2HS5A 4UHTA 3L2CA 1FP2A 4I09A 5E8GA 3NVCA 1IRGA 3DFGA 5KBFA 4E2QA 4DNCA 2DK8A 5I0RA 5E20A 4IEVA 3F8FA 1FX7A 4HQEA 4OLLA 1ODDA 2FRHA 1K78B 1ZX5A 1XE8A 2ESHA 4A0ZA 2CWEA 3MAJA 4L9NA 3J81Z 3B73A 2YX7A 3V8LA 2M1BA 3REOA 4MGIE 4I3PA 5ILSA 2L01A 4HW0A 3WODF 2FXAA 3OV8A 5K1YA 2EK5A 1VTNC 5JSPA 2DQLA 4UVCA 5FQ0B 2P6TA 2PEXA 2ZFWA 3EDPA 3NL1A 2Q2EA 2RV8A 4EJOA 2VONA 2P7CB 3IL2A 1O7LA 2XHKA 2DTRA 1ZRRA 2P4WA 4YFNF 2ELHA 3V4GA 3HT1A 4B29A 4I2OA 2HYFA 2P17A 2ESNA 2DBBA 3KP5A 4HVOA 3MPBA 5DDGA 5K8SA 3DQVC 2D45A 3GYDA 3I58A 3C3WA 4CDGA 3WTSC 4ZYHA 1TNSA 2RVCA 3ECHA 3RKXA 4IEOA 3F8CA 3HHGA 2IXLA 5JVTA 2BNNA 5IT9K 4G6QA 3KP2A 2UYAA 1XSXA 3VB2A 4U0YA 3M3IA 5J8FA 1ZVFA 3U11A 2DQRA 3HSEA 5BUVA 4MX3A 2LF8A 4K2EA 4Q0UA 3TGNA 3I59B 4MTDA 1H1IA 2GWRA 4UBHA 1F4KA 3V7CA 2L4MA 5J7MA 5K5RA 2M5WA 4LGWA 2GC1A 5E1RA 2D5FA 2AXLA 4YFXF 1HKTA 1J0RA 1Z05A 1TQMA 1W5TA 3H92A 3AAFA 4Y15A 3O6BB 3F6OA 5CVIA 4O3MA 3R4KA 2PI0A 2VE9A 5I8TA 5I8SA 4WZCA 5HS7A 3SCGA 2VODA 3ISPA 1I1GA 1OKRA 2IXKA 2XLGA 2HZTA 4GXOA 3EJKA 3S7IA 3WTZA 2IVMA 4ENJA 3G73A 2F5DA 2QCSB 2ACJA 4O9EA 4QGLA 2M45A 4IRHA 2G9WA 2VT3A 2DLLA 4A6EA 4Q4ZF 2QJVA 1XCBA 4LFUA 1UPIA 3GFLA 4DINB 3QP5A 4B09A 4RS8A 2E1CA 2HTSA 2O61A 2A6EF 4KMFA 3BPXA 2LNBA 4KU7A 4HV6A 3CUOA 2CW0F 4P9UA 5FO5A 1B9MA 4EM2A 2E7WA 3H50A 5JSRA 4Q48A 5I0TA 3TOBA 2UXXA 2K86A 2VC1A 4LUMA 4M72A 4EWDA 1PP8F 2BV6A 5CVJA 2Z3YA 4D0PA 1TNTA 5J6XA 3USSA 3LA3A 3ULQB 1G3YA 2FQ3A 3WGIA 4ZU7A 1IXCA 3GF2A 2F5FA 1O5UA 3TNQA 4D7TA 3LQQA 2YU3A 1GQGA 5CADA 3P7NA 5F64A 1WWXA 2W57A 2B0LA 1NE4A 1IZ1A 1WKMA 2H6CA 2UXNA 4L9TA 1V4RA 1BJAA 2QBYB 3K2ZA 3EHKA 1Q5OA 5CVVA 2K0GA 2KIMA 3UKTA 3JSPA 1J3QA 3BZ6A 2PG4A 4KT5C 3FMSA 5I0UA 1SFNA 2IXJA 2WFPA 5D5UB 1R1VA 1SFXA 1J59A 4KN7X 5DCFA 5L3FA 1ZZBA 2KIFA 5I93A 3H1MA 4ESFA 3KSCA 4HX7A 3RKYA 2A3SA 4UBGA 3DPTA 4EGZA 1BN5A 1MGTA 1WQ2A 4RAZA 1I27A 2ZMEB 5FPZA 3GYHX 1USTA 5ICEA 3MZYA 3K1MA 5CYVA 3SXYA 2HOEA 1SQ4A 1PMIA 1YW8A 3F6VA 3VHRA 5A2QK 3F8MA 5CLSA 1UIKA 2PMUA 4XF1A 2XAQA 1C0WA 4AWXB 4GO1A 1U3EM 1YFXA 4P55A 2PA7A 2QZ8A 4YFKF 3CLOA 1JUHA 2XAFA 1UCXA 1RUOA 4LD5A 4HMZA 1QZZA 1CAWB 2DCTA 4K8FA 3W6JB 1UB9A 2Q1ZB 2F4PA 1LKNA 2VBXA 3GUDA 4N9HA 1SEFA 4KFCA 4NB5A 4G6DA 3FMQA 3H1YA 4IEPA 4IEQA 4U0VA 5I8YA 5D5WB 2Z33A 2O0YA 2KJCA 1USSA 2UY9A 1BIBA 4EJTA 1WGPA 4M71A 1EV7A 4RB1A 4HBNA 4ON0A 5C6CA 3CJNA 3GFMA 1EH6A 3F8NA 1UHMA 5D6EA 1Z6TA 1KQ0A 2K27A 1T6SA 3JAMK 4IETA 1ZLKA 5CVRA 4FX4A 5D1IA 1ZHFA 2P8TA 5FLJA 2A5YB 3ELKA 2OZUA 4MHGA 5HDKA 1XD7A 2AS5F 2EWNA 4GULA 4LG0B 4HLYA 2MC3A 3KZYA 3LQRA 2HKXA 2QWWA 5ICCA 5J48A 1RI7A 3CDHA 3KEQA 3DXJF 1NHAA 3EYIA 1D5VA 4FAGA 1ZZ6A 2A69F 3WU0A 1OYIA 2CQKA 3DV8A 4KWKA 3D0JA 1TTYA 2WWYA 2MLKA 3KLOA 2DI3A 2VOOA 3KEOA 1R00A 2Z2SB 3I59A 4BH9A 2XAJA 4RGRA 2VBZA 4A5MA 4EV0A 3DF8A 3R60A 2JZYA 2LSOA 2EB7A 1QPMA 3VEPA 4I02A 4A0XA 4L5IA 1X3UA 2Q8KA 1ZREA 4KYWA 1W7PA 1YFUA 3HSRA 2VN2A 3KGZA 3BJAA 4CO8A 5DCMA 2RC4A 4KWLA 4CICA 3C1DA 2QENA 1XDSA 4Y17A 3FZ3A 4AQ6A 1LDDA 1CX4A 1KYWA 1XGOA 2YR2A 1HW2A 5LHIA 4S05A 2FNAA 3S2WA 1U12A 1QXRA 3OGJA 1OYWA 4KUMA 2W24A 1LVAA 2W84A 3FM5A 4LLNA 2V1UA 4XLPF 1O3RA 1ZRFA 4EROA 3HIFA 4KIBA 4OIPF 4EM0B 4Y13A 3T8RA 4L2NA 2EV0A 4HBLA 4ZZDA 5JCTA 3E5XA 3ACLA 3IRRA 4TLFA 1O5LA 3HRSA 1FBQA 2J5PA 1FC3A 3F23A 3IRQA 3G3ZA 4HX8A 1O7FA 2F5CA 5F1RA 1D8KA 3M70A 2XAHA 2WV0A 4YIIA 5D5XB 2ZXJA 2MH2A 1SAXA 5DCMB 1PUEE 4WBBA 4CGZA 4I01A 2QQAA 1NZCA 1MDMA 4Z2YA 2VECA 1LNWA 3MFKA 1TBXA 1U78A 1ZZ8A 3KMHA 4EM1A 1BC8C 2VC0A 3VODA 2GU9A 3HQXA 2M8EA 2PYTA 2RN7A 1P4AA 3KETA 3WW2A 2DPUA 4BQAA 1YFWA 1Y3TA 2H09A 3TO7A 3Q9SA 3CO6C 4UNOA 4L0YB 3JTHA 4EQQA 3HT2A 4M6YA 4G94A 3SXWA 2RKHA 2L54A 4A0YA 1JGSA 1KU3A 1SFUA 3VOEA 1TLHB 3D0SA 5I0SA 3M8FA 4QM9A 4META 1E17A 3KP3A 4ZH4F 3DL3A 3DP7A 2QVSB 5AVPA 1DZTA 4I7HA 2JT1A 2IW5A 4RGUA 4BXUA 4XFCA 2VBWA 4H7LA 3J80K 1YO5C 4FX0A 1I1SA 1J58A 4JQFA 4BHCA 4QM8A 4M9SA 2ZCWA 3PLQA 5FGMA 4ETSA 3WTWC 3KFWX 4LLLA 1FOKA 3ETQA 4D7SA 1A04A 4UVAA 3M9AA 2OD5A 3PQJA 3F72A 2FMYA 1FPQA 1ZGJA 1ZG5A 2Y0MA 5FFXA 4OIRF 3LOIA 5HDGA 4IHSA 1LR5A 2W25A 3I54A 2GAUA 3NEUA 2FSWA 2PHDA 1AWCA 5JI6A 2B5HA 4OMZA 3WE3A 3WTXC 2FF4A 1IF1A 4HN0A 1Z91A 4GGGA 2X4HA 4HF2A 3CF6E 1SD4A 3IBMA 3U0ZA 4QGNA 2HR3A 4M6XA 2V1DA 1JHHA 2MLGA 2H6BA 1EPZA 3I71A 1CF7A 1FXZA 4YRDA 2EFQA 2QDRA 4Q29A 2CV6A 5L3CA 3P9IA 2C6YA 1SD7A 3BU7A 2ET7A 1O57A 1Q1HA 2E1NA 4Z82A 2DAOA 2EJRA 2PHLA 4E70A 1TQPA 3GFJA 4FAHA 3JSOA 1KU7A 3TO6A 3ZMSA 4IRGA 1P2FA 2HJIA 5DD8A 3GXOA 6PAXA 5HI0A 3RJPA 1FI2A 3GLXA 4HDUA 3GX4X 3OTFA 1XDUA 4KICA 3R0JA 2WTEA 5KHKA 4YNIA 5DUKA 4HQMA 2FE3A 2XVCA 1ZH5A 3E6BA 1ONVA 4FHTA 1NE6A 1BOAA 1YIOA 4X6RB 3LAGA 3L9FA 3TDZC 1T39A 2HKOA 4ASNA 3FXQA 1HSTA 3GW2A 3ABUA 4M9XA 5HLIA 3C18A 4PGGA 2ETHA 1XGMA 3ML6A 3QOPA 2EFWA 1RGSA 4XRFA 3EYYA 2CFXA 5KHJA 3TDUC 1HSJA 3R61A 2HTJA 4CZZA 5BPDA 1FY7A 4RGSA 4KMUX 1UFMA 2NS0A 3WE2A 3EQLF 3GZ6A 4AVBA 1T0FA 1D8JA 4MGZE 1X7NA 4WF2A 3N4MA 3IC7A 2DO7A 2IXCA 1ON2A 5DUIA 1CAXB 1YYVA 1GHCA 2E9QA 5ICFA 3HOSA 2OQGA 3K1PA 3FMRA 2YX4A 1WLTA 4OIOF 5HS8A 2O8QA 5FLHA 3TO9A 4L9VA 3BJOA 4HF1A 2Q0AA 2VE8A 3HTSB 3FXUA 5JFRA 1CAUB 1IN6A 4ORFA 1W5SA 3ZMVA 4M73A 3JZVA 2UY8A 3BPZA 2X0LA 4QMAA 3ELNA 4N9IA 1J7KA 1K6OA 4HN1A 4XF4A 3SZPA 3OOPA 3FF5A 1HW5A 1OI6A 2NNNA 4QWQA 3ECOA 4OOIA 4WWCA 3WTVC 3GFIA 1YTYA 2M87A 2MD5A 4HVRA 2Z5UA 1BI0A 1NYWA 2IPQX 2QBYA 2OBPA 5KHHA 3KZZA 1O3TA 4IEYA 2Z9OA 2KKOA 2QYOA 1FSEA 3KE2A 5DEQA 2JPCA 3EO6A 3V7RA 1QXJA 3KP7A 3CO2A 4EMSA 3HRMA 1YFHA 2MA3A 1TQIA 3CJXA 3WW1A 1FSHA 5E8IA 4OIQF 2PBIA 1KA8A 3BOQA 3BPVA 4HSLA 2CSOA 1BI3A 4GYGA 1WI9A 3TQNA 3FHZA 1G3TA 1SMYF 3ZN1A 1F9NA 4BNCA 3HOTA 4EWEA 4RB3C 2UYBA 3L00A 2KXLA 1FYKA 2Y75A 5L3GA 1J75A 3JTGA 2K4BA 4CHUA 4EJUA 4ESBA 2GH2A 5KHGA 2FU4A 3F8BA 2STWA 1R22A 2YPRA 3BDDA 1B1BA 1JXSA 2A68F 2HYGD 1QO0D 2P7VB 3BB6A 5LGTA 5EEGA 2K02A 5LHHA 2ZBKA 4JTOA 2E7XA 3RYPA 2FMLA 2VOPA 2MH9A 1IAWA 1KQ8A 4G7OF 2PMHA 2FBIA 4H0EA 4IEZA 1CAXA 2LDUA 3K0LA 3EETA 2XLFA 4MQVA 1T2KA 2J5OA 1ZLJA 2A6HF 4BHBA 2XLAA 3RI4A 3GZ5A 1HKSA 2DU9A 5BPIA 4HX4A 3ZQ7A 4ZU4A 3NQOA 3J81K 5FDBA 1YS6A 5BV6A 4MV2A 1CAUA 2I45A 4F7ZA 4JBAA 3GEZA 2R7DA 3CEWA 3HUGA 3FZVA 1RZ4A 2GZWA 1T38A 3UKVA 2IA0A 3I7DA 4BYYA 1YLLA 2ZMEA 4L0ZB 2ZO4A 5L3DA 1LQ1A 2IJLA 3DN7A 3U1DA 3WTTC 2EA4A 1XSDA 4U7DA 3GBFA 2GA2A 1K79A 2CAUA 3V8JA 2O3FA 2OZ6A 4LULA 3K69A 5FQ0A 5KHIA 2PAKA 3F21A 3ZMUA 4AVAA 3HRUA 5T3NA 3I4PA 1R5HA 4MH0E 2PFWA 3ZP5A 2EAAA 1R36A 3F3XA 2KIUA 1LRHA 2JTVA 2XKOA 3QPTA 4R1HA 3IKTA 4LB5A 1RNLA 3CTAA 4ZYGA 2H0VA 4MNUA 3R0AA 3SHRA 3P9CA 4XSXF 4ESJA 3NSTA 2Z69A 2EFOA 4L18B 2K4JA 5E1XA 4CYDA 3S0MA 1OMIA 1U5TC 1YLFA 3FFQA 2A07F 2R7FA 1U6GA 3WG9A 1BIAA 4OINF 2XASA 2L3DA 1DZRA 1SFEA 3RYRA 1ZRCA 3QPHA 1WRJA 1X8MA 3TOAA 1HKQA 1QWRA 4XFFA 3E97A 1GXQA 2VXZA 4I0AA 2NNYA 1P4WA 4J1WA 2JSCA 1XGNA 3VFZA 4KDPA 2GQQA 5LGUA 1XMKA 4XLNF 2OU2A 1YFYA 1TW3A 2DFIA 5CU1A 1W7PB 1ZAOA 1G3SA 1RTVA 4NHJA 2BEOA 1L3JA 5E1ZB 1VR3A 5AIQA 2ZJ2A 2MHFA 1QBJA 3LSTA 1H0MA 2N7GA 1LEBA 3IWFA 1O3SA 1ZARA 1P6RA 4AXOA 4WXDA 1J3RA 3E6MA 4E2SA 2GXBA 4NQWA 3J7AO 4PIYA 1ZN2A 2HDCA 3WGHA 5LHGA 3WGGA 2HQNA 2XIGA 4LA3A 1Y9QA 5LEJA 4KIFA 5LBQA 1DGWA 2IRFG 3E5UA 1ZG3A 2G7UA 2NYXA 1K7AA 4JTNA 4O9GA 3QP6A 2OAZA 4PIZA 5H20A 4PZJA 4YG2F 4Q5SF 2IC1A 4BAYA 2F2EA 3FJSA 2UZKA 2PAMA 4AVCA 1IRFA 5JSOA 2BYVE 5FFZA 3U2RA 3QACA 3L2HA 3LA2A 4G7HF 3LA7A 3GO5A 4Q0VA 4JK1X 4M9ZA 4IJAA 2ZKLA 2FBHA 5DD4A 3TNPB 2EA2A 2D1VA 2P6SA 4E2GA 4MEXF 3T5XA 1X8EA 1KYZA 3O3KA 2IT0A 3H3ZA 1EP0A 4AQ2A 4IEXA 5ILVA 1MJAA 2XL9A 5D8LB 4N0BA 1NXMA 4HLXA 3RDIA 1YWKA 3T0YA 1OYYA 3PQKA 4RAYA 1MJBA 3T8TA 3CLPA 5A2QZ 4Q0PA 1CAWA 1QY4A 2F5EA 1OD5A 3SCFA 1FT9A 5KVRA 2IA2A 2HEOA 2COMA 2LKPA 4HAMA 4LMYA 3O14A 2RNJA 4XFGA 3OD0A 2OA2A 5HLHA 1W4MA 1Y0UA 1SD5A 3IHUA 4LUKA 2KRFA 3GVAA 3FM3A 2FNPA 4IF4A 3ES1A 1U8RA 3ZPLA 1ON1A 2V6CA 2D1HA 4WX9A 1HBXG 5BPXA 4WCGA 4YSFA 5FD5A 2ZKZA 3M7GA 2A61A 5BMZA 3HYIA 1B59A 4OFGA 4IEUA 3CUQB 3V8KA 1TQ5A 1SMTA 1QZYA 2Q30A 4LEJA 5J8CA 3H8UA 1XGSA 4RB2C 1IW7F 2ETEA 4ONUA 1GQHA 2XGXA 3LFKA 1XB4A 1S29A 1YUDA 3EBRA 2MBFA 3QU3A 4IVNA 3E6CC 1H1MA 5FLXK 3SFZA 2VQAA 3FX3A 3CL1A 1Q3EA 2FQPA 2R3SA 4U0WA 1QNTA 2PTMA 3SQNA 1UCRA 3BJ6A 5D4SA 2EV6A 1E2XA 3CO7C 2O03A 4LLOA 3QRFF 4UV9A 2Q4SA 2LF7A 2CGPA 1IN8A 4B8XA 5IT3A 4MTEA 3EUHA 4I98B 3O2PE 4YYOA 3ZDSA 3G7DA 4J1XA 3I5UA 5H6QA 1YS7A 3BALA 1I5ZA 1F5TA 3KP4A 5TRDA 2HFHA 3T1BA 1J9IA 5D6FA 2GC3A 1HQCA 1CF7B 1R58A 1FNNA 1OR7A 1OPCA 1R5GA 3WW3A 5LRRA 4XSZF 2QM3A 3PVBB 1P4XA 1QGPA 1YW9A 3RTRA 2D40A 3MWMA 2RGVA 2D2WA 5ERIA 4LG0A 1L0OC 2XKPA 4LK1F 1FBUA 5FD6A 1STZA 5E18F 3C3VA 5JR7B 1DGRA 4HVQA 1WA4A 3M1EA 4IXAA 4MEYF 3RZZA 1L3LA 2CO5A 4KN4X 3FE5A 4JVAA 4LK0F 4LA2A 5K5QA 4IHTA 4NVPA 4R79A 1J3PA 3MDPA 1TW2A 2QNKA 2ISZA 2XAGA 1XRUA 4GYIA 1S8NA 1RL3A 4G9YA 4UXNA 4HYEA 4JV4A 4HF0A 1PDNC 1G6NA 3GWZA 1YHFA 5C8WA 5E17F 2ZNYA 5EFUA 5JAXA 4KIGA 1G4DA 2EV5A 3PFIA 2V9VA 1MD0A 1JE8A 3HHHA 5CVUA 5E1WA 4P96A 4ENNA 3E5QA 2BBYA 5FB2A 4BHPA 3UKNA 5HS9A 5TJJA 4RB0A 4UXAA 4XFAA 1IXSB 5IT9Z 2IA1A 2OPKA 1LDKB 1YG2A 1CGPA 2W85A 3U9GA 4XBFA 2JPBA 1FYLA 5FCCA 4XFIA 1MKMA 1V3FA 4AD9A
chains in the Genus database with same CATH superfamily
2XROA 4ZC3A 5IATA 1EAH2 1ZBE1 4XUQA 3FHIB 1WMXA 3OYCA 4DMIA 5H6RA 1JJ8C 4FCYA 5B1BH 1E0EA 4EWAA 1GVDA 4GD4A 1OA4A 2FX0A 3W6KB 4S0HB 4OZOA 4KT6A 1RETA 2IS6A 5CKQA 3OYKA 3VPRA 1N1YA 1FWZA 2LOOA 5BNOC 5DG1A 3EQEA 4OI2A 1H30A 1NA1C 5CIRA 4UV8A 4ZDOA 2ZGLA 4CDWA 2XDVA 4D7MA 2DW4A 5K7FA 5FYSA 3SKJE 4ZTJA 4HNUA 1GNHA 1S2BA 3N97A 3ATGA 2ZEWA 2YFUA 3CZUA 2BGCA 5FO8B 5L3BA 1Q43A 3OUJA 2GN7A 4Q4X3 1HW1A 3ERED 5FYYA 4XVHA 4TWTA 5IK4A 3WU1B 2VH9A 4QKFA 1JU3A 4HT1T 1GV9A 2HEYF 3RJ2X 1ZZCA 1I9RA 4M3CE 4XAEA 2P3YA 5J36A 4BIOA 1BW6A 2HQRA 4RLFA 3T08A 3KQRA 2ET1A 2VQGA 3OL3A 4HV5A 4KG0A 3RZLA 2PHWA 5B4NA 5ICGA 2WC2A 5EPAA 5HXVA 1QQIA 2WZPP 3TEWA 3J7ZI 4WVWA 2AACA 3MF6A 5M5XJ 1W28A 5FZEA 3IKVA 1H4GA 2CJJA 4XXPA 3SZTA 3TOJA 1WZXA 2A73B 1LDJA 3VB9A 2R0QC 1SACA 3ILNA 4LJZF 2O8KA 2WS91 4KNYA 1OUXA 4Y1XA 1Y56A 3HVDA 3K7AJ 3MEXA 1OA3A 1RUJ3 2JG8A 1BKZA 4MGKE 2ZSIB 1S7OA 2BVMA 3M3CA 1HLCA 5JR3A 3D82A 4B4QA 1FBSA 2UV1A 4B47A 5HBAA 1JHFA 3JCIA 4BUPA 1JW6A 3CJRB 1REPC 3KYDB 1YRNB 3PDQA 2FCVA 2GC0A 1NLRA 2SLIA 2HDWA 4MGQA 2JECA 2P5KA 3GZUC 1AR92 1AXYA 2V1NA 1EF4A 2O1QA 2JDMA 2PN5A 3PUSA 4MO3M 3AKRA 3RI8A 2FBKA 5C4JJ 1BVVA 2QZ2A 1YJ9I 3ZQGA 5BNPB 4K21A 1H9TA 4RGXA 2NAZA 3HR9A 3LE0A 5A1AA 3FDYA 5A7SA 1IQDC 1Q8SA 2RQPA 1LE8B 4PQ9A 1Y9MA 5JI9A 5FZ1A 2UWMA 4GKXA 2OQRA 3K4DA 2VT2A 1QMJA 4NPRA 3NJXA 3HOWJ 4E7HA 3CCYA 1ND2A 2R061 1S6LA 5D4RA 2ZOEB 3E1F1 1PM7A 3RNSA 4AVVA 1S7AA 4QXCA 2VNGA 4BBSJ 2C6SA 1ZZ7A 4RGKA 2HGCA 1FLIA 1LULA 4P08A 1W8UA 4UOJA 2CYFA 3WG2A 2W68A 2J1SA 3R0RA 2V79A 5EZWA 4CU7A 2P34A 5FR3A 5ACA2 4YIFA 4CA0A 2R30A 1KQ9A 5A6XA 1VRH1 4ATEA 4AL9A 4MZUA 2FUG2 4HSJA 3SC7X 3LL7A 1O3QA 1LGNA 1KONA 2X9DA 2XUBA 3M8EA 4AOCA 1Y4WA 4FPEA 2FDIA 4LR4A 1JYTA 5FZ6A 1R1UA 1MZBA 4XE9A 4UYBA 4MGSA 1XSVA 2KIQA 1G9CA 2UU8A 4R9DA 2JB8A 3OPTA 4XQ4A 4ZY9A 3Q9VA 4L99A 4IGPA 4BEHA 3WTUC 4MGRA 4B43A 3AP7A 4ZYEA 4U7BA 2QLZA 4EJVA 4AR2A 5A3MA 4ITCA 2ISYA 1P92A 1DP0A 2P81A 1DUXC 1IC8A 3C7FA 1SCSA 4N4OB 2C0ZA 2DA1A 4FBFA 3PNAA 3IIAA 3HSFA 1QPIA 3MW2A 1A78A 4WXCA 4UFKA 5GKAC 2VU9A 3NV3A 2VVEA 3KHCA 5CG9A 1GMMA 2V1XA 4AVTA 1Y1WJ 4QQ2A 4LXLA 1FP1D 3TEDA 3DEUA 4A6DA 3H8RA 2JDZA 4BE1A 1WHUA 4EN6B 2R7EB 3LAPA 1LHOA 1PP7U 1ND3B 2DBNA 3VDCA 1MS8A 4DXZA 2YGLA 1NY72 4ES9A 4KWJA 2OUHA 1BM9A 2PELA 4RYDA 5TGTA 2XAUA 4QX5A 3SEZA 2GSYA 2P5VA 2STTA 5D8KB 3U10A 2EFPA 1UIJA 2NVUB 3NWSA 4A93J 4X6AJ 3U78A 3GJBA 4MUVA 4AZZA 3JRAA 1HA8A 3WDWA 3RMYA 2ZXIA 4AVPA 2XWJB 4HOBA 3MV01 2F4LA 3WD5A 4Y1ZA 1JN2P 1FP2A 5E8GA 1AF9A 1Z7LA 1OF4A 1H6XA 3BTJA 4C30A 4P02B 2DK8A 5IPAA 4ZXKA 5FBJA 4XDPA 3NQHA 5FKMA 4HK9A 3VBOA 1FX7A 4N43C 3S30A 2DT6A 3OD4A 4B3NA 2K40A 4A0ZA 2CWEA 2R49A 1UOFA 1TME2 5IVCA 2FHRA 1I50J 2FXAA 1V5EA 3CDIA 4W1UA 1RHI2 5K1YA 2EK5A 2OV7A 1VTNC 5BYNA 3Q8CA 3N36A 2PEXA 4XZPA 5FY8A 2Q2EA 4EJOA 2DT7B 5DXDA 4BB3A 2VW0A 3K4ZA 1ZRRA 2E34A 2ELHA 4B29A 4I2OA 2P17A 3AK0A 2DBBA 2A05A 4BBRJ 5DDGA 3DQVC 5JPMB 1W2NA 4CDGA 2QQ8A 1WCKA 3N7MA 4ZYHA 2RVCA 3ECHA 3GTKJ 3VDAA 1V6LA 5FZKA 3TL4X 1MQTB 3TEXA 4EZ4A 2BNNA 2PHXA 3CMGA 5IT9K 3HOBA 4G6QA 1ZBA2 1B35A 2HWB2 2UYAA 3VB2A 2WNVC 5FO9B 3M3IA 1IDYA 2AH2A 3WNMA 5BUVA 4MX3A 3CLQA 4E8CA 4Q0UA 3TGNA 2CDOA 3HEFA 1W06A 3MVPA 1DF0A 4UBHA 1F4KA 1FOYA 4I76A 3V7CA 3ACIA 1RESA 2L4MA 5K5RA 4LGWA 4G6TB 1NAEA 2GC1A 2LLKA 2ZMKA 4MLOA 3CJTB 3FKIJ 3SFIA 2AXLA 4Q4Y2 2HWF3 5GPCA 4Z8BA 1TQMA 3OBAA 2E1OA 3F6OA 1W2AX 5FZ8A 3MIDA 2PI0A 1W2OA 4QKBA 1OCOH 3ZVXA 5JLVA 1RUF1 2V9PA 3ISPA 2BGOA 3C7EA 3MV11 4GXOA 3VBUC 1PK6B 3S7IA 3WTZA 1PO22 4ENJA 3T1LA 2F5DA 1F4AA 1LOEA 5KNLA 4FOYA 3O0XA 4O9EA 4QGLA 4IRHA 1W0OA 2VT3A 1G59A 4H3WA 2DLLA 2MABA 4Q4ZF 2QJVA 3R05A 1QJU3 3GFLA 1YYNA 2Q8CA 1OLTA 2HTSA 1DU6A 4HOOA 4KMFA 2HDDA 1TZOA 4KQ7A 5IFTA 1FMVA 3G1OA 4KU7A 2WINB 1QVUA 2WAFA 4HV6A 4YM0A 4QX3A 4MHUA 1Y9GA 5CYYA 5IVVA 3PNTA 2VZ3A 4DS0A 2WS92 3BTLA 3H5AA 1XJAA 4Q48A 2D6PA 3OYHA 1WBLA 4GMP1 2K86A 2R063 3O0WA 4UFHA 2VC9A 4M72A 3JREA 1REDA 4EWDA 1VQ4I 1PP8F 2CU5A 3ZFFB 4D0PA 5J6XA 2WNUA 3USSA 3SH4A 2BFUL 1G3YA 1ZR4A 4NE9A 2FQ3A 1FOD3 1UO9A 3GF2A 1AYN3 2F5FA 1B35C 2JA8J 5FUPA 3TNQA 2DYRH 2ADEA 4D7TA 1KDMA 3LQQA 2I07B 4Q4V1 4O7XA 5F64A 1UZ0A 1IZ1A 1WMDA 1UYXA 1BJAA 2QBYB 3H0DA 3GLLA 1Q5OA 2B45X 4HSTA 3ZQLA 1JYXA 1E5SA 3BZKA 3VD5A 2VG9A 4R9BA 2RDRA 1PO23 2WFPA 4LOTA 4YW3A 5FJHA 2ORXA 1CWPA 5IP7J 1Y39A 4KN7X 4D0QA 3KSCA 4FPKA 3RKYA 1ZELA 4UBGA 3VDDB 2RM22 2V5DA 1HRV3 2VZQA 4QHOA 3WHUA 4A69C 2J1RA 2BXYA 2VUMJ 1VE0A 4RBOA 5JLXA 1VMJA 4NO4A 2ZMEB 2VQ0A 1H9PA 1R71A 4IV1B 5ICEA 3MZYA 2VNOA 1XS9A 3RMXA 3K1MA 4LHNA 3H0GJ 1RUI2 1SQ4A 2GOXB 3S93A 2W1SA 2R7RA 4AEDA 2WB1N 1YITI 3H8XA 2VJIA 4CP0A 4FETA 2VZSA 4FVVA 4QPYA 3W21A 4RS5B 2B9SA 4XF1A 3HWJA 4FXGB 1LOFC 1WFXA 2NM1A 5F8PA 3OMYA 2QZ8A 4YFKF 2J1VA 4E4DX 2RDSA 1UCXA 4PDWB 3JD73 1POV1 4K8FA 5EJ1B 2VCCA 4TYSA 3GUDA 5LD2C 3KEYA 1VQ5I 4NB5A 1V6NA 3V64A 1QQP3 4U0VA 2RMU3 3OS0A 5I8YA 2Z33A 3IMMA 2KJCA 4BQQA 4I99C 1BK1A 2UY9A 3U1KA 2ARXA 3JBG2 3SEQA 4OHYA 5FRAA 3AL0B 2XSDC 4D6RA 4XMIA 4RB1A 2BXZA 3CJNA 3GFMA 2IXSA 3LSGA 3O1PA 1Z6TA 3W3CA 4QHZA 4U36A 3MUZ1 4LE3A 4YZ5A 1OC1A 2MEV2 5D1IA 1GOHA 1K5MC 3ZKYA 5FLVA 4Y33A 2P8TA 5BNOB 2JDNA 2E33A 3ELKA 1ITYA 2YXSA 3BIWE 2EWNA 1JMUB 4GULA 4FTSA 3LQRA 3VN4A 2QWWA 1Q56A 2FQ4A 4XOTA 3DPRB 1D5VA 5DABA 4XTPA 1OYIA 1K83J 1H8TA 3JBG1 2VBBA 3K46A 2DA7A 4NQWB 1S2EA 3D0JA 2MLKA 3KLOA 1HB1A 2DTWA 1R00A 3FLTA 2X8KA 2XAJA 2D6OX 2VBZA 4A5MA 2JZYA 4DEQA 5AC92 2EB7A 2FCUA 1G9DA 4A0XA 2Q8KA 1X3UA 4FFFA 2WY8Q 1FOXA 4CZCA 1TME1 1US3A 3DPRC 1VBC1 3HSRA 4AFAA 3WF1A 3KGZA 4GFBA 3BJAA 4PI2A 1H2LA 1IHMA 5DCMA 5GALA 2YY1A 2EZLA 2QENA 3FZ3A 4AQ6A 1LDDA 2VJJA 2VOWA 1XGOA 4FPYA 1N78A 1U12A 5DDJ3 1QXRA 1W6MA 4ASMB 1ST8A 1BVP1 1VAVA 3FM5A 2HWE1 1AR91 5SV8A 4XLPF 2E36A 3S16J 2QTWB 2Z16A 2MC4A 3HIFA 3PIOF 1D1BA 4EM0B 4II2A 1VPHA 1XSQA 4HBLA 4Q27A 5JCTA 1RMU1 1I5PA 3HRSA 4AVZA 2J5PA 4EN9B 1NG6A 3RZHA 1WCQA 3URFA 4CEYB 3G3ZA 4HX8A 3AG2H 2F5CA 4CDQC 1D8KA 2YS9A 1OCZH 4E7KA 1SLLA 5D5XB 4YIIA 3SISA 1H8TB 4H7MA 4I01A 3TN92 3RZJA 4D7YA 3G2BA 4EM1A 1BC8C 2HWD2 3BTAA 2GU9A 4BMBA 2PYTA 3AVRA 2VIXA 5JMOA 1P4AA 3KETA 2DPUA 3ZFFA 3NAPC 2VW1A 3Q9SA 2SBAA 2ICWG 1H8VA 1QNYA 1OBNA 3OPZA 4M6YA 4G94A 5D21A 3I4MJ 1JGSA 1KU3A 4NAOA 1SFUA 1LOAA 2L2OA 5I0SA 3M8FA 1GNZA 3KQ4B 2P5BA 1X36A 1QA6A 2OS2A 4BE3A 2DBIA 4BLIA 3B00A 1MBJA 2YU1A 1KFUL 2JT1A 3JR9A 1W8TA 2J1EA 5B5EC 1RIRA 2JN6A 2WL1A 5C3PA 1RR7A 2HWC3 2PLV2 1D7PM 4OYUA 3GHMA 2LM3A 3ZPYA 3KFWX 3ETQA 5CBLA 4Z92B 3M9AA 5FFOC 2OD5A 4KITB 2FMYA 3OBZA 5E79C 4Q8KA 4XJWA 3AMNA 4TSVA 4IHSA 2VMGA 3FBMA 1LR5A 3I54A 3WQ0A 3NEUA 3BQZA 2B5HA 3HBKA 5FP4A 5B3SH 1LEDA 3WQBA 2BY2A 4HN0A 4YVSC 3ABZA 2BQPA 1SD4A 4DRVA 2FDHA 1IRXA 3BTCA 1R091 1H2KA 2XB5A 1MEC1 1CX1A 2V1DA 1ZK8A 1MNEA 3WG4A 1TWGJ 1CF7A 2EFQA 4LLFA 3K4KA 2W9XA 4Q29A 5EXOA 2M7BA 2ORZA 4OMDA 1ZBE3 1NTCA 1Z7S2 4QPQA 1G7YA 3WCRA 2E1NA 3GFJA 1LJ7A 2WO3A 5L36A 3HDDA 2WS93 1KU7A 3TO6A 1FMD2 3ZQHA 3RJPA 3G6JB 1SMVA 2DDUA 3OTFA 1PO21 3AJYA 2DDAA 1MPXA 2WTEA 5HODA 1UMIA 3DBHB 4YNIA 5DUKA 2FE3A 4M3BA 2X53S 4EE2A 1NE6A 5G05L 2E1MB 5KAFC 3FXQA 3NV1A 4JDNA 3C18A 3UJQA 4LHLA 2WZR3 1XGMA 5SV5A 2FDFA 1I6HJ 1SVMA 3ECQA 3ZLIA 5KHJA 1GR3A 1LOCA 5HCAA 2XUEA 4K8RB 2EXJA 3P1IA 4AVBA 1UZVA 4BQXA 1W9WA 3N9PA 3N4MA 2ZSHB 2DO7A 2IXCA 1ON2A 3P3NA 4FE4A 2I8DA 2A3WA 5JZGB 3FMGA 3K1PA 2W1QA 4OIOF 1AVBA 2O8QA 4RFT0 5FLHA 1FTZA 3DYOA 4URTA 2R0FA 2Q0AA 1VBE3 1POGA 3FXUA 5JFRA 2WWUA 1JGGA 1LHNA 4QMAA 3ELNA 1K6OA 4XLHA 4XF4A 2R93J 4S2GA 3MKLA 1CD3G 3FF5A 1HW5A 2LBFA 3KM5A 2DJNA 1F15A 3GFIA 5L9RA 2AXTC 4HVRA 4DRRA 4BQ4A 3ALQA 3LSIA 3POBA 2IPQX 4OWRB 4KH9A 2OBPA 3KCYA 1DBNA 2R5YA 4IEYA 4L9BA 3UK9A 3KE2A 3ZOBA 3LSDA 1QXJA 1G86A 1SANA 5FWEA 2LTNA 3OBTA 1UPSA 1SLIA 4BM8A 3HRMA 4IE4A 1RJ7A 1KRIA 1TQIA 3CJXA 3WW1A 1FSHA 3K2AA 1SLBA 1XNDA 3UGFA 5E3NA 3J9SA 1S0FA 3NKGA 1XBFA 1LPQA 3JRBA 3U1XA 1F9NA 4NWVA 5A3OA 4EWEA 3S2DJ 4WV8A 2Y75A 3I3MA 1FJLA 4D94A 2H1LA 1BMV2 4UY8I 3BTXA 4ESBA 2P1BA 2GH2A 2W47A 1B1BA 2HYGD 5IW0A 1QO0D 5EEGA 4NC6A 2M34A 2X5IA 3LNQA 4AYUA 3BG6A 1IAWA 4G7OF 2P6CA 5FPAA 4H0EA 4IEZA 4AU7A 3S3MA 3CJIB 3TW6A 1KQRA 3GCXA 4MQVA 4BHBA 2XLAA 1UG2A 3FFZA 3TAYA 5BV6A 4BDZA 4XORA 3HGYA 5EHDA 2XVGA 1OPOA 2I45A 2EIJH 2OUMA 4F7ZA 1V6KA 3FZVA 5EP9A 9ANTA 1AYM2 2IA0A 3J7LA 1C4RA 3JQXA 3BTYA 5FZ3A 3WHBA 5L3DA 4QB2A 4JHZA 5C3OA 4ZS2A 2D5VA 3V8JA 1D2SA 4YEJA 5KC6A 1NCQB 4A3KJ 2PAKA 4AVAA 1W1WE 2VAUA 3W5MA 5D8AC 2IAIA 4X8PA 2V7FA 1NCRB 5DAVA 1HXS1 3USUA 2PFWA 1X3ZB 4JZRA 4RQPA 1JZ7A 5EG0A 3O1OA 4FO9A 3THCA 3BOPA 4R1HA 5FY9A 1JYNA 1RNLA 1F2NA 2Z5WA 3WHTA 1OCTC 1ASJ3 4GB31 2A3XA 3T09A 1RRJA 2DCYA 3ME2A 2HBUA 2H0VA 2FOWA 3BU0A 3J7NA 4PHZA 1XOYA 2G9FA 2QQIA 2JUGA 3H9QA 1OMIA 2OF7A 4LO7A 1I39A 1U6GA 1SBEA 4OINF 1CJDA 3ZM8A 1AR62 1OCRH 2L3DA 1DZRA 5M5WJ 4CU6A 1ZRCA 5M3MJ 1NCRC 1VBD2 2EXHA 1QH6A 1N77A 4XFFA 5FY4A 1GXQA 1QZEA 4J1WA 1XGNA 3VFZA 4P9IA 2GQQA 1GOGA 1O8SA 5LGUA 4D6QA 3DWLE 1YFYA 3NJVA 5CU1A 1W7PB 2ZGSA 4NHJA 1X2NA 4ZXEA 3MW3A 3RG0A 2BEOA 1R4NB 3IAPA 2YFZA 2ID3A 2VBPA 4XKWA 1X19A 2ZJ2A 2MHFA 3LSRA 2M4GA 5JVGF 1LEBA 1O3SA 1ZARA 4AXOA 3E6MA 4E2SA 1UN1A 2L7KA 4NQWA 3S17J 2HDCA 2Y6LA 1BBT3 4RS5C 5M0TA 3UL2A 3WGGA 2HQNA 2NVQJ 1QU3A 1BEV3 5GZEA 2EALA 4KIFA 3VBRB 5CFDC 2E60A 2IVIB 4NR1A 4A41A 3BI3A 2TEPA 4JTNA 1S9HA 3B3QE 4PLNA 2V72A 3TN91 1OQEA 4PIZA 4IQ4A 2Y64A 4HPKA 4R4ZA 4M3FA 3WEZA 2PAMA 4AVCA 5BNQA 5JSOA 2KHMA 5DUVA 1YRNA 4RN5A 1QJFA 1XYNA 5AC91 2KM2A 2HWE2 2VTFA 3LA7A 3GO5A 4JK1X 2KZGA 3DU6A 2XJPA 4GWNA 2FBHA 3MIGA 2IS1A 1V0AA 1ZA7A 1QF3A 2IT0A 1W9FA 2WKKA 5C9AA 5IK5A 1EP0A 1MMSA 4IEXA 4CUGA 3AP4A 5A7OA 2A75A 1OCCH 1ENQA 1MJAA 4XR6A 1PIV1 4PQQA 1NXMA 3RDIA 1YWKA 2FMDA 1XNTA 4RAYA 1MJBA 1MQTC 4N90A 1CAWA 1CONA 2F5EA 1OD5A 1RUF3 3RSNA 5H9SA 2JDYA 1MMDA 1S72I 2RNJA 4XFGA 3VBSA 1YJLA 1JS9A 4MGTA 2WT1A 1SD5A 3IHUA 4LUKA 5LBCA 5EJCA 2YBSA 4Y24A 5LA2A 4IF4A 3O7OA 3IZOA 4CZSA 1SLAA 1DHKB 1DU0A 3K75B 3BIEA 2A61A 1U0AA 2BDRA 1B59A 4FQGA 2R5ZA 2JG9A 3VDDA 3VKLA 1S0IA 2VOXA 5FY7A 5HCHA 1GUUA 4CYCA 3PIPF 3I3EA 4RB2C 4YFZA 5A3PA 1AR81 2BBVA 1XQNA 3PSFA 1SDDB 2GMMA 3QH7A 2LR8A 2WO1A 2XGXA 2C9AA 2VQCA 1AR71 2BY1A 2MBFA 4FFGA 4XJZA 1H1MA 3SFZA 3S5QA 3VYSB 1HB3A 3RQ0A 1Q3EA 4U0WA 1X1DA 3ZFEB 2DA6A 2LKSA 2R041 1SLCA 4BQWA 2O03A 4KISA 4LLOA 2JE8A 2CGPA 3VBUB 5CFCA 4JX0A 3A0BC 4Q4V2 1YO8A 4Q4X1 4CCEA 1MBGA 1S4CA 3SDBA 4J1XA 4OQ9A 4AI8A 3T2TA 3BALA 2R32A 3AMPA 3OY8B 3OB8A 3T1BA 3WNNA 4A6SA 1C5HA 3HGGA 2DMPA 1WCUA 4D8MA 2ZGUA 2UUZA 4IL6C 2ZGRA 3WW3A 5LRRA 3QCWA 4C91A 2VTXJ 1JYIA 1V9U1 4INDA 1JKPC 3ABMH 2XKPA 4IX7A 1YJNI 1FAYA 5D8AB 3THDA 3DKQA 1GWMA 3C3VA 2J7MA 3VDBA 2YV8A 3SJMA 1NK2P 1RUG2 3Q8EA 5FIXA 2PJRA 5C4XJ 4RDUA 2CO5A 2W1WA 3FE5A 3NJYA 4CP1A 3V56A 3M1HA 4CU8A 1PK6A 3RWNA 5GLVA 2WR9A 4R79A 1WKYA 1TW2A 1N1SA 2QNKA 4NC8A 1TVGA 2XAGA 4GH4A 4GYIA 3WUDA 5A7QA 1VBB2 4JV4A 4HYEA 3IH2A 1QJU2 5T5LA 2ZNYA 4XURA 1UMQA 4Q4Y1 4EEFG 1I3AA 2R16A 4N7UA 1PGL1 2EV5A 1UYYA 4Q4V3 4NPMA 1PX3A 4BHPA 5A70A 4FQ4A 1OH3A 1YG2A 4XBFA 1RUJ1 1MKMA 1V3FA 3QPSA 4DQ2A 2JENA 5BOXA 5IK8A 4U88A 3BT9A 2WABA 4A2UA 3SH3A 1FATA 1IV8A 5DV5A 3OCPA 1RB8G 2COBA 4ENKA 1O91A 1UNBA 3OYLA 5FZ0A 1YQ6A 1LODA 1HRI1 1SFYA 4PJYA 4LB6B 2Y30A 3BCBA 2IP2A 2A6WA 3CJQB 5J4YA 1VP6A 4GWIA 4AHWA 2EINH 2Q8EA 1E57A 2EFNA 1JHJA 4COWA 3HTUA 4QPIC 2WNUB 2DPDA 2CG4A 4P14A 3QU6A 1QJX2 3WZ1A 5EIYB 2KPMA 1DP7P 1VBC3 2G7HA 1VBB3 3POJA 4DNYA 1LKXA 1RUNA 1POV3 5BY5A 3RGBA 4RSUA 4PJ0C 4XHBA 3BCWA 2OC6A 5DM6F 5J40A 5BXXA 1O4TA 5ED4A 1DGRN 1IGOA 2VQUA 1OCPA 2ZGQA 1RKWA 3WOGA 1UD1A 4GCVA 2Q2EB 3RPUA 4UUSB 4NN0A 4PCQA 2IWGB 2CQNA 1UY3A 2HOTA 3POSA 1U0JA 3PVOA 5FZDA 3VZJA 2K3PA 4JAAA 3KZIC 2CYYA 1Y43B 4TXWA 1R082 4ZZLA 5IAVA 4PJLA 3H7JA 2NN8A 2QKLB 1NA1B 4LBJA 1VQ7I 3LOBA 3P9KA 4LLGF 1DFQA 3E3VA 1REEA 1AOYA 5EWSA 2WADA 5I0DA 3ES4A 3PM1A 4AIDA 1C1LA 4EQVA 4RHV1 4WVZA 4JYKA 3TW7A 5T5OA 4V19K 3JBG3 5IJRA 1W8WA 2J1UA 1Z3YA 3IH3A 4YGCA 5FP7A 1XE7A 4JKKA 3S7EA 2DFBA 4G7ZF 1G3WA 4ENMA 2QUFA 1E3HA 4BOWA 4DZGA 4L5JA 2B9UA 4AFCA 1ASJ2 1NA1A 1OXCA 4NWWA 3FXLA 4RR3C 3ZR5A 1LNSA 4R52A 4LTAA 5LLQA 2JE7A 3L7WA 5F6FA 2PJPA 5IVJA 2K3FA 2VOTA 1MH4A 2CU7A 2G1MA 5CFCB 4XILA 5ERLA 4HLTA 2VASA 4IE6A 1IN7A 2ZHLA 1DPRA 4P9FA 1UHWA 4XBNA 4W97A 2XR4A 1V55H 2BHZA 3HOYJ 4P9YA 1AXZA 3N35A 1VAKA 2G4IA 4CUBA 4UW5A 1X4PA 4UW3A 5D5VB 2C4XA 5FLXZ 1MBFA 4CDXB 4Y3OA 1KXGA 3MHZA 3E7LA 4WK8F 4IERA 2WYFA 1C8M3 2LVSA 3COAC 1NG0A 1PVC3 1RVF3 2VUAA 3KWVA 1SD6A 2GXGA 4M4RA 3PO3J 4ZYDA 3GZAA 4Z2WA 1QNWA 3Q0VA 5DTDA 4PDKA 1S3JA 4LKFA 5F2WA 5ILUA 3OYEA 1N1TA 2DCJA 1F5FA 3IV5A 2HYKA 1U5TB 2QQBA 3BC8A 2Q1FA 2EBIA 5C9AB 1UU6A 3IT8A 3RFRA 1ENXA 3DXUA 1JYCA 3ZYIB 1MDMB 5JUVA 1LJ9A 1JYWA 1OQYA 2ZNZA 4B7EA 2XQXA 4C1XA 3NNLA 2ZACA 3AMQA 2D6NA 3MO4A 4FE7A 3HOXJ 3D5LA 4AG4A 4JDMA 1SAUA 2EVXA 2XV4S 3WQ1A 5F6KA 3H1WA 5IUQA 3I53A 3OYFA 3HRTA 3I3QA 3LAJA 1VBA2 3K4AA 2GA1A 3ZN5A 1X1CA 1BJZA 3CKHA 2BE5F 2ZGMA 1ZYBA 5FLIA 2BNMA 1KU2A 3VYTB 1U2WA 4DBQA 3SMHA 2JRTA 1MR5A 3H3UA 2FA5A 3A0NA 3FXMA 4CEWA 4UB8C 1DYKA 3NW4A 4UVBA 5FZBA 1YQAA 2GLOA 4HNTA 2JXAA 1UYZA 4AIHA 2QFEA 1Y8RB 4HEA2 4WM8A 3WT3A 1R7JA 5KXEA 2MPFA 5JVVA 3RPQA 2BNOA 4TV7A 3Q8FA 1OKOA 2WRAA 1SPPA 2W92A 1F8VA 3DUIA 5FZ9A 3BP8A 3UV9A 1VBA1 4YW2A 3VZNA 4XM3A 3K1NA 1EA3A 1NG7A 1VB4A 4IESA 3JQWA 2PLYA 2XF6A 1ULGA 5J1XA 3U4XA 2JDHA 1MZFA 5L9BA 4JGYA 2HWF1 1Z1DA 1CZVA 2FOKA 1MJ9A 3A23A 2HYJA 5FRMA 2DUOA 5LWBA 2QQPA 3NNMA 1D1CA 3SHFA 2FDKA 1T95A 5JZGC 2A70A 4YLZA 1ZGAA 4XAAA 1D4M3 2VZRA 3PU8A 4JQRA 3WG7H 3KHBA 1YQCA 1GWLA 1W0TA 3HJEA 1CPNA 4AEKA 4P9JA 2G9ZA 4OAZA 2Z99A 5FAXA 3LCPA 1ETVA 2H94A 3A0HC 2LRDA 4PDWC 4FPFA 2E7AA 1IRGA 3MFAA 4YVSB 4DNCA 2HVSA 2WFF1 3ZXSA 3RS6A 4CDQB 3PURA 4OLLA 2BPA2 5C8CB 3IIIA 1ZX5A 2RREA 4LOCA 1XE8A 5K0UC 3W5NA 3VKOA 4CTEA 4L9NA 1JUSA 3J81Z 1VQPI 2E2JJ 2L01A 3O1MA 5ABJB 1XNBA 5JR2A 2NVTJ 3HD8B 2JSPA 5JSPA 4CCOA 1WCSA 5FQ0B 4CE8A 3GTLJ 2P6TA 1WJDA 3EDPA 3UESA 2VONA 4AC0A 2P7CB 3FN9A 3CU7A 1MMAA 2XHKA 2X1DA 1PNGA 4BQOA 3VD3A 3VBFB 4Q4W3 1OLME 5GP9A 2X5IB 2B4KA 3KP5A 4HVOA 3ZN6B 4QD2A 5K8SA 3WTSC 2JG8C 3H5RA 4LIUA 3M8LA 1K4SA 3RKXA 4IEOA 2L7FP 3LSJA 4MXVA 3F8CA 3LPGA 2EPFA 3F95A 5FPUA 1JZ8A 1HC8A 4F3QA 3KP2A 2DVDA 4XTMA 3W2AA 5J8FA 2C1FA 1W8NA 2LFBA 2LF8A 5E8AA 2B9VA 1QOOA 3CJIC 2DVBA 4L5EA 1H1IA 4YVWA 4XXAA 3KPHA 3LIGA 4LBLA 1VQMI 4D9JA 2PQSA 5J7MA 3BR5A 3OYNA 1JOBA 5EF6A 2BWCA 4WM7B 4YFXF 4JRAA 1J0RA 1Z05A 3ZSKA 1HRI2 1VQKI 2DJIA 4O3MA 4SBVA 2DVFA 4Z1VA 1NCQC 1ONAA 3H1CA 5CNAA 3DLAA 5I8SA 3DEMA 5HS7A 3SCGA 4GH4B 4QT6A 4E8DA 3BTIA 3LSKA 4D6SA 2LY2A 1RUI3 3POEA 1Y7BA 2ARBA 3KLSA 3H35A 2HZTA 1RUG1 4COVA 1KD7A 3EJKA 1IO2A 4YM2A 3BQYA 2QCSB 3A7QA 3RQIA 3DECA 4C0BA 3MFCA 4JHTA 3O5SA 1JU4A 1AYM3 2OXBA 5GZFA 4XHXA 3UYJA 4LFUA 1AKHB 1Z0HA 1UPIA 5JOZA 2VZOA 2E1CA 2WWSA 2O61A 3TBDA 3BPXA 5M5YJ 4RHV2 3CUOA 4P9UA 1W2UA 2BU9A 3GTPJ 1B9MA 4B4PA 2E7WA 3MKZA 4UI9L 1JZ3A 4QX1A 2XHNA 2RMU1 4N7IA 1OLMA 3KZ4C 3MW4A 2YYOA 2JDKA 5CVJA 2Z3YA 4KNCA 5DAPA 5DG2A 2VMCA 2CHHA 3J8F2 1ULEA 4XRMA 1APNA 4ZU7A 2RS32 1IXCA 3Q0UA 2AQEA 1AHSA 5ACA3 1PYVA 5F0HA 3I55I 2L9LA 2WN3A 5F3EA 3P7NA 1A34A 1A5JA 1QJX1 1WWXA 2H6CA 1WKMA 4JKLA 1ALYA 3FXJA 1WZ2A 1X33A 4L9TA 1NK3P 2HZDA 1YIJI 2WAAA 4B4RA 5FKLA 2K0GA 2MSYA 4AW7A 4QQOA 3ASNH 4P9WA 2GNMA 3BZ6A 1AL21 1HKDA 4F52A 5AC93 5D5UB 4ATFA 4J19A 2QF7A 3DF0A 3BUCA 1J59A 1XPWA 5I93A 2CUFA 3H1MA 2VKHA 4HPQA 5CA6A 5B66C 3DPTA 3ZQQA 3JRHA 2ZAHA 1BN5A 2I5UA 5F04A 1BCXA 4RAZA 4AFMA 3OS1A 5C33A 5FPZA 2DMNA 2VPLA 3CCVI 2JJ6A 4PFOA 3F6VA 5F0FA 3X2QH 4HG6B 2QQWA 3F8MA 2ZGOA 4I3GA 5CLSA 2VE1A 2XGEA 2L0KA 2PMUA 4BQ5A 1C0WA 5FOBB 4GO1A 2RAEA 3LF7A 4IKFA 3J7MA 4P55A 4FPOB 3AG3H 3W59A 4G3YC 4YGBA 1JUHA 2XAFA 4J00A 3M7AA 1RUOA 5F5QA 3KT7A 1UB9A 3OR1C 3HAGA 2F4PA 4N9HA 1SEFA 3R4SA 1RMU2 5DAQA 4G6DA 1BOBA 3H1YA 4IEPA 4IEQA 4NIAA 1K5MA 1AHDP 1ND3A 1CN1A 4RQPC 5LK5A 2TCTA 1EV13 4EJTA 5A1FA 1F4HA 3PJYA 2OT7A 2O7OA 3MLJA 5FKCA 5D6EA 1UHMA 2OTLI 1KQ0A 1SVLA 2K27A 1MS9A 4IETA 4PJNA 4OUEA 4GJYA 1MBEA 1ETYA 5BNPC 1ZHFA 4OHVA 2J22A 2HWD1 3L2UA 4XMAA 2ERFA 4MHGA 3WDTA 5HDKA 5C70A 4LK7A 1H88C 3GDBA 1O4XA 3B5LB 3K51A 2MC3A 1MS4A 2HKXA 2AEYA 1ETWA 2GMPA 5J48A 1RI7A 4ASKA 2WNVB 1JKQC 3KEQA 2F6CA 3VBFC 4IO9F 1BA5A 2AUYA 2ZX1A 3KD4A 5E89A 1RUH2 2OUJA 5DDJ2 3PUFA 2A69F 2R5YB 3DV8A 2XJSA 1Y6IA 2BTVC 2WWYA 4E4HA 2VOOA 3KEOA 5CISA 4KG8A 5FYBA 4A3LJ 5FZHA 1PNFA 2CGNA 3MF9A 4KJZA 4L5IA 4B1RA 1NCRA 1ZREA 4KYWA 1FYUA 1YFUA 5KC5A 3JRCA 1AJOA 2VVDA 1OD3A 3ILRA 2YBPA 1L7RA 3APBA 1V9U3 2OVUA 3NV4A 2R4GA 2Y6JA 1RUH1 2HXOA 2D6KA 4GKYA 1KYWA 2YR2A 1HW2A 2FNAA 3HOZJ 1JZ5A 1NLQA 2HH9A 4EN7B 4D3WA 4OZXA 1APLC 1OYWA 1UXZA 1FV3A 4BKXA 2HNHA 2GM4A 4CCNA 2DFEA 1K5JA 5LFAA 3FXKA 4RS5A 2DCZA 5KXDA 1OISA 3NAPB 3T8RA 1W6PA 3AP6A 1AU7A 1FMWA 3IRRA 1O5LA 1R093 1FTTA 5GLUA 2X48A 1V5FA 3IRQA 3JRDA 1EJ9A 4QAWA 1XU2A 4M4PA 4W50A 1PVXA 1SAXA 5DCMB 5IP9J 4I0WB 1NZCA 3LSEA 2QGUA 1UMZA 2FZ1A 1UX6A 3KMHA 3NNGA 3VBSB 3GTGJ 1W0PA 2VC0A 1FX5A 3HQXA 4ET7A 2RN7A 2HWF2 5LA9A 4V2FA 2VXJA 1OUSA 4BQAA 3VBHA 5JXJA 1UOBA 4A3JJ 1U9NA 4QU1A 3CMEI 5IFPA 3CO6C 4UNOA 4AEDC 3INAA 4CUAA 2DTZA 3B6CA 4A0YA 3C7GA 4D5CA 1MVEA 2JK3A 4AI3A 3FHAA 2BW3B 2XVKA 2ZPXA 3AC0A 3EB7A 3OGRA 2EIGA 5FXWA 4LT5A 3RJRA 4R9AA 4META 1E17A 3KP3A 2W1UA 2RS12 4RA2A 3TBIA 2QVSB 5A6ZA 1DU3D 5HXMA 2EF6A 3B9CA 2IW5A 5JMCA 3AMMA 4BQYA 3J80K 1YO5C 4CCDA 2JJ7A 3A02A 4FX0A 1I1SA 1DQ6A 1J58A 1QHDA 4LG3A 4BHCA 1UAIA 1YCIA 3KYLA 4AYBN 2P37A 1FOKA 1BQPA 1XPXA 1RUE1 4FPGA 4QPIA 2VCMA 5CG8A 3UNGC 3PQJA 3F72A 1FPQA 3MIEA 5FYUA 3ABKH 2Y0MA 2XH6A 5FKOA 5HDGA 2ME6A 4NHKA 3CD6I 2R0HA 3AKZA 2FSWA 2PX9A 3HBLA 4E6KG 3ON7A 4OMZA 5DUXA 2E35A 1DQ0A 1IF1A 2XB0X 1Z91A 2D3PA 5GZDA 4HRIA 4M6XA 3OYJA 4E7LA 1UOJA 3Q9OA 1EPZA 2PMZA 3I71A 1C5IA 4YRDA 1OFSA 4FPJA 4A3IJ 3N9OA 4BJ5C 5L3CA 3P9IA 1HB4A 5EJ3A 1D2QA 2HOAA 2ET7A 3CC4I 3I2DA 4Y22A 2ZC2A 2WB1A 2AZ5A 1DGWX 4HNVA 4FAHA 3M3OA 2XJQA 4IRGA 2HJIA 4DUVA 4YZ3A 3ENRA 4IQPA 2NS7A 3MIFA 4N53A 3GZTB 2XXZA 1RPWA 5L9VA 2P3JA 3KYCB 5AFEA 4HQMA 3L2QA 1ZH5A 5A33A 4FHTA 1BOAA 4A44A 3L9FA 2ZMLA 2YU9J 4C3JJ 1K6YA 1T39A 2VZVA 4QU2A 2DVGA 4A3BJ 2JA5J 4PGGA 1QVTA 1Z21A 3G71I 3ML6A 3DLLF 2JDPA 1S55A 5FJ8J 2A6TA 1HSJA 4BJ0A 4N8MA 2O14A 4QX0A 1A8DA 2HTJA 1GDTA 2RM21 1TWCJ 1UFMA 1LOBA 3EQLF 3GZ6A 1WLWA 1T6BX 1D8JA 1N1VA 4AEMA 1SVOA 4BISA 4TZDA 3C8XA 2WFF2 3IC7A 1S0JA 4B4CA 4IHYA 1DQ1A 5DUIA 1XNCA 4CPBA 1OLRA 2E9QA 5HCBA 2QQVA 3S6PA 2H8RA 2OQGA 4B3XA 3K70C 5HS8A 2O9LA 3TO9A 2JMWA 2M7AA 3CCSI 3AKSA 4ORFA 2ZX2A 4M0HA 1W5SA 3ZMVA 3ZQCA 3B69A 1WLCA 2UY8A 2X0LA 4N9IA 4HN1A 2YMZA 3OOPA 2BWAA 4DBRA 2NPIA 1OI6A 2NNNA 4QWNA 3FUQA 1LFBA 1PVC1 1RUJ2 3CJIA 4BQ1A 3H8OA 3WTVC 3J8F3 1IKQA 2M87A 2F4OB 1O3TA 2D3RA 2LC2A 2Z9OA 1WA6X 2KKOA 1SBFA 2QYOA 3WG3A 1FSEA 5DEQA 2XONA 2JPCA 3EO6A 5JOXA 2DURA 1IG0A 3H9GA 3IN9A 3HBZA 3CP2A 4GB33 2YDEA 5FP3A 3HPNA 2MA3A 2NXNB 1F9KA 4OIQF 1S0EA 1KA8A 5A6QA 1D0ZA 2E2HJ 5E3LA 4DY5A 2WSVA 5B4XA 1BI3A 4GYGA 5IY5H 1G3TA 2ZXQA 3ZN1A 4BY1J 5GAHJ 4F91B 4BNCA 2WT0A 1BLZA 2UYBA 4DOUA 2VNRA 3ACFA 5L3GA 1BBT1 2LY1A 4EJUA 2Y2ZA 3W9AA 3AFGA 2W2IA 3BDDA 1JXSA 3SEEA 2A68F 1ORKA 1TWFJ 1UU4A 3ZRGA 2K02A 1W0NA 2ZBKA 2DA2A 3K4LA 2JDUA 2FMLA 1QOSA 2MH9A 3K4MA 5JXGA 1RUH3 2TRTA 3HZJA 4LOSA 5DZFA 4FFIA 1B72B 1WW5A 1CAXA 2BW8A 4XUTA 2KISA 2XLFA 2F4IA 1T2KA 1ZLJA 4HETA 2G19A 4XZUG 5BPIA 2DU9A 3HOUJ 1RUD3 5FDBA 1YS6A 1W3XA 4H4KC 5FZCA 2ARAA 1LTEA 3NNJA 4CCLA 1RZ4A 1ZBA1 4ZKTB 1ULDA 3AYEA 3T30A 1F31A 1UU5A 3I7DA 5FP8A 1JTXA 2FDGA 3OSFA 2ZMEA 4L0ZB 2ZO4A 2LMDA 1HDPA 2KR2A 1PIV3 1K79A 2CAUA 3AZXA 3BZCA 2O3FA 2JQ7A 2QQOA 5FQ0A 2JDAA 3HKZN 2X51A 5F3GA 5T3NA 1HQNA 1R5HA 3AX4A 3BR6A 2IFRA 5JIAA 2KIUA 3OBRA 1LRHA 2EXKA 1PO12 2HVRA 1ZTRA 4ZYGA 4IQJA 1AX1A 3B01A 5T5JA 1W6PB 4NRQA 4QX7A 3P9CA 2M0CA 3CZJA 3ZDVA 3NSTA 4ESJA 2Z69A 4L18B 2K4JA 5E1XA 2AR6A 1YLFA 1TT0A 3FFQA 2KZVA 2A07F 2R7FA 3P5JA 3OR2C 1UZYA 1AR83 1MMNA 1BEV2 2XASA 2VUDA 4YG3A 3U14A 1WRJA 1GUIA 2K9QA 5JXIA 2XOMA 3O12A 3AP9A 3PO2J 2CW8A 3E97A 2RDNA 5C9AC 2ZXWH 1VBA3 5IYBJ 1P4WA 1K42A 4NIGA 4PT6A 1JH5A 3D1NI 5FXZA 3ETPA 1XMKA 5EEAA 1W2TA 2DFIA 1G3SA 1WBFA 5C7GA 3VZKA 1TNFA 1WWYA 3UETA 1CESA 1PIV2 1VR3A 3I3BA 3PUIA 1QBJA 2QKMB 2N7GA 2EIMH 2Y34A 1P6RA 5IHRA 1B09A 3KF5A 3GJAA 2W00A 5D8AA 1ZN2A 5F08A 3WGHA 5LHGA 4BDYA 1OQ1A 2XIGA 1AR73 5CFDA 3WUCA 2IGKA 4ABZA 5LEJA 5FYVA 4Y26A 2J1TA 2ZEXA 4EJRA 4G4FA 2R7UA 3PNVA 4DYQA 4O9GA 2OAZA 3BPSA 3CQOA 3H42B 5CEHA 1YJWI 4Q5SF 1R1ZA 1MS3A 1XNAA 3IDEA 1IRFA 4XUOA 1W39A 2A6YA 2Z4FA 5DN2A 4Y7NJ 3S32A 4AE2A 2Y0IA 4DEVA 3LFIA 3DPRA 4IJAA 1WD4A 5DD4A 3S1NJ 3WF4A 5LBEA 1X8EA 1KYZA 2QQUA 3VL8A 2VQLA 2KDOA 4P1WA 2WO2A 2QQKA 1CPMA 5FV3A 2FBEA 4M6VA 5D8LB 3WDXA 3PQKA 1OOPB 4CEYC 1PVEA 3SCFA 4N53C 3DKXA 1F5JA 2E19A 1A6IA 1RUG3 4HAMA 4LMYA 1TMF2 3VHOA 3O14A 5G04L 1MSFC 2OA2A 1R1A2 3AG4H 3BG3A 1DQ5A 3ZN6A 1D0HA 4IXLA 4KGGA 1LU2A 2A6VA 2YZ4A 5KAIC 2VKEA 3HB9A 3ES1A 3A0KA 5IYYA 3ZYPA 2D1HA 1HBXG 4K3UA 4YWAA 3DTEA 4B8EA 5BMZA 1HRV2 3V8KA 1QZYA 4V2GA 1GU3A 2L9RA 4QDRA 4F55A 4C2TA 3QLQA 2QA4I 2DDBA 2Q30A 4LEJA 3HN3A 4K1YA 2VULA 1IW7F 1D0XA 1QHGA 3ITQA 5JPNB 2WQ4A 1HRI3 4DJAA 4IVNA 3NWTA 4NIDA 5C8CA 4YG6A 3CL1A 2R7XA 1PUFB 1CZTA 3TEYA 2R3SA 3I56I 1W36C 2P3IA 1PGL2 2PTMA 3J8F1 3PUHA 3RZKA 2AEZA 1JJ6C 5D4SA 2JA7J 2WNUC 4MADA 5J3LA 4PSXA 1Y8QB 2DWRA 1E2XA 5DPNA 3CO7C 3QRFF 4UV9A 1UJ8A 2LF7A 1Y1VJ 1QDCA 4UFMA 4B8XA 4DUWA 3EUHA 4I98B 2DYCA 1IGNA 5KXCA 5BNNA 3O2PE 4YYOA 3ZMNA 2VKVA 1YC61 3LDRA 3I9V2 4DB5A 4P9LA 3MEPA 1T33A 1YIFA 2HFHA 2YPDA 5HNFA 4S2HA 3KIOA 2BZTA 2GN3A 5D6FA 5FY0A 4AFDA 4EZHA 4AVSA 1HQCA 1ND2B 1R58A 1FNNA 4U87A 1R5GA 4C3IJ 4XSZF 2QM3A 4G9SB 2OQ7A 3PVBB 1SLTA 2JKBA 1JZ2A 3RTRA 3ZXGA 2RGVA 5J1UA 2ZHKA 2RR13 4LK1F 2ZZJA 1VBE2 3FLRA 1DGRM 3CESA 5E18F 3BGAA 1MW7A 4JGYB 3WX5A 1TWHJ 5JR7B 3PIGA 1CR7A 4HVQA 3A1YA 1IPSA 3M1EA 3GNEA 1VBD3 4KN4X 3ASIA 4JVAA 4IHXA 4LA2A 4UF0B 1K61A 4NIIA 2ILMA 5IOYA 2VL8A 2ISZA 1XRUA 1RYYA 4HF0A 4B1LA 2IUWA 2W0XA 3GWZA 5E17F 3PSIA 5ACA1 5EFUA 1G4DA 3DTKA 1N47A 2EIBA 1QH7A 2V9VA 1MS0A 2Y69H 4RGAA 4BCUA 4ENNA 2BBYA 3UKNA 1MH3A 5FBZA 2X6OA 1XMXA 2RJLA 5IT9Z 2IA1A 1LDKB 3ZXDA 2W85A 1CGPA 3ZIWA 1YX3A 1AL23 2EA7A 1ND3C 5FK7A 2HEWF 3DPLC 3E6DA 2XF5A 3K4NA 4LBQD 4XF0A 3MQ0A 4P5OA 1S0CA 2PHUA 2R6QA 5JHFA 2ZJRF 4R8HA 1GP6A 4IE7A 4RQPB 2E71A 1BI1A 1B9NA 3CDZB 3IH4A 4FT8A 4FTEA 2FZ2A 4XF3A 2DMQA 4HONA 2EIKH 3CMMA 1W9SA 5T5PA 1A35A 4XFBA 4HA8A 1X82A 5DZEA 1LGBA 3LWCA 3WHCA 4YVWB 4QPOA 4BXXJ 3ZFEC 4K40A 3TYJA 1JT0A 5CJ9A 3NKTA 1C8M1 1B8IA 3C2BA 2ZHMA 2B8MA 4PF5A 3DYPA 1B4AA 2D93A 4QXBA 3GF6A 1ULYA 4A12A 3R6SA 3C7JA 1OFNA 3D3AA 1G9BA 3L2YA 1T2XA 1R1TA 4CXFA 2PQQA 1Q8QA 2XJUA 3VBFA 4COYA 5FLMJ 1UOGA 2ZA9A 4PBPA 5C4WA 4YRVA 1B72A 1RVF2 5AONA 1K78A 3N9NA 1D3YA 4XNFA 3LPFA 2ME0A 2WA0A 1REFA 4B1MA 2F5VA 4HL0A 3A01A 3MICA 4M74A 1RUD2 5CFCC 1XG1A 3BCAA 1S0GA 1DGLA 2MEV3 4Q0QA 2FEZA 2NOJB 2DCKA 3OYWB 2GNBA 1HDKA 3SLIA 1SFPA 4NMIA 3IAS2 2ZB9A 1V70A 4IEWA 2NP0A 5A80A 4BS9A 2CTVA 2VI6A 4E4ZA 4AQSA 4RM3A 3N3HA 4CCCA 2K9NA 3M3YJ 2PLV1 3AMHA 5K9YA 5DYMA 1Z9CA 2HWB1 2V5YA 2BP6A 1SHWB 1WW4A 5I91A 3BG9A 1RR8C 2D5HA 2V09A 2CAVA 5K5OA 1IKPA 2IGNA 4AIKA 4QLCU 3MCZA 3I64A 1IS3A 4M01A 2KJBA 1QU0A 1AR72 5KK1A 1HX6A 1VQ9I 2L9VA 1ZNPA 3ZMDA 1BBYA 1LHUA 5E16A 5A7WB 3CUQC 1K45A 4HSRA 2ZJPF 2VW2A 1OKQA 2WAQN 3ZMTA 1PZ7A 1XMAA 2WYSA 3VBSC 2E63A 3LQCA 2PJRB 4OHXA 5KWRA 2R5ZB 3K9TA 1IPKA 1BR2A 3CUQA 2VBYA 4WVVA 1RINA 4L9JA 3HNBM 3AJZA 1F1ZA 1W7PD 2YROA 5IAXA 3RPUD 1R6RA 3MKWB 5HVQC 1PMJX 3IWZA 1LCLA 2RDQA 3RWKX 3O1VA 1MSEC 3WDUA 5C5TA 1CAVB 1EUUA 3JAMZ 4OMYA 3VYUB 4OI4A 1COV3 1UKGA 2W08A 1H89C 4HG2A 3RIRA 2A6ZA 4UFIA 3Q0WA 1HXDA 1MACA 3ST7A 4CU9A 4M00A 4MO7A 2JIGA 4UW6A 2WO7A 1R5ID 1IPJA 2NVYJ 1K12A 4WM8B 1B8IB 1VNDA 1D5YA 3H9AA 1J2XA 4X6QB 4YIRX 3S15J 1YOVB 1PZ9A 2XMLA 1B6AA 1VFCA 1PO11 3OGVA 2ARCA 1ZYRF 2ZMNA 2ADUA 1UY0A 1GVJA 4PBOA 3U4SA 2CV1A 1UWWA 1EYBA 1HIXA 3J7AY 3IDCB 3SYTA 3OUIA 1T98A 1HCRA 5GJ6A 2OTJI 1ULCA 1OLQA 2BBAA 4QB1A 4IZZA 4LMFA 5EYYA 2HBTA 1ZRDA 2NRAC 2CQXA 5HOOA 3N7JA 1WD3A 1EH8A 4L11A 3PHMA 3H3VK 3HN1A 2XRNA 4OAYA 5GAEJ 3UKGA 2YSRA 1JUIA 5IOZA 2X6XA 4ZTFA 2PN6A 1L7LA 1EH7A 3LWFA 4Q47A 4YM1A 4FP2A 1U5TA 4B7KA 2Q0OA 2RS52 2JG8B 4PIXA 4SLIA 3OF1A 3VD7A 1YE9A 1A36A 5HDNA 2Y48A 2RE9A 1FEXA 4M0NA 3PL0A 1QHHD 1N25A 2KQRA 1RC9A 4S04A 4UW4A 2KD7A 3M8JA 2M8GX 1SFOJ 2H27A 3KGLA 1TG7A 3KCXA 3BWGA 3ASOH 3K4CA 3AXDA 2W82A 2ZEZA 2OA4A 4JRLA 1TC3C 1CAVA 5LATA 1T56A 3OIQA 2AHQA 3VYRB 3OOXA 1E5IA 3S3NA 3WNXA 4ZU5A 2OIIA 5F0CA 3HKZA 1H2NA 4Q26A 3NAUA 3RRDA 1JYVA 2ATFA 1IN4A 3DEWA 2XBO1 1IN5A 1VMFA 4LO5B 3ABTA 3FWEA 5KHDA 4PGHA 4KA4A 1PM4A 2V4JC 4I0BA 2X6WA 2QQJA 4JX5A 3BY6A 2F6BA 1Q1VA 3F22A 1C1FA 5LRSA 5FP9A 3KVBA 3OY8A 4QPGC 5F1JA 3L09A 2JB4A 4YARA 1IG3A 4M3EA 5IK7A 2IXIA 2GMEA 1W03A 4UHTA 3L2CA 3QBQA 4I09A 3D5RC 5FWJA 3NVCA 4WM7A 3S1RJ 3JD72 4C2MJ 5KBFA 4E2QA 2V6EA 4URAA 1TZLA 2DCEA 4CDUB 5M3FJ 1RUI1 1QXPA 2WN2A 2A5ZA 3HL2A 5DAXA 4HQEA 3S8PA 2VZPA 1ODDA 2FRHA 1K78B 3AZVA 2VGDA 4E7JA 2ESHA 5F2SA 2LG4A 2CWSA 3MAJA 3UGHA 3V8LA 2M1BA 3REOA 4D1QA 4PLOA 4I3PA 5ILSA 3WODF 3BG5A 2HLEA 4XCAA 1A31A 2CDPA 3ACHA 2DQLA 4CP9B 2CS3A 3PTYA 2E6VA 2WBMA 2DA3A 3A4CA 2RV8A 2NQYA 1LHVA 1VQ6I 3IL2A 3ZKUA 2W87A 3OSDA 4YG0A 2DTRA 5JZGA 2P4WA 1ETOA 1E3OC 3FL7A 3V4GA 3HT1A 3N9QA 1SZBA 3IM0A 3ZFGB 1KS4A 2ESNA 2AYHA 3MPBA 2D45A 2ID4A 3GYDA 4W8JA 3CCQI 4IW3A 4IGQA 2KL4A 4UWDA 4PK4A 3HHGA 2IXLA 3VUOA 5JVTA 1GZTA 3LEKA 5DUUA 1UG0A 1L7QA 1UYPA 2MEV1 1XSXA 5EGOA 2GP3A 4CXWA 1MVQA 4D69A 5FK8A 1QJU1 4K1ZA 4GJZA 4GIQA 1SBDA 4XKBA 4K2EA 1MMGA 3I59B 2RHPA 2RMU2 5K7HA 2LP0A 1WVRA 3LDBA 5A7PA 3MD2A 2PHRA 5DM7F 4JGZC 5KR7A 3K4JA 4Y1UA 4LJHA 1A6CA 2M5WA 4IOCF 2ECCA 2D5FA 3T1MA 4FFHA 1HKTA 3H92A 3AAFA 1YQ2A 5CVIA 2X05A 2VE9A 4V2VA 4XKVA 5DZGA 1XSRA 5FKNA 2VODA 5J1RA 2W91A 1SC7A 3NO8A 1ODNA 4FTBA 2IVMA 3VBUA 2VMDA 3G73A 3B94A 1X2MA 2D98A 4P00B 2M45A 2DN0A 1EV11 2P2KA 2BY0A 3FISA 2JVHA 4BK5A 4A6EA 3N7KA 1XCBA 2V26A 3QP5A 4RS8A 5DS9A 2A6EF 1WJ5A 2VCAA 2LNBA 2HEVF 2DVAA 2E1MC 5FO5A 4EM2A 4AAPA 1COV1 3GBWA 2JA2A 2ZJQF 2ZKNA 5I0TA 4JGZA 5JI7A 1CIYA 2VC1A 4LUMA 3ZFGA 4UT5A 4WVMB 3V0BB 2CUEA 1TNTA 1TT5B 3AYAA 3LA3A 2ELKA 1IQAA 4M3CA 2M9HA 2WLPA 4BXFA 1O5UA 3Q8AA 3EUAA 5CADA 5GZCA 2HXIA 4GA9A 4PUSA 1CQ9A 2W57A 2V4VA 2ZS6B 4LK6A 5FZOB 2UXNA 1HQWA 2Y0SN 4A7ZA 2DF7A 3K2ZA 3I97A 4H55A 5CVVA 5L7OB 3ZXLA 4JX6A 1D4M2 3UKTA 5FY1A 1J3QA 1LOGA 1GLNA 1F43A 4CDWB 1ZM1A 1M06G 1QQP1 3HMYA 1EAH3 1R64A 2IXJA 1X1AA 3RI9A 3RZDJ 3KF3A 4MYEA 1SFXA 3AKQA 5DCFA 1ZZBA 1JTYA 4ESFA 4A3DJ 4HX7A 1WMFA 2A3SA 4EGZA 2QE3A 3KVAA 4OHWA 1MGTA 1WQ2A 1W6QB 1I27A 4V1PA 3WP4A 3I4IA 3DGTA 3WSOA 1USTA 1WPKA 1RUF2 5CYVA 1D0GA 4XKCA 2HOEA 4PJMA 2WBKA 4LHSA 1PMIA 4XN0A 4PLMA 3WVJA 2HYXA 2XWBB 2P6HA 3F2ZA 2XPJA 2VOVA 2RQQA 4ZJZA 2VVFA 2XAQA 1J09A 4AWXB 3IPVA 1U3EM 2PA7A 2LKXA 5LBFA 5CFDB 3BR2A 1KJLA 4H14A 1OHFA 5F7UA 4HXCA 4LD5A 1QZZA 4A3XA 4Q4X2 4QKDA 4Q5OA 1N3PA 4IE0A 1LKNA 4N43B 2VBXA 5C8CC 2I2SA 2AENA 3I49A 1TL8A 1BW5A 1X1PA 5CQEA 4LNVA 1IG7A 2O0YA 5E6HA 1TME3 4FISA 2E5ZA 2TUNA 1BIBA 3OEBA 1WGPA 2DFHA 5F27A 1EV7A 1YQ8A 4HBNA 4A3CJ 4QPIB 4GWMA 4BLJA 4JCKA 3F8NA 1HRV1 2XB6C 3ORJA 3JAMK 4KI5M 2FCTA 1ZLKA 3QD6A 4JOMA 4FX4A 1K3IA 2PXJA 3S1QJ 5FLJA 3GZEA 3OEAA 2A5YB 1RHI3 4BMEA 1XD7A 2KRCA 1V9U2 4JDOA 1T0FC 4LG0B 5JIUA 1GT0C 5GTHC 5ICCA 3I2HA 3DXJF 4FAGA 2QBXA 3MZ8A 1ZZ6A 5ANQA 3WU0A 2DFCA 2CQKA 2VJ5A 3GXUA 3M4FA 1WUVA 1Q8PA 1XXNA 4I6ZA 1MNMC 4KBZA 3I59A 1JBCA 4FOQA 4EV0A 1HN1A 4LO4B 3O1RA 3O1UA 1URXA 4WM7C 3N7LA 1IS6A 3WCSA 1WCDJ 3VEPA 4I02A 2HVQA 2VQHA 1X4OA 3CHXA 1NCQA 4CXXA 3CCRI 1WI3A 2H0BA 4UUSA 3AZZA 2RC4A 1TMF1 3NARA 2YG0A 2HPIA 1AX0A 2R043 3T0DA 2XBO2 1H0BA 5LHIA 1CQTA 4Z2AA 3S2WA 1PGW1 4FQZA 4ISRA 1WW7A 3DEEA 1FOD2 2EIEA 3FC0A 3HUGB 4KUMA 2W24A 3AKTA 2W84A 4LLNA 1GZWB 3PVNA 1NKGA 1ZRFA 4OIPF 2R071 2M2EA 2DOFA 3DU5A 4Y13A 3HQUA 1W36D 4C9YA 3VSKA 1UZWA 4AEDB 4ZZDA 4DXSA 4OCTA 1XX5A 4KBBA 3AFHA 1R49A 1AJKA 2JX9A 2VXDA 4MXWB 2JKXA 2IVJA 5F1RA 2BVBA 2ZGTA 1J84A 2XAHA 3MLKA 1D4VB 2ID6A 2ZXJA 1PGW2 3J4UH 2OPTA 2E5NA 4CGZA 2QQAA 5C3RA 5EDNA 4Z2YA 2VECA 3J26N 1LNWA