5LEKA

The transcriptional regulator prfa-g145s mutant from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
total genus 70
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lekA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lekA01
1DZRA 1Z1DA 4KMFA 3PQJA 2QLZA 2EJRA 2FU4A 4A5MA 5ILVA 4UBHA 3IWFA 2EV5A 4QGLA 2GA1A 5LRRA 1J7KA 3KP3A 1J59A 2IXHA 2ZMEA 3K1NA 4U88A 4MQ9F 1YUDA 4NQWA 3I54A 2Z99A 4ESBA 1GVJA 4L9NA 2HZTA 4LLNA 4MGYE 3ST7A 3J81K 5DCFA 1XD7A 4LB6B 2WC2A 2K27A 1YFYA 4HVOA 3RI4A 3GWZA 4Q0QA 3CDHA 4XSXF 1FBQA 4Q0SA 4Z07A 3P9KA 2C6YA 5E16A 2V1XA 4N0BA 4WVZA 2GWRA 1F4KA 2F5FA 3ML6A 1XGNA 4N9IA 3RPQA 4XLNF 1T0FA 1RUNA 4KIFA 5L3FA 2FMLA 2JSCA 3EHKA 1O7FA 4EJWA 3CUOA 1U78A 3KMHA 3EDPA 3ZMTA 2CFXA 1D3YA 4DQ2A 3IIAA 1LB2A 5CJ9A 1MKMA 1ON1A 4M72A 1IRFA 3BDDA 4PCQA 4HN0A 4FX0A 3DL3A 2GC3A 2OYZA 5BS6A 3GF2A 4IEVA 3PQKA 4HBLA 3ZN0A 3SCFA 2O3FA 4FBFA 3WTVC 3R0JA 5CVJA 2A3SA 1UIJA 1U2WA 1LEAA 2VC0A 2O61A 4J1XA 1EH7A 1DUXC 4R8HA 4DINB 5JFRA 3K1PA 1YS7A 4U0WA 3MPBA 2XROA 1IF1A 3IL2A 2FQ3A 4B09A 4QM9A 3D0JA 2RVCA 5JSOA 3M70A 4XF3A 1X82A 1TW3A 1XN7A 2H6BA 1HBXG 2Q0OA 2GC2A 4HF1A 3FM3A 3IDCB 1QO0D 2P5VA 2E7XA 3EUHA 1R1TA 4R52A 1SQ4A 5HDKA 3GLXA 3PVBB 4D0PA 2PAEA 5K5OA 5JSPA 3UKNA 4B29A 4CICA 2GQQA 3V7CA 1PP7U 1NE6A 4EJVA 4WK8F 3F23A 3FXUA 1FLIA 1XCVA 2P6TA 3ABTA 1ZYRF 4QX5A 1K79A 4M74A 1F9NA 2DFIA 5LEKA 3RKYA 4WBBA 4HLYA 2DW4A 1FOKA 1VR3A 2D45A 1IXSB 1KU9A 4FT8A 4FX4A 2V1DA 2KRFA 3JSPA 1XGOA 2QNKA 1TBXA 2BV6A 1J75A 3HRTA 1GHCA 2Z33A 2RC4A 1IW7F 2MBFA 2FNAA 2A5YB 2H94A 2L01A 2Y48A 4LK1F 4YNIA 4HSJA 4HZFA 4UVAA 1CGPA 1TNTA 1W7PD 2XVCA 1Y3TA 3LZZA 2QQ9A 3F8NA 4L2NA 4HX8A 5KHGA 4HDVA 1BI2A 2HDCA 4D7SA 3TO7A 2ET7A 3KP6A 1S8NA 4HV6A 1MJAA 3IWZA 3RKXA 3KLNA 3DKWA 4NHJA 1S7AA 1PUEE 1RC6A 1ODDA 5FPXA 4IF4A 1CAXB 6PAXA 1QGPA 2QJVA 4OIQF 5I0SA 5HLHA 2FEZA 3QP5A 4XF0A 2F5EA 3SQNA 4UXAA 3ETQA 3NSTA 2IJLA 1XSXA 4CYDA 3GBFA 3IHUA 5BPXA 2CO5A 5ICFA 3T1BA 4IESA 2UXNA 4I09A 4YIFA 3VODA 3KP4A 2V6CA 4HVRA 1SFUA 1SD6A 1Z9CA 1NYWA 1YTYA 4LK0F 2XLGA 2CAUA 4M6XA 2OPKA 2RQPA 4LEJA 3R61A 1V70A 2PEXA 4IVNA 1PDNC 2FBHA 1YLFA 2BNNA 1P4WA 3RIRA 2VC1A 4YFKF 4KN4X 1Q5OA 3BALA 3F22A 1MD0A 4EWDA 3COAC 1IN5A 2CWEA 2EK5A 3NKTA 2W25A 1Z05A 2V9VA 1Z91A 2Z3YA 3GVAA 5LHHA 3BU7A 4Z82A 3ELKA 4ZYDA 2DU9A 5LEJA 3ELNA 1Q1HA 5L3GA 2NS0A 4G7OF 2EA4A 2FMYA 2G7UA 3OOPA 4L9TA 1X8EA 2ZNZA 2RN7A 3VOEA 1ZARA 1RGSA 2I45A 1YW7A 2GA2A 3GUDA 4KYWA 5I0UA 3O2PE 4G6QA 3IDBB 4XF4A 2HYFA 1NZCA 5CU1A 4MEYF 3GFJA 1YIOA 3ACLA 2JPBA 1FSHA 1KQ8A 2K0GA 3BCWA 1I1SA 3M3IA 4RB2C 4F8AA 3WTTC 3KZYA 5D4SA 3BJAA 2PQ8A 3BROA 4LD5A 1DDNA 2ATFA 1H1IA 4AQ2A 1U3EM 3EJKA 2G7HA 4L9VA 3WTSC 4IEWA 3W6KB 3S2WA 2A6HF 5BPDA 1UCRA 4IJAA 4EVIA 2R3SA 4XFBA 1B59A 3SCHA 5JAXA 3U1DA 2L54A 2Z2SB 2DQLA 2FBKA 2A61A 1X8MA 4PIYA 5LLQA 2QENA 3SXWA 2IA1A 4HAMA 3GFIA 2PA7A 2WFPA 5BPIA 4RAZA 1KGSA 2NNYA 2OBPA 3CEWA 2HGCA 1FXZA 3QU6A 2LF7A 3I71A 3F8MA 2XAGA 1QBJA 5D1IA 3BOQA 5JHUA 2FNPA 1CAXA 1LKNA 1O4TA 2Q4SA 3L00A 1YFUA 3CUQB 4O3MA 1FZPB 1SFXA 4OIOF 4IETA 1RIOH 4LA3A 4MGZE 2UY9A 5FQ0B 2HTSA 5DD4A 2YX4A 3LAGA 2XL9A 4LLOA 2XKOA 1HW2A 4RB0A 2F4PA 1R58A 2EFNA 4OINF 5FO5A 3F3XA 2XGXA 2DPUA 3J80Z 3H7JA 4UV9A 5LHGA 1I1GA 5IT9K 2STTA 3KP7A 1CX4A 2DK5A 2PLYA 4KDPA 3O3KA 4XF9A 1R5HA 1LDKB 2FE3A 2HQNA 3GFMA 4LMYA 2ZMEB 2CG4A 4KU8A 3L09A 2L4MA 4KWKA 2KXLA 1ZRDA 5FLJA 2X0LA 4BHBA 3H8UA 2VBZA 3OD0A 2MH9A 1IZ1A 3EO6A 4XFAA 4ZU7A 1LDDA 2LSOA 2IC1A 4YRDA 4UVBA 1HXDA 2LKPA 3E5QA 3HOTA 4Q0UA 5L3BA 3LWCA 2FQPA 2P7VB 4HX4A 1VJ2A 4Q0VA 1FP2A 2OQGA 4CZZA 4KL1A 1PP8F 3WTXC 5A2QZ 4AWXB 5E8IA 3QPHA 4LJZF 1KU3A 5HDGA 4MNUA 4UV8A 1MZBA 4UNOA 4JQFA 3ULQB 2E9QA 2ESNA 5HLGA 2R7FA 1O3SA 4BIFA 1FYKA 3E5UA 4M71A 5J8CA 1MJBA 1ZN2A 1ZREA 3FFQA 2RGVA 2FXAA 2HQRA 1T2KA 3K2ZA 4XEZA 3WU1B 2DLLA 1ZAOA 4JK1X 2DTRA 2IA0A 5JR3A 2VECA 2Q2EA 1H0MA 1USSA 4L11A 2Y0MA 1ZLJA 2Z69A 3S0MA 2A69F 2VXZA 3H50A 4R79A 4I2OA 3ZMZA 3KZZA 1KYZA 3SZTA 1GQGA 2GZWA 2PQQA 3CUQA 3CJXA 4EWAA 2BBYA 1OYYA 3MAJA 1ZZ8A 4I01A 3GYHX 2PHDA 1EPZA 4ZH4F 5FQ0A 2VN2A 1H1MA 3RJPA 3I64A 2IA2A 2RKHA 2LDUA 3U10A 2G9WA 5KK1A 4EV0A 2STWA 3WGGA 3VHRA 5FPZA 1YS6A 3QU3A 2PG4A 2K86A 2EA2A 2A6EF 3J80K 2UYAA 1GXPA 4MUVA 4OIPF 1ZRRA 4IEZA 2B5HA 5L3CA 5EEHA 3O6BB 5JR7B 4RGSA 4G8XA 3ZMUA 4IHTA 3B02A 1SD4A 1HQCA 2QDRA 4YSFA 3HSEA 4MHGA 2P7CB 2ETEA 1STZA 3E3VA 1H9GA 1HKTA 4META 4HOBA 4AVPA 4GO1A 2F5DA 2XASA 2VOPA 4PIZA 2EWNA 2EB7A 2BGCA 3GZ5A 4L9JA 5DDGA 1FYMA 1OPCA 1T6SA 3FMSA 2Q8KA 5HI0A 2XV4S 3IKVA 4A0YA 1J3RA 1P92A 3REOA 3V7SA 2GXGA 4MH0E 1Z6TA 1BC8C 3JTHA 4Q48A 1Q3EA 2VE9A 3K1MA 2QZ8A 2Z9OA 2HWVA 2E1NA 2KKOA 4KMUX 3MEXA 5LHIA 2J5OA 1S7OA 1UW8A 1FI2A 5EEGA 1ZGJA 4HV5A 4ESJA 3ABUA 2ET1A 4YIIA 2PJPA 1JHFA 3GEZA 2ZO4A 3KGLA 2HS5A 3I53A 3GW2A 2QM3A 4KN7X 3WTZA 4XFCA 4IPAA 3KETA 2QCSB 2KIUA 2EV6A 1TQ5A 3WW4A 1IPKA 2D2WA 5BV6A 1LDJA 3WW2A 1KU2A 2HKOA 4BNCA 1O5UA 2KIFA 1RUOA 3MQ0A 2XHKA 5DUKA 4PJYA 4IEUA 4FAGA 1XCBA 2PHLA 2HJIA 1UFMA 4OU0A 3PLQA 2CSOA 2H09A 2HR3A 3LA2A 5IT3A 4LUKA 1OI6A 2IXIA 2P5LC 3VB2A 2H27A 3SXYA 1WLTA 2HOEA 4Y17A 4OOIA 4GYGA 4BH9A 2ELHA 4A0ZA 4P5OA 1VP6A 3NJZA 2EVXA 2MD5A 1ON2A 1XRUA 4MQVA 3RTRA 4KFCA 4KA4A 4QMAA 3L7WA 3SCGA 3H7YA 1UHWA 1F1ZA 4KIBA 2K9ZA 4S05A 3I59B 1BIBA 4RAYA 4LLGF 1Q43A 1J0RA 5CVIA 5DCMB 3P7NA 5ERIA 1EV7A 4Q47A 1GQHA 3VFZA 2NYXA 2NAZA 4PDKA 1G6NA 3NRVA 1IUYA 3JTGA 3C7JA 3WE2A 1J3QA 1B4AA 1YG2A 2CGPA 4U0YA 2BEOA 3FMQA 1U8RA 3USSA 2ZFWA 4I7HA 3DXJF 5D6EA 3H9AA 3B73A 1HSJA 3C18A 4S04A 3LWFA 3DN7A 4G94A 3ECOA 4RGUA 1O5LA 2QBYB 3CUQC 1L3LA 5FLIA 2QVOA 2MNGA 4IRIA 3BB6A 2JT1A 1T39A 3QAHA 4GYIA 2HEOA 4Q4ZF 5C8WA 4IRGA 3ZN1A 2B8MA 3TNQA 2PTMA 2W84A 2VOOA 2W85A 1KYWA 2K7LA 4RS8A 2GXBA 3WGIA 1KQ9A 3I5UA 4IHSA 2ISZA 3OTFA 3RDIA 4Y15A 4GULA 4MGKE 1MDMB 4OMZA 3CLPA 5HVQC 2DI3A 2EA7A 3CO2A 2DO7A 2M8EA 4MEXF 4LUMA 1UD1A 3TO6A 2IXJA 2VT2A 3FWEA 1B6AA 1EYBA 4EQQA 2OA2A 3NEUA 2YU3A 4AIHA 5FD5A 1X7NA 1QPMA 3T8TA 5FD6A 1FNNA 1TTYA 1R1UA 3J7AO 4HDUA 1J58A 2KJBA 4QLCU 4QGMA 2GC0A 1QZYA 3E6MA 3FJSA 2MPFA 1VTNC 2ADUA 3GZ6A 2P5KA 4KWJA 4OFGA 1FP1D 3F8CA 1G3TA 3E6CC 1W7PB 3FXQA 1A04A 4HW0A 2EV0A 1WQ2A 4XFHA 4CXFA 1K78B 2JRTA 2W24A 3EETA 3GX4X 1G3YA 2N7GA 3SFZA 1WKMA 1QZZA 3S7EA 3D0SA 1L0OC 2MLGA 4D7TA 1C0WA 2O6GE 3I59A 4QGNA 4R1HA 4HYEA 3DFGA 3G73A 1YFHA 5LGUA 3D82A 1ONVA 5DCMA 3KFWX 3I58A 4X6QB 4ETSA 1QQIA 2FF4A 1RI7A 5CYVA 1ZGAA 1FX7A 2JPCA 2XAJA 1UB9A 4KICA 3LAPA 2VODA 2YPRA 3BPZA 4WXCA 3I7DA 3DQVC 3K69A 5F64A 2VE8A 3SHFA 4E2SA 2QBYA 1BI3A 1ZZBA 4HVQA 2ZXJA 1ZLKA 1QY4A 2Y0OA 4EGZA 3WW3A 2XRNA 4A12A 2VBWA 5E17F 2V79A 2AS5F 1RZ4A 3QPTA 1I5ZA 2IT0A 4E2GA 3MDPA 3K0LA 3ISPA 3Q9VA 3V7RA 3DV8A 4WZCA 2OA4A 5TJJA 3E6DA 1U5TA 4CGZA 3V8KA 3WE3A 3M8FA 5F6FA 5D4RA 3HUGA 3ERED 4KNYA 3E6BA 1SFEA 2GU9A 2VT3A 1RNLA 1HW5A 3IKTA 2WWYA 5K5QA 3KP2A 1XGSA 4LG0A 4HA8A 4IERA 3R6SA 1MDMA 5ED4A 3T8RA 1YQAA 1ZRCA 4HX7A 4A6DA 3RKWA 2IVMA 3P9IA 1XB4A 3FXRA 3R0AA 3N4MA 5E1WA 4A0XA 2H6CA 3LOIA 3RYPA 4ZYHA 3GXOA 4ZU4A 3F6OA 3U2RA 4DNCA 3C1DA 2M5WA 1XMAA 1IN6A 4LLLA 4QM8A 2ETHA 1XE7A 1EP0A 4N9HA 4H7LA 4IEQA 1TW2A 4EM2A 2Y75A 3Q9SA 1G4DA 1PMIA 2DQRA 1W7PA 2QYOA 4ZZDA 1K78A 1F5TA 2EFWA 1EH8A 1OFNA 5CLSA 1YYVA 4ONUA 4LTAA 3HQXA 1V4RA 3KP5A 2K02A 4PGHA 1BC7C 1R1VA 3MZHA 2VBXA 1QWRA 4Y13A 4PZJA 4L0ZB 3EQLF 2ACJA 4A2UA 4PIXA 3CF6E 2UXXA 5E18F 3HTUA 1Z7UA 2VQAA 3TQNA 4UHTA 2NNNA 2P17A 4E70A 1FPQA 3SHRA 2DCTA 1B9MA 5H6RA 3J81Z 2J5PA 3CO6C 1D5VA 5D5VB 2ISYA 2OZJA 3F6VA 2RDPA 3K9TA 3TDUC 4ENNA 3T0YA 5FGMA 4RB1A 2YR2A 1WI9A 1USTA 2LNBA 5I93A 5FLXZ 4WCGA 5KHJA 3PNAA 4YARA 2IRFG 1DGRA 1JUHA 1D8JA 2HFHA 2BE5F 3UKTA 2O8XA 5J3UA 4Z2YA 1FBUA 3HHHA 5ILSA 2UY8A 1CF7B 2HTJA 2MHFA 4XBFA 2BYVE 3ES1A 1OYIA 3FHZA 1IXRC 3ES4A 3GFLA 4LULA 3I0TA 1R00A 2OZ6A 3LQQA 4BQAA 3PFIA 1WRJA 3NQOA 3FX3A 4AXOA 2PYTA 1YW9A 1V3FA 3IRRA 2Z5UA 1YFXA 4UBGA 2PBIA 2QUFA 4L5IA 3BPVA 2CV6A 3DF8A 2FRHA 1BI1A 1BJAA 1WSUA 4U7BA 1SD5A 4MGIE 3IRQA 1LEBA 3LSTA 3WG9A 3BJ6A 4EMSA 3QRFF 1YHFA 4BYYA 2XAQA 3SZPA 3KGZA 2ZBKA 1EH6A 3NL1A 4XLPF 4XRFA 3BP8A 3HSRA 2QWWA 5ICGA 5ICEA 3F8FA 3NVCA 1OKRA 3H3UA 4J1WA 1XSVA 4UXNA 1CAVB 3AAFA 1R5GA 2O1QA 2QQAA 1UHMA 1S3JA 1D8KA 4IEPA 3ZMSA 1PM7A 4KU7A 2O8QA 1HSTA 4HSLA 5D8LB 4I98B 3TNPB 2IW5A 5E8GA 3H1MA 5AIPA 3GO5A 3CTAA 3TO9A 1MGTA 3N97A 5BY5A 4U7DA 2MLKA 1DPRA 4P9GA 4MV2A 4HF0A 4G7HF 3HRMA 5EZWA 4AVCA 3HRSA 3DPLC 1NXMA 4QXKA 4OIRF 3QACA 4ESFA 4F7ZA 3MWMA 4K8FA 5ICCA 2RNJA 3DPTA 5LGTA 3ZQ7A 4KIGA 4KUMA 4BHPA 4ON0A 3Q5FA 3EYYA 1LVAA 5BUVA 4RB3C 3ZMVA 2Q0AA 2XL7A 2M45A 2LF8A 3HRUA 5HS8A 3RYRA 4HN1A 3MYXA 3C3WA 2D93A 4L5JA 2VONA 1J5YA 5BOXA 1AOYA 3G7DA 5ILUA 2GC1A 4I02A 4AIKA 1SFNA 4IEXA 1T98A 2IP2A 4ORFA 4HBNA 4P96A 4ENKA 3V8JA 4G9YA 4KT5C 1BBYA 1P4AA 1UIKA 5KVRA 2HYGD 4LGWA 3W6JB 3E5XA 2JTVA 3E97A 2H0VA 2DT5A 5FLXK 3JZVA 4KWLA 1WWXA 5A2QK 5E1RA 2P4WA 3WTUC 3MFKA 1O3QA 2FOKA 4BAYA 2D5FA 4UVCA 2D40A 1XGMA 1CF7A 3G3ZA 4IXAA 1J3PA 2VPVA 3WTWC 2ZNYA 4M9XA 3NW4A 4TLFA 5DD8A 2K4JA 3ECHA 3H3ZA 2F2EA 3KLOA 2M87A 5JSRA 5DEQA 1O7LA 5L3DA 3CO7C 2XLAA 1H9TA 1G3WA 3IBMA 1W5SA 5DUIA 4RD7A 1YWKA 3D5LA 2BNMA 3TKYA 2XAHA 1XE8A 5D5UB 2PMUA 5J48A 3FHIB 5KBFA 2GH2A 1QXJA 1W5TA 5D8KB 3BPXA 1QNTA 2R7DA 3M9AA 4MGRA 4O9GA 1U12A 2DAOA 1ZZ6A 2K4BA 3LAJA 2L4AA 1HKSA 3OGJA 1TLHB 3CJNA 5HS7A 4B8XA 1ZG5A 4GXOA 1CAVA 2AXLA 1SEFA 1SAXA 2DK8A 2W57A 4CHUA 4O6JA 1JE8A 1IAWA 1TQPA 5I8SA 1B1BA 3BZ6A 3V8LA 3FE5A 1ZHFA 2XUBA 1RTVA 4WXHA 4MX3A 4L0YB 4QWQA 2XIGA 2VBYA 1R23A 4EJUA 5BQTA 1OD5A 4MTDA 4P9FA 1W4MA 1FWZA 1G3SA 3KEOA 5H20A 4HLXA 3U9GA 2P8TA 2ZJ2A 5HLIA 3FM5A 4I3PA 3HHGA 3ROUA 2RV8A 3HIFA 4YFNF 2B0LA 2JZYA 3WW1A 3CLOA 3JAMZ 1P2FA 1B9NA 1WA4A 3OV8A 1ZG3A 4WX9A 2M1BA 1U6GA 1XDSA 3HOSA 3M8EA 1HW1A 1U5TB 2EFOA 3HT2A 3TDZC 5F1RA 4MZUA 2F5CA 5J6XA 2XKPA 1OMIA 5H6QA 1NE4A 4JTOA 2PMHA 2CQKA 4EM0B 1L3JA 2CAVA 5J7MA 3TGNA 1EY2A 4EGYA 3F8BA 4M73A 1J2XA 2EFPA 1Y9QA 5J8FA 4LG0B 3MZYA 3TOBA 1UPIA 2A07F 1DPUA 2ZCWA 4ASNA 2O0YA 1CAUB 1IRGA 4WXDA 1ZZ9A 1CAWB 1Y0UA 2PAMA 2MH2A 1BIAA 3EQEA 1J9IA 4JTNA 5AIQA 1R36A 4FHTA 5FLHA 3RZZA 1FSEA 5AONA 4OLLA 4XFGA 2L02A 1AWCA 2X4HA 4E2QA 2YSRA 4M6YA 5I0RA 3VEPA 1E2XA 4M9SA 1NHAA 5BMZA 3LA7A 1FYLA 2IXLA 5FDBA 1IXCA 2KJCA 3BWGA 2OD5A 1XMKA 3UKVA 5DYMA 5D5XB 5I91A 2PFWA 4O5VA 4U0VA 3M7GA 4G7ZF 3ZDSA 4EROA 3WGHA 3HTSB 1E17A 5I0TA 5I8YA 4EWEA 1ZZ7A 2QQBA 1OR7A 4HF2A 5HOOA 5HS9A 4HQMA 5IT9Z 5FFZA 5CVRA 5JI6A 2DBBA 5BXXA 1IPJA 5E1XA 5LBQA 4RGRA 1ZG1A 2IXKA 4BHCA 1DP7P 1I6XA 3F21A 1S29A 5D5WB 3LQRA 5LGNA 2M30A 1BN5A 5JCTA 1O3RA 3FZ3A 2PI0A 4ZYGA 3TOAA 5D6FA 4I0BA 1P4XA 1ZNPA 3KSCA 2DPDA 2E1CA 4BXUA 1LRHA 1S6LA 5E1ZB 5K1YA 3DP7A 4IRHA 2V09A 2A68F 5FB2A 1JGSA 4ZU5A 4UUVA 3P9CA 3JAMK 3QP6A 2FA5A 2IPQX 4HLTA 4YG2F 3H1YA 5K5RA 4X6RB 4IEYA 3MCZA 5FFXA 3EBRA 5EFUA 3HT1A 1SD7A 5CVUA 1GXQA 1DGWA 1FBSA 3KCCA 3H92A 1YLLA 3JW4A 2UYBA 1LQ1A 4XFFA 4MTEA 1FC3A 3BJOA 1ZVFA 2IXCA 5LRSA 2OAZA 2L3DA 1T38A 3M1EA 2B9UA 1P6RA 1BI0A 3HSFA 2WV0A 4K2EA 1XSDA 1IN7A 1K7AA 1CAUA 1FT9A 3C3VA 4GGGA 1CAWA 1UCXA 4HQEA 1JHHA 1ZH5A 5L3EA 3S7IA 1IN8A 4A6EA 4H0EA 4AD9A 2GAUA 5CVVA 1MJ9A 1JXSA 3DEUA 4JBAA 4CO8A 3F72A 1YFWA 3R4KA 3OF1A 3T5XA 3JSOA 2GIVA 2XLFA 1YO5C 2UWMA 1TNSA 3RNSA 1QXRA 1KU7A 3KE2A 3ZP5A 2BNOA 1XDUA 4FAHA 2V1UA 2MC3A 1ZRFA 3O14A 5E20A 4ZYEA 2MA3A 3BY6A 5KHKA 4TV7A 5DV5A 2UZKA 3KEQA 1SMTA 4OMYA 1HKQA 4JVAA 3IC7A 2NRAC 5CADA 1DZTA 2YX7A 1K6OA 1ZZCA 4LB5A 2O03A 1R22A 2EAAA 3GYDA 5I8TA 4IEOA 4P9UA 2EFQA 1R7JA 3OCPA 2ESHA 2XAFA 3RPUA 4I0AA 4P55A 3V4GA 2PAKA 3H1WA 3RYKA 4PGGA 3ZPLA 1ULYA 2OZUA 4EM1A 3U11A 4AVBA 2PFBA 4CDGA 4JV4A 3QOPA 1O3TA 2QVSB 5HDNA 2OU2A 4Q0PA 2WTEA 3CL1A 4XFIA 2ZKZA 2Q30A 2D5HA 4RGXA 3HYIA 2P6SA 5TRDA 4ENMA 1KA8A 2KIMA 1I27A 4A5NA 4O9EA 4LA2A 4XSZF 3WU0A 1KQ0A 1O57A 2E7WA 3FF5A 1FY7A 2CYYA 5JVTA 3FZVA 3L2HA 1YW8A 5K8SA 3L2CA 4LFUA 3R60A 4AIJA 3SMHA 1LNWA 1LJ9A 2FSWA 1BOAA 1SMYF 4XF1A 4L18B 1RL3A 1IN4A 2PN6A 1Z6RA 5AVPA 2FBIA 2OQRA 2D1HA 1OYWA 4GCVA 3LA3A 1WGPA 4NB5A 3FMRA 5KHHA 4YFXF 4EJTA 5C6CA 4ZZLA 3LFKA 3L9FA 1U5TC 2Q1ZB 4WWCA 4WF2A 1TQMA 1ZX5A 2COMA 3U0ZA 3WTYC 4AVAA 4Q5SF 2CW0F 1LR5A 5T3NA 4Q29A 2HKXA 1REPC 4XETA 1BM9A 3I4PA 4HMZA 2C0ZA 4YYOA 2TDXA 4NVPA 4ENJA 5FCCA 3WODF 3EYIA 5KHIA 4G6DA 2ZKLA 1TQIA 4EJOA 2D1VA 3ZMDA 1J1LA 1X3UA 4AQ6A 4M9ZA
chains in the Genus database with same CATH superfamily
3W20A 4N7UA 4KMFA 3ZSKA 3VDDB 5HCBA 5IVFA 2RV9A 2FU4A 4A5MA 5ILVA 1COV2 5IHRA 4L9NA 3WDWA 5DCFA 4D94A 4LB6B 1W8WA 3AMPA 2AACA 2K27A 2Y38A 4XBNA 1NCRA 2OPTA 4HVOA 3MD2A 5EJZB 3CDHA 4AFMA 1FBQA 4Q0SA 5IOZA 3H9GA 3ZPOA 4ARXA 4N0BA 4WVZA 3ZYGA 2GWRA 3I2GA 1F4KA 2JVGA 2JENA 2VUJA 4UWDA 2B46X 2JDHA 3RPQA 1LU1A 5M3FJ 3ZN5A 2XSDC 1X9PA 1RUNA 2EXJA 3D3AA 3AL5A 5L3FA 3LFMA 1NK2P 3ZQQA 2X1CA 1IKPA 1G59A 3T1LA 5DDJ3 3EHKA 4E7KA 3KMHA 3EDPA 3DEMA 1ULDA 2CFXA 4CH7A 5IK8A 1ON1A 1JZ5A 2F6BA 3N9OA 5L7OA 3DL3A 4P02B 3HM5A 5BS6A 2VZQA 4CEWC 4HBLA 3SCFA 4CDXC 3HN3A 3R0JA 2PXJA 3T09A 1LEAA 4A7ZA 2O61A 4J1XA 4UOJA 5JFRA 3K1PA 2K9SA 4CEYC 5FYUA 2M3AA 4HK9A 4TSVA 3MFCA 4QPGA 3MPBA 2VG9A 1AR72 1IF1A 1CZTA 1V6JA 3HMYA 3JRHA 5JSOA 1X82A 1TEIA 1HBXG 2JA7J 1ZM1A 4BEHB 2J1UA 3AP7A 1Z77A 3E0JB 3ZFFA 3EUHA 3VD7A 4R52A 1SQ4A 5F5AA 3BG3A 1X1DA 4BQ1A 2PAEA 2YV8A 2HQ5A 4BPZA 1HCRA 2EF6A 2NVXJ 3UKNA 2VUMJ 1QJY1 3VYSB 1FTTA 4EJVA 3FHAA 2FX0A 2DA1A 3FXUA 1XCVA 3VBFC 2E36A 4NHLA 4XKCA 2XMLA 4DRRA 4P1WA 4Y3OA 3RKYA 1NTCA 4XW3A 5BNPB 4QDSA 3VL9A 1VR3A 3QLQA 1IXSB 2BVMA 4FT8A 4FX4A 2V1DA 2KRFA 4GB31 3CDZB 1TBXA 3JCUC 1J75A 5EWSA 3HRTA 1GHCA 3E1SA 5CFCB 2DCYA 2PJRB 4RYDA 5DQ0A 1Y7BA 5FZ1A 3VB9A 4UVAA 1CGPA 2QQ9A 5FYBA 2OUJA 1XPWA 2YU2A 3IH2A 4HX8A 1MBFA 3DEWA 2YBPA 2QKDA 2EZHA 2HDCA 1G9DA 2ET7A 2XHNA 4HV6A 4BDVB 3BTIA 5FMCA 4BM8A 5FJHA 1MZ5A 4M00A 2WLPA 4MOAA 1N1YA 5LK7B 3BTLA 1PUEE 1RC6A 4Q4Y1 5A7QA 3JXSA 1ODDA 4Q27A 1SVOA 3HOVJ 2C4XA 3M2MA 1QGPA 2QJVA 5C3SA 1NY72 5HLHA 5EJCA 1OVPA 3AX4A 3LQCA 4UXAA 2VMDA 2FCVA 3AKRA 3OYWB 5E8AA 1NG0A 2V5YA 3GBFA 3N9MA 1V5GA 5ICFA 2W1QA 4IESA 4ARYA 4YIFA 3PUIA 4M3EA 4F93B 2ZEZA 2VCMA 3HQUA 2X5IA 1W0PA 2HEWF 1YTYA 1HV0A 2W46A 4M6XA 4IO9F 2OPKA 3T0AA 1F43A 1I9RA 1V70A 3LEIA 1C1FA 2FBHA 1YLFA 4H4KC 2HXIA 1OSGA 4DB5A 1YO8A 4YFKF 1DLLA 3ZFGC 2CGOA 4E4ZA 2B7YA 1MD0A 1W2AX 3COAC 3AYDA 4D7YA 3NKTA 1QKQA 3GVAA 3NKGA 3X2QH 5LHHA 4LBMA 3WQBA 1VMHA 4ZYDA 2DU9A 5LEJA 3VBSC 2NS0A 3OOPA 1U9NA 1YE9A 3VOEA 1ZARA 2I45A 1WH7A 1E57A 5FPUA 2VR4A 1N78A 3N35A 2LMDA 4V1PA 4C3JJ 2XGEA 1C8M1 2HYFA 3MKYB 1E5RA 4P08A 1AU7A 1YIPA 1KQ8A 2V9PA 1I1SA 2VKDA 3MLJA 4F8AA 4HPQA 3WTTC 2R49A 2GP3A 4QSHA 2E26A 3ZXGA 4LD5A 1UZWA 3C7GA 3Q8BA 1U3EM 2R7XA 4V2WA 2W39A 2GN7A 5FPVA 3ZSLA 4RBOA 3S2WA 2A6HF 4OQ8A 1UCRA 4IJAA 2XJTA 3GTJJ 4WM7B 3HZJA 1SFYA 3U1DA 3SJMA 3LGRA 3ABKH 2Z2SB 2DQLA 4W97A 1CONA 3HOZJ 5FZBA 1X8MA 3A7QA 3BVCA 1M1EB 2ORZA 3I4IA 2IA1A 4HAMA 4WM8B 5BPIA 4LO5B 3N05A 4JRAA 4V2GA 1CR7A 4YW6A 3C2BA 4BQ4A 3RZKA 5GLUA 3F8MA 2NOGA 2Y31A 3BOQA 1O4TA 3W5MA 2EICA 2TEPA 4O3MA 1EV11 3BODA 1QDCA 4IETA 4C3HJ 1TMF3 1L7RA 2HTSA 3ASOH 2XL9A 3LPGA 4BMBA 1OFSA 1R58A 1UG2A 4QQ2A 4YM2A 2EFNA 2CJJA 5J3LA 3F3XA 2DPUA 3J80Z 1MNEA 1AR71 5E89A 1XNBA 1I1GA 4MXVA 3UNPA 2W0XA 4KDPA 3O3KA 1R5HA 4AW7A 1LDKB 2DOFA 2YGLA 1LOBA 1QOSA 4FFHA 4KU8A 4CUBA 2VW2A 4UT5A 2KDOA 3MUZ1 4LQRA 5GP9A 2DOEA 2D43A 4BHBA 1N1SA 1RUE1 1RUJ1 3SKVA 3WHBA 2I8DA 2MH9A 3EO6A 4ZU7A 2LSOA 1RJ8A 4YRDA 3O1MA 1HXDA 1R64A 1ETQA 4F52A 2AO9A 1J83A 5FRNA 5L3BA 3LWCA 2VTFA 4UYBA 2E71A 5FXWA 1MVQA 3MGUA 3ZOBA 1QU0A 4CCEA 3OYLA 4KL1A 1PP8F 4M3GA 2R7WA 2ZA9A 4AWXB 5E8IA 2XBO2 1LUJB 1IS6A 1ZBE1 4BMEA 4DBRA 3VKNA 5FBJA 2R7FA 4R9AA 1O3SA 4BBRJ 4XUNA 3E5UA 5J8CA 5DAPA 4Q4V1 1MJBA 4QIWN 5M5XJ 3UV9A 3BPSA 3J7MA 4GH4C 3RJ2X 5F5IA 2HQRA 1T2KA 1QH7A 2BV4A 1UU5A 4NDLA 4CVUA 3VLBB 1ZAOA 2DTRA 4E4HA 2JDNA 5JR3A 2Q2EA 2WQZC 3A22A 3RMXA 2NLRA 3WDVA 1AR61 1W2TA 4I2OA 3ZMZA 5K7PA 3KZZA 1KYZA 2W5FA 1TL8A 3B9IA 2PQQA 1SLTA 2VNOA 2VBBA 2RM22 2M0CA 2WL1A 1GNHA 5CFCC 2CRGA 1HF0A 2BBYA 1OYYA 4I01A 3J7HA 4C2MJ 1EPZA 4ZH4F 5FQ0A 2XJSA 1H1MA 3CJIB 1P7IA 2IA2A 3FKIJ 4XMYA 3U10A 1I3QJ 3WGGA 2Y2ZA 3VHRA 5C9AA 3MHZA 4GWIA 3QU3A 4QHBA 4A3FJ 2LS6A 3ZQIA 5ABJB 3V0AA 2RQQA 3NNFA 4MUVA 1NZIA 2L0KA 3LOCA 1GZTA 2ZJCA 4ZXKA 1W3XA 5EEHA 4I3GA 4QPYA 4G8XA 4IHTA 3S8PA 3DLLF 1SD4A 1AHSA 2VBDA 2QDRA 1WMEA 2CS3A 5FLMJ 4MHGA 2P7CB 2P34A 4G3YC 3E3VA 2FUG2 5FKBA 2EPFA 2AENA 4CU6A 3ME2A 3VSKA 3WY6A 3ABZA 2ARAA 4A7KA 4L9JA 5DDGA 1W6QB 4NMIA 1OQ1A 1A78A 2BP6A 4A0YA 4U36A 3EUKL 1Q8QA 1J3RA 1AJOA 3REOA 1S0BA 3BLYA 2WIIB 4QB2A 5FXVA 5KAIC 4Q48A 1ASJ2 1FOD2 2VE9A 1U5IA 4HNVA 5F04A 1BLZA 4KMUX 5LHIA 1S7OA 4FI9A 4JX4A 5M3MJ 2CNAA 4YIIA 4LE4A 4ZXEA 3GW2A 4LBQD 5KWRA 4XFCA 5DUUA 1MBEA 3KZIC 1SDWA 3H8XA 1V6MA 1LDJA 5EG0B 3A2KA 4BNCA 4CCDA 2QF7A 2D5VA 2KIFA 5ERLA 3VBUB 1IGOA 1QJX1 1N3QA 3OY8B 2QDNA 4UAPA 1VQPI 2E63A 2HH9A 4DBQA 2YUSA 3F2ZA 4LUKA 2RHPA 2HOEA 3RWKX 5HCFA 2ELHA 4A0ZA 4LHSA 3RSNA 4DUXA 3DPRA 3OYFA 2EVXA 2MD5A 5JVGF 3X29B 1SCSA 4PJ0C 4XACA 5IK7A 2WNUB 2M2EA 5FRAA 4TLGA 5D8AA 1UHWA 1PVC3 1I6HJ 5B4NA 1JOPA 5T52A 2JIJA 2K9ZA 5FPAA 4A93J 1NA1C 5EZGA 1D4M3 1LCLA 3HXLA 3P7NA 1EV7A 4A3GJ 2BWCA 3HAGA 5HBAA 5IYBJ 2P5BA 2ZKNA 4YM0A 3WE2A 5A7WA 1WW6A 3RQ0A 5D6EA 2LREA 1HSJA 4PQ9A 4PDWA 1V5FA 2IS4A 4G94A 3F0CA 3OG2A 2PMWB 5A6YA 2WBKA 5FZ8A 5JPNB 1YIJI 3QAHA 5GTIC 4GYIA 2DA6A 2GXAA 3GTPJ 4A6OA 4AE2A 3E1F1 5JZGB 4FSJA 5FMOL 4IRGA 1PUFA 1RHI1 3BUCA 4FTSA 2MSYA 3TNQA 3JQXA 1HXS1 4M0NA 1SANA 4RS8A 2UUZA 5IOYA 1LGCA 2L9NA 3I5UA 4NROA 3OTFA 3DXTA 3WQ1A 4TWTA 4QTRA 3TP3A 4A3KJ 3CF5F 2EA7A 1APLC 2DO7A 2W9XA 2M8EA 1COV3 4LUMA 3TO6A 2ZGRA 2XQRA 1B6AA 3QYFA 1R4NB 2GIZA 3PIPF 1F8VA 3MBWA 3HGYA 2WV1A 3FIWA 5FD6A 3ASNH 3J7AO 4OZOA 2P81A 4QLCU 1SFOJ 4XNFA 1BBT2 1Y8QB 2LP0A 1QZYA 4TZDA 2ADUA 1D4VB 3VKMA 4JHZA 4BE0A 5FJKA 3DU6A 2WR9A 4GAZA 2A5WA 4PLOA 4C2TA 2B42B 3ZQGA 2EV0A 1WQ2A 1K5MA 2W24A 3LEGA 1S5LC 5FPLA 2PLV2 4ZKTB 4QX0A 2R042 3PNTA 2R4GA 1SFKA 4OUSA 4N8MA 4NRPA 4HYEA 1QNWA 3TN91 3D5RC 1W03A 1YFHA 3CZ6A 2WNVB 1ONVA 2P0WA 5DCMA 3KFWX 4L5EA 2E1OA 1MNDA 1LFUP 5B1AH 4N7IA 3WXPA 4LO6B 1LFBA 3UR3C 3ZQFA 3LAPA 5CISA 1N3PA 5TISC 1KS5A 1WFXA 4WXCA 1DGWY 4CCLA 2E53A 3I7DA 1UQXA 2WYFA 3WR0A 4Q8KA 2YXSA 1IHMA 2QBYA 3OWTA 1HV1A 2ZAAA 1ZZBA 4HVQA 1AR73 1QU3A 2HDDA 4EGZA 1ZKGA 1S2BA 4A12A 3CJIC 3S1QJ 2XVKA 1RZ4A 3O0XA 5IK4A 3WDYA 1AX0A 4E2GA 3MDPA 3DV8A 4WZCA 5TJJA 1XS9A 2ZBJA 4XQFA 3WE3A 3M8FA 4FPJA 5F6FA 5D4RA 3E6BA 1BHGA 2X53S 2VC9A 4M3CF 2V26A 1GR3A 3R6SA 1MDMA 2ADEA 1GWLA 3KS7A 1YQAA 2W00A 4LMFA 2VZ3A 1UXZA 2MG4A 1JZ2A 3LOIA 3RYPA 2HVRA 3MIBA 4XUOA 2DODA 1WWYA 4EZ4A 4I30A 4MHRA 2ETHA 1XE7A 1X4OA 4PUSA 1BW6A 5FKKA 4GFBA 2ZSHB 3AVRA 2MD0A 4IEQA 4XXPA 2Y75A 4W6WA 1PMIA 1JT0A 2SBAA 2OTLI 4CDUA 5FXXA 1IQAA 2QYOA 2WJSA 4FPFA 3NQHA 1OFNA 4ONUA 2KHMA 3LMMA 5GLWA 3VKOA 1K3IA 3HQXA 1V4RA 2KR2A 1OHFA 3R4DB 2BZDA 2VBXA 2XUMA 3H0GJ 4YW4A 3LSRA 2DMNA 3V65A 4L0ZB 3EQLF 4PIXA 2WFF1 3OPTA 2X9DA 4RQPB 3MIDA 1Z7UA 4WVVA 3ZRGA 3TQNA 2NNNA 2R072 4MO3M 3GTQJ 2DCTA 5KXDA 2JQ7A 4HPKA 4PHZA 3K9TA 1S0GA 5FYZA 1V6IA 4FOVA 3T0YA 2XUEA 5FGMA 1GKBA 4S2HA 2YR2A 3VD5A 3WQ0A 4CEWA 5I93A 5FLXZ 5JMCA 4CDXA 5KHJA 3WG3A 4C3IJ 1AUYA 2WNUC 5FYVA 4YARA 2QGUA 1H2LA 2VJIA 3HHHA 5ILSA 1SACA 1WCQA 4CEYA 3A21A 3ES1A 4LULA 3I0TA 2OZ6A 2R7QA 2YC2A 2EIJH 5DN2A 2E1MB 5LBFA 3LDRA 4HNUA 1TVGA 3S32A 4IGOA 1PGL2 4UBGA 3OSGA 2LD5A 4R4ZA 1UYZA 1OQDA 1BI1A 4HANA 3FFZA 2Q1FA 1SD5A 4MGIE 3PDQA 1YHFA 2XONA 1Q8PA 2XAQA 5A3NA 2BGPA 3HSRA 2ZJQF 5ICGA 5ICEA 2JICA 2CY6A 3NVCA 1Z7S1 4J1WA 4UXNA 4G6TB 3WCRA 2R1BA 2QQAA 1W6MA 3JD71 3A4UA 1PNFA 4OULA 4I98B 3TNPB 5AIPA 3VBHB 4AI1A 1C1LA 3N97A 2KISA 3F9KA 1MS3A 4YRVA 2A6VA 5FYTA 3HRSA 3AB0A 3GCWA 3AL6A 1S2EA 4DZJA 1GV5A 3QACA 4TTGA 1W0NA 4K8FA 5FZLA 3ZQ7A 3KHBA 1LVAA 2KZGA 2EIBA 2XL7A 3HRUA 2QQMA 3R0RA 4A42A 4HN1A 3MYXA 1F5JA 3C3WA 5K7HA 2D93A 1J5YA 1AOYA 1WZ2A 5KXCA 4I02A 3OR1C 1SFNA 2FDJA 2BBAA 4G9YA 4KT5C 1BBYA 1R1A2 2W3JA 3BG5A 4QT6A 4E7SA 1VALA 1VAVA 3E5XA 1LHNA 1NLRA 4OI1A 1SAUA 5A2QK 5A6ZA 3ZQLA 5E1RA 3WTUC 3MFKA 1O3QA 1TZOA 3O1VA 2WWUA 1XGMA 2BHYA 2R5YB 4XLEA 1AXYA 1RUC2 3FDYA 4BQ3A 3P3NA 3UL2A 4W50A 3KLOA 1DYPA 2M87A 3K77A 1QHDA 1LHUA 1S0IA 2BBVA 4A7YA 3ZFGA 4Q2FA 1H9TA 2CU7A 1K61A 4LHNA 1VQOI 3WNPA 4RD7A 1XE8A 2R6QA 2PMUA 5KBFA 4JKLA 4C9YA 4AHYA 3VBSA 5CFDC 1W5TA 5D8KB 2A3XA 4C8DA 3GJAA 3T4VA 2ZGOA 4NIHA 5CZKA 2HWE1 2K4BA 3LAJA 5T5LA 4HK8A 1Y4WA 3OGJA 1OD3A 1VBC1 3CJNA 5HS7A 4GXOA 1CAVA 2IZWA 2AXLA 4NWVA 4E4DX 2XBO3 3OEBA 2PHWA 5I8SA 3M3EA 2YYOA 5FYYA 1W0OA 1F5FA 1OLME 3V8LA 1U8BA 4RLFA 3R05A 3U75A 4WXHA 1SPPA 3K70C 4Z1VA 1MS0A 1RUF2 3LB9A 4YG6A 1W4MA 3KEOA 2HPMA 3FM5A 3SEZA 2JRMA 5FYSA 2O8OA 1FV2A 2JJ7A 3QOEA 3HHGA 2Y6LA 2RV8A 2DVAA 1AR92 1HLCA 4YFNF 2B0LA 2JZYA 3WW1A 3CLOA 2KMUA 3JAMZ 2D6PA 1B9NA 3AG3H 4PJMA 2RM23 1URXA 4QPIC 1U6GA 3HOSA 2RREA 1CPMA 1HW1A 3S1NJ 3OYAA 1RUI1 3J7AY 1DU3D 4RL7A 1DCSA 2HWF2 2XKPA 3W21A 4W1UA 5E79C 1MQTC 4QDRA 2PMHA 3KF3A 3PVOA 1SBFA 2HEVF 3TGNA 4A3ZA 1GFF2 4M73A 5ANNA 1J2XA 5CKTA 4AG4A 3N7KA 5J8FA 3JQWA 3ZXAC 1UPIA 2PELA 3M1HA 3KT1A 5J98B 5APAA 1IRGA 4AFAA 1XQNA 3WF3A 1Y0UA 2M34A 3IN9A 4A3LJ 4DEQA 2VQUA 4RQPC 3O1PA 1BIAA 3T3YA 1IUFA 3EQEA 2XPVA 3OYHA 1TWCJ 1UZ0A 4CA9A 5F7UA 2DU0A 4IHWA 2W82A 3D5OA 4FP3A 5I0RA 4JZRA 3VEPA 1F2NA 3AC0A 4W6YA 2P37A 2KJCA 3BWGA 1PMJX 4UW3A 3V42A 5AC91 2AEZA 2WZR1 2E2IJ 5DYMA 2QEXI 5D5XB 1RUH2 2F17A 5LZ6A 4N43B 2E31A 1ASJ3 1FOD3 3J8F2 1LEMA 1G9FA 3ONQA 2LKXA 4IHVA 5I0TA 5I8YA 3FLRA 5HS9A 2JG8C 5TGTA 1OVSA 3RSJA 1IPJA 2E1MC 2RS52 2FD5A 4RGRA 3HOYJ 1G2HA 3DYOA 1I6XA 1Y9GA 3I9V2 2M30A 4PK4A 2QQLA 1GP5A 1O3RA 2EIEA 1WUVA 3OL4A 4ZYGA 2K3FA 2DJNA 4BJ6C 1ZNPA 4CCJA 2DPDA 2JUGA 4BXUA 5D2AA 1LRHA 1BXHA 3DU5A 2XH6A 4S2DA 5FKCA 3DP7A 2A68F 3T1MA 1SZBA 2E32A 5IVEA 5FB2A 1ULPA 2LM3A 4YW5A 4QXBA 3KWVA 4GH4A 5A33B 5B2GB 1D5YA 1XYOA 1AL0G 1IG0A 2QCOA 4YG2F 3H1YA 3CP2A 4X6RB 4IEYA 4YG3A 3EBRA 1PIV1 3HT1A 4FQGA 4JYKA 1DGWA 1YRNB 1FBSA 3SDBA 2XGCA 2DF7A 2QQIA 1YLLA 4LNVA 2UYBA 4INDA 1WJCA 4NC7A 2WWJA 5CFCA 2OAZA 1T38A 4D5FA 3K4BA 3M1EA 1I5PA 1RPWA 4EATA 1IN7A 5EEAA 1K7AA 1TT5B 1CAUA 1FT9A 3DUIA 4B4RA 1OOPA 1N47A 1I39A 1UCXA 1XU1A 4HQEA 1JHHA 2YHJA 4AD9A 1CJPA 3DEUA 3H5NA 4CO8A 3OYMA 4M4RA 3F72A 1YFWA 2DUOA 2BHZA 1RKWA 3O0WA 5F5CA 4HFSA 1OLQA 2JKBA 1YYNA 3RNSA 5IVBA 1KU7A 1MS9A 2R061 1UZZA 2JDYA 1XDUA 2I5UA 3BR1A 1BK0A 1K83J 3AK0A 3O14A 5FYHA 3AZWA 5E20A 2UZKA 2QE3A 1OQYA 4RHV2 4OMYA 4NUBA 2WBMA 2YX7A 2ZMNA 2WB1A 5I8TA 1Z78A 5GM0A 3OCPA 2WAEA 2MC4A 3ZDVA 2DTZA 1CN1A 4XRMA 3CMYA 3RYKA 1JZ3A 3U07A 3U11A 2ELJA 3CP8A 5EYYA 4CCNA 3QOPA 2C24A 5GAEJ 1NCRB 1GZWA 1HJGA 2Q8CA 3WV6A 2BDRA 1BBT3 1TME1 1MEC1 5L9VA 2HVSA 3I55I 1B8IB 3WQ7A 3GTOJ 4RR3C 4JAAA 4DEVA 5TRDA 5T5PA 2KIMA 4A5NA 2PLV3 5JXJA 3Q8AA 1W9WA 4UUSA 1KQ0A 1H88C 4BKXA 1O57A 2R043 3NJXA 1FY7A 4ANJA 5JVTA 2BVBA 3MUY1 5K8SA 2D7FA 5FMBA 1CZVA 2P2KA 5L7OB 3POYA 2A75A 2W1UA 5FZHA 1VBD2 3S30A 2A71A 1BOAA 3CQZJ 4D8MA 1NA1A 3L2RA 4XF1A 1IN4A 2PN6A 1Z6RA 2VOTA 3H5RA 2BVLA 3SH4A 5FZ9A 2M7BA 2RDSA 3LA3A 4GJYA 4FOYA 3FMRA 3ZMNA 3SQOA 4EJTA 3LFKA 5J36A 2ZACA 5DZFA 3PMEA 4X8NA 2MEV1 4DPNA 4XJZA 4K7JA 4XC9A 5EHDA 1UX6A 4Y5Z0 2HKXA 1REPC 4XETA 1VBB1 2EH3A 1BM9A 3K10A 5AVAA 1LPQA 3S93A 3ZFFB 3OGRA 5KHIA 4KT6A 3CCLI 1Y39A 3S1MJ 1OCZH 5EV7A 1VBE2 4YZ5A 2D1VA 1J1LA 1QDOA 1EPWA 2ZJRF 5JI9A 3PQJA 3AMHA 3Q8EA 4DYQA 1X9TA 4BOWA 2EV5A 1IJWC 2GA1A 1H8AC 4K9SA 3KP3A 3HOBA 1J59A 4U88A 2CV2A 2Z99A 1ULEA 2HZTA 1A6IA 4MGYE 1AR81 3VHPA 5K4LA 3GZTB 2DTWA 3RI4A 4Q0QA 2DCZA 1WHUA 1DU6A 3AL0C 4Z07A 3H8RA 3BGAA 3BTCA 2M0MA 5IP6A 4CZSA 4E4SA 2F5FA 1ZR2A 2NP0A 1WW4A 1JZ7A 5FY8A 4GZ9A 5CQGA 1T0FA 4KIFA 2ECBA 3I2JA 3W58A 4KQ7A 3OEAA 2X1DA 3TEDA 4DQAA 1HRV1 1O7FA 4EJWA 1R092 2HWB2 2TRTA 1D3YA 4DQ2A 3IIAA 5CJ9A 3GBWA 4HXCA 4M72A 1IRFA 3VL8A 3ZGKA 1NXD1 2R073 2WKKA 4IEVA 2O3FA 4FBFA 2IS2A 2NVUB 5FUPA 4DJAA 1UIJA 3UT0A 1C57A 4YFWA 2AUYA 1OQEA 5FMDA 2BGOA 4XIOA 3PIGA 1LESA 2LG4A 2X5IB 4E27A 4U0WA 4ZJZA 5L73A 4BLJA 1R1ZA 3RZDJ 3AMNA 2DA2A 3IL2A 2FQ3A 3ZYBA 4QM9A 1DP3A 4OUMA 2DV9A 2VKEA 2RS32 2G4IA 3M70A 2JB4A 2YFZA 3OBRA 4EZHA 1XN7A 2GC2A 2WB1N 2J1RA 1JOBA 4NPMA 4IV3C 2NM1A 4HF1A 4YLZA 1EKEA 3CJIA 2WO3A 4BISA 1V5EA 1TP4A 1OH4A 5HDKA 3GLXA 1GUIA 3PVBB 4R9DA 2VNVA 1OPOA 2XB6C 4ES9A 5JSPA 2PX9A 2L9SA 3TP0A 1G9AA 2LOOA 1LULA 4JKKA 2HWC1 3WLUA 2EQRA 5F3CA 1FOXA 1GOFA 1ZYRF 4QDQA 4QX5A 2DUPA 1F9NA 2CH0A 1TNRA 4HLYA 1F36A 2NXNB 1FOKA 3GTMJ 2YG0A 1UKGA 3BI3A 1SMVA 5KXEA 4C2UA 2QNKA 5T55A 4AYBA 4LKEA 2Z33A 3PSIA 4QD2A 3ECQA 2MBFA 2FNAA 2H94A 1TWHJ 1WJEA 4B1RA 1O4XA 4YNIA 3M3OA 1Y3TA 5CPRB 4NAOA 4HDVA 2VTXJ 4M3CB 5FZKA 1S7EA 2P1BA 1SBEA 3KP6A 1S0JA 5IAVA 1MJAA 2CL2A 1AYM1 3IWZA 1WLCA 3PIOF 1S7AA 2X10A 5FPXA 2ZPXA 4OWRB 3FXOA 1UXXX 1A6CA 1IV8A 1MS5A 4COUA 1G9BA 3C2GA 2XPJA 1Y0NA 4CTEA 4OIQF 1JYCA 5I0SA 2RDQA 3OYJA 2FEZA 3QP5A 4XF0A 3NSTA 1XSXA 3IV5A 3IHUA 1R1A3 3QD6A 2CO5A 2CUEA 3OY8A 2BOLA 4YGDA 4B3AA 1PX4A 1SFUA 1Z9CA 3OOUA 2CWSA 2XLGA 2HBUA 2HPIA 1JXNA 4ZS2A 4YGBA 4R4XA 4X8PA 3RIRA 1W99A 3ZYJB 1RUC3 2O0OA 1Q5OA 3BALA 4FCAA 2EK5A 2XPUA 2W25A 3LDBA 5LB6A 2IVIB 2V9VA 4CUAA 3DYPA 1HB4A 1W36C 3BU7A 3G4SI 3ELKA 1VBE1 3ELNA 3POGA 3I3MA 1Q1HA 4IE5A 2EA4A 1ENQA 1ACCA 1RGSA 4W6XA 3SKJE 4K1ZA 4A4AA 1VBA2 3K70D 2GA2A 3GUDA 1TWAJ 4KYWA 5I0UA 3ZR8X 4G6QA 3FK6A 3IDBB 3JRDA 3RG0A 3GFJA 3Q9OA 1YIOA 4UFJA 3G1MA 5J47A 1DQ5A 2JPBA 3BCWA 4DW6A 5G05L 3I3DA 1RMU1 3OY9A 3PSFA 4IKFA 2EILH 2RR12 1H1IA 3AFKA 1XPXA 2QSHX 2G7HA 3O1UA 3W6KB 5BPDA 2DYSH 2OUHA 4B44A 4BY1J 3M07A 2WAAA 2R5ZA 4XXAA 3SCHA 4X0GA 3KVAA 1RUF3 2JDZA 1AJKA 1MH4A 2H0BA 1OA2A 2WQ8A 5A7OA 4BDYA 4I99C 2LBFB 2WFPA 1GQPA 3O12A 5FY0A 2NNYA 3N9PA 2Q2EB 4GALA 2CQNA 3VDBA 2JA2A 2ID6A 3CEWA 2O7OA 1AR93 1DQ4A 4LK7A 3I71A 4CP1A 3UGFA 2A6TA 4AU7A 5D1IA 5JHUA 2FNPA 4IQJA 2YGMA 1LKNA 2RS12 4AIDA 2UWAA 1X3WB 3I8TA 1JKRC 4YW1A 4OHWA 4Y1XA 3RKQA 1WJBA 4AR2A 1FZPB 1ENHA 2QBXA 1RIOH 2AQEA 2YZ4A 4XONA 2UY9A 5FQ0B 1R9TJ 2HWF3 2CW8A 2XKOA 1HW2A 5I0DA 1F15A 4RB0A 2VUDA 2W94A 3M3YJ 5C9AB 1MACA 4UFMA 1IG7A 3VN4A 5FO5A 2BVVA 4HKWA 1PO22 1PX3A 1NK3P 4XURA 5FZCA 3V0AB 5IT9K 2EZIA 5JDBA 3KP7A 1CX4A 4BE1A 3FK7A 1WI3A 2FE3A 2DYRH 2XQXA 2AC1A 2HQNA 5FREA 4QX8A 3BTZA 2IGOA 2R7VA 3DBHB 4IXLA 1F35A 5FLJA 2X0LA 3U4XA 3AJYA 1UY3A 1VNDA 1IZ1A 4XFAA 4LOTA 2RAEA 2IC1A 4JDNA 2HOAA 4MHUA 4UVBA 5DAWA 3KQ4B 4HSRA 2LKPA 2VMCA 3K51A 2X5IC 1VI0A 4WVMA 4EN8B 3HOTA 1YRZA 1RUH3 4QQOA 4NC6A 5DUWA 2M8GX 3HKZA 4AYBN 5CKMA 2FQPA 2P7VB 5T5OA 3J8F3 1VJ2A 3JBG1 1VRBA 2OQGA 3IH3A 4CZZA 2Y34A 3WTXC 5CFDA 3K75B 1DBNA 4ASKA 3MO4A 1MH3A 4Y4YA 4UY8I 3GZNB 4MNUA 2RS53 4Q4X2 5CQEA 1CVNA 2ESNA 4E7HA 1WGXA 4BIFA 1FYKA 5B4XA 4M71A 3LSIA 5GLTA 1FMVA 3W3CA 1ZN2A 2XAUA 3FFQA 1VMJA 3WU1B 3V0BA 2A05A 2DLLA 4JK1X 2ZS6B 4FCYA 5FY1A 1PJRA 1SHWB 5LASA 3VDCA 3AXEA 4L11A 1ZLJA 2Z69A 4OI4A 1RINA 3S0MA 2A69F 3QBQA 2VXZA 4LJHA 2E34A 1QIQA 2GZWA 1AL22 2F4IA 4BQ5A 2DA5A 1OJLA 4EWAA 5T50A 2JB8A 3MAJA 2PHDA 4HEA2 5JLXA 3MIGA 3AZYA 3A01A 2ID3A 2VE1A 3RJPA 4U87A 3NAPA 3D5SC 4EV0A 2W1SA 4QPIA 2GM4A 3DKQA 2EZLA 1YS6A 4XLHA 1DYOA 4DS0A 2VTXA 2PG4A 1SLBA 2YPDA 1QVTA 3BT9A 5C3OA 2DBIA 2YY1A 4OIPF 1UYYA 1ZRRA 4P5HA 1MQTA 5A7WB 2B5HA 5L3CA 3VPRA 2FOWA 5JR7B 4RGSA 3ZMUA 3KM5A 3B02A 4PDWB 3I3EA 1HQCA 2ME0A 3FUOA 2DFEA 4BCUA 3LEKA 3TBDA 1STZA 4AVPA 1H6XA 1FOWA 5F5QA 3W9AA 3THTA 2JX9A 3GZ5A 1FYMA 1BOBA 2PHXA 4K8RB 5HI0A 2XV4S 3IKVA 4OCTA 3K4KA 1PUFB 4IOAF 3IB3A 3S3OA 1P92A 2CUJA 2GXGA 3UJOA 4MH0E 1QPIA 1VZ0A 1BC8C 4J19A 1Q3EA 1FMD2 4RHV3 5A7SA 2Y0IA 2DFFA 2HOSA 1ZGJA 4HV5A 2PHUA 2ET1A 4NC8A 2VXJA 3M8JA 3KGLA 1S0CA 2VZUA 4XPVA 4CCCA 2RG4A 4KN7X 1ND3C 3KETA 2QCSB 1MMGA 3WW4A 2JG8A 3SZGA 4OHXA 2DYCA 3WW2A 4IGPA 3MQ0A 2VO5A 2XHKA 1X2NA 3C8XA 3OYEA 1JHNA 4TXWA 2JWTA 2KQRA 2E7AA 1XCBA 1ZTRA 1JUMA 4MVTA 3PLQA 2H09A 2HR3A 1WBFA 2QQKA 2FD8A 2XWJB 3ACHA 1OI6A 4XQ4A 3APBA 4IV1B 2H27A 4IEJA 1HKDA 4OOIA 1WMXA 4GYGA 2DWRA 4XN3A 2HOTA 1K5MB 1VP6A 3NJZA 3D4KA 2IGNA 4KFCA 3L7WA 4I0WB 3C7OA 1UHSA 4KIBA 3HOWJ 4S05A 4RAYA 3PUQA 4LLGF 2DFCA 1J0RA 5DCMB 5A70A 5A3WA 3VV1A 5ERIA 1GQHA 3Q0VA 1VBD3 1KONA 3UETA 1RITA 4QX3A 1HN1A 4UF0A 4C0HA 4AEDC 3NRVA 4QQLA 1JJ8C 1QEXA 2CGPA 2YUEA 4U0YA 5FO8B 2VJ4A 1LGNA 2ZFWA 3DXJF 1RESA 1FV3A 2R7RA 3LWFA 3ECOA 2WZ8A 1O5LA 5DDJ1 2QBYB 2FJ1A 4OVEA 3K4AA 3OYGA 3BB6A 4XJ8A 4XORA 3ZXDA 3IAM2 2MYSA 3K4ZA 1OLTA 4FPEA 4QX1A 4Q4ZF 3HD8B 5C9AC 3MLKA 1K5JA 3OGGA 1YIFA 4DO0A 2B8MA 1UN1A 2GMEA 5FJ8J 3W59A 1K6YA 3HPGA 2VOOA 5A3PA 2EINH 1KYWA 3PJYA 3I3QA 5A80A 3CNAA 1VBE3 4XYXA 4Y1ZA 4GWJA 3K3NA 3RS6A 3PFYA 1GNZA 2ISZA 3RDIA 4XOGA 3JRCA 4GULA 2XRLA 4PF5A 2P6HA 4MGKE 1MDMB 1E3OC 3ZX7A 2AR6A 2DI3A 4Q4X1 3CO2A 1O4YA 2VASA 1N75A 2IXJA 3NV3A 4QPQA 1EYBA 4EQQA 2R0FA 2OA2A 3NEUA 5FD5A 2QKMB 4RGGA 4XIDA 3O0VA 1NH3A 1FNNA 3PUBA 1QRYA 2ZGKA 3RZHA 2ZEXA 4QAWA 2VL8A 4XAEA 3E6MA 2MPFA 4E7JA 5FLVA 4BS9A 3ACIA 2IVJA 4OFGA 1FP1D 3F8CA 4D1QA 3CZJA 2VLAA 3ITQA 4CDUB 2P6CA 3FXQA 2ZGLA 3CDLA 4HKOA 3EETA 3VBRA 3GX4X 3WUCA 1G3YA 2QQPA 1C5IA 1PZ9A 3SFZA 1YHQI 3KT4A 3WNMA 3I4NJ 1QZZA 3D0SA 2O6GE 4RR3A 1R093 5L9RA 4R1HA 2HWB3 3LSEA 1AZDA 1OLRA 3LSHA 1D2SA 1S0FA 4XVHA 4F92B 3I58A 2BU9A 4Q1PA 5CG9A 2HYKA 1JH5A 2ZZQA 1RI7A 3DWLE 1ZGAA 4XDQA 3JB4C 4B4PA 3PNVA 2A70A 2VODA 2A3WA 4CP9A 5FZIA 5IYCJ 2DVGA 5HV0A 1ULOA 4FOWA 3K69A 4CEWB 2QFEA 5K7FA 2VE8A 3WEZA 4CDXB 1BI3A 3N36A 3SYTA 3K4DA 1RYYA 2Y0OA 3U14A 1DQUA 3WW3A 4NOTA 1BR2A 2D44A 5J1RA 5FZMA 4DZGA 2RS33 4GA9A 2VBWA 3BOPA 2AS5F 5CKQA 4ISQA 1H30A 2IT0A 5BNNC 3V7RA 2OA4A 3E6DA 1PYVA 3MKZA 4CGZA 3V8KA 2E19A 3BIWE 5HXVA 2I2SA 3HUGA 5LD2C 3K7AJ 1SFEA 2VT3A 1RNLA 1HW5A 4LHKA 4XCBA 3IKTA 2CUFA 2WWYA 1HX6A 4IERA 2I07B 2JEMA 5BNOC 5DUXA 1A36A 3P9IA 3R0AA 3N4MA 2LTNA 4A0XA 1PGW1 1ZRIA 2JDUA 4NIDA 3F6OA 1OUXA 3U2RA 4DNCA 3C1DA 1XMAA 1IN6A 3NWKA 3RZJA 4LLLA 4DZPA 5HODA 1W6MB 4W65A 3IDAA 5DS9A 1TW2A 4EM2A 2X8KA 5FMOS 3RZLA 3H9JA 3FUQA 3ZIWA 4NBQA 5GPCA 4LKSA 1W7PA 1QJEA 2O5RA 2JDPA 4ZZDA 1A5JA 1K78A 3NV1A 1WLDA 1EH8A 1Y8RB 1YYVA 5EGOA 5FKOA 4AGRA 3QWLA 2J1EA 2GMMA 2ZMKA 2JXAA 2K02A 4LK6A 3UGHA 1R1VA 3CCSI 3URFA 3NARA 2PN5A 1RUG2 2ACJA 1FEXA 2UXXA 2VUAA 2VKVA 2BFUL 4U2AA 3ZMOA 4FPGA 2EAKA 2XB0X 1U5ZA 1WKYA 2VQAA 1T6BX 2ZGMA 3SH3A 3SHRA 5F0HA 3J81Z 4DXTA 5A3LA 2ISYA 2KRCA 3TDUC 4IV1C 1A34A 1PMHX 1N3OA 2UWCA 3V56A 2WN3A 4CCOA 5CNAA 4WCGA 2VIXA 3GZAA 1FX5A 1LHVA 4IL6C 1JUHA 3AJZA 2HFHA 1VQKI 3UKTA 4HG2A 3NMBA 4K21A 1FBUA 2Y9ZA 1LFPA 3Q0WA 4LIUA 1VAKA 5A1AA 2G1MA 5FZFA 3L1PA 2ZEWA 4ZY9A 1D1BA 3DCQA 5HNHA 3FHZA 2CTVA 3FHNA 1VQNI 3VD9A 2R7SA 1R00A 1TMF1 4XJWA 1VE0A 2ZJPF 4YZ2A 4H55A 1QQP2 3PFIA 4NRMA 4ZTJA 3ZFGB 5C4XJ 5F08A 1YFXA 1NOVA 2VQCA 4L5IA 1CX1A 2CV6A 2ZGQA 1W8OA 1R71A 2FRHA 4IV3A 4BB3A 5J1UA 1BJAA 3I3BA 1VBA3 2HZDA 2XVGA 3LSTA 3BJ6A 4IQPA 4HOOA 4BYYA 3NL1A 4XRFA 3BP8A 2QWWA 3F8FA 1LHOA 4K40A 2DBNA 2RR13 1CAVB 3AAFA 2J42A 5KHDA 1R5GA 2O1QA 1UHMA 4Y26A 3JU9A 3KV4A 4IEPA 3ZMSA 1D0YA 4UUTA 2FDIA 3TRSB 1ETXA 3H1MA 4JX6A 1GSLA 2GLOA 2OKXA 5BY5A 3TL4X 2WDBA 5BYNA 4U7DA 1SPPB 2H1KA 3CCEI 4MV2A 4HF0A 2VU9A 2X6XA 3VYRB 4QXKA 3S6PA 3B6CA 2RNJA 3DPTA 5LGTA 1FTZA 4KIGA 1T95A 4KUMA 5BUVA 3MPPG 4RB3C 3ZMVA 4C91A 4B47A 5C71A 1MZFA 2M45A 2LF8A 1DDLA 5HS8A 2RS13 3G7DA 4KWUA 2GC1A 2IP2A 4ORFA 3AP4A 2XR4A 1XNCA 1P4AA 2R7EB 2W92A 1HB1A 4CDUC 3W6JB 1S1AA 1N1TA 1VQ8I 1XYNA 1MBJA 4BQNA 2JTVA 1POV0 5FP7A 3DYMA 2LY9A 4KWLA 1PO23 3D1NI 2Y64A 2V6EA 2IFWA 1B8IA 3PHMA 1MSEC 4LO7A 2FOKA 1JN2P 1CF7A 4XJAA 3G3ZA 4IXAA 1J3PA 2VPVA 1IC8A 4MGQA 4P9LA 4ASLA 3GZEA 1S72I 3NW4A 3OGSA 3ZR5A 1VQMI 1FNYA 3VWBA 5JSRA 4URAA 1NLSA 3S3MA 4EN7B 2XLAA 1G3WA 2VVEA 4CRQA 4QB1A 4BIOA 2GDFA 1YWKA 3B6AA 4RMNA 2XAHA 2WLQA 5D5UB 1ZR4A 3FHIB 2P3JA 3WF1A 2WT0A 3VD3A 2FCUA 1XNAA 4XBLA 4II2A 1U12A 2DAOA 1T2XA 2WT2A 1HKSA 5FZ3A 2KIQA 1TLHB 3POJA 5FFOC 3TAYA 4LKFA 3LSMA 1SAXA 2DFHA 2LUWA 2E33A 1IAWA 4RS5C 5C3PA 3G6EI 4GMP0 4Q4X3 3FN9A 1XTAA 2DN0A 4IL7A 5A7NA 5IYYA 3FE5A 1ZHFA 1KQRA 4UW6A 5FZDA 1ULGA 5GZGA 5FXZA 1R082 5IP9J 2VBYA 4WZFA 1R23A 4EJUA 1OD5A 1FWZA 1G3SA 5JR2A 2P3YA 2QZ2A 3KF5A 5LBCA 4JP0A 4I3PA 3BQZA 4AEJA 2VQGA 3ROUA 1XB9A 4GH4B 3HIFA 5JVVA 5CA6A 4QKDA 3OV8A 4WX9A 1AL23 1HQWA 3IMNA 1XDSA 5J96B 4JC1A 4ZC3A 5GZCA 3HT2A 4IDZA 3TDZC 5CB7A 5ACA2 1JHJA 5JOWA 5LA1A 2F5CA 4ITVA 1DG6A 3C7EA 4XQWA 1BKZA 1OMIA 1QNYA 5H6QA 5HCAA 3GZUC 5EDNA 2CAVA 1G8XA 5FBZA 1BQPA 4EGYA 1JZ4A 1Y9QA 2A6WA 3ASIA 5H2FC 1ST8A 4KG8A 3F95A 4II3A 2A07F 2ZGPA 1DPUA 3AP9A 5FYMA 1CAUB 4KGGA 4YVSA 1OOPB 2PQSA 4L97A 2CYFA 2PAMA 2OCEA 1PVC1 4JTNA 3PMSA 4K3UA 3RZMA 1T8IA 3L2WA 4A41A 1R36A 2ID4A 4FHTA 5FLHA 5C5TA 1D4M1 2GSYA 3ZKYA 4L8QA 1VRH2 2LYCA 5AONA 1AWCA 2DUQA 5J4YA 1B72A 2DCKA 5A6QA 2YSRA 3MMYB 1VF9A 1NHAA 4M3BA 5BMZA 1ULCA 1FYLA 4H14A 3GTLJ 4YFZA 4Y1YA 3HNYM 3UKVA 4NPLA 5I91A 2PFWA 1PO12 3BG6A 4U0VA 1SBDA 3QYBA 3WGHA 1RRJA 1FMD3 3HTSB 4JGYB 1Y6IA 4BE3A 5GJ6A 1KGYA 3H8OA 2WQ4A 5HOOA 1W2NA 1BK1A 5FFZA 4H3WA 1UY2A 4P00B 1G7YA 3B93A 5LBQA 1D0XA 3R4UA 5IY5H 2VOXA 4FPCA 3RZGA 4OYUA 2IXKA 4BHCA 4IE6A 1LGBA 3F21A 2W2IA 3AYAA 2VKHA 1LU2A 5LGNA 1BN5A 3GCXA 3NRUA 3PUFA 1UPSA 1H89C 1YJWI 3RI9A 1P4XA 1HA8A 1GZWB 2IGKA 4FXGB 3QYEA 4NHKA 1RUD2 2JG9C 4QX2A 3OYBA 2D3RA 5E6HA 4UUVA 4AFBA 4IE7A 1COV1 2FDHA 3QP6A 2FA5A 2JKXA 4CDQC 5K5RA 2D3PA 4UUSB 2HYXA 4D6SA 2J1SA 3CMAI 1UAAA 5EFUA 4KI5M 1SD7A 2RJKA 4PFPA 3H92A 1A35A 2OW4A 4BK4A 3CF2A 4MTEA 1X1BA 3BJOA 2JN6A 2VAUA 3ZN6A 1ETVA 2H8RA 2L3DA 1BI0A 2WV0A 1NA1B 3KV9A 1RJ7A 2FHRA 4ZZ8A 4ZHNA 1BJZA 1REDA 3C3VA 4M3CA 1BL0A 1CAWA 1IV6A 4KG0A 3PL0A 2DT6A 1IN8A 4A6EA 4H0EA 2R0HA 4ATEA 4JBAA 1JTZX 2R32A 4LITA 2DCJA 2E2JJ 1AYN2 3R4KA 1FPN2 2ZABA 3T5XA 2GIVA 1H4GA 3VYTB 3WP5A 4E7ZA 1W8UA 3J26N 2KFDA 5DTDA 1V0AA 1RIRA 2F6CA 2BNOA 5FOBB 1G8WA 3HWJA 4FAHA 2V1UA 2ENRA 4M4PA 2MA3A 3BY6A 3ZYPA 1JKOC 5HLTA 3VZLA 1JZ6A 2ILMA 3B5LB 2JUCA 1SMTA 5FK7A 2ZX0A 1HKQA 3HG9A 4PJJA 1REEA 1ZZCA 1QJU2 3G71I 1R22A 2EAAA 3GYDA 4IEOA 4P9UA 3FLTA 1R7JA 4XAAA 1ZGWA 1LVKA 3RPUA 4YZ3A 1ULYA 3Q8FA 2K9NA 1S55A 4AVBA 2PFBA 2DU1A 1R081 4JV4A 2GH8A 1ND3A 5A3MA 4JX5A 5B1BH 4HRIA 3H36A 4AHWA 3N9QA 1U0JA 3O1OA 5IFTA 3OBTA 5C33A 1HB3A 4BXFA 2E6VA 3PU3A 2Y0SA 2ZXWH 1XBFA 2VXRA 2ZKZA 1YJKA 2RE9A 4M3DA 4FTHA 3D6EA 2P6SA 1Y1VJ 1KFXL 2XXZA 3K4NA 4Y22A 1VMFA 4XSZF 3WU0A 5E3MA 4BE2A 1LECA 3PNYA 4PSWA 3L2HA 3HBZA 1YW8A 3IM0A 3GTKJ 2LLKA 2V7FA 1AXZA 3L2CA 4LFUA 1ODNA 3R60A 5EYRA 4AIJA 3MV11 4EJRA 3SMHA 1LNWA 4GD4A 2FSWA 1S9HA 2FZ2A 4NIAA 1ZBA2 1YI9A 2JDAA 4FFFA 1XE0A 5AVPA 2K9MA 2WZEA 2JD9A 2R7ZJ 1Q1VA 4CXXA 1JMUB 2WY8Q 1WGPA 2ZAHA 4AEDA 2LBFA 4AM3A 3KIOA 4BQWA 1B09A 5C6CA 4YVWC 4XQDA 3N9LA 2QKLB 5DG1A 2Q1ZB 4XRSA 4XJ9A 3OUIA 3FL7A 5JIUA 1OT5A 2COMA 4E7LA 4AVAA 3LE0A 1UKRA 1W5CC 1DZQA 2CW0F 1EAH2 1LR5A 1NY71 1K4TA 4QPOA 3I4PA 1POGA 2TDXA 1H2NA 3FBYA 4NVPA 2W08A 4CPBA 4F83A 5F2WA 3EYIA 2J22A 3CLQA 2ZKLA 2B4KA 1IDZA 1OOPC 2V4JC 5E88A 2RJ2A 4A3BJ 3TBIA 2OQ7A 2A3YA 3I2HA 2A6YA 4M9ZA 3GDBA 1DZRA 2J7MA 1Z1DA 1DGLA 3IWFA 2V1NA 1CIWA 4QGLA 5LRRA 1J7KA 4COYA 3K1NA 1Z3YA 4YGCA 1YUDA 4LO4B 3K3OA 4ESBA 1GVJA 3NNGA 4PBPA 4B4QA 5IVYA 1XD7A 2BW3A 2WC2A 3A4CA 1PVXA 4FQ4A 5DPNA 1YFYA 2Y69H 5C44J 1AF9A 4XSXF 3OOXA 2M9HA 1ITYA 3P9KA 2Z1DA 4D6RA 2C6YA 3S15J 4KJZA 2C9AA 3HL2A 4JGYC 2LALA 3ML6A 3ACFA 4N9IA 2LROA 4JQTA 4XLNF 4AF9A 3K4MA 1W06A 2YU1A 4UW5A 2FMLA 5LY1A 2A7AA 4QB6A 3MZ8A 5FK8A 4JRLA 4NNJA 2DMPA 3I97A 3ZMTA 1XU2A 4K1YA 5DUVA 1RUG3 1MKMA 3WU2C 3LSGA 4HN0A 1X2MA 2GC3A 5KC5A 2E2HJ 4AQSA 3GF2A 3CCQI 5H9RA 3PQKA 1LHWA 3WTVC 1SG3A 3PL8A 1NAEA 3WUDA 4RN5A 5CVJA 4O65A 1U2WA 3OD4A 2VC0A 1O8PA 4XDOA 1D7PM 5LBBA 1G9CA 3J7YJ 1HRI2 5JOZA 1K4SA 3MF6A 1Q8SA 3BZKA 4B09A 2HWD2 5DZGA 3OYIA 3H3LA 4CDWC 1FPN1 2B7EA 1DFQA 4FO9A 2H6BA 3EYPA 5JOYA 1KJRA 2Q0OA 4PT6A 2XG3A 3FM3A 1QQP3 1CQTA 3IDCB 1QO0D 3POIA 4D3WA 2E7XA 2XDVA 5B5EC 1R1TA 3ATGA 5BNNA 4V2VA 5K5OA 2R7UA 4OHVA 2EZKA 4MGSA 4CICA 2GQQA 3GF6A 4QHZA 4WK8F 5JIAA 3B69A 4UW4A 4PBOA 4P9JA 5C3QA 2P6TA 3ABTA 1LENA 1K79A 4DIQA 2DFIA 2Y9YA 4E8DA 2W91A 2DW4A 2Y0SN 2B45X 3OYKA 1BMV2 5BNOA 2D45A 1KU9A 2GN3A 4AHZA 3H35A 2VQ0A 4Q1RA 1H8VA 1C4RA 3B94A 5HV4A 2BV6A 3TEWA 3CBNA 1IW7F 1ALYA 1IOAA 2A5YB 1LAJA 2Y48A 3WVJA 1ETKA 4HSJA 1APNA 4MSVA 2R5ZB 1D0GA 4HZFA 2FBEA 1TNTA 3LZZA 3F8NA 5FZOA 4YEJA 3AMMA 4L2NA 2R1DA 5KHGA 1BI2A 2IUWA 3I2IA 1XMXA 4D7SA 5KNLA 3C2HA 1S8NA 4PFOA 4QXCA 2XBO1 3RKXA 3MW4A 3KLNA 3LOBA 5FYIA 3M4OJ 2GP5A 1X1AA 1RR8C 1RC9A 3S16J 1MBGA 1ZBA1 1C8NA 3SH5A 3S3NA 6PAXA 1VFCA 5F6LB 2WA0A 3ZSMA 2ZEYA 2F5EA 3SQNA 3ZFEC 2BUKA 4CYDA 2EXHA 3FBNB 2W4SA 1BEV2 3T1BA 1UYPA 2UXNA 2R7TA 4I09A 1U5XA 4DXSA 3VODA 3CQOA 1T0FC 4HVRA 1WZXA 2WAFA 3WF4A 2WRAA 1UAIA 5GLZA 3ZVXA 4IV1A 1BW5A 3SISA 2RQPA 4XOPA 3R61A 3CC7I 2PEXA 4IVNA 4TYSA 3KCYA 4LT5A 3CHXA 1CPNA 1P4WA 2RM21 2GBYA 4KN4X 4DYRA 1GWKA 3GJBA 3MKLA 2W47A 1JYTA 1IN5A 2CWEA 4XLCA 3CCJI 1Z05A 4R9CA 2E5NA 2ZGNA 1PK6A 4JDMA 4Z82A 1RKTA 3WHTA 2FMYA 2G7UA 4L9TA 4C1WA 2ZNZA 2DT7B 2W1WA 3TEYA 4XKWA 2GOMA 5F1JA 4WVMB 1YQ2A 1POV3 5CU1A 2VM9A 3ACLA 1JBCA 1GLNA 2K0GA 1FSHA 2KA3A 3POEA 5DG2A 5JLVA 4RB2C 3HNMA 1GANA 2G9ZA 5D4SA 3BJAA 2PQ8A 4IHYA 5CFDB 1NKGA 2VUCA 5IVCA 3ZXKA 4IW3A 2XB5A 2ATFA 4Y1VA 1Y9MA 1SCRA 3EJKA 2LTPA 3WOGA 4L9VA 3WTSC 4Z92B 2YB7A 5EXOA 1KS4A 1KITA 3HC7A 4EVIA 2R3SA 4XFBA 1WD3A 1QA6A 3PUHA 2L54A 1R083 1E3HA 3GBGA 2Z42A 3U1KA 2FBKA 2A61A 1ASJ1 1FOD1 4K6BA 5FUIA 3SXWA 3V0BB 3GFIA 2PA7A 4RAZA 1KGSA 2OBPA 2HGCA 1FXZA 2Q8OA 4AVVA 3Q3SA 1CAXA 4XOTA 1YFUA 1JOJA 1ETOA 4RM2A 5JOXA 4MXWA 1WPKA 1SFXA 4GMP3 4LA3A 1CQ9A 5HXMA 1VQLI 4MGZE 5ACA3 5IAXA 3A01B 5DD4A 4Z2AA 3LSDA 1OURA 3NAPB 4QPIB 4V19K 2ORXA 4OINF 5F32A 4JGZC 3GHMA 2M4GA 4N4NB 3H7JA 1UO9A 1QJY2 4AVTA 5LHGA 3WNLA 3M3QA 2YS9A 2ZHMA 2STTA 2KLOA 2DK5A 1MQTB 4FQZA 1JJ6C 1JYWA 2ZMEB 5GKAC 2L4MA 2VMHA 3MFAA 2DJIA 2KXLA 1ZRDA 5IJRA 1W90A 4A69C 4AL9A 3H8UA 1VRH3 4GB32 1LOGA 2PHTA 1LDDA 2YPJA 2HXOA 3OYDA 3GMEA 1YX5A 3NWSA 2CW7A 3E5QA 4F55A 1OISA 1CD3G 3ABLH 4Q0UA 3T2PA 3RZOJ 2AYHA 4JKMA 4KITB 1PO13 1DHKB 4B8EA 4OHZA 1W6NA 4AGGA 2Q8EA 4RA2A 3QPHA 2DA3A 4LJZF 1KU3A 3G6JB 1W28A 1ENRA 4Q4Y2 2VCCA 4YW3A 3ULQB 2E9QA 2C26A 5SV5A 3ZCOA 4CYCB 2SLIA 2JG8B 4B3XA 2CQ7A 1H8TC 3ESWB 3VKFC 2JDMA 4RS5A 1UG0A 1ZREA 3OSFA 1X33A 2I74A 3RFRA 3K2ZA 1WD4A 1G86A 1XOYA 1Z0HA 4A6SA 2A73B 1RUD3 3P6BA 3PUSA 4DY3A 2VECA 2R16A 1H0MA 2Z5WA 2BY3A 4ZDLA 2JE8A 3H50A 4R79A 4C30A 5KC6A 4CP0A 3SZTA 1UL9A 1QXPA 4LOSA 3CUQA 5A1LA 4BA6A 5C8CC 5DAVA 4HETA 1NX9A 4C1XA 4PLMA 5GZFA 2XGDA 3KEYA 5K0UC 1ZZ8A 5CEHA 1L7LA 3CJQB 2VN2A 3I64A 2RKHA 3J7NA 3WNNA 2G9WA 5KK1A 1BBT1 1D0ZA 1ND2A 1E3PA 5FPZA 2H1LA 4XTPA 2JDKA 2K86A 4AC0A 2EA2A 4UF0B 1FOYA 2UYAA 5GZEA 1QOOA 1C8M2 4IEZA 2HI3A 5IATA 2E35A 2FQ4A 3O6BB 2PLV1 3DKYA 2R041 3ZR6A 1UJ8A 3HSEA 1HKTA 4META 4HOBA 4GO1A 2F5DA 3EXUA 2XASA 4CE8A 2E51A 2DVFA 4EQVA 3SDGA 1AYN3 3POBA 2BZTA 4UFIA 1FPN3 4BQ2A 1OPCA 2Y6FA 3O1SA 2EBIA 3OYNA 4M01A 3RMYA 3O8HA 4PSXA 3V7SA 1PZ7A 4MG2A 4XM3A 1UX7A 4JOMA 1CESA 2KKOA 3WG1A 2YDEA 5CG8A 1D1CA 5FKMA 5BNQA 1UW8A 1FI2A 5EEGA 1BYHA 3BTXA 1QJU3 2AH2A 4ESJA 1JHFA 3GEZA 4L99A 2HS5A 3I53A 2QM3A 3WTZA 3IP4B 2E5ZA 3LL7A 1TQ5A 2EV6A 2WYSA 3GNEA 1IPKA 2Z79A 1KRIA 4XICA 3VHOA 5BV6A 1BVVA 2OCCH 1EV12 2HKOA 4COWA 1WA6X 3W2AA 1O5UA 2ZHNA 1RUOA 3G2BA 2K40A 5DUKA 4IEUA 1WJFA 5EIYB 1UOBA 2PHLA 1UFMA 4OU0A 2CSOA 2K9QA 2UV1A 5IT3A 3BR5A 2P5LC 3GCMA 3SXYA 1WLTA 4Y17A 4YM1A 3K4JA 3VZMA 3ALQA 4P5OA 2JG9A 1XRUA 3VBRB 4MQVA 3RTRA 4CUGA 4QMAA 4KA4A 2KPMA 2GMPA 2VI6A 4RR3B 4M3FA 1W9TA 3IAS2 1BIBA 3OSDA 1RUE2 1RUJ2 4XZUG 4YW2A 4CDQA 2VJ5A 4PJLA 2VMGA 1V6NA 2NAZA 4PDKA 3B3QE 1G6NA 1ZBA3 4FPKA 4NJ4A 2CQXA 5FUNA 3BKZA 3JRBA 3C7JA 5LA2A 1B4AA 1YG2A 2BEOA 3USSA 4CP9B 4I7HA 1SVLA 3C18A 4S04A 2DA4A 2DMUA 3DN7A 1PM4A 4N53B 3GGLA 1JKPC 3CC4I 4OAZA 2K2SA 1L3LA 5FLIA 2X6OA 1TG7A 3POFA 1T39A 4OMCA 5A7PA 1ZBE2 1LEDA 3NAPC 1VPHA 4E7IA 3AZVA 1X58A 1EAH3 2R071 1LOCA 4XDPA 2BPA2 1HLVA 1OKQA 2W84A 4Q4V2 2L7FP 2OQ6A 3HUGB 5J4VA 3VKLA 3SEQA 2K7LA 1X1CA 1KQ9A 4MO7A 4IHSA 1GOHA 2ZMEC 4HONA 3CKHA 4CU8A 1POQA 2LVSA 1DQ2A 3HPHA 1UY1A 3CLPA 2VOKA 1NCQB 3CMEI 1AR62 4J01A 2QQVA 4MEXF 3K6GA 3FWEA 1PGSA 1E5IA 2Q8DA 2IEKA 1X7NA 1GVDA 1QPMA 3CIHA 2AQFA 9ANTA 2DDUA 3U78A 1IS5A 1XNTA 4RAFA 4UFKA 1J58A 3WDXA 1PGL1 5CIRA 4YWAA 1JU3A 4YZ4A 4QGMA 2GC0A 1HIXA 3FJSA 1TE1B 1VTNC 2WAOA 3GZ6A 3U37A 2P5KA 4KWJA 2D6NA 1G3TA 2Y6JA 1JYVA 1W7PB 1A04A 3DECA 3PIJA 4XFHA 1K78B 3AL0B 3WNKA 5F0CA 1YJLA 2JRTA 5F27A 3SEPA 4YPJA 1UNBA 5EGOB 3DLAA 2V4VA 2N7GA 1WKMA 5C5UA 4B1LA 3I2KA 3S7EA 1WJ5A