5LEKA

The transcriptional regulator prfa-g145s mutant from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
b'NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
total genus 70
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lekA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lekA01
3I7DA 1QY4A 3TDZC 2STTA 5CYVA 1K78A 3SXWA 5KHIA 2GC0A 4IERA 4HX4A 1U5TA 1AOYA 3CJXA 4A0YA 2MBFA 5H6RA 2PTMA 2G9WA 3FMQA 3BCWA 1X3UA 4HN1A 1PMIA 5FGMA 3BPZA 2IA1A 2PYTA 4IRGA 1U12A 3H9AA 5F1RA 4HW0A 1IN8A 5CU1A 4UXNA 2W24A 2FQ3A 3H92A 3RPUA 5JI6A 2RQPA 2DBBA 3BJAA 2BE5F 4CO8A 4MNUA 1OKRA 3QACA 4OFGA 4PJYA 3QOPA 4LG0A 2BV6A 1J75A 1XN7A 1LJ9A 1IN6A 3BWGA 3BPXA 2WWYA 2RVCA 1LEBA 2JT1A 1LB2A 2RC4A 5BY5A 4HV5A 3H1YA 2COMA 2GIVA 5ERIA 3F21A 4EWAA 2FQPA 2IA0A 3N97A 2A6HF 4XSZF 5ED4A 2V79A 4ZYGA 2DTRA 1UCRA 4G94A 3K69A 3PNAA 1XRUA 2IJLA 4NB5A 5A2QZ 2M45A 5ILSA 3QU3A 3IBMA 3NVCA 1TTYA 1FZPB 1CAUA 2A68F 3CUQB 5D8LB 5EFUA 2WFPA 1VTNC 1EH8A 2DK5A 3JTHA 4MQ9F 5HVQC 4U88A 1E2XA 3D82A 4XSXF 3O2PE 4QGNA 2CQKA 1JGSA 1SQ4A 2E7XA 3KFWX 4IRHA 4EJOA 4A0ZA 1W5SA 1RI7A 2Y75A 4IHTA 2XKPA 3WTWC 4TLFA 1J3RA 1I5ZA 3E5QA 3JSOA 3WW2A 1AWCA 4A0XA 2P4WA 4U0WA 4F7ZA 4Q4ZF 1EPZA 3L2HA 1T39A 1DGWA 1UPIA 2KRFA 1QO0D 4HA8A 3TDUC 5DDGA 3ETQA 3ST7A 1FP1D 3ZMDA 3OTFA 4G6DA 2IC1A 2DPDA 5LRRA 5J48A 4R52A 2RNJA 5ILVA 3HT1A 4U7DA 5KHKA 1FSHA 2Z69A 4NVPA 2IA2A 3NQOA 3N4MA 4HLXA 1TNTA 3LSTA 1XE7A 1ON1A 4META 2BEOA 4MHGA 4MGYE 4HLYA 2X0LA 5E8IA 1VP6A 2PFBA 5I0RA 3L00A 4KN7X 2IRFG 2F5FA 4I09A 4EWEA 4X6QB 3MYXA 3LWCA 3FM5A 2D40A 4XFBA 3HUGA 3I64A 4EJUA 2GC2A 5BOXA 2P5LC 3P9CA 1ZVFA 4KICA 2R7FA 2YPRA 3H1WA 1W7PB 5AIPA 3HSRA 4X6RB 4RD7A 2Q2EA 3WE3A 1B4AA 4G6QA 5KVRA 3L09A 3FF5A 1XMKA 1ZZCA 1C0WA 5A2QK 4FAGA 2KIUA 2ZNZA 3CDHA 2DLLA 2D93A 3ISPA 4L0ZB 2QBYA 5D5XB 1IZ1A 1TLHB 3V4GA 3HOSA 4E2GA 4FX4A 1BJAA 1UIKA 2O8XA 3USSA 1TW3A 2QWWA 4QGMA 4OOIA 4HVRA 5ICFA 1GVJA 2O61A 2Q30A 3IWFA 4L5IA 1UB9A 4UVBA 2WC2A 2CV6A 2XASA 2IW5A 2YU3A 5E1XA 4O5VA 3Q9VA 3FXUA 5J8CA 1ZZ8A 2FBKA 2MD5A 3CO7C 1CAWA 4U0VA 4LB5A 2FRHA 2OQRA 2PJPA 4M9ZA 1XB4A 4BHBA 1XSVA 2GH2A 5HDKA 4LLGF 2F5CA 3E6DA 3CO6C 1IN5A 2MA3A 1XGSA 2R7DA 5HI0A 2N7GA 3PQJA 3FMRA 3T8RA 1FI2A 4HF1A 1YQAA 2JPCA 2XAGA 3TKYA 4MGRA 4YRDA 3VEPA 3J81Z 2NS0A 4L9VA 4UHTA 1GXPA 5KBFA 5I0UA 1GXQA 1O7FA 1FSEA 5K5RA 5JSPA 1RGSA 2PHDA 1GQHA 4MGIE 5LGTA 1PP8F 4PGGA 3LOIA 2HOEA 1PP7U 3CJNA 3VOEA 2PFWA 3W6JB 1R5GA 2EB7A 3S0MA 4P9FA 1YIOA 2Q4SA 1CAVB 3FFQA 3DQVC 1NYWA 1J9IA 3SCFA 1SFEA 2XL7A 5BQTA 4ZU4A 4AQ6A 2EWNA 1IXCA 2A6EF 2BYVE 1TBXA 1QQIA 1OYYA 2QM3A 3IDBB 2RV8A 2DFIA 3I4PA 2MNGA 2QQBA 2GZWA 2H94A 4GXOA 2P17A 5D6FA 5HOOA 1Z6RA 1YFUA 1U5TC 1SFUA 3TO9A 4LJZF 2VC1A 1QZZA 4O9GA 1WI9A 2ESHA 2VBXA 3QP5A 1RTVA 2A5YB 4LMYA 3GFLA 3LQRA 1KU3A 4HQEA 3F8CA 4RGSA 4MH0E 3I5UA 3KP4A 4S05A 3MAJA 1R58A 4HBNA 2M1BA 1WQ2A 2OZUA 2CAVA 5LGNA 2GAUA 1FWZA 1MDMB 4G8XA 4WCGA 3F72A 4OU0A 2CGPA 4BQAA 4M6YA 2C6YA 3KE2A 2ELHA 1YO5C 4N0BA 3F8NA 1NZCA 4RAZA 2OD5A 4IEUA 4KU8A 5JVTA 2EFQA 4HOBA 2K02A 3EQLF 1ZARA 3M70A 5BS6A 3GYHX 4FX0A 4HDUA 3J81K 2PAKA 2ETHA 3HTSB 3ABUA 1ZGJA 5FFXA 4LA3A 3H3UA 3DEUA 1DDNA 2IVMA 1X8EA 3EETA 4E2SA 1T38A 5HS7A 2H27A 5K5QA 5E8GA 1QXJA 3C18A 1QZYA 1OI6A 1I27A 4EV0A 2ZKZA 1U8RA 1Z1DA 2WTEA 4CDGA 5AONA 2IP2A 1S3JA 4RS8A 4E70A 1HQCA 3ULQB 2E9QA 2LNBA 3HRUA 4ESFA 1IXSB 2XLGA 3R61A 3FXRA 3F3XA 3J7AO 1EH6A 4PIYA 4FBFA 2FMYA 4KWKA 5J7MA 4L18B 4OIQF 4XFCA 3WTZA 2ACJA 4UXAA 3ZMUA 2DW4A 3ZMVA 4AQ2A 3K1MA 4JK1X 5AIQA 5ICGA 2L02A 2HFHA 2MLGA 1WKMA 3R60A 3KEOA 3M1EA 3P7NA 3F8MA 4WZCA 3UKVA 2VBYA 3U1DA 2DT5A 2PBIA 3ZQ7A 4E2QA 3ML6A 4U7BA 1P4XA 2D2WA 1KYWA 1BBYA 2EA2A 4EGZA 4MQVA 1FLIA 5D5VB 2A3SA 2VODA 1J0RA 3SQNA 1QGPA 2HTSA 1KQ8A 3UKNA 1IUYA 4O6JA 4YIFA 5HDGA 1B6AA 1SD4A 3WGGA 4LD5A 2UYAA 4GCVA 4KNYA 3K1PA 1IPKA 5C6CA 1R7JA 4O9EA 4Q0PA 4G7OF 3GXOA 1A04A 5JSOA 1BIAA 2DU9A 5DD4A 2Q1ZB 1O57A 5DCMB 3GYDA 1J7KA 1CF7A 1T0FA 5BPDA 4G9YA 4EJTA 1O7LA 5LHHA 3KMHA 5BUVA 5BMZA 4BIFA 3ABTA 1MKMA 4GYGA 4L9TA 4ZU7A 1CX4A 2GA1A 2G7HA 4QX5A 3WTUC 1TQIA 3SHFA 5KHGA 3JZVA 4WVZA 3IDCB 4JBAA 3GBFA 1K79A 3J80Z 5H6QA 1ZNPA 2HDCA 3M7GA 1FT9A 2DPUA 3MFKA 5L3DA 1K78B 4MTEA 2B0LA 1X8MA 1B59A 1G3WA 1U5TB 1V70A 1J58A 2LF8A 4GYIA 2D5HA 4OIRF 1IN4A 4DINB 4Q0UA 3HRSA 1WGPA 2XIGA 3LAJA 4S04A 4EMSA 2NRAC 1HKTA 5KHJA 1O4TA 2QDRA 3PFIA 4XETA 1L0OC 4OIOF 2ZCWA 3V7RA 3RYKA 2PG4A 1P4AA 1I1SA 4JVAA 3RIRA 5FLXK 4Q0QA 1LDDA 4HLTA 3QP6A 2VN2A 4Y15A 1RUNA 4LG0B 4LB6B 4PIXA 3R0AA 4ENKA 1YTYA 2EV0A 2HKXA 2KKOA 4ZH4F 1X82A 1S29A 3WU0A 3UKTA 4XLPF 3RZZA 2Z33A 5JCTA 1WA4A 1JUHA 4NHJA 2MPFA 4HF0A 5D4SA 3TNPB 4JTOA 4KUMA 1P6RA 2QYOA 1BI3A 1W4MA 3T8TA 3EBRA 4EROA 2FU4A 2HWVA 3EHKA 3FX3A 2M87A 1TNSA 3V8LA 3LQQA 1ZREA 4ZU5A 2DO7A 1XCVA 4A6EA 3U2RA 5DUIA 4L0YB 5DD8A 3JAMZ 1IRFA 5I8YA 2ET7A 2VQAA 4XFGA 1O3SA 4GULA 4XFFA 1CAUB 4IHSA 4I02A 2I45A 4R8HA 2D1HA 4Q29A 5CVRA 4HF2A 5J6XA 5CLSA 2V1UA 2ZO4A 1KGSA 2Z99A 2G7UA 3C3WA 3VODA 2VONA 4LLOA 2M30A 2ADUA 5C8WA 1JHHA 1T2KA 4AVAA 2JTVA 3KP6A 4YSFA 2HJIA 2ISYA 5FFZA 3TNQA 2OA2A 4Y17A 4XF1A 2M5WA 3GZ5A 3KETA 3R6SA 4DQ2A 4CXFA 3K9TA 3HQXA 4LUKA 1WSUA 2P6SA 1P2FA 4ZYDA 3EO6A 3O6BB 1BI0A 1YLFA 4RGRA 4G7ZF 2HKOA 4XFIA 3ROUA 3IKTA 2XUBA 1BM9A 4CYDA 2NNYA 5FLIA 1GHCA 3R0JA 2OA4A 3IRRA 3M9AA 1FYLA 1USTA 4LLLA 3GWZA 5E17F 3NSTA 2CG4A 1ZG5A 2KJBA 4HMZA 4KWLA 3HHHA 4AVBA 4FT8A 1FNNA 2P7CB 5CVIA 2UYBA 1Z9CA 1FY7A 2Z9OA 4LA2A 1W7PD 2FOKA 4XF3A 1QPMA 3NL1A 1OYIA 5J8FA 2K4BA 1QNTA 4OMYA 4BAYA 3DP7A 1SMTA 4RB0A 3CF6E 3R4KA 2VT3A 5FQ0A 4WBBA 2A07F 1R1VA 2L4AA 3KGZA 3HOTA 1RNLA 4JV4A 3U9GA 4IEYA 4P9UA 4Y13A 2F5EA 4QMAA 1EYBA 4ENMA 2QBYB 3CO2A 2GC3A 5L3GA 3I58A 2DQLA 2BGCA 1FBSA 1FPQA 3S7EA 5IT9Z 2GXGA 4XFAA 2PAEA 4CZZA 4M9XA 3WW4A 4G7HF 3RYPA 2IXLA 4M74A 5LHGA 4PIZA 3EQEA 2DK8A 1HSJA 4I2OA 2UZKA 1CAWB 5DCFA 4KDPA 2O3FA 2JSCA 3LAGA 2XAQA 2IXIA 3K1NA 1LR5A 3COAC 3ZMTA 2XLFA 4IEWA 2QENA 5HS8A 4WWCA 4HVOA 3TO7A 1DUXC 2YX4A 3SMHA 2A69F 4H7LA 1F9NA 1I6XA 3HSFA 4K2EA 1XGOA 2XLAA 1K7AA 4R79A 3F22A 1UFMA 3SFZA 3FXQA 1G4DA 2RN7A 2ZBKA 1IN7A 1FBUA 2Q0OA 3GF2A 1Q3EA 3DPLC 1KQ9A 5K5OA 3BDDA 2Q0AA 3GVAA 2EV5A 5E18F 2PI0A 4AVPA 4IXAA 3EJKA 3RNSA 2K4JA 4HSJA 4L9JA 3B73A 1T6SA 4ESBA 1YFXA 2ETEA 2PMHA 4KMUX 3NEUA 1IAWA 3D0JA 2OZ6A 1K6OA 2H0VA 4TV7A 1YS7A 4LK1F 5TJJA 3V8JA 1CAXA 3T0YA 2OPKA 2H6CA 4LGWA 2K86A 3HIFA 3V7SA 3ZN1A 4A12A 1B9NA 3C1DA 3H50A 3JTGA 1HSTA 4Z2YA 1FXZA 3E97A 2OYZA 3I54A 4AWXB 4I0BA 1FYKA 4N9HA 1G3TA 1HKQA 4LEJA 3SCGA 3MEXA 4QM9A 1LKNA 3QRFF 2WV0A 4EVIA 5JHUA 1VJ2A 2D1VA 2ZNYA 4YFXF 3CUOA 1OMIA 2UY8A 2V09A 4EJVA 1S8NA 1MJ9A 3RDIA 1XE8A 4P96A 3WTSC 3WE2A 1SFNA 4IEOA 2CAUA 5FCCA 2QJVA 1EP0A 2IXJA 2B8MA 2V1DA 1ZRFA 3H1MA 5HLGA 3E6MA 1YFYA 2RGVA 4PDKA 3M3IA 3CL1A 1VR3A 3ZDSA 5DV5A 1ZH5A 4BYYA 2KXLA 1U78A 5H20A 3E5XA 4WX9A 1UHMA 3MCZA 4M73A 1LDJA 4KYWA 2Q8KA 1FOKA 3U11A 2PEXA 5JSRA 3BROA 1TQ5A 2A61A 2CFXA 1ZYRF 3GFIA 1LVAA 5I0TA 3RKXA 1R1TA 2EV6A 1I1GA 1YHFA 4EGYA 2XVCA 2EFPA 1GQGA 4KA4A 4LFUA 2KIMA 4IEVA 4J1WA 5HLHA 3FHIB 2W57A 4AD9A 4ENNA 2ZFWA 3I71A 3JSPA 4LULA 1SD7A 4QM8A 3VB2A 2XV4S 1X7NA 1Y3TA 1LNWA 2PQ8A 1ZRCA 2XAFA 1BIBA 3BJ6A 2ZMEA 5KK1A 3WW1A 1F1ZA 4KIFA 2OQGA 3GFMA 4HX7A 4LTAA 3QPHA 1NE6A 1YG2A 4XF9A 2FE3A 4U0YA 1O3TA 1NE4A 3HYIA 2UWMA 2CYYA 5HS9A 3F8FA 4ENJA 3E6CC 5EZWA 3I53A 2VECA 1J3PA 2B5HA 5FO5A 3IC7A 4NQWA 1WLTA 4IEQA 3WTTC 2NYXA 4CHUA 5ICEA 3FZ3A 4IRIA 4YARA 2L4MA 2EA4A 4UVCA 2Y48A 4RB2C 1Q1HA 1G3SA 1Y0UA 4M72A 5E1WA 2ESNA 2IXCA 2YR2A 3M8FA 1JE8A 3LAPA 2F2EA 3ZPLA 2TDXA 4XLNF 1NHAA 4DNCA 3H3ZA 2Y0MA 2VT2A 3RKWA 1IRGA 2DQRA 2DCTA 3LFKA 5LEKA 1CF7B 2W84A 1KQ0A 3BPVA 1ZLKA 2BNOA 3VFZA 4EM0B 3DN7A 5CVJA 1EY2A 1HW2A 2CO5A 3TO6A 1RC6A 3LA2A 4FAHA 1FP2A 2Z2SB 2BNNA 2EA7A 1R22A 5LLQA 4RAYA 3ERED 2XROA 1MGTA 1MJBA 2MH9A 4QGLA 4OMZA 1OR7A 4D7TA 4PGHA 1DZRA 2EFNA 3GFJA 3FWEA 4ON0A 4B09A 1MZBA 6PAXA 1ZZ7A 5FPZA 3U0ZA 1YYVA 1ZZ9A 3IL2A 4Z82A 1ONVA 4XFHA 3F23A 4RB3C 1J2XA 2CSOA 2FBHA 2K0GA 2PA7A 1D8JA 4I7HA 1TQPA 2EVXA 2QCSB 1WWXA 4Z07A 4M6XA 1REPC 4HQMA 5I8TA 1XGNA 4EJWA 1RUOA 4KT5C 3H7YA 3LWFA 2O03A 2BBYA 1L3JA 2VBWA 5FDBA 4UV8A 5EEGA 4HSLA 1XCBA 4LLNA 1L3LA 1YW7A 2JRTA 3C7JA 2JPBA 4EWDA 4F8AA 3PQKA 4P5OA 5FLHA 1O3QA 4P55A 4JTNA 2IXKA 3G7DA 5LBQA 3U10A 3P9IA 2FNPA 2E1NA 1B1BA 3D5LA 2STWA 3KSCA 1D8KA 2P7VB 4KIBA 2QVSB 1BOAA 4BHCA 1JHFA 1S7OA 3RJPA 3FHZA 3SCHA 4KL1A 4MGKE 3BOQA 3RYRA 2MC3A 3IRQA 1ON2A 3CLOA 4IEZA 3ZP5A 3G3ZA 1YFWA 2GC1A 5HDNA 2KJCA 5DEQA 4M71A 1HW5A 2VBZA 1BI2A 5L3BA 3O14A 2AXLA 4EM2A 4UBHA 5FB2A 1IPJA 3WODF 2OAZA 1H0MA 2GU9A 4MX3A 2FSWA 1SAXA 2QNKA 1UD1A 3SZTA 5E16A 2X4HA 1DGRA 3EUHA 3RPQA 4YG2F 1J59A 3S7IA 2AS5F 2UXNA 3KZZA 3OF1A 2EJRA 1MJAA 2FF4A 5D6EA 1IF1A 2NNNA 1Z05A 3CLPA 3TQNA 4OINF 3G73A 5E1ZB 4AVCA 1ZRDA 1LQ1A 3OOPA 3ZMZA 4ZYHA 4PZJA 3GEZA 4QWQA 1R36A 2FMLA 3J80K 2F5DA 3WTVC 3BJOA 3ZN0A 1R23A 1DPUA 1ZZBA 1LEAA 3ELKA 1FC3A 1Q43A 3E3VA 4I3PA 4M9SA 1FX7A 2VE9A 3ECHA 3HSEA 3O3KA 2UY9A 5I91A 4I01A 3S2WA 3IKVA 3ZMSA 2E7WA 1J1LA 2GQQA 5D4RA 2VPVA 5LHIA 4I0AA 3H7JA 4L9NA 4YFKF 3ACLA 1BC7C 4ZYEA 1UW8A 4AIJA 2OZJA 2HYGD 1T98A 1NXMA 5FQ0B 1U3EM 2V1XA 1TQMA 3L9FA 2JZYA 1QBJA 2P8TA 3HRTA 5JR3A 3NW4A 3DL3A 4CGZA 5F6FA 4PCQA 4GO1A 2CWEA 1ZZ6A 1HBXG 3FM3A 4IEXA 3TGNA 5CJ9A 3NJZA 1DPRA 4UBGA 2VOOA 2GWRA 2LF7A 3DF8A 1HW1A 3VHRA 1ZG3A 2XAHA 2GXBA 4B29A 5FD5A 3Q9SA 2HYFA 2O8QA 1V4RA 1HXDA 4HAMA 5FPXA 3CUQA 3T5XA 1V3FA 2QQ9A 3HHGA 5JAXA 1XD7A 1TW2A 5FLJA 4AXOA 2Z5UA 2FNAA 1ZAOA 5HLIA 1YUDA 3KP2A 5K1YA 4KWJA 1Y9QA 3JAMK 3GZ6A 3WG9A 3FE5A 5KHHA 3MQ0A 3OV8A 2GA2A 4QXKA 1ZGAA 3DXJF 4B8XA 2P6TA 1ZN2A 4A6DA 4N9IA 1USSA 3CTAA 1ZRRA 3KGLA 2L3DA 1G6NA 3DV8A 3MDPA 2ET1A 2J5OA 4CICA 3ECOA 4RGUA 3BZ6A 2W25A 2PQQA 3RTRA 2HQRA 3FJSA 3ELNA 4OIPF 4ZZDA 2J5PA 4HN0A 4AIHA 2QZ8A 1G3YA 2MHFA 2EFOA 4HYEA 1EH7A 2PLYA 1P4WA 3KCCA 3D0SA 3I59B 1OFNA 2NAZA 1BI1A 2MH2A 2O1QA 4MGZE 4RGXA 1XDSA 4Q48A 2P5KA 5LRSA 3EYYA 2HS5A 2FBIA 5DYMA 4WF2A 3BY6A 4Q0VA 1EV7A 1H1MA 4L2NA 3BP8A 4Q0SA 2FA5A 4Q47A 3ES1A 4JQFA 1W7PA 1CAXB 5I0SA 3I59A 2RDPA 3KLOA 4EM1A 3GLXA 4ASNA 2XHKA 3HTUA 4ORFA 1RZ4A 4YFNF 3MPBA 4YYOA 4XF4A 3KZYA 1STZA 2F4PA 4MV2A 3SZPA 4YIIA 1D5VA 4I98B 5JR7B 1RIOH 3E5UA 2ATFA 4LK0F 3OD0A 1ZG1A 3BU7A 2V9VA 1U2WA 3WGIA 4WXHA 1ZX5A 4IVNA 5ILUA 1UHWA 5IT9K 3LZZA 3F6OA 3EYIA 4H0EA 3K0LA 1P92A 5LGUA 2FEZA 3BB6A 2IT0A 1IW7F 3BALA 3REOA 3GX4X 1FYMA 2BNMA 1ZHFA 4KU7A 5D8KB 2YX7A 4ONUA 2XAJA 4WXCA 3H8UA 2EFWA 4XEZA 4AIKA 1XSXA 3B02A 3QU6A 2K27A 3RI4A 3Q5FA 5LEJA 4L5JA 3LA3A 1OYWA 1Z6TA 5EEHA 2LSOA 4RB1A 2H09A 3MZYA 2K7LA 1H1IA 5CVUA 4WXDA 1FBQA 2W85A 4R1HA 5I93A 3OGJA 5AVPA 3TOAA 1CAVA 5FD6A 5E1RA 1PUEE 2VC0A 1R5HA 4MUVA 3OCPA 2IXHA 3SHRA 1KU7A 1R1UA 3KEQA 3NRVA 1YWKA 1PM7A 3W6KB 3WTYC 2DAOA 2ZMEB 2ISZA 1S7AA 1UIJA 2ZJ2A 3WGHA 4MEYF 4A5MA 1B9MA 3E6BA 5L3CA 1S6LA 4MEXF 2LKPA 1LDKB 3I0TA 1OPCA 2D5FA 3L7WA 1MD0A 2HEOA 2XRNA 2O0YA 2XL9A 3P9KA 5K8SA 2R3SA 1XDUA 4IETA 4KMFA 2E1CA 1H9TA 1UCXA 1JXSA 4OLLA 5D1IA 1SD5A 1XGMA 3DPTA 2PN6A 1OD5A 1MDMA 2KIFA 3F6VA 1SD6A 4HDVA 2CW0F 3QPTA 1QXRA 3V8KA 3FMSA 4YNIA 4MTDA 2XGXA 3KLNA 4UV9A 4IF4A 2M8EA 3MWMA 2VE8A 3V7CA 1YLLA 5BPIA 4EQQA 2LDUA 5D5UB 2PHLA 2QQAA 4ESJA 3GO5A 1SMYF 2OU2A 1J3QA 5TRDA 2HQNA 5L3FA 3TOBA 2UXXA 4QLCU 1XMAA 4KN4X 2Z3YA 3PVBB 1Q5OA 2PMUA 3KP5A 5E20A 2O6GE 4BHPA 1BC8C 4KIGA 4FHTA 1E17A 3MZHA 4HX8A 1KYZA 3LA7A 3QAHA 3GUDA 1YW8A 4A5NA 2B9UA 1BN5A 1PDNC 1O5LA 3KP7A 1IXRC 3CUQC 2Y0OA 3WW3A 3WTXC 3NKTA 1YW9A 2HGCA 4UUVA 3GW2A 1F5TA 3T1BA 1ZLJA 3CEWA 1Z7UA 1R00A 2MLKA 5DUKA 1DP7P 2ZKLA 4HZFA 5FLXZ 4IESA 5L3EA 2H6BA 4WK8F 2HZTA 2IPQX 3WU1B 2RKHA 1O5UA 3ES4A 3F8BA 4XBFA 4MZUA 1Z91A 3IIAA 5BPXA 3EDPA 4K8FA 4HVQA 4BH9A 1ODDA 4KFCA 4LUMA 2OBPA 1CGPA 5JFRA 5T3NA 1H9GA 1DZTA 4A2UA 2XKOA 1O3RA 2D45A 4ZZLA 2QLZA 2PAMA 4L11A 1KU9A 5ICCA 3IWZA 5IT3A 3K2ZA 1SEFA 4IPAA 4D0PA 1LRHA 2QVOA 2L01A 2EAAA 3L2CA 3AAFA 4BNCA 5I8SA 4XRFA 4ETSA 1YS6A 4P9GA 4IEPA 2K9ZA 4Q5SF 2DI3A 3C3VA 5CADA 1WRJA 1HKSA 3HRMA 2FXAA 5DCMA 2V6CA 4J1XA 1YFHA 3HT2A 4D7SA 2HTJA 2VOPA 3M8EA 2EK5A 2HR3A 4BXUA 5F64A 1KA8A 1U6GA 1D3YA 4IJAA 1ULYA 3FZVA 2ZXJA 3KP3A 4HV6A 2YSRA 1F4KA 2VXZA 1XSDA 3PLQA 1QWRA 5BV6A 1RL3A 3SXYA 2QUFA 4XF0A 4UNOA 4HBLA 3RKYA 5BXXA 5CVVA 4O3MA 2P5VA 4UVAA 3DKWA 4GGGA 2C0ZA 1J5YA 2L54A 3IHUA 5D5WB 1KU2A 5J3UA 3DFGA 3JW4A 1W5TA 1SFXA
chains in the Genus database with same CATH superfamily
5FP7A 1IQDC 2RS52 5DN2A 3TDZC 2BW3B 5HNHA 3UKGA 5F3GA 3SXWA 3CJXA 2W4SA 3P3PA 2UU8A 4Y22A 3VL8A 1PMIA 3ABZA 5FGMA 1BJQA 2EPFA 4BQXA 1U12A 3WQ1A 1GZWA 4MGSA 4YW6A 5JI6A 3G6EI 5FO9B 2AYHA 3CJTB 2DURA 3AFKA 5KXBA 4ZDLA 5IPAA 2EIJH 3CD6I 3QOPA 4CTEA 4M01A 1UOBA 4LG0A 4L0PA 4ZXEA 3LQCA 1TWHJ 3VZKA 3RZDJ 5C33A 2D6OX 4A69C 5D21A 1IG3A 1A36A 3BPXA 2WWYA 2RC4A 3KYDB 3P5BA 1J09A 5BY5A 3H1YA 1IC8A 3NAPB 5ERIA 5IFTA 4UW6A 2WNOA 5DTDA 5ED4A 3P1IA 2FZ2A 5J1XA 3K69A 5D8AC 4NB5A 5A2QZ 2M45A 5ILSA 3OBZA 3TAYA 1XU1A 1EAH2 3NVCA 1FZPB 5EFUA 4D5CA 1VTNC 3ZPYA 3JTHA 2XB5A 1S0IA 3DBLB 1NAEA 2KIQA 4XIDA 1UY1A 1E2XA 2M8GX 3D82A 3W5NA 1MQTA 3X29B 2YMZA 2E7XA 1Y56A 4O65A 1S2BA 1RUE2 3BT9A 4XAEA 3NJVA 4BE2A 1I5ZA 3O1SA 3JSOA 3WW2A 2BFUS 1AWCA 4DY5A 5HODA 3SEPA 4F7ZA 3PM1A 4XOTA 2NM1A 1XMXA 2P5BA 3DGTA 3TWIA 2VUCA 2P3YA 3TDUC 2WO3A 3OTFA 2C9KA 2VU9A 5LRRA 2G1MA 2R0HA 4BMBA 1LFBA 3MKWB 4R52A 1AYN1 2E36A 4U7DA 5KHKA 1FSHA 3P3NA 5LK5A 4AHYA 1D0GA 2RDSA 2NMNA 1VBA2 2YS9A 4META 4MGYE 4NPLA 3JRBA 4NHXA 5AC92 4HLYA 3MW2A 2Y9ZA 3OOUA 2DCEA 4QX1A 5B3SH 2VMIA 3VBRC 2IRFG 4EWEA 4I09A 2ZEYA 4IV1A 3FM5A 3KEYA 2GNDA 1QH6A 2GC2A 3MICA 3OSFA 3OYWA 1GV2A 2O7OA 1U5IA 2ERFA 1F43A 2JENA 5B5EC 2A3WA 2YPRA 1PX4A 3H1WA 3HSRA 1G8XA 2QUOA 1HC8A 1RUG2 1TME3 4D1QA 3SH3A 1WGXA 3WE3A 1B4AA 1B8IB 5K0UB 5JLWA 3L09A 2XUMA 1MEC3 1Z7LA 5A2QK 4ANJA 2JD4A 5LW9A 1NTCA 2HI3A 3AL0C 1TLHB 3W3CA 3ZFEA 4E2GA 2A73B 3OL3A 1BJAA 5GJ6A 2ZGNA 3KT1A 4OOIA 4X8PA 4AGGA 1GVJA 1P8JA 3IWFA 1UB9A 1TNRA 2WC2A 2M0MA 2BFUL 2OC6A 3N9MA 3ZXKA 3WNPA 5GZEA 2PJPA 4M9ZA 1XB4A 4JGYA 4XUOA 4LLGF 3H3LA 2MA3A 1BXHA 4E4HA 2WL1A 4HF1A 1YQAA 2JPCA 3DEMA 1ETOA 4CVUA 4QIWN 5HXMA 3HQUA 4L9VA 4UUTA 4M4RA 4BJTA 1O7FA 2CQNA 1GQHA 1PP8F 3LOIA 1NX9A 4FPJA 3IIIA 3VOEA 2LY2A 3IAS2 5T52A 2BWCA 5AFBA 2QDNA 2Q4SA 1RUJ2 2XJPA 5JR2A 1JTZX 1J9IA 3SCFA 3GNEA 1SFEA 3VKNA 1HB1A 3BU0A 5BQTA 3POJA 4ZU4A 5J3LA 4C91A 4ASKA 2Y6GA 1TBXA 3VN4A 4NE9A 3RS6A 3H9GA 2DMPA 5C9AC 5D8AB 2RV8A 4B3NA 2YPDA 3MD2A 2GZWA 4QPIB 2P17A 1YJKA 2W2IA 4FP3A 4A3EJ 4O9GA 1S0JA 3AG2H 4FPEA 2ESHA 3QP5A 1AR81 2O8OA 2VZQA 3UNGC 1LU2A 4D9JA 1NOVA 2CWSA 1BL0A 2M1BA 2OZUA 1D1BA 2DYCA 2G19A 1R092 1BOBA 2BOIA 4M6YA 1C8M3 2DA7A 3RVHA 1NZCA 3IAPA 3O1VA 5FYUA 2OD5A 1I3QJ 3JCUC 2W5FA 1KITA 4KU8A 1F5JA 2BXZA 2DV9A 1SLIA 5K7PA 1W8HA 5GM0A 4HDUA 3HTSB 4QB1A 2PJRA 2RJLA 5A7NA 4GZ9A 3K2AA 3JRAA 1DDNA 4E2SA 3ZQFA 2YHJA 1T38A 4UI9L 5HS7A 5CISA 2H27A 5K5QA 5E8GA 4XPVA 4QSHA 1W6OA 1QZYA 1OI6A 3RKQA 1OQEA 2ZKZA 1U8RA 1Y1VJ 5GLZA 1XPXA 3M7AA 2VASA 1XYPA 1JYNA 4CUCA 2FUG2 2DWRA 3VBSC 3JBG2 1V6KA 3U78A 3KX2A 3VBRA 2LLKA 5FZEA 1YIJI 3PJRA 5IATA 3GF6A 3AL0B 2VNVA 1DYPA 4PIYA 4FBFA 2KZVA 3T3YA 4F55A 4AI0A 3N3HA 2J1UA 2DMTA 3KLSA 1MBGA 3UL2A 3K1MA 2XXZA 2L02A 5FZHA 4RQPB 2HFHA 2MLGA 1T56A 3R60A 3KEOA 3M1EA 1V6MA 1COV1 1WJCA 2HXIA 3F8MA 3UKVA 3U1DA 3BC8A 4SLIA 4E2QA 5C8CC 3ML6A 3BR6A 3SYTA 3JD73 4D8MA 4MQVA 4QPWA 2TNFA 3OIPA 1J0RA 2NP0A 1V5FA 2W7NA 1QGPA 1KQ8A 3OGRA 1UX7A 4YLZA 5T5PA 3WNLA 4O6JA 4YIFA 3DYOA 4LD5A 2UYAA 2BTVC 4AGVA 1R082 5L73A 4YG6A 1IPKA 4O9EA 5AVAA 2C1FA 5DD4A 5EYXA 4FTEA 2K85A 4G9YA 4EJTA 2BVMA 5BUVA 5BNOB 2WA0A 1LODA 4QDRA 4RR3A 1MKMA 5HCBA 5A7WB 1H4HA 2CNAA 3C2UA 4CP0A 3AKPA 2BVLA 3BQYA 2G7HA 4QX5A 5KHGA 1BLZA 2VMFA 3ZXJA 4WVZA 4JBAA 1LFPA 4BQNA 3A0NA 1SZBA 1TNFA 1ZNPA 4LKDA 2HDCA 5LATA 4Q4X3 1WLCA 3M7GA 1FT9A 2M34A 1WW4A 3AG4H 2VPLA 2ZX1A 3MFKA 1NXD1 1YNAA 2Z42A 1CPMA 4CU6A 1G3WA 3J7HA 4EN7B 1J58A 4D6QA 2LF8A 2D5HA 2DMQA 1NY72 1JYIA 5JOYA 5LA1A 3FN9A 2HWF1 3ZIWA 1GSLA 3M3CA 3LNQA 1ULOA 3PJYA 4JRLA 4M4PA 4UOJA 4DB5A 1WVRA 3PMSA 2XIGA 1D7PM 5C9AA 4EMSA 3ASOH 3F2ZA 1L0OC 2JJ7A 4OIOF 2NS7A 2JE8A 1I1SA 2BUKA 5FYSA 1LDDA 4HLTA 3QP6A 1RUNA 4Y15A 3R0AA 2EV0A 3E7LA 1X82A 1S29A 3UKTA 3BVCA 5JCTA 1WA4A 1JUHA 1BEV3 2MPFA 4HF0A 4CUGA 1I9RA 2QQJA 3NO8A 3U07A 2HWVA 3ZXLA 3VYRB 3WV6A 3FX3A 2M87A 2J1AA 5IP6A 1FOYA 2VZPA 5IYBJ 1I3AA 4TTGA 3U2RA 3ESWB 2K9QA 1P9QC 5BYNA 5I8YA 3A0HC 3VHOA 3MIGA 1CAUB 2HU9A 2I45A 4IEJA 4Q29A 3GCWA 2V1UA 3VD9A 4NDLA 3LEGA 5GLWA 2VONA 2R043 1RR8C 5C8WA 2GSYA 2R7RA 3T1LA 3DPRC 4AVAA 3KP6A 4DZJA 3TNQA 4XF1A 2M5WA 4QKFA 4LUKA 2WY7Q 5F8PA 1WSUA 3K70C 2RMU1 2VMCA 1P2FA 4FETA 2HYXA 4YM1A 3VZNA 4Y1UA 4N90A 4Y7NJ 2IZWA 3ROUA 4GMP1 1NLRA 1BM9A 5BNGA 4CYDA 2NNYA 1VBE2 2V4VA 3VBSA 1JT6A 3IRRA 3M9AA 4V2GA 5FTTC 4D5FA 3JRGA 3D4KA 4LKEA 4M3FA 4ARXA 4XKVA 2WFF2 4YW1A 3ASNH 2WBKA 1US2A 2A6VA 3HHHA 1ZK8A 4FT8A 2R93J 3JB8A 3WP5A 1FY7A 2LD5A 2ENRA 2CH0A 1QPMA 4QXBA 3WDXA 4A93J 5B2GB 4BAYA 5C8CA 1DGWY 2IUWA 3R4KA 5DDJ1 2IVJA 4ZXKA 3POWA 5GPCA 2A07F 1ZYBA 1WW7A 2V4AA 5GZDA 4RYDA 2IGMA 4JV4A 5JDBA 2WNUC 2DMUA 1QJU2 2Y6HA 4ENMA 5J4VA 1QXPA 3CO2A 2GC3A 1VQ9I 2TBVA 3GZAA 1FBSA 3S7EA 2PAEA 2UUZA 4BGDA 4CZZA 4KT6A 2K5CA 2CDOA 1OQDA 3JRHA 4M74A 1GYKA 5FPVA 1QHDA 3KYLA 4XHBA 4IE0A 4QDQA 1APLC 4I2OA 1AZDA 2RM22 5DAPA 4A3GJ 1OCPA 1GICA 2C5DA 4B48A 4MLOA 3LAGA 1DQUA 2OUHA 4KMQA 2QENA 1JU4A 2PX9A 4AAPA 2E19A 5EWSA 2WO1A 2A69F 4NJ4A 3UJOA 3A23A 4INDA 4K2EA 5BNPB 2XLAA 1K7AA 4WZFA 2QKDA 3F22A 1UFMA 1GBGA 2DTZA 3VBOC 3VHNA 3BDDA 2XQXA 2EV5A 1OHFA 4OMCA 3SH5A 2BVVA 4UFKA 5C3QA 3J7AY 5A3NA 3N7KA 2ZC2A 5JVVA 4CXXA 2TCTA 1WKYA 1YFXA 3NEUA 1FOXA 1P7JA 3VBFA 1ONAA 2WSVA 5J98B 2OZ6A 2E32A 2B45X 2W1QA 4PI2A 3BTZA 1YS7A 4LK1F 3DTIA 4IE5A 1AL22 2Y34A 1CAXA 1Q8QA 4E9KA 4LGWA 3WDUA 3V7SA 3ZN1A 1GNYA 2DFBA 4Z2YA 2OTJI 1FXZA 4XMYA 5FKCA 2HWC1 1H8TC 2MEV1 3KF5A 1G3TA 5E8AA 1PVC3 1LKNA 2WV0A 5GLUA 2ZNYA 4YFXF 3CUOA 3HPHA 1OMIA 3BIEA 4Y1VA 1AR92 4HEA2 3WE2A 1CPNA 2DCKA 1X1PA 3K4ZA 1SFNA 3BR3A 3N05A 4FTBA 2HLEA 2QJVA 2BDRA 3E6MA 2P3IA 1YFYA 2RGVA 4PDKA 2W1WA 5FZOB 3DPRA 1U78A 3CMAI 2VJXA 1A35A 4PDWC 1LHNA 2QEXI 4M73A 4G12A 3U11A 4XJWA 4Y5SA 4A3JJ 3EUHC 3GFIA 3RKXA 3WDVA 2G9FA 4JDMA 1R1TA 3H42B 2EFPA 3I3LA 4PBOA 4PQQA 4IHYA 5A7PA 1YIPA 5HLHA 2MYSA 2LYCA 3K4CA 4JYKA 4NN0A 4LULA 1W36C 3VB2A 2E1MC 2XV4S 4A3KJ 2WNUB 1Y3TA 4IO9F 1BIBA 1VMJA 4XN0A 5KK1A 2V4JC 4LTAA 1FOD2 3QPHA 4XF9A 3O1MA 1NE4A 4AFMA 3HYIA 1CD3G 1SDDB 5JZGA 1G7YA 1POV1 1N3PA 5F32A 3BG3A 5EJZB 3K10A 5EZWA 3I53A 3VDCA 1J3PA 3POGA 2ARCA 3OBAA 5FXZA 1S9HA 4IEQA 4RBOA 2NYXA 2JG8A 5A70A 3NWSA 5ICEA 3Q9OA 4YARA 4IRIA 4FTSA 2EA4A 4NOTA 3A0KA 3AB0A 4RB2C 4I0WB 4ZKTB 2GLOA 2OF7A 2E31A 5IK8A 3MKYB 1Y0UA 3NRUA 4Y52J 3VD3A 1PK6A 2F2EA 4XLNF 2V7FA 3M3EA 4KH9A 3MFCA 3LSMA 1L7QA 3H3ZA 1PUFB 3CJRB 2QQLA 4E4DX 4UFIA 4GFBA 3LFKA 1CF7B 3VBOB 2FDFA 4P00B 1W28A 2XGCA 5EYRA 3VFZA 1QOTA 3DN7A 4CE8A 1MS3A 1EY2A 2CO5A 2R7ZJ 2VZSA 4PBPA 5LBEA 4AWDA 4FAHA 4GRIA 2EA7A 3HOVJ 4AFAA 4COUA 1PVEA 4HNTA 1MGTA 2XROA 3I2HA 1A6IA 5IWFA 1AF9A 4Y20B 1IPSA 2PLV2 2XGDA 4FQZA 3IH2A 4DYQA 1DZRA 3AXEA 2WAFA 2VO5A 3FWEA 1ZZ7A 1NG6A 4OHZA 4Z82A 4QQOA 3F23A 2L9NA 1S55A 2M4KA 3ECQA 2CSOA 2PA7A 1H2KA 2DVBA 1RRJA 4M6XA 3W2AA 3AYCA 1ZRIA 3USUA 5KC6A 3H7YA 1K4SA 1TME1 2O03A 5EEGA 2R49A 1SLCA 3GBGA 4LLNA 1UYZA 1MEC1 2JRTA 1LCLA 2ILMA 1TMF2 1O8PA 3PQKA 4UUSA 5ACA2 5FLHA 1O3QA 2IXKA 3G7DA 5IHRA 2I07B 4BQ3A 3P9IA 3UGGA 2FJ1A 2FNPA 1VBB2 2KL4A 1H8TA 4EQVA 1B1BA 3D5LA 1XS9A 2STWA 4QT6A 2ZGRA 3BOWA 3C2HA 3OUHA 3S30A 4II2A 3RJPA 1PX3A 4PDWB 2OUMA 3FXJA 3SCHA 5FZ4A 4TZDA 3ZP5A 3LE0A 3WF2A 3WP3A 1VBC1 2ADEA 2YFZA 3MBWA 1VRBA 4EM2A 3ORJA 5F3IA 3OS0A 4B8EA 2R062 1IPJA 4P1WA 2Q5TA 1Y9MA 3WODF 3AG3H 2E1MB 3HOUJ 2GNMA 2FSWA 1SAXA 3T0DA 3SZTA 4B1LA 3Q8AA 3CZ6A 4MYEA 3FHNA 4M6VA 3TRSB 3OMYA 3EUHA 1LOFC 4XDQA 1J59A 3OF1A 2EJRA 4LO4B 2QA4I 2R4GA 1Z05A 2A6TA 4U2AA 4MHRA 1ZRDA 2VZVA 2JWTA 4EN9B 4FPOB 4P9LA 4PZJA 4NNJA 4XDOA 1EV12 3NNJA 5FZ6A 1R36A 3O0XA 3WTVC 3OUIA 2R7QA 1PIV2 1FC3A 1Q43A 3E3VA 2VVEA 1PGL1 2BBVA 1FX7A 3FXKA 4LPLA 4P14A 3HVDA 2UY9A 5I91A 4GD4A 4PJMA 4W4ZA 1J1LA 3OIQA 2GQQA 5LHIA 4I0AA 3H7JA 4YFKF 2XRLA 3HBLA 1BC7C 1UW8A 4A7ZA 4AIJA 5KNLA 3ATGA 2CV1A 2A6WA 1GANA 1NXMA 2Y69H 1JKQC 1TQMA 5FKOA 2YU1A 2D44A 3BR5A 2P8TA 3CMYA 3HRTA 2XWBB 4QPGA 4RGAA 3DL3A 2W91A 2A6ZA 2WS93 4PCQA 4GO1A 3THPA 1YQCA 3FXLA 1RVF2 3DF8A 3DWLE 3K4MA 5M5YJ 4B44A 1OLRA 3Q9SA 2O8QA 3RI9A 3ZSEA 5F6KA 5J4YA 4YPJA 4FFFA 3E1SA 2FDIA 4Q4Y2 3PURA 4N8MA 4HANA 3AZXA 5K1YA 4MFDA 1LUJB 4KWJA 3GZ6A 1W2AX 3WG9A 3FE5A 2WA3A 4XABA 2UV1A 1OA2A 1QJFA 2VZ1A 1JU3A 3NV1A 4JKLA 3TEDA 2P6TA 1ZN2A 4CUAA 3CTAA 4JDNA 3BR2A 1YJ9I 2L3DA 3WSOA 4OI1A 3CMGA 5EZGA 2R7SA 5A7SA 5DM6F 1XSQA 3ECOA 4KWUA 1YX5A 2AHQA 3BZ6A 2HDWA 2W25A 1QPIA 5FR3A 3CDLA 2HQRA 1E3OC 3FJSA 2QSFX 2D98A 4ZZDA 2J5PA 5DS9A 1V9U1 1IHMA 1DQ0A 2DA5A 1XXNA 2MHFA 1DU0A 3V64A 1DP3A 1JUPA 5FZCA 1X50A 1N47A 1ULGA 3S5AA 2LALA 2DVAA 2XGEA 1OFNA 3NQHA 1BI1A 4MGZE 3BOPA 3RCOA 2HEVF 5FZ9A 2JDHA 5LRSA 4CCJA 3PVOA 2QBXA 3JD71 2JDYA 3ZOBA 1EV7A 4BLIA 3ZO0B 3ES1A 2FD5A 5H9QA 4GKYA 4RHV2 3VDDA 5FYCA 3LF7A 1YX3A 3ZSKA 5FRAA 2GOMA 4LITA 5FBJA 2EXIA 3JUUA 3OOXA 1Z7S3 4ASNA 1VE0A 4C90A 3HTUA 1T95A 4XF4A 2BWAA 3TN93 4W8JA 4TWTA 2GMEA 2ZXQA 3WQBA 1STZA 3ZLIA 2F4PA 4QTRA 4YIIA 1IS3A 2VQGA 1RIOH 3O5SA 1ZG1A 5E88A 3K4BA 1PZ9A 4NRQA 2MSYA 1U2WA 4WM8B 1O4XA 5BNNC 5JPNB 1LNSA 5TSWA 1S0EA 1UPSA 2RDQA 5ILUA 4C0HA 1VQ8I 3VYUB 5FO7B 1TEIA 4Q4X1 4KU7A 2BNMA 3PU3A 5EDNA 5D8KB 4X1EA 1Z77A 2K3PA 4AIKA 2VZOA 3KS7A 3T2TA 3Q5FA 1YEWA 4QPOA 1OYWA 2VKVA 5GTIC 4LBQA 1WUVA 1Z6TA 2ORZA 2QQIA 5EEHA 1W9WA 3FHAA 2CUJA 4D69A 4WXDA 1FBQA 1NQJA 1YI2I 5IAXA 1XB9A 3ME2A 3OGJA 5AVPA 1CZTA 1PO22 5FD6A 3QODA 2WNVC 3VKLA 1R5HA 2XBO3 4MUVA 2E2JJ 2QE3A 3VZLA 1ZKGA 3SHRA 2C26A 3I2JA 3ZSMA 2KLOA 3WTYC 2XB6C 4DXSA 2DAOA 1SEUA 4CP9A 2RS53 2KPMA 1N1TA 4MEYF 4MEXF 3POSA 1PNGA 1BEV1 1LDKB 1RMU2 1RPWA 4AVVA 1Z0HA 1UQXA 2HEOA 2O0YA 3NWTA 1HRV3 4XHXA 4UW4A 3AZWA 3FBIB 4XZUG 3ACGA 5EG0B 3CCVI 1JXSA 3OYJA 5D1IA 1XBFA 1ZBE2 1SD5A 3LEMA 3JCIA 2LW8A 1MDMA 2KIFA 2LG4A 1QXRA 3V8KA 2PQSA 2R041 3DPUA 3WHCA 2EINH 3GTMJ 3CCUI 4I6ZA 3KLNA 1W05A 4BJ0A 3OYKA 3MWMA 2VE8A 1K6YA 5JPMB 2EXKA 3RJ2X 1YLLA 2DODA 2XJVA 1KDKA 1OOPA 4EQQA 1LULA 5D5UB 4ESJA 4LORA 2AQFA 1J3QA 1C1LA 5TRDA 5KAIC 3PMEA 2HQNA 5L3FA 4RGKA 2UXXA 4CP1A 3DXUA 3K77A 2OXBA 4CCNA 2PMUA 2E5ZA 1C57A 9ANTA 1ORKA 2DN0A 1X19A 4FHTA 1EAH3 1E17A 2A6YA 2DCZA 1XSRA 3GUDA 5LBBA 2KT0A 3ZFFC 2DMNA 2RV9A 1O5LA 4JZRA 3KP7A 3PUQA 1IXRC 3ZDVA 4BMEA 2DU1A 2HGCA 4BDYA 2GBYA 3CEWA 1Z7UA 4WM7A 2ZFUA 3GTJJ 2FD8A 2ZS6B 2YC2A 2Y38A 4A3FJ 1Q8PA 1DP7P 2CHHA 2OPTA 3RZHA 2R5YA 4PCRA 3J7MA 3OYHA 2DA3A 1NCRA 3I97A 4AGRA 2W68A 4MZUA 4N53C 2VBDA 5CFCC 3ZYPA 3HGGA 1BHGA 4K8FA 5BNNB 2JDKA 1AR71 3EYPA 3RWNA 1VBA3 4IZZA 4NO4A 2YZ4A 3K2ZA 1KD7A 2HEYF 3VPRA 4MIMA 4PJJA 1YCIA 5I8SA 1RKTA 4JAAA 4ETSA 3J7NA 1Y9GA 2DI3A 3L1PA 1TG7A 1W9FA 3HRMA 4BE0A 2HTJA 4H7MA 1W9YA 4YGBA 3ZYBA 4NBQA 2G9ZA 2WO2A 2VR4A 1U6GA 5A3WA 1D3YA 4C30A 3KP3A 3RZLA 1NA1C 4F92B 4HV6A 2YSRA 3B00A 3PLQA 1RL3A 2KMUA 1VQKI 1T6BX 4CDXC 1XNKA 3QH6A 3POFA 5CVVA 4UVAA 3DKWA 2L54A 1DG6A 1ULDA 1W5TA 3OS2A 1SFXA 1D0HA 3I7DA 1AUYA 1QY4A 4FPGA 1W0UA 1XC5A 4OUMA 5CYVA 1K78A 4L92A 2GC0A 4HX4A 2WNVA 4F93B 2MBFA 4P9IA 2PTMA 3A22A 1VQOI 4Q8KA 2G9WA 2IGKA 3FMQA 1FJLA 2W9XA 3V0AB 4CEWC 1RXGA 3CCJI 2W82A 1PNFA 4HW0A 3VKMA 2W24A 1UL9A 1AR63 3H92A 1GNZA 4NHKA 4OVEA 1IKPA 1QJY2 2B7EA 3S16J 3QACA 3RG0A 5FWEA 4ZS2A 2H8RA 5T55A 4M3CB 1J75A 2JIJA 3AKTA 2Y9YA 1PVC1 1MW7A 1B35C 4X6AJ 3MIBA 5AFEA 1RUJ3 1IN6A 1RJ8A 3K51A 3BCAA 2DJIA 4OHYA 2RVCA 1HLCA 4JX4A 1LEBA 1D4VB 3PNYA 2CU5A 4YM3A 4HV5A 3WP4A 4Z8BA 2COMA 5JHFA 2WNEA 4BK4A 4OUEA 3N97A 2X6YA 2V79A 3IDEA 4M3CA 1OURA 1OKOA 3ACFA 1XRUA 4BK5A 3J8F2 4CXWA 3OYCA 1ZBA2 2Q8DA 1W6NB 1N75A 3ZFFB 2K9MA 3WF3A 2A68F 4C3IJ 2WFPA 3SLIA 4CEYC 1OH3A 5F3CA 4MQ9F 1IZ3A 3B6AA 4YGCA 4XSXF 2VBBA 4IRHA 2ZXHA 2DCJA 4GH4C 4EJOA 4AW7A 2Y75A 2YG0A 1S2EA 1WPKA 4EYUA 3E5QA 1EJ9A 1W8TA 3O12A 4MGTA 1EPZA 2JD9A 4FCYA 4W97A 3L2HA 3KM5A 3IUOA 1DGWA 2IFWA 3ETQA 4YEJA 3ZMDA 4G6DA 2W92A 1LHUA 1FPN2 5HPOA 5ILVA 3VD4A 3KB5A 2HOAA 4NVPA 2IA2A 5K7HA 2MG4A 1VI0A 1HIXA 4HLXA 1ZELA 1ON1A 5LY2A 5L19A 4MHGA 3AKSA 2V1NA 5GP9A 1VP6A 3B5LB 5FUNA 3OPTA 2OT7A 4N53A 2F5FA 5CFCA 1GZTA 3LWCA 1OSGA 3ZSJA 2D40A 4XFBA 3HUGA 3I64A 2GNBA 5BOXA 1H4GA 4BCUA 4KICA 1ETKA 2ID4A 5AIPA 1AX2A 4RD7A 3JBG3 1ETYA 2E5NA 3ZQGA 3ZR5A 1NA1B 2VOVA 4Y3OA 3FF5A 1XMKA 1C0WA 2ZAHA 1WCDJ 2ECBA 1BR1A 5HXVA 4AI2A 1OISA 1QZEA 3RSNA 4L0ZB 5C4WC 3WHBA 4L97A 1UAIA 3PSIA 1NK2P 3WQ0A 2AXTC 3CCYA 3S2DJ 3USSA 1TW3A 2QWWA 1NUKA 4QGMA 4LXLA 4HVRA 1AR82 1GR3A 1S72I 1S7EA 2O61A 3ZXSA 3CCRI 2XASA 2IW5A 3WHTA 3A4CA 4NIDA 4XLFA 1HA8A 4QDSA 3AP4A 2A6XA 4ZYAA 3H0GJ 4CDXA 3SEEA 5A6QA 3QPSA 4CEWB 3DCFA 2FRHA 5HDKA 3POBA 2CRGA 1R083 2F5CA 3CO6C 1HDDC 2R7DA 2UWAA 2PXJA 1OCRH 3T4VA 1HX6A 3J7YJ 3VEPA 5IVYA 2Q1FA 2NS0A 1GXPA 5KBFA 1FSEA 4HSTA 1RGSA 2PHDA 5IK4A 4CEWA 1ENSA 1B35B 3MPPG 1VBD2 1PP7U 4B4RA 1PM4A 3W6JB 1A8DA 3ZYFA 4P9FA 4AEDC 4UAPA 4V2VA 3MW4A 1KJLA 4Q2FA 1WMEA 5FZBA 4OAYA 1IXCA 3HKZN 3IDAA 2A6EF 5M3MJ 1QQIA 3QLQA 5DG1A 4NHLA 3CNAA 5K9YA 3H5AA 2XB0X 3OD4A 2YGMA 1B35A 2DU0A 4DIQA 4JKMA 5C4XJ 1QF3A 4ISQA 3U75A 2H94A 3AYAA 4WVWA 4CEYB 1U5TC 1SFUA 4UW5A 4LJZF 2W95A 2VC1A 2VZUA 3M07A 4CUBA 2VBXA 3S2HJ 3GFLA 4G4FA 4GH4B 3J7ZI 3F8CA 4MH0E 3KP4A 4S05A 1R58A 2WA4A 5GADJ 1COV2 3LSRA 3LSEA 1W6PA 3LFUA 2GAUA 5EZHA 4WCGA 2E53A 3LSIA 4XCAA 4DUXA 1MMNA 2VJ5A 3KE2A 2VBPA 1R49A 2ADDA 3HEFA 1GUIA 2VXJA 2WAEA 4XQWA 4NC7A 4RAZA 4RS5A 4E8DA 4BJ5C 4TXWA 3JR9A 2EFQA 4IHVA 1N3QA 3BPSA 3C8XA 1UY2A 1MS5A 1ZARA 3GYHX 1QJX1 2VOWA 3ABUA 3WDWA 5LA0A 1X8EA 4ATEA 4YFZA 1O8SA 2D3SA 4EV0A 3PU8A 1Z1DA 3IZOA 2XJTA 4CDGA 2R7WA 1DFQA 4E70A 4UB6C 4QQHA 2QQNA 3ULQB 3W6VA 2E9QA 2HH9A 3ENRA 5GAHJ 4B3XA 3HRUA 3IN9A 4ESFA 3G2BA 2J1EA 5C4WB 3FXRA 3PHMA 5C5TA 1EH6A 2FMYA 3Q0UA 1GOHA 4Z1VA 2FCUA 4XFCA 3WTZA 5JVGF 2L7ZA 2ACJA 4XE9A 5IFPA 2DW4A 1TWGJ 2CGNA 2CW8A 4ZS3A 1VBE3 5AIQA 2WZPP 3S15J 5ICGA 2WS91 5CG9A 1BW5A 1YQ8A 1UO9A 5ANNA 5LD2C 4A6OA 2DT5A 2PBIA 4U7BA 2WFF3 3O0VA 2D2WA 1KYWA 1T08B 2H0BA 1XNDA 4Y4YA 4EGZA 4D3WA 2NLRA 5D5VB 2A3SA 2VODA 3SC7X 3WCRA 5IVCA 3OGSA 1JBCA 2X8KA 1QOSA 3WGGA 1B6AA 1SD4A 3LOBA 1BBT3 5FLVA 3S1MJ 2X1DA 4GCVA 5FIXA 3DCQA 5C6CA 2WQ8A 1R7JA 1GZ9A 4Q0PA 5FPAA 4G7OF 1A04A 4JGZA 2WR9A 2Q1ZB 2PELA 5DCMB 3GYDA 2ZGKA 2R16A 1W8OA 2W47A 3KMHA 2HWB1 3NARA 5IOYA 2GMMA 4IHXA 4L9TA 4NAOA 4ZU7A 4AEDB 3TYJA 4CPBA 2GA1A 3JU9A 4MVTA 1TQIA 2F6BA 4D0QA 3JREA 1HV0A 3POIA 4B7EA 5FWJA 2XH6A 1K79A 1QIQA 4LKSA 3J80Z 4DXRA 4ZTJA 1NCQA 4N43A 2HEWF 3S14J 4MTEA 4AEKA 1U5TB 2BGOA 1AJKA 2ID6A 1V70A 2A1XA 2CS3A 4GYIA 4BE1A 2VMHA 3HC7A 1WI3A 1IS4A 3LD8A 4CYCB 1BJZA 2UURA 1VFCA 4N4OB 3CCLI 1WGPA 2EXHA 1I39A 2R7TA 1AA7A 1YJLA 4DXTA 4S04A 2NRAC 1HKTA 3CP2A 2ZX2A 1UMZA 1W8UA 5KHJA 2QDRA 3PFIA 3FUQA 4LQRA 2QKMB 3D1NI 4GB33 1Z7S1 2O5RA 4Z92B 2PG4A 2BHYA 3I3DA 4AFBA 3I9V2 1Q56A 5CB7A 4CRQA 3AMPA 1GU3A 3RIRA 2ZMKA 3ZQIA 3TN91 4WVVA 4LB6B 1DGLA 3DKXA 3S3OA 4LG3A 4CCLA 1ACCA 1XNCA 4XLPF 3HG9A 4M0NA 4OCTA 1JJ6C 4TSVA 1H1AA 3TNPB 4JTOA 2QYOA 1MZ6A 4AQSA 2VW1A 2FU4A 4QU2A 3LSJA 1XPWA 3GZEA 4A7YA 1TNSA 1AL23 4H3WA 4TN7A 4IE7A 1XCVA 4A6EA 2Y31A 3A01B 4EN6B 4L0YB 1XYOA 2AUYA 3OYNA 1DLLA 2ET7A 3AJZA 4RAFA 2E2HJ 1O3SA 4GULA 4M3DA 4IHSA 2AZ5A 2D1HA 1WJFA 3BIWE 4DBQA 3B9IA 2Z99A 3OEAA 2V73A 3C3WA 4JHTA 4AI9A 4PSXA 4XLHA 4LLOA 2RS11 1JHHA 2M9HA 1T2KA 3QD6A 2JTVA 3JRDA 4UB8C 5FZFA 2HJIA 4L99A 2ISYA 3ZXEA 3ZN4A 4BXFA 2K3FA 3RI8A 3GZ5A 2WQZC 3R6SA 4DQ2A 4CXFA 4FSJA 3IM0A 4I76A 2P6SA 3GLLA 4WVMB 4V19K 3FK6A 4GALA 2VMGA 1YLFA 4RGRA 2JX9A 3CDIA 1RR7A 4DUWA 3ZQQA 2RS51 4YZ1A 1HJGA 3MGUA 3WLUA 1FYLA 1USTA 3L9JT 1S0DA 4K1YA 4YVWB 3JQWA 2VXDA 3ZVXA 5DG2A 1J84A 1PGW1 2CJJA 2RS32 4OI2A 3NSTA 4HMZA 4KWLA 2P34A 5IVBA 1GMMA 2P81A 1FNNA 2P7CB 1Z9CA 4RFRB 4C0BA 3G1OA 4XF3A 2K4BA 1FMWA 1RUF3 3DP7A 3OR1C 2J1TA 1SMTA 2YY1A 3KV9A 3VGIA 1RUI2 1U0AA 5FQ0A 5BNQA 1POGA 3VDXA 2B63J 4WBBA 4F52A 1EUUA 3GXUA 4LHNA 1R1VA 2YBSA 5LB6A 2XG3A 3K4JA 3KGZA 3HOTA 4IE4A 1LAJA 4Y13A 4R9CA 2DYRH 1W9SA 2DCYA 3K46A 4QMAA 1XU2A 5DZGA 2QBYB 1O6UA 3K7AJ 2LRPA 4FPYA 5L3GA 2EZIA 1X9PA 2K46A 3OYMA 2VTFA 3VZMA 3VBHA 3IH4A 2GXGA 4C3JJ 3KZ4C 2G9GA 4G7HF 3RYPA 3FBMA 2X51A 5LHGA 3LSDA 4QWNA 3AVSA 4BWOA 1EAH1 2GN3A 4OMDA 3PDQA 2HDDA 1AKHA 1CAWB 4B3AA 3AVRA 2JSCA 3SJMA 3IPVB 2DFEA 4IKFA 1LR5A 4COVA 2XLFA 1LOGA 3SNMA 5HS8A 4WWCA 4HVOA 3TO7A 1DUXC 3VWBA 3SMHA 5CQEA 3HDDA 2A3XA 1ZA7A 3AKZA 1QJZA 3LIGA 4YRVA 5M3FJ 1RUH2 1W8WA 2WSUA 4BQ5A 4XM3A 4Y1ZA 1IQAA 1GLHA 1FBUA 2Q0OA 1GNHA 1Q3EA 5CFDC 5CAZA 5FY7A 4KISA 1T0FC 1KQ9A 1PO13 2W52A 2Q0AA 4XIOA 1U0JA 2CY6A 4BU2A 4AVPA 3C2GA 1NLQA 1VAKA 2QQWA 5CKNA 2X10A 3AP6A 4ESBA 4KMUX 1S0FA 2PLV3 1IAWA 1VBA1 1W6MB 1N1YA 4PQ9A 3DTKA 4CDQB 5AC91 5L36A 4A3XA 1CX1A 4TV7A 5TJJA 2ARXA 2DFFA 4II3A 4LK7A 2JDUA 3V8JA 3B3QE 3S1NJ 2OPKA 3T0YA 1IV8A 1G8WA 3I2FA 3KCYA 3B01A 3JTGA 3W20A 1IDYA 1W04A 2L0KA 1XX5A 4AWXB 2Y0IA 4I0BA 3NMBA 1RJ7A 3WG1A 1WMDA 4HXCA 4R9BA 2E35A 1KXGA 4E7IA 5F9TA 4EVIA 1QNYA 1VJ2A 1TMF3 4LLFA 3ILNA 4S2GA 5ACA3 5FXWA 1GV5A 3C7GA 5F5QA 1XE8A 4P96A 3WTSC 4RGGA 1VBB3 1JGGA 5CKQA 4HK9A 3FBNB 4IGOA 4IEOA 5B1BH 2JIGA 4W6YA 3WZ1A 2IXJA 2RREA 3M3IA 3CL1A 3ZDSA 5DV5A 4CU7A 2QQMA 1LE8A 4ASLA 4WX9A 4COYA 1IS6A 1MSFC 2TEPA 3MCZA 3OBTA 2K9LA 1HN0A 1DQ4A 2FDJA 2RMU3 4LMFA 4KYWA 2ZGPA 2X05A 2Q8KA 4LT5A 1MBJA 5JSRA 3UR3C 2Y26A 2NOGA 2VQTA 2EV6A 3ZQHA 4EGYA 5JOZA 2W57A 4ENNA 2VCAA 3AX4A 2X5IA 3A4UA 2IVIB 1GP4A 3W9AA 4LIUA 1I50J 2R0FA 3OYDA 3HPGA 2D6LX 2PQ8A 5C4JJ 1ZRCA 3CCMI 1U9OA 3F0CA 1F1ZA 4BEHB 1CJPA 1RUJ1 4RM3A 3LSKA 2R7OA 3GFMA 2AO9A 3N9NA 5FLMJ 1NLSA 1NE6A 5DDJ3 1ENHA 4U0YA 1E5SA 3Q0VA 1EV13 4IUGA 1WCKA 2UWMA 4QKNA 1EA3A 2CYYA 5HS9A 1D0XA 2D3RA 1JS9A 1N3OA 2ZXIA 3ZXAC 1H6YA 4P9YA 5FO5A 4AUXA 3FZ3A 2L4MA 4UVCA 1IRXA 3U4XA 1Q1HA 4MHUA 5C5UA 1G3SA 2ESNA 2VCMA 4E7ZA 3NAPC 2YR2A 3M8FA 2I2SA 1WZXA 2YROA 2XC7A 4QQLA 1NHAA 4IW3A 4DNCA 2JXAA 2VT2A 3RKWA 4RFT0 1IRGA 4XBQA 3WVJA 1WA6X 2DCTA 5CFDB 1PHMA 3FBYA 2W84A 4FO9A 2O8KA 3BPVA 1ZLKA 3O8HA 2BNOA 5A3TA 1KONA 2WN2A 5CVJA 1R1A3 3A0BC 3CMMA 1RVF3 4DYCA 1FP2A 1S4CA 1R22A 4HPKA 5EEAA 3ERED 4LOCA 1MZEA 3MW3A 3OSGA 5CYYA 5CFDA 1WH5A 4Q4Y3 2WB1A 3GFJA 2QF7A 4B09A 4FASD 6PAXA 4E8CA 3CJIA 4A42A 2EZLA 4XDPA 5CBLA 1ONVA 4XFHA 2J1SA 1YOVB 1J2XA 1KS4A 2K0GA 2NVYJ 4J25A 4I7HA 4CDWB 5KXEA 2QCSB 4Z07A 4HQMA 3WF0A 2W1UA 4FOVA 3JBG1 5FDBA 2VBWA 1QHHD 3NKGA 4HSLA 1ND3C 1UOJA 1QGLA 5GZGA 5FAXA 1W0NA 1R5ID 3BTCA 3C7JA 4XUNA 2VD7A 4M3BA 4BBSJ 3AZZA 2Y33A 4P5OA 4FQGA 3O1TA 1G9FA 1X2MA 3KWVA 5LY1A 2OCEA 1MNDA 2HQAA 4J19A 1D8KA 3T0BA 3MIFA 2P7VB 4BJ6C 1S2KA 1S7OA 1WJEA 2HBTA 3OPWA 2MC3A 4Q26A 1ON2A 3CLOA 1OCZH 2GXAA 2XQRA 3OY8B 4YVSA 1JZ3A 5HDNA 1UMQA 3TP3A 4RHV3 2VBZA 3N36A 1R081 4PF5A 1C8M2 1OKQA 1CZVA 1ETVA 1VMFA 4D6RA 4UF0B 5FYBA 2H1LA 3AG1H 1REFA 5IYYA 1N78A 4KG8A 1X2NA 3ASIA 3CCSI 1JZ8A 1UD1A 3VYSB 3HM5A 3BR0A 4YIRX 2VOXA 3R05A 4NROA 4YG2F 4IV3B 3S7IA 3KZZA 4LHKA 2JQ7A 4Q1RA 1MJAA 4XL9A 1OCOH 3LB9A 2NNNA 3ABMH 4XNFA 3TQNA 2JN6A 4KJZA 2GM4A 1QH7A 2BW3A 5C3PA 5E1ZB 4AVCA 1LQ1A 2EQRA 2E26A 4QWQA 3CP8A 2FMLA 4QX2A 2WY8Q 1DPUA 1ZZBA 2LKXA 1C5IA 4I3PA 1VQ4I 1RITA 2XJRA 1NY71 1ZR4A 3O3KA 2D5VA 4I01A 3IKVA 3DLAA 4FPCA 1PGSA 1POV3 5GAGJ 3NNMA 1YQ5A 2VQLA 4DUVA 1SG3A 1VZ0A 2VPVA 2V72A 5FZKA 4A7KA 4L9NA 5K7FA 2GNTA 2P1BA 2PHRA 1KFXL 1W99A 2OZJA 3I3QA 5FPUA 2BPA2 2LBFB 4YZ2A 3PO2J 4QPIC 1SVMA 2VI6A 4XK4A 1VALA 5C3OA 2LR8A 4CGZA 1FNZA 5F6FA 3NAPA 1MZFA 5FJHA 5CJ9A 2NYYA 2ZMEC 5DAWA 4UBGA 2LF7A 3PNTA 4AYBA 1RMU3 2E60A 2LS6A 3WEZA 3KVAA 2KDZA 4B29A 1GVDA 5T5JA 1V4RA 2XUEA 3T5XA 3EB7A 3C7HA 5JAXA 4R9AA 1WJ5A 2WLPA 1MBKA 2JB8A 3B69A 2FNAA 1QQP2 4XAAA 3IV5A 1Z78A 3HGYA 3KF3A 3JAMK 2BXYA 1BK1A 3MQ0A 1JHJA 1OA4A 2GA2A 5FZGA 3KHCA 2DUOA 1HKDA 2LMDA 2M7AA 3DXJF 3MVPA 1HB4A 4A6DA 3LGRA 5FY5A 1W9TA 1ZRRA 1T2XA 1ND3B 3KGLA 3ZQLA 3MN2A 1UY4A 2VJJA 2J5OA 4Q4X2 3OGGA 4RGUA 1OC1A 4JOMA 3N9OA 2WRAA 3AZVA 3ELNA 4OIPF 2BZDA 4HN0A 4H55A 3NWKA 2QZ8A 1Y8RB 1G9CA 1MS9A 1Y8QB 4ABZA 4LO8A 3GJAA 1FIAA 3BG9A 4A3ZA 1Q8OA 1VBE1 2QQUA 4GJZA 4FE4A 3UJQA 1W2UA 1ND3A 2PLYA 4GKXA 1P4WA 3D0SA 3AL6A 2CUZA 5JXGA 4RGXA 2WFF1 4CCMA 3FISA 2P5KA 5J40A 5CKTA 2FBIA 4PI0A 1ULCA 2UWCA 5B4XA 3BY6A 4Q0VA 1E3PA 1H1MA 4JQFA 4V2WA 1BBT1 5F7UA 1OD3A 1BR2A 4RQPC 1B8IA 5IYDJ 5K0UA 1BQPA 4DOUA 2LREA 4AVTA 3LIHA 3OB8A 3HD8B 4EM1A 1W39A 2C9AA 1ASJ2 1W3XA 5DXDA 2NZ9A 2VTXA 1AXZA 1VBC3 3KZYA 1QJU1 2Q8OA 3GCMA 3DKQA 3QBQA 4P02B 4I98B 5JR7B 3WP6A 2ATFA 5L9BA 3AZYA 3TW7A 4PHZA 3BU7A 4D6SA 2Z1DA 1Z21A 1MVQA 5FO8B 5J09A 4WXHA 1WBFA 5IT9K 5IVJA 2EAKA 3V56A 5LGUA 1WD4A 5BNOC 2R042 1ZHFA 4HETA 3S6PA 2XAJA 4WXCA 3MHZA 5J47A 1XSXA 3RI4A 4AL9A 5LEJA 3LA3A 4DEVA 1MMSA 1CIYA 4RB1A 5FMBA 5CVUA 5FV3A 3H3VK 5F2SA 3ZR6A 1TE1B 4R1HA 4NIIA 2NPIA 1WLWA 4GB31 1PUEE 3J26N 2VC0A 3VBUB 4F3QA 3CCQI 1XOYA 3ACIA 1R1UA 1PM7A 3KQRA 1WMXA 2ZMEB 1UIJA 2ZJ2A 3OJBA 5D8AA 3PVNA 3RJRA 5IAVA 3S1RJ 3UGHA 4B47A 4QPIA 2KFDA 1LHVA 2DXIA 4C2UA 2D5FA 1UWWA 5A3MA 1MD0A 3AFHA 1AL21 1POQA 1GV9A 4CA0A 1K45A 1ND2C 5K8SA 1XDUA 4NQWB 1F4AA 4KMFA 3M4FA 1YJWI 5H2FC 1UCXA 3NV2A 4OLLA 3MKLA 3DEWA 3DPTA 2PN6A 1QJY3 1Y39A 1SD6A 4CH7A 3HL2A 3S32A 2CW0F 2CUEA 2WT1A 4UV9A 3LDBA 1LOEA 2ZB9A 4K3UA 4L9BA 3ABLH 4YFWA 4HKWA 5BPIA 2JWPA 3MLJA 2LDUA 2PHLA 4Z2WA 3LOCA 2R073 1YRNB 2RG4A 3GZTB 1E57A 4KN4X 2Z3YA 1E5IA 2JICA 1C3HA 1HDPA 2AH2A 1VRH2 2ZX0A 4AC0A 4BHPA 1R1ZA 1AHSA 2P37A 1DLCA 3J8F3 4MXVA 3ZFGC 1ZBA3 1SPPB 5LFAA 2NMOA 1V9U3 2XPUA 1YW8A 4A5NA 1YRNA 2KDOA 4A41A 5C3RA 1JT0A 3CUQC 2VQHA 4N4NB 3SQOA 3WTXC 3CF2A 3NKTA 4UUVA 4AHZA 1CVNA 1F5TA 1MS8A 2KQRA 3W59A 1FV3A 4IQJA 1RUF1 5L7OC 1H2LA 3PIOF 5DUKA 5FY8A 1SPPA 5JI7A 2ZKLA 1UJ8A 3BG7A 2CSGA 2COBA 4LO6B 1SHWB 4IGQA 4DS0A 2IPQX 1GZCA 3F8BA 4RQPA 4H2AA 1JZ7A 1DGRN 4K1ZA 1Z91A 5BPXA 3EDPA 1FPN3 4BH9A 4AFDA 4OQ8A 5JFRA 1SLTA 1H9GA 5M0TA 4UFMA 2YGLA 1CR7A 2JG9C 4XACA 1W8FA 2CWMA 3MIEA 4HONA 5IT3A 4XKBA 2B9VA 1SEFA 1MBEA 4IPAA 4DNYA 1LRHA 3RQ0A 2OKXA 4LE3A 1QRYA 2HPIA 1PVC2 4DW6A 4NMIA 1F15A 1YS6A 4IEPA 4XKCA 4OUSA 1H9PA 1WRJA 1HKSA 1BMV2 2V6CA 1YITI 4J1XA 1W06A 4Q5OA 2Y6LA 1E5RA 2HR3A 5F64A 5BNOA 2ES3A 3MUY1 1KJRA 4IJAA 2X6OA 4XRMA 5B66C 4NIAA 4COZA 2VH9A 4UFJA 4NHYA 5A7WA 2VXZA 1XSDA 1QWRA 3JB4C 2HVQA 4XF0A 1W90A 4UNOA 4KBZA 4QX7A 3OYLA 4RM2A 3IT8A 2A05A 1TT0A 4O3MA 2C0ZA 1PO11 3EMRA 2ME0A 2DFHA 1KU2A 3DFGA 1OQYA 1JYCA 4URTA 2STTA 4BISA 3Q3SA 2LY9A 5BNPC 5KHIA 2HXOA 4IERA 1AOYA 4A0YA 2ZGUA 5H6RA 2PLV1 2VUAA 3BTLA 4O61A 2D6MA 4OI0A 2A71A 1LECA 4MOAA 1ND2B 1X3UA 1N1VA 1UG0A 5CG8A 4RL7A 2IA1A 2PYTA 4IRGA 3H9AA 3I2OA 2NXNB 1R4NB 4AE2A 5CU1A 2YC0A 5DPNA 2FQ3A 2JSPA 3BKZA 4PJLA 3OY9A 4ZPIA 2BE5F 1UMHA 2YUEA 2DBIA 4PFPA 4PJYA 1I5PA 1VBD3 3WG4A 3H35A 4YZ4A 2BV6A 1ND2A 3K3NA 4P9WA 1XN7A 5KXDA 1LJ9A 4NHMA 1TMF1 3BWGA 4DJAA 3S1QJ 5ACA1 4G6TB 1SACA 3N7LA 2JT1A 1LB2A 2XF6A 4DRRA 1VBB1 1LEDA 4BBRJ 3I56I 1GWMA 1DQ1A 4YZ5A 2GIVA 1EF4A 4R4XA 3AM2A 4Y5TA 1UYXA 4LBKA 3AJYA 3F21A 5DUWA 2FQPA 1FX5A 3ZFGB 4ZYGA 2BOJA 4G94A 2IJLA 5FP3A 2VUDA 5D2AA 1VQMI 3IBMA 2VPRA 1TTYA 1CAUA 3CUQB 5D8LB 1QMJA 2VOKA 3ALQA 2GN7A 1EH8A 1RINA 2DK5A 2ZGQA 2RDRA 3VZJA 4UWDA 2D6NA 4U88A 1Z3YA 3OR2C 1Y7BA 2ZTNA 3O2PE 1OXCA 5L7OB 4QGNA 2CQKA 2R061 1JGSA 1SQ4A 2HQ5A 4UFLA 3KFWX 1MIJA 2WYFA 3R4UA 3NJXA 1NG7A 2K9NA 2E34A 3WTWC 1J3RA 3CQOA 5FYIA 3KQ4B 3K4KA 3ZMNA 1IGOA 2P4WA 5A1AA 4U0WA 4Q4ZF 2EALA 3ZOIA 1U8BA 1V6LA 1LVKA 5GZFA 1T39A 4JCKA 4HA8A 3HJEA 5DDGA 4KQ7A 3HT1A 2JG9B 1EV11 4B7KA 1M06G 5DAVA 2Q2EB 4COWA 4Q4W3 4JC1A 3R4DB 1X1AA 5E8IA 2F4LA 4NRPA 2PFBA 2JECA 3L00A 2QFEA 4LBJA 1DQ6A 1BVP1 3MYXA 5FYVA 4XRSA 2ELJA 4E4ZA 4E7HA 1UKGA 1AR73 4XKWA 4DBRA 3P9CA 1ZVFA 3OYBA 5F2WA 4MO3M 4YZ3A 3FC0A 3B94A 1W7PB 1RHI3 2Q2EA 2EZKA 2R1DA 2WN3A 5A6ZA 2R5ZB 3JXSA 4FAGA 2IXSA 5FJKA 2KIUA 2ZNZA 3CDHA 2ZGMA 2D93A 1JKRC 2ZHNA 5A3OA 5D5XB 3V4GA 5A33B 1J1TA 1NZIA 4FX4A 2ZJCA 2RR13 1UIKA 2O8XA 5J37A 4EATA 1R1A1 1RVF1 1JMUB 1KGYA 5ICFA 2LC2A 2Q30A 2CV6A 5A1LA 1SLAA 2YU3A 5E1XA 4O5VA 3FXUA 1F4HA 1ZZ8A 3CO7C 4S0HB 2R0QC 4MXWB 1UG2A 2Y6FA 5FZ3A 3AP7A 5A33A 4LB5A 1T6GC 3ZXFA 2JDZA 3OYEA 4Q4Y1 2GDFA 1XSVA 3I3BA 3VKFC 2KA3A 5JIUA 2IGNA 3E6DA 3W2VA 1WCMJ 1IN5A 5HCHA 2YPJA 1XGSA 3PTYA 1T8IA 3WT3A 3T8RA 4ITVA 5FRMA 4XN3A 5HNFA 1FI2A 2UWBA 5A32B 3APBA 5BNPA 2YXSA 1RKWA 3KVBA 3TKYA 3W21A 4YRDA 2Y8KA 3J81Z 3THTA 5F08A 5I0UA 1D4M3 4D7NA 4MGIE 4M0HA 2WBMA 5LGTA 3U4SA 4PGGA 5JIAA 2XDVA 4AQTA 2EB7A 1H0BA 4C2MJ 1YIOA 1CAVB 4CDUB 3VSLA 3BTJA 1NYWA 3GTLJ 1O4ZA 1FEXA 1UZYA 4ASMB 3A02A 4AQ6A 2E6VA 2EWNA 4JX5A 4NIHA 2F6CA 4JP0A 1OYYA 3BGAA 2QM3A 1OUXA 1NT0A 3BTAA 3ZIXA 3MV11 3IDBB 2V26A 2DFIA 1U5XA 3I4PA 4K6BA 2QQBA 1D5YA 4W50A 3KHBA 5FJ8J 5HOOA 4AM3A 4YM0A 3TBIA 1YFUA 5FKBA 3OUJA 4KBBA 3TO9A 2OQ6A 3G1LA 1ZA4A 4GJYA 2YBKA 1WI9A 3CKHA 4RHV1 3T09A 4PK4A 4JX0A 1BCXA 2ARBA 3GDBA 2A5YB 5DMYA 3LQRA 1KU3A 1RUD2 4RGSA 4QXHA 3PVEA 3I5UA 2WS92 3Q0WA 3OSDA 4ITCA 1X1DA 1DZQA 4QKBA 4HBNA 3PFYA 2XOMA 3QPLA 2CAVA 5LGNA 1GP6A 3QYFA 2DOFA 5KWRA 1FWZA 2OV7A 1WWYA 3F72A 3D6EA 4XR6A 4LBNA 4BQAA 5ABJB 3M2MA 1DU6A 3CZUA 4N0BA 1NQDA 2JB4A 1MACA 2WWUA 2KRCA 1QKQA 4QD2A 2WB1N 5FZOA 2VULA 2VB6A 3KIOA 5JVTA 1UXZA 1APNA 2XF5A 3M70A 1RETA 5BS6A 2DVFA 4FX0A 2VTXJ 3J81K 1SMVA 4XRSG 1FMD3 2PAKA 2ETHA 1ZGJA 4LA3A 3H3UA 3ILFA 3DEUA 4HPQA 4HKOA 2AC1A 3EETA 3ZN6B 3WNNA 5CZKA 1QXJA 1XE0A 2VKDA 3DKYA 2WTEA 4N7UA 1S3JA 4RS8A 1HQCA 5JXJA 2WNUA 3T2OA 2JA2A 3F95A 1HF0A 4XUQA 2AEZA 1IUFA 4DO0A 5C44J 3UNPA 1PO21 1JHNA 1F9KA 1M4WA 3J7AO 1ERDA 3K4DA 3S5QA 4KWKA 1WCQA 3AL5A 5J7MA 4OIQF 3WU2C 5EYYA 5I0DA 2XJQA 2HNHA 3ZMUA 4AQ2A 1HV1A 3MV01 4JK1X 1BK0A 1RUC2 5KR7A 1REEA 1WKMA 2VE1A 1UZCA 5E3OA 4WZCA 3WX5A 2D6PA 3ZQ7A 3PUIA 1RMU1 2GALA 1P4XA 1GLNA 2RS33 3HAGA 3BCBA 4AOCA 1FLIA 2E7AA 3SQNA 4V2FA 2XVLA 5HDGA 3NV4A 2VLAA 3PTRB 1S1AA 5JLXA 1JOBA 2CU7A 2WQ4A 1F5FA 5JSOA 4IV1C 4UYBA 1PUFA 1IG7A 4XCBA 1BIAA 2WT2A 2X85A 2A7AA 1Y4WA 2VM9A 5EJ1B 1J7KA 1CF7A 5BPDA 1OUSA 3VBOA 1A6QA 1O7LA 5LHHA 5BMZA 2HBUA 4BIFA 3ABTA 1AYM3 4GMP0 2BZTA 1VQ6I 4GYGA 1MSEC 5EGOB 4J6GA 3TEXA 3WTUC 2DA1A 3SHFA 3HPNA 2B46X 5IY5H 5FXXA 3IDCB 2D6KA 3ZFEC 4Y20A 1RB8G 4DY3A 3GTKJ 1YO8A 4CSWA 2HWD3 1D0YA 2VZ3A 2PHTA 3OIOA 5A3LA 5FZ8A 5L3DA 1X8MA 2AGSA 5EGOA 2VKEA 4RA0A 1IN4A 2RAEA 4Q0UA 1YYNA 2ZOEB 2XBO2 4Y22B 5F0HA 2LY1A 1VPHA 5FZMA 3CC7I 1GZWB 2EIBA 4JGYC 4XJZA 1RUH3 1O4TA 4XETA 3V7RA 3RYKA 1FTZA 4AYBN 1O4YA 1PGW2 2MABA 5FLXK 4BQYA 3PIJA 2QQOA 2ZAAA 4Q0QA 2KR2A 4LG0B 3S3NA 3HNMA 4A6SA 2HKXA 2KKOA 1HRV2 1KQRA 2ZMNA 4HG6B 3RZZA 4PLNA 4M00A 1V54H 3M3OA 4PDWA 4NHJA 2P3JA 3ZPOA 2Z16A 1DCSA 5D4SA 2X1CA 4KUMA 1P6RA 5A6YA 2DTYA 4AF9A 3T8TA 3EBRA 5FMDA 1FNYA 3EHKA 1IJWC 3QYBA 3V8LA 3LQQA 1ZREA 3OPZA 4JRAA 4OHWA 3MLKA 2CQ7A 3LSHA 2DFCA 5DUIA 2EXJA 5DD8A 3ZRGA 4Y4RA 2W39A 1XJAA 3KD4A 3V65A 2V9PA 1ULFA 2VQAA 4XFGA 1QJX3 5JUVA 4I02A 4R8HA 5CVRA 4WM8C 5FPLA 5CLSA 2ZO4A 1KGSA 2OS2A 2XJUA 1VQ5I 3GBWA 1MQTB 2ADUA 3T2PA 1QNWA 3IP4B 3WF4A 1UU5A 1OLTA 3UETA 2OA2A 4Y17A 1W0OA 5GKAC 2FHRA 3K9TA 1UU6A 3HQXA 1WBLA 2OUJA 4ZYDA 3EO6A 3O6BB 1BI0A 4R4ZA 2GP5A 2HKOA 3JRIA 4XFIA 5M5WJ 3IKTA 1GHCA 2OA4A 2BHZA 4LLLA 5E17F 4D7YA 2O14A 2ZHKA 2DJNA 3QQAA 1OCCH 4AVBA 5FYTA 2ZGSA 5CVIA 5DUUA 2Z9OA 1Q1VA 1W7PD 2FOKA 5FK8A 2L9SA 4OMYA 4IV1B 5JXIA 4ZHNA 2DF7A 3T30A 3CF6E 3AMMA 3OYWB 1OA3A 1QJY1 3V0BB 2W00A 1MNEA 1K61A 2L4AA 3L2UA 3AKQA 3U9GA 3M1HA 1J83A 4IEYA 4L8QA 4P9UA 3WR0A 4I99C 2F5EA 1X33A 5C7GA 1HDKA 2R071 3I58A 1C4RA 3ZFEB 1FPQA 4Q4V2 4AAXA 3V0BA 4XBLA 4K20A 1LOBA 2HWB3 4XJAA 3WW4A 2QKLB 1SCSA 2IXLA 4PIZA 3SH4A 3EQEA 3J8F1 2DK8A 1UYYA 1HSJA 1ZBA1 1RESA 5ISLA 2UZKA 3ZR8X 4KDPA 5JMCA 3LCPA 2XAQA 3K1NA 3ZMTA 2IAIA 3AMNA 2TRTA 4IEWA 4JGYB 2DDBA 2YX4A 2LK2A 5EXOA 5HCFA 2Y60A 1F9NA 3DEEA 3AKRA 1XGOA 5F1JA 4R79A 4CCOA 3SFZA 5IYCJ 1G4DA 2RN7A 2ZBKA 1IN7A 3MI8A 3PNVA 3L2RA 4QKDA 1OR7C 1MMAA 3BTIA 2E51A 1POV0 1W8ZA 1X1BA 2L7MP 2HOSA 2W48A 4IXAA 4RR3C 3RMXA 5EP9A 5IJRA 2LVSA 1MPXA 3RNSA 1FPN1 1SFPA 4L9JA 1ZGWA 1DQ2A 4BQ4A 3WG7H 1AR62 2PMHA 2XVKA 4OHXA 1X36A 2AREA 3GHMA 1K6OA 2FBEA 2B39A 4FOQA 3WOGA 4ARYA 2JDMA 3AYEA 4Z2AA 1JN2P 2VL4A 1HQLA 3AXDA 4M3EA 3H50A 1HSTA 4LR4A 2L7KA 1UMIA 3I54A 2OYZA 1YXWA 1XQNA 1M1EB 1GQPA 1ETQA 2HWE2 2JDAA 1LOFA 2VGDA 3SCGA 3TEYA 1L7RA 3MEXA 2QCOA 4FI9A 3LL7A 3QRFF 3VL9A 5FZ7A 4YW5A 2D1VA 2YFUA 3TEWA 4EJVA 1ULEA 3U1KA