1C3HA

Acrp30 calcium complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
137
structure length
137
Chain Sequence
AYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30 KD ADIPOCYTE COMPLEMENT-RELATED PROTEIN PRECURSOR
publication title ACRP30 calcium complex
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 24
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c3hA00
2JG9B 1GR3A 2RE9A 2KA3A 1DU3D 4N90A 4DOUA 3B93A 2R6QA 4TWTA 4E4SA 4G3YC 1O91A 2RJLA 1XU1A 1U5ZA 4MXWB 3LKJA 1A8MA 3FC0A 4RSUA 1D4VB 1OSGA 2JG8A 1C28A 4OULA 3URFA 4OUMA 3B94A 4G4FA 2HEYF 1PK6C 4MXVA 4QQ2A 4D7YA 4QQOA 5KC5A 2QDNA 2HEVF 2WNUC 2Q8OA 1PK6A 2WNVB 2JG9C 3L9JT 4EN0A 4GIQA 4E4DX 3K48A 4MSVA 2JG8B 3TYJA 2TNFA 3ALQA 1U5XA 3V56A 5TSWA 1WCKA 4NN0A 2AZ5A 3TWIA 5HBAA 1XU2A 2JG9A 2TUNA 2ZPXA 2R32A 1D0GA 3QD6A 3QBQA 5BNQA 4QQPA 2Q1MA 1D2QA 1KD7A 1U5YA 4MXWA 2O0OA 4HT1T 3ME2A 4KG8A 1RJ8A 2R30A 2RJKA 2E7AA 3AB0A 2WNUA 4KGGA 1RJ7A 1JTZX 3WD5A 5L36A 2WNVC 5CIRA 1S55A 5KC6A 1OQEA 1DG6A 1TNFA 5L19A 1TNRA 4QPYA 1ALYA 2ZJCA 4J6GA 2JG8C 2QE3A 2Z5WA 5KWRA 2OIIA 4F3JA 3K51A 1I9RA 4TSVA 1PK6B 4QQLA 1JH5A 2WNVA 4QQHA 1IQAA 1OQDA 4DB5A 3B9IA 2HEWF 3MI8A 2X29A 1KXGA 2WNUB 1C3HA 4OUSA 4KGQA 3IT8A
chains in the Genus database with same CATH superfamily
3ZYFA 2VMIA 3VKOA 1L7RA 1RUF2 3EBRA 1X8MA 3OBRA 1MS0A 1VBD2 2BNNA 4NHXA 3USUB 2FMYA 1AL0G 2VCMA 5EQUA 5I0DA 2XBO1 4QPGA 4DS0A 5EWSA 3VHPA 1O59A 1SLLA 4QX0A 2RDQA 1UNBA 1VBC3 2XR4A 1DGRA 3A0NA 5DQ0A 3TN91 4SLIA 3N9LA 2D97A 3FUOA 3W5NA 2Q30A 1GOGA 2PHFA 3PTRB 1GANA 3A0KA 2W2IA 1SBDA 4R9DA 2WUHA 4Y4RA 4OQ9A 5F5IA 3PVNA 1CAVB 2B8MA 5HCAA 3R4UA 4UYBA 4FXGB 3O1UA 3T0DA 3ES4A 4CEYC 3TN93 3E5XA 5CFCB 3W9AA 2WL1A 4LO8A 1LRHA 3OUHA 2ZHNA 4HSLA 3ZN6B 3CZJA 3T1MA 4E8DA 1SQ4A 5EP9A 2DVGA 1QHDA 3OPWA 4BLIA 4XDQA 4Y1YA 5BV6A 4O61A 1ND3C 2ZEWA 1X36A 2ZXQA 3VBHC 4UOJA 2XUMA 1UOJA 3SQOA 4I3GA 3W5MA 2GP3A 1H4GA 3VZJA 4GALA 4JHTA 3QH7A 1QNYA 1V00A 5JOWA 4XJZA 3O1VA 4D6RA 1OHFA 2LALA 4NAOA 5GM0A 5LRRA 2WQ4A 4RGAA 5TSWA 4LO6B 3TNPB 5HV4A 1FV2A 2C9AA 1V6NA 2ARCA 4Z1VA 2B42B 2D44A 4Q8LA 4ATFA 3MPBA 2RVAA 4Q0SA 1DYPA 3MBWA 4NPLA 1UF2C 4QQPA 4P9JA 4NIIA 1COV1 1DQ2A 1CIYA 3VKNA 3MFAA 1D2QA 4GQ7A 5ISLA 1RUI2 2VNRA 4N43B 3LSEA 5LZ6A 4OI2A 5C3QA 3GJAA 1MS5A 2A75A 4JTOA 3IM0A 4UFHA 3MV11 4XPVA 1JYCA 2WR9A 3VZKA 5K0UA 5I91A 2HYXA 2Z2SB 1RYYA 1UYZA 3FLRA 1JN2P 5FBJA 3ZLIA 4UFMA 1F4AA 2RS53 1RJ7A 1N1SA 3RRDA 1DQ4A 1JTZX 4AVCA 2DVFA 3V0AB 1Z7S1 3P3NA 2SBAA 3KV5A 1OQEA 4J1XA 4FBFA 4IL7A 5T3NA 2ADEA 4FQZA 5AVAA 2QE3A 4GH4B 5LWBA 3ACIA 4BLJA 1Z7S3 1A3KA 1YJLA 3CJXA 3O0XA 1GICA 2BQPA 1VMJA 3LGRA 1K5JA 5F3IA 1Y9QA 3JZVA 1S2EA 4YFWA 3RNSA 4IE7A 3BB6A 3I2DA 4O9EA 4A41A 1SMVA 3E5QA 4AG4A 1Q8VA 1W6MB 4WM8A 1WA6X 4UFLA 4QDQA 2C26A 1W9FA 2VAUA 3H3UA 2D93A 3THCA 1OVSA 4A4AA 1AXKA 5FP3A 2VZQA 5SV8A 1W8ZA 4YW6A 1RUF1 3AKTA 3ZDSA 4AXOA 3AL6A 4W65A 4NR1A 1JMUB 3VD9A 1PNFA 2JEMA 3VD5A 4AW7A 5FYIA 1A8MA 1UPIA 2Y6KA 3N9MA 3NJZA 2A6VA 2GMMA 2UURA 3SCGA 2J1UA 2XJTA 1RUF3 4XABA 2CYFA 4IEZA 2P6CA 5L9BA 3SH3A 3WDVA 5G04L 2XL7A 4WM8B 5FP8A 3M3CA 1AF9A 1EPZA 1Q8PA 2XVKA 1T6BX 4Z2WA 4K20A 3DXUA 5C3OA 2ERFA 2R1DA 2KXLA 3M1HA 4RFRB 4YZ3A 5J36A 3O1RA 1GWLA 4BISA 4KG0A 2V5YA 4ISRA 4YVSA 4Y5Z0 2HEVF 4LK6A 4D7SA 2FDHA 4Y22A 5CA6A 2WNUC 5L9VA 5BNNB 1ZRRA 5EV7A 2WNVB 3OGRA 1H8TB 3AXEA 1R091 4I09A 2WDBA 3ZYBA 1Y9MA 4XJ8A 3APBA 2Y6HA 1TZOA 4NIGA 3ZYJB 3ZN5A 4P9YA 2VZ1A 2DV9A 1R093 1AYN2 1F31A 1OH3A 1RXFA 2JG9A 2RS31 4XFIA 5GLUA 4OI0A 3M70A 1UPSA 5FZCA 5LA2A 3VL8A 3K2OA 1XC6A 3M3QA 1RUG2 4YVSB 4NPRA 3RI8A 2OKXA 3VBOA 4Y22B 1KRIA 2GN3A 4OHXA 4E4ZA 4H3WA 2RS33 4ONUA 2Q1MA 2TBVA 3B69A 1ZBA1 2XDVA 4AEKA 1MR5A 3H8XA 1WLCA 4F7ZA 3BOWA 3IIIA 1VBA3 1DQ1A 1X7NA 1FNYA 1UQXA 2YY1A 3N7KA 4EWDA 2RJKA 1RUI1 3VDDB 1QJY2 3MW3A 3OGGA 4P9IA 1ZBA3 1XE8A 3SCFA 1XYPA 5DZEA 5L36A 3CDZB 5IK7A 2YC4A 5DUXA 3SMHA 3SEPA 5L9RA 4YFZA 4BMEA 5A3WA 3WHTA 3HQRA 3VBOB 5KXBA 1JYTA 2WWSA 2DCJA 2YPDA 4IV3C 5JSPA 1DDLA 1PK6B 4RA0A 2BUKA 2DTWA 4AEMA 2Y64A 4BQ4A 3ZR5A 1R1ZA 1IS5A 1W2TA 1HW5A 2D40A 3BVCA 3WUCA 4MUVA 1GUIA 5BY5A 1D2SA 2WFF2 3KQRA 3OYWA 1OH4A 5A7SA 1FOD2 1W8TA 5FQ0A 2AUYA 3KHCA 4LEJA 1UKGA 5FLHA 4YM3A 4ZZ8A 1U5IA 2WN2A 1O8PA 4CP9A 4N43C 2OPWA 1XJAA 4MVTA 4QGMA 1GZ9A 4Q4Y1 4ZS2A 2ZGNA 1TMF1 4QMAA 2HWE2 4Z92B 4K1YA 3NNFA 2PAMA 2XWJB 1WMDA 3WF2A 5FXVA 4AI0A 1NQJA 1PVC3 4KQ7A 1RVF2 2AH2A 3TBDA 4M4PA 1P8JA 1UN1A 4LE3A 3E1F1 2VMHA 3IDAA 3OEBA 4Q4Y3 2WO2A 1TMF3 5FY8A 3RYPA 4DY5A 4HK9A 1LESA 5F39A 3O1OA 3KF5A 2F4LA 5FQ0B 3AZWA 1RITA 2XVGA 2X53S 4LHNA 1IOAA 4GH4C 3URFA 3HWJA 1ZRCA 4HXCA 1QMJA 5KXCA 3AYDA 1YYNA 2NZ9A 2VZPA 3GCXA 2ZAHA 4E2SA 1O5UA 5C3SA 3VBRB 4GB32 4AQ6A 2HWD3 1JI6A 3POBA 2VOXA 3FLPA 2E33A 4QQ2A 5FZBA 3ROUA 1LGCA 3PUAA 5JDBA 1W2NA 1YFUA 2Y6FA 5T50A 1WCSA 3WXPA 4YG0A 4YW7A 3PLQA 4IGOA 5FMOL 3AZZA 4FPKA 2BV4A 2ZGRA 2ZS6B 5FYTA 5A3OA 2ZHMA 4LULA 1QIQA 2BBVA 4URTA 1S0CA 3K48A 3O1TA 3NAPB 4PT6A 1JHNA 1REFA 3MW2A 4LIUA 3GZEA 3UYJA 1H9PA 2EXKA 3HVDA 1XOYA 4K40A 4L2NA 3BTXA 5B2GB 5GLVA 4N53A 2HWC2 3J7NA 4BYYA 1GLHA 2WWJA 2ZEZA 4QAWA 4QHOA 1RUJ2 1HLCA 5LY2A 1VB4A 4BPZA 5JIUA 5LK7B 1QEXA 3AP5A 4IE6A 2VNVA 4NWWA 1JOPA 3A23A 4NO4A 1XQNA 2F6BA 2ZX0A 5EHDA 1WUVA 3M2MA 2WLQA 1MZ6A 1QXJA 1V9U2 2FCVA 1JZ7A 1PHMA 2YU1A 4RHV2 1OPMA 3EQEA 4ZKTB 1I6XA 1NUKA 4XFBA 1OC1A 3ZDVA 1LAJA 4P9XA 4CDXA 1RUG1 4H7LA 3GZTB 4CU6A 2VOWA 5CU1A 1R1A2 1SLBA 1WMEA 2A71A 3CL1A 4XF4A 1ZA4A 2DU1A 2GNMA 2CSGA 1D4M1 1DGRN 3NKGA 1HN1A 5FYBA 3U11A 3ZXJA 3LIGA 4MGSA 3V0BB 2NLRA 4DO0A 5BNNC 2DBNA 4L99A 2Z4FA 5LBBA 2WNVC 3LA3A 1H8TC 1D4M3 1QJY1 2JX9A 5J98B 4EE2A 2WAAA 4YZ1A 2WLPA 5C3RA 5FPUA 3VL9A 2ZGQA 2BBAA 2ZJCA 1OD3A 2C0ZA 4X8PA 1UX6A 4JGZA 3LFIA 3AKSA 4ASMB 4CCEA 4QT6A 2XJUA 3WF3A 3L2HA 4WM7A 2I74A 4FOYA 2WZ8A 4PI0A 4YGBA 2FDJA 1DYKA 4FFIA 4K6BA 1FPN3 2LUWA 3Q9OA 3BU7A 4CPBA 1ULFA 4RFT0 1SCRA 5IVYA 3NQHA 4OUSA 1KEXA 2YXSA 2R042 4IETA 4MHRA 1V6MA 3NNMA 4AEDC 3AZVA 2WFF1 4DEVA 3RWKX 3CO2A 2DCTA 3W59A 1FOD1 1K12A 5GKAC 1QKQA 1PGSA 5IFTA 1VRBA 1GP6A 1LHUA 2VPVA 2XHNA 3CBNA 3D6EA 3KF3A 2QKDA 2CWSA 1XRUA 3UESA 3E6CC 4JGZB 4RN5A 3J7LA 3POYA 1OKOA 3WDYA 5JUVA 5ABJC 1O91A 3PUIA 4HZFA 3JCIA 4WM7B 2XUEA 1OLMA 2G9FA 1U5ZA 1IPJA 4GULA 2ZGMA 1FI2A 5E89A 2DCZA 3WQ0A 1UY2A 3RGBA 4IEYA 2BERA 1YCIA 1AR72 1O4YA 3O1MA 3DPRA 3B01A 4TTGA 1RUD2 4UFJA 1DQ5A 4XFFA 2G4IA 4K3UA 1JOBA 3B94A 3U4XA 1A34A 4A3XA 1LOGA 3H7YA 1EUTA 3THDA 1PK6C 1W6NA 1JHJA 1US2A 4MXVA 3GNEA 4S2HA 1APNA 5DDJ2 4QHBA 1YFWA 2BU9A 2ORXA 3MPPG 3CEWA 5T5JA 5FZMA 5FXXA 3MIDA 2QBXA 4YYOA 1YO8A 3M3EA 2Z42A 2JE9A 4TXWA 3VBUB 3UT0A 5A3UA 4C90A 3J8F1 4GB31 4DIQA 4FFHA 2Q8OA 4DRVA 2RR13 2I2SA 1NG0A 2WYFA 3PVBB 3ZFEC 3UNPA 5DAQA 2ZX2A 1NKGA 1NA1A 1BBT2 2PHDA 4Q4V3 4Y4YA 5DXDA 1GZCA 4LBKA 4LITA 4HN1A 3ZM8A 1LENA 3J8F3 4GB33 4UT5A 4Q8KA 5IK4A 1FATA 2TEPA 2ZMKA 5A6XA 1VPHA 3RZZA 3DYOA 3ZXLA 4NN0A 1HRI1 2VZTA 5IVCA 4XF3A 1W6NB 2ID4A 1PGW1 1V6OA 4ZU4A 3VDDC 2B5HA 1H1AA 1ZBE2 2VXJA 2C5DA 2UU8A 3HT1A 4XW3A 2BTVC 2CGNA 1N3QA 2MEV2 1SHWB 4P02B 2HWC1 2GZWA 4XUTA 1EY2A 2B39A 2Y0OA 3FLTA 1YUDA 2IXKA 1RUJ1 1HRI3 4HSJA 1TQ5A 4XURA 4AYUA 3H1YA 3KS7A 4B7KA 3ZXFA 4OQ8A 1NA1B 1XNKA 2ZEXA 1Q8OA 1NE6A 1XBFA 2HWC3 4I3PA 4RHV1 5FZ3A 3VBRC 4MADA 3POFA 3EXUA 4C0BA 3BI3A 1F8VA 1VBE2 3PDQA 1QJU3 1X82A 4L97A 3ZXDA 4A6SA 2R30A 4DPNA 2BGPA 1LEDA 1WZXA 4YRDA 5JAXA 4XXPA 2HJIA 3ON7A 3LDBA 4K7JA 1VALA 2RS13 3H50A 5CYYA 2FDIA 1QU0A 1CPNA 2FCUA 3NAPC 4IUGA 1W06A 4AF9A 4BQ2A 5A32A 3O14A 2H0VA 2YV8A 4BHPA 2WO1A 2Q8CA 3H42B 4FCAA 2YB7A 2E7TA 1IKPA 5IW0A 3ZSJA 4F8AA 3B9CA 4LBQD 2WQZC 4Y24A 3VBSA 1Q5OA 3KV9A 2A6YA 2VMFA 3IAQA 3JB8A 1DP0A 3RSJA 4LBOA 1HKDA 3ZYPA 1DZQA 1F35A 4IV1C 5A3MA 4MOAA 3VD3A 1KXGA 4JKMA 1WA4A 1VMHA 2WT2A 3UL2A 5I8YA 2VOVA 1LJ7A 2RE9A 2VVEA 5FZOB 1DBNA 3HOBA 1PO23 4BXFA 4JGYA 1CPMA 4LE4A 1PX3A 2R041 5DUVA 2EXJA 2Y0IA 4CU7A 5K8SA 2A1XA 4CUBA 1SBFA 3OTFA 2F4PA 2VL4A 3R6SA 4G3YC 3ZXAC 2P1BA 2Y6GA 1CAUA 1T2XA 1IQDC 1GV9A 2A6WA 5FWEA 2VW1A 4HN0A 3FC0A 4AEJA 4LUKA 3WG2A 5HCHA 2H6CA 2ET1A 5C33A 3O12A 4KU7A 2PQQA 3L2YA 3R4DB 5KHGA 5JI9A 1QOSA 1SBEA 3ACFA 4HONA 4UBGA 4XUQA 4ZU7A 1VRH2 2C24A 3TNQA 1C1LA 4Q4X2 1AR71 1HB2A 1HJFA 1RB8G 1ULGA 1XNDA 1RUD1 4JGYB 2VH9A 1W6OB 1ULOA 1HXS3 4N7IA 5F2SA 3ORJA 3CJIB 4LHKA 4AQTA 2VW2A 3FE5A 4GWIA 4OYUA 3KV6A 5FYYA 3NL1A 3T0BA 4XOGA 2JDHA 4QKDA 3O1SA 1AR73 1W0NA 2QZ2A 2V4VA 3PUQA 4S2FA 4MGTA 5C8CC 2F17A 3UGHA 2R072 5F9TA 5FZAA 2RG4A 3ACLA 5FZLA 3T2TA 1GYKA 1OD5A 3MZHA 3I8TA 2JKXA 4JX0A 3V56A 4COUA 2AR6A 1ODNA 3RZLA 4JGZC 1OQ1A 5DMYA 5HBAA 1SLTA 1XU2A 1RMU2 2D3SA 4IE4A 4R4ZA 1NAEA 1QXRA 1H8VA 4DQAA 1CJPA 4YM1A 3FFZA 1JODA 2WQ8A 3MHZA 1SFPA 5IVEA 5A7WA 1IKQA 3THPA 2VJXA 3WDUA 5I0TA 4BQ3A 3B7MA 2NPIA 1AX0A 5LA0A 2ZGUA 2MEV1 4QB2A 4A44A 5KHKA 1W28A 4XACA 1O5LA 1UIKA 3LIHA 1S4CA 4LHSA 3LEGA 2W1SA 1REDA 5LRSA 1FAYA 3AYAA 1OPOA 1G7YA 2D5HA 2GC3A 1MS3A 1RJ8A 1ZZ8A 3KMHA 4FPFA 1E5HA 1MACA 2Y8KA 3GBWA 2MEV3 4GA9A 1ULPA 3MUZ1 1O7FA 3ZXEA 4BIFA 4OFGA 1VBE1 1K42A 3WCSA 5A70A 1QF3A 2ZX4A 2LW8A 4XF1A 3PJQA 1V70A 1C5IA 1FMD2 2OUHA 1AX1A 5ERLA 1B09A 4DXTA 2CHHA 1ASJ2 4FI9A 1TEIA 1HV1A 5LA1A 1WD4A 3KM5A 5L73A 2BVVA 5DAWA 1F9KA 1JZ6A 5DPNA 4HL0A 4L8QA 3CLPA 4TSVA 3ST7A 4DY3A 4QPIA 5JI7A 5A1LA 3IMMA 4FPGA 1JYVA 2YGLA 3WQ1A 2UY9A 2VMDA 2JIGA 4DB5A 5C71A 5FREA 1GOHA 4NVPA 1FYUA 2PMWB 1RUOA 2OYZA 3SITA 3GYDA 4AK3A 4E9KA 3BCWA 2JWPA 1HQNA 5F2WA 3FHAA 5H9PA 3TOJA 1OF4A 3Q8CA 3ZIWA 2HH9A 5C7GA 2ZZJA 4DMIA 5AFBA 2R0FA 1DGWA 3A22A 3AVRA 3ZOIA 3ZPOA 5AC92 2GU9A 3I49A 4CU8A 3GALA 4X6RB 2P3YA 2NMNA 5FXZA 4PQQA 5E88A 1AR93 4TWTA 3M3OA 4UWDA 3SH4A 3VKLA 1QQP2 5IK8A 1VB2A 1DQ6A 2W08A 3AMQA 4IERA 1W9YA 3EMRA 1W8FA 5FZ9A 3RI9A 1C8NA 1H9WA 2C6SA 4AVBA 1JYNA 2PA7A 1ZREA 4U2AA 5IVBA 1UMHA 1NCRA 5FMDA 2QVSB 1OURA 1ZRFA 5F1RA 3OUJA 2PHRA 4AI2A 1UOBA 4DXZA 3DEMA 4CDWA 5JWPA 3B02A 5DAPA 1JS9A 3GCWA 1VRH1 1UYXA 3IB3A 1I5ZA 3H3ZA 1ZVFA 2PLV2 1POV1 1NCQB 4XHBA 5HPOA 1TG7A 1CIWA 4QXKA 4D94A 3BPSA 4NRPA 2GDFA 3MIEA 2YC0A 3LCPA 2YUEA 3J7MA 2XBO3 3MGUA 4GIQA 1CVNA 4LKEA 2WZPP 4HANA 3ALQA 1UMIA 4XAAA 1XSQA 2ZGOA 4LA2A 2R071 1F5FA 2J22A 2WIIB 1W9WA 2Q4SA 4CDWB 1BJQA 1O4TA 1JZ5A 2VUCA 2VCBA 4PIZA 2I45A 4TLFA 3ZR6A 2VNGA 4QPGB 1JYWA 2Z69A 3GBGA 1WD3A 2A73B 1QJEA 5BNPA 2FDFA 1CWPA 1RUH2 3ILNA 4ASKA 1EPWA 1TME1 4GZ9A 3F2ZA 5FWJA 2AREA 1POV0 1T6GC 2KD7A 5KHIA 4WZCA 1XNBA 4CUGA 2O0OA 1LHOA 4I0BA 4JGYC 4BCUA 3OPZA 5LW9A 2J1RA 4A3ZA 5IVFA 5EYYA 5T5LA 3CJIC 3BUCA 3RMXA 1TME3 5B4NA 3U0ZA 1N1VA 1OT5A 2W3JA 1YQ6A 1F15A 2WINB 3LSDA 1J83A 2IXIA 2Q1FA 4DEQA 3BTYA 1K5MA 3RZJA 5JLVA 3ATGA 4QPYA 1QDCA 5CFDA 3WQ7A 4LOSA 2VZVA 2XPJA 4P9WA 3E6DA 5I0RA 2AENA 1W0PA 4AGVA 2DUPA 4XCBA 4XBNA 1CQ9A 1FMD1 4D3WA 4MO3M 2BFUL 4QGNA 2XWBB 4LXLA 4D6QA 1GOFA 1ZZCA 1YI9A 3B5LB 1WCDJ 1XYOA 2A70A 4JDNA 5JXIA 5CFCA 1COV3 2G9ZA 2PXJA 3MW4A 1PGL2 3OUIA 2V4AA 4QKFA 2OVUA 5FR3A 4QHZA 4AHWA 2VUJA 3WNLA 4BQYA 1NXD1 1K5MB 2P17A 3AYEA 4JRAA 4CP2A 1VJ2A 1CD3G 3B00A 3NJXA 4MYEA 1NT0A 4OHVA 5EJ3A 4YG3A 3VUOA 1AJOA 1SG3A 1HB4A 1NZCA 3SNMA 4XE9A 3LDKA 3PU3A 3X29B 2ZACA 4GWMA 3USSA 2BYVE 3PIJA 3WX5A 1QOOA 3OBAA 3SEEA 1D4VB 1HRV2 1QQP1 2YROA 4EZ4A 3KCXA 3HD8B 5K0UB 1WBFA 2VVFA 1G6NA 3AC0A 5E1RA 5IWFA 2XLGA 1PX4A 4XHXA 3MYXA 3N7JA 5CG8A 2W1UA 2HWF2 2ZA9A 3I3DA 4GWNA 1J1TA 1GMMA 4YLZA 3VDCA 1MEC2 5FK7A 1IHMA 1WCUA 5DN2A 5KC5A 2BGOA 1UY4A 2QDNA 3LD8A 3K46A 2E63A 3NKTA 1REEA 3AKQA 1VBD1 3TB0A 3OY8A 3D82A 2GC1A 2RDSA 4C91A 2QNKA 3QH6A 1EUUA 5IATA 2PLV1 2UY8A 3H1WA 5HCBA 5C9AA 1OF3A 3NNLA 3D0SA 2JJ6A 2HWB2 1AYM2 2VC9A 2JD4A 1S2BA 1NE4A 2YYOA 1ZZ7A 2TNFA 1X50A 4BQ1A 3I3EA 1VBD3 5HV0A 3HBZA 4QWNA 5EFUA 3I2OA 2ENRA 2W47A 2P34A 4PDWA 4R9BA 3WNOA 3LF7A 2AC1A 4RD7A 1LEMA 3N35A 1UZ0A 2RM22 4Q4W2 1D0GA 5HXMA 2DCKA 1C8M2 4NAMA 2Y60A 3WW4A 2NP0A 3I7DA 4RQPC 1VIWB 1DLLA 1H6YA 1YEWA 1YJKA 4L92A 4YGDA 3VBUA 1NYWA 2YBPA 3OY8B 4G9SB 4UFIA 2JDZA 5C9AB 2XJVA 1JXNA 1DLCA 5FBZA 2A5ZA 5I0UA 5BNOA 1RUH1 2ZGPA 4Y20A 2RDNA 4PI2A 5GALA 1OKQA 1KGYA 4Q2FA 1KQRA 1WMFA 3ZFFA 2WWUA 4OUEA 1CX1A 2J1AA 1NCQC 3INAA 3IAPA 4TZDA 1NY72 1AJKA 2WJSA 4PDWB 2DCYA 4JC1A 5F37A 2QQMA 1MZFA 4MLOA 3ES1A 3AL5A 2CAUA 3POWA 2P37A 2YBSA 1UMZA 3PUSA 4LORA 4BE3A 2OZ6A 4BQXA 5F7UA 2W9XA 4RL7A 4OCTA 5FMCA 3JXSA 3KD4A 5JMCA 5KXDA 4NJ4A 3VZOA 2BGCA 4HBNA 4QQHA 5CFCC 3DV8A 1CZVA 1IQAA 2ZHLA 5FPLA 3S7IA 5BNOB 4CDWC 5J7MA 1M06G 2WZR2 2BOJA 4ITCA 2VTXJ 3KT4A 5T52A 2VZRA 3I2FA 1VBB2 3T30A 1S0DA 4QPGC 2AEYA 1L7QA 4HKOA 4XF9A 1WLWA 1PIV2 1J59A 2VOKA 3M3IA 1C3HA 2ZOEB 4GD4A 1H6XA 1YQ2A 1AR82 2GNDA 4XAEA 1ZRDA 4IGPA 4EZHA 2JG9B 2OT7A 2X8KA 3S0MA 1PZ8A 3EYPA 3AX4A 3D0JA 4ZY9A 1GWMA 2YPJA 2GN7A 1TVGA 1YC61 4JDMA 5FZ1A 1Q8SA 3B93A 1YIPA 1W9SA 1BYHA 1RUI3 4WV8A 1FX5A 5C8WA 2YFUA 2DFBA 3LPGA 1UY1A 4HPKA 1SPPA 3C7HA 1UYPA 2IFRA 1LOFA 2VUDA 1PZ7A 4Y1UA 4MX3A 3I2HA 3TAYA 4P9GA 1PMHX 5JXHA 1B35A 2QJVA 3JQWA 4QKBA 2FCTA 3T0AA 4CCJA 3FBYA 4ET7A 3A7QA 5FPAA 2XXZA 1HRV1 3HNMA 1Q8QA 3C3VA 1JUIA 4G4FA 4FT8A 5FPVA 5D1IA 1W90A 2D3RA 4CEWA 2E26A 2IC1A 5T55A 5A3NA 2SLIA 4BQWA 1JOJA 1W9TA 2HWF1 4MH0E 1HRV3 2CNAA 2VY0A 5IJRA 1UCXA 4LIVA 4HPKB 3GHNA 3C7EA 4QPWA 1FXZA 3C7GA 2FBEA 3B3QE 2YMZA 4RGGA 4ATEA 1AR62 3AJYA 3NMBA 5FPZA 1H1MA 4ES9A 1B35B 2LS6A 4M3CF 3OYWB 4XJAA 5D8AA 4OMCA 3AXDA 4COWA 2Q8DA 5ACA2 4CXYA 3ZVXA 4QD2A 1BLZA 2RDRA 3TWIA 2BDRA 2HWB1 2C4XA 2JDAA 4CP9B 1US3A 4I2OA 2YFZA 5LEKA 1IG0A 2MNGA 3QD6A 3OPTA 4TLGA 3AM2A 1QXPA 2R062 3T4VA 1WBLA 1PVXA 1KJLA 1PZ9A 3MICA 2GSYA 5K0UC 5GZCA 3PURA 2RM21 5FV3A 4Y3OA 3WW1A 5LK5A 1BHGA 1W8WA 4BIOA 2AYHA 4EN6B 2WABA 2VQUA 4XCAA 5GLWA 4MXWA 4YNIA 1ST8A 1OVPA 2Q1ZB 1GNHA 1DGWX 1O3QA 4MGQA 1GQPA 4FOWA 3WNKA 4W50A 2A6ZA 4RS5A 2G9GA 1W3XA 2E7AA 1YQ5A 2H6BA 3UGFA 4AFAA 4HVQA 2YC2A 4XTPA 5KHJA 3KQ4B 5DG1A 2PHTA 2XOMA 2PHWA 3I2JA 2GP5A 3N9QA 1S55A 2WT1A 3TEXA 4CZSA 1NY71 3AP6A 2WS92 1HX6A 1AYN1 2DBIA 1UY3A 4QGLA 3RMYA 3UK9A 2WO7A 4P14A 1O3SA 3KGLA 1S1AA 5J1XA 3LOIA 4WM8C 2D5FA 3I3BA 3OGVA 3J7HA 4H2AA 3AP7A 4IEQA 3WDXA 1S0EA 1NQDA 4IEXA 4AVAA 4NIDA 2R7EB 1AYN3 2HEWF 4RS5B 4WZFA 3HN1A 5LASA 3ZSMA 1YI7A 1BVVA 4QX1A 3UKNA 2OX0A 5DAVA 3U75A 4N53B 3PL0A 1RUG3 2RMU2 1DIWA 1TE1B 2W87A 5FAXA 4BJ0A 1ZYBA 2IFWA 1PIV1 2ZMLA 5C9AC 5FDBA 2ZZQA 4L11A 2VQ0A 4URAA 1AR81 1IPSA 4GJYA 2A6XA 2WSVA 5FYMA 3ZMOA 5L7OA 1G9BA 4MG2A 2PHXA 4QB1A 4QX3A 3JBG2 2JE8A 3CU7A 3JU9A 4PDWC 2X5IA 2D6OX 3JB4C 3VBFA 4NRQA 4CDXB 3H9AA 1ULEA 1QJY3 4K1ZA 1AR83 5FIXA 1W03A 1S0IA 4L0PA 4XIOA 3PVOA 4Z07A 4MV2A 3VZMA 1K45A 1VAKA 4YVSC 1WLTA 2GC2A 1DCSA 1IGOA 4H14A 3LDRA 4Y33A 2UWAA 2WO3A 1VP6A 3RZKA 2HEYF 3PU8A 1N3PA 2Z79A 1XB9A 5JOZA 1BQPA 3CMGA 3OD0A 4LNVA 5EPAA 5L7OB 3HQUA 5F32A 4KWUA 3D5OA 3LE0A 1VLNA 1X9TA 2ZKNA 4QXBA 1W8OA 4R4XA 2OPKA 5A1AA 2AEZA 3FZ3A 3SHRA 4A45A 4AI3A 4DXRA 1UXZA 3P1IA 2WFF3 4FTBA 2GH8A 1FOD3 2JG9C 4KI5M 2AACA 4B1MA 5F3CA 2HWE1 2WA3A 4NIAA 3WP4A 2EAKA 4AI8A 4E4HA 4K9SA 2DWRA 1RVF1 4CCOA 5FO9B 2OZJA 3VKFC 3VBOC 5KXEA 1WCKA 3AKRA 2P2KA 2VQAA 3AMPA 2AZ5A 3T2OA 4BU2A 4CPBD 2JD9A 2ARBA 2ZAAA 2HWE3 1QH7A 5GZDA 1OOPA 1LGNA 5ACA1 5IAXA 1QH6A 1RIRA 5A7OA 1JZ2A 3RZGA 3DECA 2VVDA 2WT0A 1RVF3 3TRSB 1GP4A 4BXSV 3RPQA 3SLIA 5JPMB 1V0AA 3HNYM 4AR2A 3GXUA 2QQOA 3U07A 3Q8BA 3T2PA 2R061 1QDOA 5FCCA 1R082 3N3HA 4HMZA 2XJSA 1LGBA 3PMEA 4BWOA 3ASIA 1LOEA 2WKKA 4WVVA 1YFYA 4BOWA 4C1WA 1ND2A 2GAUA 3DPRB 3PUHA 4C1XA 2CGOA 3OJBA 1MVQA 3K4AA 4Q29A 1CGPA 2IXJA 3FL7A 3PNAA 3MFCA 2VO5A 2QQJA 3JUUA 1H2LA 1XNCA 3KZ4C 4JRLA 5FLJA 3RDIA 3WP5A 3U14A 4DUVA 5CBLA 3ZYGA 3O1PA 3CKHA 4FPYA 2JDPA 4D6SA 4QX7A 2DDUA 4Q0QA 1LCLA 1RUE2 1WKYA 2KM2A 2WNEA 2RHPA 4YPJA 4J6GA 2E51A 2JENA 4AL9A 2UWCA 4YZ5A 5A33A 4R9CA 1I9RA 1L3JA 5FJHA 4M0NA 2W68A 4HKLA 1JH5A 4JTNA 5LCWL 3THTA 4YSFA 5C5TA 2WS91 4ISQA 1V9U1 2OXBA 3POJA 3ZPYA 1DZTA 2Y6LA 4B8EA 1UXXX 2Y26A 2D7FA 2IXHA 1IS3A 1RUJ3 1V6JA 3GDBA 1Q56A 2OUJA 5H9RA 1R1A1 2D6LX 4HLTA 1YHFA 1Y9GA 1V9U3 3I3QA 4RHV3 4JQRA 1DU3D 5FY7A 3OD4A 4CDUB 5LY1A 3OSDA 1RUC2 1R64A 1W2UA 4FTSA 1MS9A 1QJX2 4RYDA 4AFBA 2RMU1 3IZOA 3QACA 2VD7A 4MGIE 1XYNA 3WG4A 1R1A3 4BM8A 4EN7B 1DGLA 3OGSA 5A33B 4CYDA 3O5SA 3IWZA 4NOTA 2VZUA 4N8MA 4BZ4A 1JW6A 4YW3A 3ELNA 3WP6A 4H7MA 1AZDA 1DZRA 4XFAA 3PIGA 1MS1A 3LKJA 3U37A 2LTNA 1LHWA 1VAVA 2RMU3 3FWEA 1DHKB 3JBG1 3NV4A 5L19A 1CAWA 2VULA 2BZDA 5FYVA 5C6CA 4Q26A 5JSRA 5DABA 2B45X 4IGQA 3PMSA 1YLLA 2GNTA 3FN9A 2ADDA 2WFPA 3KVBA 3MEPA 4YZ4A 5T5OA 2WRAA 2X05A 4E2GA 5JXJA 4QU2A 4ZXKA 1W99A 4AFDA 4BH9A 3JD72 2DF7A 4QQOA 2ATFA 4A42A 2ET7A 2V5DA 3HPNA 4CEYA 4RS5C 5A32B 4CUAA 2HYKA 4KMQA 3OEAA 1QY4A 2PQSA 4N53C 5A1FA 1W0OA 4IW3A 5FZ7A 1W6QA 3RYRA 3VBSB 4GMP1 1GQGA 4LBLA 5DZGA 3T4HB 1GZWA 2R043 3VLBB 2R49A 5IVJA 3BKZA 3N7MA 3BOPA 4E8CA 2VOTA 2J1TA 4NE9A 2GALA 1ND3A 2QFEA 3NJVA 3VBHA 5JOYA 3WCRA 4GMP3 3EO6A 2JDUA 3PJYA 4CDXC 3HQXA 3KT7A 5LATA 1HV0A 1F4HA 1Z78A 1N47A 1ZZ6A 1UOFA 1CZTA 3AP9A 4MHUA 4UBHA 3MLKA 2VBPA 2NM1A 1XNAA 4ZU5A 4ZHNA 3HBKA 2PN5A 1OUSA 5CVRA 4AAXA 2Y38A 4CXXA 3CQOA 5DDJ1 1ENXA 5FJKA 5FZEA 4FO9A 1W6QB 1CAUB 1NX9A 1LULA 1RUD3 5FY0A 4PBPA 2JDYA 1XSRA 4IEPA 4QKNA 1VBC2 3MIFA 3ZYIB 5JSOA 1KITA 4AE2A 4YARA 1R081 5CG9A 5A7NA 1ND3B 5FP7A 4GMP0 5DDJ3 3ILRA 5IAVA 3VBHB 3WSOA 1CN1A 1E57A 1QJZA 1BBT1 3WD5A 5A6QA 5JZGA 4WM7C 2Y6JA 1AL22 4NROA 5FYZA 1GWKA 3HMYA 1WW6A 4XQWA 1R083 5JOXA 5KBFA 4LO5B 1D0HA 3AFKA 2VM9A 4NUBA 1J3PA 4W4ZA 3VGIA 4EQVA 4AVSA 1BBT3 4QDRA 1ZBE1 4OI1A 3TEYA 3LWCA 3VHNA 4KWLA 4WVWA 4XILA 4R9AA 5I93A 1W6PA 2DFCA 2K46A 2JE7A 4SBVA 5DG2A 4JZRA 5FPBA 2DURA 3TEZA 2EIEA 4DFSA 4D7TA 1ZBE3 2ZGLA 4PIXA 4YW4A 5E6HA 1GQHA 2NMOA 2O1QA 4CCLA 1GR3A 2VECA 2VU9A 5JZGB 2P3JA 3LPFA 1AVBA 1QNWA 1OLME 2JB8A 1AX2A 5JVVA 5SV5A 2CGPA 3FJSA 4A2UA 4CP0A 1EP0A 2Y34A 4B4PA 5A7WB 2R6QA 3S7EA 3BIEA 4COYA 5J09A 2NN8A 3DPRC 2XKOA 3RQ0A 1RUC1 4KU8A 1VBE3 3K3OA 1YIFA 2OS2A 1JZ8A 4Y1VA 1ZZ9A 1W6PB 2VMGA 4INDA 5A6ZA 1G8WA 3NNJA 3DYPA 5IUQA 1CAXA 2K9ZA 2ZEYA 1E5IA 2IXCA 4LBNA 4Z2AA 2WAOA 1C57A 1BXHA 3GGLA 1RUC3 2W95A 3WT3A 5FYHA 1AXZA 2XKPA 3POEA 4C8DA 5CADA 3N36A 3FHIB 3GJBA 3I2IA 1UZYA 2A3XA 3POSA 1LU2A 3AKPA 1MZEA 2XH6A 4QDSA 3WDWA 1NA1C 2RS52 2WN3A 5FTTC 4NHKA 4LUMA 2PAKA 3S5QA 2VZOA 1GKBA 3CIHA 3N4MA 3JD71 1NZIA 1GP5A 2JKBA 4J25A 4QPIB 4UI9L 2E7QA 4FPOB 5ANQA 2E53A 3AZXA 1A8DA 4D0QA 5GJ6A 3L9JT 4YW2A 2R0HA 5FUPA 4MSVA 2G19A 4CDUC 1CAXB 3SKVA 5FZ0A 3TYJA 1Z7S2 5FYUA 2UWBA 1GFF2 4FP2A 4TN7A 3H7JA 3N9PA 1WLDA 2W1QA 5IYYA 5AVPA 1N1TA 5F6LB 1YXWA 1RTVA 4FAGA 3N7LA 1H30A 2DUOA 4E2QA 4FAHA 3KCYA 3CZUA 5FUIA 1RL3A 2ZGSA 3IDEA 1GU3A 4Q4X1 3BGAA 3NJYA 1UW8A 2CU5A 1K3IA 3AJZA 4ES8A 1OUXA 2JDNA 1BCXA 3PVEA 4N9IA 5F6KA 4KBBA 1CAVA 1IG3A 1VRH3 3A21A 3HAGA 2EF6A 2Y33A 1POV3 4KG8A 3OBZA 1KDMA 1UU6A 4Q4X3 1NCRB 3NV2A 3OOXA 4FPLA 3BPZA 1SLAA 3NO8A 4COZA 4KGGA 1VBC1 4GAZA 4UW3A 3OB8A 2B7YA 4XBQA 4NWVA 4B29A 4XC9A 2D3PA 1N3OA 2WNOA 3ZN6A 4IDZA 5CIRA 2ES3A 3VBSC 2FQPA 4XF0A 1LOBA 1TNFA 2BEOA 3DKQA 4EYUA 1ENRA 3LA7A 4FP3A 3ZSEA 1RMU1 3IPVA 1QWRA 5FY1A 2OIIA 2R073 2NQYA 1AL21 3RS6A 3DL3A 4QQLA 3WVJA 2D6PA 1PMIA 3VB9A 1G9FA 3K4ZA 4XMIA 3G7DA 5JR7B 1UAIA 4XUNA 1W3VA 2XLAA 4FFFA 1EV12 4M0HA 3ZYRA 5JMOA 5K7PA 2QQUA 2QQNA 1RMU3 3HIFA 3MI8A 1SLIA 1G86A 2JDKA 3K3NA 1EYBA 1NOVA 1AL23 2CAVA 2ZABA 4JKKA 4LA3A 4IV3A 4IXLA 5FMBA 3KLSA 2RJ2A 1O3RA 1A6CA 2BW8A 3HR9A 4KL1A 4W6WA 1RGSA 4YWAA 4N90A 4OHYA 2UYBA 4DOUA 3GBFA 5GZFA 4AQSA 1NLSA 1R092 4A7ZA 2P3KA 3LB9A 2JDMA 3IPVB 4M00A 5BNPB 2YZ4A 3OCPA 4HKWA 4XMAA 3WUDA 5F3GA 1LB2A 5M0TA 3I3MA 1H2NA 1WMXA 3ACHA 1Y4WA 5A7PA 1KS5A 3VDBA 4N43A 1VAMA 4LHLA 5F8PA 1ASJ1 4JCKA 1MQTA 2RS32 2YHJA 1MS4A 3R4SA 4HFSA 2IWGB 4LBMA 4M3CA 1JZ4A 2JG8A 3AP4A 5HI0A 4IV3B 1C28A 1UWWA 1CX4A 4MGZE 5FO7B 3ZFGA 5A3TA 1VBA2 3D3AA 1FMD3 2D6MA 1ONAA 1ASJ3 1F5JA 4A7YA 2ZGTA 1NLQA 1SZBA 3NWKA 4JVAA 3V0AA 3J9SA 3ZN4A 3ENRA 2XVLA 1ZBA2 4YGCA 4D7YA 1LNSA 4EWAA 5CFDB 2FDKA 4GH4A 2Q0AA 2WSUA 1JZ3A 3MUY1 3WZ1A 1CESA 3WG1A 3RYKA 2D6NA 2RS51 4Y1XA 4I30A 3FBMA 3WNNA 5AC91 5JZGC 5EYXA 2LRPA 1MQTB 4OLLA 4ZXEA 3LEIA 2WC2A 4I0WB 3IBMA 4M3CB 4CA9A 4E27A 3D8CA 2JG8B 2IZWA 3VHRA 2XB6C 3ZFGB 4AWDA 3WF4A 1ODMA 3ZO0B 1LODA 5AC93 1W6MA 2EAAA 2VTXA 2XL9A 4KBZA 3MIGA 3J26N 1I5PA 2QQKA 1J84A 5CKQA 2ZPXA 1M4WA 4AI1A 3ZIXA 3POGA 3ZKYA 1QQP3 2PELA 1YNAA 1Q3EA 3WW3A 3WY6A 3V64A 1S0JA 2ZX3A 2JB4A 4CCCA 2VZSA 3BU0A 4CCKA 4UXAA 3QLQA 3C2UA 3IDCB 1HB1A 3NW4A 3VZNA 5LB6A 2E9QA 2VQTA 4XJWA 5EJ1B 2ARAA 4QX8A 3HT2A 3RZMA 1PVC2 3GF6A 4I01A 4JDOA 3KSCA 5FO8B 4AQ2A 3WNMA 1AUYA 3WF1A 4Q4Y2 5FMOS 2XJQA 4BK4A 1TMF2 1GNYA 1PM7A 4EV0A 4V2VA 3KWVA 5FZIA 2JXAA 4K8FA 3AMHA 1V6LA 2PLV3 5FZKA 1LOCA 4QPIC 1O4ZA 1SFNA 4PCRA 5FFOC 3ZX7A 2CY6A 3LA2A 2XG3A 4AHXA 1DG6A 5FZ4A 1J58A 5EJZB 1SCSA 4F83A 5BUVA 2HWD2 2DYCA 2BNMA 3IDBB 4AAPA 5J48A 3K51A 4OMDA 3C7OA 5BNNA 5CAZA 2ZCWA 1J3RA 4P5HA 2WNVA 3W58A 1H8TA 2J7MA 3O7OA 3I2GA 1ZNPA 3RWNA 4DINB 4IE5A 3RFRA 1NXMA 1ULCA 4DZGA 2X29A 4MGYE 5FY9A 5CKNA 2DTYA 4S2DA 1EV11 2BNOA 4KGQA 3E6BA 4AGGA 1VE0A 3RJ2X 2QUOA 3RVHA 2MPFA 1EAH2 1RUH3 3NRUA 1W8UA 3LEKA 3MO4A 4EJRA 4W8JA 3P6BA 1CONA 3K75B 2J1VA 3NVCA 3I59A 3I97A 1EV13 1UD1A 2P3IA 1NCRC 3BIWE 3FX3A 4NHMA 4OI4A 4S2GA 5CZKA 2YU2A 3LAGA 5F3EA 5FLIA 4AEDA 4Q1RA 1JU3A 4P08A 1JYXA 5IVVA 1AXYA 1H0BA 1DF0A 2W46A 4JAAA 2O8OA 4Y20B 3UV9A 3ZXKA 3WINE 3ZFFB 5FYCA 3U78A 4QXHA 3DKWA 5ABJA 4AFCA 4PLNA 2VUAA 2ILMA 4AVTA 1KFUL 4Q0VA 1G9AA 2IXLA 2XQXA 4COVA 5FOBB 2X09A 1RHI2 1LTEA 4GJZA 1VBA1 3I59B 2BVBA 1PGL1 1D4M2 1OA2A 4AEDB 1OXCA 3VDAA 4CCNA 3WOGA 5K9YA 1PK6A 2W94A 3QCWA 3ITQA 3T09A 4HVOA 3EHKA 1I3HA 4HOOA 4XDPA 2A3WA 4UW6A 5A3PA 2CTVA 2XGXA 4ZONA 3I2KA 5T5PA 4XYXA 4KWJA 2EXIA 4XDOA 5ABJB 5BNPC 1W05A 1H1IA 4XQDA 3D4KA 3SH5A 1FPN2 3ZFEA 4GKYA 1H4HA 4IEOA 1BEV2 4XEZA 1POQA 1VMFA 3FHQA 2CV6A 3ZKUA 5FZHA 5I8TA 4P9LA 1ZRIA 1DYOA 2ZMNA 4FFGA 4BK5A 2E31A 4KWKA 4CCDA 3AK0A 5A6YA 3MDPA 5I8SA 4LKFA 2ZGKA 4FOVA 3VDDA 2VXRA 1SPPB 1Y43B 4Q0UA 1ZX5A 1MEC1 2QQIA 2B46X 3MLJA 2YDEA 4IE0A 3PTYA 1XXNA 5F5AA 1O6UA 4C0HA 1JUHA 1J1LA 3W21A 1K5MC 4NIHA 2QQLA 2FHRA 3ABZA 4UF0A 2XHKA 4LO4B 2HWF3 5T54A 2XONA 5CFDC 4HETA 2CL2A 2Q5TA 1UZZA 3NV1A 3ZFEB 1MEC3 1PVC1 1AYM1 2VZ3A 2BOIA 3VBRA 4W6XA 1XNTA 3LEMA 2XJRA 5CKMA 4CEWB 2PHLA 2QZ3A 1MQTC 1I1EA 4M3CE 1Y3TA 5DUUA 3MF6A 2BPA2 2JG8C 2CDOA 3NSTA 4KNCA 3ZFGC 4F3JA 4CCMA 1WW5A 1AYM3 2HWB3 2W0XA 4Q4W1 4QM9A 2HBTA 4FPCA 4XETA 4PQ9A 1C8M1 4NMIA 1UIJA 4NHLA 1HQWA 5J96B 2HWD1 2QCSB 3NAPA 3B9IA 1WW4A 2BWCA 2RR12 4UF0B 3TEWA 4DNYA 1O8SA 1O3TA 5D8AB 3VD4A 4XQ4A 2RM23 4Q4W3 3VN4A 4AHYA 1C8M3 4Q4V2 4B4RA 2EVXA 3SXWA 1SLCA 3OGJA 1UZWA 2N7GA 4CUCA 3J8F2 4CE8A 3CHXA 1GSLA 5G05L 3QOPA 1N1YA 4IV1A 1JU4A 1S0FA 4B3NA 1S0GA 4DUXA 2DU0A 5DAXA 4PLOA 1EAH1 2W91A 5FY5A 1HIXA 2EXHA 4E4SA 3DF0A 1HB3A 1IS4A 1XU1A 4BB3A 1HRI2 4MXWB 4FXKB 5C3PA 1HDKA 1PGW2 5IT6A 5D21A 3WHUA 2X10A 3WNXA 1OSGA 1EAH3 3N9OA 4JHZA 4FTEA 1QOTA 4OULA 3S6PA 2EIBA 3GZAA 3SISA 1LHVA 4Y26A 3V0BA 2WBKA 2WZR1 2YG0A 4Q27A 4NPMA 3I54A 5FP4A 1QJU2 1JYIA 2OQ6A 3E5UA 4FVVA 1VBB1 3P3PA 3BN6A 3KCCA 1HN0A 4IV1B 5FK8A 3MV01 2HKXA 2K2SA 1MPXA 5J3UA 4PJYA 2QQPA 2VBBA 2RS12 2ZBJA 5A7QA 4AFMA 2WZR3 3K4DA 5CB7A 1RHI1 5JIAA 4ARXA 1VBB3 4NRMA 2O8QA 4WVMA 1PIV3 3O0WA 3S30A 4QM8A 2ZKLA 4ARYA 2BJSA 5A3LA 1UZVA 4ASLA 4JV4A 3DXTA 4GWJA 4Q5OA 3IKWA 4RR3A 3ETPA 5C4WA 2VTFA 3WNPA 1RHI3 2D6KA 3UJQA 3T3YA 2EALA 3VBUC 3WQBA 2VCCA 2W1WA 4J1WA 1PNGA 2BWAA 5C8CA 4YZ2A 5C5UA 5J37A 1OMIA 2TUNA 3MIBA 4PF5A 4UW5A 2GC0A 2R32A 4XFGA 5A80A 5BNOC 3W20A 1FPN1 1ZA7A 2QQVA 3LZZA 4K21A 5FZGA 4BDVB 4UW4A 2FZ1A 1BEV1 3ZFFC 5BNQA 2WA4A 1IPKA 1S0BA 3RZHA 1L7LA 1PO22 4FPHA 1LKNA 4P00B 1C1FA 4DXSA 5I0SA 2XLFA 3VBFB 2X5IB 4WVMB 4KH9A 1KD7A 3DN7A 5CISA 1CR7A 2AGSA 1GBGA 4LTAA 2E6VA 2BP6A 3U10A 1BEV3 4RR3B 4Z8BA 5C4WB 5JPNB 5AFEA 2K0GA 5FYSA 1UU4A 2XQRA 3OF1A 4LLOA 1IZ3A 1W8NA 4IESA 1AR61 2C9KA 2V09A 4GXLA 4D69A 1OI6A 2J1EA 5C8CB 1LECA 3BYWA 1V6IA 1OLQA 5FZDA 3V65A 1X9PA 4B4QA 1VR3A 2JIJA 3NNGA 2W5FA 4DUWA 4LKSA 2DUQA 5E16A 1TNRA 1YFXA 1LU1A 3BALA 4PIYA 5D2AA 1AR63 1PMJX 2VNOA 2H0BA 1UX7A 1BK1A 4OHZA 1HXS2 2WZEA 1HJGA 3K77A 4LO7A 3VZLA 1IS6A 3WW2A 3LQCA 1XPWA 3LFMA 4CDQA 1OQDA 5ACA3 2OW4A 4V1PA 5FZFA 5HCFA 4LOTA 5FXWA 4LT5A 3KV4A 2L9LA 4I02A 5H9QA 2VBDA 1S2KA 5APAA 1BKZA 2KR2A 4QX5A 5FY4A 3IT8A 4YM2A 2R063 2RR11 5C70A 2QTWB 3FUQA 4YVWA 4FPJA 4XVHA 4LQRA 1OOPB 1WW7A 1DQ0A 2CWMA 3N9NA 4FQ4A 3H8UA 1LOFC 4PLMA 1Z0HA 4XBLA 1NLRA 4MGKE 4Q4V1 3ILFA 5LBEA 1X8EA 1B35C 1WCQA 2YGMA 4N7UA 2PFWA 2W39A 4BQ5A 4U36A 4CDQB 2GNBA 1RINA 4O9GA 5EZWA 3U1XA 2I07B 2JECA 1QJFA 1E5RA 1LR5A 4QU1A 4RSUA 3VKMA 4CEWC 2VMCA 3H1MA 4YW5A 1RC6A 1ENQA 3UGGA 1KS4A 1ND2B 1YWKA 2QDRA 2P6HA 4I0AA 3GZUC 3C7FA 4OUMA 2LM3A 3A4UA 1PO12 4YVWB 2P5BA 3DGTA 5BYNA 2WS93 1G9CA 4OHWA 2DVAA 3F95A 4AHZA 4CDUA 1BMV2 1CZSA 4ZS3A 3C8XA 2WYSA 3E97A 5FRAA 4BMBA 3CF6E 3ZSKA 1QJU1 3ZYHA 5D8AC 1UY0A 3P5BA 4LBQA 3VV1A 1ACCA 3CNAA 3FMGA 1GNZA 3LOBA 4IQPA 2FZ2A 1W39A 3ZXGA 1KFXL 3AZYA 2RS11 4V2WA 1OFSA 5JR2A 3O0VA 3R05A 2RV9A 3PHMA 3AYCA 4AOCA 4CRQA 2FMDA 3FFQA 2ETEA 1D7PM 3IN9A 2DVDA 4QB6A 2A3YA 2ZTNA 2XJPA 5FZOA 3H0OA 4MZUA 4LK7A 2FDGA 5FUNA 4XJ9A 3ETQA 3JBG3 2IUWA 2J42A 3EB7A 1SEFA 3BODA 3QBQA 4CSWA 3MF9A 4XUOA 3M7AA 4LBQB 4QX2A 3ECQA 3WEZA 3HN3A 5IHRA 3WR0A 5CNAA 2D43A 3T1LA 1W8HA 2E32A 2R1BA 3WLUA 1U5YA 4XFHA 5GZGA 4LJHA 1LOAA 1AR92 2PHUA 2R16A 2V73A 4UAPA 5FZ6A 2NYYA 1G9DA 1PO21 5B4XA 4HT1T 4LR4A 2XMLA 1AHSA 3ME2A 4YM0A 1WWYA 1CAWB 1YQCA 3AB0A 5FKBA 1OFNA 4O7XA 5K4LA 3Q8AA 3SKJE 4CU9A 3WV6A 4CVUA 5GLTA 1C4RA 3H8OA 1MVEA 1W2OA 1W6OA 4QXCA 4XZUG 5FZ8A 1H2KA 3CJIA 4CEYB 3H8RA 4AVVA 1BK0A 2Z5WA 1OBNA 5KWRA 4FOQA 2J1SA 2GMEA 1MS8A 1W2AX 5DUWA 4XTMA 2W92A 3BTZA 3JQXA 3ZSLA 5KHHA 5FKCA 4N9HA 3UJOA 5E8AA 3SC7X 1ULDA 5JXGA 2ZHKA 1GZWB 2MHFA 4R52A 1UO9A 2EIDA 3KGZA 2ZX1A 3SCHA 3WP3A 1HXS1 4LKDA 1CJDA 1OLRA 5L7OC 1JBCA 2XBO2 3DCQA 4JQTA 4LBJA 5H9SA 4EROA 3MIHA 3U4SA 3VBFC 2X5IC 2KA3A 4LMFA 3HJRA 4XZPA 4Z82A 2VW0A 3TN92 3POIA 3WG3A 5FOJB 2W52A 3S57A 1SACA 3GM8A 1Y7BA 1ZM1A 1BZWA 2QQWA 4RR3C 5C4WC 3EJKA 5DZFA 3Q8FA 1XE7A 2RJLA 2Q8EA 2UYAA 4UFKA 1UKRA 2HBUA 1RUE1 2A7AA 4META 4EN8B 5KR7A 2GMPA 2B9UA 1YQ8A 4YGEA 2B4KA 2O14A 1QGLA 2ARXA 1J3QA 3VD7A 4M4RA 2IVIB 4X8NA 2VMEA 1FT9A 1FNZA 4IEWA 2EICA 4RGKA 2V72A 1SDDB 2B9VA 1RUE3 4PHZA 2BFUS 1MZ5A 3ZMNA 4A7KA 3AVSA 1RUNA 4X6QB 1TME2 4OZXA 3RG0A 3I4IA 4ZPIA 1C5HA 1LHNA 2CDPA 1UU5A 4IEUA 1H2MA 4YW1A 1PO11 5BXXA 3WDTA 2G1MA 2ORZA 4M01A 4Q0PA 4XJUA 4XIKA 4NHYA 4JKLA 4CP1A 5F5QA 4CXWA 3AFGA 3MLLA 3AMMA 1BMV1 1XE0A 3J4UH 4AI9A 5EIYB 1UL9A 1YRZA 1PM4A 3KT1A 4PF1A 1QJX1 3VHOA 1UYYA 5EXOA 4EN0A 4E4DX 1OOPC 5IFPA 1PO13 3IIAA 3Q8EA 5GZEA 3NV3A 1UOGA 3H3LA 2EA7A 3OBTA 1U5XA 2VR4A 4OZOA 1KJRA 4WVZA 4IEVA 5IK5A 4Y1ZA 3RJRA 3BTAA 2YBKA 2VGDA 3M8LA 1QJX3 2VG9A 1A78A 2GH2A 1RXGA 2PYTA 4CDQC 2C1FA 2HLEA 5HXVA 4L9BA 1COV2 4W6YA 4AGRA 4HK8A 4LLFA 1ZZBA 2PTMA 4DRRA 5GLZA 5F5CA 4EN9B 2BRTA 4XFCA 1X33A 2LROA 4EWEA 1Q43A 4AZZA 2EIGA 1ND2C 1KDKA 1OA3A 1W04A 2JICA 4D8MA 3KHBA 1FV3A 3HEIA 4H55A 3WF0A 4R8HA 2VE1A 3T08A 4LPLA 4YVWC 3UKVA 2PAEA 4ORFA 3S5AA 1E5SA 4YG6A 4RQPA 1U0AA 5CEHA 1URXA 3HNBM 1BVP1 3DYMA 2VCAA 4B7EA 1AR91 2WNUA 2D98A 4HVRA 4Y5TA 3JD73 4A6OA 1ENSA 5ANNA 4TYSA 1OA4A 4CTEA 5LA9A 1SDWA 3OG2A 1STMA 5KC6A 3USUA 1V6KA 2FD8A 3DUIA 2OQ7A 3G6JB 3AMNA 4HG6B 5FP9A 5BPXA 1ALYA 3KB5A 3GHMA 1NCQA 1U12A 4K8RB 2OA2A 3IMNA 2DVBA 4O65A 5JCTA 3R0RA 4XUPA 1DFQA 5FPXA 1GZTA 3UETA 4B1LA 4BA6A 4P5YA 3T2QA 1F2NA 5LBCA 4OVEA 4FSJA 1WGPA 4GKXA 4RQPB 2P4EA 3KVAA 5LEJA 4Q1PA 4PBOA 4XXAA 3UKTA 2IVJA 2WNUB 3ACGA 1HQLA 1SFYA 5LBFA 4WBBA 3M4FA 4FPEA 4Y5SA 4ZZ5A
chains in the Genus database with same CATH topology
2VMIA 3VKOA 3EBRA 1RUF2 3OBRA 1X8MA 1MS0A 1VBD2 2BNNA 3USUB 2FMYA 1AL0G 2XBO1 4QPGA 4DS0A 5EWSA 3VHPA 1SLLA 1VBC3 1DGRA 3A0NA 3TN91 4SLIA 2D97A 3FUOA 2Q30A 2PHFA 4R9DA 1GANA 3A0KA 1SBDA 3PVNA 1CAVB 2B8MA 5HCAA 3R4UA 4FXGB 3ES4A 4CEYC 3TN93 3E5XA 5CFCB 3W9AA 2WL1A 4LO8A 1LRHA 4HSLA 2ZHNA 3ZN6B 3T1MA 1SQ4A 2DVGA 1QHDA 4BLIA 4XDQA 4Y1YA 5BV6A 1ND3C 1X36A 3VBHC 2XUMA 4I3GA 1H4GA 3VZJA 4GALA 3QH7A 1QNYA 1V00A 5JOWA 4XJZA 1OHFA 2LALA 5GM0A 5LRRA 5TSWA 2WQ4A 4RGAA 4LO6B 3TNPB 1FV2A 2C9AA 1V6NA 4Z1VA 2B42B 2D44A 4Q8LA 4ATFA 3MPBA 4Q0SA 1DYPA 1UF2C 4QQPA 4P9JA 1COV1 1DQ2A 3VKNA 3MFAA 1D2QA 4GQ7A 1RUI2 2VNRA 4N43B 3LSEA 4OI2A 1MS5A 2A75A 4JTOA 3IM0A 4XPVA 1JYCA 3VZKA 5K0UA 5I91A 2Z2SB 3FLRA 1JN2P 2RS53 1RJ7A 1N1SA 3RRDA 1DQ4A 1JTZX 4AVCA 2DVFA 3V0AB 1Z7S1 3P3NA 2SBAA 1OQEA 4J1XA 4FBFA 4IL7A 5T3NA 4FQZA 5AVAA 2QE3A 4GH4B 4BLJA 1Z7S3 1A3KA 1YJLA 3CJXA 3O0XA 1GICA 2BQPA 3LGRA 1Y9QA 3JZVA 4YFWA 3RNSA 3BB6A 3I2DA 4O9EA 1SMVA 3E5QA 4AG4A 1Q8VA 1W6MB 4WM8A 3H3UA 2D93A 1AXKA 5SV8A 1RUF1 3AKTA 3ZDSA 4AXOA 4W65A 4NR1A 1PNFA 2JEMA 4AW7A 1A8MA 1UPIA 3NJZA 2A6VA 2GMMA 2UURA 3SCGA 2XJTA 1RUF3 2CYFA 4IEZA 3SH3A 3WDVA 2XL7A 4WM8B 3M3CA 1AF9A 1EPZA 1Q8PA 2XVKA 4Z2WA 4K20A 2ERFA 2R1DA 2KXLA 3M1HA 4YZ3A 5J36A 4KG0A 2V5YA 4ISRA 4YVSA 4Y5Z0 2HEVF 4D7SA 4Y22A 5CA6A 2WNUC 5BNNB 1ZRRA 5EV7A 2WNVB 1H8TB 3AXEA 1R091 4I09A 4XJ8A 3APBA 3ZYJB 3ZN5A 4P9YA 2DV9A 1R093 1AYN2 1F31A 2JG9A 2RS31 4XFIA 5GLUA 4OI0A 3M70A 1UPSA 3VL8A 3M3QA 1RUG2 4YVSB 4NPRA 3RI8A 3VBOA 1KRIA 4Y22B 2GN3A 4OHXA 4E4ZA 4H3WA 2RS33 4ONUA 2Q1MA 2TBVA 3B69A 1ZBA1 4AEKA 1MR5A 1WLCA 4F7ZA 3BOWA 1VBA3 1DQ1A 1X7NA 1FNYA 2YY1A 3N7KA 4EWDA 2RJKA 1RUI1 1QJY2 3MW3A 3OGGA 4P9IA 1ZBA3 1XE8A 3SCFA 1XYPA 5DZEA 5L36A 5IK7A 5DUXA 3SMHA 4YFZA 4BMEA 3WHTA 3VBOB 5KXBA 2WWSA 2DCJA 4IV3C 5JSPA 1DDLA 1PK6B 4RA0A 2BUKA 2DTWA 4AEMA 1R1ZA 1IS5A 2D40A 1HW5A 3WUCA 4MUVA 5BY5A 1D2SA 2WFF2 3KQRA 3OYWA 1FOD2 5FQ0A 2AUYA 4LEJA 1UKGA 5FLHA 4YM3A 1U5IA 4N43C 4MVTA 4QGMA 1GZ9A 4Q4Y1 2ZGNA 1TMF1 4QMAA 2HWE2 4Z92B 4K1YA 2PAMA 2XWJB 1WMDA 4AI0A 1NQJA 1PVC3 4KQ7A 1RVF2 2AH2A 3TBDA 1UN1A 4LE3A 2VMHA 4Q4Y3 1TMF3 3RYPA 4DY5A 4HK9A 1LESA 5FQ0B 3AZWA 1RITA 2XVGA 2X53S 4LHNA 1IOAA 4GH4C 3URFA 3HWJA 1ZRCA 1QMJA 5KXCA 3AYDA 1YYNA 2NZ9A 4E2SA 2ZAHA 1O5UA 3VBRB 4GB32 4AQ6A 2HWD3 2VOXA 3FLPA 4QQ2A 3ROUA 1LGCA 5JDBA 1YFUA 5T50A 1WCSA 3WXPA 4YG0A 3PLQA 5FMOL 3AZZA 4FPKA 2ZGRA 2ZS6B 2ZHMA 4LULA 2BBVA 4URTA 1S0CA 3K48A 3NAPB 1JHNA 1REFA 3MW2A 1H9PA 2EXKA 4K40A 4L2NA 5B2GB 5GLVA 4N53A 2HWC2 4BYYA 1GLHA 1RUJ2 1HLCA 4BPZA 1VB4A 5JIUA 5LK7B 3AP5A 4NWWA 4NO4A 1XQNA 2F6BA 2ZX0A 1WUVA 3M2MA 2WLQA 1MZ6A 1QXJA 1V9U2 1PHMA 4RHV2 1OPMA 3EQEA 4ZKTB 1I6XA 4XFBA 4P9XA 4CDXA 1RUG1 4H7LA 3GZTB 2VOWA 5CU1A 1R1A2 1SLBA 1WMEA 2A71A 3CL1A 4XF4A 1ZA4A 2DU1A 2GNMA 1D4M1 1DGRN 3NKGA 3U11A 3ZXJA 3V0BB 2NLRA 5BNNC 4L99A 2WNVC 3LA3A 1H8TC 1D4M3 1QJY1 2JX9A 5J98B 4YZ1A 2WLPA 3VL9A 2ZGQA 2ZJCA 2C0ZA 4X8PA 1UX6A 4JGZA 4ASMB 3AKSA 4QT6A 2XJUA 3L2HA 4WM7A 2I74A 4FOYA 4YGBA 4K6BA 1DYKA 1FPN3 2LUWA 3Q9OA 3BU7A 1ULFA 4RFT0 1SCRA 4OUSA 2YXSA 2R042 4IETA 1V6MA 4AEDC 3AZVA 2WFF1 3CO2A 2DCTA 3W59A 1FOD1 5GKAC 1QKQA 1PGSA 1LHUA 2VPVA 3D6EA 2QKDA 2CWSA 1XRUA 3E6CC 4JGZB 3POYA 3WDYA 5ABJC 1O91A 4HZFA 3JCIA 4WM7B 1U5ZA 2G9FA 1IPJA 4GULA 2ZGMA 1FI2A 5E89A 2DCZA 3WQ0A 4IEYA 1YCIA 1AR72 1O4YA 3DPRA 3B01A 1RUD2 1DQ5A 4XFFA 2G4IA 4K3UA 3B94A 3U4XA 4A3XA 1LOGA 3H7YA 1PK6C 1W6NA 4MXVA 3GNEA 4S2HA 1APNA 5DDJ2 4QHBA 1YFWA 5T5JA 3MPPG 3CEWA 3MIDA 4YYOA 1YO8A 3M3EA 2Z42A 2JE9A 3VBUB 4C90A 3J8F1 4GB31 2Q8OA 4DRVA 2RR13 2I2SA 1NG0A 3PVBB 3ZFEC 2ZX2A 1NA1A 1BBT2 2PHDA 4Q4V3 4Y4YA 5DXDA 1GZCA 4LBKA 4Q8KA 4HN1A 5IK4A 1LENA 3J8F3 4GB33 1FATA 2TEPA 2ZMKA 3RZZA 3ZXLA 4NN0A 1HRI1 4XF3A 1W6NB 1PGW1 1V6OA 4ZU4A 3VDDC 2B5HA 1H1AA 1ZBE2 3HT1A 2C5DA 2UU8A 4XW3A 2BTVC 2CGNA 1N3QA 2MEV2 2HWC1 2GZWA 1EY2A 2B39A 2Y0OA 3FLTA 1YUDA 2IXKA 1RUJ1 1HRI3 4HSJA 1TQ5A 4AYUA 3H1YA 3KS7A 4B7KA 3ZXFA 1NA1B 1XNKA 4RHV1 1Q8OA 1NE6A 3VBRC 2HWC3 4I3PA 4C0BA 3EXUA 1F8VA 1VBE2 1QJU3 1X82A 4L97A 3ZXDA 2R30A 4DPNA 1LEDA 4YRDA 5JAXA 4XXPA 2HJIA 4K7JA 1VALA 2RS13 3H50A 1QU0A 1CPNA 3NAPC 4AF9A 5A32A 3O14A 2H0VA 2YV8A 4BHPA 4FCAA 2E7TA 1IKPA 3ZSJA 4F8AA 3B9CA 4LBQD 2WQZC 4Y24A 3VBSA 1Q5OA 2A6YA 3JB8A 3RSJA 3ZYPA 4LBOA 1HKDA 1DZQA 4IV1C 5A3MA 1KXGA 2WT2A 1WA4A 3UL2A 5I8YA 2VOVA 1LJ7A 2RE9A 2VVEA 1DBNA 1PO23 4JGYA 1CPMA 4LE4A 2R041 5DUVA 2EXJA 2Y0IA 5K8SA 1SBFA 3OTFA 2F4PA 3R6SA 4G3YC 3ZXAC 1CAUA 1GV9A 2A6WA 2VW1A 4HN0A 3FC0A 4AEJA 4LUKA 3WG2A 2H6CA 2ET1A 5C33A 3O12A 4KU7A 2PQQA 3L2YA 3R4DB 5KHGA 5JI9A 1QOSA 1SBEA 4UBGA 4ZU7A 1VRH2 3TNQA 1C1LA 4Q4X2 1AR71 1RB8G 1ULGA 1XNDA 1RUD1 4JGYB 2VH9A 1W6OB 1HXS3 4N7IA 4LHKA 3CJIB 4AQTA 2VW2A 3FE5A 3NL1A 4XOGA 1AR73 2QZ2A 4S2FA 5C8CC 2R072 5F9TA 3T2TA 3ACLA 1GYKA 1OD5A 3MZHA 3I8TA 3V56A 4COUA 2AR6A 4JGZC 1OQ1A 5HBAA 1SLTA 1XU2A 1RMU2 2D3SA 4R4ZA 1QXRA 1H8VA 4DQAA 1CJPA 4YM1A 3FFZA 1IKQA 3THPA 3WDUA 5I0TA 3B7MA 2NPIA 1AX0A 2ZGUA 2MEV1 5KHKA 1O5LA 1UIKA 1REDA 5LRSA 1FAYA 3AYAA 1OPOA 1G7YA 2D5HA 2GC3A 1MS3A 1RJ8A 1ZZ8A 3KMHA 4FPFA 1MACA 4TZDA 4GA9A 3GBWA 2MEV3 4BIFA 3ZXEA 1O7FA 4OFGA 1VBE1 3WCSA 1QF3A 2ZX4A 4XF1A 3PJQA 1V70A 1C5IA 1FMD2 2OUHA 1AX1A 5L19A 1B09A 1ASJ2 1TEIA 1HV1A 1WD4A 3KM5A 5L73A 2BVVA 1F9KA 4HL0A 4L8QA 3CLPA 4TSVA 3ST7A 4DY3A 4QPIA 5JI7A 4FPGA 2YGLA 3WQ1A 2UY9A 4DB5A 5FREA 4NVPA 1FYUA 1RUOA 2OYZA 3SITA 3GYDA 4AK3A 4E9KA 3BCWA 1HQNA 3ZIWA 5H9PA 3TOJA 2ZZJA 4DMIA 5AFBA 2R0FA 1DGWA 5AC92 2GU9A 3GALA 4X6RB 2NMNA 5E88A 1AR93 4TWTA 3M3OA 3SH4A 3VKLA 1QQP2 5IK8A 1VB2A 1DQ6A 2W08A 3AMQA 4IERA 3RI9A 1C8NA 1H9WA 4AVBA 2PA7A 1ZREA 4U2AA 1NCRA 2QVSB 1ZRFA 5F1RA 2PHRA 4AI2A 4DXZA 4CDWA 5JWPA 3B02A 1VRH1 1I5ZA 3H3ZA 1ZVFA 2PLV2 1POV1 1NCQB 4XHBA 4QXKA 1CIWA 4D94A 2GDFA 3MIEA 2YC0A 3LCPA 2YUEA 2XBO3 3MGUA 4GIQA 1CVNA 2WZPP 4HANA 3ALQA 2ZGOA 4LA2A 2R071 1F5FA 2WIIB 2Q4SA 4CDWB 1BJQA 1O4TA 4PIZA 2I45A 4TLFA 2VNGA 4QPGB 2Z69A 3GBGA 1WD3A 2A73B 5BNPA 1RUH2 3ILNA 1EPWA 1TME1 2AREA 1POV0 1T6GC 5KHIA 4WZCA 1XNBA 2O0OA 1LHOA 4I0BA 4JGYC 4BCUA 3OPZA 5EYYA 5T5LA 3CJIC 3RMXA 1TME3 3U0ZA 1N1VA 2WINB 3LSDA 2IXIA 1K5MA 5JLVA 3ATGA 4QPYA 1QDCA 5CFDA 3WQ7A 2XPJA 4P9WA 3E6DA 5I0RA 2AENA 1W0PA 4AGVA 2DUPA 4XBNA 1CQ9A 1FMD1 4D3WA 2BFUL 4QGNA 2XWBB 1ZZCA 1YI9A 3B5LB 1WCDJ 1XYOA 2A70A 4JDNA 1COV3 3MW4A 1PGL2 2OVUA 4AHWA 2VUJA 1NXD1 1K5MB 2P17A 3AYEA 4JRAA 4CP2A 1VJ2A 1CD3G 3B00A 4MYEA 4OHVA 5EJ3A 3VUOA 4YG3A 1AJOA 1NZCA 3SNMA 4XE9A 3X29B 2ZACA 4GWMA 3USSA 2BYVE 3WX5A 1QOOA 1D4VB 1HRV2 1QQP1 2YROA 3KCXA 3HD8B 5K0UB 1WBFA 2VVFA 1G6NA 5E1RA 2XLGA 4XHXA 3MYXA 3N7JA 5CG8A 2HWF2 2ZA9A 4GWNA 1J1TA 4YLZA 1MEC2 1IHMA 5KC5A 2QDNA 2E63A 3NKTA 1REEA 3AKQA 1VBD1 3TB0A 3OY8A 3D82A 2GC1A 4C91A 2QNKA 3QH6A 2PLV1 2UY8A 3H1WA 5HCBA 5C9AA 3D0SA 2JJ6A 2HWB2 1AYM2 2JD4A 1S2BA 1NE4A 2YYOA 1ZZ7A 2TNFA 1X50A 4BQ1A 1VBD3 3HBZA 5EFUA 2ENRA 4PDWA 2P34A 4R9BA 4RD7A 1LEMA 3N35A 2RM22 4Q4W2 1D0GA 2DCKA 1C8M2 3WW4A 2NP0A 3I7DA 4RQPC 1VIWB 1DLLA 1YJKA 4YGDA 4L92A 3VBUA 1NYWA 3OY8B 4G9SB 2JDZA 5C9AB 2XJVA 1JXNA 5FBZA 2A5ZA 5I0UA 5BNOA 1RUH1 2ZGPA 4Y20A 5GALA 1OKQA 4Q2FA 1KQRA 1WMFA 3ZFFA 1NCQC 3INAA 1NY72 1AJKA 2WJSA 4PDWB 2DCYA 4JC1A 1MZFA 4MLOA 3ES1A 2CAUA 3POWA 2P37A 1UMZA 4BE3A 2OZ6A 4RL7A 3KD4A 5JMCA 5KXDA 3VZOA 2BGCA 4HBNA 4QQHA 5CFCC 3DV8A 1IQAA 2ZHLA 3S7IA 5BNOB 1M06G 4CDWC 5J7MA 2WZR2 4ITCA 3KT4A 5T52A 1VBB2 1S0DA 4QPGC 4XF9A 4HKOA 1WLWA 1PIV2 1J59A 2VOKA 3M3IA 1C3HA 2ZOEB 1AR82 2GNDA 1ZRDA 2JG9B 2X8KA 3S0MA 1PZ8A 3AX4A 3D0JA 2YPJA 2GN7A 4JDMA 1Q8SA 3B93A 1YIPA 1BYHA 1RUI3 4WV8A 1FX5A 5C8WA 2DFBA 4HPKA 2IFRA 1LOFA 1PZ7A 4Y1UA 4MX3A 3TAYA 4P9GA 1B35A 2QJVA 3JQWA 3FBYA 1HRV1 4G4FA 1Q8QA 3C3VA 1JUIA 4FT8A 5D1IA 2D3RA 4CEWA 2IC1A 5T55A 2SLIA 1JOJA 2HWF1 4MH0E 1HRV3 2CNAA 2VY0A 1UCXA 4HPKB 3GHNA 1FXZA 2FBEA 3B3QE 2YMZA 4RGGA 4ATEA 1AR62 3AJYA 5FPZA 1H1MA 4ES9A 1B35B 4M3CF 3OYWB 4XJAA 5D8AA 3AXDA 4COWA 5ACA2 3ZVXA 4QD2A 3TWIA 2HWB1 4I2OA 5LEKA 2MNGA 3QD6A 3AM2A 2R062 1QXPA 1WBLA 1PVXA 1KJLA 1PZ9A 3MICA 2GSYA 5K0UC 5GZCA 2RM21 3WW1A 5LK5A 4BIOA 2AYHA 4EN6B 5GLWA 4MXWA 4YNIA 1O3QA 2Q1ZB 1DGWX 1GNHA 4FOWA 2A6ZA 4RS5A 2G9GA 2E7AA 4AFAA 2H6BA 5KHJA 4HVQA 4XTPA 5DG1A 2PHTA 2PHWA 1S55A 2WT1A 4CZSA 1NY71 3AP6A 2WS92 1HX6A 1AYN1 4QGLA 3RMYA 3UK9A 4P14A 1O3SA 3KGLA 1S1AA 3LOIA 4WM8C 2D5FA 3AP7A 4IEQA 3WDXA 1S0EA 1NQDA 4IEXA 4AVAA 1AYN3 2HEWF 4RS5B 4WZFA 3HN1A 3ZSMA 1YI7A 1BVVA 3UKNA 4N53B 2RMU2 1RUG3 1DIWA 1TE1B 5FAXA 1ZYBA 2IFWA 1PIV1 2ZMLA 5C9AC 5FDBA 2ZZQA 4L11A 2VQ0A 1AR81 2A6XA 2WSVA 3ZMOA 5L7OA 1G9BA 2PHXA 3JBG2 3CU7A 3JU9A 4PDWC 2X5IA 2D6OX 3JB4C 3VBFA 4CDXB 3H9AA 1ULEA 1QJY3 4K1ZA 1AR83 1S0IA 4XIOA 3PVOA 4Z07A 4MV2A 3VZMA 1VAKA 4YVSC 1WLTA 2GC2A 1IGOA 4H14A 2UWAA 1VP6A 2HEYF 1N3PA 2Z79A 5JOZA 1BQPA 3OD0A 4LNVA 5L7OB 3D5OA 1VLNA 2ZKNA 4R4XA 2OPKA 3FZ3A 3SHRA 4AI3A 2WFF3 4FTBA 2GH8A 1FOD3 2JG9C 2HWE1 2WA3A 3WP4A 2EAKA 4AI8A 4K9SA 2DWRA 1RVF1 5FO9B 2OZJA 3VKFC 3VBOC 5KXEA 1WCKA 3AKRA 2P2KA 2VQAA 3AMPA 2AZ5A 2ARBA 2ZAAA 2HWE3 1QH7A 5GZDA 1OOPA 1LGNA 5ACA1 1QH6A 1RIRA 2VVDA 2WT0A 1RVF3 3TRSB 3RPQA 3SLIA 5JPMB 3U07A 2R061 1QDOA 5FCCA 1R082 3N3HA 4HMZA 2XJSA 1LGBA 3PMEA 4BWOA 3ASIA 1LOEA 2WKKA 4WVVA 1YFYA 4BOWA 4C1WA 1ND2A 2GAUA 3DPRB 4C1XA 2CGOA 3OJBA 1MVQA 4Q29A 1CGPA 2IXJA 3PNAA 3MFCA 3JUUA 1H2LA 1XNCA 3KZ4C 4JRLA 5FLJA 3RDIA 3WP5A 5CBLA 3ZYGA 4FPYA 4CDUA 4Q0QA 1LCLA 1RUE2 2KM2A 2WNEA 2RHPA 4J6GA 2E51A 2JENA 2UWCA 4YZ5A 5A33A 4R9CA 1I9RA 1L3JA 4M0NA 2W68A 4HKLA 1JH5A 4JTNA 3THTA 4YSFA 2WS91 4ISQA 1V9U1 3ZPYA 1DZTA 4B8EA 2Y26A 2D7FA 2IXHA 1IS3A 1RUJ3 1V6JA 1Q56A 2OUJA 5H9RA 1R1A1 2D6LX 4HLTA 1YHFA 1V9U3 4RHV3 4JQRA 1DU3D 3OD4A 4CDUB 1RUC2 1W2UA 4FTSA 1MS9A 1QJX2 4AFBA 2RMU1 3QACA 4MGIE 3WG4A 4EN7B 1XYNA 4BM8A 1R1A3 1DGLA 5A33B 4CYDA 3O5SA 3IWZA 4NOTA 4BZ4A 1JW6A 4YW3A 3ELNA 3WP6A 4H7MA 1AZDA 1DZRA 4XFAA 1MS1A 3LKJA 2LTNA 1LHWA 1VAVA 2RMU3 3FWEA 1DHKB 3JBG1 3NV4A 1CAWA 2VULA 5C6CA 4Q26A 5JSRA 2B45X 3PMSA 1YLLA 2GNTA 4YZ4A 3MEPA 2WFPA 5T5OA 4E2GA 4QU2A 4ZXKA 4BH9A 4AFDA 3JD72 2DF7A 4QQOA 2ATFA 2ET7A 4CEYA 4RS5C 5A32B 2HYKA 1QY4A 4N53C 1W0OA 1W6QA 3RYRA 3VBSB 4GMP1 1GQGA 4LBLA 5DZGA 3VLBB 1GZWA 2R043 2R49A 3N7MA 3BOPA 2GALA 1ND3A 2QFEA 3VBHA 5JOYA 3WCRA 4GMP3 3EO6A 4CDXC 3PJYA 3HQXA 3KT7A 1HV0A 1Z78A 1N47A 1ZZ6A 3AP9A 4UBHA 3MLKA 2NM1A 4ZU5A 5CVRA 2PN5A 2Y38A 5DDJ1 1ENXA 4FO9A 1W6QB 1CAUB 1RUD3 1LULA 4PBPA 4IEPA 1VBC2 3MIFA 3ZYIB 5JSOA 1KITA 4AE2A 4YARA 1R081 5CG9A 1ND3B 4GMP0 5DDJ3 3ILRA 3VBHB 1CN1A 1E57A 1QJZA 1BBT1 3WD5A 5JZGA 4WM7C 1AL22 3HMYA 1WW6A 4XQWA 1R083 5JOXA 4LO5B 1D0HA 3AFKA 3VGIA 1J3PA 4AVSA 1BBT3 1ZBE1 4OI1A 3LWCA 3VHNA 4KWLA 4WVWA 4XILA 4R9AA 5I93A 1W6PA 2DFCA 2JE7A 4SBVA 5DG2A 2DURA 4DFSA 4D7TA 1ZBE3 2ZGLA 4PIXA 4YW4A 1GQHA 2NMOA 2O1QA 1GR3A 2VECA 2VU9A 5JZGB 2P3JA 1AVBA 1QNWA 1AX2A 5JVVA 5SV5A 2CGPA 3FJSA 4A2UA 4CP0A 1EP0A 4B4PA 2R6QA 3S7EA 4COYA 5J09A 2NN8A 3DPRC 2XKOA 3RQ0A 1RUC1 4KU8A 1VBE3 1YIFA 4Y1VA 1ZZ9A 1W6PB 2VMGA 4INDA 1G8WA 5IUQA 2K9ZA 1CAXA 4LBNA 2IXCA 1C57A 1BXHA 1RUC3 3WT3A 1AXZA 2XKPA 5CADA 3N36A 3FHIB 1UZYA 2A3XA 3POSA 1LU2A 3AKPA 1MZEA 2XH6A 3WDWA 1NA1C 2RS52 5FTTC 4NHKA 4LUMA 2PAKA 1GKBA 3N4MA 3JD71 2JKBA 4QPIB 2E7QA 4FPOB 2E53A 3AZXA 1A8DA 5GJ6A 3L9JT 4YW2A 2R0HA 4MSVA 4CDUC 1CAXB 3TYJA 1Z7S2 2UWBA 1GFF2 4FP2A 3H7JA 1WLDA 5AVPA 1N1TA 5F6LB 1YXWA 1RTVA 4FAGA 3N7LA 1H30A 2DUOA 4E2QA 4FAHA 3KCYA 1RL3A 2ZGSA 3IDEA 4Q4X1 1UW8A 3AJZA 1BCXA 3PVEA 4N9IA 5F6KA 4KBBA 1CAVA 1VRH3 3HAGA 2EF6A 1POV3 4KG8A 1KDMA 1UU6A 4Q4X3 1NCRB 3NV2A 4FPLA 3BPZA 1SLAA 3NO8A 4COZA 4KGGA 1VBC1 4UW3A 2B7YA 4XBQA 4NWVA 4B29A 2D3PA 1N3OA 3ZN6A 5CIRA 2ES3A 3VBSC 2FQPA 4XF0A 1LOBA 1TNFA 2BEOA 1ENRA 3LA7A 4FP3A 3ZSEA 1RMU1 3IPVA 1QWRA 2OIIA 2R073 2NQYA 1AL21 3RS6A 3DL3A 4QQLA 3WVJA 2D6PA 1PMIA 1G9FA 4XMIA 3G7DA 5JR7B 1UAIA 2XLAA 1EV12 4M0HA 3ZYRA 5K7PA 1RMU3 3HIFA 3MI8A 1SLIA 1G86A 1EYBA 1NOVA 1AL23 2CAVA 2ZABA 4LA3A 4IV3A 4IXLA 3KLSA 1O3RA 1A6CA 2BW8A 3HR9A 4KL1A 4W6WA 1RGSA 4N90A 4OHYA 2UYBA 4DOUA 3GBFA 5GZFA 4AQSA 1NLSA 1R092 4A7ZA 2P3KA 3LB9A 3IPVB 4M00A 5BNPB 2YZ4A 3OCPA 4HKWA 4XMAA 3WUDA 1LB2A 1H2NA 1KS5A 4N43A 1VAMA 4LHLA 1ASJ1 4JCKA 1MQTA 2RS32 2YHJA 1MS4A 3R4SA 4HFSA 2IWGB 4LBMA 4M3CA 2JG8A 3AP4A 5HI0A 4IV3B 1C28A 3ZFGA 1CX4A 4MGZE 5FO7B 1VBA2 1FMD3 2D6MA 1ONAA 1ASJ3 1F5JA 4A7YA 2ZGTA 3V0AA 3NWKA 4JVAA 3J9SA 3ZN4A 3ENRA 2XVLA 1ZBA2 4YGCA 4D7YA 4EWAA 5CFDB 4GH4A 2Q0AA 2WSUA 3WZ1A 1CESA 3WG1A 3RYKA 2D6NA 2RS51 4Y1XA 4I30A 3FBMA 5AC91 5JZGC 5EYXA 1MQTB 4OLLA 2WC2A 4I0WB 3IBMA 4M3CB 4E27A 3D8CA 2JG8B 2IZWA 3VHRA 2XB6C 3ZFGB 4AWDA 3ZO0B 1LODA 5AC93 1W6MA 2EAAA 2XL9A 3MIGA 3J26N 2ZPXA 1M4WA 4AI1A 3ZIXA 1QQP3 2PELA 1YNAA 1Q3EA 3WW3A 3WY6A 3V64A 1S0JA 2ZX3A 4UXAA 3QLQA 3C2UA 3IDCB 3NW4A 3VZNA 2E9QA 4XJWA 3HT2A 1PVC2 3GF6A 4I01A 4JDOA 3KSCA 5FO8B 4AQ2A 1AUYA 4Q4Y2 5FMOS 2XJQA 1TMF2 1PM7A 4EV0A 2JXAA 4K8FA 3AMHA 1V6LA 2PLV3 1LOCA 4QPIC 1O4ZA 1SFNA 4PCRA 5FFOC 3ZX7A 2CY6A 3LA2A 2XG3A 4AHXA 1DG6A 1J58A 1SCSA 4F83A 5BUVA 2HWD2 2DYCA 2BNMA 3IDBB 5J48A 3K51A 5BNNA