1C3HA

Acrp30 calcium complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
137
structure length
137
Chain Sequence
b'AYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30 KD ADIPOCYTE COMPLEMENT-RELATED PROTEIN PRECURSOR
publication title ACRP30 calcium complex
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 24
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c3hA00
2RE9A 1RJ8A 3ME2A 3L9JT 4MXWA 2E7AA 4MXWB 1TNRA 4KGQA 1WCKA 1D4VB 1XU1A 1KD7A 4OULA 2WNUA 1GR3A 2O0OA 1KXGA 1O91A 2AZ5A 1D0GA 4QPYA 4GIQA 3IT8A 2JG9C 4TSVA 3LKJA 3TWIA 2WNVB 3K48A 4QQOA 2Q8OA 2KA3A 4OUSA 1DG6A 4OUMA 4F3JA 5KC6A 1OQDA 2WNUC 3WD5A 2R30A 1RJ7A 1D2QA 1IQAA 5BNQA 1C28A 4QQHA 2JG8A 5HBAA 2JG8B 4N90A 4EN0A 4NN0A 2TUNA 2Z5WA 4TWTA 2WNVC 4RSUA 2TNFA 4D7YA 2HEYF 4E4DX 1JTZX 2WNVA 3QD6A 1ALYA 2OIIA 3MI8A 5KC5A 2JG8C 1DU3D 1U5XA 2Q1MA 4MSVA 1U5ZA 1C3HA 3URFA 2HEWF 4E4SA 3K51A 4KGGA 4QQPA 2X29A 3V56A 2RJLA 3FC0A 3B9IA 1S55A 2RJKA 2ZJCA 1PK6A 5KWRA 1PK6B 2JG9B 4MXVA 1OQEA 5L36A 5TSWA 4J6GA 4QQ2A 1TNFA 3ALQA 1JH5A 3AB0A 5CIRA 2QDNA 4G4FA 3QBQA 3TYJA 1I9RA 2WNUB 4HT1T 1XU2A 4KG8A 1PK6C 1U5YA 2ZPXA 1OSGA 4DOUA 5L19A 4QQLA 4DB5A 3B93A 2QE3A 3B94A 2JG9A 2R32A 4G3YC 1A8MA 2R6QA 2HEVF
chains in the Genus database with same CATH superfamily
3LZZA 3J8F1 4EN7B 4PIZA 4WVVA 3RS6A 4FTSA 3KZ4C 1NAEA 1NG0A 2X53S 4K3UA 5F1RA 3O7OA 1APNA 1XC6A 3ZM8A 1C8M2 1OVPA 4BXSV 4CUCA 4FTEA 5HXMA 4IEVA 4D0QA 4P9XA 4BYYA 3DGTA 2QFEA 3MHZA 2R0HA 5FYUA 1RC6A 3MO4A 2XKOA 4ORFA 1J3RA 3KVAA 4FI9A 3KHCA 5FP3A 5LA2A 4Q0UA 1O8SA 4LHLA 3BKZA 3I54A 2YROA 4CXXA 5J7MA 2FCTA 2VG9A 1CAWB 5G05L 3VD5A 4Q4V3 1K45A 1V6NA 2RJ2A 4E8CA 1H1AA 2FZ2A 1W6OA 1LU2A 1OF4A 3P1IA 4NWWA 4UF0A 2R30A 1QJU1 2IXHA 5BXXA 4Q1RA 2VZQA 4KI5M 2WT2A 4LXLA 3H0OA 2W46A 2VZ3A 4QU1A 1PIV1 1W2UA 3LIGA 4EZHA 3AK0A 2VBDA 1FPN2 3ZR6A 3EO6A 1UYZA 4UWDA 5C6CA 3PDQA 3GM8A 3ACIA 5FY7A 2QQUA 3RZGA 2WNVA 4AYUA 5LA1A 2XBO2 1H8VA 1UX6A 4EN6B 2P17A 2EICA 1RUH3 3UJQA 1W3VA 1XJAA 2R072 4Y26A 4CDXA 1V9U3 2GH8A 2OQ7A 2LTNA 2Y0OA 4CCOA 3VD9A 5F6KA 2RDNA 4FSJA 3PVEA 4LIVA 4GWMA 5FPVA 4GMP3 3AZWA 4JKMA 3KVBA 2P34A 3Q8CA 4XUNA 3VBFA 3VBFB 2D6LX 3VDDB 2YY1A 3ZSMA 5GLZA 4BDVB 5DAXA 3ACFA 3SKJE 1RUC1 2RS52 1LKNA 3WINE 1HXS3 4COZA 4DUVA 4YZ3A 5DG1A 2W1UA 5CG8A 2G4IA 3FMGA 2BGCA 4IGPA 5IYYA 1SFPA 2C0ZA 1Y9MA 1Q8PA 2CGNA 4AVBA 1W6QB 4IV1C 4RYDA 1PGW1 3M3QA 4XFIA 3MYXA 4QPGA 3H3ZA 3H9AA 1JYWA 4XYXA 4YGEA 2WR9A 2XR4A 3UV9A 4L92A 4CU9A 5A3UA 4AWDA 1LODA 1CAUB 5FZ1A 5M0TA 3ZPYA 4XE9A 1DYOA 3FZ3A 3H1WA 5JVVA 4LA2A 4DB5A 4JQRA 2WZR2 3VV1A 5CADA 1CGPA 1WW6A 2VXJA 1T6BX 3Q9OA 2VMHA 3USUB 1LGBA 2AUYA 1KJLA 3N7LA 3FBMA 4Q26A 4TTGA 4FQZA 5FYTA 1S0GA 2Z42A 2IXCA 4EQVA 4B4QA 3ME2A 3L9JT 5GZCA 2C9KA 3H3LA 3TN91 3AL5A 4CCEA 4W6YA 4C8DA 3KD4A 1G9BA 4QMAA 3H8OA 4HLTA 2XVLA 2JB8A 3JU9A 3LWCA 4LLOA 4YVWA 3S5QA 1JXNA 3WDTA 1DIWA 1SCRA 1OOPA 2FHRA 5IJRA 5JI7A 5K9YA 2W87A 4LO7A 2B8MA 1Q8QA 2RDSA 1COV2 2NYYA 5FLJA 1TME2 1C57A 2JG9C 3A23A 4GIQA 4YM0A 3PVNA 3JD73 1LEDA 1GICA 4OHXA 4NMIA 1OFSA 1OMIA 1WCUA 1YI9A 4IEWA 2BGOA 3UYJA 4QPIA 3D3AA 3G6JB 2Q8OA 3GCXA 2QKDA 2P3YA 3I7DA 3KV9A 2XLFA 3WDWA 2A70A 4A42A 4XC9A 2OW4A 2DCYA 2VMEA 2R041 5FZLA 3CJIA 3THCA 3CJIB 5KHJA 1RUG2 4BQ3A 1HIXA 1VRH3 4YWAA 1X82A 3JB8A 2AYHA 4WZCA 1RUE1 2ZMLA 1WW5A 3NV2A 4S2DA 4URAA 2DUPA 2ORXA 2TNFA 4IEOA 3QCWA 4L0PA 1N1YA 3CLPA 2BPA2 4C1XA 4UAPA 4E4DX 1OURA 5T5OA 1H1IA 4QXHA 2ARBA 1W0OA 5I8SA 3NO8A 5IW0A 5L7OC 3VBRA 3MUZ1 1BKZA 1CN1A 2DFCA 1ALYA 2OIIA 3PTYA 1JS9A 3ZXDA 4O61A 4A44A 4CDUB 1HQNA 3GDBA 5H9PA 3AFKA 4OLLA 4MX3A 1OLMA 2B45X 1JW6A 2W95A 1L7QA 3LSDA 4HPKB 4EE2A 4Y5Z0 4YARA 4CP9A 1XNTA 3IBMA 1O4TA 1Y43B 2D6KA 3K51A 4V2WA 4COUA 4DUWA 3U0ZA 1I1EA 4OMCA 4IGQA 1FOD1 5C9AA 1ASJ1 4XZPA 4XJZA 1GLHA 4BK5A 3INAA 5AFEA 3VBSB 4AI1A 4JGZC 4DZGA 1OD3A 1CONA 3BPZA 4ZZ8A 3WNPA 5HV4A 3OUIA 3M7AA 1ULPA 4NPLA 1Y9GA 3KF5A 4BQWA 5J1XA 1LEMA 2X5IC 4XCBA 4PDWB 1ZRDA 2VOVA 1OLME 2PAKA 4FVVA 3F2ZA 3VHNA 5BY5A 2FDKA 3AB0A 5L73A 1HV1A 4ZZ5A 1GBGA 3K3NA 1EUUA 1YIFA 5GZFA 1ND2A 1VAVA 1ND2B 2FQPA 2UU8A 3CBNA 4AHWA 2WUHA 4AL9A 4P14A 4A41A 3R6SA 4OZOA 3POYA 1KEXA 1UYXA 3N9QA 5A32B 2ZPXA 1XNBA 4I0BA 1SHWB 1R083 3BOPA 3UGGA 2VQTA 4A3ZA 4X6QB 1UMZA 3J7NA 1ULDA 4RA0A 4EV0A 4CUBA 3H8UA 4Q4X2 2ZS6B 3BU7A 3C7OA 3KT1A 1JOBA 1AYN1 1JYCA 3VBUC 3WF0A 2RMU1 4URTA 3WW2A 2C24A 3POWA 4F8AA 1OUSA 5LWBA 4KGQA 2VL4A 3GNEA 3LA2A 4QX0A 2VJXA 3WQ0A 2PMWB 5LASA 5DQ0A 2ZHKA 3E5QA 3N9NA 5A3TA 1BEV3 5LY1A 2J7MA 3C8XA 2HWD3 2VOTA 2WFF2 4ITCA 1O91A 4AEDB 2XBO3 4XEZA 3I97A 2NZ9A 4RHV3 4ZPIA 5D21A 5FPXA 5KHKA 1BJQA 2WJSA 3AP9A 2E51A 4A7ZA 2JDKA 1GP6A 2WIIB 4K21A 4FAGA 3KCXA 1QQP1 3GF6A 4P5YA 3VL9A 5FXVA 1FAYA 1JZ6A 1ZYBA 3LFMA 4XXAA 3O0XA 2GNDA 2WNUC 3LEGA 3THTA 3AKSA 3SXWA 2BNNA 3ZN5A 5FY1A 2Z79A 5DUXA 4OHZA 4N90A 4HSLA 5FYZA 3GBWA 4EN0A 1JI6A 1VBD1 2Z5WA 1H8TC 2WNVC 2R49A 5FZ3A 4AEJA 4XW3A 2C1FA 2VW1A 4A45A 4QDQA 2W91A 5LATA 5H9RA 4CPBD 3TEWA 1MVQA 1DF0A 4CDXC 1KRIA 4AR2A 3U4XA 2ZXQA 2NP0A 4ASLA 4WM8A 1FNYA 2MEV1 3OUHA 2G9FA 4JKLA 4XFGA 1NY72 3RJRA 1TMF2 3K77A 1YQ5A 3N9LA 5KC5A 2WQ8A 5BV6A 2JDAA 1H4GA 3VD7A 1JYNA 2JE7A 1B35B 1OUXA 5FO8B 4WZFA 1S0DA 4I30A 4DXSA 4IV3A 3URFA 4IV3B 2YC2A 3E1F1 3D8CA 1OH3A 3HD8B 3LE0A 3MW3A 1RUI2 3N7JA 4LHSA 2LROA 3APBA 4EROA 5JSOA 1IOAA 2J1EA 4FXGB 1GOGA 4H14A 2D3RA 4QQPA 3V56A 3ZKUA 2HWB2 5AC91 4DXRA 4OHVA 1NA1C 1VPHA 2P3KA 5F7UA 1H30A 3WF2A 1UU4A 3AP7A 3ZR5A 2YPJA 3THPA 1IGOA 5T5LA 1QOOA 1PM7A 3DUIA 4CP0A 4IESA 4QPGC 1O5UA 2BQPA 2LALA 3KCYA 4PBPA 5LA9A 3GCWA 2WC2A 5ANQA 1H0BA 2BFUS 1EYBA 5CFDA 1PGL2 2PXJA 3NL1A 4Q4Y1 1B09A 2I2SA 1F35A 2EXIA 1NCQA 4GJZA 1COV3 1J1LA 1TME3 3PUSA 1CZTA 5FKBA 1FMD1 5E16A 2Q1FA 1VB2A 5CFCA 1YUDA 2P6CA 4KQ7A 1WLTA 1U5YA 4OCTA 1CX4A 1PVC1 3U75A 3VKLA 3SLIA 1MQTC 4GJYA 3KHBA 4AW7A 1XYPA 4LO8A 1ZVFA 4A3XA 3I3MA 2GC3A 4D69A 1RUJ1 1H2MA 3A0KA 1QNYA 2D98A 3I59A 3KS7A 2R6QA 2W1SA 1XNKA 2ZGKA 5FMCA 4AI9A 2VZ1A 4YVWC 3ROUA 1UL9A 4MGTA 1JHNA 2G19A 5D8AB 1FYUA 5C3PA 1VBB1 1DZQA 4QX2A 4XUTA 3UKVA 1H6XA 1YFYA 3AJZA 3TOJA 4BWOA 5JOXA 2NLRA 1DDLA 1YFUA 1UQXA 4OULA 2VZOA 1BVP1 2XONA 2E7QA 3S7EA 3WF4A 4QPIC 5C7GA 4DRVA 1R64A 4M00A 1Q43A 4I2OA 1H4HA 2EIDA 2ZEXA 3JBG2 3R0RA 1Z7S1 2DFBA 3K4AA 2A3WA 2WO1A 4ASMB 2GN7A 3A7QA 4QQOA 5SV5A 3U78A 3O12A 4W4ZA 2PQSA 3I3EA 1SLCA 4E4ZA 3QH7A 1LOBA 1YXWA 1F4AA 1JODA 4HBNA 5DDJ2 3ETPA 2RS31 1W6NB 2CYFA 5JXIA 3PURA 4YGDA 1JZ3A 1SLBA 3ZIXA 1D7PM 1RIRA 4CDQB 1W3XA 3MBWA 4D6SA 4IEUA 4LBQD 4CXYA 2ZGLA 2VNRA 1RB8G 1FT9A 5LRRA 3LOBA 1Q8SA 1GZCA 1DGWA 5FOJB 1FV3A 1VE0A 3GJBA 4IUGA 1MEC1 5F9TA 1DZRA 3AZZA 1H9PA 1W9YA 3KV5A 5FUPA 1REEA 3TNPB 1J1TA 1AXYA 4KU8A 1GP5A 1NCRB 1ZBA2 3U07A 4EJRA 1LR5A 5FJHA 1KFUL 1LU1A 3NV3A 1O3SA 1RUF1 1WA4A 5CKNA 1AR72 1RVF2 4FPJA 1XXNA 1ULCA 4D8MA 4AFBA 1YQ2A 4CUAA 2P1BA 2ILMA 4OQ9A 4Y33A 1U0AA 4HN1A 3H8RA 5I8TA 4BU2A 2F6BA 2B9UA 2MNGA 4Y1XA 1JYXA 2HLEA 1EV11 1Y3TA 4UFIA 4BZ4A 1DQ6A 1Q56A 2R063 3AXEA 4MGQA 3ZYRA 1W9SA 2A75A 5JR7B 1F5JA 3SEEA 3VGIA 4CCKA 4WM7C 1SDDB 5A3WA 4K1ZA 1NQDA 1UKGA 5ISLA 2FMYA 3RZMA 1XYOA 3TRSB 1XQNA 2Z4FA 2AH2A 3LGRA 3LEMA 4R8HA 3V65A 4AF9A 4YM2A 3M2MA 2IWGB 1DGRA 3DKWA 5TSWA 1PO11 1GZWB 1VLNA 2J1RA 1OKQA 3U11A 2PHLA 5A6QA 4NHMA 3WXPA 5FZ4A 4LULA 4CUGA 1W90A 2VUAA 3QH6A 5JXHA 1QIQA 4DEQA 4AQ6A 5GLTA 1AVBA 3PU8A 3PTRB 2QNKA 4GA9A 2YBKA 5KHIA 4NRQA 4S2GA 5FRAA 5LEJA 4U2AA 1QXJA 4MGIE 4META 1LHOA 4QPWA 1IS4A 1DGRN 5FPZA 2XPJA 3SCGA 1HRI3 2QE3A 4NPRA 5IK8A 3JCIA 1G9FA 1AZDA 4K20A 3J7LA 4KWKA 2GAUA 2C6SA 4LOSA 3S7IA 3CDZB 4BMBA 2SLIA 2ENRA 3PJYA 4CA9A 4HK9A 4QWNA 2BWAA 1GV9A 4QHBA 5H9QA 1OBNA 3RRDA 3D0JA 1C1FA 3JQWA 1NT0A 2XOMA 2J1UA 2Q5TA 4HMZA 1ZREA 1YC61 4XABA 3I2JA 5AVPA 2XH6A 3WF1A 1CZSA 1OD5A 2ERFA 3ZFGC 5JOYA 1GMMA 4FXKB 3I2KA 1LTEA 4TZDA 2AEYA 5A3NA 4IE7A 2I74A 3DCQA 3LKJA 1TMF3 5I0TA 2HYKA 4R9CA 2JENA 4UBHA 3OB8A 2NPIA 3S57A 2JD4A 4Q1PA 2RM23 1N3PA 4YFZA 4CRQA 2VCAA 4LBQB 2VZRA 5CNAA 1RUI3 3I2GA 1HXS1 5K0UC 2Q8CA 3S30A 4BISA 1UYYA 2IVIB 2HWB3 3B5LB 2YC4A 3POFA 5A1AA 4LR4A 3S0MA 2BOJA 2PFWA 3ACGA 2WAOA 2BV4A 4N9HA 4IV1B 3NAPA 4E2QA 4NN0A 3O14A 1XNCA 3LIHA 3CL1A 4FFFA 4CXWA 3K3OA 3ZN6A 1V00A 1K5MA 1IS5A 1K5MB 5FYCA 2VQUA 1E5IA 2ATFA 4NIIA 5BUVA 5A1FA 3OPWA 1R092 4AI3A 4BQ4A 4HK8A 1VBA2 3VZLA 2BU9A 1BLZA 5C4WC 5FYBA 2RS13 2GALA 1GQPA 2XQRA 3KM5A 1N3QA 4AVTA 1HJFA 1U5XA 4LBKA 4P9JA 5EQUA 1F5FA 2P2KA 1U5ZA 4JC1A 5BNOA 5ERLA 4A7YA 4XFFA 1NX9A 3KV6A 3M3CA 4LE3A 2VCCA 1YNAA 4PF1A 3ZXKA 5JPMB 2CTVA 1QH6A 1QJY2 2D3SA 1XPWA 1JZ2A 1PZ7A 2V4VA 1CJPA 3ITQA 4XBNA 5KWRA 5GZGA 2JG9B 1TEIA 4NHLA 3H7JA 1QGLA 1OQEA 1CVNA 1GU3A 1LESA 2VQAA 2VW0A 3FBYA 4J6GA 4Q0QA 1RHI2 4YLZA 4JX0A 3UGFA 2JDPA 1IHMA 3E6DA 4MH0E 2YC0A 1D4M2 1ND3B 3T1LA 3P5BA 4O7XA 1QWRA 1UWWA 3PUHA 1RXGA 3BTXA 1ZRFA 4O9EA 3R4UA 3N3HA 4XCAA 2RR12 3JBG3 5FQ0B 2ZGOA 3LDBA 1NXD1 1HLCA 2JDZA 2JE8A 3LA3A 4FPOB 2WT0A 3LDKA 3M8LA 3T1MA 3VBHA 2J22A 1PK6C 5BNNA 3ENRA 4PCRA 1D0HA 2G9ZA 4IEPA 3H1MA 3AYCA 2JX9A 4J1WA 3IZOA 4LLFA 5FIXA 5FPBA 1VRH1 5DDJ3 5F6LB 1LRHA 1AR62 2W1WA 3ZXFA 2HWF2 1WA6X 3KB5A 1Y7BA 5C8CA 1PO21 3DV8A 3M3OA 3MIEA 4GWJA 3RJ2X 4E2GA 3NSTA 5JSRA 1S0JA 1UXXX 1W8UA 3DPRC 2XWJB 3LAGA 2BVBA 1HRV2 4QX8A 4N53A 1KD7A 3CHXA 1JZ8A 4CEYC 2OA2A 3WQ1A 4HXCA 2WLQA 4ARYA 4CEWA 2R1BA 3PU3A 3VD4A 1SLIA 3IKWA 3POJA 3I4IA 4QKDA 3RI9A 1GQGA 1FX5A 2W47A 3HQUA 3J26N 4W8JA 5B4XA 2O1QA 1EPZA 3B3QE 4C90A 4JGZB 5F8PA 5GKAC 4Z8BA 5FR3A 1PGSA 1VAKA 2KA3A 3P6BA 4N43A 4N43B 1LHVA 3O1OA 2Y64A 1QJEA 4C91A 4COVA 1AR93 4BK4A 1V6JA 2QQJA 1RL3A 2DVAA 2X5IB 4RGKA 1UZ0A 1S4CA 2VNGA 2P37A 1QH7A 4ONUA 5HBAA 1DQ5A 4ZY9A 2ZHNA 1SLLA 5JZGB 5HI0A 3ZLIA 5JZGA 4FBFA 1OPMA 3OPZA 3OOXA 3MPBA 4D7YA 4DO0A 3OYWB 2VOXA 2XUEA 3ZOIA 2V09A 1W9WA 3W21A 3MW2A 3KSCA 1WLCA 1BBT2 1NLRA 1YEWA 4NAMA 1R081 2DTWA 5DZFA 4D6QA 2VZVA 4N7IA 3QD6A 4FOQA 5EJ3A 5CA6A 5KR7A 1CAWA 2ZGQA 4AZZA 3U4SA 1EUTA 3VBUB 4L9BA 4B4PA 5FXXA 1DLLA 5IVFA 5A7NA 1WMXA 2EXJA 3N9PA 4AAPA 4EZ4A 3DYPA 2D5HA 1CQ9A 2YFUA 2YMZA 4CZSA 3O1MA 4KWUA 4ZXKA 5ACA2 4LTAA 4KGGA 4BQ1A 4BCUA 3IMNA 5I0RA 1X8EA 3VN4A 1MZEA 4H7MA 1F31A 4GB31 2LUWA 1V6OA 2IUWA 2UWAA 1DGWX 4AFDA 4Q4W3 4RS5B 1BEV1 4K1YA 1HJGA 5IHRA 2Z2SB 2HWD1 1HB3A 1IQDC 4H55A 4ATEA 5LEKA 1LENA 2OPKA 4RHV1 4QGLA 3B02A 4PI2A 5D2AA 5C3QA 2FDFA 5FFOC 2QQLA 1N1SA 3DN7A 2FDHA 4QM8A 4XF0A 4BQXA 3NJYA 4B1MA 2PTMA 1QJU2 2WSUA 2WS92 1TE1B 4NR1A 5LK5A 3RMXA 5L9BA 1GYKA 1Q8OA 2A73B 4DY5A 2OKXA 2BW8A 3BTZA 2W68A 2YZ4A 4OZXA 2RHPA 2OQ6A 2WNUB 1FV2A 1PIV2 2DUQA 3MFCA 1XU2A 4HT1T 4QX7A 1W0NA 1QOTA 5L9RA 1L7LA 2XJVA 3HNYM 3LEKA 1A3KA 4GALA 5F5IA 5LBEA 3OGJA 1SEFA 4YYOA 3S6PA 4LK6A 3VDDA 1H8TB 4IE0A 3T3YA 4GQ7A 4XTMA 3DXTA 1WKYA 4Y1YA 3ES4A 1LHNA 1NQJA 1YJKA 3OEBA 4HETA 1IG3A 2R32A 4UXAA 4I02A 1BCXA 2K46A 3MW4A 2RE9A 1LOCA 5T54A 4MXWA 2VR4A 4MXWB 3U1XA 4XDOA 1W6QA 4QKNA 4CCNA 4OUEA 4RR3B 1K5JA 4TLGA 5LB6A 5FJKA 1VB4A 3I2DA 3RFRA 1ZBE1 4R9DA 3SH4A 3LQCA 5FDBA 3PNAA 1GR3A 1MS1A 2HWC3 1CAUA 1EPWA 5BNPC 4XBQA 3VZOA 1VBA3 4Y5TA 4AHZA 1RUC2 5DUVA 2XB6C 1AXKA 4FPKA 1CR7A 3AVRA 4CDWB 1SDWA 4Q0SA 5FP9A 1A6CA 3USUA 4TLFA 1ZZCA 4IE5A 2Q0AA 4EWDA 5DPNA 4FPHA 1W04A 5A7QA 3RNSA 2ZCWA 4ATFA 4OI0A 1HB1A 3NAPC 4AGGA 5KXDA 1GNZA 1PGW2 1WGPA 2OVUA 4RL7A 1S0CA 4NHKA 2X09A 1ENSA 2DF7A 1N1VA 4GMP0 1QJY3 1VBE1 4FPEA 5T52A 2JG8A 2JG8B 5KXBA 4YVSB 3ZFFA 1C4RA 2A6ZA 2ZGTA 4Y22B 3ZFFB 4QB2A 4WV8A 4D6RA 2E33A 1RUD3 4RSUA 2PLV1 1W2AX 4CDWA 3CMGA 5FYVA 4MV2A 3WR0A 3C7EA 1BQPA 1ULGA 1QDCA 3OGSA 4HONA 2VZUA 1BMV1 3BYWA 3H50A 1ZA7A 5JPNB 1W6PA 1MQTB 1W6PB 2HKXA 2YV8A 5GJ6A 3OJBA 1NLQA 2V72A 3ZFEC 3DYMA 3UESA 2F4LA 4QGMA 1VBC3 2A1XA 4XZUG 3TN92 3ZVXA 4B8EA 3V0AB 3T2TA 4D3WA 3RYKA 1J58A 2DU1A 5FMBA 2B39A 4XMIA 2R0FA 4YRDA 4CYDA 4YSFA 1BK0A 5T5PA 3T30A 3HQRA 3HBZA 2Q4SA 5DUUA 3W5MA 2VMFA 4UI9L 5FWJA 4QT6A 1IPJA 3AX4A 4DUXA 4NIDA 4XQWA 5CG9A 1AR63 4BIFA 2HWF3 3VBOB 1NUKA 1QJX3 3C7GA 1AR81 5K4LA 1Q3EA 2A5ZA 3RG0A 3MDPA 2BNOA 2HBUA 5LCWL 1WBFA 4AHYA 4V1PA 1AYM3 4GH4C 5KXCA 3PUAA 1HW5A 5GLVA 2XXZA 1VRBA 2I07B 2GZWA 5LZ6A 3ES1A 2Y33A 2IXJA 4IE6A 4QQ2A 3UJOA 3VHOA 2JDNA 2R042 4K9SA 4CDUA 5CIRA 1F4HA 5BNNC 3ZMNA 4E8DA 4ASKA 3HQXA 3EXUA 1LOFA 4HPKA 1BXHA 1NYWA 4QHOA 3PMSA 4CCLA 2OXBA 3LCPA 5FP4A 1RUE2 2XVKA 2JD9A 1PZ9A 5IVCA 5F39A 3SH5A 1CX1A 3WQBA 1X7NA 2ZX3A 3NQHA 2EIGA 3O1VA 3MF9A 2HWE3 4IQPA 2Y34A 1PMHX 4QQLA 3MZHA 3VBSA 2TBVA 3CEWA 3WHTA 3UT0A 2QQWA 1WCDJ 3ETQA 2P5BA 5JLVA 2DV9A 2ETEA 3DF0A 5ABJC 4R4XA 2HEVF 3AP6A 4XFAA 1HV0A 4N53C 2VVDA 1C8M3 1UY0A 1LJ7A 2B4KA 1UX7A 2PHDA 3AM2A 1I5PA 2YFZA 1QY4A 4PDWA 4Z1VA 2AREA 1OPOA 2QBXA 2UY9A 1AX2A 4XTPA 3EQEA 3RWKX 2XLAA 1YYNA 1XU1A 3B00A 3ILRA 4UW3A 2VO5A 2ZEZA 3O1SA 1FOD2 2K9ZA 4XETA 2UYBA 4LQRA 4XDPA 1DBNA 2VBBA 5FZOB 3VZMA 2ZACA 2FDIA 5A32A 2A6XA 5F5CA 3POGA 3AMNA 5BYNA 2E26A 3D5OA 4OVEA 1NZCA 1PX4A 4DMIA 4HG6B 3AMMA 3NV4A 2R061 4XFCA 5E1RA 4CE8A 3FX3A 3AJYA 2B9VA 1Q8VA 2QZ3A 3V0BB 5J96B 1AJOA 5ACA3 4XF1A 1E5RA 5FP7A 1OQDA 1H2NA 4AHXA 2WFPA 3MIDA 5EIYB 1KS4A 1X33A 3WD5A 4F7ZA 1BZWA 2I45A 3LPFA 3T4HB 1FPN3 1C28A 2JKBA 4QKFA 2CDPA 4QQHA 4BPZA 3W59A 3AZYA 3GZAA 5A7OA 2BBVA 3RQ0A 4R9BA 2H0BA 1WMEA 5D1IA 3SISA 4AEDA 5LBBA 1WD4A 2ZX2A 3L2YA 5LW9A 5E6HA 1E57A 2ADDA 2PHWA 5FYHA 3RZZA 4I09A 2R073 1AYN2 1O3TA 1C8NA 2WS93 2WAAA 2ZA9A 4MHUA 4YGCA 2DCTA 5J09A 1EAH2 1I3HA 1W9FA 3A22A 4GWNA 1UD1A 2WNEA 5FY5A 3LSEA 1HRI1 1PIV3 1BK1A 1Z78A 2Q1MA 3MIGA 4MVTA 2DVDA 2QZ2A 4QX3A 2EIEA 2HEWF 3N9MA 4XURA 2BZDA 5FXWA 4RFRB 4UFJA 2YYOA 2X29A 2WSVA 2D40A 4P9WA 2RS53 1UY4A 1O3QA 1VMJA 3B9IA 5IFTA 2XVGA 3UK9A 4K8FA 1MS8A 3ZFGB 2RJKA 3ZDVA 5I93A 4Q0PA 1C5IA 2DCJA 1QQP2 2XLGA 1AL21 2F17A 1UMIA 3C7HA 3FN9A 4LO6B 2QTWB 3U37A 1GWMA 1ENXA 1UCXA 5IK7A 1DQ2A 1V0AA 1XE8A 4NVPA 5BPXA 4H2AA 5EJZB 5KHHA 2RM21 1B35A 1FNZA 3AXDA 3I2IA 4LMFA 3VBFC 4NIGA 3VDDC 1RUC3 2XMLA 3VDAA 1RUI1 1VBD2 2B42B 1YCIA 2WWJA 3N9OA 4XIKA 2WZR3 1HN0A 2E6VA 4G9SB 2X8KA 1H9WA 1SLAA 2PHFA 3IDCB 5LY2A 3I2OA 5L19A 2WRAA 4LBJA 1GNHA 4HVRA 3LB9A 3CO2A 3NJXA 2MEV2 1OLRA 1NE4A 3L2HA 5IATA 3H3UA 1QF3A 3NJVA 2WZEA 1V6MA 3VZNA 4DRRA 1LOGA 2XJUA 2ZZQA 5EWSA 1IKPA 4UFKA 3HOBA 5C4WB 4CU8A 4IL7A 4AEMA 4IEXA 2JDYA 2VZPA 2Y8KA 2RS11 2IZWA 1RUOA 1YIPA 4BMEA 3Q8EA 3ILFA 2JDHA 1S2BA 5AC92 1US3A 5C5UA 4FPYA 4O9GA 3Q8FA 5CBLA 1PHMA 4IE4A 4TSVA 4AVAA 5A7SA 4CSWA 5FY9A 4A7KA 2E31A 3UETA 2B5HA 3ZX7A 5KHGA 4KBZA 1G7YA 2QQOA 2F4PA 1REDA 5HCHA 4B3NA 4NAOA 4Y20B 3ZSEA 2Q1ZB 3P3NA 1G9AA 3CKHA 1H6YA 3PMEA 2HH9A 4P02B 1RUG3 2AENA 3WP6A 2R16A 4NOTA 2VTXA 4JVAA 5D8AA 1QXRA 5F37A 1RUNA 3G7DA 1K42A 1OOPC 4DXTA 1REFA 5EYXA 1UU5A 1FMD2 3WLUA 2D6PA 4I0WB 2JE9A 2DWRA 3JQXA 2WQ4A 1S1AA 4UYBA 2LM3A 5C70A 4M01A 4RQPB 3C3VA 3WG4A 1M06G 1PVC2 2DBIA 3T2PA 3WEZA 1MR5A 4QDRA 3RYRA 4I3GA 2ZHLA 2D6MA 3GZTB 3N35A 4DINB 1SFYA 1RUJ2 2QQKA 2ZGRA 4QHZA 2VGDA 5JWPA 2R043 5KBFA 3MICA 3PIGA 3PIJA 4JHZA 3AYEA 3CJIC 5A7PA 3O1RA 3POSA 1DQ1A 5DDJ1 2GMMA 1G6NA 4JTOA 3MPPG 1HB4A 1R1A1 5EYYA 1VBB2 1ULOA 1GQHA 1W6NA 1QJZA 1XSRA 4MSVA 1O4YA 3PL0A 4LKEA 4QX1A 5EHDA 2ZKLA 4CDQA 2HBTA 2WNOA 1AX1A 3WX5A 4CPBA 3ZYPA 4L99A 3DPRB 4PI0A 3RGBA 4HZFA 2EAAA 3TBDA 5IVBA 4YM3A 1Z7S2 3VBRC 4CEYB 3KWVA 1OC1A 5FYMA 4Q8KA 4TXWA 4K7JA 2QQPA 3NJZA 4JHTA 2QCSB 4AI8A 4CDUC 3VDCA 1W03A 4M0NA 1K12A 1GWKA 2UY8A 2YXSA 1NCRA 2OS2A 3BTYA 1OA4A 2ARAA 5J3UA 5L36A 2OPWA 2WYFA 4XXPA 2RS32 3PVOA 3R05A 4AFAA 4JGYA 4JGYB 4V2VA 1TNFA 2BP6A 5LRSA 3A0NA 4NPMA 4QKBA 2XUMA 4MO3M 1YHFA 5C9AC 4LUKA 4MGSA 2CGOA 1I9RA 4W6WA 2W5FA 4BA6A 4UFHA 5GALA 3C7FA 3NKGA 1PM4A 2VMGA 4HOOA 2DVBA 1UF2C 5FYSA 4YFWA 1JU3A 4FFIA 4Q4X3 4MHRA 1AR91 1F9KA 1MEC2 5B2GB 4KBBA 4LBNA 5EJ1B 5IT6A 5FZIA 4CU6A 1AHSA 3I8TA 1VR3A 2PELA 2WN3A 4YPJA 4XQDA 3WG1A 3MUY1 3OSDA 4PDWC 2YHJA 1O59A 5GLWA 1W06A 2OZJA 3Q8AA 1UY1A 2Y6GA 3KF3A 3GALA 1XE7A 1RUF2 3TAYA 3ZXJA 1GOHA 2Y38A 1GZWA 4PIYA 4XJWA 5T5JA 1ND2C 2WWSA 5FZ9A 3ZN4A 1RJ8A 1UMHA 1V70A 4NJ4A 5JOWA 1O8PA 3OBRA 4M3CB 2ZABA 3PUIA 5E8AA 1GKBA 2WFF3 3WCRA 1YFWA 5FP8A 1DGLA 4JCKA 3A21A 1NLSA 2DCKA 3RZKA 1EV12 1OA2A 2XQXA 2ZHMA 4Y1UA 4X8NA 4Q4V1 3SITA 2KXLA 5IVYA 4MOAA 5FZKA 1UOBA 2Y60A 3EJKA 4P00B 5FPLA 1UYPA 1IPKA 3E5XA 3EBRA 3CF6E 4LNVA 1EAH3 2XWBB 2BWCA 1RITA 2VW2A 2SBAA 3WV6A 2JICA 1PO12 3K2OA 1XE0A 2D43A 3BN6A 4LA3A 3CZUA 2QQVA 3VKOA 4Q4W1 2A71A 4JV4A 2HYXA 3CIHA 5KC6A 1QJFA 2YU2A 4XAEA 2JXAA 2RDQA 1DLCA 2WQZC 3BALA 3M1HA 4YZ2A 2IC1A 1OH4A 5FZGA 2B46X 2BBAA 4AEDC 4EYUA 4ZS3A 4C0BA 3U14A 1BVVA 1MACA 2QDRA 1RUH1 5BNQA 1F8VA 3IPVB 3AL6A 1V9U1 1UOJA 3IDAA 5E89A 2ADEA 2BYVE 2R7EB 4XFHA 1UZYA 2PN5A 3SQOA 2C5DA 1T2XA 4A4AA 4LPLA 4CVUA 4NRPA 1FXZA 4E9KA 5JR2A 3BODA 2WZ8A 1JTZX 4XBLA 2VY0A 3VLBB 4GMP1 4AGRA 4XPVA 4CCMA 2VZSA 1V6IA 4Z2AA 5JOZA 2H6CA 2IVJA 1WWYA 1H1MA 4L2NA 3H7YA 5H9SA 4LBQA 3FLPA 1RGSA 1VBD3 1QHDA 2GNTA 4XHXA 2BERA 4AI2A 5EV7A 1HQLA 4YG3A 4XUQA 1G9DA 4MUVA 3VB9A 2DVGA 2WT1A 4IV1A 4SBVA 3AC0A 1JUHA 5JIAA 3T08A 3BUCA 2R1DA 3AZVA 3FE5A 3HR9A 4LO5B 2EALA 3ORJA 4WM8C 4YW3A 2K0GA 3BIWE 3RZLA 5BNPB 2Q30A 1LOEA 4WVMB 1M4WA 1UW8A 2CHHA 1POV3 2HWC1 5FO7B 1B35C 5F3GA 1IS6A 4ARXA 5IUQA 2ES3A 4MGZE 3ZPOA 3AZXA 1CAXB 1HXS2 4IV3C 4MLOA 4UT5A 4XVHA 4QDSA 1LNSA 3NMBA 1O3RA 4MYEA 5AC93 3ZYBA 2WLPA 3UGHA 1HX6A 1ZZ6A 3AMHA 1DYKA 2BFUL 4IEQA 4Q8LA 2NM1A 4AI0A 2N7GA 5FK7A 3IAPA 4PQ9A 1JBCA 4KG8A 2P4EA 2W9XA 2BTVC 1DFQA 4JAAA 1QJY1 4QM9A 1W8FA 2VU9A 3KQRA 4QD2A 4BXFA 2KR2A 1D2SA 1WZXA 1RUD1 2JG9A 3T0BA 1RMU2 5CFDC 2VUJA 4CTEA 2BUKA 2VMDA 1NCQC 1FMD3 2ARXA 4WBBA 4GKYA 4FPFA 3JD71 5HCBA 2P3IA 4GZ9A 3BGAA 5CFCC 1ND3A 3VKNA 4HSJA 4OI4A 4DPNA 2O14A 5I0UA 1WCKA 2MHFA 1D4VB 2XJQA 3ACLA 1Q5OA 3WW1A 4EWAA 1KFXL 4NUBA 1VBC1 5FQ0A 2XDVA 2YDEA 4AQSA 2J1SA 4NWVA 2VXRA 4FP2A 1S2EA 3CU7A 2E53A 1POV0 2OUJA 5GLUA 1DYPA 3FFZA 2CSGA 1ONAA 3HVDA 1JOPA 1WLDA 2A6VA 1RTVA 2ZTNA 1VBB3 5A3MA 1AR61 5D8AC 3GZEA 2HWF1 4HKWA 5KXEA 5JMOA 1QJX1 1TG7A 3USSA 3EB7A 4UFLA 1KS5A 3MLJA 4JDNA 1YI7A 4GH4B 3WP4A 1W6MB 3MV01 4XHBA 1AYM1 5L7OA 2D97A 5JIUA 5L7OB 1RINA 5FZDA 2VH9A 3O5SA 4Z82A 1JZ7A 1YQ6A 4NHXA 3FLRA 3R4DB 1QKQA 5T50A 4EWEA 4RN5A 1ZX5A 3WDVA 3TEYA 1ZBA3 3RVHA 5FK8A 5FY4A 2RS33 3BPSA 1S0IA 5F2WA 4FTBA 3VHRA 3ILNA 4ZONA 1AR73 2WA3A 1RVF3 4LITA 5FZCA 3O1UA 1PO22 4JGZA 1CZVA 2VBPA 1ZRIA 1Y4WA 2HWE1 2X10A 4CDQC 1VJ2A 3POEA 4E27A 3RDIA 3KGZA 4Q2FA 3ZSKA 2A6YA 4IDZA 4AQ2A 2FDGA 5ABJB 2CDOA 4AAXA 2AC1A 1C3HA 2EXKA 3K75B 1DQ0A 2AR6A 4M3CF 3HNMA 1UZWA 2GP3A 2W92A 2X5IA 4AVCA 4ZHNA 5DAPA 1KDKA 4E2SA 1C8M1 2FZ1A 2RJLA 3RZHA 1CPMA 2V5YA 4MGYE 2IXKA 1T6GC 4A6SA 3ELNA 4ZU5A 1ST8A 1S55A 3FUOA 4FPLA 1SZBA 3OYWA 4FOYA 1IG0A 5CB7A 3WDYA 1ZZBA 5FY0A 4JDOA 3N7KA 2WDBA 5A3PA 1W28A 4IERA 3VL8A 1S0EA 3J8F2 1EV13 1VMHA 3JZVA 1UAIA 4FPGA 1NZIA 4LJHA 1OXCA 3AFGA 4NE9A 3VBUA 3MEPA 1OVSA 3HNBM 4G4FA 2O8OA 3WHUA 3WW3A 1UZZA 4L97A 2W39A 3AMPA 3WT3A 5ACA1 5IK5A 4WVZA 5DG2A 3ZO0B 4B7KA 1EP0A 5DAWA 3DEMA 1PO13 4BH9A 2GH2A 1FPN1 4AG4A 2AACA 1URXA 4RS5A 4XDQA 1IKQA 3CNAA 1J83A 3FFQA 3GHMA 3KGLA 1R082 1MS9A 3GHNA 3ZYGA 4CP2A 4FAHA 5C3SA 5FZ8A 2XBO1 4A2UA 2VNVA 1W8TA 3AYDA 4XF4A 3DYOA 3Q8BA 4YW2A 1FI2A 4KNCA 4OQ8A 3LA7A 4RFT0 3T2QA 2WINB 3AMQA 2R071 1W6OB 2Y6LA 2E7AA 3UNPA 3VKFC 4LEJA 4UF0B 1UOFA 2WS91 3P3PA 3SEPA 5A3LA 3BOWA 4C0HA 4ES8A 1OI6A 4GXLA 3B01A 3ZSJA 1X8MA 3NKTA 3I49A 2WNUA 2ZMNA 1W2TA 2W1QA 4GB32 2BGPA 4NROA 5LBFA 3JUUA 3TNQA 5B4NA 5J37A 3FWEA 2GDFA 4QPYA 2E9QA 2PAMA 2WZPP 1TVGA 1BEV2 3NNGA 4B7EA 5C5TA 3WNMA 5F3CA 4R52A 3NVCA 3TWIA 2XJTA 2HWD2 1H8TA 3T0DA 1KJRA 2WNVB 1XRUA 3LD8A 3ECQA 2RS51 4RHV2 3AYAA 1GZTA 4Y5SA 2WO7A 4OUSA 1ULEA 4CDXB 2DCZA 1VAMA 3T2OA 4CP1A 3D6EA 2V5DA 2ZMKA 5FMDA 3GBGA 1DP0A 4RR3A 4W65A 3WP3A 4C1WA 2PQQA 4DS0A 2H6BA 5A6YA 2VMIA 3HN3A 5FZEA 1SG3A 5A70A 3HAGA 2DUOA 2RDRA 2VULA 1STMA 5F32A 3SH3A 2IXLA 1R093 1VMFA 3AKPA 4SLIA 1HKDA 3OG2A 3TEXA 3ZMOA 1CIYA 4KU7A 1BHGA 5FKCA 3WZ1A 2HEYF 4CCDA 1P8JA 3BU0A 1YO8A 1TQ5A 3NV1A 5JCTA 2ZGNA 4X8PA 2WZR1 2ZGSA 1GOFA 1X9TA 3HT2A 3OY8A 3PJQA 3OY8B 3WUDA 1NA1A 2PYTA 1NA1B 1W8WA 4P9IA 3ZYHA 5FZ0A 3OTFA 5DABA 4YW5A 4LHKA 5FREA 2D44A 3WF3A 1FATA 5T3NA 4P9LA 5HCAA 4QPGB 4ZU4A 1ZBE2 2BOIA 3X29B 5FY8A 3T4VA 4E4SA 1K5MC 4XMAA 4D94A 4IXLA 1F2NA 4YVSA 2XHNA 3ZSLA 1YQCA 4Y22A 5K8SA 4Z92B 3ATGA 4R9AA 4AGVA 4LKSA 1RMU3 1ZNPA 3CQOA 3WNXA 5A6XA 1COV1 5C33A 3W58A 1TME1 5FZ7A 1LAJA 2XHKA 5I0DA 2ZBJA 1RHI3 4IETA 4DQAA 5FOBB 3WG3A 3MGUA 5IVJA 1D4M3 1MQTA 1YQ8A 2QJVA 1ZRRA 2WA4A 2EIBA 2WN2A 5FLIA 4B29A 1JYIA 4NIHA 2QQMA 2E63A 5BNOC 4BB3A 2RG4A 2RR13 3ST7A 3HEIA 5CAZA 5FAXA 1W8HA 3V0AA 1QNWA 4LE4A 2GNMA 2DVFA 5CKQA 1VBE2 4DFSA 3IAQA 2W3JA 1OFNA 1RUG1 4LOTA 1W0PA 3FJSA 4LUMA 4YVWB 3MIFA 1OOPB 1DQ4A 4P9YA 5FV3A 2PHUA 2PLV2 3HT1A 1MS3A 1VALA 5DAQA 2GP5A 2E32A 2WYSA 2CAUA 2FCVA 3IM0A 4J1XA 3VBOA 4CU7A 1LGCA 3EMRA 1H2KA 2VCBA 1BMV2 2D6NA 4TN7A 3MIBA 3WP5A 4I0AA 1W2NA 4QPIB 2XL9A 2D6OX 3I3QA 5FPAA 1ND3C 1G86A 2DBNA 4M0HA 3ZDSA 4KH9A 4AFCA 4G3YC 1JMUB 2EA7A 3LF7A 5HPOA 2CU5A 4XF9A 1HRV3 1UIKA 2ET1A 2GMEA 2OUHA 5C3OA 1IS3A 1PNGA 3VBHC 4LT5A 2WABA 1LB2A 1J59A 5FO9B 5F3IA 5GZDA 1GNYA 1OLQA 3M3EA 3B9CA 4MADA 3WVJA 4FOWA 1W8NA 4JZRA 1AR82 3DECA 4FFHA 1SBFA 1PO23 2Y6FA 4XFBA 2FDJA 3GGLA 4YGBA 3WNOA 2ZX0A 1GSLA 3IWZA 5F5AA 5C8CC 1N47A 1AJKA 4DIQA 4YZ1A 3VBRB 4ZU7A 3VD3A 3BIEA 2W94A 4JKKA 2DU0A 3OF1A 3PHMA 3T09A 3C2UA 3WQ7A 4B1LA 4LHNA 4XOGA 5DMYA 3KMHA 1TZOA 3M3IA 2C26A 5C71A 2UURA 1W2OA 1JHJA 3RMYA 3E97A 3OPTA 4CP9B 4CEWC 2OZ6A 3KLSA 3FL7A 5EPAA 3TB0A 3K4DA 2V4AA 5C9AB 2TUNA 1ASJ2 4TWTA 4FQ4A 2LRPA 5AVAA 5FZOA 4PQQA 1LCLA 3WOGA 1BBT3 5JMCA 1NOVA 3NRUA 4Q0VA 4N43C 2H0VA 2O8QA 4AXOA 3J8F3 3AKQA 3BTAA 4Q4X1 3O0VA 1UPIA 4XILA 2DDUA 1US2A 2Y0IA 4Q29A 3WDXA 4WM7A 4WM7B 5EZWA 3WG2A 4YW6A 2XGXA 3V0BA 4UBGA 4P5HA 5FMOS 1DU3D 3ZYJB 3HWJA 4MG2A 1O7FA 1U12A 4DEVA 1ODNA 2GSYA 4UW5A 1WCSA 4N9IA 5JZGC 1JYTA 1J84A 3KT7A 5FPUA 1MS5A 2JEMA 5JI9A 4E4HA 1UY2A 2G9GA 4HL0A 1ENQA 5J36A 1WLWA 1WW4A 2A7AA 2UWCA 3MIHA 4N7UA 2PHXA 2WFF1 5SV8A 1MZFA 4QX5A 2YUEA 4NO4A 3W9AA 4GD4A 2IXIA 4HKOA 1ULFA 2P6HA 2K2SA 1CWPA 3WSOA 1GP4A 3ABZA 4XQ4A 2R062 1S2KA 4ES9A 4MXVA 4WVWA 2RMU2 1QJU3 4L11A 1ZRCA 1JU4A 1N3OA 5FUNA 5JSPA 3T0AA 1EAH1 2EXHA 1X50A 1ACCA 2J1VA 4H7LA 5GM0A 1DZTA 5T55A 4EN8B 1SLTA 4FFGA 4GB33 4BJ0A 1XOYA 4JTNA 5L9VA 5JDBA 2CNAA 2VC9A 1POQA 4RS5C 4W50A 1H2LA 1R1ZA 2VE1A 1ZM1A 4IEYA 5CEHA 1OSGA 5JXJA 4FT8A 4LKFA 3RYPA 3RI8A 1C5HA 4LORA 3ZFGA 5HV0A 1HN1A 3OBAA 3FHQA 1KQRA 3B69A 3IB3A 4I3PA 2HJIA 1UNBA 2CWSA 5LBCA 2MPFA 2AGSA 2VTFA 4UFMA 1L3JA 2J42A 1HRI2 2GC1A 3NW4A 1NY71 1TMF1 2JB4A 3HBKA 1ZZ7A 2YBPA 4AE2A 3LDRA 5HCFA 2VD7A 5A7WA 5FCCA 5A7WB 4BLJA 2NN8A 1MPXA 1CAVA 1CAVB 2OX0A 5K0UA 5K0UB 2BJSA 3J4UH 1MZ6A 1A78A 2WKKA 3SC7X 2EF6A 2TEPA 4LBMA 1SMVA 4X6RB 2O0OA 1KXGA 2AZ5A 3J7MA 4AFMA 1D0GA 1W8ZA 1WW7A 2HWB1 2NQYA 3IIIA 3OD4A 1I6XA 1XB9A 4RD7A 1AXZA 4YZ5A 4PBOA 4FCAA 4DY3A 4AEKA 5CVRA 3KCCA 5IFPA 2C9AA 1KDMA 3M70A 4Y3OA 2W52A 1AL22 3K48A 1UOGA 4WM8B 3ZIWA 4OHWA 1CIWA 4PHZA 3WNKA 3GXUA 4RR3C 1DG6A 1ZBE3 2ORZA 4GULA 4ZXEA 4COYA 4GAZA 1XNDA 2X05A 4F3JA 5I0SA 5JUVA 2RM22 3J9SA 1MVEA 1G8WA 1XYNA 1POV1 4GKXA 5C4WA 4PT6A 1PGL1 2D93A 1D2QA 1GZ9A 4M4RA 4FPCA 4S2FA 4XJ9A 4IGOA 2D7FA 4BE3A 2PHTA 4YNIA 1GWLA 2PA7A 2W2IA 1CESA 3N36A 2V73A 3PVBB 4IEZA 1JYVA 2BNMA 1CPNA 1PX3A 3ACHA 3OGRA 2PHRA 4ISRA 3FHIB 5FYIA 1A8DA 4QXKA 3FUQA 3MFAA 4HKLA 2JWPA 2VMCA 1OKOA 3TN93 2QQNA 2VCMA 2BEOA 4QXBA 5LA0A 1VBE3 1SBDA 2NMNA 4Y20A 4BIOA 3LOIA 3QOPA 4P08A 1UXZA 1GANA 2JG8C 2Y6JA 5CFDB 4AK3A 4YVSC 4Q4Y2 3ZYIB 3ZFFC 2PLV3 1NCQB 3FHAA 5IVVA 4AVVA 2RS12 4XJ8A 4S2HA 3I2HA 2Y6KA 4KWLA 5F5QA 1NKGA 3ZXEA 5F2SA 1O6UA 4CDWC 3ZXLA 2PAEA 5CFCB 3HJRA 3AKTA 2WWUA 3IIAA 3QLQA 3IN9A 2DURA 4XACA 5FBZA 1A34A 4RQPA 3GBFA 2CAVA 4O65A 3W20A 2FMDA 3ASIA 4XJUA 1W05A 4XJAA 4COWA 1QEXA 4LKDA 5FYYA 1LOAA 3IDBB 1LULA 3AP4A 1VIWB 3WDUA 1SPPA 2GNBA 1SPPB 3JBG1 4HN0A 4JRLA 1PK6A 2G1MA 1PK6B 3ZKYA 4BQYA 3DL3A 1AX0A 2DYCA 3I59B 4GWIA 1J3PA 3R4SA 2VPVA 2WO2A 3AKRA 2ZEYA 2VECA 3BI3A 2VUCA 2WL1A 4OFGA 1RUE3 1JH5A 3HN1A 2FBEA 1AR83 1CJDA 3S5AA 2JDUA 3VBOC 5DUWA 1K3IA 3LEIA 2DTYA 3O1TA 2VZTA 4YW4A 4OMDA 3OBTA 1PNFA 3VZKA 2UYAA 3DPRA 5HXVA 2BRTA 3I3DA 2D5FA 4QU2A 4AQTA 1JUIA 4CEYA 2YB7A 2VVFA 2AEZA 1WD3A 5FWEA 1YLLA 2KD7A 4KWJA 2VVEA 5J48A 2JECA 3I2FA 5DXDA 1G9CA 4RGAA 4BHPA 2Y26A 3K46A 3KV4A 1ZBA1 1W99A 3JB4C 3POIA 1LOFC 1R1A2 2A3XA 2VNOA 2ZKNA 2LS6A 1N1TA 4R4ZA 4U36A 1AR71 1FOD3 1RVF1 1ASJ3 2BDRA 4QAWA 4QB1A 2VM9A 1HB2A 1SCSA 1ENRA 2FCUA 3D82A 1L7RA 1UZVA 4UOJA 3VBSC 3A4UA 4KG0A 1J3QA 4I01A 4RGGA 1V6LA 1CD3G 2W0XA 4BLIA 1UIJA 1C1LA 5K7PA 4NIAA 3ZXGA 2ZOEB 4IW3A 4EN9B 2ZAHA 4XIOA 2RV9A 1UN1A 1RXFA 3NWKA 1S0FA 5EFUA 5FZBA 2XJPA 5FZAA 5IWFA 2OT7A 3M4FA 1O4ZA 3NNFA 1F15A 3DXUA 3VZJA 1WUVA 5F3EA 2JKXA 4L8QA 1PMJX 3PUQA 5APAA 4PF5A 1W9TA 4LK7A 4TYSA 2BVVA 4BQ2A 5FZ6A 2B7YA 1LHUA 2VTXJ 4M3CA 5FMOL 3KQ4B 4YW7A 1RJ7A 1IQAA 4K40A 5DZEA 3D0SA 1AL0G 3K4ZA 3D4KA 1WCQA 3WCSA 2ZGMA 1AR92 4ISQA 1WBLA 2KM2A 1KITA 3GYDA 4INDA 1AYN3 4ZS2A 1UU6A 3OGVA 5CU1A 3RSJA 2RMU3 3SHRA 4QB6A 1UO9A 2XJSA 4BQ5A 2ID4A 2UWBA 2P3JA 4Q27A 5EP9A 2GC2A 1NXMA 4NHYA 4JQTA 4LO4B 1LECA 2IFRA 3EYPA 4QXCA 3WUCA 3CJXA 4FP3A 1Y9QA 2Q8EA 1AF9A 2YU1A 4M3CE 2ZEWA 3W5NA 2CV6A 4YZ4A 1OHFA 3BCWA 4Z2WA 3OGGA 4KL1A 4PLNA 1XNAA 1JN2P 5A33A 5A33B 5I91A 3SMHA 3OD0A 3SCHA 1VP6A 2A3YA 4LBOA 4Q4V2 5E88A 4CCJA 3IPVA 3LFIA 4XUOA 4DNYA 4Y24A 1I5ZA 1YFXA 3H8XA 3B7MA 1QQP3 1WMDA 3NNLA 3U10A 5J98B 2GMPA 1PZ8A 2GN3A 5A6ZA 4AVSA 2ZJCA 4UW4A 2JDMA 5IAVA 1V6KA 4Q4W2 4ET7A 3NNMA 4HVQA 4HVOA 1YWKA 1QOSA 5AFBA 5EXOA 3SKVA 2XG3A 3ALQA 2VQ0A 1U5IA 1EY2A 5CYYA 4Y1VA 2QDNA 1RUH2 1DHKB 1XSQA 3THDA 1JZ4A 1ODMA 1V9U2 2YG0A 3PLQA 4D7SA 3I3BA 1SQ4A 5CZKA 3VKMA 1AL23 3UKNA 4Q5OA 2MEV3 1O5LA 2VAUA 1DCSA 1MZ5A 2CWMA 4DOUA 2YBSA 1X36A 3KT4A 2CY6A 5G04L 3VUOA 1QMJA 3WNNA 1PMIA 2IFWA 2J1AA 2JIGA 2Z69A 2YPDA 3MLKA 4KMQA 4YG0A 2GU9A 4BM8A 5BNPA 1R091 3B94A 4WVMA 4OI1A 2ET7A 1VBA1 1OQ1A 5CKMA 1OF3A 4YG6A 3AP5A 1CAXA 1UKRA 2ZGPA 2ZAAA 1TNRA 4FO9A 5FUIA 4B4RA 3OBZA 4FOVA 1BYHA 3ZYFA 3NAPB 1SFNA 3IMMA 2FD8A 3DKQA 2C4XA 5CISA 4Z07A 3E6BA 3ZN6B 1PVXA 3CZJA 1NE6A 4XUPA 3IT8A 5IAXA 5DAVA 2JIJA 3VHPA 2HWC2 4MZUA 2OYZA 1QU0A 4QGNA 4D7TA 4Q4Y3 1W39A 3QACA 1KGYA 1RMU1 3MF6A 2L9LA 3RWNA 4K6BA 4OUMA 3UL2A 4JRAA 1RHI1 3ON7A 4M4PA 4BOWA 2VUDA 1D4M1 5BNOB 5FZHA 1PVC3 4XF3A 3ZFEA 1JOJA 3ZFEB 3MV11 4CCCA 3O0WA 3POBA 2QUOA 4Y4RA 1JZ5A 2QVSB 1Z0HA 2RR11 4J25A 3AVSA 3BVCA 5IK4A 4JDMA 5FZFA 3NNJA 1RUJ3 4PLMA 3H1YA 3E6CC 4Y4YA 3OCPA 4H3WA 5FBJA 2EAKA 5FLHA 1OA3A 4OYUA 4HANA 3SNMA 2RVAA 3MLLA 4OI2A 3WNLA 4XAAA 1RUD2 2YGLA 3FLTA 2YGMA 3WY6A 4K8RB 5JXGA 1RYYA 5DN2A 4P9GA 3JD72 5IVEA 1YRZA 3E5UA 3OUJA 1GUIA 4UW6A 3MI8A 4GH4A 3VDBA 1W6MA 2LW8A 3V64A 1IPSA 5C8WA 1MS4A 2JJ6A 1ZA4A 4RQPC 3RPQA 1QDOA 2A6WA 2ZGUA 2WO3A 4LIUA 4N8MA 3HPNA 1SBEA 3LPGA 2ARCA 5FTTC 1VBC2 2CGPA 4LBLA 2VOWA 4YW1A 1UY3A 3JXSA 1HRV1 1Z7S3 3N7MA 3VBHB 5BNNB 2XKPA 5I8YA 3N4MA 3EHKA 4W6XA 4A6OA 2W08A 3FC0A 2XJRA 2Q8DA 1W8OA 1XBFA 5A1LA 3HMYA 1QXPA 3SCFA 1VRH2 2WBKA 5DZGA 1YJLA 4HFSA 1R1A3 1S0BA 1ZZ9A 4DXZA 3HIFA 3TEZA 4OHYA 1MS0A 2D3PA 4F83A 5LK7B 1QJX2 1LGNA 3WW4A 3UKTA 5C8CB 3OEAA 3H42B 1WMFA 4PLOA 5A3OA 4PIXA 5FXZA 1AUYA 1AYM2 2J1TA 5FZMA 4YM1A 3ZXAC 5ABJA 3O1PA 2XL7A 3QBQA 3TYJA 2CL2A 2EVXA 4N53B 3GJAA 5C3RA 3F95A 4AOCA 2ZX4A 1MEC3 1HQWA 3IDEA 1E5HA 2ZX1A 4Y1ZA 5A80A 1X9PA 1LHWA 2NMOA 4CEWB 1SACA 1IZ3A 1UPSA 2Y6HA 2ZZJA 3RZJA 2VOKA 1GFF2 1NCRC 4NRMA 1HDKA 2E7TA 1RUF3 3GZUC 3B93A 4JGYC 2GC0A 4PJYA 3BB6A 2QQIA 1OT5A 2HWE2 3J7HA 4ZKTB 4MGKE 5GZEA 1BBT1 1ZZ8A 5JAXA 1A8MA 5ANNA 1E5SA
chains in the Genus database with same CATH topology
3LZZA 3J8F1 4EN7B 4PIZA 4WVVA 3RS6A 4FTSA 3KZ4C 5F1RA 1NG0A 2X53S 4K3UA 3O7OA 1APNA 1C8M2 4FTEA 4IEVA 4P9XA 4BYYA 3DGTA 2QFEA 2R0HA 1RC6A 2XKOA 4ORFA 1J3RA 4Q0UA 4LHLA 3I54A 2YROA 5J7MA 2VG9A 1CAWB 4Q4V3 1V6NA 1H1AA 2FZ2A 1W6OA 1LU2A 4NWWA 2R30A 1QJU1 2IXHA 5BXXA 4Q1RA 2WT2A 3H0OA 1PIV1 1W2UA 3AK0A 1FPN2 3EO6A 5C6CA 2WNVA 4AYUA 2XBO2 1H8VA 1UX6A 4EN6B 2P17A 1RUH3 3UJQA 4CDXA 2R072 4Y26A 1V9U3 2GH8A 2LTNA 2Y0OA 5F6KA 4FSJA 3PVEA 4GWMA 4GMP3 3AZWA 2P34A 3VBFA 3VBFB 2D6LX 3VDDB 2YY1A 3ZSMA 5GLZA 3WINE 1RUC1 2RS52 1LKNA 4COZA 1HXS3 4YZ3A 5DG1A 5CG8A 2G4IA 3FMGA 2BGCA 2C0ZA 1Q8PA 2CGNA 4AVBA 1W6QB 4IV1C 1PGW1 3M3QA 4XFIA 3MYXA 4QPGA 3H3ZA 3H9AA 4XYXA 4YGEA 3UV9A 4L92A 4AWDA 1LODA 1CAUB 3ZPYA 4XE9A 3FZ3A 3H1WA 5JVVA 4LA2A 4DB5A 4JQRA 2WZR2 3VV1A 5CADA 1CGPA 1WW6A 3USUB 3Q9OA 2VMHA 1LGBA 2AUYA 1KJLA 3N7LA 3FBMA 4Q26A 4FQZA 1S0GA 2Z42A 2IXCA 4B4QA 3ME2A 3L9JT 5GZCA 3TN91 4W6YA 3KD4A 1G9BA 4QMAA 4HLTA 2XVLA 3JU9A 3LWCA 4LLOA 4YVWA 3WDTA 1JXNA 5K9YA 1DIWA 1SCRA 1OOPA 2FHRA 5JI7A 4LO7A 2B8MA 1Q8QA 5FLJA 1COV2 2NYYA 4CDWB 1TME2 1C57A 2JG9C 4GIQA 4YM0A 3PVNA 3JD73 1LEDA 1GICA 4OHXA 1OFSA 1OMIA 1YI9A 4IEWA 4QPIA 3G6JB 2Q8OA 2QKDA 3I7DA 2XLFA 3WDWA 2A70A 2OW4A 2DCYA 2R041 3CJIA 3CJIB 5KHJA 1RUG2 1HIXA 1VRH3 1X82A 3JB8A 2AYHA 4WZCA 1RUE1 2ZMLA 1WW5A 3NV2A 4S2DA 2DUPA 2TNFA 4IEOA 3QCWA 1N1YA 3CLPA 2BPA2 4C1XA 4E4DX 5T5OA 1H1IA 2ARBA 1W0OA 5I8SA 3NO8A 5L7OC 3VBRA 1BKZA 1CN1A 2DFCA 1ALYA 2OIIA 3PTYA 3ZXDA 4CDUB 1HQNA 5H9PA 3AFKA 4OLLA 4MX3A 3LSDA 2B45X 1JW6A 4HPKB 4Y5Z0 4YARA 3IBMA 1O4TA 1Y43B 2D6KA 3K51A 4COUA 3U0ZA 1I1EA 1FOD1 5C9AA 1ASJ1 4XZPA 4XJZA 1GLHA 3INAA 5AFEA 3VBSB 4AI1A 4JGZC 4DZGA 1CONA 3BPZA 3M7AA 1LEMA 2X5IC 4PDWB 1ZRDA 2VOVA 2PAKA 4FVVA 3VHNA 5BY5A 3AB0A 5L73A 1HV1A 1GBGA 1YIFA 5GZFA 1ND2A 1VAVA 1ND2B 2FQPA 2UU8A 4AHWA 4P14A 3R6SA 3POYA 5A32B 2ZPXA 1XNBA 4I0BA 1R083 3BOPA 4X6QB 1UMZA 1ULDA 4RA0A 4EV0A 3H8UA 4Q4X2 2ZS6B 3BU7A 3KT1A 1AYN1 1JYCA 3VBUC 2RMU1 4URTA 3WW2A 3POWA 4F8AA 4KGQA 3GNEA 3LA2A 3WQ0A 2ZHKA 3E5QA 1BEV3 2HWD3 2WFF2 4AEDB 4ITCA 1O91A 2XBO3 4XEZA 2NZ9A 4RHV3 5FPXA 5KHKA 1BJQA 2WJSA 3AP9A 2E51A 4A7ZA 2WIIB 4K21A 4FAGA 3KCXA 1QQP1 3GF6A 3VL9A 1FAYA 1ZYBA 4XXAA 3O0XA 2GNDA 2WNUC 3THTA 3AKSA 3SXWA 2BNNA 3ZN5A 2Z79A 5DUXA 4OHZA 4N90A 4HSLA 4EN0A 3GBWA 1VBD1 2Z5WA 1H8TC 2WNVC 2R49A 4AEJA 4XW3A 2C1FA 2VW1A 5H9RA 1MVQA 1DF0A 4CDXC 1KRIA 3U4XA 2NP0A 4ASLA 4WM8A 1FNYA 2MEV1 2G9FA 4XFGA 1NY72 3RJRA 1TMF2 5KC5A 5BV6A 1H4GA 2JE7A 1B35B 5FO8B 4WZFA 1S0DA 4I30A 4IV3A 3URFA 4IV3B 3D8CA 3HD8B 3MW3A 4EROA 5JSOA 1RUI2 3N7JA 3APBA 1IOAA 4FXGB 4QQPA 4H14A 2D3RA 3V56A 2HWB2 5AC91 4OHVA 1NA1C 2P3KA 1H30A 1UU4A 3AP7A 2YPJA 3THPA 1IGOA 5T5LA 1QOOA 1PM7A 3DUIA 4CP0A 4IESA 4QPGC 1O5UA 2BQPA 2LALA 3KCYA 4PBPA 2WC2A 1H0BA 2BFUS 1EYBA 5CFDA 1PGL2 3NL1A 4Q4Y1 1B09A 2I2SA 2EXIA 1NCQA 1COV3 1J1LA 1TME3 1FMD1 5E16A 1VB2A 5CFCA 1YUDA 4KQ7A 1WLTA 1U5YA 1CX4A 1PVC1 3VKLA 3SLIA 1MQTC 4AW7A 1XYPA 4LO8A 1ZVFA 4A3XA 2GC3A 4D69A 1RUJ1 1H2MA 3A0KA 1QNYA 2D98A 3I59A 3KS7A 2R6QA 1XNKA 2ZGKA 4YVWC 3ROUA 1UL9A 1JHNA 5D8AB 1FYUA 1VBB1 1DZQA 3UKVA 4BWOA 1YFYA 3AJZA 3TOJA 5JOXA 2NLRA 1DDLA 1YFUA 4OULA 1BVP1 2E7QA 3S7EA 4QPIC 4DRVA 4M00A 1Q43A 4I2OA 1H4HA 3JBG2 3R0RA 1Z7S1 2DFBA 4ASMB 2A3WA 2GN7A 4QQOA 5SV5A 3O12A 1SLCA 4E4ZA 3QH7A 1LOBA 1YXWA 4HBNA 5DDJ2 2RS31 1W6NB 2CYFA 4YGDA 1SLBA 3ZIXA 1RIRA 4CDQB 4IEUA 4LBQD 2ZGLA 2VNRA 1RB8G 1FT9A 5LRRA 3LOBA 1Q8SA 1GZCA 1DGWA 5FOJB 1FV3A 5F9TA 1MEC1 1DZRA 3AZZA 1H9PA 1REEA 3TNPB 1J1TA 1AXYA 4KU8A 1NCRB 1ZBA2 3U07A 4EJRA 1LR5A 1KFUL 1LU1A 3NV3A 1O3SA 1RUF1 1WA4A 1AR72 1RVF2 4FPJA 1XXNA 1ULCA 4AFBA 2ILMA 1U0AA 4HN1A 5I8TA 2F6BA 2B9UA 2MNGA 4Y1XA 1EV11 1Y3TA 4BZ4A 1DQ6A 1Q56A 2R063 3AXEA 3ZYRA 2A75A 5JR7B 1F5JA 3VGIA 4WM7C 4K1ZA 1NQDA 1UKGA 2FMYA 1XYOA 3TRSB 1XQNA 3LGRA 2AH2A 4R8HA 3V65A 4AF9A 4YM2A 3M2MA 2IWGB 1DGRA 3DKWA 5TSWA 1PO11 1GZWB 1VLNA 1OKQA 3U11A 2PHLA 4NHMA 3WXPA 4LULA 2VUAA 3QH6A 4AQ6A 5GLTA 1AVBA 4GA9A 2QNKA 5KHIA 4S2GA 5FRAA 5LEJA 4U2AA 1QXJA 4MGIE 4META 1LHOA 2XPJA 1IS4A 1DGRN 5FPZA 3SCGA 1HRI3 2QE3A 4NPRA 5IK8A 3JCIA 1G9FA 1AZDA 4K20A 4KWKA 2GAUA 3S7IA 4BMBA 2SLIA 2ENRA 4HK9A 2BWAA 1GV9A 4QHBA 5H9QA 3RRDA 3D0JA 1C1FA 3JQWA 2Q5TA 4HMZA 1ZREA 5AVPA 2XH6A 1OD5A 2ERFA 3ZFGC 5JOYA 4FXKB 1LTEA 4TZDA 2I74A 3LKJA 1TMF3 5I0TA 2HYKA 4R9CA 2JENA 4UBHA 2NPIA 2JD4A 4Q1PA 2RM23 1N3PA 4YFZA 4CRQA 4LBQB 5CNAA 1RUI3 1HXS1 5K0UC 3S30A 3B5LB 2HWB3 4LR4A 3S0MA 2PFWA 4N9HA 4IV1B 3NAPA 4E2QA 4NN0A 3O14A 1XNCA 3CL1A 3ZN6A 1V00A 1K5MA 1IS5A 1K5MB 2ATFA 5BUVA 1R092 4AI3A 4HK8A 1VBA2 3VZLA 5C4WC 2RS13 2GALA 4AVTA 3KM5A 1N3QA 1U5XA 4LBKA 4P9JA 1F5FA 2P2KA 1U5ZA 4JC1A 5BNOA 4A7YA 4XFFA 3M3CA 4LE3A 1YNAA 3ZXKA 5JPMB 2CTVA 1QH6A 1QJY2 2D3SA 1PZ7A 1CJPA 4XBNA 5KWRA 5GZGA 2JG9B 1TEIA 4NHLA 3H7JA 1QGLA 1OQEA 1CVNA 2VQAA 1LESA 2VW0A 3FBYA 4J6GA 4Q0QA 4YLZA 1RHI2 1IHMA 3E6DA 4MH0E 2YC0A 1D4M2 1ND3B 3T1LA 1QWRA 1ZRFA 4O9EA 3R4UA 3N3HA 2RR12 3JBG3 5FQ0B 2ZGOA 1NXD1 1HLCA 2JDZA 3LA3A 3VBHA 4FPOB 2WT0A 3M8LA 3T1MA 5BNNA 1PK6C 3ENRA 4PCRA 1D0HA 4IEPA 4J1WA 3H1MA 3AYCA 2JX9A 4LLFA 1VRH1 5DDJ3 5F6LB 1LRHA 1AR62 3ZXFA 2HWF2 3KB5A 1Y7BA 5C8CA 1PO21 3DV8A 3M3OA 3MIEA 3RJ2X 4E2GA 3NSTA 5JSRA 1S0JA 3DPRC 2XWJB 3LAGA 2BVBA 1HRV2 4N53A 1KD7A 4CEYC 2OA2A 3WQ1A 2WLQA 4CEWA 2R1BA 1SLIA 3IKWA 3I4IA 3RI9A 1GQGA 1FX5A 3J26N 2O1QA 1EPZA 3B3QE 4C90A 4JGZB 5GKAC 4Z8BA 1PGSA 1VAKA 2KA3A 4N43A 4N43B 1LHVA 4C91A 4COVA 1AR93 1V6JA 1RL3A 2DVAA 2X5IB 2VNGA 2P37A 1QH7A 4ONUA 5HBAA 1DQ5A 2ZHNA 1SLLA 5JZGB 5HI0A 5JZGA 4FBFA 1OPMA 3OPZA 3MPBA 4D7YA 3OYWB 2VOXA 2V09A 3MW2A 3KSCA 1WLCA 1BBT2 1NLRA 1R081 2DTWA 5DZFA 4N7IA 3QD6A 4FOQA 5EJ3A 5CA6A 1CAWA 2ZGQA 4B4PA 3VBUB 4L9BA 1DLLA 2EXJA 2D5HA 1CQ9A 4CZSA 2YMZA 4ZXKA 5ACA2 4LTAA 4KGGA 4BQ1A 4BCUA 3IMNA 5I0RA 1X8EA 3VN4A 1MZEA 4H7MA 1F31A 4GB31 2LUWA 1V6OA 2UWAA 1DGWX 4AFDA 4Q4W3 4RS5B 1BEV1 4K1YA 2Z2SB 2HWD1 4H55A 4ATEA 5LEKA 1LENA 2OPKA 4RHV1 4QGLA 3B02A 5FFOC 1N1SA 3DN7A 4QM8A 4XF0A 2PTMA 1QJU2 2WSUA 2WS92 1TE1B 4NR1A 5LK5A 3RMXA 1GYKA 1Q8OA 2A73B 4DY5A 2BW8A 2W68A 2YZ4A 4OZXA 2RHPA 2WNUB 1FV2A 1PIV2 2DUQA 3MFCA 1XU2A 4HT1T 1QOTA 2XJVA 1A3KA 4GALA 3S6PA 3OGJA 1SEFA 4YYOA 3VDDA 1H8TB 4GQ7A 4XTMA 4Y1YA 3ES4A 1LHNA 1NQJA 1YJKA 4HETA 2R32A 4UXAA 4I02A 1BCXA 3MW4A 2RE9A 1LOCA 5T54A 4MXWA 4MXWB 1W6QA 4RR3B 1VB4A 3I2DA 1ZBE1 4R9DA 3SH4A 5FDBA 3PNAA 1GR3A 1MS1A 2HWC3 1CAUA 1EPWA 5BNPC 4XBQA 3VZOA 1VBA3 4AHZA 1RUC2 5DUVA 2XB6C 1AXKA 4FPKA 1CR7A 1SDWA 4Q0SA 1A6CA 3USUA 4TLFA 1ZZCA 2Q0AA 4EWDA 3RNSA 4FPHA 4ATFA 2ZCWA 4OI0A 3NAPC 4AGGA 5KXDA 1GNZA 1PGW2 1WGPA 2OVUA 4RL7A 1S0CA 4NHKA 1ENSA 2DF7A 1N1VA 4GMP0 1QJY3 1VBE1 4FPEA 5T52A 2JG8A 2JG8B 5KXBA 4YVSB 3ZFFA 1C4RA 2A6ZA 2ZGTA 4Y22B 3ZFFB 4WV8A 1RUD3 4RSUA 2PLV1 4CDWA 4MV2A 3WR0A 1BQPA 1ULGA 1QDCA 1BMV1 3H50A 5JPNB 1W6PA 1MQTB 1W6PB 2HKXA 2YV8A 5GJ6A 3OJBA 3ZFEC 4QGMA 1VBC3 3TN92 3ZVXA 4B8EA 3V0AB 3T2TA 4D3WA 3RYKA 1J58A 2DU1A 2B39A 4XMIA 2R0FA 4YRDA 4CYDA 4YSFA 5T5PA 3HBZA 2Q4SA 5DUUA 4QT6A 1IPJA 3AX4A 4XQWA 5CG9A 1AR63 4BIFA 2HWF3 3VBOB 1QJX3 1AR81 1Q3EA 2A5ZA 3RG0A 3MDPA 2BNOA 1WBFA 4AHYA 4V1PA 1AYM3 4GH4C 5KXCA 1HW5A 5GLVA 2I07B 2GZWA 3ES1A 4QQ2A 2IXJA 3UJOA 3VHOA 2R042 4K9SA 4CDUA 5CIRA 5BNNC 3ZMNA 1ZRCA 3HQXA 3EXUA 1LOFA 4HPKA 1BXHA 1NYWA 3PMSA 3LCPA 1RUE2 2XVKA 1PZ9A 3SH5A 1X7NA 2ZX3A 2EIGA 3MF9A 2HWE3 4IQPA 4QQLA 3MZHA 3VBSA 2TBVA 3CEWA 3WHTA 1WCDJ 3ETQA 5JLVA 2DV9A 2ETEA 3DF0A 5ABJC 4R4XA 2HEVF 3AP6A 4XFAA 1HV0A 4N53C 2VVDA 1C8M3 4PDWA 1LJ7A 3AM2A 2PHDA 4Z1VA 1QY4A 2AREA 1OPOA 2UY9A 4XTPA 1AX2A 3EQEA 2XLAA 1YYNA 1XU1A 3B00A 3ILRA 4UW3A 1FOD2 2K9ZA 4XETA 2UYBA 1DBNA 3VZMA 2ZACA 5A32A 2A6XA 3AMNA 5BYNA 3D5OA 4OVEA 1NZCA 4DMIA 3AMMA 3NV4A 2R061 4XFCA 5E1RA 3FX3A 3AJYA 1Q8VA 2QZ3A 3V0BB 5J96B 1AJOA 5ACA3 4XF1A 1OQDA 1H2NA 4AHXA 2WFPA 3MIDA 1KS4A 1X33A 3WD5A 4F7ZA 1BZWA 2I45A 1FPN3 1C28A 2JKBA 4QQHA 4BPZA 3W59A 3AZYA 3GZAA 2BBVA 3RQ0A 4R9BA 2H0BA 1WMEA 5D1IA 3SISA 4AEDA 1WD4A 2ZX2A 3L2YA 1E57A 2PHWA 3RZZA 4I09A 2R073 1AYN2 1O3TA 1C8NA 2WS93 2ZA9A 4YGCA 2DCTA 5J09A 1EAH2 1I3HA 4GWNA 1UD1A 2WNEA 3LSEA 1HRI1 1PIV3 1BK1A 1Z78A 2Q1MA 3MIGA 4MVTA 2DVDA 2QZ2A 2HEWF 2YYOA 2X29A 2WSVA 2D40A 4P9WA 2RS53 1O3QA 3B9IA 2XVGA 3UK9A 4K8FA 1MS8A 3ZFGB 2RJKA 5I93A 4Q0PA 1C5IA 2DCJA 1QQP2 2XLGA 1AL21 4LO6B 1ENXA 1UCXA 5IK7A 1DQ2A 1XE8A 4NVPA 5BPXA 5KHHA 2RM21 1B35A 1FNZA 3AXDA 3VBFC 3VDDC 1RUC3 1RUI1 1VBD2 2B42B 1YCIA 4XIKA 2WZR3 2E6VA 4G9SB 2X8KA 1H9WA 1SLAA 2PHFA 3IDCB 5L19A 4LBJA 1GNHA 4HVRA 3LB9A 3CO2A 2MEV2 1OLRA 1NE4A 3L2HA 3H3UA 1QF3A 1V6MA 3VZNA 4DRRA 1LOGA 2XJUA 2ZZQA 5EWSA 1IKPA 5C4WB 4IL7A 4AEMA 4IEXA 2RS11 2IZWA 1RUOA 1YIPA 4BMEA 3ILFA 5AC92 1S2BA 4FPYA 4O9GA 5CBLA 1PHMA 4TSVA 4AVAA 4A7KA 2B5HA 3ZX7A 5KHGA 1G7YA 2F4PA 1REDA 4B3NA 4Y20B 3ZSEA 2Q1ZB 3P3NA 1G9AA 3PMEA 1RUG3 2AENA 3WP6A 2R16A 4NOTA 4JVAA 5D8AA 1QXRA 1RUNA 3G7DA 1OOPC 1REFA 5EYXA 1UU5A 1FMD2 3WLUA 2D6PA 4I0WB 2JE9A 2DWRA 3JQXA 2WQ4A 1S1AA 2LM3A 4M01A 4RQPB 3C3VA 3WG4A 1M06G 1PVC2 1MR5A 3RYRA 4I3GA 2ZHLA 2D6MA 3GZTB 3N35A 4DINB 1SFYA 1RUJ2 2ZGRA 2VGDA 5JWPA 2R043 5KBFA 3MICA 3AYEA 3CJIC 3POSA 1DQ1A 5DDJ1 2GMMA 1G6NA 4JTOA 3MPPG 5EYYA 1R1A1 1VBB2 1GQHA 1W6NA 1QJZA 4MSVA 1O4YA 2ZKLA 4CDQA 1AX1A 3WX5A 3ZYPA 4L99A 3DPRB 4HZFA 2EAAA 3TBDA 4YM3A 1Z7S2 3VBRC 4CEYB 4Q8KA 4K7JA 2QQPA 3NJZA 2QCSB 4AI8A 4CDUC 4M0NA 2UY8A 2YXSA 1NCRA 1OA4A 5J3UA 5L36A 4XXPA 2RS32 3PVOA 3R05A 4AFAA 4JGYA 4JGYB 1TNFA 5LRSA 3A0NA 2XUMA 1YHFA 5C9AC 4LUKA 2CGOA 1I9RA 4W6WA 4BA6A 5GALA 3NKGA 2VMGA 2DVBA 1UF2C 4YFWA 4Q4X3 1AR91 1F9KA 1MEC2 5B2GB 4KBBA 4LBNA 5IT6A 1AHSA 3I8TA 1VR3A 2PELA 3WG1A 4XQDA 4PDWC 2YHJA 5GLWA 2OZJA 3GALA 1XE7A 1RUF2 3TAYA 3ZXJA 2Y38A 1GZWA 4PIYA 4XJWA 5T5JA 1ND2C 2WWSA 3ZN4A 1RJ8A 5JOWA 1V70A 3OBRA 4M3CB 2ZABA 5E8AA 1GKBA 2WFF3 3WCRA 1YFWA 1DGLA 4JCKA 1NLSA 2DCKA 1EV12 1OA2A 2ZHMA 4Y1UA 4X8NA 4Q4V1 3SITA 2KXLA 3EJKA 3E5XA 1IPKA 3EBRA 3CF6E 4LNVA 1EAH3 2XWBB 2BWCA 1RITA 2VW2A 2SBAA 3WV6A 2JICA 1PO12 2D43A 4LA3A 3VKOA 4Q4W1 2A71A 4JV4A 5KC6A 2JXAA 4YZ2A 2WQZC 3BALA 3M1HA 2IC1A 4AEDC 2B46X 4C0BA 5BNQA 1BVVA 1MACA 2QDRA 1RUH1 1F8VA 3IPVB 1V9U1 5E89A 2BYVE 4XFHA 1UZYA 2PN5A 2C5DA 1FXZA 4E9KA 3BODA 1JTZX 4XBLA 2VY0A 3VLBB 4GMP1 4AGRA 4XPVA 1V6IA 5JOZA 2H6CA 5H9SA 1H1MA 4L2NA 3H7YA 4LBQA 3FLPA 1RGSA 1VBD3 1QHDA 2GNTA 4XHXA 4AI2A 5EV7A 1HQLA 4YG3A 1G9DA 4MUVA 2DVGA 2WT1A 4IV1A 4SBVA 1JUHA 5JIAA 2R1DA 3AZVA 3FE5A 3HR9A 4LO5B 2EALA 4WM8C 4YW3A 2K0GA 3BIWE 5BNPB 2Q30A 1LOEA 4WVMB 1M4WA 1UW8A 2HWC1 1POV3 5FO7B 1B35C 1IS6A 5IUQA 2ES3A 4MGZE 3AZXA 1CAXB 1HXS2 4IV3C 4MLOA 1O3RA 4MYEA 5AC93 2WLPA 1HX6A 1ZZ6A 3AMHA 1DYKA 2BFUL 4IEQA 4Q8LA 2NM1A 4AI0A 2N7GA 4PQ9A 1JBCA 4KG8A 2BTVC 1DFQA 4JAAA 1QJY1 4QM9A 2VU9A 3KQRA 4QD2A 1D2SA 1RUD1 2JG9A 1RMU2 5CFDC 2VUJA 4CTEA 2BUKA 5HCBA 1NCQC 1FMD3 2ARXA 4WBBA 4GKYA 4FPFA 3JD71 2P3IA 5CFCC 1ND3A 3VKNA 4HSJA 4OI4A 4DPNA 5I0UA 1WCKA 2MHFA 1D4VB 2XJQA 3ACLA 1Q5OA 3WW1A 4EWAA 1KFXL 1VBC1 5FQ0A 2YDEA 4AQSA 4NWVA 2VXRA 4FP2A 3CU7A 2E53A 1POV0 2OUJA 5GLUA 1DYPA 3FFZA 1ONAA 1WLDA 2A6VA 1RTVA 2ZTNA 1VBB3 5A3MA 1AR61 5D8AC 2HWF1 4HKWA 5KXEA 1QJX1 3USSA 1KS5A 3MLJA 4JDNA 1YI7A 4GH4B 3WP4A 1W6MB 4XHBA 1AYM1 5L7OA 2D97A 5JIUA 5L7OB 1RINA 2VH9A 3O5SA 4Z82A 3FLRA 3R4DB 1QKQA 5T50A 4EWEA 1ZX5A 3WDVA 1ZBA3 2RS33 4FTBA 1S0IA 3VHRA 3ILNA 2WA3A 1AR73 1RVF3 1PO22 4JGZA 2HWE1 4CDQC 4E27A 1VJ2A 3RDIA 3KGZA 4Q2FA 3ZSKA 2A6YA 4AQ2A 5ABJB 1C3HA 2EXKA 1DQ0A 2AR6A 4M3CF 4AVCA 2X5IA 1KDKA 4E2SA 1C8M1 2FZ1A 2RJLA 2V5YA 1CPMA 4MGYE 2IXKA 1T6GC 3ELNA 4ZU5A 1S55A 3FUOA 4FPLA 3OYWA 4FOYA 5CB7A 3WDYA 1ZZBA 4JDOA 3N7KA 4IERA 3VL8A 1S0EA 3J8F2 1EV13 3JZVA 4FPGA 1UAIA 3VBUA 3AFGA 3MEPA 4G4FA 3WW3A 2O8OA 3WHUA 1UZZA 4L97A 2W39A 3AMPA 3WT3A 5ACA1 5IK5A 4WVZA 5DG2A 3ZO0B 4B7KA 1EP0A 1PO13 4BH9A 2GH2A 1FPN1 4AG4A 1URXA 4RS5A 4XDQA 1IKQA 3CNAA 3FFQA 3GHMA 3KGLA 1R082 1MS9A 3GHNA 3ZYGA 4CP2A 4FAHA 2XBO1 4A2UA 4XF4A 3AYDA 4YW2A 1FI2A 4KNCA 3LA7A 4RFT0 2WINB 3AMQA 2R071 1W6OB 2E7AA 3VKFC 4LEJA 2WS91 3P3PA 5A3LA 3BOWA 4C0HA 4ES8A 1OI6A 4GXLA 3B01A 3ZSJA 1X8MA 3NKTA 2WNUA 2ZMNA 4GB32 3TNQA 5J37A 3JUUA 3FWEA 2GDFA 4QPYA 2E9QA 2PAMA 2WZPP 4B7EA 1BEV2 4R52A 3NVCA 3TWIA 2XJTA 2HWD2 1H8TA 1KJRA 2WNVB 1XRUA 3ECQA 2RS51 4RHV2 3AYAA 4OUSA 1ULEA 4CDXB 2DCZA 1VAMA 4CP1A 3D6EA 2ZMKA 3GBGA 4RR3A 4W65A 3WP3A 4C1WA 2PQQA 4DS0A 2H6BA 2VMIA 3HAGA 2DUOA 2VULA 3SH3A 2IXLA 1R093 3AKPA 4SLIA 1HKDA 3ZMOA 4KU7A 3WZ1A 2HEYF 1YO8A 1TQ5A 3NV1A 5JCTA 2ZGNA 4X8PA 2WZR1 2ZGSA 3HT2A 3PJQA 3OY8A 3OY8B 3WUDA 1NA1A 2PYTA 1NA1B 4P9IA 3OTFA 4YW5A 4LHKA 5FREA 2D44A 1FATA 5T3NA 4P9LA 5HCAA 4QPGB 4ZU4A 1ZBE2 3X29B 4E4SA 1K5MC 4XMAA 4D94A 4IXLA 1F2NA 4YVSA 3ZSLA 4Y22A 5K8SA 4Z92B 3ATGA 4R9AA 4AGVA 1RMU3 1ZNPA 3WNXA 1COV1 5C33A 3W58A 1TME1 2XHKA 2ZBJA 1RHI3 4IETA 4DQAA 5FOBB 3WG3A 3MGUA 1D4M3 1MQTA 2QJVA 1ZRRA 2WA4A 5FLIA 4B29A 1JYIA 5BNOC 2E63A 2RR13 3ST7A 5CAZA 5FAXA 3V0AA 1QNWA 4LE4A 2GNMA 2DVFA 1VBE2 4DFSA 1OFNA 1RUG1 4LUMA 1W0PA 3FJSA 4YVWB 3MIFA 1OOPB 1DQ4A 4P9YA 2PHUA 2PLV2 3HT1A 1MS3A 1VALA 2CAUA </