1C3HA

Acrp30 calcium complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
137
structure length
137
Chain Sequence
AYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords 30 KD ADIPOCYTE COMPLEMENT-RELATED PROTEIN PRECURSOR
publication title ACRP30 calcium complex
rcsb
source organism Mus musculus
total genus 24
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c3hA00
2R6QA 4KG8A 1C28A 3ME2A 3TYJA 4MSVA 3LKJA 3K51A 3B93A 3B94A 5TSWA 1GR3A 1OQDA 2JG9A 2ZJCA 2HEYF 1A8MA 5CIRA 3WD5A 3MI8A 4MXVA 2TUNA 3B9IA 4OUMA 4QQPA 4TWTA 2WNVA 1PK6A 1WCKA 3ALQA 3FC0A 2QE3A 3K48A 1DG6A 4J6GA 4MXWA 4TSVA 3QBQA 3TWIA 1I9RA 2HEWF 3QD6A 4G3YC 3AB0A 4GIQA 4OULA 1U5XA 5KWRA 1DU3D 5KC5A 2R32A 5KC6A 1JH5A 4HT1T 5L36A 2JG8B 4G4FA 2R30A 1O91A 1XU2A 1TNRA 5L19A 1JTZX 1RJ8A 2QDNA 2TNFA 1XU1A 1D0GA 1RJ7A 3L9JT 4E4DX 2JG9B 1D4VB 2E7AA 1KD7A 2RJLA 4N90A 1IQAA 4EN0A 4OUSA 4QQOA 2JG8C 1U5ZA 2WNVB 4QQ2A 4E4SA 1PK6B 5HBAA 2KA3A 2WNUC 4F3JA 1OQEA 2JG8A 2AZ5A 2WNUB 4D7YA 5BNQA 4QQLA 2OIIA 1TNFA 4MXWB 4NN0A 3IT8A 4QPYA 1U5YA 2X29A 4RSUA 1C3HA 3V56A 2JG9C 4DOUA 4DB5A 4KGQA 2RJKA 1ALYA 4KGGA 2HEVF 2Q1MA 2ZPXA 2Q8OA 1S55A 2RE9A 3URFA 2WNVC 2Z5WA 1PK6C 1D2QA 1KXGA 4QQHA 2O0OA 1OSGA 2WNUA
chains in the Genus database with same CATH superfamily
2DVGA 3IAPA 1OKOA 5F2WA 3SH4A 4YFWA 4GB32 3J26N 2Y6LA 1S0BA 2O14A 1AR61 1C8M1 4IV1A 4KMQA 5T5OA 3ST7A 3HN3A 4B4PA 4W6YA 2ZJCA 5CIRA 2J1TA 4P9IA 5ISLA 5CFDB 4JTOA 5ANNA 2IFWA 4AYUA 3FX3A 1CAVB 5FYCA 4NIDA 4PQ9A 2B4KA 3ES4A 3IMNA 3LWCA 3WNLA 2XR4A 1C5IA 4EWDA 4QX1A 3CZJA 4YVWA 1KDMA 4XTPA 3K75B 4M01A 4CP1A 3I3QA 3ZFFC 1C5HA 1RUF3 1LESA 2C24A 4EN9B 1VBD3 1EAH1 2Q5TA 4L99A 4WV8A 1Q43A 2ARCA 3AP9A 5LK5A 4R9AA 3WUCA 4AI0A 2GNBA 3G6JB 2AACA 4PIZA 1QQP3 3PDQA 4NAMA 2RDNA 2BWAA 1Q8SA 4Y22A 3ZXAC 4ZZ8A 3O5SA 1NLRA 5APAA 5HV4A 4D7SA 1STMA 2VW2A 1IKQA 2GC3A 2ZGQA 3CBNA 3MV11 4XQDA 3VBOB 2ES3A 5A7SA 3ZFEC 3TNPB 3RZZA 2LS6A 4CXWA 1JTZX 5A3TA 4LA3A 5ACA1 2C0ZA 4AF9A 1GKBA 1MR5A 1E5RA 4YM1A 5JSRA 4AHZA 3AC0A 3M3CA 4M3CE 4B4RA 5EFUA 4BM8A 1F35A 1S0EA 2JG9B 2E7AA 1Q8OA 3AP7A 3DYPA 1XOYA 3PUSA 2R0HA 1O4TA 2RS12 2D6KA 2VE1A 4FXKB 2W87A 2JKBA 2VNGA 3KS7A 2D6NA 4QPIA 5IVJA 1DZRA 1XNAA 2RDRA 2ZMKA 3WVJA 2Q1ZB 3FLTA 4BLIA 5FZBA 1W6NA 3DYMA 2KA3A 1RUI2 4S2FA 5JI7A 5BXXA 5A1AA 3N9LA 1EYBA 3KCYA 2DVDA 1OA3A 1DGWA 4YZ4A 1W8ZA 3ILNA 3B02A 1D4M3 4QDRA 3WLUA 3V0BB 4IV1C 5EIYB 1JZ4A 4K6BA 3LDBA 3HNMA 4L0PA 3R4SA 5FMOL 3NAPB 3D5OA 4NIIA 1DGLA 1H0BA 2GNTA 2O1QA 1CAWA 3PMEA 1DCSA 3MIGA 4Q4W3 4ZU4A 3WDVA 4EN7B 5FPXA 3RI8A 5DABA 2XHNA 3OBRA 4EWAA 1O59A 5FWJA 1S55A 5FLJA 1XB9A 1RUD1 2H6BA 2O8QA 2VCMA 1OH4A 4OZOA 4KWUA 1I5ZA 1OT5A 3O1MA 1K5MA 4OVEA 4CDWA 4IGOA 4YVWC 4TXWA 4AQ2A 4CDXB 3MIDA 2J1AA 5JXHA 2WNOA 3IPVB 4OHXA 3WF1A 4AGRA 1MQTA 1NZCA 1WCUA 3Q8CA 4XXPA 1POV3 2FCUA 2X10A 4PLNA 4BMBA 3O0VA 5J96B 5T52A 4MGTA 1NCQB 4GMP1 4HVRA 5F2SA 1UCXA 3ZYJB 3A23A 4IEXA 5I8SA 3TYJA 4FXGB 3GYDA 3VZKA 3WG3A 3FLPA 3D82A 3CNAA 3H8XA 2RM23 3J7NA 4M3CA 5D8AB 3R4DB 5TSWA 3PIGA 4YW2A 4LHLA 2V72A 2XXZA 4E8DA 1YI7A 5I93A 3BVCA 5CAZA 1LOFA 5F1RA 2GNMA 1AXZA 3VZLA 3I2KA 2QQKA 1AR82 4IE6A 5A33A 2VMGA 3UETA 4OUMA 1DHKB 3KT1A 4M4RA 5A3OA 1VRH1 3X29B 1YFXA 1BMV2 1WD3A 5FV3A 4QX2A 2XJTA 3VHNA 2VZSA 2L9LA 2Z2SB 1C8M3 4XPVA 3ZYBA 1QGLA 1OPMA 3PJYA 4P9LA 1PZ7A 2G9FA 5DXDA 5CZKA 3ZR6A 3QLQA 4PLOA 5LA1A 1UPIA 2ET7A 1PMHX 3JBG1 3QD6A 1DIWA 3GBWA 4P5YA 3VL8A 1PO21 1VAKA 1CZSA 2PAMA 1Q8PA 4LPLA 4CDUA 1IS5A 1O3QA 1PIV3 4P08A 4CCJA 4AEJA 1FAYA 2H6CA 3T3YA 4A2UA 2VXJA 2P6HA 4AI1A 1W8FA 2JKXA 3N3HA 4MHRA 2EXHA 3DPRB 4WZCA 3AVRA 2VU9A 5GLTA 2PQSA 3QH6A 1AX1A 2A70A 3VKLA 4XUQA 4GB31 1DGRN 5C71A 3LB9A 3GXUA 4OZXA 3UGHA 1ASJ3 1VJ2A 3NSTA 1ULDA 4D69A 4OHYA 3OPTA 1KS4A 3N9OA 5EXOA 2GSYA 1W2AX 2YZ4A 3AP5A 1OMIA 1ULOA 3RSJA 4IE4A 2V5YA 5EJZB 3MFAA 2ZHNA 4AFMA 2NYYA 1K5MC 1C57A 2D6MA 3M8LA 4GZ9A 2WC2A 3ZN5A 1V6LA 1SFNA 1LTEA 4OUEA 1MQTC 5FLHA 2CV6A 1SCSA 5ACA3 5FYZA 4DXZA 3HN1A 3U1XA 3ZSLA 2A6YA 3EHKA 4DQAA 3OUHA 5CFDA 1RIRA 4AHYA 2W95A 4RHV2 2C4XA 5IFTA 4QQLA 3RFRA 4FOVA 3NNJA 1CAVA 1MS5A 1TZOA 4FO9A 5FPZA 3AZYA 4TLGA 4BQ3A 4XBQA 2X29A 4ET7A 5FKBA 3D8CA 1N1SA 5DZFA 2W91A 1LOFC 4P9YA 3W58A 1X36A 4DB5A 1AR71 4A6SA 4CVUA 1YCIA 2YUEA 3NJYA 4FPCA 1GBGA 1HV1A 2VR4A 2Q1MA 1QOTA 3JXSA 3ZPOA 1W6MB 1OD5A 1LHVA 1KXGA 3ECQA 1FMD1 2A1XA 1XE0A 1JHJA 3H8RA 3UK9A 3THDA 1PGL2 1SDDB 2D3RA 4XZPA 3V65A 4S2HA 2E7TA 4QDQA 3VBOA 1J58A 1XPWA 2WNUA 5C9AB 5LY2A 3DUIA 2CTVA 2GN3A 2R073 5LBCA 4NIAA 4Q4X3 4CDUC 3SEEA 2ORZA 5EYYA 2NPIA 3KSCA 3LGRA 4XFCA 1K3IA 3ENRA 4RQPB 1FI2A 1EV13 3NQHA 4QGLA 1JZ6A 5F3GA 1NCRA 2JG9A 2VUCA 2HWC2 3KGLA 4JGYB 3WNNA 5FPBA 1RYYA 2GMEA 4URTA 2A6XA 4LOSA 3ZSKA 1HN0A 4MGQA 2MEV2 2GC0A 3FBYA 4QGMA 2GU9A 2J1EA 2JDZA 1HB2A 2XOMA 1EPZA 4IEUA 3VZOA 3AKRA 4CXYA 4AWDA 4HG6B 4BQ4A 4DPNA 2CY6A 1IGOA 1TE1B 1UPSA 1PNFA 1V6KA 2KR2A 1R1ZA 2XBO2 3MLKA 4FAGA 5FWEA 1CD3G 1IS4A 1DYKA 1MS1A 2D6OX 3N9MA 1G8WA 3K3OA 4H2AA 3GZTB 4IERA 3MLJA 2X09A 3NO8A 2ZGNA 5E88A 3V0BA 3FHAA 5CKNA 2R063 3LCPA 3NAPA 3N35A 4XMIA 4LBQB 2ZMLA 2GH2A 1NG0A 3CLPA 4R9CA 4CZSA 2C9AA 1RHI2 3A0NA 5CFDC 1DLCA 4LMFA 2CWMA 2K46A 5DDJ2 2ADDA 1XU2A 3BODA 4Y5TA 3T0BA 1JZ7A 5CU1A 4CCKA 5CG8A 3TN92 1LHNA 1DGWX 1ZRDA 3ZYPA 1O8PA 4IE7A 1KFUL 2IC1A 4CDXA 4I2OA 2JDMA 1COV2 1F2NA 2WYSA 2LRPA 1JBCA 1RMU2 2BERA 2HWD1 2PLV1 3WW3A 5AVPA 3O1VA 2E26A 1AYN2 4H55A 4IEYA 5JLVA 1NCQA 2ZMNA 3ZKUA 5AFBA 5F6KA 4DINB 4C0BA 3DGTA 1LHOA 2KM2A 1AR81 2Y34A 3VDAA 2XJPA 2QCSB 5CB7A 3D3AA 1QU0A 1HX6A 1SG3A 5D8AA 1F31A 5CEHA 4NVPA 2DCYA 3N7KA 1BMV1 2YU2A 3PTYA 1Q8QA 4QQ2A 2WS93 5DN2A 1PK6B 4N43B 3THTA 3VBOC 4E4SA 2WNUC 2Y8KA 1PM4A 2YHJA 3I59B 3O1OA 3VV1A 1OBNA 1Y7BA 1AYM3 2ZX3A 4JHZA 1VLNA 3S5QA 5FY9A 3POGA 2VULA 4JDOA 4K40A 3MW2A 2LUWA 3RDIA 3VKOA 1SBEA 2VL4A 2CAUA 1M4WA 3BCWA 3PUQA 5L7OA 3IT8A 3BI3A 2BTVC 1YQ5A 4E27A 4EZ4A 1UOGA 2GZWA 3V56A 2LROA 2JG9C 5KHHA 3PU3A 4NHXA 5A7OA 1BVP1 2VOWA 3AYDA 4XF0A 3ZN6B 4KGQA 3VUOA 4MHUA 3E6DA 1UZZA 5C7GA 2XLAA 1S4CA 2XQXA 4Y3OA 3NV2A 4RFT0 5JPNB 4ISRA 4B7EA 2JB4A 2Z69A 2FMYA 1JUIA 5GLUA 3OD4A 1RUF2 3C7FA 5EZWA 5LA2A 4DY5A 3POBA 3KD4A 4Y4YA 5A7NA 4ES9A 4CUGA 4CDQA 1W8WA 3DPRA 4LXLA 1DF0A 4Z2AA 1VBE2 1SLIA 1GQPA 4K8FA 1L7RA 2EIEA 2EIGA 1ZBE2 3WG1A 3NNGA 4FI9A 1UNBA 3NAPC 4JQTA 5F5IA 1GQHA 1CQ9A 2NQYA 3U14A 3U0ZA 1OC1A 4LTAA 4NPLA 1OQDA 1FMD3 4A7ZA 3NWKA 4HLTA 1H1IA 3JQXA 1W8HA 4DO0A 2YDEA 4QKNA 4BPZA 1A78A 2D6LX 1NE6A 1RUC1 3MI8A 4H3WA 4META 1ENXA 2RDSA 4XJUA 1BEV2 4XZUG 4XFAA 4XW3A 5FYBA 3C7EA 2ZHKA 4CDXC 3VKNA 2IXIA 5JMOA 4BE3A 3INAA 5BV6A 1OVSA 1AXYA 1Z7S3 2XWBB 2EIDA 1NCQC 2W08A 3K2OA 5J98B 5C3PA 5H9SA 1PO11 1ONAA 3T09A 1DQ2A 4QPGB 4UWDA 5LA9A 2VZQA 5A70A 4NR1A 1EY2A 4JAAA 1UKGA 5D8AC 2XUEA 4G3YC 4ZXEA 4DEQA 3MHZA 3KV9A 4XUTA 2E7QA 5FO9B 1UY1A 3GGLA 1PGL1 1PHMA 1ZZ7A 1WW7A 4YSFA 5KC6A 1D4M2 1W0OA 5FCCA 3UJQA 5D21A 2XJQA 1PMIA 1VMHA 2ENRA 2WA3A 2VCCA 5L7OC 5FZDA 4P00B 1H8VA 2FHRA 4IGPA 3ZPYA 5FZAA 3CU7A 4M3CF 4UAPA 1JZ8A 3GZEA 2WZR2 4RN5A 1QJZA 3BTXA 2YYOA 5C9AA 3M3IA 1EUUA 3O1SA 2BVBA 1OA2A 3VKFC 1S0DA 3RZHA 3ACFA 1YNAA 3NJVA 3KMHA 4UBHA 3LQCA 4W65A 3LE0A 3DEMA 4AVSA 4QDSA 2RMU3 4RQPA 4CCEA 3KWVA 2D98A 2QQLA 2R7EB 3ZYGA 5FDBA 3MIHA 1GQGA 5HBAA 3DPRC 4JGYA 3BTZA 1A8DA 3KGZA 4A42A 1UW8A 3WP4A 2JG8A 1QJX1 2XBO1 1UYZA 1OOPB 2HWD3 1TG7A 2RM22 2WFF1 1FNZA 5FP4A 4IEOA 5JAXA 1RUH1 3RMXA 1HRI2 1CJDA 2VGDA 5FQ0A 3KV5A 2ZGUA 4XQ4A 5GALA 1QMJA 1BQPA 3U11A 5B4NA 3NV1A 1C3HA 1RXGA 4FPFA 4CTEA 5LBBA 1W9WA 2LM3A 3HOBA 4AEMA 4O9EA 2QNKA 1DGRA 4BQ5A 1GZ9A 1UY4A 3JQWA 3MFCA 4IDZA 3ZYRA 2HLEA 4L97A 4ZXKA 2TBVA 3BOWA 2EVXA 1C8M2 4LBQA 1AR62 2XPJA 3CL1A 1Z78A 5A3LA 5J48A 1POQA 3N7JA 4PT6A 1RMU1 4L8QA 4L11A 3VBRB 5C3SA 2YC4A 1S2EA 1VBB1 1FOD1 1OVPA 5FZCA 4AGVA 2QQVA 1C28A 3ME2A 5FZOB 1GP4A 5F8PA 4MSVA 3T2TA 2W1SA 3BTAA 4XAEA 1QHDA 4BQ2A 3T2QA 2WWSA 5D2AA 3ZSJA 4CP2A 5LA0A 4XFFA 2X53S 4KWLA 1RUOA 2JDHA 4Y22B 2CGOA 3M3EA 1ODMA 1N3QA 3LOIA 2JE8A 1EAH2 2BP6A 4LO4B 4A3ZA 4XJ9A 4I09A 1Q3EA 4XF4A 1QKQA 3S5AA 1TMF3 4QQPA 2QQMA 2VQTA 3DYOA 3UT0A 4AW7A 4BHPA 4D6QA 1PK6A 4N43A 3MDPA 5C9AC 3I59A 4X6RB 2WLQA 1BHGA 3EQEA 5HCAA 2E51A 5FYMA 3WNXA 5J37A 2C9KA 5ACA2 4A7KA 5KXEA 1ENQA 4RQPC 4QPIB 1RUC3 4X8PA 3B5LB 2YC2A 4AG4A 2OZJA 3MZHA 4YARA 3MLLA 4JGYC 4FAHA 1NLQA 5F5QA 3ZN6A 3WDYA 1VBD1 1H2NA 5DUXA 4AVTA 4S2DA 3O1TA 3BIEA 2LALA 5DQ0A 1OI6A 3ZSEA 2BU9A 5A6QA 1JZ3A 1YIPA 2NLRA 2VG9A 2ZGMA 3KQ4B 4QXCA 1QQP1 4PI2A 4R4ZA 4XCBA 3POFA 4LBKA 4NE9A 4UI9L 4FOWA 3WNMA 5LATA 1F8VA 1L3JA 1PO13 5FY1A 1WUVA 1F9KA 4M00A 4Z92B 2XJRA 4UFIA 3WDXA 2RHPA 1UYPA 3VDDB 1JYTA 1HLCA 2V73A 5AVAA 3UGGA 1BLZA 4YLZA 5A7WA 1QH7A 1W9YA 3MV01 3D4KA 4IW3A 3VD3A 1LOBA 4YFZA 5FUIA 4MVTA 4RGKA 4I0BA 2FDFA 2FQPA 2WSUA 1V0AA 2AENA 3PHMA 3DV8A 4LBNA 1LOAA 3VHRA 4C8DA 1LHUA 4QB2A 4CDWB 4MO3M 4ZKTB 3P3PA 1U5ZA 2IXHA 4Q4X2 2Y6GA 5E1RA 4YW7A 5FK8A 1C4RA 4NHLA 1NUKA 1G7YA 5C6CA 3T4VA 3N9QA 4XAAA 3VZJA 1ZZ8A 3C7GA 1ULCA 1EV12 2YB7A 1N1YA 4FOYA 2P37A 3HVDA 3TAYA 5A6ZA 2Y26A 4R4XA 3NRUA 2WBKA 3OGSA 4OYUA 4UW5A 4YWAA 5T3NA 1CONA 5B2GB 5K7PA 4IV3B 4RSUA 5GZEA 1MEC3 1VBA3 5CFCB 5JSPA 1JODA 2W2IA 4KNCA 4OHVA 1ZYBA 4HMZA 1AJKA 4Q0VA 4XBLA 2B9VA 4QPGA 3AKTA 4B8EA 2FDJA 1K42A 4AEDB 1OF4A 4E2SA 3T30A 2UU8A 1MZEA 5I8TA 1AR93 5JPMB 2WFF3 2YXSA 1PK6C 4N43C 4Q4W1 4QQHA 4RS5B 4UW3A 2YG0A 2VY0A 3U37A 2Z79A 3EBRA 3SCFA 1APNA 1YYNA 2BW8A 4KU8A 2EXKA 2W5FA 1UY2A 3GALA 3WQBA 5I0UA 2R062 2QQNA 5JI9A 2E6VA 2HJIA 3WF4A 2G9GA 3DXTA 1IS3A 1KEXA 2OX0A 1VRH2 1IHMA 1RB8G 1O3SA 4LO6B 5BNPB 3LDKA 2FD8A 3ZYFA 4AI2A 3HQXA 3LEGA 4Z07A 4IEZA 4GA9A 1NA1B 2B9UA 4WBBA 4BQXA 1QJEA 3DCQA 1N1TA 4CSWA 2B46X 3JBG2 1W99A 4LLOA 1X33A 4PHZA 2XL7A 1PO22 4YM3A 4QMAA 5DG1A 4AXOA 3WUDA 4E9KA 1RVF3 2OVUA 1NT0A 4MYEA 4W4ZA 3RMYA 1GWLA 4IGQA 3SHRA 1LEMA 1GOGA 4XDQA 2E53A 1NQDA 3ZVXA 1CN1A 1OOPA 2BBVA 3VKMA 4F8AA 1ZZBA 1ZM1A 4Q8KA 3JD71 4LITA 4M0HA 2XQRA 1W8NA 4XF9A 3WHTA 3LA2A 3SCGA 4FFHA 1J84A 4AI3A 1X50A 2ZZQA 3MO4A 2DU0A 2K2SA 4N53B 4OULA 3ZXKA 3UKVA 4FPGA 3LOBA 1BJQA 2A71A 4OMDA 4Q29A 1JYNA 4PDWB 3HQUA 1DFQA 1DZTA 4JGZB 4MADA 4D0QA 2VZVA 4JDMA 4ZY9A 3SC7X 1PIV1 1FXZA 1H2MA 3AFKA 5FYHA 5L9BA 1UD1A 4B1MA 5IVEA 2XH6A 2IWGB 5GKAC 1RJ8A 4AOCA 4A44A 5FO8B 4OQ9A 5FZ3A 1W28A 1UYXA 1SPPB 3VBRA 2ETEA 5EWSA 2VMCA 5LEJA 5KHJA 3O1UA 1ZBA3 4QPGC 2JX9A 4Q8LA 1GP5A 1LECA 4CXXA 1TQ5A 2R49A 2NN8A 1YQ2A 3UKTA 3K4DA 5FZOA 5HCBA 1ASJ1 3ZDVA 5DAPA 3H3ZA 5IATA 2JE7A 4GWJA 1H8TA 3HBKA 3KV4A 3UL2A 1DQ6A 1ULEA 2JDKA 4U2AA 3BU0A 3R0RA 1AR72 1D2SA 1OQEA 2HWE1 3I2DA 4AVBA 4FVVA 1US3A 1R093 2WNUB 3AM2A 1QNWA 4JRAA 3S57A 2G4IA 1UN1A 2VZPA 2CL2A 4LO5B 4E4HA 3A21A 5FZ9A 1FMD2 2XLGA 3AFGA 2JIGA 3BKZA 1NLSA 4CU6A 1HDKA 4CPBA 2DCZA 1W0NA 5KBFA 1U0AA 2ZEZA 5L73A 4MOAA 1C1LA 1NCRB 3E5XA 4O7XA 2D40A 1W9SA 5H9RA 4YVSB 4MG2A 2OYZA 2CAVA 2BGCA 4FQ4A 1MPXA 4I30A 2W47A 2OQ7A 4I0WB 2Z5WA 5BUVA 2ZTNA 1OD3A 4XDOA 5FMCA 4H7LA 3KT4A 1QOOA 1YLLA 1JHNA 1OOPC 1T6BX 3MUZ1 2PHWA 2Y64A 1J3QA 2BOJA 3HT1A 3WCRA 3BALA 2ZGLA 4PBPA 1OFNA 5F5AA 1REEA 3KT7A 1VAVA 4XOGA 4YYOA 1FYUA 4AFDA 4OI0A 2R6QA 3HAGA 3LSDA 1GFF2 4YZ2A 3M4FA 1F15A 1P8JA 1ODNA 1V6OA 3LKJA 4GH4B 2GNDA 4UF0B 3UESA 1UOBA 3HIFA 1AL23 3VDDA 2R071 3BU7A 5JWPA 4Q4X1 1TEIA 5FZKA 5GM0A 4LBMA 5HXVA 2I07B 3WNOA 1YJLA 2DFBA 4NAOA 2NZ9A 2ZX2A 2CU5A 2DBNA 4HVQA 4M0NA 5A1LA 4K20A 1GV9A 1EV11 3ZFGB 1NOVA 4YG0A 4GWMA 3GM8A 2QQJA 3VBRC 4BK5A 1O7FA 5A32B 3NJXA 3P1IA 2OXBA 2JDNA 4Z8BA 1XE8A 3DECA 3FUQA 1QJY1 4HANA 4QB6A 3MF9A 1AUYA 4J6GA 3U4XA 1MZ5A 5FREA 2RMU2 2VCAA 2DV9A 3DKWA 1S2KA 3UGFA 3RNSA 1LOCA 1OA4A 1YEWA 2BBAA 5FOBB 2RVAA 5L9VA 1KFXL 2OKXA 5FP9A 4P9JA 1D7PM 4IV3A 2HWD2 2PLV2 2EA7A 5EJ3A 2D7FA 5CFCA 5BNNB 4TN7A 2ZA9A 4YNIA 4HZFA 1EPWA 1QOSA 5I91A 1QWRA 1L7QA 1TVGA 3OY8B 4AEDA 2R061 1LKNA 1O91A 1W8OA 4OHWA 1VB2A 3QOPA 1G9BA 5T55A 3VDCA 4RS5A 5L7OB 2PQQA 1W06A 2PHFA 3JD73 2BVVA 2GC1A 3HPNA 2VZRA 3WNPA 4HONA 2YC0A 1AF9A 5AC93 4Q2FA 1KJRA 1WMXA 3V64A 4HSLA 4CCDA 3VDBA 2D44A 4Y1YA 3ACHA 3FHQA 4QPIC 5FTTC 3RYPA 4GKYA 4A41A 1I1EA 2Q30A 4LR4A 2AR6A 4BXFA 1JYCA 2ZGSA 3I3EA 5BNPA 1MS3A 1X8EA 4JX0A 3RWKX 1CVNA 1JXNA 5K4LA 1WD4A 1W2UA 2CDPA 1JZ2A 5C4WB 1IZ3A 2PAEA 2WNVB 1NA1A 2Y6JA 1JZ5A 2FCVA 2DUOA 1J3PA 2P17A 4Y1XA 3T1LA 1HXS3 3C3VA 3KF3A 4CDQB 1FPN3 2GP3A 3EJKA 4D8MA 2VXRA 2OIIA 2WS91 2PA7A 5A3PA 2W9XA 3VDDC 1AYM1 4CEYB 4NJ4A 5FZ6A 1VALA 4DUVA 2YFUA 2BEOA 2JWPA 3I2FA 2XVLA 1GSLA 1Z0HA 5IWFA 3EXUA 1C1FA 4XF3A 4Q0SA 2J1SA 4CDWC 2HWE3 4EJRA 4N53A 2WFPA 1JN2P 3KB5A 2BJSA 3N7MA 4YPJA 4PDWA 4JGZA 2FDHA 4XJWA 5FKCA 3CZUA 1RUC2 3S0MA 2JDYA 3J8F1 5IAXA 2D5FA 4V2WA 1IOAA 1GICA 4Z82A 5A3WA 3U4SA 4IV3C 4YZ5A 3CDZB 1GZWB 1SPPA 2WYFA 5IUQA 5CFCC 5FRAA 1NZIA 5F32A 3EMRA 4WZFA 1W04A 3ROUA 3NNLA 4OMCA 4AEDC 4BQWA 1R1A1 1UU4A 3H9AA 3MIBA 1PO12 2ZGOA 1A8MA 2W46A 3TOJA 2XMLA 4RS5C 2RDQA 1BBT3 2PHUA 5FJHA 2VAUA 4IETA 4K1YA 3VGIA 1X7NA 3OB8A 1ZREA 2RR13 4KL1A 3T08A 2F17A 5A3NA 4IEPA 4DXTA 3UNPA 5FZMA 1JYWA 4GMP0 5IAVA 2OA2A 3PVNA 1Y9QA 4NMIA 2UURA 2QFEA 3ITQA 4LORA 5BNPC 2QZ2A 4LBQD 3TWIA 1GANA 1Z7S1 1V6NA 2VJXA 1G86A 1DQ5A 1I9RA 3J7MA 5FBZA 5FP3A 2UWBA 3D0SA 2R1BA 2UYBA 2W39A 1NA1C 1QDOA 3WEZA 3LSEA 2WQZC 3ETQA 5KC5A 4AVCA 3FHIB 2WIIB 3SMHA 1S1AA 4YVSA 5FAXA 2JG8B 1YJKA 4G4FA 3SISA 2QQWA 4CA9A 2JDPA 2DFCA 1QJY3 4N9HA 1LR5A 1XE7A 5FXZA 2J1VA 4B7KA 1J59A 2WN3A 3IAQA 2HWF1 5FQ0B 3LFIA 3T1MA 1O4ZA 3VBSB 3LPFA 3FMGA 1SFYA 2I74A 1UX6A 2A6ZA 4XXAA 3PURA 4PIYA 4FT8A 1QJX2 2VNVA 5F6LB 1DDLA 2WFF2 1XYNA 4W6WA 4XETA 1XU1A 2ZACA 1D0GA 1RJ7A 3POJA 3W21A 1RUH2 2YBPA 1A6CA 3RI9A 4N53C 4PIXA 3SKJE 1KD7A 2D5HA 2BOIA 1W6OA 1IQAA 4GH4A 4UF0A 4DXRA 4CU8A 2VBDA 3B00A 4UFKA 4PDWC 2JEMA 4JGZC 4BMEA 1WBLA 4MZUA 1KJLA 4XVHA 3OSDA 3R05A 4NOTA 5FLIA 5GLVA 1E5IA 2Z42A 1QH6A 3THCA 1E5HA 1UQXA 2RMU1 3FUOA 3ZFGA 1R081 4MGZE 4P5HA 1UO9A 4COZA 2GMMA 4IESA 4UT5A 3BPSA 3KHBA 5IVVA 5KR7A 2J22A 2A3YA 5A32A 1FV2A 3VZMA 2DUPA 1U5YA 2OT7A 2ZGTA 4PLMA 3VB9A 1H6XA 4AQTA 5IK4A 1CZTA 1LCLA 1UMIA 2B8MA 4FFFA 5I8YA 4Y1VA 5FYVA 4FOQA 1VBB2 1ZZ9A 4B4QA 1FOD2 5HV0A 3H7YA 5FZ7A 3T2PA 5KHGA 1ALYA 4KGGA 4NHMA 3KQRA 2YBKA 3E5QA 2V4VA 1LOEA 5J36A 2YMZA 2ZGRA 3WQ0A 2VMEA 2EAAA 4EQVA 5BNNA 1VAMA 3PUHA 4NPMA 4CUCA 1CR7A 5L9RA 4P14A 5GLWA 3IMMA 3SNMA 3OY8A 2H0BA 3H1WA 4ATFA 2UYAA 1N1VA 5FXWA 1T6GC 2WQ4A 5HCFA 2VZ1A 4OFGA 1M06G 3VBFA 4YM0A 5FYTA 4E2GA 1RUNA 2AGSA 1DLLA 4KG8A 5FZ0A 4FPLA 3WNKA 2WT0A 1GYKA 4E8CA 1NCRC 4AHXA 4YVSC 5JSOA 5BNOB 2X5IB 4COUA 4WVMB 2DWRA 3LPGA 3PJQA 1OLME 3S6PA 3IDCB 1SBDA 1VE0A 1H4HA 1LEDA 2E63A 3OOXA 2N7GA 2ID4A 1VMFA 3J8F3 1IS6A 4EN8B 3PIJA 2J1RA 1YC61 2C1FA 2E32A 2JENA 5C4WA 2WNVA 4Q1PA 3U07A 3U10A 1VBD2 3AK0A 3RRDA 3FC0A 4K7JA 3TB0A 4DNYA 1UWWA 1TMF1 1RUG3 4BB3A 4LKEA 3OBZA 3WHUA 1QQP2 1UXZA 2HH9A 4NIHA 5CBLA 1R1A3 4GH4C 5A7WB 1X9PA 4PI0A 3DL3A 1DZQA 4CCCA 3S7EA 3AB0A 3GCXA 4CEYA 2WR9A 2A3WA 1R092 4KQ7A 1OKQA 4XFGA 3SH3A 4SLIA 1VR3A 4BISA 1BYHA 4FFIA 4DUXA 3KM5A 3RGBA 3ZFGC 1Y9GA 2VW0A 3M2MA 2ZX4A 3I2HA 3G7DA 2B7YA 1G9DA 3AYCA 3ABZA 1G9FA 2XGXA 3RQ0A 3BUCA 1PVXA 3RZLA 4RL7A 5LRRA 1E5SA 1V9U3 5JIUA 2K0GA 2P5BA 4AQSA 1ENRA 4QPWA 4CRQA 5JZGB 3E6CC 5LB6A 5F3EA 3AXEA 3ZYIB 1XNTA 3IB3A 3WP5A 2B5HA 2XJUA 4CU7A 2ARXA 2IFRA 3A0KA 3BGAA 3OYWB 1GLHA 2NMNA 3HR9A 2CSGA 1N3PA 2BDRA 1IPKA 4GKXA 1GZWA 2BGPA 3AP6A 3MIEA 5BNNC 4URAA 4NRPA 3UKNA 1H1AA 4GD4A 3MGUA 1W8TA 4QQOA 4AR2A 4BQ1A 5FPVA 1OLMA 1T2XA 1H9PA 2HWF3 4F3JA 3PUIA 5IVFA 3C8XA 5BNQA 4M4PA 1WZXA 2VOXA 4QXKA 4HN0A 3U78A 4HN1A 4Q4W2 4AFAA 1ZRFA 3FJSA 3H0OA 4K3UA 4LBLA 4BQYA 2RS53 5JOZA 2B42B 5HXMA 5JOYA 1UZVA 2P3YA 3NW4A 4YZ1A 2X05A 3B01A 1AXKA 2P6CA 4BU2A 2AH2A 2TEPA 3SITA 2RJKA 3AZVA 4AVAA 1HIXA 3MBWA 1VBC1 5JDBA 1IG3A 4LUKA 1MEC1 1HB4A 1VBA1 1GZTA 5C4WC 2WNVC 2Y0IA 3KVBA 5LW9A 1QIQA 5LZ6A 1R083 4CDQC 2BV4A 1Y9MA 3H7JA 2XDVA 4LKSA 4UXAA 3GCWA 1AR91 3M3QA 2OS2A 5LWBA 1PVC3 3EO6A 3OPZA 4KBZA 5FP8A 1MS8A 1XYPA 3TEZA 4CEYC 4E4ZA 1HQNA 2WO2A 1BXHA 4QKDA 3LFMA 3DN7A 3VBSA 1LGNA 2FMDA 2W92A 5LBFA 3WG2A 2QJVA 1K12A 3W59A 3J9SA 1RUE1 5C70A 3K46A 3K51A 3WQ7A 3VHOA 5FPLA 1OUSA 1V6IA 5T5JA 4O9GA 5JMCA 3JD72 3AZWA 1ULGA 4HKWA 2R041 4Y4RA 5IK7A 3ZXFA 3GJAA 1GWMA 4MXVA 5K9YA 4CE8A 5FMOS 4S2GA 3V0AB 3PVBB 4GALA 3KHCA 3L2YA 1DQ1A 4TYSA 1KDKA 5EJ1B 4GULA 4QX8A 4Q4Y3 1UY3A 4QU2A 4EV0A 4ES8A 4FFGA 2RV9A 3AXDA 2IXLA 3H42B 1DG6A 1JU4A 2MHFA 4LT5A 4MGKE 1RVF1 1PIV2 2H0VA 4R52A 1ULPA 4AK3A 1PGW1 2FDIA 4BZ4A 1UIJA 5KXDA 2BNNA 4CCOA 1NKGA 1V70A 1ZRIA 3WZ1A 1XSQA 4FTSA 3O14A 2OUJA 4LKDA 1H8TB 2KD7A 3KVAA 1FPN2 2HYKA 5KWRA 2Y6FA 3HWJA 5FY8A 3AKPA 1OLQA 3H1YA 5G04L 5A6XA 5H9PA 1CX1A 5EQUA 1JH5A 1JU3A 2Y38A 4QWNA 2R30A 2PFWA 4TZDA 1HQWA 2XKOA 1ASJ2 3SKVA 5HI0A 4Y24A 1GUIA 1SACA 4D3WA 1TNRA 3CJIB 1FV3A 4Y1UA 1ZNPA 2VVFA 4AI9A 1K45A 2CGNA 2XUMA 4UFLA 3WINE 3JU9A 4W50A 4DZGA 3O0XA 4XUPA 4OCTA 2HWE2 2E9QA 4HFSA 1XNDA 3OUIA 1UF2C 3NKGA 3I2OA 2DDUA 2OUHA 1DP0A 3PU8A 4Q26A 4RYDA 1UIKA 3LZZA 5ABJB 2VBPA 1REDA 4CU9A 4CUAA 1ZBA1 4EN0A 4QB1A 5CA6A 1HQLA 1FNYA 1DYOA 2W0XA 2BYVE 2OPWA 2JG8C 4XURA 1SQ4A 5BNOA 2X5IA 4WVMA 5A1FA 3AKSA 1V00A 3QACA 4LK7A 4BDVB 2WDBA 4W6XA 2HBTA 3VBSC 4BXSV 2CHHA 5FXVA 2WA4A 1NXD1 1SMVA 3HD8B 4PJYA 4QPYA 1QF3A 2DCJA 2CYFA 2VOKA 4CYDA 1R091 4O61A 1BBT2 4YGBA 2AUYA 3KLSA 4K21A 2RR12 1RL3A 4HKOA 1VIWB 1SLLA 2XG3A 4FPKA 2HEVF 2Q8OA 2C6SA 2RE9A 2ARAA 1W05A 5FZ1A 4EWEA 3IN9A 3CEWA 1D2QA 3HNBM 4ITCA 2R072 1SLCA 4NRQA 5C3RA 1IPSA 2A6WA 4NO4A 3VN4A 4R9DA 1N47A 3M3OA 4XF1A 4GWNA 1JYXA 4F83A 4OI4A 3VD9A 1WWYA 3IIAA 4INDA 1OH3A 3VZNA 4JCKA 1LU1A 2GMPA 4QXBA 4QKBA 5IHRA 4UOJA 4XFIA 5DAXA 5JZGA 3I3MA 1LULA 1VBC3 2WJSA 1J3RA 4Y5Z0 1X9TA 3PMSA 3VBUA 3K4ZA 2DBIA 1QJY2 5FBJA 1UYYA 3GNEA 4Y33A 1U12A 2JE9A 3OYWA 3I97A 4LJHA 3RJRA 2DVFA 2KXLA 2QQIA 3H3LA 3I2JA 4WVWA 1D0HA 5FUNA 3OD0A 4COWA 3Q8FA 4CCNA 1AL21 3WDTA 1W2TA 3IIIA 3WW2A 4P9GA 4Q5OA 4LHKA 4QAWA 4AQ6A 2VZTA 3AZXA 1JOPA 2WNEA 4C0HA 1YI9A 1DQ0A 2HWC3 5GZCA 2QTWB 1ND3B 1F4AA 1RUE3 5FIXA 4JHTA 1GOHA 2Z4FA 1QXPA 3RJ2X 1UKRA 1HN1A 2MEV3 2WL1A 2Y6KA 1H2KA 4ZS3A 4TSVA 4BA6A 5LEKA 2FDKA 4I01A 2A3XA 2R043 4YW1A 1O3RA 4WM7B 1OHFA 5GZDA 5BNOC 2X5IC 4D7TA 2BFUL 5FYIA 5KXCA 2HWB3 4RR3A 4LOTA 4K9SA 3ZIWA 4AHWA 3KZ4C 1NQJA 2Y0OA 2DTWA 5DAQA 4XIKA 1O3TA 1ULFA 1UMZA 2UY9A 2GP5A 5DUUA 4UW4A 2RJ2A 2UWAA 3IDEA 1V6MA 2EIBA 3I2GA 3LIHA 3WDUA 3AJZA 2QQUA 1RHI3 3Q8AA 1QXJA 4N9IA 3PNAA 3ZFEA 4Q4V1 3UYJA 3FE5A 2TNFA 1UZYA 2XB6C 3AYEA 3S7IA 4JV4A 2IXJA 1ND2B 3NV3A 5E6HA 2WZ8A 2WS92 2XJVA 1D4VB 3NNMA 4QKFA 4XUNA 4L9BA 4HETA 5A7PA 3TBDA 1G9CA 5FXXA 1AYM2 1MZ6A 5AC91 2OZ6A 2VTFA 3LIGA 3L2HA 2MPFA 2WABA 2ZAHA 1YQCA 4LBOA 1AYN3 4LKFA 4HSJA 5K0UB 1CWPA 1SLBA 3FN9A 4YZ3A 2OQ6A 5I0RA 4Q0UA 3FBMA 3AMQA 4D7YA 3LAGA 5JZGC 3V0AA 2VMHA 5E8AA 3NNFA 3PUAA 5JR7B 1TNFA 2EICA 1CJPA 5DUWA 3VBUC 4NROA 1GZCA 1HXS1 2WT1A 3H50A 1FPN1 3LEMA 4O65A 2VCBA 1LHWA 1SDWA 1UX7A 3J8F2 2F4PA 3WV6A 5E89A 2WRAA 1KRIA 3TEYA 1WLWA 4FPYA 4LHNA 5JR2A 2IZWA 4CUBA 3WW4A 2FZ1A 4A7YA 1RUG2 2ZS6B 2OW4A 3HBZA 3GHMA 2ADEA 4ASLA 4QT6A 1G6NA 4YW4A 2XLFA 1R1A2 1HRV3 2BNMA 1XC6A 2WWJA 3E6BA 1S0JA 4HPKB 1PNGA 5LBEA 3JCIA 3KV6A 2AEZA 3H3UA 4XILA 4OHZA 1H30A 5F3CA 4K8RB 3RS6A 3TEXA 4GJYA 3CJIA 2Q1FA 5BY5A 1BKZA 4UBGA 1CIWA 1NYWA 2GALA 3E5UA 4RR3C 4CP9A 1FATA 3WY6A 4PBOA 3CKHA 3BTYA 1BK0A 3AVSA 4R8HA 3LEIA 4EN6B 3ZM8A 1VBE3 1V9U2 1ZBE3 3OGVA 4E2QA 1UL9A 1QDCA 3FZ3A 5ABJA 3POSA 1Z7S2 3WD5A 1PM7A 2GC2A 3WCSA 2TUNA 4QXHA 1H6YA 2WWUA 4V1PA 4XTMA 2V4AA 3LD8A 1A3KA 4IE5A 3QCWA 1SFPA 2ZAAA 2BPA2 1RUJ1 3VD7A 1BBT1 1MVEA 1BZWA 3P3NA 2PYTA 3K48A 3BOPA 5H9QA 1QJU1 1BEV3 1W39A 1UOFA 5FZGA 4DRVA 2RR11 4QX5A 1XYOA 1POV0 2VUDA 2ZOEB 3ZN4A 3NMBA 3ASIA 2HWF2 4ZU5A 2HEWF 1O8SA 1W6OB 1IQDC 1HB3A 2VH9A 1CPMA 3EB7A 5FOJB 4BCUA 1YUDA 2BZDA 2P3JA 1W9FA 3AKQA 2BWCA 1WW4A 1RTVA 5EHDA 4GQ7A 4BIFA 3AMHA 1VB4A 5L36A 1J1TA 2RS52 4LIVA 4J25A 3AYAA 2ZX1A 4GWIA 2DCTA 3CO2A 4DRRA 4XUOA 2D3SA 3GJBA 3ES1A 5BYNA 2X8KA 2ZKNA 3C7HA 2WT2A 2W68A 1UXXX 1RXFA 1FX5A 2XVGA 4B1LA 1AX2A 4EROA 2ZEYA 2F4LA 4I3PA 5HPOA 5IVBA 4DUWA 2RG4A 4DEVA 1R082 3L9JT 1WMFA 1H8TC 4B29A 3JUUA 1KQRA 2C5DA 2D6PA 2WO1A 2WZR3 1TME3 5IT6A 3B3QE 3I2IA 1J83A 1PVC2 5F39A 4OUSA 1LNSA 1LJ7A 3I3DA 2EAKA 3RG0A 2WZEA 2QKDA 4MX3A 2A75A 1O5LA 2VUJA 1R64A 3WOGA 1MS4A 4Q4V3 2RS33 1N3OA 1CAXB 3CJIC 3VBFB 4COVA 2XL9A 2GN7A 2XHKA 3PVOA 2WUHA 4IE0A 3KCXA 4IXLA 4Y20B 3THPA 1SLTA 4P9XA 3OBAA 1ND3A 1OQ1A 2J42A 2DVAA 1C8NA 2P2KA 2SBAA 5FY4A 2IUWA 5IFPA 5ABJC 2VMIA 5A3UA 2IVJA 1WMDA 3ZXJA 2CGPA 3NJZA 3OJBA 4HVOA 1OUXA 1UOJA 4KI5M 4LNVA 1HRI3 2PHRA 4SBVA 3WSOA 2R16A 4Q4Y2 4QD2A 3C7OA 1PX4A 3J7HA 4MLOA 3WR0A 4WM7A 2P34A 2VMFA 1I6XA 2GH8A 5LCWL 3URFA 2R0FA 2W1QA 4UFMA 2K9ZA 2BUKA 4XABA 2SLIA 5IVYA 1OSGA 1YQ6A 2DTYA 3ZO0B 3POWA 3O7OA 4N7IA 4Z2WA 4TTGA 3W5MA 3I49A 2FDGA 3P6BA 1K5JA 1ZRRA 3QH7A 2I2SA 1H2LA 2IXKA 4KG0A 2BNOA 2HYXA 2WO7A 3Q8EA 4XCAA 4XMAA 1AR63 2QBXA 3RVHA 2VPVA 2YPDA 2Q8DA 3SLIA 1SHWB 3ZXGA 3O1RA 2ZHMA 1F5JA 1KITA 4U36A 3NL1A 2W94A 5FZFA 1A34A 1TMF2 5EP9A 3AP4A 2Y33A 4LULA 3WDWA 3ZOIA 4FSJA 1XNKA 2ZGPA 4XBNA 1ND2A 4JVAA 4JQRA 4FPOB 1EUTA 2HEYF 3F95A 4DMIA 5C5UA 2VTXJ 1MS0A 2A7AA 1XBFA 4L2NA 1G9AA 3H8OA 2LW8A 1X82A 5SV8A 1UU6A 3AMMA 2WO3A 3WG4A 2ORXA 3A22A 2R1DA 4QU1A 4ASKA 2WINB 5K0UA 3N7LA 5JUVA 2VZOA 3BYWA 1CAUA 1I3HA 1WBFA 2EALA 2JD4A 4CEWB 1L7LA 1ENSA 3O1PA 4Q0PA 2YU1A 1EAH3 4BIOA 5F5CA 3H1MA 5DG2A 4AE2A 3AX4A 2Q8CA 3QBQA 5GZFA 4XQWA 3ZIXA 2ZEXA 1RUG1 2PELA 1YO8A 2DURA 1BCXA 5BPXA 1U5XA 3MICA 4AAPA 3DKQA 1JI6A 3F2ZA 1W0PA 4HXCA 4MH0E 1UZWA 4JKLA 1X8MA 4FTBA 2WN2A 4YGCA 4IL7A 4RA0A 4P02B 1RUJ3 2PN5A 4LE3A 4NWWA 4PF5A 1OPOA 1JMUB 4KH9A 4Q1RA 1LENA 1QJU3 4C1XA 1WCSA 2A6VA 2FZ2A 2YBSA 3TRSB 1NE4A 5F7UA 1ND3C 3PTRB 2ZKLA 3AJYA 1W8UA 3HEIA 4QX0A 4HOOA 4AVVA 1MACA 1ACCA 4HPKA 5FR3A 2F6BA 2QDNA 4IEWA 1LAJA 4FTEA 3LDRA 1V9U1 1XJAA 2XVKA 1OF3A 4QHBA 1LU2A 4XHXA 4ZU7A 3RZJA 2Q8EA 4JKKA 4XC9A 4WM7C 4X6QB 3MYXA 4YG6A 2W3JA 4PF1A 4QX3A 4H7MA 5FZ4A 1H1MA 5E16A 4DFSA 2PTMA 5CVRA 3POEA 4LO7A 2D3PA 3D6EA 4COYA 2DF7A 4CCLA 1HJGA 3ZMOA 2YV8A 4Q27A 4QGNA 1WKYA 5LRSA 1AX0A 4Y5SA 1OFSA 1VBC2 2A5ZA 3AZZA 4AAXA 2AZ5A 1MEC2 1CPNA 1VBA2 4MXWB 1V6JA 3CHXA 2YY1A 1NY72 2PHXA 3P5BA 2RS11 1AJOA 5FZIA 1RITA 1QEXA 2VTXA 4DXSA 1AR92 1ND2C 1ZA4A 1S0FA 4D6RA 3VD4A 3RZGA 1RUD3 1U5IA 4C90A 4FCAA 3MIFA 5T5PA 1DBNA 3ILFA 3ZR5A 5IK5A 2AC1A 2RS51 1RUI1 4GXLA 3T0AA 2C26A 5DAVA 4A3XA 2WZPP 4NHYA 1RUE2 5C8WA 5K0UC 2XKPA 5FZ8A 1B09A 5T50A 4JTNA 4I0AA 1ZRCA 2YGLA 3TNQA 3PL0A 4GJZA 4GMP3 1UAIA 5C8CB 1JUHA 1JOBA 1BVVA 2R042 2XONA 2AREA 4KWKA 4ARXA 1Q56A 4WVVA 1WA6X 2ZGKA 3WP3A 5IYYA 3ZSMA 4LK6A 1GNZA 2HWB2 2VNOA 5SV5A 4BK4A 4LHSA 5DAWA 2VECA 4X8NA 5DZGA 4Y26A 3ZXLA 1PVC1 4FP2A 4WM8B 3E97A 3B93A 3ETPA 1B35B 2ZCWA 5A3MA 1RVF2 1GR3A 3POIA 1ZZ6A 1PGW2 3JB8A 5FYSA 2QUOA 4FPEA 1GNYA 1VRH3 4Z1VA 5K8SA 3KCCA 1HB1A 1URXA 1J1LA 1F4HA 3MPPG 1WW6A 3OEAA 4CP0A 4ZPIA 1UY0A 1VMJA 2WAOA 5JXIA 1O4YA 4DIQA 1ZZCA 4NIGA 1W6QB 1WCKA 4ATEA 3IPVA 1WW5A 3CF6E 1CAXA 3JBG3 3OEBA 4XHBA 4MUVA 1PO23 4NHKA 2QQOA 1EP0A 2QVSB 3NV4A 4Q4Y1 5C3OA 3FLRA 4Y20A 2ZHLA 2BRTA 3D0JA 3MUY1 2VQUA 4YW6A 4C1WA 1W90A 2G1MA 4R9BA 4OI1A 3SEPA 2PHDA 1YFUA 4XIOA 1CIYA 1XNCA 2MNGA 2VZ3A 1JYVA 1XRUA 5FZLA 3T2OA 1AL0G 3ZKYA 4AFBA 2R32A 5ANQA 4BLJA 4GB33 4MGSA 1MS9A 4QM9A 5FZHA 4WVZA 3WQ1A 3LF7A 1ZBA2 2Y6HA 3N9NA 4PQQA 3UJOA 2Q4SA 2VM9A 4JC1A 3OUJA 2BFUS 2VUAA 3OGJA 2E33A 5CKMA 5D1IA 4ASMB 1RC6A 4BJ0A 1DYPA 3T0DA 1OLRA 1YQ8A 3ZDSA 2PHLA 3NKTA 1US2A 1JYIA 1S0GA 4XDPA 1CX4A 5CG9A 3GZUC 2VNRA 3ZX7A 4MV2A 5FJKA 3IWZA 2JJ6A 3W9AA 1HRV2 1Q5OA 5JXGA 2WSVA 4AZZA 5EPAA 4N90A 1RINA 3SQOA 1GMMA 1F5FA 1JOJA 4RGGA 4LBJA 1W6PB 2JD9A 4LO8A 4UYBA 5J09A 5A7QA 5F37A 2YFZA 4ZONA 1YWKA 4TLFA 3M70A 1Q8VA 2BGOA 1WLCA 3IBMA 2OPKA 3VBHB 5HCHA 4OQ8A 3USSA 3SXWA 4HK8A 2P3IA 1W2NA 2FBEA 1VPHA 2V09A 3KF5A 1AR73 1FT9A 1SLAA 3GBGA 2PXJA 1SCRA 3JB4C 3A7QA 3HMYA 3USUB 3VBUB 4CEWA 2WQ8A 3FFQA 4C91A 5ERLA 1MZFA 1SEFA 3B69A 2YPJA 4RFRB 5M0TA 4PCRA 1QNYA 1LOGA 5DZEA 2ZXQA 4G9SB 5FK7A 2J7MA 3I8TA 5IJRA 2AEYA 4RHV1 3IM0A 4KWJA 2DUQA 4YGEA 5FPUA 2ZABA 1IKPA 3VL9A 2PAKA 3GHNA 3O0WA 4HKLA 3Q9OA 4XJAA 2RS13 3VBFC 1I5PA 3MW4A 3ON7A 5I0SA 2EXJA 1AL22 3OF1A 1SZBA 1W3VA 1S0CA 2IVIB 4IUGA 3E1F1 5DMYA 5LY1A 1RUI3 5FMDA 5FO7B 3ZFFB 4YW3A 3M7AA 4RGAA 1E57A 1ZX5A 4QHOA 3OPWA 4RR3B 1WCQA 2VBBA 1W3XA 4FPHA 1LRHA 2NMOA 1H9WA 1LB2A 3CIHA 1PZ9A 1O5UA 3CQOA 5F3IA 1GOFA 1S2BA 4P9WA 2HBUA 4A4AA 3IDBB 4LIUA 1W6MA 3CJXA 4XE9A 1LGCA 4N8MA 4TWTA 1NY71 5JVVA 1OURA 2PMWB 3ZYHA 1ZA7A 3J7LA 4IEVA 5C3QA 2O8OA 3ZFEB 3N4MA 2VQAA 3ALQA 1DQ4A 2B39A 5F9TA 2LTNA 1TME2 2QE3A 3HT2A 5EYXA 2VOTA 5JOWA 2G19A 1UU5A 2ILMA 3ZMNA 3ACGA 3JZVA 1XSRA 2HWC1 4MXWA 2ZEWA 2IXCA 1W2OA 4ISQA 5CISA 4GIQA 2FCTA 3POYA 4Q4V2 2RS32 3RYKA 4F7ZA 3N36A 2VVEA 2JXAA 2MEV1 3AL6A 3B9CA 3K3NA 3S30A 2WAAA 5C33A 3LA7A 1AVBA 4HT1T 4EYUA 3M1HA 3VD5A 5KHKA 2HWB1 3DF0A 4CPBD 5AC92 3RZMA 2QDRA 4H14A 2PLV3 2VC9A 1ST8A 1UMHA 2ATFA 4UW6A 3RPQA 4RD7A 3SH5A 4CEWC 1HKDA 5JOXA 5L19A 4XJ8A 1LODA 4NPRA 5C8CA 2JIJA 1HV0A 5KXBA 4KBBA 1AR83 4ORFA 1QY4A 5IVCA 3GBFA 4IV1B 3WX5A 5J7MA 3BIWE 1PMJX 3WW1A 4NUBA 1RHI1 4E4DX 1W03A 2VVDA 1WMEA 5DDJ1 4WM8A 1HXS2 4FPJA 3OGGA 5DUVA 3APBA 3TN91 1PX3A 4GAZA 5JCTA 1B35A 3R4UA 3WF0A 2UWCA 4W8JA 2XWJB 2A73B 5C5TA 3W5NA 3K4AA 3HQRA 3ORJA 3GZAA 3ZLIA 1YFYA 1COV1 3WF3A 1JS9A 3TEWA 2P1BA 2P4EA 2DCKA 5B4XA 3HNYM 1MVQA 4BYYA 4YVWB 1SBFA 5FZEA 5GZGA 1H4GA 4D6SA 4LLFA 1AYN1 3N9PA 3W20A 4JZRA 1NAEA 1XXNA 2VQ0A 3EYPA 5LASA 2GAUA 3MEPA 1GU3A 1W6QA 4CP9B 4Q0QA 4YRDA 3T4HB 5KHIA 4QM8A 4FP3A 2I45A 4OI2A 4XEZA 1CESA 5A6YA 1NX9A 4A45A 4QX7A 4XFBA 2ZPXA 3VHPA 1WGPA 5I0DA 1GWKA 2JDAA 5G05L 1VRBA 1IG0A 1IPJA 5EV7A 3I54A 4ZZ5A 3OGRA 3HJRA 1VP6A 3ACIA 3WP6A 2EXIA 2O0OA 2D97A 4ONUA 3SCHA 1CGPA 1WLTA 2QQPA 3C2UA 2JB8A 4J1WA 4EZHA 4HBNA 3OCPA 2DYCA 4LE4A 5JIAA 2QZ3A 3ZXDA 3O12A 4AFCA 4FBFA 1HRV1 3H8UA 5FY0A 1YFWA 3U75A 2VMDA 3BPZA 1RUJ2 4XFHA 5T54A 4IQPA 5FYYA 2Q0AA 3RYRA 2P3KA 2ARBA 4FQZA 4RHV3 1QJU2 3B94A 3ACLA 5FMBA 5DPNA 2VD7A 3MW3A 3PLQA 1RUF1 2VO5A 3ATGA 2D93A 4DY3A 1W6NB 1WCDJ 1PGSA 1Y43B 4ZS2A 5A80A 4NWVA 5T5LA 4YGDA 2ZZJA 4BH9A 5J1XA 4Y1ZA 1VBE1 3B9IA 5IW0A 1YIFA 4BWOA 1ZBE1 1W6PA 5C8CC 4YM2A 2AYHA 2GDFA 1XQNA 4OLLA 4KU7A 2JDUA 1RGSA 2JECA 1ZVFA 2ZX0A 3MPBA 3VBHA 3RWNA 4DS0A 1CAWB 2G9ZA 3NVCA 4WM8C 2CWSA 4L92A 3BN6A 3R6SA 3IDAA 5FFOC 1AHSA 3K77A 4J1XA 5FYUA 1B35C 2VOVA 3AMPA 3OBTA 5CKQA 2Y60A 1BEV1 2BQPA 5CYYA 3USUA 3WT3A 2DVBA 3BB6A 4D94A 5J3UA 1YHFA 5CNAA 4YG3A 5AFEA 4I02A 1K5MB 3I4IA 3UV9A 1UZ0A 1BK1A 3IZOA 1DU3D 1KGYA 2PHTA 2WLPA 2ZBJA 3PVEA 2NM1A 1MQTB 4JRLA 5GJ6A 1REFA 4XACA 5CADA 2HKXA 1RUD2 1GP6A 4UFHA 3Q8BA 4V2VA 2D43A 4A6OA 1LGBA 1GNHA 5FUPA 3MF6A 2WKKA 3CMGA 4M3CB 5JXJA 3I7DA 4HL0A 1AZDA 3OTFA 1WA4A 2J1UA 3IKWA 3FFZA 4K1ZA 2YGMA 1D4M1 1YXWA 4HK9A 2W1UA 4EE2A 4XJZA 3FL7A 2ERFA 2RJLA 4LA2A 3ZFFA 5A33B 1QJX3 2XBO3 3WXPA 3FWEA 2V5DA 3AMNA 2EF6A 4B3NA 2CNAA 1HJFA 1RUH3 3ELNA 4AL9A 4LQRA 2WZR1 1TME1 3VLBB 1NXMA 4ZHNA 1Y4WA 3A4UA 1QXRA 1Y3TA 3LEKA 4ARYA 3DXUA 4MGYE 1QJFA 4JKMA 3B7MA 2E31A 4AI8A 5FP7A 3RZKA 1HW5A 1PZ8A 4NN0A 5I0TA 1JW6A 1CZVA 1WLDA 2RS31 4LUMA 5DDJ3 3I3BA 1POV1 3AL5A 4BOWA 4CDUB 4LEJA 1S0IA 3TN93 1KS5A 2W52A 4DOUA 3GF6A 2ET1A 4MGIE 4IEQA 2XJSA 4AGGA 3J4UH 1COV3 1XNBA 2VW1A 5FY5A 4N7UA 1RMU3 2RM21 2CDOA 1YRZA 2DU1A 4YW5A 5FY7A 5GLZA 3ZXEA 1VBB3 4UFJA 1FOD3 4I3GA 1HRI1 5LK7B 1O6UA 2YROA 2W1WA 3LA3A 3OG2A 1CAUB 5FPAA 1W9TA 2VZUA 3VBHC 1OXCA 3ILRA 4AEKA 2JICA 5IK8A 4JDNA 4CCMA 4QHZA 3WF2A 2NP0A 4NRMA 4XYXA 2UY8A 3GDBA 2B45X
chains in the Genus database with same CATH topology
2DVGA 3SH4A 4YFWA 4GB32 3J26N 1S0BA 1AR61 1C8M1 4IV1A 5T5OA 3ST7A 4B4PA 4W6YA 2ZJCA 5CIRA 4P9IA 5CFDB 4JTOA 2IFWA 4AYUA 3FX3A 1CAVB 4PQ9A 3IMNA 3ES4A 3LWCA 1C5IA 4EWDA 4YVWA 1KDMA 4XTPA 4M01A 4CP1A 3ZFFC 1C5HA 1RUF3 1LESA 4EN9B 1VBD3 1EAH1 2Q5TA 4L99A 4WV8A 1Q43A 3AP9A 5LK5A 4R9AA 3WUCA 4AI0A 2GNBA 3G6JB 4PIZA 1QQP3 2BWAA 1Q8SA 4Y22A 3ZXAC 3O5SA 1NLRA 4D7SA 2VW2A 1IKQA 2GC3A 2ZGQA 4XQDA 3VBOB 2ES3A 3ZFEC 3TNPB 3RZZA 1JTZX 4LA3A 5ACA1 2C0ZA 4AF9A 1GKBA 1MR5A 4YM1A 5JSRA 4AHZA 3M3CA 4M3CE 4B4RA 5EFUA 4BM8A 1S0EA 2JG9B 2E7AA 1Q8OA 3AP7A 2R0HA 1O4TA 2RS12 2D6KA 4FXKB 2JKBA 2VNGA 3KS7A 2D6NA 4QPIA 1DZRA 2ZMKA 3WVJA 2Q1ZB 3FLTA 4BLIA 1W6NA 2KA3A 1RUI2 4S2FA 5JI7A 5BXXA 1EYBA 3KCYA 2DVDA 1OA3A 1DGWA 4YZ4A 3ILNA 3B02A 1D4M3 3WLUA 3V0BB 4IV1C 4K6BA 5FMOL 3R4SA 3NAPB 3D5OA 1DGLA 1H0BA 2GNTA 2O1QA 1CAWA 3PMEA 4Q4W3 3MIGA 4ZU4A 3WDVA 4EN7B 5FPXA 3RI8A 4EWAA 3OBRA 1S55A 5FLJA 2O8QA 1RUD1 2H6BA 1I5ZA 1K5MA 4OVEA 4CDWA 4YVWC 4AQ2A 4CDXB 3MIDA 3IPVB 4OHXA 4AGRA 1MQTA 1NZCA 4BMBA 4XXPA 1POV3 4PLNA 5J96B 3O0VA 5T52A 1NCQB 4GMP1 4HVRA 1UCXA 3ZYJB 4IEXA 5I8SA 3TYJA 4FXGB 3GYDA 3VZKA 3WG3A 3FLPA 3D82A 3CNAA 2RM23 4M3CA 5D8AB 3R4DB 5TSWA 4YW2A 4LHLA 1YI7A 5I93A 5CAZA 1LOFA 5F1RA 2GNMA 1AXZA 3VZLA 1AR82 5A33A 2VMGA 4OUMA 1DHKB 3KT1A 1VRH1 3X29B 1YFXA 1BMV2 1WD3A 2XJTA 3VHNA 2Z2SB 1C8M3 4XPVA 1QGLA 1OPMA 3PJYA 4P9LA 1PZ7A 2G9FA 5DXDA 3QLQA 4PLOA 1UPIA 2ET7A 3JBG1 3QD6A 1DIWA 3GBWA 3VL8A 1PO21 2PAMA 1VAKA 4CDUA 1Q8PA 1O3QA 1IS5A 1PIV3 4AEJA 1FAYA 2H6CA 4A2UA 4AI1A 3N3HA 2EXHA 3DPRB 4WZCA 2VU9A 5GLTA 3QH6A 1AX1A 2A70A 3VKLA 4GB31 1DGRN 3LB9A 4OZXA 1ASJ3 1VJ2A 3NSTA 1ULDA 4D69A 4OHYA 1KS4A 5EXOA 2GSYA 2YZ4A 3AP5A 1OMIA 3RSJA 2V5YA 3MFAA 2ZHNA 4AFMA 2NYYA 1K5MC 1C57A 2D6MA 3M8LA 2WC2A 3ZN5A 1V6LA 1SFNA 1LTEA 1MQTC 5FLHA 2CV6A 1SCSA 5ACA3 4DXZA 3HN1A 3ZSLA 2A6YA 3EHKA 4DQAA 5CFDA 1RIRA 4AHYA 4RHV2 4QQLA 4FOVA 1CAVA 1MS5A 4FO9A 5FPZA 3AZYA 4XBQA 2X29A 3D8CA 1N1SA 5DZFA 4P9YA 1LOFC 3W58A 1X36A 4DB5A 1AR71 1YCIA 2YUEA 4FPCA 1GBGA 1HV1A 2Q1MA 1QOTA 1W6MB 1OD5A 1LHVA 1KXGA 3ECQA 1FMD1 3UK9A 1PGL2 2D3RA 4XZPA 3V65A 4S2HA 2E7TA 3VBOA 1J58A 2WNUA 5C9AB 3DUIA 2CTVA 2GN3A 2R073 4Q4X3 4CDUC 5EYYA 2NPIA 3KSCA 3LGRA 4XFCA 3ENRA 4RQPB 1FI2A 1EV13 4QGLA 1NCRA 2JG9A 3KGLA 2HWC2 4JGYB 2GMEA 4URTA 2A6XA 3ZSKA 2MEV2 2GC0A 3FBYA 4QGMA 2GU9A 4IEUA 2JDZA 1EPZA 3VZOA 3AKRA 4AWDA 4DPNA 2CY6A 1IGOA 1TE1B 1UPSA 1PNFA 1V6KA 3MLKA 1R1ZA 2XBO2 4FAGA 1CD3G 1IS4A 1DYKA 1MS1A 2D6OX 4ITCA 1G8WA 4IERA 5BUVA 3GZTB 3MLJA 3NO8A 2ZGNA 5E88A 3V0BA 2R063 3LCPA 3NAPA 3N35A 4XMIA 4LBQB 2ZMLA 2GH2A 1NG0A 3CLPA 4R9CA 4CZSA 2C9AA 1RHI2 3A0NA 5CFDC 2CWMA 5DDJ2 1XU2A 3BODA 5CU1A 3TN92 1LHNA 1DGWX 3ZYPA 1KFUL 2IC1A 4CDXA 4I2OA 1COV2 1F2NA 1JBCA 1RMU2 2HWD1 3WW3A 2PLV1 5AVPA 1AYN2 4H55A 4IEYA 5JLVA 1NCQA 2ZMNA 5AFBA 5F6KA 4DINB 4C0BA 3DGTA 1LHOA 2KM2A 1AR81 2XJPA 2QCSB 5CB7A 1QU0A 1HX6A 5D8AA 1F31A 4NVPA 2DCYA 3N7KA 1BMV1 3PTYA 1Q8QA 4QQ2A 2WS93 3THTA 1PK6B 4N43B 4E4SA 3VBOC 2WNUC 3I59B 2YHJA 3VV1A 1Y7BA 1AYM3 2ZX3A 1VLNA 2VULA 4JDOA 4K40A 3MW2A 2LUWA 3RDIA 3VKOA 1SBEA 2CAUA 1M4WA 3BCWA 5L7OA 3IT8A 2BTVC 4E27A 2GZWA 3V56A 2JG9C 5KHHA 1BVP1 2VOWA 3AYDA 4XF0A 3ZN6B 4KGQA 3VUOA 3E6DA 1UZZA 2XLAA 3NV2A 4RFT0 5JPNB 4ISRA 4B7EA 2Z69A 2FMYA 1JUIA 5GLUA 3OD4A 1RUF2 5EZWA 4DY5A 3KD4A 4Y4YA 4ES9A 4CDQA 3DPRA 1DF0A 1VBE2 1SLIA 4K8FA 3WG1A 2EIGA 1ZBE2 3NAPC 1GQHA 1CQ9A 2NQYA 3U0ZA 4LTAA 1OQDA 1FMD3 4A7ZA 3NWKA 4HLTA 1H1IA 3JQXA 2YDEA 4BPZA 1A78A 2D6LX 1NE6A 1RUC1 3MI8A 4H3WA 4META 1ENXA 4XJUA 1BEV2 4XFAA 4XW3A 2ZHKA 4CDXC 3VKNA 2IXIA 4BE3A 3INAA 5BV6A 1AXYA 1Z7S3 2XWBB 1NCQC 2W08A 5J98B 5H9SA 1PO11 1ONAA 1DQ2A 4QPGB 4NR1A 1EY2A 4JAAA 1UKGA 5D8AC 4G3YC 2E7QA 5FO9B 1PGL1 1PHMA 1ZZ7A 1WW7A 4YSFA 5KC6A 1D4M2 1W0OA 5FCCA 3UJQA 2XJQA 1PMIA 2ENRA 2WA3A 5L7OC 3ZPYA 1H8VA 2FHRA 3CU7A 4M3CF 2WZR2 1QJZA 2YYOA 5C9AA 3M3IA 2BVBA 1OA2A 3VKFC 1S0DA 1YNAA 3KMHA 4UBHA 4W65A 4AVSA 2RMU3 4RQPA 2D98A 3ZYGA 5FDBA 3MIHA 1GQGA 5HBAA 3DPRC 4JGYA 1A8DA 3KGZA 1UW8A 3WP4A 2JG8A 2XBO1 1QJX1 1OOPB 2HWD3 2RM22 2WFF1 1FNZA 4IEOA 5JAXA 1RUH1 3RMXA 1HRI2 1CJDA 2VGDA 5FQ0A 2ZGUA 4XQ4A 5GALA 1QMJA 1BQPA 3U11A 3NV1A 1C3HA 4FPFA 4CTEA 2LM3A 4AEMA 4O9EA 2QNKA 1DGRA 1GZ9A 3JQWA 3MFCA 3ZYRA 4L97A 4ZXKA 2TBVA 3BOWA 2EVXA 1C8M2 4LBQA 1AR62 2XPJA 3CL1A 1Z78A 5A3LA 5J48A 3N7JA 1RMU1 4L8QA 4L11A 3VBRB 1VBB1 1FOD1 4AGVA 1C28A 3ME2A 4MSVA 3T2TA 3BTAA 1QHDA 2WWSA 3ZSJA 4CP2A 4XFFA 2X53S 4KWLA 1RUOA 4Y22B 2CGOA 3M3EA 1N3QA 3LOIA 4LO4B 1EAH2 4XJ9A 4I09A 1Q3EA 4XF4A 1QKQA 1TMF3 4QQPA 4AW7A 4BHPA 1PK6A 4N43A 3MDPA 5C9AC 3I59A 4X6RB 2WLQA 3EQEA 5HCAA 2E51A 3WNXA 5J37A 5ACA2 4A7KA 5KXEA 1ENQA 4RQPC 4QPIB 1RUC3 4X8PA 3B5LB 4AG4A 3MZHA 2OZJA 4YARA 3MLLA 4JGYC 4FAHA 5F5QA 3ZN6A 3WDYA 1VBD1 1H2NA 5DUXA 4AVTA 4S2DA 2LALA 1OI6A 3ZSEA 1YIPA 2NLRA 2VG9A 2ZGMA 1QQP1 4R4ZA 4LBKA 4FOWA 1F8VA 1L3JA 1PO13 1WUVA 1F9KA 4M00A 4Z92B 2XJRA 3WDXA 2RHPA 3VDDB 1HLCA 2V73A 5AVAA 4YLZA 4YFZA 1QH7A 3D4KA 1LOBA 4MVTA 4I0BA 2FQPA 2WSUA 3PHMA 2AENA 4LBNA 3DV8A 3VHRA 1LOAA 4CDWB 1LHUA 4ZKTB 3P3PA 1U5ZA 2IXHA 4Q4X2 5E1RA 1C4RA 4NHLA 1G7YA 5C6CA 3VZJA 1ZZ8A 1ULCA 1EV12 1N1YA 4FOYA 2P37A 3TAYA 2Y26A 4R4XA 5T3NA 5CG8A 4UW5A 1CONA 5B2GB 5K7PA 4IV3B 4RSUA 5GZEA 1MEC3 1VBA3 5CFCB 5JSPA 4KNCA 4OHVA 1ZYBA 4HMZA 1AJKA 4Q0VA 4XBLA 4B8EA 4QPGA 3AKTA 4AEDB 4E2SA 2UU8A 1MZEA 5I8TA 1AR93 5JPMB 2WFF3 2YXSA 1PK6C 4N43C 4Q4W1 4QQHA 4RS5B 4UW3A 2VY0A 2Z79A 3EBRA 3SCFA 1APNA 1YYNA 2BW8A 4KU8A 2EXKA 3GALA 5I0UA 2R062 5JI9A 2E6VA 2HJIA 2G9GA 1IS3A 1VRH2 1IHMA 1RB8G 1O3SA 4LO6B 5BNPB 4AI2A 3HQXA 4Z07A 4IEZA 4GA9A 1NA1B 2B9UA 4WBBA 1N1TA 2B46X 3JBG2 4LLOA 1X33A 2XL7A 1PO22 4YM3A 4QMAA 5DG1A 4AXOA 3WUDA 4E9KA 1RVF3 2OVUA 3RMYA 4MYEA 3SHRA 1LEMA 4XDQA 2E53A 1NQDA 3ZVXA 1CN1A 1OOPA 2BBVA 3VKMA 4F8AA 1ZZBA 1ZM1A 4Q8KA 3JD71 4M0HA 4XF9A 3WHTA 3LA2A 3SCGA 4AI3A 1X50A 2ZZQA 2DU0A 2K2SA 4N53B 4OULA 3ZXKA 3UKVA 4FPGA 1BJQA 2A71A 4Q29A 4PDWB 1DFQA 1DZTA 4JGZB 4JDMA 1PIV1 1FXZA 1H2MA 3AFKA 1UD1A 2XH6A 2IWGB 5GKAC 1RJ8A 5FO8B 3VBRA 2ETEA 5EWSA 5LEJA 5KHJA 1ZBA3 4QPGC 2JX9A 4Q8LA 1LECA 1TQ5A 2R49A 2NN8A 3UKTA 5HCBA 1ASJ1 3H3ZA 2JE7A 1H8TA 3UL2A 1DQ6A 1ULEA 4U2AA 3R0RA 1AR72 1D2SA 1OQEA 2HWE1 3I2DA 4AVBA 4FVVA 3AM2A 1R093 2WNUB 4JRAA 1QNWA 2G4IA 1UN1A 2CL2A 4LO5B 1FMD2 2XLGA 3AFGA 1NLSA 1HDKA 2DCZA 5KBFA 1U0AA 5L73A 1C1LA 1NCRB 3E5XA 2D40A 5H9RA 4YVSB 2OYZA 2CAVA 2BGCA 4FQ4A 4I30A 4I0WB 2Z5WA 2ZTNA 4H7LA 3KT4A 1QOOA 1YLLA 1JHNA 1OOPC 2PHWA 1J3QA 3HT1A 3WCRA 3BALA 2ZGLA 4PBPA 1OFNA 1REEA 3KT7A 1VAVA 4XOGA 4YYOA 1FYUA 4AFDA 2R6QA 3HAGA 3LSDA 1GFF2 4YZ2A 3M4FA 1V6OA 3LKJA 4GH4B 2GNDA 3HIFA 1AL23 3VDDA 2R071 3BU7A 5JWPA 4Q4X1 1TEIA 5GM0A 5HXVA 4LBMA 2I07B 1YJLA 2DFBA 2NZ9A 2ZX2A 4HVQA 4M0NA 4K20A 1GV9A 1EV11 3ZFGB 1NOVA 4YG0A 4GWMA 3VBRC 1O7FA 5A32B 4Z8BA 1XE8A 3FUQA 1QJY1 4HANA 3MF9A 1AUYA 4J6GA 3U4XA 1MZ5A 5FREA 2RMU2 2DV9A 3DKWA 1S2KA 3RNSA 1LOCA 1OA4A 5FOBB 1KFXL 4P9JA 4IV3A 2HWD2 2PLV2 2EA7A 5EJ3A 2D7FA 5CFCA 5BNNB 2ZA9A 4YNIA 4HZFA 1EPWA 1QOSA 5I91A 1QWRA 4AEDA 3OY8B 2R061 1LKNA 1O91A 4OHWA 1VB2A 3QOPA 1G9BA 5T55A 4RS5A 5L7OB 2PQQA 2PHFA 3JD73 2BVVA 2GC1A 2YC0A 1AF9A 5AC93 4Q2FA 1KJRA 3V64A 4HSLA 2D44A 4Y1YA 4QPIC 3RYPA 5FTTC 4GKYA 1I1EA 2Q30A 4LR4A 2AR6A 1JYCA 2ZGSA 5BNPA 1MS3A 1X8EA 1CVNA 1JXNA 1WD4A 1W2UA 5C4WB 1IZ3A 2PAEA 2WNVB 1NA1A 2DUOA 1J3PA 2P17A 4Y1XA 3T1LA 1HXS3 3C3VA 4CDQB 1FPN3 3EJKA 2VXRA 2OIIA 2WS91 2PA7A 3VDDC 1AYM1 4CEYB 1VALA 2BEOA 2XVLA 1GSLA 1Z0HA 3EXUA 1C1FA 4XF3A 4Q0SA 4CDWC 2HWE3 4EJRA 4N53A 2WFPA 1JN2P 3KB5A 3N7MA 4PDWA 4JGZA 4XJWA 3S0MA 1RUC2 3J8F1 2D5FA 1IOAA 1GICA 4Z82A 4IV3C 4YZ5A 5IUQA 1GZWB 5CFCC 5FRAA 4WZFA 3ROUA 4AEDC 1R1A1 1UU4A 3H9AA 3MIBA 1PO12 2ZGOA 1A8MA 3TOJA 4RS5C 1BBT3 2PHUA 4IETA 4K1YA 3VGIA 1X7NA 1ZREA 2RR13 4KL1A 4IEPA 4GMP0 2OA2A 3PVNA 1Y9QA 2UURA 2QFEA 5BNPC 2QZ2A 4LBQD 3TWIA 1GANA 1Z7S1 1V6NA 1G86A 1DQ5A 1I9RA 5FBZA 2UWBA 3D0SA 2R1BA 2UYBA 2W39A 1NA1C 1QDOA 3LSEA 2WQZC 3ETQA 5KC5A 4AVCA 3FHIB 2WIIB 3SMHA 1S1AA 4YVSA 5FAXA 2JG8B 1YJKA 4G4FA 3SISA 2DFCA 1QJY3 4N9HA 1LR5A 1XE7A 4B7KA 1J59A 5FQ0B 2HWF1 3VBSB 3T1MA 1O4ZA 3FMGA 1SFYA 2I74A 1UX6A 2A6ZA 4XXAA 4PIYA 4FT8A 1QJX2 5F6LB 1DDLA 2WFF2 1XYNA 4W6WA 4XETA 1XU1A 2ZACA 1D0GA 1RJ7A 1RUH2 1A6CA 3RI9A 4N53C 4PIXA 1KD7A 2D5HA 1W6OA 1IQAA 4GH4A 3B00A 4PDWC 2JEMA 4JGZC 4BMEA 1WBLA 4MZUA 1KJLA 3R05A 4NOTA 5FLIA 5GLVA 2Z42A 1QH6A 2RMU1 3FUOA 3ZFGA 1R081 4MGZE 4P5HA 4COZA 2GMMA 4IESA 2A3YA 5A32A 1FV2A 3VZMA 2DUPA 1U5YA 4PLMA 2ZGTA 4AQTA 5IK4A 1ZRDA 1LCLA 2B8MA 5I8YA 4Y1VA 4FOQA 1VBB2 1ZZ9A 4B4QA 1FOD2 3H7YA 5KHGA 1ALYA 4KGGA 4NHMA 3KQRA 3E5QA 1LOEA 5J36A 2YMZA 2ZGRA 3WQ0A 2EAAA 5BNNA 1VAMA 1CR7A 4P14A 5GLWA 3SNMA 3OY8A 2H0BA 3H1WA 4ATFA 2UYAA 1N1VA 1T6GC 2WQ4A 5HCFA 4OFGA 1M06G 3VBFA 4YM0A 4E2GA 1RUNA 2AGSA 1DLLA 4KG8A 4FPLA 2WT0A 1GYKA 1NCRC 4AHXA 4YVSC 5JSOA 5BNOB 2X5IB 4COUA 4WVMB 2DWRA 3PJQA 3S6PA 3IDCB 1SBDA 1H4HA 1LEDA 2E63A 2N7GA 3J8F3 1IS6A 4EN8B 2JENA 2C1FA 5C4WA 3U07A 2WNVA 4Q1PA 3U10A 1VBD2 3AK0A 3RRDA 3FC0A 4K7JA 3TB0A 4DNYA 1TMF1 1RUG3 3WHUA 1QQP2 5CBLA 1R1A3 4GH4C 3DL3A 1DZQA 3S7EA 3AB0A 4CEYA 2A3WA 1R092 4KQ7A 1OKQA 4XFGA 3SH3A 4SLIA 1VR3A 1BYHA 3KM5A 3ZFGC 2VW0A 3M2MA 2ZX4A 3G7DA 2B7YA 1G9DA 3AYCA 1G9FA 2XGXA 3RQ0A 1PVXA 4RL7A 5LRRA 1V9U3 5JIUA 2K0GA 4AQSA 4CRQA 1ENRA 5JZGB 3E6CC 3AXEA 3ZYIB 3WP5A 2B5HA 2XJUA 2ARXA 2IFRA 3A0KA 3OYWB 1GLHA 2NMNA 3HR9A 1N3PA 1IPKA 4GKXA 1GZWA 3AP6A 3MIEA 5BNNC 3UKNA 1H1AA 3MGUA 4QQOA 4BQ1A 1H9PA 2HWF3 4F3JA 5BNQA 2VOXA 4QXKA 4HN0A 4HN1A 4Q4W2 4AFAA 1ZRFA 3FJSA 3H0OA 4K3UA 4LBLA 5JOYA 2RS53 5JOZA 2B42B 3NW4A 4YZ1A 3B01A 1AXKA 2AH2A 2TEPA 3SITA 2RJKA 3AZVA 4AVAA 1HIXA 5JDBA 1VBC1 4LUKA 1MEC1 1VBA1 5C4WC 2WNVC 2Y0IA 1R083 4CDQC 3H7JA 4UXAA 3M3QA 1AR91 1PVC3 3EO6A 3OPZA 1MS8A 1XYPA 4CEYC 4E4ZA 1HQNA 4BCUA 1BXHA 3VBSA 5J3UA 3DN7A 3LOBA 1LGNA 2FMDA 3WG2A 2QJVA 3W59A 3J9SA 1RUE1 3K51A 3WQ7A 3VHOA 1V6IA 5T5JA 4O9GA 5JMCA 3JD72 3AZWA 1ULGA 4HKWA 2R041 5IK7A 3ZXFA 4MXVA 5K9YA 5FMOS 4S2GA 3V0AB 3PVBB 4GALA 3L2YA 1DQ1A 4TYSA 1KDKA 4GULA 4Q4Y3 4QU2A 4EV0A 4ES8A 3AXDA 2IXLA 1DG6A 4LT5A 2MHFA 4MGKE 1RVF1 1PIV2 2H0VA 4R52A 4AK3A 1PGW1 4BZ4A 1UIJA 5KXDA 2BNNA 1V70A 3WZ1A 4FTSA 3O14A 2OUJA 1H8TB 1FPN2 2HYKA 5KWRA 3HWJA 3AKPA 1OLQA 3H1YA 5H9PA 1JH5A 2Y38A 4TZDA 2R30A 2PFWA 1HQWA 2XKOA 1ASJ2 5HI0A 4Y24A 1SACA 4D3WA 1TNRA 3CJIB 1FV3A 4Y1UA 1ZNPA 2VVFA 2CGNA 2XUMA 3WINE 3JU9A 4DZGA 3O0XA 2HWE2 2E9QA 4HFSA 1XNDA 1UF2C 3NKGA 2OUHA 4Q26A 5ABJB 1UIKA 3LZZA 1REDA 1ZBA1 4EN0A 5CA6A 1HQLA 1FNYA 2W0XA 2BYVE 2JG8C 1SQ4A 5BNOA 2X5IA 4WVMA 3AKSA 1V00A 3QACA 4W6XA 3VBSC 2WA4A 1NXD1 1SMVA 3HD8B 4PJYA 4QPYA 1QF3A 2DCJA 2CYFA 2VOKA 4CYDA 1R091 1BBT2 4YGBA 2AUYA 3KLSA 4K21A 2RR12 1RL3A 4HKOA 1VIWB 1SLLA 2XG3A 4FPKA 2HEVF 2Q8OA 2RE9A 4EWEA 3IN9A 3CEWA 1D2QA 2R072 1SLCA 2A6WA 4NO4A 3VN4A 4R9DA 1N47A 3M3OA 4XF1A 4GWNA 4F83A 4OI4A 3IIAA 4INDA 3VZNA 4JCKA 1LU1A 2GMPA 4XFIA 5JZGA 1LULA 1VBC3 2WJSA 1J3RA 4Y5Z0 3PMSA 3VBUA 1QJY2 3GNEA 1U12A 2JE9A 3OYWA 3RJRA 2DVFA 2KXLA 4WVWA 1D0HA 3OD0A 4COWA 1AL21 3WDTA 3WW2A 4P9GA 4LHKA 4AQ6A 3AZXA 2WNEA 4C0HA 1YI9A 1DQ0A 2HWC3 5GZCA 1ND3B 1RUE3 1QXPA 3RJ2X 1UKRA 2WL1A 2MEV3 4BA6A 1H2KA 4TSVA 5LEKA 4I01A 2A3XA 2R043 4YW1A 1O3RA 4WM7B 1OHFA 5GZDA 5BNOC 2X5IC 4D7TA 2BFUL 5KXCA 2HWB3 4RR3A 4K9SA 3ZIWA 4AHWA 3KZ4C 1NQJA 2Y0OA 2DTWA 4XIKA 1O3TA 1ULFA 1UMZA 2UY9A 5DUUA 4UW4A 2UWAA 3IDEA 1V6MA 3WDUA 3AJZA 1RHI3 1QXJA 4N9IA 3PNAA 3ZFEA 4Q4V1 3FE5A 2TNFA 1UZYA 2XB6C 3AYEA 3S7IA 4JV4A 2IXJA 1ND2B 3NV3A 2WS92 2XJVA 1D4VB 4L9BA 4HETA 3TBDA 1G9CA 1AYM2 1MZ6A 5AC91 2OZ6A 3L2HA 2MPFA 2ZAHA 4LBOA 1AYN3 4HSJA 5K0UB 1SLBA 4YZ3A 5I0RA 4Q0UA 3FBMA 3AMQA 4D7YA 3LAGA 5JZGC 3V0AA 2VMHA 5E8AA 5JR7B 1TNFA 5DUWA 1CJPA 3VBUC 1GZCA 1HXS1 2WT1A 3H50A 1FPN1 1LHWA 1SDWA 3J8F2 2F4PA 3WV6A 5E89A 1KRIA 1WLWA 4FPYA 4LHNA 2IZWA 3WW4A 2FZ1A 4A7YA 1RUG2 2ZS6B 2OW4A 3HBZA 3GHMA 4ASLA 4QT6A 1G6NA 4YW4A 2XLFA 1R1A2 1HRV3 2BNMA 3E6BA 1S0JA 4HPKB 1PNGA 3JCIA 4OHZA 3H3UA 4XILA 1H30A 3RS6A 3CJIA 5BY5A 1BKZA 4UBGA 1CIWA 1NYWA 2GALA 3E5UA 4RR3C 1FATA 3WY6A 4PBOA 4R8HA 4EN6B 1VBE3 1V9U2 1ZBE3 4E2QA 1UL9A 1QDCA 3FZ3A 5ABJA 3POSA 1Z7S2 3WD5A 1PM7A 2GC2A 3WCSA 2TUNA 4V1PA 4XTMA 1A3KA 3QCWA 2ZAAA 2BPA2 1RUJ1 1BBT1 1MVEA 1BZWA 3P3NA 2PYTA 3K48A 3BOPA 5H9QA 1QJU1 1BEV3 1W39A 4DRVA 2RR11 4QX5A 1XYOA 1POV0 2ZOEB 3ZN4A 3ASIA 2HWF2 4ZU5A 2HEWF 5FOJB 1W6OB 2VH9A 1CPMA 1YUDA 2P3JA 3AKQA 2BWCA 1WW4A 1RTVA 4GQ7A 4BIFA 3AMHA 1VB4A 5L36A 1J1TA 2RS52 3AYAA 2ZX1A 2DCTA 3CO2A 4DRRA 2D3SA 3ES1A 5BYNA 2X8KA 2ZKNA 2WT2A 2W68A 1FX5A 2XVGA 1AX2A 4EROA 4I3PA 1R082 3L9JT 1WMFA 1H8TC 4B29A 3JUUA 1KQRA 2C5DA 2D6PA 2WZR3 1TME3 5IT6A 3B3QE 1PVC2 4OUSA 1LJ7A 2EAKA 3RG0A 2QKDA 4MX3A 2A75A 1O5LA 2VUJA 3WOGA 1MS4A 4Q4V3 2RS33 1N3OA 1CAXB 3CJIC 3VBFB 4COVA 2XL9A 2GN7A 2XHKA 3PVOA 3KCXA 4IXLA 4Y20B 3THPA 1SLTA 4P9XA 1ND3A 1OQ1A 2DVAA 1C8NA 2P2KA 2SBAA 5ABJC 2VMIA 2CGPA 3ZXJA 1WMDA 3NJZA 3OJBA 4HVOA 4SBVA 4LNVA 1HRI3 2PHRA 2R16A 4Q4Y2 4QD2A 4MLOA 3WR0A 4WM7A 2P34A 1I6XA 2GH8A 3URFA 2R0FA