1HV0A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYFVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv0A00
3VZNA 3RI9A 4HKWA 1OLQA 1NLRA 1QH6A 2JENA 2JEMA 2VG9A 4IXLA 2BWAA 1H1AA 1REDA 2VULA 4HKOA 1BCXA 1XNKA 1HIXA 3MFCA 2JICA 3MF9A 1H4HA 1XYNA 3WP5A 2BVVA 3ZSEA 3LB9A 5HXVA 1YNAA 3WP6A 3AKSA 3VL9A 2DCZA 3O7OA 1UU4A 3AKTA 1W2UA 3VLBB 3WT3A 2DCJA 3M4FA 3WY6A 3AKQA 4XQ4A 1M4WA 1BK1A 2DCYA 4XQWA 3AMNA 3AKRA 3LGRA 3VZOA 1KS4A 3RI8A 4S2HA 4S2DA 5EJ3A 3WQ1A 1OA3A 3VZLA 2BWCA 4H7MA 4XQDA 3VL8A 4S2FA 1XXNA 2VUJA 2B46X 1UKRA 2DFCA 3WP3A 3WXPA 4HKLA 1OA4A 1XYPA 2DFBA 2BW8A 5K7PA 1HV0A 1HV1A 1F5JA 1OLRA 3MF6A 1REEA 3B7MA 2F6BA 2NQYA 3MFAA 2B42B 3WR0A 2D98A 1C5HA 3B5LB 2B45X 1XNDA 3WQ0A 1UU6A 3EXUA 3VGIA 1XYOA 2D97A 3VHOA 3AKPA 1XNCA 1IGOA 3VZKA 1KS5A 1OA2A 3VHNA 3VZMA 3WQ7A 1REFA 1QH7A 2VGDA 4XPVA 3WX5A 1ENXA 1TE1B 3AMQA 3VZJA 2QZ2A 3WP4A 1BVVA 2Z79A 3HD8B 4HK9A 3AMMA 1H0BA 1AXKA 1T6GC 2NLRA 2C1FA 1H8VA 1H4GA 1C5IA 3VHPA 1XNBA 1PVXA 2DCKA 4S2GA 4NPRA 5K9YA 2QZ3A 3AMHA 3AMPA 1UU5A 4HK8A
chains in the Genus database with same CATH superfamily
2J7MA 4OUSA 1PVC2 5FIXA 4UW3A 3P3NA 4YW2A 4IEVA 3IIAA 2WINB 3THDA 1RUD1 3RQ0A 1ZZBA 4Q4X2 2YGLA 2EXHA 5DAQA 2LALA 5CFCC 1XBFA 3WNKA 4AK3A 1Q8VA 3I3QA 3M7AA 1UQXA 1X8MA 4PI0A 1VB2A 3NKGA 3JBG3 3PUSA 5BNPB 5FOBB 4Z92B 3LIGA 2I2SA 3OBAA 3PVOA 5EJ1B 3GZEA 2CDPA 3KF3A 1PMIA 5A32A 1GWKA 1MZEA 5KXDA 1YFUA 1VRBA 1AF9A 1A6CA 4JGYB 4UBHA 4CU9A 3E6CC 2HWD1 1V0AA 1LOEA 2ZJCA 3T4VA 1GU3A 5FV3A 1MVQA 1NKGA 2GAUA 3SNMA 4RSUA 3T0BA 1UKGA 4XZPA 2WS92 4FVVA 2OYZA 4PCRA 3JB4C 1OURA 2FCUA 1WLDA 4IESA 4XJ8A 5FYYA 3V65A 3W58A 3ZXKA 2IVJA 4QX1A 4CDQC 5BV6A 4ZONA 5FZ4A 4XBNA 2VZSA 3AMNA 1MVEA 1T6BX 2RR12 4JRAA 5K8SA 1W6OB 1H1MA 3SH3A 3AXDA 2IZWA 1U5ZA 1KS4A 2VBBA 4Q8LA 3AC0A 3HNYM 2VQUA 2WQ8A 2BWCA 2XLAA 4FP3A 3A23A 2FCVA 3CIHA 5K0UA 4ZHNA 1NUKA 4UFMA 4CEYA 4EN6B 4Q27A 1JTZX 2C9AA 5FYCA 2FBEA 2WZR1 3ILNA 3UT0A 2PHLA 1K12A 2ES3A 1V9U3 1LKNA 3K46A 4JGZB 3LA7A 4AVVA 4GWNA 1RXFA 5FMDA 3AP9A 5FYZA 4ATFA 1RMU2 5M0TA 1RUG1 5FYSA 3GM8A 4XABA 5FLJA 2D6PA 3PUHA 1MZFA 1UWWA 5E16A 1W0NA 4BA6A 3UJQA 1DF0A 5IVEA 5JZGB 2X5IC 3DUIA 3A7QA 3OBRA 5J96B 2TNFA 1KJRA 3B5LB 5C71A 1GOGA 1OSGA 4WM7A 2WZR3 1LESA 3HPNA 2VZQA 5BY5A 1JMUB 3IAPA 3J7MA 3GNEA 2BP6A 2P1BA 3U10A 4PDWA 1YI9A 3MPPG 2UWCA 1XNCA 4QB2A 4PIZA 5BUVA 2RDNA 2K46A 3CNAA 1R64A 4OCTA 1POV0 2YXSA 4A7KA 2E9QA 5A33A 3BCWA 4K8RB 4KGQA 2N7GA 5LATA 4DOUA 1UYZA 2Z79A 1WLCA 4N8MA 5FPBA 2BU9A 1AR82 4XF0A 2XB6C 4BXFA 5FLHA 3O1VA 2ZAHA 2XQXA 3OSDA 3ZDSA 3RZKA 1VRH2 3M1HA 2C26A 3POEA 1X50A 1WCUA 4GKYA 5FY0A 4AFCA 3GCWA 3D0SA 4E8CA 3ZXAC 3ZFFC 4GJYA 4GMP0 3RDIA 4Y5Z0 4X6RB 4HVQA 2D40A 1ASJ1 4H55A 5FTTC 1O7FA 5DZEA 1DIWA 3VBHC 2EXJA 2D7FA 1S0GA 1NXD1 5FZOB 5T5LA 2JECA 1UN1A 4CDWC 2RE9A 4A7ZA 4LQRA 4MADA 4LOSA 1ONAA 5CEHA 4HKOA 1U5IA 5HXMA 5T50A 3KGZA 5FK8A 3ZR5A 1RUI1 2HWD2 4M4PA 1GP5A 1AVBA 3WX5A 3WW3A 2ZMNA 3AZVA 1PK6A 3K51A 4Z82A 1ACCA 5BXXA 2G4IA 4IV1C 1DYPA 1ASJ3 3ABZA 4F83A 3WINE 3IN9A 4FFGA 5ABJA 3WT3A 3C7GA 1YFWA 2DTWA 4OHVA 1W28A 1ZBA2 2WLQA 1AXYA 5EIYB 1CAUB 1SPPA 1QKQA 3AX4A 3M8LA 2BNMA 3AVSA 3AVRA 1JI6A 4NPLA 3AKQA 4URTA 2YFUA 1MZ5A 1RUF2 1QNYA 1ZZ7A 2R0FA 1WA6X 5EQUA 2HWB1 2DCYA 2D3SA 4J6GA 4XQWA 4N7IA 2OZJA 4NMIA 4KWUA 2D6NA 3LGRA 5BNOC 1BJQA 4KGGA 3UKTA 2XJSA 4J25A 5F9TA 2Y6GA 1WW7A 4QQ2A 2A7AA 3VHRA 1QHDA 3V64A 5FK7A 1OPMA 4XFGA 3VBUA 4JDNA 4QXHA 2LROA 3H7JA 4Y1UA 2P4EA 3ZFEA 2WT0A 2HWC1 1HDKA 3OCPA 4DY5A 3MZHA 1J59A 3K4AA 2WAOA 4BMEA 5KXBA 1RUG2 4IV3B 4BMBA 3DF0A 4BISA 4FXGB 4B4QA 2NP0A 4YW3A 3GYDA 4BDVB 2GNBA 1HW5A 1PNGA 2VAUA 1W9SA 4AW7A 5C8WA 4FQZA 1K3IA 4Y22A 1QDCA 4LTAA 4L99A 4N53A 1XNTA 4W6WA 1C1LA 3FFQA 3WCSA 3ACHA 5F3GA 3NRUA 4LE3A 5FQ0B 3POGA 4MX3A 4I02A 2ARBA 2RDSA 2C5DA 2WWUA 2QQOA 5FZ1A 4MGSA 2V5DA 3THTA 1W9YA 3O0WA 5DN2A 3SEEA 1VBE2 2QDNA 4R52A 1QQP1 1RIRA 3BTAA 3NSTA 5E1RA 2MNGA 4G3YC 4KWLA 2VECA 4WZFA 4N43B 4UW5A 3WQ7A 4M00A 3FL7A 4QDSA 4XPVA 1MEC2 2VMIA 4YFWA 3RZJA 4ZY9A 5I0RA 2XR4A 2ZMLA 4OI1A 3ZSMA 1UCXA 4AVSA 1RC6A 2YBKA 4CUGA 3VKFC 5C4WC 2D5FA 1CONA 1OH3A 2ZKLA 3BB6A 4XJWA 2Q4SA 4QHOA 1HQWA 1W8OA 2VTFA 1QIQA 3APBA 5FPAA 3ZYHA 2H6BA 3NAPC 4KL1A 2Y6JA 1UY4A 2JG9C 5A3OA 5A3LA 3QOPA 4FPEA 4ZXEA 4EV0A 1R083 4HK8A 2Q8DA 5GLVA 3BGAA 4XZUG 5JMCA 1O5UA 2J1EA 2GC0A 5FZGA 4BQ5A 1LR5A 5JIUA 2QQKA 3S7EA 1C57A 4YFZA 5GZEA 3VBFB 2YYOA 1GMMA 4INDA 3FWEA 1I5PA 1NAEA 1G9DA 2PHRA 2VG9A 3J9SA 2Y6FA 4XF3A 4XURA 1VPHA 4AQSA 2CGPA 3RGBA 2EIEA 1REDA 2HEWF 3VB9A 3AYCA 2W9XA 2VXJA 2P3KA 1SEFA 2R1DA 1YRZA 3MF9A 5FYBA 1ZZ8A 5BNPC 1AR93 3Q8AA 4XC9A 5T5JA 2YY1A 4I09A 5F8PA 3RYKA 1BBT2 3IPVB 5FP3A 4PI2A 4JGYC 4JZRA 5FFOC 4ZXKA 3E6BA 2GMPA 5IW0A 2VW2A 5IAXA 2D6KA 2JE9A 2HWB2 4XUNA 4IE4A 1UX6A 4ZS3A 5F5AA 4J1XA 1VB4A 2VZPA 1PO12 1CD3G 5FPLA 1CPNA 5HI0A 4P9JA 3NWKA 5JOXA 1FOD3 5I93A 3W20A 5DZGA 3D5OA 2HWE1 3KGLA 4HSJA 4ARXA 2VCBA 5CG9A 4AG4A 1OVSA 1QGLA 2VD7A 1UYPA 4COVA 2IFWA 3NV3A 1Z78A 4UW4A 4DO0A 1K42A 2R1BA 4CU6A 4L11A 4WM8B 4M3CB 2BZDA 2E51A 3S7IA 4ATEA 2VE1A 4HANA 1E5RA 1AR63 1KFXL 3LDBA 1ZRIA 4QKNA 1UD1A 4MGTA 1US2A 1OUSA 1WW6A 2O1QA 4UBGA 3U78A 3I2HA 2EF6A 4AVBA 4JGZC 4ISQA 3BALA 3DXTA 4QPIB 1IG3A 1D4M2 2R042 1IHMA 4AWDA 2HWE3 3POSA 1PMJX 4SLIA 2YFZA 3S0MA 2HWF3 3IKWA 1XOYA 3T3YA 1R1A1 4A4AA 4LBQA 1QJY2 4AEDA 4AEKA 3BKZA 4M3CE 1SQ4A 3V0BB 1GZTA 2BNOA 5JZGC 1LODA 4U2AA 3MEPA 5J3UA 4V1PA 1JHJA 1AYN1 1TME2 1ODNA 5DMYA 2RS11 3I4IA 3MW3A 3PU8A 1QQP2 4IE7A 4Y1VA 4BIOA 1UU6A 4H14A 5JI7A 4E9KA 2LUWA 1VJ2A 2LS6A 1NE4A 2QJVA 5A7WA 4DY3A 1W6NB 1N3PA 2PHXA 1WMDA 4UFLA 1R1A3 2RDQA 3VHNA 5JLVA 1DGWA 1W8FA 3ZO0B 3VZJA 1D0HA 4AF9A 4FPJA 4RHV1 1DLLA 5A7NA 1AXKA 2HJIA 4PBPA 3ZPOA 1AHSA 5L9RA 4C1WA 1ZRRA 1K5MA 4AFAA 2VZTA 3WW4A 1XNBA 3ETPA 3MUY1 2IXCA 1AR71 3HQXA 4K7JA 4F7ZA 4BLJA 5D1IA 5I0SA 4AVCA 2QQUA 3AMHA 3V56A 5C70A 3WDVA 4A3XA 4O7XA 1KDMA 5L9VA 2X53S 3ZXLA 1UPIA 5A1LA 4UFHA 4CCEA 5J36A 4X6QB 2JJ6A 4RHV3 2A75A 1CAXA 5GLZA 3WF3A 2OQ7A 3VDDA 3RZGA 3ZYRA 3ZKYA 1KD7A 3O1PA 2VMDA 2VNRA 3G7DA 1Z7S3 4HPKA 3TEWA 4AYUA 2R0HA 1XQNA 4RQPA 5LBBA 1LTEA 2UURA 1XNKA 4M4RA 5FZHA 3D82A 4LUMA 3MIHA 3ZXDA 4NRQA 4FTEA 1COV3 5ISLA 3WP5A 1F5FA 1HRV2 3TRSB 2R30A 4LBQD 1O3SA 1O91A 2D3RA 2WJSA 3QH7A 5DUUA 1YQ8A 3AP5A 3VDAA 2A6XA 1FPN1 5KR7A 4FPGA 2R16A 4IE6A 4YZ5A 5JXJA 2E7TA 3QLQA 2JKBA 3BOWA 4PLMA 3MIGA 4YG3A 3ORJA 3I8TA 5H9PA 4LKFA 2GN7A 3IIIA 3KV5A 1W6QA 5C9AA 3D4KA 5K0UB 3ZMNA 4IQPA 4XILA 4CEYB 5FKBA 1SFPA 4LK6A 1LOBA 1SLIA 4RFT0 3TEYA 3AM2A 3CJIB 3WNOA 2ZKNA 4AR2A 4WVVA 4GKXA 1OA3A 1FPN3 4E4DX 3SKJE 4FOQA 4GB32 4OI0A 4XE9A 4JX0A 4NVPA 4XUTA 3PIJA 1JZ6A 2E63A 1ULDA 4IV3C 2D6MA 1CX4A 2W87A 3OEAA 5FZMA 3DL3A 1G6NA 2AEYA 3RG0A 3S5AA 1SLAA 3I3EA 1XSRA 4YM0A 2AREA 2J1UA 5GLTA 1W2TA 5FOJB 1AYN2 1HV0A 1D4VB 2RS12 4DNYA 4WM7B 3WUDA 3KB5A 1S0DA 3U75A 5EZWA 3WF0A 4UT5A 2IVIB 4JC1A 1JYIA 3I3BA 5A3PA 4PDWB 3QBQA 3T2QA 1UXXX 1W6MA 3J8F2 3MFAA 5J98B 4LA2A 2LM3A 3TN91 1IS3A 2A3WA 3ZMOA 3O1UA 5A33B 1DBNA 4AQ2A 1A8DA 2XJQA 1IPJA 5CADA 5GZCA 1P8JA 3N7MA 2RM22 3NNMA 3MV01 4IEWA 5T55A 1PMHX 2NMOA 2RMU1 3FJSA 4FP2A 5F2WA 3WDUA 4N43C 1U5XA 3B94A 3IZOA 3DXUA 3CBNA 3OD4A 4QX5A 5JOZA 1PHMA 3O12A 4FPKA 3W59A 5FUIA 5FP4A 4QU2A 3RMXA 4KU7A 3BPSA 4GD4A 1V6IA 2VUDA 3NNGA 1F4AA 1X9PA 2DV9A 1IPSA 1H0BA 3AFKA 4META 1IQDC 1J58A 1HXS3 1QJEA 2OS2A 4DEVA 4BM8A 2A70A 3GCXA 4JCKA 1I5ZA 2IXJA 3GDBA 2E6VA 3JQWA 3SLIA 3T08A 4NPRA 4E2GA 2RMU3 4LO4B 3OY8A 1UMIA 2UY8A 1GP6A 2EXKA 3MYXA 4I0BA 4TSVA 2BNNA 4XTMA 4BK5A 4TZDA 3ZN6A 1W6PB 2I45A 4XUQA 3PJYA 4K40A 1PGW2 1WCDJ 2QCSB 3LE0A 5J7MA 3NJZA 4B3NA 3VD9A 3VBFC 2A6ZA 4HKWA 2RVAA 1NLRA 5DG2A 1J84A 2XUEA 2OKXA 4FFHA 1PK6B 2OX0A 4M01A 4BJ0A 2QQLA 2WO1A 1O5LA 4HSLA 4YZ4A 5ABJB 1N3QA 1MS3A 1RUJ1 3O0XA 5L7OA 3H3ZA 1RUH2 1SPPB 4K6BA 5C3PA 1AYM1 4P9WA 4RL7A 4YVSB 2YBPA 4I0AA 4QDRA 4XDOA 4Q4V1 5F3CA 5HCAA 3PURA 1JHNA 2P3JA 4LITA 1N1TA 5FY1A 3WP6A 2YDEA 1UU4A 3AKTA 3LKJA 4MYEA 2WT1A 4XBQA 1W8UA 3KSCA 3M4FA 1RVF1 5FMOL 4FPYA 1KXGA 1Q8QA 3Q9OA 1TG7A 3PJQA 5KBFA 5LA1A 4ASMB 1WCSA 2KR2A 4YNIA 3ZPYA 5F32A 5A1FA 4XFIA 4XOGA 1HJFA 2AEZA 1L7QA 1OF4A 2B7YA 3PLQA 5IATA 3MPBA 1RUJ3 3A22A 3VBUB 2VZRA 1AYM3 4BQ2A 4CP0A 1FNYA 3ZFEB 3MGUA 4Q4V3 1PVC1 4CP1A 4JDOA 2Q0AA 2QUOA 3PTRB 3RI8A 1CVNA 1ST8A 2A6WA 3DYMA 3C7OA 2CSGA 3I59A 4WM8C 4YSFA 1CGPA 5KHIA 2YB7A 3UESA 2G1MA 1RVF3 4AI9A 3UKVA 3VL8A 1HQLA 2VUJA 5JMOA 1Q5OA 4Y22B 4QM9A 1MS4A 5SV8A 2GC2A 1OBNA 5FY8A 1X33A 3RWKX 4K20A 4ES8A 5F1RA 3BTXA 2W08A 5IVCA 4QPIC 3L9JT 4EWAA 1HQNA 1ZNPA 2JE8A 2PTMA 4Y24A 3SC7X 2E7QA 4FPHA 1PVC3 2PMWB 1LHNA 3NNFA 1JYCA 1W2OA 5ANNA 4Q4X3 1BMV2 1EAH1 1Y3TA 5A3TA 3NO8A 1DQ4A 1GZWA 1X7NA 2WS91 2ZX2A 5FZKA 2VZ3A 2V09A 3ACLA 1GOFA 3AYEA 3IT8A 4IEXA 3WR0A 3H1WA 2D98A 1T2XA 1HN0A 2B45X 2ILMA 1QY4A 4PJYA 3SH4A 2JIGA 4GWMA 4A3ZA 2RR11 1W2NA 2JD4A 1JU3A 3ES4A 5I0TA 4Z2AA 5A6QA 2EA7A 4IEZA 1VLNA 1EPZA 1JH5A 1ODMA 2JDUA 3CQOA 2AC1A 1EP0A 5CFDA 1JOBA 4G4FA 3UK9A 3NMBA 4KG8A 5FYVA 4QWNA 5H9RA 5J48A 1DLCA 3BN6A 3HWJA 3K4DA 4DPNA 1GFF2 5FPUA 3WP4A 2GALA 4JQRA 3RNSA 3H42B 1TEIA 1UXZA 4FOVA 2V5YA 1S0BA 1BEV1 2VMHA 3KZ4C 1GSLA 3HBZA 5KHGA 1C5IA 4EROA 1CAWA 2ZEYA 1RUOA 4CP2A 5K9YA 1NZCA 1GNZA 5F5QA 5CZKA 4AHWA 4Q0UA 1UOGA 1G9BA 2W1UA 1H1IA 2WA4A 1ND3A 5FP7A 5LA2A 1ZX5A 3AL5A 4FFIA 4D6RA 2NM1A 1OLQA 3HNMA 5FXZA 1VBC2 1AUYA 2A5ZA 1DU3D 5FP9A 3NVCA 2HBUA 4XIOA 4IUGA 4Q0PA 5C3RA 4OHWA 1RMU3 2G9GA 5IHRA 1AXZA 2DVFA 2X05A 1QF3A 2XMLA 4ISRA 2YUEA 4Q26A 5GALA 4D7TA 3N9QA 1O3QA 4Y4RA 2QQIA 2XJUA 5DDJ2 1J1LA 3UV9A 3LB9A 5IFPA 3S30A 4GZ9A 1BKZA 3I3MA 3UJOA 1W2UA 3ZSLA 4KBBA 2P2KA 2DWRA 2GSYA 1NCRA 1X36A 3WNNA 2FHRA 3KM5A 4HZFA 4DINB 3I54A 3O1OA 5FWEA 2ZTNA 3DGTA 1WD4A 4COYA 4FCAA 1PZ8A 1S0EA 1QJU2 5K0UC 5IK5A 3SISA 4CEYC 4KBZA 1RUNA 3CJIC 4NUBA 1OH4A 1AR83 2WZ8A 4S2DA 5I8SA 2WNUB 1ZYBA 5JOYA 2XPJA 1D0GA 1OKOA 2B8MA 2GMMA 2VOVA 2VVEA 3H3UA 3LEIA 5EJ3A 4HOOA 4MGQA 3WQ1A 4CE8A 2H0BA 5AVPA 3UKNA 1SHWB 1FV3A 1VRH3 1SMVA 4JQTA 4LBQB 1IS4A 5KHHA 4OZXA 4O65A 4XCBA 3POYA 5KHKA 3Q8BA 1UNBA 1RUD3 2A6YA 4X8NA 4YM2A 1EAH2 5LK5A 4P9YA 4TXWA 4WM7C 4CRQA 3K2OA 4A7YA 1ZBA1 3SMHA 5FJHA 2B9VA 2GP5A 2P5BA 2WO3A 3IMMA 3KCXA 3KVBA 4RFRB 2GC1A 2OQ6A 3WF4A 3ZM8A 4K9SA 4PDWC 3KT7A 1ZBE2 1OMIA 3ZX7A 4LBKA 3UGFA 2ZOEB 3MI8A 2EIDA 1RUF1 1GNYA 5A7PA 2FZ2A 3PUAA 2W52A 2HWD3 3RYPA 2ADDA 4GQ7A 3GBGA 5F6KA 4MXWA 3V0AA 4OHZA 4EJRA 4DUXA 3RVHA 4C8DA 4O9GA 5AC92 1UZVA 3IBMA 2P6CA 2YC0A 3VZKA 4CCOA 1ZBA3 1FXZA 1K5MB 3VZMA 5FUPA 1FAYA 1BEV2 2HEYF 2PFWA 5JVVA 1XE7A 4Q0SA 1GOHA 4C90A 4LKDA 1UF2C 3RMYA 1RUF3 3UGGA 2OW4A 1OQEA 3ELNA 2JWPA 1PGL2 2NLRA 1V6JA 1MS1A 3ZIWA 4OHXA 4E2QA 3OYWA 2G19A 4UW6A 1H2LA 3QCWA 1PVXA 1W2AX 1CAXB 1LGCA 1RITA 2ARCA 2XVKA 1QEXA 4S2GA 3VDDB 2CV6A 3EB7A 4QM8A 1EY2A 3DCQA 3TWIA 4ZS2A 1DYOA 2ENRA 4HPKB 5B4NA 3CDZB 4RQPB 4AFMA 3UETA 4XTPA 3IDBB 4YVWA 1RUG3 1V6KA 1XE8A 3AYAA 4UYBA 4PF1A 4B4RA 1POV1 5IVBA 1QH6A 1RHI2 2JENA 1PK6C 1QOSA 2XONA 1SBFA 1VBE1 4XMAA 2VR4A 5ABJC 2ET1A 1JYNA 2WC2A 2XG3A 4CVUA 2ZGNA 4GH4B 1HIXA 4L2NA 4YVSC 4QPGA 3B9CA 2J1RA 4JDMA 2FDJA 1MEC1 3OUIA 2CAVA 1CJDA 2GN3A 2QBXA 5FO9B 2WZPP 1MS5A 3IDCB 3WUCA 2Y8KA 5C3OA 2J1TA 3C7HA 4OFGA 2UYAA 4NE9A 4UF0A 1W6QB 2EVXA 4N9HA 3VLBB 4GMP1 1GWMA 2O14A 5FXVA 2VNOA 4BB3A 4SBVA 4CPBA 1VBE3 1SBDA 3EBRA 4IEUA 2WNVA 5APAA 1DZTA 4FXKB 2FCTA 4XCAA 1KITA 4I2OA 2B5HA 3FUQA 5C7GA 5I8YA 5CVRA 1JOJA 3EMRA 3VBUC 4EZ4A 2O8QA 4V2VA 3ZKUA 2C24A 1AX0A 2RJKA 1TZOA 1BK1A 3EYPA 3M3CA 3ZFEC 5F5CA 1MEC3 2AZ5A 5DQ0A 3VZOA 3JD71 4D6QA 1AL0G 3LEKA 1JOPA 1S0JA 4HMZA 5FPXA 2IWGB 1RINA 1I6XA 3P1IA 5L9BA 5JXHA 4Y26A 2Y0IA 4PBOA 3OBZA 1Q8SA 2ZEXA 4COUA 4Q8KA 4D69A 3A0KA 4XF9A 4BQYA 1OOPA 4FPFA 4LULA 2CDOA 2Y34A 4QX8A 3WXPA 2X5IA 4DEQA 5GZDA 1OA4A 2X09A 2XWBB 1BBT1 1OC1A 1W6MB 3J4UH 5ERLA 3T09A 2ZPXA 3EHKA 2DYCA 1WUVA 1F5JA 4YZ1A 1SLTA 4M3CF 1RUI3 1W8WA 1JYWA 3D8CA 2R32A 1J3RA 2W91A 3C8XA 3GBFA 4N90A 1HX6A 1PO11 1URXA 1ZZ6A 4Y20A 2RS52 4W6YA 3CF6E 2A1XA 2XLGA 5C3QA 1QNWA 3O1TA 2ZX1A 4QQHA 1N1SA 4LBLA 1Y43B 4LBMA 4AZZA 1V9U2 2XJRA 2VC9A 4ZPIA 1BBT3 3KCYA 4R9DA 3O1RA 5F3EA 2VL4A 4DMIA 3N35A 4W50A 3AKPA 4NAOA 4IEQA 3N7LA 4Q4Y1 2WAAA 4Z8BA 1IGOA 3U4XA 4V2WA 4FTSA 1V6LA 4I01A 4XUOA 3R4SA 2HWB3 1QXPA 1W0OA 1ZA4A 2DVBA 2F4PA 3ZFFA 3CZUA 3WSOA 3OY8B 1PO13 2QTWB 4HK9A 3LPFA 1JW6A 1S2BA 3AK0A 4CPBD 3ZN6B 3N9LA 1KJLA 1W3VA 1D4M1 2R041 3AYDA 3B9IA 1APNA 2E31A 2YGMA 3ZYJB 5L36A 4AGGA 3VBHA 2ZGLA 1FMD1 5HV4A 3H7YA 5IVVA 4XEZA 3N4MA 2Y38A 4AQ6A 2HWC3 5F2SA 1QJY1 5FY7A 3CJXA 3HJRA 3EJKA 2QQNA 3ZXEA 1ND2A 3VKNA 2Y60A 5FXWA 4DRRA 1TME1 4FAGA 1UZYA 3ZN5A 2JE7A 5L7OB 2BGPA 3LCPA 4L92A 2FMYA 4NHKA 2R043 3JB8A 4GWIA 4ASLA 1W3XA 1Z0HA 3T0DA 3WDWA 2FD8A 1H9PA 1QJY3 1H30A 1F31A 1W8ZA 3FE5A 2BGOA 1XU2A 3J7HA 3T2OA 1H4HA 2VW0A 3I97A 3LOIA 3ES1A 4QGLA 3VDCA 1U0AA 2BYVE 3POFA 1IS6A 2GH8A 5EWSA 4YW7A 2BVVA 3WD5A 3WG3A 1FATA 1QQP3 2YU1A 1YQ2A 4AGVA 2JG8A 5T3NA 5EJZB 1YFXA 4RA0A 1UZZA 1YCIA 2PYTA 4PQQA 4OI4A 3DYOA 5JXGA 2DTYA 2I07B 3I59B 1O8SA 5IK8A 3JD72 2AR6A 2GNMA 2PN5A 4LO5B 1O4TA 1GQHA 1LEDA 3MICA 4XVHA 1M4WA 1YQCA 1YIFA 1RUC2 3H0OA 1LHWA 4YGDA 3B02A 1W9WA 2BFUL 3N9NA 4NIGA 3KQ4B 5DUVA 3H3LA 3L2HA 3M2MA 2WNUC 3VD4A 1GQGA 2E32A 3WF1A 1ZA7A 4Q0QA 2VW1A 2IUWA 4UAPA 2NMNA 3ZFGB 2Q8OA 3HVDA 3LPGA 4Q4W2 1ZRCA 1NQJA 2EAAA 4FI9A 3RZZA 1UOJA 3I2GA 1W05A 5JR2A 4B1LA 1NE6A 1PGSA 5FPZA 1VBA2 2GNTA 5FYIA 1JZ2A 2DVAA 1GZWB 3ACIA 1HRV1 3WNLA 3HT1A 1QJX1 5IJRA 3ZVXA 4YARA 2QFEA 5C8CA 5FO7B 5HPOA 5JI9A 2ZHMA 5BYNA 1IS5A 4LT5A 4EQVA 4XBLA 3C7FA 4UOJA 4E4ZA 2WWSA 2R072 2ZGSA 1S2EA 3LA2A 4MOAA 1VAVA 2PA7A 5CFDB 5JXIA 4CDUA 2RDRA 4CA9A 5C5TA 1HJGA 2YC2A 3H8OA 4Q4Y2 4LO8A 4A6SA 2D44A 4HT1T 1XYOA 3OPTA 5LWBA 1NYWA 4IGPA 1HRV3 3VBRA 2D97A 3AXEA 3N7JA 1OUXA 4IEPA 5HCBA 4A2UA 2PHDA 1K5MC 1Q8OA 4XHXA 4B7KA 3THPA 4GB31 2QQVA 1ZVFA 1PX3A 4OQ8A 1S0IA 1Y4WA 2JDKA 2XWJB 4ITCA 4W65A 1XB9A 1HB1A 2JXAA 2VCMA 3AMQA 2EXIA 1CAWB 1FMD2 3NAPA 2JG9A 4YLZA 3TNQA 1BVVA 1WWYA 3JUUA 5EYXA 4EWDA 1PZ9A 3U11A 4AEJA 1TMF2 1UW8A 2VVDA 3GGLA 4XFCA 4XHBA 5DAVA 5A7OA 5FZIA 3RZMA 4HN0A 1H8VA 2P34A 3KF5A 2VCAA 2HBTA 4NIIA 5JR7B 1YI7A 3RYRA 5LW9A 3VBOA 3WNMA 3NJXA 4MO3M 3VDDC 3OGGA 2YBSA 4FPOB 3RZHA 4FPCA 2QZ3A 1VP6A 2GH2A 3GXUA 4NWVA 1N47A 2VH9A 4GB33 3MO4A 5LASA 3TEXA 2VQAA 4IGOA 2WFPA 5LY1A 1SCSA 1BLZA 1QMJA 4JV4A 4RQPC 5EPAA 3J8F1 3ST7A 3VD7A 2D3PA 5FJKA 5LA0A 2BBVA 4FSJA 5A3NA 3NV1A 5FR3A 3GBWA 5A1AA 3IWZA 4H3WA 3S5QA 4P14A 1G9CA 4AHZA 2VQ0A 1RB8G 2RM21 1NA1A 1K5JA 3RJRA 3DECA 1AYN3 4PHZA 5JWPA 3WHUA 4GH4C 2RS13 1MQTB 3OD0A 2AACA 1NZIA 3KV4A 1A34A 3HR9A 3ON7A 4P5HA 1BYHA 1YFYA 1DZQA 3K3OA 3J8F3 1GP4A 3OOXA 4QGMA 3MIEA 4CXYA 2HLEA 1KGYA 3O7OA 4RYDA 1FX5A 1LJ7A 2GNDA 3CEWA 2PLV1 4IGQA 4YW1A 2G9ZA 1SFYA 2RM23 3NV4A 3CLPA 3WEZA 2ZZQA 1HRI2 3J7LA 1TQ5A 1XU1A 2JB8A 1PGW1 2Z5WA 5A32B 4UI9L 4CU7A 5HCHA 4CUBA 2VPVA 3MIDA 1AR73 3OJBA 4YM3A 4I3PA 2WN3A 1PIV2 5GKAC 1W0PA 2BGCA 4XFFA 2YU2A 3T2TA 1JYVA 3OGVA 1JBCA 3URFA 4NHMA 1UIKA 2V72A 3NW4A 1QJX2 4AFBA 3P3PA 1UKRA 4XETA 2DFCA 4GJZA 1RUH1 5EFUA 5F6LB 4D3WA 1D7PM 2ORXA 2BRTA 3WP3A 1B35A 1YWKA 4AI1A 3C7EA 1D2QA 4YG6A 2A6VA 4LNVA 4R8HA 5IWFA 4ZU5A 3ME2A 4K1ZA 2C0ZA 1M06G 3ASIA 4CDXA 4TLGA 1DHKB 1VBD2 4ORFA 3ALQA 4MXWB 5FLIA 4RD7A 3V0AB 4PQ9A 2ETEA 2DVGA 1W39A 2RJLA 1AJOA 3KMHA 5FREA 5CG8A 4LR4A 3B7MA 1NT0A 4NO4A 2F6BA 3HQUA 4P5YA 3WDTA 2XKOA 3LEMA 1YC61 3EO6A 2QE3A 3DKWA 4ZZ8A 1KRIA 4OI2A 5DPNA 5C5UA 4IEOA 1H8TA 1LECA 4YGCA 2CHHA 1X8EA 2Y64A 3ATGA 1GICA 4RS5A 1YQ5A 4D8MA 4LBNA 3T1LA 3KLSA 4BU2A 1UOFA 3M3EA 1LGNA 3C2UA 4BCUA 3OYWB 4ASKA 2XJPA 4TLFA 1SBEA 4IETA 3WDXA 3A0NA 3HEIA 4XDQA 4PLOA 3ROUA 5ACA2 1O8PA 1LHUA 2VU9A 3OB8A 2R49A 1RJ8A 4I0WB 4WVMA 4YVWB 1GANA 3NV2A 5CKNA 3BTYA 2DCTA 1H2MA 4JHTA 3GJAA 2FMDA 3M3IA 1BMV1 3T4HB 2W95A 2ARAA 1V6MA 2YZ4A 4WVWA 1O3RA 4Y3OA 5L7OC 1WCKA 1DP0A 2J42A 4AE2A 4Q1RA 4QPGB 1OQDA 4AVTA 1CZTA 1F4HA 3WCRA 1CAVA 2K9ZA 2R6QA 1X9TA 1RUE2 1GUIA 1CIYA 4QXBA 4PT6A 2ORZA 4UF0B 1Q3EA 2FDHA 3TN93 2VTXJ 3USSA 1QOOA 4P9LA 4AAXA 3A4UA 1Y9QA 3NNJA 4NRPA 4BK4A 1OD3A 5A6ZA 4M0NA 2WNVB 2PLV2 1AJKA 4K21A 4CUAA 1LENA 5FAXA 3FMGA 1GQPA 2BPA2 3SXWA 3BU0A 4DQAA 5JSOA 4FPLA 4XFHA 1AL22 1R091 2VMCA 3UYJA 2ZGOA 2ZCWA 3M70A 1XNAA 4XDPA 1FYUA 4AAPA 2A73B 5I0UA 2JDZA 4AI3A 4TWTA 4XQ4A 1ENQA 4K3UA 5F3IA 5FYMA 5FYUA 2YROA 2OIIA 1OOPB 4DS0A 2AUYA 3RWNA 2X5IB 3PHMA 1VBC1 1ZRDA 3ZFGC 2ZS6B 1Q43A 4MVTA 5FZEA 4PLNA 3H50A 4OLLA 2ZX4A 4QXCA 1S1AA 2HYXA 3EQEA 5LA9A 5FQ0A 4W8JA 4NIHA 1GKBA 5DAXA 1WCQA 5JPNB 3OGRA 3CU7A 2YPJA 4CCDA 4URAA 1XYPA 2X29A 4KH9A 4H7LA 1L3JA 5DDJ1 1C8NA 4Y20B 4AVAA 5AFBA 1F9KA 4LHSA 4O9EA 1HKDA 1VBC3 3FBYA 3HIFA 3PDQA 4NPMA 2CWSA 4LXLA 2OA2A 3I2KA 4NIDA 1REEA 2AENA 4N43A 3VDBA 1WD3A 5CFDC 1BK0A 4WZCA 5EP9A 3ILFA 1X82A 4N9IA 4YW4A 1QJU1 3R05A 4DXRA 4MSVA 1XNDA 2J1AA 4Z2WA 4AGRA 4RGGA 5LCWL 1UOBA 1GNHA 1DZRA 4MGYE 5GLUA 1C8M1 5F5IA 4UFIA 3S6PA 4CEWA 1ZZCA 4QQPA 2H0VA 2ZEWA 4JRLA 4N53B 5DDJ3 2WN2A 1GZCA 4EN9B 3QH6A 2XJVA 4XJUA 1JZ5A 4HG6B 3G6JB 3MW2A 2Y6LA 2X8KA 5JOWA 3HD8B 1ULFA 4HETA 4CSWA 4B8EA 1ND2B 2P3IA 1QJU3 4IDZA 1NY72 2E26A 4AEMA 4C0BA 2C1FA 5SV5A 4LIUA 3SITA 1E5SA 1XJAA 5CAZA 3O0VA 2JDMA 5LRSA 2A71A 3UL2A 3B69A 1MS0A 5KXCA 3I2DA 3R0RA 2NYYA 1ZBE1 5DUXA 4QDQA 2DBIA 3A21A 3DPRA 1NCQA 2P17A 4Q5OA 1EUTA 4UXAA 2BERA 1PM4A 3ECQA 5FP8A 3E5XA 3BU7A 4LPLA 4TYSA 1N1YA 3RI9A 4XMIA 2FDFA 5GZGA 2Q1FA 5FZ9A 3ZXGA 1HXS2 2JEMA 3AZYA 4AQTA 1EAH3 2RS32 1KDKA 2WS93 2ZX0A 3D3AA 3GHMA 3LFMA 1MQTC 1WZXA 5FMOS 2JG8B 3NJYA 3WG4A 3WZ1A 4CP9A 3ZSKA 5AC91 5A6XA 1ZREA 1DG6A 2XBO2 1V00A 4KNCA 3WG1A 2PELA 5FUNA 2RR13 5J09A 1R092 1ZBE3 2HYKA 3LQCA 3ZYFA 1W03A 2B9UA 4NWWA 3RFRA 4WBBA 3ZR6A 1YNAA 1PGL1 5IAVA 2DCZA 3FZ3A 3PNAA 5FZ8A 5LZ6A 1ALYA 3E1F1 3TOJA 4YW5A 3WY6A 5FDBA 3H1MA 4KWJA 5KHJA 3MLLA 5AC93 2FDGA 3KCCA 1OT5A 1PX4A 2ZGTA 3ZYBA 2G9FA 3TYJA 1BEV3 1NG0A 3MIFA 3WLUA 4QD2A 4BHPA 2GMEA 1EV12 4DUWA 5BNNA 5EYYA 1GWLA 1SG3A 1JUHA 3GJBA 1RHI1 3QACA 3AP4A 2R062 5FY4A 4MH0E 4LUKA 5D8AA 4LJHA 5FZFA 3VZLA 4ARYA 5C8CB 1POQA 4H7MA 4D7SA 1L7LA 2ARXA 1XXNA 2KXLA 3I7DA 5IYYA 1PO22 1ULCA 2WFF2 3WOGA 3OGJA 2VBPA 2XH6A 3KD4A 1RYYA 2D93A 4YYOA 2DFBA 1CESA 2ZX3A 2DURA 3U1XA 1YXWA 2OT7A 4CDUB 4PF5A 2ZGUA 1IOAA 2VY0A 4EN8B 2MEV2 4BQ4A 3P6BA 1U5YA 4QB6A 1W06A 3LSDA 2W92A 1RHI3 2CTVA 1LOFA 4P9XA 1AZDA 1O4YA 2B4KA 4EZHA 4Y33A 3VBRB 1UY0A 1C8M2 1VE0A 1DQ5A 3I49A 1NOVA 1IZ3A 5JSPA 3PMSA 3AL6A 5T5PA 5KXEA 1CWPA 4AI2A 4CYDA 2C4XA 3H1YA 4FO9A 3U37A 3T1MA 3OGSA 3ETQA 3NAPB 1NLQA 5B2GB 5J37A 2JG9B 2JDPA 3LIHA 1W04A 1N3OA 2J22A 1A78A 1LU2A 2NPIA 2Z42A 2XL7A 4I3GA 4AEDB 2P6HA 3ZIXA 1SACA 4OULA 1I3HA 3PMEA 1S0CA 5IVYA 5CA6A 4DZGA 2W2IA 4YRDA 3VBOB 1EPWA 2QZ2A 2LTNA 4CCMA 5L19A 1BVP1 2JDNA 3LFIA 3M3QA 3BOPA 5CIRA 5H9QA 3VBSA 4P9IA 4YZ2A 5A7WB 1U12A 3U4SA 2CL2A 4HONA 4YVWC 1H4GA 3GHNA 3C3VA 3AZWA 2TEPA 4GIQA 4QPYA 1OFNA 3OUHA 3H8XA 3DEMA 2BBAA 2F4LA 2WABA 3ACGA 1ULEA 3H9AA 4HXCA 1NA1B 1UPSA 2P3YA 1VBB2 1HB3A 5CNAA 5GZFA 5FZ3A 2WNEA 5FZLA 4KQ7A 1G9AA 2RV9A 4QPGC 2RS51 4XF1A 4DIQA 5FWJA 2Q1ZB 2X10A 3BIWE 3BPZA 3CO2A 4QKFA 2E7AA 4L8QA 4DB5A 3K77A 1V9U1 1S4CA 4RR3A 4AHXA 2WQZC 4NOTA 3OF1A 2VQTA 5LEKA 4MXVA 2DDUA 3BTZA 1W8HA 3TEZA 2WNVC 2V73A 4AL9A 3CKHA 1YQ6A 4IL7A 1UL9A 2BDRA 2WNOA 4QPWA 3ZSEA 3OG2A 4CCLA 2RS53 1UY2A 2V4AA 1S55A 3Q8CA 5CFCA 5G04L 1CX1A 2DCJA 3CJIA 4W6XA 5EV7A 2WDBA 3PIGA 2ZHKA 2ZZJA 2Q8EA 5C33A 2DBNA 1O4ZA 1V6OA 3H8RA 4Q29A 5IK4A 1JZ3A 2Z69A 3SCFA 4AFDA 4BZ4A 2JDHA 2BJSA 1C1FA 2TUNA 4K8FA 1KQRA 2KD7A 1OOPC 2RG4A 3AKRA 5CKMA 2XJTA 2PQSA 3KHBA 3T30A 1CZVA 4S2HA 1B35B 1UIJA 3POBA 5A3WA 3ZOIA 2CGOA 4CDQA 3KHCA 1LOAA 3L2YA 5GLWA 4CDXB 4DXSA 5I91A 4OZOA 5KC5A 5C9AB 2W68A 1OI6A 1POV3 4MHRA 4BH9A 1H2NA 1ZRFA 1YO8A 4HKLA 1SFNA 3B01A 3INAA 4TTGA 2BW8A 3SHRA 4BOWA 4CXWA 1STMA 2CWMA 1WMFA 3PTYA 4RGKA 5K7PA 2ZACA 1OLMA 1UYXA 1YHFA 3O14A 2VJXA 3RSJA 1H8TB 1Y9GA 2XKPA 2Q8CA 3RS6A 2WWJA 3ZYIB 3JBG2 1Y9MA 4ONUA 3MF6A 5DUWA 4RS5B 1Q56A 5L73A 4OUMA 4BQ1A 4HN1A 4HVRA 5HCFA 4A6OA 1YIPA 5B4XA 3VUOA 1JYTA 5D21A 2ZAAA 5A3UA 4GMP3 1RUC1 3WW2A 4ZZ5A 2W46A 3VGIA 4Y4YA 4GA9A 4N53C 1RUD2 2VTXA 1LCLA 2QQWA 5FKCA 3IAQA 3POIA 4YZ3A 4LA3A 4JKMA 3T0AA 3FHQA 4R4XA 3E5UA 5DXDA 1KS5A 2OPKA 4WVMB 5LY2A 3ZN4A 1FV2A 3HN1A 3I3DA 4Q4W1 3H8UA 3JQXA 4DFSA 2VCCA 2ET7A 5E89A 4DXZA 5DAPA 2ID4A 1W6PA 5IT6A 3JD73 4QMAA 1ND2C 1VBA1 1MR5A 3WG2A 2FDIA 4O61A 1RUC3 3ZXFA 5A7SA 2SLIA 4U36A 3VHPA 1DCSA 2WLPA 2WT2A 4LO6B 3N9OA 4MG2A 2DCKA 2W1WA 1WBLA 2AH2A 3KV6A 4Q1PA 1LOGA 1UMZA 1CAVB 2VZ1A 4NROA 4KMQA 3WW1A 2O0OA 3R6SA 1W8NA 4XJZA 2AYHA 1VMJA 1GBGA 2R071 1V6NA 3FBMA 4Q2FA 4IE5A 3MLKA 4Q4W3 4YVSA 3WVJA 1WBFA 3VZNA 1WLWA 2D6OX 2XXZA 1VBA3 1KFUL 5F7UA 3PUQA 5FYTA 4CCCA 2DUOA 3AB0A 2J1SA 1RJ7A 1J3PA 1WA4A 3J26N 2JG8C 2D6LX 1DGRN 1CJPA 1YJLA 1H1AA 4JVAA 4LOTA 4NHYA 2W1SA 3T2PA 1HB4A 2OVUA 1WLTA 2PHTA 3KWVA 3POJA 1QJZA 2CU5A 3M3OA 4D6SA 2YMZA 1UMHA 2IXIA 4HVOA 1GR3A 2WZR2 4E27A 1JUIA 2IXKA 5F39A 2R073 3NQHA 1TMF1 2WR9A 5HXVA 5LK7B 3BYWA 5GJ6A 4CDWA 3VL9A 5FY5A 4Q4Y3 4BQ3A 3RRDA 4GXLA 2VVFA 1NLSA 4L97A 1OPOA 2ZXQA 2EALA 1ULOA 2VOKA 1EUUA 3Q8FA 2WQ4A 3N7KA 3LZZA 1FNZA 1C28A 4QKDA 4RN5A 1H6YA 1SCRA 4FBFA 4A44A 1F8VA 1HN1A 2W94A 3LF7A 5J1XA 3B00A 2WRAA 4IV1A 3O1MA 1D4M3 4OQ9A 1F15A 1DQ1A 2ZBJA 5FMBA 1A8MA 4BXSV 1FMD3 1CPMA 1PM7A 3LEGA 3MLJA 1VR3A 4UFKA 5G05L 4NHLA 4CXXA 1CQ9A 4M0HA 2LRPA 1TMF3 1K45A 2A3XA 1QXJA 1IKPA 4JKKA 5C8CC 3R4UA 2VUAA 4QX0A 4CTEA 1TME3 1AX2A 4ES9A 2BOIA 1TVGA 5IUQA 3HT2A 2GU9A 2Q1MA 1SLLA 2B46X 2ZHNA 3GZAA 4QX7A 5LB6A 3TBDA 5IK7A 2WO7A 4XUPA 2PXJA 1UYYA 2MPFA 2BOJA 3O5SA 4XAAA 1BQPA 4N7UA 5K4LA 5BNOA 3MUZ1 4JTNA 4CDUC 2HH9A 1R081 4RGAA 2JD9A 4YM1A 4YW6A 1XSQA 5FZCA 3K3NA 1G8WA 4EE2A 1JYXA 2DF7A 2Z4FA 4OHYA 2WZEA 3VBRC 1C4RA 3U07A 4CEWB 4QHZA 4R9BA 4P08A 2OZ6A 3I2IA 3THCA 1O59A 1VAMA 2D5HA 2YV8A 2BVBA 1HRI1 4AI8A 2YG0A 4E4HA 4ZKTB 5FMCA 1ASJ2 1AR91 1DQ2A 5FCCA 2OPWA 2YPDA 1RTVA 1W8TA 3USUA 4AEDC 4LBJA 1F35A 1PIV1 2EAKA 1OFSA 5A7QA 3JZVA 4NJ4A 4EN0A 1FI2A 1QDOA 4P9GA 3VBOC 1RUI2 2VGDA 4NR1A 3SH5A 1LULA 2E53A 1DGWX 1QXRA 2A3YA 3ZLIA 2GZWA 2VXRA 1HRI3 3E6DA 4QGNA 4BQWA 1BXHA 4YGBA 1FOD1 3DPRB 2UY9A 1NCQB 3PUIA 5LBEA 1N1VA 2TBVA 3LD8A 4JAAA 1DQ0A 2WL1A 1VBD1 4OMCA 2VZUA 4R9CA 1PIV3 1WGPA 2ZABA 4QAWA 1NA1C 3AMPA 3F2ZA 5T52A 1UU5A 1AR61 1XRUA 3CL1A 3CZJA 5C4WA 1QJX3 1VIWB 4CP9B 1LHVA 1JS9A 5CBLA 3HNBM 1DDLA 3FUOA 2ZGKA 4YWAA 3VD5A 3KT1A 3VKOA 1OF3A 3IM0A 2K0GA 2NN8A 2HWF1 3BUCA 1BCXA 1VBD3 2HWC2 4P00B 4D0QA 2F17A 2JICA 1GZ9A 1HLCA 2KM2A 1ND3B 2OUJA 2OUHA 2WO2A 3NKTA 3WNPA 3ILRA 1JZ7A 1WW4A 1LGBA 1PNFA 4QKBA 1QOTA 4QQOA 3ZXJA 1I1EA 3WF2A 3LA3A 5ACA1 1BHGA 1Q8PA 1UZ0A 1S2KA 1LU1A 3B3QE 3VKMA 2BFUS 1LRHA 4BQXA 4HL0A 1R1ZA 2WNUA 5FRAA 2ZA9A 5FYHA 2ADEA 4B7EA 4OYUA 5BNNB 5BNPA 1OQ1A 4LBOA 2WBKA 5FBZA 4L9BA 3UGHA 1RGSA 4COWA 2Q5TA 3I2JA 5F37A 3NJVA 5D8AB 2J1VA 2MHFA 4LHLA 4JGYA 4FFFA 4PIYA 2B39A 3AP6A 1QWRA 3BODA 3SKVA 3WNXA 1IQAA 4A41A 1DGLA 3ZDVA 5A6YA 1B35C 4NHXA 2BQPA 1ENRA 1NCRB 5ACA3 4YPJA 2Y0OA 4LIVA 3UNPA 1RUE1 4LORA 1WMEA 1TNRA 1OVPA 3TB0A 2VUCA 2JX9A 4CDXC 4S2FA 4CU8A 2FDKA 1R082 4XJ9A 1W9TA 1Y7BA 1YJKA 5C9AC 2WIIB 1W6OA 4XIKA 3KVAA 4BE3A 1W90A 3LWCA 4XJAA 1LEMA 1FT9A 2Y6KA 4MUVA 2PHWA 2UWAA 4MGZE 2LW8A 4DRVA 2WYSA 2W3JA 1H8TC 1O6UA 3S57A 4QQLA 4LK7A 1VALA 1AL21 2HKXA 2JB4A 5BNQA 4AXOA 4RS5C 1OLRA 1RUE3 1AR92 4YG0A 5FZBA 4X8PA 2FQPA 1J1TA 4JGZA 3B93A 1Z7S1 2P37A 4IW3A 3SCGA 2B42B 3DKQA 4LKSA 2ZGPA 2SBAA 5AVAA 1C5HA 3U14A 2NZ9A 4C91A 4XAEA 5JDBA 1H6XA 5CB7A 1MPXA 2YC4A 2PLV3 2Y33A 3FC0A 1COV1 1CZSA 3RJ2X 3VKLA 3X29B 5JAXA 3WV6A 3VBSB 3VHOA 5JCTA 2OXBA 2VMGA 5JZGA 5KC6A 3W5MA 3BI3A 3LDKA 1OA2A 1OD5A 4XACA 1AL23 1FOD2 2GDFA 2JDYA 2E33A 2W5FA 5BPXA 1DGRA 2ZGQA 3SQOA 4B29A 4F3JA 3K4ZA 4XXPA 5DG1A 4FAHA 1S0FA 2ERFA 4Y5TA 4D7YA 2CAUA 2K2SA 3CHXA 3OBTA 1LAJA 5IVFA 5HV0A 1AX1A 2DUQA 5DAWA 5A80A 1AR62 1ULGA 2UYBA 4L0PA 2AGSA 1GV9A 1WW5A 4Y1XA 1HB2A 3ZSJA 1RUH3 5FO8B 4BPZA 4RR3B 4QT6A 3MBWA 4I30A 2I74A 4WVZA 4GH4A 4FOYA 2BTVC 3VD3A 4FQ4A 2HEVF 2HWE2 3D6EA 3MHZA 2HWF2 4KI5M 4LHNA 3KQRA 4J1WA 2VNVA 4NRMA 1UO9A 4R4ZA 4BIFA 3AZZA 1NQDA 3AJYA 4XXAA 2VOTA 1SLBA 1VMFA 2BWAA 3IDEA 4XW3A 5CFCB 4MGIE 4CCNA 1WKYA 5FZ6A 3ZYPA 5C3SA 1TNFA 1MACA 1G9FA 5CKQA 4HFSA 1E57A 5I0DA 4XYXA 4BLIA 2XUMA 4C0HA 1XYNA 2EIGA 5FZOA 3MDPA 4DXTA 5IFTA 4MZUA 1ENSA 3AKSA 1NY71 2QDRA 2XHNA 3DV8A 2ZMKA 1R1A2 1J3QA 1SDWA 1MS8A 1CR7A 1YYNA 2CGNA 3OEBA 3K48A 2XQRA 4E8DA 3FLRA 3FHAA 1JZ8A 3PVEA 4QU1A 2DUPA 3VV1A 1G86A 5GM0A 4GAZA 4CDQB 2PAKA 5AFEA 2W39A 4PIXA 2C6SA 2XGXA 3CMGA 1LOCA 2Z2SB 4Q0VA 2WYFA 1CAUA 5I8TA 3OPZA 3HN3A 2QQPA 3LAGA 2ZGMA 2VO5A 3I2FA 3Q8EA 1YLLA 5JIAA 1HXS1 2W1QA 4G9SB 4Y5SA 3K75B 4CCJA 2RS31 3ZYGA 1IPKA 1RXGA 2VM9A 4GWJA 1O3TA 1IKQA 1I9RA 2XBO1 4RHV2 5LBFA 5D2AA 1IG0A 3LDRA 4MHUA 2V4VA 4LLOA 3IB3A 3W21A 4EN7B 1LHOA 3LSEA 3N9MA 4OMDA 1Z7S2 4UFJA 4Z1VA 3BVCA 1SDDB 1HV1A 2O8OA 2H6CA 1AR72 2VOXA 3AZXA 4F8AA 1SLCA 4JKLA 4CEWC 2ZEZA 1E5IA 4IV3A 4JTOA 4HLTA 2RS33 1COV2 3N3HA 2XHKA 2Q30A 2NQYA 1OLME 2R7EB 1B09A 4TN7A 1L7RA 2XBO3 1A3KA 2ZHLA 3O1SA 5T54A 3WQ0A 3EXUA 2PHFA 4D94A 1R093 3KV9A 1EV11 3N9PA 1UAIA 2VZOA 1JN2P 2CY6A 2FZ1A 2XDVA 2ATFA 4UWDA 4CCKA 1KEXA 2R061 3GZTB 4B1MA 2IFRA 2WUHA 4GULA 1SZBA 2IXHA 1WMXA 1REFA 1QH7A 2XOMA 4FT8A 5FPVA 3HQRA 1ENXA 3ITQA 3VN4A 3HBKA 1PO21 1DFQA 1YEWA 2WFF1 5EXOA 5T5OA 1H2KA 3W5NA 2CNAA 3AMMA 2XVLA 3J7NA 4CZSA 3GALA 3DPRC 2QQJA 1NCQC 2VNGA 2VZVA 1FPN2 3GF6A 4K1YA 5CYYA 2JDAA 1EV13 3POWA 4QXKA 2MEV1 2CYFA 5CU1A 3PVNA 5LEJA 3W9AA 4ZU7A 4LHKA 5IVJA 2R063 3FHIB 1LB2A 3HAGA 1CIWA 2DU0A 5FZ0A 5FXXA 3ZFFB 1UX7A 3FN9A 3RZLA 5FZDA 1PO23 2VBDA 2JKXA 1NXMA 2WFF3 3TNPB 2QNKA 4ET7A 3E5QA 3VBHB 1CN1A 1ULPA 2W0XA 2UU8A 4IEYA 5LBCA 2VMFA 4JHZA 1MS9A 3HMYA 4IXLA 3JCIA 4LKEA 4OVEA 4MV2A 3AP7A 2MEV3 4LE4A 2VULA 4NIAA 4CDWB 2Y6HA 4B4PA 3JXSA 2Y26A 3MFCA 1ND3C 1G7YA 2WSVA 3VBFA 4Q4X1 1XC6A 2QKDA 3GZUC 1C8M3 3FFZA 5E6HA 3AJZA 3TAYA 1DYKA 2BEOA 3AFGA 1JZ4A 5DABA 1LNSA 2RJ2A 3R4DB 5C6CA 4IV1B 2KA3A 1OXCA 3SCHA 3FX3A 4E2SA 3QD6A 3WHTA 5BNNC 3ENRA 3DN7A 1BZWA 4YGEA 5H9SA 3KS7A 3E97A 2WKKA 3D0JA 3PU3A 3ZFGA 4KG0A 5D8AC 2D43A 1ZM1A 3IPVA 4QHBA 4XFAA 3OPWA 2QQMA 4Y1ZA 2WA3A 4LO7A 3TN92 4QX2A 1VBB1 2RHPA 4AOCA 4IE0A 3OTFA 3HOBA 5JSRA 4MLOA 2PQQA 4CUCA 1E5HA 4QB1A 2JIJA 2VOWA 4IERA 3WDYA 1NCRC 4BWOA 5BNOB 3BIEA 2RMU2 5FY9A 1JU4A 5CISA 1DQ6A 4XF4A 3PVBB 5FZAA 3PL0A 3KT4A 3I2OA 1RL3A 4XQDA 5JPMB 4A42A 2ZGRA 5DZFA 1LOFC 2PAEA 1J83A 1C3HA 2DU1A 5E88A 3SEPA 4W4ZA 1GLHA 4HBNA 1GYKA 1US3A 1EYBA 1VBB3 2BUKA 2WSUA 2YHJA 3F95A 4M3CA 4WM8A 5FZ7A 2XL9A 4DUVA 1XPWA 1V70A 1UY3A 2PHUA 1JODA 3LOBA 3RPQA 2W47A 3IMNA 3MIBA 1H9WA 3MV11 4XFBA 3USUB 4FTBA 1W99A 1VMHA 4QPIA 1OKQA 5ANQA 1RMU1 4H2AA 2XLFA 4GALA 1UY1A 3FLTA 2EICA 4KWKA 5HBAA 4WV8A 4EYUA 5JUVA 4AHYA 4LMFA 4LEJA 3P5BA 3NL1A 4QX3A 3VBSC 3V0BA 1ZZ9A 1MZ6A 2GP3A 3NNLA 2L9LA 4KU8A 1F2NA 5EHDA 4A45A 4C1XA 4NAMA 4MGKE 4EWEA 4COZA 3U0ZA 1JXNA 1RUJ2 2VMEA 4ZU4A 5LRRA 1AYM2 3JU9A 1TE1B 3ACFA 3N36A 2PAMA 4Q4V2 4R9AA 4BYYA 3FLPA 1OHFA 4FOWA 2GC3A 4Z07A 1VAKA 1W6NA 1D2SA 1T6GC 1PZ7A 1W9FA 5A70A 5E8AA 3WQBA 5C4WB 3DYPA 1RVF2 2BV4A 5TSWA 2XVGA 2UWBA 2EIBA 2C9KA 2IXLA 3OUJA 4E4SA 4OUEA 1QU0A 1YUDA 5A3MA 4NN0A 1AR81 2DVDA 4RR3C 3IDAA 1NX9A 3JBG1 1UZWA 1XE0A 1MQTA 2IC1A 4Y1YA 5FBJA 2QVSB 4LLFA 1VRH1 4P02B 4AI0A 3MW4A 5KWRA 1QJFA
chains in the Genus database with same CATH topology
4OUSA 1PVC2 4UW3A 3P3NA 4YW2A 4IEVA 3IIAA 2WINB 1RUD1 3RQ0A 1ZZBA 4Q4X2 2YGLA 2EXHA 2LALA 5CFCC 4AK3A 1Q8VA 3M7AA 1X8MA 5FOBB 1VB2A 3NKGA 3JBG3 4Z92B 5BNPB 2I2SA 3PVOA 1PMIA 5A32A 1MZEA 5KXDA 1YFUA 1AF9A 1A6CA 4JGYB 4UBHA 3E6CC 2HWD1 1LOEA 2ZJCA 1MVQA 2GAUA 3SNMA 4RSUA 1UKGA 4XZPA 2WS92 4FVVA 2OYZA 4PCRA 3JB4C 3V65A 3W58A 1WLDA 4IESA 4XJ8A 3ZXKA 4CDQC 5BV6A 4XBNA 4JRAA 3AMNA 1MVEA 2RR12 5K8SA 1W6OB 1H1MA 3SH3A 3AXDA 2IZWA 1U5ZA 1KS4A 4Q8LA 2BWCA 2XLAA 4FP3A 5K0UA 4CEYA 4EN6B 4Q27A 1JTZX 2C9AA 2FBEA 2WZR1 3ILNA 2PHLA 2ES3A 1V9U3 1LKNA 4JGZB 3LA7A 4AVVA 4GWNA 3AP9A 4ATFA 1RMU2 1RUG1 5FLJA 2D6PA 1MZFA 5E16A 4BA6A 3UJQA 1DF0A 5JZGB 2X5IC 3DUIA 3OBRA 5J96B 2TNFA 1KJRA 3B5LB 1OSGA 4WM7A 2WZR3 1LESA 5BY5A 3GNEA 3U10A 4PDWA 1YI9A 3MPPG 2UWCA 1XNCA 4PIZA 5BUVA 3CNAA 1POV0 2YXSA 2E9QA 5A33A 3BCWA 4KGQA 2N7GA 4DOUA 2Z79A 1WLCA 1AR82 4XF0A 2XB6C 5FLHA 2ZAHA 3ZDSA 1VRH2 3M1HA 4GKYA 1X50A 4AFCA 3D0SA 3ZXAC 3ZFFC 4GMP0 3RDIA 4Y5Z0 4X6RB 4HVQA 2D40A 1ASJ1 4H55A 5FTTC 1O7FA 5DZEA 1DIWA 3VBHC 2EXJA 2D7FA 1S0GA 1NXD1 5T5LA 2JECA 1UN1A 4CDWC 2RE9A 4A7ZA 1ONAA 4HKOA 1U5IA 5T50A 3KGZA 1RUI1 2HWD2 1AVBA 3WW3A 2ZMNA 3AZVA 1PK6A 3K51A 4Z82A 5BXXA 2G4IA 4IV1C 1DYPA 1ASJ3 4F83A 3WINE 3IN9A 5ABJA 3WT3A 1YFWA 2DTWA 4OHVA 1ZBA2 2WLQA 1AXYA 1CAUB 1QKQA 3AX4A 3M8LA 2BNMA 3AKQA 4URTA 1MZ5A 1RUF2 1QNYA 1ZZ7A 2R0FA 2HWB1 2DCYA 2D3SA 4J6GA 4XQWA 4N7IA 2OZJA 2D6NA 3LGRA 5BNOC 1BJQA 4KGGA 3UKTA 2XJSA 5F9TA 1WW7A 4QQ2A 2A7AA 3VHRA 1QHDA 3V64A 1OPMA 4XFGA 3VBUA 4JDNA 3H7JA 4Y1UA 3ZFEA 2WT0A 2HWC1 1HDKA 3OCPA 4DY5A 3MZHA 1J59A 4BMEA 5KXBA 1RUG2 4IV3B 4BMBA 3DF0A 4FXGB 4B4QA 2NP0A 4YW3A 3GYDA 2GNBA 1HW5A 1PNGA 4AW7A 5C8WA 4FQZA 4Y22A 1QDCA 4LTAA 4L99A 4N53A 4W6WA 1C1LA 3FFQA 3WCSA 4LE3A 5FQ0B 4MX3A 4I02A 2ARBA 2C5DA 3THTA 3O0WA 1VBE2 2QDNA 4R52A 1QQP1 1RIRA 3BTAA 3NSTA 5E1RA 2MNGA 4G3YC 4KWLA 2VECA 4WZFA 4N43B 4UW5A 3WQ7A 4M00A 4XPVA 1MEC2 2VMIA 4YFWA 5I0RA 2ZMLA 4OI1A 3ZSMA 1UCXA 4AVSA 1RC6A 3VKFC 5C4WC 2D5FA 1CONA 2ZKLA 3BB6A 4XJWA 2Q4SA 1HQWA 3APBA 2H6BA 3NAPC 4KL1A 2JG9C 5A3LA 3QOPA 4FPEA 4EV0A 1R083 4HK8A 5JMCA 5GLVA 1O5UA 2GC0A 5JIUA 1LR5A 3S7EA 1C57A 4YFZA 5GZEA 3VBFB 2YYOA 4INDA 3FWEA 1G9DA 2PHRA 2VG9A 3J9SA 4XF3A 2CGPA 4AQSA 2HEWF 1REDA 3AYCA 2P3KA 1SEFA 2R1DA 1YRZA 3MF9A 5BNPC 1ZZ8A 1AR93 5T5JA 2YY1A 4I09A 3RYKA 1BBT2 3IPVB 4JGYC 5FFOC 4ZXKA 3E6BA 2GMPA 2VW2A 2D6KA 2JE9A 2HWB2 1UX6A 4J1XA 1VB4A 1PO12 1CD3G 1CPNA 5HI0A 4P9JA 3NWKA 5JOXA 1FOD3 5I93A 5DZGA 3D5OA 2HWE1 3KGLA 4HSJA 5CG9A 4AG4A 1QGLA 4COVA 2IFWA 3NV3A 1Z78A 4UW4A 2R1BA 4L11A 4WM8B 4M3CB 2E51A 3S7IA 4ATEA 4HANA 1AR63 1KFXL 1UD1A 1WW6A 2O1QA 4UBGA 2EF6A 4AVBA 4JGZC 4ISQA 3BALA 4QPIB 2R042 1D4M2 1IHMA 4AWDA 2HWE3 3POSA 4SLIA 3S0MA 2HWF3 3IKWA 1R1A1 4LBQA 1QJY2 4AEDA 4AEKA 4M3CE 1SQ4A 3V0BB 2BNOA 5JZGC 1LODA 4U2AA 3MEPA 4V1PA 1TME2 1AYN1 2RS11 3I4IA 3MW3A 1QQP2 4Y1VA 4BIOA 1UU6A 4H14A 5JI7A 4E9KA 2LUWA 1VJ2A 2QJVA 1NE4A 4DY3A 1W6NB 1N3PA 2PHXA 1WMDA 1R1A3 3VHNA 5JLVA 1DGWA 3ZO0B 3VZJA 1D0HA 4AF9A 4FPJA 4RHV1 1DLLA 1AXKA 2HJIA 4PBPA 1AHSA 4C1WA 1ZRRA 1K5MA 4AFAA 3WW4A 1XNBA 2IXCA 1AR71 3HQXA 4K7JA 4F7ZA 4BLJA 5D1IA 5I0SA 4AVCA 3AMHA 3V56A 3WDVA 4A3XA 1KDMA 2X53S 3ZXLA 1UPIA 5J36A 4X6QB 2JJ6A 4RHV3 2A75A 1CAXA 5GLZA 3VDDA 3ZYRA 1KD7A 2VNRA 3G7DA 1Z7S3 4HPKA 4AYUA 2R0HA 1XQNA 4RQPA 1LTEA 2UURA 1XNKA 3D82A 4LUMA 3MIHA 3ZXDA 1COV3 3WP5A 1F5FA 1HRV2 3TRSB 2R30A 4LBQD 1O3SA 1O91A 2D3RA 2WJSA 3QH7A 5DUUA 3AP5A 2A6XA 1FPN1 4FPGA 2R16A 4YZ5A 2E7TA 3QLQA 2JKBA 3BOWA 4PLMA 3MIGA 4YG3A 3I8TA 5H9PA 2GN7A 1W6QA 5C9AA 3D4KA 5K0UB 3ZMNA 4IQPA 4XILA 4CEYB 1LOBA 1SLIA 4RFT0 3AM2A 3CJIB 2ZKNA 4WVVA 4GKXA 1OA3A 1FPN3 4E4DX 4OI0A 4FOQA 4GB32 4XE9A 4NVPA 2E63A 1ULDA 4IV3C 2D6MA 1CX4A 3DL3A 1G6NA 3RG0A 1SLAA 4YM0A 2AREA 5GLTA 5FOJB 1AYN2 1HV0A 1D4VB 2RS12 4DNYA 4WM7B 3WUDA 3KB5A 1S0DA 5EZWA 4JC1A 1JYIA 4PDWB 3QBQA 1W6MA 3J8F2 3MFAA 5J98B 4LA2A 2LM3A 3TN91 1IS3A 2A3WA 3ZMOA 5A33B 1DBNA 4AQ2A 1A8DA 2XJQA 1IPJA 5CADA 5GZCA 3N7MA 5T55A 2RM22 4IEWA 2NMOA 2RMU1 3FJSA 4FP2A 3WDUA 4N43C 1U5XA 3B94A 3OD4A 4QX5A 5JOZA 1PHMA 3O12A 4FPKA 3W59A 4QU2A 3RMXA 4KU7A 4N9HA 1V6IA 4META 1H0BA 2DV9A 3AFKA 1J58A 1HXS3 4BM8A 2A70A 4JCKA 1I5ZA 2IXJA 2E6VA 3JQWA 3SLIA 4NPRA 4E2GA 2RMU3 4LO4B 3OY8A 2UY8A 4TSVA 2EXKA 3MYXA 4I0BA 2BNNA 4XTMA 4TZDA 3ZN6A 1W6PB 2I45A 3PJYA 4K40A 1PGW2 1WCDJ 2QCSB 5J7MA 3NJZA 4B3NA 3VBFC 2A6ZA 4HKWA 1NLRA 5DG2A 1PK6B 4M01A 1O5LA 4HSLA 4YZ4A 5ABJB 1N3QA 1MS3A 1RUJ1 3O0XA 5L7OA 3H3ZA 1RUH2 4K6BA 1AYM1 4P9WA 4RL7A 4YVSB 4I0AA 4Q4V1 5HCAA 1JHNA 2P3JA 1N1TA 3WP6A 2YDEA 1UU4A 3AKTA 3LKJA 4MYEA 2WT1A 4XBQA 3KSCA 3M4FA 5FMOL 1RVF1 5C6CA 4FPYA 1KXGA 1Q8QA 3Q9OA 3PJQA 5KBFA 4ASMB 1WCSA 4YNIA 3ZPYA 4XFIA 4XOGA 2B7YA 3PLQA 3MPBA 1RUJ3 3VBUB 1AYM3 4CP0A 1FNYA 3ZFEB 3MGUA 4Q4V3 1PVC1 4CP1A 4JDOA 2Q0AA 2QUOA 5KWRA 3RI8A 1CVNA 3I59A 2A6WA 4WM8C 4YSFA 1CGPA 5KHIA 1RVF3 3UKVA 3VL8A 1HQLA 2VUJA 1Q5OA 4Y22B 4QM9A 1MS4A 5SV8A 2GC2A 5F1RA 1X33A 4ES8A 4K20A 2W08A 4QPIC 3L9JT 4EWAA 1HQNA 1ZNPA 2PTMA 4Y24A 2E7QA 4FPHA 1PVC3 1LHNA 1JYCA 4Q4X3 1BMV2 1EAH1 1Y3TA 3NO8A 1DQ4A 1GZWA 1X7NA 2WS91 2ZX2A 2V09A 3ACLA 3AYEA 3IT8A 4IEXA 3WR0A 3H1WA 2D98A 2ILMA 3SH4A 2B45X 4PJYA 1QY4A 4GWMA 2RR11 2JD4A 3ES4A 5I0TA 2EA7A 4IEZA 1VLNA 1EPZA 1JH5A 1EP0A 5CFDA 4G4FA 3UK9A 4KG8A 5H9RA 5J48A 3HWJA 4DPNA 1GFF2 3WP4A 2GALA 4JQRA 3RNSA 4FOVA 1TEIA 2V5YA 1S0BA 1BEV1 2VMHA 3KZ4C 1GSLA 3HBZA 5KHGA 1C5IA 4EROA 1CAWA 1RUOA 4CP2A 5K9YA 1NZCA 1GNZA 5F5QA 4AHWA 4Q0UA 1G9BA 1H1IA 2WA4A 1ND3A 1ZX5A 2NM1A 1OLQA 1VBC2 1AUYA 2A5ZA 1DU3D 3NVCA 4XIOA 4Q0PA 4OHWA 1RMU3 2G9GA 1AXZA 2DVFA 1QF3A 4ISRA 2YUEA 4Q26A 5GALA 4D7TA 1O3QA 2XJUA 3UV9A 5DDJ2 1J1LA 3LB9A 3S30A 1BKZA 3UJOA 1W2UA 3ZSLA 4KBBA 2P2KA 2DWRA 2GSYA 1NCRA 1X36A 2FHRA 3KM5A 4HZFA 4DINB 3I54A 2ZTNA 3DGTA 1WD4A 4COYA 4FCAA 1PZ8A 1S0EA 1QJU2 5K0UC 5IK5A 3SISA 4CEYC 1RUNA 3CJIC 1AR83 4S2DA 5I8SA 2WNUB 1ZYBA 5JOYA 2XPJA 1D0GA 2B8MA 2VOVA 2GMMA 3H3UA 2VVEA 5EJ3A 3WQ1A 5J3UA 2H0BA 5AVPA 3UKNA 1FV3A 1VRH3 1SMVA 4LBQB 1IS4A 5KHHA 4OZXA 3POYA 5KHKA 1RUD3 2A6YA 4X8NA 4YM2A 1EAH2 5LK5A 4P9YA 4WM7C 4CRQA 4A7YA 1ZBA1 3SMHA 3KCXA 2GC1A 4K9SA 4PDWC 3KT7A 1ZBE2 1OMIA 3ZX7A 4LBKA 2ZOEB 3MI8A 1RUF1 2FZ2A 3RYPA 2W52A 2HWD3 4GQ7A 3GBGA 5F6KA 4MXWA 3V0AA 4OHZA 4EJRA 4O9GA 5AC92 3IBMA 2YC0A 3VZKA 1ZBA3 1FXZA 1K5MB 3VZMA 1FAYA 1BEV2 2HEYF 2PFWA 5JVVA 1XE7A 4Q0SA 4C90A 1UF2C 3RMYA 1RUF3 2OW4A 1OQEA 3ELNA 1PGL2 2NLRA 1V6JA 1MS1A 3ZIWA 4OHXA 4E2QA 3OYWA 4UW6A 1H2LA 3QCWA 1PVXA 1CAXB 1LGCA 1RITA 2XVKA 4S2GA 3VDDB 2CV6A 4QM8A 1EY2A 3TWIA 2ENRA 4HPKB 4RQPB 4AFMA 4XTPA 3IDBB 4YVWA 1RUG3 1V6KA 1XE8A 3AYAA 4B4RA 1POV1 1QH6A 1RHI2 2JENA 1PK6C 1QOSA 1SBFA 1VBE1 4XMAA 5ABJC 2ET1A 2WC2A 2XG3A 2ZGNA 4GH4B 1HIXA 4L2NA 4YVSC 4QPGA 3B9CA 4JDMA 1MEC1 2CAVA 1CJDA 2GN3A 5FO9B 2WZPP 1MS5A 3IDCB 3WUCA 4OFGA 2UYAA 1W6QB 2EVXA 3VLBB 4GMP1 2VNOA 4SBVA 1VBE3 1SBDA 3EBRA 4IEUA 2WNVA 1DZTA 4FXKB 1KITA 4I2OA 2B5HA 3FUQA 5I8YA 5CVRA 1JOJA 3VBUC 2O8QA 1AX0A 2RJKA 3M3CA 1BK1A 3ZFEC 1MEC3 2AZ5A 3VZOA 3JD71 1AL0G 4HMZA 1S0JA 5FPXA 2IWGB 1RINA 1I6XA 4Y26A 2Y0IA 4PBOA 1Q8SA 4COUA 4Q8KA 4D69A 3A0KA 4XF9A 1OOPA 4FPFA 4LULA 3WXPA 2X5IA 5GZDA 1OA4A 2XWBB 1BBT1 1W6MB 3J4UH 2ZPXA 3EHKA 2DYCA 1WUVA 1F5JA 4YZ1A 1SLTA 4M3CF 1RUI3 3D8CA 2R32A 1J3RA 3GBFA 4N90A 1HX6A 1PO11 1URXA 1ZZ6A 4Y20A 2RS52 4W6YA 3CF6E 2XLGA 1QNWA 2ZX1A 4QQHA 1N1SA 4LBLA 1Y43B 4LBMA 1V9U2 2XJRA 1BBT3 3KCYA 4R9DA 4DMIA 3N35A 4Z8BA 3AKPA 4IEQA 3N7LA 4Q4Y1 3U4XA 4FTSA 1IGOA 1V6LA 4I01A 3R4SA 2HWB3 1QXPA 1W0OA 1ZA4A 2DVBA 2F4PA 3ZFFA 3OY8B 1PO13 4HK9A 1JW6A 1S2BA 3AK0A 3ZN6B 1KJLA 2R041 1D4M1 3AYDA 3B9IA 3ZYJB 1APNA 2YGMA 5L36A 4AGGA 3VBHA 2ZGLA 1FMD1 3H7YA 4XEZA 3N4MA 2Y38A 4AQ6A 2HWC3 1QJY1 3CJXA 3EJKA 3ZXEA 1ND2A 3VKNA 4DRRA 1TME1 4FAGA 1UZYA 3ZN5A 2JE7A 5L7OB 3LCPA 4L92A 2FMYA 4NHKA 2R043 3JB8A 4ASLA 1Z0HA 3WDWA 1H9PA 1QJY3 1H30A 1F31A 3ZN4A 3FE5A 1XU2A 1H4HA 2VW0A 4QGLA 3LOIA 3ES1A 1U0AA 2BYVE 1IS6A 2GH8A 5EWSA 2BVVA 3WD5A 3WG3A 1FATA 1QQP3 4AGVA 2JG8A 5T3NA 1YFXA 4RA0A 1UZZA 1YCIA 2PYTA 4OI4A 2DTYA 2I07B 3I59B 5IK8A 3JD72 2AR6A 2GNMA 2PN5A 4LO5B 1O4TA 1GQHA 1LEDA 3MICA 1M4WA 1YIFA 1RUC2 3H0OA 1LHWA 4YGDA 3B02A 2BFUL 5DUVA 3L2HA 3M2MA 2WNUC 1GQGA 4Q0QA 2VW1A 2NMNA 3ZFGB 2Q8OA 4Q4W2 1ZRCA 1NQJA 2EAAA 3RZZA 1NE6A 1PGSA 5FPZA 1VBA2 2GNTA 2DVAA 1GZWB 1HRV1 3HT1A 1QJX1 3ZVXA 4YARA 5C8CA 2QFEA 5JI9A 5FO7B 2ZHMA 5BYNA 1IS5A 4LT5A 4XBLA 4E4ZA 2WWSA 2R072 2ZGSA 3LA2A 1VAVA 2PA7A 5CFDB 4CDUA 4Q4Y2 4LO8A 2D44A 4HT1T 1XYOA 1NYWA 1HRV3 3VBRA 2D97A 3AXEA 3N7JA 4IEPA 5HCBA 4A2UA 2PHDA 1K5MC 1Q8OA 4XHXA 4B7KA 3THPA 4GB31 1ZVFA 1S0IA 4ITCA 2XWJB 4W65A 3WX5A 2JXAA 3AMQA 3TNQA 2EXIA 1CAWB 1FMD2 3NAPA 2JG9A 4YLZA 1BVVA 3JUUA 5EYXA 4EWDA 1PZ9A 3U11A 4AEJA 1TMF2 1UW8A 2VVDA 4XFCA 4XHBA 4HN0A 1H8VA 2P34A 3RYRA 5JR7B 1YI7A 3VBOA 3VDDC 3OGGA 4FPOB 4FPCA 2QZ3A 1VP6A 2GH2A 4NWVA 1N47A 2VH9A 4GB33 2VQAA 2WFPA 1SCSA 4JV4A 1QMJA 4RQPC 3J8F1 3ST7A 2BBVA 2D3PA 4FSJA 3NV1A 3GBWA 3IWZA 4H3WA 4P14A 1G9CA 4AHZA 2VQ0A 1RB8G 2RM21 1NA1A 3RJRA 1AYN3 5JWPA 3WHUA 4GH4C 2RS13 1MQTB 3OD0A 3HR9A 4P5HA 1BYHA 1YFYA 1DZQA 3J8F3 4QGMA 3MIEA 3O7OA 1FX5A 1LJ7A 2GNDA 3CEWA 2PLV1 4YW1A 1SFYA 2RM23 3NV4A 3CLPA 2ZZQA 1HRI2 1TQ5A 1XU1A 1PGW1 2Z5WA 5A32B 2VPVA 3MIDA 1AR73 3OJBA 4YM3A 4I3PA 1PIV2 5GKAC 1W0PA 2BGCA 4XFFA 3T2TA 1JBCA 3URFA 4NHMA 1UIKA 3NW4A 1QJX2 4AFBA 3P3PA 1UKRA 4XETA 2DFCA 5EFUA 1RUH1 5F6LB 4D3WA 3WP3A 1B35A 1YWKA 4AI1A 1D2QA 4YG6A 2A6VA 4LNVA 4R8HA 4ZU5A 3ME2A 4K1ZA 2C0ZA 1M06G 3ASIA 4CDXA 1DHKB 1VBD2 4ORFA 3ALQA 4MXWB 5FLIA 4RD7A 3V0AB 4PQ9A 2ETEA 2DVGA 1W39A 2RJLA 1AJOA 3KMHA 5FREA 5CG8A 4LR4A 3B7MA 4NO4A 2F6BA 3WDTA 2XKOA 3EO6A 2QE3A 3DKWA 1KRIA 4OI2A 4IEOA 1H8TA 1LECA 4YGCA 1X8EA 3ATGA 1GICA 4RS5A 4LBNA 3T1LA 3KLSA 3M3EA 1LGNA 3C2UA 4BCUA 3OYWB 2XJPA 4TLFA 1SBEA 4IETA 3WDXA 3A0NA 5ACA2 4XDQA 4PLOA 3ROUA 1LHUA 2VU9A 2R49A 1RJ8A 4I0WB 4WVMA 4YVWB 1GANA 3NV2A 2DCTA 1H2MA 1BMV1 2FMDA 3M3IA 1V6MA 2YZ4A 4WVWA 1O3RA 5L7OC 1WCKA 4AE2A 4Q1RA 4QPGB 1OQDA 4AVTA 3WCRA 1CAVA 2K9ZA 2R6QA 1RUE2 1Q3EA 3TN93 3USSA 1QOOA 4P9LA 3A4UA 1Y9QA 4M0NA 2WNVB 2PLV2 1AJKA 4K21A 1LENA 5FAXA 3FMGA 2BPA2 3SXWA 4DQAA 5JSOA 4FPLA 4XFHA 1AL22 1R091 2ZGOA 2ZCWA 3M70A 1FYUA 2A73B 5I0UA 2JDZA 4AI3A 4TWTA 4XQ4A 1ENQA 4K3UA 2YROA 2OIIA 1OOPB 4DS0A 2AUYA 3RWNA 2X5IB 3PHMA 1VBC1 1ZRDA 3ZFGC 2ZS6B 1Q43A 4MVTA 4PLNA 3H50A 4OLLA 2ZX4A 1S1AA 3EQEA 5FQ0A 1GKBA 5JPNB 3CU7A 2YPJA 1XYPA 2X29A 4KH9A 4H7LA 1L3JA 5DDJ1 1C8NA 4Y20B 4AVAA 5AFBA 1F9KA 4O9EA 1HKDA 1VBC3 3FBYA 3HIFA 2CWSA 2OA2A 1REEA 2AENA 4N43A 1WD3A 5CFDC 4WZCA 3ILFA 1X82A 4N9IA 4YW4A 1QJU1 3R05A 4MSVA 1XNDA 4Z2WA 4AGRA 4RGGA 1GNHA 1DZRA 4MGYE 5GLUA 1C8M1 3S6PA 4CEWA 1ZZCA 4QQPA 2H0VA 4JRLA 4N53B 5DDJ3 1GZCA 4EN9B 3QH6A 2XJVA 4XJUA 3G6JB 3MW2A 5JOWA 2X8KA 3HD8B 1ULFA 4HETA 4B8EA 1ND2B 2P3IA 1QJU3 1NY72 4AEMA 4C0BA 2C1FA 5SV5A 3SITA 5CAZA 3O0VA 5LRSA 2A71A 3UL2A 3B69A 1MS0A 5KXCA 3I2DA 3R0RA 2NYYA 1ZBE1 5DUXA 3DPRA 1NCQA 2P17A 4UXAA 3ECQA 4A7KA 3E5XA 3BU7A 4TYSA 1N1YA 3RI9A 4XMIA 5GZGA 3ZXGA 1HXS2 2JEMA 3AZYA 4AQTA 1EAH3 2RS32 1KDKA 2WS93 2ZX0A 3GHMA 1MQTC 5FMOS 2JG8B 3WG4A 3WZ1A 5AC91 1ZREA 3ZSKA 1DG6A 2XBO2 1V00A 4KNCA 3WG1A 2PELA 2RR13 5J09A 1R092 1ZBE3 2HYKA 2B9UA 4NWWA 4WBBA 1YNAA 1PGL1 2DCZA 3FZ3A 3PNAA 1ALYA 3TOJA 4YW5A 3WY6A 5FDBA 3H1MA 4KWJA 5KHJA 3MLLA 5AC93 3KCCA 2ZGTA 2G9FA 3TYJA 1BEV3 1NG0A 3MIFA 3WLUA 4QD2A 4BHPA 2GMEA 1EV12 5BNNA 5EYYA 1JUHA 1RHI1 3QACA 3AP4A 2R062 4MH0E 4LUKA 5D8AA 3VZLA 5C8CB 4H7MA 4D7SA 2ARXA 1XXNA 2KXLA 3I7DA 1PO22 1ULCA 2WFF2 3WOGA 3OGJA 2XH6A 3KD4A 2D93A 4YYOA 2DFBA 1CESA 2ZX3A 2DURA 1YXWA 4CDUB 4PF5A 2ZGUA 1IOAA 2VY0A 2MEV2 1U5YA 3LSDA 1RHI3 1LOFA 2CTVA 4P9XA 1AZDA 1O4YA 3VBRB 1C8M2 1DQ5A 1NOVA 1IZ3A 5JSPA 3PMSA 5T5PA 5KXEA 4AI2A 4CYDA 3H1YA 4FO9A 3T1MA 3ETQA 3NAPB 5J37A 5B2GB 2JG9B 1N3OA 1A78A 1LU2A 2NPIA 2Z42A 2XL7A 4I3GA 4AEDB 3ZIXA 1SACA 4OULA 1I3HA 3PMEA 1S0CA 5CA6A 4DZGA 3VBOB 4YRDA 1EPWA 2QZ2A 2LTNA 5L19A 1BVP1 3M3QA 5CIRA 5H9QA 3BOPA 3VBSA 4P9IA 4YZ2A 1U12A 2CL2A 4YVWC 1H4GA 3GHNA 3C3VA 3AZWA 2TEPA 4GIQA 4QPYA 1OFNA 4EN8B 3H9AA 5CNAA 1ULEA 5GZFA 4FTBA 1NA1B 1UPSA 1VBB2 2WNEA 4KQ7A 1G9AA 4QPGC 2RS51 4XF1A 2Q1ZB 3CO2A 3BIWE 3BPZA 2E7AA 4L8QA 4DB5A 1V9U1 4RR3A 4AHXA 2WQZC 4NOTA 3OF1A 5LEKA 4MXVA 2WNVC 2V73A 4IL7A 1UL9A 3ZSEA 2RS53 1S55A 5CFCA 2DCJA 3CJIA 4W6XA 5EV7A 2ZHKA 2ZZJA 5C33A 1O4ZA 1V6OA 4Q29A 5IK4A 2Z69A 3SCFA 4AFDA 4BZ4A 1C1FA 2TUNA 4K8FA 1KQRA 1OOPC 3AKRA 2XJTA 4S2HA 1B35B 1UIJA 2CGOA 4CDQA 1LOAA 3L2YA 5GLWA 4CDXB 5I91A 5KC5A 5C9AB 2W68A 1OI6A 1POV3 4BH9A 1H2NA 1ZRFA 1YO8A 4HKLA 1SFNA 3B01A 3INAA 2BW8A 3SHRA 4BOWA 2CWMA 1WMFA 3PTYA 5K7PA 2ZACA 1YHFA 3O14A 3RSJA 1H8TB 2XKPA 3RS6A 3ZYIB 3JBG2 4ONUA 3MF6A 5DUWA 4RS5B 1Q56A 5L73A 4OUMA 4BQ1A 4HN1A 4HVRA 5HCFA 3VUOA 1YIPA 2ZAAA 4GMP3 1RUC1 3WW2A 3VGIA 4Y4YA 4GA9A 4N53C 1RUD2 1LCLA 4YZ3A 4LA3A 4R4XA 3E5UA 5DXDA 1KS5A 2OPKA 4WVMB 1FV2A