1HV0A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYFVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv0A00
1AXKA 4HK9A 1OA2A 2B45X 3VZKA 2Z79A 1TE1B 2NQYA 3RI8A 3AMNA 1W2UA 1BVVA 1REEA 1XXNA 3MFAA 2DFBA 4S2FA 2QZ2A 3VL8A 1BCXA 2DCZA 3LB9A 4NPRA 4S2HA 3VGIA 3RI9A 1REFA 3WR0A 4HKWA 3M4FA 1M4WA 3MFCA 2D97A 2VG9A 3VL9A 3VHOA 1HIXA 4HKOA 3AKSA 2F6BA 3MF6A 1UU6A 1XNCA 2B46X 2BWAA 2DCJA 1C5IA 3B7MA 3MF9A 1BK1A 4S2DA 3AMPA 3O7OA 1XNKA 3VZOA 1QH6A 3B5LB 4IXLA 1KS5A 1OLRA 2NLRA 2DCKA 3WQ1A 3VZLA 3WP4A 2QZ3A 1OA4A 1XYOA 4S2GA 3VZMA 3ZSEA 1IGOA 2JEMA 1PVXA 1UKRA 3WXPA 3WQ7A 1HV0A 1HV1A 1OA3A 2BW8A 5K9YA 3LGRA 3WP6A 3WY6A 2DCYA 2VGDA 2JENA 3HD8B 4XQWA 3EXUA 2BWCA 4XQ4A 3VZJA 1H4HA 4HKLA 3AMQA 1XNDA 3WP5A 1XNBA 2VULA 1H8VA 5EJ3A 3AKTA 4H7MA 1NLRA 2VUJA 1QH7A 1C5HA 3AMMA 4XPVA 1H1AA 1YNAA 1H4GA 2B42B 3AKPA 2JICA 1OLQA 2BVVA 3WX5A 3AKRA 2DFCA 2D98A 3WT3A 3VHNA 3VLBB 5K7PA 1T6GC 3AKQA 1KS4A 1UU5A 1F5JA 1XYPA 3AMHA 5HXVA 2C1FA 3WP3A 3VHPA 1REDA 4XQDA 3VZNA 1XYNA 1ENXA 3WQ0A 4HK8A 1UU4A 1H0BA
chains in the Genus database with same CATH superfamily
1E5RA 1F31A 2RMU2 3B3QE 1K5MC 3N7MA 4P9WA 4Q26A 4Y1VA 1BMV1 1JYTA 1OOPA 5LY1A 1TE1B 5TSWA 5FMOS 4IW3A 3RVHA 1E5IA 4GJZA 2RVAA 3GBFA 4YARA 4C90A 4PF1A 1UW8A 3CIHA 4YGDA 1WCUA 4NHXA 5EXOA 4NPRA 4RQPA 3TNQA 3CMGA 4E4HA 1UIKA 3JD71 2BFUS 5CKMA 2ZBJA 2GMPA 4L97A 4A2UA 1S2EA 1M4WA 4QX8A 1WLCA 2V73A 5JUVA 4CTEA 3UKTA 3UGGA 2AEZA 4FSJA 2AENA 3NL1A 4Q0VA 4E4ZA 2EF6A 2KA3A 3DPRA 3ZYFA 4HKOA 3BTZA 4BLIA 4N7UA 4LITA 3PUAA 3U14A 1RUI2 1AF9A 5FIXA 2D5FA 4L11A 1AYM3 3ZR5A 1DLLA 3PDQA 2P34A 4Y24A 5JZGC 1WCQA 5FYCA 1H6XA 3M70A 3TN92 1O4ZA 1G86A 4M0HA 1POQA 5T3NA 4BH9A 1U5YA 1I5ZA 1NQJA 3WHUA 1EUTA 4NWWA 1VMJA 4MXVA 1RMU3 4HL0A 2R0FA 1QQP2 2YY1A 4YZ3A 4BQWA 4WM8B 5FPLA 4G9SB 4EWAA 4RS5B 1VR3A 1POV3 2JD4A 4LBLA 4QPIB 1JOBA 4ZU7A 1VRH2 4WVMB 3GBWA 4I09A 3SEEA 1VBE1 1UKRA 3FBYA 4ZHNA 1PMHX 1ULEA 2HH9A 2W95A 2ZTNA 3P1IA 5F6KA 4M3CE 4LK7A 4PQ9A 1K5JA 3BI3A 2DCYA 2JDYA 2WO3A 4ZU4A 4UT5A 5HCFA 2RG4A 5E89A 3BKZA 4DZGA 2AGSA 2VQUA 1WA4A 2E7AA 4TXWA 3NKTA 1X33A 4Y26A 3ZN4A 3JU9A 2ZMLA 3L9JT 4MV2A 2YFZA 1VB4A 2UU8A 2WSVA 3KHCA 3IB3A 4META 3H1YA 5A32B 1PVC2 3WNMA 3DUIA 3QH6A 3RZKA 3W21A 1PK6B 2FDKA 2CTVA 3ZFFB 5CG9A 4N9IA 1GV9A 2B42B 1UQXA 3VKFC 3NJXA 2DFCA 2YMZA 5A7PA 5LK5A 5FP8A 2JG9A 4GMP3 3KF5A 3TYJA 1DZTA 4NO4A 1RJ7A 3AYCA 4JHZA 5FZBA 1QJY3 3A21A 3VKLA 1MS5A 5JIUA 5GKAC 2E7TA 1IKQA 4BMBA 1KRIA 4GWIA 2A5ZA 3WW3A 4DRRA 1QJX3 4Q8LA 4QM8A 4AFMA 4EWEA 2ADEA 2MEV3 2QQWA 3FZ3A 1JU3A 2NM1A 3OBTA 4A3XA 2R072 1VMHA 2G9FA 1X50A 4XUOA 5CFDB 4NR1A 1YHFA 1SCRA 1AXKA 3GXUA 5A7OA 3VZKA 2DWRA 4RHV3 2NQYA 1ASJ1 3H7JA 1C3HA 1MS3A 2BNNA 3AK0A 4LKDA 1V9U2 1J3RA 1J3QA 1VMFA 2HWD2 4UFHA 1OKQA 4EN0A 4Y20A 1OURA 2RR11 3QBQA 4QXHA 3MFAA 5KHGA 4C0HA 2ZGQA 2EAAA 1AUYA 1TME1 1HQWA 4BE3A 4FOYA 2Q4SA 3B9IA 3SNMA 4N53A 2RHPA 4LUKA 3OPZA 4YW3A 4GIQA 5KBFA 5FMDA 4I01A 2GSYA 1CZTA 3I2KA 3IKWA 2IZWA 3WG4A 5HPOA 4QX2A 1CX4A 4N43C 4U36A 2BERA 4AFDA 1UPIA 2C5DA 2B39A 4XVHA 3RPQA 2B46X 1QJFA 5FO7B 5JOXA 4FTSA 5IT6A 3BTXA 1G6NA 3CJIA 2VUAA 4UFLA 1APNA 3AMPA 5FQ0A 3KV6A 1IQAA 1W2OA 3F95A 1BEV1 2PHDA 1ZZ9A 4IXLA 3LSDA 1V6OA 2XBO1 5EPAA 3WNXA 3I4IA 2PELA 5BNOB 2WLPA 4CP1A 3KB5A 3BB6A 4E4DX 3TBDA 4IEZA 5AC93 5FCCA 3WQBA 1YIPA 2N7GA 3S5QA 4YPJA 5C3SA 5EYYA 3ZN6B 4S2GA 2QQUA 5DZEA 1LNSA 4NIAA 5C8CA 3KHBA 3VHRA 3I97A 1DLCA 3PVNA 4FPKA 4YM0A 1US2A 5A7QA 4OI1A 2O8OA 2BOJA 4XF1A 3CU7A 4QXBA 3UETA 2BBAA 3AZXA 2BZDA 2WZR3 3HT2A 2GDFA 3ETQA 5ABJA 1RHI3 4CCMA 1CAWA 3IDBB 5FYHA 5A6XA 1GQHA 2R043 3SITA 2LS6A 4UBHA 1ZRFA 3FJSA 5ACA1 1EYBA 1JS9A 4W6XA 2JIGA 3P6BA 1HRV2 3K4DA 4FFGA 4A41A 1BZWA 3ACIA 5FYUA 2WZPP 4YSFA 4Z1VA 2VQ0A 3KT1A 2XVKA 3F2ZA 4AE2A 4IEQA 4EROA 1YNAA 3B01A 1UY2A 3IPVA 4J25A 4M4PA 4OI2A 4X8NA 5T5PA 3ZSMA 3A7QA 3LD8A 5LATA 4D7SA 3PJYA 4BJ0A 2D98A 3BCWA 3KWVA 5HCBA 4FXKB 2Q0AA 4BQYA 5A3UA 1TNRA 1YEWA 1XE7A 3ZR6A 5IK4A 1X8EA 2QDRA 2RS12 1KS4A 3GZAA 2V09A 1XYPA 3ON7A 4Q4X2 1U5XA 4CYDA 3INAA 1PGW2 3LPFA 5HXVA 4MG2A 5IFPA 3KLSA 4CU9A 2OA2A 1A3KA 3AXEA 3WF1A 2WO2A 3HQRA 5FZ6A 1NCRC 1OLME 2VZRA 4KMQA 1W90A 1MEC1 2HBUA 1FPN1 2A3YA 3MIDA 3MIGA 3OBZA 4IDZA 4WM7A 4YG3A 4AWDA 4DUXA 1AYN3 4ITCA 2WNUB 1HKDA 2XQXA 1G9CA 1GNZA 2QVSB 3MLKA 5FREA 5FZDA 3S0MA 1G9FA 4AQTA 3JD72 1PX3A 1HDKA 3VKMA 5C3OA 2JDPA 1V00A 3WLUA 4OHYA 4Z2AA 1AR73 4NRQA 5FP4A 2HWB3 4FOVA 4L92A 4XDOA 1NCQB 4D6SA 3E6BA 3LA3A 1W8OA 2NMOA 2JDKA 3NV3A 1W6OA 4XE9A 1BQPA 3ZXKA 4BMEA 4CUAA 1L3JA 3HPNA 2RJLA 2DCZA 4P02B 5JPNB 1XPWA 1OOPC 4K3UA 5LW9A 1UOGA 1HW5A 1C1FA 2QKDA 1VBC3 1CAUA 1N1SA 3MFCA 2VBBA 2VOXA 5C8WA 4JDNA 3NNFA 1BBT3 3GBGA 1O8SA 4BB3A 1VB2A 4UAPA 5EV7A 3PL0A 4RQPC 2XLGA 4Q4Y3 2XHKA 1QJU1 2MNGA 2WZ8A 3LQCA 3ABZA 3TB0A 4Q0UA 1NAEA 1VBB3 2ZEYA 3C2UA 3NQHA 4JCKA 5LB6A 5FZ9A 2Y6LA 4YGBA 5GLZA 3V0BB 1UZWA 1QIQA 5T55A 1XNKA 5KHKA 3HOBA 3RZLA 4NMIA 3B5LB 1VBD1 2GU9A 2VE1A 2FDFA 1W8HA 1KJLA 5GZEA 1DFQA 1JYCA 1VBE2 4DS0A 1HXS1 1CESA 2YV8A 2NLRA 3AZYA 3BOPA 3J7HA 4IV1B 4QKFA 4RFT0 4NN0A 2RS33 1GZCA 5FZ3A 4LBOA 3T2PA 3BIWE 1NA1A 3DXTA 1MS9A 4ASMB 5JR2A 1JMUB 5T5OA 4HVQA 1DIWA 5IHRA 4LKSA 5BXXA 5M0TA 1UZ0A 2ZEZA 3ZSEA 3UK9A 4IEWA 3G6JB 4Y33A 4KBBA 4QMAA 3D6EA 1ZZCA 3WQ7A 5FPAA 1OA3A 2ETEA 2WNVA 3C7GA 2VD7A 3CL1A 4R9BA 1NXD1 1C8M1 1V0AA 2P1BA 4L0PA 4CDXB 1BYHA 3MW4A 3LE0A 3MPPG 5CKNA 1UY3A 3OUIA 4XQ4A 3U1XA 2H0VA 3PTRB 3NKGA 4LXLA 5F5QA 2CU5A 2FHRA 5IVVA 1CIWA 3VD5A 5FOBB 1EV13 4AXOA 1GANA 4LIVA 1G9AA 1BLZA 1O5UA 4PIXA 5KHJA 3NO8A 3IWZA 1RUJ1 4JAAA 1UYXA 3K77A 4FFHA 1JZ7A 1OVSA 3ZFGA 4AHZA 1ZX5A 4DY3A 1CX1A 3VDBA 3D4KA 5A3MA 5JLVA 4HPKA 4JDOA 3UJOA 2VZPA 2OKXA 3HQUA 3I3EA 4XJZA 5BY5A 3KVAA 5C5TA 2F17A 4XCAA 2FDJA 1W6PA 5E16A 5A3TA 1LULA 2AZ5A 1D4M1 2XLFA 4LEJA 2YB7A 3I2JA 3IIIA 2XJRA 1ASJ2 3SH5A 2QTWB 4AI3A 2ZHNA 5CZKA 2X5IA 2JG9C 2G9GA 1F9KA 2VZVA 3K3NA 2F4LA 2VMDA 4IEUA 4KI5M 5CEHA 1YCIA 4Q29A 3N7KA 3BGAA 4EQVA 4FCAA 5I8SA 1CONA 4ATFA 3AL5A 3E97A 4PCRA 5L7OA 2Q1FA 5FFOC 1OF4A 1G9BA 3M3QA 1UD1A 4NPMA 4Q2FA 3QCWA 1C8NA 4ISQA 4Q4W2 1O7FA 1HQNA 5FY5A 5IWFA 4F3JA 2HYXA 1SHWB 1CJDA 5FXXA 2A6YA 4P00B 3SHRA 3T1MA 2NYYA 4AEDB 1YC61 5JR7B 1SEFA 3UGHA 2Q8CA 2E53A 1UY4A 4QAWA 1R083 5LBFA 2DVBA 1ZVFA 3JCIA 3D3AA 3H8UA 4HKWA 4LOTA 4NRMA 2YC0A 3T4HB 4Z92B 1WCSA 4BIOA 2DVAA 2EIBA 4YFWA 1BEV2 3E1F1 3USUA 4JGYB 2GN3A 1JN2P 1YIFA 3CO2A 4C8DA 4DY5A 5F5IA 1E5HA 1FMD2 1U5IA 1UF2C 1URXA 4LE3A 5GZCA 2DCJA 4H14A 1KFUL 4N53C 4GAZA 3VBFB 1UO9A 5CAZA 4UOJA 4DIQA 4NWVA 4C1WA 4A4AA 4YRDA 3HQXA 2WNEA 3JQXA 4MHUA 4XUTA 5T52A 2Q8EA 1VIWB 4AVCA 3AZVA 2RMU1 1LOEA 4FOQA 3CJIC 3E6DA 1SBEA 5FWJA 4EN6B 3PUIA 5FP7A 1FXZA 2W5FA 4PLNA 2ZGNA 2YUEA 1U12A 1C57A 2L9LA 2IFRA 4PQQA 4QPGB 5F7UA 2VZSA 2HWF2 2ERFA 4AZZA 4XXAA 3ZLIA 2LTNA 1SFPA 3HVDA 4I30A 4BQ1A 4D69A 1JW6A 1EP0A 2VGDA 4BK5A 5DDJ3 2XMLA 1UZZA 1ENSA 2VMGA 4YVWB 2J1VA 1UZVA 4O61A 5C8CC 3EBRA 5F3EA 3N9MA 1UZYA 2PLV2 3OEBA 3RQ0A 3VZJA 1H4HA 2OIIA 1CZVA 4LBQA 5DUWA 1H8TA 1S4CA 4MUVA 2O14A 5ABJC 4Q1RA 5D2AA 1RUI1 3U4XA 3CF6E 1OF3A 2XL7A 2MPFA 1N47A 4I3GA 2OX0A 5FZCA 1RUH1 4AI8A 4AVVA 3AMMA 1GWKA 4XETA 3TWIA 3ROUA 1Z0HA 4BLJA 3TN91 4ES9A 4OZOA 3I49A 1CAXA 4CEWB 1H2KA 4GA9A 2W0XA 1UYYA 1J3PA 3KD4A 5LEKA 2RR13 2LM3A 1ULCA 1QQP1 3W58A 5FYMA 1WBFA 3H42B 1PNFA 1W99A 3VKNA 1RXGA 2NP0A 1EUUA 1IS5A 3JB4C 4FQZA 2UWCA 1QOSA 4GH4A 4HG6B 1VRH1 4BWOA 4CCNA 5FYZA 3HNYM 5GLVA 3T2OA 4MVTA 2WT1A 3WP3A 4E4SA 5K8SA 4MGQA 5J96B 4QDQA 5A33A 2Q8OA 4LT5A 1VAVA 3K4ZA 1I3HA 1OHFA 3SKVA 5DG2A 4BXSV 1LODA 2ZX2A 4CDWB 4CXYA 2JDMA 4P5YA 1WD3A 3PHMA 4QGNA 4A7KA 5C3QA 5A6ZA 2NMNA 4AVAA 4PDWB 1RUC2 4ATEA 4MX3A 1AXZA 1GLHA 4FQ4A 4LBNA 4DQAA 1MQTA 2ZX3A 5DAPA 5FZIA 3AMNA 3B94A 1PX4A 1VALA 3ACFA 4WM7C 1DQ5A 1ND2A 1REEA 4BZ4A 3H1WA 2HEVF 3U37A 2AUYA 1PVC1 1RVF1 4EYUA 2PA7A 3HWJA 3LB9A 5E6HA 4GXLA 2OW4A 2VXRA 1NX9A 3DCQA 3AJYA 1R64A 2FCUA 2VOTA 4X8PA 3ZXLA 5F9TA 2DTYA 2JD9A 4FOWA 1O3TA 2ZPXA 2EXKA 3M4FA 2A6VA 2WINB 2WA4A 4YVSB 5CKQA 1G8WA 5AVPA 3VDCA 1A8DA 3ETPA 3MLJA 1L7LA 4Q0QA 3NAPA 1DGWX 1VBD2 4FO9A 1CN1A 1ZBE2 3RYKA 5KR7A 1XNAA 1TG7A 4YLZA 3VN4A 4ZZ8A 4FTEA 3ZYBA 5FAXA 2F6BA 4BA6A 3GDBA 3W59A 3B7MA 1ZZ6A 5GM0A 2IXCA 5ACA3 3FLTA 1RUG3 2ZZQA 4AYUA 1JOJA 1OFNA 4COUA 3PTYA 3FX3A 5CU1A 1SFYA 4TZDA 5EP9A 3RGBA 2E32A 3RRDA 3ZMNA 3TEWA 1QDOA 1C8M2 1OD5A 1CZSA 1V9U1 2HWD1 4Y1XA 5SV8A 4LLOA 1N3QA 3MEPA 5LBEA 3VBUB 3NNLA 5JSRA 3BU7A 4ZU5A 5J1XA 4NIHA 1SLBA 1QMJA 2P2KA 1RGSA 2P6HA 2Y6JA 2YYOA 5FZ4A 1HV0A 3TEZA 2VL4A 4K21A 4OYUA 1UOJA 2W1SA 1FV3A 1NA1C 1ZBA1 2D6NA 4R4ZA 3ZPOA 3S7IA 3EXUA 5EZWA 3T0BA 2BWCA 1DU3D 1VLNA 3K4AA 3ZPYA 3LOIA 5KHHA 2WQZC 4TSVA 1MEC3 4HSLA 2Y6HA 2ZKLA 2WNVC 2D3SA 2OQ7A 5D8AA 2YHJA 4W8JA 4ASKA 2VAUA 3KV5A 1GUIA 1JODA 3AKTA 4XF9A 1D2SA 1ND3B 1S0IA 1X8MA 1QH7A 3CKHA 4LLFA 3SMHA 2ZMNA 1D4M2 3UYJA 1QJEA 2UY8A 2P17A 3WX5A 4H3WA 3PURA 1PNGA 4MYEA 2ZMKA 5JMOA 3AX4A 3DYPA 2TNFA 4K9SA 2EXIA 2PXJA 3AFGA 4LNVA 3EJKA 5H9SA 4AW7A 3D5OA 4Y22A 4XBLA 3ZFGC 1ODMA 4QX7A 3CZUA 4RR3B 1OVPA 3TEXA 4CEYA 4EN9B 4OQ8A 2ZX0A 2RS53 1JZ6A 2C6SA 5DAQA 5LEJA 2CYFA 1S1AA 3W5NA 2WN3A 1UU4A 1QJU3 2F4PA 3H3LA 2QQVA 3HJRA 2WN2A 4PI2A 3WINE 1VBA3 4HK9A 4JGYC 4DEQA 2X09A 4AGRA 1RMU2 5GLWA 4NHLA 2Z79A 4J1WA 1JHJA 4B8EA 2GMEA 4IGPA 2X5IC 1ZNPA 1HRV1 3OD4A 4AAXA 3IDCB 3SKJE 2HKXA 1BVVA 4XUNA 4COYA 4D94A 1N3OA 1DQ2A 1HXS3 5LA2A 4AG4A 5BNPB 5L7OC 3WEZA 3O1VA 2RDRA 4UF0B 5B4XA 5FBJA 5FY8A 4CCDA 4DNYA 1AL21 3A23A 2G4IA 2XJTA 1SMVA 1IG0A 2FZ1A 4FAGA 5JPMB 1MR5A 4KNCA 3VBHB 2JE9A 1QXPA 3ASIA 4XILA 3AVSA 2DV9A 1AR81 2GP5A 3OYWB 4W6YA 3RFRA 2HLEA 3AM2A 2C0ZA 2R7EB 2RS11 2YBPA 3MLLA 1AZDA 1PGW1 2IVJA 2BWAA 3VBRB 1C5IA 1F35A 3P3NA 4DXTA 1XNTA 3IAQA 1FATA 3T2TA 4WM8A 4FPEA 3HBZA 4JTOA 4YZ4A 1QNYA 2BP6A 2QQKA 1ODNA 3H50A 4FFIA 1WW4A 4RS5A 4QPIA 3U11A 1A34A 4RGGA 2G19A 4E9KA 1QWRA 2DTWA 1ZZ7A 1MZ5A 5C6CA 5I8YA 4FPGA 4TLFA 4WVMA 4Y5Z0 1RUJ3 4DB5A 1U0AA 2QZ3A 3I59B 5CISA 2AYHA 5FYVA 3ZX7A 4I2OA 1DGLA 1IGOA 1RUE2 2Y38A 1R1ZA 5FZMA 2ZOEB 3OJBA 1GZWB 4CP0A 1TQ5A 2FCTA 2QQIA 1KD7A 4XDQA 1FOD3 5GZDA 2HWE1 4TTGA 2QDNA 1RUH2 1TMF1 2EAKA 4WVZA 5LCWL 3OF1A 2UWBA 3OOXA 1C4RA 1PMIA 3SCFA 1YI9A 1RUD3 1BJQA 4KU7A 5A32A 1JZ4A 1DYKA 3A22A 4O7XA 1PK6A 4IE7A 3K48A 3AJZA 4HSJA 4Q4V1 4RHV2 3ZFFA 1ALYA 4XF0A 2R063 4KWUA 1CQ9A 3ST7A 3CLPA 1LECA 4Z07A 1NLRA 5FZLA 4GB32 4MOAA 4YM2A 5F3CA 2A6ZA 2XKPA 1NE4A 5JSOA 4YW7A 2VMCA 1HX6A 5A80A 3KZ4C 1A8MA 2JJ6A 3KVBA 4W50A 5L73A 1BK0A 2BQPA 3MHZA 1LCLA 4AK3A 2GNBA 2JX9A 1H8TC 1TVGA 4L8QA 2KR2A 3RS6A 2FDGA 1VRBA 3O0XA 1KFXL 2CY6A 1O4TA 2XJVA 2ZGPA 1UKGA 5GLTA 1S0FA 5AFBA 2VU9A 4CVUA 3H0OA 3R4DB 4INDA 4BM8A 2PHRA 4XABA 3RJRA 3I2HA 5CFDA 1H2NA 1LHUA 3K51A 3POJA 1LJ7A 3PIJA 4QQPA 2VECA 1J58A 1FYUA 1Q8PA 1OH4A 2JKXA 5FPUA 3HBKA 3FC0A 1RVF2 3PU3A 2EALA 2VBPA 4URTA 1OPOA 4I0AA 2P3JA 4XJAA 1OXCA 1W9WA 4M3CB 3I2OA 3DEMA 4GH4C 3UV9A 1OA2A 4QX5A 5BNNB 2VXJA 1LHOA 3WDTA 2EIEA 1C1LA 2XDVA 4MLOA 4JGZB 5LASA 2WQ8A 2PAEA 1EAH2 3I3QA 1JH5A 3KM5A 5C4WB 1HB4A 5IAXA 3VD3A 1STMA 2G1MA 5JOYA 1MZEA 1WD4A 4AR2A 1PZ9A 2WZEA 1MQTC 3PUQA 3KSCA 5K4LA 2JDAA 5D21A 3HNMA 4FI9A 3S30A 3J4UH 1ND2C 2P5BA 1SPPB 2VR4A 2XL9A 3T08A 1RUOA 4OMDA 4CCJA 1AHSA 3WVJA 4OUEA 1XBFA 5CYYA 3FL7A 1RIRA 4FP3A 4AFCA 1LAJA 5A1FA 2P6CA 3GYDA 3RG0A 3FBMA 1YQ2A 5APAA 2VZQA 3TNPB 3CQOA 4MXWB 3FUQA 4V1PA 1S0DA 2PHUA 2D93A 3MIFA 2HYKA 1J84A 5BNOA 3BOWA 1PO11 4NPLA 4DUWA 4PIZA 3NAPC 1W8ZA 3QD6A 1DZRA 1NLSA 4BDVB 3ZN6A 1O8PA 3LF7A 1Q8SA 1RUI3 4LQRA 1PIV3 3WDUA 3UJQA 2WABA 2ARXA 2HEYF 4Q4W1 1ST8A 2ENRA 5KXDA 3I8TA 1ZBA2 1WMFA 3KCXA 3UL2A 5IYYA 2BGOA 4RGAA 2VJXA 5HXMA 3TN93 1XYOA 3ZYJB 1XSRA 4R52A 4E2QA 2HEWF 3I54A 3AL6A 1N3PA 1RC6A 4N8MA 2LROA 1F4HA 1S0BA 3EQEA 4A3ZA 5DAXA 1FNYA 1I5PA 2I74A 2Z69A 4BQ3A 4CP9B 1SLLA 3S7EA 1BVP1 4P08A 5FY7A 2VQTA 2AR6A 1VRH3 2WBKA 2Q5TA 2XQRA 3AC0A 1LHWA 2J1UA 1LGNA 3BYWA 1W8FA 4XYXA 1FMD1 2CHHA 5FTTC 5FWEA 2A7AA 1ULOA 1V6LA 4R9CA 2UYBA 2J1AA 2ZJCA 4LO8A 4D3WA 1OH3A 3EMRA 5LBCA 2SLIA 3B93A 2C24A 2JG8B 4QX0A 3VUOA 1KGYA 4JRAA 2OT7A 1XQNA 4KU8A 5BV6A 1XU2A 2D5HA 4Z2WA 3MBWA 4MGKE 1JYXA 5D8AC 4HXCA 4KL1A 1LOAA 1PVC3 4QB6A 4FT8A 1OMIA 2JDUA 5BUVA 5A3LA 1BBT2 1OUXA 2CWSA 1ZM1A 2NZ9A 4GWJA 1Y9MA 3A4UA 4JC1A 2MHFA 2XVLA 2WNUA 4HOOA 5F6LB 4ZXEA 2HWF1 3OSDA 4P9GA 5JIAA 3RJ2X 2E31A 1WWYA 4SLIA 2A6XA 1O59A 1R092 2ARCA 3WDXA 5C70A 4Y1YA 3V65A 4HK8A 1H30A 3CZJA 3FFZA 3GJAA 5HV0A 1GOGA 3ZYRA 3O1UA 3AVRA 3DL3A 1NCQA 2LUWA 2PLV1 4QQOA 1AL22 1KEXA 4FPFA 2WKKA 3POFA 3Q8EA 1POV0 4CEYC 4IQPA 2DBIA 3OGVA 4KWKA 4YYOA 1CAVB 1US3A 4O9GA 4MGSA 1AR82 1WZXA 2R073 2Y6FA 3ZYIB 4AI9A 1AR62 2V4AA 3AXDA 1UL9A 1D0HA 4AEMA 4OCTA 1A6CA 5FYSA 4AOCA 3ECQA 3CJXA 3B9CA 2ZEWA 3ZXFA 3NJYA 1IZ3A 1YWKA 5F3IA 2VZOA 2Q1MA 1QJZA 3BODA 3P5BA 5J37A 4IE4A 1Q5OA 5LA1A 1D2QA 1GICA 4MHRA 4XMAA 2BTVC 3LEMA 3PVEA 3R05A 4KQ7A 3ZXGA 4LE4A 1ONAA 3U0ZA 4CDQB 3V0BA 2VTFA 3SXWA 2GALA 4QX3A 1D4VB 4BQ2A 1R1A2 2CSGA 2XR4A 2ZABA 2XWJB 1RYYA 4IV1A 4YG6A 2K46A 5A6YA 4LBKA 4D6RA 1AJOA 1W28A 5FY0A 2CAUA 4WZCA 4GMP0 3J8F2 4CUGA 3N9NA 3H8RA 5CB7A 5CFCB 1RUC1 2O8QA 2ZAHA 3Q8AA 4FPCA 3RZZA 5FDBA 3RZJA 5LY2A 2V4VA 2YC4A 2HWE2 3KQRA 1TMF2 4TWTA 2H6CA 2ZS6B 4X6RB 3HT1A 3QLQA 4WM8C 3U78A 4BISA 1GZTA 2YBSA 3CBNA 1YQCA 5DAVA 5IVEA 3N3HA 3O0WA 2QQMA 4H7LA 2PQSA 4RS5C 4CDXA 1HRI2 1PVXA 4MGIE 4Q4V2 4QPIC 1RJ8A 2VTXJ 4XF3A 4XFIA 4XIKA 5EJZB 4RGKA 5T54A 4PLMA 3LGRA 2NPIA 1NQDA 3WHTA 1QDCA 3LEIA 4Q5OA 4XC9A 2WO1A 2WIIB 2ZGMA 4BHPA 5JSPA 1NE6A 4ZKTB 4AQSA 2CGPA 3RWNA 1UWWA 1F15A 1ZBE1 3ZFEB 3ZYHA 4IL7A 1DBNA 5IFTA 5JXHA 1IPSA 3FN9A 1J59A 3E6CC 4GKXA 1XNBA 4B7KA 2IWGB 3DKQA 2ZHMA 3AZWA 4IEYA 4CCKA 4DEVA 4PBPA 1C5HA 2A3XA 1CGPA 4XJ9A 3APBA 5LK7B 2BVVA 1R082 1PK6C 3ZFFC 2J7MA 4LK6A 3AB0A 4YW4A 1Y9GA 3B69A 1WA6X 3Q9OA 4MGYE 3VBOB 4IE5A 2Q8DA 3WZ1A 1WLWA 4LJHA 5L19A 2VZ1A 2BVBA 1LRHA 3AP5A 1AR93 5K0UB 3BTAA 2C1FA 5L9VA 4CZSA 4IEPA 1SLTA 2XUEA 5CNAA 3ES1A 3DN7A 5F2WA 5F8PA 3VD7A 5FZGA 5T5JA 1COV3 2RDNA 4UW3A 1MVEA 2VQAA 1RUF1 4Q4X3 5EJ1B 1XSQA 4AEDA 2Y6GA 3A0KA 1NOVA 5A3NA 3J7NA 4J1XA 4C91A 1GMMA 1WKYA 5KXEA 4HT1T 1VP6A 5CFDC 1JZ3A 4KG8A 4XF4A 2BPA2 1W9TA 3IMMA 3VBSB 1W2UA 5GLUA 4BK4A 3I3MA 1VPHA 4DRVA 1YJKA 4YM1A 1G9DA 3O0VA 2A75A 3Q8BA 2B5HA 2RJ2A 1SLCA 5FLHA 5JI9A 4JHTA 2BGCA 2AC1A 2VMIA 4IV3B 1SFNA 4SBVA 4CDUB 4EN7B 3JD73 3HR9A 1DQ4A 1GBGA 2ZA9A 4JGYA 3THCA 1REFA 3G7DA 2ZGSA 1KQRA 1QOTA 2TBVA 3NJVA 4IETA 4ORFA 1SBDA 3RWKX 1UYZA 1PO12 1ZRCA 1D7PM 5DUVA 3N36A 1DQ0A 1Y9QA 2VPVA 4WBBA 1CPNA 3VBFA 4FFFA 5CBLA 3NV4A 1W3VA 2H0BA 2JWPA 4GKYA 3VDDB 2Q30A 1UU6A 2D6OX 2XXZA 2Y26A 4JKMA 1DDLA 1RTVA 3KT4A 3WCSA 3N4MA 4UBGA 1LTEA 1Q43A 2J1SA 2WSUA 5F5CA 1AYM1 1HJFA 2C9AA 5L36A 2Z42A 2YBKA 3VV1A 2V5YA 2WYSA 4QU2A 1Z7S2 4OQ9A 1KS5A 2WS92 4XFFA 3SEPA 2V72A 3TEYA 5FZFA 5J3UA 3OGRA 3RMXA 2O1QA 2Z5WA 3BVCA 3MUY1 2CDPA 1N1TA 5IVJA 1CPMA 4QPGA 2GC1A 2VMEA 3ME2A 2OQ6A 1RMU1 3R4UA 4MADA 3ZMOA 5F37A 1ULPA 5BNOC 3IDEA 3HN1A 5FKBA 3NW4A 3POSA 2HWC2 1IS6A 3ZXEA 3ZXDA 4NAMA 5FK8A 4LULA 5FZ7A 1VBE3 1POV1 2OS2A 5FO8B 4GD4A 5DZFA 4Y3OA 4YVWA 3PJQA 3OUJA 1FT9A 3IM0A 3I3BA 3JBG2 4QM9A 4V2WA 3UT0A 3WY6A 2W52A 2WUHA 3ACLA 5IK5A 2YU2A 1RB8G 2J1RA 2FBEA 2W92A 4DUVA 3M3CA 2XKOA 1JZ8A 2OPKA 3CEWA 2BYVE 1HB3A 2Y0OA 1T2XA 4YNIA 2C26A 1XE8A 2Y8KA 1W0NA 3GZUC 2BFUL 1PO22 1OFSA 2RV9A 2VW2A 2WLQA 3FHAA 4CEWA 4B1MA 4BU2A 5EYXA 4NRPA 1EPZA 4YFZA 2VUJA 4XPVA 3POBA 3UESA 5KXBA 4M4RA 2UWAA 4LIUA 1VJ2A 2VUDA 3IIAA 4Q0SA 1B35B 3THTA 3VDAA 4B4PA 1MS4A 2CL2A 2D6LX 2PN5A 3WW2A 1WLTA 1FAYA 5ERLA 2ZGUA 2R16A 1MPXA 1W05A 2CGNA 2GH2A 1GSLA 3KGLA 1W6NB 4E2GA 3PUSA 2YZ4A 4AVSA 3VLBB 2WWUA 4GMP1 2PHFA 4YZ1A 2FCVA 5FUNA 1DQ1A 3AKQA 3WV6A 4ZS2A 3AMHA 3WDWA 3E5XA 5FXVA 1TZOA 2XUMA 1PZ7A 2DVGA 4CDWA 1I1EA 5F1RA 3U75A 1RUE1 2GNMA 4PDWA 4LA2A 3PMEA 2YROA 3N9LA 2BGPA 1XU1A 1JYNA 1K5MB 4ONUA 2QFEA 3WNPA 2A71A 5KC5A 2D43A 4GJYA 5CA6A 4CCCA 4EN8B 2WNUC 1ASJ3 2OZJA 4FPHA 3THDA 2GC0A 3KCYA 5SV5A 4RHV1 3M2MA 2DUOA 4Y1ZA 2D6KA 4OZXA 2WQ4A 3D8CA 4HZFA 5JXJA 2E7QA 4XHXA 3WNLA 1TME3 4YVSA 1S55A 1LU1A 2J22A 3OB8A 4GB31 4S2FA 2QUOA 3W9AA 1SDDB 1Y3TA 3P3PA 4LA3A 3ZKUA 4KG0A 1NCQC 5C3RA 3RZGA 4CCEA 3ENRA 5BPXA 5FPVA 5FZHA 4CXXA 1SLAA 3C7FA 3O1MA 4D0QA 2GC2A 1O3QA 3E5QA 4JQRA 1YO8A 1BKZA 1B09A 2Z2SB 3DV8A 4JX0A 3BU0A 5FZKA 4NJ4A 2GNDA 4AEJA 1OC1A 1XNCA 5JZGB 4XCBA 2E26A 1IPKA 4HN0A 1BK1A 3MIEA 4S2DA 4ZY9A 4QX1A 3H9AA 1BEV3 1JUHA 4IGQA 1UIJA 4LOSA 1CJPA 2XBO3 5DZGA 5E8AA 4YWAA 4HVOA 2BV4A 2WL1A 1DGWA 5I8TA 4Y1UA 4XZUG 1AX2A 1GZ9A 2TEPA 3K2OA 3VBUA 2G9ZA 3JUUA 3MI8A 2RDSA 4GULA 4ISRA 2EXHA 2GMMA 3CDZB 4NVPA 5AC91 4IV1C 3O1RA 1ACCA 4JZRA 4A6SA 3QH7A 4LO7A 2XVGA 4XUQA 1EAH1 2RM22 4TLGA 3MW2A 2GAUA 3MO4A 1HV1A 1V6JA 2BW8A 1LOFA 3LZZA 4XTMA 4ZS3A 3O14A 3AP6A 4GQ7A 3H3UA 1W03A 1LOGA 1IOAA 1U5ZA 4DXRA 4BXFA 4ARXA 5GZGA 3OTFA 1LB2A 2FMYA 1F8VA 3N35A 2OZ6A 1KJRA 4A42A 2R041 2HWF3 4QKBA 4HKLA 2D40A 2R6QA 4CDXC 1ND3A 2W3JA 2ZEXA 2VZUA 2YC2A 3KF3A 1WMEA 2VULA 4A44A 2LALA 5FYIA 2GN7A 2QCSB 3MZHA 2WFF2 4H7MA 2NN8A 2OYZA 2PLV3 4ZONA 3RZMA 2JICA 4QKDA 1OLQA 4QQ2A 4ARYA 1XC6A 1W6MB 2B4KA 5A3PA 3QOPA 1SCSA 4RFRB 5FY9A 1YFYA 3OG2A 1ULDA 4HN1A 1N1VA 1W6QB 1UNBA 1WLDA 2DCTA 3WUCA 3AZZA 1RUF2 4RR3A 1LEMA 3WDVA 3LKJA 4IERA 5FYYA 3OPWA 1AX0A 3GF6A 2DVDA 1FPN3 3WG2A 3OY8B 3VZNA 3TAYA 4RD7A 4Y4RA 4K8FA 2RE9A 1H2LA 4B29A 5J7MA 5LRSA 2GH8A 4AHWA 1AYN1 5FZAA 5DQ0A 2VMHA 2WAAA 5HI0A 2B45X 4OI0A 3ZOIA 3MDPA 4AI2A 3N7LA 1H6YA 2ZXQA 3KS7A 3RI8A 4AAPA 5BNPA 4XFCA 1JYWA 4LTAA 4UF0A 1E5SA 3LIHA 3ZIXA 3WF3A 3HEIA 1LEDA 1P8JA 3RYPA 1V6MA 4LUMA 3W20A 2HWB1 4LO4B 5J36A 1RUC3 3VBHA 4AEDC 4CU6A 2WAOA 3OYWA 1UXZA 2W87A 4J6GA 1DF0A 2EICA 2SBAA 2VCAA 3DYMA 1HB1A 5FZOB 1AYM2 3PVBB 5J98B 1FOD2 4Q27A 2D97A 4N43B 3VBRA 3RNSA 1VBC1 3OPTA 5F3GA 1ENQA 1W2NA 4PI0A 2R32A 3QACA 1SDWA 5FUPA 1RUD2 4MGZE 1BHGA 5A7WB 3GHNA 4AI0A 2YDEA 1BBT1 2PFWA 3HIFA 1DQ6A 3J9SA 4IE6A 4O9EA 3MIBA 2ZGKA 3E5UA 2PAMA 2X8KA 2EIDA 3O1SA 5FZ1A 2W47A 4PF5A 4KGQA 5I0TA 1W8UA 2FQPA 1VBD3 1S2KA 1ZBE3 1R091 3H3ZA 1V70A 1W9SA 3VBFC 4XOGA 2IXJA 2XB6C 4RN5A 3I59A 2BRTA 4LBMA 4Q0PA 3CNAA 5FXZA 1GNHA 2TUNA 4W65A 3GCXA 2AREA 5JXIA 3VD4A 2CDOA 2RS31 3I2GA 4L2NA 3T2QA 5FP9A 1GZWA 4QXKA 5I93A 1AR61 3POGA 3OGGA 3NVCA 5FBZA 1X9TA 1LOCA 2ZHLA 4JDMA 5A6QA 1FNZA 2E33A 3MIHA 2IC1A 1DYPA 1H9WA 2VOWA 1C8M3 1NUKA 1LGBA 2WC2A 4QPGC 1WCDJ 1Q56A 5B2GB 2PQQA 4UI9L 5FJKA 4X6QB 2OVUA 4W6WA 4CUCA 4OHVA 1CVNA 3HD8B 1H9PA 2QQNA 1TEIA 3MV11 3OEAA 2E9QA 3NSTA 3LDRA 4LHSA 5AVAA 2A1XA 1RXFA 1IS4A 3V0AB 4YVWC 4EZHA 5G05L 1UOBA 2I07B 2JB4A 3S6PA 2YXSA 4R9DA 4BQXA 4YM3A 3NNMA 3S5AA 1DHKB 3LEGA 4NHMA 1R1A1 2QBXA 3OGSA 1EV11 2I2SA 4K20A 2QQJA 1MVQA 4LHNA 1MZFA 2P3KA 1QJY2 1ULGA 5FRAA 3V56A 1H4GA 4OMCA 4HVRA 2JE8A 1QXRA 1QJX2 1UMIA 2Z4FA 3J8F1 1Y4WA 2QQPA 4KBZA 2PHLA 4CU8A 4CEWC 5JAXA 5H9RA 2MEV2 4HLTA 2X10A 1K45A 2UURA 3KV4A 4CPBA 1T6GC 1W8NA 1D4M3 5GALA 5JDBA 1NCRB 2HBTA 3ZIWA 3IT8A 2W1QA 3NV2A 4UYBA 2B9VA 4A6OA 1HRI1 1GFF2 2BNOA 5C33A 1PGL2 4XQDA 4M3CA 4YGCA 1XYNA 3VKOA 1ENXA 2J1TA 3BPSA 4QD2A 5BNNA 4E8CA 2DVFA 3S57A 1W39A 4JGZA 1HLCA 3FMGA 4CDWC 3LDBA 3KMHA 3DXUA 5C4WA 1PIV2 4L99A 1AL0G 1QHDA 4PDWC 4W4ZA 4WZFA 1L7RA 3GNEA 1NZIA 2X05A 4LBQD 1NYWA 3L2HA 4IUGA 4NHYA 1L7QA 2DU0A 3AYEA 5E1RA 5ANNA 3TRSB 2J1EA 4QDRA 4EJRA 1PHMA 4YG0A 1OOPB 4UW4A 4YW2A 5T50A 3VL8A 3WG1A 5T5LA 5ISLA 1BXHA 1SPPA 3LDKA 1UOFA 3OBAA 2DBNA 4N9HA 2VOKA 3ZKYA 2WO7A 1HQLA 5FYTA 4QPYA 4Z8BA 3ATGA 3RZHA 1R081 1Q3EA 1M06G 3RMYA 1GWMA 4P9LA 4QGMA 3UKVA 4RQPB 1JYIA 5L9RA 4MXWA 4CUBA 1HIXA 3PUHA 4YVSC 4XJUA 2A70A 2ID4A 1RITA 1O3RA 1QXJA 1EPWA 2UYAA 1WMDA 4XXPA 2IXLA 3LA7A 5A3WA 3TOJA 4N90A 5AC92 1SACA 4P14A 3DPRB 4RL7A 2ET1A 1W9YA 2IXKA 2VMFA 1IQDC 1NKGA 2ZX1A 4QXCA 4XURA 5FPZA 4XW3A 1ZRDA 1LKNA 1GP6A 1W0PA 4I3PA 2JDNA 2D6PA 5F39A 4BYYA 2RMU3 2Y6KA 1UYPA 4U2AA 2DUQA 1J1LA 4GZ9A 2WZR2 1OQEA 3WQ1A 1EY2A 4NIDA 1RHI2 5HBAA 1S0GA 2QQLA 2ZKNA 4GALA 5FV3A 3VZMA 2R042 4CP9A 4BQ4A 5C7GA 3GHMA 5A7NA 2JEMA 4YW5A 2DURA 3WXPA 2C9KA 4B1LA 3VBUC 2BNMA 2FDHA 3ILNA 4MGTA 5C9AA 1RUNA 1X82A 4D7TA 4OUSA 2C4XA 4QT6A 4XDPA 1JUIA 2JENA 4CCLA 1W8TA 4P9IA 2O0OA 5DDJ1 4BPZA 3EO6A 4FXGB 1RUE3 3D0SA 4AL9A 4C0BA 3ACGA 1CWPA 3ES4A 4Y5TA 1QOOA 4BQ5A 4HMZA 2JG8A 1J83A 3WP5A 3O12A 4EZ4A 1NY72 1LOFC 1H8VA 3ORJA 5FUIA 4P9JA 1RUH3 3JB8A 4UXAA 3MYXA 4BCUA 1WW6A 3OUHA 3LSEA 1ND3C 1Z7S1 2WS91 2OPWA 1W8WA 1LHVA 1W0OA 3AKRA 4AVTA 4AF9A 4D7YA 1QQP3 4LKFA 3N7JA 5LWBA 2FZ2A 3PLQA 2JDHA 4GB33 3SCHA 1YQ8A 2QE3A 1OD3A 4PT6A 1AYN2 1UU5A 4XACA 1CR7A 2HWC1 1ZZ8A 4JKKA 5F2SA 2JG9B 2A6WA 5IJRA 5GZFA 1PM7A 5C9AB 1MZ6A 4AI1A 1WMXA 5KXCA 1WUVA 2VTXA 2VW0A 2K0GA 1G7YA 3M1HA 4Y5SA 2EIGA 4V2VA 3JBG1 3WCRA 1F4AA 2YPJA 3RSJA 1AR72 4RR3C 2HWB2 3ITQA 1LR5A 5FZ0A 1CAVA 2JIJA 1O5LA 1S0CA 2VNOA 4FP2A 4IE0A 5JOZA 1ZYBA 1JTZX 2W2IA 2XG3A 3WF4A 1PMJX 4LMFA 3MUZ1 5I0RA 2OUJA 4IGOA 4OHZA 4CXWA 2KD7A 5EFUA 1JYVA 5C71A 4DXSA 4M0NA 1PO21 2WNOA 1VBC2 4E2SA 1MS0A 1RVF3 1YLLA 1NT0A 1UAIA 4IEXA 1KDMA 2GZWA 4OHXA 4MH0E 2QZ2A 4CP2A 1IHMA 3W5MA 5A3OA 4XJ8A 3RI9A 4Y20B 4Q4Y2 2VNRA 5BNPC 3KV9A 4XUPA 3WR0A 4CDQA 1VBB2 3ALQA 1DCSA 1EAH3 3SC7X 5JCTA 3SQOA 2ORZA 4QQHA 4D6QA 5DAWA 5FZ8A 5FK7A 2W94A 2LW8A 4N53B 3VBHC 5FLJA 2Q1ZB 2FD8A 4JV4A 2WWSA 5FJHA 1OLMA 2RS32 5I0UA 1UX7A 2WFPA 3UKNA 5CFCA 4LPLA 3VBRC 4AEKA 4XFAA 4ZPIA 4FPYA 4CE8A 4RSUA 1UXXX 4XFHA 4E27A 4Q8KA 1RUG1 4NIIA 2CWMA 2VC9A 2ZGTA 2YG0A 1XRUA 2W68A 3CJIB 3C7OA 2VUCA 2XHNA 5FQ0B 1DYOA 2EXJA 1XB9A 2VCCA 1UMHA 4OUMA 1V9U3 2HWD3 3VZLA 5EWSA 1YFUA 1SQ4A 4GWNA 4HETA 4P9YA 3WP4A 1V6KA 5B4NA 3FFQA 4A45A 3KQ4B 3R0RA 2K9ZA 4XZPA 1AR92 5IW0A 2EA7A 3C8XA 4AGVA 1ZBA3 3ZFEA 5K9YA 5C8CB 1HN0A 1EV12 1COV2 1CIYA 1I9RA 4QHBA 4COVA 3U10A 2YGLA 3FUOA 3I3DA 1BMV2 3UGFA 2VVFA 4RA0A 3AFKA 2ARAA 3PNAA 5E88A 3WF2A 1GR3A 4CCOA 3SCGA 1F2NA 4COWA 1CAWB 1YXWA 3ILFA 2VVDA 2B9UA 2JXAA 2Y60A 3T4VA 5JXGA 3BPZA 2D3RA 5LA0A 1JZ5A 2IFWA 5EQUA 5JI7A 2X53S 3K75B 3ZN5A 1H1AA 2VNVA 1NLQA 2AH2A 3VBOA 1W04A 3R4SA 2ATFA 3N9QA 1MS8A 1Q8VA 1GQPA 3HNBM 4JVAA 5FMCA 3ZYGA 1JOPA 5K0UA 2W39A 1MACA 3PMSA 1H1MA 2GC3A 3IPVB 4L9BA 1E57A 4UFJA 2QNKA 4JTNA 4OLLA 2K2SA 4XBQA 3R6SA 3IBMA 3WD5A 2OXBA 2RM21 1LENA 5FY4A 3ACHA 3CHXA 4K1ZA 5LRRA 4WV8A 2WT0A 1VAMA 3H1MA 4TN7A 4CSWA 2RJKA 1Q8OA 2PAKA 3SH4A 4QDSA 2BDRA 4LBJA 3WQ0A 2RS51 3VBSA 2LRPA 4DXZA 1JBCA 4XIOA 1SG3A 3NV1A 4ET7A 3LCPA 2DYCA 1H2MA 2IXHA 4LHKA 2BOIA 4WM7B 5IVCA 1HRV3 3WW4A 4IV3A 1VBA1 4CDUA 5IATA 2VO5A 1A78A 3ZYPA 3I7DA 1R093 1AVBA 5BNNC 3LWCA 1IPJA 2BJSA 3NMBA 3DPRC 3ZM8A 2WFF1 3GJBA 3RDIA 2E63A 2PYTA 4JGZC 1OI6A 5A1LA 1AL23 4R4XA 2P3IA 3LFIA 3VGIA 3WW1A 5C4WC 3H8OA 5FOJB 1GQGA 1GP5A 3AP9A 4CU7A 4QB1A 5C5UA 1LOBA 2ES3A 3LEKA 3VDDA 1W6OB 4FBFA 1IKPA 1AR63 1AR83 1OSGA 3IAPA 3POEA 5GJ6A 1OPMA 3VL9A 2W46A 1GYKA 4XBNA 2RS13 4PBOA 3ZSJA 4P5HA 3AKSA 2WJSA 2YGMA 3MF6A 2D44A 2R0HA 4I0BA 1CAUB 1IS3A 2VVEA 5J09A 2VY0A 5JMCA 1GWLA 3BTYA 2V5DA 2ARBA 3B00A 4Z82A 3U07A 5KHIA 1W2TA 4UFMA 3VZOA 1S2BA 4R9AA 2AEYA 2RDQA 1YRZA 2ZAAA 2VH9A 4K40A 3T09A 5FPBA 4ASLA 4P9XA 4PLOA 4QHOA 4FVVA 2X29A 2DCKA 5F32A 1R1A3 3UNPA 3M3OA 2D3PA 1WGPA 3AYDA 3PVOA 3ZO0B 1DGRN 4Y4YA 1H1IA 2FDIA 3THPA 2DU1A 1YQ5A 5DDJ2 1Q8QA 2CAVA 5AFEA 3HAGA 3VB9A 1Y7BA 1GP4A 5ABJB 4K7JA 2OUHA 3J8F3 2Y64A 5DN2A 2ZCWA 3A0NA 1K3IA 4M3CF 1NA1B 4NOTA 5I0SA 4H55A 4RYDA 4DO0A 2HWE3 3U4SA 3WP6A 4UFIA 1GOFA 1TMF3 2W1WA 4WVVA 4DFSA 5D1IA 1PGSA 3FHIB 4AFAA 2VCMA 4YW1A 4FPLA 1FOD1 2B8MA 4XFBA 4ZXKA 5JWPA 2WNVB 2WYFA 1HRI3 2J42A 5FMBA 3T30A 4Q4V3 4COZA 2XWBB 3AMQA 4KWJA 1RUD1 3I2DA 2ORXA 1B35A 1AX1A 3ZDVA 2RR12 2PHTA 4ZZ5A 5C9AC 1YYNA 2XOMA 2WR9A 4LORA 2R061 3DF0A 4HFSA 1W6NA 5ANQA 1S0JA 1TME2 3IMNA 4KGGA 3PU8A 1YFXA 2XONA 2WDBA 3BN6A 3EYPA 1TNFA 2JG8C 2YFUA 4B4QA 3MV01 1JHNA 5JOWA 2B7YA 3MPBA 2JE7A 2QJVA 4YW6A 3ZFGB 3H8XA 1X7NA 5FMOL 4LHLA 3N9OA 3GM8A 1UCXA 4N7IA 1OQDA 5IAVA 4F83A 1GU3A 4HPKB 4PIYA 1K5MA 5DG1A 4YZ5A 1UMZA 2PTMA 2VM9A 1N1YA 4KWLA 3VHPA 3ZXAC 3JQWA 1W6PB 1DG6A 3T3YA 1ZRIA 4CPBD 5IVYA 3WNKA 3LA2A 2GP3A 3WSOA 2XBO2 5CADA 2R1DA 3AP4A 1GOHA 2PMWB 1H0BA 2X5IB 4LO5B 5EIYB 2R49A 1GKBA 5I91A 5DPNA 3WG3A 1W06A 2Y34A 2VZ3A 3K46A 1OQ1A 4K1YA 5IK8A 2WRAA 4LR4A 4QU1A 3N9PA 5L7OB 3L2YA 4AVBA 1W9FA 2WA3A 4AQ6A 3ZDSA 3LOBA 2UY9A 3DECA 2DFBA 1AXYA 4AQ2A 1QGLA 1BCXA 1T6BX 3AP7A 3MGUA 2YPDA 1QJY1 3NNJA 5DUXA 1ZA4A 4F8AA 3FE5A 3PIGA 1YFWA 3NWKA 3T0DA 2JKBA 1QJX1 1QNWA 4FAHA 2DF7A 2R1BA 3SH3A 5JZGA 3ELNA 5ACA2 3VHOA 5HCAA 1RUG2 2MEV1 4G3YC 1XJAA 1OBNA 3OCPA 4PJYA 5FY1A 2XJPA 4TYSA 3ZSLA 1RL3A 3GGLA 3T0AA 3HMYA 2ZGRA 1PO13 3BALA 3JXSA 5DABA 3USUB 4CDQC 4CRQA 1K12A 1PGL1 4IESA 3O7OA 3ZVXA 2W9XA 1KITA 1JZ2A 1QH6A 1UN1A 3OD0A 2P37A 4Q4W3 1W3XA 3WF0A 4OHWA 2ADDA 2JECA 2XJSA 4B3NA 1PIV1 4MO3M 4AHXA 4IEVA 4IEOA 1V6IA 1OA4A 5CFCC 4AFBA 3EB7A 1WW7A 4NAOA 1Z7S3 2PHXA 3WNOA 4NIGA 2WS93 4JQTA 5F5AA 2Y0IA 4UWDA 3GZTB 1KXGA 1XOYA 3WUDA 4Q1PA 3GCWA 2KXLA 1WBLA 1MEC2 2CNAA 1FPN2 1SZBA 5FYBA 4H2AA 5FLIA 3NJZA 4PHZA 5CG8A 2HWC3 5FP3A 1I6XA 4XQWA 3ZSKA 1O91A 5FKCA 5EHDA 4NROA 3Q8FA 2BEOA 1PZ8A 3DYOA 2D6MA 1FMD3 4F7ZA 5A7SA 3JBG3 5IK7A 3FLPA 3LIGA 2ZACA 3ZFEC 2FMDA 5H9PA 2W1UA 4OULA 1ULFA 1W6MA 2WT2A 2ZHKA 1D0GA 1LGCA 4LBQB 4R8HA 1FX5A 5A70A 1H8TB 3DGTA 1WCKA 1W6QA 2JDZA 3AKPA 5IUQA 2YU1A 3FHQA 1RINA 2R30A 1PO23 4WVWA 3AYAA 5L9BA 3I2IA 3J7LA 3WOGA 5FO9B 3VHNA 4D8MA 1HJGA 2WZR1 2RS52 3C3VA 1JU4A 2E51A 4JRLA 1CAXB 4FPJA 1RHI1 1SLIA 5FZEA 3OY8A 3J26N 2GNTA 3M3IA 4QB2A 1F5JA 1JI6A 3VD9A 2DDUA 3VBOC 1QJU2 4DMIA 2XJQA 1VBA2 1S0EA 2ZGOA 1OUSA 5K0UC 1OKOA 4HONA 1DZQA 3MICA 5H9QA 4JKLA 4GH4B 3DKWA 3J7MA 4OVEA 3LFMA 1HXS2 4DINB 4A7YA 5A33B 3C7HA 4O65A 3JZVA 2CGOA 3IDAA 1PM4A 3KCCA 4OFGA 1X9PA 4I0WB 4UW6A 4YGEA 4KH9A 2A3WA 1NY71 2VW1A 1F5FA 1XXNA 1W2AX 1ZRRA 4K8RB 4EE2A 1UY1A 2XLAA 3VBSC 2R071 4XHBA 5FZOA 4CA9A 2HJIA 1MQTB 4QKNA 4XJWA 3KGZA 4XMIA 3EHKA 4N43A 1IG3A 3BIEA 3FWEA 3X29B 1FV2A 3C7EA 1ZZBA 4S2HA 4QGLA 1ND2B 1FI2A 3ILRA 4IV3C 4CDUC 1DP0A 5A7WA 3IZOA 3ZXJA 5CVRA 2XGXA 1NZCA 4MZUA 4NHKA 2VG9A 5IVFA 2QQOA 4FTBA 5DMYA 3FLRA 4M01A 1SBFA 4NUBA 2AACA 2W91A 1O4YA 2ZGLA 4DOUA 1CD3G 1JXNA 1QKQA 3NNGA 5A1AA 5CIRA 2XPJA 3NAPB 3MF9A 2XJUA 1Y43B 4QHZA 3HN3A 3VDDC 1YQ6A 1RUJ2 3D0JA 5IVBA 1UX6A 2P4EA 1KDKA 1V6NA 1ZA7A 1QU0A 2P3YA 5BYNA 3GALA 2VCBA 5FPXA 5KWRA 1AR71 5HV4A 3M3EA 4B7EA 3BUCA 2XH6A 1OLRA 2A73B 2E6VA 5FXWA 2BUKA 3O1PA 2W08A 2WWJA 5J48A 4EWDA 5LBBA 1OT5A 3O1OA 5JVVA 4G4FA 1WW5A 4NE9A 1ZREA 1HB2A 3POYA 2Y33A 3B02A 3WNNA 1HN1A 2EVXA 1YJLA 4C1XA 1YI7A 3M8LA 3OBRA 4XAEA 1Z78A 3WDYA 4BIFA 3V0AA 2D7FA 5KC6A 4XFGA 2R062 1QF3A 4Q4Y1 1LESA 4XAAA 1QEXA 1VBB1 3H7YA 1GNYA 4LKEA 4OI4A 5G04L 2RM23 4QWNA 4E8DA 3KT7A 2PHWA 3POIA 4B4RA 1MS1A 3D82A 1XNDA 3GZEA 5HCHA 2VBDA 1DGRA 3SISA 1X36A 5EJ3A 4YZ2A 2ZX4A 4LO6B 4AHYA 3POWA 1UY0A 2BU9A 4UW5A 2IXIA 3SLIA 1K42A 2ILMA 2BBVA 3I2FA 4AGGA 2ZZJA 4K6BA 2KM2A 4DPNA 5LA9A 5D8AB 1O6UA 3O1TA 3O5SA 1LHNA 2ET7A 1VAKA 2CV6A 3RYRA 4XTPA 1NCRA 1B35C 1C28A 1QY4A 4UFKA 4HBNA 3Q8CA 3WT3A 3NRUA 2WFF3 3LPGA 3URFA 3T1LA 5K7PA 5FR3A 2IVIB 4QQLA 4BOWA 3LAGA 2I45A 1VE0A 2VOVA 4FPOB 2H6BA 4HANA 4EV0A 3MW3A 2JB8A 3M7AA 4XEZA 5I0DA 1AR91 1J1TA 1XE0A 1AJKA 1REDA 5DXDA 4MSVA 3OGJA 3V64A 2DUPA 1LU2A 4A7ZA 1UPSA 2IUWA 1ENRA 4GWMA 2VZTA 1NG0A 4Y22B 1RUF3 1YUDA 5DUUA 4ES8A 4QPWA 5C3PA 5LZ6A 3K3OA 4URAA 5BNQA 2VNGA 4I02A 3IN9A 3USSA 1O3SA 1NXMA 1COV1 4CEYB 4M00A 4Q4X1
chains in the Genus database with same CATH topology
1F31A 2RMU2 3B3QE 4P9WA 1K5MC 3N7MA 4Q26A 4Y1VA 1BMV1 1OOPA 1TE1B 5TSWA 5FMOS 3GBFA 4YARA 4C90A 1UW8A 4YGDA 5EXOA 4NPRA 4RQPA 3TNQA 1UIKA 3JD71 2BFUS 2ZBJA 2GMPA 4L97A 4A2UA 1M4WA 1WLCA 2V73A 4CTEA 3UKTA 4FSJA 2AENA 3NL1A 4Q0VA 4E4ZA 2EF6A 2KA3A 3DPRA 4HKOA 4BLIA 4N7UA 1RUI2 1AF9A 2D5FA 4L11A 1AYM3 1DLLA 2P34A 4Y24A 5JZGC 3M70A 3TN92 1O4ZA 1G86A 4M0HA 4BH9A 5T3NA 1U5YA 1I5ZA 1NQJA 3WHUA 4NWWA 4MXVA 1RMU3 4HL0A 2R0FA 1QQP2 2YY1A 4YZ3A 4WM8B 4G9SB 4EWAA 4RS5B 1VR3A 1POV3 2JD4A 4LBLA 4QPIB 4ZU7A 1VRH2 4WVMB 3GBWA 4I09A 1VBE1 1UKRA 3FBYA 1ULEA 2ZTNA 5F6KA 4M3CE 4PQ9A 2DCYA 4ZU4A 5HCFA 5E89A 4DZGA 2AGSA 1WA4A 2E7AA 3NKTA 1X33A 4Y26A 3ZN4A 3JU9A 2ZMLA 3L9JT 4MV2A 1VB4A 2UU8A 2WSVA 4META 3H1YA 5A32B 1PVC2 3DUIA 3QH6A 1PK6B 2CTVA 3ZFFB 5CG9A 4N9IA 1GV9A 2B42B 3VKFC 2DFCA 2YMZA 5LK5A 2JG9A 4GMP3 3TYJA 1DZTA 4NO4A 1RJ7A 3AYCA 1QJY3 3VKLA 1MS5A 5JIUA 5GKAC 2E7TA 1IKQA 4BMBA 1KRIA 2A5ZA 3WW3A 4DRRA 1QJX3 4Q8LA 4QM8A 4AFMA 4EWEA 2MEV3 3FZ3A 2NM1A 3OBTA 4A3XA 2R072 2G9FA 1X50A 5CFDB 4NR1A 1YHFA 1SCRA 1AXKA 3VZKA 2DWRA 4RHV3 2NQYA 1ASJ1 3H7JA 1C3HA 1MS3A 2BNNA 3AK0A 1V9U2 1J3RA 1J3QA 2HWD2 4EN0A 1OKQA 4Y20A 2RR11 3QBQA 3MFAA 5KHGA 4C0HA 2ZGQA 2EAAA 1AUYA 1TME1 1HQWA 4BE3A 4FOYA 2Q4SA 3B9IA 3SNMA 4N53A 2RHPA 4LUKA 3OPZA 4YW3A 4GIQA 5KBFA 4I01A 2GSYA 3WG4A 3IKWA 2IZWA 1CX4A 4N43C 4U36A 4AFDA 1UPIA 2C5DA 2B39A 3RPQA 2B46X 5FO7B 5JOXA 4FTSA 5IT6A 1G6NA 3CJIA 2VUAA 1APNA 3AMPA 5FQ0A 1IQAA 1BEV1 2PHDA 1ZZ9A 4IXLA 3LSDA 1V6OA 2XBO1 3WNXA 3I4IA 2PELA 5BNOB 2WLPA 4CP1A 3KB5A 3BB6A 4E4DX 3TBDA 4IEZA 5AC93 5FCCA 1YIPA 2N7GA 5EYYA 3ZN6B 4S2GA 5DZEA 5C8CA 3VHRA 3PVNA 4FPKA 4YM0A 4OI1A 2O8OA 4XF1A 3CU7A 3AZXA 2WZR3 3HT2A 2GDFA 3ETQA 5ABJA 1RHI3 1CAWA 3IDBB 1GQHA 2R043 3SITA 4UBHA 1ZRFA 3FJSA 5ACA1 1EYBA 4W6XA 1HRV2 1BZWA 2WZPP 4YSFA 4Z1VA 2VQ0A 3KT1A 2XVKA 4AE2A 4IEQA 4EROA 1YNAA 3B01A 3IPVA 5T5PA 4OI2A 3ZSMA 4X8NA 4D7SA 3PJYA 2D98A 3BCWA 5HCBA 4FXKB 2Q0AA 1TNRA 1XE7A 5IK4A 1X8EA 2QDRA 2RS12 1KS4A 3GZAA 2V09A 1XYPA 4Q4X2 4CYDA 1U5XA 3INAA 1PGW2 5HXVA 3KLSA 2OA2A 1A3KA 3AXEA 1NCRC 3MIDA 1MEC1 3MIGA 1FPN1 2A3YA 4WM7A 4AWDA 4YG3A 1AYN3 4ITCA 2WNUB 1HKDA 1G9CA 1GNZA 2QVSB 3MLKA 5FREA 3S0MA 1G9FA 4AQTA 3JD72 1HDKA 3VKMA 1V00A 3WLUA 4OHYA 1AR73 2HWB3 4FOVA 4L92A 1NCQB 3E6BA 3LA3A 2NMOA 3NV3A 3ZXKA 4BMEA 1W6OA 4XE9A 1BQPA 1L3JA 2RJLA 2DCZA 5JPNB 1OOPC 4K3UA 1HW5A 1C1FA 2QKDA 1VBC3 1CAUA 1N1SA 3MFCA 2VOXA 5C8WA 4JDNA 1BBT3 3GBGA 1VB2A 5EV7A 4RQPC 2XLGA 4Q4Y3 2XHKA 1QJU1 2MNGA 3TB0A 4AI3A 4Q0UA 3C2UA 1VBB3 4JCKA 4YGBA 5GLZA 3V0BB 5KHKA 5T55A 1XNKA 3B5LB 1VBD1 2GU9A 1KJLA 5GZEA 1DFQA 1JYCA 1VBE2 4DS0A 1HXS1 1CESA 2YV8A 2NLRA 3AZYA 3BOPA 4IV1B 4RFT0 4NN0A 2RS33 1GZCA 4LBOA 3BIWE 1NA1A 1MS9A 4ASMB 5T5OA 4HVQA 1DIWA 5BXXA 3ZSEA 3UK9A 4IEWA 3G6JB 4KBBA 4QMAA 3D6EA 1ZZCA 3WQ7A 1OA3A 2WNVA 2ETEA 3CL1A 4R9BA 1NXD1 1C8M1 4CDXB 1BYHA 3MW4A 3MPPG 4XQ4A 2H0VA 3NKGA 5F5QA 2FHRA 1CIWA 5FOBB 1EV13 4AXOA 1GANA 1G9AA 1O5UA 4PIXA 5KHJA 3NO8A 3IWZA 1RUJ1 4JAAA 3ZFGA 4AHZA 1ZX5A 4DY3A 3D4KA 5A3MA 5JLVA 4HPKA 4JDOA 3UJOA 4XJZA 5BY5A 1W6PA 5E16A 1LULA 2AZ5A 1D4M1 2XLFA 4LEJA 2XJRA 1ASJ2 3SH5A 2ZHNA 2X5IA 2JG9C 2G9GA 1F9KA 4IEUA 1YCIA 4Q29A 3N7KA 4FCAA 5I8SA 1CONA 4ATFA 3E97A 4PCRA 5L7OA 5FFOC 1G9BA 3M3QA 1UD1A 4Q2FA 4Q4W2 3QCWA 1C8NA 4ISQA 4F3JA 1O7FA 1HQNA 1CJDA 3SHRA 2A6YA 3T1MA 2NYYA 4AEDB 5JR7B 1SEFA 2E53A 1R083 2DVBA 1ZVFA 3JCIA 4HKWA 3H8UA 2YC0A 4Z92B 1WCSA 4BIOA 2DVAA 4YFWA 1BEV2 3USUA 4JGYB 2GN3A 1JN2P 1YIFA 3CO2A 4DY5A 1FMD2 1U5IA 1UF2C 1URXA 4LE3A 5GZCA 2DCJA 4H14A 1KFUL 4N53C 3VBFB 5CAZA 4NWVA 4C1WA 4YRDA 3HQXA 2WNEA 3JQXA 5T52A 1VIWB 4AVCA 3AZVA 2RMU1 1LOEA 4FOQA 3CJIC 3E6DA 1SBEA 4EN6B 1FXZA 4PLNA 2ZGNA 2YUEA 1U12A 1C57A 2IFRA 4QPGB 2HWF2 2ERFA 4XXAA 2LTNA 4I30A 4BQ1A 4D69A 1JW6A 1EP0A 2VGDA 5DDJ3 1UZZA 1ENSA 2VMGA 4YVWB 5C8CC 3EBRA 1UZYA 2PLV2 3RQ0A 3VZJA 1H4HA 2OIIA 4LBQA 5DUWA 1H8TA 4MUVA 5ABJC 4Q1RA 1RUI1 3U4XA 3CF6E 2XL7A 4I3GA 2MPFA 1N47A 1RUH1 4AI8A 4AVVA 3AMMA 4XETA 3TWIA 3ROUA 1Z0HA 4BLJA 3TN91 4ES9A 1CAXA 4CEWB 1H2KA 4GA9A 2W0XA 1J3PA 3KD4A 5LEKA 2RR13 2LM3A 1ULCA 1QQP1 3W58A 1WBFA 3VKNA 1PNFA 2NP0A 1IS5A 3JB4C 4FQZA 2UWCA 1QOSA 4GH4A 1VRH1 4BWOA 5K8SA 5GLVA 4MVTA 2WT1A 3WP3A 4E4SA 5J96B 2Q8OA 5A33A 4LT5A 1VAVA 1I3HA 1OHFA 5DG2A 1LODA 2ZX2A 4CDWB 1WD3A 3PHMA 4QGNA 4A7KA 2NMNA 4AVAA 4PDWB 1RUC2 4ATEA 4MX3A 1AXZA 1GLHA 4FQ4A 4LBNA 4DQAA 1MQTA 2ZX3A 3AMNA 3B94A 1VALA 4WM7C 4BZ4A 1DQ5A 1ND2A 1REEA 3H1WA 2HEVF 2AUYA 1PVC1 1RVF1 2PA7A 3HWJA 3LB9A 4GXLA 2OW4A 2VXRA 5F9TA 3AJYA 4X8PA 3ZXLA 2DTYA 4FOWA 1O3TA 2ZPXA 2EXKA 3M4FA 2A6VA 2WINB 2WA4A 4YVSB 5AVPA 1G8WA 1A8DA 3MLJA 4Q0QA 3NAPA 1DGWX 1VBD2 4FO9A 1CN1A 1ZBE2 3RYKA 3VN4A 4YLZA 4FTEA 5FAXA 2F6BA 4BA6A 3W59A 3B7MA 1ZZ6A 5GM0A 2IXCA 5ACA3 3FLTA 1RUG3 2ZZQA 4AYUA 1JOJA 1OFNA 4COUA 3PTYA 3FX3A 5CU1A 1SFYA 4TZDA 3RRDA 3ZMNA 1QDOA 1C8M2 1OD5A 1V9U1 2HWD1 4Y1XA 5SV8A 4LLOA 1N3QA 3MEPA 5JSRA 3VBUB 3BU7A 4ZU5A 1SLBA 1QMJA 2P2KA 1RGSA 2YYOA 1HV0A 4K21A 1FV3A 1NA1C 1ZBA1 2D6NA 4R4ZA 3S7IA 3EXUA 5EZWA 2BWCA 1DU3D 1VLNA 3ZPYA 3LOIA 5KHHA 2WQZC 4TSVA 1MEC3 4HSLA 2ZKLA 2WNVC 2D3SA 5D8AA 2YHJA 3AKTA 4XF9A 1D2SA 1ND3B 1S0IA 1X8MA 1QH7A 4LLFA 3SMHA 2ZMNA 1D4M2 2UY8A 2P17A 3WX5A 4H3WA 1PNGA 4MYEA 2ZMKA 3AX4A 2TNFA 4K9SA 2EXIA 3AFGA 4LNVA 3EJKA 5H9SA 4AW7A 3D5OA 4Y22A 4XBLA 3ZFGC 4RR3B 4CEYA 4EN9B 2ZX0A 2RS53 5LEJA 2CYFA 1S1AA 1UU4A 1QJU3 2F4PA 3WINE 1VBA3 4HK9A 4JGYC 4AGRA 1RMU2 5GLWA 4NHLA 2Z79A 4J1WA 4B8EA 2GMEA 2X5IC 1ZNPA 1HRV1 3OD4A 3IDCB 2HKXA 1BVVA 4COYA 4D94A 1N3OA 1DQ2A 1HXS3 4AG4A 5BNPB 5L7OC 4DNYA 1AL21 2G4IA 2XJTA 1SMVA 2FZ1A 4FAGA 5JPMB 1MR5A 4KNCA 3VBHB 2JE9A 1QXPA 3ASIA 4XILA 4W6YA 2DV9A 1AR81 3OYWB 3AM2A 2C0ZA 2RS11 3MLLA 1AZDA 1PGW1 2BWAA 3VBRB 1C5IA 3P3NA 1FATA 3T2TA 4WM8A 4FPEA 3HBZA 4JTOA 4YZ4A 1QNYA 3H50A 4RS5A 3U11A 1WW4A 4QPIA 4RGGA 4E9KA 1QWRA 2DTWA 1ZZ7A 1MZ5A 5C6CA 5I8YA 4FPGA 4TLFA 4WVMA 4Y5Z0 1RUJ3 4DB5A 1U0AA 2QZ3A 3I59B 2AYHA 4I2OA 3ZX7A 1DGLA 1IGOA 1RUE2 2Y38A 1R1ZA 2ZOEB 3OJBA 1GZWB 4CP0A 1TQ5A 4XDQA 1KD7A 5GZDA 1FOD3 2HWE1 2QDNA 1RUH2 1TMF1 2EAKA 4WVZA 3OF1A 2UWBA 1C4RA 1PMIA 3SCFA 1YI9A 1RUD3 1BJQA 4KU7A 5A32A 1DYKA 1PK6A 3K48A 3AJZA 4HSJA 4Q4V1 4RHV2 3ZFFA 1ALYA 4XF0A 2R063 1CQ9A 3ST7A 3CLPA 1LECA 4Z07A 1NLRA 4GB32 4YM2A 2A6ZA 2XKPA 1NE4A 5JSOA 1HX6A 3KZ4C 1A8MA 2JJ6A 5L73A 2BQPA 1LCLA 4AK3A 2GNBA 2JX9A 1H8TC 4L8QA 3O0XA 1KFXL 2CY6A 1O4TA 2XJVA 2ZGPA 1UKGA 5GLTA 1S0FA 5AFBA 2VU9A 3H0OA 3R4DB 4INDA 4BM8A 2PHRA 3RJRA 5CFDA 1H2NA 1LHUA 3K51A 1LJ7A 4QQPA 2VECA 1J58A 1FYUA 1Q8PA 3FC0A 1RVF2 2EALA 4URTA 1OPOA 4I0AA 2P3JA 4XJAA 4M3CB 4GH4C 3UV9A 1OA2A 4QX5A 5BNNB 1LHOA 3WDTA 1C1LA 4MLOA 4JGZB 2PAEA 1EAH2 1JH5A 3KM5A 5C4WB 5JOYA 1MZEA 1WD4A 1PZ9A 1MQTC 3KSCA 3S30A 3J4UH 1ND2C 2XL9A 1RUOA 1AHSA 3WVJA 1RIRA 4FP3A 4AFCA 3GYDA 3RG0A 3FBMA 3TNPB 4MXWB 3FUQA 4V1PA 1S0DA 2PHUA 2D93A 3MIFA 2HYKA 5BNOA 3BOWA 1PO11 4PIZA 3NAPC 3QD6A 1DZRA 1NLSA 3ZN6A 1Q8SA 1RUI3 1PIV3 3WDUA 3UJQA 2ARXA 2HEYF 4Q4W1 2ENRA 5KXDA 3I8TA 1ZBA2 1WMFA 3KCXA 3UL2A 4RGAA 3TN93 1XYOA 3ZYJB 4R52A 4E2QA 2HEWF 3I54A 1N3PA 1RC6A 1S0BA 3EQEA 1FNYA 2I74A 2Z69A 1SLLA 3S7EA 1BVP1 2AR6A 1VRH3 2Q5TA 1LHWA 1LGNA 4XYXA 1FMD1 5FTTC 2A7AA 1V6LA 4R9CA 2UYBA 2ZJCA 4LO8A 4D3WA 2SLIA 3B93A 2JG8B 3VUOA 4JRAA 1XQNA 4KU8A 5BV6A 1XU2A 2D5HA 4Z2WA 4MGKE 5D8AC 4KL1A 1LOAA 1PVC3 4FT8A 1OMIA 5BUVA 5A3LA 1BBT2 2CWSA 2NZ9A 1ZM1A 4JC1A 3A4UA 2MHFA 2XVLA 2WNUA 5F6LB 2HWF1 4P9GA 5JIAA 3RJ2X 4SLIA 2A6XA 1R092 3WDXA 4Y1YA 3V65A 4HK8A 1H30A 3FFZA 3ZYRA 3DL3A 1NCQA 2LUWA 2PLV1 4QQOA 1AL22 4FPFA 2WKKA 1POV0 4CEYC 4IQPA 4KWKA 4YYOA 1CAVB 4O9GA 1AR82 2R073 1AR62 3ZYIB 3AXDA 1UL9A 1D0HA 4AEMA 1A6CA 3ECQA 3CJXA 3B9CA 3ZXFA 1IZ3A 1YWKA 3BODA 2Q1MA 1QJZA 5J37A 1Q5OA 1D2QA 1GICA 4XMAA 2BTVC 3PVEA 3R05A 4KQ7A 3ZXGA 4LE4A 1ONAA 3U0ZA 4CDQB 3V0BA 3SXWA 2GALA 1D4VB 1R1A2 2ZABA 2XWJB 4IV1A 4YG6A 4LBKA 1AJOA 2CAUA 4WZCA 4GMP0 3J8F2 5CB7A 5CFCB 1RUC1 2O8QA 2ZAHA 4FPCA 3RZZA 5FDBA 2HWE2 3KQRA 1TMF2 4TWTA 2H6CA 2ZS6B 4X6RB 3HT1A 3QLQA 4WM8C 3N3HA 3O0WA 4H7LA 4RS5C 4CDXA 1HRI2 1PVXA 4MGIE 4Q4V2 4QPIC 1RJ8A 4XF3A 4XFIA 4XIKA 5T54A 3RS6A 3WCSA 4PLMA 3LGRA 2NPIA 1NQDA 3WHTA 1QDCA 2WIIB 2ZGMA 4BHPA 5JSPA 1NE6A 4ZKTB 4AQSA 2CGPA 3RWNA 1ZBE1 3ZFEB 4IL7A 1DBNA 1J59A 3E6CC 4GKXA 1XNBA 4B7KA 2IWGB 2ZHMA 3AZWA 4IEYA 4PBPA 1C5HA 2A3XA 1CGPA 4XJ9A 3APBA 5LK7B 2BVVA 1R082 1PK6C 3ZFFC 3AB0A 4YW4A 3B69A 3Q9OA 4MGYE 3VBOB 3WZ1A 1WLWA 5L19A 2BVBA 1LRHA 3AP5A 1AR93 5K0UB 3BTAA 2C1FA 4CZSA 4IEPA 1SLTA 5CNAA 3ES1A 3DN7A 5T5JA 1COV3 4UW3A 1MVEA 2VQAA 1RUF1 4Q4X3 4AEDA 3A0KA 1NOVA 4J1XA 4C91A 5KXEA 4HT1T 1VP6A 5CFDC 4KG8A 4XF4A 2BPA2 3VBSB 1W2UA 5GLUA 4DRVA 1G9DA 1YJKA 4YM1A 3O0VA 2A75A 2B5HA 5FLHA 1SLCA 5JI9A 2BGCA 2VMIA 4IV3B 4CDUB 1SFNA 4SBVA 4EN7B 3JD73 3HR9A 1DQ4A 1GBGA 2ZA9A 4JGYA 1REFA 3G7DA 2ZGSA 1KQRA 1QOTA 2TBVA 4IETA 4ORFA 1SBDA 1PO12 1ZRCA 5DUVA 3N36A 1DQ0A 1Y9QA 2VPVA 4WBBA 1CPNA 3VBFA 5CBLA 3NV4A 2H0BA 4GKYA 3VDDB 2Q30A 1UU6A 2D6OX 2Y26A 1DDLA 1RTVA 3KT4A 3N4MA 4UBGA 1LTEA 1Q43A 2WSUA 1AYM1 2C9AA 5L36A 2Z42A 3VV1A 2V5YA 4QU2A 1Z7S2 1KS5A 2WS92 4XFFA 5J3UA 3RMXA 2O1QA 2Z5WA 1N1TA 1CPMA 4QPGA 2GC1A 3ME2A 3R4UA 3ZMOA 1RMU1 5BNOC 3IDEA 3HN1A 3NW4A 3POSA 2HWC2 1IS6A 3ZXEA 3ZXDA 4LULA 1VBE3 1POV1 5FO8B 5DZFA 4YVWA 3PJQA 1FT9A 3IM0A 3JBG2 4QM9A 3WY6A 2W52A 5IK5A 3ACLA 1RB8G 2FBEA 3M3CA 2XKOA 2OPKA 3CEWA 2BYVE 2Y0OA 4YNIA 1XE8A 3GZUC 2BFUL 1PO22 1OFSA 2VW2A 2WLQA 4CEWA 5EYXA 1EPZA 4YFZA 2VUJA 4XPVA 5KXBA 2UWAA 4Q0SA 1VJ2A 4B4PA 3IIAA 3THTA 1B35B 1MS4A 2CL2A 2D6LX 2PN5A 3WW2A 1WLTA 1FAYA 2ZGUA 2R16A 4E2GA 2CGNA 2GH2A 1GSLA 3KGLA 1W6NB 2YZ4A 4AVSA 3VLBB 4GMP1 4YZ1A 2PHFA 1DQ1A 3AKQA 3WV6A 3WDWA 3AMHA 3E5XA 2XUMA 1PZ7A 2DVGA 4CDWA 1I1EA 5F1RA 1RUE1 2GNMA 4PDWA 4LA2A 3PMEA 2YROA 1XU1A 1K5MB 4ONUA 2QFEA 5KC5A 2A71A 2D43A 5CA6A 4EN8B 2WNUC 1ASJ3 2OZJA 4FPHA 2GC0A 3KCYA 5SV5A 4RHV1 3M2MA 2DUOA 4Y1ZA 2D6KA 4OZXA 2WQ4A 3D8CA 4HZFA 2E7QA 4XHXA 1TME3 4YVSA 1S55A 1LU1A 4GB31 4S2FA 3W9AA 2QUOA 1Y3TA 3P3PA 4LA3A 4KG0A 1NCQC 3ENRA 5BPXA 1SLAA 2GC2A 1O3QA 3E5QA 4JQRA 1YO8A 1BKZA 1B09A 2Z2SB 3DV8A 2GNDA 4AEJA 1XNCA 5JZGB 1IPKA 4HN0A 1BK1A 3MIEA 4S2DA 3H9AA 1BEV3 1JUHA 1UIJA 1CJPA 2XBO3 5DZGA 5E8AA 4HVOA 2WL1A 1DGWA 5I8TA 4Y1UA 1AX2A 1GZ9A 2TEPA 3VBUA 3JUUA 3MI8A 4GULA 4ISRA 2EXHA 2GMMA 4NVPA 5AC91 4IV1C 3QH7A 4LO7A 2XVGA 1EAH1 2RM22 3MW2A 2GAUA 1HV1A 1V6JA 2BW8A 1LOFA 3LZZA 4XTMA 3O14A 3AP6A 4GQ7A 3H3UA 1LOGA 1IOAA 1U5ZA 5GZGA 3OTFA 1LB2A 2FMYA 1F8VA 3N35A 2OZ6A 1KJRA 2R041 2HWF3 4HKLA 2D40A 2R6QA 4CDXC 1ND3A 1WMEA 2VULA 2LALA 2GN7A 2QCSB 3MZHA 2WFF2 4H7MA 2NN8A 2OYZA 2PLV3 2JICA 1OLQA 4QQ2A 1W6MB 3QOPA 1SCSA 1YFYA 1ULDA 4HN1A 1N1VA 1W6QB 1WLDA 2DCTA 3WUCA 3AZZA 1RUF2 4RR3A 1LEMA 3WDVA 3LKJA 4IERA 1AX0A 3GF6A 2DVDA 1FPN3 3WG2A 3OY8B 3VZNA 3TAYA 4RD7A 4K8FA 2RE9A 1H2LA 4B29A 5J7MA 5LRSA 2GH8A 4AHWA 1AYN1 2VMHA 5HI0A 2B45X 4OI0A 3MDPA 4AI2A 3N7LA 3RI8A 3KS7A 5BNPA 4XFCA 4LTAA 3ZIXA 1LEDA 3RYPA 1V6MA 4LUMA 2HWB1 4LO4B 5J36A 1RUC3 3VBHA 4AEDC 3OYWA 4J6GA 1DF0A 2SBAA 1AYM2 3PVBB 5J98B 1FOD2 4Q27A 2D97A 4N43B 3VBRA 3RNSA 1VBC1 1ENQA 2R32A 3QACA 1SDWA 1RUD2 4MGZE 3GHNA 4AI0A 2YDEA 1BBT1 2PFWA 3HIFA 1DQ6A 3J9SA 4O9EA 3MIBA 2ZGKA 3E5UA 2PAMA 2X8KA 4PF5A 4KGQA 5I0TA 2FQPA 1VBD3 1S2KA 1ZBE3 1R091 3H3ZA 1V70A 3VBFC 4XOGA 2IXJA 2XB6C 3I59A 4LBMA 4Q0PA 3CNAA 1GNHA 2TUNA 4W65A 2AREA 2RS31 4L2NA 1GZWA 4QXKA 1AR61 3OGGA 3NVCA 5FBZA 1LOCA 2ZHLA 4JDMA 1FNZA 3MIHA 2IC1A 1DYPA 2VOWA 1H9WA 1C8M3 4QPGC 1LGBA 2WC2A 5B2GB 1WCDJ 1Q56A 2PQQA 4X6QB 2OVUA 4W6WA 4OHVA 1CVNA 3HD8B 1H9PA 1TEIA 2E9QA 3NSTA 3V0AB 5AVAA 1IS4A 4YVWC 2I07B 3S6PA 2YXSA 4R9DA 4YM3A 1DHKB 4NHMA 1R1A1 4K20A 1EV11 2I2SA 1MVQA 4LHNA 1MZFA 2P3KA 1QJY2 1ULGA 5FRAA 3V56A 1H4GA 4HVRA 1QXRA 1QJX2 3J8F1 2QQPA 2PHLA 5JAXA 4CEWC 5H9RA 2MEV2 4HLTA 2UURA 1T6GC 1D4M3 5GALA 5JDBA 1NCRB 3ZIWA 3IT8A 3NV2A 5C33A 1HRI1 1GFF2 2BNOA 1PGL2 4XQDA 4M3CA 4YGCA 1XYNA 3VKOA 1ENXA 4QD2A 5BNNA 2DVFA 1W39A 4JGZA 1HLCA 3FMGA 4CDWC 3KMHA 5C4WA 1PIV2 4L99A 1AL0G 1QHDA 4PDWC 4WZFA 3GNEA 4LBQD 1NYWA 3L2HA 3AYEA 2DU0A 5E1RA 3TRSB 4EJRA 1PHMA 4YG0A 1OOPB 4UW4A 4YW2A 5T50A 3VL8A 3WG1A 5T5LA 1BXHA 4N9HA 2VOKA 1HQLA 4QPYA 4Z8BA 3ATGA 1R081 1Q3EA 1M06G 3RMYA 4P9LA 4QGMA 3UKVA 4RQPB 1JYIA 4MXWA 1HIXA 4YVSC 4XJUA 2A70A 1RITA 1O3RA 1QXJA 1EPWA 2UYAA 1WMDA 4XXPA 2IXLA 3LA7A 3TOJA 4N90A 5AC92 1SACA 4P14A 3DPRB 4RL7A 2ET1A 2IXKA 2ZX1A 5FPZA 1ZRDA 4XW3A 1LKNA 1W0PA 4I3PA 2D6PA 4BYYA 2RMU3 4U2AA 2DUQA 1J1LA 2WZR2 1OQEA 3WQ1A 1EY2A 1RHI2 5HBAA 1S0GA 2ZKNA 4GALA 3VZMA 2R042 3GHMA 2JEMA 4YW5A 2DURA 3WXPA 3VBUC 2BNMA 3ILNA 5C9AA 1RUNA 1X82A 4D7TA 4OUSA 4QT6A 1JUIA 2JENA 4P9IA 2O0OA 5DDJ1 4BPZA 3EO6A 4FXGB 1RUE3 3D0SA 4C0BA 3ES4A 1QOOA 4HMZA 2JG8A 3WP5A 3O12A 1NY72 1LOFC 1H8VA 4P9JA 1RUH3 3JB8A 4UXAA 3MYXA 4BCUA 1WW6A 3LSEA 1ND3C 1Z7S1 2WS91 1LHVA 1W0OA 3AKRA 4AVTA 4AF9A 4D7YA 1QQP3 3N7JA 2FZ2A 3PLQA 4GB33 3SCHA 2QE3A 1AYN2 1UU5A