1HV0A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYFVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv0A00
3VHOA 2Z79A 2BWCA 3B7MA 3MF9A 1KS4A 1UU4A 2DCYA 2VULA 2DCZA 3VZJA 1C5HA 3WR0A 1UU6A 3AKQA 4S2DA 1UU5A 3EXUA 1OLQA 3VL8A 1KS5A 5EJ3A 3VGIA 2VG9A 2DFCA 4S2FA 1OLRA 2VGDA 3HD8B 3WT3A 5HXVA 1BCXA 3VHNA 4S2GA 1F5JA 2B45X 3AMPA 2QZ2A 1NLRA 2D97A 1H8VA 3VZMA 2D98A 3WX5A 3VLBB 2JEMA 3MF6A 5K9YA 1XNKA 1UKRA 3O7OA 5K7PA 2DCKA 1XXNA 1W2UA 3VZNA 2DFBA 2NLRA 1REFA 2NQYA 3AKTA 3WP5A 4XQWA 2B46X 1XYPA 4H7MA 2BWAA 1C5IA 1HV1A 4XPVA 1H1AA 1HIXA 3M4FA 3WXPA 4S2HA 3VL9A 3B5LB 3VZOA 1XNBA 2QZ3A 4HKOA 1BK1A 2BVVA 1XYOA 2B42B 3AMHA 2VUJA 1IGOA 1XNDA 2JICA 1T6GC 3WP4A 1M4WA 1OA3A 1H4GA 1QH7A 4XQ4A 3WQ0A 1XYNA 1ENXA 3WQ7A 3WQ1A 4HKWA 3AKPA 3LGRA 3WP3A 1PVXA 2JENA 1OA4A 3VZKA 2C1FA 3MFAA 1BVVA 3AMQA 3RI9A 3AMMA 4HKLA 4XQDA 3AKSA 1REEA 1QH6A 1HV0A 3VHPA 3VZLA 4HK8A 2BW8A 1YNAA 3WY6A 3WP6A 1REDA 3AKRA 3LB9A 4NPRA 1AXKA 4HK9A 3MFCA 1OA2A 4IXLA 2F6BA 3RI8A 3ZSEA 3AMNA 1H0BA 1H4HA 2DCJA 1XNCA 1TE1B
chains in the Genus database with same CATH superfamily
1LULA 1XE0A 5CAZA 3RS6A 4TTGA 1VRH1 3I7DA 1ZA4A 3DL3A 3GZAA 5FZ0A 4AGVA 1LCLA 5A7SA 4S2DA 5FREA 2R062 3DKWA 4WVVA 4YARA 3IAPA 4BQ2A 2RG4A 3VL8A 4CDWB 1YJKA 4P08A 3POBA 2WO2A 2AEYA 4O61A 5A33A 3RYRA 3ZDVA 1HDKA 1RUH2 2KR2A 2WSUA 4QPIA 3VDDC 4XF9A 3UESA 1W2OA 1VBA3 4WVZA 3DPRC 1GP5A 1QXPA 2RR12 5FJHA 1QF3A 2TEPA 3BTAA 4N7IA 5HV4A 1K5MC 2GN7A 1WWYA 2ATFA 4N53B 4OQ9A 2Y6HA 4YM0A 1IS6A 1KEXA 2BGCA 2CDPA 2GN3A 4KGQA 1XSRA 4S2GA 4ZU5A 5FZ7A 1UWWA 5FUIA 1BEV3 1WD4A 5FWEA 5CG9A 1H2NA 1TMF1 4URTA 1VRH2 4EWAA 5FO8B 2O8OA 3C8XA 4ZU4A 2O1QA 1QU0A 4MUVA 4CDUB 2YBPA 4Y20A 2XLAA 2HBUA 4MGIE 2ZGNA 2VZOA 4O9GA 4LBNA 3AJZA 3J7NA 1RIRA 1UOFA 3TN93 2XUEA 2EIBA 3LA7A 3LDBA 2WO1A 1CPNA 4ZHNA 3LA2A 3ZXJA 3ZR6A 3AXDA 5IW0A 4HANA 3POGA 1OFNA 4YVSC 4CRQA 3T0DA 1JZ8A 2G19A 4A7KA 2P34A 1IPJA 3NNJA 1JYCA 2YY1A 1IG0A 4O9EA 4AI1A 1DQ6A 5A3WA 1PMJX 2VCAA 1CN1A 3TBDA 2VNGA 2J1UA 5SV8A 1YQ2A 3SH3A 1UZZA 4N43A 1OI6A 4HKOA 4AFAA 1JYWA 4GZ9A 5ABJA 1H6XA 1UMZA 1Q8PA 4LLOA 5HI0A 1RUC3 3NWKA 5TSWA 2GC0A 2JDUA 3AMHA 3H8RA 5GZCA 2ZBJA 2RJLA 5G04L 4C0HA 2D3SA 2VZ1A 3MIEA 1T6GC 4QPGA 4XMAA 2OUJA 1A3KA 1LNSA 3H1WA 4RR3B 2VOVA 2RJKA 2YC2A 4QHBA 3FLPA 3MIHA 2KD7A 4D7SA 3OF1A 1JZ3A 3V65A 1LOEA 4GB31 2JDNA 4IE4A 5F32A 5GLTA 2R0HA 1FATA 4XETA 2QVSB 4YW2A 2VNOA 3BOWA 4A7ZA 4GH4B 2YUEA 3I3EA 4ORFA 1U5IA 2JB4A 3ZN6A 2WLPA 2XJSA 1RXFA 5I8TA 4JX0A 2XBO3 2TUNA 3RGBA 1MEC3 3KSCA 4M00A 3GALA 5BNNC 2VOXA 1NA1A 1YNAA 2X29A 3P3NA 4NN0A 3UYJA 2ARAA 5FLJA 1YQ5A 2R063 4R4XA 5FBZA 4Q8KA 4FPKA 2Q8CA 5C8WA 1IHMA 4GD4A 2HWF1 5T5LA 4UFIA 5FLHA 4YZ5A 5JZGB 4N43C 2QFEA 1UZWA 5ABJC 3RZLA 1XNCA 4QU2A 4GB32 1TVGA 1H8TA 4MH0E 4OHWA 5A7WA 4Z1VA 3WF0A 3KHBA 2E53A 5T5PA 2DCYA 4CDXA 2R30A 1HJFA 1UU6A 5FP7A 5JLVA 3FHAA 4CP9B 2OVUA 4XUTA 2VU9A 2W1QA 2XPJA 1OLQA 1UZ0A 2GMEA 3AK0A 2HWE1 1SLCA 1VRH3 5A1LA 4HLTA 2FDIA 1G9BA 3RQ0A 1W6MB 1PX3A 3IMNA 1JBCA 1SFYA 2HWB2 3A23A 3OEBA 4EWDA 1G9DA 4TLGA 3ZSJA 2W1UA 5KBFA 3N7JA 4YGDA 1O4TA 2VZQA 4PI0A 2W47A 4Y4RA 5JVVA 1AX0A 1NA1C 4WM8B 3OTFA 3N9MA 1DZTA 1DLLA 3U1XA 4B4RA 4HPKB 1GWLA 1W8OA 4LE4A 4JRAA 4LKDA 4A6SA 1CQ9A 2XMLA 2WWUA 4AVCA 4DXSA 2GC2A 3OGSA 4CPBD 4GA9A 5EHDA 5IT6A 2PHRA 1NYWA 1O3QA 3FBYA 1FX5A 2VQTA 4FO9A 3GHMA 4A3ZA 1STMA 3VKOA 2YPDA 4IEOA 1TMF3 3I2IA 4RL7A 4C1WA 2HWE2 1X82A 5FYIA 4AK3A 4CU9A 4DO0A 3V0BB 1YI7A 4NHLA 1ULDA 3T2QA 2I07B 4UW4A 4BHPA 4CDXC 5FAXA 5DABA 5FZ3A 4B7KA 1LESA 5C6CA 4IE5A 2A6XA 3FHIB 3PURA 2ZGQA 1HRI2 4LOSA 5KWRA 2NM1A 2QNKA 2VZUA 5JI9A 2RDNA 3PDQA 4AEDC 4CEYB 5LCWL 4R52A 3B5LB 4DXTA 5KHIA 1UYPA 4BQWA 4A3XA 1VB4A 5CFCA 1LOFA 3UGHA 5C8CA 1WW5A 1SQ4A 1UIKA 4PQ9A 1IGOA 3VKMA 1SACA 2WZR1 1K5JA 1OPOA 4Y26A 4Q0SA 3UT0A 3WW2A 1UXZA 5IYYA 1J59A 3GZUC 4YM1A 2E26A 3BCWA 4EV0A 1FV2A 4ZS2A 2BUKA 4WM7A 5D8AA 3JQXA 3D4KA 1ZZ8A 2OPKA 2VMGA 3OEAA 4EN0A 3O1OA 1OQ1A 2YG0A 4XJZA 2WN3A 1NE6A 1OF4A 3IPVB 4EWEA 1LEMA 3DF0A 4ZKTB 1W6QB 1YYNA 3LPFA 1ZX5A 1B35B 5JOYA 4GB33 3ZFEA 3WZ1A 2GZWA 1LU1A 5IVBA 2VQ0A 3ENRA 1HV0A 4KQ7A 1RUD1 5GLVA 2HKXA 2MEV1 4W4ZA 3FL7A 5J3UA 4PI2A 1GQHA 3NNFA 2YHJA 2FDKA 3AKRA 1SG3A 2JECA 2R072 2VNRA 3GYDA 4HK9A 4XJ9A 1YHFA 3CMGA 3IDBB 3RI8A 4WVMA 3ZSEA 1LHNA 4BQ4A 3DGTA 4EZ4A 5DAPA 1VR3A 1TME1 2X10A 1QNYA 4V1PA 5C8CC 2BWCA 2V09A 5IVFA 1LAJA 2HWF3 3R05A 2DVAA 2PAEA 3SCHA 4HZFA 5JXGA 4WM7C 1KJRA 2GSYA 3GBGA 1ZBE1 3USUB 5T50A 2RS51 2VOWA 3POYA 3VBRB 4XXPA 2C26A 1PM7A 1Y43B 1U0AA 2GNDA 5CYYA 2MEV2 4QQ2A 5CEHA 3BI3A 2QKDA 2W08A 1YUDA 4QXHA 3HOBA 2F17A 4IV3A 3EO6A 2H6BA 2YZ4A 1PIV1 3HD8B 1ACCA 3ZFEC 2AH2A 2HWE3 1JS9A 2JDMA 3ZYFA 5F3EA 3W20A 3W9AA 4TXWA 1GICA 5DDJ2 3AMPA 5DAVA 3BVCA 1ENRA 3WDYA 2JDAA 5HCAA 4MGTA 2D40A 3ILFA 4FPYA 3NO8A 4PIYA 3VBFA 1HRI3 4OHZA 1DP0A 2WN2A 2WS91 3J7HA 3A22A 3O7OA 5F3GA 1RUF2 3WCSA 1W39A 4Y22B 2ET7A 2XG3A 5FZ4A 1GNYA 2KA3A 5H9SA 3BTZA 4NHYA 1ZBE2 4BCUA 2BGOA 3VZNA 2RS52 2WNUA 1GZTA 4JTOA 2IXJA 4Y1VA 1BXHA 4DMIA 4AQ2A 1GOFA 3K4ZA 2Q8EA 3WNPA 4D69A 4A6OA 3VBUC 2K46A 4QHOA 4DB5A 2A6YA 4NE9A 2B46X 1CAWB 1XYPA 3DYPA 4H7MA 3T2TA 2VL4A 4PLMA 5FZ9A 4BOWA 4PIZA 5FTTC 3C7OA 1CD3G 4EROA 1ENSA 1GV9A 2WDBA 1LOGA 3D0SA 4ASLA 4AFDA 4AEMA 3RZKA 3VZOA 4K40A 1XNBA 3NKTA 5IVJA 1T6BX 3ETPA 1XYOA 4IV3C 2XOMA 2WS92 3ZYGA 1RJ7A 1NZCA 2A71A 4JGYB 5AC91 3BU0A 3U0ZA 4IEPA 3KMHA 3TOJA 3NNLA 1SPPA 3ON7A 4QKDA 1LU2A 4UFHA 2ZMNA 3AJYA 4M4RA 5T5OA 3VBOB 4YW7A 1PK6A 2LM3A 3KM5A 3E1F1 1LTEA 4PT6A 5FMCA 3SISA 1ULFA 1CAUB 1QXJA 3ILNA 5GJ6A 2K2SA 3ZYIB 1WLTA 4YVWB 2WZR3 2KXLA 2Z2SB 1QDOA 1QJZA 4ITCA 3GCXA 2G9ZA 4IEUA 4P5YA 1GOGA 5EV7A 4CEYC 5C3QA 4F8AA 2R6QA 1VBE1 1WW7A 4DUXA 3ZXFA 2VVFA 3TB0A 5BV6A 1W2NA 1PNGA 4LHKA 5J48A 4D3WA 2OQ7A 5JOWA 5FZBA 1I3HA 2XVKA 2YBKA 1D0GA 3A0KA 3H7YA 2GMMA 4MOAA 1AVBA 3WP6A 5IHRA 3PJQA 3LB9A 4AHWA 5IK4A 3PVOA 2VD7A 5F6LB 2E7QA 2VBBA 3VDBA 1AYM1 2WQ8A 2QE3A 3I59B 1EAH2 2MEV3 2ZXQA 4ZONA 4RGGA 1DHKB 2FBEA 1VP6A 1CX1A 3DN7A 4ZU7A 1JYTA 3UKTA 4XZUG 3I2GA 1ZZCA 2ZHKA 4P14A 1XRUA 1H9PA 3S5AA 3MGUA 2P3YA 1WCQA 2VULA 3OSDA 4QX8A 1QWRA 4W6WA 4P9LA 5CB7A 3SEPA 3IBMA 5F2SA 3AKQA 5DDJ3 1PK6C 3NV2A 1CESA 1VBE2 1TME3 1F35A 1N3QA 5DG2A 1YFXA 2ZEWA 4OFGA 3O1UA 3SMHA 1WCSA 2IVJA 4OUSA 3U4SA 3ZFFB 2P3IA 1KD7A 1E5HA 4JQRA 1CZTA 3ZM8A 3J8F2 3LEKA 1GSLA 4XIOA 1O91A 3KGLA 1WD3A 3NV1A 2XONA 1BZWA 1ENQA 1ZBE3 4CEWA 4CUAA 1N1SA 4BIOA 1ND2B 2RS53 1AYM2 3JD71 3WDUA 3MIBA 4GMP3 4AZZA 2ZGMA 3RZGA 4MHRA 2WQ4A 3FLTA 3ITQA 2QQWA 1QJU1 3G6JB 4XHXA 2X5IA 4ZS3A 5JPMB 2BP6A 1PIV3 4CXYA 1LGCA 4NRMA 4YW6A 5J09A 1PGSA 2Q1FA 1O5UA 3O1MA 3AP7A 3BPZA 5C4WB 3VBRC 4LO8A 2XXZA 3SKVA 4NMIA 5FY7A 5CFDB 1REFA 2VM9A 5L36A 1GZCA 2WS93 3UETA 1JYIA 1DQ5A 1GQPA 3UGFA 2BNOA 2JDZA 4I0AA 5FP9A 5K0UB 1OT5A 1W03A 1DGLA 1MZ6A 1I9RA 3OGGA 5BNOB 4AGRA 4ET7A 1DYPA 1DYOA 1V9U1 5DXDA 3VBHA 3I2OA 5FZ8A 4H55A 3LEGA 1HN1A 3JD72 1DF0A 1A6CA 1H30A 1W6NA 1SBEA 1O4ZA 3POEA 5T3NA 3DYMA 4B8EA 5EQUA 4QGNA 2XH6A 1KDMA 3S57A 4IETA 3PUSA 4CEWC 3SXWA 4QM9A 4BLJA 4NUBA 1M06G 3MHZA 1TNRA 2B42B 1RXGA 4XACA 1ASJ1 5A3OA 4A42A 1N1YA 2XKOA 5GZDA 1BK0A 1ZRCA 4JGZB 1X33A 3CF6E 3WDVA 2PHWA 1S0EA 1GP6A 1YLLA 3QCWA 3RVHA 2HWC1 4UF0B 1HXS1 1OC1A 1ZVFA 2X5IC 3NAPC 1RUNA 1OH3A 3SQOA 3R6SA 2UY9A 5FZGA 5AC93 3MW4A 5I8SA 3LF7A 3SH5A 4DXZA 4RFRB 3WP3A 4FPCA 2WWSA 1V9U2 1G8WA 1EAH3 1EUUA 2R041 2R16A 4UBGA 5BUVA 1OLME 3BB6A 4BDVB 3ZOIA 3AMMA 3FFZA 3E5XA 3PLQA 4ZZ5A 5JSPA 2LW8A 3AKSA 3GBFA 1OBNA 4EZHA 2ZGKA 3BN6A 5A80A 4OVEA 2A3XA 4KBZA 3RYPA 3U14A 1ZBA1 2R1DA 4DY3A 1VPHA 5I91A 1J84A 1BBT2 4TYSA 1VBE3 2F4PA 4DUWA 1UPSA 2J22A 4YM2A 2W5FA 4LE3A 5A3PA 1PMIA 4C1XA 3AP6A 4LK7A 2WZEA 3KVBA 3H3LA 4FOQA 3WNKA 4FT8A 4UAPA 5KC6A 5F3CA 4CCOA 3U07A 4A45A 1UMIA 3MYXA 5CA6A 2PAMA 5DPNA 3OPZA 2LTNA 1JYNA 4AFBA 3O0VA 2DCZA 2WNVB 3TNQA 1AYM3 4CU8A 4P9JA 1O6UA 1PGL1 1C4RA 4R8HA 2QJVA 1J1TA 2VZTA 3PIJA 5EPAA 3ES4A 1DDLA 4P9WA 4RQPB 4QDSA 2BOIA 5BXXA 3WHUA 1HB4A 5A32B 4MGSA 5FY5A 3UKNA 1N1VA 1CJPA 1SZBA 1ZBA2 2VC9A 1CZVA 1MQTC 3K75B 4AI2A 4AVSA 4BLIA 5AFBA 4JVAA 1UY0A 3ZXLA 1C8NA 2QQNA 5JOZA 2HBTA 5GZGA 3WT3A 2BEOA 3KF3A 1BCXA 1E5IA 2Y6KA 4G3YC 4XFHA 3B01A 2FQPA 1Z78A 4CP2A 4CDQA 4XURA 5HCBA 1NQJA 1C8M1 2D5HA 4OUEA 1S0GA 4AQSA 4YSFA 2QQMA 3T0AA 2BNMA 5IFPA 3I3DA 3J7MA 2PHXA 5GZEA 1XE8A 4XFIA 3JD73 1GUIA 4LBKA 4DZGA 1ZZ7A 3OPTA 1PGL2 1WGPA 5JMOA 1QJX2 3Q8FA 4UW5A 2GC3A 2W1WA 1QJU3 2NLRA 5FQ0A 3OUHA 3PMEA 4PDWA 1DBNA 4FCAA 4LNVA 2VCMA 4I01A 1ND2C 2D6NA 2HLEA 2KM2A 2P37A 1K45A 2UURA 1GQGA 2BWAA 2XJTA 3AYCA 4OZOA 1JH5A 1ALYA 4QDRA 1AR91 1WLDA 3O14A 4I3PA 4XDOA 4Y3OA 1G6NA 4EE2A 3JCIA 2JG8A 3RJ2X 4A44A 2D6KA 2ZX0A 2VMIA 2XVGA 1P8JA 3N9NA 4RS5B 2GP5A 5F9TA 1O3TA 4YNIA 4AW7A 2FDJA 3VBSA 4LMFA 1ONAA 5SV5A 4Q0QA 3IZOA 1WUVA 1V9U3 3B02A 4LULA 2ZAAA 1RITA 3CZJA 4FI9A 1NCRB 2WNOA 4IV1B 4OLLA 3WUDA 3WP4A 1GWMA 4LIVA 4FTSA 1XE7A 1LHOA 1QH7A 3N9QA 2ERFA 2F4LA 3SEEA 4ARXA 1H1IA 3D0JA 2PYTA 5JAXA 1QMJA 1RYYA 3V0AA 1XPWA 3JB4C 2Y8KA 4JKKA 2UWBA 1ASJ3 1JZ6A 1FNZA 5BNOC 4HFSA 1EV12 3IT8A 2IXLA 3AKPA 4QB6A 4Y24A 1CIYA 5I8YA 4QPIB 4PHZA 2W95A 2HWC3 2WLQA 5F1RA 1HXS3 2PHUA 1ULPA 4LO6B 1W3VA 2AGSA 4HKLA 4XEZA 3S7IA 4D6QA 1REEA 4XDPA 3TN92 3KS7A 3ZFGA 4CP0A 3VHPA 3WG3A 1VALA 1QJFA 3QBQA 3NSTA 3GBWA 2R043 2VXJA 3LEMA 2DU0A 2ZZQA 5BPXA 2Q1MA 4C8DA 5FO9B 3B93A 3AYEA 1SLAA 1UYYA 4Q0UA 5JI7A 2VQUA 4FP2A 5A3LA 2EF6A 4MV2A 4WZFA 1QY4A 2RHPA 4B4PA 1DQ0A 3VBSC 1D4VB 1FYUA 4TLFA 4NOTA 1ZBA3 3O1RA 1WMEA 4CCEA 3ST7A 3WUCA 5FZ6A 4COVA 3THCA 2QQUA 2W94A 2Y34A 3HNMA 1B09A 4QXKA 4CCNA 3VB9A 1LECA 5HBAA 1RUC2 5FP3A 5CISA 4QKNA 5A7PA 4I02A 1DZRA 1ND3A 4BH9A 2VTXJ 4J25A 3OGVA 4Y5TA 3E5QA 1EUTA 5DAQA 5GZFA 4E2GA 1V70A 5FZ1A 3LZZA 1X8MA 2IWGB 3A0NA 3WOGA 4E4SA 3GXUA 1KS5A 1MS8A 2VG9A 4AVVA 4Q4X1 5L7OC 1HW5A 1PZ8A 1ZNPA 1OLMA 3LSDA 4JHTA 5EYYA 4ASMB 1C57A 1LENA 3NVCA 2VE1A 4F3JA 2R0FA 5FOJB 2LALA 4KNCA 1UO9A 3GNEA 5F5IA 2D98A 2YGMA 1A34A 3OCPA 4Q5OA 2D7FA 4IEYA 1A8DA 4YVSA 5CKQA 3QLQA 1MS5A 3MUY1 2XJPA 2DCKA 2A3WA 2CTVA 3TYJA 4LA2A 2CAVA 4BQ5A 2RS11 1NE4A 3QH6A 4K9SA 4WVWA 3URFA 1JZ2A 1C8M3 3NJYA 4BB3A 3B69A 4FPHA 4Q4X2 3AKTA 5EJ1B 1J83A 2YBSA 4XQWA 5FYBA 5LW9A 4RA0A 5FPZA 1ND3C 1PZ7A 1W04A 2LS6A 3ASIA 2YPJA 1ULOA 4BU2A 4QB2A 2B9VA 2P1BA 3KQ4B 4H3WA 4AHYA 5C9AA 1NT0A 5H9RA 1EV13 1W6PB 2QZ3A 3ECQA 4IW3A 5AFEA 3KV4A 4B1MA 1JZ4A 4UW6A 1F8VA 1AR93 2XWJB 3UGGA 2EVXA 2Q0AA 2XLFA 2WKKA 3DV8A 1H8TB 2WFF1 4IL7A 1AR81 1AUYA 2YFUA 3EMRA 4XF0A 5A7WB 4XUNA 3FWEA 3B9CA 4LT5A 5FKBA 2AENA 2VAUA 2RS12 2VTFA 3ABZA 4F7ZA 2A6VA 5FR3A 3F95A 3PU8A 3RZZA 2OX0A 3KF5A 2J1VA 4OMDA 4R4ZA 5BNNA 2VZSA 1AJOA 3LD8A 4AVTA 3D82A 4YZ1A 1YIFA 1IQDC 3M70A 2JG9B 1AHSA 2ID4A 2Z42A 2X8KA 4QU1A 5DAWA 3WVJA 1G9CA 2JENA 4LPLA 1OA4A 2VUCA 2I2SA 3E6BA 4ONUA 5A6ZA 4AR2A 2FMYA 1BVVA 3RI9A 3WF3A 4QD2A 1F5FA 3MIGA 5FYMA 3T1LA 1TMF2 1RC6A 4X6QB 4XW3A 4FPEA 2Z4FA 2Q4SA 2RJ2A 2YXSA 5IAVA 1NCRC 2ZHNA 3NV3A 3NV4A 4AF9A 3NRUA 1JTZX 4IE0A 4M4PA 1MPXA 4HSJA 4XMIA 1YJLA 1MZ5A 1ZM1A 1AR82 1NXD1 1V00A 2VW0A 3ZX7A 1FAYA 4UFKA 5C9AC 2QTWB 3U11A 4JAAA 2JJ6A 4QX1A 1QKQA 5BYNA 2NMNA 5JR7B 3KWVA 4FFIA 4YGEA 4QX2A 2DURA 1OH4A 1JUHA 3MPPG 4B1LA 2XUMA 1G7YA 4MXVA 1AXZA 3ZR5A 4BM8A 2SLIA 4Q0PA 1N3OA 3ZKYA 1BMV1 1RHI1 1AF9A 2TBVA 4UW3A 4CPBA 4PF5A 3ZSLA 1OXCA 4HXCA 3OB8A 1GNZA 1UU5A 1SDDB 4IEZA 4KGGA 5DUVA 5FY8A 3UKVA 1W6OA 2ZEXA 2ZJCA 1IQAA 3CQOA 3KB5A 4FPOB 1PZ9A 3RMYA 4Q4V1 3WF4A 2Y6LA 1UW8A 4FFHA 2RMU1 1OLRA 4HG6B 1H2KA 3ACLA 1CGPA 3RWNA 5CFCB 1VBC1 1GLHA 5FBJA 3WD5A 2QBXA 4ISQA 4O7XA 4CDWA 3OG2A 5EYXA 3OBTA 4I30A 4Q4X3 4HVOA 1RTVA 3AFKA 1NLRA 4UXAA 3VZMA 1Z0HA 1MR5A 5IVEA 1HQLA 2VH9A 3HNYM 1BMV2 1NKGA 2DU1A 3HPNA 4RGKA 1RHI2 4AHZA 1W2TA 4MGZE 4YZ4A 4QX0A 3T2OA 3J26N 4QKFA 4JC1A 1UYXA 4XJAA 1QQP1 2PTMA 3MI8A 4IEVA 1NCQC 4JKLA 4LBJA 4MVTA 5LA2A 1O59A 5I0TA 4NROA 4IE6A 1RMU1 3FC0A 4ZXEA 4AEDA 1IOAA 4I3GA 1NUKA 1SMVA 5C3SA 1WW6A 5IVYA 4Q4V2 3D3AA 4CDUA 4XZPA 4MADA 4QM8A 2H0VA 4YW1A 4JQTA 5A1AA 2RMU2 2HWF2 2RS13 3N9OA 2CHHA 2Y0OA 3M3EA 2JWPA 2WZPP 4IQPA 4CVUA 5LWBA 4QAWA 5FZEA 2AR6A 4YZ2A 2BNNA 2SBAA 4HOOA 3G7DA 3T0BA 2GU9A 4XXAA 4BXFA 1KQRA 3THTA 1SBDA 1RUOA 3AP5A 4XCBA 3HVDA 3KCCA 1Q8SA 1KDKA 4H2AA 5BNPB 5T5JA 3LAGA 3OY8B 4U36A 1NAEA 3ZXAC 3BKZA 2NN8A 5JCTA 1H1MA 2WRAA 4XF1A 4CDWC 2ZX2A 3Q9OA 5IWFA 1C28A 3NQHA 1QQP2 1I5PA 3S7EA 4MG2A 1RMU2 1F4AA 1S0DA 4FOYA 3RSJA 2VMDA 4LHNA 1VAKA 4PBPA 5L9RA 3Q8EA 3HAGA 2WAAA 3WQ1A 2ZCWA 3WQ7A 2WFF3 4QDQA 2PA7A 1AR83 2VOTA 4N53C 5JXHA 4Z07A 4BA6A 5FYUA 1J3RA 3CHXA 4YG3A 2CYFA 3P3PA 5DUWA 2A5ZA 3N7MA 2IC1A 4RN5A 5ANQA 1ULEA 2W0XA 5LASA 4CDUC 3I2HA 4C90A 4BJ0A 5LEJA 1Q5OA 4XE9A 3U37A 3VN4A 2FDFA 5CNAA 4GH4A 3KZ4C 2WT2A 2UWAA 3WQBA 3LWCA 1OOPB 1VIWB 3MICA 3FHQA 5IVVA 1SLTA 2C4XA 3RZMA 3VBFB 1IKQA 1REDA 1GR3A 2VBDA 5LA1A 2ES3A 2J1AA 1UY4A 2F6BA 3OJBA 2EAKA 3MDPA 3KCXA 4P02B 4MZUA 1UY3A 4JCKA 1FMD1 4JZRA 5I0UA 3S5QA 2G1MA 3WW3A 5DZFA 4B4QA 1W05A 1TE1B 3WDWA 5IATA 2WNUB 1G9FA 4SBVA 2QQKA 2VBPA 3H42B 3M3CA 2W52A 5FZCA 4AQ6A 2YC0A 1J1LA 2XJVA 3HEIA 4M3CB 5JZGA 1DQ2A 1JI6A 4K1ZA 3I2KA 3AX4A 1GANA 4SLIA 4E4DX 1BKZA 5KXEA 1RHI3 3FUOA 2G9GA 2B9UA 3MPBA 1FI2A 1Y9GA 2LROA 1ZZBA 3ZYBA 4RR3C 3WEZA 2WZR2 1HLCA 1LOBA 1TEIA 2Y60A 2Z69A 3ZXDA 4CP9A 3AYDA 5HXVA 3VHNA 1XU2A 3FN9A 2ZPXA 3CJXA 1OHFA 1QEXA 2QZ2A 3GZEA 4GH4C 1RUG1 4Q4V3 4QPWA 4X8NA 2D97A 3WNXA 5E88A 1BQPA 1L7RA 1RVF1 4MYEA 2NP0A 2RMU3 3I2JA 3VBUA 1O8SA 2AUYA 1CAVA 1UYZA 3ZIWA 1U5ZA 2A6ZA 1PNFA 1XNKA 1VBC3 2D93A 4LO5B 4FP3A 3OUJA 2PHFA 4QX5A 4NIDA 1X7NA 4COYA 2CGPA 2CGNA 1XXNA 5LBFA 1VBB1 1JOBA 3HBZA 4WM8A 1L7QA 1AR61 4HN0A 1SBFA 2X53S 2Y33A 4BK4A 1RUD2 4LKEA 1YCIA 4YW3A 5FZLA 2HH9A 3FX3A 2G9FA 5ACA1 4HPKA 5I0DA 4IEQA 5JZGC 5FZHA 1QQP3 4KWKA 1H1AA 1WKYA 3KCYA 5C7GA 1RMU3 4E2SA 2YC4A 1UQXA 1TME2 2XHNA 2C5DA 2P2KA 5F5QA 3VL9A 3V0BA 1HN0A 4HVQA 1RUG2 4YZ3A 2WR9A 5EJZB 4BMBA 1RVF2 4A2UA 4I2OA 3AB0A 4LHLA 3WNMA 3LDRA 1F31A 3IIAA 5FZMA 5FZOB 4CP1A 5IVCA 3PMSA 4Q26A 2Z5WA 4CEYA 1VBB2 1O5LA 1UY1A 3JQWA 3KV6A 4G4FA 5LRRA 4CTEA 1AR62 4P9IA 4Y4YA 2P3KA 5F7UA 4Y1UA 5HXMA 4CE8A 4JKMA 2J7MA 2I74A 5ACA2 3O0XA 4PIXA 3N9LA 5HCFA 3NJXA 3P5BA 5KHHA 4DRVA 1PIV2 1WLCA 4LBQB 1YC61 4WM8C 4R9AA 3KV9A 1FV3A 1R1A1 3MFAA 5JMCA 4IE7A 2AYHA 4LORA 1W2AX 4Y1YA 1V6LA 2ZS6B 2XQXA 3EJKA 3W59A 1CAXB 3WW4A 3VZLA 2UU8A 4HK8A 4OHYA 2CGOA 3FE5A 3IPVA 2V73A 2XQRA 1W6QA 1W28A 3H1YA 1QOTA 1AXKA 4C0BA 5EWSA 1POQA 1OA2A 1PGW1 2ARCA 3QACA 4XHBA 5HPOA 4LBLA 3HIFA 3CJIB 1JU4A 1GU3A 1HRV1 1MS0A 1XU1A 3KQRA 2DTYA 5B4XA 3E6CC 1N3PA 5LB6A 3R4SA 3L2YA 5C3RA 1UU4A 2CNAA 4IGPA 1ODMA 3NJZA 3WR0A 1VLNA 3LIHA 1WW4A 5A3TA 4XOGA 1FMD3 4K1YA 3RJRA 5A6XA 1R1A2 1ZRDA 2ADEA 2BJSA 2ZMKA 2BYVE 4E8CA 3JBG1 4YM3A 3EXUA 2R49A 3VBHB 2QQOA 4Z8BA 2ARXA 2RVAA 3A4UA 1OOPC 4P5HA 4WV8A 5ERLA 2GAUA 5AC92 2D43A 4A41A 5CVRA 4W65A 3BUCA 1GFF2 1HB1A 5I0SA 4BQ3A 1RL3A 2AC1A 3USUA 1RUD3 3AL5A 3VBRA 3C7EA 1CZSA 1I1EA 4L2NA 1HRV2 4OZXA 4P00B 1NQDA 3B00A 4R9BA 1YXWA 2W92A 2VUDA 2W1SA 5FXWA 5IAXA 4TN7A 3VLBB 3ME2A 2JDHA 4D8MA 3MF6A 5K9YA 2UYBA 1B35C 1UKRA 5DG1A 2A73B 2WL1A 4Q4Y1 3UV9A 4Q27A 2JDYA 3DKQA 4IGOA 1RUG3 3POSA 3ZXEA 3JBG2 1W8HA 1RVF3 3B9IA 1EY2A 2QDNA 4XC9A 3MLJA 2VZPA 5D21A 2CDOA 5FJKA 3BALA 4JTNA 1POV0 5D2AA 4KG8A 4RFT0 1ZRRA 3UJQA 1BVP1 5I93A 2K0GA 4OULA 3MO4A 4KH9A 2MHFA 4Y22A 1LJ7A 2W3JA 1VBB3 4DY5A 3DXUA 1AR63 4MXWB 4AI9A 2WABA 5ACA3 3W58A 4R9CA 4E9KA 3DECA 3NAPA 2UYAA 1XB9A 3R4UA 2PXJA 1CAWA 3EQEA 2JX9A 4XFCA 3AC0A 5GKAC 1XOYA 2YROA 4NHMA 4GJYA 4BWOA 2BQPA 2EALA 2ZX4A 3AYAA 3OBRA 5LBCA 2PN5A 4OQ8A 3C7GA 5FRAA 1MS3A 1V6KA 2Y0IA 1XNTA 4NHKA 2E33A 3HR9A 2ENRA 3FUQA 4AG4A 3LKJA 1XJAA 4A4AA 5FXZA 5JOXA 5L19A 1GZWB 3IIIA 3BODA 1GBGA 2HWD1 4LUKA 3S0MA 1W8TA 4HKWA 1QJY1 1DZQA 1YQCA 2VZRA 2YV8A 3ZYHA 5GLUA 2CSGA 1UL9A 4GXLA 3VBOA 1WCKA 4UFLA 5I0RA 3LA3A 1NX9A 2YYOA 2Q30A 1CAUA 2A3YA 1QJU2 4XCAA 4A7YA 1FXZA 3B3QE 4NIAA 3CKHA 1R081 2ZKNA 3EB7A 4YVWA 3O1SA 5G05L 4ZZ8A 2Y64A 1R1A3 1UXXX 3ACFA 4CDQB 1WBFA 2FD8A 3LEIA 1VE0A 2VZ3A 1UZYA 2JDPA 4RGAA 1BYHA 4YGCA 5FYVA 1MZEA 4FXGB 2Q8OA 5JIUA 2YGLA 5HCHA 1T2XA 1OKOA 2XJUA 5KHGA 4Y5SA 4HVRA 3K4AA 3SKJE 4AFCA 1MS1A 1JN2P 3VUOA 2HWD2 3MF9A 4RHV1 1MQTA 1LGBA 5FLIA 3FJSA 5FPBA 3KV5A 2LRPA 1HRV3 2EA7A 3MW2A 3O1TA 2DUPA 4OCTA 4IERA 3HWJA 3KT7A 1PO21 3I97A 1Z7S1 3OOXA 3BTYA 4CUCA 2JG8B 4PJYA 2BRTA 2EIGA 4LITA 1H2LA 1WCUA 3IAQA 2ZGRA 4JGYC 5EJ3A 1CWPA 1UIJA 5CU1A 4M3CF 1LR5A 1ASJ2 1QGLA 1UNBA 4FTEA 4LBQD 2W91A 3JU9A 3VBOC 2VMFA 3DXTA 4NR1A 1WMDA 3D8CA 3JBG3 5J36A 1YWKA 1SCRA 3CJIC 2HWC2 2V5YA 1W8WA 1HXS2 1FOD1 3RZJA 3WDTA 4YVWC 2ZABA 3ZFFA 2P4EA 2VCCA 3WG4A 2ZTNA 4AWDA 1GOHA 3AZWA 5IK7A 3VDAA 3QD6A 2XHKA 4XBQA 4RHV2 3KT4A 5DAXA 2R042 1S0FA 2DV9A 3ACGA 1ND2A 3P1IA 3POWA 4Q8LA 1O3RA 2ZHMA 4CYDA 4L11A 2PAKA 1W2UA 3HBKA 1Q56A 1RB8G 4MO3M 2OIIA 1S4CA 4CZSA 1LEDA 2VY0A 1PHMA 5T55A 1COV1 3KLSA 2XR4A 2C24A 3M7AA 3CBNA 3ZFGB 3JXSA 4Q4Y3 4CU7A 5C4WA 4BZ4A 1HV1A 3AZXA 5A7NA 1V6JA 4UOJA 3WG2A 3ZSMA 3ZXKA 3WV6A 4HETA 1FOD2 5CFDA 2BBVA 4EQVA 3D5OA 3M2MA 1PVC1 3T4HB 3HT1A 4EYUA 2BERA 4YFZA 4Z2AA 3TWIA 1NZIA 4IDZA 1QXRA 3H0OA 1VRBA 2W39A 4HT1T 4YG0A 1IS4A 1W9YA 2IZWA 5E6HA 5F5AA 1POV1 5BNOA 4D7YA 3WNOA 2JICA 3VDDB 4QXBA 2X05A 3ZFFC 3Q8AA 1W9WA 3DPRB 1OF3A 4D6SA 1RUJ1 3WQ0A 1K5MB 3OYWA 1Y9QA 4MGQA 2P3JA 3MLLA 5ISLA 2R1BA 2EXIA 2ZMLA 4XIKA 2OS2A 2QDRA 1RGSA 1PVXA 1WMXA 1UX6A 3AZVA 3MEPA 1I6XA 1L3JA 4F83A 3ZIXA 2PLV1 5CIRA 2WFPA 3AMQA 3PVEA 3VD4A 1X9PA 2JE7A 5EFUA 2OXBA 2HWD3 4ATEA 1C8M2 3KVAA 4WZCA 4AI8A 4Q2FA 1QJY3 3BGAA 5JSOA 5C4WC 1ZRFA 1SFPA 2ZGSA 1V6NA 3T4VA 1XQNA 4K6BA 2BTVC 2QQPA 1D4M1 2BZDA 3T3YA 3ZO0B 5CFDC 4LKFA 2IXKA 2BBAA 4YVSB 2GH2A 4IXLA 3N4MA 5J1XA 1HX6A 1BHGA 1R083 1FPN1 1RUJ2 3WNNA 4E2QA 3MZHA 1JZ7A 4XBLA 3W5NA 4YFWA 1EP0A 2L9LA 4EN6B 1H4HA 1UKGA 2O8QA 1D0HA 1W0PA 3P6BA 5A33B 5JUVA 3TEXA 5A6QA 3AVSA 5L7OA 5JXIA 5F6KA 3ETQA 1SFNA 1AR92 2ZGUA 4J6GA 5FPLA 3GJBA 1OKQA 5FY9A 1J3PA 1YQ6A 1JYVA 4AAPA 2PQQA 4WBBA 1KRIA 3AL6A 1HB3A 2D5FA 3O12A 2X09A 4LEJA 1TNFA 1R091 1S2KA 3HMYA 2EIEA 2QQIA 4RHV3 1DG6A 5BY5A 4K7JA 1MVQA 1S1AA 3UK9A 1JHJA 4JGZC 2WNVA 5A7QA 4W50A 5IK8A 1GZ9A 2EAAA 2J1SA 3IDCB 1D4M2 2GNBA 2FCUA 1CR7A 1PO23 3VKNA 1Z7S3 4Y20B 1WCDJ 2JB8A 5A32A 3H3ZA 1N47A 2CY6A 5CKMA 1JZ5A 3U75A 3TEZA 4CCJA 1ODNA 1Q43A 2E7AA 2B4KA 3GGLA 5DMYA 1WZXA 1LRHA 4LXLA 4QQLA 4ASKA 5BNNB 1QNWA 4NJ4A 4LBMA 4UWDA 5T54A 2D6MA 1FOD3 3MW3A 4GALA 4KL1A 4XAAA 3PVNA 4BQXA 1OMIA 4MSVA 2VECA 3DCQA 4CUBA 1JMUB 2ZA9A 1R092 2GDFA 4K3UA 4P9GA 4B7EA 3I2DA 4KWJA 4IESA 2ET1A 5FZFA 4NRQA 4N43B 4RYDA 2ARBA 2IUWA 5ABJB 2HYXA 2GNMA 4FFGA 1C1FA 3WF2A 1OVPA 2HEYF 2WJSA 1C5IA 4MX3A 4URAA 4Z2WA 5FPUA 3SNMA 2WC2A 1COV3 4HBNA 1QOOA 2K9ZA 4QPGB 2DVBA 3SC7X 3TEWA 2WSVA 1IS5A 2P6HA 1GWKA 3M1HA 4LA3A 4QX3A 2WNVC 4XILA 1HB2A 1UOBA 1SEFA 2BVVA 2E51A 2ORZA 5K0UA 1RUH1 1QIQA 2WAOA 4INDA 2OZ6A 1F9KA 4W6XA 4RQPC 1YEWA 1KFXL 2RR11 3WNLA 1PVC3 1NLQA 3ELNA 2WYSA 2WA3A 3ZN6B 4BQ1A 4XQ4A 5K4LA 3ZYRA 4XFGA 5FPAA 5F3IA 1ZZ6A 4YGBA 4Y33A 2AACA 2FCVA 1POV3 2D3PA 2J42A 3M3IA 4QMAA 2VMEA 2ADDA 2OKXA 3LE0A 4GULA 1NA1B 1NCRA 2FCTA 4IV1A 3U78A 1DCSA 5FK7A 4XF3A 3VDCA 3CL1A 4FPFA 1RUJ3 4AI3A 2DVFA 4TZDA 1O8PA 4LO4B 4OI0A 4NPMA 1KGYA 3Q8BA 1LKNA 2AEZA 3FLRA 1EPWA 3WG1A 2ZEYA 1JXNA 4ATFA 1UMHA 4KG0A 3ZPOA 1OD5A 3CO2A 2BW8A 1NXMA 4Q4W1 4XAEA 4FAHA 4AEKA 4YG6A 2R32A 3ACIA 2XLGA 1W8FA 2CAUA 4NWWA 4ZY9A 1DGRN 2JE8A 3S30A 4YWAA 5KXBA 2PLV3 4NO4A 1AYN1 4CDXB 1JOPA 2D6PA 4GIQA 1A8MA 2V5DA 2D3RA 4CCKA 4XYXA 2NMOA 1KITA 5FXXA 3SH4A 4HONA 5EIYB 5HV0A 4DEVA 5K0UC 1H0BA 4ES9A 2ETEA 2DWRA 3USSA 2BOJA 4XPVA 4AEDB 1ZREA 1D4M3 2Z79A 4MGKE 4AGGA 3R0RA 5FFOC 4Q0VA 1F15A 1URXA 2W9XA 4RS5C 4FOWA 2A75A 1VJ2A 4P9YA 1XNAA 4BE3A 1NG0A 1FPN3 1CJDA 2WWJA 2J1TA 4HL0A 4MHUA 4W8JA 2DTWA 3T08A 5CBLA 2YDEA 1G9AA 1H2MA 2RV9A 5IUQA 1UOGA 2MPFA 4DS0A 4JV4A 1Y3TA 3ZMOA 3N7KA 4IV1C 4Q4W2 1X36A 1U5YA 4YRDA 5FMOS 2WFF2 3H8OA 3HJRA 3R4DB 1JHNA 1UOJA 1W3XA 1L7LA 3JZVA 1AYN2 4CUGA 2NZ9A 4FQZA 1R093 4OI2A 5LEKA 3HQUA 1UY2A 2YU2A 3T2PA 2DUOA 3AFGA 3C7HA 4GWNA 1NCQA 4TWTA 5FMOL 1ZYBA 1OUXA 3MUZ1 1UD1A 3K2OA 5F39A 3I3MA 4J1XA 3RNSA 2CWSA 4QPIC 1DQ1A 2Y6JA 2AREA 3RYKA 2XKPA 4AE2A 3J7LA 1CX4A 5K7PA 4Q1PA 2HEWF 4BPZA 2YB7A 4FAGA 2RM21 1MVEA 4JRLA 3N35A 4NHXA 2FMDA 4FFFA 5A3NA 2XDVA 2RS31 5E8AA 5JPNB 4COWA 4DEQA 2CU5A 2CWMA 2E7TA 3NL1A 4LOTA 4EJRA 2VMCA 2VW1A 5AVAA 2ZOEB 3J9SA 5L9BA 1V6OA 5C8CB 3RZHA 2BPA2 3WXPA 4GWIA 5K8SA 2FHRA 2R7EB 4V2WA 4CA9A 3PUQA 5H9QA 4WM7B 5D8AB 1WMFA 2DBIA 5ANNA 5KXDA 1BK1A 4LKSA 1GKBA 2B5HA 4N7UA 3H50A 3WCRA 2B39A 4N53A 2HWB1 5J7MA 4X6RB 3PL0A 2IVIB 2GC1A 4NIHA 1UX7A 2QQVA 2RM22 4IUGA 3IWZA 1D2SA 5LA0A 1W6PA 2W2IA 1JYXA 1O3SA 4QPYA 1XYNA 2EXKA 1RUH3 2RS32 4GMP0 3ZFEB 2RR13 5A6YA 3OPWA 5A7OA 1SLIA 2TNFA 3OUIA 1W8ZA 5LBBA 4QPGC 1VBC2 3S6PA 4DFSA 3ES1A 1QDCA 2DBNA 4K21A 4O65A 3IKWA 5FPXA 4M3CE 1MZFA 3I54A 5LA9A 5C3OA 4KWUA 2ZGTA 4QGLA 4WVMB 4XTMA 2A6WA 4Q1RA 1AL0G 3AZYA 5FXVA 2JG9A 3U4XA 4ZXKA 3HT2A 3WY6A 5FKCA 1OSGA 2YFZA 4XABA 3VBUB 1CAVB 1HJGA 5GM0A 1HRI1 1JW6A 2OT7A 3ALQA 1AR71 3VD3A 4EN8B 4Q4W3 1AZDA 3ZVXA 2Q5TA 4G9SB 3ZYPA 2VW2A 4AI0A 2PQSA 1UZVA 5L9VA 4Y1XA 1AYN3 2OW4A 4QHZA 1VAMA 2Y6GA 1CIWA 2XB6C 4DUVA 1C5HA 4RR3A 4BXSV 3FMGA 4HMZA 4IV3B 4DOUA 1AX2A 1YFYA 2DDUA 2ORXA 1S2BA 2E31A 4KU7A 3IB3A 1K3IA 1ZA7A 3ILRA 4X8PA 3WLUA 1H8TC 1IKPA 2W68A 4L97A 4AOCA 3VHRA 5FYSA 2DFCA 2Q1ZB 1EYBA 4LBOA 1V0AA 4I09A 1AX1A 4KI5M 2VTXA 5FMDA 3N3HA 1JODA 2JKXA 3CDZB 2XL9A 3IDEA 4LJHA 2A1XA 3H8XA 1AR72 1XBFA 4AVAA 4AVBA 3M3OA 2JG9C 3VD7A 1D7PM 3OBZA 3H3UA 5DN2A 3INAA 1W8NA 4GWJA 4EN7B 4DINB 3UNPA 1C1LA 3L9JT 2JEMA 2XL7A 3BPSA 4DPNA 1CVNA 4PQQA 3NMBA 1WA6X 2EIDA 3FFQA 3ACHA 3KGZA 1YRZA 5APAA 2R071 4PBOA 1VMJA 2ZHLA 2VO5A 4NIIA 3V56A 4GJZA 4R9DA 4LHSA 2IFWA 3K3OA 4XJUA 1IPKA 1LGNA 5CZKA 1DIWA 5FZAA 1PM4A 2GNTA 4XJ8A 4AEJA 3ORJA 4AFMA 4H14A 5J98B 4LUMA 2RM23 3RG0A 3J4UH 1W9FA 1S0BA 2A7AA 5DQ0A 1FMD2 2NPIA 3CZUA 2P6CA 1SPPB 2RS33 5A70A 4NIGA 1W6MA 2PFWA 3LSEA 4LQRA 1PK6B 5EXOA 2WBKA 3QOPA 5FZDA 5CKNA 5D1IA 5E89A 3A7QA 3SITA 4L9BA 3VV1A 4CXWA 1RINA 4OI4A 1W0OA 3RPQA 2Q8DA 2JKBA 2HEVF 3AM2A 3SHRA 1JUIA 2FZ2A 3DYOA 3IMMA 4TSVA 5DDJ1 3GM8A 2VXRA 3V64A 3W21A 5LK7B 2HWB3 3FBMA 5BNPA 3OY8A 2D6LX 1LOFC 5EP9A 5CFCC 2E9QA 5T52A 3JUUA 3NNMA 4FTBA 3C7FA 2DUQA 3VZKA 2C1FA 1RUF1 1RUE1 5DZEA 3A21A 1U5XA 5D8AC 2B8MA 1VB2A 5IFTA 1QH6A 3K51A 3ZN4A 3VD5A 5FOBB 2DCTA 3D6EA 1K42A 3QH7A 4IEXA 3DEMA 5JIAA 3BTXA 4GMP1 4XDQA 1X8EA 2EICA 3K46A 1A78A 1VBD1 1S2EA 3MFCA 2XGXA 1PX4A 3NKGA 2ZGPA 4CCMA 3HQRA 3U10A 1HQNA 4XFAA 5JR2A 2VJXA 2C9AA 4COUA 1MS9A 5F37A 3VHOA 3SLIA 1OOPA 3B7MA 2JD9A 3H7JA 3BU7A 4NVPA 1BJQA 5FP8A 5FO7B 1AR73 3N36A 1D2QA 1FNYA 3LPGA 2JDKA 2YU1A 1RUE2 3PUHA 4CEWB 5IK5A 3O1PA 3BIEA 4D7TA 1VMHA 2GALA 5BNPC 1W0NA 2DVDA 3H8UA 3FZ3A 3PNAA 4QT6A 4UBHA 5LY1A 2CV6A 3GDBA 3LOIA 4XVHA 2WO7A 2XJRA 3AVRA 3LFIA 3OD0A 5C5TA 1LOAA 3MV01 3ZMNA 2X5IB 3NAPB 3ZPYA 4S2FA 4M3CA 1B35A 3I2FA 1VBD2 3CEWA 3E5UA 3ZYJB 1H9WA 2BVBA 1R64A 3EYPA 1W9SA 3W5MA 2VUAA 1IZ3A 1SLBA 1YQ8A 2WYFA 3E6DA 4XFBA 4MLOA 2V72A 1H8VA 1E5RA 3T1MA 4LO7A 3KHCA 1OUSA 3MLKA 4FPJA 3GJAA 1O7FA 2VVEA 3PHMA 4LIUA 4D94A 5C33A 4D6RA 5B4NA 3T30A 1V6MA 4KU8A 3PTYA 4AAXA 2I45A 3E97A 4NAOA 5FUPA 2VCBA 2DFBA 1H6YA 1W6NB 4Y1ZA 2G4IA 1EAH1 2RE9A 3RMXA 3VBFC 3M3QA 5FDBA 1RUI1 4AHXA 2UWCA 2ZGOA 4E4HA 2Y38A 2NYYA 3GF6A 2R073 4GKXA 4YYOA 5FWJA 1PGW2 3CIHA 2J1RA 1QHDA 3AZZA 2IXCA 1HIXA 4GWMA 4KWLA 2XWBB 4S2HA 2WNEA 3NW4A 3POIA 3WW1A 2WNUC 1SHWB 3THPA 3WDXA 5GALA 4AQTA 5LZ6A 4L0PA 1WBLA 3VD9A 4CCLA 4E8DA 1YI9A 4GAZA 5KXCA 4KBBA 4AYUA 3J8F1 4CCCA 2VUJA 3WSOA 1Y9MA 1AJKA 1MQTB 4XUQA 1M4WA 1OA3A 1N1TA 1E5SA 4QKBA 1K12A 5M0TA 1W8UA 1E57A 1WA4A 2IXIA 1ENXA 4OUMA 1SCSA 1RUI2 1Y7BA 1LOCA 1MS4A 5FZOA 3K3NA 3MBWA 2V4AA 4FOVA 3JB8A 4JDNA 3ZSKA 4K20A 1NY71 2WINB 2JD4A 5FZIA 3ZN5A 5C70A 4DNYA 4JHZA 1J3QA 2WIIB 2Y26A 4H7LA 4XQDA 5F8PA 3MIFA 5C71A 3HNBM 1S55A 4CU6A 2VVDA 3TAYA 1DU3D 3BIWE 4UFJA 4RSUA 1PO11 4DXRA 4LBQA 1OFSA 1AXYA 1MACA 1RUF3 1IPSA 4L92A 4Q4Y2 1RUE3 1OQEA 3CU7A 4GKYA 2XJQA 1AL21 1UN1A 2C6SA 3IM0A 2H0BA 4ARYA 1KFUL 1BLZA 1XC6A 2N7GA 2VZVA 4NPLA 1LHUA 3Q8CA 1ZRIA 3O0WA 4PLOA 1CAXA 3AMNA 1OD3A 2UY8A 4N9IA 4M0NA 3OGRA 5LBEA 4XTPA 4BYYA 3LCPA 4JGYA 2P17A 1ULGA 1KS4A 1EPZA 3O1VA 1VBD3 4EN9B 1W06A 1Y4WA 3VZJA 5KHKA 3THDA 1X50A 1NY72 2DVGA 2CL2A 4ISRA 4ES8A 4META 4RD7A 3OGJA 5FMBA 5GLWA 2XVLA 1W90A 2ZKLA 3CJIA 2D6OX 1TZOA 3DUIA 1YFWA 2A70A 3HN1A 4K8RB 3O5SA 3AXEA 4GQ7A 3VGIA 4V2VA 1YO8A 3EBRA 1PO12 3WINE 4CCDA 3PIGA 1CPMA 1XSQA 4I0BA 2HYKA 4NWVA 5LY2A 3K48A 2LUWA 3PJYA 5J96B 1QJEA 2VGDA 1AL22 2MNGA 2QCSB 3IDAA 2WZ8A 4QGMA 4UI9L 4OI1A 4BIFA 1US2A 3SCGA 1NLSA 2AZ5A 5BNQA 4QXCA 2JIJA 4BK5A 1F5JA 2B45X 5DZGA 4YW5A 1NOVA 3N9PA 5FQ0B 2WQZC 3WX5A 1QJY2 4PDWB 5DUXA 1FT9A 3OYWB 4LLFA 1X9TA 2WT1A 5E1RA 2JIGA 4XF4A 3I59A 3TNPB 4QQHA 5CADA 1BBT1 5KR7A 3GZTB 4BISA 2GH8A 5LATA 4AL9A 1LODA 3AP4A 3ATGA 1C3HA 1UCXA 2OZJA 2RDRA 3HN3A 2OPWA 3KT1A 1R082 1DGWA 2NQYA 4M0HA 1UAIA 1VAVA 2ZEZA 3PU3A 5DUUA 4Q29A 1IS3A 1ULCA 4FPLA 4FXKB 5F5CA 3VBSB 3X29B 5KHJA 3CNAA 3VKFC 1US3A 1LHWA 4PF1A 2D44A 3B94A 2PELA 4NAMA 4OHVA 5EZWA 2OA2A 4YW4A 2RDQA 3I8TA 4J1WA 2GMPA 1KXGA 1F4HA 3POFA 3LIGA 2FDHA 1RUI3 2ZAHA 3BYWA 5LRSA 4XFFA 2VPVA 4AXOA 1JU3A 2WT0A 1OPMA 4L99A 1LB2A 3EHKA 4PLNA 3ZKUA 3I4IA 3V0AB 1RJ8A 4UFMA 4XJWA 1TQ5A 1PMHX 1Q8QA 1YIPA 4MXWA 3VBHC 5FY4A 4FBFA 4XUPA 1CONA 2QQJA 5L7OB 1F2NA 1KJLA 3OD4A 4MGYE 4W6YA 5FYYA 1H4GA 1PO22 5H9PA 1Z7S2 4Y5Z0 2BDRA 1OURA 3I3QA 5A3UA 2E32A 1YFUA 4QB1A 4LTAA 3J8F3 2DF7A 3L2HA 4YPJA 2V4VA 3ZXGA 2OYZA 3GHNA 3K77A 1S0CA 4OHXA 5FP4A 5GLZA 3RRDA 3I49A 2VQAA 5FZKA 4CXXA 1HKDA 1QJX1 1GZWA 1O4YA 3HQXA 4DQAA 2Y6FA 4XBNA 1R1ZA 2JXAA 1GP4A 3MIDA 3PVBB 5FY1A 1ST8A 2FZ1A 2ZACA 1Q8OA 4FPGA 4N90A 3UL2A 1Q8VA 2O14A 5FIXA 5FYCA 4NPRA 3ZDSA 5C3PA 2WA4A 5FUNA 4PCRA 1COV2 1ND3B 4L8QA 5E16A 2PHDA 2VNVA 1PO13 2IFRA 2DCJA 1TG7A 3UJOA 1DQ4A 1GNHA 4UT5A 1SLLA 5IJRA 5JWPA 1OVSA 4E27A 2WUHA 1AL23 4K8FA 4QWNA 4JGZA 5CG8A 3WHTA 4JDOA 3LOBA 4FQ4A 3CLPA 4FVVA 1W9TA 1VBA1 2ILMA 1HQWA 4UF0A 1JOJA 1PVC2 2W46A 4BQYA 5B2GB 3AP9A 5FYZA 4C91A 3BOPA 5FPVA 2ZX1A 3NJVA 1DYKA 3M8LA 1LHVA 1S0JA 2VR4A 1DFQA 4QX7A 1BEV1 3C3VA 3PTRB 1G86A 1J58A 4QQPA 1EV11 3LQCA 4B3NA 4YLZA 1SDWA 3F2ZA 3RFRA 3ROUA 4ZPIA 2DYCA 3GCWA 1VMFA 4N9HA 3TRSB 1GMMA 4KMQA 3TN91 2FDGA 2P5BA 2OUHA 1DGRA 3VKLA 5FYHA 2PLV2 1VBA2 3KD4A 2GP3A 5AVPA 3WF1A 4LR4A 2PHLA 5FY0A 5FYTA 4DIQA 1IG3A 1V6IA 5C9AB 2OQ6A 3H1MA 3ZLIA 1S0IA 2BV4A 4CDQC 3WP5A 2B7YA 2JE9A 2RDSA 1BEV2 3PUIA 1BBT3 4OYUA 4B29A 4RQPA 2PHTA 3RWKX 1RUC1 5J37A 4NRPA 1FPN2 5JXJA 3M4FA 5JSRA 5C5UA 1Q3EA 5FCCA 4PDWC 2HJIA 2BU9A 3I3BA 4LK6A 2EXJA 1I5ZA 2C9KA 5L73A 1QOSA 5FV3A 2H6CA 4P9XA 2VOKA 4BMEA 1OQDA 2BFUS 3LFMA 3PUAA 1XNDA 4JDMA 2JG8C 4D0QA 4DRRA 2C0ZA 5A3MA 1UF2C 3T09A 3LDKA 2BFUL 2QUOA 4IGQA 2XBO1 2EXHA 1MEC1 2BGPA 3MV11 4U2AA 4Z82A 4E4ZA 5JDBA 1U12A 3C2UA 1W99A 2ZGLA 3LGRA 4I0WB 3POJA 1UPIA 2IXHA 3VDDA 3TEYA 2E6VA 3IN9A 3DPRA 2R061 3APBA 5A1FA 4OMCA 1GYKA 3N7LA 5LK5A 1APNA 1K5MA 1ZZ9A 4M01A 4HSLA 1DGWX 3SCFA 2O0OA 3H9AA 3K4DA 1NCQB 2WO3A 4HN1A 2PMWB 1WLWA 4COZA 4QQOA 2YMZA 2ZX3A 3RDIA 1DLCA 2ZZJA 3NNGA 4Z92B 4RS5A 4FSJA 5KC5A 5FK8A 1QJX3 2QQLA 2W87A 4N8MA 3OBAA 4UYBA 4IEWA 2VMHA 5F2WA 3ZFGC 4CSWA 1W6OB 2E63A 2XBO2 4XUOA 1MEC2 2J1EA
chains in the Genus database with same CATH topology
1LULA 5CAZA 3RS6A 1VRH1 3I7DA 1ZA4A 3DL3A 3GZAA 4AGVA 1LCLA 4S2DA 5FREA 2R062 3DKWA 4WVVA 4YARA 3VL8A 4CDWB 1YJKA 5A33A 3RYRA 1HDKA 1RUH2 2WSUA 4QPIA 3VDDC 4XF9A 1VBA3 4WVZA 3DPRC 1QXPA 2RR12 1QF3A 2TEPA 3BTAA 4N7IA 1K5MC 2GN7A 2ATFA 4N53B 4YM0A 1IS6A 2BGCA 4KGQA 2GN3A 4S2GA 4ZU5A 1BEV3 1WD4A 5CG9A 1H2NA 1TMF1 4URTA 1VRH2 4EWAA 5FO8B 2O8OA 4ZU4A 2O1QA 1QU0A 4MUVA 4CDUB 4Y20A 2XLAA 4MGIE 2ZGNA 4O9GA 4LBNA 3AJZA 1RIRA 3TN93 3LA7A 1CPNA 3LA2A 3ZXJA 3AXDA 4HANA 1OFNA 4YVSC 4CRQA 4A7KA 2P34A 1IPJA 1JYCA 2YY1A 4O9EA 4AI1A 1DQ6A 1CN1A 3TBDA 2VNGA 5SV8A 3SH3A 1UZZA 4N43A 1OI6A 4HKOA 4AFAA 5ABJA 1UMZA 4LLOA 1Q8PA 5HI0A 1RUC3 3NWKA 5TSWA 2GC0A 3AMHA 5GZCA 2ZBJA 2RJLA 4C0HA 2D3SA 3MIEA 4QPGA 1T6GC 4XMAA 2OUJA 1A3KA 3H1WA 4RR3B 2VOVA 2RJKA 4QHBA 3FLPA 3MIHA 4D7SA 3OF1A 3V65A 1LOEA 4GB31 5GLTA 2R0HA 1FATA 4XETA 2QVSB 4YW2A 2VNOA 3BOWA 4A7ZA 4GH4B 2YUEA 4ORFA 1U5IA 3ZN6A 2WLPA 2XJSA 5I8TA 2XBO3 2TUNA 1MEC3 3KSCA 4M00A 3GALA 5BNNC 2VOXA 1NA1A 1YNAA 2X29A 3P3NA 4NN0A 5FLJA 2R063 4R4XA 5FBZA 4Q8KA 4FPKA 5C8WA 1IHMA 2HWF1 5T5LA 5FLHA 4YZ5A 5JZGB 4N43C 2QFEA 5ABJC 1XNCA 4QU2A 4GB32 1H8TA 4MH0E 4OHWA 4Z1VA 2E53A 5T5PA 2DCYA 4CDXA 2R30A 1UU6A 5JLVA 2OVUA 2VU9A 2XPJA 1OLQA 2GMEA 3AK0A 2HWE1 1SLCA 1VRH3 4HLTA 3RQ0A 1W6MB 3IMNA 4EWDA 1JBCA 1SFYA 2HWB2 1G9DA 3ZSJA 5KBFA 3N7JA 4YGDA 1O4TA 5JVVA 1AX0A 1NA1C 4WM8B 3OTFA 1DZTA 1DLLA 4B4RA 4HPKB 4LE4A 4AVCA 4JRAA 1CQ9A 5IT6A 2GC2A 4GA9A 2PHRA 1NYWA 1O3QA 3FBYA 1FX5A 4FO9A 3GHMA 3VKOA 4IEOA 1TMF3 4RL7A 4C1WA 2HWE2 1X82A 4AK3A 3V0BB 1YI7A 4NHLA 1ULDA 2I07B 4UW4A 4BHPA 4CDXC 5FAXA 4B7KA 1LESA 5C6CA 2A6XA 3FHIB 5KWRA 2ZGQA 1HRI2 2NM1A 2QNKA 5JI9A 4AEDC 4CEYB 4R52A 3B5LB 5KHIA 4A3XA 1VB4A 5CFCA 1LOFA 5C8CA 1WW5A 1SQ4A 1UIKA 4PQ9A 1IGOA 3VKMA 1SACA 2WZR1 1OPOA 4Y26A 4Q0SA 3WW2A 1J59A 3GZUC 4YM1A 3BCWA 4EV0A 1FV2A 2BUKA 4WM7A 5D8AA 3JQXA 3D4KA 1ZZ8A 2OPKA 2VMGA 4EN0A 1OQ1A 4XJZA 1NE6A 3IPVB 4EWEA 1LEMA 3DF0A 4ZKTB 1W6QB 1YYNA 1ZX5A 1B35B 5JOYA 4GB33 3ZFEA 3WZ1A 2GZWA 1LU1A 2VQ0A 3ENRA 1HV0A 4KQ7A 1RUD1 5GLVA 2HKXA 2MEV1 5J3UA 1GQHA 2YHJA 3AKRA 2JECA 2R072 2VNRA 3GYDA 4HK9A 4XJ9A 1YHFA 3IDBB 3RI8A 4WVMA 3ZSEA 1LHNA 3DGTA 1VR3A 1TME1 1QNYA 4V1PA 5C8CC 2BWCA 2V09A 2HWF3 3R05A 2DVAA 2PAEA 3SCHA 4HZFA 4WM7C 1KJRA 2GSYA 3GBGA 1ZBE1 3USUB 5T50A 2RS51 2VOWA 3POYA 3VBRB 4XXPA 1PM7A 1Y43B 1U0AA 2GNDA 2MEV2 4QQ2A 2QKDA 2W08A 1YUDA 4IV3A 3EO6A 2H6BA 2YZ4A 1PIV1 3HD8B 3ZFEC 2AH2A 2HWE3 3W9AA 1GICA 5DDJ2 3AMPA 1ENRA 3WDYA 5HCAA 2D40A 3ILFA 4FPYA 3NO8A 4PIYA 3VBFA 1HRI3 4OHZA 2WS91 3O7OA 1RUF2 3WCSA 1W39A 4Y22B 2ET7A 2XG3A 2KA3A 5H9SA 1ZBE2 4BCUA 3VZNA 2RS52 2WNUA 4JTOA 4Y1VA 2IXJA 4DMIA 1BXHA 4AQ2A 4D69A 3VBUC 4DB5A 2A6YA 2B46X 1CAWB 1XYPA 3T2TA 4H7MA 4PLMA 4BOWA 4PIZA 5FTTC 1CD3G 4EROA 1ENSA 1GV9A 1LOGA 3D0SA 4ASLA 4AFDA 4AEMA 3VZOA 4K40A 1XNBA 3NKTA 4IV3C 1XYOA 2WS92 3ZYGA 1RJ7A 1NZCA 2A71A 4JGYB 5AC91 3U0ZA 4IEPA 3KMHA 3TOJA 1LU2A 2ZMNA 3AJYA 5T5OA 3VBOB 1PK6A 2LM3A 3KM5A 1LTEA 3SISA 1ULFA 1CAUB 1QXJA 3ILNA 5GJ6A 2K2SA 3ZYIB 1WLTA 4YVWB 2WZR3 2KXLA 2Z2SB 1QDOA 1QJZA 4ITCA 4IEUA 5EV7A 4CEYC 4F8AA 2R6QA 1VBE1 1WW7A 3ZXFA 2VVFA 3TB0A 5BV6A 1PNGA 4LHKA 5J48A 4D3WA 5JOWA 1I3HA 2XVKA 1D0GA 3A0KA 3H7YA 2GMMA 1AVBA 3WP6A 3PJQA 3LB9A 4AHWA 5IK4A 3PVOA 5F6LB 2E7QA 1AYM1 3I59B 2QE3A 1EAH2 2MEV3 4RGGA 1DHKB 2FBEA 1VP6A 3DN7A 4ZU7A 3UKTA 4P14A 1ZZCA 2ZHKA 1XRUA 1H9PA 3MGUA 2VULA 4W6WA 1QWRA 5CB7A 4P9LA 3IBMA 3AKQA 5DDJ3 1PK6C 3NV2A 1CESA 1VBE2 1TME3 1N3QA 5DG2A 1YFXA 4OFGA 3SMHA 1WCSA 4OUSA 3ZFFB 2P3IA 1KD7A 4JQRA 3J8F2 4XIOA 1GSLA 1O91A 3KGLA 1WD3A 3NV1A 1BZWA 1ENQA 1ZBE3 4CEWA 1N1SA 4BIOA 1ND2B 2RS53 1AYM2 3JD71 3WDUA 3MIBA 4GMP3 2ZGMA 2WQ4A 3FLTA 3G6JB 1QJU1 4XHXA 5JPMB 2X5IA 1PIV3 1LGCA 5J09A 1PGSA 1O5UA 3AP7A 3BPZA 5C4WB 3VBRC 4LO8A 5CFDB 1REFA 5L36A 1GZCA 2WS93 1JYIA 1DQ5A 2BNOA 2JDZA 4I0AA 5K0UB 1DGLA 1MZ6A 1I9RA 3OGGA 5BNOB 4AGRA 1DYPA 3VBHA 1V9U1 5DXDA 4H55A 3JD72 1DF0A 1A6CA 1H30A 1W6NA 1SBEA 1O4ZA 5T3NA 4B8EA 4QGNA 2XH6A 1KDMA 4IETA 4CEWC 3SXWA 4QM9A 4BLJA 1M06G 1TNRA 2B42B 1ASJ1 1N1YA 2XKOA 5GZDA 1ZRCA 4JGZB 1X33A 3CF6E 3WDVA 2PHWA 1S0EA 1YLLA 3QCWA 2HWC1 1HXS1 1ZVFA 2X5IC 3NAPC 1RUNA 3R6SA 2UY9A 5AC93 3MW4A 5I8SA 3SH5A 4DXZA 3WP3A 4FPCA 2WWSA 1V9U2 1G8WA 1EAH3 2R041 2R16A 4UBGA 5BUVA 3BB6A 5JSPA 3AMMA 3FFZA 3E5XA 3PLQA 3GBFA 3AKSA 2ZGKA 4OVEA 2A3XA 3RYPA 1ZBA1 2R1DA 4DY3A 5I91A 1BBT2 4TYSA 1VBE3 2F4PA 1UPSA 4YM2A 4LE3A 1PMIA 4C1XA 3AP6A 4FOQA 4FT8A 5KC6A 3U07A 3MYXA 5CA6A 2PAMA 3OPZA 2LTNA 4AFBA 3O0VA 2DCZA 2WNVB 3TNQA 1AYM3 4P9JA 1PGL1 1C4RA 4R8HA 2QJVA 1J1TA 1DDLA 3ES4A 4P9WA 4RQPB 5BXXA 3WHUA 5A32B 3UKNA 1N1VA 1CJPA 1ZBA2 1MQTC 4AI2A 4AVSA 4BLIA 5AFBA 4JVAA 3ZXLA 1C8NA 5JOZA 5GZGA 3WT3A 2BEOA 1BCXA 4G3YC 4XFHA 3B01A 2FQPA 1Z78A 4CP2A 4CDQA 5HCBA 1NQJA 1C8M1 2D5HA 1S0GA 4AQSA 4YSFA 2BNMA 2PHXA 5GZEA 1XE8A 4XFIA 3JD73 4LBKA 4DZGA 1PGL2 1ZZ7A 1WGPA 1QJX2 4UW5A 2GC3A 1QJU3 2NLRA 5FQ0A 3PMEA 4PDWA 1DBNA 4FCAA 4LNVA 4I01A 1ND2C 2D6NA 2KM2A 2P37A 3AYCA 2UURA 5FPZA 1GQGA 2BWAA 2XJTA 4XPVA 3LOBA 1JH5A 1ALYA 1AR91 1WLDA 3O14A 4I3PA 1G6NA 3JCIA 2JG8A 3RJ2X 2D6KA 2ZX0A 2VMIA 2XVGA 4RS5B 1O3TA 5F9TA 4YNIA 4AW7A 3VBSA 1ONAA 5SV5A 4Q0QA 1WUVA 1V9U3 3B02A 4LULA 2ZAAA 1RITA 1NCRB 4OLLA 4IV1B 3WUDA 3WP4A 4FTSA 1XE7A 1LHOA 1QH7A 2ERFA 1H1IA 3D0JA 2PYTA 5JAXA 1QMJA 3V0AA 3JB4C 2UWBA 1ASJ3 1FNZA 5BNOC 4HFSA 1EV12 3IT8A 2IXLA 3AKPA 4Y24A 5I8YA 4QPIB 2HWC3 2WLQA 5F1RA 1HXS3 2PHUA 4LO6B 2AGSA 4HKLA 4XEZA 3S7IA 1REEA 3TN92 3KS7A 3ZFGA 4CP0A 3VHPA 3WG3A 1VALA 3QBQA 3NSTA 3GBWA 2R043 5BPXA 5FO9B 2DU0A 2ZZQA 2Q1MA 3B93A 3AYEA 1SLAA 4Q0UA 5JI7A 5A3LA 4FP2A 2EF6A 4MV2A 4WZFA 1QY4A 2RHPA 4B4PA 1DQ0A 3VBSC 1D4VB 1FYUA 4TLFA 4NOTA 1ZBA3 1WMEA 3ST7A 3WUCA 4COVA 1B09A 4QXKA 1LECA 5HBAA 1RUC2 4I02A 1DZRA 1ND3A 4BH9A 4E2GA 5GZFA 3E5QA 1V70A 3LZZA 1X8MA 2IWGB 3A0NA 3WOGA 4E4SA 1KS5A 1MS8A 2VG9A 4AVVA 4Q4X1 5L7OC 1HW5A 1PZ8A 1ZNPA 3LSDA 5EYYA 4ASMB 1C57A 1LENA 3NVCA 4F3JA 2R0FA 5FOJB 2LALA 4KNCA 3GNEA 2D98A 2YGMA 3OCPA 2D7FA 4IEYA 1A8DA 4YVSA 3QLQA 1MS5A 2XJPA 2DCKA 2A3WA 2CTVA 3TYJA 4LA2A 2CAVA 2RS11 1NE4A 3QH6A 4K9SA 4WVWA 3URFA 1C8M3 3B69A 4FPHA 4Q4X2 3AKTA 4XQWA 4RA0A 1ND3C 1PZ7A 3ASIA 2YPJA 4H3WA 4AHYA 5C9AA 5H9RA 1EV13 1W6PB 2QZ3A 3ECQA 5AFEA 4UW6A 1F8VA 1AR93 2XWJB 2EVXA 2Q0AA 2XLFA 2WKKA 3DV8A 1H8TB 2WFF1 4IL7A 1AR81 1AUYA 4XF0A 3FWEA 3B9CA 4LT5A 2AENA 2RS12 4F7ZA 2A6VA 3RZZA 4R4ZA 5BNNA 1AJOA 4AVTA 3D82A 4YZ1A 1YIFA 3M70A 2JG9B 1AHSA 2Z42A 2X8KA 3WVJA 1G9CA 2JENA 1OA4A 2I2SA 3E6BA 4ONUA 2FMYA 1BVVA 3RI9A 4QD2A 1F5FA 3MIGA 3T1LA 1TMF2 1RC6A 4X6QB 4XW3A 4FPEA 2Q4SA 2YXSA 1NCRC 2ZHNA 3NV3A 3NV4A 4AF9A 1JTZX 4HSJA 4XMIA 1YJLA 1MZ5A 1ZM1A 1AR82 1NXD1 1V00A 2VW0A 3ZX7A 1FAYA 5C9AC 3U11A 4JAAA 2JJ6A 1QKQA 5BYNA 2NMNA 5JR7B 4YGEA 2DURA 1JUHA 3MPPG 2XUMA 1G7YA 4MXVA 1AXZA 4BM8A 2SLIA 4Q0PA 1N3OA 1BMV1 1RHI1 1AF9A 2TBVA 4UW3A 4PF5A 3ZSLA 4IEZA 1GNZA 1UU5A 5DUVA 3UKVA 4KGGA 1W6OA 2ZJCA 1IQAA 3KB5A 4FPOB 1PZ9A 3RMYA 4Q4V1 1UW8A 2RMU1 1OLRA 1H2KA 3ACLA 1CGPA 3RWNA 5CFCB 1VBC1 1GLHA 3WD5A 4ISQA 4CDWA 5EYXA 3OBTA 4I30A 4Q4X3 4HVOA 1RTVA 3AFKA 1NLRA 4UXAA 3VZMA 1Z0HA 1MR5A 1HQLA 2VH9A 1BMV2 2DU1A 1RHI2 4AHZA 4MGZE 4YZ4A 3J26N 4JC1A 4XJAA 1QQP1 2PTMA 3MI8A 4IEVA 1NCQC 4LBJA 4MVTA 5I0TA 1RMU1 3FC0A 4AEDA 1IOAA 4I3GA 1SMVA 1WW6A 4Q4V2 4CDUA 4XZPA 4QM8A 4YW1A 2H0VA 2RMU2 2HWF2 2RS13 2Y0OA 3M3EA 2WZPP 4IQPA 2AR6A 4YZ2A 2BNNA 2SBAA 3G7DA 2GU9A 4XXAA 1KQRA 3THTA 1SBDA 1RUOA 3AP5A 3KCCA 1Q8SA 1KDKA 5BNPB 5T5JA 3LAGA 3OY8B 4U36A 3ZXAC 2NN8A 5JCTA 1H1MA 4XF1A 4CDWC 2ZX2A 3Q9OA 1C28A 1QQP2 3S7EA 1RMU2 1S0DA 4FOYA 3RSJA 4LHNA 1VAKA 4PBPA 3WQ7A 3HAGA 3WQ1A 2ZCWA 2WFF3 2PA7A 1AR83 4N53C 4Z07A 4BA6A 1J3RA 4YG3A 2CYFA 3P3PA 5DUWA 2A5ZA 3N7MA 2IC1A 1ULEA 2W0XA 4CDUC 4C90A 5LEJA 1Q5OA 4XE9A 3VN4A 5CNAA 4GH4A 3KZ4C 2WT2A 2UWAA 1G9BA 3LWCA 1OOPB 1VIWB 3MICA 1SLTA 3VBFB 1IKQA 1REDA 1GR3A 2ES3A 2F6BA 3OJBA 2EAKA 3MDPA 3KCXA 4MZUA 4JCKA 1FMD1 5I0UA 3WW3A 5DZFA 4B4QA 1TE1B 3WDWA 2WNUB 1G9FA 4SBVA 3M3CA 2W52A 4AQ6A 2YC0A 2XJVA 1J1LA 4M3CB 5JZGA 1DQ2A 4K1ZA 3AX4A 1GANA 4SLIA 4E4DX 1BKZA 5KXEA 1RHI3 3FUOA 2G9GA 2B9UA 3MPBA 1FI2A 1ZZBA 4RR3C 2WZR2 1HLCA 1LOBA 1TEIA 2Z69A 3ZXDA 3AYDA 5HXVA 3VHNA 1XU2A 2ZPXA 3CJXA 1OHFA 2QZ2A 4GH4C 3E6CC 1RUG1 4Q4V3 4X8NA 2D97A 3WNXA 5E88A 1BQPA 1RVF1 4MYEA 2NP0A 2RMU3 3VBUA 2AUYA 1CAVA 3ZIWA 1U5ZA 2A6ZA 1PNFA 1XNKA 1VBC3 2D93A 4LO5B 4FP3A 4QX5A 2PHFA 1X7NA 4COYA 2CGPA 2CGNA 1XXNA 1VBB1 3HBZA 4WM8A 4HN0A 1AR61 1SBFA 2X53S 1RUD2 4YW3A 1YCIA 3FX3A 5ACA1 2G9FA 4HPKA 4IEQA 5JZGC 1QQP3 4KWKA 1H1AA 3KCYA 1RMU3 4E2SA 1TME2 5F5QA 2C5DA 2P2KA 3VL9A 3V0BA 4HVQA 1RUG2 4YZ3A 4BMBA 1RVF2 4A2UA 4I2OA 3AB0A 4LHLA 1F31A 3IIAA 4CP1A 3PMSA 4Q26A 2Z5WA 4CEYA 1VBB2 1O5LA 3JQWA 4G4FA 5LRRA 4CTEA 1AR62 4P9IA 4Y4YA 2P3KA 4Y1UA 2I74A 5ACA2 3O0XA 4PIXA 5HCFA 5KHHA 4DRVA 1PIV2 1WLCA 4LBQB 4WM8C 4R9AA 1FV3A 1R1A1 3MFAA 5JMCA 2AYHA 4Y1YA 1V6LA 2ZS6B 3EJKA 3W59A 1CAXB 3WW4A 3VZLA 2UU8A 4HK8A 4OHYA 2CGOA 3FE5A 3IPVA 2V73A 1W6QA 3H1YA 1QOTA 1AXKA 4C0BA 5EWSA 1OA2A 1PGW1 3QACA 4XHBA 4LBLA 3HIFA 3CJIB 1XU1A 1HRV1 1MS0A 3KQRA 2DTYA 1N3PA 3R4SA 3L2YA 1UU4A 2CNAA 3NJZA 3WR0A 1VLNA 1WW4A 4XOGA 1FMD3 4K1YA 3RJRA 1R1A2 1ZRDA 2ZMKA 2BYVE 3JBG1 4YM3A 3EXUA 2R49A 3VBHB 4Z8BA 2ARXA 3A4UA 1OOPC 4P5HA 4WV8A 2GAUA 5AC92 2D43A 5CVRA 4W65A 1GFF2 5I0SA 1RL3A 3USUA 1RUD3 3VBRA 1I1EA 4L2NA 1HRV2 4OZXA 4R9BA 1NQDA 3B00A 1YXWA 3VLBB 3ME2A 3MF6A 5K9YA 2UYBA 1B35C 1UKRA 5DG1A 2A73B 2WL1A 4Q4Y1 3UV9A 4Q27A 1RUG3 3POSA 3ZXEA 3JBG2 1RVF3 3B9IA 1EY2A 2QDNA 3MLJA 3BALA 4JTNA 1POV0 4KG8A 4RFT0 1ZRRA 3UJQA 1BVP1 5I93A 2K0GA 4OULA 4KH9A 2MHFA 4Y22A 1LJ7A 1VBB3 4DY5A 1AR63 4MXWB 5ACA3 3W58A 4R9CA 4E9KA 3NAPA 2UYAA 3R4UA 1CAWA 3EQEA 2JX9A 4XFCA 5GKAC 2YROA 4NHMA 4BWOA 2BQPA 2EALA 2ZX4A 3AYAA 3OBRA 2PN5A 5FRAA 1MS3A 1V6KA 2Y0IA 4NHKA 3HR9A 2ENRA 3FUQA 4AG4A 3LKJA 5L19A 5JOXA 1GZWB 3BODA 1GBGA 2HWD1 4LUKA 3S0MA 4HKWA 1QJY1 1DZQA 2YV8A 5GLUA 1UL9A 4GXLA 3VBOA 1WCKA 5I0RA 3LA3A 2YYOA 2Q30A 1CAUA 2A3YA 1QJU2 4A7YA 1FXZA 3B3QE 1R081 2ZKNA 4YVWA 1R1A3 4CDQB 1WBFA 1UZYA 4RGAA 1BYHA 4YGCA 1MZEA 4FXGB 2Q8OA 5JIUA 2YGLA 2XJUA 5KHGA 4HVRA 4AFCA 1MS1A 1JN2P 3VUOA 2HWD2 3MF9A 4RHV1 1MQTA 1LGBA 5FLIA 3FJSA 3MW2A 1HRV3 2EA7A 2DUPA 4IERA 3HWJA 3KT7A 1PO21 1Z7S1 2JG8B 4PJYA 2EIGA 1H2LA 4JGYC 5EJ3A 2ZGRA 1UIJA 5CU1A 4M3CF 1LR5A 1ASJ2 1QGLA 4FTEA 4LBQD 3JU9A 3VBOC 4NR1A 1WMDA 3D8CA 3JBG3 5J36A 1YWKA 1SCRA 3CJIC 2HWC2 2V5YA 1HXS2 1FOD1 3WDTA 4YVWC 2ZABA 3ZFFA 3WG4A 2ZTNA 4AWDA 3AZWA 5IK7A 3QD6A 2XHKA 4XBQA 4RHV2 3KT4A 2R042 1S0FA 2DV9A 4Q8LA 1ND2A 1O3RA 3POWA 2ZHMA 4CYDA 4L11A 2PAKA 1W2UA 1RB8G 1Q56A 2OIIA 4CZSA 1LEDA 2VY0A 1PHMA 5T55A 1COV1 3KLSA 3M7AA 3ZFGB 4Q4Y3 5C4WA 4BZ4A 1HV1A 3AZXA 1V6JA 3WG2A 3ZSMA 3ZXKA 3WV6A 4HETA 1FOD2 5CFDA 2BBVA 3D5OA 3M2MA 1PVC1 3HT1A 4YFZA 3TWIA 1QXRA 3H0OA 4YG0A 2W39A 4HT1T 1IS4A 2IZWA 5BNOA 1POV1 4D7YA 2JICA 3VDDB 3ZFFC 3DPRB 1RUJ1 3WQ0A 1K5MB 3OYWA 1Y9QA 2P3JA 3MLLA 2R1BA 2EXIA 2ZMLA 4XIKA 2QDRA 1RGSA 1PVXA 1UX6A 3AZVA 3MEPA 1I6XA 1L3JA 4F83A 3ZIXA 2PLV1 5CIRA 2WFPA 3AMQA 3PVEA 2JE7A 5EFUA 2HWD3 4ATEA 1C8M2 4AI8A 4WZCA 4Q2FA 1QJY3 5JSOA 1ZRFA 5C4WC 2ZGSA 1V6NA 1XQNA 4K6BA 2BTVC 2QQPA 1D4M1 3ZO0B 5CFDC 2IXKA 4YVSB 3N4MA 2GH2A 4IXLA 1HX6A 4E2QA 1R083 1FPN1 1RUJ2 3MZHA 4XBLA 4YFWA 1EP0A 4EN6B 1H4HA 1UKGA 2O8QA 1D0HA 1W0PA 5A33B 5L7OA 5F6KA 3ETQA 1SFNA 1AR92 2ZGUA 4J6GA 1OKQA 1J3PA 2PQQA 4WBBA 1KRIA 2D5FA 3O12A 4LEJA 1TNFA 1R091 1S2KA 3HMYA 4RHV3 1DG6A 5BY5A 4K7JA 1MVQA 1S1AA 3UK9A 4JGZC 2WNVA 5IK8A 1GZ9A 2EAAA 3IDCB 1D4M2 2GNBA 1CR7A 1PO23 3VKNA 1Z7S3 4Y20B 1WCDJ 5A32A 3H3ZA 1N47A 2CY6A 1Q43A 2E7AA 1LRHA 4QQLA 5BNNB 1QNWA 5T54A 4LBMA 2D6MA 1FOD3 3MW3A 4GALA 4KL1A 3PVNA 1OMIA 4MSVA 2VECA 4K3UA 2ZA9A 1R092 2GDFA 4P9GA 4B7EA 3I2DA 4KWJA 4IESA 2ET1A 4N43B 2ARBA 5ABJB 2GNMA 1C1FA 2HEYF 2WJSA 1C5IA 4MX3A 4Z2WA 3SNMA 2WC2A 1COV3 4HBNA 1QOOA 2K9ZA 4QPGB 2DVBA 2WSVA 1IS5A 3M1HA 4LA3A 4XILA 2WNVC 1SEFA 2BVVA 2E51A 5K0UA 1RUH1 4INDA 2OZ6A 1F9KA 4W6XA 4RQPC 1KFXL 2RR11 1PVC3 3ELNA 2WA3A 3ZN6B 4BQ1A 4XQ4A 3ZYRA 4XFGA 1ZZ6A 4YGBA 1POV3 2D3PA 3M3IA 4QMAA 4GULA 1NA1B 1NCRA 4IV1A 4XF3A 3CL1A 4FPFA 1RUJ3 4AI3A 2DVFA 4TZDA 4LO4B 4OI0A 3WG1A 1LKNA 3FLRA 1EPWA 1JXNA 4ATFA 4KG0A 1OD5A 3CO2A 2BW8A 1NXMA 4Q4W1 4FAHA 4AEKA 4YG6A 2R32A 2XLGA 2CAUA 4NWWA 3S30A 1DGRN 5KXBA 2PLV3 4NO4A 1AYN1 4CDXB 2D6PA 4GIQA 1A8MA 2D3RA 4XYXA 2NMOA 1KITA 3SH4A 5K0UC 1H0BA 4ES9A 2ETEA 2DWRA 3USSA 1ZREA 4AEDB 1D4M3 2Z79A 4MGKE 4AGGA 3R0RA 5FFOC 4Q0VA 1URXA 4RS5C 4FOWA 2A75A 1VJ2A 4P9YA 4BE3A 1NG0A 1FPN3 1CJDA 4HL0A 2DTWA 5CBLA 2YDEA 1G9AA 1H2MA 5IUQA 2MPFA 4DS0A 4JV4A 1Y3TA 3ZMOA 3N7KA 4IV1C 4Q4W2 1X36A 1U5YA 4YRDA 5FMOS 2WFF2 3R4DB 1JHNA 3JZVA 1AYN2 2NZ9A 4FQZA 1R093 4OI2A 5LEKA 2DUOA 3AFGA 4TWTA 4GWNA 1NCQA 5FMOL 1ZYBA 1UD1A 4J1XA 3RNSA 2CWSA 4QPIC 1DQ1A 2AREA 3RYKA 2XKPA 4AE2A 1CX4A 5K7PA 4Q1PA 2HEWF 4BPZA 4FAGA 2RM21 1MVEA 4JRLA 3N35A 2FMDA 5JPNB