1RUH3

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh300
4QPIA 5AC92 4RHV2 4Q4V3 1VRH1 1ND3C 1R081 1RUE1 5D8AC 2XBO2 1RUC3 1RUF3 2FZ2A 3IDEA 4IV1A 4CEWC 1ASJ3 4Q4W3 1VBB2 1RUI2 5DDJ2 1AYN3 5C9AC 1QJY3 5C4WB 4GMP0 2RS11 1VBE3 4N53B 1RUJ1 1HRI1 5L7OC 1AL22 2WS93 4YVSB 5C8CA 5J96B 4EJRA 2MEV2 1EAH1 3JD72 1PO13 4CDUB 1ND3A 1AYM3 2RS32 1RB8G 2WFF1 4QPGC 1VRH3 1D4M1 1R083 1RUE3 2RM22 1RUG3 1BEV3 1R091 4Q4V2 1RVF3 1RUC2 4PDWB 4Q4X1 4AEDB 5FMOL 1F8VA 1ASJ2 2HWE1 2RR11 4Q4W2 1NA1B 1OPOA 1QJY2 1PIV1 5A33B 1ZBE1 3LOBA 1BBT1 1AR91 5BNNA 1VBE2 4JGYB 2WS92 4WM8B 1EAH3 3VBRB 4Q4Y1 5BNPC 1HQNA 4FTEA 1K5MB 4NWWA 2FZ1A 1PO12 4CDQC 1AYM2 1D4M3 4JGZC 1MQTC 5A32B 1QJX2 1VRH2 1R082 1F2NA 3ZFFB 1RUG2 1BEV2 4Q4X3 4YVWC 5C4WA 1RVF2 1V9U1 5BNOB 2RS53 3VBHB 1PIV3 1BBT3 1AR93 2TBVA 1OHFA 4YVSA 4GH4B 3CJIC 2BFUL 4CDUA 1E57A 1PVC2 4CDQA 4Q4Y3 1FOD3 2HWB3 1EAH2 3DPRB 5ACA3 3JB8A 4Y4YA 3ZFGC 4YVWA 3VBOB 1D4M2 1AR63 4FTSA 1NA1A 4GB33 5A33A 2IZWA 4Q4X2 5ABJB 1VBA2 1Z7S1 2RS52 3CJIA 1AR81 1PIV2 1FPN1 4IV1C 2R071 1AR92 4WM8A 3VBRA 3VBUB 4CEYB 1B35B 1W39A 5JZGB 2X5IB 5A32A 1FOD2 1RMU1 2HWB2 3JBG1 3ZFFA 5ACA2 3TN91 5C8CC 1R1A1 5BNOA 1CD3G 1NY72 1AR62 4GB32 3J8F3 4RR3B 4GH4A 5CFCC 1AR83 1FPN3 2R063 2R073 5FMOS 5LK7B 1BMV1 4N43B 5CFDB 2HWD1 2WZR2 3DPRA 1NCQB 1ZBA1 1RHI1 1SMVA 1TME3 1RUD1 4RS5C 1PO21 1RMU3 5BNNC 3VBOA 3JBG3 3TN93 1MEC2 1HRV2 1AUYA 1R1A3 1OOPC 3NAPB 2GSYA 1C8NA 1QQP1 5ABJA 5CFCA 1ND2B 4CDXB 5FOJB 1RUF2 3J8F2 3ZFEB 3VBUA 1VB4A 3VDDB 1AR82 1AYN2 1FPN2 2R062 5C4WC 1AR71 4CEYA 1B35A 2RS13 1RUJ3 4N53C 4RS5A 1HRI3 1ZBA3 1RHI3 1TMF1 1PO23 1HXS1 2BBVA 2HWC1 4Z92B 4YVSC 1TME2 4IV3B 2BFUS 4FSJA 3JBG2 4CDWB 2RMU1 4CDUC 2WFF3 1PGW1 1R1A2 3VBFB 1QQP3 1POV1 1R093 3VBSB 4RR3A 1RUE2 1X36A 1C8M1 4PDWC 4AEDC 4N43A 5CFDA 2HWE3 2RR13 4N53A 1NA1C 1AR73 1ZBE3 1NCQA 4RQPB 2RS12 1RUH1 1RUJ2 1HX6A 4JGYC 1HRI2 1TMF3 4WM7B 1HXS3 1ZBA2 1RHI2 2HWC3 4RHV1 4WM8C 2WLPA 3VBRC 3NAPA 1CJDA 1M06G 1K5MC 2XBO1 4QPIB 2ZAHA 1ND2A 4CDXA 2WFF2 2ZZQA 1RUI1 5DDJ1 4PDWA 4AEDA 3ZFFC 1QQP2 1R092 1VAKA 3ZFEA 1X33A 1NOVA 3VDDA 4GMP1 1V9U3 5BNOC 1VBC1 5K0UB 3VBHC 2HWE2 2RR12 4JGYA 1AR72 1ZBE2 2BUKA 1RUH3 1BBT2 1H8TB 2MEV1 4GH4C 4IV3A 1QJZA 1NCRB 1OOPB 1K5MA 1TMF2 1HXS2 2R041 3M8LA 2VQ0A 4Q4Y2 2RM21 1ND3B 3DPRC 4Q4V1 5D8AB 3VBSA 4LLFA 2QQPA 1RUC1 4CEWB 3VBOC 5C9AB 4FTBA 3VBHA 1COV1 5J98B 1VBC3 4RQPA 1V9U2 2BPA2 1Z7S3 2DF7A 5ABJC 5L7OB 4WM7A 2WS91 1RUH2 2GH8A 1A6CA 1EV11 3VBUC 2R043 4CEYC 1AYM1 1B35C 4BCUA 5JZGC 2X5IC 4QPGB 2RM23 1QJX1 1IHMA 1RUG1 1BEV1 2XPJA 1RVF1 5K0UA 1COV3 1PGL1 1VBC2 1H8TA 4RR3C 1Z7S2 1PVC1 1NCRA 1OOPA 4SBVA 1EV13 2R072 2HWD3 1FMD1 2X5IA 4N43C 4Y5Z0 5CFDC 5BNPB 5JZGA 2HWF1 2Y26A 5D8AA 1NCQC 1NG0A 4CDQB 2R042 1RUD3 4JGZB 1MQTB 1QJX3 4CEWA 1RMU2 5C9AA 3TN92 5GKAC 4YVWB 1QJU1 3NAPC 2PLV1 1VBA1 2RS51 1COV2 5L7OA 1ND2C 1GFF2 4CDXC 3CJIB 1VBD1 3ZFEC 1PVC3 3VDDC 1FMD3 1BMV2 4NWVA 4QPGA 1EV12 1FOD1 2HWF3 2HWD2 2HWB1 4RFT0 5ACA1 3ZXAC 5AC91 3ZFGB 1RUD2 1PO22 4IV3C 1DDLA 2RMU3 4CDWC 1NY71 1VB2A 1AR61 4GB31 1QJU3 2PLV3 1POV3 1VBA3 3VBFC 1VBB1 3VBSC 1PGL2 1C8M3 4IV1B 1VBD3 2WZR1 5BNPA 1AL21 4RQPC 4JGZA 1MQTA 1FMD2 2HWF2 3JD71 1MEC1 4WM7C 4CDWA 1HRV1 5AC93 4RHV3 1AL0G 2RS31 5C8CB 2HWC2 3HAGA 2ZTNA 2WWSA 3VBFA 2XBO3 3S6PA 2RMU2 4QPIC 1QJU2 1RUF1 1PGW2 1RUI3 1VBB3 3J8F1 5DDJ3 2PLV2 5CFCB 1ASJ1 4Q4W1 1POV0 3JB4C 1AYN1 1WCDJ 4GMP3 2R061 3FBMA 1QJY1 1C8M2 2WZR3 1VBE1 1VBD2 5K0UC 1AL23 4RS5B 2MEV3 1TME1 3ZFGA 5BNNB 1H8TC 3JD73 1MEC3 1HRV3 1NCRC 2RS33 1PO11
chains in the Genus database with same CATH superfamily
2YG0A 1YO8A 5ERLA 4NIDA 2W94A 3O1OA 2NZ9A 1VRH1 4P9YA 1ND3C 1O4TA 4KGGA 4IERA 3UKTA 4MV2A 1ZZCA 4XPVA 1RUC3 2IXHA 3OPWA 2K2SA 4CP2A 4ISRA 1SLIA 2CY6A 2FCUA 3I59B 3ILNA 1DYPA 1GNYA 2D6PA 1ASJ3 5LEKA 2A75A 1MZ6A 2OQ7A 4Q4W3 5DDJ2 2UYAA 2VTXA 4IL7A 4CA9A 1NAEA 4D6RA 2BJSA 1SDDB 2NLRA 3JQXA 2B46X 4GMP0 2ORZA 3BPZA 5LBEA 1BVP1 2YXSA 4Q29A 3WNPA 1HRI1 2BOIA 4AXOA 4CCLA 1LENA 2P37A 2ZGSA 1SLBA 4JQTA 1ENSA 3C7HA 5EXOA 1KITA 4Z82A 2UURA 5CKQA 1J59A 4EJRA 3OPTA 2AREA 2OZ6A 4UBGA 3THPA 4YNIA 3E5XA 3GXUA 1B09A 1DQ5A 1ND3A 2WO3A 4KU7A 4OCTA 4Q26A 4D8MA 2RS32 4LJHA 3CQOA 1D4M1 3LIHA 4YZ4A 2Y6HA 4Q4V2 1UYXA 3NJVA 4Q4X1 5FMOL 1CAXA 3RFRA 2W91A 5DPNA 1ULPA 3SITA 2VXRA 1STMA 1OPOA 2EF6A 3I2GA 3F2ZA 3WF2A 2ZGNA 3ZN4A 5A33B 5M0TA 5DXDA 1H4GA 1OVSA 5BNNA 1JYVA 2DVFA 1VBE2 3P5BA 4XTPA 5T5LA 3PTYA 5T5OA 4YLZA 2YFZA 2ZBJA 4BQYA 2X8KA 4IEVA 4S2HA 2WS92 3NVCA 5IYYA 3OD4A 2IFWA 1WZXA 5BNPC 1WCQA 2FZ1A 4YZ3A 3N7JA 5FZ3A 1AYM2 1HJGA 4KWJA 3K3OA 1MQTC 1UOGA 1XOYA 3SXWA 1PHMA 5EV7A 3V65A 2MPFA 1F2NA 2PYTA 1KDMA 4MGTA 1G8WA 1BEV2 2XKOA 4FOVA 3AFKA 3H42B 3LA7A 4DY5A 4YZ5A 1JH5A 3MLLA 5GZGA 3OG2A 1D0HA 4K8FA 1D2QA 1OH3A 3D4KA 2JDNA 1OQEA 3VBHB 4JTNA 3IDBB 1PIV3 4AAXA 2WN3A 1S0DA 2RDSA 1BBT3 2C5DA 4B1LA 3UKVA 1W9SA 2EXKA 4TLGA 4F83A 4XETA 2PFWA 3SKVA 2XJUA 3LDBA 1MZEA 1KEXA 3FHAA 5A3LA 1S2EA 5CAZA 3OPZA 1PVC2 2Z5WA 3I3MA 3N9OA 2Q8EA 5DMYA 1K3IA 5HCFA 1C5IA 1QMJA 2EAKA 1EAH2 4QDSA 3DPRB 2GC1A 4Y20B 1RXGA 5I91A 2JJ6A 4XYXA 4EZ4A 3FLRA 2GNBA 5K9YA 1JYIA 3I97A 5FY4A 3VBOB 2AC1A 2YY1A 2F4PA 3WG4A 1OBNA 1UWWA 1US2A 2LALA 3ZXKA 2WL1A 4FTSA 1UZZA 2IXJA 3VHRA 1O6UA 1LOFA 4HOOA 2XDVA 4Y5SA 4D3WA 3IPVB 1F4HA 4MXWB 1W3VA 3PDQA 4QX1A 4D6QA 3M3CA 4AVVA 1XYPA 2RS52 3KT4A 1FPN1 2WNUA 4PI2A 2WZ8A 1CAVA 1R1ZA 2R071 3WDYA 5IVBA 5JSRA 4NRMA 3OBRA 2JIJA 3KV9A 4BYYA 3V0AA 1M4WA 4LITA 4PHZA 4KWLA 1B35B 4LO5B 2DFBA 1W6PA 2ZHNA 3H7YA 1LHOA 5FTTC 2B8MA 4LORA 1IPSA 4ASKA 2VD7A 3JBG1 4ZHNA 3LFMA 1N3OA 4I0BA 3RI8A 5ACA2 3POSA 2RJLA 5LA9A 1EY2A 4LEJA 4IW3A 2WT0A 2IXIA 2C9AA 4I0WB 1NY72 3QH7A 4CCCA 4BIFA 4GB32 5LRSA 2OX0A 1US3A 4OVEA 5DAPA 3AZWA 4N8MA 5IT6A 2ZGMA 2OT7A 4QKFA 2XLGA 1F9KA 5CG8A 4J25A 2XHKA 1IS5A 4FQ4A 3M3QA 1HQLA 3LA3A 5C70A 5FY7A 1HB3A 4LR4A 1LOAA 1UMHA 4IEUA 3KHBA 3I3EA 1SBEA 1AJKA 1ZBA1 1AJOA 4K7JA 1NE4A 2WRAA 3AFGA 3Q8BA 4Q2FA 4UW3A 1AVBA 4RS5C 1PO21 4XIKA 1H8VA 3T2QA 2W2IA 4K21A 3VKFC 3FJSA 2VU9A 5J36A 1W6MA 1X9PA 3N7KA 4EN6B 2Y33A 3B00A 4K40A 4X6RB 5TSWA 4BQXA 4CCOA 4AI1A 3ZDVA 2WKKA 2XQXA 3OBAA 1IG3A 5F2SA 3LZZA 2NMOA 2JENA 1N1SA 1QQP1 3HNBM 4QT6A 3WG3A 4CP1A 2E31A 5FOJB 1Q8SA 2RDQA 4O7XA 1DIWA 5I0TA 2LTNA 2QQVA 4KU8A 2OIIA 2V5DA 1S2BA 1JTZX 1O8PA 2VL4A 3LIGA 3L2YA 4QQHA 4B1MA 3VDDB 1AR82 1AYN2 1BHGA 2R062 5C4WC 2DCTA 1AR71 5FO7B 3VDAA 5C3OA 3KV5A 2XB6C 4YZ1A 2VJXA 4RS5A 1O91A 3SCGA 2J1EA 5LWBA 3OGRA 1RHI3 1APNA 1WLWA 2OXBA 1CVNA 1HXS1 4Z92B 4K6BA 5IAVA 2ZACA 4C0BA 2EICA 3POEA 4E2GA 5JMOA 3S57A 1ZRRA 2A70A 2RMU1 1HV1A 4CDUC 2C6SA 3CJXA 4XC9A 2J1AA 5HI0A 4XMAA 1R1A2 5FXZA 3VBFB 2ARCA 1R093 1RGSA 4OULA 4RR3A 3VDCA 1PMJX 4NRQA 4NE9A 2VOVA 1C8M1 1Y9GA 2WINB 5CYYA 5A7NA 2NP0A 3I2IA 3IZOA 4M0HA 3N9PA 1ZRDA 4N43A 4QKNA 5FO8B 4OHWA 4JKKA 4UXAA 3DF0A 1NA1C 1KFUL 1CWPA 1P8JA 5HV0A 4BJ0A 3O0XA 1NCQA 3AXDA 4KG8A 2HH9A 4NJ4A 4E2QA 1G9DA 1T2XA 4NHXA 3UJQA 4RQPB 3VKLA 3NNGA 2RS12 3T1LA 1RUH1 3H7JA 4PIXA 1X8MA 4JGYC 3URFA 1WCSA 1K45A 4WVMA 1Q8OA 2YZ4A 3WNLA 1EUTA 5FR3A 4WM8C 2WLPA 3NAPA 3ATGA 4CPBD 1CJDA 4AVTA 1K5MC 4DZGA 3AZVA 3U78A 2ID4A 3NNFA 3ITQA 4A45A 4CDXA 4F7ZA 2WFF2 3K75B 1MR5A 2BW8A 3MFCA 5DDJ1 1KD7A 5FO9B 3JQWA 3H3LA 3ZFFC 1O3RA 4YFWA 2ZXQA 1NOVA 2A6VA 4GMP1 4ONUA 4UF0A 3E5UA 4NHMA 3LDRA 1HV0A 1V9U3 2GN7A 4WZFA 1MS4A 4NPLA 5BNOC 1Y9QA 4IEQA 1ULGA 2HWE2 3B7MA 2ENRA 3JZVA 1YEWA 4JGYA 3RJ2X 3J7LA 1ZBE2 4CXYA 3AKQA 5FXVA 2A3WA 2ZGUA 5F32A 5JIUA 1ENRA 3QLQA 2NPIA 4GH4C 4IV3A 3ZYGA 3OEAA 1JYTA 3AL6A 1K5MA 2BVBA 2VZPA 1EUUA 3M8LA 1KS4A 5JWPA 3VZOA 1OQ1A 2DV9A 2ARXA 3PVNA 4M3CF 1ND3B 4Q4V1 2QQPA 4AOCA 2EXIA 3I4IA 5L19A 5EYYA 2I07B 4E27A 5LATA 4QU2A 1S0FA 3ZX7A 2IVJA 2B9VA 4NIIA 1ZRCA 2WO2A 4H7MA 3C7GA 1O8SA 1KDKA 3HBZA 3CKHA 3RWKX 1MS0A 3WNNA 1X7NA 4NR1A 5A7OA 3WV6A 2SLIA 5ABJC 1NYWA 3ZXDA 5A7SA 2ZKNA 3CHXA 5GLUA 1VMHA 5G05L 2WS91 1FAYA 3D0JA 2X10A 4OQ9A 4Q5OA 1W8FA 4XUQA 3UNPA 1AX0A 1UPSA 3M70A 1J84A 1UW8A 3VBUC 3QOPA 1QJFA 2JDMA 2W39A 2XJPA 4CEYC 1AYM1 2BQPA 1RINA 4BCUA 2XLAA 3LSEA 5GZEA 1OVPA 4C91A 3RNSA 2RM23 5F3EA 4BK4A 1LKNA 1UNBA 5GZDA 2D6MA 1BEV1 5A1FA 1F31A 4IE5A 1JMUB 2VECA 3ZLIA 4UFIA 2VM9A 1LU1A 1OD5A 1N3QA 2QUOA 1GNHA 2E6VA 5DAWA 5K0UA 3M3IA 3ZXFA 4XFBA 4QXBA 4AI3A 1U5XA 1DU3D 3L2HA 3NV4A 2PQSA 2YYOA 4LA2A 1T6GC 4CCNA 1VBC2 4LIVA 1XXNA 3PVBB 5JAXA 4EWAA 4AI0A 3O1SA 1PVC1 1NCRA 1UF2C 2VMIA 3RYKA 2DVGA 3ZPYA 4EN9B 1L3JA 1H1MA 5EJ1B 2HWD3 5A1LA 4XILA 5BNPB 3J4UH 5FPVA 4A7ZA 5IK4A 5F3IA 2JD9A 4XFCA 2HWF1 2ATFA 2Y26A 3JU9A 2GDFA 2W1WA 3K46A 2R042 3WQBA 4ES8A 4TZDA 1W6OB 5B2GB 2GNTA 1MQTB 2DUQA 1QGLA 4CEWA 2VTXJ 5GLWA 5LA0A 1QY4A 1G7YA 1RMU2 3JUUA 1H2LA 2V5YA 4OUSA 2YC2A 3TN92 3ZPOA 3CF6E 3WHTA 3F95A 4UFJA 1W9FA 1DQ4A 1QJU1 2W08A 2A7AA 1IQAA 2JDUA 2RS51 2J1TA 1COV2 5F5IA 3R4UA 1ND2C 1UCXA 2WA4A 2ZCWA 3LWCA 2Y6FA 1ONAA 4ES9A 1XNKA 1W90A 1VBD1 2ZABA 3ZFEC 4GJYA 4P08A 4QGMA 3GZUC 4IEYA 1QXJA 2Y64A 5C3SA 3BU7A 1FMD3 1GQHA 3OGGA 4HK8A 2QQKA 4XUPA 4ZXKA 4BXFA 4NWVA 1NKGA 4QPGA 1E5IA 1EV12 3NSTA 3H8UA 4AQSA 5DUVA 1UIJA 1W6QA 5ACA1 2VG9A 1O59A 3O0WA 3ZXAC 2D98A 5AC91 2XVKA 1C57A 5FPBA 3ZKYA 2OUHA 1HKDA 3DYOA 5IVEA 1DDLA 1NY71 4L2NA 4GB31 2FMDA 4NMIA 2FCVA 1HB4A 1W9YA 2KD7A 1OF3A 2WWJA 3NKTA 3AXEA 4DNYA 1IS4A 1O3SA 2PLV3 4NAOA 1ZNPA 3KGZA 1VBB1 4UFLA 4XF9A 3A0KA 4AFBA 4AVSA 5F9TA 3J26N 4TWTA 1OA2A 3B9IA 3PTRB 4CU8A 1HIXA 2D43A 1SBDA 2JKXA 2VMDA 4LE3A 2TUNA 4QX5A 5L9RA 5KC5A 5HPOA 1ENQA 2Y0IA 2C9KA 3U11A 1NLRA 4Y1XA 2HBTA 2VQAA 1OLQA 3VD9A 1MPXA 4AEJA 3JD71 3DL3A 1Y3TA 1LOBA 4XQ4A 1KRIA 2EXHA 4QMAA 2C24A 3HAGA 3AKTA 3TAYA 4OHYA 1JZ3A 3ENRA 2BP6A 1H9WA 4BH9A 5IFTA 1OXCA 1QOOA 1YQ6A 2OVUA 2WNVA 2OKXA 4LIUA 5E16A 3RYPA 3NV2A 5DG2A 3KF3A 1RUI3 1S0GA 1QNYA 3LOIA 2ET1A 1ZX5A 2SBAA 1JYXA 1QH7A 2KM2A 1LU2A 3JB4C 1AYN1 3OB8A 3TRSB 3KZ4C 2R061 3FBMA 2LRPA 1QJY1 1Q43A 1SZBA 1XRUA 2QZ3A 3NL1A 1C1FA 3PU8A 3ROUA 3EO6A 1U5ZA 4HANA 4MVTA 2CL2A 5FP3A 3SKJE 5F5AA 1MS5A 2VTFA 4Z1VA 4RS5B 4X8NA 3PIGA 1V6JA 1UXZA 2J42A 1DQ1A 2Y34A 3W21A 1IKQA 4FBFA 1OLMA 1UAIA 1AX2A 2DU1A 3J9SA 2BDRA 1HRV3 1YCIA 3LGRA 1W6NA 3VHOA 1OOPC 5E89A 3UL2A 3T0DA 5LW9A 1OFSA 2QTWB 4EN7B 2YDEA 2X29A 1OUSA 2O14A 3HR9A 1R081 5D8AC 1PNGA 2CAVA 2E63A 5F6LB 2FDJA 2B42B 1SCRA 2XBO2 3T0AA 3O14A 4P02B 4I0AA 3AP7A 3MW2A 4Q0SA 2DCJA 3W59A 1F5JA 1OD3A 4TN7A 3WCRA 1XBFA 1TZOA 4CCEA 4DS0A 5C4WB 2E7AA 3PNAA 2QDRA 1WW5A 4U36A 2RS11 3WNOA 3FHIB 4QXKA 2WT2A 4COZA 5E8AA 2BWAA 3EMRA 1AL22 1GICA 2ZAAA 4Y26A 4LHSA 4KI5M 3ZYFA 4CUBA 1JUIA 4RD7A 5C8CA 4XQDA 3WVJA 4D69A 4E4SA 1PO13 2JX9A 4FO9A 1W8TA 4CDUB 4Q1RA 1HN1A 1ZZ9A 4MXVA 3RSJA 3WW1A 4RFRB 1V0AA 2WFF1 1VRH3 4ZY9A 5J7MA 4KG0A 4P9GA 2ZEZA 2I45A 5DAQA 1CJPA 2AEZA 3ST7A 1YXWA 1RVF3 3NO8A 4HMZA 1RUC2 4XFIA 4DUVA 1JZ7A 1DGLA 4JX0A 3M7AA 5ANQA 5LBBA 1ASJ2 2HWE1 3N9LA 4GWIA 4Q4W2 1NA1B 3NJXA 5FRAA 5LBCA 3SQOA 3S5QA 4BZ4A 3DECA 4WV8A 1ZBE1 4M3CB 4LOTA 3LOBA 3GHMA 1UYZA 2GMEA 1AR91 2RE9A 3BKZA 2QVSB 1BXHA 3VD5A 2HBUA 4JGYB 4LXLA 2CDOA 1ENXA 3FL7A 3BTXA 3BU0A 4YWAA 4BU2A 1MACA 1ZM1A 3WP6A 4URAA 2ZS6B 5FZAA 3OBZA 4P9WA 1CAUB 4WM8B 5APAA 3O1PA 4Y1UA 2E26A 4DXTA 2WQ8A 1K5MB 3IAPA 4C0HA 1O5UA 3I49A 1D4M3 4JGZC 3APBA 4CCKA 5FPUA 1W9WA 5HCAA 3POYA 2FDIA 1CZTA 3ZFFB 3ZMOA 1RJ7A 2MNGA 2G1MA 1HB1A 1PZ8A 2PA7A 3IIIA 3I3BA 4PQ9A 4Q4X3 4QPYA 5FK8A 3WF0A 4DXRA 2Y60A 4ET7A 1SHWB 2ZHKA 5BNOB 3ZYBA 4A42A 4KWKA 4CU6A 1OC1A 1VIWB 1GZ9A 1OHFA 2TBVA 1RTVA 4YVSA 5CG9A 5JOZA 2QQLA 3PVOA 5CVRA 3THDA 4GH4B 2GC2A 3FE5A 4B7KA 4ORFA 2BFUL 3ZDSA 5GZFA 3HMYA 4A4AA 3OUIA 4N7UA 1LOGA 4OLLA 2FDHA 3THTA 1FOD3 4L11A 2DDUA 5BPXA 3NNMA 2WO1A 5LA1A 1QJEA 3JB8A 3BOPA 4FOWA 3TYJA 3RZKA 2FDFA 4HPKA 3ZFGC 5LASA 3RZMA 4JZRA 1KQRA 1LRHA 4BHPA 2PTMA 2XVGA 3G6JB 4LBQB 1AR63 1LOCA 2EIEA 1RC6A 2WDBA 5CB7A 4CCMA 5H9PA 1OI6A 5EFUA 3WDVA 3FHQA 1WA6X 4XURA 3VZLA 3IB3A 4XJ8A 4IE6A 3ZR5A 5ABJB 3OY8A 1GSLA 3A4UA 4KBZA 1PIV2 4NROA 4IE0A 4Q0UA 5A6ZA 1W06A 1XYNA 4PLNA 3D0SA 2CWSA 2PAKA 3WQ0A 3VBRA 1JU4A 4FFGA 3VBUB 2EXJA 4QHZA 4LK7A 2RDNA 3EBRA 3AB0A 4CEYB 4H3WA 4AFDA 3VL9A 4CVUA 1X8EA 3HOBA 3HNYM 1RMU1 3K4ZA 1OUXA 2EIDA 3OOXA 5JR7B 3VV1A 2D6NA 4YW6A 2W92A 3MV01 3TN91 4HKOA 5IFPA 2V4VA 3K4AA 4YSFA 4K1ZA 1G9CA 1EPZA 1Y9MA 4YM1A 2VBDA 4V2VA 3E6CC 2VOXA 5CKNA 5F8PA 5FZMA 1W2NA 4TSVA 3MHZA 4AHXA 3T0BA 2D3RA 1FPN3 3BB6A 3WCSA 1C5HA 4CE8A 1I5ZA 3A7QA 2R073 3MBWA 5FMOS 5LK7B 1UPIA 5FZOB 4Y3OA 3EQEA 2WZR2 3R6SA 1IKPA 2ZX0A 5FYMA 2XVLA 2XONA 3WEZA 2ARBA 2ZEYA 1CPNA 5FMBA 3AZZA 5BNNC 3GNEA 3JBG3 1S0BA 3OJBA 3B94A 4BPZA 1MEC2 4AI2A 2WC2A 3OBTA 2Y6JA 5FWJA 2YU1A 1LULA 2ORXA 4LKFA 3ECQA 3PHMA 2RJ2A 2QQJA 3GZEA 2VBPA 5AFBA 2YC4A 1G9AA 1ND2B 2NYYA 1H9PA 2WYSA 3H9AA 1W03A 3OYWA 1UY1A 2VAUA 1RUF2 4LHLA 1WMDA 4KQ7A 2DU0A 5G04L 2QQIA 4K9SA 4XCAA 5ANNA 5FP9A 3ZFEB 4IE4A 1H4HA 1XU1A 1CAWA 2LROA 2RG4A 1RUJ3 3KQ4B 3VZNA 3S30A 1C4RA 3O0VA 5IK7A 2ZX1A 3LSDA 1ZBA3 2YUEA 1SBFA 4NN0A 3ZSEA 2B5HA 1TMF1 1PO23 2BBAA 2YGMA 3TBDA 5JVVA 5FV3A 4BB3A 5FYSA 3AX4A 4KGQA 4FSJA 1WLDA 3MIEA 1I6XA 3RI9A 3H50A 1URXA 5FQ0B 5FZKA 1JU3A 4YW3A 3SMHA 1YJLA 2ZJCA 5D2AA 1QQP3 4XJ9A 1YIFA 2WNVB 1RUE2 2G9GA 3DCQA 5FY0A 5JXHA 1SPPB 4ITCA 2E32A 3R4SA 2R0HA 3DV8A 4PDWC 5FPZA 5FZ4A 1YI9A 1W0NA 2RR13 3ASIA 5CFDA 1W9TA 3WDTA 3ZIWA 1VLNA 3V0BA 3I2JA 5EJZB 1AR73 2O8OA 1LOFC 4JAAA 4LK6A 4XDPA 2HLEA 1IS3A 3O12A 1REFA 3WG2A 5KXDA 2VZOA 3KVBA 3RJRA 1HX6A 2EA7A 5FZ1A 1HXS3 4GA9A 1RHI2 2WNUC 1GWMA 1GOFA 2QQOA 2VVFA 4UWDA 2JG8C 1CQ9A 1UY3A 1E5HA 5D1IA 4QB2A 5FMDA 2XJSA 4IETA 2XBO1 3U0ZA 2ZAHA 3SCHA 1X9TA 1CX4A 4NIAA 2WAOA 4JHZA 2K9ZA 2ZZQA 4Q8LA 4MGYE 4FP2A 4LO8A 4PDWA 4AEDA 1GWLA 1R092 1QF3A 4KH9A 1W2AX 2BERA 2GC0A 4Y1YA 1EPWA 2H0BA 3N9QA 5C5UA 1AHSA 1IZ3A 4UFMA 1Z78A 3AZXA 1YRZA 3DXUA 5AFEA 2KXLA 1WD3A 2BUKA 3RZHA 1RUH3 5GALA 2IWGB 4MG2A 3T2TA 4XMIA 2JG8A 2VNVA 3GBGA 1SLCA 1Q8VA 1OOPB 4RL7A 5KXBA 1YWKA 1S0EA 2E9QA 2LW8A 4L8QA 1W8ZA 3UESA 2ARAA 1GV9A 1XNTA 3IKWA 1T6BX 5FYCA 4QB6A 4PLMA 2R32A 2VZRA 4Q4Y2 3UKNA 4A7YA 1LAJA 1FNZA 3VBSA 2A6XA 2R1DA 3C3VA 5D8AB 4LLFA 1PX4A 4B8EA 4DQAA 1V6IA 1JZ6A 4FPKA 2I74A 4IDZA 1WMFA 1RUC1 3VGIA 5FZLA 4G3YC 3UJOA 2VMEA 4RSUA 3GCXA 3U14A 1FT9A 1GWKA 4OI0A 3IWZA 4EWDA 4FTBA 4XJZA 4SLIA 4ZZ5A 5KBFA 1LCLA 2J1VA 4XUNA 1DGWA 2VVDA 1V9U2 5I8YA 3CO2A 1Z7S3 5JR2A 4AG4A 4LBJA 5JI9A 4WM7A 1LJ7A 2KA3A 4YW7A 2FDGA 5CKMA 4NVPA 4E4DX 2WZPP 5FZBA 2F17A 2GH8A 3MV11 4P14A 1A6CA 4B7EA 4XABA 1DCSA 2YB7A 3LF7A 3MLKA 4M00A 2ZHLA 3KMHA 4BIOA 4DFSA 5CISA 4R52A 5JZGC 4LQRA 5FPAA 5T54A 4ZS2A 2GMPA 1W3XA 5FLIA 2E7TA 3LQCA 1IHMA 4EZHA 4CP0A 4LULA 3IDCB 1CZVA 1LGNA 5C7GA 1AXYA 4R9AA 3FX3A 2CGOA 2GN3A 2VNGA 5I0UA 4RN5A 2Q8DA 1JOBA 1SFPA 2XJTA 4YM2A 1JYCA 4AHZA 1WBFA 2QQMA 4MZUA 1JODA 1PGL1 1Y7BA 1YUDA 2YBPA 3WF3A 5JOXA 1A8MA 2DUPA 4FPHA 2CNAA 2C1FA 5FWEA 4Y1VA 3GCWA 3ILRA 1V70A 1H8TA 1XNCA 3IDAA 4FPOB 3MIBA 5GLTA 3RQ0A 4RR3C 1YQ5A 2DUOA 2D40A 3WXPA 2DBIA 3ACIA 4P5HA 2ZMKA 2XJQA 3UGGA 4HL0A 3PIJA 3ZMNA 4DRVA 1G86A 2VCMA 4N43C 4Y5Z0 5JZGA 1WW4A 4CP9A 3O1VA 1DZRA 4XFFA 1OKQA 3H0OA 3P3NA 1OT5A 1XNAA 1NCQC 1GU3A 5KHHA 3SEPA 1RUD3 4S2DA 4JGZB 4CCJA 1FATA 3WP3A 5FKBA 3LPGA 2CGPA 4MX3A 5F7UA 4A3XA 5C9AA 5LCWL 3ABZA 3POJA 4LKEA 1MVQA 3MIFA 4CU7A 2WABA 2YC0A 3NAPC 4R8HA 2XQRA 5LK5A 2Y6KA 3NMBA 1UKRA 2B4KA 2VMCA 3IIAA 4I09A 3VHNA 3HEIA 3RS6A 3U37A 5L7OA 1RUOA 4CDXC 1DLLA 3AYCA 4ZXEA 1TNRA 2HJIA 4C8DA 4CUGA 2WA3A 5LRRA 3TNQA 1PVC3 5FMCA 1JBCA 3O7OA 5A6YA 1QXRA 4LE4A 1HN0A 3RDIA 2QCSB 3WDXA 4COYA 1IPJA 2ILMA 1QEXA 2XUEA 3FC0A 4HVRA 2HWF3 2HWD2 2P17A 2VW2A 2GAUA 1WLTA 4XTMA 1GKBA 2YROA 4BWOA 4MHUA 1H1AA 3IAQA 2UY9A 4YRDA 5A7WA 3ZFGB 4A44A 1XSRA 3AZYA 2DVAA 2W1UA 5HCBA 1VALA 4IV3C 3AC0A 1ALYA 1VB2A 3GDBA 4O9EA 1GZWB 2IC1A 1I9RA 1QJU3 1W04A 3MW3A 2P3JA 1UY4A 3M3OA 1PVXA 1POV3 5L36A 4HZFA 1BVVA 1A34A 5DZEA 1ODMA 2BTVC 1ZVFA 4IESA 5DZGA 5A3MA 1FNYA 1XU2A 4QM9A 1VBD3 1OA3A 2OUJA 2QFEA 2PHTA 4XE9A 4W50A 2WZR1 4HK9A 3ZN6A 1WD4A 1RUNA 3HVDA 3PL0A 4WVZA 4ZU4A 2X09A 4BA6A 3WF4A 2VY0A 1FMD2 4MADA 4AQ2A 1REEA 4YARA 5B4XA 3A0NA 5FUNA 1MEC1 4KNCA 3AK0A 5AC93 4OUMA 4RHV3 2VUJA 4QX7A 3WQ7A 3MGUA 2RS31 3WP4A 4AW7A 5FP7A 2HWC2 3ES1A 1PM4A 3MF9A 4QDQA 3SH5A 2ZTNA 5J48A 4M0NA 4QB1A 2WWSA 3KM5A 3E97A 1UIKA 2W68A 3W20A 3IT8A 1H2MA 2CWMA 1JZ2A 1BK1A 4B4QA 4WVVA 1S1AA 4FAHA 3IN9A 2XMLA 3P1IA 1J83A 1RUF1 2Z79A 1VBB3 1C28A 3N9MA 5FKCA 4AFCA 2PLV2 3MZHA 4Y1ZA 4XDOA 1WCDJ 1ZA7A 4XUTA 5KHJA 1I3HA 2C0ZA 1SG3A 2JB8A 4A2UA 1BLZA 2R0FA 1CAXB 5FXWA 2WNEA 2NQYA 2VC9A 2ZZJA 1VBE1 4HVOA 5K0UC 2OYZA 3K4DA 5JXGA 4C1XA 4ARXA 1CAWB 3SCFA 3BIWE 5IJRA 3ACGA 4ZS3A 3T1MA 2MEV3 1PX3A 1KS5A 1VR3A 1OSGA 4L92A 3T4HB 5BNNB 3JD73 2VCBA 5FY8A 2ZEXA 3WW2A 2AH2A 1NCRC 4IE7A 3I2DA 5EZWA 2VNRA 4AZZA 1H2KA 3WHUA 5JDBA 2QQWA 1O5LA 1H2NA 4MGKE 2GNDA 1RUE1 3ZSJA 1W0PA 3ES4A 3SH3A 2VQTA 4H55A 2PHUA 2Q4SA 3IDEA 2P3KA 1XE8A 4IV1A 4NAMA 2Q8OA 4CEWC 2QKDA 4EN8B 1PZ9A 2VPVA 1RUI2 4R4XA 1AYN3 5FY9A 2A6WA 2A6YA 4COVA 3TEYA 1QJY3 4QQLA 3VKNA 4BXSV 4MGZE 2DTWA 1BK0A 2OQ6A 3HPNA 4TYSA 2E53A 3AP6A 5T50A 4P9XA 3V0BB 1S0CA 1OH4A 2BGOA 4ISQA 4ZKTB 1JZ8A 3K51A 4HLTA 4JQRA 1K42A 4FXKB 4E8DA 1UYYA 3MEPA 3RZZA 3T09A 5IHRA 5J96B 4WZCA 2PMWB 3N4MA 1U0AA 3OD0A 1J58A 1EAH1 4QM8A 1YIPA 1G9FA 5C33A 1K5JA 2VCCA 1CX1A 3TOJA 3MFAA 3T2OA 3M1HA 1RB8G 5A6XA 2CGNA 4DUXA 4QPGC 4CCDA 1R083 5FFOC 2XLFA 4K20A 1RUG3 1R091 1WA4A 2WZEA 2B39A 3OEBA 3ME2A 5CADA 1PK6C 5T5JA 3R05A 1YFUA 1O3QA 2G9ZA 5C71A 2JDHA 4PDWB 5AVAA 4HFSA 3VZMA 4AEDB 2XWJB 4AQTA 1GOGA 5FREA 3LEKA 4JKMA 3L9JT 5FPXA 3AVSA 3ACLA 5DQ0A 1HB2A 2OPKA 2WNUB 3FUOA 5CEHA 2W52A 4RYDA 1CAVB 5JXIA 4AGRA 1VRBA 2JG8B 1K12A 3LD8A 4ZONA 1YFYA 5H9QA 4Q4Y1 3RWNA 3WINE 2D6KA 3V0AB 2JD4A 4NWWA 5FZHA 1SLLA 5A80A 4D0QA 1PO12 1W6PB 1PK6A 3H8OA 3B3QE 3I59A 3GJAA 1XSQA 3W5NA 1QJX2 1VRH2 3IMMA 4FQZA 1NE6A 1LR5A 4O9GA 4JCKA 4LUKA 4UW6A 4YVWC 3UGHA 3UV9A 2QQNA 1RVF2 3C7EA 3E1F1 4E4HA 3GM8A 1V9U1 2RV9A 2ET7A 1DYKA 1S4CA 3SLIA 2R7EB 3WG1A 2VMFA 2XJRA 3ILFA 4LBQD 2Z69A 2WNVC 4TLFA 1QWRA 3I2FA 2LUWA 1AR93 4OQ8A 4C1WA 1UU4A 4M3CE 5A6QA 1GYKA 2XL7A 2DFCA 5JOWA 1X50A 2WN2A 4I3GA 4LT5A 3ZSLA 1E57A 2A71A 4A6OA 5BUVA 4GALA 4AR2A 1LGCA 1IG0A 5F39A 2HWB3 2JDAA 5FZGA 3B02A 1PMHX 1D0GA 1UO9A 1YQ2A 4P9LA 4QDRA 4KMQA 4QKDA 2B7YA 1AXKA 1A8DA 3MUZ1 1AXZA 4HT1T 3ZYPA 4YVWA 1D4M2 2V4AA 2HEYF 3S7EA 1W6MB 1NT0A 3GBWA 4HETA 4FP3A 4YFZA 2D6LX 2P6HA 1GP6A 3DKWA 1AF9A 3LEGA 4JHTA 5FYVA 5A33A 1JS9A 1YYNA 4Q4X2 1Y43B 5DUWA 1QKQA 3OSDA 1YHFA 3FLPA 1VBA2 2W9XA 4H2AA 1AR81 3P3PA 2RHPA 2Q1FA 4JRLA 1E5SA 5AVPA 3BTYA 3IBMA 1OLRA 4XBNA 1JN2P 3EHKA 4OZXA 1W2OA 5CA6A 4JRAA 3W9AA 4W65A 1D7PM 1W39A 1X82A 2VUAA 3GGLA 2XGXA 4BLIA 5JZGB 3AYEA 2W46A 2BNNA 3UT0A 1FOD2 3DYPA 1J1LA 3UGFA 4IGQA 2VOWA 5FUPA 4I30A 3OTFA 5C8CC 1SFNA 2JE9A 2ZEWA 3D6EA 1R1A1 4N9IA 4YGCA 4GKYA 2JDYA 1ULEA 1AR62 4LO7A 4AHYA 5LEJA 2PHXA 4RGKA 3J7MA 4JDMA 1R64A 3J8F3 3WNKA 2UU8A 3ELNA 3RRDA 2GC3A 2XH6A 3M2MA 4RR3B 5C3PA 1XPWA 5FP4A 1WGPA 2YV8A 1UZ0A 4COUA 3KCCA 1MZ5A 4FPGA 4MH0E 3U1XA 2WYFA 4KWUA 4N43B 4AEMA 1UZYA 2A3YA 1ZZ7A 2HWD1 2VZQA 2Y0OA 1VMFA 2N7GA 1ZRIA 1N3PA 3DPRA 2Q1ZB 4OMDA 4Y20A 3ZXEA 1NCQB 2CV6A 4EE2A 3KV6A 5F3CA 2FDKA 3KCYA 3KVAA 1SMVA 1TME3 3N36A 5I8SA 3VKOA 1RMU3 3AKRA 3KT7A 3D8CA 3VBOA 5LY2A 3OUJA 2PXJA 1LODA 3WQ1A 3TN93 4IEXA 1NUKA 2BGPA 2BZDA 4WVMB 4NIHA 2X53S 1WUVA 1AUYA 2CHHA 1Y4WA 3IPVA 3PJYA 3NAPB 3LEIA 4MXWA 1LHWA 1I1EA 3LCPA 3Q8EA 2GSYA 3WW4A 1C8NA 2ZPXA 3B69A 4MOAA 3TEXA 3DN7A 4DMIA 3PURA 3FUQA 3I3DA 5FZ0A 4CDXB 4YW1A 4AL9A 5DUXA 1ZYBA 2LS6A 4M4PA 1JOJA 3AM2A 4XXAA 2C4XA 4HN1A 4DOUA 1VB4A 3P6BA 5C8WA 1FPN2 4UF0B 2BV4A 2VZ3A 2O0OA 1B35A 5SV8A 1WWYA 1ST8A 4N53C 3WDWA 3HWJA 4BOWA 2ZKLA 1HRI3 1WW7A 3O1TA 4LOSA 3VL8A 5JUVA 1CONA 2BEOA 1UY0A 3TEZA 2PHFA 4META 4DXZA 2HWC1 4YVSC 1UD1A 2VR4A 1OQDA 4JC1A 4IV3B 3HBKA 5BNQA 4EWEA 2BFUS 2P2KA 4FPEA 3JBG2 3M4FA 3BODA 3X29B 1QNWA 2D3SA 2ZGKA 3K3NA 1EYBA 3ZXJA 5I0DA 2C26A 1YC61 1VE0A 2TEPA 2ZGLA 4M01A 5J09A 4ARYA 3EJKA 3OF1A 1OMIA 2D97A 1SCSA 2BNMA 3HN1A 4AEKA 4DPNA 4QGNA 4DRRA 1W8HA 1WMXA 1J3PA 2JIGA 3HNMA 3QBQA 1MS9A 4MGSA 4N90A 3U10A 4BM8A 2NMNA 5FJKA 3LB9A 2WSUA 1DGRA 4MSVA 1A3KA 3LPFA 3OCPA 4N53A 1RJ8A 2ETEA 2QE3A 4BQ4A 1XE7A 4JKLA 4B4RA 2PAMA 4OYUA 2DWRA 2FBEA 4CUCA 5JLVA 1V6KA 5FYIA 3USSA 3QCWA 1RUJ2 4D7SA 4YG3A 5I8TA 1TMF3 1VP6A 4HKLA 1ZBA2 2ZA9A 1Q8PA 4O65A 4BQ2A 2VCAA 4QX0A 2J1RA 2Z42A 3VBRC 5K8SA 1N1VA 1YI7A 4E2SA 2DYCA 4A6SA 2ZHMA 1WLCA 1GMMA 2AUYA 4XDQA 1CZSA 3PVEA 4OMCA 4W6XA 4W8JA 1OKOA 1JXNA 4HBNA 1RUI1 4KBBA 5F5QA 5FZFA 4UBHA 4XOGA 1QQP2 3VDDA 2A73B 4LO6B 5BY5A 1H30A 2DCZA 2DTYA 2YPDA 4D7TA 1DQ2A 1VBC1 5K0UB 2RR12 3KWVA 2XKPA 4I02A 4BMEA 1AR72 5A3PA 1LEMA 1MZFA 1ULDA 4COWA 4GQ7A 1BBT2 4L0PA 4R9CA 4IEOA 3MICA 1QJZA 4GWNA 4TXWA 5EYXA 1NCRB 1OPMA 1HXS2 2R041 5B4NA 3BI3A 2LM3A 3OGVA 3MO4A 2VUCA 2DBNA 2VH9A 5BYNA 1REDA 4CUAA 3PMEA 5C5TA 1W99A 1LEDA 2Y8KA 4K8RB 5A3NA 2JDKA 5BXXA 4AYUA 4CEWB 1BQPA 4K1YA 2P3YA 3ZYRA 1LECA 4BQWA 4LMFA 3PUAA 1UU6A 2BWCA 3MIDA 4UYBA 2HKXA 4JVAA 1COV1 1C1LA 1KGYA 1GUIA 5J98B 2Q30A 3N35A 4Q0VA 2JEMA 4RQPA 1JZ4A 4I2OA 2A5ZA 2BPA2 3ZYJB 5BV6A 2K46A 1JHNA 3AYDA 4XJWA 2RVAA 4W6WA 4NIGA 1SACA 1UN1A 3HN3A 1RYYA 4LBKA 2CDPA 2BRTA 2KR2A 5FXXA 1RUH2 3FBYA 4XJUA 4ZPIA 2VBBA 2ZGOA 1EV11 2CSGA 4OZOA 5IW0A 3B9CA 4Q0PA 2GU9A 3ZXGA 1A78A 4FFIA 3MF6A 4UAPA 4FT8A 2X5IC 4QPGB 1XE0A 3CMGA 4DXSA 1QJX1 4UW5A 1W6QB 4AI8A 3NNJA 5E88A 3AKSA 4NHLA 4BE3A 1PK6B 3I2HA 4UI9L 1FV2A 2XPJA 3MPBA 1RVF1 3C7FA 3INAA 4Y4RA 2FHRA 5FUIA 2W5FA 4XBLA 2QJVA 2VMGA 4HXCA 5GM0A 3W58A 5GJ6A 5IVVA 4D94A 1RL3A 1DZTA 2PHRA 5L73A 1N47A 3MLJA 2Q8CA 4A3ZA 4ATFA 2J7MA 2VZUA 3N3HA 5LZ6A 4GULA 2A1XA 4J1WA 1PMIA 1Z7S2 2JKBA 3LDKA 1UOJA 4XZUG 2WT1A 4YW4A 5J1XA 4LBOA 2WLQA 4SBVA 2UYBA 4ASMB 5CFDC 2X5IA 3GJBA 4RA0A 5A3WA 2X05A 1VPHA 1GLHA 3WW3A 4CTEA 4IGPA 4XACA 3A22A 2EALA 1BKZA 2XOMA 5J37A 3E5QA 4YZ2A 1S2KA 2H6CA 1U5IA 1ODNA 4L99A 4DEVA 2H6BA 4XBQA 3O1MA 1ZRFA 2W1SA 4XJAA 1DGRN 1POQA 2VGDA 4YVWB 3GF6A 4B4PA 3H1YA 3I2OA 2OPWA 3MW4A 2FQPA 3AYAA 5EQUA 5DAXA 1VBA1 3B01A 3KHCA 4B29A 2BYVE 1JHJA 2ES3A 4PBPA 3T3YA 4W4ZA 1JI6A 1GFF2 1W05A 4QQ2A 5A32A 3RZJA 4JDNA 4GIQA 1W8WA 5IUQA 3CIHA 4J1XA 1KJLA 4AFAA 3AJZA 5EPAA 3DYMA 5T3NA 5JSOA 3ZYHA 3BN6A 3GALA 1BMV2 2H0VA 2K0GA 1DHKB 2PHWA 3VD7A 1FOD1 4Z2AA 1LHVA 2ZMLA 4G4FA 5IVFA 2Q0AA 2YGLA 2IVIB 5IATA 2JB4A 4QPWA 4CXXA 2ZGTA 2FCTA 3KT1A 1RUD2 1F35A 4JDOA 4RGAA 2YU2A 3ZIXA 3U4XA 3LEMA 1TE1B 3HQXA 2RMU3 1W6NB 4CDWC 4CZSA 3KV4A 3R0RA 1AR61 1KFXL 1SLAA 3KCXA 4S2FA 3SC7X 1YNAA 2ZOEB 5I93A 4XFHA 2AYHA 2CU5A 1FV3A 2XWBB 1DG6A 3WD5A 3VBSC 3WT3A 1ZREA 1IGOA 5A7QA 2JE7A 2JDPA 1UZWA 1C8M3 4TTGA 2JWPA 3S5AA 4OI1A 1UXXX 1YFWA 4PIYA 3VB9A 1KXGA 5BNPA 3BTAA 1GQGA 4ASLA 3PMSA 2YBSA 5EHDA 3IMNA 3TWIA 1AL21 2JDZA 4P9IA 4QD2A 1W6OA 1E5RA 1UL9A 2OS2A 1MQTA 2TNFA 1UZVA 3AMNA 5LBFA 2HWF2 5FDBA 5KHKA 3EXUA 1ULOA 1IPKA 2R30A 3FMGA 4WM7C 4CDWA 4LBMA 2YBKA 3MUY1 5C8CB 4M4RA 2HEVF 1ZZ8A 2PHLA 2W1QA 1ULCA 4JTOA 4PQQA 1NLSA 3POFA 4QPIC 1GR3A 4AGVA 2R49A 4QKBA 4BLJA 1NXMA 2VNOA 3CNAA 2QZ2A 4NRPA 1QJU2 4XXPA 1DF0A 1FXZA 1PGW2 5DDJ3 3WZ1A 1FI2A 4Z2WA 2ADEA 1CIWA 1ASJ1 4Q4W1 1POV0 2YPJA 2Q5TA 4FPYA 4GMP3 5EIYB 4Y24A 3KLSA 1LESA 1D4VB 4FPJA 2WZR3 1YLLA 1F4AA 1GBGA 1RIRA 2HEWF 5FZCA 1VBD2 3I2KA 2WAAA 1UYPA 4QHBA 2QDNA 4U2AA 4Z8BA 3ZR6A 1KJRA 4AK3A 3WNMA 2PELA 1H8TC 1MEC3 4XEZA 2BU9A 1MS8A 2RS33 3BOWA 1OF4A 4QPIA 4HN0A 5GLZA 4CYDA 4FAGA 4RHV2 5AC92 1G9BA 4YW2A 2VW0A 5JCTA 1UOBA 4Q4V3 5A70A 2O1QA 2P1BA 4AVCA 4EV0A 3BPSA 1RUF3 3SEEA 2FZ2A 1EP0A 1QDCA 1UMZA 3I54A 3KSCA 3SH4A 1TQ5A 3H1WA 4D6SA 1LHUA 1VBB2 1WW6A 3C2UA 3GYDA 4BMBA 5C9AC 1BYHA 2BGCA 4FPCA 1AZDA 3WUDA 4PF5A 3TNPB 3NKGA 4EYUA 4X8PA 3LFIA 5FLJA 3SISA 3WOGA 1VBE3 4N53B 1RUJ1 3CL1A 4B3NA 4DB5A 5DABA 1H0BA 4CPBA 4XIOA 4XAEA 3MDPA 4NOTA 5JPMB 1BJQA 1GOHA 4PT6A 5L7OC 1PGSA 2CTVA 2WS93 3I3QA 3PUSA 2AACA 4QXCA 4YVSB 1WCUA 2W95A 3AMPA 4URTA 2D5FA 1OA4A 2MEV2 5GZCA 2EIGA 3AMHA 2IUWA 3JD72 4YG0A 4CRQA 4XF0A 4Y22A 1AYM3 2P4EA 2WQZC 3VD3A 4P5YA 3RZLA 2ADDA 3DUIA 4IUGA 1JZ5A 1NZCA 2XG3A 1AX1A 4OHXA 5JI7A 4DEQA 1RUE3 3CU7A 3U75A 3WLUA 5FZEA 2RM22 1BEV3 1XB9A 5IAXA 4QQPA 4HPKB 2AENA 1GZCA 2WSVA 3CZJA 4NPMA 5EP9A 2P6CA 4WVWA 3WDUA 2W0XA 1F8VA 4QGLA 5I0RA 4GZ9A 4Y5TA 4QX8A 3GZAA 2RR11 4MO3M 1N1YA 1QJY2 1PIV1 3B93A 4XZPA 1NQJA 1BBT1 2WUHA 4FXGB 3H3ZA 4BISA 1ZA4A 3NV1A 5I0SA 4DUWA 3CDZB 3OY8B 1UOFA 3VD4A 1UX6A 1QOSA 4FPFA 1GNZA 5FP8A 4GXLA 1EAH3 3VBRB 4H14A 3BIEA 4LLOA 1DP0A 4YGEA 1HQNA 3AL5A 3N7LA 4YM3A 1WCKA 4FTEA 3HIFA 3BTZA 1VAVA 1SLTA 2UWBA 4XHXA 4CDQC 3H3UA 4PIZA 3OUHA 5A32B 1PNFA 3KQRA 2DCKA 4QX3A 1IS6A 1R082 2Z2SB 2GZWA 1RUG2 4AFMA 5A3UA 1LNSA 3RZGA 3POIA 5C4WA 5F37A 2F6BA 4LKSA 5KHIA 2NN8A 4AQ6A 1DGWX 3HQUA 2RS53 3LA2A 3NRUA 3BALA 5FYYA 1CPMA 2Y6LA 3DGTA 1Q5OA 4EQVA 1CESA 5KC6A 5K4LA 4FOYA 3AMQA 2D5HA 4FFHA 3GBFA 3K48A 3JXSA 3KB5A 3CJIC 3NW4A 3AP4A 5LA2A 5EWSA 4O61A 4YYOA 4CDUA 3Q8CA 5LY1A 3I7DA 4MUVA 5H9SA 3KS7A 1J1TA 3Q9OA 4CDQA 4Q4Y3 3ZVXA 4L97A 1LHNA 1L7QA 5FZ9A 5ACA3 2JECA 1Q8QA 2AEYA 1O4ZA 4ZU7A 3LE0A 4Y4YA 2PHDA 4F3JA 4GAZA 1LOEA 1O4YA 4R4ZA 5F5CA 5IVJA 5L9BA 4MHRA 1JUHA 1NA1A 1UX7A 4GB33 4PBOA 2J22A 3J7NA 3USUA 2IZWA 4M3CA 4HG6B 4P9JA 1N1TA 4S2GA 1UQXA 2UWAA 3PUHA 1XYOA 4LKDA 4XW3A 5T55A 4LUMA 2W87A 5HXVA 4GWMA 1Z7S1 3CJIA 1ACCA 1UY2A 1DBNA 3D3AA 3OYWB 3HT1A 2XR4A 3K77A 2PQQA 4IV1C 3RGBA 5C3RA 2B45X 5FY5A 1AR92 4WM8A 3RMXA 1CAUA 4NO4A 4I01A 3VHPA 4AVBA 4C90A 4E8CA 3RMYA 4XCBA 2WFPA 3TEWA 1V6OA 3MIHA 1G6NA 4V2WA 4Z07A 3V56A 2E51A 5T52A 3POBA 2X5IB 3FZ3A 2EAAA 2QNKA 5FLHA 2PAEA 1L7RA 1TEIA 2ZX4A 2HWB2 2VO5A 5KR7A 2JG9C 5FAXA 3AMMA 3ACHA 3ZFFA 3ETPA 2A3XA 2VUDA 3DKQA 5CIRA 3AKPA 4L9BA 4ATEA 4PLOA 1QDOA 4N9HA 1V6NA 4AF9A 1I5PA 1NXD1 5BNOA 1U12A 5JPNB 2OA2A 1CD3G 3Q8FA 5T5PA 1O3TA 3FWEA 1W2TA 5KXEA 1OURA 2V72A 4YM0A 2FMYA 4LHNA 1QHDA 4YGBA 1J3RA 4GH4A 1AR83 3RG0A 5CFCC 5C6CA 2R063 3CZUA 4A7KA 1CN1A 2VW1A 3CEWA 1XNDA 1DQ0A 1W8UA 3G7DA 2AGSA 1BMV1 3M3EA 5CFDB 4AE2A 4PJYA 1MVEA 4UW4A 4Q1PA 3RPQA 2WR9A 2PN5A 4LBLA 2AR6A 1FX5A 2JG9A 2MHFA 1RHI1 1YFXA 3NQHA 2ZGQA 2VULA 1RUD1 4IEZA 3HQRA 4QHOA 3OGSA 3RVHA 3E6DA 4LBQA 1IOAA 3BVCA 3A23A 3ZN5A 1HRV2 1L7LA 1LGBA 2J1SA 1DFQA 1J3QA 4IXLA 1R1A3 1YJKA 2GMMA 2VZ1A 2E33A 3TB0A 3T30A 4AEDC 2XXZA 5CFCA 2G19A 5ABJA 2L9LA 5A1AA 2QQUA 3SHRA 3NNLA 5DAVA 1DYOA 3J8F2 5FY1A 2WNOA 3DXTA 4PCRA 4N7IA 3VBUA 1SDWA 1TNFA 4OFGA 4CEYA 5JXJA 2RS13 3FN9A 1QOTA 4MYEA 5F6KA 5A7PA 4OI2A 4A41A 2XHNA 2NM1A 5FJHA 2YMZA 5HV4A 2EIBA 3ZM8A 5KWRA 2BBVA 2VZSA 1TVGA 1TME2 2UY8A 4ZZ8A 4MGQA 4CDWB 3WR0A 4GWJA 3VN4A 4AAPA 1QIQA 4DY3A 1H6YA 4AWDA 4GJZA 4GKXA 4UT5A 2WFF3 5E6HA 2VE1A 4QAWA 1PGW1 1H1IA 2FD8A 5IVCA 2WQ4A 4UFHA 1POV1 3VBSB 2ERFA 2EVXA 4LBNA 5FYBA 3ZO0B 1X36A 1DQ6A 1JW6A 4MLOA 5JSPA 3ZKUA 5FZOA 2HWE3 5F2WA 3WUCA 1NLQA 1ZBE3 4LA3A 5FYTA 3ON7A 5IVYA 4LHKA 2OW4A 3S7IA 3ZYIB 2VMHA 3N7MA 4BK5A 4X6QB 2GALA 3KGLA 1HRI2 3MYXA 3SNMA 3PLQA 3PJQA 4WM7B 5F3GA 3U4SA 2HWC3 4XFGA 5CBLA 5IK8A 4RHV1 1DLCA 3VKMA 4OHZA 3VZKA 1JYWA 1XNBA 1M06G 3O1UA 4QPIB 2ZX3A 4E4ZA 1WKYA 1ND2A 3BCWA 3WF1A 3JCIA 2IXLA 1F5FA 3AP5A 5FOBB 3E6BA 3ZFEA 1VAKA 3QD6A 2BNOA 1ZZBA 1OFNA 1X33A 1NZIA 1Q56A 4QXHA 4DO0A 4HKWA 4LPLA 3S0MA 5FYHA 3GZTB 1TG7A 2O8QA 2ZMNA 3AP9A 4V1PA 4XFAA 5FZIA 3R4DB 4W6YA 3VBHC 3C7OA 2CAUA 5FBJA 1VJ2A 3FFQA 4PI0A 4YW5A 3WNXA 1QH6A 1O7FA 1DZQA 4IQPA 1H8TB 2MEV1 1HW5A 3D5OA 3WY6A 4MGIE 4J6GA 1NQDA 1TMF2 4FCAA 1CGPA 2W3JA 2VOTA 3HD8B 2VZVA 2Z4FA 5FQ0A 4CP9B 1F15A 2VQ0A 5SV5A 2RM21 1BZWA 5JMCA 2WIIB 3DPRC 4Y22B 4XVHA 4LTAA 3MI8A 1SPPA 5L9VA 1WMEA 2DVBA 4AGGA 3VZJA 2JXAA 3VBOC 1V00A 2YFUA 3PUQA 3QH6A 1VMJA 2XL9A 2V73A 2IXKA 5C9AB 3ETQA 3VBHA 5DN2A 4YPJA 4NHYA 2I2SA 1VBC3 2JICA 3NWKA 2E7QA 2GP3A 1XQNA 5H9RA 2DF7A 4IEPA 4OUEA 1W8NA 2VXJA 5L7OB 4LO4B 5CNAA 2BVVA 1YQ8A 3POWA 2B9UA 5FYUA 4XAAA 5FZ7A 3FLTA 2DCYA 2OZJA 2R16A 3ACFA 4CSWA 2R043 2YHJA 5HCHA 1B35C 1FYUA 1GQPA 1U5YA 4FPLA 4XUOA 3THCA 2D6OX 4XF3A 4ZU5A 3IM0A 1RUG1 5FIXA 3C8XA 2D7FA 1PZ7A 5A7WB 3AVRA 3N9NA 3VDBA 2J1UA 3GHNA 4Y33A 1S0IA 4UOJA 3ZOIA 1COV3 3O1RA 1MS3A 1GZTA 2IFRA 3OGJA 5DZFA 4IEWA 1MS1A 4XF1A 5DG1A 5FZ6A 5GLVA 3KF5A 2VVEA 3H8XA 3VUOA 5FZDA 5ISLA 1UMIA 3ZXLA 4QX2A 4IGOA 4NPRA 1OOPA 5FYZA 4KL1A 4QQOA 3WSOA 5D21A 3CBNA 1EV13 1C3HA 4BDVB 2R072 4BQ3A 1FMD1 3ZN6B 3AJYA 2BOJA 3UK9A 5D8AA 4INDA 5C3QA 1NG0A 3O5SA 5DUUA 2P34A 2RDRA 5FCCA 4CDQB 2P3IA 3ALQA 4NUBA 4OI4A 1QJX3 3UYJA 3H8RA 3RYRA 4HSLA 1IQDC 5IK5A 5A3OA 4QU1A 5FPLA 5IWFA 2AZ5A 4K3UA 5GKAC 2HYKA 2DVDA 5EJ3A 1HLCA 5F1RA 3WX5A 1SQ4A 5JIAA 5CU1A 2PLV1 5FK7A 4XQWA 3PUIA 2Y38A 3USUB 4OHVA 3D82A 3T2PA 4AI9A 1PM7A 4GD4A 3T08A 2RJKA 4P00B 1GP5A 2JE8A 2P5BA 3CJIB 3H1MA 3EYPA 4Q0QA 1QXPA 2IXCA 2ZGRA 4QWNA 4YGDA 3VDDC 3J7HA 1QU0A 1HQWA 2XJVA 3K2OA 4FFFA 2W47A 4XF4A 2WJSA 5HBAA 1Z0HA 5KHGA 4UFKA 2Q1MA 4RFT0 2F4LA 2HWB1 3BGAA 4FI9A 3LKJA 4R9BA 5FZ8A 3I8TA 5E1RA 1UU5A 4HONA 4AVAA 4Q27A 2WO7A 1VAMA 5CZKA 4EN0A 4FOQA 4LNVA 1NX9A 4G9SB 1PO22 4R9DA 5LB6A 3PU3A 1W8OA 2ZX2A 2UWCA 2XUMA 4AHWA 4E9KA 3VLBB 2VQUA 4PF1A 1LB2A 4NHKA 1JYNA 1VBA3 3VBFC 2DURA 4HSJA 4DINB 2A6ZA 1V6MA 1SFYA 4EROA 1PGL2 1W2UA 1YQCA 1CR7A 3LAGA 4IV1B 3HT2A 4WBBA 3EB7A 1V6LA 3BUCA 4HVQA 3HJRA 2WBKA 2D93A 2V09A 4CU9A 1SEFA 1XJAA 1WBLA 4YG6A 4RQPC 4JGZA 1XC6A 1GANA 3CLPA 2VZTA 1H6XA 1HJFA 2JG9B 2Y6GA 4D7YA 3Q8AA 2D3PA 5JOYA 1HRV1 4CXWA 1AL0G 1ULFA 3MIGA 5HXMA 3WP5A 2GNMA 1D2SA 2WWUA 2HYXA 3NJYA 1OLME 2VOKA 3VBFA 2XBO3 3S6PA 2R1BA 1LTEA 2RMU2 2ZGPA 1UKGA 3A21A 3POGA 4Q8KA 1W28A 3KD4A 4DIQA 3DEMA 1S55A 3NV3A 1RXFA 3J8F1 1GP4A 5J3UA 1CIYA 5CFCB 5FBZA 5KXCA 3MPPG 2CYFA 3ORJA 3UETA 4H7LA 1C8M2 3BYWA 1JOPA 3ZSKA 4F8AA 2GP5A 1HDKA 3NJZA 2G4IA 4JV4A 3FFZA 3U07A 3W5MA 2GH2A 3B5LB 1Q3EA 1AL23 4FVVA 1RITA 1BCXA 4BQ5A 3V64A 3T4VA 1W0OA 1TME1 4XHBA 3ZFGA 4BQ1A 2QBXA 5A3TA 4RGGA 1S0JA 3ZSMA 5K7PA 1ZZ6A 2G9FA 4I3PA 2D44A 3QACA 2R6QA 1PO11 1GZWA
chains in the Genus database with same CATH topology
1YO8A 2NZ9A 1VRH1 4P9YA 1ND3C 1O4TA 4KGGA 4IERA 3UKTA 4MV2A 1ZZCA 4XPVA 1RUC3 2IXHA 2K2SA 4CP2A 4ISRA 1SLIA 2CY6A 3ILNA 3I59B 1DYPA 5LEKA 2D6PA 1ASJ3 2A75A 1MZ6A 4Q4W3 5DDJ2 2UYAA 4IL7A 2NLRA 3JQXA 2B46X 4GMP0 3BPZA 1BVP1 2YXSA 4Q29A 1HRI1 4AXOA 1LENA 2P37A 2ZGSA 1SLBA 1ENSA 5EXOA 1KITA 4Z82A 2UURA 1J59A 4EJRA 2AREA 2OZ6A 4UBGA 3THPA 4YNIA 3E5XA 1B09A 1DQ5A 1ND3A 4KU7A 4Q26A 2RS32 1D4M1 4YZ4A 4Q4V2 4Q4X1 5FMOL 1CAXA 3SITA 2VXRA 2EF6A 1OPOA 3ZN4A 5A33B 2ZGNA 5DXDA 1H4GA 5BNNA 2DVFA 1VBE2 4XTPA 5T5LA 3PTYA 5T5OA 4YLZA 2ZBJA 2X8KA 4IEVA 4S2HA 2WS92 3NVCA 3OD4A 2IFWA 5BNPC 2FZ1A 4YZ3A 3N7JA 1AYM2 4KWJA 3SXWA 1MQTC 3V65A 1PHMA 5EV7A 2MPFA 1F2NA 2PYTA 1KDMA 1G8WA 1BEV2 2XKOA 4FOVA 3AFKA 3LA7A 4DY5A 4YZ5A 5GZGA 1JH5A 3MLLA 1D0HA 4K8FA 1D2QA 3D4KA 1OQEA 3VBHB 4JTNA 3IDBB 1PIV3 1S0DA 1BBT3 2C5DA 3UKVA 2EXKA 4F83A 4XETA 2PFWA 2XJUA 1MZEA 5A3LA 5CAZA 3OPZA 1PVC2 2Z5WA 5HCFA 1C5IA 1QMJA 2EAKA 1EAH2 4Y20B 3DPRB 2GC1A 5I91A 2JJ6A 4XYXA 3FLRA 2GNBA 5K9YA 1JYIA 3VBOB 3WG4A 2YY1A 2F4PA 3ZXKA 2LALA 2WL1A 4FTSA 1UZZA 2IXJA 3VHRA 1LOFA 4D3WA 3IPVB 4MXWB 3M3CA 4AVVA 1XYPA 2RS52 3KT4A 1FPN1 2WNUA 1CAVA 1R1ZA 2R071 3WDYA 5JSRA 3OBRA 4BYYA 3V0AA 1M4WA 4KWLA 1B35B 4LO5B 2DFBA 1W6PA 2ZHNA 3H7YA 1LHOA 5FTTC 2B8MA 3JBG1 4I0BA 1N3OA 3RI8A 5ACA2 3POSA 2RJLA 1EY2A 4LEJA 2WT0A 2IXIA 2C9AA 4I0WB 1NY72 3QH7A 4BIFA 4GB32 5LRSA 4OVEA 3AZWA 5IT6A 2ZGMA 2XLGA 1F9KA 5CG8A 2XHKA 1IS5A 4FQ4A 3M3QA 1HQLA 3LA3A 4LR4A 1LOAA 4IEUA 1SBEA 1AJKA 1ZBA1 1AJOA 4K7JA 1NE4A 3AFGA 4UW3A 4Q2FA 1AVBA 4RS5C 1PO21 4XIKA 1H8VA 4K21A 3VKFC 3FJSA 2VU9A 5J36A 1W6MA 3N7KA 4EN6B 4K40A 3B00A 4X6RB 5TSWA 4AI1A 2WKKA 3LZZA 2NMOA 2JENA 1N1SA 1QQP1 4QT6A 3WG3A 4CP1A 5FOJB 1Q8SA 1DIWA 5I0TA 2LTNA 4KU8A 2OIIA 1S2BA 1JTZX 3L2YA 4QQHA 3VDDB 1AR82 1AYN2 2R062 5C4WC 2DCTA 1AR71 5FO7B 2XB6C 4YZ1A 4RS5A 1O91A 3SCGA 1RHI3 1APNA 1WLWA 1CVNA 1HXS1 4Z92B 4K6BA 2ZACA 4C0BA 4E2GA 1ZRRA 2A70A 2RMU1 1HV1A 4CDUC 3CJXA 5HI0A 4XMAA 1R1A2 3VBFB 1R093 1RGSA 4OULA 4RR3A 2VOVA 1C8M1 2WINB 2NP0A 4M0HA 1ZRDA 4N43A 5FO8B 4OHWA 4UXAA 3DF0A 1NA1C 1KFUL 3O0XA 1NCQA 3AXDA 4KG8A 4E2QA 1G9DA 3UJQA 4RQPB 3VKLA 2RS12 3T1LA 1RUH1 3H7JA 4PIXA 1X8MA 4JGYC 3URFA 1WCSA 4WVMA 1Q8OA 2YZ4A 4WM8C 2WLPA 3NAPA 3ATGA 1CJDA 4AVTA 1K5MC 4DZGA 3AZVA 4F7ZA 4CDXA 2WFF2 1MR5A 2BW8A 3MFCA 5DDJ1 1KD7A 5FO9B 3JQWA 3ZFFC 1O3RA 4YFWA 1NOVA 2A6VA 4GMP1 4ONUA 3E5UA 4NHMA 1HV0A 1V9U3 2GN7A 4WZFA 1MS4A 5BNOC 1Y9QA 4IEQA 1ULGA 2HWE2 3B7MA 2ENRA 3JZVA 4JGYA 3RJ2X 1ZBE2 3AKQA 2A3WA 2ZGUA 5JIUA 1ENRA 3QLQA 2NPIA 4GH4C 4IV3A 3ZYGA 1K5MA 2BVBA 3M8LA 1KS4A 5JWPA 3VZOA 1OQ1A 2DV9A 2ARXA 3PVNA 4M3CF 1ND3B 4Q4V1 2QQPA 5L19A 2EXIA 3I4IA 5EYYA 2I07B 4E27A 4QU2A 1S0FA 3ZX7A 1ZRCA 4H7MA 3HBZA 1KDKA 1MS0A 1X7NA 4NR1A 3WV6A 2SLIA 5ABJC 1NYWA 3ZXDA 2ZKNA 5GLUA 2WS91 1FAYA 3D0JA 1AX0A 1UPSA 3M70A 1UW8A 3VBUC 3QOPA 2XJPA 2W39A 4CEYC 1AYM1 2BQPA 1RINA 4BCUA 2XLAA 3LSEA 5GZEA 4C91A 3RNSA 2RM23 1LKNA 5GZDA 2D6MA 1BEV1 1F31A 2VECA 1LU1A 1OD5A 1N3QA 2QUOA 1GNHA 2E6VA 5K0UA 3M3IA 3ZXFA 4XFBA 4AI3A 1U5XA 1DU3D 3L2HA 3NV4A 2YYOA 4LA2A 1T6GC 1VBC2 1XXNA 3PVBB 5JAXA 4EWAA 4AI0A 1PVC1 1NCRA 1UF2C 2VMIA 3RYKA 2DVGA 3ZPYA 4EN9B 1L3JA 1H1MA 2HWD3 4XILA 5BNPB 3J4UH 4A7ZA 5IK4A 4XFCA 2HWF1 2ATFA 2Y26A 3JU9A 2GDFA 4ES8A 2R042 4TZDA 1W6OB 5B2GB 2GNTA 1MQTB 2DUQA 1QGLA 4CEWA 5GLWA 1QY4A 1G7YA 1RMU2 3JUUA 1H2LA 2V5YA 4OUSA 3TN92 3CF6E 3WHTA 1DQ4A 1QJU1 2W08A 2A7AA 1IQAA 2RS51 1COV2 3R4UA 1ND2C 1UCXA 2WA4A 2ZCWA 3LWCA 1ONAA 4ES9A 1XNKA 1VBD1 2ZABA 3ZFEC 4QGMA 3GZUC 4IEYA 1QXJA 3BU7A 1FMD3 1GQHA 3OGGA 4HK8A 4ZXKA 4NWVA 4QPGA 1EV12 3NSTA 4AQSA 3H8UA 5DUVA 1UIJA 1W6QA 5ACA1 2VG9A 3O0WA 3ZXAC 2D98A 5AC91 2XVKA 1C57A 2OUHA 1HKDA 1DDLA 1NY71 4L2NA 4GB31 2FMDA 3NKTA 4DNYA 3AXEA 1IS4A 1O3SA 2PLV3 1ZNPA 3KGZA 1VBB1 4XF9A 3A0KA 4AFBA 4AVSA 5F9TA 3J26N 4TWTA 1OA2A 3B9IA 1HIXA 2D43A 1SBDA 4LE3A 2TUNA 4QX5A 5KC5A 1ENQA 2Y0IA 3U11A 1NLRA 4Y1XA 2VQAA 1OLQA 4AEJA 3JD71 3DL3A 1Y3TA 1LOBA 4XQ4A 1KRIA 2EXHA 4QMAA 3HAGA 3AKTA 3TAYA 4OHYA 3ENRA 1H9WA 4BH9A 1QOOA 2WNVA 2OVUA 3RYPA 5E16A 3NV2A 5DG2A 1RUI3 1S0GA 1QNYA 3LOIA 2ET1A 1ZX5A 2SBAA 1QH7A 2KM2A 1LU2A 3JB4C 1AYN1 3TRSB 3KZ4C 2R061 3FBMA 1QJY1 1Q43A 1XRUA 3NL1A 2QZ3A 1C1FA 3ROUA 3EO6A 1U5ZA 4HANA 4MVTA 2CL2A 1MS5A 4Z1VA 4RS5B 4X8NA 4FBFA 1V6JA 1DQ1A 1IKQA 1UAIA 1AX2A 2DU1A 3J9SA 3LGRA 1HRV3 1YCIA 1W6NA 3VHOA 1OOPC 5E89A 3UL2A 1OFSA 4EN7B 2YDEA 2X29A 3HR9A 1R081 5D8AC 1PNGA 2CAVA 2E63A 5F6LB 2XBO2 2B42B 1SCRA 3O14A 4I0AA 3AP7A 3MW2A 4Q0SA 2DCJA 3W59A 1F5JA 3WCRA 4DS0A 5C4WB 2E7AA 3PNAA 2QDRA 1WW5A 4U36A 2RS11 3FHIB 4QXKA 2WT2A 4COZA 5E8AA 2BWAA 1AL22 1GICA 2ZAAA 4Y26A 1JUIA 4RD7A 5C8CA 4XQDA 3WVJA 4D69A 4E4SA 1PO13 2JX9A 4FO9A 4CDUB 4Q1RA 4MXVA 1ZZ9A 3RSJA 3WW1A 2WFF1 1VRH3 5J7MA 4KG0A 4P9GA 2I45A 1CJPA 3ST7A 1YXWA 1RVF3 3NO8A 4HMZA 1RUC2 4XFIA 1DGLA 3M7AA 1ASJ2 2HWE1 4Q4W2 5FRAA 1NA1B 4BZ4A 4WV8A 1ZBE1 4M3CB 3LOBA 3GHMA 2GMEA 1AR91 2RE9A 2QVSB 1BXHA 4JGYB 1ENXA 1MACA 1ZM1A 3WP6A 2ZS6B 4P9WA 4WM8B 1CAUB 4Y1UA 1K5MB 4C0HA 1O5UA 1D4M3 4JGZC 3APBA 5HCAA 3POYA 3ZFFB 3ZMOA 1RJ7A 2MNGA 1PZ8A 2PA7A 4Q4X3 4PQ9A 4QPYA 2ZHKA 5BNOB 4KWKA 1VIWB 1GZ9A 1OHFA 2TBVA 1RTVA 4YVSA 5CG9A 5JOZA 3PVOA 5CVRA 4GH4B 2GC2A 3FE5A 4B7KA 4ORFA 2BFUL 3ZDSA 5GZFA 3HMYA 4N7UA 1LOGA 4OLLA 3THTA 1FOD3 4L11A 5BPXA 3JB8A 3BOPA 4FOWA 3TYJA 4HPKA 3ZFGC 1KQRA 1LRHA 4BHPA 2PTMA 2XVGA 3G6JB 4LBQB 1LOCA 1AR63 5CB7A 1RC6A 5H9PA 1OI6A 5EFUA 3WDVA 3VZLA 4XJ8A 5ABJB 3OY8A 1GSLA 3A4UA 1PIV2 4Q0UA 1XYNA 4PLNA 3D0SA 2CWSA 2PAKA 3WQ0A 3VBRA 3VBUB 2EXJA 3EBRA 3AB0A 4CEYB 4H3WA 4AFDA 3VL9A 1X8EA 5JR7B 5A32A 1RMU1 3VV1A 2D6NA 3TN91 4HKOA 4YSFA 4K1ZA 1G9CA 1EPZA 4YM1A 3E6CC 2VOXA 4TSVA 4AHXA 2D3RA 1FPN3 3BB6A 3WCSA 1C5HA 1I5ZA 2R073 5FMOS 5LK7B 1UPIA 3EQEA 2WZR2 3R6SA 1IKPA 2ZX0A 2XVLA 2ARBA 1CPNA 3AZZA 5BNNC 3GNEA 3JBG3 1S0BA 3OJBA 3B94A 4BPZA 1MEC2 4AI2A 2WC2A 3OBTA 1LULA 3ECQA 3PHMA 5AFBA 1G9AA 1ND2B 2NYYA 1H9PA 3H9AA 3OYWA 4LHLA 1RUF2 1WMDA 4KQ7A 2DU0A 4K9SA 3ZFEB 1H4HA 1XU1A 1CAWA 1RUJ3 3VZNA 3S30A 1C4RA 3O0VA 5IK7A 2ZX1A 3LSDA 1ZBA3 2YUEA 1SBFA 4NN0A 3ZSEA 2B5HA 1TMF1 1PO23 2YGMA 3TBDA 5JVVA 3AX4A 4KGQA 4FSJA 1WLDA 3MIEA 1I6XA 3RI9A 3H50A 1URXA 5FQ0B 4YW3A 3SMHA 1YJLA 2ZJCA 1QQP3 4XJ9A 1YIFA 2WNVB 1RUE2 2G9GA 4ITCA 3R4SA 2R0HA 3DV8A 4PDWC 5FPZA 4AEDC 1YI9A 5CFDA 2RR13 3ASIA 3WDTA 3ZIWA 1VLNA 3V0BA 1AR73 2O8OA 1LOFC 4JAAA 1IS3A 3O12A 1REFA 3WG2A 5KXDA 3RJRA 1HX6A 2EA7A 1HXS3 4GA9A 1RHI2 2WNUC 2VVFA 2JG8C 1CQ9A 5D1IA 2XJSA 4IETA 2XBO1 3U0ZA 2ZAHA 3SCHA 1CX4A 2K9ZA 2ZZQA 4Q8LA 4MGYE 4FP2A 4LO8A 4PDWA 4AEDA 1R092 1QF3A 4KH9A 2GC0A 4Y1YA 1EPWA 2H0BA 1AHSA 1IZ3A 1Z78A 3AZXA 1YRZA 5AFEA 2KXLA 1WD3A 2BUKA 1RUH3 5GALA 2IWGB 3T2TA 4XMIA 2JG8A 3GBGA 1SLCA 1Q8VA 1OOPB 4RL7A 5KXBA 1YWKA 1S0EA 2E9QA 4L8QA 1GV9A 3IKWA 4PLMA 2R32A 4Q4Y2 3UKNA 4A7YA 1FNZA 3VBSA 2A6XA 2R1DA 3C3VA 5D8AB 4LLFA 4B8EA 4DQAA 1V6IA 4FPKA 2I74A 1WMFA 1RUC1 3VGIA 4G3YC 3UJOA 4RSUA 1FT9A 4OI0A 3IWZA 4EWDA 4FTBA 4XJZA 4SLIA 5KBFA 1LCLA 1DGWA 2VVDA 1V9U2 5I8YA 3CO2A 1Z7S3 4AG4A 4LBJA 5JI9A 4WM7A 1LJ7A 2KA3A 4NVPA 4E4DX 2WZPP 2GH8A 4P14A 1A6CA 4B7EA 4M00A 3MLKA 4DFSA 2ZHLA 3KMHA 4BIOA 4R52A 5JZGC 5T54A 2GMPA 5FLIA 2E7TA 1IHMA 4CP0A 4LULA 3IDCB 1LGNA 1AXYA 4R9AA 3FX3A 2CGOA 2GN3A 2VNGA 5I0UA 2XJTA 4YM2A 1JYCA 4AHZA 1WBFA 4MZUA 1PGL1 1Y7BA 1YUDA 5JOXA 1A8MA 2DUPA 4FPHA 2CNAA 2C1FA 4Y1VA 3ILRA 1V70A 1H8TA 1XNCA 4FPOB 5GLTA 3MIBA 3RQ0A 4RR3C 2DUOA 2D40A 3WXPA 4P5HA 2ZMKA 2XJQA 3ZMNA 4HL0A 4DRVA 1G86A 4N43C 4Y5Z0 5JZGA 1WW4A 1DZRA 4XFFA 1OKQA 3H0OA 3P3NA 1NCQC 5KHHA 1RUD3 4S2DA 4JGZB 1FATA 3WP3A 2CGPA 4MX3A 4A3XA 5C9AA 1MVQA 3MIFA 2YC0A 3NAPC 4R8HA 5LK5A 1UKRA 3IIAA 3VHNA 4I09A 3RS6A 5L7OA 1RUOA 4CDXC 1DLLA 3AYCA 1TNRA 2HJIA 2WA3A 5LRRA 3TNQA 1PVC3 1JBCA 3O7OA 1QXRA 4LE4A 3RDIA 2QCSB 3WDXA 4COYA 1IPJA 2ILMA 3FC0A 4HVRA 2HWF3 2HWD2 2P17A 2VW2A 2GAUA 1WLTA 4XTMA 1GKBA 2YROA 4BWOA 1H1AA 2UY9A 4YRDA 3ZFGB 3AZYA 2DVAA 5HCBA 1VALA 4IV3C 1ALYA 1VB2A 4O9EA 1GZWB 2IC1A 1I9RA 1QJU3 3MW3A 2P3JA 3M3OA 1PVXA 1POV3 5L36A 4HZFA 1BVVA 5DZEA 2BTVC 1ZVFA 4IESA 5DZGA 5A3MA 1FNYA 1XU2A 4QM9A 1VBD3 1OA3A 2OUJA 2QFEA 2PHTA 4XE9A 3ZN6A 2WZR1 4HK9A 1WD4A 1RUNA 4WVZA 4ZU4A 4BA6A 2VY0A 1FMD2 4AQ2A 1REEA 4YARA 3A0NA 1MEC1 4KNCA 3AK0A 5AC93 4OUMA 4RHV3 2VUJA 3WQ7A 3MGUA 2RS31 3WP4A 4AW7A 2HWC2 3ES1A 3MF9A 3SH5A 2ZTNA 5J48A 4M0NA 2WWSA 3KM5A 3E97A 1UIKA 2W68A 3IT8A 1H2MA 2CWMA 1BK1A 4B4QA 4WVVA 1S1AA 4FAHA 3IN9A 1RUF1 2Z79A 1VBB3 1C28A 4AFCA 2PLV2 3MZHA 4Y1ZA 1WCDJ 5KHJA 1I3HA 2C0ZA 4A2UA 2R0FA 1CAXB 2WNEA 2NQYA 2ZZJA 1VBE1 4HVOA 5K0UC 2OYZA 4C1XA 1CAWB 3SCFA 3BIWE 3T1MA 2MEV3 1KS5A 1VR3A 1OSGA 4L92A 5BNNB 3JD73 3WW2A 2AH2A 1NCRC 5EZWA 3I2DA 2VNRA 1H2KA 3WHUA 5JDBA 1O5LA 1H2NA 4MGKE 2GNDA 1RUE1 3ZSJA 1W0PA 3ES4A 3SH3A 4H55A 2PHUA 2Q4SA 3IDEA 2P3KA 1XE8A 4IV1A 2Q8OA 4CEWC 2QKDA 4EN8B 1PZ9A 2VPVA 1RUI2 4R4XA 1AYN3 4COVA 2A6WA 2A6YA 1QJY3 4QQLA 3VKNA 4MGZE 2DTWA 5T50A 4TYSA 2E53A 3AP6A 4P9XA 3V0BB 1S0CA 4ISQA 4ZKTB 3K51A 4HLTA 4JQRA 4FXKB 3MEPA 3RZZA 5J96B 4WZCA 3N4MA 1U0AA 3OD0A 1J58A 1EAH1 4QM8A 1YIPA 1G9FA 5C33A 3TOJA 3MFAA 3M1HA 1RB8G 2CGNA 4QPGC 1R083 5FFOC 2XLFA 4K20A 1RUG3 1R091 1WA4A 5CADA 2B39A 3ME2A 1PK6C 5T5JA 3R05A 1YFUA 1O3QA 4AQTA 4PDWB 5AVAA 4HFSA 3VZMA 4AEDB 2XWJB 5FREA 3L9JT 5FPXA 3ACLA 2OPKA 2WNUB 3FUOA 2W52A 1CAVB 4AGRA 2JG8B 1YFYA 5H9QA 4Q4Y1 3RWNA 3WINE 2D6KA 3V0AB 2JD4A 4NWWA 1SLLA 1PO12 1W6PB 1PK6A 3B3QE 3I59A 1QJX2 1VRH2 4FQZA 1NE6A 1LR5A 4O9GA 4JCKA 4LUKA 4UW6A 4YVWC 3UV9A 1RVF2 1V9U1 2ET7A 1DYKA 3SLIA 3WG1A 2XJRA 3ILFA 4LBQD 2Z69A 2WNVC 4TLFA 1QWRA 2LUWA 1AR93 4C1WA 1UU4A 4M3CE 1GYKA 2XL7A 2DFCA 5JOWA 1X50A 4I3GA 4LT5A 3ZSLA 1E57A 2A71A 5BUVA 4GALA 1LGCA 2HWB3 3B02A 1D0GA 4P9LA 2B7YA 1AXKA 1A8DA 1AXZA 4HT1T 3ZYPA 4YVWA 1D4M2 2HEYF 3S7EA 1W6MB 3GBWA 4HETA 4FP3A 4YFZA 2D6LX 3DKWA 1AF9A 5A33A 1YYNA 4Q4X2 1Y43B 5DUWA 1QKQA 1YHFA 3FLPA 1VBA2 1AR81 3P3PA 2RHPA 4JRLA 5AVPA 3IBMA 1OLRA 4XBNA 1JN2P 3EHKA 4OZXA 5CA6A 4JRAA 3W9AA 4W65A 1W39A 1X82A 2VUAA 2XGXA 4BLIA 5JZGB 3AYEA 2BNNA 1FOD2 1J1LA 2VOWA 4I30A 3OTFA 5C8CC 1SFNA 2JE9A 3D6EA 1R1A1 4N9IA 4YGCA 4GKYA 1ULEA 1AR62 4LO7A 4AHYA 5LEJA 2PHXA 4JDMA 3J8F3 2UU8A 3ELNA 3RRDA 2GC3A 2XH6A 3M2MA 4RR3B 1WGPA 2YV8A 4COUA 3KCCA 1MZ5A 4FPGA 4MH0E 4AEMA 4N43B 1UZYA 2A3YA 1ZZ7A 2HWD1 2Y0OA 2N7GA 3ZXEA 1N3PA 3DPRA 2Q1ZB 4Y20A 1NCQB 2CV6A 3KCYA 1SMVA 1TME3 3N36A 5I8SA