1RUH3

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh300
5BNPC 1NA1A 4RHV1 1VBC1 1R081 3JBG3 5K0UA 1NY72 1OHFA 3ZFEA 3J8F3 3ZFFB 2BBVA 4RFT0 5A33A 1PGW2 1TMF2 1D4M2 4CDXA 1VRH3 2R042 5JZGC 1HX6A 4RR3A 1RUG2 1PGL2 2RM21 4QPIA 1QQP1 1ZBA2 1K5MA 4SBVA 4PDWB 3M8LA 5A32B 1VBD2 1FMD3 1MEC3 1RUF3 3VBOA 4RS5A 1HRI1 4IV1A 1FOD3 1RUC3 4YVWC 4CDWB 4FSJA 1PVC2 4FTSA 1BEV1 1EAH3 1B35A 2ZTNA 1ND3B 5J98B 5C8CA 1QJY3 1R083 3CJIC 1ZBE1 1COV3 4CDUA 1TME1 4Q4X1 3JBG2 4YVSA 2HWB3 5AC91 3J8F2 4CEYA 2VQ0A 4Q4W1 3VBHC 5BNPA 1F2NA 2FZ1A 2BFUL 1RUI2 1VRH2 3ZFGC 1FPN1 1RHI3 3NAPC 4EJRA 1QQP3 2WFF1 1AYN3 4Q4Y3 1R091 3VBUA 1AL21 4JGYC 2RR11 3DPRC 1HRI3 2FZ2A 1FMD2 5ABJC 1FOD2 1RUC2 4CDQB 5DDJ3 1NCRB 1EAH2 2RS11 1AR91 4GMP3 1RB8G 3IDEA 1BMV2 4YVWA 1ZBE3 4QPGA 1QJY2 2DF7A 4RHV2 5L7OA 1VBC2 1R082 4CEWC 1V9U3 5AC93 1NA1B 1COV2 4Q4W3 2GH8A 5K0UB 3ZFEB 2Y26A 2RMU3 3CJIA 4Y5Z0 5A33B 1VBE1 4CDXB 1R093 1AL23 1QQP2 4RS5C 3VBOC 1SMVA 1AYN2 1AL0G 4Q4Y2 2RR13 3VBHA 4QPIB 4AEDC 2WS91 1K5MB 1VB4A 1PIV3 3ZFGA 1HRI2 1B35C 3JB8A 1R1A3 5C8CC 2XPJA 5D8AB 2HWE1 1BEV2 4GH4C 3DPRA 1VB2A 1CJDA 1ASJ1 1Z7S3 2WZR1 2R061 5DDJ2 3VBSC 5ABJA 1ZBE2 5ACA1 2X5IB 4JGZC 1V9U2 5AC92 2HWC1 4Q4W2 4WM7C 1OOPB 4YVSB 1IHMA 3VBUC 1NCQC 2RMU2 1QJX1 4CEWA 1VBE3 2IZWA 1RUI3 5BNPB 1AR71 2HWD1 1R092 4Q4V3 1AL22 1RUD3 2RS33 5GKAC 2RR12 4IV3A 2BPA2 1VBB1 1PO11 4LLFA 1RUH1 3VBRA 1PIV2 5J96B 2MEV3 5JZGB 1PO21 5C4WC 1ND2A 1R1A2 2HWE3 4QPGC 4AEDA 2WLPA 5L7OC 1ASJ3 5CFDA 1QJU1 1Z7S2 5CFCA 5ACA3 1A6CA 3JD71 4RHV3 4GH4A 1VBC3 4YVWB 5FOJB 1F8VA 1RUE1 4BCUA 3VBSA 4NWWA 1AYM1 1E57A 2TBVA 1VBE2 4JGZA 1AR73 2HWD3 2RM23 4GB31 4N43A 4N53C 4WM7A 1AR61 4Q4V2 1RUD2 2RS32 1NCQA 1BBT1 2XBO1 3ZFFA 1NOVA 2MEV2 1H8TB 3ZFGB 3NAPB 1CD3G 1NY71 2ZZQA 2HWE2 3VBFC 1BEV3 1PGW1 1ASJ2 4JGYB 3DPRB 1AR81 4RQPC 3JD73 5C4WA 5ACA2 1HXS1 5ABJB 4WM8B 5A32A 1ZBA1 1TME3 4Q4X3 2HWF1 5BNOC 1AYM3 2WWSA 5C9AC 3LOBA 1M06G 4IV3C 1GFF2 4GB33 5BNNC 1FPN3 1OPOA 1AR72 2HWD2 1EV11 2RM22 2WFF3 1HRV1 3VBRC 1ND3A 4RR3B 1ND2C 3VDDC 3ZXAC 2XBO3 5CFDC 1PO22 2R071 2GSYA 4N53A 1HQNA 5CFCC 1RMU1 5LK7B 3JBG1 3VBOB 4RS5B 1C8M1 4IV1B 1WCDJ 1C8NA 1AR83 2RS13 1AR93 1MQTC 3JB4C 1VBA1 1VRH1 3JD72 1B35B 1POV0 3VBFA 5D8AC 2HWF3 5C8CB 3HAGA 1TME2 4Q4X2 4RQPA 1AYM2 4N43C 3TN91 4CDUB 4CDQA 3VBSB 1MEC1 1RUF1 4CEYB 1RUC1 4Y4YA 1EV13 1HRV3 4GB32 1NCRA 1FPN2 5BNOA 4JGZB 2WFF2 4FTBA 3ZFFC 5C9AA 1OOPC 1W39A 1EAH1 4WM7B 2WS93 2ZAHA 5BNNA 2R073 3VBUB 1NCQB 2XBO2 1QJY1 1RMU3 5FMOS 1RVF1 1C8M3 1COV1 1X33A 4GMP0 3VDDA 4Z92B 1POV1 2HWB1 4PDWC 2WZR3 2R063 1AR82 1VBA3 2RS12 1AR92 1HXS2 5C4WB 1RHI1 4CDWC 1AYN1 4Q4Y1 2HWF2 4QPGB 2HWC3 2RS51 1MQTA 5L7OB 3TN93 4NWVA 5FMOL 4FTEA 1ND3C 1QJX3 5D8AA 2PLV1 1EV12 1HRV2 2BFUS 3CJIB 5DDJ1 1VBB3 1PO13 4GMP1 2X5IA 2WS92 1RUJ1 1RUH3 3VBHB 2R072 1RVF3 1PO23 1RMU2 1OOPA 1POV3 1V9U1 1C8M2 3FBMA 4N53B 2BUKA 1QJU3 1TMF1 2RMU1 2WZR2 1D4M1 1VBA2 2R062 1H8TC 2R041 4CDQC 1RUG1 1PGL1 4PDWA 2RS53 1RUE3 3VBFB 1NG0A 2HWC2 5JZGA 1NCRC 3TN92 1MEC2 1RUF2 2PLV3 1PIV1 1VBD1 4RQPB 1QJZA 4CDWA 1QJX2 1R1A1 4WM8C 1NA1C 1PVC1 4CEWB 1AR63 1DDLA 5K0UC 5BNOB 1VAKA 3ZFEC 1BBT3 1RUJ3 1Z7S1 5C9AB 1VBB2 1PO12 3S6PA 1RUH2 4IV3B 2QQPA 5BNNB 1RVF2 4CDXC 4RR3C 3VBRB 2HWB2 4QPIC 1ND2B 1X36A 3J8F1 1TMF3 3VDDB 1D4M3 1K5MC 1QJU2 2R043 4AEDB 1RUG3 5CFDB 1HXS3 1RHI2 1RUI1 4IV1C 5CFCB 1ZBA3 4Q4V1 2RS52 1RUD1 1RUE2 2RS31 4GH4B 1H8TA 1VBD3 1MQTB 3NAPA 2PLV2 2MEV1 1FMD1 1FOD1 1PVC3 2X5IC 4JGYA 4CDUC 1AR62 4YVSC 4N43B 1BBT2 4CEYC 1RUJ2 4WM8A 1AUYA 1BMV1
chains in the Genus database with same CATH superfamily
5FK8A 3RMYA 1PZ9A 1FNYA 5A3PA 2UWAA 3OGJA 5A7WA 5H9SA 1KRIA 3NNMA 3X29B 5FDBA 1VBC1 2W0XA 5JUVA 1EP0A 4NIGA 4LO7A 2J1EA 3JBG3 3QH7A 1NY72 4BWOA 2R1BA 2CSGA 4LPLA 4LIVA 4UOJA 1ZYBA 3KV5A 4RFT0 1GMMA 2XHKA 5A33A 3SLIA 3M7AA 1N3OA 1UO9A 2GAUA 4LT5A 2YBKA 1C5IA 2I2SA 4CDXA 3BUCA 3I59A 4QHZA 3VV1A 2P3YA 2A71A 4QPIA 1WW6A 2C1FA 2VQTA 1WZXA 1W6MB 1YWKA 5FP3A 1K5MA 2W47A 2FBEA 2W68A 1G9AA 3NO8A 4P9IA 1MZ6A 1EUTA 2JE9A 2PHFA 1T6BX 2V73A 4NO4A 3VBOA 3P3NA 1FOD3 1N1YA 3WY6A 1JBCA 1UY0A 1BKZA 3RJ2X 3DL3A 4CXWA 2W92A 3Q8FA 2ZGUA 1REFA 3H42B 1PGSA 3VL8A 1EAH3 1H0BA 4UW6A 5FBJA 2VTXA 4WVVA 3S30A 1W06A 3Q8EA 1O3TA 1W8OA 1JUIA 1ND3B 4ZY9A 2R32A 4PF5A 4BIFA 2CAUA 5EYYA 4IEWA 1GUIA 2W94A 2CTVA 1CIWA 3SITA 3N9QA 1ULCA 2VVDA 3OB8A 5F7UA 4ZKTB 3IB3A 3MW2A 3ST7A 5CB7A 3JBG2 4BHPA 3HNMA 2IFRA 1W8WA 1O4YA 1NZIA 2BU9A 3THTA 3I4IA 3M1HA 3AVSA 4HETA 1F2NA 4I01A 4QKFA 4LUKA 1RUI2 1N1TA 2HEWF 2A3WA 4HKWA 4Y3OA 4FOQA 1DIWA 5F9TA 3L2HA 4FPYA 2R16A 5FYMA 2Q0AA 2W46A 1R091 4P5HA 4Q4Y3 3WCRA 3N9OA 4NRMA 3T0BA 4CRQA 1CAWB 3WV6A 1ULPA 2VR4A 3HNBM 1XBFA 4CCOA 2PHLA 4AE2A 5EZWA 1FAYA 1MS9A 1F5JA 1JW6A 1SDDB 4UFHA 5FRAA 2C6SA 1FOD2 3WDYA 4BA6A 3RZJA 3BOPA 5FV3A 3NRUA 4OVEA 1VPHA 5G04L 5CKNA 3R4UA 4AQ6A 5KXEA 1BYHA 4U2AA 1RIRA 3IAQA 2C9KA 3AZVA 2O8QA 5A3OA 1EAH2 3ZXGA 2RS11 1RB8G 5DAPA 5EIYB 1WW7A 2DFBA 3M3EA 4YVWA 4MLOA 5HCAA 4H7LA 3RGBA 2WDBA 5L7OA 3H3ZA 4FFGA 4TXWA 3U75A 4E8CA 5AC93 5A7WB 3U4SA 4CCCA 3MIGA 4DY3A 2GH8A 3AZXA 4IGQA 3DYOA 5FZMA 4AI3A 3AYDA 3O1SA 1OURA 2BERA 3WNOA 4BISA 4BQYA 5A33B 2VOVA 3LE0A 3WVJA 1FATA 4XIKA 2XVLA 3N3HA 3WG4A 3OPTA 4KL1A 1LU1A 3CU7A 4CDXB 5FKBA 2DVDA 3OBRA 1G8WA 4I30A 3I59B 4Y5TA 3VBOC 1W8UA 4AI0A 4CPBA 1SMVA 2BNMA 1JYTA 4Q4Y2 2RR13 4A2UA 4GQ7A 4QPIB 4XAEA 5IFPA 4COVA 1PX3A 2YY1A 2WS91 1K5MB 1LEMA 2VMGA 4O9GA 3ZFGA 2YYOA 5CBLA 1LGCA 1R1A3 2JG9B 4BIOA 3SKJE 2ZKLA 2IFWA 4GD4A 2UYBA 4XJZA 4E9KA 3DPRA 5JOZA 1W8NA 5IVBA 5IK7A 4FXGB 3ZDSA 4DUWA 2WZR1 5FY8A 1Z7S3 1IG3A 2VL4A 1G9CA 3VBSC 5BV6A 2P3JA 4UBGA 1HV0A 2SLIA 5ABJA 2VCCA 3RZMA 2J1VA 4QB6A 4CA9A 3A23A 4I02A 1BZWA 2JIJA 2F17A 2H6CA 1RGSA 3CZJA 2X5IB 2QZ3A 4OLLA 4JGZC 3WW4A 5JXHA 4O7XA 5IVJA 5AC92 3TEZA 3THDA 4Y4RA 1XNCA 5LBEA 3DUIA 4CE8A 4I3GA 3LPGA 3NW4A 3NJZA 1QXJA 3LKJA 1OOPB 4LA3A 4P9WA 4WM7C 2FDKA 5IWFA 2B7YA 1NCQC 4MXWA 4LLOA 3KSCA 3CLPA 2XJTA 3LSDA 3VKMA 3VL9A 1W6QA 3WF1A 4AFMA 2XH6A 3T4HB 4YW2A 2JIGA 1NT0A 5BNQA 4DO0A 2VH9A 1F31A 4J25A 1I3HA 2BRTA 3KVAA 4EYUA 4QX2A 1JHJA 2JDMA 4LA2A 4M00A 3ZMNA 2RR12 3H7JA 1H4HA 3T2OA 2VZRA 1PO11 2WLQA 5J7MA 4FOYA 4LBLA 1UZ0A 2MEV3 4BQ3A 2QQKA 1XYPA 3PUQA 5JZGB 2DBIA 1A8DA 1ND2A 1Q8PA 1R1A2 2HWE3 2ERFA 1MS0A 1GZWB 2VZTA 4AEKA 1LHNA 3PNAA 1S0JA 1H4GA 4A45A 5L7OC 2QNKA 4KU8A 1CZTA 4OHYA 1QOTA 3ACGA 5E8AA 3ZXDA 4CU7A 1FYUA 4UAPA 5FZ0A 1Z7S2 2ARAA 3P5BA 4U36A 3B5LB 1LOCA 1JN2P 5FZ8A 4C8DA 4YVWB 1VBC3 4LBOA 1D0GA 3POFA 1US3A 1YFYA 5FOJB 1F8VA 1VJ2A 4QQOA 1NLSA 3FHIB 4L8QA 5KC6A 2AREA 1XYOA 3O0WA 3KV4A 4X6QB 3UL2A 1GICA 1YCIA 3FL7A 1NZCA 4NWWA 4C1WA 1GANA 1W2AX 2PN5A 3AFGA 1O6UA 2JG8C 3MICA 2TBVA 2Y64A 3C3VA 2HH9A 1K45A 1UY4A 2HWD3 3UESA 1UMIA 3NNFA 3DECA 4GB31 4IEYA 4Y5SA 2VTXJ 2WNUA 3U07A 2VOWA 1YLLA 1CX4A 1MPXA 3WD5A 2VTFA 1BBT1 3RVHA 4JVAA 1EY2A 5CIRA 4AVSA 4K8RB 1ULDA 5IVVA 1O7FA 4FXKB 4MH0E 4E2GA 4LE4A 3RRDA 2MEV2 3WDWA 4D7SA 3ZFGB 4PIZA 3FE5A 2HWE2 4BJ0A 3VBFC 1G6NA 2J42A 1RL3A 1YI9A 1I1EA 1GOFA 1PGW1 4JGYB 3TNQA 3I2KA 3DPRB 2OVUA 3R4SA 4E4DX 4CVUA 2YGMA 2VZQA 1T2XA 1L3JA 4XW3A 2TUNA 1BCXA 3NV2A 1WLTA 4CP1A 5ABJB 2YROA 4HPKB 4WM8B 5A32A 4RGGA 4KWUA 3DKWA 4Y33A 2VZOA 3ZN5A 1J3PA 3B94A 3JZVA 3ZYJB 2YFZA 5GLVA 2I07B 5FXXA 1ZZ9A 2FDIA 4Y20A 2P3KA 4Q5OA 2ZOEB 1GFF2 3LA3A 2PYTA 2TEPA 2WA3A 3H9AA 1OPOA 4MXWB 5FIXA 4C0HA 2HWD2 1EV11 1W6QB 4JTOA 3WP5A 1H30A 1KITA 4D3WA 3NL1A 4DINB 4RR3B 3N9NA 3GGLA 1ND2C 1FV2A 4AXOA 2HKXA 2ZKNA 3WDXA 2E6VA 3EHKA 2XBO3 1WD4A 2JKXA 1HB2A 2BGCA 3EMRA 2R071 1UZVA 4OFGA 5GZGA 3QACA 2GSYA 1HLCA 1OLMA 4XDQA 1RMU1 1V6MA 5EV7A 1C8M1 4NIHA 3PURA 2XJQA 4LNVA 4MOAA 2BVVA 2RS13 1K3IA 1CZSA 2NM1A 2PAMA 3EBRA 4QGMA 4IGOA 1VBA1 5FZKA 1LOEA 2RJ2A 1H8VA 1B35B 3H8UA 4DXZA 3KV9A 2IUWA 4FPOB 1FI2A 1UXZA 5FUIA 2RG4A 1AXKA 3HAGA 4PF1A 5CU1A 4ZS2A 4Q8KA 5JDBA 3N9PA 3CKHA 4ATEA 5KHKA 2QQLA 2QJVA 5LW9A 1MZFA 2WNUC 4CDQA 3OG2A 4CDUB 5FLJA 1GOGA 3VKFC 4KWKA 2IVIB 1LOAA 4CEYB 3O1MA 2J7MA 4Y4YA 2DVBA 1HRV3 1UQXA 2VG9A 1DZRA 2WT1A 1NCRA 1W2TA 4PIYA 3AKSA 4LO6B 2WNOA 3WEZA 5BNOA 1GNYA 3NJXA 1IQAA 2JE7A 3ZMOA 4JDMA 1GQGA 3ZN6A 1QDOA 4UFJA 1W8HA 2FMYA 3MLJA 1F15A 5A7OA 3WINE 3S5QA 2WS93 5FOBB 1OMIA 3KD4A 3N7MA 3OSDA 3ACLA 3VBUB 4CUAA 1UU6A 2XBO2 3MF6A 1QJY1 2D6KA 3SISA 2BGPA 1KJRA 4Q8LA 1G7YA 3FMGA 5FMOS 4H55A 3T1MA 3ZM8A 2ARXA 2EVXA 2F6BA 2SBAA 1X33A 4BB3A 4Z92B 2HWB1 1W9WA 3E97A 5GLZA 2WYFA 1HQWA 3PIJA 2WZR3 4XFHA 5FZIA 1LGBA 1ULOA 2RS12 1QGLA 4HBNA 1OT5A 2P4EA 1SACA 2XL9A 5DG2A 5IYYA 2A7AA 4BMBA 1Q8OA 1HXS2 3H8RA 4HFSA 3B02A 5TSWA 4QGLA 1QU0A 4CDWC 1W90A 3HD8B 4FAGA 4YG6A 4QD2A 4CP9A 2WWUA 3LEKA 5CZKA 2QCSB 3THCA 3TAYA 3TN93 4F7ZA 1CN1A 3E6CC 5FO7B 4TZDA 5L9BA 5K4LA 4DXTA 3ZPYA 3JUUA 4YZ4A 1MR5A 3V64A 2VNVA 1GWMA 4DRVA 5J37A 3ZIWA 1HRV2 5CG8A 2D6OX 3CJIB 3WQ0A 5EWSA 1SFYA 2FDHA 2EALA 4ORFA 2CDOA 2IXCA 1UN1A 3RMXA 1FT9A 1H9WA 4QU1A 3RZZA 1PO13 4K9SA 3E1F1 1GBGA 2WS92 1RUJ1 3VBHB 1CAVA 3LEGA 2VVEA 4G3YC 1RVF3 4AOCA 1XOYA 3B01A 1ZZ8A 3HWJA 5IW0A 5FKCA 3RZGA 2A6XA 4OULA 1NAEA 4S2HA 4XF9A 2P37A 4FPCA 3V0AB 5ISLA 1ZRIA 1W05A 2VBDA 4ITCA 3WSOA 1KEXA 1Z0HA 2WZR2 2RMU1 2G1MA 4H14A 4Y26A 1TNRA 3F95A 3KT4A 4NPLA 3ZKYA 2EAKA 3I2JA 4JHTA 1HN0A 4NIAA 1W9FA 5FYTA 3PJYA 3N36A 4CDQC 4LULA 4EWAA 3OOXA 4XABA 1QXPA 1OKOA 4KNCA 4TYSA 5A1AA 2W87A 5J1XA 1Y43B 1NG0A 4UF0B 4OZXA 4YW5A 2K2SA 4B1MA 4Z07A 1NCRC 4XE9A 3TN92 5A80A 1X7NA 1RUF2 2PLV3 1PIV1 1GWKA 1QJZA 3NKGA 4J1WA 1VR3A 2ZGTA 4OZOA 4HLTA 2HEVF 4YNIA 4LORA 4CEWB 1JMUB 1R64A 4LE3A 4QXHA 5LA9A 1DDLA 2ZHKA 4CCEA 1VAKA 4DS0A 5BNOB 3S0MA 1BBT3 5KHHA 1PO12 2VZPA 3NJVA 2AGSA 3WF3A 3B9IA 1GNHA 1SPPB 3K4AA 4LKEA 2BOJA 1RVF2 3HT2A 4D6RA 1NQJA 4HONA 2WQZC 4DEQA 5GZDA 1RINA 3R4DB 4AFCA 2CGNA 3AB0A 1OD5A 4CUBA 2LS6A 3K3OA 1X36A 5T54A 1TMF3 2ZMNA 3ASIA 4AGRA 1D4M3 4Y22A 2R043 3RNSA 1ZRDA 1PM4A 1RUG3 1JUHA 4NAMA 2HJIA 4M3CE 1RUI1 1S0GA 1W6NA 5LBBA 5C6CA 3L2YA 5J3UA 1W0PA 4LBQB 5FMBA 2Q1FA 4AK3A 2GC2A 2Y38A 4OYUA 2DCZA 1H8TA 1GLHA 5JWPA 1XPWA 1UCXA 2GP3A 2XHNA 2ZX4A 2PLV2 3ZVXA 3OBTA 2WT0A 3N7KA 5I0DA 1FOD1 3J7NA 3M3IA 3HNYM 4QX0A 3PVEA 3KGLA 2WZPP 3FLTA 5FYBA 4MO3M 3H0OA 1LU2A 4YVSC 5DUWA 3PHMA 1BBT2 3DEMA 5F1RA 4N90A 5FYVA 3GF6A 5LEJA 3LZZA 1H1MA 3H1MA 4UWDA 3MIHA 5K0UA 1YEWA 3ZFEA 2JDAA 3J8F3 3ZFFB 5H9RA 5FXWA 3VD9A 2OS2A 2BBVA 2ZGSA 4CCMA 1PGW2 1TMF2 2B39A 1D4M2 2P1BA 3IBMA 3BTXA 4BQWA 4XC9A 4MGSA 4Z2WA 2R042 4YW6A 1HX6A 4AWDA 4QT6A 1RUG2 2FHRA 5FY0A 2ORXA 2Y6HA 3JCIA 4Y1VA 4ASKA 4Y1UA 4BYYA 5KR7A 4KGQA 5FLIA 2B5HA 2NPIA 4NROA 1LRHA 3K48A 4IETA 2V5YA 1LULA 3CHXA 2QKDA 2X53S 3WP6A 3IDCB 5C3RA 1BVVA 1FMD3 1QHDA 5FYYA 2FMDA 3VB9A 1MS4A 4RS5A 4IV1A 1Q8VA 3VN4A 4QHOA 5C33A 3QH6A 1VP6A 4R9DA 3MHZA 2B42B 1AJKA 4ES8A 2WQ4A 1ZZCA 3ACHA 4GWJA 4R8HA 1QKQA 3D8CA 5F39A 2XXZA 4YFWA 5KHIA 2YC4A 3ATGA 3POJA 1QJY3 3OEBA 4ZU4A 5E88A 1PMHX 2BVBA 3HN3A 4A7YA 4FAHA 4Q4X1 4C90A 5C8WA 2K46A 3RPQA 2HWB3 4HKLA 5AC91 2J1SA 2JDNA 3J8F2 3I3EA 3P3PA 3ZLIA 1LHUA 2W1UA 4QDRA 4XF4A 3FHAA 4GXLA 1KS5A 4IE0A 3RZKA 4UBHA 2J1AA 3RZHA 3PMEA 1I9RA 3OJBA 1ZREA 5APAA 3QOPA 3EYPA 5DG1A 4YG3A 5FLHA 4EJRA 4K6BA 1QQP3 2WFF1 4ZZ8A 2DTYA 4NHMA 4BH9A 3H8XA 1W6NB 1M4WA 1D0HA 3RS6A 4DOUA 2RR11 1Q5OA 3W21A 3DCQA 4DUVA 4MVTA 1KXGA 1X8MA 2XB6C 2ZAAA 2CL2A 3MIBA 1FMD2 1VAMA 4OUSA 4FPJA 1WA6X 5FZOA 2WR9A 4OCTA 4PIXA 2VPVA 1BQPA 4Q2FA 3RYPA 3VHPA 2Q8OA 1C28A 3POSA 4TTGA 2IXHA 5A3TA 1JYNA 3H3LA 4C91A 1W3VA 2EAAA 1CPMA 2VZSA 2DBNA 1UWWA 1CESA 2O8OA 2IVJA 3AXEA 1YFWA 3KHBA 2XUMA 5T52A 4UFKA 1APNA 4MHRA 3ALQA 5JXGA 5FPZA 3IDEA 2ZGOA 4S2GA 1ZBE3 4QPGA 2QTWB 1QJY2 4RHV2 1YQ5A 2YZ4A 1S0CA 3PDQA 4P08A 1ENQA 1HB4A 1W9TA 3ZXLA 1WW4A 1CWPA 1C57A 5DAVA 4Q4W3 1OH3A 2N7GA 4OQ9A 5A6YA 5I0RA 5GLWA 3H3UA 3ZFEB 5K0UB 3HT1A 3PVOA 3DKQA 2LW8A 3B69A 2WNVB 1EPWA 1XSQA 3GZTB 4ASMB 2RMU3 3ABZA 5JXIA 5C3SA 4Z8BA 3WNPA 2VMFA 1K42A 4W6XA 3HQUA 3ZPOA 4YM0A 5B2GB 4CCLA 4EN7B 2WO1A 2XJRA 1LOGA 1QQP2 2VW1A 4RS5C 5LWBA 4Z82A 1AL0G 3ZOIA 3BPSA 3G6JB 4LO8A 1VE0A 2A5ZA 1WCSA 4AEDC 1C5HA 2QQNA 4P02B 1PIV3 1C3HA 2G9GA 1DQ0A 1TE1B 4L97A 2Y6LA 3K51A 3WCSA 1XSRA 4JRLA 5T5PA 4QB1A 5D8AB 2XUEA 2IC1A 2HWE1 2WT2A 4GH4C 5AVAA 5GLUA 4ZXEA 2VQUA 2ZCWA 4YM1A 3SCHA 2EIGA 4GKYA 4I2OA 1UZYA 1IGOA 4JAAA 1CJDA 4TLFA 5FY4A 5FZ7A 1QNYA 2JB8A 1REEA 3HR9A 4DPNA 1BK1A 1ZBE2 2DCYA 1S2BA 4DRRA 3S5AA 1LECA 1SFPA 2X10A 1J83A 1QOSA 2E63A 4WVMB 4QQLA 1OLRA 4K21A 3IWZA 2HWC1 2BEOA 4YW7A 4Q4W2 1VMHA 2ZGNA 1W8FA 2WUHA 1DYOA 4HOOA 4XOGA 2RMU2 2XQRA 2ARCA 4AHWA 1VBE3 1Y9MA 1U5XA 2PAKA 4Y1ZA 5FYHA 3UKNA 1RUI3 2JECA 2HWD1 2PHTA 2P34A 3ME2A 2WN2A 3S7EA 5T5JA 4FBFA 1I6XA 4IV3A 3ACIA 3NNLA 4V1PA 5F2SA 2BPA2 2C5DA 3URFA 4AVTA 4LLFA 1ZM1A 4LIUA 2ZHMA 1RUH1 1CVNA 4QDQA 1PIV2 5DPNA 5BUVA 1WCKA 1WUVA 2VD7A 2AEYA 1J3QA 3BVCA 2H6BA 3H1YA 2C4XA 3CQOA 4G9SB 5FZOB 1QF3A 4QPGC 3T4VA 2LM3A 2ID4A 4LUMA 1G9DA 5GALA 1QJU1 5T50A 3AC0A 3AYCA 4BMEA 2PHXA 4AQTA 5CFCA 4AGVA 5ACA3 2VBPA 3ZIXA 1A6CA 3K2OA 3OD0A 4YFZA 2W39A 2ZZJA 1J1LA 5C70A 5F6LB 1RUE1 2ETEA 2EXHA 2R0HA 3MLLA 3N7JA 5GM0A 3VBSA 3HEIA 2OXBA 4ISQA 2OYZA 1E57A 3MYXA 1WD3A 1O3SA 4FPEA 4KWLA 5DZFA 5G05L 5ERLA 1AVBA 3BYWA 4IXLA 4NJ4A 5A6ZA 3K4ZA 3B9CA 1VBE2 2W95A 4JGZA 5J48A 4XVHA 2VULA 5EPAA 4E4HA 2D40A 4KQ7A 2Q1ZB 4N43A 1IKPA 1RJ8A 4D8MA 4EN6B 5CEHA 5KBFA 4KG0A 2LTNA 2NQYA 4N53C 1ULGA 4WM7A 1AX2A 4Y24A 1PX4A 2DUQA 5JOXA 1NCQA 2CY6A 3B3QE 4FPLA 2AZ5A 1QDCA 2VMDA 2WFPA 5A3WA 3JQWA 4R4XA 1U0AA 3FFZA 3AL5A 1WLDA 2XBO1 1XU2A 2YC0A 3LCPA 3MEPA 2WAOA 5A7QA 3IAPA 2ZGKA 4M01A 3ZR6A 1UZZA 4DB5A 1WLWA 5CISA 1F35A 2YPJA 4XTMA 1W9YA 3PUSA 3A22A 4NVPA 3H1WA 1OPMA 3O14A 4KWJA 1LB2A 4XXPA 4RQPC 3JD73 2O1QA 4XQDA 2QQVA 3A0KA 2GMPA 4W6YA 5ACA2 1HXS1 1WCQA 3WLUA 5JSOA 5I91A 2ILMA 1XE0A 4HXCA 4Q4X3 4LK7A 4IEXA 5CNAA 3SCGA 4B7EA 5FJKA 1AX0A 3WG1A 4LEJA 1LOBA 4OI4A 2G9FA 3S7IA 4LBKA 5A6XA 3UK9A 1YFUA 3LOBA 3UGHA 3POGA 3LFIA 5JPMB 2X8KA 1LHWA 1MACA 1RJ7A 4IV3C 2RDRA 4Y1YA 2D3SA 2KXLA 3QBQA 2DCTA 3KGZA 2WFF3 4MZUA 1HRV1 2A73B 3JXSA 3ZSLA 3D4KA 2YC2A 4CSWA 4IE5A 3VDDC 2D3RA 4XMIA 5AVPA 2JG8A 2E33A 3TEWA 1LENA 4CP0A 2E31A 4GKXA 2PHUA 3AYEA 1N3QA 2A70A 2E53A 4XUOA 1S2KA 1HQNA 5CFCC 1OQ1A 4I0AA 3VBOB 3IMMA 5DAWA 1AR83 1MQTC 1XXNA 2Y60A 2ZHLA 4XACA 2JEMA 2B8MA 3JD72 3AP9A 4COYA 2ZMLA 5E1RA 3DGTA 1V6IA 2XLFA 5JI7A 3VBFA 3WR0A 5FYUA 5H9PA 2XVKA 2WBKA 2DVAA 2HWF3 2V09A 3ENRA 3MZHA 3BI3A 4Q4X2 1PNGA 4QXCA 5FZCA 1QIQA 2QQIA 4RSUA 5B4XA 2W52A 1DP0A 4N43C 2Q8CA 3TN91 3M4FA 4Q0VA 5HV4A 1E5SA 4AAPA 3VBSB 1RUF1 3M70A 1D2SA 5FPLA 4AVBA 1PVXA 3WNNA 2WSUA 2B4KA 1JH5A 3HQRA 2YMZA 1KGYA 5K7PA 2XKPA 2AUYA 4JGZB 2WFF2 3WNXA 5FY5A 3D82A 3Q9OA 4AHXA 1OOPC 3BTAA 3MW3A 4EN0A 1SDWA 4WM7B 2IXKA 4IEOA 5EJ3A 5IVYA 2YFUA 1E5IA 1NCQB 5CKMA 5T3NA 4I0BA 1AHSA 4AI1A 1W04A 3OUHA 5IAXA 1RVF1 3NV4A 5HI0A 2AH2A 2XWBB 3UGFA 5FO8B 2A3XA 2CDPA 2R7EB 5HBAA 4IUGA 5LBFA 3PUHA 1ALYA 4PDWC 4LOTA 3AP7A 3ON7A 5EFUA 5CKQA 1AR82 2W1QA 4M0HA 1H6YA 5DUUA 4AYUA 5C5TA 3B00A 2IXJA 3LD8A 4PQ9A 4YW3A 3LIHA 2VMIA 1WBLA 4IDZA 4JKKA 4A44A 3HJRA 4B4QA 3C7GA 1AYN1 3V56A 2UY9A 2HWF2 2HWC3 5FY1A 1X8EA 5L7OB 1YC61 2QUOA 2QVSB 4LQRA 3H8OA 2VQAA 1S0FA 1PMIA 4FPFA 1LHVA 2BTVC 3KF3A 1W6OA 3CJXA 4OI2A 2VMEA 2PLV1 5F3CA 1RYYA 1Q8SA 1URXA 2Q5TA 3T08A 3SH4A 1SBFA 1HB3A 3USSA 3OUJA 1QEXA 1ENXA 3WQ7A 2DDUA 3BKZA 1U12A 5K9YA 4QKNA 5DDJ1 4MGKE 5FZAA 1Q43A 5FZGA 3VHRA 2YBPA 3MBWA 4B7KA 3AMMA 3T09A 1RUH3 3FJSA 4K3UA 2WQ8A 3I3QA 2JG8B 4FFIA 5DZEA 3K4DA 3LOIA 2YUEA 1OH4A 4JRAA 3R6SA 2YB7A 1UIKA 1POV3 3CZUA 4P14A 3FLRA 4M3CA 1HJFA 2NMNA 1VIWB 1Y4WA 1QJU3 1ODNA 1TMF1 3R05A 1D4M1 4MGTA 4A6SA 2YHJA 2R041 3ILFA 5JIAA 3M3QA 1RUG1 1UKGA 3UT0A 1RUE3 3VBFB 3AMHA 4XJWA 2HWC2 4NHXA 4NR1A 3VD5A 1HV1A 4ZS3A 2GC1A 3KQ4B 4OMCA 1MEC2 3J26N 1X9TA 3I2IA 1CZVA 1V00A 4AFBA 4CDWA 3ITQA 2X29A 1UYYA 4WM8C 5AFEA 1GZ9A 5KXBA 1HIXA 2WC2A 3VZNA 1EPZA 1OQDA 1IKQA 1NA1C 2ET1A 3VZLA 4CP2A 1E5RA 2EXKA 3QD6A 3AP5A 2D93A 4A3XA 5FZ4A 1LODA 3J7HA 4H3WA 4QKDA 3PTYA 3MV01 5GZEA 4XHBA 3CMGA 1LHOA 5FZ9A 1RUH2 2WINB 3ZXFA 2A75A 4R9AA 2ZS6B 4FOWA 4GALA 3I3DA 2ZEYA 3PU3A 4RR3C 3O1OA 4KU7A 3WNMA 4DMIA 3MF9A 4XZUG 4WV8A 1ND2B 3J8F1 5FCCA 1SG3A 2HLEA 1KQRA 2D6LX 3ELNA 4NAOA 5JIUA 1U5YA 4UYBA 1QJU2 4XFCA 5D1IA 1XRUA 1GZTA 2PQSA 5I8SA 2OQ6A 3WG3A 5C3QA 3HBKA 3TB0A 1HXS3 1UX7A 1RHI2 4DIQA 4I0WB 5FYCA 3I3BA 4XAAA 4YYOA 2KA3A 1G86A 3WDTA 4PLMA 4E4ZA 4Q4V1 1RUD1 1H2NA 1RUE2 1DGLA 2HYXA 2VU9A 1WLCA 3A0NA 2D98A 2DFCA 4QM9A 3HIFA 5CYYA 1PM7A 1VBD3 5J09A 4UXAA 3NAPA 4WZCA 1KFXL 2ZBJA 1FMD1 2CGOA 2D7FA 1DYPA 1CPNA 1DZQA 2HBTA 4NUBA 4B8EA 4A7ZA 1V6JA 1UF2C 3BALA 5CVRA 3TYJA 3I2HA 1CAUA 4CDUC 4WBBA 1WMXA 3PUIA 4UFMA 2HYKA 4XUQA 3NV3A 2GH2A 2WNUB 2XGXA 4CEYC 1O4TA 1ZX5A 1OUSA 4BQXA 1Z78A 3Q8CA 3DXTA 3E6DA 5BNPC 3LDKA 1NYWA 5IVCA 2BV4A 2ZACA 4RHV1 1JODA 1FNZA 5LK5A 2XONA 1OHFA 4QX5A 3UV9A 3KCXA 5C71A 4XURA 2CU5A 1UYPA 2VGDA 4HN1A 4RYDA 1Q3EA 2P17A 3BB6A 1JZ7A 5DUXA 1CR7A 2Z5WA 4YZ2A 4PLOA 3ZSJA 2BDRA 1PGL2 4B1LA 5IK4A 2D5HA 3WDVA 2OX0A 1GZCA 5FYIA 2JD4A 4FCAA 3AZYA 1QQP1 1ONAA 5DAQA 3D0JA 3CNAA 3M8LA 1KS4A 1W6PA 2BQPA 2MHFA 4LBNA 4PBOA 4XIOA 4ZXKA 3E5QA 5A32B 3ZYBA 1VBD2 2A6YA 2VOTA 2Y6GA 5FP7A 4KMQA 1RUF3 2CYFA 2D5FA 5JAXA 1XNDA 2ARBA 2W9XA 4D6QA 2BYVE 1QY4A 4CDWB 2DU0A 4FSJA 3MFAA 4Y20B 1HW5A 3ZYFA 2AACA 4LJHA 2VNRA 2RE9A 5DN2A 3O0VA 2ZTNA 4URTA 2KD7A 1CAXA 2W1SA 2B9VA 2DURA 5F5CA 5C8CA 2YG0A 5BXXA 3AMNA 1V6NA 1R083 3CJIC 2YXSA 1ZBE1 3J9SA 5IUQA 4ASLA 1DZTA 3CO2A 2B46X 2EIBA 2QDNA 1TME1 3I7DA 4RGKA 3BU7A 2V5DA 4YVSA 3RI8A 3LPFA 4YZ1A 5L9RA 1KDKA 4P00B 3ROUA 1WW5A 2VQ0A 3BPZA 4Q4W1 3VBHC 3GJAA 2GN3A 5FQ0A 2CAVA 5JOYA 1PNFA 3OYWA 3RYKA 1FPN1 3ES4A 1BK0A 2FDJA 2XWJB 2ZJCA 3NAPC 2Z69A 4D7YA 5LZ6A 4XF0A 5GZCA 1AYN3 3O1TA 1QH7A 1GOHA 2YU2A 3FHQA 2P6CA 4IGPA 3SQOA 4HZFA 4EV0A 5FPBA 2OPKA 3WHTA 4LOSA 1JYIA 5FFOC 3BTYA 4MV2A 1HRI3 4DUXA 1DFQA 2JKBA 2ORZA 3CDZB 1AX1A 4QM8A 2EXIA 4E2SA 2PQQA 3GJBA 4XUPA 1G9BA 2FZ2A 2PAEA 2BZDA 3KV6A 4CDQB 2BOIA 1XJAA 2RDNA 2VO5A 2WIIB 3MGUA 3MPPG 4RL7A 4BQ4A 4Q27A 2BP6A 2XJUA 1SZBA 4L9BA 1SEFA 2GP5A 1LKNA 5JLVA 4HG6B 1NE4A 1O3QA 4X8NA 5DDJ3 1NCRB 1UMHA 4MUVA 1JU3A 1GYKA 1AR91 1S2EA 1OLQA 1CAUB 1LOFA 1XB9A 5FZBA 2ZGLA 4BM8A 4A6OA 1BMV2 3ZN6B 3O7OA 5FYZA 3HVDA 2DF7A 4UW4A 4XQWA 3SEEA 1R082 4CEWC 5IAVA 5HV0A 4P9GA 1YNAA 2P2KA 1LTEA 3K75B 4CUCA 1MS3A 2FQPA 3OCPA 4RN5A 1I5PA 4JZRA 1ZRCA 3GDBA 1OD3A 2LALA 3KWVA 1TQ5A 4Y5Z0 3VKNA 5LBCA 1OFSA 4LBMA 1VBE1 1AXZA 1O8SA 1JS9A 1AL23 2EIEA 4JKMA 1AYN2 2ZABA 4LBQD 2VMHA 2Z2SB 4FQ4A 4PHZA 1CONA 5D21A 3DYMA 5C5UA 2QQOA 3WW3A 4DFSA 3MLKA 1MVEA 1VB4A 4J1XA 3N35A 4CP9B 2YPDA 5M0TA 1HRI2 2ATFA 4R9BA 2VUCA 3ZYRA 2I45A 1IS4A 1DCSA 3ZSMA 5C8CC 1XE8A 4LHLA 2XPJA 1YIFA 1BEV2 3AZWA 4GA9A 4XUTA 3OF1A 4PLNA 1VB2A 3HPNA 1WCUA 2Y34A 4TN7A 5JR2A 5DDJ2 2FD8A 1ACCA 1IS5A 3FWEA 2OIIA 3ZYPA 4YSFA 5ACA1 5EP9A 1CAXB 3AKPA 1SLCA 4UT5A 3PTRB 2FCVA 3UNPA 2VZVA 2QQMA 4QDSA 1CAVB 2B45X 3HQXA 4IE6A 4HK8A 3VDAA 1ZZ6A 1K5JA 1XNTA 4JTNA 2BWAA 3WOGA 4YVSB 2VE1A 4XHXA 4EE2A 3NNJA 4YM3A 1IHMA 4MGYE 4XFGA 1BLZA 1XC6A 2FCUA 5F8PA 4KG8A 4EQVA 4NOTA 2E7QA 2VUAA 5F3GA 3KS7A 2VBBA 1UOBA 1XNAA 3OYWB 4AI2A 4EWEA 4Q4V3 4XCBA 1AL22 1RUD3 1J58A 1SLIA 4I09A 5GKAC 2FCTA 4HSLA 5FZ3A 3SKVA 3I49A 1VBB1 1H2MA 2Z4FA 2PHWA 3KZ4C 3VBRA 5FY9A 1XE7A 1WWYA 2F4LA 3VD7A 5C4WC 1Y9QA 1LOFC 1S0BA 3KT7A 3QCWA 2DWRA 4QQPA 2VOKA 4S2FA 1VAVA 3KVBA 4FPGA 3AMPA 2WLPA 4XPVA 4AEDA 1ASJ3 1LJ7A 2W91A 5CFDA 1TG7A 2ADDA 2UURA 5F6KA 1JZ6A 3ETQA 1JZ8A 3AJZA 1UL9A 1DGWX 3JD71 4WVZA 4ATFA 1GNZA 1WGPA 2V72A 4RHV3 4GH4A 1DBNA 3THPA 4BDVB 3V65A 4BCUA 2XJSA 2VVFA 3VGIA 3N7LA 1JYCA 5I0SA 1NXMA 1KJLA 3F2ZA 1GSLA 4LKDA 3GBFA 2V4AA 3ZSEA 4GAZA 3T1LA 1OVSA 4M4RA 4CCNA 4JC1A 2PFWA 4OUEA 5LA1A 3EQEA 1AR73 2JDPA 4Y22B 1CQ9A 2VZUA 4MX3A 4WVWA 4G4FA 1UD1A 1MS5A 1N1SA 1HJGA 1F5FA 1G9FA 3FFQA 1DGWA 4AQ2A 4Q4V2 2XVGA 3IKWA 1RUD2 2VCMA 5FWEA 5IT6A 2PXJA 2OT7A 3P1IA 1C4RA 2Y0IA 5F5QA 3RYRA 1JZ3A 2NN8A 2XL7A 4IEQA 2VY0A 1HDKA 1WMEA 2Z79A 1IPKA 4BLJA 2A3YA 1UOGA 1H8TB 2WAAA 1GQHA 2ZGMA 1CD3G 4JDNA 1STMA 3RJRA 2EF6A 4AHYA 2R1DA 3KF5A 2P3IA 4XFBA 4FFHA 2DVFA 3VD3A 1ASJ2 4MXVA 3LDRA 4W50A 5FXVA 5F2WA 5E16A 2UWCA 1AR81 4C0BA 1JZ5A 2B9UA 3PIGA 1TNFA 1VLNA 4UW3A 2WL1A 3O1RA 4AGGA 3HOBA 1ZBA1 1TME3 4IEUA 4P9JA 2O0OA 3O1PA 4XEZA 2HWF1 1AYM3 4FP2A 5A7SA 2WWSA 3RG0A 3SC7X 3VHNA 1NQDA 3WUCA 3TEYA 5JMOA 4AI9A 3IN9A 5C9AC 1NLRA 2RHPA 3VZJA 5JSRA 2RDSA 1V70A 4MADA 3W58A 1ZRRA 2QQUA 2DCJA 2WYSA 5BNNC 1FPN3 1OA4A 5CG9A 2E51A 2VM9A 1AR72 4COUA 2XJPA 1HN1A 3VBRC 4CTEA 1ND3A 4L99A 2UU8A 1F4HA 2VJXA 2WNVC 4JQRA 4AVAA 2GNDA 3PVNA 3VD4A 3JU9A 1SQ4A 4A7KA 1DQ6A 3ZXAC 4QGNA 2WN3A 4W8JA 2WNEA 4QX3A 3IM0A 1PO22 1WA4A 2WZ8A 3E6BA 2VZ3A 5CFDC 4N53A 1IS6A 4LK6A 1IZ3A 3AXDA 4FPHA 1SBEA 2IXIA 4KH9A 4N9HA 5DUVA 5L9VA 4H7MA 1ZZ7A 4RS5B 3RI9A 4IV1B 3SH5A 1C8NA 4NMIA 5I0TA 5JXJA 3NJYA 3T0DA 3KCYA 1AR93 1UKRA 1TZOA 2ADEA 4EN9B 1J84A 1VRH1 3PMSA 4AI8A 4AF9A 1POV0 1CAWA 1QWRA 2BNNA 2Q1MA 2ZX2A 5D8AC 3RSJA 3WW1A 1PK6C 1ZZBA 3NWKA 1TME2 1QOOA 1VRBA 2QDRA 4GULA 3VHOA 1DYKA 3C7FA 4RQPA 1DG6A 2A1XA 2D43A 1AYM2 3IDBB 4Z2AA 3U0ZA 3C7HA 3MV11 4XETA 4MGQA 3VZOA 1OI6A 1MEC1 1SLLA 4AVVA 1RUC1 1F4AA 2BWCA 5FP8A 1FPN2 1GKBA 1L7LA 2QE3A 4EROA 1W39A 4QXBA 4YW1A 5FPAA 1N47A 1W03A 2ZAHA 3N4MA 2WJSA 3D0SA 2XKOA 1V6KA 2AYHA 3O5SA 4XDPA 5C7GA 1DF0A 4R52A 5L36A 4MGIE 2H0BA 2WO7A 3I2FA 1COV1 4XJUA 3UKVA 1OXCA 1RC6A 4GMP0 4PI2A 3VDDA 1NKGA 1POV1 4O65A 1ZA7A 2EXJA 3CEWA 3LB9A 3K3NA 1AR92 1QMJA 2R49A 3WQ1A 1A8MA 5GZFA 3AK0A 2ZPXA 3U11A 3DXUA 3PUAA 2WABA 4IERA 4QX1A 1RHI1 3C2UA 1RXGA 4XFAA 3U10A 5JI9A 5LB6A 4YRDA 4QPGB 3W5MA 5EXOA 1MQTA 5FXZA 1ZA4A 3GYDA 3GZUC 3MW4A 3RZLA 2JG9A 1IS3A 2Y33A 2ZEZA 3KB5A 4QMAA 4TWTA 4MSVA 5FMOL 3JQXA 1ND3C 3NKTA 4XBLA 5EQUA 1V6LA 4FTEA 3UGGA 5F3EA 3LWCA 2OW4A 4XYXA 1LAJA 3LDBA 3OTFA 5C3OA 2J1UA 3OBZA 4JKLA 1O5LA 5LATA 2BNOA 1UMZA 3W59A 3R0RA 3M3CA 4NHYA 4XBNA 1MS1A 4RFRB 2VXRA 1PZ7A 2IWGB 1JYVA 1VBB3 5EHDA 4GMP1 2AC1A 4CYDA 4GIQA 2X5IA 2WKKA 3EXUA 3U14A 4OI1A 2VW0A 3K77A 3T3YA 3ILRA 5CAZA 4QHBA 1XQNA 1OOPA 1V9U1 5LY2A 2W08A 2L9LA 2EICA 1CGPA 4N53B 2R6QA 1UPIA 4EN8B 5ANQA 2BUKA 2JD9A 5FWJA 1DLLA 5B4NA 1AZDA 4EZHA 2J22A 2HEYF 1DLCA 4KI5M 1YXWA 3WXPA 2YV8A 3EO6A 2CGPA 4Q0UA 2VC9A 1PGL1 3MDPA 1YQCA 2W2IA 4CCKA 5A3MA 2WA4A 4JV4A 2RS53 1ULFA 1ULEA 4LHSA 4PDWA 4XJAA 5D2AA 3ORJA 5HCFA 4AG4A 2UY8A 4B29A 2D6NA 3GHMA 4E27A 5JZGA 1J1TA 2A6VA 2V4VA 3SEPA 2GNTA 2LRPA 3AZZA 4YGBA 1VBD1 4L11A 4S2DA 4RQPB 4XDOA 1GZWA 5F5AA 3IIIA 3FZ3A 3WF0A 5JSPA 3O12A 4M3CF 1A78A 3W20A 1JOJA 5LEKA 4JDOA 5CADA 2VECA 5JVVA 4F83A 1W8ZA 4YPJA 4CXYA 2G4IA 1VBB2 4NHLA 3S6PA 4PBPA 3POEA 4YGEA 3OY8A 4GWMA 1UNBA 4IV3B 2QQPA 1U5IA 3UJOA 1JHNA 5SV5A 4XFFA 2QZ2A 4CDXC 3U37A 5IVEA 2W3JA 2XR4A 4CCDA 3H50A 5IJRA 1DQ1A 4FO9A 2OZ6A 3FUOA 2RVAA 1W9SA 2ZEWA 4HT1T 4YLZA 4QPIC 4XF3A 5FZFA 3ZX7A 5JOWA 1YFXA 4JHZA 4YM2A 3VDDB 4AL9A 2BBAA 4SLIA 4COZA 1K5MC 1PHMA 4AHZA 4ARYA 2GMEA 4CU8A 1POQA 4BLIA 5FY7A 5FPXA 2JG9C 4Q0PA 2EIDA 1WKYA 3KCCA 4R9CA 2X09A 4EZ4A 5CFCB 1ZBA3 2W1WA 3BGAA 2RS52 5GLTA 3SMHA 2RS31 3RWKX 1DQ5A 1VMJA 2F4PA 2ZGPA 4XTPA 3WW2A 1K12A 3LSEA 2Z42A 3I3MA 1MQTB 1Y3TA 4LHNA 3MUY1 4OHZA 4A4AA 3IMNA 5I0UA 2Y8KA 3POYA 4GWNA 3WDUA 3AKQA 1RUNA 3ECQA 1P8JA 4CU9A 1NX9A 5A6QA 1PVC3 1SLBA 2ENRA 2X5IC 4JGYA 3J7LA 5AFBA 5F5IA 4URAA 3AKRA 2GZWA 1UX6A 4OHWA 2OPWA 5A3LA 5JR7B 4XXAA 4FFFA 5BPXA 2QQJA 4N43B 3SHRA 2YDEA 5FZHA 4HPKA 4WM8A 3DV8A 4RA0A 4BZ4A 1BMV1 1GU3A 1YJKA 3H7YA 1NA1A 2ZMKA 3BCWA 4YGCA 1YYNA 2BW8A 1R081 5KC5A 1JXNA 2TNFA 4LITA 4AFAA 3OGRA 2C9AA 4HVOA 3NNGA 3C8XA 1S55A 4PQQA 3ZXKA 4XILA 2GN7A 3AYAA 3O1VA 3CF6E 3OPZA 1VRH3 5JZGC 2Q30A 4HMZA 4RR3A 3KHCA 2RM21 1OSGA 2CNAA 1VALA 1CX1A 5FMDA 3AVRA 5I93A 1ZBA2 5L73A 4XF1A 1W3XA 4R4ZA 4SBVA 4PDWB 1ZVFA 2JE8A 1Q8QA 4N7IA 3NV1A 3GCXA 4Q1RA 4W65A 1DU3D 1MEC3 5HXMA 3PLQA 4A3ZA 1HRI1 4BXFA 1LCLA 1RUOA 1RUC3 4KBBA 3OEAA 4UFLA 2WO2A 4YVWC 5EYXA 3ILNA 3FX3A 4CUGA 1U5ZA 3LA2A 1PVC2 1UY1A 4FTSA 3ETPA 2MNGA 1HB1A 1BEV1 4D0QA 4QU2A 1DQ4A 5A3NA 1BJQA 4M0NA 1B35A 4ZPIA 2DVGA 5DXDA 5I8YA 5JCTA 4ZZ5A 5SV8A 1O59A 2E26A 5J98B 2VCAA 4CPBD 1JOBA 1D2QA 3BU0A 1MS8A 3OY8B 1SFNA 1COV3 3GNEA 4CDUA 2Q8EA 3RQ0A 3I2OA 2O14A 4CEYA 1TEIA 3T2QA 1Q56A 3AM2A 5FZLA 5JMCA 1LGNA 2JDKA 2JDUA 4L0PA 5A3UA 5BNPA 2FZ1A 2G19A 2BFUL 3I2DA 2QBXA 4L2NA 1VRH2 3ZFGC 5FR3A 1V6OA 1BVP1 1RHI3 1A3KA 4CCJA 1HKDA 4WZFA 4ONUA 4DQAA 4EWDA 1L7RA 1YQ8A 4XQ4A 4LKSA 1UZWA 1IQDC 3VBUA 1UY2A 1UXXX 1AL21 5FPUA 3AP4A 3OGGA 4JGYC 3SCFA 1DGRA 3DPRC 2Y6KA 3E5UA 2ET7A 2AR6A 4QPYA 5HPOA 2VZ1A 3KMHA 1W0OA 1X9PA 3VKLA 1WBFA 3AJYA 3G7DA 5ABJC 1RUC2 4E2QA 5K8SA 3I8TA 2DCKA 2WO3A 1FV3A 2NZ9A 5KHJA 1EYBA 5FMCA 3ZR5A 4K20A 1AXYA 1YQ2A 4XJ8A 4AAXA 3HBZA 5EJ1B 2C24A 4LO5B 3AMQA 3GBGA 1IOAA 4GMP3 5T55A 1OBNA 1J3RA 4W6WA 3VUOA 1C1LA 1VBC2 4Q0SA 2RDQA 1HQLA 4FQZA 4GZ9A 4YARA 1V9U3 2E7TA 4TSVA 5DQ0A 1NA1B 5J36A 1X50A 1COV2 2NP0A 2D97A 5FZEA 4I3PA 1GQPA 2DYCA 2Y6JA 2GNBA 1MZEA 2Y26A 4GJZA 3ZYGA 3BIWE 5I8TA 3CJIA 4IE7A 5DAXA 3CL1A 5FUPA 2FDGA 1OC1A 3ZYHA 2HBUA 4FP3A 4NPMA 1R093 4X8PA 4JX0A 3TOJA 2VNOA 1DGRN 3VBHA 3GXUA 4XBQA 3AX4A 1GV9A 3VZMA 1GR3A 5A7PA 3OD4A 3QLQA 1OUXA 5F37A 2KR2A 1B35C 3JB8A 1BHGA 3V0AA 1W8TA 3I2GA 2PA7A 1W2OA 3ZN4A 1W6OB 1UPSA 2ZGQA 1Y7BA 3WHUA 2GDFA 4IL7A 5H9QA 4ZONA 2QQWA 1ASJ1 4K8FA 2R061 5A7NA 5DABA 5FO9B 4QXKA 3B93A 2CHHA 3UJQA 5LRRA 5L19A 5LCWL 1JOPA 3N9LA 1E5HA 4P9XA 4UF0A 4AFDA 4QAWA 1LNSA 3IIAA 3IT8A 3PVBB 1NXD1 3ZYIB 3LGRA 2W5FA 3OGSA 3IPVA 4E4SA 3VDCA 1V9U2 3ACFA 4JQTA 3DN7A 4Q1PA 2AENA 5E6HA 1OA2A 1UU4A 3C7EA 4ARXA 2CWMA 3ZXEA 3VBUC 1WMFA 2R30A 4M3CB 1QJX1 2JENA 3LAGA 4CEWA 1EUUA 1S1AA 1FX5A 2IZWA 4QWNA 1WMDA 4LR4A 4NRQA 1RTVA 4F8AA 5BNPB 4Z1VA 4YZ5A 3VLBB 3USUA 1NUKA 1AR71 2P5BA 2YGLA 1R092 3C7OA 4XJ9A 2E7AA 1NE6A 2ES3A 2RS33 4P5YA 1SPPA 3IDAA 2GC3A 3Q8BA 2FDFA 2GALA 1PMJX 2A6ZA 4Q0QA 4HL0A 2C26A 2ZX0A 5J96B 1CJPA 2XLGA 1MZ5A 3M3OA 1S0DA 1PO21 2XG3A 3VKOA 3HN1A 4META 5KHGA 1GP5A 3WX5A 5HXVA 2D6MA 3Q8AA 3OPWA 5F32A 2ZEXA 2XJVA 3POBA 3BIEA 2DV9A 2XMLA 1YI7A 3J7MA 2VOXA 4LO4B 3UETA 4B4PA 3TBDA 2GNMA 2OA2A 3B7MA 3WF2A 4DY5A 4QPWA 3GM8A 3PJQA 2XDVA 4LBQA 1H2KA 5F3IA 1A34A 3TWIA 4OMDA 2JDYA 4XCAA 1B09A 4DXRA 1UU5A 2C0ZA 3VZKA 2A6WA 4XZPA 2OKXA 2AEZA 3RDIA 2JDZA 3U1XA 4AZZA 3BOWA 5EJZB 2EA7A 1BXHA 5IATA 2ZA9A 2ZX3A 5FREA 4FI9A 1AYM1 2NYYA 1FXZA 2H0VA 4HK9A 3MIFA 3D6EA 3WP4A 2XQXA 2RM23 4V2WA 3NVCA 1H1AA 3D5OA 3INAA 4A41A 4N7UA 4AEMA 3KM5A 1AR61 2PELA 4BXSV 4LMFA 3GHNA 2RS32 1KFUL 2DTWA 1QNWA 5FBZA 4DZGA 4NRPA 4L92A 4FT8A 2Y6FA 3T2TA 4J6GA 2D3PA 4IW3A 3ZFFA 1NOVA 4INDA 4O9EA 2J1TA 2CV6A 3NAPB 1NY71 2XLAA 3WZ1A 2ZZQA 5BYNA 4IEPA 4KBZA 2VMCA 4ZU7A 3J4UH 1XNBA 4K7JA 4LXLA 1BEV3 4AW7A 5IK5A 4NIDA 1H9PA 1S0EA 1AJOA 1UOJA 4MHUA 4NHKA 1OFNA 3N9MA 4K40A 3GZEA 5C4WA 1QJEA 1UYXA 4QB2A 3FLPA 1SLTA 1O91A 3MO4A 1YRZA 3L9JT 4NE9A 4TLGA 3RFRA 3WG2A 3MUZ1 5BNOC 1DQ2A 1X82A 3IPVB 4OHVA 1I5ZA 4UW5A 2DU1A 3A7QA 4ZU5A 4COWA 3BN6A 4UI9L 1MVQA 2BGOA 3T30A 1M06G 5BY5A 1J59A 4OI0A 3ZO0B 3MI8A 4Q29A 5FUNA 4OHXA 4GB33 4N9IA 2VW2A 4DNYA 4MG2A 1SCRA 4W4ZA 2RM22 4LHKA 4YWAA 5FPVA 1JZ4A 4LTAA 5IFTA 3USUB 2R0FA 1O4ZA 1O8PA 2VUJA 3M2MA 1L7QA 3TRSB 4D94A 3D3AA 4YGDA 2D6PA 2ZX1A 4XFIA 4Y1XA 3OBAA 5FK7A 5IVFA 5LA0A 4K1YA 3RWNA 1W6PB 3T0AA 1UW8A 3WUDA 5IK8A 2PMWB 2WZEA 1ZNPA 2VXJA 3MFCA 4NN0A 2JX9A 3JBG1 5LK7B 4IESA 1WCDJ 5FYSA 4FOVA 4IEVA 4XMAA 5T5LA 1IPSA 4OQ8A 3CIHA 5HCHA 4IEZA 3JB4C 3WT3A 3GZAA 4K1ZA 4JCKA 1S0IA 2JDHA 3FUQA 3LA7A 3TEXA 3ZDVA 4HKOA 5A1FA 3GCWA 1JYXA 3SNMA 2J1RA 4P9YA 3POWA 2RJLA 5C8CB 2WRAA 3LF7A 2DUOA 5DZGA 4B3NA 3WQBA 1OF3A 2Q8DA 3UKTA 1UIJA 1YJLA 2JJ6A 5FZ1A 4FVVA 4M4PA 3NSTA 2Q4SA 3AKTA 2MPFA 4H2AA 4HVQA 1UY3A 2PHDA 3LQCA 4BU2A 2E9QA 1UAIA 5A1LA 1H2LA 1EV13 2PHRA 1O5UA 4GB32 2NLRA 5FQ0B 3BODA 5FP4A 4ZHNA 1SBDA 3U78A 5C3PA 1TVGA 3ZFFC 4FTBA 2G9ZA 4QQHA 2UWBA 5C9AA 1H6XA 3V0BA 1EAH1 4LKFA 1D4VB 3WNLA 3O1UA 1F9KA 3DF0A 3IZOA 5BNNA 2R073 2JXAA 4QQ2A 3OGVA 1OKQA 2LROA 1D7PM 4BOWA 1W2UA 1RMU3 4CZSA 4PCRA 2E32A 1C8M3 1W0NA 1R1ZA 1GWLA 2WNVA 2ZXQA 4AR2A 3APBA 4PI0A 4D6SA 3O0XA 3ZKUA 2R063 1VBA3 3KQRA 2P6HA 1OLME 2GMMA 1SHWB 1LESA 3PU8A 4PT6A 4RGAA 2K0GA 1REDA 3P6BA 3GALA 3PL0A 5FP9A 1RITA 5C4WB 2JICA 2JWPA 2CWSA 5GJ6A 3SXWA 2YBSA 5LRSA 2OZJA 4Q4Y1 3K46A 4NIIA 3EJKA 4HANA 2RS51 1VMFA 2X05A 2I74A 4NWVA 3OUIA 5FTTC 4BPZA 4BQ2A 3ZXJA 3A4UA 1XU1A 2DUPA 4IQPA 5JPNB 1W28A 4OUMA 4A42A 1QJX3 5D8AA 1ODMA 2PTMA 4V2VA 4Q26A 1PK6A 3AP6A 1EV12 3CBNA 4IE4A 5T5OA 2BFUS 3FBYA 4FPKA 4BK4A 1AF9A 2ZGRA 3FC0A 4D7TA 1UYZA 1XNKA 5FZDA 1JU4A 1QJFA 1US2A 2JB4A 1ST8A 4WVMA 3AL6A 5E89A 1ENRA 1Y9GA 2R072 4X6RB 1PO23 2ZHNA 4QX8A 3WF4A 1RMU2 1C8M2 1V0AA 3I97A 4BK5A 3FBMA 1O3RA 2OUJA 4DEVA 1T6GC 4HVRA 2OUHA 4UFIA 1N3PA 2R062 1VBA2 5FJHA 1H8TC 5HCBA 3SH3A 1W6MA 5LY1A 3HMYA 2GU9A 3MIEA 3KLSA 3AFKA 4N8MA 1PZ8A 3LEIA 4NPRA 4ES9A 1UOFA 4LBJA 3TNPB 3UYJA 5FZ6A 1N1VA 1YIPA 1OQEA 1YQ6A 1QXRA 2RV9A 3E5XA 4YZ3A 2UYAA 3W5NA 1QJX2 3A21A 1R1A1 3NQHA 4DXSA 5CA6A 4B4RA 4F3JA 5KXCA 4HSJA 4C1XA 1JYWA 1PVC1 3MPBA 4XUNA 1AR63 2YU1A 3WNKA 2Y0OA 2WSVA 1W99A 3DYPA 4YG0A 3ZFEC 5K0UC 1LR5A 5LASA 4ET7A 5DMYA 1RUJ3 1Z7S1 3MIDA 3LFMA 4P9LA 5C9AB 3V0BB 1LEDA 4BQ5A 1ENSA 1GP6A 1OA3A 2VCBA 4AEJA 1GP4A 1SCSA 5A70A 3BTZA 5BNNB 5IHRA 4D69A 4ISRA 2KM2A 1C1FA 3VBRB 3ZSKA 2HWB2 1QH6A 4O61A 4QKBA 1XYNA 4AVCA 3W9AA 3LIGA 4AQSA 4PJYA 1OVPA 1CIYA 2IXLA 3GBWA 4GJYA 2K9ZA 4BQ1A 2WWJA 1YO8A 2BJSA 2OQ7A 4MYEA 4AEDB 4GWIA 3VDBA 5CFDB 4QX7A 5LA2A 2VUDA 4IV1C 5KXDA 4KGGA 1IG0A 1YHFA 3T2PA 5KWRA 1KDMA 2LUWA 1JZ2A 3LEMA 4E8DA 3KT1A 4GH4B 2RJKA 4RD7A 2QFEA 1SLAA 4CXXA 3NMBA 3WP3A 3S57A 4CU6A 2NMOA 3EB7A 1ZRFA 4YW4A 2MEV1 1DHKB 2VNGA 1H1IA 3I54A 3POIA 4BE3A 1S4CA 1NLQA 1OF4A 3ES1A 1KD7A 4HN0A 2VAUA 1PK6B 1YUDA 1JI6A 2GC0A 5FAXA 3U4XA 1W2NA 1AR62 2D44A 4MGZE 5ANNA 1IPJA 1RXFA 3FN9A 1RUJ2 2XOMA 1AUYA 1JTZX
chains in the Genus database with same CATH topology
3RMYA 1PZ9A 1FNYA 2UWAA 3OGJA 1KRIA 5H9SA 3X29B 5FDBA 1VBC1 2W0XA 1EP0A 4LO7A 3QH7A 3JBG3 4BWOA 1NY72 2R1BA 1ZYBA 4RFT0 2XHKA 5A33A 3SLIA 3M7AA 1N3OA 4LT5A 2GAUA 1C5IA 2I2SA 4CDXA 3I59A 3VV1A 2A71A 4QPIA 1WW6A 2C1FA 1YWKA 1W6MB 1K5MA 2W68A 2FBEA 1G9AA 3NO8A 4P9IA 1MZ6A 2V73A 2PHFA 2JE9A 4NO4A 3VBOA 3P3NA 1FOD3 1N1YA 3WY6A 1JBCA 1BKZA 3RJ2X 3DL3A 2ZGUA 1REFA 1PGSA 3VL8A 1EAH3 1H0BA 4UW6A 4WVVA 3S30A 1O3TA 1JUIA 1ND3B 2R32A 4PF5A 4BIFA 2CAUA 5EYYA 4IEWA 2CTVA 1CIWA 3SITA 1ULCA 2VVDA 4ZKTB 3MW2A 3ST7A 5CB7A 3JBG2 4BHPA 2IFRA 1O4YA 3THTA 3I4IA 3M1HA 4HETA 1F2NA 4I01A 4LUKA 1RUI2 1N1TA 2HEWF 2A3WA 4HKWA 4FOQA 1DIWA 5F9TA 3L2HA 4FPYA 2R16A 2Q0AA 4Q4Y3 1R091 4P5HA 3WCRA 4CRQA 1CAWB 3WV6A 2PHLA 4AE2A 5EZWA 1FAYA 1MS9A 1F5JA 1JW6A 5FRAA 4BA6A 1FOD2 3WDYA 3BOPA 4OVEA 3R4UA 4AQ6A 5KXEA 1BYHA 4U2AA 1RIRA 3AZVA 2O8QA 1EAH2 3ZXGA 2RS11 1RB8G 1WW7A 2DFBA 3M3EA 4YVWA 4MLOA 5HCAA 4H7LA 5L7OA 3H3ZA 5AC93 3MIGA 4DY3A 2GH8A 3AZXA 4AI3A 3AYDA 5A33B 2VOVA 3WVJA 1FATA 4XIKA 2XVLA 3N3HA 3WG4A 4KL1A 1LU1A 3CU7A 4CDXB 2DVDA 3OBRA 1G8WA 4I30A 3I59B 3VBOC 4AI0A 1SMVA 2BNMA 4Q4Y2 2RR13 4A2UA 4GQ7A 4QPIB 4COVA 2YY1A 2WS91 1K5MB 1LEMA 2VMGA 4O9GA 3ZFGA 2YYOA 5CBLA 1LGCA 1R1A3 2JG9B 4BIOA 2ZKLA 2IFWA 2UYBA 4XJZA 4E9KA 3DPRA 5JOZA 5IK7A 4FXGB 3ZDSA 2WZR1 1Z7S3 1G9CA 3VBSC 5BV6A 2P3JA 4UBGA 1HV0A 2SLIA 5ABJA 4I02A 1BZWA 2H6CA 1RGSA 2X5IB 2QZ3A 4OLLA 4JGZC 3WW4A 5AC92 1XNCA 3DUIA 4I3GA 3NW4A 3NJZA 1QXJA 3LKJA 1OOPB 4LA3A 4P9WA 4WM7C 2B7YA 1NCQC 4MXWA 4LLOA 3KSCA 3CLPA 2XJTA 3LSDA 3VKMA 3VL9A 1W6QA 4AFMA 2XH6A 4YW2A 5BNQA 2VH9A 1F31A 1I3HA 4LA2A 4M00A 3ZMNA 2RR12 3H7JA 1H4HA 1PO11 2WLQA 5J7MA 4FOYA 4LBLA 2MEV3 5JZGB 1XYPA 1A8DA 1ND2A 1Q8PA 1R1A2 2HWE3 2ERFA 1MS0A 1GZWB 4AEKA 1LHNA 3PNAA 1S0JA 1H4GA 5L7OC 2QNKA 4KU8A 4OHYA 1QOTA 5E8AA 3ZXDA 1FYUA 1Z7S2 4U36A 3B5LB 1LOCA 1JN2P 4YVWB 1VBC3 4LBOA 1D0GA 5FOJB 1YFYA 1F8VA 1VJ2A 4QQOA 1NLSA 3FHIB 4L8QA 5KC6A 2AREA 1XYOA 3O0WA 3UL2A 4X6QB 1GICA 1YCIA 1NZCA 4NWWA 4C1WA 1GANA 3AFGA 2PN5A 2JG8C 3MICA 2TBVA 3C3VA 2HWD3 4GB31 4IEYA 2WNUA 3U07A 2VOWA 1YLLA 1CX4A 3WD5A 1BBT1 4JVAA 1EY2A 5CIRA 4AVSA 1ULDA 1O7FA 4FXKB 4MH0E 4E2GA 4LE4A 3RRDA 2MEV2 4D7SA 3ZFGB 4PIZA 3FE5A 2HWE2 3VBFC 1G6NA 1RL3A 1YI9A 1I1EA 1PGW1 3TNQA 4JGYB 4I2OA 3DPRB 2OVUA 3R4SA 4E4DX 2YGMA 1L3JA 4XW3A 2TUNA 1BCXA 3NV2A 1WLTA 4CP1A 5ABJB 2YROA 4HPKB 4WM8B 5A32A 4RGGA 3DKWA 3ZN5A 1J3PA 3B94A 3JZVA 3ZYJB 5GLVA 2I07B 1ZZ9A 4Y20A 2P3KA 2ZOEB 1GFF2 3LA3A 2PYTA 2TEPA 2WA3A 3H9AA 1OPOA 4MXWB 4C0HA 2HWD2 1EV11 1W6QB 4JTOA 3WP5A 1H30A 1KITA 4D3WA 3NL1A 4DINB 4RR3B 1ND2C 1FV2A 4AXOA 2HKXA 2ZKNA 3WDXA 2E6VA 3EHKA 2XBO3 1WD4A 2BGCA 2R071 4OFGA 5GZGA 3QACA 2GSYA 1HLCA 4XDQA 1RMU1 1V6MA 5EV7A 1C8M1 2XJQA 4LNVA 2BVVA 2RS13 2NM1A 2PAMA 3EBRA 4QGMA 1VBA1 1LOEA 1H8VA 1B35B 3H8UA 4DXZA 4FPOB 1FI2A 1AXKA 3HAGA 5CU1A 4Q8KA 5JDBA 5KHKA 4ATEA 2QJVA 1MZFA 2WNUC 4CDQA 4CDUB 5FLJA 3VKFC 4KWKA 1LOAA 4CEYB 4Y4YA 2DVBA 1HRV3 2VG9A 1DZRA 2WT1A 1NCRA 4PIYA 3AKSA 4LO6B 5BNOA 1IQAA 2JE7A 3ZMOA 4JDMA 1GQGA 3ZN6A 1QDOA 2FMYA 3MLJA 3WINE 2WS93 5FOBB 1OMIA 3KD4A 3N7MA 3VBUB 3ACLA 1UU6A 2XBO2 3MF6A 1QJY1 2D6KA 3SISA 1KJRA 4Q8LA 1G7YA 3FMGA 5FMOS 4H55A 3T1MA 2ARXA 2EVXA 2F6BA 2SBAA 1X33A 4Z92B 2HWB1 3E97A 5GLZA 1HQWA 2WZR3 4XFHA 1LGBA 2RS12 1QGLA 4HBNA 1SACA 2XL9A 5DG2A 2A7AA 4BMBA 1Q8OA 1HXS2 4HFSA 3B02A 5TSWA 4QGLA 1QU0A 4CDWC 3HD8B 4FAGA 4YG6A 4QD2A 2QCSB 3TN93 3TAYA 4F7ZA 1CN1A 3E6CC 5FO7B 4TZDA 3ZPYA 3JUUA 4YZ4A 1MR5A 3V64A 4DRVA 5J37A 3ZIWA 1HRV2 5CG8A 2D6OX 3CJIB 3WQ0A 5EWSA 1SFYA 2EALA 4ORFA 2IXCA 1UN1A 3RMXA 1FT9A 1H9WA 3RZZA 1PO13 4K9SA 1GBGA 2WS92 1RUJ1 3VBHB 1CAVA 2VVEA 4G3YC 1RVF3 3B01A 1ZZ8A 3HWJA 2A6XA 4OULA 4S2HA 4XF9A 2P37A 4FPCA 3V0AB 4ITCA 1Z0HA 2WZR2 2RMU1 4H14A 4Y26A 1TNRA 3KT4A 2EAKA 3PJYA 3N36A 4CDQC 4LULA 4EWAA 1QXPA 4KNCA 4TYSA 1Y43B 1NG0A 4OZXA 4YW5A 2K2SA 4Z07A 1NCRC 4XE9A 3TN92 1X7NA 1RUF2 2PLV3 1PIV1 1QJZA 3NKGA 4J1WA 1VR3A 2ZGTA 4HLTA 2HEVF 4YNIA 4CEWB 4LE3A 1DDLA 2ZHKA 4DS0A 1VAKA 5BNOB 3S0MA 1BBT3 5KHHA 1PO12 2AGSA 3B9IA 1GNHA 1RVF2 3HT2A 1NQJA 2WQZC 5GZDA 1RINA 3R4DB 4AFCA 2CGNA 3AB0A 1OD5A 5T54A 1X36A 4AGRA 1TMF3 2ZMNA 3ASIA 1D4M3 4Y22A 2R043 3RNSA 1ZRDA 1RUG3 1JUHA 2HJIA 4M3CE 1RUI1 1S0GA 1W6NA 5C6CA 3L2YA 5J3UA 1W0PA 4LBQB 4AK3A 2GC2A 2Y38A 2DCZA 1H8TA 1GLHA 5JWPA 1UCXA 2ZX4A 2PLV2 3ZVXA 3OBTA 2WT0A 3N7KA 1FOD1 3M3IA 3PVEA 3KGLA 2WZPP 3FLTA 3H0OA 1LU2A 4YVSC 5DUWA 3PHMA 1BBT2 5F1RA 4N90A 3GF6A 5LEJA 3LZZA 1H1MA 3H1MA 5K0UA 3MIHA 3ZFEA 3J8F3 3ZFFB 5H9RA 2BBVA 2ZGSA 1PGW2 1TMF2 2B39A 1D4M2 3IBMA 4Z2WA 2R042 1HX6A 4AWDA 4QT6A 1RUG2 2FHRA 3JCIA 4Y1VA 4BYYA 4Y1UA 4KGQA 5FLIA 2B5HA 2NPIA 1LRHA 3K48A 4IETA 2V5YA 1LULA 2QKDA 2X53S 3WP6A 3IDCB 1BVVA 1FMD3 1QHDA 2FMDA 1MS4A 4RS5A 4IV1A 1Q8VA 3VN4A 5C33A 3QH6A 1VP6A 4R9DA 2B42B 1AJKA 4ES8A 2WQ4A 1ZZCA 4R8HA 1QKQA 3D8CA 5KHIA 4YFWA 3ATGA 1QJY3 4ZU4A 5E88A 2BVBA 4A7YA 4FAHA 4Q4X1 5C8WA 3RPQA 2HWB3 4HKLA 5AC91 3J8F2 3P3PA 1LHUA 4XF4A 4GXLA 1KS5A 4UBHA 3PMEA 1I9RA 3OJBA 1ZREA 3QOPA 5DG1A 4YG3A 5FLHA 4EJRA 4K6BA 1QQP3 2WFF1 2DTYA 4NHMA 4BH9A 1W6NB 1M4WA 1D0HA 3RS6A 4DOUA 2RR11 1Q5OA 4MVTA 1KXGA 1X8MA 2XB6C 2ZAAA 2CL2A 3MIBA 1FMD2 1VAMA 4OUSA 4FPJA 4PIXA 2VPVA 1BQPA 4Q2FA 3RYPA 3VHPA 2Q8OA 1C28A 3POSA 2IXHA 4C91A 2EAAA 1CPMA 1CESA 2O8OA 3AXEA 1YFWA 5T52A 2XUMA 1APNA 3ALQA 5FPZA 3IDEA 2ZGOA 4S2GA 1ZBE3 4QPGA 1QJY2 4RHV2 2YZ4A 1S0CA 1ENQA 3ZXLA 1WW4A 1C57A 4Q4W3 2N7GA 5I0RA 5GLWA 3H3UA 3ZFEB 5K0UB 3HT1A 3PVOA 1O3RA 3B69A 2WNVB 1EPWA 3GZTB 4ASMB 2RMU3 4Z8BA 4W6XA 4YM0A 5B2GB 4EN7B 2XJRA 1LOGA 1QQP2 2VW1A 4RS5C 4Z82A 1AL0G 3G6JB 4LO8A 2A5ZA 1WCSA 4AEDC 1C5HA 1PIV3 1C3HA 2G9GA 1DQ0A 1TE1B 4L97A 3K51A 3WCSA 4JRLA 5T5PA 5AVAA 5D8AB 5GLUA 2IC1A 2HWE1 2WT2A 4GH4C 3SCHA 3WDWA 4YM1A 2ZCWA 2EIGA 4GKYA 1UZYA 1IGOA 4JAAA 1CJDA 4TLFA 1QNYA 3HR9A 1REEA 4DPNA 1BK1A 1ZBE2 2DCYA 1S2BA 4DRRA 1LECA 1QOSA 2E63A 4WVMB 4QQLA 1OLRA 4K21A 3IWZA 2HWC1 2BEOA 4Q4W2 2ZGNA 4XOGA 2RMU2 4AHWA 1VBE3 4Y1ZA 1U5XA 2PAKA 3UKNA 1RUI3 2JECA 2HWD1 2PHTA 2P34A 3ME2A 3S7EA 5T5JA 4FBFA 1I6XA 4IV3A 4V1PA 2BPA2 2C5DA 3URFA 4AVTA 4LLFA 1ZM1A 2ZHMA 1RUH1 1CVNA 1PIV2 5BUVA 1WCKA 1WUVA 1J3QA 2H6BA 3H1YA 4G9SB 1QF3A 4QPGC 2LM3A 4LUMA 1G9DA 5GALA 1QJU1 5T50A 3AYCA 4BMEA 2PHXA 4AQTA 5CFCA 4AGVA 5ACA3 3ZIXA 1A6CA 3OD0A 4YFZA 2W39A 2ZZJA 1J1LA 5F6LB 1RUE1 2ETEA 2EXHA 2R0HA 3MLLA 3N7JA 5GM0A 3VBSA 4ISQA 2OYZA 1E57A 3MYXA 1WD3A 1O3SA 4FPEA 4KWLA 5DZFA 1AVBA 4IXLA 3B9CA 1VBE2 4JGZA 5J48A 2VULA 2D40A 4KQ7A 2Q1ZB 4N43A 1IKPA 1RJ8A 4EN6B 5KBFA 4KG0A 2LTNA 2NQYA 4N53C 1ULGA 4WM7A 1AX2A 4Y24A 2DUQA 5JOXA 1NCQA 2CY6A 3B3QE 4FPLA 2AZ5A 1QDCA 2WFPA 3JQWA 4R4XA 1U0AA 3FFZA 1WLDA 2XBO1 1XU2A 2YC0A 3LCPA 3MEPA 2ZGKA 4M01A 1UZZA 4DB5A 1WLWA 2YPJA 4XTMA 4NVPA 3H1WA 1OPMA 3O14A 4KWJA 1LB2A 4XXPA 4RQPC 3JD73 2O1QA 4XQDA 3A0KA 2GMPA 4W6YA 5ACA2 1HXS1 3WLUA 5JSOA 5I91A 2ILMA 4Q4X3 4IEXA 5CNAA 3SCGA 4B7EA 1AX0A 3WG1A 4LEJA 1LOBA 4OI4A 2G9FA 3S7IA 4LBKA 3UK9A 1YFUA 3LOBA 5JPMB 2X8KA 1LHWA 1MACA 1RJ7A 4IV3C 4Y1YA 2D3SA 2KXLA 3QBQA 2DCTA 3KGZA 2WFF3 4MZUA 1HRV1 2A73B 3ZSLA 3D4KA 3VDDC 2D3RA 4XMIA 5AVPA 2JG8A 1LENA 4CP0A 4GKXA 2PHUA 3AYEA 1N3QA 2A70A 2E53A 1S2KA 1HQNA 5CFCC 1OQ1A 4I0AA 3VBOB 1AR83 1MQTC 1XXNA 2ZHLA 2JEMA 2B8MA 3JD72 3AP9A 4COYA 2ZMLA 5E1RA 3DGTA 1V6IA 2XLFA 5JI7A 3VBFA 3WR0A 5H9PA 2XVKA 2DVAA 2HWF3 2V09A 3ENRA 3MZHA 4Q4X2 1PNGA 4RSUA 2W52A 4N43C 3TN91 3M4FA 4Q0VA 3VBSB 1RUF1 3M70A 1D2SA 4AVBA 1PVXA 2WSUA 1JH5A 2YMZA 5K7PA 2XKPA 2AUYA 4JGZB 2WFF2 3WNXA 3D82A 3Q9OA 4AHXA 1OOPC 3BTAA 3MW3A 4EN0A 1SDWA 4WM7B 2IXKA 4IEOA 5EJ3A 1NCQB 5T3NA 4I0BA 1AHSA 4AI1A 1RVF1 3NV4A 5HI0A 2AH2A 2XWBB 5FO8B 2A3XA 5HBAA 1ALYA 4PDWC 3AP7A 5EFUA 1AR82 4M0HA 5DUUA 4AYUA 3B00A 2IXJA 4PQ9A 4YW3A 2VMIA 1WBLA 4B4QA 1AYN1 3V56A 2UY9A 2HWF2 2HWC3 1X8EA 5L7OB 2QUOA 2QVSB 2VQAA 1S0FA 1PMIA 4FPFA 1LHVA 2BTVC 1W6OA 3CJXA 4OI2A 2PLV1 1Q8SA 1URXA 2Q5TA 3SH4A 1SBFA 3USSA 1ENXA 3WQ7A 1U12A 5K9YA 5DDJ1 4MGKE 1Q43A 3VHRA 4B7KA 3AMMA 1RUH3 3FJSA 4K3UA 2JG8B 5DZEA 3LOIA 2YUEA 4JRAA 3R6SA 1UIKA 1POV3 4P14A 3FLRA 4M3CA 2NMNA 1VIWB 1QJU3 1TMF1 3R05A 1D4M1 2YHJA 2R041 3ILFA 5JIAA 3M3QA 1RUG1 1UKGA 1RUE3 3VBFB 3AMHA 4XJWA 2HWC2 4NR1A 1HV1A 2GC1A 1MEC2 3J26N 1V00A 4AFBA 4CDWA 2X29A 4WM8C 5AFEA 1GZ9A 5KXBA 1HIXA 2WC2A 3VZNA 1EPZA 1OQDA 1IKQA 1NA1C 2ET1A 3VZLA 4CP2A 2EXKA 3QD6A 3AP5A 2D93A 4A3XA 1LODA 4H3WA 3PTYA 5GZEA 4XHBA 1LHOA 1RUH2 2WINB 3ZXFA 2A75A 4R9AA 2ZS6B 4FOWA 4GALA 4RR3C 4KU7A 4DMIA 3MF9A 4WV8A 1ND2B 3J8F1 5FCCA 2D6LX 1KQRA 3ELNA 5JIUA 1U5YA 1QJU2 4XFCA 5D1IA 1XRUA 5I8SA 3WG3A 3TB0A 1HXS3 1RHI2 4I0WB 4YYOA 2KA3A 1G86A 3WDTA 4PLMA 4E4ZA 4Q4V1 1RUD1 1H2NA 2VU9A 1RUE2 1DGLA 1WLCA 3A0NA 2D98A 2DFCA 4QM9A 3HIFA 1PM7A 1VBD3 5J09A 4UXAA 3NAPA 4WZCA 1KFXL 2ZBJA 1FMD1 2CGOA 2D7FA 1DYPA 1CPNA 1DZQA 4B8EA 4A7ZA 1V6JA 1UF2C 3BALA 5CVRA 3TYJA 1CAUA 4CDUC 4WBBA 2HYKA 3NV3A 2GH2A 2WNUB 2XGXA 4CEYC 1O4TA 1ZX5A 1Z78A 3E6DA 5BNPC 1NYWA 2ZACA 4RHV1 1FNZA 5LK5A 1OHFA 4QX5A 3UV9A 3KCXA 4HN1A 2VGDA 1Q3EA 2P17A 3BB6A 5DUXA 1CR7A 2Z5WA 4YZ2A 4PLOA 3ZSJA 1PGL2 5IK4A 2D5HA 3WDVA 1GZCA 2JD4A 4FCAA 3AZYA 1QQP1 1ONAA 3D0JA 3CNAA 3M8LA 1KS4A 1W6PA 2BQPA 2MHFA 4LBNA 4PBOA 4XIOA 4ZXKA 3E5QA 5A32B 1VBD2 2A6YA 1RUF3 2CYFA 2D5FA 5JAXA 1XNDA 2ARBA 2BYVE 1QY4A 4CDWB 2DU0A 4FSJA 3MFAA 4Y20B 1HW5A 2VNRA 2RE9A 3O0VA 2ZTNA 4URTA 1CAXA 5C8CA 2DURA 5BXXA 3AMNA 1V6NA 1R083 3CJIC 2YXSA 1ZBE1 3J9SA 5IUQA 4ASLA 1DZTA 3CO2A 2B46X 2QDNA 1TME1 3I7DA 3BU7A 4YVSA 3RI8A 4YZ1A 1KDKA 3ROUA 1WW5A 2VQ0A 3BPZA 4Q4W1 3VBHC 2GN3A 5FQ0A 2CAVA 5JOYA 1PNFA 3OYWA 3RYKA 1FPN1 3ES4A 4D7YA 2XWJB 2ZJCA 3NAPC 2Z69A 4XF0A 5GZCA 1AYN3 1QH7A 4HZFA 4EV0A 2OPKA 3WHTA 1JYIA 5FFOC 4MV2A 1HRI3 1DFQA 2JKBA 4QM8A 1AX1A 2FZ2A 2EXIA 4E2SA 2PQQA 1G9BA 2PAEA 4CDQB 2CGPA 3MPPG 2WIIB 4RL7A 3MGUA 4Q27A 2XJUA 4L9BA 1SEFA 1LKNA 5JLVA 1NE4A 1O3QA 4X8NA 5DDJ3 1NCRB 4MUVA 1GYKA 1AR91 1OLQA 1CAUB 1LOFA 4BM8A 2ZGLA 1BMV2 3ZN6B 3O7OA 2DF7A 4UW4A 4XQWA 1R082 4CEWC 4P9GA 1YNAA 2P2KA 1LTEA 1MS3A 2FQPA 3OCPA 1ZRCA 2LALA 1TQ5A 4Y5Z0 3VKNA 1OFSA 4LBMA 1VBE1 1AXZA 1AL23 1AYN2 2ZABA 4LBQD 2VMHA 2Z2SB 4FQ4A 1CONA 3WW3A 4DFSA 3MLKA 1MVEA 1VB4A 4J1XA 3N35A 1HRI2 2ATFA 4R9BA 3ZYRA 2I45A 1IS4A 3ZSMA 5C8CC 1XE8A 4LHLA 2XPJA 1YIFA 1BEV2 3AZWA 4GA9A 3OF1A 4PLNA 1VB2A 5DDJ2 1IS5A 3FWEA 2OIIA 3ZYPA 4YSFA 5ACA1 1CAXB 3AKPA 1SLCA 1CAVB 2B45X 3HQXA 4HK8A 1ZZ6A 4JTNA 2BWAA