1RUH3

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh300
1RUJ1 4QPIB 3VBRC 2WZR1 1TMF3 4GB32 4Q4Y1 1R1A3 1WCDJ 1PO21 5CFCA 1RUC2 1RUD2 5C8CA 4CDUA 1E57A 1VRH1 3JD71 2IZWA 1FPN2 2X5IB 1NCRB 4N53C 2MEV1 3TN91 1MEC1 4Z92B 1CD3G 3DPRB 1R1A2 5AC93 3LOBA 2RR12 2RMU3 4GMP3 3ZFEC 1H8TA 4QPGC 1PVC1 5ACA1 1QJX3 1ZBE3 5CFDA 5FMOL 3FBMA 2RMU2 1RVF1 1HX6A 1COV1 1VBC1 4RQPC 1VBB2 1ND3B 1AYM3 2XBO1 4CEYC 1B35A 1QJX2 4WM7A 3HAGA 1AR93 1HRI3 2HWB1 4RR3C 5GKAC 1QQP1 1FMD3 3JB4C 2PLV3 4Q4W2 4QPGB 2RM23 1RUG2 1EV11 4JGYC 4WM8A 1AYM2 4YVSC 1ASJ3 4RHV1 2HWC2 3NAPC 3VBUB 4GH4A 1HXS2 5JZGC 1RUH3 1AR92 1HRI2 3JB8A 1VBE3 5K0UC 2PLV2 3JBG3 4FTSA 1AL23 2R043 1PO11 1BBT2 2BUKA 4CDQA 2VQ0A 1ASJ2 1D4M3 1RUH2 2R061 1PIV3 3VDDB 4RS5A 2HWF1 4CEWB 1ND2A 1RMU2 3JBG2 1OHFA 1AL22 2HWE2 1TME3 1EAH1 1VBD3 1PIV2 1AYN1 1OOPC 5ABJA 1AR63 1R082 1Z7S3 2BFUL 4Q4X3 4IV1A 5A32A 5BNOB 1TMF1 3CJIA 5CFCC 4EJRA 5L7OA 1AR71 1VBD2 2TBVA 1NA1A 1NCQB 5C8CC 4CDUC 1AR62 4FSJA 2WFF3 3VBSA 3ZFGA 1C8M1 3ZFFA 2WS93 1PGW1 2HWD2 5AC91 1HQNA 1H8TC 2RMU1 4GMP1 1QJY2 1POV0 3VBFB 4GB33 1OOPB 4Q4V3 2WFF2 1RUC3 1HRV2 4CDXB 1F2NA 5CFDC 1ZBE1 3VBOA 1K5MA 1FPN3 4NWVA 5CFCB 1DDLA 2RS11 2WLPA 4CDWA 4N43A 5D8AB 4Q4V2 5C9AA 5C4WA 2RR13 1AR82 1B35C 4WM7C 1RUI3 1HRI1 4FTBA 1RUE2 5J96B 1FMD1 4PDWA 2PLV1 1BMV2 2RM21 1CJDA 4WM8C 5BNNB 1POV3 4AEDA 4GH4C 1RHI3 4JGZA 1RUI2 4IV3B 5A33A 4CEYB 1VBB3 1VBE1 1ZBA2 3VBRB 3JBG1 1PGL2 1AUYA 1GFF2 4Y4YA 2R041 1VBA3 3J8F1 4CDQC 4Q4W3 1RHI2 3M8LA 1D4M1 1R092 4RS5C 1RUG3 5DDJ3 1M06G 2WWSA 1NCRA 1ND2C 4N53B 2HWC3 5BNPA 1HXS3 2RS32 3DPRA 1VBA2 4WM8B 1TME1 2R071 3ZFEB 4GH4B 5LK7B 5DDJ2 5ABJC 1BBT3 1Z7S1 1NY71 1QJU1 4IV1C 4Q4X1 1OPOA 3CJIC 4YVWA 1PO23 4CDQB 5L7OC 1FOD3 1RMU3 1NA1C 3VBHA 4RQPB 4RS5B 2BBVA 1ND3A 2HWE3 1RUJ2 2DF7A 3JD73 3VBSC 2WFF1 3ZFGC 2WZR2 4Q4Y2 3ZFFC 1PO22 2WS91 1R083 3IDEA 4RR3B 1MQTA 1FOD2 4Y5Z0 1NOVA 1PVC3 4GB31 3JD72 4JGYB 3VBUA 4YVSB 1RUC1 5JZGB 3NAPB 2MEV2 1RUD1 3TN92 1MEC2 3VBOC 3CJIB 1K5MC 5K0UB 1FPN1 4CDWC 4N43C 5C9AC 1PVC2 5ACA2 1R1A1 5C4WC 2HWD3 2RR11 1QJY3 3VDDA 1RUI1 2HWB3 4CEWA 2ZAHA 1RVF2 1HRV3 4PDWC 1VB4A 1EV13 1PGL1 1W39A 2XBO2 4AEDC 4FTEA 4JGZC 1RHI1 5FOJB 2HWB2 1RB8G 2BFUS 1VBB1 1AR83 1QJX1 5BNOA 1PO13 1EV12 5C9AB 4RHV2 1RUE3 4Q4W1 1VAKA 1NCQA 5C8CB 1QJZA 1RUG1 4CDUB 1NCRC 1AYM1 5BNPC 2HWC1 1HXS1 1PO12 3DPRC 1AR91 1V9U3 4NWWA 2ZTNA 1ZBA3 1H8TB 1AYN3 3VBFA 1NG0A 2HWF2 1RUF3 1BBT1 2GH8A 4CDXA 1ASJ1 1RUH1 1R093 5CFDB 1X33A 1V9U2 4YVWC 1AR73 2BPA2 1EAH2 1FOD1 4QPIA 1RMU1 3VBHC 1AYN2 2FZ2A 2RS33 1AL21 5D8AA 1RUF2 1ND3C 2HWE1 2RS53 1VB2A 4RFT0 5BNPB 1B35B 1C8M3 4WM7B 1TMF2 1PIV1 1BEV3 2X5IA 1MQTC 1AR72 1R081 5BNNA 2RS52 3VBUC 1C8M2 1VBD1 4IV3A 1PGW2 4CEYA 4YVWB 1AR61 1BEV2 1RUJ3 5AC92 2RS13 5FMOS 3VBRA 2WZR3 3VBHB 4Q4Y3 1A6CA 2HWD1 1ZBE2 3VDDC 1QJY1 2FZ1A 4CEWC 1VRH3 1MQTB 4N53A 1ND2B 2RS12 1HRV1 2MEV3 3TN93 1MEC3 1AL0G 3ZFEA 4QPGA 1VRH2 5ACA3 5ABJB 4Q4V1 5J98B 1FMD2 1AR81 5BNOC 2RM22 4IV1B 5A32B 4SBVA 3J8F3 1RVF3 5L7OB 1COV3 1VBC3 1RUE1 1NCQC 1NA1B 1SMVA 4RQPA 1BMV1 1VBE2 2XBO3 3VBSB 4BCUA 2Y26A 3ZFGB 2R042 1V9U1 3J8F2 3ZFFB 1QQP3 4RR3A 2R073 1COV2 1VBC2 1D4M2 1ZBA1 3VBFC 4JGYA 1RUF1 4RHV3 1POV1 1F8VA 4CDXC 4YVSA 5JZGA 3NAPA 1QJU3 1X36A 1R091 3S6PA 2QQPA 3VBOB 1QQP2 1K5MB 1TME2 2R072 5K0UA 4QPIC 4CDWB 5D8AC 4N43B 2RS31 1VBA1 2RS51 5C4WB 1Z7S2 2R063 1NY72 1QJU2 4Q4X2 1IHMA 2HWF3 5DDJ1 4LLFA 2X5IC 1C8NA 3ZXAC 1BEV1 4PDWB 4GMP0 5BNNC 2XPJA 4AEDB 1EAH3 2GSYA 1RUD3 2R062 4JGZB 2ZZQA 4IV3C 5A33B 1OOPA 2WS92
chains in the Genus database with same CATH superfamily
1IQAA 4AW7A 2BWCA 4Y1ZA 2OIIA 4MX3A 3DV8A 2VTXJ 4LEJA 3NW4A 2WZR1 1TMF3 3AMNA 4UBGA 3H1YA 2OUJA 1WCDJ 2ZGPA 1DFQA 4AQTA 2A6XA 2C1FA 1W2AX 3SC7X 4CSWA 1EY2A 4EN0A 3AKTA 5CFCA 4UFHA 4JAAA 1NLRA 2D40A 1UY3A 4GQ7A 2BERA 4DFSA 3AC0A 1AXKA 2FDFA 3I3MA 1E57A 1VRH1 4EN9B 3OF1A 2IZWA 5HI0A 3HMYA 1GANA 5GZEA 2MEV1 4COUA 2XKOA 1CD3G 1R1A2 1Y4WA 2LROA 2L9LA 5AC93 3FX3A 2RR12 5EHDA 3FLPA 1H8TA 4AI8A 4EROA 4HKLA 1UOJA 4PLNA 3N9LA 1LOEA 2BWAA 2BNOA 3KZ4C 3P3NA 1DZTA 1YXWA 2VUJA 4A6OA 3DGTA 2BVBA 3OD4A 1NXMA 4YG0A 1H6YA 1RVF1 5FK7A 3LEMA 4OCTA 3WG1A 5FZ3A 1UY1A 1WMFA 2PHUA 2YGLA 4LBQA 3PUSA 1Q8QA 5LBFA 4CEYC 5J48A 2CDOA 4LO7A 1QJX2 4UFIA 4WM7A 5HV0A 4DS0A 4LKFA 2ZABA 1NZIA 5JVVA 5I0RA 4LT5A 1QQP1 4XFBA 1J1TA 1LOGA 5FUIA 1Q8VA 1K45A 2VZ3A 2IC1A 2YBPA 4GKXA 4W6YA 3NV2A 4HFSA 4LE4A 1YI7A 1LOBA 2XUMA 1UYPA 2JD9A 3NAPC 5FUNA 2QCSB 1UU6A 1RUH3 2VUAA 2BYVE 2JDZA 1NE6A 3JB8A 3URFA 3THDA 5BUVA 5JSOA 4FOQA 4OHVA 4I3GA 2A7AA 1KGYA 4LKSA 1IOAA 3ZOIA 1H2MA 1SPPB 1VMJA 2R043 3ACLA 1PO11 3SISA 2W95A 1BBT2 1QOSA 1VJ2A 1YIPA 4J1XA 4LMFA 3PVEA 2KR2A 1ASJ2 1W9SA 2JDUA 5KHGA 1O3SA 5DUWA 4AVAA 1FV3A 2QZ3A 2R061 3KF3A 3VZLA 4BZ4A 2C26A 5J3UA 1VMHA 4RS5A 3CJXA 2W5FA 4CEWB 1H2LA 4N90A 1W0PA 3J7HA 1A8DA 3MO4A 4XE9A 3G7DA 1H1IA 1GV9A 4JX0A 3FFQA 4LKDA 2JKXA 2W0XA 1QHDA 3SEEA 1O4YA 2CWSA 1TME3 1QJFA 1WD4A 2DU0A 4HETA 4K1ZA 4NAOA 1TEIA 4FPOB 4NPLA 5LWBA 2RDRA 1DHKB 5F5IA 2I07B 2E32A 2CGOA 1SFYA 5IW0A 4E4DX 4DRRA 3NNFA 3WW1A 3PUIA 2HEWF 4AGGA 2QJVA 5CEHA 1UX6A 3LF7A 4D94A 4XJUA 2JDPA 4P14A 5LB6A 2BJSA 1WLCA 3A21A 3AFKA 3WDVA 4EJRA 3C7OA 3EXUA 1V6IA 2FMDA 1AR71 1OFSA 1UKRA 4LO5B 1VBD2 2TBVA 3UYJA 5A3MA 5HCBA 1QMJA 2BGCA 3NL1A 4FSJA 2Q8CA 5FO9B 1BYHA 3ZPOA 3PMSA 1DLCA 3VD9A 2ZGSA 3RVHA 4XCAA 4OZXA 3NV3A 2AYHA 1GZ9A 3ZSJA 5A1FA 2A3YA 1Y9QA 3RMYA 4AVTA 3N3HA 4DUWA 3WD5A 4XHXA 1OQDA 3FLTA 2Y0IA 1POV0 4OZOA 4XFAA 2NN8A 1PNGA 1OOPB 5A1AA 3GALA 3ZYFA 1O4ZA 4CDXB 4Y5TA 1OKQA 3BVCA 3A23A 4IESA 3UETA 3VDAA 4QDQA 3I97A 3VBOA 3VHPA 1K5MA 1YYNA 5KHIA 5IVVA 2ZPXA 2A6YA 2W08A 3CL1A 5E16A 2XMLA 5C5UA 2UY8A 1I9RA 3D4KA 5C9AA 3E1F1 1QOTA 1WCUA 4CCJA 1UMZA 3CKHA 2RR13 2YFZA 1SG3A 4KWLA 4OMDA 4LLOA 4CP9B 2QQWA 3O0XA 5FLIA 4DY3A 5FPXA 1RUI3 3AZXA 1S0FA 5AVPA 1S55A 4FTBA 4BQXA 3MPBA 1D2QA 4AAXA 3VL9A 4HVOA 2O8QA 4OVEA 1W06A 4YW7A 2XLGA 3KT1A 1GP4A 2ZGOA 1W8ZA 3IMNA 4LHNA 5LA2A 2RM21 4CP2A 1CJDA 5A3TA 4RD7A 4IE6A 2ILMA 2Q1FA 3CNAA 3RS6A 4GH4C 4JRLA 4JGZA 5GLUA 3V64A 1PNFA 3WNPA 4P9YA 4UBHA 2OXBA 4GJZA 5A33A 3W21A 5IVFA 2EALA 2EXJA 3R4UA 1C1LA 2YHJA 1J1LA 4P5HA 2J1EA 3VBRB 4JDMA 3BUCA 1PGL2 3AP7A 2WJSA 1C3HA 2YZ4A 3HT2A 1VBA3 3LGRA 4CDQC 2ZGUA 5KHKA 3ZMNA 4PI2A 2P6CA 3CZJA 2BOIA 4I3PA 3WF2A 3R0RA 4CUCA 3GM8A 5FAXA 4X8NA 5B2GB 1V00A 3FHIB 1OURA 2PHRA 1X9TA 2VZTA 4AQ6A 5HXMA 4EQVA 5FFOC 1W8NA 2XVGA 2WWSA 4XJWA 1ND2C 4HN1A 1ONAA 4N53B 3HNBM 1JBCA 4O9GA 4ZKTB 5C8WA 3GZTB 5JSPA 4XF9A 4AFMA 5JAXA 1GOGA 3H8OA 2RS32 3AYAA 2SLIA 1ZX5A 4BISA 3GCWA 5IVCA 2R071 2VL4A 1DQ0A 3ZFEB 5LK7B 2ATFA 4Q0VA 3L2YA 5A3WA 2TNFA 4MYEA 1BBT3 1E5SA 2XL9A 1JZ2A 4AG4A 4N9HA 3CU7A 2B45X 4BB3A 3RZGA 4IV1C 3KV5A 2VULA 1DU3D 3NWKA 2QE3A 4PHZA 4P9IA 1PO23 3M4FA 4LBMA 4I02A 2IVIB 5L7OC 5GZGA 1NA1C 5FZIA 3MEPA 1VAMA 4U36A 4QD2A 2WNUB 1QXPA 4KWJA 1ENXA 3JD73 3VBSC 4B1MA 4QQPA 1PX4A 5JDBA 3DYPA 3T30A 1OC1A 5F2SA 4M3CA 5JXHA 4LA2A 2WS91 5FLJA 5E88A 3IDEA 5FRAA 4Y5Z0 1MQTA 1FOD2 2R1BA 1G86A 2UY9A 5FMDA 3C7HA 2VZPA 2ID4A 4QX2A 1PVC3 4GB31 2WL1A 2WINB 1AX2A 5JI7A 5FPBA 1FNZA 4QB2A 1AJKA 5C3SA 1RUC1 5CBLA 3RYRA 5JZGB 2BVVA 3CJIB 3LD8A 5A7SA 4NHLA 5K0UB 1FPN1 4CZSA 1W6OB 1DYPA 1SPPA 2GN3A 4N43C 5ACA2 2A6ZA 2VW2A 2WFPA 4LBNA 4ORFA 2Y38A 5FZ8A 5C4WC 1XE0A 2Y8KA 2WYSA 4XETA 5LW9A 4QGNA 3ROUA 3BODA 2HWB3 2QQMA 4CEWA 3T08A 3TEYA 3MV11 4X8PA 1S0EA 4O9EA 4AZZA 1QY4A 3R6SA 3WF0A 4Z8BA 3HIFA 1SCRA 1DYKA 1U5YA 2VECA 3J9SA 1PGL1 1W28A 1W39A 2CY6A 5JXIA 1AXZA 2XBO2 4FTEA 4XDOA 1WLWA 3WW4A 2JKBA 3HWJA 1QKQA 5FP7A 5KC5A 1HLCA 2J1UA 3S5QA 3D3AA 1RB8G 2XJQA 4YWAA 5I0DA 5BPXA 2D98A 1VBB1 1SFPA 2P2KA 3JQWA 5FREA 5FOBB 3M3QA 5EYXA 1FAYA 2DFBA 1SDWA 2JECA 4ARYA 4CCNA 1HB4A 2HYXA 5F5QA 2GAUA 2Q4SA 4LOSA 3X29B 1J3PA 2XJPA 2WC2A 4R52A 1MS1A 1WW7A 2Y33A 2YDEA 1YHFA 2ZX2A 3B9IA 5C8CB 4UFLA 1RUG1 2FDHA 3OPTA 4CDUB 4G9SB 2QQKA 2D5FA 3B5LB 1AYM1 1UQXA 5FZFA 2EIDA 3BKZA 3DPRC 1AR91 4NWWA 4U2AA 3WLUA 1BHGA 1ENRA 4B3NA 1YJLA 4B8EA 5DMYA 2FMYA 4OYUA 5I93A 2AH2A 2RG4A 4RYDA 1C5HA 2HWF2 5FYMA 4HVRA 1GQPA 1WW5A 1BQPA 2DTYA 3OYWA 2OUHA 3POBA 4AFCA 4CDXA 3O5SA 1KJLA 3WDWA 2P3YA 5CFDB 1S2EA 1WBLA 1V9U2 2JG8C 3IDAA 3P5BA 5LASA 5FMCA 3UKVA 3P6BA 1URXA 3SKVA 1F5FA 1DLLA 1FOD1 1SQ4A 4QPIA 3B93A 4XAEA 1RMU1 2VQTA 5DUUA 1PMIA 1AYN2 2MPFA 4A4AA 1W6NA 3A4UA 1AL21 2RS33 5EPAA 3RJ2X 1RUF2 4E2QA 4BK5A 2DUOA 2HWE1 2RS53 4HT1T 1OI6A 1V6OA 4XUPA 4CP9A 1PK6C 1YQ5A 4FQ4A 2B46X 2DYCA 4XHBA 3SNMA 1B35B 4XJAA 3OOXA 3ILFA 3SH5A 1PIV1 5B4XA 3T0BA 2JIGA 4IXLA 1Y7BA 1YNAA 2HKXA 4ET7A 4Q8LA 3VKLA 1JYTA 3MIDA 1K5JA 1UU5A 4P9XA 4A7ZA 4NRQA 3LA7A 1IS4A 1D0GA 2TUNA 4H55A 3VHRA 5KR7A 4MGQA 3MFCA 4K7JA 5EZWA 3H1MA 1C5IA 1PGW2 4KGQA 4Q2FA 4XF0A 4YVWB 4GZ9A 1BEV2 4HXCA 4GWNA 3B02A 5GM0A 3ZYGA 2OVUA 4KBBA 4CXYA 3N7JA 3D82A 2CHHA 5FMOS 5FIXA 3VBRA 3IMMA 4BHPA 5KXDA 3VBHB 4D6RA 3L9JT 1LGBA 4KBZA 3AL5A 2EXIA 3POIA 4A7YA 3W5NA 1JZ4A 1S2BA 2K2SA 4YGBA 1UZ0A 2CU5A 1H6XA 1WLDA 2Z5WA 2ET1A 3F2ZA 4FOVA 2HH9A 1KFXL 3I3QA 3VN4A 4BPZA 3TWIA 4FPGA 2BEOA 3N9MA 4CUAA 1LJ7A 4QX5A 3LE0A 3U4SA 4N53A 3MIGA 2VBDA 2RS12 1XE8A 1AL0G 1ODNA 2XL7A 4QT6A 4FAHA 3MLKA 3I54A 3OBAA 4CVUA 5CG8A 1YCIA 4NIIA 3PU3A 4NR1A 3ZFEA 4IE5A 4QPGA 4KQ7A 1YQ6A 4COVA 3J7LA 1MZ6A 3T2OA 3KWVA 2Z79A 5ACA3 4Q4V1 4META 2VMCA 2ET7A 2VMIA 1W6PA 1JZ6A 1O4TA 5T5JA 2VVFA 4QHBA 4DIQA 5A6XA 4JHTA 1ZRIA 2Q1ZB 1I5PA 2CWMA 2VMDA 5ANNA 3RNSA 4BQ2A 5DG2A 1COV3 4S2GA 1GUIA 3I59B 4R9BA 5BY5A 2WNUA 1S0DA 2JB4A 4FOYA 4J25A 1ZNPA 2XBO3 4M0NA 2VD7A 4LBOA 5ANQA 2AGSA 3ASIA 1PGSA 1C28A 1V6JA 3NNLA 1V9U1 3J8F2 3ZFFB 4CCDA 1MACA 1LOCA 2PA7A 1O91A 3K4ZA 1E5IA 1CPNA 1VBC2 5F5CA 1D4M2 2YC0A 3HOBA 3N9PA 3OSDA 3T1MA 1CESA 5F1RA 3TEZA 2ENRA 2ZHNA 4GKYA 4FO9A 3D6EA 1RUF1 4NIDA 1MS9A 1ZZ7A 1UY4A 2ZEWA 4WZFA 5JZGA 1QJU3 3AXDA 4PQQA 5EQUA 5FTTC 3WP3A 4CPBD 1R091 3AZVA 4FPHA 5GLWA 1OH4A 1T2XA 4GA9A 3H7YA 4FPEA 5ERLA 5LATA 5K0UA 2PYTA 3HQRA 1NZCA 4CU6A 4KU8A 1LHOA 2CNAA 4CDWB 5A6YA 4DMIA 1GNZA 3EHKA 5FZMA 1GNHA 4FXGB 2D44A 3WF4A 2DFCA 1W04A 2Q0AA 5FXWA 1Z7S2 1NQJA 1CAUB 2JE9A 4Q4X2 2EA7A 1JUIA 4XUTA 4BLJA 1F9KA 1KDKA 2HWF3 3I3EA 4QPYA 4KL1A 2WKKA 3IIAA 5GZFA 1BEV1 3AP5A 4GALA 2E7TA 3IZOA 1UYZA 5AFEA 4FQZA 3HBZA 1A8MA 4MXVA 4MGZE 2PFWA 5HCHA 4GWIA 2YUEA 5LBBA 2DBNA 2Y6LA 4H3WA 2GSYA 2J1VA 4ISRA 4XQDA 4M3CF 2BTVC 5DZEA 3BTAA 2CAVA 4LITA 4HSJA 4IE7A 5F3EA 3Q8BA 4OHWA 1RUJ1 5FZ0A 4A3XA 1PZ7A 4NROA 1HQLA 4DOUA 2QQVA 2X29A 3I2OA 1ODMA 2Q8DA 1RYYA 3MGUA 4Q4Y1 2QQOA 3WT3A 1LOFC 2P5BA 3E6DA 3R05A 1K12A 1RUD2 2VZ1A 1LNSA 4TWTA 2ZHMA 4CCCA 2RDNA 4QX7A 4XABA 3VHNA 5C8CA 3JXSA 3DEMA 3N9NA 4IEOA 4CDUA 2X5IB 4KGGA 4P08A 3KD4A 3TN91 3S5AA 4NJ4A 4X6QB 3TOJA 1XNCA 1LKNA 4XUQA 4GMP3 1XNDA 4TLFA 5JIAA 1DBNA 2JDHA 1GZWB 4IERA 2JG9C 4Z82A 3GYDA 2GNMA 1O8PA 5CFDA 2ADEA 2XVKA 4EN7B 5FMOL 2VG9A 3FBMA 5G05L 5IFTA 3B3QE 5FPUA 3MLLA 5HXVA 1VBC1 3POYA 1H8VA 2JXAA 5A3PA 2QZ2A 4OHZA 3WNKA 1I5ZA 3MIBA 4W4ZA 2D7FA 4FBFA 2PAEA 2JJ6A 5FZCA 2W94A 1LEDA 2VY0A 1UXZA 1B35A 3N7MA 4D0QA 1OH3A 3U10A 4N8MA 4MGSA 3ZXFA 3MLJA 3GCXA 4RR3C 4UWDA 5GKAC 3N9OA 1J83A 4Q4W2 1MR5A 3VZNA 3I2JA 3ZSEA 2VH9A 3FWEA 1EV11 4JGYC 4YLZA 4WM8A 3FUOA 5DUXA 1HV1A 1V0AA 4RHV1 2Y6JA 2HWC2 4YVSC 4E4HA 5JOXA 2PHLA 1XSRA 2R16A 4IEYA 5LK5A 1I3HA 4Q1RA 1UWWA 4ES8A 1ULGA 4BLIA 1XJAA 2G9ZA 2WIIB 2Y6FA 3DKWA 2KM2A 1KJRA 1DGWX 3FZ3A 1UXXX 4K40A 2BUKA 3WCRA 2LTNA 3D0JA 4B4PA 4QB6A 5JPNB 3KMHA 3ZXJA 4CU8A 1D4M3 4YRDA 1GLHA 1RUH2 4FAGA 3MW2A 4XDQA 4AVCA 5HCFA 4QXHA 3T2QA 2ZGNA 1JOJA 1YQ2A 5C3RA 2DUQA 3MV01 1N3QA 1IG3A 2WNVB 3BPSA 4IEXA 4XQ4A 1AHSA 2VZOA 3B94A 2RJLA 2AEZA 1W05A 3CIHA 4P00B 1EAH1 3WQBA 4BXSV 4WVWA 4TSVA 3MDPA 4W50A 4NRPA 1H4HA 3WVJA 3POWA 1AR63 4AI3A 3ZIXA 2YB7A 1BLZA 5C3QA 4JVAA 3FE5A 3KQ4B 1Z7S3 2KXLA 4Q0UA 4Q4X3 3TNPB 4C1WA 5C71A 1GWLA 5BNOB 4NHYA 3WHUA 1BZWA 1TMF1 3EMRA 4XDPA 1K42A 3MPPG 4S2FA 4E9KA 5CFCC 3MW4A 3CMGA 3UJOA 3ZKYA 3I59A 1IS3A 3HVDA 1JYXA 3H8XA 2WFF3 2R0HA 2CYFA 1DQ6A 4IW3A 3C7FA 3RWKX 2XOMA 1XSQA 3ZLIA 1DGLA 3H1WA 1C8M1 2D3PA 1SLAA 1LGCA 2OQ7A 4LIVA 2GMPA 4I2OA 3ZFFA 4URAA 5AC91 1H8TC 1DF0A 1HQNA 1Q8PA 3L2HA 4XZUG 5F32A 5FXVA 5C70A 5I91A 1QJY2 1LOAA 3VBFB 4NAMA 4I0BA 4AFBA 1CVNA 3V56A 1W8OA 5IVBA 5H9SA 1SEFA 1HRV2 3MIFA 3WZ1A 5FYCA 3TEWA 3H9AA 4JRAA 3K75B 1OXCA 2ZEXA 2OA2A 4JDNA 4W65A 4URTA 3VD4A 1JODA 3W20A 1IPJA 2DUPA 4HMZA 5HPOA 1OSGA 4CDWA 1XNKA 3PJYA 4Y20B 1PZ8A 5D8AB 4BQWA 3WSOA 4MXWB 4NIHA 5LCWL 1EP0A 2LRPA 3ZDVA 3V0AB 1OVPA 3GNEA 4WM7C 4NVPA 2XJRA 4E8CA 4HN0A 1UYYA 3OGRA 1Q8OA 4Y24A 4KMQA 3VZOA 1MS5A 1CAVB 1DG6A 2F4LA 1FXZA 4MG2A 5EJZB 4XTMA 4CCMA 3VUOA 1BMV2 4IEQA 1E5RA 2P4EA 5FYZA 3VZMA 5BNNB 4IEUA 3UNPA 1POV3 4MH0E 5IT6A 1RHI3 3OPWA 2J1SA 4YZ3A 2XB6C 2BZDA 5M0TA 1RUI2 3FMGA 4GAZA 4WVMB 3WDUA 1VPHA 3PLQA 3H7JA 3ZXGA 1HJFA 1NYWA 4XBLA 4AI9A 2FD8A 1ZBA2 1JI6A 1AUYA 2BW8A 1S0JA 1TQ5A 2R041 3CLPA 3MBWA 3O0VA 1PHMA 3KV6A 1QDCA 2VMHA 4UW5A 5DXDA 2OQ6A 4Q4W3 4AXOA 3M8LA 2RDQA 2WO2A 2XONA 1W8HA 2D6NA 4C1XA 5I0SA 2UYBA 4RS5C 5CAZA 5DDJ3 1F35A 3J4UH 3M3IA 1F15A 1OD5A 2QQLA 3AMMA 3LPFA 2HWC3 2AUYA 4I0AA 4ZY9A 5BNPA 4KWUA 1SDDB 3WUCA 2X05A 1KDMA 1VBA2 3KLSA 2EXHA 1TME1 3J26N 5IK7A 1FATA 4GH4B 5LA1A 2Z4FA 1Y3TA 3AB0A 4RGGA 2ORZA 5DPNA 1NAEA 1S0IA 1ENSA 4YW6A 1NY71 1RXGA 1OPOA 4QXKA 1LODA 3PL0A 4ZZ5A 2D6MA 1WLTA 2ZMKA 4CDQB 4JKKA 3WF3A 1N1VA 3ME2A 4RQPB 1RC6A 2ERFA 1EPWA 4LO4B 3K3OA 2R1DA 4AVSA 2DF7A 2HBUA 3C8XA 1UF2C 3ETQA 3DF0A 3ORJA 2DVFA 4DINB 5FR3A 1N1SA 4Y3OA 4Y5SA 3USUB 4NE9A 2UWCA 5IYYA 1Y9GA 1PO22 3ZXEA 4DRVA 4QB1A 1IZ3A 1KS5A 2DCYA 4RA0A 4BQ1A 1NOVA 3JD72 1GKBA 2VOWA 5DZFA 2K46A 4BQYA 3UV9A 5FY5A 2VPVA 1XNAA 3UT0A 1MEC2 4NN0A 2Z42A 4MV2A 5IAVA 3VBOC 3PUQA 2DVDA 1K5MC 3OG2A 3WQ1A 4H2AA 2AACA 3ZN5A 1ZA7A 2AREA 4I0WB 1V6LA 3J7MA 3U14A 5I0TA 5C9AC 1PVC2 2ZBJA 2W68A 1R1A1 5FY9A 1UOBA 2RR11 2JDYA 1QJY3 2V5DA 3UKNA 3WG4A 1RUI1 3ACIA 4YFWA 3VLBB 1GWMA 3NVCA 4BQ5A 2QDNA 3KQRA 4ONUA 4LUKA 4COZA 1ULOA 1HRV3 2W91A 1DZQA 2WNVA 3VHOA 2E31A 2JENA 4JGZC 1UZVA 1X7NA 2F6BA 2R32A 2XXZA 4Y1UA 3WDXA 2HWB2 5GZDA 2LM3A 1POQA 1T6GC 2YPJA 2ZEYA 4YM0A 2BFUS 5J37A 4LBLA 1ZZ9A 1XU1A 2WA4A 1QJX1 2LUWA 5BNOA 1PO13 1BJQA 4ARXA 1X82A 2UURA 2WO3A 4GWJA 3POSA 4LA3A 4V2WA 3ZXKA 4QHOA 3G6JB 4QWNA 1QJZA 3I2IA 2HLEA 4E27A 5A3LA 1JU3A 5FZLA 5DABA 3I3DA 3NRUA 4FPLA 1YFUA 2PAMA 2F4PA 2WBKA 2A6WA 3LOIA 4OI2A 2VUDA 4OUMA 4OMCA 5T54A 3GHNA 1ZBA3 2H0VA 4DEVA 3WQ0A 3K4DA 1HJGA 2XGXA 5EWSA 3VBFA 1H9PA 3OJBA 4A45A 3BIWE 4CP1A 5LEJA 1BBT1 3CHXA 3IPVB 2C9KA 2GH8A 2VMEA 1ASJ1 4FP3A 4QM9A 1G9DA 4XOGA 3RZJA 2C24A 2ZHLA 2DV9A 3MHZA 5KC6A 2QUOA 1AR73 2BPA2 2R30A 2XJVA 1CR7A 3U0ZA 4D6QA 4XIKA 5F2WA 1XQNA 4Y20A 5D8AA 2B4KA 2DURA 4MXWA 5IVYA 1EUUA 4B4RA 5FY7A 1RIRA 4P9GA 4ZU5A 3V0AA 1HN1A 1O5LA 2PAKA 4XJ9A 4CYDA 2VOTA 4XZPA 1UKGA 2WNOA 4XYXA 5EP9A 1MQTC 2EICA 4CA9A 4XPVA 2AR6A 3ATGA 1BVP1 1XBFA 1OFNA 1W8FA 1OQ1A 2GALA 2RJKA 2W39A 5F6KA 3WNNA 2JD4A 3PVBB 4ZU7A 1LCLA 3LQCA 5BNNA 2W1WA 2ZGLA 3NNJA 2D6OX 2RS52 1WCSA 3HD8B 5GLTA 1AZDA 2VTFA 1VBD1 4GXLA 4L0PA 2RV9A 4UXAA 1UZYA 4WVMA 4AOCA 2VO5A 4NPRA 5D21A 4YW3A 3U11A 3HT1A 1MS3A 2ZX4A 1FV2A 5A6ZA 3HQXA 3VDCA 1CAXB 2P1BA 2P17A 3SEPA 1REFA 3PDQA 4YGDA 1A6CA 2VNOA 5FLHA 1GU3A 1OA2A 2VOKA 4LULA 5CZKA 5SV5A 3AK0A 4AYUA 1XB9A 1ZBE2 3VZKA 5GZCA 3Q8CA 4NUBA 4CEWC 2YBKA 4XMAA 2CAUA 5FPAA 1W90A 3FHAA 4ZXKA 4M01A 2E7QA 3ST7A 1MEC3 4K8RB 4CUBA 1Q3EA 5FZ9A 3DUIA 4IQPA 1REEA 3UESA 4QXCA 2I45A 1XOYA 1W8TA 2D6PA 1WWYA 2XJTA 4WBBA 2GNDA 1BXHA 1H2NA 3NQHA 5FPZA 3BOPA 3A0KA 3E6BA 2CSGA 1DYOA 3NJXA 1F31A 4LORA 5ABJB 4QQHA 4ASMB 4YW4A 2A73B 4ISQA 4IE4A 3KCXA 1FMD2 4AL9A 3I49A 2BQPA 3KCYA 5FP3A 2O0OA 3I2KA 3PTYA 5FZOB 5T3NA 3THPA 4RQPA 1J3RA 2BRTA 1OBNA 2JX9A 1U0AA 2ZACA 4UW3A 1VBE2 5G04L 4CTEA 4N7UA 4EN6B 1ZZ8A 1GSLA 4TTGA 2ARBA 5FZAA 3VD3A 1TNFA 3ZFGB 3WUDA 5T5PA 3USUA 4EWDA 2IXIA 4XEZA 4LNVA 2VOXA 2DCJA 3UK9A 3ZYRA 2V4AA 4D7YA 2R073 4GD4A 4M3CE 1CIWA 3O1OA 1COV2 1LENA 1JS9A 1GZCA 4TXWA 4I09A 2J1RA 4AI2A 4BDVB 4F3JA 1C1FA 2ARAA 3C3VA 2Q8OA 3OGVA 5FY0A 3RG0A 1S0CA 4CP0A 2D43A 1H0BA 4CUGA 4CDXC 1ZZBA 4V2VA 3AP4A 1X36A 2Y64A 1N3OA 3LDKA 5A7NA 2QQPA 1S2KA 3O7OA 3A22A 2K9ZA 5D1IA 1HV0A 1ZYBA 1GMMA 2VXJA 4KG0A 4QPIC 1UL9A 1WD3A 4L11A 4F8AA 2D93A 2WT1A 2C5DA 3CO2A 3ZVXA 5FWJA 4L2NA 4O61A 3AM2A 3PUAA 1FNYA 2RS31 1DQ1A 3AVSA 2CDPA 3HNMA 5AVAA 3AP9A 4DUXA 5F7UA 2RS51 5I0UA 4LO6B 4PBOA 1J3QA 1RXFA 1QJU2 2QDRA 3ZSKA 1IHMA 1UN1A 5FXXA 3Q8AA 3LKJA 3H3ZA 4XFCA 2UWAA 1G9FA 5E1RA 4LLFA 5KHHA 4LTAA 3ZXAC 4PQ9A 4PDWB 5SV8A 3ZIWA 4AVBA 1U5XA 4MHUA 1X9PA 2XPJA 2NP0A 5FO8B 1H30A 4AEDB 1XE7A 2ZZQA 2ZAAA 5FYUA 4CCOA 3U78A 4ASKA 1OOPA 1O7FA 4FFHA 2VVEA 4HANA 2X8KA 4KWKA 4I30A 2NZ9A 3VBRC 5KHJA 3JQXA 5EYYA 3PIGA 1W99A 3M2MA 3KT4A 1O5UA 4IUGA 3EYPA 1K3IA 5GJ6A 1MPXA 2IVJA 1BKZA 4WZCA 3OY8B 3VDBA 1W0OA 4OHXA 3RI9A 3LDRA 2EAKA 2JDKA 3H42B 3FLRA 4N53C 1NCRB 3OTFA 3O1RA 3LB9A 2JB8A 5IK5A 3U75A 1QWRA 4IETA 4ZXEA 4MGIE 4PI0A 3VB9A 1APNA 3HQUA 4DY5A 1IQDC 3VKFC 4N7IA 2Q5TA 2RMU3 3ZFEC 4QPGC 1N1TA 1OA3A 1WGPA 2B9VA 4OULA 4EWEA 1G9CA 4OI0A 4QAWA 3NV4A 3LA2A 3SXWA 1UIKA 3IPVA 3QCWA 2VCCA 4AEKA 5ACA1 4OI4A 1TNRA 4JQRA 4Y1XA 4DZGA 1ZRRA 5FY8A 1ZBE3 3BTZA 3BN6A 3IM0A 3QH6A 3JZVA 3MIHA 2B9UA 3IAPA 1RTVA 5EFUA 2IXLA 2YY1A 3I3BA 5JOZA 2G9GA 4NO4A 4JDOA 1HX6A 1COV1 2Y6HA 5FYTA 5LBCA 3FN9A 2WNUC 3AKRA 3H50A 4HONA 2GMMA 1ND3B 5ISLA 1CWPA 1AYM3 3ENRA 2XBO1 2YROA 4O7XA 5FUPA 1JN2P 5A80A 5JLVA 1AR93 1HRI3 1VALA 4GIQA 3B01A 1EYBA 1LHWA 4QX0A 4WV8A 3FL7A 5F3IA 4QU1A 1FMD3 1DGWA 2PLV3 3LEIA 1SLTA 3HNYM 1IS6A 5BXXA 1JHJA 5LY2A 4DNYA 1Q8SA 1HIXA 4XUOA 3DCQA 1JYIA 3SCGA 3VBUB 5JZGC 1H9WA 3SMHA 1HXS2 4JTNA 3W9AA 4AR2A 5FYVA 4LBQD 4Y22B 4CCLA 2ZMNA 3IDCB 5EJ3A 1VBE3 3R4DB 5HCAA 2RJ2A 4GJYA 3Q8EA 5L9RA 5K0UC 1J58A 1KQRA 2R0FA 4OHYA 1SLBA 5LRRA 3GHMA 3JBG3 1WMEA 4P02B 4FTSA 1AL23 2YYOA 1UW8A 5FYIA 2OW4A 4XTPA 1LECA 2VQ0A 4DB5A 4YM2A 5FKBA 1OF3A 3OGSA 4XURA 3V0BB 2XUEA 2IXCA 3K77A 4QQLA 1MVQA 1PIV3 3VDDB 2VMGA 2HWF1 4LK6A 4BQ4A 5GALA 3WOGA 4TYSA 2VCMA 4YNIA 3EQEA 2XJUA 3TB0A 3AYEA 4J6GA 1WZXA 2VZUA 3O1VA 3P1IA 4FI9A 5T55A 2RHPA 5T5OA 5C6CA 3JUUA 2BBAA 4MADA 2JE7A 5F6LB 4AQSA 3NO8A 2ZOEB 4BJ0A 3MUY1 3VL8A 3WHTA 5F37A 1G7YA 1JYWA 2VZSA 1RUNA 1AYN1 5ABJA 5A6QA 2R49A 1R082 4AHWA 1W2TA 4A41A 4FPKA 3GF6A 5C7GA 4AGRA 4MGTA 1S0BA 1JZ8A 3B69A 1XYPA 3CJIA 1Z78A 4HBNA 4BIFA 1W6OA 1FI2A 1QH6A 1QNWA 4Y26A 4JCKA 1NCQB 4K6BA 2EIBA 2J1AA 1HW5A 3T0AA 4AWDA 4OFGA 5C8CC 3ZN4A 4CDUC 1AR62 2WA3A 1UY2A 1O6UA 2E6VA 3JCIA 3AL6A 2ZA9A 3ZFGA 2FCUA 3FC0A 1KFUL 3WXPA 4YGEA 4XBNA 2E53A 1PGW1 5CU1A 3TNQA 2HWD2 1G9BA 5FYSA 4ATFA 2YV8A 4GMP1 1UPSA 3M3OA 4V1PA 5A7PA 2OS2A 1MZFA 3INAA 4Q4V3 5TSWA 1MS8A 2WFF2 1XU2A 2MHFA 2XDVA 2VZVA 4XXPA 3I2GA 1HN0A 1QDOA 5CFDC 2GP5A 4F83A 5LEKA 4H7MA 3DXUA 4TZDA 4XW3A 5J1XA 4NWVA 2E63A 1XRUA 5CFCB 4L97A 2XKPA 1YC61 2VW0A 2RS11 1LHNA 1HQWA 2WLPA 4B29A 4FXKB 1JOBA 3SCFA 3GZAA 1SFNA 1O3QA 1VAVA 5FBZA 3C7EA 2C9AA 3NNMA 1AR82 3FHQA 1B35C 1HB3A 3VD5A 2KA3A 2ORXA 4PT6A 5FZ1A 2P6HA 1JXNA 5FKCA 1WKYA 5A33B 1HDKA 1RUE2 4QU2A 3ZXLA 4PDWA 3CEWA 2W47A 4W6XA 1UAIA 4Z1VA 3WCSA 1QGLA 4FVVA 5L19A 2K0GA 4WM8C 5F5AA 1ZRCA 2HYKA 2ZGTA 4AEDA 4XFIA 3T2PA 3RZZA 1XNTA 2J22A 4MHRA 1AJOA 3D0SA 1RJ7A 4IV3B 1ZRFA 1C57A 3PNAA 3MICA 4PF5A 4CEYB 4E4ZA 5JOYA 1CN1A 2Z69A 2BOJA 5FZBA 5C3OA 3WINE 2VOVA 2XVLA 3ZR6A 1IG0A 4Y4YA 1GFF2 5KWRA 5DZGA 2NMNA 3GZUC 3J8F1 4B7EA 5J09A 3HJRA 5L36A 4P5YA 1YLLA 3M7AA 4C8DA 4A6SA 1PX3A 4YYOA 1RHI2 1GQHA 3OY8A 1D4M1 5C3PA 1P8JA 4YZ1A 2ZX3A 1WCKA 1W0NA 4XF4A 2A70A 3RYPA 3T0DA 1NCRA 3APBA 1HXS3 3K2OA 2W2IA 4YARA 3EJKA 1CJPA 1G8WA 4QHZA 1W3VA 5FXZA 1WCQA 1UD1A 1VP6A 2OT7A 4XXAA 4NMIA 1UIJA 1LGNA 1OT5A 1ZA4A 2GU9A 3LIGA 4D69A 5DDJ2 4G3YC 2Q30A 5KBFA 3MZHA 4LUMA 3ACHA 1WW6A 3WP4A 3S30A 4XF1A 2OPKA 1Z7S1 2WSUA 4Q4X1 4CCEA 4NOTA 4D7TA 2Y34A 1UU4A 2VMFA 3DXTA 1QIQA 1QXRA 4YVWA 4OQ9A 1D4VB 4AVVA 2JE8A 5IK8A 3IT8A 2H6CA 4MGKE 1VR3A 2C0ZA 2ZHKA 3RQ0A 3VBHA 3BB6A 4RS5B 5JCTA 1ND3A 3MYXA 2IFWA 1F4AA 3SHRA 4A44A 2WFF1 4LHLA 4RL7A 2D5HA 1RGSA 2WZR2 2AZ5A 5APAA 4Q0QA 1WA6X 3ZFFC 3ZX7A 2D3SA 1DP0A 1R083 2ES3A 2ETEA 4KI5M 3W5MA 2WQ8A 2HJIA 2LS6A 2E33A 2XG3A 3GBFA 4ZS2A 3ZYHA 2DCZA 1XC6A 5T5LA 4A2UA 1LHVA 1JYCA 2F17A 2QVSB 3VBUA 2ADDA 2DCTA 3RDIA 3NAPB 2MEV2 1RUD1 1W6MB 1LU1A 2O8OA 4PLMA 4Y22A 3WNMA 1BK0A 1JHNA 3PVOA 3SITA 1E5HA 3MW3A 1PZ9A 1N1YA 3JU9A 3KT7A 3RSJA 1D7PM 2HEVF 3CDZB 4RGKA 4FP2A 5FCCA 5A7QA 1XPWA 1I1EA 1QH7A 4BMBA 4CDWC 2XQXA 3LA3A 4QM8A 1WUVA 2HWD3 2NPIA 2YC4A 3C2UA 1G6NA 3V0BA 1OLQA 4E4SA 4XFFA 5JXJA 2SBAA 4QX3A 3VDDA 4AK3A 1GZTA 2ZAHA 1RVF2 2A3WA 4Z07A 3KGLA 4B4QA 4OUEA 4ZHNA 1EV13 1F5JA 2EVXA 3NNGA 4BE3A 1C4RA 3RMXA 1PMHX 2VBBA 2Y6KA 2GP3A 4NPMA 3O1MA 1RHI1 4H7LA 4FPFA 1FYUA 4PF1A 2W1UA 2H6BA 4YM3A 3AYDA 1ACCA 3E5XA 4MGYE 2UWBA 1NLSA 2W87A 4N9IA 3EB7A 1VLNA 5FZ4A 1AR83 4PIYA 2WN3A 1G9AA 3WY6A 1OLME 4R9DA 4IEZA 1XYNA 3N36A 1KRIA 5C9AB 1M4WA 5CADA 1RUE3 4Q4W1 1VAKA 1W9WA 1NCQA 4Q26A 4UFKA 4L92A 1GBGA 3NJYA 3OCPA 1MS0A 2ZGQA 2JDAA 2ZJCA 1QU0A 5FZ7A 1MZ5A 4OI1A 1LAJA 5A7OA 5BNPC 3WW2A 1W2OA 1CAUA 1QOOA 2HWC1 4YFZA 4Q1PA 5L9BA 1PO12 2P37A 5KXEA 3AKQA 4XJ8A 3VD7A 3IDBB 3AZZA 4K8FA 4LHSA 2VJXA 4HZFA 3IIIA 2ZTNA 3MIEA 5DUVA 4B1LA 1W6QB 1CGPA 2XLAA 3E5QA 3KGZA 4QXBA 5GLZA 1NG0A 5IWFA 2X53S 2D97A 2VE1A 2WWUA 2Y6GA 1H1AA 4HPKB 4UAPA 1CQ9A 2ZS6B 1US3A 2JIJA 2VNVA 3LIHA 1RUH1 3DN7A 4XVHA 1PM4A 4AE2A 3O1SA 4G4FA 3ZDSA 4LK7A 4O65A 5CYYA 1RL3A 1VE0A 1YRZA 1VRBA 1DCSA 1GOFA 3RZLA 4ES9A 3IAQA 5H9RA 2CGPA 3OBRA 4MUVA 4IGPA 1N3PA 5DAWA 3WV6A 3N35A 1VB2A 3LZZA 1JZ3A 2CL2A 1C8M3 4QGLA 1X8MA 2FDJA 2VBPA 4NHMA 1AF9A 3BTYA 3QH7A 1V6KA 2A1XA 4FOWA 3SCHA 2X5IA 3AZWA 5FMBA 1AR72 3W58A 3ALQA 3BOWA 3IWZA 3KF5A 3MUZ1 3O1TA 2WLQA 1WA4A 4R4ZA 1VMFA 4LIUA 1GOHA 5L9VA 3THCA 4AFDA 4A7KA 2VTXA 4IV3A 3N7KA 3QLQA 4SLIA 5JI9A 5JXGA 1S4CA 1GZWA 4C0BA 4CEYA 4DXZA 3GBWA 3KVAA 3QBQA 3ES4A 4UFMA 3I2HA 1UYXA 4EZ4A 1SBFA 1ULFA 2WZR3 2G4IA 3ECQA 4Z2WA 3MF9A 2J1TA 3LSEA 2DVBA 4QQOA 3EO6A 4Q29A 4P9WA 3WDYA 4JQTA 1QJY1 2QFEA 3CBNA 4HK9A 4M3CB 1ULCA 1VRH3 4LQRA 3MF6A 3ZYJB 5JR7B 1MQTB 3ON7A 1ND2B 2ZKNA 2QKDA 5FPLA 2YPDA 1HRV1 2MEV3 1RUOA 3D5OA 3POFA 4DXSA 4P9LA 2WNVC 3GJBA 5DG1A 4QPWA 1WW4A 2G1MA 4BK4A 5LY1A 1BK1A 2R7EB 1LEMA 1IPKA 3ZXDA 4S2HA 3WF1A 4BM8A 3AJZA 3IB3A 4Q0SA 4AI1A 2BDRA 2PHXA 2WQ4A 2JICA 3S57A 1QJEA 2RM22 5BNOC 4IV1B 5A32B 2FDKA 4SBVA 3BYWA 1ULDA 1WMXA 4PJYA 1NX9A 1RVF3 3O1PA 5L7OB 1NA1B 1Q56A 5LBEA 1BMV1 1F4HA 3HN3A 3VKNA 2FDGA 3IN9A 4CPBA 3VBSB 1QXJA 1JW6A 2Y26A 3VGIA 1WBFA 1YWKA 1STMA 2ZXQA 3NMBA 1QQP3 3NJVA 2WZPP 2OKXA 2BU9A 2GH2A 1R1ZA 4DXTA 2RE9A 1ZBA1 4LO8A 3VBFC 3AFGA 2DDUA 2Q8EA 1GNYA 3TYJA 2WSVA 4ZPIA 4GWMA 4IEVA 4YGCA 1JUHA 2J42A 1F8VA 3NAPA 3KSCA 1W6MA 4HKWA 3U4XA 4XC9A 2LW8A 3HEIA 2V72A 2R072 3CF6E 2B39A 2QNKA 4M00A 5D8AC 1YFYA 4MLOA 4N43B 4C91A 3M3CA 3AZYA 5HV4A 1VBA1 1CZVA 4JHZA 5C4WB 3H0OA 5FY4A 5FYYA 3AX4A 2R063 1Y9MA 2WZEA 1NT0A 3I2DA 4FPCA 2UYAA 4IGOA 5E8AA 3ZYPA 5JR2A 2YXSA 2DTWA 2NQYA 3OGJA 1HB2A 3LDBA 2W3JA 3H3UA 2VZRA 2W1QA 1OKOA 5BNNC 2IWGB 1V6MA 1DGRN 2NYYA 3OYWB 4D6SA 3N4MA 4NIAA 3F95A 3HPNA 5H9PA 1OMIA 2VQUA 2KD7A 1W2UA 2WS92 2FCTA 1D2SA 4LJHA 1J84A 2HBTA 1SZBA 4QPIB 4YPJA 3WEZA 1WMDA 2D6KA 4UW4A 4ZONA 2GNBA 4PCRA 3UKTA 1W6NB 4GB32 4ATEA 1ZRDA 1R1A3 1KD7A 4BOWA 1ZREA 2BP6A 5A7WB 1L7RA 2BNMA 1PO21 4UW6A 4BQ3A 1RUC2 1X8EA 2E51A 3ES1A 3POGA 5DAXA 3RFRA 4M4RA 1RINA 2VM9A 3S7EA 3BCWA 3T3YA 1NLQA 3PURA 5FP4A 5FZGA 3JD71 1YO8A 3ZSMA 1FPN2 4BYYA 3KCCA 2Y60A 4YZ2A 2QBXA 2FHRA 5T50A 5CISA 2QQUA 1MEC1 4INDA 4Z92B 2YMZA 4E2GA 3DPRB 1JU4A 1CAVA 4EZHA 3LOBA 1UCXA 3IBMA 1W6QA 1ZM1A 5CVRA 3T1LA 2J7MA 1PVC1 5CB7A 4HPKA 4FFFA 5E89A 3BPZA 3BGAA 3GJAA 4C90A 1QJX3 3OPZA 2ZKLA 3WNLA 2BV4A 2YBSA 2JDMA 2JG8B 4MOAA 2YC2A 5JPMB 1OQEA 1YQ8A 4DXRA 2GC3A 2RMU2 1SBEA 1QF3A 5A3OA 4WVVA 5A70A 4RQPC 1AVBA 1ZZ6A 2O14A 2UU8A 4RSUA 3PIJA 1IS5A 5FPVA 1JOPA 3BU0A 4RN5A 1VBB2 5F3GA 1AXYA 4XUNA 5F9TA 3FJSA 3RGBA 1PVXA 4IDZA 1PK6B 1GR3A 1PMJX 3V65A 3LAGA 3HAGA 2EAAA 1OUSA 1AX0A 5DAQA 5FK8A 2HWB1 3NKTA 4KG8A 2ZGKA 4LBJA 4QX8A 3JB4C 2WN2A 4UF0B 4QPGB 2RM23 1KITA 3BI3A 1DIWA 2DCKA 1RUG2 2WNEA 3ZYBA 1ALYA 2VQAA 2OX0A 4CRQA 2PHWA 3H8UA 4AEJA 1AYM2 4LR4A 4MO3M 1W6PB 1ASJ3 5FJHA 4PBPA 3VV1A 4KH9A 4GH4A 3RZMA 3I7DA 1AR92 3POJA 1HRI2 1S0GA 3OBTA 4DUVA 1NUKA 2IUWA 2E26A 2VZQA 3PJQA 1SLCA 4Y33A 5C5TA 2ZX0A 2NMOA 2PLV2 4AGVA 1O3TA 4OQ8A 4K1YA 4R9AA 5IATA 2WO7A 2Y0OA 4E2SA 4CDQA 5E6HA 5IHRA 4P9JA 1CAWB 3ZPYA 3H3LA 2P3KA 2V4VA 5IJRA 2B7YA 2A6VA 1ULEA 3WP5A 4CXWA 3PMEA 3WQ7A 5IUQA 1ND2A 3ABZA 1RMU2 4BU2A 3JBG2 1OHFA 4FFIA 1AL22 4AEMA 5K9YA 1NKGA 2HWE2 2VW1A 1W3XA 2CTVA 4BA6A 4LE3A 4XCBA 2QQIA 1U5IA 1UO9A 1VBD3 1YEWA 2I2SA 4PLOA 4ZU4A 1J59A 1PIV2 1S1AA 2YU1A 1OOPC 5FZEA 2W1SA 3KS7A 3A7QA 5LRSA 4XF3A 1RJ8A 3R4SA 5CKNA 1DQ4A 2BFUL 3GBGA 4K3UA 4IV1A 5A32A 4AFAA 1LRHA 3GZEA 3LPGA 3UGGA 4UI9L 1IPSA 3ZSLA 5L7OA 4I01A 4JKMA 3CQOA 1NA1A 2VU9A 4Q27A 4Q5OA 4EE2A 3KV9A 3NSTA 2WZ8A 4YZ5A 5LA0A 3VBSA 4UYBA 4C0HA 2V73A 2EIEA 4QX1A 1UMHA 5IVEA 1Z0HA 1MS4A 2WS93 1JYNA 1I6XA 2RMU1 5CNAA 2XHKA 2G19A 4Q0PA 5D2AA 2WQZC 3NV1A 1O59A 4HKOA 2FBEA 4XAAA 1OLRA 2O1QA 4GB33 1ZZCA 1KEXA 4PIXA 2D6LX 1GP6A 2PHTA 1RUC3 4YM1A 2GZWA 1F2NA 2RDSA 3OGGA 3DL3A 1JYVA 2V09A 4NIGA 1ZBE1 2ZZJA 2G9FA 4CCKA 2VVDA 2W46A 1IKQA 1FPN3 4YSFA 5HBAA 1U12A 4XJZA 1BCXA 1GWKA 3MI8A 5FY1A 1DDLA 1TVGA 2ZCWA 4HSLA 3RZHA 4N43A 1TE1B 2W52A 3BALA 2PN5A 4FPJA 4Q4V2 3TBDA 5C4WA 3I4IA 1YQCA 4EYUA 3PVNA 3KV4A 2I74A 3LFIA 4EV0A 2WABA 1HRI1 1OF4A 1DZRA 4IE0A 2MNGA 3K46A 2YFUA 1GYKA 5J96B 1FMD1 2PLV1 2XH6A 1CIYA 1JMUB 4HL0A 5I8YA 3Q9OA 2HEYF 2FQPA 2PELA 2PHFA 2OZJA 5J7MA 1CPMA 3K4AA 1YFWA 2DWRA 1OD3A 4JZRA 2WWJA 1LULA 2XQRA 3U07A 1H1MA 2ARXA 3CZUA 1A78A 1VBB3 1VBE1 2C6SA 5EXOA 3K3NA 5LZ6A 3SH3A 2CV6A 4S2DA 3T4VA 3JBG1 1O3RA 4FT8A 5FDBA 4CU7A 5A7WA 4QGMA 1LTEA 4BMEA 1W9FA 1JTZX 1R092 3TRSB 3WX5A 4ASLA 1RUG3 5KXCA 5FZDA 2GC2A 3WG3A 1Y43B 1M06G 2GN7A 1A34A 3O12A 3AVRA 4QKFA 5BYNA 5EJ1B 4FFGA 4Y1YA 2A3XA 2DBIA 2ZMLA 3DPRA 4B7KA 4WM8B 3OEBA 2PQSA 4FPYA 3U37A 1REDA 2PMWB 3UGFA 5FQ0B 5JWPA 5F3CA 2IXJA 5ABJC 4AHXA 4AQ2A 4L99A 5AFBA 4W8JA 3RWNA 1HB1A 2JG9B 4OLLA 1SLIA 5JMOA 2FDIA 1H2KA 3PHMA 1QJU1 5H9QA 4TLGA 4NHKA 2TEPA 1YIFA 3CJIC 1US2A 2JG8A 5IK4A 2XHNA 1O8SA 4HVQA 1FOD3 1CAXA 4R8HA 1B09A 1RMU3 2N7GA 2WUHA 3KM5A 4XILA 5JUVA 2ZX1A 3AYCA 2BBVA 3N9QA 2HWE3 4XMIA 1RUJ2 3O14A 4OUSA 2XR4A 4Y4RA 4H14A 4ZZ8A 2IXKA 3MFAA 3OUHA 1PK6A 1ULPA 3RRDA 3ZFGC 2GMEA 3ACFA 4HOOA 4Q4Y2 1LESA 4LHKA 3O1UA 1LB2A 5FYHA 5T52A 3E5UA 4RR3B 1PM7A 4UF0A 1GQGA 5LA9A 5DQ0A 5JSRA 3WG2A 3IKWA 4QKNA 1OVSA 4XQWA 2IXHA 4FCAA 1LU2A 3RYKA 4QDRA 3BIEA 4JGYB 3RPQA 4RGAA 4JTOA 3WR0A 4YG6A 4YVSB 4QDSA 5J36A 4W6WA 1HKDA 1FX5A 2PTMA 4YZ4A 3TN92 2IFRA 1H4GA 5FZ6A 3U1XA 1VIWB 2E7AA 2FCVA 1U5ZA 5GLVA 5BNQA 2PXJA 4AF9A 5A3UA 4XIOA 2VCAA 4A42A 1R64A 2DVAA 3O0WA 4BH9A 2EF6A 1BVVA 2V5YA 5FBJA 3USSA 2W92A 4X6RB 4LOTA 2X10A 5FZOA 2WAOA 1CAWA 2VUCA 2LALA 1OA4A 3K51A 5FP9A 5IFPA 2Z2SB 3AP6A 3ZN6B 1RITA 2WYFA 1UY0A 2VR4A 3SQOA 2B8MA 1XNBA 5FP8A 4BWOA 3C7GA 5I8SA 3VKMA 4PDWC 1VB4A 3LSDA 2DU1A 2WR9A 4Q8KA 1DGRA 2P3IA 3VKOA 5B4NA 2PQQA 3WP6A 4AEDC 2QQNA 1XXNA 5FOJB 1UOGA 3WW3A 5I8TA 2QTWB 4WVZA 2Q1MA 1YUDA 1UX7A 5A1LA 5C33A 4D8MA 3OD0A 3S0MA 2JDNA 3ZR5A 1AX1A 3OB8A 4M0HA 2GNTA 3J7NA 2VC9A 4K21A 1EV12 1MVEA 3ILRA 4KU7A 4D7SA 4YW5A 3SKJE 4RHV2 1W9TA 4QKBA 4YW2A 3RI8A 1TZOA 1D0HA 3DKQA 1L7LA 1V70A 2VCBA 3S7IA 5FZKA 4COYA 1NCRC 3OUIA 1TG7A 1ZVFA 4D3WA 2VNRA 3OEAA 2BGPA 1YFXA 1HXS1 3ELNA 4CE8A 1UMIA 3RZKA 4YG3A 1V9U3 4PIZA 3AXEA 4DQAA 5JOWA 1ST8A 2P3JA 1OPMA 2P34A 2YGMA 2ZGRA 3POEA 4EN8B 2NM1A 2PHDA 4JV4A 1H8TB 4TN7A 5DN2A 3EBRA 1AYN3 5FO7B 5K4LA 3AJYA 2GDFA 4K9SA 1RUF3 3AKPA 3AMHA 4J1WA 3KHCA 3DYMA 2A71A 5F39A 3RJRA 4QQ2A 1W9YA 1R093 2XWBB 4MVTA 1X33A 4R4XA 1LR5A 1KS4A 1X50A 4YVWC 4XACA 1LHUA 3QD6A 1IKPA 4JKLA 3Q8FA 2ZEZA 4QKDA 3LWCA 1EAH2 4K20A 5CKMA 3WNXA 1SLLA 3VBHC 2FZ2A 1DQ2A 2WDBA 4HK8A 1ND3C 4DO0A 2A75A 3AMPA 4LBQB 4RFT0 5BNPB 3ETPA 4WM7B 1L3JA 1TMF2 3W59A 1W8UA 4IEWA 2JWPA 3TEXA 3QOPA 3LEGA 5FJKA 3ZYIB 1Q43A 1BEV3 5IAXA 5JMCA 1EPZA 1R081 2XWJB 1GP5A 4QMAA 2BNNA 1CX1A 2VXRA 4UOJA 3ITQA 1GICA 3ZKUA 4CXXA 4AHYA 2E9QA 1UOFA 1NXD1 5F8PA 1UNBA 5DAVA 2EXKA 2D3RA 3VBUC 5FYBA 2ZGMA 2YG0A 2XLFA 1C8M2 3M70A 5JIUA 4ITCA 4XFGA 1JZ7A 4MZUA 1W8WA 3SH4A 1AR61 1RUJ3 2A5ZA 1ENQA 1FT9A 2ARCA 4LXLA 5AC92 1CX4A 1JH5A 2RS13 4BXFA 4R9CA 5L73A 4HG6B 4Q4Y3 4L9BA 1LOFA 1SHWB 2VGDA 3FUQA 3FFZA 3LFMA 2HWD1 3GDBA 3ZO0B 1Q5OA 1W2NA 4A3ZA 4IL7A 3VDDC 2QQJA 4IGQA 1W03A 4BIOA 4Z2AA 2FZ1A 4L8QA 3PUHA 5FV3A 3NKGA 2AC1A 5K7PA 3K48A 4NRMA 3TN93 3WNOA 3SLIA 3GGLA 4E8DA 2WO1A 2VNGA 4AHZA 4AI0A 2X09A 1CZTA 3I8TA 3T09A 2B42B 5CA6A 5BV6A 1NE4A 3P3PA 1EUTA 5FQ0A 3M3EA 4GULA 3TAYA 1SACA 2EIGA 3B00A 3DECA 1VRH2 4UT5A 1JZ5A 1T6BX 4IEPA 4Y1VA 5J98B 2JG9A 3KVBA 1AR81 1N47A 3BU7A 2WAAA 4MSVA 4HLTA 3B7MA 4ZS3A 5KXBA 4CU9A 1IGOA 3J8F3 3HBKA 5EV7A 1NQDA 2VAUA 1VBC3 1RUE1 1NCQC 1SMVA 4DEQA 2OYZA 4F7ZA 3AKSA 3B9CA 4AAPA 3I2FA 4XFHA 3ILNA 3OUJA 3PTRB 3ACGA 4M4PA 4BCUA 2WRAA 2AENA 2CGNA 3T4HB 3M1HA 3NJZA 2R042 4UFJA 3DYOA 2BGOA 4EWAA 2RVAA 3GXUA 4RR3A 5K8SA 5EIYB 4RFRB 3THTA 2NLRA 1CONA 2AEYA 4COWA 1UZZA 1OUXA 4JGYA 3UJQA 1OLMA 4RHV3 1POV1 3AMQA 2R6QA 2YU2A 1L7QA 3FBYA 5DAPA 1MZEA 2XJSA 4YVSA 3ZMOA 2GC0A 1KXGA 1UZWA 3S6PA 3VBOB 1UPIA 1QQP2 1K5MB 1TME2 1CZSA 4LKEA 4LPLA 3WDTA 2GC1A 3LEKA 2DVGA 3N7LA 3KB5A 5A3NA 5IVJA 2WT0A 4KNCA 3A0NA 5FWEA 3HR9A 4YW1A 3UL2A 1A3KA 2OZ6A 5FZHA 5CIRA 1NY72 3ZN6A 4JC1A 1QEXA 3H8RA 3E6CC 2H0BA 5DDJ1 3UGHA 2WT2A 5CKQA 1YJKA 2X5IC 1C8NA 3HN1A 2OPWA 3ZM8A 1SBDA 3BTXA 2B5HA 1QNYA 4LBKA 3KHBA 4DPNA 3OBZA 1V6NA 4GMP0 4XBQA 3VZJA 3E97A 3QACA 2C4XA 3LCPA 2W9XA 4NHXA 1EAH3 1RUD3 1YI9A 2R062 4JGZB 1XYOA 4IV3C 2JEMA 5CG9A 3PU8A 3T2TA 3D8CA 1SCSA 1DQ5A
chains in the Genus database with same CATH topology
1IQAA 4AW7A 2BWCA 4Y1ZA 2OIIA 4MX3A 3DV8A 4LEJA 3NW4A 2WZR1 1TMF3 3AMNA 4UBGA 3H1YA 2OUJA 1WCDJ 2ZGPA 1DFQA 4AQTA 2A6XA 2C1FA 5CFCA 1EY2A 4EN0A 3AKTA 4JAAA 1NLRA 2D40A 4GQ7A 4DFSA 1AXKA 1E57A 1VRH1 4EN9B 3OF1A 2IZWA 5HI0A 3HMYA 1GANA 5GZEA 2MEV1 4COUA 2XKOA 1CD3G 1R1A2 5AC93 3FX3A 2RR12 3FLPA 1H8TA 4AI8A 4EROA 4HKLA 4PLNA 1LOEA 2BWAA 2BNOA 3KZ4C 3P3NA 1DZTA 1YXWA 2VUJA 3DGTA 2BVBA 3OD4A 1NXMA 4YG0A 1RVF1 3WG1A 1WMFA 2PHUA 2YGLA 4LBQA 1Q8QA 4CEYC 5J48A 4LO7A 1QJX2 4WM7A 4DS0A 2ZABA 5JVVA 5I0RA 4LT5A 1QQP1 4XFBA 1J1TA 1LOGA 1Q8VA 4GKXA 2IC1A 4W6YA 3NV2A 4HFSA 4LE4A 1YI7A 1LOBA 2XUMA 3NAPC 2QCSB 1UU6A 1RUH3 2VUAA 2BYVE 2JDZA 1NE6A 3JB8A 3URFA 5BUVA 5JSOA 4FOQA 4OHVA 4I3GA 2A7AA 1IOAA 1H2MA 2R043 3ACLA 1PO11 3SISA 1BBT2 1QOSA 1VJ2A 1YIPA 4J1XA 3PVEA 1ASJ2 5KHGA 1O3SA 5DUWA 4AVAA 1FV3A 2QZ3A 2R061 3VZLA 5J3UA 4BZ4A 4RS5A 3CJXA 4CEWB 1H2LA 4N90A 1W0PA 1A8DA 4XE9A 3G7DA 1H1IA 1GV9A 3FFQA 2W0XA 1QHDA 1O4YA 2CWSA 1TME3 1WD4A 4HETA 2DU0A 4K1ZA 1TEIA 4FPOB 1DHKB 2I07B 2CGOA 1SFYA 4E4DX 4DRRA 3WW1A 2HEWF 4AGGA 2QJVA 1UX6A 4D94A 4XJUA 4P14A 1WLCA 3AFKA 3WDVA 4EJRA 3EXUA 1V6IA 1AR71 1OFSA 1UKRA 2FMDA 4LO5B 1VBD2 2TBVA 5A3MA 5HCBA 1QMJA 2BGCA 3NL1A 4FSJA 5FO9B 1BYHA 3PMSA 2ZGSA 4OZXA 3NV3A 2AYHA 1GZ9A 3ZSJA 2A3YA 1Y9QA 3RMYA 4AVTA 3N3HA 3WD5A 4XHXA 1OQDA 3FLTA 2Y0IA 1POV0 4XFAA 2NN8A 1PNGA 1OOPB 3GALA 1O4ZA 4CDXB 1OKQA 4IESA 3VBOA 3VHPA 1K5MA 1YYNA 5KHIA 2ZPXA 2A6YA 2W08A 3CL1A 5E16A 2UY8A 1I9RA 3D4KA 5C9AA 1QOTA 1UMZA 2RR13 4KWLA 4LLOA 3O0XA 5FLIA 4DY3A 5FPXA 1RUI3 3AZXA 1S0FA 5AVPA 1S55A 4FTBA 3MPBA 1D2QA 3VL9A 4HVOA 2O8QA 4OVEA 2XLGA 3KT1A 2ZGOA 4CP2A 3IMNA 4LHNA 2RM21 1CJDA 4RD7A 2ILMA 3CNAA 3RS6A 4GH4C 4JRLA 4JGZA 5GLUA 3V64A 1PNFA 4P9YA 4UBHA 5A33A 2EALA 2EXJA 3R4UA 1C1LA 2YHJA 1J1LA 4P5HA 3VBRB 4JDMA 1PGL2 3AP7A 2WJSA 1C3HA 2YZ4A 3HT2A 1VBA3 3LGRA 4CDQC 2ZGUA 5KHKA 3ZMNA 4I3PA 3R0RA 5B2GB 5FAXA 4X8NA 1V00A 3FHIB 2PHRA 4AQ6A 5FFOC 2XVGA 2WWSA 4XJWA 1ND2C 4HN1A 1ONAA 4N53B 4ZKTB 1JBCA 4O9GA 5C8WA 5JSPA 3GZTB 4XF9A 4AFMA 5JAXA 2RS32 3AYAA 2SLIA 1ZX5A 2R071 1DQ0A 3ZFEB 5LK7B 2ATFA 4Q0VA 3L2YA 2TNFA 4MYEA 1BBT3 2XL9A 4AG4A 4N9HA 3CU7A 2B45X 4IV1C 3NWKA 2VULA 1DU3D 2QE3A 4P9IA 1PO23 3M4FA 4LBMA 4I02A 5L7OC 5GZGA 1NA1C 3MEPA 1VAMA 4U36A 4QD2A 2WNUB 1QXPA 4KWJA 1ENXA 3JD73 3VBSC 4QQPA 5JDBA 4M3CA 4LA2A 2WS91 5FLJA 5E88A 3IDEA 5FRAA 4Y5Z0 1MQTA 1FOD2 2R1BA 1G86A 2UY9A 1PVC3 4GB31 2WL1A 2WINB 1AX2A 5JI7A 1FNZA 1AJKA 5CBLA 1RUC1 5JZGB 3RYRA 2BVVA 3CJIB 4NHLA 5K0UB 1FPN1 4CZSA 1W6OB 1DYPA 2GN3A 4N43C 5ACA2 2A6ZA 2VW2A 2WFPA 4LBNA 4ORFA 2Y38A 5C4WC 4XETA 4QGNA 3ROUA 3BODA 2HWB3 4CEWA 4X8PA 1S0EA 4O9EA 1QY4A 3R6SA 4Z8BA 3HIFA 1SCRA 2VECA 1DYKA 1U5YA 3J9SA 1PGL1 1W39A 2CY6A 1AXZA 2XBO2 4FTEA 1WLWA 3WW4A 2JKBA 3HWJA 1QKQA 5KC5A 1HLCA 1RB8G 2XJQA 5BPXA 2D98A 1VBB1 2P2KA 3JQWA 5FREA 5FOBB 3M3QA 5EYXA 1FAYA 2DFBA 1SDWA 2JECA 5F5QA 2GAUA 2Q4SA 3X29B 1J3PA 2XJPA 2WC2A 4R52A 1MS1A 1WW7A 2YDEA 1YHFA 2ZX2A 3B9IA 5C8CB 1RUG1 4CDUB 4G9SB 2D5FA 3B5LB 1AYM1 3DPRC 1AR91 4NWWA 4U2AA 3WLUA 4B3NA 1ENRA 4B8EA 1YJLA 2FMYA 5I93A 2AH2A 1C5HA 2HWF2 4HVRA 1WW5A 1BQPA 2DTYA 3OYWA 2OUHA 4AFCA 4CDXA 3O5SA 1KJLA 3WDWA 5CFDB 1WBLA 1V9U2 2JG8C 3UKVA 1URXA 1F5FA 1DLLA 1FOD1 1SQ4A 4QPIA 3B93A 5DUUA 1RMU1 1PMIA 1AYN2 2MPFA 1W6NA 3A4UA 1AL21 2RS33 3RJ2X 4E2QA 1RUF2 2DUOA 2HWE1 2RS53 4HT1T 1OI6A 1V6OA 1PK6C 4FQ4A 4XHBA 2B46X 2DYCA 3SNMA 1B35B 4XJAA 3ILFA 3SH5A 1PIV1 4IXLA 1Y7BA 1YNAA 2HKXA 4Q8LA 3VKLA 3MIDA 1UU5A 4P9XA 4A7ZA 3LA7A 1IS4A 1D0GA 2TUNA 4H55A 3VHRA 3MFCA 4K7JA 5EZWA 3H1MA 1C5IA 1PGW2 4KGQA 4Q2FA 4XF0A 4YVWB 3ZYGA 1BEV2 4GWNA 3B02A 5GM0A 2OVUA 4KBBA 3N7JA 3D82A 5FMOS 3VBRA 4BHPA 5KXDA 3VBHB 3L9JT 1LGBA 2EXIA 4A7YA 1S2BA 2K2SA 4YGBA 4FOVA 1WLDA 4E27A 2Z5WA 2ET1A 4BPZA 1KFXL 3VN4A 3TWIA 4FPGA 2BEOA 1LJ7A 4QX5A 4N53A 3MIGA 2RS12 1XE8A 1AL0G 2XL7A 4QT6A 4FAHA 3MLKA 3I54A 5CG8A 1YCIA 4NR1A 3ZFEA 4QPGA 4KQ7A 4COVA 1MZ6A 2Z79A 5ACA3 4Q4V1 4META 2ET7A 2VMIA 1W6PA 1O4TA 5T5JA 2VVFA 4QHBA 2Q1ZB 2CWMA 3RNSA 5DG2A 1COV3 4S2GA 3I59B 4R9BA 5BY5A 2WNUA 1S0DA 4FOYA 1ZNPA 2XBO3 4M0NA 4LBOA 2AGSA 3ASIA 1PGSA 1C28A 1V6JA 1V9U1 3J8F2 3ZFFB 1MACA 1LOCA 2PA7A 1O91A 1CPNA 1VBC2 1D4M2 2YC0A 3T1MA 1CESA 5F1RA 2ENRA 2ZHNA 4GKYA 4FO9A 3D6EA 1RUF1 1MS9A 1ZZ7A 4WZFA 5JZGA 1QJU3 3AXDA 5FTTC 3WP3A 1R091 3AZVA 4FPHA 5GLWA 4GA9A 3H7YA 4FPEA 5K0UA 2PYTA 1NZCA 4KU8A 1LHOA 2CNAA 4CDWB 4DMIA 1GNZA 3EHKA 1GNHA 4FXGB 2D44A 2DFCA 2Q0AA 1NQJA 2JE9A 1CAUB 1Z7S2 4Q4X2 2EA7A 1JUIA 4BLJA 1F9KA 1KDKA 2HWF3 4QPYA 4KL1A 2WKKA 3IIAA 5GZFA 1BEV1 3AP5A 4GALA 2E7TA 5AFEA 4FQZA 3HBZA 1A8MA 4MXVA 4MGZE 2PFWA 2YUEA 4H3WA 2GSYA 4ISRA 4XQDA 4M3CF 2BTVC 5DZEA 3BTAA 2CAVA 4HSJA 4OHWA 1RUJ1 4A3XA 1PZ7A 1HQLA 4DOUA 2X29A 3MGUA 4Q4Y1 3WT3A 1LOFC 3E6DA 3R05A 1RUD2 4TWTA 2ZHMA 5C8CA 3VHNA 4IEOA 4CDUA 2X5IB 4KGGA 3KD4A 3TN91 4X6QB 3TOJA 1XNCA 1LKNA 4GMP3 1XNDA 4TLFA 5JIAA 1DBNA 1GZWB 4IERA 2JG9C 4Z82A 3GYDA 2GNMA 5CFDA 2XVKA 4EN7B 5FMOL 2VG9A 3FBMA 3B3QE 3MLLA 5HXVA 1VBC1 3POYA 1H8VA 2JXAA 2QZ2A 4OHZA 1I5ZA 3MIBA 4FBFA 2D7FA 2PAEA 2JJ6A 1LEDA 2VY0A 1B35A 3N7MA 3U10A 3ZXFA 3MLJA 4RR3C 5GKAC 4Q4W2 1MR5A 3VZNA 3ZSEA 2VH9A 3FWEA 1EV11 4JGYC 4YLZA 4WM8A 3FUOA 5DUXA 1HV1A 4YVSC 4RHV1 2HWC2 5JOXA 2PHLA 2R16A 4IEYA 5LK5A 4ES8A 1I3HA 4Q1RA 1ULGA 4BLIA 2WIIB 3DKWA 2KM2A 1KJRA 1DGWX 3FZ3A 4K40A 2BUKA 3WCRA 2LTNA 3D0JA 4B4PA 5JPNB 3KMHA 3ZXJA 1D4M3 4YRDA 1GLHA 1RUH2 4FAGA 3MW2A 4XDQA 4AVCA 5HCFA 2ZGNA 1JOJA 2DUQA 1N3QA 2WNVB 4XQ4A 4IEXA 1AHSA 3B94A 2RJLA 1EAH1 4WVWA 4TSVA 3MDPA 1H4HA 3WVJA 3POWA 1AR63 4AI3A 3ZIXA 4JVAA 3FE5A 1Z7S3 2KXLA 4Q0UA 4Q4X3 3TNPB 4C1WA 5BNOB 3WHUA 1BZWA 1TMF1 3MPPG 4S2FA 4E9KA 5CFCC 3MW4A 3UJOA 3I59A 1IS3A 2WFF3 2R0HA 2CYFA 1DQ6A 1DGLA 3H1WA 1C8M1 2D3PA 1SLAA 1LGCA 4I2OA 2GMPA 3ZFFA 5AC91 1H8TC 1DF0A 1HQNA 1Q8PA 3L2HA 5I91A 1QJY2 1LOAA 3VBFB 4I0BA 4AFBA 1CVNA 3V56A 5H9SA 1SEFA 1HRV2 3MIFA 3WZ1A 3H9AA 4JRAA 2OA2A 4JDNA 4W65A 4URTA 1IPJA 2DUPA 4HMZA 1OSGA 4CDWA 1XNKA 3PJYA 4Y20B 1PZ8A 5D8AB 4MXWB 1EP0A 3V0AB 3GNEA 4WM7C 4NVPA 2XJRA 4HN0A 1Q8OA 4Y24A 3VZOA 1MS5A 1CAVB 1DG6A 1FXZA 3VUOA 4XTMA 1BMV2 4IEQA 3VZMA 5BNNB 4IEUA 1POV3 4MH0E 5IT6A 1RHI3 4YZ3A 2XB6C 1RUI2 3FMGA 3WDUA 4WVMB 3PLQA 3H7JA 3ZXGA 1NYWA 4XBLA 1ZBA2 1AUYA 2BW8A 1S0JA 1TQ5A 2R041 3CLPA 3O0VA 1PHMA 5DXDA 1QDCA 2VMHA 4UW5A 4Q4W3 4AXOA 3M8LA 4C1XA 5I0SA 2D6NA 2UYBA 4RS5C 5CAZA 5DDJ3 3J4UH 3M3IA 3AMMA 1OD5A 5BNPA 2HWC3 2AUYA 4I0AA 3WUCA 1KDMA 1VBA2 3KLSA 2EXHA 1TME1 3J26N 5IK7A 1FATA 4GH4B 1Y3TA 3AB0A 4RGGA 1S0IA 1ENSA 1NY71 1OPOA 4QXKA 1LODA 2D6MA 1WLTA 2ZMKA 4CDQB 1N1VA 3ME2A 4RQPB 1RC6A 2ERFA 1EPWA 4LO4B 2R1DA 4AVSA 2DF7A 1UF2C 3ETQA 3DF0A 2DVFA 4DINB 1N1SA 3USUB 2UWCA 1PO22 3ZXEA 4DRVA 1IZ3A 1KS5A 2DCYA 4RA0A 4BQ1A 1NOVA 3JD72 1GKBA 2VOWA 5DZFA 3UV9A 2VPVA 1MEC2 4NN0A 2Z42A 4MV2A 3VBOC 2DVDA 1K5MC 3WQ1A 3ZN5A 2AREA 4I0WB 1V6LA 5I0TA 5C9AC 1PVC2 2ZBJA 2W68A 1R1A1 2RR11 1QJY3 3UKNA 3WG4A 1RUI1 4YFWA 3VLBB 3NVCA 2QDNA 3KQRA 4ONUA 4LUKA 4COZA 1HRV3 1DZQA 2WNVA 3VHOA 2JENA 4JGZC 2R32A 1X7NA 2F6BA 4Y1UA 3WDXA 2HWB2 5GZDA 2LM3A 1T6GC 2YPJA 4YM0A 2BFUS 5J37A 4LBLA 1ZZ9A 1XU1A 2WA4A 1QJX1 2LUWA 5BNOA 1PO13 1BJQA 1X82A 2UURA 3POSA 4LA3A 3ZXKA 3G6JB 1QJZA 5A3LA 4FPLA 1YFUA 2PAMA 2F4PA 2A6WA 3LOIA 4OI2A 4OUMA 5T54A 3GHNA 1ZBA3 2H0VA 3WQ0A 2XGXA 5EWSA 3VBFA 1H9PA 3OJBA 4CP1A 3BIWE 5LEJA 1BBT1 3IPVB 2GH8A 1ASJ1 4FP3A 4QM9A 1G9DA 4XOGA 2ZHLA 2DV9A 5KC6A 2QUOA 1AR73 2BPA2 2R30A 2XJVA 1CR7A 3U0ZA 4XIKA 1XQNA 4Y20A 5D8AA 2DURA 4MXWA 4B4RA 1RIRA 4P9GA 4ZU5A 3V0AA 1O5LA 2PAKA 4XJ9A 4CYDA 4XZPA 1UKGA 4XYXA 1MQTC 4XPVA 2AR6A 3ATGA 1BVP1 1OFNA 1OQ1A 2GALA 2RJKA 2W39A 5F6KA 2JD4A 3PVBB 4ZU7A 1LCLA 5BNNA 2ZGLA 2D6OX 2RS52 1WCSA 3HD8B 5GLTA 1AZDA 1VBD1 4GXLA 4UXAA 4WVMA 1UZYA 3U11A 4NPRA 4YW3A 3HT1A 1MS3A 2ZX4A 1FV2A 3HQXA 1CAXB 2P17A 1REFA 4YGDA 1A6CA 2VNOA 5FLHA 2VOKA 1OA2A 4LULA 5SV5A 3AK0A 4AYUA 1ZBE2 3VZKA 5GZCA 4CEWC 4XMAA 2CAUA 4ZXKA 4M01A 2E7QA 3ST7A 1MEC3 1Q3EA 3DUIA 4IQPA 1REEA 4WBBA 2I45A 2XJTA 2D6PA 2GNDA 1BXHA 1H2NA 5FPZA 3BOPA 3A0KA 3E6BA 1F31A 5ABJB 4QQHA 4ASMB 4YW4A 2A73B 4ISQA 3KCXA 1FMD2 2BQPA 3KCYA 2O0OA 3PTYA 5T3NA 3THPA 4RQPA 1J3RA 2ZACA 2JX9A 4UW3A 1U0AA 1VBE2 4CTEA 4N7UA 4EN6B 1ZZ8A 1GSLA 2ARBA 1TNFA 3ZFGB 3WUDA 5T5PA 3USUA 4EWDA 2IXIA 4XEZA 4LNVA 2VOXA 2DCJA 3UK9A 3ZYRA 4D7YA 2R073 4M3CE 1CIWA 1COV2 1LENA 4F3JA 1GZCA 4AI2A 4I09A 1C1FA 3C3VA 2Q8OA 3RG0A 1S0CA 4CP0A 2D43A 1H0BA 4CDXC 1ZZBA 3AP4A 1X36A 1N3OA 2QQPA 1S2KA 3O7OA 2K9ZA 5D1IA 1HV0A 1ZYBA 4KG0A 4QPIC 4F8AA 1UL9A 1WD3A 4L11A 2D93A 2WT1A 2C5DA 3CO2A 3ZVXA 4L2NA 3AM2A 1FNYA 2RS31 1DQ1A 5AVAA 3AP9A 2RS51 5I0UA 4LO6B 4PBOA 1J3QA 1QJU2 2QDRA 3ZSKA 1IHMA 1UN1A 3LKJA 3H3ZA 4XFCA 2UWAA 1G9FA 5E1RA 4LLFA 5KHHA 4LTAA 3ZXAC 4PQ9A 4PDWB 5SV8A 3ZIWA 4AVBA 1U5XA 2XPJA 2NP0A 5FO8B 1H30A 4AEDB 1XE7A 2ZZQA 2ZAAA 1OOPA 1O7FA 2VVEA 4HANA 2X8KA 4KWKA 4I30A 2NZ9A 3VBRC 5KHJA 3JQXA 5EYYA 3M2MA 3KT4A 1O5UA 5GJ6A 1BKZA 4WZCA 3OY8B 1W0OA 4OHXA 3RI9A 2EAKA 3FLRA 4N53C 1NCRB 3OTFA 3LB9A 5IK5A 1QWRA 4IETA 4MGIE 1APNA 4DY5A 3VKFC 4N7IA 2Q5TA 2RMU3 3ZFEC 4QPGC 1N1TA 1OA3A 1WGPA 4OULA 4EWEA 1G9CA 4OI0A 3NV4A 3LA2A 3SXWA 1UIKA 3IPVA 3QCWA 4AEKA 5ACA1 4OI4A 1TNRA 4JQRA 4Y1XA 4DZGA 1ZRRA 1ZBE3 3IM0A 3QH6A 3JZVA 3MIHA 2B9UA 1RTVA 5EFUA 2IXLA 2YY1A 5JOZA 2G9GA 4NO4A 4JDOA 1HX6A 1COV1 2WNUC 3AKRA 3H50A 2GMMA 1ND3B 1AYM3 3ENRA 2XBO1 2YROA 1JN2P 5JLVA 1AR93 1HRI3 1VALA 4GIQA 3B01A 1EYBA 1LHWA 4WV8A 1FMD3 1DGWA 2PLV3 1SLTA 5BXXA 1IS6A 4DNYA 1Q8SA 1HIXA 1JYIA 3SCGA 3VBUB 5JZGC 1H9WA 3SMHA 1HXS2 4JTNA 3W9AA 4LBQD 4Y22B 2ZMNA 3IDCB 5EJ3A 1VBE3 3R4DB 5HCAA 5K0UC 1J58A 1KQRA 2R0FA 4OHYA 1SLBA 5LRRA 3GHMA 3JBG3 1WMEA 4FTSA 1AL23 2YYOA 1UW8A 2OW4A 4XTPA 1LECA 2VQ0A 4DB5A 4YM2A 3V0BB 2IXCA 4QQLA 1MVQA 1PIV3 3VDDB 2VMGA 2HWF1 5GALA 3WOGA 4TYSA 4YNIA 3EQEA 2XJUA 3TB0A 3AYEA 4J6GA 5T55A 2RHPA 5T5OA 5C6CA 3JUUA 5F6LB 2JE7A 4AQSA 3NO8A 2ZOEB 3WHTA 3VL8A 1RUNA 1G7YA 1AYN1 5ABJA 2R49A 1R082 4AHWA 4FPKA 3GF6A 4AGRA 1S0BA 3B69A 1XYPA 3CJIA 1Z78A 4HBNA 4BIFA 1W6OA 1FI2A 1QH6A 1QNWA 4Y26A 4JCKA 1NCQB 4K6BA 4AWDA 5C8CC 1HW5A 4OFGA 3ZN4A 4CDUC 1AR62 2WA3A 2E6VA 3JCIA 2ZA9A 3ZFGA 3FC0A 1KFUL 3WXPA 4YGEA 4XBNA 2E53A 1PGW1 5CU1A 3TNQA 2HWD2 1G9BA 4ATFA 2YV8A 4GMP1 1UPSA 3M3OA 4V1PA 1MZFA 3INAA 4Q4V3 5TSWA 1MS8A 2WFF2 1XU2A 2MHFA 4XXPA 1QDOA 5CFDC 4F83A 5LEKA 4H7MA 4TZDA 4XW3A 4NWVA 2E63A 1XRUA 5CFCB