3L2HA

Crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
GMDTRKLLLTAQEISRMKGEHKVHFLNPGAVRVNKSLGDAVGLRHMGIHLIQIEPGKESTEYHLHHYEEEAVYVLSGKGTLTMENDQYPIAPGDFVGFPCHAAAHSISNDGTETLVCLVIGQRLDQDVVDYPNQHKRLYRNNGEWNLVDMADIRVLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative sugar phosphate isomerase
publication title Crystal structure of Putative sugar phosphate isomerase (AFE_0303) from Acidithiobacillus ferrooxidans ATCC 23270 at 1.85 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans
total genus 36
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3l2hA01
4UXAA 4META 2PYTA 3SCGA 3UKVA 4PJYA 2O1QA 2CAUA 4IEXA 4HN1A 1Y9QA 3G7DA 3H7JA 4IESA 2OPKA 5J48A 2ET1A 1Y3TA 1LR5A 2XKOA 1CX4A 4KWLA 3SXWA 3HQXA 1SQ4A 4HLTA 4UBGA 4HVOA 1RUNA 4DINB 5E1RA 4YNIA 1OFNA 3CJXA 2GZWA 5BY5A 5BPXA 4Q0QA 3S0MA 2QVSB 4Z82A 4MUVA 4LULA 4KL1A 2GAUA 4XF1A 2IXHA 4LUMA 4ORFA 4J1WA 5EZWA 5I93A 5E16A 4IEOA 2XL9A 4I0AA 1FT9A 3HT1A 2GC3A 2XKPA 1XE7A 1U12A 1XE8A 4BHPA 4OFGA 3I59B 3USSA 2PTMA 3IDCB 5EFUA 2H6CA 1RTVA 2UY9A 1DGRA 4AXOA 4IEZA 2BYVE 1ZNPA 2XL7A 3HT2A 4WBBA 3HIFA 4YARA 4KU7A 3D0JA 1LB2A 2HKXA 3IIAA 3CLPA 1DZTA 2H6BA 4FT8A 3VHRA 4I2OA 1X8EA 1O5LA 1X8MA 2PFWA 2XHKA 1QY4A 1CAWB 4XETA 4I0BA 3NJZA 4Q0PA 3OD0A 1EY2A 2BNOA 3OF1A 4QGLA 2QJVA 2WFPA 2Z69A 2BNNA 4IEPA 2V09A 1H1IA 3IBMA 2BGCA 1ZZBA 1V70A 1J1LA 2EVXA 2PHLA 4HZFA 1H1MA 4XF4A 5CVRA 3E5QA 3M70A 1O7FA 2VPVA 1I6XA 1NXMA 3I59A 2P17A 4O9EA 5I0RA 2XLAA 4BIFA 3BALA 4BH9A 2B5HA 2VECA 4MH0E 4D7TA 2E9QA 2MHFA 4A2UA 4MGZE 4EWDA 1X82A 3PNAA 3LWCA 3MPBA 4J1XA 3S7IA 1WGPA 4YYOA 1O3TA 2MPFA 2B9UA 1IPJA 1RGSA 1WA4A 1CAWA 4QGNA 4EWEA 1EPZA 3FX3A 4HBNA 3LA2A 4R52A 4XF3A 3SCHA 4WZCA 3NSTA 5JCTA 5K8SA 3M3IA 3BU7A 4B29A 2H0VA 1EP0A 5FCCA 1O5UA 3H7YA 4QXKA 1ZZ9A 2Q30A 1Q5OA 2FMYA 2IC1A 3TNQA 3GYDA 5KBFA 3FZ3A 3EO6A 1ZRDA 2XLFA 1UD1A 4Q29A 5I91A 4LTAA 3KMHA 1UPIA 2GC0A 2QNKA 3PVBB 1G6NA 3FE5A 3WW3A 5JSOA 1ZZ7A 3CL1A 3LOIA 1Q3EA 3H1MA 2KXLA 4BYYA 1GQGA 4GULA 4PIZA 3D82A 3IDBB 4D7SA 3RPQA 1QXRA 2DCTA 3H9AA 2D93A 3QOPA 5KHKA 2FQPA 3LA7A 2Q4SA 5I8SA 3D0SA 4X6QB 1QWRA 3ES4A 3UKNA 3RYPA 4HMZA 2K9ZA 3FWEA 1UCXA 4TLFA 2IXKA 4XEZA 4XFAA 4AVBA 1OI6A 3CF6E 3I54A 4Z07A 4XFFA 2UYAA 4H7LA 5C6CA 4JTNA 2GU9A 1UIJA 1EYBA 3JZVA 4JV4A 4IEVA 3MDPA 5BUVA 2EAAA 4E2SA 5I0UA 2EA7A 4O9GA 1RUOA 5FLJA 3RDIA 3EQEA 4I3PA 4XFHA 1LRHA 3RNSA 4FBFA 3OTFA 2VQAA 4KU8A 1PM7A 1CAVB 3LZZA 2D5FA 3WW4A 4Q0VA 2GH2A 4IEQA 2N7GA 4FAGA 2IXIA 3ROUA 4R8HA 5JR7B 4KWJA 2QDRA 2WC2A 2OA2A 3L2HA 1UW8A 3IWZA 1CAXB 1VR3A 3RZZA 3O14A 4XFGA 3MYXA 2PAKA 5BV6A 3RYRA 3H3ZA 3KGLA 1CGPA 5FPXA 3H8UA 4LLOA 1RC6A 2GC1A 3BCWA 5I0TA 5J3UA 1ZRFA 4MV2A 3C3VA 2OZ6A 3EHKA 2PA7A 4E2GA 4Q0SA 4AVAA 5FDBA 1ZRRA 3FJSA 3KCCA 2Y0OA 1OD5A 1J3RA 5LEKA 2B8MA 3DN7A 4L11A 4F7ZA 1YWKA 1O3QA 1RL3A 1J3PA 4HSJA 3UKTA 3KGZA 1YHFA 2CGPA 4PIXA 3QACA 1I5ZA 1J59A 3LA3A 4ZU7A 3EJKA 4HN0A 1CAVA 4IEUA 4MGIE 5JSRA 2PHDA 2UY8A 1O3RA 5FLHA 1YFYA 5D1IA 3E6DA 3ST7A 1JUHA 2OZJA 1TQ5A 4L2NA 4EWAA 1CAXA 2Z2SB 5FQ0B 4N9HA 1ZZCA 4N9IA 4AVCA 1Q43A 1XRUA 4LA2A 4YRDA 4ZU5A 2ZKLA 4K8FA 2O8QA 3TNPB 3MZHA 4ONUA 2D40A 3BPZA 3U0ZA 4NVPA 5BXXA 2C0ZA 4AQ6A 1YFUA 4IERA 3ACLA 4KWKA 5J7MA 3GBFA 3EBRA 4QM9A 1O4TA 4WVZA 1J58A 3U11A 2HJIA 4F8AA 2IXLA 5FLIA 3NW4A 3SMHA 4Q0UA 4UBHA 1L3JA 4FAHA 1OMIA 4XF9A 2BEOA 5JSPA 4LEJA 3NKTA 3NL1A 5KHGA 4XFBA 2I45A 4IETA 1CAUB 2D5HA 5FQ0A 3OCPA 4OLLA 5LEJA 1VP6A 2XGXA 5KHIA 1UIKA 3E5XA 1LKNA 4JTOA 3BB6A 4I09A 3S7EA 2PAMA 1YUDA 3WW2A 3H1YA 5I0SA 4MGYE 3ETQA 4RD7A 3FFQA 4MGKE 3LAGA 1NYWA 4CYDA 1QXJA 2GC2A 4JVAA 4HVQA 1NZCA 3R6SA 2XLGA 4EV0A 1VJ2A 3N4MA 4LUKA 4XFCA 5AVPA 1GQHA 3H1WA 4IEWA 1PMIA 4HVRA 3OGJA 5LRSA 5T3NA 1IPKA 3ES1A 5FPZA 1ZRCA 3I7DA 4MX3A 5F1RA 3B02A 1ZX5A 4PIYA 1CAUA 2Q1ZB 2ATFA 1NE4A 3DL3A 3E5UA 2OYZA 4I01A 2BNMA 1ZZ6A 1WLTA 1YFWA 1SEFA 3H50A 2ETEA 1FI2A 2QCSB 3RYKA 3NVCA 2PAEA 5CADA 2IXJA 3H3UA 4YSFA 1X7NA 3U10A 2IXCA 2UYBA 5KHHA 1O3SA 4I02A 4QMAA 5HI0A 3E97A 4EROA 2CV6A 3SHRA 4XFIA 5I8YA 1NE6A 3ZDSA 1DGWA 1HW5A 5KHJA 3FHIB 1FXZA 2CAVA 5JAXA 2K0GA 1ZVFA 5LRRA 3PLQA 5I8TA 1ZZ8A 3SCFA 4XF0A 3ELNA 4E2QA 2ET7A 3KSCA 1SFNA 3WW1A 3E6BA 3CO2A 2Q0AA 4QX5A 4ZU4A 5CU1A 3DV8A 4IEYA 2MNGA 2F4PA 3DKWA 4AQ2A 4QGMA 1DZRA 4MZUA 1YFXA 1YLLA 1J3QA 2PQQA 4HSLA 4P9GA 2ZCWA 3E6CC 3CEWA 1ZREA 4X6RB 5C8WA 4QM8A 4LA3A
chains in the Genus database with same CATH superfamily
2OIIA 2Q8OA 4META 1TMF1 2CU5A 2PYTA 2WNOA 2WR9A 4IE7A 4XABA 2VZUA 4CUGA 1DHKB 2R7EB 1VIWB 2O1QA 5CKNA 3OY8A 2IFRA 1T6GC 1WMFA 4Y4YA 3WHUA 4IEXA 4HN1A 1Y9QA 3G7DA 4FPJA 1HRI3 1Q8QA 2W92A 4ZXEA 1CX4A 2GDFA 4CEWC 2Z5WA 4OQ9A 4HLTA 4UBGA 1RUE1 5J37A 4HVOA 4DS0A 4SBVA 5DUVA 5TSWA 3ZN4A 4GB31 3I2HA 3MUY1 3OPWA 2RMU1 3KV9A 2GZWA 5BPXA 2ZACA 3DPRA 2QVSB 4Z82A 1QJY1 3AKSA 4N53C 4U36A 4CCEA 4KL1A 4AEDB 3HPNA 2GAUA 4WM7A 3Q9OA 4E8CA 4N43B 2P3KA 2RS32 5EZWA 2QQOA 5I93A 4YM0A 3VDDC 2RM21 1SZBA 2YC4A 4A6SA 1W6NB 4LOSA 3W5MA 1ZA7A 1GU3A 2J7MA 5CKQA 4OFGA 2W3JA 3VDCA 1BBT2 4DUVA 1XYNA 2VMGA 3OG2A 3USSA 3WSOA 2PTMA 3ZFFA 1YEWA 3ZXJA 4AI1A 1ZBA3 4HL0A 1XNBA 4NWWA 1C8M1 1RTVA 2UY9A 4AFCA 4D7YA 5JWPA 5F8PA 1W2UA 3B00A 3POFA 5ANQA 5FZHA 3U78A 4CUAA 2HWC2 4P02B 1AR81 2BOIA 2GNDA 3HIFA 4BU2A 4CP9A 4W6XA 5IYYA 1B35C 3IIIA 4ITCA 3CLPA 2QKDA 1RHI2 4FT8A 1W8TA 2HWD2 2C4XA 4DXZA 1X8EA 1X8MA 4YW7A 2PFWA 4YW6A 3LOBA 2JD9A 3SEEA 5KWRA 3AJYA 4RR3A 5IFTA 4XETA 4E4SA 3LFIA 4Q0PA 4YGCA 5LZ6A 3MLJA 3OD0A 1G9BA 2WSVA 4JRLA 1AYM2 4KBZA 2QJVA 2WFPA 1X33A 3ZN6B 3HAGA 3O1VA 3PUIA 4IEPA 3IBMA 4W50A 2WZR1 4CDUA 4E8DA 3DXUA 1XYPA 5EYXA 1HXS3 3JQWA 1RUH3 2ES3A 1A34A 1C3HA 1T6BX 2R073 1AR93 4DXSA 3A23A 1AR73 1UWWA 2PHWA 4RFRB 5D8AA 5FY1A 4M3CE 4UWDA 3RQ0A 4DY5A 2A6XA 3LKJA 1UX7A 3GZAA 4Q4Y3 1MS4A 3CQOA 3IN9A 4DB5A 3EB7A 3N7LA 4QKBA 1D4VB 3V0AA 1GV9A 2VOWA 4HKLA 4BH9A 4QPGB 5IW0A 4Z2AA 4YVWA 1C1LA 5C71A 2AEYA 1TME2 1WW7A 1UU5A 3C8XA 3CNAA 2PHTA 2ZPXA 1KITA 1JH5A 4FCAA 1X82A 2LALA 4K1ZA 4RS5C 2EICA 3WQBA 1YNAA 1JN2P 1RUG2 2JIGA 3LD8A 1IHMA 4DQAA 1RUF2 2L9LA 3GBGA 1CAWA 4QGNA 3AB0A 4Y20B 4EWEA 1LU1A 2JG9C 5CFCB 2TNFA 2NMNA 3T0AA 1W9FA 3I2IA 5FBJA 3VBRA 5FZLA 5C7GA 5FY5A 4HBNA 5EJ1B 5E88A 2A3YA 1KXGA 5FP7A 5F5IA 3LDBA 4R52A 4XF3A 3SCHA 3OSDA 4EE2A 5K8SA 1UY3A 3ZFGA 3FBMA 3QCWA 2AUYA 3AP6A 4YZ1A 2H0VA 1XNAA 5DAVA 4NIDA 1O5UA 2Q30A 2J1SA 3HNBM 1W2OA 3UNPA 1S0IA 2FMYA 4LBKA 1VRH2 2VU9A 5DUWA 3GZTB 3L2YA 3TNQA 2DCJA 3VHOA 4NPMA 2Z42A 1DGLA 1UD1A 1GYKA 5I91A 2VZRA 4KG8A 4LTAA 5FY0A 1WLCA 4D69A 1OBNA 4WZFA 3VD4A 2A7AA 2XR4A 3ZX7A 4FSJA 4HK9A 3UYJA 3WQ0A 3WX5A 1WW5A 4BK4A 4YZ5A 3SH4A 3RZMA 4MXVA 1NQJA 1QMJA 1FOD3 4JGZC 3AKPA 3WW3A 1K3IA 1W6MB 3H1MA 4AHWA 2AEZA 2A3XA 2KXLA 4BYYA 3W21A 1GBGA 1QQP1 1AJOA 3HNYM 2QQMA 3IDBB 3J7MA 4WVMA 2P4EA 4D7SA 2XBO3 4E4HA 3RZLA 4IE4A 1QXRA 2DCTA 1BLZA 1EV12 4LMFA 2VTFA 1ONAA 5FP9A 2WNVB 2C26A 2R30A 4RFT0 5DDJ3 1K5MA 2EAKA 1PO13 1RXGA 2OUHA 2QE3A 4QX0A 5I8SA 5CG8A 2O0OA 4X6QB 2D6LX 5LB6A 3ES4A 3NAPC 5GZEA 2YY1A 3UKNA 4HMZA 3ACIA 5JR2A 2DVFA 2K9ZA 4CPBD 2IXKA 4FPLA 4KGGA 4XEZA 2V5DA 2R062 4FFIA 3T0DA 2JDKA 2VL4A 2Q8CA 5C8CC 4AVSA 4JTNA 3O1PA 2VW2A 3OYWB 2PELA 4OI4A 2X05A 4IEVA 4MADA 2CL2A 4AFBA 5F6KA 2R043 1YC61 5JDBA 3SISA 1LCLA 4NRPA 4COWA 2ORZA 1JYNA 4BXFA 5KXBA 4PDWC 1AYN2 4UW6A 4W6WA 2GN7A 4NUBA 5JXGA 3GDBA 4OMDA 1KDKA 3ZIXA 1RUOA 1H8TC 1UU6A 2R0FA 1AR61 3I2DA 5DZGA 3RDIA 2FDIA 1S0GA 1Q8VA 5GLUA 4I3PA 1PGW2 2ZGQA 2Y34A 4FBFA 4ATEA 1REEA 2OPWA 4NR1A 3INAA 4NHLA 4Y5SA 3WD5A 3DKQA 1WCUA 1JZ5A 3BTAA 2D5FA 2PHUA 2DBNA 3QLQA 4JRAA 4CEWA 4CPBA 2ZGMA 4AI8A 5F3CA 3CU7A 2DCYA 5IFPA 2VNOA 4BOWA 2QQKA 1S55A 5BNQA 5F9TA 4KWJA 4JCKA 4XIKA 1VLNA 3RZHA 1VBD3 1CAXB 3WHTA 3RZZA 3O14A 5HXMA 3MYXA 4N53A 4QPYA 4A7KA 5A70A 3M8LA 5FPXA 1KRIA 1MQTB 1RYYA 2WFF3 1A6CA 4LLOA 3HVDA 5FAXA 3T30A 5I0TA 5FZGA 4OI1A 2LM3A 4JDMA 5JI9A 4XDQA 1C8NA 4YVSA 2OZ6A 3AYEA 4LE3A 4OULA 3KQ4B 3J7HA 3M3CA 1CQ9A 1F5JA 4FFFA 4OMCA 1XU2A 4PT6A 4Q0SA 2ZHLA 4FI9A 2RS31 4IL7A 4AVAA 4NHKA 4X8PA 1J3RA 1W04A 1CVNA 2NZ9A 4QPIC 4INDA 3IMMA 3GJBA 4DNYA 1O3QA 4Q4W2 5CFDB 1XSQA 4HSJA 4GWMA 1BBT1 4AGRA 4CDWA 5JI7A 4NIHA 4LHLA 3LEMA 1AXZA 3QACA 1DDLA 4CXWA 1UYZA 4P08A 4A4AA 2A5ZA 3LA3A 4JGYC 2VUJA 1B35A 3POBA 4JKMA 1UY1A 2YGLA 4N90A 3VKMA 4IEUA 5FZ7A 4MGIE 5JSRA 1W6QB 3T09A 4GMP1 2A6YA 3O1RA 4IV1B 2AACA 3N9PA 5BNOB 3P6BA 1D7PM 2IVJA 1X9PA 5DPNA 3ST7A 3ZKUA 2VNGA 2ARCA 1HN1A 1RHI1 1OH4A 4EN0A 3THCA 2HYXA 1G7YA 2GH8A 1UY2A 3WDXA 4EWAA 1FATA 1AJKA 2RDSA 3JD73 3ZVXA 3JBG2 4FVVA 3OD4A 1FYUA 5IAXA 3THDA 4YW1A 3ZSMA 4N9IA 3BTYA 1QJZA 1AYM1 4JDNA 4LA2A 1XB9A 3PTRB 4ZU5A 5J1XA 1BEV1 4AOCA 3ZSKA 2O8QA 1OQ1A 3ZO0B 5JIAA 2ZEYA 3BPZA 5E89A 2ZTNA 5ACA2 5A7NA 1BVVA 1LHUA 3ZOIA 1XQNA 5A32A 2XVGA 1HRV1 4NVPA 1HJGA 1HIXA 4S2FA 3VB9A 4BPZA 5LBFA 1SDDB 4GXLA 1U5XA 1KS5A 2RJLA 4Y1XA 3GBFA 2VZPA 4QM9A 1JOBA 1XBFA 4NMIA 2W9XA 4UW3A 3TBDA 5IHRA 1US2A 3VL9A 2RVAA 4CA9A 3UJQA 1GP6A 1AL22 1EUUA 1OH3A 1UKGA 1W8ZA 1WUVA 2IXLA 1PVC3 4FQZA 5C4WB 1NY72 3LSEA 4XJ9A 3R4UA 1Z7S1 3W20A 1ENRA 4GWJA 1TME1 2KM2A 3WLUA 4A7YA 4Q4V3 3H8XA 1ASJ3 3OGSA 4CU8A 5JSPA 3M4FA 1MEC3 3OBTA 3NKTA 3GBWA 2RDNA 5A1LA 3KM5A 3VHPA 1IS6A 2W91A 4U2AA 4Y1ZA 2Y6LA 2X09A 4OLLA 4XUNA 1TNRA 2JIJA 3ACHA 4C0HA 4HPKB 3VDDB 4YZ2A 1LKNA 1RUC3 1H1AA 2WNEA 1HQWA 2VCAA 2YGMA 1POQA 3B9CA 4CP1A 1QOSA 1F8VA 1UZVA 5F5QA 2PAMA 5FTTC 3J8F3 1V9U3 1YUDA 3MGUA 5FYCA 4E27A 1W28A 1BMV1 2B42B 4UFKA 4XC9A 1V6MA 2WBKA 2XUMA 2CY6A 4CCKA 3ETQA 1JU4A 1NYWA 4N8MA 1QXJA 1POV3 5AC91 1Q56A 4XQDA 4C91A 3RFRA 3URFA 1VRH1 1YQ5A 4JVAA 4AQSA 4HVQA 4QU2A 4FTBA 1QF3A 1ENXA 4N43C 3K3NA 4QPWA 4EV0A 2CWSA 2QFEA 3KB5A 4JGZA 4QXBA 3RJRA 3GHNA 4URAA 1NX9A 4DMIA 1C4RA 4XVHA 4Y22B 1RMU3 2ARXA 4XFCA 2P6HA 2VXRA 3H1WA 3K4DA 1JZ2A 1C57A 1OF4A 4HVRA 3HN1A 4QDRA 2WT2A 4C8DA 2Y6FA 4B1LA 3RZJA 1D0GA 3WUDA 1Q8PA 3NAPA 3B02A 3L9JT 4CE8A 2NN8A 1EV11 2ENRA 4PIYA 3VBUB 4DY3A 1CAUA 3K51A 2Q1ZB 4CU9A 5F39A 4DXRA 4KGQA 1KFUL 1YXWA 4FPEA 4OHZA 5C8CA 1FV3A 1WCSA 1W9YA 3VHNA 1W6PA 2E51A 1ULFA 4DOUA 5FOJB 2R061 3WQ7A 1SEFA 4B4RA 2ARAA 1WMXA 2DFBA 3H50A 5F5AA 4PDWA 4FXKB 3AVRA 2ETEA 5J96B 1YJKA 1H2NA 4HKWA 5JXJA 1QHDA 5A7QA 1H8TA 3LDKA 4MGSA 3NV3A 4O65A 2CDPA 5JZGC 1WD3A 1W05A 2PAEA 2WQ4A 4QDQA 3MW3A 4Z2WA 3BODA 3FUQA 4OUEA 3VKOA 4RS5B 4YSFA 1S0EA 3B93A 3C2UA 1TMF2 4PLOA 4AG4A 5KHHA 4I02A 1PGW1 1NCQB 4EROA 1PZ7A 2HH9A 3VZMA 1FNZA 2JG9B 2D98A 4XFIA 5K0UB 2WZEA 1O91A 4N7UA 5DUUA 4QPGC 1XC6A 1HW5A 4L97A 2ILMA 2LTNA 3USUA 3FHIB 4LORA 3SNMA 4D94A 1REDA 2FCVA 4RSUA 1ZVFA 2QZ2A 3S57A 5I8TA 2W1UA 4WM8A 3U07A 4XACA 4PCRA 2GMPA 3ELNA 4E2QA 3WV6A 2Y6KA 3AP4A 1IS3A 5FY8A 1TVGA 1VAMA 5GZDA 4QX5A 3V0BA 4ZU4A 5CU1A 4BJ0A 4CP2A 4OHYA 4LO5B 5CFCC 3ZFEC 3WINE 4JKLA 4QPIA 2CHHA 4QT6A 2RR12 4YG3A 1GWMA 2QQWA 1MZ5A 1P8JA 4FOWA 5JMCA 2MNGA 2F4PA 4XIOA 5J09A 1DZRA 2E7AA 5EWSA 4LIUA 3WP4A 1FMD1 2BRTA 3R05A 3IT8A 4P9IA 4K20A 2HBUA 4GKYA 5DG1A 1KEXA 2ZCWA 4Q4W1 4B7EA 5L7OC 2WT0A 3E6CC 1ZBA2 3D4KA 1H4HA 1IGOA 2W0XA 2QBXA 2VAUA 4X6RB 2UURA 5C8WA 5C9AB 4LA3A 1JS9A 3QH6A 4AE2A 1NKGA 4UXAA 2FDGA 4L8QA 1SFPA 2C5DA 4Q4X3 2Y33A 2ZX2A 1MS1A 4WVVA 4RYDA 3WQ1A 3I8TA 4RA0A 2WA3A 2W08A 4A6OA 4FQ4A 1DQ0A 3VZKA 4A44A 3IAQA 1H8VA 2JE8A 4LJHA 2YROA 2PLV3 1H0BA 4UT5A 4QU1A 4IESA 2OPKA 2JKXA 2XKOA 4KWLA 4CSWA 4MG2A 1EAH3 3TN93 2VVDA 3NQHA 4MXWA 2WZR2 2V4AA 3C7GA 3JBG1 3N9QA 3N3HA 2ZEZA 5E1RA 1JOPA 2WNVC 4BXSV 5LK5A 1OFNA 2YU2A 4AEMA 3UJOA 5DQ0A 5BY5A 4BQYA 1HXS2 1RUH2 1I5PA 2Y38A 4CDXB 3TRSB 2Z4FA 4LHNA 3UT0A 4OCTA 3OGVA 2IXHA 5ACA1 4LUMA 4Q4Y2 4J1WA 2ZGSA 1JZ8A 1PO23 2UWAA 1NAEA 2A3WA 2VZTA 4IEOA 5E16A 5HCBA 1XNKA 2XL9A 4I0AA 3VBSB 3OJBA 1NCRA 3HT1A 1U12A 1XE8A 1ULEA 3HD8B 1AXYA 1A8DA 3I2OA 2EALA 1AL21 1UMZA 4XMIA 1VBA3 1DGRA 3D8CA 1VRBA 1NY71 1YI7A 2BFUS 2BYVE 3AMNA 1N1VA 2VULA 2J1UA 2R49A 5JLVA 2AYHA 1RVF1 2ZEWA 5ABJC 2PHFA 4YARA 2LROA 3D0JA 1GSLA 1LB2A 1G9FA 3PDQA 1RINA 2HKXA 4CUBA 1DQ6A 2FDJA 1DZTA 2H6BA 4XCAA 3M3QA 4MVTA 3GZUC 5A3MA 1WBFA 1S1AA 5AFBA 2BJSA 2A6VA 4AEJA 3PJYA 3OUJA 3PUQA 1V6LA 1DQ4A 2GALA 3AVSA 3NJZA 4G3YC 1AF9A 1BQPA 1EY2A 3BYWA 3K75B 3OUHA 1PIV3 3PVEA 4QGLA 5FPBA 4LLFA 5CZKA 3WDWA 5L36A 1QJU2 4XJZA 2Z69A 1LGNA 2BNNA 2V09A 3WCSA 2C24A 2RG4A 2JDUA 3QH7A 2E33A 3POWA 4AEDA 3I3QA 4BQWA 5KC5A 2VZSA 1MQTC 4N43A 1OVSA 5CEHA 4JGYB 5LY2A 3GF6A 1BYHA 1H1MA 1W6NA 3MICA 1L7LA 5FK8A 2ZHKA 5BNNC 1JYIA 1N47A 2ZS6B 1O7FA 1X9TA 1I6XA 2VPVA 4O9EA 5FP3A 2P17A 4CXXA 5I0RA 2XLAA 1QH6A 3Q8FA 4RGGA 5FMOS 1VB2A 4XUQA 5CFDC 5DAPA 1RUJ3 1UXXX 2VECA 2X10A 1FNYA 5EJ3A 3FHQA 4MH0E 4D7TA 5C3OA 4QQHA 3DYPA 4LOTA 1QU0A 4XHBA 2HWB2 2VQTA 4NHMA 4EWDA 3PNAA 1QKQA 3MPBA 4BISA 1GR3A 2QQUA 1NXD1 2HWE3 1UYYA 4YYOA 2MPFA 1OKQA 2B9UA 2QQNA 3PMEA 3DCQA 3POEA 4QD2A 5FWJA 2VNRA 2YDEA 5G05L 1PO12 1D2QA 4H2AA 2RS52 5BNOC 3BIEA 1S2BA 2C9KA 4UFJA 4IE0A 2VBBA 3PIJA 3HOBA 3LA2A 5DXDA 4AEKA 5LASA 3ZN6A 2UWCA 1IS4A 4P14A 3WNKA 5FR3A 1ULOA 1NUKA 3TEYA 4QDSA 3AK0A 3BU7A 3BGAA 5FPUA 1DG6A 1GOHA 1F4AA 2BW8A 1EP0A 1HB2A 2PXJA 1UOBA 1NOVA 1MACA 3O1OA 3AZZA 3BOPA 1KD7A 1AR62 2RS13 2BERA 1KS4A 1W8OA 2GMMA 1Y9GA 2IC1A 1U5IA 1KJLA 1D2SA 2XVLA 3GYDA 4YWAA 2D3PA 3BTXA 4XYXA 3ZR6A 4ISRA 2FZ1A 2OVUA 4QQOA 1ZRDA 3ZKYA 2W47A 3LF7A 4QXHA 1R083 3KMHA 4M0HA 4QPGA 1C5IA 3JB8A 1N3PA 3AM2A 4A45A 3BPSA 1S0DA 2TBVA 3NJXA 2GC0A 3CIHA 3RVHA 2ZEXA 4Y1YA 1A78A 1HQLA 2XQXA 2YC0A 4IW3A 2PN5A 2YU1A 3CL1A 3LOIA 3RSJA 1ODNA 5C4WC 5D2AA 1DP0A 1L7QA 2VNVA 3RGBA 4AW7A 1GQGA 4GULA 4BA6A 1R1A3 2I07B 4K40A 1ULGA 1PNFA 1ULCA 5EYYA 4DPNA 2FQPA 4LK6A 1TG7A 4Y20A 1LOAA 2Q4SA 4W65A 5HCHA 1OT5A 5EHDA 2WFF2 2A6ZA 4R9AA 3LSDA 2JD4A 3FWEA 5FIXA 1PGL2 1MZ6A 3T2QA 2ZGTA 4XFFA 2WDBA 2UYAA 3AXEA 4H7LA 5DG2A 2P3IA 5DZFA 4AGVA 4EZ4A 5IVEA 1FPN3 2JENA 2RR11 2GU9A 1UIJA 1EYBA 1MPXA 1W8UA 3HNMA 5LRSA 4EQVA 2C9AA 4UF0B 5K4LA 4E2SA 4R4XA 1QJY3 2WIIB 2RJKA 2ADDA 1W2AX 4G4FA 4Q8LA 2RE9A 1ZBA1 4GJZA 4IUGA 3T3YA 4IXLA 1W0PA 1QNYA 1KQRA 1POV0 4XFHA 1LRHA 3ZYGA 3WF1A 1CESA 3O5SA 3OTFA 1O4ZA 4LO4B 3WNLA 4QB6A 4KU8A 2J1RA 2OUJA 2AZ5A 1W6MA 3LZZA 2BWCA 5CKMA 4BQ1A 2GH2A 4ZKTB 2O8OA 2ZGOA 1XXNA 5JR7B 1PMHX 4JC1A 5CA6A 2WNVA 1VBB2 3WY6A 2OA2A 2D7FA 2F17A 3L2HA 1AR83 1V0AA 4HT1T 4SLIA 4CTEA 1BEV2 1Y43B 1DGWX 2EF6A 3BOWA 4NOTA 4DZGA 5FV3A 1HB3A 3A21A 2PAKA 5JZGB 3VBUC 4AR2A 3KGLA 3Q8EA 3MIEA 5A6YA 2V5YA 1HRV2 3G6JB 1HXS1 1RUH1 1ZBE3 5FYMA 5HPOA 2C1FA 1W0OA 2R071 1ZRFA 3OYWA 4UFHA 1RJ8A 1JU3A 3LFMA 5F6LB 2PA7A 5LBEA 4CCDA 1XNCA 2BBAA 2Q1MA 1CR7A 1CN1A 2VOXA 4Q4Y1 3FJSA 1LULA 5LEKA 4NPLA 1XU1A 2VM9A 3NNJA 2VD7A 2XJQA 3N9LA 4L0PA 3WF3A 4P9LA 2FHRA 3HBKA 4RQPC 2KR2A 3ZLIA 1Z7S2 1PVC2 1EUTA 4MLOA 1V6KA 4PIXA 5A7WB 5LBCA 4IV3B 1DYKA 1I5ZA 1W6OB 3KT4A 3CJIB 3OGRA 4KH9A 4XBNA 3WP3A 3EJKA 2W87A 5LA0A 3ZYRA 4AI2A 5EPAA 4UW5A 2PHDA 1MEC2 1NCQC 2KD7A 1IG3A 5A6ZA 4ASLA 5L9BA 5D1IA 5K0UC 4OVEA 3ZFEB 4BK5A 2OZJA 3ATGA 1CAXA 3PURA 1RUC2 3FMGA 5IK4A 1BMV2 3X29B 4N9HA 3MW4A 3AMQA 3U4XA 4CP0A 3J8F2 4Q1PA 1GOFA 3VZJA 1Q43A 1MQTA 2DUQA 2ZMKA 1QJU1 3O0VA 5L7OB 1SCSA 2WWSA 4YRDA 1OPOA 2VXJA 2ZKLA 5AC92 3UV9A 4CDQB 3UGFA 1UOFA 2OKXA 3DEMA 4D8MA 1VAKA 3ITQA 5EIYB 2DUPA 1GZCA 1TZOA 1VBE3 4YW5A 3VD9A 3MIBA 4BE3A 1ND2C 2C0ZA 2NQYA 1YO8A 2QDNA 4KG0A 2JDHA 1J83A 3KT7A 5CFDA 2P5BA 3IZOA 3ACLA 1ZYBA 2ZJCA 4LKDA 4M01A 1UOGA 5J7MA 2BZDA 3I3EA 3PU8A 1XPWA 5SV8A 3OBZA 4QWNA 1GFF2 1S0BA 4LQRA 3AYDA 4YGDA 4F8AA 4PQQA 4YM3A 5F2WA 5CG9A 5CAZA 2EXHA 2P2KA 3U37A 1APNA 2TUNA 3NW4A 4D3WA 5GLWA 1CD3G 1W6QA 3SMHA 1OQEA 5C9AC 3AKQA 3HN3A 4PI2A 2HWB1 1NLSA 1ND3C 4PLNA 3A7QA 4Q0UA 4C90A 4IV1A 1L3JA 2XBO1 4UBHA 5BNOA 3O1SA 1OMIA 2BEOA 5GZCA 4LEJA 1SCRA 1W9TA 5FZOB 1STMA 2ZX3A 1AXKA 4Q8KA 2A75A 4XXAA 5DDJ1 3S5QA 3ZYIB 4A7ZA 1PO11 4Q27A 5FZ1A 1R093 4PI0A 1VBC2 4CP9B 2PQSA 2RS51 3ORJA 1WWYA 5FUPA 1W3VA 4AFDA 3VD3A 2XGXA 5JOYA 1QQP3 2HWF3 1W8HA 4HOOA 1RIRA 4WVWA 2LS6A 2CDOA 1BVP1 5FY4A 4NIGA 1W8FA 3TEWA 4I09A 1YQ8A 2VVEA 1LOFC 3SH3A 3RI8A 4MYEA 4YW2A 3WW2A 3AL6A 2NLRA 4RD7A 3ZSJA 3B69A 5FZ4A 2WQ8A 3M3EA 3KVBA 4GH4B 4CDXC 2Y6GA 1IKQA 3I2KA 5IK5A 2VUAA 4RHV2 5ABJB 5ISLA 1W8NA 1VJ2A 2JG8C 3N4MA 2JKBA 1H9WA 3VBFB 3ZXAC 1RUI2 3ILRA 5C4WA 3VBSC 1GQHA 2VY0A 5A7OA 3J4UH 3KF3A 4IEWA 1PMIA 1K45A 5T54A 1JYXA 2ZGLA 5T3NA 2BQPA 2EIGA 1IPKA 2DFCA 5ERLA 3ZYPA 1VPHA 1JBCA 4FPOB 5FPZA 1ZRCA 3I7DA 1RUD2 4NRQA 4HFSA 1QDCA 4QXCA 2A73B 3CDZB 3B5LB 4H3WA 4MX3A 5IWFA 4D6RA 5F1RA 4KWUA 1H4GA 4FPCA 2FCTA 3EMRA 5EV7A 4XMAA 4FOVA 3IMNA 1T2XA 3ZN5A 2K2SA 5A33B 3VBHC 1GP5A 3WP6A 4HPKA 3VDDA 3RI9A 2WFF1 3E5UA 5BNNB 1WLTA 1YFWA 5JOZA 1PGL1 1V6OA 1ODMA 3T0BA 4TSVA 1FMD2 4JZRA 3AZWA 1KJRA 1D4M2 1QXPA 3RYKA 2YBPA 1OF3A 4I30A 4EJRA 1RITA 1JXNA 1SFYA 3HQRA 3MEPA 1KFXL 1LENA 4UAPA 5FZMA 2IXJA 1LHNA 3BKZA 4EN7B 5LWBA 3GM8A 4NN0A 2R0HA 2R1DA 4PQ9A 3VKFC 4W8JA 4Y22A 2RS33 4QMAA 5GJ6A 2G1MA 4B3NA 2E26A 5HI0A 2YV8A 3PUAA 1S0JA 3S30A 2QQJA 1I3HA 4Y1VA 1DQ1A 3SHRA 4XTPA 5I8YA 1NE6A 1AZDA 1W2NA 4JDOA 1BBT3 1ZRIA 4Y5Z0 5EQUA 3ZDSA 2WZ8A 2IVIB 3HQUA 4LBQB 4M0NA 1WW4A 4A3XA 4XQ4A 5FY7A 5LA2A 1WCKA 5JAXA 2K0GA 1MZEA 1O4YA 1EAH2 1NQDA 3PLQA 4IQPA 4CCCA 1X50A 3JD71 1CIWA 1ZZ8A 3K4AA 1VBB1 2HWC3 3VBUA 2J1AA 3D3AA 2IZWA 2OXBA 2VGDA 2VZ1A 2WN3A 5FYTA 2D44A 3BN6A 3KSCA 1CPNA 4XHXA 4CCJA 3WW1A 3E6BA 1DQ2A 1IQDC 3CO2A 3LPFA 5DAXA 5FZ3A 5BNPB 2CYFA 2HWD3 2YMZA 2BU9A 4XUTA 5K7PA 4Z92B 1LECA 1DQ5A 4AI3A 4C0BA 2R32A 5ANNA 2LW8A 3DKWA 4AQ2A 4W4ZA 3J26N 2JEMA 1YFXA 5KXCA 3GJAA 1YLLA 1WLWA 2VQUA 3N36A 1H6XA 2PQQA 3EXUA 5B4NA 4RS5A 3CEWA 4QX2A 4K8RB 5FXWA 1ZREA 1HLCA 5J36A 1PVC1 2P3YA 1SPPA 3F95A 4L9BA 5APAA 1NCQA 1RVF2 1S2EA 1JZ3A 3ASIA 3SC7X 4JHZA 3RMYA 3ZR5A 2JG9A 5K0UA 4A41A 3I2GA 4Q4V1 3FLPA 4V2WA 2Q8DA 3SCGA 3UKVA 1CWPA 4M4PA 1MEC1 4CCOA 4S2DA 5KC6A 5HBAA 2E32A 2GNBA 3IPVA 5FKBA 1MR5A 1UNBA 2D43A 4I3GA 3OGGA 5FXZA 1NLQA 5J48A 2ET1A 1Y3TA 2ID4A 1LR5A 3M3OA 4HETA 2SBAA 2HEYF 1SQ4A 1PIV2 1RUNA 4GWNA 1UZYA 3U4SA 1RUC1 1PX4A 1Y4WA 1RUG3 2D6MA 4YNIA 2AGSA 2B46X 2W46A 2WNUB 3J8F1 4Z8BA 2X5IB 1H30A 1HKDA 1RUF3 2GP5A 3VD5A 1DFQA 4MUVA 4R9BA 3HEIA 3MIGA 1POV1 1LNSA 1UYXA 4XF1A 2BWAA 5GLTA 3OUIA 2YZ4A 4ORFA 4BDVB 3FC0A 1WMEA 1DLLA 3VLBB 4Q26A 1FT9A 1W99A 5FK7A 4AFMA 4DUXA 1DYOA 4GD4A 4XAEA 5FUNA 2GNTA 3CZUA 1JUIA 4XJUA 1UZ0A 3I59B 3VV1A 5C9AA 1RUJ2 2WYSA 5C5UA 5EFUA 2H6CA 3M1HA 2VQ0A 2OX0A 1HV0A 1UPSA 1VRH3 5F3EA 1W39A 4IEZA 5F3GA 3PVNA 4XJAA 2XL7A 1SMVA 2XOMA 3HT2A 3KS7A 4RGKA 4WBBA 2BDRA 5T5OA 4CEYB 2GSYA 3THTA 5LY1A 3DUIA 5JXIA 4FFHA 3RRDA 5J98B 5C3QA 2DCKA 1UO9A 4I2OA 2XG3A 4QB2A 4XURA 1AHSA 1O5LA 4COYA 3IKWA 2LUWA 2XHKA 1QY4A 4E4ZA 1LOFA 1VBC1 3PL0A 1PNGA 3AJZA 2VZVA 1PVXA 5F7UA 5A1AA 2BNOA 3LEGA 3OF1A 4K3UA 3U1XA 5FUIA 5FJHA 4RQPB 5EJZB 3NNMA 1QJX2 3WG3A 4CVUA 2VCBA 4CDXA 4BLJA 2BGCA 1DLCA 2VOVA 3OOXA 3ZMOA 1K12A 2EVXA 2W1QA 2WLPA 3MLLA 4TLGA 2YPDA 4LO8A 5L73A 4YM1A 4UYBA 1HN0A 2PHLA 2XJUA 4HZFA 3B94A 3VBSA 1G9DA 4RHV1 5CVRA 1F5FA 2BTVC 2G19A 3BI3A 3M70A 4KQ7A 1NXMA 4MHRA 4TXWA 1H6YA 3WNXA 4OQ8A 4DUWA 3Q8BA 1RUI1 4BZ4A 5C3RA 2B5HA 3VKLA 1MS3A 3AP5A 1AYN3 3LQCA 5I0DA 2E6VA 2ZGKA 1HRI2 2E9QA 1N1SA 2MHFA 3VBOB 4A2UA 4MGZE 3J7LA 1R1A2 3CHXA 4IV3C 2NYYA 1Z0HA 2VCMA 3CJIC 4J1XA 2VZOA 3PUSA 2NP0A 1I1EA 4I0WB 4TWTA 1RUD1 3S7IA 2ZGPA 4K1YA 5BYNA 4OYUA 2E53A 1O3TA 3W59A 1RGSA 4R4ZA 4MO3M 5A3OA 1CZSA 1YI9A 2B9VA 3GCXA 3HBZA 4AQTA 1Q8SA 1EPZA 3GHMA 3K4ZA 4F83A 3FX3A 3POYA 2D97A 1GMMA 1ND2B 2WINB 2DVAA 2D6KA 1WKYA 3WT3A 2HYKA 1VMHA 4B4PA 3NSTA 5HXVA 5JCTA 2Y26A 1FPN2 2XUEA 4AF9A 3ZYJB 4COVA 4B29A 5FCCA 1L7RA 2BOJA 4HXCA 4EN6B 3POSA 4QXKA 1ZZ9A 4TN7A 4XE9A 1D4M1 1OOPB 1Q5OA 5FBZA 4JGYA 3AMPA 3LEKA 2K46A 4LO7A 4CDQC 5A80A 4E9KA 1JYWA 3C7OA 1ND3B 4YFWA 4DO0A 2WUHA 2ORXA 5T5JA 4JX0A 1O8SA 4Q29A 2W68A 3MIDA 4XTMA 1UPIA 5T52A 3TEXA 2D3SA 3B3QE 4P5YA 1A3KA 3AXDA 3SLIA 5K9YA 1QEXA 1KGYA 2QNKA 2P37A 5FZBA 3NV1A 3EYPA 3TB0A 2ZAAA 3UGHA 4LXLA 3VD7A 4HK8A 1G6NA 5HCAA 1ZZ7A 2R16A 3K2OA 4NHXA 1Q3EA 5LW9A 4XJ8A 3ZSLA 1SHWB 2WS93 5DMYA 3D82A 2BPA2 2VMIA 4IGQA 5T5PA 2D93A 1EAH1 3QOPA 1DBNA 3LCPA 5FO9B 1VAVA 4NWVA 4DRVA 1JW6A 4YGEA 4NJ4A 4AWDA 3LA7A 1HQNA 1COV3 2VUDA 4Y3OA 1F4HA 5FZ9A 5FZCA 1JYVA 3FLTA 1NA1B 2R072 3RYPA 1AR92 5KR7A 1AR72 4XFAA 1F2NA 5FYYA 2VVFA 4AVBA 2VOKA 3T08A 3T2PA 1JTZX 2YYOA 4FO9A 1WD4A 2JG8B 3GXUA 4XBLA 4Z07A 1OA3A 2WZPP 5A3PA 4JQTA 2NPIA 3H42B 2DURA 3MPPG 3JBG3 4IGPA 5C6CA 4JV4A 1PO21 1VMJA 1OA4A 3ZXKA 1DCSA 4AHZA 1XYOA 4QX1A 4BQ3A 2EAAA 4AI9A 1QJFA 2ZBJA 3IB3A 1UU4A 2EA7A 3V65A 4DRRA 3RZGA 2JDPA 3B7MA 3W58A 1YIFA 3ECQA 5FLJA 4WV8A 5ACA3 4GH4C 3C7EA 4GAZA 1O8PA 1VBA1 1W0NA 1H9PA 2W95A 4KI5M 4JQRA 4BMBA 1OSGA 4ATFA 2W1SA 4LKSA 3E1F1 4M00A 3A22A 5D8AC 3VBHB 1PM7A 5JUVA 1CAVB 1GZWB 3VBFC 1MS8A 1PX3A 2ZGUA 1SLIA 3WW4A 4P9WA 4Q0VA 4UI9L 3T4HB 4FAGA 2DBIA 3AP7A 2IXIA 3CBNA 3LGRA 1C1FA 1IOAA 1F15A 3ROUA 4R8HA 1I9RA 4XQWA 3ZYBA 1CONA 4PF5A 3WF4A 4B4QA 3AMMA 2QDRA 3T4VA 1UW8A 3W9AA 2DVDA 1N3QA 3ACGA 1PIV1 4P5HA 4AHYA 5HV4A 4XFGA 3NV4A 3H8OA 3RYRA 2MEV3 2G4IA 3MFAA 4WM8B 2ZX1A 2XJRA 5FFOC 1US3A 3MF6A 5GZFA 2JDYA 1RC6A 2GC1A 1DGRN 2DTYA 2E7QA 2V73A 3BCWA 3ILNA 3N7KA 3KLSA 4XJWA 3C7HA 2A71A 2X53S 4CZSA 1VBE2 2YG0A 1W06A 1OUSA 4ASKA 4OHXA 2RDRA 4PF1A 1ZRRA 3KCCA 3VUOA 4UF0A 5GLZA 1OD5A 1PK6B 3VBRC 2GNMA 3DN7A 4IE5A 1WZXA 4L11A 5GALA 4P00B 4F7ZA 1YWKA 4FPKA 5IUQA 1FOD2 2DWRA 1RL3A 5FMCA 3POJA 3R4SA 4GJYA 5IJRA 5LA9A 1J3PA 5FZIA 3UKTA 3KGZA 1YHFA 4QQPA 3KWVA 2X29A 2CGPA 3DYOA 1OC1A 1RUJ1 2AR6A 3LIHA 3QD6A 2XBO2 1J59A 1TEIA 3NNGA 1SBEA 5FWEA 5IVCA 3ZPOA 5DDJ2 3O1MA 2B4KA 4KBBA 3PJQA 4Y1UA 4M3CF 3ZIWA 5FLHA 1DZQA 1XJAA 2W1WA 3PU3A 3OBAA 4YG6A 3U14A 2J1TA 5FPLA 5FZEA 1W3XA 1JUHA 1R092 1UL9A 3H0OA 4BLIA 1WMDA 4QX3A 2Q8EA 4R9CA 2DU0A 3O0XA 1JOJA 2HWF2 3AZXA 2Z2SB 3N35A 5FQ0B 1GLHA 1S0CA 5JZGA 1ZZCA 1OLRA 2EIBA 4ISQA 2R042 3MLKA 4FPYA 5JIUA 3TWIA 3DECA 4MXWB 3O7OA 4LKEA 4K8FA 1QJX1 4XDOA 1OLME 3TNPB 2WJSA 2Y64A 1JZ6A 2JJ6A 4ONUA 5FP4A 2P1BA 2WO7A 5BNPC 2RS11 3U0ZA 5IVFA 3BU0A 3MFCA 3POGA 4Y24A 5BXXA 2XJVA 1GQPA 1H2MA 4V2VA 1LJ7A 5A3WA 3VGIA 1JHNA 2ZABA 4S2HA 1ULDA 2EXKA 1LOEA 4KWKA 2WA4A 3AZYA 1IZ3A 3EBRA 4WVZA 1SLAA 1M4WA 1J58A 1G8WA 3U11A 5A7WA 4IV3A 5FYVA 1W6OA 1UZWA 3CJIA 1SLTA 1W9WA 5IVBA 4FTEA 4PBPA 5FYSA 5FLIA 1HRI1 4KNCA 5H9QA 3P5BA 1MVEA 1TMF3 4YLZA 4FPGA 1R1A1 1VBD2 2JDZA 3NV2A 2W5FA 1GUIA 4XF9A 4G9SB 1MZFA 5CFCA 4AL9A 3ZFEA 1GKBA 4Z1VA 5A3UA 3NL1A 1YRZA 1PZ9A 2I45A 4YG0A 5FZAA 1G9AA 1AUYA 1S0FA 2UU8A 4NHYA 2D5HA 1SG3A 5FZFA 1V6JA 3OCPA 4XBQA 5IVVA 5KHIA 1QNWA 1RUE3 4XUPA 4DEQA 3E5XA 4AAPA 1GP4A 1D0HA 3BB6A 1GOGA 4GB33 5L7OA 3MUZ1 5FXXA 3S7EA 2BVBA 2RMU3 5JPNB 1FPN1 1JZ4A 4M4RA 5HCFA 1UY0A 1PM4A 2B39A 3RWKX 4CDQA 3VDBA 3RJ2X 2W39A 3I2JA 4MOAA 2WNUC 2RJ2A 1W03A 3FFQA 3OEBA 4XCBA 3LAGA 1CZVA 2XB6C 3AYAA 2X5IC 3WVJA 3AZVA 2DVGA 4DFSA 3WR0A 1NLRA 5F5CA 3J7NA 5LCWL 1LODA 1GWLA 5FOBB 2RR13 2VW0A 2RM23 2XLGA 1MS0A 5A3NA 3PHMA 3RWNA 3ON7A 2WO1A 4E4DX 2AC1A 2Y6JA 4ZPIA 5H9RA 2IWGB 2VJXA 4YVSC 1HB4A 1E5RA 1C8M3 1GICA 1WCDJ 3OEAA 3OGJA 1BKZA 3N9MA 4M3CB 1UXZA 4UFLA 4ZXKA 4NE9A 3N9NA 4CU6A 5IK8A 1AX2A 3JD72 2HLEA 1UX6A 1N1YA 4NAOA 5CYYA 4D6QA 5FZOA 3NMBA 4NIAA 4CDWC 3ZXDA 4XPVA 1UMIA 1GNHA 2WLQA 1B09A 1O6UA 4K6BA 2ZOEB 4ZZ5A 1O59A 2F4LA 4QX7A 4CEYC 1S2KA 2ATFA 1RXFA 3BIWE 5FREA 3MI8A 3ILFA 3LE0A 2VMHA 2VZ3A 4BQ2A 4D6SA 2XONA 1AR91 2BNMA 2NM1A 2Q5TA 1ZZ6A 1AR71 2VBPA 2W94A 1Q8OA 1ZBE1 1PZ8A 3A4UA 4D0QA 2E63A 1FX5A 3KF5A 3SQOA 3ZSEA 1W2TA 2WZR3 4LPLA 1FI2A 2VOTA 5FP8A 2QCSB 2Q1FA 2Y60A 2FDFA 1UKRA 4GH4A 3NNFA 5CADA 3H8RA 4N7IA 5ABJA 5JOWA 3H3UA 1UF2C 3PVOA 4Q5OA 2IXCA 4AYUA 2DF7A 2UYBA 4Q4V2 1ASJ2 3I2FA 3NKGA 3VBFA 1N1TA 3HJRA 4OUSA 2DUOA 3I3MA 3JQXA 3E97A 3FLRA 2CV6A 1VB4A 1SDWA 2NMOA 3JB4C 3PMSA 4XOGA 2LRPA 4XDPA 3DGTA 4ZHNA 5AVAA 1VE0A 1AX1A 3OY8B 1DGWA 3M7AA 4GQ7A 1YJLA 5KHJA 5JOXA 3I49A 1K5JA 3WNPA 1NZIA 2R6QA 3ZXFA 4AHXA 1IG0A 3VBOC 5LRRA 4K9SA 2D3RA 4DXTA 4BIOA 1V9U2 2XDVA 4OI2A 4XF0A 3WNOA 2WKKA 4NAMA 2EXIA 5A33A 2ERFA 2ET7A 1LOCA 2W52A 4LBLA 2FDHA 4LBQD 5BNNA 2Q0AA 1WLDA 2WL1A 3LDRA 1CIYA 3AYCA 2AH2A 3BVCA 3IAPA 2VTXA 4QQ2A 3DV8A 3HMYA 3DPRB 4EN9B 1NT0A 4IEYA 1BXHA 1JHJA 2J22A 1YCIA 2KA3A 3CMGA 2A70A 3GALA 4PHZA 1VBE1 2DV9A 3VL8A 3BUCA 5F37A 4WM7B 1ACCA 4ZZ8A 4QGMA 3A0NA 1GWKA 1CJDA 1QJU3 1RMU2 2WSUA 4MZUA 3SKVA 4EZHA 3AKRA 2CNAA 1ALYA 4HSLA 4XZUG 3BTZA 1VALA 3AKTA 1FOD1 1OOPC 1BK1A 4BMEA 5C33A 2YFZA 4HANA 3RZKA 4OUMA 1CZTA 4IGOA 2D6OX 3ZFFB 4QM8A 2DDUA 5JMOA 2DCZA 1DYPA 3VZOA 1E5IA 2YBKA 3CZJA 1MS9A 3LEIA 4PBOA 2QQLA 1R1ZA 4PJYA 1OVPA 1RJ7A 3KV6A 1ZM1A 4LBQA 2FBEA 2CAUA 1URXA 2PHXA 3WP5A 5FYBA 3S5AA 3KV5A 4DEVA 1BZWA 3H7JA 1R091 3ZXEA 3SXWA 3PUHA 3UGGA 4QAWA 3HQXA 3WZ1A 1OXCA 2HWB3 3FBYA 2HWF1 4AVTA 4P9XA 3KCXA 4RR3B 4COZA 2ZHNA 3ACFA 4YPJA 4CCLA 4LITA 4DINB 1XNDA 5BNPA 2ZXQA 2R041 1DIWA 3CJXA 5C3SA 4Q0QA 1EPWA 3S0MA 2RS53 4CDUB 4EN8B 5FYUA 1NA1C 2ZX0A 5LA1A 1E57A 3RS6A 4LULA 3B9IA 1IQAA 2VBDA 3ABZA 3ZYFA 3DXTA 5A3TA 1SBFA 5EXOA 4ARYA 3ZPYA 5D8AB 5B2GB 1FAYA 5FZ0A 2DYCA 5FZDA 2BV4A 3M2MA 1WCQA 3I97A 2GC3A 2XKPA 2YB7A 1XE7A 2JWPA 5GKAC 1OURA 5E6HA 4B8EA 2WRAA 2ZAHA 4BHPA 2FMDA 2ARBA 1XSRA 2WT1A 1PHMA 3IDCB 3V0AB 4QX8A 1AR63 1S4CA 4YVWB 1NG0A 3P1IA 4AXOA 2JX9A 4RN5A 4XAAA 1ZNPA 4YZ4A 1K42A 2VG9A 2YC2A 1VBD1 1Y7BA 4GALA 4OZOA 4KU7A 2XPJA 4W6YA 1OUXA 1SBDA 1YQCA 2FCUA 3IIAA 5M0TA 4AK3A 3GCWA 3VHRA 1A8MA 1OLQA 3VKNA 2DVBA 3ZYHA 2DTWA 2C6SA 3OPTA 1CAWB 2XXZA 2YPJA 4FTSA 5LBBA 4I0BA 3UL2A 4CRQA 2P34A 3VBRB 4IDZA 2WNUA 1U5ZA 1JZ7A 2ZMLA 1VMFA 1QJEA 2X5IA 1H1IA 3IDEA 3WOGA 3ZFGB 3O1UA 2FZ2A 1ZZBA 3WUCA 1V70A 1J1LA 2VMEA 3MV11 1OD3A 4WM8C 5CB7A 4YFZA 3NWKA 1OA2A 3MIFA 1GANA 1V6IA 5D21A 5DABA 1G86A 4Q4X2 3PTYA 3ENRA 4XF4A 4L92A 1LGBA 4YGBA 4F3JA 4GZ9A 2YXSA 2FD8A 3E5QA 4LBOA 2E7TA 3FL7A 1MVQA 3I59A 4ES9A 2VE1A 1PK6C 4BIFA 3BALA 4GWIA 4NIIA 1UQXA 1UN1A 4PLMA 2PLV2 2B45X 2Z79A 3TEZA 4C1WA 3HWJA 2IUWA 5CNAA 1MS5A 5FJKA 4OI0A 2JDAA 5JXHA 2WS92 2F6BA 3TN92 3NJYA 3WG2A 3GNEA 4TTGA 5A6QA 4FFGA 4CEYA 2TEPA 3LWCA 2WYFA 1BK0A 2VO5A 1WW6A 4OZXA 1PMJX 1JYTA 1WGPA 4GMP3 3T2TA 4WVMB 4CUCA 1SLBA 1IPJA 2HWC1 4RGAA 3J9SA 1TNFA 4ZS3A 1COV2 1BJQA 4JHTA 1H2KA 1RHI3 1WA4A 4QHOA 3K48A 1GZ9A 1U5YA 1ZA4A 3KQRA 1K5MB 4FPFA 1JYCA 3NNLA 5FKCA 1QIQA 4QHBA 1LU2A 2HWD1 1LHOA 3JU9A 3KHBA 3QBQA 5LATA 3KHCA 1HJFA 2O14A 5J3UA 1PO22 1YYNA 4WZCA 4RQPA 1AYM3 1VBB3 3M3IA 3O0WA 5A7SA 1HB1A 1JODA 4O7XA 1BEV3 4AFAA 5IVJA 2XWJB 3H7YA 3HR9A 5DUXA 4K7JA 2GN3A 1V00A 5FPAA 1VBA2 1HRV3 4LBMA 5KBFA 3FZ3A 3EO6A 5DAQA 2XH6A 1QOOA 2XLFA 2V4VA 3S6PA 4BB3A 2WO2A 2Y0IA 1R64A 3WDUA 4ET7A 2HEWF 1ASJ1 2BUKA 2B7YA 3T1MA 2VMDA 1DU3D 3PVBB 3WNNA 2ZA9A 5FO7B 3AX4A 3VBOA 3FE5A 5JSOA 4FPHA 2A1XA 4URTA 5IATA 1Z7S3 3ETPA 2EXJA 1TME3 1NCRC 4UFIA 2X8KA 3OB8A 1LEDA 4CEWB 4PIZA 2VW1A 4LKFA 3RPQA 1IS5A 3H9AA 2ZZQA 5KHKA 1QOTA 5L19A 1OKOA 1V9U1 3VDAA 1RUG1 2MEV2 2OS2A 3TYJA 3D0SA 1QWRA 1ND2A 3NJVA 5EP9A 4N53B 4CCMA 5HV0A 1HV1A 4LK7A 1UCXA 1RUF1 2H0BA 3CKHA 4FP2A 4LIVA 1OI6A 3MBWA 1ULPA 4TLFA 3RG0A 2VMCA 3CF6E 3I54A 2IFWA 3IM0A 2CGOA 3FUOA 1UYPA 5T50A 3VN4A 3JZVA 4YVSB 1OOPA 1ENQA 2E31A 4AI0A 3MDPA 5BUVA 1RMU1 2WAOA 2BVVA 2YFUA 2XJSA 3AFKA 3AMHA 4P9YA 5AC93 3TAYA 1ND3A 1C28A 5I0UA 3WNMA 1XNTA 3N9OA 4O9GA 4X8NA 4BQ4A 2GMEA 2JE9A 3F2ZA 4XZPA 1BHGA 4CDWB 3KVAA 5F2SA 3EQEA 3K3OA 5L9RA 4AEDC 2HWE2 3RNSA 4ZONA 4A3ZA 4QKFA 2G9ZA 1REFA 2VQAA 1UY4A 2JB8A 3N7MA 1B35B 5IAVA 3WF0A 3B01A 4UOJA 5FO8B 2YBSA 5CBLA 2QQVA 5LK7B 3MW2A 4NROA 1C5HA 1CJPA 2P6CA 4GA9A 3LPGA 4IEQA 2N7GA 3D6EA 1ENSA 5F32A 1OQDA 4CU7A 2ADEA 2CGNA 5T55A 4XUOA 3O12A 4BQ5A 4C1XA 2WC2A 2QZ3A 5IVYA 4AAXA 2RV9A 1EV13 5JPMB 3IWZA 3WDVA 1VR3A 2CTVA 4XXPA 2BFUL 5T5LA 1NA1A 4LR4A 3O1TA 5BV6A 3H3ZA 3T2OA 1CGPA 2RS12 2JECA 4UFMA 5GZGA 3H8UA 3WEZA 3ZXLA 2HBTA 2JG8A 2WAAA 3JXSA 1VBC3 1W9SA 3ME2A 4GIQA 5FYIA 5A6XA 3RMXA 2R063 4NO4A 5A3LA 4MV2A 4QQLA 5CIRA 3C3VA 3EHKA 4E2GA 3K46A 1OFSA 4FP3A 1R082 4ARXA 5GM0A 5A32B 5FDBA 3I3DA 3JUUA 2Y0OA 2B8MA 5DZEA 2JICA 2OW4A 4R9DA 4Y4RA 3P3PA 4EYUA 2JB4A 2ZZJA 3ZMNA 2YHJA 2J1VA 1ST8A 2V72A 1AYN1 4ZU7A 4Y33A 4HN0A 4IE6A 4RHV3 4YZ3A 3MIHA 3SEPA 3VBHA 2SLIA 1LOBA 1CAVA 1GZWA 2J42A 2ZGNA 4XW3A 1SPPB 4LO6B 5JVVA 2UY8A 1O3RA 4OHWA 1YFYA 1JI6A 1RUI3 1XOYA 3E6DA 3R4DB 4DIQA 3NRUA 3IDAA 5DAWA 4BWOA 2BGOA 2QQIA 2BP6A 2JXAA 4QHZA 1JMUB 1OHFA 5FMOL 3ZDVA 1TQ5A 4L2NA 1RUE2 2ZMNA 3THPA 5H9PA 1Z78A 3IPVB 2BBVA 3SH5A 1IPSA 3OBRA 4GB32 3APBA 2I2SA 1RUD3 3I3BA 5FRAA 1LEMA 2RMU2 1AVBA 4AVCA 5IK7A 3KZ4C 3Q8AA 1XRUA 1XE0A 1LGCA 4MSVA 4BQXA 4Q2FA 5FPVA 1QJY2 5FZ6A 4QKDA 1LAJA 2FDKA 3MZHA 1QGLA 2D40A 2QQPA 5FZKA 4NRMA 1U0AA 1J84A 3UK9A 3R0RA 3DPRC 1PK6A 3DF0A 4AQ6A 1OLMA 1YFUA 3AL5A 2RM22 3WDYA 4IERA 1OPMA 1G9CA 2XHNA 1FMD3 4Q4X1 4WM7C 4A42A 1O4TA 1D4M3 4Q4W3 2EIDA 1J1TA 4JGZB 4QKNA 3WXPA 4B7KA 2XJTA 2HJIA 4MHUA 2UWBA 1C8M2 2PLV1 4LHSA 1H2LA 3TOJA 2I74A 2QUOA 3ZFFC 1AR82 1LTEA 2WS91 3TN91 4FAHA 1F35A 2DU1A 1AL0G 5FYHA 1SACA 3NAPB 3NO8A 1YQ2A 4FOYA 5KHGA 4XFBA 1IKPA 4TYSA 4COUA 1COV1 4IETA 1CAUB 1ZBE2 2Y8KA 4L99A 2OQ7A 3VZNA 5FQ0A 5LEJA 1VP6A 5C8CB 1UIKA 3H3LA 1UOJA 1W6PB 2XMLA 4JTOA 2CSGA 2VMFA 3GZEA 5FYZA 4MGQA 4RR3C 1QH7A 5C3PA 3ZM8A 2VUCA 3H1YA 4K21A 3MF9A 5I0SA 4PDWB 4HKOA 3ALQA 5DN2A 4MGYE 3W5NA 3D5OA 3FN9A 4MGKE 4CYDA 4JKKA 1H8TB 4B1MA 4CDUC 5FY9A 2GC2A 3T1LA 1NZCA 3KCYA 4LBJA 3KV4A 3R6SA 4AZZA 5KXDA 4RL7A 1WBLA 2PHRA 4LUKA 2OQ6A 2ZGRA 1HDKA 3FHAA 5FMDA 3I4IA 4FOQA 5AVPA 1KDMA 3UESA 2GP3A 4JAAA 1AL23 4LNVA 4AVVA 1UAIA 4Q1RA 4GKXA 1F9KA 2OT7A 2AREA 4YVWC 3ES1A 1LESA 4HONA 5FMBA 4FXGB 2D6NA 1RVF3 3USUB 5A7PA 1CPMA 5C5TA 2WWJA 1SLCA 2QTWB 5A1FA 1ZX5A 3WG4A 3U75A 1HX6A 5B4XA 2WO3A 2W2IA 2BGPA 3N7JA 1NE4A 3KT1A 4O61A 1QDOA 2MEV1 1GNZA 2RDQA 2EIEA 2XJPA 4YW4A 4LT5A 3DL3A 4CCNA 2OYZA 4I01A 1YQ6A 3DYMA 1LHVA 1N3OA 2JE7A 3V0BB 3SKJE 1DF0A 2XQRA 1E5SA 4ZY9A 2A6WA 4LE4A 2JDNA 2ZHMA 4QPIB 4S2GA 3UETA 4ASMB 1V6NA 1AX0A 4Y5TA 4J6GA 2R1BA 2P3JA 1UMHA 3AC0A 3NVCA 3ZFGC 3SITA 2PMWB 4LHKA 3ZXGA 1GNYA 1SLLA 2CWMA 2ZX4A 1X7NA 3U10A 2J1EA 3MHZA 5FXVA 2XVKA 1O3SA 2RHPA 2G9GA 4H55A 5CISA 2D6PA 4Y26A 4H7MA 4ES8A 4CXYA 3P3NA 1E5HA 4J25A 5G04L 2HWE1 1PGSA 3K77A 3LB9A 3FFZA 5H9SA 5AFEA 1YIPA 4M3CA 5KXEA 4ZS2A 1LHWA 3OPZA 1W90A 3AFGA 4LBNA 4TZDA 4KMQA 1GZTA 4BCUA 4OHVA 3V56A 1QQP2 5E8AA 2WABA 1FXZA 5IT6A 2CAVA 1BCXA 2JDMA 2XWBB 3LIGA 4HG6B 4BM8A 1RB8G 4P9JA 5L9VA 2VTXJ 4NPRA 3A0KA 3PIGA 3SCFA 4AGGA 3MO4A 4V1PA 3WG1A 3GGLA 3V64A 1SFNA 3KD4A 2VZQA 3Q8CA 4GMP0 3MV01 3JCIA 4IV1C 4XILA 1X36A 3C7FA 4H14A 1UZZA 1K5MC 2YUEA 1M06G 1FV2A 2WQZC 3WDTA 4UW4A 2HEVF 5SV5A 2VR4A 2AENA 5C70A 2Y6HA 3AP9A 1LOGA 2WN2A 5GLVA 4MGTA 1W8WA 1R081 2WWUA 3WCRA 4QB1A 3WF2A 2ZKNA 1F31A 1J3QA 2VH9A 1WA6X 1QJX3 3VZLA 1Y9MA 5FZ8A 1NCRB 2VC9A 2G9FA 4P9GA 5F3IA 3POIA 4YM2A 4YW3A 1CX1A 2VCCA 1TE1B
chains in the Genus database with same CATH topology
2OIIA 2Q8OA 4META 1TMF1 2PYTA 1DHKB 1VIWB 2O1QA 3OY8A 2IFRA 1T6GC 1WMFA 4Y4YA 3WHUA 4IEXA 4HN1A 1Y9QA 3G7DA 4FPJA 1HRI3 1Q8QA 1CX4A 2GDFA 4CEWC 2Z5WA 4HLTA 4UBGA 1RUE1 5J37A 4HVOA 4DS0A 4SBVA 5DUVA 5TSWA 3ZN4A 4GB31 2RMU1 2GZWA 5BPXA 2ZACA 3DPRA 2QVSB 4Z82A 1QJY1 3AKSA 4N53C 4U36A 4KL1A 4AEDB 2GAUA 4WM7A 3Q9OA 4N43B 2P3KA 2RS32 5EZWA 5I93A 4YM0A 3VDDC 2RM21 1W6NB 4OFGA 1BBT2 1XYNA 2VMGA 3USSA 2PTMA 3ZFFA 3ZXJA 4AI1A 1ZBA3 4HL0A 1XNBA 4NWWA 1C8M1 1RTVA 2UY9A 4AFCA 4D7YA 5JWPA 1W2UA 3B00A 2HWC2 1AR81 2GNDA 3HIFA 4W6XA 1B35C 4ITCA 3CLPA 2QKDA 1RHI2 4FT8A 4DXZA 2HWD2 1X8EA 1X8MA 2PFWA 3LOBA 5KWRA 3AJYA 4RR3A 4XETA 4E4SA 4Q0PA 4YGCA 3MLJA 3OD0A 1G9BA 2WSVA 4JRLA 1AYM2 2QJVA 2WFPA 1X33A 3ZN6B 3HAGA 4IEPA 3IBMA 2WZR1 4CDUA 1XYPA 5EYXA 1HXS3 3JQWA 1RUH3 2ES3A 1C3HA 2R073 1AR93 1AR73 2PHWA 5D8AA 3RQ0A 4M3CE 4DY5A 2A6XA 3LKJA 3GZAA 4Q4Y3 1MS4A 4DB5A 3IN9A 3N7LA 1D4VB 3V0AA 1GV9A 2VOWA 4HKLA 4BH9A 4QPGB 4YVWA 1C1LA 1TME2 1WW7A 1UU5A 3CNAA 2PHTA 2ZPXA 1KITA 1JH5A 4FCAA 1X82A 2LALA 4K1ZA 4RS5C 1YNAA 1JN2P 1RUG2 1IHMA 4DQAA 1RUF2 3GBGA 1CAWA 4QGNA 3AB0A 4Y20B 4EWEA 1LU1A 2JG9C 5CFCB 2TNFA 2NMNA 3VBRA 4HBNA 5E88A 2A3YA 1KXGA 4R52A 4XF3A 3SCHA 5K8SA 3ZFGA 3FBMA 3QCWA 2AUYA 3AP6A 4YZ1A 2H0VA 1O5UA 2Q30A 1S0IA 2FMYA 4LBKA 1VRH2 2VU9A 5DUWA 3GZTB 3L2YA 3TNQA 2DCJA 3VHOA 2Z42A 1DGLA 1UD1A 1GYKA 5I91A 4KG8A 4LTAA 4D69A 1WLCA 4WZFA 2A7AA 3ZX7A 4FSJA 4HK9A 3WQ0A 3WX5A 1WW5A 4YZ5A 3SH4A 4MXVA 1NQJA 1QMJA 1FOD3 4JGZC 3AKPA 3WW3A 1W6MB 3H1MA 4AHWA 2A3XA 2KXLA 4BYYA 1GBGA 1QQP1 1AJOA 3IDBB 4D7SA 4WVMA 2XBO3 1QXRA 2DCTA 1EV12 1ONAA 2WNVB 2R30A 4RFT0 5DDJ3 1K5MA 2EAKA 1PO13 2OUHA 2QE3A 5I8SA 5CG8A 2O0OA 4X6QB 2D6LX 3ES4A 3NAPC 5GZEA 2YY1A 3UKNA 4HMZA 2DVFA 2K9ZA 2IXKA 4FPLA 4KGGA 4XEZA 2R062 5C8CC 4AVSA 4JTNA 2VW2A 3OYWB 2PELA 4OI4A 4IEVA 2CL2A 4AFBA 5F6KA 2R043 5JDBA 3SISA 1LCLA 4COWA 5KXBA 4PDWC 1AYN2 4UW6A 4W6WA 2GN7A 1KDKA 3ZIXA 1RUOA 1H8TC 1UU6A 2R0FA 1AR61 3I2DA 5DZGA 3RDIA 1S0GA 1Q8VA 5GLUA 4I3PA 1PGW2 2ZGQA 4FBFA 4ATEA 1REEA 4NR1A 3INAA 4NHLA 3WD5A 3BTAA 2D5FA 2PHUA 3QLQA 4JRAA 4CEWA 2ZGMA 4AI8A 3CU7A 2DCYA 2VNOA 4BOWA 1S55A 5BNQA 5F9TA 4KWJA 4JCKA 4XIKA 1VLNA 1VBD3 1CAXB 3WHTA 3RZZA 3O14A 3MYXA 4N53A 4QPYA 4A7KA 3M8LA 5FPXA 1KRIA 1MQTB 2WFF3 1A6CA 4LLOA 5FAXA 5I0TA 4OI1A 2LM3A 4JDMA 5JI9A 4XDQA 1C8NA 4YVSA 2OZ6A 3AYEA 4LE3A 4OULA 3M3CA 1CQ9A 1F5JA 4Q0SA 1XU2A 4AVAA 2ZHLA 4IL7A 2RS31 4NHKA 4X8PA 1J3RA 2NZ9A 1CVNA 4QPIC 4INDA 4DNYA 1O3QA 4Q4W2 5CFDB 4HSJA 4GWMA 1BBT1 4AGRA 4CDWA 5JI7A 4LHLA 1AXZA 3QACA 1DDLA 2A5ZA 3LA3A 4JGYC 2VUJA 1B35A 2YGLA 4N90A 3VKMA 4IEUA 4MGIE 5JSRA 1W6QB 4GMP1 2A6YA 4IV1B 5BNOB 3ST7A 2VNGA 1RHI1 4EN0A 1G7YA 2GH8A 3WDXA 4EWAA 1FATA 1AJKA 3JD73 3ZVXA 3JBG2 4FVVA 3OD4A 1FYUA 3ZSMA 4YW1A 4N9IA 1QJZA 1AYM1 4JDNA 4LA2A 4ZU5A 1BEV1 3ZSKA 2O8QA 1OQ1A 3ZO0B 5JIAA 3BPZA 5E89A 2ZTNA 5ACA2 1BVVA 1LHUA 5A32A 1XQNA 2XVGA 1HRV1 4NVPA 4S2FA 1HIXA 4BPZA 4GXLA 1U5XA 1KS5A 2RJLA 4Y1XA 3GBFA 4QM9A 4UW3A 3TBDA 3VL9A 3UJQA 1AL22 2IXLA 4FQZA 1UKGA 1WUVA 5C4WB 1PVC3 1NY72 3LSEA 4XJ9A 3R4UA 1Z7S1 1ENRA 1TME1 2KM2A 3WLUA 4A7YA 4Q4V3 1ASJ3 5JSPA 3M4FA 1MEC3 3OBTA 3NKTA 3GBWA 3KM5A 3VHPA 1IS6A 4U2AA 4Y1ZA 4OLLA 1TNRA 4C0HA 4HPKB 3VDDB 4YZ2A 1LKNA 1RUC3 1H1AA 2WNEA 1HQWA 2YGMA 3B9CA 4CP1A 1F8VA 1QOSA 5F5QA 2PAMA 5FTTC 3J8F3 1V9U3 1YUDA 3MGUA 1BMV1 4E27A 2B42B 1V6MA 2XUMA 2CY6A 3ETQA 1NYWA 1QXJA 1POV3 5AC91 1Q56A 4XQDA 4C91A 3URFA 1VRH1 4JVAA 4AQSA 4HVQA 4QU2A 4FTBA 1QF3A 1ENXA 4N43C 4EV0A 2CWSA 2QFEA 3KB5A 4JGZA 3RJRA 3GHNA 4DMIA 1C4RA 4Y22B 1RMU3 2ARXA 4XFCA 2VXRA 3H1WA 1C57A 4HVRA 3HN1A 2WT2A 1D0GA 3WUDA 1Q8PA 3NAPA 3B02A 3L9JT 2NN8A 1EV11 2ENRA 4PIYA 3VBUB 4DY3A 1CAUA 3K51A 2Q1ZB 4KGQA 1KFUL 1YXWA 4FPEA 4OHZA 5C8CA 1FV3A 1WCSA 3VHNA 1W6PA 2E51A 1ULFA 4DOUA 5FOJB 2R061 3WQ7A 1SEFA 4B4RA 3H50A 2DFBA 4PDWA 4FXKB 2ETEA 5J96B 1YJKA 1H2NA 4HKWA 1QHDA 1H8TA 3NV3A 5JZGC 1WD3A 2WQ4A 2PAEA 3MW3A 4Z2WA 3BODA 3FUQA 3VKOA 4RS5B 4YSFA 1S0EA 3B93A 3C2UA 1TMF2 4PLOA 4AG4A 5KHHA 4I02A 1PGW1 1NCQB 4EROA 1PZ7A 3VZMA 1FNZA 2JG9B 2D98A 4XFIA 5K0UB 1O91A 4N7UA 5DUUA 4QPGC 1HW5A 4L97A 2ILMA 2LTNA 3USUA 3FHIB 3SNMA 4D94A 1REDA 4RSUA 1ZVFA 2QZ2A 5I8TA 4WM8A 3U07A 4PCRA 2GMPA 3ELNA 4E2QA 3WV6A 3AP4A 1IS3A 1VAMA 5GZDA 4QX5A 3V0BA 4ZU4A 5CU1A 4CP2A 4OHYA 4LO5B 5CFCC 3ZFEC 3WINE 4QPIA 4QT6A 2RR12 4YG3A 1MZ5A 4FOWA 5JMCA 2MNGA 2F4PA 4XIOA 5J09A 1DZRA 2E7AA 5EWSA 3WP4A 1FMD1 3R05A 3IT8A 4P9IA 4K20A 4GKYA 5DG1A 4B7EA 2ZCWA 4Q4W1 5L7OC 3E6CC 2WT0A 1ZBA2 3D4KA 1H4HA 1IGOA 2W0XA 4X6RB 2UURA 5C8WA 5C9AB 4LA3A 3QH6A 4AE2A 4UXAA 4L8QA 4Q4X3 2C5DA 4WVVA 2ZX2A 1MS1A 3WQ1A 3I8TA 4RA0A 2WA3A 2W08A 4FQ4A 1DQ0A 3VZKA 1H8VA 2YROA 2PLV3 1H0BA 4IESA 2OPKA 2XKOA 4KWLA 1EAH3 3TN93 2VVDA 4MXWA 2WZR2 3JBG1 3N3HA 5E1RA 2WNVC 5LK5A 1OFNA 4AEMA 3UJOA 5BY5A 1HXS2 1RUH2 2Y38A 4CDXB 3TRSB 4LHNA 2IXHA 5ACA1 4LUMA 4Q4Y2 4J1WA 2ZGSA 1PO23 2UWAA 2A3WA 4IEOA 5E16A 5HCBA 1XNKA 2XL9A 4I0AA 3VBSB 3OJBA 1NCRA 3HT1A 1U12A 1XE8A 1ULEA 3HD8B 1AXYA 1A8DA 2EALA 1AL21 1UMZA 4XMIA 1VBA3 1DGRA 3D8CA 1NY71 1YI7A 2BFUS 2BYVE 3AMNA 1N1VA 2VULA 2R49A 5JLVA 2AYHA 1RVF1 5ABJC 2PHFA 4YARA 3D0JA 1GSLA 1LB2A 1G9FA 1RINA 2HKXA 1DQ6A 1DZTA 2H6BA 3M3QA 4MVTA 3GZUC 5A3MA 1WBFA 1S1AA 5AFBA 4AEJA 2A6VA 3PJYA 1V6LA 1DQ4A 2GALA 3NJZA 4G3YC 1AF9A 1BQPA 1EY2A 3PVEA 1PIV3 4QGLA 4LLFA 3WDWA 5L36A 1QJU2 4XJZA 2Z69A 1LGNA 2BNNA 2V09A 3WCSA 3QH7A 3POWA 4AEDA 5KC5A 1MQTC 4N43A 4JGYB 3GF6A 1BYHA 1H1MA 1W6NA 3MICA 5BNNC 2ZHKA 1JYIA 1N47A 2ZS6B 1O7FA 2VPVA 1I6XA 4O9EA 2P17A 5I0RA 2XLAA 1QH6A 4RGGA 5FMOS 1VB2A 5CFDC 1RUJ3 2VECA 1FNYA 5EJ3A 4MH0E 4D7TA 4QQHA 1QU0A 4XHBA 2HWB2 4EWDA 4NHMA 3PNAA 1QKQA 3MPBA 1GR3A 1NXD1 2HWE3 4YYOA 2MPFA 1OKQA 2B9UA 3PMEA 4QD2A 2VNRA 2YDEA 1PO12 1D2QA 2RS52 5BNOC 1S2BA 3LA2A 5DXDA 4AEKA 3ZN6A 2UWCA 1IS4A 4P14A 3AK0A 3BU7A 1DG6A 2BW8A 1EP0A 1NOVA 1MACA 3AZZA 3BOPA 1KD7A 1AR62 2RS13 1KS4A 2GMMA 2IC1A 1U5IA 1KJLA 1D2SA 2XVLA 3GYDA 2D3PA 4XYXA 4ISRA 2FZ1A 2OVUA 4QQOA 1ZRDA 1R083 3KMHA 4M0HA 4QPGA 1C5IA 3JB8A 1N3PA 3AM2A 1S0DA 2TBVA 2GC0A 4Y1YA 1A78A 1HQLA 2YC0A 2PN5A 3CL1A 3RSJA 3LOIA 5C4WC 4AW7A 1GQGA 4GULA 4BA6A 1R1A3 2I07B 4K40A 1ULGA 1PNFA 1ULCA 5EYYA 4DPNA 2FQPA 4Y20A 1LOAA 2Q4SA 4W65A 2WFF2 2A6ZA 4R9AA 3LSDA 2JD4A 3FWEA 1PGL2 1MZ6A 2ZGTA 4XFFA 2UYAA 3AXEA 4H7LA 5DG2A 2P3IA 5DZFA 4AGVA 1FPN3 2JENA 2RR11 2GU9A 1UIJA 1EYBA 2C9AA 4E2SA 4R4XA 1QJY3 2WIIB 2RJKA 4G4FA 4Q8LA 2RE9A 1ZBA1 4IXLA 1W0PA 1QNYA 1KQRA 1POV0 4XFHA 1LRHA 3ZYGA 1CESA 3O5SA 3OTFA 1O4ZA 4LO4B 4KU8A 2OUJA 2AZ5A 1W6MA 3LZZA 2BWCA 4BQ1A 2GH2A 4ZKTB 2O8OA 2ZGOA 1XXNA 5JR7B 4JC1A 5CA6A 2WNVA 1VBB2 3WY6A 2OA2A 2D7FA 3L2HA 4HT1T 1AR83 4SLIA 4CTEA 1BEV2 1Y43B 1DGWX 2EF6A 3BOWA 4NOTA 4DZGA 5JZGB 2PAKA 3VBUC 3KGLA 3MIEA 2V5YA 1HRV2 3G6JB 1HXS1 1RUH1 1ZBE3 2C1FA 1W0OA 2R071 1ZRFA 3OYWA 1RJ8A 5F6LB 2PA7A 1XNCA 2Q1MA 1CR7A 1CN1A 2VOXA 4Q4Y1 3FJSA 1LULA 5LEKA 1XU1A 2XJQA 4P9LA 2FHRA 4RQPC 1Z7S2 1PVC2 4MLOA 1V6KA 4PIXA 4IV3B 1DYKA 1I5ZA 1W6OB 3KT4A 3CJIB 4KH9A 4XBNA 3WP3A 3EJKA 3ZYRA 4AI2A 4UW5A 2PHDA 1MEC2 1NCQC 4ASLA 5D1IA 5K0UC 4OVEA 3ZFEB 2OZJA 3ATGA 1CAXA 5IK4A 1RUC2 3FMGA 1BMV2 3X29B 4N9HA 3MW4A 3AMQA 3U4XA 4CP0A 3J8F2 4Q1PA 3VZJA 1Q43A 1MQTA 2DUQA 2ZMKA 1QJU1 3O0VA 5L7OB 1SCSA 2WWSA 4YRDA 1OPOA 2ZKLA 5AC92 3UV9A 4CDQB 1VAKA 2DUPA 1GZCA 1VBE3 4YW5A 3MIBA 4BE3A 1ND2C 2C0ZA 2NQYA 1YO8A 2QDNA 4KG0A 3KT7A 5CFDA 3ACLA 1ZYBA 2ZJCA 5J7MA 4M01A 5SV8A 1GFF2 1S0BA 4YGDA 3AYDA 4F8AA 4YM3A 5CG9A 5CAZA 2EXHA 2P2KA 1APNA 2TUNA 3NW4A 4D3WA 5GLWA 1CD3G 1W6QA 3SMHA 1OQEA 5C9AC 3AKQA 4C90A 2HWB1 1NLSA 1ND3C 4PLNA 4Q0UA 4IV1A 1L3JA 2XBO1 4UBHA 5BNOA 1OMIA 2BEOA 5GZCA 4LEJA 1SCRA 2ZX3A 1AXKA 4Q8KA 2A75A 4XXAA 5DDJ1 3ZYIB 4A7ZA 1PO11 4Q27A 1R093 1VBC2 2RS51 4AFDA 2XGXA 5JOYA 1QQP3 2HWF3 1RIRA 4WVWA 1BVP1 4I09A 2VVEA 1LOFC 3SH3A 3RI8A 4MYEA 4YW2A 3WW2A 2NLRA 4RD7A 3ZSJA 3B69A 3M3EA 4GH4B 4CDXC 1IKQA 5IK5A 2VUAA 4RHV2 5ABJB 1VJ2A 2JG8C 3N4MA 2JKBA 1H9WA 3VBFB 3ZXAC 1RUI2 3ILRA 5C4WA 3VBSC 1GQHA 2VY0A 3J4UH 4IEWA 1PMIA 5T54A 2ZGLA 5T3NA 2BQPA 2EIGA 1IPKA 2DFCA 3ZYPA 1JBCA 4FPOB 5FPZA 1ZRCA 3I7DA 1RUD2 4HFSA 1QDCA 2A73B 4MX3A 3B5LB 4H3WA 5F1RA 1H4GA 4FPCA 5EV7A 4XMAA 4FOVA 3IMNA 3ZN5A 2K2SA 5A33B 3VBHC 3WP6A 4HPKA 3VDDA 3RI9A 2WFF1 3E5UA 5BNNB 1WLTA 1YFWA 5JOZA 1PGL1 1V6OA 4TSVA 1FMD2 3AZWA 1KJRA 1D4M2 1QXPA 3RYKA 4I30A 4EJRA 1RITA 1JXNA 1SFYA 3MEPA 1KFXL 1LENA 2IXJA 1LHNA 4EN7B 4NN0A 2R0HA 2R1DA 4PQ9A 3VKFC 4Y22A 2RS33 4QMAA 5GJ6A 4B3NA 5HI0A 2YV8A 3S30A 1S0JA 1I3HA 4Y1VA 1DQ1A 3SHRA 4XTPA 5I8YA 1NE6A 1AZDA 4JDOA 4Y5Z0 1BBT3 3ZDSA 4LBQB 4M0NA 1WW4A 4A3XA 4XQ4A 1WCKA 5JAXA 2K0GA 1MZEA 1O4YA 1EAH2 1NQDA 3PLQA 4IQPA 1X50A 3JD71 1CIWA 1ZZ8A 3VBUA 1VBB1 2HWC3 2IZWA 2VGDA 2D44A 3KSCA 1CPNA 4XHXA 3WW1A 3E6BA 1DQ2A 3CO2A 5BNPB 2CYFA 2HWD3 2YMZA 5K7PA 4Z92B 1LECA 1DQ5A 4AI3A 4C0BA 2R32A 3DKWA 4AQ2A 3J26N 2JEMA 1YFXA 5KXCA 1YLLA 1WLWA 3N36A 2PQQA 3EXUA 4RS5A 3CEWA 1ZREA 1HLCA 5J36A 1PVC1 4L9BA 1NCQA 1RVF2 3ASIA 3RMYA 2JG9A 5K0UA 4Q4V1 3FLPA 3SCGA 3UKVA 1MEC1 4S2DA 5KC6A 5HBAA 3IPVA 2GNBA 1MR5A 2D43A 4I3GA 3OGGA 5J48A 2ET1A 1Y3TA 1LR5A 3M3OA 4HETA 2SBAA 2HEYF 1SQ4A 1PIV2 1RUNA 4GWNA 1UZYA 1RUC1 1RUG3 2D6MA 4YNIA 2AGSA 2B46X 2WNUB 3J8F1 4Z8BA 2X5IB 1H30A 1HKDA 1RUF3 1DFQA 4MUVA 4R9BA 3MIGA 1POV1 4XF1A 2BWAA 5GLTA 4ORFA 2YZ4A 3FC0A 1WMEA 1DLLA 3VLBB 4Q26A 1FT9A 4AFMA 2GNTA 1JUIA 4XJUA 3VV1A 3I59B 5C9AA 1RUJ2 5EFUA 2H6CA 3M1HA 2VQ0A 1HV0A 1UPSA 1VRH3 1W39A 4IEZA 3PVNA 4XJAA 2XL7A 1SMVA 3HT2A 3KS7A 4WBBA 5T5OA 4CEYB 2GSYA 3THTA 3DUIA 3RRDA 5J98B 2DCKA 4I2OA 2XG3A 4COYA 1AHSA 1O5LA 3IKWA 2LUWA 2XHKA 1QY4A 4E4ZA 1LOFA 1VBC1 1PNGA 3AJZA 1PVXA 2BNOA 3OF1A 4K3UA 4RQPB 3WG3A 1QJX2 4CDXA 4BLJA 2BGCA 2VOVA 3ZMOA 2EVXA 2WLPA 3MLLA 5L73A 4LO8A 4YM1A 2PHLA 2XJUA 4HZFA 3B94A 3VBSA 1G9DA 4RHV1 5CVRA 1F5FA 2BTVC 3M70A 4KQ7A 1NXMA 3WNXA 1RUI1 4BZ4A 2B5HA 3VKLA 1MS3A 3AP5A 1AYN3 2E6VA 2ZGKA 1HRI2 2E9QA 1N1SA 2MHFA 3VBOB 4A2UA 4MGZE 1R1A2 4IV3C 2NYYA 1Z0HA 3CJIC 4J1XA 2NP0A 1I1EA 4I0WB 4TWTA 1RUD1 3S7IA 2ZGPA 4K1YA 5BYNA 1O3TA 2E53A 3W59A 1RGSA 4R4ZA 1YI9A 3HBZA 4AQTA 1Q8SA 1EPZA 3GHMA 4F83A 3FX3A 3POYA