3L2HA

Crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
b'GMDTRKLLLTAQEISRMKGEHKVHFLNPGAVRVNKSLGDAVGLRHMGIHLIQIEPGKESTEYHLHHYEEEAVYVLSGKGTLTMENDQYPIAPGDFVGFPCHAAAHSISNDGTETLVCLVIGQRLDQDVVDYPNQHKRLYRNNGEWNLVDMADIRVLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar phosphate isomerase
publication title Crystal structure of Putative sugar phosphate isomerase (AFE_0303) from Acidithiobacillus ferrooxidans ATCC 23270 at 1.85 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans
molecule tags Isomerase
total genus 36
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3l2hA01
1X7NA 2PQQA 5I0UA 5I8SA 3E6DA 1O4TA 1GQGA 2GU9A 4HVOA 4I01A 2BEOA 4XF3A 1IPJA 1UIJA 2Z69A 5C6CA 4D7TA 2B5HA 4QGMA 4YSFA 4O9EA 2QVSB 2CGPA 1NE4A 2OZJA 4BHPA 2D93A 3KGLA 2ET1A 3ST7A 3KSCA 3EJKA 2QCSB 1ZRFA 2O8QA 2XHKA 3PVBB 3IWZA 5C8WA 4HSJA 3SCFA 1RGSA 4UBGA 1X8MA 4BYYA 5E1RA 1ZZ8A 1ZRRA 4L11A 5J3UA 4FAGA 3L2HA 4N9HA 3NSTA 3ROUA 4LTAA 4MV2A 1I6XA 1YFWA 3BALA 3B02A 3DV8A 1Y3TA 4WVZA 3U0ZA 4GULA 1NYWA 4KWKA 3E5QA 1UD1A 3G7DA 2CAVA 4HN0A 1G6NA 3H3UA 3UKNA 2IXKA 4WBBA 2B8MA 2UY9A 1ZZ9A 4K8FA 5HI0A 1O5UA 1YLLA 4IEXA 2QJVA 3OF1A 4Q29A 4XF9A 4BIFA 3RYPA 4QX5A 3WW1A 2EA7A 2H6BA 3O14A 4J1XA 4XEZA 3UKVA 4HN1A 1CAUA 3I59A 4ONUA 1OI6A 4Q0QA 5JR7B 3FE5A 2IXHA 3H1MA 3OGJA 2ATFA 5KHKA 4EWAA 1LKNA 5J7MA 1RUOA 3SHRA 4H7LA 4UXAA 3S0MA 4R52A 3MDPA 4JV4A 3GBFA 4XFCA 4QGLA 2XLFA 3R6SA 5LEKA 1J3QA 3IBMA 5KHJA 3ACLA 1CAWB 3USSA 1EY2A 3FFQA 3NVCA 3N4MA 1WA4A 1OFNA 2PAKA 2VECA 2DCTA 4X6RB 2UYAA 2E9QA 1EP0A 3EQEA 1RC6A 2FMYA 2GC1A 2XKOA 3FX3A 1FI2A 3I7DA 4AVBA 5I0SA 3SCGA 1DZTA 4EV0A 4QM9A 4HBNA 3VHRA 1YWKA 5FQ0A 2GC0A 1YFYA 3D82A 1FT9A 3FWEA 4D7SA 3NJZA 4ORFA 1V70A 3I59B 4Q0UA 3BCWA 4ZU4A 4N9IA 2K0GA 1CAVB 1U12A 3WW4A 3ZDSA 3WW3A 2BGCA 4YYOA 2BNOA 4YARA 2ZCWA 2CAUA 4KL1A 3LOIA 2B9UA 3H3ZA 4AVAA 4IEYA 3TNQA 1GQHA 4I3PA 4E2SA 5CU1A 1HW5A 4AVCA 1RTVA 1YUDA 1CAXA 4IEOA 4KWJA 1SQ4A 2PHLA 5LEJA 2PAEA 2XLGA 1VP6A 3CEWA 1QXRA 3OD0A 2GC2A 4CYDA 3LWCA 1ZVFA 3HIFA 5K8SA 4ZU7A 5JSPA 3MPBA 3BPZA 4XFFA 1WGPA 4HZFA 5FLHA 4OFGA 4IEPA 1O3SA 2D40A 2IXCA 3M70A 3EO6A 4IETA 3DL3A 2D5FA 1NZCA 2CV6A 5FPZA 2QNKA 4YRDA 3LAGA 3CLPA 5JSOA 1ZNPA 3ETQA 5BUVA 2PYTA 4HMZA 4LULA 3I54A 4HSLA 4KU8A 2Z2SB 3NKTA 2ET7A 5I93A 1X82A 1J3PA 5I91A 4R8HA 3E5UA 4UBHA 3U10A 1NXMA 2GAUA 3MZHA 4YNIA 2WFPA 4F8AA 2OA2A 1PMIA 5T3NA 2O1QA 2IXJA 5FLJA 1H1MA 3NL1A 4XFAA 2PA7A 4XFGA 5BXXA 1I5ZA 4XF0A 5EZWA 4ZU5A 3RYKA 5J48A 3S7IA 5AVPA 1DZRA 4IEVA 4MX3A 4Q0SA 5FPXA 3RDIA 4XF4A 4I2OA 5KHHA 3ELNA 4LUMA 4Q0PA 4FAHA 2Y0OA 3LZZA 4AXOA 4PIXA 1UIKA 5KHIA 4AQ6A 2H0VA 3OTFA 4Z07A 4E2GA 4O9GA 4IEQA 3H50A 2IC1A 1TQ5A 3BB6A 1LB2A 3H7JA 2PTMA 5E16A 1FXZA 3DKWA 3KCCA 1ZREA 4OLLA 1CX4A 3CO2A 1VR3A 4MGZE 4MUVA 4P9GA 2GZWA 3E97A 3HQXA 2PFWA 2QDRA 2GH2A 5BPXA 4XFBA 1EPZA 1EYBA 5LRRA 4XFHA 5JCTA 1YHFA 3E6CC 3TNPB 3MYXA 3UKTA 4MGKE 2MNGA 3CF6E 4NVPA 3PLQA 4EWEA 1CAUB 4X6QB 3JZVA 5FDBA 2H6CA 2HJIA 1ZX5A 4HVQA 5FCCA 3SXWA 5KHGA 1O3TA 2WC2A 1ZZ7A 2PHDA 4XETA 3ES4A 1RUNA 1IPKA 3H1WA 3PNAA 4F7ZA 1OD5A 4EROA 4PJYA 4XF1A 1ZZBA 2BNNA 2UY8A 4WZCA 3IDCB 2XL9A 1DGRA 1CGPA 3RZZA 3C3VA 3IIAA 2F4PA 3DN7A 4JTNA 2PAMA 4IEZA 1UW8A 3RNSA 4IEUA 4KU7A 4XFIA 2K9ZA 3RYRA 4Q0VA 1J59A 3QACA 4QGNA 2BYVE 3EHKA 4PIYA 4HLTA 1VJ2A 1QY4A 5FQ0B 5I0TA 5LRSA 2N7GA 1XE8A 3IDBB 2OYZA 2IXLA 3ES1A 2Q30A 3RPQA 5CADA 5F1RA 3M3IA 1O3RA 3SMHA 3FZ3A 3KGZA 1Y9QA 3KMHA 4KWLA 4JVAA 1YFXA 5I8YA 2MHFA 1Q43A 4DINB 5I0RA 4QXKA 2XL7A 3FJSA 4MGIE 2Q4SA 5JSRA 5JAXA 4LUKA 4I0AA 3WW2A 1QWRA 1CAXB 4MH0E 4RD7A 1ZRCA 2EVXA 1CAWA 2UYBA 3D0JA 3CJXA 4HVRA 1O7FA 5D1IA 3U11A 4B29A 4J1WA 4QMAA 3HT2A 2I45A 2OZ6A 1H1IA 3NW4A 4IESA 4A2UA 1XE7A 3E5XA 2C0ZA 3S7EA 2XGXA 2KXLA 2EAAA 4I09A 2Q1ZB 2VPVA 1J3RA 5BV6A 2P17A 1OMIA 4LA3A 2OPKA 3LA2A 3BU7A 4AQ2A 1CAVA 1SFNA 4FT8A 4IERA 1RL3A 3OCPA 2V09A 4E2QA 4FBFA 2IXIA 1Q3EA 2XKPA 4MGYE 2ZKLA 4MZUA 5FLIA 1NE6A 2VQAA 4I02A 1J1LA 4EWDA 1YFUA 1Q5OA 2Q0AA 4QM8A 2GC3A 1LR5A 1XRUA 2BNMA 3HT1A 1JUHA 3SCHA 1ZZCA 4LEJA 3FHIB 5I8TA 3CL1A 5BY5A 3E6BA 3GYDA 5KBFA 1UPIA 2ETEA 1ZZ6A 1DGWA 5CVRA 2FQPA 2MPFA 3EBRA 3H8UA 4Z82A 4PIZA 1O3QA 2D5HA 1SEFA 4JTOA 4BH9A 1PM7A 3LA3A 1X8EA 4LA2A 4LLOA 4I0BA 1O5LA 1QXJA 4IEWA 1J58A 1ZRDA 3H9AA 3H7YA 5EFUA 1WLTA 3D0SA 1LRHA 3H1YA 2HKXA 1L3JA 1UCXA 2XLAA 3LA7A 3QOPA 4L2NA 4TLFA 4META
chains in the Genus database with same CATH superfamily
1F9KA 2QQWA 2YPDA 5CEHA 3E6DA 2HBUA 3JU9A 4DB5A 2JE9A 5FY4A 5BNQA 3BU0A 5A1FA 4NHXA 5E89A 4YW1A 2VO5A 3MUY1 3T0BA 3N9OA 1AR91 4I01A 2W39A 2ZHLA 2DWRA 3BTAA 5DDJ3 5A3WA 3LEIA 1I9RA 3WCRA 3T0AA 2Z69A 3FBYA 2CDOA 3W58A 3POBA 4YM2A 2DYCA 2B5HA 4LBNA 1N3PA 1WLWA 4YSFA 1QOTA 1XQNA 2D3PA 3VBHA 4GZ9A 1QOSA 1OSGA 3VGIA 1A8DA 1GLHA 2D93A 2XJQA 5K0UA 4BHPA 5L7OB 1F4HA 1QJU2 1H8VA 3U14A 1PMJX 1VBD3 3AKPA 2G9GA 2B39A 4JDOA 3ST7A 4JHTA 1XU2A 4FPGA 2E7AA 4GKXA 3A22A 1W2NA 1RVF3 1DCSA 2JDMA 3P5BA 1G86A 2JEMA 2ZGOA 5FY7A 1RVF2 3IWZA 1VBA3 4OMDA 4CP2A 3UNPA 3UGFA 3T2OA 2HEVF 1RGSA 3HQRA 1VBA2 2NP0A 1X8MA 1F5FA 2WLPA 3OYWA 1RUJ3 1AVBA 2BUKA 4FAGA 2GMEA 1RUJ2 3S30A 2XJPA 5CFCA 3PVEA 3BGAA 3ROUA 2PHTA 3RZJA 1VAKA 2WNVB 3HPNA 4CDQC 1HV1A 2RHPA 4XZUG 1ND2A 3K51A 3B01A 2JG9A 4P5YA 4EN7B 1BK0A 1IKQA 3I4IA 4L9BA 2IFWA 1LODA 5FMOL 5IVCA 1NYWA 1G7YA 3MLJA 2E6VA 3HNBM 4LO5B 3WG4A 2QQNA 4DNYA 4CU6A 2W1QA 4QXHA 2WN2A 2CAVA 1NY72 2P34A 2W2IA 1W2AX 5FBZA 3OSDA 2D3RA 4Y3OA 1GP5A 3BTZA 3MIGA 4JX0A 3WNPA 2VGDA 4WBBA 2PHWA 4DFSA 2UY9A 4UW3A 1QJY3 2D44A 2BBAA 1YLLA 5FIXA 2YFZA 3VBHB 4Q29A 4Y24A 3S57A 2YC0A 2YZ4A 2E53A 2GALA 4QX5A 3UYJA 4LIUA 4X8PA 5IVVA 3RZMA 3PURA 2VE1A 3IT8A 4URAA 2EA7A 2UWAA 1BKZA 3H0OA 3O14A 4MSVA 3UKVA 4HN1A 3O1OA 1VB4A 1AJOA 2JDPA 3OD4A 3WDXA 1RXGA 4COVA 1Z7S3 1LOAA 1OQDA 5DQ0A 4AEDB 1OKQA 4ONUA 1OI6A 1Z7S2 2YPJA 1FPN3 4OCTA 2JE7A 4JGZC 1WD3A 4XUOA 3OGJA 4WVWA 5LBEA 2ATFA 5GZGA 1RUI2 2BQPA 4GH4A 5JMCA 2A3WA 1SPPB 3OYWB 4RSUA 4N8MA 3L2YA 5IVYA 4CRQA 5J7MA 5H9SA 5CFDC 3IN9A 1RUOA 5CFCB 4A45A 3S0MA 1Z0HA 4AEJA 4R52A 1D2SA 1MS8A 5EIYB 1DQ5A 1GOFA 4LXLA 1TME1 1KEXA 1QJX1 4HT1T 5FZFA 4QX8A 3WNNA 2E31A 3R6SA 2E26A 1J3QA 2Q8CA 5KHJA 3WG2A 1GU3A 5HXVA 2HWB1 1DQ2A 3NKGA 2WSUA 3KD4A 2A70A 3JQXA 1X9TA 3SKVA 2Q5TA 5KXBA 4YFWA 3N4MA 2ZACA 4N43C 1WW6A 5KWRA 4MVTA 3VZOA 5FY9A 2OQ7A 4NJ4A 5JXJA 1F5JA 1T2XA 3ACGA 4MLOA 2ZTNA 5CZKA 1F2NA 1Q8OA 3OJBA 2DUOA 1RC6A 4YZ1A 2ZHMA 3K2OA 3JB8A 4AVBA 1FI2A 2C9KA 4CSWA 5D8AA 4QM9A 4CP1A 4XC9A 3LF7A 1RUF1 3OPWA 4YVWC 1W05A 3USUA 4N53A 1YFYA 1REFA 3EB7A 3JQWA 2VD7A 2ZAHA 3NJZA 5FO8B 2AZ5A 2CL2A 2O14A 3A21A 2FMDA 4QX7A 3T4HB 4BA6A 4ZU4A 3OBTA 4XVHA 2RM23 1WMDA 3V64A 3FLRA 1PK6B 4GH4B 4NRQA 2RM22 3PUHA 3WW4A 1LU1A 1HXS3 1WA6X 2K46A 2W0XA 4YYOA 2BNOA 1OLQA 2VMGA 4UW5A 1HXS2 5GZEA 1OA4A 5FY5A 3ZXLA 3WEZA 2H0BA 4IDZA 5HBAA 3LOIA 3H3ZA 4XDOA 5L9RA 3PUIA 3UETA 2ZHNA 4ZZ5A 2DVBA 1QJEA 2A6XA 4Y5SA 5FZCA 4I3PA 4JHZA 3T4VA 5CKNA 1RHI1 3OGGA 5B2GB 1AR92 1S0DA 1RTVA 2ZGRA 5FYYA 2F4LA 3T1LA 1J84A 3DEMA 3POGA 3UGGA 2PHLA 1VLNA 5LEJA 3KHCA 4Q4X1 1XSRA 4QX2A 2GC2A 4CEYB 4CYDA 1L7LA 1ZVFA 3HIFA 3ILFA 4YWAA 3LEMA 1PIV1 3POEA 5IVBA 3MPBA 1OUSA 2WO2A 5LK5A 1OH4A 1WGPA 3DXUA 1YO8A 3HBZA 3N9LA 4LHKA 3VD7A 4Q1RA 2JG8A 4OFGA 4ZONA 2QQIA 3NJXA 3VKMA 3ZFEA 2D40A 1PZ8A 2WFF3 1T6BX 3M70A 2WFF2 5FUIA 3VBOA 3ZFGB 4IETA 2BFUL 3USUB 4BJ0A 3ZPYA 2EIBA 2ZHKA 1TMF1 2W3JA 2R073 3ZN6B 2R1DA 3AZYA 2CV6A 2R072 3LAGA 1ODMA 1PNFA 4R9BA 1Q8PA 4Y1UA 3VB9A 5BUVA 5HV4A 4G4FA 1EV13 5F3CA 4HMZA 2WYSA 1EV12 3ZFFB 2HWD3 4ZS2A 1W9YA 3I54A 3UV9A 1TZOA 2Z2SB 2WKKA 1GZCA 3NKTA 1JHNA 4UFKA 2ZX4A 1H8TA 1X82A 3DKQA 1S2BA 4GA9A 1J3PA 1XYPA 1OOPA 1GWLA 4UI9L 2HEYF 1RIRA 4LO4B 3ZSLA 4LBQD 4AR2A 2JDAA 4JKLA 2JDUA 5A3UA 4YNIA 3AKSA 1HN1A 2WFPA 2OA2A 5EJ3A 1AUYA 4MG2A 1VRH1 2XJRA 5EV7A 2SBAA 1UYZA 2FCUA 2O1QA 3RMXA 1F4AA 1QH6A 2RVAA 3VLBB 2GNMA 1W8ZA 1QU0A 4XFAA 3NL1A 2GN7A 4PLOA 3SLIA 4MYEA 1LHUA 4QXBA 3WV6A 4LJHA 1UY2A 1ACCA 2VU9A 5ISLA 2A3XA 3MV01 3RRDA 2JKXA 2OUHA 1LOFC 1G9AA 4LBJA 1FAYA 2JG8B 4XJUA 5FPXA 5L7OC 4XF4A 3DPRA 4LBLA 4D6SA 3ZFEB 3ZPOA 2RJ2A 2WWJA 2OIIA 4FFGA 1COV1 2RS13 4FOVA 3GJAA 4GJZA 1XNCA 3PMSA 1R093 2WO1A 4AXOA 4XBNA 1UY1A 4AOCA 2PN5A 1RMU3 5ABJA 1ZRCA 4CXXA 1MVQA 1YQCA 4Q4V1 3BN6A 3IDEA 3ZXAC 1HRI3 1FV2A 2XMLA 2VZQA 2VZVA 4P9WA 1HRI2 4PT6A 1TME2 3I2JA 1SCSA 1VR3A 1H8TB 2HWB3 5JI7A 1CPMA 1OOPB 3AB0A 3HQXA 2HWB2 2YHJA 2QDRA 3ZDVA 4CXWA 3HQUA 3KV4A 2D6LX 2J1EA 3ITQA 3NAPA 1O4ZA 4OMCA 5LRRA 4XFHA 4UAPA 1NAEA 4FXKB 2VAUA 1NKGA 2CYFA 4QPGA 1BEV1 3MYXA 1VBC3 3UKTA 3OUJA 2MNGA 3N7KA 5F5AA 4QPIB 3WCSA 4V1PA 4OQ8A 3PLQA 1VBC2 1PGL2 4QX1A 1LCLA 1LHWA 1CQ9A 3CKHA 1ZX5A 2W5FA 2WAAA 3LOBA 2WUHA 4WVVA 5FCCA 2X8KA 1GBGA 4ITCA 4FTBA 3SXWA 1RUE1 1BBT1 2RDQA 3VBHC 4DIQA 5IHRA 3R05A 1ZBA1 4Y4YA 4K9SA 3V56A 1IPKA 4Q5OA 4XZPA 2WT2A 4K1YA 5F37A 2AENA 4HFSA 3ZYFA 3VKOA 3VL9A 5A70A 4FOWA 1QOOA 3AK0A 1LHVA 4AEDC 3DUIA 3GCWA 3LFIA 1XPWA 3OBZA 1LAJA 2EALA 4XOGA 4AHYA 1D4M3 5ABJB 2VR4A 3MBWA 2QUOA 4INDA 1CGPA 4A3XA 4PDWA 4TN7A 1CONA 1S1AA 4XQDA 5I0DA 4GKYA 4IEZA 3PVOA 5CFCC 3RNSA 1S0JA 4IEUA 4KU7A 3VBFB 4D94A 2ZMKA 2ZMLA 3ZSEA 3WY6A 1WW7A 1RHI2 2JD9A 4WVMA 2HWE3 3QACA 3MIEA 2JG9C 5J98B 4FO9A 1K5MA 2DFCA 2HWE2 2VC9A 4GXLA 4Q4X3 5DUUA 4E4SA 2DF7A 4AI0A 4Q4X2 4OUEA 3ZX7A 3J26N 3NAPB 3ZLIA 2W68A 1R1A1 1VJ2A 4HLTA 5DAXA 4EN0A 5FQ0B 3GZEA 5I0TA 3H8OA 3ME2A 1C1FA 4QPGB 5A3MA 3O1TA 3AJYA 2W9XA 1SCRA 2Q30A 4JQTA 1STMA 5F5IA 5A7QA 4OULA 3SISA 1CIWA 1PX4A 1Y4WA 4R4XA 4B4PA 3BYWA 2ARCA 3AL6A 5B4NA 3FZ3A 1GMMA 4OZXA 3MO4A 1PVC3 3RI8A 1Y9QA 2P6HA 5IAXA 1JUIA 1TMF2 2CSGA 1AL21 3L9JT 5F5CA 3WNMA 5I8YA 1BYHA 4E8DA 5FJKA 5I0RA 3PL0A 4PI0A 3WF0A 4Z2AA 2Q4SA 4UF0B 2YUEA 2JWPA 2ADDA 5FYMA 4CUCA 3SKJE 5E88A 3VUOA 4GH4C 4KI5M 4YW7A 1F35A 4RD7A 4C90A 3W9AA 3SEEA 2J1RA 2EVXA 1TNFA 2HWC1 1CAWA 2UWBA 2VOTA 3P1IA 5D2AA 3MLKA 1GNYA 1PM4A 3R0RA 4IV1A 1GANA 4LBMA 4Q8LA 4C1XA 4HVRA 2L9LA 4W8JA 4YG0A 2ZAAA 4RQPB 1J1TA 2AUYA 5T5LA 1BCXA 3THCA 1QF3A 2W08A 3RVHA 3POSA 1W6OB 1AYM1 2YB7A 1K5MB 1VRH2 4IE5A 1OQ1A 1W03A 1ULFA 4IESA 3VDAA 1CVNA 1IQAA 1WWYA 1XE7A 3VZJA 5FYCA 5F2SA 2C0ZA 1AJKA 5KC6A 4CCMA 2KXLA 1WCKA 2ZX0A 2EAAA 4I09A 1E5RA 2VUJA 2V4AA 1OMIA 3PU3A 5IVJA 1VAMA 4CEWB 3H8RA 1WW4A 1COV2 1G8WA 2VULA 1UZVA 3IM0A 2C5DA 2VMDA 3THPA 5L36A 5C4WA 1NLQA 2JX9A 2QQVA 1V9U3 5FV3A 3BOPA 2V09A 2D6KA 3FUOA 4IE0A 1W6QB 2CTVA 4D69A 3WXPA 4JDNA 2XKPA 4MZUA 5FLIA 1BQPA 2HBTA 5T5JA 2LROA 1YXWA 1CESA 4ATEA 2OVUA 4OHYA 4NHLA 1AX0A 4QT6A 3AC0A 1VIWB 2VBBA 5CYYA 4QM8A 3U37A 3U07A 3ZFFC 1LR5A 4K3UA 2W91A 2FDHA 3KB5A 1L7RA 4DEVA 3AZZA 2ZX2A 5I8TA 3CU7A 3Q8CA 2JIJA 3VDDB 5KBFA 1DDLA 3WT3A 4L8QA 3ATGA 1DGWA 2J1VA 5CVRA 1V0AA 1GOHA 5FY1A 4CA9A 5H9PA 3H8UA 2EICA 3B94A 5IFPA 4JTOA 1AR83 1BZWA 2MEV1 1BEV2 5GLVA 1BXHA 3VZNA 4LA2A 3NNFA 3G6JB 3AP7A 5FO7B 1AZDA 1O5LA 2Q1MA 3LQCA 4IE6A 4RGGA 1WD4A 1J58A 1H4HA 1MZ5A 1ULDA 2QTWB 3CMGA 3H9AA 1BBT3 3H7YA 4ZKTB 1H2MA 1BBT2 5AVAA 1MACA 2WZR3 4A41A 2XLAA 2JG8C 2WZR2 4L2NA 3MICA 4META 4XPVA 1ZBE3 1X7NA 3ZFEC 1W0NA 5I8SA 5A3OA 5LZ6A 3VBOC 2ZGQA 1GQGA 3Q8AA 3FLPA 5FZMA 2J1SA 1UIJA 5CIRA 2BWCA 1U5YA 1VAVA 3ZMNA 4AFBA 4D7TA 4RR3B 1SMVA 4M3CA 3KWVA 2DCJA 4RFRB 1R1ZA 3CJIA 4O9EA 5J36A 4JGZB 5GJ6A 3ZR6A 5LBBA 2QVSB 3J7NA 1HJGA 2Y33A 3WDWA 3ZYRA 2WT1A 3O5SA 3WOGA 2ZABA 3KGLA 4Y1XA 1CJPA 1H8TC 2ET1A 5F6LB 3KSCA 1OOPC 1WMXA 5IAVA 1GP6A 4ES9A 3KQ4B 1Q8QA 4GWMA 2QCSB 1R1A2 3PVBB 3HWJA 2BVBA 3LDKA 2VZPA 5DPNA 1HRV3 3WDYA 3FFZA 2A75A 1GZWA 4IL7A 5E1RA 4BYYA 1HRV2 4L11A 5J3UA 3L2HA 4QPIC 1RUH1 1ST8A 2V5YA 4JZRA 4QB2A 4UFIA 4XURA 1ULGA 3WNKA 5ACA3 5T52A 1A3KA 1XNBA 2CWMA 4NIDA 5ACA2 1YFWA 4B4RA 2DVAA 5A7WA 1AL22 1C4RA 5FK7A 1RUD1 3DV8A 1K12A 3LPFA 2CU5A 3VHOA 2VZUA 3VN4A 4OQ9A 2X5IB 3OBRA 3U0ZA 1OPOA 2OW4A 4HK9A 1NCQA 4KWKA 2XHNA 3QLQA 4IQPA 3U78A 2ZX3A 3KZ4C 4BXFA 3BTYA 1SLLA 2WDBA 2ID4A 3PJQA 3V0BA 3O1SA 1IG3A 5ABJC 2W92A 2A6YA 3UKNA 2IXKA 4M3CB 4OHWA 1NCRA 5FR3A 3GZAA 3QH7A 3ILRA 2PHFA 4FP3A 5FPUA 2QQOA 4ZPIA 3RYPA 4LR4A 3VBFC 1PO23 3SNMA 1AYM2 4FI9A 5ANNA 1PVXA 1WMFA 2WLQA 5EHDA 1WZXA 2RDRA 2IVIB 5LA0A 2QDNA 1VB2A 3ZOIA 4B4QA 3B00A 3ALQA 1JXNA 2OQ6A 4I0WB 1DU3D 1CD3G 3M3CA 5H9RA 4Q0QA 2R043 4P14A 4EN8B 3NAPC 5JR7B 1XE0A 2PXJA 1UL9A 1WBFA 3H1MA 4JKMA 4XDPA 2ZJCA 3PU8A 1GZWB 1LKNA 3NRUA 2GN3A 2LS6A 2DDUA 3OG2A 4QPGC 4E4ZA 4XIOA 2WABA 1MZFA 5KC5A 4GWNA 3SHRA 2XPJA 1E57A 4UXAA 3KCYA 2RMU1 3D8CA 1QDCA 3LPGA 1OA2A 2VVDA 3Q8FA 4YM1A 3TAYA 2VY0A 5BNNB 3TEZA 1CN1A 4LOSA 3B7MA 4AF9A 1AX2A 2A3YA 4Q1PA 5FUNA 1XSQA 2TEPA 1UOBA 1WCUA 2XVKA 1GYKA 3ECQA 4TLGA 3TEWA 1OVSA 3SC7X 3WF3A 3ZSMA 4DPNA 4AK3A 1D0GA 1W2OA 3U4SA 4HANA 4J25A 3FFQA 3NVCA 4AFDA 2VZOA 1JMUB 3H8XA 3MW3A 4CP9B 4XUPA 2V72A 1U5XA 2LM3A 2XOMA 2BZDA 2VBPA 2R061 1R081 2D6NA 2VXRA 3CDZB 1EP0A 5JDBA 5A3LA 4YW4A 5DUWA 3T08A 4IW3A 1QH7A 1DYOA 1HQNA 2FMYA 3EXUA 2Q8OA 2GC1A 3IMNA 4GMP3 1DFQA 1DZTA 3NNMA 1UN1A 2YU2A 5A7NA 3RJRA 4BDVB 4D7YA 4EV0A 1RJ8A 3ACHA 4GMP0 1CJDA 4JGYB 4RQPC 4FTEA 2WS93 2RR13 1RUG3 3ZXDA 3FWEA 2D97A 2ORZA 2WS92 4D7SA 2VTXJ 1K5MC 1UMZA 5FRAA 4S2GA 3D4KA 4ASMB 2XG3A 2VZ1A 1WMEA 4CU8A 4N9IA 5GALA 2E63A 1MZEA 1U12A 3NNJA 3AXDA 4UYBA 5FZ6A 3WW3A 4E9KA 4YW3A 5LK7B 2FCVA 1LU2A 3I2HA 2C4XA 1CWPA 1WKYA 1UOJA 4FQ4A 4YARA 2ZCWA 5DG2A 1H0BA 3H3LA 2GSYA 4AVAA 3R4DB 4NHMA 4FPLA 4IEYA 1UXXX 3TNQA 4ARYA 2P3JA 1UMHA 5A1LA 4CEWC 5L9VA 1GQHA 3K4AA 3RG0A 2Z42A 3B3QE 1W39A 2HH9A 2OKXA 3U1XA 1HW5A 5T5OA 4A7YA 2JECA 4AVCA 1QJU3 3I3QA 3OGRA 3NV3A 4CZSA 5FP9A 2W1WA 1AF9A 4H14A 3ZXKA 1DYKA 2G4IA 3NJYA 2PAEA 3WVJA 1GWKA 1W06A 3AX4A 2YBPA 1QXRA 3CEWA 5FREA 1IZ3A 1YCIA 2F6BA 5DAQA 4R9AA 3PHMA 3GZTB 5C8CB 4ZU7A 3ZSKA 5FTTC 4XW3A 4CDXA 4P5HA 3BPZA 5C33A 3DYMA 2IUWA 4QXCA 4HZFA 4XFFA 5AC91 1ULPA 4MXWA 2JD4A 3ZR5A 4IEPA 1URXA 2VTXA 3GNEA 4AGRA 1O3SA 4BQWA 5K4LA 2VCAA 4CE8A 5CG9A 3VDDC 3SEPA 3S5QA 3WZ1A 2SLIA 2D5FA 4QKDA 3VV1A 2ZEZA 1IGOA 2QNKA 4CUBA 4W4ZA 4YRDA 3ETQA 3KVBA 1IQDC 2PYTA 4AWDA 3JUUA 3ZKUA 3VBSA 3UESA 2P3YA 1AL0G 3I8TA 4CP0A 1UZYA 3ZIWA 5G04L 1OLME 1BK1A 4FXGB 4NAMA 4YZ2A 2FDIA 5KXEA 2RS31 5GLUA 1DP0A 5JXIA 4DRVA 5I91A 5DMYA 1VBE1 4R8HA 2VG9A 4V2WA 5JXGA 2IVJA 1XYOA 2XVGA 4CCJA 1NXMA 2JDKA 3FUQA 4OVEA 1PMHX 1PGW2 1XBFA 2WNUA 3HJRA 1JZ8A 3MZHA 4U36A 1FOD3 4YW5A 5LASA 5C4WC 4BZ4A 2B42B 3M1HA 4F8AA 5K0UB 1FOD2 4PQQA 4OHZA 5T3NA 1EUUA 1SACA 5JOWA 4LIVA 1H1MA 3VKFC 4BE3A 2NLRA 5IJRA 3D6EA 4RR3C 1GUIA 2EAKA 2FZ1A 4CDXB 1I5ZA 1RUI3 3WSOA 3S7IA 5LY2A 1DZRA 4IEVA 1JOJA 3POFA 4Q0SA 4IE7A 5GZFA 4FTSA 1US3A 4QQPA 4RHV1 2AC1A 1AYN1 4JC1A 1UF2C 4XQWA 5TSWA 5JOYA 3I2OA 1BVP1 4LUMA 2JE8A 3A0KA 3B5LB 2Y0OA 1OVPA 2AYHA 1UU6A 2ZBJA 4LBQA 4BISA 1ND2B 2J42A 2JG9B 4H7MA 4NROA 5JOZA 2WAOA 1JYXA 2E32A 4CCNA 2VTFA 1CPNA 2H0VA 3CIHA 3K75B 4B1LA 2RMU3 1ZA4A 3V65A 4E2GA 4JAAA 5EPAA 2RMU2 1NT0A 1OF4A 2WA3A 3BB6A 1DHKB 3H50A 4IEQA 4P9XA 3DKWA 1ZREA 4ZXKA 3AYCA 3CO2A 1V6JA 5HCAA 2I2SA 2CHHA 5JI9A 2UU8A 4R9DA 3N9NA 1QMJA 2PFWA 2Q1FA 4FFIA 3A7QA 2AREA 4K7JA 3AYDA 1NOVA 2X5IC 1W28A 3FHAA 3E6CC 2NYYA 5CKQA 3DYOA 3C7HA 2WYFA 2BOIA 3KV6A 2O8OA 4EWEA 3U4XA 4L92A 3JZVA 4XDQA 5FDBA 5DAPA 2HJIA 2RDNA 3LE0A 1PHMA 1C57A 1KQRA 2A73B 3AFKA 3PMEA 3JBG1 5KXCA 5FYZA 1SZBA 3AYEA 4XABA 1LNSA 1JH5A 1QNYA 5KHGA 2BP6A 1NX9A 5DXDA 4YW2A 5C9AA 2B45X 3ES4A 3HMYA 1RUNA 3CZUA 1MQTA 2FDKA 3RJ2X 2Q8DA 4QB6A 1JS9A 1G9BA 1ZZBA 2UY8A 4LBQB 4WZCA 4XACA 1IPSA 1SLAA 3A4UA 5FZKA 2BOJA 1AR93 2YFUA 3C7OA 4EN6B 1JYTA 4H3WA 3WP3A 4CPBD 4N7IA 1PX3A 1TVGA 3TEYA 3R4SA 5EQUA 4EQVA 3IIAA 2F4PA 5JIAA 3WLUA 3DN7A 4BWOA 2PAMA 1F15A 2Y26A 3C7EA 1QDOA 4XFIA 2VQ0A 3RYRA 1QIQA 4Q26A 4D8MA 2Y6FA 3ZVXA 1I1EA 1IOAA 1VALA 4M01A 4NAOA 4UW4A 5BNNC 4G3YC 4LKSA 2ZS6B 4JKKA 3AKRA 2BYVE 2TUNA 2YGLA 3EHKA 4PIYA 5D8AB 4DZGA 1V6IA 1K3IA 1NCQC 4COUA 1XE8A 3P3NA 1JZ7A 4GWIA 3RSJA 4N53B 4LKEA 1MS1A 4BQYA 5A6ZA 2GH8A 3RPQA 3W59A 5AC92 5F1RA 3PUAA 4CUAA 5BYNA 3NWKA 1O3RA 4RYDA 4AEKA 2VL4A 5BNOA 5FP7A 4C0HA 1XNKA 3V0AA 5FXZA 5C9AB 4KWLA 1UX7A 1W3VA 4JGYC 1IS6A 1CR7A 1RUC1 2FDJA 4ZZ8A 2BFUS 5F3EA 2BDRA 2XVLA 1W6NA 3J7HA 2XL7A 4FPHA 1MS9A 4LHLA 4OUSA 4W6YA 5JSRA 3VKNA 1YQ2A 4LBOA 4D0QA 3M4FA 5CG8A 2FCTA 3POYA 1OXCA 4I0AA 2W46A 4NWWA 1QWRA 4MH0E 1LGBA 2JDZA 4ET7A 2RS32 1VBE3 2A7AA 1VBE2 4A4AA 1W2UA 1QNWA 5LATA 1JYWA 2X05A 3WF1A 5E8AA 5EP9A 2C24A 4B29A 4J1WA 3OPTA 3K4ZA 1EAH1 5LB6A 3VBRA 2DCZA 5EJ1B 4PLMA 3LDBA 5FKBA 5IVEA 4FPFA 2QQKA 1OQEA 3VBOB 3WQBA 2Z79A 1AX1A 4QQ2A 4LPLA 2GNBA 2XB6C 4CDWA 5IYYA 4TWTA 3SH4A 1A78A 5C8CC 3O1RA 1SFPA 4QD2A 1U5ZA 2P2KA 2Y6KA 4EN9B 1J3RA 5BV6A 2Y6GA 3MIHA 4HL0A 1ULEA 4LA3A 5GLTA 1R64A 3B69A 4OZOA 1AYN2 3LA2A 5F32A 1DLLA 5JZGA 5JR2A 3K3NA 3IB3A 2DUQA 4AQ2A 1FX5A 5A80A 1CAVA 3RQ0A 1TME3 4PLNA 1QJX3 1SFNA 1UO9A 4IERA 4QHBA 4IV3A 1RL3A 4OUMA 1QJX2 1V6OA 4A42A 2Y6JA 3WDUA 5FZGA 3TEXA 1W6NB 3HEIA 4UWDA 1JBCA 4YG6A 2QZ3A 1YJKA 2ZKLA 4AI3A 4FSJA 2A6ZA 3IPVA 2RE9A 4W6XA 4FQZA 3GHNA 3ETPA 2EF6A 3WUDA 2WO3A 2YROA 4P9YA 4EWDA 5A6QA 2FDFA 3MFAA 1YFUA 1Q5OA 5A33A 1OURA 4AI1A 1QJZA 1QQP1 2GC3A 3MFCA 4U2AA 3O0XA 3HT1A 5GLWA 1YNAA 3P3PA 3SCHA 1ZZCA 4Y33A 1BVVA 3EYPA 3M3QA 4JRLA 2ZKNA 1EPWA 3WP6A 4SBVA 1UPIA 2ETEA 4W6WA 3LGRA 5L9BA 4ZXEA 3SITA 1N3OA 3Q8EA 4K8RB 2MPFA 4MGTA 2EIEA 2W94A 4FOQA 1RUF3 4PIZA 4Z82A 5EJZB 5FYSA 3T09A 1SEFA 3W20A 4YM3A 5FXVA 1RUF2 1VPHA 1DGLA 4P9IA 5FZ3A 5K0UC 2VBDA 3ZXJA 3DPRB 1RITA 1GP4A 3WDVA 1YI9A 5LA2A 1PZ7A 3FHQA 4TZDA 1QXJA 1POQA 2O0OA 1W8OA 1ZRDA 1S55A 2VW2A 4ASLA 1UX6A 3JBG2 4KQ7A 1W9WA 1WLTA 2WZ8A 3GZUC 5HV0A 2B7YA 4CDXC 3RZKA 5FZ8A 3VD4A 2VUDA 3H1YA 3CHXA 5JXHA 4P9JA 1H2KA 1KDMA 5J1XA 3LA7A 5HPOA 4K6BA 5JZGB 4Y26A 3ZXGA 1KJRA 4KGQA 1W0OA 2BGOA 3LDRA 5I0UA 3VZKA 4AE2A 3RI9A 4Q4W1 2ERFA 5C3SA 4UT5A 2GU9A 1RHI3 5DZEA 2W47A 4GB31 2ZMNA 1N1SA 2LTNA 2VXJA 1MR5A 2W95A 1IPJA 1ND2C 5ERLA 5FYBA 1C1LA 2Z4FA 3WG1A 1CZTA 5JMOA 1VMHA 4BB3A 5A33B 1FNYA 1PIV3 1AR61 2ADEA 1LULA 3K4DA 4AW7A 1V6LA 2CGPA 3F2ZA 2OZJA 1PIV2 2A6VA 4LKDA 5LCWL 5F39A 3AP9A 3FC0A 3BIEA 4UFJA 3JD71 1W3XA 1W6MA 2RDSA 1G9CA 3EJKA 2C1FA 4AVSA 1C28A 1IKPA 2OXBA 1ZRFA 4TXWA 5C8WA 4HSJA 1TMF3 3BPSA 3AMNA 2QBXA 4ZS3A 4UBGA 5SV5A 1QKQA 4FPEA 3C8XA 4LNVA 4HPKA 3KHBA 5JWPA 3B9IA 3OB8A 4QU2A 4N9HA 3NSTA 3WG3A 3MW4A 2VJXA 4LTAA 4MV2A 1O91A 5A3NA 1TE1B 4URTA 2J1UA 3HN1A 3IAPA 1I6XA 1DQ0A 5KXDA 2P1BA 3BALA 5FZ4A 3K46A 1KGYA 1PO11 4NR1A 3LSEA 4WM8A 3WNOA 5LA1A 3B02A 3J8F1 1Y3TA 4PDWB 3O0VA 4WVZA 3WP5A 5EYXA 4FOYA 5C3RA 3LIHA 1GR3A 3HD8B 2WL1A 1FYUA 2DUPA 2HWF1 3KS7A 3N36A 3E5QA 5FY8A 4WVMB 5ANQA 1UD1A 1VE0A 4OYUA 1VRH3 1MEC1 2R0HA 1V00A 1GNZA 1JU3A 1LOEA 2WJSA 3POWA 1FMD1 4IGPA 5FYTA 1W8FA 3H3UA 4KBZA 5T54A 4DS0A 1JI6A 2I74A 5M0TA 2JJ6A 4LKFA 1WBLA 2DU1A 2FBEA 3N7JA 4YGCA 4K8FA 4UFMA 1O5UA 5HI0A 2VZ3A 3OF1A 1IG0A 3D3AA 4DRRA 1EAH2 3VBUA 2EXKA 4LLFA 4J1XA 2H6BA 1JHJA 2YBKA 3O12A 4NOTA 4P9LA 4XEZA 5DUVA 5J96B 1H6YA 3Q8BA 4AEMA 4BQ2A 2KR2A 1CAUA 1M06G 1COV3 2Z5WA 1NUKA 5CKMA 3CZJA 1ND3A 1RYYA 2WBKA 3FE5A 1POV1 4GWJA 3GF6A 4Y22A 5D8AC 5EWSA 3WD5A 5A3PA 1OC1A 4YW6A 2JB8A 4XHXA 4QX0A 4EWAA 3I2FA 1LGNA 2DBNA 4N53C 4Q4V3 3M7AA 4H7LA 4D3WA 4LHNA 1XYNA 4Q4V2 4YLZA 4CU7A 1CX1A 5C70A 1CZVA 1F31A 4CCOA 4JV4A 3GBFA 4LHSA 1I3HA 5IW0A 5F9TA 4XFCA 2XBO1 3O1VA 3N9PA 4QDRA 1YQ5A 3WF4A 2XLFA 1REDA 2OUJA 4FCAA 4AI2A 5CA6A 2DTWA 3IBMA 5C9AC 3RMYA 4OHXA 2WR9A 1CAWB 5FYHA 1MQTC 4Y20A 2UURA 3USSA 3IZOA 4IV1B 4OI2A 4ASKA 2E33A 4AFMA 5IFTA 1WA4A 1OFNA 4AGVA 3O1MA 2DCTA 3CQOA 1W2TA 3TN91 1QQP2 2UYAA 3RZGA 1BEV3 2R0FA 2RJLA 1UYPA 4AAXA 4PBOA 3QBQA 1ULCA 3EQEA 5CAZA 1W8NA 5GM0A 2XKOA 5I0SA 2YYOA 3SCGA 3POJA 1ZYBA 1RUE3 2GC0A 1ZBA3 4A3ZA 5CFDA 3O1PA 1RUE2 3LIGA 1FT9A 2XJVA 1ZBA2 3K77A 3BTXA 1V70A 2F17A 1KJLA 2Y6LA 3BCWA 4Q0UA 4AFCA 4BU2A 1VBB1 1ND3B 2K0GA 4PF1A 4AL9A 5C4WB 4W65A 3EMRA 4QKBA 3ZDSA 5J37A 4WZFA 5F3IA 3ZXEA 4PQ9A 4NPMA 3T0DA 3RWNA 5FZEA 5DZGA 1C3HA 2KD7A 4CU9A 3LFMA 4LORA 4XUTA 3J4UH 2W52A 4IE4A 5HCFA 4N43A 3J9SA 4GB33 4E2SA 5CU1A 4YGDA 3ZYGA 4GB32 5DDJ1 3WDTA 2ILMA 1YUDA 1CAXA 4KWJA 3BOWA 4KNCA 3NMBA 3MI8A 3URFA 3DF0A 5K7PA 4ARXA 1LECA 3LD8A 1S0CA 2RS51 2JICA 1H2NA 3LWCA 1F8VA 1R1A3 4BPZA 5JSPA 1NA1A 4YVWA 1AR62 4A44A 4ES8A 3I2GA 2PLV1 1KXGA 3ZMOA 3TOJA 4AHZA 2WIIB 4FVVA 2Y6HA 3E1F1 5FLHA 5FZ7A 1G9DA 3KT7A 1OA3A 1VBD1 4MADA 1S2KA 3JD72 4DO0A 5GKAC 5FZAA 4DXSA 3K48A 5DG1A 5FY0A 3I3BA 3PIJA 1RVF1 1SDWA 3T2QA 3EO6A 3WNXA 1JW6A 4YZ5A 1VBA1 3OY8A 3DL3A 1BLZA 1NZCA 5L19A 1AL23 2J1AA 1Y9MA 2OX0A 1W8TA 4XUNA 4E8CA 3WINE 5FPZA 1RUJ1 1ZNPA 3DPRC 5FP8A 3OEBA 4HKLA 4DUWA 1DQ1A 4CDWC 5C3OA 2ZZQA 3NO8A 4HSLA 2IZWA 4H2AA 4KU8A 1C5HA 4NRPA 4TYSA 4KGGA 1NLSA 1JU4A 2ET7A 4HKWA 5I93A 2HWC3 3J8F2 2E7QA 1PZ9A 2HWC2 5JZGC 2VMIA 3E5UA 4W50A 4ZHNA 1KRIA 3CJIB 1ZM1A 3U10A 1W6PA 1WW5A 2GP3A 3WHUA 4A7ZA 2GAUA 2VZSA 2ZGLA 1AYM3 2WZEA 2P6CA 4IV3C 4LO7A 1U0AA 5FPBA 4O61A 3MUZ1 2UWCA 1FMD2 4MO3M 4RFT0 3WUCA 4AAPA 4QX3A 5FLJA 4V2VA 3N35A 3T1MA 2PA7A 3MPPG 1QJY1 2C9AA 4XFGA 1NA1B 4Z1VA 1OPMA 1FATA 4K21A 1UMIA 4AGGA 3J7MA 4ZU5A 3TB0A 5J48A 5IK7A 3N9QA 1HB1A 4A6OA 3UJQA 4Z2WA 3GM8A 4YGEA 3GBWA 4RS5A 4Z92B 3J7LA 4SLIA 2ENRA 1E5SA 2WQ4A 4I2OA 5KHHA 1Z7S1 1ONAA 2ARXA 1JYNA 5A6YA 3VZLA 4XCAA 4AI9A 1FPN1 3LZZA 3OY8B 2PMWB 4GQ7A 3KM5A 1UIKA 5T50A 3IMMA 5A7WB 5FOBB 2JDYA 1KDKA 4Q27A 4PI2A 3IAQA 4QWNA 1UAIA 3N3HA 1VMFA 2OPWA 3ZO0B 5FK8A 1TQ5A 2WO7A 1NCQB 3H7JA 3X29B 4C91A 2A5ZA 3Q9OA 1FXZA 1KFXL 2HYXA 3KCCA 3HBKA 3V0BB 2XDVA 4MGZE 4MUVA 1ENSA 1W99A 2BERA 2GZWA 2JDHA 1BJQA 3C7FA 3THTA 5JPNB 4RN5A 1NCRB 2W87A 4BQXA 2GH2A 4PDWC 4NPLA 1O8SA 1EPZA 4NUBA 1MS4A 4XFBA 4XJAA 1UY3A 1EYBA 1DF0A 2YXSA 1ZRIA 3IIIA 3TN93 5JCTA 1HN0A 1YHFA 2G9FA 2MEV3 2JIGA 3TN92 5L7OA 3WHTA 2IWGB 2MEV2 3VD5A 4NRMA 2ZGTA 2WSVA 2GMMA 1US2A 1H2LA 3DECA 3MF6A 4X6QB 2H6CA 4NN0A 1TNRA 1UU4A 4HVQA 4B1MA 1HDKA 1E5IA 4FFFA 1JODA 4IGOA 1O3TA 2ZGMA 1K45A 3SH5A 4XTPA 1QHDA 3ZKYA 4OI4A 5IK8A 5SV8A 3PNAA 2DURA 2FZ2A 1OD5A 4M4PA 1SDDB 3KQRA 1UZZA 5APAA 1GQPA 3AMQA 2CGOA 2CNAA 2RM21 4MGSA 2BNNA 1N47A 4XF1A 2WNVA 3VDCA 4AVTA 2GDFA 1HXS1 3AVRA 5A1AA 2XL9A 1ALYA 4COWA 1W8HA 1JZ3A 4BIOA 1GFF2 2WRAA 1Q56A 4RA0A 2JDNA 3C3VA 5HCHA 4LT5A 4HETA 4JTNA 1JZ5A 1W8WA 4CVUA 1UW8A 5FZIA 2OS2A 1HKDA 4P02B 2YC4A 3KT4A 4XHBA 1YJLA 4MHUA 4BK4A 1J59A 1LOBA 2OT7A 5DDJ2 1YQ8A 2VOWA 3WQ1A 1UYXA 5HXMA 3GJBA 1TEIA 2ARBA 1X9PA 3GDBA 4JQRA 4PCRA 4QGNA 4WM8C 1VRBA 5FZOA 5G05L 2RS53 3KLSA 5IWFA 1U5IA 2RS52 1ZA7A 4IV1C 4HXCA 3UJOA 1QY4A 2PLV3 1JTZX 4YVSA 3IDBB 4FFHA 2PLV2 5AFBA 1MS5A 3M2MA 4CPBA 1VBD2 5LBFA 2XUMA 3M3IA 1C8NA 3SMHA 1UWWA 1RUH3 2WFF1 2CDPA 4AEDA 1RUH2 4NHYA 2VOKA 3N7LA 3PUSA 3I2DA 3MIBA 4XAAA 4XAEA 2KM2A 3KGZA 4XIKA 3KMHA 2AEZA 2XXZA 3MHZA 4Q4Y1 5CISA 4XUQA 1SPPA 2R071 2X09A 3VBUC 3D5OA 5DAWA 1RUD3 4YGBA 2R6QA 1JZ4A 1OH3A 1RUD2 1W9TA 4KH9A 3M3EA 1XOYA 4FP2A 4MGIE 1OD3A 1EV11 1XJAA 1Y9GA 3I3DA 3MF9A 4FPOB 2HWD1 1ND3C 5JAXA 4UOJA 4LUKA 3WW2A 5FMOS 1UQXA 5JIUA 1ODNA 3I49A 2BJSA 4YG3A 1D2QA 1ENXA 1KD7A 1S0EA 2UYBA 3CBNA 3AYAA 2VNGA 1OKOA 3D0JA 3CJXA 3HR9A 4ISQA 3OPZA 1O7FA 2P3IA 4XBLA 3UGHA 3RWKX 4QAWA 5GZDA 4QMAA 1LTEA 3HT2A 2R30A 1ENRA 3NV4A 4MXWB 3THDA 5FZOB 3QCWA 4A7KA 1UXZA 1LHOA 4CDUA 4XJ9A 1MS0A 1W9FA 2ZGPA 5F5QA 2ZEWA 2WWSA 1QJY2 3E5XA 4YVSB 3S7EA 2V5DA 4KG8A 2EIDA 3MW2A 3ZYBA 5FBJA 3AFGA 2D7FA 4LK6A 2RV9A 3ACFA 4P00B 4K1ZA 2OPKA 3BU7A 4R4ZA 2RS11 4BLJA 3VBSB 2LRPA 3ON7A 1R091 1FPN2 2PHRA 1PK6A 4FT8A 2BTVC 4BM8A 3RGBA 1H6XA 1QEXA 1RMU1 2GNTA 3DGTA 4Y1YA 4FBFA 2IXIA 4AI8A 4Q2FA 1HIXA 1Q3EA 2BV4A 1UZ0A 2NN8A 2ZA9A 3ZN5A 2AACA 2VQAA 1HRI1 4I02A 1J1LA 2G19A 2V4VA 2WNUB 1GICA 2E51A 2Q0AA 1N1VA 3BIWE 4XJ8A 4BCUA 2EXIA 2YMZA 4QQLA 4NIIA 1LHNA 2R063 1R083 2BNMA 5JVVA 1SLTA 5BNPA 1JUHA 2R062 3NV1A 1R082 4MGQA 5FFOC 5LA9A 3ZXFA 1E5HA 2QKDA 3E6BA 1NQJA 4B8EA 2D6PA 4YPJA 3SQOA 4CEYA 4LITA 3T2PA 2Y60A 3MEPA 3CJIC 4Q8KA 2P3KA 1L7QA 1GSLA 5E6HA 2D5HA 5JUVA 4ISRA 2VCMA 4XQ4A 1PM7A 3LA3A 4N90A 4BH9A 5IT6A 5FZ0A 1VBC1 4CDUB 2JB4A 3W5NA 5GLZA 1PGL1 1M4WA 4YFZA 1HQLA 1SLBA 2XWJB 3ABZA 3OUIA 5EYYA 4AG4A 2RJKA 4Y1ZA 5IVFA 3BKZA 4IEWA 5LWBA 4K40A 1UU5A 4OI1A 3ZFGA 3OUHA 5EFUA 1NA1C 5DZFA 3WQ7A 3LSDA 3OGVA 3D0SA 1LRHA 2E7TA 4ATFA 3AMMA 3ZN6A 2HKXA 1L3JA 1UCXA 1UZWA 1HB2A 3LEKA 3MIFA 4L99A 4RGAA 3QOPA 5IK4A 5FPLA 4TLFA 5FO9B 4E4HA 2PQQA 4B3NA 1O4TA 1LESA 3ZFFA 4FPKA 4QU1A 1W9SA 1D4M1 4HVOA 3VZMA 2BEOA 4XF3A 1UNBA 2I07B 2ZXQA 4AHXA 1BMV1 1UY4A 3FBMA 1VMJA 5C6CA 5C71A 4DQAA 4QGMA 4XILA 1YEWA 1HB3A 1LJ7A 1Q8VA 4AHWA 1OLRA 4QHZA 1XB9A 1NE4A 2LALA 3TYJA 3KF3A 4DY3A 2HWE1 5AC93 5BNPB 1QXPA 2ZGUA 3KV5A 4BXSV 2NQYA 3ORJA 4QPWA 1NCRC 4XCBA 4MHRA 1JOBA 1JYCA 1GZ9A 2O8QA 2XHKA 4NIHA 2VW0A 3SCFA 1IHMA 3OOXA 3AP6A 2ES3A 4UFHA 3O1UA 2X53S 1H1AA 1MQTB 1UYYA 1RINA 1ZRRA 1ZZ8A 5B4XA 3KV9A 5FPVA 3BVCA 5FPAA 3JXSA 1HLCA 1OF3A 4AQTA 1B09A 2WT0A 5J09A 4BQ3A 2JENA 4Q4Y3 1PVC1 4LO6B 3ZN4A 1AXKA 1WLCA 2GMPA 4Q4Y2 4F3JA 4QQHA 2VNRA 2RS33 3IKWA 2ZEYA 3FL7A 4RS5C 4XMAA 4J6GA 4QDSA 5IK5A 1UY0A 2WINB 3BUCA 4GULA 2Q8EA 5F8PA 5C7GA 2YU1A 1HQWA 2HWD2 3AZXA 4YZ4A 3MLLA 3G7DA 4L0PA 3GCXA 2WNOA 4I30A 2AGSA 4HN0A 1G6NA 5DABA 1DYPA 1RXFA 5F3GA 4Y4RA 1OHFA 4M4RA 5JOXA 2B8MA 3OBAA 1ZZ9A 4DEQA 4R9CA 3HAGA 3OEAA 2QJVA 4IEXA 4XBQA 1D7PM 4XF9A 2DTYA 2LW8A 1WLDA 3HNYM 1X50A 1S0IA 1SBEA 3LB9A 4BIFA 5KR7A 3WW1A 4XE9A 4XJZA 4QPIA 5L73A 4LBKA 4RHV3 1AYN3 1YIPA 3AVSA 1J83A 4RHV2 5BNOB 3M8LA 3I59A 3B9CA 1KFUL 2K2SA 2XONA 3AJZA 5FJHA 3V0AB 2IXHA 1O6UA 4M0NA 2CGNA 1OLMA 4DXTA 2ZGKA 1V6KA 2DBIA 3A23A 2BRTA 1B35A 1DGRN 3QH6A 4EYUA 5FMBA 3BODA 4C8DA 4CCEA 1D0HA 4LK7A 4B7EA 4WM7A 2ZGNA 4GJYA 2RS12 3MDPA 4L97A 3BI3A 1R092 2YDEA 4QGLA 2VOVA 1V9U1 3ZSJA 1XU1A 2BWAA 3R4UA 5LEKA 1RMU2 1YYNA 1YI7A 1H9PA 3ACLA 3JB4C 2P37A 2VMFA 4CCDA 5CBLA 4IXLA 5F7UA 1EY2A 3A0NA 5FZ1A 3RS6A 2XQRA 3VBFA 2CY6A 2PAKA 2XJTA 1WCDJ 2VECA 2WNVC 3GALA 4XTMA 4X6RB 3T30A 3WR0A 2BVVA 3VBRB 1S0BA 1XNAA 2E9QA 3AKTA 4PF5A 5LY1A 1JZ2A 3VD3A 4EZ4A 3P6BA 2Y38A 3TWIA 5LBCA 4M3CE 4DUVA 3ILNA 3FX3A 2BPA2 3I7DA 4NHKA 4X8NA 4S2HA 5DN2A 3AP5A 3AZVA 3MIDA 3VHRA 3JBG3 4HBNA 1FNZA 4CDWB 4DXZA 1YWKA 5C5TA 5FQ0A 1OFSA 3LKJA 5AFEA 3INAA 1AR81 1AXZA 3D82A 2BGPA 4GAZA 4B7KA 5IUQA 1RJ7A 2X29A 2A6WA 2W1SA 4ORFA 1NLRA 3I59B 3VDBA 2J22A 3ACIA 2VMHA 1CAVB 5HCBA 1LOGA 2VNOA 4UW6A 2ORXA 1IS4A 1JN2P 1B35B 4IV3B 2BGCA 1W8UA 1MVEA 4YVSC 4YZ3A 1OBNA 3C7GA 1MPXA 1SBDA 2C26A 2WZR1 1W90A 4XYXA 4ZY9A 2CAUA 4KL1A 5FUPA 3WX5A 2B9UA 4WM7B 1QJFA 4K20A 3VHPA 3I3EA 5C3PA 3IPVB 4BQ4A 1ZBE1 1LGCA 1RB8G 3I2IA 4FPCA 4UF0A 3VBSC 1Y7BA 4MOAA 1UPSA 1D4M2 2TNFA 2ZOEB 1QGLA 3ENRA 4IEOA 5JPMB 3WNLA 1SQ4A 3B93A 2J7MA 1BMV2 4H55A 4LQRA 3LCPA 2XLGA 2QQPA 1VP6A 3OD0A 3O7OA 1DGWX 5K8SA 4A6SA 1GZTA 2R49A 5FZHA 4RQPA 1EUTA 5T5PA 3ZYHA 3PDQA 3I3MA 1ENQA 2R32A 2YC2A 4XJWA 2WNUC 4AFAA 3VHNA 1W6OA 1HB4A 4N7UA 4AZZA 4BQ1A 1AXYA 2R7EB 5FP4A 4IUGA 3AM2A 2IXCA 1I5PA 2QE3A 4XMIA 4LE3A 4GD4A 4JCKA 1P8JA 4MXVA 1LENA 4HONA 1MS3A 2PQSA 2ARAA 3NJVA 5FKCA 1HRV1 3KF5A 1UOFA 4BOWA 4CCLA 1RUC3 3FMGA 4TSVA 2VW1A 5KHKA 3N7MA 3CLPA 2D6MA 1RUC2 4CDUC 3PTRB 5JSOA 1N1YA 3VKLA 4CEWA 2WWUA 2YV8A 5JLVA 1NQDA 1XXNA 2BW8A 2X10A 5FZDA 5ACA1 1CIYA 2NMOA 4LULA 2DCKA 4BK5A 2Y64A 1PVC2 2ZGSA 4NE9A 3T3YA 2VUAA 4DMIA 1W6QA 1WUVA 2DFBA 2VNVA 3ZM8A 2C6SA 4NMIA 5F2WA 5H9QA 1DQ6A 3FN9A 5K9YA 4DXRA 3AMPA 4UBHA 1JZ6A 4S2FA 4G9SB 1W0PA 4DOUA 1NXD1 4EE2A 2DCYA 1PK6C 1XC6A 4KG0A 1EAH3 3TBDA 4EZHA 4CCCA 1PMIA 4LE4A 4E27A 2P5BA 2KA3A 1IS3A 2D43A 2PELA 4QB1A 1H30A 4O65A 2IXJA 4BLIA 1W6MB 3VDDA 1REEA 1SLCA 3MV11 1K42A 1UOGA 1N3QA 2D3SA 5BXXA 1AR71 3C2UA 2ZZJA 3HN3A 4CDQA 5FWJA 3FLTA 4XF0A 4JRAA 5EZWA 3AMHA 3RYKA 2EIGA 5AVPA 4AVVA 1PO21 5FOJB 3WP4A 3RZHA 1YIFA 4MX3A 4HPKB 2PHUA 3DXTA 2QQJA 3RDIA 4D6QA 1DBNA 5A7SA 1ASJ1 2R1BA 5BNPC 2VQTA 1X33A 3ELNA 5D21A 2V73A 3CNAA 4CEYC 4Q0PA 4FAHA 2VCBA 2R041 4PIXA 5A7PA 1GV9A 1C8M1 1A8MA 3ASIA 4NIAA 5KHIA 4WM8B 4AQ6A 1IS5A 3OTFA 4Z07A 2AEYA 2ZX1A 4O9GA 2IC1A 2DV9A 4KWUA 4BMBA 4BQ5A 1LB2A 1SHWB 1UKRA 3ZFGC 2PTMA 5E16A 2VQUA 1QQP3 4OLLA 1CX4A 1WCQA 2DVFA 1V9U2 2Y0IA 4UFLA 4NWVA 4P9GA 3E97A 2PHXA 1KITA 1Y43B 4RR3A 5BPXA 4D6RA 5C5UA 3OGSA 2FHRA 4E4DX 4JGZA 1YC61 4DY5A 3KT1A 1AHSA 1WCSA 4RL7A 3VBUB 4XXPA 3TNPB 3AL5A 4QDQA 5A32A 4MGKE 3U75A 3VL8A 3CF6E 2DVGA 4NVPA 4CCKA 4HOOA 2HLEA 1CAUB 2XUEA 5FAXA 1KS5A 4CDQB 4GMP1 4Y22B 2FD8A 2J1TA 1SLIA 2VCCA 5FZ9A 3NNGA 2WC2A 2WS91 4LOTA 1ZZ7A 2PHDA 4XETA 2RR11 1AR82 1RUG1 2NPIA 4GALA 4HKOA 4M0HA 4NO4A 3UL2A 3VD9A 1DIWA 2HYKA 3H1WA 4NPRA 3POIA 2QQMA 2YY1A 4F7ZA 2ZPXA 1O59A 4EROA 4PJYA 4Q4W3 4CTEA 5BNOC 3IDCB 2EXJA 4Q4W2 1NG0A 1ULOA 5FYVA 2VH9A 2WQ8A 4C1WA 2DVDA 1DGRA 4Y5TA 3RZZA 1S2EA 1S0FA 4Y20B 4HG6B 3IDAA 5IATA 2X5IA 1ZBE2 4PHZA 5FXXA 2AR6A 1GOGA 3AP4A 5DUXA 1AR63 5FMCA 4WV8A 4BMEA 2G9ZA 2VUCA 2K9ZA 2ZEXA 5LW9A 3S5AA 1O8PA 4Q0VA 1QJU1 1YRZA 4Z8BA 3JD73 4O7XA 4AQSA 2VMEA 2QQUA 5T55A 3PUQA 1Z78A 5FZLA 1JYIA 2A1XA 5FZBA 5LRSA 2N7GA 3LEGA 5A32B 1C5IA 2XR4A 1HX6A 3O0WA 2OYZA 2IXLA 5CFDB 3W5MA 4FPYA 3ES1A 4NIGA 2XH6A 2JKBA 3VBRC 5CADA 3APBA 2NM1A 2VMCA 1LEMA 4KMQA 4HK8A 5FYIA 5FYUA 2QFEA 3PTYA 5GZCA 2VM9A 3M3OA 4COZA 2EXHA 4JVAA 1YFXA 4GIQA 1HJFA 4YM0A 1PO13 1DG6A 1DLCA 3ZYJB 3J8F3 2MHFA 2IFRA 1Q43A 1PO12 2YGMA 4DINB 1CZSA 2P4EA 1NZIA 4QXKA 2AH2A 2WZPP 1TG7A 3FJSA 5FP3A 1LEDA 4N43B 2HWF3 5FMDA 3DYPA 1G9FA 3S6PA 2VZRA 3KVAA 1V6NA 5A6XA 1APNA 2HWF2 1Q8SA 5CNAA 3W21A 5BNNA 3TRSB 3RZLA 1GNHA 1MEC3 1CAXB 1JYVA 1NY71 1B35C 2LUWA 3F95A 1FMD3 2VOXA 4I3GA 1MEC2 2Y8KA 4OHVA 3UT0A 2NMNA 2B9VA 2WQZC 4CXYA 4QKNA 3ZIXA 4WM7C 3GBGA 4M3CF 1PGW1 3HOBA 2Y34A 2VVEA 5D1IA 4YVWB 3U11A 1UKGA 4CP9A 1FOD1 3ZYPA 3SH3A 1HV0A 2XQXA 2RG4A 2I45A 2OZ6A 1V6MA 1H1IA 1YQ6A 1FV3A 2NZ9A 3DCQA 3JCIA 1MZ6A 1SG3A 2G1MA 2GP5A 3NW4A 3RFRA 5DAVA 4F83A 1O4YA 1AR73 3PJYA 3WF2A 4A2UA 1XNTA 1AR72 1POV3 1JOPA 2YG0A 1RUI1 2BU9A 2XGXA 2XJSA 4JGYA 4QQOA 1PNGA 2B4KA 4QHOA 1POV0 5EXOA 1PO22 4DUXA 2Q1ZB 2VPVA 1ASJ3 5A3TA 2P17A 2R16A 3GHMA 4AYUA 1ASJ2 4PBPA 2DU0A 1A6CA 2VZTA 3UK9A 3T2TA 3MGUA 2XBO3 1C8M3 2XWBB 2R042 4M00A 1DZQA 3AXEA 5C3QA 2XBO2 1C8M2 3OCPA 2FDGA 2W1UA 3NNLA 4QPYA 4E2QA 4IGQA 3AKQA 2WNEA 3I97A 4TTGA 4P08A 4MGYE 5CB7A 4XXAA 1NE6A 1W6PB 4LO8A 3GXUA 3I2KA 1SFYA 3AZWA 2D6OX 1LOFA 4CUGA 2XJUA 2VVFA 1XRUA 2WA4A 3GGLA 1PGSA 4KBBA 2A71A 5BY5A 1SBFA 4LEJA 3FHIB 1W04A 4QKFA 4COYA 1LOCA 1BHGA 3CL1A 1S0GA 4FPJA 2QQLA 3GYDA 4EJRA 2JXAA 4RGKA 5A7OA 1GWMA 2QZ2A 3ZYIB 1ZZ6A 5C8CA 3HNMA 3PVNA 1N1TA 2FQPA 1S4CA 1D4VB 3EBRA 1O3QA 2D98A 1H9WA 3KCXA 1OT5A 3NQHA 2GNDA 4RS5B 2TBVA 1X8EA 5FWEA 1A34A 2HEWF 1X36A 1T6GC 2WN3A 2CWSA 2BBVA 4LLOA 3K3OA 3NV2A 4I0BA 4Y5Z0 2YBSA 3H42B 3QD6A 4S2DA 5F6KA 1GKBA 1VBB3 2B46X 1K5JA 1DQ4A 3WQ0A 4C0BA 3HVDA 1VBB2 4LMFA 1KS4A 1OUXA 3N9MA 5FXWA 2RR12 1RUG2 1H4GA 4JDMA 4Y1VA 1XNDA 4OI0A 3PIGA
chains in the Genus database with same CATH topology
1F9KA 3E6DA 5BNQA 3JU9A 4DB5A 2JE9A 5E89A 4YW1A 1AR91 4I01A 2W39A 2ZHLA 2DWRA 3BTAA 5DDJ3 3WCRA 1I9RA 2Z69A 3FBYA 3W58A 4YM2A 2DYCA 2B5HA 4LBNA 1N3PA 1WLWA 4YSFA 1QOTA 1XQNA 2D3PA 3VBHA 1QOSA 1OSGA 3VGIA 1A8DA 1GLHA 2D93A 2XJQA 5K0UA 4BHPA 5L7OB 1QJU2 1H8VA 1VBD3 3AKPA 2G9GA 2B39A 4JDOA 3ST7A 1XU2A 4FPGA 2E7AA 4GKXA 1RVF3 1G86A 2JEMA 2ZGOA 1RVF2 3IWZA 1VBA3 4CP2A 2HEVF 1RGSA 2NP0A 1VBA2 1X8MA 1F5FA 2WLPA 3OYWA 1RUJ3 1AVBA 2BUKA 4FAGA 2GMEA 1RUJ2 3S30A 2XJPA 5CFCA 3PVEA 3ROUA 2PHTA 1VAKA 2WNVB 4CDQC 1HV1A 2RHPA 1ND2A 3K51A 3B01A 2JG9A 4EN7B 1IKQA 3I4IA 4L9BA 2IFWA 1LODA 5FMOL 1NYWA 1G7YA 3MLJA 2E6VA 4LO5B 3WG4A 4DNYA 2CAVA 1NY72 2P34A 5FBZA 2D3RA 3MIGA 2VGDA 4WBBA 2PHWA 4DFSA 2UY9A 4UW3A 1QJY3 2D44A 1YLLA 3VBHB 4Q29A 4Y24A 2YC0A 2YZ4A 2E53A 2GALA 4QX5A 4X8PA 3IT8A 2EA7A 2UWAA 1BKZA 3H0OA 3O14A 4MSVA 3UKVA 4HN1A 1VB4A 1AJOA 3OD4A 3WDXA 4COVA 1Z7S3 1LOAA 1OQDA 4AEDB 1OKQA 4ONUA 1OI6A 1Z7S2 2YPJA 1FPN3 2JE7A 4JGZC 1WD3A 3OGJA 4WVWA 2ATFA 5GZGA 1RUI2 2BQPA 4GH4A 5JMCA 2A3WA 3OYWB 4RSUA 4CRQA 3L2YA 5J7MA 5H9SA 5CFDC 3IN9A 1RUOA 5CFCB 3S0MA 1Z0HA 4AEJA 4R52A 1D2SA 1MS8A 1DQ5A 1TME1 1QJX1 4HT1T 3R6SA 1J3QA 5KHJA 3WG2A 5HXVA 2HWB1 1DQ2A 3NKGA 2WSUA 3KD4A 2A70A 3JQXA 2Q5TA 5KXBA 4YFWA 3N4MA 2ZACA 4N43C 1WW6A 5KWRA 4MVTA 3VZOA 1F5JA 4MLOA 2ZTNA 1F2NA 1Q8OA 3OJBA 2DUOA 1RC6A 4YZ1A 2ZHMA 3JB8A 4AVBA 1FI2A 5D8AA 4QM9A 4CP1A 1RUF1 4YVWC 3USUA 4N53A 1YFYA 1REFA 3JQWA 2ZAHA 3NJZA 5FO8B 2AZ5A 2CL2A 2FMDA 4BA6A 4ZU4A 3OBTA 2RM23 1WMDA 3V64A 3FLRA 1PK6B 4GH4B 3WW4A 2RM22 1LU1A 1HXS3 2W0XA 4YYOA 2BNOA 1OLQA 2VMGA 4UW5A 1HXS2 5GZEA 1OA4A 3ZXLA 2H0BA 5HBAA 3LOIA 3H3ZA 2ZHNA 2DVBA 2A6XA 4I3PA 1RHI1 3OGGA 5B2GB 1AR92 1S0DA 1RTVA 2ZGRA 3T1LA 2PHLA 1VLNA 5LEJA 4Q4X1 2GC2A 4CEYB 4CYDA 1ZVFA 3HIFA 3ILFA 1PIV1 3MPBA 5LK5A 1WGPA 3HBZA 1YO8A 4LHKA 4Q1RA 2JG8A 4OFGA 3VKMA 3ZFEA 2D40A 1PZ8A 2WFF3 3M70A 2WFF2 3VBOA 3ZFGB 4IETA 2BFUL 3USUB 3ZPYA 2ZHKA 1TMF1 2R073 3ZN6B 2R1DA 3AZYA 2CV6A 2R072 3LAGA 1PNFA 4R9BA 1Q8PA 4Y1UA 5BUVA 4G4FA 1EV13 4HMZA 1EV12 3ZFFB 2HWD3 3UV9A 3I54A 2Z2SB 2WKKA 1GZCA 3NKTA 1JHNA 2ZX4A 1H8TA 1X82A 1S2BA 4GA9A 1J3PA 1XYPA 1OOPA 2HEYF 1RIRA 4LO4B 3ZSLA 4LBQD 4YNIA 3AKSA 2WFPA 2OA2A 5EJ3A 1AUYA 1VRH1 2XJRA 5EV7A 2SBAA 2O1QA 3RMXA 1QH6A 3VLBB 2GNMA 1QU0A 4XFAA 3NL1A 2GN7A 4PLOA 3SLIA 4MYEA 1LHUA 3WV6A 2VU9A 2A3XA 3RRDA 2OUHA 1LOFC 1G9AA 4LBJA 1FAYA 2JG8B 4XJUA 5FPXA 5L7OC 4XF4A 3DPRA 4LBLA 3ZFEB 2OIIA 1COV1 2RS13 4FOVA 1XNCA 3PMSA 1R093 4AXOA 4XBNA 2PN5A 1RMU3 5ABJA 1MVQA 4Q4V1 3IDEA 3ZXAC 1HRI3 1FV2A 4P9WA 1HRI2 1TME2 1SCSA 1VR3A 1H8TB 2HWB3 5JI7A 1CPMA 1OOPB 3AB0A 3HQXA 2HWB2 2YHJA 2QDRA 2D6LX 3NAPA 1O4ZA 5LRRA 4XFHA 4FXKB 2CYFA 4QPGA 1BEV1 3MYXA 1VBC3 3UKTA 3WCSA 2MNGA 3N7KA 4QPIB 4V1PA 3PLQA 1VBC2 1PGL2 1LCLA 1LHWA 1CQ9A 1ZX5A 3LOBA 4WVVA 5FCCA 2X8KA 1GBGA 4ITCA 4FTBA 3SXWA 1RUE1 1BBT1 3VBHC 3R05A 1ZBA1 4Y4YA 4K9SA 3V56A 1IPKA 4XZPA 2WT2A 4K1YA 2AENA 4HFSA 3VKOA 3VL9A 4FOWA 1QOOA 3AK0A 1LHVA 4AEDC 3DUIA 2EALA 4XOGA 4AHYA 1D4M3 5ABJB 2QUOA 4INDA 1CGPA 4A3XA 4PDWA 1CONA 1S1AA 4XQDA 4GKYA 4IEZA 3PVOA 5CFCC 3RNSA 1S0JA 4IEUA 4KU7A 3VBFB 4D94A 2ZMKA 2ZMLA 3ZSEA 3WY6A 1WW7A 1RHI2 4WVMA 2HWE3 3QACA 3MIEA 2JG9C 5J98B 4FO9A 1K5MA 2DFCA 2HWE2 4GXLA 4Q4X3 5DUUA 4E4SA 2DF7A 4AI0A 4Q4X2 3ZX7A 3J26N 3NAPB 2W68A 1R1A1 1VJ2A 4HLTA 4EN0A 5FQ0B 5I0TA 3ME2A 1C1FA 4QPGB 5A3MA 3AJYA 1SCRA 2Q30A 3SISA 4OULA 1CIWA 4R4XA 4B4PA 3FZ3A 4OZXA 1PVC3 3RI8A 1Y9QA 1JUIA 1TMF2 3L9JT 1AL21 5I8YA 1BYHA 5I0RA 2Q4SA 2YUEA 5E88A 3VUOA 4GH4C 4RD7A 4C90A 3W9AA 1ZRCA 2UWBA 1TNFA 2EVXA 1CAWA 2HWC1 3MLKA 4IV1A 3R0RA 1GANA 4LBMA 4Q8LA 4C1XA 4HVRA 4YG0A 2ZAAA 4RQPB 1J1TA 2AUYA 5T5LA 1BCXA 1QF3A 2W08A 3POSA 1W6OB 1AYM1 1K5MB 1VRH2 1OQ1A 1ULFA 4IESA 1CVNA 1IQAA 1XE7A 3VZJA 2C0ZA 1AJKA 5KC6A 2KXLA 1WCKA 2ZX0A 2EAAA 4I09A 2VUJA 1OMIA 1VAMA 4CEWB 1WW4A 1COV2 1G8WA 2VULA 3IM0A 2C5DA 3THPA 5L36A 5C4WA 2JX9A 1V9U3 3BOPA 2V09A 2D6KA 3FUOA 1W6QB 2CTVA 4D69A 3WXPA 4JDNA 2XKPA 4MZUA 5FLIA 1BQPA 5T5JA 1YXWA 1CESA 4ATEA 2OVUA 4OHYA 4NHLA 1AX0A 4QT6A 1VIWB 4QM8A 3U07A 3ZFFC 1LR5A 4K3UA 3KB5A 3AZZA 2ZX2A 5I8TA 3CU7A 3VDDB 5KBFA 1DDLA 3WT3A 4L8QA 3ATGA 1DGWA 5CVRA 5H9PA 3H8UA 3B94A 4JTOA 1AR83 1BZWA 2MEV1 1BEV2 5GLVA 1BXHA 3VZNA 4LA2A 3G6JB 3AP7A 5FO7B 1AZDA 1O5LA 2Q1MA 4RGGA 1WD4A 1J58A 1H4HA 1MZ5A 1ULDA 3H9AA 4ZKTB 1BBT3 3H7YA 1H2MA 1BBT2 5AVAA 1MACA 2WZR3 2XLAA 2JG8C 2WZR2 4L2NA 3MICA 4META 4XPVA 1ZBE3 1X7NA 3ZFEC 5I8SA 3VBOC 2ZGQA 1GQGA 3FLPA 1UIJA 5CIRA 2BWCA 1U5YA 1VAVA 3ZMNA 4AFBA 4D7TA 4RR3B 1SMVA 4M3CA 2DCJA 1R1ZA 3CJIA 4O9EA 5J36A 4JGZB 5GJ6A 2QVSB 3WDWA 3ZYRA 2WT1A 3O5SA 3WOGA 2ZABA 3KGLA 4Y1XA 1CJPA 1H8TC 2ET1A 5F6LB 3KSCA 1OOPC 4ES9A 1Q8QA 4GWMA 2QCSB 1R1A2 3PVBB 3HWJA 2BVBA 1HRV3 3WDYA 3FFZA 2A75A 1GZWA 4IL7A 5E1RA 4BYYA 1HRV2 4L11A 5J3UA 3L2HA 4QPIC 1RUH1 2V5YA 1ULGA 5ACA3 5T52A 1A3KA 1XNBA 2CWMA 5ACA2 1YFWA 4B4RA 2DVAA 1AL22 1C4RA 1RUD1 3DV8A 3VHOA 3VN4A 2X5IB 3OBRA 3U0ZA 1OPOA 2OW4A 4HK9A 1NCQA 4KWKA 3QLQA 4IQPA 2ZX3A 3KZ4C 1SLLA 3PJQA 3V0BA 5ABJC 2A6YA 3UKNA 2IXKA 4M3CB 4OHWA 1NCRA 3GZAA 3QH7A 3ILRA 2PHFA 4FP3A 3RYPA 4LR4A 3VBFC 1PO23 3SNMA 1AYM2 1PVXA 1WMFA 2WLQA 2QDNA 1VB2A 4B4QA 3B00A 3ALQA 1JXNA 4I0WB 1DU3D 1CD3G 3M3CA 5H9RA 4Q0QA 2R043 4P14A 4EN8B 3NAPC 5JR7B 3H1MA 1UL9A 1WBFA 2ZJCA 1GZWB 1LKNA 2GN3A 4E4ZA 4QPGC 4XIOA 5KC5A 1MZFA 2XPJA 4GWNA 3SHRA 1E57A 4UXAA 3KCYA 2RMU1 3D8CA 1QDCA 1OA2A 2VVDA 4YM1A 3TAYA 2VY0A 5BNNB 1CN1A 3B7MA 4AF9A 1AX2A 2A3YA 4Q1PA 2TEPA 3ECQA 2XVKA 1GYKA 3ZSMA 4DPNA 4AK3A 1D0GA 4HANA 3FFQA 3NVCA 4AFDA 3MW3A 1U5XA 2LM3A 2R061 1R081 2D6NA 2VXRA 1EP0A 5JDBA 5A3LA 4YW4A 5DUWA 1QH7A 1HQNA 2FMYA 3EXUA 2Q8OA 2GC1A 3IMNA 4GMP3 1DFQA 1DZTA 3RJRA 1UN1A 4EV0A 4D7YA 1RJ8A 4GMP0 4JGYB 1CJDA 4RQPC 4FTEA 2WS93 2RR13 1RUG3 3ZXDA 3FWEA 2D97A 2WS92 4D7SA 1K5MC 1UMZA 5FRAA 4S2GA 3D4KA 4ASMB 2XG3A 1WMEA 4N9IA 5GALA 2E63A 1MZEA 1U12A 3AXDA 3WW3A 4E9KA 4YW3A 5LK7B 1LU2A 4FQ4A 4YARA 2ZCWA 5DG2A 1H0BA 2GSYA 4AVAA 3R4DB 4NHMA 4FPLA 4IEYA 3TNQA 2P3JA 4CEWC 1GQHA 3RG0A 2Z42A 3B3QE 1W39A 1HW5A 5T5OA 4A7YA 2JECA 4AVCA 1QJU3 4CZSA 3NV3A 1AF9A 4H14A 3ZXKA 1DYKA 2G4IA 3WVJA 2PAEA 3AX4A 3CEWA 5FREA 1QXRA 1IZ3A 1YCIA 2F6BA 4R9AA 3PHMA 3GZTB 5C8CB 4ZU7A 3ZSKA 5FTTC 4XW3A 4CDXA 4P5HA 3BPZA 5C33A 4XFFA 4HZFA 5AC91 4MXWA 2JD4A 4IEPA 1URXA 3GNEA 4AGRA 1O3SA 5CG9A 3VDDC 3WZ1A 2SLIA 2D5FA 3VV1A 1IGOA 2QNKA 4YRDA 3ETQA 2PYTA 4AWDA 3JUUA 3VBSA 1AL0G 3I8TA 4CP0A 1UZYA 3ZIWA 1BK1A 4FXGB 4YZ2A 5KXEA 2RS31 5GLUA 4DRVA 5I91A 1VBE1 4R8HA 2VG9A 1XYOA 2XVGA 1NXMA 3FUQA 4OVEA 1PGW2 2WNUA 3MZHA 4U36A 1FOD3 4YW5A 5C4WC 4BZ4A 2B42B 3M1HA 4F8AA 5K0UB 1FOD2 4OHZA 5T3NA 1SACA 5JOWA 1H1MA 3VKFC 4BE3A 2NLRA 3D6EA 4RR3C 2EAKA 2FZ1A 4CDXB 1I5ZA 1RUI3 3S7IA 1DZRA 4IEVA 1JOJA 4Q0SA 5GZFA 4FTSA 4QQPA 4RHV1 1AYN1 4JC1A 1UF2C 4XQWA 5TSWA 5JOYA 1BVP1 4LUMA 3A0KA 3B5LB 2Y0OA 2AYHA 1UU6A 2ZBJA 4LBQA 1ND2B 2JG9B 4H7MA 5JOZA 1CPNA 2H0VA 2RMU3 1ZA4A 3V65A 4E2GA 4JAAA 2RMU2 3H50A 4IEQA 2WA3A 3BB6A 1DHKB 4P9XA 3DKWA 1ZREA 4ZXKA 3AYCA 3CO2A 1V6JA 5HCAA 2I2SA 2UU8A 4R9DA 1QMJA 2PFWA 2AREA 4K7JA 3AYDA 1NOVA 2X5IC 3E6CC 2NYYA 2O8OA 4EWEA 3U4XA 4L92A 3JZVA 4XDQA 5FDBA 2HJIA 1PHMA 1C57A 1KQRA 2A73B 3AFKA 3PMEA 3JBG1 5KXCA 5KHGA 3AYEA 1QNYA 1JH5A 4YW2A 5DXDA 5C9AA 2B45X 3ES4A 3HMYA 1RUNA 1MQTA 3RJ2X 1G9BA 1ZZBA 2UY8A 4LBQB 4WZCA 3A4UA 1SLAA 1AR93 4EN6B 4H3WA 3WP3A 4N7IA 3R4SA 3IIAA 2F4PA 5JIAA 3WLUA 3DN7A 4BWOA 2PAMA 2Y26A 1QDOA 4XFIA 2VQ0A 3RYRA 1I1EA 4Q26A 3ZVXA 1IOAA 1VALA 4M01A 4UW4A 5BNNC 4G3YC 2ZS6B 3AKRA 2BYVE 2TUNA 2YGLA 3EHKA 4PIYA 5D8AB 4DZGA 1V6IA 1NCQC 4COUA 1XE8A 3P3NA 3RSJA 4N53B 1MS1A 5AC92 2GH8A 3RPQA 3W59A 5F1RA 5BYNA 3NWKA 1O3RA 4AEKA 5BNOA 4C0HA 1XNKA 3V0AA 5C9AB 4KWLA 4JGYC 1IS6A 1CR7A 1RUC1 2BFUS 2XVLA 1W6NA 4OUSA 2XL7A 4FPHA 1MS9A 4LHLA 4W6YA 5JSRA 3VKNA 4LBOA 3M4FA 5CG8A 3POYA 4I0AA 4NWWA 1QWRA 4MH0E 1LGBA 2JDZA 2RS32 1VBE3 2A7AA 1VBE2 1W2UA 1QNWA 5E8AA 4B29A 4J1WA 1EAH1 3VBRA 2DCZA 4PLMA 4FPFA 1OQEA 3VBOB 2Z79A 1AX1A 4QQ2A 2GNBA 2XB6C 4CDWA 4TWTA 3SH4A 1A78A 5C8CC 4QD2A 1U5ZA 2P2KA 4EN9B 1J3RA 5BV6A 3MIHA 4HL0A 1ULEA 4LA3A 5GLTA 3B69A 5JZGA 1AYN2 3LA2A 1DLLA 2DUQA 4AQ2A 1FX5A 1CAVA 3RQ0A 1TME3 4PLNA 1QJX3 1SFNA 4IERA 4QHBA 4IV3A 1RL3A 4OUMA 1QJX2 1V6OA 3WDUA 1W6NB 1JBCA 4YG6A 2QZ3A 1YJKA 2ZKLA 4AI3A 4FSJA 2A6ZA 3IPVA 2RE9A 4W6XA 4FQZA 3GHNA 3WUDA 2EF6A 2YROA 4P9YA 4EWDA 3MFAA 1YFUA 1Q5OA 5A33A 4AI1A 1QJZA 1QQP1 2GC3A 3MFCA 4U2AA 3O0XA 3HT1A 5GLWA 1YNAA 3P3PA 3SCHA 1ZZCA 1BVVA 3M3QA 4JRLA 2ZKNA 1EPWA 3WP6A 4SBVA 1UPIA 2ETEA 4W6WA 3LGRA 3SITA 1N3OA 2MPFA 4FOQA 4Z82A 1RUF3 4PIZA 1SEFA 4YM3A 1RUF2 1DGLA 4P9IA 5K0UC 3ZXJA 3DPRB 1RITA 3WDVA 1YI9A 1PZ7A 4TZDA 1QXJA 2O0OA 1ZRDA 1S55A 2VW2A 4ASLA 1UX6A 3JBG2 4KQ7A 3GZUC 1WLTA 2B7YA 4CDXC 3H1YA 4P9JA 1H2KA 1KDMA 5JZGB 3LA7A 4K6BA 4Y26A 3ZXGA 1KJRA 4KGQA 1W0OA 5I0UA 3VZKA 4AE2A 3RI9A 4Q4W1 2ERFA 2GU9A 1RHI3 5DZEA 4GB31 2ZMNA 1N1SA 2LTNA 1MR5A 1IPJA 1ND2C 1C1LA 3WG1A 5A33B 1FNYA 1PIV3 1AR61 1LULA 4AW7A 1V6LA 2CGPA 2OZJA 1PIV2 2A6VA 3AP9A 3FC0A 3JD71 1W6MA 1G9CA 3EJKA 2C1FA 4AVSA 1C28A 1IKPA 1ZRFA 5C8WA 4HSJA 1TMF3 3AMNA 4UBGA 5SV5A 1QKQA 4FPEA 4LNVA 4HPKA 5JWPA 3B9IA 4QU2A 4N9HA 3NSTA 3WG3A 3MW4A 4LTAA 4MV2A 1O91A 1TE1B 4URTA 3HN1A 1I6XA 1DQ0A 5KXDA 3BALA 4NR1A 1PO11 3LSEA 4WM8A 3B02A 3J8F1 1Y3TA 4PDWB 3O0VA 4WVZA 3WP5A 5EYXA 4FOYA 1GR3A 3HD8B 2WL1A 1FYUA 2DUPA 2HWF1 3KS7A 3N36A 3E5QA 4WVMB 1UD1A 1VRH3 1MEC1 2R0HA 1V00A 1GNZA 2WJSA 1LOEA 3POWA 1FMD1 4DS0A 3H3UA 5T54A 2I74A 2JJ6A 1WBLA 2DU1A 2FBEA 3N7JA 4YGCA 4K8FA 5HI0A 1O5UA 3OF1A 4DRRA 1EAH2 3VBUA 2EXKA 4LLFA 4J1XA 2H6BA 3O12A 4NOTA 4P9LA 4XEZA 5DUVA 5J96B 5JI9A 4AEMA 1CAUA 1M06G 1COV3 2Z5WA 1ND3A 4Y22A 5KHKA 3FE5A 1POV1 3GF6A 3WD5A 5D8AC 5EWSA 4XHXA 4EWAA 1LGNA 4N53C 4Q4V3 3M7AA 4H7LA 4D3WA 4LHNA 1XYNA 4Q4V2 4YLZA 1F31A 4JV4A 3GBFA 5F9TA 1I3HA 4XFCA 2XBO1 2XLFA 1REDA 2OUJA 4FCAA 4AI2A 5CA6A 2DTWA 3IBMA 5C9AC 3RMYA 4OHXA 1CAWB 3USSA 1MQTC 4Y20A 2UURA 4IV1B 4OI2A 4AFMA 1WA4A 1OFNA 4AGVA 2DCTA 3TN91 1QQP2 2UYAA 1BEV3 2R0FA 2RJLA 4PBOA 3QBQA 1ULCA 3EQEA 5CAZA 5GM0A 2XKOA 5I0SA 2YYOA 3SCGA 1ZYBA 1RUE3 2GC0A