5A1FA

Crystal structure of the catalytic domain of plu1 in complex with n-oxalylglycine.
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
458
structure length
450
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 450
sequence length 458
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a1fA01
2OQ6A 5FZFA 5A7SA 4CCLA 4LIUA 5FUPA 5FZGA 5FYTA 5FZ7A 2YPDA 5FYZA 1VRBA 3AVRA 3KVAA 2GP5A 4AAPA 4HOOA 4GJZA 5F2SA 5IVVA 5F5CA 3RVHA 2Q8CA 2P5BA 2XDVA 5FYCA 3K2OA 5FY9A 5F5IA 4CCKA 2YBSA 5FWEA 4LXLA 5IWFA 5F39A 4AI9A 5A1LA 3KV5A 3AL5A 5FZHA 5IVJA 5A7PA 3K3OA 2OQ7A 2VD7A 5FZ0A 4CCNA 3N9PA 5FXWA 3N9QA 5F37A 2OS2A 5A7QA 5FZEA 2OX0A 5FYIA 5F3CA 5FZ4A 5FPLA 2XMLA 3PUAA 4QX8A 2XUEA 5A7WB 4D6RA 5FWJA 5CEHA 4E4HA 4NUBA 5FYUA 5FZLA 4CCJA 4Y3OA 3KV4A 4GAZA 5FYHA 5KR7A 5FP7A 5FY5A 5FPAA 5F3IA 3OPWA 2Q8EA 3N9NA 5F3EA 3U4SA 5FPUA 2YBKA 4BU2A 4IGOA 5FY1A 5IW0A 5FY8A 5F3GA 3PU3A 4QXBA 5FZ3A 4QXHA 5FJKA 3K3NA 3AL6A 4LIVA 5A7WA 4IGPA 2XXZA 4LITA 5FJHA 4UF0A 4XDOA 4Y33A 5LW9A 3N9MA 4DIQA 5FYYA 4CCMA 3KVBA 3KV9A 4CSWA 4EZ4A 4QU1A 2Q8DA 4UF0B 4CUGA 3DXUA 4DO0A 5FY7A 5F5AA 3PTRB 5A7OA 2WWUA 4C8DA 3KV6A 5A3PA 4URAA 4QX7A 5FXVA 3PU8A 3PUSA 4QXCA 4GD4A 4ASKA 5IVEA 3N9LA 4XDPA 5F32A 5FP9A 5FZMA 5FZDA 5FPBA 5IVFA 5A3NA 3LD8A 5FP8A 4BXFA 5E6HA 5FZ9A 5A3WA 5FZOA 2YU2A 5FZ6A 3NJYA 5ISLA 4EYUA 2OT7A 4TN7A 5FYSA 5FZOB 5FY0A 5LWBA 4Y4RA 5A80A 5FP3A 5FZBA 5ANQA 5FXZA 2GP3A 5FYVA 4CCOA 5IVYA 4D6SA 4HONA 4IGQA 5FV3A 5A7NA 5A3TA 5FY4A 5FZKA 5FZCA 4EZHA 2YU1A 3DXTA 5FYBA 5FZAA 5F2WA 5LY2A 5FZ1A 4GJYA 2PXJA 4QWNA 4V2WA 2W2IA 3UYJA 3ZLIA 3OPTA 3ZPOA 5K4LA 5FZIA 5FPVA 5FUNA 2YBPA 4D6QA 5A1FA 5LY1A 5FXXA 3PDQA 3PURA 5FYMA 5FP4A 4V2VA 5IVCA 3LDBA 5FZ8A 3PUQA 4BISA 5FBJA 3N9OA 3AVSA 3U78A 5IVBA 2WWJA
chains in the Genus database with same CATH superfamily
4X8PA 4IEQA 4OI1A 1MZ5A 1P8JA 2ZGKA 4IEZA 3IMNA 2Q1FA 1V6OA 4FOYA 1NQDA 5FCCA 3V0AB 3KVAA 1DIWA 4IE0A 2EVXA 4Q4W2 1MEC2 2QDRA 1MZEA 2R072 1CAXA 2OUHA 4YFWA 2FCUA 1W03A 5ANNA 2VNGA 1W8HA 2WZEA 1RMU2 4UXAA 1K5JA 3K2OA 3H0OA 4A3XA 1ENXA 4MXWA 3TOJA 2B46X 2YZ4A 2ZGOA 1V6LA 2B9VA 5F6LB 1BK1A 1OD5A 3ACIA 3IIAA 2EALA 4L0PA 1XNAA 1YIPA 3O12A 5FXWA 3U4XA 2MPFA 2HEYF 3BN6A 1KRIA 2Y0OA 4NIDA 1W6MB 1LKNA 2CHHA 1EV13 1O4TA 2XMLA 2X8KA 3K51A 2FDKA 1V9U3 2RDNA 4NAOA 2D40A 2RDRA 4FO9A 2WO2A 4FPKA 4XZPA 5FZIA 3SISA 1OOPC 1LOFA 2YC4A 2ZX3A 2ERFA 2AEZA 4IE6A 1OD3A 4TWTA 5F3IA 4W6XA 1ENRA 4OULA 5IK4A 1EV12 2QNKA 3OYWB 2XJQA 4PF1A 4XUPA 1Z7S1 3JQWA 4LE3A 4Y1XA 2F17A 5AVAA 3JBG3 4D0QA 4LBMA 1QQP1 3KF3A 1KGYA 3ILNA 1W3XA 4QPGC 5JZGB 3T3YA 1Q8SA 2RR11 4LIVA 2D5HA 4A41A 3SXWA 4J1WA 3LDKA 3B69A 3JBG2 1V70A 4P9GA 1C3HA 1ZYBA 3PVOA 4EJRA 4AI2A 1C57A 1PGW1 2D6OX 1ND3C 5LBCA 1YFWA 4ARXA 5C8WA 2VC9A 4GQ7A 4FAHA 3ON7A 1LOCA 2VZUA 5K0UB 1CONA 5C6CA 3FN9A 1RGSA 4FQZA 4AR2A 2PHLA 3D5OA 2MEV1 2GNBA 4B7EA 1UIKA 1RHI3 4YW6A 3ZMNA 4BQWA 4COYA 5JOYA 3I2JA 4KU8A 3N4MA 1VPHA 2IXCA 4QX3A 1ND2A 1EPWA 1PX3A 1CVNA 1U5XA 1MS8A 1GP6A 3U07A 1WLCA 5JMOA 3LOBA 4AGVA 1UIJA 3GALA 3AB0A 3C7EA 1D2QA 1RHI2 2GMPA 5DG2A 1GOHA 4O61A 5FK8A 4D3WA 1BVVA 1G9DA 1NXMA 1RTVA 1VBD1 2DUOA 2UY9A 4FFFA 2G9ZA 5A80A 2HH9A 4IL7A 3EXUA 2C5DA 1LGCA 4PJYA 3ZYBA 5HCHA 3D6EA 3VBFA 1ULOA 5DAPA 1DGWX 2Y34A 1HX6A 1ULGA 1YQ8A 4LBQD 5DUWA 1GV9A 3PHMA 2RJKA 1KJRA 3MICA 1VLNA 3A0KA 3OSDA 4OUMA 4XXAA 5E8AA 3T1LA 3USUB 3WQ0A 1VBB3 1HB4A 1X9TA 3P1IA 4ITCA 3GYDA 2ZPXA 1NCQB 4KBBA 1O3RA 1EAH3 1QOTA 1GNZA 4HKLA 4Q0UA 1Y43B 4B3NA 1APNA 4XUTA 2VOVA 3HNMA 4MGSA 5IVCA 5L9VA 4AFAA 1ZVFA 2JX9A 3JZVA 2PFWA 1AYM1 2VNOA 1IQAA 2WWJA 2P6CA 3BODA 3LPFA 1EAH2 1YFUA 5BXXA 3C7GA 2JB4A 1T6GC 3WDYA 3DF0A 4JC1A 4AF9A 5KXEA 4UW4A 5C3QA 1LHVA 4R9DA 4GJZA 1NXD1 3CEWA 1ALYA 4RHV3 4Y20A 5JSOA 5M0TA 4WZFA 3VZJA 1J3QA 3VKFC 4XE9A 2XR4A 3FBMA 1G9BA 1OVPA 4XFHA 4R8HA 5FREA 1IKQA 1B09A 2DV9A 5C71A 4LO6B 4KWKA 4S2GA 3DGTA 4HPKB 3EB7A 4RHV2 4KG8A 2RMU1 2BNNA 1DBNA 4FXGB 3GZAA 4FPCA 4DINB 4N8MA 1W2UA 4BH9A 4Y5SA 5F37A 2WLQA 1MQTA 4Z82A 4B8EA 1UWWA 4QX8A 2BUKA 5T50A 3KGZA 4JV4A 2OVUA 3PVNA 4XMIA 3TNPB 4NWWA 4DRRA 4Z1VA 4YVWC 3ZYFA 5FY5A 4Z92B 1X9PA 4IESA 1BMV1 2GAUA 4FPHA 4QGMA 1RUF3 1TVGA 2GMEA 4IV1C 1YJKA 2R32A 2B9UA 4WVWA 3D82A 1X8EA 1OBNA 2HWD1 4CDWA 1TME3 2CYFA 2ZCWA 2HBTA 4PQ9A 5DZGA 2CU5A 3LGRA 1W0PA 4MHUA 4A44A 1RUF2 3VBUB 4Q4V3 4S2DA 4OHYA 1D4VB 1LOBA 5JIAA 3AJZA 2JG9C 3AP6A 3LFIA 2JE9A 3G6JB 4QKFA 1S55A 1TME2 2DYCA 4COZA 1QF3A 2WZR1 4AVSA 5JMCA 1SDWA 4AFDA 3BU7A 1W8TA 4Q4V2 2VG9A 3VHPA 3PMEA 5I0SA 4PIXA 2Z2SB 3KV6A 3POWA 4AW7A 1JUIA 2Q5TA 3KCYA 4URAA 2AACA 3RRDA 5GM0A 5DUXA 2IUWA 1OFNA 1PK6B 1SQ4A 1XJAA 5CKQA 3KCXA 3HD8B 3MIFA 1UCXA 5FP8A 1FYUA 1ZBE2 4XUNA 5BNPC 1WKYA 3H3ZA 1OH3A 5JUVA 2XQXA 1KITA 4GIQA 2FZ1A 2VMGA 2ZEYA 3EYPA 4INDA 5FYSA 5A70A 3MLLA 3WUCA 2BVBA 3A4UA 3UJQA 3K46A 5FOBB 5C9AB 1D0HA 3PIGA 1ZA7A 4I09A 3B94A 2XJRA 3E97A 4D6SA 1HXS3 4E2GA 3LF7A 3J7MA 1C28A 1A8MA 2C0ZA 4LHNA 4CVUA 4XHXA 3UT0A 4DUWA 2PELA 4COVA 1ZRCA 4LR4A 4YARA 3DXTA 2D3SA 1U5ZA 5CIRA 2A6XA 2PXJA 2RS13 1HXS2 4CZSA 3O7OA 3ZLIA 1JZ5A 1FXZA 3C7OA 3JB8A 2IVIB 4J1XA 4JX0A 1LEMA 4LHKA 1WCKA 4N9HA 5DDJ1 3X29B 3ZXGA 5A1FA 3C8XA 3URFA 5FXXA 4YZ2A 5BV6A 3RDIA 1QJY3 1VR3A 4CCCA 1I3HA 2EICA 2UY8A 2BPA2 2RS12 2HEVF 1MVQA 2Q30A 2R063 2WQZC 2A3YA 3LDRA 5FZGA 1PO21 4LLFA 2A6ZA 2G9FA 1CJPA 1Q8QA 1QJY2 1OF3A 1WLDA 3BVCA 4YW7A 3R4UA 4JDMA 4CP9A 3ALQA 4NE9A 4N43B 5CFCB 2GDFA 1PIV1 2R062 2UWAA 2XG3A 3CBNA 4UFKA 1RJ7A 2ET1A 4CCKA 5IWFA 2HYKA 4LBQB 3SLIA 1Y4WA 3B02A 4FTEA 1XNDA 2A6WA 3SC7X 3UJOA 2F6BA 3ZFFA 1NE4A 2ZXQA 3CDZB 1UF2C 4GKXA 1CN1A 1O7FA 3NAPB 4XMAA 4G3YC 3S6PA 3LAGA 2RE9A 4FCAA 3WF1A 1UN1A 2VW0A 5A32B 4FP3A 2CSGA 4BE3A 2PHFA 1BEV1 3KV4A 1FV2A 3R6SA 4BLJA 1GQPA 1SFPA 1J58A 3VZNA 3VDCA 1PGL1 5L9BA 1B35A 3JQXA 5J37A 2VQAA 2PQQA 2WAAA 4BIFA 2NYYA 3B5LB 3P5BA 4DNYA 3AXEA 3AMQA 1H1MA 4MZUA 1HJFA 4FTBA 4X6QB 2NM1A 4PIZA 3TYJA 2NPIA 4CDXB 3POFA 1LHWA 4FBFA 3I2OA 3CJIA 4EN9B 4META 2NP0A 2W47A 5LCWL 3OBRA 4Q26A 3VD4A 3M70A 3N9MA 4NROA 4IUGA 1XSRA 3J9SA 4BMEA 2EA7A 3U14A 4DZGA 2EAKA 4LBLA 1WGPA 2YROA 3FLTA 1BYHA 3MIGA 4ISQA 3B01A 2TUNA 1WMFA 4XF0A 1VRH3 2AYHA 4R4XA 1YHFA 1JI6A 2FMDA 2VOKA 2VQUA 3ZSLA 1ND2C 1G9AA 1ONAA 1O4ZA 5G04L 3E6CC 4ORFA 1VBC1 1W8UA 3PUSA 1POV3 1Y9MA 4GD4A 1J1TA 4K20A 4QDRA 2WYFA 4S2FA 1VRH2 5CVRA 1H8TB 1DZQA 3AYEA 4CP1A 3ST7A 1LR5A 1N1YA 2QQWA 2YU2A 4JKLA 3EHKA 2YYOA 4RGGA 3RZMA 2JDPA 2ZHKA 3N7KA 2E9QA 4X6RB 1LULA 5EWSA 1OH4A 5FZOB 3VBFC 2EIEA 3ORJA 1NX9A 1PX4A 1Q43A 2HWC3 1CAWA 1K5MA 2ORZA 2VH9A 3IDBB 3INAA 2XVLA 2HWE3 3E5XA 4MOAA 3KM5A 3MEPA 1VAVA 1G9FA 1VAMA 1O5LA 2PLV1 2Y6LA 3LKJA 1WMEA 4QGLA 5FYBA 2HWC2 2WNVB 3ZDSA 3ENRA 2W1WA 4V1PA 4SBVA 2DFBA 1WCDJ 3IBMA 3OPTA 1JU3A 2HWE2 4AHWA 3SMHA 5FPVA 2RDSA 3I3EA 3HR9A 1LESA 3KWVA 3PDQA 3PMSA 1UW8A 3PURA 4H7MA 3ATGA 4LUKA 3TN91 1REDA 1UYPA 4E2SA 3MUY1 3VD9A 2LALA 3BB6A 4M3CE 1BKZA 3WNXA 4RYDA 1RUI1 1ULDA 1W9FA 1SZBA 4MGKE 1JZ7A 2QZ3A 2P4EA 5L7OA 3P6BA 4C1XA 3NMBA 3PTYA 2ORXA 3AVRA 2HWF3 4KWLA 1IG0A 1VP6A 1RUH1 3LOIA 5F5CA 2FDGA 1NCRA 4IEUA 4QB6A 1HRI1 1QEXA 4H14A 2QQUA 3GZEA 5HCBA 3J7NA 4B7KA 2UWCA 2DURA 1VBE3 2Z5WA 4JDNA 2HWF2 3QCWA 5EP9A 1MQTC 2A3XA 4OI0A 1ZBA1 1WW4A 2P17A 1FV3A 3ZFEB 1QMJA 4QT6A 1E5IA 2BFUS 1I5PA 2O1QA 4Y22A 4D7YA 3GZUC 1QH6A 1IQDC 1WW6A 1VBE2 1QDOA 3NWKA 1F35A 2GC2A 1D7PM 3AZZA 3EO6A 5DQ0A 3I59A 3WNKA 4J6GA 3I3QA 2JDUA 3WXPA 4BQ2A 3LE0A 5AFEA 1WW7A 3ILFA 2W9XA 3ZSMA 2JDNA 4CDWC 1QXPA 3L9JT 3U37A 1HB2A 1DU3D 1UD1A 1WCUA 4AG4A 4BQ1A 2WABA 4XJ9A 5B4XA 4YZ5A 2WFPA 1QJX3 2VNVA 1I5ZA 2XQRA 1AR83 2C6SA 1C1LA 4XZUG 5FJKA 3OBAA 1MVEA 4AZZA 4LITA 1US2A 4JGZB 4M3CA 1ULEA 1JZ4A 4ZHNA 4A7KA 4BMBA 4MG2A 3WHUA 1QJX2 3AC0A 3FFZA 5L9RA 1D2SA 3GHNA 1G6NA 4ONUA 1D4M3 3H42B 2DUPA 1C8NA 5AVPA 3ETPA 3THPA 5A3PA 4GH4A 5KXBA 1JZ3A 4BB3A 1FOD3 2TBVA 1QH7A 4NHMA 4FPLA 3VD7A 4NIHA 4AQ6A 3E1F1 1GFF2 1YFYA 1S2KA 2ZKNA 4HFSA 1D4M2 3R4SA 4IV3B 4ASKA 5BNNA 1UZVA 1W06A 2WQ4A 4Y24A 4LORA 2FDIA 1FMD1 4LA3A 3RWNA 1FOD2 4K9SA 4CDUA 2GSYA 2J1SA 3DPRC 3KT7A 2ZGUA 3MUZ1 3E6BA 2UYAA 2DF7A 2PHUA 3ACHA 1Z78A 2BW8A 3C3VA 3ZR5A 4LBOA 1GWLA 4CEWA 3PNAA 3VKOA 2KXLA 2YGMA 1SFYA 3Q8EA 2A1XA 1RUE3 2ZGPA 3A22A 1JYTA 2WN2A 4IGQA 1SMVA 3HT2A 1JZ2A 5C4WA 1ND3A 1QNYA 2AENA 2JDZA 3PJQA 3MIBA 3VDDA 2WNUA 5DAXA 4YGCA 5FZCA 3RYKA 4PI2A 2R6QA 1LU2A 2FDJA 1J1LA 2JE7A 4HL0A 4L2NA 3M7AA 4JKMA 4ZXKA 1RUE2 4U36A 4GJYA 2UWBA 2Z4FA 4BOWA 4K3UA 4HETA 1MS1A 5CAZA 3ZPOA 4AHZA 2ZHMA 1YLLA 1RUG3 2YBPA 1XC6A 3DV8A 1VIWB 1NQJA 4CU6A 4ASMB 4CDQA 3VBSB 4JCKA 2AC1A 4RR3A 4NHLA 3S7EA 2JECA 5FZFA 2RS53 4OHXA 1RUG2 3UK9A 4QQHA 5FZ7A 3OUIA 4H7LA 5LBEA 3GBGA 3QLQA 3SKJE 2Y64A 2YY1A 2AH2A 5FLIA 1IPSA 4WBBA 4PF5A 3WNMA 1OQEA 2XONA 2XHNA 1V00A 2RS52 3NV4A 4LXLA 1PGSA 1WLWA 3E6DA 4DEVA 5FZHA 3ZFFC 1RVF1 1W9SA 1NUKA 3MFCA 4AEDB 5IVJA 3I3BA 1AF9A 3HNYM 1MR5A 2K2SA 4HSLA 2ZMKA 3Q9OA 4Q4Y1 5GZGA 3VBRA 5LBBA 3OD0A 2FD8A 1AX2A 1XNTA 3C7FA 5JWPA 1S0FA 2OW4A 2XUEA 4W6WA 1LNSA 3POJA 2ATFA 3KHCA 4ZU4A 1B35C 3WF0A 4Q4X3 4HZFA 5KR7A 2ZX4A 3ECQA 1OMIA 1XRUA 3GXUA 4XTMA 3K48A 4GWIA 4YM3A 3DL3A 2OZ6A 4P5HA 4RFRB 2PQSA 3CJIC 1O3SA 2CAUA 2DWRA 4UYBA 3WP3A 2R7EB 4Q8KA 4PDWA 3BTAA 5DMYA 2RJLA 5LA0A 4FPJA 2W3JA 3VHNA 3NO8A 1ZZ7A 5IAXA 1YQ2A 4K21A 4YW1A 3FBYA 1U5YA 2SLIA 2VAUA 2VZQA 2VZ3A 4QU1A 4YG6A 2JG8A 2Q8DA 3VZKA 2VQ0A 1EUTA 2W94A 1XNKA 2V4AA 4XJWA 5I93A 2BNOA 2RHPA 2ARXA 2ZTNA 1UMHA 1ZZBA 3O0VA 1FI2A 1HIXA 2P3IA 5FXVA 5CKNA 1S0IA 2HWB1 3NNFA 4PIYA 3CO2A 2D6MA 1UY1A 5F32A 3WDTA 2VTFA 3VZLA 4CUBA 1RITA 3WT3A 2JDMA 2AGSA 5T55A 5ABJA 4JHZA 5E6HA 1VBA1 2B8MA 1IPJA 4FXKB 4Q0SA 4B1MA 2BU9A 2OA2A 4Y1ZA 1COV1 2E7TA 4LMFA 2X09A 2E31A 2VW1A 2ZEXA 2D3RA 2ZZQA 4QDSA 5FY0A 4XCBA 1WWYA 3VBOA 4GMP0 2CWMA 3HOBA 2DCKA 5T5JA 4BQYA 1ASJ2 3MPPG 4EQVA 5EIYB 4MHRA 2NN8A 1OI6A 2BRTA 3OOXA 5FY4A 3NL1A 1AR62 1TMF1 4YYOA 1IKPA 2JDYA 4JTNA 4D69A 2R042 1X7NA 3AKPA 1CAXB 1TEIA 2ID4A 1F4HA 2YGLA 1BHGA 2D7FA 4M0NA 4UAPA 4WM7B 3VDBA 4CXYA 5A3OA 4D6QA 5IK7A 2BNMA 2P37A 4BQ3A 1GP5A 5L7OC 3LDBA 3N35A 2NQYA 4KI5M 4P00B 3S57A 3H8UA 1EYBA 3OG2A 5BNPA 2D3PA 3S0MA 2ZX0A 3FE5A 1S0DA 4MO3M 1ZM1A 1NCRC 5FYZA 4Q0QA 1M06G 1W6NA 4FOQA 4AAPA 4LULA 4I2OA 4I0WB 2E32A 1EUUA 2P5BA 2Y6JA 1R092 1IS5A 2ZGQA 3T2TA 1GZWB 4ARYA 1GYKA 5F39A 4LKFA 2AR6A 2FZ2A 5AC93 4OUSA 1YYNA 2ZGNA 4Q0PA 3S5AA 1PVC3 1A3KA 2PMWB 1QGLA 3ZVXA 4AK3A 4CXXA 3NW4A 3WY6A 3LEKA 1SCSA 5DAWA 1JTZX 2BQPA 5FZ4A 4QHOA 4A45A 5F3CA 5AC92 5D8AA 3C7HA 4EN0A 3TRSB 1QIQA 1W90A 2GH2A 3T08A 1PVC2 4Q4W1 4QQOA 1MEC1 3ITQA 3OEAA 2R071 4NHYA 4UW6A 4ZONA 2DVBA 1HV0A 3ZX7A 1KDKA 1AL23 1RMU1 3RWKX 3WD5A 3ZFGA 2BOIA 1NKGA 2XBO3 1ZZCA 3WF4A 4AEKA 2FMYA 4QDQA 3W59A 3O14A 1XE7A 2Y26A 3O1VA 1CX4A 3WNPA 1C5HA 4MUVA 1AYN3 5FKBA 1UY2A 4M01A 5FQ0B 2B45X 1AL22 2Q1ZB 2QJVA 4XBQA 3VGIA 4BM8A 2XBO2 4J25A 3OTFA 2BV4A 4YVSC 4C91A 4A7YA 1OLME 1UAIA 1E5RA 2VW2A 4CXWA 5F7UA 3N7MA 5FRAA 4A6OA 1AYN2 1DQ4A 2W95A 4EN6B 3T09A 1K42A 4YZ1A 1W28A 1NZIA 4RGAA 3K4AA 3WF3A 4CUGA 1EV11 2WUHA 1Y9GA 4LBKA 4AEMA 4GH4C 1W9TA 4OUEA 1PMJX 5JI7A 4LA2A 2QQPA 5D1IA 3AFKA 1YQ5A 4HBNA 1JHJA 2CGPA 1H6YA 1V6JA 4ZZ5A 3OEBA 3FHAA 1R64A 4XFAA 5BNNC 2H6BA 1YQ6A 1DQ1A 5FMBA 1V9U2 1LHNA 2PHWA 4XDQA 1JODA 4KMQA 3T0BA 4OHWA 3N9LA 1F5FA 2VXRA 3RI8A 1PNGA 4XFBA 3WW2A 5FZDA 4CDUC 1O3TA 3JBG1 3J8F3 4BPZA 4EWDA 1CWPA 4M4RA 4CEWC 3J7LA 4XUQA 5GLTA 3AKTA 4F8AA 4R52A 4LK7A 4AFCA 1QKQA 5BNOB 2OT7A 2GU9A 4DOUA 4MH0E 2WO1A 3M1HA 5C4WC 4BZ4A 3VDDC 3J8F2 5FXZA 1JZ8A 1DFQA 2WNUC 1REEA 5GLWA 5CFDA 2YUEA 1Z7S3 3BPZA 5JVVA 1XYPA 5A7NA 3THCA 3BIWE 2J1RA 5H9PA 3W21A 2JWPA 2XB6C 1WLTA 4R9CA 3TEZA 1LOAA 1TNRA 3AFGA 1JYXA 3P3PA 2IFRA 1I1EA 5HBAA 1W6QA 2P3JA 2RV9A 2ZGSA 3ILRA 3A21A 2WRAA 4ISRA 4LO5B 1Z7S2 5ACA3 3BTZA 1RHI1 4K6BA 1OFSA 2QBXA 4QPIA 4GALA 4CDQC 1SDDB 4RR3C 4AAXA 1HLCA 3B7MA 1YFXA 1SBFA 1QNWA 2XOMA 2ZX1A 1W8FA 1V6KA 4ZS2A 2ZX2A 3WDWA 1UZWA 4L9BA 1W0NA 2IXIA 5ACA2 3BTXA 4XOGA 3U78A 3PLQA 5A7SA 5J36A 3CL1A 3DECA 2OPKA 3SCFA 5T52A 5KHKA 3ZIWA 1HRV3 2JD9A 2VM9A 5LRRA 4AI8A 5IVVA 1W2TA 2W1QA 3KCCA 4ZPIA 5EFUA 3K75B 1KS4A 2WT2A 4GWJA 2QE3A 3OY8B 4RL7A 1S0CA 3SHRA 3UKVA 1CZVA 1HRV2 4G4FA 1WMDA 5A6YA 3VBRC 1W6MA 2W39A 3O0WA 1C8M3 3VBHB 2LROA 4HANA 3N9PA 3ZSKA 3LQCA 3ES4A 2BVVA 2BERA 2BBAA 2D97A 3KHBA 3O1MA 2NMOA 2A6VA 2PHXA 4NPRA 1VBB2 2EXKA 2D6KA 2P34A 2WZ8A 4PLNA 5IFTA 4PLOA 5FYUA 1C8M2 3OYWA 2Z42A 5GLUA 4PT6A 5SV5A 3U75A 3FHIB 1BK0A 3ZSJA 3UKNA 3BGAA 4YGEA 4XJAA 3UGHA 4RHV1 2WS93 5JZGA 1AR73 1WD4A 4KWUA 5JXGA 3MLKA 4PDWC 4ES8A 5C70A 2UYBA 4N53C 1KQRA 2YV8A 2DFCA 2QQOA 2IFWA 4AVTA 1X8MA 4IGPA 4PI0A 2WS92 1XNCA 2JG8C 4YG0A 2LUWA 1AR72 4YG3A 1X33A 2WR9A 4DIQA 3IPVA 4CCMA 1G8WA 4R9BA 4YWAA 4XUOA 4KL1A 3ZYHA 5H9QA 4R9AA 4G9SB 1OQ1A 3DXUA 1SLLA 5F5AA 4CP0A 2C24A 1K12A 2V4VA 3MW4A 4I01A 1REFA 1OSGA 2DTWA 1H6XA 3ZO0B 2X10A 4OI4A 4NRMA 5C3OA 2EF6A 1XOYA 5I0TA 4AGRA 1AHSA 2RMU3 2X5IB 2VZOA 3IB3A 1RUJ3 2V5DA 5LEKA 4H3WA 5ABJC 1AJOA 1RUF1 1CAVB 1O4YA 4JQTA 4IE7A 1GBGA 1ODMA 1CZSA 5HCFA 5FZ9A 5A3WA 2WJSA 1RUJ2 3VBOC 1JYNA 1C1FA 3UV9A 2QQVA 4FPFA 5HXVA 5F6KA 4NHKA 1OUSA 2V5YA 2JENA 4PQQA 4F3JA 5DXDA 3B00A 5IVYA 3DYPA 5A3TA 3USUA 4FPGA 4AI1A 5LEJA 1YQCA 1EP0A 1GUIA 1AJKA 4RS5B 1W9WA 5BPXA 2UU8A 1AXYA 3SH4A 3TEXA 1BMV2 2HJIA 4CP9B 4CA9A 3RI9A 3GCWA 5FO9B 4RGKA 3I49A 3RJRA 1C5IA 2QQIA 5FZ1A 5JR7B 1ZBE1 2MHFA 2BZDA 4CRQA 5HXMA 2BWCA 1PHMA 1SFNA 2ZABA 3D8CA 3CU7A 4LEJA 3DCQA 2JKXA 2CNAA 3OB8A 1VE0A 4K8RB 1K3IA 2E51A 2C9KA 3M3OA 2WZR3 4KBZA 4WM8B 3H8OA 1W2NA 4QD2A 2E26A 2XWJB 1TNFA 2WT0A 3MI8A 1OUXA 5CYYA 3JB4C 2BEOA 3DPRA 1NA1B 3IM0A 4WZCA 1JOJA 2WZR2 1OLRA 2QKDA 4JZRA 4HOOA 4JHTA 3O1OA 4BIOA 1YWKA 3RS6A 4E4ZA 3Q8CA 4HPKA 2B39A 1W8WA 1HXS1 2YFZA 1UY3A 1S0JA 1ULFA 3CMGA 4K40A 4OCTA 3TB0A 1SG3A 2DUQA 5LK5A 4O9EA 1O3QA 5FIXA 4DPNA 4AFBA 1BBT3 3K3OA 4BDVB 1AUYA 2E7AA 3EQEA 2HEWF 5D8AC 2ZGMA 1MS4A 1UZ0A 3TEWA 3MV01 1XNBA 3APBA 1RINA 1OPMA 3LA3A 5JSPA 1U12A 2XJVA 4CEYB 1JOPA 2DVAA 2ZMLA 3ZFGC 1BBT2 1QJY1 3I3MA 3RGBA 2IXJA 4YSFA 3P3NA 3NKGA 3VV1A 4QX1A 3NJZA 4ATFA 1MZFA 3W9AA 4DXZA 3G7DA 1UOBA 1V6MA 3NV1A 2ZZJA 5T3NA 2Q8EA 4A42A 5CADA 2ZMNA 2VTXA 4OVEA 3ETQA 3QH7A 2JICA 3ZIXA 4BK5A 2PYTA 4LOTA 3DKWA 2CDPA 2Y6KA 2CL2A 4JQRA 5T54A 1GQGA 3ZXEA 2JDAA 2XH6A 4QXBA 3SH3A 4LKEA 4A2UA 4HSJA 4XILA 5EQUA 3K3NA 3Q8BA 5A7WA 5FJHA 3M4FA 4Y33A 5DAVA 5FMOL 3WNLA 1H30A 5JCTA 3FZ3A 1WBLA 3TBDA 2V73A 5ERLA 2L9LA 4UF0B 4D7SA 2VZTA 3HMYA 2ARCA 4CPBD 2A71A 3AMMA 1PK6A 1N3OA 4Q1PA 1DDLA 1K5MB 1UZZA 4H55A 4K1YA 2WQ8A 2RJ2A 3PL0A 4BQ5A 3AKQA 3TEYA 3RZJA 4COUA 2QQJA 1FT9A 4E4DX 1OHFA 1RC6A 4LO4B 3UKTA 3ZYRA 2CV6A 1CD3G 1KJLA 2VU9A 2A6YA 4XDPA 1PMIA 5FZMA 1DQ2A 5J09A 3AP7A 4AHYA 4MVTA 2C1FA 5IT6A 3WCSA 2DCJA 5A3MA 1ZZ6A 5TSWA 2PAEA 3FLRA 4QU2A 5FK7A 5C9AA 3K4DA 5CFDC 4URTA 2IXHA 4CUAA 1NE6A 4XJZA 4GKYA 1DQ6A 3R05A 2FHRA 4LKDA 3NNMA 5KXCA 4NHXA 4QMAA 4UWDA 1XBFA 4XTPA 5IATA 5FZAA 4QX0A 4QPIC 4UW3A 5LY2A 1LAJA 1UX6A 1DYKA 1H2NA 1NCRB 5FKCA 5EZWA 4E2QA 4UBHA 5C33A 5GZDA 2YHJA 4E27A 1OKOA 2V72A 1W6OB 3AYDA 3MGUA 3VKMA 4DB5A 2CWSA 2P3YA 1POV1 5EPAA 2O8OA 3IDCB 4UFMA 3UESA 5BY5A 2ENRA 4JGYA 1SHWB 2VY0A 4AVCA 1GANA 2JKBA 2JIGA 3HN1A 3PJYA 1DHKB 1SLAA 4YLZA 1GICA 4CCLA 4N43A 5FYTA 3KZ4C 3MFAA 2YPDA 3SEEA 1PO13 1ZZ9A 3AZWA 3AKRA 3FX3A 4B29A 3WV6A 4LBQA 5J96B 1GZ9A 1W6PB 2HWC1 1S2BA 5FYCA 2CDOA 1S0GA 3FLPA 4Q0VA 5F5IA 3VN4A 1RIRA 1DYPA 1J3PA 4HMZA 5FWEA 2HWE1 5LBFA 3ZN5A 2DTYA 1PO12 4AI9A 3WZ1A 4L8QA 3NAPA 1FPN3 1F8VA 4B4RA 4Y1VA 3R4DB 1US3A 1UU6A 1AL0G 2RM21 2WNEA 4WV8A 5A32A 5B2GB 2J1EA 2O14A 3M3CA 3ZXKA 1S1AA 3PIJA 2QDNA 2KD7A 1QJU3 5CEHA 1FPN2 2W87A 4RQPA 2OZJA 1I6XA 1URXA 3BPSA 4EWEA 4NR1A 5FOJB 3CKHA 5JZGC 5KHGA 2HYXA 2R16A 3OPWA 4RFT0 4YZ3A 5A3LA 5FPXA 1LTEA 3WG1A 2VO5A 1QJU2 3VUOA 4UBGA 4CDXA 2Y33A 1HV1A 2LTNA 3NNLA 3NV3A 4QB1A 4QM9A 4BU2A 3GF6A 3HAGA 1AXZA 1UXZA 1E5HA 2TEPA 5FY1A 4OHZA 3ZPYA 3OBZA 4AQSA 1OOPB 4BQ4A 4MSVA 5JOXA 2GNDA 4FPOB 1RUNA 1CESA 1N1TA 4BXSV 1RUI3 1VBE1 3FUQA 2D43A 1QHDA 4QQPA 4BJ0A 2VVEA 4I0AA 2VUCA 2FCTA 5CKMA 3GNEA 3BOWA 3J7HA 2W52A 5C5UA 1NLRA 4LUMA 1YNAA 2I07B 3ASIA 4P14A 4QPGB 5FY7A 3WG3A 3WG4A 1WMXA 2WWUA 4KGGA 3WP6A 4C8DA 1H2LA 3M3EA 1DGLA 5KHJA 2OPWA 4Y5TA 4QX7A 2JDKA 1ZBA3 1ND3B 1H8TA 3J4UH 3GBWA 3JD71 3VDDB 1J84A 1TZOA 4QXCA 3CZUA 5JDBA 2ZBJA 4HKWA 5IVFA 3S30A 2CGOA 4BXFA 4XQ4A 5FZOA 3KF5A 5H9SA 1QJX1 3HNBM 4CE8A 5ISLA 4YVSA 2J22A 5DZEA 3H3LA 5A33B 1JOBA 3POSA 3QH6A 4RD7A 1UOFA 4EV0A 3QOPA 1F4AA 1OQDA 4FFHA 3ZYGA 2W68A 1AR82 2GP3A 5FYVA 2VZPA 3H3UA 2XLFA 2WNVA 3KS7A 4Q8LA 1UL9A 2QTWB 4R4ZA 1D4M1 1YI9A 4EZHA 3ZN6A 1W99A 2EAAA 5HV0A 5L19A 4AL9A 3USSA 1CAUA 1DGRN 4Z2WA 1YJLA 1FOD1 4XEZA 3ZMOA 4LJHA 1HW5A 4CU7A 4GMP1 4BQXA 3T2QA 5K8SA 5EV7A 2P3KA 1K45A 1QJFA 3LPGA 5LY1A 1UY0A 5DPNA 1X82A 3I54A 1AR93 1JUHA 4NWVA 1XU1A 1CPNA 3KD4A 4JRLA 2LM3A 2XUMA 3TAYA 3RMXA 4D8MA 2G4IA 4YW3A 1POV0 1TQ5A 3OBTA 1JBCA 2LS6A 4L11A 2PAMA 1RUE1 2H0VA 2ZGTA 2H6CA 4NPLA 5T5PA 4XF9A 1AR92 2VMFA 3AXDA 2GC3A 1N47A 3K77A 4QQ2A 4DRVA 4DY3A 3GZTB 3LIGA 2OXBA 3ZFEA 4LBNA 2R1BA 3AYCA 1PZ8A 4CUCA 4QQLA 4D94A 5IHRA 4FOWA 4JVAA 2R30A 5C5TA 2VULA 1BZWA 1DG6A 5FPBA 1WCSA 4C0BA 1RUG1 2OX0A 3BIEA 3WP4A 1I9RA 5H9RA 4MGZE 4BYYA 3M2MA 2FDFA 4NN0A 4MGQA 2VJXA 2X05A 3ZXAC 4YPJA 4OYUA 5GKAC 4OQ8A 3VBUC 2W5FA 1QOSA 2BGCA 3EMRA 3DUIA 4HVRA 4LOSA 1DCSA 2ZJCA 1HN0A 1LGBA 3N7LA 1A78A 3RZHA 3BOPA 2ADDA 2Q1MA 3PUIA 1KXGA 4JGZA 4MADA 3PU3A 4YVWB 5KHHA 3W58A 2AREA 1UOJA 2QFEA 4P9YA 3UETA 1OT5A 5K7PA 3SQOA 3OCPA 1LGNA 5F5QA 1YRZA 3OUHA 1DGWA 4IW3A 5DN2A 4IV1B 5IYYA 3CJXA 5IAVA 2B42B 2Y6HA 3WNOA 5ABJB 4QKNA 4KGQA 4CSWA 3CQOA 5FBZA 3WF2A 1PK6C 2K9ZA 1UU4A 1PM7A 2XL7A 4XC9A 3M3IA 4YZ4A 4XAEA 5K9YA 4NMIA 3FC0A 2ZAAA 3WSOA 2JG9B 4XFGA 3MIHA 2VBBA 3NSTA 1W9YA 3ES1A 4RA0A 1RUC3 4HXCA 2VXJA 4IERA 4Q4X2 3AX4A 5C9AC 1XYNA 3FUOA 5DZFA 1U0AA 1NLQA 4Y1YA 3RYRA 2E7QA 4N53A 3WCRA 4BHPA 3FL7A 1RUC2 3GJBA 2Y0IA 3IN9A 1SPPA 1RUD1 3ZXJA 4EYUA 2ZA9A 4KQ7A 5A1AA 1N3QA 4Y4RA 1G9CA 1FNZA 3WVJA 3RNSA 2R49A 5FV3A 2B5HA 4MX3A 3LA7A 1ZA4A 3RSJA 5BNPB 2A73B 5APAA 4GWNA 1OA4A 3CHXA 4AQ2A 1ZRDA 1IS6A 2J42A 3JCIA 1GNYA 3B9IA 5FO7B 2ZOEB 3HIFA 3M8LA 4QWNA 5LA9A 3WOGA 1JS9A 1W04A 3KQRA 4JGYC 4XJ8A 4XPVA 3VBSA 2WSUA 2G19A 4OMCA 2K46A 3BYWA 3SH5A 1MS0A 5JXIA 3O1SA 3AZXA 3VD3A 4E9KA 3GCXA 4WVMA 4N43C 1QJZA 2F4PA 1QU0A 4QX2A 1ASJ1 3N9OA 1H9PA 4HK8A 4AI3A 2Z79A 4B1LA 4BISA 4TZDA 5CNAA 1Q56A 4XFIA 2RS33 5FUPA 3V0BB 4NRQA 5G05L 4ATEA 1VMFA 4LE4A 1JMUB 1AR61 1N1VA 1W8ZA 2WFF3 1V6IA 2BGOA 5D8AB 2R041 4H2AA 3S7IA 1ZREA 2HWB3 3I2IA 4FQ4A 3T4HB 4ASLA 2XDVA 3SITA 3ZFGB 1DLLA 2WO7A 2RS32 3NAPC 1VBA3 4UFHA 5A1LA 4W4ZA 2WFF2 3ZM8A 1GP4A 2EXJA 3DEMA 5A7PA 1O6UA 2W92A 1R1A3 3OGJA 5FUIA 2OQ7A 5FZ0A 5KC6A 1LJ7A 4MXWB 2VE1A 1SEFA 3MO4A 3NVCA 1NY71 4Q5OA 3T2PA 1H9WA 1VBA2 1XE8A 5JI9A 4RQPC 2A5ZA 2D5FA 2ZHNA 3D3AA 3F2ZA 3IKWA 3T4VA 1R1A2 4NUBA 2GNMA 5I8SA 2XHKA 3MV11 3RFRA 4GB33 1R091 1DLCA 4CDXC 3U0ZA 3LEIA 3HWJA 1GZCA 1UMIA 2XJTA 4K7JA 4N90A 1ZRIA 3RZLA 1PVXA 1ZRFA 2ES3A 3RZKA 2G1MA 1GU3A 3NRUA 1OC1A 1H1IA 1UZYA 4GB32 3OD4A 4PCRA 5FZ3A 2ADEA 3WQ1A 1V6NA 4AVBA 5AC91 1BCXA 5LATA 1UXXX 2HLEA 1PVC1 1U5IA 2EIDA 2Q4SA 2GN3A 2ZGLA 2GALA 5T5OA 5I8TA 1F2NA 4QAWA 1O8SA 2QVSB 1JXNA 3W5NA 2GMMA 3VB9A 1MS9A 4AXOA 3UGFA 3Q8AA 3POIA 4DO0A 2C26A 4EN7B 3NJXA 3I97A 2Y60A 1H8TC 1IPKA 1AX0A 2H0BA 2VZSA 1AL21 1MS5A 1NOVA 2XBO1 1D0GA 2P6HA 2Q0AA 4IEPA 3AK0A 2DU1A 1SBDA 4FVVA 4TXWA 5IJRA 1W6QB 4OHVA 2BYVE 3WEZA 4P9LA 4IXLA 2ARAA 1S4CA 5FZ6A 1MEC3 1R083 1RJ8A 3NJYA 4NOTA 1ND2B 3MDPA 1Q8VA 5CBLA 2EXHA 1HQWA 4FPEA 4XJUA 2WN3A 3MIEA 2J1AA 3VKNA 5EXOA 1LRHA 4QPYA 2WNVC 3WUDA 2VZRA 1KS5A 5DAQA 3VHOA 3POGA 5J1XA 1R082 2WIIB 4FPYA 4P9XA 2B7YA 3POEA 4S2HA 1ODNA 1V9U1 2W08A 4WM7A 3OJBA 5FZKA 1DF0A 2AUYA 3VLBB 4A4AA 2PHTA 2AEYA 4XBNA 2WT1A 4XF1A 2WLPA 3RMYA 2VVDA 4NPMA 3VBFB 3LEMA 5C8CA 2DBNA 2XVGA 5J98B 2WL1A 4AVAA 5JSRA 5IK8A 4V2WA 2W2IA 1JZ6A 2VZVA 2CY6A 2E53A 1QXRA 4UI9L 4FFIA 4MXVA 4DUXA 5FR3A 1JYVA 1Y7BA 4LTAA 1LOGA 4QGNA 3U1XA 3J8F1 4AEJA 1C4RA 3H1MA 1S0BA 4E4SA 5IVBA 4F83A 1BXHA 4LIUA 4FSJA 3QD6A 4XBLA 3WDUA 5DUVA 1CIYA 1XXNA 1H2KA 5F9TA 1GZWA 2V09A 4OMDA 2GP5A 5LASA 4BK4A 4EE2A 4ZU7A 5CG8A 3ZFEC 3HVDA 3RVHA 2ZAHA 2QCSB 3KGLA 2JB8A 1J59A 4NIGA 1UO9A 1QQP3 1CGPA 4Y20B 4LK6A 2RR13 4UT5A 2WINB 1HB1A 3QACA 2ZEWA 4BWOA 1OLMA 1XQNA 5EJ3A 3ZN4A 4CCNA 2XJSA 1AX1A 2OS2A 5ACA1 1QQP2 4FP2A 4NVPA 2JEMA 4ZZ8A 3KT1A 5A3UA 2VUDA 4OZOA 1A8DA 2RR12 2VMEA 4XHBA 3V0AA 3FWEA 3KQ4B 1MQTB 1YIFA 3IPVB 2A70A 2GNTA 3QBQA 4GAZA 2MEV3 5FYHA 1VMHA 4ES9A 3O1RA 1PGW2 1KDMA 5FQ0A 5KWRA 5AFBA 1IG3A 2WDBA 4QHZA 1HRV1 4JGZC 3A23A 5GZEA 1IS4A 2R1DA 2DCZA 2WAOA 3LEGA 4OLLA 2MEV2 1GMMA 5BUVA 4YM0A 4PHZA 4QPWA 1YC61 2A3WA 2RG4A 3SCHA 3I2HA 4IEWA 3LWCA 2ZGRA 4QB2A 1VBB1 1EY2A 1VBD3 2XXZA 3H9AA 1OURA 3H7JA 1GR3A 4XDOA 3ZYIB 1C8M1 4CDWB 2NMNA 1BQPA 1EAH1 5GLZA 3WINE 2WA4A 1XE0A 2W0XA 2BOJA 4CU8A 1W2OA 3KMHA 3RG0A 3AMNA 4HKOA 4IV3C 4M0HA 1VBD2 2VCAA 2XLGA 4AOCA 3HT1A 1XSQA 4DQAA 3MYXA 4IDZA 2VOXA 4UW5A 1XYOA 4OQ9A 2ILMA 3MZHA 1Q5OA 1VB4A 1JYCA 3VL8A 2DVDA 2A75A 4B4QA 1HQNA 1JU4A 1H8VA 2BBVA 5FP9A 2WS91 4UOJA 2BTVC 4EWAA 1AR71 5A3NA 5BNOA 4YNIA 4NIIA 2GN7A 4HT1T 1AYM3 3HN3A 4AE2A 4FAGA 3HBZA 4HN1A 5A6QA 3B3QE 1MZ6A 3V64A 4C90A 3NNGA 2VBDA 5K0UA 5B4NA 3OUJA 3UGGA 1E57A 3KLSA 3MF9A 5JR2A 3AM2A 1WA6X 2QQNA 4CCOA 2JDHA 3KSCA 5JXJA 3M3QA 1AYM2 4HONA 3ZDVA 2WSVA 4W6YA 5JIUA 1EPZA 3DPRB 3WLUA 4CTEA 2X29A 1JW6A 1RL3A 4JKKA 4AVVA 2HKXA 2YU1A 1YCIA 2D93A 3VBSC 1UQXA 2PHRA 1RXGA 1F15A 1RUJ1 4CCEA 4XFCA 3LCPA 1PNFA 1J3RA 3HQRA 4Y1UA 5FP4A 1TME1 1S0EA 2I45A 2RMU2 3AZVA 5FZ8A 3TNQA 1PMHX 2IVJA 2QUOA 2YFUA 3O0XA 1ZRRA 4O9GA 1BJQA 3DN7A 4Q4V1 1DGRA 4IEOA 1X50A 3FMGA 4AEDC 4JRAA 2BWAA 3OY8A 1HKDA 4IEYA 5CZKA 3GGLA 1ENSA 2C4XA 3OGRA 2Z69A 1H0BA 2HWD3 4XAAA 2YPJA 1NCQA 4QX5A 3VBHA 1XU2A 1UKGA 3GJAA 3AL5A 1ST8A 4L97A 2VCMA 1KFXL 3IWZA 1F5JA 3NV2A 3IDAA 3U11A 1F9KA 4I3GA 1Y3TA 1WUVA 2HWD2 1OKQA 2WNOA 4XETA 5A7QA 3LA2A 1CR7A 5CB7A 5FZEA 4AQTA 3H8XA 1DQ5A 5FFOC 1ULPA 3PUAA 3T0AA 5A7WB 1LHOA 5DABA 4RSUA 1L7LA 5EJZB 3ZFFB 4XURA 2VNRA 1IZ3A 5FZLA 4Y3OA 2DU0A 5DUUA 4YM2A 4LT5A 1PZ9A 1NZCA 5FP7A 2ET7A 1GWMA 3FHQA 1KFUL 1L7RA 1VMJA 4YFZA 1ZBE3 2VUJA 4FI9A 3I2KA 3IDEA 4CP2A 1CQ9A 1UYZA 3WR0A 1UPIA 2ZEZA 5C7GA 4I30A 1B35B 2VVFA 1QWRA 5FPZA 5FY8A 3VZOA 3O1PA 2WKKA 2OUJA 2RS11 1BBT1 2TNFA 3RZGA 2OIIA 4GULA 3IT8A 1W39A 4TYSA 2VBPA 3KV9A 4XFFA 4MYEA 1JN2P 3CJIB 1HN1A 1POQA 5JPMB 5LRSA 1OXCA 2XJPA 1JYWA 5A7OA 2O8QA 2X5IA 2J1VA 2WYSA 2R061 4D7TA 1QJEA 2WZPP 1CAVA 1NT0A 2PHDA 1H1AA 4GZ9A 4IEVA 4XABA 3ROUA 3ZXFA 4W8JA 1LB2A 5E16A 1RB8G 2O0OA 3EJKA 4JAAA 5DDJ3 3VBUA 4ZKTB 4HVQA 1Q8OA 3ZKUA 2XKOA 1Q8PA 3CZJA 3LD8A 1HJGA 2VL4A 2R0FA 2MNGA 2WA3A 3ACGA 3E5QA 1O5UA 4QXKA 5DDJ2 1PO23 2VOTA 5C3PA 2BJSA 1X36A 4M00A 5LWBA 4MV2A 4JGYB 2LW8A 3AP4A 4I3PA 5FZBA 3B9CA 4RS5A 4WM7C 1PIV3 5HI0A 2GZWA 4U2AA 4XF3A 3DYOA 1ENQA 5C8CC 3LFMA 2W1SA 1PO22 4K1ZA 4MGTA 1VJ2A 2ZKLA 4IEXA 1CAWB 1W05A 2IZWA 2VOWA 5CG9A 4DXSA 4LNVA 1YEWA 1MACA 1T6BX 2K0GA 5FMOS 4WM8A 2YG0A 2FCVA 1PIV2 4XW3A 2B4KA 1JYIA 2I74A 5A6ZA 1WCQA 3F95A 4I02A 1NA1A 4P08A 2XKPA 1W2AX 3PUQA 1BEV3 1LOFC 4M4PA 1NAEA 3HPNA 2VMIA 3I8TA 3A0NA 3JXSA 5HV4A 3C2UA 1VRBA 5CU1A 4AGGA 5HPOA 1Q3EA 4FOVA 3SCGA 3OGVA 2FDHA 4RQPB 2Q8OA 1BEV2 4B4PA 5L7OB 4BA6A 4LLOA 4FT8A 4Y26A 2XLAA 2YC2A 2YBSA 1W0OA 1PGL2 2PTMA 3IZOA 5FO8B 1AVBA 1VRH1 3KV5A 3ZYJB 2SBAA 3MF6A 3MBWA 2G9GA 3I3DA 4CEYA 2VD7A 1GWKA 1BVP1 3FFQA 3N9QA 2C9AA 3ELNA 3MPBA 4XXPA 5LA2A 3UNPA 1NG0A 1RXFA 2ZS6B 4YW4A 4D6RA 4AWDA 5EHDA 3VL9A 4E4HA 2KM2A 3AYAA 3NJVA 4PLMA 2F4LA 4Y22B 5J7MA 5CFCA 1SCRA 1ZZ8A 4N7IA 1QY4A 3ZYPA 5LB6A 5FPAA 1M4WA 3N9NA 1VBC3 1PO11 3I59B 2W1UA 3D0JA 3SNMA 2QZ2A 3WW1A 3S5QA 5FPUA 1LEDA 5JXHA 2P2KA 2XVKA 1VB2A 3O5SA 1OVSA 5KHIA 3WDXA 2D6LX 2PA7A 4IQPA 3BTYA 3HQXA 1GSLA 2YB7A 1RYYA 3PVEA 1VBC2 1TG7A 3AL6A 4UF0A 1FPN1 2Y8KA 1VAKA 3IMMA 1SLIA 5BYNA 4TTGA 4PBPA 4OZXA 4ZU5A 5EYYA 2OKXA 1GKBA 5I0UA 4YVSB 5IK5A 2XGXA 5GZFA 3D0SA 4M3CB 4QKBA 1JHNA 2E6VA 3PTRB 1QJU1 2PLV3 5I0RA 3T0DA 4XACA 5FMDA 4DXTA 1MPXA 2Y6FA 1CPMA 3POYA 4DMIA 5A6XA 1IGOA 3NQHA 3JUUA 4WVVA 2LRPA 5LZ6A 2HWF1 5GALA 3VHRA 5BNOC 5CISA 2RM23 3MW3A 3EBRA 2PLV2 3AKSA 4GH4B 4HVOA 4IE5A 3TN93 4L99A 4Q2FA 3ZN6B 1UYXA 2J1TA 1SLBA 2WBKA 2XL9A 2WC2A 3L2YA 3MW2A 4LQRA 1FX5A 1CAUB 4GXLA 1CIWA 1H2MA 5JOWA 5K0UC 5D2AA 1W8NA 5BNNB 1NYWA 3LSEA 4N7UA 2RM22 1A34A 4E8DA 4A3ZA 3WQBA 3TN92 4HLTA 4IE4A 4KH9A 4CDUB 5FP3A 5ANQA 3AP9A 1RUH3 3A7QA 2D6PA 3OGSA 1WZXA 1RUI2 2BFUL 4QM8A 4CEWB 1HRI3 3DKQA 3VKLA 5JOZA 1L7QA 2D44A 4Q27A 4P9JA 1OA2A 5J3UA 2P1BA 2JXAA 1W6OA 4ZS3A 2BDRA 2RDQA 1OPOA 5FLJA 5J48A 3DYMA 4XVHA 3RYPA 1CX1A 5C4WB 1RUH2 2NZ9A 4NJ4A 3Q8FA 4SLIA 4X8NA 4XIOA 1SLCA 2WNUB 3WNNA 3ZKYA 1Z0HA 5GLVA 1BLZA 1HRI2 1XPWA 1UYYA 4PBOA 4XF4A 1JH5A 2A7AA 1T2XA 5GZCA 5CA6A 1DZTA 4E8CA 1GQHA 1ZBA2 5F8PA 4AFMA 4DUVA 4A6SA 1AR81 3BI3A 1O91A 4EROA 1DYOA 4YGDA 1N1SA 1W6PA 2VTXJ 2YDEA 2OQ6A 5FAXA 4F7ZA 5GJ6A 1QOOA 3I2GA 4CDQB 4Y4YA 4RR3B 2WWSA 3JD73 1NCQC 3VBHC 2VMHA 3IAPA 4KU7A 3BKZA 2IC1A 1N3PA 1WA4A 3BUCA 2Q8CA 2CAVA 1GLHA 2ARBA 4CU9A 3HJRA 5FMCA 2FBEA 1GZTA 4UFIA 5JAXA 1OF4A 3JD72 3H50A 2EIBA 2E33A 1FAYA 4LHLA 4UFJA 4YM1A 1ACCA 2Y38A 4CCDA 4TLGA 4LPLA 5FYIA 2ZACA 4XIKA 5FPLA 4DFSA 4P5YA 2W46A 3UL2A 5FWJA 2VMDA 4CCJA 3E5UA 3VBRB 3BCWA 3O1TA 1LECA 1O59A 4DY5A 4N9IA 2VQTA 2JE8A 1AR91 4W65A 1G86A 4AYUA 2XPJA 3WQ7A 3MIDA 3H8RA 5F3EA 1OOPA 4HK9A 4NRPA 4Q29A 4IETA 3LB9A 4GMP3 2BGPA 5JLVA 1DP0A 2FQPA 2YBKA 4C1WA 4IGOA 1FMD3 3I4IA 5LA1A 1OLQA 3CF6E 5IW0A 3BU0A 3I2FA 5F3GA 4ZXEA 3J26N 3ZR6A 1PM4A 3HBKA 5FDBA 4QXHA 2PN5A 1FATA 4LO7A 3RQ0A 5LW9A 4QPGA 5FYYA 1FMD2 3GBFA 4GWMA 3KVBA 5JPNB 1SBEA 4PDWB 2X5IC 3GHMA 1GNHA 4N53B 1G7YA 3GDBA 2BP6A 1W3VA 2VUAA 1SPPB 3I2DA 2JIJA 1UU5A 4P9IA 2JG8B 2RS51 2VZ1A 5I91A 5KC5A 2ZHLA 2GH8A 3NKTA 4YW2A 4LBJA 3VD5A 1UMZA 4WVZA 3SKVA 5IVEA 3IIIA 1LODA 5E1RA 1Y9QA 4Z8BA 4QHBA 5A33A 2QQKA 5C3RA 1VALA 5C3SA 3THTA 2J1UA 2YMZA 4KNCA 4RS5C 3T2OA 2NLRA 1J83A 2GC0A 5FLHA 4NO4A 3LZZA 2D98A 4WVMB 5DG1A 1UNBA 5F1RA 4CPBA 1GOFA 2AZ5A 1XB9A 3ACFA 4ZY9A 4YRDA 3WG2A 3WW4A 3WX5A 3O1UA 1H4HA 4OFGA 3VBOB 4KG0A 1UPSA 2YC0A 4WM8C 1RUOA 3KT4A 4IV3A 1RVF3 4Q4X1 1R1ZA 2JD4A 3KB5A 5E89A 5F2WA 4DEQA 2I2SA 2XJUA 3LSDA 2KA3A 3ZXLA 3N3HA 4Q4Y3 2IXLA 3UYJA 2VGDA 1KEXA 1NA1C 5K4LA 3BALA 1WBFA 3L2HA 3WP5A 5FUNA 1RUC1 2IXKA 4XQDA 1RVF2 4RN5A 1S2EA 4K8FA 3WHTA 3WDVA 1LCLA 5IFPA 5I8YA 1DQ0A 4I0BA 5E88A 4V2VA 2UURA 4Q4Y2 2VPVA 5D21A 1UX7A 4MLOA 2IWGB 4UFLA 1YI7A 3PVBB 2EXIA 5F2SA 3HEIA 1LENA 2DCTA 2JJ6A 1STMA 5FY9A 1W6NB 2ETEA 4CEYC 4Z2AA 1OA3A 2VCCA 3IAQA 2D6NA 1ULCA 3AP5A 3OF1A 2DCYA 1YXWA 1RUD3 1WW5A 1ZNPA 3AJYA 3MHZA 5EJ1B 3VDAA 3FJSA 4GA9A 1AXKA 5KXDA 3SEPA 2DVGA 4AI0A 2YXSA 5CFCC 4QKDA 4LKSA 2EIGA 2Y6GA 3H7YA 1A6CA 3AZYA 3JU9A 4LHSA 4TLFA 3HQUA 3ME2A 1RUD2 1UKRA 3ABZA 2DVFA 2HBUA 1LHUA 3THDA 2PAKA 3NNJA 1AZDA 1KD7A 2DDUA 2RS31 3MLJA 1YO8A 5I0DA 2WO3A 2KR2A 2CGNA 2WFF1 4BCUA 1QXJA 4YVWA 3WW3A 1W8OA 3ZOIA 4AEDA 1GOGA 3U4SA 2QQLA 1PZ7A 3AMHA 2R0HA 1SLTA 4NAMA 1IOAA 3OPZA 4FFGA 4IV1A 3I7DA 1NLSA 4OI2A 3VZMA 1COV3 4M3CF 1ASJ3 4W50A 2HWB2 5L73A 4HN0A 4O65A 3ZXDA 3AMPA 3PUHA 4FTSA 4JDOA 3LIHA 1CZTA 2QQMA 1R1A1 1K5MC 1SACA 4TSVA 5SV8A 4EN8B 1AR63 1HQLA 2W91A 3H1WA 4Q1RA 1UY4A 5EYXA 4EZ4A 5L36A 4MGYE 2R043 1WD3A 1ZX5A 4A7ZA 1COV2 5LK7B 3B93A 4NIAA 2JG9A 1CJDA 1TMF3 2GC1A 4AHXA 3V56A 4Z07A 5IUQA 2DBIA 2VMCA 3TWIA 3POBA 4GB31 4CYDA 1FNYA 5KBFA 3CIHA 2VR4A 2VECA 5FTTC 3CNAA 5HCAA 5T5LA 3ACLA 2CTVA 3PU8A 1MS3A 4DS0A 2X53S 1TMF2 4XQWA 1QDCA 4Y5Z0 2J7MA 4O7XA 5C8CB 1E5SA 1DZRA 1IHMA 3GM8A 4ET7A 3K4ZA 4BLIA 1F31A 1HB3A 3RPQA 1NY72 1R093 4TN7A 4XCAA 1H4GA 2XWBB 4YGBA 3RZZA 5BNQA 3N36A 1YUDA 3T1MA 1HDKA 1UOGA 1TE1B 1LU1A 3CLPA 1LOEA 4COWA 3D4KA 1O8PA 3V65A 5CFDB 4DXRA 3N7JA 4XYXA 3H1YA 4P9WA 1L3JA 4P02B 2E63A 4JTOA 2VCBA 2RVAA 4C0HA 1AYN1 1IS3A 3W5MA 3R0RA 3ZSEA 2N7GA 4LO8A 3OGGA 2OYZA 4MGIE 4YW5A 3W20A 5FYMA 3V0BA 4L92A 4Q4W3 3U10A 2R073 4HG6B 4QPIB 4KWJA 5FBJA 3T30A 3AVSA 1V0AA 1RMU3 1R081 3RJ2X
chains in the Genus database with same CATH topology
2OQ6A 5FZFA 5A7SA 4CCLA 4LIUA 5FUPA 5FZGA 5FYTA 5FZ7A 2YPDA 5FYZA 1VRBA 3AVRA 3KVAA 2GP5A 4AAPA 4HOOA 4GJZA 5F2SA 5IVVA 5F5CA 3RVHA 2Q8CA 2P5BA 2XDVA 5FYCA 3K2OA 5FY9A 5F5IA 4CCKA 2YBSA 5FWEA 4LXLA 5IWFA 5F39A 4AI9A 5A1LA 3KV5A 3AL5A 5FZHA 5IVJA 5A7PA 3K3OA 2OQ7A 2VD7A 5FZ0A 4CCNA 3N9PA 5FXWA 3N9QA 5F37A 2OS2A 5A7QA 5FZEA 2OX0A 5FYIA 5F3CA 5FZ4A 5FPLA 2XMLA 3PUAA 4QX8A 2XUEA 5A7WB 4D6RA 5FWJA 5CEHA 4E4HA 4NUBA 5FYUA 5FZLA 4CCJA 4Y3OA 3KV4A 4GAZA 5FYHA 5KR7A 5FP7A 5FY5A 5FPAA 5F3IA 3OPWA 2Q8EA 3N9NA 5F3EA 3U4SA 5FPUA 2YBKA 4BU2A 4IGOA 5FY1A 5IW0A 5FY8A 5F3GA 3PU3A 4QXBA 5FZ3A 4QXHA 5FJKA 3K3NA 3AL6A 4LIVA 5A7WA 4IGPA 2XXZA 4LITA 5FJHA 4UF0A 4XDOA 4Y33A 5LW9A 3N9MA 4DIQA 5FYYA 4CCMA 3KVBA 3KV9A 4CSWA 4EZ4A 4QU1A 2Q8DA 4UF0B 4CUGA 3DXUA 4DO0A 5FY7A 5F5AA 3PTRB 5A7OA 2WWUA 4C8DA 3KV6A 5A3PA 4URAA 4QX7A 5FXVA 3PU8A 3PUSA 4QXCA 4GD4A 4ASKA 5IVEA 3N9LA 4XDPA 5F32A 5FP9A 5FZMA 5FZDA 5FPBA 5IVFA 5A3NA 3LD8A 5FP8A 4BXFA 5E6HA 5FZ9A 5A3WA 5FZOA 2YU2A 5FZ6A 3NJYA 5ISLA 4EYUA 2OT7A 4TN7A 5FYSA 5FZOB 5FY0A 5LWBA 4Y4RA 5A80A 5FP3A 5FZBA 5ANQA 5FXZA 2GP3A 5FYVA 4CCOA 5IVYA 4D6SA 4HONA 4IGQA 5FV3A 5A7NA 5A3TA 5FY4A 5FZKA 5FZCA 4EZHA 2YU1A 3DXTA 5FYBA 5FZAA 5F2WA 5LY2A 5FZ1A 4GJYA 2PXJA 4QWNA 4V2WA 2W2IA 3UYJA 3ZLIA 3OPTA 3ZPOA 5K4LA 5FZIA 5FPVA 5FUNA 2YBPA 4D6QA 5A1FA 5LY1A 5FXXA 3PDQA 3PURA 5FYMA 5FP4A 4V2VA 5IVCA 3LDBA 5FZ8A 3PUQA 4BISA 5FBJA 3N9OA 3AVSA 3U78A 5IVBA 2WWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ6 A;  5FZF A;  5A7S A;  4CCL A;  4LIU A;  5FUP A;  5FZG A;  5FYT A;  5FZ7 A;  2YPD A;  5FYZ A;  1VRB A;  3AVR A;  3KVA A;  2GP5 A;  4AAP A;  4HOO A;  4GJZ A;  5F2S A;  5IVV A;  5F5C A;  3RVH A;  2Q8C A;  2P5B A;  2XDV A;  5FYC A;  3K2O A;  5FY9 A;  5F5I A;  4CCK A;  2YBS A;  5FWE A;  4LXL A;  5IWF A;  5F39 A;  4AI9 A;  5A1L A;  3KV5 A;  3AL5 A;  5FZH A;  5IVJ A;  5A7P A;  3K3O A;  2OQ7 A;  2VD7 A;  5FZ0 A;  4CCN A;  3N9P A;  5FXW A;  3N9Q A;  5F37 A;  2OS2 A;  5A7Q A;  5FZE A;  2OX0 A;  5FYI A;  5F3C A;  5FZ4 A;  5FPL A;  2XML A;  3PUA A;  4QX8 A;  2XUE A;  5A7W B;  4D6R A;  5FWJ A;  5CEH A;  4E4H A;  4NUB A;  5FYU A;  5FZL A;  4CCJ A;  4Y3O A;  3KV4 A;  4GAZ A;  5FYH A;  5KR7 A;  5FP7 A;  5FY5 A;  5FPA A;  5F3I A;  3OPW A;  2Q8E A;  3N9N A;  5F3E A;  3U4S A;  5FPU A;  2YBK A;  4BU2 A;  4IGO A;  5FY1 A;  5IW0 A;  5FY8 A;  5F3G A;  3PU3 A;  4QXB A;  5FZ3 A;  4QXH A;  5FJK A;  3K3N A;  3AL6 A;  4LIV A;  5A7W A;  4IGP A;  2XXZ A;  4LIT A;  5FJH A;  4UF0 A;  4XDO A;  4Y33 A;  5LW9 A;  3N9M A;  4DIQ A;  5FYY A;  4CCM A;  3KVB A;  3KV9 A;  4CSW A;  4EZ4 A;  4QU1 A;  2Q8D A;  4UF0 B;  4CUG A;  3DXU A;  4DO0 A;  5FY7 A;  5F5A A;  3PTR B;  5A7O A;  2WWU A;  4C8D A;  3KV6 A;  5A3P A;  4URA A;  4QX7 A;  5FXV A;  3PU8 A;  3PUS A;  4QXC A;  4GD4 A;  4ASK A;  5IVE A;  3N9L A;  4XDP A;  5F32 A;  5FP9 A;  5FZM A;  5FZD A;  5FPB A;  5IVF A;  5A3N A;  3LD8 A;  5FP8 A;  4BXF A;  5E6H A;  5FZ9 A;  5A3W A;  5FZO A;  2YU2 A;  5FZ6 A;  3NJY A;  5ISL A;  4EYU A;  2OT7 A;  4TN7 A;  5FYS A;  5FZO B;  5FY0 A;  5LWB A;  4Y4R A;  5A80 A;  5FP3 A;  5FZB A;  5ANQ A;  5FXZ A;  2GP3 A;  5FYV A;  4CCO A;  5IVY A;  4D6S A;  4HON A;  4IGQ A;  5FV3 A;  5A7N A;  5A3T A;  5FY4 A;  5FZK A;  5FZC A;  4EZH A;  2YU1 A;  3DXT A;  5FYB A;  5FZA A;  5F2W A;  5LY2 A;  5FZ1 A;  4GJY A;  2PXJ A;  4QWN A;  4V2W A;  2W2I A;  3UYJ A;  3ZLI A;  3OPT A;  3ZPO A;  5K4L A;  5FZI A;  5FPV A;  5FUN A;  2YBP A;  4D6Q A;  5A1F A;  5LY1 A;  5FXX A;  3PDQ A;  3PUR A;  5FYM A;  5FP4 A;  4V2V A;  5IVC A;  3LDB A;  5FZ8 A;  3PUQ A;  4BIS A;  5FBJ A;  3N9O A;  3AVS A;  3U78 A;  5IVB A;  2WWJ A; 
#chains in the Genus database with same CATH topology
 4X8P A;  4IEQ A;  4OI1 A;  1MZ5 A;  1P8J A;  2ZGK A;  4IEZ A;  3IMN A;  2Q1F A;  1V6O A;  4FOY A;  1NQD A;  5FCC A;  3V0A B;  3KVA A;  1DIW A;  4IE0 A;  2EVX A;  4Q4W 2;  1MEC 2;  2QDR A;  1MZE A;  2R07 2;  1CAX A;  2OUH A;  4YFW A;  2FCU A;  1W03 A;  5ANN A;  2VNG A;  1W8H A;  2WZE A;  1RMU 2;  4UXA A;  1K5J A;  3K2O A;  3H0O A;  4A3X A;  1ENX A;  4MXW A;  3TOJ A;  2B46 X;  2YZ4 A;  2ZGO A;  1V6L A;  2B9V A;  5F6L B;  1BK1 A;  1OD5 A;  3ACI A;  3IIA A;  2EAL A;  4L0P A;  1XNA A;  1YIP A;  3O12 A;  5FXW A;  3U4X A;  2MPF A;  2HEY F;  3BN6 A;  1KRI A;  2Y0O A;  4NID A;  1W6M B;  1LKN A;  2CHH A;  1EV1 3;  1O4T A;  2XML A;  2X8K A;  3K51 A;  2FDK A;  1V9U 3;  2RDN A;  4NAO A;  2D40 A;  2RDR A;  4FO9 A;  2WO2 A;  4FPK A;  4XZP A;  5FZI A;  3SIS A;  1OOP C;  1LOF A;  2YC4 A;  2ZX3 A;  2ERF A;  2AEZ A;  4IE6 A;  1OD3 A;  4TWT A;  5F3I A;  4W6X A;  1ENR A;  4OUL A;  5IK4 A;  1EV1 2;  2QNK A;  3OYW B;  2XJQ A;  4PF1 A;  4XUP A;  1Z7S 1;  3JQW A;  4LE3 A;  4Y1X A;  2F17 A;  5AVA A;  3JBG 3;  4D0Q A;  4LBM A;  1QQP 1;  3KF3 A;  1KGY A;  3ILN A;  1W3X A;  4QPG C;  5JZG B;  3T3Y A;  1Q8S A;  2RR1 1;  4LIV A;  2D5H A;  4A41 A;  3SXW A;  4J1W A;  3LDK A;  3B69 A;  3JBG 2;  1V70 A;  4P9G A;  1C3H A;  1ZYB A;  3PVO A;  4EJR A;  4AI2 A;  1C57 A;  1PGW 1;  2D6O X;  1ND3 C;  5LBC A;  1YFW A;  4ARX A;  5C8W A;  2VC9 A;  4GQ7 A;  4FAH A;  3ON7 A;  1LOC A;  2VZU A;  5K0U B;  1CON A;  5C6C A;  3FN9 A;  1RGS A;  4FQZ A;  4AR2 A;  2PHL A;  3D5O A;  2MEV 1;  2GNB A;  4B7E A;  1UIK A;  1RHI 3;  4YW6 A;  3ZMN A;  4BQW A;  4COY A;  5JOY A;  3I2J A;  4KU8 A;  3N4M A;  1VPH A;  2IXC A;  4QX3 A;  1ND2 A;  1EPW A;  1PX3 A;  1CVN A;  1U5X A;  1MS8 A;  1GP6 A;  3U07 A;  1WLC A;  5JMO A;  3LOB A;  4AGV A;  1UIJ A;  3GAL A;  3AB0 A;  3C7E A;  1D2Q A;  1RHI 2;  2GMP A;  5DG2 A;  1GOH A;  4O61 A;  5FK8 A;  4D3W A;  1BVV A;  1G9D A;  1NXM A;  1RTV A;  1VBD 1;  2DUO A;  2UY9 A;  4FFF A;  2G9Z A;  5A80 A;  2HH9 A;  4IL7 A;  3EXU A;  2C5D A;  1LGC A;  4PJY A;  3ZYB A;  5HCH A;  3D6E A;  3VBF A;  1ULO A;  5DAP A;  1DGW X;  2Y34 A;  1HX6 A;  1ULG A;  1YQ8 A;  4LBQ D;  5DUW A;  1GV9 A;  3PHM A;  2RJK A;  1KJR A;  3MIC A;  1VLN A;  3A0K A;  3OSD A;  4OUM A;  4XXA A;  5E8A A;  3T1L A;  3USU B;  3WQ0 A;  1VBB 3;  1HB4 A;  1X9T A;  3P1I A;  4ITC A;  3GYD A;  2ZPX A;  1NCQ B;  4KBB A;  1O3R A;  1EAH 3;  1QOT A;  1GNZ A;  4HKL A;  4Q0U A;  1Y43 B;  4B3N A;  1APN A;  4XUT A;  2VOV A;  3HNM A;  4MGS A;  5IVC A;  5L9V A;  4AFA A;  1ZVF A;  2JX9 A;  3JZV A;  2PFW A;  1AYM 1;  2VNO A;  1IQA A;  2WWJ A;  2P6C A;  3BOD A;  3LPF A;  1EAH 2;  1YFU A;  5BXX A;  3C7G A;  2JB4 A;  1T6G C;  3WDY A;  3DF0 A;  4JC1 A;  4AF9 A;  5KXE A;  4UW4 A;  5C3Q A;  1LHV A;  4R9D A;  4GJZ A;  1NXD 1;  3CEW A;  1ALY A;  4RHV 3;  4Y20 A;  5JSO A;  5M0T A;  4WZF A;  3VZJ A;  1J3Q A;  3VKF C;  4XE9 A;  2XR4 A;  3FBM A;  1G9B A;  1OVP A;  4XFH A;  4R8H A;  5FRE A;  1IKQ A;  1B09 A;  2DV9 A;  5C71 A;  4LO6 B;  4KWK A;  4S2G A;  3DGT A;  4HPK B;  3EB7 A;  4RHV 2;  4KG8 A;  2RMU 1;  2BNN A;  1DBN A;  4FXG B;  3GZA A;  4FPC A;  4DIN B;  4N8M A;  1W2U A;  4BH9 A;  4Y5S A;  5F37 A;  2WLQ A;  1MQT A;  4Z82 A;  4B8E A;  1UWW A;  4QX8 A;  2BUK A;  5T50 A;  3KGZ A;  4JV4 A;  2OVU A;  3PVN A;  4XMI A;  3TNP B;  4NWW A;  4DRR A;  4Z1V A;  4YVW C;  3ZYF A;  5FY5 A;  4Z92 B;  1X9P A;  4IES A;  1BMV 1;  2GAU A;  4FPH A;  4QGM A;  1RUF 3;  1TVG A;  2GME A;  4IV1 C;  1YJK A;  2R32 A;  2B9U A;  4WVW A;  3D82 A;  1X8E A;  1OBN A;  2HWD 1;  4CDW A;  1TME 3;  2CYF A;  2ZCW A;  2HBT A;  4PQ9 A;  5DZG A;  2CU5 A;  3LGR A;  1W0P A;  4MHU A;  4A44 A;  1RUF 2;  3VBU B;  4Q4V 3;  4S2D A;  4OHY A;  1D4V B;  1LOB A;  5JIA A;  3AJZ A;  2JG9 C;  3AP6 A;  3LFI A;  2JE9 A;  3G6J B;  4QKF A;  1S55 A;  1TME 2;  2DYC A;  4COZ A;  1QF3 A;  2WZR 1;  4AVS A;  5JMC A;  1SDW A;  4AFD A;  3BU7 A;  1W8T A;  4Q4V 2;  2VG9 A;  3VHP A;  3PME A;  5I0S A;  4PIX A;  2Z2S B;  3KV6 A;  3POW A;  4AW7 A;  1JUI A;  2Q5T A;  3KCY A;  4URA A;  2AAC A;  3RRD A;  5GM0 A;  5DUX A;  2IUW A;  1OFN A;  1PK6 B;  1SQ4 A;  1XJA A;  5CKQ A;  3KCX A;  3HD8 B;  3MIF A;  1UCX A;  5FP8 A;  1FYU A;  1ZBE 2;  4XUN A;  5BNP C;  1WKY A;  3H3Z A;  1OH3 A;  5JUV A;  2XQX A;  1KIT A;  4GIQ A;  2FZ1 A;  2VMG A;  2ZEY A;  3EYP A;  4IND A;  5FYS A;  5A70 A;  3MLL A;  3WUC A;  2BVB A;  3A4U A;  3UJQ A;  3K46 A;  5FOB B;  5C9A B;  1D0H A;  3PIG A;  1ZA7 A;  4I09 A;  3B94 A;  2XJR A;  3E97 A;  4D6S A;  1HXS 3;  4E2G A;  3LF7 A;  3J7M A;  1C28 A;  1A8M A;  2C0Z A;  4LHN A;  4CVU A;  4XHX A;  3UT0 A;  4DUW A;  2PEL A;  4COV A;  1ZRC A;  4LR4 A;  4YAR A;  3DXT A;  2D3S A;  1U5Z A;  5CIR A;  2A6X A;  2PXJ A;  2RS1 3;  1HXS 2;  4CZS A;  3O7O A;  3ZLI A;  1JZ5 A;  1FXZ A;  3C7O A;  3JB8 A;  2IVI B;  4J1X A;  4JX0 A;  1LEM A;  4LHK A;  1WCK A;  4N9H A;  5DDJ 1;  3X29 B;  3ZXG A;  5A1F A;  3C8X A;  3URF A;  5FXX A;  4YZ2 A;  5BV6 A;  3RDI A;  1QJY 3;  1VR3 A;  4CCC A;  1I3H A;  2EIC A;  2UY8 A;  2BPA 2;  2RS1 2;  2HEV F;  1MVQ A;  2Q30 A;  2R06 3;  2WQZ C;  2A3Y A;  3LDR A;  5FZG A;  1PO2 1;  4LLF A;  2A6Z A;  2G9F A;  1CJP A;  1Q8Q A;  1QJY 2;  1OF3 A;  1WLD A;  3BVC A;  4YW7 A;  3R4U A;  4JDM A;  4CP9 A;  3ALQ A;  4NE9 A;  4N43 B;  5CFC B;  2GDF A;  1PIV 1;  2R06 2;  2UWA A;  2XG3 A;  3CBN A;  4UFK A;  1RJ7 A;  2ET1 A;  4CCK A;  5IWF A;  2HYK A;  4LBQ B;  3SLI A;  1Y4W A;  3B02 A;  4FTE A;  1XND A;  2A6W A;  3SC7 X;  3UJO A;  2F6B A;  3ZFF A;  1NE4 A;  2ZXQ A;  3CDZ B;  1UF2 C;  4GKX A;  1CN1 A;  1O7F A;  3NAP B;  4XMA A;  4G3Y C;  3S6P A;  3LAG A;  2RE9 A;  4FCA A;  3WF1 A;  1UN1 A;  2VW0 A;  5A32 B;  4FP3 A;  2CSG A;  4BE3 A;  2PHF A;  1BEV 1;  3KV4 A;  1FV2 A;  3R6S A;  4BLJ A;  1GQP A;  1SFP A;  1J58 A;  3VZN A;  3VDC A;  1PGL 1;  5L9B A;  1B35 A;  3JQX A;  5J37 A;  2VQA A;  2PQQ A;  2WAA A;  4BIF A;  2NYY A;  3B5L B;  3P5B A;  4DNY A;  3AXE A;  3AMQ A;  1H1M A;  4MZU A;  1HJF A;  4FTB A;  4X6Q B;  2NM1 A;  4PIZ A;  3TYJ A;  2NPI A;  4CDX B;  3POF A;  1LHW A;  4FBF A;  3I2O A;  3CJI A;  4EN9 B;  4MET A;  2NP0 A;  2W47 A;  5LCW L;  3OBR A;  4Q26 A;  3VD4 A;  3M70 A;  3N9M A;  4NRO A;  4IUG A;  1XSR A;  3J9S A;  4BME A;  2EA7 A;  3U14 A;  4DZG A;  2EAK A;  4LBL A;  1WGP A;  2YRO A;  3FLT A;  1BYH A;  3MIG A;  4ISQ A;  3B01 A;  2TUN A;  1WMF A;  4XF0 A;  1VRH 3;  2AYH A;  4R4X A;  1YHF A;  1JI6 A;  2FMD A;  2VOK A;  2VQU A;  3ZSL A;  1ND2 C;  1G9A A;  1ONA A;  1O4Z A;  5G04 L;  3E6C C;  4ORF A;  1VBC 1;  1W8U A;  3PUS A;  1POV 3;  1Y9M A;  4GD4 A;  1J1T A;  4K20 A;  4QDR A;  2WYF A;  4S2F A;  1VRH 2;  5CVR A;  1H8T B;  1DZQ A;  3AYE A;  4CP1 A;  3ST7 A;  1LR5 A;  1N1Y A;  2QQW A;  2YU2 A;  4JKL A;  3EHK A;  2YYO A;  4RGG A;  3RZM A;  2JDP A;  2ZHK A;  3N7K A;  2E9Q A;  4X6R B;  1LUL A;  5EWS A;  1OH4 A;  5FZO B;  3VBF C;  2EIE A;  3ORJ A;  1NX9 A;  1PX4 A;  1Q43 A;  2HWC 3;  1CAW A;  1K5M A;  2ORZ A;  2VH9 A;  3IDB B;  3INA A;  2XVL A;  2HWE 3;  3E5X A;  4MOA A;  3KM5 A;  3MEP A;  1VAV A;  1G9F A;  1VAM A;  1O5L A;  2PLV 1;  2Y6L A;  3LKJ A;  1WME A;  4QGL A;  5FYB A;  2HWC 2;  2WNV B;  3ZDS A;  3ENR A;  2W1W A;  4V1P A;  4SBV A;  2DFB A;  1WCD J;  3IBM A;  3OPT A;  1JU3 A;  2HWE 2;  4AHW A;  3SMH A;  5FPV A;  2RDS A;  3I3E A;  3HR9 A;  1LES A;  3KWV A;  3PDQ A;  3PMS A;  1UW8 A;  3PUR A;  4H7M A;  3ATG A;  4LUK A;  3TN9 1;  1RED A;  1UYP A;  4E2S A;  3MUY 1;  3VD9 A;  2LAL A;  3BB6 A;  4M3C E;  1BKZ A;  3WNX A;  4RYD A;  1RUI 1;  1ULD A;  1W9F A;  1SZB A;  4MGK E;  1JZ7 A;  2QZ3 A;  2P4E A;  5L7O A;  3P6B A;  4C1X A;  3NMB A;  3PTY A;  2ORX A;  3AVR A;  2HWF 3;  4KWL A;  1IG0 A;  1VP6 A;  1RUH 1;  3LOI A;  5F5C A;  2FDG A;  1NCR A;  4IEU A;  4QB6 A;  1HRI 1;  1QEX A;  4H14 A;  2QQU A;  3GZE A;  5HCB A;  3J7N A;  4B7K A;  2UWC A;  2DUR A;  1VBE 3;  2Z5W A;  4JDN A;  2HWF 2;  3QCW A;  5EP9 A;  1MQT C;  2A3X A;  4OI0 A;  1ZBA 1;  1WW4 A;  2P17 A;  1FV3 A;  3ZFE B;  1QMJ A;  4QT6 A;  1E5I A;  2BFU S;  1I5P A;  2O1Q A;  4Y22 A;  4D7Y A;  3GZU C;  1QH6 A;  1IQD C;  1WW6 A;  1VBE 2;  1QDO A;  3NWK A;  1F35 A;  2GC2 A;  1D7P M;  3AZZ A;  3EO6 A;  5DQ0 A;  3I59 A;  3WNK A;  4J6G A;  3I3Q A;  2JDU A;  3WXP A;  4BQ2 A;  3LE0 A;  5AFE A;  1WW7 A;  3ILF A;  2W9X A;  3ZSM A;  2JDN A;  4CDW C;  1QXP A;  3L9J T;  3U37 A;  1HB2 A;  1DU3 D;  1UD1 A;  1WCU A;  4AG4 A;  4BQ1 A;  2WAB A;  4XJ9 A;  5B4X A;  4YZ5 A;  2WFP A;  1QJX 3;  2VNV A;  1I5Z A;  2XQR A;  1AR8 3;  2C6S A;  1C1L A;  4XZU G;  5FJK A;  3OBA A;  1MVE A;  4AZZ A;  4LIT A;  1US2 A;  4JGZ B;  4M3C A;  1ULE A;  1JZ4 A;  4ZHN A;  4A7K A;  4BMB A;  4MG2 A;  3WHU A;  1QJX 2;  3AC0 A;  3FFZ A;  5L9R A;  1D2S A;  3GHN A;  1G6N A;  4ONU A;  1D4M 3;  3H42 B;  2DUP A;  1C8N A;  5AVP A;  3ETP A;  3THP A;  5A3P A;  4GH4 A;  5KXB A;  1JZ3 A;  4BB3 A;  1FOD 3;  2TBV A;  1QH7 A;  4NHM A;  4FPL A;  3VD7 A;  4NIH A;  4AQ6 A;  3E1F 1;  1GFF 2;  1YFY A;  1S2K A;  2ZKN A;  4HFS A;  1D4M 2;  3R4S A;  4IV3 B;  4ASK A;  5BNN A;  1UZV A;  1W06 A;  2WQ4 A;  4Y24 A;  4LOR A;  2FDI A;  1FMD 1;  4LA3 A;  3RWN A;  1FOD 2;  4K9S A;  4CDU A;  2GSY A;  2J1S A;  3DPR C;  3KT7 A;  2ZGU A;  3MUZ 1;  3E6B A;  2UYA A;  2DF7 A;  2PHU A;  3ACH A;  1Z78 A;  2BW8 A;  3C3V A;  3ZR5 A;  4LBO A;  1GWL A;  4CEW A;  3PNA A;  3VKO A;  2KXL A;  2YGM A;  1SFY A;  3Q8E A;  2A1X A;  1RUE 3;  2ZGP A;  3A22 A;  1JYT A;  2WN2 A;  4IGQ A;  1SMV A;  3HT2 A;  1JZ2 A;  5C4W A;  1ND3 A;  1QNY A;  2AEN A;  2JDZ A;  3PJQ A;  3MIB A;  3VDD A;  2WNU A;  5DAX A;  4YGC A;  5FZC A;  3RYK A;  4PI2 A;  2R6Q A;  1LU2 A;  2FDJ A;  1J1L A;  2JE7 A;  4HL0 A;  4L2N A;  3M7A A;  4JKM A;  4ZXK A;  1RUE 2;  4U36 A;  4GJY A;  2UWB A;  2Z4F A;  4BOW A;  4K3U A;  4HET A;  1MS1 A;  5CAZ A;  3ZPO A;  4AHZ A;  2ZHM A;  1YLL A;  1RUG 3;  2YBP A;  1XC6 A;  3DV8 A;  1VIW B;  1NQJ A;  4CU6 A;  4ASM B;  4CDQ A;  3VBS B;  4JCK A;  2AC1 A;  4RR3 A;  4NHL A;  3S7E A;  2JEC A;  5FZF A;  2RS5 3;  4OHX A;  1RUG 2;  3UK9 A;  4QQH A;  5FZ7 A;  3OUI A;  4H7L A;  5LBE A;  3GBG A;  3QLQ A;  3SKJ E;  2Y64 A;  2YY1 A;  2AH2 A;  5FLI A;  1IPS A;  4WBB A;  4PF5 A;  3WNM A;  1OQE A;  2XON A;  2XHN A;  1V00 A;  2RS5 2;  3NV4 A;  4LXL A;  1PGS A;  1WLW A;  3E6D A;  4DEV A;  5FZH A;  3ZFF C;  1RVF 1;  1W9S A;  1NUK A;  3MFC A;  4AED B;  5IVJ A;  3I3B A;  1AF9 A;  3HNY M;  1MR5 A;  2K2S A;  4HSL A;  2ZMK A;  3Q9O A;  4Q4Y 1;  5GZG A;  3VBR A;  5LBB A;  3OD0 A;  2FD8 A;  1AX2 A;  1XNT A;  3C7F A;  5JWP A;  1S0F A;  2OW4 A;  2XUE A;  4W6W A;  1LNS A;  3POJ A;  2ATF A;  3KHC A;  4ZU4 A;  1B35 C;  3WF0 A;  4Q4X 3;  4HZF A;  5KR7 A;  2ZX4 A;  3ECQ A;  1OMI A;  1XRU A;  3GXU A;  4XTM A;  3K48 A;  4GWI A;  4YM3 A;  3DL3 A;  2OZ6 A;  4P5H A;  4RFR B;  2PQS A;  3CJI C;  1O3S A;  2CAU A;  2DWR A;  4UYB A;  3WP3 A;  2R7E B;  4Q8K A;  4PDW A;  3BTA A;  5DMY A;  2RJL A;  5LA0 A;  4FPJ A;  2W3J A;  3VHN A;  3NO8 A;  1ZZ7 A;  5IAX A;  1YQ2 A;  4K21 A;  4YW1 A;  3FBY A;  1U5Y A;  2SLI A;  2VAU A;  2VZQ A;  2VZ3 A;  4QU1 A;  4YG6 A;  2JG8 A;  2Q8D A;  3VZK A;  2VQ0 A;  1EUT A;  2W94 A;  1XNK A;  2V4A A;  4XJW A;  5I93 A;  2BNO A;  2RHP A;  2ARX A;  2ZTN A;  1UMH A;  1ZZB A;  3O0V A;  1FI2 A;  1HIX A;  2P3I A;  5FXV A;  5CKN A;  1S0I A;  2HWB 1;  3NNF A;  4PIY A;  3CO2 A;  2D6M A;  1UY1 A;  5F32 A;  3WDT A;  2VTF A;  3VZL A;  4CUB A;  1RIT A;  3WT3 A;  2JDM A;  2AGS A;  5T55 A;  5ABJ A;  4JHZ A;  5E6H A;  1VBA 1;  2B8M A;  1IPJ A;  4FXK B;  4Q0S A;  4B1M A;  2BU9 A;  2OA2 A;  4Y1Z A;  1COV 1;  2E7T A;  4LMF A;  2X09 A;  2E31 A;  2VW1 A;  2ZEX A;  2D3R A;  2ZZQ A;  4QDS A;  5FY0 A;  4XCB A;  1WWY A;  3VBO A;  4GMP 0;  2CWM A;  3HOB A;  2DCK A;  5T5J A;  4BQY A;  1ASJ 2;  3MPP G;  4EQV A;  5EIY B;  4MHR A;  2NN8 A;  1OI6 A;  2BRT A;  3OOX A;  5FY4 A;  3NL1 A;  1AR6 2;  1TMF 1;  4YYO A;  1IKP A;  2JDY A;  4JTN A;  4D69 A;  2R04 2;  1X7N A;  3AKP A;  1CAX B;  1TEI A;  2ID4 A;  1F4H A;  2YGL A;  1BHG A;  2D7F A;  4M0N A;  4UAP A;  4WM7 B;  3VDB A;  4CXY A;  5A3O A;  4D6Q A;  5IK7 A;  2BNM A;  2P37 A;  4BQ3 A;  1GP5 A;  5L7O C;  3LDB A;  3N35 A;  2NQY A;  4KI5 M;  4P00 B;  3S57 A;  3H8U A;  1EYB A;  3OG2 A;  5BNP A;  2D3P A;  3S0M A;  2ZX0 A;  3FE5 A;  1S0D A;  4MO3 M;  1ZM1 A;  1NCR C;  5FYZ A;  4Q0Q A;  1M06 G;  1W6N A;  4FOQ A;  4AAP A;  4LUL A;  4I2O A;  4I0W B;  2E32 A;  1EUU A;  2P5B A;  2Y6J A;  1R09 2;  1IS5 A;  2ZGQ A;  3T2T A;  1GZW B;  4ARY A;  1GYK A;  5F39 A;  4LKF A;  2AR6 A;  2FZ2 A;  5AC9 3;  4OUS A;  1YYN A;  2ZGN A;  4Q0P A;  3S5A A;  1PVC 3;  1A3K A;  2PMW B;  1QGL A;  3ZVX A;  4AK3 A;  4CXX A;  3NW4 A;  3WY6 A;  3LEK A;  1SCS A;  5DAW A;  1JTZ X;  2BQP A;  5FZ4 A;  4QHO A;  4A45 A;  5F3C A;  5AC9 2;  5D8A A;  3C7H A;  4EN0 A;  3TRS B;  1QIQ A;  1W90 A;  2GH2 A;  3T08 A;  1PVC 2;  4Q4W 1;  4QQO A;  1MEC 1;  3ITQ A;  3OEA A;  2R07 1;  4NHY A;  4UW6 A;  4ZON A;  2DVB A;  1HV0 A;  3ZX7 A;  1KDK A;  1AL2 3;  1RMU 1;  3RWK X;  3WD5 A;  3ZFG A;  2BOI A;  1NKG A;  2XBO 3;  1ZZC A;  3WF4 A;  4AEK A;  2FMY A;  4QDQ A;  3W59 A;  3O14 A;  1XE7 A;  2Y26 A;  3O1V A;  1CX4 A;  3WNP A;  1C5H A;  4MUV A;  1AYN 3;  5FKB A;  1UY2 A;  4M01 A;  5FQ0 B;  2B45 X;  1AL2 2;  2Q1Z B;  2QJV A;  4XBQ A;  3VGI A;  4BM8 A;  2XBO 2;  4J25 A;  3OTF A;  2BV4 A;  4YVS C;  4C91 A;  4A7Y A;  1OLM E;  1UAI A;  1E5R A;  2VW2 A;  4CXW A;  5F7U A;  3N7M A;  5FRA A;  4A6O A;  1AYN 2;  1DQ4 A;  2W95 A;  4EN6 B;  3T09 A;  1K42 A;  4YZ1 A;  1W28 A;  1NZI A;  4RGA A;  3K4A A;  3WF3 A;  4CUG A;  1EV1 1;  2WUH A;  1Y9G A;  4LBK A;  4AEM A;  4GH4 C;  1W9T A;  4OUE A;  1PMJ X;  5JI7 A;  4LA2 A;  2QQP A;  5D1I A;  3AFK A;  1YQ5 A;  4HBN A;  1JHJ A;  2CGP A;  1H6Y A;  1V6J A;  4ZZ5 A;  3OEB A;  3FHA A;  1R64 A;  4XFA A;  5BNN C;  2H6B A;  1YQ6 A;  1DQ1 A;  5FMB A;  1V9U 2;  1LHN A;  2PHW A;  4XDQ A;  1JOD A;  4KMQ A;  3T0B A;  4OHW A;  3N9L A;  1F5F A;  2VXR A;  3RI8 A;  1PNG A;  4XFB A;  3WW2 A;  5FZD A;  4CDU C;  1O3T A;  3JBG 1;  3J8F 3;  4BPZ A;  4EWD A;  1CWP A;  4M4R A;  4CEW C;  3J7L A;  4XUQ A;  5GLT A;  3AKT A;  4F8A A;  4R52 A;  4LK7 A;  4AFC A;  1QKQ A;  5BNO B;  2OT7 A;  2GU9 A;  4DOU A;  4MH0 E;  2WO1 A;  3M1H A;  5C4W C;  4BZ4 A;  3VDD C;  3J8F 2;  5FXZ A;  1JZ8 A;  1DFQ A;  2WNU C;  1REE A;  5GLW A;  5CFD A;  2YUE A;  1Z7S 3;  3BPZ A;  5JVV A;  1XYP A;  5A7N A;  3THC A;  3BIW E;  2J1R A;  5H9P A;  3W21 A;  2JWP A;  2XB6 C;  1WLT A;  4R9C A;  3TEZ A;  1LOA A;  1TNR A;  3AFG A;  1JYX A;  3P3P A;  2IFR A;  1I1E A;  5HBA A;  1W6Q A;  2P3J A;  2RV9 A;  2ZGS A;  3ILR A;  3A21 A;  2WRA A;  4ISR A;  4LO5 B;  1Z7S 2;  5ACA 3;  3BTZ A;  1RHI 1;  4K6B A;  1OFS A;  2QBX A;  4QPI A;  4GAL A;  4CDQ C;  1SDD B;  4RR3 C;  4AAX A;  1HLC A;  3B7M A;  1YFX A;  1SBF A;  1QNW A;  2XOM A;  2ZX1 A;  1W8F A;  1V6K A;  4ZS2 A;  2ZX2 A;  3WDW A;  1UZW A;  4L9B A;  1W0N A;  2IXI A;  5ACA 2;  3BTX A;  4XOG A;  3U78 A;  3PLQ A;  5A7S A;  5J36 A;  3CL1 A;  3DEC A;  2OPK A;  3SCF A;  5T52 A;  5KHK A;  3ZIW A;  1HRV 3;  2JD9 A;  2VM9 A;  5LRR A;  4AI8 A;  5IVV A;  1W2T A;  2W1Q A;  3KCC A;  4ZPI A;  5EFU A;  3K75 B;  1KS4 A;  2WT2 A;  4GWJ A;  2QE3 A;  3OY8 B;  4RL7 A;  1S0C A;  3SHR A;  3UKV A;  1CZV A;  1HRV 2;  4G4F A;  1WMD A;  5A6Y A;  3VBR C;  1W6M A;  2W39 A;  3O0W A;  1C8M 3;  3VBH B;  2LRO A;  4HAN A;  3N9P A;  3ZSK A;  3LQC A;  3ES4 A;  2BVV A;  2BER A;  2BBA A;  2D97 A;  3KHB A;  3O1M A;  2NMO A;  2A6V A;  2PHX A;  4NPR A;  1VBB 2;  2EXK A;  2D6K A;  2P34 A;  2WZ8 A;  4PLN A;  5IFT A;  4PLO A;  5FYU A;  1C8M 2;  3OYW A;  2Z42 A;  5GLU A;  4PT6 A;  5SV5 A;  3U75 A;  3FHI B;  1BK0 A;  3ZSJ A;  3UKN A;  3BGA A;  4YGE A;  4XJA A;  3UGH A;  4RHV 1;  2WS9 3;  5JZG A;  1AR7 3;  1WD4 A;  4KWU A;  5JXG A;  3MLK A;  4PDW C;  4ES8 A;  5C70 A;  2UYB A;  4N53 C;  1KQR A;  2YV8 A;  2DFC A;  2QQO A;  2IFW A;  4AVT A;  1X8M A;  4IGP A;  4PI0 A;  2WS9 2;  1XNC A;  2JG8 C;  4YG0 A;  2LUW A;  1AR7 2;  4YG3 A;  1X33 A;  2WR9 A;  4DIQ A;  3IPV A;  4CCM A;  1G8W A;  4R9B A;  4YWA A;  4XUO A;  4KL1 A;  3ZYH A;  5H9Q A;  4R9A A;  4G9S B;  1OQ1 A;  3DXU A;  1SLL A;  5F5A A;  4CP0 A;  2C24 A;  1K12 A;  2V4V A;  3MW4 A;  4I01 A;  1REF A;  1OSG A;  2DTW A;  1H6X A;  3ZO0 B;  2X10 A;  4OI4 A;  4NRM A;  5C3O A;  2EF6 A;  1XOY A;  5I0T A;  4AGR A;  1AHS A;  2RMU 3;  2X5I B;  2VZO A;  3IB3 A;  1RUJ 3;  2V5D A;  5LEK A;  4H3W A;  5ABJ C;  1AJO A;  1RUF 1;  1CAV B;  1O4Y A;  4JQT A;  4IE7 A;  1GBG A;  1ODM A;  1CZS A;  5HCF A;  5FZ9 A;  5A3W A;  2WJS A;  1RUJ 2;  3VBO C;  1JYN A;  1C1F A;  3UV9 A;  2QQV A;  4FPF A;  5HXV A;  5F6K A;  4NHK A;  1OUS A;  2V5Y A;  2JEN A;  4PQQ A;  4F3J A;  5DXD A;  3B00 A;  5IVY A;  3DYP A;  5A3T A;  3USU A;  4FPG A;  4AI1 A;  5LEJ A;  1YQC A;  1EP0 A;  1GUI A;  1AJK A;  4RS5 B;  1W9W A;  5BPX A;  2UU8 A;  1AXY A;  3SH4 A;  3TEX A;  1BMV 2;  2HJI A;  4CP9 B;  4CA9 A;  3RI9 A;  3GCW A;  5FO9 B;  4RGK A;  3I49 A;  3RJR A;  1C5I A;  2QQI A;  5FZ1 A;  5JR7 B;  1ZBE 1;  2MHF A;  2BZD A;  4CRQ A;  5HXM A;  2BWC A;  1PHM A;  1SFN A;  2ZAB A;  3D8C A;  3CU7 A;  4LEJ A;  3DCQ A;  2JKX A;  2CNA A;  3OB8 A;  1VE0 A;  4K8R B;  1K3I A;  2E51 A;  2C9K A;  3M3O A;  2WZR 3;  4KBZ A;  4WM8 B;  3H8O A;  1W2N A;  4QD2 A;  2E26 A;  2XWJ B;  1TNF A;  2WT0 A;  3MI8 A;  1OUX A;  5CYY A;  3JB4 C;  2BEO A;  3DPR A;  1NA1 B;  3IM0 A;  4WZC A;  1JOJ A;  2WZR 2;  1OLR A;  2QKD A;  4JZR A;  4HOO A;  4JHT A;  3O1O A;  4BIO A;  1YWK A;  3RS6 A;  4E4Z A;  3Q8C A;  4HPK A;  2B39 A;  1W8W A;  1HXS 1;  2YFZ A;  1UY3 A;  1S0J A;  1ULF A;  3CMG A;  4K40 A;  4OCT A;  3TB0 A;  1SG3 A;  2DUQ A;  5LK5 A;  4O9E A;  1O3Q A;  5FIX A;  4DPN A;  4AFB A;  1BBT 3;  3K3O A;  4BDV B;  1AUY A;  2E7A A;  3EQE A;  2HEW F;  5D8A C;  2ZGM A;  1MS4 A;  1UZ0 A;  3TEW A;  3MV0 1;  1XNB A;  3APB A;  1RIN A;  1OPM A;  3LA3 A;  5JSP A;  1U12 A;  2XJV A;  4CEY B;  1JOP A;  2DVA A;  2ZML A;  3ZFG C;  1BBT 2;  1QJY 1;  3I3M A;  3RGB A;  2IXJ A;  4YSF A;  3P3N A;  3NKG A;  3VV1 A;  4QX1 A;  3NJZ A;  4ATF A;  1MZF A;  3W9A A;  4DXZ A;  3G7D A;  1UOB A;  1V6M A;  3NV1 A;  2ZZJ A;  5T3N A;  2Q8E A;  4A42 A;  5CAD A;  2ZMN A;  2VTX A;  4OVE A;  3ETQ A;  3QH7 A;  2JIC A;  3ZIX A;  4BK5 A;  2PYT A;  4LOT A;  3DKW A;  2CDP A;  2Y6K A;  2CL2 A;  4JQR A;  5T54 A;  1GQG A;  3ZXE A;  2JDA A;  2XH6 A;  4QXB A;  3SH3 A;  4LKE A;  4A2U A;  4HSJ A;  4XIL A;  5EQU A;  3K3N A;  3Q8B A;  5A7W A;  5FJH A;  3M4F A;  4Y33 A;  5DAV A;  5FMO L;  3WNL A;  1H30 A;  5JCT A;  3FZ3 A;  1WBL A;  3TBD A;  2V73 A;  5ERL A;  2L9L A;  4UF0 B;  4D7S A;  2VZT A;  3HMY A;  2ARC A;  4CPB D;  2A71 A;  3AMM A;  1PK6 A;  1N3O A;  4Q1P A;  1DDL A;  1K5M B;  1UZZ A;  4H55 A;  4K1Y A;  2WQ8 A;  2RJ2 A;  3PL0 A;  4BQ5 A;  3AKQ A;  3TEY A;  3RZJ A;  4COU A;  2QQJ A;  1FT9 A;  4E4D X;  1OHF A;  1RC6 A;  4LO4 B;  3UKT A;  3ZYR A;  2CV6 A;  1CD3 G;  1KJL A;  2VU9 A;  2A6Y A;  4XDP A;  1PMI A;  5FZM A;  1DQ2 A;  5J09 A;  3AP7 A;  4AHY A;  4MVT A;  2C1F A;  5IT6 A;  3WCS A;  2DCJ A;  5A3M A;  1ZZ6 A;  5TSW A;  2PAE A;  3FLR A;  4QU2 A;  5FK7 A;  5C9A A;  3K4D A;  5CFD C;  4URT A;  2IXH A;  4CUA A;  1NE6 A;  4XJZ A;  4GKY A;  1DQ6 A;  3R05 A;  2FHR A;  4LKD A;  3NNM A;  5KXC A;  4NHX A;  4QMA A;  4UWD A;  1XBF A;  4XTP A;  5IAT A;  5FZA A;  4QX0 A;  4QPI C;  4UW3 A;  5LY2 A;  1LAJ A;  1UX6 A;  1DYK A;  1H2N A;  1NCR B;  5FKC A;  5EZW A;  4E2Q A;  4UBH A;  5C33 A;  5GZD A;  2YHJ A;  4E27 A;  1OKO A;  2V72 A;  1W6O B;  3AYD A;  3MGU A;  3VKM A;  4DB5 A;  2CWS A;  2P3Y A;  1POV 1;  5EPA A;  2O8O A;  3IDC B;  4UFM A;  3UES A;  5BY5 A;  2ENR A;  4JGY A;  1SHW B;  2VY0 A;  4AVC A;  1GAN A;  2JKB A;  2JIG A;  3HN1 A;  3PJY A;  1DHK B;  1SLA A;  4YLZ A;  1GIC A;  4CCL A;  4N43 A;  5FYT A;  3KZ4 C;  3MFA A;  2YPD A;  3SEE A;  1PO1 3;  1ZZ9 A;  3AZW A;  3AKR A;  3FX3 A;  4B29 A;  3WV6 A;  4LBQ A;  5J96 B;  1GZ9 A;  1W6P B;  2HWC 1;  1S2B A;  5FYC A;  2CDO A;  1S0G A;  3FLP A;  4Q0V A;  5F5I A;  3VN4 A;  1RIR A;  1DYP A;  1J3P A;  4HMZ A;  5FWE A;  2HWE 1;  5LBF A;  3ZN5 A;  2DTY A;  1PO1 2;  4AI9 A;  3WZ1 A;  4L8Q A;  3NAP A;  1FPN 3;  1F8V A;  4B4R A;  4Y1V A;  3R4D B;  1US3 A;  1UU6 A;  1AL0 G;  2RM2 1;  2WNE A;  4WV8 A;  5A32 A;  5B2G B;  2J1E A;  2O14 A;  3M3C A;  3ZXK A;  1S1A A;  3PIJ A;  2QDN A;  2KD7 A;  1QJU 3;  5CEH A;  1FPN 2;  2W87 A;  4RQP A;  2OZJ A;  1I6X A;  1URX A;  3BPS A;  4EWE A;  4NR1 A;  5FOJ B;  3CKH A;  5JZG C;  5KHG A;  2HYX A;  2R16 A;  3OPW A;  4RFT 0;  4YZ3 A;  5A3L A;  5FPX A;  1LTE A;  3WG1 A;  2VO5 A;  1QJU 2;  3VUO A;  4UBG A;  4CDX A;  2Y33 A;  1HV1 A;  2LTN A;  3NNL A;  3NV3 A;  4QB1 A;  4QM9 A;  4BU2 A;  3GF6 A;  3HAG A;  1AXZ A;  1UXZ A;  1E5H A;  2TEP A;  5FY1 A;  4OHZ A;  3ZPY A;  3OBZ A;  4AQS A;  1OOP B;  4BQ4 A;  4MSV A;  5JOX A;  2GND A;  4FPO B;  1RUN A;  1CES A;  1N1T A;  4BXS V;  1RUI 3;  1VBE 1;  3FUQ A;  2D43 A;  1QHD A;  4QQP A;  4BJ0 A;  2VVE A;  4I0A A;  2VUC A;  2FCT A;  5CKM A;  3GNE A;  3BOW A;  3J7H A;  2W52 A;  5C5U A;  1NLR A;  4LUM A;  1YNA A;  2I07 B;  3ASI A;  4P14 A;  4QPG B;  5FY7 A;  3WG3 A;  3WG4 A;  1WMX A;  2WWU A;  4KGG A;  3WP6 A;  4C8D A;  1H2L A;  3M3E A;  1DGL A;  5KHJ A;  2OPW A;  4Y5T A;  4QX7 A;  2JDK A;  1ZBA 3;  1ND3 B;  1H8T A;  3J4U H;  3GBW A;  3JD7 1;  3VDD B;  1J84 A;  1TZO A;  4QXC A;  3CZU A;  5JDB A;  2ZBJ A;  4HKW A;  5IVF A;  3S30 A;  2CGO A;  4BXF A;  4XQ4 A;  5FZO A;  3KF5 A;  5H9S A;  1QJX 1;  3HNB M;  4CE8 A;  5ISL A;  4YVS A;  2J22 A;  5DZE A;  3H3L A;  5A33 B;  1JOB A;  3POS A;  3QH6 A;  4RD7 A;  1UOF A;  4EV0 A;  3QOP A;  1F4A A;  1OQD A;  4FFH A;  3ZYG A;  2W68 A;  1AR8 2;  2GP3 A;  5FYV A;  2VZP A;  3H3U A;  2XLF A;  2WNV A;  3KS7 A;  4Q8L A;  1UL9 A;  2QTW B;  4R4Z A;  1D4M 1;  1YI9 A;  4EZH A;  3ZN6 A;  1W99 A;  2EAA A;  5HV0 A;  5L19 A;  4AL9 A;  3USS A;  1CAU A;  1DGR N;  4Z2W A;  1YJL A;  1FOD 1;  4XEZ A;  3ZMO A;  4LJH A;  1HW5 A;  4CU7 A;  4GMP 1;  4BQX A;  3T2Q A;  5K8S A;  5EV7 A;  2P3K A;  1K45 A;  1QJF A;  3LPG A;  5LY1 A;  1UY0 A;  5DPN A;  1X82 A;  3I54 A;  1AR9 3;  1JUH A;  4NWV A;  1XU1 A;  1CPN A;  3KD4 A;  4JRL A;  2LM3 A;  2XUM A;  3TAY A;  3RMX A;  4D8M A;  2G4I A;  4YW3 A;  1POV 0;  1TQ5 A;  3OBT A;  1JBC A;  2LS6 A;  4L11 A;  2PAM A;  1RUE 1;  2H0V A;  2ZGT A;  2H6C A;  4NPL A;  5T5P A;  4XF9 A;  1AR9 2;  2VMF A;  3AXD A;  2GC3 A;  1N47 A;  3K77 A;  4QQ2 A;  4DRV A;  4DY3 A;  3GZT B;  3LIG A;  2OXB A;  3ZFE A;  4LBN A;  2R1B A;  3AYC A;  1PZ8 A;  4CUC A;  4QQL A;  4D94 A;  5IHR A;  4FOW A;  4JVA A;  2R30 A;  5C5T A;  2VUL A;  1BZW A;  1DG6 A;  5FPB A;  1WCS A;  4C0B A;  1RUG 1;  2OX0 A;  3BIE A;  3WP4 A;  1I9R A;  5H9R A;  4MGZ E;  4BYY A;  3M2M A;  2FDF A;  4NN0 A;  4MGQ A;  2VJX A;  2X05 A;  3ZXA C;  4YPJ A;  4OYU A;  5GKA C;  4OQ8 A;  3VBU C;  2W5F A;  1QOS A;  2BGC A;  3EMR A;  3DUI A;  4HVR A;  4LOS A;  1DCS A;  2ZJC A;  1HN0 A;  1LGB A;  3N7L A;  1A78 A;  3RZH A;  3BOP A;  2ADD A;  2Q1M A;  3PUI A;  1KXG A;  4JGZ A;  4MAD A;  3PU3 A;  4YVW B;  5KHH A;  3W58 A;  2ARE A;  1UOJ A;  2QFE A;  4P9Y A;  3UET A;  1OT5 A;  5K7P A;  3SQO A;  3OCP A;  1LGN A;  5F5Q A;  1YRZ A;  3OUH A;  1DGW A;  4IW3 A;  5DN2 A;  4IV1 B;  5IYY A;  3CJX A;  5IAV A;  2B42 B;  2Y6H A;  3WNO A;  5ABJ B;  4QKN A;  4KGQ A;  4CSW A;  3CQO A;  5FBZ A;  3WF2 A;  1PK6 C;  2K9Z A;  1UU4 A;  1PM7 A;  2XL7 A;  4XC9 A;  3M3I A;  4YZ4 A;  4XAE A;  5K9Y A;  4NMI A;  3FC0 A;  2ZAA A;  3WSO A;  2JG9 B;  4XFG A;  3MIH A;  2VBB A;  3NST A;  1W9Y A;  3ES1 A;  4RA0 A;  1RUC 3;  4HXC A;  2VXJ A;  4IER A;  4Q4X 2;  3AX4 A;  5C9A C;  1XYN A;  3FUO A;  5DZF A;  1U0A A;  1NLQ A;  4Y1Y A;  3RYR A;  2E7Q A;  4N53 A;  3WCR A;  4BHP A;  3FL7 A;  1RUC 2;  3GJB A;  2Y0I A;  3IN9 A;  1SPP A;  1RUD 1;  3ZXJ A;  4EYU A;  2ZA9 A;  4KQ7 A;  5A1A A;  1N3Q A;  4Y4R A;  1G9C A;  1FNZ A;  3WVJ A;  3RNS A;  2R49 A;  5FV3 A;  2B5H A;  4MX3 A;  3LA7 A;  1ZA4 A;  3RSJ A;  5BNP B;  2A73 B;  5APA A;  4GWN A;  1OA4 A;  3CHX A;  4AQ2 A;  1ZRD A;  1IS6 A;  2J42 A;  3JCI A;  1GNY A;  3B9I A;  5FO7 B;  2ZOE B;  3HIF A;  3M8L A;  4QWN A;  5LA9 A;  3WOG A;  1JS9 A;  1W04 A;  3KQR A;  4JGY C;  4XJ8 A;  4XPV A;  3VBS A;  2WSU A;  2G19 A;  4OMC A;  2K46 A;  3BYW A;  3SH5 A;  1MS0 A;  5JXI A;  3O1S A;  3AZX A;  3VD3 A;  4E9K A;  3GCX A;  4WVM A;  4N43 C;  1QJZ A;  2F4P A;  1QU0 A;  4QX2 A;  1ASJ 1;  3N9O A;  1H9P A;  4HK8 A;  4AI3 A;  2Z79 A;  4B1L A;  4BIS A;  4TZD A;  5CNA A;  1Q56 A;  4XFI A;  2RS3 3;  5FUP A;  3V0B B;  4NRQ A;  5G05 L;  4ATE A;  1VMF A;  4LE4 A;  1JMU B;  1AR6 1;  1N1V A;  1W8Z A;  2WFF 3;  1V6I A;  2BGO A;  5D8A B;  2R04 1;  4H2A A;  3S7I A;  1ZRE A;  2HWB 3;  3I2I A;  4FQ4 A;  3T4H B;  4ASL A;  2XDV A;  3SIT A;  3ZFG B;  1DLL A;  2WO7 A;  2RS3 2;  3NAP C;  1VBA 3;  4UFH A;  5A1L A;  4W4Z A;  2WFF 2;  3ZM8 A;  1GP4 A;  2EXJ A;  3DEM A;  5A7P A;  1O6U A;  2W92 A;  1R1A 3;  3OGJ A;  5FUI A;  2OQ7 A;  5FZ0 A;  5KC6 A;  1LJ7 A;  4MXW B;  2VE1 A;  1SEF A;  3MO4 A;  3NVC A;  1NY7 1;  4Q5O A;  3T2P A;  1H9W A;  1VBA 2;  1XE8 A;  5JI9 A;  4RQP C;  2A5Z A;  2D5F A;  2ZHN A;  3D3A A;  3F2Z A;  3IKW A;  3T4V A;  1R1A 2;  4NUB A;  2GNM A;  5I8S A;  2XHK A;  3MV1 1;  3RFR A;  4GB3 3;  1R09 1;  1DLC A;  4CDX C;  3U0Z A;  3LEI A;  3HWJ A;  1GZC A;  1UMI A;  2XJT A;  4K7J A;  4N90 A;  1ZRI A;  3RZL A;  1PVX A;  1ZRF A;  2ES3 A;  3RZK A;  2G1M A;  1GU3 A;  3NRU A;  1OC1 A;  1H1I A;  1UZY A;  4GB3 2;  3OD4 A;  4PCR A;  5FZ3 A;  2ADE A;  3WQ1 A;  1V6N A;  4AVB A;  5AC9 1;  1BCX A;  5LAT A;  1UXX X;  2HLE A;  1PVC 1;  1U5I A;  2EID A;  2Q4S A;  2GN3 A;  2ZGL A;  2GAL A;  5T5O A;  5I8T A;  1F2N A;  4QAW A;  1O8S A;  2QVS B;  1JXN A;  3W5N A;  2GMM A;  3VB9 A;  1MS9 A;  4AXO A;  3UGF A;  3Q8A A;  3POI A;  4DO0 A;  2C26 A;  4EN7 B;  3NJX A;  3I97 A;  2Y60 A;  1H8T C;  1IPK A;  1AX0 A;  2H0B A;  2VZS A;  1AL2 1;  1MS5 A;  1NOV A;  2XBO 1;  1D0G A;  2P6H A;  2Q0A A;  4IEP A;  3AK0 A;  2DU1 A;  1SBD A;  4FVV A;  4TXW A;  5IJR A;  1W6Q B;  4OHV A;  2BYV E;  3WEZ A;  4P9L A;  4IXL A;  2ARA A;  1S4C A;  5FZ6 A;  1MEC 3;  1R08 3;  1RJ8 A;  3NJY A;  4NOT A;  1ND2 B;  3MDP A;  1Q8V A;  5CBL A;  2EXH A;  1HQW A;  4FPE A;  4XJU A;  2WN3 A;  3MIE A;  2J1A A;  3VKN A;  5EXO A;  1LRH A;  4QPY A;  2WNV C;  3WUD A;  2VZR A;  1KS5 A;  5DAQ A;  3VHO A;  3POG A;  5J1X A;  1R08 2;  2WII B;  4FPY A;  4P9X A;  2B7Y A;  3POE A;  4S2H A;  1ODN A;  1V9U 1;  2W08 A;  4WM7 A;  3OJB A;  5FZK A;  1DF0 A;  2AUY A;  3VLB B;  4A4A A;  2PHT A;  2AEY A;  4XBN A;  2WT1 A;  4XF1 A;  2WLP A;  3RMY A;  2VVD A;  4NPM A;  3VBF B;  3LEM A;  5C8C A;  2DBN A;  2XVG A;  5J98 B;  2WL1 A;  4AVA A;  5JSR A;  5IK8 A;  4V2W A;  2W2I A;  1JZ6 A;  2VZV A;  2CY6 A;  2E53 A;  1QXR A;  4UI9 L;  4FFI A;  4MXV A;  4DUX A;  5FR3 A;  1JYV A;  1Y7B A;  4LTA A;  1LOG A;  4QGN A;  3U1X A;  3J8F 1;  4AEJ A;  1C4R A;  3H1M A;  1S0B A;  4E4S A;  5IVB A;  4F83 A;  1BXH A;  4LIU A;  4FSJ A;  3QD6 A;  4XBL A;  3WDU A;  5DUV A;  1CIY A;  1XXN A;  1H2K A;  5F9T A;  1GZW A;  2V09 A;  4OMD A;  2GP5 A;  5LAS A;  4BK4 A;  4EE2 A;  4ZU7 A;  5CG8 A;  3ZFE C;  3HVD A;  3RVH A;  2ZAH A;  2QCS B;  3KGL A;  2JB8 A;  1J59 A;  4NIG A;  1UO9 A;  1QQP 3;  1CGP A;  4Y20 B;  4LK6 A;  2RR1 3;  4UT5 A;  2WIN B;  1HB1 A;  3QAC A;  2ZEW A;  4BWO A;  1OLM A;  1XQN A;  5EJ3 A;  3ZN4 A;  4CCN A;  2XJS A;  1AX1 A;  2OS2 A;  5ACA 1;  1QQP 2;  4FP2 A;  4NVP A;  2JEM A;  4ZZ8 A;  3KT1 A;  5A3U A;  2VUD A;  4OZO A;  1A8D A;  2RR1 2;  2VME A;  4XHB A;  3V0A A;  3FWE A;  3KQ4 B;  1MQT B;  1YIF A;  3IPV B;  2A70 A;  2GNT A;  3QBQ A;  4GAZ A;  2MEV 3;  5FYH A;  1VMH A;  4ES9 A;  3O1R A;  1PGW 2;  1KDM A;  5FQ0 A;  5KWR A;  5AFB A;  1IG3 A;  2WDB A;  4QHZ A;  1HRV 1;  4JGZ C;  3A23 A;  5GZE A;  1IS4 A;  2R1D A;  2DCZ A;  2WAO A;  3LEG A;  4OLL A;  2MEV 2;  1GMM A;  5BUV A;  4YM0 A;  4PHZ A;  4QPW A;  1YC6 1;  2A3W A;  2RG4 A;  3SCH A;  3I2H A;  4IEW A;  3LWC A;  2ZGR A;  4QB2 A;  1VBB 1;  1EY2 A;  1VBD 3;  2XXZ A;  3H9A A;  1OUR A;  3H7J A;  1GR3 A;  4XDO A;  3ZYI B;  1C8M 1;  4CDW B;  2NMN A;  1BQP A;  1EAH 1;  5GLZ A;  3WIN E;  2WA4 A;  1XE0 A;  2W0X A;  2BOJ A;  4CU8 A;  1W2O A;  3KMH A;  3RG0 A;  3AMN A;  4HKO A;  4IV3 C;  4M0H A;  1VBD 2;  2VCA A;  2XLG A;  4AOC A;  3HT1 A;  1XSQ A;  4DQA A;  3MYX A;  4IDZ A;  2VOX A;  4UW5 A;  1XYO A;  4OQ9 A;  2ILM A;  3MZH A;  1Q5O A;  1VB4 A;  1JYC A;  3VL8 A;  2DVD A;  2A75 A;  4B4Q A;  1HQN A;  1JU4 A;  1H8V A;  2BBV A;  5FP9 A;  2WS9 1;  4UOJ A;  2BTV C;  4EWA A;  1AR7 1;  5A3N A;  5BNO A;  4YNI A;  4NII A;  2GN7 A;  4HT1 T;  1AYM 3;  3HN3 A;  4AE2 A;  4FAG A;  3HBZ A;  4HN1 A;  5A6Q A;  3B3Q E;  1MZ6 A;  3V64 A;  4C90 A;  3NNG A;  2VBD A;  5K0U A;  5B4N A;  3OUJ A;  3UGG A;  1E57 A;  3KLS A;  3MF9 A;  5JR2 A;  3AM2 A;  1WA6 X;  2QQN A;  4CCO A;  2JDH A;  3KSC A;  5JXJ A;  3M3Q A;  1AYM 2;  4HON A;  3ZDV A;  2WSV A;  4W6Y A;  5JIU A;  1EPZ A;  3DPR B;  3WLU A;  4CTE A;  2X29 A;  1JW6 A;  1RL3 A;  4JKK A;  4AVV A;  2HKX A;  2YU1 A;  1YCI A;  2D93 A;  3VBS C;  1UQX A;  2PHR A;  1RXG A;  1F15 A;  1RUJ 1;  4CCE A;  4XFC A;  3LCP A;  1PNF A;  1J3R A;  3HQR A;  4Y1U A;  5FP4 A;  1TME 1;  1S0E A;  2I45 A;  2RMU 2;  3AZV A;  5FZ8 A;  3TNQ A;  1PMH X;  2IVJ A;  2QUO A;  2YFU A;  3O0X A;  1ZRR A;  4O9G A;  1BJQ A;  3DN7 A;  4Q4V 1;  1DGR A;  4IEO A;  1X50 A;  3FMG A;  4AED C;  4JRA A;  2BWA A;  3OY8 A;  1HKD A;  4IEY A;  5CZK A;  3GGL A;  1ENS A;  2C4X A;  3OGR A;  2Z69 A;  1H0B A;  2HWD 3;  4XAA A;  2YPJ A;  1NCQ A;  4QX5 A;  3VBH A;  1XU2 A;  1UKG A;  3GJA A;  3AL5 A;  1ST8 A;  4L97 A;  2VCM A;  1KFX L;  3IWZ A;  1F5J A;  3NV2 A;  3IDA A;  3U11 A;  1F9K A;  4I3G A;  1Y3T A;  1WUV A;  2HWD 2;  1OKQ A;  2WNO A;  4XET A;  5A7Q A;  3LA2 A;  1CR7 A;  5CB7 A;  5FZE A;  4AQT A;  3H8X A;  1DQ5 A;  5FFO C;  1ULP A;  3PUA A;  3T0A A;  5A7W B;  1LHO A;  5DAB A;  4RSU A;  1L7L A;  5EJZ B;  3ZFF B;  4XUR A;  2VNR A;  1IZ3 A;  5FZL A;  4Y3O A;  2DU0 A;  5DUU A;  4YM2 A;  4LT5 A;  1PZ9 A;  1NZC A;  5FP7 A;  2ET7 A;  1GWM A;  3FHQ A;  1KFU L;  1L7R A;  1VMJ A;  4YFZ A;  1ZBE 3;  2VUJ A;  4FI9 A;  3I2K A;  3IDE A;  4CP2 A;  1CQ9 A;  1UYZ A;  3WR0 A;  1UPI A;  2ZEZ A;  5C7G A;  4I30 A;  1B35 B;  2VVF A;  1QWR A;  5FPZ A;  5FY8 A;  3VZO A;  3O1P A;  2WKK A;  2OUJ A;  2RS1 1;  1BBT 1;  2TNF A;  3RZG A;  2OII A;  4GUL A;  3IT8 A;  1W39 A;  4TYS A;  2VBP A;  3KV9 A;  4XFF A;  4MYE A;  1JN2 P;  3CJI B;  1HN1 A;  1POQ A;  5JPM B;  5LRS A;  1OXC A;  2XJP A;  1JYW A;  5A7O A;  2O8Q A;  2X5I A;  2J1V A;  2WYS A;  2R06 1;  4D7T A;  1QJE A;  2WZP P;  1CAV A;  1NT0 A;  2PHD A;  1H1A A;  4GZ9 A;  4IEV A;  4XAB A;  3ROU A;  3ZXF A;  4W8J A;  1LB2 A;  5E16 A;  1RB8 G;  2O0O A;  3EJK A;  4JAA A;  5DDJ 3;  3VBU A;  4ZKT B;  4HVQ A;  1Q8O A;  3ZKU A;  2XKO A;  1Q8P A;  3CZJ A;  3LD8 A;  1HJG A;  2VL4 A;  2R0F A;  2MNG A;  2WA3 A;  3ACG A;  3E5Q A;  1O5U A;  4QXK A;  5DDJ 2;  1PO2 3;  2VOT A;  5C3P A;  2BJS A;  1X36 A;  4M00 A;  5LWB A;  4MV2 A;  4JGY B;  2LW8 A;  3AP4 A;  4I3P A;  5FZB A;  3B9C A;  4RS5 A;  4WM7 C;  1PIV 3;  5HI0 A;  2GZW A;  4U2A A;  4XF3 A;  3DYO A;  1ENQ A;  5C8C C;  3LFM A;  2W1S A;  1PO2 2;  4K1Z A;  4MGT A;  1VJ2 A;  2ZKL A;  4IEX A;  1CAW B;  1W05 A;  2IZW A;  2VOW A;  5CG9 A;  4DXS A;  4LNV A;  1YEW A;  1MAC A;  1T6B X;  2K0G A;  5FMO S;  4WM8 A;  2YG0 A;  2FCV A;  1PIV 2;  4XW3 A;  2B4K A;  1JYI A;  2I74 A;  5A6Z A;  1WCQ A;  3F95 A;  4I02 A;  1NA1 A;  4P08 A;  2XKP A;  1W2A X;  3PUQ A;  1BEV 3;  1LOF C;  4M4P A;  1NAE A;  3HPN A;  2VMI A;  3I8T A;  3A0N A;  3JXS A;  5HV4 A;  3C2U A;  1VRB A;  5CU1 A;  4AGG A;  5HPO A;  1Q3E A;  4FOV A;  3SCG A;  3OGV A;  2FDH A;  4RQP B;  2Q8O A;  1BEV 2;  4B4P A;  5L7O B;  4BA6 A;  4LLO A;  4FT8 A;  4Y26 A;  2XLA A;  2YC2 A;  2YBS A;  1W0O A;  1PGL 2;  2PTM A;  3IZO A;  5FO8 B;  1AVB A;  1VRH 1;  3KV5 A;  3ZYJ B;  2SBA A;  3MF6 A;  3MBW A;  2G9G A;  3I3D A;  4CEY A;  2VD7 A;  1GWK A;  1BVP 1;  3FFQ A;  3N9Q A;  2C9A A;  3ELN A;  3MPB A;  4XXP A;  5LA2 A;  3UNP A;  1NG0 A;  1RXF A;  2ZS6 B;  4YW4 A;  4D6R A;  4AWD A;  5EHD A;  3VL9 A;  4E4H A;  2KM2 A;  3AYA A;  3NJV A;  4PLM A;  2F4L A;  4Y22 B;  5J7M A;  5CFC A;  1SCR A;  1ZZ8 A;  4N7I A;  1QY4 A;  3ZYP A;  5LB6 A;  5FPA A;  1M4W A;  3N9N A;  1VBC 3;  1PO1 1;  3I59 B;  2W1U A;  3D0J A;  3SNM A;  2QZ2 A;  3WW1 A;  3S5Q A;  5FPU A;  1LED A;  5JXH A;  2P2K A;  2XVK A;  1VB2 A;  3O5S A;  1OVS A;  5KHI A;  3WDX A;  2D6L X;  2PA7 A;  4IQP A;  3BTY A;  3HQX A;  1GSL A;  2YB7 A;  1RYY A;  3PVE A;  1VBC 2;  1TG7 A;  3AL6 A;  4UF0 A;  1FPN 1;  2Y8K A;  1VAK A;  3IMM A;  1SLI A;  5BYN A;  4TTG A;  4PBP A;  4OZX A;  4ZU5 A;  5EYY A;  2OKX A;  1GKB A;  5I0U A;  4YVS B;  5IK5 A;  2XGX A;  5GZF A;  3D0S A;  4M3C B;  4QKB A;  1JHN A;  2E6V A;  3PTR B;  1QJU 1;  2PLV 3;  5I0R A;  3T0D A;  4XAC A;  5FMD A;  4DXT A;  1MPX A;  2Y6F A;  1CPM A;  3POY A;  4DMI A;  5A6X A;  1IGO A;  3NQH A;  3JUU A;  4WVV A;  2LRP A;  5LZ6 A;  2HWF 1;  5GAL A;  3VHR A;  5BNO C;  5CIS A;  2RM2 3;  3MW3 A;  3EBR A;  2PLV 2;  3AKS A;  4GH4 B;  4HVO A;  4IE5 A;  3TN9 3;  4L99 A;  4Q2F A;  3ZN6 B;  1UYX A;  2J1T A;  1SLB A;  2WBK A;  2XL9 A;  2WC2 A;  3L2Y A;  3MW2 A;  4LQR A;  1FX5 A;  1CAU B;  4GXL A;  1CIW A;  1H2M A;  5JOW A;  5K0U C;  5D2A A;  1W8N A;  5BNN B;  1NYW A;  3LSE A;  4N7U A;  2RM2 2;  1A34 A;  4E8D A;  4A3Z A;  3WQB A;  3TN9 2;  4HLT A;  4IE4 A;  4KH9 A;  4CDU B;  5FP3 A;  5ANQ A;  3AP9 A;  1RUH 3;  3A7Q A;  2D6P A;  3OGS A;  1WZX A;  1RUI 2;  2BFU L;  4QM8 A;  4CEW B;  1HRI 3;  3DKQ A;  3VKL A;  5JOZ A;  1L7Q A;  2D44 A;  4Q27 A;  4P9J A;  1OA2 A;  5J3U A;  2P1B A;  2JXA A;  1W6O A;  4ZS3 A;  2BDR A;  2RDQ A;  1OPO A;  5FLJ A;  5J48 A;  3DYM A;  4XVH A;  3RYP A;  1CX1 A;  5C4W B;  1RUH 2;  2NZ9 A;  4NJ4 A;  3Q8F A;  4SLI A;  4X8N A;  4XIO A;  1SLC A;  2WNU B;  3WNN A;  3ZKY A;  1Z0H A;  5GLV A;  1BLZ A;  1HRI 2;  1XPW A;  1UYY A;  4PBO A;  4XF4 A;  1JH5 A;  2A7A A;  1T2X A;  5GZC A;  5CA6 A;  1DZT A;  4E8C A;  1GQH A;  1ZBA 2;  5F8P A;  4AFM A;  4DUV A;  4A6S A;  1AR8 1;  3BI3 A;  1O91 A;  4ERO A;  1DYO A;  4YGD A;  1N1S A;  1W6P A;  2VTX J;  2YDE A;  2OQ6 A;  5FAX A;  4F7Z A;  5GJ6 A;  1QOO A;  3I2G A;  4CDQ B;  4Y4Y A;  4RR3 B;  2WWS A;  3JD7 3;  1NCQ C;  3VBH C;  2VMH A;  3IAP A;  4KU7 A;  3BKZ A;  2IC1 A;  1N3P A;  1WA4 A;  3BUC A;  2Q8C A;  2CAV A;  1GLH A;  2ARB A;  4CU9 A;  3HJR A;  5FMC A;  2FBE A;  1GZT A;  4UFI A;  5JAX A;  1OF4 A;  3JD7 2;  3H50 A;  2EIB A;  2E33 A;  1FAY A;  4LHL A;  4UFJ A;  4YM1 A;  1ACC A;  2Y38 A;  4CCD A;  4TLG A;  4LPL A;  5FYI A;  2ZAC A;  4XIK A;  5FPL A;  4DFS A;  4P5Y A;  2W46 A;  3UL2 A;  5FWJ A;  2VMD A;  4CCJ A;  3E5U A;  3VBR B;  3BCW A;  3O1T A;  1LEC A;  1O59 A;  4DY5 A;  4N9I A;  2VQT A;  2JE8 A;  1AR9 1;  4W65 A;  1G86 A;  4AYU A;  2XPJ A;  3WQ7 A;  3MID A;  3H8R A;  5F3E A;  1OOP A;  4HK9 A;  4NRP A;  4Q29 A;  4IET A;  3LB9 A;  4GMP 3;  2BGP A;  5JLV A;  1DP0 A;  2FQP A;  2YBK A;  4C1W A;  4IGO A;  1FMD 3;  3I4I A;  5LA1 A;  1OLQ A;  3CF6 E;  5IW0 A;  3BU0 A;  3I2F A;  5F3G A;  4ZXE A;  3J26 N;  3ZR6 A;  1PM4 A;  3HBK A;  5FDB A;  4QXH A;  2PN5 A;  1FAT A;  4LO7 A;  3RQ0 A;  5LW9 A;  4QPG A;  5FYY A;  1FMD 2;  3GBF A;  4GWM A;  3KVB A;  5JPN B;  1SBE A;  4PDW B;  2X5I C;  3GHM A;  1GNH A;  4N53 B;  1G7Y A;  3GDB A;  2BP6 A;  1W3V A;  2VUA A;  1SPP B;  3I2D A;  2JIJ A;  1UU5 A;  4P9I A;  2JG8 B;  2RS5 1;  2VZ1 A;  5I91 A;  5KC5 A;  2ZHL A;  2GH8 A;  3NKT A;  4YW2 A;  4LBJ A;  3VD5 A;  1UMZ A;  4WVZ A;  3SKV A;  5IVE A;  3III A;  1LOD A;  5E1R A;  1Y9Q A;  4Z8B A;  4QHB A;  5A33 A;  2QQK A;  5C3R A;  1VAL A;  5C3S A;  3THT A;  2J1U A;  2YMZ A;  4KNC A;  4RS5 C;  3T2O A;  2NLR A;  1J83 A;  2GC0 A;  5FLH A;  4NO4 A;  3LZZ A;  2D98 A;  4WVM B;  5DG1 A;  1UNB A;  5F1R A;  4CPB A;  1GOF A;  2AZ5 A;  1XB9 A;  3ACF A;  4ZY9 A;  4YRD A;  3WG2 A;  3WW4 A;  3WX5 A;  3O1U A;  1H4H A;  4OFG A;  3VBO B;  4KG0 A;  1UPS A;  2YC0 A;  4WM8 C;  1RUO A;  3KT4 A;  4IV3 A;  1RVF 3;  4Q4X 1;  1R1Z A;  2JD4 A;  3KB5 A;  5E89 A;  5F2W A;  4DEQ A;  2I2S A;  2XJU A;  3LSD A;  2KA3 A;  3ZXL A;  3N3H A;  4Q4Y 3;  2IXL A;  3UYJ A;  2VGD A;  1KEX A;  1NA1 C;  5K4L A;  3BAL A;  1WBF A;  3L2H A;  3WP5 A;  5FUN A;  1RUC 1;  2IXK A;  4XQD A;  1RVF 2;  4RN5 A;  1S2E A;  4K8F A;  3WHT A;  3WDV A;  1LCL A;  5IFP A;  5I8Y A;  1DQ0 A;  4I0B A;  5E88 A;  4V2V A;  2UUR A;  4Q4Y 2;  2VPV A;  5D21 A;  1UX7 A;  4MLO A;  2IWG B;  4UFL A;  1YI7 A;  3PVB B;  2EXI A;  5F2S A;  3HEI A;  1LEN A;  2DCT A;  2JJ6 A;  1STM A;  5FY9 A;  1W6N B;  2ETE A;  4CEY C;  4Z2A A;  1OA3 A;  2VCC A;  3IAQ A;  2D6N A;  1ULC A;  3AP5 A;  3OF1 A;  2DCY A;  1YXW A;  1RUD 3;  1WW5 A;  1ZNP A;  3AJY A;  3MHZ A;  5EJ1 B;  3VDA A;  3FJS A;  4GA9 A;  1AXK A;  5KXD A;  3SEP A;  2DVG A;  4AI0 A;  2YXS A;  5CFC C;  4QKD A;  4LKS A;  2EIG A;  2Y6G A;  3H7Y A;  1A6C A;  3AZY A;  3JU9 A;  4LHS A;  4TLF A;  3HQU A;  3ME2 A;  1RUD 2;  1UKR A;  3ABZ A;  2DVF A;  2HBU A;  1LHU A;  3THD A;  2PAK A;  3NNJ A;  1AZD A;  1KD7 A;  2DDU A;  2RS3 1;  3MLJ A;  1YO8 A;  5I0D A;  2WO3 A;  2KR2 A;  2CGN A;  2WFF 1;  4BCU A;  1QXJ A;  4YVW A;  3WW3 A;  1W8O A;  3ZOI A;  4AED A;  1GOG A;  3U4S A;  2QQL A;  1PZ7 A;  3AMH A;  2R0H A;  1SLT A;  4NAM A;  1IOA A;  3OPZ A;  4FFG A;  4IV1 A;  3I7D A;  1NLS A;  4OI2 A;  3VZM A;  1COV 3;  4M3C F;  1ASJ 3;  4W50 A;  2HWB 2;  5L73 A;  4HN0 A;  4O65 A;  3ZXD A;  3AMP A;  3PUH A;  4FTS A;  4JDO A;  3LIH A;  1CZT A;  2QQM A;  1R1A 1;  1K5M C;  1SAC A;  4TSV A;  5SV8 A;  4EN8 B;  1AR6 3;  1HQL A;  2W91 A;  3H1W A;  4Q1R A;  1UY4 A;  5EYX A;  4EZ4 A;  5L36 A;  4MGY E;  2R04 3;  1WD3 A;  1ZX5 A;  4A7Z A;  1COV 2;  5LK7 B;  3B93 A;  4NIA A;  2JG9 A;  1CJD A;  1TMF 3;  2GC1 A;  4AHX A;  3V56 A;  4Z07 A;  5IUQ A;  2DBI A;  2VMC A;  3TWI A;  3POB A;  4GB3 1;  4CYD A;  1FNY A;  5KBF A;  3CIH A;  2VR4 A;  2VEC A;  5FTT C;  3CNA A;  5HCA A;  5T5L A;  3ACL A;  2CTV A;  3PU8 A;  1MS3 A;  4DS0 A;  2X53 S;  1TMF 2;  4XQW A;  1QDC A;  4Y5Z 0;  2J7M A;  4O7X A;  5C8C B;  1E5S A;  1DZR A;  1IHM A;  3GM8 A;  4ET7 A;  3K4Z A;  4BLI A;  1F31 A;  1HB3 A;  3RPQ A;  1NY7 2;  1R09 3;  4TN7 A;  4XCA A;  1H4G A;  2XWB B;  4YGB A;  3RZZ A;  5BNQ A;  3N36 A;  1YUD A;  3T1M A;  1HDK A;  1UOG A;  1TE1 B;  1LU1 A;  3CLP A;  1LOE A;  4COW A;  3D4K A;  1O8P A;  3V65 A;  5CFD B;  4DXR A;  3N7J A;  4XYX A;  3H1Y A;  4P9W A;  1L3J A;  4P02 B;  2E63 A;  4JTO A;  2VCB A;  2RVA A;  4C0H A;  1AYN 1;  1IS3 A;  3W5M A;  3R0R A;  3ZSE A;  2N7G A;  4LO8 A;  3OGG A;  2OYZ A;  4MGI E;  4YW5 A;  3W20 A;  5FYM A;  3V0B A;  4L92 A;  4Q4W 3;  3U10 A;  2R07 3;  4HG6 B;  4QPI B;  4KWJ A;  5FBJ A;  3T30 A;  3AVS A;  1V0A A;  1RMU 3;  1R08 1;  3RJ2 X; 
#chains in the Genus database with same CATH homology
 2OQ6 A;  5FZF A;  5A7S A;  4CCL A;  4LIU A;  5FUP A;  5FZG A;  5FYT A;  5FZ7 A;  2YPD A;  5FYZ A;  1VRB A;  3AVR A;  3KVA A;  2GP5 A;  4AAP A;  4HOO A;  4GJZ A;  5F2S A;  5IVV A;  5F5C A;  3RVH A;  2Q8C A;  2P5B A;  2XDV A;  5FYC A;  3K2O A;  5FY9 A;  5F5I A;  4CCK A;  2YBS A;  5FWE A;  4LXL A;  5IWF A;  5F39 A;  4AI9 A;  5A1L A;  3KV5 A;  3AL5 A;  5FZH A;  5IVJ A;  5A7P A;  3K3O A;  2OQ7 A;  2VD7 A;  5FZ0 A;  4CCN A;  3N9P A;  5FXW A;  3N9Q A;  5F37 A;  2OS2 A;  5A7Q A;  5FZE A;  2OX0 A;  5FYI A;  5F3C A;  5FZ4 A;  5FPL A;  2XML A;  3PUA A;  4QX8 A;  2XUE A;  5A7W B;  4D6R A;  5FWJ A;  5CEH A;  4E4H A;  4NUB A;  5FYU A;  5FZL A;  4CCJ A;  4Y3O A;  3KV4 A;  4GAZ A;  5FYH A;  5KR7 A;  5FP7 A;  5FY5 A;  5FPA A;  5F3I A;  3OPW A;  2Q8E A;  3N9N A;  5F3E A;  3U4S A;  5FPU A;  2YBK A;  4BU2 A;  4IGO A;  5FY1 A;  5IW0 A;  5FY8 A;  5F3G A;  3PU3 A;  4QXB A;  5FZ3 A;  4QXH A;  5FJK A;  3K3N A;  3AL6 A;  4LIV A;  5A7W A;  4IGP A;  2XXZ A;  4LIT A;  5FJH A;  4UF0 A;  4XDO A;  4Y33 A;  5LW9 A;  3N9M A;  4DIQ A;  5FYY A;  4CCM A;  3KVB A;  3KV9 A;  4CSW A;  4EZ4 A;  4QU1 A;  2Q8D A;  4UF0 B;  4CUG A;  3DXU A;  4DO0 A;  5FY7 A;  5F5A A;  3PTR B;  5A7O A;  2WWU A;  4C8D A;  3KV6 A;  5A3P A;  4URA A;  4QX7 A;  5FXV A;  3PU8 A;  3PUS A;  4QXC A;  4GD4 A;  4ASK A;  5IVE A;  3N9L A;  4XDP A;  5F32 A;  5FP9 A;  5FZM A;  5FZD A;  5FPB A;  5IVF A;  5A3N A;  3LD8 A;  5FP8 A;  4BXF A;  5E6H A;  5FZ9 A;  5A3W A;  5FZO A;  2YU2 A;  5FZ6 A;  3NJY A;  5ISL A;  4EYU A;  2OT7 A;  4TN7 A;  5FYS A;  5FZO B;  5FY0 A;  5LWB A;  4Y4R A;  5A80 A;  5FP3 A;  5FZB A;  5ANQ A;  5FXZ A;  2GP3 A;  5FYV A;  4CCO A;  5IVY A;  4D6S A;  4HON A;  4IGQ A;  5FV3 A;  5A7N A;  5A3T A;  5FY4 A;  5FZK A;  5FZC A;  4EZH A;  2YU1 A;  3DXT A;  5FYB A;  5FZA A;  5F2W A;  5LY2 A;  5FZ1 A;  4GJY A;  2PXJ A;  4QWN A;  4V2W A;  2W2I A;  3UYJ A;  3ZLI A;  3OPT A;  3ZPO A;  5K4L A;  5FZI A;  5FPV A;  5FUN A;  2YBP A;  4D6Q A;  5A1F A;  5LY1 A;  5FXX A;  3PDQ A;  3PUR A;  5FYM A;  5FP4 A;  4V2V A;  5IVC A;  3LDB A;  5FZ8 A;  3PUQ A;  4BIS A;  5FBJ A;  3N9O A;  3AVS A;  3U78 A;  5IVB A;  2WWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...