5A1FA

Crystal structure of the catalytic domain of plu1 in complex with n-oxalylglycine.
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
458
structure length
450
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 450
sequence length 458
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a1fA01
5FUPA 5FXVA 5IVJA 2WWUA 5FYYA 5FZBA 5K4LA 2GP5A 3U78A 4EYUA 3UYJA 5FZLA 4XDPA 5FXXA 5FZAA 5FPBA 5F3CA 4E4HA 5FZ4A 5FZDA 5IVEA 2YPDA 5FXZA 5FYIA 2WWJA 4XDOA 5F5IA 3AL6A 4URAA 3AVRA 2VD7A 4UF0B 5ISLA 2OQ6A 5A80A 4BXFA 4DIQA 5FWJA 5IWFA 4HOOA 3AL5A 5FBJA 5FJKA 5FUNA 5FZ0A 5FZ9A 5FZFA 5IW0A 3LDBA 4CCNA 4EZ4A 4HONA 3PTRB 2YBSA 5FWEA 2GP3A 3PU8A 2YBKA 5FY0A 4CCJA 5F2WA 3N9LA 5FPAA 4IGQA 5FYTA 5FYCA 5FZOB 5A7SA 5FY4A 5FZHA 5A7OA 2Q8EA 2XUEA 3KVBA 2Q8DA 5FY7A 3N9QA 5F5AA 4AAPA 3N9OA 3N9MA 4CCMA 4D6SA 2YU2A 5FP9A 5FY9A 3K3OA 5E6HA 4LXLA 3KV5A 5FY1A 4V2WA 5A7WA 2P5BA 3PUSA 5IVFA 4BU2A 5LWBA 4Y3OA 5IVBA 5FYBA 5IVVA 4EZHA 5CEHA 4D6QA 5FZ3A 3AVSA 3OPWA 1VRBA 5FZ1A 5FYHA 4V2VA 5FP3A 3DXTA 3N9PA 4CCKA 4NUBA 4CUGA 4TN7A 5LW9A 3PURA 5F5CA 2YU1A 3N9NA 5FXWA 4QX8A 5FJHA 2OT7A 4DO0A 5FPLA 5FZMA 5FZEA 4LIUA 4IGPA 5FP7A 5FP8A 2Q8CA 3PUAA 5A3NA 5FPUA 4IGOA 5FZCA 5FZIA 4C8DA 3KV6A 5FV3A 5F39A 4CCLA 4CSWA 5IVCA 3LD8A 2OS2A 5A3WA 3RVHA 4LIVA 5FYMA 5FZOA 4Y4RA 2PXJA 3DXUA 5FYUA 5FZKA 5A7QA 4GJZA 4Y33A 4GAZA 2OX0A 4LITA 2XDVA 3PUQA 3ZPOA 5A3PA 2YBPA 5F3IA 5FZ8A 3PDQA 5F3EA 5FYZA 5A1FA 4BISA 4QXHA 5ANQA 5LY1A 3KV9A 5F32A 3K3NA 5KR7A 5F2SA 5F3GA 5FYSA 4UF0A 5A7NA 5A1LA 5IVYA 5LY2A 5FPVA 5FZ6A 3PU3A 5FYVA 5A7PA 4GJYA 4ASKA 2XMLA 3KV4A 2W2IA 3OPTA 5FP4A 3K2OA 5FZ7A 5FZGA 2XXZA 4AI9A 4CCOA 4D6RA 3NJYA 5A3TA 4QU1A 5FY5A 4QX7A 4QWNA 2OQ7A 5FY8A 5A7WB 3U4SA 3KVAA 4QXBA 4QXCA 3ZLIA 5F37A 4GD4A
chains in the Genus database with same CATH superfamily
4AVVA 1HV0A 4WVMB 5FZBA 1ULPA 2JX9A 4JTOA 5D2AA 1URXA 1UPSA 4XC9A 5I8SA 2QVSB 3AB0A 2JICA 3U4XA 1H6XA 5JI9A 1IHMA 3C7GA 2V09A 4Q4X1 4RS5B 3THPA 1KITA 1V6LA 4XFFA 1R092 1GOHA 4AZZA 2H0VA 3ZFGA 2BWAA 4IE7A 4A3ZA 4LNVA 2JD9A 2VQAA 1TG7A 2QE3A 3AZXA 5E89A 1NXMA 5KXBA 3M1HA 3AFGA 4EROA 4HL0A 4L92A 1HB3A 4AI2A 2I2SA 2GP3A 4CU7A 3VBUB 4ARYA 1ND3C 4BMBA 2EF6A 3SKJE 2NM1A 3N9LA 5AC92 5ABJA 2C5DA 1X7NA 3ZYBA 2RMU1 2EIEA 5DQ0A 5A7SA 3ZR6A 1N1TA 3H3LA 2YG0A 1PM7A 2Q8DA 1LOEA 1YUDA 1PVXA 2C4XA 2QDRA 4QMAA 2GNMA 4XTPA 2XB6C 1B35C 1FNYA 2LUWA 2WNUA 4OYUA 4YGCA 4BH9A 3NW4A 4S2HA 3AKPA 1UMIA 3WDTA 1QDCA 1S2EA 1JYVA 2RS11 4HK8A 4QGLA 3PUSA 3TYJA 4BU2A 4YM2A 2YC0A 1GNYA 3P6BA 4ZXEA 5L19A 3T1LA 3ZKUA 3POJA 1I6XA 3PMEA 3QBQA 4LBKA 4ET7A 1ENXA 1JUIA 5FP3A 2WO1A 1AL0G 3NNJA 3TN93 5DG1A 1C4RA 1ZM1A 2KD7A 1OUSA 1O7FA 4HT1T 1ND2C 1PNGA 1SG3A 1O6UA 4DO0A 1OQDA 1Q8SA 3AYAA 1AR81 4Q4X2 5FZEA 4AFCA 5LBFA 4YW2A 3GZUC 2E51A 5LA1A 2XR4A 4XF0A 4LO5B 4YSFA 2W68A 2YMZA 2EXKA 4QX3A 1J59A 4BQ4A 1LHWA 2HYXA 5D8AA 4QX1A 4EV0A 5FO8B 5T5PA 4A7YA 3VDCA 5J48A 5KHHA 2Q1MA 2WYFA 4W4ZA 2R16A 4LITA 1P8JA 1EUUA 5LEKA 2RS52 1UY0A 2W92A 1PGW1 4L9BA 4EN7B 5FBZA 2GMMA 2RMU2 3UGFA 5JR2A 1QXRA 2NYYA 3LOBA 5F2SA 1S0GA 1MS5A 3NO8A 4XF9A 2HH9A 1I9RA 1W3VA 1AYM2 1XOYA 1YJLA 2ZGUA 5C4WB 1RB8G 2FDFA 4BE3A 2XJVA 5LCWL 4UI9L 5IJRA 3P3PA 1BEV1 4IDZA 1POV3 4XUQA 3KB5A 2Y6GA 2Y38A 1J1TA 3KWVA 4MO3M 1O4TA 1RUF2 4B29A 4EN0A 2QQMA 3WDYA 4QQ2A 2V4VA 2Q4SA 4YW1A 4QX7A 2OQ7A 2YZ4A 1XPWA 2WL1A 1UO9A 2PHRA 2ZAHA 4LBQB 4M0HA 4C91A 4DFSA 3IM0A 4YZ5A 1UU4A 1JODA 4ZS3A 2XVGA 4ZXKA 3RWKX 2P6CA 1AR82 2RM23 2GP5A 3VHRA 1NZIA 2XG3A 1RUH1 5T55A 3AMMA 5A70A 1YLLA 2HKXA 3ZO0B 4DY3A 4Q4Y1 5FZAA 5I0TA 1VBD1 4JDOA 1NCRB 4BQ1A 4E4HA 4O9EA 4UW3A 3TWIA 2YPDA 1UX6A 2D7FA 2BOIA 2HYKA 2VGDA 4XDOA 3OEAA 5BV6A 3VZKA 4JTNA 1KDMA 3DN7A 2IFRA 3BB6A 3BPSA 2KA3A 4FO9A 1OPMA 1R081 1ASJ3 2Q0AA 3DV8A 1XYNA 4PDWC 4BWOA 4DIQA 1PGL1 1JZ5A 5IK7A 1LHNA 4UBHA 5ERLA 5IW0A 5FFOC 1Y9QA 4HBNA 5JWPA 3MBWA 2OUJA 5LA9A 4R52A 1NA1A 5DUWA 5FPAA 5IT6A 2JD4A 4QPGC 4XVHA 5AVPA 5FY4A 5FZHA 4QQHA 2VECA 3LWCA 3MEPA 4NHMA 1GZCA 5CFDA 3SEEA 1JUHA 2ZGOA 1ENQA 4LO6B 4AQTA 5JDBA 4FAHA 5IAVA 1ND3B 2JDZA 1BEV2 3WP3A 3UGGA 2K0GA 3MO4A 5GJ6A 2WABA 4F7ZA 5IFTA 1ZBE2 1V6KA 4NHYA 4GWNA 4MHUA 3J7NA 3MW2A 2CTVA 3MPBA 2ZZJA 1CJPA 1B35B 2BYVE 3JQXA 3BVCA 2YHJA 5B4XA 1V9U3 2K2SA 4DUVA 3O1TA 4AGVA 5BY5A 3CO2A 1RUI2 1AR93 4XFBA 2HWC1 1DQ1A 2GN7A 5J96B 2ZX4A 4IEXA 3EBRA 4AW7A 3QACA 1RUH2 2PFWA 1YNAA 2PLV3 4MGZE 1F4AA 4Q4Y2 4Z2WA 2W94A 3BIEA 1PIV1 1US2A 1Z7S1 5FMOL 1VBD2 3VHOA 5FP8A 4EN6B 3H0OA 4JCKA 5J1XA 4E27A 1GWMA 4F83A 1F4HA 1OOPA 1COV2 4AF9A 2ZX1A 1LULA 3IBMA 1CAWA 5KC6A 1C8NA 1ND2B 3URFA 4L2NA 3NV2A 4AVTA 1R082 1PO13 2EVXA 2IXKA 1DDLA 1POV0 1HLCA 4QU2A 4XCAA 3IAQA 3NWKA 4E9KA 1GR3A 4LO8A 4A6OA 1OLMA 3AMQA 5KHKA 3H7JA 2CGNA 1W8FA 1M4WA 1UOGA 3E5UA 1PMJX 1QY4A 1U5YA 2VC9A 2Z2SB 2VL4A 3ACGA 3VD9A 2HEYF 2W95A 3T0AA 4W6XA 5A6ZA 3AZVA 3QCWA 5DG2A 5E88A 1AX2A 5FLIA 5IVYA 3LA7A 3LB9A 2ZGMA 2J1SA 2Y6HA 4JGZA 1GWLA 1LGCA 2VJXA 5GM0A 3U14A 2FDJA 3I7DA 4PQQA 5TSWA 3RMXA 4XJUA 3WV6A 4BQ3A 2PHFA 3PL0A 3HT2A 4ZU5A 5EFUA 4Q8KA 2NMNA 1FAYA 1RMU1 2XONA 3GF6A 3I3MA 4NPRA 1QJZA 5A3TA 5DAQA 2EXIA 1KRIA 4RFT0 3OBAA 3U4SA 3OUJA 5I0UA 3KVAA 2PMWB 2WINB 1O3QA 1Q8OA 5FUPA 1AL23 1WCDJ 2EIDA 2R6QA 2WWUA 5FYYA 2BJSA 4CP2A 2K46A 1XNAA 1YO8A 1MS4A 2P4EA 3UYJA 3WG3A 3PJYA 5C6CA 5KHIA 1JYNA 2LALA 4TXWA 3V0AB 5J37A 1R64A 5JUVA 2PQSA 2QUOA 5LK7B 3KSCA 2WIIB 5K8SA 5JSRA 3SH5A 2ZAAA 4DINB 4HN0A 1QXJA 4HPKB 5T5OA 4EE2A 1D0GA 2VCCA 4RGAA 4KWJA 2RHPA 3EHKA 1DU3D 3C7FA 3C7HA 5A33B 4IEWA 1LNSA 2F17A 1ALYA 3SEPA 3U07A 5FWJA 1W6PB 1XE0A 4DOUA 4Q29A 1N3QA 1T2XA 5KXDA 3B3QE 1MR5A 1G9AA 3LEGA 3KHCA 1BMV2 5F2WA 4I01A 2WFF1 4M00A 4IEVA 1OH3A 4BYYA 3IIIA 4PDWB 2NN8A 4QPIA 3ZSKA 4R9AA 3IPVA 1DQ2A 3KVBA 1NY72 3RZHA 3M3EA 5JXIA 4FPYA 1I1EA 1QOTA 5APAA 5GZDA 3IDBB 1S4CA 4QM9A 5JMOA 4NWVA 3T4VA 2GDFA 4QPGB 1S2BA 2ILMA 1MS0A 4JDMA 3I2KA 2WA4A 2Q30A 1VBE1 2FD8A 1CR7A 1EPWA 4ASMB 2R063 3M4FA 4A2UA 1KD7A 3I59A 4OQ8A 3D5OA 5L7OC 2ZMLA 4NUBA 3J7LA 1UIKA 3ACHA 4LORA 1GV9A 3NNMA 5J3UA 3N9NA 4IE6A 5E16A 3U37A 1WW6A 1CIYA 4URTA 1DZRA 2W1QA 4H7LA 4WBBA 3V0BA 3Q8CA 1RUC1 4XUOA 4UFMA 1RUG3 2D40A 2JWPA 1HQWA 3BU0A 2OW4A 2CHHA 2DVBA 5FZCA 1JBCA 3J8F3 2XJSA 3FLPA 3BTXA 2H6BA 2GNDA 1W6OB 3CU7A 4WZCA 4YG6A 1EY2A 1HXS3 1MS8A 5FK8A 1EAH1 5CBLA 1HB4A 4LHSA 1QJX3 5JVVA 3H9AA 5F8PA 2DFCA 3K4ZA 4LHLA 2VVEA 5EWSA 1W6MB 4CUBA 5A3PA 2D6MA 5FTTC 3ZFEA 1G9BA 3CDZB 2XH6A 1H30A 3EXUA 4LTAA 5FZ8A 2WFF2 2J7MA 1GICA 5KHGA 4BISA 3KV9A 2WQ8A 2JG8C 4H2AA 4QQPA 4EQVA 1R1A1 1ZZCA 2OZJA 5HXMA 5JAXA 5F3GA 5FIXA 2QQLA 5EJZB 2PHLA 4PF1A 1W2UA 4LR4A 3AX4A 3WP5A 4NVPA 2VZVA 5IATA 5ACA3 2DVGA 4QD2A 2Y34A 1SBDA 2FCVA 4E2QA 4GH4A 2Z5WA 3E97A 1VBE2 4YW6A 2AEYA 1RMU3 3BU7A 4KNCA 1H8TA 1E5RA 3ZKYA 4UWDA 5A6XA 4GMP1 4P08A 3PIJA 1H2NA 1W6NB 1IKPA 3F95A 3J7HA 4AI9A 4D8MA 4CYDA 3ZN4A 1ULFA 3AZYA 1F5FA 3WNNA 3K77A 3ST7A 4JHTA 2RV9A 3HQUA 4I09A 4YYOA 4Y22A 5IYYA 3UESA 4ZU7A 4JGYA 1H1AA 2HJIA 1DG6A 1VBB1 1RUC2 1WD4A 3I97A 2VQ0A 4NRPA 3CJIC 4P9IA 5HXVA 4EWDA 1XB9A 2D93A 3ACLA 3FE5A 1FI2A 3KCYA 4CDUA 2DCYA 1CZSA 2IZWA 1VBA1 5JSOA 2Z4FA 3TEWA 1YFYA 4INDA 4XHXA 5JOXA 2WYSA 2RS31 1EAH2 3CL1A 1X36A 3ENRA 4LHKA 2WZEA 1PX3A 2HWD2 2OYZA 1K12A 3MLLA 4FPOB 3MUZ1 4MLOA 3O0XA 2BNNA 5DDJ1 4IV1C 3OJBA 3RZMA 3BUCA 3ZMOA 4YW5A 4LULA 1XYPA 2LW8A 1UCXA 4RGGA 5JPNB 3GNEA 2R1DA 1PK6A 1YFWA 2KXLA 2BNOA 1AJOA 1SFYA 1Y9GA 3GM8A 3BCWA 1RVF3 3N9OA 4XTMA 1FT9A 3OGRA 1OQ1A 1UU5A 4Q1PA 1W06A 3NJZA 1HDKA 4K7JA 4LXLA 3VKFC 3I8TA 1C5HA 4YM1A 4XFGA 2JENA 1RUD3 1CPMA 4GWIA 5FKBA 5I0SA 2AYHA 4P00B 3GJBA 1MVEA 4Y1YA 4OVEA 2QQUA 3E5QA 3ZYJB 1LESA 1RUJ3 5K0UA 3B69A 4B4PA 1MZFA 2VOTA 3O1VA 4COYA 4NPLA 4CCKA 5FO7B 3SCGA 1GBGA 1PVC3 3LDRA 4BLIA 1ULEA 3PURA 1G6NA 4Q4V2 2YU1A 2QQWA 4GWJA 5FXWA 2OIIA 4O65A 2ZGTA 5LATA 2OT7A 4CXXA 3TEYA 5C3RA 4ZU4A 1QDOA 1DFQA 4BIOA 5L7OB 1VBA2 5GZCA 1GWKA 3ES4A 5L36A 4OI2A 2WNUC 4KU7A 4Z1VA 1VB2A 1GP5A 4LE4A 4YARA 2A6VA 3MYXA 4CCLA 4CSWA 5IVCA 2QBXA 4XIOA 3LD8A 4P9XA 4CP9A 3SQOA 3MZHA 4YPJA 3ZXDA 4MH0E 4YRDA 1SCRA 3FC0A 2RDRA 3KF3A 1W0NA 2ATFA 4ZY9A 2OX0A 3ZXKA 3ZPOA 1WGPA 3J9SA 3U1XA 4KQ7A 4Q4W3 4YZ4A 4CUCA 1V00A 2CDOA 1LJ7A 2WWSA 4XURA 2IVJA 5F32A 3TB0A 4HXCA 1CGPA 2UY8A 3K3NA 3A22A 5C9AC 1OA3A 3M8LA 4Q0VA 1DHKB 4AEMA 5A1LA 2Y0IA 3ZOIA 5DAWA 4HKWA 2DUPA 2ZOEB 4NRQA 3WINE 1MS9A 2CWMA 4W65A 2JG8B 2Y60A 3J26N 3PU3A 4JKLA 4IEOA 4P5HA 4Q5OA 5BNPC 2VBPA 4HZFA 3AZZA 4FFFA 1AR61 4Z82A 3T2QA 1FPN2 4OMDA 5C70A 4GMP3 2W52A 5CG9A 3W21A 4BLJA 1KFXL 4L0PA 2P3JA 4AR2A 1IGOA 4NIDA 2W1UA 3W20A 4RA0A 4MGIE 1PNFA 2W46A 1WW7A 1KS4A 5JLVA 1QJY3 4QXBA 2VZRA 1VBB3 4NPMA 3VGIA 2BGOA 2W47A 2B9UA 5K4LA 1VRH1 2HEVF 2QTWB 1VPHA 2VUCA 1LHUA 5FLHA 4RR3C 4KGQA 2DBNA 5DUUA 5FPBA 5JXHA 2RS33 5FQ0B 1ZRIA 5FZDA 5IVEA 3I2GA 4DNYA 4JDNA 2D6NA 3CJIB 4WM8A 3MIEA 4UF0B 3DGTA 4LHNA 2WKKA 5DDJ3 5FOJB 2Y6FA 1VBC1 1CAVB 3MIFA 1FNZA 2RR11 3ELNA 5I93A 1NLSA 4FOWA 3KD4A 1D2SA 3PU8A 1H9WA 4PI2A 4LMFA 4CDXA 3SISA 1UF2C 4XFHA 4NIHA 1STMA 2Z69A 2IXLA 5FMCA 2WS92 1UOJA 2Q1FA 1HV1A 2DU1A 1FYUA 1UZ0A 1WLTA 1QHDA 4IV1B 2W5FA 4D6SA 4AE2A 2UWCA 2YU2A 2BV4A 1NCQA 2VMDA 3GZEA 3OUHA 5DAXA 1W8ZA 2B46X 5FY1A 4FFGA 1XU1A 2J22A 5GLTA 5LBCA 3JBG1 3S5AA 2CGPA 2SLIA 2XBO3 4XUTA 4CU8A 5FYBA 5BXXA 1CX4A 5CA6A 4OCTA 1GLHA 1J3QA 4COZA 2E7TA 3Q9OA 2X5IA 3ZXEA 2HWF3 1NG0A 4K21A 4J1WA 4CUGA 3TBDA 4M3CE 1SPPB 1TME3 1VRH2 3KMHA 2ET7A 4QX8A 3IAPA 1OUXA 1S55A 1WMDA 1DBNA 1UIJA 3ETQA 4FTEA 1LOCA 4H3WA 4IETA 3I2JA 1D4M2 1Z0HA 4XE9A 1PO22 3SCHA 3O1OA 4QB6A 3FFZA 4YW3A 4AVAA 1DZTA 1BZWA 1AHSA 5DXDA 1J84A 3MF6A 5A3NA 3T0DA 1LB2A 4RSUA 2OPWA 1UYYA 4CDWC 3PTYA 4CEYC 1BXHA 2FDKA 1AR71 4H55A 1SLLA 1HRI1 1UAIA 4PLNA 2VAUA 1YWKA 3O5SA 2ZEXA 4HSJA 4LKSA 3WF1A 2QQOA 4BB3A 1OA4A 3KM5A 2WNUB 3NL1A 4WM7A 4Y33A 3IN9A 1Y9MA 1U0AA 2BW8A 4YZ1A 4K1YA 4BDVB 3GBGA 3OGVA 4FSJA 2TEPA 4TWTA 3OF1A 3GGLA 3DCQA 1S0EA 3O1PA 5G04L 1DGWA 1QGLA 3AYEA 4NMIA 3ZM8A 3J7MA 2MNGA 3S7IA 4ES8A 2DBIA 1TEIA 4JVAA 2XJUA 5FUIA 5JI7A 4QDRA 4AL9A 2QQNA 3D6EA 1HRV2 4FOYA 5FZ6A 2BWCA 4L11A 3N7LA 1CQ9A 1XXNA 2ZCWA 5C9AB 2E31A 1R091 4J1XA 3H8XA 3BYWA 5SV8A 2CV6A 1C8M3 5HCBA 1JZ4A 2XXZA 2PYTA 1DP0A 4QU1A 4QWNA 4RHV1 3QH6A 5BNPB 1V6OA 1W8UA 4FPCA 3VD5A 3RDIA 5A1AA 1QU0A 1EUTA 1GP4A 1V6JA 4XETA 2YY1A 3HWJA 4FFIA 5IVJA 1E57A 4QM8A 3L2YA 3LCPA 5K9YA 3ZN6B 3RNSA 1GANA 1H1IA 1RIRA 3D3AA 2GC2A 2R043 4R4XA 4OUMA 3USUA 4N53C 4YM3A 1HN0A 5F3CA 5JZGC 2F4LA 1JZ6A 1AR72 1W0PA 1ULCA 4AVSA 1HRI2 3ASIA 3IDAA 1W0OA 1NLQA 4NIAA 3AP6A 5FYIA 3VBOC 2JG9C 2WSUA 4A7KA 5F5IA 4BK4A 2IWGB 2UWAA 3WDUA 4URAA 1AJKA 1VBC3 4CCCA 4RR3B 2B5HA 2F4PA 2A6WA 2OQ6A 4DB5A 3LAGA 5E1RA 5LB6A 4Y20B 4U36A 4UFKA 5LASA 4AEKA 4BOWA 4EWEA 2BGPA 4YZ3A 4GULA 4C0HA 1JZ8A 1MQTC 5FYTA 2VXJA 1BBT3 1EV13 1W04A 2O1QA 1A8DA 2G9FA 3NQHA 2H0BA 3UNPA 2Y6KA 3K46A 2BU9A 2VY0A 3FJSA 5A7WA 1ENSA 1AYN1 2P5BA 3DYPA 4RQPC 1EYBA 1QQP3 3Q8BA 3VKOA 2VBDA 3WSOA 2RDNA 2VZTA 3AM2A 3HNBM 2HWB1 3BODA 4B4QA 3AVSA 3WF4A 4MVTA 3BN6A 1U5ZA 1ULDA 4LJHA 4RHV2 1F5JA 5FYHA 2P34A 1BCXA 4AAXA 1H1MA 3LEKA 2DCKA 4CCDA 5DAVA 2RS51 1WCSA 4LK7A 3ACFA 1DLLA 2XL7A 1LODA 5IHRA 5H9RA 3CF6E 4ZPIA 2PN5A 4BPZA 2CL2A 2P17A 3IT8A 5DZGA 2E32A 4ZONA 3WCSA 3ZSLA 2D6KA 3VBFA 3TAYA 4K40A 3KV6A 1AYM1 2J1AA 5AVAA 4ES9A 4BQXA 3LA2A 2J1RA 4B3NA 2XLAA 3WOGA 4CE8A 5FK7A 2OS2A 3MDPA 1ZYBA 2ES3A 2XHNA 4P9YA 5KXCA 1UKGA 3R4SA 4XPVA 1RUF1 3NAPA 4CDWB 4CEYB 2UURA 4COUA 3WCRA 1ZZ8A 2JE7A 1POQA 4XJ8A 3VDAA 1QF3A 2VU9A 5BUVA 1REEA 3AXEA 1VAVA 2YUEA 3OYWA 4DUXA 5CIRA 4XXAA 3AP7A 1TE1B 2UWBA 4GWMA 5CFCA 2QZ2A 3V56A 3V64A 4HVQA 4LBOA 1CAXA 5H9QA 2C6SA 1UW8A 4PQ9A 1AYN2 2YGLA 3NMBA 4GKXA 3KGZA 4MXWB 1Q8VA 5A7PA 1H4GA 3SHRA 3VKLA 1SHWB 1J58A 2BP6A 2HWB2 3VZLA 2XPJA 4LBQD 4AK3A 3LIGA 4CVUA 2FQPA 1Y3TA 3I4IA 2J1VA 3AMNA 4UW4A 3DPRC 1BVVA 2DFBA 1FOD3 1OBNA 3FHAA 2Q8OA 1REFA 1OKOA 2VZOA 5F37A 3EYPA 4GD4A 4IV3C 5FLJA 5L9RA 3AP4A 5FMBA 1BLZA 5AC93 2PHWA 2Y33A 2GH2A 2BEOA 4NJ4A 2FZ2A 2R30A 3JXSA 1EPZA 1MZEA 2YXSA 4UAPA 3ZYIB 5B2GB 1HIXA 4E4DX 1WD3A 4IERA 4N43A 2ADDA 2WQZC 4QQLA 4DPNA 2PAKA 3VDDC 1QIQA 5JMCA 3TOJA 1LEMA 1ZZ6A 2JE9A 2VQTA 2LM3A 1HJGA 5FXZA 3ZXFA 4KMQA 4AEJA 4DMIA 3VBSC 2VD7A 1ASJ2 1ZBE1 1FATA 1ONAA 4N53B 2W1SA 2A6XA 5JZGB 5EJ3A 2BOJA 2RG4A 2XKOA 3HN1A 4JQTA 4BJ0A 3W5MA 3POIA 1WLWA 4DEVA 3VBOB 3FHQA 2JG9B 2YBSA 2Q1ZB 2ZKLA 5DUXA 4QXKA 1RXFA 5FY0A 1T6GC 3WNMA 1CAUB 1KQRA 5BYNA 2D5FA 1RUI1 3MLKA 4J25A 4O9GA 4A45A 4AFDA 4NIGA 1H9PA 2BTVC 3RS6A 2WJSA 1GFF2 3FUQA 1RHI2 2DTYA 2J1TA 2JJ6A 3ILRA 4AHXA 1JHNA 4LK6A 1RGSA 4OZXA 4Q4X3 5FP9A 4XFAA 3O1RA 4Q27A 4XQWA 3KV5A 3CNAA 3LEIA 3SXWA 1MQTB 5HV4A 4A3XA 1SLTA 4WVZA 2EXHA 1G9CA 2WR9A 2Z42A 1COV1 4KU8A 4P9GA 1V9U2 2VQUA 5GZFA 2CSGA 1XE8A 2A73B 1PZ9A 2ARXA 1JZ3A 2OA2A 3AMPA 3I3DA 1EP0A 5CISA 2Y0OA 3ECQA 4OUEA 4RS5A 4RQPB 4XMIA 2P6HA 2O8QA 3GZAA 1NQDA 4XCBA 1REDA 2PLV2 2RMU3 5GLZA 3N36A 1NYWA 3GYDA 3SH4A 5J7MA 4X8NA 4PBOA 4LLFA 1PK6C 1YI9A 4LIUA 3KQ4B 4Y24A 1UOFA 4E2GA 4P9LA 1AX0A 4OQ9A 4EJRA 1A6CA 3RGBA 2RS13 2XVLA 4BIFA 3VBUA 3NVCA 4XJZA 1D0HA 3DL3A 2DVFA 2BDRA 1MVQA 5A3UA 5LA0A 1UZWA 4XF4A 5FRAA 1OD3A 4NOTA 3VZNA 5F7UA 1K5MC 5FZKA 5LK5A 5C3QA 3PUQA 1NUKA 4ATEA 5KBFA 4MGTA 5F3IA 4AQ6A 1WMFA 2ZHMA 2WZ8A 1LOFC 3FBYA 3SNMA 3LEMA 4AFAA 1BHGA 2WLQA 4D7YA 1AR83 1OT5A 2ZMKA 4LA2A 1W2AX 3WX5A 4E4ZA 3I59B 4KL1A 4MGSA 2W91A 4K6BA 3RQ0A 3RZLA 3THCA 3U75A 3GXUA 4GQ7A 1OH4A 3A7QA 2HWE1 3AKSA 4LBJA 2DCJA 1SFPA 1S0DA 2JDMA 3AJZA 4K20A 2H6CA 3GCXA 3RWNA 2JIGA 3VDBA 3OPTA 3EMRA 5A32B 5C3PA 5T50A 1F35A 5IVBA 1AUYA 1YFUA 1YXWA 2JDAA 4KWLA 3T09A 2D3SA 2NP0A 3H50A 2DCTA 4QKBA 1AL22 2BVBA 3BPZA 4QXCA 4BCUA 4YVWC 1AF9A 1YFXA 4MHRA 1BMV1 2ZACA 3JZVA 3R4UA 3VN4A 4JRLA 4XZPA 4CA9A 3DPRB 2XJTA 3MGUA 5BPXA 5BNQA 3VBRC 4XJ9A 1Y43B 1IG0A 3HVDA 1NY71 2ZPXA 1BEV3 2VVFA 4IV3B 4Y26A 4R4ZA 4QX0A 4G9SB 1ST8A 2GC1A 1C3HA 3OEBA 1WBLA 3AL6A 3VHNA 2CAVA 4N7IA 2X09A 2ZEYA 2ZGLA 4IEQA 1RYYA 5A3MA 5IWFA 3VDDB 4HOOA 2ZEZA 5C4WA 3THDA 3PVNA 3B9CA 1LOAA 1VMFA 4J6GA 1RUI3 1VB4A 3B9IA 3H7YA 1OLME 4LBMA 3HQXA 3VBSB 4Z8BA 3H8OA 1DQ5A 1Q8PA 4IEUA 3R0RA 3SMHA 4CZSA 4RGKA 1TVGA 1YCIA 2ZJCA 4FCAA 5FZOB 3VV1A 1HW5A 1RUH3 2Q8EA 3NKGA 1UMHA 2FBEA 4Q4Y3 4IEYA 4B1LA 1VBD3 4LE3A 1BQPA 2HWE2 1AXYA 3BI3A 1ZBA2 2WZR1 4Y22B 3WG1A 4IEPA 5HI0A 4LBQA 5I0RA 5JXJA 1OFNA 4JQRA 4XJAA 5G05L 2ENRA 5LWBA 4I30A 2CWSA 3KT7A 2JDPA 1R083 2R062 1FV3A 3CZUA 4FBFA 3VZJA 2YB7A 3AKQA 3KCCA 4IUGA 4RL7A 1W90A 3P3NA 1NCRA 4AVBA 4W6YA 3NV4A 1RUOA 3LIHA 3MW3A 1XYOA 3WT3A 3I54A 1VMJA 1RUG2 1OC1A 3BIWE 4XZUG 5FZMA 1AVBA 4CXYA 3ZIXA 3FBMA 2WT2A 4C8DA 2ZABA 1NCQC 4META 3JUUA 1IPJA 1PM4A 1DIWA 1LGBA 3OD4A 4M0NA 1G8WA 3NSTA 5A3WA 1MEC1 1OVSA 1WLCA 1PK6B 2ZX0A 1X9TA 5EYYA 4X8PA 1YI7A 2NLRA 1ENRA 4OHXA 1TMF1 1OFSA 2PHXA 5ANNA 5A7QA 4CDQC 5F9TA 4GB32 3HAGA 4Y1ZA 3SCFA 4CU6A 2E7QA 4K1ZA 2HWC3 4KH9A 4W6WA 1ND3A 1Q43A 2WNVC 1X8MA 3BOPA 2SBAA 3S0MA 4PJYA 5GKAC 5LY1A 1K5MB 3N3HA 1RUE1 4LT5A 1PIV3 1Z7S3 1B35A 4FP3A 4JKKA 3ES1A 4JAAA 2BFUS 2W08A 2WZR2 3EJKA 3I3QA 3ITQA 4LOTA 1YQ8A 3NJVA 4NAMA 4I0AA 4DUWA 2VMIA 2DVDA 4AFBA 3W59A 4C90A 3UGHA 4GJYA 3U0ZA 1YYNA 3RYRA 2XJQA 2DF7A 1X9PA 3ZFFC 3K75B 5BNNC 2R7EB 1WCUA 5FP4A 3ZSJA 4A7ZA 4EN9B 5FCCA 5FPXA 1OPOA 2HWD1 4XAAA 2FMYA 5I0DA 1OLRA 1JW6A 1MACA 2E6VA 3VBHC 3ZXAC 5AFEA 2FDGA 5LRRA 2GU9A 5FMDA 3VLBB 3JD71 2VOXA 3RZZA 4Z2AA 1W3XA 3G7DA 5A6QA 1ND2A 3OBRA 1C1FA 1FMD1 4PCRA 2W0XA 5C8CC 4YVSC 3S30A 2GALA 4N9HA 4QPYA 1QJU1 1NLRA 5DN2A 1X82A 2IC1A 2XOMA 2D6LX 1O4ZA 2X05A 3ZXJA 4YVWB 1MEC2 1XNDA 4OFGA 4RYDA 3B01A 1TMF2 3AVRA 3T08A 4ASLA 4YM0A 3VBRB 1NT0A 4G4FA 2JB8A 3GHMA 4IE0A 3QOPA 5JCTA 2WO3A 4O7XA 4CCNA 3PTRB 1ODNA 5FWEA 2TBVA 3A0NA 2GH8A 1GZWB 1F2NA 1RUE2 2QZ3A 3WF3A 1HB1A 1YIFA 4Q4V1 1RVF2 4NN0A 4DXRA 1NXD1 1D4VB 1W9YA 1BK1A 3NV3A 3N7MA 1KDKA 3ZIWA 5FY9A 2XLGA 3IKWA 3OG2A 5BNOC 1W8NA 3K3OA 2BBAA 3N4MA 2DV9A 3OPZA 1RUD2 4NROA 3ABZA 4NRMA 1GQHA 2VNOA 4Y3OA 1DGLA 2P3IA 5KHJA 1L7RA 2UYBA 1QXPA 4CEWC 2BRTA 5EIYB 4NWWA 2PHTA 2EAKA 1AXKA 2ADEA 3V0AA 2CU5A 2ARBA 3JD72 2J42A 1O5UA 1GUIA 4COVA 4GIQA 1UZZA 2VZSA 4PI0A 3VD4A 1FMD2 1I5PA 2WFF3 1X33A 4P9WA 3MIBA 4HPKA 1QJU2 3WUCA 4JRAA 4XIKA 1ZRCA 5FPLA 1QH7A 5A33A 1LHOA 1S0BA 2XL9A 4IESA 2Q8CA 2AR6A 2WNEA 3PUAA 1W6PA 4TLFA 5FO9B 1S0CA 3TNPB 5CKQA 3WDVA 2MHFA 1LCLA 1A8MA 5CVRA 3RVHA 4M3CB 3ZFGC 4HETA 1VBE3 2OKXA 3MV01 2HBUA 1MZ6A 4PDWA 4EWAA 5FYUA 1V0AA 2AREA 1UZVA 2QCSB 2ZMNA 1FPN1 4OHZA 2C26A 1NCQB 1MS3A 4R9DA 1KS5A 1MZ5A 2IXHA 3WXPA 4BMEA 2YBPA 3K51A 1PZ7A 1N3PA 2VM9A 4M4PA 1QH6A 5F3EA 3S5QA 2Y6LA 1HQNA 2ZGKA 4L97A 4QPGA 5ANQA 5T52A 4CDQB 2ETEA 2ET1A 4AI3A 1UMZA 2VULA 5ABJC 1RUC3 4OMCA 4TSVA 1JZ2A 3CQOA 4JHZA 4ITCA 2WNVB 4DXSA 2R32A 3IDCB 4MADA 4QDQA 2FMDA 2KR2A 3H42B 3CZJA 3ME2A 5C8WA 1MS1A 2G9GA 1VALA 3POBA 4E4SA 1LKNA 1EAH3 3KV4A 5EQUA 3ZYPA 2PAMA 3AP5A 1SACA 2XVKA 1YQ5A 4YLZA 2D3PA 2Y8KA 4FXKB 4YGBA 1RJ7A 2L9LA 1BJQA 1U12A 3POSA 5FY8A 2JKBA 2VZQA 3ATGA 3K4DA 2WFPA 1O59A 3TEZA 1RL3A 2JKXA 3MFAA 3HR9A 3ZFFB 1R1A3 1NAEA 1QKQA 5BNNB 2P3YA 5JOWA 1H0BA 5FPZA 2CYFA 3M3OA 3MPPG 2WS91 3VBHB 3ZXLA 4B8EA 3ZYHA 1UL9A 1W6MA 2D98A 4UFLA 5IK5A 3DF0A 4V1PA 2OPKA 3WD5A 4AHWA 5FZ4A 2AENA 2WQ4A 2VUAA 4ISQA 3FX3A 1PHMA 1SDDB 5C8CB 4YVSB 4XHBA 4C1XA 2VBBA 3I2HA 3PHMA 4OHYA 3ETPA 2E53A 2Y6JA 3BOWA 5D8AC 1C5IA 5J98B 2BPA2 5EJ1B 5FZFA 4D7TA 4I3PA 2ID4A 5F6KA 4BHPA 4MGQA 2TNFA 5J09A 4BXSV 4YG3A 2DVAA 5DMYA 4HSLA 5T5LA 3USSA 4TYSA 1K3IA 2ZHNA 2XGXA 2VUDA 1OD5A 3WNOA 4EN8B 2A5ZA 4Y1VA 3WW2A 4ATFA 4IXLA 1W6NA 3LPFA 4UFIA 1VBA3 2IXCA 4OHVA 3RJRA 1GOFA 1D4M1 1BVP1 1NX9A 1PO21 2IXIA 2YYOA 2MEV1 4E8CA 3T0BA 3CEWA 3ZYGA 4KWKA 2YFZA 4BZ4A 1LGNA 1WA6X 1UU6A 4KBBA 1DZQA 1SQ4A 4C1WA 5IVVA 3OOXA 3WW3A 4D6QA 1W8HA 2A6YA 1SCSA 4XOGA 3OBZA 5C5UA 3FZ3A 4OULA 5BNOB 3OPWA 1APNA 3S57A 4OUSA 4QPWA 4QX2A 5JXGA 1K5JA 3LQCA 4NO4A 5JR7B 1TME2 1UKRA 2LS6A 5HCHA 4IE4A 3WW4A 4TN7A 1DYOA 3FL7A 5F5CA 5A3OA 4CEWB 2XHKA 4ZS2A 3LKJA 1N1YA 1J83A 3WQBA 1G86A 2LRPA 2WNOA 1US3A 5FJHA 1HJFA 3R05A 1NKGA 1W9SA 2IUWA 2VG9A 3WP6A 3E1F1 5CB7A 5FPUA 5EYXA 2V5DA 1VJ2A 1ZZ9A 1IS5A 4IGOA 3FN9A 3MI8A 1O4YA 2GC3A 4COWA 1XNKA 4MG2A 4CTEA 5K7PA 5F39A 4DXTA 1YJKA 3AJYA 3H8UA 2GSYA 1O3SA 1JYCA 1JU4A 1NZCA 1HRV1 2A7AA 3M3CA 3NJXA 4UT5A 5FREA 5FYMA 3M70A 2B9VA 2VPVA 3U11A 2W1WA 3WVJA 4RD7A 4DS0A 3A23A 1GZTA 4HG6B 5HCAA 1L7LA 3LFIA 2VMCA 4M3CF 2WLPA 2ZS6B 3JB8A 4HMZA 1Y4WA 2YGMA 3ZFGB 4PIXA 2RDSA 5KR7A 1S0FA 1NA1C 2R072 2B8MA 1UNBA 1XNCA 1K45A 3I3BA 4CRQA 4L99A 5JSPA 1DLCA 3O12A 5CFDC 1KJRA 2MEV2 4GALA 3ZYRA 5C7GA 1GNZA 4M4RA 1QOOA 5DZFA 3CJXA 3Q8FA 4QB1A 1WWYA 4FPKA 4YGDA 2GAUA 1QJEA 5ABJB 1JHJA 2QQPA 4FXGB 4TZDA 4OHWA 2YV8A 1WCQA 1KEXA 2AEZA 2R49A 3HIFA 5L7OA 5FZ7A 5CZKA 1WBFA 5KXEA 4XUPA 2A3XA 4XQ4A 2AACA 2VTXJ 3LA3A 2XWJB 4QHBA 4R9BA 4TLGA 4GMP0 3SKVA 1WLDA 3GBFA 3V65A 3ZLIA 4AI0A 4W50A 3TRSB 1ULOA 2XQRA 1OF4A 1W9WA 3C8XA 2E7AA 3F2ZA 2C9AA 3NAPB 2A70A 2JXAA 5FZLA 4A41A 1F8VA 3KS7A 1V6NA 3LGRA 3LFMA 4HVOA 3VUOA 4UW6A 4XEZA 1AR63 2VXRA 1OOPC 2UY9A 5C3OA 4W8JA 5IFPA 2C0ZA 3OCPA 1W05A 2D97A 3A0KA 2DUQA 4Q2FA 3B7MA 4QX5A 5FZ0A 1WMXA 2V5YA 2JG8A 3M7AA 1DGRN 1JOBA 4FPJA 5F6LB 5FKCA 4KG0A 1VRH3 1BBT2 3WUDA 5D8AB 3GZTB 1OXCA 2D6OX 2JECA 2VW2A 2DWRA 3Q8EA 4OI0A 1HKDA 5F5AA 1YC61 1XBFA 3G6JB 3MW4A 4R8HA 1LAJA 4AEDA 2V4AA 3D0SA 1S1AA 1AXZA 3HJRA 3RFRA 1QQP2 4QKNA 4XILA 2C24A 1UOBA 2PA7A 4Q0QA 1AZDA 5DPNA 1JXNA 3D82A 4JGZC 4MZUA 4TTGA 2D43A 3E5XA 2Y64A 4R9CA 5CU1A 2ZX3A 3FLTA 1A3KA 2RR13 3MIDA 4XACA 5FZ1A 4X6RB 1UPIA 4BQ5A 2A75A 2BNMA 1JU3A 3MIGA 2ZHKA 5FQ0A 1QJFA 1Y7BA 1L3JA 3EQEA 4XBNA 1JYTA 4A4AA 1IQAA 3D8CA 1W39A 3I2DA 4QGNA 2B45X 3WEZA 3ZYFA 2D3RA 3W9AA 5L73A 2RJKA 2B42B 3KQRA 1CAVA 4Y5SA 3RZKA 1ZVFA 2VW1A 3RI9A 3JBG3 3QLQA 3DYMA 3RYPA 3JQWA 2QQVA 3WDWA 1POV1 4D3WA 4FQ4A 3ZVXA 4LUKA 1V70A 4UBGA 4I0BA 4BQYA 3O1UA 3ZSMA 3DXUA 3H1MA 4OI1A 2D5HA 4IV1A 4P14A 2Q5TA 3UK9A 3WLUA 2A71A 4FI9A 4YZ2A 3TN92 1O3RA 3AKTA 1F9KA 2QQKA 3HQRA 3VD3A 5A1FA 2G9ZA 2YPJA 4QXHA 2G19A 5JPMB 4YGEA 4C0BA 2ARAA 4LA3A 4MSVA 3WNPA 3CLPA 2RM21 4QPIC 1DQ0A 1IG3A 2EAAA 2EIGA 3DECA 3JU9A 2BFUL 5LY2A 3BTZA 1MPXA 3A21A 1AR73 1HRI3 3I49A 1NA1B 1SPPA 4XAEA 2VO5A 3VL9A 3I2OA 1HB2A 1OSGA 2RJLA 4Q0SA 3BTYA 2G4IA 2FHRA 4OI4A 1W03A 5CFDB 3D4KA 3KGLA 1R1ZA 2W2IA 1TZOA 1FOD2 4JZRA 4A44A 1ASJ1 3INAA 2V72A 4DY5A 1GKBA 3K48A 2JDNA 3P1IA 4HLTA 2ORZA 5AFBA 2R0HA 2J1EA 3BALA 4I0WB 3HNYM 4SLIA 1O91A 3POWA 4H14A 4YFWA 3PUIA 4XJWA 1LOGA 2F6BA 4MGKE 5DABA 1D7PM 1GP6A 5CYYA 1JOPA 2WDBA 4LUMA 3RYKA 1N1VA 1RHI1 3I2FA 1QNYA 5IAXA 2VTFA 2WRAA 1R093 3WR0A 2WWJA 3OB8A 4XFCA 4SBVA 4N90A 2PHDA 3MV11 2VTXA 4JV4A 4BXFA 2R0FA 3OGJA 4KG8A 2VVDA 1V9U1 4RHV3 3OY8A 1CN1A 1OOPB 1AR91 3O14A 4XDQA 1CAWB 2WAAA 3ZFEC 5C9AA 3W5NA 3DEMA 2JDKA 2RM22 1E5HA 1OQEA 2DURA 3FWEA 1GZ9A 4NAOA 1YIPA 2OXBA 2PLV1 1Q5OA 4S2FA 4D0QA 2N7GA 3EB7A 3RSJA 2AZ5A 2YROA 5E6HA 2HEWF 2QJVA 2J1UA 4MV2A 1HQLA 3HEIA 4D7SA 5BNPA 3ZDSA 1QMJA 4JX0A 4GH4C 4LO4B 3HNMA 1PO11 3U10A 3ZN6A 1H8TC 4UFHA 5CNAA 5HV0A 4I02A 3PVBB 4PLOA 4FQZA 4LOSA 1W6QA 4JGZB 3H3UA 4PLMA 1N3OA 1LU2A 2NMOA 1FV2A 3QH7A 4AHZA 3H8RA 2LTNA 2QQIA 4JGYC 3GDBA 5EV7A 4RR3A 2AH2A 2HBTA 2JEMA 2QFEA 2VMEA 1W99A 2RS12 3ALQA 4Y20A 2VMFA 5FZIA 3WG2A 3MIHA 1AYN3 1PMIA 2JE8A 4CDUC 5JOYA 4MOAA 3ZR5A 2BZDA 1OMIA 4QQOA 3WQ1A 4GA9A 2HWB3 3JCIA 1W8OA 4IW3A 4WVMA 3E6DA 4XMAA 3ROUA 3O7OA 1AR92 4KWUA 2JIJA 2ZHLA 3FUOA 3GJAA 2CAUA 2E9QA 2RJ2A 3OGGA 2ORXA 1BKZA 2RS53 4LPLA 2ZTNA 5FYZA 4PT6A 3WP4A 3PJQA 4QB2A 4AYUA 3RI8A 3I3EA 1AL21 4D69A 2GMEA 2Z79A 1JOJA 4P5YA 2ZGRA 1U5IA 3MICA 3TNQA 3WQ0A 1CD3G 3IB3A 1AYM3 4WZFA 1WZXA 4Y5Z0 5FPVA 3T4HB 2CDPA 4DQAA 4GKYA 3LDKA 4ASKA 2GZWA 1GMMA 4YG0A 1PO12 1RXGA 4KBZA 4BQ2A 5M0TA 4QPIB 1WCKA 4Y5TA 5EP9A 1LOBA 5LEJA 3IPVB 2VOVA 1RUF3 1D2QA 1PGW2 4CCOA 5T3NA 3ILNA 4OZOA 1W28A 2X10A 3GHNA 5K0UC 2ZXQA 3VD7A 1CJDA 1JH5A 2PELA 1I3HA 2VZ1A 3O0VA 5C3SA 5JIAA 1L7QA 3U78A 3ZMNA 4EYUA 2RVAA 1BK0A 1RHI3 4X6QB 4XDPA 3VHPA 5FXXA 4CDWA 1UWWA 1IPKA 3C7OA 4CEYA 4GXLA 3SC7X 4CPBD 1I5ZA 1HX6A 3APBA 4HVRA 1ZBA1 2B7YA 2O0OA 3V0BB 1WKYA 1W8WA 4U2AA 3J4UH 1VAKA 2BVVA 1AX1A 3WNLA 2R061 3AXDA 3WF2A 4HONA 2MPFA 2WSVA 3O0WA 1JS9A 3GALA 2YBKA 1CIWA 1GYKA 4MXWA 3MUY1 4NR1A 3R6SA 1PZ8A 3AKRA 4DRRA 3LSDA 3IWZA 3RZGA 3ILFA 4NHKA 5C71A 2WBKA 4UOJA 5A7OA 4B7EA 1W8TA 4E2SA 1Z78A 1B09A 2GMPA 3N9QA 4S2DA 5FY7A 1UN1A 4AAPA 2AGSA 4CP0A 3POGA 2PQQA 3ZSEA 1RUG1 2XKPA 1ZRDA 3ZFEB 2WN3A 4CU9A 3KF5A 5I8TA 2RDQA 2ZGPA 2VMGA 3J8F1 3LZZA 3N35A 5IVFA 5IUQA 2YFUA 1HN1A 1ZBE3 1QWRA 2EICA 3E6BA 2EXJA 1HXS1 3IZOA 1PGL2 1O8SA 3BTAA 1DCSA 1QJX1 1TQ5A 2I45A 3L2HA 1CZVA 4GB31 2C1FA 3OTFA 1OURA 4FPEA 4DXZA 4GH4B 5CAZA 3MFCA 2DTWA 2DU0A 1H8TB 1VLNA 5DAPA 2VNVA 3ZXGA 4ARXA 5LW9A 1O5LA 1ZA4A 2PAEA 4N53A 5JZGA 3CIHA 4P9JA 5FR3A 4AI8A 1JYXA 4QHZA 4YNIA 5B4NA 5GZGA 3VBOA 2YC2A 2JG9A 4AHYA 4XBQA 1CAUA 4JGYB 3QD6A 1COV3 4XF1A 5ACA1 1E5SA 1DGWX 3WNKA 3MHZA 3PVOA 5JIUA 2PXJA 4WM8C 4UFJA 4Z07A 4NIIA 4ZHNA 4XQDA 2HWC2 1H8VA 3AC0A 5F1RA 2QDNA 4AI1A 4CDUB 2XDVA 1W2TA 1YQCA 2P2KA 3Q8AA 1MQTA 1VAMA 4MUVA 2HLEA 2P1BA 1F31A 2DCZA 3OUIA 1PIV2 4XW3A 1Z7S2 4CDXC 2XLFA 4AVCA 3L9JT 2D6PA 3MLJA 5C5TA 1VP6A 2NQYA 1IS4A 2ZGQA 4LQRA 5A7NA 3UL2A 1RINA 3J8F2 3ORJA 4RQPA 2FDHA 1HXS2 1DQ6A 3POEA 1QJX2 5A6YA 1WUVA 2XUMA 1O8PA 5LBBA 3EO6A 5D1IA 1JI6A 3WHTA 3WG4A 4FVVA 2WA3A 1OI6A 2YC4A 2X5IC 3T1MA 1LECA 1GQGA 4JKMA 3SLIA 4S2GA 1RC6A 4LEJA 3NNGA 3O1MA 4Q8LA 4E8DA 4Y1XA 1G9DA 3TEXA 1F15A 3S7EA 1DF0A 4ORFA 5K0UB 1K42A 4MXVA 1RVF1 1H2MA 2OZ6A 4HN1A 3OSDA 1LTEA 5ACA2 5CG8A 2HWE3 1ZBA3 2W39A 1SLIA 3M3QA 3ON7A 1RMU2 2E63A 4ONUA 1RUD1 3WDXA 1W2OA 2VCMA 4UYBA 2ZEWA 5H9SA 5A80A 1ZZ7A 2ZGSA 1CESA 3HBKA 1LENA 5FBJA 5FUNA 5FZ9A 5GZEA 4EZ4A 4WM7C 3LDBA 1RUJ1 1ZX5A 3HOBA 1X50A 4AGRA 4NHLA 3FLRA 2X53S 1UYXA 1PVC1 4CP9B 4DRVA 3HPNA 1N47A 3NV1A 5GLVA 4N7UA 2I07B 2YDEA 4XFIA 2DYCA 4QDSA 2AC1A 5A32A 3ZN5A 4CCMA 3IIAA 1RITA 1NE4A 2VE1A 2PTMA 3NRUA 2KM2A 1CVNA 2A3YA 2LROA 4IQPA 4F3JA 5J36A 2O14A 4K8RB 5GALA 2XQXA 4EZHA 4WVVA 5L9BA 3WW1A 5CEHA 4AFMA 3RRDA 4RFRB 3DPRA 3OD0A 4L8QA 1VRBA 1TNFA 4HKOA 4GB33 1NE6A 3PVEA 4LKFA 1IOAA 1VMHA 4FPGA 1CX1A 4B1MA 4IV3A 1SEFA 5T54A 1V6IA 4Q4W1 4PIYA 3SH3A 3D0JA 3ZPYA 2BQPA 1GQPA 5GLWA 3RG0A 1WW4A 4QGMA 3THTA 3C3VA 3BGAA 2GN3A 4IGPA 5FP7A 1KGYA 3VDDA 4CPBA 1YRZA 4YFZA 1UY3A 2WZR3 3HN3A 4QKDA 5EPAA 4AEDC 3M3IA 3VBSA 1E5IA 1OKQA 4FTSA 5JOZA 1OF3A 3R4DB 1VR3A 1WMEA 1ZRRA 1SZBA 5GLUA 2QNKA 5FZOA 1H4HA 1UZYA 3DKWA 1RUJ2 2C9KA 4Q0PA 4Q26A 5EXOA 1RUNA 1GOGA 4FPLA 1PVC2 2BGCA 1PX4A 3OGSA 1QJY1 2WT1A 2TUNA 3FHIB 4WM8B 3UJOA 5T5JA 4KGGA 4FFHA 5FYSA 1DGRA 1XC6A 2WT0A 1ODMA 2IVIB 2VUJA 4BA6A 4LBNA 3S6PA 3IMMA 4CCEA 4HFSA 1J1LA 3AYDA 3HMYA 4CDXB 2GC0A 5IK8A 1MEC3 1Q3EA 1UXXX 1UQXA 4ZZ8A 1TMF3 4FOQA 3OBTA 4QHOA 1NQJA 1RTVA 2VCAA 1ZRFA 1W9TA 3HBZA 5FZGA 4D6RA 4AGGA 5CKMA 3NJYA 1BYHA 5FY5A 2IFWA 2WO7A 1Q56A 4Q4W2 1R1A2 2ZGNA 4CXWA 3NNLA 1ZZBA 3B94A 2UYAA 3CKHA 3DUIA 4FPHA 4XYXA 1RUE3 2FZ1A 3LSEA 3POFA 1TNRA 1UXZA 4HKLA 1W9FA 3DKQA 2W87A 4I2OA 2ZBJA 4D94A 2X5IB 4QAWA 3HT1A 3WZ1A 4ZZ5A 3AYCA 3VBFC 5DUVA 4N8MA 4FAGA 4YW4A 4JC1A 4WVWA 1K5MA 2XBO1 4FOVA 2WO2A 3UT0A 4IE5A 5ISLA 1XSRA 2HWD3 1H6YA 3N7KA 3CBNA 5FJKA 1CWPA 4HANA 1LOFA 4OLLA 2ZA9A 1IQDC 3JD73 3NAPC 1QJY2 1XSQA 2HWF1 2P37A 3WNXA 1VBB2 1XQNA 5LRSA 4CCJA 2JB4A 4G3YC 1KFUL 1FMD3 1QOSA 5LZ6A 5FYCA 2WZPP 1TME1 1GU3A 2W3JA 1QJU3 1W6OA 3JB4C 3BKZA 2B4KA 1LHVA 3GCWA 5LA2A 4WM7B 5CFCC 3ZDVA 5KWRA 1FX5A 3FMGA 3PLQA 3PNAA 5CADA 2RS32 5I8YA 1OVPA 2VOKA 3FFQA 4V2WA 3T2TA 3WY6A 3UV9A 2XJPA 3IMNA 1XRUA 2G1MA 4O61A 4A6SA 5LBEA 4H7MA 1LRHA 1XJAA 2JDUA 3DYOA 4Y1UA 4IL7A 5DDJ2 3SITA 5FZ3A 1Q8QA 1YHFA 1X8EA 1PGSA 3B02A 4K3UA 3T2OA 4LKEA 2K9ZA 1SLCA 2VNRA 1JZ7A 3DXTA 1QEXA 2EIBA 2ZX2A 1ZNPA 4YVWA 1SBFA 3UJQA 1XU2A 4AWDA 3A4UA 3UKTA 2XJRA 2VZUA 3VZMA 3P5BA 4B7KA 5I91A 1ULGA 4Q4V3 3WHUA 2WN2A 5KC5A 3VBRA 4DEQA 4DZGA 1A34A 5FMOS 4ZKTB 5DZEA 2R071 3CMGA 4XUNA 2VNGA 2VW0A 5CKNA 4N43C 5FV3A 4PF5A 2EA7A 1CONA 2XBO2 1U5XA 4MGYE 2VH9A 3I2IA 1GZWA 2R1BA 4LIVA 3VB9A 3T3YA 4Y4RA 4BK5A 1RJ8A 2RE9A 5F5QA 4CUAA 2NZ9A 3T30A 3UETA 1T6BX 4NHXA 1G7YA 1C8M1 4YW7A 4AEDB 2HWF2 5L9VA 3USUB 2JDHA 3CHXA 5IK4A 3WF0A 1WA4A 1JTZX 3AZWA 3C7EA 4IEZA 1UX7A 2DUOA 4YWAA 1ACCA 1S2KA 2E26A 1UD1A 1LR5A 2O8OA 1IKQA 1C28A 2XWBB 3PMSA 1S0JA 2FDIA 5HPOA 3E6CC 5HBAA 5HCFA 1JYIA 1J3PA 3M2MA 1SLAA 3MF9A 2R041 1ZREA 2ZZQA 1OA2A 2GNTA 5FYVA 1C57A 1VIWB 2A3WA 2NPIA 3KZ4C 4N9IA 2A1XA 4FTBA 3RMYA 2PHUA 3ZX7A 1H2KA 1YEWA 1ZA7A 3RJ2X 3VKMA 1FPN3 1KJLA 2CY6A 3HD8B 1SLBA 2VZ3A 3KT1A 1DYPA 4MYEA 2ZKNA 5A7WB 4RN5A 4RS5C 2V73A 5FXVA 2VR4A 4K8FA 4M3CA 5SV5A 2E33A 3PUHA 1UY2A 1JMUB 1OHFA 1BBT1 1EV11 4AG4A 3B5LB 4Q1RA 4B4RA 4FPFA 5C33A 2ARCA 1IS3A 1AR62 3H1YA 4GZ9A 5E8AA 4HK9A 1JN2P 2B39A 2EALA 3GBWA 3VBUC 2GNBA 3H1WA 1QQP1 2DDUA 4CDQA 4CP1A 1VE0A 3LPGA 1C8M2 3C2UA 1N1SA 4K9SA 2A6ZA 3VBFB 3AL5A 2WNVA 1XE7A 4AQSA 1PMHX 2FCUA 2QQJA 4LBLA 1IPSA 5H9PA 1QNWA 4PBPA 3KHBA 5FAXA 1NOVA 1OLQA 4IGQA 4XF3A 3VZOA 2Y26A 4XABA 4FT8A 3KLSA 1SFNA 3W58A 2X29A 1FXZA 2OUHA 2WS93 2XUEA 3POYA 2R042 4FP2A 4AQ2A 1JYWA 4Z92B 2WAOA 3N9MA 1YQ6A 1IS6A 3WQ7A 2IXJA 5FOBB 3LOIA 3ZFFA 1CPNA 3NKTA 5BNNA 3OYWB 4BQWA 1VBC2 2RR12 5CFCB 4NE9A 5FDBA 1M06G 4Q0UA 1GSLA 1XNBA 1CAXB 4AOCA 2P3KA 2WC2A 3VBHA 3VKNA 4MX3A 4V2VA 3N9PA 1C1LA 2W9XA 4QT6A 2BUKA 1DQ4A 2ERFA 3UKNA 3IDEA 3RZJA 3TN91 5C8CA 4YVSA 2BERA 4PHZA 4XBLA 1EV12 2X8KA 1KXGA 2R073 5A3LA 5D21A 1V6MA 1IZ3A 3OY8B 1UYPA 1D4M3 3JBG2 2VOWA 1PO23 4PIZA 1S0IA 2MEV3 3LE0A 1UYZA 2BBVA 1WW5A 3NNFA 2WUHA 1YQ2A 3X29B 4A42A 2OVUA 3KCXA 2VZPA 3O1SA 1GNHA 4GJZA 1A78A 1UY4A 1W2NA 2FCTA 4GAZA 4LO7A 4N43B 1UY1A 3B00A 5C4WC 3H3ZA 4WV8A 3UKVA 2UU8A 1FOD1 3PDQA 4P02B 5EHDA 2QKDA 3LF7A 4BM8A 4LKDA 2VCBA 4I3GA 4AXOA 3KT4A 3CJIA 5AC91 4UF0A 1G9FA 4F8AA 5BNOA 1O3TA 4ISRA 3B93A 1DYKA 3VL8A 1W6QB 3AFKA 4UW5A 3AP9A 1LU1A 1CZTA 1SMVA 1HRV3 3K4AA 4LLOA 4CEWA 2CGOA 2I74A 2XMLA 3T2PA 1LEDA 1XNTA 3ACIA 4XXPA 2AUYA 2VMHA 4UXAA 4KI5M 2CNAA 4Y4YA 3RPQA 3K2OA 4M01A 1SDWA 3N7JA 1J3RA 3AK0A 3AMHA 2JDYA 1H2LA 1SBEA 3PIGA 2D44A 4QKFA 5EZWA 1NCRC
chains in the Genus database with same CATH topology
5FUPA 5FXVA 5IVJA 2WWUA 5FYYA 5FZBA 5K4LA 2GP5A 3U78A 4EYUA 3UYJA 5FZLA 4XDPA 5FXXA 5FZAA 5FPBA 5F3CA 4E4HA 5FZ4A 5FZDA 5IVEA 2YPDA 5FXZA 5FYIA 2WWJA 4XDOA 5F5IA 3AL6A 4URAA 3AVRA 2VD7A 4UF0B 5ISLA 2OQ6A 5A80A 4BXFA 4DIQA 5FWJA 5IWFA 4HOOA 3AL5A 5FBJA 5FJKA 5FUNA 5FZ0A 5FZ9A 5FZFA 5IW0A 3LDBA 4CCNA 4EZ4A 4HONA 3PTRB 2YBSA 5FWEA 2GP3A 3PU8A 2YBKA 5FY0A 4CCJA 5F2WA 3N9LA 5FPAA 4IGQA 5FYTA 5FYCA 5FZOB 5A7SA 5FY4A 5FZHA 5A7OA 2Q8EA 2XUEA 3KVBA 2Q8DA 5FY7A 3N9QA 5F5AA 4AAPA 3N9OA 3N9MA 4CCMA 4D6SA 2YU2A 5FP9A 5FY9A 3K3OA 5E6HA 4LXLA 3KV5A 5FY1A 4V2WA 5A7WA 2P5BA 3PUSA 5IVFA 4BU2A 5LWBA 4Y3OA 5IVBA 5FYBA 5IVVA 4EZHA 5CEHA 4D6QA 5FZ3A 3AVSA 3OPWA 1VRBA 5FZ1A 5FYHA 4V2VA 5FP3A 3DXTA 3N9PA 4CCKA 4NUBA 4CUGA 4TN7A 5LW9A 3PURA 5F5CA 2YU1A 3N9NA 5FXWA 4QX8A 5FJHA 2OT7A 4DO0A 5FPLA 5FZMA 5FZEA 4LIUA 4IGPA 5FP7A 5FP8A 2Q8CA 3PUAA 5A3NA 5FPUA 4IGOA 5FZCA 5FZIA 4C8DA 3KV6A 5FV3A 5F39A 4CCLA 4CSWA 5IVCA 3LD8A 2OS2A 5A3WA 3RVHA 4LIVA 5FYMA 5FZOA 4Y4RA 2PXJA 3DXUA 5FYUA 5FZKA 5A7QA 4GJZA 4Y33A 4GAZA 2OX0A 4LITA 2XDVA 3PUQA 3ZPOA 5A3PA 2YBPA 5F3IA 5FZ8A 3PDQA 5F3EA 5FYZA 5A1FA 4BISA 4QXHA 5ANQA 5LY1A 3KV9A 5F32A 3K3NA 5KR7A 5F2SA 5F3GA 5FYSA 4UF0A 5A7NA 5A1LA 5IVYA 5LY2A 5FPVA 5FZ6A 3PU3A 5FYVA 5A7PA 4GJYA 4ASKA 2XMLA 3KV4A 2W2IA 3OPTA 5FP4A 3K2OA 5FZ7A 5FZGA 2XXZA 4AI9A 4CCOA 4D6RA 3NJYA 5A3TA 4QU1A 5FY5A 4QX7A 4QWNA 2OQ7A 5FY8A 5A7WB 3U4SA 3KVAA 4QXBA 4QXCA 3ZLIA 5F37A 4GD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUP A;  5FXV A;  5IVJ A;  2WWU A;  5FYY A;  5FZB A;  5K4L A;  2GP5 A;  3U78 A;  4EYU A;  3UYJ A;  5FZL A;  4XDP A;  5FXX A;  5FZA A;  5FPB A;  5F3C A;  4E4H A;  5FZ4 A;  5FZD A;  5IVE A;  2YPD A;  5FXZ A;  5FYI A;  2WWJ A;  4XDO A;  5F5I A;  3AL6 A;  4URA A;  3AVR A;  2VD7 A;  4UF0 B;  5ISL A;  2OQ6 A;  5A80 A;  4BXF A;  4DIQ A;  5FWJ A;  5IWF A;  4HOO A;  3AL5 A;  5FBJ A;  5FJK A;  5FUN A;  5FZ0 A;  5FZ9 A;  5FZF A;  5IW0 A;  3LDB A;  4CCN A;  4EZ4 A;  4HON A;  3PTR B;  2YBS A;  5FWE A;  2GP3 A;  3PU8 A;  2YBK A;  5FY0 A;  4CCJ A;  5F2W A;  3N9L A;  5FPA A;  4IGQ A;  5FYT A;  5FYC A;  5FZO B;  5A7S A;  5FY4 A;  5FZH A;  5A7O A;  2Q8E A;  2XUE A;  3KVB A;  2Q8D A;  5FY7 A;  3N9Q A;  5F5A A;  4AAP A;  3N9O A;  3N9M A;  4CCM A;  4D6S A;  2YU2 A;  5FP9 A;  5FY9 A;  3K3O A;  5E6H A;  4LXL A;  3KV5 A;  5FY1 A;  4V2W A;  5A7W A;  2P5B A;  3PUS A;  5IVF A;  4BU2 A;  5LWB A;  4Y3O A;  5IVB A;  5FYB A;  5IVV A;  4EZH A;  5CEH A;  4D6Q A;  5FZ3 A;  3AVS A;  3OPW A;  1VRB A;  5FZ1 A;  5FYH A;  4V2V A;  5FP3 A;  3DXT A;  3N9P A;  4CCK A;  4NUB A;  4CUG A;  4TN7 A;  5LW9 A;  3PUR A;  5F5C A;  2YU1 A;  3N9N A;  5FXW A;  4QX8 A;  5FJH A;  2OT7 A;  4DO0 A;  5FPL A;  5FZM A;  5FZE A;  4LIU A;  4IGP A;  5FP7 A;  5FP8 A;  2Q8C A;  3PUA A;  5A3N A;  5FPU A;  4IGO A;  5FZC A;  5FZI A;  4C8D A;  3KV6 A;  5FV3 A;  5F39 A;  4CCL A;  4CSW A;  5IVC A;  3LD8 A;  2OS2 A;  5A3W A;  3RVH A;  4LIV A;  5FYM A;  5FZO A;  4Y4R A;  2PXJ A;  3DXU A;  5FYU A;  5FZK A;  5A7Q A;  4GJZ A;  4Y33 A;  4GAZ A;  2OX0 A;  4LIT A;  2XDV A;  3PUQ A;  3ZPO A;  5A3P A;  2YBP A;  5F3I A;  5FZ8 A;  3PDQ A;  5F3E A;  5FYZ A;  5A1F A;  4BIS A;  4QXH A;  5ANQ A;  5LY1 A;  3KV9 A;  5F32 A;  3K3N A;  5KR7 A;  5F2S A;  5F3G A;  5FYS A;  4UF0 A;  5A7N A;  5A1L A;  5IVY A;  5LY2 A;  5FPV A;  5FZ6 A;  3PU3 A;  5FYV A;  5A7P A;  4GJY A;  4ASK A;  2XML A;  3KV4 A;  2W2I A;  3OPT A;  5FP4 A;  3K2O A;  5FZ7 A;  5FZG A;  2XXZ A;  4AI9 A;  4CCO A;  4D6R A;  3NJY A;  5A3T A;  4QU1 A;  5FY5 A;  4QX7 A;  4QWN A;  2OQ7 A;  5FY8 A;  5A7W B;  3U4S A;  3KVA A;  4QXB A;  4QXC A;  3ZLI A;  5F37 A;  4GD4 A; 
#chains in the Genus database with same CATH topology
 4AVV A;  1HV0 A;  4WVM B;  5FZB A;  1ULP A;  2JX9 A;  4JTO A;  5D2A A;  1URX A;  1UPS A;  4XC9 A;  5I8S A;  2QVS B;  3AB0 A;  2JIC A;  3U4X A;  1H6X A;  5JI9 A;  1IHM A;  3C7G A;  2V09 A;  4Q4X 1;  4RS5 B;  3THP A;  1KIT A;  1V6L A;  4XFF A;  1R09 2;  1GOH A;  4AZZ A;  2H0V A;  3ZFG A;  2BWA A;  4IE7 A;  4A3Z A;  4LNV A;  2JD9 A;  2VQA A;  1TG7 A;  2QE3 A;  3AZX A;  5E89 A;  1NXM A;  5KXB A;  3M1H A;  3AFG A;  4ERO A;  4HL0 A;  4L92 A;  1HB3 A;  4AI2 A;  2I2S A;  2GP3 A;  4CU7 A;  3VBU B;  4ARY A;  1ND3 C;  4BMB A;  2EF6 A;  3SKJ E;  2NM1 A;  3N9L A;  5AC9 2;  5ABJ A;  2C5D A;  1X7N A;  3ZYB A;  2RMU 1;  2EIE A;  5DQ0 A;  5A7S A;  3ZR6 A;  1N1T A;  3H3L A;  2YG0 A;  1PM7 A;  2Q8D A;  1LOE A;  1YUD A;  1PVX A;  2C4X A;  2QDR A;  4QMA A;  2GNM A;  4XTP A;  2XB6 C;  1B35 C;  1FNY A;  2LUW A;  2WNU A;  4OYU A;  4YGC A;  4BH9 A;  3NW4 A;  4S2H A;  3AKP A;  1UMI A;  3WDT A;  1QDC A;  1S2E A;  1JYV A;  2RS1 1;  4HK8 A;  4QGL A;  3PUS A;  3TYJ A;  4BU2 A;  4YM2 A;  2YC0 A;  1GNY A;  3P6B A;  4ZXE A;  5L19 A;  3T1L A;  3ZKU A;  3POJ A;  1I6X A;  3PME A;  3QBQ A;  4LBK A;  4ET7 A;  1ENX A;  1JUI A;  5FP3 A;  2WO1 A;  1AL0 G;  3NNJ A;  3TN9 3;  5DG1 A;  1C4R A;  1ZM1 A;  2KD7 A;  1OUS A;  1O7F A;  4HT1 T;  1ND2 C;  1PNG A;  1SG3 A;  1O6U A;  4DO0 A;  1OQD A;  1Q8S A;  3AYA A;  1AR8 1;  4Q4X 2;  5FZE A;  4AFC A;  5LBF A;  4YW2 A;  3GZU C;  2E51 A;  5LA1 A;  2XR4 A;  4XF0 A;  4LO5 B;  4YSF A;  2W68 A;  2YMZ A;  2EXK A;  4QX3 A;  1J59 A;  4BQ4 A;  1LHW A;  2HYX A;  5D8A A;  4QX1 A;  4EV0 A;  5FO8 B;  5T5P A;  4A7Y A;  3VDC A;  5J48 A;  5KHH A;  2Q1M A;  2WYF A;  4W4Z A;  2R16 A;  4LIT A;  1P8J A;  1EUU A;  5LEK A;  2RS5 2;  1UY0 A;  2W92 A;  1PGW 1;  4L9B A;  4EN7 B;  5FBZ A;  2GMM A;  2RMU 2;  3UGF A;  5JR2 A;  1QXR A;  2NYY A;  3LOB A;  5F2S A;  1S0G A;  1MS5 A;  3NO8 A;  4XF9 A;  2HH9 A;  1I9R A;  1W3V A;  1AYM 2;  1XOY A;  1YJL A;  2ZGU A;  5C4W B;  1RB8 G;  2FDF A;  4BE3 A;  2XJV A;  5LCW L;  4UI9 L;  5IJR A;  3P3P A;  1BEV 1;  4IDZ A;  1POV 3;  4XUQ A;  3KB5 A;  2Y6G A;  2Y38 A;  1J1T A;  3KWV A;  4MO3 M;  1O4T A;  1RUF 2;  4B29 A;  4EN0 A;  2QQM A;  3WDY A;  4QQ2 A;  2V4V A;  2Q4S A;  4YW1 A;  4QX7 A;  2OQ7 A;  2YZ4 A;  1XPW A;  2WL1 A;  1UO9 A;  2PHR A;  2ZAH A;  4LBQ B;  4M0H A;  4C91 A;  4DFS A;  3IM0 A;  4YZ5 A;  1UU4 A;  1JOD A;  4ZS3 A;  2XVG A;  4ZXK A;  3RWK X;  2P6C A;  1AR8 2;  2RM2 3;  2GP5 A;  3VHR A;  1NZI A;  2XG3 A;  1RUH 1;  5T55 A;  3AMM A;  5A70 A;  1YLL A;  2HKX A;  3ZO0 B;  4DY3 A;  4Q4Y 1;  5FZA A;  5I0T A;  1VBD 1;  4JDO A;  1NCR B;  4BQ1 A;  4E4H A;  4O9E A;  4UW3 A;  3TWI A;  2YPD A;  1UX6 A;  2D7F A;  2BOI A;  2HYK A;  2VGD A;  4XDO A;  3OEA A;  5BV6 A;  3VZK A;  4JTN A;  1KDM A;  3DN7 A;  2IFR A;  3BB6 A;  3BPS A;  2KA3 A;  4FO9 A;  1OPM A;  1R08 1;  1ASJ 3;  2Q0A A;  3DV8 A;  1XYN A;  4PDW C;  4BWO A;  4DIQ A;  1PGL 1;  1JZ5 A;  5IK7 A;  1LHN A;  4UBH A;  5ERL A;  5IW0 A;  5FFO C;  1Y9Q A;  4HBN A;  5JWP A;  3MBW A;  2OUJ A;  5LA9 A;  4R52 A;  1NA1 A;  5DUW A;  5FPA A;  5IT6 A;  2JD4 A;  4QPG C;  4XVH A;  5AVP A;  5FY4 A;  5FZH A;  4QQH A;  2VEC A;  3LWC A;  3MEP A;  4NHM A;  1GZC A;  5CFD A;  3SEE A;  1JUH A;  2ZGO A;  1ENQ A;  4LO6 B;  4AQT A;  5JDB A;  4FAH A;  5IAV A;  1ND3 B;  2JDZ A;  1BEV 2;  3WP3 A;  3UGG A;  2K0G A;  3MO4 A;  5GJ6 A;  2WAB A;  4F7Z A;  5IFT A;  1ZBE 2;  1V6K A;  4NHY A;  4GWN A;  4MHU A;  3J7N A;  3MW2 A;  2CTV A;  3MPB A;  2ZZJ A;  1CJP A;  1B35 B;  2BYV E;  3JQX A;  3BVC A;  2YHJ A;  5B4X A;  1V9U 3;  2K2S A;  4DUV A;  3O1T A;  4AGV A;  5BY5 A;  3CO2 A;  1RUI 2;  1AR9 3;  4XFB A;  2HWC 1;  1DQ1 A;  2GN7 A;  5J96 B;  2ZX4 A;  4IEX A;  3EBR A;  4AW7 A;  3QAC A;  1RUH 2;  2PFW A;  1YNA A;  2PLV 3;  4MGZ E;  1F4A A;  4Q4Y 2;  4Z2W A;  2W94 A;  3BIE A;  1PIV 1;  1US2 A;  1Z7S 1;  5FMO L;  1VBD 2;  3VHO A;  5FP8 A;  4EN6 B;  3H0O A;  4JCK A;  5J1X A;  4E27 A;  1GWM A;  4F83 A;  1F4H A;  1OOP A;  1COV 2;  4AF9 A;  2ZX1 A;  1LUL A;  3IBM A;  1CAW A;  5KC6 A;  1C8N A;  1ND2 B;  3URF A;  4L2N A;  3NV2 A;  4AVT A;  1R08 2;  1PO1 3;  2EVX A;  2IXK A;  1DDL A;  1POV 0;  1HLC A;  4QU2 A;  4XCA A;  3IAQ A;  3NWK A;  4E9K A;  1GR3 A;  4LO8 A;  4A6O A;  1OLM A;  3AMQ A;  5KHK A;  3H7J A;  2CGN A;  1W8F A;  1M4W A;  1UOG A;  3E5U A;  1PMJ X;  1QY4 A;  1U5Y A;  2VC9 A;  2Z2S B;  2VL4 A;  3ACG A;  3VD9 A;  2HEY F;  2W95 A;  3T0A A;  4W6X A;  5A6Z A;  3AZV A;  3QCW A;  5DG2 A;  5E88 A;  1AX2 A;  5FLI A;  5IVY A;  3LA7 A;  3LB9 A;  2ZGM A;  2J1S A;  2Y6H A;  4JGZ A;  1GWL A;  1LGC A;  2VJX A;  5GM0 A;  3U14 A;  2FDJ A;  3I7D A;  4PQQ A;  5TSW A;  3RMX A;  4XJU A;  3WV6 A;  4BQ3 A;  2PHF A;  3PL0 A;  3HT2 A;  4ZU5 A;  5EFU A;  4Q8K A;  2NMN A;  1FAY A;  1RMU 1;  2XON A;  3GF6 A;  3I3M A;  4NPR A;  1QJZ A;  5A3T A;  5DAQ A;  2EXI A;  1KRI A;  4RFT 0;  3OBA A;  3U4S A;  3OUJ A;  5I0U A;  3KVA A;  2PMW B;  2WIN B;  1O3Q A;  1Q8O A;  5FUP A;  1AL2 3;  1WCD J;  2EID A;  2R6Q A;  2WWU A;  5FYY A;  2BJS A;  4CP2 A;  2K46 A;  1XNA A;  1YO8 A;  1MS4 A;  2P4E A;  3UYJ A;  3WG3 A;  3PJY A;  5C6C A;  5KHI A;  1JYN A;  2LAL A;  4TXW A;  3V0A B;  5J37 A;  1R64 A;  5JUV A;  2PQS A;  2QUO A;  5LK7 B;  3KSC A;  2WII B;  5K8S A;  5JSR A;  3SH5 A;  2ZAA A;  4DIN B;  4HN0 A;  1QXJ A;  4HPK B;  5T5O A;  4EE2 A;  1D0G A;  2VCC A;  4RGA A;  4KWJ A;  2RHP A;  3EHK A;  1DU3 D;  3C7F A;  3C7H A;  5A33 B;  4IEW A;  1LNS A;  2F17 A;  1ALY A;  3SEP A;  3U07 A;  5FWJ A;  1W6P B;  1XE0 A;  4DOU A;  4Q29 A;  1N3Q A;  1T2X A;  5KXD A;  3B3Q E;  1MR5 A;  1G9A A;  3LEG A;  3KHC A;  1BMV 2;  5F2W A;  4I01 A;  2WFF 1;  4M00 A;  4IEV A;  1OH3 A;  4BYY A;  3III A;  4PDW B;  2NN8 A;  4QPI A;  3ZSK A;  4R9A A;  3IPV A;  1DQ2 A;  3KVB A;  1NY7 2;  3RZH A;  3M3E A;  5JXI A;  4FPY A;  1I1E A;  1QOT A;  5APA A;  5GZD A;  3IDB B;  1S4C A;  4QM9 A;  5JMO A;  4NWV A;  3T4V A;  2GDF A;  4QPG B;  1S2B A;  2ILM A;  1MS0 A;  4JDM A;  3I2K A;  2WA4 A;  2Q30 A;  1VBE 1;  2FD8 A;  1CR7 A;  1EPW A;  4ASM B;  2R06 3;  3M4F A;  4A2U A;  1KD7 A;  3I59 A;  4OQ8 A;  3D5O A;  5L7O C;  2ZML A;  4NUB A;  3J7L A;  1UIK A;  3ACH A;  4LOR A;  1GV9 A;  3NNM A;  5J3U A;  3N9N A;  4IE6 A;  5E16 A;  3U37 A;  1WW6 A;  1CIY A;  4URT A;  1DZR A;  2W1Q A;  4H7L A;  4WBB A;  3V0B A;  3Q8C A;  1RUC 1;  4XUO A;  4UFM A;  1RUG 3;  2D40 A;  2JWP A;  1HQW A;  3BU0 A;  2OW4 A;  2CHH A;  2DVB A;  5FZC A;  1JBC A;  3J8F 3;  2XJS A;  3FLP A;  3BTX A;  2H6B A;  2GND A;  1W6O B;  3CU7 A;  4WZC A;  4YG6 A;  1EY2 A;  1HXS 3;  1MS8 A;  5FK8 A;  1EAH 1;  5CBL A;  1HB4 A;  4LHS A;  1QJX 3;  5JVV A;  3H9A A;  5F8P A;  2DFC A;  3K4Z A;  4LHL A;  2VVE A;  5EWS A;  1W6M B;  4CUB A;  5A3P A;  2D6M A;  5FTT C;  3ZFE A;  1G9B A;  3CDZ B;  2XH6 A;  1H30 A;  3EXU A;  4LTA A;  5FZ8 A;  2WFF 2;  2J7M A;  1GIC A;  5KHG A;  4BIS A;  3KV9 A;  2WQ8 A;  2JG8 C;  4H2A A;  4QQP A;  4EQV A;  1R1A 1;  1ZZC A;  2OZJ A;  5HXM A;  5JAX A;  5F3G A;  5FIX A;  2QQL A;  5EJZ B;  2PHL A;  4PF1 A;  1W2U A;  4LR4 A;  3AX4 A;  3WP5 A;  4NVP A;  2VZV A;  5IAT A;  5ACA 3;  2DVG A;  4QD2 A;  2Y34 A;  1SBD A;  2FCV A;  4E2Q A;  4GH4 A;  2Z5W A;  3E97 A;  1VBE 2;  4YW6 A;  2AEY A;  1RMU 3;  3BU7 A;  4KNC A;  1H8T A;  1E5R A;  3ZKY A;  4UWD A;  5A6X A;  4GMP 1;  4P08 A;  3PIJ A;  1H2N A;  1W6N B;  1IKP A;  3F95 A;  3J7H A;  4AI9 A;  4D8M A;  4CYD A;  3ZN4 A;  1ULF A;  3AZY A;  1F5F A;  3WNN A;  3K77 A;  3ST7 A;  4JHT A;  2RV9 A;  3HQU A;  4I09 A;  4YYO A;  4Y22 A;  5IYY A;  3UES A;  4ZU7 A;  4JGY A;  1H1A A;  2HJI A;  1DG6 A;  1VBB 1;  1RUC 2;  1WD4 A;  3I97 A;  2VQ0 A;  4NRP A;  3CJI C;  4P9I A;  5HXV A;  4EWD A;  1XB9 A;  2D93 A;  3ACL A;  3FE5 A;  1FI2 A;  3KCY A;  4CDU A;  2DCY A;  1CZS A;  2IZW A;  1VBA 1;  5JSO A;  2Z4F A;  3TEW A;  1YFY A;  4IND A;  4XHX A;  5JOX A;  2WYS A;  2RS3 1;  1EAH 2;  3CL1 A;  1X36 A;  3ENR A;  4LHK A;  2WZE A;  1PX3 A;  2HWD 2;  2OYZ A;  1K12 A;  3MLL A;  4FPO B;  3MUZ 1;  4MLO A;  3O0X A;  2BNN A;  5DDJ 1;  4IV1 C;  3OJB A;  3RZM A;  3BUC A;  3ZMO A;  4YW5 A;  4LUL A;  1XYP A;  2LW8 A;  1UCX A;  4RGG A;  5JPN B;  3GNE A;  2R1D A;  1PK6 A;  1YFW A;  2KXL A;  2BNO A;  1AJO A;  1SFY A;  1Y9G A;  3GM8 A;  3BCW A;  1RVF 3;  3N9O A;  4XTM A;  1FT9 A;  3OGR A;  1OQ1 A;  1UU5 A;  4Q1P A;  1W06 A;  3NJZ A;  1HDK A;  4K7J A;  4LXL A;  3VKF C;  3I8T A;  1C5H A;  4YM1 A;  4XFG A;  2JEN A;  1RUD 3;  1CPM A;  4GWI A;  5FKB A;  5I0S A;  2AYH A;  4P00 B;  3GJB A;  1MVE A;  4Y1Y A;  4OVE A;  2QQU A;  3E5Q A;  3ZYJ B;  1LES A;  1RUJ 3;  5K0U A;  3B69 A;  4B4P A;  1MZF A;  2VOT A;  3O1V A;  4COY A;  4NPL A;  4CCK A;  5FO7 B;  3SCG A;  1GBG A;  1PVC 3;  3LDR A;  4BLI A;  1ULE A;  3PUR A;  1G6N A;  4Q4V 2;  2YU1 A;  2QQW A;  4GWJ A;  5FXW A;  2OII A;  4O65 A;  2ZGT A;  5LAT A;  2OT7 A;  4CXX A;  3TEY A;  5C3R A;  4ZU4 A;  1QDO A;  1DFQ A;  4BIO A;  5L7O B;  1VBA 2;  5GZC A;  1GWK A;  3ES4 A;  5L36 A;  4OI2 A;  2WNU C;  4KU7 A;  4Z1V A;  1VB2 A;  1GP5 A;  4LE4 A;  4YAR A;  2A6V A;  3MYX A;  4CCL A;  4CSW A;  5IVC A;  2QBX A;  4XIO A;  3LD8 A;  4P9X A;  4CP9 A;  3SQO A;  3MZH A;  4YPJ A;  3ZXD A;  4MH0 E;  4YRD A;  1SCR A;  3FC0 A;  2RDR A;  3KF3 A;  1W0N A;  2ATF A;  4ZY9 A;  2OX0 A;  3ZXK A;  3ZPO A;  1WGP A;  3J9S A;  3U1X A;  4KQ7 A;  4Q4W 3;  4YZ4 A;  4CUC A;  1V00 A;  2CDO A;  1LJ7 A;  2WWS A;  4XUR A;  2IVJ A;  5F32 A;  3TB0 A;  4HXC A;  1CGP A;  2UY8 A;  3K3N A;  3A22 A;  5C9A C;  1OA3 A;  3M8L A;  4Q0V A;  1DHK B;  4AEM A;  5A1L A;  2Y0I A;  3ZOI A;  5DAW A;  4HKW A;  2DUP A;  2ZOE B;  4NRQ A;  3WIN E;  1MS9 A;  2CWM A;  4W65 A;  2JG8 B;  2Y60 A;  3J26 N;  3PU3 A;  4JKL A;  4IEO A;  4P5H A;  4Q5O A;  5BNP C;  2VBP A;  4HZF A;  3AZZ A;  4FFF A;  1AR6 1;  4Z82 A;  3T2Q A;  1FPN 2;  4OMD A;  5C70 A;  4GMP 3;  2W52 A;  5CG9 A;  3W21 A;  4BLJ A;  1KFX L;  4L0P A;  2P3J A;  4AR2 A;  1IGO A;  4NID A;  2W1U A;  3W20 A;  4RA0 A;  4MGI E;  1PNF A;  2W46 A;  1WW7 A;  1KS4 A;  5JLV A;  1QJY 3;  4QXB A;  2VZR A;  1VBB 3;  4NPM A;  3VGI A;  2BGO A;  2W47 A;  2B9U A;  5K4L A;  1VRH 1;  2HEV F;  2QTW B;  1VPH A;  2VUC A;  1LHU A;  5FLH A;  4RR3 C;  4KGQ A;  2DBN A;  5DUU A;  5FPB A;  5JXH A;  2RS3 3;  5FQ0 B;  1ZRI A;  5FZD A;  5IVE A;  3I2G A;  4DNY A;  4JDN A;  2D6N A;  3CJI B;  4WM8 A;  3MIE A;  4UF0 B;  3DGT A;  4LHN A;  2WKK A;  5DDJ 3;  5FOJ B;  2Y6F A;  1VBC 1;  1CAV B;  3MIF A;  1FNZ A;  2RR1 1;  3ELN A;  5I93 A;  1NLS A;  4FOW A;  3KD4 A;  1D2S A;  3PU8 A;  1H9W A;  4PI2 A;  4LMF A;  4CDX A;  3SIS A;  1UF2 C;  4XFH A;  4NIH A;  1STM A;  2Z69 A;  2IXL A;  5FMC A;  2WS9 2;  1UOJ A;  2Q1F A;  1HV1 A;  2DU1 A;  1FYU A;  1UZ0 A;  1WLT A;  1QHD A;  4IV1 B;  2W5F A;  4D6S A;  4AE2 A;  2UWC A;  2YU2 A;  2BV4 A;  1NCQ A;  2VMD A;  3GZE A;  3OUH A;  5DAX A;  1W8Z A;  2B46 X;  5FY1 A;  4FFG A;  1XU1 A;  2J22 A;  5GLT A;  5LBC A;  3JBG 1;  3S5A A;  2CGP A;  2SLI A;  2XBO 3;  4XUT A;  4CU8 A;  5FYB A;  5BXX A;  1CX4 A;  5CA6 A;  4OCT A;  1GLH A;  1J3Q A;  4COZ A;  2E7T A;  3Q9O A;  2X5I A;  3ZXE A;  2HWF 3;  1NG0 A;  4K21 A;  4J1W A;  4CUG A;  3TBD A;  4M3C E;  1SPP B;  1TME 3;  1VRH 2;  3KMH A;  2ET7 A;  4QX8 A;  3IAP A;  1OUX A;  1S55 A;  1WMD A;  1DBN A;  1UIJ A;  3ETQ A;  4FTE A;  1LOC A;  4H3W A;  4IET A;  3I2J A;  1D4M 2;  1Z0H A;  4XE9 A;  1PO2 2;  3SCH A;  3O1O A;  4QB6 A;  3FFZ A;  4YW3 A;  4AVA A;  1DZT A;  1BZW A;  1AHS A;  5DXD A;  1J84 A;  3MF6 A;  5A3N A;  3T0D A;  1LB2 A;  4RSU A;  2OPW A;  1UYY A;  4CDW C;  3PTY A;  4CEY C;  1BXH A;  2FDK A;  1AR7 1;  4H55 A;  1SLL A;  1HRI 1;  1UAI A;  4PLN A;  2VAU A;  1YWK A;  3O5S A;  2ZEX A;  4HSJ A;  4LKS A;  3WF1 A;  2QQO A;  4BB3 A;  1OA4 A;  3KM5 A;  2WNU B;  3NL1 A;  4WM7 A;  4Y33 A;  3IN9 A;  1Y9M A;  1U0A A;  2BW8 A;  4YZ1 A;  4K1Y A;  4BDV B;  3GBG A;  3OGV A;  4FSJ A;  2TEP A;  4TWT A;  3OF1 A;  3GGL A;  3DCQ A;  1S0E A;  3O1P A;  5G04 L;  1DGW A;  1QGL A;  3AYE A;  4NMI A;  3ZM8 A;  3J7M A;  2MNG A;  3S7I A;  4ES8 A;  2DBI A;  1TEI A;  4JVA A;  2XJU A;  5FUI A;  5JI7 A;  4QDR A;  4AL9 A;  2QQN A;  3D6E A;  1HRV 2;  4FOY A;  5FZ6 A;  2BWC A;  4L11 A;  3N7L A;  1CQ9 A;  1XXN A;  2ZCW A;  5C9A B;  2E31 A;  1R09 1;  4J1X A;  3H8X A;  3BYW A;  5SV8 A;  2CV6 A;  1C8M 3;  5HCB A;  1JZ4 A;  2XXZ A;  2PYT A;  1DP0 A;  4QU1 A;  4QWN A;  4RHV 1;  3QH6 A;  5BNP B;  1V6O A;  1W8U A;  4FPC A;  3VD5 A;  3RDI A;  5A1A A;  1QU0 A;  1EUT A;  1GP4 A;  1V6J A;  4XET A;  2YY1 A;  3HWJ A;  4FFI A;  5IVJ A;  1E57 A;  4QM8 A;  3L2Y A;  3LCP A;  5K9Y A;  3ZN6 B;  3RNS A;  1GAN A;  1H1I A;  1RIR A;  3D3A A;  2GC2 A;  2R04 3;  4R4X A;  4OUM A;  3USU A;  4N53 C;  4YM3 A;  1HN0 A;  5F3C A;  5JZG C;  2F4L A;  1JZ6 A;  1AR7 2;  1W0P A;  1ULC A;  4AVS A;  1HRI 2;  3ASI A;  3IDA A;  1W0O A;  1NLQ A;  4NIA A;  3AP6 A;  5FYI A;  3VBO C;  2JG9 C;  2WSU A;  4A7K A;  5F5I A;  4BK4 A;  2IWG B;  2UWA A;  3WDU A;  4URA A;  1AJK A;  1VBC 3;  4CCC A;  4RR3 B;  2B5H A;  2F4P A;  2A6W A;  2OQ6 A;  4DB5 A;  3LAG A;  5E1R A;  5LB6 A;  4Y20 B;  4U36 A;  4UFK A;  5LAS A;  4AEK A;  4BOW A;  4EWE A;  2BGP A;  4YZ3 A;  4GUL A;  4C0H A;  1JZ8 A;  1MQT C;  5FYT A;  2VXJ A;  1BBT 3;  1EV1 3;  1W04 A;  2O1Q A;  1A8D A;  2G9F A;  3NQH A;  2H0B A;  3UNP A;  2Y6K A;  3K46 A;  2BU9 A;  2VY0 A;  3FJS A;  5A7W A;  1ENS A;  1AYN 1;  2P5B A;  3DYP A;  4RQP C;  1EYB A;  1QQP 3;  3Q8B A;  3VKO A;  2VBD A;  3WSO A;  2RDN A;  2VZT A;  3AM2 A;  3HNB M;  2HWB 1;  3BOD A;  4B4Q A;  3AVS A;  3WF4 A;  4MVT A;  3BN6 A;  1U5Z A;  1ULD A;  4LJH A;  4RHV 2;  1F5J A;  5FYH A;  2P34 A;  1BCX A;  4AAX A;  1H1M A;  3LEK A;  2DCK A;  4CCD A;  5DAV A;  2RS5 1;  1WCS A;  4LK7 A;  3ACF A;  1DLL A;  2XL7 A;  1LOD A;  5IHR A;  5H9R A;  3CF6 E;  4ZPI A;  2PN5 A;  4BPZ A;  2CL2 A;  2P17 A;  3IT8 A;  5DZG A;  2E32 A;  4ZON A;  3WCS A;  3ZSL A;  2D6K A;  3VBF A;  3TAY A;  4K40 A;  3KV6 A;  1AYM 1;  2J1A A;  5AVA A;  4ES9 A;  4BQX A;  3LA2 A;  2J1R A;  4B3N A;  2XLA A;  3WOG A;  4CE8 A;  5FK7 A;  2OS2 A;  3MDP A;  1ZYB A;  2ES3 A;  2XHN A;  4P9Y A;  5KXC A;  1UKG A;  3R4S A;  4XPV A;  1RUF 1;  3NAP A;  4CDW B;  4CEY B;  2UUR A;  4COU A;  3WCR A;  1ZZ8 A;  2JE7 A;  1POQ A;  4XJ8 A;  3VDA A;  1QF3 A;  2VU9 A;  5BUV A;  1REE A;  3AXE A;  1VAV A;  2YUE A;  3OYW A;  4DUX A;  5CIR A;  4XXA A;  3AP7 A;  1TE1 B;  2UWB A;  4GWM A;  5CFC A;  2QZ2 A;  3V56 A;  3V64 A;  4HVQ A;  4LBO A;  1CAX A;  5H9Q A;  2C6S A;  1UW8 A;  4PQ9 A;  1AYN 2;  2YGL A;  3NMB A;  4GKX A;  3KGZ A;  4MXW B;  1Q8V A;  5A7P A;  1H4G A;  3SHR A;  3VKL A;  1SHW B;  1J58 A;  2BP6 A;  2HWB 2;  3VZL A;  2XPJ A;  4LBQ D;  4AK3 A;  3LIG A;  4CVU A;  2FQP A;  1Y3T A;  3I4I A;  2J1V A;  3AMN A;  4UW4 A;  3DPR C;  1BVV A;  2DFB A;  1FOD 3;  1OBN A;  3FHA A;  2Q8O A;  1REF A;  1OKO A;  2VZO A;  5F37 A;  3EYP A;  4GD4 A;  4IV3 C;  5FLJ A;  5L9R A;  3AP4 A;  5FMB A;  1BLZ A;  5AC9 3;  2PHW A;  2Y33 A;  2GH2 A;  2BEO A;  4NJ4 A;  2FZ2 A;  2R30 A;  3JXS A;  1EPZ A;  1MZE A;  2YXS A;  4UAP A;  3ZYI B;  5B2G B;  1HIX A;  4E4D X;  1WD3 A;  4IER A;  4N43 A;  2ADD A;  2WQZ C;  4QQL A;  4DPN A;  2PAK A;  3VDD C;  1QIQ A;  5JMC A;  3TOJ A;  1LEM A;  1ZZ6 A;  2JE9 A;  2VQT A;  2LM3 A;  1HJG A;  5FXZ A;  3ZXF A;  4KMQ A;  4AEJ A;  4DMI A;  3VBS C;  2VD7 A;  1ASJ 2;  1ZBE 1;  1FAT A;  1ONA A;  4N53 B;  2W1S A;  2A6X A;  5JZG B;  5EJ3 A;  2BOJ A;  2RG4 A;  2XKO A;  3HN1 A;  4JQT A;  4BJ0 A;  3W5M A;  3POI A;  1WLW A;  4DEV A;  3VBO B;  3FHQ A;  2JG9 B;  2YBS A;  2Q1Z B;  2ZKL A;  5DUX A;  4QXK A;  1RXF A;  5FY0 A;  1T6G C;  3WNM A;  1CAU B;  1KQR A;  5BYN A;  2D5F A;  1RUI 1;  3MLK A;  4J25 A;  4O9G A;  4A45 A;  4AFD A;  4NIG A;  1H9P A;  2BTV C;  3RS6 A;  2WJS A;  1GFF 2;  3FUQ A;  1RHI 2;  2DTY A;  2J1T A;  2JJ6 A;  3ILR A;  4AHX A;  1JHN A;  4LK6 A;  1RGS A;  4OZX A;  4Q4X 3;  5FP9 A;  4XFA A;  3O1R A;  4Q27 A;  4XQW A;  3KV5 A;  3CNA A;  3LEI A;  3SXW A;  1MQT B;  5HV4 A;  4A3X A;  1SLT A;  4WVZ A;  2EXH A;  1G9C A;  2WR9 A;  2Z42 A;  1COV 1;  4KU8 A;  4P9G A;  1V9U 2;  2VQU A;  5GZF A;  2CSG A;  1XE8 A;  2A73 B;  1PZ9 A;  2ARX A;  1JZ3 A;  2OA2 A;  3AMP A;  3I3D A;  1EP0 A;  5CIS A;  2Y0O A;  3ECQ A;  4OUE A;  4RS5 A;  4RQP B;  4XMI A;  2P6H A;  2O8Q A;  3GZA A;  1NQD A;  4XCB A;  1RED A;  2PLV 2;  2RMU 3;  5GLZ A;  3N36 A;  1NYW A;  3GYD A;  3SH4 A;  5J7M A;  4X8N A;  4PBO A;  4LLF A;  1PK6 C;  1YI9 A;  4LIU A;  3KQ4 B;  4Y24 A;  1UOF A;  4E2G A;  4P9L A;  1AX0 A;  4OQ9 A;  4EJR A;  1A6C A;  3RGB A;  2RS1 3;  2XVL A;  4BIF A;  3VBU A;  3NVC A;  4XJZ A;  1D0H A;  3DL3 A;  2DVF A;  2BDR A;  1MVQ A;  5A3U A;  5LA0 A;  1UZW A;  4XF4 A;  5FRA A;  1OD3 A;  4NOT A;  3VZN A;  5F7U A;  1K5M C;  5FZK A;  5LK5 A;  5C3Q A;  3PUQ A;  1NUK A;  4ATE A;  5KBF A;  4MGT A;  5F3I A;  4AQ6 A;  1WMF A;  2ZHM A;  2WZ8 A;  1LOF C;  3FBY A;  3SNM A;  3LEM A;  4AFA A;  1BHG A;  2WLQ A;  4D7Y A;  1AR8 3;  1OT5 A;  2ZMK A;  4LA2 A;  1W2A X;  3WX5 A;  4E4Z A;  3I59 B;  4KL1 A;  4MGS A;  2W91 A;  4K6B A;  3RQ0 A;  3RZL A;  3THC A;  3U75 A;  3GXU A;  4GQ7 A;  1OH4 A;  3A7Q A;  2HWE 1;  3AKS A;  4LBJ A;  2DCJ A;  1SFP A;  1S0D A;  2JDM A;  3AJZ A;  4K20 A;  2H6C A;  3GCX A;  3RWN A;  2JIG A;  3VDB A;  3OPT A;  3EMR A;  5A32 B;  5C3P A;  5T50 A;  1F35 A;  5IVB A;  1AUY A;  1YFU A;  1YXW A;  2JDA A;  4KWL A;  3T09 A;  2D3S A;  2NP0 A;  3H50 A;  2DCT A;  4QKB A;  1AL2 2;  2BVB A;  3BPZ A;  4QXC A;  4BCU A;  4YVW C;  1AF9 A;  1YFX A;  4MHR A;  1BMV 1;  2ZAC A;  3JZV A;  3R4U A;  3VN4 A;  4JRL A;  4XZP A;  4CA9 A;  3DPR B;  2XJT A;  3MGU A;  5BPX A;  5BNQ A;  3VBR C;  4XJ9 A;  1Y43 B;  1IG0 A;  3HVD A;  1NY7 1;  2ZPX A;  1BEV 3;  2VVF A;  4IV3 B;  4Y26 A;  4R4Z A;  4QX0 A;  4G9S B;  1ST8 A;  2GC1 A;  1C3H A;  3OEB A;  1WBL A;  3AL6 A;  3VHN A;  2CAV A;  4N7I A;  2X09 A;  2ZEY A;  2ZGL A;  4IEQ A;  1RYY A;  5A3M A;  5IWF A;  3VDD B;  4HOO A;  2ZEZ A;  5C4W A;  3THD A;  3PVN A;  3B9C A;  1LOA A;  1VMF A;  4J6G A;  1RUI 3;  1VB4 A;  3B9I A;  3H7Y A;  1OLM E;  4LBM A;  3HQX A;  3VBS B;  4Z8B A;  3H8O A;  1DQ5 A;  1Q8P A;  4IEU A;  3R0R A;  3SMH A;  4CZS A;  4RGK A;  1TVG A;  1YCI A;  2ZJC A;  4FCA A;  5FZO B;  3VV1 A;  1HW5 A;  1RUH 3;  2Q8E A;  3NKG A;  1UMH A;  2FBE A;  4Q4Y 3;  4IEY A;  4B1L A;  1VBD 3;  4LE3 A;  1BQP A;  2HWE 2;  1AXY A;  3BI3 A;  1ZBA 2;  2WZR 1;  4Y22 B;  3WG1 A;  4IEP A;  5HI0 A;  4LBQ A;  5I0R A;  5JXJ A;  1OFN A;  4JQR A;  4XJA A;  5G05 L;  2ENR A;  5LWB A;  4I30 A;  2CWS A;  3KT7 A;  2JDP A;  1R08 3;  2R06 2;  1FV3 A;  3CZU A;  4FBF A;  3VZJ A;  2YB7 A;  3AKQ A;  3KCC A;  4IUG A;  4RL7 A;  1W90 A;  3P3N A;  1NCR A;  4AVB A;  4W6Y A;  3NV4 A;  1RUO A;  3LIH A;  3MW3 A;  1XYO A;  3WT3 A;  3I54 A;  1VMJ A;  1RUG 2;  1OC1 A;  3BIW E;  4XZU G;  5FZM A;  1AVB A;  4CXY A;  3ZIX A;  3FBM A;  2WT2 A;  4C8D A;  2ZAB A;  1NCQ C;  4MET A;  3JUU A;  1IPJ A;  1PM4 A;  1DIW A;  1LGB A;  3OD4 A;  4M0N A;  1G8W A;  3NST A;  5A3W A;  1MEC 1;  1OVS A;  1WLC A;  1PK6 B;  2ZX0 A;  1X9T A;  5EYY A;  4X8P A;  1YI7 A;  2NLR A;  1ENR A;  4OHX A;  1TMF 1;  1OFS A;  2PHX A;  5ANN A;  5A7Q A;  4CDQ C;  5F9T A;  4GB3 2;  3HAG A;  4Y1Z A;  3SCF A;  4CU6 A;  2E7Q A;  4K1Z A;  2HWC 3;  4KH9 A;  4W6W A;  1ND3 A;  1Q43 A;  2WNV C;  1X8M A;  3BOP A;  2SBA A;  3S0M A;  4PJY A;  5GKA C;  5LY1 A;  1K5M B;  3N3H A;  1RUE 1;  4LT5 A;  1PIV 3;  1Z7S 3;  1B35 A;  4FP3 A;  4JKK A;  3ES1 A;  4JAA A;  2BFU S;  2W08 A;  2WZR 2;  3EJK A;  3I3Q A;  3ITQ A;  4LOT A;  1YQ8 A;  3NJV A;  4NAM A;  4I0A A;  4DUW A;  2VMI A;  2DVD A;  4AFB A;  3W59 A;  4C90 A;  3UGH A;  4GJY A;  3U0Z A;  1YYN A;  3RYR A;  2XJQ A;  2DF7 A;  1X9P A;  3ZFF C;  3K75 B;  5BNN C;  2R7E B;  1WCU A;  5FP4 A;  3ZSJ A;  4A7Z A;  4EN9 B;  5FCC A;  5FPX A;  1OPO A;  2HWD 1;  4XAA A;  2FMY A;  5I0D A;  1OLR A;  1JW6 A;  1MAC A;  2E6V A;  3VBH C;  3ZXA C;  5AFE A;  2FDG A;  5LRR A;  2GU9 A;  5FMD A;  3VLB B;  3JD7 1;  2VOX A;  3RZZ A;  4Z2A A;  1W3X A;  3G7D A;  5A6Q A;  1ND2 A;  3OBR A;  1C1F A;  1FMD 1;  4PCR A;  2W0X A;  5C8C C;  4YVS C;  3S30 A;  2GAL A;  4N9H A;  4QPY A;  1QJU 1;  1NLR A;  5DN2 A;  1X82 A;  2IC1 A;  2XOM A;  2D6L X;  1O4Z A;  2X05 A;  3ZXJ A;  4YVW B;  1MEC 2;  1XND A;  4OFG A;  4RYD A;  3B01 A;  1TMF 2;  3AVR A;  3T08 A;  4ASL A;  4YM0 A;  3VBR B;  1NT0 A;  4G4F A;  2JB8 A;  3GHM A;  4IE0 A;  3QOP A;  5JCT A;  2WO3 A;  4O7X A;  4CCN A;  3PTR B;  1ODN A;  5FWE A;  2TBV A;  3A0N A;  2GH8 A;  1GZW B;  1F2N A;  1RUE 2;  2QZ3 A;  3WF3 A;  1HB1 A;  1YIF A;  4Q4V 1;  1RVF 2;  4NN0 A;  4DXR A;  1NXD 1;  1D4V B;  1W9Y A;  1BK1 A;  3NV3 A;  3N7M A;  1KDK A;  3ZIW A;  5FY9 A;  2XLG A;  3IKW A;  3OG2 A;  5BNO C;  1W8N A;  3K3O A;  2BBA A;  3N4M A;  2DV9 A;  3OPZ A;  1RUD 2;  4NRO A;  3ABZ A;  4NRM A;  1GQH A;  2VNO A;  4Y3O A;  1DGL A;  2P3I A;  5KHJ A;  1L7R A;  2UYB A;  1QXP A;  4CEW C;  2BRT A;  5EIY B;  4NWW A;  2PHT A;  2EAK A;  1AXK A;  2ADE A;  3V0A A;  2CU5 A;  2ARB A;  3JD7 2;  2J42 A;  1O5U A;  1GUI A;  4COV A;  4GIQ A;  1UZZ A;  2VZS A;  4PI0 A;  3VD4 A;  1FMD 2;  1I5P A;  2WFF 3;  1X33 A;  4P9W A;  3MIB A;  4HPK A;  1QJU 2;  3WUC A;  4JRA A;  4XIK A;  1ZRC A;  5FPL A;  1QH7 A;  5A33 A;  1LHO A;  1S0B A;  2XL9 A;  4IES A;  2Q8C A;  2AR6 A;  2WNE A;  3PUA A;  1W6P A;  4TLF A;  5FO9 B;  1S0C A;  3TNP B;  5CKQ A;  3WDV A;  2MHF A;  1LCL A;  1A8M A;  5CVR A;  3RVH A;  4M3C B;  3ZFG C;  4HET A;  1VBE 3;  2OKX A;  3MV0 1;  2HBU A;  1MZ6 A;  4PDW A;  4EWA A;  5FYU A;  1V0A A;  2ARE A;  1UZV A;  2QCS B;  2ZMN A;  1FPN 1;  4OHZ A;  2C26 A;  1NCQ B;  1MS3 A;  4R9D A;  1KS5 A;  1MZ5 A;  2IXH A;  3WXP A;  4BME A;  2YBP A;  3K51 A;  1PZ7 A;  1N3P A;  2VM9 A;  4M4P A;  1QH6 A;  5F3E A;  3S5Q A;  2Y6L A;  1HQN A;  2ZGK A;  4L97 A;  4QPG A;  5ANQ A;  5T52 A;  4CDQ B;  2ETE A;  2ET1 A;  4AI3 A;  1UMZ A;  2VUL A;  5ABJ C;  1RUC 3;  4OMC A;  4TSV A;  1JZ2 A;  3CQO A;  4JHZ A;  4ITC A;  2WNV B;  4DXS A;  2R32 A;  3IDC B;  4MAD A;  4QDQ A;  2FMD A;  2KR2 A;  3H42 B;  3CZJ A;  3ME2 A;  5C8W A;  1MS1 A;  2G9G A;  1VAL A;  3POB A;  4E4S A;  1LKN A;  1EAH 3;  3KV4 A;  5EQU A;  3ZYP A;  2PAM A;  3AP5 A;  1SAC A;  2XVK A;  1YQ5 A;  4YLZ A;  2D3P A;  2Y8K A;  4FXK B;  4YGB A;  1RJ7 A;  2L9L A;  1BJQ A;  1U12 A;  3POS A;  5FY8 A;  2JKB A;  2VZQ A;  3ATG A;  3K4D A;  2WFP A;  1O59 A;  3TEZ A;  1RL3 A;  2JKX A;  3MFA A;  3HR9 A;  3ZFF B;  1R1A 3;  1NAE A;  1QKQ A;  5BNN B;  2P3Y A;  5JOW A;  1H0B A;  5FPZ A;  2CYF A;  3M3O A;  3MPP G;  2WS9 1;  3VBH B;  3ZXL A;  4B8E A;  3ZYH A;  1UL9 A;  1W6M A;  2D98 A;  4UFL A;  5IK5 A;  3DF0 A;  4V1P A;  2OPK A;  3WD5 A;  4AHW A;  5FZ4 A;  2AEN A;  2WQ4 A;  2VUA A;  4ISQ A;  3FX3 A;  1PHM A;  1SDD B;  5C8C B;  4YVS B;  4XHB A;  4C1X A;  2VBB A;  3I2H A;  3PHM A;  4OHY A;  3ETP A;  2E53 A;  2Y6J A;  3BOW A;  5D8A C;  1C5I A;  5J98 B;  2BPA 2;  5EJ1 B;  5FZF A;  4D7T A;  4I3P A;  2ID4 A;  5F6K A;  4BHP A;  4MGQ A;  2TNF A;  5J09 A;  4BXS V;  4YG3 A;  2DVA A;  5DMY A;  4HSL A;  5T5L A;  3USS A;  4TYS A;  1K3I A;  2ZHN A;  2XGX A;  2VUD A;  1OD5 A;  3WNO A;  4EN8 B;  2A5Z A;  4Y1V A;  3WW2 A;  4ATF A;  4IXL A;  1W6N A;  3LPF A;  4UFI A;  1VBA 3;  2IXC A;  4OHV A;  3RJR A;  1GOF A;  1D4M 1;  1BVP 1;  1NX9 A;  1PO2 1;  2IXI A;  2YYO A;  2MEV 1;  4E8C A;  3T0B A;  3CEW A;  3ZYG A;  4KWK A;  2YFZ A;  4BZ4 A;  1LGN A;  1WA6 X;  1UU6 A;  4KBB A;  1DZQ A;  1SQ4 A;  4C1W A;  5IVV A;  3OOX A;  3WW3 A;  4D6Q A;  1W8H A;  2A6Y A;  1SCS A;  4XOG A;  3OBZ A;  5C5U A;  3FZ3 A;  4OUL A;  5BNO B;  3OPW A;  1APN A;  3S57 A;  4OUS A;  4QPW A;  4QX2 A;  5JXG A;  1K5J A;  3LQC A;  4NO4 A;  5JR7 B;  1TME 2;  1UKR A;  2LS6 A;  5HCH A;  4IE4 A;  3WW4 A;  4TN7 A;  1DYO A;  3FL7 A;  5F5C A;  5A3O A;  4CEW B;  2XHK A;  4ZS2 A;  3LKJ A;  1N1Y A;  1J83 A;  3WQB A;  1G86 A;  2LRP A;  2WNO A;  1US3 A;  5FJH A;  1HJF A;  3R05 A;  1NKG A;  1W9S A;  2IUW A;  2VG9 A;  3WP6 A;  3E1F 1;  5CB7 A;  5FPU A;  5EYX A;  2V5D A;  1VJ2 A;  1ZZ9 A;  1IS5 A;  4IGO A;  3FN9 A;  3MI8 A;  1O4Y A;  2GC3 A;  4COW A;  1XNK A;  4MG2 A;  4CTE A;  5K7P A;  5F39 A;  4DXT A;  1YJK A;  3AJY A;  3H8U A;  2GSY A;  1O3S A;  1JYC A;  1JU4 A;  1NZC A;  1HRV 1;  2A7A A;  3M3C A;  3NJX A;  4UT5 A;  5FRE A;  5FYM A;  3M70 A;  2B9V A;  2VPV A;  3U11 A;  2W1W A;  3WVJ A;  4RD7 A;  4DS0 A;  3A23 A;  1GZT A;  4HG6 B;  5HCA A;  1L7L A;  3LFI A;  2VMC A;  4M3C F;  2WLP A;  2ZS6 B;  3JB8 A;  4HMZ A;  1Y4W A;  2YGM A;  3ZFG B;  4PIX A;  2RDS A;  5KR7 A;  1S0F A;  1NA1 C;  2R07 2;  2B8M A;  1UNB A;  1XNC A;  1K45 A;  3I3B A;  4CRQ A;  4L99 A;  5JSP A;  1DLC A;  3O12 A;  5CFD C;  1KJR A;  2MEV 2;  4GAL A;  3ZYR A;  5C7G A;  1GNZ A;  4M4R A;  1QOO A;  5DZF A;  3CJX A;  3Q8F A;  4QB1 A;  1WWY A;  4FPK A;  4YGD A;  2GAU A;  1QJE A;  5ABJ B;  1JHJ A;  2QQP A;  4FXG B;  4TZD A;  4OHW A;  2YV8 A;  1WCQ A;  1KEX A;  2AEZ A;  2R49 A;  3HIF A;  5L7O A;  5FZ7 A;  5CZK A;  1WBF A;  5KXE A;  4XUP A;  2A3X A;  4XQ4 A;  2AAC A;  2VTX J;  3LA3 A;  2XWJ B;  4QHB A;  4R9B A;  4TLG A;  4GMP 0;  3SKV A;  1WLD A;  3GBF A;  3V65 A;  3ZLI A;  4AI0 A;  4W50 A;  3TRS B;  1ULO A;  2XQR A;  1OF4 A;  1W9W A;  3C8X A;  2E7A A;  3F2Z A;  2C9A A;  3NAP B;  2A70 A;  2JXA A;  5FZL A;  4A41 A;  1F8V A;  3KS7 A;  1V6N A;  3LGR A;  3LFM A;  4HVO A;  3VUO A;  4UW6 A;  4XEZ A;  1AR6 3;  2VXR A;  1OOP C;  2UY9 A;  5C3O A;  4W8J A;  5IFP A;  2C0Z A;  3OCP A;  1W05 A;  2D97 A;  3A0K A;  2DUQ A;  4Q2F A;  3B7M A;  4QX5 A;  5FZ0 A;  1WMX A;  2V5Y A;  2JG8 A;  3M7A A;  1DGR N;  1JOB A;  4FPJ A;  5F6L B;  5FKC A;  4KG0 A;  1VRH 3;  1BBT 2;  3WUD A;  5D8A B;  3GZT B;  1OXC A;  2D6O X;  2JEC A;  2VW2 A;  2DWR A;  3Q8E A;  4OI0 A;  1HKD A;  5F5A A;  1YC6 1;  1XBF A;  3G6J B;  3MW4 A;  4R8H A;  1LAJ A;  4AED A;  2V4A A;  3D0S A;  1S1A A;  1AXZ A;  3HJR A;  3RFR A;  1QQP 2;  4QKN A;  4XIL A;  2C24 A;  1UOB A;  2PA7 A;  4Q0Q A;  1AZD A;  5DPN A;  1JXN A;  3D82 A;  4JGZ C;  4MZU A;  4TTG A;  2D43 A;  3E5X A;  2Y64 A;  4R9C A;  5CU1 A;  2ZX3 A;  3FLT A;  1A3K A;  2RR1 3;  3MID A;  4XAC A;  5FZ1 A;  4X6R B;  1UPI A;  4BQ5 A;  2A75 A;  2BNM A;  1JU3 A;  3MIG A;  2ZHK A;  5FQ0 A;  1QJF A;  1Y7B A;  1L3J A;  3EQE A;  4XBN A;  1JYT A;  4A4A A;  1IQA A;  3D8C A;  1W39 A;  3I2D A;  4QGN A;  2B45 X;  3WEZ A;  3ZYF A;  2D3R A;  3W9A A;  5L73 A;  2RJK A;  2B42 B;  3KQR A;  1CAV A;  4Y5S A;  3RZK A;  1ZVF A;  2VW1 A;  3RI9 A;  3JBG 3;  3QLQ A;  3DYM A;  3RYP A;  3JQW A;  2QQV A;  3WDW A;  1POV 1;  4D3W A;  4FQ4 A;  3ZVX A;  4LUK A;  1V70 A;  4UBG A;  4I0B A;  4BQY A;  3O1U A;  3ZSM A;  3DXU A;  3H1M A;  4OI1 A;  2D5H A;  4IV1 A;  4P14 A;  2Q5T A;  3UK9 A;  3WLU A;  2A71 A;  4FI9 A;  4YZ2 A;  3TN9 2;  1O3R A;  3AKT A;  1F9K A;  2QQK A;  3HQR A;  3VD3 A;  5A1F A;  2G9Z A;  2YPJ A;  4QXH A;  2G19 A;  5JPM B;  4YGE A;  4C0B A;  2ARA A;  4LA3 A;  4MSV A;  3WNP A;  3CLP A;  2RM2 1;  4QPI C;  1DQ0 A;  1IG3 A;  2EAA A;  2EIG A;  3DEC A;  3JU9 A;  2BFU L;  5LY2 A;  3BTZ A;  1MPX A;  3A21 A;  1AR7 3;  1HRI 3;  3I49 A;  1NA1 B;  1SPP A;  4XAE A;  2VO5 A;  3VL9 A;  3I2O A;  1HB2 A;  1OSG A;  2RJL A;  4Q0S A;  3BTY A;  2G4I A;  2FHR A;  4OI4 A;  1W03 A;  5CFD B;  3D4K A;  3KGL A;  1R1Z A;  2W2I A;  1TZO A;  1FOD 2;  4JZR A;  4A44 A;  1ASJ 1;  3INA A;  2V72 A;  4DY5 A;  1GKB A;  3K48 A;  2JDN A;  3P1I A;  4HLT A;  2ORZ A;  5AFB A;  2R0H A;  2J1E A;  3BAL A;  4I0W B;  3HNY M;  4SLI A;  1O91 A;  3POW A;  4H14 A;  4YFW A;  3PUI A;  4XJW A;  1LOG A;  2F6B A;  4MGK E;  5DAB A;  1D7P M;  1GP6 A;  5CYY A;  1JOP A;  2WDB A;  4LUM A;  3RYK A;  1N1V A;  1RHI 1;  3I2F A;  1QNY A;  5IAX A;  2VTF A;  2WRA A;  1R09 3;  3WR0 A;  2WWJ A;  3OB8 A;  4XFC A;  4SBV A;  4N90 A;  2PHD A;  3MV1 1;  2VTX A;  4JV4 A;  4BXF A;  2R0F A;  3OGJ A;  4KG8 A;  2VVD A;  1V9U 1;  4RHV 3;  3OY8 A;  1CN1 A;  1OOP B;  1AR9 1;  3O14 A;  4XDQ A;  1CAW B;  2WAA A;  3ZFE C;  5C9A A;  3W5N A;  3DEM A;  2JDK A;  2RM2 2;  1E5H A;  1OQE A;  2DUR A;  3FWE A;  1GZ9 A;  4NAO A;  1YIP A;  2OXB A;  2PLV 1;  1Q5O A;  4S2F A;  4D0Q A;  2N7G A;  3EB7 A;  3RSJ A;  2AZ5 A;  2YRO A;  5E6H A;  2HEW F;  2QJV A;  2J1U A;  4MV2 A;  1HQL A;  3HEI A;  4D7S A;  5BNP A;  3ZDS A;  1QMJ A;  4JX0 A;  4GH4 C;  4LO4 B;  3HNM A;  1PO1 1;  3U10 A;  3ZN6 A;  1H8T C;  4UFH A;  5CNA A;  5HV0 A;  4I02 A;  3PVB B;  4PLO A;  4FQZ A;  4LOS A;  1W6Q A;  4JGZ B;  3H3U A;  4PLM A;  1N3O A;  1LU2 A;  2NMO A;  1FV2 A;  3QH7 A;  4AHZ A;  3H8R A;  2LTN A;  2QQI A;  4JGY C;  3GDB A;  5EV7 A;  4RR3 A;  2AH2 A;  2HBT A;  2JEM A;  2QFE A;  2VME A;  1W99 A;  2RS1 2;  3ALQ A;  4Y20 A;  2VMF A;  5FZI A;  3WG2 A;  3MIH A;  1AYN 3;  1PMI A;  2JE8 A;  4CDU C;  5JOY A;  4MOA A;  3ZR5 A;  2BZD A;  1OMI A;  4QQO A;  3WQ1 A;  4GA9 A;  2HWB 3;  3JCI A;  1W8O A;  4IW3 A;  4WVM A;  3E6D A;  4XMA A;  3ROU A;  3O7O A;  1AR9 2;  4KWU A;  2JIJ A;  2ZHL A;  3FUO A;  3GJA A;  2CAU A;  2E9Q A;  2RJ2 A;  3OGG A;  2ORX A;  1BKZ A;  2RS5 3;  4LPL A;  2ZTN A;  5FYZ A;  4PT6 A;  3WP4 A;  3PJQ A;  4QB2 A;  4AYU A;  3RI8 A;  3I3E A;  1AL2 1;  4D69 A;  2GME A;  2Z79 A;  1JOJ A;  4P5Y A;  2ZGR A;  1U5I A;  3MIC A;  3TNQ A;  3WQ0 A;  1CD3 G;  3IB3 A;  1AYM 3;  4WZF A;  1WZX A;  4Y5Z 0;  5FPV A;  3T4H B;  2CDP A;  4DQA A;  4GKY A;  3LDK A;  4ASK A;  2GZW A;  1GMM A;  4YG0 A;  1PO1 2;  1RXG A;  4KBZ A;  4BQ2 A;  5M0T A;  4QPI B;  1WCK A;  4Y5T A;  5EP9 A;  1LOB A;  5LEJ A;  3IPV B;  2VOV A;  1RUF 3;  1D2Q A;  1PGW 2;  4CCO A;  5T3N A;  3ILN A;  4OZO A;  1W28 A;  2X10 A;  3GHN A;  5K0U C;  2ZXQ A;  3VD7 A;  1CJD A;  1JH5 A;  2PEL A;  1I3H A;  2VZ1 A;  3O0V A;  5C3S A;  5JIA A;  1L7Q A;  3U78 A;  3ZMN A;  4EYU A;  2RVA A;  1BK0 A;  1RHI 3;  4X6Q B;  4XDP A;  3VHP A;  5FXX A;  4CDW A;  1UWW A;  1IPK A;  3C7O A;  4CEY A;  4GXL A;  3SC7 X;  4CPB D;  1I5Z A;  1HX6 A;  3APB A;  4HVR A;  1ZBA 1;  2B7Y A;  2O0O A;  3V0B B;  1WKY A;  1W8W A;  4U2A A;  3J4U H;  1VAK A;  2BVV A;  1AX1 A;  3WNL A;  2R06 1;  3AXD A;  3WF2 A;  4HON A;  2MPF A;  2WSV A;  3O0W A;  1JS9 A;  3GAL A;  2YBK A;  1CIW A;  1GYK A;  4MXW A;  3MUY 1;  4NR1 A;  3R6S A;  1PZ8 A;  3AKR A;  4DRR A;  3LSD A;  3IWZ A;  3RZG A;  3ILF A;  4NHK A;  5C71 A;  2WBK A;  4UOJ A;  5A7O A;  4B7E A;  1W8T A;  4E2S A;  1Z78 A;  1B09 A;  2GMP A;  3N9Q A;  4S2D A;  5FY7 A;  1UN1 A;  4AAP A;  2AGS A;  4CP0 A;  3POG A;  2PQQ A;  3ZSE A;  1RUG 1;  2XKP A;  1ZRD A;  3ZFE B;  2WN3 A;  4CU9 A;  3KF5 A;  5I8T A;  2RDQ A;  2ZGP A;  2VMG A;  3J8F 1;  3LZZ A;  3N35 A;  5IVF A;  5IUQ A;  2YFU A;  1HN1 A;  1ZBE 3;  1QWR A;  2EIC A;  3E6B A;  2EXJ A;  1HXS 1;  3IZO A;  1PGL 2;  1O8S A;  3BTA A;  1DCS A;  1QJX 1;  1TQ5 A;  2I45 A;  3L2H A;  1CZV A;  4GB3 1;  2C1F A;  3OTF A;  1OUR A;  4FPE A;  4DXZ A;  4GH4 B;  5CAZ A;  3MFC A;  2DTW A;  2DU0 A;  1H8T B;  1VLN A;  5DAP A;  2VNV A;  3ZXG A;  4ARX A;  5LW9 A;  1O5L A;  1ZA4 A;  2PAE A;  4N53 A;  5JZG A;  3CIH A;  4P9J A;  5FR3 A;  4AI8 A;  1JYX A;  4QHZ A;  4YNI A;  5B4N A;  5GZG A;  3VBO A;  2YC2 A;  2JG9 A;  4AHY A;  4XBQ A;  1CAU A;  4JGY B;  3QD6 A;  1COV 3;  4XF1 A;  5ACA 1;  1E5S A;  1DGW X;  3WNK A;  3MHZ A;  3PVO A;  5JIU A;  2PXJ A;  4WM8 C;  4UFJ A;  4Z07 A;  4NII A;  4ZHN A;  4XQD A;  2HWC 2;  1H8V A;  3AC0 A;  5F1R A;  2QDN A;  4AI1 A;  4CDU B;  2XDV A;  1W2T A;  1YQC A;  2P2K A;  3Q8A A;  1MQT A;  1VAM A;  4MUV A;  2HLE A;  2P1B A;  1F31 A;  2DCZ A;  3OUI A;  1PIV 2;  4XW3 A;  1Z7S 2;  4CDX C;  2XLF A;  4AVC A;  3L9J T;  2D6P A;  3MLJ A;  5C5T A;  1VP6 A;  2NQY A;  1IS4 A;  2ZGQ A;  4LQR A;  5A7N A;  3UL2 A;  1RIN A;  3J8F 2;  3ORJ A;  4RQP A;  2FDH A;  1HXS 2;  1DQ6 A;  3POE A;  1QJX 2;  5A6Y A;  1WUV A;  2XUM A;  1O8P A;  5LBB A;  3EO6 A;  5D1I A;  1JI6 A;  3WHT A;  3WG4 A;  4FVV A;  2WA3 A;  1OI6 A;  2YC4 A;  2X5I C;  3T1M A;  1LEC A;  1GQG A;  4JKM A;  3SLI A;  4S2G A;  1RC6 A;  4LEJ A;  3NNG A;  3O1M A;  4Q8L A;  4E8D A;  4Y1X A;  1G9D A;  3TEX A;  1F15 A;  3S7E A;  1DF0 A;  4ORF A;  5K0U B;  1K42 A;  4MXV A;  1RVF 1;  1H2M A;  2OZ6 A;  4HN1 A;  3OSD A;  1LTE A;  5ACA 2;  5CG8 A;  2HWE 3;  1ZBA 3;  2W39 A;  1SLI A;  3M3Q A;  3ON7 A;  1RMU 2;  2E63 A;  4ONU A;  1RUD 1;  3WDX A;  1W2O A;  2VCM A;  4UYB A;  2ZEW A;  5H9S A;  5A80 A;  1ZZ7 A;  2ZGS A;  1CES A;  3HBK A;  1LEN A;  5FBJ A;  5FUN A;  5FZ9 A;  5GZE A;  4EZ4 A;  4WM7 C;  3LDB A;  1RUJ 1;  1ZX5 A;  3HOB A;  1X50 A;  4AGR A;  4NHL A;  3FLR A;  2X53 S;  1UYX A;  1PVC 1;  4CP9 B;  4DRV A;  3HPN A;  1N47 A;  3NV1 A;  5GLV A;  4N7U A;  2I07 B;  2YDE A;  4XFI A;  2DYC A;  4QDS A;  2AC1 A;  5A32 A;  3ZN5 A;  4CCM A;  3IIA A;  1RIT A;  1NE4 A;  2VE1 A;  2PTM A;  3NRU A;  2KM2 A;  1CVN A;  2A3Y A;  2LRO A;  4IQP A;  4F3J A;  5J36 A;  2O14 A;  4K8R B;  5GAL A;  2XQX A;  4EZH A;  4WVV A;  5L9B A;  3WW1 A;  5CEH A;  4AFM A;  3RRD A;  4RFR B;  3DPR A;  3OD0 A;  4L8Q A;  1VRB A;  1TNF A;  4HKO A;  4GB3 3;  1NE6 A;  3PVE A;  4LKF A;  1IOA A;  1VMH A;  4FPG A;  1CX1 A;  4B1M A;  4IV3 A;  1SEF A;  5T54 A;  1V6I A;  4Q4W 1;  4PIY A;  3SH3 A;  3D0J A;  3ZPY A;  2BQP A;  1GQP A;  5GLW A;  3RG0 A;  1WW4 A;  4QGM A;  3THT A;  3C3V A;  3BGA A;  2GN3 A;  4IGP A;  5FP7 A;  1KGY A;  3VDD A;  4CPB A;  1YRZ A;  4YFZ A;  1UY3 A;  2WZR 3;  3HN3 A;  4QKD A;  5EPA A;  4AED C;  3M3I A;  3VBS A;  1E5I A;  1OKQ A;  4FTS A;  5JOZ A;  1OF3 A;  3R4D B;  1VR3 A;  1WME A;  1ZRR A;  1SZB A;  5GLU A;  2QNK A;  5FZO A;  1H4H A;  1UZY A;  3DKW A;  1RUJ 2;  2C9K A;  4Q0P A;  4Q26 A;  5EXO A;  1RUN A;  1GOG A;  4FPL A;  1PVC 2;  2BGC A;  1PX4 A;  3OGS A;  1QJY 1;  2WT1 A;  2TUN A;  3FHI B;  4WM8 B;  3UJO A;  5T5J A;  4KGG A;  4FFH A;  5FYS A;  1DGR A;  1XC6 A;  2WT0 A;  1ODM A;  2IVI B;  2VUJ A;  4BA6 A;  4LBN A;  3S6P A;  3IMM A;  4CCE A;  4HFS A;  1J1L A;  3AYD A;  3HMY A;  4CDX B;  2GC0 A;  5IK8 A;  1MEC 3;  1Q3E A;  1UXX X;  1UQX A;  4ZZ8 A;  1TMF 3;  4FOQ A;  3OBT A;  4QHO A;  1NQJ A;  1RTV A;  2VCA A;  1ZRF A;  1W9T A;  3HBZ A;  5FZG A;  4D6R A;  4AGG A;  5CKM A;  3NJY A;  1BYH A;  5FY5 A;  2IFW A;  2WO7 A;  1Q56 A;  4Q4W 2;  1R1A 2;  2ZGN A;  4CXW A;  3NNL A;  1ZZB A;  3B94 A;  2UYA A;  3CKH A;  3DUI A;  4FPH A;  4XYX A;  1RUE 3;  2FZ1 A;  3LSE A;  3POF A;  1TNR A;  1UXZ A;  4HKL A;  1W9F A;  3DKQ A;  2W87 A;  4I2O A;  2ZBJ A;  4D94 A;  2X5I B;  4QAW A;  3HT1 A;  3WZ1 A;  4ZZ5 A;  3AYC A;  3VBF C;  5DUV A;  4N8M A;  4FAG A;  4YW4 A;  4JC1 A;  4WVW A;  1K5M A;  2XBO 1;  4FOV A;  2WO2 A;  3UT0 A;  4IE5 A;  5ISL A;  1XSR A;  2HWD 3;  1H6Y A;  3N7K A;  3CBN A;  5FJK A;  1CWP A;  4HAN A;  1LOF A;  4OLL A;  2ZA9 A;  1IQD C;  3JD7 3;  3NAP C;  1QJY 2;  1XSQ A;  2HWF 1;  2P37 A;  3WNX A;  1VBB 2;  1XQN A;  5LRS A;  4CCJ A;  2JB4 A;  4G3Y C;  1KFU L;  1FMD 3;  1QOS A;  5LZ6 A;  5FYC A;  2WZP P;  1TME 1;  1GU3 A;  2W3J A;  1QJU 3;  1W6O A;  3JB4 C;  3BKZ A;  2B4K A;  1LHV A;  3GCW A;  5LA2 A;  4WM7 B;  5CFC C;  3ZDV A;  5KWR A;  1FX5 A;  3FMG A;  3PLQ A;  3PNA A;  5CAD A;  2RS3 2;  5I8Y A;  1OVP A;  2VOK A;  3FFQ A;  4V2W A;  3T2T A;  3WY6 A;  3UV9 A;  2XJP A;  3IMN A;  1XRU A;  2G1M A;  4O61 A;  4A6S A;  5LBE A;  4H7M A;  1LRH A;  1XJA A;  2JDU A;  3DYO A;  4Y1U A;  4IL7 A;  5DDJ 2;  3SIT A;  5FZ3 A;  1Q8Q A;  1YHF A;  1X8E A;  1PGS A;  3B02 A;  4K3U A;  3T2O A;  4LKE A;  2K9Z A;  1SLC A;  2VNR A;  1JZ7 A;  3DXT A;  1QEX A;  2EIB A;  2ZX2 A;  1ZNP A;  4YVW A;  1SBF A;  3UJQ A;  1XU2 A;  4AWD A;  3A4U A;  3UKT A;  2XJR A;  2VZU A;  3VZM A;  3P5B A;  4B7K A;  5I91 A;  1ULG A;  4Q4V 3;  3WHU A;  2WN2 A;  5KC5 A;  3VBR A;  4DEQ A;  4DZG A;  1A34 A;  5FMO S;  4ZKT B;  5DZE A;  2R07 1;  3CMG A;  4XUN A;  2VNG A;  2VW0 A;  5CKN A;  4N43 C;  5FV3 A;  4PF5 A;  2EA7 A;  1CON A;  2XBO 2;  1U5X A;  4MGY E;  2VH9 A;  3I2I A;  1GZW A;  2R1B A;  4LIV A;  3VB9 A;  3T3Y A;  4Y4R A;  4BK5 A;  1RJ8 A;  2RE9 A;  5F5Q A;  4CUA A;  2NZ9 A;  3T30 A;  3UET A;  1T6B X;  4NHX A;  1G7Y A;  1C8M 1;  4YW7 A;  4AED B;  2HWF 2;  5L9V A;  3USU B;  2JDH A;  3CHX A;  5IK4 A;  3WF0 A;  1WA4 A;  1JTZ X;  3AZW A;  3C7E A;  4IEZ A;  1UX7 A;  2DUO A;  4YWA A;  1ACC A;  1S2K A;  2E26 A;  1UD1 A;  1LR5 A;  2O8O A;  1IKQ A;  1C28 A;  2XWB B;  3PMS A;  1S0J A;  2FDI A;  5HPO A;  3E6C C;  5HBA A;  5HCF A;  1JYI A;  1J3P A;  3M2M A;  1SLA A;  3MF9 A;  2R04 1;  1ZRE A;  2ZZQ A;  1OA2 A;  2GNT A;  5FYV A;  1C57 A;  1VIW B;  2A3W A;  2NPI A;  3KZ4 C;  4N9I A;  2A1X A;  4FTB A;  3RMY A;  2PHU A;  3ZX7 A;  1H2K A;  1YEW A;  1ZA7 A;  3RJ2 X;  3VKM A;  1FPN 3;  1KJL A;  2CY6 A;  3HD8 B;  1SLB A;  2VZ3 A;  3KT1 A;  1DYP A;  4MYE A;  2ZKN A;  5A7W B;  4RN5 A;  4RS5 C;  2V73 A;  5FXV A;  2VR4 A;  4K8F A;  4M3C A;  5SV5 A;  2E33 A;  3PUH A;  1UY2 A;  1JMU B;  1OHF A;  1BBT 1;  1EV1 1;  4AG4 A;  3B5L B;  4Q1R A;  4B4R A;  4FPF A;  5C33 A;  2ARC A;  1IS3 A;  1AR6 2;  3H1Y A;  4GZ9 A;  5E8A A;  4HK9 A;  1JN2 P;  2B39 A;  2EAL A;  3GBW A;  3VBU C;  2GNB A;  3H1W A;  1QQP 1;  2DDU A;  4CDQ A;  4CP1 A;  1VE0 A;  3LPG A;  1C8M 2;  3C2U A;  1N1S A;  4K9S A;  2A6Z A;  3VBF B;  3AL5 A;  2WNV A;  1XE7 A;  4AQS A;  1PMH X;  2FCU A;  2QQJ A;  4LBL A;  1IPS A;  5H9P A;  1QNW A;  4PBP A;  3KHB A;  5FAX A;  1NOV A;  1OLQ A;  4IGQ A;  4XF3 A;  3VZO A;  2Y26 A;  4XAB A;  4FT8 A;  3KLS A;  1SFN A;  3W58 A;  2X29 A;  1FXZ A;  2OUH A;  2WS9 3;  2XUE A;  3POY A;  2R04 2;  4FP2 A;  4AQ2 A;  1JYW A;  4Z92 B;  2WAO A;  3N9M A;  1YQ6 A;  1IS6 A;  3WQ7 A;  2IXJ A;  5FOB B;  3LOI A;  3ZFF A;  1CPN A;  3NKT A;  5BNN A;  3OYW B;  4BQW A;  1VBC 2;  2RR1 2;  5CFC B;  4NE9 A;  5FDB A;  1M06 G;  4Q0U A;  1GSL A;  1XNB A;  1CAX B;  4AOC A;  2P3K A;  2WC2 A;  3VBH A;  3VKN A;  4MX3 A;  4V2V A;  3N9P A;  1C1L A;  2W9X A;  4QT6 A;  2BUK A;  1DQ4 A;  2ERF A;  3UKN A;  3IDE A;  3RZJ A;  3TN9 1;  5C8C A;  4YVS A;  2BER A;  4PHZ A;  4XBL A;  1EV1 2;  2X8K A;  1KXG A;  2R07 3;  5A3L A;  5D21 A;  1V6M A;  1IZ3 A;  3OY8 B;  1UYP A;  1D4M 3;  3JBG 2;  2VOW A;  1PO2 3;  4PIZ A;  1S0I A;  2MEV 3;  3LE0 A;  1UYZ A;  2BBV A;  1WW5 A;  3NNF A;  2WUH A;  1YQ2 A;  3X29 B;  4A42 A;  2OVU A;  3KCX A;  2VZP A;  3O1S A;  1GNH A;  4GJZ A;  1A78 A;  1UY4 A;  1W2N A;  2FCT A;  4GAZ A;  4LO7 A;  4N43 B;  1UY1 A;  3B00 A;  5C4W C;  3H3Z A;  4WV8 A;  3UKV A;  2UU8 A;  1FOD 1;  3PDQ A;  4P02 B;  5EHD A;  2QKD A;  3LF7 A;  4BM8 A;  4LKD A;  2VCB A;  4I3G A;  4AXO A;  3KT4 A;  3CJI A;  5AC9 1;  4UF0 A;  1G9F A;  4F8A A;  5BNO A;  1O3T A;  4ISR A;  3B93 A;  1DYK A;  3VL8 A;  1W6Q B;  3AFK A;  4UW5 A;  3AP9 A;  1LU1 A;  1CZT A;  1SMV A;  1HRV 3;  3K4A A;  4LLO A;  4CEW A;  2CGO A;  2I74 A;  2XML A;  3T2P A;  1LED A;  1XNT A;  3ACI A;  4XXP A;  2AUY A;  2VMH A;  4UXA A;  4KI5 M;  2CNA A;  4Y4Y A;  3RPQ A;  3K2O A;  4M01 A;  1SDW A;  3N7J A;  1J3R A;  3AK0 A;  3AMH A;  2JDY A;  1H2L A;  1SBE A;  3PIG A;  2D44 A;  4QKF A;  5EZW A;  1NCR C; 
#chains in the Genus database with same CATH homology
 5FUP A;  5FXV A;  5IVJ A;  2WWU A;  5FYY A;  5FZB A;  5K4L A;  2GP5 A;  3U78 A;  4EYU A;  3UYJ A;  5FZL A;  4XDP A;  5FXX A;  5FZA A;  5FPB A;  5F3C A;  4E4H A;  5FZ4 A;  5FZD A;  5IVE A;  2YPD A;  5FXZ A;  5FYI A;  2WWJ A;  4XDO A;  5F5I A;  3AL6 A;  4URA A;  3AVR A;  2VD7 A;  4UF0 B;  5ISL A;  2OQ6 A;  5A80 A;  4BXF A;  4DIQ A;  5FWJ A;  5IWF A;  4HOO A;  3AL5 A;  5FBJ A;  5FJK A;  5FUN A;  5FZ0 A;  5FZ9 A;  5FZF A;  5IW0 A;  3LDB A;  4CCN A;  4EZ4 A;  4HON A;  3PTR B;  2YBS A;  5FWE A;  2GP3 A;  3PU8 A;  2YBK A;  5FY0 A;  4CCJ A;  5F2W A;  3N9L A;  5FPA A;  4IGQ A;  5FYT A;  5FYC A;  5FZO B;  5A7S A;  5FY4 A;  5FZH A;  5A7O A;  2Q8E A;  2XUE A;  3KVB A;  2Q8D A;  5FY7 A;  3N9Q A;  5F5A A;  4AAP A;  3N9O A;  3N9M A;  4CCM A;  4D6S A;  2YU2 A;  5FP9 A;  5FY9 A;  3K3O A;  5E6H A;  4LXL A;  3KV5 A;  5FY1 A;  4V2W A;  5A7W A;  2P5B A;  3PUS A;  5IVF A;  4BU2 A;  5LWB A;  4Y3O A;  5IVB A;  5FYB A;  5IVV A;  4EZH A;  5CEH A;  4D6Q A;  5FZ3 A;  3AVS A;  3OPW A;  1VRB A;  5FZ1 A;  5FYH A;  4V2V A;  5FP3 A;  3DXT A;  3N9P A;  4CCK A;  4NUB A;  4CUG A;  4TN7 A;  5LW9 A;  3PUR A;  5F5C A;  2YU1 A;  3N9N A;  5FXW A;  4QX8 A;  5FJH A;  2OT7 A;  4DO0 A;  5FPL A;  5FZM A;  5FZE A;  4LIU A;  4IGP A;  5FP7 A;  5FP8 A;  2Q8C A;  3PUA A;  5A3N A;  5FPU A;  4IGO A;  5FZC A;  5FZI A;  4C8D A;  3KV6 A;  5FV3 A;  5F39 A;  4CCL A;  4CSW A;  5IVC A;  3LD8 A;  2OS2 A;  5A3W A;  3RVH A;  4LIV A;  5FYM A;  5FZO A;  4Y4R A;  2PXJ A;  3DXU A;  5FYU A;  5FZK A;  5A7Q A;  4GJZ A;  4Y33 A;  4GAZ A;  2OX0 A;  4LIT A;  2XDV A;  3PUQ A;  3ZPO A;  5A3P A;  2YBP A;  5F3I A;  5FZ8 A;  3PDQ A;  5F3E A;  5FYZ A;  5A1F A;  4BIS A;  4QXH A;  5ANQ A;  5LY1 A;  3KV9 A;  5F32 A;  3K3N A;  5KR7 A;  5F2S A;  5F3G A;  5FYS A;  4UF0 A;  5A7N A;  5A1L A;  5IVY A;  5LY2 A;  5FPV A;  5FZ6 A;  3PU3 A;  5FYV A;  5A7P A;  4GJY A;  4ASK A;  2XML A;  3KV4 A;  2W2I A;  3OPT A;  5FP4 A;  3K2O A;  5FZ7 A;  5FZG A;  2XXZ A;  4AI9 A;  4CCO A;  4D6R A;  3NJY A;  5A3T A;  4QU1 A;  5FY5 A;  4QX7 A;  4QWN A;  2OQ7 A;  5FY8 A;  5A7W B;  3U4S A;  3KVA A;  4QXB A;  4QXC A;  3ZLI A;  5F37 A;  4GD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...