5A1FA

Crystal structure of the catalytic domain of plu1 in complex with n-oxalylglycine.
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
458
structure length
450
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
total genus 144
structure length 450
sequence length 458
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a1fA01
5FY8A 5FYHA 5FYYA 5ISLA 5FZ0A 4XDOA 2YBKA 5FZOA 2OS2A 4IGPA 5FZ6A 4BXFA 5FZ7A 4V2WA 5FUPA 5FZ1A 5FZEA 4DO0A 4GJZA 4QWNA 2W2IA 3PU8A 2YU1A 5FYTA 4TN7A 3N9MA 3OPTA 5IVVA 3AL5A 3LDBA 5FP9A 2OQ6A 5FXZA 4CCOA 3PURA 4UF0B 3LD8A 5FP3A 2YBPA 5A3PA 4LITA 3UYJA 5FP4A 2GP3A 5FUNA 4CCKA 5FXVA 5A7WB 5FZBA 4CCNA 2YU2A 2Q8DA 5F37A 4BISA 5FZAA 5F2WA 4QXBA 3AL6A 4IGOA 4Y3OA 5FYVA 5FJKA 4GJYA 4IGQA 5FYIA 5LY1A 2XUEA 4Y33A 5IW0A 3ZLIA 4D6RA 5FPBA 3U4SA 5FYZA 2XMLA 4XDPA 5FY4A 5A3WA 4D6QA 5IVYA 4QU1A 5FY9A 3N9OA 4LIUA 5LY2A 3KV6A 4QXCA 5FYMA 4HONA 5FZ3A 3U78A 5FZLA 4V2VA 5FZIA 5IVFA 4CCLA 4CSWA 3KV5A 4UF0A 3PUAA 5FWJA 5FPVA 4C8DA 4URAA 4BU2A 5A7NA 3N9NA 5A7QA 5FYCA 3RVHA 4QX8A 5FXWA 4QX7A 5IVJA 5A7WA 5FZDA 3K2OA 3PUQA 5CEHA 5FZKA 5F39A 4QXHA 4LIVA 4HOOA 5K4LA 3KV9A 3ZPOA 4CCJA 5LW9A 5IVCA 4GAZA 4EZHA 3DXTA 5IVBA 4NUBA 5FZGA 5F3EA 1VRBA 2OQ7A 3N9PA 2P5BA 2GP5A 5FPLA 4EZ4A 3PUSA 3K3NA 5FXXA 4E4HA 5A3TA 5FP8A 4LXLA 2YBSA 5FZFA 5E6HA 4ASKA 3N9LA 5ANQA 5FYUA 5FY5A 5FWEA 2Q8EA 4AAPA 5FPAA 3N9QA 2VD7A 5FY1A 5A3NA 5A7OA 5FPUA 5A7SA 4EYUA 4D6SA 5F5AA 5A1FA 3NJYA 4DIQA 3AVRA 3PDQA 2WWJA 5IWFA 5FZHA 2XXZA 5F5IA 2OX0A 4CCMA 5F3IA 5FZMA 4AI9A 5FZCA 5A80A 3K3OA 4CUGA 4Y4RA 5FY7A 2PXJA 5F3CA 5FZ9A 5A7PA 5F32A 3AVSA 2WWUA 5F2SA 5FZ4A 3OPWA 3PTRB 5FY0A 5LWBA 2OT7A 3KVAA 2XDVA 5FJHA 5FYSA 3DXUA 3KV4A 4GD4A 5KR7A 3PU3A 5FV3A 5IVEA 5FBJA 5F5CA 3KVBA 5A1LA 2Q8CA 5FP7A 2YPDA 5FYBA 5FZOB 5FZ8A 5F3GA
chains in the Genus database with same CATH superfamily
3LAGA 5I0SA 2DUOA 2EAKA 4KL1A 1D7PM 3ZYRA 5EFUA 5CFDB 3ZSLA 1NCQB 2OVUA 5I8YA 1HXS3 4WBBA 1I6XA 1XNBA 2F4LA 3J7NA 3HNBM 4DO0A 5CFDA 2A5ZA 4Y1YA 2VMGA 1SCSA 1X7NA 1HB3A 3SKVA 5KHGA 4GXLA 2XLAA 3MPPG 3R05A 2N7GA 5AFEA 1SHWB 2WWSA 3ZXAC 2WINB 1R081 1UZYA 3T08A 1I1EA 4XETA 5ANNA 5CA6A 3FWEA 3U10A 2W0XA 5GALA 3UJQA 1GOFA 1CAUB 5DZEA 2WFF1 1IZ3A 1XYOA 3JU9A 3KB5A 4JHZA 4AQ2A 5T55A 4NHYA 1JUIA 1LGBA 2ARAA 2FQPA 2XONA 1EPZA 2EAAA 1CAUA 3QBQA 2O14A 1SLIA 1YCIA 4DEQA 1OMIA 4QKBA 4DPNA 3ZN6B 5E8AA 5FZ3A 4XBLA 1SLCA 3ZFFC 1R1ZA 4YVSC 4AFAA 4P9YA 2A73B 4NPMA 4NJ4A 3NSTA 1SG3A 5A7QA 2JEMA 1QXPA 1HV0A 1YUDA 3HNYM 3HMYA 1YFWA 2VQUA 4FXGB 4YGDA 1C1LA 5EJZB 3WXPA 5HV4A 4TTGA 2L9LA 4LOTA 5GLUA 2BFUL 5J98B 1NCRC 3D4KA 5F39A 2A1XA 4LIVA 1J83A 3O0XA 1O5LA 1CZVA 4LKFA 4CCJA 3U0ZA 1X8EA 4QM8A 4U2AA 2BGOA 1ND2C 1F5JA 2UYAA 4PIZA 2VVFA 5F3EA 5BPXA 2WNEA 4CEWC 3T0DA 2R062 5IFTA 1W6PA 3P6BA 2QNKA 1S0EA 5ACA3 2G19A 2A6WA 3HQUA 1VBD3 1VALA 3LQCA 4QB1A 2EIBA 5FY5A 3W58A 3Q8AA 4LE3A 3ZFFB 4RHV3 2O8OA 3I59A 4YVSB 5A7SA 1MS0A 4JDOA 3VD9A 3V0BB 5F5AA 5A1FA 1W9SA 1OOPC 3PDQA 3J8F3 1Z0HA 3C7HA 3CEWA 4L0PA 3WDXA 3ZFFA 1S4CA 4YVSA 4YW4A 3V0BA 5A33A 2B5HA 4XJAA 1OQDA 1BVP1 3TN91 1OD5A 4FPCA 3T4HB 1XSRA 3POYA 2DCKA 1UZWA 3MPBA 4AGGA 1TME3 2ERFA 1EAH1 4KU7A 3WCRA 1NCRA 4ZKTB 1O3SA 5FYSA 5G05L 1Q43A 1GWLA 1X82A 2JDKA 4COWA 2JXAA 3BPZA 4UW3A 1JU3A 5FP7A 3W9AA 2GNDA 2YPDA 1UOFA 3IDBB 3NKTA 3VL9A 1ND2A 2HWB2 5FZOB 3ZSJA 4CEWA 4M01A 3WNLA 4W6WA 3BTYA 1LAJA 3CHXA 3WG4A 1Z7S1 4XDOA 1SMVA 1REDA 2VBPA 5FZOA 4C91A 1L7RA 3ON7A 1HN0A 2ARBA 2Y33A 4AQSA 3AJYA 1PIV1 1VBC3 4MGYE 3O7OA 4XFAA 5D8AC 1OOPA 3AL5A 5JMOA 1D4M3 2OQ6A 1BEV1 2PHFA 5FTTC 5BY5A 5C5TA 1MZEA 5J37A 3FJSA 4NR1A 4I3PA 2VY0A 5L19A 4YG6A 1VB4A 1WLWA 3SH3A 1XYNA 2OZ6A 1DIWA 1BHGA 1AR82 1WW5A 2RV9A 2XBO2 3BTAA 4M3CB 4R52A 3VDAA 2D97A 1KD7A 1VBE3 2TEPA 2UWAA 5F37A 4S2HA 4CDWB 1NYWA 4GMP3 4M3CA 5FZAA 3AJZA 4Y1ZA 4DUWA 1W3VA 5JXJA 2EF6A 4BIOA 1PMIA 2ORZA 4L9BA 3WG1A 4QM9A 3ZLIA 2OUJA 2RMU3 4IEWA 2FDFA 3HOBA 4LA2A 2VVEA 2RM21 5GLZA 4IEPA 4JKMA 4JTOA 4DY5A 1VBB1 2Y60A 3B9CA 4QU1A 3BIWE 2A6XA 4QXCA 1X9TA 4UFIA 3L2YA 1ASJ2 1RUC1 2HBUA 4BLIA 5D8AB 5FZLA 1FNYA 1XNTA 3N7LA 1VLNA 5I91A 1FPN3 2WQ8A 2QTWB 3POWA 4LBQD 5D8AA 3TOJA 4R9BA 4XPVA 1UAIA 3RPQA 2BNNA 5A7NA 1CZTA 4F7ZA 4PHZA 2ZKNA 1BLZA 2Y38A 3WHTA 1AYN1 1W3XA 4LO4B 4LBOA 1RHI1 4Q4Y2 1W90A 1NLQA 3HEIA 4XEZA 1FOD2 3SLIA 2ZX4A 2J1UA 1PO12 4FI9A 1RINA 2D3RA 2G9FA 4XXAA 4F83A 2Z5WA 4HOOA 4QKFA 3GF6A 3UESA 1E5IA 1YFXA 2FZ1A 2QQMA 3ACLA 4IE5A 4HL0A 5CU1A 3MLKA 4EZHA 3A0NA 2Q1ZB 4IEQA 2XJUA 5KHIA 5DAWA 1MR5A 1W99A 1KGYA 2VW0A 4Q0SA 4AEKA 1OH3A 1YFYA 3TEWA 3K3NA 3N4MA 4XFIA 1RL3A 2WA4A 1FX5A 3JXSA 1WW7A 3UGGA 2LW8A 4BCUA 5CBLA 4NIDA 4JVAA 1VP6A 5LASA 4YYOA 2ZGKA 4Z2AA 3IWZA 5A3NA 2E53A 4LK7A 4LHLA 2IFRA 2OW4A 2CL2A 3DUIA 4Y1UA 1UXXX 2AENA 5AVAA 2BBVA 4N8MA 2OX0A 4P9GA 4Q1RA 5FZMA 2WAAA 5C7GA 2DBIA 3HQRA 1REEA 5HXVA 1FNZA 4QKNA 4Y5TA 4YPJA 4XAEA 5C3QA 2W1WA 2Y8KA 3PJQA 2JG8C 5ERLA 4I09A 4R4XA 4QAWA 1HXS2 3B93A 2RDNA 4W65A 1RVF1 3TWIA 1PX4A 4IDZA 4NN0A 4H7MA 5LEKA 2B39A 1HW5A 3VBRC 3LDRA 2VTFA 4P00B 1QJX1 4QGNA 2BZDA 4Z1VA 4M0HA 4QKDA 1VJ2A 3AXDA 3EJKA 2VNGA 2QDRA 2Q5TA 3N36A 3LEIA 4I02A 4EN8B 2R1BA 2FDHA 4RR3B 2WNUC 5FYHA 3GGLA 1O3RA 1V9U3 1UYYA 2YBKA 2OPWA 1W6QB 2RS32 3QH6A 2AR6A 3J26N 2ZEZA 3VDBA 1PVC3 3AKTA 3ZDVA 1COV3 2QQLA 1W6QA 2WSUA 1VBA3 3PU8A 4GJZA 2A6YA 2P3KA 1DQ5A 5FO7B 3AMNA 1XU2A 3I3QA 1K42A 2JDMA 2VH9A 3NNLA 1R1A2 4X6QB 1PZ7A 3EMRA 4XILA 4GA9A 2D7FA 1W8NA 3WLUA 1RUOA 1BYHA 1HB1A 2JG8A 4XIKA 3WP3A 2VZOA 5L36A 1EPWA 1AJKA 1NLRA 5EPAA 1O91A 3S7EA 1OFSA 1OLMA 3SNMA 2MEV3 3LA7A 3VBRA 2ZCWA 1N1SA 3HD8B 1BBT3 4B4PA 3EYPA 3D3AA 2RDQA 2HWC1 2W92A 3NJXA 4M4RA 3S6PA 4Q4V3 3SITA 1WBLA 4OUSA 4QPYA 4YZ1A 2DVBA 1CAWA 3LE0A 3JB8A 3HNMA 2QBXA 5FO8B 3JBG3 3HJRA 4FPKA 4YGBA 2LTNA 4BQ5A 3BIEA 2VZVA 3VBHB 4COVA 1JZ5A 2G4IA 2VZUA 5FWJA 4FOWA 4P5HA 4Q29A 2W5FA 3NMBA 4QPIC 4NHKA 1KJRA 2ZS6B 1ALYA 2BWAA 2X09A 1UY4A 2DTYA 2ZX3A 1MPXA 4MGKE 3I8TA 1A34A 3BU7A 1HQNA 4LLFA 4MZUA 1IG0A 1LR5A 2VUJA 4RN5A 1S0BA 4AHYA 1NQJA 4OHXA 4EQVA 3T3YA 1YEWA 1HRV3 3U75A 5I8SA 4GAZA 2VMDA 1WMXA 1SFPA 2J7MA 3CJIC 3T2QA 1NXMA 5G04L 4OZOA 1RUE1 4EZ4A 1ZZ7A 4FPFA 4YM0A 5FXXA 1DZTA 2ENRA 3AMQA 2UWBA 3QACA 4E4HA 2FDIA 3ACFA 3BALA 1XNDA 3N9LA 4DRRA 2ZZJA 4ET7A 2CSGA 2PLV1 4P9IA 4YSFA 3MIGA 5LEJA 2W1SA 4NHXA 4YM1A 4B8EA 3OUIA 4DEVA 3W5MA 4AHZA 1ACCA 3AYDA 1W0NA 4KG0A 1PM4A 2VL4A 1JUHA 2H0VA 3LIHA 4QPIB 1J1TA 4UW5A 5EHDA 1QGLA 4DY3A 2XKPA 2WZR1 2WUHA 5BNPB 3ETQA 4UFKA 4NMIA 5F3CA 3CIHA 4JRLA 4QPIA 4AW7A 4QD2A 1LEMA 2QZ3A 3FFZA 5DG2A 3X29B 1W9TA 1AX2A 4GB32 5LA2A 4KU8A 4P02B 2AH2A 4XJZA 1W28A 1CPNA 2Q8OA 3CJIB 4FPJA 4NWVA 5F8PA 5FUIA 3SC7X 5JOXA 4LBQB 3VV1A 1JS9A 2YB7A 3H0OA 1PGW2 1D4M2 2DURA 4Q0UA 5TSWA 3WT3A 5FOJB 1QKQA 2BPA2 3CJIA 4LORA 1V6IA 2J42A 2YC2A 4RS5C 5FZKA 1JYVA 3Q9OA 4BMBA 4PQQA 2HYXA 4D7YA 5K9YA 5CG8A 4YM2A 1XBFA 3BVCA 3VB9A 1VBE2 3ZO0B 3PVOA 5DG1A 1DCSA 2PA7A 4B4RA 4CPBA 2TUNA 1PVXA 4M00A 3MW4A 2IXHA 3PVNA 5C70A 1V6MA 3ZOIA 2JG9C 4OMCA 4XW3A 4LHSA 2DUQA 3MW3A 2JECA 1RUI3 2ZHNA 4SLIA 4CEYC 4CXXA 1VAMA 3MIEA 2VU9A 4Q4W1 3KQRA 5C33A 2W3JA 5J96B 5JIUA 1PGL1 1D2SA 2D93A 1QOOA 3N3HA 1JZ7A 4PBOA 5IYYA 4XZUG 4A45A 3MF9A 4OZXA 3ZKYA 1W8TA 3F95A 3QH7A 3ZSEA 4UOJA 1POV1 3WDWA 1NLSA 4LO6B 5HCBA 4GJYA 4RS5B 2VNVA 2XUEA 4OI1A 1J58A 1UPIA 1GNYA 2O1QA 4YZ4A 3U4SA 1EUTA 1VRH1 4RS5A 5C5UA 1CIYA 5F6LB 1F31A 1LOFC 2D6OX 5IVYA 4MOAA 1HRI2 3LSEA 5B4XA 3WY6A 1AR61 4DFSA 4W8JA 4B29A 5J3UA 3T0BA 3TNPB 4CEYB 4ZZ8A 5FPXA 4H3WA 1BZWA 3CBNA 2JG9A 3OD4A 4MUVA 1XE0A 4CEYA 3FX3A 1Z7S3 3EXUA 4QHOA 3K2OA 3M4FA 1ZZ9A 2E31A 2R49A 4EWAA 2ZGPA 4WM8B 4AHXA 4YRDA 4ZHNA 3AKRA 4IERA 2YMZA 4IE6A 3OBTA 1PM7A 4CCCA 5LW9A 1L7QA 3IZOA 1T6BX 2I2SA 4KMQA 3KGLA 3H1YA 5IVCA 3RMYA 2Q30A 3NJVA 1W8OA 3DXTA 1XSQA 2VQAA 2Y26A 3KGZA 1QOSA 4L11A 1S0IA 2J22A 1C28A 3FC0A 4BMEA 1NX9A 2BGPA 5T52A 3WDUA 2XLFA 3WCSA 2VNRA 2DVGA 1MZ6A 4P5YA 5A6QA 4RA0A 1GZCA 4XQWA 4PIYA 4YW5A 5LRRA 1KQRA 1CESA 1D4VB 3N9QA 4JKKA 1LOFA 1B09A 1HJFA 2XHKA 2WIIB 1YNAA 4IEXA 1XQNA 1YRZA 2G1MA 1FMD1 4O65A 3VLBB 1RTVA 3O1SA 1APNA 4DIQA 4CUCA 1OF4A 1SLLA 1W6NB 5C9AB 1RUG1 4CCMA 3VDDC 1XE8A 2XR4A 1AR71 4YGEA 2XVLA 3K3OA 1N3PA 1W8HA 2RM23 4J1XA 4OYUA 3LCPA 3ZYPA 1UYZA 3AVSA 4ARYA 3BCWA 1YHFA 2WSVA 2WR9A 3DYOA 1RUC3 4LTAA 4WVZA 5FJHA 4Q2FA 3OEAA 4HLTA 1G9FA 2YDEA 1VBA2 2J1RA 3B00A 3HWJA 4S2DA 5I0UA 3BOPA 4AFBA 2GU9A 3KT1A 2DU1A 2VOVA 2WQ4A 2E7QA 5FYBA 5B2GB 4CDXB 5SV8A 2IFWA 1KFUL 2ILMA 4LMFA 1RXGA 1QNWA 1RHI3 1ZVFA 3O1OA 1H2MA 1IS6A 2HEYF 1AX1A 2AZ5A 1EYBA 5FZ6A 4IL7A 3QCWA 4H14A 1Y9MA 2C6SA 4OVEA 5FUPA 3THDA 2R063 1GBGA 2MEV2 1UWWA 3MEPA 3MI8A 3MO4A 3OF1A 3PL0A 1SLAA 4ZS3A 3VDDB 3ZXFA 3WEZA 3H8XA 2E7AA 2RR11 1AL21 4HMZA 4Y24A 2BTVC 3NAPC 1BBT2 2B9UA 3G7DA 4BJ0A 3LOBA 1OQEA 1VIWB 4XJ8A 3UETA 3VDDA 4A3ZA 1CWPA 3H3ZA 4Q4V2 5H9QA 5JSPA 4K8FA 2B46X 3O1MA 2XHNA 2QQIA 1XNCA 3LA3A 2NZ9A 1A6CA 1RC6A 3UV9A 2HKXA 3KCYA 1DBNA 1NY72 1AYM1 1H6XA 1RMU1 1N3QA 5AC93 5CFCC 3UK9A 5F2WA 4D94A 1H1AA 3KT7A 2EICA 3M70A 2XKOA 3I49A 3ZIXA 5JWPA 3GNEA 2EALA 3HT2A 3OBZA 2VVDA 2BV4A 3AMMA 1LHOA 3RZZA 3H1WA 5FYZA 3B3QE 3FHQA 2LRPA 3HT1A 1F35A 3F2ZA 1RIRA 4ATFA 3DKQA 5FY9A 4I2OA 3ST7A 4ORFA 4UAPA 3VGIA 4KBZA 3E5UA 3SH5A 4AEDC 5L9VA 2YFUA 1J84A 1CX1A 3RQ0A 1PK6B 1AUYA 2OA2A 3PUIA 4JV4A 4DUVA 1L7LA 1HQWA 4URAA 2WQZC 5GZDA 1OH4A 1UW8A 4X8PA 2FBEA 1NKGA 1R082 4QX0A 3AM2A 5FZDA 4ZXEA 5A3UA 1X8MA 2DFBA 1LENA 1CJPA 3M8LA 2MPFA 3L2HA 4I0AA 5CFCB 1HB2A 5IJRA 5JPNB 4LA3A 3WF4A 3N35A 4GMP0 1BJQA 5L73A 1DP0A 2IVIB 5CFCA 2WFF2 2A71A 3OYWB 1WLCA 1V6KA 2HEVF 1JYNA 4HKOA 3CQOA 2EIDA 2PAKA 3VKNA 4LBLA 2B9VA 5FAXA 4FTBA 1WD4A 1TMF1 1JMUB 2VOTA 3LF7A 4BQYA 2A70A 4AVCA 4AEDB 1SCRA 1GKBA 2ZX0A 1UMZA 1K5JA 3C7GA 5A70A 4LUKA 5KXCA 4WM7C 2ZJCA 4AEDA 3U14A 1V6JA 1WW4A 4FFGA 3VZLA 4Q0PA 2JKXA 3NV2A 2LALA 3ZIWA 3O1VA 1W9WA 3K46A 2JDNA 1NQDA 1ASJ3 3WP5A 3OY8B 1YQCA 4ARXA 5F2SA 3UKVA 4CDQB 1DGRA 2JENA 2VM9A 2WNVC 5EWSA 5GZFA 1UOBA 3OY8A 1UXZA 5KR7A 3PU3A 3RI8A 3UL2A 3WNKA 4K8RB 5F9TA 3B94A 1FATA 3BU0A 4Q4Y3 5CNAA 4QX5A 2ZX2A 3Q8BA 1FOD3 3THCA 1CQ9A 1RUF1 4FPYA 1PO13 2W87A 3VN4A 4EWDA 4NO4A 1NCQC 1PGSA 2B42B 3M2MA 3N7KA 1XE7A 1XRUA 4N90A 2JDUA 4IEYA 4XUNA 5DDJ3 1GSLA 2VZSA 4V2WA 5APAA 3N7JA 3NL1A 2NQYA 2Z79A 5T5JA 5FCCA 5GZEA 2QFEA 1UY0A 5FMOS 4CXWA 1RUH1 2W2IA 1KEXA 2F4PA 4S2GA 1LHVA 3DYPA 2GMPA 4WM7A 5D2AA 1F2NA 4CCOA 3ZXGA 5FPZA 3TN92 1ENRA 1HDKA 3BTZA 2PELA 5EYYA 4B1LA 2E32A 2WC2A 2WNVB 1EAH2 3I54A 4LULA 4PQ9A 4HK9A 4Q8KA 4QPGB 1CPMA 1LESA 2YU2A 2WLPA 4YZ3A 2WNVA 4KWKA 3FE5A 1F5FA 5CADA 5DAPA 2RE9A 2D6PA 3MBWA 3WVJA 2R7EB 1JOJA 2ZGMA 4AVVA 1R091 2PHLA 2RJKA 5JPMB 3RZLA 2WZR3 2YC0A 1NA1B 5J7MA 4AVBA 2ZAAA 4ZPIA 2QZ2A 1Z7S2 4XACA 5FY4A 4BZ4A 1NCQA 5IK8A 1H9PA 3T1MA 4A42A 4PT6A 4XUQA 2VZQA 3KV6A 2XLGA 3I4IA 4C90A 1DZRA 1YQ6A 2WL1A 3TEXA 1OLME 3MHZA 1PIV2 1NUKA 1ZBA1 2R073 1TEIA 3A21A 2HEWF 4JDNA 4QQHA 5A6ZA 1BEV2 1RUD1 4GIQA 1IPJA 4AK3A 1PZ8A 1H1MA 2RS33 3U4XA 2SLIA 4AVSA 4HVQA 3K48A 2Q4SA 2YFZA 4HETA 3IKWA 1UU6A 2A75A 3DECA 1CIWA 4JGYB 4GWMA 3FHAA 1QMJA 3CKHA 4RGKA 5C6CA 5JXIA 1QJEA 3AXEA 3CO2A 2GSYA 2VCCA 5E1RA 2HWF1 4P9JA 1R1A3 1VE0A 1XXNA 1C8M1 3ILFA 3OUJA 3S5AA 1EV13 2RM22 5FP8A 2YBSA 4OI2A 1UO9A 1VBB2 1LTEA 3ZN6A 3O14A 3KCCA 2HWD1 5FPAA 5EV7A 1RUC2 1XC6A 2ARCA 4NRPA 3VL8A 5FMOL 4FFIA 5JCTA 1BKZA 4A44A 2HLEA 2CAUA 3BN6A 1YQ2A 5IWFA 3ZFGC 5FREA 3OD0A 2YUEA 3LGRA 2OUHA 4NWWA 4AI9A 3FN9A 2GNTA 5FZCA 1AR91 3ASIA 4Z2WA 1C5IA 4XTMA 2RS11 3VBSB 5F32A 1RHI2 2Y64A 3OEBA 1SFNA 4E2QA 2OT7A 1CZSA 4AEMA 5CYYA 4FP3A 1YJLA 3D0JA 3EHKA 2GH2A 2XJVA 3IAQA 3DXUA 1O5UA 4HVOA 3ZXKA 1KRIA 3UGFA 2CWMA 3FFQA 3KVBA 4I0WB 2IXIA 1I5ZA 2ZGUA 4LEJA 3BYWA 4MO3M 1VR3A 5F7UA 2FCTA 1BMV1 3MICA 2ZGTA 3WSOA 5E89A 4AWDA 2XG3A 1DGWA 4FQ4A 3ZFGB 3AP5A 4K40A 5AC92 4QWNA 2PHUA 3APBA 5AFBA 2VTXA 4AI2A 5FP9A 3VD7A 3ZFGA 1UU4A 1V6OA 4UF0B 1UQXA 4XURA 5JSOA 1MVQA 5HV0A 1ULFA 3CU7A 3K4AA 3T4VA 4CDWC 3HAGA 3OCPA 2VJXA 3WW2A 1DQ0A 1RVF2 4YW2A 5FZBA 1UY1A 1BQPA 1DLLA 1H2LA 4MXVA 4CU9A 5K7PA 3ZM8A 3NNGA 4OULA 1QJX2 1QIQA 4BH9A 3E6BA 4R4ZA 3I3EA 3VKLA 1AJOA 5FIXA 1N47A 3PIGA 3VKMA 3J9SA 2GC1A 2V5YA 4CYDA 4NIAA 1ODNA 1W8ZA 2WN3A 4HPKB 2BDRA 4GB33 4U36A 3PUHA 5A3LA 2QQKA 5IHRA 4O9EA 4Z82A 3WW1A 2NM1A 4HPKA 2WT2A 4YW3A 2BQPA 1JOPA 1WUVA 3VHRA 4BQXA 3I2KA 2QQOA 2YV8A 5KXDA 4HVRA 5DAXA 5LK5A 5ABJB 3MIFA 2QVSB 2BGCA 3LFIA 4MGTA 2A6VA 4YLZA 1LCLA 3W59A 2DDUA 3RZMA 3RG0A 2VMEA 4XUOA 4BU2A 1X33A 1Y43B 4YW1A 3AZZA 4QX8A 1YIFA 3K75B 2V4AA 4KWLA 3VBUB 1O4YA 3WG3A 3THPA 5C8WA 1GOGA 1BCXA 4CDWA 1D0HA 2CWSA 4AG4A 1JU4A 4QDSA 5FLJA 4XF0A 2G9ZA 1I5PA 3D0SA 4KBBA 1W2TA 5C71A 4XIOA 1HX6A 4CE8A 5EJ3A 4FAGA 1N3OA 5FPLA 1F9KA 2HWC2 5JZGC 1HQLA 3IAPA 4LO5B 1MEC1 3R4DB 2MHFA 5E6HA 3AB0A 5JI7A 1E5RA 2B45X 3AMPA 2Q8EA 1LGNA 1M4WA 2EVXA 1AYM3 2YZ4A 3JD71 5FY1A 4IETA 4LE4A 2E7TA 3I2GA 4NPLA 4E4DX 4FPEA 2ET7A 1IPSA 4DRVA 3MIBA 5JR2A 5EXOA 5FZHA 2FCUA 1ZM1A 1LEDA 1PO21 1HRI3 2O0OA 5M0TA 4CUGA 3RZKA 3RRDA 2BERA 2D5FA 3NV3A 5JVVA 2MNGA 1KDKA 4GULA 3E6CC 2RS53 1LECA 1UYXA 2KXLA 5DDJ2 4TXWA 1LHNA 3WZ1A 1W0PA 1DQ6A 5T3NA 2ATFA 1NT0A 2FZ2A 5H9RA 2KR2A 2VMIA 4LKEA 3SISA 3HBZA 3LDKA 5FV3A 3CMGA 5KC6A 1C5HA 2UURA 4FPHA 5F5CA 5A1LA 3E1F1 3FLTA 4MGIE 5JZGB 1KJLA 4DXRA 1S0JA 2R041 1S55A 2VMFA 1RUE2 3D5OA 4O61A 2JWPA 4RR3C 4KWJA 4PIXA 2JE9A 3A23A 3ENRA 2D44A 5BNNC 5JZGA 4G4FA 1LB2A 5C3OA 1CX4A 2PLV2 1UY2A 1ZZ6A 2AREA 2SBAA 2ZHLA 3KZ4C 4QQOA 5FKBA 3ZXEA 1HIXA 3ZVXA 1V6NA 3QOPA 5T5LA 4JRAA 1QY4A 4SBVA 3H7JA 3T0AA 2ZABA 5IK5A 1KS4A 1YYNA 1QXRA 1UMHA 2EIGA 1KXGA 2VBDA 4TN7A 4UXAA 1DGRN 1C3HA 5IVVA 1OURA 2XL9A 4UWDA 5FKCA 1OPMA 1H8TC 1WCQA 2F6BA 2WZR2 3KT4A 1TE1B 4PCRA 2C24A 2X10A 3OBRA 4EE2A 1FYUA 4X8NA 5FXVA 2BYVE 4D8MA 4C1WA 5LA0A 4GWJA 2DCTA 2JICA 3HR9A 2WS91 1G9CA 3O1PA 4ZS2A 2Z42A 4IV1B 1US2A 2R072 4RQPB 1IGOA 2ZGLA 3KLSA 4EV0A 1OLRA 1O6UA 4S2FA 3OGGA 5BNNB 5BNOB 3R0RA 1CR7A 5IW0A 5LY1A 4RR3A 1UX6A 2NLRA 5LB6A 2XVKA 4GKYA 5BNNA 3D82A 2W47A 4L99A 2DF7A 5JR7B 4IV3B 4CU7A 3TBDA 2D6NA 4XJWA 4A6OA 5J1XA 3DYMA 4I3GA 5FYMA 3U78A 3VBFB 3J7MA 2VG9A 3IB3A 2ZXQA 3VBHC 2UY8A 4LNVA 5IVFA 3OSDA 1H8TB 4K3UA 2OZJA 3KHBA 2YGLA 2ID4A 2P37A 4NRMA 3N7MA 2W52A 4IEZA 4P9LA 2VZ3A 1EV12 3MLLA 4PDWB 3N9NA 1YJKA 1H8TA 3M7AA 1RXFA 1S2BA 1PGL2 4OUEA 2WT1A 3AKPA 4QX7A 4ZU4A 3ZX7A 3UNPA 2FCVA 1W03A 5KHKA 5FLHA 1UF2C 2WA3A 4DB5A 2RDSA 1RUH3 2BBAA 3IDEA 4OI0A 4CTEA 2RDRA 4CUBA 1QQP1 1U5XA 2XBO1 3KMHA 4Q4X3 3RI9A 3PHMA 3U11A 2FMDA 1VRBA 2ZGOA 1VPHA 4FTEA 2GP5A 3OGVA 3OUHA 3PUSA 2XWBB 1VRH2 2NMNA 3RZJA 4NE9A 1SBFA 3H42B 1DU3D 1TG7A 3INAA 3LEKA 3ZYIB 3C7FA 4AAPA 2JJ6A 1C1FA 5JAXA 3GYDA 4KH9A 1ULGA 3W5NA 3MIDA 4MHRA 5KHJA 1OF3A 1UL9A 3A22A 3VBHA 2WWJA 1GNHA 1A3KA 5BNPC 5A6XA 3LFMA 1DG6A 2P3JA 3BB6A 3W20A 4TLGA 2Z69A 2QQUA 4IEVA 4Y4RA 3CZJA 3TB0A 4BE3A 1Y7BA 2XB6C 3ACHA 3T2OA 5E16A 4CP2A 4H55A 2W1QA 1OQ1A 1DYPA 1GUIA 1B35C 2VECA 5C3RA 1ZBE1 4CDUB 5IVEA 3MUY1 5LBFA 1IKQA 4W6XA 3LB9A 2Q8CA 5LCWL 1R083 4G9SB 2VO5A 3VD5A 3SXWA 4FCAA 4FVVA 2XOMA 4FFFA 2GALA 4QGLA 3BTXA 4N53B 2BVBA 4LKSA 3CLPA 3OGRA 3VHNA 4LR4A 2WFF3 3WQ1A 4JQRA 1QH6A 2BEOA 4FOVA 2RJLA 5FZEA 1FMD2 4B1MA 3I3MA 1DQ2A 4Z92B 1JTZX 3TEZA 4P9XA 4BYYA 4EN7B 3N9MA 3HIFA 5HCAA 1RUG2 3SEPA 3LSDA 4PLOA 1AR72 5BNPA 5FP3A 3RYPA 4CCEA 1DDLA 2AEZA 3ZFEC 5EP9A 4KWUA 4GWIA 1JZ8A 3O0VA 3Q8CA 1B35B 1BXHA 2GP3A 1GR3A 1QDCA 2I45A 2ZEYA 3B5LB 3POSA 5A7WB 1GZ9A 3AMHA 3VKOA 3ZR6A 2F17A 5HPOA 4NROA 1B35A 4BISA 1RJ8A 2XJTA 3DL3A 2ZGQA 4H7LA 4LBQA 4QXBA 2R32A 2LS6A 4YW6A 4XJUA 1WKYA 4I0BA 3IDCB 4LUMA 4AVTA 4LHNA 1HXS1 1W9YA 4XXPA 4YZ2A 1QJZA 3H8RA 2ZHKA 1ND3B 2RS13 2XJPA 2XMLA 4OUMA 3LPGA 2JDPA 4MV2A 1S1AA 4DINB 1EUUA 4WVWA 1GWKA 2VCAA 2AYHA 3ES1A 4J6GA 3RSJA 1GLHA 2W94A 2PAEA 1ZA4A 4M0NA 2XL7A 3S7IA 5I0RA 1US3A 2RR12 4CSWA 1AL22 4HN0A 3ZFEB 5CIRA 2FDKA 3C3VA 4DZGA 4XDQA 5FMDA 1C4RA 2C9AA 1YIPA 4IW3A 3ZFEA 4DXTA 4WM8C 3PVEA 3VDCA 1WA4A 1W2OA 4CP9B 4FAHA 1JYIA 3WHUA 1AYM2 1G7YA 2Y6LA 1RMU2 1E5SA 5K4LA 3TN93 5K0UB 4J1WA 4Q27A 2ZBJA 2CDOA 5C4WB 4B3NA 5IVBA 1EAH3 1L3JA 1URXA 2P5BA 3RJ2X 1YI9A 3FMGA 3WDTA 2WLQA 5IAXA 2V5DA 3AYAA 3DCQA 4QMAA 4Y20B 2YYOA 2YG0A 5JXGA 1WLTA 3KHCA 3ZYJB 4D7TA 1WCSA 2RS52 3JQWA 3FZ3A 3CF6E 5A32B 4D69A 4Y20A 4AGVA 4QPWA 4ATEA 5C9AC 4QT6A 3MDPA 5DUUA 3AZYA 4D0QA 1UMIA 4HK8A 3EQEA 2XXZA 4YVWB 2UU8A 2UWCA 3A4UA 5F3IA 1YO8A 3LZZA 1LOGA 1PX3A 3ACGA 4AQTA 4QB6A 3CJXA 1VMJA 3POJA 3DEMA 1PIV3 3EBRA 5L7OC 4WM8A 4OQ8A 1O4ZA 4FT8A 5LATA 1GP6A 1BEV3 1OVSA 2B8MA 3IN9A 4ZZ5A 1VMHA 5DAVA 4BK5A 1Q8PA 2D6MA 1W8WA 5ACA1 1E5HA 3POFA 1UZZA 1VBD1 4BPZA 5FLIA 2C4XA 1W04A 4CDXC 1DF0A 3UT0A 1OT5A 3JCIA 4RHV1 3ZXJA 5FZ8A 3GBFA 3GHNA 4GH4B 1NAEA 4K1ZA 2EXHA 3OJBA 1KS5A 3J8F1 5ISLA 4AI3A 4AEJA 2V73A 1V0AA 1WD3A 2XQXA 4PLNA 4DS0A 2ZGNA 2RJ2A 1WGPA 1Y4WA 2C26A 3I2JA 3MGUA 4FP2A 4K6BA 4E2GA 4A7YA 2VZRA 4AF9A 1PMHX 3C8XA 4AFDA 2YU1A 1W6NA 5C9AA 1TME1 3GBWA 4CRQA 3OPTA 4META 1VBB3 1Y9QA 5FXZA 2P1BA 1IOAA 3ILRA 4UI9L 3BUCA 2E6VA 4HFSA 2YBPA 2ZHMA 5L7OB 1A8DA 2JB4A 1YQ5A 1SPPB 4I01A 4AFCA 3QLQA 2PHWA 1SDWA 4JQTA 4ISRA 4FOYA 5L7OA 4CCNA 2XGXA 1WWYA 2P3IA 3IBMA 2CNAA 1JYWA 3RWNA 1AYN3 3POIA 3WINE 3SCGA 1WCDJ 2ZAHA 4IGQA 1RUF2 2VCMA 4CDXA 2VPVA 2DUPA 1Q8QA 4XMIA 2GZWA 4HBNA 1LULA 1Q8SA 1JOBA 4XDPA 4COZA 4DXZA 1VBC1 4WZFA 1IPKA 1NZCA 3I2IA 1D4M1 4LIUA 1QJU1 1MQTB 1LJ7A 4XVHA 1HJGA 1JW6A 1PK6C 1RUH2 4UT5A 2VQTA 4JDMA 1UOGA 5FZIA 1TVGA 5I93A 4CCLA 3W21A 3ZXLA 2PTMA 3WR0A 1QHDA 2CAVA 4Q4X2 5A3MA 2PYTA 3LEGA 1VBE1 3NKGA 2ZKLA 4FO9A 4YM3A 1LU1A 1UN1A 1WMEA 4GMP1 5F5QA 2EXIA 3RVHA 4HSLA 1UY3A 2J1VA 1ZREA 2V72A 2DCYA 2QQVA 3MIHA 1DYKA 4XABA 1W6MB 2QJVA 4QXHA 1K45A 2RMU1 3GCWA 1GU3A 2VE1A 2XH6A 4K9SA 4R9AA 2WZ8A 4D3WA 1U5IA 4W4ZA 3LEMA 5LBBA 5EIYB 3WNNA 1R092 1M06G 3OGSA 2EXKA 2IVJA 3VKFC 3ORJA 1RVF3 4FPLA 4Q0QA 1W2AX 2D98A 4A7KA 4M3CE 1QJX3 2GMMA 4YZ5A 2W91A 1FPN1 5ANQA 4AAXA 4XHBA 4QXKA 1OA4A 4MHUA 1DZQA 4PJYA 1OLQA 1ZBA2 5CKQA 2NP0A 4BWOA 1PK6A 4OHWA 3SEEA 1H6YA 1RUD2 2OIIA 3CNAA 2X05A 3VUOA 1GZWB 4CDQC 2WJSA 3VZKA 4RYDA 2VZTA 3CL1A 1CGPA 4LBKA 1LU2A 2WWUA 5FZ4A 1IQAA 5FY0A 3R4UA 5KHHA 1GZWA 4ZU5A 3SCFA 2WABA 3SHRA 3E5XA 4JKLA 2JKBA 3U37A 2WDBA 1JODA 2CU5A 4Y22B 4N7IA 1CAVB 5B4NA 5C3PA 2EXJA 1QJY1 4CP1A 5IT6A 3OYWA 1C8M2 1ODMA 2HJIA 1IKPA 3DV8A 4NHMA 2G9GA 1RUJ1 1XYPA 4E8CA 1H0BA 2ZPXA 4KQ7A 2AUYA 2D6KA 2DCJA 4O7XA 2V09A 1GANA 1JHNA 3AFKA 2HWD2 4IUGA 1VAVA 3WF0A 2DVFA 1GWMA 2WFPA 4W50A 4YG3A 2JDYA 4NIHA 4F8AA 4LBMA 2HWC3 5D1IA 2JDAA 1JYTA 1ZZ8A 1QEXA 3GZAA 4FXKB 4X6RB 4EJRA 3URFA 5KBFA 4XBQA 3ME2A 3PURA 3T2PA 2Y6FA 1AR92 4CXYA 3B01A 4XFHA 2RS12 1GQHA 4PF5A 4QPGC 2VOWA 4CA9A 4XUPA 4CDQA 5A3PA 1S2EA 4MH0E 3HPNA 5IK4A 2Y34A 5J48A 2BNOA 2J1AA 2Q8DA 2W39A 5IUQA 4BM8A 3Q8FA 1V9U1 2X53S 2WN2A 3D8CA 1NA1C 3H3UA 5F6KA 1MZ5A 2P17A 3DPRB 4FQZA 3ZPYA 1IHMA 2D3SA 1PVC1 1U5ZA 4XOGA 4HT1T 3RMXA 3AP6A 1COV1 2VTXJ 2TNFA 2X5IB 5C8CC 1OKQA 2C1FA 3UKNA 1VBA1 1BMV2 4GKXA 1ZYBA 1QOTA 2DVDA 4XFBA 1LOBA 1AXKA 4KI5M 1XB9A 1NXD1 2LROA 1SLBA 3MFCA 4OMDA 3LKJA 1ZBE3 4XF9A 4FPGA 1RUE3 4HONA 4UBHA 2VGDA 1ENQA 1ST8A 1CVNA 3ZR5A 3AFGA 1WMFA 2PLV3 2CTVA 4JZRA 1I3HA 1VAKA 1X36A 2VMCA 2J1EA 2VUDA 4QGMA 2VBBA 4JGYC 2MEV1 4JGZB 4HG6B 1MVEA 4YFWA 5IVJA 5JDBA 4QPGA 3AYEA 4QQPA 4BLJA 5CEHA 5JLVA 3RZHA 1WMDA 3P1IA 1UZ0A 2ETEA 2K0GA 1WCUA 2RG4A 4ZONA 3O1UA 1JYXA 4XCBA 3GCXA 1K5MC 3GHMA 1NA1A 5C8CB 2K2SA 2OQ7A 4BOWA 5EJ1B 3FHIB 3ILNA 3JBG1 2B7YA 3DN7A 5C8CA 4DOUA 3DGTA 4N9HA 3NO8A 5E88A 5FWEA 3MLJA 2A3WA 1IQDC 2FMYA 4XF3A 5GLWA 3WP4A 4BQ4A 4NOTA 4BQWA 4BQ2A 3MYXA 3OPZA 3KS7A 5A7OA 1HB4A 1VB2A 4ZXKA 1YQ8A 2RHPA 1SQ4A 2HWE1 4LHKA 3ZSMA 1MS4A 1CN1A 2Y6JA 4Q8LA 3VBSC 1Q8OA 1LHWA 1S0GA 1BK1A 3I3BA 5A80A 1W39A 2LM3A 1HRV1 4BDVB 1FXZA 1SDDB 2JD4A 1IS4A 1PNGA 3OPWA 4JGYA 5EYXA 5FBZA 4MYEA 1AXZA 4MGSA 5T50A 4F3JA 5LWBA 3I7DA 2Y6HA 2WRAA 3WP6A 4BK4A 3E97A 3O1TA 4Q0VA 4XFCA 5I8TA 2ADDA 2BWCA 2DVAA 1J1LA 4YNIA 4E8DA 4NAOA 1K5MB 4UFJA 4JHTA 4Q4W3 5FK8A 2XPJA 4AYUA 1WCKA 1W0OA 1K5MA 4QX1A 1MEC2 4XUTA 2PHXA 5FJKA 2P2KA 1WBFA 1Q8VA 1S2KA 3NV4A 3PJYA 4UW4A 1POV3 2Z4FA 5LZ6A 2P34A 4HKLA 3JD72 3LIGA 4IEUA 2IXCA 2HH9A 4M4PA 3MF6A 3A7QA 4XBNA 1VRH3 1AYN2 1SFYA 3WNXA 4QB2A 4HXCA 1ZRCA 4P14A 2IWGB 1ULDA 1GP4A 1JXNA 2CY6A 1PO22 3AP7A 4A3XA 4CU6A 3KQ4B 3ZXDA 1AR63 4RGAA 1OA3A 2VQ0A 3VBSA 2J1TA 4LITA 4LLOA 1AF9A 4EN9B 3PNAA 4AHWA 4L92A 2OKXA 4HN1A 1GMMA 4CCDA 2DU0A 4PBPA 2CGPA 1O7FA 4AI8A 1JZ4A 4BB3A 4D7SA 2R042 1G9BA 3B9IA 5IATA 4ITCA 2BVVA 4QHBA 4UFHA 4BXSV 4JX0A 2P4EA 5DXDA 2ZA9A 1W6PB 4P9WA 4W6YA 4XCAA 5A3WA 1AZDA 1V00A 4MLOA 2YY1A 2W1UA 1ULCA 5ABJC 3AP9A 1U12A 2GDFA 3KF5A 2E51A 1RUI1 3LWCA 1DQ1A 3I59B 4IQPA 3AC0A 3PMSA 4E4ZA 3KV5A 2P6HA 4C0HA 4UF0A 5KXEA 1S0DA 2DCZA 3ELNA 1T2XA 1C8NA 1CAXB 1MS5A 2DYCA 1ULEA 2CHHA 4LK6A 3VBUC 3WW3A 5KWRA 5A33B 2VZPA 4UW6A 1FMD3 4XHXA 1CAXA 4TYSA 4WVVA 3PUQA 2P6CA 4COYA 4Z8BA 1F8VA 5FOBB 5T54A 2GN3A 1RUG3 2WS92 4GQ7A 5HXMA 2YC4A 1AR73 3P5BA 1NCRB 5CVRA 3WV6A 4AE2A 2K46A 3ZN5A 1N1VA 4NIIA 3UGHA 4MSVA 4UFMA 4NUBA 2D3PA 5FZGA 1R64A 1AXYA 5CKNA 4PLMA 3POEA 4G3YC 1DHKB 1ND2B 4BHPA 4CEWB 4LXLA 5CKMA 5FZFA 1OBNA 4YGCA 4COUA 3IMNA 3L9JT 3S57A 2PHRA 3VHPA 1G6NA 1BVVA 5ABJA 2QKDA 5I0DA 3B69A 1HLCA 1W9FA 1Z78A 2CDPA 3K77A 5L9BA 4D6SA 4ZU7A 4IE0A 2ZGRA 1POQA 2AGSA 4N9IA 3H50A 2XJSA 5CAZA 1H4GA 5FMBA 1OOPB 3H7YA 2UY9A 1X50A 3VBUA 2GMEA 5K8SA 5FO9B 1QJU3 2RR13 1AL23 1QNYA 2WO7A 3LPFA 4NHLA 4K21A 1XNAA 2ADEA 1QQP2 2BUKA 1D2QA 4FPOB 4OCTA 5BV6A 5FBJA 3ROUA 4PF1A 3WX5A 3POBA 2VC9A 2OXBA 2WYSA 1JYCA 1CD3G 4Y4YA 1GNZA 2Z2SB 3GJAA 1J59A 4RFT0 4Y5SA 3G6JB 5LRSA 1Y9GA 1GFF2 3RWKX 3NNFA 1RMU3 2R1DA 2H6CA 3J7HA 1UCXA 5DUXA 5FZ0A 4BQ3A 3V65A 2JIJA 2ZGSA 1UD1A 5FZ7A 1GYKA 5CISA 2NYYA 5FZ1A 3OG2A 3AKQA 2FD8A 4Y1VA 1ENXA 4E4SA 1ZRDA 1OVPA 5FYTA 1F4HA 3GJBA 4YWAA 1H9WA 5FR3A 4P08A 1SLTA 1N1YA 4ASLA 4XF4A 2JD9A 3HBKA 3LD8A 4DMIA 2R30A 3WUDA 5F1RA 5DMYA 2BOJA 1Q5OA 3THTA 1XPWA 3ALQA 2NPIA 3I97A 2ES3A 5FP4A 5FUNA 4TWTA 1LKNA 1MS8A 1UZVA 4IV1C 4OFGA 1HKDA 1NOVA 2QQNA 1ZBE2 4XFFA 5A6YA 3S30A 4RQPC 2CV6A 2GAUA 1OC1A 3I2DA 3I2OA 1NE6A 1UU5A 2X8KA 4QX2A 5BNOC 3GALA 2HBTA 3I3DA 5FYVA 4CPBD 1UNBA 5JIAA 4GZ9A 4KGQA 4E27A 2GC3A 2ZMKA 2R061 1GV9A 4IV3C 2ZZQA 2VZ1A 3OTFA 1U0AA 2PFWA 4HANA 4XZPA 1JH5A 3VBFC 2VUAA 5J09A 2I74A 1JZ3A 1V70A 4ASMB 4CZSA 4LPLA 1A8MA 2NMOA 1UIKA 3H8UA 5H9SA 4EN0A 3PLQA 1FV3A 5IFPA 1QJY3 2A3YA 3WQ7A 2WO3A 4C1XA 4PDWC 4B7EA 4QHZA 1RUJ3 1TMF3 2GNBA 2J1SA 4HSJA 3VZNA 4TZDA 2H0BA 5AC91 2OPKA 2GN7A 3IIAA 3NW4A 1QDOA 4H2AA 4QQLA 1H4HA 5FQ0B 4OQ9A 2AEYA 3VZJA 4AZZA 2PAMA 1OPOA 3KCXA 5FQ0A 5DUVA 4IV1A 3ES4A 3SH4A 5IK7A 4RQPA 4ES9A 4WV8A 3RGBA 4DUXA 2JDHA 1XNKA 2GC0A 3VBOC 1ZNPA 3DF0A 2OYZA 4LBNA 5BNOA 2EIEA 1HN1A 1W2NA 5J36A 2HWB1 1OXCA 5LBCA 4O9GA 5JOYA 3FUQA 1DGLA 1WZXA 2NN8A 5T5PA 5KC5A 4INDA 1GP5A 4IV3A 4ASKA 3AK0A 1RUNA 1OUXA 3BOWA 2R0FA 2WZPP 2CYFA 3VBFA 2BOIA 1P8JA 4HZFA 4CVUA 1RUF3 5FPUA 3K4ZA 3QD6A 4Q4W2 1TNFA 4GALA 4Y26A 1DGWX 1WW6A 3EO6A 1W8FA 1OI6A 3MZHA 4PDWA 4LT5A 2GNMA 5BXXA 3RZGA 1JI6A 2A3XA 4AL9A 3WDYA 3HN3A 4FBFA 4XJ9A 1OKOA 1O4TA 1AR81 2K9ZA 3RS6A 4CDUC 4Q5OA 3WD5A 2JG8B 3VBOB 2AC1A 4RGGA 2V4VA 2WZEA 5FRAA 5GZCA 1JN2P 1DQ4A 1S0CA 2C5DA 1QH7A 2R16A 2XVGA 3MUZ1 3VBRB 4XYXA 2D40A 3VBOA 4NPRA 1G9DA 3O5SA 1AR62 4N53C 3ZYGA 5GLTA 2IXKA 2WO2A 2VXJA 4Y1XA 4XF1A 3PTYA 3JZVA 4L8QA 4JCKA 3B02A 3I2HA 5DAQA 4MG2A 2LUWA 2OS2A 4IGPA 2C9KA 2PQSA 4KG8A 1R093 2JIGA 2VW2A 2WNUB 1CAWB 1JBCA 4LQRA 4L2NA 3ZSKA 4B4QA 1ASJ1 2Y0OA 5LA1A 2QQPA 2BNMA 4E2SA 2WNUA 3HQXA 2YHJA 3BKZA 4CU8A 1E57A 1TQ5A 5LK7B 3M3CA 1J3PA 2ZEXA 5FK7A 1QU0A 5A3OA 3E6DA 1PHMA 1OHFA 3GZTB 3AX4A 2KD7A 3ZYBA 1O8PA 4XMAA 1ZBA3 1O3TA 2JE7A 2IZWA 5DZGA 3LOIA 1RUD3 4OI4A 4Q4Y1 2KA3A 3JQXA 1FOD1 4YW7A 1PO11 4CDUA 5ACA2 3C7OA 4IESA 5LBEA 3FLPA 1VBD2 2WT0A 4K1YA 1YC61 2R0HA 1ULPA 2HWE3 4B7KA 5FDBA 1H2NA 1ND3C 1QXJA 3FUOA 3IMMA 4IGOA 5DDJ1 3ZKUA 2D43A 3WQ0A 4RHV2 4Q26A 1LHUA 2B4KA 5FPBA 1GQPA 3AZVA 4N53A 3J8F2 4D6QA 1YWKA 2HWF3 5DN2A 1OUSA 1F15A 2W9XA 3USUB 4Y5Z0 1C8M3 5LY2A 1F4AA 3DKWA 2VNOA 1YXWA 3K4DA 4M3CF 2IC1A 1JZ2A 1O3QA 3USUA 1TME2 1H8VA 2QCSB 2VAUA 2E63A 4ES8A 4R9DA 1OFNA 3PUAA 2HWD3 2VOXA 3ZDSA 4C8DA 1UYPA 5EQUA 2BRTA 2XWJB 5FYCA 4ISQA 5D21A 1I9RA 2DTWA 3HN1A 5A7WA 3B7MA 3M3OA 2FDJA 3WG2A 1FT9A 5K0UC 4QDQA 3VHOA 4AOCA 3OOXA 3O0WA 4LKDA 4Z07A 4C0BA 5C4WC 3I2FA 1AR93 2Y6GA 1Y3TA 2H6BA 4RSUA 1WA6X 2ZMLA 2QQJA 3M3QA 1HV1A 2JB8A 1ND3A 4J25A 2WBKA 3OGJA 3RFRA 5SV5A 1VBC2 2R071 3ZYFA 1DYOA 4A6SA 1ZRFA 1QJU2 3RJRA 2RS31 3P3NA 2VD7A 4PI2A 2YROA 4YVWC 1GICA 2VULA 2XJRA 3AVRA 2I07B 3P3PA 4MVTA 3ECQA 4JTNA 5DPNA 5JMCA 3VD4A 1RB8G 4XTPA 1UPSA 1NZIA 3WF2A 2Y6KA 4AXOA 3KD4A 5FY7A 1UKGA 3O12A 4CP9A 2BP6A 1R1A1 1X9PA 5GZGA 2ZMNA 4FSJA 2RMU2 4EN6B 3NJZA 3KVAA 1EV11 2XDVA 2VR4A 5K0UA 4GD4A 4XFGA 4A2UA 3SKJE 5C4WA 3H8OA 3T2TA 1VMFA 4IE4A 3K51A 3S0MA 1S0FA 2A7AA 2QE3A 4GH4C 4HKWA 2WAOA 3USSA 1LOAA 1MACA 3WF3A 4I30A 1FPN2 5A32A 2Q1MA 2IXLA 2IXJA 2W08A 3TYJA 1N1TA 3IPVB 2E9QA 5FMCA 5HI0A 1UKRA 1ZRIA 2E26A 3C2UA 5KXBA 2BW8A 3LA2A 3ZYHA 4L97A 1QF3A 2W46A 4LBJA 4XQDA 3IPVA 3UKTA 3NV1A 2DWRA 1IS5A 4YVWA 3RYRA 3LDBA 1SBEA 4A7ZA 2ORXA 2PQQA 1H1IA 3FBYA 1MS3A 3NQHA 3VZOA 1WLDA 3AZWA 1EP0A 2JG9B 1KITA 1Q56A 5JI9A 3U07A 1K3IA 3IT8A 5HBAA 1T6GC 4AVAA 1MZFA 1NE4A 4CCKA 2CGNA 4A4AA 4YFZA 1QJY2 2YXSA 1G9AA 2BU9A 1U5YA 1RUJ2 1GOHA 1TMF2 4QQ2A 5JSRA 2FHRA 4Y33A 2YGMA 4FOQA 1LNSA 5DUWA 4GH4A 3WOGA 1J3RA 3WNOA 1LGCA 1SACA 1SBDA 1MQTC 4IXLA 1ZX5A 4QU2A 1POV0 3MV11 3N9OA 3FBMA 5H9PA 2WYFA 3E5QA 3GXUA 4LO7A 1DFQA 1XJAA 3AP4A 1MEC3 3PVBB 2D6LX 4YARA 3ZN4A 1W8UA 5GKAC 3T09A 3KF3A 5CB7A 5BUVA 4OHVA 1GZTA 1G8WA 5FPVA 3JD73 3KWVA 4AR2A 4NVPA 3AKSA 1OA2A 1SPPA 2XJQA 5FXWA 4E9KA 1RJ7A 3KM5A 1UIJA 3ACIA 1ULOA 5BYNA 3NWKA 1ONAA 3FLRA 1PO23 4GB31 2Y0IA 3EB7A 4PI0A 5JOWA 1OSGA 4Q1PA 3H1MA 4R8HA 1V9U2 1MS9A 3Q8EA 4K20A 4DQAA 1AL0G 3TEYA 1PVC2 4TLFA 1PGW1 2GC2A 3N9PA 1COV2 2DBNA 4NIGA 2Q0AA 2ZOEB 3GZUC 4NRQA 1MQTA 2R043 1NG0A 1Q3EA 2QDNA 3GZEA 1RITA 3J4UH 4EYUA 4UBGA 2W68A 3NJYA 1C57A 1LODA 5A1AA 1G86A 2QQWA 4RFRB 3CZUA 1FAYA 1LOCA 1PNFA 1ZRRA 4CUAA 4FTSA 3WNMA 3IM0A 3POGA 3NNJA 4XAAA 3TRSB 2PXJA 5FZ9A 5A7PA 2ZTNA 4XC9A 3U1XA 4K7JA 1W6MA 1ENSA 1PMJX 3JB4C 4LOSA 4WZCA 4RD7A 4OHYA 3KV4A 1QWRA 3ATGA 1ZZBA 5EZWA 1JHJA 1W2UA 2ZEWA 2E33A 2W95A 4ZY9A 1XOYA 2O8QA 1REFA 1GQGA 4XE9A 3T30A 5C3SA 4KNCA 3JBG2 2WS93 5F3GA 2AACA 3NRUA 3OBAA 1AVBA 5FY8A 4LO8A 5FYYA 3RYKA 1UOJA 3O1RA 4BXFA 1CJDA 2DV9A 4UFLA 4NAMA 4FFHA 4AGRA 3BI3A 4WVMB 1HRI1 4QX3A 2FDGA 2GH8A 5HCHA 4MX3A 3RDIA 3H3LA 2R6QA 1UX7A 3SQOA 3HVDA 2HWE2 2RS51 1EY2A 4WVMA 4A41A 4BA6A 1H2KA 4JC1A 1TNRA 4N43C 2HWB3 1STMA 1HRV2 2EA7A 4YG0A 5JUVA 3PIJA 3WNPA 3NAPB 1FI2A 2A6ZA 2HWF2 2XUMA 2X29A 4OHZA 3UYJA 5CG9A 1A78A 4QDRA 3AZXA 2UYBA 4Y22A 3AYCA 1IS3A 1PZ9A 3MFAA 3NAPA 2IUWA 2ZACA 1AHSA 3M3IA 1CAVA 4DNYA 1ZA7A 3DPRC 4XQ4A 5DQ0A 1V6LA 3AL6A 5DZFA 4AQ6A 2JE8A 2YPJA 2VOKA 4Y3OA 2X5IC 1W6OB 5FYIA 5HCFA 1LRHA 3V0AB 4D6RA 3IDAA 4RL7A 2WKKA 2PHTA 3WDVA 1W6OA 2C0ZA 1QQP3 4AI0A 2XBO3 1AR83 3V0AA 3KSCA 4AFMA 2JX9A 2CGOA 3VZMA 1LOEA 4AI1A 4EROA 4MGZE 1KDMA 1MS1A 4TSVA 4IEOA 3ZMOA 3M1HA 1DLCA 3NNMA 4KGGA 3SCHA 4V2VA 3ETPA 1IG3A 1YLLA 1FV2A 4JAAA 1AX0A 4GWNA 5CZKA 4BQ1A 3NVCA 1D0GA 4N43B 3IIIA 1ZZCA 2VXRA 2WO1A 5GJ6A 4JGZC 3WF1A 2Q1FA 5JOZA 5LA9A 1TZOA 3T1LA 2VMHA 4N43A 3RNSA 3A0KA 3SMHA 4CP0A 1OD3A 3BGAA 4UYBA 4OLLA 2D5HA 1SZBA 4ONUA 3BPSA 3GDBA 3UJOA 3FL7A 3TNQA 3KV9A 3R4SA 1BK0A 3MV01 3ZPOA 5L9RA 5IAVA 3DPRA 4V1PA 3S5QA 1J3QA 2TBVA 5JXHA 2ARXA 2X5IA 3D6EA 5GM0A 5A3TA 1RYYA 4BIFA 4IE7A 5FYUA 5AVPA 2ZX1A 2XQRA 3V64A 1RUI2 3R6SA 5CFDC 1KFXL 3PMEA 3WQBA 3TAYA 3OB8A 2P3YA 3GBGA 5T5OA 3BODA 2KM2A 1SEFA 3WUCA 3M3EA 5F5IA 2WNOA 2VUCA 5DABA 3J7LA 4WM7B 1W05A 2RVAA 1BBT1 1CONA 1K12A 1XU1A 3CDZB 3GM8A 4JGZA 5I0TA 1YI7A 4N7UA 2QUOA 2PN5A 2HYKA 3ABZA 4Q4V1 3V56A 3ZMNA 3MW2A 3PTRB 4Q4X1 2VW1A 4R9CA 4DXSA 4MGQA 3C7EA 2BFUS 1RGSA 1O59A 3JUUA 5BNQA 5GLVA 4MXWB 4MADA 1YFUA 4LJHA 1W06A 1NY71 4URTA 3WW4A 2VCBA 2BJSA 3VD3A 2PMWB 3ITQA 5FFOC 1H30A 2PHDA 4MXWA 1QJFA 1JZ6A 2ET1A 3H9AA 2JDZA 1O8SA 2DFCA 4EWEA
chains in the Genus database with same CATH topology
5FY8A 5FYHA 5FYYA 5ISLA 5FZ0A 4XDOA 2YBKA 5FZOA 2OS2A 4IGPA 5FZ6A 4BXFA 5FZ7A 4V2WA 5FUPA 5FZ1A 5FZEA 4DO0A 4GJZA 4QWNA 2W2IA 3PU8A 2YU1A 5FYTA 4TN7A 3N9MA 3OPTA 5IVVA 3AL5A 3LDBA 5FP9A 2OQ6A 5FXZA 4CCOA 3PURA 4UF0B 3LD8A 5FP3A 2YBPA 5A3PA 4LITA 3UYJA 5FP4A 2GP3A 5FUNA 4CCKA 5FXVA 5A7WB 5FZBA 4CCNA 2YU2A 2Q8DA 5F37A 4BISA 5FZAA 5F2WA 4QXBA 3AL6A 4IGOA 4Y3OA 5FYVA 5FJKA 4GJYA 4IGQA 5FYIA 5LY1A 2XUEA 4Y33A 5IW0A 3ZLIA 4D6RA 5FPBA 3U4SA 5FYZA 2XMLA 4XDPA 5FY4A 5A3WA 4D6QA 5IVYA 4QU1A 5FY9A 3N9OA 4LIUA 5LY2A 3KV6A 4QXCA 5FYMA 4HONA 5FZ3A 3U78A 5FZLA 4V2VA 5FZIA 5IVFA 4CCLA 4CSWA 3KV5A 4UF0A 3PUAA 5FWJA 5FPVA 4C8DA 4URAA 4BU2A 5A7NA 3N9NA 5A7QA 5FYCA 3RVHA 4QX8A 5FXWA 4QX7A 5IVJA 5A7WA 5FZDA 3K2OA 3PUQA 5CEHA 5FZKA 5F39A 4QXHA 4LIVA 4HOOA 5K4LA 3KV9A 3ZPOA 4CCJA 5LW9A 5IVCA 4GAZA 4EZHA 3DXTA 5IVBA 4NUBA 5FZGA 5F3EA 1VRBA 2OQ7A 3N9PA 2P5BA 2GP5A 5FPLA 4EZ4A 3PUSA 3K3NA 5FXXA 4E4HA 5A3TA 5FP8A 4LXLA 2YBSA 5FZFA 5E6HA 4ASKA 3N9LA 5ANQA 5FYUA 5FY5A 5FWEA 2Q8EA 4AAPA 5FPAA 3N9QA 2VD7A 5FY1A 5A3NA 5A7OA 5FPUA 5A7SA 4EYUA 4D6SA 5F5AA 5A1FA 3NJYA 4DIQA 3AVRA 3PDQA 2WWJA 5IWFA 5FZHA 2XXZA 5F5IA 2OX0A 4CCMA 5F3IA 5FZMA 4AI9A 5FZCA 5A80A 3K3OA 4CUGA 4Y4RA 5FY7A 2PXJA 5F3CA 5FZ9A 5A7PA 5F32A 3AVSA 2WWUA 5F2SA 5FZ4A 3OPWA 3PTRB 5FY0A 5LWBA 2OT7A 3KVAA 2XDVA 5FJHA 5FYSA 3DXUA 3KV4A 4GD4A 5KR7A 3PU3A 5FV3A 5IVEA 5FBJA 5F5CA 3KVBA 5A1LA 2Q8CA 5FP7A 2YPDA 5FYBA 5FZOB 5FZ8A 5F3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY8 A;  5FYH A;  5FYY A;  5ISL A;  5FZ0 A;  4XDO A;  2YBK A;  5FZO A;  2OS2 A;  4IGP A;  5FZ6 A;  4BXF A;  5FZ7 A;  4V2W A;  5FUP A;  5FZ1 A;  5FZE A;  4DO0 A;  4GJZ A;  4QWN A;  2W2I A;  3PU8 A;  2YU1 A;  5FYT A;  4TN7 A;  3N9M A;  3OPT A;  5IVV A;  3AL5 A;  3LDB A;  5FP9 A;  2OQ6 A;  5FXZ A;  4CCO A;  3PUR A;  4UF0 B;  3LD8 A;  5FP3 A;  2YBP A;  5A3P A;  4LIT A;  3UYJ A;  5FP4 A;  2GP3 A;  5FUN A;  4CCK A;  5FXV A;  5A7W B;  5FZB A;  4CCN A;  2YU2 A;  2Q8D A;  5F37 A;  4BIS A;  5FZA A;  5F2W A;  4QXB A;  3AL6 A;  4IGO A;  4Y3O A;  5FYV A;  5FJK A;  4GJY A;  4IGQ A;  5FYI A;  5LY1 A;  2XUE A;  4Y33 A;  5IW0 A;  3ZLI A;  4D6R A;  5FPB A;  3U4S A;  5FYZ A;  2XML A;  4XDP A;  5FY4 A;  5A3W A;  4D6Q A;  5IVY A;  4QU1 A;  5FY9 A;  3N9O A;  4LIU A;  5LY2 A;  3KV6 A;  4QXC A;  5FYM A;  4HON A;  5FZ3 A;  3U78 A;  5FZL A;  4V2V A;  5FZI A;  5IVF A;  4CCL A;  4CSW A;  3KV5 A;  4UF0 A;  3PUA A;  5FWJ A;  5FPV A;  4C8D A;  4URA A;  4BU2 A;  5A7N A;  3N9N A;  5A7Q A;  5FYC A;  3RVH A;  4QX8 A;  5FXW A;  4QX7 A;  5IVJ A;  5A7W A;  5FZD A;  3K2O A;  3PUQ A;  5CEH A;  5FZK A;  5F39 A;  4QXH A;  4LIV A;  4HOO A;  5K4L A;  3KV9 A;  3ZPO A;  4CCJ A;  5LW9 A;  5IVC A;  4GAZ A;  4EZH A;  3DXT A;  5IVB A;  4NUB A;  5FZG A;  5F3E A;  1VRB A;  2OQ7 A;  3N9P A;  2P5B A;  2GP5 A;  5FPL A;  4EZ4 A;  3PUS A;  3K3N A;  5FXX A;  4E4H A;  5A3T A;  5FP8 A;  4LXL A;  2YBS A;  5FZF A;  5E6H A;  4ASK A;  3N9L A;  5ANQ A;  5FYU A;  5FY5 A;  5FWE A;  2Q8E A;  4AAP A;  5FPA A;  3N9Q A;  2VD7 A;  5FY1 A;  5A3N A;  5A7O A;  5FPU A;  5A7S A;  4EYU A;  4D6S A;  5F5A A;  5A1F A;  3NJY A;  4DIQ A;  3AVR A;  3PDQ A;  2WWJ A;  5IWF A;  5FZH A;  2XXZ A;  5F5I A;  2OX0 A;  4CCM A;  5F3I A;  5FZM A;  4AI9 A;  5FZC A;  5A80 A;  3K3O A;  4CUG A;  4Y4R A;  5FY7 A;  2PXJ A;  5F3C A;  5FZ9 A;  5A7P A;  5F32 A;  3AVS A;  2WWU A;  5F2S A;  5FZ4 A;  3OPW A;  3PTR B;  5FY0 A;  5LWB A;  2OT7 A;  3KVA A;  2XDV A;  5FJH A;  5FYS A;  3DXU A;  3KV4 A;  4GD4 A;  5KR7 A;  3PU3 A;  5FV3 A;  5IVE A;  5FBJ A;  5F5C A;  3KVB A;  5A1L A;  2Q8C A;  5FP7 A;  2YPD A;  5FYB A;  5FZO B;  5FZ8 A;  5F3G A; 
#chains in the Genus database with same CATH topology
 3LAG A;  5I0S A;  2DUO A;  2EAK A;  4KL1 A;  1D7P M;  3ZYR A;  5EFU A;  5CFD B;  3ZSL A;  1NCQ B;  2OVU A;  5I8Y A;  1HXS 3;  4WBB A;  1I6X A;  1XNB A;  2F4L A;  3J7N A;  3HNB M;  4DO0 A;  5CFD A;  2A5Z A;  4Y1Y A;  2VMG A;  1SCS A;  1X7N A;  1HB3 A;  3SKV A;  5KHG A;  4GXL A;  2XLA A;  3MPP G;  3R05 A;  2N7G A;  5AFE A;  1SHW B;  2WWS A;  3ZXA C;  2WIN B;  1R08 1;  1UZY A;  3T08 A;  1I1E A;  4XET A;  5ANN A;  5CA6 A;  3FWE A;  3U10 A;  2W0X A;  5GAL A;  3UJQ A;  1GOF A;  1CAU B;  5DZE A;  2WFF 1;  1IZ3 A;  1XYO A;  3JU9 A;  3KB5 A;  4JHZ A;  4AQ2 A;  5T55 A;  4NHY A;  1JUI A;  1LGB A;  2ARA A;  2FQP A;  2XON A;  1EPZ A;  2EAA A;  1CAU A;  3QBQ A;  2O14 A;  1SLI A;  1YCI A;  4DEQ A;  1OMI A;  4QKB A;  4DPN A;  3ZN6 B;  5E8A A;  5FZ3 A;  4XBL A;  1SLC A;  3ZFF C;  1R1Z A;  4YVS C;  4AFA A;  4P9Y A;  2A73 B;  4NPM A;  4NJ4 A;  3NST A;  1SG3 A;  5A7Q A;  2JEM A;  1QXP A;  1HV0 A;  1YUD A;  3HNY M;  3HMY A;  1YFW A;  2VQU A;  4FXG B;  4YGD A;  1C1L A;  5EJZ B;  3WXP A;  5HV4 A;  4TTG A;  2L9L A;  4LOT A;  5GLU A;  2BFU L;  5J98 B;  1NCR C;  3D4K A;  5F39 A;  2A1X A;  4LIV A;  1J83 A;  3O0X A;  1O5L A;  1CZV A;  4LKF A;  4CCJ A;  3U0Z A;  1X8E A;  4QM8 A;  4U2A A;  2BGO A;  1ND2 C;  1F5J A;  2UYA A;  4PIZ A;  2VVF A;  5F3E A;  5BPX A;  2WNE A;  4CEW C;  3T0D A;  2R06 2;  5IFT A;  1W6P A;  3P6B A;  2QNK A;  1S0E A;  5ACA 3;  2G19 A;  2A6W A;  3HQU A;  1VBD 3;  1VAL A;  3LQC A;  4QB1 A;  2EIB A;  5FY5 A;  3W58 A;  3Q8A A;  4LE3 A;  3ZFF B;  4RHV 3;  2O8O A;  3I59 A;  4YVS B;  5A7S A;  1MS0 A;  4JDO A;  3VD9 A;  3V0B B;  5F5A A;  5A1F A;  1W9S A;  1OOP C;  3PDQ A;  3J8F 3;  1Z0H A;  3C7H A;  3CEW A;  4L0P A;  3WDX A;  3ZFF A;  1S4C A;  4YVS A;  4YW4 A;  3V0B A;  5A33 A;  2B5H A;  4XJA A;  1OQD A;  1BVP 1;  3TN9 1;  1OD5 A;  4FPC A;  3T4H B;  1XSR A;  3POY A;  2DCK A;  1UZW A;  3MPB A;  4AGG A;  1TME 3;  2ERF A;  1EAH 1;  4KU7 A;  3WCR A;  1NCR A;  4ZKT B;  1O3S A;  5FYS A;  5G05 L;  1Q43 A;  1GWL A;  1X82 A;  2JDK A;  4COW A;  2JXA A;  3BPZ A;  4UW3 A;  1JU3 A;  5FP7 A;  3W9A A;  2GND A;  2YPD A;  1UOF A;  3IDB B;  3NKT A;  3VL9 A;  1ND2 A;  2HWB 2;  5FZO B;  3ZSJ A;  4CEW A;  4M01 A;  3WNL A;  4W6W A;  3BTY A;  1LAJ A;  3CHX A;  3WG4 A;  1Z7S 1;  4XDO A;  1SMV A;  1RED A;  2VBP A;  5FZO A;  4C91 A;  1L7R A;  3ON7 A;  1HN0 A;  2ARB A;  2Y33 A;  4AQS A;  3AJY A;  1PIV 1;  1VBC 3;  4MGY E;  3O7O A;  4XFA A;  5D8A C;  1OOP A;  3AL5 A;  5JMO A;  1D4M 3;  2OQ6 A;  1BEV 1;  2PHF A;  5FTT C;  5BY5 A;  5C5T A;  1MZE A;  5J37 A;  3FJS A;  4NR1 A;  4I3P A;  2VY0 A;  5L19 A;  4YG6 A;  1VB4 A;  1WLW A;  3SH3 A;  1XYN A;  2OZ6 A;  1DIW A;  1BHG A;  1AR8 2;  1WW5 A;  2RV9 A;  2XBO 2;  3BTA A;  4M3C B;  4R52 A;  3VDA A;  2D97 A;  1KD7 A;  1VBE 3;  2TEP A;  2UWA A;  5F37 A;  4S2H A;  4CDW B;  1NYW A;  4GMP 3;  4M3C A;  5FZA A;  3AJZ A;  4Y1Z A;  4DUW A;  1W3V A;  5JXJ A;  2EF6 A;  4BIO A;  1PMI A;  2ORZ A;  4L9B A;  3WG1 A;  4QM9 A;  3ZLI A;  2OUJ A;  2RMU 3;  4IEW A;  2FDF A;  3HOB A;  4LA2 A;  2VVE A;  2RM2 1;  5GLZ A;  4IEP A;  4JKM A;  4JTO A;  4DY5 A;  1VBB 1;  2Y60 A;  3B9C A;  4QU1 A;  3BIW E;  2A6X A;  4QXC A;  1X9T A;  4UFI A;  3L2Y A;  1ASJ 2;  1RUC 1;  2HBU A;  4BLI A;  5D8A B;  5FZL A;  1FNY A;  1XNT A;  3N7L A;  1VLN A;  5I91 A;  1FPN 3;  2WQ8 A;  2QTW B;  3POW A;  4LBQ D;  5D8A A;  3TOJ A;  4R9B A;  4XPV A;  1UAI A;  3RPQ A;  2BNN A;  5A7N A;  1CZT A;  4F7Z A;  4PHZ A;  2ZKN A;  1BLZ A;  2Y38 A;  3WHT A;  1AYN 1;  1W3X A;  4LO4 B;  4LBO A;  1RHI 1;  4Q4Y 2;  1W90 A;  1NLQ A;  3HEI A;  4XEZ A;  1FOD 2;  3SLI A;  2ZX4 A;  2J1U A;  1PO1 2;  4FI9 A;  1RIN A;  2D3R A;  2G9F A;  4XXA A;  4F83 A;  2Z5W A;  4HOO A;  4QKF A;  3GF6 A;  3UES A;  1E5I A;  1YFX A;  2FZ1 A;  2QQM A;  3ACL A;  4IE5 A;  4HL0 A;  5CU1 A;  3MLK A;  4EZH A;  3A0N A;  2Q1Z B;  4IEQ A;  2XJU A;  5KHI A;  5DAW A;  1MR5 A;  1W99 A;  1KGY A;  2VW0 A;  4Q0S A;  4AEK A;  1OH3 A;  1YFY A;  3TEW A;  3K3N A;  3N4M A;  4XFI A;  1RL3 A;  2WA4 A;  1FX5 A;  3JXS A;  1WW7 A;  3UGG A;  2LW8 A;  4BCU A;  5CBL A;  4NID A;  4JVA A;  1VP6 A;  5LAS A;  4YYO A;  2ZGK A;  4Z2A A;  3IWZ A;  5A3N A;  2E53 A;  4LK7 A;  4LHL A;  2IFR A;  2OW4 A;  2CL2 A;  3DUI A;  4Y1U A;  1UXX X;  2AEN A;  5AVA A;  2BBV A;  4N8M A;  2OX0 A;  4P9G A;  4Q1R A;  5FZM A;  2WAA A;  5C7G A;  2DBI A;  3HQR A;  1REE A;  5HXV A;  1FNZ A;  4QKN A;  4Y5T A;  4YPJ A;  4XAE A;  5C3Q A;  2W1W A;  2Y8K A;  3PJQ A;  2JG8 C;  5ERL A;  4I09 A;  4R4X A;  4QAW A;  1HXS 2;  3B93 A;  2RDN A;  4W65 A;  1RVF 1;  3TWI A;  1PX4 A;  4IDZ A;  4NN0 A;  4H7M A;  5LEK A;  2B39 A;  1HW5 A;  3VBR C;  3LDR A;  2VTF A;  4P00 B;  1QJX 1;  4QGN A;  2BZD A;  4Z1V A;  4M0H A;  4QKD A;  1VJ2 A;  3AXD A;  3EJK A;  2VNG A;  2QDR A;  2Q5T A;  3N36 A;  3LEI A;  4I02 A;  4EN8 B;  2R1B A;  2FDH A;  4RR3 B;  2WNU C;  5FYH A;  3GGL A;  1O3R A;  1V9U 3;  1UYY A;  2YBK A;  2OPW A;  1W6Q B;  2RS3 2;  3QH6 A;  2AR6 A;  3J26 N;  2ZEZ A;  3VDB A;  1PVC 3;  3AKT A;  3ZDV A;  1COV 3;  2QQL A;  1W6Q A;  2WSU A;  1VBA 3;  3PU8 A;  4GJZ A;  2A6Y A;  2P3K A;  1DQ5 A;  5FO7 B;  3AMN A;  1XU2 A;  3I3Q A;  1K42 A;  2JDM A;  2VH9 A;  3NNL A;  1R1A 2;  4X6Q B;  1PZ7 A;  3EMR A;  4XIL A;  4GA9 A;  2D7F A;  1W8N A;  3WLU A;  1RUO A;  1BYH A;  1HB1 A;  2JG8 A;  4XIK A;  3WP3 A;  2VZO A;  5L36 A;  1EPW A;  1AJK A;  1NLR A;  5EPA A;  1O91 A;  3S7E A;  1OFS A;  1OLM A;  3SNM A;  2MEV 3;  3LA7 A;  3VBR A;  2ZCW A;  1N1S A;  3HD8 B;  1BBT 3;  4B4P A;  3EYP A;  3D3A A;  2RDQ A;  2HWC 1;  2W92 A;  3NJX A;  4M4R A;  3S6P A;  4Q4V 3;  3SIT A;  1WBL A;  4OUS A;  4QPY A;  4YZ1 A;  2DVB A;  1CAW A;  3LE0 A;  3JB8 A;  3HNM A;  2QBX A;  5FO8 B;  3JBG 3;  3HJR A;  4FPK A;  4YGB A;  2LTN A;  4BQ5 A;  3BIE A;  2VZV A;  3VBH B;  4COV A;  1JZ5 A;  2G4I A;  2VZU A;  5FWJ A;  4FOW A;  4P5H A;  4Q29 A;  2W5F A;  3NMB A;  4QPI C;  4NHK A;  1KJR A;  2ZS6 B;  1ALY A;  2BWA A;  2X09 A;  1UY4 A;  2DTY A;  2ZX3 A;  1MPX A;  4MGK E;  3I8T A;  1A34 A;  3BU7 A;  1HQN A;  4LLF A;  4MZU A;  1IG0 A;  1LR5 A;  2VUJ A;  4RN5 A;  1S0B A;  4AHY A;  1NQJ A;  4OHX A;  4EQV A;  3T3Y A;  1YEW A;  1HRV 3;  3U75 A;  5I8S A;  4GAZ A;  2VMD A;  1WMX A;  1SFP A;  2J7M A;  3CJI C;  3T2Q A;  1NXM A;  5G04 L;  4OZO A;  1RUE 1;  4EZ4 A;  1ZZ7 A;  4FPF A;  4YM0 A;  5FXX A;  1DZT A;  2ENR A;  3AMQ A;  2UWB A;  3QAC A;  4E4H A;  2FDI A;  3ACF A;  3BAL A;  1XND A;  3N9L A;  4DRR A;  2ZZJ A;  4ET7 A;  2CSG A;  2PLV 1;  4P9I A;  4YSF A;  3MIG A;  5LEJ A;  2W1S A;  4NHX A;  4YM1 A;  4B8E A;  3OUI A;  4DEV A;  3W5M A;  4AHZ A;  1ACC A;  3AYD A;  1W0N A;  4KG0 A;  1PM4 A;  2VL4 A;  1JUH A;  2H0V A;  3LIH A;  4QPI B;  1J1T A;  4UW5 A;  5EHD A;  1QGL A;  4DY3 A;  2XKP A;  2WZR 1;  2WUH A;  5BNP B;  3ETQ A;  4UFK A;  4NMI A;  5F3C A;  3CIH A;  4JRL A;  4QPI A;  4AW7 A;  4QD2 A;  1LEM A;  2QZ3 A;  3FFZ A;  5DG2 A;  3X29 B;  1W9T A;  1AX2 A;  4GB3 2;  5LA2 A;  4KU8 A;  4P02 B;  2AH2 A;  4XJZ A;  1W28 A;  1CPN A;  2Q8O A;  3CJI B;  4FPJ A;  4NWV A;  5F8P A;  5FUI A;  3SC7 X;  5JOX A;  4LBQ B;  3VV1 A;  1JS9 A;  2YB7 A;  3H0O A;  1PGW 2;  1D4M 2;  2DUR A;  4Q0U A;  5TSW A;  3WT3 A;  5FOJ B;  1QKQ A;  2BPA 2;  3CJI A;  4LOR A;  1V6I A;  2J42 A;  2YC2 A;  4RS5 C;  5FZK A;  1JYV A;  3Q9O A;  4BMB A;  4PQQ A;  2HYX A;  4D7Y A;  5K9Y A;  5CG8 A;  4YM2 A;  1XBF A;  3BVC A;  3VB9 A;  1VBE 2;  3ZO0 B;  3PVO A;  5DG1 A;  1DCS A;  2PA7 A;  4B4R A;  4CPB A;  2TUN A;  1PVX A;  4M00 A;  3MW4 A;  2IXH A;  3PVN A;  5C70 A;  1V6M A;  3ZOI A;  2JG9 C;  4OMC A;  4XW3 A;  4LHS A;  2DUQ A;  3MW3 A;  2JEC A;  1RUI 3;  2ZHN A;  4SLI A;  4CEY C;  4CXX A;  1VAM A;  3MIE A;  2VU9 A;  4Q4W 1;  3KQR A;  5C33 A;  2W3J A;  5J96 B;  5JIU A;  1PGL 1;  1D2S A;  2D93 A;  1QOO A;  3N3H A;  1JZ7 A;  4PBO A;  5IYY A;  4XZU G;  4A45 A;  3MF9 A;  4OZX A;  3ZKY A;  1W8T A;  3F95 A;  3QH7 A;  3ZSE A;  4UOJ A;  1POV 1;  3WDW A;  1NLS A;  4LO6 B;  5HCB A;  4GJY A;  4RS5 B;  2VNV A;  2XUE A;  4OI1 A;  1J58 A;  1UPI A;  1GNY A;  2O1Q A;  4YZ4 A;  3U4S A;  1EUT A;  1VRH 1;  4RS5 A;  5C5U A;  1CIY A;  5F6L B;  1F31 A;  1LOF C;  2D6O X;  5IVY A;  4MOA A;  1HRI 2;  3LSE A;  5B4X A;  3WY6 A;  1AR6 1;  4DFS A;  4W8J A;  4B29 A;  5J3U A;  3T0B A;  3TNP B;  4CEY B;  4ZZ8 A;  5FPX A;  4H3W A;  1BZW A;  3CBN A;  2JG9 A;  3OD4 A;  4MUV A;  1XE0 A;  4CEY A;  3FX3 A;  1Z7S 3;  3EXU A;  4QHO A;  3K2O A;  3M4F A;  1ZZ9 A;  2E31 A;  2R49 A;  4EWA A;  2ZGP A;  4WM8 B;  4AHX A;  4YRD A;  4ZHN A;  3AKR A;  4IER A;  2YMZ A;  4IE6 A;  3OBT A;  1PM7 A;  4CCC A;  5LW9 A;  1L7Q A;  3IZO A;  1T6B X;  2I2S A;  4KMQ A;  3KGL A;  3H1Y A;  5IVC A;  3RMY A;  2Q30 A;  3NJV A;  1W8O A;  3DXT A;  1XSQ A;  2VQA A;  2Y26 A;  3KGZ A;  1QOS A;  4L11 A;  1S0I A;  2J22 A;  1C28 A;  3FC0 A;  4BME A;  1NX9 A;  2BGP A;  5T52 A;  3WDU A;  2XLF A;  3WCS A;  2VNR A;  2DVG A;  1MZ6 A;  4P5Y A;  5A6Q A;  4RA0 A;  1GZC A;  4XQW A;  4PIY A;  4YW5 A;  5LRR A;  1KQR A;  1CES A;  1D4V B;  3N9Q A;  4JKK A;  1LOF A;  1B09 A;  1HJF A;  2XHK A;  2WII B;  1YNA A;  4IEX A;  1XQN A;  1YRZ A;  2G1M A;  1FMD 1;  4O65 A;  3VLB B;  1RTV A;  3O1S A;  1APN A;  4DIQ A;  4CUC A;  1OF4 A;  1SLL A;  1W6N B;  5C9A B;  1RUG 1;  4CCM A;  3VDD C;  1XE8 A;  2XR4 A;  1AR7 1;  4YGE A;  2XVL A;  3K3O A;  1N3P A;  1W8H A;  2RM2 3;  4J1X A;  4OYU A;  3LCP A;  3ZYP A;  1UYZ A;  3AVS A;  4ARY A;  3BCW A;  1YHF A;  2WSV A;  2WR9 A;  3DYO A;  1RUC 3;  4LTA A;  4WVZ A;  5FJH A;  4Q2F A;  3OEA A;  4HLT A;  1G9F A;  2YDE A;  1VBA 2;  2J1R A;  3B00 A;  3HWJ A;  4S2D A;  5I0U A;  3BOP A;  4AFB A;  2GU9 A;  3KT1 A;  2DU1 A;  2VOV A;  2WQ4 A;  2E7Q A;  5FYB A;  5B2G B;  4CDX B;  5SV8 A;  2IFW A;  1KFU L;  2ILM A;  4LMF A;  1RXG A;  1QNW A;  1RHI 3;  1ZVF A;  3O1O A;  1H2M A;  1IS6 A;  2HEY F;  1AX1 A;  2AZ5 A;  1EYB A;  5FZ6 A;  4IL7 A;  3QCW A;  4H14 A;  1Y9M A;  2C6S A;  4OVE A;  5FUP A;  3THD A;  2R06 3;  1GBG A;  2MEV 2;  1UWW A;  3MEP A;  3MI8 A;  3MO4 A;  3OF1 A;  3PL0 A;  1SLA A;  4ZS3 A;  3VDD B;  3ZXF A;  3WEZ A;  3H8X A;  2E7A A;  2RR1 1;  1AL2 1;  4HMZ A;  4Y24 A;  2BTV C;  3NAP C;  1BBT 2;  2B9U A;  3G7D A;  4BJ0 A;  3LOB A;  1OQE A;  1VIW B;  4XJ8 A;  3UET A;  3VDD A;  4A3Z A;  1CWP A;  3H3Z A;  4Q4V 2;  5H9Q A;  5JSP A;  4K8F A;  2B46 X;  3O1M A;  2XHN A;  2QQI A;  1XNC A;  3LA3 A;  2NZ9 A;  1A6C A;  1RC6 A;  3UV9 A;  2HKX A;  3KCY A;  1DBN A;  1NY7 2;  1AYM 1;  1H6X A;  1RMU 1;  1N3Q A;  5AC9 3;  5CFC C;  3UK9 A;  5F2W A;  4D94 A;  1H1A A;  3KT7 A;  2EIC A;  3M70 A;  2XKO A;  3I49 A;  3ZIX A;  5JWP A;  3GNE A;  2EAL A;  3HT2 A;  3OBZ A;  2VVD A;  2BV4 A;  3AMM A;  1LHO A;  3RZZ A;  3H1W A;  5FYZ A;  3B3Q E;  3FHQ A;  2LRP A;  3HT1 A;  1F35 A;  3F2Z A;  1RIR A;  4ATF A;  3DKQ A;  5FY9 A;  4I2O A;  3ST7 A;  4ORF A;  4UAP A;  3VGI A;  4KBZ A;  3E5U A;  3SH5 A;  4AED C;  5L9V A;  2YFU A;  1J84 A;  1CX1 A;  3RQ0 A;  1PK6 B;  1AUY A;  2OA2 A;  3PUI A;  4JV4 A;  4DUV A;  1L7L A;  1HQW A;  4URA A;  2WQZ C;  5GZD A;  1OH4 A;  1UW8 A;  4X8P A;  2FBE A;  1NKG A;  1R08 2;  4QX0 A;  3AM2 A;  5FZD A;  4ZXE A;  5A3U A;  1X8M A;  2DFB A;  1LEN A;  1CJP A;  3M8L A;  2MPF A;  3L2H A;  4I0A A;  5CFC B;  1HB2 A;  5IJR A;  5JPN B;  4LA3 A;  3WF4 A;  3N35 A;  4GMP 0;  1BJQ A;  5L73 A;  1DP0 A;  2IVI B;  5CFC A;  2WFF 2;  2A71 A;  3OYW B;  1WLC A;  1V6K A;  2HEV F;  1JYN A;  4HKO A;  3CQO A;  2EID A;  2PAK A;  3VKN A;  4LBL A;  2B9V A;  5FAX A;  4FTB A;  1WD4 A;  1TMF 1;  1JMU B;  2VOT A;  3LF7 A;  4BQY A;  2A70 A;  4AVC A;  4AED B;  1SCR A;  1GKB A;  2ZX0 A;  1UMZ A;  1K5J A;  3C7G A;  5A70 A;  4LUK A;  5KXC A;  4WM7 C;  2ZJC A;  4AED A;  3U14 A;  1V6J A;  1WW4 A;  4FFG A;  3VZL A;  4Q0P A;  2JKX A;  3NV2 A;  2LAL A;  3ZIW A;  3O1V A;  1W9W A;  3K46 A;  2JDN A;  1NQD A;  1ASJ 3;  3WP5 A;  3OY8 B;  1YQC A;  4ARX A;  5F2S A;  3UKV A;  4CDQ B;  1DGR A;  2JEN A;  2VM9 A;  2WNV C;  5EWS A;  5GZF A;  1UOB A;  3OY8 A;  1UXZ A;  5KR7 A;  3PU3 A;  3RI8 A;  3UL2 A;  3WNK A;  4K8R B;  5F9T A;  3B94 A;  1FAT A;  3BU0 A;  4Q4Y 3;  5CNA A;  4QX5 A;  2ZX2 A;  3Q8B A;  1FOD 3;  3THC A;  1CQ9 A;  1RUF 1;  4FPY A;  1PO1 3;  2W87 A;  3VN4 A;  4EWD A;  4NO4 A;  1NCQ C;  1PGS A;  2B42 B;  3M2M A;  3N7K A;  1XE7 A;  1XRU A;  4N90 A;  2JDU A;  4IEY A;  4XUN A;  5DDJ 3;  1GSL A;  2VZS A;  4V2W A;  5APA A;  3N7J A;  3NL1 A;  2NQY A;  2Z79 A;  5T5J A;  5FCC A;  5GZE A;  2QFE A;  1UY0 A;  5FMO S;  4CXW A;  1RUH 1;  2W2I A;  1KEX A;  2F4P A;  4S2G A;  1LHV A;  3DYP A;  2GMP A;  4WM7 A;  5D2A A;  1F2N A;  4CCO A;  3ZXG A;  5FPZ A;  3TN9 2;  1ENR A;  1HDK A;  3BTZ A;  2PEL A;  5EYY A;  4B1L A;  2E32 A;  2WC2 A;  2WNV B;  1EAH 2;  3I54 A;  4LUL A;  4PQ9 A;  4HK9 A;  4Q8K A;  4QPG B;  1CPM A;  1LES A;  2YU2 A;  2WLP A;  4YZ3 A;  2WNV A;  4KWK A;  3FE5 A;  1F5F A;  5CAD A;  5DAP A;  2RE9 A;  2D6P A;  3MBW A;  3WVJ A;  2R7E B;  1JOJ A;  2ZGM A;  4AVV A;  1R09 1;  2PHL A;  2RJK A;  5JPM B;  3RZL A;  2WZR 3;  2YC0 A;  1NA1 B;  5J7M A;  4AVB A;  2ZAA A;  4ZPI A;  2QZ2 A;  1Z7S 2;  4XAC A;  5FY4 A;  4BZ4 A;  1NCQ A;  5IK8 A;  1H9P A;  3T1M A;  4A42 A;  4PT6 A;  4XUQ A;  2VZQ A;  3KV6 A;  2XLG A;  3I4I A;  4C90 A;  1DZR A;  1YQ6 A;  2WL1 A;  3TEX A;  1OLM E;  3MHZ A;  1PIV 2;  1NUK A;  1ZBA 1;  2R07 3;  1TEI A;  3A21 A;  2HEW F;  4JDN A;  4QQH A;  5A6Z A;  1BEV 2;  1RUD 1;  4GIQ A;  1IPJ A;  4AK3 A;  1PZ8 A;  1H1M A;  2RS3 3;  3U4X A;  2SLI A;  4AVS A;  4HVQ A;  3K48 A;  2Q4S A;  2YFZ A;  4HET A;  3IKW A;  1UU6 A;  2A75 A;  3DEC A;  1CIW A;  4JGY B;  4GWM A;  3FHA A;  1QMJ A;  3CKH A;  4RGK A;  5C6C A;  5JXI A;  1QJE A;  3AXE A;  3CO2 A;  2GSY A;  2VCC A;  5E1R A;  2HWF 1;  4P9J A;  1R1A 3;  1VE0 A;  1XXN A;  1C8M 1;  3ILF A;  3OUJ A;  3S5A A;  1EV1 3;  2RM2 2;  5FP8 A;  2YBS A;  4OI2 A;  1UO9 A;  1VBB 2;  1LTE A;  3ZN6 A;  3O14 A;  3KCC A;  2HWD 1;  5FPA A;  5EV7 A;  1RUC 2;  1XC6 A;  2ARC A;  4NRP A;  3VL8 A;  5FMO L;  4FFI A;  5JCT A;  1BKZ A;  4A44 A;  2HLE A;  2CAU A;  3BN6 A;  1YQ2 A;  5IWF A;  3ZFG C;  5FRE A;  3OD0 A;  2YUE A;  3LGR A;  2OUH A;  4NWW A;  4AI9 A;  3FN9 A;  2GNT A;  5FZC A;  1AR9 1;  3ASI A;  4Z2W A;  1C5I A;  4XTM A;  2RS1 1;  3VBS B;  5F32 A;  1RHI 2;  2Y64 A;  3OEB A;  1SFN A;  4E2Q A;  2OT7 A;  1CZS A;  4AEM A;  5CYY A;  4FP3 A;  1YJL A;  3D0J A;  3EHK A;  2GH2 A;  2XJV A;  3IAQ A;  3DXU A;  1O5U A;  4HVO A;  3ZXK A;  1KRI A;  3UGF A;  2CWM A;  3FFQ A;  3KVB A;  4I0W B;  2IXI A;  1I5Z A;  2ZGU A;  4LEJ A;  3BYW A;  4MO3 M;  1VR3 A;  5F7U A;  2FCT A;  1BMV 1;  3MIC A;  2ZGT A;  3WSO A;  5E89 A;  4AWD A;  2XG3 A;  1DGW A;  4FQ4 A;  3ZFG B;  3AP5 A;  4K40 A;  5AC9 2;  4QWN A;  2PHU A;  3APB A;  5AFB A;  2VTX A;  4AI2 A;  5FP9 A;  3VD7 A;  3ZFG A;  1UU4 A;  1V6O A;  4UF0 B;  1UQX A;  4XUR A;  5JSO A;  1MVQ A;  5HV0 A;  1ULF A;  3CU7 A;  3K4A A;  3T4V A;  4CDW C;  3HAG A;  3OCP A;  2VJX A;  3WW2 A;  1DQ0 A;  1RVF 2;  4YW2 A;  5FZB A;  1UY1 A;  1BQP A;  1DLL A;  1H2L A;  4MXV A;  4CU9 A;  5K7P A;  3ZM8 A;  3NNG A;  4OUL A;  1QJX 2;  1QIQ A;  4BH9 A;  3E6B A;  4R4Z A;  3I3E A;  3VKL A;  1AJO A;  5FIX A;  1N47 A;  3PIG A;  3VKM A;  3J9S A;  2GC1 A;  2V5Y A;  4CYD A;  4NIA A;  1ODN A;  1W8Z A;  2WN3 A;  4HPK B;  2BDR A;  4GB3 3;  4U36 A;  3PUH A;  5A3L A;  2QQK A;  5IHR A;  4O9E A;  4Z82 A;  3WW1 A;  2NM1 A;  4HPK A;  2WT2 A;  4YW3 A;  2BQP A;  1JOP A;  1WUV A;  3VHR A;  4BQX A;  3I2K A;  2QQO A;  2YV8 A;  5KXD A;  4HVR A;  5DAX A;  5LK5 A;  5ABJ B;  3MIF A;  2QVS B;  2BGC A;  3LFI A;  4MGT A;  2A6V A;  4YLZ A;  1LCL A;  3W59 A;  2DDU A;  3RZM A;  3RG0 A;  2VME A;  4XUO A;  4BU2 A;  1X33 A;  1Y43 B;  4YW1 A;  3AZZ A;  4QX8 A;  1YIF A;  3K75 B;  2V4A A;  4KWL A;  3VBU B;  1O4Y A;  3WG3 A;  3THP A;  5C8W A;  1GOG A;  1BCX A;  4CDW A;  1D0H A;  2CWS A;  4AG4 A;  1JU4 A;  4QDS A;  5FLJ A;  4XF0 A;  2G9Z A;  1I5P A;  3D0S A;  4KBB A;  1W2T A;  5C71 A;  4XIO A;  1HX6 A;  4CE8 A;  5EJ3 A;  4FAG A;  1N3O A;  5FPL A;  1F9K A;  2HWC 2;  5JZG C;  1HQL A;  3IAP A;  4LO5 B;  1MEC 1;  3R4D B;  2MHF A;  5E6H A;  3AB0 A;  5JI7 A;  1E5R A;  2B45 X;  3AMP A;  2Q8E A;  1LGN A;  1M4W A;  2EVX A;  1AYM 3;  2YZ4 A;  3JD7 1;  5FY1 A;  4IET A;  4LE4 A;  2E7T A;  3I2G A;  4NPL A;  4E4D X;  4FPE A;  2ET7 A;  1IPS A;  4DRV A;  3MIB A;  5JR2 A;  5EXO A;  5FZH A;  2FCU A;  1ZM1 A;  1LED A;  1PO2 1;  1HRI 3;  2O0O A;  5M0T A;  4CUG A;  3RZK A;  3RRD A;  2BER A;  2D5F A;  3NV3 A;  5JVV A;  2MNG A;  1KDK A;  4GUL A;  3E6C C;  2RS5 3;  1LEC A;  1UYX A;  2KXL A;  5DDJ 2;  4TXW A;  1LHN A;  3WZ1 A;  1W0P A;  1DQ6 A;  5T3N A;  2ATF A;  1NT0 A;  2FZ2 A;  5H9R A;  2KR2 A;  2VMI A;  4LKE A;  3SIS A;  3HBZ A;  3LDK A;  5FV3 A;  3CMG A;  5KC6 A;  1C5H A;  2UUR A;  4FPH A;  5F5C A;  5A1L A;  3E1F 1;  3FLT A;  4MGI E;  5JZG B;  1KJL A;  4DXR A;  1S0J A;  2R04 1;  1S55 A;  2VMF A;  1RUE 2;  3D5O A;  4O61 A;  2JWP A;  4RR3 C;  4KWJ A;  4PIX A;  2JE9 A;  3A23 A;  3ENR A;  2D44 A;  5BNN C;  5JZG A;  4G4F A;  1LB2 A;  5C3O A;  1CX4 A;  2PLV 2;  1UY2 A;  1ZZ6 A;  2ARE A;  2SBA A;  2ZHL A;  3KZ4 C;  4QQO A;  5FKB A;  3ZXE A;  1HIX A;  3ZVX A;  1V6N A;  3QOP A;  5T5L A;  4JRA A;  1QY4 A;  4SBV A;  3H7J A;  3T0A A;  2ZAB A;  5IK5 A;  1KS4 A;  1YYN A;  1QXR A;  1UMH A;  2EIG A;  1KXG A;  2VBD A;  4TN7 A;  4UXA A;  1DGR N;  1C3H A;  5IVV A;  1OUR A;  2XL9 A;  4UWD A;  5FKC A;  1OPM A;  1H8T C;  1WCQ A;  2F6B A;  2WZR 2;  3KT4 A;  1TE1 B;  4PCR A;  2C24 A;  2X10 A;  3OBR A;  4EE2 A;  1FYU A;  4X8N A;  5FXV A;  2BYV E;  4D8M A;  4C1W A;  5LA0 A;  4GWJ A;  2DCT A;  2JIC A;  3HR9 A;  2WS9 1;  1G9C A;  3O1P A;  4ZS2 A;  2Z42 A;  4IV1 B;  1US2 A;  2R07 2;  4RQP B;  1IGO A;  2ZGL A;  3KLS A;  4EV0 A;  1OLR A;  1O6U A;  4S2F A;  3OGG A;  5BNN B;  5BNO B;  3R0R A;  1CR7 A;  5IW0 A;  5LY1 A;  4RR3 A;  1UX6 A;  2NLR A;  5LB6 A;  2XVK A;  4GKY A;  5BNN A;  3D82 A;  2W47 A;  4L99 A;  2DF7 A;  5JR7 B;  4IV3 B;  4CU7 A;  3TBD A;  2D6N A;  4XJW A;  4A6O A;  5J1X A;  3DYM A;  4I3G A;  5FYM A;  3U78 A;  3VBF B;  3J7M A;  2VG9 A;  3IB3 A;  2ZXQ A;  3VBH C;  2UY8 A;  4LNV A;  5IVF A;  3OSD A;  1H8T B;  4K3U A;  2OZJ A;  3KHB A;  2YGL A;  2ID4 A;  2P37 A;  4NRM A;  3N7M A;  2W52 A;  4IEZ A;  4P9L A;  2VZ3 A;  1EV1 2;  3MLL A;  4PDW B;  3N9N A;  1YJK A;  1H8T A;  3M7A A;  1RXF A;  1S2B A;  1PGL 2;  4OUE A;  2WT1 A;  3AKP A;  4QX7 A;  4ZU4 A;  3ZX7 A;  3UNP A;  2FCV A;  1W03 A;  5KHK A;  5FLH A;  1UF2 C;  2WA3 A;  4DB5 A;  2RDS A;  1RUH 3;  2BBA A;  3IDE A;  4OI0 A;  4CTE A;  2RDR A;  4CUB A;  1QQP 1;  1U5X A;  2XBO 1;  3KMH A;  4Q4X 3;  3RI9 A;  3PHM A;  3U11 A;  2FMD A;  1VRB A;  2ZGO A;  1VPH A;  4FTE A;  2GP5 A;  3OGV A;  3OUH A;  3PUS A;  2XWB B;  1VRH 2;  2NMN A;  3RZJ A;  4NE9 A;  1SBF A;  3H42 B;  1DU3 D;  1TG7 A;  3INA A;  3LEK A;  3ZYI B;  3C7F A;  4AAP A;  2JJ6 A;  1C1F A;  5JAX A;  3GYD A;  4KH9 A;  1ULG A;  3W5N A;  3MID A;  4MHR A;  5KHJ A;  1OF3 A;  1UL9 A;  3A22 A;  3VBH A;  2WWJ A;  1GNH A;  1A3K A;  5BNP C;  5A6X A;  3LFM A;  1DG6 A;  2P3J A;  3BB6 A;  3W20 A;  4TLG A;  2Z69 A;  2QQU A;  4IEV A;  4Y4R A;  3CZJ A;  3TB0 A;  4BE3 A;  1Y7B A;  2XB6 C;  3ACH A;  3T2O A;  5E16 A;  4CP2 A;  4H55 A;  2W1Q A;  1OQ1 A;  1DYP A;  1GUI A;  1B35 C;  2VEC A;  5C3R A;  1ZBE 1;  4CDU B;  5IVE A;  3MUY 1;  5LBF A;  1IKQ A;  4W6X A;  3LB9 A;  2Q8C A;  5LCW L;  1R08 3;  4G9S B;  2VO5 A;  3VD5 A;  3SXW A;  4FCA A;  4FVV A;  2XOM A;  4FFF A;  2GAL A;  4QGL A;  3BTX A;  4N53 B;  2BVB A;  4LKS A;  3CLP A;  3OGR A;  3VHN A;  4LR4 A;  2WFF 3;  3WQ1 A;  4JQR A;  1QH6 A;  2BEO A;  4FOV A;  2RJL A;  5FZE A;  1FMD 2;  4B1M A;  3I3M A;  1DQ2 A;  4Z92 B;  1JTZ X;  3TEZ A;  4P9X A;  4BYY A;  4EN7 B;  3N9M A;  3HIF A;  5HCA A;  1RUG 2;  3SEP A;  3LSD A;  4PLO A;  1AR7 2;  5BNP A;  5FP3 A;  3RYP A;  4CCE A;  1DDL A;  2AEZ A;  3ZFE C;  5EP9 A;  4KWU A;  4GWI A;  1JZ8 A;  3O0V A;  3Q8C A;  1B35 B;  1BXH A;  2GP3 A;  1GR3 A;  1QDC A;  2I45 A;  2ZEY A;  3B5L B;  3POS A;  5A7W B;  1GZ9 A;  3AMH A;  3VKO A;  3ZR6 A;  2F17 A;  5HPO A;  4NRO A;  1B35 A;  4BIS A;  1RJ8 A;  2XJT A;  3DL3 A;  2ZGQ A;  4H7L A;  4LBQ A;  4QXB A;  2R32 A;  2LS6 A;  4YW6 A;  4XJU A;  1WKY A;  4I0B A;  3IDC B;  4LUM A;  4AVT A;  4LHN A;  1HXS 1;  1W9Y A;  4XXP A;  4YZ2 A;  1QJZ A;  3H8R A;  2ZHK A;  1ND3 B;  2RS1 3;  2XJP A;  2XML A;  4OUM A;  3LPG A;  2JDP A;  4MV2 A;  1S1A A;  4DIN B;  1EUU A;  4WVW A;  1GWK A;  2VCA A;  2AYH A;  3ES1 A;  4J6G A;  3RSJ A;  1GLH A;  2W94 A;  2PAE A;  1ZA4 A;  4M0N A;  2XL7 A;  3S7I A;  5I0R A;  1US3 A;  2RR1 2;  4CSW A;  1AL2 2;  4HN0 A;  3ZFE B;  5CIR A;  2FDK A;  3C3V A;  4DZG A;  4XDQ A;  5FMD A;  1C4R A;  2C9A A;  1YIP A;  4IW3 A;  3ZFE A;  4DXT A;  4WM8 C;  3PVE A;  3VDC A;  1WA4 A;  1W2O A;  4CP9 B;  4FAH A;  1JYI A;  3WHU A;  1AYM 2;  1G7Y A;  2Y6L A;  1RMU 2;  1E5S A;  5K4L A;  3TN9 3;  5K0U B;  4J1W A;  4Q27 A;  2ZBJ A;  2CDO A;  5C4W B;  4B3N A;  5IVB A;  1EAH 3;  1L3J A;  1URX A;  2P5B A;  3RJ2 X;  1YI9 A;  3FMG A;  3WDT A;  2WLQ A;  5IAX A;  2V5D A;  3AYA A;  3DCQ A;  4QMA A;  4Y20 B;  2YYO A;  2YG0 A;  5JXG A;  1WLT A;  3KHC A;  3ZYJ B;  4D7T A;  1WCS A;  2RS5 2;  3JQW A;  3FZ3 A;  3CF6 E;  5A32 B;  4D69 A;  4Y20 A;  4AGV A;  4QPW A;  4ATE A;  5C9A C;  4QT6 A;  3MDP A;  5DUU A;  3AZY A;  4D0Q A;  1UMI A;  4HK8 A;  3EQE A;  2XXZ A;  4YVW B;  2UU8 A;  2UWC A;  3A4U A;  5F3I A;  1YO8 A;  3LZZ A;  1LOG A;  1PX3 A;  3ACG A;  4AQT A;  4QB6 A;  3CJX A;  1VMJ A;  3POJ A;  3DEM A;  1PIV 3;  3EBR A;  5L7O C;  4WM8 A;  4OQ8 A;  1O4Z A;  4FT8 A;  5LAT A;  1GP6 A;  1BEV 3;  1OVS A;  2B8M A;  3IN9 A;  4ZZ5 A;  1VMH A;  5DAV A;  4BK5 A;  1Q8P A;  2D6M A;  1W8W A;  5ACA 1;  1E5H A;  3POF A;  1UZZ A;  1VBD 1;  4BPZ A;  5FLI A;  2C4X A;  1W04 A;  4CDX C;  1DF0 A;  3UT0 A;  1OT5 A;  3JCI A;  4RHV 1;  3ZXJ A;  5FZ8 A;  3GBF A;  3GHN A;  4GH4 B;  1NAE A;  4K1Z A;  2EXH A;  3OJB A;  1KS5 A;  3J8F 1;  5ISL A;  4AI3 A;  4AEJ A;  2V73 A;  1V0A A;  1WD3 A;  2XQX A;  4PLN A;  4DS0 A;  2ZGN A;  2RJ2 A;  1WGP A;  1Y4W A;  2C26 A;  3I2J A;  3MGU A;  4FP2 A;  4K6B A;  4E2G A;  4A7Y A;  2VZR A;  4AF9 A;  1PMH X;  3C8X A;  4AFD A;  2YU1 A;  1W6N A;  5C9A A;  1TME 1;  3GBW A;  4CRQ A;  3OPT A;  4MET A;  1VBB 3;  1Y9Q A;  5FXZ A;  2P1B A;  1IOA A;  3ILR A;  4UI9 L;  3BUC A;  2E6V A;  4HFS A;  2YBP A;  2ZHM A;  5L7O B;  1A8D A;  2JB4 A;  1YQ5 A;  1SPP B;  4I01 A;  4AFC A;  3QLQ A;  2PHW A;  1SDW A;  4JQT A;  4ISR A;  4FOY A;  5L7O A;  4CCN A;  2XGX A;  1WWY A;  2P3I A;  3IBM A;  2CNA A;  1JYW A;  3RWN A;  1AYN 3;  3POI A;  3WIN E;  3SCG A;  1WCD J;  2ZAH A;  4IGQ A;  1RUF 2;  2VCM A;  4CDX A;  2VPV A;  2DUP A;  1Q8Q A;  4XMI A;  2GZW A;  4HBN A;  1LUL A;  1Q8S A;  1JOB A;  4XDP A;  4COZ A;  4DXZ A;  1VBC 1;  4WZF A;  1IPK A;  1NZC A;  3I2I A;  1D4M 1;  4LIU A;  1QJU 1;  1MQT B;  1LJ7 A;  4XVH A;  1HJG A;  1JW6 A;  1PK6 C;  1RUH 2;  4UT5 A;  2VQT A;  4JDM A;  1UOG A;  5FZI A;  1TVG A;  5I93 A;  4CCL A;  3W21 A;  3ZXL A;  2PTM A;  3WR0 A;  1QHD A;  2CAV A;  4Q4X 2;  5A3M A;  2PYT A;  3LEG A;  1VBE 1;  3NKG A;  2ZKL A;  4FO9 A;  4YM3 A;  1LU1 A;  1UN1 A;  1WME A;  4GMP 1;  5F5Q A;  2EXI A;  3RVH A;  4HSL A;  1UY3 A;  2J1V A;  1ZRE A;  2V72 A;  2DCY A;  2QQV A;  3MIH A;  1DYK A;  4XAB A;  1W6M B;  2QJV A;  4QXH A;  1K45 A;  2RMU 1;  3GCW A;  1GU3 A;  2VE1 A;  2XH6 A;  4K9S A;  4R9A A;  2WZ8 A;  4D3W A;  1U5I A;  4W4Z A;  3LEM A;  5LBB A;  5EIY B;  3WNN A;  1R09 2;  1M06 G;  3OGS A;  2EXK A;  2IVJ A;  3VKF C;  3ORJ A;  1RVF 3;  4FPL A;  4Q0Q A;  1W2A X;  2D98 A;  4A7K A;  4M3C E;  1QJX 3;  2GMM A;  4YZ5 A;  2W91 A;  1FPN 1;  5ANQ A;  4AAX A;  4XHB A;  4QXK A;  1OA4 A;  4MHU A;  1DZQ A;  4PJY A;  1OLQ A;  1ZBA 2;  5CKQ A;  2NP0 A;  4BWO A;  1PK6 A;  4OHW A;  3SEE A;  1H6Y A;  1RUD 2;  2OII A;  3CNA A;  2X05 A;  3VUO A;  1GZW B;  4CDQ C;  2WJS A;  3VZK A;  4RYD A;  2VZT A;  3CL1 A;  1CGP A;  4LBK A;  1LU2 A;  2WWU A;  5FZ4 A;  1IQA A;  5FY0 A;  3R4U A;  5KHH A;  1GZW A;  4ZU5 A;  3SCF A;  2WAB A;  3SHR A;  3E5X A;  4JKL A;  2JKB A;  3U37 A;  2WDB A;  1JOD A;  2CU5 A;  4Y22 B;  4N7I A;  1CAV B;  5B4N A;  5C3P A;  2EXJ A;  1QJY 1;  4CP1 A;  5IT6 A;  3OYW A;  1C8M 2;  1ODM A;  2HJI A;  1IKP A;  3DV8 A;  4NHM A;  2G9G A;  1RUJ 1;  1XYP A;  4E8C A;  1H0B A;  2ZPX A;  4KQ7 A;  2AUY A;  2D6K A;  2DCJ A;  4O7X A;  2V09 A;  1GAN A;  1JHN A;  3AFK A;  2HWD 2;  4IUG A;  1VAV A;  3WF0 A;  2DVF A;  1GWM A;  2WFP A;  4W50 A;  4YG3 A;  2JDY A;  4NIH A;  4F8A A;  4LBM A;  2HWC 3;  5D1I A;  2JDA A;  1JYT A;  1ZZ8 A;  1QEX A;  3GZA A;  4FXK B;  4X6R B;  4EJR A;  3URF A;  5KBF A;  4XBQ A;  3ME2 A;  3PUR A;  3T2P A;  2Y6F A;  1AR9 2;  4CXY A;  3B01 A;  4XFH A;  2RS1 2;  1GQH A;  4PF5 A;  4QPG C;  2VOW A;  4CA9 A;  4XUP A;  4CDQ A;  5A3P A;  1S2E A;  4MH0 E;  3HPN A;  5IK4 A;  2Y34 A;  5J48 A;  2BNO A;  2J1A A;  2Q8D A;  2W39 A;  5IUQ A;  4BM8 A;  3Q8F A;  1V9U 1;  2X53 S;  2WN2 A;  3D8C A;  1NA1 C;  3H3U A;  5F6K A;  1MZ5 A;  2P17 A;  3DPR B;  4FQZ A;  3ZPY A;  1IHM A;  2D3S A;  1PVC 1;  1U5Z A;  4XOG A;  4HT1 T;  3RMX A;  3AP6 A;  1COV 1;  2VTX J;  2TNF A;  2X5I B;  5C8C C;  1OKQ A;  2C1F A;  3UKN A;  1VBA 1;  1BMV 2;  4GKX A;  1ZYB A;  1QOT A;  2DVD A;  4XFB A;  1LOB A;  1AXK A;  4KI5 M;  1XB9 A;  1NXD 1;  2LRO A;  1SLB A;  3MFC A;  4OMD A;  3LKJ A;  1ZBE 3;  4XF9 A;  4FPG A;  1RUE 3;  4HON A;  4UBH A;  2VGD A;  1ENQ A;  1ST8 A;  1CVN A;  3ZR5 A;  3AFG A;  1WMF A;  2PLV 3;  2CTV A;  4JZR A;  1I3H A;  1VAK A;  1X36 A;  2VMC A;  2J1E A;  2VUD A;  4QGM A;  2VBB A;  4JGY C;  2MEV 1;  4JGZ B;  4HG6 B;  1MVE A;  4YFW A;  5IVJ A;  5JDB A;  4QPG A;  3AYE A;  4QQP A;  4BLJ A;  5CEH A;  5JLV A;  3RZH A;  1WMD A;  3P1I A;  1UZ0 A;  2ETE A;  2K0G A;  1WCU A;  2RG4 A;  4ZON A;  3O1U A;  1JYX A;  4XCB A;  3GCX A;  1K5M C;  3GHM A;  1NA1 A;  5C8C B;  2K2S A;  2OQ7 A;  4BOW A;  5EJ1 B;  3FHI B;  3ILN A;  3JBG 1;  2B7Y A;  3DN7 A;  5C8C A;  4DOU A;  3DGT A;  4N9H A;  3NO8 A;  5E88 A;  5FWE A;  3MLJ A;  2A3W A;  1IQD C;  2FMY A;  4XF3 A;  5GLW A;  3WP4 A;  4BQ4 A;  4NOT A;  4BQW A;  4BQ2 A;  3MYX A;  3OPZ A;  3KS7 A;  5A7O A;  1HB4 A;  1VB2 A;  4ZXK A;  1YQ8 A;  2RHP A;  1SQ4 A;  2HWE 1;  4LHK A;  3ZSM A;  1MS4 A;  1CN1 A;  2Y6J A;  4Q8L A;  3VBS C;  1Q8O A;  1LHW A;  1S0G A;  1BK1 A;  3I3B A;  5A80 A;  1W39 A;  2LM3 A;  1HRV 1;  4BDV B;  1FXZ A;  1SDD B;  2JD4 A;  1IS4 A;  1PNG A;  3OPW A;  4JGY A;  5EYX A;  5FBZ A;  4MYE A;  1AXZ A;  4MGS A;  5T50 A;  4F3J A;  5LWB A;  3I7D A;  2Y6H A;  2WRA A;  3WP6 A;  4BK4 A;  3E97 A;  3O1T A;  4Q0V A;  4XFC A;  5I8T A;  2ADD A;  2BWC A;  2DVA A;  1J1L A;  4YNI A;  4E8D A;  4NAO A;  1K5M B;  4UFJ A;  4JHT A;  4Q4W 3;  5FK8 A;  2XPJ A;  4AYU A;  1WCK A;  1W0O A;  1K5M A;  4QX1 A;  1MEC 2;  4XUT A;  2PHX A;  5FJK A;  2P2K A;  1WBF A;  1Q8V A;  1S2K A;  3NV4 A;  3PJY A;  4UW4 A;  1POV 3;  2Z4F A;  5LZ6 A;  2P34 A;  4HKL A;  3JD7 2;  3LIG A;  4IEU A;  2IXC A;  2HH9 A;  4M4P A;  3MF6 A;  3A7Q A;  4XBN A;  1VRH 3;  1AYN 2;  1SFY A;  3WNX A;  4QB2 A;  4HXC A;  1ZRC A;  4P14 A;  2IWG B;  1ULD A;  1GP4 A;  1JXN A;  2CY6 A;  1PO2 2;  3AP7 A;  4A3X A;  4CU6 A;  3KQ4 B;  3ZXD A;  1AR6 3;  4RGA A;  1OA3 A;  2VQ0 A;  3VBS A;  2J1T A;  4LIT A;  4LLO A;  1AF9 A;  4EN9 B;  3PNA A;  4AHW A;  4L92 A;  2OKX A;  4HN1 A;  1GMM A;  4CCD A;  2DU0 A;  4PBP A;  2CGP A;  1O7F A;  4AI8 A;  1JZ4 A;  4BB3 A;  4D7S A;  2R04 2;  1G9B A;  3B9I A;  5IAT A;  4ITC A;  2BVV A;  4QHB A;  4UFH A;  4BXS V;  4JX0 A;  2P4E A;  5DXD A;  2ZA9 A;  1W6P B;  4P9W A;  4W6Y A;  4XCA A;  5A3W A;  1AZD A;  1V00 A;  4MLO A;  2YY1 A;  2W1U A;  1ULC A;  5ABJ C;  3AP9 A;  1U12 A;  2GDF A;  3KF5 A;  2E51 A;  1RUI 1;  3LWC A;  1DQ1 A;  3I59 B;  4IQP A;  3AC0 A;  3PMS A;  4E4Z A;  3KV5 A;  2P6H A;  4C0H A;  4UF0 A;  5KXE A;  1S0D A;  2DCZ A;  3ELN A;  1T2X A;  1C8N A;  1CAX B;  1MS5 A;  2DYC A;  1ULE A;  2CHH A;  4LK6 A;  3VBU C;  3WW3 A;  5KWR A;  5A33 B;  2VZP A;  4UW6 A;  1FMD 3;  4XHX A;  1CAX A;  4TYS A;  4WVV A;  3PUQ A;  2P6C A;  4COY A;  4Z8B A;  1F8V A;  5FOB B;  5T54 A;  2GN3 A;  1RUG 3;  2WS9 2;  4GQ7 A;  5HXM A;  2YC4 A;  1AR7 3;  3P5B A;  1NCR B;  5CVR A;  3WV6 A;  4AE2 A;  2K46 A;  3ZN5 A;  1N1V A;  4NII A;  3UGH A;  4MSV A;  4UFM A;  4NUB A;  2D3P A;  5FZG A;  1R64 A;  1AXY A;  5CKN A;  4PLM A;  3POE A;  4G3Y C;  1DHK B;  1ND2 B;  4BHP A;  4CEW B;  4LXL A;  5CKM A;  5FZF A;  1OBN A;  4YGC A;  4COU A;  3IMN A;  3L9J T;  3S57 A;  2PHR A;  3VHP A;  1G6N A;  1BVV A;  5ABJ A;  2QKD A;  5I0D A;  3B69 A;  1HLC A;  1W9F A;  1Z78 A;  2CDP A;  3K77 A;  5L9B A;  4D6S A;  4ZU7 A;  4IE0 A;  2ZGR A;  1POQ A;  2AGS A;  4N9I A;  3H50 A;  2XJS A;  5CAZ A;  1H4G A;  5FMB A;  1OOP B;  3H7Y A;  2UY9 A;  1X50 A;  3VBU A;  2GME A;  5K8S A;  5FO9 B;  1QJU 3;  2RR1 3;  1AL2 3;  1QNY A;  2WO7 A;  3LPF A;  4NHL A;  4K21 A;  1XNA A;  2ADE A;  1QQP 2;  2BUK A;  1D2Q A;  4FPO B;  4OCT A;  5BV6 A;  5FBJ A;  3ROU A;  4PF1 A;  3WX5 A;  3POB A;  2VC9 A;  2OXB A;  2WYS A;  1JYC A;  1CD3 G;  4Y4Y A;  1GNZ A;  2Z2S B;  3GJA A;  1J59 A;  4RFT 0;  4Y5S A;  3G6J B;  5LRS A;  1Y9G A;  1GFF 2;  3RWK X;  3NNF A;  1RMU 3;  2R1D A;  2H6C A;  3J7H A;  1UCX A;  5DUX A;  5FZ0 A;  4BQ3 A;  3V65 A;  2JIJ A;  2ZGS A;  1UD1 A;  5FZ7 A;  1GYK A;  5CIS A;  2NYY A;  5FZ1 A;  3OG2 A;  3AKQ A;  2FD8 A;  4Y1V A;  1ENX A;  4E4S A;  1ZRD A;  1OVP A;  5FYT A;  1F4H A;  3GJB A;  4YWA A;  1H9W A;  5FR3 A;  4P08 A;  1SLT A;  1N1Y A;  4ASL A;  4XF4 A;  2JD9 A;  3HBK A;  3LD8 A;  4DMI A;  2R30 A;  3WUD A;  5F1R A;  5DMY A;  2BOJ A;  1Q5O A;  3THT A;  1XPW A;  3ALQ A;  2NPI A;  3I97 A;  2ES3 A;  5FP4 A;  5FUN A;  4TWT A;  1LKN A;  1MS8 A;  1UZV A;  4IV1 C;  4OFG A;  1HKD A;  1NOV A;  2QQN A;  1ZBE 2;  4XFF A;  5A6Y A;  3S30 A;  4RQP C;  2CV6 A;  2GAU A;  1OC1 A;  3I2D A;  3I2O A;  1NE6 A;  1UU5 A;  2X8K A;  4QX2 A;  5BNO C;  3GAL A;  2HBT A;  3I3D A;  5FYV A;  4CPB D;  1UNB A;  5JIA A;  4GZ9 A;  4KGQ A;  4E27 A;  2GC3 A;  2ZMK A;  2R06 1;  1GV9 A;  4IV3 C;  2ZZQ A;  2VZ1 A;  3OTF A;  1U0A A;  2PFW A;  4HAN A;  4XZP A;  1JH5 A;  3VBF C;  2VUA A;  5J09 A;  2I74 A;  1JZ3 A;  1V70 A;  4ASM B;  4CZS A;  4LPL A;  1A8M A;  2NMO A;  1UIK A;  3H8U A;  5H9S A;  4EN0 A;  3PLQ A;  1FV3 A;  5IFP A;  1QJY 3;  2A3Y A;  3WQ7 A;  2WO3 A;  4C1X A;  4PDW C;  4B7E A;  4QHZ A;  1RUJ 3;  1TMF 3;  2GNB A;  2J1S A;  4HSJ A;  3VZN A;  4TZD A;  2H0B A;  5AC9 1;  2OPK A;  2GN7 A;  3IIA A;  3NW4 A;  1QDO A;  4H2A A;  4QQL A;  1H4H A;  5FQ0 B;  4OQ9 A;  2AEY A;  3VZJ A;  4AZZ A;  2PAM A;  1OPO A;  3KCX A;  5FQ0 A;  5DUV A;  4IV1 A;  3ES4 A;  3SH4 A;  5IK7 A;  4RQP A;  4ES9 A;  4WV8 A;  3RGB A;  4DUX A;  2JDH A;  1XNK A;  2GC0 A;  3VBO C;  1ZNP A;  3DF0 A;  2OYZ A;  4LBN A;  5BNO A;  2EIE A;  1HN1 A;  1W2N A;  5J36 A;  2HWB 1;  1OXC A;  5LBC A;  4O9G A;  5JOY A;  3FUQ A;  1DGL A;  1WZX A;  2NN8 A;  5T5P A;  5KC5 A;  4IND A;  1GP5 A;  4IV3 A;  4ASK A;  3AK0 A;  1RUN A;  1OUX A;  3BOW A;  2R0F A;  2WZP P;  2CYF A;  3VBF A;  2BOI A;  1P8J A;  4HZF A;  4CVU A;  1RUF 3;  5FPU A;  3K4Z A;  3QD6 A;  4Q4W 2;  1TNF A;  4GAL A;  4Y26 A;  1DGW X;  1WW6 A;  3EO6 A;  1W8F A;  1OI6 A;  3MZH A;  4PDW A;  4LT5 A;  2GNM A;  5BXX A;  3RZG A;  1JI6 A;  2A3X A;  4AL9 A;  3WDY A;  3HN3 A;  4FBF A;  4XJ9 A;  1OKO A;  1O4T A;  1AR8 1;  2K9Z A;  3RS6 A;  4CDU C;  4Q5O A;  3WD5 A;  2JG8 B;  3VBO B;  2AC1 A;  4RGG A;  2V4V A;  2WZE A;  5FRA A;  5GZC A;  1JN2 P;  1DQ4 A;  1S0C A;  2C5D A;  1QH7 A;  2R16 A;  2XVG A;  3MUZ 1;  3VBR B;  4XYX A;  2D40 A;  3VBO A;  4NPR A;  1G9D A;  3O5S A;  1AR6 2;  4N53 C;  3ZYG A;  5GLT A;  2IXK A;  2WO2 A;  2VXJ A;  4Y1X A;  4XF1 A;  3PTY A;  3JZV A;  4L8Q A;  4JCK A;  3B02 A;  3I2H A;  5DAQ A;  4MG2 A;  2LUW A;  2OS2 A;  4IGP A;  2C9K A;  2PQS A;  4KG8 A;  1R09 3;  2JIG A;  2VW2 A;  2WNU B;  1CAW B;  1JBC A;  4LQR A;  4L2N A;  3ZSK A;  4B4Q A;  1ASJ 1;  2Y0O A;  5LA1 A;  2QQP A;  2BNM A;  4E2S A;  2WNU A;  3HQX A;  2YHJ A;  3BKZ A;  4CU8 A;  1E57 A;  1TQ5 A;  5LK7 B;  3M3C A;  1J3P A;  2ZEX A;  5FK7 A;  1QU0 A;  5A3O A;  3E6D A;  1PHM A;  1OHF A;  3GZT B;  3AX4 A;  2KD7 A;  3ZYB A;  1O8P A;  4XMA A;  1ZBA 3;  1O3T A;  2JE7 A;  2IZW A;  5DZG A;  3LOI A;  1RUD 3;  4OI4 A;  4Q4Y 1;  2KA3 A;  3JQX A;  1FOD 1;  4YW7 A;  1PO1 1;  4CDU A;  5ACA 2;  3C7O A;  4IES A;  5LBE A;  3FLP A;  1VBD 2;  2WT0 A;  4K1Y A;  1YC6 1;  2R0H A;  1ULP A;  2HWE 3;  4B7K A;  5FDB A;  1H2N A;  1ND3 C;  1QXJ A;  3FUO A;  3IMM A;  4IGO A;  5DDJ 1;  3ZKU A;  2D43 A;  3WQ0 A;  4RHV 2;  4Q26 A;  1LHU A;  2B4K A;  5FPB A;  1GQP A;  3AZV A;  4N53 A;  3J8F 2;  4D6Q A;  1YWK A;  2HWF 3;  5DN2 A;  1OUS A;  1F15 A;  2W9X A;  3USU B;  4Y5Z 0;  1C8M 3;  5LY2 A;  1F4A A;  3DKW A;  2VNO A;  1YXW A;  3K4D A;  4M3C F;  2IC1 A;  1JZ2 A;  1O3Q A;  3USU A;  1TME 2;  1H8V A;  2QCS B;  2VAU A;  2E63 A;  4ES8 A;  4R9D A;  1OFN A;  3PUA A;  2HWD 3;  2VOX A;  3ZDS A;  4C8D A;  1UYP A;  5EQU A;  2BRT A;  2XWJ B;  5FYC A;  4ISQ A;  5D21 A;  1I9R A;  2DTW A;  3HN1 A;  5A7W A;  3B7M A;  3M3O A;  2FDJ A;  3WG2 A;  1FT9 A;  5K0U C;  4QDQ A;  3VHO A;  4AOC A;  3OOX A;  3O0W A;  4LKD A;  4Z07 A;  4C0B A;  5C4W C;  3I2F A;  1AR9 3;  2Y6G A;  1Y3T A;  2H6B A;  4RSU A;  1WA6 X;  2ZML A;  2QQJ A;  3M3Q A;  1HV1 A;  2JB8 A;  1ND3 A;  4J25 A;  2WBK A;  3OGJ A;  3RFR A;  5SV5 A;  1VBC 2;  2R07 1;  3ZYF A;  1DYO A;  4A6S A;  1ZRF A;  1QJU 2;  3RJR A;  2RS3 1;  3P3N A;  2VD7 A;  4PI2 A;  2YRO A;  4YVW C;  1GIC A;  2VUL A;  2XJR A;  3AVR A;  2I07 B;  3P3P A;  4MVT A;  3ECQ A;  4JTN A;  5DPN A;  5JMC A;  3VD4 A;  1RB8 G;  4XTP A;  1UPS A;  1NZI A;  3WF2 A;  2Y6K A;  4AXO A;  3KD4 A;  5FY7 A;  1UKG A;  3O12 A;  4CP9 A;  2BP6 A;  1R1A 1;  1X9P A;  5GZG A;  2ZMN A;  4FSJ A;  2RMU 2;  4EN6 B;  3NJZ A;  3KVA A;  1EV1 1;  2XDV A;  2VR4 A;  5K0U A;  4GD4 A;  4XFG A;  4A2U A;  3SKJ E;  5C4W A;  3H8O A;  3T2T A;  1VMF A;  4IE4 A;  3K51 A;  3S0M A;  1S0F A;  2A7A A;  2QE3 A;  4GH4 C;  4HKW A;  2WAO A;  3USS A;  1LOA A;  1MAC A;  3WF3 A;  4I30 A;  1FPN 2;  5A32 A;  2Q1M A;  2IXL A;  2IXJ A;  2W08 A;  3TYJ A;  1N1T A;  3IPV B;  2E9Q A;  5FMC A;  5HI0 A;  1UKR A;  1ZRI A;  2E26 A;  3C2U A;  5KXB A;  2BW8 A;  3LA2 A;  3ZYH A;  4L97 A;  1QF3 A;  2W46 A;  4LBJ A;  4XQD A;  3IPV A;  3UKT A;  3NV1 A;  2DWR A;  1IS5 A;  4YVW A;  3RYR A;  3LDB A;  1SBE A;  4A7Z A;  2ORX A;  2PQQ A;  1H1I A;  3FBY A;  1MS3 A;  3NQH A;  3VZO A;  1WLD A;  3AZW A;  1EP0 A;  2JG9 B;  1KIT A;  1Q56 A;  5JI9 A;  3U07 A;  1K3I A;  3IT8 A;  5HBA A;  1T6G C;  4AVA A;  1MZF A;  1NE4 A;  4CCK A;  2CGN A;  4A4A A;  4YFZ A;  1QJY 2;  2YXS A;  1G9A A;  2BU9 A;  1U5Y A;  1RUJ 2;  1GOH A;  1TMF 2;  4QQ2 A;  5JSR A;  2FHR A;  4Y33 A;  2YGM A;  4FOQ A;  1LNS A;  5DUW A;  4GH4 A;  3WOG A;  1J3R A;  3WNO A;  1LGC A;  1SAC A;  1SBD A;  1MQT C;  4IXL A;  1ZX5 A;  4QU2 A;  1POV 0;  3MV1 1;  3N9O A;  3FBM A;  5H9P A;  2WYF A;  3E5Q A;  3GXU A;  4LO7 A;  1DFQ A;  1XJA A;  3AP4 A;  1MEC 3;  3PVB B;  2D6L X;  4YAR A;  3ZN4 A;  1W8U A;  5GKA C;  3T09 A;  3KF3 A;  5CB7 A;  5BUV A;  4OHV A;  1GZT A;  1G8W A;  5FPV A;  3JD7 3;  3KWV A;  4AR2 A;  4NVP A;  3AKS A;  1OA2 A;  1SPP A;  2XJQ A;  5FXW A;  4E9K A;  1RJ7 A;  3KM5 A;  1UIJ A;  3ACI A;  1ULO A;  5BYN A;  3NWK A;  1ONA A;  3FLR A;  1PO2 3;  4GB3 1;  2Y0I A;  3EB7 A;  4PI0 A;  5JOW A;  1OSG A;  4Q1P A;  3H1M A;  4R8H A;  1V9U 2;  1MS9 A;  3Q8E A;  4K20 A;  4DQA A;  1AL0 G;  3TEY A;  1PVC 2;  4TLF A;  1PGW 1;  2GC2 A;  3N9P A;  1COV 2;  2DBN A;  4NIG A;  2Q0A A;  2ZOE B;  3GZU C;  4NRQ A;  1MQT A;  2R04 3;  1NG0 A;  1Q3E A;  2QDN A;  3GZE A;  1RIT A;  3J4U H;  4EYU A;  4UBG A;  2W68 A;  3NJY A;  1C57 A;  1LOD A;  5A1A A;  1G86 A;  2QQW A;  4RFR B;  3CZU A;  1FAY A;  1LOC A;  1PNF A;  1ZRR A;  4CUA A;  4FTS A;  3WNM A;  3IM0 A;  3POG A;  3NNJ A;  4XAA A;  3TRS B;  2PXJ A;  5FZ9 A;  5A7P A;  2ZTN A;  4XC9 A;  3U1X A;  4K7J A;  1W6M A;  1ENS A;  1PMJ X;  3JB4 C;  4LOS A;  4WZC A;  4RD7 A;  4OHY A;  3KV4 A;  1QWR A;  3ATG A;  1ZZB A;  5EZW A;  1JHJ A;  1W2U A;  2ZEW A;  2E33 A;  2W95 A;  4ZY9 A;  1XOY A;  2O8Q A;  1REF A;  1GQG A;  4XE9 A;  3T30 A;  5C3S A;  4KNC A;  3JBG 2;  2WS9 3;  5F3G A;  2AAC A;  3NRU A;  3OBA A;  1AVB A;  5FY8 A;  4LO8 A;  5FYY A;  3RYK A;  1UOJ A;  3O1R A;  4BXF A;  1CJD A;  2DV9 A;  4UFL A;  4NAM A;  4FFH A;  4AGR A;  3BI3 A;  4WVM B;  1HRI 1;  4QX3 A;  2FDG A;  2GH8 A;  5HCH A;  4MX3 A;  3RDI A;  3H3L A;  2R6Q A;  1UX7 A;  3SQO A;  3HVD A;  2HWE 2;  2RS5 1;  1EY2 A;  4WVM A;  4A41 A;  4BA6 A;  1H2K A;  4JC1 A;  1TNR A;  4N43 C;  2HWB 3;  1STM A;  1HRV 2;  2EA7 A;  4YG0 A;  5JUV A;  3PIJ A;  3WNP A;  3NAP B;  1FI2 A;  2A6Z A;  2HWF 2;  2XUM A;  2X29 A;  4OHZ A;  3UYJ A;  5CG9 A;  1A78 A;  4QDR A;  3AZX A;  2UYB A;  4Y22 A;  3AYC A;  1IS3 A;  1PZ9 A;  3MFA A;  3NAP A;  2IUW A;  2ZAC A;  1AHS A;  3M3I A;  1CAV A;  4DNY A;  1ZA7 A;  3DPR C;  4XQ4 A;  5DQ0 A;  1V6L A;  3AL6 A;  5DZF A;  4AQ6 A;  2JE8 A;  2YPJ A;  2VOK A;  4Y3O A;  2X5I C;  1W6O B;  5FYI A;  5HCF A;  1LRH A;  3V0A B;  4D6R A;  3IDA A;  4RL7 A;  2WKK A;  2PHT A;  3WDV A;  1W6O A;  2C0Z A;  1QQP 3;  4AI0 A;  2XBO 3;  1AR8 3;  3V0A A;  3KSC A;  4AFM A;  2JX9 A;  2CGO A;  3VZM A;  1LOE A;  4AI1 A;  4ERO A;  4MGZ E;  1KDM A;  1MS1 A;  4TSV A;  4IEO A;  3ZMO A;  3M1H A;  1DLC A;  3NNM A;  4KGG A;  3SCH A;  4V2V A;  3ETP A;  1IG3 A;  1YLL A;  1FV2 A;  4JAA A;  1AX0 A;  4GWN A;  5CZK A;  4BQ1 A;  3NVC A;  1D0G A;  4N43 B;  3III A;  1ZZC A;  2VXR A;  2WO1 A;  5GJ6 A;  4JGZ C;  3WF1 A;  2Q1F A;  5JOZ A;  5LA9 A;  1TZO A;  3T1L A;  2VMH A;  4N43 A;  3RNS A;  3A0K A;  3SMH A;  4CP0 A;  1OD3 A;  3BGA A;  4UYB A;  4OLL A;  2D5H A;  1SZB A;  4ONU A;  3BPS A;  3GDB A;  3UJO A;  3FL7 A;  3TNQ A;  3KV9 A;  3R4S A;  1BK0 A;  3MV0 1;  3ZPO A;  5L9R A;  5IAV A;  3DPR A;  4V1P A;  3S5Q A;  1J3Q A;  2TBV A;  5JXH A;  2ARX A;  2X5I A;  3D6E A;  5GM0 A;  5A3T A;  1RYY A;  4BIF A;  4IE7 A;  5FYU A;  5AVP A;  2ZX1 A;  2XQR A;  3V64 A;  1RUI 2;  3R6S A;  5CFD C;  1KFX L;  3PME A;  3WQB A;  3TAY A;  3OB8 A;  2P3Y A;  3GBG A;  5T5O A;  3BOD A;  2KM2 A;  1SEF A;  3WUC A;  3M3E A;  5F5I A;  2WNO A;  2VUC A;  5DAB A;  3J7L A;  4WM7 B;  1W05 A;  2RVA A;  1BBT 1;  1CON A;  1K12 A;  1XU1 A;  3CDZ B;  3GM8 A;  4JGZ A;  5I0T A;  1YI7 A;  4N7U A;  2QUO A;  2PN5 A;  2HYK A;  3ABZ A;  4Q4V 1;  3V56 A;  3ZMN A;  3MW2 A;  3PTR B;  4Q4X 1;  2VW1 A;  4R9C A;  4DXS A;  4MGQ A;  3C7E A;  2BFU S;  1RGS A;  1O59 A;  3JUU A;  5BNQ A;  5GLV A;  4MXW B;  4MAD A;  1YFU A;  4LJH A;  1W06 A;  1NY7 1;  4URT A;  3WW4 A;  2VCB A;  2BJS A;  3VD3 A;  2PMW B;  3ITQ A;  5FFO C;  1H30 A;  2PHD A;  4MXW A;  1QJF A;  1JZ6 A;  2ET1 A;  3H9A A;  2JDZ A;  1O8S A;  2DFC A;  4EWE A; 
#chains in the Genus database with same CATH homology
 5FY8 A;  5FYH A;  5FYY A;  5ISL A;  5FZ0 A;  4XDO A;  2YBK A;  5FZO A;  2OS2 A;  4IGP A;  5FZ6 A;  4BXF A;  5FZ7 A;  4V2W A;  5FUP A;  5FZ1 A;  5FZE A;  4DO0 A;  4GJZ A;  4QWN A;  2W2I A;  3PU8 A;  2YU1 A;  5FYT A;  4TN7 A;  3N9M A;  3OPT A;  5IVV A;  3AL5 A;  3LDB A;  5FP9 A;  2OQ6 A;  5FXZ A;  4CCO A;  3PUR A;  4UF0 B;  3LD8 A;  5FP3 A;  2YBP A;  5A3P A;  4LIT A;  3UYJ A;  5FP4 A;  2GP3 A;  5FUN A;  4CCK A;  5FXV A;  5A7W B;  5FZB A;  4CCN A;  2YU2 A;  2Q8D A;  5F37 A;  4BIS A;  5FZA A;  5F2W A;  4QXB A;  3AL6 A;  4IGO A;  4Y3O A;  5FYV A;  5FJK A;  4GJY A;  4IGQ A;  5FYI A;  5LY1 A;  2XUE A;  4Y33 A;  5IW0 A;  3ZLI A;  4D6R A;  5FPB A;  3U4S A;  5FYZ A;  2XML A;  4XDP A;  5FY4 A;  5A3W A;  4D6Q A;  5IVY A;  4QU1 A;  5FY9 A;  3N9O A;  4LIU A;  5LY2 A;  3KV6 A;  4QXC A;  5FYM A;  4HON A;  5FZ3 A;  3U78 A;  5FZL A;  4V2V A;  5FZI A;  5IVF A;  4CCL A;  4CSW A;  3KV5 A;  4UF0 A;  3PUA A;  5FWJ A;  5FPV A;  4C8D A;  4URA A;  4BU2 A;  5A7N A;  3N9N A;  5A7Q A;  5FYC A;  3RVH A;  4QX8 A;  5FXW A;  4QX7 A;  5IVJ A;  5A7W A;  5FZD A;  3K2O A;  3PUQ A;  5CEH A;  5FZK A;  5F39 A;  4QXH A;  4LIV A;  4HOO A;  5K4L A;  3KV9 A;  3ZPO A;  4CCJ A;  5LW9 A;  5IVC A;  4GAZ A;  4EZH A;  3DXT A;  5IVB A;  4NUB A;  5FZG A;  5F3E A;  1VRB A;  2OQ7 A;  3N9P A;  2P5B A;  2GP5 A;  5FPL A;  4EZ4 A;  3PUS A;  3K3N A;  5FXX A;  4E4H A;  5A3T A;  5FP8 A;  4LXL A;  2YBS A;  5FZF A;  5E6H A;  4ASK A;  3N9L A;  5ANQ A;  5FYU A;  5FY5 A;  5FWE A;  2Q8E A;  4AAP A;  5FPA A;  3N9Q A;  2VD7 A;  5FY1 A;  5A3N A;  5A7O A;  5FPU A;  5A7S A;  4EYU A;  4D6S A;  5F5A A;  5A1F A;  3NJY A;  4DIQ A;  3AVR A;  3PDQ A;  2WWJ A;  5IWF A;  5FZH A;  2XXZ A;  5F5I A;  2OX0 A;  4CCM A;  5F3I A;  5FZM A;  4AI9 A;  5FZC A;  5A80 A;  3K3O A;  4CUG A;  4Y4R A;  5FY7 A;  2PXJ A;  5F3C A;  5FZ9 A;  5A7P A;  5F32 A;  3AVS A;  2WWU A;  5F2S A;  5FZ4 A;  3OPW A;  3PTR B;  5FY0 A;  5LWB A;  2OT7 A;  3KVA A;  2XDV A;  5FJH A;  5FYS A;  3DXU A;  3KV4 A;  4GD4 A;  5KR7 A;  3PU3 A;  5FV3 A;  5IVE A;  5FBJ A;  5F5C A;  3KVB A;  5A1L A;  2Q8C A;  5FP7 A;  2YPD A;  5FYB A;  5FZO B;  5FZ8 A;  5F3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...