5A1FA

Crystal structure of the catalytic domain of plu1 in complex with n-oxalylglycine.
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
458
structure length
450
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
total genus 144
structure length 450
sequence length 458
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a1fA01
4CCNA 5FYMA 2XDVA 5FYIA 5FZ6A 5FY0A 4QXHA 4QU1A 2PXJA 2YPDA 5CEHA 5FYZA 5FP7A 5A7OA 2OT7A 3N9LA 3KVAA 5FWEA 4D6RA 3NJYA 5F3CA 4V2VA 2VD7A 5FZCA 3N9QA 5FP9A 5FZDA 3LD8A 2OQ7A 5F5AA 2XUEA 4EZ4A 4HOOA 5IVEA 4C8DA 4GJZA 4IGOA 2W2IA 5FYSA 4QWNA 2YU1A 5LY1A 3N9NA 5A3WA 3N9OA 3AL6A 5FXXA 5LWBA 4D6SA 5A1FA 2Q8CA 4LIUA 4TN7A 5FYVA 3K3NA 4CCMA 5A3TA 5A7SA 1VRBA 4NUBA 3OPTA 3PU8A 4BU2A 4XDOA 5IVBA 3N9PA 5FY4A 2GP5A 5FZFA 5FPAA 5FZ9A 4IGPA 3PUSA 4EZHA 4QXBA 5FZOB 5FZEA 2WWUA 5FZ3A 5A1LA 5FYCA 5F32A 5FXVA 2YBSA 4UF0A 5F2WA 5FYYA 5FP8A 5FZAA 3PURA 4URAA 5FY1A 5FZOA 2Q8EA 5FJHA 4LIVA 5FPLA 3ZLIA 5K4LA 4Y33A 5F3EA 5F3IA 5A7NA 5A3PA 3PDQA 5FXZA 5IWFA 4AI9A 5FZLA 5IVCA 4XDPA 4EYUA 5A7WB 4V2WA 3AL5A 4QX7A 5ISLA 5FYHA 4QX8A 4CCKA 2OX0A 5LY2A 2P5BA 5IVFA 3KV6A 5A7WA 5FZ4A 5FZ8A 3DXUA 2XMLA 5F5CA 2YU2A 3KVBA 3AVRA 5IVJA 4LITA 5LW9A 5FPVA 5KR7A 5F3GA 5A80A 5ANQA 5FUPA 2Q8DA 5FV3A 5F5IA 4QXCA 4BXFA 3K2OA 3N9MA 3AVSA 4UF0B 5FBJA 5FZGA 5A7PA 3U78A 5F37A 5FPUA 5IVVA 3OPWA 5FZ7A 4AAPA 3U4SA 5FWJA 4Y3OA 4CCLA 4CUGA 4BISA 5FXWA 4GAZA 5F2SA 4CCJA 2WWJA 2YBKA 4GD4A 3DXTA 4CSWA 5FYUA 5FPBA 4D6QA 3LDBA 5A3NA 5FP3A 3K3OA 5FY7A 5FZ1A 5IW0A 4LXLA 4ASKA 3KV4A 5E6HA 2YBPA 3RVHA 4CCOA 3PTRB 5FYTA 3KV5A 4IGQA 4Y4RA 5FUNA 5FYBA 4E4HA 3KV9A 2OQ6A 4GJYA 5FJKA 5FZBA 2OS2A 4DIQA 5FZIA 4DO0A 5FY8A 5FZKA 2XXZA 3PUAA 3UYJA 3PU3A 3ZPOA 5FZHA 5FZMA 2GP3A 5FZ0A 5FY5A 5A7QA 5F39A 4HONA 5FY9A 5IVYA 3PUQA 5FP4A
chains in the Genus database with same CATH superfamily
4FT8A 4Q4V1 4QHBA 1DZTA 5A3MA 4HPKB 4G9SB 4NR1A 4YW6A 3ITQA 2YC0A 4XJZA 5FY0A 4BQWA 3SLIA 1H1IA 2W1WA 4XHBA 2K46A 4GMP0 1NA1B 1OUSA 3FWEA 1GFF2 4LLOA 2GH8A 2QQLA 1F9KA 1OLRA 3POIA 1K5MC 5DAXA 4Q8KA 2AZ5A 2H6BA 2EXJA 1V9U1 2GMMA 3WDUA 1WLDA 1ENQA 3SH3A 3MIHA 4KWLA 1AX1A 1H6XA 2ORXA 2X09A 2E26A 4QGNA 4CDQC 2ATFA 3AMNA 5EHDA 3MUY1 1ENRA 2AACA 2YFZA 4C8DA 4PDWA 4HVRA 2CY6A 1CAXB 2WDBA 3N9NA 1J3PA 3I2HA 4ZY9A 2CL2A 4RR3A 3W5NA 1AR91 2J1EA 2QQVA 3Q8AA 4MHUA 4JC1A 4RS5A 4J25A 1AYM2 4YVSB 2ZMLA 3K3NA 4CCMA 5I8SA 1JYVA 4JX0A 3OPTA 4PIXA 5E8AA 3WNOA 5C71A 2WA4A 5CADA 3GHNA 3DPRC 3ZN4A 1AR82 2ZGTA 4FPOB 1CZTA 4IDZA 4LOTA 5FPAA 3U4XA 4HT1T 4INDA 5LATA 3I3DA 1MACA 2D6OX 1YCIA 1ZBE1 3FLTA 1C4RA 3OGJA 3RYPA 3HD8B 4NWVA 2Y6GA 3FL7A 5CG9A 1OUXA 2MEV2 3RI9A 1RUE1 3VUOA 1LNSA 3NSTA 2B42B 2OPWA 2HWC2 1UYXA 2W46A 2J1SA 3MUZ1 4DINB 4W4ZA 2QUOA 1PO21 2ZZJA 3RWNA 4CU7A 2CSGA 2BVVA 2VPVA 5IWFA 1FOD3 3OG2A 1IOAA 1HRV2 2UWBA 5FZLA 1TE1B 4KU8A 3A22A 3HNBM 1RC6A 1MZ5A 2I2SA 2RMU2 3I2FA 4N90A 1WW6A 2DVFA 3VLBB 5KXDA 3LA7A 1SLTA 1JZ8A 4W6WA 2GDFA 1CX1A 5LY2A 5IVFA 1RUG3 2X10A 1S0FA 2J1UA 3N7KA 2LTNA 3RGBA 3GDBA 2XMLA 1SBEA 1L7QA 1Z78A 3ZXFA 3PUIA 1U5YA 4LHLA 4JGYB 4JHZA 1NCRC 2A73B 2F4PA 1VALA 1KD7A 4XE9A 5BNOA 1DFQA 2A3YA 4FFHA 5JXHA 4OFGA 3MV01 2RV9A 4XIOA 4Y1VA 4K9SA 3AVSA 5IAXA 4CP2A 2G19A 1UPIA 4NROA 1W6PB 1POV3 3MIBA 1ZYBA 2C1FA 4JTNA 1W2AX 2VZ3A 3WT3A 3A0NA 3INAA 2HEYF 3NV1A 3SHRA 3ZIXA 5F1RA 2Y8KA 3OGVA 3QH6A 2RE9A 4AHZA 3BIWE 1ZRRA 1DHKB 3MFCA 3R6SA 3UV9A 2P4EA 4FPEA 4CSWA 4ES9A 2D3SA 4Q0QA 5FY7A 4WVMA 3V0AB 2Z42A 4OQ8A 2E6VA 4DEQA 1OI6A 3IAQA 2PMWB 2W1SA 2D6PA 3JB8A 1BQPA 5FY8A 4TYSA 4RHV2 1R1A1 4N7UA 2KD7A 4BYYA 1L7LA 1VPHA 1POV0 1RGSA 2ZXQA 2W1UA 3PDQA 2JDNA 2PLV2 5AC91 4UYBA 4XACA 1GOFA 4KQ7A 4Q4X1 4YZ1A 1RMU1 1IHMA 1KXGA 1MQTA 2B46X 3ZXGA 4QXHA 2ZGLA 3LPFA 4HETA 4JDOA 4DPNA 3H3ZA 3LCPA 4AI3A 4I0BA 5FO7B 4NRMA 1OSGA 1UX6A 1PX4A 4COWA 5C8CC 5CKNA 2CGPA 5F3CA 3VD4A 4R52A 4AFMA 4V2VA 4LT5A 1DZQA 2ZS6B 3DGTA 4AVTA 2Y34A 4WV8A 5IJRA 1RHI3 5CFCB 1UL9A 4G3YC 3FBMA 3TEXA 2QDRA 2XKPA 2FBEA 3A7QA 3DYOA 2FD8A 3KMHA 1DDLA 1VBB2 1W8OA 2X5IC 3VDDB 1W8ZA 2ZBJA 3MZHA 3V65A 5C8WA 5DAQA 3MW3A 4Q1PA 3SEEA 2EA7A 3K4AA 3VZNA 2PQSA 4AQSA 1GQHA 1OFNA 3A21A 1O6UA 1YWKA 1VRBA 2FQPA 4YFWA 3AK0A 4TLGA 4NHXA 1LU2A 1S1AA 4MGYE 3ST7A 4QGLA 3CJXA 1Z0HA 2RS11 1V70A 4UW4A 4XHXA 1X7NA 3GYDA 1N3PA 4Z2AA 1BVP1 2AH2A 3AFKA 3PVBB 3QLQA 5L9RA 2VW0A 5GZEA 2QZ2A 3AJZA 4UF0A 5F2WA 2VY0A 2IWGB 5FKCA 3AYEA 2XVLA 1Y3TA 5TSWA 2JB4A 2PN5A 1PK6A 5FPLA 3WSOA 1HJGA 1PO11 2VBPA 4LA2A 3WP5A 1G9CA 1QU0A 2VZRA 2TBVA 4EE2A 1YIFA 4FTEA 1A34A 1WD3A 3POSA 2HWD3 2ZGRA 3H0OA 5C4WB 2B9UA 4HBNA 3RYKA 3KWVA 2KM2A 4P02B 1H2MA 3NW4A 3MO4A 1AR63 5BPXA 5JI7A 1PK6C 1RINA 3HNMA 4UFJA 4MZUA 2V4VA 2C0ZA 4D7YA 4GWIA 4NHLA 5JR2A 4COVA 3SKJE 1AXZA 3M3OA 4J6GA 4I01A 1LGCA 2CGNA 3B00A 5FFOC 4KGQA 1NCRA 1QJY3 4RL7A 4YGEA 3IDEA 5C9AA 1H1MA 1CAUB 2W52A 2XJRA 3VHPA 2QBXA 4Z2WA 4QGMA 2X5IA 2XBO3 1O3SA 4E8DA 5HCFA 1RJ8A 1V0AA 2HWF2 4QX2A 3C3VA 3GZEA 1LJ7A 5JLVA 3TAYA 4IEYA 5E6HA 3ZN6B 3B02A 3NNMA 2FCVA 3JD73 4BLIA 1OPMA 5SV8A 1CAWB 2JDAA 4ATEA 1GV9A 3ZO0B 2ZKNA 4H3WA 1O3RA 2XXZA 3K4ZA 3I97A 3DKQA 2KXLA 3HBKA 3BOWA 3J4UH 1G86A 2TEPA 4MV2A 3RJRA 1Y4WA 5LEKA 1FT9A 3T0DA 1OKQA 2VL4A 3PUQA 2AREA 2RM22 3NVCA 4Q4V3 3C7GA 1JN2P 1N1YA 2HBUA 1AR61 2E7TA 1S0CA 1UQXA 2VH9A 1AYM1 4JCKA 5T55A 2WZR3 1CQ9A 1ZX5A 3I2JA 4DRVA 2LRPA 3USUB 1O5UA 1VJ2A 2ERFA 3DCQA 4XJAA 1D4VB 3PVNA 3NAPA 3T2OA 4DUWA 4KNCA 3IT8A 2ZX4A 3TB0A 5JR7B 1QH7A 4CP1A 4QM9A 3J8F1 1Q8PA 4GALA 3JBG3 5FLJA 3ZFEB 4RFT0 3H50A 4WM8B 2QQIA 2DCKA 2ZMNA 1K5MA 1DYOA 1X9TA 1ZM1A 3K46A 4IGOA 1H8TB 4FAHA 3H8UA 5EQUA 1UXXX 2ZGMA 1OOPA 1JOJA 4YFZA 4QHZA 3TNQA 5FK8A 1J83A 2Z4FA 5CFDB 2WT1A 3U11A 4UW6A 1N1VA 2K2SA 2YB7A 4Z8BA 2D44A 4MG2A 2GP5A 2IXCA 2WSVA 4GH4A 5A7PA 1DZRA 5JI9A 1ZBA2 1AHSA 1UYPA 5E89A 3VZKA 4CPBA 1FV3A 2VAUA 2WINB 3H1YA 4FFFA 5DABA 4URAA 3MV11 2VZSA 4JDNA 5FPXA 3ZLIA 1OLME 2C24A 2XOMA 3OUJA 4RGKA 5K4LA 1REFA 4CE8A 2P3KA 3O1SA 1ULFA 4C1WA 2ZAHA 5D21A 1VBA3 2WFF2 2XLGA 2GALA 1ASJ2 5GJ6A 1FXZA 5FLIA 4QPGB 3SNMA 2WSUA 1IQDC 1N3QA 3FBYA 4XQDA 4XYXA 2BPA2 1WLCA 3Q8BA 1GANA 3RNSA 4AK3A 2BBAA 4AVVA 3KQRA 4LO8A 4YVSA 2IC1A 2Y26A 4R9BA 3DUIA 1G7YA 1AL22 3TEZA 1KITA 3AVRA 4EN6B 4OHXA 3T2QA 5FPVA 5KR7A 5F3GA 5A80A 3VZJA 4AOCA 4FXGB 1SLIA 2A7AA 1R1A3 3NNJA 3USSA 2HWB2 2ZGPA 4HPKA 1KDKA 2YDEA 4MVTA 1UIKA 1EY2A 4BQYA 2OA2A 3NV3A 1ASJ3 2OXBA 2DV9A 2CDOA 4GWJA 1CIYA 4IV3B 4PDWC 2BGOA 4MUVA 4Q1RA 3U4SA 2XJQA 3AP7A 4A3ZA 4TWTA 4YM2A 4IEUA 3MIEA 3AYAA 2VJXA 4IXLA 4BA6A 3ABZA 4CCEA 1E57A 4Y1UA 3BU0A 2LROA 1AXKA 2JICA 3URFA 1SLAA 2RG4A 1AZDA 2WNVB 1QY4A 1P8JA 3P3PA 1A8DA 1ZREA 1BZWA 5L9BA 2BFUL 5FBZA 2QTWB 1W6QB 3O0XA 3POJA 4LKFA 4PHZA 4OHZA 4XJ8A 3AJYA 3U75A 2VZUA 1FPN2 4N43B 4Z82A 5HCBA 1NX9A 2FDHA 1PGL1 5EWSA 3PUAA 2DVBA 3POYA 1W39A 4S2HA 5FZHA 3MDPA 1JODA 3T1LA 2PHXA 3B3QE 3MIFA 3ZYJB 3U07A 2IFWA 5KC6A 1MZ6A 5CFDC 1JZ2A 1PZ9A 1S2KA 2B39A 4K7JA 2JDKA 4BMEA 3LQCA 2ARAA 2L9LA 2RS52 2VOXA 4B4QA 4CDXA 1QJX2 5KXCA 2WNOA 4PLMA 1BK1A 1UY1A 3V56A 2VUCA 3ACLA 4D7SA 1GU3A 4W6XA 2QJVA 1H9WA 3JD71 3PJYA 4N9IA 5D8AA 3JB4C 3UKTA 4P08A 4OUEA 2RDRA 1XB9A 4DFSA 3M1HA 3IDAA 3IMMA 2VQUA 5C5UA 5F5AA 3ZXJA 2NP0A 2VQ0A 1DP0A 2V4AA 3RDIA 1DLLA 4K8RB 1Q3EA 2YMZA 4PLOA 5CG8A 3T4HB 2P1BA 2XKOA 1OF3A 4JHTA 2QCSB 5A1FA 1KS5A 1B35C 1W3XA 5K7PA 3K77A 5AFBA 5JXGA 5FYVA 4AEJA 2EICA 2B4KA 4NUBA 4PBOA 3THTA 1WCKA 1W8NA 1ZRCA 1NCQB 4D0QA 2XONA 5JIAA 4Z07A 2VMFA 5JIUA 2J22A 1JZ3A 3RZZA 1UMHA 1RUC2 1LHOA 2VVEA 4M0HA 3A23A 1NCRB 1AL21 2AUYA 5FMCA 1CWPA 3OD4A 2TNFA 5DDJ2 5FZ3A 2W0XA 2Y60A 4JQRA 4O9EA 1A8MA 5EJZB 4YVWB 3S7IA 2QQWA 1XC6A 3S5QA 4B4RA 4CU6A 4B7KA 1DYKA 2A6YA 2JE7A 3ZKYA 4NHYA 5C7GA 2QQJA 2VG9A 1UCXA 1ZZ8A 3IZOA 1DCSA 4QB2A 1F2NA 1J1LA 4XUNA 4LO6B 5JWPA 5A6YA 1JYXA 1FNZA 1PIV3 1Y43B 4GQ7A 2NQYA 4B1LA 3KGLA 5FOJB 1R64A 2A3WA 3EJKA 5GZDA 3TN92 3VDDA 2WBKA 2JIGA 4GKYA 3THDA 3ZMNA 3N35A 5FYHA 3HQRA 4GB31 3W20A 2BWAA 1N3OA 2VMCA 4M3CA 3WCSA 3OPZA 5BNPB 4XF1A 4Z1VA 1Q8OA 3PUHA 3WP6A 3WVJA 3ZDVA 3U10A 1UOJA 2F17A 4R4ZA 5BNQA 2ZX0A 2ZHKA 2P17A 2ZEYA 1Q56A 3AYCA 1PIV1 4KG0A 4Y5Z0 3HN3A 2CHHA 4YGCA 5CYYA 3S6PA 2OZJA 3KSCA 3CBNA 3ZXLA 4AEKA 1WMDA 2VUDA 1AR72 1GQGA 4UFKA 3N36A 3WP3A 3BOPA 4QDQA 4FFGA 5D1IA 3M3IA 5LB6A 1LEDA 4AL9A 3OY8A 2ZAAA 2R1BA 4XAAA 1EV12 1WZXA 1YFYA 2D97A 2VZVA 5F2SA 2CAUA 1XYNA 1HV1A 2WN2A 3RI8A 5F9TA 1C28A 2HBTA 4J1XA 1FI2A 1FPN3 4N43A 3NKTA 4UW3A 2W3JA 2GNMA 4YNIA 3WEZA 5GLWA 4AVBA 5GLVA 4JKMA 4CXWA 5FUNA 4E4HA 3LEIA 2LM3A 2IXHA 4QPIC 4LBKA 1YYNA 1JS9A 2WRAA 1MS9A 4AZZA 2ZMKA 4NOTA 4A6OA 1ST8A 2Y0OA 1W8HA 2GP3A 3POFA 4UAPA 5DN2A 1RUC3 1ODMA 4RSUA 1WUVA 3RZHA 3IDBB 4WM7B 2NMOA 1HJFA 3T2TA 5A33B 1YQCA 3I4IA 5EJ3A 3ZYRA 5C6CA 2Q1MA 1EV13 1RUJ1 1W6MA 1W9FA 2BU9A 2VOVA 2AENA 3MI8A 2PXJA 2KR2A 2QDNA 2DVGA 3WF0A 4O9GA 3DEMA 5CKMA 1W2NA 3ZSEA 1GWLA 2OT7A 4H55A 1LECA 1US3A 1G9FA 1OC1A 2DUOA 2JJ6A 4TTGA 5DAWA 3V0BB 3IIAA 3ZR5A 1QJX1 4AVSA 5C8CB 3D8CA 1RUG2 2VR4A 1MEC3 5IVEA 4FPHA 1CJPA 2WKKA 1E5SA 4OHWA 2XPJA 5LA9A 2NN8A 1CAWA 1PX3A 2JKBA 4AVAA 4OI0A 2RMU3 1WMFA 4NIAA 4BDVB 4YYOA 5C9AC 5JXIA 2C6SA 2TUNA 2CV6A 1FOD2 2JENA 3O0VA 4C0HA 2BOIA 2H0BA 4HFSA 1XU2A 5FR3A 3N9PA 1I1EA 2HEVF 1TVGA 2QQKA 5D2AA 4A41A 1UZ0A 4CDXB 1MEC1 5IT6A 3IBMA 3BTAA 2Y38A 4K40A 5KBFA 2R073 1LKNA 4H14A 5FXVA 4Q29A 2BDRA 2BGPA 2Z69A 1KS4A 3E6BA 4KWJA 1EAH1 2XWJB 3O12A 4NJ4A 3RMYA 1O7FA 2DU1A 3ZXAC 2R32A 1S0JA 3C7OA 4XJ9A 4RQPA 4YLZA 3WOGA 1W03A 3B93A 4COZA 2VXJA 4JV4A 3WQBA 2ZHLA 1H4GA 1LOFC 1W05A 2EF6A 4FQZA 4HSLA 4LO7A 4QKBA 1PMJX 1GP4A 3WY6A 3PLQA 1X33A 4LEJA 4AYUA 5C4WC 4UBGA 3VBSB 1C5IA 5KHIA 3M3CA 3H8RA 1HIXA 2XUMA 2RS33 1W06A 4QAWA 2FDIA 3O1UA 2RDQA 4MSVA 2WC2A 3FFZA 3VKMA 4W6YA 3I2OA 4Q0SA 3PMEA 1FATA 3HPNA 5B4NA 4FTSA 5FV3A 1UIJA 1BBT2 5FLHA 3VB9A 2VZPA 3QOPA 4B3NA 5J3UA 2JDZA 3PMSA 4PI0A 1NLQA 2IZWA 3M7AA 1BEV3 1VAMA 3AC0A 1QJX3 2DURA 4XOGA 4QB6A 1HDKA 4AAPA 1WA4A 2YY1A 1W6NA 1F35A 2WNVA 2HWD2 3OUHA 4BQ2A 2XJTA 4ONUA 4IE6A 2QKDA 1G9BA 3BI3A 2VVDA 5BYNA 1I6XA 5E1RA 1H9PA 1UZZA 2BV4A 1ZBA1 1COV3 2JDPA 3AZWA 2WLPA 3LZZA 4XFFA 3WDXA 4MGTA 2VCAA 1FAYA 2FZ1A 3FX3A 5EP9A 3ZR6A 5JOZA 4WM7A 3I49A 1MQTC 3DPRB 5FY5A 2J1VA 3HWJA 4LE4A 1QNYA 3J8F3 3CL1A 3M3EA 5LA0A 1BVVA 1XPWA 3SC7X 2W68A 4XCAA 3ZSKA 2ZPXA 4FOVA 4IV3A 5APAA 5GLZA 4RS5C 4LHSA 2A1XA 3ZDSA 1QXRA 2O14A 2PAMA 3ILFA 1YI9A 2XGXA 2WZPP 2VMHA 1AL0G 1UY0A 4OYUA 1V00A 2AEYA 1RXGA 1YLLA 3ES4A 3ZYPA 5J36A 1XE8A 1S2EA 5GLUA 2OQ7A 5DUUA 4CXXA 1Q8VA 2XUEA 4ITCA 2W92A 4LK6A 5EV7A 1AR62 3WG3A 1QJZA 2GC0A 4FCAA 1OFSA 3UL2A 1NUKA 2PELA 2UWCA 3LDRA 5HCAA 1HLCA 4JKKA 3UGGA 3C2UA 3R4DB 5EIYB 2CYFA 1N47A 3RQ0A 5FCCA 1BXHA 3VN4A 5FY4A 3ELNA 3THPA 2VCMA 4LPLA 3BKZA 4EV0A 5FUIA 2Y6JA 3WW1A 3JXSA 4AI1A 2Q30A 5FZOB 1OLMA 3VBHA 2Y6LA 3DN7A 2ZABA 3R4SA 1XE0A 2V5DA 4IUGA 2ZHMA 3HVDA 4MHRA 1GNZA 5CVRA 4CCDA 5AC93 3OGGA 1BYHA 1WLTA 2PHLA 4QX0A 3AX4A 1S2BA 1IKQA 1ND2C 5FJHA 1SACA 4TZDA 3R0RA 5LCWL 4Y33A 1VAKA 1O3TA 2GC2A 1ZA7A 1XNTA 4DY5A 4OI4A 4M3CB 1STMA 2AEZA 4LQRA 4HN1A 1UN1A 1HX6A 1VBB3 2VOWA 4XFCA 3VKFC 4BQ3A 4EYUA 3T2PA 5BNNB 4NPRA 1TMF1 5JSOA 3ALQA 2P5BA 4P9IA 4RR3B 3ZN5A 4LA3A 1IZ3A 1RUE3 1A78A 2ADDA 2ARXA 3OEBA 4LULA 1PNGA 5DQ0A 4V1PA 3ZXDA 1N1TA 2YHJA 1W6OA 2YU2A 4NRQA 1UU4A 1AX0A 2RVAA 5I0TA 1QHDA 4LKEA 1WLWA 4KWUA 3SCHA 5CZKA 1CJDA 5A33A 4LBMA 4MXWB 4RN5A 2P6HA 3FHIB 2OZ6A 3OY8B 3WDTA 4R8HA 1GZCA 5IVVA 2ENRA 3WG1A 3ZFEA 1HN0A 1XBFA 3B5LB 3DF0A 1W9YA 2QQOA 3MYXA 5LA2A 2MNGA 1TNFA 3TN93 1XNCA 1XYPA 4K3UA 3NWKA 4A4AA 4CRQA 1W2OA 4AFCA 4GAZA 4IE4A 1UZYA 2WWJA 4U36A 1XNBA 3ZYGA 5JZGA 3LDBA 1F8VA 2HWC3 1HRI2 3OGSA 4JVAA 1LRHA 1V6OA 2X53S 1GR3A 1SDDB 5D8AC 4A3XA 3RZMA 2ES3A 4HLTA 1UYZA 2WNUB 1CIWA 4CDUC 2G9ZA 3FHAA 3BPSA 4YG6A 3VDAA 3IN9A 3Q9OA 5FZKA 4D94A 4ISRA 5JMCA 3ZPOA 1QOSA 2Q4SA 4YSFA 4UXAA 2E53A 4L8QA 3IAPA 5IK5A 4DNYA 1DQ1A 5FY9A 2P3YA 4WVZA 1VBD1 3ZFFC 5IHRA 3GCXA 2XJUA 4UT5A 1PVC3 4QU1A 2V72A 3PJQA 2BJSA 2XBO2 5CEHA 5I91A 3MICA 1UD1A 4UOJA 4CEWB 3D0SA 1BMV2 3AKPA 1IS5A 5FWEA 1HXS2 4FPKA 3N7LA 2E32A 4QKFA 4AQ6A 1K12A 5I0DA 4QXKA 1VIWB 3LOBA 1V6LA 1W2UA 2OUJA 3B69A 5D8AB 1NE4A 1C57A 1JUHA 1W8FA 3AKQA 3L9JT 3PVOA 4GJZA 3V64A 4BXSV 4TSVA 5SV5A 2PLV1 5CIRA 1S0EA 1ULDA 2RS53 4D6SA 2FZ2A 5FO8B 3WV6A 1MS4A 3KCXA 3GXUA 2JDMA 3ZYIB 2RJKA 1UWWA 3AXDA 4JTOA 3VBFA 3HIFA 1RVF3 1SBDA 2XB6C 4AEDC 3ZYHA 5HXMA 2MEV3 4L11A 1WMEA 2VMIA 1D7PM 4K21A 1CN1A 2DTWA 1J1TA 4DOUA 1IG0A 1DQ2A 3NNLA 4CEYB 2DCTA 1HRI1 3E5QA 1UF2C 2JG8A 1XSQA 1YFUA 2YXSA 1YQ6A 1XE7A 4LHNA 4BQ4A 2RS13 2Y6KA 2VZ1A 5J7MA 5ACA2 4QKNA 4ZU5A 2VTFA 1PZ7A 3VBRC 2HKXA 1E5IA 3G6JB 5IFPA 2I74A 4JZRA 2WUHA 3BCWA 3CIHA 2PTMA 1GZWA 1SLLA 3POGA 5JZGC 3MGUA 3S7EA 5H9PA 1AJKA 3MW2A 2JKXA 4NWWA 2Y33A 4U2AA 4IEZA 3WUDA 4JGZC 1TG7A 1H4HA 1I3HA 4F7ZA 4KU7A 1W28A 1QF3A 3OBRA 1JOPA 5FAXA 2NLRA 4D69A 3LFIA 1AJOA 5FO9B 5IVJA 2WYFA 5JAXA 1QJU1 5IATA 2R30A 3QBQA 4NVPA 4YWAA 3RYRA 1WCQA 1NCQC 1WBFA 1YXWA 1W6MB 3LSDA 1RUNA 2IXKA 1D4M2 1GP6A 3N9MA 4QPYA 2WZ8A 4IEPA 1HQWA 4S2FA 4UF0B 3OPWA 2IFRA 2JWPA 3KB5A 3RWKX 4QQLA 2A6WA 3TNPB 1C8M2 2WA3A 4SBVA 5A70A 3TN91 3FLPA 4M4RA 3RFRA 4DXSA 3CKHA 4FPJA 1VBA2 2WFF3 4GD4A 4XZUG 5A3NA 3OEAA 3C7FA 2MEV1 5FPBA 3FUOA 5LRRA 4HMZA 4CYDA 4ZU7A 2YYOA 3E1F1 3I7DA 3AMMA 5FMOL 2IXIA 5FMDA 4LTAA 2QE3A 1AXYA 3NQHA 1PGW1 4IGQA 2XVGA 5FYBA 4O7XA 1GOHA 5FZBA 1UOBA 5DZEA 4BM8A 5DUWA 4N53A 2GAUA 1FV2A 3QCWA 4YRDA 3THCA 1EAH3 2BFUS 4FTBA 3J7LA 4IEVA 4HK9A 5BV6A 3CZUA 2ZGQA 2W94A 5F39A 3SQOA 2Q5TA 1QJEA 1LOAA 3I3BA 4RYDA 1DLCA 3ATGA 3USUA 2RDNA 4X8NA 3J7NA 2BUKA 2D7FA 2Q1FA 4NPLA 4Q4Y1 1NXD1 1W8TA 2BNMA 3OBAA 5BXXA 5L9VA 3NAPB 1VR3A 1JTZX 1JMUB 4WM8C 1QJFA 3KQ4B 1O59A 3EMRA 1MQTB 3DL3A 4BH9A 3AP9A 3RS6A 3VV1A 1RUF1 1SFYA 5GZCA 5LBEA 4NAMA 1VBE3 5ERLA 4GULA 1NA1A 2VD7A 3R4UA 3WF2A 1K5MB 5FZDA 2QNKA 2VNRA 1CESA 2XL7A 2JDHA 3J9SA 2J1AA 3E5XA 2ZGSA 1AUYA 4EZ4A 2FDKA 1IPJA 5FDBA 1QOTA 5A3UA 2XQXA 1H2NA 2HYKA 2V09A 4YM0A 3U37A 5KXEA 1SCRA 5T5OA 5CFCA 3O1MA 3KGZA 4DUXA 3TEYA 2W47A 1QKQA 1V6MA 3W9AA 3POWA 2J42A 2RS51 1D4M1 1SHWB 1WCUA 1NQDA 2PHWA 5DMYA 3RZJA 2EXKA 2VUAA 2NPIA 3VKLA 3E5UA 5L7OB 4Q4V2 1UY4A 3PU8A 5IVBA 2R16A 4I3PA 4QT6A 3SCGA 4CZSA 1WW5A 3AXEA 4PQ9A 2WABA 4XXAA 3CJIC 4XURA 4BLJA 3JBG1 2Q8OA 4CDWB 5J37A 1QQP3 1DGWA 1VMHA 3HR9A 4YZ3A 4LORA 1QJU2 4E4ZA 1G9DA 2ZGOA 4IESA 4C1XA 4CP9A 3JCIA 4OZOA 3R05A 1TME3 5T5PA 4JKLA 1LGNA 5LK5A 5IVCA 1AYM3 4YARA 4AW7A 1OA4A 3FUQA 1SG3A 1Z7S1 1FYUA 2VXRA 1MR5A 1PM4A 2ZEXA 3CO2A 4IV1A 3SISA 1H8TA 2XLFA 4XF4A 5GKAC 1H2KA 1TME2 5F8PA 1W6OB 3AKTA 4A7YA 4KGGA 2CAVA 3GCWA 2ET1A 4EQVA 5M0TA 2BERA 2BTVC 2YUEA 5T50A 4EROA 3WNPA 3UK9A 5DDJ1 1ZVFA 3IIIA 4WVWA 1QQP1 4GMP3 3P6BA 4PQQA 1CPNA 1V6IA 2XHNA 4I30A 4P00B 1QQP2 1CPMA 1NZCA 2ZZQA 4BMBA 4CVUA 4META 5IUQA 4MO3M 5F37A 1JHJA 1X9PA 4Y1XA 2OUHA 2SLIA 4LE3A 3KF5A 2X8KA 2CDPA 5FWJA 4XCBA 2R062 3BODA 3ZFGB 3VBUC 5HI0A 1H8TC 2OPKA 4SLIA 1VP6A 1LOFA 2ILMA 4TLFA 4PI2A 2C9KA 3K3OA 1W6NB 4OMDA 5IW0A 1H6YA 1GZTA 3D0JA 3VBSC 1WKYA 4XFAA 5BNNA 2YC2A 1I5ZA 4Y4RA 1LCLA 4LR4A 4XDQA 1J3RA 2XQRA 4GJYA 4K20A 4DIQA 2OS2A 1LULA 4GMP1 5I0SA 1REDA 5DZFA 3E6DA 4CUCA 1QJY1 3RJ2X 3CJIB 4CDWC 1SQ4A 1UX7A 3EYPA 4XFHA 4YG3A 2G9GA 2X29A 3FC0A 1OQEA 4P14A 2YGLA 1ZZBA 2Q8DA 3B94A 4C0BA 4W8JA 5FP4A 3ZYBA 2BQPA 4MXWA 3I2DA 5GZFA 1Z7S3 1KEXA 1DGRN 3D5OA 5FYMA 2R042 1W9WA 2XDVA 2R1DA 5CNAA 1PGSA 5F7UA 3Q8EA 4XUPA 5LZ6A 4BIFA 3GBFA 2B8MA 5FP7A 4DRRA 3WDYA 1ND3C 1K45A 5EJ1B 1W8WA 3BB6A 5FTTC 5AC92 1K42A 1JH5A 4Y20A 4QDRA 4AGVA 2GN7A 2DF7A 2VQTA 3LDKA 2W87A 5FZCA 5DUXA 1RHI1 4DXZA 1LOEA 1S0IA 2RS31 3UKNA 1IG3A 4BJ0A 1F15A 1NE6A 3ZM8A 2XHKA 2EALA 3BPZA 4QQPA 4FXKB 1HV0A 4QD2A 4QPGA 3W58A 2FCUA 3X29B 3ON7A 4NIGA 2BYVE 3TYJA 1RVF2 2E9QA 4UFHA 2GN3A 2C26A 3M2MA 4Z92B 4ZU4A 3K75B 1EPWA 1PO23 3WUCA 4XUOA 1REEA 2PLV3 3M3QA 5C3SA 1KDMA 4F8AA 2RR12 2ID4A 4C90A 1O4TA 1PVXA 3ZYFA 2VC9A 4Y24A 3BIEA 3KLSA 1VBE2 1WWYA 1XJAA 5A1LA 3PHMA 5CA6A 4GH4B 1HKDA 1JU3A 2E7AA 3LSEA 1BEV1 1W8UA 1CR7A 2PQQA 2P2KA 5E16A 4M01A 2Q8EA 3WQ0A 1OMIA 5C3PA 1C8M1 1HXS3 2W9XA 5C3RA 2VZOA 5JPMB 1DG6A 2CWSA 5FXZA 3ILRA 3VKOA 2CU5A 5I8TA 4P9YA 1VBA1 3VD5A 4Y1ZA 4R9DA 3WLUA 2PA7A 1NG0A 1YUDA 4AI8A 4V2WA 1UPSA 2PAEA 3H7YA 3S30A 2B5HA 3PL0A 3WF1A 1RUD3 2IVJA 4KL1A 5FZ4A 3IDCB 3LWCA 4YGBA 3DECA 1RYYA 1T6GC 5I0RA 1WGPA 1NLRA 2QVSB 1W90A 3HT2A 4X6QB 4LITA 3RSJA 4P9GA 1QJU3 4XQWA 3ETPA 1WW7A 3VHRA 4AFDA 3B9CA 3D4KA 3ZPYA 3EBRA 5JXJA 5KXBA 4DZGA 1FNYA 3KF3A 2FMDA 4JGZB 5LASA 1C8M3 3ZX7A 1YNAA 1UKGA 3VGIA 1H0BA 5FZ7A 3M70A 3OYWB 4I09A 4OI2A 3CQOA 4CP9B 1MZFA 3HQXA 2JDYA 4ARYA 3HMYA 4XBQA 1GBGA 3A0KA 1NQJA 3C7EA 4EWDA 4LXLA 1O8SA 4AGRA 4A7ZA 4N53B 3RVHA 5FYTA 3ACIA 1U0AA 1PM7A 5KHHA 3ZSLA 1KJRA 4OI1A 4A2UA 2RS32 4BCUA 2I07B 1O4YA 1MS1A 2D98A 4XMIA 1LHNA 4DB5A 2BEOA 4HZFA 2ZA9A 3AP6A 5LBFA 1HN1A 4HONA 4PF1A 5T52A 1MS8A 4K8FA 1WBLA 3MPBA 5DUVA 3CHXA 3SKVA 4BB3A 3CF6E 5ABJC 4I0AA 3WQ1A 1JYTA 4AEMA 5L19A 3AKRA 2YPDA 4LMFA 5K0UC 1ODNA 4RGAA 2EAAA 2JG8B 1D2SA 1N1SA 5LEJA 2R7EB 3WW4A 4Q5OA 4HVOA 4CDQB 4EN0A 4FPLA 1EUTA 5AVAA 1NKGA 1MVQA 2JX9A 3AMPA 3OF1A 5FP9A 5HXVA 4LBLA 2XBO1 5IFTA 3WNKA 2WO2A 1CONA 2W91A 1LU1A 3VZLA 4CEWC 5AFEA 4XF0A 1BHGA 3ZXEA 4Q27A 1HRI3 2W2IA 2XG3A 4H7MA 5L7OA 2K0GA 5LWBA 4XFGA 1I5PA 1NCQA 2PYTA 1COV1 1RMU3 4QM8A 5K0UA 3WDWA 5A3TA 2PHFA 4IEWA 2EIEA 4AG4A 2R061 1FPN1 1OQDA 1NY72 5B4XA 4YVWA 3FE5A 2DFCA 4P9XA 3CDZB 5IK7A 1HB2A 5CFDA 3I3QA 4FQ4A 5FZEA 4H7LA 3H3LA 1SLCA 1A6CA 5F32A 1MVEA 4O61A 3F2ZA 3UJOA 3VBOA 2CGOA 3T4VA 1DU3D 2WL1A 1BLZA 2OYZA 3BALA 2D6MA 2WAAA 3FHQA 4XABA 5F3IA 4CCCA 5A3PA 1T6BX 4E9KA 2BNOA 3JUUA 1RUI2 1IS4A 3UGHA 4BQXA 4Q0UA 4Q8LA 2YV8A 3G7DA 4FBFA 1Q8SA 2Z2SB 1SFNA 1PO12 2DU0A 4CUAA 3RPQA 4UFMA 3VBRB 2JD9A 3ILNA 5GLTA 4P9LA 2OKXA 5A32A 1SPPA 4P9JA 4ZXKA 1ENXA 2XWBB 1VB2A 3OOXA 1QDCA 3U14A 4X6RB 2RS12 4EWAA 4GWNA 2ZEZA 2DUQA 5I93A 3AKSA 3UGFA 2DUPA 1UY2A 3KCYA 1AF9A 2UYAA 1HB1A 1COV2 3TOJA 1DBNA 1EUUA 4DS0A 1ZA4A 5FZGA 3B7MA 3I3EA 3U0ZA 2VTXJ 2FDJA 3AYDA 1CZSA 4AXOA 3LFMA 4LKSA 2BRTA 4UW5A 1S0DA 2K9ZA 4RFRB 1W0OA 1AR73 2EAKA 4LK7A 1POQA 1Y7BA 4HVQA 5CISA 2HWE3 1RUG1 3NKGA 1Q43A 1FOD1 1SCSA 4LO5B 1JHNA 3WDVA 2ARBA 3LEKA 5FZ1A 3BVCA 5ANNA 5LA1A 1ZZ7A 2ARCA 3WW3A 5F5QA 1IGOA 2NYYA 5FMBA 3VZMA 4YM3A 3ZIWA 1SMVA 1D0HA 2ZHNA 4NIDA 1RUE2 5HV4A 4YW4A 1NZIA 2VQAA 1ZBE2 1YJLA 5AVPA 5FZ0A 3SH4A 3WCRA 4Q4Y3 3K48A 1RUJ2 2NMNA 1TMF3 5FXXA 2DWRA 3E6CC 1AYN1 1RUH2 4Y5SA 2ZGKA 1LAJA 1MPXA 4CCNA 4NE9A 3ZFFB 4LLFA 1AR93 5JVVA 3PVEA 4MOAA 1MS5A 1JU4A 3J8F2 3SITA 4XTPA 2ZKLA 2VZTA 3ZMOA 1LHUA 1HQNA 3I59A 4CDUA 5JDBA 4CXYA 3LA2A 1FMD2 1OD3A 3MIDA 2B9VA 2EVXA 4L2NA 4MYEA 4D6RA 4DY3A 3NJYA 5ACA3 4PBPA 1LHVA 4JRAA 4IE7A 3N9QA 4LBNA 2WNUC 5JMOA 1AYN3 4FSJA 4E8CA 3AZVA 2VECA 4NPMA 2GNBA 2Z5WA 1BKZA 4B1MA 5GM0A 2W08A 4HOOA 2A71A 1IQAA 3LGRA 3N7MA 5F6LB 3NAPC 5K0UB 4QX5A 1JYCA 1RUH1 5G04L 5IAVA 2ZGNA 1YQ8A 3IPVB 2E7QA 3HN1A 4TXWA 1BCXA 4M00A 5HBAA 5ABJB 3LA3A 4WVVA 2PFWA 4TN7A 4XTMA 2G1MA 4YW1A 2E63A 3T30A 1VBD3 2ZX2A 4FOQA 1XOYA 4XDOA 1LHWA 4Y22A 3RMXA 4IETA 2IXJA 3W21A 4A7KA 1J59A 1AR71 4YZ2A 2A6XA 4M4PA 2J7MA 1LODA 5EZWA 4QKDA 2O8QA 3AMQA 5FYYA 4HKOA 3PURA 5J48A 3LKJA 4IL7A 1RXFA 1UMIA 4HN0A 2R49A 1YI7A 3ZFGA 1GNYA 2C9AA 2D93A 2MPFA 3D82A 3WHTA 2WLQA 5BNNC 1JXNA 1OVSA 2VMGA 3MW4A 2VNGA 4UWDA 4YW2A 3TEWA 3V0AA 4I0WB 1XYOA 4N9HA 3QD6A 4GZ9A 1DQ0A 3T08A 3SXWA 3C7HA 4QX8A 2HWC1 1UO9A 3MHZA 1RUD1 2EIBA 3WF4A 5JSRA 1JI6A 4JGYA 4IV1B 1ND2B 2BW8A 4GXLA 3KT7A 4L9BA 2VOTA 2A5ZA 5LW9A 4QX3A 3UNPA 1O5LA 4BQ5A 5IK8A 1WMXA 2DBNA 1R1ZA 2A6VA 3FMGA 3U78A 1T2XA 1AR92 2Y6FA 3HQUA 3N4MA 4A6SA 1B35B 2WS91 4QPGC 1V6JA 2WO1A 1VBC3 1JYWA 1W6PA 3RRDA 3W5MA 4Q2FA 4AHXA 1ZRFA 5I8YA 1RHI2 3I2KA 4ASKA 2ETEA 2DCYA 4CCOA 1MEC2 5L7OC 3MLLA 5B2GB 4OULA 1OF4A 3VDBA 2WWSA 4EN9B 1ULCA 5FJKA 1CAVA 3WG4A 2JG9A 3L2HA 4L99A 4ORFA 2GC1A 2VBDA 2ZJCA 1PMIA 4I2OA 3UESA 1OBNA 3KT4A 3NL1A 1NT0A 2QQNA 5H9QA 2Y64A 1YRZA 1UU6A 2LW8A 1Y9QA 2R041 2H6CA 2DVDA 4RS5B 5IVYA 3ZSJA 1JYNA 1WD4A 1S0GA 4Q4X3 4HXCA 1QDOA 1GSLA 3GM8A 4XF3A 3LEGA 5C9AB 4NN0A 3H8XA 5T5JA 2PAKA 3NNFA 2C5DA 4YM1A 1F5FA 4LJHA 1Y9GA 4HKWA 2WO7A 3BTZA 1RJ7A 4DUVA 1IKPA 4YZ5A 4QB1A 5A7OA 1TNRA 3N9LA 4ZHNA 3VD3A 2CTVA 3LPGA 2VCCA 1PVC1 4KG8A 3FZ3A 4B8EA 4LO4B 2BBVA 2D43A 3TRSB 4NRPA 2PHTA 2R071 1AVBA 3KCCA 3NNGA 4YW5A 4EN8B 1YFWA 4MX3A 5A1AA 1ND3B 4Y20B 3FLRA 4XUTA 2WNVC 5F6KA 3CU7A 1JOBA 3V0BA 1NA1C 3EHKA 1QMJA 2VW1A 4OHYA 1MS0A 1K5JA 3GZUC 4F83A 2YU1A 2WS93 2HJIA 3ASIA 1LEMA 1SBFA 1ULPA 2C4XA 3NJZA 1POV1 5C33A 1SLBA 2B45X 3PNAA 4LBJA 2IUWA 4FAGA 4Q4Y2 4XVHA 5A32B 4M3CF 4HK8A 4ET7A 1CD3G 5IK4A 1HW5A 1CAXA 1R1A2 2O8OA 3IKWA 4XXPA 5DG2A 5A7SA 1RUOA 1BJQA 1QWRA 2Y0IA 3PIGA 4LKDA 4XAEA 1ZNPA 3LE0A 3B01A 3PUSA 4AR2A 1DIWA 3DYMA 3P3NA 4JGYC 4ARXA 2HWB1 1X36A 1C1FA 2YBSA 1S55A 1ZZ9A 5C4WA 4AHYA 4QPWA 2ZCWA 2R6QA 4IV1C 3LEMA 2HYXA 1X82A 4MGQA 3KHBA 4NO4A 4NHKA 4FPFA 2IVIB 1VAVA 1X8MA 5A7NA 1RB8G 1VBC2 3AP5A 2R0HA 3LAGA 4P5HA 1ULOA 2DTYA 4I3GA 2D6LX 1LB2A 3ZFGC 4S2DA 3GHMA 4QQ2A 3U1XA 1EPZA 3EO6A 4D3WA 3GZTB 1W0PA 1PIV2 5ISLA 1OOPB 1C3HA 2OX0A 4P9WA 2PHDA 4MLOA 2AC1A 3ACGA 2BP6A 2YZ4A 4HANA 2EIDA 2GC3A 3ACHA 3DXUA 4Q0VA 4K6BA 3VBFB 2JDUA 2WJSA 1G6NA 5HCHA 1W99A 4PLNA 1DYPA 1ALYA 4BXFA 5FMOS 4BOWA 3T09A 3C8XA 5FPUA 4XEZA 1PHMA 1LOGA 1S0BA 2JD4A 3MPPG 1PK6B 4GB32 2V73A 2XLAA 3KT1A 4JGZA 3O1TA 2FDFA 1LENA 3OUIA 3H1MA 1DGLA 2A3XA 1BEV2 1QGLA 2YBKA 1W6QA 5G05L 5H9RA 4D6QA 1XXNA 4EJRA 4QDSA 1TQ5A 1CAVB 1KRIA 1IPKA 1QXJA 1KJLA 2HLEA 4XETA 1BBT3 4F3JA 3MLKA 2YG0A 4AHWA 4E2QA 5ACA1 3WXPA 1AR81 3CZJA 3KV9A 4K1YA 4WM8A 1ZRDA 1ONAA 4WVMB 1GNHA 2AGSA 4OZXA 3GZAA 3PU3A 1PZ8A 2EXIA 1KFXL 4WBBA 3APBA 3WINE 1AL23 5FREA 4ZXEA 3VBOC 4NAOA 1E5HA 5A7QA 4LHKA 2Q8CA 1IS3A 3GJBA 5DAPA 2YFUA 3D6EA 1F4HA 5C3OA 3H8OA 5EYXA 4AEDA 4DEVA 3HBZA 1E5RA 1QNWA 2WZEA 3DKWA 2X5IB 4GB33 4O65A 3UJQA 1UZVA 3W59A 2ZACA 1V9U2 1OH3A 3WW2A 1AYN2 2VUJA 1TZOA 2VULA 2XR4A 3JD72 4IEQA 4A44A 1Y9MA 4L0PA 1PGW2 4OHVA 4QPIB 4AVCA 4A45A 2NM1A 4AFBA 2QQUA 4CEWA 2XJPA 2R072 1M4WA 3HNYM 3MF9A 5KWRA 2HWF3 1DQ5A 1NLSA 3OTFA 3EQEA 4JQTA 1YFXA 3CNAA 1BMV1 2CNAA 2ZTNA 2ZX1A 4QWNA 2VTXA 2UU8A 3O1PA 3AL6A 3EB7A 4HKLA 3VKNA 4KH9A 1GQPA 4JAAA 2WQZC 2JXAA 4LIUA 4YPJA 1RUJ3 3AB0A 1QJY2 3IPVA 4ZZ5A 2VMDA 4MXVA 3WNMA 4BU2A 3OGRA 5FKBA 1HB3A 1LGBA 5FIXA 4IGPA 3WQ7A 2WWUA 1ZRIA 1GWMA 1UZWA 2E33A 4OVEA 1QIQA 1VRH1 1JZ4A 1PGL2 2Q0AA 5FY1A 3GNEA 5FZOA 4Y5TA 4PCRA 2AYHA 3DV8A 1UNBA 1V6NA 4XFBA 1GKBA 2P6CA 5KHKA 3WNNA 1Q8QA 2WT2A 5DXDA 2F4LA 1VB4A 4AI9A 1UXZA 2DCZA 1UAIA 3ZVXA 4XDPA 4KI5M 5A7WB 3S5AA 2V5YA 2J1TA 4FP2A 4QX7A 3RZLA 2WS92 3T0AA 2HEWF 5GZGA 4CTEA 1MS3A 2RM23 2GNTA 4XZPA 5JPNB 3K4DA 3SEPA 3LOIA 2ORZA 2OVUA 4FFIA 4YVWC 2D5FA 3KVBA 1YC61 4OUMA 3VD7A 3CLPA 1RUD2 3BN6A 1SPPB 1EYBA 5CBLA 4YZ4A 1ULEA 3O1VA 4AI2A 3EXUA 4IERA 2YC4A 4RGGA 4DXTA 1O4ZA 5DDJ3 4CEYA 3P5BA 1PO13 4B7EA 4FP3A 1GP5A 2WFF1 1OKOA 4AFAA 1OA3A 1TMF2 4K1ZA 4OCTA 2RHPA 5C3QA 1W9TA 1ZBE3 3BU7A 1ACCA 1ASJ1 5BUVA 5FYUA 1UMZA 3WNLA 1UY3A 2GMPA 1OQ1A 2VOKA 3PTRB 3OD0A 3JBG2 1HXS1 4Q26A 2WZR1 5EFUA 1WA6X 4LBQD 4URTA 5FZIA 3DYPA 1ND2A 3MBWA 2D5HA 3NRUA 4KWKA 4KMQA 1GZ9A 4CDXC 4IE5A 1OT5A 3OCPA 2LUWA 3PIJA 2WFPA 5ABJA 1QH6A 4NIHA 4N8MA 4AEDB 1RMU2 2BNNA 4QX1A 3KHCA 2R063 1VBD2 4Y22B 1DF0A 2GU9A 3H42B 3KD4A 3NV2A 1XSRA 1A3KA 1DGWX 1RUF3 2VBBA 2DBIA 5FRAA 4RA0A 4RHV3 1OPOA 5A6QA 2D3RA 1K3IA 4LBQA 5A6ZA 1WW4A 4NMIA 4IEOA 2FMYA 3KVAA 1OURA 3O7OA 1U5XA 1ZBA3 3VHOA 3AZXA 3FN9A 1OD5A 4FVVA 4BPZA 3HT1A 4AGGA 4Y4YA 3LD8A 3POBA 1LTEA 4BQ1A 2RJLA 4HG6B 2WR9A 3I2IA 4B29A 4NIIA 5KHGA 1FMD1 2JG9B 3M4FA 1V9U3 5FYSA 3ZFEC 4QHOA 3SCFA 1ND3A 1M06G 2E51A 3WNXA 1W9SA 3O1OA 3N9OA 4YG0A 3BYWA 4ZZ8A 4MGKE 1U5IA 1YIPA 5T5LA 4IV3C 1OA2A 3LB9A 5A3LA 4M3CE 4H2AA 4FOWA 3JQWA 1US2A 4BWOA 1PNFA 5EYYA 5DZGA 2GSYA 3TWIA 2I45A 2HWB3 3M8LA 2E31A 3VZOA 4XFIA 2GZWA 4CDWA 5FP8A 5FZAA 2HWF1 1YEWA 1J58A 2WZR2 4XUQA 4ATFA 1RL3A 2BVBA 1U12A 2UYBA 2WN3A 2WQ4A 5F3EA 3WP4A 5KHJA 2RMU1 3J7HA 3SH5A 4ZS3A 1GMMA 4I02A 2A70A 1ENSA 2NZ9A 2VU9A 4AF9A 2ET7A 5E88A 1CZVA 1PO22 1C5HA 2D3PA 2UWAA 2ZGUA 5H9SA 4A42A 3O14A 1L3JA 4IE0A 4S2GA 4CCKA 3KS7A 1KFUL 5J96B 3HOBA 2N7GA 1OLQA 5L36A 1B09A 1OVPA 2VW2A 1MZEA 2WT0A 1HB4A 2DYCA 3MLJA 4ASMB 1JYIA 2FDGA 1UU5A 4MGIE 4GH4C 1JZ7A 1H8VA 5IYYA 1R083 3H1WA 1JZ6A 1AR83 1AX2A 2J1RA 5ANQA 5FUPA 1QEXA 4ZS2A 2QFEA 3WX5A 4UBHA 4QXCA 4OQ9A 2P37A 4YW7A 1CX4A 1FMD3 3S57A 3ZSMA 4MADA 1LOBA 1OOPC 5FBJA 3LF7A 1RUI1 1RUC1 2BOJA 2XVKA 4IW3A 3OB8A 2FHRA 1GYKA 2RR11 2ZX3A 3ME2A 4CU8A 4BISA 2XH6A 2IXLA 3IWZA 4E4SA 1VLNA 2R043 1W2TA 4CCJA 1F31A 4EWEA 3NV4A 1IS6A 3CMGA 3GGLA 1L7RA 1RVF1 2Q1ZB 2W1QA 5FP3A 5JOWA 4XQ4A 4CPBD 4PT6A 3POEA 1UYYA 1APNA 1V6KA 1SEFA 1U5ZA 3IMNA 4PF5A 5FK7A 1SZBA 3F95A 1OHFA 1JBCA 3N3HA 4RD7A 4XBLA 4DO0A 5BNPA 4LUKA 4LNVA 1CGPA 2RR13 2VVFA 1GICA 5GALA 4CP0A 4IEXA 2CWMA 5FPZA 2QQPA 2UURA 3O0WA 3JU9A 3RZKA 3GF6A 3FJSA 4D7TA 2B7YA 2JE9A 3VL8A 3WD5A 5BNOB 3NJVA 3WR0A 2EXHA 5LK7B 1OXCA 5FYIA 5FZ6A 4BK4A 1ZZ6A 1D4M3 4WM7C 1F5JA 5FQ0B 2JG9C 1X8EA 1J3QA 1NXMA 2WIIB 1D2QA 4MGZE 5BY5A 3PTYA 5T3NA 3I3MA 1VBB1 2G9FA 5CFCC 1XNAA 4AWDA 4KBZA 3ES1A 1R081 2LALA 1HQLA 2YGMA 3ETQA 5JUVA 5JCTA 2RJ2A 2XL9A 4LUMA 1C8NA 3VBUA 3E97A 3MF6A 4BHPA 2DVAA 4GIQA 2HWD1 1UKRA 2ZOEB 1XNKA 4AI0A 1JW6A 1ULGA 1RITA 2WYSA 1H1AA 5A3WA 5C8CA 5DAVA 4GKXA 4KBBA 4OUSA 2KA3A 2G4IA 3GJAA 2ZEWA 4CU9A 4FPCA 4X8PA 1DGRA 1GOGA 4RHV1 4OLLA 5CU1A 4Q4X2 1W3VA 2O1QA 3CEWA 3ECQA 4XW3A 3QH7A 2FCTA 5CB7A 5FZFA 3ZXKA 5FZ9A 5A6XA 3T0BA 3BGAA 2XJSA 4QXBA 4EZHA 3HJRA 3MFAA 4UFIA 2UY9A 5FYCA 2YROA 2GH2A 1YO8A 2D6NA 2VO5A 1TEIA 4N53C 4XILA 1VE0A 4LIVA 3AZZA 5BNPC 4QPIA 1KGYA 1LR5A 3OYWA 1GLHA 1H30A 1SFPA 3SMHA 4RQPC 2HH9A 2WO3A 5HPOA 2R0FA 4MH0E 3S0MA 1JZ5A 4C91A 2OIIA 1G8WA 2P3JA 4FOYA 1EV11 2LS6A 2VM9A 4MGSA 4PDWB 4Q0PA 4W65A 4GWMA 4XJWA 3AL5A 1HRV3 4UFLA 1C1LA 1OH4A 1O8PA 1S4CA 2WNEA 1GWKA 3KV6A 3Q8FA 2VCBA 2DFBA 5A3OA 4E4DX 3I2GA 1VRH2 4EN7B 2A75A 2VMEA 2GNDA 5CKQA 5FZ8A 4FO9A 3CJIA 3VBSA 1CVNA 1XU1A 2GMEA 4AAXA 1W04A 3A4UA 3AMHA 4BZ4A 3WHUA 2QZ3A 3I54A 4LOSA 3OJBA 3IM0A 3AZYA 3VDCA 4XF9A 4XPVA 3K2OA 4Y26A 3NJXA 4E2GA 1F4AA 3OBTA 4DXRA 3HAGA 3UETA 1RTVA 2A6ZA 5JZGB 4COYA 2P34A 4FPYA 5EPAA 4CCLA 4CUGA 3O1RA 3MEPA 3NMBA 5FXWA 4PJYA 4RQPB 3VDDC 2WNUA 3BTYA 4JDMA 1HRV1 4QQOA 1XRUA 4IQPA 1RIRA 2BGCA 4L97A 3B9IA 5FOBB 2YBPA 1VBE1 2QQMA 3KV5A 2JB8A 5J1XA 1W0NA 2JE8A 5LBCA 1YQ5A 4ZKTB 4BE3A 5T54A 5LRSA 3ROUA 2D40A 5HV0A 1D0GA 2JG8C 5FZMA 2JEMA 2ADEA 2Z79A 4XIKA 1RUF2 4E2SA 1Q5OA 2BZDA 2H0VA 3GBGA 4D8MA 1KQRA 3LIGA 4AQ2A 3RG0A 3DPRA 3O5SA 3WZ1A 3BTXA 4L92A 4LBQB 2P3IA 1YHFA 4FPGA 3UKVA 3OSDA 4XBNA 5FYZA 2VGDA 3ACFA 1QOOA 4G4FA 4XC9A 4BK5A 2F6BA 2WAOA 4QU2A 3VL9A 3JQXA 3AM2A 2RM21 3ENRA 1PMHX 3N7JA 4XMAA 4N43C 2VNOA 3MIGA 4Q4W3 1I9RA 5JOXA 4WZCA 4J1WA 1UOGA 3WF3A 3Q8CA 4QMAA 4AQTA 1YJKA 5KC5A 4CDQA 1URXA 3GALA 4E27A 3H3UA 3ZKUA 4HSJA 1NAEA 1PVC2 5C5TA 5K9YA 4GA9A 3K51A 2JECA 4XJUA 1IPSA 4CA9A 4YW3A 5LY1A 4ASLA 4ZONA 2W5FA 1XQNA 5I0UA 3H7JA 2WQ8A 3ZOIA 2DDUA 3J7MA 5LBBA 5BNOC 1UOFA 3OBZA 2SBAA 5J98B 1RUH3 2VNVA 3VBHB 4COUA 3BUCA 2X05A 1VMFA 3VBOB 4NHMA 3ZFFA 1SDWA 4BIOA 4OMCA 1R092 1NOVA 4B4PA 3NO8A 4PIZA 4QQHA 1UW8A 4DMIA 4W50A 4CDUB 4CUBA 4Q4W1 5C70A 3T3YA 2Y6HA 1EP0A 3GBWA 2OW4A 3VHNA 3AFGA 1GZWB 5EXOA 1FX5A 4AE2A 4R9AA 4WZFA 1O91A 2YPJA 3KM5A 4DQAA 2HWE2 4R4XA 4P5YA 3VBUB 4PIYA 3VBRA 4ES8A 3KZ4C 2O0OA 1VBC1 1BBT1 5J09A 1LOCA 3AP4A 5JOYA 2RDSA 4R9CA 4N7IA 3I8TA 1JUIA 3HEIA 5DPNA 5A7WA 1BK0A 1DQ6A 5F5CA 3P1IA 4FI9A 1QXPA 1ZZCA 2VZQA 3FFQA 5L73A 4CEYC 3L2YA 3VBFC 1TME1 1J84A 2DCJA 3TBDA 1R093 1XNDA 5F5IA 1B35A 2W95A 2EIGA 4LBOA 4ISQA 2VE1A 1VMJA 4RR3C 1H2LA 1GUIA 3H9AA 4HL0A 2HWE1 2UY8A 4YVSC 5FQ0A 3T1MA 1NY71 2XJVA 2BWCA 4Y3OA 3I59B 2W39A 1CAUA 1Z7S2 1EAH2 3WG2A 3ZN6A 1RUI3 3DXTA 1DQ4A 3JZVA 2PHRA 3UT0A 3VD9A 3QACA 2JIJA 3KV4A 1WCSA 1O3QA 1LESA 1R082 4UI9L 3J26N 3ORJA 4ZPIA 2OQ6A 2D6KA 3IB3A 4Y1YA 2PHUA 3RZGA 2AR6A 1WCDJ 4Q4W2 1X50A 4YGDA 3UYJA 1G9AA 1R091 2MHFA 1YQ2A 3LIHA 4M0NA 5CAZA 5K8SA 5JSPA 3D3AA 4JRLA 3VBHC 5DG1A 1VRH3 1NYWA
chains in the Genus database with same CATH topology
4CCNA 5FYMA 2XDVA 5FYIA 5FZ6A 5FY0A 4QXHA 4QU1A 2PXJA 2YPDA 5CEHA 5FYZA 5FP7A 5A7OA 2OT7A 3N9LA 3KVAA 5FWEA 4D6RA 3NJYA 5F3CA 4V2VA 2VD7A 5FZCA 3N9QA 5FP9A 5FZDA 3LD8A 2OQ7A 5F5AA 2XUEA 4EZ4A 4HOOA 5IVEA 4C8DA 4GJZA 4IGOA 2W2IA 5FYSA 4QWNA 2YU1A 5LY1A 3N9NA 5A3WA 3N9OA 3AL6A 5FXXA 5LWBA 4D6SA 5A1FA 2Q8CA 4LIUA 4TN7A 5FYVA 3K3NA 4CCMA 5A3TA 5A7SA 1VRBA 4NUBA 3OPTA 3PU8A 4BU2A 4XDOA 5IVBA 3N9PA 5FY4A 2GP5A 5FZFA 5FPAA 5FZ9A 4IGPA 3PUSA 4EZHA 4QXBA 5FZOB 5FZEA 2WWUA 5FZ3A 5A1LA 5FYCA 5F32A 5FXVA 2YBSA 4UF0A 5F2WA 5FYYA 5FP8A 5FZAA 3PURA 4URAA 5FY1A 5FZOA 2Q8EA 5FJHA 4LIVA 5FPLA 3ZLIA 5K4LA 4Y33A 5F3EA 5F3IA 5A7NA 5A3PA 3PDQA 5FXZA 5IWFA 4AI9A 5FZLA 5IVCA 4XDPA 4EYUA 5A7WB 4V2WA 3AL5A 4QX7A 5ISLA 5FYHA 4QX8A 4CCKA 2OX0A 5LY2A 2P5BA 5IVFA 3KV6A 5A7WA 5FZ4A 5FZ8A 3DXUA 2XMLA 5F5CA 2YU2A 3KVBA 3AVRA 5IVJA 4LITA 5LW9A 5FPVA 5KR7A 5F3GA 5A80A 5ANQA 5FUPA 2Q8DA 5FV3A 5F5IA 4QXCA 4BXFA 3K2OA 3N9MA 3AVSA 4UF0B 5FBJA 5FZGA 5A7PA 3U78A 5F37A 5FPUA 5IVVA 3OPWA 5FZ7A 4AAPA 3U4SA 5FWJA 4Y3OA 4CCLA 4CUGA 4BISA 5FXWA 4GAZA 5F2SA 4CCJA 2WWJA 2YBKA 4GD4A 3DXTA 4CSWA 5FYUA 5FPBA 4D6QA 3LDBA 5A3NA 5FP3A 3K3OA 5FY7A 5FZ1A 5IW0A 4LXLA 4ASKA 3KV4A 5E6HA 2YBPA 3RVHA 4CCOA 3PTRB 5FYTA 3KV5A 4IGQA 4Y4RA 5FUNA 5FYBA 4E4HA 3KV9A 2OQ6A 4GJYA 5FJKA 5FZBA 2OS2A 4DIQA 5FZIA 4DO0A 5FY8A 5FZKA 2XXZA 3PUAA 3UYJA 3PU3A 3ZPOA 5FZHA 5FZMA 2GP3A 5FZ0A 5FY5A 5A7QA 5F39A 4HONA 5FY9A 5IVYA 3PUQA 5FP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCN A;  5FYM A;  2XDV A;  5FYI A;  5FZ6 A;  5FY0 A;  4QXH A;  4QU1 A;  2PXJ A;  2YPD A;  5CEH A;  5FYZ A;  5FP7 A;  5A7O A;  2OT7 A;  3N9L A;  3KVA A;  5FWE A;  4D6R A;  3NJY A;  5F3C A;  4V2V A;  2VD7 A;  5FZC A;  3N9Q A;  5FP9 A;  5FZD A;  3LD8 A;  2OQ7 A;  5F5A A;  2XUE A;  4EZ4 A;  4HOO A;  5IVE A;  4C8D A;  4GJZ A;  4IGO A;  2W2I A;  5FYS A;  4QWN A;  2YU1 A;  5LY1 A;  3N9N A;  5A3W A;  3N9O A;  3AL6 A;  5FXX A;  5LWB A;  4D6S A;  5A1F A;  2Q8C A;  4LIU A;  4TN7 A;  5FYV A;  3K3N A;  4CCM A;  5A3T A;  5A7S A;  1VRB A;  4NUB A;  3OPT A;  3PU8 A;  4BU2 A;  4XDO A;  5IVB A;  3N9P A;  5FY4 A;  2GP5 A;  5FZF A;  5FPA A;  5FZ9 A;  4IGP A;  3PUS A;  4EZH A;  4QXB A;  5FZO B;  5FZE A;  2WWU A;  5FZ3 A;  5A1L A;  5FYC A;  5F32 A;  5FXV A;  2YBS A;  4UF0 A;  5F2W A;  5FYY A;  5FP8 A;  5FZA A;  3PUR A;  4URA A;  5FY1 A;  5FZO A;  2Q8E A;  5FJH A;  4LIV A;  5FPL A;  3ZLI A;  5K4L A;  4Y33 A;  5F3E A;  5F3I A;  5A7N A;  5A3P A;  3PDQ A;  5FXZ A;  5IWF A;  4AI9 A;  5FZL A;  5IVC A;  4XDP A;  4EYU A;  5A7W B;  4V2W A;  3AL5 A;  4QX7 A;  5ISL A;  5FYH A;  4QX8 A;  4CCK A;  2OX0 A;  5LY2 A;  2P5B A;  5IVF A;  3KV6 A;  5A7W A;  5FZ4 A;  5FZ8 A;  3DXU A;  2XML A;  5F5C A;  2YU2 A;  3KVB A;  3AVR A;  5IVJ A;  4LIT A;  5LW9 A;  5FPV A;  5KR7 A;  5F3G A;  5A80 A;  5ANQ A;  5FUP A;  2Q8D A;  5FV3 A;  5F5I A;  4QXC A;  4BXF A;  3K2O A;  3N9M A;  3AVS A;  4UF0 B;  5FBJ A;  5FZG A;  5A7P A;  3U78 A;  5F37 A;  5FPU A;  5IVV A;  3OPW A;  5FZ7 A;  4AAP A;  3U4S A;  5FWJ A;  4Y3O A;  4CCL A;  4CUG A;  4BIS A;  5FXW A;  4GAZ A;  5F2S A;  4CCJ A;  2WWJ A;  2YBK A;  4GD4 A;  3DXT A;  4CSW A;  5FYU A;  5FPB A;  4D6Q A;  3LDB A;  5A3N A;  5FP3 A;  3K3O A;  5FY7 A;  5FZ1 A;  5IW0 A;  4LXL A;  4ASK A;  3KV4 A;  5E6H A;  2YBP A;  3RVH A;  4CCO A;  3PTR B;  5FYT A;  3KV5 A;  4IGQ A;  4Y4R A;  5FUN A;  5FYB A;  4E4H A;  3KV9 A;  2OQ6 A;  4GJY A;  5FJK A;  5FZB A;  2OS2 A;  4DIQ A;  5FZI A;  4DO0 A;  5FY8 A;  5FZK A;  2XXZ A;  3PUA A;  3UYJ A;  3PU3 A;  3ZPO A;  5FZH A;  5FZM A;  2GP3 A;  5FZ0 A;  5FY5 A;  5A7Q A;  5F39 A;  4HON A;  5FY9 A;  5IVY A;  3PUQ A;  5FP4 A; 
#chains in the Genus database with same CATH topology
 4FT8 A;  4Q4V 1;  4QHB A;  1DZT A;  5A3M A;  4HPK B;  4G9S B;  4NR1 A;  4YW6 A;  3ITQ A;  2YC0 A;  4XJZ A;  5FY0 A;  4BQW A;  3SLI A;  1H1I A;  2W1W A;  4XHB A;  2K46 A;  4GMP 0;  1NA1 B;  1OUS A;  3FWE A;  1GFF 2;  4LLO A;  2GH8 A;  2QQL A;  1F9K A;  1OLR A;  3POI A;  1K5M C;  5DAX A;  4Q8K A;  2AZ5 A;  2H6B A;  2EXJ A;  1V9U 1;  2GMM A;  3WDU A;  1WLD A;  1ENQ A;  3SH3 A;  3MIH A;  4KWL A;  1AX1 A;  1H6X A;  2ORX A;  2X09 A;  2E26 A;  4QGN A;  4CDQ C;  2ATF A;  3AMN A;  5EHD A;  3MUY 1;  1ENR A;  2AAC A;  2YFZ A;  4C8D A;  4PDW A;  4HVR A;  2CY6 A;  1CAX B;  2WDB A;  3N9N A;  1J3P A;  3I2H A;  4ZY9 A;  2CL2 A;  4RR3 A;  3W5N A;  1AR9 1;  2J1E A;  2QQV A;  3Q8A A;  4MHU A;  4JC1 A;  4RS5 A;  4J25 A;  1AYM 2;  4YVS B;  2ZML A;  3K3N A;  4CCM A;  5I8S A;  1JYV A;  4JX0 A;  3OPT A;  4PIX A;  5E8A A;  3WNO A;  5C71 A;  2WA4 A;  5CAD A;  3GHN A;  3DPR C;  3ZN4 A;  1AR8 2;  2ZGT A;  4FPO B;  1CZT A;  4IDZ A;  4LOT A;  5FPA A;  3U4X A;  4HT1 T;  4IND A;  5LAT A;  3I3D A;  1MAC A;  2D6O X;  1YCI A;  1ZBE 1;  3FLT A;  1C4R A;  3OGJ A;  3RYP A;  3HD8 B;  4NWV A;  2Y6G A;  3FL7 A;  5CG9 A;  1OUX A;  2MEV 2;  3RI9 A;  1RUE 1;  3VUO A;  1LNS A;  3NST A;  2B42 B;  2OPW A;  2HWC 2;  1UYX A;  2W46 A;  2J1S A;  3MUZ 1;  4DIN B;  4W4Z A;  2QUO A;  1PO2 1;  2ZZJ A;  3RWN A;  4CU7 A;  2CSG A;  2BVV A;  2VPV A;  5IWF A;  1FOD 3;  3OG2 A;  1IOA A;  1HRV 2;  2UWB A;  5FZL A;  1TE1 B;  4KU8 A;  3A22 A;  3HNB M;  1RC6 A;  1MZ5 A;  2I2S A;  2RMU 2;  3I2F A;  4N90 A;  1WW6 A;  2DVF A;  3VLB B;  5KXD A;  3LA7 A;  1SLT A;  1JZ8 A;  4W6W A;  2GDF A;  1CX1 A;  5LY2 A;  5IVF A;  1RUG 3;  2X10 A;  1S0F A;  2J1U A;  3N7K A;  2LTN A;  3RGB A;  3GDB A;  2XML A;  1SBE A;  1L7Q A;  1Z78 A;  3ZXF A;  3PUI A;  1U5Y A;  4LHL A;  4JGY B;  4JHZ A;  1NCR C;  2A73 B;  2F4P A;  1VAL A;  1KD7 A;  4XE9 A;  5BNO A;  1DFQ A;  2A3Y A;  4FFH A;  5JXH A;  4OFG A;  3MV0 1;  2RV9 A;  4XIO A;  4Y1V A;  4K9S A;  3AVS A;  5IAX A;  4CP2 A;  2G19 A;  1UPI A;  4NRO A;  1W6P B;  1POV 3;  3MIB A;  1ZYB A;  2C1F A;  4JTN A;  1W2A X;  2VZ3 A;  3WT3 A;  3A0N A;  3INA A;  2HEY F;  3NV1 A;  3SHR A;  3ZIX A;  5F1R A;  2Y8K A;  3OGV A;  3QH6 A;  2RE9 A;  4AHZ A;  3BIW E;  1ZRR A;  1DHK B;  3MFC A;  3R6S A;  3UV9 A;  2P4E A;  4FPE A;  4CSW A;  4ES9 A;  2D3S A;  4Q0Q A;  5FY7 A;  4WVM A;  3V0A B;  2Z42 A;  4OQ8 A;  2E6V A;  4DEQ A;  1OI6 A;  3IAQ A;  2PMW B;  2W1S A;  2D6P A;  3JB8 A;  1BQP A;  5FY8 A;  4TYS A;  4RHV 2;  1R1A 1;  4N7U A;  2KD7 A;  4BYY A;  1L7L A;  1VPH A;  1POV 0;  1RGS A;  2ZXQ A;  2W1U A;  3PDQ A;  2JDN A;  2PLV 2;  5AC9 1;  4UYB A;  4XAC A;  1GOF A;  4KQ7 A;  4Q4X 1;  4YZ1 A;  1RMU 1;  1IHM A;  1KXG A;  1MQT A;  2B46 X;  3ZXG A;  4QXH A;  2ZGL A;  3LPF A;  4HET A;  4JDO A;  4DPN A;  3H3Z A;  3LCP A;  4AI3 A;  4I0B A;  5FO7 B;  4NRM A;  1OSG A;  1UX6 A;  1PX4 A;  4COW A;  5C8C C;  5CKN A;  2CGP A;  5F3C A;  3VD4 A;  4R52 A;  4AFM A;  4V2V A;  4LT5 A;  1DZQ A;  2ZS6 B;  3DGT A;  4AVT A;  2Y34 A;  4WV8 A;  5IJR A;  1RHI 3;  5CFC B;  1UL9 A;  4G3Y C;  3FBM A;  3TEX A;  2QDR A;  2XKP A;  2FBE A;  3A7Q A;  3DYO A;  2FD8 A;  3KMH A;  1DDL A;  1VBB 2;  1W8O A;  2X5I C;  3VDD B;  1W8Z A;  2ZBJ A;  3MZH A;  3V65 A;  5C8W A;  5DAQ A;  3MW3 A;  4Q1P A;  3SEE A;  2EA7 A;  3K4A A;  3VZN A;  2PQS A;  4AQS A;  1GQH A;  1OFN A;  3A21 A;  1O6U A;  1YWK A;  1VRB A;  2FQP A;  4YFW A;  3AK0 A;  4TLG A;  4NHX A;  1LU2 A;  1S1A A;  4MGY E;  3ST7 A;  4QGL A;  3CJX A;  1Z0H A;  2RS1 1;  1V70 A;  4UW4 A;  4XHX A;  1X7N A;  3GYD A;  1N3P A;  4Z2A A;  1BVP 1;  2AH2 A;  3AFK A;  3PVB B;  3QLQ A;  5L9R A;  2VW0 A;  5GZE A;  2QZ2 A;  3AJZ A;  4UF0 A;  5F2W A;  2VY0 A;  2IWG B;  5FKC A;  3AYE A;  2XVL A;  1Y3T A;  5TSW A;  2JB4 A;  2PN5 A;  1PK6 A;  5FPL A;  3WSO A;  1HJG A;  1PO1 1;  2VBP A;  4LA2 A;  3WP5 A;  1G9C A;  1QU0 A;  2VZR A;  2TBV A;  4EE2 A;  1YIF A;  4FTE A;  1A34 A;  1WD3 A;  3POS A;  2HWD 3;  2ZGR A;  3H0O A;  5C4W B;  2B9U A;  4HBN A;  3RYK A;  3KWV A;  2KM2 A;  4P02 B;  1H2M A;  3NW4 A;  3MO4 A;  1AR6 3;  5BPX A;  5JI7 A;  1PK6 C;  1RIN A;  3HNM A;  4UFJ A;  4MZU A;  2V4V A;  2C0Z A;  4D7Y A;  4GWI A;  4NHL A;  5JR2 A;  4COV A;  3SKJ E;  1AXZ A;  3M3O A;  4J6G A;  4I01 A;  1LGC A;  2CGN A;  3B00 A;  5FFO C;  4KGQ A;  1NCR A;  1QJY 3;  4RL7 A;  4YGE A;  3IDE A;  5C9A A;  1H1M A;  1CAU B;  2W52 A;  2XJR A;  3VHP A;  2QBX A;  4Z2W A;  4QGM A;  2X5I A;  2XBO 3;  1O3S A;  4E8D A;  5HCF A;  1RJ8 A;  1V0A A;  2HWF 2;  4QX2 A;  3C3V A;  3GZE A;  1LJ7 A;  5JLV A;  3TAY A;  4IEY A;  5E6H A;  3ZN6 B;  3B02 A;  3NNM A;  2FCV A;  3JD7 3;  4BLI A;  1OPM A;  5SV8 A;  1CAW B;  2JDA A;  4ATE A;  1GV9 A;  3ZO0 B;  2ZKN A;  4H3W A;  1O3R A;  2XXZ A;  3K4Z A;  3I97 A;  3DKQ A;  2KXL A;  3HBK A;  3BOW A;  3J4U H;  1G86 A;  2TEP A;  4MV2 A;  3RJR A;  1Y4W A;  5LEK A;  1FT9 A;  3T0D A;  1OKQ A;  2VL4 A;  3PUQ A;  2ARE A;  2RM2 2;  3NVC A;  4Q4V 3;  3C7G A;  1JN2 P;  1N1Y A;  2HBU A;  1AR6 1;  2E7T A;  1S0C A;  1UQX A;  2VH9 A;  1AYM 1;  4JCK A;  5T55 A;  2WZR 3;  1CQ9 A;  1ZX5 A;  3I2J A;  4DRV A;  2LRP A;  3USU B;  1O5U A;  1VJ2 A;  2ERF A;  3DCQ A;  4XJA A;  1D4V B;  3PVN A;  3NAP A;  3T2O A;  4DUW A;  4KNC A;  3IT8 A;  2ZX4 A;  3TB0 A;  5JR7 B;  1QH7 A;  4CP1 A;  4QM9 A;  3J8F 1;  1Q8P A;  4GAL A;  3JBG 3;  5FLJ A;  3ZFE B;  4RFT 0;  3H50 A;  4WM8 B;  2QQI A;  2DCK A;  2ZMN A;  1K5M A;  1DYO A;  1X9T A;  1ZM1 A;  3K46 A;  4IGO A;  1H8T B;  4FAH A;  3H8U A;  5EQU A;  1UXX X;  2ZGM A;  1OOP A;  1JOJ A;  4YFZ A;  4QHZ A;  3TNQ A;  5FK8 A;  1J83 A;  2Z4F A;  5CFD B;  2WT1 A;  3U11 A;  4UW6 A;  1N1V A;  2K2S A;  2YB7 A;  4Z8B A;  2D44 A;  4MG2 A;  2GP5 A;  2IXC A;  2WSV A;  4GH4 A;  5A7P A;  1DZR A;  5JI9 A;  1ZBA 2;  1AHS A;  1UYP A;  5E89 A;  3VZK A;  4CPB A;  1FV3 A;  2VAU A;  2WIN B;  3H1Y A;  4FFF A;  5DAB A;  4URA A;  3MV1 1;  2VZS A;  4JDN A;  5FPX A;  3ZLI A;  1OLM E;  2C24 A;  2XOM A;  3OUJ A;  4RGK A;  5K4L A;  1REF A;  4CE8 A;  2P3K A;  3O1S A;  1ULF A;  4C1W A;  2ZAH A;  5D21 A;  1VBA 3;  2WFF 2;  2XLG A;  2GAL A;  1ASJ 2;  5GJ6 A;  1FXZ A;  5FLI A;  4QPG B;  3SNM A;  2WSU A;  1IQD C;  1N3Q A;  3FBY A;  4XQD A;  4XYX A;  2BPA 2;  1WLC A;  3Q8B A;  1GAN A;  3RNS A;  4AK3 A;  2BBA A;  4AVV A;  3KQR A;  4LO8 A;  4YVS A;  2IC1 A;  2Y26 A;  4R9B A;  3DUI A;  1G7Y A;  1AL2 2;  3TEZ A;  1KIT A;  3AVR A;  4EN6 B;  4OHX A;  3T2Q A;  5FPV A;  5KR7 A;  5F3G A;  5A80 A;  3VZJ A;  4AOC A;  4FXG B;  1SLI A;  2A7A A;  1R1A 3;  3NNJ A;  3USS A;  2HWB 2;  2ZGP A;  4HPK A;  1KDK A;  2YDE A;  4MVT A;  1UIK A;  1EY2 A;  4BQY A;  2OA2 A;  3NV3 A;  1ASJ 3;  2OXB A;  2DV9 A;  2CDO A;  4GWJ A;  1CIY A;  4IV3 B;  4PDW C;  2BGO A;  4MUV A;  4Q1R A;  3U4S A;  2XJQ A;  3AP7 A;  4A3Z A;  4TWT A;  4YM2 A;  4IEU A;  3MIE A;  3AYA A;  2VJX A;  4IXL A;  4BA6 A;  3ABZ A;  4CCE A;  1E57 A;  4Y1U A;  3BU0 A;  2LRO A;  1AXK A;  2JIC A;  3URF A;  1SLA A;  2RG4 A;  1AZD A;  2WNV B;  1QY4 A;  1P8J A;  3P3P A;  1A8D A;  1ZRE A;  1BZW A;  5L9B A;  2BFU L;  5FBZ A;  2QTW B;  1W6Q B;  3O0X A;  3POJ A;  4LKF A;  4PHZ A;  4OHZ A;  4XJ8 A;  3AJY A;  3U75 A;  2VZU A;  1FPN 2;  4N43 B;  4Z82 A;  5HCB A;  1NX9 A;  2FDH A;  1PGL 1;  5EWS A;  3PUA A;  2DVB A;  3POY A;  1W39 A;  4S2H A;  5FZH A;  3MDP A;  1JOD A;  3T1L A;  2PHX A;  3B3Q E;  3MIF A;  3ZYJ B;  3U07 A;  2IFW A;  5KC6 A;  1MZ6 A;  5CFD C;  1JZ2 A;  1PZ9 A;  1S2K A;  2B39 A;  4K7J A;  2JDK A;  4BME A;  3LQC A;  2ARA A;  2L9L A;  2RS5 2;  2VOX A;  4B4Q A;  4CDX A;  1QJX 2;  5KXC A;  2WNO A;  4PLM A;  1BK1 A;  1UY1 A;  3V56 A;  2VUC A;  3ACL A;  4D7S A;  1GU3 A;  4W6X A;  2QJV A;  1H9W A;  3JD7 1;  3PJY A;  4N9I A;  5D8A A;  3JB4 C;  3UKT A;  4P08 A;  4OUE A;  2RDR A;  1XB9 A;  4DFS A;  3M1H A;  3IDA A;  3IMM A;  2VQU A;  5C5U A;  5F5A A;  3ZXJ A;  2NP0 A;  2VQ0 A;  1DP0 A;  2V4A A;  3RDI A;  1DLL A;  4K8R B;  1Q3E A;  2YMZ A;  4PLO A;  5CG8 A;  3T4H B;  2P1B A;  2XKO A;  1OF3 A;  4JHT A;  2QCS B;  5A1F A;  1KS5 A;  1B35 C;  1W3X A;  5K7P A;  3K77 A;  5AFB A;  5JXG A;  5FYV A;  4AEJ A;  2EIC A;  2B4K A;  4NUB A;  4PBO A;  3THT A;  1WCK A;  1W8N A;  1ZRC A;  1NCQ B;  4D0Q A;  2XON A;  5JIA A;  4Z07 A;  2VMF A;  5JIU A;  2J22 A;  1JZ3 A;  3RZZ A;  1UMH A;  1RUC 2;  1LHO A;  2VVE A;  4M0H A;  3A23 A;  1NCR B;  1AL2 1;  2AUY A;  5FMC A;  1CWP A;  3OD4 A;  2TNF A;  5DDJ 2;  5FZ3 A;  2W0X A;  2Y60 A;  4JQR A;  4O9E A;  1A8M A;  5EJZ B;  4YVW B;  3S7I A;  2QQW A;  1XC6 A;  3S5Q A;  4B4R A;  4CU6 A;  4B7K A;  1DYK A;  2A6Y A;  2JE7 A;  3ZKY A;  4NHY A;  5C7G A;  2QQJ A;  2VG9 A;  1UCX A;  1ZZ8 A;  3IZO A;  1DCS A;  4QB2 A;  1F2N A;  1J1L A;  4XUN A;  4LO6 B;  5JWP A;  5A6Y A;  1JYX A;  1FNZ A;  1PIV 3;  1Y43 B;  4GQ7 A;  2NQY A;  4B1L A;  3KGL A;  5FOJ B;  1R64 A;  2A3W A;  3EJK A;  5GZD A;  3TN9 2;  3VDD A;  2WBK A;  2JIG A;  4GKY A;  3THD A;  3ZMN A;  3N35 A;  5FYH A;  3HQR A;  4GB3 1;  3W20 A;  2BWA A;  1N3O A;  2VMC A;  4M3C A;  3WCS A;  3OPZ A;  5BNP B;  4XF1 A;  4Z1V A;  1Q8O A;  3PUH A;  3WP6 A;  3WVJ A;  3ZDV A;  3U10 A;  1UOJ A;  2F17 A;  4R4Z A;  5BNQ A;  2ZX0 A;  2ZHK A;  2P17 A;  2ZEY A;  1Q56 A;  3AYC A;  1PIV 1;  4KG0 A;  4Y5Z 0;  3HN3 A;  2CHH A;  4YGC A;  5CYY A;  3S6P A;  2OZJ A;  3KSC A;  3CBN A;  3ZXL A;  4AEK A;  1WMD A;  2VUD A;  1AR7 2;  1GQG A;  4UFK A;  3N36 A;  3WP3 A;  3BOP A;  4QDQ A;  4FFG A;  5D1I A;  3M3I A;  5LB6 A;  1LED A;  4AL9 A;  3OY8 A;  2ZAA A;  2R1B A;  4XAA A;  1EV1 2;  1WZX A;  1YFY A;  2D97 A;  2VZV A;  5F2S A;  2CAU A;  1XYN A;  1HV1 A;  2WN2 A;  3RI8 A;  5F9T A;  1C28 A;  2HBT A;  4J1X A;  1FI2 A;  1FPN 3;  4N43 A;  3NKT A;  4UW3 A;  2W3J A;  2GNM A;  4YNI A;  3WEZ A;  5GLW A;  4AVB A;  5GLV A;  4JKM A;  4CXW A;  5FUN A;  4E4H A;  3LEI A;  2LM3 A;  2IXH A;  4QPI C;  4LBK A;  1YYN A;  1JS9 A;  2WRA A;  1MS9 A;  4AZZ A;  2ZMK A;  4NOT A;  4A6O A;  1ST8 A;  2Y0O A;  1W8H A;  2GP3 A;  3POF A;  4UAP A;  5DN2 A;  1RUC 3;  1ODM A;  4RSU A;  1WUV A;  3RZH A;  3IDB B;  4WM7 B;  2NMO A;  1HJF A;  3T2T A;  5A33 B;  1YQC A;  3I4I A;  5EJ3 A;  3ZYR A;  5C6C A;  2Q1M A;  1EV1 3;  1RUJ 1;  1W6M A;  1W9F A;  2BU9 A;  2VOV A;  2AEN A;  3MI8 A;  2PXJ A;  2KR2 A;  2QDN A;  2DVG A;  3WF0 A;  4O9G A;  3DEM A;  5CKM A;  1W2N A;  3ZSE A;  1GWL A;  2OT7 A;  4H55 A;  1LEC A;  1US3 A;  1G9F A;  1OC1 A;  2DUO A;  2JJ6 A;  4TTG A;  5DAW A;  3V0B B;  3IIA A;  3ZR5 A;  1QJX 1;  4AVS A;  5C8C B;  3D8C A;  1RUG 2;  2VR4 A;  1MEC 3;  5IVE A;  4FPH A;  1CJP A;  2WKK A;  1E5S A;  4OHW A;  2XPJ A;  5LA9 A;  2NN8 A;  1CAW A;  1PX3 A;  2JKB A;  4AVA A;  4OI0 A;  2RMU 3;  1WMF A;  4NIA A;  4BDV B;  4YYO A;  5C9A C;  5JXI A;  2C6S A;  2TUN A;  2CV6 A;  1FOD 2;  2JEN A;  3O0V A;  4C0H A;  2BOI A;  2H0B A;  4HFS A;  1XU2 A;  5FR3 A;  3N9P A;  1I1E A;  2HEV F;  1TVG A;  2QQK A;  5D2A A;  4A41 A;  1UZ0 A;  4CDX B;  1MEC 1;  5IT6 A;  3IBM A;  3BTA A;  2Y38 A;  4K40 A;  5KBF A;  2R07 3;  1LKN A;  4H14 A;  5FXV A;  4Q29 A;  2BDR A;  2BGP A;  2Z69 A;  1KS4 A;  3E6B A;  4KWJ A;  1EAH 1;  2XWJ B;  3O12 A;  4NJ4 A;  3RMY A;  1O7F A;  2DU1 A;  3ZXA C;  2R32 A;  1S0J A;  3C7O A;  4XJ9 A;  4RQP A;  4YLZ A;  3WOG A;  1W03 A;  3B93 A;  4COZ A;  2VXJ A;  4JV4 A;  3WQB A;  2ZHL A;  1H4G A;  1LOF C;  1W05 A;  2EF6 A;  4FQZ A;  4HSL A;  4LO7 A;  4QKB A;  1PMJ X;  1GP4 A;  3WY6 A;  3PLQ A;  1X33 A;  4LEJ A;  4AYU A;  5C4W C;  4UBG A;  3VBS B;  1C5I A;  5KHI A;  3M3C A;  3H8R A;  1HIX A;  2XUM A;  2RS3 3;  1W06 A;  4QAW A;  2FDI A;  3O1U A;  2RDQ A;  4MSV A;  2WC2 A;  3FFZ A;  3VKM A;  4W6Y A;  3I2O A;  4Q0S A;  3PME A;  1FAT A;  3HPN A;  5B4N A;  4FTS A;  5FV3 A;  1UIJ A;  1BBT 2;  5FLH A;  3VB9 A;  2VZP A;  3QOP A;  4B3N A;  5J3U A;  2JDZ A;  3PMS A;  4PI0 A;  1NLQ A;  2IZW A;  3M7A A;  1BEV 3;  1VAM A;  3AC0 A;  1QJX 3;  2DUR A;  4XOG A;  4QB6 A;  1HDK A;  4AAP A;  1WA4 A;  2YY1 A;  1W6N A;  1F35 A;  2WNV A;  2HWD 2;  3OUH A;  4BQ2 A;  2XJT A;  4ONU A;  4IE6 A;  2QKD A;  1G9B A;  3BI3 A;  2VVD A;  5BYN A;  1I6X A;  5E1R A;  1H9P A;  1UZZ A;  2BV4 A;  1ZBA 1;  1COV 3;  2JDP A;  3AZW A;  2WLP A;  3LZZ A;  4XFF A;  3WDX A;  4MGT A;  2VCA A;  1FAY A;  2FZ1 A;  3FX3 A;  5EP9 A;  3ZR6 A;  5JOZ A;  4WM7 A;  3I49 A;  1MQT C;  3DPR B;  5FY5 A;  2J1V A;  3HWJ A;  4LE4 A;  1QNY A;  3J8F 3;  3CL1 A;  3M3E A;  5LA0 A;  1BVV A;  1XPW A;  3SC7 X;  2W68 A;  4XCA A;  3ZSK A;  2ZPX A;  4FOV A;  4IV3 A;  5APA A;  5GLZ A;  4RS5 C;  4LHS A;  2A1X A;  3ZDS A;  1QXR A;  2O14 A;  2PAM A;  3ILF A;  1YI9 A;  2XGX A;  2WZP P;  2VMH A;  1AL0 G;  1UY0 A;  4OYU A;  1V00 A;  2AEY A;  1RXG A;  1YLL A;  3ES4 A;  3ZYP A;  5J36 A;  1XE8 A;  1S2E A;  5GLU A;  2OQ7 A;  5DUU A;  4CXX A;  1Q8V A;  2XUE A;  4ITC A;  2W92 A;  4LK6 A;  5EV7 A;  1AR6 2;  3WG3 A;  1QJZ A;  2GC0 A;  4FCA A;  1OFS A;  3UL2 A;  1NUK A;  2PEL A;  2UWC A;  3LDR A;  5HCA A;  1HLC A;  4JKK A;  3UGG A;  3C2U A;  3R4D B;  5EIY B;  2CYF A;  1N47 A;  3RQ0 A;  5FCC A;  1BXH A;  3VN4 A;  5FY4 A;  3ELN A;  3THP A;  2VCM A;  4LPL A;  3BKZ A;  4EV0 A;  5FUI A;  2Y6J A;  3WW1 A;  3JXS A;  4AI1 A;  2Q30 A;  5FZO B;  1OLM A;  3VBH A;  2Y6L A;  3DN7 A;  2ZAB A;  3R4S A;  1XE0 A;  2V5D A;  4IUG A;  2ZHM A;  3HVD A;  4MHR A;  1GNZ A;  5CVR A;  4CCD A;  5AC9 3;  3OGG A;  1BYH A;  1WLT A;  2PHL A;  4QX0 A;  3AX4 A;  1S2B A;  1IKQ A;  1ND2 C;  5FJH A;  1SAC A;  4TZD A;  3R0R A;  5LCW L;  4Y33 A;  1VAK A;  1O3T A;  2GC2 A;  1ZA7 A;  1XNT A;  4DY5 A;  4OI4 A;  4M3C B;  1STM A;  2AEZ A;  4LQR A;  4HN1 A;  1UN1 A;  1HX6 A;  1VBB 3;  2VOW A;  4XFC A;  3VKF C;  4BQ3 A;  4EYU A;  3T2P A;  5BNN B;  4NPR A;  1TMF 1;  5JSO A;  3ALQ A;  2P5B A;  4P9I A;  4RR3 B;  3ZN5 A;  4LA3 A;  1IZ3 A;  1RUE 3;  1A78 A;  2ADD A;  2ARX A;  3OEB A;  4LUL A;  1PNG A;  5DQ0 A;  4V1P A;  3ZXD A;  1N1T A;  2YHJ A;  1W6O A;  2YU2 A;  4NRQ A;  1UU4 A;  1AX0 A;  2RVA A;  5I0T A;  1QHD A;  4LKE A;  1WLW A;  4KWU A;  3SCH A;  5CZK A;  1CJD A;  5A33 A;  4LBM A;  4MXW B;  4RN5 A;  2P6H A;  3FHI B;  2OZ6 A;  3OY8 B;  3WDT A;  4R8H A;  1GZC A;  5IVV A;  2ENR A;  3WG1 A;  3ZFE A;  1HN0 A;  1XBF A;  3B5L B;  3DF0 A;  1W9Y A;  2QQO A;  3MYX A;  5LA2 A;  2MNG A;  1TNF A;  3TN9 3;  1XNC A;  1XYP A;  4K3U A;  3NWK A;  4A4A A;  4CRQ A;  1W2O A;  4AFC A;  4GAZ A;  4IE4 A;  1UZY A;  2WWJ A;  4U36 A;  1XNB A;  3ZYG A;  5JZG A;  3LDB A;  1F8V A;  2HWC 3;  1HRI 2;  3OGS A;  4JVA A;  1LRH A;  1V6O A;  2X53 S;  1GR3 A;  1SDD B;  5D8A C;  4A3X A;  3RZM A;  2ES3 A;  4HLT A;  1UYZ A;  2WNU B;  1CIW A;  4CDU C;  2G9Z A;  3FHA A;  3BPS A;  4YG6 A;  3VDA A;  3IN9 A;  3Q9O A;  5FZK A;  4D94 A;  4ISR A;  5JMC A;  3ZPO A;  1QOS A;  2Q4S A;  4YSF A;  4UXA A;  2E53 A;  4L8Q A;  3IAP A;  5IK5 A;  4DNY A;  1DQ1 A;  5FY9 A;  2P3Y A;  4WVZ A;  1VBD 1;  3ZFF C;  5IHR A;  3GCX A;  2XJU A;  4UT5 A;  1PVC 3;  4QU1 A;  2V72 A;  3PJQ A;  2BJS A;  2XBO 2;  5CEH A;  5I91 A;  3MIC A;  1UD1 A;  4UOJ A;  4CEW B;  3D0S A;  1BMV 2;  3AKP A;  1IS5 A;  5FWE A;  1HXS 2;  4FPK A;  3N7L A;  2E32 A;  4QKF A;  4AQ6 A;  1K12 A;  5I0D A;  4QXK A;  1VIW B;  3LOB A;  1V6L A;  1W2U A;  2OUJ A;  3B69 A;  5D8A B;  1NE4 A;  1C57 A;  1JUH A;  1W8F A;  3AKQ A;  3L9J T;  3PVO A;  4GJZ A;  3V64 A;  4BXS V;  4TSV A;  5SV5 A;  2PLV 1;  5CIR A;  1S0E A;  1ULD A;  2RS5 3;  4D6S A;  2FZ2 A;  5FO8 B;  3WV6 A;  1MS4 A;  3KCX A;  3GXU A;  2JDM A;  3ZYI B;  2RJK A;  1UWW A;  3AXD A;  4JTO A;  3VBF A;  3HIF A;  1RVF 3;  1SBD A;  2XB6 C;  4AED C;  3ZYH A;  5HXM A;  2MEV 3;  4L11 A;  1WME A;  2VMI A;  1D7P M;  4K21 A;  1CN1 A;  2DTW A;  1J1T A;  4DOU A;  1IG0 A;  1DQ2 A;  3NNL A;  4CEY B;  2DCT A;  1HRI 1;  3E5Q A;  1UF2 C;  2JG8 A;  1XSQ A;  1YFU A;  2YXS A;  1YQ6 A;  1XE7 A;  4LHN A;  4BQ4 A;  2RS1 3;  2Y6K A;  2VZ1 A;  5J7M A;  5ACA 2;  4QKN A;  4ZU5 A;  2VTF A;  1PZ7 A;  3VBR C;  2HKX A;  1E5I A;  3G6J B;  5IFP A;  2I74 A;  4JZR A;  2WUH A;  3BCW A;  3CIH A;  2PTM A;  1GZW A;  1SLL A;  3POG A;  5JZG C;  3MGU A;  3S7E A;  5H9P A;  1AJK A;  3MW2 A;  2JKX A;  4NWW A;  2Y33 A;  4U2A A;  4IEZ A;  3WUD A;  4JGZ C;  1TG7 A;  1H4H A;  1I3H A;  4F7Z A;  4KU7 A;  1W28 A;  1QF3 A;  3OBR A;  1JOP A;  5FAX A;  2NLR A;  4D69 A;  3LFI A;  1AJO A;  5FO9 B;  5IVJ A;  2WYF A;  5JAX A;  1QJU 1;  5IAT A;  2R30 A;  3QBQ A;  4NVP A;  4YWA A;  3RYR A;  1WCQ A;  1NCQ C;  1WBF A;  1YXW A;  1W6M B;  3LSD A;  1RUN A;  2IXK A;  1D4M 2;  1GP6 A;  3N9M A;  4QPY A;  2WZ8 A;  4IEP A;  1HQW A;  4S2F A;  4UF0 B;  3OPW A;  2IFR A;  2JWP A;  3KB5 A;  3RWK X;  4QQL A;  2A6W A;  3TNP B;  1C8M 2;  2WA3 A;  4SBV A;  5A70 A;  3TN9 1;  3FLP A;  4M4R A;  3RFR A;  4DXS A;  3CKH A;  4FPJ A;  1VBA 2;  2WFF 3;  4GD4 A;  4XZU G;  5A3N A;  3OEA A;  3C7F A;  2MEV 1;  5FPB A;  3FUO A;  5LRR A;  4HMZ A;  4CYD A;  4ZU7 A;  2YYO A;  3E1F 1;  3I7D A;  3AMM A;  5FMO L;  2IXI A;  5FMD A;  4LTA A;  2QE3 A;  1AXY A;  3NQH A;  1PGW 1;  4IGQ A;  2XVG A;  5FYB A;  4O7X A;  1GOH A;  5FZB A;  1UOB A;  5DZE A;  4BM8 A;  5DUW A;  4N53 A;  2GAU A;  1FV2 A;  3QCW A;  4YRD A;  3THC A;  1EAH 3;  2BFU S;  4FTB A;  3J7L A;  4IEV A;  4HK9 A;  5BV6 A;  3CZU A;  2ZGQ A;  2W94 A;  5F39 A;  3SQO A;  2Q5T A;  1QJE A;  1LOA A;  3I3B A;  4RYD A;  1DLC A;  3ATG A;  3USU A;  2RDN A;  4X8N A;  3J7N A;  2BUK A;  2D7F A;  2Q1F A;  4NPL A;  4Q4Y 1;  1NXD 1;  1W8T A;  2BNM A;  3OBA A;  5BXX A;  5L9V A;  3NAP B;  1VR3 A;  1JTZ X;  1JMU B;  4WM8 C;  1QJF A;  3KQ4 B;  1O59 A;  3EMR A;  1MQT B;  3DL3 A;  4BH9 A;  3AP9 A;  3RS6 A;  3VV1 A;  1RUF 1;  1SFY A;  5GZC A;  5LBE A;  4NAM A;  1VBE 3;  5ERL A;  4GUL A;  1NA1 A;  2VD7 A;  3R4U A;  3WF2 A;  1K5M B;  5FZD A;  2QNK A;  2VNR A;  1CES A;  2XL7 A;  2JDH A;  3J9S A;  2J1A A;  3E5X A;  2ZGS A;  1AUY A;  4EZ4 A;  2FDK A;  1IPJ A;  5FDB A;  1QOT A;  5A3U A;  2XQX A;  1H2N A;  2HYK A;  2V09 A;  4YM0 A;  3U37 A;  5KXE A;  1SCR A;  5T5O A;  5CFC A;  3O1M A;  3KGZ A;  4DUX A;  3TEY A;  2W47 A;  1QKQ A;  1V6M A;  3W9A A;  3POW A;  2J42 A;  2RS5 1;  1D4M 1;  1SHW B;  1WCU A;  1NQD A;  2PHW A;  5DMY A;  3RZJ A;  2EXK A;  2VUA A;  2NPI A;  3VKL A;  3E5U A;  5L7O B;  4Q4V 2;  1UY4 A;  3PU8 A;  5IVB A;  2R16 A;  4I3P A;  4QT6 A;  3SCG A;  4CZS A;  1WW5 A;  3AXE A;  4PQ9 A;  2WAB A;  4XXA A;  3CJI C;  4XUR A;  4BLJ A;  3JBG 1;  2Q8O A;  4CDW B;  5J37 A;  1QQP 3;  1DGW A;  1VMH A;  3HR9 A;  4YZ3 A;  4LOR A;  1QJU 2;  4E4Z A;  1G9D A;  2ZGO A;  4IES A;  4C1X A;  4CP9 A;  3JCI A;  4OZO A;  3R05 A;  1TME 3;  5T5P A;  4JKL A;  1LGN A;  5LK5 A;  5IVC A;  1AYM 3;  4YAR A;  4AW7 A;  1OA4 A;  3FUQ A;  1SG3 A;  1Z7S 1;  1FYU A;  2VXR A;  1MR5 A;  1PM4 A;  2ZEX A;  3CO2 A;  4IV1 A;  3SIS A;  1H8T A;  2XLF A;  4XF4 A;  5GKA C;  1H2K A;  1TME 2;  5F8P A;  1W6O B;  3AKT A;  4A7Y A;  4KGG A;  2CAV A;  3GCW A;  2ET1 A;  4EQV A;  5M0T A;  2BER A;  2BTV C;  2YUE A;  5T50 A;  4ERO A;  3WNP A;  3UK9 A;  5DDJ 1;  1ZVF A;  3III A;  4WVW A;  1QQP 1;  4GMP 3;  3P6B A;  4PQQ A;  1CPN A;  1V6I A;  2XHN A;  4I30 A;  4P00 B;  1QQP 2;  1CPM A;  1NZC A;  2ZZQ A;  4BMB A;  4CVU A;  4MET A;  5IUQ A;  4MO3 M;  5F37 A;  1JHJ A;  1X9P A;  4Y1X A;  2OUH A;  2SLI A;  4LE3 A;  3KF5 A;  2X8K A;  2CDP A;  5FWJ A;  4XCB A;  2R06 2;  3BOD A;  3ZFG B;  3VBU C;  5HI0 A;  1H8T C;  2OPK A;  4SLI A;  1VP6 A;  1LOF A;  2ILM A;  4TLF A;  4PI2 A;  2C9K A;  3K3O A;  1W6N B;  4OMD A;  5IW0 A;  1H6Y A;  1GZT A;  3D0J A;  3VBS C;  1WKY A;  4XFA A;  5BNN A;  2YC2 A;  1I5Z A;  4Y4R A;  1LCL A;  4LR4 A;  4XDQ A;  1J3R A;  2XQR A;  4GJY A;  4K20 A;  4DIQ A;  2OS2 A;  1LUL A;  4GMP 1;  5I0S A;  1RED A;  5DZF A;  3E6D A;  4CUC A;  1QJY 1;  3RJ2 X;  3CJI B;  4CDW C;  1SQ4 A;  1UX7 A;  3EYP A;  4XFH A;  4YG3 A;  2G9G A;  2X29 A;  3FC0 A;  1OQE A;  4P14 A;  2YGL A;  1ZZB A;  2Q8D A;  3B94 A;  4C0B A;  4W8J A;  5FP4 A;  3ZYB A;  2BQP A;  4MXW A;  3I2D A;  5GZF A;  1Z7S 3;  1KEX A;  1DGR N;  3D5O A;  5FYM A;  2R04 2;  1W9W A;  2XDV A;  2R1D A;  5CNA A;  1PGS A;  5F7U A;  3Q8E A;  4XUP A;  5LZ6 A;  4BIF A;  3GBF A;  2B8M A;  5FP7 A;  4DRR A;  3WDY A;  1ND3 C;  1K45 A;  5EJ1 B;  1W8W A;  3BB6 A;  5FTT C;  5AC9 2;  1K42 A;  1JH5 A;  4Y20 A;  4QDR A;  4AGV A;  2GN7 A;  2DF7 A;  2VQT A;  3LDK A;  2W87 A;  5FZC A;  5DUX A;  1RHI 1;  4DXZ A;  1LOE A;  1S0I A;  2RS3 1;  3UKN A;  1IG3 A;  4BJ0 A;  1F15 A;  1NE6 A;  3ZM8 A;  2XHK A;  2EAL A;  3BPZ A;  4QQP A;  4FXK B;  1HV0 A;  4QD2 A;  4QPG A;  3W58 A;  2FCU A;  3X29 B;  3ON7 A;  4NIG A;  2BYV E;  3TYJ A;  1RVF 2;  2E9Q A;  4UFH A;  2GN3 A;  2C26 A;  3M2M A;  4Z92 B;  4ZU4 A;  3K75 B;  1EPW A;  1PO2 3;  3WUC A;  4XUO A;  1REE A;  2PLV 3;  3M3Q A;  5C3S A;  1KDM A;  4F8A A;  2RR1 2;  2ID4 A;  4C90 A;  1O4T A;  1PVX A;  3ZYF A;  2VC9 A;  4Y24 A;  3BIE A;  3KLS A;  1VBE 2;  1WWY A;  1XJA A;  5A1L A;  3PHM A;  5CA6 A;  4GH4 B;  1HKD A;  1JU3 A;  2E7A A;  3LSE A;  1BEV 1;  1W8U A;  1CR7 A;  2PQQ A;  2P2K A;  5E16 A;  4M01 A;  2Q8E A;  3WQ0 A;  1OMI A;  5C3P A;  1C8M 1;  1HXS 3;  2W9X A;  5C3R A;  2VZO A;  5JPM B;  1DG6 A;  2CWS A;  5FXZ A;  3ILR A;  3VKO A;  2CU5 A;  5I8T A;  4P9Y A;  1VBA 1;  3VD5 A;  4Y1Z A;  4R9D A;  3WLU A;  2PA7 A;  1NG0 A;  1YUD A;  4AI8 A;  4V2W A;  1UPS A;  2PAE A;  3H7Y A;  3S30 A;  2B5H A;  3PL0 A;  3WF1 A;  1RUD 3;  2IVJ A;  4KL1 A;  5FZ4 A;  3IDC B;  3LWC A;  4YGB A;  3DEC A;  1RYY A;  1T6G C;  5I0R A;  1WGP A;  1NLR A;  2QVS B;  1W90 A;  3HT2 A;  4X6Q B;  4LIT A;  3RSJ A;  4P9G A;  1QJU 3;  4XQW A;  3ETP A;  1WW7 A;  3VHR A;  4AFD A;  3B9C A;  3D4K A;  3ZPY A;  3EBR A;  5JXJ A;  5KXB A;  4DZG A;  1FNY A;  3KF3 A;  2FMD A;  4JGZ B;  5LAS A;  1C8M 3;  3ZX7 A;  1YNA A;  1UKG A;  3VGI A;  1H0B A;  5FZ7 A;  3M70 A;  3OYW B;  4I09 A;  4OI2 A;  3CQO A;  4CP9 B;  1MZF A;  3HQX A;  2JDY A;  4ARY A;  3HMY A;  4XBQ A;  1GBG A;  3A0K A;  1NQJ A;  3C7E A;  4EWD A;  4LXL A;  1O8S A;  4AGR A;  4A7Z A;  4N53 B;  3RVH A;  5FYT A;  3ACI A;  1U0A A;  1PM7 A;  5KHH A;  3ZSL A;  1KJR A;  4OI1 A;  4A2U A;  2RS3 2;  4BCU A;  2I07 B;  1O4Y A;  1MS1 A;  2D98 A;  4XMI A;  1LHN A;  4DB5 A;  2BEO A;  4HZF A;  2ZA9 A;  3AP6 A;  5LBF A;  1HN1 A;  4HON A;  4PF1 A;  5T52 A;  1MS8 A;  4K8F A;  1WBL A;  3MPB A;  5DUV A;  3CHX A;  3SKV A;  4BB3 A;  3CF6 E;  5ABJ C;  4I0A A;  3WQ1 A;  1JYT A;  4AEM A;  5L19 A;  3AKR A;  2YPD A;  4LMF A;  5K0U C;  1ODN A;  4RGA A;  2EAA A;  2JG8 B;  1D2S A;  1N1S A;  5LEJ A;  2R7E B;  3WW4 A;  4Q5O A;  4HVO A;  4CDQ B;  4EN0 A;  4FPL A;  1EUT A;  5AVA A;  1NKG A;  1MVQ A;  2JX9 A;  3AMP A;  3OF1 A;  5FP9 A;  5HXV A;  4LBL A;  2XBO 1;  5IFT A;  3WNK A;  2WO2 A;  1CON A;  2W91 A;  1LU1 A;  3VZL A;  4CEW C;  5AFE A;  4XF0 A;  1BHG A;  3ZXE A;  4Q27 A;  1HRI 3;  2W2I A;  2XG3 A;  4H7M A;  5L7O A;  2K0G A;  5LWB A;  4XFG A;  1I5P A;  1NCQ A;  2PYT A;  1COV 1;  1RMU 3;  4QM8 A;  5K0U A;  3WDW A;  5A3T A;  2PHF A;  4IEW A;  2EIE A;  4AG4 A;  2R06 1;  1FPN 1;  1OQD A;  1NY7 2;  5B4X A;  4YVW A;  3FE5 A;  2DFC A;  4P9X A;  3CDZ B;  5IK7 A;  1HB2 A;  5CFD A;  3I3Q A;  4FQ4 A;  5FZE A;  4H7L A;  3H3L A;  1SLC A;  1A6C A;  5F32 A;  1MVE A;  4O61 A;  3F2Z A;  3UJO A;  3VBO A;  2CGO A;  3T4V A;  1DU3 D;  2WL1 A;  1BLZ A;  2OYZ A;  3BAL A;  2D6M A;  2WAA A;  3FHQ A;  4XAB A;  5F3I A;  4CCC A;  5A3P A;  1T6B X;  4E9K A;  2BNO A;  3JUU A;  1RUI 2;  1IS4 A;  3UGH A;  4BQX A;  4Q0U A;  4Q8L A;  2YV8 A;  3G7D A;  4FBF A;  1Q8S A;  2Z2S B;  1SFN A;  1PO1 2;  2DU0 A;  4CUA A;  3RPQ A;  4UFM A;  3VBR B;  2JD9 A;  3ILN A;  5GLT A;  4P9L A;  2OKX A;  5A32 A;  1SPP A;  4P9J A;  4ZXK A;  1ENX A;  2XWB B;  1VB2 A;  3OOX A;  1QDC A;  3U14 A;  4X6R B;  2RS1 2;  4EWA A;  4GWN A;  2ZEZ A;  2DUQ A;  5I93 A;  3AKS A;  3UGF A;  2DUP A;  1UY2 A;  3KCY A;  1AF9 A;  2UYA A;  1HB1 A;  1COV 2;  3TOJ A;  1DBN A;  1EUU A;  4DS0 A;  1ZA4 A;  5FZG A;  3B7M A;  3I3E A;  3U0Z A;  2VTX J;  2FDJ A;  3AYD A;  1CZS A;  4AXO A;  3LFM A;  4LKS A;  2BRT A;  4UW5 A;  1S0D A;  2K9Z A;  4RFR B;  1W0O A;  1AR7 3;  2EAK A;  4LK7 A;  1POQ A;  1Y7B A;  4HVQ A;  5CIS A;  2HWE 3;  1RUG 1;  3NKG A;  1Q43 A;  1FOD 1;  1SCS A;  4LO5 B;  1JHN A;  3WDV A;  2ARB A;  3LEK A;  5FZ1 A;  3BVC A;  5ANN A;  5LA1 A;  1ZZ7 A;  2ARC A;  3WW3 A;  5F5Q A;  1IGO A;  2NYY A;  5FMB A;  3VZM A;  4YM3 A;  3ZIW A;  1SMV A;  1D0H A;  2ZHN A;  4NID A;  1RUE 2;  5HV4 A;  4YW4 A;  1NZI A;  2VQA A;  1ZBE 2;  1YJL A;  5AVP A;  5FZ0 A;  3SH4 A;  3WCR A;  4Q4Y 3;  3K48 A;  1RUJ 2;  2NMN A;  1TMF 3;  5FXX A;  2DWR A;  3E6C C;  1AYN 1;  1RUH 2;  4Y5S A;  2ZGK A;  1LAJ A;  1MPX A;  4CCN A;  4NE9 A;  3ZFF B;  4LLF A;  1AR9 3;  5JVV A;  3PVE A;  4MOA A;  1MS5 A;  1JU4 A;  3J8F 2;  3SIT A;  4XTP A;  2ZKL A;  2VZT A;  3ZMO A;  1LHU A;  1HQN A;  3I59 A;  4CDU A;  5JDB A;  4CXY A;  3LA2 A;  1FMD 2;  1OD3 A;  3MID A;  2B9V A;  2EVX A;  4L2N A;  4MYE A;  4D6R A;  4DY3 A;  3NJY A;  5ACA 3;  4PBP A;  1LHV A;  4JRA A;  4IE7 A;  3N9Q A;  4LBN A;  2WNU C;  5JMO A;  1AYN 3;  4FSJ A;  4E8C A;  3AZV A;  2VEC A;  4NPM A;  2GNB A;  2Z5W A;  1BKZ A;  4B1M A;  5GM0 A;  2W08 A;  4HOO A;  2A71 A;  1IQA A;  3LGR A;  3N7M A;  5F6L B;  3NAP C;  5K0U B;  4QX5 A;  1JYC A;  1RUH 1;  5G04 L;  5IAV A;  2ZGN A;  1YQ8 A;  3IPV B;  2E7Q A;  3HN1 A;  4TXW A;  1BCX A;  4M00 A;  5HBA A;  5ABJ B;  3LA3 A;  4WVV A;  2PFW A;  4TN7 A;  4XTM A;  2G1M A;  4YW1 A;  2E63 A;  3T30 A;  1VBD 3;  2ZX2 A;  4FOQ A;  1XOY A;  4XDO A;  1LHW A;  4Y22 A;  3RMX A;  4IET A;  2IXJ A;  3W21 A;  4A7K A;  1J59 A;  1AR7 1;  4YZ2 A;  2A6X A;  4M4P A;  2J7M A;  1LOD A;  5EZW A;  4QKD A;  2O8Q A;  3AMQ A;  5FYY A;  4HKO A;  3PUR A;  5J48 A;  3LKJ A;  4IL7 A;  1RXF A;  1UMI A;  4HN0 A;  2R49 A;  1YI7 A;  3ZFG A;  1GNY A;  2C9A A;  2D93 A;  2MPF A;  3D82 A;  3WHT A;  2WLQ A;  5BNN C;  1JXN A;  1OVS A;  2VMG A;  3MW4 A;  2VNG A;  4UWD A;  4YW2 A;  3TEW A;  3V0A A;  4I0W B;  1XYO A;  4N9H A;  3QD6 A;  4GZ9 A;  1DQ0 A;  3T08 A;  3SXW A;  3C7H A;  4QX8 A;  2HWC 1;  1UO9 A;  3MHZ A;  1RUD 1;  2EIB A;  3WF4 A;  5JSR A;  1JI6 A;  4JGY A;  4IV1 B;  1ND2 B;  2BW8 A;  4GXL A;  3KT7 A;  4L9B A;  2VOT A;  2A5Z A;  5LW9 A;  4QX3 A;  3UNP A;  1O5L A;  4BQ5 A;  5IK8 A;  1WMX A;  2DBN A;  1R1Z A;  2A6V A;  3FMG A;  3U78 A;  1T2X A;  1AR9 2;  2Y6F A;  3HQU A;  3N4M A;  4A6S A;  1B35 B;  2WS9 1;  4QPG C;  1V6J A;  2WO1 A;  1VBC 3;  1JYW A;  1W6P A;  3RRD A;  3W5M A;  4Q2F A;  4AHX A;  1ZRF A;  5I8Y A;  1RHI 2;  3I2K A;  4ASK A;  2ETE A;  2DCY A;  4CCO A;  1MEC 2;  5L7O C;  3MLL A;  5B2G B;  4OUL A;  1OF4 A;  3VDB A;  2WWS A;  4EN9 B;  1ULC A;  5FJK A;  1CAV A;  3WG4 A;  2JG9 A;  3L2H A;  4L99 A;  4ORF A;  2GC1 A;  2VBD A;  2ZJC A;  1PMI A;  4I2O A;  3UES A;  1OBN A;  3KT4 A;  3NL1 A;  1NT0 A;  2QQN A;  5H9Q A;  2Y64 A;  1YRZ A;  1UU6 A;  2LW8 A;  1Y9Q A;  2R04 1;  2H6C A;  2DVD A;  4RS5 B;  5IVY A;  3ZSJ A;  1JYN A;  1WD4 A;  1S0G A;  4Q4X 3;  4HXC A;  1QDO A;  1GSL A;  3GM8 A;  4XF3 A;  3LEG A;  5C9A B;  4NN0 A;  3H8X A;  5T5J A;  2PAK A;  3NNF A;  2C5D A;  4YM1 A;  1F5F A;  4LJH A;  1Y9G A;  4HKW A;  2WO7 A;  3BTZ A;  1RJ7 A;  4DUV A;  1IKP A;  4YZ5 A;  4QB1 A;  5A7O A;  1TNR A;  3N9L A;  4ZHN A;  3VD3 A;  2CTV A;  3LPG A;  2VCC A;  1PVC 1;  4KG8 A;  3FZ3 A;  4B8E A;  4LO4 B;  2BBV A;  2D43 A;  3TRS B;  4NRP A;  2PHT A;  2R07 1;  1AVB A;  3KCC A;  3NNG A;  4YW5 A;  4EN8 B;  1YFW A;  4MX3 A;  5A1A A;  1ND3 B;  4Y20 B;  3FLR A;  4XUT A;  2WNV C;  5F6K A;  3CU7 A;  1JOB A;  3V0B A;  1NA1 C;  3EHK A;  1QMJ A;  2VW1 A;  4OHY A;  1MS0 A;  1K5J A;  3GZU C;  4F83 A;  2YU1 A;  2WS9 3;  2HJI A;  3ASI A;  1LEM A;  1SBF A;  1ULP A;  2C4X A;  3NJZ A;  1POV 1;  5C33 A;  1SLB A;  2B45 X;  3PNA A;  4LBJ A;  2IUW A;  4FAG A;  4Q4Y 2;  4XVH A;  5A32 B;  4M3C F;  4HK8 A;  4ET7 A;  1CD3 G;  5IK4 A;  1HW5 A;  1CAX A;  1R1A 2;  2O8O A;  3IKW A;  4XXP A;  5DG2 A;  5A7S A;  1RUO A;  1BJQ A;  1QWR A;  2Y0I A;  3PIG A;  4LKD A;  4XAE A;  1ZNP A;  3LE0 A;  3B01 A;  3PUS A;  4AR2 A;  1DIW A;  3DYM A;  3P3N A;  4JGY C;  4ARX A;  2HWB 1;  1X36 A;  1C1F A;  2YBS A;  1S55 A;  1ZZ9 A;  5C4W A;  4AHY A;  4QPW A;  2ZCW A;  2R6Q A;  4IV1 C;  3LEM A;  2HYX A;  1X82 A;  4MGQ A;  3KHB A;  4NO4 A;  4NHK A;  4FPF A;  2IVI B;  1VAV A;  1X8M A;  5A7N A;  1RB8 G;  1VBC 2;  3AP5 A;  2R0H A;  3LAG A;  4P5H A;  1ULO A;  2DTY A;  4I3G A;  2D6L X;  1LB2 A;  3ZFG C;  4S2D A;  3GHM A;  4QQ2 A;  3U1X A;  1EPZ A;  3EO6 A;  4D3W A;  3GZT B;  1W0P A;  1PIV 2;  5ISL A;  1OOP B;  1C3H A;  2OX0 A;  4P9W A;  2PHD A;  4MLO A;  2AC1 A;  3ACG A;  2BP6 A;  2YZ4 A;  4HAN A;  2EID A;  2GC3 A;  3ACH A;  3DXU A;  4Q0V A;  4K6B A;  3VBF B;  2JDU A;  2WJS A;  1G6N A;  5HCH A;  1W99 A;  4PLN A;  1DYP A;  1ALY A;  4BXF A;  5FMO S;  4BOW A;  3T09 A;  3C8X A;  5FPU A;  4XEZ A;  1PHM A;  1LOG A;  1S0B A;  2JD4 A;  3MPP G;  1PK6 B;  4GB3 2;  2V73 A;  2XLA A;  3KT1 A;  4JGZ A;  3O1T A;  2FDF A;  1LEN A;  3OUI A;  3H1M A;  1DGL A;  2A3X A;  1BEV 2;  1QGL A;  2YBK A;  1W6Q A;  5G05 L;  5H9R A;  4D6Q A;  1XXN A;  4EJR A;  4QDS A;  1TQ5 A;  1CAV B;  1KRI A;  1IPK A;  1QXJ A;  1KJL A;  2HLE A;  4XET A;  1BBT 3;  4F3J A;  3MLK A;  2YG0 A;  4AHW A;  4E2Q A;  5ACA 1;  3WXP A;  1AR8 1;  3CZJ A;  3KV9 A;  4K1Y A;  4WM8 A;  1ZRD A;  1ONA A;  4WVM B;  1GNH A;  2AGS A;  4OZX A;  3GZA A;  3PU3 A;  1PZ8 A;  2EXI A;  1KFX L;  4WBB A;  3APB A;  3WIN E;  1AL2 3;  5FRE A;  4ZXE A;  3VBO C;  4NAO A;  1E5H A;  5A7Q A;  4LHK A;  2Q8C A;  1IS3 A;  3GJB A;  5DAP A;  2YFU A;  3D6E A;  1F4H A;  5C3O A;  3H8O A;  5EYX A;  4AED A;  4DEV A;  3HBZ A;  1E5R A;  1QNW A;  2WZE A;  3DKW A;  2X5I B;  4GB3 3;  4O65 A;  3UJQ A;  1UZV A;  3W59 A;  2ZAC A;  1V9U 2;  1OH3 A;  3WW2 A;  1AYN 2;  2VUJ A;  1TZO A;  2VUL A;  2XR4 A;  3JD7 2;  4IEQ A;  4A44 A;  1Y9M A;  4L0P A;  1PGW 2;  4OHV A;  4QPI B;  4AVC A;  4A45 A;  2NM1 A;  4AFB A;  2QQU A;  4CEW A;  2XJP A;  2R07 2;  1M4W A;  3HNY M;  3MF9 A;  5KWR A;  2HWF 3;  1DQ5 A;  1NLS A;  3OTF A;  3EQE A;  4JQT A;  1YFX A;  3CNA A;  1BMV 1;  2CNA A;  2ZTN A;  2ZX1 A;  4QWN A;  2VTX A;  2UU8 A;  3O1P A;  3AL6 A;  3EB7 A;  4HKL A;  3VKN A;  4KH9 A;  1GQP A;  4JAA A;  2WQZ C;  2JXA A;  4LIU A;  4YPJ A;  1RUJ 3;  3AB0 A;  1QJY 2;  3IPV A;  4ZZ5 A;  2VMD A;  4MXV A;  3WNM A;  4BU2 A;  3OGR A;  5FKB A;  1HB3 A;  1LGB A;  5FIX A;  4IGP A;  3WQ7 A;  2WWU A;  1ZRI A;  1GWM A;  1UZW A;  2E33 A;  4OVE A;  1QIQ A;  1VRH 1;  1JZ4 A;  1PGL 2;  2Q0A A;  5FY1 A;  3GNE A;  5FZO A;  4Y5T A;  4PCR A;  2AYH A;  3DV8 A;  1UNB A;  1V6N A;  4XFB A;  1GKB A;  2P6C A;  5KHK A;  3WNN A;  1Q8Q A;  2WT2 A;  5DXD A;  2F4L A;  1VB4 A;  4AI9 A;  1UXZ A;  2DCZ A;  1UAI A;  3ZVX A;  4XDP A;  4KI5 M;  5A7W B;  3S5A A;  2V5Y A;  2J1T A;  4FP2 A;  4QX7 A;  3RZL A;  2WS9 2;  3T0A A;  2HEW F;  5GZG A;  4CTE A;  1MS3 A;  2RM2 3;  2GNT A;  4XZP A;  5JPN B;  3K4D A;  3SEP A;  3LOI A;  2ORZ A;  2OVU A;  4FFI A;  4YVW C;  2D5F A;  3KVB A;  1YC6 1;  4OUM A;  3VD7 A;  3CLP A;  1RUD 2;  3BN6 A;  1SPP B;  1EYB A;  5CBL A;  4YZ4 A;  1ULE A;  3O1V A;  4AI2 A;  3EXU A;  4IER A;  2YC4 A;  4RGG A;  4DXT A;  1O4Z A;  5DDJ 3;  4CEY A;  3P5B A;  1PO1 3;  4B7E A;  4FP3 A;  1GP5 A;  2WFF 1;  1OKO A;  4AFA A;  1OA3 A;  1TMF 2;  4K1Z A;  4OCT A;  2RHP A;  5C3Q A;  1W9T A;  1ZBE 3;  3BU7 A;  1ACC A;  1ASJ 1;  5BUV A;  5FYU A;  1UMZ A;  3WNL A;  1UY3 A;  2GMP A;  1OQ1 A;  2VOK A;  3PTR B;  3OD0 A;  3JBG 2;  1HXS 1;  4Q26 A;  2WZR 1;  5EFU A;  1WA6 X;  4LBQ D;  4URT A;  5FZI A;  3DYP A;  1ND2 A;  3MBW A;  2D5H A;  3NRU A;  4KWK A;  4KMQ A;  1GZ9 A;  4CDX C;  4IE5 A;  1OT5 A;  3OCP A;  2LUW A;  3PIJ A;  2WFP A;  5ABJ A;  1QH6 A;  4NIH A;  4N8M A;  4AED B;  1RMU 2;  2BNN A;  4QX1 A;  3KHC A;  2R06 3;  1VBD 2;  4Y22 B;  1DF0 A;  2GU9 A;  3H42 B;  3KD4 A;  3NV2 A;  1XSR A;  1A3K A;  1DGW X;  1RUF 3;  2VBB A;  2DBI A;  5FRA A;  4RA0 A;  4RHV 3;  1OPO A;  5A6Q A;  2D3R A;  1K3I A;  4LBQ A;  5A6Z A;  1WW4 A;  4NMI A;  4IEO A;  2FMY A;  3KVA A;  1OUR A;  3O7O A;  1U5X A;  1ZBA 3;  3VHO A;  3AZX A;  3FN9 A;  1OD5 A;  4FVV A;  4BPZ A;  3HT1 A;  4AGG A;  4Y4Y A;  3LD8 A;  3POB A;  1LTE A;  4BQ1 A;  2RJL A;  4HG6 B;  2WR9 A;  3I2I A;  4B29 A;  4NII A;  5KHG A;  1FMD 1;  2JG9 B;  3M4F A;  1V9U 3;  5FYS A;  3ZFE C;  4QHO A;  3SCF A;  1ND3 A;  1M06 G;  2E51 A;  3WNX A;  1W9S A;  3O1O A;  3N9O A;  4YG0 A;  3BYW A;  4ZZ8 A;  4MGK E;  1U5I A;  1YIP A;  5T5L A;  4IV3 C;  1OA2 A;  3LB9 A;  5A3L A;  4M3C E;  4H2A A;  4FOW A;  3JQW A;  1US2 A;  4BWO A;  1PNF A;  5EYY A;  5DZG A;  2GSY A;  3TWI A;  2I45 A;  2HWB 3;  3M8L A;  2E31 A;  3VZO A;  4XFI A;  2GZW A;  4CDW A;  5FP8 A;  5FZA A;  2HWF 1;  1YEW A;  1J58 A;  2WZR 2;  4XUQ A;  4ATF A;  1RL3 A;  2BVB A;  1U12 A;  2UYB A;  2WN3 A;  2WQ4 A;  5F3E A;  3WP4 A;  5KHJ A;  2RMU 1;  3J7H A;  3SH5 A;  4ZS3 A;  1GMM A;  4I02 A;  2A70 A;  1ENS A;  2NZ9 A;  2VU9 A;  4AF9 A;  2ET7 A;  5E88 A;  1CZV A;  1PO2 2;  1C5H A;  2D3P A;  2UWA A;  2ZGU A;  5H9S A;  4A42 A;  3O14 A;  1L3J A;  4IE0 A;  4S2G A;  4CCK A;  3KS7 A;  1KFU L;  5J96 B;  3HOB A;  2N7G A;  1OLQ A;  5L36 A;  1B09 A;  1OVP A;  2VW2 A;  1MZE A;  2WT0 A;  1HB4 A;  2DYC A;  3MLJ A;  4ASM B;  1JYI A;  2FDG A;  1UU5 A;  4MGI E;  4GH4 C;  1JZ7 A;  1H8V A;  5IYY A;  1R08 3;  3H1W A;  1JZ6 A;  1AR8 3;  1AX2 A;  2J1R A;  5ANQ A;  5FUP A;  1QEX A;  4ZS2 A;  2QFE A;  3WX5 A;  4UBH A;  4QXC A;  4OQ9 A;  2P37 A;  4YW7 A;  1CX4 A;  1FMD 3;  3S57 A;  3ZSM A;  4MAD A;  1LOB A;  1OOP C;  5FBJ A;  3LF7 A;  1RUI 1;  1RUC 1;  2BOJ A;  2XVK A;  4IW3 A;  3OB8 A;  2FHR A;  1GYK A;  2RR1 1;  2ZX3 A;  3ME2 A;  4CU8 A;  4BIS A;  2XH6 A;  2IXL A;  3IWZ A;  4E4S A;  1VLN A;  2R04 3;  1W2T A;  4CCJ A;  1F31 A;  4EWE A;  3NV4 A;  1IS6 A;  3CMG A;  3GGL A;  1L7R A;  1RVF 1;  2Q1Z B;  2W1Q A;  5FP3 A;  5JOW A;  4XQ4 A;  4CPB D;  4PT6 A;  3POE A;  1UYY A;  1APN A;  1V6K A;  1SEF A;  1U5Z A;  3IMN A;  4PF5 A;  5FK7 A;  1SZB A;  3F95 A;  1OHF A;  1JBC A;  3N3H A;  4RD7 A;  4XBL A;  4DO0 A;  5BNP A;  4LUK A;  4LNV A;  1CGP A;  2RR1 3;  2VVF A;  1GIC A;  5GAL A;  4CP0 A;  4IEX A;  2CWM A;  5FPZ A;  2QQP A;  2UUR A;  3O0W A;  3JU9 A;  3RZK A;  3GF6 A;  3FJS A;  4D7T A;  2B7Y A;  2JE9 A;  3VL8 A;  3WD5 A;  5BNO B;  3NJV A;  3WR0 A;  2EXH A;  5LK7 B;  1OXC A;  5FYI A;  5FZ6 A;  4BK4 A;  1ZZ6 A;  1D4M 3;  4WM7 C;  1F5J A;  5FQ0 B;  2JG9 C;  1X8E A;  1J3Q A;  1NXM A;  2WII B;  1D2Q A;  4MGZ E;  5BY5 A;  3PTY A;  5T3N A;  3I3M A;  1VBB 1;  2G9F A;  5CFC C;  1XNA A;  4AWD A;  4KBZ A;  3ES1 A;  1R08 1;  2LAL A;  1HQL A;  2YGM A;  3ETQ A;  5JUV A;  5JCT A;  2RJ2 A;  2XL9 A;  4LUM A;  1C8N A;  3VBU A;  3E97 A;  3MF6 A;  4BHP A;  2DVA A;  4GIQ A;  2HWD 1;  1UKR A;  2ZOE B;  1XNK A;  4AI0 A;  1JW6 A;  1ULG A;  1RIT A;  2WYS A;  1H1A A;  5A3W A;  5C8C A;  5DAV A;  4GKX A;  4KBB A;  4OUS A;  2KA3 A;  2G4I A;  3GJA A;  2ZEW A;  4CU9 A;  4FPC A;  4X8P A;  1DGR A;  1GOG A;  4RHV 1;  4OLL A;  5CU1 A;  4Q4X 2;  1W3V A;  2O1Q A;  3CEW A;  3ECQ A;  4XW3 A;  3QH7 A;  2FCT A;  5CB7 A;  5FZF A;  3ZXK A;  5FZ9 A;  5A6X A;  3T0B A;  3BGA A;  2XJS A;  4QXB A;  4EZH A;  3HJR A;  3MFA A;  4UFI A;  2UY9 A;  5FYC A;  2YRO A;  2GH2 A;  1YO8 A;  2D6N A;  2VO5 A;  1TEI A;  4N53 C;  4XIL A;  1VE0 A;  4LIV A;  3AZZ A;  5BNP C;  4QPI A;  1KGY A;  1LR5 A;  3OYW A;  1GLH A;  1H30 A;  1SFP A;  3SMH A;  4RQP C;  2HH9 A;  2WO3 A;  5HPO A;  2R0F A;  4MH0 E;  3S0M A;  1JZ5 A;  4C91 A;  2OII A;  1G8W A;  2P3J A;  4FOY A;  1EV1 1;  2LS6 A;  2VM9 A;  4MGS A;  4PDW B;  4Q0P A;  4W65 A;  4GWM A;  4XJW A;  3AL5 A;  1HRV 3;  4UFL A;  1C1L A;  1OH4 A;  1O8P A;  1S4C A;  2WNE A;  1GWK A;  3KV6 A;  3Q8F A;  2VCB A;  2DFB A;  5A3O A;  4E4D X;  3I2G A;  1VRH 2;  4EN7 B;  2A75 A;  2VME A;  2GND A;  5CKQ A;  5FZ8 A;  4FO9 A;  3CJI A;  3VBS A;  1CVN A;  1XU1 A;  2GME A;  4AAX A;  1W04 A;  3A4U A;  3AMH A;  4BZ4 A;  3WHU A;  2QZ3 A;  3I54 A;  4LOS A;  3OJB A;  3IM0 A;  3AZY A;  3VDC A;  4XF9 A;  4XPV A;  3K2O A;  4Y26 A;  3NJX A;  4E2G A;  1F4A A;  3OBT A;  4DXR A;  3HAG A;  3UET A;  1RTV A;  2A6Z A;  5JZG B;  4COY A;  2P34 A;  4FPY A;  5EPA A;  4CCL A;  4CUG A;  3O1R A;  3MEP A;  3NMB A;  5FXW A;  4PJY A;  4RQP B;  3VDD C;  2WNU A;  3BTY A;  4JDM A;  1HRV 1;  4QQO A;  1XRU A;  4IQP A;  1RIR A;  2BGC A;  4L97 A;  3B9I A;  5FOB B;  2YBP A;  1VBE 1;  2QQM A;  3KV5 A;  2JB8 A;  5J1X A;  1W0N A;  2JE8 A;  5LBC A;  1YQ5 A;  4ZKT B;  4BE3 A;  5T54 A;  5LRS A;  3ROU A;  2D40 A;  5HV0 A;  1D0G A;  2JG8 C;  5FZM A;  2JEM A;  2ADE A;  2Z79 A;  4XIK A;  1RUF 2;  4E2S A;  1Q5O A;  2BZD A;  2H0V A;  3GBG A;  4D8M A;  1KQR A;  3LIG A;  4AQ2 A;  3RG0 A;  3DPR A;  3O5S A;  3WZ1 A;  3BTX A;  4L92 A;  4LBQ B;  2P3I A;  1YHF A;  4FPG A;  3UKV A;  3OSD A;  4XBN A;  5FYZ A;  2VGD A;  3ACF A;  1QOO A;  4G4F A;  4XC9 A;  4BK5 A;  2F6B A;  2WAO A;  4QU2 A;  3VL9 A;  3JQX A;  3AM2 A;  2RM2 1;  3ENR A;  1PMH X;  3N7J A;  4XMA A;  4N43 C;  2VNO A;  3MIG A;  4Q4W 3;  1I9R A;  5JOX A;  4WZC A;  4J1W A;  1UOG A;  3WF3 A;  3Q8C A;  4QMA A;  4AQT A;  1YJK A;  5KC5 A;  4CDQ A;  1URX A;  3GAL A;  4E27 A;  3H3U A;  3ZKU A;  4HSJ A;  1NAE A;  1PVC 2;  5C5T A;  5K9Y A;  4GA9 A;  3K51 A;  2JEC A;  4XJU A;  1IPS A;  4CA9 A;  4YW3 A;  5LY1 A;  4ASL A;  4ZON A;  2W5F A;  1XQN A;  5I0U A;  3H7J A;  2WQ8 A;  3ZOI A;  2DDU A;  3J7M A;  5LBB A;  5BNO C;  1UOF A;  3OBZ A;  2SBA A;  5J98 B;  1RUH 3;  2VNV A;  3VBH B;  4COU A;  3BUC A;  2X05 A;  1VMF A;  3VBO B;  4NHM A;  3ZFF A;  1SDW A;  4BIO A;  4OMC A;  1R09 2;  1NOV A;  4B4P A;  3NO8 A;  4PIZ A;  4QQH A;  1UW8 A;  4DMI A;  4W50 A;  4CDU B;  4CUB A;  4Q4W 1;  5C70 A;  3T3Y A;  2Y6H A;  1EP0 A;  3GBW A;  2OW4 A;  3VHN A;  3AFG A;  1GZW B;  5EXO A;  1FX5 A;  4AE2 A;  4R9A A;  4WZF A;  1O91 A;  2YPJ A;  3KM5 A;  4DQA A;  2HWE 2;  4R4X A;  4P5Y A;  3VBU B;  4PIY A;  3VBR A;  4ES8 A;  3KZ4 C;  2O0O A;  1VBC 1;  1BBT 1;  5J09 A;  1LOC A;  3AP4 A;  5JOY A;  2RDS A;  4R9C A;  4N7I A;  3I8T A;  1JUI A;  3HEI A;  5DPN A;  5A7W A;  1BK0 A;  1DQ6 A;  5F5C A;  3P1I A;  4FI9 A;  1QXP A;  1ZZC A;  2VZQ A;  3FFQ A;  5L73 A;  4CEY C;  3L2Y A;  3VBF C;  1TME 1;  1J84 A;  2DCJ A;  3TBD A;  1R09 3;  1XND A;  5F5I A;  1B35 A;  2W95 A;  2EIG A;  4LBO A;  4ISQ A;  2VE1 A;  1VMJ A;  4RR3 C;  1H2L A;  1GUI A;  3H9A A;  4HL0 A;  2HWE 1;  2UY8 A;  4YVS C;  5FQ0 A;  3T1M A;  1NY7 1;  2XJV A;  2BWC A;  4Y3O A;  3I59 B;  2W39 A;  1CAU A;  1Z7S 2;  1EAH 2;  3WG2 A;  3ZN6 A;  1RUI 3;  3DXT A;  1DQ4 A;  3JZV A;  2PHR A;  3UT0 A;  3VD9 A;  3QAC A;  2JIJ A;  3KV4 A;  1WCS A;  1O3Q A;  1LES A;  1R08 2;  4UI9 L;  3J26 N;  3ORJ A;  4ZPI A;  2OQ6 A;  2D6K A;  3IB3 A;  4Y1Y A;  2PHU A;  3RZG A;  2AR6 A;  1WCD J;  4Q4W 2;  1X50 A;  4YGD A;  3UYJ A;  1G9A A;  1R09 1;  2MHF A;  1YQ2 A;  3LIH A;  4M0N A;  5CAZ A;  5K8S A;  5JSP A;  3D3A A;  4JRL A;  3VBH C;  5DG1 A;  1VRH 3;  1NYW A; 
#chains in the Genus database with same CATH homology
 4CCN A;  5FYM A;  2XDV A;  5FYI A;  5FZ6 A;  5FY0 A;  4QXH A;  4QU1 A;  2PXJ A;  2YPD A;  5CEH A;  5FYZ A;  5FP7 A;  5A7O A;  2OT7 A;  3N9L A;  3KVA A;  5FWE A;  4D6R A;  3NJY A;  5F3C A;  4V2V A;  2VD7 A;  5FZC A;  3N9Q A;  5FP9 A;  5FZD A;  3LD8 A;  2OQ7 A;  5F5A A;  2XUE A;  4EZ4 A;  4HOO A;  5IVE A;  4C8D A;  4GJZ A;  4IGO A;  2W2I A;  5FYS A;  4QWN A;  2YU1 A;  5LY1 A;  3N9N A;  5A3W A;  3N9O A;  3AL6 A;  5FXX A;  5LWB A;  4D6S A;  5A1F A;  2Q8C A;  4LIU A;  4TN7 A;  5FYV A;  3K3N A;  4CCM A;  5A3T A;  5A7S A;  1VRB A;  4NUB A;  3OPT A;  3PU8 A;  4BU2 A;  4XDO A;  5IVB A;  3N9P A;  5FY4 A;  2GP5 A;  5FZF A;  5FPA A;  5FZ9 A;  4IGP A;  3PUS A;  4EZH A;  4QXB A;  5FZO B;  5FZE A;  2WWU A;  5FZ3 A;  5A1L A;  5FYC A;  5F32 A;  5FXV A;  2YBS A;  4UF0 A;  5F2W A;  5FYY A;  5FP8 A;  5FZA A;  3PUR A;  4URA A;  5FY1 A;  5FZO A;  2Q8E A;  5FJH A;  4LIV A;  5FPL A;  3ZLI A;  5K4L A;  4Y33 A;  5F3E A;  5F3I A;  5A7N A;  5A3P A;  3PDQ A;  5FXZ A;  5IWF A;  4AI9 A;  5FZL A;  5IVC A;  4XDP A;  4EYU A;  5A7W B;  4V2W A;  3AL5 A;  4QX7 A;  5ISL A;  5FYH A;  4QX8 A;  4CCK A;  2OX0 A;  5LY2 A;  2P5B A;  5IVF A;  3KV6 A;  5A7W A;  5FZ4 A;  5FZ8 A;  3DXU A;  2XML A;  5F5C A;  2YU2 A;  3KVB A;  3AVR A;  5IVJ A;  4LIT A;  5LW9 A;  5FPV A;  5KR7 A;  5F3G A;  5A80 A;  5ANQ A;  5FUP A;  2Q8D A;  5FV3 A;  5F5I A;  4QXC A;  4BXF A;  3K2O A;  3N9M A;  3AVS A;  4UF0 B;  5FBJ A;  5FZG A;  5A7P A;  3U78 A;  5F37 A;  5FPU A;  5IVV A;  3OPW A;  5FZ7 A;  4AAP A;  3U4S A;  5FWJ A;  4Y3O A;  4CCL A;  4CUG A;  4BIS A;  5FXW A;  4GAZ A;  5F2S A;  4CCJ A;  2WWJ A;  2YBK A;  4GD4 A;  3DXT A;  4CSW A;  5FYU A;  5FPB A;  4D6Q A;  3LDB A;  5A3N A;  5FP3 A;  3K3O A;  5FY7 A;  5FZ1 A;  5IW0 A;  4LXL A;  4ASK A;  3KV4 A;  5E6H A;  2YBP A;  3RVH A;  4CCO A;  3PTR B;  5FYT A;  3KV5 A;  4IGQ A;  4Y4R A;  5FUN A;  5FYB A;  4E4H A;  3KV9 A;  2OQ6 A;  4GJY A;  5FJK A;  5FZB A;  2OS2 A;  4DIQ A;  5FZI A;  4DO0 A;  5FY8 A;  5FZK A;  2XXZ A;  3PUA A;  3UYJ A;  3PU3 A;  3ZPO A;  5FZH A;  5FZM A;  2GP3 A;  5FZ0 A;  5FY5 A;  5A7Q A;  5F39 A;  4HON A;  5FY9 A;  5IVY A;  3PUQ A;  5FP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...