2Z2SB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
182
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRDPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 40
structure length 182
sequence length 193
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z2sB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z2sB02
1ZVFA 3UKNA 3HUGB 1YFXA 2PHDA 5KHHA 2XLGA 1J3PA 3D82A 1I6XA 1LRHA 2XGXA 1O3RA 3LA3A 3OF1A 5LRRA 4KWLA 1CAUA 3H7JA 4YSFA 1GQHA 2MHFA 1YFUA 5LRSA 5E1RA 4HN1A 5BUVA 1QXJA 1SFNA 2H6BA 4X6QB 4QM8A 2GC2A 3USSA 5J3UA 1IPKA 2B5HA 2FQPA 4D7TA 1CGPA 1ZZBA 3FE5A 3HQXA 1OFNA 4BIFA 2BYVE 1X82A 2ZCWA 5JSRA 4JV4A 2Z2SB 4K8FA 3FZ3A 1L3JA 4LULA 1RUNA 2V09A 5BXXA 1JUHA 1ZZ6A 4HSJA 4AQ6A 3G7DA 4Q0QA 2Q30A 1NZCA 3SHRA 2XL7A 3E5XA 1ZZ8A 1O3TA 4HVOA 2FMYA 1QXRA 4QXKA 3UKTA 1OI6A 2BNMA 3U11A 1ZX5A 1YHFA 3LAGA 4FAGA 2CGPA 4XF4A 4MGKE 4X6RB 2E9QA 1GQGA 2WFPA 5KHKA 2EAAA 2ATFA 2PAMA 2PA7A 3KMHA 3S0MA 3RZZA 2XLFA 4Q0SA 4CYDA 2QCSB 3MYXA 1FI2A 4ONUA 4R8HA 5CADA 2Y0OA 2D40A 2OA2A 4O9EA 4PJYA 1PM7A 4IEUA 5F1RA 1DGRA 3E6BA 4IEZA 5AVPA 2CV6A 1DZTA 4XFGA 4MH0E 4EWDA 4EV0A 2VPVA 4XFHA 4FT8A 3NW4A 5BPXA 2C0ZA 4P9GA 4R52A 1XE7A 2CAVA 1CAXA 4I09A 3SCGA 4Q29A 2XLAA 3ES4A 4ZU5A 2D93A 1ZZCA 1X7NA 2O8QA 5LEJA 3PLQA 2IXJA 3WW3A 4YRDA 2IXLA 3NJZA 3EQEA 1WA4A 1ZZ7A 2QVSB 3ETQA 1G6NA 2XL9A 1J59A 1QY4A 4AVAA 5EZWA 2GU9A 4IEOA 1CAWB 1UCXA 3DKWA 1EY2A 3LA7A 4H7LA 4DINB 4META 2OYZA 5BY5A 3SXWA 3BU7A 1NYWA 3FX3A 3ES1A 1Q5OA 2B8MA 5D1IA 5KHJA 3KGZA 2GC0A 1U12A 2UY8A 3CF6E 2ET1A 5JR7B 2Q1ZB 4EWAA 1YFYA 4IEWA 1O3QA 3R6SA 3LOIA 2PAEA 4PIYA 1H1IA 3WW2A 1VP6A 4IERA 1UD1A 2GH2A 1RTVA 3BALA 3RNSA 1Y9QA 2BGCA 4XFBA 3DV8A 3KSCA 3S7EA 2BEOA 1QWRA 2PHLA 5CVRA 2PQQA 3QOPA 3O14A 1LKNA 2F4PA 3N4MA 1WLTA 2VQAA 3FJSA 2O1QA 3ROUA 3B02A 1YUDA 3UKVA 3SCFA 1VJ2A 2HJIA 1J3RA 2KXLA 5KHGA 4KWJA 3IDCB 3I59B 3S7IA 2H6CA 2XKPA 5I93A 4IEYA 4YARA 5BV6A 3BB6A 1RC6A 4OFGA 4AVBA 1DZRA 2VECA 1ZRDA 2GAUA 3FHIB 4XFFA 4IEVA 2Q0AA 5I8SA 3H3UA 3SCHA 3IDBB 1CAUB 1UIKA 2D5HA 3HIFA 4Q0PA 5K8SA 3RDIA 4QMAA 4IEPA 4Z07A 4XETA 2D5FA 4HSLA 2UYAA 4WZCA 4ZU7A 4LEJA 1X8EA 4QX5A 5CU1A 4HBNA 5J7MA 4XFIA 2QDRA 4MGIE 1YWKA 3L2HA 2GC3A 3TNQA 1WGPA 3D0JA 4BH9A 1XE8A 4N9IA 4JVAA 2PTMA 4LLOA 3GBFA 3E6CC 5T3NA 1H1MA 4MUVA 5J48A 4Z82A 1X8MA 3MPBA 4KWKA 1SEFA 1V70A 5C8WA 4N9HA 4I01A 2EA7A 3H7YA 1CAVA 4IEQA 3QACA 1LB2A 1LR5A 5I91A 4MX3A 4QGNA 2PFWA 1EYBA 4LUKA 1O4TA 3ZDSA 4FBFA 2WC2A 1NXMA 1ZREA 3NKTA 3ELNA 4XEZA 5I0SA 3E97A 4KU7A 4YNIA 4PIXA 4XF1A 4XFAA 1ZRRA 4ORFA 5I8TA 3CL1A 3H1YA 1HW5A 3IIAA 2GZWA 4Q0UA 4QGMA 5C6CA 3H3ZA 3VHRA 2ET7A 1UIJA 3KCCA 1EP0A 2OZ6A 4L11A 1OD5A 1CAXB 3GYDA 4J1XA 1NE4A 4D7SA 4XFCA 2ETEA 1FXZA 3LA2A 4I02A 2MNGA 5JSOA 3ST7A 4F7ZA 1FT9A 4KU8A 3BPZA 3HT1A 4AVCA 2PYTA 3M3IA 2EVXA 1CX4A 4TLFA 1IPJA 1YFWA 3RPQA 3E6DA 5JCTA 3I7DA 4QGLA 3KGLA 5EFUA 3NL1A 3U10A 3DL3A 4Q0VA 2IC1A 3RYPA 3OD0A 1Q43A 1Q3EA 1I5ZA 4E2QA 1ZZ9A 4O9GA 3LZZA 3WW4A 5E16A 2QJVA 2DCTA 3FWEA 3IBMA 1RGSA 2HKXA 4L2NA 4IESA 1UW8A 4LUMA 4PIZA 4QM9A 1TQ5A 3OCPA 3LWCA 3TNPB 4IETA 5I0UA 3MZHA 4F8AA 2BNOA 5FLIA 5FPXA 1O3SA 4WVZA 3H1MA 2IXKA 2H0VA 2I45A 3CLPA 2IXIA 4HZFA 4MZUA 4EROA 2XKOA 3DN7A 5FCCA 3CJXA 3SMHA 1J58A 3OTFA 3HT2A 5JAXA 2UYBA 5KBFA 2BNNA 1XRUA 1UPIA 2B9UA 2XHKA 1J1LA 3MDPA 5FQ0A 4UBHA 2Q4SA 4AXOA 3E5UA 5I0RA 1RUOA 4HMZA 3E5QA 5FLJA 2QNKA 4XF0A 1PMIA 2OPKA 4JTNA 4JTOA 1ZRFA 2K9ZA 2UY9A 5FDBA 2GC1A 4EWEA 4NQWB 4UXAA 1EPZA 3EBRA 3NVCA 3EJKA 2MPFA 3CO2A 4LA3A 3U0ZA 4J1WA 3NSTA 1VR3A 4E2GA 1ZRCA 2K0GA 2IXHA 4GULA 1O5UA 1CAWA 2N7GA 4E2SA 4XF9A 3M70A 3OGJA 3EO6A 4I0AA 4LA2A 3PVBB 1DGWA 5FPZA 5FLHA 5FQ0B 4I0BA 4A2UA 2Z69A 5JSPA 5HI0A 4WBBA 3WW1A 3EHKA 2PAKA 4I2OA 3IWZA 3BCWA 4MGYE 4YYOA 1SQ4A 2IXCA 3CEWA 3JZVA 4AQ2A 4MV2A 1Y3TA 4HVRA 4FAHA 5I8YA 3I54A 2CAUA 1YLLA 4MGZE 1RL3A 4KL1A 3H1WA 1CAVB 4RD7A 5I0TA 4IEXA 1OMIA 3C3VA 4ZU4A 2ZKLA 4B29A 1O7FA 4HVQA 2P17A 1NE6A 3H8UA 4UBGA 3H9AA 3PNAA 1O5LA 4NVPA 3RYRA 4BYYA 4BHPA 4LTAA 3I59A 4I3PA 1J3QA 5LEKA 1ZNPA 4HN0A 3ACLA 4OLLA 4XF3A 3D0SA 2OZJA 5KHIA 4HLTA 3RYKA 3FFQA 3H50A
chains in the Genus database with same CATH superfamily
3E6MA 2BOIA 3HUGB 3NNLA 1Z3XA 3FXKA 3OYEA 3F8FA 1NZIA 1YO5C 1N3QA 1RUH3 3HSRA 2JUCA 3OSGA 5AC92 4EJWA 3ZP5A 1WCQA 1X36A 3M07A 1BI2A 1FMD3 1OKRA 3JREA 4E4HA 4C8DA 2W1OA 2W00A 4NWVA 4AEDB 1POV0 1X82A 4GAZA 1OCCH 4K8FA 4AGVA 4PLNA 1FV2A 2RM22 1BJZA 4OI4A 2CQ7A 1S3JA 3ZMVA 2FZ2A 5FZ0A 4CPBA 2GXGA 2F4OB 2ZGMA 1ZBE2 1ZZ8A 3TN92 3ZYGA 4QPIC 5H9QA 2RHPA 4FAGA 1YEWA 1R71A 3U1XA 2R49A 3K75B 1LDJA 1Y56A 2BRTA 3IIIA 3MEXA 3F6VA 5FKKA 5FP4A 2F4LA 3CU7A 1NA1A 4DOUA 1P4XA 1H9GA 3DTIA 4IEUA 3E6BA 3SZTA 3OYMA 3QYFA 1Q8OA 3RS6A 3NW4A 4LK6A 4HSRA 1R64A 4OU0A 1MMDA 4YG6A 3DBLB 2VTXA 3AFGA 4DNCA 1XD7A 3ASOH 4MGSA 1RITA 2EZHA 3JD73 3W59A 2NVUB 3WW3A 4FSJA 2ZZQA 3FMGA 4EN9B 1Z7UA 3VDXA 3PIGA 2XSJC 2A75A 4CP9A 5E6HA 3ZVXA 3DKWA 2RR11 3RZJA 2DT5A 2GQQA 4P1WA 2Y9ZA 4AR2A 1A35A 5KHJA 1MEC1 1GZTA 2GC0A 3ZSLA 1PIV1 2P5LC 3VZMA 2VKDA 3GHNA 5EHDA 1MPXA 3R6SA 1NG6A 4A6SA 3BJ6A 1PO11 1PGW2 5FPLA 1OD3A 2GH8A 2BGCA 2LBFB 4K1YA 1HB4A 3HG9A 2A6YA 2WNUC 3QOPA 1XGOA 4FXKB 4UNOA 3GFMA 2JMWA 2MLKA 1HXS3 2ZGSA 2O1QA 4LQRA 4QB1A 1VJ2A 4CUGA 5FZEA 3IDCB 4PDKA 3T3YA 3SEZA 2XKPA 2BU9A 2K3PA 2GOXB 4NUBA 1XYNA 3BGAA 4KGQA 4XACA 4GMP1 5DEQA 1F4AA 4CU8A 2HYGD 5HDGA 2GMPA 3VBHC 4QLCU 2OT7A 2C9KA 5FUNA 1AX2A 3L2YA 3N36A 3NV4A 1AX0A 3JB8A 5JXIA 1TNSA 4WZCA 4OIOF 1R093 1IRZA 3AL0C 4S2HA 3CMEI 4KBZA 4YPJA 2G9FA 3KYDB 1S4CA 2WNOA 3WTVC 1WJDA 4B1MA 4A6EA 3D0JA 4PF1A 3WNXA 2IAIA 3BPSA 4MHRA 2B39A 3FXLA 4MUVA 4XBFA 3A01A 2B42B 2PHTA 2Z79A 5B66C 2DOFA 5FXVA 2EA7A 3H7YA 3VD3A 3KEYA 1Y43B 2EFWA 4LJZF 2VMGA 3P9CA 1JKRC 5F0CA 1DU6A 1PNGA 3WF0A 1B09A 4DO0A 3CJTB 3M3QA 1DYPA 3UV9A 4L99A 1DF0A 5AIPA 4FX4A 2GWRA 3SNMA 4HDUA 1VBA3 5HBAA 2M0CA 5SV5A 2VZPA 3AVSA 2GA2A 3HUGA 1YG2A 2ET7A 4J00A 3WP3A 3WSOA 2VMEA 4Y5TA 3LFKA 3U21A 1XBFA 1AR83 3GW2A 5GLWA 4FPJA 2PI0A 3S17J 3ST7A 4OZOA 4HX7A 4XSZF 2KMUA 1W8FA 4MVTA 2TDXA 3B6AA 1UX6A 4AEDA 5C3OA 1VQOI 2RQPA 3LEKA 2VOWA 4ARXA 1IPJA 3OIPA 5JCTA 2COBA 2FA5A 2VLAA 4ZXEA 1BKZA 4NAOA 2C26A 4II3A 1GT0C 5JVTA 4J01A 5ANNA 1CQ9A 5BOXA 3T8TA 3GALA 1BR4A 1IS5A 3OS2A 1NCQB 3KWVA 1OSGA 2IS4A 3KYCB 1XGSA 2VH9A 1ZYBA 1XU2A 5L7OB 1LUJB 1J7KA 3HAGA 4D6RA 4ENJA 1BEV1 1LNWA 2DQRA 2EQRA 5EXOA 4K20A 5JOZA 3HWJA 3N7JA 3CJXA 1D0GA 4A44A 1GP4A 4I30A 2TEPA 3WX5A 4PFOA 2WZEA 2XOMA 3KF3A 1W6NB 4W6XA 1X1DA 4Q47A 2WRAA 2H8WA 3WZ1A 1N25A 5K0UC 2NYXA 5E79C 4J1WA 1HX6A 4E2GA 1IN8A 4HG2A 4LK0F 2ESNA 2YSRA 4BY7J 1IV6A 2QA4I 3WOGA 3MBWA 4I98B 1DGWA 5FPZA 1GP6A 5FQ0B 5LY2A 1FPN1 4V1PA 3HQRA 3ZN0A 5IHRA 1NLSA 2PAKA 2LY2A 2E1NA 4MGYE 2OBPA 1VIWB 4A5MA 1GLNA 3UGFA 5L3CA 1HA8A 5D6FA 2ZNYA 1S0JA 3NNMA 5ABJC 4D7MA 2LBFA 1FIPA 2FF4A 4N8MA 2OPWA 2QLZA 4V2WA 2DMPA 4DXZA 2JD4A 1O7LA 1NE6A 1IN7A 3VZKA 1W5CC 2DFIA 1YJNI 2XGCA 1MMSA 5TGTA 3CCMI 3H36A 3K10A 5J4YA 1EUUA 5BNGA 3KFWX 3DUIA 1BN5A 3U4XA 1HW2A 5K7PA 2WL1A 5DQ0A 3RYKA 4AM3A 3WP6A 4YG3A 2DFEA 5KK1A 3O1TA 3QPLA 4CPBD 2XLGA 2K2SA 2Y38A 4LO4B 4L9JA 3JB4C 1LE8B 3BYWA 2RE9A 5BUVA 3K3NA 4OIRF 3I2JA 3HM5A 3WGIA 3MW3A 1IPKA 4PQ9A 2OXBA 3FN9A 4M9SA 3MFCA 4GXLA 3ORJA 1G8XA 2PMHA 4AIKA 5GADJ 2DJNA 3K7AJ 2AUYA 3K1MA 2RJKA 4Q4X2 3RZGA 4LBLA 1X2NA 4UW6A 2M4KA 5FY0A 3MLLA 3KYLA 4MEXF 1NCRB 1YCIA 2BV6A 5AC93 4MGKE 3P9IA 2A6TA 2CV0A 4X8PA 2AENA 3CJIB 2V79A 1W7PD 4M00A 3DECA 4TWTA 4FOYA 1WD3A 4XABA 3HNBM 3ACIA 1OC1A 1GICA 2YC0A 2RM23 3ACHA 4IJAA 4HKWA 3K4ZA 4XXPA 5FPUA 1WJBA 2P6HA 3TN93 1ZBE3 4MH0E 4M9XA 5JVGF 2K4BA 1W0PA 2DO7A 4CUAA 2F5DA 4P9GA 4X0GA 1RUJ1 2V26A 4RGGA 2KRHA 1XE7A 1VQMI 2WBMA 3CDHA 5IAVA 3I8TA 2VI6A 2OU2A 1N75A 4BE3A 3UNPA 2M8GX 3MWMA 1QKQA 3EB7A 3ML6A 3MD2A 1HRI2 2IXLA 5IYYA 1ZZ7A 2OTLI 3PU3A 1SFUA 1AVBA 1HSTA 1AUYA 1MQTB 2VN2A 3WCRA 5JOXA 3W20A 5A6YA 1A36A 5DD4A 3GF6A 3ZQQA 1PVC2 4LT5A 1FOWA 2ZTNA 4PDWC 2ETHA 5HVQC 2MH2A 2F4MB 1NCQA 5T52A 2IT0A 2G4IA 1IN6A 4EQVA 2J5PA 1VQ8I 1A8MA 3ZKYA 4PIYA 2DDAA 1VP6A 2LDUA 2VGDA 2VZ3A 2W91A 2RV8A 5L7OA 1HDPA 1KXGA 1H89C 4H0EA 2CW8A 3S15J 3ZFEB 4CEYC 4WXHA 4QPYA 4F3JA 1DG6A 1OLME 1IZ1A 1X9PA 2BW3B 1SD4A 5IPAA 5DPNA 3FHQA 4D6SA 3S3MA 2WTEA 2HJIA 1CX1A 1U3EM 2DFBA 1V6MA 1Q1VA 1QOTA 1W6NA 1LODA 2FQ4A 3ZMZA 3I2GA 5H2FC 3JRFA 4EZHA 5LA1A 1MVEA 1TMF1 1QRYA 4NHKA 3HIFA 5FK8A 3ZXLA 2LY9A 4OIPF 1EF4A 2CJJA 3TDUC 1VQNI 4F91B 1QJZA 2OW4A 4JAAA 3WE2A 1K78B 5LZ6A 2XAJA 1YWKA 2WINB 1YI7A 3JQXA 3OYJA 2A5WA 5C8CB 4HG6B 4TTGA 4Y52J 5C4XJ 1ULOA 5LA2A 2HYJA 1RHI2 3VBSB 2BJSA 4JGYC 4ENNA 3ZDSA 3I4PA 3DGTA 3O8HA 3WQ0A 4DY5A 2M7BA 3MFKA 2VUMJ 2GN7A 5FLXZ 4AVPA 3NKTA 2RS31 2LRDA 4NMIA 2ELHA 2E35A 4B09A 4YNIA 5K7ZA 3E1SA 1LEDA 1S72I 1N1VA 3NO8A 1SANA 2XR4A 4UFLA 3DEEA 3W2AA 1CZSA 3H3ZA 2R5YB 1LPQA 2E5ZA 1XSXA 1H9WA 1T2KA 2K27A 2VMFA 2DT7B 1PK6C 3ACFA 2L9SA 2WAQA 1ZQ3P 2R7ZJ 4O6JA 1W6OA 3V8KA 1LHOA 2GNDA 1LE8A 1AKHB 4JC1A 1SEUA 2VUAA 1OA3A 4GMP0 3SITA 3TOBA 2WYFA 2HBTA 2CO5A 4CDQB 1XNBA 3ABTA 1T6SA 4A3XA 2X6WA 2LNBA 1SG3A 4YZ5A 3ZYIB 5HLHA 1GXPA 4Q0VA 1FP2A 4Y33A 1GWKA 2ZHMA 4RGKA 4XW3A 2X1EA 3TEWA 3WW4A 1NCRA 2E2JJ 5IWFA 5FD6A 3CJIA 4DIQA 3F22A 4QM9A 1SFYA 3LSJA 2IS1A 4BQ4A 3POIA 2JQ7A 4Y1UA 2HWD2 2B7YA 2L9RA 4F92B 2OKXA 2JDPA 3HT2A 3TBIA 3AKZA 2SLIA 4FTSA 3MIFA 2Q4SA 3LAJA 1MH3A 2V1UA 3ZN6B 4WXDA 4MQ9F 1JU3A 3VKOA 3BROA 3WTZA 2L2OA 1QXPA 3F2ZA 1FWZA 4P00B 3EJKA 2VNGA 4W1UA 2ZGTA 4AFCA 4QHBA 3KEOA 4IPAA 5CB7A 1MQTA 3DP7A 2W1WA 4C1XA 4LA2A 3EO6A 4IE5A 4W4ZA 1S8NA 1ULCA 4AWXB 4K21A 4A2UA 1ND3B 3D4KA 3OG2A 3IP4B 5FFZA 1Z7S1 4WVVA 2XAHA 3W21A 1WCUA 3V42A 2RGVA 1IW7F 5HCHA 4COYA 3ZN1A 3NEUA 1AXZA 3I3BA 3SDGA 3JSPA 3S1RJ 4OAYA 3ZFEA 4ES8A 2JG8B 2P17A 4R79A 2BW3A 3TOJA 2UZKA 1ZYRF 3HOXJ 5D8AB 3MCZA 4EZ4A 1VB2A 1D4VB 3WNKA 4HT1T 2L7FP 2H94A 4NB5A 2VNOA 3VDDB 3MHZA 2O7OA 4U7BA 4B4CA 5LGUA 2BOLA 5FZ6A 3WT3A 1X4PA 1UU4A 3LA3A 3K69A 3MV11 4PJ0C 3E7LA 4IGPA 1RVF2 4L5IA 2JDYA 1YFUA 3OBTA 3A02A 4FCAA 1CGPA 2HQAA 1OFNA 1K78A 4OUSA 4LB6B 3GZ5A 1R081 2STWA 3HRUA 1ZZ6A 5FLXK 4NJ4A 5C8CA 2CYYA 1FNNA 5CVUA 3G7DA 3CCQI 4LD5A 3SHRA 4PI2A 4QXBA 3X29B 4IHWA 4E4ZA 3U11A 2X05A 3VBSA 5F6FA 2CGPA 5J8FA 5FZOB 2VQTA 1WD4A 5LBBA 2Y0MA 1TNFA 2ATFA 2QKLB 4BHBA 1YJWI 3ZXKA 2CWMA 3M2MA 3IM0A 4HX8A 1QDCA 3WUCA 2VNRA 5F3IA 3QRFF 1E2XA 3HD8B 1PM7A 2VOVA 2WV1A 2Y2ZA 2W3JA 4Q4X3 1LDKB 4XFGA 1Z1DA 4XFHA 1LTEA 4MG2A 2R5YA 2R7QA 2DDBA 2YYOA 5T55A 1FOXA 2AYHA 4Q29A 2ZGQA 4A5NA 1AKHA 1FTTA 2GXBA 3CLQA 2YB7A 2Y6KA 5F2SA 2YS9A 4CDQA 2Y6JA 2FQ3A 3RJPA 1LCLA 2ZFWA 2VBPA 2YU2A 3IDEA 4RAZA 2KPMA 1OCRH 1W8NA 3DCFA 3WNPA 3DBHB 5IT9Z 4AUXA 4OIQF 4QX2A 2BW8A 3LIHA 5LWBA 5F0FA 3T09A 1H8VA 1OFCX 1XC6A 4FPLA 2VW2A 3PUHA 5BNPB 4YM3A 3MLKA 3X2QH 4XJUA 1XN7A 4IOCF 1O3QA 1OVPA 4DQAA 2KL4A 2HWC2 2HWF1 1HRI3 4M3GA 5L73A 3KV4A 1YRNB 5CFDC 1BOBA 3WP5A 1EV12 1G9FA 4RFRB 5HDKA 3O14A 2KDOA 1PVC3 2JD9A 1YUDA 3UKVA 5CKMA 1J3RA 2R072 4KWJA 3S7IA 3NRVA 4IE7A 4IEYA 3MZYA 3BY6A 5FZMA 1BK0A 5FZDA 4AVBA 3ZN6A 3BTCA 5K5OA 2WAAA 1L7LA 3FXOA 1H8TB 1U5TC 1RUC3 4HKOA 4WVMB 3URFA 4HYEA 4YZ3A 4XYXA 3HQUA 3DU6A 2NVQJ 2W25A 3LSIA 5HCBA 3SYTA 1QQP1 1Q8VA 5E3MA 3GTLJ 2E36A 3RTRA 3ZSMA 5J7MA 5F64A 3ELKA 3CTAA 1ND3A 4L9VA 4AHXA 4QX3A 5GAEJ 4RAFA 3JRGA 2JDHA 3THCA 1VBD3 2PHWA 2XAQA 3GFIA 4N4OB 2IGNA 2MSYA 3AZYA 5BNNB 3MKLA 2PFWA 4IF4A 4Y5SA 3HNMA 2D3RA 5J09A 2WN2A 4GH4C 2JG8A 4RS8A 4LE3A 1NXMA 3LFMA 4M3EA 4H3WA 2HU9A 5D8AA 5APAA 2CL2A 2X9DA 1JUPA 1HW5A 3VDDA 5HLIA 2Y26A 1JZ2A 1DQ1A 1TLHB 3CMMA 3U07A 1RHI3 3PUFA 1EP0A 2OZ6A 2D5VA 4AE2A 1OD5A 2ZOEB 4GYGA 4D7SA 5DUKA 4HXCA 3TW6A 1V54H 5KNLA 4Q8LA 2ZKNA 4A7ZA 1Q8SA 1K5MB 4COZA 3ULQB 1F5TA 3IC7A 1S2BA 1S7EA 4GKXA 5EPAA 2CU7A 2QSFX 1T0FC 3DEMA 1A31A 5F6LB 3PQKA 3BPZA 3T5XA 3MKZA 3G6JB 1YFWA 3WODF 1AR61 3INAA 2PMWB 2Z5WA 1DPRA 2HEOA 4IHTA 2O0OA 4YIIA 2XHNA 1YNAA 2NVTJ 5J37A 2EIDA 2FDFA 4M3FA 5FZOA 5CG8A 5FYVA 4LB5A 1UZWA 1JYIA 4LGWA 3PQJA 4IETA 2P2KA 4KBBA 5FPXA 4IV3B 1F43A 4XURA 5EV7A 1T33A 5IOYA 5K5RA 2VODA 3DXUA 3I3EA 3A7QA 2Y34A 4Q4Y1 2LSOA 4UI9L 4A0XA 3ABKH 1LOAA 3PUAA 4ZJZA 2ECBA 4ISRA 3IB3A 5IT9K 1RUOA 3DYMA 2R1BA 1FYLA 5B4XA 3KP2A 4HK9A 3OOPA 4ZHNA 2W48A 2LS6A 1OT5A 3GZEA 2RVAA 4XLFA 2NXNB 4JTNA 4JTOA 1GVJA 2GNBA 4R9CA 1D2SA 2GC1A 5D8KB 3GLXA 1MBKA 3HOSA 1EPZA 1RIRA 1GOFA 3TEYA 2DFFA 1NH3A 3K70C 3HEIA 1W99A 2ZMEC 1O5UA 2HWD3 4YG0A 4OMDA 3ZOIA 1IHMA 2CMPA 4BQNA 1KYWA 1S6LA 1YW8A 5DAVA 2NVXJ 2G9ZA 1O4ZA 3WQ1A 2L3DA 1FYUA 4QXCA 5BNPA 2O8OA 1Y3TA 2CWEA 1G8WA 4BAYA 3AYEA 3PM1A 2PFBA 2GMMA 4RD7A 1YRNA 1REPC 1JYNA 4IV1C 3K4LA 4KN4X 1MD0A 5FOJB 1NHAA 5FV3A 3L2RA 4A3GJ 4YZ1A 3VZJA 4KNCA 2VIXA 2C1FA 4LO6B 4HONA 2Y30A 1KJLA 1SMTA 2ZJPF 2O8XA 4EGYA 1RNLA 4RN5A 2EXJA 2VC9A 4XKWA 1H8TA 1J3PA 4EM0B 1O3RA 3WG2A 2TNFA 4ZZLA 2EXHA 4WVMA 1FEXA 4YSFA 5A6ZA 5HS9A 5FJKA 3I0TA 3SJMA 2ZGRA 4CP0A 2GC2A 5J3UA 5CA6A 5FRNA 2ADDA 3TQNA 4ZZ8A 3BR6A 1LOEA 2JK3A 3GYHX 2R042 1V55H 2DBIA 5DG2A 1WH5A 1VRH2 1RVF3 1JZ3A 1S7OA 1R23A 2BPA2 1IXRC 1JHNA 5BNNA 1PGSA 1EAH1 3NARA 5C7GA 5T5PA 2O8KA 4LO7A 4ENMA 4NN0A 2ZXHA 5J6XA 2CFXA 4HL0A 4PJYA 4BHCA 4ABZA 2DA1A 5DM6F 1DGRA 4EMSA 2R7DA 1DZTA 4GWNA 5IYBJ 5HODA 2ERFA 1YQAA 3RI8A 2C0ZA 2QDNA 3HGGA 1O57A 1A5JA 4CICA 4BQQA 4ZU5A 3ZYRA 1K5MA 2R30A 2J1RA 2RDSA 3AMMA 4DQ2A 3V8LA 5H6QA 4YRDA 5IJRA 2FJ1A 3EQEA 1BW6A 1ZG5A 4MSVA 1G6NA 1LULA 2KKOA 4V2VA 2QUFA 4AI9A 1UCXA 1Z7LA 4Z92B 4C2MJ 5E17F 1YI9A 4G7OF 4XJZA 4HSTA 3ES1A 3QCWA 1QOSA 2DVAA 1JHHA 4AW7A 3OYKA 3SEPA 5BQTA 1QJX1 5EP9A 3PVEA 4ZC3A 4AHYA 4HNVA 1PUFB 4NPMA 2M7AA 2UUZA 1AWCA 4IV3A 2R7OA 3U37A 3E1F1 5EQUA 2WT1A 4BJ0A 3D1NI 1QH7A 2KXLA 3I4NJ 2JXAA 4L97A 4YW1A 3IZOA 4GQ7A 1F31A 3WTYC 2D3PA 3AP9A 4DXRA 3V7RA 3RI9A 1BIBA 1V6IA 5A6QA 4ON0A 3JXSA 2GIVA 4JHZA 1QQP2 4BQ3A 1SHWB 3NNGA 2D6NA 5I8SA 4D0PA 4Y15A 1EV13 3BUCA 4RL7A 4A3DJ 5C3RA 1CJDA 1Z9CA 3OBAA 3B69A 2L7KA 5FY1A 4Y4YA 1X8EA 2R073 1UWWA 1KU2A 3N9OA 3MKWB 1X33A 1BVVA 5FMBA 5H9SA 2PBIA 3L2HA 5EJ1B 1XE8A 3ZX7A 2YFUA 1RKWA 1VF9A 4CE8A 5FKLA 2VC0A 1GV9A 2WB1A 3ZN5A 2DN0A 5C5UA 1VLNA 3BPVA 4ANJA 1YQ2A 5FRAA 3IDAA 2HYXA 3KP5A 4OUMA 1TWFJ 1GR3A 3I2DA 4LUKA 1PVXA 2NOJB 4YG2F 2EXKA 3B01A 1RUE1 1KONA 1X19A 1DDLA 2OUJA 3WG1A 5CQEA 3LOBA 2XVKA 2L4AA 1D1CA 1MH4A 5FPVA 1FY7A 2DDUA 3IIAA 2XVLA 5ICCA 3GM8A 5DAWA 2P7VB 4JGZB 4O7XA 1UIJA 2FDGA 3OBZA 2MEV1 2R3SA 2B63J 4YVSB 2ETEA 1A3KA 2XAUA 3LA2A 4LKSA 5FGMA 3RKYA 4A3EJ 5C4WC 4KU8A 1LHNA 4FE4A 4K3UA 3QP6A 2OIIA 3KB5A 4ZDPA 4KI5M 3FK7A 2PMUA 3R0JA 3QPHA 3I7DA 1V9U2 4GZ9A 3ZYHA 1UYZA 1K79A 1E3OC 2MA3A 4QKNA 2WFF2 1OUSA 2H27A 2NP0A 3GFJA 5A3LA 1YIPA 4M3CF 1N3PA 2WIIB 4P9UA 4GDFA 3LZZA 1R1VA 2JUGA 2P37A 3IBMA 1H6XA 3WNMA 5ACA2 1D0HA 3M8JA 4L0YB 2Y69H 3AMPA 2O9LA 4NNJA 1QNWA 1NQJA 3H1MA 1IXCA 2KDZA 3RPUA 3HPHA 2H0VA 2IA2A 5LGTA 1C8M1 4O3MA 3LWFA 1J58A 3OPZA 2UYBA 4A3IJ 2ZGPA 3FXQA 3KT1A 1FBQA 2E1CA 1RUD3 1Y7BA 4YFZA 1S0EA 2L02A 5CKQA 5J3LA 1SDDB 4GB33 1BA5A 1W39A 3OD4A 3P6BA 1TC3C 2Y6LA 5FDBA 2DFHA 4LIVA 4NQWB 3NVCA 4BISA 3W5MA 4LA3A 3CCLI 1OR7C 2ZGOA 3PVNA 3NSTA 1JUMA 4RGAA 2XBO2 3M1HA 2VZVA 4JBAA 5A7NA 3ZXGA 4AK3A 3ZFGB 5FO8B 1W9WA 4I0BA 2C9AA 2EV0A 1RPWA 3AVRA 5HV0A 4MHUA 4NHJA 1S0IA 2XQXA 4GFBA 3UT0A 1SACA 2NVYJ 5LFAA 5C9AC 5BNOC 3ZR8X 4RM2A 2GLOA 5I8YA 3WG3A 3BG3A 3F6OA 2F48A 1YJKA 2DTWA 4ZYDA 4F55A 2ZX3A 1PUFA 2MC3A 1ND2B 2E2HJ 3CNAA 3D3AA 3TO9A 4BE1A 4RQPC 1BC7C 5FRMA 1D2QA 4BYYA 4LTAA 3BR1A 4LMYA 1IKPA 2HBUA 5FBJA 1D1AA 1HW1A 3BIWE 1OLMA 3JBG3 5CPRB 2P81A 4LHLA 5IVJA 3PDQA 3VBRC 1ETQA 1ZN2A 5J1RA 1IQDC 1YQ8A 1UX7A 1V5FA 3GZAA 1D7PM 5JXJA 5E89A 2MHFA 3PVOA 1N47A 1G3SA 1MDMB 1E5SA 3OYCA 2VW1A 4JYKA 2JKXA 3OY8B 1GZWB 4XICA 1J09A 3GTJJ 4D94A 1OF4A 1QJFA 2BYVE 2DK5A 4UAPA 1MSFC 3WU1B 1TW3A 2L9VA 1VQPI 2IXSA 1PP8F 1TQPA 2Q30A 5FLMJ 2WNVB 2RNGA 2FRHA 2VBXA 1JXSA 3RFRA 5TRDA 1D5YA 2FMDA 3CJRB 2ZBKA 2DUQA 4GJYA 1WMXA 4UB6C 4YM2A 4QB2A 4TSVA 1W8OA 1BVP1 1MBGA 4X1EA 2H09A 5J4VA 2XJRA 2VL8A 4ZYEA 4BLIA 3WUDA 4CYDA 5GLTA 5FYIA 4R8HA 5H9RA 2VXRA 2OA2A 3N35A 3OV8A 2OD5A 3GZTB 1RUG2 4LBJA 4JX5A 5AVPA 5IVEA 5BS6A 2VPVA 3T4HB 2R043 1EA3A 1I5PA 4JGZA 4RS5C 1VRH3 2VASA 5EDNA 4I09A 4CHUA 2F5VA 4B7KA 4XLPF 4YVSA 2D44A 2VCMA 4LITA 5A7SA 1VFCA 1PGL1 4YIFA 5M3MJ 5L9VA 3NNJA 2B46X 1RC9A 2HQNA 5J1UA 4BJ6C 1T6BX 4NHMA 1F4KA 5H20A 3S3NA 1VBC2 4YEJA 2OYZA 2VXJA 2PJRB 4DBRA 1G2HA 4XONA 3BU7A 1HV0A 4AGGA 1O59A 1GZ9A 5LK5A 2ZJQF 4FHTA 2EA4A 1LHUA 5A3WA 4EM1A 2Y0SA 3IWFA 4XRFA 5DAXA 3PSFA 4NC6A 2FHRA 4MEYF 4P9IA 2QVOA 3K4JA 4GWJA 5GPCA 1COV1 2GH2A 5IVFA 3RNSA 5D5UB 3T30A 2BEOA 3FMSA 1FNYA 1R1UA 4NROA 2M0MA 4E7IA 1A8DA 4ETSA 3J7ZI 2VQAA 2XGEA 4MGQA 3UYJA 3EUHC 3VKNA 1HRV1 4WXCA 2JB4A 1XCVA 4OFGA 5M5YJ 4HANA 2XAFA 3P5BA 4YM1A 5JOYA 2JDNA 1W8WA 5GZFA 1CAUB 4NQWA 3JSOA 1AYM1 4IRIA 4F3QA 5K8SA 2W47A 3HHGA 4RDUA 1DQUA 2PHRA 2QDRA 4FQ4A 5EYXA 3ZFGA 4R9DA 1XMXA 4BDYA 4I99C 3AYCA 2OPTA 4GGGA 2VPLA 2CQNA 2LW8A 3I9V2 1IZ3A 2IUWA 1J1TA 3T1MA 1K7AA 3MPBA 3G1LA 3WQ7A 2HI3A 3VYSB 3VFZA 1IRXA 4PJJA 1ND2A 1LOGA 3QACA 3OL3A 3GTPJ 5E1ZB 4FBFA 5IY5H 2K86A 4JX6A 3CP2A 1XYOA 3ELNA 2XJTA 3BOWA 1JGSA 3WCSA 4ORFA 4KT6A 5FMOL 2VMIA 5JIAA 1H2LA 3MF6A 3VHRA 2P3IA 2ADUA 5ED4A 1IUFA 3C7OA 1VQ7I 4EJOA 1CAXB 1AL22 2FNPA 2VKVA 3LD8A 3MIBA 3C2BA 3GTKJ 1MDMA 3IH3A 3OY8A 2CDPA 1GZWA 1FATA 2BVBA 3ABZA 3TP3A 2VUJA 2YZ4A 1RUH1 5IW0A 3SEEA 2J7MA 3BZCA 1H8AC 3W2WA 2Z3YA 1QJY2 3KGLA 1QOOA 1FMD1 1NA1C 2NMNA 3RYPA 2WNVA 1JODA 4LBKA 1QVUA 1XMAA 1QEXA 3FFZA 2A1XA 2V4AA 3PJRA 2QJVA 1T56A 5FY5A 5F8PA 4QT6A 1MS3A 2Z4FA 1D0ZA 5L3BA 2A71A 3LDRA 4GCVA 2F5FA 4M74A 2GXAA 3T1LA 4WVZA 4XCBA 2IXKA 2HWB2 1QPMA 1V9U3 5FKCA 2WZR2 1MNEA 4DXTA 3VD9A 5FCCA 2WFF3 1C1LA 2HKOA 4AI8A 3MGUA 4JX0A 4CO8A 3F0CA 3BTJA 2ZX2A 1P8JA 1AJKA 1R1A2 3J80K 1OPOA 1QVTA 2CSOA 4AHZA 2AGSA 1LU2A 2QGUA 3FLTA 5ACA3 2MC4A 2LALA 3OGVA 2VTXJ 3LB9A 3OYBA 4Q4W2 3R4DB 5E1XA 2VZUA 1T08B 3LSTA 2P6CA 3S2HJ 1YIFA 3IV5A 1G3TA 3KM5A 3RQ4A 3FXMA 3JD71 2PJRA 2EJRA 4XSXF 5FLHA 2ZC2A 4ZH4F 3CZUA 1U8RA 1AXYA 5A70A 4XZUG 3RKXA 2QTWB 3K4AA 1JH5A 4CCLA 4RHV2 1GP5A 4PCQA 5CYYA 1C5IA 2ICWG 3LGRA 1RL3A 5AFBA 1NK3P 1W0UA 3VKFC 4YW5A 2VXZA 2WADA 2XBO3 5L3DA 5JLWA 3BTZA 1ULYA 4JP0A 3DBRB 1H0MA 4I0WB 1MJBA 2XV4S 3W6VA 1NY72 2OTJI 3T0YA 1W5TA 4CDGA 5K7HA 1XOYA 4QDSA 1K83J 3EETA 5KAFC 1W2OA 5EIYB 3D0SA 3TO7A 1HXS1 5GZGA 3IAS2 4BQ5A 1JS9A 1ONVA 2QCSB 4BK5A 2F6CA 2KP6A 1S0DA 3OF1A 3BR3A 2I07B 3CO6C 4BL0B 1CAUA 4U0VA 4XNFA 3H7JA 2EINH 1JT0A 1JKOC 1WW6A 4BQXA 4XQWA 1YTYA 2H6BA 1QXJA 4JKMA 3S16J 3J8F2 2VCCA 5CZKA 2KQRA 1G3YA 3J4UH 5IVCA 4BIFA 1FX7A 2BVVA 3O1RA 5IYDJ 3ZPLA 1L3JA 3LL7A 2D45A 3I2HA 1QF3A 4PSWA 3OSDA 4GMP3 2FBKA 1E3HA 2X1CA 5F5QA 5JXGA 2PLYA 4HOOA 3TBDA 1D4M2 3ZQ7A 1ONAA 2FXAA 2L9NA 2K9NA 4BK4A 4BZ4A 1GV2A 3KMHA 3S0MA 1X1BA 1YFHA 4J25A 5A32B 4DUXA 2K40A 1C5HA 3IN9A 2F5CA 1R6RA 5EJCA 2BQPA 4AYBN 5G05L 4AEDC 3ZFFB 3VSKA 4AAPA 2ME0A 2D3SA 3N9MA 4EGZA 3CZ6A 3F72A 4A3ZA 4UWDA 2J1SA 2YHJA 4H7MA 1SLCA 1AA7A 3S1MJ 1YC61 1VBA1 5F7UA 2LRPA 1P9QC 1CAXA 5EZGA 1CESA 2V72A 2VCAA 1AYN2 2ZFUA 3CC7I 1E5HA 5HLGA 5B4NA 5EEHA 1W36D 1WA4A 1C57A 1DQ5A 2QVSB 1AR81 2WZPP 2LVSA 2XG3A 5KC5A 1RUG3 5EZWA 4XIDA 4G6TB 4IEOA 1HB2A 2P5VA 4DINB 2YC2A 1PDNC 1Q5OA 1O91A 2NYYA 3R4SA 4ZS2A 3CD6I 4AAXA 1H4GA 2K46A 3POGA 3ZQHA 2XF5A 1ZLKA 3BQYA 2BZDA 4DB5A 1OKOA 3AZXA 3WW2A 1WZXA 4RGUA 3H9JA 3K2OA 4CXFA 1S0CA 1JMUB 2P7CB 1U9NA 3GCXA 5CYVA 1KQRA 4JDNA 1LHWA 5JOWA 3TRSB 4XZPA 4FFGA 1MIJA 3DKQA 1Z05A 3KP6A 3FMQA 4WM7B 5FKBA 1C3HA 2MABA 2H6CA 1JZ8A 2X85A 1UMQA 3H5NA 1FJLA 2YXSA 3AKPA 3I3QA 1Z6TA 1ZRDA 2H8RA 1LGCA 4TZDA 3K4BA 1WJ5A 1QNYA 2QQIA 1JXNA 1GVDA 3KT4A 3Q8EA 2EIJH 1WPKA 2J42A 4ESFA 3SH5A 2YGLA 1VBE2 4B4RA 5M0TA 3ZXSA 1CZVA 1F8VA 3LCPA 4KT5C 2D43A 3FC0A 3HOBA 1WCKA 1IOAA 3DPLC 5LHHA 2VT3A 4XHXA 4CZZA 4AIHA 3WU0A 3NKGA 3JW4A 1X8MA 3ZSJA 1QJEA 3LSRA 2RDNA 1LR5A 2E26A 4MX3A 2NPIA 4QGNA 1O4TA 3S30A 3ZPOA 1YX5A 1PYVA 3LEIA 4MTDA 1I50J 4XOTA 3ABUA 4Z6YA 3DYOA 3IHUA 2DYSH 2DA4A 2IA1A 4XEZA 1FPN3 3ZKUA 4C2UA 3GTGJ 1YS7A 3ZO0B 5A3NA 4HQEA 5J47A 1X3ZB 2I5UA 5KXCA 2ZO4A 3WG9A 5BPDA 5C6CA 2ZAAA 2GNMA 2R7FA 2VMCA 2W46A 4GWIA 3GYDA 3LIGA 1WJAA 2DA7A 3GF2A 4PCRA 2JT1A 2G7UA 2XIGA 3T2OA 4I02A 1M1EB 2ID6A 3KP4A 1LFPA 4NPLA 4XE9A 4KIFA 5F27A 3LSHA 5F9TA 3HN1A 4URTA 3AMQA 2GIZA 4BIOA 4TLFA 1DBNA 3AG4H 5HNFA 4EJRA 3N9LA 2E34A 2ZGUA 3H42B 2RC4A 1AL23 2YFZA 2JSCA 4H14A 2GOMA 1PMHX 2RJLA 1U0AA 1FOD1 1SLLA 4JGYB 2HKXA 3I2OA 1S0BA 2VQHA 2W52A 1KS5A 2X4HA 3TNPB 5A3UA 3HNYM 2FDKA 1OKQA 5AC91 5A32A 4P96A 1WJCA 4QX0A 2E7XA 4NIGA 5HXVA 2XVGA 1QJY3 1U0JA 1F9NA 2IXIA 4MIMA 4LIUA 1ASJ2 3DN7A 5FFOC 2HXIA 2JWPA 2WAFA 3ZFFA 2RKHA 5KBFA 1BL0A 2XHKA 1W8TA 2M30A 3QAHA 2RM21 1H4HA 5FYCA 1CONA 3K48A 5A1AA 3HOTA 1ZBE1 3TN91 1ZGAA 3VV1A 2G7HA 3E0JB 2HWB3 2G9GA 1TQIA 5L9RA 2QWWA 1E5IA 2WZR3 5L7OC 5F32A 4UOJA 2EFPA 2E63A 2ZJCA 2M45A 2R062 1R1A3 4OHVA 2Y75A 1X3UA 3GXUA 2ENRA 3EQLF 1UYYA 4CSWA 3ZXEA 5KHDA 5FP3A 4XBNA 1LDDA 1CN1A 3C2GA 2VBYA 3IL2A 3LNQA 2XVCA 3I54A 1EJ9A 4Q4W3 1XDUA 3OYHA 2EIMH 3UJOA 1MACA 5E3LA 3AFHA 2W24A 1SC7A 4M6XA 1W28A 4IEXA 5FJHA 2V9KA 1FMVA 3C3VA 2EFQA 1O7FA 1GZCA 5CFCC 3SDBA 4FE7A 4UT5A 2VE9A 3KLSA 5AONA 4XHBA 4WM7A 2ZX0A 1N1YA 3K9TA 1RUI3 1J3QA 3WV6A 2O3FA 4S2FA 4RHV3 4B44A 1F2NA 1ODMA 1UQXA 2YGMA 1XC5A 3LSGA 3WP4A 4QQ2A 1D3YA 2EFOA 3O7OA 3BTAA 4XRSA 4CDUB 1FOKA 2HTJA 4UVBA 2FCTA 2FU4A 1PGW1 3LSKA 4HPQA 2BHYA 1R092 2WKKA 5CG9A 3CCSI 3USSA 4D7TA 5D8LB 4CH7A 2CHHA 4CA0A 3PJYA 2QFEA 2M34A 4Q4V2 3QU6A 1MBFA 3H1CA 1MZEA 3K51A 4KYWA 3QLQA 1SDWA 1T2XA 1K4TA 2WUHA 4HF2A 1TMF3 4QD2A 3J8F3 5CKTA 3WHCA 4BE2A 1VQ6I 4Q0SA 3ME2A 3AMNA 3C3WA 5LA9A 2ZGLA 2LKXA 1MS0A 4FPKA 1ETKA 1DYOA 3TB0A 1QA6A 3Q9OA 5F1RA 1YYVA 2XROA 2E33A 3HDDA 2GDFA 1PHMA 1PUEE 4FP3A 1YQ5A 1TTYA 5DG1A 4TLGA 1UO9A 3OY9A 3WHTA 1BOAA 4NHLA 1UY2A 4Y1ZA 4XRMA 5JLXA 3Q8CA 4PGGA 1D4M3 1OURA 4FETA 2ZGNA 2NNNA 4PGHA 3RZDJ 1V00A 2L4MA 1ACIA 2D93A 4MOAA 2G19A 3LDKA 2Q8OA 1NCRC 3W2VA 1BM9A 3VDBA 3CJIC 5FUPA 3FBMA 2L5QA 3A0NA 5LY1A 1BJQA 3H3LA 4CCMA 4BXSV 3I2IA 1H9PA 4P5YA 4OHYA 3POFA 3OOXA 1LEAA 4IE0A 1JYWA 3ISPA 4UFKA 3PSIA 4LBNA 2Q8KA 3VL8A 4A41A 2VVEA 2JEMA 3FXUA 1AYN3 1W7PB 3LOIA 4JGYA 4O5VA 4WF2A 2VMHA 1ON2A 1AL0G 2ORXA 2YBPA 3S7EA 2DUPA 2VM9A 4M01A 3S93A 4LXLA 5B3SH 2BGOA 3I5UA 4YW7A 1XSVA 5FD5A 2Y48A 4U0WA 5E3NA 5KHGA 2FMLA 1MQTC 1WCDJ 2W5FA 1J0RA 2PHUA 4YARA 2M87A 2EWNA 5D4SA 4ZKTB 2M4GA 5LK7B 1SBDA 2Q0AA 5CVVA 1MSEC 3KE2A 2RMU2 2OV7A 4ATEA 4DYRA 3RCOA 5GLZA 2EZLA 2ZMKA 3ECHA 5JWPA 4XQ4A 3LE0A 4ZU7A 3VYTB 4RB3C 3GEZA 4XTMA 5JIUA 4C90A 3M3EA 1GUIA 2QYOA 4IRGA 1CVNA 3ZFEC 2R7WA 4RSUA 2E7AA 3TNQA 3OIOA 4IVNA 3A1YA 2HEVF 2D97A 3RZKA 4XILA 5FB2A 2CUZA 2ESHA 3E6CC 1ZGJA 5DAQA 2XPWA 4KWKA 5FYMA 1HQWA 5AVAA 4I01A 1KZHA 1OBNA 1OCPA 4ATFA 3PNYA 3S8PA 3K4MA 4QU2A 2V73A 2IW5A 2WC2A 1DGLA 2ECCA 4KISA 3ZYPA 1OFSA 2A70A 3E97A 5FKOA 3RQ0A 3BODA 1OUXA 4A3JJ 4Y20B 1IXSB 2LK2A 4NAMA 3RMXA 4DFSA 2DODA 2JECA 1X9TA 3RWNA 4EJVA 1R4MB 3NAUA 3T2TA 3PMEA 1ZHFA 4J1XA 5C8CC 4XDPA 1HDDC 1NE4A 3J7MA 4CDUA 4RLFA 5DZFA 2A3XA 4FPCA 4JKKA 3WDVA 2QQAA 4F7ZA 3L2WA 3VBSC 3ZXDA 1DP7P 2ID4A 1YOVB 2VZTA 4FISA 4YFKF 1NLRA 2ZZJA 4LHNA 2BTVC 3I2FA 2IPQX 5DYMA 2D6KA 4HETA 5EG0B 4JDMA 1Q43A 4FVVA 1B8IB 3D5OA 2Z42A 1QU0A 2M9HA 4O9GA 2X6XA 1Z3YA 3P1IA 4BDVB 4AL9A 1KYZA 3V56A 3H0GJ 3K2ZA 3OCPA 4RB2C 4NHXA 3MZHA 2WNEA 4EJTA 4U7DA 5A80A 2VJ4A 4DUWA 2JZYA 1UAIA 3GBGA 2NZ9A 3MLJA 2ELJA 2IS2A 4CCDA 1A34A 1UKGA 4Y1XA 1WLDA 2XKOA 4CDQC 1PZ7A 3KS7A 4CXYA 1ETVA 1DLCA 3C1DA 3V0BB 1OISA 5FYUA 5J8CA 2QNKA 3TL4X 1JJ8C 4Q4X1 2DOEA 4IGOA 3H8XA 1EV7A 3MW4A 3GFLA 4XBLA 1USTA 3FK6A 3AZWA 5GLUA 1KU3A 4GULA 3FMRA 5GTHC 1ASJ3 4AGRA 4E4DX 4G4FA 1UMIA 3PNVA 4QSHA 4WV8A 5CQGA 4E7SA 2FDJA 3AKQA 3LMMA 3C7FA 5D2AA 1NXD1 3EHKA 3ZIXA 4GA9A 1W7PA 1SQ4A 3MIGA 3T2PA 4AQ2A 4P5OA 1RKTA 1W0NA 2NMOA 4UW5A 1JYXA 4UUVA 1RR7A 2QQPA 4UF0B 3KVAA 1CF7B 3Q8FA 4KDPA 1WA6X 4HVQA 3FKJA 2NQYA 1D8JA 1HRI1 4UBGA 2R063 1DGWX 2HOEA 2WWJA 2KLOA 2Z9OA 3TEXA 2P1BA 3CUQC 1UYPA 2HOAA 3MIEA 1M06G 4UVAA 1PVC1 4Y22B 4BXFA 1ND3C 1Y9GA 3NJVA 3GUDA 5DV5A 2J1UA 3N7MA 4ZXKA 2AXLA 2JA5J 2DXIA 3BN6A 2IFWA 4XOPA 4AD9A 2ZXIA 5FYBA 3LSEA 2ZMEB 1RUC1 5DXDA 4FPFA 1W2UA 1FSEA 3BR5A 3A03A 4OMZA 2ZCWA 1GWLA 1DQ6A 2VY0A 3BJAA 2HDDA 2JG8C 2N8GA 3R4KA 4LULA 3CF5F 1R49A 5BXXA 2Z5UA 4FQGA 4L5JA 5D8AC 2WO7A 1SVLA 4D3WA 4IHSA 2Y64A 3VEPA 4QX1A 2KR2A 1O3TA 1W05A 1QXRA 1X4OA 3LSMA 1OYIA 4RM3A 3VDDC 2P5KA 2FE3A 2QQJA 3BG9A 3OS1A 4XF4A 2JRMA 2E9QA 4COVA 4ZTJA 3MFAA 3NV2A 2BBAA 1F36A 1F5JA 1VALA 1VBD1 1GV5A 2VPRA 3ZMDA 2PAMA 4U36A 2OX0A 1W3VA 2XLFA 2QF7A 1BBT2 4DOZA 2Y0OA 1X50A 1GBGA 3QH6A 3ZMNA 4PJMA 2D6LX 4KN7X 1W6QB 4IEZA 4Q4V3 4Y20A 5FP8A 1JZ5A 4O65A 3OGRA 3B6CA 3B93A 1JYCA 2R32A 3SXYA 2IVMA 1WCSA 4Z8BA 1K6OA 1XNAA 5ICFA 4AG4A 4A45A 3H8OA 2P34A 4OMCA 1RHI1 2IXJA 2P3YA 3ETQA 5FXXA 2YX7A 3CESA 2W9XA 4QPWA 4Y26A 4DW6A 3TGNA 4PK4A 5FY9A 1C8NA 4H7LA 2WJSA 2HH9A 3K3OA 5EG0A 3THDA 2I10A 3N97A 3O8GA 4LBMA 2ET1A 3POWA 1B8IA 4MNUA 1UZCA 5EJZB 2AZ5A 2DPUA 3H5AA 3BG6A 3BJOA 3T4VA 1FP1D 3KP7A 4XFBA 4Y3OA 1QWRA 1C0WA 4HV6A 3HTUA 3QODA 3OS0A 3DF0A 5FWJA 3FJSA 4ASNA 2PMZN 3SCFA 5ISLA 2YU9J 4IHVA 1ETYA 3AJYA 4KQ7A 1XSQA 1MS8A 4BNCA 3O0WA 4K9SA 2AC1A 3WD5A 3V0BA 4QHOA 1K3IA 1TG7A 5LW9A 1GSLA 2CDOA 1DZRA 1DFQA 2C6SA 2VECA 3FHIB 2FD8A 1P2FA 5BNPC 3JTGA 3N7LA 1I1SA 2DOAA 5FOBB 3MN2A 1VMJA 1RINA 5F39A 3BU0A 3GTQJ 3LSDA 5CVJA 5GZCA 5FZLA 5HV4A 4S0HB 1WGPA 2HWD1 4RFT0 4BB3A 4LLLA 5FIXA 2HVRA 1NT0A 3ZR6A 5D5WB 2Q8EA 2RMU3 1SEFA 2JX9A 3VKMA 4LK1F 2YX4A 4UF0A 1H8TC 3ABLH 1CF7A 1OPMA 2JTVA 2O14A 1UYXA 1WW7A 4UXNA 1UHMA 1ZREA 4I7HA 2VBZA 3VBFB 1YE9A 2UWMA 2RNJA 2P3JA 2WYSA 3KEQA 3CL1A 4B8XA 1HKDA 4WWCA 4HW0A 4Y22A 3BDDA 2X48A 2I74A 2ARBA 1YXWA 4XUOA 3NQOA 4IKFA 1QHHD 2A05A 3K4DA 4EN8B 1YQCA 4ZYHA 3C18A 1XS9A 4R1HA 4XDQA 2W08A 3R61A 1G9AA 3KZIC 2E71A 1Y39A 3PHMA 2GP5A 4JKLA 4A6OA 2LFBA 2ZMEA 1USSA 4AFAA 5BNNC 2O03A 1X1AA 4P5HA 1TL8A 3M8FA 4C3HJ 2X1DA 5A3PA 1I3HA 1W9TA 4QGLA 3RRDA 1EH6A 4UUSB 1LECA 2QQWA 1XCBA 5IK7A 1SLAA 4P9WA 2ID3A 2MLGA 1WH7A 2BFUL 4JQFA 1ZZ9A 4AFMA 1W6OB 1FBSA 2VUDA 2ZMLA 2XMLA 4NR1A 5IATA 1ZTRA 4PIZA 4OHXA 3PIOF 2W1SA 2K3FA 4HRIA 4DYQA 1RVF1 4F8AA 3U14A 4FX0A 2VQGA 2JA7J 1K5MC 2VW0A 3RKWA 1VQ9I 3OEBA 2F17A 2RS12 1W6QA 3L2UA 4EROA 1ZLJA 4OOIA 1GU3A 4HPKB 1LOFC 4A69C 1IF1A 5JAXA 1AHDP 2WT0A 3S3OA 3O1MA 4JQTA 1ODNA 1IS3A 1GOGA 4QB6A 4OULA 4AI3A 4BJTA 2WA4A 2HLEA 4RR3B 4DBQA 3JR9A 3BR2A 4I3GA 5CJ9A 5EF6A 3S5QA 2R7SA 5I0DA 1PVEA 3O1SA 1VR3A 2IXHA 3GCMA 2VUCA 3BTIA 5F5CA 1NQDA 3LSPA 2XUBA 4IV3C 4W97A 4XQDA 5JDBA 1D0XA 5ILVA 3EPZA 5JUVA 1XPWA 3K46A 1RMU2 4UW3A 3WG7H 1XPXA 4W65A 3WW1A 2KFDA 4E6KG 1P6RA 3CEWA 3VB9A 1RIOH 1ZGWA 2NNYA 5FMOS 2YBSA 2QCOA 4CCEA 2ELKA 1UHSA 1CAVB 1SMYF 4HOBA 2OCEA 2M3AA 5EZHA 2H0BA 3OYLA 3G4SI 2YU1A 2XAGA 2DF7A 4GKYA 5L3GA 1VBB3 3Q8AA 3H9AA 4NDLA 1N1TA 5C70A 4ITVA 1DLLA 4I3PA 2W39A 2RS52 5JMOA 3TO6A 5IP6A 2JE9A 2PLV2 2X5IB 3WY6A 3VYRB 1RUC2 4QTRA 2ZMNA 1AHSA 1JKPC 4JRLA 3AXDA 2IGKA 3RJ2X 2HWC1 1QDOA 3UK9A 5E1RA 4XM3A 5T50A 1SFNA 5A7PA 2V6CA 2CW0F 2AQEA 4QM8A 5A7WB 2B5HA 4A42A 1EV11 2ACJA 4CEWB 4JV4A 3QYBA 4IEJA 3VB2A 4UHTA 4HSJA 4IHYA 3O1PA 4X8NA 1QQIA 1BI1A 1JI8A 2R071 1JHFA 1NZCA 2UU8A 1VBD2 2CSGA 2WDBA 2OUMA 1OI6A 4N43B 4C0HA 5A2QZ 4QWQA 3DPUA 1GQGA 2ARCA 1BIAA 2RN7A 1IN5A 2XB0X 1VE0A 5FFXA 5E8IA 3S1NJ 4X6AJ 1R58A 3IRQA 3VBFA 2O61A 1UU6A 2JA2A 2P4WA 3WEZA 1VAVA 3SFIA 4ASLA 4A3BJ 4FT8A 1LGBA 3POBA 2UXXA 1NKGA 2XXZA 2ZEZA 3VZOA 2O5RA 4N0BA 2X10A 3VUOA 1ZK8A 4JRAA 1G9CA 5JI7A 4BLJA 3EXUA 2IEKA 3GJBA 3I53A 4DZGA 1XG1A 1BBT3 1OA2A 2LTPA 1UF2C 2IVIB 3M4OJ 3T8RA 1WMDA 1JUSA 2ZEXA 1KU9A 1RUE3 2KT0A 4LG0B 4C3JJ 3RIRA 4PBPA 4UW4A 4UUSA 1G86A 3BVCA 1NOVA 4B48A 1WW5A 1Y8RB 3M8LA 3SQOA 2HWE3 3IRRA 1KFUL 3IAPA 4B3XA 1AR93 3MPPG 1OLQA 2KISA 2PAEA 5FTTC 4QPQA 3WGGA 4CDXB 2M8EA 5CVRA 1DDNA 4IX7A 1LKNA 5B1BH 1SFXA 3M1EA 1WLTA 2RG4A 3T1BA 2RDPA 4BACA 3A4UA 4HLXA 4HPKA 5TISC 2CS3A 5JPNB 4KUMA 4ZZDA 3FDYA 4XTPA 2YMZA 1QJU2 2A68F 1HKSA 3HC7A 1U2WA 3WTTC 3BB6A 5IOZA 1RC6A 4YW4A 1APNA 4GO1A 2E7QA 2GAUA 3SLIA 1JZ4A 1DP3A 4IEVA 4OYUA 4RR3A 1RUD1 1HN0A 3PNTA 4L9BA 4GB31 5HS8A 3HJEA 2FOWA 1CPNA 4QX5A 2JDMA 3GHMA 3ZYFA 1Z78A 2GC3A 5GZEA 4BH9A 3WTWC 4KG0A 2IBDA 3CO7C 4XAEA 4FQZA 3P3PA 5GKAC 3L9JT 3O1OA 5J48A 1R00A 4W50A 1QGLA 5F3GA 4C0BA 1CAVA 5I91A 4YGDA 2C5DA 4Y24A 5FYTA 2JG9B 3CCUI 5SV8A 1G4DA 4Z2YA 5IAXA 2X0LA 4EN6B 2A3SA 4QX7A 1XSDA 1R1ZA 1MS9A 1HKTA 2EA2A 4BPZA 3AG3H 3P5JA 4NIAA 3H1YA 5LBCA 3WDUA 3KD4A 4TXWA 3DEUA 2WZ8A 3MVPA 4YWAA 2CQXA 2X6YA 3FXRA 2X5IA 1B6AA 1PO22 2LF8A 2DBBA 5LLQA 4AHWA 1MBEA 1V3FA 3JBG1 1MS5A 1R5HA 4ZTFA 2ZX4A 3S14J 5FPAA 1S55A 2AHQA 5A7WA 4N4NB 1H2MA 3C2UA 4AZZA 4CEWA 4BQ2A 5HCFA 2DQLA 3H9GA 3I3MA 3RPQA 1IRGA 1QGPA 4BEHB 1W6MB 1N78A 3USUB 1YIJI 4Y4RA 5IFPA 1WGXA 3LPGA 3BCBA 1GUUA 4RYDA 5HXMA 1DP0A 4N43A 2LYCA 1UELB 4JGZC 2D1VA 2PEXA 1ULPA 2FDHA 2EF6A 3ZOBA 1OF3A 1XNKA 4YVSC 2R0HA 1AR72 3VBUB 2Y9YA 2XJPA 3O0XA 4BMEA 4Z2AA 4A0YA 2WV0A 1XNCA 3CQOA 5A33B 2H1KA 4ZY9A 4HBLA 2B7EA 4XQFA 4M72A 3U1DA 1H30A 2HOSA 5FYZA 1FIAA 4M9ZA 3ILFA 1XDSA 2RQQA 5FLJA 3WF1A 3JTHA 1SCRA 1SZBA 3WNLA 2R041 2VJ5A 1XB4A 1Z67A 3BR0A 1CPMA 1VRH1 4IGQA 3DU5A 3B5LB 3WTXC 3SZPA 1HQLA 2RS13 4LG0A 2YC4A 5H6RA 2BV4A 5GALA 4C2TA 1KD7A 3M70A 1Z0HA 3L1PA 2BXYA 3HOYJ 1LGNA 1DU0A 1JYVA 5HI0A 1UOJA 2XPVA 2TUNA 5G04L 4A6DA 1ZM1A 1POQA 1OOPB 3H1WA 1JOJA 4CDXA 5IP7J 2V5YA 3JRDA 1HLVA 4B29A 4HV5A 3AKSA 1RMU3 2QKDA 4KMFA 1V6KA 4G9YA 3U9GA 3RSNA 4UUTA 3PL0A 3ACLA 1UG0A 3ZDVA 3ZFGC 2ZSIB 3HBKA 2DMNA 3ZXFA 1V0AA 2VD7A 5KHHA 1BMV2 1I6XA 5E88A 2QZ8A 5LRRA 1M4WA 4P55A 2YR2A 3VOEA 4HN1A 2QQUA 2M2EA 4D6QA 1Z21A 1S1AA 3NRUA 1ND2C 4OWRB 3PO3J 2KZGA 5JSRA 2RS53 2Z2SB 4LE4A 1IJWC 3CIHA 3DLAA 3CMGA 3RVHA 2PLV3 3RZOJ 3M3YJ 4HVOA 3KHBA 1ULDA 3GWZA 1YHFA 3QPTA 3LAGA 3CCEI 5DCMB 5IYCJ 1AYM3 5GPAA 4QQOA 3T2QA 3RSJA 2DJIA 2ZXJA 3T0AA 1IDYA 3RZZA 1JE8A 2JG9A 1FI2A 5CADA 1Z77A 4O9EA 1AJOA 2CG4A 4ZYAA 1U9OA 1TQMA 2WQ8A 3CP8A 1KQ9A 4BJ5C 1K12A 4U0YA 1UJ8A 1K4SA 3Q0UA 4DYCA 4A7KA 3H3VK 3R05A 3KF5A 5C71A 4NIHA 3J7HA 2JJ7A 5FLVA 1Z6RA 5H9PA 2XLAA 4CU7A 1KDMA 1LVAA 1X7NA 2LLKA 1FOYA 5TJJA 3OR2C 4BXUA 1NX9A 3HKZA 2G1MA 5FXWA 1J59A 2A6EF 1I3AA 2AREA 2B45X 2FEZA 5C3EJ 4BOWA 1W6MA 4BEHA 1E57A 3USUA 5A7OA 5F0HA 1NYWA 2B8MA 2OZUA 2X51A 3KGZA 1UXXX 3QWLA 1U12A 4NHYA 3CF6E 5JR7B 2P3KA 1UN1A 3P3NA 4D0QA 4LPLA 3RQIA 2QBXA 2KHMA 1F9KA 1ZA7A 3BCAA 2HEYF 3K1NA 2K4JA 3PUSA 2JDKA 5LASA 3VBUA 1G3WA 2F4PA 3DLLF 2ZKZA 4B1RA 3WF2A 1O8SA 2ARAA 5A33A 4G8XA 1UOBA 3M3OA 3MO4A 5E8AA 1OLTA 2LTNA 5IP9J 1RUD2 1V9U1 4UV9A 1B35B 3JCIA 2JDAA 3ETPA 4U87A 2WFF1 4XVHA 4II2A 1DQ0A 4FFIA 4MHGA 2DTZA 4GB32 1HJFA 3DPTA 1J5YA 1B59A 4XXAA 4AWDA 1REEA 5FZCA 1U5YA 5JI6A 2HWVA 3O2PE 1F1ZA 4XJWA 4AI0A 3LPFA 4CUBA 1UIKA 5C3QA 3K6GA 3RDIA 2D5FA 5LD2C 5ACA1 4HNUA 3HRTA 3SKJE 4QX8A 1KQ8A 1I39A 3FXJA 4B47A 5DUVA 1KRIA 1QJU3 4BA6A 2I8DA 3W6JB 4FTEA 3VGIA 3NAPB 2XF7A 3FHNA 2W68A 4RB1A 1XQNA 2PX9A 4OINF 1UY3A 1OOPA 1ON1A 1V70A 5C8WA 3PIPF 3F8MA 3A0BC 1EUTA 2DURA 3QH7A 3M8EA 1EYBA 3J7AY 4M0NA 3W3CA 3KP3A 1SPPB 4BE0A 2BUKA 4KFCA 4N7UA 2K5CA 1KA8A 5I0SA 2XBO1 2W92A 1UMZA 3S5AA 2GZWA 3JBG2 4YVWB 1STMA 3CCJI 1VAKA 1SLBA 1UG2A 3HRMA 1SAXA 2Z1DA 3M7AA 4MFDA 4NIDA 3FUQA 3G73A 4WM8C 2LH9A 3WE3A 3KCXA 3AL6A 1Y1VJ 4Q1RA 4XDOA 3PIJA 1TBXA 3V0AB 4NPRA 1CX4A 3COAC 3D5LA 4KGGA 4CDWB 1Q1HA 4HEA2 1LJ9A 1GNYA 4QPGB 2DU9A 1IG3A 4CVUA 1PO23 5FAXA 2E1MB 4E2QA 5FZGA 2BERA 1TME2 1T95A 2R92J 2V1XA 5DCMA 4N90A 3UNGC 5E16A 1WWYA 2DCTA 1QIQA 3TP0A 2E31A 1BQPA 4L9TA 4L2NA 2VZSA 3WR0A 3SZGA 3PUBA 2XH6A 1KDKA 1OQYA 2CH0A 1MJ9A 5FY8A 5F04A 4L5EA 3MI8A 4MZUA 3ZQIA 3FL7A 2OQ6A 1LU1A 1U5XA 2CGNA 3AXEA 3CHXA 5JLVA 4IHXA 3FBNB 1R36A 3O1UA 4QHZA 1TWAJ 2VG9A 4OI2A 5GP9A 4CUCA 2DW4A 2XONA 2WS92 5DDJ2 4Q4ZF 5DCFA 2VQ0A 2CYFA 1T98A 5DM7F 2A6HF 1AR73 4LOCA 1TP4A 1OCTC 3OUIA 4A12A 2ISYA 3AKRA 1Y6IA 4K6BA 3CDIA 4OQ9A 5IT3A 1WWXA 2L9LA 1O4YA 4ZYGA 1RUG1 2EIGA 2JVGA 4F52A 1N1SA 3ASIA 2NS8A 3IWZA 3BCWA 1XYPA 2P5BA 4E7LA 1HXDA 1WFXA 4HVRA 5LA0A 1D1BA 3D6EA 1IDZA 4CXWA 1WUVA 3I97A 4HAMA 3CLOA 4B4PA 2R93J 4TN7A 3LAPA 1ZBA2 1S0GA 3QU3A 3H8UA 2R7UA 2Y6HA 1ZR2A 4NVPA 5ANQA 2DT6A 3VYUB 1KITA 3KPHA 4AYBA 5CIRA 1VBC1 4ZZ5A 4H4KC 1B35A 1UZ0A 3ZXJA 5DUXA 2D6OX 3HMYA 3H50A 2PHDA 4BMBA 2DWRA 4NIIA 3H5RA 2PELA 4XUNA 2K7LA 4G3YC 3U2RA 1WJEA 5J98B 1KQ0A 3ZN4A 3I4IA 3BOPA 2HQRA 2KA3A 3FKIJ 3LEGA 3HSEA 1J75A 4X6QB 3M7GA 3ZMTA 3ZLIA 3NV3A 1OCZH 3IH2A 5LGNA 5LHGA 3HQXA 2X53S 2XC7A 4HNTA 2HR3A 2AH2A 2D6MA 3NAPA 2NS0A 5GJ6A 2V09A 1W9FA 2H1LA 1OYWA 1R5GA 1NG0A 1JYTA 2ES3A 1SD5A 3UKTA 4YLZA 3L2CA 4ESBA 2DI3A 4OCTA 3K1PA 4YW6A 1U5IA 2BXZA 1JU4A 2VBBA 2PN5A 1G9BA 2WFPA 2QQVA 4INDA 2EAAA 3ERMA 1IQAA 1SPPA 3DYPA 4N53B 4ONUA 3WQBA 3R0RA 1MS4A 4A4AA 3GNEA 5CFCB 1LAJA 5KCMA 2MGQA 1RUF2 3IAQA 1Y4WA 1D5VA 3S6PA 1LJ7A 4EV0A 4BS9A 5BNQA 4YVWA 9ANTA 5E8GA 2LKSA 1Z91A 1VMFA 2X09A 4KWUA 1POV3 1SFPA 1S0FA 1W6PB 1JTXA 2CAVA 3KCYA 4KICA 4LBQD 3N9QA 1CJPA 2BVLA 2YPJA 2BBVA 1GQPA 5IUQA 5FPBA 2DMQA 3WTUC 4M73A 2JB8A 1QY4A 3V0AA 1DIWA 3FLPA 1ORKA 3V64A 4CDWA 1OH3A 2J22A 4LLGF 2W1UA 3FX3A 4Y17A 4QPGA 3T0BA 1F35A 3ZMSA 1YYNA 1A6QA 1H0BA 4GJZA 3BTXA 2DCKA 3OGGA 3PUIA 3ZFFC 1H2KA 4BQOA 2R16A 4F93B 4G6DA 2ZABA 3F8NA 2JN6A 1K61A 1Y9QA 1AL21 5J40A 3KHCA 3L2QA 2IS6A 3N4MA 3ROUA 1W3XA 1WZ2A 5FO9B 1TE1B 1VPHA 2YBKA 1S2EA 1QJY1 2DVDA 3RG0A 3ECOA 1QHDA 2YU3A 1FOD3 1W1WE 3U1KA 2Q8DA 4QQPA 1TZLA 3HZJA 2M1BA 3CDZB 4PI0A 3LDBA 1FV3A 3H3UA 3WVJA 2E7WA 5K5QA 5E3OA 4NRPA 4Q0PA 2V9VA 4HSLA 1T6GC 2DVGA 5DZEA 3FUOA 4ZS3A 2XQRA 1MZBA 2HXOA 3M1CA 2ZEYA 2LREA 2HWB1 2DVBA 5FZKA 5IVYA 1ENSA 2WZR1 1DGWY 2CQKA 3SISA 1H88C 4WM7C 3K4CA 2EZKA 4Z2WA 1R1A1 1WMFA 1LHVA 1V6JA 4XR6A 1IN4A 3RZLA 1RI7A 1GNZA 4ASMB 4Q4W1 2RR12 1UCRA 2EIKH 2AQFA 5T5LA 1MEC2 5JI9A 4KU7A 2R5ZB 4PIXA 1PIV2 2Y8KA 1NLQA 1W2NA 2K9LA 1AX1A 3FM3A 3K2AA 1GFF2 3A23A 4QGMA 3AYAA 5FO7B 1DPUA 3OJBA 1UZZA 4MYEA 1PO12 1AF9A 1RUI1 4LBOA 4LK7A 5JZGB 1SAUA 2BZTA 3ON7A 4CXXA 1YLFA 4RHV1 4RMNA 2F5EA 1D0YA 2CQQA 4EJUA 2BY3A 2AXTC 4RBOA 4PT6A 4Q48A 4LLNA 3EUAA 3OYAA 2IRFG 5FZ3A 1MW7A 3U10A 1WI9A 1NY71 2HDCA 2JPCA 4NWWA 3CF2A 2HVQA 4A3CJ 4YIRX 2VOTA 4XK4A 4UFIA 2O0YA 1CZTA 2JSPA 5LBQA 3BTYA 3FWEA 5FZFA 4AVTA 1RGSA 1G7YA 1WRJA 4R4ZA 1ITYA 1TQ5A 2Y6GA 3OYDA 4ZONA 5LB6A 3J9SA 2DMUA 1ZR4A 4MXWB 4N53A 3VBOB 1ZAOA 5CFCA 1YO8A 3R0AA 1VZ0A 1W0OA 2I45A 1JN2P 1QBJA 3M9AA 5F3EA 1QO0D 5A1LA 3DPRB 1UHWA 3J8F1 3I49A 2WSUA 3AYDA 1F5FA 2CY6A 1TME3 5FZ7A 5FQ0A 3VHPA 4G7HF 1QU3A 2NOGA 1W6PA 5ILSA 3EDPA 5L9BA 2QQKA 2MD5A 2E1OA 2VB6A 3WTSC 4HQMA 2KRCA 1PZ9A 2FD5A 1UB9A 1D4M1 1H1AA 2JE7A 3L9FA 2N7GA 1US2A 5DAPA 4XF9A 3OGJA 1ETOA 4A0ZA 3PVBB 1LOCA 3K4KA 2DLLA 4AOCA 4WBBA 2TRTA 3AG2H 1A78A 2HQ5A 2WS93 5FY7A 3RGBA 2IXCA 5DDJ3 4FAHA 1REDA 2JIGA 1S5LC 3P7NA 5F37A 4KG8A 5LCWL 2TBVA 4J6GA 1AYN1 5I0TA 4XKCA 1CWPA 3IT8A 5FUIA 5BMZA 5FJ8J 5BPIA 3OB8A 3H0DA 2VT2A 4KIBA 4AVVA 4KJZA 2WQ4A 4QPIB 3DCQA 2HPIA 4HLTA 2CW7A 3FFQA 3LKJA 5C4JJ 1YFXA 4MGTA 5F08A 2BWCA 4WCGA 1ZBA3 1BEV2 1FMWA 2BFUS 3ZM8A 4LJHA 4HK8A 1K42A 2E5NA 1HQCA 1NK2P 1W4MA 5EEAA 3BC8A 3OOUA 4HF0A 2V7FA 4QU1A 4Q0QA 5JXHA 4D7NA 1PX3A 4QQHA 4A3FJ 1T38A 4CP1A 2FMYA 1YQ6A 4AI1A 2Q2EB 1ZX5A 4QDQA 2LG4A 3HKZN 5D21A 2P6SA 2WN3A 2PA7A 2DAOA 4XJ8A 1HF0A 4CDUC 3MYXA 2BVMA 2B9VA 1FPN2 2R5ZA 2QE3A 1YS6A 4M4PA 4NO4A 1VBE1 3CUQB 1WLWA 1IV8A 4XL9A 2GMEA 3NWTA 2RDQA 3F95A 2QQBA 4C91A 1HB3A 2VXDA 2R0FA 5JZGA 3SCGA 3ES4A 5D6EA 2WNUB 4PSXA 2DYRH 2O8QA 4UFJA 3PLQA 3HN3A 2Y6FA 4XAAA 4R9BA 1RUF3 2GU9A 1CAWB 1PM4A 2YUSA 1OQ1A 4XORA 1EY2A 2W94A 4META 4ES9A 4GXOA 2HYFA 1XX5A 3SXWA 2VZOA 2EV6A 3BG5A 3ZQGA 2K9MA 3VD7A 2QQ9A 2UY8A 4AEJA 2VULA 3C7GA 2DA3A 3VBHB 2QZ2A 3MV01 5GZDA 5FY4A 4IEWA 4GWMA 3ZQFA 4DNYA 5FR3A 2STTA 2EK5A 2BHZA 1F15A 3BALA 2D7FA 2XDVA 3KT7A 2W57A 4FFFA 2AS5F 3KSCA 3AL0B 1IG7A 2EPFA 4MXWA 3VBOA 2VAUA 1O8PA 4HFSA 1IS6A 4CYCB 3DPRA 2GM4A 1VB4A 1GHCA 4L92A 2JIJA 3WF3A 1W8HA 2XB5A 4JCKA 3DKXA 3N9NA 2QENA 4W8JA 4DZPA 1FSHA 2O6GE 1UOGA 3VHNA 5K9YA 4W6WA 2HDWA 2Z16A 4Z07A 4C3IJ 1SFKA 2RV9A 3IKWA 3UETA 2A6XA 4E7JA 1I27A 2MW8A 1L7RA 4HBNA 2ADEA 4OZXA 2IZWA 1X1CA 4S2DA 2L7ZA 4DJAA 1RUJ2 1ASJ1 5KVRA 3AP4A 2PTMA 1KJRA 4B3AA 4HDVA 1N77A 3S2WA 4A3KJ 2ZHLA 5J96B 1BW5A 3AP7A 1W9YA 1LB2A 3ZIWA 2RAEA 2VVDA 2E2IJ 2EALA 2HZDA 1NTCA 3Q9VA 1HSJA 3ZCOA 4O61A 1F4HA 4BBSJ 1QH6A 4XUQA 5LBFA 4EVIA 5DUUA 4XF1A 2HZTA 4V2GA 1RUI2 2FCUA 4L18B 4QPIA 1X2MA 2A3WA 2R061 5JMCA 2PQSA 1J9IA 2GBYA 3VZNA 1W04A 4L9NA 3MW2A 5F5IA 1KGYA 2DCZA 5IK4A 2KIMA 3SC7X 2RR13 1C28A 3OYGA 2FBIA 4XC9A 4HF1A 4A3MJ 2Q5TA 1MEC3 1PIV3 4NC8A 3A0HC 2C24A 2EBIA 4GD4A 3BZKA 3PO2J 3GVAA 4MTEA 2ISZA 4ARYA 3DL3A 1GLHA 1GWMA 1IKQA 1BLZA 1BZWA 3DEWA 1PO13 4QKBA 1I5ZA 4FO9A 2WBKA 5CKNA 3AZZA 2Q2EA 4EEFG 4H2AA 3UGGA 3DQVC 4PFPA 1TMF2 5K0UB 5KWRA 2FOKA 3K77A 1HCRA 1UW8A 4IESA 3HGYA 1HIXA 3LWCA 2JE8A 5HDNA 5FLIA 5A3OA 3QP5A 1Y9MA 3J7YJ 1NUKA 1R091 3H35A 1CQTA 2XPUA 4P9YA 1FTZA 2WAOA 3CUQA 4CP2A 1EPWA 3MUZ1 3VLBB 3T08A 3FBIB 2OC6A 3HEFA 2BWAA 4AEKA 4E8CA 5ABJB 3MQ0A 4Q4V1 5EYYA 3HTSB 1AU7A 2VZRA 2CFOA 3BG7A 2WNUA 2OPKA 4BM8A 2GNTA 5ILUA 4YELA 4PQQA 2JPBA 2RS32 2IJLA 1HDKA 4YGBA 2VE1A 3AMHA 1CAWA 2Q1MA 4CZCA 4V19K 4A93J 4M3DA 4RLQA 2NLRA 1OQDA 2Z69A 2EH3A 4CTEA 3NMBA 1TWHJ 2FBEA 4XUPA 2KIUA 3VBHA 4I2OA 4AC0A 1IG0A 4DGWB 3HPNA 5CVIA 1O6UA 2L01A 5F2WA 2EICA 4DUVA 2ARXA 1LVKA 1KS4A 5CISA 3BI3A 4IO9F 4HX4A 4CYCA 4ZU4A 1UKRA 2XB6C 4OQ8A 3REOA 3PNAA 4UB8C 3B9CA 1R5ID 1Y0NA 2R1DA 2KJCA 2VJJA 5T54A 4OLLA 1QPIA 5GM0A 5KHIA 4G94A 2RVCA 4OHWA 5KAIC 3ZMUA 1ZVFA 3O0VA 2W7NA 2HNHA 1WCMJ 4OMYA 4NOTA 5J1XA 1TNTA 4ZDLA 4CCJA 5A1FA 2VNVA 4KWLA 1ETWA 1JTYA 4M3CE 4OVEA 5HPOA 4FOWA 2UWAA 1RESA 4XPVA 3KLOA 1ZZBA 3FE5A 1TZOA 2UWBA 1PJRA 3IUOA 4HKLA 1VAMA 3NWSA 3VPRA 3POEA 3ZQLA 1JUHA 1V5EA 4CU6A 2ZAHA 3W6KB 4KIGA 2XJSA 3QD6A 4Y7NJ 4LMFA 1OA4A 3SKVA 2WSVA 1TW2A 3PTYA 3ILRA 1UNBA 2B4KA 4JK1X 3BTLA 1BEV3 2EB7A 1ETXA 1YITI 1RETA 4IXAA 3CUOA 2C4XA 2RMU1 1SFEA 4L8QA 5F6KA 4RAYA 3UJQA 2W84A 3EMRA 4HLYA 3QBQA 3ZRGA 2PMZA 3LFUA 1HKQA 3UL2A 4PDWB 1US3A 1Z7S2 2VKEA 4M6YA 1Y1WJ 3MF9A 4P02B 1FX5A 3HVDA 3WDYA 1XNDA 1W06A 1V4RA 4IZZA 3CMYA 4R52A 4CGZA 3FF5A 2RJ2A 1SCSA 4IE6A 5IT6A 3WF4A 4E8DA 3UR3C 1FYMA 1PNFA 4CEYB 1K5JA 3MIDA 1ZARA 3NJZA 4Q27A 4JDOA 3ALQA 3ONQA 4L0ZB 2LROA 1ENQA 4P9LA 4UYBA 5FZIA 1A04A 5IK5A 3ZSEA 4XLEA 3ZSKA 5BY5A 4LKDA 2K85A 4QWNA 5D1IA 2IA0A 3KV5A 3KX2A 1FNZA 3SHFA 1OJLA 1JW6A 1YFYA 5K0UA 1GMMA 2OQ7A 4JHTA 2ZNZA 2BE5F 4IERA 1RTVA 2LF7A 3DV8A 1IC8A 5K7FA 3BWGA 4A3LJ 5FZ8A 1LENA 2QZ3A 3BZ6A 3K4NA 1R082 3AB0A 4EN0A 1VNDA 4KITB 4KH9A 4G12A 5D5XB 1LKXA 3B02A 5FZ4A 4H55A 2ZSHB 1QHGA 3C2HA 2A07F 3EYIA 4B3NA 3AX4A 5ABJA 2XF6A 2J1VA 4CCCA 3H9QA 2WA0A 3JCUC 1P4AA 1HJGA 2VKHA 2JVHA 3IKTA 1R1TA 3GJAA 3AC0A 2L54A 1EH8A 2E6VA 3CJNA 2QQNA 1ENXA 2WY8Q 5CU1A 2XJUA 4R9AA 2JKBA 1TWGJ 4B43A 3HOVJ 3HSFA 1G9DA 4DRVA 1PK6B 3ZYBA 2K9QA 3GBFA 4DEVA 1FBUA 4QKFA 2VQUA 2A73B 1LFBA 3O1VA 4Z82A 1TNRA 3W58A 3ERED 2AACA 1NCQC 2LP0A 3F8CA 2WT2A 2IWGB 1OCOH 3FIWA 1S9HA 4IEQA 4GRIA 5M5XJ 1J84A 4MXVA 1VMHA 3GXOA 3EYYA 5JPMB 2VQCA 4XLNF 1W2AX 5C44J 4EYUA 4AFDA 4XRSG 1RUJ3 1LOFA 1W2TA 4IUGA 4XFAA 4FPYA 1SD6A 1Y8QB 5DTDA 1TEIA 1UZYA 1VBB1 2P6TA 2A6WA 4K8RB 2HWF2 3POJA 3AZVA 2DCJA 2COMA 4U2AA 1YW9A 3AG1H 5FXZA 5JSOA 2P0WA 2R7VA 5IVVA 3I2KA 2D98A 3TOAA 4B8EA 3BLYA 4XKBA 2PYTA 4AVCA 2W95A 4AFBA 3CCVI 4JZRA 3NL1A 3VSLA 1AOYA 2JDUA 1S2KA 2A7AA 2X29A 4Q5OA 5HCAA 3VBFC 3OD0A 3VD5A 1KFXL 3G1OA 3PFIA 4OAZA 4DPNA 3G2BA 1W90A 2WQZC 2HWC3 2XSDC 4RA0A 5DS9A 2MH9A 1BK1A 4LUMA 4ZPIA 4P9FA 4YFWA 5BYNA 3AFKA 4LG3A 3NV1A 2WO2A 3J81Z 5I0UA 2F2EA 1YJ9I 1ENRA 2VBWA 4ENKA 4BY1J 2LOOA 1BCXA 1WHUA 1JJ6C 4HZFA 2DTYA 4PDWA 3CKHA 3ZQCA 3HRSA 1W9SA 3PFYA 5AIQA 3OTFA 1JOBA 4FPOB 4NRMA 2YROA 3I56I 2BNNA 1MNMC 3N7KA 4S04A 3ABMH 3BP8A 3MEPA 1HB1A 3SQNA 1JHJA 4HMZA 4UVCA 2WAQN 4LORA 2RREA 3D5SC 2JA6J 3CZJA 4YGCA 1ZRFA 1BR1A 4CEYA 4XJAA 4LFUA 1QZZA 1SVOA 3CO2A 2CUFA 2J1EA 2KD7A 4E27A 4P14A 4E2SA 1CR7A 1XE0A 1QZEA 2JJ6A 4OI1A 4XKVA 1BBT1 3PUQA 5DUIA 3CJQB 2VU9A 3L7WA 3TMOA 4ESJA 2DVFA 4LOSA 3ECQA 2DUOA 3O12A 4K2EA 4MV2A 2L0KA 2F6BA 4MGZE 3JRAA 2HPMA 3BQZA 2HWE1 1VQKI 1TWCJ 1POGA 2RS33 3GCWA 1AR91 4RR3C 3RMYA 1I3QJ 3N05A 1JGGA 3OYNA 1ULGA 3OMYA 1AR62 4AVSA 5T5JA 3UGHA 1O5LA 1DQ2A 4MQVA 4BHPA 3H8RA 4WVWA 2QUOA 4FASD 4AU7A 3TAYA 4BU2A 4XLCA 4HN0A 4XF3A 5E18F 2NAZA 4BKXA 3AP5A 2V4VA 2BY0A 3WGHA 5ERIA 2JICA 5HNHA 5EYRA 1GANA 3GDBA 3OGSA 2VC1A 3P9KA 4EQQA 5L3FA 5FYHA 1SLTA 5LHIA 4XBQA 2OUHA 5L3EA 3HOWJ