2Z2SB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
182
Chain Sequence
b'TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRDPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 40
structure length 182
sequence length 193
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z2sB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z2sB02
4DINB 5C8WA 2OZJA 4Q29A 4EV0A 4XFHA 4JTOA 2QDRA 2XLAA 1Y3TA 4HSJA 1U12A 3NW4A 3DL3A 3OD0A 4LLOA 3LA2A 1QXRA 3CF6E 4IERA 4L11A 3BU7A 3I59B 1CAWA 4R52A 3ETQA 3L2HA 3LA3A 2OYZA 2O8QA 4I0BA 1RC6A 2IC1A 3FFQA 3H3ZA 3SMHA 4HLTA 4AQ6A 3S0MA 5LRSA 3O14A 4HVRA 4KWKA 4EWEA 1UIKA 1JUHA 1CGPA 2MPFA 4EWAA 4K8FA 1FXZA 3NKTA 2E9QA 1SEFA 1ZZCA 1Q5OA 2PAKA 3PLQA 4HN1A 5I8TA 1J58A 4L2NA 3U0ZA 2D93A 5KBFA 2XKOA 3R6SA 2XL7A 2GH2A 4IEQA 3C3VA 4EROA 2GU9A 1CAVB 1TQ5A 2XKPA 3E97A 3EBRA 2BEOA 5I93A 5J48A 3I7DA 3H1WA 2VECA 4ZU4A 4PIZA 5E16A 2Q4SA 2B8MA 5JCTA 5C6CA 4IEUA 3EJKA 1UIJA 4Q0SA 3M70A 3HIFA 2V09A 5I0TA 3EHKA 1SFNA 1OFNA 3E5QA 5I0SA 4QGLA 3FE5A 4AVBA 3PVBB 4H7LA 4LULA 3TNPB 2B9UA 2BNMA 3HT1A 3CLPA 2XLFA 5BUVA 3ST7A 3EQEA 4HMZA 3HT2A 4MH0E 3TNQA 1ZZ9A 1DGRA 1QXJA 4E2QA 4LUMA 3PNAA 3QACA 3LAGA 2D5FA 1CAVA 2XL9A 3E6DA 1J1LA 2UYBA 1WLTA 4XFCA 4AVAA 3H1MA 1IPKA 1VP6A 4QM8A 2PHDA 4YARA 2GC3A 2IXIA 2XGXA 3SCGA 1LB2A 4J1XA 2XLGA 2WC2A 2OPKA 1UCXA 1LR5A 3G7DA 1X8EA 5I91A 2N7GA 5FCCA 2KXLA 2OA2A 1UW8A 4Z07A 4I0AA 4FAGA 5CU1A 2ET7A 4N9HA 3FX3A 4XF4A 5F1RA 2MNGA 3H7JA 3MYXA 4ONUA 1Y9QA 4XF3A 4JTNA 3FWEA 2PHLA 4KU8A 5FLIA 4Z82A 2PAEA 1UD1A 2UYAA 3LZZA 4B29A 1CAUA 4QGNA 5JSRA 1ZREA 4QX5A 5HI0A 1YFUA 4EWDA 2BNNA 1ZZ7A 3WW2A 1ZZBA 2H6BA 1I6XA 3D0JA 3M3IA 2P17A 1GQHA 1DZTA 4QMAA 3U11A 1Q3EA 5LEJA 4GULA 1VR3A 4IEWA 1NE6A 3MZHA 1ZRCA 1IPJA 3EO6A 5BV6A 1ZX5A 4KU7A 1QWRA 3HQXA 1SQ4A 4I01A 4ZU7A 3ZDSA 5EZWA 1H1IA 2PAMA 2QVSB 5BY5A 2GC0A 4AQ2A 4YRDA 2IXHA 4AXOA 1J3QA 2I45A 1CAXA 3E5UA 4J1WA 3CO2A 4X6QB 3RZZA 2IXLA 3RDIA 2GC1A 3IDCB 3NSTA 3VHRA 1PMIA 5JR7B 5FDBA 1YUDA 2OZ6A 4IEOA 5AVPA 1QY4A 2BGCA 1O3QA 4XF1A 3H50A 2ATFA 1GQGA 1EYBA 2B5HA 3LWCA 4JVAA 4FBFA 5J3UA 3KMHA 2Q0AA 1NYWA 5FLJA 1OI6A 1O3RA 1OD5A 2PFWA 4KWJA 1RUOA 2UY8A 3NJZA 2ETEA 5KHIA 1EPZA 4N9IA 3D0SA 4I09A 4MGZE 4IEZA 5FPZA 3FJSA 4BH9A 4D7SA 4HBNA 4WVZA 2QJVA 4YYOA 1FT9A 3QOPA 1G6NA 1H1MA 3IWZA 4XETA 5BXXA 4IESA 4XFBA 4A2UA 1X7NA 1RTVA 1X82A 1CAUB 2Z69A 4BHPA 2BNOA 3KGZA 4D7TA 1EY2A 2FQPA 1ZRRA 3NVCA 2DCTA 4I2OA 5I8SA 1VJ2A 1ZRFA 2O1QA 2IXCA 4MUVA 3IBMA 2K9ZA 4R8HA 2QCSB 5JSOA 4X6RB 5J7MA 5T3NA 4MGYE 3FHIB 3OCPA 1O5UA 1O5LA 4XF0A 1J59A 4LA3A 3DV8A 1O7FA 4KWLA 3GBFA 4I3PA 1YHFA 1CAXB 3E6CC 4YNIA 3H7YA 3LA7A 4PIYA 2F4PA 2GAUA 3H3UA 3RNSA 3RYPA 2PA7A 4Q0VA 3U10A 3LOIA 3B02A 1YFXA 4PJYA 3H1YA 4F7ZA 3ROUA 2H0VA 1V70A 4XF9A 4UBHA 4OFGA 3N4MA 1ZZ8A 2QNKA 3SCHA 4KL1A 3H9AA 1WGPA 5I8YA 1NZCA 1YWKA 4FT8A 4TLFA 2FMYA 4IETA 4HZFA 3MPBA 3RYKA 1NXMA 2HJIA 4F8AA 5K8SA 3H8UA 3WW1A 5FQ0A 1RL3A 1NE4A 4XFGA 1ZZ6A 1O4TA 4LUKA 5I0UA 3WW4A 5JAXA 1ZVFA 3SCFA 2PYTA 4WBBA 2WFPA 2CV6A 4META 5LEKA 4PIXA 1WA4A 4HVQA 4NQWB 5CVRA 1I5ZA 4MX3A 2VPVA 2ZCWA 4XFIA 3ACLA 5KHJA 3USSA 1OMIA 3RPQA 4HSLA 4MGIE 3JZVA 1RUNA 1O3SA 1DZRA 5E1RA 4P9GA 3HUGB 1J3PA 1J3RA 5BPXA 2EAAA 2PTMA 3S7EA 3OGJA 2IXJA 2HKXA 4XFAA 3FZ3A 4Q0PA 3DN7A 3GYDA 4YSFA 5KHKA 1X8MA 2BYVE 2Z2SB 3I54A 2C0ZA 4BIFA 4FAHA 2D5HA 1O3TA 2Y0OA 5KHHA 3WW3A 2Q1ZB 4LTAA 3S7IA 1XE8A 4MV2A 4IEVA 2EA7A 5LRRA 2PQQA 1L3JA 4HN0A 3OTFA 1FI2A 2ZKLA 3E5XA 4ORFA 4OLLA 3BCWA 3I59A 4MZUA 4XFFA 3CJXA 4O9GA 2VQAA 3UKTA 2UY9A 3ES4A 1ZRDA 5EFUA 4LEJA 3DKWA 2Q30A 4MGKE 4E2SA 3IIAA 1XE7A 3SHRA 4RD7A 4ZU5A 3CL1A 1HW5A 3BPZA 3BALA 5I0RA 3ELNA 3BB6A 5FPXA 2EVXA 3ES1A 5KHGA 1XRUA 3SXWA 5FLHA 3D82A 4QGMA 1EP0A 3RYRA 4UBGA 4E2GA 1Q43A 4O9EA 2CGPA 1YLLA 3UKNA 2D40A 2ET1A 4Q0QA 4JV4A 1CAWB 3MDPA 4IEPA 3KGLA 4WZCA 5FQ0B 5JSPA 3IDBB 4QM9A 4I02A 1DGWA 4UXAA 3UKVA 3KSCA 4BYYA 2GC2A 1ZNPA 4CYDA 2CAUA 2IXKA 2MHFA 5CADA 1UPIA 4AVCA 4NVPA 4QXKA 2K0GA 2GZWA 1LKNA 1YFYA 2XHKA 4HVOA 1LRHA 5D1IA 4LA2A 3OF1A 1CX4A 4IEYA 4IEXA 1RGSA 1PM7A 3NL1A 4XEZA 1YFWA 3KCCA 3E6BA 4Q0UA 2H6CA 3CEWA 2CAVA
chains in the Genus database with same CATH superfamily
3UGFA 1SPPA 1Z9CA 2XAFA 1LOGA 5CKQA 1F36A 4AI9A 2QDRA 5C3SA 4BBRJ 2VKDA 4E7HA 2HVSA 3CJIB 3GJAA 3PUIA 2FDJA 2JUGA 2FDIA 1MMGA 4IERA 2PLV2 3I59B 1CAWA 1D2QA 1CQ9A 4G7HF 2PLV3 2BUKA 4RA0A 1Y8QB 3ZN1A 2G19A 1TQIA 5LY2A 1I50J 1K45A 3U1KA 4ZS3A 1W6MA 4HVRA 4IZZA 1OBNA 2Z3YA 5IUQA 3Q8EA 2ME6A 1Z3XA 2L3DA 2JE7A 3JBG3 3NKTA 2E7WA 1WMDA 4JX0A 4LBQA 2DVBA 4A0YA 5I8TA 1Z7S2 2OCEA 2VW2A 3DWLE 4SLIA 1WH7A 5FPBA 5F6KA 3OD4A 4DNCA 2VI6A 5KCMA 3THPA 1BEV1 3GFMA 3AAFA 1A35A 2RG4A 3M3CA 4NPRA 1YTYA 2VMHA 1JYVA 2VMIA 4ZU4A 5E16A 4KGQA 4MEXF 2Z5WA 4A41A 5J1RA 3NAPC 1SMTA 1RITA 2DODA 3G73A 4MLOA 1D5YA 1Y39A 1ZA4A 4LBLA 3E5QA 1QQP2 2ZJ2A 1OH4A 3JTGA 1QQP3 4L9BA 4LBKA 4R9CA 1OR7C 2XLFA 5TSWA 3ST7A 4CRQA 2L4AA 1RUF2 3VBHC 3EQEA 4CVUA 5IYYA 4Z2YA 1AL22 3R0RA 3A0HC 3KF3A 4LIUA 3M3YJ 1LOCA 3CZJA 1VRH1 3O1TA 5F5CA 2WAEA 1TWHJ 2XL9A 1J1LA 2AREA 2KRHA 5HV0A 4AVAA 4BY1J 4OI2A 2KM2A 1ALYA 3DCQA 2DTZA 3SCGA 4UVCA 2VBPA 3CCJI 1XGOA 5H9RA 3ZYBA 4HX7A 5F0HA 5GM0A 2YBPA 3LAJA 2WFF2 4BY7J 4WV8A 4HSTA 2HWC1 2HWF2 1CPNA 2YDEA 4ZY9A 1T39A 2WFF3 5FAXA 2QQPA 2BVLA 2HWF3 2O0YA 2NYYA 4CDQA 4BQQA 1G8XA 4J00A 3J7NA 1U5XA 2YV8A 1QPIA 3IDEA 3OR2C 3HOVJ 4YZ1A 1LEBA 4AZZA 3CQOA 5K5QA 4FTHA 4K40A 4XQFA 2B63J 3A03A 3AKSA 1RUH3 2CRGA 1NG0A 1HB2A 5SV8A 3ZX7A 3MKZA 3GZAA 1UHWA 4E4HA 4NRQA 1UY0A 2IGKA 2LREA 2DQLA 1J75A 2WNVB 3HOZJ 2XVKA 1KGSA 3W21A 4D3WA 2HYXA 2LUWA 3IH4A 4PFOA 1KQRA 1XE0A 2IXHA 4AXOA 1ETYA 5DAVA 5FYHA 4ESBA 5FD6A 2IA2A 2M0CA 1ZYBA 3AC0A 3FC0A 2ZKZA 4QXHA 3A7QA 2N8GA 4U0VA 2V73A 4JAAA 4UXNA 4A3MJ 2ZMKA 1TC3C 1QJU1 2VOTA 3IPVA 1H2LA 3Q3SA 3VBUA 3GXOA 3CNAA 3ZXFA 4YFKF 4D7SA 3M3OA 2QJVA 3LDRA 3V0AB 1A78A 2JDKA 1XCVA 4IW3A 1LQ1A 2VMDA 2OJED 1VAMA 1X82A 5LATA 3ZFGB 4LB6B 2H0BA 3B69A 5IFTA 1RUD3 3A21A 4MUVA 2K9ZA 3AL0B 2A69F 3PQKA 4X6RB 5LK5A 4CEYB 1H8AC 3HRUA 1U5YA 4MHGA 3HD8B 5FKBA 4CU9A 2NVQJ 1EUTA 1STMA 1O7FA 3RPUA 2R7OA 1YHFA 1ZG3A 4BLJA 3EUHC 3AG2H 3U14A 1ZYRF 2BPA2 3MW3A 2X5IC 1QOOA 1RUE3 4LLLA 3L2UA 1OOPC 2R6QA 1GMMA 2IGMA 5DAPA 4KMFA 1W39A 1TVGA 4G6TB 3BIEA 2QSHX 1WGPA 2LFBA 3HKZA 1IQAA 1Z1DA 3GLLA 2A70A 1JZ6A 1GP5A 3V8LA 4HOOA 3ZYJB 1RL3A 1ZQ3P 3HGYA 4L0PA 3MMYB 4YELA 1IHMA 2Z4FA 3CZUA 5A3MA 4NC7A 4NHXA 4XCBA 1I5ZA 3T3YA 3HEFA 2V1UA 1EH7A 4HLXA 3USSA 4ESJA 4HSLA 4FO9A 4BBSJ 3FUOA 1TE1B 1NK3P 3KX2A 3K4AA 3FDYA 1OJLA 3DN7A 3HOSA 4AUXA 4M0NA 2WAOA 5T5OA 2PJPA 3KEOA 4KWUA 4DXZA 5HLIA 4PUSA 3DTIA 4XCAA 3VKMA 3N9NA 2O9LA 1CJPA 2CDOA 5IK7A 4C9YA 5LHGA 4AYBA 1FI2A 1GVJA 2VZ3A 4QIWN 3NO8A 3T1LA 1H2KA 2BZDA 3PUSA 3J80K 5A3TA 3DQVC 2A6TA 1MQTA 3B00A 2IFWA 2VOVA 4L0YB 3IIAA 2OTJI 2VBWA 3IH2A 1MSEC 5CG9A 1YX3A 1Q56A 3BPZA 5ACA2 3D4KA 1PK6C 2CJJA 3F3XA 4BEHA 3VDAA 4KN4X 3WE2A 3H8XA 1MDMB 4QM9A 2M4KA 1LU1A 1X50A 2VCBA 1S9HA 3LDKA 5JMOA 1FMD2 4K21A 4IUGA 3UKVA 3PSFA 4ZYHA 2P8TA 3ZYFA 1R092 5FJHA 1FMD3 2R7XA 4K9SA 2H27A 5HVQC 3PVNA 1Z7UA 1B35A 4U36A 2R062 4IEYA 2XWJB 2ARBA 2EWNA 2Z1DA 2A6EF 2OZJA 1I39A 3TEDA 1FPN1 1WJFA 3HTSB 2F17A 3OPZA 1QHDA 2Y60A 4JBAA 1E3OC 3BU7A 3C2HA 3LA3A 2IA0A 1LE8B 5DDJ1 1Z78A 2R7DA 1R081 2DVGA 4F91B 5EHDA 4II2A 4A3CJ 2K46A 1NTCA 1HV0A 1ONVA 2W84A 2WY8Q 2ETHA 3CCEI 2R93J 1Z6RA 4K8FA 2UXXA 1SEFA 2VD7A 4CSWA 2MG4A 2Y0IA 3HNMA 4CU6A 3KM5A 2G9GA 3U0ZA 2JG9C 2XIGA 3G2BA 1VBC2 4WZFA 5FZAA 2DYRH 2DK5A 1VBC3 2DQRA 3GM8A 1GT0C 3AFHA 4QQ2A 2K27A 4RFT0 4PIZA 1KRIA 3OBZA 1PO22 1GLNA 3G4SI 4FE4A 4OWRB 2DMTA 1WZ2A 3J7AO 4A6EA 2DVAA 2WZ8A 4D5CA 2ECCA 2YPDA 5F3EA 2RV9A 1LODA 5DM6F 2H1LA 3H8RA 5ICGA 2IGNA 1O8PA 3TNPB 4RQPC 2NM1A 3VBSB 3CLPA 3WUCA 2V1NA 3RFRA 2KR2A 5H20A 3HT2A 2AYHA 5FUIA 1ZHFA 3HNYM 3RPUD 3HAGA 2HZDA 2LP0A 2GXAA 2A3WA 3BOPA 2OUMA 3V0BA 1R1ZA 3DF8A 2J1VA 1B6AA 1RR8C 2PLYA 4DMIA 3MQ0A 2DU1A 2XVLA 4JX4A 1MBKA 1U8BA 5HXMA 2XQRA 1YEWA 5J1YA 3NJXA 4OI4A 3ENRA 4I0WB 5FBJA 3OSGA 4BKXA 4RB3C 5FO9B 3PUQA 1FMVA 1MJ9A 2BFUL 2KA3A 4Y1VA 3WHCA 5EZHA 2L7KA 4IRIA 4BQ2A 5HCBA 1OCZH 5A80A 5EP9A 2MH9A 3E0JB 2W95A 4A44A 1N3PA 2A5WA 4BQOA 1EF4A 1I6XA 1F9NA 3R0JA 2ZNYA 3PTYA 2VBYA 1BI1A 1XNAA 5LA2A 4JX6A 4AIDA 2HTSA 2L9SA 5K9YA 2PG4A 4AI3A 1ZX5A 2XRLA 1DBNA 1V0AA 2XSJC 3SQOA 1MZFA 4M3CE 2O5RA 4RLQA 2W1QA 4YRDA 4RR3A 1HOMA 4FTSA 5FYBA 2VXJA 2W92A 3EPZA 3FISA 2BP6A 1U2WA 3H9JA 3WHTA 4JGZB 4WM7B 1UU4A 1X3WB 4MXWA 2QVOA 1WUVA 4AHWA 2PN6A 2CU5A 4C2TA 4V2GA 5JXHA 4JHTA 1X58A 3DGTA 3OYMA 3NJZA 2HVQA 1EPZA 4N9IA 1GICA 1OA4A 1DQ1A 3POEA 3BKZA 3QOPA 3Q0VA 1XDSA 3HBLA 3MV11 1AVBA 4XETA 3CLOA 3LWFA 2JRMA 4ZZ8A 1X7NA 5ERIA 2DJIA 3IKTA 1NAEA 4DOZA 3QP5A 2ZZQA 4A3JJ 2M0MA 4PI0A 1AX2A 4Y22B 3ZPYA 2DTYA 5JXIA 1B72A 3CJQB 2VZUA 3I3BA 4OUEA 3C2GA 1OF3A 4EN8B 3KLOA 1UY1A 4BS9A 5T5JA 4IPAA 3DU5A 1SHWB 2HS5A 4HKWA 4LG0A 3GBFA 3CDHA 3NAPA 4I3PA 4HEA2 4Y5Z0 4OZXA 2IBDA 3FUQA 2Z5UA 2P0WA 3GXUA 2VMCA 3V7CA 5EJCA 4DRVA 1IZ3A 4BIOA 1OISA 3VYRB 2JDZA 2CUJA 1S1AA 2NS7A 3A22A 1ERDA 1OR7A 4CZSA 2P3IA 2H8WA 2Q1MA 3VBHA 4XBLA 4LD5A 4NBQA 5A3OA 3GTKJ 2DAOA 2BWAA 4CPBA 3HMYA 4BHBA 4LKSA 3BG5A 2JDAA 2MC4A 4XQ4A 3KCXA 1KS5A 5CKMA 1SLCA 3WU2C 5SV5A 5LEKA 3ZFFB 3DKQA 3BY6A 1XNDA 1CZVA 2DCZA 5KHJA 2GBYA 3GZ6A 1E2XA 3M8LA 3TP0A 4QU1A 1UNBA 5JZGC 5A1LA 4MG2A 1X1AA 1DZRA 3DEUA 5FXZA 2VMFA 3HUGB 4QKBA 1LDDA 2YC2A 2FSWA 2IZWA 2BGOA 3L2VA 2JENA 3OS0A 3TL4X 4N53C 2RM21 2JDMA 5GAEJ 1P92A 3GALA 3UNPA 2A6WA 1Z77A 2K4JA 5A1FA 3FHAA 4AI2A 5B5EC 4G4FA 1NY71 3FM5A 1ETXA 2O8XA 3BCWA 5FZFA 3FMGA 2J1SA 1BHGA 1YW7A 3RWKX 4FPYA 4RAZA 5EFUA 1W8HA 3C7HA 4E4DX 2NS8A 1RUI3 4JKKA 3CESA 4FP3A 4LR4A 3S32A 4N7UA 3P7NA 1PM4A 1SFUA 4XMIA 4W6XA 1Z6TA 1PO12 4XBQA 1ETOA 5KHGA 1YW8A 2V9KA 3ULQB 1P9QC 2XBO3 3JRHA 1B9NA 4A12A 2XB6C 2V7FA 2Q8OA 3WG4A 2BTVC 4RB0A 1DHKB 4AGGA 4Y26A 5L7OC 1UMHA 3S5QA 1LKNA 4I30A 3H5NA 4YWAA 4KIBA 2AUYA 2EXIA 1KU3A 3CEWA 4R52A 3BTYA 2L9LA 4U0WA 2AHQA 2QA4I 1JZ2A 3J9SA 2VBDA 4O61A 2WZR2 4GAZA 4R4XA 2AEZA 4LNVA 3GFIA 2EXHA 3LA2A 3H3VK 2WZR3 1V54H 3WNOA 1QPMA 3V8JA 2VE1A 1PVXA 1SMYF 2ZEXA 3PVOA 5K0UC 4XUOA 1F35A 4LB5A 2J1UA 3CCVI 1E5IA 3O14A 3WV6A 3RSNA 1V6OA 3EUHA 1UIKA 5IOYA 2EV6A 5IY5H 2OUHA 1LDJA 1MR5A 2X5IA 4D0PA 2KDOA 1GOHA 1UYPA 2V79A 4ZDPA 5C7GA 1ZAOA 4LE4A 3EYIA 1OOPA 2DOFA 3CUOA 3V7SA 2XL7A 4QX1A 1UELB 4U0YA 1AXKA 1TQ5A 1YO5C 5FY9A 5KNLA 5ERLA 2CNAA 2VECA 1AR62 4DEVA 1WJDA 4QPIB 3KCYA 4IXLA 4Q48A 2K5CA 5EJZB 5FZEA 4AI1A 2IVMA 5FZ9A 5T52A 4FPJA 4OU0A 2TCTA 1Q8OA 3VB9A 3CCYA 3UETA 2BNMA 5B4XA 3CCSI 2WA4A 2F4OB 3HRSA 1E17A 1H2MA 3TNQA 3AG1H 4CZZA 5DAQA 5DUUA 4XLAA 1DGRA 1QXJA 1TLHB 5FJ8J 2DK8A 5FK8A 3LAGA 4LBNA 1YHQI 1POQA 2WNOA 2EAKA 3V56A 2VIXA 5BNNB 2VCMA 4M3BA 2RS51 4ISQA 2D1VA 4XJZA 1T2KA 2WSUA 2M34A 4XZPA 2XAGA 1JOBA 1CD3G 1U8RA 1MVEA 1PK6A 4ARYA 1FBSA 5A3PA 5C3EJ 5ICCA 2RR13 3VBRC 5E89A 4Z82A 2XPWA 4S05A 1YYNA 3EUKL 3OYCA 3JREA 4F92B 1HN0A 3SEZA 1R7JA 1RUC2 1RJ7A 3WP3A 2ZAHA 1POGA 2ZB9A 4O65A 4D7YA 3NV3A 3WP6A 1SQ4A 4FHTA 2O8OA 2WADA 1H1IA 2PMHA 3DF0A 4M71A 1JUMA 4EM2A 3DPRB 1PUFB 3WGHA 3WTXC 4BJ5C 1IF1A 1OQEA 3NSTA 2E2IJ 1HDDC 3HBZA 2CH0A 2QBYB 2E1CA 1QDCA 3HZJA 5FYYA 2QUOA 3HM5A 1ULYA 3FXMA 1T6SA 4O7XA 1SD5A 5L3DA 3V42A 5FLJA 2E5NA 1C8NA 4K3UA 1GUIA 3VDXA 3LDBA 1JHJA 3R4SA 5E6HA 2YFZA 3ZN6A 1Y9GA 2WN3A 4FP2A 2GSYA 1R64A 5KC6A 2WT2A 4E7IA 4Q47A 1H1AA 1REFA 3GO5A 1QHGA 2NNYA 3AMHA 4MGTA 1XB4A 2HDDA 1MIJA 3PL8A 4IV1B 4BQ4A 5TGTA 2VJXA 2BNOA 4HANA 1CQTA 2D5VA 1YS7A 2CY6A 2GNBA 1PGW2 2JG9A 5DD4A 5J8CA 2O1QA 1GWKA 3C7FA 4IGOA 2R5ZB 2KQRA 2Z16A 5JHFA 4GH4C 1HQLA 2QCSB 4CCCA 5L3CA 3ABMH 5FZGA 2LDUA 5JR2A 3DKYA 3C2UA 5TJJA 1TWCJ 3AXDA 3ZKYA 2VY0A 2A71A 3D5OA 2W00A 2LD5A 3RKXA 3ECHA 1PGL1 4AWXB 3ZN0A 4DGWB 4NOTA 3VBOB 2HYFA 2C6YA 4XDPA 1F8VA 3BPVA 4RQPA 3ROUA 3ISPA 1GVDA 2W52A 1QH7A 1OSGA 2W25A 3F8BA 3PDQA 4ZJZA 4J19A 1SVLA 1GOGA 2OKXA 2F4LA 2ZGOA 2YYOA 3W2AA 2I07B 3OYDA 1T95A 3WOGA 4ZDLA 2HEYF 3PTRB 5L73A 2BHYA 3I4PA 3BGAA 3ACLA 4ZZ5A 1G3WA 5E8GA 4DXRA 1RZ4A 1PHMA 2YBSA 2YPJA 1OH3A 1JYCA 1F15A 1Q1HA 2DCEA 2WYFA 3ACIA 2ADDA 4R9DA 4P9UA 4Q0PA 3S3NA 1RINA 2F5CA 3I54A 3K69A 1LENA 2C0ZA 4FAHA 3KP2A 1W9FA 3WLUA 4FASD 2NZ9A 2M7AA 3BI3A 5EG0A 3D5RC 3MUY1 4OLLA 3ZMTA 1RUG1 2E63A 1OCTC 1QXPA 4M3FA 5DM7F 1ZRDA 5DUXA 1WFXA 1FX7A 1YJNI 3H42B 4EZ4A 1XE7A 2XJPA 1DQUA 5DPNA 5EIYB 2I8DA 2EVXA 4PGHA 2DLLA 4TXWA 1YQCA 1W8NA 2BXYA 1ZBE1 4UI9L 5JSPA 3OPTA 4CXWA 3C7JA 4C3HJ 1DGWA 1DQ2A 2FF4A 5FKOA 3J7HA 4BQYA 1SFYA 1H6YA 5JI6A 3I55I 2A6YA 2XJVA 1GR3A 1W2UA 1TZOA 3NNJA 1A5JA 2MEV3 3GZEA 1YFYA 1LRHA 2ZX3A 3OWTA 4EYUA 2Y26A 3ZLIA 1QJFA 1NT0A 1FV2A 1QJX3 1O4YA 1SACA 1KONA 3VD9A 1USSA 4Y1YA 5DG1A 1SANA 4DEQA 2Y30A 4PDWC 2FBKA 1UN1A 5IP9J 2ZX0A 2WABA 5CVUA 3BPXA 1XX5A 1WLDA 5CPRB 1ULEA 1WZXA 1IN8A 1WJBA 2ZBJA 2OCCH 3O12A 2OT7A 2WBKA 4EWEA 1DPRA 5IFPA 3H0GJ 3ZSKA 2C5DA 2QENA 2NXNB 2IP2A 2R30A 4WK8F 1F5TA 4CP2A 1QIQA 4CDXC 3WNMA 4A3LJ 4COWA 2HDCA 2VJ5A 4OUMA 3B7MA 2HH9A 2YXSA 4EROA 5GKAC 4PT6A 3DXTA 2ZEYA 1B59A 1BI0A 4Q4X1 3V4GA 1OVSA 4NROA 5G04L 2DT5A 1JOJA 3SH3A 1G9AA 3AMQA 1XG1A 3HJRA 5FYUA 3M4OJ 1SPPB 3FLPA 4BQWA 2JKBA 2V09A 2XVCA 3K6GA 3H0DA 2XR4A 4UUTA 4XBNA 1MH3A 5A6YA 3IP4B 4L5IA 2CV1A 4AVBA 2DYCA 4ASKA 5JZGA 4H7LA 3WU1B 3HT1A 2WINB 3POIA 1LCLA 3VKNA 1YG2A 3J7ZI 4UB8C 1JTXA 1FY7A 4N53A 1J0RA 5AC91 3R4KA 3W9AA 1RUJ2 4AYUA 5IVJA 1W6MB 2DU9A 2QZ2A 4ON0A 1D4M1 1S0JA 1VP6A 2IRFG 5K1YA 4FXGB 1QU3A 4LBQB 4XRSA 2YX4A 1LB2A 4MEYF 2VXZA 3U4SA 4EGYA 2N7GA 1LECA 4XQWA 2BRTA 2OA2A 2V5YA 1PVC2 3NJVA 2GNTA 3KS7A 4CCDA 4M6YA 1REPC 4ONUA 3O6BB 5IW0A 2YY1A 4B09A 1PZ8A 5F0CA 4OMCA 2VNRA 1WLCA 3NV1A 4QGNA 5FTTC 1TG7A 3K48A 4N4NB 3V65A 3DEMA 1NA1C 4S2GA 3ILNA 2DUQA 1W03A 3B6AA 1DZTA 2P37A 1S72I 2YROA 2VNGA 1OUXA 4JQRA 1RKWA 1AJKA 5L7OA 1A34A 3JUUA 5D5XB 2R1DA 4XN0A 1AX0A 2ZGUA 4AQ2A 4X6QB 2IXLA 4XIDA 3GW2A 1TL8A 1U9OA 3NWSA 3LKJA 3PHMA 1FOD2 4A3BJ 1IO2A 4C2UA 3LQRA 4YGCA 1XSVA 2FHRA 1FYUA 3I2FA 4FPFA 1GQGA 1YJ9I 4FBFA 3PJYA 5FYSA 4OAYA 2YG0A 3CMAI 4NNJA 3KMHA 4IHTA 1UX7A 1RIOH 5K0UA 1R6RA 1XMXA 2Y9YA 3CC7I 2Y0SN 1RUOA 2JWPA 3UT0A 3K46A 1RKTA 2ETEA 4UV9A 3LD8A 4WVZA 1IQDC 4FQZA 3Q9SA 1D3YA 1KS4A 4NUBA 4CDQB 2RDNA 4B1LA 3AM2A 5FYMA 3K3NA 3M9AA 4NQWA 2HNHA 5F64A 3POSA 1Y0NA 2KKOA 1R49A 1DF0A 1EV11 4G6DA 4L0ZB 4YM2A 3POGA 5JSOA 2VKHA 1FAYA 4BE1A 3ZMUA 4IQPA 3GLXA 4KWLA 5C3OA 5FROA 2GMPA 4D9JA 3ZQFA 5CVVA 3GGLA 4PIYA 2F4PA 4DUWA 5FY0A 4ZTJA 1BBT3 2XROA 4JDMA 1JKOC 5D5VB 3ASOH 4UFLA 1X2MA 1YFXA 1FPQA 3Q8CA 1TME1 5EEGA 2VUMJ 4AU7A 4L9VA 3GHMA 2CFOA 4XF9A 3VBUB 2A1XA 1COV1 2HWD2 1TMF2 3H9QA 5JMCA 2FMYA 4IETA 1OYIA 2HWD3 2YFUA 4FOYA 5K8SA 2R5YB 4Y33A 4MYEA 5CKNA 1VF9A 2PBIA 4Y17A 1BMV1 2R072 4HKLA 3I2DA 2LF8A 1WA4A 4HVQA 1HB3A 3LEIA 4RS5A 2KD7A 1SZBA 1JXSA 5DV5A 1YLFA 4BGDA 4P14A 2KJBA 1YC61 1XPWA 3WD5A 5FWEA 3S93A 4HDUA 2VAUA 2F48A 1HXS1 2BVBA 4WWCA 1LNWA 3QYBA 3VBRA 2BYVE 2Z2SB 2D5HA 4Q4V1 1FNZA 5LBCA 3PMSA 5ED4A 1MEC2 3AJZA 5BNOC 3JSPA 3N7LA 2R0FA 2DPDA 1DZQA 2E26A 3JU9A 2K9LA 3KZZA 4DPNA 3GNEA 4ORFA 4KN7X 2UWCA 3GJBA 3PVEA 1Q1VA 5A3LA 1Q8PA 2GH8A 3I9V2 2ZC2A 3FL7A 5CQGA 4BMEA 1WW4A 3M7AA 3MHZA 4NHJA 4Y52J 1TNFA 1WI3A 2GNMA 4ZU5A 1WJAA 2WKKA 2LY9A 2BERA 2DI3A 2LS6A 1I3QJ 1IJWC 5CYYA 3QODA 1ASJ2 4XOGA 1JGSA 2WB1N 4Z2AA 5GALA 1AR82 1ENQA 4CDWC 4NIHA 4EJUA 4EEFG 2EFWA 3N9OA 3T1MA 3IRQA 2L0KA 4S04A 2Y8KA 1VLNA 3E6MA 4K8RB 1JKQC 3K7AJ 2VVFA 1BKZA 3WU0A 5EDNA 2C9AA 2ERFA 4NVPA 3KLNA 3WNPA 2XHKA 4PCQA 1LOBA 3K1NA 5EV7A 1DGWY 2PMZN 1SD6A 2TUNA 3E6BA 2Q2EA 3BZCA 3U1XA 3AZXA 5JOZA 5C9AC 1ZH5A 3GTGJ 3CMYA 1XU1A 2W1UA 2FE3A 3NEUA 1QGPA 2A6ZA 2ZGNA 2B9VA 3LMMA 3PIOF 4GH4A 4D94A 5JVGF 1QXRA 1ZGAA 1LPQA 1FATA 1Z7S1 3Q8FA 5GLUA 1URXA 3BTIA 2K86A 1MQTB 3J7MA 1MBGA 2IC1A 2XDVA 3H3ZA 2X53S 3BTZA 4OMZA 3A4CA 2VTFA 5FMDA 3B73A 1C4RA 3VV1A 5FKNA 4YM0A 1ENXA 2RDSA 4BEHB 1MKMA 1TQMA 1FXZA 5FZ8A 4RL7A 4CCMA 4X0GA 3J8F3 3P9KA 3ACFA 3HOWJ 3GFLA 3VBFB 1FP2A 1C0WA 1MW7A 2D93A 1XB9A 3R6SA 2Y6HA 3OJBA 3ZQQA 3B6CA 3WTWC 1CWPA 1I1SA 3K70C 4EJOA 3E97A 5FPVA 2BEOA 4DFSA 3S14J 1B35B 3OEBA 2G7UA 1RUF1 3MPPG 1HC8A 3K4MA 2WUHA 1AL21 4MVTA 1K6YA 5C6CA 5IYCJ 4DZGA 2ZX1A 5CZKA 3LFUA 3HIFA 2FJ1A 4WVWA 3QYFA 1SFNA 1RR7A 3OSDA 3JRGA 4R79A 3MFKA 4BCUA 5LBEA 2E53A 5B1BH 3I2HA 1JHNA 4HNVA 3AL5A 1PNFA 2XV4S 2QCOA 2V9VA 1ZBA1 3CC4I 3LGRA 3TDZC 3OPWA 3OGSA 2Q8CA 1WJEA 5FLVA 5D4SA 2KJCA 3LPFA 1AR73 3WQBA 2XGDA 1KDMA 2WC2A 5IVBA 4AEDC 5J36A 1LR5A 4LOSA 5H9SA 5FCCA 1QVTA 4YVWC 2CDPA 4M00A 5L3GA 4N9HA 2VKEA 1GFF2 4QPGC 1SFXA 5JLXA 2VQUA 1SLAA 4BE3A 1WJCA 4YW1A 2M1BA 4ENJA 3VZKA 1LFBA 3BTJA 1UYXA 3ZR5A 3O1UA 2WO3A 1SMVA 1HRV2 4L9TA 3I58A 3L9FA 2IGOA 3B5LB 2P17A 3VUOA 1D0YA 4RGUA 4AR2A 1VR3A 3W6JB 5ABJC 2CW0F 3OEAA 1P7JA 5CVJA 5HLGA 1QWRA 2VM9A 1HRI3 4Y1UA 5LASA 4UFKA 1B4AA 4ZU7A 1DP7P 2ADUA 3BTAA 4U7BA 2HYKA 4Y13A 1V6LA 3LEGA 4B8EA 1ULGA 5BYNA 4PDWA 1IG0A 1OFCX 4UVBA 4UB6C 2MABA 4WM8C 2CUFA 1VBE2 2QQAA 1RC9A 1VBE3 4YW3A 3OL4A 4I09A 4D0QA 2RKHA 3ILRA 3RJ2X 4COVA 4IE6A 2J22A 1W8FA 3KP7A 2ID4A 1V9U3 3KGZA 3FKIJ 4CDXA 3PO2J 1ODMA 5ICEA 1HQWA 3O1RA 2ECBA 2R7UA 4Z92B 3MFAA 5AIQA 3IBMA 2RHPA 2E32A 3F2ZA 2NP0A 5T3NA 2YPRA 5FZDA 3W6KB 4XF0A 1VB4A 1R9TJ 1Z21A 1RRJA 4IE0A 1BR4A 1Z67A 2DU0A 1N1SA 3NNGA 2YZ4A 2BOIA 2VC1A 3HNBM 4B4QA 1N1VA 4RR3B 1Z3YA 1I9RA 2XGEA 3C7EA 1C28A 4P55A 2F6BA 3BG7A 2WS93 5F32A 4UW3A 1W0OA 4V2WA 3RNSA 3RYPA 3WTVC 1CPMA 3JTHA 1UZWA 1V6JA 4MXWB 5KR7A 1GKBA 2VT2A 1JTYA 3MW2A 4F3JA 5IVVA 1G3SA 3RKQA 3ZN5A 5APAA 3UYJA 1BC7C 4UBHA 5DMYA 4OFGA 4PSXA 3FXQA 2QNKA 2Y48A 5L3FA 1IS5A 1UY2A 4HZFA 3OS2A 4NHYA 2QQ9A 1JU3A 1DP3A 3GZUC 4UT5A 3R61A 1XC5A 1NKGA 3D5LA 2QGUA 1VBA2 2LTNA 4ARXA 4IF4A 3VYTB 2ZA9A 2O8KA 4HK8A 4ZONA 1NG7A 3PUFA 3R05A 2IFRA 2EZLA 4XC9A 3WNNA 3KPHA 2BQPA 1TTYA 1B72B 1HJGA 3MVPA 4EJVA 1IG3A 2TBVA 4HL0A 3VHOA 3EYYA 3POWA 3RZHA 1EH8A 1VMFA 1J7KA 4JHZA 4BIFA 5ACA1 3WTYC 4LG0B 1S0GA 5KHHA 3NAPB 2ZHLA 4EQVA 2M9HA 2Q0OA 3TN92 1G8WA 1NA1A 1QA6A 2RMU2 4IQ4A 4A3KJ 3TN93 4OHZA 3KIOA 3UKTA 4NN0A 3HYIA 4DRRA 4BK4A 5L19A 2PHXA 3DKWA 3LSGA 4MGKE 3VD5A 4E2SA 1R091 4GMP3 4LBOA 3Q8AA 3VBHB 1VE0A 2FCVA 3WG9A 5FPXA 3GX4X 3ES1A 2DTRA 2R061 1XGSA 3AB0A 3SITA 2ZX2A 4E2GA 4QSHA 2OS2A 2W85A 3UKNA 2AR6A 1EV7A 2AXLA 3GTJJ 1C5IA 2R043 4KNCA 2RE9A 2YB7A 4QXBA 4AEKA 1A3KA 4DB5A 5CB7A 4D69A 3N3HA 3OBTA 4AF9A 2GDFA 2NMOA 4XXPA 3HSFA 5C70A 5CG8A 3VGIA 3KLSA 2FMLA 1ENRA 4LA2A 1ULCA 4IEXA 1RGSA 5ISLA 1PM7A 4XEZA 1LULA 2FBEA 1DP0A 3JD71 1JS9A 4DJAA 3BR1A 4ESFA 2ZNZA 1MS3A 4PHZA 4L11A 3AZWA 3L1PA 1CF7A 1UXXX 3BR0A 1MMNA 1VPHA 5FYVA 2DDBA 1ZRIA 4AFBA 4GYGA 2ES3A 4CH7A 3MO4A 1FV3A 1V5EA 5E1XA 2F2EA 3FLRA 2LG4A 1X33A 4Q4Y3 2RVAA 5A7WA 4MO7A 2I2SA 4K20A 5FP4A 2GALA 5GTHC 2L5QA 2VJ4A 1PO21 3W5MA 4M6VA 4G7OF 4R9AA 1WLWA 4I99C 3CO7C 4HN1A 1WMEA 5FY1A 1J58A 5F5AA 2K3PA 5C8CC 4IEQA 4LJZF 2Z33A 3TOAA 4Q5SF 4BMBA 2NQYA 4D1QA 1G4DA 1S0FA 3N9PA 5I93A 4RA2A 5LCWL 2PQSA 1S7OA 4SBVA 1G86A 1R1A2 1X4OA 5CFDA 3LSTA 4OQ8A 3JCUC 5F2WA 5EQUA 2D6KA 4JRLA 3LSHA 3M70A 5DUWA 5JXGA 2HKOA 2OXBA 1PUEE 1VMJA 1N47A 3AP9A 3TAYA 2CGNA 4MTDA 3GTOJ 1U0AA 3WY6A 4FCYA 3JQXA 2H8RA 3WXPA 4WF2A 1J2XA 1GV5A 3T2OA 3GMEA 1JYWA 1FC3A 4V2VA 2COBA 3POJA 1CZTA 1NHAA 5BNOA 1JZ5A 3U9GA 1RMU1 2WN2A 3HG9A 1T0FA 2V72A 2X5IB 2HWB2 4YARA 3JB4C 5IYBJ 2XJSA 1OOPB 4RGAA 3LSMA 3A4UA 1D0HA 2D3PA 2HOTA 3GTQJ 1AWCA 1YRZA 3G7DA 1X8EA 4QQPA 1RHI2 4GIQA 5FKMA 3WGIA 4ZTFA 3ILFA 4OUSA 3UESA 3AVRA 1TBXA 2DVDA 4XF4A 4QHBA 2HWE2 3FWEA 4E8CA 4YM1A 1JUSA 2CW7A 2ENRA 1CAUA 3KV9A 2HWE3 2XPVA 3AZYA 3WW2A 5KXBA 3UJOA 2NN8A 2W47A 5LB6A 2QKLB 3QH7A 5C3PA 3OYWA 2ZBKA 1X2NA 3LAPA 3WCRA 2O03A 2JT1A 5BNGA 5IWFA 4PGGA 3FHNA 3RI8A 2QVSB 1OC1A 4OAZA 1ACCA 1X3ZB 4LO8A 4PBPA 4GD4A 1X36A 4XLEA 4YGEA 4B3NA 5C9AA 1G9CA 1U5ZA 1AYM3 3MLLA 5T50A 2QQNA 1HA8A 4M9SA 1XGNA 4A3GJ 3LWCA 3W59A 2CGOA 5KXDA 1ZGJA 4HW0A 1NQJA 2CMPA 1J09A 2VULA 3UV9A 4XOTA 1UAIA 2FZ2A 1IS3A 4LK0F 3WX5A 3IL2A 5LFAA 1PK6B 2Y6GA 1BEV2 3HDDA 3T30A 1P4WA 3B93A 1BEV3 1S0CA 4HNTA 3I2IA 5L9BA 2W1WA 5FP8A 3NVCA 3WTUC 4KYWA 2M2EA 4I2OA 1S5LC 3EETA 5K7ZA 1T8IA 4A7ZA 2EF6A 2P1BA 3O8GA 1MNEA 4C3IJ 5HDNA 1HJFA 5I0DA 3MBWA 4Y20A 4Y5TA 1WD3A 1XNBA 4UFJA 4XJWA 2ILMA 3HOUJ 2BVMA 3O5SA 1XMKA 4P96A 3RRDA 4N4OB 1T33A 3KE2A 4HG6B 4XRMA 1W8ZA 1LFUP 5A7OA 4RS8A 4Q0VA 2UUZA 4WXHA 2Q8DA 3ASIA 5HXVA 2VBZA 1G7YA 3LSIA 1VRH3 1SEUA 3G1MA 3UNGC 4BL0B 3VZJA 1H2NA 4KIFA 4KT5C 3ZN6B 4MHRA 1N78A 5J09A 1W7PA 3K2ZA 3ZXAC 4F8AA 2HWC2 3MUZ1 3N35A 5LK7B 5A70A 5FZBA 5JAXA 2HWC3 1IC8A 3RZJA 4WBBA 1S8NA 3T2QA 2RREA 4AEDA 2JG9B 2F5DA 5FP9A 2C26A 3LPGA 4YVWA 2P6CA 2X1CA 3W2WA 1J3RA 2LKXA 5FKKA 1YE9A 3F72A 5KHKA 2M7BA 2VQLA 4LT5A 3PIPF 1QEXA 3P6BA 3WE3A 2VLAA 1PO11 1AYN2 1B9MA 2PQQA 3TRSB 1RXFA 2DUOA 2ZKLA 3IWFA 3W2VA 3T0YA 3ABUA 5ABJA 1LU2A 4O9GA 2UY9A 3WP4A 4URAA 3ES4A 3T8RA 4RQPB 4FPCA 5D6FA 2QZ3A 3IAS2 4EN6B 4RD7A 1IXSB 5I0RA 1QJU2 5M5YJ 4DW6A 3D82A 1EP0A 1QJU3 5DABA 2ID6A 5FXWA 2XG3A 2G7HA 1A31A 2BFUS 5IP7J 5FZLA 2IAIA 3IDBB 2OQ6A 4WM8A 2WSVA 3ZMOA 3GF6A 1QJY1 1FNYA 4V1PA 3U37A 3M8JA 4XBFA 5E8IA 1G2HA 3WDUA 1UPIA 3WSOA 4OIRF 4HVOA 2TDXA 5DXDA 1FTTA 1BR1A 3OF1A 3KZYA 4LK1F 4XTMA 2X4HA 1E0EA 1H0BA 2H6CA 1FSEA 4FVVA 1PZ9A 1K79A 4XFHA 5K5RA 2ARCA 5GLTA 3BPSA 3T0AA 3CCRI 2LY2A 3LQCA 1Y3TA 4JRAA 2C1FA 2KZGA 2L02A 5EG0B 1H9WA 5E8AA 4ZYEA 2RJKA 1D1AA 3ETQA 3NRUA 3D8CA 4QPQA 1GWLA 3ABLH 5G05L 4QX3A 3BLYA 4IGQA 2HXIA 1XPXA 2RDRA 1AR61 1D8KA 2PJRA 3T4VA 5GTIC 3I4IA 4Y4YA 2V26A 1TZLA 1OYYA 2YGLA 3DPLC 4A3EJ 1JYIA 4AHYA 4JGZC 4S2DA 1LUJB 1VAKA 2DCJA 2PX9A 4AVPA 4L8QA 3QLQA 2BY3A 4CUGA 1DYPA 1MS4A 2W48A 2ACJA 1NLQA 2XVGA 2AH2A 4XNFA 4YLZA 2EBIA 1W4MA 2QQMA 4RGRA 3ZCOA 5AFBA 3PM1A 2BGPA 2PN5A 1OLQA 1O4XA 1KQ9A 5JOYA 4DXTA 4DYRA 2R7ZJ 5DCFA 1KFXL 3DXUA 4ES8A 3OMYA 4M3DA 2YC4A 4OVEA 4ZXKA 3F8CA 2WDBA 2QFEA 2XJUA 2P7VB 1AR92 4QKFA 3N05A 3ZRGA 3LB9A 4JYKA 4B48A 3K70D 4DZPA 1JYXA 1UZCA 4EZHA 2O7OA 2VUJA 4QHOA 2EIBA 2A73B 3PNAA 3U4XA 4YG6A 1DLCA 3E6DA 4JKLA 4AAPA 2UWAA 4NWWA 4AI8A 3R4DB 3J7YJ 4XXAA 2MC3A 1WW6A 2H94A 2RS11 3DBLB 3K4JA 5LLQA 2QEXI 5FZOA 3IN9A 2DW4A 1OA3A 1RUC1 2C24A 2R0HA 3O2PE 4Z07A 4P08A 2Y2ZA 3CDZB 2IT0A 3OB8A 1TWGJ 1SBEA 4MXVA 3J7LA 1EAH2 2DVFA 3MIDA 2NNNA 4M6XA 5HDGA 5T54A 4HA8A 3MGUA 4YW5A 2O14A 1U78A 4HQEA 3QU6A 4OIPF 4CCLA 2X8KA 2BBAA 5LEJA 3A02A 5DS9A 2HZTA 4UY8I 1FPN2 4X1EA 5B2GB 3HR9A 2STWA 5JZGB 1FPN3 1Y7BA 1HDKA 2CHHA 3AMNA 3GZNB 1DYOA 1YJLA 3OYLA 2JX9A 5A1AA 1JJ8C 5DDJ2 1I27A 1MS5A 4GQ7A 2EPFA 3CCMI 4N53B 1WHUA 4CCJA 5ILUA 5DDJ3 1QZEA 1UHSA 1R083 4BQ3A 4EN7B 1OA2A 4RYDA 4B1RA 5LHHA 4RAYA 2XONA 3VSLA 3QPTA 1UPSA 1FOWA 3ZYGA 2HFHA 1PGW1 4HF2A 4OHWA 3KF5A 1YCIA 5C5TA 1YS6A 1WGXA 3N9LA 2X6YA 3LOBA 1VBB2 1RJ8A 3I3LA 4BH9A 4PDKA 5FPZA 1TT0A 4FQGA 3K4KA 1ULPA 4E70A 1SFPA 1ND2C 2CWSA 5T5LA 4G7ZF 4Z6YA 2VU9A 4IESA 3BYWA 4PJ0C 5IP6A 5JVVA 3K2AA 4HOBA 1EY2A 2MH2A 2DCTA 5LHIA 3A0KA 5C8CA 2IXCA 1TP4A 4O6JA 2JIJA 1ULDA 3TEWA 5L7OB 4ISRA 1O5UA 3POFA 4UV8A 4ZPIA 4RLFA 1Y8RB 4CCOA 4GWNA 1TW2A 2RS31 1J83A 3LA7A 3GWZA 2Y64A 1HBXG 1UFMA 3B01A 2VXDA 3J26N 2FQ4A 2WQ8A 4LHKA 4LLGF 2W7NA 5K0UB 3FBIB 2X05A 1UZYA 4RM3A 3SCHA 2QSGX 4QKDA 2B46X 3RYKA 2HJIA 3TW7A 1PIV1 1E3PA 4IE5A 1ZZ6A 2VJIA 3K9TA 5CFCC 1H9TA 4Z2WA 3DEWA 1UYYA 1FMWA 1OKQA 5FRNA 2PYTA 1LHNA 3H8OA 1AYM1 4NQWB 4R1HA 3AL6A 2QQIA 3SDBA 2VPVA 2XHNA 3THDA 3JBG2 2G1MA 2J1EA 1KU2A 3JZVA 2FCTA 5F5IA 4WXDA 2EXJA 4EJWA 2EAAA 4FFFA 3RJRA 3BCAA 2LTPA 4YSFA 3GYDA 2DA6A 4AHXA 3ZXDA 3WW3A 4K2EA 3B9CA 1Y56A 4D5FA 3HB9A 4ENMA 1OLME 4IV3B 4MV2A 1GXQA 2PMUA 4HFSA 1A36A 3EB7A 4EJTA 2KLOA 1SDDB 3CP2A 2XASA 2A5ZA 4C2MJ 2XF6A 1K6OA 4RGGA 3SC7X 5FP3A 4GXOA 4P9LA 1OQ1A 4QDRA 3FZVA 1D4VB 5JI7A 5DTDA 5HODA 4TSVA 1L7RA 1XRUA 1SLLA 3VL8A 5EEHA 4GWMA 2D40A 1QZZA 2YUSA 3S1QJ 3AVSA 1OYWA 2VZ1A 4OHVA 2AXTC 3I3MA 3CO6C 2ZO4A 1ZNPA 4KMQA 3IIIA 4Q2FA 4P9IA 2FD8A 1XSRA 2WBMA 2DPUA 3LIGA 1CX4A 1YQ2A 4PF5A 1KU9A 3VBRB 4M0HA 3WDTA 4YFWA 3NARA 4Q26A 3T2TA 1R00A 2HYGD 3KT7A 3QQAA 1JI6A 1JXNA 3DYOA 1DPUA 5D8LB 5LBBA 3SXYA 3CMGA 3NW4A 4XQDA 2EZKA 4RB1A 4KGGA 1RUH2 3FFQA 2B7EA 4ENKA 1UYZA 4M74A 4NJ4A 3SMHA 3T5XA 4UF0A 3F22A 3K1PA 5EYRA 4DNYA 4KWKA 5FXXA 2GXGA 4HF0A 4E7KA 1BIBA 2WO2A 1XYOA 1BJQA 1ETVA 2X1DA 2AACA 2PAKA 1GNHA 3U75A 2IXSA 1MACA 5FV3A 4AGVA 3ABTA 2OQRA 5A2QZ 1IV8A 1WWXA 1BC8C 2GIVA 5GLVA 4G3YC 3JXSA 3CD6I 3ME2A 1H30A 2EINH 4UHTA 1YQAA 1QGLA 5D8AC 5FFXA 1ETQA 1JKPC 4D6RA 2Z99A 1UU5A 2DT6A 1IRZA 3BTLA 4AIJA 3J4UH 2EIDA 2GNDA 2Q2EB 1IPSA 3HHGA 3IHUA 2Y33A 1NK2P 2IPQX 1AZDA 1R1VA 2XUEA 3L09A 4HQMA 1X1PA 1MMDA 2G9WA 4XORA 3I4MJ 4INDA 3A23A 1KQ0A 5C5UA 4GH4B 2RM23 1AX1A 3GCXA 1FYMA 1NY72 2UURA 3HPGA 1OURA 1RUD2 1FYLA 4A4AA 4MGQA 4L18B 5DD8A 3BTCA 2E1MC 2O3FA 3KEYA 3ZR8X 2D5FA 1JZ7A 4BM8A 2VO5A 2X6WA 4XFCA 1ETKA 2VZTA 3K77A 2FDGA 5EZGA 2Y31A 3OYAA 3BR5A 2CQKA 4BAYA 1VQ8I 3K75B 3TO9A 4D7MA 1RUE2 4U7DA 1YRNA 1WW7A 4AM3A 4PBOA 1W0NA 5JDBA 2VJJA 3H5AA 2P6SA 5F1RA 5B1AH 1WRJA 5CKTA 1F2NA 4CU7A 1UD1A 1NOVA 1WPKA 5JSRA 2VUDA 3FLTA 3OSFA 2ORZA 2NVUB 4JQFA 3ZXJA 2OAZA 3CC2I 3M3IA 2DFBA 4HYEA 3ZSMA 3W58A 4AWDA 4XJAA 3VKLA 3KQRA 4LOCA 1D5VA 1IPJA 5BV6A 3P1IA 3BWGA 3SJMA 2R7WA 3ZDSA 2PAMA 4KQ7A 1GNZA 3VHNA 2Z79A 2ZGRA 4J1WA 3CO2A 3LQQA 1O7LA 1W9YA 3M1HA 4NIIA 2XGCA 5D2AA 4QD2A 1VQ6I 4AI0A 2WAAA 5C4WC 5AVPA 4C30A 2DBIA 2UV1A 4ZYAA 5JIAA 1DU0A 3KVAA 5M3MJ 2PELA 1USTA 3VDDC 2XSDC 3BJAA 5JOWA 1RESA 4XILA 2XJQA 5FMOS 1GZTA 1XSXA 5DEQA 4ANJA 3I8TA 5J37A 3TQNA 4ZYGA 5FZHA 1Z0XA 1QOTA 2XB0X 1L7QA 2VC9A 4XSXF 4M01A 2MLKA 1VBD1 1GHCA 2FCUA 1W0TA 3QYEA 3AKZA 2GIZA 1IKPA 1GP6A 1K5JA 3SZGA 5I8SA 4XONA 2A7AA 1GDTA 4UWDA 5LWBA 3EXUA 4KNYA 5J7MA 4XL9A 4BE2A 1E5HA 4JGZA 3U78A 3CJRB 3ZQLA 4FOQA 2P5KA 2EIJH 4JDNA 4FTBA 4Q5OA 4LOTA 3DV8A 1SVOA 4FISA 2M8EA 1I1GA 4BZ4A 4PQ9A 3N9QA 1E5SA 3OY9A 1TMF1 4A5MA 3G1OA 2E7TA 1NG6A 4PDWB 1GV2A 3FBMA 1WCKA 5AIPA 2R071 4HETA 1K78A 3ZYPA 1Q8SA 4R4ZA 4F7ZA 4MIMA 4UFIA 3O7OA 5K7PA 3PO3J 3SFIA 4CA0A 2FA5A 2A5YB 1KDKA 2RS53 4BU2A 2YU2A 1GV9A 4BDVB 2X48A 1YJWI 1X1DA 3DBRB 4KFCA 3WF1A 2F4MB 2CV6A 2NLRA 1MEC1 3Q5FA 2VPLA 3FXKA 5DZEA 3F9KA 1YO8A 3K10A 3RZDJ 4GJYA 4CDXB 1L7LA 4ASMB 5L36A 1MS1A 3FN9A 2KIMA 4FX0A 3OYKA 4P9GA 2EQRA 4PJNA 5BPXA 4GO1A 3IV5A 1VIWB 1JUPA 5GAHJ 1X8MA 5IT6A 2WIIB 2EJRA 1LNSA 1W2OA 2D97A 1ON1A 3IAM2 4W6YA 3F8FA 4CE8A 5EYXA 1ASJ1 3IMMA 4YFNF 1XE8A 3RZOJ 1AR81 3PJRA 5FRMA 3ERED 3POBA 1ST8A 4NC6A 4P1WA 1UMQA 3RZLA 3BJOA 4TYSA 3EMRA 3AKPA 3RSJA 2DURA 4S2FA 3T09A 2JECA 2XJTA 1SD7A 3HN1A 2Y69H 3WF0A 3FKJA 3SH5A 4DUXA 1PVEA 5E18F 3DYPA 1POV0 1FNNA 1OPMA 3ZFEB 2UXNA 5FBZA 2AGSA 5LA9A 5CA6A 3JRCA 2DV9A 3JRAA 4UXAA 5AVAA 3ZQCA 3NRVA 3IM0A 3IAQA 1FWZA 1CIWA 1UF2C 2XAQA 3BUCA 3GDBA 2VZRA 5HNHA 4RAGA 3T4HB 3Q8BA 2CYYA 3VSKA 1ACIA 1ND2A 2VH9A 1TW3A 5IT9Z 4ABZA 3OUIA 4MSVA 2XRNA 4S0HB 5F27A 5C8WA 2NPIA 3ZMSA 1K5MC 1NA1B 4W97A 1QJEA 5A7PA 2VTXA 4OHYA 3WNKA 2WAFA 1PGL2 3CF6E 1ZKGA 3AJYA 2QQBA 4F3QA 2GA1A 2DFHA 1NLSA 5IHRA 1RB8G 1BW6A 1FP1D 1JT0A 2LRDA 1NXD1 4C1WA 4NAMA 1JUHA 3JRFA 1MD0A 3PNVA 4XJUA 4EJRA 5GLWA 1IRFA 4PF1A 5C4XJ 4ITVA 3ZO0B 5LY1A 2DN0A 2ESNA 4L2NA 4BE0A 4XKWA 1OHFA 5J4YA 2GH2A 1CESA 3L2WA 5LA1A 1QJZA 1F31A 4B4RA 1CAVB 4NB5A 3KV4A 1GNYA 5F1JA 1WCQA 3I7DA 1OQYA 3TMOA 4EM1A 2ZSHB 5IK4A 2JSCA 1OT5A 3EJKA 3NNLA 5CFCA 4F55A 3H5RA 2K02A 3CF2A 2EZHA 2BDRA 3FE5A 3ZQHA 1W05A 2CTVA 1P2FA 3BZKA 3OOPA 4O3MA 2HQRA 2FEZA 5IAVA 3FBNB 2DTWA 2JDHA 1CF7B 3EYPA 1FEXA 3QRFF 3ZMDA 4HMZA 1D0ZA 1UOJA 4MFEA 4DBQA 1TWFJ 1RUG3 2O0OA 1VQ4I 5KHDA 4OQ9A 1CVNA 3ZSLA 3WDXA 3NV2A 5GLZA 3W6VA 2WNEA 1IPKA 1QDOA 3L2RA 4AL9A 4G94A 3ZVXA 2KFDA 2RGVA 4QPIA 2GC3A 1HRV1 4ZYDA 1QMJA 2NRAC 4LIVA 2OPTA 2OPKA 5JPMB 3MCZA 1UCXA 4ET7A 1SLTA 1BOAA 2OTLI 1ZBE3 1W5TA 4DQ2A 1MVQA 4XZUG 2DCKA 3VHPA 5FZIA 1IN7A 1H8TC 2UYAA 3K4NA 4XDQA 4EVIA 4U87A 1OCPA 1I5PA 1YFUA 4AEMA 2ZACA 1C8M1 2E36A 2XF5A 4CYCB 1QH6A 3D0JA 2W5FA 3AK0A 4V19K 4XLPF 2GP3A 3HWJA 4XIKA 3G6JB 3EO6A 4FCAA 4YVSC 1HB1A 5DDGA 4DY3A 5LA0A 5EZWA 3A2KA 4F52A 4M4RA 4JGYC 2I45A 3AKTA 2HLEA 2VZPA 2M87A 1EA3A 2WZPP 5JHUA 2L7FP 4XMAA 2DA5A 3VZMA 1UQXA 5BNOB 4FFGA 3OGVA 3OY8A 2LNBA 1ULFA 1YUDA 4QPYA 5FYTA 1SLBA 1A6QA 2B45X 4H3WA 3VODA 2AEYA 2UU8A 1JUIA 1VQNI 2ATFA 1EYBA 2B5HA 3M1EA 3I49A 1QKQA 1T2XA 1O3RA 4KWJA 2WAQA 3WQ0A 1FIAA 4OULA 3BOWA 4YRVA 4EM0B 2NYXA 3MIEA 2YU9J 2BY2A 5AONA 2YMZA 2DFEA 4BA6A 1RUI2 5H6RA 3M2MA 4Q4X2 4CDWB 1RTVA 2ISZA 1LHWA 1CAUB 4BHPA 1IXRC 2JA8J 1YFHA 1EJ9A 5M5WJ 1MMSA 2QTWB 2FQPA 3DPRA 4Q4X3 4HONA 4JQTA 3VYUB 2A07F 2BBYA 3NWKA 1MH4A 2K9MA 4CCEA 2XBO2 4ZH4F 5CLSA 3OYWB 1IGOA 4B3AA 2DA1A 3WR0A 1W2TA 2I10A 4XK4A 1O5LA 5D8AA 4KITB 1MNMC 3I2JA 3FM3A 5FB2A 4D8MA 1POV1 1IKQA 4YW2A 5JI9A 1K42A 2HQNA 2LKSA 2I5UA 1UY4A 1IGNA 1KU7A 5C9AB 5DUIA 1VBA1 1NCRC 2JDUA 1W6OB 4OMDA 5GPAA 3ORJA 4P9WA 1GOFA 5AC93 5FZ7A 1QNTA 1PGSA 2H0VA 3I3QA 3ELKA 2KHMA 2XH6A 1D4M3 4KL1A 1IUYA 4UAPA 3SQNA 1LOAA 3MPBA 3GBGA 3WW1A 5FQ0A 3G1LA 2XPJA 3BU0A 4XM3A 3F8NA 1ZVFA 4IDZA 3DLAA 2JA6J 4IE7A 4GKXA 2ZOEB 4CTEA 2YSRA 4UW4A 4HV5A 2W87A 4B7KA 3ITQA 4XURA 2KL4A 3F21A 2LVSA 4XFAA 2QZ8A 4JP0A 5DUVA 2ZAAA 2C6SA 1HKSA 1CIYA 1W36D 2DXIA 3DPUA 3NNMA 5JR3A 3E5XA 4KBZA 2O6GE 4KICA 4O5VA 4GKYA 2ZXWH 1NQDA 3FXRA 3B3QE 5HPOA 3DECA 2BE5F 2Q30A 3SHRA 4YGDA 4G9YA 4XR6A 5GZDA 1HW5A 3BALA 2BV6A 4NIGA 1NUKA 4H2AA 3BR2A 1SCRA 1W7PB 4MQVA 4CEWC 2PMWB 2D98A 5C4WA 3MDPA 4E7JA 1MBEA 4N0BA 3S57A 2LSOA 2BW3A 3VDDA 5TRDA 4HPKA 3RZMA 4AEDB 2JWTA 4AVCA 2EIGA 4YVWB 5D1IA 4XAAA 4KDPA 3P9CA 4A45A 3ZPLA 5JVTA 4QPGB 4RS5C 3TGNA 1EV13 4NHMA 3PUHA 2JA7J 1UX6A 3QU3A 1F5JA 2CAVA 4TWTA 3TO6A 3IZOA 4Q29A 1FOKA 4W4ZA 5ANQA 5FO5A 4AVSA 5LW9A 2RR12 2A6HF 2P5LC 1ND3C 5F6FA 3CHXA 4LLOA 4MO3M 5A33A 2Y0SA 2IS2A 1R36A 5ABJB 1BVVA 4CDUC 2HTJA 2O8QA 1UOGA 5D4RA 1RC6A 3ZSJA 4RAFA 2KRCA 1BOBA 1BJAA 3S0MA 1V3FA 3L2CA 2R16A 5LBQA 1JJ6C 2GOMA 1MJAA 1R1A1 4BK5A 1TME3 1CGPA 1COV2 3RQ0A 1B1BA 1QNWA 3SEQA 2A6VA 1COV3 1W8UA 2LF7A 3WDYA 2QKMB 4L99A 4AVZA 2ID3A 4CP9A 3T2PA 1G9BA 4WM8B 2EFPA 1NZIA 3GUDA 2RJ2A 3RJPA 2JPCA 4UNOA 1YIFA 2IWGB 2QLZA 2B4KA 3EBRA 4RHV1 4XABA 5BS6A 1QF3A 3U2RA 3NWTA 1MPXA 4BACA 2EFNA 3HOXJ 1Y9MA 1SG3A 3FHQA 3SKJE 5JCTA 4BDZA 2AZ5A 5GAGJ 3BOQA 5C3RA 4IEUA 3MLKA 3U21A 1S7EA 3L00A 4B43A 3ALQA 1I3AA 3CZ6A 1HXS3 2ZMLA 4KI5M 4Q4V2 5JLVA 1N75A 2JXAA 4B4CA 2HWB1 4Q4V3 5HCHA 2B9UA 2QE3A 1UCRA 3P3PA 2ADEA 3KP6A 2VQCA 4P9YA 1OVPA 3SKVA 4QPWA 3E1SA 3NAUA 1RHI1 1SBDA 3R4UA 1X9TA 1RNLA 3MKYB 4Q1RA 1U5TC 5J8FA 2ZGQA 4URTA 2PJRB 5DCMA 5LD2C 1HQNA 2WT0A 1N1TA 1JU4A 3LEKA 2XGXA 2RVCA 2Z42A 2DA4A 2HQ5A 1J5YA 4C0HA 4ASLA 4XLNF 3H36A 2OX0A 4TZDA 2JZYA 2FU4A 1KJLA 2VOKA 2CG4A 1AKHA 4LORA 1VAVA 2RN7A 1BQPA 5CU1A 4H4KC 2ET7A 4LBMA 5C3QA 4JTNA 2PHLA 4KU8A 4DBRA 5FR3A 4PLMA 2C9KA 1LGNA 1PDNC 1Z0HA 3WT3A 4B4PA 2EALA 5ICFA 2XMLA 1V6KA 1YIPA 1S2KA 1FZPB 4XJ8A 3UJQA 1KFUL 2VCCA 5FD5A 2G9FA 3O1SA 1UY3A 4BB3A 3FXUA 1HIXA 5FZ4A 5IOZA 5EJ3A 2DDAA 3CUQC 4GRIA 5BY5A 2VB6A 2WB1A 4XLHA 5BNPC 1VQ7I 2LC2A 1H8VA 2CYFA 1Z7S3 1K5MA 4OOIA 3N36A 4UYBA 4LO4B 2EXKA 2ZMEC 5JR7B 4X6AJ 4IEOA 4BWOA 3OYIA 2NOGA 4FPKA 4KT6A 2VASA 3T8TA 4YFXF 1A6CA 3Q0UA 1AL0G 2IUWA 3M8FA 2K9SA 5A7QA 2Q0AA 3KFWX 1RVF1 3KV6A 5FJKA 2RAEA 4XE9A 1DQ4A 4OI1A 2CO5A 4N90A 4LKEA 5FZOB 4B1MA 2PMZA 2XJRA 1W2NA 4YYOA 2WL1A 2OIIA 1NH3A 1CR7A 4BJ6C 2DMNA 3BN6A 4JK1X 2VW0A 5EJ1B 1NX9A 4QXCA 3CDIA 3SEEA 1RUF3 4GDFA 1VJ2A 1AL23 1B09A 2J1RA 4KJZA 1VMHA 4CCKA 1RIRA 1YQ8A 4G6QA 3FHIB 2JB8A 1M06G 2AC1A 2KIFA 3WTZA 2WLPA 3K51A 4XKBA 4NE9A 3EQLF 1GUUA 2AENA 1B8IB 3ASNH 3S1RJ 1T6GC 2R49A 4XAEA 4W8JA 2ZGPA 2MEV2 1CONA 3GF2A 2PHWA 3MZYA 3GTMJ 2VL4A 1NCQB 2CS3A 1XN7A 5J40A 2GAUA 1QJX2 1HKQA 3J81Z 2WAQN 2QM3A 1ZBA2 4ENNA 1HSJA 4GB31 4HF1A 1ZBA3 2XUBA 1DGRM 2JJ7A 4PJYA 1LJ9A 1XMAA 4DXSA 2MD0A 2E2JJ 4NHKA 4AHZA 4A3DJ 4FPLA 1UZ0A 3SNMA 4CU8A 1S0EA 2LRPA 2RV8A 5FO8B 2CQQA 4EMSA 3MIGA 2J5OA 2ARAA 4A3IJ 3N97A 2DMQA 4GJZA 4PLNA 1HSTA 3USUA 3IUOA 1GWMA 2WZEA 3CJTB 4OYUA 4MX3A 1AYN1 2R3SA 1XCBA 2Y6FA 4QX2A 4WX9A 5C8CB 2W68A 5FLXZ 2P5BA 5FZ3A 3NNFA 5F6LB 1IAWA 1ULOA 4RN5A 4BDYA 3O1MA 1H8TA 2Y0OA 4LPLA 1IS4A 4HN0A 5IVCA 3IC7A 1D1BA 2P4EA 2DFFA 1I6HJ 3ZIXA 2R5YA 3AYCA 4GZ9A 4YVSA 4LEJA 4CUAA 4HX4A 2JRTA 4A7YA 3BTXA 2L7MP 1SVMA 4JGYA 3ELNA 5A6QA 1TWAJ 2KMUA 2XXZA 1V5FA 1PYVA 1W6QA 4HKOA 2EA2A 5E3LA 3S17J 1P4XA 4AIHA 4DYCA 1CAWB 3PU3A 1YYVA 1MJBA 2STTA 3OOXA 9ANTA 3QP6A 2I74A 2W57A 3WG2A 3H3LA 3PMEA 1A04A 2WA3A 1BXHA 3M1CA 4H14A 2K0GA 1H88C 2BHZA 2K7LA 5H6QA 2E7AA 4QKNA 5EPAA 3OIPA 1VQ5I 4UW5A 1YITI 3G6EI 5J98B 5F37A 2DMPA 4YW7A 1YXWA 1VI0A 4CGZA 4IJAA 3GCWA 2JD4A 3ZQIA 4N7IA 1U12A 2R7QA 4W6WA 3HRMA 3FMRA 3MKWB 3VPRA 3L2HA 1JH5A 4I0BA 3QAHA 4YG0A 4V2FA 4DOUA 2IS1A 4LBQD 4B7EA 3HGGA 4RGKA 4BQXA 4I7HA 1T56A 4ITCA 2OZUA 3HJEA 4QWNA 3FXOA 2E9QA 3WINE 1BCXA 3CCLI 1NCRA 1LHVA 3PLQA 4IOCF 2D6LX 3JR9A 3CIHA 4CA9A 3RI4A 5DQ0A 3ONQA 1IN6A 1F43A 2XKPA 3KV5A 2ZSIB 1AR91 1LJ7A 2F5EA 5BPDA 1GLHA 2Q4SA 2QQUA 5L3BA 2ZHMA 4RFRB 3GZTB 3RKWA 3BP8A 4W1UA 2SLIA 2QYOA 3Q9VA 3M4FA 2LALA 5A6XA 3HRTA 1OPCA 3IAPA 2FDFA 2LMDA 2PHFA 4QGLA 1M1EB 5ACA3 3PVBB 3DPTA 5J3LA 3NQHA 2ZGKA 2HI3A 4X8NA 2KDZA 1GANA 4MGRA 5BUVA 2UWMA 1HDPA 4P5YA 5FZ0A 2VVDA 2NVXJ 3HPNA 3VBFA 2RNJA 4E2QA 4YM3A 4UF0B 3QACA 1EAH1 1WJ5A 1IRXA 2WR9A 3SH4A 4HDVA 1ETWA 1R093 3N9MA 2ZXJA 2AQFA 3SZTA 1FOXA 4R9BA 3WGGA 4E6KG 2DBBA 2R063 5JIUA 2MYSA 2HEVF 1ODNA 3L7WA 3HVDA 3OR1C 2B42B 1ZR4A 1BBT2 2E7QA 2DA2A 4XSZF 2KXLA 1A8DA 2V5DA 2E33A 4OHXA 3WTTC 1QU0A 3LE0A 4HLYA 5FLIA 4CEWA 2OD5A 3VKFC 1DQ0A 4AG4A 3IPVB 4EWDA 1W0PA 2B7YA 1ZA7A 2M4GA 1C57A 2FX0A 3JD72 2E34A 1OLTA 3MZHA 5CFDC 1Y0UA 3JD73 3BG6A 2W08A 3OGRA 4Y24A 2RC4A 4OMYA 3WF4A 3DYMA 2HQAA 3HQUA 3LNQA 5GZEA 3HEIA 3OYFA 1VBB1 2ISYA 1CAXA 2JB4A 1JHFA 2ZEWA 4BOWA 5F39A 1IXCA 4F93B 1OLRA 2IEKA 1WA6X 1PMIA 3CTAA 2MD5A 2OZ6A 4LO6B 4Q4W1 1WW5A 3KYCB 1DQ6A 1ND3A 2DUPA 2VCAA 3SFZA 3S15J 3PIGA 2ZGMA 1OI6A 4CDUA 3WNXA 3VZNA 1Y43B 3N7MA 2VE8A 1YRNB 4LHLA 3AFGA 1PO23 1T0FC 3T1BA 2M5WA 2EV0A 1BYHA 4PJMA 3AYAA 5ANNA 3LF7A 4LMYA 2WNUC 3KVBA 3NJYA 1G6NA 5FYIA 3CDLA 2K4BA 4DQAA 1YI2I 1REDA 5BXXA 2KP6A 1W04A 2LOOA 1UMZA 4A2UA 4XFBA 1JODA 3UGHA 3O1OA 2FD5A 3TOBA 5H9PA 3H92A 2CQNA 1F4AA 3OL3A 5IYDJ 3GTLJ 1P6RA 3MWMA 4LA3A 4EQQA 5HV4A 5CVIA 3ZQ7A 4COYA 3CP8A 2PQ8A 4ZHNA 4AD9A 3TBIA 3H7YA 1Z05A 2CV2A 3ACHA 2PLV1 1XNKA 2PA7A 2ZEZA 4QQHA 2GP5A 2R92J 2ZHNA 1RMU2 1GXPA 3ZXSA 5FY5A 1RMU3 3JBG1 3LL7A 1ZZ8A 4M9ZA 4UOJA 2E6VA 4AQTA 3H9AA 1NZCA 3CF5F 1IRGA 1JI8A 3I2KA 3CQZJ 1Z91A 1MBFA 1U5TA 1DDLA 2J1TA 2BVVA 2HYJA 1NE4A 4LUKA 3C18A 2JTVA 2G9ZA 3QH6A 4E7LA 1D0GA 1DU3D 3G3ZA 2DA3A 1SDWA 2CQ7A 3JQWA 3UL2A 3J8F2 3TO7A 4FXKB 2XF7A 4OI0A 1BK0A 2E35A 2BY0A 2V4VA 1AXZA 1ONAA 5JOXA 4XHXA 2XQXA 1LFPA 1QQP1 3BQYA 4NRPA 3JCIA 3S7IA 2JDPA 4IEVA 1L3JA 4YIFA 1WKMA 2JG8C 5GZFA 2Z9OA 3O0WA 1A6IA 3WG1A 3ABZA 2V1XA 2FNPA 3KP5A 1K78B 3R60A 3W5NA 1JMUB 5E1WA 1PX3A 3PIJA 1AHDP 2DT7B 3CUQA 3P5BA 4YZ4A 2X1EA 5BNPA 2ZXIA 2W39A 3C7OA 1R58A 5IK5A 3RYRA 1AXYA 5FYZA 2ZMEA 2WT1A 4BQAA 2CGPA 2K85A 5AFEA 4D6SA 3K1MA 3APBA 4JV4A 3VL9A 4DO0A 1GQPA 2JD9A 2FOWA 3U1DA 4I02A 3UKGA 2Y9ZA 2WFF1 2HWF1 2ELJA 3HN3A 2NVTJ 4M9XA 3GBWA 3KSCA 3REOA 1H89C 3K4BA 1KYWA 2GQQA 2GZWA 1IG7A 1AR72 4Q8LA 3ZXEA 4LE3A 4HBLA 1RUH1 5EYYA 2PEXA 2OQ7A 3DFGA 2D43A 5C33A 3J80Z 4XUQA 3AYDA 2K9QA 4XKVA 6PAXA 4N43C 4DINB 2LY1A 2D44A 4JTOA 2WWSA 1FJLA 4ATFA 1H9GA 1QQIA 2ORXA 5F3CA 5IJRA 3OD0A 3AG4H 2RJLA 3KZIC 4IHVA 2ZZJA 2A6XA 1JZ4A 2LROA 1IN5A 2HDWA 4E4SA 2UZKA 5M0TA 2JDYA 2QQWA 1WCUA 1HRI2 1RI7A 5A3WA 1YX5A 3FHZA 1UAAA 1WCSA 4LJHA 1GBGA 3ESWB 5CBLA 4XUTA 5C71A 2F5VA 2EZIA 5FFZA 4BISA 3V0BB 5J48A 4AAXA 5HCFA 2DOAA 3H1WA 1YQ6A 1RUD1 3QD6A 3HKZN 3QOEA 1ND2B 5A32A 2WO1A 2ZPXA 3MIHA 3H9GA 4L5EA 3S3MA 1YI7A 5F3IA 2M30A 3RQ4A 3I97A 1V9U2 3VD7A 1XD7A 4LULA 2ZKNA 1PO13 2EFOA 5KAIC 5HCAA 4HRIA 1MNDA 3ZN4A 1RUE1 1OLMA 4WXCA 4LUMA 3VZOA 2L7ZA 2Y34A 2RQQA 1XQNA 1TT5B 3HTUA 3RS6A 2K40A 3OGGA 1SLIA 4P00B 3I71A 1UOFA 1X1BA 4LK7A 4BQNA 2J7MA 4FFHA 4AYBN 2ZTNA 4QQOA 4J1XA 2IJLA 3OOUA 2WS92 2D45A 4FX4A 3AMMA 3F95A 4K1YA 1FTZA 3WHUA 1QJY2 2FMDA 2WYSA 4XDOA 2BBVA 2W94A 4K6BA 4CO8A 1QJY3 1HX6A 2PAEA 3LZZA 3MF9A 4WVMA 5IK8A 3DLLF 4QX5A 1LOFC 1ZELA 5CFCB 2CW8A 2Y6LA 4LITA 5F0FA 3CJIC 4Y4RA 1P8JA 3IKWA 1DGWX 3F6VA 4I6ZA 2XUMA 3HXLA 3T0BA 3IMNA 3KQ4B 1WI9A 3LFIA 2JUCA 1R5GA 2WA0A 5BNQA 1LVKA 2R7SA 5KWRA 3OYJA 2L01A 1UKRA 2GC0A 3I53A 5E20A 3RZZA 1C5HA 3THTA 2FBIA 4CCNA 5DN2A 3I64A 4GGGA 3PSIA 2EICA 1GYKA 5A6ZA 2R32A 3LFKA 1GZWA 3AFKA 5A7SA 3WP5A 2NAZA 2BOLA 3PL0A 5J3UA 2D6PA 5D5UB 3LCPA 1AR63 5IATA 4IV3C 2J1AA 1DLLA 3AP4A 2E1OA 1R1UA 4L5JA 1S0DA 2JVGA 2YU1A 4C8DA 4QDQA 3ZOIA 2LBFA 1V6MA 5EEAA 3MLJA 1X3UA 4MQ9F 4WCGA 1H9PA 4XN3A 1FMD1 1W9SA 2ZABA 1WD4A 4XVHA 3E3VA 3WODF 2HBTA 3WEZA 1OUSA 1FOYA 5GP9A 2QDNA 3ZXLA 5ILSA 2CWEA 4R8HA 1R1TA 3ACGA 2R042 4YG3A 5LGTA 2EA4A 1W8TA 2YS9A 4HK9A 3ZKUA 5F9TA 4XHBA 3CMEI 3TDUC 3PFIA 1SD4A 4EN0A 3HBKA 4BNCA 3RGBA 4YNIA 3QWLA 1W28A 4COZA 3KHCA 4E8DA 5J47A 2E60A 2J5PA 3OY8B 5L9VA 3ZSEA 1PMJX 3LOIA 4LGWA 1UO9A 4YIRX 3EDPA 4CPBD 1S0BA 2HU9A 1ZK8A 2WJSA 4MGSA 2P7CB 4LLFA 3ML6A 3CMMA 1U3EM 4KMUX 2P3JA 2RS12 5E3OA 2CL2A 4XYXA 5DG2A 4K7JA 4FT8A 4TLFA 2JICA 3QPLA 4AIKA 4UVAA 1E57A 2RS13 3JRDA 2FXAA 2OBPA 4I3GA 1AHSA 1DU6A 1RUC3 1VBC1 2BJSA 2LK2A 3JAMK 1H4HA 2ZCWA 1WBFA 4A0XA 4Q4Y2 5FPLA 5FYCA 1LAJA 2GM4A 5LBFA 2KPMA 3GFJA 2WNVC 4MGIE 3JW4A 2H09A 1O3SA 5KVRA 2WWUA 5T5PA 4UUSA 1QNYA 2JE8A 2PTMA 4JOMA 3FZ3A 2VTXJ 2MBFA 5D8AB 1O59A 3MIBA 1O3TA 3KB5A 2F6CA 3HOYJ 2F4IA 2EA7A 2H1KA 4J6GA 1G3YA 3OTFA 3I5UA 2KIUA 4OIQF 3MAJA 1EPWA 4KBBA 1YQ5A 4CZCA 5K7HA 2ZHKA 4A6OA 1OPOA 2OVUA 1JE8A 1OCCH 1HW2A 3PUAA 3BODA 4IHXA 3CL1A 1YI9A 2DOEA 2RQPA 3LSEA 4A0ZA 5EGOA 4UW6A 2VOWA 4C90A 1GP4A 1ZN2A 2E1MB 2NVYJ 4UBGA 1APLC 3PJQA 3O1PA 5L9RA 5FQ0B 1S55A 3ZFGC 4PFPA 1SCSA 5DAWA 5A7NA 3AXEA 3AL0C 3TOJA 3LSKA 2VR4A 4CEYC 2QWWA 3LOCA 4QXKA 3WF2A 4LK6A 3WF3A 2RNGA 2BW8A 5FKLA 4LLNA 2WNUA 5D8KB 1D0XA 1DQ5A 1YFWA 5CQEA 3AP7A 5B3SH 2Q8EA 2WQ4A 2ZXQA 4IRHA 5H2FC 4W50A 2RS32 2W1OA 4RDUA 5DAXA 4E9KA 1W6PA 4PK4A 1W6NA 4LBJA 2RS33 2FRHA 4FSJA 4AGRA 1VQLI 3O1VA 1Y4WA 4AFAA 2WLQA 5FMBA 1M4WA 3GZ5A 3BG3A 3DKXA 3DEEA 1QZYA 1ZARA 3ZGKA 2CSOA 1T38A 5GJ6A 4QHZA 3LSPA 2GMEA 5C4WB 1BN5A 1PIV2 5HNFA 3BQZA 5LGUA 1BIAA 1YIOA 4E4ZA 5KBFA 2BW3B 2CU7A 3VDDB 1PIV3 5IVYA 1T6BX 2R7VA 3C3VA 2VE9A 4HPKB 1AYM2 1JZ3A 1VQPI 1WMFA 3OYNA 1JHHA 2A3XA 5CEHA 2EIKH 2Q5TA 1D7PM 1REEA 5ILVA 1HN1A 4IGPA 4DUVA 3M07A 3IB3A 1UG2A 1AUYA 1K83J 3PNTA 3WQ7A 2VONA 2YGMA 4P9JA 2K9NA 1W3VA 2HGCA 3OIQA 2JJ6A 4E7SA 1DUXC 4YPJA 5I0SA 4Y5SA 4A69C 1Y1WJ 1FYKA 5A33B 1YIJI 1IOAA 5JLWA 4LO7A 2CV0A 5FMOL 3OS1A 1ZZ9A 4AW7A 3VFZA 2R7EB 1CZSA 4OINF 3W20A 4JC1A 1ODDA 2A61A 2JIGA 2HOAA 3H1MA 2JG8A 2DA7A 4QM8A 2IXIA 3RZKA 2VZOA 1XTAA 4Q1PA 3F6OA 4CP9B 2B9SA 4BXXJ 1N25A 2VUCA 2X0LA 1LEDA 2R7FA 1LEAA 4FAGA 2WQZC 1VRH2 3MYXA 3VKOA 3ZMNA 1ZREA 1XC6A 2H6BA 5FUNA 4UUVA 3VN4A 4QMAA 1APNA 5JWPA 4ZZDA 4CP1A 4H0EA 1J84A 1NE6A 1US3A 4RB2C 5FIXA 1W8WA 4NMIA 2YX7A 1K61A 3HQXA 1SAXA 1UOBA 5F7UA 4YIIA 3IH3A 1J3QA 2HR3A 3E5UA 4N43A 4BJ0A 3KT1A 3RDIA 1OKOA 2KT0A 3P5JA 4IL6C 1RUI1 2QUFA 1QY4A 3FFZA 1KQ8A 1IV6A 3I3DA 2BGCA 4QQLA 1BI2A 5DCMB 4XF1A 1TEIA 2D6NA 2VOXA 1OF4A 4YW4A 5K7FA 1VQ9I 1OD5A 2FBHA 4YW6A 2VZQA 2XBO1 2V1DA 3WG3A 3D0SA 4HX8A 3M8EA 3SHFA 4MGZE 1AKHB 3WNLA 4NO4A 4YFZA 5EF6A 1H1MA 3KWVA 4M3CA 1UMIA 4IO9F 3KD4A 4NHLA 2J42A 4HXCA 2PHUA 1STZA 1C3HA 4HV6A 1MMAA 5F3GA 5D21A 4HNUA 4JDOA 3K4ZA 3ZFEC 1R5ID 3AX4A 3A1YA 2WV1A 4ZDOA 2JEMA 3VBSC 4P9FA 1G59A 3K4LA 4M4PA 3ZYRA 3BJ6A 3ON7A 4A3FJ 1IDZA 1RUJ3 1ORKA 1JT6A 3RZGA 3S8PA 3PFYA 3WQ1A 1UZZA 3D6EA 4IHWA 4RBOA 1V00A 5FRAA 2WZR1 5E79C 1UZVA 3E6CC 5EXOA 4H55A 1K5MB 4AEJA 4U88A 2QF7A 3UR3C 1J9IA 5FKCA 4AFDA 4B47A 3A01A 1PVC3 1D2SA 3B02A 3ZQGA 3HQRA 2GWRA 1V6NA 3S1MJ 1JW6A 3ZMZA 5FPUA 2W46A 3POYA 4C3JJ 2JA2A 2LH9A 2X6OA 1C1FA 4DZJA 4U2AA 4CHUA 2ZGTA 3MFCA 4PZJA 3WHBA 1DGRN 3H8UA 4XJ9A 4FETA 4XFGA 5I0UA 1LGBA 5IPAA 3MD2A 1SFOJ 3IDAA 4DS0A 3B9IA 1L3LA 1YJKA 4PIXA 5CVRA 1IW7F 1KYZA 2HXOA 3DBHB 4PLOA 1FLIA 2QQ8A 1BI3A 5E1RA 2BXZA 4XPVA 2L2OA 5KK1A 1SBFA 1DG6A 2AQEA 2V4AA 1FOD3 1S4CA 2DDUA 3HPHA 3O0XA 2Q1ZB 4LTAA 3SYTA 3ABKH 1LOFA 1PMHX 4WM7C 1ZLKA 2EV5A 3CJIA 2Y75A 4UFHA 1UU6A 4II3A 1YW9A 1G9FA 1EH6A 3I59A 2VKVA 2PFBA 4XIOA 2FQ3A 5JXJA 5KXEA 2KZVA 3O3KA 4C1XA 2DJNA 3FXLA 2VQTA 3LIHA 1JGGA 2E2HJ 3SXWA 4AE2A 2KRFA 5FLHA 1AA7A 3FK7A 3RWNA 5FY4A 3DP7A 2JE9A 3H0OA 4YGBA 3USUB 1P7IA 1VBD2 1KD7A 2RR11 4XRFA 1RETA 1U9NA 2GC2A 2P6HA 1KA8A 1SFEA 4IV3A 5CADA 1FBQA 1VBD3 4GYIA 4IRGA 3DTEA