2Z2SB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
182
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRDPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
molecule keywords RpoE, ECF SigE
total genus 40
structure length 182
sequence length 193
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z2sB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z2sB02
4Q0SA 3M70A 3CLPA 1WLTA 2DCTA 3U0ZA 1CAWB 4XF0A 3OD0A 2OZJA 1JUHA 2BEOA 2MHFA 3S7IA 4QXKA 2B5HA 1J1LA 3PVBB 2K9ZA 1ZVFA 3JZVA 4HN1A 3EO6A 2OZ6A 1LRHA 3RZZA 5E1RA 3S7EA 1O3RA 3SMHA 3IBMA 4H7LA 1EYBA 3FX3A 3OF1A 2EVXA 1ZZBA 4J1XA 2Q1ZB 4E2SA 4HN0A 3WW3A 4PIZA 1XRUA 4IERA 3QACA 4QGMA 4K8FA 5FPZA 3O14A 2GC2A 3MYXA 4HLTA 3ACLA 1QXRA 4PIXA 2UY8A 1ZZCA 3MPBA 3HT2A 4YARA 3GYDA 1UIKA 4IEZA 4WVZA 4XF4A 3NW4A 5J3UA 5FLIA 5I0RA 1ZRCA 1CAVA 4QGLA 5KHKA 4N9IA 4YRDA 4META 4IEXA 1YUDA 1O3SA 3I7DA 4IETA 5FDBA 5KBFA 1SFNA 4QM9A 5JSPA 3H50A 2Q30A 2IXHA 4MH0E 2ZCWA 1XE7A 4GULA 4L11A 1CAUA 5LRSA 3KGLA 1ZRDA 2QNKA 2CAUA 4MGZE 1SQ4A 2QCSB 1OI6A 2P17A 1O3QA 4JTNA 3IDBB 4E2QA 3NVCA 3L2HA 1IPJA 3IIAA 1UIJA 3RYPA 3SCGA 5KHIA 5BV6A 5JCTA 1X82A 3H3ZA 1HW5A 4IEUA 2V09A 4Q0VA 1YFUA 1LB2A 1NXMA 3LWCA 5JSRA 1WGPA 4AQ6A 1Y3TA 3D0SA 1I5ZA 2EAAA 5HI0A 2XL9A 4IEOA 3RNSA 2XKOA 4FBFA 3FFQA 4F7ZA 3DKWA 4YNIA 5CU1A 2PQQA 1FI2A 3RYRA 3E6CC 3H1WA 4XFGA 1TQ5A 2D5FA 3R6SA 2PTMA 3OTFA 5J7MA 2OPKA 3RYKA 3IDCB 1SEFA 3BALA 5I0TA 1O4TA 2GC0A 3UKVA 1ZZ6A 1GQHA 3H1YA 4AQ2A 3M3IA 4MGYE 4LUMA 2GU9A 2GH2A 1YHFA 2WFPA 1H1MA 1GQGA 2ATFA 3WW4A 3HQXA 1YFWA 4J1WA 1Q3EA 3LA3A 5I8TA 3I59B 2MPFA 3DV8A 4X6QB 2BNOA 4MGIE 1CAXB 2VQAA 3DL3A 1UD1A 2D93A 2Y0OA 3FE5A 2E9QA 5JR7B 5I8YA 2PHDA 1ZX5A 4EV0A 5BXXA 1ZRFA 2MNGA 1UPIA 2CGPA 5LEJA 4KL1A 4EWEA 5J48A 1CAUB 1CGPA 4XFCA 1O7FA 1RC6A 4EWAA 1L3JA 2BGCA 1UCXA 5KHHA 4FAHA 3LA7A 4OLLA 5I0UA 4ZU7A 2O1QA 4CYDA 4ORFA 4E2GA 1VR3A 1VP6A 2VPVA 3NL1A 1J3RA 1PMIA 3HT1A 4QX5A 2QVSB 2BNNA 1OMIA 5I8SA 1I6XA 2GZWA 2VECA 3KGZA 1Y9QA 1Q43A 1O5UA 2Q0AA 4NVPA 3SXWA 5C6CA 1OFNA 4I09A 3QOPA 5JAXA 4R52A 3E5UA 4IEYA 4UXAA 4XFIA 5KHJA 1RL3A 4R8HA 4Z07A 4HVOA 3H8UA 2K0GA 5D1IA 3OCPA 3H7YA 3H9AA 4I02A 4BYYA 2PFWA 4D7TA 1EP0A 1XE8A 1DGWA 4KU8A 4YYOA 3LAGA 2ET1A 1J58A 3HIFA 2PAMA 1DZRA 4AVCA 2Z2SB 3H1MA 1NZCA 4O9GA 1YFXA 4OFGA 4Q29A 1ZZ9A 3D82A 2PA7A 2XKPA 5E16A 1X8MA 5I0SA 2XHKA 2UYAA 1X8EA 2B9UA 1YLLA 2IXLA 5C8WA 1U12A 2ZKLA 4EWDA 1RUNA 3BB6A 2I45A 2PHLA 4I2OA 5AVPA 4I0BA 4AVAA 4HVQA 1PM7A 1ZREA 3U11A 3PLQA 3WW1A 2XGXA 4KU7A 4IEPA 3USSA 4QM8A 3CO2A 3ST7A 3E6DA 3SHRA 1CAXA 4O9EA 5I93A 3FZ3A 4Q0QA 3NJZA 2H0VA 4HSJA 4TLFA 3EBRA 2WC2A 3G7DA 4FT8A 3H7JA 2D40A 3MDPA 2XLFA 1QWRA 3WW2A 3ROUA 1Q5OA 1DZTA 1EY2A 2Q4SA 1RTVA 2XL7A 2XLAA 4IEWA 4IEVA 4LA2A 1FXZA 4AVBA 3VHRA 5LRRA 2OA2A 3BPZA 4FAGA 4B29A 3FWEA 3SCHA 2PYTA 3ETQA 5FLHA 3OGJA 2ET7A 4ONUA 1DGRA 5I91A 3E6BA 4Z82A 4JTOA 4XEZA 2QJVA 2EA7A 2IXCA 4MV2A 2HKXA 1IPKA 2UYBA 3N4MA 4AXOA 2CAVA 2OYZA 2IXKA 4I0AA 1J59A 3HUGB 3H3UA 3KSCA 4KWLA 3B02A 4LTAA 1ZRRA 4LULA 4I3PA 3LZZA 2HJIA 4HMZA 5FPXA 3BCWA 4KWKA 3RPQA 1RUOA 2O8QA 1FT9A 5CADA 5KHGA 5K8SA 3I59A 1NE6A 4L2NA 3GBFA 4Q0PA 2H6CA 2KXLA 3D0JA 4KWJA 1NE4A 4WBBA 4MZUA 2C0ZA 2GC3A 4IEQA 4PJYA 4HSLA 4XFHA 5JSOA 4PIYA 3KMHA 1QXJA 2GC1A 3NSTA 5EZWA 1UW8A 4P9GA 2IXJA 4ZU5A 1ZZ7A 3CL1A 3IWZA 1J3QA 1RGSA 3ZDSA 4NQWB 4LLOA 4LUKA 4UBGA 5F1RA 3UKNA 4BHPA 4BIFA 3RDIA 4D7SA 3BU7A 4N9HA 4XF3A 4XETA 2Z69A 4JVAA 2FQPA 3SCFA 2ETEA 1V70A 2F4PA 4QGNA 4XFAA 3CJXA 3I54A 4A2UA 2IC1A 2GAUA 4XF9A 3EQEA 4JV4A 3ES4A 5BY5A 2QDRA 3E5XA 4MGKE 4XFFA 4IESA 1YFYA 4LA3A 5EFUA 4YSFA 1LKNA 1OD5A 1QY4A 1ZNPA 3E5QA 3LOIA 3EJKA 4RD7A 4EROA 5BPXA 4BH9A 4I01A 1X7NA 3C3VA 4MUVA 3E97A 1CX4A 5FQ0B 4HZFA 1O3TA 4UBHA 1CAWA 3CEWA 4XFBA 4X6RB 4QMAA 1G6NA 4HVRA 4DINB 5LEKA 3KCCA 3MZHA 2H6BA 1WA4A 5FQ0A 1H1IA 3LA2A 3UKTA 2IXIA 4Q0UA 1O5LA 2BNMA 3FJSA 3EHKA 2D5HA 3DN7A 1CAVB 4HBNA 2B8MA 4XF1A 1YWKA 3CF6E 4WZCA 2XLGA 1J3PA 1VJ2A 3NKTA 4MX3A 5BUVA 1NYWA 5FCCA 4ZU4A 5FLJA 5T3NA 3FHIB 2N7GA 3TNQA 3U10A 2PAKA 5CVRA 3ES1A 3TNPB 1EPZA 1ZZ8A 4F8AA 1LR5A 2CV6A 2BYVE 2PAEA 2UY9A 3PNAA 2FMYA 4LEJA 3S0MA 3ELNA
chains in the Genus database with same CATH superfamily
4NE9A 1WKMA 1I1SA 3CLPA 3W5NA 3ZSKA 1Y0UA 4DYCA 1XE0A 4LOSA 2OT7A 2Z99A 4A3GJ 3IP4B 5F37A 4MHRA 4YZ3A 3R0RA 3TDUC 3BG5A 1SAXA 4EATA 2XUBA 3SMHA 3VOEA 5F0HA 2ICWG 3AP7A 1NA1A 2TRTA 2PHRA 5FYYA 4XAAA 3FX3A 3ABTA 1WRJA 1W8UA 2DBBA 1A6IA 5JPNB 5IYDJ 2Q1ZB 3KZIC 5L7OA 1AUYA 1RMU3 3PJQA 3LSGA 2NVYJ 4N43A 2JIGA 5CVIA 4YG0A 3UESA 2QGUA 5IK4A 3N9QA 3FXQA 5KK1A 3E1F1 3J7AO 3GJBA 4A42A 2HU9A 3G6EI 2CWSA 4Y26A 2W84A 1VTNC 4LNVA 3I3DA 5FZIA 3M07A 1H88C 2VXRA 4QKDA 4YRDA 2LR8A 4KMUX 5G04L 1SFNA 4QM9A 5JSPA 5DMYA 3D5SC 1ZR4A 3ZMNA 1JUMA 2D6OX 3VBHB 1IS3A 4YW2A 4KI5M 4BL0B 1FWZA 2P17A 2WV1A 1CZTA 1VQPI 3L2HA 1A36A 3GTQJ 1AXYA 3SZGA 2UXXA 4IQPA 1HDKA 2NLRA 4QQHA 1IN5A 4I7HA 3RWKX 5JCTA 1GNHA 1BOAA 2AUYA 4YEJA 2HEWF 5DTDA 1LB2A 4EM2A 5H6QA 4RS5A 2IPQX 2RDNA 2M4GA 2VBDA 4BPZA 1JBCA 4IEOA 4MXWA 2XRLA 4AI2A 3BG9A 5DUXA 4BIOA 1RUJ1 5HODA 1BK0A 2QDNA 5JLVA 1C8M1 3KHCA 5L3CA 5I0TA 1MH3A 2D2WA 2O8KA 3L2UA 4RAZA 5M5WJ 4B3XA 1YHFA 3I2FA 1YFWA 4Y20B 1H2LA 1RHI2 2H94A 3VEPA 2NNYA 1ND3A 3FK6A 1D1AA 4PJJA 3MIDA 2J1UA 4AEJA 4AEKA 4CCMA 1R64A 3RPUA 4OHZA 3MF9A 2DVBA 2K27A 4Q4W1 1MEC2 2Z1DA 5BOXA 3VKMA 4EWEA 1CAUB 4RQPC 3NWKA 1NCQB 1RUC2 1L3JA 3GTKJ 4HNVA 5A33B 3AP4A 1N25A 3WF3A 1HX6A 3WHBA 1HB3A 4PK4A 2XRNA 2MD5A 4ZONA 3CJTB 1FEXA 3TGNA 3H5RA 1SMYF 4HNUA 4XFIA 5EV7A 3F0CA 4HLXA 4QX8A 2BGPA 2A61A 3SZPA 1OCOH 2X09A 2OU2A 3CDHA 5FZOB 2FD5A 3F6VA 1DGWA 4KU8A 4FCAA 2LRPA 3SJMA 2K02A 3LSTA 2PLV2 1E5IA 4QT6A 3IPVA 1XGNA 5C3OA 1W2AX 1LVKA 2P7VB 2JVHA 1ERDA 2DVDA 3JAMK 1K79A 5LBEA 2BVBA 1CF7A 2OS2A 2W39A 3UKGA 1W5SA 4KU7A 2W3JA 3AKZA 3I64A 4G9YA 2VQGA 3RZHA 5ICFA 4HSJA 3DTEA 2QQUA 3MDPA 4AOCA 5FJ8J 3QOEA 3VSLA 4LIVA 3N36A 1KFUL 5FWEA 3G1OA 3CCRI 1SLBA 3S5AA 1ZBE2 4GB33 2LTNA 5LCWL 1W2OA 4PF1A 3KWVA 4N8MA 2ZA9A 3HSRA 5JMCA 2LH9A 1OKRA 1QQP1 2VKDA 1QGPA 2A6HF 1AKHA 1YQCA 4KBZA 3MPPG 3O12A 3KYDB 1LOFA 3AZVA 2EIJH 4QAWA 4NHJA 4ASKA 1ND2B 3SH5A 1XC6A 3JD71 3HPHA 1UAIA 4FOQA 2WNVC 3PIJA 1N1TA 1ZA4A 3MO4A 4Q4V2 2AREA 2BXYA 2Y0SN 2D97A 4QPGA 1PGW1 2KXLA 5D8AC 3ZQCA 1CPMA 2VC9A 4QKBA 4FPGA 3KMHA 2EIGA 4P9GA 1UKRA 3N9MA 3G1LA 3AMPA 4PBPA 1XNTA 1F4KA 1QEXA 4UBGA 1FOXA 1GU3A 2ZB9A 2Y9ZA 3DQVC 4QKFA 2G19A 1WWYA 3KP3A 3SISA 1RXFA 4OQ9A 5H20A 2OAZA 3OOPA 3AFKA 3K75B 3TEYA 2V1DA 2XJTA 3MD2A 1R7JA 2V5YA 4HAMA 2P1BA 5HDKA 3O3KA 5C4WC 2XJUA 4OHWA 4XFFA 1VALA 1YOVB 4P96A 1YW9A 4BBSJ 1MIJA 4L9NA 3V0AB 1IN7A 4NDLA 4U2AA 2CQNA 5FZKA 4FVVA 4BBRJ 1MQTA 3M3YJ 4KIFA 4TYSA 1B9MA 4ISQA 3WG1A 3GUDA 2DFBA 1O3TA 1ZLJA 1KJRA 5KCMA 1TTYA 2Y48A 1HSJA 3HUGA 3PNVA 3J7LA 1IG0A 4B7KA 3VZOA 3W2AA 3KM5A 4Q0UA 2BNMA 5L7OC 3EHKA 1FOWA 3NNMA 2VT3A 1ULDA 1E5HA 1H9TA 4XLAA 2WN2A 1JUPA 4WZCA 3FXRA 2YFUA 3HRUA 2VY0A 1NYWA 4KQ7A 3WG2A 3RZOJ 3O6BB 3ZYIB 1QJU3 1UYXA 3WVJA 3WP6A 1TVGA 2HQRA 4UB8C 4HF0A 3S0MA 1HQCA 1K6YA 2KR2A 2P3IA 4A6OA 5FZFA 2BFUS 3J7AY 1B35B 3PIGA 1VBC3 2WNEA 5BNPA 1OFSA 1RR8C 3LSPA 2K9ZA 3MIEA 1D5VA 1WHUA 3S1NJ 2XONA 1MSFC 3TN93 1AWCA 4Y33A 3BU0A 1N3OA 3BTJA 5T5LA 2Q0OA 1XGOA 5D4SA 1FAYA 5IPAA 1IO2A 1LOBA 4I76A 2CNAA 1RUJ2 5L73A 2R072 2EALA 1Y4WA 3OYNA 2ZFWA 4PGHA 1OC1A 4XTMA 4HG2A 4GDFA 1HC8A 5I0RA 2RKHA 2XDVA 4DIQA 3I7DA 2E31A 3LMMA 1YC61 2P4EA 1KU9A 4FPLA 4CVUA 1XMKA 2M9HA 1S0BA 3T2PA 1POGA 3VLBB 3EUAA 4D7MA 1HLCA 1S5LC 1O4XA 4C1XA 4JGYC 1K61A 4LT5A 3WNPA 2WO1A 3TL4X 1AR91 5EZHA 4LHKA 5D4RA 3NARA 4JZRA 2M8GX 1DLCA 1VBE2 1GYKA 2EXIA 1ENHA 3GTGJ 1BZWA 3VBOA 1KQ0A 3E7LA 1RI7A 1TC3C 4M6VA 1S9HA 5HI0A 1G86A 3Q8FA 4PCQA 2XL9A 1U2WA 3UYJA 2JZYA 4EN0A 2C4XA 2E5ZA 1HRI3 2KZGA 2F4LA 4OI2A 2V9VA 2DJNA 1O59A 1Z6TA 1UNBA 1IV8A 1RINA 3HNYM 1S7OA 1K12A 1UZVA 2KFDA 3C18A 3BZKA 3GXUA 1O4TA 2KRHA 2JENA 3T30A 4LUMA 4L97A 1KQRA 2V9KA 3LD8A 5DQ0A 2ATFA 2ZHLA 3D5OA 4ASLA 2KIUA 2DW4A 4BISA 4BZ4A 4YM0A 3DV8A 4WX9A 3TRSB 1K42A 3U1KA 1PK6B 1D7PM 2WRAA 1XD7A 5DZEA 3EB7A 2J5PA 3MZ8A 5FZGA 1ETKA 1UD1A 2D93A 1NA1C 3EUHA 4WM8A 5GLTA 1V6OA 2CGPA 3N3HA 2E32A 3VKOA 2GA2A 2ETHA 1IUYA 1JXNA 1ONAA 2K9LA 5I0UA 2O1QA 1W9SA 2VL8A 1EKEA 3NL1A 1V00A 1ZYBA 2HWB1 4LKDA 4AEDC 4W97A 5IYYA 1GFF2 3ZXGA 2QQPA 1FNNA 4ZH4F 3PUIA 2WAAA 3IAPA 2J1AA 3HJEA 2X5IA 3N7LA 1OFCX 4XILA 3J7HA 1DBNA 2GNMA 3U07A 4RHV1 4WM7B 4HKOA 5EQUA 2O9LA 4CYCA 5FAXA 4BYYA 4XIDA 2PFWA 5EEGA 2DPDA 4BACA 1EP0A 1XN7A 4L0YB 3CLQA 5JOWA 3VBUB 1GV5A 4MTEA 2PAMA 4OI0A 3SDBA 3I2DA 5HCAA 3W20A 4JGZC 5FGMA 3O1RA 3FXJA 2CO5A 5JXHA 2ZTNA 2NOJB 2IXLA 3B01A 3WTTC 4IGQA 1FV3A 1UJ8A 4ZTFA 1EAH1 2R92J 5FYBA 5FLMJ 4HVQA 4XONA 5LLQA 5CG8A 3GZTB 4RB2C 3I2HA 3ST7A 2H0VA 1YI7A 4OMCA 3WW2A 1AR72 3RQIA 1NX9A 4XOGA 2GALA 2M7AA 4HPKA 5E8GA 3KETA 4EMSA 2AZ5A 3KEYA 5IVBA 1MBFA 5GAEJ 5F9TA 3F8CA 4MQ9F 3VODA 1QOTA 1IGNA 3NAUA 3OSDA 2COBA 1UYZA 2JRTA 2DDUA 5I91A 1FMD3 3HOBA 1ZHFA 1CWPA 2O03A 4OI1A 1KITA 5AFEA 2OJED 3QAHA 1FBSA 1TMF2 2WS92 2EIBA 3HTSB 4FOYA 5FK8A 3PU3A 2ZJ2A 3ILRA 1POV1 3A0KA 1DFQA 2HWF1 3QCWA 2M2EA 4ZJZA 1SPPA 2QSHX 3O1SA 1PDNC 1E3OC 3NV2A 4IL7A 3S16J 1HRV2 2NYXA 3D0JA 4IEQA 3L9FA 2GC1A 4G94A 4FQZA 4UFMA 5FP8A 2WNVB 4LUKA 5CQEA 4IHVA 4YGEA 1NG7A 1G8WA 1VMJA 1AR71 2LF7A 1W6OA 3FC0A 5KC5A 2ZGMA 3QPSA 4AFMA 4CCNA 1UELB 2IA2A 2V6EA 1P7JA 1Q8QA 4QGNA 4PSXA 3BR0A 4PBOA 3DEWA 4XABA 5DZGA 5A7WA 4G6TB 2I5UA 1OD5A 1W8TA 4BLIA 4CA9A 1RNLA 4GH4B 3RJRA 1FPN1 2G4IA 2WAOA 1DQ5A 1UZZA 2R4GA 3SC7X 2JWTA 2JA8J 4MUVA 4HX4A 1A35A 4PDWB 1A3KA 3B9IA 1DCSA 4XFBA 1B8IB 2DVGA 4ZYAA 3FHQA 2GLOA 1QNYA 1B8IA 2HWC1 2IFWA 2ZZQA 2IFRA 2VUJA 2RNGA 3R60A 2JT1A 2RV9A 3EDPA 3GZ6A 4W6XA 2E5NA 2DUPA 4MX3A 5BUVA 1KGYA 4NN0A 2MABA 1Z21A 3HD8B 3ZFEC 4A3IJ 2BPA2 5D8AB 3ENRA 4HKWA 1JU3A 4NHMA 3HHHA 1HB4A 3FXUA 3PNTA 1BYHA 2XJQA 3KCYA 3QYBA 5LBQA 4B8XA 3H0GJ 5HBAA 4CE8A 4JOMA 2MHFA 4MEXF 2WNUC 1Q1HA 1SFKA 4L92A 3OYWA 4LGWA 1GOFA 1XGMA 5GPCA 5EGOB 5IT6A 4NIDA 4FPHA 3ABUA 2L4AA 4HK9A 2JTVA 3CMEI 1RUH3 3M4FA 3K4KA 4M71A 2R5ZA 2LKXA 4KIBA 1Z0HA 4CA0A 5F3GA 4CCOA 3WW3A 2R30A 5GLZA 2K2SA 5HXMA 2G7UA 5KXBA 4UWDA 2Z5UA 1TLHB 4QX7A 5EEAA 1QH6A 4HSRA 3JB4C 3HXLA 4S0HB 3S1QJ 4IEZA 2IBDA 1H2NA 2M0CA 5FLIA 4OAZA 1CAVA 1RUE3 1TWHJ 4D3WA 4Q4Y2 5H6RA 4S2DA 2XF6A 1K7AA 4BU2A 4LLFA 4LR4A 3MLLA 5FMBA 3ESWB 1D0ZA 2HVRA 4XTPA 3C2HA 3GX4X 1BK1A 2QNKA 3WF1A 2YZ4A 1R49A 1Q8VA 3AMNA 4L9TA 4F3QA 1SFXA 1YW8A 5ACA1 3RJ2X 1QHDA 2VB6A 4XUQA 4YM2A 2J1RA 4XQDA 3DU5A 4C3IJ 5HS9A 6PAXA 4E7KA 4HRIA 4CO8A 2WIIB 1VQ9I 1AL22 1W90A 3M8LA 2M7BA 4MO7A 4YNIA 3W21A 2RR13 4P9FA 1EJ9A 3K70D 1SEFA 4JHZA 1ZZ6A 2WFF2 4XLFA 4RA0A 3C1DA 2EIEA 4XNFA 3QQAA 2Q2EA 3H3VK 1AYM2 3P9CA 3BUCA 3ITQA 3THPA 1U8BA 1SC7A 2HTSA 5JWPA 4XJAA 3VDBA 3FE5A 3P3PA 4LHSA 5GZFA 1VMHA 2QQAA 3SKVA 1ETOA 2JDNA 4RN5A 1XS9A 3C2GA 4Q8KA 5FO7B 2IS1A 1D8KA 2R0QC 1UCXA 4QB6A 2Y6KA 4FAHA 3LA7A 5J98B 4ORFA 1HW1A 2ZFUA 3HSFA 2HQAA 3PIPF 2NP0A 5I8SA 4M9XA 3ZKUA 3OBAA 4BY7J 5C6CA 1W36C 1PVXA 2HBTA 1EAH3 2HWD3 3LQRA 2BZDA 1J7KA 5JVGF 4ATEA 1BJQA 1SCRA 3OYEA 5FY9A 4EJVA 3CJIC 3K4BA 2VBYA 2FHRA 3BCBA 1CJPA 2X10A 1E3PA 2JSPA 3SEEA 1GBGA 1W8FA 5J09A 4RB3C 4B4RA 5FYVA 1BBT2 2JDUA 3U4SA 2DMQA 4YM1A 1V9U3 3PQJA 4A44A 4BXUA 4JAAA 3UR3C 3VD9A 2DMNA 9ANTA 1W8ZA 5FPUA 4QIWN 2I07B 1KU3A 2E51A 1SPPB 4Q4X3 4AFBA 4KJZA 2WB1A 1MS4A 3USSA 1CAXA 3FHNA 1JUSA 2W9XA 1IQDC 2BERA 5FK7A 2QKLB 5FO8B 1W2NA 4IQ4A 3RZGA 2JG8C 1EY2A 2JICA 3GZ5A 1DIWA 1XPWA 1M1EB 2L9VA 1HXS1 1JHFA 1S0DA 1FMVA 3BPZA 3S15J 3T1LA 5IY5H 2YBSA 2ADUA 1LULA 1DF0A 3ETQA 4NUBA 2TDXA 4Z2WA 2HZTA 4ONUA 2JN6A 4GKXA 2A68F 3E6BA 1AYM1 4NB5A 4CXWA 2D6NA 3OYLA 3FBNB 5AIPA 4C1WA 2E7XA 3FN9A 4AFDA 3H3UA 3A21A 2WWSA 1ACIA 3D1NI 4XJWA 3LZZA 3OS0A 2HJIA 4PFPA 1OBNA 5E3NA 3CCSI 3HN3A 3MHZA 3ZDVA 2VCBA 3P1IA 4L2NA 4Q8LA 4LBQA 5LWBA 4XIKA 2QTWB 1PX3A 1DGRM 3GZNB 3UGFA 3SEPA 1TL8A 4LLGF 4RGRA 4ZU5A 2BDRA 3OY9A 4AUXA 5TRDA 4SBVA 1JZ7A 4XW3A 3BU7A 2OXBA 2E7AA 4NHXA 5ABJB 2IUWA 4OIPF 2CGOA 3HNMA 2VNRA 3OB8A 2HWB3 4CCJA 2GAUA 2PHTA 3NJYA 5BY5A 2BY3A 2E7WA 2WO7A 1YFYA 4LA3A 3NNGA 3J26N 1Y56A 5DEQA 3ZOIA 4EROA 5LW9A 4Z2AA 5IVJA 3L2YA 3M1EA 2BZTA 4BS9A 1DU3D 5FQ0B 1G6NA 1N1SA 4XMYA 1O8PA 4KUMA 4B1MA 5JR2A 4HBNA 4K6BA 2Y2ZA 4MGSA 3BR5A 4KITB 5J4VA 4KG0A 1UOFA 1YWKA 1S0GA 4A45A 2RMU2 2DVAA 2V4VA 2LOOA 1X2NA 1SZBA 1UXZA 4PDWC 3FHIB 2OV7A 2PELA 2RM21 4F8AA 2HWF3 3FFZA 4AIJA 4OIOF 2JE9A 4ZKTB 1GUUA 2F6CA 3FMSA 3OYDA 4IQJA 3DCFA 2RS51 4DXTA 2ZOEB 1ENQA 2ID4A 2OF7A 2XG3A 2RJKA 3K77A 2DCTA 3JRAA 1IGOA 1Y9GA 3MIGA 3FLRA 5B1BH 1R1TA 3S7IA 4U0YA 2DJIA 1BMV1 2E36A 3PVBB 1LRHA 3BOPA 2R32A 5HCHA 5FFZA 2FZ2A 2GQQA 1WMFA 2WO3A 1X9PA 2DQLA 4H0EA 4XRSG 2YBKA 4J1XA 4YFKF 2CUJA 5F6KA 3ATGA 2DU9A 4AIHA 3HN1A 4BEHB 3R0JA 2ZMEB 2LMDA 1YJ9I 1ZZCA 1FSEA 5L3GA 4HW0A 4JKLA 5E88A 2P2KA 1K6OA 4XF4A 1GOGA 3VKFC 1E57A 2L54A 5EF6A 1T38A 2CQKA 4QGLA 5CVUA 2X1CA 4N9IA 4E4SA 1D4VB 2VQCA 1MMNA 3PL8A 1ZG1A 1P4XA 1A8MA 2YPRA 1PZ7A 1WZ2A 2YYOA 1X3ZB 1FOD3 3R05A 4P9JA 4UFLA 4CRQA 2FMLA 4GWMA 1XNDA 3GTLJ 2DA1A 3K4NA 1ETYA 1O3QA 2M34A 1DP0A 4LHLA 1TNRA 3OIQA 4ESJA 5DG2A 2XOMA 1X1CA 3BTCA 4AVSA 3VSKA 1A6CA 4FPYA 2A6EF 4JDMA 5F5AA 1MJAA 4NBQA 2VZQA 4C90A 2WAQA 4IEUA 2WBMA 3ZFGC 4XORA 1J5YA 2ERFA 5F5QA 3JXSA 2E1NA 2MLKA 1O57A 3FKJA 2DV9A 3THDA 3KD4A 3DKWA 1YW7A 3CJIB 4LE3A 1ZBE1 4YVSA 1FI2A 1JOJA 2D5FA 3R6SA 1WD3A 3Q3SA 2RS52 2DYCA 5CISA 3BALA 1LOAA 4K40A 1UXXX 3H1YA 4RR3C 2VC0A 3HBLA 4DNYA 2CDPA 3ZFGB 3ZR8X 4BXXJ 2YB7A 1AHDP 3C7HA 5DPNA 4GMP0 4XKWA 2ECBA 4COYA 4YW3A 1ZBA1 1C8NA 4ITCA 3LSJA 2BNOA 4E8DA 1PVC3 1J9IA 3OBTA 4HETA 2YGLA 2Q1MA 1CAXB 2VQAA 5DDJ2 1Z7LA 5I8YA 4QX1A 1YO5C 1IF1A 3B00A 1TZLA 1UY0A 1XYNA 3OPZA 1F4HA 2Y6LA 5IT9K 1FNZA 4NWVA 4L5EA 5IW0A 1RUG1 2VPRA 2WT0A 1V6JA 3VBRA 1VZ0A 5ICCA 4XZUG 4RGXA 1J3RA 3ZQLA 5LY1A 4HG6B 1R1A2 3FBMA 4A3ZA 1Y9QA 3VDXA 1O5UA 1VIWB 2Q0AA 3T3YA 3GW2A 4WV8A 1IDYA 5J36A 4EYUA 5HOOA 1W06A 4QX3A 3AXEA 2J7MA 2A69F 1V9U1 3K4JA 1BKZA 2HVQA 4A3MJ 4PDWA 3M7GA 2BQPA 2DA6A 3S2HJ 2E1CA 2DCJA 2B9SA 1AA7A 4GRIA 2VASA 3LAGA 1OF4A 2VXDA 4C0BA 5A7PA 5HDNA 1AJKA 3D82A 2DFIA 2W85A 2QQOA 3IHUA 3RZDJ 1T0FA 3U1DA 3GXOA 2VJJA 1V6MA 3QPTA 3ZN0A 3APBA 4LJZF 2PHLA 4XXAA 3GFIA 2Y0SA 1RUG2 5CKQA 3CZUA 2AXTC 4Q0QA 3AMMA 3BN6A 3HQUA 3FBIB 4NJ4A 5FZDA 1FMWA 3I4IA 1MKMA 2DU0A 1GXQA 2FUG2 2EIDA 4B29A 1CR7A 1JJ6C 5FLHA 4Q4W3 1F9NA 5C4JJ 2WWJA 2MEV2 2AGSA 3MW2A 4DBQA 1R9TJ 2LKPA 1WCDJ 3I4NJ 3W2WA 2WR9A 2RQPA 4I0AA 4BWOA 2K7LA 3CDLA 5DAXA 2XBO3 4A5MA 4LTAA 4XJ9A 4BE2A 4G8XA 5DCMA 3MW3A 2KPMA 1ND2A 3PVEA 4WM7C 5CADA 1LQ1A 5F32A 4JKKA 4P00B 1WA6X 2C0ZA 4LBKA 3MZYA 1FYMA 1OH3A 1JYVA 4BQ2A 5A1AA 4B48A 3HNBM 1ND2C 3RDIA 4E4DX 4WM7A 2R7XA 1SVMA 4NIAA 3Q5FA 1ORKA 4A69C 2ETEA 4HQEA 4L18B 1OOPB 1PM4A 4BQQA 1S2BA 1I3AA 4EJOA 3USUA 1DDLA 5APAA 1NG6A 1ULCA 3ERMA 3T2OA 3F8NA 4MGKE 3AM2A 4HV6A 3U75A 1AYN2 3KLOA 3BWGA 1DQ4A 1G9BA 4U88A 1YE9A 1URXA 3UV9A 1LHOA 2EIKH 3FMGA 4B47A 3HEIA 2RJ2A 5FYIA 3CCQI 3S3MA 5IP9J 1OYYA 3LA2A 1XC5A 5DAVA 1O5LA 4KNCA 1W9TA 4EJTA 1I3HA 3VBOC 2WO2A 1QVTA 3ZYJB 2ZXIA 2ZGKA 4NAOA 1O4YA 1PO23 2VQLA 5FLJA 2JVGA 4ENNA 1OPMA 3RKXA 1RVF2 1QHHD 4OI4A 3O2PE 4TV7A 2VZTA 4LKEA 2DYRH 4M74A 5LBFA 3R61A 2XLFA 5IFTA 3WXPA 5CKTA 3I4PA 5J8CA 3MGUA 2YC4A 1Q1VA 3V4GA 4LXLA 1TT5B 3CP2A 5HLTA 4FFFA 2KKOA 3VBHC 1S55A 4LOTA 3B6AA 4M4PA 4BHBA 2QSGX 2OTJI 3BIWE 1T39A 5DN2A 3QU3A 1IS4A 1VQNI 3MIFA 3KYCB 3PMSA 3CUOA 3WGIA 1VAKA 4EZ4A 3OF1A 4ARXA 5FZ7A 1ALYA 1T56A 2A05A 2Y60A 2W08A 2JDYA 3S1MJ 5ED4A 1MMDA 1LJ7A 1UMZA 1DP7P 2VU9A 3WD5A 1XDSA 4DRVA 2O7OA 1VBA1 4PI2A 3ONQA 1W99A 1ZLKA 2Y6JA 1RVF1 4COVA 1R22A 3GYDA 2X6OA 3HOTA 3PVNA 3COAC 1E2XA 1CN1A 1ZRCA 4RFT0 2W47A 4JX6A 1MS9A 2ZEWA 3O1TA 1QRYA 5B2GB 5FMCA 4KNYA 5KAIC 3F8BA 2NMOA 4OCTA 2ZHKA 2ID3A 2ZCWA 2ORXA 1KJLA 2R5ZB 3G2BA 1H8AC 1VRBA 3TOJA 1ZRIA 2O3FA 1YRNA 1R36A 5JLWA 4YELA 5FKKA 1UY1A 4M72A 4ZDOA 1AXZA 3KHBA 5BV6A 2CG4A 1T6GC 1X82A 3K4CA 2WAEA 3H3ZA 4D69A 3V7SA 3WDVA 5K0UB 2CQQA 3CJRB 1BA5A 2LW8A 1WGPA 4DRRA 1NG0A 2VQ0A 1LKXA 4ZS3A 5JPMB 4OUSA 4FISA 3P5JA 4F7ZA 5F2SA 2BVLA 5F6LB 1OA3A 2XB5A 3AVRA 5C8CB 3W3CA 5E17F 2A07F 2O8XA 3ZMSA 1G9FA 2GU9A 5FRNA 3JQXA 1WLDA 4HBLA 4ESBA 3ZYHA 5FP4A 3I59B 3L2QA 1X19A 3UNPA 1G8XA 3I71A 2VULA 1OCPA 1D5YA 1JS9A 5C71A 3BVCA 5AC91 4EV0A 3TEDA 1ZRFA 3CC4I 3TP0A 3HGYA 1NKGA 1AJOA 3KVBA 1ZBA3 2FX0A 2QUOA 1YIJI 5A3NA 4FETA 1MVEA 1ZK8A 1I6XA 1U5YA 3DECA 3AYDA 4DEVA 1W8HA 1OFNA 2XV4S 2OW4A 5JUVA 1UO9A 3E5UA 4Q4V1 3IM0A 5F5IA 2VOWA 3H9JA 1RUJ3 3N35A 3CD6I 1D0GA 4Z07A 2R5YA 2VUMJ 2H1KA 1F35A 3MN2A 1RRJA 4CEWA 3GWZA 2R5YB 1LGNA 1XE8A 1I9RA 1XX5A 5SV5A 2PXJA 2XMLA 1R1VA 3HHGA 3DP7A 2Z2SB 4ZXEA 2YPJA 1BI0A 2PA7A 3UK9A 2D7FA 2NVXJ 1OCRH 5GLWA 5I0SA 4FTSA 4CHUA 3CJIA 4A3CJ 1KFXL 4H14A 1MBGA 1SVLA 4EWDA 3ASOH 2SLIA 1XNCA 3R4DB 4QPOA 4K8RB 3IL2A 4R1HA 3RSNA 4IEPA 3C7OA 2PFBA 2EWNA 3M3CA 2WABA 1F1ZA 1D4M3 1VBB3 2HDDA 2ARCA 3ROUA 1WCUA 4E4ZA 2IS2A 5KXCA 1RKTA 4LB5A 5LRRA 2OA2A 1PNGA 1Z67A 3B94A 3IDAA 4BB3A 4QDQA 5JXGA 4Z2YA 4IXAA 3LL7A 4EN8B 1U5ZA 5BNGA 3NNLA 2QJVA 2TBVA 4LO7A 2EFOA 4IHXA 1WJCA 5FB2A 4XXPA 4AFCA 1UL9A 1Z3XA 3K3NA 4RM3A 2FOKA 3B02A 4Q2FA 3U9GA 1ZRRA 5FROA 1IJWC 2YFZA 4U0WA 1EAH2 3PL0A 4KWKA 3B7MA 3WNMA 4DYQA 1UYYA 3BR2A 5FKCA 1IC8A 4XFHA 4HSLA 5FZ4A 3LPGA 1F36A 4NC8A 4RLFA 2JUCA 2EBIA 3ZXJA 1FPN3 5FYMA 1MH4A 1YEWA 4DEQA 3UKNA 4D7SA 3ZXLA 2ILMA 4N9HA 3I8TA 2M45A 2JIJA 3N97A 4KT5C 1V9U2 3I2JA 2AHQA 1W8WA 1X36A 5C44J 4AI1A 4B1RA 1EV11 1Z9CA 4BJ5C 4XN0A 4MADA 4YW5A 2P5VA 3DTIA 2NVQJ 1S2KA 1UG2A 3LAJA 1LHUA 4FFGA 2QDRA 2YC0A 2QQKA 2NS7A 4C3HJ 1WJ5A 1IZ1A 3SQOA 2CUZA 1X9TA 1QU3A 1U3EM 3K9TA 3T09A 4OHVA 2GIVA 4O7XA 5HNFA 1O6UA 3VBSA 1CX4A 2WT2A 1KYWA 2W25A 1JTXA 3W9AA 5C9AC 4QQOA 2RN7A 3ZN6B 1NQJA 3DF8A 3CUQA 2ZJRF 4RM2A 5GZGA 5DDJ1 5CEHA 1MQTC 1K5JA 1YIPA 4O65A 3OYKA 2P6TA 2FDHA 5FD6A 1W3XA 5GADJ 4CYCB 1VJ2A 5FZOA 4ZYEA 4LD5A 4IE5A 5TISC 2D6PA 5J3LA 4QB1A 3KPHA 4O5VA 1AYN1 2UY9A 1YQ8A 4HEA2 1HB2A 4Q0SA 3WDWA 1PP7U 3SXYA 2EV0A 3D8CA 4L9VA 5FTTC 2VKHA 2E1MC 1SD4A 1MNMC 1MR5A 3QODA 3POFA 2BFUL 1ZVFA 3RSJA 3F3XA 3B9CA 4QWQA 2HYGD 3IRQA 1VRH3 1EYBA 2JDZA 2KRCA 4XACA 3FHZA 2ELHA 1QNTA 1QVUA 1HF0A 3LDBA 5DYMA 3MUZ1 3PHMA 4LORA 2CYYA 1AX2A 1XRUA 1PO12 3OD4A 3CO7C 4QGMA 2A1XA 5JFRA 1C1FA 5FRAA 3VZNA 2X51A 2ELKA 2ESNA 5IAXA 3LWFA 5FPZA 1USSA 1DDNA 4NPRA 2ZEXA 5FXVA 1LGCA 3ACLA 4XQWA 3GBWA 3AP6A 1JHJA 4X8NA 3QH7A 2EICA 3K46A 1PHMA 3H8XA 1FX7A 2Q30A 1A8DA 3BCAA 4CDQA 2VZPA 2R7WA 1RJ7A 1VQKI 5KXEA 3KV6A 4MGTA 3PM1A 4J01A 4IRIA 3AFGA 2R071 2DBNA 4E8CA 2V72A 1RUD2 1I50J 1IN6A 4RHV3 1HB1A 4QLCU 3POEA 1K5MC 1JKPC 3AYEA 1NXD1 2VTFA 3VHNA 4AIDA 1ENRA 3Q8CA 2M30A 1HLVA 2VZRA 5LA1A 4RQPA 5C3EJ 2ZGNA 3S32A 4IW3A 4IV1C 2JA6J 5FZ1A 2ZABA 4NIHA 3U21A 5A3OA 2PMHA 3ECQA 4XDPA 2IVMA 4ENMA 4AC0A 3HB9A 5JZGA 4CXYA 1G4DA 3Q9SA 4XJZA 2UWCA 1F15A 3N05A 3HBZA 3UKVA 1YO8A 1W6MB 1ZARA 2YDEA 3F95A 1Y8QB 3QPLA 4XDQA 3VDDA 2LY9A 1EUUA 5FY5A 2BGOA 1JKRC 3J8F1 3LA3A 1UPSA 1Z91A 5TJJA 2ZO4A 2FRHA 2MPFA 3WP5A 3ABZA 3ZFEB 1AR61 2EB7A 2E2HJ 5FY0A 4I30A 1UY3A 2PHDA 4RGSA 3AL0C 2MNGA 1I3QJ 2I2SA 2MGQA 1WJFA 2W82A 1B59A 2VN2A 2VT2A 4IX7A 4Q4V3 1YG2A 4V2VA 5A33A 2MD0A 4YG2F 1PZ9A 5EG0A 4E2GA 2IXSA 1QPIA 1RUI1 1PMIA 1DG6A 3KP5A 2VECA 3KGZA 1Q43A 1US2A 3AYCA 4NVPA 5B4XA 4PHZA 5JAXA 2KDZA 2Y6FA 4QPWA 1S6LA 2VZ1A 2KDOA 4IXLA 2A3WA 2VXJA 4GXLA 2DN0A 1IHMA 4COWA 1KA8A 4LMFA 4YYOA 2J1SA 5AC92 3BJOA 4AVCA 3H1MA 2KQRA 1LE8A 1WLWA 5F3IA 3NV1A 1QJY2 5EPAA 5BNNB 2XKPA 2IP2A 5JVTA 4Q4Y3 1VBD2 2LSOA 2WQ8A 1U12A 4Q26A 5T5PA 4ZHNA 3O1VA 2BHYA 2C6YA 2DOEA 2X6YA 4RYDA 3WE2A 3VB2A 1T2XA 2RG4A 3K1NA 4MHGA 2C6SA 2EXKA 4XICA 3AZWA 4MSVA 5I93A 3BLYA 4Z8BA 2JG9C 2JRMA 3EBRA 2M8EA 4XLCA 1F9KA 2MYSA 1RUF2 4CZZA 2HQNA 4IEVA 5E8IA 2H8WA 2R93J 3FWEA 2VW0A 4LBNA 2IGOA 3ZN1A 1TEIA 2OCCH 2OQ7A 4LBLA 2FJ1A 2Y8KA 3OGSA 3RFRA 2P81A 5CLSA 4XPVA 2IXCA 1IPKA 4BDZA 3POSA 5B3SH 5AFBA 2PHFA 1YRNB 3MCZA 2DXIA 3IKWA 2L7MP 3RKQA 3WTVC 3KX2A 4Q5OA 4FOVA 4H2AA 1FBQA 5DDGA 3PUAA 2VCAA 4OU0A 2E7TA 4GAZA 1LNWA 4IV3C 1YQAA 2KIQA 4M73A 3RZJA 2Y30A 3HM5A 4V19K 1NE4A 3OPTA 1HKTA 4BDYA 1GICA 3N7JA 4BHCA 1IG3A 5LBCA 3KZZA 3CL1A 2XJSA 4FI9A 3ACGA 4OMZA 3I2GA 4PSWA 1JH5A 3S8PA 3T4VA 2EZLA 4PLMA 3DKYA 3O5SA 1JGSA 2LC2A 3ZYBA 5GLVA 3VD7A 4U7BA 2EINH 4BM8A 2P34A 3ZVXA 4JV4A 1BC8C 1U5TB 2F2EA 2VMDA 5DUKA 1HKSA 1MZ5A 4IESA 2RJLA 1WPKA 4TZDA 1W7PD 1QY4A 4Y13A 1Z7S3 5LD2C 5F64A 1US3A 3LOIA 2E1OA 1HQLA 1LHNA 5A6YA 1SAUA 2O0YA 3JW4A 4EN6B 4XSZF 2Y6HA 1T08B 2QQMA 1U78A 1SD5A 1FC3A 1G9DA 3G6JB 2LY1A 4LOCA 4LJHA 4JX4A 5L3FA 2XAFA 1W4MA 3CEWA 1YLFA 4IOCF 4QSHA 1YI2I 4DINB 1WA4A 1P92A 2E7QA 5FD5A 2GOXB 3CF2A 1H0BA 2LYCA 1CZSA 1DYKA 3AKPA 3OYIA 5FO5A 2FXAA 1W39A 1JHHA 2NMNA 1Y39A 2MSYA 1BBT3 1RMU2 4XSXF 2YPDA 2M3AA 4A4AA 5TGTA 2AQEA 4PQ9A 3GFJA 1VBE3 2X5IB 2N7GA 3GCMA 1WD4A 3TNPB 1K78B 3WE3A 4XC9A 1SFEA 1RMU1 2A5YB 3F22A 1XCBA 2GH8A 2GMMA 3DYOA 4K2EA 5E1XA 2UXNA 3VWBA 1MQTB 3CJQB 3RI8A 3J9SA 1UU4A 2CMPA 1W7PB 2NS0A 3WHTA 1E3HA 3OBZA 1SBDA 5F7UA 4DZPA 4Y5TA 3U0ZA 1O8SA 1R082 4H7MA 3ZXSA 4BQAA 2CH0A 5CKNA 2VKVA 5ICEA 1J1LA 3K2AA 1HDPA 3FZVA 4IPAA 1GMMA 1AVBA 2HYKA 3VBRB 2W95A 3GNEA 2BE5F 3MKLA 2D43A 2CSOA 1R6RA 1H8TB 5FR3A 3JUUA 4P9UA 4QX2A 1NLQA 4ZYGA 3M3EA 5D8LB 1HIXA 3E1SA 3WDYA 1Q8PA 1JOPA 2XIGA 3BJ6A 3JCIA 1OKOA 3J81Z 5FOBB 2UY8A 3PUBA 4LHNA 2JB4A 4Y24A 2WNVA 3TDZC 2QQWA 5FKOA 5C4WA 5KBFA 4GMP3 4UUTA 2E53A 1R71A 5K7FA 4CEYC 3BROA 3BODA 1W0TA 4L11A 5JIAA 3THCA 4NRPA 5A7WB 2K3FA 1U5XA 2I74A 1HOMA 2ZMEC 3IDBB 3MF6A 3L09A 1GT0C 1HQNA 1X4OA 4L5JA 1QPMA 4ZZLA 4LE4A 2VBWA 1W5CC 1B72B 2L3DA 2IGMA 3TKYA 3PTYA 4CEYA 1T6SA 2DFFA 4ZYDA 4E4HA 3OOUA 1IAWA 2VGDA 3TMOA 1JI6A 5EJ1B 2GOMA 2MEV1 2CW0F 3KT4A 3JB8A 5B5EC 4IEJA 2Y9YA 3ZQGA 4FPCA 1N1YA 2FF4A 2H27A 3QU6A 1U8RA 4AHZA 5H9PA 3KFWX 1DYOA 1SLTA 3UNGC 1HQWA 4AK3A 5DABA 4A0XA 2K5CA 5FMOL 2GH2A 2JWPA 1YI9A 3CO6C 1YJKA 2PN5A 4HT1T 5CNAA 1ULFA 5GPAA 2DCEA 5A70A 3PIOF 1Q3EA 5I8TA 2AACA 1UZYA 1FMD2 5JZGB 1SACA 1M4WA 3C7FA 2XVGA 2DT7B 2HWC2 1IXCA 1DGLA 3NJXA 1IPSA 1L0OC 4YGDA 4KL1A 4XUTA 1O7FA 2BGCA 4XOPA 4R4XA 2UUZA 2KP6A 2E26A 2AO9A 4ZYHA 3LOCA 2J1EA 5A2QK 2OA4A 1OMIA 3OY8A 2WAQN 2MH2A 3VDAA 2CUEA 3P9IA 4BK5A 1H30A 4YW4A 4DQAA 3V0AA 1KYZA 4IGOA 1RYYA 2XQXA 2JUGA 1LPQA 4I02A 5I0DA 3NRVA 3SNMA 2XUMA 3Q0VA 4LK6A 3ZYPA 4CU9A 2BU9A 1DZRA 3N9LA 3O1OA 2HPMA 2R1BA 1YFXA 3CQZJ 1T6BX 3A01B 3JR9A 4RA2A 2V6CA 2B9UA 1CX1A 2K46A 2VOXA 1NT0A 3Q9VA 3GF2A 1C57A 3EMRA 3DYPA 3EUKL 2ZMKA 1Y8RB 2WZR3 4AI0A 2QQ8A 1NCRA 3VBSB 2L2OA 4O9EA 2BWAA 2F5DA 3G7DA 2STTA 2VD7A 1LDJA 3PUFA 2W52A 2XL7A 3AL6A 4C2UA 1V6IA 4LQRA 4NRQA 4QXCA 1JYNA 3HQRA 2CFOA 1OCZH 5DXDA 1LOEA 1IS5A 2HKXA 1WI3A 1HBXG 4Y1VA 4A6EA 1YXWA 4AAXA 4M4RA 2IXKA 1DQUA 1HV0A 3AZYA 3W5MA 1B35C 4EQQA 1W05A 4UUVA 2C26A 4I3PA 2V1UA 5CG9A 3VD3A 4JGZA 1S2EA 3EUHC 2RQQA 1OH4A 2B45X 2W48A 1SVOA 1RR7A 2WDBA 4KMQA 3ZO0B 2VMEA 3IKTA 4O3MA 2CW8A 4DXSA 5EZWA 4EJWA 4OZXA 1ZZ7A 1FOYA 3L00A 3LEIA 3K70C 2XGCA 1NQDA 1AX1A 3H8OA 3ZFEA 3GTMJ 4INDA 4FPEA 4RQPB 2Y34A 1ITYA 2P3YA 1PZ8A 2IJLA 4A93J 5FBZA 1BBT1 1LKNA 1ZNPA 5CFCA 1AR73 1UYPA 4CDGA 3IRRA 4LBQB 4RD7A 3HKZA 1BEV3 4ASMB 4GA9A 2X9DA 2E63A 4HZFA 2ARBA 3WU2C 1JXSA 1R1UA 4ZS2A 1RUE1 4UFIA 1LAJA 4Y4RA 2XC7A 4P9LA 2KISA 2R7ZJ 2X0LA 4YW6A 3K2OA 3WY6A 3OUJA 3RS6A 2JG9A 1SHWB 4OINF 2XASA 1WFXA 1NZIA 5A3LA 2ENRA 5J1YA 2GM4A 3O1UA 5LA2A 2VJIA 1W6PB 1I39A 2RS33 4RAFA 2HVSA 2FMYA 3T8TA 4CXXA 2ZX1A 5B4NA 2RR12 3I97A 4DW6A 4CZCA 1V3FA 4JQTA 3SEQA 1OT5A 2AC1A 2EXHA 1OR7A 3WQ0A 1QQP3 5J1XA 3CKHA 5D5WB 4DOZA 5FZHA 1S0IA 3ME2A 4HN1A 2QQNA 1STMA 1W0UA 4NHKA 4OOIA 5D5UB 1AR92 1PMHX 2ZMLA 1RPWA 5CVVA 4HSTA 5T54A 3MW4A 2XBO2 2GWRA 3AZXA 1VAVA 3ZMVA 4A3FJ 2IZWA 1AHSA 3ZMTA 2R061 2GP3A 3FHAA 2RS31 1GKBA 4A0ZA 2JE7A 4ZXKA 1WH5A 1V55H 1IXRC 3HOWJ 4K9SA 1H2MA 1Z77A 2B4KA 5FZBA 4YARA 3H42B 2WWUA 1BLZA 2CW7A 4DOUA 1W8NA 1O3SA 1ZELA 4XRFA 1QJX3 5HDGA 3OY8B 3ZIWA 5JI6A 5LATA 1TNTA 2W92A 4IUGA 4A6SA 2BV6A 3AVSA 1RXGA 3AB0A 2A6VA 4HA8A 2R7RA 1W6MA 4C3JJ 3KEOA 4MEYF 2DU1A 5FKBA 2EILH 2E34A 4CSWA 2FDJA 3H5NA 1W0OA 5FBJA 3J7MA 4RL7A 4GMP1 1KDMA 3IT8A 1EV13 1JGGA 2YU1A 3FIWA 2WYFA 4AQ6A 2KL4A 1H9GA 3ORJA 3ZN6A 4HXCA 4ZDPA 5AIQA 2VMFA 3KVAA 5CU1A 4XFGA 4IE0A 4IGPA 5IVYA 2PTMA 3LF7A 5E1ZB 3OTFA 4QPGB 5LA9A 2UURA 5J7MA 2FNAA 3RYKA 3OYCA 3IDCB 4I6ZA 4M9SA 2TNFA 1S7AA 1QJEA 3NQOA 5C4XJ 2VTXA 3DFGA 2KZVA 2EFWA 5T52A 3HJRA 3WW4A 1GUIA 2DFEA 3HR9A 3HQXA 4CEWC 2FBIA 3K7AJ 3IWFA 2XF5A 5A7OA 2WNUA 3TN91 1L7RA 1TME1 4RDUA 3FKIJ 2BVMA 2DUQA 1A04A 4OQ8A 4CP2A 2BXZA 3K1MA 5A1FA 3RWNA 2VBPA 1RUE2 2LP0A 2KD7A 2KIMA 2RS12 4OYUA 3K3OA 2EV5A 4C30A 4QDSA 3RMXA 3LFIA 2WY8Q 2DTYA 5LGUA 5FRMA 3ZN4A 2PMZA 2LNBA 3DU6A 5EJZB 2XPWA 5D6EA 3POWA 5CAZA 1N47A 2X05A 4YFXF 3IH2A 2JDPA 4ASNA 2Y0MA 4I09A 4NRMA 1JKOC 3TEXA 4IEYA 2CUFA 3O7OA 4P5YA 4UXNA 2ZX3A 3C2UA 3E0JB 5IWFA 3H7YA 5SV8A 2KJCA 1WBLA 4COUA 3OYMA 3I5UA 1OQDA 4XLPF 1TMF3 2WS93 3F6OA 3ILNA 3WF2A 2K4JA 3KZYA 5EDNA 4N43C 4NMIA 4R4ZA 5FYSA 4DZJA 4UW5A 3FL7A 4F91B 1R23A 2JDMA 3GHNA 1YHQI 4R9BA 1OISA 1HRV3 4KN4X 2WBKA 2ZHMA 1SBFA 3CO2A 1E0EA 2R042 2UWBA 3T0BA 4W4ZA 4M01A 5D5VB 1MS5A 5LFAA 1BI3A 4QHBA 1UU6A 5FLXZ 4RSUA 2M1BA 4GH4A 2B0LA 2DT6A 5GALA 1YJWI 1AL21 5A6ZA 1CZVA 3B3QE 3N7MA 4M0NA 5IK8A 3JBG3 3H36A 5E3OA 1CESA 1WCSA 3ZX7A 1HCRA 4HX8A 4PQQA 3D6EA 3DCQA 2CV0A 3ACIA 1DPUA 1XGSA 2Z4FA 1ENXA 2R062 3O0XA 4MHUA 4Y3OA 1NE6A 3G1MA 5B1AH 2HQ5A 4DYRA 3Q8EA 3DEMA 1D0XA 4WBBA 2HDCA 1DQ6A 3WHCA 5K1YA 1RHI1 1QXJA 1UW8A 5GM0A 1IOAA 3MWMA 1KQ8A 1Y7BA 2HLEA 4X1EA 3C7GA 3IIIA 5JXIA 4O61A 2VE1A 1ETWA 4YWAA 3V65A 2GA1A 4CDUB 3BR1A 4GYGA 3MI8A 3GEZA 3ZSJA 4AR2A 4LBJA 1EA3A 1SD7A 4NIGA 4Q4X2 3ES4A 3AMQA 3JSPA 4CDWC 1ZA7A 4UV9A 1ULOA 1WJBA 4FSJA 4UF0A 2BW8A 3CIHA 4A3LJ 2VH9A 4U87A 5L3BA 1YFHA 4G6DA 4QPIA 5BMZA 4NC6A 3KCCA 4BJ0A 4OHXA 4Y1UA 5F39A 1RUH2 3L2VA 5D8AA 3VBFB 1WCQA 1PIV1 3BTLA 1ZGJA 4FOWA 2ZGPA 1CAVB 1J83A 2DWRA 4UVCA 2A75A 2IA1A 4NWWA 4MIMA 3P6BA 2XF7A 2ZC2A 3GO5A 4FPJA 3NKTA 4V2WA 5M3MJ 4ZU4A 5BNOA 4FPOB 3LSIA 4IHSA 3J4UH 2FQ4A 3TBIA 2A6TA 5L9BA 2Z3YA 2FA5A 1NH3A 2K9QA 4FE7A 1JE8A 4LEJA 1BW5A 3ELNA 2WADA 1YX5A 2HEYF 3QWLA 3QP6A 4GWIA 3P7NA 1BR1A 2ZSIB 2MH9A 1IN8A 1KEXA 3HAGA 2IT0A 1WMDA 2PJPA 4XF0A 5F8PA 3KS7A 1XMXA 4TLGA 2JXAA 2KMUA 2LFBA 5E1RA 5E20A 3IBMA 3C8XA 2BJSA 1OJLA 4H7LA 2RDPA 5DS9A 3BTZA 1WCKA 4DS0A 5BNNA 1MMAA 4MFDA 2VVFA 4YGCA 1W2TA 5CA6A 4XLNF 3A0NA 3HWJA 2FEZA 4JQFA 2ZGLA 2Q1FA 2W87A 4CCEA 2XB0X 2G0EA 4F55A 5AVAA 2WA3A 1DQ1A 5EEHA 3MYXA 5C33A 1DP3A 1T2KA 4BQXA 3KQRA 4R79A 3JD72 1UZCA 1VBE1 1LDKB 1TQPA 2FCUA 5H2FC 3DBHB 1HN1A 2P5BA 2TUNA 5ANQA 1YUDA 2VL4A 3IZOA 2GXAA 2OCEA 3H50A 1F5FA 3WF4A 2D45A 3UJQA 3F21A 3HDDA 3DUIA 2XVKA 1V6NA 3VUOA 2WLQA 2JD4A 3WINE 5FXXA 2XAHA 1SQ4A 1OI6A 1SG3A 3RCOA 1IPJA 1W6OB 3ZYGA 4XN3A 3OS1A 3CC2I 3K48A 2C24A 1FYUA 2RE9A 2RM22 4YZ4A 3CESA 3GVAA 1ZTRA 5KHIA 2DOFA 1YIOA 2ZXHA 1AKHB 2VXZA 2OQRA 1K78A 4HONA 1LODA 4GKYA 5KHDA 1YYVA 1W03A 1I5ZA 3WUDA 1NK3P 1R081 4FBFA 5K0UA 3CTAA 1XSDA 1A34A 4PI0A 3WV6A 1OYIA 4SLIA 2IS6A 3ZP5A 4W65A 3RKWA 3VBFC 2ZJCA 5F6FA 2F4MB 4DY3A 2DDBA 3VL9A 4AVTA 2RVAA 4CCKA 4H55A 5IT9Z 3WDTA 2D1HA 3ZQIA 1C8M3 3T8RA 3W6JB 2ZX0A 3TW7A 4AYUA 1H1MA 4YRVA 4AHXA 2VMGA 3NV3A 3POGA 3KP2A 3VBFA 3I56I 1YTYA 4IVNA 2COMA 3M1HA 4CP9B 2EA2A 1WW6A 2VNGA 2NYYA 3ZMZA 4Q5SF 2WWYA 3W58A 2PHWA 2RNJA 3QYEA 1CD3G 4AVZA 2VVEA 5L36A 1JYCA 3CCVI 3AZZA 4RGKA 1FYKA 3IAS2 2CQXA 1L7LA 2WNUB 1RZ4A 4FTBA 1IRXA 4IL6C 4YIRX 1D3YA 4QX5A 3FISA 3V7CA 2HH9A 2P0WA 3LEMA 5T5OA 2WQZC 5FUPA 4P1WA 4K20A 4UHTA 3JTGA 4Q4X1 1D1CA 2DI3A 3AP5A 4YLZA 4BA6A 4BQ1A 1JYIA 1UB9A 2YROA 3HGGA 1RESA 1R5GA 2WL1A 5ABJC 5K9YA 1W6QB 4DY5A 4K1ZA 1ACCA 5HCBA 5IYBJ 3K6GA 2P8TA 4MGQA 3BDDA 1Z05A 1QKQA 3CDIA 2E35A 1MDMB 5HLHA 1MZBA 1NAEA 1UHWA 1IQAA 1H8TA 1ZZ9A 2DQRA 1BVVA 2JKXA 4FTEA 2FOWA 4AHWA 3OEAA 1HXS2 3JRGA 4P14A 1T8IA 1VFCA 3WW1A 5GAGJ 1MNEA 4CU8A 2FE3A 5IVEA 2HYJA 3SITA 1RKWA 1OLQA 3LPFA 4HK8A 4LA2A 5A3TA 1E5RA 4KN7X 1X58A 2VBXA 2W1QA 1TP4A 3SCHA 4XMAA 2IA0A 3OGJA 2XAQA 5K5RA 5FKNA 1RHI3 4B43A 2HOAA 2HWB2 3ZOBA 2ZJPF 2Z42A 2EPFA 4RGGA 3TO7A 4BNCA 2ZNZA 1U0JA 1HV1A 3MAJA 4WF2A 3R4SA 4TWTA 4I3GA 5E89A 3UL2A 3POIA 3U14A 4N53A 2RS11 4IRHA 3LIHA 3CCJI 5IOZA 3MKYB 3BCWA 3GALA 4A3KJ 1FOKA 2ADEA 3RPQA 3CQOA 3ZYFA 4JX5A 1RUOA 2R7TA 4AE2A 2QKMB 4QHZA 4G9SB 1QZZA 3EYIA 2L9LA 4ENJA 1LEMA 5FMDA 3JSOA 5L19A 2VVDA 5FP9A 1APNA 4ESFA 3ACFA 4FQGA 3JRIA 3ZDSA 3OYGA 3A23A 2QM3A 2R7DA 2BWCA 2PHUA 1YYNA 2XROA 3WDXA 1Z7UA 3O8GA 4A12A 1ZKGA 1VBB1 2DF7A 4EVIA 1FTZA 2M4KA 3VBSC 2GXBA 1VQ4I 3ZYRA 1V5EA 3EQEA 3VV1A 5CYYA 5C9AA 3RPUD 1XNAA 3N9OA 1FZPB 1TT0A 3H0DA 3NNJA 2PLV3 3RGBA 4QPQA 1U5TA 4CEYB 3OGRA 3PNYA 1FPQA 3WZ1A 1GQPA 2YC2A 4BH9A 4PLOA 5JHFA 2W24A 4L9JA 1ASJ2 1A6QA 3AX4A 1MGTA 3QD6A 1JYTA 3FM5A 2MG4A 2WQ4A 4MVTA 3KP4A 3S93A 4F3JA 4CPBD 4M3CB 2HFHA 5DAPA 2ZGUA 5A7QA 3A0BC 2DOAA 2NN8A 3TWIA 1ZBE3 4GB32 5CFDC 4YG6A 1LOCA 2STWA 4YFWA 1JI8A 3VL8A 5FKLA 2HPIA 1JW6A 1XB9A 3FXKA 2YU3A 1LECA 3TNQA 2PAKA 1HRI1 4YG3A 2H0BA 3O0VA 2ZAAA 4ARYA 1LFPA 2WNOA 2FSWA 4UF0B 2QSFX 2QQLA 2ZAHA 3S2WA 5E1WA 3J7NA 1KGSA 2DA4A 2MW8A 4OIRF 2YUSA 4UW6A 2ARXA 2A73B 1G3SA 1R092 2HOSA 2QQJA 2F48A 1H4GA 1ETQA 2L7ZA 5IFPA 3ZMOA 3WTZA 5HV0A 3DXTA 4FP3A 4AYBA 2YMZA 3RIRA 4XVHA 5BNPC 1W6NB 4E2SA 3KLNA 4M3BA 4IV1B 3WQ1A 3BZCA 1XNKA 3WTSC 3LIGA 4K3UA 3I53A 1R58A 1HKQA 2Q2EB 4PIXA 2DUOA 1ZR2A 5J1RA 2EFPA 1CVNA 5A3PA 1YCIA 5B66C 4IEXA 4UB6C 5K4LA 1XPXA 3WCSA 2FDIA 4PLNA 3ZSLA 3DF0A 1P4AA 4BKXA 4MH0E 1MVQA 2GIZA 1XE7A 2MC4A 2WSVA 2HYFA 4IF4A 1CAUA 3CJNA 2VONA 4BMBA 3KV9A 4Y22A 2CAUA 2K9MA 1STZA 4FX0A 1WW5A 2LK2A 4X6AJ 1EV7A 2W57A 4IE7A 3L9JT 3RVHA 4PZJA 4Q4Y1 3EPZA 4G3YC 1TE1B 3HVDA 1APLC 4Q0VA 5DCFA 1FSHA 5JOYA 2YGMA 1GHCA 1Y3TA 1PJRA 5FP3A 3HOXJ 1QJU2 4XIOA 2WA0A 3DPRC 4AQTA 4CCLA 3GHMA 4AZZA 2ZKZA 4GYIA 4LKFA 3V8KA 1SFPA 2W7NA 2CYFA 3BI3A 1FATA 3LFKA 4XBLA 3HC7A 1GLNA 3I3MA 3ZFGA 1VBB2 5EXOA 1MDMA 4HDVA 4F52A 1NUKA 4HDUA 4JHTA 2Y31A 2IRFG 3MV11 2AEZA 2XR4A 2NM1A 2KHMA 2OZUA 1OA2A 3ZLIA 3DLAA 4YVSB 4IDZA 5DAQA 4BAYA 5FO9B 1MBEA 1POV3 5FZ6A 5IJRA 2FBHA 1EH6A 2DA3A 2E9QA 1RUI2 2HWE3 1TBXA 3HBKA 3H35A 2LBFB 1PO11 3OEBA 1U5IA 3ON7A 5IATA 3PUSA 1CGPA 1D2QA 4GZ9A 3KF5A 1NCRC 5HCFA 2ZBJA 3GYHX 3R4UA 5IVVA 1UKGA 2VNVA 1ULYA 3HT1A 1D1BA 1G59A 2QKDA 1RUG3 3S3NA 1ODMA 1B72A 2GZWA 2WAFA 5FFXA 2NXNB 5BNPB 2R0HA 4IOAF 2ZHNA 4M6YA 3M3OA 5J4YA 4RAGA 2V9PA 3FMQA 2PLYA 3OL3A 1C0WA 4HVOA 3LB9A 2M0MA 3GCWA 1EH8A 1QA6A 5A6QA 2B63J 1KS5A 4XE9A 1BJZA 4Q29A 2VO5A 2B42B 2E60A 4M00A 3PJYA 4IV3B 1X33A 3REOA 2V4AA 4LIUA 1KU7A 2NZ9A 3TQNA 3LCPA 4XHBA 1BI2A 1MBKA 3M8EA 4RGUA 3HOZJ 2XGXA 3E6DA 3O1MA 4A41A 4FT8A 2D40A 3BTAA 1N3PA 5FY7A 2XLAA 2HWD2 4BOWA 1UMHA 1VAMA 4AW7A 2PYTA 5DAWA 3NWSA 2ET7A 3MIHA 1I5PA 3J8F2 3HOYJ 1LE8B 5ABJA 2EA7A 4CU7A 4LK7A 4WM8B 1RIRA 2DAOA 5KR7A 2ID6A 4XDOA 3HUGB 4AVPA 1NY71 2PJRB 3V0BB 4LULA 4HX7A 3DYMA 3KCXA 1WGXA 2EZIA 1TMF1 2D6KA 2WS91 4MYEA 3FXOA 1WKYA 2VM9A 2CFXA 4Q0PA 1TQMA 2DTRA 3IKVA 4MZUA 1VRH2 4P9YA 3NSTA 1PYVA 3IH4A 4OUEA 5F1RA 1SMTA 5IHRA 1BOBA 1W9WA 4HLYA 4B09A 4AFAA 1UX6A 5FZMA 4L5IA 3F2ZA 1UHMA 1LTEA 1ZM1A 1V70A 4GFBA 5A6XA 3WP4A 2O8OA 3LSMA 2LF8A 2RHPA 2JJ6A 3I54A 3KLSA 5GAHJ 4M9ZA 5ERLA 4U36A 1BR4A 1GWKA 3OUHA 1NA1B 5TSWA 4KGQA 4N0BA 2GNTA 4HPKB 5EFUA 5EYYA 3MV01 4BY1J 5C3SA 4W8JA 4MO3M 5BPXA 2CSGA 3KB5A 4TSVA 3UT0A 4PCRA 3NNFA 1IW7F 1N75A 3PFYA 4KMFA 4UBHA 3HPGA 2JECA 1CAWA 3LDKA 2JE8A 3G73A 3I58A 4BDVB 3BQZA 2L9SA 2MLGA 2UWMA 4E7HA 3MZHA 2H6BA 4IRGA 2F17A 3ZXDA 2DCYA 4S2HA 2Y69H 1XSXA 3CNAA 5C8CA 1ZQ3P 1JZ4A 3WCRA 5GKAC 2XLGA 3VZMA 4YVWA 3BKZA 1F31A 1PUFA 2WY7Q 3GZAA 4KISA 5E8AA 2X4HA 1UZ0A 3PUQA 2EXJA 2DTZA 5C8CC 4IO9F 4N4NB 2PAEA 1TG7A 4URAA 4D1QA 2ES3A 4ZC3A 2ADDA 3MFCA 2PX9A 2F5CA 4QHOA 4CZSA 3OMYA 1MEC3 4N7IA 3HTUA 1XYOA 2LBFA 1R4MB 3QH6A 1UN1A 2WFF3 2NRAC 2NS8A 1LENA 1R5HA 3OWTA 2JPCA 2ZGOA 4ON0A 1JOBA 3ERED 3JTHA 3ABMH 1AYM3 5JLXA 2DA5A 2FMDA 4DUWA 2YUEA 1G7YA 2JK3A 2WLPA 2YSRA 4BXFA 1PGL2 2GN7A 4IHWA 1JYXA 3ZM8A 2IGNA 4XM3A 3X2QH 1JJ8C 3CLOA 3FXMA 2ZKNA 4BUPA 3QACA 2LREA 3C7JA 4TXWA 3KYLA 4F92B 1FY7A 2OUMA 1LUJB 2B9VA 3MPBA 2BV4A 2HWE1 5EHDA 3HT2A 1XXNA 5J3UA 2O61A 1J1TA 4N53C 4LLLA 4IHTA 5HPOA 4CH7A 5KAFC 4XZPA 2J1TA 4YFZA 2WA4A 2B39A 4RGAA 4W50A 4CUAA 3Q9OA 1JT6A 4LITA 1MS1A 5A2QZ 4NHYA 1LU2A 1H0MA 1F43A 4ES9A 1SLLA 2BBVA 1IRFA 1XOYA 2W5FA 3HOUJ 2C9KA 1Y0NA 1W6QA 3IIAA 1ST8A 1LDDA 3SCGA 1ND3B 4WXDA 1J2XA 4WWCA 1QJY3 3AAFA 3ISPA 3CZJA 4AGRA 3LWCA 5JSRA 3IV5A 4AM3A 4PT6A 2M87A 5CFDA 4CDXB 2OUJA 2EAAA 1TW3A 4Z92B 4CUGA 3FFQA 2IW5A 1UQXA 5F04A 4YZ5A 3H1WA 2LTPA 2QQBA 1IG7A 3KZ4C 4GH4C 3UJOA 1HKDA 4NPMA 4N7UA 1MJBA 3CDZB 4RS5C 2GC0A 4CP1A 4A3BJ 4AQ2A 4JRAA 1FOD2 4ABZA 5C5TA 4PFOA 4GCVA 2PI0A 2DURA 2WINB 1QF3A 4XMIA 3BY6A 4NOTA 2Y26A 2HEVF 4PJ0C 4HOBA 3O0WA 3K2ZA 4C9YA 2HS5A 2CU5A 5FY4A 2XHNA 4OUMA 2GN3A 4CCCA 3KP7A 1CIWA 2VZ3A 5CYVA 3RJPA 1VR3A 2VPVA 4QDRA 5GTIC 3WX5A 1KD7A 2ZMNA 3MKZA 2L9RA 3MVPA 3S1RJ 1PGW2 2HWVA 2VZSA 4UFHA 2F6BA 5CZKA 1W9YA 3AKSA 4I98B 4L8QA 3B69A 2VOOA 2K0GA 5JOXA 2X48A 3FK7A 4E6KG 3VZKA 4ZPIA 3GLLA 3BR3A 1DZQA 3ZIXA 4EN9B 4O9GA 1QXPA 5EYXA 2DFCA 3M9AA 3CP8A 3UETA 5LK7B 4MNUA 2VC1A 1X8MA 1S8NA 3WU1B 1RUC3 2ZKLA 1RUNA 3ZKYA 4D6QA 3OYHA 3G3ZA 4I2OA 3QBQA 1R4NB 3JBG1 1GZTA 2QZ2A 3W59A 1F2NA 1VB4A 2VCMA 3M7AA 3OYWB 3DPRA 4TLFA 3S30A 2WC2A 2JG8B 3H7JA 1OSGA 4CDQB 1PNFA 1Q5OA 4XLHA 4EEFG 4DBRA 3WG3A 2WZ8A 4II2A 3RQ4A 4XCBA 1B35A 2V79A 1V6KA 5EG0B 4Y15A 1IZ3A 1JTYA 1NCRB 4IKFA 1FIAA 1OOPC 4UFJA 4MV2A 5FYZA 2JG8A 4TN7A 2OYZA 5L3DA 4BGDA 3V7RA 4S04A 4OMYA 4KWLA 5C4WB 1GLHA 3F72A 1YS6A 2VBZA 1G2HA 2R073 4AQSA 5DUUA 3MKWB 5C3PA 4D6RA 3K10A 5FPXA 4NNJA 3ZR5A 1BQPA 2DT5A 2BTVC 1NCQC 3I59A 1VRH1 4FPKA 2ZXWH 4M3DA 3TBDA 3ECOA 2GC3A 4BQOA 1AX0A 1BL0A 5DV5A 1QDOA 3U1XA 5JSOA 2DA7A 4FFIA 3H5AA 2PBIA 1EUTA 2D1VA 3PURA 2W1UA 3PTRB 3U4XA 4Q4ZF 2V7FA 1ENSA 1VI0A 3ZQFA 3VDDC 4JK1X 3VBOB 5ACA2 4HPQA 2QFEA 4Q4W2 4DUXA 2RC4A 4V2GA 2F4PA 4G12A 4M3EA 1I1EA 1F4AA 2BOIA 1N78A 3C2BA 2J22A 4XF9A 4WVMA 2EJRA 3B93A 4L99A 3A1YA 4E7SA 3LQCA 3BTXA 2V4JC 5E6HA 3WP3A 3K4DA 2WUHA 1WJDA 2Z16A 1YRZA 4CP9A 4HF2A 5KXDA 3HOSA 2DVFA 1GP4A 3K4ZA 1XG1A 1RUF3 4RR3B 2BOLA 2R7FA 4PF5A 1T0FC 1PP8F 4KFCA 3IC7A 1E5SA 1T98A 4UT5A 1WCMJ 5J6XA 1Q56A 3NAPA 4D8MA 3NMBA 4JCKA 1IKPA 3ASIA 3BQYA 1ETXA 3EQLF 1LEAA 4KT6A 4MXVA 2O6GE 1J3PA 4HQMA 2VNOA 4QPIB 3BG7A 1AL0G 5LA0A 2LUWA 2V73A 5CVRA 2ARAA 5FUNA 3MBWA 1PIV3 3R4KA 2BYVE 1SMVA 5DCMB 1REEA 2L02A 1VQLI 2D6LX 2JD9A 1Z6RA 3Q0WA 3LFUA 2M5WA 2ZBKA 2QF7A 2QYOA 2HXOA 3FMRA 1REFA 2D6MA 2EAKA 2OZJA 1PVEA 3GZEA 1W28A 3AJZA 2AYHA 4FHTA 4UAPA 2R7QA 3EO6A 3POYA 4IE4A 4XURA 5LY2A 3ZSMA 3IB3A 1J75A 4DXRA 2ZSHB 3IAQA 3A2KA 3LKJA 3T08A 5EJ3A 1OR7C 1OLME 2WJSA 5FPAA 5IP7J 4P9XA 4UFKA 2XGDA 2IEKA 4HN0A 1BCXA 3CMGA 2ZGTA 3PUHA 1OD3A 1COV2 1QGLA 2J1VA 1RB8G 4K8FA 5LBBA 4HLTA 1OVPA 3F8MA 1Q8SA 2H8RA 1UG0A 4DFSA 3ZXKA 1OQYA 4D5CA 3OYBA 2JMWA 3V8JA 5KHKA 4GWNA 2E1MB 3NV4A 1IV6A 1OF3A 4IETA 2L0KA 3N9NA 2DK5A 1ODNA 5LGTA 3CCEI 3M2MA 5F0CA 3KP6A 2VAUA 4JP0A 1W5TA 3C7EA 4YIFA 3BTIA 5D21A 1VLNA 2VODA 4MGZE 1KXGA 1I6HJ 4JTNA 4E2QA 4ES8A 4AWDA 5A1LA 3RYPA 2GP5A 1QU0A 2C9AA 3BG3A 2KM2A 2PG4A 1LGBA 1OCTC 3D4KA 1P7IA 4RAYA 3M8FA 2O14A 3K4LA 2VOTA 3D5LA 2XKOA 4LBQD 3DLLF 1WI9A 1MZEA 1QJY1 2KIFA 2GNBA 3E6CC 2R0FA 1VB2A 2P3KA 4BQ3A 3ZR6A 1K83J 3T4HB 2JG9B 4PUSA 3ECHA 5KNLA 4GJYA 2OIIA 1JZ6A 4QPIC 1OLTA 1GQHA 1XYPA 4MTDA 2LM3A 1V0AA 2W2IA 3SQNA 1E17A 5JZGC 1H2KA 1SLAA 3I55I 4BJ6C 4B8EA 3OSGA 5BPIA 2OUHA 3MFKA 1W0PA 1BVP1 2D98A 3F9KA 3W2VA 1GWMA 5JR7B 1U6GA 4RS5B 2DTWA 3POBA 4KWUA 4RFRB 5ILUA 5BNOC 4ZDLA 4QPYA 1TWFJ 3DEUA 1JMUB 2QBYB 2XUEA 2ME6A 3L2CA 5KHHA 4Y1XA 2P4WA 1PUFB 2P7CB 2XWJB 1CONA 3KV5A 3JU9A 2ZEYA 4XJ8A 2VLAA 2FDKA 2EFQA 1XCVA 1FLIA 1AR62 4Q47A 1UHSA 3VBHA 2VTXJ 1S0EA 4FPFA 4XL9A 3EYPA 2YV8A 5D6FA 2K3PA 1JHNA 3B73A 5BNQA 5FPVA 4R9AA 4R8HA 3H8UA 4BQNA 2EFNA 3VD4A 5M5XJ 3VYUB 2MA3A 1RUC1 2Y6GA 2HYXA 2DO7A 1A78A 4L9BA 2A3SA 3RKYA 2W94A 4ANJA 3OOXA 2RMU1 1MD0A 3ZXEA 1O91A 1OQ1A 5E16A 3V56A 1XNBA 4AGVA 2HWD1 3BB6A 2R7VA 1OLMA 3AG3H 5FFOC 1ZREA 2LS6A 5FWJA 4F83A 2D3SA 3BOWA 4QM8A 3FZ3A 3WTXC 4WCGA 2ISZA 3GTPJ 2RS53 1H6YA 4KBBA 1DZTA 2Q8KA 1RUD1 3OJBA 2Q4SA 1RTVA 4XYXA 2AQFA 1TW2A 3P9KA 3CMYA 2RM23 2DODA 2YXSA 1AF9A 5A80A 3GDBA 2NNNA 2FU4A 4YPJA 3D5RC 4D5FA 3CZ6A 1ON1A 4D7YA 1C1LA 1H8VA 2EF6A 2WZR1 1JUIA 3JAMZ 1FTTA 4QTRA 3M3QA 2IGKA 1FP2A 2YG0A 2CJJA 2JJ7A 3R0AA 3PSIA 2O5RA 2C1FA 1GR3A 2LY2A 5DD4A 1FYLA 4XUPA 4AGGA 4BCUA 5AONA 1FBUA 3VYSB 3IDEA 1COV1 2WB1N 1RETA 2O8QA 2AS5F 2Y0IA 3ZQ7A 2X6WA 1EF4A 2VJXA 4KWJA 1LEBA 1R1A3 3I9V2 4AD9A 2W1OA 2PMUA 1RITA 1XMAA 1X1PA 5CJ9A 1RUF1 3GF6A 4NQWB 4LLOA 3JRHA 1NK2P 4BIFA 3GFLA 2CQ7A 5IVCA 4XF3A 4FFHA 4XETA 4XRMA 1BW6A 4JVAA 5T50A 1CJDA 2W46A 4P08A 3MUY1 4LG3A 1LOGA 1TZOA 1K45A 5FZ0A 3K69A 3BC8A 4A2UA 2FDGA 2XAUA 2R7OA 5F3EA 5DM6F 1TME2 3VD5A 1MS8A 1O7LA 1MACA 1B09A 5LHGA 1JZ5A 4CDQC 1PVC1 5GZDA 1ZG3A 1F8VA 3WNOA 2EK5A 3JRFA 5LZ6A 3K4AA 1X7NA 3CUQB 1BIAA 1W1WE 1U9NA 3THTA 1H89C 2R49A 3TOBA 1ZYRF 4IJAA 3DGTA 2CV2A 1KONA 3QRFF 1H4HA 2K40A 4XBFA 2R1DA 5CQGA 5FJKA 2BRTA 2VBBA 3EYYA 3GGLA 5GZCA 5FZAA 5FP7A 1PMJX 3AL0B 3CCLI 1WLCA 2VE9A 3ASNH 3U78A 4JRLA 5T3NA 2XGEA 3FXLA 2CV1A 3KF3A 2A7AA 4M6XA 5JOZA 2BY0A 2JA7J 2Q8DA 2A70A 4Y17A 2CV6A 4EM1A 5FZ9A 3BPSA 1UOGA 3I0TA 3HL2A 4FO9A 1D4M1 1Y1WJ 3NWTA 4XHXA 4G7OF 1WLTA 2Y64A 4UV8A 5ILVA 2BW3B 2LALA 3GM8A 4CDUA 1JUHA 2BEOA 3MFAA 3WNXA 4ET7A 3G71I 1ZAOA 2JKBA 3JZVA 2OKXA 1QZYA 3FDYA 2DLLA 3ZCOA 3RZZA 3S7EA 4NAMA 5LHIA 1HRI2 4LO6B 3CCMI 2IWGB 2CL2A 4DB5A 1T95A 4AVVA 1CIYA 4FE4A 5LK5A 2EVXA 1QOOA 5JDBA 1ZZBA 1XJAA 3T2TA 3CU7A 4MQVA 1OUXA 1Y6IA 5JI7A 3K4MA 2GC2A 1WBFA 4Y5Z0 3DPUA 3KEQA 1GV9A 1J09A 2QUFA 1OLRA 4HFSA 4MGRA 3TEZA 3NEUA 4E7ZA 1QO0D 2FQ3A 1OURA 5IK5A 5E3MA 1N1VA 5FYUA 4NQWA 2QA4I 3CHXA 2ZS6B 5FPLA 1C5IA 4RR3A 1P8JA 1W9FA 3FUOA 5A32A 3A01A 2VI6A 1NOVA 3WTWC 2R7UA 1EPWA 2BBYA 2JDAA 1ONVA 3OYJA 5J1UA 4M3GA 2OQ6A 3AKRA 4CP0A 2OD5A 3ULQB 1TQIA 3QLQA 2XPJA 1REPC 5IOYA 1FX5A 1Z7S2 3VHPA 5GZEA 1HW5A 2E6VA 3JRCA 1YFUA 1NXMA 1W6PA 2VZVA 3GJAA 5FYCA 3HPNA 2EH3A 1X1DA 2OTLI 5IUQA 4AEDA 2C5DA 1K4TA 3GZUC 1TQ5A 5IYCJ 1D8JA 1GVDA 1D4M2 1MBJA 3VDDB 3NQHA 4XOTA 2Q5TA 2DBIA 2ZX2A 3I3QA 1GQGA 3VN4A 3ZPYA 2A6XA 3LEKA 5DD8A 1SANA 5FPBA 3I2KA 5FV3A 5J8FA 3W6KB 3ELKA 5L7OB 2HI3A 1UU5A 2D44A 4EE2A 4B4CA 1HW2A 2ZEZA 4CICA 1X1AA 2JA2A 1XDUA 5D8KB 1VBA3 1QJX2 2L4MA 3WQ7A 3FLPA 2A5WA 3VB9A 1BC7C 4Z1VA 1VBC1 2F4IA 3DKXA 5HNHA 1R093 2DCZA 4HOOA 5FXZA 4AHYA 2WZR2 4H3WA 4AU7A 4JX0A 3T1MA 5A7SA 2IVIB 3SXWA 1V6LA 2YX7A 4HNTA 1WMXA 4P5HA 5G05L 1X2MA 1KZHA 4B3NA 3V42A 5LB6A 1B9NA 4YVWB 1HDDC 1AU7A 2XPVA 2W0XA 3ZFFB 4PDKA 1GDTA 1H1AA 4QD2A 1SEUA 3LGRA 4YM3A 3OBRA 3HRSA 1WJEA 3WF0A 4M3CE 4N43B 1SBEA 1NZCA 3WUCA 3EETA 1P6RA 5ICGA 4R9CA 2R7SA 2XHKA 4BEHA 1X8EA 1XBFA 3WEZA 5C8WA 2ZGSA 1F5TA 2XXZA 1S29A 2SBAA 2DMTA 3HKZN 3S3OA 5AVPA 4I0BA 4AVAA 5EP9A 1HJFA 1PM7A 4QQPA 5GLUA 2XJPA 1WH7A 1VQOI 2EA4A 4JC1A 1BIBA 4QQLA 1K4SA 5FZCA 3VYRB 3TEWA 3VBRC 4XLEA 2K85A 3J81K 1WW4A 2MFZA 5LHHA 3IAM2 3TO6A 1YJNI 3Q8AA 3MQ0A 1D2SA 5ILSA 1FXZA 3L1PA 3VHRA 3NJVA 4HL0A 4G7HF 5FIXA 3I3BA 4X8PA 2B7YA 2ZX4A 4K1YA 2YX4A 5FUIA 1DGRA 4A3EJ 4C91A 4CDWA 4UVAA 3ZPLA 2V5DA 5HS7A 3N4MA 2Z9OA 4JGYB 3SH4A 4FASD 2CAVA 2VOKA 5AC93 3LSKA 1LEDA 5K7ZA 1C5HA 1FOD1 3KSCA 4OIQF 2VQUA 1AYN3 3HMYA 1OKQA 3SH3A 4YIIA 1YQ2A 4GQ7A 2HXIA 3HEFA 2IAIA 1OHFA 2ORZA 2VW1A 4YVSC 2P6HA 2VW2A 4LMYA 3GBFA 4CEWB 1POV0 5L9VA 1VQMI 4PJYA 1IN4A 3GTJJ 1Z78A 3ML6A 2IXJA 3DBRB 2HOEA 2CWEA 5F5CA 2XPUA 2FCTA 4IHYA 5F08A 4P9WA 1NY72 2W91A 3LSDA 4ISRA 3WT3A 2X5IC 5JIUA 4PJNA 4EJUA 2LG4A 2HTJA 2VJ4A 3ZXFA 4YW7A 3E5XA 1PK6C 4E70A 1EH7A 2YU9J 3FUQA 3E5QA 5J40A 4I99C 4U0VA 3CMAI 5ANNA 3KT1A 3RZKA 3LAPA 4Y20A 3T2QA 3CMMA 1HXDA 1UWWA 1HN0A 1X3UA 4BMEA 4N4OB 1SLIA 3LOBA 1AR83 2WTEA 4QMAA 4HVRA 2ZZJA 5FQ0A 1C28A 4P02B 3SLIA 2IXIA 1ND3C 3I3EA 3FJSA 3ABKH 3AJYA 2HGCA 2RR11 3H8RA 2V26A 1Y43B 1QDCA 1FNYA 5A7NA 2DFHA 4QB2A 2E19A 2XWBB 2JA5J 2ESHA 3OG2A 2X1DA 4Y4YA 1PVC2 1LR5A 4P5OA 1MZFA 2CDOA 1S1AA 3NO8A 3HYIA 5E79C 4JGZB 4E7JA 3M70A 1VMFA 1OPCA 2WT1A 1B4AA 1J0RA 3LDRA 3E6MA 4HV5A 4RLQA 3DBLB 2Y38A 1UX7A 1AL23 4LLNA 3ZQQA 5ISLA 1W0NA 5C7GA 2ZACA 5HLGA 2FDFA 2AEYA 3HRMA 2VMCA 4Y1ZA 1CF7B 4AL9A 1N77A 3KE2A 1HJGA 4LO8A 1C4RA 5ERIA 4P9IA 2VUAA 3WSOA 3ZMUA 3OYAA 3IPVB 3OS2A 1QIQA 5J96B 4ZZ5A 2OVUA 4Q1RA 1XSQA 4PIZA 1HRV1 3Q8BA 2V1NA 2RMU3 3DPLC 1S0FA 1VNDA 3UGGA