2Z2SB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
182
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRDPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 40
structure length 182
sequence length 193
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z2sB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z2sB02
4O9GA 5BUVA 3RYKA 3DV8A 5I8TA 3EJKA 2XLGA 4IETA 3S0MA 1H1MA 3IBMA 2BGCA 3FWEA 5CADA 1V70A 3G7DA 4PIXA 2K0GA 3BCWA 4MZUA 3DKWA 5J7MA 4N9IA 3HUGB 2P17A 4UBGA 4Z07A 1ZZBA 3OTFA 4HN1A 2FMYA 1GQGA 3H50A 2B8MA 5KHHA 1ZRFA 3OD0A 3IWZA 2GC3A 1WA4A 1LKNA 2IXJA 4XFAA 3H1MA 5EFUA 1RL3A 1SEFA 4QMAA 5FQ0A 1G6NA 4ZU7A 3U0ZA 3E6CC 3H3UA 5LEJA 1OMIA 1NE6A 1QY4A 2Q30A 1FXZA 5JR7B 4META 3S7EA 1PMIA 3OCPA 4WBBA 1YHFA 4HVQA 2O1QA 1J59A 2BEOA 2XKOA 1ZRDA 5E1RA 2HJIA 3LA7A 3RPQA 1X8MA 5EZWA 4MGIE 4UXAA 1Q5OA 2WFPA 4WVZA 3CJXA 3KGLA 5I8YA 3BPZA 4XF0A 2Q4SA 4F7ZA 5AVPA 3TNQA 5JAXA 2H0VA 2ZKLA 3FJSA 4UBHA 2EAAA 4L11A 2EVXA 2PAMA 2ZCWA 3NSTA 4NVPA 5FLIA 2O8QA 4WZCA 3H7JA 5I0UA 3UKNA 3BU7A 1L3JA 2VQAA 2CGPA 1I5ZA 1GQHA 2B9UA 3KGZA 1DZRA 4XF4A 5I93A 3WW1A 4BIFA 1YLLA 4HVRA 3ROUA 3LA2A 4HVOA 1DGWA 1IPJA 5BPXA 2UYBA 5JCTA 3NVCA 3E5UA 3IIAA 4JTNA 4JTOA 4IEWA 1RC6A 5J48A 2OYZA 5J3UA 5I0SA 4JVAA 3HQXA 3S7IA 1RUNA 1NXMA 5KBFA 3HIFA 4B29A 1YFXA 1J58A 3FFQA 4PJYA 5BXXA 1CGPA 2PAKA 4I2OA 4LA2A 1UIJA 4I09A 4LEJA 5KHGA 2MPFA 2GC1A 3RZZA 2XL9A 3FX3A 4OLLA 4PIYA 1ZZ6A 3ES1A 4F8AA 3USSA 2XLFA 3I59B 3U10A 4FAHA 2GC0A 2Y0OA 4AXOA 4FAGA 4HSJA 1WLTA 4MGKE 5C8WA 4Q0UA 4EWEA 3HT1A 2VPVA 3KMHA 4KWKA 1XE8A 1VP6A 3MDPA 3RYRA 3ELNA 1O3RA 2KXLA 2BNMA 4IEQA 5LRSA 2D40A 1H1IA 2GC2A 1YUDA 2PAEA 3LZZA 4YNIA 1Y9QA 2OZ6A 1YFUA 1ZZ8A 1CAUB 2H6BA 3H1YA 2XKPA 4YRDA 4EWDA 4QGMA 2GAUA 2GH2A 4ZU4A 4HMZA 1IPKA 3B02A 4Q0QA 3CF6E 4AVBA 4QGLA 3MZHA 3LWCA 3M3IA 4MX3A 5T3NA 2V09A 3R6SA 4AQ6A 1J3QA 1J3RA 3ACLA 4LULA 3PVBB 2ATFA 1I6XA 4MH0E 4MUVA 1QXRA 5I0RA 4HN0A 5D1IA 4IESA 4D7SA 3ZDSA 4X6RB 1EY2A 1UIKA 1X8EA 1XRUA 2E9QA 2UYAA 5FDBA 4Q29A 4QX5A 3SXWA 1U12A 2OPKA 4ZU5A 1Q3EA 1YFWA 3LAGA 3HT2A 1JUHA 1CAUA 2UY8A 3GBFA 1CAWB 5FLJA 1VR3A 3WW3A 4AVCA 4E2GA 2QNKA 4EV0A 1QWRA 1X7NA 1RGSA 3E5XA 3KCCA 4KL1A 4XFIA 4CYDA 3WW4A 2MNGA 5BV6A 4KU7A 1O3SA 4QM9A 4YARA 3FZ3A 4P9GA 5BY5A 1UW8A 4K8FA 4XFCA 3QOPA 2D5FA 3E6DA 5LEKA 3E5QA 5I8SA 3U11A 3CEWA 1SFNA 4XETA 4Q0PA 4R52A 2IXKA 3C3VA 2D93A 4Q0SA 2PTMA 3VHRA 5JSRA 1EYBA 5F1RA 3LA3A 4IEUA 4KWLA 4LUKA 5JSOA 2XLAA 4IERA 4YSFA 2FQPA 1CAWA 2CAVA 1CX4A 4ONUA 2PHLA 5E16A 1CAXB 3D0SA 4QXKA 2ET1A 2IXLA 3DN7A 4Z82A 1ZREA 4QGNA 3SCFA 1Y3TA 1O7FA 5C6CA 2CAUA 1HW5A 4FBFA 1J3PA 1XE7A 2MHFA 2N7GA 2BNNA 3CO2A 4J1XA 3KSCA 2IXHA 4XF9A 3FHIB 4JV4A 3ST7A 2EA7A 1O3QA 4AVAA 1EP0A 1UCXA 5FPZA 2QDRA 4IEYA 2QCSB 4XEZA 1ZZ9A 3OGJA 4H7LA 1YWKA 5I91A 5HI0A 3H1WA 3SMHA 4XFBA 2B5HA 5KHKA 4L2NA 4I0AA 4PIZA 4IEXA 3UKVA 4ORFA 4IEVA 3DL3A 4J1WA 3SCHA 3H7YA 4O9EA 4R8HA 2WC2A 3H9AA 3I7DA 1CAXA 2IXIA 3NW4A 3H8UA 2DCTA 2CV6A 2PFWA 1EPZA 4MGZE 4MV2A 4I3PA 3WW2A 1ZVFA 4Q0VA 1O4TA 1RTVA 1OI6A 2HKXA 2GU9A 2GZWA 5K8SA 4QM8A 3PLQA 4DINB 4AQ2A 1ZNPA 4LLOA 3M70A 2BNOA 4D7TA 4E2QA 4EROA 3I59A 2PYTA 1FT9A 3SCGA 3UKTA 3IDBB 4LA3A 3E97A 2I45A 3RNSA 4I01A 3BB6A 3IDCB 3QACA 1RUOA 5FPXA 4I0BA 3LOIA 2IC1A 2C0ZA 3CL1A 1NYWA 3N4MA 4KWJA 3EQEA 1SQ4A 4LUMA 2Q1ZB 4HBNA 1LRHA 2PA7A 3MPBA 3FE5A 2Z2SB 2QVSB 4A2UA 1LR5A 3PNAA 3D82A 5KHIA 3H3ZA 3MYXA 1O3TA 2IXCA 3JZVA 1ZZ7A 5I0TA 1O5LA 1DZTA 4OFGA 3OF1A 4GULA 1VJ2A 2XL7A 1UD1A 4BHPA 1OFNA 4MGYE 1O5UA 3L2HA 3I54A 4YYOA 1UPIA 1J1LA 2ETEA 3EHKA 4NQWB 2OZJA 1CAVB 2XHKA 4XF3A 4XFGA 4XF1A 3GYDA 2PQQA 1PM7A 2UY9A 4BH9A 5KHJA 1ZRRA 1NE4A 3TNPB 1DGRA 3ETQA 4BYYA 3EO6A 4RD7A 1WGPA 3BALA 4IEPA 2F4PA 4TLFA 4LTAA 4XFHA 3NJZA 5JSPA 1QXJA 3ES4A 3NL1A 3NKTA 3E6BA 4I02A 1OD5A 1TQ5A 3EBRA 5CU1A 4IEOA 2OA2A 1FI2A 1ZRCA 2ET7A 2K9ZA 5LRRA 1ZX5A 2XGXA 4EWAA 2PHDA 1YFYA 4X6QB 3RDIA 4HZFA 3SHRA 2H6CA 4XFFA 2BYVE 5FCCA 1NZCA 2QJVA 2VECA 5FLHA 3O14A 4IEZA 4HSLA 1CAVA 1ZZCA 1X82A 3RYPA 1Q43A 4KU8A 4HLTA 4E2SA 5FQ0B 1LB2A 2Z69A 5CVRA 3D0JA 4N9HA 2Q0AA 2D5HA 3CLPA 4FT8A
chains in the Genus database with same CATH superfamily
2HQ5A 1TNRA 2QFEA 4PZJA 3IBMA 1XCBA 2G9ZA 1EV11 4XLAA 3GZ6A 2VH9A 1POV1 4W6YA 4DFSA 3HJEA 5F6LB 4LR4A 3F8BA 1PO21 2P17A 4CCLA 2OT7A 1S5LC 1W6NB 3W6VA 4HNVA 1SG3A 3BI3A 1J1TA 1ASJ2 2CUZA 3H3UA 4CYCB 2AACA 4GMP3 4AYBA 2OIIA 2HOSA 2NYXA 4CDXB 5IAXA 4HX8A 5ERIA 4HPQA 4CTEA 1GKBA 2IGNA 5H20A 1X8MA 3POGA 3ABKH 1G9FA 5IK4A 1Q5OA 2X1EA 4WXHA 4W65A 2IS2A 3B94A 4XF0A 3NV4A 4A3ZA 3FK6A 4XDOA 5JAXA 3FJSA 2GNDA 3TQNA 1QJU1 2GA1A 2HR3A 1GV9A 4M3FA 5A33B 2EXHA 3H7JA 1DLCA 2FNAA 2YHJA 2JEMA 1D1BA 3OIOA 1WMFA 4B4CA 2BY3A 5DZGA 1R4MB 3DKQA 2VB6A 5FV3A 1VBC1 1DGWA 3K4KA 1IPJA 2FZ2A 3O8GA 1HOMA 5FLXZ 2CSGA 1B35A 3V8JA 4IEWA 1OKOA 4CDWB 5E88A 3HM5A 1RUNA 3DECA 1Z3YA 2MA3A 2R7TA 2X4HA 1XC6A 2B9SA 3TMOA 2OW4A 3LFIA 1T8IA 2QUOA 4IX7A 3K7AJ 1RHI1 3FUQA 1T38A 4MQ9F 1H8VA 3I59B 2Y0OA 3DTKA 4S04A 3VGIA 4AI9A 1BMV2 3LOCA 1HRV1 1WLTA 1S9HA 1IS4A 4FFIA 2C6YA 4MGTA 2XWBB 2W57A 5FZOA 5A7SA 1SD7A 2CQKA 1O3RA 2W52A 5LHIA 2WRAA 4EATA 1YUDA 2V9PA 5KNLA 1UY1A 3OYNA 1RI7A 4JGYA 1EA3A 1UY0A 1YFUA 1ND3A 1DF0A 2AHQA 1IPKA 3T0AA 3OR1C 4AQ6A 2CFOA 1WUVA 4RB2C 1UOJA 2K3FA 1B4AA 1MACA 3ZN5A 3OGGA 2ETHA 1MMGA 3D5RC 3K69A 3OSFA 3TEDA 2XRLA 1V00A 3BWGA 4COUA 4DNYA 4C3JJ 1RNLA 1JOJA 1BLZA 1JYWA 5FB2A 2XUEA 3U07A 3R60A 1FTZA 1W36D 3AFGA 4M3EA 4EV0A 2WO3A 1X7NA 1Y7BA 2FD5A 4DO0A 2K9LA 4BA6A 1B59A 1MZ6A 4Y20B 1O3SA 1IN4A 3CCJI 3E6DA 1Q8VA 4IZZA 2C24A 2Y31A 2LBFA 3HEIA 4M0HA 4MGRA 1LENA 2DT6A 3T2PA 1IG0A 3EETA 4AM3A 1N1TA 3UYJA 4F52A 4NPRA 4IW3A 5FTTC 4FVVA 2VVDA 3LFMA 2IT0A 2W7NA 4A5NA 4AWDA 2IXHA 5FFXA 1S4CA 4XAEA 4ZXEA 4FOVA 1BBT3 2KDOA 2QDRA 3GGLA 1JKQC 3OMYA 1S2KA 3B6AA 2B5HA 5BNOC 1X33A 3V8KA 4P9YA 3GTJJ 3C7EA 1V6NA 4EYUA 3DCFA 3KZIC 1Z1DA 3ON7A 4KMFA 3OY8B 1W6MB 2WINB 2YPJA 2RREA 1SDWA 3L2QA 3CCSI 1RUE3 3HOWJ 4EN7B 3CNAA 1RUD2 1HB4A 2D44A 2MEV2 3PUSA 3I59A 5IPAA 4CEYC 4F55A 5J1UA 3SCGA 3AL0C 4CUGA 1ZYBA 2PLV1 4LG0B 5JHFA 4D6RA 4R4XA 5F8PA 3RI9A 4QQPA 1ETVA 4OI0A 4P14A 3VBRC 1I50J 2J5PA 3DCQA 1QGPA 1SQ4A 1Z7S2 3QP5A 4Q4Y2 4RQPB 2BFUL 3MPBA 4JK1X 3IAPA 3H3ZA 4CDGA 4A3EJ 4FTHA 3QCWA 2WT0A 1FBUA 4QXCA 1UL9A 4QPIB 1KJLA 1MIJA 3IH2A 4MGYE 3H9QA 1H0MA 3VSKA 4K3UA 3SKVA 4XMAA 1WZ2A 1IRFA 3CCQI 1PVC1 5FXZA 2Z16A 1GWMA 4F3JA 4N7IA 1GYKA 1E5IA 4QB6A 3V0AB 5CG9A 1Y1WJ 3GTPJ 1WGPA 4MQVA 4TLFA 2QQUA 4LTAA 2WT2A 5J4YA 4OHXA 2GMEA 4QDQA 3CIHA 1OOPC 1K5MC 4DQAA 2CU7A 3RMXA 3I56I 4HG6B 3KYLA 2OC6A 3KX2A 3S1NJ 1R49A 3O1OA 2P1BA 4XDPA 1REPC 4HSLA 4AG4A 1H8AC 1W6OA 1FP1D 4LHKA 4II3A 2RNGA 1D5YA 2VJ5A 3I58A 5BOXA 3T8TA 5FYMA 5CA6A 3N7LA 1V70A 3AC0A 2X51A 4R79A 1IUFA 4N9IA 1AR71 5A3MA 4UBGA 1T6SA 2EFPA 4OULA 2QA4I 5GADJ 3H50A 4ZH4F 1IAWA 3MQ0A 3J7AO 2OKXA 1LKNA 2RJKA 3ZPOA 5ABJC 4EZHA 5DUVA 5AONA 3QD6A 2ZHMA 2Y30A 4QMAA 2VOKA 5BNPC 1XGNA 1BI0A 1DGWX 5BNOA 4FHTA 1LAJA 2QQKA 2CG4A 4P00B 3CMEI 3M3CA 5JR7B 3ZCOA 5D5XB 1YYVA 5FOBB 2DUPA 1XB9A 3CDHA 2BEOA 3EXUA 2XKOA 2VC1A 5KAFC 3JRHA 1YQCA 3H92A 2B63J 2E36A 1MS3A 3HJRA 3GCWA 4UV8A 1XU1A 3TP0A 1H9WA 3K4MA 4CEYA 2D3PA 2X8KA 5F3EA 4BXFA 1RRJA 4XTMA 2LP0A 4LO5B 3S6PA 2JE7A 2O8QA 3K4ZA 2E63A 5EEAA 3UKNA 4L97A 2EA4A 4MSVA 4FP2A 2VMGA 2B7EA 4CSWA 5FKLA 1D0XA 1S0DA 1BL0A 1SLCA 5FLMJ 1JZ5A 3JRAA 1W99A 3AVRA 1IW7F 1SMTA 5J1RA 4JVAA 5T5JA 3S7IA 1BJAA 4GCVA 1EV13 1UWWA 4JQTA 2HBUA 1POV3 1Z05A 2VKDA 4CP2A 2Y64A 2QQWA 5CBLA 1W6PA 1PO23 5GKAC 1QVUA 2ZGNA 5JR2A 4A3CJ 1H2NA 3AYAA 2OQGA 5FYHA 1KRIA 2WWYA 3HSFA 4JOMA 5C8WA 4CUBA 3T8RA 3BTCA 2X5IB 1VP6A 3Q0VA 3I49A 1WMXA 2ISYA 2NVUB 1TWFJ 5FK8A 4JZRA 4RN5A 1OKQA 2D7FA 2E34A 4AVTA 3ISPA 5C4JJ 3S3OA 3HHHA 2JENA 2HWC2 4QGMA 4CU7A 5CKNA 3CCRI 4ZU4A 1OOPA 1K5MA 2RDQA 3B02A 1LDDA 2HH9A 1MNDA 5FY9A 4FPOB 3ZMDA 5L73A 3PVBB 2ATFA 1I6XA 2G4IA 2O14A 2ZMNA 2IW5A 3UJQA 2DA2A 4XM3A 3VD3A 1G9AA 4FFFA 3ZLIA 2VAUA 2WYFA 1SVMA 4Q29A 1Q8OA 3KEOA 3SXWA 2JK3A 1MJBA 5A2QK 3I3EA 1S0BA 1FMD3 4Y17A 2ZXHA 3NNJA 1F9NA 1RMU2 1H2LA 2NOJB 1JYXA 3NAPB 2L9RA 1VI0A 3KZZA 4BISA 1Q8PA 3OL3A 3PSFA 5JOYA 2A75A 4Y22B 5AFBA 4FOQA 3WGHA 3VYSB 2RQPA 5ABJA 3KLSA 4BM8A 1XGSA 3HHGA 1RHI3 3NNFA 5BNPA 4NR1A 2A61A 3ML6A 3MEXA 3OWTA 2QSGX 3KV4A 4UF0A 4HSTA 1HRV3 1LEMA 4Y1YA 1YIFA 1XOYA 5TGTA 2XPWA 1TBXA 2X6OA 4A42A 3DN7A 1BOBA 1O7FA 1HW5A 4NUBA 5ERLA 2XJQA 2PJRB 2UV1A 4WXCA 2EH3A 1GSLA 1PMHX 3KT4A 1QJY2 1EP0A 2DVFA 2EXJA 4GDFA 3WDYA 1L7QA 1UZYA 2R5YA 2DMPA 3S8PA 4UB6C 4IRIA 5FY5A 4LKEA 4NHKA 4CXFA 2DMUA 4R8HA 1WW7A 3K51A 4Z1VA 5FPAA 1OYIA 2A5WA 2X53S 1BQPA 4RR3B 4I3PA 3CUQC 1RUC2 2NNYA 1PJRA 5FRMA 1F5TA 1FYLA 2IUWA 5JFRA 1GR3A 4B8EA 3G71I 3MMYB 2VW0A 3KD4A 4EROA 1I3HA 3M07A 3CUQB 1POQA 4V2VA 2PYTA 2W39A 2O8XA 1AZDA 3CDZB 2P3YA 5TSWA 2ZKNA 4BJTA 2WNUB 4FFGA 2ME6A 1RUOA 3P1IA 2VKHA 2VMHA 5D8LB 1EAH1 1VBE3 4BK5A 2IC1A 3QP6A 3VDXA 2DA4A 4WV8A 3EQEA 5ICFA 5B4NA 1H4HA 4LG3A 2ZMKA 2RE9A 4HK8A 4A2UA 3I97A 4YWAA 1P6RA 4FQGA 4DUVA 2OA4A 2WZ8A 1HQLA 4LMYA 5LA1A 4G7OF 5JVTA 2JKBA 3CCLI 1NLSA 5E18F 3JZVA 3HOTA 4IKFA 1ZZ7A 3AK0A 2DTRA 3LSIA 2XL7A 2ZO4A 4YYOA 3DTEA 3GFIA 2FNPA 1VRH3 4XZPA 4RHV2 4FQ4A 1Y39A 2WAQA 1ASJ1 4LLGF 3D5OA 3DLAA 1W8TA 1NE4A 4JRLA 4HKLA 2MH9A 3X2QH 3ETQA 4UHTA 4AVVA 5CVVA 4BE1A 4AQTA 3VZKA 2B39A 4Q4V3 2ZX3A 4EE2A 1C1LA 2V7FA 4QWNA 4Y5SA 4HZFA 3GX4X 1LEBA 4G8XA 2ZXWH 3RYPA 1ZARA 1RESA 1GZWB 2PLV3 1LB2A 2Z69A 3H3LA 2E7QA 4JKLA 3RYKA 3C7OA 4OMDA 2LW8A 2KISA 2BGCA 2E2JJ 1C3HA 3N3HA 3SEPA 2XGEA 4MZUA 2WR9A 2FCVA 2DFCA 3J7HA 3FBMA 5EGOB 5F3CA 1GMMA 4Q4X2 2FD8A 2CGNA 4YFWA 4IL7A 2VQ0A 1PGL2 1RITA 1YE9A 4LBOA 3OV8A 4XR6A 2NVTJ 1OCOH 4RLQA 1R5ID 2P5LC 4QXHA 1GOGA 2JSCA 1BMV1 4META 3CHXA 4A7YA 1T6GC 1SFPA 4ASNA 2VNGA 5DZFA 1HJFA 5M0TA 3OPWA 3CUQA 5KCMA 1XSXA 2K40A 2E5ZA 3WR0A 4E7JA 2X1CA 1TNFA 5GLTA 1F8VA 3MPPG 4QPWA 4AHYA 2HZDA 2H0VA 2DTZA 3VYRB 3WG1A 2JRTA 4XBNA 1EH6A 5DMYA 2PAMA 1IQDC 2IFRA 3HG9A 4HPKB 1UOGA 3HOSA 5F2WA 1GOFA 1US3A 2P2KA 1GQHA 4JCKA 5AFEA 5I93A 3WW1A 3WVJA 4HVRA 3LA2A 1SFEA 4PJ0C 1SFYA 1W05A 2VIXA 3JAMZ 3RZOJ 2K02A 2QQVA 1V5GA 2A6ZA 5F5QA 2OZUA 1LECA 4M0NA 1IXCA 4BJ6C 4AI8A 2A6TA 1AR73 1GP6A 3M8JA 4PBOA 3RI8A 1UAIA 1B8IB 2BOLA 1LDJA 5FD5A 3LAPA 2XLFA 3U10A 3ZXEA 2FX0A 4N0BA 3WX5A 1ACIA 3WF1A 1RUJ2 1K5JA 4NWWA 1DYKA 2K9MA 2HVQA 4JKMA 1ND2C 4AEDC 1TME3 2HWVA 5D8AB 3L00A 2R30A 4M9XA 1I6HJ 1UMZA 4DZJA 1R092 1W0OA 3HYIA 3USUB 5CPRB 1MJAA 4BXSV 1YIOA 3E6MA 4AFCA 3R61A 3S1RJ 4QU2A 1MQTC 3ACLA 4MH0E 1VIWB 4FPFA 1YRNB 5D1IA 3MIDA 2A6XA 1S2BA 2KP6A 3I4PA 4BNCA 4B1MA 1IGNA 5HCHA 4BY7J 2SBAA 3DLLF 2DCKA 3JR9A 3M3QA 3HT2A 3MUZ1 1P4WA 3P5BA 4NHXA 2O61A 2WZR2 1HCRA 1TP4A 4M3DA 1FYKA 1I1SA 1RUD1 2ESHA 5BV6A 1YTYA 2H94A 2MEV1 2QQIA 2LVSA 1JJ8C 4YARA 3KT1A 1OLME 5LEKA 2A6HF 3WLUA 3GHMA 4R52A 1F5FA 4IV1C 2XJSA 4MGQA 4Q0SA 4LLLA 1ON2A 3F0CA 3K1PA 1W6QA 5A6ZA 3OYBA 1AKHA 3GZUC 2P3KA 5JXJA 4OHYA 1CAXB 1X9TA 3K3NA 1KDKA 1NG0A 3TOJA 3JXSA 1HLVA 4PDWB 4HFSA 4FPHA 3WP4A 5C6CA 5FD6A 1Z7S1 1J3PA 1RJ8A 2BNNA 4UVCA 3BDDA 1US2A 4Q4Y1 1XNBA 1PVXA 1REEA 4AZZA 4XUNA 2R49A 1S7OA 5HI0A 1MBEA 1RUH3 3PUHA 4XABA 1BR4A 3URFA 3WNKA 4KGGA 2QSFX 3H7YA 5IHRA 2BBAA 3NW4A 1UHWA 4EJOA 4V19K 5IVCA 2BOIA 2WL1A 4P02B 4DINB 4OUMA 2VR4A 2BTVC 1JN2P 1PGSA 3TEWA 2VBBA 1XG1A 1GZ9A 3HZJA 2I07B 1KS4A 1U9NA 2P5KA 2GOMA 2GALA 3FMGA 1FT9A 2R7FA 2E2IJ 4YRVA 3D4KA 4XLCA 5SV5A 3CO6C 2WN2A 4YW3A 1AL23 1W0UA 1ND2A 3USUA 4AEDA 4ZONA 1YI9A 1SPPA 3HQRA 1I1GA 3IWFA 4CP9B 3C2HA 1X3UA 4BQ3A 2ILMA 1DIWA 1K61A 2ZGOA 5F37A 3NV2A 1YHQI 1HX6A 4P5YA 1MQTA 2AREA 3ATGA 1XCVA 1IHMA 4XAAA 5IFPA 3EHKA 2DVAA 3WY6A 2VTFA 5FPUA 3ZRGA 2EV6A 1GT0C 1W8WA 3W59A 4TV7A 2ELHA 4YG2F 1L3LA 4IGPA 3RJPA 4KQ7A 1DCSA 3VOEA 4FXKB 1GICA 4LIUA 3WODF 5J98B 4IEPA 4BQNA 5CYVA 1VQ9I 2R1BA 4IE6A 2BVVA 3NL1A 1ZBE2 3MZYA 1OD5A 4NE9A 2OA2A 3UKGA 2X09A 1ZX5A 4MXWB 2DT5A 2BYVE 3HGYA 1JTZX 5FLHA 4DEVA 2XAGA 3N97A 5F5CA 4DB5A 2PHUA 5A7PA 5F6KA 5LA9A 4IV1A 3ASNH 2RDRA 1YJ9I 2WY8Q 1WW4A 2EWNA 5FMDA 1BI3A 3WDXA 4EJRA 3CLPA 3PTYA 2GLOA 2VL4A 2YYOA 3DV8A 4KISA 3TN93 3S5AA 4IETA 3GTMJ 3ZFEC 2JDAA 1EAH3 2ZXQA 4LO4B 1EH7A 3JSPA 4WM8C 4NOTA 1CIWA 2GMMA 1H6XA 1T33A 4DY3A 1CF7B 3ZYGA 2GC3A 1XNAA 3ZO0B 2A73B 3JD72 1F1ZA 3W9AA 1MS8A 5E79C 1WPKA 4HG2A 2EFOA 3WTWC 3L2WA 1TWHJ 4UT5A 4RB1A 3DKXA 2YU3A 1YHFA 4HVQA 1K6OA 4AIJA 2DMTA 2FEZA 1ASJ3 2O1QA 4QDSA 5HS7A 1J59A 1JHFA 4PLMA 3FXJA 1KS5A 3FMSA 4C3HJ 3J8F2 2NNNA 3MFKA 3JRIA 1K79A 1FY7A 2JE8A 2QYOA 2VPRA 4WCGA 2BERA 4ZZDA 2HWC1 1I39A 2QWWA 1Y8QB 1KFUL 4OHVA 2EAAA 3NSTA 2ZJ2A 4NVPA 3WNLA 3QWLA 1UYXA 4CPBD 4L9BA 2W1OA 4P9FA 5I0UA 1VTNC 3DYOA 4AVPA 1MEC2 3FLPA 3EYIA 3WUDA 2FXAA 1PIV2 3DU5A 4GMP0 3ROUA 3N9NA 2XPJA 4OAZA 2E7WA 1FX7A 3CJIB 3P5JA 4CO8A 4D7YA 3RTRA 5HLTA 3JREA 1RMU1 2D6LX 3THPA 2YX4A 4LLFA 1MVQA 2NPIA 2AUYA 3DPUA 3BTIA 1WI3A 4OLLA 3CF2A 2ELJA 1X2NA 3QU3A 5TISC 1UU5A 3QPSA 1MH4A 5K1YA 5FZKA 1WBLA 2OD5A 4CCOA 5L3EA 4HQEA 3HTSB 4AXOA 2WS93 3WTYC 1LVKA 2B4KA 2Q1FA 3MDPA 1J83A 5EJ3A 5C4WB 4N43C 2BNMA 1TVGA 3GJAA 4KT6A 3LEKA 5IYDJ 4IJAA 2GAUA 2DU1A 3GVAA 2EAKA 5CQGA 3JRDA 3MI8A 1BK1A 1UY2A 1NTCA 3PTRB 4WWCA 2DA1A 1DQ5A 1DGWY 4RGKA 1S0JA 2ZEYA 1QJY1 4HN0A 3E0JB 5CFDB 4M6YA 4E7SA 3H36A 2DMNA 1H30A 1UIKA 1BN5A 3VN4A 2IA0A 1LESA 2HVSA 3U4XA 4Y1VA 5FDBA 1H9PA 3KQ4B 5FUPA 2KA3A 4ZU5A 4XMIA 5A80A 1LKXA 1YFWA 4DW6A 1UX6A 3HKZA 3AKSA 3K1MA 1ZG5A 1CAUA 3ZFEA 5A1AA 1CAWB 5FLJA 1S0IA 2YX7A 3V7SA 2YPDA 5IVBA 3OSDA 2BU9A 2QUFA 3E5XA 3A0KA 4WM8A 4LORA 2LYCA 2EV0A 1COV1 4UW6A 3BOWA 4DBQA 1GZCA 2ZGSA 3VZMA 4ABZA 2D6OX 4HX4A 3GF6A 3L2CA 2HQRA 2P0WA 1PP7U 4BQ4A 2P6HA 1FTTA 5FAXA 5J36A 1HRI2 2IXKA 5JIAA 2ZJQF 2WNVC 5JSRA 1EYBA 5FKBA 2XB5A 3SEZA 5FWJA 3ZQQA 1ZRIA 1VFCA 3WSOA 4XL9A 5FYVA 5B5EC 2AC1A 3OS0A 4EN8B 2E32A 2RS31 4FX4A 5F32A 3ELKA 3FZVA 2HGCA 3COAC 4XF9A 3TBDA 2DFFA 3ST7A 4L5IA 2EA7A 5EZHA 3JB8A 4DUWA 4PF1A 2FUG2 2DYCA 4N53C 3WDWA 2VE9A 4YGEA 4A6EA 3VBHB 3VBOC 3WU2C 3RI4A 3U9GA 4N8MA 4N53B 4RHV1 4C0BA 1LQ1A 5GZDA 3S17J 3POSA 4YGDA 1V6JA 2BW3A 3A02A 3Q9SA 4BKXA 1CPMA 3O1VA 3MEPA 3RKYA 3F8CA 4DZGA 2R7EB 5AC92 4D69A 3V0BB 2L7ZA 3WE3A 3BG5A 4WM7C 2K86A 3THDA 1O4ZA 2ZOEB 2GM4A 3UKTA 1SMYF 4ESJA 2JIJA 4XCAA 2JX9A 1W7PA 2MEV3 2D1HA 4I01A 1MDMB 2H8RA 4BE0A 5A3LA 2XQXA 3HDDA 3PUIA 2D3SA 3EYYA 5H9SA 4HV6A 3GBWA 5JI6A 3CCYA 1ZHFA 4N90A 1Z21A 4BQ1A 2HOTA 4IV3B 4N43A 4HXCA 1MSEC 1XNTA 4Y5TA 4LUMA 2HOAA 2DVDA 5J4VA 4LBQD 4S2FA 4RAYA 3NNGA 1O8PA 1ZA7A 3MYXA 1WLWA 1WGXA 4CU6A 4Q4Y3 3F23A 4Q4X1 2O8KA 2ZKZA 4E7IA 4D7MA 1AYM2 1MKMA 1G8WA 1PGL1 4W4ZA 4ASLA 1CAVB 4B09A 1J9IA 3DYPA 4ENKA 1URXA 5FP3A 4HYEA 4XLPF 1N3QA 2H27A 3OB8A 1UG0A 1WHUA 2NLRA 4A3KJ 4LBMA 4JC1A 2RM22 1U6GA 3NJZA 4C9YA 4PCQA 4HF1A 3VL9A 5LY1A 1PNGA 5F0CA 5BPDA 4X6QB 4AIKA 2TBVA 4CDUB 1SFOJ 3ILNA 3RZLA 1RXGA 2OS2A 4DNCA 4D6QA 4KA4A 4DXSA 1VE0A 1R1VA 2WNVA 1U8BA 3EUAA 4QB2A 1AOYA 1AXKA 2WBMA 1VQMI 3OUIA 3R0JA 2FDIA 4CA0A 2E35A 2ERFA 4YFZA 4YZ1A 2M3AA 2HXOA 5FYIA 4XLFA 5A7OA 3O2PE 3BPSA 2VZQA 5KHHA 3OD0A 3PU8A 2HTSA 1WBFA 4XFAA 3Q3SA 4ESBA 5F6FA 1CONA 4QKBA 4N53A 4LKSA 3CO7C 1AXYA 1W5TA 4MHGA 3AJZA 1G86A 3WHCA 5FQ0A 3VBOA 4XSXF 5JPMB 4L9VA 4ET7A 3LFKA 1ODNA 5F2SA 3AG2H 4FE4A 4ZYAA 4OMZA 4UFLA 2BBVA 1LCLA 2LRPA 5E1RA 3NJVA 3WDTA 3GMEA 1W5CC 3BZ6A 2F5DA 1QDCA 3HUGA 3IRQA 4WVZA 2L2OA 4TN7A 3RQ0A 5ICEA 5AVPA 5IT3A 4C2TA 4UBHA 4WM7A 3MHZA 5L19A 3LNQA 3SZGA 4L11A 1DQ0A 3BP8A 3PJRA 2XH6A 4PF5A 1J75A 1KQ8A 3M3YJ 2ZHNA 3TOBA 1HSJA 1VBB3 3H8RA 4EJWA 3NRUA 4YVWC 1YLLA 3JU9A 5FBJA 1ZN2A 3GZEA 1VBA1 3BKZA 4MFEA 3H9GA 4RB3C 3GO5A 4IQ4A 2OYZA 4K7JA 3HRUA 4A6DA 1GVJA 3HIFA 1LOBA 3IPVB 3LPGA 3FFQA 2Z42A 5DCMA 2WZR1 3OPZA 2XL9A 1OLTA 1WH7A 2P5BA 4PIYA 2GIVA 4NIHA 2C5DA 5TJJA 1ZZ6A 3ONQA 4XXAA 3N05A 3DTIA 2PMZA 4FAHA 4M6XA 5LASA 4HSJA 2VC0A 4M74A 4UOJA 2F6BA 2LS6A 1ULYA 2XGCA 2HKOA 1YITI 5FMBA 5JLVA 2X6WA 2XONA 4YNIA 4COWA 2D6MA 1F4AA 1GWKA 3TL4X 2VJ4A 4KITB 4XSZF 3LD8A 1POV0 1S6LA 2KLOA 3LWCA 4MX3A 1J3QA 1UNBA 5EHDA 2HWC3 4FPYA 4MTDA 1R22A 4H14A 4YM0A 2XWJB 3KZ4C 1X8EA 5CZKA 2UYAA 5A2QZ 3AMHA 2ZSIB 4LXLA 1FOD2 1CQ9A 3E1F1 1JUHA 4CGZA 2V4AA 2EV5A 2DCJA 2H09A 4IPAA 4U87A 1PHMA 2NN8A 5IATA 3KLOA 1RMU3 1NQJA 3TGNA 1TEIA 2DN0A 1RVF3 1MMSA 2VZSA 4UW5A 2ECBA 4R9DA 3FM3A 4NHMA 3RGBA 1V3FA 1AR82 4O3MA 4FOWA 4Q0PA 3WZ1A 3OYDA 4CCEA 3C7FA 2R0FA 5K5QA 3OYMA 3ZR8X 2R5ZA 5E8AA 4EGZA 3K4CA 3GDBA 2W91A 3RZHA 1VRBA 1DG6A 3F21A 1XE0A 4A4AA 3N7MA 3KE2A 1K42A 1MMDA 4XN0A 4MOAA 1KJRA 3BLYA 4B48A 1ZTRA 3AKRA 1X4OA 1AHDP 3ZXJA 3HRMA 2VJJA 2EINH 3WQ7A 1ZLKA 5IWFA 4DIQA 1AR62 2OTLI 2KM2A 3FXMA 1QJY3 1AHSA 1K6YA 4H7MA 3T4VA 3SCHA 2TCTA 1OF3A 4YVWA 2HQAA 3NAUA 2PFWA 3ERMA 4L0ZB 1OVPA 3LAJA 3ZN0A 3HR9A 1UZWA 5IVFA 2ZMEC 3CP2A 4PI0A 4QM8A 3AFHA 2LK2A 2BNOA 3D6EA 3OS1A 2OUHA 1PUFA 2E71A 1ZBE1 1C0WA 1XYNA 1COV3 2YR2A 2I45A 1SLLA 2UWMA 1J2XA 3M1HA 2MD5A 4IVNA 3M7AA 3CL1A 4UFHA 2VQCA 3DF8A 2DVBA 4IO9F 3K46A 3HQUA 1ST8A 1EPWA 3SQOA 3VBUB 3F72A 1UN1A 2DWRA 4UWDA 2VW1A 4A7KA 3I55I 3PNAA 2RS33 2DA3A 1HSTA 3VBSC 1PZ8A 1EUUA 1ENXA 3VL8A 4DXZA 3BPXA 3KIOA 4A5MA 5FP9A 2MFZA 3N7JA 3TEYA 2NP0A 3JD71 3VD9A 2R043 2ZEWA 3VDDB 1H1AA 3F6OA 1JKRC 3V42A 4LOCA 3WHBA 3HAGA 3Q8FA 1ZRRA 2IFWA 1P4AA 4CEWB 5HDKA 1K12A 3EO6A 3N9PA 3KETA 1DPRA 2FQ3A 5EG0A 3BALA 1ULCA 4ARYA 5D5VB 5D5WB 1WD3A 4Q1RA 2FF4A 3U37A 1W2UA 1OSGA 4LNVA 5IOZA 5FP4A 2VNVA 3JW4A 4HOBA 1ZRCA 4BWOA 3QBQA 4II2A 5D2AA 1X1AA 1YFYA 4NIAA 1F43A 2H6CA 2RR11 4RM3A 3WGIA 1NZCA 1MBHA 3O14A 4GYGA 5E1ZB 4XUPA 5C8CC 3SITA 4BBSJ 1W2OA 4NIGA 2AH2A 1MEC1 2ARBA 3KVAA 1PIV1 1D8JA 3C3WA 3EJKA 4URTA 4F83A 3JTHA 3G7DA 1W8HA 3BCWA 3I4NJ 5FZGA 1W5SA 2P6CA 2FMYA 1IJWC 3OYJA 1OYWA 1C28A 1OPMA 5GLWA 2JIGA 5BNQA 3IZOA 3V56A 2CUEA 1UAAA 1AU7A 2L7KA 1LOFC 4Q4X3 1QJEA 3VKOA 3IMMA 2B46X 5L3GA 1C1FA 2VMCA 1OMIA 2VCAA 3AL5A 5CKTA 2ESNA 1PMIA 5C5UA 2NVXJ 2VKEA 4D5CA 2K27A 5CIRA 2HJIA 2ZMEA 3QH7A 1W1WE 1ZH5A 5E20A 1YO8A 3WD5A 5BNNC 3KGLA 1R7JA 3SXYA 1IKPA 3OIPA 2V4JC 1QH7A 2M45A 4QX3A 2XDVA 1QOSA 3WINE 3K70C 4EJVA 5C3QA 1JHHA 1WJ5A 2XSDC 2M5WA 2DUQA 3GYHX 4C0HA 1JU3A 2VUMJ 3K9TA 2Q2EA 1G3YA 1YRZA 3LSHA 3MN2A 2LMDA 2DF7A 3F3XA 1VPHA 2Y9ZA 4D1QA 3FXRA 2W4SA 4Z2YA 4RGAA 3FK7A 2RS12 4QQ2A 1NA1B 5FWEA 2V1NA 3T0BA 2EIMH 4XRSA 3S57A 1YFXA 4Y5Z0 3VBSA 4MNUA 3SLIA 3BOPA 5M3FJ 4I09A 2Y6JA 5LHGA 2CFXA 2NZ9A 3PUAA 3MW3A 4BEHB 2EZKA 3QAHA 4DYQA 1NLQA 2A6VA 3KQRA 2M9HA 1IN8A 3USSA 4IHSA 4XIOA 5LW9A 2JWPA 3ZSKA 3RKXA 3LDBA 2DYSH 3CDIA 1LFPA 1HRI1 2KFDA 1MZBA 5L7OC 2HI3A 2ARXA 4F93B 5LRSA 5D8KB 1HXS3 2GIZA 4L92A 2YBKA 1KITA 1IQAA 4Y7NJ 4ZZ8A 4PK4A 3WG2A 5L3CA 1OQEA 3VYUB 2JA5J 3ZXDA 4HMZA 4Q0QA 1UOFA 3CF6E 4PSWA 1QU3A 1VAVA 5FZ0A 4GH4B 2ZMLA 1DUXC 4WK8F 1LEAA 2IRFG 4M72A 1NK3P 4L0YB 2E31A 4D7SA 4MGSA 4XYXA 1QA6A 1YLFA 4X6RB 2AXTC 5C8CA 2HLEA 3TEXA 1QGLA 1U12A 5EYRA 2DLLA 1Q3EA 2HZTA 5C3EJ 3ZYBA 3G4SI 4MXVA 3WW3A 1VR3A 4MADA 1H8TB 1VBA3 2E1OA 1WCQA 5FO9B 3K4BA 5A3NA 4YW4A 3H3VK 4DS0A 4Y24A 2F5FA 3DBLB 1A34A 1P7IA 4BUPA 4OI1A 5AC91 1P7JA 1UW8A 4XFCA 4BE2A 2BWCA 1LOFA 5FUNA 4AQSA 3D3AA 2ZXIA 4ZYHA 4KT5C 1LFUP 5JR3A 3ZOBA 2JZYA 3BROA 1DBNA 1D5VA 5GLVA 2VE1A 4BQYA 2A7AA 3KS7A 3CCVI 1ETWA 1W2TA 4MEXF 4AE2A 4QGNA 3G73A 4QQOA 5DAVA 3O7OA 4FBFA 2N7GA 5A3PA 5BNNA 2HNHA 4UI9L 5A3UA 1K3IA 3G1LA 2OQRA 1GZTA 2L01A 4M00A 3O1MA 3W5NA 3GLXA 1SCRA 2QCSB 4XIDA 1SFUA 4GD4A 1D7PM 1AYM1 2QVOA 1XSRA 4J1WA 4KIGA 1A31A 2YG0A 4M3CE 3NKGA 4A44A 3UETA 5LK7B 3CQOA 5A3TA 1M1EB 2DDUA 4E4HA 1W0TA 4V2FA 4URAA 3BR6A 2VW2A 4CP1A 1CJDA 2VCBA 2VOTA 1B9MA 2JUCA 1B9NA 4XACA 3WNOA 2RM21 2FDJA 2M2EA 1HB2A 1I1EA 3GTOJ 5CFCC 2RV8A 2BGPA 4FPKA 3ZYRA 3LCPA 3CJTB 1FOYA 3TO6A 5CJ9A 5FKNA 1RUG2 4X8PA 3LOIA 1OT5A 5B1AH 2KT0A 3OYLA 1NH3A 5L7OA 2C0ZA 2NVQJ 3PHMA 3VKMA 1NYWA 1I27A 4CCDA 2WQZC 3KYDB 3VKNA 1QMJA 1T56A 1H4GA 4HBNA 2Y33A 1LRHA 4TWTA 3VV1A 2L7FP 3OYKA 4XJ8A 2VOVA 4CP0A 2D97A 3MF6A 4SLIA 5FZHA 1V9U3 1X9PA 4XQWA 2LF8A 1JUSA 4S2GA 3VKLA 2QBYA 2OCCH 1OC1A 3RG0A 4XORA 1CZSA 2KZGA 4BE3A 4QPQA 2HWE2 1Y8RB 5EF6A 1VMJA 2EZHA 3K4NA 3AG3H 3VB9A 2L9VA 1WLDA 4LT5A 4KH9A 4NQWB 2WQ4A 4Z2AA 4PDKA 5C4XJ 2FMLA 1BR1A 3F95A 3WTSC 5H9PA 4OIQF 2A69F 2UY9A 1FPN2 3R0RA 1DYOA 4CH7A 1WWXA 3HOYJ 3HC7A 5LLQA 5L3DA 3RWNA 2WLPA 3QOEA 3FHNA 3I2JA 1XGOA 3H0DA 1TWCJ 4CDQB 1SAUA 1Z9CA 4NB5A 1FZPB 1AUYA 1LULA 4BS9A 3BQYA 1XGMA 5ACA3 2ET7A 2P6SA 3SQNA 1WLCA 3F2ZA 4P5HA 2R061 3ZPYA 3NMBA 2AEZA 1SBFA 4CHUA 2QJVA 2GWRA 3ALQA 1DGLA 1WCSA 3S1MJ 1ZZCA 2VQHA 1Q43A 4L9JA 3T0DA 4GO1A 5FKKA 3FHQA 3NEUA 4GALA 1V4RA 4Q27A 3ZGKA 3ME2A 2ZS6B 3BVCA 2IGOA 3NWTA 3FDYA 2VZUA 5M5XJ 2XF7A 5BUVA 4K21A 5IK8A 2ZNZA 4FTSA 5IT9K 4W8JA 4Q26A 4LKDA 5CADA 2MC4A 3SEQA 3KWVA 4FO9A 3MW2A 3ZIXA 1DDLA 2NM1A 4Z8BA 5E3OA 3DEMA 5FO5A 3ZSJA 2ADUA 3POJA 2E53A 5ANQA 2GXBA 4JX0A 2YS9A 3H1MA 1VBD2 2DYRH 2Y6FA 2R6QA 3NWSA 3MIBA 1JBCA 3VD4A 2PHXA 1QY4A 2CJJA 2EQRA 3JD73 3IH4A 2HWF2 2CSOA 2YC2A 1EJ9A 1W8UA 4UYBA 2IP2A 4HDUA 5CYYA 4BB3A 5FFOC 1OISA 3Q5FA 3KF5A 1C8NA 3KEYA 3LGRA 1JZ8A 1LHNA 1BOAA 4XC9A 4ZKTB 1FMVA 4Q4W2 5DAXA 3ZSMA 1QQP3 2ZXJA 5FLIA 5CFCA 3FXLA 1Z78A 3L9JT 2RR13 3PVEA 4LK0F 1UZVA 3P9IA 1KYWA 1QBJA 1ZBA2 2PEXA 3BJ6A 3ZYHA 1I5ZA 1Y0NA 2WN3A 4HVOA 3I3MA 2E60A 1H2KA 4BIOA 3LIHA 1BVP1 5HDGA 1FOD1 2R7WA 3G6JB 5KC6A 3AP6A 2P7VB 4B29A 2EXKA 1UOBA 4KN4X 4QPGC 2Y0SN 5BXXA 4HT1T 1LNSA 2WFF2 1L7LA 4W50A 4YW2A 5C3SA 3WG7H 1BKZA 1RUF3 2PMHA 4U0WA 3OYAA 3FN9A 2MABA 5FP7A 1AR81 3KMHA 2XAFA 5I0DA 2K85A 3K3OA 4L0PA 4FOYA 5FLVA 3ELNA 2KXLA 3HVDA 3JQXA 3FM5A 1SLIA 3MKZA 2WIIB 2OZ6A 2OPTA 1SHWB 4NN0A 4GJYA 1EKEA 3F8FA 3WNMA 1XC5A 1W3XA 1LVAA 5CVJA 3NO8A 5LBQA 1XYOA 3K10A 2QZ3A 3R05A 4AVZA 4AFBA 2KD7A 2Y48A 2OQ6A 2F17A 1JTXA 3DBHB 2XB0X 1DHKB 3M8EA 4GAZA 1YW8A 1MH3A 1JS9A 1W3VA 3J7YJ 4IE5A 1AR61 1BYHA 1EY2A 3BR1A 1Z77A 3KV9A 4Q48A 4AGGA 3IKVA 2KPMA 2Z9OA 3JRCA 5FZBA 1KFXL 2TRTA 1QZEA 4UFMA 5A32B 2QQMA 1ETQA 2WLQA 3GBFA 1MJ9A 4KN7X 3DPRC 5E1XA 3L2YA 1FNZA 1ZGAA 1RGSA 5DPNA 5JOXA 3K4LA 4XHXA 2HVRA 4LMFA 3LOBA 3FZ3A 2F4MB 2VN2A 1MZEA 4K8FA 1ALYA 1ULOA 2Q8EA 3PJYA 2Q8OA 3S3MA 2EICA 2EIDA 4C2MJ 3CDLA 1X2MA 4LUKA 1HRI3 2X85A 2Q8CA 2H8WA 1FNYA 2XVGA 3WF0A 4QHBA 4QT6A 5FUIA 5LA0A 3GXUA 2P8TA 1FBQA 1PK6C 1DP0A 3EPZA 1O3QA 4GZ9A 1U5ZA 4EVIA 3VSLA 1GWLA 1WCDJ 3NNMA 5DN2A 2ZBKA 4KIFA 4TLGA 4EM2A 4JDMA 5FZ7A 1S0GA 2ZBJA 2VMFA 1UCRA 3TWIA 3FHZA 4J25A 3U1DA 1Y9MA 1TLHB 5DYMA 4AC0A 2ES3A 1ZVFA 3VBFB 1YG2A 2VZ1A 2RS53 3IRRA 5HBAA 2UURA 5C3OA 2GU9A 3R4DB 1BZWA 1W06A 4QKFA 4QPGA 2XQRA 1OD3A 4NMIA 1ACCA 2CUJA 3GXOA 4Z2WA 2RAEA 4OHZA 4XHBA 3E97A 3RNSA 1HB3A 5H9QA 2Q5TA 4O61A 4D0QA 3DXJF 4CDXC 2LUWA 5GTHC 3OEBA 3SH4A 1D8KA 1QXPA 1U5TB 3T4HB 1ENHA 4PT6A 3N4MA 1OFSA 5FFZA 3AKZA 2DODA 4JGZB 4B43A 2BE5F 4G6TB 4MIMA 4XURA 2CS3A 2MLGA 2VT3A 1B09A 1FV3A 1W03A 3OBTA 2RMU2 3IAM2 5J6XA 3WTXC 3HPHA 4HONA 3I54A 1DP3A 2DA6A 1PYVA 1LODA 1E3HA 3IKTA 1HBXG 2W1WA 3B73A 2JDMA 2NMNA 1QJFA 1AYM3 2PQQA 3KB5A 1QF3A 2HPIA 4OWRB 4PHZA 4CDWC 2QQNA 4XKCA 2OF7A 3DPRA 2IA1A 3BUCA 3MLLA 3ZN6A 3FFZA 3I3BA 3LFUA 1WD4A 4P9LA 3L7WA 4OIPF 1OHFA 1IRZA 5IFTA 2E1CA 1TTYA 4EWAA 3RWKX 2I5UA 3I71A 3RIRA 3WHTA 4UY8I 1H9GA 4MYEA 3TEZA 2CUFA 4N4OB 3WP3A 5HOOA 3S5QA 4E8CA 1RUE2 2LKXA 5CVRA 2L9SA 2R7DA 4HDVA 5I8TA 2ZC2A 2R92J 2W2IA 3DPLC 1JW6A 3TDZC 5L36A 2J1RA 4E7HA 5DUKA 2IBDA 2RS11 1IXSB 1R1A3 2CTVA 2PHTA 4TSVA 1DZQA 1PK6A 1VALA 5LZ6A 3ZQGA 1ZZBA 4ZTFA 3ABUA 1ZG1A 2QKDA 5FY4A 4BPZA 2UXXA 3UK9A 3FXOA 1YO5C 1WJFA 2IXJA 3GF2A 2RGVA 1V54H 5EFUA 2FSWA 4L18B 4X8NA 5E3LA 5JI7A 1NE6A 1RPWA 1NY72 1NCQB 2BY0A 2YB7A 3GFJA 4CXYA 5EIYB 1F2NA 2VD7A 1RZ4A 1U9OA 5I8YA 4U7DA 1TWAJ 5JXGA 4DBRA 3O1SA 1W6NA 2IA2A 2EVXA 4ON0A 3ASOH 1T6BX 5JOZA 4CYCA 2ADDA 1JGSA 2R063 4XBQA 4JX4A 1WZXA 4CCCA 1GUUA 1LHUA 1L3JA 3VFZA 4CDXA 2B9UA 1OCZH 1XX5A 5CKQA 4AD9A 1M4WA 4ZZLA 5L3FA 2YBSA 4RS8A 2JG9B 2L9NA 3NVCA 3MICA 1NQDA 1Z3XA 4ZDPA 1JODA 1LU1A 4HL0A 3WCSA 3A1YA 5FMOL 4EN9B 1J58A 3NJXA 5JWPA 4PJYA 2GA2A 3TAYA 1GDTA 3GLLA 1QQIA 2H1LA 5KHGA 4HW0A 5A33A 2M7AA 2FZ1A 3O5SA 2D6PA 3ZP5A 1XSDA 1CJPA 1I3AA 2MC3A 1LJ7A 1NUKA 3ES1A 3QU6A 3B3QE 5EPAA 1GP4A 4GB32 5L9BA 4P9JA 2D45A 1JZ4A 1XDSA 4Q0UA 2VPVA 1WFXA 1SLBA 4AHZA 1FATA 3OGVA 2K7LA 4YPJA 1QU0A 4CDWA 1K83J 2EJRA 1W8OA 4EMSA 5DUWA 2RC4A 2ZHKA 1HDKA 1OLQA 1CVNA 1W4MA 2VUCA 2KKOA 5J40A 2Q8KA 3ZN1A 1XNCA 1ULPA 3MZHA 4QAWA 5E89A 4AI3A 3P3PA 3WEZA 4LBQB 1O57A 1UKGA 1S1AA 1XMAA 2DI3A 3EB7A 1WCMJ 3CU7A 1F9KA 1LHOA 3FC0A 4B1RA 2BXYA 1IV8A 2WZEA 2Q8DA 3I2FA 3CLOA 1D2SA 2E51A 4NRMA 4RQPC 3LKJA 5FY7A 5M5WJ 2VMEA 2IPQX 4LO7A 5D4RA 5KAIC 4K9SA 5IP9J 4BCUA 1FIPA 2FJ1A 3I2IA 1KDMA 4A3LJ 4QPIC 2AS5F 1OF4A 3DF0A 4GWMA 2MG4A 4RGSA 2BP6A 1T2XA 2W48A 4XRMA 3CEWA 1IDZA 1V55H 5FK7A 1YQ6A 1EV12 2G9FA 4G94A 4KWLA 3GCMA 1WJEA 4H4KC 1R1TA 4YSFA 3IB3A 2JDHA 1RUG1 1MS5A 4XTPA 5IK5A 2ZNYA 1BXHA 1PO22 4FETA 2LSOA 2UWBA 1V5FA 1R1UA 4GXOA 2CDOA 4WVVA 2CU5A 2XRNA 3T2OA 5FMOS 2ZZJA 3KSCA 3M3EA 4Q5OA 4Y20A 3OYWB 1JOBA 1N3PA 2CHHA 4H55A 2OU2A 2R7QA 3O0WA 4H3WA 4FCAA 2XBO2 1A8MA 1XXNA 5D6FA 2W1QA 3OJBA 4RGRA 2VMDA 2YFZA 2F4OB 5C70A 4QX0A 2HWE1 4L2NA 4OCTA 1BM9A 2PN6A 1GBGA 2CDPA 2BUKA 4ATFA 4G4FA 3I7DA 4JYKA 2L3DA 4ES8A 4LHNA 5JXHA 2VBYA 2CV6A 2JUGA 1SVLA 4YIFA 1GNZA 3WW2A 4IRHA 2A71A 1FPN1 5FJHA 4BK4A 4Y15A 1HKQA 1ZG3A 2IXSA 1OI6A 4WVMB 2GZWA 3MWMA 2ZABA 1VQ4I 4IE4A 1NK2P 3J7MA 4UVBA 3L2RA 2HDWA 5JLWA 3MBWA 4AW7A 4AGVA 4BJ5C 4EN0A 1FMD2 2OX0A 5BPIA 4XPVA 2GNBA 4I30A 2G7HA 1G9BA 2G19A 1K78B 3MD2A 3A0BC 2XF6A 4LIVA 1W9FA 3FBIB 4CE8A 4YG6A 5DDGA 2QEXI 3OY8A 1W6MA 3WHUA 2HYJA 3U4SA 1ON1A 3PURA 3S30A 1MMAA 1F36A 1C4RA 2EFNA 3TKYA 2QM3A 1FBSA 3M8LA 3RVHA 3OOPA 1UZCA 3QPTA 3WV6A 1PMJX 2W5FA 3KP2A 2C9KA 3OR2C 3R4SA 3ERED 2VE8A 3WNNA 3VD7A 1YQ5A 3J7AY 4LG0A 1A78A 2LNBA 2P7CB 1VQNI 4OFGA 2YU1A 2TNFA 5IOYA 1YC61 3VZJA 3LL7A 3MGUA 3P9KA 3ZSLA 4ARXA 1IG7A 2XB6C 2QQLA 1UPIA 1DGRN 2HWD3 4UUSB 3NWKA 1VBD1 1MMNA 3V7RA 2VC9A 3B00A 2GDFA 1PM7A 2CQ7A 2WV0A 3WU1B 3S15J 3LE0A 2HWF1 1YXWA 4RQPA 2O3FA 2G0EA 4Q2FA 2A3YA 2EXIA 5E1WA 4M9SA 2HWB3 1ZA4A 2R7ZJ 4QHZA 1BC8C 1SFXA 1OPOA 4YLZA 5KXBA 1X1PA 3TBIA 3SFZA 2WB1N 2BHYA 5HS8A 4I02A 4HLYA 1BBYA 3AM2A 4AF9A 5IVVA 1A35A 3PUFA 3MIHA 3RKWA 3CKHA 4QPIA 5LRRA 5HLHA 4C2UA 3B5LB 4E7KA 4Q4W1 1GVDA 1W8NA 2UXNA 4IEZA 4YM2A 1LE8B 3OBZA 2X5IC 3MKLA 1AF9A 1GNHA 1AX1A 2XASA 1KONA 2PHWA 2FCTA 4TXWA 3V0AA 4O9GA 1PO12 3HPNA 5JZGC 4AL9A 4FTBA 5HCFA 3OYWA 4QQHA 3UNPA 4A45A 4E4SA 1TMF1 3KP3A 4IEJA 2PHRA 5C71A 3LSDA 3PFYA 4FCYA 5JZGB 3VD5A 1AYN1 1SD5A 3Q0UA 4K6BA 2IEKA 5CAZA 2CW8A 2BOJA 4IGOA 1VBE2 2WFF1 3WTVC 4LHLA 3PJQA 4LK6A 1UF2C 3NJYA 5EWSA 4AYBN 2VULA 4NROA 4XBFA 2Y8KA 1QO0D 3EUHC 2NMOA 5LEJA 2CO5A 1QJU3 2Y38A 4PFPA 1FXZA 2E6VA 5K0UB 4WVMA 2WWJA 4XQFA 5IP6A 3OIQA 3NAPC 3RZGA 2NS7A 1I3QJ 3FMQA 2VZRA 1E5RA 5EZWA 2JPBA 4I3GA 3SDGA 2F48A 5T5PA 1VBC3 1C57A 4ANJA 2Z3YA 1VRH2 5JIUA 2STWA 2JWTA 2J1SA 1DP7P 3ASIA 3MFAA 4DMIA 5GP9A 2O5RA 1OKRA 3A7QA 4P9WA 2HOEA 4J19A 3PSIA 3ZFFB 3WT3A 3VHPA 4M6VA 1QNYA 1YIPA 4WXDA 2E19A 4Q4V2 1A6CA 3WTUC 3BG9A 3FXUA 3KGZA 1NX9A 1YEWA 5JMCA 1TQPA 3W6KB 4E9KA 3ILFA 1LOEA 4RLFA 2BXZA 3SZPA 5J3UA 3FBYA 4YVSB 2VBWA 1YW7A 3VWBA 2PLV2 2E1MB 4I2OA 3ZMSA 2M34A 4NRQA 2FBHA 2ZPXA 4OZXA 1KU2A 3QODA 4YW5A 1IN5A 3ACGA 1E17A 2QQ9A 3UV9A 1JYNA 3W21A 2CW7A 2CYYA 1X1BA 5EYXA 5A7NA 1RKWA 4XKWA 1VMHA 4DRRA 2QCOA 5K7PA 1HW1A 5A3OA 4RR3C 4E70A 4KWKA 2EALA 2VNRA 5DUXA 1BHGA 3ZMVA 2I10A 4NIDA 3DP7A 4PCRA 4CCNA 3M1CA 4YG3A 1OVSA 2BRTA 2VKVA 3BYWA 3FKJA 1R00A 1S55A 5AIQA 4Q4ZF 1Z0XA 3JRBA 3H0GJ 3O8HA 4XK4A 2ZJRF 2L4MA 5FPBA 5D5UB 3IP4B 5K9YA 4MTEA 1J3RA 2ZJPF 2WNUC 4MHUA 4DEQA 3ZFGC 1S7AA 2IZWA 4KBBA 2G9GA 2X5IA 5FZCA 1ZQ3P 1LFBA 4AFDA 1XRUA 4UW4A 1FIAA 2FBEA 3ZFGB 2OPKA 3WDUA 5JZGA 3LAGA 2VJXA 2QQBA 4C8DA 3BCAA 2VQTA 4C3IJ 4XLHA 2QNKA 4CICA 2O0YA 4WZFA 1QOTA 3VB2A 3ZQ7A 1Y0UA 3K6GA 4HETA 3WU0A 4JQRA 1FEXA 3FMRA 3O12A 5BY5A 5BMZA 2PI0A 4IOCF 5A7WB 4XETA 3EUHA 2ZX4A 4IOAF 1EH8A 3LEIA 1M06G 4IERA 1LGCA 3NAPA 3JAMK 2P34A 4QX7A 2B7YA 4U88A 2EIBA 1ZLJA 1JYVA 4Y22A 4IQPA 5K5OA 4UXNA 2YGMA 4AAPA 4IQJA 3FHIB 2WAFA 3ABTA 3MLJA 3BR3A 1UMHA 1RR7A 4O6JA 3RSNA 1YWKA 2RMU1 5I91A 1TME2 2DT7B 5T5LA 2VXJA 5LD2C 1K4TA 2E5NA 3VKFC 1QKQA 4I0AA 3DQVC 1U0JA 3I3DA 3A01B 4LBNA 5K7FA 3JTGA 4XJ9A 4XKBA 1IC8A 3M4FA 1SC7A 4CXXA 3H9AA 1HF0A 1EPZA 2KZVA 3K4DA 2MBFA 2V4VA 3AYDA 2FDHA 3J4UH 4A93J 1UY4A 5IYYA 4KNYA 4A6OA 2WWSA 2PJRA 4ZDLA 4R1HA 4L5JA 2VVFA 1B72B 4WVWA 1IGOA 1B1BA 1E3OC 3AZVA 4BQ5A 2Z5WA 2WSVA 4JRAA 1GLNA 3BB6A 4BMBA 5IVEA 1TL8A 2CV2A 1OA3A 4RR3A 1SVOA 4KYWA 5KC5A 4I0BA 1RUE1 5K5RA 3I64A 4CUCA 2XJRA 2VXZA 3MIFA 1PVC3 5JMOA 4IXAA 5FKMA 3H1CA 1LR5A 3MO4A 4HA8A 4RYDA 2A5YB 5LB6A 4LK7A 2RVCA 1O3TA 1QPMA 3X29B 5GPCA 4D6SA 1U5YA 5KVRA 3K2OA 2WNUA 2ADEA 2P37A 2P5VA 3ZFGA 2VODA 3WTZA 2VY0A 4L99A 4JHZA 2M0MA 4BQQA 1UHSA 4E8DA 5FZ6A 2I8DA 3DXUA 3H9JA 4AIHA 2HWE3 4JDNA 3TOAA 3H35A 5KHJA 3IAS2 1NY71 1NCRC 3B9CA 1A6IA 2A6WA 2GXGA 1FOXA 3RPUA 4ATEA 5HLIA 5HNHA 1RUH2 1N3OA 1NCRB 5KXEA 5B3SH 4YIRX 3EBRA 2JG8C 3WE2A 1S0CA 4J01A 2K9ZA 1PZ7A 3SHRA 4QD2A 1AR92 4XFFA 2HEYF 1BR2A 2AEYA 2JG8B 2ZJCA 3C2BA 5FZAA 1JYCA 2SLIA 5D8AC 1MPXA 1C8M2 4FT8A 4OZOA 2ZEZA 3OY9A 2KR2A 3QYEA 3RRDA 2V9VA 2HYXA 1D2QA 4PGHA 4C91A 4AYUA 2R1DA 4XJAA 1U5XA 4FPJA 1LGNA 3IAQA 1V5EA 1MW7A 4F92B 2DFIA 1QJX2 4HN1A 2KDZA 3A01A 1W7PD 4KMQA 4FI9A 2L02A 3SHFA 3CLQA 4XBLA 1AL22 4LD5A 1GZWA 2BPA2 2CH0A 5EYYA 1G6NA 1CN1A 1P2FA 1MS9A 4ZU7A 4HOOA 1ODMA 2KJBA 1FX5A 4BXXJ 3WCRA 2Q30A 1VB4A 4GB31 3HN3A 3F8MA 4WBBA 5DAPA 5T54A 2XR4A 4ZXKA 2P3JA 5CEHA 4A3BJ 4XCBA 3ZSEA 4M01A 1QHHD 2PXJA 1X1CA 4KMUX 2HWF3 5EGOA 2DK5A 3G3ZA 2JA7J 1B35B 3T1MA 1R1ZA 5LBBA 5F7UA 1YX5A 1BEV2 1RETA 2DFEA 3BPZA 4XRFA 1UFMA 1FWZA 4QX8A 3AYEA 3U75A 2HYKA 2ZCWA 2DXIA 3HOVJ 5K7HA 2UUZA 4Q4W3 2YUSA 3RJ2X 5LK5A 1A04A 3MCZA 5EV7A 4Y4RA 1DDNA 4PJJA 2KIMA 5HPOA 4XF4A 1JUPA 3OSGA 3IUOA 1JTYA 2AYHA 4CCKA 2W87A 4XILA 2UYBA 4PDWC 3V64A 3O0VA 3HL2A 4INDA 3ZOIA 2WO7A 3IIAA 5FZOB 3M9AA 3J81Z 4BL0B 5GZGA 2IS1A 4GKYA 4UVAA 5J8FA 5JDBA 4PI2A 1TMF3 1ENSA 1TNTA 4JGYB 2PAKA 4LA2A 1R6RA 1UIJA 3KP7A 2JB4A 3RZZA 4HPKA 3N35A 1FSHA 3UJOA 2CWEA 1AYN3 5GLUA 5J37A 3TN92 4F8AA 4AAXA 1EAH2 3UL2A 3LSJA 1N77A 1R082 3H42B 1VMFA 4BZ4A 2EPFA 3ABMH 2XJUA 3BC8A 3BZKA 1FLIA 3TW6A 2JDKA 1Q1VA 1NCRA 4KUMA 1J7KA 2PAEA 1W39A 2W95A 3TYJA 5C33A 3C7HA 4COZA 2YC4A 2XJTA 2XKPA 1UXZA 4A3DJ 1BA5A 4GGGA 1W9SA 4K8RB 3ZKYA 1JZ6A 1B8IA 4W6XA 2JG8A 3KYCB 3M3IA 3ZQHA 2V09A 3LEMA 3O0XA 4NRPA 2VG9A 5B66C 3GTGJ 1ZKGA 3QYBA 4LE3A 1XMXA 4GWJA 3U1KA 2XBO1 1D0GA 3VDBA 3N9OA 2IVIB 5E8IA 3AMNA 4BDYA 4ZHNA 1FOWA 1HC8A 2ZX0A 2LBFB 2E9QA 2ZZQA 2ELKA 5D8AA 4FP3A 2HXIA 1K4SA 2YV8A 1NZIA 2C6SA 2X29A 3VZLA 1WQ2A 4HANA 4M3CF 2CQXA 2DJNA 3I5UA 2CQQA 2DFBA 2MD0A 4D94A 2M8EA 1DQ1A 3KCCA 4XFIA 4CYDA 2M4KA 5FY1A 2MNGA 4AEKA 1YRNA 1H0BA 4WX9A 3B9IA 4QM9A 2AR6A 1P8JA 2VU9A 3U11A 1FMD1 5J96B 1ETYA 3GZNB 2E7TA 2GNTA 4ISRA 4XOTA 5FZ9A 1YNAA 4IHTA 2XV4S 2UWCA 4CU9A 1MSFC 3T3YA 4IEUA 4FPCA 3M1EA 1W2NA 5JSOA 3CC7I 1CX4A 3HBZA 1FSEA 3RQIA 3SCFA 4PJMA 3W3CA 1JKPC 2JDNA 1VQOI 3PMEA 3JRGA 4D0PA 1OA4A 5LBCA 2WS92 2YUEA 1O6UA 3JBG2 5HS9A 3BTXA 3S3NA 5FPZA 1PUEE 2K5CA 4ZYDA 1WW5A 2QDNA 4H7LA 2OCEA 4EJUA 2K4JA 5GAGJ 3H1WA 4Q1PA 3AP9A 5ISLA 4LITA 4IEXA 2NVYJ 5KWRA 4ORFA 1MNMC 1TWGJ 2ZB9A 2WC2A 1W2AX 1CAXA 2XAUA 2X05A 2DCTA 5FZIA 2IS6A 3UNGC 3BGAA 4PDWA 3NNLA 4XVHA 3IIIA 2Y0MA 1O4TA 4QX1A 3J80K 4G3YC 2R4GA 9ANTA 5K8SA 2WNEA 4AQ2A 1RIOH 5CB7A 3EYPA 1USSA 4V1PA 3ZM8A 2Z5UA 4DOZA 2JA6J 3PUBA 5ED4A 2O8OA 3IH3A 2R93J 3MVPA 1WRJA 2XSJC 3BTLA 4B4PA 3QACA 3DU6A 2XPVA 1R64A 3RCOA 2A1XA 3ZR6A 2J1TA 3DYMA 2FHRA 1ENQA 4N7UA 3KP5A 3CCEI 3RZDJ 1PO11 3B69A 1DQ2A 1LOCA 4E27A 4RGXA 2W0XA 4TZDA 3LF7A 1Q56A 3SISA 2Y6HA 2L5QA 4JBAA 5F39A 2WAEA 3G6EI 1IG3A 3PO3J 4R9CA 2ICWG 1PX4A 4DYRA 1O5LA 2ZGPA 2WAQN 4P55A 4L5EA 3UT0A 4OIRF 2XAJA 1KQ0A 1VBE1 5FYUA 3KP4A 1J1LA 4IHYA 2RMU3 1XD7A 3ZMUA 4LJHA 2BY2A 3ZXGA 2QSHX 3JB4C 3CJIC 1N1SA 1W6OB 3AZZA 5F5AA 1MS4A 4RAFA 2F5CA 2IAIA 2LY2A 4BYYA 4CP9A 2WDBA 1DPUA 1TZOA 1N75A 1S0EA 2M1BA 4D5FA 4JAAA 1Y4WA 5A70A 5CU1A 4QTRA 1VRH1 1RUI2 1FI2A 5J1YA 1NT0A 2VGDA 1HV0A 4KG0A 1Q1HA 1WJDA 2ZGTA 5J09A 4HF2A 3MUY1 5IW0A 3PNVA 2LC2A 4X6AJ 5BQTA 4XMYA 1ENRA 4BQ2A 2VUJA 5C4WC 5BNOB 1YI2I 4Q4V1 4KIBA 4CXWA 3CQZJ 2BVMA 1PX3A 3HOZJ 5K7ZA 5J7MA 4EEFG 4MXWA 3WNXA 5EZGA 1KU7A 4DY5A 1SDDB 5CFDC 4YFNF 4CEYB 3GTQJ 4C1XA 1RL3A 1NG6A 4U36A 3AL0B 4IUGA 5BNGA 3TO9A 4HNTA 2JDYA 3MV01 2UWAA 3CTAA 3HN1A 1A36A 2PG4A 4P1WA 2VMIA 4F91B 1DU0A 4RAGA 3S16J 3VBRB 2J5OA 1CESA 1J0RA 2WT1A 1JYTA 1CF7A 4BQWA 1WVRA 4FTEA 1RUC1 4A41A 1OH3A 3T08A 4LBLA 2FDKA 2HYGD 3FHAA 4JQFA 1W6PB 4RBOA 2A3SA 1D4VB 1HQNA 4OOIA 1IO2A 1DZRA 2ARCA 2EILH 2HQNA 1Z0HA 4DXRA 1U5IA 5DM7F 5A1LA 4UFKA 5F0FA 2RDNA 1MZ5A 5CVUA 4XRSG 2B9VA 1NXMA 5T50A 4QLCU 5K4LA 1D0YA 1XMKA 3P3NA 4RGUA 2HU9A 4K1ZA 1F15A 1L7RA 1OOPB 1K5MB 3VBHC 1N47A 1WJBA 2XXZA 2LD5A 4LBJA 2VL8A 1GXPA 2DPUA 1JE8A 5HXMA 3HT1A 1Y1VJ 3BTAA 1XE8A 1GV5A 2RN7A 3CJIA 2JDUA 5J8CA 2WJSA 4GB33 5A3WA 3UGFA 4Y52J 4B1LA 2D40A 1H1IA 2VUAA 3LZZA 4YG0A 2EIEA 1JKOC 3SZTA 3LQCA 5DXDA 4FASD 2KJCA 2BQPA 5FGMA 4QKDA 4AVBA 2QTWB 4HKWA 2CQNA 3QH6A 4CRQA 2XG3A 2Z4FA 1QXRA 3SFIA 4YW7A 1OQYA 1RUD3 5ABJB 2DMQA 1TME1 3PFIA 4Q47A 2W46A 2OTJI 5C4WA 4IV3C 5BNPB 3VZNA 2J42A 4FISA 1H9TA 3N9QA 3BTJA 2GN7A 3OGRA 5J3LA 2R16A 3SDBA 4UF0B 3AP5A 3OOUA 5CNAA 3A03A 2W24A 2BFUS 1PDNC 1W0NA 1LHVA 5E6HA 1QWRA 1QOOA 4FE7A 5C44J 3LIGA 2WAAA 2RNJA 4KL1A 4OIOF 4I99C 4S05A 1VBB2 2JJ6A 1E0EA 5EP9A 3A23A 3OGSA 3HNBM 1Z7S3 4I6ZA 5CFDA 1W28A 1X3WB 2D5FA 3U1XA 2FE3A 5DABA 5DUUA 4G7ZF 1XS9A 2IGMA 1BI1A 3C3VA 2N8GA 4GA9A 4U7BA 1XJAA 2PTMA 4OI2A 2R5YB 3VBRA 2BV6A 1WWYA 4NAMA 4UB8C 3W2AA 2YY1A 4D8MA 1CAWA 2CAVA 2VZPA 3W20A 1IUYA 2E7AA 3UGHA 1ITYA 4G12A 2CW0F 4OMYA 3DXTA 3HSEA 5C9AC 2MGQA 1X36A 4V2WA 1FYUA 1MR5A 4CDUC 4AHWA 2M0CA 5C3RA 4AVAA 2JXAA 5T55A 3HXLA 1H6YA 3LSPA 4L8QA 3L9FA 1IPSA 5C9AB 1KA8A 3CJNA 3ZXAC 1HB1A 2XBO3 3GCXA 2JVHA 2UU8A 4HAMA 2OUJA 2O6GE 4OYUA 1VQ6I 3MW4A 4QQLA 4QX2A 5A1FA 2AQEA 2HBTA 3ZDVA 4Q5SF 1Z7UA 3HTUA 4BACA 2JA8J 1W36C 1RUH1 2X1DA 3A0HC 1AX0A 2DCEA 3R4UA 2WO1A 1QNWA 4Q8KA 3VBHA 1CIYA 2EIGA 3ZVXA 3FXKA 2ID3A 1VQLI 1AR91 4AU7A 2R7SA 1IS3A 4IHWA 3WQBA 1UU6A 5FPXA 3VODA 4CCMA 1STZA 4KFCA 4UUTA 1VQ5I 4AEMA 1RVF2 1C8M1 1VF9A 2PELA 2GOXB 5FJ8J 1RUJ1 2EIKH 4B4QA 5CLSA 3V0BA 4HKOA 4OAYA 2ZGLA 3HBLA 5KXDA 2BZTA 2X48A 3LDKA 3O1TA 1VLNA 3T5XA 1DZTA 1QJX1 3Q8EA 4IHVA 2KIUA 1MDMA 1R091 5FXXA 2DVGA 3PNYA 2W94A 5JI9A 5JUVA 1AL21 1O5UA 3FUOA 2DOEA 1W8ZA 1HDDC 2ETEA 3U21A 4UAPA 5FJKA 5HV0A 1JXNA 4XF3A 4HRIA 4XFGA 2K9NA 4IV3A 2VNOA 3QLQA 1GANA 3NQOA 1IS6A 2W68A 1UYZA 2CRGA 4RD7A 4M3GA 4ETSA 2F4PA 2BVLA 5JSPA 2VOPA 1QXJA 3KPHA 1BK0A 4KWUA 3OYFA 3K70D 1UO9A 3POFA 3E6BA 1UQXA 1SCSA 3QYFA 3AX4A 4DUXA 1BEV1 2Y34A 4Y33A 4QSHA 4IEOA 2BW8A 3VDAA 2CV1A 4P9UA 2COMA 5FCCA 2DA7A 2K3PA 1VQ7I 2VECA 3D8CA 1CAVA 3BIWE 3BPVA 4XXPA 1A8DA 3PIJA 2W84A 4XDQA 4IRGA 2LY9A 5E3NA 3RZJA 1DGRM 4Y4YA 1BI2A 4N9HA 2R072 2VCMA 3G1MA 4IHXA 3AJYA 3S0MA 1YQAA 1QNTA 1COV2 4EGYA 3BG7A 5FBZA 3K2ZA 1RKTA 3DKWA 1PO13 5HXVA 3HSRA 3LSGA 3ZYIB 5C9AA 4CDUA 1IDYA 5GM0A 3IWZA 4ZYEA 3JUUA 3S2DJ 1JJ6C 1SEFA 2ZA9A 1G4DA 2A3XA 3M7GA 3TN91 4JKKA 2JDZA 3PL8A 2NYYA 2RS32 1R081 5HVQC 3OCPA 4NWVA 2YROA 4NHYA 4ENJA 1OBNA 1ZRDA 3T30A 3POIA 1KU3A 2LTNA 5DZEA 4PBPA 2R042 1OR7C 2QKLB 3UR3C 2JA2A 1ULFA 2ME0A 4F7ZA 1JUMA 4D3WA 3LQRA 3BQZA 1G3WA 1T0FC 4ITCA 1MD0A 3ENRA 4AFAA 3I53A 4RFRB 1XPWA 4QPYA 3E1SA 2CWMA 5EJCA 3AFKA 2QGUA 2QZ8A 4X0GA 1QZYA 2MH2A 1HN1A 4WF2A 4JTOA 2ZGUA 4GWIA 5IYBJ 5FYYA 5IYCJ 3HQXA 1D4M2 4QKNA 5FZFA 2Y9YA 3VDCA 2GN3A 1F5JA 2WQ8A 3A4UA 1JT0A 1XSVA 3PIGA 1RYYA 4XOGA 3AP7A 3CBNA 1BW6A 2HEOA 4IE0A 2JDPA 4HSRA 3SC7X 2IVJA 4XLEA 3TB0A 2YBPA 2XJVA 2OAZA 4R9AA 2V5DA 2P4EA 1X58A 2RDPA 1SAXA 2DW4A 4EWEA 2W00A 3H5NA 3J9SA 3RZKA 3S1QJ 2ZGMA 1OUXA 1FMWA 2JKXA 3IDEA 3IM0A 3H5RA 4RAZA 3IPVA 1MGTA 1Y9QA 2CY6A 1UY3A 2O9LA 3RFRA 3B7MA 4BDVB 1NKGA 4HNUA 2CL2A 3L09A 2VQUA 2PN5A 3QPLA 4QGLA 4YZ5A 3CMMA 2WABA 5T3NA 2WS91 5GZEA 5GALA 1RUC3 1Z6TA 2GQQA 3JBG1 5I0RA 4PUSA 1G59A 2YDEA 4U2AA 3HKZN 3GTKJ 3HPGA 1WCKA 2WO2A 4QX5A 3VBUC 1R23A 1OQDA 1W6QB 1H88C 2WA0A 3OYHA 1MBGA 1AKHB 3O1UA 3OG2A 1ZELA 3OUJA 2DJIA 4TTGA 4KU7A 5D4SA 3IL2A 4HBLA 1TNSA 2J1VA 3ETPA 4P9GA 4M4PA 3VDDC 5L9RA 2LTPA 3ZQCA 2VVEA 2LF7A 2EZLA 3E5QA 4K40A 4JHTA 1SFNA 2K4BA 2QQJA 3AG1H 4CEWC 2E26A 2PMUA 4JDOA 5F1RA 3GZAA 3PMSA 3A0NA 2RHPA 2PHLA 3T2TA 5F04A 3D0SA 3ACHA 2ET1A 2MSYA 1UKRA 4RHV3 1YFHA 4XNFA 1OR7A 3IKWA 4UW3A 4BLIA 2Z79A 1R36A 2YU2A 1GNYA 3J8F1 3ZQLA 3WF4A 1OLMA 2BDRA 3N7KA 3C2UA 4Q8LA 1T0FA 2DUOA 1HXS2 5EXOA 3PIOF 1W8FA 3UKVA 1FP2A 2EB7A 2JE9A 3AB0A 1QHDA 4Y26A 1PP8F 4JP0A 5KHDA 3H8UA 2DBNA 2ECCA 4S0HB 5D21A 1XYPA 1DLLA 1RTVA 4A7ZA 2J7MA 1ND2B 4AEDB 3PIPF 2IVMA 1REFA 1SPPB 1TG7A 2HDDA 2ZTNA 2NAZA 4YFKF 1JZ7A 3OOXA 4XQ4A 5F1JA 4E6KG 3KV6A 1LDKB 1RUI1 4XOPA 4I76A 4R4ZA 1Y56A 1QIQA 1O91A 2DV9A 3LSTA 2NXNB 1MQTB 4U0VA 1VBA2 2ZHLA 1Z67A 2JECA 1W90A 1XNDA 1QHGA 4Y1UA 5IY5H 1V0AA 3BR2A 5ILUA 4UNOA 2RV9A 3OEAA 3GWZA 3O6BB 4LB5A 2GSYA 5L9VA 2VTXJ 4RSUA 4C30A 1QDOA 4OINF 3D82A 4D9JA 3KCYA 1CD3G 3W6JB 5F5IA 5DUIA 3N36A 1VAMA 4GULA 4S2HA 5LBEA 5IUQA 2IJLA 5GLZA 4U0YA 1OFNA 1NG7A 1L0OC 1JZ2A 3HRSA 2W1SA 3U2RA 5EQUA 4ZY9A 5A7QA 1J09A 3BZCA 4IV1B 3Q9OA 2A05A 3A2KA 2QKMB 3TNPB 1NA1C 4B44A 1MNEA 2JJ7A 5EJ1B 3VBUA 4A3IJ 1GP5A 4B3XA 1P9QC 2W47A 3INAA 1G9DA 4NHJA 1HQWA 3VYTB 2B42B 2ZFUA 4LLNA 4ZJZA 1BVVA 4ZTJA 5J1XA 3BOQA 2VT2A 2OVUA 2IS4A 4XW3A 2IGKA 1UXXX 3HRTA 4ENMA 2WA4A 2NS8A 1SLTA 3RDIA 2VOXA 3AZYA 3CMGA 2V73A 2JRMA 3VDDA 3WDVA 5C3PA 5CQEA 3POEA 4GKXA 1S8NA 2JT1A 1AXZA 4KU8A 5IVYA 4CEWA 1AR93 2STTA 1DQUA 5EJZB 3GFLA 2Q0AA 4MEYF 2X9DA 2MYSA 3ZKUA 5JOWA 3VZOA 4HEA2 3FLTA 2BHZA 3FWEA 1IZ1A 1N25A 5FYSA 4QU1A 5IT6A 1C8M3 1ORKA 4IXLA 1RUJ3 4A3JJ 5EEHA 2F5EA 2M30A 4GH4C 4Z07A 2FMDA 2L4AA 1ZM1A 3I2KA 5FMCA 2CNAA 5A6XA 4L9TA 1LPQA 1WA4A 2MLKA 1UYYA 3WQ0A 1E2XA 2RJLA 2UZKA 1QVTA 1QJX3 4C1WA 1R093 1F35A 2KIQA 3U0ZA 2V9KA 4NC7A 4M4RA 1V9U2 1APLC 4FXGB 2Q1MA 5E8GA 1H8TC 1XPXA 3BR5A 2W3JA 4LHSA 1HA8A 1REDA 2A5ZA 5DD4A 3LA7A 5FRNA 2RVAA 2OJED 2J22A 4UXAA 2PFBA 2WFPA 3CJXA 3E3VA 4BHBA 4A0ZA 4LO6B 4DGWB 2Q4SA 3TNQA 2ZKLA 3IDAA 1XSQA 1WMEA 3KT7A 1BEV3 4BLJA 1R71A 4LOSA 4WZCA 4YELA 1OA2A 2PHFA 2LKPA 3BU7A 4MO7A 2WZR3 3AYCA 1YJWI 1Z7LA 4K2EA 3C18A 1IOAA 2DCZA 1WW6A 1OPCA 4BIFA 2F5VA 3V65A 3CJQB 1JI8A 5ACA2 4IF4A 2A70A 4JTNA 2R7XA 2A68F 4BXUA 1JHNA 2JSPA 1RINA 2Y75A 5KBFA 2HFHA 2WKKA 3CMAI 5FIXA 4MLOA 1RJ7A 1Q8SA 2PMZN 2L7MP 5ILSA 3FF5A 5ILVA 3KHBA 5DAWA 1VBB1 3PVOA 3UGGA 2A3WA 2DDBA 5B2GB 2YSRA 4UV9A 4I7HA 5FOJB 2G9WA 1HIXA 2R7OA 1JHJA 4PQQA 3O1RA 3THTA 1QH6A 4G9SB 3MKWB 1KXGA 1NA1A 3P9CA 1JH5A 1E3PA 2HEVF 1TQMA 1R083 5DG2A 1BJZA 2ZACA 2ZX1A 3OBAA 2L54A 1ZZ8A 2E33A 1CAUB 3ZFEB 2KRFA 4YRDA 3FXQA 1ONVA 2ZEXA 4NIIA 5G04L 1STMA 5GTIC 1BCXA 1ZGJA 4BEHA 4NPMA 5FRAA 1VNDA 4WM8B 3R6SA 4GRIA 3CZ6A 4LULA 1DYPA 1GUIA 1RXFA 5FY8A 2TUNA 4GXLA 1JOPA 5M5YJ 2VZ3A 5M3MJ 2JVGA 4XUTA 3ZDSA 1U78A 2P6TA 1APNA 3KVBA 1IZ3A 2MW8A 3DFGA 3OYCA 2ZGQA 5DM6F 2D1VA 3A21A 2VXDA 5FYZA 2ZFWA 2XJPA 1QQP2 5FZ4A 3LSMA 3OPTA 3V8LA 1RC9A 1W0PA 1BW5A 3F8NA 2RR12 1KYZA 3ZXKA 4GH4A 2M87A 1O4XA 3MZ8A 4FQZA 1X3ZB 5EDNA 4CU8A 1J84A 3AMPA 4O7XA 5HLGA 4LKFA 3LMMA 2WA3A 4AI2A 1IRXA 3QOPA 2ISZA 3T1BA 4XN3A 3HMYA 2PX9A 2Y2ZA 1WSUA 2DOFA 4A0YA 4BMEA 1KD7A 1ETKA 2W85A 3GBGA 3SEEA 2XAQA 5DS9A 1D1CA 2F6CA 1H8TA 2XOMA 1YIJI 4KGQA 4AK3A 3K77A 4CDQC 2CV0A 1RVF1 3HD8B 4GIQA 1LGBA 2BW3B 1RUF2 3DEEA 1NXD1 3WXPA 3J7NA 3DPTA 4F3QA 2VASA 3CD6I 3ZQIA 4OVEA 3J7ZI 3JBG3 4FPEA 1W7PB 1GV2A 1ZBE3 4GFBA 4O9EA 3GFMA 1OUSA 3NQHA 2GP5A 3SNMA 2BZDA 1G3SA 3J80Z 1H89C 4BQOA 4HV5A 5FZEA 1O7LA 3VLBB 4N43B 3PLQA 4ZZ5A 1GFF2 3DUIA 4BDZA 1Y43B 1O59A 3T2QA 2JICA 5BYNA 5DG1A 1ONAA 4I0WB 2VUDA 3CUOA 3NV3A 1Z91A 2VI6A 2LR8A 2DBIA 5ICGA 3MIGA 4OHWA 2AO9A 1OLRA 4B47A 3QPHA 4BY1J 4RA0A 5FZDA 5F3IA 4OUSA 2R071 5DDJ2 3TDUC 3I8TA 2Q1ZB 3BU0A 3APBA 3ZX7A 2K46A 2W92A 2BJSA 2V5YA 4QWQA 2JD4A 2I74A 4YZ3A 3HOXJ 2NQYA 2WV1A 3QQAA 5IP7J 1FC3A 1VJ2A 3J8F3 4AFMA 3SH3A 3L2HA 1JT6A 1FJLA 2AZ5A 5DTDA 2XHKA 2L9LA 3IN9A 4ISQA 2AXLA 1V6IA 3AXDA 2WNVB 2PBIA 3VHNA 2JD9A 3G1OA 1KU9A 1E57A 3L1PA 4OQ9A 5FXVA 2P3IA 4Y1ZA 4A6SA 1MEC3 5FYBA 3H8OA 2R7UA 1PIV3 3DBRB 1IN6A 2PQ8A 2R041 2D6NA 4JX6A 1XN7A 2PHDA 1TC3C 3WG9A 2M7BA 1CQTA 1VQPI 3OBRA 4NQWA 2Y0IA 3HBKA 2RS52 1XQNA 1RUI3 4V2GA 1F4KA 5FQ0B 5H6QA 1S3JA 4RM2A 2DU0A 3VBOB 2KL4A 2D5HA 3BJAA 4ZYGA 4GJZA 2VQGA 4CDQA 1IV6A 2K0GA 5FZLA 3V4GA 4PLOA