2Z2SB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
182
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRDPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
molecule keywords RpoE, ECF SigE
total genus 40
structure length 182
sequence length 193
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z2sB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z2sB02
3HT2A 2Q30A 4EWDA 4OFGA 3NSTA 4N9HA 3SMHA 5I8YA 4OLLA 2UY9A 3ES1A 2D93A 3HT1A 4F8AA 4UXAA 1XRUA 1NYWA 4EWEA 2QVSB 5FLJA 4MGZE 4IEPA 4YSFA 4KU7A 4X6QB 5BXXA 1Y3TA 4KWKA 3DN7A 3OCPA 5FQ0A 3RYKA 5FLIA 1EPZA 2WC2A 4XFCA 2EAAA 2GC1A 4HVQA 5C8WA 3DL3A 3BPZA 3KCCA 4AVCA 5I93A 2KXLA 3LAGA 3S7IA 3EO6A 1EY2A 2OA2A 1J3QA 2OZJA 5I0TA 4MUVA 4F7ZA 4ZU5A 4BIFA 1GQGA 1XE8A 2PYTA 4E2QA 4A2UA 3IDCB 4KWJA 3LZZA 5KHHA 3U10A 2ET7A 2DCTA 2IXKA 2PA7A 5KHIA 2CGPA 3FZ3A 1SFNA 2CAVA 3ELNA 1YFUA 1ZZ8A 4IEOA 1LB2A 2GU9A 1YFWA 1H1IA 2PHLA 4XFIA 2BGCA 4Q29A 4FT8A 4KWLA 4XF0A 2D40A 3I7DA 4AQ6A 1ZZ9A 3NW4A 3OD0A 4JTOA 2E9QA 5JAXA 3UKNA 2VECA 1Q43A 4HVRA 1YUDA 2B9UA 3FJSA 4IEXA 1FXZA 5I0RA 2D5HA 5EFUA 2H0VA 4E2SA 4Q0VA 5I8SA 4Z82A 3M3IA 1L3JA 1CAWB 2Z2SB 3KGZA 1Y9QA 3H7YA 1I6XA 4IESA 4Z07A 3LOIA 3H1MA 3PVBB 5FLHA 3NJZA 2QNKA 3DKWA 4IEQA 1O7FA 4FAGA 4DINB 5FPZA 1CAVB 1OMIA 2HKXA 4Q0UA 4Q0QA 4BHPA 4LULA 5LEKA 3I54A 4I02A 4YYOA 3ES4A 3EQEA 1LR5A 3E6DA 3H1YA 4RD7A 4QMAA 5FQ0B 3RPQA 2N7GA 1O5LA 3LA2A 5K8SA 1EP0A 5KBFA 3SCGA 3EHKA 1DZTA 1XE7A 1ZVFA 2FMYA 2GC0A 2PAKA 3BALA 1ZRRA 4LUMA 1CAWA 3S0MA 1UW8A 3I59B 4LEJA 1OFNA 3ZDSA 1JUHA 2Z69A 2Q1ZB 5JR7B 4XFBA 2K0GA 2BEOA 2OYZA 5FCCA 1O5UA 3O14A 4HN0A 3C3VA 3IDBB 3GYDA 5LRRA 3MDPA 3QACA 3PLQA 4P9GA 3E5XA 3NL1A 2IC1A 4XETA 3JZVA 4I0BA 2FQPA 3D0JA 5LRSA 2Q0AA 3MYXA 1RUNA 4LTAA 4IETA 4BH9A 5BV6A 4AVAA 5I91A 2XGXA 4HBNA 3RZZA 4XF9A 3LWCA 3MPBA 4I09A 3BCWA 2XL9A 2K9ZA 4I3PA 1V70A 3HQXA 3CEWA 1G6NA 4PJYA 1UIKA 3U11A 1J1LA 3H1WA 1ZZBA 2BYVE 2D5FA 3OTFA 5LEJA 1FI2A 5FPXA 5T3NA 4QX5A 4LUKA 2UYAA 3QOPA 3UKTA 4J1XA 3FX3A 3H9AA 2XLGA 3USSA 3VHRA 3CL1A 3H7JA 4NVPA 2ZCWA 5C6CA 1NZCA 2Q4SA 5E1RA 1OI6A 4XF3A 1ZZ6A 3KSCA 3H3UA 1VJ2A 1RL3A 4QXKA 4I2OA 1QXJA 2H6BA 4N9IA 2XLAA 5CADA 5KHKA 3BB6A 2BNNA 3LA7A 1CAXB 4PIZA 3H3ZA 4QM8A 1CX4A 1NE6A 3HIFA 5F1RA 2I45A 3RNSA 3IIAA 2XKPA 2C0ZA 4YRDA 2IXIA 2ETEA 1SQ4A 3OF1A 3MZHA 5J7MA 3WW2A 4BYYA 1GQHA 5E16A 4HZFA 2XKOA 3SCHA 1Q5OA 5J48A 3OGJA 3HUGB 5I0SA 1UD1A 3TNPB 5AVPA 5KHGA 1O3QA 1YWKA 4QGMA 1O3TA 3DV8A 4HSLA 5CU1A 4MGKE 4XF4A 1ZRCA 1VR3A 3H8UA 2BNOA 4WVZA 4XEZA 4FAHA 4MV2A 1O4TA 3R6SA 2CAUA 3E97A 4X6RB 4LLOA 4GULA 1VP6A 4O9EA 3IBMA 2V09A 4IEWA 3LA3A 4IEZA 1CAUB 4PIXA 4MGIE 2IXLA 1PM7A 2PAEA 3D0SA 1OD5A 2OZ6A 2QCSB 3BU7A 1IPJA 3SCFA 2VPVA 4D7SA 1TQ5A 5JSRA 1X82A 5JSPA 5JSOA 2XHKA 3I59A 3RDIA 2CV6A 3WW4A 4MZUA 3ACLA 2GC3A 5BY5A 1RUOA 5CVRA 3KMHA 1NE4A 1WLTA 4H7LA 1RC6A 4R52A 2GC2A 3EBRA 3EJKA 2F4PA 2MPFA 3S7EA 4D7TA 4CYDA 3WW3A 1YFYA 2PAMA 5BPXA 4EWAA 3U0ZA 4AQ2A 4B29A 4IEYA 1CGPA 1DZRA 3B02A 1EYBA 1U12A 1HW5A 4UBHA 1RGSA 2O8QA 3ROUA 1UCXA 4K8FA 4WBBA 1UPIA 4LA2A 3SXWA 4QGNA 4UBGA 2H6CA 5I8TA 4KL1A 1ZNPA 1PMIA 1IPKA 3TNQA 1YLLA 2EA7A 3H50A 1QXRA 4IEVA 5D1IA 3RYRA 2PTMA 4MX3A 4FBFA 3UKVA 3KGLA 4EROA 2PFWA 5JCTA 2PHDA 2O1QA 1X7NA 1J3PA 4I0AA 4PIYA 3M70A 1QWRA 3IWZA 4HLTA 1DGRA 3PNAA 1ZRDA 4QM9A 3FFQA 2IXHA 2ET1A 4AVBA 3ETQA 2GH2A 1WA4A 4IEUA 1O3RA 2HJIA 3G7DA 2QDRA 2ZKLA 1X8MA 3CLPA 1FT9A 2BNMA 2PQQA 3FWEA 4WZCA 1O3SA 2GAUA 4XF1A 1I5ZA 1J58A 1ZZ7A 4Q0SA 1NXMA 4JVAA 5KHJA 3E6CC 3D82A 2MHFA 2WFPA 1LKNA 2XLFA 3RYPA 5HI0A 1X8EA 2VQAA 2Y0OA 4XFAA 1Q3EA 1CAVA 4LA3A 4E2GA 3WW1A 4HSJA 4HVOA 1UIJA 4J1WA 4Q0PA 1CAUA 1DGWA 5J3UA 3NKTA 4EV0A 4L11A 3E5QA 1J3RA 2B5HA 1CAXA 2IXJA 4MGYE 3FE5A 3GBFA 4XFHA 5BUVA 4ORFA 4YARA 1ZX5A 5I0UA 4XFGA 1ZREA 2UY8A 3NVCA 2OPKA 1H1MA 4I01A 5FDBA 3CJXA 3ST7A 1ZZCA 3CF6E 4TLFA 1YFXA 4JV4A 4YNIA 3L2HA 4KU8A 4O9GA 1J59A 3N4MA 1WGPA 3E5UA 4IERA 4ZU4A 1ZRFA 2B8MA 2ATFA 3SHRA 4META 3E6BA 2XL7A 1QY4A 4QGLA 4XFFA 2GZWA 5EZWA 4L2NA 2QJVA 2MNGA 4HN1A 3FHIB 2IXCA 3CO2A 4AXOA 4ZU7A 2P17A 1YHFA 2UYBA 4MH0E 1RTVA 2EVXA 1LRHA 1SEFA 4JTNA 4NQWB 4HMZA 4ONUA 4R8HA
chains in the Genus database with same CATH superfamily
1B09A 2E63A 3ZYIB 2AS5F 1YO8A 2OQGA 1KD7A 3IH3A 3HPNA 2XBO3 5KXDA 5LHGA 2JA7J 2UY9A 2Y9YA 4C2TA 1H88C 1P7JA 1MEC1 3WG4A 2A6VA 2VPLA 4KWKA 3WNLA 3RYKA 1W1WE 2YGLA 2JECA 2KLOA 1IG7A 2EZKA 1DYOA 3KZZA 2C9AA 3HD8B 4YW3A 3RRDA 4WF2A 4TWTA 2P7CB 1ND3B 1C8M2 4QPIA 4KUMA 4Y1UA 1BBT2 3DEMA 3TN92 2LKPA 5FD5A 1ASJ2 3ECOA 2D45A 2V4VA 3IMNA 5K7PA 2IXKA 1UZYA 4IXLA 3WTUC 1OLMA 4L92A 3FXKA 3OYJA 5GAHJ 2GU9A 5DQ0A 1GR3A 3ERMA 2BGCA 2JJ6A 2ZGUA 4KWLA 1YYNA 3MGUA 2D40A 4IE5A 4KGQA 1ZZ9A 2E9QA 1OKRA 2VZPA 2UUZA 4HV5A 2A6HF 2VC1A 2W2IA 3EPZA 3WV6A 1NX9A 3S15J 5EQUA 1Y9QA 1W6OB 4X6AJ 3J7ZI 2LALA 5F04A 2XQRA 1BA5A 2VTFA 2Y0MA 2VQ0A 4MGSA 4HEA2 1KA8A 3WG3A 5F3CA 3NAUA 1MNDA 5BNOC 4B8EA 2MH2A 2RJLA 4EJWA 3KF5A 2JSCA 5E20A 2R1DA 3BROA 4FPLA 1NXD1 2P81A 2W0XA 3T09A 1OH3A 5KBFA 1WJFA 3WGHA 1XMKA 1A04A 3PO3J 3CD6I 5GLUA 3QD6A 2Q8EA 3ZMDA 5IFPA 1TME1 3Q3SA 3ZDSA 2XQXA 2VONA 5F2SA 1BOBA 3RZKA 5FRNA 1D7PM 3PLQA 4F92B 2CQ7A 2EV0A 2MW8A 2RMU2 4OHVA 5A3MA 2VZ1A 1SLBA 5LRSA 3I8TA 3KT4A 5EZGA 2WR9A 1USSA 3VHOA 4BHCA 5CG9A 3TB0A 1DQ4A 2K9ZA 5L3DA 1G6NA 1NKGA 3U11A 1S2BA 5DDJ1 2JIGA 2RDPA 2M7AA 3PL8A 1Y7BA 3OGRA 4QX5A 1NUKA 4E7JA 2XSDC 1RNLA 4WXHA 3USSA 1SMYF 5BNQA 3I3DA 1U9OA 2E71A 2ID3A 2DWRA 3Q8CA 1ZZ6A 2E1NA 4OUEA 3L2WA 4R9CA 1WKYA 1P4XA 5FKLA 4YG3A 5IP7J 1FOWA 5F8PA 3ONQA 1NA1C 2GWRA 1CX4A 3VDDA 1OISA 1M06G 2K5CA 3QPSA 2NS7A 2XUMA 3TN93 2EINH 2RREA 1RZ4A 2IBDA 1FTTA 3WXPA 3T4HB 4ZC3A 1B9MA 1QJY2 1UYPA 4PDKA 1UD1A 5AIPA 5AVPA 3WOGA 3L2UA 5KHGA 1S9HA 4EJUA 4BQWA 4QGMA 1BJZA 3K46A 5E3NA 3S5AA 3GGLA 5IJRA 4FOQA 3H8XA 2D6NA 1W6MB 4WVZA 2ISYA 3SKVA 3CQZJ 2YC4A 2CWMA 4AI1A 4CDUC 2QDNA 4P9JA 1CZTA 2M9HA 1V0AA 4XUNA 1OURA 2EFNA 2AHQA 5K0UC 4CPBA 3BG3A 2VNOA 1KU7A 4K3UA 4QPGB 3TOBA 3WG9A 5J96B 1UOGA 4KIGA 2H0BA 5FAXA 5CVIA 2ZZQA 2QQBA 1JODA 2L4MA 3WP3A 3O2PE 2F4IA 2VTXA 5BPXA 5F6FA 1WW5A 5TGTA 1MMAA 5C70A 3POFA 4QQOA 1N1VA 5BNOA 1XGNA 4AAXA 3KD4A 2WO1A 4PI2A 3AXEA 4X1EA 2E7XA 2O8QA 3WY6A 2F5EA 3WTSC 3UESA 3CLOA 3ZYHA 4GO1A 4PGGA 1X1CA 1W36C 1QPMA 1UG0A 1OPMA 5FYUA 1HW2A 1FEXA 1RHI1 4CEYA 1GXQA 1QXRA 4PFPA 3FFZA 4IEVA 5D8AC 1OA2A 4FO9A 3FBYA 1WD4A 3MW2A 1UZZA 1ZG5A 1HV1A 4DGWB 1PJRA 5JI6A 5JCTA 1AJOA 2QSHX 1Y39A 1OF3A 1WGXA 2VJ4A 1ACIA 1CQ9A 3OOUA 4BQYA 3H3LA 1S1AA 2ZSHB 4S2DA 3VBRB 3E6MA 1UOFA 5FYMA 2ZKLA 2BVMA 4NHYA 3S93A 2R7TA 3HSEA 3NARA 1UCRA 1ZZ7A 5ABJA 1SVOA 1UXZA 2V6CA 2XASA 5FFOC 2PEXA 2VJ5A 1JYNA 4XFAA 2DYSH 4EJRA 1XGSA 1ON2A 3G1OA 4EGZA 1UMIA 4XMIA 2JPCA 4IQJA 2X1DA 2L54A 2J1UA 2HKOA 1FOD3 4P1WA 1FV3A 4OMZA 4BBRJ 3JREA 2HWE3 4MHGA 2XAJA 1RVF1 3FE5A 1G3WA 4GALA 2HVQA 4XFGA 2Q2EA 2PMHA 1REPC 2JZYA 4XLCA 1AHSA 4LBQB 1K5MC 1S55A 4Q4X3 5JHUA 4BK5A 1VB4A 4QKBA 2ZMKA 4NIHA 1VIWB 5GKAC 2GZWA 3I9V2 4G7HF 1EH7A 2Q8CA 2STTA 2VXJA 5BNNC 3VL9A 4A3LJ 2AXLA 3CCRI 2E7TA 3IT8A 5M0TA 4ZTJA 1HC8A 1SACA 5EYRA 4FXKB 4CDUB 3FUOA 1P6RA 4IXAA 2P37A 1MACA 2ZPXA 4MHRA 5DUIA 1MR5A 5FPAA 4BLIA 2QQVA 3GTLJ 4UXAA 1DGLA 4EWEA 4MGZE 3K10A 1MZEA 4QLCU 1A6CA 2XJTA 4XUTA 3HG9A 1ZBE3 4QU1A 3KM5A 4DZPA 1RVF3 1JZ8A 3B7MA 2NS0A 2P8TA 1MVEA 1EKEA 1WH5A 1YRZA 5FYBA 3KS7A 4S05A 4Y5SA 2D5VA 5FV3A 3WODF 3GXUA 4XMAA 4AIDA 3ABZA 2VBYA 3NV4A 3DF0A 4TLGA 2BW8A 1FP1D 4JZRA 1LVAA 5B3SH 5C4WC 5H20A 4HPKA 5FZ1A 5C9AB 1YQ6A 1YUDA 5AFEA 2X09A 1S7OA 1DDLA 1PYVA 1X9PA 4LG0B 5DAQA 3J7AO 1CIYA 4BISA 5BS6A 4YZ4A 2DOEA 4EYUA 4LKDA 1EH6A 5JLXA 3LGRA 3WQ7A 1VQ4I 1LTEA 2WSUA 4GMP3 3CF5F 3VBFC 5FPZA 2BHZA 1KFXL 3GZAA 4HQEA 4IV3B 1SD4A 2R4GA 2R7VA 3OSDA 3PUSA 4OHYA 1JGGA 3QAHA 3ZMOA 2GSYA 1U5TB 3BZ6A 1ERDA 3DXTA 1O5LA 3I97A 4PF1A 4RFRB 4FSJA 1ZVFA 3A02A 1QDOA 1QJZA 1HN1A 4NHMA 2G19A 2GOXB 1R1VA 2Z5UA 5E3LA 3RVHA 2QQJA 3EYIA 2W52A 5DDJ3 4LB5A 3M1HA 1B8IA 4XDPA 4LTAA 1ZBA2 1W2UA 3G1MA 2VMHA 3HGGA 1VRH1 1GU3A 4C2UA 3ABLH 4D5FA 2NQYA 1UX7A 3DBHB 4BXUA 1BXHA 4CVUA 4HV6A 3ZFEC 4BXFA 3WDTA 5FOBB 3RJRA 4FISA 3H9AA 1YTYA 2JDPA 3ACFA 3K77A 4ES8A 3KYCB 4DUWA 5E88A 3BI3A 4S2GA 4C0BA 1V6LA 3W2VA 2H6BA 3CJTB 4NNJA 3NAPA 1NK3P 3BJOA 2MD0A 2WNUA 3HIFA 3P5BA 2GP5A 4WM7C 3DKYA 2ZMLA 1C1FA 5F3EA 1TQPA 3AL0B 2D98A 3QYEA 2VJIA 4B4QA 1IXCA 2WZ8A 3KE2A 3G4SI 4TYSA 3BR0A 1DYKA 5E89A 3VBUA 1QOSA 2BP6A 1SPPB 3GCMA 3H8UA 4XIDA 4PUSA 2UWMA 1VLNA 2QQMA 3MIHA 3D5SC 2IS2A 3BT9A 4HQMA 2EIDA 3JB8A 5DN2A 2WIIB 4FE4A 4V2GA 5EGOB 2XHKA 1SLTA 1C8M1 3JCUC 3WW4A 2LD5A 2HBUA 1X3WB 5FZ3A 5FMBA 1ZN2A 4H7LA 4Q5OA 4D1QA 2Y69H 3R4SA 1LEDA 2MSYA 4Y7NJ 1TP4A 1GOFA 4Q4V1 4IEYA 3U75A 2IVIB 4Q4V2 1QNTA 2CFOA 4N90A 5JZGB 2QQWA 1SD5A 1LU2A 2WKKA 5F37A 4RM2A 4UXNA 2Y64A 4FFIA 3N9QA 2NLRA 3SXWA 1W5SA 2QKMB 1XYNA 2H6CA 1IPKA 1U5ZA 2EXHA 3PVOA 1POV1 2ENRA 2RS13 4WVWA 2J1EA 1MMDA 1NT0A 1VRH2 2O5RA 3MLLA 4QHBA 3AYCA 1JUSA 4BU2A 2NMOA 2WB1N 3A01A 3AKTA 3K2ZA 3DWLE 1X7NA 3IKVA 4P5HA 5CIRA 1L7LA 4EATA 2VW0A 3M8EA 4O61A 2M87A 1LKXA 4QB1A 3K51A 1D4VB 2IGMA 5CYYA 3A22A 1PX4A 2WBMA 3L9JT 3KV5A 2E2JJ 3U2RA 3MEPA 4XMYA 4IV3C 2GAUA 3IDEA 3NV3A 2FDGA 4XF1A 1WA6X 3PJQA 1J58A 1OSGA 2E7AA 4W97A 4E8DA 4FFHA 1LFUP 1WBFA 1PVC1 2XJPA 3W59A 5FO9B 2V4AA 1W04A 3KT7A 4IHYA 3ZXJA 4Q0PA 2HYGD 5BYNA 2WQ4A 1CAUA 3KB5A 4ZY9A 1GYKA 2VBBA 4QXHA 2E7QA 3ESWB 2F5VA 2XWJB 1QU0A 4D6QA 2A3SA 1RI7A 2YFZA 4GDFA 4KDPA 1IC8A 3ZR6A 3D6EA 2I5UA 1CPMA 2OPKA 1RITA 3OY8A 3AZZA 3CF6E 4AOCA 4AZZA 3MUY1 1POV3 3FMGA 5F5CA 3ASOH 2K4BA 1ZG1A 5JOXA 5E1WA 2F6CA 3O7OA 3P3NA 4BE1A 3WF0A 1VQMI 1RUF2 1QY4A 5EEGA 4QGLA 3R4UA 1JKOC 5JDBA 1X3ZB 2G9ZA 2XR4A 4WVVA 2MABA 2JUGA 3HOZJ 3DUIA 3T08A 3MZYA 4IVNA 3JBG1 3QH7A 1RUI1 2VOOA 2DUOA 4K1YA 1VBA1 2HWD3 3EYYA 2B7YA 2B45X 2QBYA 5FB2A 3I71A 4DXTA 4B7EA 3AAFA 1W9YA 3DKXA 3SYTA 1E57A 5AONA 2COBA 2A05A 3VD3A 4OLLA 2KKOA 3ZCOA 1EV11 2OW4A 3MV11 3S30A 2JA2A 4M3EA 1X1PA 3DN7A 3KCYA 4BDZA 3LKJA 4Y20B 2GC1A 4OINF 2QENA 1O8PA 3TEDA 3C7GA 5HCAA 5L73A 2AGSA 2X1CA 1IGOA 1VZ0A 1VBE3 2A6YA 4U7DA 2RS53 3V0AA 1ODDA 3J4UH 2DA6A 1G3TA 4HNVA 2CTVA 2KL4A 1UU5A 3OOPA 1YJKA 4RB2C 2WYFA 2OPWA 3LSPA 4DJAA 4XDOA 2Y34A 4AFMA 3RZGA 1W0PA 5ERIA 3I3LA 2EALA 3AZYA 1GHCA 5J47A 5K5RA 1WLWA 2WUHA 5ICGA 1DLLA 4L99A 2YX4A 2CS3A 5IP6A 4E7LA 3I2KA 2VZRA 3K70D 3AKQA 3OIPA 2WNOA 3F8BA 1W8UA 4Z07A 5FYCA 3PVBB 2ZXHA 3FKIJ 2W94A 1W9FA 2JVHA 5A3OA 3ZFFB 1MZBA 4XRMA 3ILFA 3K1NA 3JU9A 2DA5A 2JG8C 4ABZA 3DXJF 3H1YA 1SVMA 1WW6A 1BJAA 2V1XA 1HRI3 2JVGA 3ZXEA 4P9LA 1U78A 2ZGOA 2WO7A 1XE7A 2HEVF 4LBLA 1S0GA 2OF7A 2YBSA 2C24A 2PN5A 4URTA 1J83A 3HOVJ 1Y0NA 2YB7A 4M3BA 5FY8A 4WV8A 4XQ4A 2ZFUA 4ENKA 1BIAA 5JXJA 3MLKA 3RI8A 2VUMJ 3T2TA 2NMNA 1K79A 2LRPA 4BJ0A 1RIOH 5H9QA 4I0BA 1YHQI 3SITA 1ZQ3P 2R7ZJ 4UFMA 2JG9A 5BV6A 3O6BB 5E8GA 5FKCA 3LE0A 2M30A 1VAKA 1PO12 3MPBA 2DMNA 4KMUX 2ZEYA 1QZEA 3J7HA 1G9AA 2FQ4A 1FI2A 3SZTA 3DCFA 3ELKA 2CWEA 1IS6A 5FY7A 2RC4A 1N1TA 2X6OA 2WRAA 2HVRA 2PX9A 1XD7A 4AR2A 3Q8AA 1CAXB 1EUUA 2Y6KA 4JRAA 4Z2AA 3RNSA 2RNJA 1U5TA 4A3ZA 2GMPA 4UYBA 1CQTA 3CO6C 3VDXA 3CZ6A 1VB2A 2IW5A 1WZXA 1Q8OA 2RV8A 3JD73 1YIFA 5FGMA 4ESBA 3TP3A 3HVDA 5DAVA 3ZYBA 1HRV2 1ZH5A 2BOLA 4HYEA 3FF5A 4W1UA 1BBYA 1O4TA 1G8WA 3FDYA 1EUTA 3U1XA 2TEPA 3BTJA 3OIOA 4AVPA 3IKTA 4D9JA 1DFQA 3HNMA 1PM7A 1RUH2 4M6VA 5F64A 4CDXA 1T38A 1IPJA 2EFQA 2BDRA 3K4CA 5HVQC 2BHYA 4GYGA 4JK1X 1MS8A 4R52A 5HS7A 4BS9A 4RMNA 5GPCA 5LA9A 1YI9A 2TBVA 3S7EA 1UZVA 1FAYA 2G9FA 4QU2A 4GXOA 5DD4A 3ALQA 5LHHA 1TEIA 5H9PA 4EWAA 4MHUA 2UWCA 3ZXFA 1CGPA 1F15A 3IWFA 2DURA 3I3EA 4QXBA 3K4MA 1U12A 5A3PA 1UCXA 1J75A 5BNNA 1UXXX 1KEXA 4M00A 3FC0A 2LNBA 2RM22 1STZA 4A6OA 5FBZA 2Y0SN 4UW4A 2CUJA 1MH3A 3AK0A 3S2WA 2FQ3A 1RUE3 1YS6A 5C7GA 1RR7A 1VF9A 4CU6A 1R71A 2WAQN 4NR1A 4AL9A 2DVDA 2VCMA 3C7EA 1HXDA 4KBBA 3JAMK 3PNAA 3KYLA 1GXPA 2VJJA 1RJ8A 2LUWA 2VBXA 2Y48A 5TJJA 2VB6A 3N9LA 1X8MA 2E35A 1E5SA 4OAYA 4FFFA 2FJ1A 4D6RA 2XLFA 4DQAA 1R081 3WP4A 1GV2A 2VMGA 5ERLA 2QCOA 1SHWB 4E2GA 1R082 2YY1A 3NRVA 4XLEA 4K6BA 3LSRA 2OCEA 2J1VA 4UUSA 2KIFA 1ODMA 1R4MB 2YV8A 4J6GA 3OYDA 1WCDJ 3S3MA 2HQRA 1UNBA 1CAXA 5H6QA 3C8XA 5GTHC 4XORA 5I0UA 3MKLA 2GNBA 4A7KA 2UY8A 3V8LA 4KFCA 1XMAA 3Q0WA 2Q8DA 1WQ2A 3Q5FA 1G4DA 2W1WA 2WL1A 5JFRA 3SNMA 4Y15A 4CCOA 3HHGA 2RVAA 4CDWB 5L7OA 5LBBA 1GLHA 2GNTA 3G3ZA 5LFAA 5EIYB 1VQ8I 1XSDA 4UUTA 1W9WA 3I2HA 2DTRA 2R7FA 5ICCA 4Q26A 4GQ7A 1GP4A 5EXOA 4XN3A 2QJVA 1O4YA 2A5YB 1JKQC 3LF7A 1JJ8C 2X29A 3TOJA 4ZZDA 1EV13 3FM3A 5JXHA 9ANTA 1XU1A 1M4WA 2IWGB 4QPIB 1LDJA 2L9NA 2OXBA 4DOZA 2HYFA 4FASD 4Q4X1 3IB3A 3P6BA 5ANQA 1J1TA 1XNBA 4Q4X2 2WDBA 1C3HA 1DQ2A 3GTKJ 1WMEA 1XRUA 2QVSB 4OIOF 5FRAA 3HMYA 3M4OJ 2WA3A 3N7LA 1SFOJ 2JPBA 3ETPA 4YPJA 1Q1HA 3DL3A 5ABJC 1UYZA 3C3WA 1AL0G 2HYJA 1N47A 2AYHA 4KWUA 3U1DA 4RAFA 4F7ZA 3L00A 1LOCA 4HOBA 2DQLA 1UU6A 3QOEA 5EP9A 3GTPJ 2G9GA 3K4DA 1PGW2 3X29B 4DEVA 1RUI2 2NP0A 4AE2A 4CCKA 2HTJA 4C3JJ 2DBNA 4Q29A 3M8LA 1H9GA 5LATA 4XVHA 1UAAA 2QSGX 3TBDA 3W6JB 2R30A 2YS9A 1I27A 2M4GA 5I0RA 2D5HA 1L7QA 3BTLA 4MTEA 3OR1C 2PLYA 4CU8A 3NNGA 1AXKA 1CAWB 3S1RJ 2EIJH 5FP8A 1HKSA 2NVTJ 1IHMA 2NYXA 4CUCA 1SFXA 5LY1A 1BVP1 3O1SA 1WMFA 4LHNA 4KISA 1V9U3 3ES4A 4XCBA 3CUQA 4DOUA 4RYDA 1O4XA 3DLAA 4NQWA 2JDYA 1IOAA 1OYYA 5FK7A 4NRQA 4RS5C 5CFCA 4HG2A 5ICFA 2R32A 4MGTA 4XLPF 1S0BA 2JWPA 3RWKX 1MEC3 4PI0A 3I59B 5EZHA 3A03A 4ZZLA 5A6QA 1OQYA 4CXXA 3GNEA 1MNEA 4R79A 4P9GA 1E5IA 5F32A 1VQPI 2DA4A 3DPTA 1ETWA 1TBXA 4N4NB 1ALYA 1C8NA 3D0JA 5IYBJ 3WHTA 1D0ZA 4XR6A 1R36A 1E3OC 5CBLA 2XPJA 1EV12 1P4WA 2YU9J 2A5WA 5E1ZB 4B8XA 4RS5B 3RTRA 4CDGA 1C57A 1J1LA 1ULDA 4QKFA 2O61A 4YFKF 2VMFA 2I2SA 1ETXA 1REDA 4LUKA 1YEWA 2XLGA 3USUA 5JWPA 4XTPA 3THPA 2M2EA 4G8XA 1JW6A 1ZHFA 3KSCA 5IVYA 4Q1PA 5L3BA 5K5OA 5JIAA 2VBPA 2JQ7A 2XLAA 2YPDA 2VQUA 2BZTA 2CV2A 4HONA 3LFMA 3DPRB 4XJ9A 4NOTA 3MZHA 3APBA 4KH9A 4HLXA 5HXMA 3J8F3 3LAPA 4IHWA 2EH3A 1GZ9A 3I0TA 3R4DB 4CEWC 1NLSA 3H0DA 5JVTA 3FLPA 2KDZA 5CKTA 1TNRA 2EILH 5CEHA 4YIIA 2YHJA 2I07B 3FZVA 5GP9A 4N7UA 4XF4A 1ZRCA 1QZZA 1VFCA 2BNOA 1IAWA 2X51A 3Q9SA 2J1AA 3VYTB 4FOWA 2LY9A 4OIRF 2JKXA 4OHWA 5DM7F 1MQTB 4A69C 2OAZA 3VDDB 4YW7A 2KM2A 2A7AA 2Y6LA 5L3CA 1H0BA 5LK7B 3GMEA 3NAPC 3WZ1A 1W3XA 2KFDA 1LDDA 4W6XA 2PLV2 2QCSB 1H4HA 3CMEI 3VN4A 2V9KA 3U1KA 4BMEA 1JZ5A 2D3PA 3GZEA 2F4OB 5KR7A 2VUCA 4D7TA 2IT0A 2OA4A 3WW3A 4B1RA 1YFYA 2K85A 4NRPA 4JGYC 2R7SA 2LF8A 4UFHA 1ZM1A 2QKLB 5FFXA 4QQ2A 3VBRC 1SMVA 4AHYA 3V7RA 4K8FA 3GHNA 2NPIA 4LMFA 2XRNA 1ULGA 3FBIB 3IPVB 2VH9A 5HCFA 3J8F1 2GMEA 2Y6JA 2YROA 5JOYA 3T8TA 3ZQIA 1CONA 4AVSA 4M9XA 2FD8A 3BC8A 3Q0VA 1O59A 4AEMA 4UVCA 4WK8F 3TN91 1AL22 5IUQA 4C1WA 5IHRA 1QWRA 1DGRA 1BM9A 4GKYA 2DCKA 4M6YA 2GNMA 2IXSA 2BV6A 1JE8A 4DFSA 4XJWA 1WSUA 2O14A 2HWF1 2G9WA 4TSVA 3FMSA 4K8RB 1R093 3HBZA 4EM1A 4KGGA 3KLNA 1SC7A 4PFOA 1UFMA 1UB9A 5C3QA 1CAVA 2VE9A 2TUNA 4LOSA 4M4RA 3CF2A 2VZOA 2RG4A 4L0YB 3WU1B 1JI6A 4KI5M 3E5QA 4LE4A 3LCPA 1MNMC 2PJRB 2XH6A 3AYAA 4OUSA 5FDBA 4BGDA 1VBC3 2V7FA 1X50A 2JDKA 1H8VA 3MW4A 2ZMEB 3HGYA 3P7NA 3WQ1A 5ISLA 3L2HA 2R7OA 4QB6A 3FL7A 3OYBA 4P9XA 4UUSB 1XNAA 3DXUA 4Q4Y3 2KRHA 4LLLA 1LVKA 3MIDA 2ZXJA 1URXA 1PZ7A 5DCMB 4YELA 1Q8PA 1GNYA 1OLQA 2CYFA 4G6TB 1BL0A 3JSPA 5L3EA 1C1LA 2BE5F 2BBYA 4A93J 3CCJI 4EQVA 5JLWA 4DBQA 2P7VB 4JX4A 4YM0A 3T0BA 4N53A 1VBD3 3BJ6A 3BPXA 2A5ZA 1S0FA 1VQ7I 1OPOA 4G7ZF 5F0CA 2VAUA 3CQOA 4WM8C 3W21A 3J80Z 4F8AA 5KWRA 2FNAA 2R072 3WDUA 2QKDA 4YGCA 4IEPA 4YSFA 1YX5A 4HX7A 4X6QB 1D4M1 3KHBA 2LP0A 5T55A 1MS0A 1WUVA 3I2FA 1DG6A 1H2LA 2A3XA 3WCRA 3V7SA 4ATFA 1OPCA 2AACA 3S3OA 3ZFGB 4XLHA 3M7AA 2PYTA 4COVA 3ZPLA 1BR1A 2UV1A 4XLFA 2ET7A 2ZGLA 2YPRA 2K46A 2R062 5BOXA 1RXFA 5J40A 4FPHA 1UMZA 1XCBA 4XFIA 1FTZA 1RUC3 4U7BA 1XYPA 2HWB3 1FX5A 4AQ6A 2FX0A 4EEFG 4BQ2A 1C5IA 1QPIA 3GHMA 2RKHA 2PI0A 5C4XJ 2EFOA 4RS8A 2HEWF 4E2SA 1G8XA 2LW8A 1I6HJ 2X4HA 3HOYJ 2D6LX 1JYCA 1K45A 3EQLF 3T8RA 3U9GA 2XUEA 1DGRN 4L18B 3B01A 4Q2FA 1E3HA 3JBG2 3FK7A 3NJXA 2ZKZA 2R041 3I2IA 1SAUA 5J3LA 3I54A 3AP5A 3CZUA 3EXUA 2XVKA 4TN7A 1HJFA 2DVAA 4CP9A 2N7GA 1N3QA 2E1MC 4HKWA 1WJ5A 4GXLA 1FOXA 2ZHMA 3CP2A 5FZHA 1QHDA 2MBFA 2Y31A 3N9PA 1ZRRA 1FMVA 1K7AA 2YC2A 1NCQC 5JR7B 3ACHA 4XFBA 5FKMA 3CESA 1Y43B 1A31A 3PNVA 3IL2A 3IDBB 4FPKA 4M71A 4NE9A 2HEYF 4HNUA 2OBPA 3WG2A 1IXRC 1CESA 1PO21 3ZQCA 1QMJA 1K5MB 1DIWA 4BE2A 1RUC1 3MEXA 4RQPB 3F95A 4YW6A 4AVAA 5I91A 3D4KA 2RS31 2N8GA 5IK8A 1JOBA 3U37A 4I09A 4I3PA 5FYTA 4AAPA 5A6XA 1UOBA 2OC6A 2VCBA 1UIKA 2KISA 5D5XB 2BRTA 1DHKB 1Y8QB 1OLTA 3S2DJ 2IS6A 3GFLA 2B4KA 2BXZA 3AFKA 1XGMA 1T2KA 4LORA 4R4XA 1OYWA 4YGBA 3IIIA 2ZCWA 4OOIA 5FYVA 4OAZA 3UGHA 1K83J 1IV8A 3OPZA 4CDQB 4FOVA 5FYZA 4DUXA 2PG4A 1DPUA 4FPJA 2O7OA 3H5RA 1Z6TA 1PVC2 3ZXGA 1JZ4A 4MXWB 3H1CA 1FP2A 2BU9A 2XJRA 3A21A 3AYEA 1OBNA 4BYYA 5EGOA 4QQLA 2HWC3 1OCOH 3OGGA 1UX6A 1IW7F 4RHV3 1O3QA 2VUJA 4LBNA 5A7WB 2X10A 4RFT0 1QQP2 3C2GA 3LSJA 3BG9A 4DPNA 4BPZA 1QJX1 2RS32 1VP6A 2QUFA 1HDKA 1KRIA 3LA3A 2Q1FA 2W57A 1GDTA 4PK4A 5EV7A 4UFIA 2VQGA 2PAEA 5CFDC 4C3HJ 2O8OA 5EJCA 5J1RA 1O6UA 4D7SA 4XKBA 5CVVA 2AH2A 2A3YA 1HB1A 3TGNA 2WLQA 1RUOA 2GC3A 2DOFA 1Q1VA 3H36A 2GC2A 1MDMB 4NC8A 2BBVA 2H1KA 1B35A 1F5JA 4A7YA 1YQ2A 4FHTA 3BCAA 3AZVA 3JRBA 1QGLA 2DUPA 5KXEA 1FBUA 1XNKA 5F3IA 1UYYA 4Y33A 4UBGA 3QQAA 4CP0A 4R9AA 4BL0B 4M9ZA 4HK9A 3H5NA 2QZ3A 2VGDA 1NY71 4EROA 3OYWA 1J3PA 1JYIA 2B63J 4Y22B 4JGYB 1A6QA 4HLTA 1X19A 1ZBA3 3H9QA 2IGNA 3WP6A 2K9QA 3PIGA 3V65A 1MBKA 4II3A 3K70C 2HR3A 1HA8A 3ZX7A 2VT3A 4BJTA 2D1VA 3RFRA 2GQQA 1I5ZA 4JX5A 2JA8J 5AC91 5HI0A 2E51A 2ARBA 5FBJA 1K6YA 2KRCA 1U9NA 4F93B 1JTYA 5LY2A 2E6VA 4YRVA 4J1WA 3MW3A 2X5IC 3ENRA 2IP2A 4EV0A 1W8ZA 3KEQA 5CB7A 3ZQLA 1LU1A 3ZQ7A 4NO4A 4FTHA 1ENXA 4YW5A 5LA0A 4EN9B 1BJQA 5ILVA 5GM0A 3F22A 3D3AA 1JYVA 1RUF1 5EWSA 1GQPA 2OUJA 1I9RA 2JDMA 2OIIA 2VT2A 3ZYGA 2PHUA 3ZN6A 2JUCA 2VCCA 5FY1A 2FE3A 1BMV2 4RAYA 5LGTA 2K7LA 3S14J 1W4MA 2UWAA 1W0NA 2BBAA 4UY8I 4MLOA 1YJ9I 1WCSA 4COYA 1G9DA 1ZG3A 1XDUA 3IDAA 4OFGA 4I6ZA 5FZ9A 5E6HA 4XW3A 2FBEA 3KLOA 1G3SA 2FBHA 3ZLIA 2RAEA 4E7IA 1MMSA 3NJVA 1JOJA 4XK4A 3DTIA 5IYDJ 1QDCA 4OHXA 4QWQA 5A7PA 1WJEA 3ABMH 3M4FA 1MBGA 5BXXA 1Y3TA 4E7HA 1NY72 2FDFA 2EAAA 2BXYA 3IAQA 3BPZA 4UF0A 4OMCA 2KXLA 2VIXA 3NV2A 4AIHA 5FLXZ 3BP8A 1F9KA 3BKZA 4A0XA 2KR2A 4E2QA 4BB3A 2DCTA 2PA7A 5KHIA 2WYSA 5CFDB 2R7XA 2DAOA 4AHZA 4ZS3A 2ICWG 4LPLA 3HM5A 4Q47A 3KYDB 3LIGA 2HWVA 2J5PA 3I7DA 1SFYA 3V7CA 3HN3A 3VBRA 4GH4A 2D6KA 3UT0A 2SLIA 2NVQJ 3FJSA 2YXSA 2BFUL 2R5YB 4TV7A 3GEZA 4Z82A 4XUOA 1USTA 5HDGA 2VVEA 4IESA 3GF2A 1W3VA 5LGUA 2GIZA 4J01A 1HXS1 1RUI3 1OMIA 2RMU3 4L5JA 2IRFG 1D2SA 1JUIA 3WNMA 5T5PA 3ZQHA 1FNZA 2NOJB 3BR1A 2CGNA 5IW0A 1S0IA 5C4WB 4QTRA 4LNVA 4XM3A 3BR5A 5FY0A 3ZGKA 4U87A 3CJRB 1LGBA 4YIRX 5GZGA 2FMYA 2V1NA 1HSJA 1ENQA 1UW8A 1MPXA 4LEJA 3ZXDA 5F5QA 4KT5C 3JRCA 4HN0A 3VZJA 1MIJA 3I3QA 1QJFA 3F8CA 1APNA 4XOTA 1GT0C 4SLIA 2PFBA 3OYNA 2FCUA 1S72I 4XURA 4NPMA 4LIVA 1MGTA 5AFBA 4L5IA 2IA1A 1UYXA 4D7NA 1TNSA 1U2WA 4MGRA 1RUG2 2FMLA 4LO4B 2LSOA 3WE2A 3NO8A 3TDUC 4LLNA 4OI4A 5LGNA 5ACA1 3MF9A 1JJ6C 4YW2A 1V6MA 5FIXA 3BR3A 4ENNA 4NVPA 2IGKA 4CCCA 4WZFA 4QWNA 4YW4A 1NZCA 4K7JA 3K3OA 1K78B 3LQQA 2VOPA 2HWC1 4QXKA 4BQXA 4COUA 3LIHA 4Q5SF 2DT6A 3LA7A 2DK8A 2K9NA 5D5WB 5EYXA 5F27A 5H2FC 3R4KA 2EZLA 4XSZF 4DXSA 4RR3A 3FBMA 3PUAA 1VBE2 3WW2A 2A6WA 1A78A 3SCHA 1W2NA 2IS4A 3PVEA 4UWDA 1U8RA 3P3PA 4U88A 4HSLA 1B59A 1RUH1 1HKTA 5FKNA 3E3VA 1RB8G 3VEPA 3GDBA 2EV6A 4A0ZA 3T4VA 4QPIC 5CQGA 3VD4A 2GXAA 2VMCA 3WVJA 5A2QZ 1TME2 2LR8A 4PIXA 4FPFA 5HCBA 4INDA 4IQ4A 4BNCA 2YU1A 3RDIA 1Z21A 5D8AB 3PURA 4K9SA 3IC7A 4UUVA 3KPHA 1FC3A 2EA4A 5T5JA 3A2KA 1OLME 4Q4W2 2P5KA 1MKMA 3I56I 4YVSB 1TZOA 2ELHA 1PIV1 3ZN0A 2M7BA 1KFUL 1G9CA 1XNCA 3OR2C 5C71A 1LDKB 1Q56A 1N3OA 3TNQA 1LOAA 3ZQFA 1QQP1 2H94A 1PNFA 4PLMA 5D1IA 3AP9A 3BZCA 2GXGA 5J1UA 4C8DA 4KIFA 2ZEXA 1LFBA 4CYCB 2PFWA 3EUAA 5BMZA 1FOD2 4OVEA 3RKQA 2Y26A 4OI2A 3O1PA 4ZYGA 1AX2A 1MQTC 1QRYA 1ZRDA 3TW7A 1FWZA 2GH2A 3I58A 3T1LA 2O03A 3J7AY 2EZIA 5LWBA 5A33A 4L9VA 2KMUA 4UT5A 1QOTA 1UPSA 4HRIA 4LLFA 2VM9A 1X8EA 1RINA 5CFCC 5HPOA 2Y0OA 5I0DA 2BWAA 1T6BX 5SV5A 1UIJA 5DZFA 1YG2A 4FPCA 1IXSB 4BEHA 2HDWA 1IS4A 5J36A 5GZEA 4CP9B 1R1A2 2O9LA 3Q8FA 1R58A 3A0BC 1F4KA 2K9LA 4YVWA 1UOJA 1R6RA 2DDAA 2J5OA 2Z3YA 3PUFA 3PL0A 1BBT3 4I01A 1R1TA 1ZYRF 2QZ8A 1ZZCA 1R091 2R5YA 4OWRB 2QQIA 2VC0A 2EB7A 1B35B 5FPVA 1A35A 2G1MA 3K4AA 3KP7A 2X1EA 4ZU4A 3F2ZA 2GA1A 2G7HA 3ZR8X 5FJHA 2KJCA 1B6AA 4Y1XA 5JPNB 1HLVA 3PTRB 2VZSA 4YGDA 5C9AA 5FUIA 3CDIA 1JYXA 4B3AA 4ZU7A 4LBOA 2XVCA 3PIOF 4U36A 2Y33A 4BQ1A 1RUJ1 1W7PB 4UFJA 1RKWA 3RZHA 1UHSA 5A7OA 2XBO1 2EIBA 4RDUA 5CVUA 2VMIA 4U0VA 3GLLA 2CWSA 1LQ1A 5F6KA 1GLNA 1DQ1A 3NWTA 3K4ZA 2BVBA 3AJZA 2JA6J 2AO9A 2ECBA 5FWJA 5A3UA 2K3PA 1K12A 4V2WA 5I93A 1AX0A 2ZHLA 3S7IA 5F7UA 2LM3A 1TWAJ 3G1LA 3WHCA 5BNPC 2LDUA 4KG0A 2WAEA 2RE9A 4BIFA 1OXCA 5BPDA 1K5JA 3LB9A 3WGIA 1LHVA 2MEV1 3LQCA 4P08A 2VUAA 1V4RA 2WAOA 2DT7B 1BC7C 1KJRA 2CAVA 5KAIC 1D8JA 5GZDA 2FEZA 2CQXA 4QKNA 1AR91 2NVYJ 5D5UB 4XF0A 4KT6A 3J7YJ 4BM8A 2ZSIB 1KZHA 2VE1A 4CICA 4D8MA 3UKNA 4HVRA 5FTTC 3GO5A 4PT6A 3JW4A 4IHVA 3HRSA 4ENJA 4CHUA 2VQTA 3M3IA 5IYCJ 3VPRA 4HBLA 3CCMI 3H7YA 5FZOA 4F52A 2M8GX 3S32A 3VODA 3HUGA 1TT5B 5J6XA 2W1UA 3DFGA 5ED4A 3WHUA 1UY2A 1H89C 2F5CA 2ID4A 4Y17A 3H0OA 1XGOA 5LB6A 1I1GA 3OEAA 4BOWA 4CUGA 3HBKA 3BJAA 3SISA 3CJQB 3RPUD 2C26A 5FPUA 2WABA 1SFPA 3J26N 1XSRA 3TBIA 4KN4X 1WCMJ 3S1QJ 1AYM1 5LA1A 3CDZB 3C3VA 2ELJA 2JKBA 2ME6A 2EBIA 1WFXA 4A3KJ 3G71I 3FXRA 2RVCA 3A4UA 3VZNA 4CZZA 2V1DA 5HLIA 5CFCB 4RB1A 4BY1J 5F1JA 4OQ9A 5D8AA 4BXSV 3JCIA 1YW8A 2ADUA 4XRSA 3S1MJ 4FX4A 3Q8BA 2JICA 2YMZA 2F6BA 1YIJI 1IQDC 3CMYA 4PLNA 3GZ6A 1BKZA 4CCDA 1ZLJA 3F8NA 1U0AA 3DBLB 4LKSA 1RR8C 2QA4I 2D6PA 4LR4A 2BWCA 4M3CB 1TW2A 4QDQA 2MA3A 4IHSA 2MG4A 4N9IA 4IV3A 1FPN3 1I1SA 1XSXA 5A80A 5IT6A 4XQWA 1IN6A 3I3MA 1V55H 1X1AA 5F39A 3ASIA 4Y5Z0 4LG0A 1AOYA 5FYHA 3ASNH 5J7MA 1XC5A 4JHZA 4GRIA 2X5IB 3AMHA 3CJIC 1DYPA 2JE7A 3OGVA 4L97A 2PMZA 1NG0A 4GJZA 1AYN1 1AYM3 1QEXA 1FBSA 2RJKA 4KNYA 4X6RB 2HH9A 5T54A 2E26A 4K1ZA 4E4SA 4O9EA 3O1TA 4QT6A 3POYA 1WJBA 1MSFC 2R5ZB 3KLSA 4IL7A 3LQRA 2W00A 4FI9A 1SDDB 4KBZA 4I3GA 1TZLA 1H30A 2PHWA 3AZXA 2OKXA 5D4RA 2CV6A 4A3BJ 1WLDA 5BY5A 1J0RA 2HWC2 3GWZA 4C30A 1W5CC 2KQRA 4U2AA 1I1EA 1RC6A 1W0TA 4PQ9A 1MBFA 3RKYA 3IRQA 4ZKTB 1ETYA 4B4CA 2VKVA 1F1ZA 3ITQA 1PK6B 2FHRA 3HOBA 3AG3H 3U0ZA 1QQP3 5HDNA 1CJDA 2W68A 4B29A 4RLFA 2LTPA 2X0LA 2DDUA 1GWKA 1XN7A 4P96A 5A3NA 2X48A 4LO8A 3ROUA 2FBIA 1PO13 1Z7S3 2ZGSA 4M6XA 1UHMA 4CU9A 2R49A 1J09A 3GJBA 1ZNPA 3SHFA 1C0WA 3WNKA 3CCEI 5DCFA 2JE9A 3SJMA 4GD4A 2FRHA 5DM6F 4I76A 2LFBA 3ECQA 3POJA 2L3DA 1Y1WJ 2Y0IA 4XNFA 3FXJA 3JRFA 3IWZA 2W24A 1R49A 5FY4A 3K7AJ 3KVAA 4EVIA 2CSOA 3G7DA 4PLOA 1I50J 4H55A 5KXCA 1I3HA 2IFWA 5IVBA 2WN3A 2DODA 4K2EA 3M2MA 1N1SA 1Y9GA 4QD2A 2ZGNA 3PTYA 1Y9MA 4NBQA 3PU3A 2D6MA 3KP3A 1ZELA 5DS9A 3ULQB 2WA0A 5BNPA 1Q3EA 2JDUA 5JOZA 1PGL2 1BK1A 1BBT1 3POEA 2ZO4A 4DBRA 2GN3A 3QBQA 1ZBA1 4P9FA 3Q9OA 3D5RC 3NKTA 4XPVA 1T33A 1QJX2 2EXJA 3BY6A 4M0HA 3E0JB 2L9SA 2DA7A 3PUQA 4IHXA 5LBQA 1E5RA 2IA0A 2DMQA 1H1MA 4D7YA 3ST7A 4CEWA 1ULCA 5DZEA 1YLFA 1M1EB 1W8WA 3AL6A 1CN1A 2WWYA 3J7NA 2XROA 5F9TA 2ZX4A 2ATFA 1IRGA 2CU5A 1L3LA 3QH6A 1R4NB 1Z05A 2MNGA 4O6JA 4XJZA 5L7OC 5FO8B 3LSIA 3FHIB 3CO2A 4H2AA 1HV0A 4GZ9A 3O8HA 3DEUA 1BYHA 4CEYC 1Z91A 4HF0A 2Z1DA 4GB33 3PUHA 3CC4I 2W95A 4N9HA 1XB9A 4XOPA 5A70A 2DT5A 2P6TA 4G9YA 3JUUA 2D93A 3BGAA 2AC1A 1LHUA 3Q0UA 3WDVA 4NC6A 3LSDA 3ABUA 5A7SA 3KV6A 2NNYA 1OCZH 2C6SA 2GBYA 2WC2A 1W2AX 5BNOB 5C8WA 4M73A 5A33B 4A12A 4RGAA 2DK5A 1KQ8A 1GWMA 4P5OA 4RQPA 2WAFA 3O1VA 4NPLA 4YVWB 2GDFA 2ZGRA 1W8OA 5LW9A 3SH3A 3DP7A 1LGCA 1WI3A 4BQQA 5DAXA 5KHHA 3WHBA 5HLHA 1Z9CA 1HSTA 1UG2A 1KXGA 4BQ5A 1LHOA 1V6OA 1G9BA 4KQ7A 4LBKA 1H8AC 3VYSB 1SMTA 1AYM2 1W39A 3GTQJ 4DRRA 4XBFA 4XJ8A 3ILRA 4IE6A 5A1AA 3CZJA 1HW1A 5JAXA 2FCTA 1PX3A 2YX7A 3PFYA 3N7MA 4RSUA 3BTXA 2E60A 3LSKA 3OEBA 3TEZA 2WS92 3K69A 1KGSA 3K4JA 4LKEA 1W06A 3RI4A 2A71A 4QKDA 1T6SA 3WF2A 4WVMB 4UFKA 1LOFA 5LEKA 3VKMA 2NYYA 2P2KA 4YYOA 3AG2H 1D2QA 1IPSA 2HLEA 2NN8A 3VD7A 2TCTA 1FMD2 5FQ0B 1E17A 3HEIA 4HKOA 5B66C 1D1BA 4F55A 3BN6A 2LKSA 3BZKA 3MBWA 3HOXJ 4IGOA 3WQ0A 2VUDA 5T5OA 4YM1A 2XJVA 3O1MA 2DPUA 4PCQA 1S0EA 1CZVA 5IK5A 2W3JA 3GZTB 3E5XA 4E4HA 2OUHA 3I5UA 2HS5A 3QU3A 5KNLA 1PNGA 3K4BA 3V8KA 4JGZB 4H14A 4WM7A 2KD7A 2KDOA 2NOGA 4HBNA 2NAZA 1ACCA 4GCVA 1GP5A 3CEWA 3W20A 4AHXA 3PQJA 2ISZA 2EIKH 4RGGA 1I3AA 3RZLA 3LFIA 5IAXA 2QFEA 3S5QA 1YQ5A 4RGXA 4PJMA 4DXRA 1HRV3 2MYSA 2WV1A 1JT6A 1IRFA 3M3EA 3H3UA 2OD5A 1AX1A 3P9IA 1V54H 3QPHA 1RL3A 2P3IA 4FQ4A 3K2OA 5KHKA 2ZS6B 1QNYA 4CXWA 4AG4A 5DUKA 4QM8A 3VBHA 1NE6A 3TRSB 4FQGA 5F1RA 1Y1VJ 2VOWA 4ZZ5A 1A36A 2TNFA 3REOA 4JX6A 1RUD1 3V56A 3NKGA 3N9NA 2XKOA 3MVPA 3S2HJ 4OHZA 3GM8A 3HUGB 1NK2P 5JI7A 2V5DA 3AYDA 3AP7A 1RC9A 4B4RA 3N9MA 3FKJA 1YJLA 2FDIA 4IRGA 4AI9A 1LUJB 2PN6A 1GOHA 3KT1A 3IBMA 4CDWC 1IZ3A 4MXWA 4MGIE 5FUNA 4XJAA 4OUMA 3BUCA 1JU4A 1KITA 5L3FA 3PUBA 4ISQA 1N77A 3IV5A 5JSPA 2RM23 2R0HA 1TTYA 2ZAAA 1VBD2 3OS2A 3ON7A 1A3KA 4EQQA 3F3XA 2WNUC 2R93J 4LKFA 2XB0X 4GGGA 4LK6A 3I55I 4P00B 4Y4RA 5HNFA 4Q1RA 5HDKA 1JT0A 3WTTC 5D2AA 3ZN6B 3BR6A 1D0GA 3THDA 2YFUA 2PMZN 3POSA 3UK9A 2CHHA 2DUQA 3ZYJB 5EG0A 3URFA 1EV7A 1PZ8A 5LLQA 3HZJA 4BJ6C 4C91A 4RGRA 2VU9A 5ABJB 4RL7A 2R7QA 2O3FA 2CJJA 2LF7A 2E1MB 4FBFA 2QBXA 1BR2A 1B1BA 1FLIA 5BNPB 1TE1B 2O1QA 3NMBA 1FYLA 1IKPA 3M70A 4PQQA 3NWSA 3HTSB 3OY9A 3OS0A 3FFQA 4AFBA 1Z78A 4AVBA 3ETQA 5BNNB 1WA4A 2DTYA 2BY1A 5DD8A 3DPLC 3M3OA 2BY0A 2RDRA 3J8F2 1KS5A 3TEXA 2J42A 3B73A 4EJOA 1ENSA 1NXMA 3VB2A 2QUOA 1SBEA 2WFPA 2JMWA 3RYPA 3V42A 4OMYA 4KG8A 2EWNA 4HT1T 4AWXB 3BTAA 4ASNA 1UMQA 4WM8B 4ANJA 2CSGA 2J1RA 5DG1A 4V19K 3KFWX 3VKLA 1LEAA 3VL8A 4YVSC 3H42B 4ESFA 1FNNA 4MG2A 4XLNF 3FISA 4ATEA 4OMDA 2ZA9A 1LHNA 1IG3A 4ORFA 5KAFC 1XPWA 2DLLA 3PIJA 1F4HA 1YFXA 1WCUA 1S0DA 2EK5A 2PHXA 1I5PA 3POIA 4PGHA 5EZWA 5FKBA 2YU3A 4L2NA 1ZYBA 1FIAA 3C7FA 4HN1A 2F48A 4P14A 2AUYA 1OHFA 2ECCA 3K6GA 1PIV2 3VBHC 1DP7P 3QP6A 3UJOA 4P02B 2Q30A 1JMUB 3SDBA 4XBLA 4I98B 3OPTA 4G6DA 3ES1A 2VKEA 4XRSG 2AQEA 5KCMA 2IUWA 3GTMJ 1W8TA 5FLJA 3NNLA 1S2KA 4BE3A 4LJHA 3J81K 5FMDA 1RRJA 1XJAA 3QU6A 2RNGA 2C6YA 3EO6A 3F6VA 3DKQA 4RBOA 4L0ZB 4MFEA 1W8FA 1TNTA 4G7OF 4MTDA 4GH4B 4MNUA 4PJNA 2EJRA 1ULYA 1HIXA 5M5WJ 4ZU5A 1GQGA 2Z9OA 4L0PA 3NQHA 3U10A 2VJXA 4Y13A 5A6YA 1AWCA 1S0CA 1F43A 3F72A 4G94A 3ZN4A 5M3MJ 4HOOA 3A01B 1MD0A 1WPKA 4L5EA 1ZZ8A 3ZXAC 4IPAA 4TZDA 5C3EJ 4K20A 3DLLF 1BLZA 2RDNA 3AC0A 3OUIA 3F23A 3JB4C 2JRMA 4KIBA 3RMYA 3LL7A 2CO5A 3V8JA 2Q2EB 1RUD2 1TWCJ 2HYKA 1JZ3A 2B42B 3ZXKA 2WNUB 1R1A1 1IJWC 1IUYA 3ZFGC 5EFUA 4LBQA 3QWLA 2HWD2 5FLMJ 3K0LA 2Y75A 4O5VA 3KZYA 3HWJA 1I6XA 4HG6B 2WO2A 4PDWB 5F0FA 2HKXA 2ARCA 2GMMA 4UW6A 3QCWA 2YUSA 3HQRA 2E53A 4BHPA 2LBFB 4LULA 2ZXQA 1ONAA 5HV0A 4I02A 3EQEA 5IVCA 4JAAA 4DUVA 1SCSA 2RS11 2R061 4XAAA 2VZUA 5K8SA 5H9SA 4A3GJ 1DP0A 5KVRA 3CCUI 4LK1F 3EHKA 1I39A 2GC0A 2ORZA 3HBLA 5B4XA 3MWMA 1POQA 3CMMA 1OR7C 2Q1ZB 2VG9A 4JX0A 2K0GA 2OYZA 2E19A 3IN9A 2IEKA 2UXXA 1V6NA 3E1SA 2HDCA 5FZ0A 4UW5A 1IQAA 1A5JA 4IQPA 5C3PA 5K9YA 4RB3C 3PU8A 4XN0A 2L9RA 1OOPA 3MYXA 4IJAA 4FPYA 3GCXA 4ETSA 5EDNA 1RJ7A 2LKXA 3RZZA 2B9VA 4PSXA 1N75A 3T0DA 4L9JA 4LLGF 4DEQA 2KIMA 3DPRA 5FZ7A 2EQRA 1QGPA 5FPXA 4FPOB 1C4RA 5FZGA 1DUXC 4QQPA 3LEIA 1ZA7A 3CL1A 2WWJA 4QQHA 4Y26A 2P4WA 4IE0A 1VRBA 5IOYA 4BCUA 2W46A 3UKGA 3WUCA 3EUKL 4G9SB 4FP2A 3H3ZA 1XSVA 2LYCA 4BHBA 5CAZA 1GWLA 4YG6A 5FZ6A 3CUQB 2C0ZA 3H5AA 1HQLA 4PF5A 4YFXF 5E1XA 1Q5OA 4QB2A 1OJLA 2LLKA 1VRH3 2AQFA 2Y6GA 3FLRA 1WLCA 3W58A 3D5LA 2WT2A 4XQFA 1YE9A 4M3CE 2JWTA 2Z4FA 3V0BB 2HOEA 3CUOA 3OJBA 3IKWA 4LBMA 2HDDA 1V9U2 3U07A 4V1PA 1VBA3 4A3EJ 2QYOA 4EN8B 3WT3A 4IHTA 3B93A 2CH0A 3OYCA 2OZ6A 5C8CA 4BQAA 3FHQA 3I49A 4NIGA 3S57A 3ACLA 3RZOJ 1HLCA 3U4XA 3P5JA 3KMHA 3OY8B 2ORXA 3EBRA 5BNGA 1S0JA 1ND2A 2I10A 3MKWB 5FREA 1F8VA 1RPWA 3SLIA 5FZAA 3F9KA 1K3IA 3I53A 4XBQA 2L02A 3AMQA 1A8MA 3B9CA 1RGSA 3AX4A 1C5HA 4PDWC 2WNVB 3ZOBA 4QGNA 1X2NA 1NG6A 2Z16A 4FX0A 5B5EC 2XJUA 5K7HA 4Y1ZA 5DEQA 3BCBA 1NCRB 1MSEC 5JIUA 1X36A 5L9VA 3GYHX 4CE8A 3L2RA 1TWHJ 4PIYA 3OL4A 1MS5A 4V2VA 4XZUG 4S2FA 1DQ0A 2ZBJA 5FZKA 4E4ZA 4II2A 1AR82 1QJY1 3VWBA 4RR3C 1RUH3 3CLPA 4QX2A 2JRTA 1AR61 5B1AH 2TDXA 2I8DA 2PQQA 3BWGA 4XRFA 3SFIA 4Q0SA 4JVAA 5KXBA 2VQLA 4AI3A 1LKNA 1XU2A 1BW5A 3MAJA 1B35C 5ILUA 5ILSA 3K48A 2JN6A 4OULA 5HODA 1AJKA 1HRI1 4WXDA 4H3WA 5FZCA 3SQNA 4QX0A 3H0GJ 4PBPA 1DGWA 2A6ZA 2M0MA 1ND3A 3O8GA 4P9IA 3ML6A 1AF9A 2XIGA 1CVNA 3AVSA 3GBFA 4O65A 3IHUA 1PMHX 3NVCA 1AKHB 4ZDOA 1CPNA 2QVOA 4ARYA 4CO8A 1RETA 4E7ZA 5H9RA 4JV4A 1CF7A 4KU8A 4P9UA 1J59A 3BLYA 2YUEA 2W4SA 2MD5A 2R073 4XE9A 5HLGA 3O1OA 3B69A 3CNAA 3U4SA 5GLZA 1FMD1 1BI2A 5FKOA 3A7QA 3A0KA 2BZDA 1BIBA 4HDUA 4IGPA 1VALA 1GICA 2UYBA 3MFAA 2WWUA 1HXS2 1ZGWA 1PZ9A 4HETA 1SBDA 5FLXK 4IE4A 2HOSA 1R00A 1SFEA 2AREA 4EWDA 2R6QA 1ZK8A 1ZRIA 3ZFEA 3X2QH 4UV9A 1RUG1 1WBLA 4Q4W3 2RR13 3GJAA 3OL3A 1BCXA 2X53S 3CO7C 1RUC2 4AQTA 2E36A 3M9AA 2KHMA 4YM3A 1EPZA 4XYXA 1U0JA 1G59A 5JR3A 2HPMA 4JDNA 4YZ2A 3NRUA 3JD71 1LPQA 4C9YA 1GKBA 1SLIA 4N7IA 2PJRA 1UHWA 1ZTRA 4LT5A 3T5XA 2KIUA 3LZZA 4G12A 4U0YA 1LGNA 3I4PA 3QLQA 3JBG3 1XSQA 4AEJA 3M7GA 1FJLA 5IT3A 3FZ3A 1YRNB 4L9BA 1YFUA 3UJQA 2DMUA 4RM3A 3OYIA 3CDLA 1ULEA 3RSJA 2Z33A 4BMBA 2STWA 5J4YA 1AUYA 2KJBA 3W3CA 3S17J 1FMD3 4RGKA 3C2BA 5JVGF 3CCQI 1OKOA 1PGW1 4LMYA 1TME3 2KPMA 3MMYB 1WH7A 2W91A 3OMYA 5IVJA 2JJ7A 1FXZA 3A0HC 1T2XA 2X5IA 2RDQA 4S0HB 1KU9A 2RN7A 3K1PA 2YZ4A 1VI0A 1V9U1 4HSRA 3E7LA 5CVJA 3VBOA 2AENA 5LK5A 1LJ7A 3CHXA 2JSPA 1W2TA 4XC9A 3WE3A 1A8DA 4SBVA 3OYLA 3BTIA 4XOGA 2FDJA 4QHOA 4D0PA 2XVLA 4MADA 2DTZA 3T2QA 3TQNA 2GNDA 3SC7X 1JHJA 2KA3A 2RGVA 2ESNA 5D8KB 1Q8QA 1RUE1 5J1XA 3AL0C 1REFA 2L4AA 3PNTA 3WNOA 3G2BA 1K4TA 1PP8F 5JHFA 4BACA 4DYCA 1VAVA 4W8JA 1SBFA 4NN0A 5IPAA 2EXIA 4XUPA 3IMMA 2A3WA 5D6EA 2Y8KA 3KV4A 4B1MA 4BIOA 3KX2A 3UNGC 2VXZA 2WFF1 3BTCA 3IAM2 5FZMA 3BU0A 2Y0SA 1COV2 3TEYA 3C18A 3MUZ1 2NZ9A 4HX4A 4IETA 3HN1A 1HF0A 1QJU2 3DECA 4LG3A 3IAPA 1EF4A 3MIEA 4KA4A 3S8PA 3H1WA 4IUGA 3HJEA 1QU3A 3K4KA 4A3CJ 3QOPA 2RS12 2UYAA 3ZYFA 3LAJA 4ON0A 1RMU2 4YFNF 1V00A 3ZMZA 2A73B 2CW0F 4MEXF 2Q4SA 4XAEA 1OT5A 4LBJA 1TT0A 1FMWA 3ZXLA 3ABTA 3AP6A 4I2OA 3DYMA 1YYVA 2AEYA 2E7WA 2WV0A 4PIZA 1AVBA 5T52A 3ZOIA 3OV8A 1Z7S2 4MOAA 1BZWA 1DCSA 1GV9A 3CC2I 5FZEA 1LOGA 1IRXA 3DPUA 3J7LA 3ZIWA 1GQHA 1W90A 3OGJA 3NNMA 1S5LC 3TP0A 5JR2A 1UF2C 3OBRA 2Q0OA 4AIJA 2EFWA 4Y22A 5EPAA 1NG7A 2PLV1 1AR92 2H8RA 4XDQA 2DV9A 1R7JA 3MV01 1ZAOA 3OIQA 2VODA 4YIFA 4AD9A 1BEV3 1RHI3 4AUXA 1S29A 2IXLA 2QQ9A 1U3EM 5FOJB 4FTSA 1OD5A 3LWFA 4ENMA 3SCFA 3BDDA 2QQAA 3KP2A 2XAUA 1OFCX 4DNCA 2A1XA 3WP5A 1D5YA 2JG8B 3OD4A 4E7KA 1LOBA 2J22A 3OWTA 3ERED 2X6YA 4B47A 2LY1A 2VCAA 2F4PA 2MPFA 4ZPIA 5DDJ2 2CFXA 1MBHA 1OVSA 5A7NA 1TQMA 1W7PD 3B02A 4GWNA 2R7UA 3FM5A 1W0OA 2DF7A 5FXVA 4ZJZA 2ZNZA 3WD5A 1W6PB 4P9YA 2VI6A 2ZXWH 1QBJA 2D1HA 2BUKA 2AXTC 5I8TA 2PXJA 2QGUA 3ABKH 2WSVA 4CTEA 1US3A 1UU4A 4DIQA 3AXDA 1QJY3 2HWD1 4JOMA 3DTEA 3GTGJ 1AR63 3CBNA 1PUFA 2CYYA 4UNOA 4I0AA 3MD2A 3MIBA 3KV9A 4Z2WA 4LOCA 4BQNA 2CV1A 4D69A 2HOAA 4QM9A 4OI0A 2FD5A 5GADJ 1AXZA 1Y4WA 1O3RA 2HJIA 4AGVA 2CW8A 1AYN3 1W2OA 4A3JJ 2DI3A 5LCWL 3K3NA 4HKLA 5KK1A 1O3SA 1HKQA 3NQOA 2VNVA 5DMYA 1S4CA 4F83A 4PDWA 4B4PA 2WO3A 4DMIA 5DABA 2E31A 2QSFX 1U6GA 1XMXA 3TDZC 1YW9A 2M5WA 4R9DA 4QDSA 1Z3YA 2ZKNA 4LO5B 4B7KA 5JXGA 1YI2I 2XGEA 1H8TB 1FOKA 3HRMA 1C8M3 2RDSA 4OZOA 2EIGA 2R92J 1YNAA 2F5FA 2R7EB 1OD3A 2DFEA 1QH6A 3OB8A 2XAGA 4YLZA 4O9GA 3N4MA 1O57A 4IERA 1YW7A 3NNJA 4XLAA 3VYRB 4IEJA 4WX9A 5APAA 2Y38A 4AIKA 1ZBE1 3CTAA 2LY2A 2WNVA 1RHI2 3ZMTA 1MJBA 4XZPA 1QVTA 2DYCA 1YHFA 3HOTA 1LRHA 2ZMNA 4EM0B 4J25A 5FP3A 1AKHA 5IK4A 3DU5A 4NQWB 4RA2A 1FZPB 4A45A 5BQTA 5K4LA 3VDAA 2WQ8A 2VPRA 1Z1DA 2RQPA 4TTGA 1R092 5DUUA 1P9QC 3RGBA 3OBAA 3GBWA 5FMOS 4CZSA 1W0UA 1KDKA 2VNRA 3MIFA 1H9WA 1T08B 5FP7A 2Y6HA 2NXNB 3ZIXA 3FMRA 1JHHA 3AG1H 5FQ0A 2IVJA 1N1YA 2BPA2 3VLBB 4CH7A 4WWCA 4AVCA 4AI8A 5FYIA 1XG1A 5F08A 4B1LA 1J3QA 4GMP0 4AQSA 1P2FA 1UZWA 1US2A 2W84A 3VZKA 4AWDA 3W5NA 1BQPA 1ENRA 1XNDA 2MC4A 2XSJC 1KQ9A 3KP5A 3P1IA 3WTZA 2HQAA 4D3WA 3TO9A 4KMQA 4JGZA 2XG3A 2XHNA 2DVGA 2FUG2 2X6XA 1MZ6A 1TMF2 2R5ZA 4JTOA 1ULPA 5B1BH 4RGSA 1WW7A 4IEXA 3QP5A 1VBB1 3VKFC 3PSFA 4NJ4A 3T30A 4YG0A 3G6EI 3N35A 1R64A 3VBOC 2IJLA 5FZBA 2EV5A 3WNNA 1GMMA 2QNKA 3VBUB 4IEQA 1T0FC 1VQOI 3ZPOA 2DO7A 4PJJA 4FTEA 4NHXA 2P0WA 4CUAA 2GLOA 1LR5A 3E6DA 5A2QK 1G86A 4AI0A 1FOYA 3KP6A 1G9FA 4HNTA 3ISPA 2VN2A 4GYIA 5DAWA 4CDUA 3EUHC 2VULA 3L9FA 4G3YC 1DZTA 1STMA 2DW4A 4XICA 1WWYA 2JD9A 2PAKA 4JCKA 2OJED 1ULOA 2CY6A 3ZXSA 1X4OA 3N3HA 3F8FA 4AU7A 2P6CA 2OT7A 2P5LC 3ZSMA 1BI1A 2BW3B 5FPLA 4YM2A 5EHDA 4IOAF 4XONA 5TSWA 4ASKA 3LEGA 1JI8A 4IRHA 2DYRH 1EH8A 1TWGJ 1HKDA 2IGOA 3P9KA 2HWF3 5FJKA 1WWXA 2RS33 3O5SA 5D4SA 1BOAA 4LGWA 4UF0B 3JTHA 1QZYA 2Q0AA 1MBEA 3BIEA 4LITA 2DA1A 2Y30A 3VDDC 4QXCA 4IF4A 3VUOA 4YW1A 1RIRA 1UY4A 5J09A 2WB1A 5FZLA 3DCQA 3HOWJ 2WS91 4QSHA 4BUPA 3TYJA 1UL9A 1PDNC 3N36A 5T3NA 2IAIA 3T2PA 4Y1YA 4UB6C 4CP1A 3H7JA 3PSIA 5FJ8J 3ZQGA 2JK3A 4A6SA 2OTJI 3TMOA 4FETA 2VC9A 3PHMA 2J1SA 5L9RA 3KZ4C 4AEDA 5CADA 3AZWA 1JU3A 3WNPA 3A23A 3ZM8A 1HQWA 1MQTA 1Z3XA 1VNDA 5GLVA 4C3IJ 3RQ4A 4YRDA 2ETEA 1A6IA 3OF1A 5IOZA 4A5MA 5E16A 1S8NA 3M07A 5J48A 3S16J 5L7OB 3TNPB 3HXLA 3DYOA 2K27A 1YFHA 2VVDA 4F3JA 4AEKA 4EN6B 5A6ZA 4MGKE 1R083 4YVWC 2VMDA 1REEA 4FAHA 2JD4A 4GULA 2ZABA 3LSTA 4IV1A 2FZ2A 3OGSA 1CAUB 3BTYA 4QPOA 2X85A 2PELA 5CPRB 1HX6A 2M45A 3FHAA 2QWWA 1SCRA 3K75B 2WS93 1XE0A 5CVRA 5GPAA 5CZKA 3M1CA 1PUEE 3FXQA 2O0YA 3WUDA 3CCVI 4M3DA 3D8CA 4GFBA 4RAGA 2W9XA 3ZFFA 2A68F 2CUFA 3ZYRA 2ZX0A 2HGCA 3V4GA 3NAPB 2BGPA 3WINE 3VZMA 2JDHA 4XXAA 1VBC2 5IYYA 4Y3OA 1PMIA 1V3FA 2COMA 2HI3A 5J4VA 1VQ5I 1LCLA 3RSNA 2CL2A 3BVCA 4V2FA 2HWB1 4UVAA 4AYBA 5C4JJ 2HNHA 3L2QA 3BPSA 2LG4A 3I4MJ 5JZGA 1NLQA 2ZGTA 1PO22 1XYOA 1ETKA 2BNMA 3VBUC 2LTNA 5KC6A 1B4AA 2W1SA 2ARXA 3E6CC 1LE8B 3LSMA 2RQQA 2A6TA 5AVAA 3RWNA 2KT0A 2ZMEA 4LXLA 3LNQA 1YQAA 3WW1A 2RM21 3OG2A 2UWBA 1BK0A 3HPHA 1W28A 4L11A 4LK7A 3I2OA 1J2XA 1J3RA 2B5HA 5F3GA 3B6CA 3EB7A 4AW7A 2KZVA 2R7RA 2V1UA 4CXFA 1ZX5A 1LEBA 2HWE1 4L8QA 3WF3A 5FY5A 2F5DA 1TNFA 2R0FA 4QX8A 5FPBA 1LJ9A 3THTA 4M9SA 4YNIA 3AG4H 5L9BA 2B8MA 2XL7A 3O3KA 5SV8A 4NDLA 3GFJA 3UR3C 4QX1A 3LSHA 3WG7H 2LRDA 1H1AA 2NNNA 3QPTA 5C3RA 2NRAC 4AXOA 2D44A 4IV1B 1DU6A 4MYEA 3TEWA 1SEFA 2Z42A 3EYPA 2B7EA 3VBSC 3R61A 1MJ9A 4DY5A 4HF2A 4JP0A 4ONUA 4DB5A 1KGYA 1KDMA 1WCQA 4CYCA 1PUFB 5DG2A 1ZARA 4BWOA 3ZRGA 1T8IA 4JDMA 3AFHA 3HT1A 3CUQC 2MC3A 1O4ZA 1IRZA 2L5QA 1YQ8A 4KU7A 4ZDLA 5C8CC 1Z77A 2ZGQA 3VGIA 2BJSA 3ZVXA 2YC0A 2V26A 5DV5A 1LODA 3NWKA 1QQIA 5I0TA 4EGYA 3CCYA 4NC7A 3CC7I 2Y9ZA 4HPQA 1JTZX 4XHXA 1V5GA 2R7DA 1O8SA 4LB6B 3R05A 3DU6A 4Z1VA 1HDDC 3W5MA 2XF7A 1OA3A 3FXLA 1FYUA 2NM1A 2WNVC 5F5AA 3T3YA 2DQRA 1T39A 1EJ9A 4FVVA 1FY7A 3IRRA 5ANNA 1DLCA 2V5YA 4IEOA 3BYWA 3OYWB 2PHLA 3SDGA 1WZ2A 5B2GB 4BY7J 4CDQA 5FR3A 4OCTA 1DQUA 2ELKA 2GOMA 3AKRA 2VECA 3B00A 2I74A 2VNGA 1D4M3 3MFCA 4URAA 2B9UA 5C3SA 4AEDC 5A32B 1JS9A 3F6OA 4JKMA 4IE7A 3L2VA 2JG8A 1O91A 2VXDA 2DXIA 1W7PA 5JUVA 2WZPP 4YWAA 3U14A 3H8OA 5A1LA 1H8TC 4KITB 2XDVA 2ERFA 2V9VA 4PCRA 2HXIA 3AFGA 4LJZF 3LOBA 4YVSA 4GAZA 3C2HA 4I99C 2XUBA 1PVC3 4E8CA 3O12A 1WI9A 2L0KA 2WY7Q 2A6XA 1ZBE2 1DZQA 1GOGA 2DMPA 2ADDA 3AMMA 2OCCH 3SCGA 1SLAA 1SAXA 3I64A 1YIPA 5FKKA 3NNFA 4A3MJ 1IG0A 4XBNA 3OUJA 4RHV2 2Z69A 1G3YA 3O14A 1X2MA 5LRRA 2VD7A 4OZXA 4FE7A 2UURA 4XETA 2CNAA 4GJYA 2K02A 3VKOA 4MGQA 5FXXA 1RUNA 4IL6C 3N9OA 2R043 5EJ1B 4MVTA 5DTDA 2DU9A 4HX8A 3HL2A 2MEV2 4AFDA 1OR7A 3JRIA 3PJRA 2OQ6A 2A69F 5DUWA 2BYVE 2D97A 1CWPA 1BVVA 5GZFA 2XVGA 2HU9A 4ZTFA 1V6KA 3FX3A 3JTGA 1FX7A 5IVEA 4TXWA 1IZ1A 3LFUA 5E3MA 3VV1A 5HBAA 1GV5A 4A6EA 1MH4A 3JR9A 3COAC 2IFRA 3DBRB 1XB4A 5J8CA 1NHAA 3GTOJ 2XPVA 4XL9A 3N7KA 1MMNA 2E5ZA 4HW0A 5HXVA 4E6KG 4YGEA 1XQNA 4N43A 4Q8KA 2LROA 2ZC2A 2HZTA 3SFZA 3SEEA 5I0SA 4R9BA 3SQOA 3QYBA 4NIAA 5LD2C 1GP6A 4H4KC 4O3MA 4LOTA 1NLRA 2ME0A 2HEOA 4H0EA 1VBE1 5LA2A 5TISC 4MQ9F 4XEZA 5DXDA 4NWVA 4MV2A 2PMWB 3LFKA 3BTZA 2WZEA 1UZ0A 1CIWA 3INAA 3O1UA 3D0SA 1Q8VA 1H9TA 2TRTA 5J37A 4AVVA 2V72A 2VPVA 1SD7A 2ILMA 3L7WA 4Y5TA 1MEC2 1I3QJ 4JQRA 4Q48A 1AR62 4M0NA 4B3XA 5KC5A 1ON1A 3T1BA 3RIRA 1JZ6A 3W6VA 4XXPA 3K2AA 1X9TA 3HPGA 2JG9B 2VOXA 3OYKA 4BAYA 1EYBA 4Q4Y1 5EYYA 1XXNA 1Y56A 5DUXA 3RZJA 5HOOA 2WJSA 1GZWB 4CDXC 4MO7A 2AZ5A 3DPRC 3KEOA 3GZUC 2ZBKA 3ZFGA 1S2EA 2DCYA 3WF4A 1UO9A 2NVXJ 3PO2J 2VLAA 2QQKA 3GFMA 3BODA 1APLC 4EZHA 3RYRA 2PTMA 2ZXIA 2VTXJ 4HF1A 2FOWA 1XNTA 1X1BA 5ICEA 3LPFA 1OUSA 3KQ4B 4MSVA 1FPN2 5EEAA 3KEYA 1B72B 2IXHA 3HDDA 4AYBN 2GM4A 2EICA 4G6QA 4FTBA 2FOKA 1XTAA 2C5DA 1VAMA 4XIKA 1FATA 3CMAI 5KHJA 4NHJA 3B3QE 4BE0A 3WDYA 1YJNI 3RZDJ 1R5GA 1TWFJ 4HVOA 3RQ0A 1YRNA 2DBBA 3WDXA 1K78A 2RHPA 2XOMA 3QODA 4M3FA 2X05A 4XACA 1OH4A 3JRGA 2JB4A 4XFHA 1R23A 1ZREA 4LE3A 4DRVA 4GB32 1JHNA 2VBWA 1D0YA 2FZ1A 4DXZA 3QPLA 1DGWX 1HN0A 5CISA 4IW3A 2JX9A 3TWIA 3QYFA 4AFCA 4ISRA 2A6EF 2E2IJ 2ARAA 2QQOA 2M1BA 4QX3A 3ZSJA 1ZRFA 3SHRA 3E6BA 5TRDA 1COV1 3ZQQA 1LNSA 2ETHA 2DCJA 3L2CA 4F91B 2WLPA 5EEHA 2UZKA 4NAOA 4ASLA 2IXCA 3BPVA 2CQQA 2R042 3VDBA 2EVXA 3WU2C 1UKRA 1QF3A 4B09A 3IH2A 1O7LA 2QLZA 1ETQA 2VKHA 2M3AA 2DPDA 2DCZA 3HT2A 1F4AA 5A1FA 5FMCA 3AM2A 3POWA 3OSFA 3OPWA 3ZR5A 1DGRM 4RQPC 1IN4A 3N97A 5FO5A 4BQ3A 2G7UA 3WSOA 4RN5A 1UMHA 2P5BA 1Y6IA 3I2DA 2EIMH 4O7XA 4RLQA 5FK8A 4XFCA 1K4SA 2P3YA 2VL8A 1EY2A 2W85A 3A4CA 2GIVA 2WBKA 5HLTA 2EFPA 2VR4A 1BI0A 2LK2A 1E2XA 4DO0A 5EJZB 4NPRA 1LEMA 4M3GA 3GCWA 2C4XA 4HDVA 3O0VA 4CDWA 4M4PA 3ELNA 2L7ZA 1W6MA 3FLTA 1NH3A 1BC8C 1H4GA 4PJ0C 1YFWA 4L9NA 1COV3 5FO7B 1QJU3 4S2HA 3OD0A 2DFIA 2CDOA 4ZH4F 4ZXKA 2JEMA 3PNYA 1WHUA 5I8SA 1MVQA 4ET7A 2WINB 1ZGAA 1L3JA 4MXVA 1BR4A 3GZNB 2WY8Q 5GJ6A 5CJ9A 3H1MA 4C90A 1O7FA 2AR6A 4FAGA 4XQDA 4IZZA 1CAVB 2JDZA 2HWF2 4Q0UA 4AGRA 2CRGA 2E1OA 2LMDA 4IOCF 3HNYM 5HS9A 2VBZA 2OV7A 2OTLI 4HPKB 3WDWA 4NHLA 4QMAA 4JHTA 3FXUA 2VZVA 4KICA 4Q4W1 1J9IA 2L7KA 1HDPA 2RR11 4EJTA 4XKVA 4N43B 1VBB3 3BALA 2WFF2 1JUHA 2BEOA 3UETA 4RB0A 3A0NA 2HQNA 2VZ3A 4ARXA 4Q8LA 3PJYA 1ITYA 1EAH2 5IVVA 2QQNA 3UYJA 1DP3A 2WZR1 1OCRH 4NMIA 1DU0A 3S1NJ 2R3SA 3WQBA 4AF9A 4OI1A 1IN5A 1HXS3 2YDEA 2XGXA 3L2YA 2XV4S 3BCWA 5GLTA 3LDRA 1HBXG 1R9TJ 5CNAA 2Y60A 2X9DA 3U78A 4IO9F 3OTFA 5FWEA 2E34A 3RKWA 5FD6A 1UKGA 5FP9A 1YOVB 5G05L 1P92A 4J1XA 5IP9J 3VHRA 1E0EA 1DF0A 5C5UA 2ID6A 1ND2C 1VJ2A 4FP3A 3LSGA 2JTVA 5K7ZA 2PHRA 2BERA 5GALA 3ZMSA 2IVMA 4A3DJ 1W6QA 2W87A 1QXPA 4ITCA 5KHDA 3PVNA 2DMTA 3K4NA 3GXOA 5GAEJ 1ASJ3 3LPGA 3GLXA 1ZR2A 2ZGKA 3HHHA 4HZFA 5HS8A 4GA9A 2H09A 2R1BA 1EAH1 3F8MA 3VHPA 1FSEA 1H6YA 3ZMVA 2LC2A 3DV8A 4Z92B 5AC93 3H35A 3T1MA 4M72A 4DS0A 1T95A 3OS1A 6PAXA 5ACA3 2VXRA 3OUHA 2XF6A 4XHBA 3M1EA 1X4PA 1CZSA 3R6SA 2XXZA 2CAUA 1WRJA 1AU7A 3I2GA 5DYMA 3LD8A 4XUQA 3W2AA 2DJNA 2V09A 5FZIA 3IZOA 2YGMA 1SANA 5IT9K 4JQFA 2DFFA 2BVLA 2HWE2 4RR3B 2OX0A 1AXYA 2D3RA 5FFZA 1HB2A 1TQ5A 1X82A 3PFIA 3I59A 1F5FA 1F2NA 1SLLA 1YS7A 1HJGA 1QNWA 3ZFEB 2ZGPA 4A3XA 2V73A 3UGGA 2V79A 4W4ZA 1Y8RB 4FCYA 3EJKA 4CCMA 1HCRA 3OYGA 3C7OA 3CMGA 2QQPA 1RUF3 2PAMA 2M4KA 3VSLA 2HVSA 2RR12 5FXWA 2ZHNA 3LEKA 1IO2A 1GVJA 1DBNA 4AHWA 3IAS2 3JXSA 1NCQB 2FMDA 2VOVA 2OPTA 1KYZA 2HFHA 1QH7A 5FMOL 4RGUA 4KN7X 1UPIA 4ZXEA 3HKZN 2OS2A 2CMPA 4KL1A 3RQIA 3CJIB 2HOTA 1FV2A 3GUDA 3FN9A 3O0XA 1OOPC 1EAH3 2WQZC 5M5XJ 3KGLA 4K40A 3N05A 5CKNA 2A70A 1HOMA 2DA3A 2VQHA 1W5TA 3NV1A 2XMLA 3AMNA 1WJCA 5EG0B 5L3GA 4LO7A 5A32A 2ZJQF 2PLV3 2E2HJ 5FLVA 2KP6A 2ZFWA 4WZCA 4RHV1 3WLUA 2IZWA 1QVUA 1NCRC 4JC1A 3R0RA 2VE8A 4ZYEA 2BTVC 3T2OA 1NOVA 2FSWA 3RS6A 3GALA 4X8NA 2VASA 3MIGA 5FZFA 3ECHA 3B5LB 1YQCA 1P7IA 3ME2A 4MFDA 3NJYA 4C2MJ 1VBA2 5J3UA 2XAFA 2LH9A 1VBD1 1UY1A 3AP4A 3OYEA 2IXJA 1E3PA 3BIWE 4YARA 3CP8A 5C44J 3LMMA 2DDBA 2IA2A 2W92A 1F36A 3TO6A 2B39A 2XJSA 3BG7A 2WNEA 3MCZA 3ZO0B 5AC92 3HSFA 2BY3A 3HOSA 3CDHA 1E5HA 1RUE2 1Z7UA 3FBNB 3H8RA 3JRDA 1B8IB 1PP7U 1ORKA 4E27A 2B46X 1VTNC 3DQVC 2RMU1 4R4ZA 2VVFA 3PMSA 1MBJA 1KQRA 1JKRC 1VMFA 3ZSKA 1HB3A 4COZA 3L1PA 1J84A 5CKMA 4JTNA 2CUEA 4IGQA 1ZKGA 2L9LA 1GANA 4JQTA 1SLCA 2W7NA 4R8HA 3CU7A 1ENHA 5FYSA 3GBGA 1GFF2 1T98A 3USUB 3NSTA 1UQXA 1B9NA 2QTWB 3LOCA 1H0MA 2LREA 5I8YA 3BOPA 4X8PA 2CGOA 5K5QA 4N53C 2O8KA 4M01A 1W9TA 4Y1VA 3L09A 3KCXA 3RPUA 4IX7A 1TQIA 3OCPA 3NEUA 1GSLA 1AR83 4DQ2A 2DFHA 3K9TA 1NZIA 5T5LA 4CA9A 2OZJA 2WADA 3HRUA 4CDQC 1F35A 4OYUA 1XE8A 2BOIA 3C1DA 1QJU1 3IDCB