1HV1A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTAYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv1A00
3WT3A 5HXVA 3VHNA 3WX5A 1BVVA 2NLRA 4NPRA 1OA3A 3B7MA 1TE1B 1BK1A 1UKRA 1BCXA 3LB9A 1KS5A 4XQDA 4S2GA 3AKQA 3WQ1A 2NQYA 2VGDA 2BWCA 1H0BA 1H1AA 1OLQA 2B42B 1T6GC 3AMMA 2C1FA 1UU6A 3VZKA 2DCKA 1HV1A 1ENXA 3VHOA 3AMNA 4S2DA 4HK9A 2BW8A 1UU5A 1REEA 1XYOA 3WP6A 5K7PA 2QZ3A 3LGRA 3M4FA 4HK8A 2D97A 1XNDA 3AKSA 2B46X 1H8VA 4HKOA 4IXLA 1OLRA 2Z79A 1C5IA 3VZMA 1XNBA 4S2HA 2VG9A 3MFCA 4H7MA 1M4WA 1IGOA 2DCJA 2JENA 3HD8B 3WQ7A 4XQ4A 3AKRA 3VL9A 3VGIA 3VZJA 2QZ2A 2DCYA 1H4HA 1REFA 3WY6A 1QH7A 2B45X 3RI9A 1KS4A 3VHPA 2DFBA 3WXPA 3WR0A 3VZNA 1OA2A 1AXKA 3B5LB 3AKPA 3MF9A 5K9YA 1W2UA 3WQ0A 1XYNA 4HKWA 4HKLA 3MF6A 3VL8A 1XNCA 3VZLA 2JICA 1UU4A 3MFAA 3RI8A 4S2FA 2VULA 3WP5A 3AMHA 1XYPA 3WP4A 1QH6A 2F6BA 1XXNA 2DFCA 3EXUA 3O7OA 3ZSEA 1XNKA 4XQWA 3AMQA 1C5HA 3VZOA 3AMPA 1NLRA 2DCZA 2BVVA 4XPVA 5EJ3A 1HIXA 1HV0A 2JEMA 2D98A 1H4GA 3WP3A 1REDA 3AKTA 1PVXA 1F5JA 1YNAA 2VUJA 1OA4A 2BWAA 3VLBB
chains in the Genus database with same CATH superfamily
2I2SA 5T5LA 2XJPA 3K46A 2QQKA 4BZ4A 1ZRDA 2FD8A 4Q0VA 1CZSA 3VD9A 4E4SA 4ZY9A 1ZVFA 1HB1A 1K42A 1AYM1 1LOEA 3PHMA 3T2OA 4BK5A 2ZHNA 2WNVC 5JZGB 4DRVA 3O0VA 4YVSC 1KS5A 2OQ6A 3RWNA 5BNNB 5C5UA 3ZFEA 5JPNB 4MZUA 4XFCA 4Q29A 2W1SA 2WR9A 3NL1A 4KU8A 4IV3C 1OLQA 2B42B 4LE4A 2ORXA 1AR83 2AENA 2YPJA 4OMDA 2EICA 1VBD3 3ACFA 4LUMA 4WZCA 1DGWA 1CZVA 4CE8A 2BW8A 3LPFA 4P14A 3JQWA 4TTGA 2AYHA 2HWC1 1DGWX 5DG1A 3WOGA 3GCWA 2RJKA 2CY6A 1NCRB 1DZRA 4CU8A 3IN9A 2B46X 2R1BA 1EAH2 4B29A 5C7GA 5IAXA 1WMFA 2JDPA 1OUSA 2NPIA 4A7ZA 2YBSA 2X5IC 1R1ZA 3H1WA 3K3OA 2VCAA 1C1FA 2E7AA 3VZMA 2FHRA 5FY7A 5C70A 2VUDA 2JXAA 1HB3A 2DYCA 2VNOA 4OHXA 4L92A 1OQEA 3AVSA 1DDLA 4LBQD 1W8NA 2OA2A 3LA2A 3RGBA 3M3OA 2HYXA 4Q4V3 3ZFFA 2D3PA 4ZXKA 4CCDA 4XTMA 1R093 4LBNA 4CSWA 4UFLA 1S0BA 1FPN2 2V4VA 4X6QB 5B2GB 2IXLA 4Y1UA 3VKLA 4UFIA 1R1A1 5FZ8A 1MZ6A 1VRH1 4XUQA 5DABA 5FZLA 2FDGA 4XOGA 2ZGPA 3B00A 1JTZX 5C4WA 3VB9A 4YW3A 4Q4X1 1FATA 2JX9A 3U4XA 2VE1A 3ASIA 5FZFA 4UFKA 5FY9A 2RM22 3ZMOA 3L2YA 5I8SA 1ODMA 2ARCA 3POYA 1MS9A 1HRI1 4I01A 4Q26A 3Q8AA 3PVNA 1MR5A 3A0NA 2UYAA 2WNUC 4BM8A 3RZHA 4MG2A 3QBQA 4LTAA 4FVVA 3OBZA 1GZCA 4JVAA 5GZGA 1FAYA 1SHWB 4PLMA 4LBQA 5H9PA 2V4AA 1A78A 1Q8OA 4IUGA 4ZXEA 5IAVA 5JOYA 4AGGA 4MHUA 1LOFC 4META 5F3CA 3AMPA 1W9FA 2J42A 1J3PA 2QQNA 2XJTA 4KNCA 3MZHA 1ENSA 1W6NA 2BVVA 2XONA 3ILFA 5FLHA 3E97A 1DF0A 1HV0A 1OF4A 1WZXA 2PHRA 3BB6A 3CJIB 4Z07A 2CDPA 3JB4C 2ES3A 4Q4W2 4RGGA 3TB0A 3WP3A 4AWDA 3DYPA 1Y9QA 2RS51 1GZ9A 3W5MA 1PVXA 2OQ7A 3ZYGA 4I09A 1ASJ1 3S5QA 3LEMA 1DYKA 1V70A 5GM0A 3VDDA 4DZGA 1NA1C 3NJYA 4J1WA 3WX5A 4GALA 2WWUA 3DEMA 3KT7A 4XHXA 2VMGA 4LITA 2WZR1 3V0AA 1TMF3 1GP6A 1C1LA 2ZOEB 1GQHA 4K20A 3IPVB 4E4HA 3WDWA 4AI0A 2VD7A 4Q8KA 1XU1A 3POGA 5KHJA 3NNMA 3MYXA 4XJUA 5H9SA 2VQ0A 3MIHA 2XLFA 5HI0A 2VGDA 3W5NA 2JE9A 4GA9A 2R49A 1GSLA 1YEWA 1BBT1 2DTWA 5JXHA 3T0BA 2QQPA 1PZ7A 4YYOA 2CV6A 4YW2A 1ZZCA 2C1FA 5ABJB 1A8DA 1HQWA 1VBA3 2BNOA 3RPQA 4DIQA 2BFUS 5IATA 2A7AA 3RS6A 1WBLA 2E53A 1UWWA 4QX1A 1A34A 1GU3A 4C0HA 3ZFGA 4CZSA 1RYYA 4AQ2A 4BWOA 4ZU7A 5FO8B 1OOPB 4QX5A 4IERA 2R1DA 3C8XA 1KFXL 5FBZA 2WABA 1W05A 3I8TA 5LA9A 4AF9A 1RUC2 4XFGA 4HOOA 1HN0A 2BV4A 2HWF1 3I2JA 1UNBA 2VZQA 2WT2A 2ET7A 1YHFA 4OI2A 2LRPA 5IJRA 5HBAA 5JOXA 5LB6A 3OF1A 3VL9A 5A32A 3HIFA 2HWD2 2D6PA 1AVBA 4I2OA 4COWA 1GZTA 1ZZ6A 3DKWA 4QQHA 3QH6A 2RR11 2VTXA 3HQXA 3PMEA 5ACA1 2UWBA 2EIGA 3RYKA 5HCHA 4XF1A 3WHUA 4LR4A 3IBMA 4PBOA 1VALA 2BEOA 4E8CA 1MEC1 3HNYM 4RS5B 3SNMA 1AXKA 1I5ZA 4JAAA 1AYM3 4KG8A 5FPLA 3OUIA 3KMHA 1UOJA 3PLQA 2XLAA 1O8PA 1ZNPA 4D94A 1W2OA 4HKWA 4IEYA 1QJX2 4MGQA 2MHFA 4QDRA 3S7IA 3VN4A 4GD4A 1HN1A 2XR4A 3PJQA 4QPIB 1D2SA 3W20A 4M0NA 4NJ4A 2BYVE 2FDJA 2RDRA 3J7LA 1JHJA 2DTYA 4BB3A 4ET7A 5ABJC 3N9MA 2D40A 4YRDA 5F5IA 1VB4A 4NIIA 1W8UA 1WBFA 3KCCA 2DFCA 3U1XA 4F8AA 2C6SA 4AGRA 2LM3A 2FZ1A 3FUOA 5FMDA 2ZX1A 4KGQA 1R082 2VW2A 2XMLA 4XC9A 1GR3A 1OOPC 5CG8A 5IK5A 2HWC3 4QPYA 4AZZA 2DF7A 4XPVA 1RUD3 2IWGB 1CESA 4PF1A 3VBRA 1OFNA 4RD7A 3RDIA 2ZGMA 4YGCA 3K2OA 2IXJA 4QQLA 3FUQA 4UFMA 1Z78A 5FP9A 3PVOA 1GZWA 3E1F1 4L9BA 3WT3A 2R072 3PUSA 3DL3A 2FBEA 5L7OB 4AVTA 1ND3A 2ADEA 3QLQA 1TE1B 2WSVA 5FREA 4Q4Y1 2XUEA 3DCQA 4P9YA 4NIAA 2WNOA 3O0WA 1RUF1 4Q5OA 3ES1A 2GALA 5ANNA 4S2GA 1QF3A 4PQ9A 1ZRFA 3HT2A 3GXUA 2W87A 2VR4A 5KHIA 1BMV2 5A70A 1H1IA 1ZBA1 1RUI2 1OPOA 4LORA 3GBGA 4J25A 4RS5C 2PHFA 3FHIB 1R1A3 3OJBA 3KGZA 4I3GA 4KWUA 3MW2A 4AVVA 5T55A 5AC91 1T6GC 4K7JA 3SC7X 5FOJB 4QPGB 4Q4X3 3OD4A 2E9QA 3IMMA 4MYEA 2XL9A 4PLOA 1PO23 2VQAA 1W2NA 2YB7A 4TN7A 5CYYA 4QPIC 2UWAA 1GWKA 1X8EA 4NOTA 5HCAA 5K7PA 1HRI3 1JHNA 2VOVA 3I2KA 2VZ3A 3DN7A 1OLMA 3NVCA 1FMD1 1H8VA 1Y43B 2P3IA 2RJ2A 3OSDA 4L97A 1CAWB 1GWLA 3NJXA 1D7PM 2VMCA 2AUYA 3KF3A 5CFDA 5J37A 3PTYA 1SLIA 1K12A 4URTA 5DUUA 2RS13 2WFF2 3BPSA 1JH5A 4KG0A 4XILA 2W1UA 4BDVB 2W46A 4QHOA 1UYPA 1RUOA 1VB2A 3PUHA 5FZ6A 3LFIA 3FL7A 3IDBB 1H4HA 2C26A 4CCOA 3BKZA 3U11A 3UJOA 2QTWB 2VU9A 1LR5A 5L7OC 1YXWA 3SXWA 4HL0A 4QXKA 1R64A 4SLIA 5FYIA 4KQ7A 1TNFA 3WXPA 1OF3A 2GMPA 1EV13 3WDUA 1HB4A 4JC1A 4QKFA 1BZWA 2GMMA 4NHXA 3SEEA 1B35C 2C0ZA 5EP9A 2Y26A 2LALA 3MUY1 4NE9A 4INDA 1JOBA 4PBPA 3WQ0A 1ZBE2 2ET1A 1AR92 1FXZA 2JB4A 3AP4A 3O1PA 2J1AA 1QJY2 1CX1A 1DCSA 4Z1VA 3MFAA 4LT5A 1Q43A 3ZYHA 1BBT3 1YJLA 1HLCA 1LGBA 4QPGC 2VW0A 3H7YA 1CAXB 4OZOA 1SLLA 1C4RA 1FPN1 3F2ZA 1N1YA 4FPEA 4RQPB 4JKKA 3WP4A 4DO0A 5IVFA 5LZ6A 2Y0OA 3GJAA 2DU1A 3B01A 2Q1ZB 3IWZA 5FZ0A 3CIHA 1U12A 2C24A 3HEIA 3GCXA 3ILNA 3M3IA 4I02A 4FAHA 4LBKA 5C8WA 3CU7A 2LTNA 4MGTA 5C71A 2GAUA 5JAXA 4RL7A 5CKMA 1KD7A 4L8QA 5J3UA 4HT1T 2E51A 4YG3A 2D7FA 1VBC2 2RM21 2VY0A 4LXLA 1UPSA 3O14A 2E33A 1HQNA 4CVUA 1QNWA 5JR7B 5CFCA 1NE4A 1F5JA 1W6OA 2ZX4A 1Y7BA 3VLBB 4Y5SA 3VV1A 3O1TA 2JDHA 1NYWA 1W3VA 2GNDA 1RUH2 2EA7A 2GH8A 2ERFA 3D0JA 4OMCA 1L7RA 3AZXA 4NPRA 4CDXA 5BV6A 2DV9A 4COVA 1W8FA 2JG8B 3OGJA 4Q1RA 5FZKA 4EN8B 4XFHA 5D21A 2QQJA 3I49A 1VBB2 4JQRA 2RR13 3WLUA 4GH4A 1L7QA 5ACA3 4LNVA 3GDBA 1UIJA 2PHTA 4IQPA 4RFRB 5J98B 3QH7A 3OGGA 1H1AA 2ZA9A 1TEIA 3W9AA 1AYN2 1MEC3 4A45A 2XPJA 5T5PA 4AL9A 3NNJA 5LBCA 1YWKA 3LOIA 4FPKA 4M4PA 2OYZA 1YQ5A 2F4PA 2YC4A 2DBIA 3AMNA 2TUNA 1H2NA 2YV8A 2D93A 3E6CC 3B94A 1PO12 3J9SA 1AX1A 5J09A 1XNDA 2R043 3JBG2 1ZYBA 4C90A 4QT6A 4LHSA 4RQPC 1NLSA 4Z2WA 5FLJA 4EN7B 2CAVA 3PUQA 1QWRA 3FFQA 2GNTA 1WGPA 2YDEA 2HKXA 3TAYA 3T30A 3BU7A 3HOBA 1C8NA 3DV8A 3FJSA 1S0GA 3PUAA 2DCJA 3CZUA 3WF1A 2Q8EA 4P08A 4AXOA 4FPOB 3JD73 4CUBA 1Z7S2 3QACA 4QX3A 1O3RA 1SBDA 5CA6A 2E7TA 4NHLA 3VBHA 2XJUA 3ZO0B 3P1IA 2EF6A 5EFUA 1E5RA 4Z2AA 2YYOA 4CCKA 2JDMA 2WA4A 3ZSLA 3UKNA 2R30A 3NO8A 1PNGA 4M4RA 3AX4A 3K48A 3TEYA 2JG8C 2Y6LA 5L9BA 4DS0A 5EPAA 4MGSA 3B5LB 3KQ4B 5IT6A 3N7MA 2I45A 4Q4Y3 3AKPA 4RA0A 4Y1ZA 1RUF3 4OLLA 5C5TA 3S7EA 5FDBA 1N47A 2DU0A 1ZRIA 2J22A 3NV4A 1ZBA3 4DNYA 3NJVA 4P9JA 1W6NB 1UO9A 2JDYA 4MGIE 3QCWA 3KZ4C 1JW6A 1XNTA 4LBJA 4N7IA 3LA3A 1OXCA 5AC93 1W28A 3MV01 3R05A 5LA1A 1UL9A 2RS31 1V0AA 2VNGA 5FQ0B 4LO4B 4XQWA 1IOAA 4DXZA 1CN1A 4CDQA 2WYSA 4MVTA 1SDWA 3NNGA 4FP3A 5FPZA 2W92A 1BHGA 1FMD3 2VECA 3C3VA 4CYDA 3HPNA 1H4GA 1YQ8A 2XLGA 1YFWA 4RYDA 4D8MA 5FMOL 2VJXA 1VPHA 4ISQA 4Q0UA 3POJA 4OQ8A 3CZJA 1OKOA 3MDPA 5FZMA 3ZSMA 3NAPA 2Q8CA 1QKQA 2GC0A 4PIXA 1WA4A 1VBE2 2PLV1 2VMEA 4LA2A 4X8PA 2WWSA 3OG2A 2NLRA 2XH6A 1W9WA 5DZEA 1MPXA 1WMEA 1N3OA 2VVFA 4LEJA 3RZGA 3E5XA 1ULCA 1GICA 4TZDA 3KT1A 5EYYA 2AEYA 1VMJA 1WCDJ 3DPRB 1K5MA 4JRLA 4CCLA 3WF4A 1TZOA 1W04A 2NN8A 4F7ZA 3BU0A 1PGW2 3I2IA 3X29B 4FT8A 4E27A 2B8MA 1LEMA 2H6BA 3ZIWA 1UYXA 2P1BA 1VR3A 2HWE1 2N7GA 1US3A 1AR62 2CU5A 2ZPXA 3I2DA 2QQMA 3I54A 1RJ8A 2GP5A 2XJSA 4IV1B 5DDJ2 2F4LA 4L99A 5C9AA 4YG6A 2W2IA 2XHKA 5DUVA 1W6PA 1IG0A 2ARBA 1O8SA 1PMJX 1WCUA 5A32B 5T5OA 3ZDSA 4COYA 2DVFA 1E5SA 4LHKA 1GYKA 2GZWA 3GZUC 5EWSA 4XJWA 1J83A 4MGYE 5LBEA 1BEV1 2R061 1YQ6A 1BMV1 1RUI1 5JCTA 1PIV3 2QFEA 3KV4A 4XJ9A 5JXGA 4FXGB 5JPMB 2SBAA 4K1ZA 2AR6A 1H8TB 1UY3A 5K4LA 2BZDA 3ZM8A 4ATFA 4D0QA 2SLIA 3B9CA 3JB8A 3O0XA 4PIYA 3WG2A 2AGSA 4HN1A 4E9KA 2DVAA 1S0CA 2FMDA 3K75B 4B4PA 2FMYA 2I74A 1OSGA 4G9SB 4AHZA 5KC6A 1QH7A 2RM23 5FZEA 4M00A 4OHWA 4N7UA 1ONAA 4HVRA 3ZFEB 4FPHA 2HLEA 3D3AA 5FYZA 5GJ6A 5A3OA 1WD4A 3SH3A 3VBFA 4BYYA 3SCHA 1S1AA 3WZ1A 5FPUA 2DFBA 1UN1A 4XJZA 1DQ0A 5T5JA 3WHTA 4K21A 4WM8B 1LB2A 3PIJA 4N9HA 5FZIA 1OD5A 2WQ4A 3GHNA 1G9BA 3WW3A 1WMDA 1NKGA 1UOBA 4QAWA 1UYYA 4EROA 2XWJB 3E6BA 3DPRC 3MF9A 1MZ5A 2XQRA 2ZGLA 4Y20B 3ZN6B 5I91A 4JGYC 4AEDA 5A7PA 4AVAA 3AM2A 1CAUB 1D4M1 4IE4A 4D69A 4QX0A 1V9U3 3AFGA 4UFJA 3DECA 5D8AA 1XNCA 3U75A 1LOAA 1J1LA 1UU4A 3WNLA 4DOUA 5A3LA 2ZEWA 4JRAA 4CEWA 1S2KA 1STMA 3Q8EA 1CIWA 3D82A 3UESA 3WP5A 2GC1A 1QH6A 1S0FA 4IV1C 5T52A 1GZWB 1OLME 2DVBA 3SITA 5LBBA 2AC1A 1HB2A 3IMNA 4BMBA 3N7JA 4KWJA 1WW7A 2JWPA 5T50A 3WNOA 5FZOA 4XIOA 1HDKA 1K3IA 1N1VA 3T2PA 1B09A 3ACHA 1AR91 4MSVA 1F35A 2Z2SB 4N43C 1H8TC 1QJY1 2ZTNA 3BODA 2BWAA 4PF5A 1G7YA 2D3RA 2PAKA 2HEVF 1FNZA 3I59A 3PVEA 1AF9A 1Q5OA 3AL5A 2PAMA 5IYYA 1MZEA 1UXZA 2GU9A 3AZZA 3I2HA 4TXWA 3UGHA 3O1VA 3A4UA 3N35A 4I30A 4FFIA 1JZ7A 3FHAA 3CQOA 1W0NA 1Y9MA 4MH0E 5F6KA 5FIXA 3QD6A 3KB5A 4OI4A 2CYFA 2CSGA 3H1YA 4HG6B 2BJSA 4CDWA 1SZBA 2G9ZA 5SV5A 4WVWA 4QXCA 4WM8C 1TME2 4ZU4A 1AX0A 2G19A 1S0IA 5FUIA 2X05A 1AL21 1ND2A 2D43A 1T6BX 2XBO3 1LEDA 1CJPA 1LTEA 4PT6A 5KXDA 2DCKA 1HV1A 3ELNA 2JDAA 5BNQA 4UBHA 2QNKA 1RUH1 3ST7A 1NQJA 3A23A 4TLFA 2VOXA 1UU5A 2R32A 4A2UA 3EMRA 5G04L 4BQ1A 3GNEA 5C3SA 1CPMA 4QMAA 1HJFA 1VBB1 3ZSJA 1JYWA 2QQUA 4M3CB 4D6RA 4KWLA 4QX2A 5JOZA 1W6QB 4JTNA 2W5FA 3RG0A 2RS33 4NWVA 4FTSA 5I0TA 2P5BA 1XQNA 1GNHA 5EIYB 5DG2A 2PTMA 1PHMA 5K0UB 3TN92 2BVBA 4DEQA 2IFWA 5JVVA 4N53A 4O61A 4LKDA 4YW6A 1COV1 2OS2A 1REFA 3D6EA 4ARYA 1D2QA 3IDAA 5JUVA 3MEPA 3H8OA 4UAPA 4KBBA 3WF3A 5EXOA 3JBG1 1AHSA 3PJYA 5FKBA 4BXFA 2PLV3 4IE6A 3IKWA 4QGMA 5FYTA 1PVC1 1UOGA 3GGLA 1MVQA 5BNPC 2Z69A 1JS9A 1JUIA 2W68A 4TWTA 1J3QA 5A7WA 1MS5A 2HWB1 1XRUA 5JMOA 3RQ0A 2EXIA 5CZKA 5E6HA 3FFZA 2QDNA 1APNA 2ZMLA 1RUG3 3KSCA 1QJU1 2LUWA 1X50A 2V09A 2ZABA 1PX3A 3S57A 4K8FA 1RHI2 3SISA 2VULA 2HWE3 1KFUL 5JI7A 3AZVA 2RDSA 1XXNA 1V6NA 2A5ZA 3KCYA 1JYNA 2ETEA 3LDBA 2RVAA 4P9WA 4NUBA 2ZMNA 2HBUA 4F3JA 1C5HA 4HSJA 1CR7A 3AYDA 5AFEA 5CISA 3KGLA 1HRV2 4QWNA 1AR72 3GM8A 5FP3A 5JZGC 1ULOA 2DCZA 2A70A 3HMYA 2YFZA 2QQLA 3K4ZA 5BNNC 4BE3A 3ETQA 3LZZA 3LWCA 1BEV3 2R063 3TBDA 2WC2A 1X82A 4GH4B 4A42A 2WQ8A 3VDAA 1ZX5A 4W8JA 2X53S 5K0UC 4XJAA 3H9AA 4LHNA 2JKXA 3GJBA 5FY1A 4TYSA 2OX0A 4GXLA 2Q0AA 1IZ3A 3T0DA 3MIBA 1OVSA 2JG9A 1IQDC 2ZX2A 4LO6B 1BCXA 4W6XA 2BTVC 3A0KA 4YLZA 4RHV1 5BY5A 1NCRC 1Z0HA 2WS93 4UWDA 2AEZA 2FCUA 1NUKA 4ASLA 1KQRA 5CAZA 1RC6A 3GZAA 4GWMA 2VZVA 3CF6E 2DUOA 4FFGA 4NHKA 1G9AA 1UMIA 3HR9A 4PDWA 1GP4A 3ZYIB 4OI1A 1W90A 1YYNA 3ROUA 3JCIA 2Y60A 2IXHA 2TNFA 1VBE1 3FC0A 4R52A 4EE2A 1V6LA 3RNSA 4IW3A 3WNMA 3GBWA 5F6LB 1D4M3 1VMHA 2PHUA 2X8KA 3WP6A 4AAXA 2WT1A 2W39A 1HXS2 1PM7A 1GFF2 1RUE3 3K51A 4JGZA 5F3IA 3VBHB 5K8SA 2V73A 3CLPA 4UFHA 1MACA 4NIDA 4HPKB 2QQOA 2TEPA 4EYUA 3U07A 2Z79A 3POFA 4Y1XA 4ZZ8A 1C5IA 4BCUA 1PGW1 1BLZA 1UY4A 3MIFA 1RMU2 3HD8B 3M70A 1Y4WA 3J8F1 4JTOA 2C9AA 2YPDA 4QU2A 3BCWA 2KM2A 5FJKA 3T0AA 1WUVA 2Q8OA 3OUHA 5EHDA 4AVCA 1RITA 3VBSA 4GH4C 3OYWA 1QQP2 2ZJCA 3N3HA 1P8JA 1AR93 2VCCA 2GC3A 4Y24A 3RMYA 5D2AA 4AI8A 1POV1 2ZHMA 4Y1YA 1YO8A 2YG0A 5FO7B 4Z92B 4NVPA 3CBNA 4JDMA 3WR0A 5KHHA 3E5UA 3IZOA 1BVP1 4R4ZA 1OVPA 4LO7A 3VBUA 2J7MA 1I5PA 3BPZA 4AQTA 5LCWL 5KXEA 5FRAA 4AQ6A 1YCIA 4ZONA 4WVZA 1W8HA 4XURA 5LA0A 1POQA 2XVLA 3WDTA 5C8CB 4CDQB 2RMU2 1GANA 2H6CA 1RVF1 2JKBA 3CJIC 5DXDA 4LKEA 3RFRA 5KBFA 3J7HA 1EP0A 1DIWA 2ZAHA 3USUB 4V1PA 3ZXJA 1UZVA 1AL23 5FXZA 1MQTA 1QDOA 1VAKA 4FSJA 4LKSA 1X9PA 4K8RB 2VQTA 3IDEA 1ULGA 1OH4A 4HSLA 4QKNA 3NAPB 1GNZA 1XNKA 4A44A 2C5DA 2VMFA 1PK6A 2J1EA 2D44A 1L3JA 2ZHKA 4LJHA 5JDBA 3M1HA 2YU1A 1VIWB 3GALA 2PXJA 4MOAA 4E2SA 5I93A 1NY72 1LULA 3ZXKA 1NCQB 3THCA 3T09A 1LGNA 3V0BA 3O1UA 4EWAA 2NP0A 4AFAA 3NNLA 3HT1A 3PUIA 1AJKA 1AXZA 2ZEYA 1W39A 3RZJA 4RR3A 3WD5A 3R6SA 1W9YA 1HQLA 2KD7A 3MIEA 4AI9A 1YI9A 3MW4A 3BYWA 4ES8A 1COV3 5JR2A 1RB8G 4D3WA 3ZKYA 2IVIB 2A3YA 4TLGA 4PI0A 4LHLA 3AK0A 2P2KA 5FYBA 1XJAA 3I3MA 2XVGA 1AR82 3N36A 3WCSA 3ITQA 2ZEZA 4LE3A 4QKDA 1LOCA 1N1TA 1NT0A 1J58A 5GZFA 4BH9A 4MO3M 2WRAA 2ZAAA 4N90A 4Z8BA 1UZ0A 1PVC3 4A41A 4WM7A 5BXXA 4AVBA 5F1RA 5FUPA 5J1XA 1S2EA 5C8CC 2FDFA 3WQBA 2HWB3 2VBBA 3OEBA 1QXRA 1GMMA 3ACLA 3VBOB 2MEV1 3VKOA 4B1LA 4XAEA 1KEXA 1SPPA 3M8LA 1QJU3 3THPA 4XFFA 2Q1FA 3KVAA 4Y3OA 2B5HA 2IZWA 2MNGA 5LBFA 1D4VB 3OUJA 1NLQA 3NAPC 4YGDA 3D0SA 1QJFA 1TME1 1PGL2 4NMIA 5A1AA 4Q4V2 3GBFA 4MXWB 1VAVA 2WLQA 1R092 5IWFA 4XFIA 1ZZ7A 3LDRA 5E8AA 3OPTA 2HEYF 5BPXA 3UK9A 3UYJA 1WD3A 1FOD1 4J6GA 4XABA 4B3NA 1VRH3 4DXRA 1C8M2 1NCQC 4QX7A 4FBFA 2C4XA 3QOPA 3WF0A 4DUWA 1ZA7A 3IB3A 3J7NA 3NV1A 4XFAA 2JB8A 3ZXLA 2A3WA 5LASA 1VMFA 3WNNA 1IS3A 5A6XA 5ANQA 4IV3A 4ITCA 2CWSA 3I3DA 2UU8A 1UZYA 2XB6C 5D8AB 1ACCA 1F4HA 4QX8A 2KR2A 3MI8A 1TG7A 3O12A 1F5FA 3WV6A 1US2A 4AQSA 1T2XA 3UGGA 3VKNA 5A6ZA 2BDRA 3FBMA 1MS1A 4G3YC 4CDUA 5F5QA 5FZHA 3L2HA 4GWIA 5E89A 4RHV3 4W6WA 3T2QA 3HNMA 3RZLA 1D0HA 5B4XA 2EVXA 4QKBA 2JICA 1LCLA 2VW1A 2X5IA 1DZTA 4BLJA 5A33B 4Q1PA 2QDRA 1FT9A 2IXIA 1WCSA 4IEPA 1LU1A 3AMHA 5CBLA 2RS53 1BK0A 4WVVA 4EZ4A 5L36A 1KXGA 1Q3EA 3VBOC 4AHXA 4DUXA 1ASJ3 1W0OA 4XZPA 4B1MA 1EAH1 1O4TA 3DYMA 1D0GA 2E32A 2P4EA 5A1LA 4LUKA 2FZ2A 2D6OX 3LOBA 1LOGA 2WZR3 2XGXA 3BVCA 2O1QA 4FPJA 5FYMA 4WVMA 1OD3A 3WUDA 2ZMKA 2FQPA 1RL3A 1JU4A 2VOWA 4NHMA 3RSJA 4CDWB 1G9FA 3KD4A 1TMF2 1SFNA 1OA4A 3WW1A 1VRBA 4O7XA 4NIGA 4AFBA 1LHUA 1DP0A 1RHI1 1ND2B 5H9QA 1YQCA 4AFDA 1KDMA 3J8F3 4R4XA 5A3WA 4C1WA 3WDVA 1QOSA 4BOWA 4GJYA 4IGQA 2EALA 2GP3A 4EZHA 1W8WA 3WF2A 3HN1A 4QM9A 2FDKA 4FQ4A 2JD4A 1BK1A 4YVWB 3PU8A 1JODA 1H9WA 1UF2C 5F3GA 5LA2A 2WNUA 4N9IA 4DINB 1U5ZA 4BPZA 1XSRA 2HJIA 2VZSA 1HRV1 4WV8A 1VBA2 1NAEA 1POV3 5FPAA 2RJLA 1SLTA 1DBNA 3RRDA 1J59A 2ADDA 1JZ6A 1LHVA 4QGNA 4ZS2A 5CB7A 4NWWA 2F17A 1LOFA 3AMMA 5FY4A 2ATFA 5LY1A 1KJRA 1VE0A 1S0EA 2HWF3 4Y26A 1ZA4A 1L7LA 3P3NA 2VNRA 4BK4A 1CGPA 2CGOA 1G9CA 2GH2A 3R4SA 2XKOA 4H3WA 2JE8A 4XUOA 4ASKA 2J1TA 1RVF3 5AVAA 2BBVA 4KBZA 1IKQA 2VAUA 4FOQA 4H14A 4LO8A 3WUCA 1UIKA 4CP2A 3M7AA 4H55A 5FOBB 3OEAA 1F31A 1NA1A 5GLVA 4ZHNA 2B9VA 2ZBJA 2DURA 4UW3A 4BXSV 4Q4W1 3BTYA 2OW4A 4PQQA 2VCBA 4XFBA 1OFSA 5A6YA 1XE0A 4DEVA 5CG9A 2Z5WA 5A7WB 5IFPA 1IS4A 3H0OA 3T08A 2GC2A 1AYM2 1UZZA 3OOXA 5F5AA 3WG1A 2DUPA 5F2SA 4MADA 3ZFFB 2VVEA 3AYCA 1OA2A 4YVWC 3PURA 4O9GA 1F4AA 3VKMA 5FZAA 2Q1MA 5JLVA 5A3NA 2GN3A 1RMU1 1UW8A 3AP7A 1CJDA 3ZMNA 4D7YA 4GULA 2VQUA 2WQZC 3ZYPA 4L0PA 4W50A 1WMXA 3VD3A 5F5CA 5C4WB 4XBQA 1DU3D 3ZPYA 3VKFC 4YM2A 1UAIA 1X36A 2LW8A 2HWC2 3LD8A 4FI9A 4GWNA 4HVOA 3UV9A 4CP1A 1MS4A 4OHVA 1RUD2 1JZ2A 2X09A 3IIAA 4MUVA 5FPXA 1X7NA 4QHBA 1LKNA 1W06A 2V5DA 3OY8A 1RUC1 2MEV3 2QUOA 5IW0A 1BYHA 1AL0G 2VUAA 1HIXA 2ZGNA 3A21A 3HWJA 1AJOA 3MUZ1 1RUJ2 1W8OA 4LBQB 2PYTA 4LMFA 1EPWA 4PIZA 3TYJA 5FR3A 1FYUA 5SV8A 3I97A 4JQTA 1HW5A 2PA7A 2HWD1 3IPVA 3H3ZA 3I4IA 5GZDA 2EXKA 3LE0A 3PTRB 1LOBA 2CL2A 4HANA 4K9SA 4H7LA 4LBOA 5IHRA 1FOD3 3JQXA 4KMQA 4UW6A 4BISA 2J1RA 2K9ZA 3B7MA 5IVVA 1E5HA 1XE7A 3ZXAC 3G7DA 3KQRA 3HNBM 3ZKUA 1O59A 1R1A2 2PELA 4XAAA 5FZCA 3MPPG 5FLIA 5HCFA 3AB0A 1JN2P 3M3CA 2BOJA 2B39A 3VDDB 3UNPA 3BI3A 5ABJA 2FDHA 1RXGA 4P00B 4MLOA 1WA6X 4Q4X2 2NQYA 2BWCA 3ZFFC 5ERLA 4FQZA 4KI5M 3V0AB 1PO22 2Y34A 1H0BA 4PJYA 5FYCA 4LLOA 1HRI2 4Q0PA 1QJX1 1LAJA 3U78A 3VZKA 4A3ZA 3SCGA 3VHOA 4Y22A 3ZIXA 1DZQA 3UL2A 2VPVA 2RHPA 2K46A 2QVSB 4HK9A 1OPMA 5DUXA 3NV2A 4EV0A 1JXNA 2NZ9A 2XJVA 4BA6A 5C4WC 4WZFA 1XYOA 3BOPA 3IT8A 1PZ8A 3M4FA 1DQ6A 2RS12 3WW4A 2ZKLA 4HKOA 3VD5A 1YC61 3OYWB 4IXLA 2KA3A 1UX7A 2P3JA 3RZZA 1R081 4CU6A 2W1WA 3NWKA 4MX3A 4DPNA 1AR81 5EJZB 1PMIA 3RMXA 2ZGUA 2B7YA 2R0HA 3ZFGB 4E2QA 4Q0SA 4PI2A 1OI6A 1XNBA 2CNAA 1ZZ9A 2Y6KA 4GB32 1EAH3 5CVRA 2JENA 2VCMA 1YRZA 2VXRA 3KCXA 4I3PA 2DWRA 4B8EA 1DQ2A 1HKDA 2VZ1A 3NQHA 2QKDA 4PLNA 1GKBA 5A3MA 3VBUB 4JDOA 4NR1A 5IVCA 4ZS3A 1UQXA 1OUXA 1RJ7A 1JZ3A 2R071 4AFCA 2V5YA 1DLLA 1EV12 1IS5A 4RS5A 2A71A 4XEZA 3FLRA 1SDDB 1KGYA 2ZZQA 1QGLA 4P5YA 3R4DB 2YU2A 5FXVA 3FE5A 5FP7A 5FZGA 3VHPA 3I2FA 4JKLA 5J96B 2EIEA 2PQQA 4QPIA 3ZR6A 3PMSA 2WWJA 4Z82A 1WLDA 4YZ4A 1FPN3 4GMP1 1SG3A 1IPKA 4Q4V1 1QJZA 3VDDC 1BBT2 3ORJA 4Y5Z0 4CXXA 5K9YA 5CIRA 1C57A 3U4SA 1QXPA 4XIKA 4HZFA 1XYNA 1C8M1 1HRV3 1SLCA 4FPGA 1J1TA 2ZEXA 3VZLA 4FCAA 1GQPA 3RJRA 1W3XA 1AXYA 4YFZA 3V0BB 2IXCA 1V6JA 4HBNA 2EXJA 1XSQA 3GYDA 4Y1VA 1MS0A 5FWEA 1WW4A 4C1XA 1QXJA 3EXUA 2UY9A 4A6SA 1ULDA 2OUJA 2A6WA 5E16A 4LA3A 3N9OA 1DQ4A 3ES4A 3VZOA 1XC6A 4QXHA 1O4ZA 3CKHA 3DXUA 3RJ2X 4XVHA 1NQDA 2K2SA 5DAWA 5L7OA 1CWPA 2WFF1 4AR2A 4UF0A 1J84A 2WUHA 3LQCA 3ZFGC 5KHKA 5IK8A 2UURA 2XG3A 5EQUA 3V64A 1MZFA 5C33A 1DGLA 3VD4A 4GZ9A 1YQ2A 2P6HA 2BERA 5JSRA 4QXBA 1B35A 3ALQA 3VBRB 2HH9A 3VBUC 4Q4W3 4B7KA 2RR12 3CNAA 3KV6A 4COZA 1BVVA 2A6VA 2PQSA 3ABZA 3G6JB 1X9TA 2PMWB 4A3XA 4DXSA 1DG6A 3FBYA 5ACA2 1V00A 2V72A 3LEKA 4QQPA 4CUCA 5FKCA 3H8RA 5DZFA 3ZR5A 5FYSA 5F8PA 1MEC2 1NZIA 4QPGA 2HYKA 1AUYA 1ND3B 5DAXA 5C6CA 3U37A 4R9DA 3J4UH 5HPOA 1PZ9A 2RG4A 4YW7A 4J1XA 2UWCA 1Q8VA 1ZBE1 3N9LA 2JIGA 1F9KA 4MHRA 4CCCA 4DFSA 5IVBA 1GQGA 2R042 5FP4A 4C91A 1ENXA 3PL0A 5FMOS 5GLTA 1H2KA 5JWPA 1CAWA 5DAVA 2UYBA 4XUPA 1NX9A 5DPNA 4BQ2A 2PN5A 1IS6A 1I6XA 4O65A 1W2AX 4Y33A 5L19A 1GBGA 3O1OA 1GLHA 2VC9A 4Q0QA 2BNMA 3ZFEC 1XNAA 1LHOA 3JD72 1MS3A 4C0BA 2IXKA 3EO6A 1PNFA 1UPIA 2Q4SA 3GHMA 1CAVA 2W0XA 3FWEA 1O5UA 3L9JT 5FO9B 1I1EA 2RDNA 1XB9A 3J26N 4H7MA 1M4WA 1ZREA 4BQ5A 1VBC1 1RUC3 1WWYA 1J3RA 3RVHA 3UKTA 4FXKB 4Y4YA 5CFDB 2BNNA 2OXBA 3I3QA 1F15A 2O8QA 5C3PA 4I0AA 4IEUA 1AZDA 5L9VA 4CDUB 4AYUA 1DYPA 4DUVA 4FPCA 2YY1A 1KS4A 1FNYA 4NROA 1KJLA 1DHKB 2HWD3 2MPFA 3N9QA 4Q4Y2 4XXAA 5LRRA 3VBRC 2OPWA 3AP6A 1TNRA 2X5IB 2R7EB 1RUF2 2YUEA 3ZLIA 3RZKA 5FBJA 1AX2A 5A1FA 2A75A 5FY8A 1O5LA 1ZBA2 3U0ZA 2W3JA 3AP5A 3WNKA 5H9RA 4F83A 4PHZA 2WDBA 3EHKA 3LA7A 4CCMA 1POV0 1ND3C 1NXD1 1CAXA 1Y9GA 2R16A 2ZX0A 4RQPA 3N9PA 5AC92 1OQ1A 3PVBB 4OI0A 4NRQA 1AYN1 1SFPA 1JYTA 4HKLA 3MF6A 4BQ4A 1UZWA 2CTVA 2O0OA 3RI8A 4WVMB 3DYOA 3ENRA 1WCQA 1O4YA 4NAOA 4D6SA 1PO11 4IL7A 1QJX3 3ME2A 4P9IA 4BQXA 2Y8KA 2IUWA 4CUGA 1FMD2 3ZYRA 1WLCA 1M06G 1PMHX 3I2GA 3WDYA 3HJRA 5KR7A 3O1MA 3LIGA 3MO4A 4UOJA 2CDOA 1EUUA 4XACA 1XBFA 3DKQA 2VOTA 2LROA 3BIEA 1U5YA 3S30A 4OHYA 3N7LA 3MGUA 2VZRA 1I3HA 1REDA 2YHJA 1R083 4CU9A 2WNUB 4KL1A 2JG8A 1XE8A 2BFUL 5GZEA 2ZKNA 2Y6JA 2OUHA 1Z7S1 3WCRA 2ORZA 4R8HA 4QB6A 1QOTA 3Q8CA 3NW4A 4YW1A 5HXVA 3VHNA 4KWKA 5CFDC 4AE2A 1YIPA 2VMHA 1EUTA 4XJ8A 2EIDA 2BRTA 4CRQA 1S0JA 5CFCB 4AW7A 1RUD1 3ZSKA 4CDUC 5FK7A 2BBAA 1W6OB 1IQAA 2R073 4DB5A 4CP9A 5FJHA 5JXJA 3ZXFA 4CU7A 4E4DX 1YFXA 3AKQA 4JKMA 3WQ1A 3AC0A 2VZTA 4CDXB 3EJKA 4OYUA 2PHWA 1U0AA 1XOYA 4AFMA 5ISLA 1URXA 3BOWA 4BQWA 1SMVA 4I0WB 3OPZA 1RUJ1 2L9LA 2Y6GA 2YC2A 4O9EA 3THTA 1OMIA 2WN2A 5FWJA 2JECA 3POSA 2BUKA 1NA1B 5AVPA 1EYBA 1QNYA 3KS7A 3VUOA 4YW5A 2VUCA 4GMP3 4YZ1A 1RUI3 2QJVA 1V6KA 5DUWA 4Q2FA 2OVUA 3BIWE 2WFPA 1C8M3 1REEA 3B93A 3M2MA 4K40A 2VZOA 3ECQA 3LGRA 4D6QA 4HK8A 1PIV2 1TVGA 2D97A 1SBEA 3VHRA 3WSOA 4AHWA 1JYIA 1ULFA 2A73B 3GZTB 1JZ8A 1QJEA 2OZJA 5M0TA 4XXPA 1U5XA 2BQPA 5KC5A 3T1LA 3R0RA 2JE7A 5LWBA 1CVNA 1W9TA 1PO21 3E6DA 2ZZJA 3FZ3A 3MW3A 4XDOA 3S6PA 1A3KA 1SCSA 2GNMA 3VGIA 3WG4A 1LENA 1I9RA 2P3KA 3SQOA 4RGAA 2O8OA 2WFF3 3JXSA 3WY6A 2DVDA 5A6QA 4P5HA 1PM4A 2NMNA 1LJ7A 4L11A 4U36A 4YM3A 2BP6A 3HQUA 2RS11 3M3EA 2W47A 2CGPA 4FTBA 3AVRA 2BGCA 1WLTA 3HAGA 4BJ0A 3NKGA 1QDCA 5CFCC 3SKJE 4Q8LA 3BUCA 4Y4RA 4HFSA 4GQ7A 4YZ2A 5FZBA 1V9U2 2X10A 4Q27A 1VP6A 2GN7A 2P17A 2AH2A 3I3BA 3CDZB 2YFUA 4CUAA 4E4ZA 4A7YA 3S5AA 3UGFA 1UY0A 1UMZA 4GB31 5G05L 4CDXC 1GV9A 2VTXJ 1Q8PA 1W2UA 3C7FA 2D6MA 2OZ6A 4NRMA 2EAAA 4XBLA 5E88A 3OY8B 2WN3A 4IDZA 4CXWA 5IVJA 5FQ0A 3ZPOA 1AR61 4IESA 1G8WA 2Y6HA 4EN6B 4CCNA 4D7SA 3N7KA 1Q8SA 2C9KA 5A7OA 5KXCA 4S2FA 1EV11 3APBA 5DAQA 2ILMA 3ZYJB 5DDJ1 1CPNA 1ZBE3 4AI1A 1ZRCA 1C28A 1BQPA 1JI6A 5A3PA 3DGTA 2BGPA 1QJY3 2XKPA 2ZHLA 3ZN4A 1WCKA 3LIHA 4R9BA 4CEYA 1K5JA 3ZYBA 2BPA2 4IE0A 3H8UA 1GUIA 2JDZA 4GJZA 1DGRN 1GWMA 2VBPA 2XOMA 4ARXA 3WDXA 3SCFA 5IVYA 2JIJA 4RN5A 3C2UA 5FXXA 4V2WA 2WZ8A 4ZPIA 3USSA 2VUJA 4XDQA 4ASMB 2FDIA 4ONUA 3WNPA 3FLPA 5JSPA 3A7QA 3PDQA 4B7EA 1FX5A 3DPRA 1VBC3 1QOOA 2YZ4A 5BNOA 1OA3A 1YFUA 4JGYA 4EN0A 1LU2A 4GIQA 3TEZA 3MLJA 4Y22B 1S0DA 5F3EA 5GZCA 3R4UA 1SLAA 4XUTA 3C7GA 1UY1A 2XBO2 1RUH3 1V6MA 2XXZA 5DAPA 3BTZA 3VBHC 4B4RA 4XDPA 2NMOA 1FV2A 3CEWA 4IV1A 3O5SA 3NJZA 3KV9A 2B4KA 4L2NA 1H2MA 4EJRA 1WLWA 3OPWA 4LLFA 5F9TA 5LRSA 3H8XA 1G6NA 1VBB3 1JU3A 2XUMA 1QY4A 4TSVA 1EY2A 1UU6A 3I2OA 4IE5A 4M3CF 4OUEA 1K5MB 2D5HA 1GOHA 3OGRA 5LEJA 3H50A 4RFT0 1QHDA 2WIIB 5AFBA 2J1VA 3WW2A 1OBNA 1W8TA 5DN2A 3S0MA 3N4MA 5FZ9A 3RYPA 3WEZA 5C3RA 2YC0A 1AYN3 2RS32 1X8MA 3POBA 2XJRA 3AKSA 3KWVA 4N43A 4DRRA 1H8TA 4FFFA 4FOVA 4LBMA 2K0GA 4RGKA 5KHGA 1U5IA 3V56A 4OCTA 1LODA 1V6IA 2QQIA 5C9AB 1PO13 5FYVA 4CXYA 1W6PB 1VBD2 3JBG3 3IAQA 3CMGA 4S2HA 1OT5A 5APAA 3OBAA 4LPLA 1W2TA 2NYYA 2ZGSA 4P9GA 3AKRA 4R9AA 4P9XA 1Q56A 1OHFA 2ARXA 2R041 3BALA 4EQVA 4WM8A 2PLV2 2W95A 3KVBA 3CHXA 4CDQC 2P37A 2B45X 3LAGA 1CQ9A 1W0PA 5HXMA 1MS8A 1QIQA 4AOCA 4C8DA 5FFOC 5FZ7A 1Z7S3 3AXDA 1N1SA 3ACGA 4Y20A 3IM0A 3OCPA 2J1UA 4P02B 3ZN6A 5HV4A 4QDQA 1JYXA 4A7KA 1CAUA 4YPJA 1KITA 3JD71 5FPVA 3KHBA 4P9LA 2G4IA 5CEHA 3NRUA 1RUG2 1ZM1A 5LY2A 4QPWA 3K3NA 4QB1A 1WKYA 3ILRA 3TEWA 3MV11 1OQDA 3VBFB 1XU2A 4IEZA 2HWE2 2WNVA 3WNXA 3KF5A 3ZXEA 4YGEA 4IGPA 5B4NA 1VLNA 4YVSA 5GALA 1CIYA 3OBRA 3MLKA 3W21A 4D7TA 4OFGA 1RUJ3 1VJ2A 2W91A 2D6NA 4LBLA 4UF0B 1K5MC 3T4VA 2D5FA 3FHQA 3PU3A 3VDCA 4NRPA 2WAOA 4AEDB 1ZZBA 3W58A 1EPZA 3O7OA 5JOWA 2ZGQA 1B35B 4XE9A 3AMQA 1BEV2 2E31A 2R062 3C7HA 2IVJA 1OH3A 1OKQA 1GNYA 4FPLA 4CEWB 5J48A 2DUQA 1SEFA 5FYYA 5A3TA 4NPMA 5I8YA 1LECA 5C9AC 4FOYA 3J7MA 4AGVA 5IK7A 4OUSA 3W59A 3ZYFA 5DQ0A 3FX3A 3AL6A 3TN91 4AG4A 3TOJA 5FZ3A 2ID4A 3SEPA 5BUVA 2E6VA 1Y3TA 1DLCA 1SFYA 2PAEA 2WL1A 4IEVA 5BNPA 3ON7A 2KXLA 1O91A 3OGVA 5EZWA 3DF0A 2DDUA 5FZOB 1NZCA 2WS92 3AFKA 1K45A 3T4HB 5EV7A 5FMBA 5F32A 5IUQA 2VMIA 5FK8A 1DQ1A 1H2LA 1UKRA 2WO3A 2E26A 2XL7A 2VVDA 3MIGA 5TSWA 1VBE3 3D4KA 1W6MA 3I59B 5IK4A 3LPGA 4R9CA 3MIDA 2W9XA 4HN0A 4HXCA 5FYHA 5JI9A 5T54A 2A1XA 3IAPA 5KWRA 2ZACA 2ENRA 2HBTA 1UY2A 2WNEA 3HVDA 5HCBA 4AK3A 3CO2A 3Q9OA 3T3YA 3CL1A 2Z4FA 4HLTA 4XUNA 1D4M2 4YARA 2VXJA 3VBFC 4A4AA 2VZUA 2P34A 1KRIA 2A3XA 2VZPA 4XF3A 1CAVB 3D5OA 5FY5A 1RUE2 2OIIA 5JZGA 3LEGA 2H0VA 1H6YA 4GB33 4CP0A 4M3CA 5I0UA 2R6QA 5LATA 5DZGA 5CKQA 4HETA 5GLZA 3WVJA 5BNNA 1W6QA 1LGCA 2P6CA 5FUNA 1O3QA 1AR63 1H1MA 2GDFA 4LQRA 2WINB 3NKTA 4LK7A 4PCRA 4IE7A 4AEDC 5A3UA 5K0UA 3H3LA 4YZ5A 1OLRA 5DDJ3 3ATGA 3ETPA 5D8AC 4IETA 3EQEA 4IGOA 4LKFA 1CD3G 1AR71 1CX4A 2E63A 1JOPA 4CEWC 4K1YA 2PHXA 2FCTA 3HN3A 1JOJA 1IGOA 3LEIA 5A7NA 4AEJA 4YVWA 1SLBA 2ZGTA 4GKYA 5C3QA 1QEXA 1E5IA 1NCRA 3MLLA 1V6OA 4IEWA 2XVKA 2DCYA 2PHDA 5J7MA 1BKZA 2Q5TA 1F8VA 3V65A 1YLLA 5A7QA 3VDBA 2WSUA 5FYUA 4YWAA 5FXWA 3SKVA 2A6XA 1NOVA 5FCCA 4K6BA 2WT0A 1ST8A 5I0SA 4YNIA 2H0BA 1PIV1 2VOKA 4UI9L 1VAMA 1WW6A 4COUA 4XF4A 4W65A 4N53B 3ZX7A 3EYPA 3LFMA 2WLPA 1KDKA 2Y33A 3F95A 3VZNA 3GF6A 4JHTA 4EN9B 1BJQA 1N3QA 4AI2A 3POWA 4CCEA 5CKNA 2PFWA 5I0DA 1IG3A 1IHMA 1G9DA 1RUNA 4B4QA 5LK7B 1O3SA 2CWMA 2LS6A 1AL22 1QMJA 4CTEA 4ORFA 4CPBD 4BIFA 2DVGA 5DMYA 4UBGA 4DXTA 1YIFA 3HBKA 4XW3A 4NIHA 1LHNA 2W1QA 4N8MA 1ZRRA 1ULEA 3VD7A 3ZXDA 1TQ5A 1CZTA 4CDWC 2WKKA 4GKXA 3B02A 4GMP0 5BYNA 2W94A 1HJGA 1FI2A 2G9FA 2QE3A 3KT4A 2W08A 1ND2C 3LSDA 4GWJA 3TWIA 3HBZA 1HXS1 2VM9A 4NO4A 4QD2A 4LO5B 1JMUB 4FP2A 2JDKA 3THDA 3URFA 2AREA 3RZMA 1O6UA 3WG3A 3HQRA 4ZZ5A 1V9U1 3C7EA 4NAMA 1NLRA 4A6OA 1FV3A 1ENRA 3MICA 2OT7A 1O7FA 4AEKA 3AJZA 2D98A 1H9PA 2NM1A 4CP9B 3BTAA 3EBRA 3AKTA 2FCVA 2VNVA 2UY8A 3SH5A 4XETA 3OB8A 3K4DA 1Q8QA 5I8TA 1COV2 4JDNA 1S4CA 3U10A 4NPLA 4CPBA 1QQP1 1ULPA 4FAGA 1UKGA 2ZXQA 1JBCA 4XTPA 1JYCA 4FOWA 2XQXA 3CJIA 4AEMA 2RDQA 3LB9A 4M0HA 4BQ3A 4UXAA 3IDCB 4XQDA 2HEWF 4UT5A 1PVC2 1PGSA 2YBPA 4N53C 3AZYA 3KV5A 4LIUA 1LESA 5A7SA 1JZ5A 4E2GA 2HWB2 2Y64A 3DUIA 4XYXA 3SMHA 3T2TA 4URAA 5IFTA 1DYOA 2JG9B 4MGZE 2Y38A 1NE6A 1E57A 1SBFA 5FZ4A 5T3NA 3OTFA 3AJYA 1CONA 1GOGA 2RMU1 2VMDA 3EB7A 2DBNA 1A8MA 2AZ5A 1QJU2 1TME3 4YSFA 3ZN5A 2W52A 3UETA 5I0RA 4HPKA 4S2DA 2CHHA 4FO9A 5FTTC 2I07B 3ZDVA 4XMAA 1G86A 2VL4A 3AXEA 2QZ3A 1RINA 4LULA 4PDWB 4DMIA 3NV3A 1UD1A 4HMZA 4X8NA 4YZ3A 4ZU5A 2XBO1 2D6LX 1VRH2 1UXXX 1JYVA 2J1SA 4CCJA 1N3PA 3PIGA 4KH9A 2Q30A 3AZWA 1NY71 1ZZ8A 2Q8DA 4WBBA 3BTXA 2VG9A 3MFCA 5FAXA 4JGZB 3LDKA 5JSOA 4LOSA 2GMEA 3B69A 5GLUA 3WQ7A 2WO2A 2OKXA 3U14A 3OD0A 4YG0A 2QZ2A 4XF9A 1OOPA 1YFYA 4MXVA 4HONA 3KLSA 3TEXA 1RXFA 2VH9A 2ZCWA 4V2VA 2VO5A 4X6RB 3RI9A 5E1RA 4EWDA 3NNFA 4ISRA 3TN93 3FLTA 2A6YA 5FY0A 5C3OA 4W6YA 3INAA 4FPFA 5F37A 5C8CA 4IEXA 4JZRA 4MV2A 4M01A 4XHBA 3VBSB 4RHV2 3WINE 4ATEA 1O3TA 3LSEA 3USUA 4AI3A 2ZS6B 1IPJA 2JDNA 3LKJA 4ES9A 2BU9A 1VBD1 3FN9A 2IC1A 4EWEA 4XF0A 3TNQA 1OURA 4CEYB 3O1SA 2EIBA 2RS52 2ZGOA 1YJKA 1JUHA 1BXHA 4GAZA 4QU1A 2RE9A 2JG9C 5CU1A 5JIUA 1ASJ2 1UX6A 1SACA 2XHNA 1GOFA 5LW9A 5J36A 3T1MA 4FFHA 5D1IA 2G9GA 1S2BA 2ARAA 1XYPA 3B9IA 4XMIA 3SH4A 2WO1A 2WZR2 2IFRA 1NCQA 3UT0A 4XCBA 1W8ZA 3ZSEA 4IEQA 4UYBA 4YM1A 4OULA 4PDWC 1A6CA 4JCKA 3I7DA 1RHI3 4UW5A 4NN0A 1GP5A 3AP9A 5BNOB 1QU0A 2EXHA 1MQTB 5F39A 1RUG1 4JGYB 1PGL1 3SHRA 5EJ3A 2G1MA 3LCPA 1R091 3J8F2 4U2AA 2Y6FA 2WZEA 2QCSB 2YGMA 1PK6B 2GSYA 3D8CA 4RSUA 4YW4A 3TRSB 4QDSA 1YNAA 4JGZC 2BGOA 1AR73 2WO7A 3A22A 1WW5A 3SLIA 4MGKE 3H7JA 1MVEA 3MBWA 4JV4A 5F2WA 3RWKX 1H6XA 4FTEA 1PX4A 2WA3A 3TNPB 1W99A 4XZUG 2PHLA 4QQ2A 3P5BA 3BGAA 2R0FA 2WYFA 1HX6A 5EJ1B 1XPWA 3UJQA 5FV3A 1UYZA 1LNSA 1S55A 2XDVA 3OBTA 4BU2A 1DQ5A 4IEOA 2GNBA 4RR3B 1RTVA 3H3UA 3VBSC 2HWF2 4N43B 3E5QA 2WJSA 2D6KA 2YROA 3VBOA 5GKAC 3Q8FA 4BQYA 5KXBA 1X33A 4Y5TA 1RVF2 1H30A 5L9RA 2B9UA 2OPKA 3O1RA 3B3QE 4UW4A 3AYEA 3AYAA 4QHZA 4CEYC 5CNAA 2CGNA 4FPYA 2AACA 5FZ1A 2WAAA 2ZX3A 4LK6A 4DY3A 2WS91 4BIOA 3K77A 4G4FA 4JHZA 1IKPA 2EAKA 3POEA 4MXWA 3GZEA 3UKVA 4WM7B 2VBDA 2YBKA 1RGSA 4KU7A 1C3HA 5LK5A 5FMCA 2A6ZA 4LIVA 1F2NA 4AHYA 4I0BA 2D3SA 2ZGRA 3ZOIA 3BN6A 4W4ZA 3C7OA 1HXS3 1SPPB 2QBXA 5EYXA 1MQTC 4DY5A 4HVQA 4OZXA 5BNOC 4CA9A 3MHZA 1UMHA 4OVEA 4YM0A 4BLIA 4XQ4A 2X29A 2YXSA 3JZVA 3IIIA 3VZJA 5HV0A 1W03A 2O14A 1TMF1 2TBVA 1RUE1 3NMBA 3Q8BA 1PK6C 2E7QA 5JMCA 4AVSA 1DFQA 1LRHA 5F7UA 1RMU3 1W9SA 2YMZA 1DGRA 2WNVB 3K4AA 3MPBA 2JJ6A 3N9NA 2DCTA 3KHCA 2ZGKA 4YVSB 3M3QA 5FZDA 3POIA 4LOTA 1OC1A 4OUMA 1YI7A 3P3PA 1QQP3 3PNAA 3KM5A 1UOFA 1SCRA 4XCAA 1VBA1 1ODNA 2QQWA 3ACIA 4IV3B 3FMGA 5A33A 5A80A 4JX0A 4E8DA 5LEKA 3OGSA 2QQVA 1NXMA 4BHPA 1YUDA 4RR3C 3JUUA 4ZKTB 4QGLA 5FP8A 1ENQA 3H42B 3ZVXA 1SQ4A 4OHZA 3VL8A 5CADA 3H1MA 1LHWA 2VTFA 4SBVA 4QQOA 2Y0IA 4M3CE 4YFWA 5JIAA 2MEV2 2RV9A 4YGBA 3P6BA 2YGLA 2RMU3 2F6BA 5IVEA 3NSTA 4QM8A 4AAPA 4OQ9A 5BNPB 3DXTA 3CJXA 2P3YA 4NHYA 1IPSA 3ZXGA 4WM7C 4QB2A 2XJQA 1UCXA 1NG0A 4XBNA 5FPBA 2CAUA 1ALYA 2BOIA 2Z42A 5L73A 2JEMA 2JDUA 2XWBB 1JZ4A 4KGGA 1FOD2 5JXIA 3JU9A 1W6MB 2WZPP 3I3EA 4H2AA 2WBKA 4BMEA 3RYRA 4K3UA 5GLWA 3LF7A 1RIRA 4DQAA 2JD9A
chains in the Genus database with same CATH topology
2I2SA 5T5LA 2XJPA 4BZ4A 1ZRDA 4Q0VA 4E4SA 1ZVFA 1AYM1 1LOEA 3PHMA 2ZHNA 2WNVC 5JZGB 4DRVA 3O0VA 4YVSC 1KS5A 3RWNA 5BNNB 5JPNB 4MZUA 4XFCA 4Q29A 3NL1A 4KU8A 4IV3C 1OLQA 2B42B 4LE4A 1AR83 2AENA 2YPJA 1VBD3 4LUMA 4WZCA 1DGWA 2BW8A 4P14A 3JQWA 2AYHA 2HWC1 1DGWX 5DG1A 3WOGA 2RJKA 2CY6A 1NCRB 1DZRA 3IN9A 2B46X 2R1BA 1EAH2 4B29A 1WMFA 2NPIA 4A7ZA 2X5IC 1R1ZA 3H1WA 1C1FA 2E7AA 3VZMA 2FHRA 2JXAA 2VNOA 2DYCA 4OHXA 4L92A 1OQEA 1DDLA 4LBQD 2OA2A 3LA2A 3M3OA 4Q4V3 3ZFFA 2D3PA 4ZXKA 4XTMA 1R093 4LBNA 1S0BA 1FPN2 4X6QB 5B2GB 2IXLA 4Y1UA 3VKLA 1R1A1 1MZ6A 1VRH1 4XOGA 2ZGPA 3B00A 1JTZX 5C4WA 4YW3A 4Q4X1 1FATA 2JX9A 3U4XA 3ASIA 2RM22 3ZMOA 3L2YA 5I8SA 3POYA 1MS9A 1HRI1 4I01A 4Q26A 3PVNA 1MR5A 3A0NA 2UYAA 2WNUC 4BM8A 3QBQA 4LTAA 4FVVA 1GZCA 4JVAA 5GZGA 1FAYA 4PLMA 4LBQA 5H9PA 5JOYA 1A78A 1Q8OA 4AGGA 1LOFC 4META 3AMPA 1J3PA 2XJTA 3MZHA 4KNCA 1ENSA 1W6NA 2BVVA 5FLHA 3ILFA 3E97A 1DF0A 1HV0A 2PHRA 3CJIB 4Z07A 3BB6A 3TB0A 4AWDA 3JB4C 4Q4W2 2ES3A 4RGGA 3WP3A 1Y9QA 2RS51 1GZ9A 1PVXA 3ZYGA 4I09A 1ASJ1 1DYKA 1V70A 5GM0A 3VDDA 4DZGA 1NA1C 4J1WA 3WX5A 4GALA 3KT7A 4XHXA 2VMGA 2WZR1 3V0AA 1TMF3 1C1LA 2ZOEB 1GQHA 4K20A 3IPVB 3WDWA 4AI0A 4Q8KA 1XU1A 5KHJA 4XJUA 3MYXA 5H9SA 2VQ0A 3MIHA 2XLFA 5HI0A 2VGDA 2JE9A 4GA9A 2R49A 1GSLA 2DTWA 1BBT1 2QQPA 1PZ7A 4YYOA 2CV6A 4YW2A 1ZZCA 2C1FA 5ABJB 1A8DA 1HQWA 1VBA3 2BNOA 3RPQA 2BFUS 2A7AA 3RS6A 1WBLA 2E53A 4C0HA 3ZFGA 4CZSA 4AQ2A 4BWOA 4ZU7A 5FO8B 1OOPB 4QX5A 4IERA 2R1DA 1KFXL 5FBZA 4AF9A 3I8TA 1RUC2 4XFGA 2HWF1 2WT2A 2ET7A 1YHFA 4OI2A 5HBAA 5JOXA 3OF1A 3VL9A 5A32A 3HIFA 2HWD2 2D6PA 1AVBA 4I2OA 4COWA 1ZZ6A 3DKWA 4QQHA 3QH6A 2RR11 3HQXA 3PMEA 5ACA1 2UWBA 2EIGA 3RYKA 4XF1A 3WHUA 4LR4A 3IBMA 4PBOA 1VALA 2BEOA 1MEC1 4RS5B 3SNMA 1AXKA 1I5ZA 4JAAA 1AYM3 4KG8A 3KMHA 3PLQA 2XLAA 1ZNPA 4D94A 4HKWA 4IEYA 1QJX2 3S7IA 2MHFA 3VN4A 3ZFEA 4EROA 5I91A 4QPIB 3PJQA 1D2SA 4M0NA 2BYVE 5ABJC 2DTYA 2D40A 4YRDA 1VB4A 1WBFA 3KCCA 2DFCA 4F8AA 4AGRA 2LM3A 2FZ1A 3FUOA 2ZX1A 4KGQA 1R082 2VW2A 1GR3A 1OOPC 5CG8A 5IK5A 2HWC3 4QPYA 2DF7A 4XPVA 1RUD3 2IWGB 1CESA 3VBRA 1OFNA 4RD7A 3RDIA 2ZGMA 4YGCA 4QQLA 2IXJA 3FUQA 1Z78A 3PVOA 1GZWA 4L9BA 3WT3A 2R072 3DL3A 2FBEA 5L7OB 4AVTA 1ND3A 3QLQA 1TE1B 2WSVA 5FREA 4Q4Y1 4P9YA 3O0WA 1RUF1 3ES1A 2GALA 4S2GA 1QF3A 4PQ9A 1ZRFA 3HT2A 1BMV2 1H1IA 1ZBA1 1RUI2 1OPOA 3GBGA 4RS5C 2PHFA 3FHIB 1R1A3 3OJBA 3KGZA 4I3GA 4AVVA 3MW2A 5T55A 5AC91 1T6GC 4K7JA 5FOJB 4QPGB 4Q4X3 3OD4A 2E9QA 4MYEA 2XL9A 4PLOA 1PO23 2VQAA 4QPIC 2UWAA 1X8EA 4NOTA 5HCAA 5K7PA 1HRI3 1JHNA 2VOVA 3DN7A 3NVCA 1FMD1 1H8VA 1Y43B 2P3IA 4L97A 1CAWB 5CFDA 2AUYA 5J37A 3PTYA 1SLIA 4URTA 5DUUA 2RS13 2WFF2 4KG0A 1JH5A 4XILA 1RUOA 1VB2A 3IDBB 1H4HA 3U11A 3UJOA 2VU9A 1LR5A 5L7OC 1YXWA 3SXWA 4HL0A 4QXKA 4SLIA 4KQ7A 1TNFA 3WXPA 2GMPA 1EV13 3WDUA 4JC1A 1BZWA 2GMMA 1B35C 2C0ZA 2Y26A 2LALA 4INDA 4PBPA 3WQ0A 1ZBE2 2ET1A 1AR92 1FXZA 3AP4A 1QJY2 4Z1VA 3MFAA 4LT5A 1Q43A 1BBT3 1YJLA 1HLCA 1LGBA 4QPGC 2VW0A 3H7YA 1CAXB 1SLLA 1C4RA 1FPN1 4FPEA 1N1YA 4RQPB 3WP4A 2Y0OA 3IWZA 2DU1A 3B01A 2Q1ZB 1U12A 3M3IA 3ILNA 4FAHA 4I02A 5C8WA 4LBKA 3CU7A 2LTNA 2GAUA 5JAXA 4RL7A 1KD7A 4L8QA 5J3UA 4HT1T 2E51A 4YG3A 2D7FA 1VBC2 2RM21 2VY0A 5CFCA 1UPSA 3O14A 1HQNA 1QNWA 5JR7B 1NE4A 1F5JA 1W6OA 2ZX4A 1Y7BA 3VLBB 3VV1A 1NYWA 2GNDA 1RUH2 2EA7A 2GH8A 2ERFA 3D0JA 4CDXA 5BV6A 3AZXA 4NPRA 2DV9A 4COVA 2JG8B 3OGJA 4Q1RA 4EN8B 4XFHA 1VBB2 4JQRA 2RR13 3WLUA 4GH4A 5ACA3 4LNVA 1UIJA 2PHTA 4IQPA 5J98B 3QH7A 3OGGA 1H1AA 2ZA9A 1TEIA 3W9AA 1AYN2 1MEC3 2XPJA 5T5PA 1YWKA 3LOIA 4FPKA 2OYZA 2F4PA 3AMNA 2TUNA 1H2NA 2YV8A 2D93A 3E6CC 3B94A 1PO12 3J9SA 1AX1A 5J09A 1XNDA 2R043 3JBG2 1ZYBA 4C90A 4QT6A 4RQPC 1NLSA 4Z2WA 5FLJA 4EN7B 2CAVA 1QWRA 3FFQA 2GNTA 1WGPA 2YDEA 2HKXA 3TAYA 3BU7A 1C8NA 3DV8A 3FJSA 1S0GA 2DCJA 4AXOA 4FPOB 3JD73 1Z7S2 3QACA 1O3RA 1SBDA 5CA6A 2E7TA 4NHLA 3VBHA 2XJUA 3ZO0B 2EF6A 5EFUA 2YYOA 2WA4A 3ZSLA 3UKNA 2R30A 3NO8A 1PNGA 3AX4A 3K48A 2JG8C 4DS0A 3B5LB 5IT6A 3N7MA 2I45A 4Q4Y3 3AKPA 4RA0A 4Y1ZA 1RUF3 4OLLA 3S7EA 5FDBA 1N47A 2DU0A 3NV4A 1ZBA3 4DNYA 4P9JA 1W6NB 4MGIE 3QCWA 3KZ4C 1JW6A 4LBJA 4N7IA 3LA3A 5AC93 3R05A 1UL9A 2RS31 2VNGA 5FQ0B 4LO4B 4XQWA 1IOAA 4DXZA 1CN1A 4CDQA 4MVTA 1SDWA 4FP3A 5FPZA 3C3VA 1FMD3 2VECA 4CYDA 1H4GA 2XLGA 1YFWA 5FMOL 4ISQA 4Q0UA 3MDPA 3ZSMA 3NAPA 1QKQA 2GC0A 4PIXA 1WA4A 1VBE2 2PLV1 4LA2A 4X8PA 2WWSA 2NLRA 2XH6A 5DZEA 1WMEA 1N3OA 2VVFA 4LEJA 3E5XA 1ULCA 1GICA 4TZDA 3KT1A 5EYYA 4JRLA 1WCDJ 3DPRB 4F7ZA 1K5MA 2NN8A 1PGW2 3X29B 4FT8A 4E27A 2B8MA 1LEMA 2H6BA 3ZIWA 1VR3A 2HWE1 2N7GA 1AR62 2ZPXA 3I2DA 3I54A 1RJ8A 2XJSA 4IV1B 5DDJ2 5C9AA 4L99A 4YG6A 2XHKA 5DUVA 3ZDSA 1W6PA 5A32B 2ARBA 5T5OA 4COYA 2DVFA 4LHKA 1GYKA 2GZWA 3GZUC 5EWSA 4XJWA 4MGYE 1BEV1 2R061 1BMV1 1RUI1 5JCTA 1PIV3 2QFEA 4XJ9A 5JPMB 4FXGB 2SBAA 4K1ZA 2AR6A 1H8TB 4ATFA 2SLIA 3B9CA 3JB8A 3O0XA 4PIYA 3WG2A 2AGSA 4HN1A 4E9KA 2DVAA 1S0CA 2FMDA 4B4PA 2FMYA 2I74A 1OSGA 4G9SB 4AHZA 5KC6A 1QH7A 2RM23 4M00A 4OHWA 4N7UA 1ONAA 4HVRA 3ZFEB 4FPHA 4BYYA 5GJ6A 3SH3A 1WD4A 3VBFA 3SCHA 1S1AA 3WZ1A 2DFBA 1UN1A 4XJZA 1DQ0A 5T5JA 3WHTA 4K21A 4WM8B 1LB2A 4N9HA 1OD5A 2WQ4A 3GHNA 1G9BA 3WW3A 1WMDA 2XWJB 3E6BA 3DPRC 3MF9A 1MZ5A 2ZGLA 4Y20B 3ZN6B 4JGYC 4AEDA 4AVAA 3AM2A 1CAUB 1D4M1 4D69A 1V9U3 3AFGA 5D8AA 1XNCA 1LOAA 1J1LA 1UU4A 4DOUA 5A3LA 4JRAA 4CEWA 1S2KA 3WP5A 1CIWA 3D82A 2GC1A 1QH6A 1S0FA 4IV1C 5T52A 1GZWB 2DVBA 3SITA 3IMNA 4BMBA 3N7JA 4KWJA 1WW7A 5T50A 4XIOA 1HDKA 1N1VA 1B09A 4MSVA 1AR91 2Z2SB 4N43C 1H8TC 1QJY1 2ZTNA 3BODA 2BWAA 4PF5A 1G7YA 2D3RA 2PAKA 2HEVF 1FNZA 3I59A 3PVEA 1AF9A 1Q5OA 2PAMA 1MZEA 2GU9A 3AZZA 3A4UA 3N35A 4I30A 4MH0E 5F6KA 3QD6A 3KB5A 4OI4A 2CYFA 3H1YA 4CDWA 5SV5A 4WVWA 4WM8C 1TME2 4ZU4A 1AX0A 1S0IA 1AL21 1ND2A 2D43A 2XBO3 1LEDA 1CJPA 1LTEA 5KXDA 2DCKA 1HV1A 3ELNA 5BNQA 4UBHA 2QNKA 1RUH1 3ST7A 1NQJA 4TLFA 2VOXA 1UU5A 2R32A 4A2UA 4BQ1A 3GNEA 1CPMA 4QMAA 3ZSJA 1VBB1 4M3CB 4KWLA 5JOZA 1W6QB 4JTNA 3RG0A 2RS33 4NWVA 4FTSA 5I0TA 1XQNA 1GNHA 5DG2A 2PTMA 1PHMA 5K0UB 3TN92 2BVBA 2IFWA 5JVVA 4N53A 1COV1 1REFA 3D6EA 1D2QA 3MEPA 4KBBA 5EXOA 3JBG1 1AHSA 3PJYA 2PLV3 3IKWA 4QGMA 1PVC1 1MVQA 5BNPC 2Z69A 1JUIA 2W68A 4TWTA 1J3QA 1MS5A 2HWB1 1XRUA 3RQ0A 2EXIA 3FFZA 2QDNA 1APNA 2ZMLA 1RUG3 3KSCA 1QJU1 2LUWA 1X50A 2V09A 2ZABA 4K8FA 1RHI2 3SISA 2VULA 2HWE3 1KFUL 5JI7A 3AZVA 1XXNA 1V6NA 2A5ZA 3KCYA 2ETEA 4P9WA 2ZMNA 4F3JA 1C5HA 4HSJA 1CR7A 3AYDA 5AFEA 3KGLA 1HRV2 1AR72 5JZGC 2DCZA 2A70A 3HMYA 5BNNC 4BE3A 3ETQA 3LZZA 3LWCA 1BEV3 2R063 3TBDA 2WC2A 1X82A 4GH4B 1ZX5A 2X53S 5K0UC 4XJAA 3H9AA 4LHNA 4TYSA 4GXLA 2Q0AA 1IZ3A 3MIBA 2JG9A 4LO6B 2ZX2A 1BCXA 4W6XA 2BTVC 3A0KA 4YLZA 4RHV1 5BY5A 1NCRC 1Z0HA 2WS93 4ASLA 5CAZA 1KQRA 1RC6A 3GZAA 4GWMA 3CF6E 2DUOA 4NHKA 1G9AA 3HR9A 4PDWA 3ZYIB 4OI1A 1YYNA 3ROUA 3JCIA 2IXHA 2TNFA 1VBE1 3FC0A 4R52A 1V6LA 3RNSA 3GBWA 5F6LB 1D4M3 2PHUA 2X8KA 3WP6A 2WT1A 2W39A 1HXS2 1PM7A 1GFF2 1RUE3 3K51A 4JGZA 3VBHB 2V73A 3CLPA 1MACA 4HPKB 2TEPA 3U07A 2Z79A 4Y1XA 1C5IA 4BCUA 1PGW1 3MIFA 1RMU2 3HD8B 3M70A 4JTOA 3J8F1 2C9AA 4QU2A 3BCWA 2KM2A 1WUVA 2Q8OA 4AVCA 1RITA 3VBSA 4GH4C 3OYWA 1QQP2 2ZJCA 3N3HA 1AR93 2GC3A 4Y24A 3RMYA 4AI8A 1POV1 2ZHMA 4Y1YA 1YO8A 5FO7B 4Z92B 4NVPA 4JDMA 3WR0A 5KHHA 3E5UA 1BVP1 4R4ZA 4LO7A 3VBUA 3BPZA 4AQTA 5KXEA 5FRAA 4AQ6A 1YCIA 4WVZA 2XVLA 3WDTA 5C8CB 4CDQB 2RMU2 1GANA 2H6CA 1RVF1 2JKBA 3CJIC 5DXDA 5KBFA 1EP0A 1DIWA 2ZAHA 3USUB 4V1PA 3ZXJA 1AL23 1MQTA 1QDOA 1VAKA 4FSJA 3IDEA 1ULGA 4HSLA 3NAPB 1GNZA 1XNKA 2C5DA 1PK6A 2D44A 1L3JA 2ZHKA 5JDBA 3M1HA 1VIWB 3GALA 4E2SA 5I93A 1NY72 1LULA 3ZXKA 1NCQB 3V0BA 1LGNA 4EWAA 2NP0A 4AFAA 3HT1A 1AJKA 1AXZA 1W39A 4RR3A 3WD5A 3R6SA 1HQLA 3MIEA 4ES8A 1YI9A 3MW4A 1COV3 1RB8G 4D3WA 2A3YA 4LHLA 3AK0A 2P2KA 2XVGA 1AR82 3N36A 3WCSA 4LE3A 1LOCA 1N1TA 5GZFA 1J58A 4BH9A 4N90A 2ZAAA 4Z8BA 1PVC3 4WM7A 5BXXA 4AVBA 5F1RA 5C8CC 2HWB3 1QXRA 3ACLA 3VBOB 2MEV1 3VKOA 3M8LA 1QJU3 3THPA 4XFFA 2B5HA 2IZWA 2MNGA 1D4VB 3NAPC 4YGDA 3D0SA 1TME1 1PGL2 4Q4V2 3GBFA 4MXWB 1VAVA 2WLQA 1R092 4XFIA 1ZZ7A 5E8AA 3UK9A 2HEYF 5BPXA 1WD3A 1FOD1 4J6GA 4B3NA 1VRH3 1C8M2 1NCQC 4FBFA 3QOPA 3NV1A 4XFAA 3ZXLA 2A3WA 1IS3A 4IV3A 4ITCA 2CWSA 2UU8A 1UZYA 2XB6C 5D8AB 3MI8A 3O12A 1F5FA 3WV6A 4AQSA 3VKNA 3FBMA 1MS1A 4G3YC 4CDUA 5F5QA 3L2HA 5E89A 4RHV3 4W6WA 1D0HA 2EVXA 4BLJA 2JICA 1LCLA 2VW1A 2X5IA 1DZTA 5A33B 4Q1PA 2QDRA 1FT9A 2IXIA 1WCSA 4IEPA 1LU1A 3AMHA 5CBLA 2RS53 4WVVA 5L36A 1KXGA 1Q3EA 3VBOC 4AHXA 1ASJ3 1W0OA 4XZPA 1EAH1 1O4TA 1D0GA 4LUKA 2FZ2A 2D6OX 1LOGA 2WZR3 2XGXA 2O1QA 4FPJA 4WVMA 3WUDA 2ZMKA 2FQPA 1RL3A 2VOWA 4NHMA 3RSJA 4CDWB 1G9FA 3KD4A 1TMF2 1SFNA 1OA4A 3WW1A 4AFBA 1LHUA 1RHI1 1ND2B 5H9QA 4AFDA 1KDMA 3J8F3 4R4XA 4C1WA 3WDVA 1QOSA 4BOWA 2EALA 3HN1A 4QM9A 4FQ4A 2JD4A 1BK1A 4YVWB 1UF2C 1H9WA 2WNUA 4N9IA 4DINB 1U5ZA 4BPZA 2HJIA 1HRV1 4WV8A 1VBA2 1POV3 2RJLA 1SLTA 1DBNA 3RRDA 1J59A 1LHVA 4QGNA 5CB7A 4NWWA 1LOFA 3AMMA 2ATFA 1KJRA 1S0EA 2HWF3 4Y26A 1ZA4A 3P3NA 2VNRA 1CGPA 2CGOA 1G9CA 2GH2A 3R4SA 2XKOA 4H3WA 1RVF3 5AVAA 2BBVA 1IKQA 4FOQA 4LO8A 4H14A 3WUCA 1UIKA 4CP2A 3M7AA 4H55A 5FOBB 1F31A 1NA1A 5GLVA 2ZBJA 2DURA 4UW3A 4Q4W1 2OW4A 4XFBA 1OFSA 5CG9A 2Z5WA 1IS4A 3H0OA 2GC2A 1AYM2 1UZZA 3WG1A 2DUPA 3ZFFB 2VVEA 3AYCA 1OA2A 4YVWC 4O9GA 3VKMA 2Q1MA 5JLVA 2GN3A 1RMU1 1UW8A 3AP7A 1CJDA 3ZMNA 4D7YA 4GULA 2WQZC 3ZYPA 5C4WB 4XBQA 1DU3D 3ZPYA 3VKFC 4YM2A 1UAIA 1X36A 2HWC2 4GWNA 4HVOA 3UV9A 4CP1A 1MS4A 4OHVA 1RUD2 3IIAA 4MUVA 5FPXA 1X7NA 4QHBA 1LKNA 3OY8A 1RUC1 2MEV3 2QUOA 1BYHA 1AL0G 2VUAA 1HIXA 2ZGNA 3HWJA 1AJOA 1RUJ2 3TYJA 4LBQB 2PYTA 1EPWA 4PIZA 1FYUA 5SV8A 1HW5A 2PA7A 2HWD1 3IPVA 3H3ZA 3I4IA 5GZDA 2EXKA 1LOBA 2CL2A 4HANA 4K9SA 4H7LA 4LBOA 1FOD3 3JQXA 4UW6A 2K9ZA 3B7MA 1XE7A 3ZXAC 3G7DA 3KQRA 1R1A2 5HCFA 2PELA 3MPPG 5FLIA 3AB0A 1JN2P 3M3CA 2B39A 3VDDB 5ABJA 4MLOA 4Q4X2 2NQYA 2BWCA 3ZFFC 4FQZA 3V0AB 1PO22 1H0BA 4PJYA 4LLOA 1HRI2 4Q0PA 1QJX1 3VZKA 3SCGA 3VHOA 4Y22A 3ZIXA 1DZQA 3UL2A 2VPVA 2RHPA 2QVSB 4HK9A 1OPMA 5DUXA 3NV2A 4EV0A 1JXNA 2NZ9A 2XJVA 4BA6A 5C4WC 4WZFA 1XYOA 3BOPA 3IT8A 1PZ8A 3M4FA 1DQ6A 2RS12 3WW4A 2ZKLA 4HKOA 3OYWB 4IXLA 2KA3A 2P3JA 3RZZA 1R081 3NWKA 4MX3A 4DPNA 1AR81 1PMIA 3RMXA 2ZGUA 2B7YA 2R0HA 3ZFGB 4E2QA 4Q0SA 1OI6A 1XNBA 2CNAA 1ZZ9A 4GB32 1EAH3 5CVRA 2JENA 4B8EA 1YRZA 2VXRA 3KCXA 4I3PA 2DWRA 4DQAA 1DQ2A 1HKDA 5A3MA 2QKDA 4PLNA 1GKBA 3VBUB 4JDOA 4NR1A 1RJ7A 2R071 4AFCA 2V5YA 1DLLA 1EV12 1IS5A 4RS5A 2A71A 4XEZA 3FLRA 2ZZQA 1QGLA 3VHPA 3R4DB 3FE5A 5J96B 2PQQA 4QPIA 3PMSA 4Z82A 4YZ4A 1WLDA 1FPN3 4GMP1 3VDDC 1IPKA 4Q4V1 1QJZA 1BBT2 4Y5Z0 5K9YA 5CIRA 1C57A 1QXPA 4XIKA 4HZFA 1XYNA 1C8M1 1HRV3 1SLCA 4FPGA 1J1TA 3VZLA 4FCAA 3RJRA 3V0BB 1AXYA 4YFZA 2IXCA 1V6JA 4HBNA 2EXJA 3GYDA 4Y1VA 1MS0A 1WW4A 4C1XA 1QXJA 3EXUA 2UY9A 1ULDA 2OUJA 2A6WA 5E16A 4LA3A 1DQ4A 3ES4A 3VZOA 1O4ZA 3RJ2X 1NQDA 2K2SA 5L7OA 2WFF1 5KHKA 3ZFGC 5IK8A 2UURA 2XG3A 3V64A 1MZFA 5C33A 1DGLA 5JSRA 1B35A 3ALQA 3VBRB 3VBUC 4B7KA 4Q4W3 4COZA 2RR12 3CNAA 1BVVA 2A6VA 4A3XA 3G6JB 5ACA2 1DG6A 3FBYA 1V00A 4QQPA 5DZFA 1MEC2 4QPGA 2HYKA 1AUYA 1ND3B 5C6CA 4R9DA 3J4UH 1PZ9A 4J1XA 2UWCA 1Q8VA 1ZBE1 4DFSA 1F9KA 1GQGA 2R042 4C91A 1ENXA 5FMOS 5GLTA 1H2KA 5JWPA 1CAWA 2UYBA 2PN5A 1IS6A 1I6XA 5L19A 1GBGA 1GLHA 4Q0QA 2BNMA 3ZFEC 1LHOA 3JD72 1MS3A 4C0BA 2IXKA 3EO6A 1PNFA 1UPIA 2Q4SA 3GHMA 1CAVA 2W0XA 3FWEA 1O5UA 3L9JT 5FO9B 1I1EA 3J26N 4H7MA 1M4WA 1ZREA 1VBC1 1RUC3 1J3RA 3UKTA 4FXKB 4Y4YA 5CFDB 2BNNA 2O8QA 4I0AA 4IEUA 1AZDA 4CDUB 4AYUA 1DYPA 4FPCA 2YY1A 1KS4A 1FNYA 4Q4Y2 1KJLA 1DHKB 2HWD3 2MPFA 3VBRC 4XXAA 5LRRA 5KHIA 3AP6A 1TNRA 2X5IB 1RUF2 2YUEA 1AX2A 2A75A 1O5LA 1ZBA2 3U0ZA 3AP5A 4F83A 5H9RA 3EHKA 3LA7A 1POV0 1ND3C 1NXD1 1CAXA 2R16A 2ZX0A 4RQPA 5AC92 4OI0A 1OQ1A 3PVBB 1AYN1 4HKLA 3MF6A 2CTVA 2O0OA 3RI8A 4WVMB 3ENRA 1O4YA 1PO11 4IL7A 1QJX3 3ME2A 4P9IA 1FMD2 3ZYRA 1WLCA 1M06G 3WDYA 1U5YA 3S30A 4OHYA 3N7LA 3MGUA 1I3HA 1REDA 2YHJA 1R083 2WNUB 4KL1A 2JG8A 1XE8A 2BFUL 5GZEA 2ZKNA 2OUHA 1Z7S1 3WCRA 4R8HA 1QOTA 4YW1A 3NW4A 5HXVA 3VHNA 4KWKA 5CFDC 4AE2A 1YIPA 2VMHA 4XJ8A 4CRQA 1S0JA 5CFCB 4AW7A 1RUD1 3ZSKA 4CDUC 1W6OB 1IQAA 2R073 4DB5A 3ZXFA 4E4DX 1YFXA 3AKQA 3WQ1A 4CDXB 3EJKA 2PHWA 1U0AA 4AFMA 1URXA 3BOWA 1SMVA 4I0WB 3OPZA 1RUJ1 4O9EA 3THTA 1OMIA 2JECA 3POSA 2BUKA 1NA1B 5AVPA 1EYBA 1QNYA 3KS7A 3VUOA 4YW5A 4GMP3 4YZ1A 1RUI3 2QJVA 1V6KA 5DUWA 4Q2FA 2OVUA 3BIWE 2WFPA 1C8M3 1REEA 3B93A 3M2MA 4K40A 3ECQA 3LGRA 4HK8A 1PIV2 2D97A 3VHRA 1SBEA 4AHWA 1JYIA 1ULFA 2A73B 3GZTB 2OZJA 4XXPA 1U5XA 2BQPA 5KC5A 3T1LA 3R0RA 2JE7A 1CVNA 3E6DA 1PO21 2ZZJA 3FZ3A 3MW3A 3S6PA 1A3KA 1SCSA 2GNMA 3VGIA 3WG4A 1LENA 1I9RA 2P3KA 4RGAA 2O8OA 2WFF3 3WY6A 2DVDA 4P5HA 2NMNA 1LJ7A 4L11A 4U36A 4YM3A 2RS11 3M3EA 2CGPA 4FTBA 5CFCC 2BGCA 1WLTA 3HAGA 3NKGA 1QDCA 4Q8LA 4HFSA 4GQ7A 4YZ2A 1V9U2 4Q27A 1VP6A 2GN7A 2P17A 2AH2A 4E4ZA 4A7YA 3LOBA 4CDXC 1UMZA 4GB31 1GV9A 1Q8PA 1W2UA 2D6MA 2OZ6A 5E88A 2EAAA 4XBLA 3OY8B 5FQ0A 1AR61 4IESA 1G8WA 4EN6B 4D7SA 3N7KA 1Q8SA 5KXCA 4S2FA 1EV11 3APBA 2ILMA 3ZYJB 5DDJ1 1CPNA 1ZBE3 4AI1A 1ZRCA