1HV1A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTAYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv1A00
2B42B 1HV1A 1OA2A 3WQ0A 3VZLA 1XYNA 3WT3A 3VL8A 3B5LB 4S2FA 3ZSEA 3AKSA 3VHOA 3WP3A 5K7PA 3VHNA 2DCKA 2NQYA 3VLBB 2NLRA 2BWCA 3LB9A 4HK9A 1UU4A 1BVVA 4H7MA 4HKOA 4HKLA 3AMQA 1XYPA 2QZ3A 3WQ1A 2DCYA 1T6GC 3AKRA 1M4WA 2C1FA 1UKRA 1OLQA 2DCZA 1NLRA 3AKTA 2BW8A 2JENA 1OLRA 2JICA 1REEA 2DCJA 4S2DA 3AMNA 2B45X 3MFCA 2VG9A 1H8VA 1OA3A 1H0BA 3WP6A 4XPVA 1H1AA 3B7MA 3VGIA 3VZMA 1OA4A 5HXVA 1QH6A 3M4FA 3AKQA 3MFAA 4XQWA 1REFA 2BWAA 4S2HA 3RI8A 2VUJA 3VHPA 3EXUA 3MF6A 1XYOA 1F5JA 2B46X 4NPRA 1YNAA 2DFBA 1H4GA 5EJ3A 1PVXA 3VZJA 1C5HA 3MF9A 1W2UA 1REDA 1C5IA 3AMMA 4S2GA 3WQ7A 1XNCA 5K9YA 2BVVA 3RI9A 1QH7A 2VGDA 1AXKA 2D98A 3WX5A 3WXPA 4XQ4A 3AMHA 2QZ2A 4IXLA 3O7OA 3WR0A 3VZOA 3WP4A 1XNBA 1XNKA 2VULA 2D97A 3HD8B 2JEMA 3WY6A 2DFCA 1HV0A 4HK8A 1BCXA 1ENXA 1HIXA 1IGOA 1H4HA 3VL9A 1UU6A 1KS5A 3VZKA 1KS4A 1BK1A 1TE1B 3LGRA 1XNDA 3AMPA 4HKWA 2Z79A 4XQDA 1XXNA 1UU5A 2F6BA 3WP5A 3VZNA 3AKPA
chains in the Genus database with same CATH superfamily
5GZCA 1SCSA 4LBQA 4Y20B 1WCQA 2XWJB 5FAXA 3UKTA 1DGWA 2VBDA 3LCPA 5H9PA 4LBLA 3M1HA 4U36A 2XL7A 5FPUA 2ZOEB 5I0RA 2RMU1 3ECQA 5I8TA 1W9WA 3ZIWA 5CG9A 2VECA 2OQ6A 2GDFA 1VRH1 1LENA 1UMZA 1UOBA 2GNMA 4XVHA 2BGCA 2GZWA 4A6OA 1Y3TA 4BMEA 3HT1A 3RZGA 3KT4A 4GXLA 5FPAA 5BXXA 4OYUA 2P1BA 3THCA 4L97A 2ZMKA 5GALA 3BTXA 2ZKLA 1OF3A 3ZMNA 2YXSA 4MVTA 4XUPA 4NJ4A 4AVTA 2VR4A 1YQCA 1LOBA 5F5CA 1PX3A 4B1MA 5K7PA 1O8PA 2CV6A 1ZREA 4CDQB 5C71A 3MDPA 4FFIA 4ARYA 5FKCA 2BERA 1OPMA 1NQJA 4IEUA 4PQ9A 5A3UA 1W03A 2QQKA 2YC2A 2W87A 3PU8A 3QBQA 1AUYA 2DWRA 1HXS1 1RUD1 2TNFA 4R9DA 4Y3OA 5EWSA 1KFXL 4N7UA 1KQRA 4RS5B 5LATA 1AR71 2W2IA 3E6DA 4NHMA 1GZTA 1RUF2 2YBPA 1FPN3 5DXDA 3E6BA 2EXHA 3RVHA 3ZYGA 4CDUB 2EXJA 1RXFA 1IZ3A 2VZUA 3BTAA 3LQCA 2AYHA 1VB2A 2BZDA 2E51A 2WINB 4HOOA 4PDWB 1FAYA 1SDDB 4P02B 4QQLA 4MGTA 3NJXA 2R041 2JG9B 2B46X 3RWNA 1GU3A 2GMMA 4AK3A 4TWTA 1Q5OA 2C26A 4C90A 3VDDA 4XABA 3CBNA 1VBC3 4YGBA 4PBOA 3WDTA 2Z42A 4BQ1A 4OI2A 1W6NA 3DN7A 2XH6A 1Y4WA 1DBNA 2C6SA 3IM0A 5A6QA 4BM8A 1S0EA 5T54A 4M00A 1AYN3 4BQXA 4IE6A 2W1SA 1YHFA 2ADDA 2R061 3RGBA 5DN2A 1LGNA 5ISLA 1HRI1 3ZMOA 2D98A 2VTFA 2MNGA 1XB9A 2PFWA 3CJXA 1ENRA 3WR0A 3ZPOA 5CFCC 2VUAA 4BLIA 1JODA 2X53S 1FATA 5ACA2 2VNVA 1X50A 4FP3A 2W3JA 2ORZA 1WA4A 4LBQB 3SNMA 3QH6A 3I59A 2AEYA 4ZONA 4LT5A 4OMCA 3N9QA 2R6QA 4E2QA 1OH4A 5IVJA 3LEMA 2EICA 5FOJB 4KBZA 1SLAA 1B35A 1KS5A 3ASIA 1S2EA 1W6MB 2QKDA 3K4ZA 2DYCA 3IKWA 1CAUA 5FYMA 3WNPA 3AK0A 4ES9A 1NG0A 2B39A 5F3GA 2A70A 4NUBA 2OQ7A 1RINA 4PI2A 2FCUA 4XIOA 1GOHA 1RMU1 1UU5A 1VAKA 5A7QA 3WCSA 1AYM2 4BISA 3AZXA 4HANA 2EAAA 2XJPA 5A3LA 4XBNA 3OY8B 2A5ZA 3ST7A 3N9PA 3I3DA 5DUWA 3WQ0A 2WQ8A 1SDWA 2HWB1 3ZFGA 3O1MA 4I0WB 1S0GA 1NY72 1WWYA 2OIIA 2VJXA 2WZR1 1A34A 4LORA 1RUF3 1E5HA 3T08A 4DEVA 1ZZ8A 3ENRA 3VLBB 3BTYA 1IG3A 1PO22 1V6NA 1MS4A 1VBD3 1W2NA 2XOMA 4CP0A 4E4HA 5J7MA 3EMRA 2CTVA 4K1ZA 2PHLA 1OKOA 1Q43A 2ETEA 2WR9A 5JSPA 5F2SA 3ME2A 2XWBB 2P34A 1A3KA 4FP2A 2RR11 1VAVA 3ZFFB 1DGWX 3CL1A 2ZHKA 4JRLA 2A71A 1BZWA 2CHHA 4KGGA 3GNEA 3CJIB 1W6PA 1NE6A 1IHMA 1W9FA 4YW5A 1V6OA 1ZA4A 5HCFA 3VDDB 1QOSA 3O5SA 2P3JA 1FYUA 1N1TA 1W6NB 1MVEA 2LROA 1POV0 2VTXJ 2CU5A 2E6VA 3MFCA 5IVEA 2D3RA 4RA0A 5LY1A 3USSA 5IVFA 3POEA 5E88A 5FREA 2P17A 2ET7A 3PIGA 1UZVA 2A6VA 1RIRA 5LBBA 4QHZA 4IUGA 3K3NA 1LOEA 1S0BA 3DPRB 4A7YA 2FQPA 3VKFC 4JGZC 4DRVA 2FDIA 1QNWA 2JDYA 4LHLA 1NCRC 1OI6A 3EXUA 2OKXA 5A7NA 4JGZB 4AGGA 4N43B 1F5JA 4JVAA 1UWWA 4YVSA 3OBZA 1O4YA 1PVC3 4CDXC 1PZ7A 1VBE2 3LEGA 1H2KA 2A3XA 3WNKA 4RQPA 1WCDJ 3I59B 3BIEA 4QAWA 3Q8FA 3O12A 1PM7A 3DKWA 1QJZA 1AYM3 3PLQA 1NOVA 3Q8EA 3NAPB 4EJRA 2RMU2 4F83A 1B35B 3K75B 1O4ZA 1XNCA 1MS9A 4S2GA 5FZ4A 4COWA 4UAPA 3AYEA 3KHCA 5ABJB 2GP3A 1LB2A 4MGKE 4DUWA 2B9VA 1ND2A 3CQOA 1ZRIA 2ZCWA 2W52A 4JCKA 2E63A 5BV6A 3O1PA 1PO23 4KGQA 5C7GA 3NV2A 4XF3A 4AEKA 4DXSA 5FZAA 1H8TC 5H9QA 5E6HA 2R16A 1ZBE2 1GQHA 1AX1A 4W4ZA 1UO9A 2WT1A 1J3QA 3OPTA 2ZGOA 2WFF1 3DF0A 1IS6A 3IN9A 4AEDC 5JXIA 1N3QA 1D4M2 2E53A 5T52A 1F15A 1C4RA 5C70A 4LITA 4HKWA 3V0AA 5JMOA 1HXS2 4MLOA 5JPMB 5DZGA 1BEV2 4OHZA 1LHUA 1WGPA 4XXAA 1AR72 4BYYA 1HV1A 2GNTA 2QCSB 1SACA 3LKJA 2J7MA 3E1F1 4PLNA 1SPPB 3O1VA 3WHUA 1BVP1 4A41A 2HWE3 4CTEA 1UXXX 1N1YA 4JGYB 2R042 3T09A 4CEYC 5F3CA 1XU2A 5FZ7A 3ZYRA 3GJBA 5J37A 3UNPA 1GWKA 2XBO1 4YFWA 1GFF2 5I0DA 1QDOA 2BWCA 2YV8A 4XCBA 3LB9A 2E26A 1ULEA 4PQQA 5SV8A 3T2TA 1KDMA 4HKOA 3QOPA 5BNOA 1NLSA 3AMQA 1VBE3 5APAA 4YW4A 2WYSA 4FVVA 2Q5TA 4H7LA 2VZQA 1UOJA 3J7MA 1J1TA 3HT2A 5T3NA 3MIFA 2A7AA 2VZ1A 1O6UA 2GH2A 2ZAAA 2RMU3 3V65A 3KVAA 3TN92 3K77A 1AJOA 4D69A 4Q27A 3T3YA 4KMQA 3HBKA 5I0UA 3WDVA 5IK5A 4ISRA 4MXWB 3VBOC 4FAHA 5FY8A 3LZZA 3I3EA 2AH2A 1F9KA 2QJVA 1GNZA 3AP4A 2WAAA 1HRV1 4J25A 3TEXA 4BWOA 5A1LA 2KA3A 2YFUA 1O5LA 1AX0A 4LLOA 4P5HA 3B3QE 1GQPA 4XF4A 2R49A 5F5AA 3JBG2 5FYTA 2DTWA 3ELNA 1YXWA 4GH4B 1ZBE3 3K4AA 1S0IA 3KF3A 3I2GA 4LIVA 4E27A 3AX4A 1FOD2 4I01A 1RMU2 4OLLA 1CPMA 4NPRA 4ZZ5A 1PMIA 3THDA 1D4M3 3PHMA 5L9BA 2F4LA 4GMP0 4Y1XA 1RUG1 2WIIB 4INDA 1TMF3 1R1A1 3N7MA 4QX7A 5FIXA 1PMJX 4FBFA 4AW7A 2J1UA 1PVXA 1TME1 1BXHA 1XNTA 1BEV3 4XUOA 3TOJA 1LKNA 4TXWA 1U5XA 1VMHA 1CR7A 1AR73 1QNYA 2RDNA 2WT2A 3ZYPA 4OQ8A 1GANA 3FL7A 5LEJA 3RI9A 2ARBA 2JD4A 3LFIA 1JZ7A 3RZMA 4NHKA 2FHRA 1CAXA 2GAUA 4RHV1 3UETA 5F3IA 1QOTA 4IXLA 1RUE2 2XJSA 2R043 3IBMA 1IS3A 4N90A 1YRZA 2VULA 2AACA 3S7IA 5F1RA 1W8WA 2ID4A 1ULDA 2RR12 4DEQA 1K12A 1ND3C 4XJ8A 1W2OA 4O61A 2R0FA 5LW9A 2R30A 5IFTA 2CWSA 3DYOA 5DG2A 4BIOA 4NWWA 4EWAA 4HN0A 3DXUA 5CFDA 4KL1A 1RUOA 1PNGA 2WNVB 1UU6A 2XHKA 2JDZA 5LRSA 2HWD1 2BV4A 4HG6B 1WBLA 3OUJA 4FQZA 3W20A 1NA1C 4E9KA 2PXJA 3GBWA 4H2AA 5L9VA 3BOWA 4NE9A 2R0HA 3TN93 4IEPA 2CDOA 2EAKA 2JKBA 1UZWA 4IESA 4WM8B 1PM4A 4OHVA 2I07B 5C9AA 2D44A 3HAGA 4IV3B 3HNMA 1VMJA 4QB6A 2BFUS 1QJX1 4P9YA 3DGTA 1QJY1 3KZ4C 4TSVA 2V4AA 3AFGA 1IKPA 2IFRA 5SV5A 4XIKA 3M3CA 1ULOA 2QNKA 4XW3A 2UWCA 3GXUA 3O0WA 3ZSEA 4BK5A 4E8DA 5D8AA 3JBG3 1H30A 1X82A 4NROA 5FLIA 1FNYA 4B4PA 3WLUA 2TUNA 4OUMA 2EIBA 3ACFA 1FOD3 4BU2A 4CVUA 3ATGA 1PK6B 3PUHA 4M0NA 4XC9A 3WG2A 3N4MA 4GJZA 2P3KA 4YYOA 2D6LX 4COZA 4M01A 3N3HA 3T1LA 3IMNA 3LA2A 4QGMA 1IPJA 1XPWA 2X5IA 4HLTA 3WD5A 4META 1K5JA 3SXWA 1IS5A 4Y5TA 1OVPA 4CZSA 5KC6A 2JIGA 4A4AA 4H3WA 2A3WA 4XFFA 1R092 5E8AA 3VBUA 4AI8A 5FZOB 3BOPA 2YDEA 1QF3A 5A3WA 4FPCA 2ARCA 2DCJA 5F3EA 1JHJA 5K8SA 3C2UA 2P2KA 1SLIA 1RUE3 4N53B 4QPGA 4AXOA 1HJGA 4FPGA 3FZ3A 4KG8A 3SCHA 3KSCA 5F37A 3O1UA 1UF2C 2VU9A 3DECA 5FMBA 1G86A 3CMGA 4NRQA 2WFF2 3ZFEC 3U4XA 1OA4A 2WNUC 4K21A 1UNBA 3QCWA 5FJKA 2W47A 3ZKYA 1UXZA 5GLWA 3ZFEB 4YVWC 3Q8CA 3X29B 1FPN1 1JU4A 2V5YA 1A8MA 5IJRA 5KXBA 3ZN6A 5CAZA 4IEQA 2D40A 3VBFA 3I2FA 1CAWB 4HMZA 1FX5A 3MHZA 4Q4V3 1YQ2A 4QHOA 3UJOA 2HBUA 2YYOA 1WMDA 3V0BA 2WYFA 1TQ5A 5IK8A 2WN3A 3MF9A 4ZZ8A 3TEZA 4Z1VA 4QU2A 4A44A 4JKLA 2GC1A 3JQWA 2PHWA 4XJZA 1AYN1 2XBO2 1L3JA 3LA3A 3S0MA 4LK6A 1OLMA 5FZIA 3O1RA 4LBOA 3SC7X 3VZOA 5FCCA 4I30A 1WD3A 1SBFA 3J26N 1DQ1A 5FZKA 3HD8B 1AJKA 4YFZA 2VW0A 4GALA 3F2ZA 2OZJA 2PQSA 1RJ8A 4SLIA 1LHWA 2YROA 2WUHA 4W65A 1AF9A 4IQPA 3U10A 1DLCA 1TVGA 2W9XA 4UW3A 2BGPA 5A6ZA 2N7GA 4LMFA 5D8AB 3WF0A 1GP5A 1C8NA 2BOJA 2WKKA 2G9FA 4QDSA 2ARXA 2JDNA 1NCQA 4XACA 5C4WA 3PUIA 1VP6A 3THTA 3A22A 4R9CA 3QH7A 4IE4A 1R093 1FV3A 3P3NA 1XU1A 1MZ5A 4IEWA 4CP9A 3POYA 2X09A 3AKPA 1Y7BA 2B7YA 1HRV2 2VOKA 2PHFA 3A7QA 4NIGA 2ZX4A 4LJHA 1WLWA 4QGLA 3A4UA 5L9RA 2ZXQA 3VZLA 2BBVA 3WT3A 1S1AA 1OVSA 1IPKA 4UFIA 2UWBA 2J1VA 5A3OA 4CEWA 1W28A 2EIGA 2P6HA 1JS9A 3N9OA 1EV13 3NSTA 4FPLA 2XL9A 2FD8A 3OBTA 1UY4A 2BJSA 5D21A 4AI1A 2NQYA 1RUF1 1RUG2 3K48A 3P6BA 4MO3M 4X8PA 1GOFA 1O5UA 4HK9A 4QPGB 3ILRA 5A7WB 1R1A2 1RL3A 2JKXA 1LHVA 3VB9A 4EN8B 1VBD1 3GZEA 2FDGA 4HKLA 1MS5A 3O1OA 2VQUA 3FFQA 2DCYA 1IKQA 3MIBA 3ZXAC 1IQDC 2PELA 1QJEA 4G3YC 1CVNA 4BQYA 1E57A 3T1MA 5FTTC 4YGEA 3RWKX 4NHYA 3B69A 4WBBA 5L73A 3AVRA 3HR9A 5BYNA 1WW7A 2VNRA 4IERA 1OLRA 1ZBA3 2J22A 4XHXA 1G9BA 3WG4A 1O3TA 4GWMA 3VBFB 1W8ZA 1DIWA 1JYNA 3OUIA 2A6XA 1YFWA 3A0NA 4DZGA 3JXSA 4QPWA 5KXCA 4IV1A 4ONUA 2B8MA 1DYOA 5I8YA 1JYXA 2CYFA 4XETA 1OOPC 1F35A 4OULA 2WABA 3SITA 5C3RA 4NWVA 3MYXA 4A7ZA 3VZMA 3LAGA 3IWZA 1MQTA 1BQPA 3LSEA 4LTAA 3U07A 2HWD2 2BEOA 3MLJA 3WF4A 1I3HA 1LESA 5CA6A 3RRDA 4CUAA 3WDYA 4NHXA 4LO7A 5FMOL 3EYPA 3ZDVA 1HN1A 5FQ0A 4NIAA 3CLPA 3PVOA 1LOCA 3AJYA 3GGLA 3H7YA 4IEVA 1U5YA 3RNSA 1OLME 1YFYA 3LPFA 4XFGA 4CYDA 2DFBA 1AR92 2DV9A 1PVC1 2SLIA 4LO4B 5FP9A 2ZJCA 4QKNA 1QJY2 1ZYBA 5FBZA 5A7OA 1NXD1 2ZX0A 3RYRA 1W2AX 3FFZA 1JH5A 2WDBA 4JTNA 1HRV3 2IXIA 1W0NA 2O8OA 5FY1A 4BMBA 3B01A 2WT0A 3NNMA 4ZS3A 2W1QA 2EIDA 4AVCA 1AXKA 3VD7A 2JXAA 3KT1A 3ZN5A 1WLTA 1RUC1 1ULFA 4YG3A 1YI9A 5D1IA 1Y9MA 3ZO0B 1N3PA 3B94A 4UI9L 2XXZA 3LPGA 1NKGA 4CDWC 1XJAA 1NY71 4OI0A 3CIHA 1Y9GA 2E9QA 2DUQA 4MYEA 4CDWB 3H3LA 3MIGA 1PX4A 1R1A3 4GB31 4X6QB 4GA9A 2FBEA 4P5YA 1PO21 3WDWA 3J8F1 4QX8A 3NJZA 1HIXA 5LA9A 4M3CF 4BHPA 1DQ6A 5EIYB 3RZHA 2ZEXA 4GD4A 1H4HA 3MI8A 5F6LB 1WD4A 1ZZBA 3SKJE 3LD8A 1CPNA 1X9PA 3T0AA 2D6NA 1TE1B 2D7FA 3KCCA 4R9BA 3BKZA 2ZABA 3AXEA 3WW2A 4A45A 1W39A 2BYVE 3LIHA 1DDLA 4P9LA 1XE7A 2JECA 4LKFA 2W1WA 3JB4C 4FOWA 5T50A 4V2WA 1DZRA 1XBFA 4K9SA 3VBSC 3RYKA 4DOUA 3IDBB 4YPJA 4AAXA 3VBSB 3WG1A 3D3AA 2WSUA 2XVKA 4P08A 2PAMA 3WNNA 5LK5A 4CU6A 4RGGA 2BOIA 3JB8A 4LBQD 3VD3A 1HW5A 5FYCA 1LOAA 3LOBA 3RJ2X 3H8UA 4ES8A 1W8NA 5LA0A 3NJVA 3J7LA 2A6YA 3AKSA 3E5XA 3I4IA 2HWE1 3T4VA 3VHOA 4EN7B 5FP3A 2VW1A 1JOPA 2XONA 2DCKA 2PQQA 3FN9A 3NWKA 4NPMA 5FLJA 3ZYIB 4DFSA 2VO5A 2QDRA 2WQ4A 1SFNA 4ATFA 2VZPA 2IUWA 4YM2A 4MGYE 2VE1A 3U1XA 1JI6A 4Q26A 5CG8A 2XDVA 2Y6KA 5A6YA 1CX1A 3HQUA 5CISA 2RM22 2C4XA 3GHMA 5FUIA 5KXEA 5IK7A 4Q0UA 1AR93 3IDCB 1NXMA 1C3HA 1VBE1 3SH3A 1QJY3 1UMIA 2IXJA 2VCAA 5BNNA 1L7QA 3AYAA 4FXGB 5JI7A 2RG4A 3RZJA 5A32B 5FQ0B 4TYSA 5JCTA 1FMD2 5AFBA 2JENA 3WG3A 5IW0A 5JOXA 4O9EA 3ZM8A 1T6BX 1DQ5A 2YMZA 1H9PA 4R52A 1ODMA 2QE3A 2Y26A 1JMUB 4FPYA 1ZM1A 4E4ZA 3R0RA 2MEV2 2JG8A 1MVQA 3FLRA 3POFA 3R4DB 1K5MC 4ZU4A 4I2OA 4SBVA 2WA4A 4BQWA 3AP6A 5H9SA 4OQ9A 1K5MB 1AXZA 5IAXA 1SLLA 2Y8KA 2YU2A 4URAA 5CFCA 1HQWA 1YQ8A 3MFAA 4Q4Y2 1Z0HA 5JMCA 1UY1A 5L36A 3AP9A 5C3QA 4CDQC 3ES4A 2XJVA 3LF7A 1NZIA 2ZA9A 4AQSA 4QPIC 3UGHA 3S5AA 1S0DA 1UQXA 1ZBE1 2CGOA 2NM1A 5A7SA 4QPIB 5D2AA 1YFUA 1LOGA 4HETA 4RFRB 1JTZX 1D4M1 3OPZA 4DY3A 2O8QA 4DY5A 3DV8A 3I97A 4AI9A 1TMF1 3LIGA 4RS5C 3I2OA 2AREA 1LAJA 2ZHMA 2VMCA 4LHKA 4MOAA 2ORXA 3CKHA 2Q8EA 1BEV1 3VBHB 4CDUC 5JSRA 3K2OA 4CCJA 4FPJA 1DYKA 5A1AA 3ZOIA 4WM7C 5JZGB 4PDWC 2X29A 5BNPC 5ANQA 1CX4A 4Y4YA 3WF2A 5KXDA 4WM7B 4URTA 2WWSA 5L7OA 1V6KA 5C8CB 5BNPB 5F7UA 1VBD2 3NRUA 5GZFA 2JG9C 3SEPA 1JYTA 2E7TA 1RUJ2 4LOTA 4CU7A 1ZZCA 2YGMA 1Q8QA 2GNBA 2WRAA 4IE5A 4HVRA 4BLJA 3KQ4B 1H6XA 3NV4A 4XFCA 3RZLA 1MS3A 2XB6C 1VALA 4YW6A 5FZMA 1EYBA 3RSJA 1Q56A 2RM23 2Y6GA 4L0PA 1KS4A 4COUA 4EZ4A 3WV6A 3A23A 3S7EA 5CB7A 2Y33A 3PJYA 5EFUA 5I0TA 3BPSA 1FMD3 5HCBA 1LEDA 1LU1A 2D93A 4RGKA 5DUXA 4BQ4A 2V73A 2P3IA 3ZXGA 5F32A 3TN91 3L2HA 5FZ0A 2LS6A 1AHSA 3KWVA 5E89A 3H1WA 1OA2A 2K2SA 4NIIA 1LODA 2MEV3 1AR82 2JDKA 4D3WA 2LRPA 3WZ1A 3GBFA 1UW8A 4AEJA 3KLSA 4AHXA 1EPWA 3WP3A 5CADA 5KHKA 1W8HA 4Q4Y3 4V2VA 2ERFA 2HEWF 2VOVA 4QX3A 4AL9A 1GZWA 1PVC2 3JBG1 5FYBA 4TLFA 4EWEA 5LWBA 1SG3A 1EP0A 4Y4RA 3H8RA 3IMMA 3D82A 4JQRA 1FOD1 2ENRA 2GH8A 2LUWA 2VH9A 4B7KA 3GF6A 4XBQA 4C0BA 1NCRA 3AKRA 4RD7A 3ZLIA 2AENA 2R1BA 1EUUA 1RUC2 1V00A 4DRRA 2RV9A 4YZ5A 2GSYA 2JDPA 3I2DA 4UFJA 4UWDA 3CHXA 2ZS6B 4QGNA 4XTMA 3CZJA 2ZGNA 2QQVA 5FR3A 1AX2A 2VG9A 1MPXA 3H1YA 3NO8A 4GB32 4JX0A 4M3CA 3J8F2 5C3PA 1RUJ3 4XF9A 3BI3A 2JE7A 1RUE1 2CNAA 1RB8G 3H9AA 1DLLA 2EIEA 4P9IA 2DF7A 3BODA 1AXYA 3ZFFC 1IG0A 5FZEA 4ZHNA 1SEFA 4KU8A 2OS2A 1ZRCA 2BWAA 4JDOA 3PTRB 3OUHA 3TB0A 3CJIC 1VIWB 1MS8A 5T5OA 1H8TA 1COV2 5DMYA 1HB2A 3FHAA 3BCWA 3OPWA 1XE0A 2GN3A 3EB7A 3VDDC 3HN3A 1OQEA 4QWNA 5LY2A 3OG2A 3IAQA 4W6YA 4BIFA 4AEDA 3VZJA 2A1XA 4A6SA 2I45A 4Q4V1 4W6WA 1D2SA 4E4DX 1AZDA 2RHPA 5CVRA 5DQ0A 2RS13 3THPA 2HWE2 3DPRC 1AR83 5T5LA 3AMHA 5FY5A 1A8DA 4K20A 4AFAA 1V6LA 4C0HA 1QMJA 4N43C 4IGPA 4BZ4A 1OC1A 4L92A 1XNKA 4D7TA 4XCAA 3UGGA 2BTVC 1LHOA 3FMGA 2C0ZA 2WN2A 1W8FA 4CEYA 3TNQA 5K4LA 1QKQA 2L9LA 3JD72 3U78A 3VKNA 3NAPC 4D0QA 4CUGA 3BUCA 5KC5A 4JAAA 4V1PA 5FXVA 1B35C 3N36A 4YG0A 2FZ1A 2E32A 1XNDA 5ABJC 1GZWB 1RUC3 1CAUB 2WO2A 2XG3A 2VMGA 4GIQA 2F6BA 3U0ZA 4JQTA 3WINE 5L19A 3BGAA 4QXKA 1DQ4A 3PTYA 1DGRN 1T2XA 3BU0A 3WUDA 1EUTA 1R091 4LO8A 3T2PA 1V6JA 1UYPA 2Y60A 1WKYA 3GJAA 1UYYA 4PF1A 4FQ4A 4OI1A 4GB33 5F5IA 3ZYBA 2PA7A 1PO12 1XYNA 2RVAA 3AZVA 3J8F3 3ZFGC 2GMEA 1KJRA 2ZX3A 3PMSA 3R4SA 4LA2A 3ZFGB 5KHIA 1WA6X 2Y38A 4HVOA 3UYJA 3VBOA 2ZZJA 4WVVA 2KR2A 2YB7A 4KU7A 1D0GA 1EV11 3SH4A 1OQ1A 2NMNA 4ASKA 4XFIA 3MPPG 2XQXA 2NMOA 4FT8A 1WUVA 1YC61 3AJZA 5F2WA 1HLCA 2BBAA 2NZ9A 1COV3 5A7PA 3BTZA 1TMF2 5CKNA 2IVIB 3IAPA 1ZRRA 2OPKA 4WZFA 3OGRA 4XFHA 2QUOA 4M3CE 2Q4SA 4Y1ZA 3I7DA 4R9AA 3PVEA 2HYKA 3KHBA 4LOSA 5EZWA 1MEC3 5ANNA 3D0SA 5FK8A 4YARA 3EO6A 1XE8A 3UKNA 1BLZA 4GKXA 3BN6A 3LE0A 4JGYC 4N9HA 5F5QA 1HJFA 5I91A 1W6PB 4GMP3 5DABA 2FZ2A 3AMNA 1ZBA1 4UT5A 3WDXA 2VCCA 3TAYA 4AE2A 5A3TA 4XJUA 2XVGA 4BOWA 3HBZA 1HX6A 2E7QA 3R05A 4XDQA 4YRDA 1H0BA 4KI5M 3KCXA 1JU3A 4XUTA 1UY3A 2GC2A 5M0TA 1UY0A 1WCUA 3UKVA 2VMHA 2JDMA 4FI9A 5FXZA 3JD73 1CZVA 1OF4A 4QX5A 2RJLA 1QWRA 4Y22A 3FWEA 4BQ2A 1ND3A 4YVSC 5FPBA 1CQ9A 4NMIA 5LK7B 2Q30A 4FOVA 1W8TA 4YVSB 3MGUA 3U11A 5IATA 5EXOA 4P00B 2QDNA 4UXAA 5FPZA 5LBEA 3POJA 4RQPB 3DXTA 5FRAA 4DXTA 1REDA 3RYPA 1NA1A 1Y43B 3FHQA 4XEZA 4OZOA 5K9YA 1H1IA 3FUQA 5FPLA 4AF9A 1FI2A 1O7FA 5FP8A 5A3PA 1UOFA 2PAKA 3PVBB 4CPBD 1PO13 1LOFA 4GH4C 5CKQA 2J42A 4RSUA 1ND2C 4XQ4A 3F95A 4AI2A 1VAMA 3RS6A 1ULGA 2VZSA 5IVVA 2YC0A 1KITA 3I3BA 1ND2B 3PUAA 4LPLA 1O8SA 4WVMA 5A33A 5LA2A 4F7ZA 1JZ2A 1XNBA 2VOTA 3FLTA 4YGCA 2BNNA 5F9TA 2XJQA 5FYZA 2YUEA 3ETPA 4BE3A 2XJTA 3FUOA 4QXBA 3HOBA 2FMYA 2W1UA 2HYXA 2XMLA 3FBYA 4ZPIA 3U14A 4ZKTB 1K45A 2WSVA 3C7FA 2HKXA 3MV11 4XJAA 4R4XA 4A3XA 1HQLA 4CP2A 5GZGA 5JLVA 1D0HA 4D8MA 4B4RA 3LDRA 2ET1A 1W6OA 3KGLA 4AGRA 3K46A 1OFSA 5A80A 5E1RA 1C8M3 1I5ZA 4XAAA 1U5IA 5FYVA 1CJPA 3SKVA 2J1TA 1R64A 1VBA2 4X6RB 3V0AB 3WW1A 3A21A 3WNMA 2W92A 3S30A 4J1XA 1MS1A 2VBPA 5LBFA 3ZR5A 1QU0A 2J1EA 1FV2A 4YNIA 3PU3A 2D5FA 5HCAA 4NO4A 3ZYFA 1SZBA 2WNVC 3WW4A 4PIYA 2LALA 4B8EA 4LUKA 3MICA 3ZXEA 1J3PA 2BVBA 4E2GA 1S0FA 2WQZC 5IUQA 4XF1A 4DMIA 2WNUA 4IEYA 2HJIA 4Q4V2 1MR5A 1TEIA 3AZYA 1F2NA 4WM8C 3WQ1A 4FTSA 1LR5A 4IV3C 4YVWA 2QQUA 3HEIA 5BNOB 1UAIA 1U0AA 5FMOS 4RL7A 3WF1A 2ZHLA 1SQ4A 1VBB1 5DAVA 5EP9A 4MHUA 3VUOA 1AR91 2DCZA 4HT1T 2DVDA 2NYYA 2IVJA 3AKTA 4Y22B 3UJQA 2FCTA 4J1WA 3HPNA 4FO9A 3R6SA 4C1WA 4K1YA 5DAWA 1RVF1 3D4KA 2XLFA 1JW6A 1N1SA 3M8LA 4CU9A 2JIJA 1MZEA 3LWCA 1PK6C 3WCRA 4FPEA 2XUEA 1QXJA 4QQPA 2BPA2 3SHRA 2FDKA 5FZ1A 3RJRA 3VGIA 3DEMA 4NRMA 1LJ7A 3GCWA 1JZ4A 4LO6B 2OW4A 3IPVA 5G05L 2A75A 1O4TA 2VOWA 3GZUC 4MGZE 1CESA 1OPOA 2DDUA 4QM9A 4S2HA 3WHTA 3ZDSA 3USUA 3GHNA 1GWLA 1J83A 2G4IA 4B4QA 1OURA 1YNAA 5JUVA 4L11A 4HPKA 1F4AA 1JYCA 3AP7A 2VPVA 4OHXA 5IK4A 3ETQA 1R082 1VBA3 2HWC3 2BNMA 4N53C 4P9JA 4YM0A 4B1LA 2ZGPA 3OD0A 3NJYA 2VCMA 3AMMA 2ZGTA 3VDBA 4L99A 4DIQA 5C5UA 2YG0A 1STMA 4Z92B 1GV9A 2VGDA 4EROA 1H2LA 4QKFA 5FY9A 1EV12 5FK7A 2VUDA 1CAXB 3VBRA 3HIFA 3HNYM 5FPVA 5K0UA 4CUBA 5B4NA 1UPSA 2YU1A 3H3ZA 2K9ZA 4HZFA 3T30A 1F5FA 3LDBA 2D97A 4NRPA 1O91A 4GWNA 4Q4W3 2YPDA 5T55A 3C7HA 5GZDA 4XHBA 4CCOA 2AZ5A 2D6OX 3I2HA 3NKGA 4RYDA 1S0CA 2XKPA 1JUHA 4ZXKA 1GNYA 2W91A 4JTOA 4DQAA 2Y64A 5IT6A 2ZGUA 4AFCA 3Q8BA 1DCSA 1PZ9A 3K51A 3MIEA 4CE8A 4M4PA 5AVPA 4HXCA 5FBJA 2OT7A 3HWJA 5JVVA 5CFDB 2WNEA 4BQ5A 2RM21 1TZOA 3ILNA 1LHNA 1ZBA2 4YZ3A 3KV9A 1OXCA 3KV5A 2YBSA 2W0XA 1W04A 1ZNPA 2YPJA 3I54A 4IGOA 4RR3A 2GU9A 3WP5A 5FOBB 5LB6A 3VZNA 2CAUA 2HWF2 5FWEA 1FMD1 4MSVA 5FY4A 3RMXA 2PHDA 1D7PM 2AC1A 2PLV2 2Q0AA 4QX0A 4XMIA 2DCTA 5C9AB 3HQXA 1RUH3 2E7AA 4CCMA 2ZEYA 4CCKA 5CEHA 5J36A 3KS7A 1WW6A 1C1FA 2MEV1 3B00A 3GBGA 1RGSA 3ACIA 5D8AC 2DVGA 2XHNA 3TRSB 2C9AA 4LE4A 5DZFA 4OUEA 1YIPA 3RFRA 1G9AA 2NLRA 3M3QA 4N9IA 1OOPA 3SCGA 2GC0A 2VL4A 5FJHA 4AG4A 4Q4Y1 3GZAA 4Z2AA 2EVXA 2HBTA 3H8XA 2JD9A 2ZGLA 1T6GC 1URXA 2H0VA 4TTGA 2D3SA 5KHGA 2AGSA 3IT8A 1I9RA 3DKQA 4ISQA 2XUMA 1R083 1Z7S3 3IPVB 4AEMA 2C1FA 2X5IB 3ABZA 4NR1A 3AM2A 1ASJ2 3RZKA 3BU7A 1Q8SA 3I8TA 3ZSKA 2QBXA 3SCFA 4YLZA 2CY6A 2OVUA 4P9XA 3H7JA 5JIUA 3FBMA 4XXPA 1ACCA 1LEMA 1REEA 3VBUB 2FDHA 3J7NA 1P8JA 2IXCA 4BB3A 5KR7A 4JKKA 1ODNA 2IXKA 4W50A 2VMEA 4DPNA 4QPGC 1H8VA 1OA3A 5I0SA 3MBWA 1J1LA 3ON7A 4LK7A 5FZ8A 1OT5A 2VOXA 2W68A 4P9WA 2NP0A 3WP6A 5AC92 4XPVA 5JZGC 4QD2A 2WS92 3RG0A 1V0AA 3LDKA 4XE9A 2Y0OA 2I74A 1RUJ1 2H0BA 1UL9A 4UOJA 1PGW2 4MUVA 5FYUA 3WNLA 4AFDA 4AQ6A 5JIAA 1RC6A 4XFAA 1REFA 1EAH2 3JQXA 4LHNA 2WZEA 5FZGA 1YI7A 4CUCA 1ALYA 2FDJA 3P3PA 2P3YA 4JHTA 4ATEA 3AZWA 3VBFC 4A2UA 3PJQA 3ZN6B 4GULA 1R1ZA 5FDBA 4AFBA 2NN8A 1NAEA 5DAQA 1SLBA 3NQHA 5LRRA 2TEPA 4U2AA 2GMPA 1KFUL 2HWF3 4Q0QA 3T2OA 3V0BB 1JZ6A 2PLV3 5HV0A 1AL0G 3KM5A 1X7NA 2W08A 1IPSA 1PMHX 4XDPA 3E5UA 2RS11 2RDQA 2MHFA 4CSWA 1POQA 1SLCA 2QZ2A 4XILA 4EYUA 3KQRA 3ZPYA 1AR81 4WZCA 1NLQA 2HEVF 2F4PA 3O0XA 1RUI2 1KXGA 3HMYA 4LXLA 1V6IA 5FZLA 2Y6JA 4I02A 1V9U2 4D6SA 3ZXKA 2OX0A 4GJYA 4AVAA 1WW5A 2CL2A 2DU1A 2X8KA 4GAZA 1HKDA 4HK8A 3W9AA 3BALA 4AYUA 4DUVA 1QHDA 1VBB2 3AYCA 3PL0A 5BUVA 4A7KA 1DFQA 3MIDA 3PDQA 1TNFA 5F39A 1H2MA 4UF0A 4HONA 5GLVA 3T0BA 1VMFA 1NCQC 4AHWA 4E4SA 1F4HA 5FUNA 1QXPA 3M2MA 1OUSA 1ASJ3 1RVF2 2CGNA 3LEIA 5DAXA 5C4WB 1NCQB 4MGSA 2X05A 2ZGRA 5JXHA 1UPIA 1AL23 2VVFA 4OUSA 1QJU2 4Y20A 4F8AA 4Z07A 2GALA 4CP9B 1JYVA 4PHZA 1W6QA 2BUKA 3LA7A 3ZYJB 5EYYA 4EE2A 2XQRA 3AXDA 1E5SA 5AC93 2H6CA 2WS93 3HJRA 4LQRA 4MGQA 1HB1A 3FX3A 2JDAA 2VBBA 2UWAA 2BP6A 2WAOA 4KNCA 4CEWB 2BU9A 1L7RA 1NQDA 5IFPA 4QT6A 2Y0IA 1EAH3 5J48A 4JV4A 1RUNA 2Z4FA 2Q8CA 4K3UA 2WO1A 2QZ3A 5KWRA 2R072 3GDBA 1COV1 1QIQA 4CDQA 1DYPA 1M4WA 1PZ8A 3WEZA 3LOIA 3KGZA 4Z2WA 1BK0A 1F31A 3H50A 1GUIA 2C9KA 1BBT1 3DYPA 2VC9A 1MZ6A 5J96B 4IEXA 1YJKA 5C33A 4H55A 4Y1VA 1MEC1 2OA2A 1W06A 2YFZA 1JN2P 1RTVA 1SLTA 4RS5A 5T5PA 3UL2A 1KEXA 1SBEA 4GMP1 4COYA 4I0BA 4CDUA 1GKBA 2MPFA 1H1AA 1RUI3 1GLHA 1J58A 4IV1B 4PDWA 5DZEA 4AHYA 1QXRA 1V9U3 1EY2A 1OSGA 4LKSA 2C24A 3T0DA 1KGYA 2P6CA 1MQTB 1LCLA 1OHFA 2B9UA 1VBB3 2JG9A 1YO8A 2XLGA 4LBMA 4QQHA 4YW2A 4NN0A 5CNAA 3ZSLA 2QFEA 5CIRA 4YG6A 3OGGA 2RS32 4IE0A 3TEWA 5JXGA 3JD71 3OJBA 3PMEA 1ZA7A 3INAA 1RVF3 3URFA 3OYWA 4ASMB 2FDFA 1K42A 5KHHA 3KD4A 4CXWA 4QXCA 1H4GA 2YC4A 2DUOA 1L7LA 2WC2A 1X36A 3MUZ1 4WV8A 1C5IA 1QJU3 1ULCA 4XYXA 4IEZA 1WZXA 1W8UA 2A6WA 2EXKA 2PHRA 4CCEA 4UF0B 2G9GA 4BPZA 2X10A 3TEYA 3RQ0A 2ZMNA 3GM8A 1LTEA 2RS51 2VCBA 3WNXA 1SHWB 4NOTA 5DDJ2 4LBNA 5IVYA 4B3NA 4OVEA 2VD7A 4Z8BA 1D4VB 5LASA 1PO11 5CZKA 1ENQA 1GZ9A 1QQP1 1SFPA 1ZRDA 4XBLA 1HDKA 3VKLA 1W6QB 1GSLA 1W9SA 2KD7A 1UX6A 3CNAA 3E5QA 4QHBA 2VZTA 1BCXA 1ENXA 4UFLA 1W6MA 4KBBA 2D3PA 1NX9A 4Q0PA 5JWPA 2R073 2QQPA 4QB1A 4ZY9A 5T5JA 1YLLA 3B02A 4Q0VA 3VBHC 2XJUA 3L9JT 2WJSA 2W95A 1VE0A 4TZDA 1HN0A 3ZVXA 2CAVA 1KDKA 5BPXA 1DGRA 4KWKA 3OTFA 3D8CA 4AAPA 3OY8A 2Q1FA 5FXXA 1C8M1 3L2YA 5C8CC 5C3SA 5HI0A 5IYYA 2QQLA 2GNDA 4TLGA 5FZBA 2YZ4A 1S2BA 1UYXA 4UBGA 4BA6A 5EYXA 1X8MA 1S4CA 3OSDA 3VL8A 3T2QA 4K40A 2EALA 4PI0A 4QDQA 5CU1A 3AC0A 4FOYA 5LA1A 1RITA 4S2FA 4EZHA 4MX3A 1DGLA 4RFT0 5I8SA 2ZEWA 2Y6FA 2VAUA 2P4EA 3VHNA 1ONAA 4UFHA 3IIAA 2JJ6A 2VNGA 5LZ6A 3WSOA 4JC1A 2RS33 1BVVA 4RN5A 1DF0A 3IIIA 3HQRA 3TNPB 3QACA 2ZGMA 3ZFFA 2P5BA 3WNOA 5HCHA 4QMAA 4DB5A 3N9LA 3ORJA 2XPJA 3M3IA 3MO4A 3O14A 1AR62 3J7HA 1UOGA 4QQOA 4Q5OA 4HVQA 3CJIA 4XF0A 1UKGA 5BNNC 5LCWL 1UD1A 5JAXA 4FPHA 2RS12 1NLRA 2Q1MA 4Q4X2 5BNNB 1TNRA 4P14A 3B9CA 1X9TA 4S2DA 1C1LA 3B93A 1Y9QA 4YW1A 3OYWB 4XTPA 5DDJ3 1YUDA 4YZ1A 4ORFA 4OZXA 2JG8C 5LBCA 1OMIA 1POV3 4G4FA 3RMYA 5JR7B 3C7OA 2JG8B 3DPRA 4XJ9A 2VMFA 4MADA 1UN1A 1QJFA 1I5PA 3N9NA 4JGZA 4N43A 4AWDA 4XQWA 2WBKA 1ZZ6A 3S5QA 4DXRA 5CFCB 1OBNA 4NIDA 1UIKA 4FTEA 3PVNA 4CDXA 1RHI1 1W3VA 2V72A 1QDCA 3NAPA 4OI4A 4A3ZA 5FYHA 3BB6A 1QGLA 1XC6A 5ABJA 2G9ZA 1VBA1 2BVVA 2HWC1 1PHMA 2UYBA 3M3EA 4XOGA 4FFHA 1VJ2A 1W9YA 2DTYA 2FCVA 2IC1A 2VQTA 3CO2A 3W21A 5IVBA 4FSJA 4LEJA 3EQEA 1I1EA 1WBFA 1W05A 2QQOA 2Y34A 2ZGKA 4YZ2A 5L7OC 2V5DA 2XR4A 3NNGA 3O7OA 4WVWA 5FZ9A 3H8OA 3QD6A 1NT0A 1PIV2 5L7OB 3QLQA 4BQ3A 4QXHA 3NNLA 3WY6A 3RZZA 2B5HA 2W39A 4LKDA 4OCTA 3U4SA 2AEZA 2UYAA 3WF3A 3MUY1 4Q2FA 4Q4W1 3ZKUA 2WO7A 1HB4A 2VVEA 5A3NA 2PYTA 1IGOA 3ILFA 1US3A 3P5BA 1H9WA 1BBT2 3POGA 4YWAA 1GR3A 1AR63 4NAOA 1CN1A 2WA3A 1YFXA 3AL6A 3E6CC 1W99A 1MEC2 3H3UA 1Q8OA 3LGRA 2OPWA 4D94A 3AMPA 4BDVB 4HL0A 1GYKA 1W0OA 4Q4X3 3ZXDA 2WZPP 4IEOA 2CGPA 2K0GA 4Q8LA 3Q9OA 3K4DA 1DU3D 2A6ZA 2ATFA 2QQJA 3VKOA 5J1XA 1SPPA 3LEKA 5C8WA 3OGJA 5J3UA 1US2A 2EF6A 3D5OA 2WO3A 4B29A 4JGYA 4KWLA 3M70A 3DUIA 3FJSA 3MLKA 3GYDA 5JDBA 1RUH1 2QTWB 4Q0SA 2OYZA 1F8VA 4LKEA 1JUIA 5FYIA 3JZVA 1LU2A 3J4UH 5JOWA 3EBRA 1BJQA 1WLDA 3MW2A 4HSLA 3Q8AA 4BXFA 5ACA3 3M7AA 2V09A 2DURA 3ZN4A 3VDAA 3ACLA 3UV9A 4QU1A 1XYPA 2GN7A 1BYHA 2Q1ZB 3IDAA 5GLZA 1N3OA 1H6YA 4C1XA 4AVBA 5JOZA 1Q3EA 5JSOA 5FY0A 1E5IA 4GZ9A 2RS52 4FFFA 1UZZA 1JOJA 1C57A 3ACHA 1NCRB 1YCIA 4Y1YA 3K3OA 1GQGA 1R081 1Z7S1 3KT7A 5LEKA 1W0PA 4CDXB 2OXBA 4BH9A 1CAVA 4MXWA 5FV3A 1XSRA 3ACGA 3SEEA 1D2QA 1QQP2 3OF1A 1RXGA 4NAMA 4NVPA 3HVDA 5FZFA 3NMBA 2Z5WA 4MZUA 2D6MA 2OZ6A 4PCRA 5EQUA 1PIV3 1FT9A 1OFNA 2WWUA 2YBKA 1VRH2 5BNQA 1RYYA 2R32A 3PUQA 5GM0A 4M3CB 3TBDA 2VXRA 4GH4A 5CBLA 2XLAA 3AFKA 2XGXA 5C8CA 2SBAA 5HXVA 5C5TA 3AKQA 4D7SA 1WW4A 5FXWA 4ZU7A 4DXZA 3ZXFA 1DQ0A 4BK4A 5A1FA 4QPYA 3MLLA 3RI8A 1BBT3 4I3PA 1SMVA 5JXJA 4CXXA 1W3XA 4CCNA 4Y24A 4MXVA 1C8M2 1U5ZA 2WNOA 4Y5SA 1XSQA 4NPLA 4CCLA 1H8TB 1WCKA 3OBAA 3MW4A 1NUKA 1WMFA 2VUCA 5FY7A 3AYDA 5EJ3A 3WOGA 3OCPA 2ZAHA 1V70A 1W2UA 2B4KA 5FO8B 4AZZA 3MEPA 4PLOA 3NV1A 3WQ7A 4AEDB 5HXMA 4QQ2A 1MS0A 1IQAA 3PUSA 4DO0A 1RUD2 2EXIA 1QH7A 3C7GA 1O3RA 1J59A 2HWF1 2GC3A 1ZZ7A 1J84A 3WX5A 2PLV1 1LGBA 5IWFA 1G9FA 3GCXA 4C91A 3H42B 5E16A 1SCRA 3KMHA 4Y26A 1C28A 4IETA 2Q8DA 3VD5A 3E97A 4AFMA 2JEMA 4YZ4A 2Q8OA 2VXJA 2DFCA 2BGOA 4EN0A 1DZTA 4ARXA 4PLMA 4OMDA 1ENSA 3CF6E 2KXLA 4Q1PA 1G7YA 1UY2A 2CDPA 5JR2A 2WNVA 1SBDA 1GBGA 1UYZA 4RQPC 1MACA 4I09A 3AL5A 4CEYB 4UFKA 1NE4A 1WCSA 4I0AA 2RJ2A 1LECA 4HBNA 5EPAA 4XURA 5FP4A 2RS53 5FO7B 3SMHA 3H0OA 3JCIA 1DZQA 1GWMA 5FZHA 3POBA 3GZTB 1QOOA 4WM8A 4XQDA 5DPNA 1JOBA 3ZSMA 4IV3A 2RDSA 4OFGA 4COVA 5JI9A 5FZDA 1ASJ1 2R062 3POIA 3MW3A 3NW4A 1VPHA 1YYNA 5FZCA 1Z78A 1HRI2 1QQP3 3KB5A 3T4HB 2PHXA 4Z82A 5B2GB 2VZ3A 1AL21 2O1QA 2ADEA 2D5HA 3OEBA 1VRH3 2UY9A 2VW2A 2ZKNA 3IZOA 2LTNA 1ZZ9A 1UX7A 1U12A 1X8EA 2LM3A 2WWJA 3FC0A 3POSA 1CAVB 3PURA 4CA9A 4CCDA 1PGSA 5AC91 1IOAA 1RHI2 2WS91 3OB8A 1PK6A 5DAPA 4KH9A 3HNBM 1DG6A 5FMDA 1PGW1 3VBOB 1BMV1 3R4UA 4JHZA 2YY1A 4Q1RA 4H7MA 4KQ7A 1M06G 1UMHA 1EAH1 1QY4A 1UIJA 2IXLA 2Y6LA 4Q29A 2ZGSA 3ZR6A 5FWJA 5IHRA 3N7JA 3I3MA 3OGSA 2HWC2 2JE8A 1OKQA 2R1DA 5FKBA 2JDUA 4OHWA 4FPKA 2D6KA 1YEWA 2ZBJA 3D6EA 4J6GA 5EV7A 5FZOA 1OLQA 5J98B 4AQTA 3ALQA 3I2IA 3BVCA 1DP0A 2G19A 4QKDA 4XUQA 1HXS3 3APBA 1RUD3 1HB3A 1UCXA 4QM8A 4CCCA 4N53A 3NNJA 2HWB2 4Y33A 1RJ7A 2VQ0A 1WMEA 2ZMLA 2WZR2 2VNOA 4Q4W2 3NVCA 3ROUA 5CKMA 1IS4A 1TG7A 5GLTA 5F6KA 4ZXEA 2TBVA 3WVJA 4CPBA 1FNZA 2JWPA 4FXKB 4AI3A 1B09A 3OOXA 3ZFEA 1HQNA 2HH9A 3OBRA 4H14A 1N1VA 1QH6A 5A6XA 5BNOC 1RUI1 2F17A 1OUXA 1XNAA 2I2SA 3M4FA 2D6PA 2RJKA 2Z2SB 3MZHA 1LULA 1GP6A 1V9U1 4IDZA 4EWDA 2DU0A 4IE7A 4LHSA 4UW6A 3ES1A 1CAWA 1X33A 3VHRA 3G7DA 5BY5A 5AVAA 1FXZA 2J1SA 1H2NA 4PT6A 2YGLA 4ZU5A 4CU8A 1H1MA 1ND3B 4F3JA 3EHKA 4BJ0A 3AZZA 4PF5A 4A42A 2R063 3KCYA 1HRI3 1RUH2 1OH3A 4PIZA 2VMIA 1NA1B 1QJU1 2Z69A 3OEAA 3SLIA 5KBFA 2LW8A 4IL7A 1LOFC 1VB4A 5F8PA 2JDHA 4XMAA 3VKMA 3WQBA 5KHJA 3O1SA 3SISA 2H6BA 4JKMA 4UYBA 4XDOA 1JXNA 1O3SA 2HEYF 1Q8VA 1RHI3 1GICA 2FMDA 5A33B 3NL1A 1A78A 4WVMB 4ZS2A 4I3GA 4QX1A 3U37A 1ULPA 4YM3A 2RE9A 1GP4A 3V56A 3PNAA 4G9SB 1ST8A 5FLHA 1PGL1 2ZX1A 1CIYA 3EJKA 3G6JB 3I3QA 4KWUA 4FPFA 4B7EA 1Z7S2 2JX9A 3W5NA 5HBAA 4YW7A 5DG1A 5EHDA 2R071 1RMU3 1KJLA 2JB8A 3N35A 1GOGA 3W5MA 1W6OB 2BNOA 4JDNA 3UT0A 5FO9B 4N8MA 4FTBA 2AUYA 5IAVA 4NIHA 3S6PA 1NZCA 5FZ6A 5GJ6A 2HWB3 2B42B 4PJYA 1W9TA 1YQ6A 2ZTNA 1LGCA 2WZR3 1O59A 4UFMA 4AI0A 2UURA 1CD3G 3DL3A 4IGQA 4EQVA 2XKOA 4AVSA 2VMDA 3B5LB 2PAEA 2EA7A 3W59A 1YJLA 5G04L 3GALA 5A7WA 5C6CA 5CFDC 5IVCA 4GQ7A 4FPOB 2ZZQA 4CRQA 3OGVA 4WVZA 3W58A 2AR6A 3ITQA 3WW3A 2A3YA 2RR13 2QVSB 1S55A 4PIXA 4ET7A 2IWGB 3JUUA 3AB0A 5FYSA 2OUHA 2RS31 2WNUB 1GNHA 2BQPA 2IFWA 1XRUA 3C8XA 4LR4A 3TWIA 4K6BA 4LBJA 5C9AC 3C3VA 4YVWB 5FP7A 5FUPA 3DCQA 3D0JA 1MZFA 5B4XA 4D7YA 5CYYA 2ILMA 4HN1A 3DYMA 1CZTA 4JDMA 4M4RA 5JPNB 2JICA 1APNA 2QQWA 1KRIA 4AR2A 3O0VA 3POWA 3VD4A 2D43A 1VBC1 2ZGQA 4R4ZA 5GLUA 3NV3A 3ZSJA 1JBCA 3VD9A 1W90A 1E5RA 1JZ8A 4XUNA 1JZ5A 2ZHNA 5H9RA 4N7IA 3MIHA 1YQ5A 4C8DA 5DDJ1 1JHNA 3A0KA 4AHZA 3B7MA 1WLCA 3MPBA 4QX2A 4CP1A 2XVLA 1POV1 1DHKB 5C3OA 4W8JA 2VZRA 1K3IA 4DUXA 2W94A 1PNFA 2QQIA 5AFEA 2ES3A 2ZEZA 1BHGA 2VVDA 2X5IC 3ZYHA 3NNFA 4MG2A 2KM2A 3IDEA 5J09A 2WLPA 4R8HA 1QEXA 4E8CA 4LIUA 3USUB 3VBUC 2QQNA 2J1RA 3ZX7A 1GMMA 1AL22 4HPKB 1LRHA 3UGFA 1G9DA 3UK9A 1C5HA 3RPQA 4UBHA 1AVBA 4QKBA 3KV4A 2V4VA 3PIJA 4UW5A 1OQDA 4X8NA 4LUMA 4XZPA 1N47A 3CZUA 4XAEA 4L2NA 1BMV2 5FYYA 2GP5A 3VBRC 3CEWA 5K0UC 1J3RA 3BPZA 4CDWA 3VBRB 2G1MA 5K0UB 2WLQA 1OD5A 2J1AA 1G9CA 2O0OA 1HV0A 2O14A 4LBKA 3CU7A 4QB2A 3M3OA 4UW4A 5EJZB 4YW3A 2RDRA 1GZCA 2CWMA 2P37A 2WFF3 2VTXA 3I2KA 4RGAA 3C7EA 4LNVA 4FCAA 4FAGA 3VL9A 4LULA 4LO5B 2ARAA 2VY0A 4YSFA 4Y1UA 4FFGA 2UU8A 4K8FA 3ZIXA 1AR61 1TME2 3B9IA 2Z79A 2ZX2A 4AOCA 1JYIA 1XXNA 5JOYA 3I49A 2VZVA 2E31A 4RR3C 3VBSA 5DUVA 2DVAA 3SH5A 1A6CA 4Q4X1 4RR3B 4AQ2A 1KD7A 1G8WA 4RHV2 3UESA 3FHIB 1YIFA 2WL1A 2UY8A 5EJ1B 4CXYA 2PTMA 2Y6HA 4OHYA 2DVFA 3ZXLA 5A70A 2VZOA 1S2KA 2XBO3 2VQAA 4EN6B 4O65A 3WUCA 1YWKA 2DVBA 2PN5A 3CDZB 4TN7A 4AVVA 4BCUA 2PHUA 4Q8KA 2CSGA 2DBIA 4W6XA 4LLFA 5HPOA 1UU4A 3AP5A 3JU9A 5C4WC 1OOPB 1SFYA 1DQ2A 1W8OA 2QQMA 4IW3A 4EN9B 5ACA1 4DNYA 4GWJA 5DUUA 2NPIA 4XZUG 2XJRA 2YHJA 5A32A 2BDRA 4L8QA 1Q8PA 1UKRA 3J9SA 2BFUL 3LFMA 4GWIA 4ASLA 3RDIA 2VM9A 2BW8A 3U75A 5I93A 3VV1A 4MHRA 1QJX2 2A73B 3N7KA 4CEWC 1XOYA 4GKYA 1LNSA 2B45X 4K8RB 4PBPA 1JZ3A 3N9MA 2E33A 3AVSA 4MH0E 1AYM1 3O1TA 1S0JA 2DBNA 2PMWB 1K5MA 3LSDA 1PGL2 4BXSV 2WFPA 4JRAA 2DUPA 1OD3A 3VDCA 1PIV1 1CONA 5ERLA 3KVBA 5TSWA 4K7JA 3BYWA 2JB4A 1EPZA 1V6MA 2BRTA 2IZWA 5GZEA 2VUJA 3VHPA 3KF5A 3MF6A 4QPIA 1RUG3 1XYOA 4YGDA 1BKZA 3IB3A 4MV2A 2ZPXA 3BIWE 2W46A 2C5DA 3TYJA 2K46A 2OUJA 1TME3 4DINB 1VRBA 1CGPA 1I6XA 3VN4A 4XJWA 2WZ8A 3I2JA 3VBHA 4E2SA 1CJDA 5HV4A 4O7XA 2W5FA 1JYWA 4YM1A 1CWPA 3FE5A 4RHV3 5JZGA 3KV6A 4IV1C 4NHLA 4O9GA 3SQOA 1XQNA 3ZXJA 1WMXA 4WM7A 4KG0A 3V64A 1ZRFA 3NKTA 5BNPA 1MQTC 3WXPA 1NYWA 3S57A 4HFSA 5FPXA 1ZX5A 4LA3A 3OD4A 4DS0A 1G6NA 1UZYA 1VR3A 3WP4A 3HN1A 5FZ3A 4QDRA 4EV0A 3WDUA 1UZ0A 4Y5Z0 1FPN2 4D6RA 2IXHA 5GKAC 4ITCA 4MGIE 3FLPA 4P9GA 4XFBA 3N7LA 2HWD3 4AGVA 3MV01 2JE9A 4FOQA 2R7EB 3H1MA 2HLEA 3VZKA 5A3MA 3P1IA 4JZRA 1W2TA 1BK1A 4LE3A 1VLNA 1VBC2 1CIWA 4M0HA 5FMCA 1O3QA 1CZSA 4HSJA 5FFOC 1ZVFA 4D6QA 2PHTA 1QJX3 4L9BA 1AYN2 4KWJA 2ZACA
chains in the Genus database with same CATH topology
5GZCA 1SCSA 4LBQA 4Y20B 2XWJB 3UKTA 5FAXA 1DGWA 3LCPA 5H9PA 4LBLA 3M1HA 4U36A 2XL7A 2ZOEB 5I0RA 2RMU1 3ECQA 5I8TA 3ZIWA 5CG9A 2VECA 2GDFA 1VRH1 1LENA 1UMZA 2GNMA 2BGCA 2GZWA 4BMEA 1Y3TA 3HT1A 3KT4A 4GXLA 5BXXA 4L97A 2ZMKA 5GALA 2ZKLA 3ZMNA 2YXSA 4MVTA 4AVTA 1LOBA 2CV6A 1ZREA 4CDQB 3MDPA 1OPMA 1NQJA 4IEUA 4PQ9A 3QBQA 1AUYA 2DWRA 1HXS1 1RUD1 2TNFA 4R9DA 5EWSA 1KFXL 4N7UA 1KQRA 4RS5B 1AR71 3E6DA 4NHMA 5DXDA 1RUF2 4CDUB 1FPN3 3E6BA 2EXHA 3ZYGA 2EXJA 3BTAA 1IZ3A 4YZ5A 2AYHA 1VB2A 2E51A 2WINB 4PDWB 1FAYA 4QQLA 2R041 2JG9B 2B46X 3RWNA 2GMMA 4AK3A 4TWTA 1Q5OA 4C90A 3VDDA 1VBC3 4YGBA 4PBOA 3WDTA 2Z42A 4BQ1A 4OI2A 1W6NA 3DN7A 2XH6A 1DBNA 3IM0A 4BM8A 1S0EA 5T54A 4M00A 1AYN3 1YHFA 2R061 1LGNA 1HRI1 3ZMOA 2D98A 2MNGA 2PFWA 3CJXA 1ENRA 3WR0A 5CFCC 2VUAA 4BLIA 2X53S 1FATA 5ACA2 1X50A 4FP3A 1WA4A 4LBQB 3SNMA 3QH6A 3I59A 4LT5A 2R6QA 4E2QA 5FOJB 1SLAA 1B35A 1KS5A 3ASIA 1W6MB 2QKDA 2DYCA 3IKWA 1CAUA 4ES9A 3AK0A 1NG0A 2B39A 2A70A 3SLIA 1RINA 3WCSA 4XIOA 1RMU1 1UU5A 1VAKA 1AYM2 3AZXA 4HANA 2EAAA 2XJPA 5A3LA 4XBNA 3OY8B 2A5ZA 3ST7A 5DUWA 3WQ0A 1SDWA 2HWB1 3ZFGA 4I0WB 1S0GA 2WZR1 1NY72 2OIIA 1RUF3 1ZZ8A 3ENRA 3VLBB 1PO22 1V6NA 1VBD3 1MS4A 4CP0A 5J7MA 2CTVA 4K1ZA 2PHLA 1Q43A 2ETEA 5JSPA 3ME2A 2XWBB 2P34A 1A3KA 4FP2A 2RR11 1VAVA 3ZFFB 1DGWX 3CL1A 2ZHKA 4JRLA 2A71A 1BZWA 4KGGA 3GNEA 3CJIB 1W6PA 1NE6A 1IHMA 4YW5A 1V6OA 1ZA4A 5HCFA 3VDDB 1QOSA 3O5SA 2P3JA 1FYUA 1N1TA 1W6NB 1MVEA 1POV0 3MFCA 2E6VA 2D3RA 4RA0A 3USSA 5E88A 5FREA 2P17A 2ET7A 2A6VA 1RIRA 1LOEA 1S0BA 3DPRB 4A7YA 2FQPA 3VKFC 4JGZC 4DRVA 1QNWA 4LHLA 1NCRC 1OI6A 3EXUA 4JGZB 4AGGA 4N43B 1F5JA 4JVAA 4YVSA 1O4YA 1PVC3 4CDXC 1PZ7A 1VBE2 1H2KA 2A3XA 4RQPA 1WCDJ 3I59B 3O12A 1PM7A 3DKWA 1QJZA 1AYM3 3PLQA 1NOVA 3NAPB 4EJRA 2RMU2 4F83A 1B35B 4S2GA 1O4ZA 1XNCA 1MS9A 4COWA 3AYEA 5ABJB 1LB2A 4MGKE 1ND2A 2ZCWA 2W52A 4JCKA 2E63A 5BV6A 1PO23 4KGQA 3NV2A 4XF3A 4AEKA 1H8TC 5H9QA 2R16A 1GQHA 1ZBE2 1AX1A 2WT1A 1J3QA 2ZGOA 2WFF1 3DF0A 1IS6A 3IN9A 4AEDC 1N3QA 1D4M2 2E53A 5T52A 1C4RA 4HKWA 3V0AA 1HXS2 4MLOA 5JPMB 5DZGA 1BEV2 4OHZA 1LHUA 1WGPA 4XXAA 1AR72 4BYYA 1HV1A 2GNTA 2QCSB 1SACA 3LKJA 4PLNA 3WHUA 1BVP1 2HWE3 4CTEA 1N1YA 4JGYB 2R042 4CEYC 1XU2A 3ZYRA 5J37A 2XBO1 4YFWA 1GFF2 1QDOA 2BWCA 2YV8A 3LB9A 1ULEA 5SV8A 3T2TA 1KDMA 4HKOA 3QOPA 5BNOA 1NLSA 3AMQA 1VBE3 4YW4A 4FVVA 2Q5TA 4H7LA 1J1TA 3HT2A 5T3NA 3MIFA 2A7AA 2GH2A 2ZAAA 2RMU3 3V65A 3TN92 1AJOA 4D69A 4Q27A 5I0UA 3WDVA 5IK5A 4ISRA 4MXWB 3VBOC 4FAHA 3LZZA 2AH2A 1F9KA 2QJVA 1GNZA 3AP4A 1HRV1 4BWOA 2KA3A 4P5HA 1O5LA 1AX0A 4LLOA 3B3QE 4XF4A 2R49A 3JBG2 2DTWA 3ELNA 1YXWA 4GH4B 1ZBE3 1S0IA 4E27A 3AX4A 1FOD2 4I01A 1RMU2 4OLLA 1CPMA 4NPRA 1PMIA 1D4M3 3PHMA 4GMP0 4Y1XA 1RUG1 2WIIB 4INDA 1TMF3 1R1A1 3N7MA 4FBFA 4AW7A 1PVXA 1TME1 1BXHA 3TOJA 1BEV3 1LKNA 1U5XA 3ZYPA 1CR7A 1AR73 1QNYA 2WT2A 1GANA 5LEJA 3RI9A 2ARBA 2JD4A 4NHKA 2FHRA 1CAXA 2GAUA 4RHV1 1QOTA 4IXLA 1RUE2 2XJSA 2R043 3IBMA 1IS3A 4N90A 1YRZA 2VULA 3S7IA 5F1RA 1ULDA 2RR12 1ND3C 4XJ8A 2R0FA 2R30A 2CWSA 5DG2A 4BIOA 4NWWA 4EWAA 4HN0A 5CFDA 4KL1A 1RUOA 1PNGA 2WNVB 1UU6A 2XHKA 2JDZA 5LRSA 2HWD1 1WBLA 4FQZA 1NA1C 4E9KA 3GBWA 3BOWA 2R0HA 3TN93 4IEPA 2EAKA 2JKBA 4IESA 4WM8B 4OHVA 2I07B 5C9AA 2D44A 3HAGA 4IV3B 2BFUS 1QJX1 4P9YA 3DGTA 1QJY1 3KZ4C 4TSVA 3AFGA 1IKPA 2IFRA 5SV5A 4XIKA 3M3CA 2QNKA 4XW3A 2UWCA 3O0WA 3ZSEA 5D8AA 3JBG3 1H30A 1X82A 5FLIA 1FNYA 4B4PA 3WLUA 2TUNA 4OUMA 1FOD3 3ATGA 1PK6B 4M0NA 3WG2A 3N4MA 2P3KA 4YYOA 2D6LX 4COZA 4M01A 3N3HA 3T1LA 3IMNA 3LA2A 4QGMA 1IPJA 2X5IA 4HLTA 3WD5A 4META 3SXWA 1IS5A 5KC6A 4CZSA 4H3WA 2A3WA 4XFFA 1R092 5E8AA 3VBUA 4AI8A 3BOPA 2YDEA 1QF3A 4FPCA 2DCJA 5K8SA 3C2UA 2P2KA 1SLIA 1RUE3 4N53B 4QPGA 4AXOA 4FPGA 3SCHA 3FZ3A 4KG8A 3KSCA 1UF2C 2VU9A 1G86A 3U4XA 2WFF2 3ZFEC 1OA4A 2WNUC 4K21A 3QCWA 5GLWA 3ZFEB 4YVWC 3X29B 1FPN1 2V5YA 1A8MA 5KXBA 3ZN6A 5CAZA 4IEQA 2D40A 3VBFA 1CAWB 4HMZA 1FX5A 4Q4V3 3UJOA 2YYOA 1WMDA 3V0BA 1TQ5A 5IK8A 3MF9A 4Z1VA 4QU2A 2GC1A 3JQWA 2PHWA 4XJZA 1AYN1 2XBO2 1L3JA 3LA3A 3S0MA 4LBOA 3VZOA 5FCCA 4I30A 1WD3A 1SBFA 3J26N 1DQ1A 3HD8B 1AJKA 4YFZA 2VW0A 4GALA 2OZJA 1RJ8A 4SLIA 1LHWA 2YROA 4W65A 1AF9A 4IQPA 3U10A 4UW3A 2N7GA 5D8AB 1C8NA 2WKKA 2G9FA 2ARXA 5C4WA 1NCQA 1VP6A 3THTA 4R9CA 3QH7A 1R093 1FV3A 3P3NA 1XU1A 1MZ5A 4IEWA 3POYA 3AKPA 1Y7BA 2B7YA 1HRV2 2VOKA 2PHFA 2ZX4A 4QGLA 1WLWA 3A4UA 3VZLA 2BBVA 3WT3A 1S1AA 1IPKA 2UWBA 4CEWA 2EIGA 1EV13 3NSTA 4FPLA 2XL9A 3OBTA 4AI1A 2NQYA 1RUF1 1RUG2 3K48A 4X8PA 4HK9A 1O5UA 4QPGB 3ILRA 1R1A2 1RL3A 1LHVA 4EN8B 1VBD1 4HKLA 1MS5A 3FFQA 2DCYA 1IKQA 3MIBA 3ZXAC 2PELA 4G3YC 1CVNA 1E57A 3T1MA 5FTTC 4YGEA 3B69A 4WBBA 5L73A 3HR9A 5BYNA 1WW7A 2VNRA 4IERA 1OLRA 1ZBA3 4XHXA 1G9BA 3WG4A 1O3TA 4GWMA 3VBFB 1DIWA 2A6XA 1YFWA 3A0NA 4DZGA 5KXCA 4IV1A 4ONUA 2B8MA 5I8YA 2CYFA 4XETA 1OOPC 4OULA 3SITA 4NWVA 3MYXA 4A7ZA 3VZMA 3LAGA 3IWZA 1MQTA 1BQPA 3LSEA 4LTAA 3U07A 2HWD2 2BEOA 3MLJA 1I3HA 1LESA 5CA6A 3RRDA 3WDYA 4LO7A 5FMOL 5FQ0A 3CLPA 3PVOA 1LOCA 3AJYA 4IEVA 3H7YA 3RNSA 1U5YA 1YFYA 4XFGA 4CYDA 2DFBA 1AR92 2DV9A 1PVC1 2SLIA 4LO4B 2ZJCA 1QJY2 1ZYBA 5FBZA 1NXD1 2ZX0A 3RYRA 3FFZA 1JH5A 4JTNA 1HRV3 2IXIA 2O8OA 4BMBA 3B01A 2WT0A 4AVCA 1AXKA 2JXAA 3KT1A 3ZN5A 1WLTA 1RUC1 1ULFA 4YG3A 1YI9A 5D1IA 3ZO0B 1N3PA 3B94A 4CDWC 1NY71 4OI0A 2E9QA 2DUQA 4MYEA 4CDWB 3MIGA 1R1A3 4GB31 4X6QB 4GA9A 2FBEA 3WDWA 1PO21 3J8F1 3NJZA 1HIXA 4BHPA 4M3CF 1DQ6A 1H4HA 3MI8A 5F6LB 1WD4A 1ZZBA 1CPNA 2D6NA 1TE1B 2D7FA 3KCCA 4R9BA 2ZABA 3AXEA 3WW2A 1W39A 2BYVE 1DDLA 4P9LA 1XE7A 2JECA 3S7EA 3JB4C 4FOWA 5T50A 3VBSC 1DZRA 4K9SA 5C8CA 3RYKA 4DOUA 3IDBB 3VBSB 3WG1A 2WSUA 2XVKA 2PAMA 5LK5A 4RGGA 3JB8A 4LBQD 1HW5A 1LOAA 3LOBA 3RJ2X 3H8UA 4ES8A 2A6YA 3AKSA 3E5XA 3I4IA 2HWE1 3VHOA 4EN7B 2VW1A 5FLJA 5K7PA 2DCKA 2PQQA 3NWKA 3ZYIB 4DFSA 2QDRA 2WQ4A 1SFNA 4ATFA 4YM2A 4MGYE 4Q26A 5CG8A 2RM22 3GHMA 5KXEA 5IK7A 4Q0UA 1AR93 3IDCB 1NXMA 1C3HA 1VBE1 3SH3A 1QJY3 2IXJA 5BNNA 3AYAA 4FXGB 5JI7A 5A32B 5FQ0B 4TYSA 5JCTA 1FMD2 5AFBA 2JENA 3WG3A 5JOXA 4O9EA 2YMZA 1DQ5A 1H9PA 4R52A 2QE3A 2Y26A 4FPYA 1ZM1A 4E4ZA 3R0RA 2MEV2 2JG8A 1MVQA 3FLRA 3R4DB 1K5MC 4ZU4A 4I2OA 4SBVA 2WA4A 3AP6A 5H9SA 1K5MB 1AXZA 1SLLA 5CFCA 1HQWA 3MFAA 4Q4Y2 1Z0HA 5JMCA 5L36A 3AP9A 4CDQC 3ES4A 2XJVA 4AQSA 2ZA9A 4QPIC 1S0DA 1ZBE1 2CGOA 2NM1A 4QPIB 1YFUA 1LOGA 4HETA 1JTZX 1D4M1 3OPZA 4DY3A 2O8QA 4DY5A 3DV8A 1TMF1 4RS5C 2AREA 2ZHMA 4LHKA 5JSRA 5JZGC 3VBHB 1BEV1 4CDUC 4FPJA 1DYKA 5JZGB 4WM7C 4PDWC 2X29A 5BNPC 1CX4A 4Y4YA 5L7OA 5KXDA 4WM7B 4URTA 2WWSA 1V6KA 5C8CB 5BNPB 1VBD2 5GZFA 2JG9C 2E7TA 1RUJ2 1ZZCA 2YGMA 1Q8QA 2GNBA 4HVRA 4BLJA 3NV4A 4XFCA 1MS3A 2XB6C 1VALA 1EYBA 3RSJA 1Q56A 2RM23 1KS4A 4COUA 3WV6A 5CB7A 3PJYA 5EFUA 5I0TA 1FMD3 5HCBA 1LEDA 1LU1A 2D93A 5DUXA 2V73A 2P3IA 3ZXGA 3TN91 3L2HA 1AHSA 5E89A 3H1WA 1OA2A 2K2SA 1LODA 2MEV3 1AR82 4D3WA 3WZ1A 3GBFA 1UW8A 4AEJA 3KLSA 4AHXA 1EPWA 3WP3A 5CADA 5KHKA 4Q4Y3 2ERFA 2HEWF 2VOVA 1GZWA 1PVC2 3JBG1 4TLFA 4EWEA 1EP0A 3D82A 4JQRA 1FOD1 2ENRA 2GH8A 2LUWA 2VH9A 4B7KA 3GF6A 4XBQA 4C0BA 1NCRA 3AKRA 4RD7A 2AENA 2R1BA 1RUC2 1V00A 4DRRA 2GSYA 3I2DA 2ZS6B 4QGNA 4XTMA 2ZGNA 1AX2A 2VG9A 4GB32 3H1YA 3NO8A 4M3CA 3J8F2 1RUJ3 4XF9A 2JE7A 1RUE1 2CNAA 1RB8G 3H9AA 1DLLA 4P9IA 2DF7A 3BODA 1AXYA 3ZFFC 1SEFA 4KU8A 1ZRCA 2BWAA 4JDOA 3TB0A 3CJIC 1VIWB 1MS8A 5T5OA 1H8TA 1COV2 3BCWA 3VDDC 2GN3A 1OQEA 4W6YA 4BIFA 4AEDA 3VZJA 2I45A 4Q4V1 4W6WA 1D2SA 4E4DX 1AZDA 2RHPA 5CVRA 2RS13 3THPA 2HWE2 3DPRC 1AR83 5T5LA 3AMHA 4AFAA 1A8DA 4K20A 1V6LA 4C0HA 1QMJA 4N43C 4BZ4A 4D7TA 4L92A 1XNKA 2BTVC 1LHOA 3FMGA 2C0ZA 4CEYA 3TNQA 1QKQA 3JD72 3VKNA 3NAPC 5KC5A 4JAAA 4V1PA 1B35C 3N36A 4YG0A 2FZ1A 1XNDA 5ABJC 1GZWB 1RUC3 1CAUB 2XG3A 2VMGA 4GIQA 2F6BA 3U0ZA 3WINE 5L19A 4QXKA 1DQ4A 3PTYA 1DGRN 3WUDA 1R091 4LO8A 1V6JA 4FQ4A 4OI1A 4GB33 2PA7A 1PO12 1XYNA 3AZVA 3J8F3 3ZFGC 2GMEA 1KJRA 2ZX3A 3PMSA 3R4SA 4LA2A 3ZFGB 5KHIA 3VBOA 2Y38A 4HVOA 2ZZJA 4WVVA 4KU7A 1D0GA 1EV11 3SH4A 1OQ1A 2NMNA 4XFIA 3MPPG 4FT8A 2NMOA 1WUVA 3AJZA 1HLCA 2NZ9A 1COV3 1TMF2 1ZRRA 2OPKA 4WZFA 4XFHA 2QUOA 4M3CE 2Q4SA 4Y1ZA 3I7DA 4R9AA 3PVEA 2HYKA 5EZWA 4YARA 1MEC3 3D0SA 3EO6A 1XE8A 3UKNA 4GKXA 4JGYC 4N9HA 5F5QA 5I91A 1W6PB 4GMP3 2FZ2A 3AMNA 1ZBA1 3WDXA 3TAYA 4AE2A 4XJUA 2XVGA 4BOWA 3HBZA 1HX6A 2E7QA 3R05A 4XDQA 4YRDA 1H0BA 3KCXA 2GC2A 3UKVA 2VMHA 3JD73 4QX5A 2RJLA 1QWRA 4Y22A 3FWEA 1ND3A 4YVSC 1CQ9A 5LK7B 2Q30A 4FOVA 4YVSB 3MGUA 3U11A 5EXOA 2QDNA 4UXAA 5FPZA 4RQPB 5FRAA 1REDA 3RYPA 1NA1A 1Y43B 4XEZA 5K9YA 1H1IA 3FUQA 4AF9A 1FI2A 1O7FA 2PAKA 3PVBB 1PO13 1LOFA 4GH4C 4RSUA 1ND2C 4XQ4A 4AI2A 1VAMA 3RS6A 1ULGA 2YC0A 1KITA 5A33A 1ND2B 4F7ZA 4WVMA 1XNBA 3FLTA 4YGCA 2BNNA 5F9TA 2XJQA 2YUEA 4BE3A 2XJTA 3FUOA 2FMYA 3FBYA 4ZKTB 2WSVA 4XJAA 2HKXA 4A3XA 4R4XA 4CP2A 1HQLA 5GZGA 1D0HA 4B4RA 2ET1A 1W6OA 3KGLA 4AGRA 1OFSA 5E1RA 1C8M3 1I5ZA 1U5IA 1CJPA 1VBA2 4X6RB 3V0AB 3WW1A 3S30A 4J1XA 1MS1A 1QU0A 1FV2A 4YNIA 2D5FA 5HCAA 4NO4A 2WNVC 3WW4A 4PIYA 2LALA 4B8EA 4LUKA 3MICA 3ZXEA 1J3PA 2BVBA 4E2GA 1S0FA 2WQZC 5IUQA 4XF1A 4DMIA 2WNUA 4IEYA 2HJIA 4Q4V2 1MR5A 1TEIA 3AZYA 1F2NA 4WM8C 3WQ1A 4FTSA 1LR5A 4IV3C 4YVWA 5BNOB 1UAIA 1U0AA 5FMOS 4RL7A 2ZHLA 1SQ4A 1VBB1 3VUOA 1AR91 2DCZA 4HT1T 2DVDA 2NYYA 3AKTA 4Y22B 3UJQA 4J1WA 4FO9A 3R6SA 4C1WA 4K1YA 1RVF1 3D4KA 2XLFA 1JW6A 1N1SA 3M8LA 1MZEA 3LWCA 1PK6C 3WCRA 4FPEA 4QQPA 1QXJA 2BPA2 3SHRA 3RJRA 3VGIA 1LJ7A 4LO6B 2OW4A 3IPVA 2A75A 1O4TA 2VOWA 3GZUC 4MGZE 1CESA 1OPOA 4QM9A 4S2HA 3WHTA 3ZDSA 3USUA 3GHNA 2G4IA 4B4QA 1YNAA 4L11A 4HPKA 1JYCA 3AP7A 2VPVA 4OHXA 5IK4A 3ETQA 1R082 1VBA3 2HWC3 2BNMA 4N53C 4P9JA 4YM0A 2ZGPA 3OD0A 3AMMA 2ZGTA 4L99A 4Z92B 1GV9A 2VGDA 4EROA 1H2LA 1EV12 1CAXB 3VBRA 3HIFA 5K0UA 1UPSA 3H3ZA 2K9ZA 4HZFA 1F5FA 2D97A 1O91A 4GWNA 4Q4W3 5T55A 5GZDA 4XHBA 2AZ5A 2D6OX 3NKGA 1S0CA 2XKPA 1JUHA 4ZXKA 4JTOA 4DQAA 5IT6A 2ZGUA 4AFCA 1PZ9A 3K51A 3MIEA 5AVPA 3HWJA 5JVVA 5CFDB 2WNEA 2RM21 3ILNA 1LHNA 1ZBA2 4YZ3A 2W0XA 3I54A 1ZNPA 2YPJA 4RR3A 3WP5A 2GU9A 5FOBB 3VZNA 2CAUA 2HWF2 1FMD1 4MSVA 3RMXA 2PHDA 2Q0AA 2PLV2 4XMIA 2DCTA 5C9AB 3HQXA 1RUH3 2E7AA 5J36A 3KS7A 1WW6A 1C1FA 2MEV1 3B00A 3GBGA 1RGSA 5D8AC 2DVGA 3TRSB 2C9AA 4LE4A 5DZFA 1YIPA 1G9AA 2NLRA 3M3QA 4N9IA 1OOPA 3SCGA 2GC0A 4AG4A 4Q4Y1 3GZAA 2EVXA 2ZGLA 1T6GC 1URXA 2H0VA 2D3SA 5KHGA 2AGSA 3IT8A 1I9RA 4ISQA 2XUMA 1R083 1Z7S3 3IPVB 4AEMA 2C1FA 2X5IB 4NR1A 3AM2A 1ASJ2 3BU7A 1Q8SA 3I8TA 3ZSKA 3SCFA 4YLZA 2CY6A 2OVUA 4P9XA 3H7JA 5JIUA 3FBMA 4XXPA 1LEMA 1REEA 3VBUB 2IXCA 2IXKA 4DPNA 4QPGC 1H8VA 1OA3A 5I0SA 1J1LA 2W68A 2VOXA 4P9WA 2NP0A 3WP6A 5AC92 4XPVA 4QD2A 2WS92 3RG0A 4XE9A 2Y0OA 2I74A 1RUJ1 2H0BA 1UL9A 4AFDA 1PGW2 4MUVA 4AQ6A 5JIAA 1RC6A 4XFAA 1REFA 1EAH2 3JQXA 4LHNA 1YI7A 1ALYA 3P3PA 4ATEA 3AZWA 3VBFC 4A2UA 3PJQA 3ZN6B 4GULA 1R1ZA 5FDBA 4AFBA 2NN8A 1SLBA 5LRRA 2TEPA 4U2AA 2GMPA 1KFUL 2HWF3 4Q0QA 3V0BB 2PLV3 1AL0G 3KM5A 1X7NA 2W08A 3E5UA 2RS11 2MHFA 2QZ2A 1SLCA 4XILA 3KQRA 3ZPYA 1AR81 4WZCA 2HEVF 2F4PA 3O0XA 1RUI2 1KXGA 3HMYA 1V6IA 4I02A 1V9U2 3ZXKA 4AVAA 1WW5A 2CL2A 2DU1A 2X8KA 3W9AA 1HKDA 4HK8A 4AYUA 3BALA 1QHDA 1VBB2 3AYCA 5BUVA 4A7KA 1DFQA 3MIDA 1TNFA 1H2MA 5GLVA 1NCQC 4AHWA 4E4SA 3ZSJA 5JLVA 1QXPA 3M2MA 1RVF2 1ASJ3 2CGNA 5C4WB 1NCQB 2ZGRA 1UPIA 1AL23 2VVFA 4OUSA 1QJU2 4Y20A 4F8AA 4Z07A 2GALA 1W6QA 2BUKA 3LA7A 3ZYJB 5EYYA 3AXDA 5AC93 2H6CA 2WS93 3FX3A 2UWAA 4KNCA 4CEWB 1NQDA 4QT6A 2Y0IA 1EAH3 5J48A 4JV4A 1RUNA 4K3UA 2QZ3A 5KWRA 2R072 1COV1 4CDQA 1DYPA 1M4WA 1PZ8A 3LOIA 3KGZA 4Z2WA 1F31A 3H50A 1BBT1 1MZ6A 5J96B 4IEXA 1YJKA 5C33A 4H55A 4Y1VA 1MEC1 2OA2A 1JN2P 1RTVA 1SLTA 4RS5A 5T5PA 3UL2A 1SBEA 4GMP1 4COYA 4I0BA 4CDUA 1GKBA 2MPFA 1H1AA 1RUI3 1GLHA 1J58A 4IV1B 4PDWA 5DZEA 4AHYA 1QXRA 1V9U3 1EY2A 1OSGA 2XLGA 1MQTB 1LCLA 1OHFA 2B9UA 1VBB3 2JG9A 1YO8A 4LBMA 4QQHA 4YW2A 3ZSLA 4NN0A 5CNAA 2QFEA 5CIRA 4YG6A 3OGGA 2RS32 3JD71 3OJBA 3PMEA 3INAA 1RVF3 3URFA 3OYWA 4ASMB 5KHHA 3KD4A 1H4GA 2DUOA 2WC2A 1X36A 4WV8A 4XYXA 1C5IA 1QJU3 1ULCA 4IEZA 2A6WA 2EXKA 2PHRA 2G9GA 4BPZA 3RQ0A 2ZMNA 1LTEA 2RS51 3WNXA 4NOTA 5DDJ2 4LBNA 4B3NA 4OVEA 4Z8BA 1D4VB 1PO11 1ENQA 1GZ9A 1QQP1 1ZRDA 4XBLA 1HDKA 3VKLA 1W6QB 1GSLA 3CNAA 3E5QA 1UX6A 4QHBA 1BCXA 1ENXA 1W6MA 4KBBA 2D3PA 4Q0PA 2QQPA 5JWPA 2R073 5T5JA 1YLLA 3B02A 4Q0VA 3VBHC 2XJUA 3L9JT 2WJSA 4TZDA 3ZVXA 2CAVA 1KDKA 5BPXA 1DGRA 4KWKA 3OTFA 3D8CA 3OY8A 1C8M1 3L2YA 5C8CC 5HI0A 2GNDA 2YZ4A 1S2BA 4UBGA 4BA6A 5EYXA 1X8MA 3VL8A 4K40A 2EALA 5CU1A 4FOYA 1RITA 4S2FA 4MX3A 1DGLA 4RFT0 5I8SA 3VHNA 1ONAA 3IIAA 2JJ6A 2VNGA 4JC1A 2RS33 1BVVA 1DF0A 3TNPB 3QACA 2ZGMA 3ZFFA 4QMAA 4DB5A 2XPJA 3M3IA 1AR62 3O14A 4QQOA 4HVQA 3CJIA 4XF0A 1UKGA 5BNNC 1UD1A 5JAXA 4FPHA 2RS12 1NLRA 2Q1MA 4Q4X2 5BNNB 1TNRA 4P14A 3B9CA 4S2DA 1C1LA 3B93A 1Y9QA 4YW1A 3OYWB 4XTPA 5DDJ3 1YUDA 4YZ1A 4ORFA 4OZXA 2JG8C 1OMIA 1POV3 4G4FA 3RMYA 5JR7B 2JG8B 3DPRA 4XJ9A 1UN1A 4JGZA 4N43A 4AWDA 4XQWA 5CFCB 1ZZ6A 1UIKA 4FTEA 3PVNA 4CDXA 1RHI1 1QDCA 3NAPA 4OI4A 3BB6A 1QGLA 5ABJA 1VBA1 2BVVA 2HWC1 1PHMA 2UYBA 3M3EA 4XOGA 1VJ2A 2DTYA 2IC1A 3CO2A 4FSJA