1HV1A

Dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTAYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Dissecting the electrostatic interactions and pH-dependent activity of a family 11 glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hv1A00
4HKWA 3VLBB 4XQDA 3MF9A 4S2DA 2C1FA 2DCJA 3EXUA 3WP5A 1H0BA 3WR0A 1W2UA 4NPRA 1ENXA 3RI8A 2B42B 3AKPA 1XYNA 3WP6A 1BCXA 3HD8B 2JICA 1OLQA 2QZ2A 1C5HA 1H1AA 1KS4A 4HK8A 1BK1A 1UKRA 3AKRA 3WT3A 1OLRA 2DCZA 3VZMA 3AMHA 1H4GA 1XNCA 3LB9A 4HKOA 1KS5A 3AMMA 1OA2A 4HKLA 3AMPA 4HK9A 4XPVA 3VZNA 3VHOA 1H8VA 4S2GA 1NLRA 1HV0A 2D98A 3B7MA 3WQ0A 3WXPA 1OA3A 2VGDA 1M4WA 3WQ7A 3VHPA 1XNDA 2JENA 3VL9A 2VUJA 3AKTA 3VZOA 2B46X 1YNAA 2BWCA 1UU5A 1XYPA 2BVVA 3VZKA 3B5LB 1OA4A 1XNKA 2NLRA 3MF6A 3VZJA 5EJ3A 5HXVA 1F5JA 2DFBA 1UU6A 3WY6A 1QH6A 1REEA 3WX5A 1T6GC 4S2HA 1REFA 2NQYA 3MFCA 3RI9A 1HIXA 1XNBA 2VULA 2Z79A 2BW8A 5K9YA 2BWAA 2JEMA 1BVVA 2DCKA 1XYOA 4H7MA 3AMQA 2VG9A 4IXLA 3AKSA 1PVXA 3LGRA 3WQ1A 3ZSEA 4XQWA 1REDA 3WP3A 5K7PA 3MFAA 1IGOA 3VHNA 3O7OA 1XXNA 1TE1B 3AKQA 4S2FA 3VZLA 3VL8A 2D97A 1C5IA 3VGIA 1AXKA 1QH7A 2DFCA 3WP4A 2F6BA 2B45X 2DCYA 4XQ4A 3M4FA 1H4HA 1HV1A 2QZ3A 1UU4A 3AMNA
chains in the Genus database with same CATH superfamily
1RUE1 3HR9A 5KC6A 3AZZA 4YVWB 4UW6A 2C26A 1X82A 2ZXQA 3AYDA 4XUNA 5LBFA 4ATEA 3NJXA 5FYUA 2X5IC 2L9LA 2EA7A 4IEUA 1NE6A 2MNGA 3AP9A 1OMIA 1PK6C 5A6XA 5KXEA 2VW1A 1FAYA 2W08A 3IIAA 3W9AA 1AR91 2E9QA 3U14A 1ZBA1 3WP6A 4BMEA 5FY9A 4BXSV 5D2AA 2QDRA 3AVSA 3LEIA 4IGOA 5I8SA 1WD4A 4N8MA 2A3WA 5GZDA 3LQCA 4AHZA 2XVLA 4CCKA 2W92A 1GOGA 3WNNA 1ZBE3 4LUMA 1WW4A 3ZSKA 2MEV1 4R4XA 1O3RA 1OKQA 5FP4A 4WM7C 3NL1A 5FZ0A 2ZX1A 1OVPA 2CTVA 4A42A 1JTZX 3RJ2X 3DV8A 1VRH1 3FLRA 4HKOA 5IVYA 2JDMA 5KXCA 4L11A 3OBRA 1F35A 1UPSA 4P9JA 4QD2A 3AZWA 1AL21 3D0JA 3G7DA 3IN9A 4ITCA 4M4PA 3BPZA 4R9BA 1MR5A 5FDBA 3FHQA 3HQUA 4Z82A 5LCWL 1OFNA 4AG4A 4JCKA 4CEWA 3VZNA 3VHOA 5JIUA 2RS11 5DUWA 2Z42A 3BCWA 1W2TA 2VCCA 3CMGA 1HV0A 5F5AA 2QQPA 4HN0A 5A6QA 3GHMA 1WGPA 2UURA 2XG3A 4K6BA 4XUPA 2A73B 2WZR3 2R071 2Q30A 1JXNA 3KHCA 4QB6A 4CYDA 1PO13 3THPA 2J1AA 1UMHA 5IUQA 2O1QA 4AGGA 4HSJA 2VMHA 4FI9A 3FZ3A 4GMP0 1PM4A 5A80A 5FP8A 2YC0A 2ZX2A 2Z5WA 5FMBA 2HBTA 2LRPA 2B46X 4QB2A 3NMBA 2DVGA 4AK3A 1SACA 4LE3A 2BWCA 2NMNA 4QKFA 1JZ8A 3THTA 4EJRA 1CESA 1N47A 1W8WA 2GSYA 3B5LB 5FV3A 3T4VA 2J42A 2YHJA 1TMF2 2E51A 2IXHA 2VBPA 4XEZA 4Y5Z0 1EYBA 2JWPA 2W3JA 1EAH3 3B94A 4AFCA 4E4ZA 3MIHA 1WLDA 1K3IA 2E26A 5LY2A 4TZDA 1EUUA 5KR7A 1UX7A 4K20A 2X29A 1RUF2 2CY6A 3ZO0B 3H1MA 1QDCA 4FOQA 1V6JA 3J7LA 4YLZA 1W9TA 3PUAA 5DDJ2 3LDKA 4MSVA 4OHWA 2P6HA 3AFGA 3URFA 3VBUC 3IMMA 3NAPA 1K5MC 4LITA 3MV11 4OZOA 5GZGA 3OD4A 4AI1A 4LT5A 5DPNA 4ONUA 5K7PA 2YBSA 3E1F1 3LF7A 5FZFA 2Y6LA 2F4LA 3PNAA 5IW0A 3APBA 4AVSA 3PUHA 1HDKA 3Q8EA 2Q8OA 4ATFA 1V9U3 2A6XA 2IUWA 3MI8A 4FQZA 4S2FA 1E5HA 4XF9A 4CDWC 5LRSA 4CVUA 1PIV3 4IV3B 5FOBB 1BLZA 2DFCA 5A32B 2WZ8A 1C57A 4CU7A 1SZBA 4JGYB 3MUZ1 1W9YA 1YJLA 3RMYA 2KA3A 3TN92 5JMCA 2ZS6B 3MLKA 3H8OA 4FPFA 4ZS3A 5CKNA 4EN9B 1GU3A 2V4VA 4OUMA 1UX6A 2ZGPA 4Q4W3 2ZGLA 4CXXA 4N43B 1DF0A 2DVBA 4D3WA 1QJU1 4KWUA 1UY3A 2HEVF 4PF1A 4BH9A 1H0BA 1JZ7A 1SPPA 1BMV2 3VDDA 3R0RA 4INDA 4P9WA 3TN91 5JOZA 3AX4A 1NE4A 4KBZA 4JZRA 4I01A 5HCFA 2CWSA 2GC0A 2ZGTA 3ENRA 4CDQC 4BXFA 4MHRA 1JYCA 1S0IA 3J7HA 4M3CA 5C5TA 2Z4FA 4FPGA 1MEC3 3HMYA 3OPZA 2VZVA 4LBQD 4AHWA 1VIWB 4LBJA 1RUJ3 2B5HA 1UOBA 4DXRA 4ET7A 4NOTA 1WWYA 2H0BA 4IE7A 4YGBA 1UKRA 1QIQA 1BMV1 1CR7A 3OGRA 5F5CA 4BQ4A 1EV11 3AYCA 3ZKUA 3LIGA 2Y26A 5EYXA 4LMFA 3N36A 1OOPA 3KF5A 3DKQA 3ZR6A 1FOD3 4DQAA 1GLHA 1LOEA 2ZABA 2Q1FA 1RITA 3TEYA 4XE9A 4TYSA 2OZJA 4AEJA 4DUXA 1HJFA 2ZBJA 4V2WA 4AFDA 1C8M2 1VMJA 5F8PA 2YU2A 4DEQA 4KL1A 4YM2A 1AR62 1N3PA 4CZSA 4TXWA 1ZZCA 2D6MA 2NPIA 1KRIA 1O8PA 4KG0A 4CPBA 2VZQA 5JSPA 1VJ2A 5CBLA 2K0GA 4O9GA 5CFDC 4OMDA 3H3ZA 2NMOA 3WQBA 4AL9A 5FYVA 3U78A 2VNVA 4FPOB 1UOJA 3MLLA 5GLZA 3QLQA 2YROA 5F9TA 4W50A 2WT0A 2XB6C 4L92A 5K0UA 1AR61 2J1TA 3RPQA 3CDZB 5F7UA 2FDGA 2QNKA 3HQRA 4AE2A 1HKDA 2D6PA 3V65A 3POIA 4I09A 3THDA 3JZVA 5FZ1A 4E4SA 1XNKA 2R042 4CEWC 2NM1A 5DZGA 1F5JA 3DPRA 2R7EB 4K9SA 4DRRA 1CZTA 2C4XA 2W91A 1N1VA 2WS93 3AZVA 5KHJA 1FX5A 3B69A 3O1OA 1JODA 3VB9A 5JZGA 1CAUA 3N9PA 4I2OA 2G4IA 4IQPA 4LIUA 3FUOA 1AX0A 2GP5A 2JEMA 3P1IA 2W1QA 3PIGA 5I8YA 3NWKA 4IEZA 3E5XA 4AYUA 4NHXA 1PVXA 4XMAA 4BIFA 1XU1A 3ACIA 3OUHA 3VBHB 2LTNA 1HB4A 4OHZA 4I3GA 1SCSA 1SLLA 1GV9A 1RMU1 1VBE2 3FN9A 2PHWA 4JDNA 4JDOA 3VBSA 1REDA 2BUKA 5I91A 1MZ6A 1D2SA 3AC0A 2P34A 5EV7A 1J1LA 2B39A 3RMXA 4NAOA 3T1LA 1HQNA 1XXNA 1IS3A 3NNFA 5ABJB 1XE8A 5IK8A 4OZXA 4DFSA 3IWZA 3SCFA 4ARYA 4LTAA 1VBE1 3VL8A 2I07B 5FY8A 1C5IA 1ZRIA 1CZSA 3GJBA 4R9DA 1KQRA 2D43A 4XJZA 5BNOA 5FPVA 3EO6A 1IS6A 3L2HA 2B45X 3ZOIA 4PI0A 5JR2A 5FLHA 4EQVA 5HI0A 5F39A 3CU7A 1CJPA 1VBC1 4WM7B 4XIKA 3RFRA 4N7UA 4BQXA 4FPKA 3VLBB 2WFF3 3NAPC 2P5BA 3FJSA 1MS8A 3WD5A 2C1FA 3MV01 2RDQA 1GOFA 1NLQA 3PVBB 4K3UA 3FE5A 4MXVA 1IHMA 5I0DA 2BZDA 1GP5A 1Z0HA 1PZ7A 3ELNA 5J98B 5K8SA 1ZREA 1AR83 4FTSA 5BNPC 1VALA 1NLSA 1YUDA 1IZ3A 2VMEA 3HD8B 4XF3A 3TAYA 2XL9A 3HBKA 4GQ7A 2J1RA 1QOOA 5LEKA 4DIQA 4B4RA 2DBIA 4DOUA 1LODA 4NPLA 2FZ2A 3NNLA 1IPJA 1J3PA 4CCOA 2RM22 4I30A 3PTYA 2WO2A 1XNCA 4WZCA 4XDOA 2P17A 1ODNA 4YVWA 2GN3A 5J37A 3BUCA 3Q9OA 4Y1VA 1DGRN 2YG0A 4AQ6A 1SLTA 1UL9A 2OA2A 4Y1ZA 4U2AA 4NJ4A 3ILRA 4FOWA 1WCUA 4GA9A 1PM7A 2D98A 2VM9A 4LBLA 5FIXA 5C8CA 2GDFA 4FSJA 3RYRA 1YJKA 3M3OA 2FDFA 2HKXA 5FUNA 4AVCA 1U5YA 3POGA 5FKBA 4E2GA 4PDWC 3RDIA 4EN0A 1RVF2 1RUD3 4NIIA 2BOJA 1J3RA 3VHPA 4YNIA 2WLQA 1QJX2 1BK0A 2VC9A 1S1AA 3TEXA 5LA2A 1NX9A 3K4ZA 1W3XA 2TNFA 1OH3A 5FZBA 4CEYA 3POEA 3LIHA 1K5MB 3AP4A 3ACLA 3POJA 5M0TA 2YDEA 3I2OA 1JI6A 4Q4Y2 4Q8KA 2ZA9A 2A3YA 1VB4A 1UOGA 5EJ3A 3VZJA 4BE3A 1HRV1 3H8UA 1YYNA 1ND2B 2DVAA 2GC3A 2XBO3 4UXAA 3OG2A 1CONA 2ZHMA 1VBD3 3ZSLA 3GF6A 1IQAA 1X9PA 4QX8A 1JUIA 3JBG1 4Q4Y1 5H9SA 4X8PA 1QJFA 3CJIB 4AF9A 1UY1A 5K0UC 5DABA 1L7RA 1CD3G 5GZCA 3RNSA 4DUVA 1UQXA 1CQ9A 3UT0A 3AXDA 1K12A 3T0BA 4META 4OQ9A 1QQP3 1FV2A 1QOSA 4MYEA 1POV0 2VL4A 4DPNA 1YO8A 3I4IA 5A6ZA 2TEPA 4LPLA 3WW4A 3LKJA 4P9XA 2EXJA 3KS7A 5JSOA 1MZEA 4N53B 3DPRC 1FMD1 3M3CA 5J09A 1LCLA 3VBFB 4CDQB 2CDOA 1DQ6A 1QDOA 4CPBD 2R062 3U75A 3IB3A 4DRVA 1AXKA 2I45A 3CZJA 5E88A 3ZXFA 4Y4YA 2DCYA 4QPYA 2VNGA 1UCXA 3AM2A 4I0WB 4XURA 2R1DA 3J8F1 4DY5A 1W0PA 5CA6A 2IXKA 5A1AA 3MGUA 3SNMA 1VB2A 2GN7A 3KCCA 4C1WA 4BQ5A 1W06A 5KHKA 1AR72 1DP0A 1W8ZA 5C5UA 4KU7A 2YU1A 2W1SA 3WP5A 2QQJA 4YPJA 1BBT2 5GJ6A 3SH3A 3FUQA 1DZRA 1COV3 4BCUA 1LNSA 3S0MA 2D93A 1PZ8A 1XYNA 2QQLA 3ON7A 1OQDA 4IEXA 5DN2A 4P08A 1WMEA 3VHRA 4BISA 4XJUA 5LRRA 2PAMA 1BEV2 1DQ2A 1CIYA 1YXWA 3DYPA 3PU8A 4YSFA 5BNOC 1AR71 4RHV2 1FI2A 4AVTA 5CFDB 2WNUA 1LR5A 4IV3A 1OD3A 4E8DA 5JXHA 4H14A 3E6CC 1FXZA 4JGYA 3C8XA 4QHBA 4U36A 1HXS3 1OH4A 1RUH1 2XWJB 2D3SA 4YW6A 1K42A 2JKBA 3J7NA 5FQ0A 1DGRA 4LORA 4WVMB 4FAHA 1TME3 3AMMA 3MLJA 4Q4X3 5ERLA 4OHYA 1R093 4CE8A 5LA1A 5IFTA 3POYA 4HK9A 4XZPA 3CF6E 4I0AA 3UKNA 3ZXDA 1WLWA 1E5SA 1T2XA 1F31A 2VCBA 4TN7A 1MVEA 2ARAA 4B8EA 5LWBA 4LQRA 3WHTA 5LB6A 4QPGB 3WDTA 5JXIA 4KG8A 4Q0SA 1GZWB 3AYAA 3N7KA 3UJOA 2IVJA 5FPUA 2E7AA 3HT2A 3IKWA 4LO7A 5APAA 4BPZA 4LIVA 4ZY9A 2DU1A 4UW5A 1ZM1A 3VL9A 4ASKA 3OTFA 3VZOA 1GQGA 1S2KA 3W21A 4DUWA 2DUPA 2ZZQA 4YVWC 2K46A 2O0OA 2NP0A 1IPKA 1AZDA 1O5UA 2F4PA 1PO22 1MS3A 4XUTA 1JOJA 4NHKA 3MO4A 5FZ4A 2OYZA 2V72A 2ZEYA 2RR11 5AC92 3OGJA 5LBBA 2XXZA 1XJAA 2BP6A 4Y1UA 3U07A 1UZYA 1FNYA 1V6MA 3QBQA 1RL3A 1US2A 3Q8BA 2P1BA 3MFCA 4HVOA 3KMHA 3WF4A 1CAWB 4K1ZA 5IATA 2BWAA 1GQHA 3I2GA 5D8AB 4H7LA 1NY72 2BRTA 2QQOA 4GJZA 5C71A 2I74A 3MZHA 5IYYA 4DY3A 3CNAA 2WNOA 4CP0A 4PBOA 2XVGA 2BQPA 5CG8A 2W39A 4R9CA 5EQUA 1C1FA 2VO5A 3K51A 2D3RA 3PVEA 3ZIWA 4EWDA 5A33B 2VTFA 4AQSA 1H8TB 1OSGA 5GLVA 4N9IA 1YC61 1YLLA 5E16A 1Q8OA 3CBNA 5JOYA 3JD73 1LESA 1C28A 1CJDA 1PVC2 3KHBA 2RS32 3MIGA 5BNPB 3A23A 5CU1A 3ES4A 1SLCA 3WINE 1GZ9A 5FK7A 1VBA3 4R8HA 1C1LA 5HCAA 1R083 4GH4C 1KFXL 1ZZ6A 4NPMA 1OF3A 2ZOEB 3OEAA 3FFZA 4PHZA 4GWNA 2EIDA 2Q1ZB 2WDBA 2CHHA 3O1RA 3VBHA 1O4TA 4P5HA 1ULDA 4PJYA 3AXEA 3WR0A 4A44A 3C7GA 2X5IA 3M2MA 4C91A 4NROA 3WNOA 1U0AA 3ZXEA 2B42B 2PLV1 3ECQA 2HWF2 2XJTA 5ABJA 1Q3EA 1J59A 3BN6A 2WQ4A 5FCCA 2QQWA 3B00A 4Q0QA 4YG3A 3TEZA 1UY2A 1WMXA 4M3CF 1GYKA 3LOIA 2RMU3 4N7IA 5IFPA 2HWB3 4PDWB 3SITA 5JIAA 3KT4A 1LAJA 4Z8BA 2BVBA 4GXLA 3O1MA 1V6NA 4NWWA 4AI8A 4EZ4A 2P3KA 4WM7A 4ZZ8A 4BWOA 4RS5B 1ZRFA 1VPHA 5FZ3A 2B9VA 4NUBA 4EN8B 4LOTA 2OW4A 3USUA 2DBNA 2V4AA 4LLFA 2UWAA 1DQ0A 3UGFA 1LECA 4JDMA 4MADA 2ZPXA 2DV9A 2SBAA 3DKWA 5F5IA 2VCMA 1YFXA 2WYSA 4LR4A 5CKQA 5FREA 2Y6HA 1OA3A 3RWKX 5FMOL 5ACA1 5LASA 4O9EA 4IV3C 2DTWA 5FXWA 1RHI3 4Z2WA 2CAUA 1SCRA 4LEJA 4JGYC 3MDPA 2JX9A 1R1A1 3KF3A 1A8DA 5FY0A 4H55A 3GXUA 1J83A 2R49A 4LHLA 1RUC1 1S0GA 2Y64A 5A7PA 4XIOA 3GZTB 2N7GA 1VBB2 4N43C 4Q4V1 4P02B 1ZZ7A 3K4AA 4OHVA 4Y1YA 4RGAA 1J3QA 4B7KA 3SCHA 1OFSA 2JG8B 5IK4A 1NXMA 2VZSA 3ORJA 4QGLA 2JDYA 3B9CA 2TUNA 1CIWA 3M3EA 2VBDA 1LEMA 3EJKA 4UW4A 1AYN3 4XDPA 5IVEA 2FDIA 1K5JA 1ASJ2 5J7MA 3NV3A 1FATA 1JZ5A 5GLUA 1ND3C 4W65A 1RUG3 1BVVA 2P4EA 4F7ZA 2W47A 3ZKYA 5CISA 2WWSA 1RUI3 1SBDA 5T52A 4BDVB 5BYNA 4IESA 1GUIA 2PELA 2BV4A 3WQ1A 3ZSEA 4EWAA 3U37A 2TBVA 2ZEZA 3WF3A 1Z7S3 1K5MA 1LU2A 4B3NA 1IS5A 2PQQA 2HYKA 5FPAA 5C3RA 1GZTA 5JVVA 2QQMA 3N9NA 4CA9A 4J1WA 4K1YA 2GAUA 1A3KA 1XBFA 2VAUA 2D97A 3VZLA 2ZGUA 4LXLA 3H3UA 2RJKA 3HEIA 1WBFA 4CDWA 4DEVA 4WM8C 4ARXA 2ZX4A 1WW6A 4IV1B 1M06G 2E53A 4AEMA 1ZBE2 3M4FA 1ZVFA 4HONA 1DFQA 3LPGA 4JRLA 1IKQA 4MGZE 4ES9A 1AHSA 1RGSA 4XYXA 2BOIA 2DCJA 4S2DA 2VZRA 3WW3A 1UWWA 2WINB 5FXZA 4UI9L 3S5AA 3N4MA 2BNOA 4Y5TA 3SXWA 4DINB 3BYWA 4RSUA 5JPMB 4JAAA 4NHLA 4WVZA 4N53A 3WNXA 5CYYA 2J22A 4HANA 2VNOA 3VBFA 2ERFA 1GR3A 4BK5A 4CDQA 1BHGA 5A3MA 2RS53 1CPMA 2VOKA 4CUGA 2Z2SB 2PQSA 4FFHA 2HYXA 2YBKA 4NMIA 1V6IA 2WZR2 1H9PA 2VMDA 4RR3B 5FY7A 2GC1A 4LO4B 1PO12 2A6ZA 2BNNA 1LHVA 3C7HA 4AEDB 3BPSA 1X9TA 1W6NB 1QOTA 4QXBA 1S0EA 2HWE3 1ULOA 1XC6A 4HSLA 3VBHC 1FPN3 4HOOA 1SLAA 2UWBA 2QUOA 3O1VA 4QDSA 4W6XA 1MS9A 2CSGA 3I54A 2VUCA 3N35A 1VMFA 3OCPA 2ZX3A 4RQPB 4HZFA 5CZKA 2JD9A 5DAPA 5ABJC 3GZAA 4KQ7A 4UAPA 3O0VA 1TG7A 1UMZA 2JE8A 4YW7A 1UIJA 1O3SA 1EAH2 2C6SA 1SBEA 3POWA 4B1MA 1L7QA 2A6WA 4OHXA 4QHOA 5CFDA 2R0FA 1GP4A 1XOYA 3Q8FA 2PAEA 5FYMA 4URAA 5C4WB 1O6UA 2ZJCA 3C3VA 4XILA 2JECA 3TOJA 2J7MA 3T4HB 2JDAA 1LOFA 3ATGA 1XNTA 3V0BA 4QPIC 4WVMA 1JUHA 2HBUA 2PHUA 4AFBA 4GWJA 5GZFA 4LULA 1CN1A 2XR4A 5A1LA 1JYWA 3NKTA 4NRQA 4DO0A 2HWD3 1HQWA 4NIHA 2DF7A 4BQ3A 1F8VA 2YGMA 4JTNA 4BQ2A 1O8SA 4QPGA 1V9U2 2JE7A 4CU9A 1PIV2 1WBLA 1WMDA 3RI9A 4LA3A 1LEDA 4QT6A 2WNEA 1U5XA 5F6LB 4GH4B 3ZR5A 1C4RA 4XACA 2IC1A 2YBPA 3KM5A 2BNMA 3LGRA 1Q5OA 4LO5B 3JXSA 5FYYA 3M3QA 2JKXA 2KXLA 1WW5A 4BHPA 1UXZA 3ZFEB 4Q4W2 3BIEA 3WP3A 5KXDA 1R1ZA 3KV6A 4QX7A 3UGHA 4BB3A 3W59A 4HG6B 4NHYA 1RUE3 4QPWA 3GCXA 2JG9B 1CX4A 5BNNB 2B9UA 3IAQA 1J1TA 2P37A 1OPMA 1AR93 2RDSA 5C70A 1V70A 4QXHA 3NKGA 4N90A 1ZBA3 1RUJ2 4FO9A 1CAWA 2VQTA 4KBBA 4XQ4A 4BA6A 2IWGB 1TMF1 5D8AA 3JQWA 3ZYHA 3P3PA 2ID4A 2J1SA 3KZ4C 2XMLA 2XQRA 3LDRA 3NV1A 3KVBA 3RS6A 2YPDA 4DXZA 5FO8B 2VMIA 4MH0E 1SLIA 3UESA 2OUHA 5FOJB 5LEJA 2MEV3 1BKZA 1GP6A 1FOD2 2P3JA 2X8KA 3BOWA 1W2UA 1D4M3 1W39A 3ES1A 4HLTA 5DAQA 5A33A 1RUF1 4D6RA 4Y3OA 4BYYA 2AZ5A 3LEMA 5EPAA 3UKTA 3WG4A 1VRH3 2FZ1A 3AKPA 2HEYF 4FQ4A 4GJYA 4MV2A 5DDJ1 4A3ZA 1ND2C 1G6NA 1W0OA 1AL23 3FFQA 3ZFFB 3AL6A 1GQPA 1POQA 5BNPA 2OQ7A 3PUQA 5J96B 5JPNB 4IE4A 3R4DB 2XPJA 4FFGA 4JHTA 1XB9A 3ZX7A 3WF1A 5E89A 2RS13 1HRI3 3CJIC 3DYMA 1H1IA 1ENSA 2AACA 3WUCA 2QDNA 1NCRB 5L9RA 3RRDA 3PU3A 3BTYA 1Q43A 1ZZBA 2R073 2FQPA 1XNAA 2DUQA 1Q56A 2K9ZA 2OT7A 3TBDA 2OXBA 4UF0B 2KR2A 4XPVA 2ZEWA 2ZZJA 3FLPA 3PDQA 3NNMA 5JAXA 3D6EA 3LWCA 4N53C 1KDMA 3O12A 4COUA 1X8EA 5FZOB 1AYM3 2XHKA 3VBFC 3V56A 4YW2A 3KV5A 5J1XA 1UYXA 2WS92 5FZHA 5IAXA 5LY1A 5JWPA 3DL3A 1D7PM 2WN3A 5FPLA 1QJY3 1YQ5A 2Q1MA 3BB6A 4BIOA 3VUOA 3NV2A 4HETA 1N1TA 2OQ6A 3ZN4A 3T3YA 1ND3B 4FPJA 4PDWA 2G9GA 3UGGA 4PQQA 1B35C 4EE2A 1NA1B 3AKTA 3LDBA 4MGTA 4R52A 4XJ9A 5FLIA 1W8TA 1ZRRA 3CO2A 3VDAA 3MIFA 1ULPA 4IDZA 5JR7B 4BLJA 3ZYGA 4YW3A 4AEKA 4ZKTB 3NSTA 1DYOA 5L7OB 1RUNA 2ORXA 1X33A 2LS6A 3I59B 3VKFC 3VKNA 1OPOA 4GB32 1NZCA 4Q27A 4QQLA 2YY1A 3W20A 1QU0A 4AI3A 2A7AA 2JDZA 3PJYA 3B93A 5FZIA 4WM8B 4D7SA 4YZ2A 5JXJA 1W9SA 2WSVA 2PA7A 2PHDA 1C8M1 3E5UA 1H9WA 2EXHA 1LOFC 4QM8A 4GB31 3IDAA 4HPKB 2IXIA 4X8NA 4XQWA 3RZJA 1H30A 2WFF2 4FXGB 3N9OA 1MVQA 4LO8A 2W0XA 4FFFA 4Q2FA 4XFCA 4YM3A 5LZ6A 1PHMA 2VY0A 2QVSB 3VHNA 2D3PA 2IVIB 4GMP1 2IZWA 4C0BA 1AXZA 5A6YA 2JG8A 3MW4A 4QPGC 1QJU3 5FP7A 3ZXJA 1W9FA 1AR82 1GFF2 1MPXA 2EXKA 2VVDA 4PF5A 3IT8A 4Y20B 2AUYA 4DZGA 2XQXA 1PGL2 1ZRDA 1QH7A 2GU9A 2W1UA 5C7GA 3PVNA 4YGDA 3MPPG 2NYYA 3CJXA 4IGPA 2R041 3LFMA 4UFIA 5EFUA 5FYTA 3I3QA 4YW1A 4CUAA 1UU4A 4IE6A 1OURA 1JU3A 1ZRCA 3D4KA 1WW7A 4QAWA 1W6QA 1F9KA 1LULA 3T2TA 1HJGA 4AOCA 3AZXA 2WT1A 2XWBB 4QM9A 5T5OA 1F2NA 1WLCA 2LUWA 3QCWA 1UIKA 3WCRA 4AI0A 4AVBA 1PGL1 2VMGA 4Y4RA 4ZZ5A 1EV13 1W6MA 4XFBA 1S0DA 3SEPA 2KM2A 3A0NA 3HNBM 4XETA 4DB5A 4D94A 1F5FA 3DN7A 3UKVA 4UFLA 1UNBA 1H1MA 5F3GA 1JZ3A 4BQWA 4IL7A 2ZEXA 2YUEA 4K21A 4FPCA 4QX5A 1KFUL 1O3QA 2ZGMA 1I1EA 2PN5A 1F4HA 2CNAA 5D8AC 1BQPA 3WG2A 1HN1A 3RWNA 5KHIA 1RUD2 4RA0A 1O4ZA 1JW6A 3SC7X 2WL1A 3U10A 3HAGA 1DQ5A 5L19A 2VXJA 1JBCA 4Q1RA 1B09A 2ARBA 4OVEA 5GALA 2PHFA 1EPWA 3I3DA 3FWEA 5HBAA 1OA2A 3GNEA 4QPIB 3BODA 1KJLA 2DCTA 4P9YA 1H8TC 1AUYA 2X10A 1WCSA 4COZA 1URXA 2EVXA 4A4AA 5FZ7A 3D8CA 1RUD1 3HIFA 4ISRA 2WO3A 3F95A 4XBQA 5FMOS 1T6BX 1GWMA 5IAVA 4FAGA 4LO6B 5HCHA 4BU2A 4PBPA 5B4NA 3E6DA 4FTBA 2XBO2 1HX6A 3X29B 5BY5A 1LGBA 1VBD2 5CFCB 1LOCA 2OPWA 3WQ7A 4RR3A 3WVJA 1JZ2A 4PCRA 5FJHA 3GGLA 2E32A 1PNFA 3DXUA 1X7NA 3OBTA 3O5SA 1LHNA 1JYXA 1CAVB 4UFJA 5FZEA 4KU8A 5FLJA 2FDHA 1VBD1 1QQP2 2BVVA 3INAA 4YGCA 2VE1A 4URTA 1QGLA 4X6RB 2BBAA 2JIJA 1XSQA 5IVFA 4AFAA 4RQPA 3SCGA 2Q4SA 4JGZB 1RMU3 4XUOA 3I2KA 4BZ4A 1O7FA 2PHTA 3PURA 1S55A 1YQ8A 2CGNA 2RM21 3R05A 1REEA 3KGLA 4D8MA 2ZHLA 4CU8A 2ZX0A 3N3HA 1DBNA 4S2HA 2WSUA 4CTEA 4ZS2A 2Z79A 5FY1A 1MQTC 1RYYA 3FBYA 2A1XA 2YC2A 3M7AA 4TWTA 4XC9A 3RG0A 1YHFA 1W2OA 1VBE3 2JIGA 3EB7A 1ONAA 5C4WA 2ENRA 3M70A 1R64A 2GP3A 1EY2A 4LKSA 1XPWA 4RS5C 1BJQA 2Y0OA 3R6SA 5C9AB 2Y34A 5FYHA 4NIAA 2J1VA 4UBGA 2ZAHA 2UY9A 1VBC3 5AVPA 1RVF1 2VZ1A 1JMUB 1IG3A 2DWRA 3VKMA 1KITA 3AJYA 3GZEA 1COV2 3KD4A 1F4AA 4M0NA 1QJX1 4CDUB 4CU6A 1G8WA 3C7OA 5GLTA 3NRUA 3VDBA 2BERA 2XJUA 5F2SA 3I7DA 3PIJA 4XTPA 4EYUA 5HV4A 3KCXA 5FZMA 1GNYA 1KJRA 3CIHA 3LCPA 4XHXA 2WKKA 2RJ2A 1QJZA 5FMDA 3U0ZA 3LSEA 2EIGA 3BGAA 4GH4A 2PTMA 3VBRB 5I0RA 1HXS2 2JDUA 4KI5M 2AEYA 4UBHA 2FDJA 3FMGA 1KGYA 1TME2 4Q4X2 3ZFEA 4D6SA 2ARCA 1R092 2GZWA 1QWRA 5KWRA 4PIYA 2PHLA 5FUIA 2JG8C 3ZYJB 2XJVA 1UF2C 3AZYA 4FPHA 4QWNA 1ULFA 2AYHA 4MXWB 4LBQB 1YQ6A 2JG9A 3IZOA 5GKAC 3ME2A 1I9RA 4GWIA 4UW3A 4XBNA 4OQ8A 2QZ2A 3I3MA 2JE9A 4LNVA 4H3WA 2WWJA 5G05L 4QGMA 5FXXA 3PUIA 3WT3A 4E4HA 3LOBA 4KNCA 4Y24A 3UV9A 4AQTA 1B35B 1SEFA 2PYTA 1STMA 5I0UA 3T2PA 3AL5A 4HFSA 2R061 4YZ5A 3K48A 3G6JB 2FBEA 5F32A 5L36A 3P5BA 4K8RB 4MHUA 2W94A 1H8VA 4MGKE 4CSWA 2RDNA 4YVSB 2VZPA 3S6PA 1QKQA 4AAXA 3J4UH 5D1IA 4R9AA 3ZFFA 4MGIE 2VGDA 1JS9A 3TB0A 3MHZA 4IV1C 3ZXKA 1UAIA 1BBT1 1HRV3 1DDLA 4GKYA 5A32A 5I8TA 1NG0A 3ZYFA 4LE4A 2XJSA 2WYFA 4ZU4A 1BEV1 1GOHA 3IIIA 3IDCB 2GMPA 3J7MA 3JBG3 3L2YA 4Q0VA 5DMYA 4RHV1 1AJOA 3KGZA 4N43A 3LEGA 4OI4A 3P3NA 5A7SA 2QQUA 4UF0A 2XL7A 3AJZA 3MF6A 4OLLA 2CAVA 3HJRA 4JRAA 5HXVA 3DF0A 3JD72 4QKBA 2DDUA 5FZOA 2EXIA 1LHUA 3H3LA 3NNGA 1SG3A 4WV8A 4XF1A 4YARA 4KWLA 4XW3A 5E6HA 5H9PA 3SHRA 1HIXA 1VAVA 2VULA 1FMD3 2ZCWA 4RR3C 5HPOA 1VBA2 2ARXA 1LOGA 4W8JA 1R082 1WMFA 1V6OA 3AMQA 4AEDC 1ND3A 2A6YA 3ZYBA 3OOXA 5F2WA 1W99A 4EV0A 2ETEA 3O1PA 1NA1A 5H9RA 3ZIXA 2PMWB 1AL0G 2AREA 3T0AA 1S0BA 5BV6A 3IMNA 4QDRA 3J8F3 1F15A 1JN2P 1W04A 4RQPC 3N9MA 5H9QA 2HWC3 1LGNA 2G19A 3QACA 1DQ4A 3I59A 4AR2A 2VZ3A 5L9VA 1LKNA 3MW2A 3SKVA 3ZMNA 4YW4A 2ZHNA 4I3PA 4AW7A 1OT5A 4M0HA 4AAPA 2MPFA 5F6KA 5FPBA 3I8TA 2RMU2 4WM8A 1JYTA 1DYPA 4NIDA 1PO21 2HWB2 2FCVA 5C4WC 2ZTNA 1ALYA 1OKOA 3VD9A 3ZYRA 1V00A 4FPEA 4JQRA 3CL1A 1JZ6A 3FC0A 5AC91 4HPKA 4W6YA 3HPNA 2EALA 1MS0A 3OEBA 4O61A 4CCEA 3JUUA 5B2GB 3S57A 1JU4A 2ZGOA 2PAKA 3EBRA 1RUH3 4EN7B 3M8LA 4FP2A 3WG3A 1P8JA 3V0AB 1BVP1 1NY71 4QX1A 2RG4A 2Y6GA 4YW5A 3MIBA 3DXTA 2VU9A 4FT8A 4ZXEA 1W8UA 3AP6A 1POV1 4JKLA 1MACA 3ACFA 3DUIA 5KHGA 4QMAA 4Z2AA 1A6CA 1N3OA 1RHI2 2B4KA 2ET7A 2VW2A 3K46A 2Y38A 2VQAA 2FCTA 3B02A 4QQOA 1CZVA 4XHBA 5BUVA 2WABA 2CGPA 1UYPA 4UYBA 2ZAAA 1EP0A 1GNZA 2D7FA 3OJBA 3OGVA 1PVC1 1H4GA 3LB9A 4FOVA 2RS31 2F17A 2VOVA 5EWSA 3I97A 3OPWA 3ZFEC 3ZYIB 1WCKA 2QBXA 5A3WA 2P3YA 1TQ5A 1GSLA 2ES3A 5A3LA 1RHI1 2VVFA 4ZHNA 4Y33A 5FJKA 2XJPA 5FYBA 2QCSB 1Y7BA 2XOMA 1VRBA 2CWMA 1X8MA 3TYJA 2JG9C 3PUSA 5LBCA 4AI9A 3WQ0A 4NN0A 5BNNC 1YI9A 1HW5A 4ZU7A 1SHWB 1OC1A 1AYN2 3S30A 1C8NA 1LTEA 5LA0A 2R16A 4EROA 2Y0IA 2R1BA 2RR13 4QXCA 1MQTB 1RUG2 4GULA 1WLTA 2IFWA 5LK5A 2HWF1 1RUI2 3VKLA 2A70A 3AP7A 3CZUA 2VMFA 4UFMA 1O4YA 2R30A 2IXJA 2PHRA 5DG1A 3USSA 3UL2A 3VDDB 4NO4A 1XYPA 4QPIA 4XJWA 5HXMA 2FD8A 3UNPA 1UOFA 1Z7S2 4HMZA 2QE3A 5IT6A 1MS5A 4W4ZA 1OLME 3DGTA 3H8RA 3OB8A 3UYJA 1XU2A 3E6BA 3ZFFC 2WUHA 1QH6A 1UZ0A 2EAAA 4L8QA 2WLPA 2NQYA 4ZU5A 1NCQB 1K45A 1Z7S1 2GH8A 1X50A 1JOPA 3S7IA 5CFCA 2DCKA 1W8NA 1WUVA 2R0HA 2D5HA 1NCRC 2W95A 5DG2A 1G7YA 4CP2A 3W5MA 2Q0AA 3VBOB 3O1SA 1XQNA 1HQLA 3GBGA 5BPXA 1RB8G 3WDXA 2GNMA 1CAVA 4IETA 4JKMA 1V6KA 4RGGA 4YZ4A 2OUJA 2JDPA 1O3TA 1UO9A 2XUMA 4QDQA 1GZCA 2ZKNA 3AKQA 4M00A 4OFGA 4SBVA 5FFOC 5IVJA 1A78A 2CGOA 2OVUA 2RHPA 2V5DA 3KB5A 1OBNA 1VBB1 1W0NA 3ILNA 2XKPA 2RS52 3HQXA 2QFEA 1DG6A 2PLV3 2R6QA 4CDXC 1MS4A 3BIWE 1WA4A 1G9FA 4MLOA 3ZMOA 1A34A 1SDDB 2WZEA 1W05A 5LBEA 5FYCA 1W9WA 1NA1C 3ZN6B 4HKWA 4YM1A 4BOWA 5DUVA 2HWE2 1NQJA 3A0KA 1FPN2 1G9CA 5C9AA 3GHNA 1NT0A 4Q0PA 1ASJ1 3B9IA 1CPNA 5L7OC 1ENXA 1TNRA 5L9BA 2YC4A 5FBZA 2O14A 5JZGB 3ITQA 5FYIA 3WDWA 1Q8VA 1ND2A 1O91A 1Y3TA 4XAAA 2UWCA 3OPTA 1FPN1 5FAXA 3U11A 3I49A 2WNVB 1S2BA 4PLMA 5SV8A 1GANA 3E97A 5EYYA 2Y6JA 2W1WA 3IPVB 1OLRA 4QQPA 4V1PA 3CJIA 1S0CA 5ACA3 2VQUA 1Y9QA 3VBRA 5DAVA 2ZKLA 3ETQA 4KGQA 3OSDA 2W46A 5DUXA 1R1A3 4OMCA 4MGQA 1IPSA 1PGSA 1YQCA 4A6OA 4IE5A 3BTZA 4QU2A 1RUC3 1UKGA 1ZBE1 3WNPA 5AFBA 3GDBA 3I3BA 4IUGA 3RYKA 1PMHX 2D6KA 4Q4V3 3B7MA 2HWD2 5FZ9A 4OUSA 2WZPP 1GBGA 2QQKA 4BM8A 4LBQA 3SEEA 3U4XA 3OUIA 3T30A 2Y8KA 3OYWB 3R4UA 3WNKA 5CKMA 1SFPA 4FVVA 4IW3A 1H6XA 2G1MA 2XH6A 1C3HA 2EIEA 4PI2A 1PX3A 4M4RA 4LBOA 1ZZ9A 5FZDA 4QQHA 1B35A 4P9LA 5T50A 4L0PA 1RC6A 2YXSA 1YFYA 1UU5A 4NWVA 3VN4A 1DYKA 3ZSJA 3AB0A 3I2DA 4LBNA 1W2AX 4B1LA 1DCSA 3EMRA 2WZR1 4RFRB 1YIFA 1PO11 3KV9A 5CB7A 2JB4A 1RUE2 4YVSA 1DGLA 2GMEA 5J36A 3U1XA 2ZGRA 4LJHA 2D5FA 3D0SA 4QX2A 1PZ9A 2RE9A 4JC1A 1AR92 4A2UA 4Y5SA 3AVRA 4COVA 1ZBA2 1QEXA 2HH9A 5F5QA 2H6BA 3ZXAC 3SKJE 5FZGA 3RZZA 5IK7A 4HXCA 1I6XA 1XRUA 2E33A 2EIBA 2ATFA 2IXLA 1EAH1 3JB8A 4H2AA 2A3XA 1S0FA 1W8FA 5HCBA 1CX1A 3TRSB 2MEV2 2Q5TA 5FPZA 1IKPA 1D4M2 5C8CB 1G86A 5FRAA 1VRH2 3ALQA 3KVAA 5FZKA 2WQ8A 4M3CE 2YMZA 3VGIA 3K77A 1AL22 1APNA 4GKXA 1EUTA 1O5LA 1GZWA 2LROA 4Z07A 5CFCC 3O1UA 3AFKA 1Q8SA 4DNYA 1D4M1 2RS12 1D0HA 1OXCA 3NNJA 3OGSA 5JI9A 1HRI2 2A75A 4JX0A 4CEYB 1HV1A 2AR6A 2H6CA 2I2SA 3WF0A 4JVAA 4A3XA 1YQ2A 3HOBA 4IEQA 4CCDA 3MF9A 4JV4A 4Q29A 2R072 2E7TA 1V9U1 2JDKA 3NJZA 1QXJA 4MG2A 1NKGA 1PIV1 3K3NA 5CAZA 5FBJA 3S7EA 4RGKA 3RI8A 3J9SA 2Q8DA 1HRI1 3Q8CA 1ENRA 3FL7A 4JGZC 3K2OA 2JDNA 3NJVA 1U12A 4WVWA 4XZUG 1AYM2 1J58A 3POFA 3WW2A 1UYZA 5IVBA 1QXPA 1WCDJ 4Q4W1 1MEC2 4YZ1A 3IAPA 3LFIA 1QJY2 4IERA 4Y26A 5JSRA 5JXGA 1W2NA 4D7YA 4QKDA 1Y9GA 2QQNA 3NJYA 3VZMA 2QJVA 3ZFGC 1RTVA 1U5ZA 2XHNA 1RJ8A 2WN2A 1QNYA 2YYOA 3O0WA 1AYM1 4WBBA 4ZONA 1KS5A 5EXOA 1BYHA 4B29A 5JOXA 1H2LA 5C9AC 3H9AA 5HV0A 4C8DA 2VTXJ 3LD8A 5BNQA 4QGNA 1H2NA 2BFUL 1MEC1 1S0JA 3THCA 4Z1VA 3ZLIA 1QJY1 5EIYB 4NRPA 4A45A 3P6BA 1H8TA 1PMJX 1RUJ1 3CKHA 1ST8A 2LW8A 4CDUC 4CUBA 1NLRA 3V0AA 1H2MA 4XTMA 3O1TA 3WHUA 5FYSA 3WXPA 2UU8A 3I2JA 4OCTA 3BKZA 4LK7A 1MS1A 2GNTA 2QQVA 2WAOA 1FOD1 3SMHA 2A5ZA 4A7YA 4J1XA 3A7QA 3QOPA 3VBRC 3TWIA 3ACHA 2WA4A 4P9GA 4BMBA 1LJ7A 2AC1A 4E8CA 3PMSA 4M01A 4BLIA 3WOGA 3L9JT 1NYWA 2NLRA 3PMEA 1BXHA 3B3QE 4P5YA 4Y22B 3RZKA 4XDQA 1IOAA 4LLOA 5CIRA 4KMQA 5A7OA 1E57A 4CCCA 3QD6A 5FZ8A 3TNQA 3WY6A 2WNUB 1QJU2 4Z92B 1S4CA 2VZUA 5JDBA 4NVPA 4AI2A 1S2EA 1UZVA 2VOTA 4UFHA 1UZWA 2SLIA 4CDXB 1D2QA 2VG9A 5FQ0B 3UJQA 1MQTA 2VUAA 1N1SA 3OD0A 1W03A 2BYVE 3NW4A 3LA2A 1QHDA 5LW9A 4YGEA 1CAXB 1PMIA 2WS91 3CEWA 4RS5A 4XFAA 1DLCA 3WV6A 3RZLA 1TMF3 3MIDA 1IGOA 1I5PA 1Y43B 1TEIA 5JI7A 2CYFA 1J84A 1EV12 2WWUA 1H6YA 3KWVA 4XJ8A 3H42B 4IEYA 5CADA 3S5QA 5A3NA 4YVSC 4XF0A 2DVFA 4YG6A 2UY8A 2LALA 2QKDA 3H50A 5EJZB 2XKOA 1RUF3 1XE0A 1HB2A 5A3UA 2XJRA 3KLSA 3OBZA 1UMIA 3PJQA 3OGGA 5DDJ3 5IVCA 2ZHKA 1NCQA 2YPJA 4MVTA 2JXAA 4EZHA 4MOAA 5FY4A 4NIGA 3OF1A 1DIWA 3ZDVA 1H4HA 2G9FA 3HVDA 1VR3A 3VD5A 4AZZA 1L7LA 2Q8CA 2BEOA 5A7QA 3VBOA 2VXRA 2WC2A 2BTVC 4F83A 1ULCA 3GBWA 4CP9B 2Y60A 2CL2A 5T55A 1RXFA 3GCWA 2ZGSA 2YV8A 3PHMA 5GM0A 1OF4A 4HN1A 5EHDA 5CVRA 4A7KA 1O59A 1SDWA 1LU1A 2VD7A 2ZGNA 2OS2A 2GMMA 4YM0A 3WDVA 1UD1A 1GKBA 4FFIA 4IEPA 3H0OA 4A6SA 3QH7A 2WFF1 4P00B 4YZ3A 3TN93 3BTXA 2BBVA 4LHNA 3HN3A 1SQ4A 5EZWA 3HT1A 4G4FA 1LOBA 3AMHA 2WO1A 5FO7B 3RSJA 1ZYBA 5A7WB 1TVGA 1Y4WA 4PIXA 3ZN6A 4E2QA 1AR81 1E5RA 4WZFA 2NZ9A 2R32A 4HKLA 3MBWA 5K4LA 2WRAA 4E27A 4CXWA 4YFZA 4PT6A 4Y1XA 1JYIA 1DHKB 3SQOA 4B4PA 1AJKA 4LKEA 4QXKA 1RMU2 2O8QA 5C3OA 1DZQA 3OY8B 1YIPA 5I0TA 5DXDA 2VUDA 2O8OA 1W8HA 4AGVA 4FP3A 3WG1A 2WNVA 3GYDA 2VECA 4A7ZA 2VTXA 4IV1A 2QQIA 3IPVA 5T5PA 2JENA 5A3OA 3BU7A 1W6OB 3KT7A 4XFIA 2ADEA 2XUEA 4RN5A 3AYEA 5LA9A 2BU9A 3M3IA 4LHKA 1AX1A 2X5IB 4B7EA 2BGPA 1C8M3 1Q8QA 1PK6B 2IFRA 3FHAA 3WDUA 1US3A 1YRZA 3GALA 3N7MA 1L3JA 3Q8AA 1AR63 4GB33 1VBC2 2WJSA 1HB1A 1HLCA 4V2VA 2DFBA 2ZGKA 3LSDA 2WQZC 2OIIA 4AGRA 1W3VA 3ZYPA 1GICA 1SBFA 1T6GC 5IK5A 4GMP3 1DZTA 1XNBA 2J1UA 5TSWA 5K9YA 2W9XA 3ZDSA 3OYWA 4N9HA 4LBKA 2E31A 1AXYA 1XYOA 4L97A 4IXLA 1JOBA 3BOPA 3RGBA 1NQDA 2AEZA 2VVEA 4AEDA 3WCSA 1W6NA 4RD7A 4XFGA 4CCJA 2W68A 5IVVA 3USUB 2AGSA 2P6CA 5D21A 1N3QA 2R043 1FT9A 1UW8A 2XBO1 3J26N 3MUY1 3MFAA 1NZIA 4MZUA 5FK8A 4CUCA 4FBFA 3D5OA 3RZHA 1DU3D 2ZMLA 1VP6A 2CV6A 1ULGA 1UY4A 5ANNA 5JCTA 2V5YA 4LOSA 2PHXA 1XSRA 3BI3A 4OI2A 1I3HA 3E5QA 3WP4A 2DTYA 1JH5A 4UOJA 5FTTC 1QQP1 1FNZA 2DYCA 5A3PA 2HLEA 5J3UA 5FZLA 4AWDA 2DURA 5E8AA 1PGW2 5CEHA 4G9SB 3ZN5A 5L73A 3ZFGB 1TNFA 3H7JA 1W8OA 1AX2A 2W87A 3MICA 4D7TA 4E9KA 5J48A 5SV5A 2EAKA 4XAEA 3EXUA 4GAZA 3B01A 3F2ZA 4PLOA 4OI1A 2IXCA 3VDDC 1YCIA 4GZ9A 4MO3M 4NPRA 3ILFA 4TLGA 3ZXGA 3WF2A 4IGQA 3LA3A 2FDKA 1GNHA 1PGW1 2XDVA 3MEPA 1G9AA 5BXXA 5ANQA 4LKDA 1BCXA 2CDPA 1WA6X 4ASMB 4RFT0 1V0AA 3SH5A 5C3PA 1ODMA 2JICA 2RV9A 1VAMA 2Y33A 1JZ4A 2ORZA 2VOWA 2UYBA 3IDBB 1NCQC 4HK8A 4E4DX 2YFUA 3O0XA 3AKRA 4L9BA 1HRV2 1WZXA 4DS0A 2DCZA 2JB8A 4HT1T 5I0SA 4JKKA 1OOPC 4MUVA 4UWDA 1COV1 1W6PB 1YFUA 1ZA4A 5DZFA 3WUDA 2Q8EA 3VBOC 4GIQA 3VBUB 4CCLA 2XLAA 2VR4A 1DGWA 3K3OA 4NE9A 1MZ5A 3KV4A 4X6QB 3JBG2 2WO7A 3N9QA 3VKOA 1N1YA 4GWMA 3MW3A 4XFHA 1LHWA 4S2GA 1V6LA 2V73A 1QXRA 2VBBA 2ZMNA 3T2OA 4XVHA 4AHXA 1QY4A 4CDWB 5JLVA 2AH2A 1HXS1 4R4ZA 4K7JA 4Q1PA 3O14A 5FXVA 2JJ6A 5BNNA 1SLBA 2XLFA 1GWLA 1MZFA 1TME1 4Q4X1 2JD4A 1Q8PA 2PFWA 3I3EA 1R091 4SLIA 5KC5A 1FMD2 4K40A 1OHFA 4COYA 1XNDA 3IM0A 2RM23 2VUJA 2Y6KA 4YWAA 5B4XA 4F8AA 4FOYA 1PNGA 4WVVA 1YNAA 3LPFA 3SISA 4C0HA 1JYNA 1TZOA 4C90A 1FV3A 2CU5A 3JU9A 1OA4A 3I2FA 5FZAA 3EQEA 1DLLA 3J8F2 4QHZA 3ZPOA 4UT5A 2DVDA 4LBMA 4DXSA 1QNWA 3VD7A 2HWC2 4IEWA 4XCBA 4XOGA 1YI7A 4JTOA 4HVRA 1E5IA 1HN0A 1UU6A 2RVAA 5JZGC 4HL0A 3H1YA 4OULA 4FPLA 1FYUA 3PVOA 1RVF3 2WNVC 1OUSA 5AFEA 1QJX3 1UZZA 4H7MA 5GLWA 2PXJA 3AKSA 3FBMA 2HWC1 3IDEA 2D6LX 5DAXA 2FMDA 2J1EA 2D40A 3VBSC 4AXOA 5IJRA 5C3QA 2XLGA 3LAGA 4NAMA 1NCRA 4PIZA 1UYYA 3EHKA 3T2QA 4OUEA 4PQ9A 4ISQA 4Q4Y3 3N9LA 2GNDA 5C8WA 3BU0A 4LK6A 4XXAA 5C33A 3H7YA 4QU1A 2GH2A 3O7OA 2FHRA 5FY5A 1RUH2 1BZWA 3JCIA 2C0ZA 2NN8A 2X53S 3C7EA 4Y22A 5EJ1B 2ZGQA 2VZTA 4F3JA 4D0QA 1SMVA 3ZM8A 2YZ4A 2BPA2 1AF9A 5AVAA 5F37A 4Q5OA 1UY0A 5JMOA 1CVNA 2VCAA 4O65A 2WIIB 2BGOA 3ROUA 4KWJA 4LKFA 4XUQA 4CDXA 3HNYM 1NUKA 1UXXX 2QZ3A 3RZGA 3V0BB 3WW1A 3AMNA 5EP9A 4IEVA 1LOAA 3JD71 1ZA7A 2OKXA 5F3EA 2XVKA 3ABZA 2XONA 1JYVA 2MHFA 2RDRA 4I02A 5FR3A 1CAXA 2DU0A 2VPVA 1NAEA 1OI6A 4CEWB 4PLNA 1VBA1 3C2UA 3K75B 1R081 2W5FA 3KCYA 5FUPA 3DECA 5L7OA 4XMIA 2OX0A 2R063 3VD3A 2WA3A 4BQYA 4ASLA 1YFWA 4AVAA 1LRHA 5DUUA 2RJLA 4HVQA 4AQ2A 2GC2A 1RXGA 1RIRA 4W6WA 2RR12 2D6NA 1WKYA 4AHYA 4LUKA 1AR73 1VE0A 3VD4A 2BFUS 1YEWA 1GMMA 2P3IA 1BBT3 5T54A 5F3CA 4CP9A 1ZX5A 4YFWA 2YFZA 3N7LA 4L99A 5FMCA 3T09A 5CG9A 1RINA 1PX4A 3HNMA 1LHOA 2RMU1 2E7QA 3LEKA 5C8CC 4D6QA 1G9BA 2HWB1 3GM8A 1OD5A 3U4SA 1BEV3 4IE0A 4ES8A 3PL0A 1CWPA 4RHV3 1DQ1A 2WT2A 4XCAA 5ISLA 1M4WA 2ILMA 4BK4A 3RJRA 3FLTA 2VH9A 4JQTA 4Y20A 5LATA 3RQ0A 4OI0A 1QMJA 5T5JA 1X36A 2VOXA 4CEYC 4E2SA 5KXBA 2LM3A 2D44A 1EPZA 3NAPB 4JHZA 4NR1A 5T5LA 2EF6A 5A7WA 1KXGA 2B8MA 2H0VA 4QQ2A 3VZKA 4OYUA 2W2IA 1A8MA 4RL7A 1IG0A 4FCAA 3KQ4B 1KD7A 2V09A 5A3TA 4KH9A 2WBKA 4EWEA 4TLFA 1W90A 4Q0UA 5FP3A 2ADDA 2ET1A 2Y6FA 4BJ0A 2FMYA 3VDCA 2BJSA 3NQHA 3W5NA 4LHSA 3T1MA 3RVHA 1REFA 2GALA 3OY8A 3MIEA 4ORFA 2VW0A 2BW8A 5FYZA 2G9ZA 3CQOA 4P9IA 2E63A 2PLV2 3UK9A 3PTRB 1VMHA 3SLIA 4XABA 2Z69A 3RZMA 3ST7A 1W6OA 4GALA 2DUOA 2E6VA 1Z78A 2A71A 2VZOA 5E1RA 3WDYA 3WSOA 3WEZA 3DEMA 1ULEA 1SPPB 3BALA 1PO23 4ZPIA 1JHJA 1OUXA 1AYN1 4AFMA 3BTAA 4QB1A 5FP9A 5JOWA 1PK6A 3NVCA 3KSCA 3R4SA 3POBA 5AC93 4M3CB 1RUG1 2HJIA 3ZXLA 2GNBA 4QKNA 1DGWX 1H2KA 1RUI1 4UFKA 1UN1A 1CGPA 1IS4A 4XJAA 1LENA 3OUJA 1GWKA 4J25A 5CNAA 4DMIA 4I0BA 5FZCA 1ZZ8A 2P2KA 1IQDC 5DQ0A 4B4QA 5I93A 4MGYE 1KDKA 2ZACA 4YG0A 1POV3 2WAAA 1OOPB 2QTWB 3GJAA 5ACA2 4XQDA 5FO9B 4NRMA 3PLQA 5FWJA 3HBZA 3WZ1A 1WCQA 1W28A 4XXPA 3KT1A 1D0GA 1R1A2 4XF4A 2BGCA 4HBNA 4CCMA 2XGXA 1LB2A 2D6OX 1PVC3 3HN1A 3DCQA 4J6GA 1RUC2 2RS33 4AVVA 5JUVA 3AP5A 3SH4A 4JGZA 4CCNA 4XBLA 4Q4V2 2WNUC 1D4VB 2C9AA 4QX3A 1OLQA 2XJQA 1C5HA 1H1AA 3MYXA 1KS4A 4DXTA 1NOVA 1JHNA 1G9DA 1BK1A 3D82A 5G04L 5K0UB 1RUOA 3M1HA 1KEXA 1NXD1 1QF3A 4P14A 1UPIA 5C6CA 1Y9MA 2HEWF 3ZFGA 4C1XA 2JDHA 2C9KA 2X09A 1ZNPA 2VJXA 3ASIA 4D69A 3VV1A 3KQRA 3TNPB 2RS51 3AMPA 3ETPA 3ZSMA 4MGSA 4COWA 3MPBA 2HWF3 4LA2A 1HB3A 3DPRB 5KHHA 3C7FA 3JB4C 3WLUA 2UYAA 3GZUC 3POSA 2FCUA 4TTGA 4CDUA 2AENA 3JQXA 1ENQA 2HWE1 2C24A 4KWKA 1CAUB 4FXKB 4XFFA 3V64A 3ZVXA 5IHRA 4ZXKA 2KD7A 3EYPA 3QH6A 1VAKA 5A70A 2VMCA 3ZPYA 1SFNA 3HWJA 1RJ7A 3LA7A 1W6QB 1OQEA 3A4UA 4CXYA 2VNRA 2K2SA 3VBSB 3H8XA 1W6PA 3VBUA 1OVSA 4K8FA 1W6MB 3DYOA 3N7JA 2VQ0A 3T08A 5F3IA 4QX0A 5FZ6A 4A41A 4IEOA 3NO8A 2X05A 5T3NA 4KGGA 3IBMA 2EICA 5A7NA 4CP1A 4FPYA 2B7YA 4L2NA 3TEWA 1SFYA 3WX5A 5BNOB 2BDRA 2OZ6A 4MXWA 3ACGA 3RYPA 1ACCA 4MX3A 4YRDA 3LE0A 4O7XA 3OBAA 4BQ1A 5DAWA 3CHXA 3CLPA 5DZEA 1QJEA 3AK0A 1XE7A 2W52A 4YYOA 3T0DA 1LGCA 1VBB3 2C5DA 2ZMKA 2A6VA 2HWD1 3H1WA 4Q8LA 5FWEA 5A1FA 2WFPA 3FHIB 3FX3A 5FKCA 5LK7B 4EN6B 2YGLA 3UETA 3W58A 1VLNA 4FTEA 3D3AA 3I2IA 1YWKA 5GZEA 3A21A 3WNLA 1OQ1A 1TE1B 2YB7A 1OLMA 3I2HA 5KBFA 5FPXA 4CRQA 2WR9A 5C3SA 5F1RA 1ASJ3 2OPKA 4Q26A 4GD4A 4RYDA 4NHMA 3A22A 1AVBA 3WNMA 2F6BA 3GBFA 4G3YC 5IWFA 1WD3A 3BVCA 3K4DA 3NV4A 1U5IA 3LZZA 1I5ZA 4TSVA
chains in the Genus database with same CATH topology
1RUE1 3HR9A 5KC6A 3AZZA 4YVWB 4UW6A 1X82A 3AYDA 4ATEA 2X5IC 2EA7A 4IEUA 1NE6A 2MNGA 3AP9A 1OMIA 1PK6C 5KXEA 2VW1A 1FAYA 2W08A 3IIAA 3W9AA 1AR91 2E9QA 1ZBA1 3WP6A 4BMEA 2QDRA 5I8SA 1WD4A 2A3WA 5GZDA 4AHZA 2XVLA 1ZBE3 4LUMA 1WW4A 3ZSKA 2MEV1 4R4XA 1O3RA 1OKQA 4WM7C 3NL1A 2ZX1A 2CTVA 1JTZX 3RJ2X 3DV8A 1VRH1 3FLRA 4HKOA 5KXCA 4L11A 3OBRA 1UPSA 4P9JA 4QD2A 3AZWA 1AL21 3D0JA 3G7DA 3IN9A 4ITCA 4R9BA 3BPZA 5FDBA 1MR5A 4Z82A 1OFNA 4AG4A 4JCKA 4CEWA 3VZNA 3VHOA 5JIUA 2RS11 5DUWA 2Z42A 3BCWA 1HV0A 4HN0A 3GHMA 1WGPA 2UURA 2XG3A 4K6BA 2A73B 2WZR3 2R071 2Q30A 1JXNA 4CYDA 1PO13 3THPA 5IUQA 2O1QA 4AGGA 4HSJA 2VMHA 3FZ3A 4GMP0 2YC0A 2ZX2A 2Z5WA 2B46X 4AK3A 2DVGA 1SACA 4LE3A 2BWCA 2NMNA 3THTA 4EJRA 1CESA 1N47A 2GSYA 3B5LB 2YHJA 1TMF2 2E51A 2IXHA 4XEZA 4Y5Z0 1EYBA 3B94A 1EAH3 4AFCA 4E4ZA 3MIHA 1WLDA 4TZDA 4K20A 2X29A 1RUF2 2CY6A 3ZO0B 3H1MA 1QDCA 4FOQA 1V6JA 4YLZA 5DDJ2 4MSVA 4OHWA 3AFGA 3URFA 3VBUC 5GZGA 3NAPA 1K5MC 3OD4A 4AI1A 4LT5A 4ONUA 5K7PA 3PNAA 3APBA 4AVSA 1HDKA 4ATFA 2Q8OA 2QQPA 1V9U3 2A6XA 3MI8A 4FQZA 4S2FA 4XF9A 4CDWC 5LRSA 1PIV3 4IV3B 5FOBB 2DFCA 5A32B 1C57A 4JGYB 1YJLA 3RMYA 2KA3A 3TN92 5JMCA 2ZS6B 3MLKA 4FPFA 4EN9B 4OUMA 1UX6A 2ZGPA 4Q4W3 2ZGLA 4N43B 1DF0A 2DVBA 4D3WA 1QJU1 4BH9A 2HEVF 1H0BA 1BMV2 3VDDA 3R0RA 4INDA 4P9WA 3TN91 5JOZA 3AX4A 1NE4A 5HCFA 4I01A 2CWSA 2GC0A 2ZGTA 3ENRA 4CDQC 1JYCA 1S0IA 4M3CA 4FPGA 1MEC3 3HMYA 3OPZA 4LBQD 4AHWA 1VIWB 4LBJA 1RUJ3 2B5HA 4NOTA 2H0BA 4YGBA 1BMV1 1UKRA 1CR7A 1EV11 3AYCA 2Y26A 5EYXA 3N36A 1OOPA 1FOD3 4DQAA 1GLHA 1LOEA 2ZABA 1RITA 4XE9A 4TYSA 2OZJA 4AEJA 2ZBJA 4AFDA 1C8M2 4KL1A 4YM2A 1AR62 1N3PA 4CZSA 1ZZCA 2D6MA 2NPIA 1KRIA 4KG0A 5JSPA 1VJ2A 5CBLA 2K0GA 4O9GA 5CFDC 3H3ZA 2NMOA 4FPOB 3MLLA 1I5ZA 5GLZA 3QLQA 2YROA 5F9TA 2XB6C 2WT0A 4L92A 5K0UA 1AR61 3RPQA 2QNKA 4AE2A 1HKDA 2D6PA 3V65A 4I09A 3JZVA 4E4SA 1XNKA 2R042 4CEWC 2NM1A 5DZGA 1F5JA 3DPRA 4K9SA 4DRRA 2WS93 1N1VA 5KHJA 3AZVA 1FX5A 3B69A 5JZGA 1CAUA 4I2OA 2G4IA 4IQPA 3FUOA 1AX0A 2JEMA 5I8YA 3NWKA 4IEZA 3E5XA 4AYUA 4BIFA 1PVXA 4XMAA 1XU1A 3VBHB 2LTNA 4OHZA 4I3GA 1SCSA 1SLLA 1GV9A 1RMU1 1VBE2 4JDNA 2PHWA 3VBSA 4JDOA 1REDA 2BUKA 5I91A 1MZ6A 1D2SA 5EV7A 2P34A 1J1LA 2B39A 3RMXA 3T1LA 1HQNA 1XXNA 1IS3A 5ABJB 1XE8A 5IK8A 4OZXA 4DFSA 3IWZA 3SCFA 4LTAA 1VBE1 3VL8A 2I07B 1C5IA 4R9DA 1KQRA 2D43A 4XJZA 5BNOA 3EO6A 1IS6A 3L2HA 2B45X 5FLHA 5HI0A 3CU7A 1CJPA 1VBC1 4WM7B 4XIKA 4N7UA 4FPKA 3VLBB 2WFF3 3NAPC 3FJSA 1MS8A 3WD5A 2C1FA 3PVBB 4K3UA 3FE5A 4MXVA 1IHMA 1Z0HA 3ELNA 1PZ7A 5J98B 5K8SA 1ZREA 1AR83 4FTSA 5BNPC 1VALA 1NLSA 1IZ3A 1YUDA 3HD8B 4XF3A 3TAYA 2XL9A 4GQ7A 1QOOA 5LEKA 4B4RA 4DOUA 1LODA 2FZ2A 1IPJA 1J3PA 2RM22 4I30A 3PTYA 4WZCA 1XNCA 2P17A 4YVWA 2GN3A 5J37A 3Q9OA 4Y1VA 1DGRN 4AQ6A 1SLTA 1UL9A 2OA2A 4Y1ZA 4U2AA 3ILRA 4FOWA 4GA9A 5C8CA 1PM7A 2D98A 4LBLA 2GDFA 4FSJA 3RYRA 1YJKA 3M3OA 2HKXA 4AVCA 1U5YA 4E2GA 4PDWC 3RDIA 4EN0A 1RVF2 1RUD3 1J3RA 3VHPA 4YNIA 2WLQA 1QJX2 1S1AA 2TNFA 4CEYA 1K5MB 3AP4A 3ACLA 2YDEA 4Q4Y2 4Q8KA 2ZA9A 2A3YA 1VB4A 5EJ3A 3VZJA 4BE3A 1HRV1 3H8UA 1YYNA 1ND2B 2DVAA 2GC3A 2XBO3 4UXAA 3ZSLA 1CONA 2ZHMA 1VBD3 3GF6A 1IQAA 1JUIA 3JBG1 4Q4Y1 5H9SA 4X8PA 3CJIB 4AF9A 5K0UC 1CD3G 5GZCA 3RNSA 1CQ9A 3AXDA 4META 1QQP3 1FV2A 1QOSA 4MYEA 1POV0 4DPNA 1YO8A 3I4IA 2TEPA 3WW4A 3LKJA 4P9XA 2EXJA 3KS7A 5JSOA 1MZEA 4N53B 3DPRC 1FMD1 3M3CA 5J09A 1LCLA 3VBFB 4CDQB 1DQ6A 1QDOA 2R062 4DRVA 1AXKA 2I45A 3ZXFA 5E88A 4Y4YA 2DCYA 4QPYA 2VNGA 1UCXA 3AM2A 4I0WB 4DY5A 2R1DA 3J8F1 5CA6A 1W0PA 2IXKA 3MGUA 3SNMA 1VB2A 2GN7A 3KCCA 4C1WA 5KHKA 1AR72 4KU7A 3WP5A 1BBT2 5GJ6A 3SH3A 3FUQA 1DZRA 1COV3 4BCUA 3S0MA 2D93A 1PZ8A 1XYNA 4IEXA 1OQDA 3VHRA 1WMEA 4XJUA 5LRRA 2PAMA 1BEV2 1DQ2A 1YXWA 4YSFA 5BNOC 1AR71 4RHV2 1FI2A 4AVTA 5CFDB 2WNUA 1LR5A 4IV3A 4H14A 3E6CC 1FXZA 4JGYA 4U36A 4QHBA 2XWJB 1HXS3 1RUH1 2D3SA 2JKBA 5FQ0A 1DGRA 4FAHA 4WVMB 1TME3 3AMMA 3MLJA 4Q4X3 4OHYA 1R093 3POYA 4HK9A 4XZPA 3CF6E 4I0AA 3UKNA 3ZXDA 1WLWA 4CP2A 4EV0A 1F31A 1MVEA 4B8EA 3WHTA 4QPGB 3WDTA 4KG8A 4Q0SA 1GZWB 3AYAA 3N7KA 3UJOA 2E7AA 3HT2A 3IKWA 4LO7A 4BPZA 2DU1A 4UW5A 1ZM1A 3VL9A 3OTFA 3VZOA 1GQGA 1S2KA 2DUPA 2ZZQA 4YVWC 2O0OA 2NP0A 1IPKA 1AZDA 1O5UA 2F4PA 1PO22 1MS3A 1JOJA 4NHKA 2OYZA 2RR11 5AC92 3OGJA 4Y1UA 3U07A 1UZYA 1FNYA 1V6MA 3QBQA 1RL3A 3MFCA 4HVOA 3KMHA 1CAWB 4K1ZA 2BWAA 1GQHA 5D8AB 4H7LA 1NY72 3MZHA 2I74A 4DY3A 3CNAA 4CP0A 4PBOA 2XVGA 2BQPA 5CG8A 2W39A 4R9CA 5FO8B 1C1FA 3K51A 3PVEA 2D3RA 3ZIWA 4EWDA 5A33B 1H8TB 1OSGA 5GLVA 4N9IA 1YLLA 5E16A 1Q8OA 5JOYA 3JD73 1LESA 1C28A 1CJDA 1PVC2 2RS32 3MIGA 5BNPB 5CU1A 3ES4A 1SLCA 3WINE 1GZ9A 1VBA3 4R8HA 1C1LA 1R083 4GH4C 1KFXL 1ZZ6A 2ZOEB 3FFZA 4GWNA 2Q1ZB 3VBHA 1O4TA 4P5HA 1ULDA 4PJYA 3AXEA 3WR0A 2X5IA 3M2MA 4C91A 3ZXEA 1U0AA 2B42B 2PLV1 3ECQA 2HWF2 2XJTA 5ABJA 1Q3EA 1J59A 2WQ4A 5FCCA 3B00A 4Q0QA 4YG3A 4M3CF 1GYKA 3LOIA 2RMU3 4N7IA 2HWB3 4PDWB 3SITA 5JIAA 3KT4A 4Z8BA 2BVBA 4GXLA 1V6NA 4NWWA 4AI8A 2P3KA 4WM7A 4BWOA 4RS5B 1ZRFA 4EN8B 2OW4A 3USUA 4LLFA 2UWAA 1DQ0A 1LECA 4JDMA 2ZPXA 2DV9A 2SBAA 3DKWA 1YFXA 4LR4A 5FREA 1OA3A 5ACA1 5FMOL 4O9EA 4IV3C 2DTWA 1RHI3 4Z2WA 2CAUA 1SCRA 4LEJA 4JGYC 3MDPA 2JX9A 1R1A1 1A8DA 4H55A 2R49A 4LHLA 1RUC1 1S0GA 4XIOA 3GZTB 2N7GA 1VBB2 4N43C 4Q4V1 1ZZ7A 4OHVA 4Y1YA 4RGAA 1J3QA 4B7KA 3SCHA 1OFSA 2JG8B 5IK4A 1NXMA 4QGLA 3B9CA 2TUNA 1CIWA 3M3EA 1LEMA 3EJKA 4UW4A 1AYN3 1ASJ2 5J7MA 3NV3A 1FATA 5GLUA 1ND3C 4W65A 1RUG3 1BVVA 4F7ZA 2WWSA 1RUI3 1SBDA 5T52A 5BYNA 4IESA 2PELA 3WQ1A 3ZSEA 4EWAA 2TBVA 1Z7S3 1K5MA 1LU2A 4B3NA 1IS5A 2PQQA 2HYKA 5JVVA 4J1WA 4K1YA 2GAUA 1A3KA 3VZLA 2D97A 2ZGUA 3H3UA 2RJKA 4CDWA 1WBFA 4WM8C 2ZX4A 1WW6A 4IV1B 1M06G 2E53A 4AEMA 1ZBE2 3M4FA 1ZVFA 1DFQA 4JRLA 4ES9A 1IKQA 4MGZE 1AHSA 1RGSA 4XYXA 4S2DA 2DCJA 3WW3A 2WINB 3N4MA 2BNOA 3SXWA 4DINB 4RSUA 5JPMB 4JAAA 4NHLA 4WVZA 4N53A 3WNXA 4HANA 2VNOA 3VBFA 2ERFA 1GR3A 4CDQA 5A3MA 2RS53 1CPMA 2VOKA 2Z2SB 4RR3B 1V6IA 2WZR2 1H9PA 2GC1A 4LO4B 1PO12 2A6ZA 2BNNA 1LHVA 4AEDB 1W6NB 1QOTA 1S0EA 2HWE3 4HSLA 3VBHC 1FPN3 1SLAA 2UWBA 2QUOA 4W6XA 1MS9A 3I54A 3N35A 3OCPA 2ZX3A 4RQPB 4HZFA 5ABJC 3GZAA 4KQ7A 3O0VA 1UMZA 1UIJA 1O3SA 1EAH2 3POWA 1SBEA 2A6WA 4OHXA 5CFDA 2R0FA 2PAEA 5C4WB 2ZJCA 3C3VA 4XILA 2JECA 3TOJA 1LOFA 3ATGA 3V0BA 4QPIC 4WVMA 1JUHA 2PHUA 4AFBA 5GZFA 4LULA 1CN1A 1F8VA 3NKTA 2HWD3 1HQWA 2DF7A 2YGMA 4JTNA 4QPGA 1V9U2 2JE7A 1PIV2 1WBLA 1WMDA 3RI9A 4LA3A 1LEDA 4QT6A 2WNEA 1U5XA 5F6LB 4GH4B 1C4RA 2IC1A 3KM5A 2BNMA 3LGRA 1Q5OA 4LO5B 3M3QA 2KXLA 1WW5A 4BHPA 3ZFEB 4Q4W2 3WP3A 5KXDA 1R1ZA 3W59A 1RUE3 2JG9B 1CX4A 5BNNB 2B9UA 1J1TA 2P37A 1OPMA 1AR93 1V70A 3NKGA 4N90A 1ZBA3 1RUJ2 4FO9A 1CAWA 4XQ4A 4KBBA 4BA6A 2IWGB 1TMF1 5D8AA 3JQWA 3P3PA 3KZ4C 3NV1A 3RS6A 4DXZA 2VMIA 4MH0E 1SLIA 5FOJB 2OUHA 5LEJA 2MEV3 1BKZA 2P3JA 1FOD2 2X8KA 3BOWA 3ES1A 1W2UA 1D4M3 1W39A 4HLTA 5A33A 5HCAA 1RUF1 4BYYA 2AZ5A 3WG4A 3UKTA 1VRH3 2FZ1A 3AKPA 2HEYF 4FQ4A 5DDJ1 4MV2A 1ND2C 1G6NA 1W0OA 1AL23 3FFQA 3ZFFB 5BNPA 5J96B 5JPNB 2XPJA 3R4DB 3ZX7A 5E89A 2RS13 1HRI3 3CJIC 1H1IA 1ENSA 3WUCA 2QDNA 1NCRB 3RRDA 1Q43A 1ZZBA 2R073 2FQPA 2DUQA 1Q56A 2K9ZA 3TBDA 4XPVA 2ZZJA 3FLPA 5JAXA 3D6EA 3LWCA 4N53C 1KDMA 3O12A 4COUA 1X8EA 1AYM3 2XHKA 3VBFC 3V56A 4YW2A 2WS92 5JWPA 3DL3A 1QJY3 2Q1MA 3BB6A 4BIOA 3VUOA 3NV2A 4HETA 1N1TA 3ZN4A 1ND3B 4FPJA 4PDWA 2G9GA 1B35C 1NA1B 3AKTA 4R52A 4XJ9A 5FLIA 1ZRRA 3CO2A 3MIFA 5JR7B 4BLJA 3ZYGA 4YW3A 4AEKA 4ZKTB 3NSTA 5L7OB 1RUNA 1X33A 3I59B 3VKFC 3VKNA 1OPOA 4GB32 1NZCA 4Q27A 4QQLA 2YY1A 4AI3A 1QU0A 2A7AA 2JDZA 3PJYA 3B93A 4WM8B 4D7SA 4YZ2A 2WSVA 2PA7A 2PHDA 1C8M1 3E5UA 1H9WA 2EXHA 1LOFC 4QM8A 4GB31 4HPKB 2IXIA 4X8NA 4XQWA 2WFF2 1H30A 4FXGB 4LO8A 1MVQA 4Q2FA 2W0XA 4XFCA 4YM3A 1PHMA 2VY0A 2QVSB 3VHNA 2D3PA 4C0BA 4GMP1 2IZWA 1AXZA 2JG8A 3MW4A 4QPGC 1QJU3 3ZXJA 1AR82 1GFF2 2EXKA 2VVDA 4PF5A 4Y20B 3IT8A 2AUYA 4DZGA 1PGL2 1ZRDA 1QH7A 2GU9A 3PVNA 4YGDA 3MPPG 2NYYA 3CJXA 2R041 5EFUA 4YW1A 1UU4A 1ZRCA 3D4KA 1WW7A 1W6QA 1F9KA 1LULA 3T2TA 4AQSA 3AZXA 2WT1A 2XWBB 4QM9A 5T5OA 1F2NA 1WLCA 2LUWA 3QCWA 1UIKA 3WCRA 4AI0A 4AVBA 1PGL1 2VMGA 1EV13 1W6MA 4XFBA 1S0DA 2KM2A 3A0NA 4XETA 4DB5A 4D94A 1F5FA 3DN7A 3UKVA 1H1MA 4IL7A 2YUEA 4K21A 4FPCA 4QX5A 1KFUL 1O3QA 2ZGMA 1I1EA 2PN5A 2CNAA 5D8AC 3WG2A 1BQPA 5KHIA 3RWNA 1RUD2 4RA0A 1O4ZA 1JW6A 2WL1A 3U10A 3HAGA 1DQ5A 5L19A 1JBCA 4Q1RA 1B09A 2ARBA 5GALA 2PHFA 1EPWA 3FWEA 5HBAA 1OA2A 3GNEA 4QPIB 3BODA 1KJLA 2DCTA 4P9YA 1H8TC 1AUYA 1WCSA 4COZA 1URXA 2EVXA 3D8CA 1RUD1 3HIFA 4ISRA 4XBQA 5FMOS 4FAGA 4LO6B 4PBPA 3E6DA 4FTBA 2XBO2 1HX6A 3X29B 5BY5A 1LGBA 1VBD2 5CFCB 1LOCA 3WQ7A 4RR3A 3WVJA 4PCRA 1PNFA 1X7NA 3OBTA 3O5SA 1LHNA 1CAVB 4KU8A 5FLJA 1VBD1 1QQP2 2BVVA 3INAA 4YGCA 4URTA 1QGLA 4X6RB 4AFAA 4RQPA 3SCGA 2Q4SA 4JGZB 1RMU3 4BZ4A 1O7FA 2PHTA 1S55A 2CGNA 2RM21 3R05A 1REEA 3KGLA 2ZHLA 2ZX0A 3N3HA 1DBNA 4S2HA 2WSUA 4CTEA 2Z79A 1MQTC 3RG0A 3FBYA 4TWTA 3M7AA 4EN6B 1YHFA 1VBE3 1ONAA 5C4WA 2ENRA 3M70A 1EY2A 4RS5C 1BJQA 2Y0OA 3R6SA 5C9AB 4UBGA 2ZAHA 2UY9A 1VBC3 5AVPA 1RVF1 3VKMA 2DWRA 1KITA 3AJYA 4CDUB 1COV2 3KD4A 4M0NA 1QJX1 1G8WA 5GLTA 2XJUA 3I7DA 4XTPA 3KCXA 1KJRA 3LCPA 4XHXA 2WKKA 1QJZA 3U0ZA 3LSEA 2EIGA 4GH4A 2PTMA 3VBRB 5I0RA 1HXS2 4UBHA 3FMGA 1TME2 4Q4X2 3ZFEA 1R092 2GZWA 1QWRA 5KWRA 4PIYA 2PHLA 2JG8C 3ZYJB 2XJVA 1UF2C 3AZYA 4FPHA 1ULFA 2AYHA 4MXWB 4LBQB 2JG9A 5GKAC 3ME2A 1I9RA 4XBNA 4UW3A 2QZ2A 2JE9A 4LNVA 4H3WA 4QGMA 3WT3A 3LOBA 4KNCA 4Y24A 3UV9A 4AQTA 1B35B 1SEFA 2PYTA 5I0UA 4HFSA 2R061 4YZ5A 3K48A 3G6JB 2FBEA 5L36A 1H8VA 4MGKE 4YVSB 3S6PA 1QKQA 3J4UH 5D1IA 4R9AA 3ZFFA 4MGIE 2VGDA 3TB0A 4IV1C 3ZXKA 1UAIA 1BBT1 1HRV3 1DDLA 4GKYA 5A32A 5I8TA 1NG0A 4LE4A 2XJSA 4ZU4A 1BEV1 3L2YA 3IDCB 2GMPA 3JBG3 4Q0VA 4RHV1 1AJOA 3KGZA 4N43A 4OI4A 3P3NA 2XL7A 3AJZA 3MF6A 4OLLA 2CAVA 4JRAA 5HXVA 3DF0A 3JD72 2EXIA 1LHUA 4WV8A 4XF1A 4YARA 4KWLA 4XW3A 5H9PA 3SHRA 1HIXA 1VAVA 2VULA 1FMD3 2ZCWA 4RR3C 1VBA2 2ARXA 1LOGA 1R082 1WMFA 1V6OA 3AMQA 4AEDC 1ND3A 2A6YA 2ETEA 1NA1A 5H9RA 3ZIXA 1AL0G 2AREA 1S0BA 5BV6A 3IMNA 3J8F3 1JN2P 4RQPC 5H9QA 2HWC3 1LGNA 3QACA 1DQ4A 3I59A 1LKNA 3MW2A 3ZMNA 4YW4A 2ZHNA 4I3PA 4AW7A 4M0HA 2MPFA 5F6KA 3I8TA 2RMU2 4WM8A 1DYPA 1PO21 2HWB2 5C4WC 2ZTNA 1ALYA 3ZYRA 1V00A 4FPEA 4JQRA 3CL1A 3FC0A 5AC91 4HPKA 4W6YA 2EALA 1MS0A 3JUUA 5B2GB 2ZGOA 3EBRA 2PAKA 1RUH3 4EN7B 3M8LA 4FP2A 3WG3A 3V0AB 1BVP1 1NY71 4YW5A 3MIBA 2VU9A 4FT8A 3AP6A 1POV1 1MACA 5KHGA 3DUIA 4QMAA 1A6CA 1N3OA 1RHI2 2ET7A 2VW2A 4OVEA 4QQOA 2Y38A 2VQAA 3B02A 4RD7A 4XHBA 5BUVA 2CGPA 2ZAAA 1EP0A 1GNZA 2D7FA 3OJBA 1PVC1 1H4GA 3LB9A 4FOVA 2RS31 2VOVA 5EWSA 3ZFEC 3ZYIB 1WCKA 1TQ5A 1GSLA 2ES3A 5A3LA 1RHI1 2VVFA 2XJPA 2QCSB 1Y7BA 2CWMA 1X8MA 3TYJA 2JG9C 3WQ0A 4NN0A 5BNNC 1YI9A 1HW5A 4ZU7A 1AYN2 3S30A 1C8NA 1LTEA 2R16A 4EROA 2Y0IA 2R1BA 2RR13 1MQTB 1RUG2 4GULA 1WLTA 2IFWA 5LK5A 2HWF1 1RUI2 3VKLA 2A70A 3AP7A 1O4YA 2R30A 2IXJA 2PHRA 5DG1A 3USSA 3UL2A 3VDDB 4NO4A 1XYPA 4QPIA 4XJWA 1Z7S2 4HMZA 2QE3A 5IT6A 1MS5A 3DGTA 1XU2A 3E6BA 3ZFFC 1QH6A 2EAAA 4L8QA 2WLPA 2NQYA 4ZU5A 1NCQB 1Z7S1 2GH8A 1X50A 3S7IA 5CFCA 2DCKA 1WUVA 2R0HA 2D5HA 1NCRC 5DG2A 1G7YA 2Q0AA 3VBOB 1XQNA 1HQLA 3GBGA 5BPXA 1RB8G 3WDXA 2GNMA 1CAVA 4IETA 1V6KA 4RGGA 4YZ4A 2OUJA 1O3TA 2XUMA 5FFOC 1GZCA 2ZKNA 3AKQA 4M00A 4OFGA 4SBVA 1A78A 2CGOA 2OVUA 2RHPA 3KB5A 1VBB1 3ILNA 2XKPA 2RS52 3HQXA 2QFEA 2R6QA 1DG6A 2PLV3 4CDXC 1MS4A 3BIWE 1WA4A 1G9FA 4MLOA 3ZMOA 1NA1C 3ZN6B 4HKWA 4YM1A 4BOWA 5DUVA 2HWE2 1NQJA 3A0KA 1FPN2 1G9CA 5C9AA 3GHNA 4Q0PA 1ASJ1 3B9IA 1CPNA 5L7OC 1ENXA 1TNRA 5FBZA 5JZGB 3WDWA 1Q8VA 1ND2A 1O91A 1Y3TA 5FAXA 2UWCA 1FPN1 3U11A 2WNVB 1S2BA 4PLMA 5SV8A 1GANA 3E97A 5EYYA 3IPVB 1OLRA 4QQPA 4V1PA 3CJIA 1S0CA 5ACA3 1Y9QA 3VBRA 2ZKLA 3ETQA 4KGQA 5DUXA 1R1A3 1PGSA 4QU2A 1RUC3 1UKGA 1ZBE1 5AFBA 3RYKA 2D6KA 4Q4V3 2WZPP 3B7MA 2HWD2 4OUSA 1GBGA 4BM8A 4LBQA 3U4XA 3OYWB 3R4UA 4FVVA 2XH6A 1C3HA 4LBOA 1ZZ9A 5T50A 4QQHA 1B35A 4P9LA 1RC6A 2YXSA 1YFYA 1UU5A 4NWVA 3VN4A 1DYKA 3ZSJA 3AB0A 3I2DA 4LBNA 2WZR1 1YIFA 1PO11 5CB7A 1RUE2 4YVSA 1DGLA 2GMEA 5J36A 2ZGRA 2D5FA 3D0SA 1PZ9A 2RE9A 4JC1A 1AR92 4A2UA 4COVA 1ZBA2 5F5QA 2H6BA 3ZXAC 3RZZA 5IK7A 1I6XA 1XRUA 2ATFA 2IXLA 1EAH1 3JB8A 2A3XA 1S0FA 5HCBA 3TRSB 2MEV2 2Q5TA 5FPZA 1IKPA 1D4M2 5C8CB 1G86A 5FRAA 1VRH2 3ALQA 4M3CE 2YMZA 3VGIA 1AL22 1APNA 4GKXA 1O5LA 1GZWA 4Z07A 5CFCC 3AFKA 1Q8SA 4DNYA 1D4M1 2RS12 1D0HA 5JI9A 1HRI2 2A75A 4CEYB 1HV1A 2AR6A 2H6CA 2I2SA 4JVAA 4A3XA 4IEQA 3MF9A 4JV4A 4Q29A 2R072 2E7TA 1V9U1 3NJZA 1QXJA 1PIV1 5CAZA 3S7EA 3RI8A 3J9SA 1HRI1 1ENRA 4JGZC 1U12A 4WVWA 1AYM2 1J58A 3WW2A 1QXPA 1WCDJ 4Q4W1 1MEC2 4YZ1A 1QJY2 4IERA 4Y26A 5JSRA 4D7YA 3VZMA 3ZFGC 2QJVA 1RTVA 1U5ZA 1RJ8A 2YYOA 1QNYA 4WBBA 3O0WA 1AYM1 5EXOA 1KS5A 4B29A 1BYHA 5JOXA 1H2LA 5C9AC 3H9AA 5BNQA 4QGNA 1H2NA 2BFUL 1MEC1 1S0JA 4Z1VA 1QJY1 1H8TA 1RUJ1 4CDUC 1NLRA 3V0AA 1H2MA 4XTMA 3WHUA 3WXPA 2UU8A 1MS1A 2GNTA 1FOD1 3SMHA 2A5ZA 4A7YA 4J1XA 3QOPA 3VBRC 3TWIA 2WA4A 4P9GA 4BMBA 1LJ7A 3PMSA 4M01A 4BLIA 3WOGA 3L9JT 1NYWA 2NLRA 3PMEA 1BXHA 3B3QE 4Y22B 4XDQA 1IOAA 4LLOA