2J1RA

Structure of a streptococcus pneumoniae fucose binding module
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1rA00
5JR2A 3OGSA 5JMOA 1SDDB 2EICA 3C8XA 2HLEA 3HJRA 2YB7A 4UOJA 5HPOA 3LPGA 2C4XA 3I2GA 2V4VA 3NNGA 2YFUA 1IQDC 1NX9A 2RVAA 1KGYA 1W9WA 1UY2A 4ZXEA 3T0BA 1NUKA 4UAPA 4D8MA 4QPWA 3F2ZA 1W0NA 1GOHA 3PUIA 1NKGA 2WABA 4XUOA 3VDCA 4IUGA 2W1SA 1DYOA 3HNYM 4KMQA 4BDVB 5IHRA 2Y6KA 3CKHA 2VQTA 4MGSA 1JZ6A 4DUXA 2X10A 2J1TA 1WKYA 1US2A 3LEGA 3WF3A 3WSOA 3C7EA 4CU7A 3WNMA 1UWWA 1ULOA 3LEKA 1D7PM 3T2QA 2QQKA 3K75B 5IYYA 4A41A 2QQMA 2PQSA 4KI5M 3K77A 2R7EB 2X05A 3ABZA 3T0AA 1XNAA 4A44A 3GXUA 2W3JA 1JZ8A 1JZ4A 4PT6A 4CUAA 3CQOA 4QDQA 4LHSA 1UMHA 5I0DA 3HNMA 4HG6B 1H6XA 2VMEA 4JHZA 1W99A 4E8CA 1BHGA 3I2FA 5LA1A 1GNYA 3IDAA 1JYVA 1CX1A 3C7OA 1UYXA 2J7MA 2YFZA 4ET7A 5CYYA 1TVGA 3NJVA 2ZXQA 1YQ2A 3P6BA 2LW8A 5B4NA 3W5NA 4ZY9A 4QDSA 2E31A 5JXIA 1DP0A 1UXZA 3LPFA 1XNTA 4AAXA 2J1EA 3EYPA 2JE8A 4CU9A 3AC0A 1J83A 2DCJA 2XOMA 4CU6A 2ZEYA 3ECQA 3C7FA 4QX2A 3MV11 2HYXA 2X09A 1NAEA 2EIDA 1R64A 2Y6JA 3OGVA 3WF4A 2WDBA 4RN5A 1JZ5A 3ETPA 4L0PA 2W94A 1OH4A 2QQIA 2ZEWA 3HPNA 5G05L 3CZJA 3WNPA 5LA0A 3GGLA 2OKXA 2VL4A 3FN9A 4XUTA 4QX0A 2VCAA 1XPWA 2WO3A 5FUIA 5C71A 1EUTA 2L9LA 1W9TA 4RYDA 3T0DA 4AG4A 5F7UA 3I2HA 1EUUA 3ZM8A 1P8JA 1JYNA 4BK4A 2J1UA 2E33A 2JDAA 4MO3M 3WF2A 3OEBA 1JZ7A 3W5MA 4TTGA 1US3A 3T08A 3DECA 5C7GA 1UYYA 2VZRA 2Y8KA 2VZSA 2VR4A 1UY3A 5DN2A 1CZTA 4PQQA 2B9VA 1SG3A 3HOBA 1HN1A 2W1QA 1UX7A 2J22A 5DMYA 3I2IA 4XVHA 1GQPA 2WAAA 5JXGA 1PX3A 2W5FA 2CDPA 4DEVA 1GOGA 3EB7A 3DYOA 2VCBA 3J7HA 5DPNA 2Z4FA 2VMDA 3MUY1 2W91A 3JXSA 3UESA 4CVUA 3A7QA 3WQBA 2C26A 4CUBA 2W95A 2Y6LA 3E1F1 3VDBA 1W8OA 4QX1A 4W4ZA 1PMHX 1JU3A 1F4AA 2VC9A 3FL7A 3IAQA 1H6YA 5EIYB 3MUZ1 4LPLA 4ZZ8A 3LQCA 1UMIA 1J84A 1O8SA 2EIBA 4W50A 3K46A 2RJ2A 4P00B 1LNSA 2W87A 3NJXA 3VD3A 2ZEXA 3DYMA 2CDOA 2QQOA 1I5PA 2V72A 3U37A 3MO4A 1L7RA 2VM9A 4MGQA 3LEIA 3T2PA 2VCCA 3ACHA 2VMCA 3I2KA 2WO1A 2Y6GA 5CZKA 1PX4A 2VMFA 3I3DA 1O8PA 4ZZ5A 2VQUA 5IFTA 3A21A 2XHNA 1O59A 4CUCA 4QAWA 3A22A 4PF1A 3WNLA 3K4ZA 1W9SA 4TXWA 1DLCA 5A1AA 4A6OA 2W9XA 2QQJA 4UI9L 3DYPA 2RV9A 1L7QA 4A3ZA 1K3IA 1JHJA 3ACIA 1JYWA 1UY4A 3MBWA 1PMJX 2EIEA 4YPJA 3WF1A 3CDZB 2VZOA 2YG0A 1UY0A 1OD3A 4JX0A 3VDAA 4A45A 1JI6A 2J1VA 4E8DA 3IAPA 3VD7A 4DXSA 1SHWB 4GWIA 2WN2A 2VTFA 3FHQA 4LKSA 3WNKA 1GU3A 4A42A 2VJXA 3T09A 2W1WA 3MV01 3HNBM 2WN3A 2J1SA 3UNPA 2VZTA 2E26A 4W8JA 2W1UA 2BGPA 3SKJE 3BGAA 1T2XA 4OMCA 2XQXA 4DXRA 4JKKA 2WZEA 1UZ0A 2YC2A 2XONA 4BXSV 3K4DA 4ARYA 2BBAA 4XUNA 2WO2A 4CU8A 2B4KA 4ARXA 5EJZB 4A4AA 4M4PA 2WQ8A 1OF4A 2VZUA 3HN3A 5IFPA 1W8NA 1GMMA 2WZ8A 3VD9A 2LS6A 1K42A 2BGOA 1TG7A 3THDA 2BERA 2W92A 2E32A 4M4RA 3FHAA 5EJ1B 1OT5A 1JZ2A 2Y64A 4QB1A 1UY1A 4P08A 1JYXA 3C7GA 4FI9A 2JKXA 3I2JA 4XZUG 2J1AA 5JXHA 3CIHA 5JUVA 3CZUA 1GUIA 4OMDA 3UETA 3OEAA 4QB2A 3IIIA 3PUHA 4D0QA 4GWJA 4MADA 4QX3A 1CIYA 1ULPA 2Y6HA 3T2OA 3D3AA 2QBXA 2VOTA 3OB8A 1MPXA 3VD5A 2VO5A 1JZ3A 5B4XA 4BJ0A 4KWUA 2ID4A 1KEXA 2WYSA 3IB3A 2WUHA 3WNNA 4DUWA 2KD7A 4BK5A 2C9KA 4QDRA 5JXJA 2QQLA 2JD9A 3K4AA 4GZ9A 1K12A 3SKVA 3NRUA 5DQ0A 4JKLA 3OGRA 3SEEA 2W46A 2BZDA 3NQHA 2VZ3A 2ZEZA 3HEIA 1K45A 2WBKA 5LCWL 2YC4A 3CMGA 3ACFA 3C7HA 4JKMA 2VZPA 3OBAA 4DEQA 2WAOA 2VZ1A 4Z2AA 1JU4A 1F4HA 4DXTA 3THCA 3GDBA 3WEZA 3P1IA 2DDUA 4XUPA 2QQNA 4LQRA 3BN6A 3WF0A 1CZSA 4XUQA 5LA2A 4OYUA 2VZQA 2VZVA 3I3BA 3A23A 1GOFA 3ACGA 4MOAA 2W47A 4OZOA 5HXMA 4DUVA 4P02B 1CZVA 1RYYA 3GM8A 1UXXX 3I97A 3LE0A 3I3EA 2ORXA 3VD4A 2ORZA 4QB6A 3SEPA 1UYZA 3OG2A 4P5YA 2DCKA 4OUEA 4XURA 1WCQA 5C70A 5G04L 2V5DA 3WNOA 5IJRA 1OF3A 1XC6A 2J1RA 5J1XA
chains in the Genus database with same CATH superfamily
5DUWA 4CCNA 4ZU7A 3EMRA 4NR1A 1TNFA 4XXPA 3EBRA 5JMOA 1JOJA 5A7NA 5E1RA 4QQPA 2AR6A 1LEMA 4NIAA 4IEXA 5DAQA 3N4MA 3S7IA 3LPGA 3QBQA 1JOBA 1LR5A 1GBGA 3K3NA 4HKWA 5FYMA 2GC1A 1O91A 5KXCA 3I2GA 2V4VA 1ODMA 2XBO3 1GSLA 3NNGA 4AVAA 1UF2C 3R4DB 1DFQA 4META 2B5HA 5FY5A 1Y4WA 1KGYA 4GWMA 4UW4A 3ZN6B 4OUMA 3WHUA 1RIRA 2D6NA 4FXKB 1UL9A 3H42B 1AX1A 2A70A 1W9WA 2BVBA 4ZXEA 2D40A 4DXZA 1SLCA 1NUKA 4XW3A 3R05A 1V6JA 3FLPA 4Q4Y3 1LOCA 1PO13 4HKLA 2VUDA 3WW4A 1W0NA 1GOHA 5KXDA 2QZ3A 2WABA 4K9SA 2VPVA 2VU9A 2W1SA 3NSTA 3NV3A 4JGYC 5KC6A 4I3GA 4KMQA 4BDVB 2VUCA 4K1ZA 1Y9QA 4RGKA 5C3RA 3IMMA 5FBJA 5BNOC 4Y20A 4K20A 4Y20B 3TYJA 1FMD1 1NOVA 4DUXA 1ASJ3 4YG3A 2J1TA 3QD6A 3LEGA 1KJRA 5C3QA 4KQ7A 2NQYA 3C7EA 4CU7A 3KCXA 1RMU1 1UWWA 4UBHA 2IFRA 3T2QA 2P37A 2QQKA 2R063 3BU7A 4Q0QA 2ZA9A 5FP3A 1LODA 4QU1A 1BKZA 1RUE1 4XZPA 5L9RA 2IXKA 1WMDA 3OY8B 1MR5A 3KWVA 3NAPA 4XC9A 2QQMA 3CF6E 5C8CB 4KI5M 5BNNC 4Y5TA 4K1YA 4EZHA 5IK5A 1TMF3 1UZWA 4YGCA 5EP9A 1DQ0A 1YJLA 2R7EB 3LIHA 4AZZA 1KRIA 2OUHA 2VTXJ 2Y60A 2X05A 2ARAA 3ABZA 1FPN3 3T0AA 5FK8A 3W20A 3TOJA 2VAUA 2W3JA 1YI9A 5F5QA 1W8FA 2E9QA 3CHXA 3S57A 3A4UA 4LO6B 2DVGA 3CQOA 1DU3D 4QDQA 5F5AA 4CP9B 3DKWA 3VDDC 1V6NA 3HD8B 4EN0A 4ZS2A 3CO2A 1H6XA 1FV3A 4HG6B 3ZFEB 4EYUA 4K8RB 3VBUC 2GC2A 4E8CA 1OQDA 1S2KA 1QJEA 3N36A 3ZXGA 1UQXA 4JGZB 1FPN2 1C4RA 2VNVA 1QJX3 1SDWA 3AP7A 3IDAA 2QFEA 1PVC3 2UWCA 3NAPC 4Q0PA 4RQPB 1CX1A 1GR3A 4LLFA 4KWKA 2BGCA 1POV0 2J7MA 3OBZA 5E8AA 4FQ4A 2DV9A 4DIQA 2K9ZA 4ET7A 2BBVA 3USUA 4RS5C 1QU0A 5CYYA 3PVNA 1WMXA 3O0VA 3P6BA 1NCQA 4HZFA 2DUPA 4IETA 4KG8A 1CD3G 1C8NA 2TEPA 4WVWA 1YFYA 1DP0A 3AXEA 2W2IA 1F5JA 3LPFA 2HWE2 2D6KA 3AYEA 4CU9A 4QGMA 1WD3A 3ZVXA 1HLCA 5FMDA 5JOXA 2D5FA 3HBKA 5A7OA 2OT7A 3NV4A 1AHSA 2JXAA 2XOMA 3N9OA 4K6BA 4LHNA 3VBFC 1BBT1 5J09A 2VGDA 2WR9A 5J37A 1LEDA 3P3NA 1WA6X 3ECQA 3C7FA 2XVKA 1H1AA 3N7LA 1NQJA 3WG4A 1C8M1 3MFCA 3ZFFA 3NNMA 2QQPA 1MZ6A 5DUXA 2EIDA 2Y6JA 4PIXA 1FX5A 4IGQA 4GJYA 3LA3A 2LUWA 5A3MA 1W03A 2EF6A 2JD4A 4BWOA 2RS52 4Q4Y1 4NPRA 1GLHA 4PI0A 1AX0A 3ZYHA 1ONAA 4HLTA 5G05L 3JD73 1OFNA 4X8PA 5F6LB 3U75A 1UD1A 4Q4V1 4UBGA 4AEKA 1S0JA 3AMPA 5SV8A 2VL4A 4COWA 1UAIA 1DZRA 5F8PA 1UOFA 5H9QA 4G9SB 1KS4A 3JBG3 2VCAA 4LBQA 4N9IA 1XPWA 2AEYA 1QJU1 3D8CA 3TN92 4CXYA 1IPSA 1RUE3 1U5IA 3AXDA 4CCCA 2PHWA 5BNPB 5GZGA 5LK7B 3H1YA 1ASJ2 3JD72 4L8QA 2WLQA 1IZ3A 2QZ2A 4WM7B 3UGGA 2WS93 4YRDA 4NO4A 3O0XA 2E6VA 2RS33 3POWA 4TSVA 3AMQA 3DF0A 1JYNA 1Q3EA 2A3XA 1Q8VA 5LASA 2QQUA 2UY8A 4FTEA 1WWYA 1XSRA 1LHNA 1MVQA 1QJU2 4MO3M 4QX8A 2WFF3 1QXRA 1GICA 1JZ7A 4IEUA 4XTPA 3FWEA 1OLME 1V6KA 2VW2A 3MDPA 3W5MA 4IV3B 4GA9A 4LUMA 3DECA 3WLUA 4LITA 4X6RB 1WD4A 3L9JT 2VR4A 1UY3A 3ES4A 4URTA 1SG3A 3J9SA 1BEV2 2Y33A 1SMVA 4F83A 1O5LA 3J26N 2RM22 4XFGA 2SLIA 3MIHA 5FMOS 3I2IA 5FP7A 1AL22 3MEPA 4QPYA 1DG6A 4IV1B 3DCQA 4KNCA 5HCAA 4IV1C 5FO7B 1JTZX 1VBC1 4GD4A 3U07A 5K7PA 4NWVA 4P9GA 5EJ3A 1DIWA 4UFMA 3MUY1 4N43A 2PHTA 3RI9A 1ENSA 1ND2C 2A6WA 3JXSA 3PUQA 5FZBA 2VTXA 3B7MA 1ND2B 3SC7X 3NKGA 5A3PA 4ORFA 1ZRCA 2W95A 3GBWA 3VDBA 4RHV3 4BCUA 5CKQA 5FR3A 1NT0A 4L11A 1AVBA 1RUF3 1CAXB 2EAAA 4QHBA 4CPBA 1X8EA 5FZ3A 4PQ9A 1VMFA 2QQVA 3MUZ1 1KDMA 4CRQA 1QXJA 3FLRA 2DURA 4LPLA 2CHHA 3LQCA 3WV6A 1J84A 1LU2A 3H8RA 3ZDVA 3T4HB 1VBE2 2AYHA 2EIBA 1YHFA 4NWWA 2NZ9A 3OGJA 4NIHA 1LNSA 1GWKA 2W87A 3AZXA 4PLOA 1ENXA 3NJXA 1DGRA 1LESA 3AFGA 3DYMA 2CDOA 3AP4A 5A3UA 1ZRFA 4L9BA 3AL6A 4A2UA 3U37A 1RUF2 2AENA 2I74A 3MO4A 1L7RA 1AX2A 4MGQA 1PGL2 5FYBA 4IESA 2VCCA 4QPGB 3AKRA 2ZGSA 1V6LA 4NRQA 1MQTB 2AUYA 5IWFA 1SBEA 2P5BA 4LK7A 2VMCA 3VB9A 4DRVA 5C9AA 1MQTC 3KV9A 1AR91 2WQ4A 4K3UA 2ZHLA 5CZKA 2G9ZA 4DRRA 1PX4A 2P34A 4I0BA 1A34A 4NHYA 3I3DA 4RFT0 5LZ6A 2FDGA 5A3TA 1W8UA 2FDKA 2R072 5IFTA 4M3CE 1O59A 1HRV1 2ZMNA 4CUCA 3VBUB 1AYN2 2KA3A 2IZWA 2Y34A 4LTAA 1W9SA 3JZVA 2NYYA 4TXWA 4ZU4A 1DLCA 4U36A 3NAPB 3ZYGA 4BOWA 5FUPA 2B7YA 3T30A 2ETEA 2QCSB 4ONUA 5D1IA 2YV8A 3AMNA 5D21A 2WINB 2BP6A 3ST7A 4OQ9A 1L7QA 2FMDA 3O1UA 3U4XA 4S2HA 4Y3OA 1D4M1 2ES3A 1JYWA 1V00A 3ELNA 3VLBB 1HRV2 4AI0A 4OQ8A 3WF1A 1SPPB 2D43A 1HW5A 2J42A 3CDZB 4AI8A 5AVPA 1OD3A 2XL7A 3VDAA 4V1PA 4YZ5A 3BOPA 3GCWA 3PTYA 2BNOA 1IS5A 4FOQA 4HFSA 4DXSA 1LJ7A 2WN2A 2VTFA 4XQWA 3FHQA 4LKSA 5I8TA 4LJHA 4QXHA 2VG9A 3WNKA 3O1PA 4FPLA 1GU3A 5ACA1 3DUIA 2WS91 3O7OA 3RS6A 1RUJ2 4IDZA 2J1SA 1YQ6A 3E5XA 2E26A 5IVEA 2PAEA 4W8JA 2BGPA 3SKJE 2GH2A 3UGHA 3BU0A 4FXGB 4MYEA 2ZGMA 4MV2A 3RJ2X 4JKKA 5GLVA 3FFZA 3UK9A 4AHYA 2A73B 5CVRA 4MXVA 1PZ9A 2YROA 2R6QA 1D4VB 3BCWA 3CLPA 2I07B 2W08A 4IXLA 3K4DA 2JDHA 4QQOA 1PO23 4CU8A 3S5AA 5IVVA 3H50A 4OCTA 4R4ZA 2BOJA 5KC5A 4I2OA 4M4PA 2WQ8A 2VZUA 3KV6A 4QM9A 4F3JA 2WZR1 1UIJA 1M4WA 4KWJA 3KHBA 4QPIA 4CCEA 5IFPA 1RGSA 5H9SA 2A7AA 3VD9A 2IXLA 1K42A 1PK6A 2BGOA 2RR12 2HWF3 5BNPC 1FATA 1VJ2A 1TG7A 3ITQA 3OY8A 5DDJ1 3IBMA 2R061 2BERA 4Q1RA 3E6CC 2W92A 1WCSA 4PIZA 1BK1A 2Y64A 5C8CC 4QB1A 4MSVA 2Y38A 1CAWA 1UY1A 2Z79A 4AI1A 3LKJA 4INDA 5L36A 4P08A 1RXGA 2C9AA 3PHMA 1NZIA 3C7GA 5FYIA 3U78A 4AWDA 1JYXA 2GZWA 4IEZA 4TZDA 1VLNA 4M0NA 4PDWB 3GJAA 4XJ9A 5C3SA 3CZUA 5JCTA 5JZGB 1AR63 2YHJA 1I6XA 3J8F1 4QB2A 4JDMA 3VKMA 3OYWA 2D6OX 4D0QA 3J7NA 3VV1A 4GWJA 3ALQA 1H0BA 4FAGA 3U10A 4QX3A 5A7WB 1H8TC 2PAKA 4LKDA 4N7IA 2F6BA 1CIYA 1OLMA 2Y6HA 4Q4Y2 1BBT3 4S2FA 5AVAA 4CE8A 3D3AA 2QBXA 2VOTA 5FY0A 5KHIA 3M3EA 1DCSA 3FBYA 4UFKA 3VD5A 1YQ8A 5FYUA 4MXWA 5C3OA 2D6PA 3GBFA 4KWUA 4IL7A 1ZRDA 4YG6A 2WYSA 3HMYA 3OD0A 5D8AA 4DUWA 1PO12 4LBLA 1AR62 3KF5A 5JWPA 4QDRA 5JPNB 5ANNA 1R1A1 1XB9A 4LO8A 5FZIA 3S6PA 2YGLA 3N9PA 4FPGA 3SKVA 1CAUA 2E53A 4CZSA 1YNAA 4GULA 1HV1A 1YCIA 5JI7A 4XJUA 5F3EA 5L73A 1W8HA 1OKOA 1Y43B 4LEJA 4PI2A 5DG1A 2W46A 4CCKA 3KQRA 1C57A 3SXWA 1MZEA 1K45A 2JIJA 2WBKA 1UIKA 2XMLA 2BTVC 3ZN5A 4CDQA 2YC4A 3CMGA 3DXUA 2D44A 4JDOA 4R8HA 3WCRA 3BIEA 4OHYA 4YVWC 5C5UA 1DYPA 3OBAA 2QQWA 2W68A 4HVRA 2FDHA 2R043 4OHZA 1W0OA 4LORA 4EQVA 4DFSA 1QH7A 3FUOA 2VZ1A 4Z2AA 1FXZA 3IPVA 3THCA 3VBFB 4AHZA 4BM8A 3AX4A 2XLGA 3VL8A 5FDBA 1W2UA 1OOPC 4B4RA 1JYIA 2WSVA 4AQTA 3N7KA 2F4PA 2WSUA 1H2KA 1AR71 4GB32 5A7QA 1NA1B 4UT5A 2BWCA 2BVVA 1ACCA 4CTEA 2OIIA 4MHRA 1COV3 2VZVA 2Q0AA 1Q43A 1GP4A 4G4FA 3SHRA 4AVSA 1OSGA 1VBD1 3R6SA 1TMF1 1T6GC 1TZOA 2K46A 1GOFA 3ACGA 3BALA 1AJOA 3MIBA 4W6XA 4EWAA 2B45X 2JG8B 4K40A 2I2SA 2W47A 3JBG1 3POFA 4YVWA 2PAMA 2XBO1 2H0VA 1IKPA 3T1MA 1RYYA 3GM8A 3I97A 1J58A 4N8MA 2BFUL 5A33B 2WNUA 1NE6A 1ZBE2 3OUJA 2MPFA 2FCVA 1PNFA 1NXMA 2ORZA 4BQYA 1RUI2 4QB6A 3JB4C 4RGGA 3I3MA 3O1RA 4FFHA 4Q4X2 1YO8A 4QKDA 1S0EA 1IS6A 1CESA 3OG2A 3ASIA 3E5UA 1PZ8A 2AC1A 4FCAA 4XMIA 1LGBA 1XE7A 2UY9A 2DCKA 1OBNA 4LUKA 4M3CB 1NY71 2OXBA 3RWNA 4AGVA 1AYN1 5ABJC 4XDPA 1WMEA 2PLV3 1BEV1 5C70A 2XBO2 5ABJB 3QCWA 3WNOA 2EA7A 3NMBA 4BQ4A 2FDIA 1NQDA 1W3VA 1RTVA 4LNVA 3MIDA 4KG0A 1XNCA 1ZZ6A 4FPCA 1SDDB 1LHWA 2Q8OA 1F31A 1Y7BA 2HLEA 3V56A 5IT6A 2D6LX 2JB4A 4GWNA 4Q27A 5FZ7A 5C33A 2CSGA 1FMD3 4IV3C 4IE7A 1Z7S3 1EP0A 4NPMA 5JOZA 4B7KA 2EXHA 3VBHA 5EQUA 5IK7A 2YFUA 1VBC2 4JQTA 5IK4A 1SCRA 1NX9A 1RUNA 4MH0E 1IQAA 1HB1A 2XJUA 3DGTA 4HVOA 3IZOA 3RYRA 3M70A 1EYBA 3ILRA 3UV9A 2ENRA 4K7JA 4XCBA 1S4CA 4XDQA 2EXKA 5EWSA 1HRI2 1BQPA 4D8MA 4QPWA 2CTVA 2JIGA 2TBVA 2X5IA 1NKGA 4JGYB 2D98A 2NM1A 3I49A 3M8LA 4XCAA 4PLNA 4YZ4A 1O4ZA 1WBLA 2WWSA 3IT8A 2YU2A 1W8ZA 3R4UA 3UYJA 4NROA 4CP0A 1W2TA 3ZXLA 4D7YA 2HH9A 2HWD3 3E6BA 1AXZA 1VAVA 4GAZA 5L19A 1VBB2 4FPOB 1R1A2 1US2A 3J7MA 5FXVA 3WF3A 1SBDA 2O8QA 1QOTA 4BMEA 1OVPA 2QNKA 1R093 4FAHA 2GH8A 4XDOA 3WNMA 4C0BA 3RZGA 4QU2A 2LRPA 1QQP1 3WXPA 3ZFEA 1HKDA 2PLV2 1K5MC 4NRPA 1ZBE3 1DGWX 2ZMKA 5BV6A 2UYBA 1UPSA 3CJIA 1REFA 4A41A 4CP1A 4N53A 1GWMA 2PQSA 2YXSA 1FNZA 1YJKA 2QDRA 1XNKA 1ZZCA 2Y26A 2ARXA 3RZJA 1I3HA 2JKBA 4WBBA 3TEXA 5CKNA 4Z92B 2VMHA 2VY0A 5CFDA 2WNOA 5CFDB 3TWIA 5JZGC 2IXJA 5EZWA 3NL1A 2RS53 2XXZA 3VDDB 1UZYA 5FZ9A 4B29A 2WYFA 3Q8FA 4BMBA 4KBBA 1HX6A 4CEYC 3SCFA 4LHSA 3WP5A 5I0DA 2GDFA 3HNMA 4RL7A 4UW3A 4W65A 3J4UH 1Q56A 2XG3A 3VBUA 3WINE 1BVP1 5JOWA 4XEZA 1W99A 2FZ2A 4JGZC 5APAA 1EAH2 2MEV1 4YLZA 5GJ6A 5LW9A 4XXAA 4AR2A 3CL1A 3OPTA 1O5UA 4RQPC 3BTZA 1LB2A 1JYVA 1X7NA 1QEXA 1W2NA 4P9XA 2R30A 4TLFA 1CAWB 1JUHA 2VVEA 2WZR2 2QVSB 2YFZA 3AP9A 3B5LB 2XJQA 2VUAA 3TEWA 1TVGA 1EV13 2R071 5AFEA 2CAVA 3ZX7A 4M00A 2WFF1 4R9CA 1O6UA 2WT1A 1E5SA 4CP9A 5KWRA 4YZ3A 3OYWB 1NCQC 5GLTA 1BK0A 5J48A 2PA7A 5FXZA 4AEDB 4L99A 1OKQA 4LA3A 1W6OB 5DUVA 5FZGA 4AAXA 4EWDA 3EYPA 1J83A 1WLWA 2JE7A 2RM23 2UU8A 3JQWA 4LLOA 5BYNA 2A6ZA 1BVVA 4N43B 1OOPA 1Q8PA 1HV0A 3CBNA 5T5PA 1AR93 1UKRA 1UOJA 2ZBJA 1ND2A 2RS13 1A6CA 1UMZA 3FUQA 5M0TA 4CU6A 2C24A 2ZEYA 3WX5A 5IK8A 4XOGA 5BNOA 1BXHA 4QX2A 2CU5A 5DG2A 5F3GA 2HYXA 2X09A 3CNAA 1NAEA 3T3YA 5JPMB 2V73A 3ZMNA 3KD4A 2FZ1A 2JDMA 4XF9A 5FK7A 1HQNA 3M3IA 1R081 1SLIA 1W3XA 1HB4A 5EV7A 4BXFA 3ZOIA 4ATFA 1JZ5A 4L0PA 2R16A 1MS9A 1E57A 1R082 1UYPA 2CL2A 2W94A 2ZEWA 4GIQA 3VGIA 5CKMA 2JG8C 3A0NA 4LE3A 2BV4A 4N53C 3K3OA 3WNPA 3GALA 1OUXA 2PYTA 5E89A 4Y1XA 1IPKA 4ZKTB 1FOD2 1YUDA 2HYKA 1VBB3 4LO7A 5IAVA 3SQOA 4IERA 5FUIA 2VOVA 5B2GB 1EUTA 3VL9A 3RPQA 4HETA 2L9LA 4CUGA 5FP8A 1W9TA 1S0CA 4RYDA 2FMYA 1VMJA 2HWC2 4J1WA 2A3WA 5CG8A 2Q30A 5J96B 2D3PA 3ZM8A 5FJKA 4KU8A 4FOVA 4CDUA 4OVEA 5A6QA 5FPUA 5I0SA 4RHV1 3WQ0A 2JDAA 1WW6A 5K0UA 3QH7A 1OD5A 1RUH2 4EN6B 2DUOA 1L3JA 1DQ1A 1FYUA 1H2MA 2O1QA 2QDNA 3WW3A 2W39A 1YQ5A 2RDSA 4E4DX 1UKGA 3DKQA 1IOAA 1UYYA 3MLJA 3VZJA 4HONA 2VZSA 5DN2A 1CZTA 2IWGB 2B9VA 2R042 3OPZA 3DN7A 4QT6A 4YNIA 1RUJ3 2VNGA 2VOKA 1S0DA 2W1QA 4K8FA 1UX7A 2AACA 1W6PB 5CIRA 3LOBA 1OLQA 3VBRB 3QACA 1YLLA 4AI3A 4DO0A 1PX3A 4PF5A 3V0BB 4FPKA 4CCOA 3AYCA 2CDPA 2DVBA 1J1LA 4MGKE 4AFAA 2AH2A 4UFIA 2XLAA 4GQ7A 4YM1A 3EB7A 3ZLIA 2IUWA 4KGQA 3AK0A 4YW3A 4ES9A 4I01A 3VUOA 2BEOA 4IGPA 3J7HA 5DPNA 5BNQA 2Z4FA 4UYBA 1RHI1 1FNYA 4YW6A 2W91A 3O0WA 3ILFA 2ZAAA 3RYKA 1VALA 2FHRA 4H7MA 3VHPA 2X8KA 4YARA 1MQTA 2Y6LA 1DZTA 3E1F1 5CU1A 5FO8B 2YUEA 1RB8G 1GP5A 2VMIA 1JU3A 1LGNA 1SQ4A 1F4AA 3FL7A 4XIOA 1H6YA 4TLGA 4NAMA 4OI1A 3AL5A 1PHMA 1RJ7A 4ZZ8A 4WM8B 1HB3A 3WZ1A 1K5MB 1ZNPA 4WM8C 1GFF2 3K46A 4WZFA 2ZAHA 3MYXA 5FZ0A 4J1XA 3ZSKA 3VD3A 2KXLA 5T3NA 4MG2A 1NA1C 2X53S 5JSOA 4HSJA 3WHTA 3NNJA 3KMHA 4Z2WA 1RL3A 1S2BA 1UZZA 2G1MA 2VM9A 3LEIA 1C8M3 2OYZA 3T2PA 3VZNA 4IGOA 1C1FA 4P5HA 4A6SA 3ACHA 1MS5A 2G9GA 5C8WA 3K2OA 5CFDC 3O1VA 1CGPA 3PJQA 1DQ2A 2DFBA 3KCCA 3AP6A 2WO1A 2XH6A 1HRI1 1ND3A 2DYCA 1V9U3 3OJBA 1D4M2 4CEYB 2PHLA 4H3WA 1MEC2 1VE0A 5FPVA 2B42B 4ZXKA 4IEWA 5LB6A 2A75A 3LA2A 4I0WB 1PGW2 3A22A 4PF1A 1VAKA 3OUHA 4HK8A 1W06A 4COZA 3T1LA 4NJ4A 4DZGA 4FP2A 5KXBA 4P9LA 1OMIA 1C8M2 4GKYA 1JBCA 3WUCA 1TME2 3PMSA 4XF4A 3RDIA 5I91A 1LHVA 1U0AA 4A3ZA 4ASLA 5D2AA 2XVLA 3AMMA 1JHJA 1LRHA 2VW1A 2XLFA 3LFMA 1UY4A 3H3UA 1PMJX 2HBUA 5CAZA 2LM3A 1I5ZA 2VNOA 5D8AB 5FTTC 4XF1A 2GNDA 1ZVFA 5D8AC 1H4GA 4UF0A 2RS12 3LDBA 3VD7A 4N43C 4Y1UA 2R0FA 4AFMA 1WZXA 1F5FA 1G86A 1EAH3 3GHNA 5DXDA 4Q4V3 1SFYA 2ZGNA 1JHNA 3KZ4C 3PNAA 5EFUA 1YIFA 5IAXA 2W1WA 4ZHNA 2GN3A 3D6EA 3HQXA 4YGBA 3UNPA 2VZTA 1FPN1 4R9AA 3WW2A 2VUJA 2ET1A 2RG4A 2RMU3 5F5IA 2WZEA 1UZ0A 3I54A 2YC2A 4Q0VA 5F32A 4RD7A 4Y33A 3KQ4B 3ILNA 3IKWA 3G6JB 3WOGA 1MEC3 2DVAA 2WWJA 4ARYA 4XUNA 4LOSA 2ZHKA 3Q8AA 4LHKA 2A6YA 1N1TA 1NA1A 1OA4A 4FTSA 4AOCA 2JE9A 2P17A 2ZABA 3DPRC 2IXIA 1IG3A 3POSA 4OHVA 5EJZB 3HN3A 4A4AA 4AXOA 2YBPA 1GMMA 3LDKA 2P1BA 1LAJA 5EYXA 5FPZA 4KH9A 1B35C 3I4IA 5F6KA 1R1A3 4LT5A 4FP3A 3PVBB 1B35B 2KM2A 1W6QA 1HXS1 3CJIB 5KHKA 1OQ1A 4AQSA 2E32A 4XABA 3FHAA 5C5TA 2C0ZA 5EJ1B 3SCHA 1XRUA 4YGEA 4DY3A 5T5JA 1GP6A 3ZXEA 1V0AA 5FZKA 2JG9B 2ZGTA 4NRMA 4FI9A 4PDWC 5FMOL 1XYNA 3PMEA 5FIXA 4XZUG 1ZA7A 2P3IA 1C5HA 4JTNA 1DGWA 1COV2 1GUIA 2P6CA 1QWRA 3OEAA 3M2MA 3TRSB 1FOD3 2H6BA 1RUD2 3LZZA 5A7SA 3AZZA 3O1TA 5ERLA 5J7MA 1S2EA 1RUC3 5C9AB 3T2OA 4E4HA 2ADEA 1AF9A 2FBEA 3ZYBA 2HJIA 4OHXA 5C9AC 5LBCA 4AQ6A 3VZMA 3I2OA 2VO5A 2DBIA 3TN91 1KEXA 4CP2A 1ZRRA 1S0IA 1AR72 4GB31 4BK5A 3ZMOA 5EXOA 1D0HA 1W39A 2JDPA 3I8TA 4IV1A 1U12A 4AVVA 5JXJA 1NZCA 3K4AA 1EY2A 4WVMB 3IIAA 3ZXJA 3ZFGA 3B69A 3JCIA 1DQ4A 1IGOA 1VAMA 4XF3A 3RJRA 1A3KA 5FP9A 3SEEA 2BZDA 2GMPA 4LKFA 1CN1A 2ZX2A 3PVEA 4NOTA 1KDKA 2ZX3A 2DUQA 5LCWL 4A7KA 2CV6A 1RMU3 4I30A 2CNAA 3IMNA 1GANA 4JKMA 2JG8A 3TNPB 5ACA3 2FDFA 5I0UA 3G7DA 2RDRA 5EPAA 4RR3B 4H14A 4E2GA 4UXAA 3AZYA 4P9JA 4AFCA 4DXTA 3H8OA 3POJA 3WEZA 3N9LA 1OUSA 5FPLA 4FOWA 1G8WA 2DDUA 2WO7A 3MF6A 1W8WA 2D93A 2UWAA 5JIAA 1RVF1 3RMYA 5CISA 4WVVA 4LBOA 1MS3A 1QJY2 3WF0A 4OLLA 4XUQA 1PGW1 4QHOA 1M06G 5FZLA 1QGLA 1TE1B 1W2OA 1PO21 4BU2A 3UKNA 1EPWA 2O8OA 4YGDA 4Y22B 4TN7A 2YZ4A 4XBQA 5IVBA 5H9PA 5C6CA 2R0HA 4Q26A 3NJYA 4LULA 4N53B 2DWRA 4MGYE 1R092 2JDZA 3WP6A 1PO22 3ZR6A 1YRZA 1JUIA 1I9RA 4P02B 4OI4A 3OOXA 5BUVA 3WDTA 1RVF2 3MIEA 1UNBA 3LE0A 3S5QA 4JV4A 3WQ7A 3H7JA 3ZYFA 1EV12 5FRAA 4WV8A 5HCHA 1C3HA 2OPWA 5HCBA 4C90A 1GZ9A 1ZZ9A 2CY6A 2XJSA 1LOFA 2PHRA 4XETA 4OUEA 4XURA 4HKOA 1CAVA 3W9AA 4C1WA 3O1SA 1QOOA 5FZCA 4GMP3 1DQ5A 5FYZA 5G04L 2HWF1 4Q0SA 4MUVA 1OF3A 1WGPA 5GLWA 4LBNA 2WQZC 1KFUL 2X5IC 2J1RA 1WMFA 3E5QA 2YY1A 2GSYA 3POBA 4HN0A 4KU7A 5FYVA 2X5IB 4XACA 3UKVA 4FFIA 3OGSA 1OURA 2BDRA 4S2GA 4C1XA 4DB5A 2WA3A 4B3NA 1QMJA 3T2TA 3NVCA 2CGNA 2WNVC 1ULDA 3H1WA 3HJRA 4L97A 1O3TA 1N3QA 2OPKA 5DAXA 2YB7A 1AR81 2IC1A 2DU0A 3M3CA 3ORJA 5FYYA 1ULFA 1OFSA 5FAXA 4LO4B 1QH6A 1N3OA 1U5XA 4RHV2 4CPBD 3LSEA 1RHI2 4PDWA 2JECA 3PL0A 5F2WA 2PHFA 3SH3A 4J6GA 4LBMA 4GXLA 4XMAA 1BBT2 3AVSA 2BUKA 1W28A 1CAUB 1J1TA 2G19A 3HQRA 5A80A 1TME3 2WWUA 4QHZA 4YYOA 3WDYA 3ZN6A 1G9AA 3VBRC 1X36A 5T55A 1CPNA 1WW7A 3BOWA 4UAPA 3MW2A 3FHIB 3LF7A 4XFFA 5A32B 5A32A 5IVJA 1OA2A 1YIPA 3PUIA 3VHNA 5A70A 4HBNA 1S0BA 1ZBA3 1WW5A 2A6VA 2ZACA 3WDWA 5KHGA 5KHJA 3VDCA 4FBFA 3O1OA 3IDCB 1DYOA 2ZHNA 1RUF1 1XYPA 1D2QA 2XJVA 3BODA 5CFCA 5IHRA 5GZFA 1NE4A 2Y6KA 1LOEA 2HWC3 3CKHA 2NLRA 2VQTA 4MGSA 1K5JA 3FZ3A 4RA0A 4XBNA 3ZFFB 1KJLA 1WKYA 3B3QE 2ADDA 3JBG2 5CB7A 3R4SA 1HDKA 3ZFFC 3WSOA 3VDDA 2NMNA 2RS32 3DEMA 4L92A 4NHMA 2Z42A 2CGPA 2VQ0A 5A1LA 1Q8OA 1W04A 1POQA 1XJAA 3ZXAC 3LEKA 1D7PM 3OBTA 5BY5A 5FWJA 4CDUB 3CJIC 2ZHMA 1UOGA 3LGRA 1VMHA 4AK3A 1SFNA 5IYYA 2G4IA 2CGOA 1JW6A 3M1HA 3BKZA 1G9FA 1PM7A 4D6RA 5IUQA 2C1FA 1IHMA 3K77A 2OA2A 2VH9A 5GKAC 5LEKA 2RHPA 3ZSJA 1OH3A 4CCLA 3HBZA 3BTAA 1N1VA 1XNAA 4A44A 3GXUA 1XU2A 3C3VA 3RMXA 2FD8A 2IXHA 3FE5A 1JZ4A 1G7YA 1LENA 2UURA 1EPZA 3HN1A 4CUAA 5F9TA 3S0MA 1ND3B 3JUUA 3KM5A 3KSCA 3B94A 3I59A 1ND3C 4LO5B 3BI3A 3H3LA 4CCMA 2WZPP 4WM7A 5FV3A 1UMHA 5JLVA 1W6MA 1AXKA 2VMEA 2WA4A 4MX3A 4PBPA 1WUVA 4JHZA 1DBNA 3I2FA 5FQ0A 2FCTA 1RMU2 2VBBA 1GNYA 2EVXA 2DCTA 1ZBA1 3H8XA 1Q5OA 3ZIWA 2A3YA 1OA3A 4QX5A 3C7OA 3NWKA 4HMZA 1S1AA 1YFWA 3D0SA 2Q8DA 3USUB 2ZZQA 4KGGA 3RZZA 4XQ4A 2XPJA 3JU9A 2ZXQA 4ASMB 2LW8A 3BPSA 3RG0A 4XQDA 1NCQB 1W90A 1ZM1A 2V4AA 3W5NA 4ZY9A 2D5HA 4AEDC 3BVCA 4NIIA 2E31A 3F95A 2ZGLA 1U5ZA 5FZFA 4AI2A 4ATEA 1MVEA 1XNTA 2J1EA 5FZMA 5HV4A 3KHCA 2WFF2 1LOAA 2JE8A 3JD71 5LK5A 1JMUB 1XE0A 2BOIA 4PJYA 4RR3C 3IWZA 1ZZBA 3MPBA 1GV9A 2DCYA 2P3JA 2BNNA 4C91A 3OTFA 3BUCA 5FJHA 4JGYA 1DGLA 2DTWA 1VBC3 4HK9A 2YGMA 4W6YA 4DMIA 1Z78A 5CADA 2MEV3 3MV11 4JQRA 5JVVA 1UZVA 4NIGA 1J3RA 3DXTA 5DUUA 1R64A 3MLKA 4Y1YA 2GAUA 2HEWF 4BIOA 2RS11 3AYDA 3TN93 5LRRA 2RR11 5LY2A 4QXBA 2A1XA 2BW8A 2WDBA 1K5MA 3UGFA 5IVCA 5IVYA 1LOGA 3ETPA 3MGUA 4B7EA 1OH4A 4XFBA 3JB8A 5F2SA 1YC61 4E2QA 5LATA 5CEHA 4UFHA 4IE0A 3AJZA 5LA0A 5K0UB 3WP4A 5F39A 1CJPA 1UO9A 3FN9A 4JRAA 1OPOA 3DPRB 2LTNA 2ZTNA 5FMCA 4BH9A 4QX0A 1SZBA 4LBQD 4BYYA 1F15A 3V0AB 1RJ8A 2HWB3 2BQPA 2Q1ZB 2DTYA 3OGGA 5DABA 5C71A 4LIVA 4DY5A 5FYTA 5AC93 3VHOA 5ISLA 4EE2A 2XJRA 1YFUA 3T0DA 3W21A 1QF3A 1KD7A 1HJGA 2R062 3THPA 1QXPA 1KITA 1C5IA 1POV3 1EUUA 2BYVE 2HWE1 5DDJ2 4D7SA 4E4SA 4MGIE 2DFCA 4CDWA 1GQGA 4X8NA 4FVVA 2ZKNA 1QJX1 2Z69A 3TEZA 4BK4A 5LWBA 2F17A 4JDNA 5IVFA 1W6NB 3ZYPA 3VBSB 4XJAA 5FY1A 2E7AA 2SBAA 2JDYA 3OEBA 4GJZA 1OPMA 2WL1A 4IEOA 4YM0A 1QJY1 2JWPA 1US3A 1QQP3 4L2NA 3T08A 4TTGA 4IV3A 2EXIA 5JIUA 1F35A 2ET7A 2Y8KA 3V0AA 1SCSA 4O9EA 4QGNA 4CCJA 4QXKA 1VBA2 1HN1A 3H1MA 3K48A 4HANA 4CEWA 1KXGA 1GQPA 3DL3A 4XVHA 2BRTA 4A3XA 4BA6A 4D6SA 2AEZA 3FJSA 3VHRA 5JXGA 1X33A 1Y9MA 2QE3A 5F1RA 1YYNA 2W5FA 3OD4A 1ENRA 2VXJA 3HIFA 3VKNA 1QHDA 4EN8B 2VCBA 1XBFA 2JDNA 4NE9A 5E88A 5IATA 1VB4A 2HKXA 2AZ5A 2OS2A 2ARBA 2O0OA 3UESA 5FY9A 1QDCA 1VIWB 1B09A 4CUBA 2ZGRA 4RS5A 4CCDA 3L2HA 5HV0A 2ZCWA 1W8OA 4JHTA 4QX1A 5FZOA 3U0ZA 1RUE2 3EO6A 4NUBA 3AJYA 1E5RA 2D3SA 2VC9A 4D6QA 1Z7S1 3Q9OA 2OX0A 2Y6FA 1UCXA 5JMCA 2VE1A 2PHDA 2PHUA 3EHKA 1RITA 1UMIA 3AFKA 5FLHA 1VRBA 4YFZA 5BNNA 3ZKYA 4FFFA 4W50A 2RJ2A 2BU9A 4P00B 5LBBA 4Q4X1 4CXXA 3VZLA 4YFWA 4HPKA 2ZEXA 3MICA 5T54A 1LHUA 1RUD3 1HXS3 2B39A 1C28A 1FOD1 5FYSA 3AYAA 1CIWA 2MHFA 2OUJA 5FXWA 3ATGA 1OC1A 2WT2A 5JR7B 5L7OA 4AEJA 3I2KA 2NP0A 2Y0OA 1CJDA 4N90A 4Q4W2 3ZDSA 1WLCA 2VMFA 4KBZA 4IW3A 1O8PA 4ZZ5A 3O1MA 1VRH2 2VQUA 3A21A 3SISA 4XFAA 2I45A 3WNLA 1N3PA 4MHUA 4LXLA 4OHWA 3ZKUA 3ZXDA 3SMHA 1QJY3 2YU1A 4XJ8A 5DAVA 3BPZA 4ITCA 5FPAA 3GF6A 4A6OA 5A1AA 1V6OA 3UT0A 4EWEA 1PNGA 4XAEA 5LRSA 1VB2A 1LTEA 2GNBA 1ULCA 4YVSA 3DYPA 3B9IA 2RV9A 4ZPIA 1ZBE1 1WBFA 4YVSB 1NLSA 1K3IA 4FT8A 4LR4A 5FUNA 4B4PA 4YVSC 3TEYA 3WVJA 3FX3A 2BFUS 3I2DA 3BYWA 1LKNA 4Y5SA 2HWE3 3MI8A 2EIEA 4YPJA 1HQWA 3VZOA 5CA6A 4C0HA 4EN9B 2GMMA 1DGRN 1SLAA 4CEYA 2VZOA 4RR3A 3IDEA 1UY0A 3BTXA 4AQ2A 3AB0A 1JI6A 1MS0A 3ZR5A 2J1VA 2Q1MA 2HWB1 4E8DA 3IAPA 4XBLA 4GMP0 2HWD2 4GWIA 2B46X 1RC6A 2RDQA 2R49A 1DYKA 1RUG2 3BIWE 1PGL1 1H8VA 4OFGA 3ZIXA 4A42A 3T09A 1AXYA 1DZQA 5K9YA 4AVTA 2QJVA 1PVC2 3MV01 3B9CA 1PO11 1LECA 2D97A 2ZGOA 1QQP2 5FKBA 5I8SA 2C5DA 2N7GA 4LMFA 1PIV3 4Y22A 4BHPA 4CDQC 1J59A 3ETQA 4UFJA 2K2SA 3OSDA 4AL9A 2E63A 1T2XA 4M3CF 4OMCA 2KR2A 5AC92 4X6QB 2XQXA 2Q8EA 4DXRA 5A3NA 3FC0A 1E5HA 1QNWA 1UN1A 3UKTA 1H2LA 2YBKA 2XONA 3HVDA 2OQ6A 5K4LA 3J8F2 1XE8A 3ZSMA 4IE4A 1TEIA 2WRAA 3WDXA 1GZCA 2E7QA 2WO2A 4MVTA 2Z2SB 1SLTA 2B4KA 3E6DA 4ARXA 1O4TA 4E27A 5FYCA 1ALYA 3S7EA 4FFGA 4QPIC 4AGRA 1W2AX 1OF4A 4QPIB 1G9DA 1W8NA 3ZO0B 1BCXA 1MS1A 2XHKA 3KCYA 3NNFA 3RQ0A 3VN4A 2UYAA 3ZYIB 2RMU2 4LK6A 2GC3A 4DNYA 2E51A 3KGLA 1CX4A 4FPEA 3QLQA 3UL2A 1D2SA 2PLV1 5CBLA 3W58A 1AYN3 2PQQA 2WLPA 4CDUC 3LCPA 1VBE3 1AL0G 3PTRB 5IW0A 2WT0A 1OT5A 2JENA 5JOYA 1APNA 2JG9C 1JYCA 4GH4C 3GZTB 1NLRA 1HIXA 1V9U1 2WIIB 4BLIA 4CDXB 2JKXA 4CDXA 4Z07A 5FZAA 4JCKA 3KT4A 2J1AA 1Z0HA 5JXHA 3CIHA 5JUVA 3MFAA 1YI7A 3QH6A 3I7DA 3UETA 3EXUA 5HPOA 5FY8A 3IIIA 5FCCA 2YC0A 2FCUA 3NW4A 3PUHA 2YPJA 1SFPA 4MADA 5JDBA 1V9U2 1KFXL 2XVGA 3M7AA 1HJFA 3B93A 4AYUA 1AL23 5A7WA 3WR0A 2Q5TA 5CG9A 3LDRA 4SBVA 2OW4A 1MPXA 1HQLA 1SLLA 2VQAA 5LY1A 3KB5A 5FOJB 5B4XA 2ID4A 3KS7A 2JDKA 1UU4A 2A5ZA 2D3RA 5GLZA 2WS92 1ODNA 3MIGA 5FZ6A 2WUHA 3PUSA 3WNNA 2XB6C 2C9KA 2HBTA 4QGLA 4YW1A 1H9PA 1E5IA 2GNTA 2QQLA 3KLSA 5FQ0B 4UF0B 3LOIA 4K21A 4PBOA 2WC2A 3NRUA 1UW8A 5DQ0A 4G3YC 1KQRA 3OGRA 1LHOA 2WZR3 1L7LA 1H1IA 1LULA 3NQHA 2YPDA 1JS9A 1QJZA 4Q4W1 4Y1ZA 3SNMA 3RGBA 3RZKA 1RHI3 4SLIA 3MHZA 4HN1A 2XL9A 3C7HA 4F7ZA 4NMIA 2VZPA 1NY72 4FTBA 4D94A 4IEPA 1UPIA 1O3RA 4Z8BA 2HWC1 1XNBA 1JXNA 4DS0A 1Y3TA 3IPVB 1ZZ7A 4FSJA 3P1IA 1RUJ1 2VECA 4XUPA 1RUI1 4FPYA 2NPIA 2VNRA 4E4ZA 2YYOA 4S2DA 3BN6A 3FFQA 3UJQA 1CWPA 5LA2A 4OYUA 3D4KA 4HOOA 2PFWA 3ROUA 2ATFA 1DQ6A 2VZQA 4Q4W3 3UJOA 4EZ4A 4BLJA 2DCZA 1AYM2 1RINA 4PCRA 3A23A 2XKOA 1BJQA 4NAOA 4Z82A 5DAWA 2D7FA 2DVDA 4AVBA 1X50A 4NHXA 1ST8A 2P4EA 4OZOA 5FKCA 5HXMA 1UOBA 4DUVA 5JAXA 4Q2FA 1DHKB 2R1DA 5L9BA 5K0UC 3IN9A 2OVUA 3V65A 1UXXX 4XILA 2PELA 4QX7A 3I3EA 4P9IA 5EHDA 2ORXA 3VBOA 3ACLA 4QKBA 3AP5A 1JYTA 3SEPA 1AYM3 4KWLA 2PTMA 1LOFC 2RR13 3DPRA 2XJTA 1Y9GA 1W6PA 3DV8A 4XIKA 4O61A 2V09A 1ULEA 4P5YA 1W6MB 5SV5A 2CAUA 4XJWA 2UWBA 3D82A 3NNLA 5BPXA 2V5DA 1XYOA 1PK6C 3IDBB 4FQZA 5BNPA 1W6NA 1DLLA 2RS31 4OULA 4MXWB 2VVFA 3H7YA 3PIGA 2G9FA 5JR2A 3PVOA 1AR92 2W0XA 2XQRA 2WNVB 3D5OA 1UU6A 3KT7A 5HI0A 3CEWA 3NO8A 2EICA 4TYSA 3C8XA 3SH4A 4COYA 4UOJA 2A71A 5FLIA 4QD2A 4R9DA 4IEVA 2C4XA 1LGCA 5FBZA 1VP6A 3ZFGC 1OHFA 3LSDA 4WVZA 4B8EA 1IQDC 2RVAA 3POYA 1NCRA 1QIQA 4JVAA 3EQEA 3VZKA 1FAYA 1G9CA 3AKPA 5K8SA 1UY2A 1V6IA 3A0KA 4WZCA 3U4SA 3T0BA 3LIGA 4AEDA 2WKKA 5HBAA 1RUC2 3Q8CA 4CEWC 3KV4A 3F2ZA 1PM4A 4CEWB 3N7JA 4HXCA 3WUDA 2O14A 5FXXA 4XUOA 4TWTA 4BQ3A 4IUGA 4BISA 1WW4A 4XHXA 3K51A 3RVHA 3SLIA 1A78A 3ES1A 3HNYM 4GMP1 5F37A 4BB3A 4OI0A 4HT1T 4QQHA 3Q8BA 4FPJA 4ISRA 4LIUA 2YBSA 1JZ6A 1GWLA 3APBA 2X10A 1SACA 3HT2A 2JX9A 3J7LA 3KV5A 1W6QB 1NXD1 2RS51 4LOTA 4NIDA 2XR4A 5A6YA 2Q1FA 3S30A 1SBFA 1NYWA 4LBKA 2H0BA 1ULOA 1RVF3 2GN7A 1GQHA 5FY7A 3U11A 3K75B 4I3PA 3KVBA 1WA4A 4CA9A 1CAXA 2VOXA 2ZZJA 2ARCA 2K0GA 1IPJA 3IM0A 4NHKA 5J3UA 5FMBA 1GKBA 1HB2A 4EJRA 1D0GA 3VBOC 2C6SA 5BNNB 1CQ9A 1PGSA 4QKNA 4P9WA 2WJSA 3MPPG 1JZ8A 3H0OA 5KHHA 4AFBA 5GLUA 2BJSA 2EAKA 1QDOA 4I02A 2QUOA 4O7XA 4PT6A 4JAAA 1R091 4YW5A 3VKOA 4M01A 4V2VA 3NJZA 4Y24A 2EIGA 4XE9A 3RYPA 3RWKX 1R083 1WLTA 2WFPA 2ZKLA 1H4HA 3LFIA 1QY4A 2JICA 3NV1A 1S55A 1VBA3 2VVDA 2VMGA 1BHGA 2HWF2 4DINB 2VW0A 3AKQA 5I0RA 2R041 2XUMA 3GHMA 1V70A 5LA1A 1PIV1 1YFXA 2ZMLA 5ACA2 4YW7A 5BXXA 1X8MA 5E6HA 3OCPA 4JRLA 3H9AA 3ZPOA 1UYXA 1ZBA2 2VD7A 2AGSA 3PUAA 4FPHA 1W05A 4Q5OA 4B1LA 2JDUA 3O12A 3RSJA 4COVA 4P9YA 4EV0A 1LOBA 1TNRA 3WT3A 3NJVA 2HWD1 4R52A 5DZEA 3ZXFA 1YQ2A 1NCRB 2F4LA 3KVAA 2Z5WA 5B4NA 4LA2A 1CAVB 2YDEA 4ASKA 4ZU5A 3LD8A 4QDSA 5JXIA 4IQPA 1RUD1 3ZXKA 2GP5A 3VBRA 1UXZA 1W6OA 4Q29A 4O65A 5GM0A 5T52A 4B4QA 1XU1A 4D3WA 3AC0A 2DCJA 4Q1PA 3AZWA 4Q8LA 2WNEA 4COUA 3MW3A 3AKTA 2XUEA 4QXCA 4RQPA 1AZDA 2ZX4A 5T5OA 3GBGA 1O3QA 1PVC1 4F8AA 1FI2A 1VBE1 3H3ZA 3AMHA 4XF0A 1NG0A 4AGGA 3RZHA 1C1LA 5FPXA 1BEV3 1XOYA 1BYHA 1F9KA 1KS5A 1B35A 2A6XA 1HXS2 4CDWB 4OI2A 5KXEA 2HWB2 3OGVA 4IE5A 3TAYA 3WF4A 3N3HA 5DZGA 4Q4X3 2PHXA 5FZDA 1CVNA 4XHBA 4RN5A 1FV2A 2Q4SA 1PVXA 4DQAA 1PMIA 2QQIA 1VBD2 3HPNA 3CZJA 4H7LA 3WCSA 3FMGA 5AFBA 2HEYF 4QWNA 5LA9A 4BZ4A 1W9FA 4UW5A 3GGLA 3PIJA 2OKXA 2IFWA 1OVSA 3O5SA 4XUTA 2ZJCA 3PJYA 4CYDA 1AR61 3J8F3 3CJXA 3VBFA 2WO3A 4RSUA 1OLRA 3LAGA 2R1BA 3AVRA 3H8UA 5FREA 1GYKA 1W8TA 1H8TA 3E97A 3LB9A 1STMA 2LROA 3JQXA 5FZEA 1Z7S2 5T5LA 4AG4A 3X29B 3AM2A 3I2HA 5F7UA 3ME2A 3PURA 3INAA 1HN0A 4R9BA 3I59B 1P8JA 3VKFC 1MS4A 3WD5A 1YWKA 3VBSC 1TMF2 2J1UA 4QKFA 4WVMA 3USSA 1FMD2 2E33A 4V2WA 4CDXC 5A1FA 1MZFA 4JC1A 3WF2A 4BIFA 4YW4A 5C8CA 5I93A 5J36A 3BTYA 2ERFA 4XJZA 4E9KA 2ZS6B 3KGZA 1COV1 1REEA 5C3PA 2VOWA 4MGTA 2B8MA 4AF9A 2VCMA 3M3OA 4YM2A 3TB0A 2CWSA 5C7GA 2VZRA 5KBFA 4PQQA 3WY6A 1O4YA 1SPPA 3GZUC 4FOYA 3TNQA 2IXCA 4HVQA 1HRI3 3HOBA 1EAH1 2MEV2 3WW1A 1ASJ1 2J22A 5DMYA 2ILMA 2XWJB 1VBA1 2WAAA 2RMU1 3CU7A 3V0BA 3RZMA 4XFHA 3T4VA 3R0RA 4AHXA 5ANQA 1A8MA 5DZFA 5T50A 2NMOA 4P14A 3POEA 4DEVA 1WCDJ 5C4WA 1GOGA 5CFCB 3MZHA 3DYOA 4Q8KA 4YSFA 1Q8QA 3TBDA 2RJLA 2VMDA 5A6XA 2WNVA 1AR73 3N7MA 1H1MA 4ES8A 3AKSA 4CXWA 2QKDA 2CWMA 3OUIA 1ZA4A 2P6HA 3SCGA 5BNOB 1GZTA 4FO9A 2GNMA 4J25A 1WCUA 3A7QA 1XSQA 4QM8A 2C26A 5FY4A 3HQUA 5FPBA 3WQBA 4D69A 1NLQA 4YM3A 3FBMA 3KF3A 1H9WA 4W4ZA 5FO9B 1PMHX 1SLBA 4LKEA 3WDUA 3IAQA 3THTA 5JSRA 5EIYB 2MNGA 1POV1 5F3IA 4MGZE 1CONA 1O8SA 1D4M3 2RJKA 1BLZA 3MW4A 5C4WC 1DF0A 4ZS3A 3GCXA 3PU8A 2Y0IA 2QQOA 1I5PA 1YEWA 5JSPA 2V72A 3QOPA 5DDJ3 2VULA 2B9UA 2ZGQA 1RUH3 4XAAA 4XPVA 5A3OA 4N7UA 1LCLA 3U1XA 4BE3A 1OI6A 1XNDA 4IEQA 4HSLA 2JEMA 3ZYRA 1AJKA 2CYFA 1VBD3 3N35A 2DBNA 4OUSA 2HEVF 2Y6GA 1T6BX 5FP4A 1ZREA 4AFDA 2GU9A 1S0FA 4UW6A 3LEMA 5FOBB 4C8DA 2OQ7A 3ZFEC 2XHNA 1IS4A 5GZEA 4ISQA 4IEYA 2NN8A 4QAWA 5A33A 1U5YA 3K4ZA 2PXJA 4QQ2A 2XDVA 1YXWA 3ZYJB 4YZ1A 1X9PA 3OBRA 3P3PA 2QTWB 2W9XA 2QQJA 2JJ6A 4LE4A 4YG0A 3WQ1A 2GC0A 4UI9L 4Y1VA 4Z1VA 3BB6A 4NHLA 3SITA 1QKQA 2ZX1A 4W6WA 4AVCA 1F2NA 5ABJA 4Y4RA 1RUG3 2AREA 1VR3A 4U2AA 1CPMA 3ACIA 1XXNA 1H30A 3MLLA 3KT1A 1VPHA 3MBWA 4PIYA 4QQLA 1XQNA 4AW7A 2TUNA 4M3CA 4YW2A 2GALA 2YG0A 3RNSA 2ZPXA 4JX0A 4FPFA 3ZSEA 4Y5Z0 4AEMA 4A45A 5AC91 3HWJA 4CSWA 3P5BA 4B1MA 4BPZA 1IG0A 4BQWA 1IS3A 1SHWB 2TNFA 4I0AA 3C2UA 3VBHB 4YWAA 4HL0A 2VBDA 3I3QA 5FZHA 2ZGUA 3VBHC 4EROA 4NPLA 1X9TA 2VJXA 3V64A 3ZFGB 2BPA2 1MACA 1HRV3 3NKTA 1F8VA 3HNBM 4CDQB 1OQEA 2WN3A 3W59A 1WCKA 1GNZA 3B02A 5GZDA 2PN5A 4UFLA 1G6NA 5A3LA 1GZWB 2W1UA 1GZWA 2RDNA 3BGAA 4PLMA 1N1YA 5CNAA 4NVPA 4BQXA 4Q0UA 3N9MA 3POGA 4WM8A 2ZGKA 5HCFA 4BXSV 4DOUA 2XJPA 2VBPA 2PMWB 2WNUC 2BBAA 3N9QA 4R4XA 4GALA 2FQPA 4AHWA 1AUYA 2WNUB 3GNEA 3OF1A 1QOSA 5JZGA 2ZX0A 4CVUA 1JN2P 1O3SA 1MS8A 5E16A 4HPKB 1W9YA 4IE6A 5DAPA 1AL21 2WZ8A 1WLDA 1JODA 4EN7B 1S0GA 2LS6A 1VRH3 5FZOB 3OPWA 2P3KA 3THDA 2E7TA 1VRH1 4JGZA 4OZXA 4LBJA 4AI9A 2XWBB 3GJBA 1URXA 4M4RA 1RXFA 5F3CA 4GH4B 1JZ2A 2P3YA 1TQ5A 1ENQA 2DU1A 2IVIB 3VBOB 3POIA 4XFIA 5TSWA 5GZCA 5L9VA 2JG9A 5FZ1A 2H6CA 4H2AA 3I2JA 3WG2A 3RI8A 3ENRA 1RUOA 4OMDA 4MZUA 1RUH1 1ZZ8A 1X82A 3B00A 1QNYA 1J3PA 1REDA 1ZRIA 4I09A 4XYXA 2OZJA 1UU5A 1ULPA 4BQ1A 3PLQA 5L7OB 1H8TB 3OB8A 1AYM1 3SH5A 5L7OC 1ULGA 3EJKA 5FWEA 1OXCA 3HR9A 3ZN4A 1JZ3A 5FLJA 2V5YA 2RM21 4BJ0A 2BNMA 2FDJA 3WP3A 4URAA 5I8YA 1DDLA 4RGAA 3AZVA 3IB3A 1TME1 4ZONA 3LA7A 2KD7A 3HAGA 1ZYBA 3MF9A 5CFCC 5LEJA 1JH5A 1A8DA 4GZ9A 2JD9A 1BZWA 4YZ2A 1K12A 4JTOA 4XTMA 1PIV2 2BWAA 1Q8SA 4RS5B 1SEFA 5F5CA 3WNXA 5I0TA 2RE9A 3U14A 4D7TA 4JKLA 5GALA 2ZGPA 4KL1A 1V6MA 2EALA 1NCRC 3MIFA 5H9RA 2XKPA 2DF7A 1FT9A 1CR7A 4BQ5A 2VZ3A 2ZEZA 3HEIA 1O7FA 3VKLA 3WG3A 1R1ZA 4QMAA 2EXJA 4GKXA 1QJX2 2R32A 3ACFA 3RRDA 1BMV2 3RFRA 4DEQA 4E2SA 5LBEA 2GP3A 4YVWB 2X29A 3M3QA 3RZLA 2WAOA 4MLOA 1JU4A 1F4HA 3GYDA 4Y4YA 2IVJA 2YMZA 3GDBA 3O14A 4LBQB 4BQ2A 1G9BA 4JZRA 5A3WA 1EV11 2R073 1YQCA 1GNHA 3M4FA 5C4WB 2QQNA 4NN0A 4DPNA 5FZ8A 1OOPB 3WG1A 4LQRA 2D6MA 4A7ZA 1W0PA 1JOPA 1CZSA 3ON7A 3WDVA 4AAPA 1AR82 5KR7A 1ZX5A 1LU1A 1MEC1 1QJFA 3PU3A 1RUI3 4QPGC 4UWDA 5HXVA 2VXRA 4AE2A 4XFCA 3I3BA 1UX6A 3NV2A 3ZPYA 4MOAA 4QPGA 1QJU3 3GZEA 5J98B 3VBSA 1VBB1 4GH4A 3Q8EA 5A7PA 3L2YA 3LWCA 1J3QA 1MZ5A 1CZVA 2JB8A 3GZAA 5FZ4A 5JI9A 3N9NA 3B01A 4GB33 3ZSLA 1AR83 4H55A 5EYYA 2OZ6A 4M0HA 3VD4A 2GMEA 2Q8CA 1RUG1 2W52A 1IKQA 1N1SA 1I1EA 1UYZA 2P2KA 4N9HA 1RUC1 3HT1A 4O9GA 3PDQA 2ZOEB 1N47A 4RFRB 4WM7C 5FFOC 3URFA 4Q4V2 2DVFA 4CDWC 1PK6B 4LHLA 5LBFA 1WCQA 1H2NA 4Y26A 3FLTA 5FYHA 2LALA 4A7YA 5IJRA 5J1XA 1BMV1 2XGXA 1PZ7A 1XC6A 5A6ZA 3D0JA 4PHZA
chains in the Genus database with same CATH topology
5JR2A 3OGSA 5JMOA 1SDDB 2EICA 3C8XA 2HLEA 3HJRA 2YB7A 4UOJA 5HPOA 3LPGA 2C4XA 3I2GA 2V4VA 3NNGA 2YFUA 1IQDC 1NX9A 2RVAA 1KGYA 1W9WA 1UY2A 4ZXEA 3T0BA 1NUKA 4UAPA 4D8MA 4QPWA 3F2ZA 1W0NA 1GOHA 3PUIA 1NKGA 2WABA 4XUOA 3VDCA 4IUGA 2W1SA 1DYOA 3HNYM 4KMQA 4BDVB 5IHRA 2Y6KA 3CKHA 2VQTA 4MGSA 1JZ6A 4DUXA 2X10A 2J1TA 1WKYA 1US2A 3LEGA 3WF3A 3WSOA 3C7EA 4CU7A 3WNMA 1UWWA 1ULOA 3LEKA 1D7PM 3T2QA 2QQKA 3K75B 5IYYA 4A41A 2QQMA 2PQSA 4KI5M 3K77A 2R7EB 2X05A 3ABZA 3T0AA 1XNAA 4A44A 3GXUA 2W3JA 1JZ8A 1JZ4A 4PT6A 4CUAA 3CQOA 4QDQA 4LHSA 1UMHA 5I0DA 3HNMA 4HG6B 1H6XA 2VMEA 4JHZA 1W99A 4E8CA 1BHGA 3I2FA 5LA1A 1GNYA 3IDAA 1JYVA 1CX1A 3C7OA 1UYXA 2J7MA 2YFZA 4ET7A 5CYYA 1TVGA 3NJVA 2ZXQA 1YQ2A 3P6BA 2LW8A 5B4NA 3W5NA 4ZY9A 4QDSA 2E31A 5JXIA 1DP0A 1UXZA 3LPFA 1XNTA 4AAXA 2J1EA 3EYPA 2JE8A 4CU9A 3AC0A 1J83A 2DCJA 2XOMA 4CU6A 2ZEYA 3ECQA 3C7FA 4QX2A 3MV11 2HYXA 2X09A 1NAEA 2EIDA 1R64A 2Y6JA 3OGVA 3WF4A 2WDBA 4RN5A 1JZ5A 3ETPA 4L0PA 2W94A 1OH4A 2QQIA 2ZEWA 3HPNA 5G05L 3CZJA 3WNPA 5LA0A 3GGLA 2OKXA 2VL4A 3FN9A 4XUTA 4QX0A 2VCAA 1XPWA 2WO3A 5FUIA 5C71A 1EUTA 2L9LA 1W9TA 4RYDA 3T0DA 4AG4A 5F7UA 3I2HA 1EUUA 3ZM8A 1P8JA 1JYNA 4BK4A 2J1UA 2E33A 2JDAA 4MO3M 3WF2A 3OEBA 1JZ7A 3W5MA 4TTGA 1US3A 3T08A 3DECA 5C7GA 1UYYA 2VZRA 2Y8KA 2VZSA 2VR4A 1UY3A 5DN2A 1CZTA 4PQQA 2B9VA 1SG3A 3HOBA 1HN1A 2W1QA 1UX7A 2J22A 5DMYA 3I2IA 4XVHA 1GQPA 2WAAA 5JXGA 1PX3A 2W5FA 2CDPA 4DEVA 1GOGA 3EB7A 3DYOA 2VCBA 3J7HA 5DPNA 2Z4FA 2VMDA 3MUY1 2W91A 3JXSA 3UESA 4CVUA 3A7QA 3WQBA 2C26A 4CUBA 2W95A 2Y6LA 3E1F1 3VDBA 1W8OA 4QX1A 4W4ZA 1PMHX 1JU3A 1F4AA 2VC9A 3FL7A 3IAQA 1H6YA 5EIYB 3MUZ1 4LPLA 4ZZ8A 3LQCA 1UMIA 1J84A 1O8SA 2EIBA 4W50A 3K46A 2RJ2A 4P00B 1LNSA 2W87A 3NJXA 3VD3A 2ZEXA 3DYMA 2CDOA 2QQOA 1I5PA 2V72A 3U37A 3MO4A 1L7RA 2VM9A 4MGQA 3LEIA 3T2PA 2VCCA 3ACHA 2VMCA 3I2KA 2WO1A 2Y6GA 5CZKA 1PX4A 2VMFA 3I3DA 1O8PA 4ZZ5A 2VQUA 5IFTA 3A21A 2XHNA 1O59A 4CUCA 4QAWA 3A22A 4PF1A 3WNLA 3K4ZA 1W9SA 4TXWA 1DLCA 5A1AA 4A6OA 2W9XA 2QQJA 4UI9L 3DYPA 2RV9A 1L7QA 4A3ZA 1K3IA 1JHJA 3ACIA 1JYWA 1UY4A 3MBWA 1PMJX 2EIEA 4YPJA 3WF1A 3CDZB 2VZOA 2YG0A 1UY0A 1OD3A 4JX0A 3VDAA 4A45A 1JI6A 2J1VA 4E8DA 3IAPA 3VD7A 4DXSA 1SHWB 4GWIA 2WN2A 2VTFA 3FHQA 4LKSA 3WNKA 1GU3A 4A42A 2VJXA 3T09A 2W1WA 3MV01 3HNBM 2WN3A 2J1SA 3UNPA 2VZTA 2E26A 4W8JA 2W1UA 2BGPA 3SKJE 3BGAA 1T2XA 4OMCA 2XQXA 4DXRA 4JKKA 2WZEA 1UZ0A 2YC2A 2XONA 4BXSV 3K4DA 4ARYA 2BBAA 4XUNA 2WO2A 4CU8A 2B4KA 4ARXA 5EJZB 4A4AA 4M4PA 2WQ8A 1OF4A 2VZUA 3HN3A 5IFPA 1W8NA 1GMMA 2WZ8A 3VD9A 2LS6A 1K42A 2BGOA 1TG7A 3THDA 2BERA 2W92A 2E32A 4M4RA 3FHAA 5EJ1B 1OT5A 1JZ2A 2Y64A 4QB1A 1UY1A 4P08A 1JYXA 3C7GA 4FI9A 2JKXA 3I2JA 4XZUG 2J1AA 5JXHA 3CIHA 5JUVA 3CZUA 1GUIA 4OMDA 3UETA 3OEAA 4QB2A 3IIIA 3PUHA 4D0QA 4GWJA 4MADA 4QX3A 1CIYA 1ULPA 2Y6HA 3T2OA 3D3AA 2QBXA 2VOTA 3OB8A 1MPXA 3VD5A 2VO5A 1JZ3A 5B4XA 4BJ0A 4KWUA 2ID4A 1KEXA 2WYSA 3IB3A 2WUHA 3WNNA 4DUWA 2KD7A 4BK5A 2C9KA 4QDRA 5JXJA 2QQLA 2JD9A 3K4AA 4GZ9A 1K12A 3SKVA 3NRUA 5DQ0A 4JKLA 3OGRA 3SEEA 2W46A 2BZDA 3NQHA 2VZ3A 2ZEZA 3HEIA 1K45A 2WBKA 5LCWL 2YC4A 3CMGA 3ACFA 3C7HA 4JKMA 2VZPA 3OBAA 4DEQA 2WAOA 2VZ1A 4Z2AA 1JU4A 1F4HA 4DXTA 3THCA 3GDBA 3WEZA 3P1IA 2DDUA 4XUPA 2QQNA 4LQRA 3BN6A 3WF0A 1CZSA 4XUQA 5LA2A 4OYUA 2VZQA 2VZVA 3I3BA 3A23A 1GOFA 3ACGA 4MOAA 2W47A 4OZOA 5HXMA 4DUVA 4P02B 1CZVA 1RYYA 3GM8A 1UXXX 3I97A 3LE0A 3I3EA 2ORXA 3VD4A 2ORZA 4QB6A 3SEPA 1UYZA 3OG2A 4P5YA 2DCKA 4OUEA 4XURA 1WCQA 5C70A 5G04L 2V5DA 3WNOA 5IJRA 1OF3A 1XC6A 2J1RA 5J1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR2 A;  3OGS A;  5JMO A;  1SDD B;  2EIC A;  3C8X A;  2HLE A;  3HJR A;  2YB7 A;  4UOJ A;  5HPO A;  3LPG A;  2C4X A;  3I2G A;  2V4V A;  3NNG A;  2YFU A;  1IQD C;  1NX9 A;  2RVA A;  1KGY A;  1W9W A;  1UY2 A;  4ZXE A;  3T0B A;  1NUK A;  4UAP A;  4D8M A;  4QPW A;  3F2Z A;  1W0N A;  1GOH A;  3PUI A;  1NKG A;  2WAB A;  4XUO A;  3VDC A;  4IUG A;  2W1S A;  1DYO A;  3HNY M;  4KMQ A;  4BDV B;  5IHR A;  2Y6K A;  3CKH A;  2VQT A;  4MGS A;  1JZ6 A;  4DUX A;  2X10 A;  2J1T A;  1WKY A;  1US2 A;  3LEG A;  3WF3 A;  3WSO A;  3C7E A;  4CU7 A;  3WNM A;  1UWW A;  1ULO A;  3LEK A;  1D7P M;  3T2Q A;  2QQK A;  3K75 B;  5IYY A;  4A41 A;  2QQM A;  2PQS A;  4KI5 M;  3K77 A;  2R7E B;  2X05 A;  3ABZ A;  3T0A A;  1XNA A;  4A44 A;  3GXU A;  2W3J A;  1JZ8 A;  1JZ4 A;  4PT6 A;  4CUA A;  3CQO A;  4QDQ A;  4LHS A;  1UMH A;  5I0D A;  3HNM A;  4HG6 B;  1H6X A;  2VME A;  4JHZ A;  1W99 A;  4E8C A;  1BHG A;  3I2F A;  5LA1 A;  1GNY A;  3IDA A;  1JYV A;  1CX1 A;  3C7O A;  1UYX A;  2J7M A;  2YFZ A;  4ET7 A;  5CYY A;  1TVG A;  3NJV A;  2ZXQ A;  1YQ2 A;  3P6B A;  2LW8 A;  5B4N A;  3W5N A;  4ZY9 A;  4QDS A;  2E31 A;  5JXI A;  1DP0 A;  1UXZ A;  3LPF A;  1XNT A;  4AAX A;  2J1E A;  3EYP A;  2JE8 A;  4CU9 A;  3AC0 A;  1J83 A;  2DCJ A;  2XOM A;  4CU6 A;  2ZEY A;  3ECQ A;  3C7F A;  4QX2 A;  3MV1 1;  2HYX A;  2X09 A;  1NAE A;  2EID A;  1R64 A;  2Y6J A;  3OGV A;  3WF4 A;  2WDB A;  4RN5 A;  1JZ5 A;  3ETP A;  4L0P A;  2W94 A;  1OH4 A;  2QQI A;  2ZEW A;  3HPN A;  5G05 L;  3CZJ A;  3WNP A;  5LA0 A;  3GGL A;  2OKX A;  2VL4 A;  3FN9 A;  4XUT A;  4QX0 A;  2VCA A;  1XPW A;  2WO3 A;  5FUI A;  5C71 A;  1EUT A;  2L9L A;  1W9T A;  4RYD A;  3T0D A;  4AG4 A;  5F7U A;  3I2H A;  1EUU A;  3ZM8 A;  1P8J A;  1JYN A;  4BK4 A;  2J1U A;  2E33 A;  2JDA A;  4MO3 M;  3WF2 A;  3OEB A;  1JZ7 A;  3W5M A;  4TTG A;  1US3 A;  3T08 A;  3DEC A;  5C7G A;  1UYY A;  2VZR A;  2Y8K A;  2VZS A;  2VR4 A;  1UY3 A;  5DN2 A;  1CZT A;  4PQQ A;  2B9V A;  1SG3 A;  3HOB A;  1HN1 A;  2W1Q A;  1UX7 A;  2J22 A;  5DMY A;  3I2I A;  4XVH A;  1GQP A;  2WAA A;  5JXG A;  1PX3 A;  2W5F A;  2CDP A;  4DEV A;  1GOG A;  3EB7 A;  3DYO A;  2VCB A;  3J7H A;  5DPN A;  2Z4F A;  2VMD A;  3MUY 1;  2W91 A;  3JXS A;  3UES A;  4CVU A;  3A7Q A;  3WQB A;  2C26 A;  4CUB A;  2W95 A;  2Y6L A;  3E1F 1;  3VDB A;  1W8O A;  4QX1 A;  4W4Z A;  1PMH X;  1JU3 A;  1F4A A;  2VC9 A;  3FL7 A;  3IAQ A;  1H6Y A;  5EIY B;  3MUZ 1;  4LPL A;  4ZZ8 A;  3LQC A;  1UMI A;  1J84 A;  1O8S A;  2EIB A;  4W50 A;  3K46 A;  2RJ2 A;  4P00 B;  1LNS A;  2W87 A;  3NJX A;  3VD3 A;  2ZEX A;  3DYM A;  2CDO A;  2QQO A;  1I5P A;  2V72 A;  3U37 A;  3MO4 A;  1L7R A;  2VM9 A;  4MGQ A;  3LEI A;  3T2P A;  2VCC A;  3ACH A;  2VMC A;  3I2K A;  2WO1 A;  2Y6G A;  5CZK A;  1PX4 A;  2VMF A;  3I3D A;  1O8P A;  4ZZ5 A;  2VQU A;  5IFT A;  3A21 A;  2XHN A;  1O59 A;  4CUC A;  4QAW A;  3A22 A;  4PF1 A;  3WNL A;  3K4Z A;  1W9S A;  4TXW A;  1DLC A;  5A1A A;  4A6O A;  2W9X A;  2QQJ A;  4UI9 L;  3DYP A;  2RV9 A;  1L7Q A;  4A3Z A;  1K3I A;  1JHJ A;  3ACI A;  1JYW A;  1UY4 A;  3MBW A;  1PMJ X;  2EIE A;  4YPJ A;  3WF1 A;  3CDZ B;  2VZO A;  2YG0 A;  1UY0 A;  1OD3 A;  4JX0 A;  3VDA A;  4A45 A;  1JI6 A;  2J1V A;  4E8D A;  3IAP A;  3VD7 A;  4DXS A;  1SHW B;  4GWI A;  2WN2 A;  2VTF A;  3FHQ A;  4LKS A;  3WNK A;  1GU3 A;  4A42 A;  2VJX A;  3T09 A;  2W1W A;  3MV0 1;  3HNB M;  2WN3 A;  2J1S A;  3UNP A;  2VZT A;  2E26 A;  4W8J A;  2W1U A;  2BGP A;  3SKJ E;  3BGA A;  1T2X A;  4OMC A;  2XQX A;  4DXR A;  4JKK A;  2WZE A;  1UZ0 A;  2YC2 A;  2XON A;  4BXS V;  3K4D A;  4ARY A;  2BBA A;  4XUN A;  2WO2 A;  4CU8 A;  2B4K A;  4ARX A;  5EJZ B;  4A4A A;  4M4P A;  2WQ8 A;  1OF4 A;  2VZU A;  3HN3 A;  5IFP A;  1W8N A;  1GMM A;  2WZ8 A;  3VD9 A;  2LS6 A;  1K42 A;  2BGO A;  1TG7 A;  3THD A;  2BER A;  2W92 A;  2E32 A;  4M4R A;  3FHA A;  5EJ1 B;  1OT5 A;  1JZ2 A;  2Y64 A;  4QB1 A;  1UY1 A;  4P08 A;  1JYX A;  3C7G A;  4FI9 A;  2JKX A;  3I2J A;  4XZU G;  2J1A A;  5JXH A;  3CIH A;  5JUV A;  3CZU A;  1GUI A;  4OMD A;  3UET A;  3OEA A;  4QB2 A;  3III A;  3PUH A;  4D0Q A;  4GWJ A;  4MAD A;  4QX3 A;  1CIY A;  1ULP A;  2Y6H A;  3T2O A;  3D3A A;  2QBX A;  2VOT A;  3OB8 A;  1MPX A;  3VD5 A;  2VO5 A;  1JZ3 A;  5B4X A;  4BJ0 A;  4KWU A;  2ID4 A;  1KEX A;  2WYS A;  3IB3 A;  2WUH A;  3WNN A;  4DUW A;  2KD7 A;  4BK5 A;  2C9K A;  4QDR A;  5JXJ A;  2QQL A;  2JD9 A;  3K4A A;  4GZ9 A;  1K12 A;  3SKV A;  3NRU A;  5DQ0 A;  4JKL A;  3OGR A;  3SEE A;  2W46 A;  2BZD A;  3NQH A;  2VZ3 A;  2ZEZ A;  3HEI A;  1K45 A;  2WBK A;  5LCW L;  2YC4 A;  3CMG A;  3ACF A;  3C7H A;  4JKM A;  2VZP A;  3OBA A;  4DEQ A;  2WAO A;  2VZ1 A;  4Z2A A;  1JU4 A;  1F4H A;  4DXT A;  3THC A;  3GDB A;  3WEZ A;  3P1I A;  2DDU A;  4XUP A;  2QQN A;  4LQR A;  3BN6 A;  3WF0 A;  1CZS A;  4XUQ A;  5LA2 A;  4OYU A;  2VZQ A;  2VZV A;  3I3B A;  3A23 A;  1GOF A;  3ACG A;  4MOA A;  2W47 A;  4OZO A;  5HXM A;  4DUV A;  4P02 B;  1CZV A;  1RYY A;  3GM8 A;  1UXX X;  3I97 A;  3LE0 A;  3I3E A;  2ORX A;  3VD4 A;  2ORZ A;  4QB6 A;  3SEP A;  1UYZ A;  3OG2 A;  4P5Y A;  2DCK A;  4OUE A;  4XUR A;  1WCQ A;  5C70 A;  5G04 L;  2V5D A;  3WNO A;  5IJR A;  1OF3 A;  1XC6 A;  2J1R A;  5J1X A; 
#chains in the Genus database with same CATH topology
 5DUW A;  4CCN A;  4ZU7 A;  3EMR A;  4NR1 A;  1TNF A;  4XXP A;  3EBR A;  5JMO A;  1JOJ A;  5A7N A;  5E1R A;  4QQP A;  2AR6 A;  1LEM A;  4NIA A;  4IEX A;  5DAQ A;  3N4M A;  3S7I A;  3LPG A;  3QBQ A;  1JOB A;  1LR5 A;  1GBG A;  3K3N A;  4HKW A;  5FYM A;  2GC1 A;  1O91 A;  5KXC A;  3I2G A;  2V4V A;  1ODM A;  2XBO 3;  1GSL A;  3NNG A;  4AVA A;  1UF2 C;  3R4D B;  1DFQ A;  4MET A;  2B5H A;  5FY5 A;  1Y4W A;  1KGY A;  4GWM A;  4UW4 A;  3ZN6 B;  4OUM A;  3WHU A;  1RIR A;  2D6N A;  4FXK B;  1UL9 A;  3H42 B;  1AX1 A;  2A70 A;  1W9W A;  2BVB A;  4ZXE A;  2D40 A;  4DXZ A;  1SLC A;  1NUK A;  4XW3 A;  3R05 A;  1V6J A;  3FLP A;  4Q4Y 3;  1LOC A;  1PO1 3;  4HKL A;  2VUD A;  3WW4 A;  1W0N A;  1GOH A;  5KXD A;  2QZ3 A;  2WAB A;  4K9S A;  2VPV A;  2VU9 A;  2W1S A;  3NST A;  3NV3 A;  4JGY C;  5KC6 A;  4I3G A;  4KMQ A;  4BDV B;  2VUC A;  4K1Z A;  1Y9Q A;  4RGK A;  5C3R A;  3IMM A;  5FBJ A;  5BNO C;  4Y20 A;  4K20 A;  4Y20 B;  3TYJ A;  1FMD 1;  1NOV A;  4DUX A;  1ASJ 3;  4YG3 A;  2J1T A;  3QD6 A;  3LEG A;  1KJR A;  5C3Q A;  4KQ7 A;  2NQY A;  3C7E A;  4CU7 A;  3KCX A;  1RMU 1;  1UWW A;  4UBH A;  2IFR A;  3T2Q A;  2P37 A;  2QQK A;  2R06 3;  3BU7 A;  4Q0Q A;  2ZA9 A;  5FP3 A;  1LOD A;  4QU1 A;  1BKZ A;  1RUE 1;  4XZP A;  5L9R A;  2IXK A;  1WMD A;  3OY8 B;  1MR5 A;  3KWV A;  3NAP A;  4XC9 A;  2QQM A;  3CF6 E;  5C8C B;  4KI5 M;  5BNN C;  4Y5T A;  4K1Y A;  4EZH A;  5IK5 A;  1TMF 3;  1UZW A;  4YGC A;  5EP9 A;  1DQ0 A;  1YJL A;  2R7E B;  3LIH A;  4AZZ A;  1KRI A;  2OUH A;  2VTX J;  2Y60 A;  2X05 A;  2ARA A;  3ABZ A;  1FPN 3;  3T0A A;  5FK8 A;  3W20 A;  3TOJ A;  2VAU A;  2W3J A;  1YI9 A;  5F5Q A;  1W8F A;  2E9Q A;  3CHX A;  3S57 A;  3A4U A;  4LO6 B;  2DVG A;  3CQO A;  1DU3 D;  4QDQ A;  5F5A A;  4CP9 B;  3DKW A;  3VDD C;  1V6N A;  3HD8 B;  4EN0 A;  4ZS2 A;  3CO2 A;  1H6X A;  1FV3 A;  4HG6 B;  3ZFE B;  4EYU A;  4K8R B;  3VBU C;  2GC2 A;  4E8C A;  1OQD A;  1S2K A;  1QJE A;  3N36 A;  3ZXG A;  1UQX A;  4JGZ B;  1FPN 2;  1C4R A;  2VNV A;  1QJX 3;  1SDW A;  3AP7 A;  3IDA A;  2QFE A;  1PVC 3;  2UWC A;  3NAP C;  4Q0P A;  4RQP B;  1CX1 A;  1GR3 A;  4LLF A;  4KWK A;  2BGC A;  1POV 0;  2J7M A;  3OBZ A;  5E8A A;  4FQ4 A;  2DV9 A;  4DIQ A;  2K9Z A;  4ET7 A;  2BBV A;  3USU A;  4RS5 C;  1QU0 A;  5CYY A;  3PVN A;  1WMX A;  3O0V A;  3P6B A;  1NCQ A;  4HZF A;  2DUP A;  4IET A;  4KG8 A;  1CD3 G;  1C8N A;  2TEP A;  4WVW A;  1YFY A;  1DP0 A;  3AXE A;  2W2I A;  1F5J A;  3LPF A;  2HWE 2;  2D6K A;  3AYE A;  4CU9 A;  4QGM A;  1WD3 A;  3ZVX A;  1HLC A;  5FMD A;  5JOX A;  2D5F A;  3HBK A;  5A7O A;  2OT7 A;  3NV4 A;  1AHS A;  2JXA A;  2XOM A;  3N9O A;  4K6B A;  4LHN A;  3VBF C;  1BBT 1;  5J09 A;  2VGD A;  2WR9 A;  5J37 A;  1LED A;  3P3N A;  1WA6 X;  3ECQ A;  3C7F A;  2XVK A;  1H1A A;  3N7L A;  1NQJ A;  3WG4 A;  1C8M 1;  3MFC A;  3ZFF A;  3NNM A;  2QQP A;  1MZ6 A;  5DUX A;  2EID A;  2Y6J A;  4PIX A;  1FX5 A;  4IGQ A;  4GJY A;  3LA3 A;  2LUW A;  5A3M A;  1W03 A;  2EF6 A;  2JD4 A;  4BWO A;  2RS5 2;  4Q4Y 1;  4NPR A;  1GLH A;  4PI0 A;  1AX0 A;  3ZYH A;  1ONA A;  4HLT A;  5G05 L;  3JD7 3;  1OFN A;  4X8P A;  5F6L B;  3U75 A;  1UD1 A;  4Q4V 1;  4UBG A;  4AEK A;  1S0J A;  3AMP A;  5SV8 A;  2VL4 A;  4COW A;  1UAI A;  1DZR A;  5F8P A;  1UOF A;  5H9Q A;  4G9S B;  1KS4 A;  3JBG 3;  2VCA A;  4LBQ A;  4N9I A;  1XPW A;  2AEY A;  1QJU 1;  3D8C A;  3TN9 2;  4CXY A;  1IPS A;  1RUE 3;  1U5I A;  3AXD A;  4CCC A;  2PHW A;  5BNP B;  5GZG A;  5LK7 B;  3H1Y A;  1ASJ 2;  3JD7 2;  4L8Q A;  2WLQ A;  1IZ3 A;  2QZ2 A;  4WM7 B;  3UGG A;  2WS9 3;  4YRD A;  4NO4 A;  3O0X A;  2E6V A;  2RS3 3;  3POW A;  4TSV A;  3AMQ A;  3DF0 A;  1JYN A;  1Q3E A;  2A3X A;  1Q8V A;  5LAS A;  2QQU A;  2UY8 A;  4FTE A;  1WWY A;  1XSR A;  1LHN A;  1MVQ A;  1QJU 2;  4MO3 M;  4QX8 A;  2WFF 3;  1QXR A;  1GIC A;  1JZ7 A;  4IEU A;  4XTP A;  3FWE A;  1OLM E;  1V6K A;  2VW2 A;  3MDP A;  3W5M A;  4IV3 B;  4GA9 A;  4LUM A;  3DEC A;  3WLU A;  4LIT A;  4X6R B;  1WD4 A;  3L9J T;  2VR4 A;  1UY3 A;  3ES4 A;  4URT A;  1SG3 A;  3J9S A;  1BEV 2;  2Y33 A;  1SMV A;  4F83 A;  1O5L A;  3J26 N;  2RM2 2;  4XFG A;  2SLI A;  3MIH A;  5FMO S;  3I2I A;  5FP7 A;  1AL2 2;  3MEP A;  4QPY A;  1DG6 A;  4IV1 B;  3DCQ A;  4KNC A;  5HCA A;  4IV1 C;  5FO7 B;  1JTZ X;  1VBC 1;  4GD4 A;  3U07 A;  5K7P A;  4NWV A;  4P9G A;  5EJ3 A;  1DIW A;  4UFM A;  3MUY 1;  4N43 A;  2PHT A;  3RI9 A;  1ENS A;  1ND2 C;  2A6W A;  3JXS A;  3PUQ A;  5FZB A;  2VTX A;  3B7M A;  1ND2 B;  3SC7 X;  3NKG A;  5A3P A;  4ORF A;  1ZRC A;  2W95 A;  3GBW A;  3VDB A;  4RHV 3;  4BCU A;  5CKQ A;  5FR3 A;  1NT0 A;  4L11 A;  1AVB A;  1RUF 3;  1CAX B;  2EAA A;  4QHB A;  4CPB A;  1X8E A;  5FZ3 A;  4PQ9 A;  1VMF A;  2QQV A;  3MUZ 1;  1KDM A;  4CRQ A;  1QXJ A;  3FLR A;  2DUR A;  4LPL A;  2CHH A;  3LQC A;  3WV6 A;  1J84 A;  1LU2 A;  3H8R A;  3ZDV A;  3T4H B;  1VBE 2;  2AYH A;  2EIB A;  1YHF A;  4NWW A;  2NZ9 A;  3OGJ A;  4NIH A;  1LNS A;  1GWK A;  2W87 A;  3AZX A;  4PLO A;  1ENX A;  3NJX A;  1DGR A;  1LES A;  3AFG A;  3DYM A;  2CDO A;  3AP4 A;  5A3U A;  1ZRF A;  4L9B A;  3AL6 A;  4A2U A;  3U37 A;  1RUF 2;  2AEN A;  2I74 A;  3MO4 A;  1L7R A;  1AX2 A;  4MGQ A;  1PGL 2;  5FYB A;  4IES A;  2VCC A;  4QPG B;  3AKR A;  2ZGS A;  1V6L A;  4NRQ A;  1MQT B;  2AUY A;  5IWF A;  1SBE A;  2P5B A;  4LK7 A;  2VMC A;  3VB9 A;  4DRV A;  5C9A A;  1MQT C;  3KV9 A;  1AR9 1;  2WQ4 A;  4K3U A;  2ZHL A;  5CZK A;  2G9Z A;  4DRR A;  1PX4 A;  2P34 A;  4I0B A;  1A34 A;  4NHY A;  3I3D A;  4RFT 0;  5LZ6 A;  2FDG A;  5A3T A;  1W8U A;  2FDK A;  2R07 2;  5IFT A;  4M3C E;  1O59 A;  1HRV 1;  2ZMN A;  4CUC A;  3VBU B;  1AYN 2;  2KA3 A;  2IZW A;  2Y34 A;  4LTA A;  1W9S A;  3JZV A;  2NYY A;  4TXW A;  4ZU4 A;  1DLC A;  4U36 A;  3NAP B;  3ZYG A;  4BOW A;  5FUP A;  2B7Y A;  3T30 A;  2ETE A;  2QCS B;  4ONU A;  5D1I A;  2YV8 A;  3AMN A;  5D21 A;  2WIN B;  2BP6 A;  3ST7 A;  4OQ9 A;  1L7Q A;  2FMD A;  3O1U A;  3U4X A;  4S2H A;  4Y3O A;  1D4M 1;  2ES3 A;  1JYW A;  1V00 A;  3ELN A;  3VLB B;  1HRV 2;  4AI0 A;  4OQ8 A;  3WF1 A;  1SPP B;  2D43 A;  1HW5 A;  2J42 A;  3CDZ B;  4AI8 A;  5AVP A;  1OD3 A;  2XL7 A;  3VDA A;  4V1P A;  4YZ5 A;  3BOP A;  3GCW A;  3PTY A;  2BNO A;  1IS5 A;  4FOQ A;  4HFS A;  4DXS A;  1LJ7 A;  2WN2 A;  2VTF A;  4XQW A;  3FHQ A;  4LKS A;  5I8T A;  4LJH A;  4QXH A;  2VG9 A;  3WNK A;  3O1P A;  4FPL A;  1GU3 A;  5ACA 1;  3DUI A;  2WS9 1;  3O7O A;  3RS6 A;  1RUJ 2;  4IDZ A;  2J1S A;  1YQ6 A;  3E5X A;  2E26 A;  5IVE A;  2PAE A;  4W8J A;  2BGP A;  3SKJ E;  2GH2 A;  3UGH A;  3BU0 A;  4FXG B;  4MYE A;  2ZGM A;  4MV2 A;  3RJ2 X;  4JKK A;  5GLV A;  3FFZ A;  3UK9 A;  4AHY A;  2A73 B;  5CVR A;  4MXV A;  1PZ9 A;  2YRO A;  2R6Q A;  1D4V B;  3BCW A;  3CLP A;  2I07 B;  2W08 A;  4IXL A;  3K4D A;  2JDH A;  4QQO A;  1PO2 3;  4CU8 A;  3S5A A;  5IVV A;  3H50 A;  4OCT A;  4R4Z A;  2BOJ A;  5KC5 A;  4I2O A;  4M4P A;  2WQ8 A;  2VZU A;  3KV6 A;  4QM9 A;  4F3J A;  2WZR 1;  1UIJ A;  1M4W A;  4KWJ A;  3KHB A;  4QPI A;  4CCE A;  5IFP A;  1RGS A;  5H9S A;  2A7A A;  3VD9 A;  2IXL A;  1K42 A;  1PK6 A;  2BGO A;  2RR1 2;  2HWF 3;  5BNP C;  1FAT A;  1VJ2 A;  1TG7 A;  3ITQ A;  3OY8 A;  5DDJ 1;  3IBM A;  2R06 1;  2BER A;  4Q1R A;  3E6C C;  2W92 A;  1WCS A;  4PIZ A;  1BK1 A;  2Y64 A;  5C8C C;  4QB1 A;  4MSV A;  2Y38 A;  1CAW A;  1UY1 A;  2Z79 A;  4AI1 A;  3LKJ A;  4IND A;  5L36 A;  4P08 A;  1RXG A;  2C9A A;  3PHM A;  1NZI A;  3C7G A;  5FYI A;  3U78 A;  4AWD A;  1JYX A;  2GZW A;  4IEZ A;  4TZD A;  1VLN A;  4M0N A;  4PDW B;  3GJA A;  4XJ9 A;  5C3S A;  3CZU A;  5JCT A;  5JZG B;  1AR6 3;  2YHJ A;  1I6X A;  3J8F 1;  4QB2 A;  4JDM A;  3VKM A;  3OYW A;  2D6O X;  4D0Q A;  3J7N A;  3VV1 A;  4GWJ A;  3ALQ A;  1H0B A;  4FAG A;  3U10 A;  4QX3 A;  5A7W B;  1H8T C;  2PAK A;  4LKD A;  4N7I A;  2F6B A;  1CIY A;  1OLM A;  2Y6H A;  4Q4Y 2;  1BBT 3;  4S2F A;  5AVA A;  4CE8 A;  3D3A A;  2QBX A;  2VOT A;  5FY0 A;  5KHI A;  3M3E A;  1DCS A;  3FBY A;  4UFK A;  3VD5 A;  1YQ8 A;  5FYU A;  4MXW A;  5C3O A;  2D6P A;  3GBF A;  4KWU A;  4IL7 A;  1ZRD A;  4YG6 A;  2WYS A;  3HMY A;  3OD0 A;  5D8A A;  4DUW A;  1PO1 2;  4LBL A;  1AR6 2;  3KF5 A;  5JWP A;  4QDR A;  5JPN B;  5ANN A;  1R1A 1;  1XB9 A;  4LO8 A;  5FZI A;  3S6P A;  2YGL A;  3N9P A;  4FPG A;  3SKV A;  1CAU A;  2E53 A;  4CZS A;  1YNA A;  4GUL A;  1HV1 A;  1YCI A;  5JI7 A;  4XJU A;  5F3E A;  5L73 A;  1W8H A;  1OKO A;  1Y43 B;  4LEJ A;  4PI2 A;  5DG1 A;  2W46 A;  4CCK A;  3KQR A;  1C57 A;  3SXW A;  1MZE A;  1K45 A;  2JIJ A;  2WBK A;  1UIK A;  2XML A;  2BTV C;  3ZN5 A;  4CDQ A;  2YC4 A;  3CMG A;  3DXU A;  2D44 A;  4JDO A;  4R8H A;  3WCR A;  3BIE A;  4OHY A;  4YVW C;  5C5U A;  1DYP A;  3OBA A;  2QQW A;  2W68 A;  4HVR A;  2FDH A;  2R04 3;  4OHZ A;  1W0O A;  4LOR A;  4EQV A;  4DFS A;  1QH7 A;  3FUO A;  2VZ1 A;  4Z2A A;  1FXZ A;  3IPV A;  3THC A;  3VBF B;  4AHZ A;  4BM8 A;  3AX4 A;  2XLG A;  3VL8 A;  5FDB A;  1W2U A;  1OOP C;  4B4R A;  1JYI A;  2WSV A;  4AQT A;  3N7K A;  2F4P A;  2WSU A;  1H2K A;  1AR7 1;  4GB3 2;  5A7Q A;  1NA1 B;  4UT5 A;  2BWC A;  2BVV A;  1ACC A;  4CTE A;  2OII A;  4MHR A;  1COV 3;  2VZV A;  2Q0A A;  1Q43 A;  1GP4 A;  4G4F A;  3SHR A;  4AVS A;  1OSG A;  1VBD 1;  3R6S A;  1TMF 1;  1T6G C;  1TZO A;  2K46 A;  1GOF A;  3ACG A;  3BAL A;  1AJO A;  3MIB A;  4W6X A;  4EWA A;  2B45 X;  2JG8 B;  4K40 A;  2I2S A;  2W47 A;  3JBG 1;  3POF A;  4YVW A;  2PAM A;  2XBO 1;  2H0V A;  1IKP A;  3T1M A;  1RYY A;  3GM8 A;  3I97 A;  1J58 A;  4N8M A;  2BFU L;  5A33 B;  2WNU A;  1NE6 A;  1ZBE 2;  3OUJ A;  2MPF A;  2FCV A;  1PNF A;  1NXM A;  2ORZ A;  4BQY A;  1RUI 2;  4QB6 A;  3JB4 C;  4RGG A;  3I3M A;  3O1R A;  4FFH A;  4Q4X 2;  1YO8 A;  4QKD A;  1S0E A;  1IS6 A;  1CES A;  3OG2 A;  3ASI A;  3E5U A;  1PZ8 A;  2AC1 A;  4FCA A;  4XMI A;  1LGB A;  1XE7 A;  2UY9 A;  2DCK A;  1OBN A;  4LUK A;  4M3C B;  1NY7 1;  2OXB A;  3RWN A;  4AGV A;  1AYN 1;  5ABJ C;  4XDP A;  1WME A;  2PLV 3;  1BEV 1;  5C70 A;  2XBO 2;  5ABJ B;  3QCW A;  3WNO A;  2EA7 A;  3NMB A;  4BQ4 A;  2FDI A;  1NQD A;  1W3V A;  1RTV A;  4LNV A;  3MID A;  4KG0 A;  1XNC A;  1ZZ6 A;  4FPC A;  1SDD B;  1LHW A;  2Q8O A;  1F31 A;  1Y7B A;  2HLE A;  3V56 A;  5IT6 A;  2D6L X;  2JB4 A;  4GWN A;  4Q27 A;  5FZ7 A;  5C33 A;  2CSG A;  1FMD 3;  4IV3 C;  4IE7 A;  1Z7S 3;  1EP0 A;  4NPM A;  5JOZ A;  4B7K A;  2EXH A;  3VBH A;  5EQU A;  5IK7 A;  2YFU A;  1VBC 2;  4JQT A;  5IK4 A;  1SCR A;  1NX9 A;  1RUN A;  4MH0 E;  1IQA A;  1HB1 A;  2XJU A;  3DGT A;  4HVO A;  3IZO A;  3RYR A;  3M70 A;  1EYB A;  3ILR A;  3UV9 A;  2ENR A;  4K7J A;  4XCB A;  1S4C A;  4XDQ A;  2EXK A;  5EWS A;  1HRI 2;  1BQP A;  4D8M A;  4QPW A;  2CTV A;  2JIG A;  2TBV A;  2X5I A;  1NKG A;  4JGY B;  2D98 A;  2NM1 A;  3I49 A;  3M8L A;  4XCA A;  4PLN A;  4YZ4 A;  1O4Z A;  1WBL A;  2WWS A;  3IT8 A;  2YU2 A;  1W8Z A;  3R4U A;  3UYJ A;  4NRO A;  4CP0 A;  1W2T A;  3ZXL A;  4D7Y A;  2HH9 A;  2HWD 3;  3E6B A;  1AXZ A;  1VAV A;  4GAZ A;  5L19 A;  1VBB 2;  4FPO B;  1R1A 2;  1US2 A;  3J7M A;  5FXV A;  3WF3 A;  1SBD A;  2O8Q A;  1QOT A;  4BME A;  1OVP A;  2QNK A;  1R09 3;  4FAH A;  2GH8 A;  4XDO A;  3WNM A;  4C0B A;  3RZG A;  4QU2 A;  2LRP A;  1QQP 1;  3WXP A;  3ZFE A;  1HKD A;  2PLV 2;  1K5M C;  4NRP A;  1ZBE 3;  1DGW X;  2ZMK A;  5BV6 A;  2UYB A;  1UPS A;  3CJI A;  1REF A;  4A41 A;  4CP1 A;  4N53 A;  1GWM A;  2PQS A;  2YXS A;  1FNZ A;  1YJK A;  2QDR A;  1XNK A;  1ZZC A;  2Y26 A;  2ARX A;  3RZJ A;  1I3H A;  2JKB A;  4WBB A;  3TEX A;  5CKN A;  4Z92 B;  2VMH A;  2VY0 A;  5CFD A;  2WNO A;  5CFD B;  3TWI A;  5JZG C;  2IXJ A;  5EZW A;  3NL1 A;  2RS5 3;  2XXZ A;  3VDD B;  1UZY A;  5FZ9 A;  4B29 A;  2WYF A;  3Q8F A;  4BMB A;  4KBB A;  1HX6 A;  4CEY C;  3SCF A;  4LHS A;  3WP5 A;  5I0D A;  2GDF A;  3HNM A;  4RL7 A;  4UW3 A;  4W65 A;  3J4U H;  1Q56 A;  2XG3 A;  3VBU A;  3WIN E;  1BVP 1;  5JOW A;  4XEZ A;  1W99 A;  2FZ2 A;  4JGZ C;  5APA A;  1EAH 2;  2MEV 1;  4YLZ A;  5GJ6 A;  5LW9 A;  4XXA A;  4AR2 A;  3CL1 A;  3OPT A;  1O5U A;  4RQP C;  3BTZ A;  1LB2 A;  1JYV A;  1X7N A;  1QEX A;  1W2N A;  4P9X A;  2R30 A;  4TLF A;  1CAW B;  1JUH A;  2VVE A;  2WZR 2;  2QVS B;  2YFZ A;  3AP9 A;  3B5L B;  2XJQ A;  2VUA A;  3TEW A;  1TVG A;  1EV1 3;  2R07 1;  5AFE A;  2CAV A;  3ZX7 A;  4M00 A;  2WFF 1;  4R9C A;  1O6U A;  2WT1 A;  1E5S A;  4CP9 A;  5KWR A;  4YZ3 A;  3OYW B;  1NCQ C;  5GLT A;  1BK0 A;  5J48 A;  2PA7 A;  5FXZ A;  4AED B;  4L99 A;  1OKQ A;  4LA3 A;  1W6O B;  5DUV A;  5FZG A;  4AAX A;  4EWD A;  3EYP A;  1J83 A;  1WLW A;  2JE7 A;  2RM2 3;  2UU8 A;  3JQW A;  4LLO A;  5BYN A;  2A6Z A;  1BVV A;  4N43 B;  1OOP A;  1Q8P A;  1HV0 A;  3CBN A;  5T5P A;  1AR9 3;  1UKR A;  1UOJ A;  2ZBJ A;  1ND2 A;  2RS1 3;  1A6C A;  1UMZ A;  3FUQ A;  5M0T A;  4CU6 A;  2C24 A;  2ZEY A;  3WX5 A;  5IK8 A;  4XOG A;  5BNO A;  1BXH A;  4QX2 A;  2CU5 A;  5DG2 A;  5F3G A;  2HYX A;  2X09 A;  3CNA A;  1NAE A;  3T3Y A;  5JPM B;  2V73 A;  3ZMN A;  3KD4 A;  2FZ1 A;  2JDM A;  4XF9 A;  5FK7 A;  1HQN A;  3M3I A;  1R08 1;  1SLI A;  1W3X A;  1HB4 A;  5EV7 A;  4BXF A;  3ZOI A;  4ATF A;  1JZ5 A;  4L0P A;  2R16 A;  1MS9 A;  1E57 A;  1R08 2;  1UYP A;  2CL2 A;  2W94 A;  2ZEW A;  4GIQ A;  3VGI A;  5CKM A;  2JG8 C;  3A0N A;  4LE3 A;  2BV4 A;  4N53 C;  3K3O A;  3WNP A;  3GAL A;  1OUX A;  2PYT A;  5E89 A;  4Y1X A;  1IPK A;  4ZKT B;  1FOD 2;  1YUD A;  2HYK A;  1VBB 3;  4LO7 A;  5IAV A;  3SQO A;  4IER A;  5FUI A;  2VOV A;  5B2G B;  1EUT A;  3VL9 A;  3RPQ A;  4HET A;  2L9L A;  4CUG A;  5FP8 A;  1W9T A;  1S0C A;  4RYD A;  2FMY A;  1VMJ A;  2HWC 2;  4J1W A;  2A3W A;  5CG8 A;  2Q30 A;  5J96 B;  2D3P A;  3ZM8 A;  5FJK A;  4KU8 A;  4FOV A;  4CDU A;  4OVE A;  5A6Q A;  5FPU A;  5I0S A;  4RHV 1;  3WQ0 A;  2JDA A;  1WW6 A;  5K0U A;  3QH7 A;  1OD5 A;  1RUH 2;  4EN6 B;  2DUO A;  1L3J A;  1DQ1 A;  1FYU A;  1H2M A;  2O1Q A;  2QDN A;  3WW3 A;  2W39 A;  1YQ5 A;  2RDS A;  4E4D X;  1UKG A;  3DKQ A;  1IOA A;  1UYY A;  3MLJ A;  3VZJ A;  4HON A;  2VZS A;  5DN2 A;  1CZT A;  2IWG B;  2B9V A;  2R04 2;  3OPZ A;  3DN7 A;  4QT6 A;  4YNI A;  1RUJ 3;  2VNG A;  2VOK A;  1S0D A;  2W1Q A;  4K8F A;  1UX7 A;  2AAC A;  1W6P B;  5CIR A;  3LOB A;  1OLQ A;  3VBR B;  3QAC A;  1YLL A;  4AI3 A;  4DO0 A;  1PX3 A;  4PF5 A;  3V0B B;  4FPK A;  4CCO A;  3AYC A;  2CDP A;  2DVB A;  1J1L A;  4MGK E;  4AFA A;  2AH2 A;  4UFI A;  2XLA A;  4GQ7 A;  4YM1 A;  3EB7 A;  3ZLI A;  2IUW A;  4KGQ A;  3AK0 A;  4YW3 A;  4ES9 A;  4I01 A;  3VUO A;  2BEO A;  4IGP A;  3J7H A;  5DPN A;  5BNQ A;  2Z4F A;  4UYB A;  1RHI 1;  1FNY A;  4YW6 A;  2W91 A;  3O0W A;  3ILF A;  2ZAA A;  3RYK A;  1VAL A;  2FHR A;  4H7M A;  3VHP A;  2X8K A;  4YAR A;  1MQT A;  2Y6L A;  1DZT A;  3E1F 1;  5CU1 A;  5FO8 B;  2YUE A;  1RB8 G;  1GP5 A;  2VMI A;  1JU3 A;  1LGN A;  1SQ4 A;  1F4A A;  3FL7 A;  4XIO A;  1H6Y A;  4TLG A;  4NAM A;  4OI1 A;  3AL5 A;  1PHM A;  1RJ7 A;  4ZZ8 A;  4WM8 B;  1HB3 A;  3WZ1 A;  1K5M B;  1ZNP A;  4WM8 C;  1GFF 2;  3K46 A;  4WZF A;  2ZAH A;  3MYX A;  5FZ0 A;  4J1X A;  3ZSK A;  3VD3 A;  2KXL A;  5T3N A;  4MG2 A;  1NA1 C;  2X53 S;  5JSO A;  4HSJ A;  3WHT A;  3NNJ A;  3KMH A;  4Z2W A;  1RL3 A;  1S2B A;  1UZZ A;  2G1M A;  2VM9 A;  3LEI A;  1C8M 3;  2OYZ A;  3T2P A;  3VZN A;  4IGO A;  1C1F A;  4P5H A;  4A6S A;  3ACH A;  1MS5 A;  2G9G A;  5C8W A;  3K2O A;  5CFD C;  3O1V A;  1CGP A;  3PJQ A;  1DQ2 A;  2DFB A;  3KCC A;  3AP6 A;  2WO1 A;  2XH6 A;  1HRI 1;  1ND3 A;  2DYC A;  1V9U 3;  3OJB A;  1D4M 2;  4CEY B;  2PHL A;  4H3W A;  1MEC 2;  1VE0 A;  5FPV A;  2B42 B;  4ZXK A;  4IEW A;  5LB6 A;  2A75 A;  3LA2 A;  4I0W B;  1PGW 2;  3A22 A;  4PF1 A;  1VAK A;  3OUH A;  4HK8 A;  1W06 A;  4COZ A;  3T1L A;  4NJ4 A;  4DZG A;  4FP2 A;  5KXB A;  4P9L A;  1OMI A;  1C8M 2;  4GKY A;  1JBC A;  3WUC A;  1TME 2;  3PMS A;  4XF4 A;  3RDI A;  5I91 A;  1LHV A;  1U0A A;  4A3Z A;  4ASL A;  5D2A A;  2XVL A;  3AMM A;  1JHJ A;  1LRH A;  2VW1 A;  2XLF A;  3LFM A;  1UY4 A;  3H3U A;  1PMJ X;  2HBU A;  5CAZ A;  2LM3 A;  1I5Z A;  2VNO A;  5D8A B;  5FTT C;  4XF1 A;  2GND A;  1ZVF A;  5D8A C;  1H4G A;  4UF0 A;  2RS1 2;  3LDB A;  3VD7 A;  4N43 C;  4Y1U A;  2R0F A;  4AFM A;  1WZX A;  1F5F A;  1G86 A;  1EAH 3;  3GHN A;  5DXD A;  4Q4V 3;  1SFY A;  2ZGN A;  1JHN A;  3KZ4 C;  3PNA A;  5EFU A;  1YIF A;  5IAX A;  2W1W A;  4ZHN A;  2GN3 A;  3D6E A;  3HQX A;  4YGB A;  3UNP A;  2VZT A;  1FPN 1;  4R9A A;  3WW2 A;  2VUJ A;  2ET1 A;  2RG4 A;  2RMU 3;  5F5I A;  2WZE A;  1UZ0 A;  3I54 A;  2YC2 A;  4Q0V A;  5F32 A;  4RD7 A;  4Y33 A;  3KQ4 B;  3ILN A;  3IKW A;  3G6J B;  3WOG A;  1MEC 3;  2DVA A;  2WWJ A;  4ARY A;  4XUN A;  4LOS A;  2ZHK A;  3Q8A A;  4LHK A;  2A6Y A;  1N1T A;  1NA1 A;  1OA4 A;  4FTS A;  4AOC A;  2JE9 A;  2P17 A;  2ZAB A;  3DPR C;  2IXI A;  1IG3 A;  3POS A;  4OHV A;  5EJZ B;  3HN3 A;  4A4A A;  4AXO A;  2YBP A;  1GMM A;  3LDK A;  2P1B A;  1LAJ A;  5EYX A;  5FPZ A;  4KH9 A;  1B35 C;  3I4I A;  5F6K A;  1R1A 3;  4LT5 A;  4FP3 A;  3PVB B;  1B35 B;  2KM2 A;  1W6Q A;  1HXS 1;  3CJI B;  5KHK A;  1OQ1 A;  4AQS A;  2E32 A;  4XAB A;  3FHA A;  5C5T A;  2C0Z A;  5EJ1 B;  3SCH A;  1XRU A;  4YGE A;  4DY3 A;  5T5J A;  1GP6 A;  3ZXE A;  1V0A A;  5FZK A;  2JG9 B;  2ZGT A;  4NRM A;  4FI9 A;  4PDW C;  5FMO L;  1XYN A;  3PME A;  5FIX A;  4XZU G;  1ZA7 A;  2P3I A;  1C5H A;  4JTN A;  1DGW A;  1COV 2;  1GUI A;  2P6C A;  1QWR A;  3OEA A;  3M2M A;  3TRS B;  1FOD 3;  2H6B A;  1RUD 2;  3LZZ A;  5A7S A;  3AZZ A;  3O1T A;  5ERL A;  5J7M A;  1S2E A;  1RUC 3;  5C9A B;  3T2O A;  4E4H A;  2ADE A;  1AF9 A;  2FBE A;  3ZYB A;  2HJI A;  4OHX A;  5C9A C;  5LBC A;  4AQ6 A;  3VZM A;  3I2O A;  2VO5 A;  2DBI A;  3TN9 1;  1KEX A;  4CP2 A;  1ZRR A;  1S0I A;  1AR7 2;  4GB3 1;  4BK5 A;  3ZMO A;  5EXO A;  1D0H A;  1W39 A;  2JDP A;  3I8T A;  4IV1 A;  1U12 A;  4AVV A;  5JXJ A;  1NZC A;  3K4A A;  1EY2 A;  4WVM B;  3IIA A;  3ZXJ A;  3ZFG A;  3B69 A;  3JCI A;  1DQ4 A;  1IGO A;  1VAM A;  4XF3 A;  3RJR A;  1A3K A;  5FP9 A;  3SEE A;  2BZD A;  2GMP A;  4LKF A;  1CN1 A;  2ZX2 A;  3PVE A;  4NOT A;  1KDK A;  2ZX3 A;  2DUQ A;  5LCW L;  4A7K A;  2CV6 A;  1RMU 3;  4I30 A;  2CNA A;  3IMN A;  1GAN A;  4JKM A;  2JG8 A;  3TNP B;  5ACA 3;  2FDF A;  5I0U A;  3G7D A;  2RDR A;  5EPA A;  4RR3 B;  4H14 A;  4E2G A;  4UXA A;  3AZY A;  4P9J A;  4AFC A;  4DXT A;  3H8O A;  3POJ A;  3WEZ A;  3N9L A;  1OUS A;  5FPL A;  4FOW A;  1G8W A;  2DDU A;  2WO7 A;  3MF6 A;  1W8W A;  2D93 A;  2UWA A;  5JIA A;  1RVF 1;  3RMY A;  5CIS A;  4WVV A;  4LBO A;  1MS3 A;  1QJY 2;  3WF0 A;  4OLL A;  4XUQ A;  1PGW 1;  4QHO A;  1M06 G;  5FZL A;  1QGL A;  1TE1 B;  1W2O A;  1PO2 1;  4BU2 A;  3UKN A;  1EPW A;  2O8O A;  4YGD A;  4Y22 B;  4TN7 A;  2YZ4 A;  4XBQ A;  5IVB A;  5H9P A;  5C6C A;  2R0H A;  4Q26 A;  3NJY A;  4LUL A;  4N53 B;  2DWR A;  4MGY E;  1R09 2;  2JDZ A;  3WP6 A;  1PO2 2;  3ZR6 A;  1YRZ A;  1JUI A;  1I9R A;  4P02 B;  4OI4 A;  3OOX A;  5BUV A;  3WDT A;  1RVF 2;  3MIE A;  1UNB A;  3LE0 A;  3S5Q A;  4JV4 A;  3WQ7 A;  3H7J A;  3ZYF A;  1EV1 2;  5FRA A;  4WV8 A;  5HCH A;  1C3H A;  2OPW A;  5HCB A;  4C90 A;  1GZ9 A;  1ZZ9 A;  2CY6 A;  2XJS A;  1LOF A;  2PHR A;  4XET A;  4OUE A;  4XUR A;  4HKO A;  1CAV A;  3W9A A;  4C1W A;  3O1S A;  1QOO A;  5FZC A;  4GMP 3;  1DQ5 A;  5FYZ A;  5G04 L;  2HWF 1;  4Q0S A;  4MUV A;  1OF3 A;  1WGP A;  5GLW A;  4LBN A;  2WQZ C;  1KFU L;  2X5I C;  2J1R A;  1WMF A;  3E5Q A;  2YY1 A;  2GSY A;  3POB A;  4HN0 A;  4KU7 A;  5FYV A;  2X5I B;  4XAC A;  3UKV A;  4FFI A;  3OGS A;  1OUR A;  2BDR A;  4S2G A;  4C1X A;  4DB5 A;  2WA3 A;  4B3N A;  1QMJ A;  3T2T A;  3NVC A;  2CGN A;  2WNV C;  1ULD A;  3H1W A;  3HJR A;  4L97 A;  1O3T A;  1N3Q A;  2OPK A;  5DAX A;  2YB7 A;  1AR8 1;  2IC1 A;  2DU0 A;  3M3C A;  3ORJ A;  5FYY A;  1ULF A;  1OFS A;  5FAX A;  4LO4 B;  1QH6 A;  1N3O A;  1U5X A;  4RHV 2;  4CPB D;  3LSE A;  1RHI 2;  4PDW A;  2JEC A;  3PL0 A;  5F2W A;  2PHF A;  3SH3 A;  4J6G A;  4LBM A;  4GXL A;  4XMA A;  1BBT 2;  3AVS A;  2BUK A;  1W28 A;  1CAU B;  1J1T A;  2G19 A;  3HQR A;  5A80 A;  1TME 3;  2WWU A;  4QHZ A;  4YYO A;  3WDY A;  3ZN6 A;  1G9A A;  3VBR C;  1X36 A;  5T55 A;  1CPN A;  1WW7 A;  3BOW A;  4UAP A;  3MW2 A;  3FHI B;  3LF7 A;  4XFF A;  5A32 B;  5A32 A;  5IVJ A;  1OA2 A;  1YIP A;  3PUI A;  3VHN A;  5A70 A;  4HBN A;  1S0B A;  1ZBA 3;  1WW5 A;  2A6V A;  2ZAC A;  3WDW A;  5KHG A;  5KHJ A;  3VDC A;  4FBF A;  3O1O A;  3IDC B;  1DYO A;  2ZHN A;  1RUF 1;  1XYP A;  1D2Q A;  2XJV A;  3BOD A;  5CFC A;  5IHR A;  5GZF A;  1NE4 A;  2Y6K A;  1LOE A;  2HWC 3;  3CKH A;  2NLR A;  2VQT A;  4MGS A;  1K5J A;  3FZ3 A;  4RA0 A;  4XBN A;  3ZFF B;  1KJL A;  1WKY A;  3B3Q E;  2ADD A;  3JBG 2;  5CB7 A;  3R4S A;  1HDK A;  3ZFF C;  3WSO A;  3VDD A;  2NMN A;  2RS3 2;  3DEM A;  4L92 A;  4NHM A;  2Z42 A;  2CGP A;  2VQ0 A;  5A1L A;  1Q8O A;  1W04 A;  1POQ A;  1XJA A;  3ZXA C;  3LEK A;  1D7P M;  3OBT A;  5BY5 A;  5FWJ A;  4CDU B;  3CJI C;  2ZHM A;  1UOG A;  3LGR A;  1VMH A;  4AK3 A;  1SFN A;  5IYY A;  2G4I A;  2CGO A;  1JW6 A;  3M1H A;  3BKZ A;  1G9F A;  1PM7 A;  4D6R A;  5IUQ A;  2C1F A;  1IHM A;  3K77 A;  2OA2 A;  2VH9 A;  5GKA C;  5LEK A;  2RHP A;  3ZSJ A;  1OH3 A;  4CCL A;  3HBZ A;  3BTA A;  1N1V A;  1XNA A;  4A44 A;  3GXU A;  1XU2 A;  3C3V A;  3RMX A;  2FD8 A;  2IXH A;  3FE5 A;  1JZ4 A;  1G7Y A;  1LEN A;  2UUR A;  1EPZ A;  3HN1 A;  4CUA A;  5F9T A;  3S0M A;  1ND3 B;  3JUU A;  3KM5 A;  3KSC A;  3B94 A;  3I59 A;  1ND3 C;  4LO5 B;  3BI3 A;  3H3L A;  4CCM A;  2WZP P;  4WM7 A;  5FV3 A;  1UMH A;  5JLV A;  1W6M A;  1AXK A;  2VME A;  2WA4 A;  4MX3 A;  4PBP A;  1WUV A;  4JHZ A;  1DBN A;  3I2F A;  5FQ0 A;  2FCT A;  1RMU 2;  2VBB A;  1GNY A;  2EVX A;  2DCT A;  1ZBA 1;  3H8X A;  1Q5O A;  3ZIW A;  2A3Y A;  1OA3 A;  4QX5 A;  3C7O A;  3NWK A;  4HMZ A;  1S1A A;  1YFW A;  3D0S A;  2Q8D A;  3USU B;  2ZZQ A;  4KGG A;  3RZZ A;  4XQ4 A;  2XPJ A;  3JU9 A;  2ZXQ A;  4ASM B;  2LW8 A;  3BPS A;  3RG0 A;  4XQD A;  1NCQ B;  1W90 A;  1ZM1 A;  2V4A A;  3W5N A;  4ZY9 A;  2D5H A;  4AED C;  3BVC A;  4NII A;  2E31 A;  3F95 A;  2ZGL A;  1U5Z A;  5FZF A;  4AI2 A;  4ATE A;  1MVE A;  1XNT A;  2J1E A;  5FZM A;  5HV4 A;  3KHC A;  2WFF 2;  1LOA A;  2JE8 A;  3JD7 1;  5LK5 A;  1JMU B;  1XE0 A;  2BOI A;  4PJY A;  4RR3 C;  3IWZ A;  1ZZB A;  3MPB A;  1GV9 A;  2DCY A;  2P3J A;  2BNN A;  4C91 A;  3OTF A;  3BUC A;  5FJH A;  4JGY A;  1DGL A;  2DTW A;  1VBC 3;  4HK9 A;  2YGM A;  4W6Y A;  4DMI A;  1Z78 A;  5CAD A;  2MEV 3;  3MV1 1;  4JQR A;  5JVV A;  1UZV A;  4NIG A;  1J3R A;  3DXT A;  5DUU A;  1R64 A;  3MLK A;  4Y1Y A;  2GAU A;  2HEW F;  4BIO A;  2RS1 1;  3AYD A;  3TN9 3;  5LRR A;  2RR1 1;  5LY2 A;  4QXB A;  2A1X A;  2BW8 A;  2WDB A;  1K5M A;  3UGF A;  5IVC A;  5IVY A;  1LOG A;  3ETP A;  3MGU A;  4B7E A;  1OH4 A;  4XFB A;  3JB8 A;  5F2S A;  1YC6 1;  4E2Q A;  5LAT A;  5CEH A;  4UFH A;  4IE0 A;  3AJZ A;  5LA0 A;  5K0U B;  3WP4 A;  5F39 A;  1CJP A;  1UO9 A;  3FN9 A;  4JRA A;  1OPO A;  3DPR B;  2LTN A;  2ZTN A;  5FMC A;  4BH9 A;  4QX0 A;  1SZB A;  4LBQ D;  4BYY A;  1F15 A;  3V0A B;  1RJ8 A;  2HWB 3;  2BQP A;  2Q1Z B;  2DTY A;  3OGG A;  5DAB A;  5C71 A;  4LIV A;  4DY5 A;  5FYT A;  5AC9 3;  3VHO A;  5ISL A;  4EE2 A;  2XJR A;  1YFU A;  3T0D A;  3W21 A;  1QF3 A;  1KD7 A;  1HJG A;  2R06 2;  3THP A;  1QXP A;  1KIT A;  1C5I A;  1POV 3;  1EUU A;  2BYV E;  2HWE 1;  5DDJ 2;  4D7S A;  4E4S A;  4MGI E;  2DFC A;  4CDW A;  1GQG A;  4X8N A;  4FVV A;  2ZKN A;  1QJX 1;  2Z69 A;  3TEZ A;  4BK4 A;  5LWB A;  2F17 A;  4JDN A;  5IVF A;  1W6N B;  3ZYP A;  3VBS B;  4XJA A;  5FY1 A;  2E7A A;  2SBA A;  2JDY A;  3OEB A;  4GJZ A;  1OPM A;  2WL1 A;  4IEO A;  4YM0 A;  1QJY 1;  2JWP A;  1US3 A;  1QQP 3;  4L2N A;  3T08 A;  4TTG A;  4IV3 A;  2EXI A;  5JIU A;  1F35 A;  2ET7 A;  2Y8K A;  3V0A A;  1SCS A;  4O9E A;  4QGN A;  4CCJ A;  4QXK A;  1VBA 2;  1HN1 A;  3H1M A;  3K48 A;  4HAN A;  4CEW A;  1KXG A;  1GQP A;  3DL3 A;  4XVH A;  2BRT A;  4A3X A;  4BA6 A;  4D6S A;  2AEZ A;  3FJS A;  3VHR A;  5JXG A;  1X33 A;  1Y9M A;  2QE3 A;  5F1R A;  1YYN A;  2W5F A;  3OD4 A;  1ENR A;  2VXJ A;  3HIF A;  3VKN A;  1QHD A;  4EN8 B;  2VCB A;  1XBF A;  2JDN A;  4NE9 A;  5E88 A;  5IAT A;  1VB4 A;  2HKX A;  2AZ5 A;  2OS2 A;  2ARB A;  2O0O A;  3UES A;  5FY9 A;  1QDC A;  1VIW B;  1B09 A;  4CUB A;  2ZGR A;  4RS5 A;  4CCD A;  3L2H A;  5HV0 A;  2ZCW A;  1W8O A;  4JHT A;  4QX1 A;  5FZO A;  3U0Z A;  1RUE 2;  3EO6 A;  4NUB A;  3AJY A;  1E5R A;  2D3S A;  2VC9 A;  4D6Q A;  1Z7S 1;  3Q9O A;  2OX0 A;  2Y6F A;  1UCX A;  5JMC A;  2VE1 A;  2PHD A;  2PHU A;  3EHK A;  1RIT A;  1UMI A;  3AFK A;  5FLH A;  1VRB A;  4YFZ A;  5BNN A;  3ZKY A;  4FFF A;  4W50 A;  2RJ2 A;  2BU9 A;  4P00 B;  5LBB A;  4Q4X 1;  4CXX A;  3VZL A;  4YFW A;  4HPK A;  2ZEX A;  3MIC A;  5T54 A;  1LHU A;  1RUD 3;  1HXS 3;  2B39 A;  1C28 A;  1FOD 1;  5FYS A;  3AYA A;  1CIW A;  2MHF A;  2OUJ A;  5FXW A;  3ATG A;  1OC1 A;  2WT2 A;  5JR7 B;  5L7O A;  4AEJ A;  3I2K A;  2NP0 A;  2Y0O A;  1CJD A;  4N90 A;  4Q4W 2;  3ZDS A;  1WLC A;  2VMF A;  4KBZ A;  4IW3 A;  1O8P A;  4ZZ5 A;  3O1M A;  1VRH 2;  2VQU A;  3A21 A;  3SIS A;  4XFA A;  2I45 A;  3WNL A;  1N3P A;  4MHU A;  4LXL A;  4OHW A;  3ZKU A;  3ZXD A;  3SMH A;  1QJY 3;  2YU1 A;  4XJ8 A;  5DAV A;  3BPZ A;  4ITC A;  5FPA A;  3GF6 A;  4A6O A;  5A1A A;  1V6O A;  3UT0 A;  4EWE A;  1PNG A;  4XAE A;  5LRS A;  1VB2 A;  1LTE A;  2GNB A;  1ULC A;  4YVS A;  3DYP A;  3B9I A;  2RV9 A;  4ZPI A;  1ZBE 1;  1WBF A;  4YVS B;  1NLS A;  1K3I A;  4FT8 A;  4LR4 A;  5FUN A;  4B4P A;  4YVS C;  3TEY A;  3WVJ A;  3FX3 A;  2BFU S;  3I2D A;  3BYW A;  1LKN A;  4Y5S A;  2HWE 3;  3MI8 A;  2EIE A;  4YPJ A;  1HQW A;  3VZO A;  5CA6 A;  4C0H A;  4EN9 B;  2GMM A;  1DGR N;  1SLA A;  4CEY A;  2VZO A;  4RR3 A;  3IDE A;  1UY0 A;  3BTX A;  4AQ2 A;  3AB0 A;  1JI6 A;  1MS0 A;  3ZR5 A;  2J1V A;  2Q1M A;  2HWB 1;  4E8D A;  3IAP A;  4XBL A;  4GMP 0;  2HWD 2;  4GWI A;  2B46 X;  1RC6 A;  2RDQ A;  2R49 A;  1DYK A;  1RUG 2;  3BIW E;  1PGL 1;  1H8V A;  4OFG A;  3ZIX A;  4A42 A;  3T09 A;  1AXY A;  1DZQ A;  5K9Y A;  4AVT A;  2QJV A;  1PVC 2;  3MV0 1;  3B9C A;  1PO1 1;  1LEC A;  2D97 A;  2ZGO A;  1QQP 2;  5FKB A;  5I8S A;  2C5D A;  2N7G A;  4LMF A;  1PIV 3;  4Y22 A;  4BHP A;  4CDQ C;  1J59 A;  3ETQ A;  4UFJ A;  2K2S A;  3OSD A;  4AL9 A;  2E63 A;  1T2X A;  4M3C F;  4OMC A;  2KR2 A;  5AC9 2;  4X6Q B;  2XQX A;  2Q8E A;  4DXR A;  5A3N A;  3FC0 A;  1E5H A;  1QNW A;  1UN1 A;  3UKT A;  1H2L A;  2YBK A;  2XON A;  3HVD A;  2OQ6 A;  5K4L A;  3J8F 2;  1XE8 A;  3ZSM A;  4IE4 A;  1TEI A;  2WRA A;  3WDX A;  1GZC A;  2E7Q A;  2WO2 A;  4MVT A;  2Z2S B;  1SLT A;  2B4K A;  3E6D A;  4ARX A;  1O4T A;  4E27 A;  5FYC A;  1ALY A;  3S7E A;  4FFG A;  4QPI C;  4AGR A;  1W2A X;  1OF4 A;  4QPI B;  1G9D A;  1W8N A;  3ZO0 B;  1BCX A;  1MS1 A;  2XHK A;  3KCY A;  3NNF A;  3RQ0 A;  3VN4 A;  2UYA A;  3ZYI B;  2RMU 2;  4LK6 A;  2GC3 A;  4DNY A;  2E51 A;  3KGL A;  1CX4 A;  4FPE A;  3QLQ A;  3UL2 A;  1D2S A;  2PLV 1;  5CBL A;  3W58 A;  1AYN 3;  2PQQ A;  2WLP A;  4CDU C;  3LCP A;  1VBE 3;  1AL0 G;  3PTR B;  5IW0 A;  2WT0 A;  1OT5 A;  2JEN A;  5JOY A;  1APN A;  2JG9 C;  1JYC A;  4GH4 C;  3GZT B;  1NLR A;  1HIX A;  1V9U 1;  2WII B;  4BLI A;  4CDX B;  2JKX A;  4CDX A;  4Z07 A;  5FZA A;  4JCK A;  3KT4 A;  2J1A A;  1Z0H A;  5JXH A;  3CIH A;  5JUV A;  3MFA A;  1YI7 A;  3QH6 A;  3I7D A;  3UET A;  3EXU A;  5HPO A;  5FY8 A;  3III A;  5FCC A;  2YC0 A;  2FCU A;  3NW4 A;  3PUH A;  2YPJ A;  1SFP A;  4MAD A;  5JDB A;  1V9U 2;  1KFX L;  2XVG A;  3M7A A;  1HJF A;  3B93 A;  4AYU A;  1AL2 3;  5A7W A;  3WR0 A;  2Q5T A;  5CG9 A;  3LDR A;  4SBV A;  2OW4 A;  1MPX A;  1HQL A;  1SLL A;  2VQA A;  5LY1 A;  3KB5 A;  5FOJ B;  5B4X A;  2ID4 A;  3KS7 A;  2JDK A;  1UU4 A;  2A5Z A;  2D3R A;  5GLZ A;  2WS9 2;  1ODN A;  3MIG A;  5FZ6 A;  2WUH A;  3PUS A;  3WNN A;  2XB6 C;  2C9K A;  2HBT A;  4QGL A;  4YW1 A;  1H9P A;  1E5I A;  2GNT A;  2QQL A;  3KLS A;  5FQ0 B;  4UF0 B;  3LOI A;  4K21 A;  4PBO A;  2WC2 A;  3NRU A;  1UW8 A;  5DQ0 A;  4G3Y C;  1KQR A;  3OGR A;  1LHO A;  2WZR 3;  1L7L A;  1H1I A;  1LUL A;  3NQH A;  2YPD A;  1JS9 A;  1QJZ A;  4Q4W 1;  4Y1Z A;  3SNM A;  3RGB A;  3RZK A;  1RHI 3;  4SLI A;  3MHZ A;  4HN1 A;  2XL9 A;  3C7H A;  4F7Z A;  4NMI A;  2VZP A;  1NY7 2;  4FTB A;  4D94 A;  4IEP A;  1UPI A;  1O3R A;  4Z8B A;  2HWC 1;  1XNB A;  1JXN A;  4DS0 A;  1Y3T A;  3IPV B;  1ZZ7 A;  4FSJ A;  3P1I A;  1RUJ 1;  2VEC A;  4XUP A;  1RUI 1;  4FPY A;  2NPI A;  2VNR A;  4E4Z A;  2YYO A;  4S2D A;  3BN6 A;  3FFQ A;  3UJQ A;  1CWP A;  5LA2 A;  4OYU A;  3D4K A;  4HOO A;  2PFW A;  3ROU A;  2ATF A;  1DQ6 A;  2VZQ A;  4Q4W 3;  3UJO A;  4EZ4 A;  4BLJ A;  2DCZ A;  1AYM 2;  1RIN A;  4PCR A;  3A23 A;  2XKO A;  1BJQ A;  4NAO A;  4Z82 A;  5DAW A;  2D7F A;  2DVD A;  4AVB A;  1X50 A;  4NHX A;  1ST8 A;  2P4E A;  4OZO A;  5FKC A;  5HXM A;  1UOB A;  4DUV A;  5JAX A;  4Q2F A;  1DHK B;  2R1D A;  5L9B A;  5K0U C;  3IN9 A;  2OVU A;  3V65 A;  1UXX X;  4XIL A;  2PEL A;  4QX7 A;  3I3E A;  4P9I A;  5EHD A;  2ORX A;  3VBO A;  3ACL A;  4QKB A;  3AP5 A;  1JYT A;  3SEP A;  1AYM 3;  4KWL A;  2PTM A;  1LOF C;  2RR1 3;  3DPR A;  2XJT A;  1Y9G A;  1W6P A;  3DV8 A;  4XIK A;  4O61 A;  2V09 A;  1ULE A;  4P5Y A;  1W6M B;  5SV5 A;  2CAU A;  4XJW A;  2UWB A;  3D82 A;  3NNL A;  5BPX A;  2V5D A;  1XYO A;  1PK6 C;  3IDB B;  4FQZ A;  5BNP A;  1W6N A;  1DLL A;  2RS3 1;  4OUL A;  4MXW B;  2VVF A;  3H7Y A;  3PIG A;  2G9F A;  5JR2 A;  3PVO A;  1AR9 2;  2W0X A;  2XQR A;  2WNV B;  3D5O A;  1UU6 A;  3KT7 A;  5HI0 A;  3CEW A;  3NO8 A;  2EIC A;  4TYS A;  3C8X A;  3SH4 A;  4COY A;  4UOJ A;  2A71 A;  5FLI A;  4QD2 A;  4R9D A;  4IEV A;  2C4X A;  1LGC A;  5FBZ A;  1VP6 A;  3ZFG C;  1OHF A;  3LSD A;  4WVZ A;  4B8E A;  1IQD C;  2RVA A;  3POY A;  1NCR A;  1QIQ A;  4JVA A;  3EQE A;  3VZK A;  1FAY A;  1G9C A;  3AKP A;  5K8S A;  1UY2 A;  1V6I A;  3A0K A;  4WZC A;  3U4S A;  3T0B A;  3LIG A;  4AED A;  2WKK A;  5HBA A;  1RUC 2;  3Q8C A;  4CEW C;  3KV4 A;  3F2Z A;  1PM4 A;  4CEW B;  3N7J A;  4HXC A;  3WUD A;  2O14 A;  5FXX A;  4XUO A;  4TWT A;  4BQ3 A;  4IUG A;  4BIS A;  1WW4 A;  4XHX A;  3K51 A;  3RVH A;  3SLI A;  1A78 A;  3ES1 A;  3HNY M;  4GMP 1;  5F37 A;  4BB3 A;  4OI0 A;  4HT1 T;  4QQH A;  3Q8B A;  4FPJ A;  4ISR A;  4LIU A;  2YBS A;  1JZ6 A;  1GWL A;  3APB A;  2X10 A;  1SAC A;  3HT2 A;  2JX9 A;  3J7L A;  3KV5 A;  1W6Q B;  1NXD 1;  2RS5 1;  4LOT A;  4NID A;  2XR4 A;  5A6Y A;  2Q1F A;  3S30 A;  1SBF A;  1NYW A;  4LBK A;  2H0B A;  1ULO A;  1RVF 3;  2GN7 A;  1GQH A;  5FY7 A;  3U11 A;  3K75 B;  4I3P A;  3KVB A;  1WA4 A;  4CA9 A;  1CAX A;  2VOX A;  2ZZJ A;  2ARC A;  2K0G A;  1IPJ A;  3IM0 A;  4NHK A;  5J3U A;  5FMB A;  1GKB A;  1HB2 A;  4EJR A;  1D0G A;  3VBO C;  2C6S A;  5BNN B;  1CQ9 A;  1PGS A;  4QKN A;  4P9W A;  2WJS A;  3MPP G;  1JZ8 A;  3H0O A;  5KHH A;  4AFB A;  5GLU A;  2BJS A;  2EAK A;  1QDO A;  4I02 A;  2QUO A;  4O7X A;  4PT6 A;  4JAA A;  1R09 1;  4YW5 A;  3VKO A;  4M01 A;  4V2V A;  3NJZ A;  4Y24 A;  2EIG A;  4XE9 A;  3RYP A;  3RWK X;  1R08 3;  1WLT A;  2WFP A;  2ZKL A;  1H4H A;  3LFI A;  1QY4 A;  2JIC A;  3NV1 A;  1S55 A;  1VBA 3;  2VVD A;  2VMG A;  1BHG A;  2HWF 2;  4DIN B;  2VW0 A;  3AKQ A;  5I0R A;  2R04 1;  2XUM A;  3GHM A;  1V70 A;  5LA1 A;  1PIV 1;  1YFX A;  2ZML A;  5ACA 2;  4YW7 A;  5BXX A;  1X8M A;  5E6H A;  3OCP A;  4JRL A;  3H9A A;  3ZPO A;  1UYX A;  1ZBA 2;  2VD7 A;  2AGS A;  3PUA A;  4FPH A;  1W05 A;  4Q5O A;  4B1L A;  2JDU A;  3O12 A;  3RSJ A;  4COV A;  4P9Y A;  4EV0 A;  1LOB A;  1TNR A;  3WT3 A;  3NJV A;  2HWD 1;  4R52 A;  5DZE A;  3ZXF A;  1YQ2 A;  1NCR B;  2F4L A;  3KVA A;  2Z5W A;  5B4N A;  4LA2 A;  1CAV B;  2YDE A;  4ASK A;  4ZU5 A;  3LD8 A;  4QDS A;  5JXI A;  4IQP A;  1RUD 1;  3ZXK A;  2GP5 A;  3VBR A;  1UXZ A;  1W6O A;  4Q29 A;  4O65 A;  5GM0 A;  5T52 A;  4B4Q A;  1XU1 A;  4D3W A;  3AC0 A;  2DCJ A;  4Q1P A;  3AZW A;  4Q8L A;  2WNE A;  4COU A;  3MW3 A;  3AKT A;  2XUE A;  4QXC A;  4RQP A;  1AZD A;  2ZX4 A;  5T5O A;  3GBG A;  1O3Q A;  1PVC 1;  4F8A A;  1FI2 A;  1VBE 1;  3H3Z A;  3AMH A;  4XF0 A;  1NG0 A;  4AGG A;  3RZH A;  1C1L A;  5FPX A;  1BEV 3;  1XOY A;  1BYH A;  1F9K A;  1KS5 A;  1B35 A;  2A6X A;  1HXS 2;  4CDW B;  4OI2 A;  5KXE A;  2HWB 2;  3OGV A;  4IE5 A;  3TAY A;  3WF4 A;  3N3H A;  5DZG A;  4Q4X 3;  2PHX A;  5FZD A;  1CVN A;  4XHB A;  4RN5 A;  1FV2 A;  2Q4S A;  1PVX A;  4DQA A;  1PMI A;  2QQI A;  1VBD 2;  3HPN A;  3CZJ A;  4H7L A;  3WCS A;  3FMG A;  5AFB A;  2HEY F;  4QWN A;  5LA9 A;  4BZ4 A;  1W9F A;  4UW5 A;  3GGL A;  3PIJ A;  2OKX A;  2IFW A;  1OVS A;  3O5S A;  4XUT A;  2ZJC A;  3PJY A;  4CYD A;  1AR6 1;  3J8F 3;  3CJX A;  3VBF A;  2WO3 A;  4RSU A;  1OLR A;  3LAG A;  2R1B A;  3AVR A;  3H8U A;  5FRE A;  1GYK A;  1W8T A;  1H8T A;  3E97 A;  3LB9 A;  1STM A;  2LRO A;  3JQX A;  5FZE A;  1Z7S 2;  5T5L A;  4AG4 A;  3X29 B;  3AM2 A;  3I2H A;  5F7U A;  3ME2 A;  3PUR A;  3INA A;  1HN0 A;  4R9B A;  3I59 B;  1P8J A;  3VKF C;  1MS4 A;  3WD5 A;  1YWK A;  3VBS C;  1TMF 2;  2J1U A;  4QKF A;  4WVM A;  3USS A;  1FMD 2;  2E33 A;  4V2W A;  4CDX C;  5A1F A;  1MZF A;  4JC1 A;  3WF2 A;  4BIF A;  4YW4 A;  5C8C A;  5I93 A;  5J36 A;  3BTY A;  2ERF A;  4XJZ A;  4E9K A;  2ZS6 B;  3KGZ A;  1COV 1;  1REE A;  5C3P A;  2VOW A;  4MGT A;  2B8M A;  4AF9 A;  2VCM A;  3M3O A;  4YM2 A;  3TB0 A;  2CWS A;  5C7G A;  2VZR A;  5KBF A;  4PQQ A;  3WY6 A;  1O4Y A;  1SPP A;  3GZU C;  4FOY A;  3TNQ A;  2IXC A;  4HVQ A;  1HRI 3;  3HOB A;  1EAH 1;  2MEV 2;  3WW1 A;  1ASJ 1;  2J22 A;  5DMY A;  2ILM A;  2XWJ B;  1VBA 1;  2WAA A;  2RMU 1;  3CU7 A;  3V0B A;  3RZM A;  4XFH A;  3T4V A;  3R0R A;  4AHX A;  5ANQ A;  1A8M A;  5DZF A;  5T50 A;  2NMO A;  4P14 A;  3POE A;  4DEV A;  1WCD J;  5C4W A;  1GOG A;  5CFC B;  3MZH A;  3DYO A;  4Q8K A;  4YSF A;  1Q8Q A;  3TBD A;  2RJL A;  2VMD A;  5A6X A;  2WNV A;  1AR7 3;  3N7M A;  1H1M A;  4ES8 A;  3AKS A;  4CXW A;  2QKD A;  2CWM A;  3OUI A;  1ZA4 A;  2P6H A;  3SCG A;  5BNO B;  1GZT A;  4FO9 A;  2GNM A;  4J25 A;  1WCU A;  3A7Q A;  1XSQ A;  4QM8 A;  2C26 A;  5FY4 A;  3HQU A;  5FPB A;  3WQB A;  4D69 A;  1NLQ A;  4YM3 A;  3FBM A;  3KF3 A;  1H9W A;  4W4Z A;  5FO9 B;  1PMH X;  1SLB A;  4LKE A;  3WDU A;  3IAQ A;  3THT A;  5JSR A;  5EIY B;  2MNG A;  1POV 1;  5F3I A;  4MGZ E;  1CON A;  1O8S A;  1D4M 3;  2RJK A;  1BLZ A;  3MW4 A;  5C4W C;  1DF0 A;  4ZS3 A;  3GCX A;  3PU8 A;  2Y0I A;  2QQO A;  1I5P A;  1YEW A;  5JSP A;  2V72 A;  3QOP A;  5DDJ 3;  2VUL A;  2B9U A;  2ZGQ A;  1RUH 3;  4XAA A;  4XPV A;  5A3O A;  4N7U A;  1LCL A;  3U1X A;  4BE3 A;  1OI6 A;  1XND A;  4IEQ A;  4HSL A;  2JEM A;  3ZYR A;  1AJK A;  2CYF A;  1VBD 3;  3N35 A;  2DBN A;  4OUS A;  2HEV F;  2Y6G A;  1T6B X;  5FP4 A;  1ZRE A;  4AFD A;  2GU9 A;  1S0F A;  4UW6 A;  3LEM A;  5FOB B;  4C8D A;  2OQ7 A;  3ZFE C;  2XHN A;  1IS4 A;  5GZE A;  4ISQ A;  4IEY A;  2NN8 A;  4QAW A;  5A33 A;  1U5Y A;  3K4Z A;  2PXJ A;  4QQ2 A;  2XDV A;  1YXW A;  3ZYJ B;  4YZ1 A;  1X9P A;  3OBR A;  3P3P A;  2QTW B;  2W9X A;  2QQJ A;  2JJ6 A;  4LE4 A;  4YG0 A;  3WQ1 A;  2GC0 A;  4UI9 L;  4Y1V A;  4Z1V A;  3BB6 A;  4NHL A;  3SIT A;  1QKQ A;  2ZX1 A;  4W6W A;  4AVC A;  1F2N A;  5ABJ A;  4Y4R A;  1RUG 3;  2ARE A;  1VR3 A;  4U2A A;  1CPM A;  3ACI A;  1XXN A;  1H30 A;  3MLL A;  3KT1 A;  1VPH A;  3MBW A;  4PIY A;  4QQL A;  1XQN A;  4AW7 A;  2TUN A;  4M3C A;  4YW2 A;  2GAL A;  2YG0 A;  3RNS A;  2ZPX A;  4JX0 A;  4FPF A;  3ZSE A;  4Y5Z 0;  4AEM A;  4A45 A;  5AC9 1;  3HWJ A;  4CSW A;  3P5B A;  4B1M A;  4BPZ A;  1IG0 A;  4BQW A;  1IS3 A;  1SHW B;  2TNF A;  4I0A A;  3C2U A;  3VBH B;  4YWA A;  4HL0 A;  2VBD A;  3I3Q A;  5FZH A;  2ZGU A;  3VBH C;  4ERO A;  4NPL A;  1X9T A;  2VJX A;  3V64 A;  3ZFG B;  2BPA 2;  1MAC A;  1HRV 3;  3NKT A;  1F8V A;  3HNB M;  4CDQ B;  1OQE A;  2WN3 A;  3W59 A;  1WCK A;  1GNZ A;  3B02 A;  5GZD A;  2PN5 A;  4UFL A;  1G6N A;  5A3L A;  1GZW B;  2W1U A;  1GZW A;  2RDN A;  3BGA A;  4PLM A;  1N1Y A;  5CNA A;  4NVP A;  4BQX A;  4Q0U A;  3N9M A;  3POG A;  4WM8 A;  2ZGK A;  5HCF A;  4BXS V;  4DOU A;  2XJP A;  2VBP A;  2PMW B;  2WNU C;  2BBA A;  3N9Q A;  4R4X A;  4GAL A;  2FQP A;  4AHW A;  1AUY A;  2WNU B;  3GNE A;  3OF1 A;  1QOS A;  5JZG A;  2ZX0 A;  4CVU A;  1JN2 P;  1O3S A;  1MS8 A;  5E16 A;  4HPK B;  1W9Y A;  4IE6 A;  5DAP A;  1AL2 1;  2WZ8 A;  1WLD A;  1JOD A;  4EN7 B;  1S0G A;  2LS6 A;  1VRH 3;  5FZO B;  3OPW A;  2P3K A;  3THD A;  2E7T A;  1VRH 1;  4JGZ A;  4OZX A;  4LBJ A;  4AI9 A;  2XWB B;  3GJB A;  1URX A;  4M4R A;  1RXF A;  5F3C A;  4GH4 B;  1JZ2 A;  2P3Y A;  1TQ5 A;  1ENQ A;  2DU1 A;  2IVI B;  3VBO B;  3POI A;  4XFI A;  5TSW A;  5GZC A;  5L9V A;  2JG9 A;  5FZ1 A;  2H6C A;  4H2A A;  3I2J A;  3WG2 A;  3RI8 A;  3ENR A;  1RUO A;  4OMD A;  4MZU A;  1RUH 1;  1ZZ8 A;  1X82 A;  3B00 A;  1QNY A;  1J3P A;  1RED A;  1ZRI A;  4I09 A;  4XYX A;  2OZJ A;  1UU5 A;  1ULP A;  4BQ1 A;  3PLQ A;  5L7O B;  1H8T B;  3OB8 A;  1AYM 1;  3SH5 A;  5L7O C;  1ULG A;  3EJK A;  5FWE A;  1OXC A;  3HR9 A;  3ZN4 A;  1JZ3 A;  5FLJ A;  2V5Y A;  2RM2 1;  4BJ0 A;  2BNM A;  2FDJ A;  3WP3 A;  4URA A;  5I8Y A;  1DDL A;  4RGA A;  3AZV A;  3IB3 A;  1TME 1;  4ZON A;  3LA7 A;  2KD7 A;  3HAG A;  1ZYB A;  3MF9 A;  5CFC C;  5LEJ A;  1JH5 A;  1A8D A;  4GZ9 A;  2JD9 A;  1BZW A;  4YZ2 A;  1K12 A;  4JTO A;  4XTM A;  1PIV 2;  2BWA A;  1Q8S A;  4RS5 B;  1SEF A;  5F5C A;  3WNX A;  5I0T A;  2RE9 A;  3U14 A;  4D7T A;  4JKL A;  5GAL A;  2ZGP A;  4KL1 A;  1V6M A;  2EAL A;  1NCR C;  3MIF A;  5H9R A;  2XKP A;  2DF7 A;  1FT9 A;  1CR7 A;  4BQ5 A;  2VZ3 A;  2ZEZ A;  3HEI A;  1O7F A;  3VKL A;  3WG3 A;  1R1Z A;  4QMA A;  2EXJ A;  4GKX A;  1QJX 2;  2R32 A;  3ACF A;  3RRD A;  1BMV 2;  3RFR A;  4DEQ A;  4E2S A;  5LBE A;  2GP3 A;  4YVW B;  2X29 A;  3M3Q A;  3RZL A;  2WAO A;  4MLO A;  1JU4 A;  1F4H A;  3GYD A;  4Y4Y A;  2IVJ A;  2YMZ A;  3GDB A;  3O14 A;  4LBQ B;  4BQ2 A;  1G9B A;  4JZR A;  5A3W A;  1EV1 1;  2R07 3;  1YQC A;  1GNH A;  3M4F A;  5C4W B;  2QQN A;  4NN0 A;  4DPN A;  5FZ8 A;  1OOP B;  3WG1 A;  4LQR A;  2D6M A;  4A7Z A;  1W0P A;  1JOP A;  1CZS A;  3ON7 A;  3WDV A;  4AAP A;  1AR8 2;  5KR7 A;  1ZX5 A;  1LU1 A;  1MEC 1;  1QJF A;  3PU3 A;  1RUI 3;  4QPG C;  4UWD A;  5HXV A;  2VXR A;  4AE2 A;  4XFC A;  3I3B A;  1UX6 A;  3NV2 A;  3ZPY A;  4MOA A;  4QPG A;  1QJU 3;  3GZE A;  5J98 B;  3VBS A;  1VBB 1;  4GH4 A;  3Q8E A;  5A7P A;  3L2Y A;  3LWC A;  1J3Q A;  1MZ5 A;  1CZV A;  2JB8 A;  3GZA A;  5FZ4 A;  5JI9 A;  3N9N A;  3B01 A;  4GB3 3;  3ZSL A;  1AR8 3;  4H55 A;  5EYY A;  2OZ6 A;  4M0H A;  3VD4 A;  2GME A;  2Q8C A;  1RUG 1;  2W52 A;  1IKQ A;  1N1S A;  1I1E A;  1UYZ A;  2P2K A;  4N9H A;  1RUC 1;  3HT1 A;  4O9G A;  3PDQ A;  2ZOE B;  1N47 A;  4RFR B;  4WM7 C;  5FFO C;  3URF A;  4Q4V 2;  2DVF A;  4CDW C;  1PK6 B;  4LHL A;  5LBF A;  1WCQ A;  1H2N A;  4Y26 A;  3FLT A;  5FYH A;  2LAL A;  4A7Y A;  5IJR A;  5J1X A;  1BMV 1;  2XGX A;  1PZ7 A;  1XC6 A;  5A6Z A;  3D0J A;  4PHZ A; 
#chains in the Genus database with same CATH homology
 5JR2 A;  3OGS A;  5JMO A;  1SDD B;  2EIC A;  3C8X A;  2HLE A;  3HJR A;  2YB7 A;  4UOJ A;  5HPO A;  3LPG A;  2C4X A;  3I2G A;  2V4V A;  3NNG A;  2YFU A;  1IQD C;  1NX9 A;  2RVA A;  1KGY A;  1W9W A;  1UY2 A;  4ZXE A;  3T0B A;  1NUK A;  4UAP A;  4D8M A;  4QPW A;  3F2Z A;  1W0N A;  1GOH A;  3PUI A;  1NKG A;  2WAB A;  4XUO A;  3VDC A;  4IUG A;  2W1S A;  1DYO A;  3HNY M;  4KMQ A;  4BDV B;  5IHR A;  2Y6K A;  3CKH A;  2VQT A;  4MGS A;  1JZ6 A;  4DUX A;  2X10 A;  2J1T A;  1WKY A;  1US2 A;  3LEG A;  3WF3 A;  3WSO A;  3C7E A;  4CU7 A;  3WNM A;  1UWW A;  1ULO A;  3LEK A;  1D7P M;  3T2Q A;  2QQK A;  3K75 B;  5IYY A;  4A41 A;  2QQM A;  2PQS A;  4KI5 M;  3K77 A;  2R7E B;  2X05 A;  3ABZ A;  3T0A A;  1XNA A;  4A44 A;  3GXU A;  2W3J A;  1JZ8 A;  1JZ4 A;  4PT6 A;  4CUA A;  3CQO A;  4QDQ A;  4LHS A;  1UMH A;  5I0D A;  3HNM A;  4HG6 B;  1H6X A;  2VME A;  4JHZ A;  1W99 A;  4E8C A;  1BHG A;  3I2F A;  5LA1 A;  1GNY A;  3IDA A;  1JYV A;  1CX1 A;  3C7O A;  1UYX A;  2J7M A;  2YFZ A;  4ET7 A;  5CYY A;  1TVG A;  3NJV A;  2ZXQ A;  1YQ2 A;  3P6B A;  2LW8 A;  5B4N A;  3W5N A;  4ZY9 A;  4QDS A;  2E31 A;  5JXI A;  1DP0 A;  1UXZ A;  3LPF A;  1XNT A;  4AAX A;  2J1E A;  3EYP A;  2JE8 A;  4CU9 A;  3AC0 A;  1J83 A;  2DCJ A;  2XOM A;  4CU6 A;  2ZEY A;  3ECQ A;  3C7F A;  4QX2 A;  3MV1 1;  2HYX A;  2X09 A;  1NAE A;  2EID A;  1R64 A;  2Y6J A;  3OGV A;  3WF4 A;  2WDB A;  4RN5 A;  1JZ5 A;  3ETP A;  4L0P A;  2W94 A;  1OH4 A;  2QQI A;  2ZEW A;  3HPN A;  5G05 L;  3CZJ A;  3WNP A;  5LA0 A;  3GGL A;  2OKX A;  2VL4 A;  3FN9 A;  4XUT A;  4QX0 A;  2VCA A;  1XPW A;  2WO3 A;  5FUI A;  5C71 A;  1EUT A;  2L9L A;  1W9T A;  4RYD A;  3T0D A;  4AG4 A;  5F7U A;  3I2H A;  1EUU A;  3ZM8 A;  1P8J A;  1JYN A;  4BK4 A;  2J1U A;  2E33 A;  2JDA A;  4MO3 M;  3WF2 A;  3OEB A;  1JZ7 A;  3W5M A;  4TTG A;  1US3 A;  3T08 A;  3DEC A;  5C7G A;  1UYY A;  2VZR A;  2Y8K A;  2VZS A;  2VR4 A;  1UY3 A;  5DN2 A;  1CZT A;  4PQQ A;  2B9V A;  1SG3 A;  3HOB A;  1HN1 A;  2W1Q A;  1UX7 A;  2J22 A;  5DMY A;  3I2I A;  4XVH A;  1GQP A;  2WAA A;  5JXG A;  1PX3 A;  2W5F A;  2CDP A;  4DEV A;  1GOG A;  3EB7 A;  3DYO A;  2VCB A;  3J7H A;  5DPN A;  2Z4F A;  2VMD A;  3MUY 1;  2W91 A;  3JXS A;  3UES A;  4CVU A;  3A7Q A;  3WQB A;  2C26 A;  4CUB A;  2W95 A;  2Y6L A;  3E1F 1;  3VDB A;  1W8O A;  4QX1 A;  4W4Z A;  1PMH X;  1JU3 A;  1F4A A;  2VC9 A;  3FL7 A;  3IAQ A;  1H6Y A;  5EIY B;  3MUZ 1;  4LPL A;  4ZZ8 A;  3LQC A;  1UMI A;  1J84 A;  1O8S A;  2EIB A;  4W50 A;  3K46 A;  2RJ2 A;  4P00 B;  1LNS A;  2W87 A;  3NJX A;  3VD3 A;  2ZEX A;  3DYM A;  2CDO A;  2QQO A;  1I5P A;  2V72 A;  3U37 A;  3MO4 A;  1L7R A;  2VM9 A;  4MGQ A;  3LEI A;  3T2P A;  2VCC A;  3ACH A;  2VMC A;  3I2K A;  2WO1 A;  2Y6G A;  5CZK A;  1PX4 A;  2VMF A;  3I3D A;  1O8P A;  4ZZ5 A;  2VQU A;  5IFT A;  3A21 A;  2XHN A;  1O59 A;  4CUC A;  4QAW A;  3A22 A;  4PF1 A;  3WNL A;  3K4Z A;  1W9S A;  4TXW A;  1DLC A;  5A1A A;  4A6O A;  2W9X A;  2QQJ A;  4UI9 L;  3DYP A;  2RV9 A;  1L7Q A;  4A3Z A;  1K3I A;  1JHJ A;  3ACI A;  1JYW A;  1UY4 A;  3MBW A;  1PMJ X;  2EIE A;  4YPJ A;  3WF1 A;  3CDZ B;  2VZO A;  2YG0 A;  1UY0 A;  1OD3 A;  4JX0 A;  3VDA A;  4A45 A;  1JI6 A;  2J1V A;  4E8D A;  3IAP A;  3VD7 A;  4DXS A;  1SHW B;  4GWI A;  2WN2 A;  2VTF A;  3FHQ A;  4LKS A;  3WNK A;  1GU3 A;  4A42 A;  2VJX A;  3T09 A;  2W1W A;  3MV0 1;  3HNB M;  2WN3 A;  2J1S A;  3UNP A;  2VZT A;  2E26 A;  4W8J A;  2W1U A;  2BGP A;  3SKJ E;  3BGA A;  1T2X A;  4OMC A;  2XQX A;  4DXR A;  4JKK A;  2WZE A;  1UZ0 A;  2YC2 A;  2XON A;  4BXS V;  3K4D A;  4ARY A;  2BBA A;  4XUN A;  2WO2 A;  4CU8 A;  2B4K A;  4ARX A;  5EJZ B;  4A4A A;  4M4P A;  2WQ8 A;  1OF4 A;  2VZU A;  3HN3 A;  5IFP A;  1W8N A;  1GMM A;  2WZ8 A;  3VD9 A;  2LS6 A;  1K42 A;  2BGO A;  1TG7 A;  3THD A;  2BER A;  2W92 A;  2E32 A;  4M4R A;  3FHA A;  5EJ1 B;  1OT5 A;  1JZ2 A;  2Y64 A;  4QB1 A;  1UY1 A;  4P08 A;  1JYX A;  3C7G A;  4FI9 A;  2JKX A;  3I2J A;  4XZU G;  2J1A A;  5JXH A;  3CIH A;  5JUV A;  3CZU A;  1GUI A;  4OMD A;  3UET A;  3OEA A;  4QB2 A;  3III A;  3PUH A;  4D0Q A;  4GWJ A;  4MAD A;  4QX3 A;  1CIY A;  1ULP A;  2Y6H A;  3T2O A;  3D3A A;  2QBX A;  2VOT A;  3OB8 A;  1MPX A;  3VD5 A;  2VO5 A;  1JZ3 A;  5B4X A;  4BJ0 A;  4KWU A;  2ID4 A;  1KEX A;  2WYS A;  3IB3 A;  2WUH A;  3WNN A;  4DUW A;  2KD7 A;  4BK5 A;  2C9K A;  4QDR A;  5JXJ A;  2QQL A;  2JD9 A;  3K4A A;  4GZ9 A;  1K12 A;  3SKV A;  3NRU A;  5DQ0 A;  4JKL A;  3OGR A;  3SEE A;  2W46 A;  2BZD A;  3NQH A;  2VZ3 A;  2ZEZ A;  3HEI A;  1K45 A;  2WBK A;  5LCW L;  2YC4 A;  3CMG A;  3ACF A;  3C7H A;  4JKM A;  2VZP A;  3OBA A;  4DEQ A;  2WAO A;  2VZ1 A;  4Z2A A;  1JU4 A;  1F4H A;  4DXT A;  3THC A;  3GDB A;  3WEZ A;  3P1I A;  2DDU A;  4XUP A;  2QQN A;  4LQR A;  3BN6 A;  3WF0 A;  1CZS A;  4XUQ A;  5LA2 A;  4OYU A;  2VZQ A;  2VZV A;  3I3B A;  3A23 A;  1GOF A;  3ACG A;  4MOA A;  2W47 A;  4OZO A;  5HXM A;  4DUV A;  4P02 B;  1CZV A;  1RYY A;  3GM8 A;  1UXX X;  3I97 A;  3LE0 A;  3I3E A;  2ORX A;  3VD4 A;  2ORZ A;  4QB6 A;  3SEP A;  1UYZ A;  3OG2 A;  4P5Y A;  2DCK A;  4OUE A;  4XUR A;  1WCQ A;  5C70 A;  5G04 L;  2V5D A;  3WNO A;  5IJR A;  1OF3 A;  1XC6 A;  2J1R A;  5J1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...