2J1RA

Structure of a streptococcus pneumoniae fucose binding module
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1rA00
3W5MA 1UY1A 3NQHA 1L7RA 1CZSA 4P08A 4DEVA 2EIBA 1CZVA 3CKHA 4ET7A 3OEBA 3PUIA 2ZEWA 3HNYM 1GQPA 3VDBA 1OT5A 4UI9L 2XHNA 1IQDC 4E8DA 3J7HA 2VZRA 4JKLA 3VD5A 2Y6HA 4ZZ8A 3I3EA 3LPFA 3VD7A 3VD3A 4BXSV 4QX3A 1JYXA 4OMCA 3OB8A 1RYYA 2W46A 3NRUA 3U37A 3I3DA 4LQRA 5G05L 1W9SA 2OKXA 4PT6A 3VD4A 5IFTA 4KWUA 1D7PM 2VTFA 3WF0A 2W47A 3NNGA 4PQQA 5G04L 4DEQA 2ZEYA 4M4PA 3OBAA 3CQOA 1BHGA 1PX3A 3UETA 2WN3A 2VO5A 2W3JA 3I2IA 3T0BA 2W9XA 3OGSA 4CU9A 4XURA 3HN3A 2CDPA 2DCJA 1UWWA 2E31A 3GM8A 5JMOA 1UY0A 3C7OA 3WNKA 2Y64A 4A41A 1DYOA 5EJZB 2J1AA 1JYVA 3C7GA 2XQXA 3F2ZA 1LNSA 1DP0A 4JX0A 1NUKA 2XOMA 3ZM8A 2C9KA 2WDBA 1K3IA 1XPWA 1NKGA 1UY3A 1I5PA 4JKMA 4DUVA 2QQJA 3ACGA 4HG6B 4QDRA 2Y6KA 2VZOA 2W95A 2QBXA 3T2QA 1OD3A 3C8XA 1ULPA 2R7EB 2YG0A 1GNYA 3C7HA 3OG2A 4QB2A 1EUTA 3FHAA 4CU8A 3K4ZA 2W94A 4D0QA 5LA0A 5CYYA 4A44A 2VQUA 5B4XA 5EJ1B 1JZ3A 5JXGA 4W8JA 2YC4A 5JXJA 2J7MA 3I2FA 4A3ZA 2WUHA 4BJ0A 3VDCA 2JKXA 2WQ8A 2J1TA 2VCCA 2VQTA 3DYMA 3MV01 5F7UA 1O8SA 1K45A 1JZ2A 3CDZB 3WNPA 3E1F1 1GUIA 4DUXA 4MGQA 2RJ2A 2ZXQA 4OUEA 4UAPA 4KI5M 5LA1A 2L9LA 4ARXA 3FN9A 1UZ0A 2VCAA 4OZOA 3PUHA 2WN2A 5IYYA 1UYZA 1WCQA 3IAPA 2JD9A 3T2OA 2WO1A 3K77A 1H6YA 3HPNA 1JZ5A 2W1QA 2XONA 5JUVA 1WKYA 3HOBA 4CUBA 2HLEA 4ZY9A 3WNLA 4AAXA 3I2HA 5DN2A 4QX2A 3K4AA 4DUWA 2DCKA 3T2PA 1MPXA 5A1AA 5HPOA 4A45A 3HJRA 3ETPA 3GXUA 5I0DA 4QB1A 4UOJA 4OMDA 2BERA 2Y6GA 3T0AA 1UYXA 1JZ7A 3EYPA 3SKVA 2E26A 3SEEA 2CDOA 3WNNA 2Y8KA 5EIYB 4D8MA 3FL7A 2BBAA 2VZSA 3MBWA 2J1SA 2J22A 1UY4A 3WF4A 3SEPA 3WF3A 1TG7A 5LCWL 4LHSA 3A22A 1YQ2A 4DXTA 4A6OA 5IFPA 3I3BA 5DMYA 3UESA 5JXHA 2J1EA 2VM9A 1K12A 4XZUG 3BN6A 1OF3A 4CU7A 4A42A 4LKSA 3T08A 3T09A 4E8CA 3FHQA 1PX4A 1F4AA 1W9TA 1XNAA 1J84A 3CMGA 1JU3A 1JU4A 5J1XA 3T0DA 3CIHA 5C71A 1GU3A 2B4KA 1J83A 3LQCA 4XUTA 1XC6A 3IDAA 3LE0A 1UXXX 2EICA 5IHRA 2W91A 2VMDA 2VZ1A 1UXZA 2VZTA 3MUY1 2VMFA 1US3A 3I2KA 3ACFA 1NAEA 2VZUA 1T2XA 1JI6A 2QQOA 4JKKA 2QQMA 3JXSA 3A7QA 2WZ8A 3ECQA 2VMCA 4CUAA 4QPWA 1H6XA 2ID4A 1PMHX 5C70A 4CU6A 4W50A 1GOGA 4AG4A 2YFZA 3ABZA 2J1UA 3A21A 2EIEA 2WO2A 3HEIA 1P8JA 2C26A 5IJRA 4BK4A 1UY2A 1US2A 1O59A 4XVHA 3P1IA 3C7FA 4QX1A 2KD7A 3P6BA 4BK5A 2W1SA 3HNMA 2E33A 2W92A 1W9WA 5B4NA 1L7QA 2W1UA 4QDSA 2VC9A 4QAWA 3CZUA 3LPGA 4Z2AA 2W5FA 3IAQA 4GWJA 1JHJA 4RN5A 3WF1A 3WNMA 3WQBA 2BGOA 2WABA 3LEKA 1JZ6A 2ZEZA 2ORXA 2VZVA 4MO3M 2Y6LA 1JZ8A 1OH4A 3I2GA 4XUOA 5JR2A 2QQLA 2WZEA 1W8OA 4XUNA 5LA2A 4XUQA 3DYPA 3CZJA 2WBKA 1KGYA 4MOAA 3DECA 2JDAA 1JZ4A 3NJXA 2VZQA 4DXRA 3OGRA 4LPLA 3LEGA 1JYWA 2V5DA 1GMMA 3HNBM 1UX7A 3C7EA 3A23A 4FI9A 4GZ9A 4KMQA 4CVUA 2YB7A 1W99A 3VDAA 4YPJA 3UNPA 1CX1A 4XUPA 4M4RA 2BZDA 2RVAA 4OYUA 5FUIA 1CIYA 2BGPA 2WAOA 2QQKA 1R64A 3K75B 2VCBA 3K4DA 4TTGA 1OF4A 2X10A 4CUCA 5CZKA 1W0NA 3THCA 1NX9A 2VJXA 2X09A 1SDDB 4P00B 2Z4FA 4GWIA 4JHZA 3W5NA 1CZTA 2WO3A 3SKJE 1UMIA 3ACIA 2LW8A 3I2JA 5DQ0A 4TXWA 4IUGA 4BDVB 2VZPA 3BGAA 2W87A 2RV9A 4P5YA 3THDA 5C7GA 3GGLA 4PF1A 5DPNA 4P02B 4W4ZA 2X05A 1SHWB 1EUUA 2WYSA 4MGSA 2YFUA 3WSOA 3IIIA 2ZEXA 4QX0A 4QB6A 2DDUA 2Y6JA 5HXMA 2VZ3A 1UYYA 1TVGA 1KEXA 1O8PA 3DYOA 2J1RA 3MUZ1 2J1VA 3NJVA 3GDBA 4A4AA 1GOHA 1JYNA 3MO4A 3IB3A 3WF2A 2QQNA 2VL4A 2VR4A 2WAAA 1PMJX 2EIDA 2JE8A 1GOFA 1ULOA 3OGVA 1W8NA 2VMEA 3MV11 3LEIA 2YC2A 3ACHA 3WEZA 3WNOA 1UMHA 1F4HA 5JXIA 2C4XA 2V72A 2VOTA 3EB7A 2V4VA 3D3AA 3OEAA 2LS6A 1DLCA 4DXSA 2QQIA 2ORZA 1XNTA 2E32A 2PQSA 4RYDA 4ZXEA 1K42A 3AC0A 1HN1A 3I97A 2B9VA 1SG3A 4ARYA 4L0PA 3VD9A 4ZZ5A 4QDQA 3K46A 4MADA 2HYXA 2W1WA
chains in the Genus database with same CATH superfamily
4Q29A 3IT8A 4JHTA 4SLIA 3W5MA 3NQHA 1RUF3 2OQ7A 1FV2A 2BYVE 2PHXA 4FOVA 1RUD3 3B7MA 5JMCA 2NM1A 3N9QA 4Y1VA 1OSGA 5A6YA 5A6ZA 3QH6A 1OFNA 4PI0A 2ZEWA 2UY9A 4YVSC 5HXVA 3WD5A 1Q8VA 2P3KA 2VOVA 2Z42A 1PGSA 2CNAA 3B01A 4ZS3A 3VDDC 1ENSA 1W2OA 4CEWC 4NAOA 1XBFA 5I93A 5A6QA 1DQ6A 3AFGA 1UZYA 2MEV1 4I3GA 4UW3A 2XHNA 3VZOA 3VDBA 3RJ2X 4FFGA 3S6PA 3WNXA 4CPBD 1GQHA 1Y3TA 3X29B 2A6ZA 2F6BA 5FMDA 3FC0A 3LPFA 4WVVA 5ACA1 4NRQA 1NY71 2BW8A 4Q0QA 4ZS2A 2XQRA 2CAUA 4BXSV 4YSFA 3A4UA 1POV1 3WP4A 1AR82 1NCRB 2YDEA 4X8PA 5FJKA 1X7NA 1QJFA 1COV3 4NPRA 3U37A 3K3NA 2AREA 1RUI2 2D40A 4HK9A 4N43B 4XQDA 5G05L 1PGW2 1R1ZA 1W9SA 2OKXA 5F1RA 1Y4WA 4CEYB 1UD1A 2P2KA 5E89A 4KWUA 1W6NA 2VTFA 4AFCA 5ABJA 1ND3A 4NPLA 4GB32 1PVXA 3MF9A 1NE6A 2G1MA 3LDKA 5GJ6A 3N3HA 1CAWA 1RUE3 1POV0 4FFHA 4LJHA 3NV3A 3OBAA 1BHGA 1C5HA 2JICA 1SQ4A 1VBD3 2WN3A 3S5QA 4A7YA 1TQ5A 1EAH1 2W3JA 2XVKA 3I2IA 4U2AA 4UFKA 5K0UA 1PZ8A 4R9CA 4BQ3A 5JIUA 3V65A 4JDOA 2WQZC 3A0KA 1AR71 4TSVA 3LSDA 1C4RA 4NWVA 3VBUC 4CDWB 3HN3A 2E31A 2H0VA 2QFEA 4FPCA 3VBOC 1DFQA 4LBMA 5D8AB 3TN91 3ZO0B 1AYM3 2XVLA 3ZDSA 1O3QA 1Q8SA 3C7OA 2Y64A 4LLOA 5J36A 1DYOA 2OX0A 2GMMA 2VQ0A 1S0JA 1U5ZA 1MEC2 2HWB1 4ZONA 2YV8A 4CCLA 5IVVA 1NT0A 2ZTNA 4EZ4A 1DP0A 1SDWA 3MIDA 4IEOA 3TYJA 2X53S 4K1ZA 4N53B 4OHXA 3H0OA 4Z92B 1NCQA 3CU7A 2WC2A 5FZEA 2JKBA 1SLIA 4QKBA 1XOYA 1PK6A 1ACCA 1W03A 4BQWA 5IK7A 4XQWA 5A1FA 1Q8OA 1CAUA 1S2BA 2XKOA 3BOPA 1UPIA 2GSYA 3NKTA 1CD3G 3PNAA 4AYUA 1M06G 5FOBB 1G9BA 4Q0VA 1YC61 1NLSA 3FLRA 4QPGC 4YM2A 4KBZA 2W95A 2A3WA 4MGZE 4LBNA 1X9TA 2FMDA 1OD3A 2JDPA 2WT2A 3C8XA 4QM8A 2N7GA 3W9AA 3N9NA 1E5HA 4IXLA 3FHAA 4CU8A 2DVBA 4C1WA 1QXPA 1FI2A 2QZ2A 2R041 2W94A 3TNQA 1UKRA 5ANQA 5FYCA 2YROA 3WY6A 1ZZBA 2JDUA 5A3MA 4RGAA 1OPOA 2VU9A 3IMNA 3M3CA 4N9IA 4Q4V3 4RR3B 5DG2A 3WG2A 4A44A 4BQ2A 2BVVA 1RUOA 1HV1A 2BEOA 5EPAA 1EP0A 3ZXFA 4YRDA 1PVC3 3ZYFA 4BQ5A 2XLGA 3QOPA 5T5LA 4OLLA 3WXPA 4DPNA 1A6CA 3MPBA 5JXJA 5FUNA 2AH2A 4XFAA 2P6CA 2VW2A 1Z78A 4AFAA 5F9TA 2A6VA 2JKXA 1ND2B 2RS33 2WQ8A 4MLOA 2LM3A 4LBLA 4MVTA 5KXCA 1G8WA 3U11A 2CYFA 3H3ZA 3ZFGA 5CKNA 5JOXA 2DU1A 3V64A 3I2DA 2DV9A 2UY8A 1LOEA 2VNOA 3CJIC 5FMOL 5A32A 3IWZA 5JOWA 3AMHA 3CDZB 3WNPA 3KF5A 3TEXA 1MS0A 3O1RA 1EV12 4AHXA 2ZXQA 2NZ9A 4KI5M 1SCSA 1UOBA 5A3TA 5H9QA 2W68A 5FXXA 4ZU7A 1CIWA 1PO23 1SBFA 1SEFA 3TB0A 2E6VA 1IHMA 3B3QE 3ZYPA 1UZ0A 5L7OB 1CN1A 2AEZA 2Y33A 2D98A 1WCUA 1ENXA 2GNBA 3KGLA 5IYYA 2HWD1 4IE7A 4FT8A 2WIIB 2AGSA 4XFFA 4QKDA 5JUVA 1WKYA 1H2LA 3ES1A 1RUJ2 3ZPYA 3H1MA 1WW5A 3WNLA 2WNOA 1EPWA 4YFZA 2JJ6A 3I2HA 4XTMA 5DN2A 4BWOA 2JG9C 3AZXA 4B7EA 2PHDA 3PHMA 4QD2A 2A70A 4CCCA 3PURA 4QU1A 3LA3A 1N47A 1WA4A 2Q8OA 1W3XA 5FZKA 2O8OA 2BWCA 2CGNA 4A45A 4AVCA 4L97A 2ZGKA 3SLIA 5I0DA 3VBSB 4QB1A 5A33A 4NPMA 3UGFA 4HVQA 2Y6GA 1YHFA 4LNVA 3T0AA 3BB6A 5J7MA 2XJPA 5I0UA 4LORA 2FCUA 3U1XA 4O65A 3ZX7A 3EO6A 3ASIA 3DXTA 3UJQA 4QXBA 4TLFA 2B8MA 4R4XA 3AYCA 5F5IA 3WNNA 2Y8KA 5EIYB 1UIJA 2EALA 1W6NB 2JEMA 2VZSA 4IQPA 2ES3A 3HQXA 3O14A 3OBRA 1GZCA 4MUVA 1ZNPA 2D6NA 4H55A 3NJYA 3VLBB 5T3NA 1V6NA 4J1WA 3ZKYA 4LHSA 4AVBA 1GICA 1BEV2 4XOGA 1PIV3 3ZFEB 1YIFA 4A6OA 5IFPA 2E9QA 1XNDA 2B45X 4HSJA 4PF5A 2Y60A 4Y1YA 5EJ3A 2O8QA 2VM9A 5FP8A 1AZDA 4XZUG 1CQ9A 4FPKA 4ASKA 1AX2A 2BNOA 3GZEA 1R1A3 1VLNA 5LBBA 3BN6A 4QMAA 3CBNA 1QJY2 2BOJA 2XLFA 3Q8CA 2VG9A 5FZ1A 3B9CA 4GKYA 3VV1A 5FMBA 4DOUA 1OF3A 4CXXA 4E27A 4DMIA 4LKSA 4GXLA 3T08A 5GM0A 4AAPA 4E8CA 2D6OX 3M3EA 4N7IA 1ZRCA 3FHQA 4L2NA 1PX4A 1VRBA 2GN7A 5FY7A 3LA2A 1DU3D 5LBCA 1J84A 4CE8A 5ABJC 1ND3C 1AJOA 1JU3A 5FYHA 4QGMA 4RS5A 2OUJA 4J25A 3NNMA 3FJSA 4HT1T 2VVEA 4S2HA 4F83A 5C5UA 4XBNA 2ZGPA 3VBFA 1VP6A 3M8LA 3VKFC 3IDAA 1CAUB 1W6MB 4DINB 5K0UC 4W6YA 2ZAAA 4E4SA 5ANNA 1V9U3 1WGPA 2WNUC 4HFSA 1UYPA 5C3QA 1GNHA 1RUC1 4LE4A 4OFGA 1O5UA 1PO21 4Y4YA 4KWLA 1MZEA 4UT5A 1V6JA 3PMSA 2VZ1A 3NKGA 3O1SA 2UWBA 4L92A 1RUH3 1US3A 3WG3A 4XPVA 5AVPA 3PMEA 3TOJA 4AL9A 4OQ8A 2HWC3 3GBWA 5GKAC 1R081 2P17A 2RS11 2Y38A 3QLQA 1AYN3 5F2WA 2WL1A 1ENRA 3J7LA 3MFCA 2JDMA 1QXJA 1QHDA 1U0AA 2BNNA 3P5BA 3MFAA 5C5TA 3AJZA 5IK8A 5CKMA 1HXS1 5C70A 1RMU3 2E7QA 1NCQC 1PM7A 3IKWA 3LDBA 4HBNA 4EZHA 1LGNA 4LKEA 4LLFA 1PK6C 5IVJA 4LIVA 2RJLA 3KVBA 4QPIA 3B02A 1QEXA 4FPFA 5JVVA 2J1UA 3QACA 4XJ8A 1LHNA 2EIEA 2BWAA 3V56A 3ZVXA 4I3PA 4QX8A 1Q3EA 2BRTA 4AVVA 1HRV1 3GALA 4JVAA 3S7IA 4UYBA 1FNYA 2RR12 5A32B 1IS5A 1W8TA 2NMNA 4AGGA 1A34A 1LEDA 2ZMKA 1FAYA 3SCGA 2ARXA 1LOGA 2PAEA 5GZDA 5F32A 4CUGA 2CGPA 4YW2A 4OULA 3WQ1A 4CTEA 2QJVA 4BLJA 1L7QA 1NQDA 5B4NA 2XG3A 2YPDA 4QDSA 3HIFA 2VC9A 4DB5A 3HMYA 3PL0A 4Y5TA 2AR6A 2W5FA 1GV9A 4PBOA 1C1LA 3R05A 3RJRA 5HV4A 2FQPA 5DUWA 5BNPB 2FDJA 1YFXA 3WNMA 5HBAA 1PO13 3INAA 2BGOA 1QY4A 3LEKA 4XE9A 1F5JA 2ZEZA 3RMXA 3NNFA 1E57A 3R4SA 4RA0A 3WT3A 4LBJA 5IVCA 1ZX5A 5CADA 2AACA 1CONA 3PUAA 4QHBA 5A7WA 3ZFGC 2RS51 3BALA 1OH4A 2OPKA 4GALA 4HN1A 2PAMA 2WS91 3HWJA 4AEMA 1NG0A 3I2GA 3T4VA 3J4UH 2QDRA 1T6GC 4XUNA 5LA2A 2HWF2 4W6WA 2IXIA 2WBKA 3VL8A 1KGYA 5FZ9A 4MOAA 1BXHA 2OYZA 4EN6B 3S0MA 1RVF1 3NJXA 1TZOA 2DCTA 2Y0IA 2VZQA 3WDVA 1J3QA 2PMWB 1SLLA 4V1PA 3OGRA 3AB0A 3AP7A 4NHKA 1DYKA 1RUG1 2WNEA 3SCHA 5IAXA 2V5DA 2XBO2 3P3PA 4MXWB 1K5MB 2A1XA 4JQRA 2JWPA 3AVRA 1HKDA 1V0AA 2YB7A 4DZGA 4IE4A 4K21A 5DAQA 3ILNA 1NXMA 3OYWA 4PLMA 4MSVA 4XAAA 2EF6A 1JOPA 1ZZ9A 2MEV2 4NRMA 5FUIA 4AEJA 2DCZA 2R073 2BGPA 2RDRA 4JGYA 1N3QA 3I4IA 3M7AA 1RB8G 5LBFA 3DGTA 1MS4A 2A71A 4M01A 2ZBJA 5ACA2 1NY72 3BIEA 3PU8A 1PNFA 2X5IB 3MI8A 2PQQA 2XJRA 4EN7B 2AC1A 3MGUA 1W3VA 2A6XA 4XJUA 4MHRA 3GYDA 1VBC3 2D93A 1O7FA 3POFA 3AMQA 2HEYF 2Q1ZB 1LU2A 5FYTA 2CGOA 4NN0A 4IUGA 5FZOB 3LB9A 3T4HB 2R49A 2RV9A 4A3XA 2B42B 2A5ZA 3O1UA 1BZWA 1QJU1 1IPSA 4PI2A 5CISA 5IK4A 5A3OA 2JE9A 3OY8B 3URFA 5BNNA 3WW4A 4YW3A 1SLBA 1FATA 4QT6A 1EAH2 3GZAA 3PLQA 2WZR1 4OHZA 1JZ6A 3IIIA 2VBPA 5AC91 5C3RA 1AR72 4QB6A 1S0FA 3WW1A 1BK1A 3WINE 4YM0A 4A2UA 1UYYA 3O1OA 1DQ1A 4MGYE 4Q0SA 3TN92 1KEXA 3DYOA 1NA1A 2ZX2A 1G7YA 5FZAA 3EBRA 4Q4Y3 1QQP1 3GBGA 3OF1A 1ONAA 2RDSA 3MO4A 2EAAA 4IV3C 1FX5A 3WF2A 1UZWA 3ZXLA 5KHJA 4KWJA 2HWB2 1VBB3 2R061 4LBKA 2YHJA 1BBT3 5EWSA 2PTMA 3PJYA 5EYXA 3JQWA 1X50A 2W08A 3VDDA 4CEWA 5FO9B 1QH7A 4PIXA 4YG0A 3IIAA 3K48A 4Q8KA 1OHFA 3WNOA 4RS5C 3JU9A 3AZVA 4FP2A 1O4YA 5A6XA 2WFF3 2RMU3 3MIEA 4LA2A 3LOBA 2CWSA 4JDNA 4H7MA 4LT5A 5LY1A 2V72A 1UZZA 4IESA 4PDWB 3VBFC 1YQ8A 4AI9A 4FQZA 3ZYJB 1W9FA 5CNAA 1V70A 1VB2A 4JV4A 3O1VA 5F5CA 1DLCA 1NOVA 1DZQA 4AFMA 4F7ZA 4HKOA 1XNTA 2PQSA 4RYDA 4PCRA 2WNVA 2DTWA 2IXKA 4L9BA 4WVZA 1PHMA 2R042 2B7YA 1FOD3 1HRI1 4ZZ5A 2AYHA 2OZ6A 2BFUL 5FYYA 2QQPA 4FTSA 1MQTB 4AEDB 3I59A 4LBOA 1ZBA3 5KWRA 3L9JT 4WZFA 1L7RA 1CZSA 3P3NA 3B9IA 4B1LA 5CAZA 2DYCA 3PUIA 1NZIA 1VBA1 4GMP1 4LO4B 5FP4A 4WZCA 3B93A 1JOJA 3IN9A 1AL21 1QOOA 4KBBA 1GQPA 1OT5A 4GH4B 1BVP1 2ZAHA 3J7HA 3OPZA 4XIKA 5FR3A 1DLLA 3VD7A 5K7PA 4BM8A 1DHKB 2PA7A 2BP6A 5A7WB 1D4M3 1YQ5A 3T30A 4OCTA 1SFNA 3ZN6A 1TMF3 3MF6A 4OMCA 1DDLA 4RFRB 1RYYA 3POSA 3NRUA 5GLUA 4GMP0 4FPLA 3I3DA 1HQLA 1WLWA 2CSGA 4PT6A 3AYEA 5IFTA 3AXEA 1GZTA 5FZLA 5LZ6A 2HWD2 4JC1A 3ZSEA 4E2GA 5G04L 4CCEA 5FY8A 3CO2A 2EXIA 3QH7A 5HCHA 1W8HA 2JX9A 4AHYA 1AVBA 5FK7A 4RHV3 5FZ3A 1JTZX 3UETA 1QNYA 3OD4A 1F5FA 2VO5A 2HH9A 3E97A 4AVTA 4B8EA 2RG4A 3S7EA 3RYKA 1UX6A 1N1TA 1OA2A 2ARCA 4IE6A 2PLV3 5AVAA 5FYSA 4EN9B 4FOYA 2DCJA 2JECA 5JI9A 5BV6A 4WVMA 1D0HA 1ZZ6A 2HWE3 5LRRA 3GM8A 3WP3A 3I3QA 5JMOA 4Y20B 1HQWA 4FPEA 1UY0A 1S2EA 3VHNA 3D4KA 1NZCA 2D97A 3M3IA 1DGWA 2R16A 5EJZB 1VRH1 4BIOA 1N1VA 1JYVA 1MS9A 3E6CC 3C7GA 5FZGA 5D21A 2ZZQA 3GCXA 3F2ZA 3C2UA 4HK8A 5FXVA 3FZ3A 3VBRA 2FD8A 4COUA 2RM21 1QJX3 1ZBE2 2HEWF 3DPRB 3J8F3 2CAVA 2BUKA 3N7MA 5GLVA 3ZM8A 5C33A 4IEQA 4GD4A 3CJIA 5GZEA 1C3HA 1UY3A 4DUVA 4JKMA 1WBLA 2QQJA 4JGYC 5F6LB 4QDRA 2H6BA 3ZSMA 3JB8A 3ORJA 3T2QA 1H9PA 5FMCA 2ZGNA 1SLCA 4AHWA 4AQTA 1ULPA 3C7HA 2C24A 3OG2A 4UW6A 1YNAA 3WDTA 1VBE3 5DABA 4AEKA 4BQ4A 1F9KA 1MZ6A 1Q8QA 4Q1PA 4XAEA 3IBMA 3M70A 2YC0A 3OCPA 3E6DA 4WM8A 5CYYA 3QBQA 2F4LA 1BK0A 1WD3A 2TBVA 1C8M1 1NXD1 5KR7A 2R1BA 5F3CA 3LEMA 3RZJA 4W8JA 4YVSB 1O3SA 2YC4A 1ZZCA 5I0SA 1TME3 3VDDB 4CEWB 4C0HA 2KXLA 2Q8DA 5JOYA 2J7MA 4WVWA 1DQ5A 4BJ0A 1O5LA 1UN1A 3G6JB 3RZKA 3POEA 4R8HA 1FPN3 5BNNC 1GYKA 3WG1A 3H42B 3ZSJA 2QE3A 1GP6A 5FPBA 5F7UA 1CAVA 2ZHMA 1O8SA 1K45A 4ISQA 1RUC2 2LALA 3L2HA 4XBLA 4ONUA 3H50A 3O1PA 5BYNA 5JIAA 4E9KA 2ILMA 4MV2A 4EE2A 4DUXA 3AKRA 3KHCA 4JCKA 2R32A 4CZSA 4N7UA 1H30A 1NA1C 4O9GA 3WLUA 5LA1A 1YFWA 1RHI1 3AVSA 2YU1A 3LFMA 3WW3A 1GP4A 4ARXA 4QWNA 1R082 2RS12 3J7MA 4P5HA 5KHKA 2VCAA 1R093 3PUHA 2DURA 4R9DA 3RYRA 4IL7A 1I3HA 1UU5A 3GNEA 4CDUB 1HXS2 1OFSA 3B00A 3T2OA 2WO1A 5HCFA 3K77A 1H6YA 1JZ5A 2W1QA 2WT1A 1E5RA 2VQAA 2FDGA 4FPGA 3AZZA 1ZYBA 2KR2A 2IXLA 5FCCA 3SQOA 5J96B 1OUXA 4MXVA 3ZDVA 4B7KA 4AE2A 3O1TA 2CV6A 4AAXA 4IERA 3VBUB 2FDHA 2VVFA 5LASA 1FMD3 1HRV2 1LRHA 3VBOB 2JDZA 5J37A 3T2PA 1IQAA 1W0PA 4TZDA 1C1FA 4CP2A 2GZWA 2P3IA 2G4IA 4ITCA 1JYTA 2CHHA 2WNVC 3ETPA 3MLLA 5FBZA 3GXUA 2NP0A 4XC9A 1IS6A 1J1TA 3M2MA 3POBA 4BU2A 1DGWX 3VZKA 1HB3A 3O0XA 2D6PA 3RWKX 3AMMA 3ZN5A 3SKVA 3VGIA 4YW6A 2E26A 2CDOA 1KJLA 3ZSKA 2JB4A 5APAA 4P9WA 1H2MA 4D8MA 2B5HA 4D6RA 4Q4W1 1JYNA 5LRSA 4WBBA 1QOSA 3JZVA 4I30A 5A3WA 4TWTA 3ZYBA 5A1LA 4Y3OA 3I2OA 1MACA 1VAVA 5FYUA 2J22A 4CRQA 2Z2SB 2WNUA 3WF4A 3D82A 3JD73 3AL6A 4QPGB 1RJ8A 1LECA 1TG7A 1WW4A 4P9LA 4Y1XA 3KV5A 1VBE1 4B4QA 5JSPA 2VVDA 2JDYA 4PQ9A 1MS1A 5LCWL 2RS52 4L11A 5FQ0A 4TN7A 2GMEA 3UESA 5JXHA 2J1EA 2WS92 1K12A 4HVOA 5F8PA 4NMIA 4IETA 1RITA 1ZRDA 2VTXJ 4HN0A 1U5IA 1RVF2 4WVMB 4INDA 2WLQA 1LU1A 4EJRA 2Y6FA 1J3PA 1RUG2 4PBPA 2XL9A 5FZ7A 4EWEA 2BJSA 2VNRA 2VXRA 4XJWA 3USUB 1JHNA 2YUEA 1ASJ1 2GC3A 4COWA 2D5FA 2PHUA 1S0CA 3CIHA 2GP5A 1U5XA 1SZBA 2XJUA 4OUMA 4UWDA 5F2SA 3SH5A 1J83A 3POGA 3AP9A 4CEYC 4KNCA 2B39A 1YI7A 1ZRIA 5DDJ3 1Q56A 3O5SA 5A70A 1H1AA 2WLPA 4ZHNA 1HB2A 3CJIB 1DGRN 5BY5A 1IS3A 2BU9A 1X8EA 2XVGA 1AHSA 1RUF1 2JDHA 1RUD1 2D6MA 1OLMA 2EICA 4K3UA 5IHRA 3ELNA 1NLQA 4XMAA 5FK8A 3V0AA 4ZU5A 1IS4A 3N7JA 3Q8BA 3TEWA 1D4VB 5T5JA 1HIXA 1K5JA 5IWFA 1UXZA 4C1XA 3MUY1 2VMFA 2XHKA 4BOWA 5A3LA 2A73B 3AKSA 1C57A 3DF0A 3LFIA 4K1YA 3H8XA 2KM2A 2VZUA 1JI6A 2I45A 2QNKA 4JKKA 4CCOA 4FFIA 1CJDA 1UCXA 3JXSA 4OVEA 2IFRA 4V2VA 4FFFA 3U78A 3OBZA 1GLHA 3ECQA 2VMCA 3VBRC 1CR7A 5F37A 4Y24A 1H6XA 3AK0A 1WLCA 3ETQA 1ULGA 4LO8A 5CKQA 1DQ2A 1MS8A 2EXHA 4IGPA 1QJU2 4CU6A 2P6HA 2R1DA 4W50A 1COV1 1GZWB 1W6QB 1CVNA 1GOGA 4AG4A 5GLTA 2XXZA 2YGMA 4XJ9A 3WVJA 2JG9B 3ABZA 3ZR6A 4C0BA 1W06A 1REFA 4CDQA 1SLTA 1AR93 2WZR2 3T0DA 1QKQA 3JBG3 1OLRA 1FXZA 3WHTA 5AC92 5FY9A 4AF9A 1XE8A 2PHRA 3ZXGA 3LIGA 3PVBB 1US2A 1RUE1 2TEPA 4XVHA 3P1IA 2B9UA 3C7FA 3SC7X 3WUDA 4QX1A 5A7OA 2KD7A 1BCXA 1QQP2 5FP9A 4BK5A 1KD7A 1V00A 3AP4A 3HNMA 5FZMA 1VBD1 2NYYA 2EAKA 4Q4X3 1HDKA 1HJFA 1W9WA 2R062 4LULA 4COZA 4WM8C 4YZ5A 2Z69A 4XF0A 3ITQA 5FYBA 5GZGA 2IZWA 3S5AA 3SHRA 1RUNA 1WUVA 3CZUA 3WX5A 4D6SA 4GWJA 3BIWE 2G9GA 3AP6A 4OI4A 4ES9A 4QQPA 1AR63 5JLVA 1AYM1 3NAPA 5FZHA 1UU6A 4RD7A 2JE7A 2YMZA 4NWWA 1OOPC 5CEHA 2VZVA 3WDYA 3H3LA 3ZXKA 5JPNB 1OI6A 4MO3M 4XHXA 3ZYHA 4AI0A 2HBUA 1Z7S3 1OD5A 4OHVA 3LKJA 3R4DB 4B4RA 4R9AA 2QKDA 3E5UA 2QQLA 1ND2C 3RWNA 3HT2A 3QCWA 1LHOA 3HAGA 4KGQA 2I74A 4BIFA 3IDCB 1HRI2 2ZJCA 3CZJA 1QDCA 3FUQA 2EXKA 3WDUA 4P9GA 1JZ4A 4XBQA 4EWAA 2ZGTA 2E63A 4DXRA 3N9PA 4U36A 5ABJB 1ND3B 1KDMA 4LIUA 4LPLA 2AEYA 5CFCC 1POQA 5KXDA 3HNBM 1UX7A 2C5DA 1CAWB 1N3PA 2J42A 2YBKA 4META 3A23A 4GZ9A 5I0TA 4KMQA 3UJOA 1VBA2 3N9OA 3VDAA 4MGIE 4YPJA 1AR83 1IG0A 4BZ4A 5FLIA 1TE1B 1CAXA 2Y0OA 1AL22 2Y26A 1JW6A 3GCWA 1XU2A 5K0UB 1F35A 2P3YA 1H8VA 5ISLA 1RUI3 4QQ2A 2D44A 4Q4V1 1SLAA 3ES4A 2XPJA 4XFCA 3WDWA 4FAHA 4CDXA 1H8TA 5FO7B 1BQPA 1OF4A 1PVC1 5KHIA 3MPPG 1X9PA 4IV3A 5FZBA 1W90A 1QH6A 5CZKA 3WOGA 4GB33 4M00A 1JH5A 2MPFA 4HVRA 3MLKA 1XNKA 1ALYA 2VJXA 4XCAA 4DXZA 2CU5A 3MZHA 2RS31 2NQYA 1XQNA 3ILRA 1SDDB 4P00B 1JBCA 2OVUA 4JHZA 1IOAA 4QGLA 1C28A 1CZTA 2WO3A 3SKJE 1UMIA 4P9YA 3ZYRA 3U0ZA 5BNOC 1BLZA 1BVVA 3HR9A 1GBGA 1OMIA 4TXWA 1ODMA 5DAWA 1NCQB 1QF3A 2VZPA 3BGAA 3Q8FA 5JOZA 5IVEA 1PK6B 1Q5OA 3GHNA 4UFJA 4QU2A 4Z07A 4B29A 3HD8B 4PF1A 2AUYA 4LK6A 1AXKA 5DPNA 5T54A 1LOCA 4W4ZA 4Y1ZA 3BOWA 1SHWB 1LTEA 1EUUA 2QCSB 3AZYA 2WYSA 3FFQA 3TEYA 4RGGA 3FE5A 3WSOA 5HI0A 1MEC3 5FREA 2GC0A 3WQ0A 1YFUA 4LUKA 4Z82A 3AL5A 3KCYA 3ZYIB 5HXMA 2ZS6B 3PTYA 4Q5OA 2JENA 2VZ3A 2FMYA 2VUCA 1O8PA 3OPTA 4OZXA 2J1RA 5EP9A 3KT1A 4MHUA 2J1VA 3ZFEC 2CTVA 5EZWA 1VRH2 3H8OA 3CL1A 2VR4A 2WAAA 3ATGA 4URTA 2WWSA 3KT4A 3M4FA 2EIDA 2JE8A 3POIA 2XL7A 3OGVA 2WKKA 3DXUA 3H8UA 1GWLA 4IV1A 5FUPA 2WT0A 4IEYA 3MV11 2RM22 3BTXA 3ACHA 3WEZA 1F4HA 1KFUL 4AXOA 1UIKA 3F95A 3BVCA 3HBZA 4WM7A 1G9AA 1REEA 1DZTA 3ZFGB 2JG8A 4GIQA 3SITA 3AKTA 3EB7A 4IGQA 5KXBA 2JD4A 4E4HA 1RC6A 4C90A 3OEAA 5JZGA 3ZR5A 3E5QA 3D5OA 3IPVA 2PFWA 2YXSA 1NE4A 2QQIA 2R0FA 4IE0A 1K42A 2VUJA 3SCFA 1HN1A 2VMGA 3SXWA 2OXBA 4OUSA 2B9VA 2W39A 4AI8A 3PVEA 4YGCA 1G9DA 2W0XA 3Q9OA 1O4TA 1WLDA 1CESA 4YGBA 1RINA 1S1AA 5C6CA 1ODNA 1PIV1 2HYXA 1C8M2 2W1WA 3AMPA 2JDKA 4MADA 3ZLIA 4D7YA 5L36A 1OQDA 4P08A 1OXCA 4AZZA 2EIBA 2SLIA 3LWCA 2ZMLA 1VE0A 3OEBA 1R1A1 2PN5A 1LKNA 4I02A 2P5BA 3ZIXA 5CG9A 1H9WA 4EV0A 2ARBA 1EV13 2A6WA 1ULCA 4HPKA 1Y9MA 1IQDC 4E8DA 4BMBA 2VZRA 4COVA 1KDKA 5F3GA 3VD5A 2Y6HA 4CDQC 4Y1UA 1RXFA 3WCRA 4ZZ8A 2DVGA 2CY6A 4IEXA 4YWAA 2XWBB 3BTAA 3I3EA 2YY1A 3BU7A 1AX0A 1WZXA 4GA9A 3UV9A 4UFIA 5A33B 1W2AX 2GNMA 4Q0PA 5E16A 5H9SA 2IFWA 2PHTA 1RHI2 1RUJ3 4YVWA 1WMXA 4H14A 1ST8A 4FPJA 1S0EA 2XUMA 3APBA 3PVNA 1V9U1 5T5OA 2K46A 1WMFA 5L9VA 1QGLA 2DUOA 2WA4A 2W47A 3H1WA 1B35A 2HBTA 2QZ3A 3RFRA 4PQQA 4OQ9A 3TWIA 3LSEA 4OI2A 1RUH1 4M4PA 1LR5A 3NAPC 3MW4A 5EV7A 2LUWA 5DUUA 3CQOA 4AQ2A 1PX3A 5B2GB 5K9YA 2HWC1 5KBFA 4NR1A 1S0DA 1QU0A 1C8NA 5T55A 1CX4A 4IEPA 5LW9A 1AYN1 2JXAA 4LBQA 2W9XA 5K4LA 1PNGA 1W0OA 4CU9A 2VAUA 1F2NA 4G9SB 1YJKA 2BTVC 2JDNA 1RMU1 4HXCA 5LATA 5C4WA 3AYAA 2YZ4A 3ZPOA 2BGCA 3JQXA 4KU7A 5HV0A 5E1RA 2RE9A 3GJAA 2VBDA 1ZZ8A 1BEV3 4Q8LA 3GZUC 4RS5B 3RRDA 4JX0A 2D3PA 4Q4W2 2XJQA 4QXHA 1ULDA 1NUKA 2MNGA 1M4WA 4K20A 4NO4A 4S2GA 3BTYA 1MR5A 2P4EA 1GP5A 2VBBA 2C9KA 3VBFB 5T50A 1ZA4A 1QJY3 5C8CA 5CG8A 2F4PA 3AJYA 4PJYA 4QKFA 1IPKA 1NKGA 1I5PA 5FKBA 1RXGA 4XDOA 2W52A 2GAUA 4LE3A 1KFXL 4HG6B 3SMHA 2Y6KA 3HN1A 3POYA 4CDXC 1H8TC 2FDFA 3HT1A 4LHNA 4XCBA 1WD4A 3FBYA 1EY2A 1FNZA 2CWMA 2R7EB 2YG0A 4YZ3A 1DYPA 1EUTA 3G7DA 1PO11 4PHZA 3K4ZA 5C9AA 5FKCA 5CVRA 5CFDA 4Z1VA 5FY5A 4N8MA 3KS7A 2VQUA 3M1HA 4L8QA 5B4XA 4QHOA 5EJ1B 3SISA 1JZ3A 1BYHA 5JXGA 2GC1A 3LDRA 4NVPA 3RS6A 1ASJ2 1Q43A 5FYIA 2OZJA 2QUOA 4ES8A 2V5YA 3MYXA 1W39A 4IGOA 4JGZA 4QPIB 5FRAA 4NIAA 5J48A 2WUHA 2JIJA 2HYKA 3VDCA 3IM0A 3ZFFA 1W6OA 2GALA 5FZCA 3U10A 3FMGA 4YGEA 1SCRA 4LBQD 3MV01 3LAGA 4M3CA 4QGNA 1RUF2 1U5YA 1RUD2 1VR3A 4XTPA 3UKTA 5FPLA 3CNAA 1S0IA 2FCVA 3KSCA 4QQHA 1JZ2A 1XU1A 3E1F1 3U4XA 1AL0G 2ZABA 3RZZA 2O0OA 4UAPA 4OUEA 4MX3A 1X36A 2R071 1H2KA 5FYZA 2OUHA 2VECA 3CF6E 4KG8A 1ZRRA 3FN9A 4MYEA 4XFHA 3N36A 3ST7A 4AI3A 3OPWA 4HLTA 2WZPP 4OZOA 1OVSA 4P9XA 3H8RA 1UYZA 4IV1C 3AM2A 1W28A 3HPNA 1IG3A 1COV2 2XONA 5FY1A 5FV3A 1XB9A 2RR13 4Y26A 3HOBA 1X33A 4WM7C 1VBC1 1QWRA 5F3EA 5CA6A 3JB4C 1HJGA 2HLEA 2JG8C 4W6XA 1LOFA 3AKPA 1GNZA 1H4HA 3CJXA 5JZGC 2DVAA 5F6KA 2DFBA 3N7LA 3OSDA 4DUWA 1BMV1 4K8FA 1MPXA 1W2NA 3NVCA 1RUE2 5HPOA 2DBIA 2VCMA 3HJRA 4PDWC 4J6GA 3S57A 1XJAA 4KWKA 1RJ7A 2OQ6A 1VBD2 3PIGA 4I0AA 4TYSA 4XACA 1UYXA 3T3YA 1HQNA 4XZPA 2ADDA 4HONA 5I8TA 1JZ7A 3EYPA 4N43A 1GWKA 3SEEA 4I01A 3MIHA 4NE9A 4RGKA 1DG6A 5GLWA 3VBHC 4X6QB 5FBJA 4CEYA 5JWPA 3OYWB 1OQ1A 2C6SA 3FL7A 2BBAA 3MBWA 1AYM2 2J1SA 2ZGLA 4AEDC 4FSJA 4JGYB 2HWF3 4Q4Y1 5EYYA 1UY4A 3K2OA 1YFYA 1XE7A 1BJQA 4BB3A 4JRLA 3WF3A 4FCAA 1VBB1 1UOFA 3A22A 3W20A 1BBT1 4CCKA 5EHDA 3ZXEA 3EMRA 3I3BA 1L3JA 2QVSB 3ACLA 4LTAA 5C3PA 1W04A 5CBLA 3I7DA 2XBO3 1H2NA 3AZWA 4XYXA 4B4PA 2XDVA 4LXLA 5GZCA 1UPSA 2ZX0A 4CSWA 4CDWA 2WFF1 2RMU1 4I0WB 2IWGB 3TRSB 5LK5A 4DRRA 1OC1A 3RQ0A 2P34A 5D8AA 1WBFA 3D8CA 2MEV3 2XLAA 2ZGRA 4QKNA 3FX3A 2X8KA 4YVWC 3A0NA 1LESA 4AQ6A 1F4AA 1W9TA 3DEMA 4F3JA 3PVOA 3RMYA 1Q8PA 2TUNA 2ZGSA 1LHUA 5ACA3 1DCSA 3NWKA 1JU4A 3PDQA 1POV3 4Q1RA 4AW7A 5I8YA 5J1XA 1B35C 4QHZA 3W21A 3PU3A 5C71A 4N53A 4KGGA 5BNNB 1GU3A 1FOD1 3DL3A 4S2DA 2I07B 5DAVA 3LQCA 1RGSA 2VOKA 2DU0A 4UXAA 3ZKUA 4Q4V2 5AFEA 1QNWA 3NSTA 1XC6A 1LHVA 2LROA 1ZBA1 4ATFA 3M3OA 3WP6A 1PVC2 3ZMNA 3OOXA 2Y34A 4DY5A 2WWJA 3ZXJA 1GFF2 4Y4RA 2VMDA 1NA1B 1W8FA 4JTOA 2VZTA 2F17A 3HQUA 4FP3A 3NL1A 4NOTA 3U75A 2RS32 3VZLA 3ZYGA 4B3NA 3ALQA 5C4WC 5DZEA 3U4SA 1NAEA 1B09A 2ZPXA 3BUCA 2D7FA 1EAH3 2A3YA 2QQMA 3E5XA 4GJZA 4AI1A 2WJSA 1WW6A 1CPNA 4W65A 3VUOA 4RR3A 2ZA9A 3VKOA 2WZ8A 3J26N 1V6IA 1S55A 4JZRA 5L9RA 1D4M1 3CHXA 2DVDA 1OOPA 2P3JA 4QPWA 1AR73 4QXKA 4XFGA 4XIOA 2WYFA 5KHHA 3ZXAC 3VZJA 2ETEA 1TMF1 4R52A 3JUUA 1VPHA 2VXJA 3EXUA 3I8TA 3KV9A 3RVHA 3TN93 3WV6A 1LGCA 1LULA 3R0RA 4IEWA 5C8CC 3OUJA 1PO22 1STMA 1ND2A 4RQPC 2ET1A 1SFPA 2HWB3 2X29A 3MIFA 2XWJB 1D2SA 1QDOA 2C26A 4TLGA 1C5IA 1W2UA 2WNVB 1AF9A 3IDEA 5IJRA 3SNMA 2ARAA 4DNYA 5A7PA 3FHIB 1UY2A 1O59A 2FBEA 5E88A 2TNFA 4RHV1 4BXFA 2HEVF 1HV0A 3BKZA 3RNSA 3P6BA 5C9AC 3I59B 5CFCA 2WRAA 1WCSA 2E33A 1O4ZA 1QXRA 1WMEA 5CFDC 4XJZA 4FBFA 3K3OA 4H2AA 2VMHA 2WA3A 4K7JA 4Y5Z0 1ULEA 4FPOB 2W1UA 4Y5SA 4DQAA 3HQRA 5FDBA 5L7OA 2DUPA 5JPMB 1Y7BA 2PLV1 2VUAA 4QAWA 3LPGA 3IAQA 1JHJA 4EN0A 2HWE1 3MICA 1QJZA 1SBEA 4G3YC 4RN5A 4IEZA 4JGZC 4N9HA 2GH2A 1UMZA 4K9SA 4XFIA 5FZ4A 5A7NA 2WQ4A 3WF1A 1QIQA 2R043 2XBO1 3WQBA 4E4ZA 3ZFFC 5DXDA 4EN8B 2ORXA 1KITA 1DF0A 2NLRA 4CXYA 3L2YA 2Y6LA 4YARA 4FPYA 1XXNA 1REDA 4CXWA 4JAAA 1LENA 4XMIA 3AXDA 3ZN6B 4XUOA 3M3QA 3MDPA 5DAXA 2WZEA 1QJX1 3J7NA 3ME2A 4K40A 5BNOA 2QQVA 3J8F1 1I1EA 3O7OA 3DYPA 3CEWA 4YM3A 4FQ4A 1GKBA 1LEMA 5J3UA 2E51A 3ZIWA 3DECA 1A3KA 2BNMA 2JDAA 2JIGA 1YUDA 3VBSA 2FCTA 1PIV2 4XETA 1PZ7A 1DZRA 2VNVA 1UQXA 1VIWB 3GBFA 1JYWA 5GLZA 1Y43B 2RJKA 3I3MA 1A8MA 5A3UA 1R1A2 1XYOA 1OPMA 5BPXA 1W99A 3NNLA 3U14A 5LWBA 4Q2FA 1VAMA 2RVAA 4OYUA 1BKZA 1CIYA 1J1LA 4NIIA 4ZU4A 2WAOA 4R9BA 3RG0A 1LOFC 1PZ9A 5SV5A 3K75B 3K4DA 4HZFA 4CDUC 4TTGA 5FWJA 5A7SA 1LOAA 4RL7A 2X10A 3N9MA 3IMMA 3EHKA 1APNA 4K6BA 5IW0A 3ZFEA 1TME1 2HWD3 3TAYA 1MZ5A 4FVVA 4I09A 3KV4A 1EYBA 3MIBA 5FP7A 2XJTA 1NX9A 3KHBA 2Q4SA 3J9SA 1NCRC 2VUDA 1UKGA 2K0GA 2X09A 4BH9A 2GMPA 1E5IA 2Z4FA 1FPN1 4GWIA 4H3WA 4SBVA 3KT7A 1UO9A 2E53A 3VBRB 2LW8A 2O14A 1V9U2 3LA7A 4XDPA 1VALA 3I2JA 3USSA 4N43C 5DQ0A 3LZZA 4MZUA 1SPPA 5J98B 3VN4A 4YW1A 3NW4A 3RGBA 2ZACA 1TEIA 2W87A 2WO7A 4P5YA 4MGKE 1X82A 3GGLA 2DCYA 3OUHA 1RUH2 4LUMA 5IATA 1KS4A 4D7TA 2GH8A 4AVSA 1UZVA 5FY0A 2HWC2 2VULA 2YPJA 2AZ5A 4MGSA 1AYN2 5FPVA 4YG6A 1R091 2ZEXA 4M3CF 1S2KA 4D7SA 1W6MA 4QX0A 1XYNA 1Y9QA 5FPZA 2Y6JA 5JDBA 1RMU2 3B5LB 1RL3A 4NIHA 4CDWC 2DTYA 2ATFA 1ZBE3 1NQJA 3BPSA 4Q27A 3GDBA 4WM8B 5FXWA 4HKWA 5L73A 1WCKA 2LRPA 3IB3A 4K8RB 1W8UA 2EIGA 2QQNA 4NHMA 5D8AC 2VL4A 1OKOA 2WFPA 1H1IA 2GDFA 4D3WA 5F3IA 1GOFA 1FMD1 1N1YA 2PYTA 2FHRA 2UU8A 1O3TA 2JB8A 4HSLA 5A7QA 4AGVA 4Y33A 1W8NA 3PUSA 2BV4A 1D2QA 2VMEA 2EXJA 3LEIA 3R6SA 3POJA 5BNQA 4IEVA 5C3SA 1XSQA 5JSOA 1OOPB 4CCNA 1V6OA 3O0VA 4GWMA 4N53C 4V2WA 5BUVA 5JXIA 3HBKA 2VH9A 1MS3A 4BISA 1CAVB 2VOTA 2YU2A 4WV8A 4J1XA 4FOWA 3TEZA 2V4VA 3W58A 3D3AA 3LD8A 2LS6A 2IXHA 1KJRA 3NMBA 3LCPA 4NHXA 2E32A 4ZXEA 2DBNA 2D3SA 3V0BA 2R30A 1Y9GA 3I97A 4BE3A 1PO12 1SG3A 4ARYA 4L0PA 4EYUA 2RDQA 3KMHA 2OIIA 4JQTA 4I2OA 1MZFA 2W2IA 3JD71 4GWNA 1DGRA 5CFCB 2SBAA 3RI8A 2OW4A 1UY1A 3MLJA 4LHKA 3N9LA 4RR3C 5EQUA 4DEVA 1RUC3 1CZVA 3CKHA 4ET7A 1KXGA 2ZZJA 4GQ7A 3HNYM 4BYYA 3KCXA 4KU8A 5JI7A 4DFSA 1G86A 1WW7A 5BNPA 2GN3A 4UI9L 4JKLA 1QOTA 1R083 2IXCA 1IZ3A 3W59A 2RS13 2ZGMA 4H7LA 5LEJA 4XF3A 4XHBA 3CLPA 2ERFA 5DUVA 3VD3A 4NHLA 1WMDA 4LO5B 4YZ1A 3D0SA 4QX3A 1JYXA 1HXS3 1A8DA 2ZHNA 1PGL1 4UW4A 4GKXA 1CJPA 1ENQA 1XNBA 3OB8A 4FXGB 1SACA 2W46A 3LIHA 2R072 2GNDA 5BNOB 5DDJ1 4LQRA 2WSVA 3RSJA 3N4MA 4DY3A 5FP3A 1J59A 2ENRA 5FZ6A 4O61A 3VD4A 4XQ4A 1ZRFA 1D7PM 1HRV3 5L7OC 2IVJA 3LOIA 5FLJA 4PLOA 3WF0A 4B1MA 2A3XA 3NNGA 2WNUB 3OBTA 4MXWA 1K5MA 3KWVA 2ZEYA 3S30A 4DEQA 5J09A 1EPZA 1WWYA 3AKQA 1VBC2 2PELA 5FMOS 3MW3A 3MHZA 3POWA 1OLME 4EROA 3I54A 5FQ0B 5F5QA 4UFHA 4CP1A 1ZBE1 1WLTA 5D2AA 1KQRA 3T0BA 3OGSA 1S4CA 2R6QA 4LR4A 1RIRA 4OHYA 1BMV2 1YXWA 4AWDA 4XURA 1YWKA 3KVAA 2CDPA 2VOXA 4A7ZA 5SV8A 1UWWA 5TSWA 3Q8EA 2X5IA 1IPJA 4OI0A 3NV4A 1DIWA 3WNKA 5EXOA 4A41A 4GJYA 5I91A 4LMFA 1TNFA 1FYUA 2EVXA 2D3RA 1AR91 2ZX1A 4KQ7A 2J1AA 3JBG1 4ORFA 3VBSC 2R0HA 4D94A 1F31A 4KG0A 2D5HA 2RS53 2XQXA 4RSUA 1LNSA 2XMLA 4XFBA 4YGDA 1QJEA 4NJ4A 2WS93 5KC5A 1SPPB 3VKNA 5FFOC 3ZXDA 1SBDA 5FZOA 2E7AA 2QDNA 2XOMA 4Q4Y2 2Q8CA 3VZNA 2WDBA 4JDMA 1J3RA 1K3IA 1XPWA 1RVF3 4Q4X1 1VBB2 3OY8A 3GZTB 1GWMA 1BBT2 1CPMA 3ACGA 2VZOA 3V0AB 3UKNA 1RUG3 2HKXA 3AP5A 1YIPA 4XEZA 3VZMA 1ZM1A 2CL2A 1GQGA 1LCLA 2QBXA 2ZGQA 3BCWA 4XABA 3TNPB 2D6KA 3WHUA 1GNYA 2O1QA 4LKFA 5IVBA 2WFF2 2RMU2 1AR61 2VW0A 4QB2A 4CYDA 4FO9A 2ZKNA 2DWRA 5IT6A 1ULFA 2G9ZA 4D0QA 3PTRB 4NIGA 5LA0A 1N3OA 1OH3A 5FYMA 3WDXA 1YCIA 3AMNA 4NAMA 3ZSLA 1Z7S1 4CP0A 1TNRA 5I0RA 1JODA 4UBHA 1O91A 3E6BA 5F5AA 5H9PA 5HCBA 5LK7B 5AFBA 3DUIA 3VKMA 1AX1A 3WP5A 2NMOA 2VGDA 4MH0E 1FOD2 3BPZA 2ADEA 2DUQA 1W8WA 3I2FA 3R4UA 4A3ZA 1ZREA 1H1MA 3FLTA 4CDQB 4YW5A 1YEWA 2J1TA 2VCCA 2VOWA 5DZFA 2Q8EA 2FDKA 4G4FA 2VQTA 3DYMA 1ZBA2 1LOBA 4IE5A 4NROA 4PDWA 4ZPIA 1NLRA 1VB4A 4AGRA 3GF6A 4LEJA 1GUIA 5BXXA 1AR81 2EA7A 4MGQA 2RJ2A 2WR9A 2FZ1A 3KQ4B 1QJU3 1W05A 3KZ4C 5FZ8A 4BLIA 3V0BB 3ILFA 3VBHA 1FT9A 4LITA 2BOIA 2L9LA 1S0GA 1RUI1 4UFMA 1T6BX 2IC1A 1H0BA 1PGW1 4NRPA 4CCDA 4JTNA 5FWEA 1OUSA 1CWPA 2WZR3 1IKQA 5FIXA 1MQTA 1UAIA 1RTVA 3VHPA 4PIYA 2D43A 4AEDA 3WCSA 4E2QA 1D4M2 5EFUA 3VL9A 5AC93 2WN2A 3FLPA 3ENRA 1WCQA 3IDBB 3IAPA 2JD9A 4GB31 1TMF2 1V6MA 3NAPB 1SFYA 2XUEA 1WA6X 2PHFA 2G9FA 4CUBA 4NHYA 1QQP3 4UF0A 1N1SA 5GZFA 2PXJA 4ZY9A 4C91A 2BPA2 2IUWA 3RDIA 4Q0UA 2R063 4GH4A 4UW5A 4QX2A 3K4AA 1IGOA 1JUIA 2GC2A 2DCKA 4M0HA 2A7AA 5M0TA 5A1AA 2ZKLA 3NNJA 1HX6A 4O9EA 4XJAA 5KHGA 3OTFA 4RHV2 3BTZA 1GANA 2FZ2A 3H9AA 4PLNA 4FXKB 4UOJA 4OMDA 2BERA 3DKQA 1S0BA 4URAA 1AXYA 3DV8A 2BVBA 1MEC1 1OURA 1UOGA 4Z8BA 5A3NA 3N7KA 4HKLA 1SMVA 5IVFA 2VTXA 2PLV2 1KRIA 2VMIA 2WSUA 3PJQA 2HWE2 1CAXB 4RFT0 5C8WA 1U12A 1HLCA 4XXAA 4NIDA 2ZGUA 5GALA 2Q5TA 3OUIA 1HRI3 4QQLA 1DQ0A 3SEPA 3VKLA 5BNPC 4ASMB 4CDXB 1H8TB 1YLLA 4E4DX 5FZ0A 3OJBA 1YQ2A 4DXTA 2VD7A 4IV3B 3MIGA 2Q1MA 5DMYA 1YJLA 2K9ZA 1E5SA 2ZOEB 5A80A 1JOBA 2VNGA 1DBNA 5DAPA 4FTBA 1JYCA 1QJX2 4YZ4A 3J8F2 1VBA3 4GMP3 3MW2A 2H6CA 4CU7A 5JR7B 1AL23 4X8NA 4A42A 2YBPA 4Y20A 1ZA7A 2BDRA 2C9AA 4DS0A 3BI3A 3T09A 4DRVA 2PAKA 4UBGA 3RI9A 2XH6A 1JUHA 5K8SA 2FDIA 5I8SA 3WZ1A 4AVAA 2XGXA 1G6NA 1XNAA 4GULA 3UGHA 4BQXA 1J58A 3CMGA 5T52A 2PHWA 2VY0A 1VBE2 4RQPA 2YBSA 4QX7A 3ROUA 5A3PA 1K5MC 5FZDA 2B4KA 5L19A 1VMHA 1XNCA 1W6PA 3DPRA 4XUTA 5JSRA 2XKPA 3BODA 3K51A 1OQEA 3QD6A 1W9YA 1GSLA 3RYPA 4LK7A 5HCAA 3ZN4A 2A6YA 1W2TA 1I6XA 1UXXX 3LE0A 5E8AA 1TME2 4ATEA 2KA3A 1OVPA 2W91A 1DQ4A 4QXCA 3RZGA 1EV11 2X5IC 4KH9A 3I2KA 3EJKA 3HVDA 3KD4A 1H4GA 1PM4A 3ACFA 1FPN2 1GZ9A 1YO8A 4HL0A 5FZFA 4AQSA 2BBVA 1T2XA 2ZCWA 2QQOA 3KGZA 5LEKA 2ZX4A 4LO6B 4IV1B 4AFBA 1YI9A 3A7QA 4QX5A 4BPZA 1GR3A 2UWAA 3H7YA 2P1BA 4CUAA 1D0GA 2ID4A 4YLZA 3T1MA 4WM7B 1PMHX 2ET7A 4YVSA 5DUXA 1YYNA 2OPWA 4AOCA 4MGTA 2JG8B 2PHLA 2XJVA 1YRZA 3FFZA 2Z5WA 5FPXA 3LGRA 2E7TA 1RUJ1 2YFZA 3VB9A 2VE1A 3WW2A 4AFDA 4HETA 4LA3A 4YW4A 4ZKTB 5JZGB 3NV2A 1VRH3 3D0JA 4X6RB 3A21A 4YW7A 2WO2A 5FOJB 3IPVB 3ZMOA 1R092 2ZGOA 1XYPA 3HEIA 1P8JA 4XF1A 4D6QA 2UURA 3NV1A 1Z0HA 3DCQA 5IK5A 2RDNA 5LBEA 2MHFA 4NUBA 3WUCA 4BK4A 4CP9A 1HB4A 4Y22A 2RM23 1I9RA 5CIRA 2VW1A 4BA6A 4BMEA 1VMFA 4QM9A 4EWDA 2H0BA 5FYVA 4BCUA 3SH3A 3EQEA 2W1SA 1UOJA 3LF7A 2W92A 1IKPA 2NPIA 3B94A 5D1IA 3U07A 3VBHB 1FMD2 3OGJA 5LB6A 1OKQA 1O3RA 1YQCA 5T5PA 2I2SA 3UT0A 4Z2AA 4COYA 2NN8A 4MG2A 4HPKB 4CDUA 3N35A 3AFKA 1VAKA 2WABA 3JCIA 4DO0A 3AX4A 5KXEA 4AR2A 4AHZA 2DVFA 1LHWA 4R4ZA 4S2FA 1OLQA 4UF0B 5C3OA 4IW3A 1BEV1 1JZ8A 1G9CA 1C8M3 2UYBA 3KV6A 4QPYA 5DG1A 2B46X 4FPHA 1NCRA 4QPIC 3VBUA 2Z79A 4BHPA 5JR2A 1UNBA 3WG4A 2D6LX 1ZZ7A 1W8OA 3VBOA 2LTNA 4CA9A 4XUQA 4PIZA 5FPUA 3H3UA 4YVWB 1QJY1 3OD0A 2UWCA 3JD72 4LO7A 1URXA 4BQ1A 1ZVFA 3I49A 4E2SA 2XJSA 3ON7A 5FJHA 3IZOA 5F39A 4XILA 5IAVA 3UK9A 3KF3A 4A7KA 1YQ6A 4D69A 1CGPA 5FZIA 2GNTA 1MQTC 1JS9A 1NYWA 2ZX3A 1B35B 1MS5A 3LEGA 1I5ZA 4IDZA 1GMMA 1HN0A 3FWEA 5ERLA 3C7EA 4FI9A 4CVUA 3NO8A 3D6EA 5DZGA 4FTEA 3GHMA 3O12A 2DF7A 4ZXKA 1XSRA 5FPAA 3UNPA 2V4AA 4XUPA 1CX1A 4HMZA 1MVQA 4M4RA 2BZDA 5FXZA 4HANA 5LA9A 1RHI3 1VMJA 1LJ7A 1WCDJ 5CU1A 3UL2A 2XB6C 4LBQB 2ZHLA 1V6KA 3B69A 5FY4A 2QQKA 1KS5A 1R64A 1UF2C 2P37A 2VPVA 2VCBA 4QPGA 5FLHA 4GH4C 3KM5A 5IVYA 1JYIA 2AENA 2Q30A 3SH4A 4CUCA 2Q1FA 2BFUS 2XR4A 3Q8AA 5CB7A 3FUOA 3ZOIA 1W0NA 5C4WB 4L99A 1PGL2 4P9JA 3THCA 1QMJA 2K2SA 2UYAA 4BQYA 5DDJ2 4LOTA 3BYWA 3OGGA 3W5NA 4GAZA 5L9BA 3ACIA 3PUQA 5FO8B 2OS2A 4IEUA 4ASLA 5H9RA 1LAJA 3RZLA 2DFCA 1V6LA 2RHPA 1G9FA 3KCCA 1AXZA 1L7LA 4BDVB 4ISRA 3H1YA 4XW3A 4AI2A 3MEPA 5C8CB 3THDA 4M3CE 3USUA 3VHOA 4A6SA 1AJKA 5C7GA 2OA2A 2ZMNA 4YG3A 1UW8A 2QQWA 4P02B 4RQPB 4YNIA 4Q26A 2X05A 3THPA 3WR0A 4CCMA 4KL1A 4FAGA 2BQPA 2V73A 1OA3A 3UKVA 1W6PB 2IXJA 2YFUA 1HB1A 2ZHKA 3H7JA 4F8AA 2WINB 4CPBA 5FTTC 1UL9A 4XF9A 4AK3A 3T2TA 1F8VA 2DDUA 1AUYA 4I0BA 4C8DA 5KC6A 2Q0AA 1X8MA 4Q4W3 4YYOA 3DKWA 4EQVA 1LB2A 4P14A 5C9AB 1OBNA 1LODA 2RR11 3DN7A 4YZ2A 1TVGA 5CFDB 3RZMA 3MUZ1 4LKDA 5LY2A 3NJVA 1OA4A 3KLSA 1GOHA 5FAXA 3RPQA 4A4AA 2A75A 1A78A 1AR92 4CCJA 1UU4A 4XDQA 3JBG2 1DGLA 3BU0A 2GP3A 3AYDA 4DIQA 3T1LA 1PMJX 3RZHA 1ULOA 1W8ZA 4M0NA 5JCTA 4OI1A 4QQOA 2GU9A 1HW5A 1MVEA 4JGZB 5E6HA 3NJZA 2YC2A 3TBDA 5IUQA 2HJIA 2IVIB 3ZFFB 1UMHA 4Z2WA 1W6OB 2V09A 4YM1A 2C4XA 1JMUB 3PIJA 1F15A 4M3CB 4N90A 3UYJA 1GZWA 4Q4X2 3DPRC 4LHLA 3WQ7A 1XE0A 1W6QA 1O6UA 1JXNA 4HOOA 1LGBA 3C3VA 4JRAA 4YFWA 1VJ2A 2JG9A 4FOQA 4LOSA 2QQUA 3GJBA 2OT7A 2YGLA 4UFLA 1JN2P 2G19A 4XXPA 4DXSA 2ORZA 3O1MA 2C0ZA 2C1FA 1ASJ3 3THTA 3UGGA 3AC0A 1AR62 3VHRA 4XF4A 4P9IA 2WWUA 2HWF1 4CP9B 3VD9A 4Y22B 2YYOA 5JAXA 1FV3A 2QTWB 4OHWA 3FBMA 3KQRA 1XRUA 3O0WA 1PMIA 4QDQA 3KB5A 3K46A 4O7XA 1Z7S2
chains in the Genus database with same CATH topology
3W5MA 1UY1A 3NQHA 1L7RA 1CZSA 4P08A 4DEVA 2EIBA 1CZVA 3CKHA 4ET7A 3OEBA 3PUIA 2ZEWA 3HNYM 1GQPA 3VDBA 1OT5A 4UI9L 2XHNA 1IQDC 4E8DA 3J7HA 2VZRA 4JKLA 3VD5A 2Y6HA 4ZZ8A 3I3EA 3LPFA 3VD7A 3VD3A 4BXSV 4QX3A 1JYXA 4OMCA 3OB8A 1RYYA 2W46A 3NRUA 3U37A 3I3DA 4LQRA 5G05L 1W9SA 2OKXA 4PT6A 3VD4A 5IFTA 4KWUA 1D7PM 2VTFA 3WF0A 2W47A 3NNGA 4PQQA 5G04L 4DEQA 2ZEYA 4M4PA 3OBAA 3CQOA 1BHGA 1PX3A 3UETA 2WN3A 2VO5A 2W3JA 3I2IA 3T0BA 2W9XA 3OGSA 4CU9A 4XURA 3HN3A 2CDPA 2DCJA 1UWWA 2E31A 3GM8A 5JMOA 1UY0A 3C7OA 3WNKA 2Y64A 4A41A 1DYOA 5EJZB 2J1AA 1JYVA 3C7GA 2XQXA 3F2ZA 1LNSA 1DP0A 4JX0A 1NUKA 2XOMA 3ZM8A 2C9KA 2WDBA 1K3IA 1XPWA 1NKGA 1UY3A 1I5PA 4JKMA 4DUVA 2QQJA 3ACGA 4HG6B 4QDRA 2Y6KA 2VZOA 2W95A 2QBXA 3T2QA 1OD3A 3C8XA 1ULPA 2R7EB 2YG0A 1GNYA 3C7HA 3OG2A 4QB2A 1EUTA 3FHAA 4CU8A 3K4ZA 2W94A 4D0QA 5LA0A 5CYYA 4A44A 2VQUA 5B4XA 5EJ1B 1JZ3A 5JXGA 4W8JA 2YC4A 5JXJA 2J7MA 3I2FA 4A3ZA 2WUHA 4BJ0A 3VDCA 2JKXA 2WQ8A 2J1TA 2VCCA 2VQTA 3DYMA 3MV01 5F7UA 1O8SA 1K45A 1JZ2A 3CDZB 3WNPA 3E1F1 1GUIA 4DUXA 4MGQA 2RJ2A 2ZXQA 4OUEA 4UAPA 4KI5M 5LA1A 2L9LA 4ARXA 3FN9A 1UZ0A 2VCAA 4OZOA 3PUHA 2WN2A 5IYYA 1UYZA 1WCQA 3IAPA 2JD9A 3T2OA 2WO1A 3K77A 1H6YA 3HPNA 1JZ5A 2W1QA 2XONA 5JUVA 1WKYA 3HOBA 4CUBA 2HLEA 4ZY9A 3WNLA 4AAXA 3I2HA 5DN2A 4QX2A 3K4AA 4DUWA 2DCKA 3T2PA 1MPXA 5A1AA 5HPOA 4A45A 3HJRA 3ETPA 3GXUA 5I0DA 4QB1A 4UOJA 4OMDA 2BERA 2Y6GA 3T0AA 1UYXA 1JZ7A 3EYPA 3SKVA 2E26A 3SEEA 2CDOA 3WNNA 2Y8KA 5EIYB 4D8MA 3FL7A 2BBAA 2VZSA 3MBWA 2J1SA 2J22A 1UY4A 3WF4A 3SEPA 3WF3A 1TG7A 5LCWL 4LHSA 3A22A 1YQ2A 4DXTA 4A6OA 5IFPA 3I3BA 5DMYA 3UESA 5JXHA 2J1EA 2VM9A 1K12A 4XZUG 3BN6A 1OF3A 4CU7A 4A42A 4LKSA 3T08A 3T09A 4E8CA 3FHQA 1PX4A 1F4AA 1W9TA 1XNAA 1J84A 3CMGA 1JU3A 1JU4A 5J1XA 3T0DA 3CIHA 5C71A 1GU3A 2B4KA 1J83A 3LQCA 4XUTA 1XC6A 3IDAA 3LE0A 1UXXX 2EICA 5IHRA 2W91A 2VMDA 2VZ1A 1UXZA 2VZTA 3MUY1 2VMFA 1US3A 3I2KA 3ACFA 1NAEA 2VZUA 1T2XA 1JI6A 2QQOA 4JKKA 2QQMA 3JXSA 3A7QA 2WZ8A 3ECQA 2VMCA 4CUAA 4QPWA 1H6XA 2ID4A 1PMHX 5C70A 4CU6A 4W50A 1GOGA 4AG4A 2YFZA 3ABZA 2J1UA 3A21A 2EIEA 2WO2A 3HEIA 1P8JA 2C26A 5IJRA 4BK4A 1UY2A 1US2A 1O59A 4XVHA 3P1IA 3C7FA 4QX1A 2KD7A 3P6BA 4BK5A 2W1SA 3HNMA 2E33A 2W92A 1W9WA 5B4NA 1L7QA 2W1UA 4QDSA 2VC9A 4QAWA 3CZUA 3LPGA 4Z2AA 2W5FA 3IAQA 4GWJA 1JHJA 4RN5A 3WF1A 3WNMA 3WQBA 2BGOA 2WABA 3LEKA 1JZ6A 2ZEZA 2ORXA 2VZVA 4MO3M 2Y6LA 1JZ8A 1OH4A 3I2GA 4XUOA 5JR2A 2QQLA 2WZEA 1W8OA 4XUNA 5LA2A 4XUQA 3DYPA 3CZJA 2WBKA 1KGYA 4MOAA 3DECA 2JDAA 1JZ4A 3NJXA 2VZQA 4DXRA 3OGRA 4LPLA 3LEGA 1JYWA 2V5DA 1GMMA 3HNBM 1UX7A 3C7EA 3A23A 4FI9A 4GZ9A 4KMQA 4CVUA 2YB7A 1W99A 3VDAA 4YPJA 3UNPA 1CX1A 4XUPA 4M4RA 2BZDA 2RVAA 4OYUA 5FUIA 1CIYA 2BGPA 2WAOA 2QQKA 1R64A 3K75B 2VCBA 3K4DA 4TTGA 1OF4A 2X10A 4CUCA 5CZKA 1W0NA 3THCA 1NX9A 2VJXA 2X09A 1SDDB 4P00B 2Z4FA 4GWIA 4JHZA 3W5NA 1CZTA 2WO3A 3SKJE 1UMIA 3ACIA 2LW8A 3I2JA 5DQ0A 4TXWA 4IUGA 4BDVB 2VZPA 3BGAA 2W87A 2RV9A 4P5YA 3THDA 5C7GA 3GGLA 4PF1A 5DPNA 4P02B 4W4ZA 2X05A 1SHWB 1EUUA 2WYSA 4MGSA 2YFUA 3WSOA 3IIIA 2ZEXA 4QX0A 4QB6A 2DDUA 2Y6JA 5HXMA 2VZ3A 1UYYA 1TVGA 1KEXA 1O8PA 3DYOA 2J1RA 3MUZ1 2J1VA 3NJVA 3GDBA 4A4AA 1GOHA 1JYNA 3MO4A 3IB3A 3WF2A 2QQNA 2VL4A 2VR4A 2WAAA 1PMJX 2EIDA 2JE8A 1GOFA 1ULOA 3OGVA 1W8NA 2VMEA 3MV11 3LEIA 2YC2A 3ACHA 3WEZA 3WNOA 1UMHA 1F4HA 5JXIA 2C4XA 2V72A 2VOTA 3EB7A 2V4VA 3D3AA 3OEAA 2LS6A 1DLCA 4DXSA 2QQIA 2ORZA 1XNTA 2E32A 2PQSA 4RYDA 4ZXEA 1K42A 3AC0A 1HN1A 3I97A 2B9VA 1SG3A 4ARYA 4L0PA 3VD9A 4ZZ5A 4QDQA 3K46A 4MADA 2HYXA 2W1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5M A;  1UY1 A;  3NQH A;  1L7R A;  1CZS A;  4P08 A;  4DEV A;  2EIB A;  1CZV A;  3CKH A;  4ET7 A;  3OEB A;  3PUI A;  2ZEW A;  3HNY M;  1GQP A;  3VDB A;  1OT5 A;  4UI9 L;  2XHN A;  1IQD C;  4E8D A;  3J7H A;  2VZR A;  4JKL A;  3VD5 A;  2Y6H A;  4ZZ8 A;  3I3E A;  3LPF A;  3VD7 A;  3VD3 A;  4BXS V;  4QX3 A;  1JYX A;  4OMC A;  3OB8 A;  1RYY A;  2W46 A;  3NRU A;  3U37 A;  3I3D A;  4LQR A;  5G05 L;  1W9S A;  2OKX A;  4PT6 A;  3VD4 A;  5IFT A;  4KWU A;  1D7P M;  2VTF A;  3WF0 A;  2W47 A;  3NNG A;  4PQQ A;  5G04 L;  4DEQ A;  2ZEY A;  4M4P A;  3OBA A;  3CQO A;  1BHG A;  1PX3 A;  3UET A;  2WN3 A;  2VO5 A;  2W3J A;  3I2I A;  3T0B A;  2W9X A;  3OGS A;  4CU9 A;  4XUR A;  3HN3 A;  2CDP A;  2DCJ A;  1UWW A;  2E31 A;  3GM8 A;  5JMO A;  1UY0 A;  3C7O A;  3WNK A;  2Y64 A;  4A41 A;  1DYO A;  5EJZ B;  2J1A A;  1JYV A;  3C7G A;  2XQX A;  3F2Z A;  1LNS A;  1DP0 A;  4JX0 A;  1NUK A;  2XOM A;  3ZM8 A;  2C9K A;  2WDB A;  1K3I A;  1XPW A;  1NKG A;  1UY3 A;  1I5P A;  4JKM A;  4DUV A;  2QQJ A;  3ACG A;  4HG6 B;  4QDR A;  2Y6K A;  2VZO A;  2W95 A;  2QBX A;  3T2Q A;  1OD3 A;  3C8X A;  1ULP A;  2R7E B;  2YG0 A;  1GNY A;  3C7H A;  3OG2 A;  4QB2 A;  1EUT A;  3FHA A;  4CU8 A;  3K4Z A;  2W94 A;  4D0Q A;  5LA0 A;  5CYY A;  4A44 A;  2VQU A;  5B4X A;  5EJ1 B;  1JZ3 A;  5JXG A;  4W8J A;  2YC4 A;  5JXJ A;  2J7M A;  3I2F A;  4A3Z A;  2WUH A;  4BJ0 A;  3VDC A;  2JKX A;  2WQ8 A;  2J1T A;  2VCC A;  2VQT A;  3DYM A;  3MV0 1;  5F7U A;  1O8S A;  1K45 A;  1JZ2 A;  3CDZ B;  3WNP A;  3E1F 1;  1GUI A;  4DUX A;  4MGQ A;  2RJ2 A;  2ZXQ A;  4OUE A;  4UAP A;  4KI5 M;  5LA1 A;  2L9L A;  4ARX A;  3FN9 A;  1UZ0 A;  2VCA A;  4OZO A;  3PUH A;  2WN2 A;  5IYY A;  1UYZ A;  1WCQ A;  3IAP A;  2JD9 A;  3T2O A;  2WO1 A;  3K77 A;  1H6Y A;  3HPN A;  1JZ5 A;  2W1Q A;  2XON A;  5JUV A;  1WKY A;  3HOB A;  4CUB A;  2HLE A;  4ZY9 A;  3WNL A;  4AAX A;  3I2H A;  5DN2 A;  4QX2 A;  3K4A A;  4DUW A;  2DCK A;  3T2P A;  1MPX A;  5A1A A;  5HPO A;  4A45 A;  3HJR A;  3ETP A;  3GXU A;  5I0D A;  4QB1 A;  4UOJ A;  4OMD A;  2BER A;  2Y6G A;  3T0A A;  1UYX A;  1JZ7 A;  3EYP A;  3SKV A;  2E26 A;  3SEE A;  2CDO A;  3WNN A;  2Y8K A;  5EIY B;  4D8M A;  3FL7 A;  2BBA A;  2VZS A;  3MBW A;  2J1S A;  2J22 A;  1UY4 A;  3WF4 A;  3SEP A;  3WF3 A;  1TG7 A;  5LCW L;  4LHS A;  3A22 A;  1YQ2 A;  4DXT A;  4A6O A;  5IFP A;  3I3B A;  5DMY A;  3UES A;  5JXH A;  2J1E A;  2VM9 A;  1K12 A;  4XZU G;  3BN6 A;  1OF3 A;  4CU7 A;  4A42 A;  4LKS A;  3T08 A;  3T09 A;  4E8C A;  3FHQ A;  1PX4 A;  1F4A A;  1W9T A;  1XNA A;  1J84 A;  3CMG A;  1JU3 A;  1JU4 A;  5J1X A;  3T0D A;  3CIH A;  5C71 A;  1GU3 A;  2B4K A;  1J83 A;  3LQC A;  4XUT A;  1XC6 A;  3IDA A;  3LE0 A;  1UXX X;  2EIC A;  5IHR A;  2W91 A;  2VMD A;  2VZ1 A;  1UXZ A;  2VZT A;  3MUY 1;  2VMF A;  1US3 A;  3I2K A;  3ACF A;  1NAE A;  2VZU A;  1T2X A;  1JI6 A;  2QQO A;  4JKK A;  2QQM A;  3JXS A;  3A7Q A;  2WZ8 A;  3ECQ A;  2VMC A;  4CUA A;  4QPW A;  1H6X A;  2ID4 A;  1PMH X;  5C70 A;  4CU6 A;  4W50 A;  1GOG A;  4AG4 A;  2YFZ A;  3ABZ A;  2J1U A;  3A21 A;  2EIE A;  2WO2 A;  3HEI A;  1P8J A;  2C26 A;  5IJR A;  4BK4 A;  1UY2 A;  1US2 A;  1O59 A;  4XVH A;  3P1I A;  3C7F A;  4QX1 A;  2KD7 A;  3P6B A;  4BK5 A;  2W1S A;  3HNM A;  2E33 A;  2W92 A;  1W9W A;  5B4N A;  1L7Q A;  2W1U A;  4QDS A;  2VC9 A;  4QAW A;  3CZU A;  3LPG A;  4Z2A A;  2W5F A;  3IAQ A;  4GWJ A;  1JHJ A;  4RN5 A;  3WF1 A;  3WNM A;  3WQB A;  2BGO A;  2WAB A;  3LEK A;  1JZ6 A;  2ZEZ A;  2ORX A;  2VZV A;  4MO3 M;  2Y6L A;  1JZ8 A;  1OH4 A;  3I2G A;  4XUO A;  5JR2 A;  2QQL A;  2WZE A;  1W8O A;  4XUN A;  5LA2 A;  4XUQ A;  3DYP A;  3CZJ A;  2WBK A;  1KGY A;  4MOA A;  3DEC A;  2JDA A;  1JZ4 A;  3NJX A;  2VZQ A;  4DXR A;  3OGR A;  4LPL A;  3LEG A;  1JYW A;  2V5D A;  1GMM A;  3HNB M;  1UX7 A;  3C7E A;  3A23 A;  4FI9 A;  4GZ9 A;  4KMQ A;  4CVU A;  2YB7 A;  1W99 A;  3VDA A;  4YPJ A;  3UNP A;  1CX1 A;  4XUP A;  4M4R A;  2BZD A;  2RVA A;  4OYU A;  5FUI A;  1CIY A;  2BGP A;  2WAO A;  2QQK A;  1R64 A;  3K75 B;  2VCB A;  3K4D A;  4TTG A;  1OF4 A;  2X10 A;  4CUC A;  5CZK A;  1W0N A;  3THC A;  1NX9 A;  2VJX A;  2X09 A;  1SDD B;  4P00 B;  2Z4F A;  4GWI A;  4JHZ A;  3W5N A;  1CZT A;  2WO3 A;  3SKJ E;  1UMI A;  3ACI A;  2LW8 A;  3I2J A;  5DQ0 A;  4TXW A;  4IUG A;  4BDV B;  2VZP A;  3BGA A;  2W87 A;  2RV9 A;  4P5Y A;  3THD A;  5C7G A;  3GGL A;  4PF1 A;  5DPN A;  4P02 B;  4W4Z A;  2X05 A;  1SHW B;  1EUU A;  2WYS A;  4MGS A;  2YFU A;  3WSO A;  3III A;  2ZEX A;  4QX0 A;  4QB6 A;  2DDU A;  2Y6J A;  5HXM A;  2VZ3 A;  1UYY A;  1TVG A;  1KEX A;  1O8P A;  3DYO A;  2J1R A;  3MUZ 1;  2J1V A;  3NJV A;  3GDB A;  4A4A A;  1GOH A;  1JYN A;  3MO4 A;  3IB3 A;  3WF2 A;  2QQN A;  2VL4 A;  2VR4 A;  2WAA A;  1PMJ X;  2EID A;  2JE8 A;  1GOF A;  1ULO A;  3OGV A;  1W8N A;  2VME A;  3MV1 1;  3LEI A;  2YC2 A;  3ACH A;  3WEZ A;  3WNO A;  1UMH A;  1F4H A;  5JXI A;  2C4X A;  2V72 A;  2VOT A;  3EB7 A;  2V4V A;  3D3A A;  3OEA A;  2LS6 A;  1DLC A;  4DXS A;  2QQI A;  2ORZ A;  1XNT A;  2E32 A;  2PQS A;  4RYD A;  4ZXE A;  1K42 A;  3AC0 A;  1HN1 A;  3I97 A;  2B9V A;  1SG3 A;  4ARY A;  4L0P A;  3VD9 A;  4ZZ5 A;  4QDQ A;  3K46 A;  4MAD A;  2HYX A;  2W1W A; 
#chains in the Genus database with same CATH topology
 4Q29 A;  3IT8 A;  4JHT A;  4SLI A;  3W5M A;  3NQH A;  1RUF 3;  2OQ7 A;  1FV2 A;  2BYV E;  2PHX A;  4FOV A;  1RUD 3;  3B7M A;  5JMC A;  2NM1 A;  3N9Q A;  4Y1V A;  1OSG A;  5A6Y A;  5A6Z A;  3QH6 A;  1OFN A;  4PI0 A;  2ZEW A;  2UY9 A;  4YVS C;  5HXV A;  3WD5 A;  1Q8V A;  2P3K A;  2VOV A;  2Z42 A;  1PGS A;  2CNA A;  3B01 A;  4ZS3 A;  3VDD C;  1ENS A;  1W2O A;  4CEW C;  4NAO A;  1XBF A;  5I93 A;  5A6Q A;  1DQ6 A;  3AFG A;  1UZY A;  2MEV 1;  4I3G A;  4UW3 A;  2XHN A;  3VZO A;  3VDB A;  3RJ2 X;  4FFG A;  3S6P A;  3WNX A;  4CPB D;  1GQH A;  1Y3T A;  3X29 B;  2A6Z A;  2F6B A;  5FMD A;  3FC0 A;  3LPF A;  4WVV A;  5ACA 1;  4NRQ A;  1NY7 1;  2BW8 A;  4Q0Q A;  4ZS2 A;  2XQR A;  2CAU A;  4BXS V;  4YSF A;  3A4U A;  1POV 1;  3WP4 A;  1AR8 2;  1NCR B;  2YDE A;  4X8P A;  5FJK A;  1X7N A;  1QJF A;  1COV 3;  4NPR A;  3U37 A;  3K3N A;  2ARE A;  1RUI 2;  2D40 A;  4HK9 A;  4N43 B;  4XQD A;  5G05 L;  1PGW 2;  1R1Z A;  1W9S A;  2OKX A;  5F1R A;  1Y4W A;  4CEY B;  1UD1 A;  2P2K A;  5E89 A;  4KWU A;  1W6N A;  2VTF A;  4AFC A;  5ABJ A;  1ND3 A;  4NPL A;  4GB3 2;  1PVX A;  3MF9 A;  1NE6 A;  2G1M A;  3LDK A;  5GJ6 A;  3N3H A;  1CAW A;  1RUE 3;  1POV 0;  4FFH A;  4LJH A;  3NV3 A;  3OBA A;  1BHG A;  1C5H A;  2JIC A;  1SQ4 A;  1VBD 3;  2WN3 A;  3S5Q A;  4A7Y A;  1TQ5 A;  1EAH 1;  2W3J A;  2XVK A;  3I2I A;  4U2A A;  4UFK A;  5K0U A;  1PZ8 A;  4R9C A;  4BQ3 A;  5JIU A;  3V65 A;  4JDO A;  2WQZ C;  3A0K A;  1AR7 1;  4TSV A;  3LSD A;  1C4R A;  4NWV A;  3VBU C;  4CDW B;  3HN3 A;  2E31 A;  2H0V A;  2QFE A;  4FPC A;  3VBO C;  1DFQ A;  4LBM A;  5D8A B;  3TN9 1;  3ZO0 B;  1AYM 3;  2XVL A;  3ZDS A;  1O3Q A;  1Q8S A;  3C7O A;  2Y64 A;  4LLO A;  5J36 A;  1DYO A;  2OX0 A;  2GMM A;  2VQ0 A;  1S0J A;  1U5Z A;  1MEC 2;  2HWB 1;  4ZON A;  2YV8 A;  4CCL A;  5IVV A;  1NT0 A;  2ZTN A;  4EZ4 A;  1DP0 A;  1SDW A;  3MID A;  4IEO A;  3TYJ A;  2X53 S;  4K1Z A;  4N53 B;  4OHX A;  3H0O A;  4Z92 B;  1NCQ A;  3CU7 A;  2WC2 A;  5FZE A;  2JKB A;  1SLI A;  4QKB A;  1XOY A;  1PK6 A;  1ACC A;  1W03 A;  4BQW A;  5IK7 A;  4XQW A;  5A1F A;  1Q8O A;  1CAU A;  1S2B A;  2XKO A;  3BOP A;  1UPI A;  2GSY A;  3NKT A;  1CD3 G;  3PNA A;  4AYU A;  1M06 G;  5FOB B;  1G9B A;  4Q0V A;  1YC6 1;  1NLS A;  3FLR A;  4QPG C;  4YM2 A;  4KBZ A;  2W95 A;  2A3W A;  4MGZ E;  4LBN A;  1X9T A;  2FMD A;  1OD3 A;  2JDP A;  2WT2 A;  3C8X A;  4QM8 A;  2N7G A;  3W9A A;  3N9N A;  1E5H A;  4IXL A;  3FHA A;  4CU8 A;  2DVB A;  4C1W A;  1QXP A;  1FI2 A;  2QZ2 A;  2R04 1;  2W94 A;  3TNQ A;  1UKR A;  5ANQ A;  5FYC A;  2YRO A;  3WY6 A;  1ZZB A;  2JDU A;  5A3M A;  4RGA A;  1OPO A;  2VU9 A;  3IMN A;  3M3C A;  4N9I A;  4Q4V 3;  4RR3 B;  5DG2 A;  3WG2 A;  4A44 A;  4BQ2 A;  2BVV A;  1RUO A;  1HV1 A;  2BEO A;  5EPA A;  1EP0 A;  3ZXF A;  4YRD A;  1PVC 3;  3ZYF A;  4BQ5 A;  2XLG A;  3QOP A;  5T5L A;  4OLL A;  3WXP A;  4DPN A;  1A6C A;  3MPB A;  5JXJ A;  5FUN A;  2AH2 A;  4XFA A;  2P6C A;  2VW2 A;  1Z78 A;  4AFA A;  5F9T A;  2A6V A;  2JKX A;  1ND2 B;  2RS3 3;  2WQ8 A;  4MLO A;  2LM3 A;  4LBL A;  4MVT A;  5KXC A;  1G8W A;  3U11 A;  2CYF A;  3H3Z A;  3ZFG A;  5CKN A;  5JOX A;  2DU1 A;  3V64 A;  3I2D A;  2DV9 A;  2UY8 A;  1LOE A;  2VNO A;  3CJI C;  5FMO L;  5A32 A;  3IWZ A;  5JOW A;  3AMH A;  3CDZ B;  3WNP A;  3KF5 A;  3TEX A;  1MS0 A;  3O1R A;  1EV1 2;  4AHX A;  2ZXQ A;  2NZ9 A;  4KI5 M;  1SCS A;  1UOB A;  5A3T A;  5H9Q A;  2W68 A;  5FXX A;  4ZU7 A;  1CIW A;  1PO2 3;  1SBF A;  1SEF A;  3TB0 A;  2E6V A;  1IHM A;  3B3Q E;  3ZYP A;  1UZ0 A;  5L7O B;  1CN1 A;  2AEZ A;  2Y33 A;  2D98 A;  1WCU A;  1ENX A;  2GNB A;  3KGL A;  5IYY A;  2HWD 1;  4IE7 A;  4FT8 A;  2WII B;  2AGS A;  4XFF A;  4QKD A;  5JUV A;  1WKY A;  1H2L A;  3ES1 A;  1RUJ 2;  3ZPY A;  3H1M A;  1WW5 A;  3WNL A;  2WNO A;  1EPW A;  4YFZ A;  2JJ6 A;  3I2H A;  4XTM A;  5DN2 A;  4BWO A;  2JG9 C;  3AZX A;  4B7E A;  2PHD A;  3PHM A;  4QD2 A;  2A70 A;  4CCC A;  3PUR A;  4QU1 A;  3LA3 A;  1N47 A;  1WA4 A;  2Q8O A;  1W3X A;  5FZK A;  2O8O A;  2BWC A;  2CGN A;  4A45 A;  4AVC A;  4L97 A;  2ZGK A;  3SLI A;  5I0D A;  3VBS B;  4QB1 A;  5A33 A;  4NPM A;  3UGF A;  4HVQ A;  2Y6G A;  1YHF A;  4LNV A;  3T0A A;  3BB6 A;  5J7M A;  2XJP A;  5I0U A;  4LOR A;  2FCU A;  3U1X A;  4O65 A;  3ZX7 A;  3EO6 A;  3ASI A;  3DXT A;  3UJQ A;  4QXB A;  4TLF A;  2B8M A;  4R4X A;  3AYC A;  5F5I A;  3WNN A;  2Y8K A;  5EIY B;  1UIJ A;  2EAL A;  1W6N B;  2JEM A;  2VZS A;  4IQP A;  2ES3 A;  3HQX A;  3O14 A;  3OBR A;  1GZC A;  4MUV A;  1ZNP A;  2D6N A;  4H55 A;  3NJY A;  3VLB B;  5T3N A;  1V6N A;  4J1W A;  3ZKY A;  4LHS A;  4AVB A;  1GIC A;  1BEV 2;  4XOG A;  1PIV 3;  3ZFE B;  1YIF A;  4A6O A;  5IFP A;  2E9Q A;  1XND A;  2B45 X;  4HSJ A;  4PF5 A;  2Y60 A;  4Y1Y A;  5EJ3 A;  2O8Q A;  2VM9 A;  5FP8 A;  1AZD A;  4XZU G;  1CQ9 A;  4FPK A;  4ASK A;  1AX2 A;  2BNO A;  3GZE A;  1R1A 3;  1VLN A;  5LBB A;  3BN6 A;  4QMA A;  3CBN A;  1QJY 2;  2BOJ A;  2XLF A;  3Q8C A;  2VG9 A;  5FZ1 A;  3B9C A;  4GKY A;  3VV1 A;  5FMB A;  4DOU A;  1OF3 A;  4CXX A;  4E27 A;  4DMI A;  4LKS A;  4GXL A;  3T08 A;  5GM0 A;  4AAP A;  4E8C A;  2D6O X;  3M3E A;  4N7I A;  1ZRC A;  3FHQ A;  4L2N A;  1PX4 A;  1VRB A;  2GN7 A;  5FY7 A;  3LA2 A;  1DU3 D;  5LBC A;  1J84 A;  4CE8 A;  5ABJ C;  1ND3 C;  1AJO A;  1JU3 A;  5FYH A;  4QGM A;  4RS5 A;  2OUJ A;  4J25 A;  3NNM A;  3FJS A;  4HT1 T;  2VVE A;  4S2H A;  4F83 A;  5C5U A;  4XBN A;  2ZGP A;  3VBF A;  1VP6 A;  3M8L A;  3VKF C;  3IDA A;  1CAU B;  1W6M B;  4DIN B;  5K0U C;  4W6Y A;  2ZAA A;  4E4S A;  5ANN A;  1V9U 3;  1WGP A;  2WNU C;  4HFS A;  1UYP A;  5C3Q A;  1GNH A;  1RUC 1;  4LE4 A;  4OFG A;  1O5U A;  1PO2 1;  4Y4Y A;  4KWL A;  1MZE A;  4UT5 A;  1V6J A;  3PMS A;  2VZ1 A;  3NKG A;  3O1S A;  2UWB A;  4L92 A;  1RUH 3;  1US3 A;  3WG3 A;  4XPV A;  5AVP A;  3PME A;  3TOJ A;  4AL9 A;  4OQ8 A;  2HWC 3;  3GBW A;  5GKA C;  1R08 1;  2P17 A;  2RS1 1;  2Y38 A;  3QLQ A;  1AYN 3;  5F2W A;  2WL1 A;  1ENR A;  3J7L A;  3MFC A;  2JDM A;  1QXJ A;  1QHD A;  1U0A A;  2BNN A;  3P5B A;  3MFA A;  5C5T A;  3AJZ A;  5IK8 A;  5CKM A;  1HXS 1;  5C70 A;  1RMU 3;  2E7Q A;  1NCQ C;  1PM7 A;  3IKW A;  3LDB A;  4HBN A;  4EZH A;  1LGN A;  4LKE A;  4LLF A;  1PK6 C;  5IVJ A;  4LIV A;  2RJL A;  3KVB A;  4QPI A;  3B02 A;  1QEX A;  4FPF A;  5JVV A;  2J1U A;  3QAC A;  4XJ8 A;  1LHN A;  2EIE A;  2BWA A;  3V56 A;  3ZVX A;  4I3P A;  4QX8 A;  1Q3E A;  2BRT A;  4AVV A;  1HRV 1;  3GAL A;  4JVA A;  3S7I A;  4UYB A;  1FNY A;  2RR1 2;  5A32 B;  1IS5 A;  1W8T A;  2NMN A;  4AGG A;  1A34 A;  1LED A;  2ZMK A;  1FAY A;  3SCG A;  2ARX A;  1LOG A;  2PAE A;  5GZD A;  5F32 A;  4CUG A;  2CGP A;  4YW2 A;  4OUL A;  3WQ1 A;  4CTE A;  2QJV A;  4BLJ A;  1L7Q A;  1NQD A;  5B4N A;  2XG3 A;  2YPD A;  4QDS A;  3HIF A;  2VC9 A;  4DB5 A;  3HMY A;  3PL0 A;  4Y5T A;  2AR6 A;  2W5F A;  1GV9 A;  4PBO A;  1C1L A;  3R05 A;  3RJR A;  5HV4 A;  2FQP A;  5DUW A;  5BNP B;  2FDJ A;  1YFX A;  3WNM A;  5HBA A;  1PO1 3;  3INA A;  2BGO A;  1QY4 A;  3LEK A;  4XE9 A;  1F5J A;  2ZEZ A;  3RMX A;  3NNF A;  1E57 A;  3R4S A;  4RA0 A;  3WT3 A;  4LBJ A;  5IVC A;  1ZX5 A;  5CAD A;  2AAC A;  1CON A;  3PUA A;  4QHB A;  5A7W A;  3ZFG C;  2RS5 1;  3BAL A;  1OH4 A;  2OPK A;  4GAL A;  4HN1 A;  2PAM A;  2WS9 1;  3HWJ A;  4AEM A;  1NG0 A;  3I2G A;  3T4V A;  3J4U H;  2QDR A;  1T6G C;  4XUN A;  5LA2 A;  2HWF 2;  4W6W A;  2IXI A;  2WBK A;  3VL8 A;  1KGY A;  5FZ9 A;  4MOA A;  1BXH A;  2OYZ A;  4EN6 B;  3S0M A;  1RVF 1;  3NJX A;  1TZO A;  2DCT A;  2Y0I A;  2VZQ A;  3WDV A;  1J3Q A;  2PMW B;  1SLL A;  4V1P A;  3OGR A;  3AB0 A;  3AP7 A;  4NHK A;  1DYK A;  1RUG 1;  2WNE A;  3SCH A;  5IAX A;  2V5D A;  2XBO 2;  3P3P A;  4MXW B;  1K5M B;  2A1X A;  4JQR A;  2JWP A;  3AVR A;  1HKD A;  1V0A A;  2YB7 A;  4DZG A;  4IE4 A;  4K21 A;  5DAQ A;  3ILN A;  1NXM A;  3OYW A;  4PLM A;  4MSV A;  4XAA A;  2EF6 A;  1JOP A;  1ZZ9 A;  2MEV 2;  4NRM A;  5FUI A;  4AEJ A;  2DCZ A;  2R07 3;  2BGP A;  2RDR A;  4JGY A;  1N3Q A;  3I4I A;  3M7A A;  1RB8 G;  5LBF A;  3DGT A;  1MS4 A;  2A71 A;  4M01 A;  2ZBJ A;  5ACA 2;  1NY7 2;  3BIE A;  3PU8 A;  1PNF A;  2X5I B;  3MI8 A;  2PQQ A;  2XJR A;  4EN7 B;  2AC1 A;  3MGU A;  1W3V A;  2A6X A;  4XJU A;  4MHR A;  3GYD A;  1VBC 3;  2D93 A;  1O7F A;  3POF A;  3AMQ A;  2HEY F;  2Q1Z B;  1LU2 A;  5FYT A;  2CGO A;  4NN0 A;  4IUG A;  5FZO B;  3LB9 A;  3T4H B;  2R49 A;  2RV9 A;  4A3X A;  2B42 B;  2A5Z A;  3O1U A;  1BZW A;  1QJU 1;  1IPS A;  4PI2 A;  5CIS A;  5IK4 A;  5A3O A;  2JE9 A;  3OY8 B;  3URF A;  5BNN A;  3WW4 A;  4YW3 A;  1SLB A;  1FAT A;  4QT6 A;  1EAH 2;  3GZA A;  3PLQ A;  2WZR 1;  4OHZ A;  1JZ6 A;  3III A;  2VBP A;  5AC9 1;  5C3R A;  1AR7 2;  4QB6 A;  1S0F A;  3WW1 A;  1BK1 A;  3WIN E;  4YM0 A;  4A2U A;  1UYY A;  3O1O A;  1DQ1 A;  4MGY E;  4Q0S A;  3TN9 2;  1KEX A;  3DYO A;  1NA1 A;  2ZX2 A;  1G7Y A;  5FZA A;  3EBR A;  4Q4Y 3;  1QQP 1;  3GBG A;  3OF1 A;  1ONA A;  2RDS A;  3MO4 A;  2EAA A;  4IV3 C;  1FX5 A;  3WF2 A;  1UZW A;  3ZXL A;  5KHJ A;  4KWJ A;  2HWB 2;  1VBB 3;  2R06 1;  4LBK A;  2YHJ A;  1BBT 3;  5EWS A;  2PTM A;  3PJY A;  5EYX A;  3JQW A;  1X50 A;  2W08 A;  3VDD A;  4CEW A;  5FO9 B;  1QH7 A;  4PIX A;  4YG0 A;  3IIA A;  3K48 A;  4Q8K A;  1OHF A;  3WNO A;  4RS5 C;  3JU9 A;  3AZV A;  4FP2 A;  1O4Y A;  5A6X A;  2WFF 3;  2RMU 3;  3MIE A;  4LA2 A;  3LOB A;  2CWS A;  4JDN A;  4H7M A;  4LT5 A;  5LY1 A;  2V72 A;  1UZZ A;  4IES A;  4PDW B;  3VBF C;  1YQ8 A;  4AI9 A;  4FQZ A;  3ZYJ B;  1W9F A;  5CNA A;  1V70 A;  1VB2 A;  4JV4 A;  3O1V A;  5F5C A;  1DLC A;  1NOV A;  1DZQ A;  4AFM A;  4F7Z A;  4HKO A;  1XNT A;  2PQS A;  4RYD A;  4PCR A;  2WNV A;  2DTW A;  2IXK A;  4L9B A;  4WVZ A;  1PHM A;  2R04 2;  2B7Y A;  1FOD 3;  1HRI 1;  4ZZ5 A;  2AYH A;  2OZ6 A;  2BFU L;  5FYY A;  2QQP A;  4FTS A;  1MQT B;  4AED B;  3I59 A;  4LBO A;  1ZBA 3;  5KWR A;  3L9J T;  4WZF A;  1L7R A;  1CZS A;  3P3N A;  3B9I A;  4B1L A;  5CAZ A;  2DYC A;  3PUI A;  1NZI A;  1VBA 1;  4GMP 1;  4LO4 B;  5FP4 A;  4WZC A;  3B93 A;  1JOJ A;  3IN9 A;  1AL2 1;  1QOO A;  4KBB A;  1GQP A;  1OT5 A;  4GH4 B;  1BVP 1;  2ZAH A;  3J7H A;  3OPZ A;  4XIK A;  5FR3 A;  1DLL A;  3VD7 A;  5K7P A;  4BM8 A;  1DHK B;  2PA7 A;  2BP6 A;  5A7W B;  1D4M 3;  1YQ5 A;  3T30 A;  4OCT A;  1SFN A;  3ZN6 A;  1TMF 3;  3MF6 A;  4OMC A;  1DDL A;  4RFR B;  1RYY A;  3POS A;  3NRU A;  5GLU A;  4GMP 0;  4FPL A;  3I3D A;  1HQL A;  1WLW A;  2CSG A;  4PT6 A;  3AYE A;  5IFT A;  3AXE A;  1GZT A;  5FZL A;  5LZ6 A;  2HWD 2;  4JC1 A;  3ZSE A;  4E2G A;  5G04 L;  4CCE A;  5FY8 A;  3CO2 A;  2EXI A;  3QH7 A;  5HCH A;  1W8H A;  2JX9 A;  4AHY A;  1AVB A;  5FK7 A;  4RHV 3;  5FZ3 A;  1JTZ X;  3UET A;  1QNY A;  3OD4 A;  1F5F A;  2VO5 A;  2HH9 A;  3E97 A;  4AVT A;  4B8E A;  2RG4 A;  3S7E A;  3RYK A;  1UX6 A;  1N1T A;  1OA2 A;  2ARC A;  4IE6 A;  2PLV 3;  5AVA A;  5FYS A;  4EN9 B;  4FOY A;  2DCJ A;  2JEC A;  5JI9 A;  5BV6 A;  4WVM A;  1D0H A;  1ZZ6 A;  2HWE 3;  5LRR A;  3GM8 A;  3WP3 A;  3I3Q A;  5JMO A;  4Y20 B;  1HQW A;  4FPE A;  1UY0 A;  1S2E A;  3VHN A;  3D4K A;  1NZC A;  2D97 A;  3M3I A;  1DGW A;  2R16 A;  5EJZ B;  1VRH 1;  4BIO A;  1N1V A;  1JYV A;  1MS9 A;  3E6C C;  3C7G A;  5FZG A;  5D21 A;  2ZZQ A;  3GCX A;  3F2Z A;  3C2U A;  4HK8 A;  5FXV A;  3FZ3 A;  3VBR A;  2FD8 A;  4COU A;  2RM2 1;  1QJX 3;  1ZBE 2;  2HEW F;  3DPR B;  3J8F 3;  2CAV A;  2BUK A;  3N7M A;  5GLV A;  3ZM8 A;  5C33 A;  4IEQ A;  4GD4 A;  3CJI A;  5GZE A;  1C3H A;  1UY3 A;  4DUV A;  4JKM A;  1WBL A;  2QQJ A;  4JGY C;  5F6L B;  4QDR A;  2H6B A;  3ZSM A;  3JB8 A;  3ORJ A;  3T2Q A;  1H9P A;  5FMC A;  2ZGN A;  1SLC A;  4AHW A;  4AQT A;  1ULP A;  3C7H A;  2C24 A;  3OG2 A;  4UW6 A;  1YNA A;  3WDT A;  1VBE 3;  5DAB A;  4AEK A;  4BQ4 A;  1F9K A;  1MZ6 A;  1Q8Q A;  4Q1P A;  4XAE A;  3IBM A;  3M70 A;  2YC0 A;  3OCP A;  3E6D A;  4WM8 A;  5CYY A;  3QBQ A;  2F4L A;  1BK0 A;  1WD3 A;  2TBV A;  1C8M 1;  1NXD 1;  5KR7 A;  2R1B A;  5F3C A;  3LEM A;  3RZJ A;  4W8J A;  4YVS B;  1O3S A;  2YC4 A;  1ZZC A;  5I0S A;  1TME 3;  3VDD B;  4CEW B;  4C0H A;  2KXL A;  2Q8D A;  5JOY A;  2J7M A;  4WVW A;  1DQ5 A;  4BJ0 A;  1O5L A;  1UN1 A;  3G6J B;  3RZK A;  3POE A;  4R8H A;  1FPN 3;  5BNN C;  1GYK A;  3WG1 A;  3H42 B;  3ZSJ A;  2QE3 A;  1GP6 A;  5FPB A;  5F7U A;  1CAV A;  2ZHM A;  1O8S A;  1K45 A;  4ISQ A;  1RUC 2;  2LAL A;  3L2H A;  4XBL A;  4ONU A;  3H50 A;  3O1P A;  5BYN A;  5JIA A;  4E9K A;  2ILM A;  4MV2 A;  4EE2 A;  4DUX A;  3AKR A;  3KHC A;  4JCK A;  2R32 A;  4CZS A;  4N7U A;  1H30 A;  1NA1 C;  4O9G A;  3WLU A;  5LA1 A;  1YFW A;  1RHI 1;  3AVS A;  2YU1 A;  3LFM A;  3WW3 A;  1GP4 A;  4ARX A;  4QWN A;  1R08 2;  2RS1 2;  3J7M A;  4P5H A;  5KHK A;  2VCA A;  1R09 3;  3PUH A;  2DUR A;  4R9D A;  3RYR A;  4IL7 A;  1I3H A;  1UU5 A;  3GNE A;  4CDU B;  1HXS 2;  1OFS A;  3B00 A;  3T2O A;  2WO1 A;  5HCF A;  3K77 A;  1H6Y A;  1JZ5 A;  2W1Q A;  2WT1 A;  1E5R A;  2VQA A;  2FDG A;  4FPG A;  3AZZ A;  1ZYB A;  2KR2 A;  2IXL A;  5FCC A;  3SQO A;  5J96 B;  1OUX A;  4MXV A;  3ZDV A;  4B7K A;  4AE2 A;  3O1T A;  2CV6 A;  4AAX A;  4IER A;  3VBU B;  2FDH A;  2VVF A;  5LAS A;  1FMD 3;  1HRV 2;  1LRH A;  3VBO B;  2JDZ A;  5J37 A;  3T2P A;  1IQA A;  1W0P A;  4TZD A;  1C1F A;  4CP2 A;  2GZW A;  2P3I A;  2G4I A;  4ITC A;  1JYT A;  2CHH A;  2WNV C;  3ETP A;  3MLL A;  5FBZ A;  3GXU A;  2NP0 A;  4XC9 A;  1IS6 A;  1J1T A;  3M2M A;  3POB A;  4BU2 A;  1DGW X;  3VZK A;  1HB3 A;  3O0X A;  2D6P A;  3RWK X;  3AMM A;  3ZN5 A;  3SKV A;  3VGI A;  4YW6 A;  2E26 A;  2CDO A;  1KJL A;  3ZSK A;  2JB4 A;  5APA A;  4P9W A;  1H2M A;  4D8M A;  2B5H A;  4D6R A;  4Q4W 1;  1JYN A;  5LRS A;  4WBB A;  1QOS A;  3JZV A;  4I30 A;  5A3W A;  4TWT A;  3ZYB A;  5A1L A;  4Y3O A;  3I2O A;  1MAC A;  1VAV A;  5FYU A;  2J22 A;  4CRQ A;  2Z2S B;  2WNU A;  3WF4 A;  3D82 A;  3JD7 3;  3AL6 A;  4QPG B;  1RJ8 A;  1LEC A;  1TG7 A;  1WW4 A;  4P9L A;  4Y1X A;  3KV5 A;  1VBE 1;  4B4Q A;  5JSP A;  2VVD A;  2JDY A;  4PQ9 A;  1MS1 A;  5LCW L;  2RS5 2;  4L11 A;  5FQ0 A;  4TN7 A;  2GME A;  3UES A;  5JXH A;  2J1E A;  2WS9 2;  1K12 A;  4HVO A;  5F8P A;  4NMI A;  4IET A;  1RIT A;  1ZRD A;  2VTX J;  4HN0 A;  1U5I A;  1RVF 2;  4WVM B;  4IND A;  2WLQ A;  1LU1 A;  4EJR A;  2Y6F A;  1J3P A;  1RUG 2;  4PBP A;  2XL9 A;  5FZ7 A;  4EWE A;  2BJS A;  2VNR A;  2VXR A;  4XJW A;  3USU B;  1JHN A;  2YUE A;  1ASJ 1;  2GC3 A;  4COW A;  2D5F A;  2PHU A;  1S0C A;  3CIH A;  2GP5 A;  1U5X A;  1SZB A;  2XJU A;  4OUM A;  4UWD A;  5F2S A;  3SH5 A;  1J83 A;  3POG A;  3AP9 A;  4CEY C;  4KNC A;  2B39 A;  1YI7 A;  1ZRI A;  5DDJ 3;  1Q56 A;  3O5S A;  5A70 A;  1H1A A;  2WLP A;  4ZHN A;  1HB2 A;  3CJI B;  1DGR N;  5BY5 A;  1IS3 A;  2BU9 A;  1X8E A;  2XVG A;  1AHS A;  1RUF 1;  2JDH A;  1RUD 1;  2D6M A;  1OLM A;  2EIC A;  4K3U A;  5IHR A;  3ELN A;  1NLQ A;  4XMA A;  5FK8 A;  3V0A A;  4ZU5 A;  1IS4 A;  3N7J A;  3Q8B A;  3TEW A;  1D4V B;  5T5J A;  1HIX A;  1K5J A;  5IWF A;  1UXZ A;  4C1X A;  3MUY 1;  2VMF A;  2XHK A;  4BOW A;  5A3L A;  2A73 B;  3AKS A;  1C57 A;  3DF0 A;  3LFI A;  4K1Y A;  3H8X A;  2KM2 A;  2VZU A;  1JI6 A;  2I45 A;  2QNK A;  4JKK A;  4CCO A;  4FFI A;  1CJD A;  1UCX A;  3JXS A;  4OVE A;  2IFR A;  4V2V A;  4FFF A;  3U78 A;  3OBZ A;  1GLH A;  3ECQ A;  2VMC A;  3VBR C;  1CR7 A;  5F37 A;  4Y24 A;  1H6X A;  3AK0 A;  1WLC A;  3ETQ A;  1ULG A;  4LO8 A;  5CKQ A;  1DQ2 A;  1MS8 A;  2EXH A;  4IGP A;  1QJU 2;  4CU6 A;  2P6H A;  2R1D A;  4W50 A;  1COV 1;  1GZW B;  1W6Q B;  1CVN A;  1GOG A;  4AG4 A;  5GLT A;  2XXZ A;  2YGM A;  4XJ9 A;  3WVJ A;  2JG9 B;  3ABZ A;  3ZR6 A;  4C0B A;  1W06 A;  1REF A;  4CDQ A;  1SLT A;  1AR9 3;  2WZR 2;  3T0D A;  1QKQ A;  3JBG 3;  1OLR A;  1FXZ A;  3WHT A;  5AC9 2;  5FY9 A;  4AF9 A;  1XE8 A;  2PHR A;  3ZXG A;  3LIG A;  3PVB B;  1US2 A;  1RUE 1;  2TEP A;  4XVH A;  3P1I A;  2B9U A;  3C7F A;  3SC7 X;  3WUD A;  4QX1 A;  5A7O A;  2KD7 A;  1BCX A;  1QQP 2;  5FP9 A;  4BK5 A;  1KD7 A;  1V00 A;  3AP4 A;  3HNM A;  5FZM A;  1VBD 1;  2NYY A;  2EAK A;  4Q4X 3;  1HDK A;  1HJF A;  1W9W A;  2R06 2;  4LUL A;  4COZ A;  4WM8 C;  4YZ5 A;  2Z69 A;  4XF0 A;  3ITQ A;  5FYB A;  5GZG A;  2IZW A;  3S5A A;  3SHR A;  1RUN A;  1WUV A;  3CZU A;  3WX5 A;  4D6S A;  4GWJ A;  3BIW E;  2G9G A;  3AP6 A;  4OI4 A;  4ES9 A;  4QQP A;  1AR6 3;  5JLV A;  1AYM 1;  3NAP A;  5FZH A;  1UU6 A;  4RD7 A;  2JE7 A;  2YMZ A;  4NWW A;  1OOP C;  5CEH A;  2VZV A;  3WDY A;  3H3L A;  3ZXK A;  5JPN B;  1OI6 A;  4MO3 M;  4XHX A;  3ZYH A;  4AI0 A;  2HBU A;  1Z7S 3;  1OD5 A;  4OHV A;  3LKJ A;  3R4D B;  4B4R A;  4R9A A;  2QKD A;  3E5U A;  2QQL A;  1ND2 C;  3RWN A;  3HT2 A;  3QCW A;  1LHO A;  3HAG A;  4KGQ A;  2I74 A;  4BIF A;  3IDC B;  1HRI 2;  2ZJC A;  3CZJ A;  1QDC A;  3FUQ A;  2EXK A;  3WDU A;  4P9G A;  1JZ4 A;  4XBQ A;  4EWA A;  2ZGT A;  2E63 A;  4DXR A;  3N9P A;  4U36 A;  5ABJ B;  1ND3 B;  1KDM A;  4LIU A;  4LPL A;  2AEY A;  5CFC C;  1POQ A;  5KXD A;  3HNB M;  1UX7 A;  2C5D A;  1CAW B;  1N3P A;  2J42 A;  2YBK A;  4MET A;  3A23 A;  4GZ9 A;  5I0T A;  4KMQ A;  3UJO A;  1VBA 2;  3N9O A;  3VDA A;  4MGI E;  4YPJ A;  1AR8 3;  1IG0 A;  4BZ4 A;  5FLI A;  1TE1 B;  1CAX A;  2Y0O A;  1AL2 2;  2Y26 A;  1JW6 A;  3GCW A;  1XU2 A;  5K0U B;  1F35 A;  2P3Y A;  1H8V A;  5ISL A;  1RUI 3;  4QQ2 A;  2D44 A;  4Q4V 1;  1SLA A;  3ES4 A;  2XPJ A;  4XFC A;  3WDW A;  4FAH A;  4CDX A;  1H8T A;  5FO7 B;  1BQP A;  1OF4 A;  1PVC 1;  5KHI A;  3MPP G;  1X9P A;  4IV3 A;  5FZB A;  1W90 A;  1QH6 A;  5CZK A;  3WOG A;  4GB3 3;  4M00 A;  1JH5 A;  2MPF A;  4HVR A;  3MLK A;  1XNK A;  1ALY A;  2VJX A;  4XCA A;  4DXZ A;  2CU5 A;  3MZH A;  2RS3 1;  2NQY A;  1XQN A;  3ILR A;  1SDD B;  4P00 B;  1JBC A;  2OVU A;  4JHZ A;  1IOA A;  4QGL A;  1C28 A;  1CZT A;  2WO3 A;  3SKJ E;  1UMI A;  4P9Y A;  3ZYR A;  3U0Z A;  5BNO C;  1BLZ A;  1BVV A;  3HR9 A;  1GBG A;  1OMI A;  4TXW A;  1ODM A;  5DAW A;  1NCQ B;  1QF3 A;  2VZP A;  3BGA A;  3Q8F A;  5JOZ A;  5IVE A;  1PK6 B;  1Q5O A;  3GHN A;  4UFJ A;  4QU2 A;  4Z07 A;  4B29 A;  3HD8 B;  4PF1 A;  2AUY A;  4LK6 A;  1AXK A;  5DPN A;  5T54 A;  1LOC A;  4W4Z A;  4Y1Z A;  3BOW A;  1SHW B;  1LTE A;  1EUU A;  2QCS B;  3AZY A;  2WYS A;  3FFQ A;  3TEY A;  4RGG A;  3FE5 A;  3WSO A;  5HI0 A;  1MEC 3;  5FRE A;  2GC0 A;  3WQ0 A;  1YFU A;  4LUK A;  4Z82 A;  3AL5 A;  3KCY A;  3ZYI B;  5HXM A;  2ZS6 B;  3PTY A;  4Q5O A;  2JEN A;  2VZ3 A;  2FMY A;  2VUC A;  1O8P A;  3OPT A;  4OZX A;  2J1R A;  5EP9 A;  3KT1 A;  4MHU A;  2J1V A;  3ZFE C;  2CTV A;  5EZW A;  1VRH 2;  3H8O A;  3CL1 A;  2VR4 A;  2WAA A;  3ATG A;  4URT A;  2WWS A;  3KT4 A;  3M4F A;  2EID A;  2JE8 A;  3POI A;  2XL7 A;  3OGV A;  2WKK A;  3DXU A;  3H8U A;  1GWL A;  4IV1 A;  5FUP A;  2WT0 A;  4IEY A;  3MV1 1;  2RM2 2;  3BTX A;  3ACH A;  3WEZ A;  1F4H A;  1KFU L;  4AXO A;  1UIK A;  3F95 A;  3BVC A;  3HBZ A;  4WM7 A;  1G9A A;  1REE A;  1DZT A;  3ZFG B;  2JG8 A;  4GIQ A;  3SIT A;  3AKT A;  3EB7 A;  4IGQ A;  5KXB A;  2JD4 A;  4E4H A;  1RC6 A;  4C90 A;  3OEA A;  5JZG A;  3ZR5 A;  3E5Q A;  3D5O A;  3IPV A;  2PFW A;  2YXS A;  1NE4 A;  2QQI A;  2R0F A;  4IE0 A;  1K42 A;  2VUJ A;  3SCF A;  1HN1 A;  2VMG A;  3SXW A;  2OXB A;  4OUS A;  2B9V A;  2W39 A;  4AI8 A;  3PVE A;  4YGC A;  1G9D A;  2W0X A;  3Q9O A;  1O4T A;  1WLD A;  1CES A;  4YGB A;  1RIN A;  1S1A A;  5C6C A;  1ODN A;  1PIV 1;  2HYX A;  1C8M 2;  2W1W A;  3AMP A;  2JDK A;  4MAD A;  3ZLI A;  4D7Y A;  5L36 A;  1OQD A;  4P08 A;  1OXC A;  4AZZ A;  2EIB A;  2SLI A;  3LWC A;  2ZML A;  1VE0 A;  3OEB A;  1R1A 1;  2PN5 A;  1LKN A;  4I02 A;  2P5B A;  3ZIX A;  5CG9 A;  1H9W A;  4EV0 A;  2ARB A;  1EV1 3;  2A6W A;  1ULC A;  4HPK A;  1Y9M A;  1IQD C;  4E8D A;  4BMB A;  2VZR A;  4COV A;  1KDK A;  5F3G A;  3VD5 A;  2Y6H A;  4CDQ C;  4Y1U A;  1RXF A;  3WCR A;  4ZZ8 A;  2DVG A;  2CY6 A;  4IEX A;  4YWA A;  2XWB B;  3BTA A;  3I3E A;  2YY1 A;  3BU7 A;  1AX0 A;  1WZX A;  4GA9 A;  3UV9 A;  4UFI A;  5A33 B;  1W2A X;  2GNM A;  4Q0P A;  5E16 A;  5H9S A;  2IFW A;  2PHT A;  1RHI 2;  1RUJ 3;  4YVW A;  1WMX A;  4H14 A;  1ST8 A;  4FPJ A;  1S0E A;  2XUM A;  3APB A;  3PVN A;  1V9U 1;  5T5O A;  2K46 A;  1WMF A;  5L9V A;  1QGL A;  2DUO A;  2WA4 A;  2W47 A;  3H1W A;  1B35 A;  2HBT A;  2QZ3 A;  3RFR A;  4PQQ A;  4OQ9 A;  3TWI A;  3LSE A;  4OI2 A;  1RUH 1;  4M4P A;  1LR5 A;  3NAP C;  3MW4 A;  5EV7 A;  2LUW A;  5DUU A;  3CQO A;  4AQ2 A;  1PX3 A;  5B2G B;  5K9Y A;  2HWC 1;  5KBF A;  4NR1 A;  1S0D A;  1QU0 A;  1C8N A;  5T55 A;  1CX4 A;  4IEP A;  5LW9 A;  1AYN 1;  2JXA A;  4LBQ A;  2W9X A;  5K4L A;  1PNG A;  1W0O A;  4CU9 A;  2VAU A;  1F2N A;  4G9S B;  1YJK A;  2BTV C;  2JDN A;  1RMU 1;  4HXC A;  5LAT A;  5C4W A;  3AYA A;  2YZ4 A;  3ZPO A;  2BGC A;  3JQX A;  4KU7 A;  5HV0 A;  5E1R A;  2RE9 A;  3GJA A;  2VBD A;  1ZZ8 A;  1BEV 3;  4Q8L A;  3GZU C;  4RS5 B;  3RRD A;  4JX0 A;  2D3P A;  4Q4W 2;  2XJQ A;  4QXH A;  1ULD A;  1NUK A;  2MNG A;  1M4W A;  4K20 A;  4NO4 A;  4S2G A;  3BTY A;  1MR5 A;  2P4E A;  1GP5 A;  2VBB A;  2C9K A;  3VBF B;  5T50 A;  1ZA4 A;  1QJY 3;  5C8C A;  5CG8 A;  2F4P A;  3AJY A;  4PJY A;  4QKF A;  1IPK A;  1NKG A;  1I5P A;  5FKB A;  1RXG A;  4XDO A;  2W52 A;  2GAU A;  4LE3 A;  1KFX L;  4HG6 B;  3SMH A;  2Y6K A;  3HN1 A;  3POY A;  4CDX C;  1H8T C;  2FDF A;  3HT1 A;  4LHN A;  4XCB A;  1WD4 A;  3FBY A;  1EY2 A;  1FNZ A;  2CWM A;  2R7E B;  2YG0 A;  4YZ3 A;  1DYP A;  1EUT A;  3G7D A;  1PO1 1;  4PHZ A;  3K4Z A;  5C9A A;  5FKC A;  5CVR A;  5CFD A;  4Z1V A;  5FY5 A;  4N8M A;  3KS7 A;  2VQU A;  3M1H A;  4L8Q A;  5B4X A;  4QHO A;  5EJ1 B;  3SIS A;  1JZ3 A;  1BYH A;  5JXG A;  2GC1 A;  3LDR A;  4NVP A;  3RS6 A;  1ASJ 2;  1Q43 A;  5FYI A;  2OZJ A;  2QUO A;  4ES8 A;  2V5Y A;  3MYX A;  1W39 A;  4IGO A;  4JGZ A;  4QPI B;  5FRA A;  4NIA A;  5J48 A;  2WUH A;  2JIJ A;  2HYK A;  3VDC A;  3IM0 A;  3ZFF A;  1W6O A;  2GAL A;  5FZC A;  3U10 A;  3FMG A;  4YGE A;  1SCR A;  4LBQ D;  3MV0 1;  3LAG A;  4M3C A;  4QGN A;  1RUF 2;  1U5Y A;  1RUD 2;  1VR3 A;  4XTP A;  3UKT A;  5FPL A;  3CNA A;  1S0I A;  2FCV A;  3KSC A;  4QQH A;  1JZ2 A;  1XU1 A;  3E1F 1;  3U4X A;  1AL0 G;  2ZAB A;  3RZZ A;  2O0O A;  4UAP A;  4OUE A;  4MX3 A;  1X36 A;  2R07 1;  1H2K A;  5FYZ A;  2OUH A;  2VEC A;  3CF6 E;  4KG8 A;  1ZRR A;  3FN9 A;  4MYE A;  4XFH A;  3N36 A;  3ST7 A;  4AI3 A;  3OPW A;  4HLT A;  2WZP P;  4OZO A;  1OVS A;  4P9X A;  3H8R A;  1UYZ A;  4IV1 C;  3AM2 A;  1W28 A;  3HPN A;  1IG3 A;  1COV 2;  2XON A;  5FY1 A;  5FV3 A;  1XB9 A;  2RR1 3;  4Y26 A;  3HOB A;  1X33 A;  4WM7 C;  1VBC 1;  1QWR A;  5F3E A;  5CA6 A;  3JB4 C;  1HJG A;  2HLE A;  2JG8 C;  4W6X A;  1LOF A;  3AKP A;  1GNZ A;  1H4H A;  3CJX A;  5JZG C;  2DVA A;  5F6K A;  2DFB A;  3N7L A;  3OSD A;  4DUW A;  1BMV 1;  4K8F A;  1MPX A;  1W2N A;  3NVC A;  1RUE 2;  5HPO A;  2DBI A;  2VCM A;  3HJR A;  4PDW C;  4J6G A;  3S57 A;  1XJA A;  4KWK A;  1RJ7 A;  2OQ6 A;  1VBD 2;  3PIG A;  4I0A A;  4TYS A;  4XAC A;  1UYX A;  3T3Y A;  1HQN A;  4XZP A;  2ADD A;  4HON A;  5I8T A;  1JZ7 A;  3EYP A;  4N43 A;  1GWK A;  3SEE A;  4I01 A;  3MIH A;  4NE9 A;  4RGK A;  1DG6 A;  5GLW A;  3VBH C;  4X6Q B;  5FBJ A;  4CEY A;  5JWP A;  3OYW B;  1OQ1 A;  2C6S A;  3FL7 A;  2BBA A;  3MBW A;  1AYM 2;  2J1S A;  2ZGL A;  4AED C;  4FSJ A;  4JGY B;  2HWF 3;  4Q4Y 1;  5EYY A;  1UY4 A;  3K2O A;  1YFY A;  1XE7 A;  1BJQ A;  4BB3 A;  4JRL A;  3WF3 A;  4FCA A;  1VBB 1;  1UOF A;  3A22 A;  3W20 A;  1BBT 1;  4CCK A;  5EHD A;  3ZXE A;  3EMR A;  3I3B A;  1L3J A;  2QVS B;  3ACL A;  4LTA A;  5C3P A;  1W04 A;  5CBL A;  3I7D A;  2XBO 3;  1H2N A;  3AZW A;  4XYX A;  4B4P A;  2XDV A;  4LXL A;  5GZC A;  1UPS A;  2ZX0 A;  4CSW A;  4CDW A;  2WFF 1;  2RMU 1;  4I0W B;  2IWG B;  3TRS B;  5LK5 A;  4DRR A;  1OC1 A;  3RQ0 A;  2P34 A;  5D8A A;  1WBF A;  3D8C A;  2MEV 3;  2XLA A;  2ZGR A;  4QKN A;  3FX3 A;  2X8K A;  4YVW C;  3A0N A;  1LES A;  4AQ6 A;  1F4A A;  1W9T A;  3DEM A;  4F3J A;  3PVO A;  3RMY A;  1Q8P A;  2TUN A;  2ZGS A;  1LHU A;  5ACA 3;  1DCS A;  3NWK A;  1JU4 A;  3PDQ A;  1POV 3;  4Q1R A;  4AW7 A;  5I8Y A;  5J1X A;  1B35 C;  4QHZ A;  3W21 A;  3PU3 A;  5C71 A;  4N53 A;  4KGG A;  5BNN B;  1GU3 A;  1FOD 1;  3DL3 A;  4S2D A;  2I07 B;  5DAV A;  3LQC A;  1RGS A;  2VOK A;  2DU0 A;  4UXA A;  3ZKU A;  4Q4V 2;  5AFE A;  1QNW A;  3NST A;  1XC6 A;  1LHV A;  2LRO A;  1ZBA 1;  4ATF A;  3M3O A;  3WP6 A;  1PVC 2;  3ZMN A;  3OOX A;  2Y34 A;  4DY5 A;  2WWJ A;  3ZXJ A;  1GFF 2;  4Y4R A;  2VMD A;  1NA1 B;  1W8F A;  4JTO A;  2VZT A;  2F17 A;  3HQU A;  4FP3 A;  3NL1 A;  4NOT A;  3U75 A;  2RS3 2;  3VZL A;  3ZYG A;  4B3N A;  3ALQ A;  5C4W C;  5DZE A;  3U4S A;  1NAE A;  1B09 A;  2ZPX A;  3BUC A;  2D7F A;  1EAH 3;  2A3Y A;  2QQM A;  3E5X A;  4GJZ A;  4AI1 A;  2WJS A;  1WW6 A;  1CPN A;  4W65 A;  3VUO A;  4RR3 A;  2ZA9 A;  3VKO A;  2WZ8 A;  3J26 N;  1V6I A;  1S55 A;  4JZR A;  5L9R A;  1D4M 1;  3CHX A;  2DVD A;  1OOP A;  2P3J A;  4QPW A;  1AR7 3;  4QXK A;  4XFG A;  4XIO A;  2WYF A;  5KHH A;  3ZXA C;  3VZJ A;  2ETE A;  1TMF 1;  4R52 A;  3JUU A;  1VPH A;  2VXJ A;  3EXU A;  3I8T A;  3KV9 A;  3RVH A;  3TN9 3;  3WV6 A;  1LGC A;  1LUL A;  3R0R A;  4IEW A;  5C8C C;  3OUJ A;  1PO2 2;  1STM A;  1ND2 A;  4RQP C;  2ET1 A;  1SFP A;  2HWB 3;  2X29 A;  3MIF A;  2XWJ B;  1D2S A;  1QDO A;  2C26 A;  4TLG A;  1C5I A;  1W2U A;  2WNV B;  1AF9 A;  3IDE A;  5IJR A;  3SNM A;  2ARA A;  4DNY A;  5A7P A;  3FHI B;  1UY2 A;  1O59 A;  2FBE A;  5E88 A;  2TNF A;  4RHV 1;  4BXF A;  2HEV F;  1HV0 A;  3BKZ A;  3RNS A;  3P6B A;  5C9A C;  3I59 B;  5CFC A;  2WRA A;  1WCS A;  2E33 A;  1O4Z A;  1QXR A;  1WME A;  5CFD C;  4XJZ A;  4FBF A;  3K3O A;  4H2A A;  2VMH A;  2WA3 A;  4K7J A;  4Y5Z 0;  1ULE A;  4FPO B;  2W1U A;  4Y5S A;  4DQA A;  3HQR A;  5FDB A;  5L7O A;  2DUP A;  5JPM B;  1Y7B A;  2PLV 1;  2VUA A;  4QAW A;  3LPG A;  3IAQ A;  1JHJ A;  4EN0 A;  2HWE 1;  3MIC A;  1QJZ A;  1SBE A;  4G3Y C;  4RN5 A;  4IEZ A;  4JGZ C;  4N9H A;  2GH2 A;  1UMZ A;  4K9S A;  4XFI A;  5FZ4 A;  5A7N A;  2WQ4 A;  3WF1 A;  1QIQ A;  2R04 3;  2XBO 1;  3WQB A;  4E4Z A;  3ZFF C;  5DXD A;  4EN8 B;  2ORX A;  1KIT A;  1DF0 A;  2NLR A;  4CXY A;  3L2Y A;  2Y6L A;  4YAR A;  4FPY A;  1XXN A;  1RED A;  4CXW A;  4JAA A;  1LEN A;  4XMI A;  3AXD A;  3ZN6 B;  4XUO A;  3M3Q A;  3MDP A;  5DAX A;  2WZE A;  1QJX 1;  3J7N A;  3ME2 A;  4K40 A;  5BNO A;  2QQV A;  3J8F 1;  1I1E A;  3O7O A;  3DYP A;  3CEW A;  4YM3 A;  4FQ4 A;  1GKB A;  1LEM A;  5J3U A;  2E51 A;  3ZIW A;  3DEC A;  1A3K A;  2BNM A;  2JDA A;  2JIG A;  1YUD A;  3VBS A;  2FCT A;  1PIV 2;  4XET A;  1PZ7 A;  1DZR A;  2VNV A;  1UQX A;  1VIW B;  3GBF A;  1JYW A;  5GLZ A;  1Y43 B;  2RJK A;  3I3M A;  1A8M A;  5A3U A;  1R1A 2;  1XYO A;  1OPM A;  5BPX A;  1W99 A;  3NNL A;  3U14 A;  5LWB A;  4Q2F A;  1VAM A;  2RVA A;  4OYU A;  1BKZ A;  1CIY A;  1J1L A;  4NII A;  4ZU4 A;  2WAO A;  4R9B A;  3RG0 A;  1LOF C;  1PZ9 A;  5SV5 A;  3K75 B;  3K4D A;  4HZF A;  4CDU C;  4TTG A;  5FWJ A;  5A7S A;  1LOA A;  4RL7 A;  2X10 A;  3N9M A;  3IMM A;  3EHK A;  1APN A;  4K6B A;  5IW0 A;  3ZFE A;  1TME 1;  2HWD 3;  3TAY A;  1MZ5 A;  4FVV A;  4I09 A;  3KV4 A;  1EYB A;  3MIB A;  5FP7 A;  2XJT A;  1NX9 A;  3KHB A;  2Q4S A;  3J9S A;  1NCR C;  2VUD A;  1UKG A;  2K0G A;  2X09 A;  4BH9 A;  2GMP A;  1E5I A;  2Z4F A;  1FPN 1;  4GWI A;  4H3W A;  4SBV A;  3KT7 A;  1UO9 A;  2E53 A;  3VBR B;  2LW8 A;  2O14 A;  1V9U 2;  3LA7 A;  4XDP A;  1VAL A;  3I2J A;  3USS A;  4N43 C;  5DQ0 A;  3LZZ A;  4MZU A;  1SPP A;  5J98 B;  3VN4 A;  4YW1 A;  3NW4 A;  3RGB A;  2ZAC A;  1TEI A;  2W87 A;  2WO7 A;  4P5Y A;  4MGK E;  1X82 A;  3GGL A;  2DCY A;  3OUH A;  1RUH 2;  4LUM A;  5IAT A;  1KS4 A;  4D7T A;  2GH8 A;  4AVS A;  1UZV A;  5FY0 A;  2HWC 2;  2VUL A;  2YPJ A;  2AZ5 A;  4MGS A;  1AYN 2;  5FPV A;  4YG6 A;  1R09 1;  2ZEX A;  4M3C F;  1S2K A;  4D7S A;  1W6M A;  4QX0 A;  1XYN A;  1Y9Q A;  5FPZ A;  2Y6J A;  5JDB A;  1RMU 2;  3B5L B;  1RL3 A;  4NIH A;  4CDW C;  2DTY A;  2ATF A;  1ZBE 3;  1NQJ A;  3BPS A;  4Q27 A;  3GDB A;  4WM8 B;  5FXW A;  4HKW A;  5L73 A;  1WCK A;  2LRP A;  3IB3 A;  4K8R B;  1W8U A;  2EIG A;  2QQN A;  4NHM A;  5D8A C;  2VL4 A;  1OKO A;  2WFP A;  1H1I A;  2GDF A;  4D3W A;  5F3I A;  1GOF A;  1FMD 1;  1N1Y A;  2PYT A;  2FHR A;  2UU8 A;  1O3T A;  2JB8 A;  4HSL A;  5A7Q A;  4AGV A;  4Y33 A;  1W8N A;  3PUS A;  2BV4 A;  1D2Q A;  2VME A;  2EXJ A;  3LEI A;  3R6S A;  3POJ A;  5BNQ A;  4IEV A;  5C3S A;  1XSQ A;  5JSO A;  1OOP B;  4CCN A;  1V6O A;  3O0V A;  4GWM A;  4N53 C;  4V2W A;  5BUV A;  5JXI A;  3HBK A;  2VH9 A;  1MS3 A;  4BIS A;  1CAV B;  2VOT A;  2YU2 A;  4WV8 A;  4J1X A;  4FOW A;  3TEZ A;  2V4V A;  3W58 A;  3D3A A;  3LD8 A;  2LS6 A;  2IXH A;  1KJR A;  3NMB A;  3LCP A;  4NHX A;  2E32 A;  4ZXE A;  2DBN A;  2D3S A;  3V0B A;  2R30 A;  1Y9G A;  3I97 A;  4BE3 A;  1PO1 2;  1SG3 A;  4ARY A;  4L0P A;  4EYU A;  2RDQ A;  3KMH A;  2OII A;  4JQT A;  4I2O A;  1MZF A;  2W2I A;  3JD7 1;  4GWN A;  1DGR A;  5CFC B;  2SBA A;  3RI8 A;  2OW4 A;  1UY1 A;  3MLJ A;  4LHK A;  3N9L A;  4RR3 C;  5EQU A;  4DEV A;  1RUC 3;  1CZV A;  3CKH A;  4ET7 A;  1KXG A;  2ZZJ A;  4GQ7 A;  3HNY M;  4BYY A;  3KCX A;  4KU8 A;  5JI7 A;  4DFS A;  1G86 A;  1WW7 A;  5BNP A;  2GN3 A;  4UI9 L;  4JKL A;  1QOT A;  1R08 3;  2IXC A;  1IZ3 A;  3W59 A;  2RS1 3;  2ZGM A;  4H7L A;  5LEJ A;  4XF3 A;  4XHB A;  3CLP A;  2ERF A;  5DUV A;  3VD3 A;  4NHL A;  1WMD A;  4LO5 B;  4YZ1 A;  3D0S A;  4QX3 A;  1JYX A;  1HXS 3;  1A8D A;  2ZHN A;  1PGL 1;  4UW4 A;  4GKX A;  1CJP A;  1ENQ A;  1XNB A;  3OB8 A;  4FXG B;  1SAC A;  2W46 A;  3LIH A;  2R07 2;  2GND A;  5BNO B;  5DDJ 1;  4LQR A;  2WSV A;  3RSJ A;  3N4M A;  4DY3 A;  5FP3 A;  1J59 A;  2ENR A;  5FZ6 A;  4O61 A;  3VD4 A;  4XQ4 A;  1ZRF A;  1D7P M;  1HRV 3;  5L7O C;  2IVJ A;  3LOI A;  5FLJ A;  4PLO A;  3WF0 A;  4B1M A;  2A3X A;  3NNG A;  2WNU B;  3OBT A;  4MXW A;  1K5M A;  3KWV A;  2ZEY A;  3S30 A;  4DEQ A;  5J09 A;  1EPZ A;  1WWY A;  3AKQ A;  1VBC 2;  2PEL A;  5FMO S;  3MW3 A;  3MHZ A;  3POW A;  1OLM E;  4ERO A;  3I54 A;  5FQ0 B;  5F5Q A;  4UFH A;  4CP1 A;  1ZBE 1;  1WLT A;  5D2A A;  1KQR A;  3T0B A;  3OGS A;  1S4C A;  2R6Q A;  4LR4 A;  1RIR A;  4OHY A;  1BMV 2;  1YXW A;  4AWD A;  4XUR A;  1YWK A;  3KVA A;  2CDP A;  2VOX A;  4A7Z A;  5SV8 A;  1UWW A;  5TSW A;  3Q8E A;  2X5I A;  1IPJ A;  4OI0 A;  3NV4 A;  1DIW A;  3WNK A;  5EXO A;  4A41 A;  4GJY A;  5I91 A;  4LMF A;  1TNF A;  1FYU A;  2EVX A;  2D3R A;  1AR9 1;  2ZX1 A;  4KQ7 A;  2J1A A;  3JBG 1;  4ORF A;  3VBS C;  2R0H A;  4D94 A;  1F31 A;  4KG0 A;  2D5H A;  2RS5 3;  2XQX A;  4RSU A;  1LNS A;  2XML A;  4XFB A;  4YGD A;  1QJE A;  4NJ4 A;  2WS9 3;  5KC5 A;  1SPP B;  3VKN A;  5FFO C;  3ZXD A;  1SBD A;  5FZO A;  2E7A A;  2QDN A;  2XOM A;  4Q4Y 2;  2Q8C A;  3VZN A;  2WDB A;  4JDM A;  1J3R A;  1K3I A;  1XPW A;  1RVF 3;  4Q4X 1;  1VBB 2;  3OY8 A;  3GZT B;  1GWM A;  1BBT 2;  1CPM A;  3ACG A;  2VZO A;  3V0A B;  3UKN A;  1RUG 3;  2HKX A;  3AP5 A;  1YIP A;  4XEZ A;  3VZM A;  1ZM1 A;  2CL2 A;  1GQG A;  1LCL A;  2QBX A;  2ZGQ A;  3BCW A;  4XAB A;  3TNP B;  2D6K A;  3WHU A;  1GNY A;  2O1Q A;  4LKF A;  5IVB A;  2WFF 2;  2RMU 2;  1AR6 1;  2VW0 A;  4QB2 A;  4CYD A;  4FO9 A;  2ZKN A;  2DWR A;  5IT6 A;  1ULF A;  2G9Z A;  4D0Q A;  3PTR B;  4NIG A;  5LA0 A;  1N3O A;  1OH3 A;  5FYM A;  3WDX A;  1YCI A;  3AMN A;  4NAM A;  3ZSL A;  1Z7S 1;  4CP0 A;  1TNR A;  5I0R A;  1JOD A;  4UBH A;  1O91 A;  3E6B A;  5F5A A;  5H9P A;  5HCB A;  5LK7 B;  5AFB A;  3DUI A;  3VKM A;  1AX1 A;  3WP5 A;  2NMO A;  2VGD A;  4MH0 E;  1FOD 2;  3BPZ A;  2ADE A;  2DUQ A;  1W8W A;  3I2F A;  3R4U A;  4A3Z A;  1ZRE A;  1H1M A;  3FLT A;  4CDQ B;  4YW5 A;  1YEW A;  2J1T A;  2VCC A;  2VOW A;  5DZF A;  2Q8E A;  2FDK A;  4G4F A;  2VQT A;  3DYM A;  1ZBA 2;  1LOB A;  4IE5 A;  4NRO A;  4PDW A;  4ZPI A;  1NLR A;  1VB4 A;  4AGR A;  3GF6 A;  4LEJ A;  1GUI A;  5BXX A;  1AR8 1;  2EA7 A;  4MGQ A;  2RJ2 A;  2WR9 A;  2FZ1 A;  3KQ4 B;  1QJU 3;  1W05 A;  3KZ4 C;  5FZ8 A;  4BLI A;  3V0B B;  3ILF A;  3VBH A;  1FT9 A;  4LIT A;  2BOI A;  2L9L A;  1S0G A;  1RUI 1;  4UFM A;  1T6B X;  2IC1 A;  1H0B A;  1PGW 1;  4NRP A;  4CCD A;  4JTN A;  5FWE A;  1OUS A;  1CWP A;  2WZR 3;  1IKQ A;  5FIX A;  1MQT A;  1UAI A;  1RTV A;  3VHP A;  4PIY A;  2D43 A;  4AED A;  3WCS A;  4E2Q A;  1D4M 2;  5EFU A;  3VL9 A;  5AC9 3;  2WN2 A;  3FLP A;  3ENR A;  1WCQ A;  3IDB B;  3IAP A;  2JD9 A;  4GB3 1;  1TMF 2;  1V6M A;  3NAP B;  1SFY A;  2XUE A;  1WA6 X;  2PHF A;  2G9F A;  4CUB A;  4NHY A;  1QQP 3;  4UF0 A;  1N1S A;  5GZF A;  2PXJ A;  4ZY9 A;  4C91 A;  2BPA 2;  2IUW A;  3RDI A;  4Q0U A;  2R06 3;  4GH4 A;  4UW5 A;  4QX2 A;  3K4A A;  1IGO A;  1JUI A;  2GC2 A;  2DCK A;  4M0H A;  2A7A A;  5M0T A;  5A1A A;  2ZKL A;  3NNJ A;  1HX6 A;  4O9E A;  4XJA A;  5KHG A;  3OTF A;  4RHV 2;  3BTZ A;  1GAN A;  2FZ2 A;  3H9A A;  4PLN A;  4FXK B;  4UOJ A;  4OMD A;  2BER A;  3DKQ A;  1S0B A;  4URA A;  1AXY A;  3DV8 A;  2BVB A;  1MEC 1;  1OUR A;  1UOG A;  4Z8B A;  5A3N A;  3N7K A;  4HKL A;  1SMV A;  5IVF A;  2VTX A;  2PLV 2;  1KRI A;  2VMI A;  2WSU A;  3PJQ A;  2HWE 2;  1CAX B;  4RFT 0;  5C8W A;  1U12 A;  1HLC A;  4XXA A;  4NID A;  2ZGU A;  5GAL A;  2Q5T A;  3OUI A;  1HRI 3;  4QQL A;  1DQ0 A;  3SEP A;  3VKL A;  5BNP C;  4ASM B;  4CDX B;  1H8T B;  1YLL A;  4E4D X;  5FZ0 A;  3OJB A;  1YQ2 A;  4DXT A;  2VD7 A;  4IV3 B;  3MIG A;  2Q1M A;  5DMY A;  1YJL A;  2K9Z A;  1E5S A;  2ZOE B;  5A80 A;  1JOB A;  2VNG A;  1DBN A;  5DAP A;  4FTB A;  1JYC A;  1QJX 2;  4YZ4 A;  3J8F 2;  1VBA 3;  4GMP 3;  3MW2 A;  2H6C A;  4CU7 A;  5JR7 B;  1AL2 3;  4X8N A;  4A42 A;  2YBP A;  4Y20 A;  1ZA7 A;  2BDR A;  2C9A A;  4DS0 A;  3BI3 A;  3T09 A;  4DRV A;  2PAK A;  4UBG A;  3RI9 A;  2XH6 A;  1JUH A;  5K8S A;  2FDI A;  5I8S A;  3WZ1 A;  4AVA A;  2XGX A;  1G6N A;  1XNA A;  4GUL A;  3UGH A;  4BQX A;  1J58 A;  3CMG A;  5T52 A;  2PHW A;  2VY0 A;  1VBE 2;  4RQP A;  2YBS A;  4QX7 A;  3ROU A;  5A3P A;  1K5M C;  5FZD A;  2B4K A;  5L19 A;  1VMH A;  1XNC A;  1W6P A;  3DPR A;  4XUT A;  5JSR A;  2XKP A;  3BOD A;  3K51 A;  1OQE A;  3QD6 A;  1W9Y A;  1GSL A;  3RYP A;  4LK7 A;  5HCA A;  3ZN4 A;  2A6Y A;  1W2T A;  1I6X A;  1UXX X;  3LE0 A;  5E8A A;  1TME 2;  4ATE A;  2KA3 A;  1OVP A;  2W91 A;  1DQ4 A;  4QXC A;  3RZG A;  1EV1 1;  2X5I C;  4KH9 A;  3I2K A;  3EJK A;  3HVD A;  3KD4 A;  1H4G A;  1PM4 A;  3ACF A;  1FPN 2;  1GZ9 A;  1YO8 A;  4HL0 A;  5FZF A;  4AQS A;  2BBV A;  1T2X A;  2ZCW A;  2QQO A;  3KGZ A;  5LEK A;  2ZX4 A;  4LO6 B;  4IV1 B;  4AFB A;  1YI9 A;  3A7Q A;  4QX5 A;  4BPZ A;  1GR3 A;  2UWA A;  3H7Y A;  2P1B A;  4CUA A;  1D0G A;  2ID4 A;  4YLZ A;  3T1M A;  4WM7 B;  1PMH X;  2ET7 A;  4YVS A;  5DUX A;  1YYN A;  2OPW A;  4AOC A;  4MGT A;  2JG8 B;  2PHL A;  2XJV A;  1YRZ A;  3FFZ A;  2Z5W A;  5FPX A;  3LGR A;  2E7T A;  1RUJ 1;  2YFZ A;  3VB9 A;  2VE1 A;  3WW2 A;  4AFD A;  4HET A;  4LA3 A;  4YW4 A;  4ZKT B;  5JZG B;  3NV2 A;  1VRH 3;  3D0J A;  4X6R B;  3A21 A;  4YW7 A;  2WO2 A;  5FOJ B;  3IPV B;  3ZMO A;  1R09 2;  2ZGO A;  1XYP A;  3HEI A;  1P8J A;  4XF1 A;  4D6Q A;  2UUR A;  3NV1 A;  1Z0H A;  3DCQ A;  5IK5 A;  2RDN A;  5LBE A;  2MHF A;  4NUB A;  3WUC A;  4BK4 A;  4CP9 A;  1HB4 A;  4Y22 A;  2RM2 3;  1I9R A;  5CIR A;  2VW1 A;  4BA6 A;  4BME A;  1VMF A;  4QM9 A;  4EWD A;  2H0B A;  5FYV A;  4BCU A;  3SH3 A;  3EQE A;  2W1S A;  1UOJ A;  3LF7 A;  2W92 A;  1IKP A;  2NPI A;  3B94 A;  5D1I A;  3U07 A;  3VBH B;  1FMD 2;  3OGJ A;  5LB6 A;  1OKQ A;  1O3R A;  1YQC A;  5T5P A;  2I2S A;  3UT0 A;  4Z2A A;  4COY A;  2NN8 A;  4MG2 A;  4HPK B;  4CDU A;  3N35 A;  3AFK A;  1VAK A;  2WAB A;  3JCI A;  4DO0 A;  3AX4 A;  5KXE A;  4AR2 A;  4AHZ A;  2DVF A;  1LHW A;  4R4Z A;  4S2F A;  1OLQ A;  4UF0 B;  5C3O A;  4IW3 A;  1BEV 1;  1JZ8 A;  1G9C A;  1C8M 3;  2UYB A;  3KV6 A;  4QPY A;  5DG1 A;  2B46 X;  4FPH A;  1NCR A;  4QPI C;  3VBU A;  2Z79 A;  4BHP A;  5JR2 A;  1UNB A;  3WG4 A;  2D6L X;  1ZZ7 A;  1W8O A;  3VBO A;  2LTN A;  4CA9 A;  4XUQ A;  4PIZ A;  5FPU A;  3H3U A;  4YVW B;  1QJY 1;  3OD0 A;  2UWC A;  3JD7 2;  4LO7 A;  1URX A;  4BQ1 A;  1ZVF A;  3I49 A;  4E2S A;  2XJS A;  3ON7 A;  5FJH A;  3IZO A;  5F39 A;  4XIL A;  5IAV A;  3UK9 A;  3KF3 A;  4A7K A;  1YQ6 A;  4D69 A;  1CGP A;  5FZI A;  2GNT A;  1MQT C;  1JS9 A;  1NYW A;  2ZX3 A;  1B35 B;  1MS5 A;  3LEG A;  1I5Z A;  4IDZ A;  1GMM A;  1HN0 A;  3FWE A;  5ERL A;  3C7E A;  4FI9 A;  4CVU A;  3NO8 A;  3D6E A;  5DZG A;  4FTE A;  3GHM A;  3O12 A;  2DF7 A;  4ZXK A;  1XSR A;  5FPA A;  3UNP A;  2V4A A;  4XUP A;  1CX1 A;  4HMZ A;  1MVQ A;  4M4R A;  2BZD A;  5FXZ A;  4HAN A;  5LA9 A;  1RHI 3;  1VMJ A;  1LJ7 A;  1WCD J;  5CU1 A;  3UL2 A;  2XB6 C;  4LBQ B;  2ZHL A;  1V6K A;  3B69 A;  5FY4 A;  2QQK A;  1KS5 A;  1R64 A;  1UF2 C;  2P37 A;  2VPV A;  2VCB A;  4QPG A;  5FLH A;  4GH4 C;  3KM5 A;  5IVY A;  1JYI A;  2AEN A;  2Q30 A;  3SH4 A;  4CUC A;  2Q1F A;  2BFU S;  2XR4 A;  3Q8A A;  5CB7 A;  3FUO A;  3ZOI A;  1W0N A;  5C4W B;  4L99 A;  1PGL 2;  4P9J A;  3THC A;  1QMJ A;  2K2S A;  2UYA A;  4BQY A;  5DDJ 2;  4LOT A;  3BYW A;  3OGG A;  3W5N A;  4GAZ A;  5L9B A;  3ACI A;  3PUQ A;  5FO8 B;  2OS2 A;  4IEU A;  4ASL A;  5H9R A;  1LAJ A;  3RZL A;  2DFC A;  1V6L A;  2RHP A;  1G9F A;  3KCC A;  1AXZ A;  1L7L A;  4BDV B;  4ISR A;  3H1Y A;  4XW3 A;  4AI2 A;  3MEP A;  5C8C B;  3THD A;  4M3C E;  3USU A;  3VHO A;  4A6S A;  1AJK A;  5C7G A;  2OA2 A;  2ZMN A;  4YG3 A;  1UW8 A;  2QQW A;  4P02 B;  4RQP B;  4YNI A;  4Q26 A;  2X05 A;  3THP A;  3WR0 A;  4CCM A;  4KL1 A;  4FAG A;  2BQP A;  2V73 A;  1OA3 A;  3UKV A;  1W6P B;  2IXJ A;  2YFU A;  1HB1 A;  2ZHK A;  3H7J A;  4F8A A;  2WIN B;  4CPB A;  5FTT C;  1UL9 A;  4XF9 A;  4AK3 A;  3T2T A;  1F8V A;  2DDU A;  1AUY A;  4I0B A;  4C8D A;  5KC6 A;  2Q0A A;  1X8M A;  4Q4W 3;  4YYO A;  3DKW A;  4EQV A;  1LB2 A;  4P14 A;  5C9A B;  1OBN A;  1LOD A;  2RR1 1;  3DN7 A;  4YZ2 A;  1TVG A;  5CFD B;  3RZM A;  3MUZ 1;  4LKD A;  5LY2 A;  3NJV A;  1OA4 A;  3KLS A;  1GOH A;  5FAX A;  3RPQ A;  4A4A A;  2A75 A;  1A78 A;  1AR9 2;  4CCJ A;  1UU4 A;  4XDQ A;  3JBG 2;  1DGL A;  3BU0 A;  2GP3 A;  3AYD A;  4DIQ A;  3T1L A;  1PMJ X;  3RZH A;  1ULO A;  1W8Z A;  4M0N A;  5JCT A;  4OI1 A;  4QQO A;  2GU9 A;  1HW5 A;  1MVE A;  4JGZ B;  5E6H A;  3NJZ A;  2YC2 A;  3TBD A;  5IUQ A;  2HJI A;  2IVI B;  3ZFF B;  1UMH A;  4Z2W A;  1W6O B;  2V09 A;  4YM1 A;  2C4X A;  1JMU B;  3PIJ A;  1F15 A;  4M3C B;  4N90 A;  3UYJ A;  1GZW A;  4Q4X 2;  3DPR C;  4LHL A;  3WQ7 A;  1XE0 A;  1W6Q A;  1O6U A;  1JXN A;  4HOO A;  1LGB A;  3C3V A;  4JRA A;  4YFW A;  1VJ2 A;  2JG9 A;  4FOQ A;  4LOS A;  2QQU A;  3GJB A;  2OT7 A;  2YGL A;  4UFL A;  1JN2 P;  2G19 A;  4XXP A;  4DXS A;  2ORZ A;  3O1M A;  2C0Z A;  2C1F A;  1ASJ 3;  3THT A;  3UGG A;  3AC0 A;  1AR6 2;  3VHR A;  4XF4 A;  4P9I A;  2WWU A;  2HWF 1;  4CP9 B;  3VD9 A;  4Y22 B;  2YYO A;  5JAX A;  1FV3 A;  2QTW B;  4OHW A;  3FBM A;  3KQR A;  1XRU A;  3O0W A;  1PMI A;  4QDQ A;  3KB5 A;  3K46 A;  4O7X A;  1Z7S 2; 
#chains in the Genus database with same CATH homology
 3W5M A;  1UY1 A;  3NQH A;  1L7R A;  1CZS A;  4P08 A;  4DEV A;  2EIB A;  1CZV A;  3CKH A;  4ET7 A;  3OEB A;  3PUI A;  2ZEW A;  3HNY M;  1GQP A;  3VDB A;  1OT5 A;  4UI9 L;  2XHN A;  1IQD C;  4E8D A;  3J7H A;  2VZR A;  4JKL A;  3VD5 A;  2Y6H A;  4ZZ8 A;  3I3E A;  3LPF A;  3VD7 A;  3VD3 A;  4BXS V;  4QX3 A;  1JYX A;  4OMC A;  3OB8 A;  1RYY A;  2W46 A;  3NRU A;  3U37 A;  3I3D A;  4LQR A;  5G05 L;  1W9S A;  2OKX A;  4PT6 A;  3VD4 A;  5IFT A;  4KWU A;  1D7P M;  2VTF A;  3WF0 A;  2W47 A;  3NNG A;  4PQQ A;  5G04 L;  4DEQ A;  2ZEY A;  4M4P A;  3OBA A;  3CQO A;  1BHG A;  1PX3 A;  3UET A;  2WN3 A;  2VO5 A;  2W3J A;  3I2I A;  3T0B A;  2W9X A;  3OGS A;  4CU9 A;  4XUR A;  3HN3 A;  2CDP A;  2DCJ A;  1UWW A;  2E31 A;  3GM8 A;  5JMO A;  1UY0 A;  3C7O A;  3WNK A;  2Y64 A;  4A41 A;  1DYO A;  5EJZ B;  2J1A A;  1JYV A;  3C7G A;  2XQX A;  3F2Z A;  1LNS A;  1DP0 A;  4JX0 A;  1NUK A;  2XOM A;  3ZM8 A;  2C9K A;  2WDB A;  1K3I A;  1XPW A;  1NKG A;  1UY3 A;  1I5P A;  4JKM A;  4DUV A;  2QQJ A;  3ACG A;  4HG6 B;  4QDR A;  2Y6K A;  2VZO A;  2W95 A;  2QBX A;  3T2Q A;  1OD3 A;  3C8X A;  1ULP A;  2R7E B;  2YG0 A;  1GNY A;  3C7H A;  3OG2 A;  4QB2 A;  1EUT A;  3FHA A;  4CU8 A;  3K4Z A;  2W94 A;  4D0Q A;  5LA0 A;  5CYY A;  4A44 A;  2VQU A;  5B4X A;  5EJ1 B;  1JZ3 A;  5JXG A;  4W8J A;  2YC4 A;  5JXJ A;  2J7M A;  3I2F A;  4A3Z A;  2WUH A;  4BJ0 A;  3VDC A;  2JKX A;  2WQ8 A;  2J1T A;  2VCC A;  2VQT A;  3DYM A;  3MV0 1;  5F7U A;  1O8S A;  1K45 A;  1JZ2 A;  3CDZ B;  3WNP A;  3E1F 1;  1GUI A;  4DUX A;  4MGQ A;  2RJ2 A;  2ZXQ A;  4OUE A;  4UAP A;  4KI5 M;  5LA1 A;  2L9L A;  4ARX A;  3FN9 A;  1UZ0 A;  2VCA A;  4OZO A;  3PUH A;  2WN2 A;  5IYY A;  1UYZ A;  1WCQ A;  3IAP A;  2JD9 A;  3T2O A;  2WO1 A;  3K77 A;  1H6Y A;  3HPN A;  1JZ5 A;  2W1Q A;  2XON A;  5JUV A;  1WKY A;  3HOB A;  4CUB A;  2HLE A;  4ZY9 A;  3WNL A;  4AAX A;  3I2H A;  5DN2 A;  4QX2 A;  3K4A A;  4DUW A;  2DCK A;  3T2P A;  1MPX A;  5A1A A;  5HPO A;  4A45 A;  3HJR A;  3ETP A;  3GXU A;  5I0D A;  4QB1 A;  4UOJ A;  4OMD A;  2BER A;  2Y6G A;  3T0A A;  1UYX A;  1JZ7 A;  3EYP A;  3SKV A;  2E26 A;  3SEE A;  2CDO A;  3WNN A;  2Y8K A;  5EIY B;  4D8M A;  3FL7 A;  2BBA A;  2VZS A;  3MBW A;  2J1S A;  2J22 A;  1UY4 A;  3WF4 A;  3SEP A;  3WF3 A;  1TG7 A;  5LCW L;  4LHS A;  3A22 A;  1YQ2 A;  4DXT A;  4A6O A;  5IFP A;  3I3B A;  5DMY A;  3UES A;  5JXH A;  2J1E A;  2VM9 A;  1K12 A;  4XZU G;  3BN6 A;  1OF3 A;  4CU7 A;  4A42 A;  4LKS A;  3T08 A;  3T09 A;  4E8C A;  3FHQ A;  1PX4 A;  1F4A A;  1W9T A;  1XNA A;  1J84 A;  3CMG A;  1JU3 A;  1JU4 A;  5J1X A;  3T0D A;  3CIH A;  5C71 A;  1GU3 A;  2B4K A;  1J83 A;  3LQC A;  4XUT A;  1XC6 A;  3IDA A;  3LE0 A;  1UXX X;  2EIC A;  5IHR A;  2W91 A;  2VMD A;  2VZ1 A;  1UXZ A;  2VZT A;  3MUY 1;  2VMF A;  1US3 A;  3I2K A;  3ACF A;  1NAE A;  2VZU A;  1T2X A;  1JI6 A;  2QQO A;  4JKK A;  2QQM A;  3JXS A;  3A7Q A;  2WZ8 A;  3ECQ A;  2VMC A;  4CUA A;  4QPW A;  1H6X A;  2ID4 A;  1PMH X;  5C70 A;  4CU6 A;  4W50 A;  1GOG A;  4AG4 A;  2YFZ A;  3ABZ A;  2J1U A;  3A21 A;  2EIE A;  2WO2 A;  3HEI A;  1P8J A;  2C26 A;  5IJR A;  4BK4 A;  1UY2 A;  1US2 A;  1O59 A;  4XVH A;  3P1I A;  3C7F A;  4QX1 A;  2KD7 A;  3P6B A;  4BK5 A;  2W1S A;  3HNM A;  2E33 A;  2W92 A;  1W9W A;  5B4N A;  1L7Q A;  2W1U A;  4QDS A;  2VC9 A;  4QAW A;  3CZU A;  3LPG A;  4Z2A A;  2W5F A;  3IAQ A;  4GWJ A;  1JHJ A;  4RN5 A;  3WF1 A;  3WNM A;  3WQB A;  2BGO A;  2WAB A;  3LEK A;  1JZ6 A;  2ZEZ A;  2ORX A;  2VZV A;  4MO3 M;  2Y6L A;  1JZ8 A;  1OH4 A;  3I2G A;  4XUO A;  5JR2 A;  2QQL A;  2WZE A;  1W8O A;  4XUN A;  5LA2 A;  4XUQ A;  3DYP A;  3CZJ A;  2WBK A;  1KGY A;  4MOA A;  3DEC A;  2JDA A;  1JZ4 A;  3NJX A;  2VZQ A;  4DXR A;  3OGR A;  4LPL A;  3LEG A;  1JYW A;  2V5D A;  1GMM A;  3HNB M;  1UX7 A;  3C7E A;  3A23 A;  4FI9 A;  4GZ9 A;  4KMQ A;  4CVU A;  2YB7 A;  1W99 A;  3VDA A;  4YPJ A;  3UNP A;  1CX1 A;  4XUP A;  4M4R A;  2BZD A;  2RVA A;  4OYU A;  5FUI A;  1CIY A;  2BGP A;  2WAO A;  2QQK A;  1R64 A;  3K75 B;  2VCB A;  3K4D A;  4TTG A;  1OF4 A;  2X10 A;  4CUC A;  5CZK A;  1W0N A;  3THC A;  1NX9 A;  2VJX A;  2X09 A;  1SDD B;  4P00 B;  2Z4F A;  4GWI A;  4JHZ A;  3W5N A;  1CZT A;  2WO3 A;  3SKJ E;  1UMI A;  3ACI A;  2LW8 A;  3I2J A;  5DQ0 A;  4TXW A;  4IUG A;  4BDV B;  2VZP A;  3BGA A;  2W87 A;  2RV9 A;  4P5Y A;  3THD A;  5C7G A;  3GGL A;  4PF1 A;  5DPN A;  4P02 B;  4W4Z A;  2X05 A;  1SHW B;  1EUU A;  2WYS A;  4MGS A;  2YFU A;  3WSO A;  3III A;  2ZEX A;  4QX0 A;  4QB6 A;  2DDU A;  2Y6J A;  5HXM A;  2VZ3 A;  1UYY A;  1TVG A;  1KEX A;  1O8P A;  3DYO A;  2J1R A;  3MUZ 1;  2J1V A;  3NJV A;  3GDB A;  4A4A A;  1GOH A;  1JYN A;  3MO4 A;  3IB3 A;  3WF2 A;  2QQN A;  2VL4 A;  2VR4 A;  2WAA A;  1PMJ X;  2EID A;  2JE8 A;  1GOF A;  1ULO A;  3OGV A;  1W8N A;  2VME A;  3MV1 1;  3LEI A;  2YC2 A;  3ACH A;  3WEZ A;  3WNO A;  1UMH A;  1F4H A;  5JXI A;  2C4X A;  2V72 A;  2VOT A;  3EB7 A;  2V4V A;  3D3A A;  3OEA A;  2LS6 A;  1DLC A;  4DXS A;  2QQI A;  2ORZ A;  1XNT A;  2E32 A;  2PQS A;  4RYD A;  4ZXE A;  1K42 A;  3AC0 A;  1HN1 A;  3I97 A;  2B9V A;  1SG3 A;  4ARY A;  4L0P A;  3VD9 A;  4ZZ5 A;  4QDQ A;  3K46 A;  4MAD A;  2HYX A;  2W1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...