2J1RA

Structure of a streptococcus pneumoniae fucose binding module
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1rA00
1W8NA 3FL7A 1JZ6A 2KD7A 5B4NA 2J22A 1EUUA 3ACGA 4KWUA 3WNMA 2RVAA 4DXRA 3T0DA 1PMJX 4QDRA 3LPGA 3WNLA 1JZ7A 5JXHA 2XOMA 1TVGA 4XUOA 1UXZA 2BERA 4ZY9A 3MUZ1 2WN2A 1GQPA 2WAAA 4ZXEA 4RN5A 2W1QA 4CUBA 1MPXA 2YFUA 1US3A 4JKLA 2JDAA 2WZ8A 1NX9A 3A7QA 2WYSA 2J1RA 5C70A 4HG6B 2Y64A 2ZEZA 3T0BA 4ZZ8A 2VMCA 2RJ2A 1XC6A 2VZVA 3CMGA 3I2JA 3OB8A 1ULPA 3NRUA 2VZQA 4LQRA 4FI9A 3VD7A 4BK4A 4BK5A 5JXIA 4L0PA 3ACHA 2W92A 5HPOA 1UY4A 5DMYA 3PUHA 2X10A 1W0NA 4GWIA 3IAPA 3OGSA 3HOBA 1XNTA 3I2KA 5IFTA 1XPWA 4CU8A 2WO3A 4DEVA 1K42A 4MO3M 4A45A 4QX0A 1SHWB 4GWJA 4QB2A 1UWWA 2WQ8A 4A44A 3SEEA 1NUKA 3HNBM 1GOGA 2XQXA 3NJVA 4IUGA 2EIBA 2XHNA 3MUY1 3U37A 3HPNA 2DCJA 2VQTA 4OZOA 4CU9A 2YG0A 5IFPA 3A22A 1F4HA 4D8MA 1R64A 1GU3A 2YFZA 2QQIA 4QB1A 3WEZA 3D3AA 3VDBA 2VZPA 4UOJA 5G04L 1UY0A 2Y6LA 4CUAA 4KI5M 3C7OA 1GUIA 4Z2AA 3UNPA 2VZSA 3T09A 3C7EA 4DUWA 3EB7A 3THDA 3T2PA 4AG4A 2PQSA 5EJZB 2VMEA 4LPLA 2E26A 3K4AA 3OGVA 2Y8KA 3LQCA 3LEIA 2C9KA 3K4ZA 4JKKA 1YQ2A 1JYNA 2VCBA 2W87A 1ULOA 4OUEA 3ACIA 5J1XA 2C26A 1LNSA 1WCQA 3P1IA 1JZ8A 4ARYA 1GMMA 3WNNA 1CX1A 3C8XA 1W9WA 3GDBA 4LHSA 1O8PA 3I97A 2Y6KA 1UXXX 5EJ1B 2VMFA 1L7QA 3DECA 2QQNA 1CZSA 3IB3A 3NJXA 1O8SA 4D0QA 4M4PA 1H6YA 2J1AA 4W50A 3CKHA 2QBXA 2HYXA 3I3BA 3K4DA 2J1EA 3J7HA 3W5MA 4JKMA 3VD4A 3PUIA 2W3JA 3T2OA 2BGOA 1NKGA 2JKXA 2WDBA 2RV9A 2J1VA 1K12A 4P00B 4YPJA 3I2GA 3HNMA 1OD3A 4M4RA 3FN9A 5DQ0A 3T2QA 1US2A 4A42A 5JUVA 1EUTA 3NQHA 3OGRA 4W4ZA 5IJRA 4DXTA 2QQMA 3WNPA 1GOFA 2VCCA 1OF3A 5CZKA 3I2FA 2J1TA 4XUQA 2YB7A 3SKJE 4P5YA 2WABA 2OKXA 4E8CA 2JE8A 1D7PM 4PF1A 1JYWA 3BN6A 3WNOA 4XUNA 3HJRA 3WNKA 1JZ2A 4PQQA 1UMIA 4KMQA 2VCAA 5LA0A 2WUHA 5CYYA 4DUVA 2L9LA 3NNGA 3WF3A 1W9SA 2YC2A 3VDCA 3ETPA 3GGLA 4A3ZA 2W1SA 4A6OA 2ZXQA 3CIHA 4BDVB 1PX3A 1H6XA 2DDUA 3MV11 4ZZ5A 4XURA 1W8OA 4MGQA 3A21A 1F4AA 5JXGA 3WF0A 3THCA 3EYPA 2ZEXA 4QAWA 1KEXA 3W5NA 1NAEA 2XONA 3DYPA 3F2ZA 2CDOA 2VZRA 2EIEA 3GM8A 2X05A 3ACFA 5FUIA 2Y6GA 3C7GA 4XVHA 1O59A 2BBAA 5LCWL 4DEQA 3UETA 1L7RA 4QX2A 1DP0A 2EIDA 3AC0A 3CQOA 1OT5A 1CZVA 3JXSA 4QB6A 2V5DA 3HEIA 5IYYA 3C7HA 1DYOA 1JYVA 2VO5A 2CDPA 2J7MA 1BHGA 2BZDA 2ORXA 3OEBA 1JU3A 4QX1A 2V72A 1JYXA 2VZTA 3SKVA 3OEAA 4QX3A 3WF2A 3FHQA 1UX7A 1XNAA 3LE0A 5HXMA 3MO4A 1JZ3A 3ZM8A 1K3IA 3GXUA 2W94A 2E31A 3LEGA 1UZ0A 5A1AA 5JMOA 1IQDC 2WO2A 4CU7A 3I2IA 3WQBA 2W5FA 2E33A 1UY3A 3VD9A 3CZJA 2QQLA 2Y6JA 3CZUA 2WO1A 3CDZB 4XUTA 5C7GA 2VMDA 1J84A 3T0AA 3K46A 4MGSA 1CIYA 5G05L 2W47A 2C4XA 2VL4A 2QQJA 3C7FA 1SDDB 5LA1A 4XZUG 2E32A 4W8JA 5F7UA 2R7EB 4AAXA 4CVUA 1JZ5A 3IAQA 5EIYB 4A4AA 2VZOA 4A41A 5C71A 4DXSA 1W99A 3E1F1 2J1UA 2VC9A 3K75B 2VTFA 2W1UA 2ZEWA 2VJXA 4JX0A 1P8JA 1OF4A 1TG7A 5B4XA 2ORZA 3WSOA 4CU6A 1RYYA 1K45A 4PT6A 4BXSV 1W9TA 3MV01 4JHZA 2W95A 2ZEYA 2W1WA 3I2HA 2W91A 1UYYA 1T2XA 3HNYM 2BGPA 4OMCA 3IDAA 4QPWA 2X09A 3FHAA 4ARXA 4UI9L 4LKSA 1HN1A 2VZ1A 2W46A 3VDAA 2B9VA 5JR2A 3LPFA 1GOHA 2B4KA 4RYDA 3K77A 2YC4A 2W9XA 4P08A 4UAPA 2V4VA 4E8DA 1WKYA 3T08A 2WBKA 2WN3A 4GZ9A 4P02B 2HLEA 5IHRA 1OH4A 3MBWA 1SG3A 1J83A 4XUPA 3WF1A 2LW8A 4OYUA 1UY1A 3HN3A 2VOTA 3DYMA 1JU4A 4TXWA 1KGYA 1PMHX 1UY2A 5I0DA 3A23A 1UYXA 2JD9A 2VZ3A 1I5PA 2QQOA 1CZTA 2VM9A 4CUCA 2WZEA 2VZUA 4ET7A 3BGAA 2Y6HA 5LA2A 3VD5A 1GNYA 1JZ4A 3OBAA 2Z4FA 1DLCA 1UMHA 3DYOA 2DCKA 1JHJA 3IIIA 5DN2A 2J1SA 4MOAA 3ABZA 4OMDA 5JXJA 4TTGA 2VQUA 2QQKA 3VD3A 3P6BA 2VR4A 3UESA 1JI6A 2WAOA 3LEKA 2LS6A 4QDSA 4DUXA 2ID4A 3SEPA 4MADA 5DPNA 4BJ0A 3OG2A 1UYZA 3I3DA 3WF4A 3ECQA 4QDQA 1PX4A 3I3EA 2EICA
chains in the Genus database with same CATH superfamily
4PI0A 5FPXA 1OURA 4JGYB 4ASLA 2OZJA 3H42B 3J7MA 3ZVXA 2KD7A 5B4NA 4G4FA 1G9CA 1R1A1 4C91A 1EPWA 5JAXA 2WNUC 5HXVA 2WA4A 2DCYA 1UD1A 3AJZA 1APNA 1V6LA 4QDRA 5JOWA 2YZ4A 4NHMA 4IEWA 2OXBA 1MS8A 4NRQA 3AVRA 4FPHA 1JOBA 5BNPA 4BQ1A 5IK8A 4ZY9A 2VW2A 3MUZ1 1V9U3 4LKDA 5GM0A 2BTVC 1GQPA 3LZZA 3LOBA 4HVQA 1AR72 2CYFA 4B3NA 4GJZA 4CUBA 5BUVA 1QGLA 3FUQA 1PMIA 4BOWA 4DB5A 1RUC2 1US3A 5JPNB 4JKLA 2YU2A 3HT2A 4CEWB 4TZDA 2ZGQA 4IE4A 1GFF2 1H4HA 2JG8B 2RS33 2P34A 4N7IA 5FMOL 5FY1A 2R32A 2XJTA 3Q8AA 3T0BA 4AHYA 3MIEA 3NV4A 3L2YA 4R4ZA 1PNGA 5F3GA 3OB8A 3UV9A 3NNFA 1XBFA 4L2NA 3RWNA 2ETEA 2VNRA 5F3IA 4AF9A 3WG1A 4AQ6A 1W6PA 2A75A 2BU9A 4LE4A 1O3SA 4FI9A 4AI9A 1HQNA 5FZHA 2VVFA 1UY4A 2TEPA 2VE1A 2JKBA 5FZ3A 3SHRA 5HPOA 3N36A 3K3OA 4Y5SA 1AR83 1RL3A 3POIA 4QXKA 4XQDA 4LO6B 5GJ6A 2YMZA 3ZXJA 5FO9B 3BCWA 5IVFA 3RYPA 1O4ZA 1BBT2 4CU8A 2DVAA 4NIHA 3VL8A 2AEZA 4CP1A 5FDBA 4HFSA 4FPEA 3RYKA 1NZIA 3H7JA 4YG3A 2UWAA 4QX0A 1SHWB 3O7OA 4GMP1 4W6YA 4LO5B 4RS5B 4EZ4A 4CCCA 4GWJA 1REDA 5A32A 2Z42A 1GZTA 1R093 2W52A 4PQ9A 5HCAA 1VLNA 1NUKA 2DCTA 1GOGA 3RMXA 4LXLA 4XDQA 5FZ9A 3NJVA 2YPDA 1WGPA 4S2HA 4Q4X2 1IS6A 1OQDA 4WVMA 5FKCA 3S7EA 1TNFA 3A0KA 3O1OA 2YG0A 1W8ZA 1PVC3 1F4HA 1GU3A 2YFZA 2XWBB 5LW9A 2YPJA 1LHNA 2XKOA 3T1LA 1WW5A 4Z2WA 2A1XA 2YYOA 2WWUA 3V0BA 2PHTA 3D3AA 1OQ1A 3VDBA 3BIWE 1VE0A 2BEOA 2XUMA 1D2QA 1QJX2 3POFA 1UY0A 4KU7A 5EYXA 1RUH2 3CL1A 3LSEA 2X5IB 5G04L 4CUAA 5FYZA 1QEXA 1OD5A 3CJIC 4TSVA 1XE7A 3C7OA 1JN2P 3IBMA 3I3MA 5DZEA 2JDMA 4JRLA 4Z2AA 3AKRA 5DUWA 1E57A 3AL6A 4MHUA 3EB7A 5EJZB 3OD4A 4CCMA 2E26A 3KM5A 5F32A 4XJAA 1DQ1A 2Y8KA 4XW3A 1IOAA 3LQCA 4Y24A 5LK5A 4QD2A 3THTA 3AZWA 4MXVA 1IQAA 5IVVA 4UBGA 1OLQA 1YQ2A 1AL0G 4Q4Y2 2R063 4KQ7A 1RVF3 4J6GA 3JD72 2ZGKA 2XJQA 4R4XA 2W87A 1Q8OA 1RUF1 3OPZA 5FAXA 2VUJA 5J98B 2Q8EA 3ME2A 1KJRA 3GZUC 4V2WA 4BB3A 2C26A 1JODA 1H4GA 1W6NA 1AR91 4XFBA 1WCQA 1VBA2 3J7NA 1XU1A 3KT7A 4K40A 4MSVA 4CA9A 3C8XA 1MS5A 2ZMLA 3GDBA 4AQSA 5K0UC 1PGL2 4XFIA 1U5XA 2A5ZA 2WFF3 4RGGA 1VJ2A 1AL21 1C1FA 4NPRA 5FIXA 1PO21 4FT8A 1UXXX 5FO7B 4DZGA 1Y9MA 4K8RB 5LRRA 2OUHA 4IEXA 4Q8KA 5M0TA 4GWNA 3DXUA 5KHJA 1ZBE3 3MFAA 4W6XA 3AL5A 3M2MA 3GBWA 1O8SA 4XETA 4ZKTB 5C3SA 5A7WA 3ZN4A 1IKPA 2IXKA 3VZLA 3D0JA 1OSGA 1NY71 2J1AA 4BU2A 4NPMA 2QBXA 2HYXA 2YXSA 2B42B 5JPMB 2F4LA 5DAWA 3KQRA 3LDBA 1BVVA 5GZDA 1RC6A 3PMEA 5FPVA 4IV1A 1RUD3 2Q1ZB 1DYKA 3PUIA 4K8FA 2W3JA 4PDWC 3VBFC 4OI0A 4YZ1A 4WM7C 4I0BA 4BQXA 4E2GA 2PA7A 5C3OA 1HXS2 2BOIA 2J1VA 2RV9A 2ZZJA 2VUCA 3HNMA 1GKBA 1OD3A 2CAUA 4HOOA 2ZGSA 5FPUA 3BTYA 3PVOA 2EXKA 4L92A 1OFNA 2XJVA 3POBA 4NHYA 2AH2A 1VAMA 1HRV3 3T2QA 4ES8A 2GNMA 5JLVA 4A42A 4AVCA 1LHOA 3LSDA 1ZREA 1YNAA 5IJRA 1GSLA 2WNVB 1NLRA 3O5SA 5KXDA 4IXLA 1QXJA 3FC0A 4DIQA 4IEUA 5CFDA 1DQ5A 2QQMA 3GHMA 1W6QA 3DEMA 2HWB2 5FXVA 5E89A 4EQVA 1UOFA 2J1TA 2YB7A 2C0ZA 1J3PA 2DWRA 4LLOA 4XJZA 4YNIA 1UIJA 2A70A 2R0HA 1W28A 2XBO3 2WABA 2HEYF 1C1LA 4YW1A 4LHLA 2GNTA 4E27A 3DUIA 4MLOA 4EZHA 2FHRA 1PHMA 2GDFA 2ZAAA 2ES3A 4GH4A 2B45X 1HV1A 4N53A 1EY2A 4Y33A 4MVTA 2WZR3 3VLBB 3QCWA 3IMNA 2V5YA 1VBD3 1FV2A 1MQTC 1GBGA 1WUVA 2Z5WA 4K20A 4NIDA 3D5OA 1HB1A 4WZFA 4HZFA 5FLJA 4BYYA 1S0FA 2BDRA 4QPGB 1PZ8A 1OKQA 2ARCA 3PL0A 1Y4WA 5CYYA 4DUVA 3JZVA 1JS9A 2VW0A 1W6OA 4EE2A 4E9KA 3PUQA 1CWPA 1O5LA 4XAAA 1NCQC 3PJQA 3ZN5A 1V0AA 4OLLA 3AKPA 1NZCA 3FX3A 3VDCA 3MIHA 3GGLA 3JU9A 2XL7A 1AR62 2VBBA 1MS4A 5GLUA 1XSQA 2PLV3 4QX7A 4Y4YA 2A6ZA 1H6XA 1VBB1 3SH4A 4FTEA 5K7PA 5JIAA 4BWOA 4XFGA 2XJPA 5D21A 5EYYA 2PHRA 1BK0A 5KR7A 2G9GA 2ZX0A 4NIIA 1ZBA1 1CPNA 4A7KA 2PQQA 3CO2A 1HB2A 2I45A 1MZ6A 1MEC3 3EYPA 4IDZA 4AFDA 3QLQA 1X9TA 2GC1A 4HETA 1KEXA 4QAWA 5HV4A 2HH9A 2OQ6A 5GZFA 1QOTA 5LBFA 3IPVA 1NQDA 1XSRA 1HX6A 1YQCA 2CDOA 4N9IA 2EIEA 3MDPA 2QZ2A 4ASKA 1RUF2 1ND2B 3ACFA 5FUIA 1V6JA 4LNVA 1FPN3 1F9KA 4IV3C 3KCCA 3VDDA 4XBNA 5LCWL 2FD8A 2ZMKA 4DEQA 3SISA 4QX2A 1VALA 3WT3A 2O8OA 3K3NA 2VY0A 1BK1A 3AC0A 3OTFA 5FLIA 5H9SA 1W2NA 1CZVA 1PO12 3J8F1 4PLMA 4HK8A 3C7HA 2XXZA 2CWSA 3J4UH 1DYOA 1X7NA 2CDPA 4Q0QA 2KR2A 4Q8LA 4NVPA 3WDWA 5IUQA 4OI2A 3TEXA 5FOBB 4C8DA 5KWRA 1V6MA 1GLHA 4QX1A 4UT5A 4RR3A 4BE3A 4CDXA 1G9FA 4CRQA 2I74A 3SKVA 4Y1ZA 1LTEA 3POEA 4JDOA 3MYXA 1F8VA 1UX7A 3SXWA 2Q1MA 2RG4A 4LE3A 3MO4A 4LBQD 2FZ2A 4AGGA 1K3IA 2W2IA 2W94A 2VECA 2HBUA 2IUWA 1OUXA 1UZ0A 1B09A 1BQPA 1NXD1 1RUI2 4A6SA 5JMOA 1RXFA 3ALQA 2DYCA 3WP6A 1DQ0A 4AGVA 2BBVA 5A7OA 1U5YA 1R1A3 5FFOC 1T6GC 1CAVA 3K48A 3NKTA 1OOPA 4ISQA 5E8AA 2AR6A 2W5FA 4DY5A 4YZ5A 4JQRA 5A3PA 1W3XA 2Y6JA 2FDKA 5JDBA 3M3QA 3J7LA 2WO1A 2WT0A 1DGRN 1N1TA 3Q8FA 1XRUA 3GBFA 1J84A 4X8PA 2JIGA 1YO8A 3B7MA 4KBBA 3VBHC 3WZ1A 4RSUA 3RJRA 4YWAA 1YYNA 2C4XA 1LHWA 4GXLA 1O3QA 3MICA 3DPRC 2E32A 3UJOA 1C4RA 2P2KA 4YVSC 5IATA 3G6JB 4P9GA 4Y1YA 5L9RA 5FYIA 1JTZX 2NM1A 2QFEA 4FP3A 3WDUA 4PHZA 4GA9A 2Q8CA 4JDMA 3KT4A 5HXMA 1UN1A 1DZTA 2RS31 2VZOA 1FNZA 1ZRFA 1RHI2 4GMP0 1W99A 2K46A 2VC9A 2MNGA 3K75B 3R0RA 1ZRIA 2D3SA 4P9WA 4WZCA 4HKWA 1OF4A 1GWMA 4G9SB 2ORZA 3WSOA 5BNNA 2A6XA 2V09A 5FPAA 2CV6A 1N1SA 2W1WA 4BM8A 3SNMA 2E6VA 2H6BA 1H9PA 4HSLA 1AR81 3HNYM 4QPWA 4XFHA 5A32B 3FJSA 1GZWA 4GKYA 1JW6A 1PK6A 2X09A 3UL2A 4CPBA 1ULDA 3ZYRA 4GMP3 2DUQA 1D4VB 3AXEA 5LEJA 1RUG1 4Y26A 2VZ1A 2WO7A 2YGMA 3N7MA 4LLFA 1V6KA 1R091 3VHOA 4B4PA 2QKDA 1Y43B 4JTNA 4CXWA 2SLIA 3E6DA 3JBG2 2BFUS 3N9QA 3IT8A 4R9CA 4XHXA 5FWEA 2XUEA 3OY8B 4E8DA 1GANA 2WBKA 3V65A 4AAPA 3V0BB 5CB7A 2P17A 3RS6A 4X6QB 4EWAA 1QF3A 3OD0A 4Y5Z0 3GF6A 3CJXA 2HLEA 2R072 4YLZA 1J58A 4Z1VA 4FPJA 2A6YA 4CP9B 1X33A 1OVSA 2WFPA 5DG2A 1QJY1 5ACA3 5C8CC 3GZEA 2WINB 2DURA 2ET7A 2LW8A 4H7LA 1UY1A 4L97A 1WMEA 1YUDA 3DYMA 3KCYA 1JU4A 1V6NA 2ZGTA 5CIRA 1UPSA 1OPOA 1KGYA 1PMHX 1LESA 1UY2A 3A23A 3KGZA 3OOXA 2IC1A 4JGZB 3WINE 3O1VA 3TN93 2VTXA 1I5PA 2P3KA 1S0EA 5ANQA 1CZTA 2VM9A 5FXXA 4RQPC 2WZEA 1Z78A 2VZUA 3KZ4C 2WNUA 2CL2A 5A1FA 5JZGC 5ABJC 5JVVA 4YVWC 5CG8A 4UXAA 3OUHA 1JZ4A 1WLCA 1OXCA 2CHHA 2NZ9A 3OBAA 4C1WA 1W6NB 4CCLA 3AMQA 2F6BA 1UOGA 3BU7A 4RFRB 2ET1A 2R061 4NJ4A 1ODNA 4NOTA 5DN2A 5F2SA 2J1SA 2Y33A 4BIOA 2VPVA 4MOAA 4OHZA 4TTGA 5DDJ1 3ZN6A 3E5QA 4UWDA 5LA9A 5D8AC 3VD3A 2MEV1 1Q8PA 3ZIXA 1KRIA 1BMV2 4IE6A 1MZ5A 2OIIA 4NR1A 4PLOA 1R082 4Q0UA 5LY1A 1OH3A 2HWC3 4AI2A 2ADEA 2C24A 1GNZA 1AL23 1BZWA 1PO23 4QDSA 4H14A 3GZAA 1H8TC 4YM1A 1D4M3 3SEPA 3AM2A 2ILMA 1V6OA 4K9SA 2YGLA 2A6WA 2JDNA 2VMHA 4M0NA 3H1YA 4MADA 4PLNA 3WW2A 1UIKA 4OULA 4XF3A 5BNOB 4J25A 3LF7A 1RUE1 1BKZA 3AYCA 3NV1A 5T52A 4YARA 4DY3A 1ZBE1 1NT0A 2WZPP 2KA3A 5A3UA 4IV1B 1FV3A 1Q8QA 1A3KA 4AEJA 1QJZA 5T54A 5I8YA 3ZDSA 2AC1A 3QBQA 4MXWB 1W8NA 4IGOA 4XIOA 5FV3A 1ND3B 1V9U2 4LKFA 4PCRA 1COV1 2J22A 3WCRA 1EUUA 1RUD1 2YUEA 3SH5A 4DXRA 2VBPA 1K5JA 3T0DA 1IS4A 1TMF3 3OPTA 1ZZ7A 5C33A 2XOMA 1TVGA 4UW3A 1ULEA 3DN7A 4IESA 4MGIE 4J1XA 5LATA 4CEYC 5F5AA 5H9PA 4DPNA 1W2TA 3RVHA 1HRV1 1W6QB 2ARBA 1CAXB 3U11A 1W6MB 4HVRA 1V70A 3PVNA 1UZWA 4ZXEA 2A3XA 4M00A 2BVBA 4ZPIA 4AEKA 4RN5A 3QH7A 1YI9A 4NUBA 3N9NA 2YFUA 5C9AB 4UFKA 2VXRA 2VQAA 3WQ0A 2X8KA 2JDAA 2WZ8A 4E4DX 5CAZA 2XL9A 3PIJA 2WYSA 3EXUA 3JB8A 4HG6B 2ZEZA 3UJQA 4RHV3 1B35B 1YEWA 2B5HA 3CJIA 2VZVA 3AZVA 4IEQA 3ZO0B 3I4IA 4COVA 2XBO1 3N9MA 1WD4A 3O0WA 4G3YC 4LQRA 4XJ8A 2WRAA 4ISRA 3VD7A 4BK4A 2EF6A 2CTVA 1SLIA 1XB9A 4L0PA 4NHXA 1VMFA 4HPKA 3OUJA 5HI0A 2CGNA 1CPMA 2YU1A 4GWIA 3IAPA 1QDOA 2BVVA 3HOBA 1LU2A 3UT0A 5DZFA 2QQVA 1ZZCA 4K21A 2PAKA 1W6OB 1HB4A 5C4WB 1VBC2 4YW3A 5DAQA 1OQEA 1HRI2 1K42A 1PVC2 2D43A 2JDYA 3NWKA 4CDWB 3BTZA 3ZMNA 5CVRA 2QTWB 4M0HA 1SEFA 3ZMOA 5ERLA 4EN8B 3H8UA 3SC7X 2P4EA 1PM7A 3B69A 4FQZA 3SEEA 1POQA 5LBBA 5FQ0A 1ZZ6A 1YHFA 2D40A 3HWJA 3NAPB 2EIBA 4CP2A 3VBRC 1VBB3 5J3UA 2XHNA 3AXDA 3IWZA 3MUY1 3U37A 4S2DA 1X9PA 4XMIA 5K0UA 5A6QA 4Y22A 1C28A 4JGYC 4QPIB 5GLTA 3KV4A 4CU9A 1DGRA 4LMFA 1WCUA 3A22A 4MGKE 2WNOA 2P37A 4H7MA 1Q43A 2QQIA 3H8XA 5FY9A 2VULA 2WIIB 4QB1A 1SZBA 3IPVB 2XDVA 2FDIA 2VW1A 5BYNA 2Y6LA 4CDUC 2HJIA 1MEC1 1RMU3 4AI0A 4LR4A 2FCVA 1WBLA 3HQUA 1QMJA 2C5DA 2ZGPA 3H0OA 5BXXA 3TNPB 5L7OB 2R062 1RVF2 3UNPA 1S4CA 3E6BA 1LHUA 1UO9A 3NJYA 4CXYA 2GC3A 3U75A 2O0OA 3WV6A 4DUWA 3LKJA 2EXIA 3VHPA 3VBFA 1J3RA 1FPN1 1S0JA 4PDWA 2PQSA 1OUSA 4WM7A 4AK3A 4EJRA 2VMEA 4N43B 1WMDA 4CEWC 4QQHA 2MHFA 2JG8C 5JCTA 2D6MA 3J8F3 3WVJA 4XF4A 2ZKNA 4N90A 1LEMA 1YRZA 4PBOA 2XVLA 2GN7A 1JYNA 1QKQA 1NLQA 2WFF2 1YIPA 2VCBA 3PU3A 5E1RA 3T4VA 5IVCA 1ULOA 1RUOA 4OUEA 3FFZA 5KXEA 5J1XA 2Q30A 1X50A 1FMD3 3KF3A 1JZ8A 3SCFA 2WWJA 3WNNA 2DTWA 3B9IA 5IVEA 1BEV3 4FSJA 4Y1XA 4LHSA 4PJYA 4HXCA 4I0AA 2DTYA 4BISA 1O8PA 1U5IA 4XACA 2JDUA 1C8NA 2V4AA 2Y6KA 3IMMA 1G7YA 1URXA 2HWD3 1H1IA 3PVEA 1ZNPA 3SQOA 3FHIB 5A6ZA 5EJ1B 5FMOS 4RS5C 3O1TA 1OOPB 3NVCA 2E53A 4K3UA 5IWFA 1HIXA 1DHKB 3IB3A 1CZSA 2XLAA 3ORJA 1OBNA 4AVAA 1S55A 1A8DA 4FCAA 1K5MB 4M4PA 1G9AA 3P3PA 3WQ1A 2WQZC 1C8M3 1H6YA 1KXGA 1LGNA 1MQTA 1D0HA 2IVJA 2QNKA 2WNEA 3CKHA 3CNAA 1HRV2 4GALA 1YFWA 3I3BA 3K4DA 4QQPA 2J1EA 4GD4A 3DKQA 4CDQB 3WG2A 4JKMA 3VD4A 2DVGA 3M4FA 4YFZA 5C3QA 3T2OA 2BGOA 3OGJA 1MZEA 3TNQA 5D2AA 1CIWA 1NCQA 2I2SA 3ES1A 3WW3A 1K12A 4P00B 4JQTA 2X5IC 1HQLA 3VBOB 3ZR6A 3P3NA 1QJEA 1QY4A 1LENA 1EV11 2WKKA 1NA1C 4JHTA 3TB0A 4CTEA 2JICA 2RS52 5EWSA 1H2KA 1DU3D 4NWVA 4BZ4A 4WM8B 5F8PA 1NG0A 3NMBA 4W4ZA 3KD4A 1BXHA 5BNNB 3B00A 3WNPA 1YLLA 5L19A 2DFCA 2HWE3 1FNYA 1ZYBA 2OA2A 5CKNA 3NKGA 1FXZA 4JVAA 2WZR2 3WCSA 1VRH2 1REEA 2WS92 2TBVA 1VBD2 4IE5A 4XUQA 1D0GA 4DXZA 1QOOA 1AF9A 1A34A 1OLRA 4P5YA 3WOGA 2E51A 3KS7A 4E8CA 4AEDB 2WR9A 1XE8A 3EHKA 5EPAA 1SLTA 1Y3TA 5FJKA 4LIVA 4BQ4A 1TME3 1SPPA 1G6NA 1HN0A 1YFXA 2EIGA 4IV3A 1ASJ1 5FZ4A 2JJ6A 1D7PM 1RUG3 2ZMNA 3WNOA 4NRPA 4AYUA 4Q4W2 1F31A 2PLV2 3HJRA 4NWWA 3WNKA 4X8NA 1DYPA 4AL9A 4CE8A 3V0AA 3ZSEA 3POYA 2AZ5A 2JG9C 5AC91 5C3RA 3FLPA 2WLPA 5FK8A 2Q8DA 3GCWA 3VZMA 1MR5A 3NNGA 3BALA 2UWCA 1DZRA 3OBRA 4NHLA 1LOEA 1IG0A 1NCRB 3ETPA 4XFCA 3ZFEB 1UYPA 3KV6A 2W1SA 2RMU2 2OT7A 1QJY3 1HLCA 3UGHA 1W0PA 2IXIA 1PX3A 4NHKA 3ATGA 3ZFGC 4LORA 2IXJA 3MV11 3BOPA 5ACA1 4OI1A 3VL9A 2PHXA 2BGCA 3FLTA 4XJWA 1CAUB 1FPN2 1REFA 2H0VA 3A21A 1F4AA 1SLAA 5KHKA 4MG2A 4Q5OA 3PTRB 5JXGA 1W9YA 2WNUB 3THCA 2DVBA 4R9AA 3AP4A 3H3ZA 3QACA 2Y0IA 4IQPA 2ZEXA 3TN91 3OBZA 2GALA 3AZXA 2XONA 3FZ3A 2ZX3A 3WR0A 1ULFA 1NE6A 1OC1A 3AZYA 4EN7B 1LEDA 4FPYA 2VZRA 3WX5A 4DO0A 1DLLA 2QUOA 1AX2A 5JSOA 5GKAC 2Y6GA 3C7GA 4XVHA 1SLBA 3S57A 1VAVA 4LOTA 2SBAA 1O59A 5A7QA 4A2UA 2RE9A 2RR11 3VBHA 4LO8A 5HCFA 2IXHA 4PIZA 1NXMA 1IPJA 3N4MA 3UETA 5TSWA 1ALYA 2A3YA 3RZJA 5FPZA 1L7RA 5DDJ3 3R4UA 1DP0A 1XYOA 2EIDA 1CAWB 2AEYA 2JXAA 1PGW2 5DXDA 2MEV3 2XJUA 1ENXA 5DUUA 3AVSA 3KVBA 3DPRA 5KC5A 2WSVA 2IZWA 3NNMA 1WD3A 4F8AA 4UFHA 5IYYA 1DIWA 3P5BA 4MH0E 5FZKA 4DNYA 2VO5A 3LD8A 5AFEA 4R52A 2R49A 4AHZA 1QJU1 1UX6A 2HWC1 1W3VA 4P9LA 4S2FA 1QJFA 3OEBA 4AVSA 3JUUA 4DS0A 4AQ2A 3C3VA 2IXCA 4OVEA 3USUA 3ZX7A 4EN6B 1CQ9A 3NSTA 4I3PA 3RFRA 1D4M1 1R1A2 1RUE3 2GN3A 4OI4A 5FLHA 3UK9A 3ZYBA 3WF2A 3B93A 5FZDA 2VU9A 3LE0A 3MLLA 3KWVA 5LBEA 4QPGC 3ZFFB 4BQ3A 1WW7A 2GAUA 4BCUA 5FO8B 3ZM8A 1JZ3A 3GXUA 3BKZA 4D69A 2E31A 1DBNA 2OYZA 1EP0A 2BNNA 3AMNA 5C5TA 5C6CA 3MLJA 2TNFA 1C5HA 3AP9A 3KF5A 5BNQA 1COV3 3ILRA 3I2IA 4CU7A 2Y26A 1GR3A 1EAH3 4LBOA 3RNSA 2BNOA 4XEZA 4D6QA 3RZGA 2QQLA 3CZJA 5J48A 3LDRA 2XB6C 5ANNA 1CGPA 4QQLA 1KFUL 1TMF1 3CDZB 4KGGA 5I8SA 5A7PA 1I6XA 3SCGA 1KS4A 1YIFA 4AGRA 1CN1A 3ILFA 3VB9A 2O8QA 2UY9A 3DXTA 4OHVA 1LJ7A 3C7FA 3RZLA 1SDDB 4NPLA 4XZUG 2Y60A 2YDEA 2ATFA 3ST7A 3CJIB 5LA1A 1F15A 4U36A 2QCSB 1DFQA 4LK6A 5C8CA 1JZ5A 4E2QA 1ND2C 3PIGA 5EIYB 4IEVA 4IE0A 1AYN1 5FMDA 5FJHA 1DF0A 4UFIA 3TAYA 5LWBA 5FY7A 3RI8A 4XFAA 1FOD1 5C71A 2ZS6B 4RHV1 4F7ZA 1KDMA 2J1UA 3TEYA 4QX8A 4JX0A 2W1UA 4FPGA 1WW6A 2JDKA 1P8JA 2FQPA 4QT6A 1TG7A 1X8EA 3WG3A 1RB8G 3G7DA 3ZPOA 4IW3A 4YG0A 1RYYA 3POJA 1KITA 4AI8A 1WCDJ 1W9TA 4CXXA 5K9YA 2W95A 2QQPA 3IKWA 4RQPA 4XF1A 1S0CA 2V73A 3TBDA 5F1RA 3BU0A 5JZGA 4N9HA 2R0FA 3W21A 5ABJA 2BGPA 2YBSA 5FTTC 4YVWA 3L9JT 1QNWA 3KV9A 3FHAA 3ZSLA 4ARXA 2ZGLA 1UAIA 2D6NA 4FVVA 3USSA 3ES4A 5FYHA 1HN1A 2D93A 2W46A 2H0BA 4INDA 3AX4A 1WCKA 3H1WA 3NNLA 4XQWA 5FYCA 2Q4SA 1GOHA 5D8AA 3K77A 4ATFA 2W9XA 1G86A 2A6VA 2PXJA 2VBDA 2PTMA 4KWKA 1WKYA 1CVNA 4QKFA 5DUVA 3EO6A 5CKMA 3HIFA 2JDZA 1A78A 2WN3A 2BYVE 1H8TA 4UW4A 3M3EA 4P02B 2B7YA 4YSFA 5IHRA 1SMVA 3MBWA 4FAGA 1DZQA 2RJKA 1BYHA 5IVBA 1J83A 2IXLA 1XJAA 3M3IA 2RM21 3M3CA 3WF1A 4KNCA 5JR7B 2W39A 1LKNA 1Y9GA 3N9OA 1KQRA 5EZWA 1WW4A 5CU1A 1ZZBA 1RMU1 2VOTA 4C0BA 3D0SA 4PDWB 5A3WA 3QOPA 4Y20A 2HWF1 2IFRA 4ZS3A 3VBUC 1AR92 3I54A 2QQOA 1GWLA 4EV0A 1N1VA 3FBYA 4QQOA 1FI2A 3AKTA 2D7FA 2EAAA 5F5QA 5HBAA 1SLLA 3ROUA 2QJVA 3BGAA 3TOJA 1IPSA 1V6IA 2P3IA 5LA2A 1O3TA 1O91A 3MF9A 1AL22 1QXPA 4V2VA 4XTMA 1PO22 2OZ6A 4CEYA 4CCJA 1DLCA 2HEVF 4FBFA 3FWEA 3DYOA 4RGAA 4O7XA 4WBBA 2UY8A 1F35A 1JHJA 1S2KA 2BOJA 4EWDA 3LWCA 5FKBA 4A3XA 4YZ2A 2AREA 1FT9A 1I9RA 4OCTA 4HANA 4UW5A 1W2OA 2QQKA 1FMD1 1NY72 2YROA 5FYUA 1MVEA 1UNBA 2B8MA 4COWA 4P9IA 4LEJA 5DAPA 4BH9A 3GJAA 1CR7A 1Q3EA 1X36A 1BEV1 1X82A 2LS6A 3LEKA 4UYBA 4FOQA 3VBSB 4DUXA 1OHFA 1SACA 2ID4A 3UKTA 1MS9A 2DV9A 1SBDA 2ZKLA 3RDIA 1PZ9A 1H1MA 2HWD1 2GNBA 4AEMA 4QKBA 1OMIA 2Z2SB 1MQTB 4BJ0A 1JH5A 1JUIA 1UYZA 4XC9A 1H2MA 4JZRA 3WF4A 1NOVA 1TMF2 2XJSA 4U2AA 1PX4A 5GLZA 5LEKA 1HDKA 3JD73 4Q1PA 3VHRA 1W2UA 4Q4V1 4WVWA 5BNPB 1C8M1 3RMYA 1ONAA 2VVEA 1KD7A 1NCQB 2G1MA 3FL7A 1UZZA 1S0DA 4FPOB 4KG0A 3SCHA 4AWDA 2A73B 4HL0A 3ACGA 1LOBA 2JWPA 3WNMA 2RVAA 4AFMA 1DQ6A 4BHPA 3LAGA 2EALA 4Y1UA 3T4HB 3JQWA 3WNLA 3ZYGA 2PYTA 1EV13 5T5OA 5BV6A 4M3CA 2NPIA 4FOVA 4NRMA 2DCZA 1JYTA 2ZGMA 4WVZA 4RHV2 3DCQA 1ZRRA 2BERA 3VBRA 3ZDVA 4M3CF 4NIGA 3A0NA 3VUOA 2R1BA 2EVXA 4JGZC 4I2OA 1W6PB 1POV3 1E5HA 2WAAA 3JB4C 4JGYA 2P6HA 3DF0A 1YFUA 1YC61 4LBLA 2VOWA 2W1QA 3WDXA 2KXLA 5FZGA 4I01A 1XNCA 1PGSA 4OQ8A 2PHFA 5DAVA 2HWE1 4JCKA 1NX9A 3A7QA 1BVP1 2R6QA 3AYDA 3OYWA 4PIXA 4CDUA 5C70A 2DBIA 3FMGA 4P9XA 2NYYA 3PHMA 2VMCA 2RJ2A 1XC6A 2D6LX 4L8QA 3WP3A 5CBLA 5L36A 1DGWX 4MHRA 1G9BA 4WVVA 1HXS3 5A3OA 1ACCA 4JV4A 4FO9A 4XTPA 2VZQA 1RUJ1 3HQXA 1ASJ3 4Z07A 5FZEA 1PIV1 2QDRA 1F5FA 2QQWA 2ZHNA 5JSRA 1TME1 5DMYA 3VZOA 2VMIA 2X10A 3PUHA 4OUMA 1W0NA 3L2HA 2B9UA 3OGSA 4CEWA 3WXPA 5IK5A 2R30A 3WW1A 1XNTA 5IFTA 3RYRA 1VBB2 2JG8A 4GAZA 4WVMB 1XPWA 4ES9A 2F17A 5AC93 5EFUA 3I8TA 1JOJA 2D3RA 2ZACA 2HWB3 4Z82A 1EYBA 3GYDA 5BNOC 4MO3M 3MHZA 1ZBA2 4M3CE 4YM2A 1GP5A 3KV5A 3HNBM 2BJSA 2XQXA 3INAA 4AHWA 4LULA 4PIYA 4D6SA 5A6XA 2DFBA 4EWEA 4ZU5A 3RQ0A 2UYAA 3HPNA 4D94A 4J1WA 4Y1VA 3NNJA 5E6HA 5FY5A 1QQP1 4COZA 5IFPA 5J96B 2AUYA 4ASMB 2G9ZA 3AYAA 3LA3A 2H6CA 4I3GA 4RS5A 5J09A 1XNKA 1W8WA 4XBLA 3WEZA 1VP6A 1H2NA 2ENRA 3UYJA 4UOJA 3J8F2 1VB2A 4UF0A 4KI5M 2GSYA 4F83A 3KCXA 4YVSA 3VBHB 1H0BA 1GUIA 5A3MA 1VBE1 4E4HA 4QWNA 3ZYFA 4CZSA 5J37A 2VZSA 3B5LB 3ZIWA 2JDPA 2ZTNA 2RR13 2RJLA 1JUHA 4ITCA 1L3JA 5I0UA 1W05A 3THDA 2Z79A 3T2PA 4GB31 2RS11 5C9AC 1FMD2 3DPRB 3LB9A 1LECA 4LPLA 2TUNA 4BLIA 4DQAA 3AP7A 3ILNA 3THPA 1HV0A 3CHXA 2X5IA 1XYPA 1B35C 1QDCA 4N7UA 3ZXDA 1XOYA 1GP6A 1NA1A 1J1LA 3K4ZA 2ARXA 4BXFA 5IW0A 4D7YA 5FREA 5CFCB 3POGA 5LRSA 1SFPA 1XNBA 5DABA 1QJU3 3ACIA 1LNSA 4XCAA 4P14A 5A7WB 4DMIA 1UCXA 4AE2A 2YBKA 4ARYA 4AZZA 1GMMA 4RGKA 1VAKA 4KWJA 1WA4A 4LA2A 2GMMA 5C4WC 2D3PA 4L9BA 4ONUA 1QH7A 3I97A 2W68A 4Q1RA 4ZONA 1Y7BA 3PJYA 4CDWC 1BLZA 4XXPA 3W58A 1L7QA 4CP0A 1Z7S1 3DECA 2QQNA 3NJXA 1PO13 1AX0A 4Q29A 2XJRA 3LA7A 2UU8A 3NAPC 3PUSA 3RWKX 5FUPA 1EAH1 4W50A 5T5PA 1UU4A 4XFFA 1BJQA 4QPIC 4FP2A 4YGEA 2JG9A 3J7HA 5JSPA 2BUKA 2RS32 3MGUA 4ATEA 4AQTA 2HYKA 5A70A 5CFDB 1NKGA 5FZFA 1AYM1 1W0OA 1I3HA 1OFSA 4B1MA 2JKXA 4IEZA 2WDBA 4QU1A 4RD7A 3I2GA 4LUKA 4FPLA 3BYWA 4OQ9A 3VGIA 2ZAHA 4XMAA 3FN9A 5K8SA 4XOGA 5DQ0A 3O1RA 3VZJA 4A7ZA 5L7OC 2WJSA 2LM3A 3W9AA 1AR82 1AYN3 1EUTA 3ZFGA 2WWSA 3NQHA 3OGRA 2ZCWA 1NE4A 4Q26A 1NYWA 4W65A 3CU7A 1FOD3 2OPWA 3I59A 3U4SA 4GH4B 3U0ZA 4N53B 1RUG2 4N43C 4RQPB 4AI1A 3MI8A 4QKDA 2VCCA 3TYJA 3I2FA 3ZSKA 1YWKA 3AMPA 4MV2A 5JZGB 1R092 3SKJE 3ZYJB 5ABJB 1GICA 1TNRA 2LROA 3UKVA 4W6WA 2PFWA 2IWGB 1OI6A 2OKXA 2ARAA 1WMFA 1AUYA 5DAXA 1FX5A 3VKOA 3M70A 1OVPA 3PTYA 3E6CC 3HVDA 4O61A 4BMBA 5EQUA 1AR71 4YW5A 5GZGA 2FCUA 2OS2A 3FUOA 2CSGA 4PF1A 5JMCA 2B39A 1SCSA 4LBMA 2WSUA 4XUNA 1RUC1 5EP9A 4YZ4A 3MLKA 3NV3A 1OKOA 1OPMA 2RHPA 1ENQA 5FPLA 1QJY2 5FY0A 3TEWA 3WHUA 1I1EA 4PQQA 5LASA 3FLRA 3VKLA 5A3TA 2WT1A 5LA0A 1IG3A 2WUHA 3MZHA 2L9LA 4YG6A 2VOKA 5CNAA 5EHDA 3SMHA 4HK9A 2C6SA 4YGBA 1D2SA 5FR3A 3R4SA 3IDEA 3WF3A 2P5BA 4I0WB 3KSCA 1K5MC 4A3ZA 1YFYA 4A6OA 2FZ1A 4B7KA 2D98A 4QKNA 3O1SA 3CIHA 1LOFC 3LFIA 1WLTA 3OGGA 5FRAA 5T50A 1O5UA 1HB3A 2RM23 5GALA 3WDYA 2DDUA 3H50A 1HQWA 2G19A 1BBT1 3NO8A 4QPGA 4CDQC 4CUGA 1LCLA 1WA6X 5DUXA 4ZZ5A 1YQ6A 5JI9A 5SV5A 3VZKA 3WW4A 1MS3A 3VKNA 1W8OA 3ZXLA 3BUCA 4KL1A 3VDDB 1A8MA 1MVQA 4FFHA 5J36A 2HWF3 3R4DB 5FYYA 3WF0A 3VBOC 5FPBA 4O9GA 5ISLA 5DDJ2 5CG9A 1KFXL 1ZZ9A 1JHNA 1JYCA 2ZX2A 2MEV2 4XE9A 3JBG3 4BIFA 2XKPA 2VG9A 5FZLA 1CJDA 3DYPA 4WM8C 4CEYB 2QZ3A 3BODA 4Q4X1 5B2GB 3GM8A 2HKXA 3UKNA 5FP4A 3S0MA 1RGSA 3Q9OA 4D7TA 5FZ0A 5KBFA 3T30A 4AOCA 3S6PA 3E5UA 2BBAA 5C5UA 2RDRA 4RR3B 3RZZA 4CDXB 3U07A 1RUE2 3S7IA 3T3YA 1ZBE2 1QJX1 1M06G 3CQOA 4COYA 4H2AA 1RUH1 3BPZA 3JXSA 3HN1A 1AX1A 3O1PA 2FMDA 3HEIA 2XHKA 3KGLA 4AEDC 1CONA 3ZLIA 5FMBA 1W8TA 3HT1A 4JDNA 4OUSA 1ND2A 1JYVA 2J7MA 1MZFA 3I7DA 5FZMA 3WNXA 5J7MA 2BZDA 3RRDA 1LOGA 4RA0A 1COV2 1JU3A 3IIAA 1RUD2 3O0XA 4KU8A 1CAVB 4MX3A 4AR2A 2VZTA 1JYXA 4ZU7A 4P9YA 4CPBD 1LOAA 2BQPA 3FHQA 1XNAA 3IZOA 4QQ2A 5FZ7A 3LCPA 4MGTA 3AB0A 3DL3A 3FE5A 1W39A 4Q4V3 3LEGA 4Q4Y1 5IK7A 2GH2A 3JD71 4LITA 3T2TA 3RZMA 1E5RA 2NQYA 1NCRC 3LEMA 1UL9A 2JE9A 1S2BA 4V1PA 5FP7A 3ZFEC 1GP4A 1ZX5A 4YRDA 2GC2A 4AFAA 1MS1A 3WQBA 1VBA1 4FTBA 5EXOA 1OLME 5KXBA 1R083 2JECA 1UY3A 3VBRB 1VR3A 4YGCA 3VD9A 4LIUA 4IGQA 2BRTA 3ZXEA 2FDFA 3WLUA 2KM2A 3CBNA 1PGL1 4B8EA 4HKLA 3WP4A 5C7GA 1RXGA 2XBO2 5GZEA 5C3PA 1ST8A 4QMAA 4XPVA 5F5IA 5I93A 2ZBJA 4Z8BA 1UW8A 4FAHA 1IS3A 1POV1 3BTAA 1O4YA 2VCMA 3OYWB 4CDUB 3BVCA 4FPKA 3AMMA 4LO4B 1GZCA 2R7EB 1T6BX 3TEZA 2JB8A 1SDWA 1Z0HA 2E9QA 3IAQA 1UKRA 1O4TA 3AK0A 3MPPG 4K6BA 2BWCA 3R05A 1GZWB 1PK6B 1ULCA 2UURA 3CEWA 4GKXA 4DXSA 2E7QA 1RUJ3 2R043 4PF5A 3TWIA 1PIV3 2ZEWA 3GCXA 1LU1A 1VPHA 5JI7A 5B4XA 1HXS1 5I0SA 2FDGA 3KQ4B 3VBUA 1QU0A 2WL1A 1K45A 1X8MA 1STMA 2CNAA 4PT6A 1FAYA 3MV01 4SBVA 5LB6A 4LT5A 3X29B 4OHXA 2ZEYA 3ACLA 4Q0PA 3VZNA 2E63A 4QHBA 2IVIB 2DU1A 5FMCA 1UYYA 1LHVA 2DUOA 3BOWA 3IDAA 3PLQA 4AVVA 1UZVA 2XGXA 5FYSA 1KJLA 2EA7A 2Z69A 2ZOEB 4FPFA 4LBQA 4UW6A 1UQXA 2HWB1 3VDAA 5DZGA 3WG4A 2CU5A 2JX9A 3ZFFC 1ULGA 1PVXA 3H3UA 4XAEA 3LPFA 1MEC2 5F2WA 2B4KA 1LODA 4RYDA 3U14A 1LULA 3TRSB 2O14A 4P08A 3T1MA 3WDTA 3ZYIB 4I09A 1QQP3 4AHXA 2D97A 3AYEA 1GNHA 2P6CA 1RITA 3MIGA 1VMHA 4JC1A 3POWA 4XBQA 1F5JA 1AXKA 2FDJA 5SV8A 2ERFA 4UF0B 2NMOA 5IVYA 5F39A 1OH4A 2GMPA 1VMJA 1LB2A 2GU9A 1SG3A 2LTNA 1VBC3 3JQXA 4YVSB 4AI3A 5A6YA 2DVDA 1HRI3 1IPKA 2DUPA 3GBGA 4XZPA 1ODMA 3HN3A 4F3JA 1VBE3 3FFQA 3OY8A 4Q2FA 2WNVC 4IETA 3MW3A 4MZUA 4TXWA 4XF9A 1UYXA 1UZYA 2JD9A 2VZ3A 3S5QA 5IK4A 4HONA 4GB33 2RS13 2EAKA 1DGWA 2HBTA 1AR61 1CJPA 3ZN6B 2AENA 2C9AA 4YW4A 1NA1B 4CP9A 3BPSA 2BNMA 2MPFA 4ET7A 1NQJA 5BY5A 1XE0A 3AZZA 3MEPA 5GLVA 3O12A 1S0GA 4FQ4A 3A4UA 4C1XA 1TEIA 3VD5A 1GNYA 5JOYA 4B4RA 5FZOA 2GC0A 5FZCA 1QWRA 4JGZA 3KB5A 3ZSJA 1TE1B 2PHWA 3ABZA 4LBJA 4AXOA 5JXJA 2CWMA 2VQUA 3EQEA 1UU5A 4NE9A 4QPYA 3P6BA 1E5IA 4B7EA 2VR4A 2GZWA 4H55A 4JTOA 4IEYA 3UESA 2AGSA 2O1QA 1JI6A 1GQGA 1N3PA 1YCIA 3H9AA 1SFYA 2A7AA 2WAOA 3HR9A 4LTAA 5F5CA 2CAVA 2YHJA 4MGZE 3H8RA 4PI2A 1TZOA 1CESA 4HKOA 4XDPA 5DPNA 1Z7S3 1XQNA 5I0RA 1SQ4A 1UPIA 1N47A 3WD5A 3I3DA 4LHNA 5FOJB 2ZX4A 4KWLA 3ECQA 1PO11 1AXYA 1U5ZA 2JG9B 1EV12 4IEOA 1JBCA 5T3NA 3U78A 3VHNA 5A1LA 2NMNA 3I3EA 2VVDA 5AFBA 1IKQA 4K1ZA 1QHDA 1DQ4A 1QIQA 1ZA4A 4EYUA 2YV8A 3KHBA 3PVBB 2OPKA 2VQ0A 4IGPA 4XHBA 4BQYA 1JZ6A 1AYM3 2G4IA 1WBFA 5BNOA 2EXHA 3V64A 4KWUA 3RZHA 3AP5A 5FYMA 1J1TA 1AZDA 3B3QE 4B4QA 4TLGA 1PMJX 1HJGA 3LPGA 3ZFGB 1JZ7A 5JXHA 1XXNA 4JRAA 3QH6A 2CGPA 3BIEA 5FCCA 2ZZQA 3I59B 1UXZA 4XUOA 5FZBA 3RZKA 3GHNA 3MW4A 2GP3A 2VXJA 4MXWA 1C5IA 1RUI1 3WP5A 1ND3A 1WZXA 2WN2A 5FZ8A 1ZZ8A 1ASJ2 5CEHA 5LY2A 2NN8A 2CY6A 1MPXA 3ZKUA 4HPKB 1N3QA 5FZIA 3H7YA 2P1BA 5EV7A 5FY8A 5IAVA 2BPA2 4Z92B 3MW2A 5AVAA 2JE7A 3VKFC 2J1RA 2Y64A 5AC92 3Q8CA 3D6EA 4ZZ8A 3S5AA 3CMGA 3I2JA 5KHIA 4KH9A 1ULPA 1CAXA 1W6MA 3MIFA 3NRUA 2Q8OA 4QXHA 4CCNA 3Q8BA 1AR73 2FDHA 3E97A 4BK5A 2OQ7A 5JXIA 2HEWF 3N7JA 3ACHA 4QGNA 3EJKA 5A80A 2W92A 1RUC3 1R1ZA 2RS53 2VTXJ 3FBMA 5FQ0B 5A7SA 3AFKA 5C9AA 1F2NA 3R6SA 1UMZA 4LBNA 1ZVFA 3I2KA 4O9EA 2FBEA 4OFGA 5FY4A 3VBSC 5L73A 3ASIA 1B35A 2D6PA 4Y22B 5A33A 5ACA2 5K0UB 3ZYPA 2WO3A 3D8CA 3N3HA 1KDKA 4DEVA 1Y9QA 1VRH3 4HMZA 1RHI1 4XCBA 1IS5A 2BP6A 2WS93 4A45A 2Q1FA 3Q8EA 4QB2A 4TLFA 1UWWA 2WQ8A 3ZYHA 4LA3A 1LR5A 4A44A 5FWJA 5FP9A 5FYVA 1PNFA 3D4KA 4NIAA 1XU2A 3TN92 2ZHMA 4XXAA 5CFCA 4IUGA 3WY6A 3N9PA 5JWPA 5BNPC 5CADA 1BBT3 2DF7A 1JMUB 2DCJA 5C4WA 1W8HA 2DVFA 3URFA 3CLPA 2VQTA 4OZOA 5FZ6A 2QVSB 4MGYE 3VV1A 3ZSMA 4D8MA 1MS0A 1R64A 2RDSA 4LO7A 2RR12 4CDWA 2AACA 4SLIA 3O1MA 3LIHA 4Q4W3 3AKSA 4GULA 3VBFB 3RPQA 1UOBA 4WM7B 3ZR5A 2ZGNA 3MIBA 3OCPA 4YW2A 1O3RA 1BCXA 2VZPA 1WLDA 1N1YA 2VOXA 3ENRA 4K7JA 4KG8A 1Q8VA 1UOJA 3NAPA 2XR4A 1UKGA 4E4SA 4L11A 4Q4X3 1M4WA 2VGDA 5DG1A 1H2LA 1RIRA 3JBG1 3RG0A 4QPIA 4OZXA 1QJU2 3T09A 2HWC2 3C7EA 2G9FA 2RMU3 4LHKA 4NO4A 3H3LA 4AG4A 1D4M2 3MIDA 2R071 1QJX3 2VNGA 4LBKA 4WV8A 1C3HA 3K4AA 1RUH3 5I0TA 3OGVA 1IZ3A 1A6CA 3LEIA 4RFT0 2C9KA 3LFMA 3AFGA 4JKKA 5L7OA 4BQ5A 2ZHLA 3NW4A 4FOWA 3H1MA 2P3YA 3ZXKA 2N7GA 4IEPA 4DOUA 5APAA 1SBEA 4XIKA 4D3WA 5E88A 3P1IA 2OVUA 4XILA 1AJKA 1DG6A 4N43A 3SITA 4FFIA 1S2EA 1CX1A 2AYHA 2Y0OA 1W9WA 1RJ8A 2DBNA 3PUAA 5BPXA 4HLTA 2Q0AA 4Q4Y3 4CSWA 1SLCA 3PDQA 3GJBA 2BV4A 3HBKA 2K9ZA 5KC6A 4LJHA 4NN0A 4XABA 5IT6A 2VMFA 2JB4A 4GIQA 2BWAA 4D0QA 1POV0 2GMEA 4QGLA 4QM9A 1VBA3 3B01A 4Q0SA 4HT1T 1WCSA 4META 3N35A 2WT2A 2ZPXA 3RJ2X 1FATA 2OUJA 5A3LA 1BMV1 3B94A 5LK7B 4QHOA 5EJ3A 3RGBA 1R081 1NLSA 1AYN2 1YQ8A 3PMSA 1HW5A 3OPWA 3W5MA 4Q27A 1FOD2 2K2SA 2YC0A 4M01A 3ZOIA 1O7FA 4GJYA 4IL7A 4EN0A 1JYIA 4YPJA 4UFJA 1K5MA 2UYBA 3ZXFA 4M4RA 2PHUA 1FYUA 4AFBA 2GH8A 1LOFA 1JOPA 1US2A 4IERA 2A71A 5JUVA 3J26N 3BI3A 4CDQA 2X53S 4YGDA 4B1LA 1V9U1 4IE7A 4DXTA 1SPPB 3ZKYA 2VUAA 3VBUB 5KHGA 4IV3B 5HV0A 3OUIA 1WMXA 1GOFA 1O6UA 4Q0VA 3DV8A 4NAOA 5JIUA 1OF3A 5CZKA 1W8FA 3HD8B 2R041 4YZ3A 3VBOA 4XJ9A 5T5JA 4AW7A 3F95A 2R1DA 3VN4A 4UFLA 5F37A 2FCTA 5IAXA 4QHZA 3V56A 3V0AB 2YY1A 5FUNA 2ADDA 4QXBA 5CFCC 4K1YA 1W06A 2DU0A 1LOCA 4QM8A 3DGTA 4WM8A 1RUNA 4LBQB 4YFWA 3KLSA 4I30A 2R16A 3LIGA 4ZHNA 1W2AX 1V00A 1OA2A 2XH6A 3AP6A 3B9CA 2JE8A 4FOYA 5FXWA 5A7NA 2ZA9A 2Y34A 3B02A 1JYWA 3BN6A 3SH3A 4C0HA 2ZGRA 4BA6A 2E7TA 5H9QA 1WWYA 2K0GA 2RM22 4E4ZA 1JZ2A 1UMIA 4KMQA 2VCAA 3AJYA 3K2OA 4IV1C 1LGCA 4YM3A 4AEDA 1RMU2 1DQ2A 1EPZA 2XVKA 1ZRDA 3IM0A 4H3WA 4MUVA 4D7SA 5H9RA 1ND3C 4YW7A 1W9SA 2HWF2 2YC2A 4ORFA 1SFNA 5L9BA 4HSJA 1HKDA 2XQRA 4GQ7A 5FK7A 2ZXQA 2OW4A 2PAMA 3HQRA 5FP3A 2WLQA 3HBZA 2D6KA 1H9WA 1DGLA 1UU6A 1ENRA 4GWMA 2VD7A 5C8WA 1G9DA 1W03A 4FTSA 1VBC1 4XURA 4OHWA 1DDLA 2ZJCA 3KVAA 1HRI1 5CFDC 5FBJA 4OHYA 2I07B 1PVC1 4MGQA 3WQ7A 3HAGA 5FZ1A 4AFCA 2RDNA 2Q5TA 2YBPA 1NCRA 4CCDA 1HJFA 3ZXGA 1AR63 2LALA 3OJBA 4HN1A 3ZFEA 4XQ4A 4CCEA 2WQ4A 1N3OA 2C1FA 2VAUA 3KT1A 3W5NA 1ENSA 1NAEA 3NJZA 2PMWB 4S2GA 1I5ZA 3F2ZA 1TQ5A 1ZM1A 5FZOB 3S30A 2X05A 1BEV2 2Y6FA 2PELA 1C57A 3I3QA 4GH4C 5JOZA 1CAUA 3LA2A 5GZCA 4N53C 3M1HA 3W20A 1VRBA 3N7KA 2HWD2 3USUB 5T55A 4TN7A 3SLIA 1AHSA 1H30A 3GZTB 1IHMA 4YW6A 3QD6A 1YI7A 4UFMA 1SBFA 4PBPA 4RL7A 1Q5OA 2BFUL 1OT5A 2FMYA 4BQWA 4QB6A 3I49A 4P5HA 1QOSA 2V5DA 2D5HA 1UF2C 1LRHA 3U1XA 1RUF3 2JD4A 4Q4V2 4EN9B 3M3OA 5AVPA 5I91A 1C8M2 4MYEA 2XMLA 1LGBA 1RVF1 1QNYA 1AR93 3LGRA 1BHGA 2WYFA 2X29A 4E2SA 2PAEA 2ORXA 3O0VA 2V72A 2NP0A 4TYSA 3U4XA 1OA4A 1W90A 3OEAA 4I02A 4QX3A 1CAWA 3PNAA 3WHTA 2B46X 3EBRA 4ZS2A 1S0IA 3PU8A 3WUDA 3D82A 2D44A 2XLFA 3OF1A 4BLJA 1AVBA 2W08A 4CCOA 5A1AA 1SCRA 3C2UA 2WFF1 2PHDA 4EROA 1IQDC 4KGQA 4P9JA 2WO2A 4QU2A 5FP8A 5F3CA 4QX5A 5KXCA 5FXZA 5K4LA 4COUA 3N7LA 2ZABA 4R9DA 2E33A 5KHHA 4X6RB 2HWE2 2Y38A 2XPJA 3CZUA 3ZFFA 5A3NA 5C8CB 4URAA 4FXGB 2J42A 1W9FA 3RSJA 4XUTA 3H8OA 4CYDA 3APBA 3ETQA 2VMDA 1RUI3 1QXRA 5F3EA 3VDDC 4BQ2A 3N9LA 1AXZA 3T0AA 4XDOA 4BMEA 2A3WA 3K46A 1RUJ2 1CIYA 2XWJB 4MGSA 2R042 5G05L 3KHCA 1PIV2 2W47A 2NLRA 1TME2 3ITQA 5L9VA 4NROA 2VL4A 1ZRCA 2QQJA 2QDNA 4W8JA 5F7UA 4R8HA 1AJOA 1CD3G 4AAXA 4CVUA 4NMIA 4DRRA 2WC2A 1KS5A 1W8UA 4YVWB 4A4AA 4FFGA 2JIJA 2LRPA 2OX0A 5LBCA 4A41A 3AKQA 5HCHA 4RR3C 3E1F1 3LOIA 4CDXC 2VTFA 5JOXA 2VJXA 2VMGA 1DCSA 2WNVA 4ZXKA 1XNDA 4LK7A 2PHLA 2RDQA 3M7AA 5F6LB 1XYNA 2ZGOA 5F6KA 4CU6A 3ZXAC 4XYXA 4BXSV 3HMYA 4JHZA 4Y3OA 4HBNA 5A33B 3NL1A 4LUMA 3I2HA 3J9SA 5D8AB 2RS51 5FYBA 2W91A 4R9BA 4AVBA 3ELNA 1JXNA 1T2XA 4OMCA 3VKMA 3EMRA 5FZAA 2IFWA 1QQP2 3GALA 2WA3A 4QXCA 4LOSA 1RHI3 5CISA 1H8TB 4UI9L 1OOPC 4LKSA 3NV2A 1U0AA 3RI9A 2WZR1 3BB6A 1VRH1 2WS91 1J3QA 1YJKA 5HCBA 1VBD1 2B9VA 4L99A 1YQ5A 4KBZA 4XF0A 4LKEA 4DINB 5JR2A 1LAJA 1GWKA 1S1AA 2EXJA 1WLWA 3MPBA 3WUCA 2F4PA 1H1AA 2YC4A 5IVJA 4FFFA 2QE3A 1VBE2 4D6RA 1CX4A 2V4VA 1RJ7A 3E5XA 3PURA 4UAPA 3T08A 1GV9A 1RTVA 4YM0A 3GNEA 3AMHA 4DFSA 1MACA 4Y20B 4GZ9A 1J59A 4QGMA 2D5FA 4GB32 2RS12 4B29A 5I8TA 2UWBA 1W04A 3UGGA 2ZHKA 3MFCA 1PM4A 1Q56A 4Q4W1 2PLV1 1E5SA 2JDHA 2VUDA 1Q8SA 2CGOA 2XLGA 3MF6A 4XUPA 3IN9A 5E16A 4BDVB 4FPCA 4OYUA 1YJLA 3I2OA 4CCKA 1ZBA3 4UBHA 1S0BA 5FYTA 4FXKB 4YYOA 1L7LA 3OSDA 2P3JA 4Y4RA 5I0DA 4XJUA 1OLMA 2BW8A 2GP5A 2LUWA 5T5LA 1GYKA 3OBTA 5BNNC 4HVOA 2XG3A 3BTXA 2R073 1QH6A 1VIWB 2ZGUA 5D1IA 4CUCA 2RMU1 3U10A 1OA3A 3UGFA 3I2DA 2Y6HA 3JCIA 3ZPYA 1PK6C 1PZ7A 4BPZA 2ZX1A 2Z4FA 2JENA 5CKQA 3WDVA 1UMHA 3O14A 3POSA 2DCKA 1GZ9A 1Z7S2 3IIIA 3K51A 4URTA 5F9TA 1U12A 2QQUA 4DRVA 2VOVA 3KMHA 4N8MA 4OMDA 3M8LA 1IGOA 4Y5TA 1EAH2 2W0XA 3DKWA 5CA6A 4O65A 1RINA 2XVGA 1ZA7A 4A7YA 2GNDA 3IDBB 3W59A 4TWTA 2VNOA 1GQHA 1G8WA 2E7AA 4ZU4A 2PN5A 3CF6E 1H8VA 2D6OX 1AYM2 2JEMA 3IDCB 5FBZA 4C90A 3OG2A 4HN0A 4JAAA 4NAMA 3LDKA 4AVTA 5LZ6A 1PGW1 3ON7A 2VH9A 4QDQA 4M3CB 1VB4A 2VNVA 5GLWA 1YXWA 3O1UA 2EICA 3VBSA
chains in the Genus database with same CATH topology
1W8NA 3FL7A 1JZ6A 2KD7A 5B4NA 2J22A 1EUUA 3ACGA 4KWUA 3WNMA 2RVAA 4DXRA 3T0DA 1PMJX 4QDRA 3LPGA 3WNLA 1JZ7A 5JXHA 2XOMA 1TVGA 4XUOA 1UXZA 2BERA 4ZY9A 3MUZ1 2WN2A 1GQPA 2WAAA 4ZXEA 4RN5A 2W1QA 4CUBA 1MPXA 2YFUA 1US3A 4JKLA 2JDAA 2WZ8A 1NX9A 3A7QA 2WYSA 2J1RA 5C70A 4HG6B 2Y64A 2ZEZA 3T0BA 4ZZ8A 2VMCA 2RJ2A 1XC6A 2VZVA 3CMGA 3I2JA 3OB8A 1ULPA 3NRUA 2VZQA 4LQRA 4FI9A 3VD7A 4BK4A 4BK5A 5JXIA 4L0PA 3ACHA 2W92A 5HPOA 1UY4A 5DMYA 3PUHA 2X10A 1W0NA 4GWIA 3IAPA 3OGSA 3HOBA 1XNTA 3I2KA 5IFTA 1XPWA 4CU8A 2WO3A 4DEVA 1K42A 4MO3M 4A45A 4QX0A 1SHWB 4GWJA 4QB2A 1UWWA 2WQ8A 4A44A 3SEEA 1NUKA 3HNBM 1GOGA 2XQXA 3NJVA 4IUGA 2EIBA 2XHNA 3MUY1 3U37A 3HPNA 2DCJA 2VQTA 4OZOA 4CU9A 2YG0A 5IFPA 3A22A 1F4HA 4D8MA 1R64A 1GU3A 2YFZA 2QQIA 4QB1A 3WEZA 3D3AA 3VDBA 2VZPA 4UOJA 5G04L 1UY0A 2Y6LA 4CUAA 4KI5M 3C7OA 1GUIA 4Z2AA 3UNPA 2VZSA 3T09A 3C7EA 4DUWA 3EB7A 3THDA 3T2PA 4AG4A 2PQSA 5EJZB 2VMEA 4LPLA 2E26A 3K4AA 3OGVA 2Y8KA 3LQCA 3LEIA 2C9KA 3K4ZA 4JKKA 1YQ2A 1JYNA 2VCBA 2W87A 1ULOA 4OUEA 3ACIA 5J1XA 2C26A 1LNSA 1WCQA 3P1IA 1JZ8A 4ARYA 1GMMA 3WNNA 1CX1A 3C8XA 1W9WA 3GDBA 4LHSA 1O8PA 3I97A 2Y6KA 1UXXX 5EJ1B 2VMFA 1L7QA 3DECA 2QQNA 1CZSA 3IB3A 3NJXA 1O8SA 4D0QA 4M4PA 1H6YA 2J1AA 4W50A 3CKHA 2QBXA 2HYXA 3I3BA 3K4DA 2J1EA 3J7HA 3W5MA 4JKMA 3VD4A 3PUIA 2W3JA 3T2OA 2BGOA 1NKGA 2JKXA 2WDBA 2RV9A 2J1VA 1K12A 4P00B 4YPJA 3I2GA 3HNMA 1OD3A 4M4RA 3FN9A 5DQ0A 3T2QA 1US2A 4A42A 5JUVA 1EUTA 3NQHA 3OGRA 4W4ZA 5IJRA 4DXTA 2QQMA 3WNPA 1GOFA 2VCCA 1OF3A 5CZKA 3I2FA 2J1TA 4XUQA 2YB7A 3SKJE 4P5YA 2WABA 2OKXA 4E8CA 2JE8A 1D7PM 4PF1A 1JYWA 3BN6A 3WNOA 4XUNA 3HJRA 3WNKA 1JZ2A 4PQQA 1UMIA 4KMQA 2VCAA 5LA0A 2WUHA 5CYYA 4DUVA 2L9LA 3NNGA 3WF3A 1W9SA 2YC2A 3VDCA 3ETPA 3GGLA 4A3ZA 2W1SA 4A6OA 2ZXQA 3CIHA 4BDVB 1PX3A 1H6XA 2DDUA 3MV11 4ZZ5A 4XURA 1W8OA 4MGQA 3A21A 1F4AA 5JXGA 3WF0A 3THCA 3EYPA 2ZEXA 4QAWA 1KEXA 3W5NA 1NAEA 2XONA 3DYPA 3F2ZA 2CDOA 2VZRA 2EIEA 3GM8A 2X05A 3ACFA 5FUIA 2Y6GA 3C7GA 4XVHA 1O59A 2BBAA 5LCWL 4DEQA 3UETA 1L7RA 4QX2A 1DP0A 2EIDA 3AC0A 3CQOA 1OT5A 1CZVA 3JXSA 4QB6A 2V5DA 3HEIA 5IYYA 3C7HA 1DYOA 1JYVA 2VO5A 2CDPA 2J7MA 1BHGA 2BZDA 2ORXA 3OEBA 1JU3A 4QX1A 2V72A 1JYXA 2VZTA 3SKVA 3OEAA 4QX3A 3WF2A 3FHQA 1UX7A 1XNAA 3LE0A 5HXMA 3MO4A 1JZ3A 3ZM8A 1K3IA 3GXUA 2W94A 2E31A 3LEGA 1UZ0A 5A1AA 5JMOA 1IQDC 2WO2A 4CU7A 3I2IA 3WQBA 2W5FA 2E33A 1UY3A 3VD9A 3CZJA 2QQLA 2Y6JA 3CZUA 2WO1A 3CDZB 4XUTA 5C7GA 2VMDA 1J84A 3T0AA 3K46A 4MGSA 1CIYA 5G05L 2W47A 2C4XA 2VL4A 2QQJA 3C7FA 1SDDB 5LA1A 4XZUG 2E32A 4W8JA 5F7UA 2R7EB 4AAXA 4CVUA 1JZ5A 3IAQA 5EIYB 4A4AA 2VZOA 4A41A 5C71A 4DXSA 1W99A 3E1F1 2J1UA 2VC9A 3K75B 2VTFA 2W1UA 2ZEWA 2VJXA 4JX0A 1P8JA 1OF4A 1TG7A 5B4XA 2ORZA 3WSOA 4CU6A 1RYYA 1K45A 4PT6A 4BXSV 1W9TA 3MV01 4JHZA 2W95A 2ZEYA 2W1WA 3I2HA 2W91A 1UYYA 1T2XA 3HNYM 2BGPA 4OMCA 3IDAA 4QPWA 2X09A 3FHAA 4ARXA 4UI9L 4LKSA 1HN1A 2VZ1A 2W46A 3VDAA 2B9VA 5JR2A 3LPFA 1GOHA 2B4KA 4RYDA 3K77A 2YC4A 2W9XA 4P08A 4UAPA 2V4VA 4E8DA 1WKYA 3T08A 2WBKA 2WN3A 4GZ9A 4P02B 2HLEA 5IHRA 1OH4A 3MBWA 1SG3A 1J83A 4XUPA 3WF1A 2LW8A 4OYUA 1UY1A 3HN3A 2VOTA 3DYMA 1JU4A 4TXWA 1KGYA 1PMHX 1UY2A 5I0DA 3A23A 1UYXA 2JD9A 2VZ3A 1I5PA 2QQOA 1CZTA 2VM9A 4CUCA 2WZEA 2VZUA 4ET7A 3BGAA 2Y6HA 5LA2A 3VD5A 1GNYA 1JZ4A 3OBAA 2Z4FA 1DLCA 1UMHA 3DYOA 2DCKA 1JHJA 3IIIA 5DN2A 2J1SA 4MOAA 3ABZA 4OMDA 5JXJA 4TTGA 2VQUA 2QQKA 3VD3A 3P6BA 2VR4A 3UESA 1JI6A 2WAOA 3LEKA 2LS6A 4QDSA 4DUXA 2ID4A 3SEPA 4MADA 5DPNA 4BJ0A 3OG2A 1UYZA 3I3DA 3WF4A 3ECQA 4QDQA 1PX4A 3I3EA 2EICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8N A;  3FL7 A;  1JZ6 A;  2KD7 A;  5B4N A;  2J22 A;  1EUU A;  3ACG A;  4KWU A;  3WNM A;  2RVA A;  4DXR A;  3T0D A;  1PMJ X;  4QDR A;  3LPG A;  3WNL A;  1JZ7 A;  5JXH A;  2XOM A;  1TVG A;  4XUO A;  1UXZ A;  2BER A;  4ZY9 A;  3MUZ 1;  2WN2 A;  1GQP A;  2WAA A;  4ZXE A;  4RN5 A;  2W1Q A;  4CUB A;  1MPX A;  2YFU A;  1US3 A;  4JKL A;  2JDA A;  2WZ8 A;  1NX9 A;  3A7Q A;  2WYS A;  2J1R A;  5C70 A;  4HG6 B;  2Y64 A;  2ZEZ A;  3T0B A;  4ZZ8 A;  2VMC A;  2RJ2 A;  1XC6 A;  2VZV A;  3CMG A;  3I2J A;  3OB8 A;  1ULP A;  3NRU A;  2VZQ A;  4LQR A;  4FI9 A;  3VD7 A;  4BK4 A;  4BK5 A;  5JXI A;  4L0P A;  3ACH A;  2W92 A;  5HPO A;  1UY4 A;  5DMY A;  3PUH A;  2X10 A;  1W0N A;  4GWI A;  3IAP A;  3OGS A;  3HOB A;  1XNT A;  3I2K A;  5IFT A;  1XPW A;  4CU8 A;  2WO3 A;  4DEV A;  1K42 A;  4MO3 M;  4A45 A;  4QX0 A;  1SHW B;  4GWJ A;  4QB2 A;  1UWW A;  2WQ8 A;  4A44 A;  3SEE A;  1NUK A;  3HNB M;  1GOG A;  2XQX A;  3NJV A;  4IUG A;  2EIB A;  2XHN A;  3MUY 1;  3U37 A;  3HPN A;  2DCJ A;  2VQT A;  4OZO A;  4CU9 A;  2YG0 A;  5IFP A;  3A22 A;  1F4H A;  4D8M A;  1R64 A;  1GU3 A;  2YFZ A;  2QQI A;  4QB1 A;  3WEZ A;  3D3A A;  3VDB A;  2VZP A;  4UOJ A;  5G04 L;  1UY0 A;  2Y6L A;  4CUA A;  4KI5 M;  3C7O A;  1GUI A;  4Z2A A;  3UNP A;  2VZS A;  3T09 A;  3C7E A;  4DUW A;  3EB7 A;  3THD A;  3T2P A;  4AG4 A;  2PQS A;  5EJZ B;  2VME A;  4LPL A;  2E26 A;  3K4A A;  3OGV A;  2Y8K A;  3LQC A;  3LEI A;  2C9K A;  3K4Z A;  4JKK A;  1YQ2 A;  1JYN A;  2VCB A;  2W87 A;  1ULO A;  4OUE A;  3ACI A;  5J1X A;  2C26 A;  1LNS A;  1WCQ A;  3P1I A;  1JZ8 A;  4ARY A;  1GMM A;  3WNN A;  1CX1 A;  3C8X A;  1W9W A;  3GDB A;  4LHS A;  1O8P A;  3I97 A;  2Y6K A;  1UXX X;  5EJ1 B;  2VMF A;  1L7Q A;  3DEC A;  2QQN A;  1CZS A;  3IB3 A;  3NJX A;  1O8S A;  4D0Q A;  4M4P A;  1H6Y A;  2J1A A;  4W50 A;  3CKH A;  2QBX A;  2HYX A;  3I3B A;  3K4D A;  2J1E A;  3J7H A;  3W5M A;  4JKM A;  3VD4 A;  3PUI A;  2W3J A;  3T2O A;  2BGO A;  1NKG A;  2JKX A;  2WDB A;  2RV9 A;  2J1V A;  1K12 A;  4P00 B;  4YPJ A;  3I2G A;  3HNM A;  1OD3 A;  4M4R A;  3FN9 A;  5DQ0 A;  3T2Q A;  1US2 A;  4A42 A;  5JUV A;  1EUT A;  3NQH A;  3OGR A;  4W4Z A;  5IJR A;  4DXT A;  2QQM A;  3WNP A;  1GOF A;  2VCC A;  1OF3 A;  5CZK A;  3I2F A;  2J1T A;  4XUQ A;  2YB7 A;  3SKJ E;  4P5Y A;  2WAB A;  2OKX A;  4E8C A;  2JE8 A;  1D7P M;  4PF1 A;  1JYW A;  3BN6 A;  3WNO A;  4XUN A;  3HJR A;  3WNK A;  1JZ2 A;  4PQQ A;  1UMI A;  4KMQ A;  2VCA A;  5LA0 A;  2WUH A;  5CYY A;  4DUV A;  2L9L A;  3NNG A;  3WF3 A;  1W9S A;  2YC2 A;  3VDC A;  3ETP A;  3GGL A;  4A3Z A;  2W1S A;  4A6O A;  2ZXQ A;  3CIH A;  4BDV B;  1PX3 A;  1H6X A;  2DDU A;  3MV1 1;  4ZZ5 A;  4XUR A;  1W8O A;  4MGQ A;  3A21 A;  1F4A A;  5JXG A;  3WF0 A;  3THC A;  3EYP A;  2ZEX A;  4QAW A;  1KEX A;  3W5N A;  1NAE A;  2XON A;  3DYP A;  3F2Z A;  2CDO A;  2VZR A;  2EIE A;  3GM8 A;  2X05 A;  3ACF A;  5FUI A;  2Y6G A;  3C7G A;  4XVH A;  1O59 A;  2BBA A;  5LCW L;  4DEQ A;  3UET A;  1L7R A;  4QX2 A;  1DP0 A;  2EID A;  3AC0 A;  3CQO A;  1OT5 A;  1CZV A;  3JXS A;  4QB6 A;  2V5D A;  3HEI A;  5IYY A;  3C7H A;  1DYO A;  1JYV A;  2VO5 A;  2CDP A;  2J7M A;  1BHG A;  2BZD A;  2ORX A;  3OEB A;  1JU3 A;  4QX1 A;  2V72 A;  1JYX A;  2VZT A;  3SKV A;  3OEA A;  4QX3 A;  3WF2 A;  3FHQ A;  1UX7 A;  1XNA A;  3LE0 A;  5HXM A;  3MO4 A;  1JZ3 A;  3ZM8 A;  1K3I A;  3GXU A;  2W94 A;  2E31 A;  3LEG A;  1UZ0 A;  5A1A A;  5JMO A;  1IQD C;  2WO2 A;  4CU7 A;  3I2I A;  3WQB A;  2W5F A;  2E33 A;  1UY3 A;  3VD9 A;  3CZJ A;  2QQL A;  2Y6J A;  3CZU A;  2WO1 A;  3CDZ B;  4XUT A;  5C7G A;  2VMD A;  1J84 A;  3T0A A;  3K46 A;  4MGS A;  1CIY A;  5G05 L;  2W47 A;  2C4X A;  2VL4 A;  2QQJ A;  3C7F A;  1SDD B;  5LA1 A;  4XZU G;  2E32 A;  4W8J A;  5F7U A;  2R7E B;  4AAX A;  4CVU A;  1JZ5 A;  3IAQ A;  5EIY B;  4A4A A;  2VZO A;  4A41 A;  5C71 A;  4DXS A;  1W99 A;  3E1F 1;  2J1U A;  2VC9 A;  3K75 B;  2VTF A;  2W1U A;  2ZEW A;  2VJX A;  4JX0 A;  1P8J A;  1OF4 A;  1TG7 A;  5B4X A;  2ORZ A;  3WSO A;  4CU6 A;  1RYY A;  1K45 A;  4PT6 A;  4BXS V;  1W9T A;  3MV0 1;  4JHZ A;  2W95 A;  2ZEY A;  2W1W A;  3I2H A;  2W91 A;  1UYY A;  1T2X A;  3HNY M;  2BGP A;  4OMC A;  3IDA A;  4QPW A;  2X09 A;  3FHA A;  4ARX A;  4UI9 L;  4LKS A;  1HN1 A;  2VZ1 A;  2W46 A;  3VDA A;  2B9V A;  5JR2 A;  3LPF A;  1GOH A;  2B4K A;  4RYD A;  3K77 A;  2YC4 A;  2W9X A;  4P08 A;  4UAP A;  2V4V A;  4E8D A;  1WKY A;  3T08 A;  2WBK A;  2WN3 A;  4GZ9 A;  4P02 B;  2HLE A;  5IHR A;  1OH4 A;  3MBW A;  1SG3 A;  1J83 A;  4XUP A;  3WF1 A;  2LW8 A;  4OYU A;  1UY1 A;  3HN3 A;  2VOT A;  3DYM A;  1JU4 A;  4TXW A;  1KGY A;  1PMH X;  1UY2 A;  5I0D A;  3A23 A;  1UYX A;  2JD9 A;  2VZ3 A;  1I5P A;  2QQO A;  1CZT A;  2VM9 A;  4CUC A;  2WZE A;  2VZU A;  4ET7 A;  3BGA A;  2Y6H A;  5LA2 A;  3VD5 A;  1GNY A;  1JZ4 A;  3OBA A;  2Z4F A;  1DLC A;  1UMH A;  3DYO A;  2DCK A;  1JHJ A;  3III A;  5DN2 A;  2J1S A;  4MOA A;  3ABZ A;  4OMD A;  5JXJ A;  4TTG A;  2VQU A;  2QQK A;  3VD3 A;  3P6B A;  2VR4 A;  3UES A;  1JI6 A;  2WAO A;  3LEK A;  2LS6 A;  4QDS A;  4DUX A;  2ID4 A;  3SEP A;  4MAD A;  5DPN A;  4BJ0 A;  3OG2 A;  1UYZ A;  3I3D A;  3WF4 A;  3ECQ A;  4QDQ A;  1PX4 A;  3I3E A;  2EIC A; 
#chains in the Genus database with same CATH topology
 4PI0 A;  5FPX A;  1OUR A;  4JGY B;  4ASL A;  2OZJ A;  3H42 B;  3J7M A;  3ZVX A;  2KD7 A;  5B4N A;  4G4F A;  1G9C A;  1R1A 1;  4C91 A;  1EPW A;  5JAX A;  2WNU C;  5HXV A;  2WA4 A;  2DCY A;  1UD1 A;  3AJZ A;  1APN A;  1V6L A;  4QDR A;  5JOW A;  2YZ4 A;  4NHM A;  4IEW A;  2OXB A;  1MS8 A;  4NRQ A;  3AVR A;  4FPH A;  1JOB A;  5BNP A;  4BQ1 A;  5IK8 A;  4ZY9 A;  2VW2 A;  3MUZ 1;  1V9U 3;  4LKD A;  5GM0 A;  2BTV C;  1GQP A;  3LZZ A;  3LOB A;  4HVQ A;  1AR7 2;  2CYF A;  4B3N A;  4GJZ A;  4CUB A;  5BUV A;  1QGL A;  3FUQ A;  1PMI A;  4BOW A;  4DB5 A;  1RUC 2;  1US3 A;  5JPN B;  4JKL A;  2YU2 A;  3HT2 A;  4CEW B;  4TZD A;  2ZGQ A;  4IE4 A;  1GFF 2;  1H4H A;  2JG8 B;  2RS3 3;  2P34 A;  4N7I A;  5FMO L;  5FY1 A;  2R32 A;  2XJT A;  3Q8A A;  3T0B A;  4AHY A;  3MIE A;  3NV4 A;  3L2Y A;  4R4Z A;  1PNG A;  5F3G A;  3OB8 A;  3UV9 A;  3NNF A;  1XBF A;  4L2N A;  3RWN A;  2ETE A;  2VNR A;  5F3I A;  4AF9 A;  3WG1 A;  4AQ6 A;  1W6P A;  2A75 A;  2BU9 A;  4LE4 A;  1O3S A;  4FI9 A;  4AI9 A;  1HQN A;  5FZH A;  2VVF A;  1UY4 A;  2TEP A;  2VE1 A;  2JKB A;  5FZ3 A;  3SHR A;  5HPO A;  3N36 A;  3K3O A;  4Y5S A;  1AR8 3;  1RL3 A;  3POI A;  4QXK A;  4XQD A;  4LO6 B;  5GJ6 A;  2YMZ A;  3ZXJ A;  5FO9 B;  3BCW A;  5IVF A;  3RYP A;  1O4Z A;  1BBT 2;  4CU8 A;  2DVA A;  4NIH A;  3VL8 A;  2AEZ A;  4CP1 A;  5FDB A;  4HFS A;  4FPE A;  3RYK A;  1NZI A;  3H7J A;  4YG3 A;  2UWA A;  4QX0 A;  1SHW B;  3O7O A;  4GMP 1;  4W6Y A;  4LO5 B;  4RS5 B;  4EZ4 A;  4CCC A;  4GWJ A;  1RED A;  5A32 A;  2Z42 A;  1GZT A;  1R09 3;  2W52 A;  4PQ9 A;  5HCA A;  1VLN A;  1NUK A;  2DCT A;  1GOG A;  3RMX A;  4LXL A;  4XDQ A;  5FZ9 A;  3NJV A;  2YPD A;  1WGP A;  4S2H A;  4Q4X 2;  1IS6 A;  1OQD A;  4WVM A;  5FKC A;  3S7E A;  1TNF A;  3A0K A;  3O1O A;  2YG0 A;  1W8Z A;  1PVC 3;  1F4H A;  1GU3 A;  2YFZ A;  2XWB B;  5LW9 A;  2YPJ A;  1LHN A;  2XKO A;  3T1L A;  1WW5 A;  4Z2W A;  2A1X A;  2YYO A;  2WWU A;  3V0B A;  2PHT A;  3D3A A;  1OQ1 A;  3VDB A;  3BIW E;  1VE0 A;  2BEO A;  2XUM A;  1D2Q A;  1QJX 2;  3POF A;  1UY0 A;  4KU7 A;  5EYX A;  1RUH 2;  3CL1 A;  3LSE A;  2X5I B;  5G04 L;  4CUA A;  5FYZ A;  1QEX A;  1OD5 A;  3CJI C;  4TSV A;  1XE7 A;  3C7O A;  1JN2 P;  3IBM A;  3I3M A;  5DZE A;  2JDM A;  4JRL A;  4Z2A A;  3AKR A;  5DUW A;  1E57 A;  3AL6 A;  4MHU A;  3EB7 A;  5EJZ B;  3OD4 A;  4CCM A;  2E26 A;  3KM5 A;  5F32 A;  4XJA A;  1DQ1 A;  2Y8K A;  4XW3 A;  1IOA A;  3LQC A;  4Y24 A;  5LK5 A;  4QD2 A;  3THT A;  3AZW A;  4MXV A;  1IQA A;  5IVV A;  4UBG A;  1OLQ A;  1YQ2 A;  1AL0 G;  4Q4Y 2;  2R06 3;  4KQ7 A;  1RVF 3;  4J6G A;  3JD7 2;  2ZGK A;  2XJQ A;  4R4X A;  2W87 A;  1Q8O A;  1RUF 1;  3OPZ A;  5FAX A;  2VUJ A;  5J98 B;  2Q8E A;  3ME2 A;  1KJR A;  3GZU C;  4V2W A;  4BB3 A;  2C26 A;  1JOD A;  1H4G A;  1W6N A;  1AR9 1;  4XFB A;  1WCQ A;  1VBA 2;  3J7N A;  1XU1 A;  3KT7 A;  4K40 A;  4MSV A;  4CA9 A;  3C8X A;  1MS5 A;  2ZML A;  3GDB A;  4AQS A;  5K0U C;  1PGL 2;  4XFI A;  1U5X A;  2A5Z A;  2WFF 3;  4RGG A;  1VJ2 A;  1AL2 1;  1C1F A;  4NPR A;  5FIX A;  1PO2 1;  4FT8 A;  1UXX X;  5FO7 B;  4DZG A;  1Y9M A;  4K8R B;  5LRR A;  2OUH A;  4IEX A;  4Q8K A;  5M0T A;  4GWN A;  3DXU A;  5KHJ A;  1ZBE 3;  3MFA A;  4W6X A;  3AL5 A;  3M2M A;  3GBW A;  1O8S A;  4XET A;  4ZKT B;  5C3S A;  5A7W A;  3ZN4 A;  1IKP A;  2IXK A;  3VZL A;  3D0J A;  1OSG A;  1NY7 1;  2J1A A;  4BU2 A;  4NPM A;  2QBX A;  2HYX A;  2YXS A;  2B42 B;  5JPM B;  2F4L A;  5DAW A;  3KQR A;  3LDB A;  1BVV A;  5GZD A;  1RC6 A;  3PME A;  5FPV A;  4IV1 A;  1RUD 3;  2Q1Z B;  1DYK A;  3PUI A;  4K8F A;  2W3J A;  4PDW C;  3VBF C;  4OI0 A;  4YZ1 A;  4WM7 C;  4I0B A;  4BQX A;  4E2G A;  2PA7 A;  5C3O A;  1HXS 2;  2BOI A;  2J1V A;  2RV9 A;  2ZZJ A;  2VUC A;  3HNM A;  1GKB A;  1OD3 A;  2CAU A;  4HOO A;  2ZGS A;  5FPU A;  3BTY A;  3PVO A;  2EXK A;  4L92 A;  1OFN A;  2XJV A;  3POB A;  4NHY A;  2AH2 A;  1VAM A;  1HRV 3;  3T2Q A;  4ES8 A;  2GNM A;  5JLV A;  4A42 A;  4AVC A;  1LHO A;  3LSD A;  1ZRE A;  1YNA A;  5IJR A;  1GSL A;  2WNV B;  1NLR A;  3O5S A;  5KXD A;  4IXL A;  1QXJ A;  3FC0 A;  4DIQ A;  4IEU A;  5CFD A;  1DQ5 A;  2QQM A;  3GHM A;  1W6Q A;  3DEM A;  2HWB 2;  5FXV A;  5E89 A;  4EQV A;  1UOF A;  2J1T A;  2YB7 A;  2C0Z A;  1J3P A;  2DWR A;  4LLO A;  4XJZ A;  4YNI A;  1UIJ A;  2A70 A;  2R0H A;  1W28 A;  2XBO 3;  2WAB A;  2HEY F;  1C1L A;  4YW1 A;  4LHL A;  2GNT A;  4E27 A;  3DUI A;  4MLO A;  4EZH A;  2FHR A;  1PHM A;  2GDF A;  2ZAA A;  2ES3 A;  4GH4 A;  2B45 X;  1HV1 A;  4N53 A;  1EY2 A;  4Y33 A;  4MVT A;  2WZR 3;  3VLB B;  3QCW A;  3IMN A;  2V5Y A;  1VBD 3;  1FV2 A;  1MQT C;  1GBG A;  1WUV A;  2Z5W A;  4K20 A;  4NID A;  3D5O A;  1HB1 A;  4WZF A;  4HZF A;  5FLJ A;  4BYY A;  1S0F A;  2BDR A;  4QPG B;  1PZ8 A;  1OKQ A;  2ARC A;  3PL0 A;  1Y4W A;  5CYY A;  4DUV A;  3JZV A;  1JS9 A;  2VW0 A;  1W6O A;  4EE2 A;  4E9K A;  3PUQ A;  1CWP A;  1O5L A;  4XAA A;  1NCQ C;  3PJQ A;  3ZN5 A;  1V0A A;  4OLL A;  3AKP A;  1NZC A;  3FX3 A;  3VDC A;  3MIH A;  3GGL A;  3JU9 A;  2XL7 A;  1AR6 2;  2VBB A;  1MS4 A;  5GLU A;  1XSQ A;  2PLV 3;  4QX7 A;  4Y4Y A;  2A6Z A;  1H6X A;  1VBB 1;  3SH4 A;  4FTE A;  5K7P A;  5JIA A;  4BWO A;  4XFG A;  2XJP A;  5D21 A;  5EYY A;  2PHR A;  1BK0 A;  5KR7 A;  2G9G A;  2ZX0 A;  4NII A;  1ZBA 1;  1CPN A;  4A7K A;  2PQQ A;  3CO2 A;  1HB2 A;  2I45 A;  1MZ6 A;  1MEC 3;  3EYP A;  4IDZ A;  4AFD A;  3QLQ A;  1X9T A;  2GC1 A;  4HET A;  1KEX A;  4QAW A;  5HV4 A;  2HH9 A;  2OQ6 A;  5GZF A;  1QOT A;  5LBF A;  3IPV A;  1NQD A;  1XSR A;  1HX6 A;  1YQC A;  2CDO A;  4N9I A;  2EIE A;  3MDP A;  2QZ2 A;  4ASK A;  1RUF 2;  1ND2 B;  3ACF A;  5FUI A;  1V6J A;  4LNV A;  1FPN 3;  1F9K A;  4IV3 C;  3KCC A;  3VDD A;  4XBN A;  5LCW L;  2FD8 A;  2ZMK A;  4DEQ A;  3SIS A;  4QX2 A;  1VAL A;  3WT3 A;  2O8O A;  3K3N A;  2VY0 A;  1BK1 A;  3AC0 A;  3OTF A;  5FLI A;  5H9S A;  1W2N A;  1CZV A;  1PO1 2;  3J8F 1;  4PLM A;  4HK8 A;  3C7H A;  2XXZ A;  2CWS A;  3J4U H;  1DYO A;  1X7N A;  2CDP A;  4Q0Q A;  2KR2 A;  4Q8L A;  4NVP A;  3WDW A;  5IUQ A;  4OI2 A;  3TEX A;  5FOB B;  4C8D A;  5KWR A;  1V6M A;  1GLH A;  4QX1 A;  4UT5 A;  4RR3 A;  4BE3 A;  4CDX A;  1G9F A;  4CRQ A;  2I74 A;  3SKV A;  4Y1Z A;  1LTE A;  3POE A;  4JDO A;  3MYX A;  1F8V A;  1UX7 A;  3SXW A;  2Q1M A;  2RG4 A;  4LE3 A;  3MO4 A;  4LBQ D;  2FZ2 A;  4AGG A;  1K3I A;  2W2I A;  2W94 A;  2VEC A;  2HBU A;  2IUW A;  1OUX A;  1UZ0 A;  1B09 A;  1BQP A;  1NXD 1;  1RUI 2;  4A6S A;  5JMO A;  1RXF A;  3ALQ A;  2DYC A;  3WP6 A;  1DQ0 A;  4AGV A;  2BBV A;  5A7O A;  1U5Y A;  1R1A 3;  5FFO C;  1T6G C;  1CAV A;  3K48 A;  3NKT A;  1OOP A;  4ISQ A;  5E8A A;  2AR6 A;  2W5F A;  4DY5 A;  4YZ5 A;  4JQR A;  5A3P A;  1W3X A;  2Y6J A;  2FDK A;  5JDB A;  3M3Q A;  3J7L A;  2WO1 A;  2WT0 A;  1DGR N;  1N1T A;  3Q8F A;  1XRU A;  3GBF A;  1J84 A;  4X8P A;  2JIG A;  1YO8 A;  3B7M A;  4KBB A;  3VBH C;  3WZ1 A;  4RSU A;  3RJR A;  4YWA A;  1YYN A;  2C4X A;  1LHW A;  4GXL A;  1O3Q A;  3MIC A;  3DPR C;  2E32 A;  3UJO A;  1C4R A;  2P2K A;  4YVS C;  5IAT A;  3G6J B;  4P9G A;  4Y1Y A;  5L9R A;  5FYI A;  1JTZ X;  2NM1 A;  2QFE A;  4FP3 A;  3WDU A;  4PHZ A;  4GA9 A;  2Q8C A;  4JDM A;  3KT4 A;  5HXM A;  1UN1 A;  1DZT A;  2RS3 1;  2VZO A;  1FNZ A;  1ZRF A;  1RHI 2;  4GMP 0;  1W99 A;  2K46 A;  2VC9 A;  2MNG A;  3K75 B;  3R0R A;  1ZRI A;  2D3S A;  4P9W A;  4WZC A;  4HKW A;  1OF4 A;  1GWM A;  4G9S B;  2ORZ A;  3WSO A;  5BNN A;  2A6X A;  2V09 A;  5FPA A;  2CV6 A;  1N1S A;  2W1W A;  4BM8 A;  3SNM A;  2E6V A;  2H6B A;  1H9P A;  4HSL A;  1AR8 1;  3HNY M;  4QPW A;  4XFH A;  5A32 B;  3FJS A;  1GZW A;  4GKY A;  1JW6 A;  1PK6 A;  2X09 A;  3UL2 A;  4CPB A;  1ULD A;  3ZYR A;  4GMP 3;  2DUQ A;  1D4V B;  3AXE A;  5LEJ A;  1RUG 1;  4Y26 A;  2VZ1 A;  2WO7 A;  2YGM A;  3N7M A;  4LLF A;  1V6K A;  1R09 1;  3VHO A;  4B4P A;  2QKD A;  1Y43 B;  4JTN A;  4CXW A;  2SLI A;  3E6D A;  3JBG 2;  2BFU S;  3N9Q A;  3IT8 A;  4R9C A;  4XHX A;  5FWE A;  2XUE A;  3OY8 B;  4E8D A;  1GAN A;  2WBK A;  3V65 A;  4AAP A;  3V0B B;  5CB7 A;  2P17 A;  3RS6 A;  4X6Q B;  4EWA A;  1QF3 A;  3OD0 A;  4Y5Z 0;  3GF6 A;  3CJX A;  2HLE A;  2R07 2;  4YLZ A;  1J58 A;  4Z1V A;  4FPJ A;  2A6Y A;  4CP9 B;  1X33 A;  1OVS A;  2WFP A;  5DG2 A;  1QJY 1;  5ACA 3;  5C8C C;  3GZE A;  2WIN B;  2DUR A;  2ET7 A;  2LW8 A;  4H7L A;  1UY1 A;  4L97 A;  1WME A;  1YUD A;  3DYM A;  3KCY A;  1JU4 A;  1V6N A;  2ZGT A;  5CIR A;  1UPS A;  1OPO A;  1KGY A;  1PMH X;  1LES A;  1UY2 A;  3A23 A;  3KGZ A;  3OOX A;  2IC1 A;  4JGZ B;  3WIN E;  3O1V A;  3TN9 3;  2VTX A;  1I5P A;  2P3K A;  1S0E A;  5ANQ A;  1CZT A;  2VM9 A;  5FXX A;  4RQP C;  2WZE A;  1Z78 A;  2VZU A;  3KZ4 C;  2WNU A;  2CL2 A;  5A1F A;  5JZG C;  5ABJ C;  5JVV A;  4YVW C;  5CG8 A;  4UXA A;  3OUH A;  1JZ4 A;  1WLC A;  1OXC A;  2CHH A;  2NZ9 A;  3OBA A;  4C1W A;  1W6N B;  4CCL A;  3AMQ A;  2F6B A;  1UOG A;  3BU7 A;  4RFR B;  2ET1 A;  2R06 1;  4NJ4 A;  1ODN A;  4NOT A;  5DN2 A;  5F2S A;  2J1S A;  2Y33 A;  4BIO A;  2VPV A;  4MOA A;  4OHZ A;  4TTG A;  5DDJ 1;  3ZN6 A;  3E5Q A;  4UWD A;  5LA9 A;  5D8A C;  3VD3 A;  2MEV 1;  1Q8P A;  3ZIX A;  1KRI A;  1BMV 2;  4IE6 A;  1MZ5 A;  2OII A;  4NR1 A;  4PLO A;  1R08 2;  4Q0U A;  5LY1 A;  1OH3 A;  2HWC 3;  4AI2 A;  2ADE A;  2C24 A;  1GNZ A;  1AL2 3;  1BZW A;  1PO2 3;  4QDS A;  4H14 A;  3GZA A;  1H8T C;  4YM1 A;  1D4M 3;  3SEP A;  3AM2 A;  2ILM A;  1V6O A;  4K9S A;  2YGL A;  2A6W A;  2JDN A;  2VMH A;  4M0N A;  3H1Y A;  4MAD A;  4PLN A;  3WW2 A;  1UIK A;  4OUL A;  4XF3 A;  5BNO B;  4J25 A;  3LF7 A;  1RUE 1;  1BKZ A;  3AYC A;  3NV1 A;  5T52 A;  4YAR A;  4DY3 A;  1ZBE 1;  1NT0 A;  2WZP P;  2KA3 A;  5A3U A;  4IV1 B;  1FV3 A;  1Q8Q A;  1A3K A;  4AEJ A;  1QJZ A;  5T54 A;  5I8Y A;  3ZDS A;  2AC1 A;  3QBQ A;  4MXW B;  1W8N A;  4IGO A;  4XIO A;  5FV3 A;  1ND3 B;  1V9U 2;  4LKF A;  4PCR A;  1COV 1;  2J22 A;  3WCR A;  1EUU A;  1RUD 1;  2YUE A;  3SH5 A;  4DXR A;  2VBP A;  1K5J A;  3T0D A;  1IS4 A;  1TMF 3;  3OPT A;  1ZZ7 A;  5C33 A;  2XOM A;  1TVG A;  4UW3 A;  1ULE A;  3DN7 A;  4IES A;  4MGI E;  4J1X A;  5LAT A;  4CEY C;  5F5A A;  5H9P A;  4DPN A;  1W2T A;  3RVH A;  1HRV 1;  1W6Q B;  2ARB A;  1CAX B;  3U11 A;  1W6M B;  4HVR A;  1V70 A;  3PVN A;  1UZW A;  4ZXE A;  2A3X A;  4M00 A;  2BVB A;  4ZPI A;  4AEK A;  4RN5 A;  3QH7 A;  1YI9 A;  4NUB A;  3N9N A;  2YFU A;  5C9A B;  4UFK A;  2VXR A;  2VQA A;  3WQ0 A;  2X8K A;  2JDA A;  2WZ8 A;  4E4D X;  5CAZ A;  2XL9 A;  3PIJ A;  2WYS A;  3EXU A;  3JB8 A;  4HG6 B;  2ZEZ A;  3UJQ A;  4RHV 3;  1B35 B;  1YEW A;  2B5H A;  3CJI A;  2VZV A;  3AZV A;  4IEQ A;  3ZO0 B;  3I4I A;  4COV A;  2XBO 1;  3N9M A;  1WD4 A;  3O0W A;  4G3Y C;  4LQR A;  4XJ8 A;  2WRA A;  4ISR A;  3VD7 A;  4BK4 A;  2EF6 A;  2CTV A;  1SLI A;  1XB9 A;  4L0P A;  4NHX A;  1VMF A;  4HPK A;  3OUJ A;  5HI0 A;  2CGN A;  1CPM A;  2YU1 A;  4GWI A;  3IAP A;  1QDO A;  2BVV A;  3HOB A;  1LU2 A;  3UT0 A;  5DZF A;  2QQV A;  1ZZC A;  4K21 A;  2PAK A;  1W6O B;  1HB4 A;  5C4W B;  1VBC 2;  4YW3 A;  5DAQ A;  1OQE A;  1HRI 2;  1K42 A;  1PVC 2;  2D43 A;  2JDY A;  3NWK A;  4CDW B;  3BTZ A;  3ZMN A;  5CVR A;  2QTW B;  4M0H A;  1SEF A;  3ZMO A;  5ERL A;  4EN8 B;  3H8U A;  3SC7 X;  2P4E A;  1PM7 A;  3B69 A;  4FQZ A;  3SEE A;  1POQ A;  5LBB A;  5FQ0 A;  1ZZ6 A;  1YHF A;  2D40 A;  3HWJ A;  3NAP B;  2EIB A;  4CP2 A;  3VBR C;  1VBB 3;  5J3U A;  2XHN A;  3AXD A;  3IWZ A;  3MUY 1;  3U37 A;  4S2D A;  1X9P A;  4XMI A;  5K0U A;  5A6Q A;  4Y22 A;  1C28 A;  4JGY C;  4QPI B;  5GLT A;  3KV4 A;  4CU9 A;  1DGR A;  4LMF A;  1WCU A;  3A22 A;  4MGK E;  2WNO A;  2P37 A;  4H7M A;  1Q43 A;  2QQI A;  3H8X A;  5FY9 A;  2VUL A;  2WII B;  4QB1 A;  1SZB A;  3IPV B;  2XDV A;  2FDI A;  2VW1 A;  5BYN A;  2Y6L A;  4CDU C;  2HJI A;  1MEC 1;  1RMU 3;  4AI0 A;  4LR4 A;  2FCV A;  1WBL A;  3HQU A;  1QMJ A;  2C5D A;  2ZGP A;  3H0O A;  5BXX A;  3TNP B;  5L7O B;  2R06 2;  1RVF 2;  3UNP A;  1S4C A;  3E6B A;  1LHU A;  1UO9 A;  3NJY A;  4CXY A;  2GC3 A;  3U75 A;  2O0O A;  3WV6 A;  4DUW A;  3LKJ A;  2EXI A;  3VHP A;  3VBF A;  1J3R A;  1FPN 1;  1S0J A;  4PDW A;  2PQS A;  1OUS A;  4WM7 A;  4AK3 A;  4EJR A;  2VME A;  4N43 B;  1WMD A;  4CEW C;  4QQH A;  2MHF A;  2JG8 C;  5JCT A;  2D6M A;  3J8F 3;  3WVJ A;  4XF4 A;  2ZKN A;  4N90 A;  1LEM A;  1YRZ A;  4PBO A;  2XVL A;  2GN7 A;  1JYN A;  1QKQ A;  1NLQ A;  2WFF 2;  1YIP A;  2VCB A;  3PU3 A;  5E1R A;  3T4V A;  5IVC A;  1ULO A;  1RUO A;  4OUE A;  3FFZ A;  5KXE A;  5J1X A;  2Q30 A;  1X50 A;  1FMD 3;  3KF3 A;  1JZ8 A;  3SCF A;  2WWJ A;  3WNN A;  2DTW A;  3B9I A;  5IVE A;  1BEV 3;  4FSJ A;  4Y1X A;  4LHS A;  4PJY A;  4HXC A;  4I0A A;  2DTY A;  4BIS A;  1O8P A;  1U5I A;  4XAC A;  2JDU A;  1C8N A;  2V4A A;  2Y6K A;  3IMM A;  1G7Y A;  1URX A;  2HWD 3;  1H1I A;  3PVE A;  1ZNP A;  3SQO A;  3FHI B;  5A6Z A;  5EJ1 B;  5FMO S;  4RS5 C;  3O1T A;  1OOP B;  3NVC A;  2E53 A;  4K3U A;  5IWF A;  1HIX A;  1DHK B;  3IB3 A;  1CZS A;  2XLA A;  3ORJ A;  1OBN A;  4AVA A;  1S55 A;  1A8D A;  4FCA A;  1K5M B;  4M4P A;  1G9A A;  3P3P A;  3WQ1 A;  2WQZ C;  1C8M 3;  1H6Y A;  1KXG A;  1LGN A;  1MQT A;  1D0H A;  2IVJ A;  2QNK A;  2WNE A;  3CKH A;  3CNA A;  1HRV 2;  4GAL A;  1YFW A;  3I3B A;  3K4D A;  4QQP A;  2J1E A;  4GD4 A;  3DKQ A;  4CDQ B;  3WG2 A;  4JKM A;  3VD4 A;  2DVG A;  3M4F A;  4YFZ A;  5C3Q A;  3T2O A;  2BGO A;  3OGJ A;  1MZE A;  3TNQ A;  5D2A A;  1CIW A;  1NCQ A;  2I2S A;  3ES1 A;  3WW3 A;  1K12 A;  4P00 B;  4JQT A;  2X5I C;  1HQL A;  3VBO B;  3ZR6 A;  3P3N A;  1QJE A;  1QY4 A;  1LEN A;  1EV1 1;  2WKK A;  1NA1 C;  4JHT A;  3TB0 A;  4CTE A;  2JIC A;  2RS5 2;  5EWS A;  1H2K A;  1DU3 D;  4NWV A;  4BZ4 A;  4WM8 B;  5F8P A;  1NG0 A;  3NMB A;  4W4Z A;  3KD4 A;  1BXH A;  5BNN B;  3B00 A;  3WNP A;  1YLL A;  5L19 A;  2DFC A;  2HWE 3;  1FNY A;  1ZYB A;  2OA2 A;  5CKN A;  3NKG A;  1FXZ A;  4JVA A;  2WZR 2;  3WCS A;  1VRH 2;  1REE A;  2WS9 2;  2TBV A;  1VBD 2;  4IE5 A;  4XUQ A;  1D0G A;  4DXZ A;  1QOO A;  1AF9 A;  1A34 A;  1OLR A;  4P5Y A;  3WOG A;  2E51 A;  3KS7 A;  4E8C A;  4AED B;  2WR9 A;  1XE8 A;  3EHK A;  5EPA A;  1SLT A;  1Y3T A;  5FJK A;  4LIV A;  4BQ4 A;  1TME 3;  1SPP A;  1G6N A;  1HN0 A;  1YFX A;  2EIG A;  4IV3 A;  1ASJ 1;  5FZ4 A;  2JJ6 A;  1D7P M;  1RUG 3;  2ZMN A;  3WNO A;  4NRP A;  4AYU A;  4Q4W 2;  1F31 A;  2PLV 2;  3HJR A;  4NWW A;  3WNK A;  4X8N A;  1DYP A;  4AL9 A;  4CE8 A;  3V0A A;  3ZSE A;  3POY A;  2AZ5 A;  2JG9 C;  5AC9 1;  5C3R A;  3FLP A;  2WLP A;  5FK8 A;  2Q8D A;  3GCW A;  3VZM A;  1MR5 A;  3NNG A;  3BAL A;  2UWC A;  1DZR A;  3OBR A;  4NHL A;  1LOE A;  1IG0 A;  1NCR B;  3ETP A;  4XFC A;  3ZFE B;  1UYP A;  3KV6 A;  2W1S A;  2RMU 2;  2OT7 A;  1QJY 3;  1HLC A;  3UGH A;  1W0P A;  2IXI A;  1PX3 A;  4NHK A;  3ATG A;  3ZFG C;  4LOR A;  2IXJ A;  3MV1 1;  3BOP A;  5ACA 1;  4OI1 A;  3VL9 A;  2PHX A;  2BGC A;  3FLT A;  4XJW A;  1CAU B;  1FPN 2;  1REF A;  2H0V A;  3A21 A;  1F4A A;  1SLA A;  5KHK A;  4MG2 A;  4Q5O A;  3PTR B;  5JXG A;  1W9Y A;  2WNU B;  3THC A;  2DVB A;  4R9A A;  3AP4 A;  3H3Z A;  3QAC A;  2Y0I A;  4IQP A;  2ZEX A;  3TN9 1;  3OBZ A;  2GAL A;  3AZX A;  2XON A;  3FZ3 A;  2ZX3 A;  3WR0 A;  1ULF A;  1NE6 A;  1OC1 A;  3AZY A;  4EN7 B;  1LED A;  4FPY A;  2VZR A;  3WX5 A;  4DO0 A;  1DLL A;  2QUO A;  1AX2 A;  5JSO A;  5GKA C;  2Y6G A;  3C7G A;  4XVH A;  1SLB A;  3S57 A;  1VAV A;  4LOT A;  2SBA A;  1O59 A;  5A7Q A;  4A2U A;  2RE9 A;  2RR1 1;  3VBH A;  4LO8 A;  5HCF A;  2IXH A;  4PIZ A;  1NXM A;  1IPJ A;  3N4M A;  3UET A;  5TSW A;  1ALY A;  2A3Y A;  3RZJ A;  5FPZ A;  1L7R A;  5DDJ 3;  3R4U A;  1DP0 A;  1XYO A;  2EID A;  1CAW B;  2AEY A;  2JXA A;  1PGW 2;  5DXD A;  2MEV 3;  2XJU A;  1ENX A;  5DUU A;  3AVS A;  3KVB A;  3DPR A;  5KC5 A;  2WSV A;  2IZW A;  3NNM A;  1WD3 A;  4F8A A;  4UFH A;  5IYY A;  1DIW A;  3P5B A;  4MH0 E;  5FZK A;  4DNY A;  2VO5 A;  3LD8 A;  5AFE A;  4R52 A;  2R49 A;  4AHZ A;  1QJU 1;  1UX6 A;  2HWC 1;  1W3V A;  4P9L A;  4S2F A;  1QJF A;  3OEB A;  4AVS A;  3JUU A;  4DS0 A;  4AQ2 A;  3C3V A;  2IXC A;  4OVE A;  3USU A;  3ZX7 A;  4EN6 B;  1CQ9 A;  3NST A;  4I3P A;  3RFR A;  1D4M 1;  1R1A 2;  1RUE 3;  2GN3 A;  4OI4 A;  5FLH A;  3UK9 A;  3ZYB A;  3WF2 A;  3B93 A;  5FZD A;  2VU9 A;  3LE0 A;  3MLL A;  3KWV A;  5LBE A;  4QPG C;  3ZFF B;  4BQ3 A;  1WW7 A;  2GAU A;  4BCU A;  5FO8 B;  3ZM8 A;  1JZ3 A;  3GXU A;  3BKZ A;  4D69 A;  2E31 A;  1DBN A;  2OYZ A;  1EP0 A;  2BNN A;  3AMN A;  5C5T A;  5C6C A;  3MLJ A;  2TNF A;  1C5H A;  3AP9 A;  3KF5 A;  5BNQ A;  1COV 3;  3ILR A;  3I2I A;  4CU7 A;  2Y26 A;  1GR3 A;  1EAH 3;  4LBO A;  3RNS A;  2BNO A;  4XEZ A;  4D6Q A;  3RZG A;  2QQL A;  3CZJ A;  5J48 A;  3LDR A;  2XB6 C;  5ANN A;  1CGP A;  4QQL A;  1KFU L;  1TMF 1;  3CDZ B;  4KGG A;  5I8S A;  5A7P A;  1I6X A;  3SCG A;  1KS4 A;  1YIF A;  4AGR A;  1CN1 A;  3ILF A;  3VB9 A;  2O8Q A;  2UY9 A;  3DXT A;  4OHV A;  1LJ7 A;  3C7F A;  3RZL A;  1SDD B;  4NPL A;  4XZU G;  2Y60 A;  2YDE A;  2ATF A;  3ST7 A;  3CJI B;  5LA1 A;  1F15 A;  4U36 A;  2QCS B;  1DFQ A;  4LK6 A;  5C8C A;  1JZ5 A;  4E2Q A;  1ND2 C;  3PIG A;  5EIY B;  4IEV A;  4IE0 A;  1AYN 1;  5FMD A;  5FJH A;  1DF0 A;  4UFI A;  3TAY A;  5LWB A;  5FY7 A;  3RI8 A;  4XFA A;  1FOD 1;  5C71 A;  2ZS6 B;  4RHV 1;  4F7Z A;  1KDM A;  2J1U A;  3TEY A;  4QX8 A;  4JX0 A;  2W1U A;  4FPG A;  1WW6 A;  2JDK A;  1P8J A;  2FQP A;  4QT6 A;  1TG7 A;  1X8E A;  3WG3 A;  1RB8 G;  3G7D A;  3ZPO A;  4IW3 A;  4YG0 A;  1RYY A;  3POJ A;  1KIT A;  4AI8 A;  1WCD J;  1W9T A;  4CXX A;  5K9Y A;  2W95 A;  2QQP A;  3IKW A;  4RQP A;  4XF1 A;  1S0C A;  2V73 A;  3TBD A;  5F1R A;  3BU0 A;  5JZG A;  4N9H A;  2R0F A;  3W21 A;  5ABJ A;  2BGP A;  2YBS A;  5FTT C;  4YVW A;  3L9J T;  1QNW A;  3KV9 A;  3FHA A;  3ZSL A;  4ARX A;  2ZGL A;  1UAI A;  2D6N A;  4FVV A;  3USS A;  3ES4 A;  5FYH A;  1HN1 A;  2D93 A;  2W46 A;  2H0B A;  4IND A;  3AX4 A;  1WCK A;  3H1W A;  3NNL A;  4XQW A;  5FYC A;  2Q4S A;  1GOH A;  5D8A A;  3K77 A;  4ATF A;  2W9X A;  1G86 A;  2A6V A;  2PXJ A;  2VBD A;  2PTM A;  4KWK A;  1WKY A;  1CVN A;  4QKF A;  5DUV A;  3EO6 A;  5CKM A;  3HIF A;  2JDZ A;  1A78 A;  2WN3 A;  2BYV E;  1H8T A;  4UW4 A;  3M3E A;  4P02 B;  2B7Y A;  4YSF A;  5IHR A;  1SMV A;  3MBW A;  4FAG A;  1DZQ A;  2RJK A;  1BYH A;  5IVB A;  1J83 A;  2IXL A;  1XJA A;  3M3I A;  2RM2 1;  3M3C A;  3WF1 A;  4KNC A;  5JR7 B;  2W39 A;  1LKN A;  1Y9G A;  3N9O A;  1KQR A;  5EZW A;  1WW4 A;  5CU1 A;  1ZZB A;  1RMU 1;  2VOT A;  4C0B A;  3D0S A;  4PDW B;  5A3W A;  3QOP A;  4Y20 A;  2HWF 1;  2IFR A;  4ZS3 A;  3VBU C;  1AR9 2;  3I54 A;  2QQO A;  1GWL A;  4EV0 A;  1N1V A;  3FBY A;  4QQO A;  1FI2 A;  3AKT A;  2D7F A;  2EAA A;  5F5Q A;  5HBA A;  1SLL A;  3ROU A;  2QJV A;  3BGA A;  3TOJ A;  1IPS A;  1V6I A;  2P3I A;  5LA2 A;  1O3T A;  1O91 A;  3MF9 A;  1AL2 2;  1QXP A;  4V2V A;  4XTM A;  1PO2 2;  2OZ6 A;  4CEY A;  4CCJ A;  1DLC A;  2HEV F;  4FBF A;  3FWE A;  3DYO A;  4RGA A;  4O7X A;  4WBB A;  2UY8 A;  1F35 A;  1JHJ A;  1S2K A;  2BOJ A;  4EWD A;  3LWC A;  5FKB A;  4A3X A;  4YZ2 A;  2ARE A;  1FT9 A;  1I9R A;  4OCT A;  4HAN A;  4UW5 A;  1W2O A;  2QQK A;  1FMD 1;  1NY7 2;  2YRO A;  5FYU A;  1MVE A;  1UNB A;  2B8M A;  4COW A;  4P9I A;  4LEJ A;  5DAP A;  4BH9 A;  3GJA A;  1CR7 A;  1Q3E A;  1X36 A;  1BEV 1;  1X82 A;  2LS6 A;  3LEK A;  4UYB A;  4FOQ A;  3VBS B;  4DUX A;  1OHF A;  1SAC A;  2ID4 A;  3UKT A;  1MS9 A;  2DV9 A;  1SBD A;  2ZKL A;  3RDI A;  1PZ9 A;  1H1M A;  2HWD 1;  2GNB A;  4AEM A;  4QKB A;  1OMI A;  2Z2S B;  1MQT B;  4BJ0 A;  1JH5 A;  1JUI A;  1UYZ A;  4XC9 A;  1H2M A;  4JZR A;  3WF4 A;  1NOV A;  1TMF 2;  2XJS A;  4U2A A;  1PX4 A;  5GLZ A;  5LEK A;  1HDK A;  3JD7 3;  4Q1P A;  3VHR A;  1W2U A;  4Q4V 1;  4WVW A;  5BNP B;  1C8M 1;  3RMY A;  1ONA A;  2VVE A;  1KD7 A;  1NCQ B;  2G1M A;  3FL7 A;  1UZZ A;  1S0D A;  4FPO B;  4KG0 A;  3SCH A;  4AWD A;  2A73 B;  4HL0 A;  3ACG A;  1LOB A;  2JWP A;  3WNM A;  2RVA A;  4AFM A;  1DQ6 A;  4BHP A;  3LAG A;  2EAL A;  4Y1U A;  3T4H B;  3JQW A;  3WNL A;  3ZYG A;  2PYT A;  1EV1 3;  5T5O A;  5BV6 A;  4M3C A;  2NPI A;  4FOV A;  4NRM A;  2DCZ A;  1JYT A;  2ZGM A;  4WVZ A;  4RHV 2;  3DCQ A;  1ZRR A;  2BER A;  3VBR A;  3ZDV A;  4M3C F;  4NIG A;  3A0N A;  3VUO A;  2R1B A;  2EVX A;  4JGZ C;  4I2O A;  1W6P B;  1POV 3;  1E5H A;  2WAA A;  3JB4 C;  4JGY A;  2P6H A;  3DF0 A;  1YFU A;  1YC6 1;  4LBL A;  2VOW A;  2W1Q A;  3WDX A;  2KXL A;  5FZG A;  4I01 A;  1XNC A;  1PGS A;  4OQ8 A;  2PHF A;  5DAV A;  2HWE 1;  4JCK A;  1NX9 A;  3A7Q A;  1BVP 1;  2R6Q A;  3AYD A;  3OYW A;  4PIX A;  4CDU A;  5C70 A;  2DBI A;  3FMG A;  4P9X A;  2NYY A;  3PHM A;  2VMC A;  2RJ2 A;  1XC6 A;  2D6L X;  4L8Q A;  3WP3 A;  5CBL A;  5L36 A;  1DGW X;  4MHR A;  1G9B A;  4WVV A;  1HXS 3;  5A3O A;  1ACC A;  4JV4 A;  4FO9 A;  4XTP A;  2VZQ A;  1RUJ 1;  3HQX A;  1ASJ 3;  4Z07 A;  5FZE A;  1PIV 1;  2QDR A;  1F5F A;  2QQW A;  2ZHN A;  5JSR A;  1TME 1;  5DMY A;  3VZO A;  2VMI A;  2X10 A;  3PUH A;  4OUM A;  1W0N A;  3L2H A;  2B9U A;  3OGS A;  4CEW A;  3WXP A;  5IK5 A;  2R30 A;  3WW1 A;  1XNT A;  5IFT A;  3RYR A;  1VBB 2;  2JG8 A;  4GAZ A;  4WVM B;  1XPW A;  4ES9 A;  2F17 A;  5AC9 3;  5EFU A;  3I8T A;  1JOJ A;  2D3R A;  2ZAC A;  2HWB 3;  4Z82 A;  1EYB A;  3GYD A;  5BNO C;  4MO3 M;  3MHZ A;  1ZBA 2;  4M3C E;  4YM2 A;  1GP5 A;  3KV5 A;  3HNB M;  2BJS A;  2XQX A;  3INA A;  4AHW A;  4LUL A;  4PIY A;  4D6S A;  5A6X A;  2DFB A;  4EWE A;  4ZU5 A;  3RQ0 A;  2UYA A;  3HPN A;  4D94 A;  4J1W A;  4Y1V A;  3NNJ A;  5E6H A;  5FY5 A;  1QQP 1;  4COZ A;  5IFP A;  5J96 B;  2AUY A;  4ASM B;  2G9Z A;  3AYA A;  3LA3 A;  2H6C A;  4I3G A;  4RS5 A;  5J09 A;  1XNK A;  1W8W A;  4XBL A;  3WEZ A;  1VP6 A;  1H2N A;  2ENR A;  3UYJ A;  4UOJ A;  3J8F 2;  1VB2 A;  4UF0 A;  4KI5 M;  2GSY A;  4F83 A;  3KCX A;  4YVS A;  3VBH B;  1H0B A;  1GUI A;  5A3M A;  1VBE 1;  4E4H A;  4QWN A;  3ZYF A;  4CZS A;  5J37 A;  2VZS A;  3B5L B;  3ZIW A;  2JDP A;  2ZTN A;  2RR1 3;  2RJL A;  1JUH A;  4ITC A;  1L3J A;  5I0U A;  1W05 A;  3THD A;  2Z79 A;  3T2P A;  4GB3 1;  2RS1 1;  5C9A C;  1FMD 2;  3DPR B;  3LB9 A;  1LEC A;  4LPL A;  2TUN A;  4BLI A;  4DQA A;  3AP7 A;  3ILN A;  3THP A;  1HV0 A;  3CHX A;  2X5I A;  1XYP A;  1B35 C;  1QDC A;  4N7U A;  3ZXD A;  1XOY A;  1GP6 A;  1NA1 A;  1J1L A;  3K4Z A;  2ARX A;  4BXF A;  5IW0 A;  4D7Y A;  5FRE A;  5CFC B;  3POG A;  5LRS A;  1SFP A;  1XNB A;  5DAB A;  1QJU 3;  3ACI A;  1LNS A;  4XCA A;  4P14 A;  5A7W B;  4DMI A;  1UCX A;  4AE2 A;  2YBK A;  4ARY A;  4AZZ A;  1GMM A;  4RGK A;  1VAK A;  4KWJ A;  1WA4 A;  4LA2 A;  2GMM A;  5C4W C;  2D3P A;  4L9B A;  4ONU A;  1QH7 A;  3I97 A;  2W68 A;  4Q1R A;  4ZON A;  1Y7B A;  3PJY A;  4CDW C;  1BLZ A;  4XXP A;  3W58 A;  1L7Q A;  4CP0 A;  1Z7S 1;  3DEC A;  2QQN A;  3NJX A;  1PO1 3;  1AX0 A;  4Q29 A;  2XJR A;  3LA7 A;  2UU8 A;  3NAP C;  3PUS A;  3RWK X;  5FUP A;  1EAH 1;  4W50 A;  5T5P A;  1UU4 A;  4XFF A;  1BJQ A;  4QPI C;  4FP2 A;  4YGE A;  2JG9 A;  3J7H A;  5JSP A;  2BUK A;  2RS3 2;  3MGU A;  4ATE A;  4AQT A;  2HYK A;  5A70 A;  5CFD B;  1NKG A;  5FZF A;  1AYM 1;  1W0O A;  1I3H A;  1OFS A;  4B1M A;  2JKX A;  4IEZ A;  2WDB A;  4QU1 A;  4RD7 A;  3I2G A;  4LUK A;  4FPL A;  3BYW A;  4OQ9 A;  3VGI A;  2ZAH A;  4XMA A;  3FN9 A;  5K8S A;  4XOG A;  5DQ0 A;  3O1R A;  3VZJ A;  4A7Z A;  5L7O C;  2WJS A;  2LM3 A;  3W9A A;  1AR8 2;  1AYN 3;  1EUT A;  3ZFG A;  2WWS A;  3NQH A;  3OGR A;  2ZCW A;  1NE4 A;  4Q26 A;  1NYW A;  4W65 A;  3CU7 A;  1FOD 3;  2OPW A;  3I59 A;  3U4S A;  4GH4 B;  3U0Z A;  4N53 B;  1RUG 2;  4N43 C;  4RQP B;  4AI1 A;  3MI8 A;  4QKD A;  2VCC A;  3TYJ A;  3I2F A;  3ZSK A;  1YWK A;  3AMP A;  4MV2 A;  5JZG B;  1R09 2;  3SKJ E;  3ZYJ B;  5ABJ B;  1GIC A;  1TNR A;  2LRO A;  3UKV A;  4W6W A;  2PFW A;  2IWG B;  1OI6 A;  2OKX A;  2ARA A;  1WMF A;  1AUY A;  5DAX A;  1FX5 A;  3VKO A;  3M70 A;  1OVP A;  3PTY A;  3E6C C;  3HVD A;  4O61 A;  4BMB A;  5EQU A;  1AR7 1;  4YW5 A;  5GZG A;  2FCU A;  2OS2 A;  3FUO A;  2CSG A;  4PF1 A;  5JMC A;  2B39 A;  1SCS A;  4LBM A;  2WSU A;  4XUN A;  1RUC 1;  5EP9 A;  4YZ4 A;  3MLK A;  3NV3 A;  1OKO A;  1OPM A;  2RHP A;  1ENQ A;  5FPL A;  1QJY 2;  5FY0 A;  3TEW A;  3WHU A;  1I1E A;  4PQQ A;  5LAS A;  3FLR A;  3VKL A;  5A3T A;  2WT1 A;  5LA0 A;  1IG3 A;  2WUH A;  3MZH A;  2L9L A;  4YG6 A;  2VOK A;  5CNA A;  5EHD A;  3SMH A;  4HK9 A;  2C6S A;  4YGB A;  1D2S A;  5FR3 A;  3R4S A;  3IDE A;  3WF3 A;  2P5B A;  4I0W B;  3KSC A;  1K5M C;  4A3Z A;  1YFY A;  4A6O A;  2FZ1 A;  4B7K A;  2D98 A;  4QKN A;  3O1S A;  3CIH A;  1LOF C;  3LFI A;  1WLT A;  3OGG A;  5FRA A;  5T50 A;  1O5U A;  1HB3 A;  2RM2 3;  5GAL A;  3WDY A;  2DDU A;  3H50 A;  1HQW A;  2G19 A;  1BBT 1;  3NO8 A;  4QPG A;  4CDQ C;  4CUG A;  1LCL A;  1WA6 X;  5DUX A;  4ZZ5 A;  1YQ6 A;  5JI9 A;  5SV5 A;  3VZK A;  3WW4 A;  1MS3 A;  3VKN A;  1W8O A;  3ZXL A;  3BUC A;  4KL1 A;  3VDD B;  1A8M A;  1MVQ A;  4FFH A;  5J36 A;  2HWF 3;  3R4D B;  5FYY A;  3WF0 A;  3VBO C;  5FPB A;  4O9G A;  5ISL A;  5DDJ 2;  5CG9 A;  1KFX L;  1ZZ9 A;  1JHN A;  1JYC A;  2ZX2 A;  2MEV 2;  4XE9 A;  3JBG 3;  4BIF A;  2XKP A;  2VG9 A;  5FZL A;  1CJD A;  3DYP A;  4WM8 C;  4CEY B;  2QZ3 A;  3BOD A;  4Q4X 1;  5B2G B;  3GM8 A;  2HKX A;  3UKN A;  5FP4 A;  3S0M A;  1RGS A;  3Q9O A;  4D7T A;  5FZ0 A;  5KBF A;  3T30 A;  4AOC A;  3S6P A;  3E5U A;  2BBA A;  5C5U A;  2RDR A;  4RR3 B;  3RZZ A;  4CDX B;  3U07 A;  1RUE 2;  3S7I A;  3T3Y A;  1ZBE 2;  1QJX 1;  1M06 G;  3CQO A;  4COY A;  4H2A A;  1RUH 1;  3BPZ A;  3JXS A;  3HN1 A;  1AX1 A;  3O1P A;  2FMD A;  3HEI A;  2XHK A;  3KGL A;  4AED C;  1CON A;  3ZLI A;  5FMB A;  1W8T A;  3HT1 A;  4JDN A;  4OUS A;  1ND2 A;  1JYV A;  2J7M A;  1MZF A;  3I7D A;  5FZM A;  3WNX A;  5J7M A;  2BZD A;  3RRD A;  1LOG A;  4RA0 A;  1COV 2;  1JU3 A;  3IIA A;  1RUD 2;  3O0X A;  4KU8 A;  1CAV B;  4MX3 A;  4AR2 A;  2VZT A;  1JYX A;  4ZU7 A;  4P9Y A;  4CPB D;  1LOA A;  2BQP A;  3FHQ A;  1XNA A;  3IZO A;  4QQ2 A;  5FZ7 A;  3LCP A;  4MGT A;  3AB0 A;  3DL3 A;  3FE5 A;  1W39 A;  4Q4V 3;  3LEG A;  4Q4Y 1;  5IK7 A;  2GH2 A;  3JD7 1;  4LIT A;  3T2T A;  3RZM A;  1E5R A;  2NQY A;  1NCR C;  3LEM A;  1UL9 A;  2JE9 A;  1S2B A;  4V1P A;  5FP7 A;  3ZFE C;  1GP4 A;  1ZX5 A;  4YRD A;  2GC2 A;  4AFA A;  1MS1 A;  3WQB A;  1VBA 1;  4FTB A;  5EXO A;  1OLM E;  5KXB A;  1R08 3;  2JEC A;  1UY3 A;  3VBR B;  1VR3 A;  4YGC A;  3VD9 A;  4LIU A;  4IGQ A;  2BRT A;  3ZXE A;  2FDF A;  3WLU A;  2KM2 A;  3CBN A;  1PGL 1;  4B8E A;  4HKL A;  3WP4 A;  5C7G A;  1RXG A;  2XBO 2;  5GZE A;  5C3P A;  1ST8 A;  4QMA A;  4XPV A;  5F5I A;  5I93 A;  2ZBJ A;  4Z8B A;  1UW8 A;  4FAH A;  1IS3 A;  1POV 1;  3BTA A;  1O4Y A;  2VCM A;  3OYW B;  4CDU B;  3BVC A;  4FPK A;  3AMM A;  4LO4 B;  1GZC A;  2R7E B;  1T6B X;  3TEZ A;  2JB8 A;  1SDW A;  1Z0H A;  2E9Q A;  3IAQ A;  1UKR A;  1O4T A;  3AK0 A;  3MPP G;  4K6B A;  2BWC A;  3R05 A;  1GZW B;  1PK6 B;  1ULC A;  2UUR A;  3CEW A;  4GKX A;  4DXS A;  2E7Q A;  1RUJ 3;  2R04 3;  4PF5 A;  3TWI A;  1PIV 3;  2ZEW A;  3GCX A;  1LU1 A;  1VPH A;  5JI7 A;  5B4X A;  1HXS 1;  5I0S A;  2FDG A;  3KQ4 B;  3VBU A;  1QU0 A;  2WL1 A;  1K45 A;  1X8M A;  1STM A;  2CNA A;  4PT6 A;  1FAY A;  3MV0 1;  4SBV A;  5LB6 A;  4LT5 A;  3X29 B;  4OHX A;  2ZEY A;  3ACL A;  4Q0P A;  3VZN A;  2E63 A;  4QHB A;  2IVI B;  2DU1 A;  5FMC A;  1UYY A;  1LHV A;  2DUO A;  3BOW A;  3IDA A;  3PLQ A;  4AVV A;  1UZV A;  2XGX A;  5FYS A;  1KJL A;  2EA7 A;  2Z69 A;  2ZOE B;  4FPF A;  4LBQ A;  4UW6 A;  1UQX A;  2HWB 1;  3VDA A;  5DZG A;  3WG4 A;  2CU5 A;  2JX9 A;  3ZFF C;  1ULG A;  1PVX A;  3H3U A;  4XAE A;  3LPF A;  1MEC 2;  5F2W A;  2B4K A;  1LOD A;  4RYD A;  3U14 A;  1LUL A;  3TRS B;  2O14 A;  4P08 A;  3T1M A;  3WDT A;  3ZYI B;  4I09 A;  1QQP 3;  4AHX A;  2D97 A;  3AYE A;  1GNH A;  2P6C A;  1RIT A;  3MIG A;  1VMH A;  4JC1 A;  3POW A;  4XBQ A;  1F5J A;  1AXK A;  2FDJ A;  5SV8 A;  2ERF A;  4UF0 B;  2NMO A;  5IVY A;  5F39 A;  1OH4 A;  2GMP A;  1VMJ A;  1LB2 A;  2GU9 A;  1SG3 A;  2LTN A;  1VBC 3;  3JQX A;  4YVS B;  4AI3 A;  5A6Y A;  2DVD A;  1HRI 3;  1IPK A;  2DUP A;  3GBG A;  4XZP A;  1ODM A;  3HN3 A;  4F3J A;  1VBE 3;  3FFQ A;  3OY8 A;  4Q2F A;  2WNV C;  4IET A;  3MW3 A;  4MZU A;  4TXW A;  4XF9 A;  1UYX A;  1UZY A;  2JD9 A;  2VZ3 A;  3S5Q A;  5IK4 A;  4HON A;  4GB3 3;  2RS1 3;  2EAK A;  1DGW A;  2HBT A;  1AR6 1;  1CJP A;  3ZN6 B;  2AEN A;  2C9A A;  4YW4 A;  1NA1 B;  4CP9 A;  3BPS A;  2BNM A;  2MPF A;  4ET7 A;  1NQJ A;  5BY5 A;  1XE0 A;  3AZZ A;  3MEP A;  5GLV A;  3O12 A;  1S0G A;  4FQ4 A;  3A4U A;  4C1X A;  1TEI A;  3VD5 A;  1GNY A;  5JOY A;  4B4R A;  5FZO A;  2GC0 A;  5FZC A;  1QWR A;  4JGZ A;  3KB5 A;  3ZSJ A;  1TE1 B;  2PHW A;  3ABZ A;  4LBJ A;  4AXO A;  5JXJ A;  2CWM A;  2VQU A;  3EQE A;  1UU5 A;  4NE9 A;  4QPY A;  3P6B A;  1E5I A;  4B7E A;  2VR4 A;  2GZW A;  4H55 A;  4JTO A;  4IEY A;  3UES A;  2AGS A;  2O1Q A;  1JI6 A;  1GQG A;  1N3P A;  1YCI A;  3H9A A;  1SFY A;  2A7A A;  2WAO A;  3HR9 A;  4LTA A;  5F5C A;  2CAV A;  2YHJ A;  4MGZ E;  3H8R A;  4PI2 A;  1TZO A;  1CES A;  4HKO A;  4XDP A;  5DPN A;  1Z7S 3;  1XQN A;  5I0R A;  1SQ4 A;  1UPI A;  1N47 A;  3WD5 A;  3I3D A;  4LHN A;  5FOJ B;  2ZX4 A;  4KWL A;  3ECQ A;  1PO1 1;  1AXY A;  1U5Z A;  2JG9 B;  1EV1 2;  4IEO A;  1JBC A;  5T3N A;  3U78 A;  3VHN A;  5A1L A;  2NMN A;  3I3E A;  2VVD A;  5AFB A;  1IKQ A;  4K1Z A;  1QHD A;  1DQ4 A;  1QIQ A;  1ZA4 A;  4EYU A;  2YV8 A;  3KHB A;  3PVB B;  2OPK A;  2VQ0 A;  4IGP A;  4XHB A;  4BQY A;  1JZ6 A;  1AYM 3;  2G4I A;  1WBF A;  5BNO A;  2EXH A;  3V64 A;  4KWU A;  3RZH A;  3AP5 A;  5FYM A;  1J1T A;  1AZD A;  3B3Q E;  4B4Q A;  4TLG A;  1PMJ X;  1HJG A;  3LPG A;  3ZFG B;  1JZ7 A;  5JXH A;  1XXN A;  4JRA A;  3QH6 A;  2CGP A;  3BIE A;  5FCC A;  2ZZQ A;  3I59 B;  1UXZ A;  4XUO A;  5FZB A;  3RZK A;  3GHN A;  3MW4 A;  2GP3 A;  2VXJ A;  4MXW A;  1C5I A;  1RUI 1;  3WP5 A;  1ND3 A;  1WZX A;  2WN2 A;  5FZ8 A;  1ZZ8 A;  1ASJ 2;  5CEH A;  5LY2 A;  2NN8 A;  2CY6 A;  1MPX A;  3ZKU A;  4HPK B;  1N3Q A;  5FZI A;  3H7Y A;  2P1B A;  5EV7 A;  5FY8 A;  5IAV A;  2BPA 2;  4Z92 B;  3MW2 A;  5AVA A;  2JE7 A;  3VKF C;  2J1R A;  2Y64 A;  5AC9 2;  3Q8C A;  3D6E A;  4ZZ8 A;  3S5A A;  3CMG A;  3I2J A;  5KHI A;  4KH9 A;  1ULP A;  1CAX A;  1W6M A;  3MIF A;  3NRU A;  2Q8O A;  4QXH A;  4CCN A;  3Q8B A;  1AR7 3;  2FDH A;  3E97 A;  4BK5 A;  2OQ7 A;  5JXI A;  2HEW F;  3N7J A;  3ACH A;  4QGN A;  3EJK A;  5A80 A;  2W92 A;  1RUC 3;  1R1Z A;  2RS5 3;  2VTX J;  3FBM A;  5FQ0 B;  5A7S A;  3AFK A;  5C9A A;  1F2N A;  3R6S A;  1UMZ A;  4LBN A;  1ZVF A;  3I2K A;  4O9E A;  2FBE A;  4OFG A;  5FY4 A;  3VBS C;  5L73 A;  3ASI A;  1B35 A;  2D6P A;  4Y22 B;  5A33 A;  5ACA 2;  5K0U B;  3ZYP A;  2WO3 A;  3D8C A;  3N3H A;  1KDK A;  4DEV A;  1Y9Q A;  1VRH 3;  4HMZ A;  1RHI 1;  4XCB A;  1IS5 A;  2BP6 A;  2WS9 3;  4A45 A;  2Q1F A;  3Q8E A;  4QB2 A;  4TLF A;  1UWW A;  2WQ8 A;  3ZYH A;  4LA3 A;  1LR5 A;  4A44 A;  5FWJ A;  5FP9 A;  5FYV A;  1PNF A;  3D4K A;  4NIA A;  1XU2 A;  3TN9 2;  2ZHM A;  4XXA A;  5CFC A;  4IUG A;  3WY6 A;  3N9P A;  5JWP A;  5BNP C;  5CAD A;  1BBT 3;  2DF7 A;  1JMU B;  2DCJ A;  5C4W A;  1W8H A;  2DVF A;  3URF A;  3CLP A;  2VQT A;  4OZO A;  5FZ6 A;  2QVS B;  4MGY E;  3VV1 A;  3ZSM A;  4D8M A;  1MS0 A;  1R64 A;  2RDS A;  4LO7 A;  2RR1 2;  4CDW A;  2AAC A;  4SLI A;  3O1M A;  3LIH A;  4Q4W 3;  3AKS A;  4GUL A;  3VBF B;  3RPQ A;  1UOB A;  4WM7 B;  3ZR5 A;  2ZGN A;  3MIB A;  3OCP A;  4YW2 A;  1O3R A;  1BCX A;  2VZP A;  1WLD A;  1N1Y A;  2VOX A;  3ENR A;  4K7J A;  4KG8 A;  1Q8V A;  1UOJ A;  3NAP A;  2XR4 A;  1UKG A;  4E4S A;  4L11 A;  4Q4X 3;  1M4W A;  2VGD A;  5DG1 A;  1H2L A;  1RIR A;  3JBG 1;  3RG0 A;  4QPI A;  4OZX A;  1QJU 2;  3T09 A;  2HWC 2;  3C7E A;  2G9F A;  2RMU 3;  4LHK A;  4NO4 A;  3H3L A;  4AG4 A;  1D4M 2;  3MID A;  2R07 1;  1QJX 3;  2VNG A;  4LBK A;  4WV8 A;  1C3H A;  3K4A A;  1RUH 3;  5I0T A;  3OGV A;  1IZ3 A;  1A6C A;  3LEI A;  4RFT 0;  2C9K A;  3LFM A;  3AFG A;  4JKK A;  5L7O A;  4BQ5 A;  2ZHL A;  3NW4 A;  4FOW A;  3H1M A;  2P3Y A;  3ZXK A;  2N7G A;  4IEP A;  4DOU A;  5APA A;  1SBE A;  4XIK A;  4D3W A;  5E88 A;  3P1I A;  2OVU A;  4XIL A;  1AJK A;  1DG6 A;  4N43 A;  3SIT A;  4FFI A;  1S2E A;  1CX1 A;  2AYH A;  2Y0O A;  1W9W A;  1RJ8 A;  2DBN A;  3PUA A;  5BPX A;  4HLT A;  2Q0A A;  4Q4Y 3;  4CSW A;  1SLC A;  3PDQ A;  3GJB A;  2BV4 A;  3HBK A;  2K9Z A;  5KC6 A;  4LJH A;  4NN0 A;  4XAB A;  5IT6 A;  2VMF A;  2JB4 A;  4GIQ A;  2BWA A;  4D0Q A;  1POV 0;  2GME A;  4QGL A;  4QM9 A;  1VBA 3;  3B01 A;  4Q0S A;  4HT1 T;  1WCS A;  4MET A;  3N35 A;  2WT2 A;  2ZPX A;  3RJ2 X;  1FAT A;  2OUJ A;  5A3L A;  1BMV 1;  3B94 A;  5LK7 B;  4QHO A;  5EJ3 A;  3RGB A;  1R08 1;  1NLS A;  1AYN 2;  1YQ8 A;  3PMS A;  1HW5 A;  3OPW A;  3W5M A;  4Q27 A;  1FOD 2;  2K2S A;  2YC0 A;  4M01 A;  3ZOI A;  1O7F A;  4GJY A;  4IL7 A;  4EN0 A;  1JYI A;  4YPJ A;  4UFJ A;  1K5M A;  2UYB A;  3ZXF A;  4M4R A;  2PHU A;  1FYU A;  4AFB A;  2GH8 A;  1LOF A;  1JOP A;  1US2 A;  4IER A;  2A71 A;  5JUV A;  3J26 N;  3BI3 A;  4CDQ A;  2X53 S;  4YGD A;  4B1L A;  1V9U 1;  4IE7 A;  4DXT A;  1SPP B;  3ZKY A;  2VUA A;  3VBU B;  5KHG A;  4IV3 B;  5HV0 A;  3OUI A;  1WMX A;  1GOF A;  1O6U A;  4Q0V A;  3DV8 A;  4NAO A;  5JIU A;  1OF3 A;  5CZK A;  1W8F A;  3HD8 B;  2R04 1;  4YZ3 A;  3VBO A;  4XJ9 A;  5T5J A;  4AW7 A;  3F95 A;  2R1D A;  3VN4 A;  4UFL A;  5F37 A;  2FCT A;  5IAX A;  4QHZ A;  3V56 A;  3V0A B;  2YY1 A;  5FUN A;  2ADD A;  4QXB A;  5CFC C;  4K1Y A;  1W06 A;  2DU0 A;  1LOC A;  4QM8 A;  3DGT A;  4WM8 A;  1RUN A;  4LBQ B;  4YFW A;  3KLS A;  4I30 A;  2R16 A;  3LIG A;  4ZHN A;  1W2A X;  1V00 A;  1OA2 A;  2XH6 A;  3AP6 A;  3B9C A;  2JE8 A;  4FOY A;  5FXW A;  5A7N A;  2ZA9 A;  2Y34 A;  3B02 A;  1JYW A;  3BN6 A;  3SH3 A;  4C0H A;  2ZGR A;  4BA6 A;  2E7T A;  5H9Q A;  1WWY A;  2K0G A;  2RM2 2;  4E4Z A;  1JZ2 A;  1UMI A;  4KMQ A;  2VCA A;  3AJY A;  3K2O A;  4IV1 C;  1LGC A;  4YM3 A;  4AED A;  1RMU 2;  1DQ2 A;  1EPZ A;  2XVK A;  1ZRD A;  3IM0 A;  4H3W A;  4MUV A;  4D7S A;  5H9R A;  1ND3 C;  4YW7 A;  1W9S A;  2HWF 2;  2YC2 A;  4ORF A;  1SFN A;  5L9B A;  4HSJ A;  1HKD A;  2XQR A;  4GQ7 A;  5FK7 A;  2ZXQ A;  2OW4 A;  2PAM A;  3HQR A;  5FP3 A;  2WLQ A;  3HBZ A;  2D6K A;  1H9W A;  1DGL A;  1UU6 A;  1ENR A;  4GWM A;  2VD7 A;  5C8W A;  1G9D A;  1W03 A;  4FTS A;  1VBC 1;  4XUR A;  4OHW A;  1DDL A;  2ZJC A;  3KVA A;  1HRI 1;  5CFD C;  5FBJ A;  4OHY A;  2I07 B;  1PVC 1;  4MGQ A;  3WQ7 A;  3HAG A;  5FZ1 A;  4AFC A;  2RDN A;  2Q5T A;  2YBP A;  1NCR A;  4CCD A;  1HJF A;  3ZXG A;  1AR6 3;  2LAL A;  3OJB A;  4HN1 A;  3ZFE A;  4XQ4 A;  4CCE A;  2WQ4 A;  1N3O A;  2C1F A;  2VAU A;  3KT1 A;  3W5N A;  1ENS A;  1NAE A;  3NJZ A;  2PMW B;  4S2G A;  1I5Z A;  3F2Z A;  1TQ5 A;  1ZM1 A;  5FZO B;  3S30 A;  2X05 A;  1BEV 2;  2Y6F A;  2PEL A;  1C57 A;  3I3Q A;  4GH4 C;  5JOZ A;  1CAU A;  3LA2 A;  5GZC A;  4N53 C;  3M1H A;  3W20 A;  1VRB A;  3N7K A;  2HWD 2;  3USU B;  5T55 A;  4TN7 A;  3SLI A;  1AHS A;  1H30 A;  3GZT B;  1IHM A;  4YW6 A;  3QD6 A;  1YI7 A;  4UFM A;  1SBF A;  4PBP A;  4RL7 A;  1Q5O A;  2BFU L;  1OT5 A;  2FMY A;  4BQW A;  4QB6 A;  3I49 A;  4P5H A;  1QOS A;  2V5D A;  2D5H A;  1UF2 C;  1LRH A;  3U1X A;  1RUF 3;  2JD4 A;  4Q4V 2;  4EN9 B;  3M3O A;  5AVP A;  5I91 A;  1C8M 2;  4MYE A;  2XML A;  1LGB A;  1RVF 1;  1QNY A;  1AR9 3;  3LGR A;  1BHG A;  2WYF A;  2X29 A;  4E2S A;  2PAE A;  2ORX A;  3O0V A;  2V72 A;  2NP0 A;  4TYS A;  3U4X A;  1OA4 A;  1W90 A;  3OEA A;  4I02 A;  4QX3 A;  1CAW A;  3PNA A;  3WHT A;  2B46 X;  3EBR A;  4ZS2 A;  1S0I A;  3PU8 A;  3WUD A;  3D82 A;  2D44 A;  2XLF A;  3OF1 A;  4BLJ A;  1AVB A;  2W08 A;  4CCO A;  5A1A A;  1SCR A;  3C2U A;  2WFF 1;  2PHD A;  4ERO A;  1IQD C;  4KGQ A;  4P9J A;  2WO2 A;  4QU2 A;  5FP8 A;  5F3C A;  4QX5 A;  5KXC A;  5FXZ A;  5K4L A;  4COU A;  3N7L A;  2ZAB A;  4R9D A;  2E33 A;  5KHH A;  4X6R B;  2HWE 2;  2Y38 A;  2XPJ A;  3CZU A;  3ZFF A;  5A3N A;  5C8C B;  4URA A;  4FXG B;  2J42 A;  1W9F A;  3RSJ A;  4XUT A;  3H8O A;  4CYD A;  3APB A;  3ETQ A;  2VMD A;  1RUI 3;  1QXR A;  5F3E A;  3VDD C;  4BQ2 A;  3N9L A;  1AXZ A;  3T0A A;  4XDO A;  4BME A;  2A3W A;  3K46 A;  1RUJ 2;  1CIY A;  2XWJ B;  4MGS A;  2R04 2;  5G05 L;  3KHC A;  1PIV 2;  2W47 A;  2NLR A;  1TME 2;  3ITQ A;  5L9V A;  4NRO A;  2VL4 A;  1ZRC A;  2QQJ A;  2QDN A;  4W8J A;  5F7U A;  4R8H A;  1AJO A;  1CD3 G;  4AAX A;  4CVU A;  4NMI A;  4DRR A;  2WC2 A;  1KS5 A;  1W8U A;  4YVW B;  4A4A A;  4FFG A;  2JIJ A;  2LRP A;  2OX0 A;  5LBC A;  4A41 A;  3AKQ A;  5HCH A;  4RR3 C;  3E1F 1;  3LOI A;  4CDX C;  2VTF A;  5JOX A;  2VJX A;  2VMG A;  1DCS A;  2WNV A;  4ZXK A;  1XND A;  4LK7 A;  2PHL A;  2RDQ A;  3M7A A;  5F6L B;  1XYN A;  2ZGO A;  5F6K A;  4CU6 A;  3ZXA C;  4XYX A;  4BXS V;  3HMY A;  4JHZ A;  4Y3O A;  4HBN A;  5A33 B;  3NL1 A;  4LUM A;  3I2H A;  3J9S A;  5D8A B;  2RS5 1;  5FYB A;  2W91 A;  4R9B A;  4AVB A;  3ELN A;  1JXN A;  1T2X A;  4OMC A;  3VKM A;  3EMR A;  5FZA A;  2IFW A;  1QQP 2;  3GAL A;  2WA3 A;  4QXC A;  4LOS A;  1RHI 3;  5CIS A;  1H8T B;  4UI9 L;  1OOP C;  4LKS A;  3NV2 A;  1U0A A;  3RI9 A;  2WZR 1;  3BB6 A;  1VRH 1;  2WS9 1;  1J3Q A;  1YJK A;  5HCB A;  1VBD 1;  2B9V A;  4L99 A;  1YQ5 A;  4KBZ A;  4XF0 A;  4LKE A;  4DIN B;  5JR2 A;  1LAJ A;  1GWK A;  1S1A A;  2EXJ A;  1WLW A;  3MPB A;  3WUC A;  2F4P A;  1H1A A;  2YC4 A;  5IVJ A;  4FFF A;  2QE3 A;  1VBE 2;  4D6R A;  1CX4 A;  2V4V A;  1RJ7 A;  3E5X A;  3PUR A;  4UAP A;  3T08 A;  1GV9 A;  1RTV A;  4YM0 A;  3GNE A;  3AMH A;  4DFS A;  1MAC A;  4Y20 B;  4GZ9 A;  1J59 A;  4QGM A;  2D5F A;  4GB3 2;  2RS1 2;  4B29 A;  5I8T A;  2UWB A;  1W04 A;  3UGG A;  2ZHK A;  3MFC A;  1PM4 A;  1Q56 A;  4Q4W 1;  2PLV 1;  1E5S A;  2JDH A;  2VUD A;  1Q8S A;  2CGO A;  2XLG A;  3MF6 A;  4XUP A;  3IN9 A;  5E16 A;  4BDV B;  4FPC A;  4OYU A;  1YJL A;  3I2O A;  4CCK A;  1ZBA 3;  4UBH A;  1S0B A;  5FYT A;  4FXK B;  4YYO A;  1L7L A;  3OSD A;  2P3J A;  4Y4R A;  5I0D A;  4XJU A;  1OLM A;  2BW8 A;  2GP5 A;  2LUW A;  5T5L A;  1GYK A;  3OBT A;  5BNN C;  4HVO A;  2XG3 A;  3BTX A;  2R07 3;  1QH6 A;  1VIW B;  2ZGU A;  5D1I A;  4CUC A;  2RMU 1;  3U10 A;  1OA3 A;  3UGF A;  3I2D A;  2Y6H A;  3JCI A;  3ZPY A;  1PK6 C;  1PZ7 A;  4BPZ A;  2ZX1 A;  2Z4F A;  2JEN A;  5CKQ A;  3WDV A;  1UMH A;  3O14 A;  3POS A;  2DCK A;  1GZ9 A;  1Z7S 2;  3III A;  3K51 A;  4URT A;  5F9T A;  1U12 A;  2QQU A;  4DRV A;  2VOV A;  3KMH A;  4N8M A;  4OMD A;  3M8L A;  1IGO A;  4Y5T A;  1EAH 2;  2W0X A;  3DKW A;  5CA6 A;  4O65 A;  1RIN A;  2XVG A;  1ZA7 A;  4A7Y A;  2GND A;  3IDB B;  3W59 A;  4TWT A;  2VNO A;  1GQH A;  1G8W A;  2E7A A;  4ZU4 A;  2PN5 A;  3CF6 E;  1H8V A;  2D6O X;  1AYM 2;  2JEM A;  3IDC B;  5FBZ A;  4C90 A;  3OG2 A;  4HN0 A;  4JAA A;  4NAM A;  3LDK A;  4AVT A;  5LZ6 A;  1PGW 1;  3ON7 A;  2VH9 A;  4QDQ A;  4M3C B;  1VB4 A;  2VNV A;  5GLW A;  1YXW A;  3O1U A;  2EIC A;  3VBS A; 
#chains in the Genus database with same CATH homology
 1W8N A;  3FL7 A;  1JZ6 A;  2KD7 A;  5B4N A;  2J22 A;  1EUU A;  3ACG A;  4KWU A;  3WNM A;  2RVA A;  4DXR A;  3T0D A;  1PMJ X;  4QDR A;  3LPG A;  3WNL A;  1JZ7 A;  5JXH A;  2XOM A;  1TVG A;  4XUO A;  1UXZ A;  2BER A;  4ZY9 A;  3MUZ 1;  2WN2 A;  1GQP A;  2WAA A;  4ZXE A;  4RN5 A;  2W1Q A;  4CUB A;  1MPX A;  2YFU A;  1US3 A;  4JKL A;  2JDA A;  2WZ8 A;  1NX9 A;  3A7Q A;  2WYS A;  2J1R A;  5C70 A;  4HG6 B;  2Y64 A;  2ZEZ A;  3T0B A;  4ZZ8 A;  2VMC A;  2RJ2 A;  1XC6 A;  2VZV A;  3CMG A;  3I2J A;  3OB8 A;  1ULP A;  3NRU A;  2VZQ A;  4LQR A;  4FI9 A;  3VD7 A;  4BK4 A;  4BK5 A;  5JXI A;  4L0P A;  3ACH A;  2W92 A;  5HPO A;  1UY4 A;  5DMY A;  3PUH A;  2X10 A;  1W0N A;  4GWI A;  3IAP A;  3OGS A;  3HOB A;  1XNT A;  3I2K A;  5IFT A;  1XPW A;  4CU8 A;  2WO3 A;  4DEV A;  1K42 A;  4MO3 M;  4A45 A;  4QX0 A;  1SHW B;  4GWJ A;  4QB2 A;  1UWW A;  2WQ8 A;  4A44 A;  3SEE A;  1NUK A;  3HNB M;  1GOG A;  2XQX A;  3NJV A;  4IUG A;  2EIB A;  2XHN A;  3MUY 1;  3U37 A;  3HPN A;  2DCJ A;  2VQT A;  4OZO A;  4CU9 A;  2YG0 A;  5IFP A;  3A22 A;  1F4H A;  4D8M A;  1R64 A;  1GU3 A;  2YFZ A;  2QQI A;  4QB1 A;  3WEZ A;  3D3A A;  3VDB A;  2VZP A;  4UOJ A;  5G04 L;  1UY0 A;  2Y6L A;  4CUA A;  4KI5 M;  3C7O A;  1GUI A;  4Z2A A;  3UNP A;  2VZS A;  3T09 A;  3C7E A;  4DUW A;  3EB7 A;  3THD A;  3T2P A;  4AG4 A;  2PQS A;  5EJZ B;  2VME A;  4LPL A;  2E26 A;  3K4A A;  3OGV A;  2Y8K A;  3LQC A;  3LEI A;  2C9K A;  3K4Z A;  4JKK A;  1YQ2 A;  1JYN A;  2VCB A;  2W87 A;  1ULO A;  4OUE A;  3ACI A;  5J1X A;  2C26 A;  1LNS A;  1WCQ A;  3P1I A;  1JZ8 A;  4ARY A;  1GMM A;  3WNN A;  1CX1 A;  3C8X A;  1W9W A;  3GDB A;  4LHS A;  1O8P A;  3I97 A;  2Y6K A;  1UXX X;  5EJ1 B;  2VMF A;  1L7Q A;  3DEC A;  2QQN A;  1CZS A;  3IB3 A;  3NJX A;  1O8S A;  4D0Q A;  4M4P A;  1H6Y A;  2J1A A;  4W50 A;  3CKH A;  2QBX A;  2HYX A;  3I3B A;  3K4D A;  2J1E A;  3J7H A;  3W5M A;  4JKM A;  3VD4 A;  3PUI A;  2W3J A;  3T2O A;  2BGO A;  1NKG A;  2JKX A;  2WDB A;  2RV9 A;  2J1V A;  1K12 A;  4P00 B;  4YPJ A;  3I2G A;  3HNM A;  1OD3 A;  4M4R A;  3FN9 A;  5DQ0 A;  3T2Q A;  1US2 A;  4A42 A;  5JUV A;  1EUT A;  3NQH A;  3OGR A;  4W4Z A;  5IJR A;  4DXT A;  2QQM A;  3WNP A;  1GOF A;  2VCC A;  1OF3 A;  5CZK A;  3I2F A;  2J1T A;  4XUQ A;  2YB7 A;  3SKJ E;  4P5Y A;  2WAB A;  2OKX A;  4E8C A;  2JE8 A;  1D7P M;  4PF1 A;  1JYW A;  3BN6 A;  3WNO A;  4XUN A;  3HJR A;  3WNK A;  1JZ2 A;  4PQQ A;  1UMI A;  4KMQ A;  2VCA A;  5LA0 A;  2WUH A;  5CYY A;  4DUV A;  2L9L A;  3NNG A;  3WF3 A;  1W9S A;  2YC2 A;  3VDC A;  3ETP A;  3GGL A;  4A3Z A;  2W1S A;  4A6O A;  2ZXQ A;  3CIH A;  4BDV B;  1PX3 A;  1H6X A;  2DDU A;  3MV1 1;  4ZZ5 A;  4XUR A;  1W8O A;  4MGQ A;  3A21 A;  1F4A A;  5JXG A;  3WF0 A;  3THC A;  3EYP A;  2ZEX A;  4QAW A;  1KEX A;  3W5N A;  1NAE A;  2XON A;  3DYP A;  3F2Z A;  2CDO A;  2VZR A;  2EIE A;  3GM8 A;  2X05 A;  3ACF A;  5FUI A;  2Y6G A;  3C7G A;  4XVH A;  1O59 A;  2BBA A;  5LCW L;  4DEQ A;  3UET A;  1L7R A;  4QX2 A;  1DP0 A;  2EID A;  3AC0 A;  3CQO A;  1OT5 A;  1CZV A;  3JXS A;  4QB6 A;  2V5D A;  3HEI A;  5IYY A;  3C7H A;  1DYO A;  1JYV A;  2VO5 A;  2CDP A;  2J7M A;  1BHG A;  2BZD A;  2ORX A;  3OEB A;  1JU3 A;  4QX1 A;  2V72 A;  1JYX A;  2VZT A;  3SKV A;  3OEA A;  4QX3 A;  3WF2 A;  3FHQ A;  1UX7 A;  1XNA A;  3LE0 A;  5HXM A;  3MO4 A;  1JZ3 A;  3ZM8 A;  1K3I A;  3GXU A;  2W94 A;  2E31 A;  3LEG A;  1UZ0 A;  5A1A A;  5JMO A;  1IQD C;  2WO2 A;  4CU7 A;  3I2I A;  3WQB A;  2W5F A;  2E33 A;  1UY3 A;  3VD9 A;  3CZJ A;  2QQL A;  2Y6J A;  3CZU A;  2WO1 A;  3CDZ B;  4XUT A;  5C7G A;  2VMD A;  1J84 A;  3T0A A;  3K46 A;  4MGS A;  1CIY A;  5G05 L;  2W47 A;  2C4X A;  2VL4 A;  2QQJ A;  3C7F A;  1SDD B;  5LA1 A;  4XZU G;  2E32 A;  4W8J A;  5F7U A;  2R7E B;  4AAX A;  4CVU A;  1JZ5 A;  3IAQ A;  5EIY B;  4A4A A;  2VZO A;  4A41 A;  5C71 A;  4DXS A;  1W99 A;  3E1F 1;  2J1U A;  2VC9 A;  3K75 B;  2VTF A;  2W1U A;  2ZEW A;  2VJX A;  4JX0 A;  1P8J A;  1OF4 A;  1TG7 A;  5B4X A;  2ORZ A;  3WSO A;  4CU6 A;  1RYY A;  1K45 A;  4PT6 A;  4BXS V;  1W9T A;  3MV0 1;  4JHZ A;  2W95 A;  2ZEY A;  2W1W A;  3I2H A;  2W91 A;  1UYY A;  1T2X A;  3HNY M;  2BGP A;  4OMC A;  3IDA A;  4QPW A;  2X09 A;  3FHA A;  4ARX A;  4UI9 L;  4LKS A;  1HN1 A;  2VZ1 A;  2W46 A;  3VDA A;  2B9V A;  5JR2 A;  3LPF A;  1GOH A;  2B4K A;  4RYD A;  3K77 A;  2YC4 A;  2W9X A;  4P08 A;  4UAP A;  2V4V A;  4E8D A;  1WKY A;  3T08 A;  2WBK A;  2WN3 A;  4GZ9 A;  4P02 B;  2HLE A;  5IHR A;  1OH4 A;  3MBW A;  1SG3 A;  1J83 A;  4XUP A;  3WF1 A;  2LW8 A;  4OYU A;  1UY1 A;  3HN3 A;  2VOT A;  3DYM A;  1JU4 A;  4TXW A;  1KGY A;  1PMH X;  1UY2 A;  5I0D A;  3A23 A;  1UYX A;  2JD9 A;  2VZ3 A;  1I5P A;  2QQO A;  1CZT A;  2VM9 A;  4CUC A;  2WZE A;  2VZU A;  4ET7 A;  3BGA A;  2Y6H A;  5LA2 A;  3VD5 A;  1GNY A;  1JZ4 A;  3OBA A;  2Z4F A;  1DLC A;  1UMH A;  3DYO A;  2DCK A;  1JHJ A;  3III A;  5DN2 A;  2J1S A;  4MOA A;  3ABZ A;  4OMD A;  5JXJ A;  4TTG A;  2VQU A;  2QQK A;  3VD3 A;  3P6B A;  2VR4 A;  3UES A;  1JI6 A;  2WAO A;  3LEK A;  2LS6 A;  4QDS A;  4DUX A;  2ID4 A;  3SEP A;  4MAD A;  5DPN A;  4BJ0 A;  3OG2 A;  1UYZ A;  3I3D A;  3WF4 A;  3ECQ A;  4QDQ A;  1PX4 A;  3I3E A;  2EIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...