2J1RA

Structure of a streptococcus pneumoniae fucose binding module
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1rA00
1JU4A 2RJ2A 1TG7A 5EJ1B 3DECA 5HPOA 2JKXA 5HXMA 3FN9A 1GMMA 5IYYA 2W3JA 2J1TA 3HOBA 3I2GA 3T08A 3GXUA 3CQOA 3UESA 1YQ2A 1JZ8A 2C9KA 3MV01 2X05A 3LE0A 2W91A 4JX0A 3WNMA 2WAAA 2X10A 1UY1A 4MO3M 4GWJA 3OB8A 4LKSA 1NKGA 1US2A 1PMJX 4RN5A 4A41A 2XONA 3OEBA 2W94A 2WBKA 2HYXA 1W8NA 3VD4A 1NAEA 2VZ1A 1EUUA 2E32A 4DUWA 3C7EA 3MO4A 1UZ0A 2V5DA 1OF3A 1W99A 3ABZA 1UYZA 3C7OA 3WEZA 4E8DA 2DCJA 5EIYB 3VD7A 5FUIA 3CMGA 3ACHA 2J22A 2HLEA 3HPNA 2LS6A 2Y6KA 2WAOA 4JKLA 3WNLA 3HJRA 4CVUA 2XOMA 4ZXEA 2E33A 3K4AA 1GU3A 1UYYA 1WCQA 1OH4A 2X09A 5LCWL 4A45A 2QQJA 3DYPA 4QDQA 1CZTA 4W4ZA 2B4KA 3P6BA 2VZVA 2WO2A 2EIEA 2VMEA 1IQDC 2E31A 5C70A 2VQTA 5JUVA 5IFTA 3E1F1 2VCCA 3LQCA 4ZY9A 1JI6A 2ZXQA 3I97A 2RVAA 5G05L 4LHSA 4DXRA 3AC0A 1UXXX 1JZ7A 3F2ZA 3A21A 3T0DA 4BXSV 2WUHA 4JHZA 2WQ8A 1W0NA 3CZUA 4MGSA 3I2IA 3HNMA 5B4XA 2VZUA 4Z2AA 1JZ4A 1L7QA 1DYOA 2ZEXA 4PT6A 4M4RA 4CUAA 4P5YA 3D3AA 4MOAA 2LW8A 3MBWA 4PQQA 2W1WA 1RYYA 1F4HA 3VD3A 2VL4A 4MADA 2Y6HA 2W95A 1JYVA 1H6YA 4PF1A 4BJ0A 3ACFA 5C7GA 1NUKA 4JKMA 1JZ2A 3NQHA 4LPLA 5JMOA 2KD7A 3C7HA 2VCBA 4UI9L 3A7QA 3VDCA 2E26A 4AG4A 4XURA 4XUOA 1P8JA 2PQSA 3A22A 1JYXA 2WABA 1K45A 3LEKA 3WSOA 4A4AA 5CYYA 5G04L 4OYUA 1GOHA 5B4NA 1JU3A 3OGRA 2V4VA 1OT5A 2W9XA 1PX3A 4M4PA 2VMFA 4ZZ8A 1J83A 3SKVA 4L0PA 3A23A 4CUCA 2W92A 2J7MA 3ACIA 4XUQA 4QB2A 2RV9A 3OGSA 1KEXA 4TTGA 2QQNA 4A3ZA 1UY4A 2VZSA 1XNAA 2Y8KA 2YFZA 2CDOA 1TVGA 2VO5A 4OUEA 1O8SA 3ZM8A 1UXZA 3T09A 4DUXA 1H6XA 5IJRA 3THDA 3FHQA 4HG6B 3DYMA 3ECQA 3VDAA 2BBAA 3I3EA 3I2KA 1JZ6A 2VOTA 4BK4A 4MGQA 2W1QA 4DXSA 2WO1A 1L7RA 4QPWA 2J1RA 4QX1A 2L9LA 1ULOA 4CU9A 2YB7A 4W50A 3WF4A 4UOJA 1BHGA 4A44A 5JXGA 3HNYM 4DUVA 3IDAA 4QDRA 5DQ0A 2QBXA 1UX7A 5DMYA 1XPWA 1UY3A 3HEIA 3LPFA 4QX3A 3WF3A 5IFPA 3ETPA 5LA2A 2W46A 4W8JA 1UY2A 3SEPA 3K75B 1DLCA 2J1SA 2Y64A 4XUPA 5I0DA 3CZJA 3IB3A 2BGPA 1JZ5A 2WZ8A 4BDVB 1XC6A 3T2OA 1MPXA 1O8PA 2QQIA 5C71A 2CDPA 1JYWA 5J1XA 3I2JA 4FI9A 4KI5M 3GGLA 1W9WA 2JE8A 1EUTA 1UMHA 2VZQA 3FHAA 5F7UA 1GQPA 1SHWB 2J1VA 3MUY1 3SKJE 2ORXA 2JD9A 4OMCA 2VCAA 5JXIA 3BGAA 5JXHA 1CZVA 2VZRA 4D0QA 1JHJA 2DDUA 2VZOA 2VR4A 3GM8A 4ET7A 2JDAA 1R64A 1K12A 4BK5A 1NX9A 2QQOA 2WYSA 3K4ZA 5JXJA 3HNBM 4XZUG 2Y6GA 2EIBA 2W5FA 5EJZB 3BN6A 3I3BA 4CU6A 3MUZ1 1JZ3A 1PMHX 1LNSA 1JYNA 3K46A 1CZSA 1DP0A 1OF4A 1W9SA 3EB7A 4KMQA 3VD9A 3I2HA 1O59A 3OGVA 3U37A 2VZPA 2YC2A 1KGYA 5DPNA 1HN1A 2QQKA 3CIHA 3FL7A 3IAPA 3SEEA 4QAWA 2J1AA 4QDSA 3WNKA 2WZEA 4ARYA 2EICA 3T0AA 3GDBA 1J84A 2WO3A 3K4DA 2W1SA 1CIYA 2VQUA 4UAPA 1F4AA 2DCKA 1W9TA 2EIDA 3WNPA 3THCA 1CX1A 4QX2A 4QB1A 2YG0A 4ZZ5A 2W47A 1ULPA 3C7FA 4CU7A 1SDDB 4ARXA 3LPGA 4IUGA 2WN2A 1PX4A 2WN3A 3NJXA 2QQMA 2ZEWA 1UY0A 2ORZA 3WF2A 4D8MA 2Y6JA 1GOGA 4KWUA 4DXTA 3OEAA 1I5PA 3C7GA 1WKYA 1UMIA 4YPJA 4QX0A 3NJVA 5CZKA 2VC9A 1D7PM 3CKHA 3K77A 3HN3A 4OMDA 2VMDA 2ID4A 3MV11 3LEIA 3VD5A 3WNOA 4CUBA 3NNGA 2BERA 4GWIA 3DYOA 4CU8A 2BGOA 3OG2A 4OZOA 4LQRA 3LEGA 3J7HA 3ACGA 3VDBA 2VM9A 4A6OA 4P00B 1GNYA 4XUNA 3JXSA 3I3DA 4QB6A 2Z4FA 1US3A 2QQLA 4GZ9A 1GOFA 3CDZB 1XNTA 4XUTA 1SG3A 2W87A 5LA1A 3IAQA 2C4XA 4RYDA 3T2QA 2W1UA 1GUIA 5A1AA 3I2FA 3PUHA 1UYXA 4A42A 3WF0A 2BZDA 2R7EB 3UNPA 2VZTA 2J1EA 2ZEZA 1W8OA 3NRUA 5DN2A 2VZ3A 2ZEYA 2VTFA 3C8XA 2XQXA 1K3IA 3T2PA 2YC4A 4XVHA 2YFUA 5LA0A 2OKXA 5IHRA 1T2XA 3P1IA 4AAXA 4E8CA 2VMCA 3OBAA 4JKKA 2C26A 3WNNA 3W5NA 3UETA 2V72A 2B9VA 2XHNA 3WF1A 2Y6LA 2VJXA 4P02B 1OD3A 3W5MA 2J1UA 3PUIA 4TXWA 4P08A 5JR2A 3EYPA 1UWWA 3IIIA 4DEVA 3T0BA 1K42A 3WQBA 4DEQA 2WDBA
chains in the Genus database with same CATH superfamily
4QXKA 5M0TA 1GR3A 1RUF3 1Q8PA 2HBTA 2YPDA 1OOPA 1JU4A 5FYIA 4XXPA 3ZSEA 1CWPA 5BNPC 5EP9A 3SLIA 3ZR6A 3BYWA 1ULEA 2JDHA 2Y38A 2JKXA 4Q4X1 4QM9A 4RHV3 1YQ8A 3ZVXA 4LJHA 2PLV1 4M3CE 5JOXA 2W3JA 1BK0A 4RD7A 3CJXA 4GKXA 4XFHA 5FYTA 1W05A 3T08A 2HEWF 3ETQA 2WFF1 3NJYA 1LOAA 4XCAA 1W03A 5EPAA 3ZPOA 1YQ2A 3H3LA 4Y3OA 4LUMA 3WP5A 1DHKB 3LE0A 3WR0A 1JOJA 5DUXA 3H3UA 4GWNA 4RR3C 2FDGA 2FDFA 2WAAA 4X6RB 3N9MA 2WWJA 1LULA 2X10A 5CKQA 4GMP3 2R0HA 4YG6A 3DUIA 1XRUA 1VBB3 4NIGA 1PMJX 4S2FA 4A41A 3ZFFC 2ARBA 2K9ZA 4XHXA 2VVEA 3OEBA 2EAAA 4MYEA 3OPZA 2WBKA 2HYXA 5FBZA 3J9SA 3VD4A 1NAEA 2AR6A 4UYBA 4AEMA 1QOSA 2HWB2 2VGDA 3FHIB 4DUWA 1FPN3 1T6GC 3KVAA 3MIBA 1YQ6A 2GSYA 4L11A 1MVQA 4RQPB 1W04A 2IXJA 3KT7A 1FOD1 1PO13 4IESA 5A3OA 1RUC2 3ROUA 4BXFA 5JCTA 1UYZA 4FFFA 4C91A 3N7MA 4JRLA 4AEDB 3HT2A 1VBA3 3I54A 3ZFGA 5CBLA 5FO8B 1LEDA 3AZVA 4JQRA 3TEZA 1YQCA 5T50A 4EN7B 2HLEA 2HWF3 1YI7A 2VBBA 1BEV2 1JYTA 5L7OA 3OBZA 3BODA 2RE9A 4LKFA 4JKLA 3KT1A 5HBAA 3T30A 4WM7A 1D4M2 3AYDA 5C4WB 1ZBE2 2X5IC 1H2KA 3PUAA 4IEQA 4K20A 1WCQA 2X09A 3BB6A 3JQXA 3MLJA 5JOWA 2QQJA 1ZZ8A 2X29A 1CZTA 5GZEA 3ZO0B 4E2SA 2B4KA 1QJY2 3NNFA 5GLVA 1V9U1 2EVXA 2F17A 2RJLA 3WG3A 4UW5A 2DVAA 2EIEA 2E7AA 2VMEA 2A3WA 1FI2A 2D98A 2EXKA 4TYSA 5AC93 1AZDA 1RHI3 4S2GA 5JSOA 4IE0A 1N3OA 5JLVA 1OLMA 2AACA 3TOJA 3ZYBA 3DKWA 2R063 4QPGC 1EYBA 3LQCA 4ZY9A 1JI6A 3I97A 3HAGA 5E16A 2EA7A 4COVA 3VKMA 5DZGA 1Z7S3 4LHSA 3AC0A 1GNHA 1OQEA 1UXXX 2I07B 4CXWA 5A32A 5F3EA 5ABJB 5A3NA 4FTSA 2Q5TA 3MW4A 4QPIC 3UT0A 2D3RA 3QBQA 5L9BA 1SLIA 4CUGA 2PELA 1GWKA 3ZFEC 1CAVA 3CZUA 4MGSA 4CXYA 3I2IA 1MR5A 3VBHC 1J3RA 4W6XA 4Z2AA 4YW6A 1L7QA 4P9WA 3OBTA 1J58A 1STMA 1W6NA 2YPJA 4E4DX 1AHSA 1WMFA 1DBNA 1MS3A 4QHZA 5F5IA 1ND2C 2UY9A 2ZEXA 1YFUA 5CG9A 4R8HA 5T5PA 4CZSA 5CFCC 2IXKA 5BYNA 2FDHA 2F4PA 1J3QA 1PIV1 5FWJA 3MBWA 4PQQA 3ZFFB 5ANQA 1X8EA 2W1WA 4RGGA 2FDKA 4NPLA 2ZKLA 2JG9B 3OGGA 4NHKA 4LOTA 1VB2A 4MADA 1OH3A 2Y6HA 1PZ7A 3ZOIA 2E53A 4PF1A 4XFBA 4BJ0A 3WW1A 1S0BA 3FX3A 4B3NA 1U5XA 4KG8A 4DZGA 5C7GA 5J37A 4TWTA 4MUVA 1TMF1 2B42B 4XPVA 3ASIA 2KD7A 3C7HA 2A7AA 2R1DA 4XMIA 3VDCA 4B8EA 3W20A 2ZX2A 4ATFA 4E4SA 5ACA2 3ELNA 3VZMA 3WVJA 1XSRA 3ACLA 4R9AA 4QPYA 1EAH2 4BQYA 1UNBA 2EALA 3BU7A 4AG4A 1BXHA 1W2AX 3A22A 1XOYA 2XQRA 3WG2A 4A6SA 3ME2A 2WABA 5DDJ3 4Y1ZA 1HRV2 1CR7A 4OFGA 1RJ7A 2R043 4LBQB 2JDKA 2ZMKA 3ZLIA 4OYUA 4DS0A 1QQP1 1DZQA 1IHMA 1B35C 1H2LA 1XU1A 4IEXA 4P9GA 3WT3A 4ASKA 3OGRA 4F83A 2W9XA 4CTEA 1PX3A 1LOEA 1YO8A 2P17A 2JIGA 2WA4A 1O6UA 3DXTA 2ZCWA 4CCDA 3H8XA 5FBJA 4P9XA 4UXAA 2W92A 1MZ6A 4LKEA 1QNYA 4I0WB 3S5AA 4YW1A 1GLHA 3K2OA 4XJUA 4XUQA 2MHFA 4HPKA 1DFQA 4TTGA 4GB32 1AR63 3AM2A 2QQNA 4A3ZA 4BQ5A 1YI9A 2VZSA 4CSWA 4DFSA 4MG2A 1HXS2 1MS1A 4GA9A 2HEYF 3L9JT 4XAEA 5FLIA 4J1WA 2Y8KA 3GCWA 1JUHA 2PQQA 3Q8AA 1UKRA 2VO5A 4OUEA 4UW6A 2HWD2 5FK8A 5FZ0A 1COV3 4C90A 2LTNA 3O1VA 3FFQA 2IFWA 1UXZA 1HN0A 4PJYA 4XILA 4AOCA 2WS92 3THDA 4G3YC 2R072 3LSEA 5JIUA 1E5IA 2JB8A 2ZTNA 4CEYB 4UFIA 3BIWE 2KM2A 2RS31 4NROA 4CDWB 2WC2A 1IQAA 2BJSA 2LROA 2VOTA 2PXJA 2QQPA 1EP0A 2W1QA 1HQNA 3PUSA 3TB0A 1UZWA 1WA4A 4AI9A 4JAAA 4A3XA 1Q3EA 5FZKA 3RZGA 3AJZA 2SBAA 2ZGPA 3BI3A 1U0AA 3D6EA 1OLRA 4YGBA 2P37A 2DBNA 4CU9A 4W50A 2VBPA 4UOJA 4CP1A 5HI0A 4ES8A 5JXGA 1XNCA 1PK6A 2IZWA 3AK0A 3HBZA 4EWAA 4XDQA 2CWMA 4EQVA 1CESA 1QH7A 3IDCB 1SBDA 5FY7A 4AVSA 1Y9QA 2D3SA 3AP7A 5FP7A 1URXA 1VRH3 1UW8A 3D4KA 5EWSA 4EZHA 5CEHA 3V56A 3NL1A 4IDZA 5DMYA 4NO4A 1FNZA 3Q8EA 3VBUA 1JHNA 1I5ZA 1YWKA 4TSVA 3VKFC 3U11A 2EXIA 3D82A 3I2DA 4PLOA 3LSDA 1G6NA 3ETPA 5BY5A 2RR11 2D6PA 2A1XA 3CF6E 1FOD3 2DURA 4W8JA 1B35B 4LBMA 5IVVA 2ATFA 3SEPA 5KHIA 1W6QB 3FUOA 1BVVA 3CJIA 2W52A 5DZFA 1LCLA 4CCCA 1S0EA 4LXLA 5JOYA 3CZJA 3OYWB 1RUE1 4YVWC 3RYPA 2BGPA 2DV9A 2VMGA 2V5YA 3GHNA 4IEVA 3T2TA 5TSWA 5CISA 3VL9A 4E4HA 1VBD2 3WDTA 1D2QA 4BISA 1ENQA 2IXCA 2FQPA 2VH9A 2WZR2 1REDA 3H1MA 4Q4W1 2JDYA 4AFDA 3HQXA 5GLWA 1V9U3 1LOFA 5A7WA 4CE8A 2VULA 3ALQA 5F7UA 3O1OA 4AQTA 1GQPA 4HONA 2J1VA 2RHPA 1F2NA 2OZ6A 2OQ6A 3AKTA 2WYFA 1W9YA 1LU2A 1UL9A 2LRPA 4CEWA 5JXIA 4LLFA 1CZVA 2WQ4A 2ZABA 4NIAA 5L9VA 4D0QA 1GZTA 2QKDA 3ZYPA 3N9NA 4XFIA 5DAXA 5IVEA 3RZKA 1AR91 3PHMA 3U10A 3VZOA 5BNNC 3VKNA 1SACA 5FZIA 1NZCA 3IT8A 5DAWA 1XU2A 4AHZA 3AFKA 1YNAA 3RFRA 1ZRCA 2A6YA 4AI8A 1R091 5JXJA 4ZKTB 3K4ZA 3O1PA 3RZJA 1Q43A 4EN0A 1SLCA 2W5FA 5FMBA 3I3BA 4IE6A 3E5UA 5CFDB 2JKBA 3W59A 2YMZA 1JBCA 1PMHX 1W6PA 2JENA 1JYNA 4FTEA 5LEJA 1MQTB 1UOBA 2A3XA 5IVJA 3T4HB 4KMQA 5IK5A 1PIV3 4QQHA 2UWBA 1ND3C 2WKKA 3VD9A 2ZZQA 1CAUA 3FBYA 3OGVA 1NLQA 4AHWA 4XZPA 4OQ9A 1KGYA 1W8ZA 3VN4A 3DXUA 2RS52 4UF0A 2AZ5A 5EFUA 1PGL1 2VW0A 2ZGMA 3LAGA 2H6CA 5CADA 2I45A 4FPOB 4QDSA 1YCIA 3TEYA 1H8TB 1HRI1 2EICA 1TMF3 2RDSA 2WZEA 4L8QA 4NUBA 1PNFA 3MW2A 2W1SA 5LW9A 1GZ9A 5K7PA 2NZ9A 5JPNB 2Y26A 4IERA 3PJYA 1RUNA 2A73B 4GXLA 5JZGC 2OS2A 5LBBA 1F4AA 3WNPA 1W9TA 4GAZA 5KXEA 1KFXL 4M3CB 5LK5A 3LKJA 4OZXA 4QB1A 3VZKA 5IK4A 1PHMA 2W47A 5J48A 1RUJ1 4MV2A 2DVBA 3B5LB 4GKYA 2E7TA 3S7IA 3LA3A 2XVLA 1YFYA 2Q8EA 1QQP3 4ARXA 2VNRA 4IUGA 2NLRA 2WN2A 4KBZA 3NJXA 3PU3A 1DIWA 4D6QA 3VKOA 3M3EA 2JEMA 2AEZA 1TZOA 1ULGA 2ORZA 2XWBB 3WF2A 4NJ4A 4D8MA 4EYUA 5FLHA 4IW3A 2VXRA 1GOGA 4COYA 4KWUA 2VD7A 1V0AA 1W6OA 4BMBA 1ZZ9A 3USUB 2RS11 3LGRA 1QJEA 4IQPA 4Y1UA 1KJLA 3KLSA 5CZKA 1UZYA 3CBNA 1WWYA 3HD8B 2VMDA 2ID4A 1H9PA 2BWAA 2GALA 5CA6A 1RTVA 3CNAA 5JVVA 4LBJA 1W2TA 2DCTA 3AZYA 5FPAA 3WNOA 3X29B 2BERA 4HVOA 3T1MA 3ZSLA 1DF0A 1WLWA 3DN7A 2W0XA 4BB3A 5JMCA 3CJIC 3OG2A 1NCRA 2CAUA 2ZJCA 4BQ4A 4LQRA 1RMU2 2RS33 1O3QA 2JG8A 3M3IA 1AL21 4LEJA 1CGPA 1PM7A 3M7AA 1Q56A 2DVGA 4AK3A 1AR71 4IV3A 1ND3B 1CX4A 2RMU1 2YU2A 5FKCA 4XDPA 5IVYA 1RUD2 1SCRA 4IEUA 3RYRA 4EN9B 1MACA 3U75A 2XL9A 1PVC2 4OI2A 3VBSC 5BNOA 3BTYA 4Q8LA 1US3A 4EN6B 4GZ9A 4J25A 3WD5A 2GNDA 1IS6A 3O1TA 1XNTA 2VNOA 4FPCA 4N7IA 5SV5A 3AP9A 1ASJ1 3E97A 5FYZA 1H1IA 3ZN6B 1GP6A 4M00A 5I0RA 3KCYA 1NOVA 1J3PA 1BBT2 2AC1A 4NWVA 5LY1A 2OUJA 4LK7A 5C5TA 4IEPA 1AUYA 5A1AA 1QJX2 2W1UA 3GBGA 4ZS3A 5F2SA 4HXCA 4A42A 2Z2SB 2QFEA 2BZDA 2R7EB 5FXZA 2XGXA 2FD8A 4GWMA 3NRUA 3V0AB 1OD5A 3IMMA 2D5HA 2B9UA 2A6VA 2RR13 3APBA 3VGIA 1OI6A 2EIGA 3UKTA 3MGUA 5GZFA 4Q1PA 1N3PA 3SNMA 1CAXA 1K3IA 1QXPA 1XSQA 3ENRA 4Q0VA 1LHOA 1Y9MA 2BOJA 4XBLA 4MVTA 4YLZA 1IS5A 3P1IA 2BOIA 1RUE3 4FAHA 4UW3A 2RDNA 1J1LA 3S30A 4JKKA 1DQ6A 2YYOA 2C26A 1IKPA 1Q8OA 2DCZA 3WUDA 3ZN4A 4E2QA 3O1UA 1ULFA 4AI0A 3IDEA 4Q4W3 1U12A 3UETA 4A2UA 2ZKNA 1G9DA 1UU6A 2B9VA 2Y6LA 4YW5A 4IE4A 4P02B 1OD3A 4MXWA 4XC9A 4Y4RA 1CIWA 4CCOA 1SDWA 3C3VA 2ZMLA 5JR2A 2BPA2 5FZ3A 3EYPA 5FY1A 3BU0A 1UWWA 4AI1A 1K42A 4URAA 4ZU4A 1C57A 2AYHA 5I91A 1MS4A 4KU8A 4CCEA 4YARA 4YM3A 4AEDA 4OUMA 3RZZA 4X8PA 3DECA 1AJKA 1JOBA 1DGWA 5E1RA 3MIEA 1GMMA 4YW2A 1AR93 1I3HA 2UURA 5K8SA 4NHLA 2UYBA 5FK7A 2IVJA 3CU7A 3UYJA 3VDDC 5IATA 2HWE1 3I2GA 1NA1B 4ZHNA 4GD4A 1VMFA 4WM8B 3PVBB 1SFNA 2WNVA 3CQOA 1TE1B 1R093 5D8AA 3UESA 5DAPA 4AI3A 3LZZA 4FP3A 5FY9A 1KJRA 2ZGNA 3CL1A 2NM1A 4JCKA 4PBPA 4XOGA 3ZMOA 5C8CB 2UY8A 1IPSA 1WD3A 3HVDA 3KZ4C 3VBOB 4MO3M 1CVNA 4OI1A 4BQ1A 3Q8BA 1O5UA 3GHMA 1VPHA 3K3NA 3KCXA 2XKPA 1VBC1 3OD0A 3MLKA 2FZ1A 5HCFA 5F5QA 4AI2A 5JI9A 2XONA 3P3PA 2ARXA 4WZCA 4Y1XA 1IG3A 4LORA 4R4ZA 4GH4B 4KNCA 2R30A 2DUPA 3NV4A 2FDJA 2E32A 5ABJA 5FUPA 3C7EA 4QGLA 4B1LA 3AKPA 1OF3A 1HRI3 3GBFA 4DOUA 1IS3A 1XYOA 2HKXA 3C7OA 2DCJA 5C9AC 3VD7A 3ES1A 3CMGA 4Q0PA 1LESA 4Y5SA 3WY6A 1UYPA 1QU0A 3MPPG 3UGGA 1W8TA 4K21A 4QXHA 3WNLA 3DPRA 5FZOB 1RUJ3 4PLNA 2QTWB 3BVCA 3POBA 5KC5A 2DYCA 1GP4A 2BUKA 5KXBA 5SV8A 4RS5C 2XJPA 2GH8A 3DYPA 4A45A 4CP9A 4QDQA 4W4ZA 2OPWA 1GFF2 3JU9A 5FMDA 2XR4A 5KHHA 4AHXA 1QNWA 4NRQA 5AFEA 2C9AA 1IQDC 1HKDA 2GN7A 5FZFA 1D0HA 3PVOA 3OPWA 4Z8BA 3E1F1 3R4SA 1AYM1 2VCCA 3N7LA 3W58A 3WINE 1SCSA 2ZXQA 4XIOA 2RS13 1AR82 2WNUB 5G05L 5J98B 3H7JA 4DXRA 3BPZA 2PA7A 1W3XA 3T0DA 2WINB 2WWSA 2YBPA 4JHZA 4D7SA 2TEPA 4S2HA 4WVZA 5EXOA 2AH2A 5IUQA 3B01A 3JB8A 3PMEA 1V6LA 4CRQA 4JGYC 3ZKYA 4META 3V0BA 4QMAA 2VZUA 2QCSB 1JZ4A 3M4FA 3INAA 4XF4A 2ZPXA 1AL23 2QZ2A 3KHBA 3O0XA 3ZPYA 4JGZB 1AR73 5A1LA 5CNAA 5FMOS 2RMU3 4P5YA 1R082 1RHI2 4XJAA 4YG0A 4PIXA 3WHTA 4CDXA 3MFCA 3MHZA 1RYYA 1RL3A 4C1XA 4DIQA 1C4RA 3HQRA 3VD3A 5FPXA 2ZAHA 1LOGA 3IPVA 1UMZA 2PMWB 2W95A 3LDBA 2TNFA 4AFBA 1H6YA 4QXBA 1AYN2 1ASJ3 2Z42A 1S2KA 2FZ2A 1WMXA 2WT1A 1Z78A 1JZ2A 1KDKA 1SZBA 5EYXA 1UO9A 3OTFA 4GQ7A 2VECA 1KDMA 1BKZA 5C5UA 1LENA 4XJ8A 4AGRA 4UI9L 3A7QA 1H1MA 3KV4A 1NCQC 1RUC1 5F39A 4W6YA 1HJGA 1KQRA 3O5SA 2PQSA 3LA7A 1W2OA 3GBWA 1JYXA 1KITA 1SBFA 3PMSA 5LK7B 1G8WA 1QIQA 1J59A 1BEV1 1K45A 1SQ4A 3H8RA 5HCBA 4PDWB 4A4AA 1HB4A 5CYYA 1SPPB 3H7YA 1DG6A 4R9CA 2KXLA 5C8WA 3BOPA 4IEOA 5D8AC 4AGVA 5J7MA 1D4M1 3SISA 1JU3A 1GWMA 1ZBE1 1OT5A 3GALA 4YVSC 1FMD2 2A5ZA 4LULA 4AFAA 4ZZ8A 4XHBA 1BK1A 1N1SA 1HDKA 3A0KA 3KQRA 5FYYA 3BTXA 4K40A 1KXGA 3A23A 1QJY1 4CUCA 2YBSA 5J09A 3VBRB 2J7MA 2W39A 1ZRFA 1C8M2 1PGW2 1SLLA 2G19A 5DABA 5FZMA 3MLLA 1UF2C 2JX9A 2VNGA 4FFGA 4JDOA 4Z92B 1OC1A 4Q4V2 4H7MA 2C1FA 4HETA 1VALA 2Q30A 5FQ0B 5E8AA 1ZRDA 3PUQA 2YFZA 2CDOA 1TVGA 2ZACA 3HMYA 4HFSA 2R49A 1O8SA 3ZM8A 4IXLA 3WDWA 5DDJ2 4COZA 2ZA9A 1EPWA 3ZXFA 3OY8A 1KFUL 3WW4A 5IJRA 1EV12 4HG6B 3DYMA 2ERFA 4CDUB 4ORFA 5T5LA 1HB2A 4XAAA 4E27A 2PAMA 1W6QA 1ZRRA 4YFZA 2YY1A 4UT5A 4EZ4A 5A3MA 3I2KA 4CDQC 4XQWA 4M0HA 3H1YA 1NXD1 4BK4A 5FZ6A 2ADEA 3DPRC 4D3WA 1CJPA 5FZCA 1K5MA 2WO1A 2AUYA 3SH4A 1ZX5A 2HWE3 3IKWA 3NAPB 3OPTA 4GIQA 1G86A 4Q1RA 2A6XA 2P6CA 4OHVA 2JB4A 2QQWA 3DEMA 4NPRA 5JWPA 1H4HA 5APAA 4INDA 3WF4A 4H55A 1VLNA 1FNYA 5FYUA 2Q8OA 4N53A 1BHGA 1AXZA 3E5QA 3P3NA 1QJU1 3HNYM 4OI4A 4UFLA 5FZBA 1S0CA 4QHBA 4D6SA 1V6JA 5FCCA 1FT9A 1HB1A 4Y20A 5K4LA 3I2OA 1NCQB 1VBC3 3USSA 1Q8SA 4YSFA 1O3TA 2WT2A 1XB9A 4B1MA 4QX8A 2C0ZA 1S2BA 2FMDA 2W68A 5KR7A 3LPFA 4ZS2A 5FJHA 5ACA1 5BNPB 3LFIA 3WF3A 4CXXA 5IFPA 1UPSA 1UY2A 5F2WA 5FO7B 1JN2P 5HCAA 4MGKE 1AXKA 1HRV1 3RMXA 2J1SA 2Y64A 1XYNA 3WCRA 4O61A 1CPNA 2P3IA 5FR3A 3OBRA 4KH9A 3CLPA 3IB3A 1GZCA 2DFBA 1LHWA 1XC6A 5K0UC 3VHOA 1MQTA 4RR3B 1O5LA 5LRRA 4I3PA 4CDXC 1O8PA 2QQIA 4QGMA 5C6CA 2OPKA 4XETA 5J1XA 1LJ7A 1VRH2 1W0OA 4QU1A 1MS0A 1OFNA 1S0JA 1H2MA 1W9WA 1XBFA 3O0VA 2PN5A 5FZ7A 2BVBA 3WZ1A 3N4MA 2HEVF 2YU1A 1HXS1 3D0JA 4YNIA 5EZWA 3TYJA 1SHWB 4X8NA 3MUY1 4QGNA 3SKJE 2CHHA 2XLAA 4N9HA 1QY4A 2BFUS 1AYM3 5FYVA 3J8F1 2VAUA 5DUUA 1KD7A 2VCAA 3IMNA 4LHNA 4Z07A 3BGAA 5JXHA 2WS91 2XJVA 3KV6A 1BCXA 2VZRA 4BA6A 2R071 2GP5A 1UZVA 5FZ9A 3N9QA 4R4XA 2DDUA 2RDRA 2VZOA 1OOPC 4OHZA 3BKZA 4JC1A 4YGCA 3CEWA 2R32A 3FFZA 1WZXA 1R64A 3L2HA 5CB7A 3RZLA 2ZGKA 5FXVA 1K12A 4BK5A 3KQ4B 2XLFA 4IV1A 4KL1A 2X5IB 2EIBA 2Y6GA 3DCQA 4XYXA 1JW6A 3PL0A 1C5IA 3NV3A 4WBBA 5FFOC 4FSJA 3K46A 2Q4SA 1LOCA 3POYA 4W6WA 2DVFA 1F31A 3EB7A 3LOIA 2WWUA 3N9PA 3I2HA 4NWWA 3VHRA 1LGCA 2VUJA 1XYPA 3U37A 5FOBB 2YC2A 1HN1A 4UFKA 5C3SA 3BTAA 3USUA 3FL7A 1DQ2A 1QH6A 1X8MA 2OA2A 4ZPIA 3WP6A 2PAKA 2BRTA 3DKQA 4QPGB 4XXAA 1UIKA 3THPA 4JHTA 1VAKA 4AVAA 4N43A 2D3PA 4PLMA 4P14A 1ZYBA 3ILFA 1RUI2 1C1LA 1OVPA 3P5BA 3GDBA 1J84A 3K4DA 4D69A 2YZ4A 3D5OA 4QPIB 1RB8G 1F8VA 3BOWA 1BMV1 3GCXA 1DLLA 1RUC3 4L99A 2MPFA 3ZFEB 3MIHA 4NIHA 3VBHB 5GALA 1CN1A 3ZFGC 4NIIA 1K5MC 1UKGA 3MDPA 1ULPA 4EWEA 1BEV3 2ZGQA 1NLRA 3C7FA 1ND2B 5CAZA 5L7OC 4NN0A 1CAWA 4Q4X3 1RINA 5CFCB 1UU5A 2VE1A 2WFPA 2VXJA 2PLV3 1D4M3 1PX4A 4UW4A 2WN3A 3FLTA 5FOJB 1AX2A 1ZBE3 3F95A 4LHLA 4Q5OA 4WM7C 5FZLA 1V6OA 1ENRA 1YYNA 5FYMA 4TLGA 2D97A 2XXZA 3FJSA 4QKDA 4ISQA 1PZ9A 2WFF3 1YLLA 2Z79A 1QJY3 4JDMA 4LLOA 1WBFA 3R6SA 4FOYA 3V64A 3ZN6A 4BE3A 2YGMA 2Y6JA 3JQWA 4E9KA 1SBEA 1RUG2 3H9AA 5I8YA 3I49A 1AF9A 2PAEA 4DXTA 4CCNA 1SFYA 2CGNA 1RUH2 2GAUA 1WKYA 3UK9A 4QX0A 1N3QA 3NJVA 1BJQA 5HV4A 2C6SA 2O1QA 2VUCA 4HSLA 1UOFA 3NWKA 1D4VB 4FPFA 3TNPB 1G9BA 3MV11 1YFWA 3M3QA 3LEIA 4NPMA 5DUWA 2G9GA 3VBFA 3OD4A 1BYHA 2JDPA 5FY5A 5C3RA 3QH6A 3B00A 3N3HA 3DYOA 4GWIA 4CU8A 2Y0IA 4JTOA 1I1EA 4OZOA 2P6HA 3AMMA 3MYXA 4UFHA 3IWZA 2WZPP 1CONA 1QXRA 1OURA 2ETEA 3AMPA 1ENXA 1MZ5A 3KGLA 5D21A 3VDBA 1R1A2 2WRAA 4QX7A 1NXMA 2ADDA 2WQZC 4PIZA 3H50A 3ZXAC 4AVBA 4Q29A 4AL9A 1DU3D 4EROA 4XJZA 1VBE1 4LBKA 2QQLA 1HV0A 3CDZB 5L19A 4JV4A 4QXCA 3KS7A 3BIEA 3WW2A 3SITA 3KT4A 1ZM1A 3LOBA 2SLIA 4JRAA 2RS51 3UJOA 2R0FA 2R1BA 1QJU3 1PO21 1ZBA1 4I0AA 3SMHA 5HCHA 3FUQA 5LA1A 3EQEA 4Q0UA 1Q5OA 2HBUA 1SEFA 3IAQA 5L9RA 1MS9A 1F5FA 3NNLA 4PCRA 3I7DA 4HK9A 4QKBA 4KG0A 2RM22 3UNPA 1QOOA 2RS32 1K5JA 2O14A 1TME2 1W8OA 5ACA3 1UOGA 4BIOA 4CCJA 5JOZA 3C2UA 4WVMA 1H4GA 2BNNA 4DQAA 3TEWA 2NPIA 1YFXA 5FJKA 1BLZA 1NY72 2VUAA 2ZEYA 3HWJA 3J26N 1NA1A 3U1XA 3C8XA 2ET7A 2XQXA 4COWA 3T2PA 4DXZA 4IV1C 1HRV3 4KGGA 4B4RA 3NV2A 4XVHA 3B69A 5JDBA 2BGCA 5GLZA 4AQ6A 2CTVA 3WP4A 4AAXA 4TZDA 1UU4A 3NNJA 3OBAA 5C8CA 2GC3A 2XJUA 5ANNA 1H9WA 5GJ6A 4LUKA 2HWC2 3VBOA 1AXYA 1DGLA 3ZXDA 2Y6FA 4JTNA 3T3YA 3WNNA 3W5NA 4IGPA 3AX4A 3H3ZA 3QLQA 2V72A 4FQ4A 3WF1A 1A8DA 4AFCA 1RXFA 2VJXA 3N7KA 1MS5A 3UGFA 1S0IA 4N43C 2PHDA 2ILMA 3JD71 5DAQA 3JBG1 1HXS3 1LTEA 4XQ4A 1RUOA 3OGJA 3AP5A 1RXGA 3IIIA 1WCKA 4LHKA 5FZAA 4DEVA 3WQBA 3M8LA 2ZGSA 1RVF1 5A7SA 5IAXA 5ERLA 3OSDA 3N9LA 1DQ0A 3AL6A 4XTMA 3J8F3 3RGBA 2RJ2A 3ZDSA 4B7EA 5C3OA 3RG0A 2FCVA 5EJ1B 4AZZA 3VB9A 1CAVB 2WS93 1D0GA 3WDVA 5HPOA 5A1FA 2R073 5A6ZA 3Q8CA 5HXMA 3VZLA 3O1SA 3FN9A 2XUEA 2ZGTA 5IYYA 1RMU1 3MICA 5FZOA 5FV3A 4CA9A 4YVWB 4YM0A 5GZDA 3GXUA 3AL5A 3ZSJA 1QDCA 5LBFA 3LDRA 3BTZA 1RUD1 3AP4A 2C9KA 2X05A 2XBO1 5ISLA 1X82A 4LKDA 2W91A 1GSLA 1OMIA 2QDRA 1NT0A 2NN8A 2FBEA 3WDUA 2BTVC 1UY1A 4D7TA 4OHWA 3MIGA 4LNVA 4UFJA 4LKSA 1NKGA 1Y4WA 2QZ3A 1G9FA 4RN5A 4U2AA 1XNKA 1LRHA 2JECA 5H9QA 3ZN5A 1W6MB 4XQDA 1D2SA 2JDZA 1WA6X 3S7EA 1HJFA 5L36A 1BBT1 1PK6C 2LUWA 2W94A 4E2GA 1W8NA 4LOSA 2WNUA 1OUSA 5EJ3A 1RJ8A 2VZ1A 1EUUA 3KV9A 4NRMA 4RGKA 4V1PA 1LGBA 3MO4A 2V5DA 5LB6A 4BWOA 1AR92 2G1MA 4QKNA 1W99A 3S57A 3URFA 3VBFC 3ABZA 4Z82A 1V6NA 3POGA 3VBUC 1MEC2 1S2EA 2BW8A 3HT1A 3KMHA 5EIYB 1ZVFA 5BNNB 5FUIA 4QQOA 2QE3A 1CD3G 4NHMA 5HXVA 3ZSKA 1PM4A 1HQLA 4XBNA 2O8QA 3HJRA 4CVUA 2VOWA 2E33A 4JGZA 3GZAA 4AHYA 2YGLA 2ZX4A 4GMP0 4M3CF 3QOPA 1PNGA 2ET1A 3P6BA 1YRZA 3M2MA 2W2IA 2CAVA 3OUIA 1VRBA 2QQUA 3ZDVA 2QNKA 3IZOA 2GNMA 2QUOA 2CSGA 1HRI2 1MVEA 3TAYA 3B94A 5JUVA 2NP0A 4JQTA 1LOFC 4NOTA 4SBVA 5LY2A 2A75A 3LD8A 1WBLA 2XPJA 2XJRA 2LM3A 5T54A 2RVAA 1OBNA 4MGTA 4BIFA 1GANA 1E5SA 4HN1A 4YWAA 4ZU5A 3PU8A 4FPYA 3ZMNA 3AKRA 2YDEA 2YHJA 5JZGB 5LBCA 2Q1FA 1X33A 2WUHA 1IKQA 1OSGA 1U5IA 4CEWC 4K7JA 2MNGA 1DGRN 4M0NA 1XNDA 1RUJ2 3NNMA 1GZWB 1W0NA 4PDWA 4XDOA 5IVBA 4G9SB 1PGSA 1C3HA 2WSVA 3GZEA 1RITA 2VPVA 3HNMA 5B4XA 3FBMA 2GN3A 3SCHA 1DYOA 1ZNPA 4H3WA 3SQOA 4OLLA 4FPHA 4RL7A 1C5HA 1F35A 1RGSA 4K8FA 4M4RA 5KBFA 4OCTA 3D3AA 1RC6A 2LW8A 5JI7A 2DTYA 1O4ZA 1ZZBA 2VQ0A 3VBRA 5FY0A 2MEV2 1F4HA 3G7DA 4AGGA 4FAGA 1A3KA 2YUEA 3ZIWA 2XKOA 1VBE3 3VZNA 4DMIA 3LWCA 3POIA 2VUDA 3I59B 3ZKUA 4AFMA 1JYVA 4WVWA 3ACFA 4FPJA 2RS53 3AZXA 3I4IA 4P9IA 3WOGA 1PO23 1ZBA3 5FO9B 1WCUA 3M3OA 3TBDA 4XBQA 3AKSA 4FOQA 4URTA 2BV4A 2OXBA 3AJYA 2E26A 4FXGB 3N35A 1QMJA 4U36A 4RQPA 2CGPA 2BNOA 3K48A 4H14A 3PTRB 2JXAA 4KQ7A 4XURA 4XUOA 1P8JA 3CJIB 4MHRA 1AL22 4WVVA 4YG3A 3WP3A 1UQXA 3A4UA 4BQ2A 1YIFA 2TUNA 2WIIB 3HQUA 2D93A 2XDVA 2ZHKA 5B2GB 5T3NA 2G9ZA 4QHOA 5G04L 5FZGA 2VOVA 4YZ1A 3NAPA 3R4UA 1W8HA 3BCWA 5LASA 2BU9A 2H6BA 2V4VA 3SCGA 3MPBA 3Q8FA 2GC2A 3VBSB 1J83A 4I3GA 2GNBA 3SKVA 2D6KA 4O9GA 5C4WA 4AR2A 4L0PA 4CP0A 1W28A 3IBMA 1O4YA 1FYUA 3NMBA 2O8OA 2JD4A 1W2NA 5BUVA 3NO8A 4N7UA 1IZ3A 3ZXGA 1DZRA 4QD2A 5LBEA 1WGPA 3TN91 1VE0A 3AMQA 4BHPA 5H9PA 1UY4A 4FPKA 1Y3TA 3IN9A 1AR81 4XMAA 1NQJA 3FC0A 1VAMA 3JD73 1RUF2 3LA2A 3JBG3 3RWNA 1HQWA 5BNPA 3T09A 4DUXA 2X8KA 4KWKA 3FHQA 1RVF3 1R1ZA 3WQ1A 2XH6A 2VTXJ 2JE9A 4RHV2 3VDAA 2BNMA 3EJKA 2BBAA 2P1BA 4HL0A 1ZA4A 3I3EA 4IGQA 2CGOA 2VW1A 4I0BA 3M3CA 4KWJA 5A3WA 3UJQA 3J7LA 4Z2WA 4MGQA 4P9LA 4DXSA 1NCRC 3GJAA 5A33B 1L7RA 1RMU3 1WW5A 4Y5Z0 1VJ2A 2J1RA 2JG8C 2CYFA 1LGNA 4RR3A 2ZX3A 1A6CA 4V2VA 5B4NA 2OW4A 1AJOA 4ITCA 2OQ7A 4IV3C 4NAOA 4D6RA 2HYKA 2L9LA 1F9KA 1R081 1CAUB 1RHI1 1RUD3 2XBO3 3KSCA 2YB7A 1VBB2 3EO6A 1ZZ6A 3HR9A 5JR7B 3ZFFA 5BNOC 4A44A 4OUSA 5CKNA 2JG9A 3THTA 1FATA 4HANA 4DUVA 2XJSA 1OXCA 1AYN1 2DVDA 5DQ0A 4Q4Y1 2VG9A 3M70A 4LBNA 1UX7A 4PIYA 4HT1T 5E6HA 1FPN2 5IAVA 1BBT3 2R6QA 4Y1VA 2D7FA 1PO12 2QDNA 4N90A 5CU1A 4LT5A 1XPWA 1UY3A 3HEIA 4I01A 3RMYA 1OFSA 4ZU7A 1VBA2 5LEKA 5GLTA 2HWF2 2W46A 3ZXLA 2Q1MA 1ODMA 3NVCA 3R05A 4PBOA 3JUUA 3VDDB 3B93A 4K6BA 1FV2A 2Y34A 5FPUA 1X7NA 1DLCA 3K75B 4HKOA 3RNSA 1UOJA 1EY2A 2EF6A 5FP3A 2CU5A 2VVDA 2X5IA 4NRPA 3U4SA 5I0DA 5KHJA 3NKGA 4ISRA 1A78A 2TBVA 2UWAA 3B9IA 4LBQA 1JZ5A 5A80A 4ATEA 2WZ8A 1X9PA 4A7KA 5FMOL 1FMD1 2CL2A 5D2AA 1TNFA 5K9YA 3PURA 4IETA 4BM8A 1QJZA 1VBC2 3OCPA 5FLJA 2CDPA 1JYWA 1C8M1 1ONAA 1PGW1 2PHLA 3I2JA 4FI9A 4RFT0 5AC92 1W6OB 5IW0A 1CQ9A 5LA9A 5JSRA 3GGLA 4Q4V1 1F5JA 1XE8A 2VZQA 4QPGA 1XNBA 4FT8A 1GNZA 2R062 4AXOA 5IHRA 1PZ8A 4DINB 4QWNA 2YC0A 5T5OA 2ORXA 4XACA 4LIVA 5FWEA 2JD9A 1Z7S2 3LCPA 4YRDA 5FPLA 3PNAA 3WQ7A 4C8DA 1S4CA 1W8WA 3SH3A 2GH2A 3VHPA 4QPIA 3S5QA 1EV11 4LTAA 4RQPC 5C9AB 4LA2A 2HWB1 1JHJA 1W0PA 4I02A 1GKBA 2WL1A 2OX0A 4FFHA 3VBHA 2ENRA 2VR4A 4UBHA 3UV9A 2A70A 3WX5A 4AEDC 1OLQA 2BVVA 2ES3A 3GM8A 1JXNA 4F7ZA 3WDXA 3IDBB 3GNEA 4CEYA 4ET7A 4P9JA 4FFIA 2PHWA 3JCIA 2B39A 5FKBA 5BXXA 1OQ1A 3RSJA 2P4EA 3WLUA 4CDWA 1NX9A 2QQOA 2WYSA 4IEWA 3AZWA 2P3KA 3HNBM 5CFCA 3ILRA 2ZBJA 1SMVA 4H2AA 4CU6A 2BDRA 4RS5B 3MUZ1 5A6YA 5FDBA 4R9DA 5C4WC 1LNSA 2PHXA 1KS4A 2UYAA 2WNVC 1CZSA 5F6KA 1LEMA 2IVIB 2IFRA 4Y26A 4YFWA 3RQ0A 3U4XA 5J36A 4EE2A 2DU0A 4EWDA 1O91A 5FZ8A 1AYM2 5F5AA 3VUOA 3B7MA 3L2YA 4PI2A 3ZYFA 2QQKA 1GV9A 1EPZA 3LIGA 4COUA 4QAWA 3NKTA 3RI9A 4Q8KA 1NE4A 4ARYA 5A7NA 3E6CC 5FZ1A 5CKMA 1DGRA 3MIDA 1IPKA 2B5HA 3AXEA 2VQUA 5ABJC 4N8MA 2G9FA 2ZHNA 4UAPA 4XCBA 4FOVA 4R9BA 2DCKA 4F3JA 2BBVA 1CAXB 3THCA 2ZOEB 2FHRA 1CX1A 4JGYB 4QX2A 2YG0A 2D6MA 2DCYA 2R042 3VZJA 1B35A 2D43A 3LEMA 2PYTA 3VLBB 4NR1A 4DRVA 4H7LA 1PMIA 1NLSA 4IL7A 3PIJA 4QQLA 5FY4A 4CP2A 4E4ZA 2GMMA 4HLTA 1SDDB 3I8TA 5DAVA 3DL3A 2XJTA 3EMRA 3OYWA 2D6OX 4IEYA 2YBKA 5DXDA 2I2SA 4MSVA 2QQMA 1MZFA 2QJVA 3ATGA 5H9SA 2ZEWA 1UY0A 1VRH1 2JG9C 4MXWB 4CCKA 2VBDA 4FPGA 1AR62 1BVP1 3OUJA 5IT6A 5FUNA 1V6KA 2C24A 2P34A 4BU2A 5A6QA 1MZEA 4ASLA 4B29A 3OEAA 3TN93 1I5PA 4O9EA 3C7GA 5JIAA 1UMIA 1COV2 2XMLA 2VC9A 1E5HA 1D7PM 3K77A 4FXKB 3AMHA 3DV8A 2H0VA 1AR83 2D44A 1WLCA 2RDQA 5FYHA 4K9SA 3VD5A 4L97A 2GC0A 1LHUA 4MGIE 4CUBA 2PHTA 3NNGA 4CYDA 4EN8B 2XWJB 4Q4X2 5BNQA 1C8NA 5EHDA 3WW3A 1EAH1 1XXNA 2GC1A 2PLV2 2IC1A 4AVTA 4BZ4A 1H8VA 2C5DA 3AFGA 3KVBA 4JVAA 2WNVB 1JYIA 4I2OA 5D8AB 1QJFA 1AX0A 1O4TA 5CG8A 3ACGA 1IPJA 2Y0OA 2WFF2 4P00B 1WW4A 4YVSB 4BQXA 3ZYGA 1GNYA 3H1WA 3JXSA 3KF3A 1H30A 4AVVA 5CFDA 4QB6A 2JJ6A 2O0OA 2DBIA 1N1TA 1W39A 3AYAA 3AVSA 4ONUA 5FP4A 1GOFA 1R083 1ZA7A 4Y22B 5EYYA 4CPBA 4G4FA 2ZX0A 2JDMA 3TNQA 1JMUB 4XUTA 2V73A 5F3IA 1O3SA 1SG3A 1UPIA 2K2SA 4XF9A 3WNXA 2PHFA 4Q26A 3JB4C 3O14A 1GBGA 1AYN3 4GB31 1LODA 2BFUL 4Q4Y3 4RYDA 1RUI1 3T2QA 3U14A 1GUIA 3I2FA 4IE5A 1UYXA 2IXHA 3NV1A 5KHGA 2UWCA 1H8TA 2VZTA 3QD6A 1FOD2 2HWD1 2A6ZA 2WLPA 1V6MA 5J96B 2OZJA 1DYPA 2VW2A 3MW3A 4BMEA 1GQHA 4CDQB 3EBRA 3EHKA 5DN2A 2VZ3A 4CEYC 5GZCA 1APNA 3DPRB 2VTFA 2XB6C 2E51A 4CDWC 5C3QA 4YVWA 4M3CA 4HSJA 4OHXA 2ZGOA 2YFUA 4CCLA 5LA0A 4LBQD 2E7QA 4Y33A 2AEYA 3U07A 2OKXA 4XJWA 4XW3A 3RI8A 4CP9B 1VIWB 3POJA 4E8CA 3W9AA 5KC6A 2XVKA 3AXDA 4O65A 4HVRA 4XFFA 4BQ3A 1QJU2 1FMD3 1LECA 3FWEA 4K1YA 4MZUA 4BLJA 5GZGA 4LO5B 1ENSA 1HIXA 5DZEA 5F6LB 1V9U2 5FPBA 3HIFA 3KB5A 1W6MA 4Y1YA 5FZEA 1RUG1 2ZZJA 1C8M3 4RFRB 3D0SA 2FCUA 4KGQA 4SLIA 3TRSB 2ZS6B 3PUIA 3W5MA 1TNRA 4Y24A 4TXWA 1Y7BA 4P08A 1RUH1 1N1YA 4Q4V3 2FMYA 4A7ZA 4DRRA 4LBOA 4YM1A 1OA3A 4AW7A 1XE7A 4UWDA 3RWKX 1UN1A 4DEQA 2AREA 3A0NA 2H0BA 2WDBA 2NMOA 5GM0A 4LMFA 4B4PA 1ALYA 2BWCA 4BYYA 5BNNA 3ORJA 1TG7A 4IEZA 3K51A 3J4UH 1DQ4A 1EV13 2OUHA 2HWB3 4BLIA 1QKQA 3V0BB 1JH5A 2K46A 4QQPA 3B02A 5KXDA 3NSTA 1UD1A 2J1TA 4FO9A 4AAPA 3HOBA 2I74A 3O1RA 1ACCA 1SLAA 1R1A1 3OOXA 1OA2A 2GNTA 4XE9A 5K0UB 3UL2A 2B8MA 3K3OA 1JZ8A 3MV01 1WMEA 4CDXB 5LWBA 1ND3A 1LHVA 1PIV2 1DQ5A 4JX0A 1E57A 4L92A 3WNMA 4DB5A 2IXLA 3IPVB 1S55A 5FYBA 2WNEA 3J7MA 3O0WA 4YW4A 3RDIA 5KXCA 2CY6A 3OB8A 4GWJA 1VAVA 1VBD1 2GU9A 1US2A 3OUHA 2WZR1 4K3UA 3WG4A 1G7YA 2OT7A 4N53C 2PTMA 1JODA 3H42B 3FZ3A 1V6IA 3Q9OA 3J8F2 1U5ZA 3SC7X 5FZ4A 3W21A 5I8TA 4AE2A 1AX1A 1TMF2 4FOWA 2DU1A 2VCMA 4Z1VA 3E5XA 1QXJA 2V4AA 2Q8DA 3POEA 4ZONA 2BQPA 1UZ0A 5JZGA 2RM21 5F3CA 2G4IA 4HMZA 2NMNA 4XIKA 1TME1 3J7NA 2DWRA 1OOPB 2WO7A 5FMCA 3WEZA 4E8DA 2GMEA 3AYEA 4NHXA 1GZWA 4FVVA 2AENA 5I0UA 4OVEA 1NY71 2J22A 3ACHA 4XABA 3AYCA 5F32A 5FP8A 3HPNA 3UKVA 2LS6A 3V0AA 1W8FA 4WZFA 2Y6KA 4TLFA 2WAOA 4NVPA 5E89A 1QF3A 4XTPA 4P5HA 4HKLA 4CCMA 1BQPA 1QGLA 4LR4A 5D1IA 4HVQA 1QQP2 3KGZA 1JZ7A 2E63A 2XOMA 4ZXEA 1GQGA 3K4AA 2ARCA 1O7FA 2QQVA 1GU3A 1UCXA 1REEA 1UYYA 1OH4A 5CFDC 5LCWL 3O1MA 1GYKA 2P3YA 4DO0A 1W2UA 1W9FA 2HWC1 3AKQA 3H0OA 4MH0E 3VL8A 1MQTC 2VZVA 3POWA 2WO2A 4EJRA 1Y9GA 3I59A 3E6BA 5T5JA 2ZX1A 4AYUA 2E31A 2F6BA 4XEZA 5C70A 1U5YA 3PTYA 4AQSA 2VQTA 4XJ9A 5A7QA 5IFTA 3MF9A 3G6JB 1LAJA 5A7PA 2RJKA 3OY8B 1LU1A 1BMV2 5I8SA 1H8TC 3BALA 2WR9A 3F2ZA 5FXWA 1W90A 3A21A 4BXSV 3EXUA 1QWRA 2EXHA 2WQ8A 5FRAA 5JSPA 4BPZA 3AMNA 3KV5A 4D94A 2A6WA 4IE7A 3ZFGB 4B7KA 1K5MB 5C3PA 1WMDA 4LK6A 4NE9A 3U0ZA 3RPQA 5L7OB 1YHFA 1WCSA 1EAH3 3SCFA 1I6XA 5FYCA 3SHRA 4PT6A 3VBSA 1QHDA 2E6VA 4WM8A 4WM7B 2E9QA 5GKAC 4XFCA 4NIDA 4CUAA 1DYKA 2P2KA 2KR2A 1W3VA 1B09A 4MOAA 4R52A 4N53B 1XJAA 3MFAA 4GULA 3RJRA 4NHYA 4CPBD 3GF6A 2HJIA 3M1HA 2VL4A 2LALA 4Y20B 4AEKA 4ZXKA 4LO4B 1UIJA 4LO8A 1J1TA 4AVCA 4Q0QA 4S2DA 3WV6A 4YZ5A 3B9CA 1NUKA 3POFA 3RRDA 4FPLA 4PHZA 4YM2A 1POV0 4JKMA 1BZWA 4WV8A 4YW3A 3NQHA 1JYCA 4LPLA 4GALA 4D7YA 5JMOA 3PLQA 4O7XA 2VTXA 4XF1A 4GB33 5I93A 2VCBA 4GH4A 4HOOA 1RUI3 5GLUA 4QKFA 1MEC1 4FPEA 5A32B 4BQWA 2RR12 2WJSA 3PDQA 4RA0A 4YYOA 4FQZA 3RVHA 2P5BA 5H9RA 5A70A 2HWD3 3R4DB 1YIPA 4GJYA 3KCCA 3LEKA 3WSOA 5A33A 1Q8QA 2OYZA 4LE3A 5IWFA 5F3GA 1GOHA 1RUE2 1GP5A 1W6NB 1VBE2 3ITQA 4HZFA 4FP2A 2FDIA 4M4PA 1LKNA 4UBGA 2VMFA 2VOKA 4BH9A 3ZYJB 2WLQA 2B46X 4Q4W2 1DZTA 1KS5A 4MXVA 1RIRA 1PO22 1ZBA2 5EV7A 3AP6A 3ACIA 2CV6A 1PVC1 3RZHA 4QB2A 1HB3A 1YXWA 2RV9A 4QT6A 3E6DA 3OGSA 1KEXA 4KBBA 4RGAA 4DNYA 2IXIA 4W65A 1FAYA 2Q0AA 2WT0A 1RUG3 2KA3A 3AVRA 1XNAA 4L9BA 3WHUA 4L2NA 5AVPA 1RUH3 3OF1A 2P3JA 1IGOA 2V09A 5FPZA 1SLTA 4MGZE 1H1AA 1H6XA 4HK8A 5F37A 1UZZA 1QJX1 4QX5A 4JDNA 4Q0SA 3ECQA 4PF5A 4DY5A 4EV0A 2PHRA 3VDDA 2ZMNA 1JZ6A 4K8RB 2J42A 2QVSB 3AB0A 4IV1B 2X53S 5CIRA 1S0DA 3RYKA 2GMPA 2JIJA 3O7OA 1R092 5C33A 4QPWA 1W06A 3SH5A 2D6NA 1AVBA 4J6GA 1R1A3 2ARAA 3N7JA 4QX1A 5FXXA 1GICA 4MHUA 2MEV1 1ULOA 2XHKA 2BEOA 3UKNA 1F15A 1V70A 5FP9A 1ZZ7A 1JS9A 4M01A 1WUVA 2PHUA 1PVXA 5LATA 3JD72 3FE5A 1Q8VA 4AEJA 3JBG2 1FV3A 4HPKB 4N43B 3UGHA 3RJ2X 1POV1 1VBD3 2W08A 2YV8A 3IDAA 4IGOA 4QDRA 2WZR3 3ZXKA 4C0HA 5KHKA 1PGL2 1RVF2 5F9TA 5BV6A 2QBXA 5FPVA 1JUIA 1NE6A 1NYWA 1REFA 3D8CA 4QM8A 3PVNA 2VMHA 4RSUA 1WLTA 3MEPA 5DUVA 1ZZCA 3MZHA 1YUDA 1S0GA 5C9AA 4QX3A 4LE4A 3WQ0A 1S0FA 5LA2A 3DGTA 2RM23 1ULDA 3FLRA 5I0TA 1YJKA 5HV0A 4ASMB 1TME3 3IM0A 1IG0A 3GZUC 3JZVA 4YZ4A 4HN0A 2Z5WA 1ODNA 1WLDA 1CAWB 1YC61 4X6QB 4BCUA 2XBO2 1QOTA 2N7GA 1CJDA 4XUPA 1NA1C 4RS5A 4WM8C 2D40A 5F5CA 3POSA 1SPPA 3WDYA 4BDVB 3T2OA 2CWSA 1MPXA 1KRIA 5F1RA 2Z69A 4XF3A 1WD4A 2Q8CA 3U78A 1ZREA 4MLOA 5C8CC 5C71A 1LB2A 2HWC3 2JICA 5CVRA 4KI5M 2DUQA 5EQUA 3VBOC 1O3RA 3PJQA 2JE8A 3HN1A 1UX6A 1EUTA 1UMHA 5IVCA 1NZIA 1PK6B 1VMJA 3FHAA 3T4VA 3QH7A 5A7OA 5FZDA 5JPMB 1MS8A 2DFCA 2RS12 5E88A 2ZHLA 4C1WA 3GJBA 5JAXA 1XQNA 1RUF1 4OMCA 3VHNA 5FQ0A 1Y43B 1HW5A 4GH4C 5FIXA 1W8UA 2XVGA 3VBFB 3VBUB 2VMIA 1QDOA 2D6LX 2YXSA 4Q2FA 1X9TA 2ZGLA 3ZXJA 4RHV1 1VB4A 2AGSA 2IWGB 4JGYA 1Z0HA 1WW7A 4Q27A 4CDUA 3I3QA 2JDAA 4YGDA 3SXWA 3S6PA 1OA4A 1OPMA 3MI8A 3KF5A 3FLPA 4XZUG 3ZYIB 4FBFA 1AR72 5F8PA 5EJZB 3BN6A 2RMU2 3O12A 1DDLA 2RG4A 3H8OA 2BP6A 3PIGA 1HX6A 3QCWA 5I0SA 1JZ3A 4LO6B 3VV1A 3ZSMA 1HV1A 2ZHMA 1DP0A 1OF4A 4GMP1 5A3UA 1W9SA 1VBB1 2JDUA 3RZMA 1T6BX 1O59A 1ST8A 5T55A 3IIAA 2VZPA 5DPNA 1ASJ2 2D5FA 2B7YA 4C0BA 4K1ZA 3CIHA 5IK7A 3IAPA 5A7WB 2GZWA 3ON7A 3CHXA 1G9AA 3SEEA 3WUCA 3MF6A 2J1AA 3CO2A 1QEXA 4YGEA 1FPN1 3WNKA 1M4WA 4AF9A 5FYSA 1NCQA 3ILNA 1M06G 1PO11 3LDKA 3T0AA 5A6XA 2CNAA 2A71A 2WO3A 2WNUC 2XUMA 2YROA 2HH9A 1CIYA 3R0RA 5A3PA 1VBA1 4CEWB 4WVMB 1JOPA 5KWRA 2IUWA 2HWF1 4UFMA 4QU2A 2DF7A 2DUOA 2EIDA 2VQAA 1MEC3 3B3QE 1X36A 2Y60A 2DTWA 3WXPA 4ZZ5A 5FTTC 1AL0G 3ZR5A 4TN7A 3KM5A 3NW4A 4YVSA 4CU7A 5LRSA 3WG1A 2ZGUA 5DG2A 4FTBA 2BYVE 2WA3A 4J1XA 3LPGA 4XFGA 1G9CA 1WW6A 2B45X 3V65A 4JGZC 1OQDA 3DF0A 1GWLA 3BUCA 1W6PB 2OIIA 4LITA 4PI0A 4Y22A 4Y4YA 2XLGA 1LOBA 5AC91 1LHNA 3AZZA 4P9YA 1SFPA 1ZRIA 1WCDJ 3GYDA 2OVUA 2ZGRA 2K0GA 1PVC3 2R061 2FCTA 4N9IA 3N36A 4UF0B 1N1VA 4YPJA 3PVEA 1Z7S1 5AFBA 1H2NA 3LIHA 4V2WA 3CKHA 2GP3A 3HN3A 1IOAA 4OMDA 4Y5TA 2PFWA 3ST7A 3QACA 5J3UA 3ZYRA 1XE0A 5L73A 5FREA 3TEXA 2NQYA 4YZ3A 2JE7A 4CDQA 1A34A 3BPSA 1OVSA 1QJX3 2WSUA 2BGOA 3ES4A 1OUXA 4HKWA 1VMHA 1VP6A 3N9OA 5IK8A 1DGWX 4XF0A 1IS4A 2HWE2 1L7LA 3J7HA 3LEGA 1C28A 2XL7A 4PDWC 1POQA 1L3JA 2VM9A 4A6OA 5FY8A 4OHYA 2XG3A 2Y33A 5LZ6A 4XUNA 3KHCA 3ZYHA 4MGYE 4B4QA 3I3DA 3TWIA 1FX5A 4KWLA 2Z4FA 5FAXA 4OQ8A 3TN92 2VY0A 3VKLA 1SLBA 1OPOA 2XJQA 1VR3A 4NMIA 1YQ5A 2MEV3 4I30A 3VBRC 4YZ2A 4JZRA 1UAIA 5A3TA 3ZIXA 2W87A 1E5RA 2VOXA 3LB9A 1YJLA 3ZXEA 4A7YA 1A8MA 1DCSA 1POV3 1JTZX 2C4XA 3LF7A 1OKOA 2JDNA 3PUHA 5T52A 3WF0A 4FCAA 3GZTB 4LO7A 2J1EA 4PQ9A 2F4LA 3FMGA 2ZEZA 2VU9A 4LA3A 2JWPA 3ZX7A 4I09A 5DDJ1 4OULA 1I9RA 4CDUC 3T1LA 2R041 4GJZA 4NAMA 3ZFEA 1NCRB 4AWDA 2YC4A 1X50A 5K0UA 1H0BA 1YEWA 1LR5A 2JG8B 5A3LA 5AVAA 2EXJA 3NJZA 1NG0A 2WNOA 4HBNA 3H8UA 1S1AA 3KWVA 3LFMA 1CPMA 1T2XA 4IV3B 4LIUA 4QQ2A 1C1FA 1ND2A 2Q1ZB 1FXZA 2VMCA 3NAPC 3RS6A 1TQ5A 1OHFA 2EAKA 1TEIA 2A3YA 3WCSA 1NQDA 3KD4A 3OJBA 4LBLA 4DY3A 1OLME 4ES9A 5BNOB 1V00A 2VNVA 2NYYA 4XFAA 1OKQA 1AR61 4MX3A 4Q4Y2 5FZHA 5BPXA 4BOWA 1N47A 2ZAAA 4F8AA 2XHNA 4YW7A 4DPNA 1HLCA 2R16A 2J1UA 2VVFA 4AQ2A 3HBKA 3S0MA 1COV1 1ULCA 2UU8A 4OI0A 3MIFA 1DQ1A 2GDFA 3T0BA 5IVFA 5DG1A 4KU7A 3I3MA
chains in the Genus database with same CATH topology
1JU4A 2RJ2A 1TG7A 5EJ1B 3DECA 5HPOA 2JKXA 5HXMA 3FN9A 1GMMA 5IYYA 2W3JA 2J1TA 3HOBA 3I2GA 3T08A 3GXUA 3CQOA 3UESA 1YQ2A 1JZ8A 2C9KA 3MV01 2X05A 3LE0A 2W91A 4JX0A 3WNMA 2WAAA 2X10A 1UY1A 4MO3M 4GWJA 3OB8A 4LKSA 1NKGA 1US2A 1PMJX 4RN5A 4A41A 2XONA 3OEBA 2W94A 2WBKA 2HYXA 1W8NA 3VD4A 1NAEA 2VZ1A 1EUUA 2E32A 4DUWA 3C7EA 3MO4A 1UZ0A 2V5DA 1OF3A 1W99A 3ABZA 1UYZA 3C7OA 3WEZA 4E8DA 2DCJA 5EIYB 3VD7A 5FUIA 3CMGA 3ACHA 2J22A 2HLEA 3HPNA 2LS6A 2Y6KA 2WAOA 4JKLA 3WNLA 3HJRA 4CVUA 2XOMA 4ZXEA 2E33A 3K4AA 1GU3A 1UYYA 1WCQA 1OH4A 2X09A 5LCWL 4A45A 2QQJA 3DYPA 4QDQA 1CZTA 4W4ZA 2B4KA 3P6BA 2VZVA 2WO2A 2EIEA 2VMEA 1IQDC 2E31A 5C70A 2VQTA 5JUVA 5IFTA 3E1F1 2VCCA 3LQCA 4ZY9A 1JI6A 2ZXQA 3I97A 2RVAA 5G05L 4LHSA 4DXRA 3AC0A 1UXXX 1JZ7A 3F2ZA 3A21A 3T0DA 4BXSV 2WUHA 4JHZA 2WQ8A 1W0NA 3CZUA 4MGSA 3I2IA 3HNMA 5B4XA 2VZUA 4Z2AA 1JZ4A 1L7QA 1DYOA 2ZEXA 4PT6A 4M4RA 4CUAA 4P5YA 3D3AA 4MOAA 2LW8A 3MBWA 4PQQA 2W1WA 1RYYA 1F4HA 3VD3A 2VL4A 4MADA 2Y6HA 2W95A 1JYVA 1H6YA 4PF1A 4BJ0A 3ACFA 5C7GA 1NUKA 4JKMA 1JZ2A 3NQHA 4LPLA 5JMOA 2KD7A 3C7HA 2VCBA 4UI9L 3A7QA 3VDCA 2E26A 4AG4A 4XURA 4XUOA 1P8JA 2PQSA 3A22A 1JYXA 2WABA 1K45A 3LEKA 3WSOA 4A4AA 5CYYA 5G04L 4OYUA 1GOHA 5B4NA 1JU3A 3OGRA 2V4VA 1OT5A 2W9XA 1PX3A 4M4PA 2VMFA 4ZZ8A 1J83A 3SKVA 4L0PA 3A23A 4CUCA 2W92A 2J7MA 3ACIA 4XUQA 4QB2A 2RV9A 3OGSA 1KEXA 4TTGA 2QQNA 4A3ZA 1UY4A 2VZSA 1XNAA 2Y8KA 2YFZA 2CDOA 1TVGA 2VO5A 4OUEA 1O8SA 3ZM8A 1UXZA 3T09A 4DUXA 1H6XA 5IJRA 3THDA 3FHQA 4HG6B 3DYMA 3ECQA 3VDAA 2BBAA 3I3EA 3I2KA 1JZ6A 2VOTA 4BK4A 4MGQA 2W1QA 4DXSA 2WO1A 1L7RA 4QPWA 2J1RA 4QX1A 2L9LA 1ULOA 4CU9A 2YB7A 4W50A 3WF4A 4UOJA 1BHGA 4A44A 5JXGA 3HNYM 4DUVA 3IDAA 4QDRA 5DQ0A 2QBXA 1UX7A 5DMYA 1XPWA 1UY3A 3HEIA 3LPFA 4QX3A 3WF3A 5IFPA 3ETPA 5LA2A 2W46A 4W8JA 1UY2A 3SEPA 3K75B 1DLCA 2J1SA 2Y64A 4XUPA 5I0DA 3CZJA 3IB3A 2BGPA 1JZ5A 2WZ8A 4BDVB 1XC6A 3T2OA 1MPXA 1O8PA 2QQIA 5C71A 2CDPA 1JYWA 5J1XA 3I2JA 4FI9A 4KI5M 3GGLA 1W9WA 2JE8A 1EUTA 1UMHA 2VZQA 3FHAA 5F7UA 1GQPA 1SHWB 2J1VA 3MUY1 3SKJE 2ORXA 2JD9A 4OMCA 2VCAA 5JXIA 3BGAA 5JXHA 1CZVA 2VZRA 4D0QA 1JHJA 2DDUA 2VZOA 2VR4A 3GM8A 4ET7A 2JDAA 1R64A 1K12A 4BK5A 1NX9A 2QQOA 2WYSA 3K4ZA 5JXJA 3HNBM 4XZUG 2Y6GA 2EIBA 2W5FA 5EJZB 3BN6A 3I3BA 4CU6A 3MUZ1 1JZ3A 1PMHX 1LNSA 1JYNA 3K46A 1CZSA 1DP0A 1OF4A 1W9SA 3EB7A 4KMQA 3VD9A 3I2HA 1O59A 3OGVA 3U37A 2VZPA 2YC2A 1KGYA 5DPNA 1HN1A 2QQKA 3CIHA 3FL7A 3IAPA 3SEEA 4QAWA 2J1AA 4QDSA 3WNKA 2WZEA 4ARYA 2EICA 3T0AA 3GDBA 1J84A 2WO3A 3K4DA 2W1SA 1CIYA 2VQUA 4UAPA 1F4AA 2DCKA 1W9TA 2EIDA 3WNPA 3THCA 1CX1A 4QX2A 4QB1A 2YG0A 4ZZ5A 2W47A 1ULPA 3C7FA 4CU7A 1SDDB 4ARXA 3LPGA 4IUGA 2WN2A 1PX4A 2WN3A 3NJXA 2QQMA 2ZEWA 1UY0A 2ORZA 3WF2A 4D8MA 2Y6JA 1GOGA 4KWUA 4DXTA 3OEAA 1I5PA 3C7GA 1WKYA 1UMIA 4YPJA 4QX0A 3NJVA 5CZKA 2VC9A 1D7PM 3CKHA 3K77A 3HN3A 4OMDA 2VMDA 2ID4A 3MV11 3LEIA 3VD5A 3WNOA 4CUBA 3NNGA 2BERA 4GWIA 3DYOA 4CU8A 2BGOA 3OG2A 4OZOA 4LQRA 3LEGA 3J7HA 3ACGA 3VDBA 2VM9A 4A6OA 4P00B 1GNYA 4XUNA 3JXSA 3I3DA 4QB6A 2Z4FA 1US3A 2QQLA 4GZ9A 1GOFA 3CDZB 1XNTA 4XUTA 1SG3A 2W87A 5LA1A 3IAQA 2C4XA 4RYDA 3T2QA 2W1UA 1GUIA 5A1AA 3I2FA 3PUHA 1UYXA 4A42A 3WF0A 2BZDA 2R7EB 3UNPA 2VZTA 2J1EA 2ZEZA 1W8OA 3NRUA 5DN2A 2VZ3A 2ZEYA 2VTFA 3C8XA 2XQXA 1K3IA 3T2PA 2YC4A 4XVHA 2YFUA 5LA0A 2OKXA 5IHRA 1T2XA 3P1IA 4AAXA 4E8CA 2VMCA 3OBAA 4JKKA 2C26A 3WNNA 3W5NA 3UETA 2V72A 2B9VA 2XHNA 3WF1A 2Y6LA 2VJXA 4P02B 1OD3A 3W5MA 2J1UA 3PUIA 4TXWA 4P08A 5JR2A 3EYPA 1UWWA 3IIIA 4DEVA 3T0BA 1K42A 3WQBA 4DEQA 2WDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU4 A;  2RJ2 A;  1TG7 A;  5EJ1 B;  3DEC A;  5HPO A;  2JKX A;  5HXM A;  3FN9 A;  1GMM A;  5IYY A;  2W3J A;  2J1T A;  3HOB A;  3I2G A;  3T08 A;  3GXU A;  3CQO A;  3UES A;  1YQ2 A;  1JZ8 A;  2C9K A;  3MV0 1;  2X05 A;  3LE0 A;  2W91 A;  4JX0 A;  3WNM A;  2WAA A;  2X10 A;  1UY1 A;  4MO3 M;  4GWJ A;  3OB8 A;  4LKS A;  1NKG A;  1US2 A;  1PMJ X;  4RN5 A;  4A41 A;  2XON A;  3OEB A;  2W94 A;  2WBK A;  2HYX A;  1W8N A;  3VD4 A;  1NAE A;  2VZ1 A;  1EUU A;  2E32 A;  4DUW A;  3C7E A;  3MO4 A;  1UZ0 A;  2V5D A;  1OF3 A;  1W99 A;  3ABZ A;  1UYZ A;  3C7O A;  3WEZ A;  4E8D A;  2DCJ A;  5EIY B;  3VD7 A;  5FUI A;  3CMG A;  3ACH A;  2J22 A;  2HLE A;  3HPN A;  2LS6 A;  2Y6K A;  2WAO A;  4JKL A;  3WNL A;  3HJR A;  4CVU A;  2XOM A;  4ZXE A;  2E33 A;  3K4A A;  1GU3 A;  1UYY A;  1WCQ A;  1OH4 A;  2X09 A;  5LCW L;  4A45 A;  2QQJ A;  3DYP A;  4QDQ A;  1CZT A;  4W4Z A;  2B4K A;  3P6B A;  2VZV A;  2WO2 A;  2EIE A;  2VME A;  1IQD C;  2E31 A;  5C70 A;  2VQT A;  5JUV A;  5IFT A;  3E1F 1;  2VCC A;  3LQC A;  4ZY9 A;  1JI6 A;  2ZXQ A;  3I97 A;  2RVA A;  5G05 L;  4LHS A;  4DXR A;  3AC0 A;  1UXX X;  1JZ7 A;  3F2Z A;  3A21 A;  3T0D A;  4BXS V;  2WUH A;  4JHZ A;  2WQ8 A;  1W0N A;  3CZU A;  4MGS A;  3I2I A;  3HNM A;  5B4X A;  2VZU A;  4Z2A A;  1JZ4 A;  1L7Q A;  1DYO A;  2ZEX A;  4PT6 A;  4M4R A;  4CUA A;  4P5Y A;  3D3A A;  4MOA A;  2LW8 A;  3MBW A;  4PQQ A;  2W1W A;  1RYY A;  1F4H A;  3VD3 A;  2VL4 A;  4MAD A;  2Y6H A;  2W95 A;  1JYV A;  1H6Y A;  4PF1 A;  4BJ0 A;  3ACF A;  5C7G A;  1NUK A;  4JKM A;  1JZ2 A;  3NQH A;  4LPL A;  5JMO A;  2KD7 A;  3C7H A;  2VCB A;  4UI9 L;  3A7Q A;  3VDC A;  2E26 A;  4AG4 A;  4XUR A;  4XUO A;  1P8J A;  2PQS A;  3A22 A;  1JYX A;  2WAB A;  1K45 A;  3LEK A;  3WSO A;  4A4A A;  5CYY A;  5G04 L;  4OYU A;  1GOH A;  5B4N A;  1JU3 A;  3OGR A;  2V4V A;  1OT5 A;  2W9X A;  1PX3 A;  4M4P A;  2VMF A;  4ZZ8 A;  1J83 A;  3SKV A;  4L0P A;  3A23 A;  4CUC A;  2W92 A;  2J7M A;  3ACI A;  4XUQ A;  4QB2 A;  2RV9 A;  3OGS A;  1KEX A;  4TTG A;  2QQN A;  4A3Z A;  1UY4 A;  2VZS A;  1XNA A;  2Y8K A;  2YFZ A;  2CDO A;  1TVG A;  2VO5 A;  4OUE A;  1O8S A;  3ZM8 A;  1UXZ A;  3T09 A;  4DUX A;  1H6X A;  5IJR A;  3THD A;  3FHQ A;  4HG6 B;  3DYM A;  3ECQ A;  3VDA A;  2BBA A;  3I3E A;  3I2K A;  1JZ6 A;  2VOT A;  4BK4 A;  4MGQ A;  2W1Q A;  4DXS A;  2WO1 A;  1L7R A;  4QPW A;  2J1R A;  4QX1 A;  2L9L A;  1ULO A;  4CU9 A;  2YB7 A;  4W50 A;  3WF4 A;  4UOJ A;  1BHG A;  4A44 A;  5JXG A;  3HNY M;  4DUV A;  3IDA A;  4QDR A;  5DQ0 A;  2QBX A;  1UX7 A;  5DMY A;  1XPW A;  1UY3 A;  3HEI A;  3LPF A;  4QX3 A;  3WF3 A;  5IFP A;  3ETP A;  5LA2 A;  2W46 A;  4W8J A;  1UY2 A;  3SEP A;  3K75 B;  1DLC A;  2J1S A;  2Y64 A;  4XUP A;  5I0D A;  3CZJ A;  3IB3 A;  2BGP A;  1JZ5 A;  2WZ8 A;  4BDV B;  1XC6 A;  3T2O A;  1MPX A;  1O8P A;  2QQI A;  5C71 A;  2CDP A;  1JYW A;  5J1X A;  3I2J A;  4FI9 A;  4KI5 M;  3GGL A;  1W9W A;  2JE8 A;  1EUT A;  1UMH A;  2VZQ A;  3FHA A;  5F7U A;  1GQP A;  1SHW B;  2J1V A;  3MUY 1;  3SKJ E;  2ORX A;  2JD9 A;  4OMC A;  2VCA A;  5JXI A;  3BGA A;  5JXH A;  1CZV A;  2VZR A;  4D0Q A;  1JHJ A;  2DDU A;  2VZO A;  2VR4 A;  3GM8 A;  4ET7 A;  2JDA A;  1R64 A;  1K12 A;  4BK5 A;  1NX9 A;  2QQO A;  2WYS A;  3K4Z A;  5JXJ A;  3HNB M;  4XZU G;  2Y6G A;  2EIB A;  2W5F A;  5EJZ B;  3BN6 A;  3I3B A;  4CU6 A;  3MUZ 1;  1JZ3 A;  1PMH X;  1LNS A;  1JYN A;  3K46 A;  1CZS A;  1DP0 A;  1OF4 A;  1W9S A;  3EB7 A;  4KMQ A;  3VD9 A;  3I2H A;  1O59 A;  3OGV A;  3U37 A;  2VZP A;  2YC2 A;  1KGY A;  5DPN A;  1HN1 A;  2QQK A;  3CIH A;  3FL7 A;  3IAP A;  3SEE A;  4QAW A;  2J1A A;  4QDS A;  3WNK A;  2WZE A;  4ARY A;  2EIC A;  3T0A A;  3GDB A;  1J84 A;  2WO3 A;  3K4D A;  2W1S A;  1CIY A;  2VQU A;  4UAP A;  1F4A A;  2DCK A;  1W9T A;  2EID A;  3WNP A;  3THC A;  1CX1 A;  4QX2 A;  4QB1 A;  2YG0 A;  4ZZ5 A;  2W47 A;  1ULP A;  3C7F A;  4CU7 A;  1SDD B;  4ARX A;  3LPG A;  4IUG A;  2WN2 A;  1PX4 A;  2WN3 A;  3NJX A;  2QQM A;  2ZEW A;  1UY0 A;  2ORZ A;  3WF2 A;  4D8M A;  2Y6J A;  1GOG A;  4KWU A;  4DXT A;  3OEA A;  1I5P A;  3C7G A;  1WKY A;  1UMI A;  4YPJ A;  4QX0 A;  3NJV A;  5CZK A;  2VC9 A;  1D7P M;  3CKH A;  3K77 A;  3HN3 A;  4OMD A;  2VMD A;  2ID4 A;  3MV1 1;  3LEI A;  3VD5 A;  3WNO A;  4CUB A;  3NNG A;  2BER A;  4GWI A;  3DYO A;  4CU8 A;  2BGO A;  3OG2 A;  4OZO A;  4LQR A;  3LEG A;  3J7H A;  3ACG A;  3VDB A;  2VM9 A;  4A6O A;  4P00 B;  1GNY A;  4XUN A;  3JXS A;  3I3D A;  4QB6 A;  2Z4F A;  1US3 A;  2QQL A;  4GZ9 A;  1GOF A;  3CDZ B;  1XNT A;  4XUT A;  1SG3 A;  2W87 A;  5LA1 A;  3IAQ A;  2C4X A;  4RYD A;  3T2Q A;  2W1U A;  1GUI A;  5A1A A;  3I2F A;  3PUH A;  1UYX A;  4A42 A;  3WF0 A;  2BZD A;  2R7E B;  3UNP A;  2VZT A;  2J1E A;  2ZEZ A;  1W8O A;  3NRU A;  5DN2 A;  2VZ3 A;  2ZEY A;  2VTF A;  3C8X A;  2XQX A;  1K3I A;  3T2P A;  2YC4 A;  4XVH A;  2YFU A;  5LA0 A;  2OKX A;  5IHR A;  1T2X A;  3P1I A;  4AAX A;  4E8C A;  2VMC A;  3OBA A;  4JKK A;  2C26 A;  3WNN A;  3W5N A;  3UET A;  2V72 A;  2B9V A;  2XHN A;  3WF1 A;  2Y6L A;  2VJX A;  4P02 B;  1OD3 A;  3W5M A;  2J1U A;  3PUI A;  4TXW A;  4P08 A;  5JR2 A;  3EYP A;  1UWW A;  3III A;  4DEV A;  3T0B A;  1K42 A;  3WQB A;  4DEQ A;  2WDB A; 
#chains in the Genus database with same CATH topology
 4QXK A;  5M0T A;  1GR3 A;  1RUF 3;  1Q8P A;  2HBT A;  2YPD A;  1OOP A;  1JU4 A;  5FYI A;  4XXP A;  3ZSE A;  1CWP A;  5BNP C;  5EP9 A;  3SLI A;  3ZR6 A;  3BYW A;  1ULE A;  2JDH A;  2Y38 A;  2JKX A;  4Q4X 1;  4QM9 A;  4RHV 3;  1YQ8 A;  3ZVX A;  4LJH A;  2PLV 1;  4M3C E;  5JOX A;  2W3J A;  1BK0 A;  4RD7 A;  3CJX A;  4GKX A;  4XFH A;  5FYT A;  1W05 A;  3T08 A;  2HEW F;  3ETQ A;  2WFF 1;  3NJY A;  1LOA A;  4XCA A;  1W03 A;  5EPA A;  3ZPO A;  1YQ2 A;  3H3L A;  4Y3O A;  4LUM A;  3WP5 A;  1DHK B;  3LE0 A;  3WR0 A;  1JOJ A;  5DUX A;  3H3U A;  4GWN A;  4RR3 C;  2FDG A;  2FDF A;  2WAA A;  4X6R B;  3N9M A;  2WWJ A;  1LUL A;  2X10 A;  5CKQ A;  4GMP 3;  2R0H A;  4YG6 A;  3DUI A;  1XRU A;  1VBB 3;  4NIG A;  1PMJ X;  4S2F A;  4A41 A;  3ZFF C;  2ARB A;  2K9Z A;  4XHX A;  2VVE A;  3OEB A;  2EAA A;  4MYE A;  3OPZ A;  2WBK A;  2HYX A;  5FBZ A;  3J9S A;  3VD4 A;  1NAE A;  2AR6 A;  4UYB A;  4AEM A;  1QOS A;  2HWB 2;  2VGD A;  3FHI B;  4DUW A;  1FPN 3;  1T6G C;  3KVA A;  3MIB A;  1YQ6 A;  2GSY A;  4L11 A;  1MVQ A;  4RQP B;  1W04 A;  2IXJ A;  3KT7 A;  1FOD 1;  1PO1 3;  4IES A;  5A3O A;  1RUC 2;  3ROU A;  4BXF A;  5JCT A;  1UYZ A;  4FFF A;  4C91 A;  3N7M A;  4JRL A;  4AED B;  3HT2 A;  1VBA 3;  3I54 A;  3ZFG A;  5CBL A;  5FO8 B;  1LED A;  3AZV A;  4JQR A;  3TEZ A;  1YQC A;  5T50 A;  4EN7 B;  2HLE A;  2HWF 3;  1YI7 A;  2VBB A;  1BEV 2;  1JYT A;  5L7O A;  3OBZ A;  3BOD A;  2RE9 A;  4LKF A;  4JKL A;  3KT1 A;  5HBA A;  3T30 A;  4WM7 A;  1D4M 2;  3AYD A;  5C4W B;  1ZBE 2;  2X5I C;  1H2K A;  3PUA A;  4IEQ A;  4K20 A;  1WCQ A;  2X09 A;  3BB6 A;  3JQX A;  3MLJ A;  5JOW A;  2QQJ A;  1ZZ8 A;  2X29 A;  1CZT A;  5GZE A;  3ZO0 B;  4E2S A;  2B4K A;  1QJY 2;  3NNF A;  5GLV A;  1V9U 1;  2EVX A;  2F17 A;  2RJL A;  3WG3 A;  4UW5 A;  2DVA A;  2EIE A;  2E7A A;  2VME A;  2A3W A;  1FI2 A;  2D98 A;  2EXK A;  4TYS A;  5AC9 3;  1AZD A;  1RHI 3;  4S2G A;  5JSO A;  4IE0 A;  1N3O A;  5JLV A;  1OLM A;  2AAC A;  3TOJ A;  3ZYB A;  3DKW A;  2R06 3;  4QPG C;  1EYB A;  3LQC A;  4ZY9 A;  1JI6 A;  3I97 A;  3HAG A;  5E16 A;  2EA7 A;  4COV A;  3VKM A;  5DZG A;  1Z7S 3;  4LHS A;  3AC0 A;  1GNH A;  1OQE A;  1UXX X;  2I07 B;  4CXW A;  5A32 A;  5F3E A;  5ABJ B;  5A3N A;  4FTS A;  2Q5T A;  3MW4 A;  4QPI C;  3UT0 A;  2D3R A;  3QBQ A;  5L9B A;  1SLI A;  4CUG A;  2PEL A;  1GWK A;  3ZFE C;  1CAV A;  3CZU A;  4MGS A;  4CXY A;  3I2I A;  1MR5 A;  3VBH C;  1J3R A;  4W6X A;  4Z2A A;  4YW6 A;  1L7Q A;  4P9W A;  3OBT A;  1J58 A;  1STM A;  1W6N A;  2YPJ A;  4E4D X;  1AHS A;  1WMF A;  1DBN A;  1MS3 A;  4QHZ A;  5F5I A;  1ND2 C;  2UY9 A;  2ZEX A;  1YFU A;  5CG9 A;  4R8H A;  5T5P A;  4CZS A;  5CFC C;  2IXK A;  5BYN A;  2FDH A;  2F4P A;  1J3Q A;  1PIV 1;  5FWJ A;  3MBW A;  4PQQ A;  3ZFF B;  5ANQ A;  1X8E A;  2W1W A;  4RGG A;  2FDK A;  4NPL A;  2ZKL A;  2JG9 B;  3OGG A;  4NHK A;  4LOT A;  1VB2 A;  4MAD A;  1OH3 A;  2Y6H A;  1PZ7 A;  3ZOI A;  2E53 A;  4PF1 A;  4XFB A;  4BJ0 A;  3WW1 A;  1S0B A;  3FX3 A;  4B3N A;  1U5X A;  4KG8 A;  4DZG A;  5C7G A;  5J37 A;  4TWT A;  4MUV A;  1TMF 1;  2B42 B;  4XPV A;  3ASI A;  2KD7 A;  3C7H A;  2A7A A;  2R1D A;  4XMI A;  3VDC A;  4B8E A;  3W20 A;  2ZX2 A;  4ATF A;  4E4S A;  5ACA 2;  3ELN A;  3VZM A;  3WVJ A;  1XSR A;  3ACL A;  4R9A A;  4QPY A;  1EAH 2;  4BQY A;  1UNB A;  2EAL A;  3BU7 A;  4AG4 A;  1BXH A;  1W2A X;  3A22 A;  1XOY A;  2XQR A;  3WG2 A;  4A6S A;  3ME2 A;  2WAB A;  5DDJ 3;  4Y1Z A;  1HRV 2;  1CR7 A;  4OFG A;  1RJ7 A;  2R04 3;  4LBQ B;  2JDK A;  2ZMK A;  3ZLI A;  4OYU A;  4DS0 A;  1QQP 1;  1DZQ A;  1IHM A;  1B35 C;  1H2L A;  1XU1 A;  4IEX A;  4P9G A;  3WT3 A;  4ASK A;  3OGR A;  4F83 A;  2W9X A;  4CTE A;  1PX3 A;  1LOE A;  1YO8 A;  2P17 A;  2JIG A;  2WA4 A;  1O6U A;  3DXT A;  2ZCW A;  4CCD A;  3H8X A;  5FBJ A;  4P9X A;  4UXA A;  2W92 A;  1MZ6 A;  4LKE A;  1QNY A;  4I0W B;  3S5A A;  4YW1 A;  1GLH A;  3K2O A;  4XJU A;  4XUQ A;  2MHF A;  4HPK A;  1DFQ A;  4TTG A;  4GB3 2;  1AR6 3;  3AM2 A;  2QQN A;  4A3Z A;  4BQ5 A;  1YI9 A;  2VZS A;  4CSW A;  4DFS A;  4MG2 A;  1HXS 2;  1MS1 A;  4GA9 A;  2HEY F;  3L9J T;  4XAE A;  5FLI A;  4J1W A;  2Y8K A;  3GCW A;  1JUH A;  2PQQ A;  3Q8A A;  1UKR A;  2VO5 A;  4OUE A;  4UW6 A;  2HWD 2;  5FK8 A;  5FZ0 A;  1COV 3;  4C90 A;  2LTN A;  3O1V A;  3FFQ A;  2IFW A;  1UXZ A;  1HN0 A;  4PJY A;  4XIL A;  4AOC A;  2WS9 2;  3THD A;  4G3Y C;  2R07 2;  3LSE A;  5JIU A;  1E5I A;  2JB8 A;  2ZTN A;  4CEY B;  4UFI A;  3BIW E;  2KM2 A;  2RS3 1;  4NRO A;  4CDW B;  2WC2 A;  1IQA A;  2BJS A;  2LRO A;  2VOT A;  2PXJ A;  2QQP A;  1EP0 A;  2W1Q A;  1HQN A;  3PUS A;  3TB0 A;  1UZW A;  1WA4 A;  4AI9 A;  4JAA A;  4A3X A;  1Q3E A;  5FZK A;  3RZG A;  3AJZ A;  2SBA A;  2ZGP A;  3BI3 A;  1U0A A;  3D6E A;  1OLR A;  4YGB A;  2P37 A;  2DBN A;  4CU9 A;  4W50 A;  2VBP A;  4UOJ A;  4CP1 A;  5HI0 A;  4ES8 A;  5JXG A;  1XNC A;  1PK6 A;  2IZW A;  3AK0 A;  3HBZ A;  4EWA A;  4XDQ A;  2CWM A;  4EQV A;  1CES A;  1QH7 A;  3IDC B;  1SBD A;  5FY7 A;  4AVS A;  1Y9Q A;  2D3S A;  3AP7 A;  5FP7 A;  1URX A;  1VRH 3;  1UW8 A;  3D4K A;  5EWS A;  4EZH A;  5CEH A;  3V56 A;  3NL1 A;  4IDZ A;  5DMY A;  4NO4 A;  1FNZ A;  3Q8E A;  3VBU A;  1JHN A;  1I5Z A;  1YWK A;  4TSV A;  3VKF C;  3U11 A;  2EXI A;  3D82 A;  3I2D A;  4PLO A;  3LSD A;  1G6N A;  3ETP A;  5BY5 A;  2RR1 1;  2D6P A;  2A1X A;  3CF6 E;  1FOD 3;  2DUR A;  4W8J A;  1B35 B;  4LBM A;  5IVV A;  2ATF A;  3SEP A;  5KHI A;  1W6Q B;  3FUO A;  1BVV A;  3CJI A;  2W52 A;  5DZF A;  1LCL A;  4CCC A;  1S0E A;  4LXL A;  5JOY A;  3CZJ A;  3OYW B;  1RUE 1;  4YVW C;  3RYP A;  2BGP A;  2DV9 A;  2VMG A;  2V5Y A;  3GHN A;  4IEV A;  3T2T A;  5TSW A;  5CIS A;  3VL9 A;  4E4H A;  1VBD 2;  3WDT A;  1D2Q A;  4BIS A;  1ENQ A;  2IXC A;  2FQP A;  2VH9 A;  2WZR 2;  1RED A;  3H1M A;  4Q4W 1;  2JDY A;  4AFD A;  3HQX A;  5GLW A;  1V9U 3;  1LOF A;  5A7W A;  4CE8 A;  2VUL A;  3ALQ A;  5F7U A;  3O1O A;  4AQT A;  1GQP A;  4HON A;  2J1V A;  2RHP A;  1F2N A;  2OZ6 A;  2OQ6 A;  3AKT A;  2WYF A;  1W9Y A;  1LU2 A;  1UL9 A;  2LRP A;  4CEW A;  5JXI A;  4LLF A;  1CZV A;  2WQ4 A;  2ZAB A;  4NIA A;  5L9V A;  4D0Q A;  1GZT A;  2QKD A;  3ZYP A;  3N9N A;  4XFI A;  5DAX A;  5IVE A;  3RZK A;  1AR9 1;  3PHM A;  3U10 A;  3VZO A;  5BNN C;  3VKN A;  1SAC A;  5FZI A;  1NZC A;  3IT8 A;  5DAW A;  1XU2 A;  4AHZ A;  3AFK A;  1YNA A;  3RFR A;  1ZRC A;  2A6Y A;  4AI8 A;  1R09 1;  5JXJ A;  4ZKT B;  3K4Z A;  3O1P A;  3RZJ A;  1Q43 A;  4EN0 A;  1SLC A;  2W5F A;  5FMB A;  3I3B A;  4IE6 A;  3E5U A;  5CFD B;  2JKB A;  3W59 A;  2YMZ A;  1JBC A;  1PMH X;  1W6P A;  2JEN A;  1JYN A;  4FTE A;  5LEJ A;  1MQT B;  1UOB A;  2A3X A;  5IVJ A;  3T4H B;  4KMQ A;  5IK5 A;  1PIV 3;  4QQH A;  2UWB A;  1ND3 C;  2WKK A;  3VD9 A;  2ZZQ A;  1CAU A;  3FBY A;  3OGV A;  1NLQ A;  4AHW A;  4XZP A;  4OQ9 A;  1KGY A;  1W8Z A;  3VN4 A;  3DXU A;  2RS5 2;  4UF0 A;  2AZ5 A;  5EFU A;  1PGL 1;  2VW0 A;  2ZGM A;  3LAG A;  2H6C A;  5CAD A;  2I45 A;  4FPO B;  4QDS A;  1YCI A;  3TEY A;  1H8T B;  1HRI 1;  2EIC A;  1TMF 3;  2RDS A;  2WZE A;  4L8Q A;  4NUB A;  1PNF A;  3MW2 A;  2W1S A;  5LW9 A;  1GZ9 A;  5K7P A;  2NZ9 A;  5JPN B;  2Y26 A;  4IER A;  3PJY A;  1RUN A;  2A73 B;  4GXL A;  5JZG C;  2OS2 A;  5LBB A;  1F4A A;  3WNP A;  1W9T A;  4GAZ A;  5KXE A;  1KFX L;  4M3C B;  5LK5 A;  3LKJ A;  4OZX A;  4QB1 A;  3VZK A;  5IK4 A;  1PHM A;  2W47 A;  5J48 A;  1RUJ 1;  4MV2 A;  2DVB A;  3B5L B;  4GKY A;  2E7T A;  3S7I A;  3LA3 A;  2XVL A;  1YFY A;  2Q8E A;  1QQP 3;  4ARX A;  2VNR A;  4IUG A;  2NLR A;  2WN2 A;  4KBZ A;  3NJX A;  3PU3 A;  1DIW A;  4D6Q A;  3VKO A;  3M3E A;  2JEM A;  2AEZ A;  1TZO A;  1ULG A;  2ORZ A;  2XWB B;  3WF2 A;  4NJ4 A;  4D8M A;  4EYU A;  5FLH A;  4IW3 A;  2VXR A;  1GOG A;  4COY A;  4KWU A;  2VD7 A;  1V0A A;  1W6O A;  4BMB A;  1ZZ9 A;  3USU B;  2RS1 1;  3LGR A;  1QJE A;  4IQP A;  4Y1U A;  1KJL A;  3KLS A;  5CZK A;  1UZY A;  3CBN A;  1WWY A;  3HD8 B;  2VMD A;  2ID4 A;  1H9P A;  2BWA A;  2GAL A;  5CA6 A;  1RTV A;  3CNA A;  5JVV A;  4LBJ A;  1W2T A;  2DCT A;  3AZY A;  5FPA A;  3WNO A;  3X29 B;  2BER A;  4HVO A;  3T1M A;  3ZSL A;  1DF0 A;  1WLW A;  3DN7 A;  2W0X A;  4BB3 A;  5JMC A;  3CJI C;  3OG2 A;  1NCR A;  2CAU A;  2ZJC A;  4BQ4 A;  4LQR A;  1RMU 2;  2RS3 3;  1O3Q A;  2JG8 A;  3M3I A;  1AL2 1;  4LEJ A;  1CGP A;  1PM7 A;  3M7A A;  1Q56 A;  2DVG A;  4AK3 A;  1AR7 1;  4IV3 A;  1ND3 B;  1CX4 A;  2RMU 1;  2YU2 A;  5FKC A;  4XDP A;  5IVY A;  1RUD 2;  1SCR A;  4IEU A;  3RYR A;  4EN9 B;  1MAC A;  3U75 A;  2XL9 A;  1PVC 2;  4OI2 A;  3VBS C;  5BNO A;  3BTY A;  4Q8L A;  1US3 A;  4EN6 B;  4GZ9 A;  4J25 A;  3WD5 A;  2GND A;  1IS6 A;  3O1T A;  1XNT A;  2VNO A;  4FPC A;  4N7I A;  5SV5 A;  3AP9 A;  1ASJ 1;  3E97 A;  5FYZ A;  1H1I A;  3ZN6 B;  1GP6 A;  4M00 A;  5I0R A;  3KCY A;  1NOV A;  1J3P A;  1BBT 2;  2AC1 A;  4NWV A;  5LY1 A;  2OUJ A;  4LK7 A;  5C5T A;  4IEP A;  1AUY A;  5A1A A;  1QJX 2;  2W1U A;  3GBG A;  4ZS3 A;  5F2S A;  4HXC A;  4A42 A;  2Z2S B;  2QFE A;  2BZD A;  2R7E B;  5FXZ A;  2XGX A;  2FD8 A;  4GWM A;  3NRU A;  3V0A B;  1OD5 A;  3IMM A;  2D5H A;  2B9U A;  2A6V A;  2RR1 3;  3APB A;  3VGI A;  1OI6 A;  2EIG A;  3UKT A;  3MGU A;  5GZF A;  4Q1P A;  1N3P A;  3SNM A;  1CAX A;  1K3I A;  1QXP A;  1XSQ A;  3ENR A;  4Q0V A;  1LHO A;  1Y9M A;  2BOJ A;  4XBL A;  4MVT A;  4YLZ A;  1IS5 A;  3P1I A;  2BOI A;  1RUE 3;  4FAH A;  4UW3 A;  2RDN A;  1J1L A;  3S30 A;  4JKK A;  1DQ6 A;  2YYO A;  2C26 A;  1IKP A;  1Q8O A;  2DCZ A;  3WUD A;  3ZN4 A;  4E2Q A;  3O1U A;  1ULF A;  4AI0 A;  3IDE A;  4Q4W 3;  1U12 A;  3UET A;  4A2U A;  2ZKN A;  1G9D A;  1UU6 A;  2B9V A;  2Y6L A;  4YW5 A;  4IE4 A;  4P02 B;  1OD3 A;  4MXW A;  4XC9 A;  4Y4R A;  1CIW A;  4CCO A;  1SDW A;  3C3V A;  2ZML A;  5JR2 A;  2BPA 2;  5FZ3 A;  3EYP A;  5FY1 A;  3BU0 A;  1UWW A;  4AI1 A;  1K42 A;  4URA A;  4ZU4 A;  1C57 A;  2AYH A;  5I91 A;  1MS4 A;  4KU8 A;  4CCE A;  4YAR A;  4YM3 A;  4AED A;  4OUM A;  3RZZ A;  4X8P A;  3DEC A;  1AJK A;  1JOB A;  1DGW A;  5E1R A;  3MIE A;  1GMM A;  4YW2 A;  1AR9 3;  1I3H A;  2UUR A;  5K8S A;  4NHL A;  2UYB A;  5FK7 A;  2IVJ A;  3CU7 A;  3UYJ A;  3VDD C;  5IAT A;  2HWE 1;  3I2G A;  1NA1 B;  4ZHN A;  4GD4 A;  1VMF A;  4WM8 B;  3PVB B;  1SFN A;  2WNV A;  3CQO A;  1TE1 B;  1R09 3;  5D8A A;  3UES A;  5DAP A;  4AI3 A;  3LZZ A;  4FP3 A;  5FY9 A;  1KJR A;  2ZGN A;  3CL1 A;  2NM1 A;  4JCK A;  4PBP A;  4XOG A;  3ZMO A;  5C8C B;  2UY8 A;  1IPS A;  1WD3 A;  3HVD A;  3KZ4 C;  3VBO B;  4MO3 M;  1CVN A;  4OI1 A;  4BQ1 A;  3Q8B A;  1O5U A;  3GHM A;  1VPH A;  3K3N A;  3KCX A;  2XKP A;  1VBC 1;  3OD0 A;  3MLK A;  2FZ1 A;  5HCF A;  5F5Q A;  4AI2 A;  5JI9 A;  2XON A;  3P3P A;  2ARX A;  4WZC A;  4Y1X A;  1IG3 A;  4LOR A;  4R4Z A;  4GH4 B;  4KNC A;  2R30 A;  2DUP A;  3NV4 A;  2FDJ A;  2E32 A;  5ABJ A;  5FUP A;  3C7E A;  4QGL A;  4B1L A;  3AKP A;  1OF3 A;  1HRI 3;  3GBF A;  4DOU A;  1IS3 A;  1XYO A;  2HKX A;  3C7O A;  2DCJ A;  5C9A C;  3VD7 A;  3ES1 A;  3CMG A;  4Q0P A;  1LES A;  4Y5S A;  3WY6 A;  1UYP A;  1QU0 A;  3MPP G;  3UGG A;  1W8T A;  4K21 A;  4QXH A;  3WNL A;  3DPR A;  5FZO B;  1RUJ 3;  4PLN A;  2QTW B;  3BVC A;  3POB A;  5KC5 A;  2DYC A;  1GP4 A;  2BUK A;  5KXB A;  5SV8 A;  4RS5 C;  2XJP A;  2GH8 A;  3DYP A;  4A45 A;  4CP9 A;  4QDQ A;  4W4Z A;  2OPW A;  1GFF 2;  3JU9 A;  5FMD A;  2XR4 A;  5KHH A;  4AHX A;  1QNW A;  4NRQ A;  5AFE A;  2C9A A;  1IQD C;  1HKD A;  2GN7 A;  5FZF A;  1D0H A;  3PVO A;  3OPW A;  4Z8B A;  3E1F 1;  3R4S A;  1AYM 1;  2VCC A;  3N7L A;  3W58 A;  3WIN E;  1SCS A;  2ZXQ A;  4XIO A;  2RS1 3;  1AR8 2;  2WNU B;  5G05 L;  5J98 B;  3H7J A;  4DXR A;  3BPZ A;  2PA7 A;  1W3X A;  3T0D A;  2WIN B;  2WWS A;  2YBP A;  4JHZ A;  4D7S A;  2TEP A;  4S2H A;  4WVZ A;  5EXO A;  2AH2 A;  5IUQ A;  3B01 A;  3JB8 A;  3PME A;  1V6L A;  4CRQ A;  4JGY C;  3ZKY A;  4MET A;  3V0B A;  4QMA A;  2VZU A;  2QCS B;  1JZ4 A;  3M4F A;  3INA A;  4XF4 A;  2ZPX A;  1AL2 3;  2QZ2 A;  3KHB A;  3O0X A;  3ZPY A;  4JGZ B;  1AR7 3;  5A1L A;  5CNA A;  5FMO S;  2RMU 3;  4P5Y A;  1R08 2;  1RHI 2;  4XJA A;  4YG0 A;  4PIX A;  3WHT A;  4CDX A;  3MFC A;  3MHZ A;  1RYY A;  1RL3 A;  4C1X A;  4DIQ A;  1C4R A;  3HQR A;  3VD3 A;  5FPX A;  2ZAH A;  1LOG A;  3IPV A;  1UMZ A;  2PMW B;  2W95 A;  3LDB A;  2TNF A;  4AFB A;  1H6Y A;  4QXB A;  1AYN 2;  1ASJ 3;  2Z42 A;  1S2K A;  2FZ2 A;  1WMX A;  2WT1 A;  1Z78 A;  1JZ2 A;  1KDK A;  1SZB A;  5EYX A;  1UO9 A;  3OTF A;  4GQ7 A;  2VEC A;  1KDM A;  1BKZ A;  5C5U A;  1LEN A;  4XJ8 A;  4AGR A;  4UI9 L;  3A7Q A;  1H1M A;  3KV4 A;  1NCQ C;  1RUC 1;  5F39 A;  4W6Y A;  1HJG A;  1KQR A;  3O5S A;  2PQS A;  3LA7 A;  1W2O A;  3GBW A;  1JYX A;  1KIT A;  1SBF A;  3PMS A;  5LK7 B;  1G8W A;  1QIQ A;  1J59 A;  1BEV 1;  1K45 A;  1SQ4 A;  3H8R A;  5HCB A;  4PDW B;  4A4A A;  1HB4 A;  5CYY A;  1SPP B;  3H7Y A;  1DG6 A;  4R9C A;  2KXL A;  5C8W A;  3BOP A;  4IEO A;  5D8A C;  4AGV A;  5J7M A;  1D4M 1;  3SIS A;  1JU3 A;  1GWM A;  1ZBE 1;  1OT5 A;  3GAL A;  4YVS C;  1FMD 2;  2A5Z A;  4LUL A;  4AFA A;  4ZZ8 A;  4XHB A;  1BK1 A;  1N1S A;  1HDK A;  3A0K A;  3KQR A;  5FYY A;  3BTX A;  4K40 A;  1KXG A;  3A23 A;  1QJY 1;  4CUC A;  2YBS A;  5J09 A;  3VBR B;  2J7M A;  2W39 A;  1ZRF A;  1C8M 2;  1PGW 2;  1SLL A;  2G19 A;  5DAB A;  5FZM A;  3MLL A;  1UF2 C;  2JX9 A;  2VNG A;  4FFG A;  4JDO A;  4Z92 B;  1OC1 A;  4Q4V 2;  4H7M A;  2C1F A;  4HET A;  1VAL A;  2Q30 A;  5FQ0 B;  5E8A A;  1ZRD A;  3PUQ A;  2YFZ A;  2CDO A;  1TVG A;  2ZAC A;  3HMY A;  4HFS A;  2R49 A;  1O8S A;  3ZM8 A;  4IXL A;  3WDW A;  5DDJ 2;  4COZ A;  2ZA9 A;  1EPW A;  3ZXF A;  3OY8 A;  1KFU L;  3WW4 A;  5IJR A;  1EV1 2;  4HG6 B;  3DYM A;  2ERF A;  4CDU B;  4ORF A;  5T5L A;  1HB2 A;  4XAA A;  4E27 A;  2PAM A;  1W6Q A;  1ZRR A;  4YFZ A;  2YY1 A;  4UT5 A;  4EZ4 A;  5A3M A;  3I2K A;  4CDQ C;  4XQW A;  4M0H A;  3H1Y A;  1NXD 1;  4BK4 A;  5FZ6 A;  2ADE A;  3DPR C;  4D3W A;  1CJP A;  5FZC A;  1K5M A;  2WO1 A;  2AUY A;  3SH4 A;  1ZX5 A;  2HWE 3;  3IKW A;  3NAP B;  3OPT A;  4GIQ A;  1G86 A;  4Q1R A;  2A6X A;  2P6C A;  4OHV A;  2JB4 A;  2QQW A;  3DEM A;  4NPR A;  5JWP A;  1H4H A;  5APA A;  4IND A;  3WF4 A;  4H55 A;  1VLN A;  1FNY A;  5FYU A;  2Q8O A;  4N53 A;  1BHG A;  1AXZ A;  3E5Q A;  3P3N A;  1QJU 1;  3HNY M;  4OI4 A;  4UFL A;  5FZB A;  1S0C A;  4QHB A;  4D6S A;  1V6J A;  5FCC A;  1FT9 A;  1HB1 A;  4Y20 A;  5K4L A;  3I2O A;  1NCQ B;  1VBC 3;  3USS A;  1Q8S A;  4YSF A;  1O3T A;  2WT2 A;  1XB9 A;  4B1M A;  4QX8 A;  2C0Z A;  1S2B A;  2FMD A;  2W68 A;  5KR7 A;  3LPF A;  4ZS2 A;  5FJH A;  5ACA 1;  5BNP B;  3LFI A;  3WF3 A;  4CXX A;  5IFP A;  1UPS A;  1UY2 A;  5F2W A;  5FO7 B;  1JN2 P;  5HCA A;  4MGK E;  1AXK A;  1HRV 1;  3RMX A;  2J1S A;  2Y64 A;  1XYN A;  3WCR A;  4O61 A;  1CPN A;  2P3I A;  5FR3 A;  3OBR A;  4KH9 A;  3CLP A;  3IB3 A;  1GZC A;  2DFB A;  1LHW A;  1XC6 A;  5K0U C;  3VHO A;  1MQT A;  4RR3 B;  1O5L A;  5LRR A;  4I3P A;  4CDX C;  1O8P A;  2QQI A;  4QGM A;  5C6C A;  2OPK A;  4XET A;  5J1X A;  1LJ7 A;  1VRH 2;  1W0O A;  4QU1 A;  1MS0 A;  1OFN A;  1S0J A;  1H2M A;  1W9W A;  1XBF A;  3O0V A;  2PN5 A;  5FZ7 A;  2BVB A;  3WZ1 A;  3N4M A;  2HEV F;  2YU1 A;  1HXS 1;  3D0J A;  4YNI A;  5EZW A;  3TYJ A;  1SHW B;  4X8N A;  3MUY 1;  4QGN A;  3SKJ E;  2CHH A;  2XLA A;  4N9H A;  1QY4 A;  2BFU S;  1AYM 3;  5FYV A;  3J8F 1;  2VAU A;  5DUU A;  1KD7 A;  2VCA A;  3IMN A;  4LHN A;  4Z07 A;  3BGA A;  5JXH A;  2WS9 1;  2XJV A;  3KV6 A;  1BCX A;  2VZR A;  4BA6 A;  2R07 1;  2GP5 A;  1UZV A;  5FZ9 A;  3N9Q A;  4R4X A;  2DDU A;  2RDR A;  2VZO A;  1OOP C;  4OHZ A;  3BKZ A;  4JC1 A;  4YGC A;  3CEW A;  2R32 A;  3FFZ A;  1WZX A;  1R64 A;  3L2H A;  5CB7 A;  3RZL A;  2ZGK A;  5FXV A;  1K12 A;  4BK5 A;  3KQ4 B;  2XLF A;  4IV1 A;  4KL1 A;  2X5I B;  2EIB A;  2Y6G A;  3DCQ A;  4XYX A;  1JW6 A;  3PL0 A;  1C5I A;  3NV3 A;  4WBB A;  5FFO C;  4FSJ A;  3K46 A;  2Q4S A;  1LOC A;  3POY A;  4W6W A;  2DVF A;  1F31 A;  3EB7 A;  3LOI A;  2WWU A;  3N9P A;  3I2H A;  4NWW A;  3VHR A;  1LGC A;  2VUJ A;  1XYP A;  3U37 A;  5FOB B;  2YC2 A;  1HN1 A;  4UFK A;  5C3S A;  3BTA A;  3USU A;  3FL7 A;  1DQ2 A;  1QH6 A;  1X8M A;  2OA2 A;  4ZPI A;  3WP6 A;  2PAK A;  2BRT A;  3DKQ A;  4QPG B;  4XXA A;  1UIK A;  3THP A;  4JHT A;  1VAK A;  4AVA A;  4N43 A;  2D3P A;  4PLM A;  4P14 A;  1ZYB A;  3ILF A;  1RUI 2;  1C1L A;  1OVP A;  3P5B A;  3GDB A;  1J84 A;  3K4D A;  4D69 A;  2YZ4 A;  3D5O A;  4QPI B;  1RB8 G;  1F8V A;  3BOW A;  1BMV 1;  3GCX A;  1DLL A;  1RUC 3;  4L99 A;  2MPF A;  3ZFE B;  3MIH A;  4NIH A;  3VBH B;  5GAL A;  1CN1 A;  3ZFG C;  4NII A;  1K5M C;  1UKG A;  3MDP A;  1ULP A;  4EWE A;  1BEV 3;  2ZGQ A;  1NLR A;  3C7F A;  1ND2 B;  5CAZ A;  5L7O C;  4NN0 A;  1CAW A;  4Q4X 3;  1RIN A;  5CFC B;  1UU5 A;  2VE1 A;  2WFP A;  2VXJ A;  2PLV 3;  1D4M 3;  1PX4 A;  4UW4 A;  2WN3 A;  3FLT A;  5FOJ B;  1AX2 A;  1ZBE 3;  3F95 A;  4LHL A;  4Q5O A;  4WM7 C;  5FZL A;  1V6O A;  1ENR A;  1YYN A;  5FYM A;  4TLG A;  2D97 A;  2XXZ A;  3FJS A;  4QKD A;  4ISQ A;  1PZ9 A;  2WFF 3;  1YLL A;  2Z79 A;  1QJY 3;  4JDM A;  4LLO A;  1WBF A;  3R6S A;  4FOY A;  3V64 A;  3ZN6 A;  4BE3 A;  2YGM A;  2Y6J A;  3JQW A;  4E9K A;  1SBE A;  1RUG 2;  3H9A A;  5I8Y A;  3I49 A;  1AF9 A;  2PAE A;  4DXT A;  4CCN A;  1SFY A;  2CGN A;  1RUH 2;  2GAU A;  1WKY A;  3UK9 A;  4QX0 A;  1N3Q A;  3NJV A;  1BJQ A;  5HV4 A;  2C6S A;  2O1Q A;  2VUC A;  4HSL A;  1UOF A;  3NWK A;  1D4V B;  4FPF A;  3TNP B;  1G9B A;  3MV1 1;  1YFW A;  3M3Q A;  3LEI A;  4NPM A;  5DUW A;  2G9G A;  3VBF A;  3OD4 A;  1BYH A;  2JDP A;  5FY5 A;  5C3R A;  3QH6 A;  3B00 A;  3N3H A;  3DYO A;  4GWI A;  4CU8 A;  2Y0I A;  4JTO A;  1I1E A;  4OZO A;  2P6H A;  3AMM A;  3MYX A;  4UFH A;  3IWZ A;  2WZP P;  1CON A;  1QXR A;  1OUR A;  2ETE A;  3AMP A;  1ENX A;  1MZ5 A;  3KGL A;  5D21 A;  3VDB A;  1R1A 2;  2WRA A;  4QX7 A;  1NXM A;  2ADD A;  2WQZ C;  4PIZ A;  3H50 A;  3ZXA C;  4AVB A;  4Q29 A;  4AL9 A;  1DU3 D;  4ERO A;  4XJZ A;  1VBE 1;  4LBK A;  2QQL A;  1HV0 A;  3CDZ B;  5L19 A;  4JV4 A;  4QXC A;  3KS7 A;  3BIE A;  3WW2 A;  3SIT A;  3KT4 A;  1ZM1 A;  3LOB A;  2SLI A;  4JRA A;  2RS5 1;  3UJO A;  2R0F A;  2R1B A;  1QJU 3;  1PO2 1;  1ZBA 1;  4I0A A;  3SMH A;  5HCH A;  3FUQ A;  5LA1 A;  3EQE A;  4Q0U A;  1Q5O A;  2HBU A;  1SEF A;  3IAQ A;  5L9R A;  1MS9 A;  1F5F A;  3NNL A;  4PCR A;  3I7D A;  4HK9 A;  4QKB A;  4KG0 A;  2RM2 2;  3UNP A;  1QOO A;  2RS3 2;  1K5J A;  2O14 A;  1TME 2;  1W8O A;  5ACA 3;  1UOG A;  4BIO A;  4CCJ A;  5JOZ A;  3C2U A;  4WVM A;  1H4G A;  2BNN A;  4DQA A;  3TEW A;  2NPI A;  1YFX A;  5FJK A;  1BLZ A;  1NY7 2;  2VUA A;  2ZEY A;  3HWJ A;  3J26 N;  1NA1 A;  3U1X A;  3C8X A;  2ET7 A;  2XQX A;  4COW A;  3T2P A;  4DXZ A;  4IV1 C;  1HRV 3;  4KGG A;  4B4R A;  3NV2 A;  4XVH A;  3B69 A;  5JDB A;  2BGC A;  5GLZ A;  4AQ6 A;  2CTV A;  3WP4 A;  4AAX A;  4TZD A;  1UU4 A;  3NNJ A;  3OBA A;  5C8C A;  2GC3 A;  2XJU A;  5ANN A;  1H9W A;  5GJ6 A;  4LUK A;  2HWC 2;  3VBO A;  1AXY A;  1DGL A;  3ZXD A;  2Y6F A;  4JTN A;  3T3Y A;  3WNN A;  3W5N A;  4IGP A;  3AX4 A;  3H3Z A;  3QLQ A;  2V72 A;  4FQ4 A;  3WF1 A;  1A8D A;  4AFC A;  1RXF A;  2VJX A;  3N7K A;  1MS5 A;  3UGF A;  1S0I A;  4N43 C;  2PHD A;  2ILM A;  3JD7 1;  5DAQ A;  3JBG 1;  1HXS 3;  1LTE A;  4XQ4 A;  1RUO A;  3OGJ A;  3AP5 A;  1RXG A;  3III A;  1WCK A;  4LHK A;  5FZA A;  4DEV A;  3WQB A;  3M8L A;  2ZGS A;  1RVF 1;  5A7S A;  5IAX A;  5ERL A;  3OSD A;  3N9L A;  1DQ0 A;  3AL6 A;  4XTM A;  3J8F 3;  3RGB A;  2RJ2 A;  3ZDS A;  4B7E A;  5C3O A;  3RG0 A;  2FCV A;  5EJ1 B;  4AZZ A;  3VB9 A;  1CAV B;  2WS9 3;  1D0G A;  3WDV A;  5HPO A;  5A1F A;  2R07 3;  5A6Z A;  3Q8C A;  5HXM A;  3VZL A;  3O1S A;  3FN9 A;  2XUE A;  2ZGT A;  5IYY A;  1RMU 1;  3MIC A;  5FZO A;  5FV3 A;  4CA9 A;  4YVW B;  4YM0 A;  5GZD A;  3GXU A;  3AL5 A;  3ZSJ A;  1QDC A;  5LBF A;  3LDR A;  3BTZ A;  1RUD 1;  3AP4 A;  2C9K A;  2X05 A;  2XBO 1;  5ISL A;  1X82 A;  4LKD A;  2W91 A;  1GSL A;  1OMI A;  2QDR A;  1NT0 A;  2NN8 A;  2FBE A;  3WDU A;  2BTV C;  1UY1 A;  4D7T A;  4OHW A;  3MIG A;  4LNV A;  4UFJ A;  4LKS A;  1NKG A;  1Y4W A;  2QZ3 A;  1G9F A;  4RN5 A;  4U2A A;  1XNK A;  1LRH A;  2JEC A;  5H9Q A;  3ZN5 A;  1W6M B;  4XQD A;  1D2S A;  2JDZ A;  1WA6 X;  3S7E A;  1HJF A;  5L36 A;  1BBT 1;  1PK6 C;  2LUW A;  2W94 A;  4E2G A;  1W8N A;  4LOS A;  2WNU A;  1OUS A;  5EJ3 A;  1RJ8 A;  2VZ1 A;  1EUU A;  3KV9 A;  4NRM A;  4RGK A;  4V1P A;  1LGB A;  3MO4 A;  2V5D A;  5LB6 A;  4BWO A;  1AR9 2;  2G1M A;  4QKN A;  1W99 A;  3S57 A;  3URF A;  3VBF C;  3ABZ A;  4Z82 A;  1V6N A;  3POG A;  3VBU C;  1MEC 2;  1S2E A;  2BW8 A;  3HT1 A;  3KMH A;  5EIY B;  1ZVF A;  5BNN B;  5FUI A;  4QQO A;  2QE3 A;  1CD3 G;  4NHM A;  5HXV A;  3ZSK A;  1PM4 A;  1HQL A;  4XBN A;  2O8Q A;  3HJR A;  4CVU A;  2VOW A;  2E33 A;  4JGZ A;  3GZA A;  4AHY A;  2YGL A;  2ZX4 A;  4GMP 0;  4M3C F;  3QOP A;  1PNG A;  2ET1 A;  3P6B A;  1YRZ A;  3M2M A;  2W2I A;  2CAV A;  3OUI A;  1VRB A;  2QQU A;  3ZDV A;  2QNK A;  3IZO A;  2GNM A;  2QUO A;  2CSG A;  1HRI 2;  1MVE A;  3TAY A;  3B94 A;  5JUV A;  2NP0 A;  4JQT A;  1LOF C;  4NOT A;  4SBV A;  5LY2 A;  2A75 A;  3LD8 A;  1WBL A;  2XPJ A;  2XJR A;  2LM3 A;  5T54 A;  2RVA A;  1OBN A;  4MGT A;  4BIF A;  1GAN A;  1E5S A;  4HN1 A;  4YWA A;  4ZU5 A;  3PU8 A;  4FPY A;  3ZMN A;  3AKR A;  2YDE A;  2YHJ A;  5JZG B;  5LBC A;  2Q1F A;  1X33 A;  2WUH A;  1IKQ A;  1OSG A;  1U5I A;  4CEW C;  4K7J A;  2MNG A;  1DGR N;  4M0N A;  1XND A;  1RUJ 2;  3NNM A;  1GZW B;  1W0N A;  4PDW A;  4XDO A;  5IVB A;  4G9S B;  1PGS A;  1C3H A;  2WSV A;  3GZE A;  1RIT A;  2VPV A;  3HNM A;  5B4X A;  3FBM A;  2GN3 A;  3SCH A;  1DYO A;  1ZNP A;  4H3W A;  3SQO A;  4OLL A;  4FPH A;  4RL7 A;  1C5H A;  1F35 A;  1RGS A;  4K8F A;  4M4R A;  5KBF A;  4OCT A;  3D3A A;  1RC6 A;  2LW8 A;  5JI7 A;  2DTY A;  1O4Z A;  1ZZB A;  2VQ0 A;  3VBR A;  5FY0 A;  2MEV 2;  1F4H A;  3G7D A;  4AGG A;  4FAG A;  1A3K A;  2YUE A;  3ZIW A;  2XKO A;  1VBE 3;  3VZN A;  4DMI A;  3LWC A;  3POI A;  2VUD A;  3I59 B;  3ZKU A;  4AFM A;  1JYV A;  4WVW A;  3ACF A;  4FPJ A;  2RS5 3;  3AZX A;  3I4I A;  4P9I A;  3WOG A;  1PO2 3;  1ZBA 3;  5FO9 B;  1WCU A;  3M3O A;  3TBD A;  4XBQ A;  3AKS A;  4FOQ A;  4URT A;  2BV4 A;  2OXB A;  3AJY A;  2E26 A;  4FXG B;  3N35 A;  1QMJ A;  4U36 A;  4RQP A;  2CGP A;  2BNO A;  3K48 A;  4H14 A;  3PTR B;  2JXA A;  4KQ7 A;  4XUR A;  4XUO A;  1P8J A;  3CJI B;  4MHR A;  1AL2 2;  4WVV A;  4YG3 A;  3WP3 A;  1UQX A;  3A4U A;  4BQ2 A;  1YIF A;  2TUN A;  2WII B;  3HQU A;  2D93 A;  2XDV A;  2ZHK A;  5B2G B;  5T3N A;  2G9Z A;  4QHO A;  5G04 L;  5FZG A;  2VOV A;  4YZ1 A;  3NAP A;  3R4U A;  1W8H A;  3BCW A;  5LAS A;  2BU9 A;  2H6B A;  2V4V A;  3SCG A;  3MPB A;  3Q8F A;  2GC2 A;  3VBS B;  1J83 A;  4I3G A;  2GNB A;  3SKV A;  2D6K A;  4O9G A;  5C4W A;  4AR2 A;  4L0P A;  4CP0 A;  1W28 A;  3IBM A;  1O4Y A;  1FYU A;  3NMB A;  2O8O A;  2JD4 A;  1W2N A;  5BUV A;  3NO8 A;  4N7U A;  1IZ3 A;  3ZXG A;  1DZR A;  4QD2 A;  5LBE A;  1WGP A;  3TN9 1;  1VE0 A;  3AMQ A;  4BHP A;  5H9P A;  1UY4 A;  4FPK A;  1Y3T A;  3IN9 A;  1AR8 1;  4XMA A;  1NQJ A;  3FC0 A;  1VAM A;  3JD7 3;  1RUF 2;  3LA2 A;  3JBG 3;  3RWN A;  1HQW A;  5BNP A;  3T09 A;  4DUX A;  2X8K A;  4KWK A;  3FHQ A;  1RVF 3;  1R1Z A;  3WQ1 A;  2XH6 A;  2VTX J;  2JE9 A;  4RHV 2;  3VDA A;  2BNM A;  3EJK A;  2BBA A;  2P1B A;  4HL0 A;  1ZA4 A;  3I3E A;  4IGQ A;  2CGO A;  2VW1 A;  4I0B A;  3M3C A;  4KWJ A;  5A3W A;  3UJQ A;  3J7L A;  4Z2W A;  4MGQ A;  4P9L A;  4DXS A;  1NCR C;  3GJA A;  5A33 B;  1L7R A;  1RMU 3;  1WW5 A;  4Y5Z 0;  1VJ2 A;  2J1R A;  2JG8 C;  2CYF A;  1LGN A;  4RR3 A;  2ZX3 A;  1A6C A;  4V2V A;  5B4N A;  2OW4 A;  1AJO A;  4ITC A;  2OQ7 A;  4IV3 C;  4NAO A;  4D6R A;  2HYK A;  2L9L A;  1F9K A;  1R08 1;  1CAU B;  1RHI 1;  1RUD 3;  2XBO 3;  3KSC A;  2YB7 A;  1VBB 2;  3EO6 A;  1ZZ6 A;  3HR9 A;  5JR7 B;  3ZFF A;  5BNO C;  4A44 A;  4OUS A;  5CKN A;  2JG9 A;  3THT A;  1FAT A;  4HAN A;  4DUV A;  2XJS A;  1OXC A;  1AYN 1;  2DVD A;  5DQ0 A;  4Q4Y 1;  2VG9 A;  3M70 A;  4LBN A;  1UX7 A;  4PIY A;  4HT1 T;  5E6H A;  1FPN 2;  5IAV A;  1BBT 3;  2R6Q A;  4Y1V A;  2D7F A;  1PO1 2;  2QDN A;  4N90 A;  5CU1 A;  4LT5 A;  1XPW A;  1UY3 A;  3HEI A;  4I01 A;  3RMY A;  1OFS A;  4ZU7 A;  1VBA 2;  5LEK A;  5GLT A;  2HWF 2;  2W46 A;  3ZXL A;  2Q1M A;  1ODM A;  3NVC A;  3R05 A;  4PBO A;  3JUU A;  3VDD B;  3B93 A;  4K6B A;  1FV2 A;  2Y34 A;  5FPU A;  1X7N A;  1DLC A;  3K75 B;  4HKO A;  3RNS A;  1UOJ A;  1EY2 A;  2EF6 A;  5FP3 A;  2CU5 A;  2VVD A;  2X5I A;  4NRP A;  3U4S A;  5I0D A;  5KHJ A;  3NKG A;  4ISR A;  1A78 A;  2TBV A;  2UWA A;  3B9I A;  4LBQ A;  1JZ5 A;  5A80 A;  4ATE A;  2WZ8 A;  1X9P A;  4A7K A;  5FMO L;  1FMD 1;  2CL2 A;  5D2A A;  1TNF A;  5K9Y A;  3PUR A;  4IET A;  4BM8 A;  1QJZ A;  1VBC 2;  3OCP A;  5FLJ A;  2CDP A;  1JYW A;  1C8M 1;  1ONA A;  1PGW 1;  2PHL A;  3I2J A;  4FI9 A;  4RFT 0;  5AC9 2;  1W6O B;  5IW0 A;  1CQ9 A;  5LA9 A;  5JSR A;  3GGL A;  4Q4V 1;  1F5J A;  1XE8 A;  2VZQ A;  4QPG A;  1XNB A;  4FT8 A;  1GNZ A;  2R06 2;  4AXO A;  5IHR A;  1PZ8 A;  4DIN B;  4QWN A;  2YC0 A;  5T5O A;  2ORX A;  4XAC A;  4LIV A;  5FWE A;  2JD9 A;  1Z7S 2;  3LCP A;  4YRD A;  5FPL A;  3PNA A;  3WQ7 A;  4C8D A;  1S4C A;  1W8W A;  3SH3 A;  2GH2 A;  3VHP A;  4QPI A;  3S5Q A;  1EV1 1;  4LTA A;  4RQP C;  5C9A B;  4LA2 A;  2HWB 1;  1JHJ A;  1W0P A;  4I02 A;  1GKB A;  2WL1 A;  2OX0 A;  4FFH A;  3VBH A;  2ENR A;  2VR4 A;  4UBH A;  3UV9 A;  2A70 A;  3WX5 A;  4AED C;  1OLQ A;  2BVV A;  2ES3 A;  3GM8 A;  1JXN A;  4F7Z A;  3WDX A;  3IDB B;  3GNE A;  4CEY A;  4ET7 A;  4P9J A;  4FFI A;  2PHW A;  3JCI A;  2B39 A;  5FKB A;  5BXX A;  1OQ1 A;  3RSJ A;  2P4E A;  3WLU A;  4CDW A;  1NX9 A;  2QQO A;  2WYS A;  4IEW A;  3AZW A;  2P3K A;  3HNB M;  5CFC A;  3ILR A;  2ZBJ A;  1SMV A;  4H2A A;  4CU6 A;  2BDR A;  4RS5 B;  3MUZ 1;  5A6Y A;  5FDB A;  4R9D A;  5C4W C;  1LNS A;  2PHX A;  1KS4 A;  2UYA A;  2WNV C;  1CZS A;  5F6K A;  1LEM A;  2IVI B;  2IFR A;  4Y26 A;  4YFW A;  3RQ0 A;  3U4X A;  5J36 A;  4EE2 A;  2DU0 A;  4EWD A;  1O91 A;  5FZ8 A;  1AYM 2;  5F5A A;  3VUO A;  3B7M A;  3L2Y A;  4PI2 A;  3ZYF A;  2QQK A;  1GV9 A;  1EPZ A;  3LIG A;  4COU A;  4QAW A;  3NKT A;  3RI9 A;  4Q8K A;  1NE4 A;  4ARY A;  5A7N A;  3E6C C;  5FZ1 A;  5CKM A;  1DGR A;  3MID A;  1IPK A;  2B5H A;  3AXE A;  2VQU A;  5ABJ C;  4N8M A;  2G9F A;  2ZHN A;  4UAP A;  4XCB A;  4FOV A;  4R9B A;  2DCK A;  4F3J A;  2BBV A;  1CAX B;  3THC A;  2ZOE B;  2FHR A;  1CX1 A;  4JGY B;  4QX2 A;  2YG0 A;  2D6M A;  2DCY A;  2R04 2;  3VZJ A;  1B35 A;  2D43 A;  3LEM A;  2PYT A;  3VLB B;  4NR1 A;  4DRV A;  4H7L A;  1PMI A;  1NLS A;  4IL7 A;  3PIJ A;  4QQL A;  5FY4 A;  4CP2 A;  4E4Z A;  2GMM A;  4HLT A;  1SDD B;  3I8T A;  5DAV A;  3DL3 A;  2XJT A;  3EMR A;  3OYW A;  2D6O X;  4IEY A;  2YBK A;  5DXD A;  2I2S A;  4MSV A;  2QQM A;  1MZF A;  2QJV A;  3ATG A;  5H9S A;  2ZEW A;  1UY0 A;  1VRH 1;  2JG9 C;  4MXW B;  4CCK A;  2VBD A;  4FPG A;  1AR6 2;  1BVP 1;  3OUJ A;  5IT6 A;  5FUN A;  1V6K A;  2C24 A;  2P34 A;  4BU2 A;  5A6Q A;  1MZE A;  4ASL A;  4B29 A;  3OEA A;  3TN9 3;  1I5P A;  4O9E A;  3C7G A;  5JIA A;  1UMI A;  1COV 2;  2XML A;  2VC9 A;  1E5H A;  1D7P M;  3K77 A;  4FXK B;  3AMH A;  3DV8 A;  2H0V A;  1AR8 3;  2D44 A;  1WLC A;  2RDQ A;  5FYH A;  4K9S A;  3VD5 A;  4L97 A;  2GC0 A;  1LHU A;  4MGI E;  4CUB A;  2PHT A;  3NNG A;  4CYD A;  4EN8 B;  2XWJ B;  4Q4X 2;  5BNQ A;  1C8N A;  5EHD A;  3WW3 A;  1EAH 1;  1XXN A;  2GC1 A;  2PLV 2;  2IC1 A;  4AVT A;  4BZ4 A;  1H8V A;  2C5D A;  3AFG A;  3KVB A;  4JVA A;  2WNV B;  1JYI A;  4I2O A;  5D8A B;  1QJF A;  1AX0 A;  1O4T A;  5CG8 A;  3ACG A;  1IPJ A;  2Y0O A;  2WFF 2;  4P00 B;  1WW4 A;  4YVS B;  4BQX A;  3ZYG A;  1GNY A;  3H1W A;  3JXS A;  3KF3 A;  1H30 A;  4AVV A;  5CFD A;  4QB6 A;  2JJ6 A;  2O0O A;  2DBI A;  1N1T A;  1W39 A;  3AYA A;  3AVS A;  4ONU A;  5FP4 A;  1GOF A;  1R08 3;  1ZA7 A;  4Y22 B;  5EYY A;  4CPB A;  4G4F A;  2ZX0 A;  2JDM A;  3TNQ A;  1JMU B;  4XUT A;  2V73 A;  5F3I A;  1O3S A;  1SG3 A;  1UPI A;  2K2S A;  4XF9 A;  3WNX A;  2PHF A;  4Q26 A;  3JB4 C;  3O14 A;  1GBG A;  1AYN 3;  4GB3 1;  1LOD A;  2BFU L;  4Q4Y 3;  4RYD A;  1RUI 1;  3T2Q A;  3U14 A;  1GUI A;  3I2F A;  4IE5 A;  1UYX A;  2IXH A;  3NV1 A;  5KHG A;  2UWC A;  1H8T A;  2VZT A;  3QD6 A;  1FOD 2;  2HWD 1;  2A6Z A;  2WLP A;  1V6M A;  5J96 B;  2OZJ A;  1DYP A;  2VW2 A;  3MW3 A;  4BME A;  1GQH A;  4CDQ B;  3EBR A;  3EHK A;  5DN2 A;  2VZ3 A;  4CEY C;  5GZC A;  1APN A;  3DPR B;  2VTF A;  2XB6 C;  2E51 A;  4CDW C;  5C3Q A;  4YVW A;  4M3C A;  4HSJ A;  4OHX A;  2ZGO A;  2YFU A;  4CCL A;  5LA0 A;  4LBQ D;  2E7Q A;  4Y33 A;  2AEY A;  3U07 A;  2OKX A;  4XJW A;  4XW3 A;  3RI8 A;  4CP9 B;  1VIW B;  3POJ A;  4E8C A;  3W9A A;  5KC6 A;  2XVK A;  3AXD A;  4O65 A;  4HVR A;  4XFF A;  4BQ3 A;  1QJU 2;  1FMD 3;  1LEC A;  3FWE A;  4K1Y A;  4MZU A;  4BLJ A;  5GZG A;  4LO5 B;  1ENS A;  1HIX A;  5DZE A;  5F6L B;  1V9U 2;  5FPB A;  3HIF A;  3KB5 A;  1W6M A;  4Y1Y A;  5FZE A;  1RUG 1;  2ZZJ A;  1C8M 3;  4RFR B;  3D0S A;  2FCU A;  4KGQ A;  4SLI A;  3TRS B;  2ZS6 B;  3PUI A;  3W5M A;  1TNR A;  4Y24 A;  4TXW A;  1Y7B A;  4P08 A;  1RUH 1;  1N1Y A;  4Q4V 3;  2FMY A;  4A7Z A;  4DRR A;  4LBO A;  4YM1 A;  1OA3 A;  4AW7 A;  1XE7 A;  4UWD A;  3RWK X;  1UN1 A;  4DEQ A;  2ARE A;  3A0N A;  2H0B A;  2WDB A;  2NMO A;  5GM0 A;  4LMF A;  4B4P A;  1ALY A;  2BWC A;  4BYY A;  5BNN A;  3ORJ A;  1TG7 A;  4IEZ A;  3K51 A;  3J4U H;  1DQ4 A;  1EV1 3;  2OUH A;  2HWB 3;  4BLI A;  1QKQ A;  3V0B B;  1JH5 A;  2K46 A;  4QQP A;  3B02 A;  5KXD A;  3NST A;  1UD1 A;  2J1T A;  4FO9 A;  4AAP A;  3HOB A;  2I74 A;  3O1R A;  1ACC A;  1SLA A;  1R1A 1;  3OOX A;  1OA2 A;  2GNT A;  4XE9 A;  5K0U B;  3UL2 A;  2B8M A;  3K3O A;  1JZ8 A;  3MV0 1;  1WME A;  4CDX B;  5LWB A;  1ND3 A;  1LHV A;  1PIV 2;  1DQ5 A;  4JX0 A;  1E57 A;  4L92 A;  3WNM A;  4DB5 A;  2IXL A;  3IPV B;  1S55 A;  5FYB A;  2WNE A;  3J7M A;  3O0W A;  4YW4 A;  3RDI A;  5KXC A;  2CY6 A;  3OB8 A;  4GWJ A;  1VAV A;  1VBD 1;  2GU9 A;  1US2 A;  3OUH A;  2WZR 1;  4K3U A;  3WG4 A;  1G7Y A;  2OT7 A;  4N53 C;  2PTM A;  1JOD A;  3H42 B;  3FZ3 A;  1V6I A;  3Q9O A;  3J8F 2;  1U5Z A;  3SC7 X;  5FZ4 A;  3W21 A;  5I8T A;  4AE2 A;  1AX1 A;  1TMF 2;  4FOW A;  2DU1 A;  2VCM A;  4Z1V A;  3E5X A;  1QXJ A;  2V4A A;  2Q8D A;  3POE A;  4ZON A;  2BQP A;  1UZ0 A;  5JZG A;  2RM2 1;  5F3C A;  2G4I A;  4HMZ A;  2NMN A;  4XIK A;  1TME 1;  3J7N A;  2DWR A;  1OOP B;  2WO7 A;  5FMC A;  3WEZ A;  4E8D A;  2GME A;  3AYE A;  4NHX A;  1GZW A;  4FVV A;  2AEN A;  5I0U A;  4OVE A;  1NY7 1;  2J22 A;  3ACH A;  4XAB A;  3AYC A;  5F32 A;  5FP8 A;  3HPN A;  3UKV A;  2LS6 A;  3V0A A;  1W8F A;  4WZF A;  2Y6K A;  4TLF A;  2WAO A;  4NVP A;  5E89 A;  1QF3 A;  4XTP A;  4P5H A;  4HKL A;  4CCM A;  1BQP A;  1QGL A;  4LR4 A;  5D1I A;  4HVQ A;  1QQP 2;  3KGZ A;  1JZ7 A;  2E63 A;  2XOM A;  4ZXE A;  1GQG A;  3K4A A;  2ARC A;  1O7F A;  2QQV A;  1GU3 A;  1UCX A;  1REE A;  1UYY A;  1OH4 A;  5CFD C;  5LCW L;  3O1M A;  1GYK A;  2P3Y A;  4DO0 A;  1W2U A;  1W9F A;  2HWC 1;  3AKQ A;  3H0O A;  4MH0 E;  3VL8 A;  1MQT C;  2VZV A;  3POW A;  2WO2 A;  4EJR A;  1Y9G A;  3I59 A;  3E6B A;  5T5J A;  2ZX1 A;  4AYU A;  2E31 A;  2F6B A;  4XEZ A;  5C70 A;  1U5Y A;  3PTY A;  4AQS A;  2VQT A;  4XJ9 A;  5A7Q A;  5IFT A;  3MF9 A;  3G6J B;  1LAJ A;  5A7P A;  2RJK A;  3OY8 B;  1LU1 A;  1BMV 2;  5I8S A;  1H8T C;  3BAL A;  2WR9 A;  3F2Z A;  5FXW A;  1W90 A;  3A21 A;  4BXS V;  3EXU A;  1QWR A;  2EXH A;  2WQ8 A;  5FRA A;  5JSP A;  4BPZ A;  3AMN A;  3KV5 A;  4D94 A;  2A6W A;  4IE7 A;  3ZFG B;  4B7K A;  1K5M B;  5C3P A;  1WMD A;  4LK6 A;  4NE9 A;  3U0Z A;  3RPQ A;  5L7O B;  1YHF A;  1WCS A;  1EAH 3;  3SCF A;  1I6X A;  5FYC A;  3SHR A;  4PT6 A;  3VBS A;  1QHD A;  2E6V A;  4WM8 A;  4WM7 B;  2E9Q A;  5GKA C;  4XFC A;  4NID A;  4CUA A;  1DYK A;  2P2K A;  2KR2 A;  1W3V A;  1B09 A;  4MOA A;  4R52 A;  4N53 B;  1XJA A;  3MFA A;  4GUL A;  3RJR A;  4NHY A;  4CPB D;  3GF6 A;  2HJI A;  3M1H A;  2VL4 A;  2LAL A;  4Y20 B;  4AEK A;  4ZXK A;  4LO4 B;  1UIJ A;  4LO8 A;  1J1T A;  4AVC A;  4Q0Q A;  4S2D A;  3WV6 A;  4YZ5 A;  3B9C A;  1NUK A;  3POF A;  3RRD A;  4FPL A;  4PHZ A;  4YM2 A;  1POV 0;  4JKM A;  1BZW A;  4WV8 A;  4YW3 A;  3NQH A;  1JYC A;  4LPL A;  4GAL A;  4D7Y A;  5JMO A;  3PLQ A;  4O7X A;  2VTX A;  4XF1 A;  4GB3 3;  5I93 A;  2VCB A;  4GH4 A;  4HOO A;  1RUI 3;  5GLU A;  4QKF A;  1MEC 1;  4FPE A;  5A32 B;  4BQW A;  2RR1 2;  2WJS A;  3PDQ A;  4RA0 A;  4YYO A;  4FQZ A;  3RVH A;  2P5B A;  5H9R A;  5A70 A;  2HWD 3;  3R4D B;  1YIP A;  4GJY A;  3KCC A;  3LEK A;  3WSO A;  5A33 A;  1Q8Q A;  2OYZ A;  4LE3 A;  5IWF A;  5F3G A;  1GOH A;  1RUE 2;  1GP5 A;  1W6N B;  1VBE 2;  3ITQ A;  4HZF A;  4FP2 A;  2FDI A;  4M4P A;  1LKN A;  4UBG A;  2VMF A;  2VOK A;  4BH9 A;  3ZYJ B;  2WLQ A;  2B46 X;  4Q4W 2;  1DZT A;  1KS5 A;  4MXV A;  1RIR A;  1PO2 2;  1ZBA 2;  5EV7 A;  3AP6 A;  3ACI A;  2CV6 A;  1PVC 1;  3RZH A;  4QB2 A;  1HB3 A;  1YXW A;  2RV9 A;  4QT6 A;  3E6D A;  3OGS A;  1KEX A;  4KBB A;  4RGA A;  4DNY A;  2IXI A;  4W65 A;  1FAY A;  2Q0A A;  2WT0 A;  1RUG 3;  2KA3 A;  3AVR A;  1XNA A;  4L9B A;  3WHU A;  4L2N A;  5AVP A;  1RUH 3;  3OF1 A;  2P3J A;  1IGO A;  2V09 A;  5FPZ A;  1SLT A;  4MGZ E;  1H1A A;  1H6X A;  4HK8 A;  5F37 A;  1UZZ A;  1QJX 1;  4QX5 A;  4JDN A;  4Q0S A;  3ECQ A;  4PF5 A;  4DY5 A;  4EV0 A;  2PHR A;  3VDD A;  2ZMN A;  1JZ6 A;  4K8R B;  2J42 A;  2QVS B;  3AB0 A;  4IV1 B;  2X53 S;  5CIR A;  1S0D A;  3RYK A;  2GMP A;  2JIJ A;  3O7O A;  1R09 2;  5C33 A;  4QPW A;  1W06 A;  3SH5 A;  2D6N A;  1AVB A;  4J6G A;  1R1A 3;  2ARA A;  3N7J A;  4QX1 A;  5FXX A;  1GIC A;  4MHU A;  2MEV 1;  1ULO A;  2XHK A;  2BEO A;  3UKN A;  1F15 A;  1V70 A;  5FP9 A;  1ZZ7 A;  1JS9 A;  4M01 A;  1WUV A;  2PHU A;  1PVX A;  5LAT A;  3JD7 2;  3FE5 A;  1Q8V A;  4AEJ A;  3JBG 2;  1FV3 A;  4HPK B;  4N43 B;  3UGH A;  3RJ2 X;  1POV 1;  1VBD 3;  2W08 A;  2YV8 A;  3IDA A;  4IGO A;  4QDR A;  2WZR 3;  3ZXK A;  4C0H A;  5KHK A;  1PGL 2;  1RVF 2;  5F9T A;  5BV6 A;  2QBX A;  5FPV A;  1JUI A;  1NE6 A;  1NYW A;  1REF A;  3D8C A;  4QM8 A;  3PVN A;  2VMH A;  4RSU A;  1WLT A;  3MEP A;  5DUV A;  1ZZC A;  3MZH A;  1YUD A;  1S0G A;  5C9A A;  4QX3 A;  4LE4 A;  3WQ0 A;  1S0F A;  5LA2 A;  3DGT A;  2RM2 3;  1ULD A;  3FLR A;  5I0T A;  1YJK A;  5HV0 A;  4ASM B;  1TME 3;  3IM0 A;  1IG0 A;  3GZU C;  3JZV A;  4YZ4 A;  4HN0 A;  2Z5W A;  1ODN A;  1WLD A;  1CAW B;  1YC6 1;  4X6Q B;  4BCU A;  2XBO 2;  1QOT A;  2N7G A;  1CJD A;  4XUP A;  1NA1 C;  4RS5 A;  4WM8 C;  2D40 A;  5F5C A;  3POS A;  1SPP A;  3WDY A;  4BDV B;  3T2O A;  2CWS A;  1MPX A;  1KRI A;  5F1R A;  2Z69 A;  4XF3 A;  1WD4 A;  2Q8C A;  3U78 A;  1ZRE A;  4MLO A;  5C8C C;  5C71 A;  1LB2 A;  2HWC 3;  2JIC A;  5CVR A;  4KI5 M;  2DUQ A;  5EQU A;  3VBO C;  1O3R A;  3PJQ A;  2JE8 A;  3HN1 A;  1UX6 A;  1EUT A;  1UMH A;  5IVC A;  1NZI A;  1PK6 B;  1VMJ A;  3FHA A;  3T4V A;  3QH7 A;  5A7O A;  5FZD A;  5JPM B;  1MS8 A;  2DFC A;  2RS1 2;  5E88 A;  2ZHL A;  4C1W A;  3GJB A;  5JAX A;  1XQN A;  1RUF 1;  4OMC A;  3VHN A;  5FQ0 A;  1Y43 B;  1HW5 A;  4GH4 C;  5FIX A;  1W8U A;  2XVG A;  3VBF B;  3VBU B;  2VMI A;  1QDO A;  2D6L X;  2YXS A;  4Q2F A;  1X9T A;  2ZGL A;  3ZXJ A;  4RHV 1;  1VB4 A;  2AGS A;  2IWG B;  4JGY A;  1Z0H A;  1WW7 A;  4Q27 A;  4CDU A;  3I3Q A;  2JDA A;  4YGD A;  3SXW A;  3S6P A;  1OA4 A;  1OPM A;  3MI8 A;  3KF5 A;  3FLP A;  4XZU G;  3ZYI B;  4FBF A;  1AR7 2;  5F8P A;  5EJZ B;  3BN6 A;  2RMU 2;  3O12 A;  1DDL A;  2RG4 A;  3H8O A;  2BP6 A;  3PIG A;  1HX6 A;  3QCW A;  5I0S A;  1JZ3 A;  4LO6 B;  3VV1 A;  3ZSM A;  1HV1 A;  2ZHM A;  1DP0 A;  1OF4 A;  4GMP 1;  5A3U A;  1W9S A;  1VBB 1;  2JDU A;  3RZM A;  1T6B X;  1O59 A;  1ST8 A;  5T55 A;  3IIA A;  2VZP A;  5DPN A;  1ASJ 2;  2D5F A;  2B7Y A;  4C0B A;  4K1Z A;  3CIH A;  5IK7 A;  3IAP A;  5A7W B;  2GZW A;  3ON7 A;  3CHX A;  1G9A A;  3SEE A;  3WUC A;  3MF6 A;  2J1A A;  3CO2 A;  1QEX A;  4YGE A;  1FPN 1;  3WNK A;  1M4W A;  4AF9 A;  5FYS A;  1NCQ A;  3ILN A;  1M06 G;  1PO1 1;  3LDK A;  3T0A A;  5A6X A;  2CNA A;  2A71 A;  2WO3 A;  2WNU C;  2XUM A;  2YRO A;  2HH9 A;  1CIY A;  3R0R A;  5A3P A;  1VBA 1;  4CEW B;  4WVM B;  1JOP A;  5KWR A;  2IUW A;  2HWF 1;  4UFM A;  4QU2 A;  2DF7 A;  2DUO A;  2EID A;  2VQA A;  1MEC 3;  3B3Q E;  1X36 A;  2Y60 A;  2DTW A;  3WXP A;  4ZZ5 A;  5FTT C;  1AL0 G;  3ZR5 A;  4TN7 A;  3KM5 A;  3NW4 A;  4YVS A;  4CU7 A;  5LRS A;  3WG1 A;  2ZGU A;  5DG2 A;  4FTB A;  2BYV E;  2WA3 A;  4J1X A;  3LPG A;  4XFG A;  1G9C A;  1WW6 A;  2B45 X;  3V65 A;  4JGZ C;  1OQD A;  3DF0 A;  1GWL A;  3BUC A;  1W6P B;  2OII A;  4LIT A;  4PI0 A;  4Y22 A;  4Y4Y A;  2XLG A;  1LOB A;  5AC9 1;  1LHN A;  3AZZ A;  4P9Y A;  1SFP A;  1ZRI A;  1WCD J;  3GYD A;  2OVU A;  2ZGR A;  2K0G A;  1PVC 3;  2R06 1;  2FCT A;  4N9I A;  3N36 A;  4UF0 B;  1N1V A;  4YPJ A;  3PVE A;  1Z7S 1;  5AFB A;  1H2N A;  3LIH A;  4V2W A;  3CKH A;  2GP3 A;  3HN3 A;  1IOA A;  4OMD A;  4Y5T A;  2PFW A;  3ST7 A;  3QAC A;  5J3U A;  3ZYR A;  1XE0 A;  5L73 A;  5FRE A;  3TEX A;  2NQY A;  4YZ3 A;  2JE7 A;  4CDQ A;  1A34 A;  3BPS A;  1OVS A;  1QJX 3;  2WSU A;  2BGO A;  3ES4 A;  1OUX A;  4HKW A;  1VMH A;  1VP6 A;  3N9O A;  5IK8 A;  1DGW X;  4XF0 A;  1IS4 A;  2HWE 2;  1L7L A;  3J7H A;  3LEG A;  1C28 A;  2XL7 A;  4PDW C;  1POQ A;  1L3J A;  2VM9 A;  4A6O A;  5FY8 A;  4OHY A;  2XG3 A;  2Y33 A;  5LZ6 A;  4XUN A;  3KHC A;  3ZYH A;  4MGY E;  4B4Q A;  3I3D A;  3TWI A;  1FX5 A;  4KWL A;  2Z4F A;  5FAX A;  4OQ8 A;  3TN9 2;  2VY0 A;  3VKL A;  1SLB A;  1OPO A;  2XJQ A;  1VR3 A;  4NMI A;  1YQ5 A;  2MEV 3;  4I30 A;  3VBR C;  4YZ2 A;  4JZR A;  1UAI A;  5A3T A;  3ZIX A;  2W87 A;  1E5R A;  2VOX A;  3LB9 A;  1YJL A;  3ZXE A;  4A7Y A;  1A8M A;  1DCS A;  1POV 3;  1JTZ X;  2C4X A;  3LF7 A;  1OKO A;  2JDN A;  3PUH A;  5T52 A;  3WF0 A;  4FCA A;  3GZT B;  4LO7 A;  2J1E A;  4PQ9 A;  2F4L A;  3FMG A;  2ZEZ A;  2VU9 A;  4LA3 A;  2JWP A;  3ZX7 A;  4I09 A;  5DDJ 1;  4OUL A;  1I9R A;  4CDU C;  3T1L A;  2R04 1;  4GJZ A;  4NAM A;  3ZFE A;  1NCR B;  4AWD A;  2YC4 A;  1X50 A;  5K0U A;  1H0B A;  1YEW A;  1LR5 A;  2JG8 B;  5A3L A;  5AVA A;  2EXJ A;  3NJZ A;  1NG0 A;  2WNO A;  4HBN A;  3H8U A;  1S1A A;  3KWV A;  3LFM A;  1CPM A;  1T2X A;  4IV3 B;  4LIU A;  4QQ2 A;  1C1F A;  1ND2 A;  2Q1Z B;  1FXZ A;  2VMC A;  3NAP C;  3RS6 A;  1TQ5 A;  1OHF A;  2EAK A;  1TEI A;  2A3Y A;  3WCS A;  1NQD A;  3KD4 A;  3OJB A;  4LBL A;  4DY3 A;  1OLM E;  4ES9 A;  5BNO B;  1V00 A;  2VNV A;  2NYY A;  4XFA A;  1OKQ A;  1AR6 1;  4MX3 A;  4Q4Y 2;  5FZH A;  5BPX A;  4BOW A;  1N47 A;  2ZAA A;  4F8A A;  2XHN A;  4YW7 A;  4DPN A;  1HLC A;  2R16 A;  2J1U A;  2VVF A;  4AQ2 A;  3HBK A;  3S0M A;  1COV 1;  1ULC A;  2UU8 A;  4OI0 A;  3MIF A;  1DQ1 A;  2GDF A;  3T0B A;  5IVF A;  5DG1 A;  4KU7 A;  3I3M A; 
#chains in the Genus database with same CATH homology
 1JU4 A;  2RJ2 A;  1TG7 A;  5EJ1 B;  3DEC A;  5HPO A;  2JKX A;  5HXM A;  3FN9 A;  1GMM A;  5IYY A;  2W3J A;  2J1T A;  3HOB A;  3I2G A;  3T08 A;  3GXU A;  3CQO A;  3UES A;  1YQ2 A;  1JZ8 A;  2C9K A;  3MV0 1;  2X05 A;  3LE0 A;  2W91 A;  4JX0 A;  3WNM A;  2WAA A;  2X10 A;  1UY1 A;  4MO3 M;  4GWJ A;  3OB8 A;  4LKS A;  1NKG A;  1US2 A;  1PMJ X;  4RN5 A;  4A41 A;  2XON A;  3OEB A;  2W94 A;  2WBK A;  2HYX A;  1W8N A;  3VD4 A;  1NAE A;  2VZ1 A;  1EUU A;  2E32 A;  4DUW A;  3C7E A;  3MO4 A;  1UZ0 A;  2V5D A;  1OF3 A;  1W99 A;  3ABZ A;  1UYZ A;  3C7O A;  3WEZ A;  4E8D A;  2DCJ A;  5EIY B;  3VD7 A;  5FUI A;  3CMG A;  3ACH A;  2J22 A;  2HLE A;  3HPN A;  2LS6 A;  2Y6K A;  2WAO A;  4JKL A;  3WNL A;  3HJR A;  4CVU A;  2XOM A;  4ZXE A;  2E33 A;  3K4A A;  1GU3 A;  1UYY A;  1WCQ A;  1OH4 A;  2X09 A;  5LCW L;  4A45 A;  2QQJ A;  3DYP A;  4QDQ A;  1CZT A;  4W4Z A;  2B4K A;  3P6B A;  2VZV A;  2WO2 A;  2EIE A;  2VME A;  1IQD C;  2E31 A;  5C70 A;  2VQT A;  5JUV A;  5IFT A;  3E1F 1;  2VCC A;  3LQC A;  4ZY9 A;  1JI6 A;  2ZXQ A;  3I97 A;  2RVA A;  5G05 L;  4LHS A;  4DXR A;  3AC0 A;  1UXX X;  1JZ7 A;  3F2Z A;  3A21 A;  3T0D A;  4BXS V;  2WUH A;  4JHZ A;  2WQ8 A;  1W0N A;  3CZU A;  4MGS A;  3I2I A;  3HNM A;  5B4X A;  2VZU A;  4Z2A A;  1JZ4 A;  1L7Q A;  1DYO A;  2ZEX A;  4PT6 A;  4M4R A;  4CUA A;  4P5Y A;  3D3A A;  4MOA A;  2LW8 A;  3MBW A;  4PQQ A;  2W1W A;  1RYY A;  1F4H A;  3VD3 A;  2VL4 A;  4MAD A;  2Y6H A;  2W95 A;  1JYV A;  1H6Y A;  4PF1 A;  4BJ0 A;  3ACF A;  5C7G A;  1NUK A;  4JKM A;  1JZ2 A;  3NQH A;  4LPL A;  5JMO A;  2KD7 A;  3C7H A;  2VCB A;  4UI9 L;  3A7Q A;  3VDC A;  2E26 A;  4AG4 A;  4XUR A;  4XUO A;  1P8J A;  2PQS A;  3A22 A;  1JYX A;  2WAB A;  1K45 A;  3LEK A;  3WSO A;  4A4A A;  5CYY A;  5G04 L;  4OYU A;  1GOH A;  5B4N A;  1JU3 A;  3OGR A;  2V4V A;  1OT5 A;  2W9X A;  1PX3 A;  4M4P A;  2VMF A;  4ZZ8 A;  1J83 A;  3SKV A;  4L0P A;  3A23 A;  4CUC A;  2W92 A;  2J7M A;  3ACI A;  4XUQ A;  4QB2 A;  2RV9 A;  3OGS A;  1KEX A;  4TTG A;  2QQN A;  4A3Z A;  1UY4 A;  2VZS A;  1XNA A;  2Y8K A;  2YFZ A;  2CDO A;  1TVG A;  2VO5 A;  4OUE A;  1O8S A;  3ZM8 A;  1UXZ A;  3T09 A;  4DUX A;  1H6X A;  5IJR A;  3THD A;  3FHQ A;  4HG6 B;  3DYM A;  3ECQ A;  3VDA A;  2BBA A;  3I3E A;  3I2K A;  1JZ6 A;  2VOT A;  4BK4 A;  4MGQ A;  2W1Q A;  4DXS A;  2WO1 A;  1L7R A;  4QPW A;  2J1R A;  4QX1 A;  2L9L A;  1ULO A;  4CU9 A;  2YB7 A;  4W50 A;  3WF4 A;  4UOJ A;  1BHG A;  4A44 A;  5JXG A;  3HNY M;  4DUV A;  3IDA A;  4QDR A;  5DQ0 A;  2QBX A;  1UX7 A;  5DMY A;  1XPW A;  1UY3 A;  3HEI A;  3LPF A;  4QX3 A;  3WF3 A;  5IFP A;  3ETP A;  5LA2 A;  2W46 A;  4W8J A;  1UY2 A;  3SEP A;  3K75 B;  1DLC A;  2J1S A;  2Y64 A;  4XUP A;  5I0D A;  3CZJ A;  3IB3 A;  2BGP A;  1JZ5 A;  2WZ8 A;  4BDV B;  1XC6 A;  3T2O A;  1MPX A;  1O8P A;  2QQI A;  5C71 A;  2CDP A;  1JYW A;  5J1X A;  3I2J A;  4FI9 A;  4KI5 M;  3GGL A;  1W9W A;  2JE8 A;  1EUT A;  1UMH A;  2VZQ A;  3FHA A;  5F7U A;  1GQP A;  1SHW B;  2J1V A;  3MUY 1;  3SKJ E;  2ORX A;  2JD9 A;  4OMC A;  2VCA A;  5JXI A;  3BGA A;  5JXH A;  1CZV A;  2VZR A;  4D0Q A;  1JHJ A;  2DDU A;  2VZO A;  2VR4 A;  3GM8 A;  4ET7 A;  2JDA A;  1R64 A;  1K12 A;  4BK5 A;  1NX9 A;  2QQO A;  2WYS A;  3K4Z A;  5JXJ A;  3HNB M;  4XZU G;  2Y6G A;  2EIB A;  2W5F A;  5EJZ B;  3BN6 A;  3I3B A;  4CU6 A;  3MUZ 1;  1JZ3 A;  1PMH X;  1LNS A;  1JYN A;  3K46 A;  1CZS A;  1DP0 A;  1OF4 A;  1W9S A;  3EB7 A;  4KMQ A;  3VD9 A;  3I2H A;  1O59 A;  3OGV A;  3U37 A;  2VZP A;  2YC2 A;  1KGY A;  5DPN A;  1HN1 A;  2QQK A;  3CIH A;  3FL7 A;  3IAP A;  3SEE A;  4QAW A;  2J1A A;  4QDS A;  3WNK A;  2WZE A;  4ARY A;  2EIC A;  3T0A A;  3GDB A;  1J84 A;  2WO3 A;  3K4D A;  2W1S A;  1CIY A;  2VQU A;  4UAP A;  1F4A A;  2DCK A;  1W9T A;  2EID A;  3WNP A;  3THC A;  1CX1 A;  4QX2 A;  4QB1 A;  2YG0 A;  4ZZ5 A;  2W47 A;  1ULP A;  3C7F A;  4CU7 A;  1SDD B;  4ARX A;  3LPG A;  4IUG A;  2WN2 A;  1PX4 A;  2WN3 A;  3NJX A;  2QQM A;  2ZEW A;  1UY0 A;  2ORZ A;  3WF2 A;  4D8M A;  2Y6J A;  1GOG A;  4KWU A;  4DXT A;  3OEA A;  1I5P A;  3C7G A;  1WKY A;  1UMI A;  4YPJ A;  4QX0 A;  3NJV A;  5CZK A;  2VC9 A;  1D7P M;  3CKH A;  3K77 A;  3HN3 A;  4OMD A;  2VMD A;  2ID4 A;  3MV1 1;  3LEI A;  3VD5 A;  3WNO A;  4CUB A;  3NNG A;  2BER A;  4GWI A;  3DYO A;  4CU8 A;  2BGO A;  3OG2 A;  4OZO A;  4LQR A;  3LEG A;  3J7H A;  3ACG A;  3VDB A;  2VM9 A;  4A6O A;  4P00 B;  1GNY A;  4XUN A;  3JXS A;  3I3D A;  4QB6 A;  2Z4F A;  1US3 A;  2QQL A;  4GZ9 A;  1GOF A;  3CDZ B;  1XNT A;  4XUT A;  1SG3 A;  2W87 A;  5LA1 A;  3IAQ A;  2C4X A;  4RYD A;  3T2Q A;  2W1U A;  1GUI A;  5A1A A;  3I2F A;  3PUH A;  1UYX A;  4A42 A;  3WF0 A;  2BZD A;  2R7E B;  3UNP A;  2VZT A;  2J1E A;  2ZEZ A;  1W8O A;  3NRU A;  5DN2 A;  2VZ3 A;  2ZEY A;  2VTF A;  3C8X A;  2XQX A;  1K3I A;  3T2P A;  2YC4 A;  4XVH A;  2YFU A;  5LA0 A;  2OKX A;  5IHR A;  1T2X A;  3P1I A;  4AAX A;  4E8C A;  2VMC A;  3OBA A;  4JKK A;  2C26 A;  3WNN A;  3W5N A;  3UET A;  2V72 A;  2B9V A;  2XHN A;  3WF1 A;  2Y6L A;  2VJX A;  4P02 B;  1OD3 A;  3W5M A;  2J1U A;  3PUI A;  4TXW A;  4P08 A;  5JR2 A;  3EYP A;  1UWW A;  3III A;  4DEV A;  3T0B A;  1K42 A;  3WQB A;  4DEQ A;  2WDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...