2J1RA

Structure of a streptococcus pneumoniae fucose binding module
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1rA00
1D7PM 5EJ1B 5LA1A 2VMCA 1UMIA 3C7GA 3WEZA 3MV11 5IYYA 2VM9A 3DECA 3IIIA 2VZPA 1GU3A 3GXUA 4LKSA 1TVGA 4QX2A 2HLEA 3VD5A 2VZTA 3WNNA 2ORZA 2W5FA 4M4RA 1J84A 2LS6A 4JKKA 1ULOA 3LPGA 3A7QA 1GOFA 1IQDC 3IAQA 3JXSA 1JZ3A 2QQJA 2YG0A 1W99A 3K4DA 2LW8A 5DPNA 4CUCA 3OEAA 2E31A 2YFZA 3I3DA 3WNMA 4P00B 1KGYA 1W9SA 2QQIA 3WF0A 4GWIA 1RYYA 1GQPA 3F2ZA 1UX7A 4UI9L 3ACIA 1CZVA 3HJRA 3IDAA 1H6YA 2YB7A 2ID4A 3J7HA 3NJXA 4DUWA 2ZXQA 3HNYM 2VZOA 3DYOA 2QQKA 3UESA 2BERA 5G04L 2VC9A 1UWWA 2YFUA 4OYUA 5DN2A 2WDBA 4RN5A 2W92A 2DCKA 4JHZA 2DDUA 3I2GA 2X10A 2WO1A 2Y64A 3WNPA 5IJRA 1HN1A 2VMFA 2ORXA 2VMDA 2W3JA 5JXIA 2W46A 5I0DA 3VD7A 4DXTA 5CYYA 3AC0A 1PX3A 2L9LA 2QQMA 2CDPA 3ABZA 4D8MA 2V4VA 2WZ8A 4E8CA 4QAWA 1TG7A 1OD3A 3LEIA 3EB7A 1NAEA 3DYPA 5DQ0A 4XUPA 5IFTA 3LEKA 2W95A 3ACHA 2WUHA 3WF2A 2VQTA 2XOMA 3NJVA 5C71A 4LHSA 1W8NA 5DMYA 3OGRA 2J1TA 5LA0A 3I97A 5G05L 4TTGA 2W1WA 1OF3A 1OF4A 1P8JA 2B4KA 3UETA 2VJXA 3E1F1 2JD9A 3MUY1 2JE8A 2J1SA 2QQOA 4CVUA 3T2OA 2JDAA 1PMHX 4MGQA 3FHQA 2J7MA 1O8SA 1EUTA 4P08A 3VDAA 3A21A 1CX1A 1JYXA 1GOHA 3VD3A 4DUXA 1LNSA 3SEPA 1JZ6A 2E26A 1JYVA 4DXSA 3VDCA 1JZ5A 1CZSA 1GMMA 3OEBA 5F7UA 3T2PA 2V5DA 2E32A 2W1QA 2WQ8A 1UY1A 1W9TA 4MOAA 3HPNA 3GGLA 1OT5A 2J1AA 1H6XA 5C7GA 3FN9A 1BHGA 4CU9A 2RVAA 1W9WA 1UY4A 2QBXA 4ZZ5A 4Z2AA 4BXSV 2W1SA 3THDA 5JXJA 4QDRA 2VCAA 3W5MA 1UMHA 4CUBA 2J1RA 3I2KA 4BDVB 2J1EA 1CZTA 1NUKA 3ECQA 3I2FA 1XPWA 1GNYA 4P5YA 2Y6KA 4M4PA 1R64A 3CQOA 3I3EA 4JKLA 2J1UA 3ZM8A 5JMOA 1DLCA 2X05A 4QDQA 2ZEZA 4QDSA 4ARXA 5HXMA 4XUOA 2EIDA 3CDZB 4LPLA 4XUTA 4L0PA 4A42A 2ZEYA 4LQRA 1WCQA 4AG4A 3OBAA 4DUVA 4GWJA 1SDDB 3HNBM 2BBAA 3OB8A 3WSOA 3K4AA 2ZEXA 3A23A 3IAPA 1ULPA 4A3ZA 4XVHA 1JZ2A 1WKYA 2Y6JA 2VTFA 2VOTA 4W8JA 4CU6A 3T0BA 4KMQA 1JYWA 1SG3A 3NNGA 2W94A 4KWUA 4BK5A 3WF3A 1KEXA 2OKXA 2VMEA 5JXHA 2C4XA 3C8XA 1O59A 4FI9A 4A41A 2B9VA 1I5PA 5EJZB 2VQUA 3CKHA 4CU8A 4OMDA 1DYOA 4PQQA 2VZSA 3CMGA 4UAPA 4DXRA 1UY2A 5JXGA 1GOGA 3U37A 1J83A 4DEVA 1L7RA 1UXXX 4QB2A 3SKVA 2VZ3A 5JUVA 4GZ9A 2WYSA 2R7EB 3HOBA 3T0AA 2QQNA 3MV01 2XQXA 3MO4A 4A4AA 3UNPA 1XNAA 2C26A 3WF1A 4QX3A 2EICA 4HG6B 3D3AA 1NKGA 1JZ7A 1SHWB 2W1UA 3I2JA 4QPWA 2VZRA 5LA2A 2Y6HA 2VZUA 3WF4A 2C9KA 1K45A 5FUIA 2WAAA 2J22A 5LCWL 1JU4A 2CDOA 2QQLA 1K12A 2PQSA 3FHAA 3PUHA 2EIBA 3P6BA 1NX9A 2WZEA 4UOJA 2WABA 4OMCA 1EUUA 1F4HA 2V72A 2WN2A 1CIYA 1UY3A 3T09A 2WBKA 2W87A 3CZJA 4XZUG 4ET7A 4BK4A 1L7QA 3BN6A 2EIEA 2W91A 3MUZ1 4W50A 2E33A 2KD7A 1XC6A 2BGOA 4D0QA 1OH4A 1UXZA 3PUIA 4QB1A 5IHRA 4A6OA 1UZ0A 3SEEA 1JI6A 3P1IA 3EYPA 3OGSA 4MGSA 3I3BA 3K77A 3I2IA 1UYZA 4A45A 3HEIA 3ACGA 4ARYA 1W0NA 1JZ4A 1W8OA 3OG2A 4XUNA 3NRUA 4XURA 3MBWA 2VZVA 3C7OA 2XHNA 2WO2A 1PMJX 4IUGA 4AAXA 3W5NA 2VZQA 4YPJA 2HYXA 3CIHA 2YC2A 4E8DA 3NQHA 2RJ2A 2Y6LA 3LQCA 1K42A 2YC4A 3IB3A 1MPXA 3THCA 4XUQA 4CU7A 2DCJA 4QX1A 3OGVA 3T2QA 3I2HA 3LE0A 3T0DA 4PT6A 1T2XA 2X09A 2RV9A 3WNKA 4QX0A 4CUAA 3VDBA 1UYYA 2WAOA 1UYXA 5IFPA 1F4AA 1JZ8A 3K75B 3A22A 2Y6GA 4JX0A 4OZOA 3WNLA 3SKJE 5C70A 2W9XA 1JYNA 2WO3A 2Y8KA 5JR2A 4P02B 2JKXA 4W4ZA 3LPFA 1US3A 3HNMA 3C7HA 4ZXEA 3K46A 4JKMA 4RYDA 3ACFA 4KI5M 3BGAA 5CZKA 1XNTA 1O8PA 4BJ0A 2VL4A 1K3IA 4OUEA 4DEQA 5HPOA 2W47A 1YQ2A 3DYMA 3ETPA 2VCCA 3LEGA 3WNOA 1US2A 4QB6A 3VD4A 3GM8A 4PF1A 2BGPA 3T08A 2J1VA 2XONA 4A44A 2ZEWA 2VO5A 3GDBA 2WN3A 4MADA 4MO3M 5A1AA 1JHJA 1JU3A 1GUIA 2BZDA 3HN3A 4ZY9A 5J1XA 1DP0A 5B4NA 2VZ1A 5EIYB 3C7FA 2VR4A 1UY0A 4ZZ8A 2Z4FA 3CZUA 3WQBA 3VD9A 1PX4A 3C7EA 3FL7A 3K4ZA 5B4XA 2VCBA 4TXWA
chains in the Genus database with same CATH superfamily
5BUVA 1NLQA 1OLRA 3LSDA 2O8OA 3M2MA 3WHTA 1C1FA 4AQ2A 3FFZA 4TN7A 4FPGA 5ABJA 3BIWE 3UK9A 1EPWA 4FOQA 2RS51 3B01A 3ZYBA 3ZVXA 5JZGA 5LA1A 3ZLIA 2LUWA 5EYXA 1FX5A 4D3WA 2R0HA 4HFSA 5LZ6A 3WEZA 1ZA4A 3MV11 4YFWA 3DECA 3ACLA 1H8TB 1GU3A 4LKSA 2VOXA 4O9EA 1XQNA 2XMLA 1QJX3 4FFHA 4R4ZA 4BISA 5FWEA 2Q30A 2WR9A 1ZRRA 2VZTA 1W6OA 4QPGC 5E1RA 3ZYIB 2ORZA 3B5LB 3KGLA 4X6QB 4RR3A 5FZ0A 1O4YA 2D7FA 1CAWA 2VULA 5FP3A 5FYBA 1KFUL 1W39A 3K4DA 2YMZA 4CDQA 2VPVA 5LK7B 3BU7A 1AXZA 1HIXA 4QHOA 2E31A 3I4IA 3MDPA 1GP4A 4NJ4A 5JOZA 1NA1C 1R1A3 5F2SA 3H8OA 3P3NA 4Y1VA 2EAAA 2YGMA 5A7QA 4LBKA 4UI9L 1N1VA 1I3HA 2AEZA 3ACIA 2XLFA 2YB7A 4B8EA 4DUWA 2ZXQA 4OQ8A 1AHSA 2TEPA 3SC7X 1CAUB 5CA6A 5GZCA 2WNVB 4JRLA 2A1XA 1O6UA 2VC9A 1SBEA 5GKAC 1LCLA 1UWWA 2PHTA 1MS3A 2R061 3RYRA 1LEMA 5A7PA 3TRSB 4JHZA 3SNMA 5IVJA 4FAGA 1GNHA 3CBNA 1ASJ2 1QU0A 2QZ3A 1O4ZA 4IEZA 5D21A 2VMFA 3ZYPA 1N1TA 2ORXA 1MQTA 3TN92 2GZWA 3LOBA 2XL7A 2UURA 3AP6A 1RUH1 4K8FA 4Q8KA 2OX0A 2P3IA 4P9JA 3VD7A 4F83A 1C57A 5E6HA 1CAVB 3OUHA 5KBFA 3HAGA 4LK7A 5JOWA 3OPTA 5L36A 1Q3EA 2L9LA 3ORJA 4HVOA 1LGNA 4N43C 3INAA 1UN1A 1D2SA 2CDPA 2D6KA 1YFXA 1D0GA 2D43A 3WR0A 4E8CA 3VBFB 2EIGA 3PMSA 4YNIA 4NE9A 5GM0A 4AVTA 3SH3A 5EYYA 2W95A 1S55A 3JQWA 5E16A 1A8MA 3PDQA 3NNJA 4NHXA 1HB3A 5FZEA 1WBLA 1RHI2 4YZ3A 1QMJA 4XYXA 5F3IA 5FUPA 5KR7A 3WW2A 3RWKX 3I8TA 1V6JA 5G05L 2WZR1 3ASIA 3FUOA 4BQ4A 3H7YA 2IXLA 4DQAA 1KQRA 4CDXA 1P8JA 4LKDA 2C5DA 1IS3A 1OI6A 3UETA 2ATFA 1LESA 4BIFA 2YPDA 4M3CA 2Q5TA 5T5JA 5DZEA 5BNNC 3TB0A 4CVUA 4NHMA 3T2OA 4WVMA 3IIAA 5A3LA 2JICA 3WZ1A 4Y4RA 1IGOA 2F4LA 5CU1A 2CWSA 2G9GA 3ELNA 4Q0SA 3ZSJA 5L9BA 2YBSA 4UF0A 3VDAA 3MEPA 1CX1A 2YBPA 1DQ4A 5EPAA 2ERFA 1JYXA 3WHUA 3VKFC 4HVRA 5FXXA 5IVFA 1EV13 2WC2A 3VDCA 4IEYA 2IXJA 2TNFA 1CZSA 5FYYA 2A3XA 4NHLA 4NR1A 5K0UA 4JVAA 3IN9A 4YG0A 3RFRA 4IEWA 5IK5A 1IOAA 4GJYA 4XFGA 1OMIA 1NXD1 4LLFA 3T2PA 1ZZ9A 2Q1ZB 5A3MA 3U1XA 1S2KA 4ITCA 1JHNA 1ZBE3 4NRMA 1UY1A 3NW4A 1W9TA 4LHNA 3NL1A 1UKRA 3O5SA 3HPNA 5H9SA 1YEWA 4XZPA 1WCSA 2DFCA 5FREA 4LHKA 2NMOA 4YZ1A 1VAKA 3QLQA 3FHIB 4GALA 5FY1A 4CU9A 1ODNA 2RVAA 3MIEA 1E5HA 1UY4A 3LD8A 1DLLA 5T55A 5FZ8A 4UWDA 2R043 5CEHA 1LJ7A 5JXJA 1Y4WA 2V09A 2B8MA 4QDRA 4HKWA 2VCAA 3W5MA 4COZA 1UMHA 4CUBA 4HZFA 2VXRA 3GHMA 1LHOA 1RINA 2J1RA 3J8F1 3OD0A 5KXBA 3O1OA 3AZVA 4XXPA 5IK8A 1GNZA 4Q4W1 1IKPA 1NUKA 2P3JA 2D6LX 3I2FA 2Y34A 3QH7A 4DMIA 1BK0A 3LKJA 4Q26A 1Y9MA 4RQPA 1UKGA 2BNNA 3SCFA 3SCGA 4XF3A 4IETA 4Q4Y1 3CU7A 3I3EA 3VBHB 5TSWA 5DAPA 1YI9A 5JMOA 5EHDA 2VCMA 1DLCA 4DS0A 4DINB 4Q4W2 2KR2A 2ZEZA 3A0KA 3RJRA 1H1MA 1S0GA 4AHYA 2QCSB 4UFKA 5JVVA 3VHRA 1PGL1 4AI8A 4XUTA 2J42A 1VBC1 4L0PA 3AP4A 2BOIA 5IAXA 3POSA 3DPRA 2ZEYA 3V64A 4LQRA 4AG4A 1H9WA 2R49A 2OW4A 3I2DA 2C1FA 2K2SA 3OBAA 3PVNA 3ZXGA 3HNBM 2BBAA 4M3CF 3WDYA 1JYIA 1K5MA 3OB8A 1NYWA 3I7DA 2FBEA 5D8AB 4EZHA 1Q43A 3AKTA 3WSOA 2A70A 3OYWB 1W8FA 1IPKA 2YUEA 2ZEXA 3A23A 1C8M1 1S0IA 4I0BA 5FLJA 5FY7A 4OFGA 4OULA 1ULPA 1AZDA 4YRDA 1AYM1 4A3ZA 4XETA 1UMZA 1IG0A 4DXZA 5FYTA 3MIGA 3D0JA 5EQUA 2O14A 1WKYA 4TSVA 4HVQA 4R9BA 3AKPA 1QGLA 4CU6A 4CP1A 3T0BA 3AFKA 1S0FA 4Q4X3 1OBNA 1RJ8A 4AHZA 5IATA 4LOTA 3ES1A 4J6GA 4KGGA 2ETEA 4DOUA 5C8CA 4TWTA 1Q8OA 1UNBA 1PO11 3HBZA 3D82A 2C4XA 3C8XA 3UYJA 1OKOA 3VZJA 3P3PA 4KG0A 1J1TA 3WLUA 1B09A 4CUGA 4RS5A 4QU2A 2PHDA 4A41A 2DU1A 5T50A 2QQUA 4JDNA 2VVFA 1OA4A 2JENA 2RM23 4OMDA 2ZGMA 4KU7A 4ZU5A 3POJA 4IV3A 1PO12 4AXOA 1NZCA 1WCDJ 3FLPA 4OHWA 3SITA 1GLHA 1QEXA 1X33A 1CIWA 4DXRA 1H1AA 5AC93 1O91A 1DZTA 3OD4A 4LBOA 1DQ0A 1POV3 2F6BA 2MPFA 4HONA 4FVVA 5DDJ2 1V6KA 5HXVA 1UXXX 4QB2A 3SKVA 3G6JB 2VZ3A 4OUMA 2OUJA 5JUVA 3AKRA 2WA4A 3BTAA 2HWB1 1BKZA 2WYSA 3HQRA 5FPLA 4OQ9A 4CXXA 2QUOA 3MV01 4IE5A 3PNAA 4LO8A 1UIJA 3WW3A 3UNPA 3RSJA 5FYIA 3BIEA 2XDVA 4BQ2A 1COV3 2EICA 3AZXA 1HRV3 4HG6B 4E27A 1SHWB 3NAPA 1AL23 2FCTA 2W1UA 4UXAA 1ZRCA 3ETQA 2K46A 2VTXJ 5J98B 3ZYJB 4FTBA 4QGLA 1POQA 5A1FA 3HR9A 3V0BB 4QM8A 4BOWA 4MV2A 3MYXA 1TE1B 4MXVA 1DGRN 2J22A 3GZTB 1JU4A 2P34A 3GYDA 2AGSA 4LIVA 1GZTA 1CVNA 2KXLA 2P2KA 3M3OA 5CKMA 1KS5A 3ZFEA 4XHXA 2HWD1 5H9QA 1DQ1A 4CDUA 2AENA 5DABA 2PQSA 3FHAA 5FZ3A 2EIBA 2NYYA 1YO8A 3RMXA 1W0PA 1QJX2 4URTA 1OKQA 3KGZA 3K51A 1QJY3 1EAH1 2OS2A 1OURA 1EUUA 3VL9A 1DQ5A 4L92A 2HWD2 3JBG3 1GV9A 2BNMA 3KZ4C 2VOWA 4HKOA 1W6NB 4B1LA 1UY3A 2B7YA 1GP5A 1OFSA 2WBKA 3CZJA 4XZUG 1EAH2 4KNCA 5FP4A 1L7QA 5F5CA 3ZXJA 2EIEA 2GDFA 5FK8A 5FPVA 1VBE1 2JG9C 1X82A 2ZBJA 2CWMA 3DL3A 4NHYA 1LKNA 2MEV1 5JI7A 4PIYA 3N9MA 3E97A 2BGOA 3FE5A 1APNA 3GHNA 3HT1A 4SBVA 5A32B 1OH4A 1QH7A 2X5IB 4HN0A 4LNVA 1HB1A 1ENXA 5FO9B 1VR3A 4HLTA 1SFNA 1Z78A 1ZBA2 5IHRA 3I3BA 2IXIA 3BVCA 2ADEA 3K77A 1JOJA 2MEV2 2VMHA 5FPBA 1F8VA 2DCTA 3MF9A 1MVEA 3PHMA 3WX5A 1Z7S3 3ACGA 1BVVA 3OGGA 5F1RA 2FCVA 2HWF2 3DV8A 2ZKLA 5E89A 4AVBA 2PELA 1ZM1A 4XF1A 4WVZA 5FZ4A 4CEWA 3W59A 3V65A 3ZFGB 1C5HA 4HK8A 2XHNA 3T3YA 3RZZA 4Y5TA 3OCPA 3OY8B 1AX1A 4NIGA 4AAXA 3W5NA 3NJYA 1OOPC 2VW1A 4YPJA 3LSEA 2BP6A 1AX0A 2HYXA 3AYAA 4IEXA 4L99A 2WWUA 3AJYA 1JMUB 1H8TA 1W2UA 1XYOA 4QQPA 1XSRA 2VQAA 1XSQA 2QDNA 2RJ2A 3ZXFA 3AKSA 3D4KA 4HOOA 4RGGA 1J1LA 4PLNA 1VP6A 2UWBA 5I8YA 2WRAA 2WFPA 3IB3A 1WCKA 3THCA 4IL7A 5SV5A 3H50A 3IDBB 3NKGA 1FNZA 1H0BA 3NSTA 4ONUA 3OGVA 4NAOA 1ND3B 1YRZA 1KDMA 3T1MA 3I2HA 2VNOA 4AEKA 3QD6A 3M3QA 2ES3A 2VVEA 3LE0A 4FXKB 1T2XA 4R9DA 5FLIA 3WNKA 1RUNA 2DUQA 4QGMA 3LIGA 3VDBA 1UYYA 4F3JA 2WAOA 1B35C 1PK6B 1RUF3 5FP7A 1SPPB 3H3UA 2OYZA 3WDUA 3OPZA 2OA2A 4DNYA 4LIUA 3WP5A 5A33B 5F3CA 3BPSA 1XXNA 5A1LA 3JCIA 1F9KA 4E4DX 4OZOA 1RUC1 1C3HA 4GB31 3PTRB 5C70A 1WD4A 2ET7A 4FPCA 1O3RA 2W9XA 4I01A 2WYFA 2Y8KA 3UV9A 1WW6A 2FZ2A 1W2NA 5JR2A 1PHMA 2ZGSA 3TEXA 4IEVA 4YM0A 1ND2C 4EN9B 1I5ZA 3C7HA 3K46A 5DZFA 3A0NA 3PU8A 3ACFA 4QPIA 1M06G 2IFRA 1SLCA 4D94A 1OUXA 2ZACA 4HPKA 1POV0 2E53A 5JCTA 2A3YA 4O9GA 4OUEA 4Y20A 3U75A 3VN4A 2W52A 2X8KA 3OF1A 4D6RA 4JGZA 5HPOA 2ARBA 1Q8VA 1NQDA 2BJSA 1BBT3 1RMU1 3N9PA 2CYFA 4JRAA 5ANQA 5BY5A 1FNYA 4QB6A 2RDRA 3DGTA 2VMIA 5CAZA 2DCZA 2ZHMA 2K9ZA 4XQWA 1JH5A 1CAVA 2ZX2A 3GM8A 4R8HA 2QNKA 4QX7A 1H2LA 1G6NA 3SQOA 4YZ5A 1BEV3 4XMAA 5C8WA 2XONA 3VUOA 2WS93 4CEYB 4FSJA 2GAUA 4LE4A 1RMU2 4GZ9A 4L2NA 2PQQA 4DY5A 3PLQA 2BWCA 3B93A 2D44A 4K6BA 3VBFA 2RR11 2W68A 3AK0A 5FO7B 2P1BA 5F6LB 4XFHA 2R063 3HN3A 4PLOA 1DP0A 5FZGA 2R042 4K7JA 1AR73 4LBQB 3UKNA 3LIHA 4ZS3A 5EIYB 1CWPA 1N3OA 1RJ7A 2VR4A 4NHKA 1NA1B 2WLPA 2Y6FA 1AX2A 3VBUA 4K20A 1HQNA 3QH6A 1OFNA 1PX4A 1V9U1 3ITQA 4YGBA 3FL7A 3K4ZA 1AR91 3J4UH 4HT1T 4CCLA 2WIIB 4TXWA 2D5FA 2XWBB 1GBGA 3NV3A 1R093 3BOPA 4D7YA 2W0XA 4QQ2A 2JJ6A 4HSJA 3THPA 4AL9A 1V9U2 1CX4A 4W6YA 5EJ1B 1AXYA 1H1IA 2W08A 1STMA 1UMIA 1XYNA 1YNAA 2UYAA 1F31A 3M1HA 4GH4A 5FLHA 5CFDC 1LOCA 2E6VA 1Q8QA 1SLTA 1M4WA 2OZJA 3C7GA 4ISRA 1LR5A 1DIWA 1RUD3 5A7OA 3VBSC 5F37A 5IVVA 2Q8CA 2ZTNA 3IIIA 3CJIC 2JIGA 2WFF3 3ZPOA 2F17A 3PIGA 2ADDA 1TME1 4N7IA 4ATFA 3LFIA 1PNFA 4QX2A 3KT1A 5ACA3 3V0AA 3AYCA 2UYBA 2WZR3 4AFBA 4AFAA 5LATA 2PXJA 1GICA 2VMGA 4M4RA 3RDIA 4BHPA 5A7WB 3ZN4A 1ULOA 5BV6A 3AMPA 2IC1A 3A7QA 1JZ3A 2OQ7A 1RUE1 5DAWA 1TME2 4M00A 2LW8A 1DGRA 2RS33 4XFAA 5ABJC 4GQ7A 3GALA 4S2HA 3OEAA 3BOWA 2HWC3 2YFZA 4IESA 4MXWA 5GLVA 3O1RA 4PDWC 5JZGC 1YYNA 4GWIA 4ISQA 1RYYA 4YZ4A 3B3QE 3ROUA 1QJU3 1HXS1 2YU1A 1AUYA 1PGW2 2P17A 2VOKA 4BQYA 4YSFA 5DXDA 4FPLA 4P9WA 5J36A 2EXJA 1H30A 4XACA 4ZXKA 1ULGA 1ULCA 2PN5A 3WQ1A 2RM22 5FIXA 4IQPA 3HQUA 3DYOA 4FCAA 1UOGA 1X9TA 2BERA 1OQEA 4YVWA 2TUNA 4BQWA 1LHWA 5HCAA 3KSCA 5AC92 4LHLA 4OYUA 3DUIA 5DN2A 3USUB 4M0HA 2PTMA 4AVAA 3BB6A 4CDQC 1LOEA 2V4AA 3WP3A 3ILNA 3GZAA 5FPUA 4PIZA 2SBAA 5KHKA 1XE0A 5BNNB 3M8LA 3WNPA 3M3EA 1COV2 1FPN1 1MS8A 1RB8G 2D6NA 3WNXA 3CJXA 2W3JA 5JXIA 1PVC2 1O5UA 2QFEA 5GZFA 2W46A 4FPKA 4MVTA 5ERLA 5LBEA 1YXWA 4DXTA 1ZZ8A 2PHLA 5AVPA 4KWKA 2I45A 4YW4A 3ZFFA 2ZOEB 1ULDA 2NMNA 3RZMA 1N3QA 2OVUA 1VRH3 2Q1FA 3AYEA 3ZFGC 5F5QA 3I49A 1BQPA 3J8F3 5D8AA 2W39A 3HT2A 1QNYA 1GWLA 3ABZA 3DN7A 3ZYRA 5FK7A 4AI0A 4OI1A 2BUKA 1JTZX 4WVVA 2KM2A 4IXLA 3EB7A 1S4CA 2GMMA 2JX9A 1ZRIA 2QKDA 3H1MA 1Y43B 2IVJA 4Q4Y3 2X53S 2WUHA 4A7ZA 2DFBA 3RZHA 5CFCC 3W21A 2LTNA 2XOMA 3NJVA 1GFF2 4MGTA 1QJY2 4LHSA 1LHVA 3M7AA 2GP5A 1UOJA 1H8VA 1GKBA 1UZWA 1GWKA 1N1YA 2XBO3 1S1AA 3ZR5A 3I97A 1X7NA 1AVBA 4WM7C 1YIFA 2VUAA 1TMF3 3I59B 3JBG2 5EJ3A 4I3PA 4XBQA 3ZPYA 2DVAA 4Z1VA 2FQPA 1QDOA 1IG3A 1HB4A 2YPJA 3S7EA 4Y1UA 5L9RA 2G9FA 3SH4A 2B4KA 1E5RA 2VBBA 4EROA 3PUSA 4NWWA 4Q8LA 5HCBA 3E1F1 3LZZA 1W6PA 3NVCA 1R083 2VQ0A 2XKPA 3H3ZA 3ZSKA 3UGFA 1SDWA 1VLNA 5FP9A 4CCNA 3FUQA 1QQP3 4J1XA 3L2YA 3KT4A 4NN0A 4DPNA 1QNWA 3AXEA 1V6LA 3AYDA 4MUVA 4MGQA 5AFEA 3FHQA 4TZDA 5CADA 4WBBA 3BCWA 1O8SA 1UAIA 3LWCA 4EQVA 4Y22A 4KQ7A 1OC1A 2Q8EA 5C6CA 2UY8A 3MLLA 1GOHA 2QJVA 4DUXA 5I0DA 4FFGA 1PO23 4AEDC 4BQ5A 4DXSA 4EWDA 2Z2SB 5C3RA 5HV4A 4Q0UA 1J58A 3AB0A 2ILMA 3ZXEA 2FD8A 1UL9A 4F7ZA 5F7UA 1VBD2 2P6HA 3QOPA 1XNCA 4GKXA 1RUJ3 2V5DA 2JE9A 4XOGA 2W1QA 2C9AA 4FPHA 4GMP1 1C28A 1RUI2 1RTVA 2JB8A 1F5JA 3H1YA 5E8AA 4GD4A 1QOTA 3H9AA 3GGLA 1MACA 1OT5A 3ZMNA 1RL3A 2JDYA 4QGNA 5F39A 4BXFA 5C33A 1BHGA 3AX4A 2A71A 4JZRA 1W9WA 2AUYA 2RJKA 1DG6A 3N9OA 1OXCA 5FZLA 2BOJA 4CEYC 5FTTC 3NNMA 2KA3A 1JS9A 4QMAA 4BIOA 4AHWA 1LENA 5BNOC 3BI3A 3I2KA 4BDVB 4NOTA 2IVIB 2J1EA 1U0AA 3W20A 1CZTA 2D6OX 4C91A 5K0UC 2BTVC 2BVVA 2HKXA 3QBQA 2OPWA 5JI9A 1W6NA 3MIFA 4AVCA 3CF6E 4Q27A 3RVHA 4P5YA 2Y6KA 4IEUA 1NY71 1QDCA 1K5JA 4M4PA 4P9IA 5T5LA 2YROA 1A3KA 1AYN3 2ZZJA 1S0BA 3RPQA 1RUF2 4QDQA 3ES4A 4LA3A 3RWNA 1EPZA 1G8WA 1T6BX 3CDZB 3IPVB 1IS5A 2WINB 2FDJA 3HMYA 4MGKE 1NY72 2X5IA 1ASJ1 4RHV3 4S2GA 2VVDA 3HD8B 3ZKUA 1D4VB 2ZHNA 1BLZA 3FLRA 4GWJA 1SDDB 3TN91 2VUJA 5IVBA 4NIIA 4JCKA 3UGGA 3TYJA 2PHXA 3DXUA 2DBIA 2P5BA 1IHMA 5KXDA 1LULA 3IAPA 4LITA 5EWSA 5ACA1 5FZCA 1HX6A 5K9YA 4RQPC 4XFFA 5FY0A 3ZN6B 1ALYA 4BMEA 1W90A 5F3GA 2A73B 2R16A 4AZZA 2VTFA 1KS4A 3AL6A 3TOJA 5KXEA 3VV1A 1URXA 1BBT2 4UW3A 1RXFA 3VKLA 4N9HA 1LOAA 4IGQA 1FOD3 4BK5A 5FR3A 3KT7A 4R4XA 1KEXA 2OKXA 4KBZA 2EA7A 3C3VA 3WDVA 4FAHA 3OBTA 3NKTA 1BEV2 1RHI1 3R0RA 1MEC3 4XFBA 1H2MA 3KLSA 2WS92 2AEYA 1HRI3 1JXNA 1O59A 2VECA 1QJFA 2B9VA 4FI9A 4JAAA 1K5MC 2QTWB 1FMD3 4LKFA 4D69A 2PAMA 5C3SA 2XKOA 2ZGOA 3CKHA 1KRIA 1O4TA 1DYOA 4IE4A 1AJOA 1VMFA 4AE2A 4FFIA 4GWNA 1WW7A 2A75A 4NIAA 2AC1A 2ZMLA 1QJZA 3GNEA 3AKQA 2ARCA 4NIDA 5JXGA 1GOGA 1G9DA 1YLLA 1TNFA 1EY2A 2BWAA 2JG9B 5JDBA 3GBGA 4XBLA 4YW1A 4UFLA 1AR82 2QQNA 2XGXA 1PK6A 2XQXA 4RFRB 1XNAA 3JB4C 2ZGLA 4V1PA 3S5AA 4QX3A 5LY1A 3D3AA 3URFA 4CE8A 2WKKA 3POFA 1QWRA 2XPJA 2ZX4A 4RS5C 1R092 2VZRA 2Q8OA 4BQ1A 5FJKA 2GH8A 3RI9A 4FFFA 5FUIA 1YC61 1TZOA 3T30A 5JR7B 2E63A 2CDOA 3V56A 2EXIA 4B7KA 2PHWA 2VW2A 3HVDA 2JDZA 2ZGKA 2QQLA 1RUD2 2XG3A 5DAXA 2HYKA 2DCYA 2IXCA 5JPNB 4Y1YA 5GZGA 3FC0A 3G7DA 4Q1PA 2B39A 3N9NA 3PUHA 5I91A 3SLIA 1J3QA 5A3PA 1NX9A 2WZEA 2ZGUA 3E6CC 4UOJA 1OOPB 2WABA 4OMCA 5HBAA 1CGPA 1GZ9A 3KVBA 2RMU3 1PM4A 2FDGA 2Q4SA 3ZMOA 4KBBA 1AR63 3WY6A 3AM2A 4I0WB 4Q29A 4DZGA 1RUC3 3AL5A 4BB3A 2RS32 4QPGA 3T09A 2LROA 2W87A 4Q4V1 4UBHA 1FAYA 1NCRC 2Y0IA 5AVAA 2HWC2 4ET7A 4KGQA 1VBB1 3BN6A 5LBBA 2ZS6B 4WZCA 3RZGA 4EWEA 1S0DA 1SCRA 2W91A 5H9RA 4C8DA 1PIV3 4CDUC 1HV0A 1MZ6A 4LBQA 3GZUC 1RUOA 1SFYA 4Q4V2 3SHRA 1NA1A 1VBB2 3PUIA 4QB1A 5DUUA 1B35B 3BALA 1UZ0A 1F15A 1WW5A 2JD4A 3NV2A 4OI4A 4A6OA 1JI6A 3OBZA 4H3WA 1UPIA 3JB8A 2PYTA 5FCCA 5L9VA 4A6SA 4BYYA 1A34A 4NPMA 3WDWA 3ZKYA 4A2UA 4N90A 5FZOA 3QACA 2FDKA 5FXZA 3O14A 3HEIA 1W0NA 2RDQA 4D6QA 5FRAA 1XRUA 1W8OA 1ND2B 4XUNA 4XURA 1GZCA 3RQ0A 5BNPA 1LU2A 1GZWB 3M3IA 4NAMA 4J1WA 1FYUA 5E88A 3O0VA 1UO9A 5I8SA 4CCKA 3M3CA 4QKNA 3PJQA 3TNPB 1PMJX 1F2NA 4IUGA 4DY3A 1SBFA 5T5OA 3N4MA 1JW6A 4XF0A 2VXJA 4YW6A 1YFUA 4AI1A 2YC2A 2DF7A 2UWCA 3EJKA 5A7NA 2D3RA 1CONA 4Z2WA 1VRH2 3NQHA 3IDCB 1XU1A 3E5XA 1XNKA 2Y6LA 4ORFA 4FPYA 4YYOA 3LQCA 4LEJA 4AI9A 1K42A 3LA7A 4B29A 4Z92B 1O3SA 1VBA3 1GR3A 1ST8A 4RFT0 3LEMA 3S57A 2DYCA 2JXAA 2XJSA 4FPJA 2HWE3 2DCJA 3DF0A 4MYEA 4QX1A 1AL0G 1PGSA 4IV1C 1W8UA 4N43A 2PLV3 1XE8A 2ET1A 1N47A 1EP0A 1ENSA 3KF3A 4FP2A 3T0DA 1RVF1 1SQ4A 3KMHA 4WVWA 4XIKA 2IXKA 4YM3A 2XBO2 5IVYA 4CUAA 4EE2A 1W8HA 1MS9A 4P5HA 1TMF2 5KWRA 2CAUA 1QXRA 4CDWC 1JZ8A 4DB5A 5DDJ1 4N53B 2JB4A 4QWNA 4CCJA 3FLTA 1AF9A 1D4M2 2Y6GA 3L9JT 4GAZA 3LGRA 4JX0A 3WUCA 1RVF2 3JD72 5EV7A 4QHBA 3SKJE 1D0HA 1UW8A 2VE1A 4GKYA 4WM8C 4XPVA 1OQDA 2WO3A 3O1MA 5GLZA 1RUG3 2PFWA 3VBOB 2XVKA 4ZKTB 1IS4A 2ARAA 3N35A 5K4LA 4IERA 3TEWA 4JKMA 5C9AB 3UKVA 3BGAA 1VAVA 3K2OA 1XNTA 1W05A 2QQVA 4P9YA 1CAXB 1O8PA 1W6MA 2DV9A 2WNUC 2LM3A 2A7AA 5BNNA 3RI8A 4LE3A 3ALQA 1PO22 2W47A 1YQ2A 2CY6A 5CFDB 3DYMA 5LBCA 3VBSB 2C6SA 4BMBA 3ZXAC 1H2NA 4AW7A 5C4WA 1HXS3 3AP7A 3CJIB 3JU9A 2Q0AA 1U12A 1QJX1 3PTYA 1RUJ2 4PF1A 5IAVA 3KF5A 1V70A 4QU1A 2ZEWA 2CU5A 5L7OB 4D6SA 4AEMA 2WO7A 2R32A 5LEKA 3AVSA 5A1AA 2FMYA 4QPIC 4RL7A 1W2TA 1JU3A 2JG8C 4JGYC 4YVSC 3T4HB 4D7TA 2R073 4EZ4A 2GALA 4IW3A 5FPZA 4AI2A 3O0WA 5ABJB 1FV3A 4PDWB 5JZGB 4Q2FA 5DUWA 4FPEA 2Z4FA 4FXGB 5LA9A 1ZRDA 4F8AA 3CZUA 2DTYA 1DQ6A 3B9CA 1O3TA 1VPHA 2A6ZA 3VD9A 2G1MA 4B4QA 3DCQA 3I59A 3U14A 1D2QA 5JWPA 5B4XA 1MZ5A 2UY9A 4PIXA 1ZBA1 2VCBA 3U37A 1R1A2 1W6OB 4KU8A 5LW9A 4UFJA 1KXGA 2OZ6A 2RS13 3FZ3A 5BXXA 4C0BA 5A3UA 1CAWB 2JDPA 4FBFA 3PVOA 2E51A 3POWA 1UZVA 2VMCA 2Z79A 4CDQB 5KC6A 3J9SA 1LU1A 4EN6B 1PZ7A 2HWF1 1X36A 4N8MA 3OJBA 4RHV2 3P5BA 2YGLA 5IYYA 1NXMA 2GNMA 3ZSEA 5IK4A 2WQ4A 5I8TA 4HETA 3GXUA 3WW1A 2XJPA 4YM2A 1DHKB 3QCWA 2FMDA 3VKOA 5ISLA 2FDIA 1E5IA 1DBNA 3SMHA 4FP3A 5SV8A 3AMQA 4S2FA 3WNNA 5LY2A 2W5FA 2JECA 1NCQC 1IS6A 1V00A 2R30A 2XLGA 3VDDC 2A6WA 1SFPA 2H0VA 2LS6A 4JKKA 2P4EA 3JXSA 1GOFA 3LPGA 5FZ9A 3VHNA 2OT7A 2YG0A 5HCHA 1NE6A 5DPNA 4UT5A 3BTZA 4AFDA 2BPA2 2D40A 1ULFA 2I74A 4AF9A 3POYA 1EYBA 2BU9A 2PAKA 4I09A 1KGYA 1UOBA 4PJYA 3LOIA 4CCEA 1A8DA 1FOD2 4GH4C 1RGSA 2A6VA 1GQPA 3GF6A 3U4SA 3RYPA 5A80A 4UW4A 1UX7A 2QDRA 5CFCB 2Y60A 1CZVA 1ENRA 1MEC2 3HJRA 3IDAA 1LODA 2EXHA 1H6YA 3NJXA 2ID4A 4CP0A 3U0ZA 1FMD2 1PNGA 2ZX3A 1REFA 3Q8AA 4QPYA 4WM7B 2E7AA 3HNYM 5FXWA 5BNQA 4BWOA 4I2OA 2GMPA 2GC1A 3T1LA 2VZOA 2WWJA 4XF4A 4XJUA 1NZIA 3UESA 3LA3A 4AQTA 3K48A 1FT9A 4QT6A 2YFUA 4CCMA 2TBVA 4HXCA 1CJDA 3N7LA 3RNSA 2RS53 2VBPA 2DCKA 3FFQA 1Q8PA 2DDUA 2X10A 3HQXA 3SH5A 4AQ6A 4XTPA 5A6XA 5IJRA 4PBPA 1HN1A 3KHBA 4FOWA 1UPSA 3S5QA 1LGBA 4XILA 4E4ZA 2ZJCA 3B7MA 1BVP1 2WNEA 4XJ8A 1CAUA 2VGDA 2WNVA 2BFUS 1PGL2 4XABA 5IUQA 5I93A 5CIRA 2WQZC 3AC0A 4AEDB 4CTEA 2B42B 3IM0A 2QQMA 3ZO0B 3MLJA 4KWJA 4QM9A 1TNRA 1WW4A 4D8MA 4BQXA 4SLIA 4CPBA 2V4VA 2WZ8A 4YVWC 3SXWA 4CDXB 1JYCA 4LR4A 3ZN6A 1ZBE1 3LEIA 5DQ0A 3VBRC 5IFTA 1EV12 4J25A 4G9SB 4XUPA 5F32A 3PURA 4M3CB 2VNGA 1LECA 1LOFA 1TEIA 4K1ZA 4KL1A 2GN7A 1S0CA 1W8NA 4CXYA 3OGRA 1KJLA 4MGIE 3WVJA 2JIJA 1ACCA 1V6MA 2GSYA 3GJAA 2R041 4G3YC 4META 5FMCA 1ZBE2 3ATGA 4LULA 4BZ4A 3PU3A 5DG2A 3ZFFC 4TTGA 2W1WA 2JKBA 3PVBB 4P14A 4B7EA 4FOVA 4OHVA 4B1MA 5BNOB 2JE7A 4QXBA 3B9IA 2SLIA 3EMRA 4Y1XA 5CNAA 2R0FA 5GLTA 5K0UB 2JD9A 3Q9OA 3BPZA 1DGWA 4DRVA 3O1TA 3ZDVA 4C1XA 3NO8A 4E2QA 4N53C 2Z42A 2QQOA 1S0EA 2C24A 4LXLA 4AR2A 2JDAA 1NE4A 3W58A 1EUTA 3VBOC 3ZSLA 1FI2A 1RUH3 5KC5A 3A21A 5T5PA 4EYUA 3VD3A 4YFZA 2ZGQA 1PVXA 1JZ6A 1SEFA 4Y4YA 5A6ZA 2E26A 2B45X 5C9AC 1JYVA 3T2TA 5JPMB 1W2OA 2DVBA 4XBNA 1UOFA 4Y1ZA 3VLBB 3CEWA 4K21A 3VB9A 3OEBA 3Q8CA 4XCAA 1JOPA 1SBDA 5IT6A 4QQOA 3T08A 3O12A 3I2OA 3JQXA 3RRDA 3O1VA 5FBZA 3RGBA 2WQ8A 3O1SA 1OLME 3POEA 4RD7A 1VIWB 1L3JA 3PMEA 2HBUA 4RQPB 2N7GA 5LB6A 5C7GA 1H6XA 5JIAA 3AVRA 3FN9A 4FTSA 2BEOA 2MNGA 1KITA 2GU9A 5FZMA 2I07B 3J26N 1WBFA 1DZRA 3THDA 3ENRA 5L7OC 3MZHA 3R4SA 2ZZQA 4CRQA 4XFIA 3BTXA 3DPRB 1PGW1 2Q8DA 1XU2A 4S2DA 2HWE2 3KV6A 2EALA 3CNAA 4NMIA 1ZYBA 4Q4X2 1XPWA 1GNYA 1K5MB 3IMNA 2ZMKA 4XDPA 5C3QA 5A3OA 4L97A 2XH6A 2RM21 4DO0A 1RC6A 1W2AX 5HV0A 3CQOA 3RG0A 1U5YA 2J1UA 2RDSA 2JEMA 1W8TA 3LFMA 3RS6A 5AC91 1NOVA 2X05A 2AACA 4ARXA 1POV1 5C5UA 4MH0E 4XUOA 4COYA 1VB2A 2EIDA 1UYPA 4ES8A 4LO4B 1WUVA 5KHIA 4NVPA 1FXZA 1LHUA 1WCQA 2Y26A 3KV9A 3NV1A 4CP2A 4RR3C 3S7IA 1B35A 1RUG2 4DUVA 3K3NA 2CSGA 3VKNA 1COV1 4AFCA 4AWDA 1G9CA 3ZXKA 4ASMB 1PVC1 1MR5A 1AL21 4DIQA 3K4AA 4RGKA 5FXVA 2BDRA 1VALA 2IWGB 2XL9A 1DYKA 1QHDA 4RS5B 5FJHA 3VBHA 5H9PA 5JOYA 4LORA 3H0OA 3KVAA 3B02A 1RXGA 4TLGA 1ZZCA 3PL0A 4FPFA 1JZ2A 1ND2A 4XQDA 4IV3B 1HRV2 2XJVA 4YZ2A 1HQWA 1AL22 1WZXA 3NNGA 2G9ZA 1T6GC 2W94A 4KWUA 2PMWB 4HSLA 2WLQA 3BU0A 4OVEA 1BMV2 2D6MA 3WF3A 3HWJA 3ME2A 5JXHA 5LEJA 1QJY1 3OYWA 3WDTA 3ZYFA 4Q4W3 2C0ZA 1S2BA 3IDEA 5EJZB 1XYPA 3HN1A 4OLLA 3JBG1 2VQUA 3UL2A 3NAPB 1HLCA 1SZBA 2BGCA 3TNQA 1DFQA 2PHRA 3CMGA 2XR4A 1KJRA 3AZYA 2PHUA 4UAPA 1NCRB 4KWLA 1XNBA 4CYDA 1MQTC 2H6BA 1J83A 4COVA 3BUCA 2Y38A 4NRPA 1C8NA 2VTXA 1HJGA 2XJRA 1VBC3 4E9KA 4B3NA 1LTEA 4QQHA 2R7EB 4XDOA 4GIQA 3WINE 1Q5OA 3KQ4B 1ULEA 3MO4A 4CDUB 4LLOA 1WD3A 4JC1A 2CGNA 4XC9A 5FMOS 1JUHA 3GZEA 5CB7A 2ZX1A 5FZHA 2JDHA 2ZGTA 4UFMA 1JZ7A 5JSRA 2DUPA 3I2JA 3VZNA 2XJQA 1C8M3 5GZDA 1HQLA 3U07A 2VZUA 3PJYA 2RS12 1BZWA 2YY1A 3B94A 3WF4A 1AYM3 5A70A 2WAAA 4MGYE 4CZSA 2E7TA 3MF6A 2RG4A 1Z7S1 3J7MA 3MPPG 3R4UA 1ZNPA 4E2GA 4HK9A 1VBD1 3E5UA 4XEZA 4YGDA 4N7UA 1K12A 4AYUA 2I2SA 3VGIA 3GJBA 3WD5A 3O1PA 1RUI1 5GZEA 1OD5A 4BU2A 4H7MA 1I9RA 1NQJA 1ZZBA 3U11A 5CISA 1PO13 3P6BA 4XJWA 1W0OA 1Z7S2 2ZGPA 3OUIA 1S2EA 4XAAA 4CDXC 2WZPP 2RHPA 5D2AA 4I3GA 4OHZA 3POIA 3BKZA 3V0BA 4XTMA 1F4HA 4Q1RA 4AAPA 5FQ0B 2Q1MA 2V72A 2FZ1A 1J3RA 3B69A 1CIYA 3OPWA 2D5HA 2PAEA 5FPXA 2GC2A 4PQ9A 4W6WA 2ZABA 1XOYA 5FP8A 5FZ1A 1PMIA 4RGAA 4HMZA 4ZS2A 2VU9A 4IV1B 3UT0A 3MUZ1 4RA0A 4E4HA 4W50A 1BCXA 2E33A 2HWB3 2KD7A 5IVCA 4CEWB 5GLUA 2D98A 4D0QA 4OZXA 2CV6A 4PDWA 4CCCA 1UXZA 1RUF1 3RMYA 1DGLA 3IMMA 1W9FA 4CDWB 3S0MA 4IEPA 3P1IA 1UQXA 3EYPA 4I0AA 3N9QA 4XAEA 2WT2A 4D7SA 3I2IA 4XJAA 4XXAA 2UU8A 1HW5A 1PZ8A 3NJZA 4WM8B 5GJ6A 3N7JA 2RS52 2WL1A 3WUDA 1ODMA 4A45A 3KB5A 4Y24A 4AQSA 5LRSA 1JZ4A 3Q8BA 1Y3TA 5CVRA 1H2KA 3NRUA 5FYZA 3VZOA 4UW6A 2HWD3 1SLLA 3APBA 1PZ9A 1VRBA 5A32A 1QF3A 2G4IA 1ENQA 2VZVA 4Y26A 4Q5OA 2BVBA 1V6NA 4CSWA 1E57A 1YWKA 2VZQA 2VD7A 2D6PA 2WNUB 1EAH3 1GQGA 2BQPA 3CIHA 1XNDA 4MLOA 4CP9B 3SCHA 1RIRA 1Y7BA 5EP9A 3WQ0A 3FX3A 1BBT1 4EN8B 4OI0A 3WCRA 2VW0A 5J48A 4PLMA 1ZRFA 3D5OA 2YC4A 5FZAA 4NIHA 1OPOA 1DF0A 4XUQA 4LT5A 1DZQA 1BEV1 1UX6A 3KCYA 1UU6A 2WS91 3T2QA 4BCUA 1ZBA3 5K8SA 3ZFGA 1VBE3 4XHBA 3OY8A 1JODA 5JMCA 3LA2A 1UCXA 3ON7A 3TAYA 2MEV3 4PT6A 4BLIA 4EWAA 5BNPC 4QPIB 4YVSB 2X09A 4JGYB 2JG8B 2NLRA 4LBJA 3DPRC 4QX0A 1ZREA 1HKDA 4UFHA 2CTVA 4YWAA 1DQ2A 1AR71 1UYXA 4JTOA 4HPKB 3MPBA 2HWF3 2V5YA 5CFCA 3K75B 4Y20B 5DUXA 3IWZA 4LO5B 2XXZA 2P3KA 4YG3A 4C1WA 3A22A 2DWRA 5CBLA 4JGZB 3TEYA 1KFXL 4HN1A 2HH9A 1CR7A 3N3HA 4PF5A 1AR81 4RSUA 4WM7A 5FYCA 5FO8B 3U4XA 1JYNA 2LRPA 2R062 5FYMA 1ND3A 4L8QA 5FV3A 1WA4A 1AR72 2VUCA 3I54A 4W4ZA 3ZOIA 3LPFA 1US3A 3HNMA 2BNOA 4XJZA 1C4RA 3CO2A 4H2AA 1R091 4NPRA 4RYDA 5CZKA 4INDA 5C8CC 1RUH2 5CKQA 1SPPA 4PI0A 4BJ0A 5JSPA 5DG1A 1CJPA 4OHXA 3ZYHA 5A33A 2D3SA 5A3NA 4L9BA 1YJKA 5FKBA 4XDQA 1RUD1 3L2HA 1NG0A 3JZVA 1MS5A 2WFF1 4AK3A 3LEGA 1US2A 3VBUB 5AFBA 2D97A 3WQ7A 3H8UA 5IWFA 4DRRA 3FJSA 2BGPA 3AFGA 3MGUA 1UU4A 4I02A 1HDKA 2QQWA 2J1VA 4IV3C 5FZIA 4AEDA 4CCDA 1DU3D 5F5AA 4ASLA 4ZONA 3IKWA 4O65A 4AGRA 2YBKA 3FBMA 1NCQB 2LALA 4MO3M 3VDDB 2WFF2 4H55A 1JHJA 1OSGA 4MG2A 5FZDA 2RS31 1GUIA 2BZDA 4ZY9A 4E4SA 1NT0A 2ZX0A 5ACA2 2HWC1 2QE3A 2X29A 2WZR2 4GJZA 2VZ1A 4YG6A 3THTA 4Y5SA 2AZ5A 1UY0A 5KXCA 4GH4B 4WV8A 2F4PA 1AJKA 3NAPC 1QJU1 2JDNA 3OUJA 1WLDA 4IEOA 3WOGA 4AEJA 5KHGA 2ZGNA 4GB33 3UKTA 2WJSA 3VD4A 5C4WC 3WDXA 5HCFA 4CEYA 5CG9A 3IT8A 2BW8A 1ZZ7A 4LA2A 5FMDA 1REEA 5BNOA 3V0AB 5EXOA 2P3YA 5IW0A 3VL8A 3VHPA 1QJU2 4A7KA 2YHJA 3ZFEC 4PI2A 1D7PM 2WT0A 3CHXA 1QKQA 1XB9A 1G9BA 1U5XA 4QXCA 4YW7A 4MGZE 2GC3A 1MZEA 1W6QB 3OTFA 1TQ5A 1X8MA 3MIDA 5FYHA 4Y3OA 1RMU3 3O0XA 2GH2A 4MXWB 5F6KA 5CKNA 2VM9A 3KD4A 2CGOA 1S0JA 5DAQA 2VZPA 4UFIA 2OPKA 4W65A 1NLRA 1W04A 4EJRA 2GNDA 4U36A 5EZWA 5L73A 1TVGA 5KHHA 2HLEA 5LK5A 3VD5A 1JOBA 3WP4A 5EFUA 1MS0A 3FBYA 5I0TA 1J84A 1X8EA 1VRH1 1WGPA 2D3PA 3MIHA 2NP0A 4LTAA 3VKMA 2YDEA 1IQDC 3IBMA 3IAQA 1PM7A 2QQJA 1W99A 2RR13 4LK6A 3MW2A 4K3UA 4QQLA 5FYSA 2FDFA 1LOGA 4YVWB 4CUCA 3A4UA 1CPNA 4BLJA 3I3DA 5C3OA 3WNMA 4P00B 1W9SA 2QQIA 3MW3A 3WF0A 3VBRB 1WWYA 3USSA 3ILRA 4LKEA 3F2ZA 3DKQA 2EXKA 3J8F2 2QQPA 3F95A 4CXWA 1V9U3 3K3OA 5FY9A 5KHJA 2UWAA 2XBO1 3J7HA 4Q0VA 1AR93 2WT1A 3LB9A 3AMHA 4G4FA 1TMF1 1CN1A 5A7WA 3VZMA 1YUDA 3OBRA 3J7LA 3S30A 4Q4Y2 5M0TA 2JDMA 5T3NA 2QQKA 3ZFFB 4ATEA 5FFOC 1D4M1 4NO4A 3WCSA 5G04L 2YV8A 1CPMA 3JD71 1ZX5A 5T52A 1H4HA 3ZR6A 4CEWC 2WDBA 4RN5A 4IGOA 2W92A 1R081 3ST7A 3I2GA 1MS4A 1VBC2 1ZZ6A 1YFYA 1QQP1 3D0SA 1QIQA 2WO1A 2Y64A 3H8XA 2DVGA 5J09A 2VNRA 1H8TC 4LBQD 3E6DA 3VZKA 1N3PA 1TME3 3N7KA 2VMDA 3MFCA 4Q0QA 3NNLA 2QZ2A 2NPIA 3MW4A 1N1SA 1R082 1C8M2 2JDUA 3WV6A 1QOOA 4YGCA 5FYUA 1PO21 1QQP2 1SACA 2CAVA 5CYYA 5I0UA 3ZSMA 1AYM2 1PX3A 2R1DA 3USUA 3CLPA 3S6PA 1LAJA 1UZYA 4FTEA 4IEQA 1JUIA 1WMDA 4XJ9A 1O7FA 1RUE3 3OSDA 5F3EA 1WLWA 3OGJA 2VY0A 1RUJ1 5IVEA 4QAWA 3WP6A 3LDKA 1TG7A 3N7MA 1OD3A 4N9IA 1NAEA 1W6PB 2GMEA 2VUDA 3DYPA 3WW4A 3LEKA 2XUEA 3ACHA 4ZU4A 4QXKA 1XJAA 1HB2A 4LO7A 3WF2A 2VQTA 3M4FA 4HL0A 2OXBA 4I30A 5C71A 3POGA 2O1QA 5DMYA 1OVPA 2XLAA 2XWJB 2J1TA 4K1YA 4H7LA 3RZLA 5LA0A 5J3UA 4LUMA 3KWVA 4Y22B 4IE0A 3N9LA 4MX3A 2HEWF 2WNVC 4M3CE 4FPOB 1OF3A 3H42B 3ZIWA 1OF4A 3E6BA 4NROA 3W9AA 2VJXA 4QX5A 5FZ6A 3WG2A 4AGVA 5LASA 3KV5A 1SLAA 2ZHKA 1DYPA 1PVC3 5JSOA 1A78A 1HV1A 3AMMA 4V2VA 1L7LA 1MZFA 1H9PA 3MUY1 2JWPA 2JE8A 1QOSA 3N36A 4ZPIA 2HWB2 3DKWA 1R1A1 2J1SA 3AMNA 5DAVA 4JQRA 1DCSA 1NCRA 1AYN1 2WWSA 4JGZC 2R6QA 1PMHX 2J7MA 3FMGA 1LOFC 1FPN3 2ZGRA 5FOJB 3NWKA 4OI2A 4P08A 4FT8A 1BJQA 2ZKNA 4YARA 4X8NA 3EQEA 1LNSA 1CQ9A 3SEPA 4U2AA 3AP9A 4QD2A 2DVDA 4RHV1 4Y5Z0 2BBVA 2DU0A 1JZ5A 1AYN2 1V6IA 4E2SA 5L19A 2XVGA 1Y9GA 5APAA 3D8CA 4BH9A 1GMMA 4RR3B 1BYHA 4FQ4A 2HBTA 3VBFC 2WNOA 1CESA 1UZZA 2BFUL 1MS1A 4IGPA 4Z8BA 2E32A 4NPLA 4FO9A 5GALA 2ARXA 4O61A 2XQRA 4MOAA 4Q0PA 4AOCA 2VNVA 2YU2A 1G86A 1YQ6A 4IE6A 3KV4A 2J1AA 4R9CA 3VBUC 1IPJA 2R1BA 2QBXA 4TLFA 3EHKA 4ZZ5A 1OLMA 4Z2AA 1DDLA 4BXSV 2W1SA 4L11A 1FOD1 2BRTA 2DTWA 3ILFA 5T54A 5DUVA 5LWBA 1QY4A 3GCXA 5D1IA 1MEC1 1OH3A 4FOYA 4KG8A 5FZBA 1HRI1 3IZOA 5FQ0A 3ECQA 1FMD1 1VBE2 1JBCA 2B9UA 3DEMA 4YGEA 3GCWA 2YYOA 1QH6A 1BK1A 3TWIA 3MFAA 1R64A 1WMFA 4K9SA 4JKLA 1LEDA 1YQ5A 3ZM8A 4MHUA 2VOVA 2RE9A 4IV1A 1HRI2 2HJIA 1VBD3 1R1ZA 4QDSA 3LF7A 1W06A 5HXMA 3CL1A 1MQTB 1X50A 2MHFA 4LPLA 3WG1A 4XFCA 4A42A 1FV2A 3LCPA 3ZN5A 1RUI3 4EV0A 5FY8A 4NRQA 1U5ZA 1MVQA 4PBOA 4Z07A 3NV4A 4BE3A 4CDWA 4M0NA 1UF2C 4LUKA 4LBNA 5FMBA 3PIJA 1GANA 3VHOA 2RDNA 3NMBA 4BPZA 1VB4A 1VMJA 4GMP3 4WM8A 3ZYGA 1I1EA 3H3LA 2JDKA 1OVSA 1LGCA 1WLTA 2P37A 4XVHA 4R9AA 2H0BA 2Y6JA 1XBFA 2FDHA 3IPVA 2VOTA 3ZIXA 2D93A 2RJLA 4W8JA 3LAGA 1Z0HA 1IKQA 4IDZA 4KMQA 1SG3A 1JYWA 4JDMA 1W9YA 4COUA 1REDA 4PHZA 2DVFA 1EV11 1C5IA 1IQAA 3X29B 2WNUA 5B2GB 4FQZA 2XJUA 1LB2A 2EVXA 1G7YA 4CP9A 2VBDA 2VMEA 4AVVA 3MHZA 1OA3A 4URAA 5A3WA 4OHYA 3H8RA 1JYTA 2GP3A 2GNBA 1IZ3A 2GC0A 4O7XA 3WT3A 4AI3A 4CCOA 1I5PA 2RMU1 1V6OA 2AREA 4JQTA 3Q8EA 3Q8FA 3UJOA 1AR61 3B00A 3BYWA 4CU8A 3VBHC 4PQQA 4A7YA 2V73A 2GNTA 2VZSA 1WCUA 1J3PA 3GBWA 1OA2A 1W28A 5FAXA 5FWJA 4MHRA 5J37A 3E5QA 2XJTA 2ZMNA 4V2WA 1OHFA 1UY2A 4GA9A 4WVMB 3U78A 3H7JA 5DZGA 2RMU2 3MLKA 1L7RA 4UW5A 4YVSA 4JGYA 2JG8A 1OLQA 4UF0B 1U5IA 1AR62 2Z69A 1PIV1 1HJFA 3MIBA 2EF6A 4GXLA 1RUC2 1ASJ3 1VE0A 3HOBA 1LHNA 4GB32 3T0AA 1O5LA 2PA7A 2VAUA 3LDBA 1VJ2A 4JV4A 5FY4A 4A4AA 1YQCA 4PCRA 2C26A 5C5TA 2O8QA 2OUHA 3TN93 3WF1A 5D8AC 2ZPXA 1KDKA 1NKGA 2CGPA 3ZDSA 2PHFA 1H4GA 4QPWA 5LA2A 4JDOA 1ZVFA 2Y6HA 1PIV2 2C9KA 1K45A 2XUMA 4ES9A 5FZ7A 3AZZA 1YCIA 5LRRA 5C3PA 3HBKA 3D6EA 4QKDA 4XF9A 4BQ3A 5LCWL 5ANNA 3PVEA 3RJ2X 2AH2A 1Q56A 4QPGB 2JG9A 4IE7A 2CHHA 3UJQA 4ZU7A 3KS7A 5FOBB 2CNAA 5FZFA 2AYHA 4X6RB 3SISA 2ZHLA 4XIOA 5FYVA 2IUWA 4YW2A 1QXPA 1WA6X 4Y33A 1HN0A 1RHI3 4NWVA 1YFWA 4YW3A 2GN3A 4P9XA 3O7OA 2HEYF 5LBFA 5A6QA 5J7MA 3H1WA 1SCSA 1QXJA 2K0GA 4BM8A 2IZWA 2WN2A 5A6YA 2RR12 3EBRA 4LJHA 1AR83 2ENRA 1VBA1 5BPXA 3POBA 5F2WA 4CPBD 5FUNA 4BK4A 3BTYA 2HWE1 1NCQA 4W6XA 5FZOB 5F8PA 3VDDA 3R4DB 2CL2A 1LOBA 1GQHA 2PLV1 2QVSB 4Q4X1 4DEVA 1Q8SA 2Z5WA 1W3XA 1JN2P 2VH9A 3RZKA 1XC6A 1OOPA 2XVLA 3KCXA 3MICA 4YM1A 5BNPB 3DXTA 1J59A 1VBA2 3AZWA 1AR92 1OPMA 2IXHA 2H6CA 1W3VA 5J96B 3C2UA 2P6CA 2NQYA 3M70A 2PLV2 4JTNA 3SEEA 3OGSA 4MGSA 4DFSA 4EN0A 3J7NA 4HKLA 4LO6B 1YI7A 1UYZA 4XCBA 4XE9A 4LMFA 5JIUA 2A6YA 5FKCA 5FMOL 3GBFA 4UYBA 1RUG1 1OQ1A 2FCUA 4ARYA 4GULA 2WSUA 5IK7A 3KHCA 2FHRA 1OUSA 3TBDA 3OG2A 4HANA 2A3WA 4HBNA 4NUBA 3AXDA 4P9LA 1DGWX 1WMEA 4QXHA 5BYNA 1GYKA 3MBWA 4LBLA 5CG8A 4N43B 3C7OA 4YLZA 1XE7A 1YQ8A 4AVSA 2WO2A 1KD7A 1YJLA 1W6QA 5C8CB 2Y0OA 5I0SA 5HI0A 4H14A 2ZCWA 1HRV1 3KM5A 1G9FA 4E8DA 4JHTA 2HEVF 4TYSA 4CA9A 1WMXA 4COWA 2ZA9A 1UIKA 4QKBA 5GLWA 1VMHA 1BMV1 5F9TA 1W8ZA 2YXSA 3I3MA 1RUE2 3OOXA 5FPAA 2B46X 3LDRA 1MPXA 2XHKA 3R05A 3WXPA 1V0AA 4P9GA 3EXUA 4Q4V3 4XQ4A 3ZXLA 3PUQA 4CU7A 2AR6A 1VBB3 4GMP0 1GZWA 1GP6A 4AFMA 4XW3A 2A6XA 3EO6A 3ZXDA 1YHFA 1F35A 5FBJA 1HXS2 2Y33A 4ZHNA 1I6XA 2RV9A 2R071 2X5IC 1W8WA 1C1LA 3VBRA 2VG9A 1QJEA 1SMVA 1W6MB 4A3XA 1GWMA 5IFPA 1F4AA 4K8RB 4XMIA 1RITA 4GWMA 1W03A 4ASKA 3WNLA 1O3QA 2R072 2YC0A 2W2IA 4AGGA 5C4WB 3O1UA 4MSVA 1NLSA 4P02B 2BV4A 4B4RA 1WLCA 2DUOA 2NN8A 1CD3G 2JKXA 4OCTA 4LOSA 2ZAHA 1G9AA 1FATA 2DBNA 2EAKA 4ZXEA 3WG4A 3R6SA 3ZX7A 4Z82A 5I0RA 4KI5M 1IPSA 2RS11 3KCCA 4UBGA 3KQRA 3ZFEB 1FPN2 2OIIA 3HIFA 3RYKA 4C90A 2DURA 2VL4A 1K3IA 4N53A 4DEQA 4QKFA 5F5IA 4K40A 1AXKA 1E5SA 2WA3A 3AJZA 4M01A 2G19A 1X9PA 3AP5A 5K7PA 3ETPA 2WSVA 3RZJA 2VCCA 5FDBA 2O0OA 3VBOA 3WNOA 4AHXA 5A3TA 5JLVA 4R52A 1UD1A 1Y9QA 1ONAA 4BA6A 2IFWA 5FY5A 1UU5A 1GSLA 4C0HA 1VAMA 3NNFA 4A44A 5C9AA 2NM1A 1ND3C 1BXHA 4B4PA 1F5FA 2VO5A 5JOXA 3GDBA 3UGHA 2WN3A 4MADA 3WG3A 1CAXA 1D4M3 3JUUA 2B5HA 3TEZA 4KH9A 4LBMA 1RVF3 3JD73 4OUSA 4EN7B 3U10A 5J1XA 5CFDA 4YW5A 2A5ZA 1PK6C 4QHZA 2ZAAA 4WZFA 5JAXA 1YIPA 3T4VA 3VBSA 5B4NA 3C7FA 1SLIA 3CJIA 5DDJ3 4ZZ8A 5A7SA 2E7QA 3FWEA 2XB6C 1ZA7A 5FZKA 2E9QA 3WQBA 2YZ4A 3C7EA 2BYVE 4QX8A 1LRHA 2NZ9A 3I3QA 1A6CA 4MZUA 3VZLA 5L7OA 3PUAA 4X8PA 2OQ6A 3BODA 3MI8A 1SLBA
chains in the Genus database with same CATH topology
1D7PM 5EJ1B 5LA1A 2VMCA 1UMIA 3C7GA 3WEZA 3MV11 5IYYA 2VM9A 3DECA 3IIIA 2VZPA 1GU3A 3GXUA 4LKSA 1TVGA 4QX2A 2HLEA 3VD5A 2VZTA 3WNNA 2ORZA 2W5FA 4M4RA 1J84A 2LS6A 4JKKA 1ULOA 3LPGA 3A7QA 1GOFA 1IQDC 3IAQA 3JXSA 1JZ3A 2QQJA 2YG0A 1W99A 3K4DA 2LW8A 5DPNA 4CUCA 3OEAA 2E31A 2YFZA 3I3DA 3WNMA 4P00B 1KGYA 1W9SA 2QQIA 3WF0A 4GWIA 1RYYA 1GQPA 3F2ZA 1UX7A 4UI9L 3ACIA 1CZVA 3HJRA 3IDAA 1H6YA 2YB7A 2ID4A 3J7HA 3NJXA 4DUWA 2ZXQA 3HNYM 2VZOA 3DYOA 2QQKA 3UESA 2BERA 5G04L 2VC9A 1UWWA 2YFUA 4OYUA 5DN2A 2WDBA 4RN5A 2W92A 2DCKA 4JHZA 2DDUA 3I2GA 2X10A 2WO1A 2Y64A 3WNPA 5IJRA 1HN1A 2VMFA 2ORXA 2VMDA 2W3JA 5JXIA 2W46A 5I0DA 3VD7A 4DXTA 5CYYA 3AC0A 1PX3A 2L9LA 2QQMA 2CDPA 3ABZA 4D8MA 2V4VA 2WZ8A 4E8CA 4QAWA 1TG7A 1OD3A 3LEIA 3EB7A 1NAEA 3DYPA 5DQ0A 4XUPA 5IFTA 3LEKA 2W95A 3ACHA 2WUHA 3WF2A 2VQTA 2XOMA 3NJVA 5C71A 4LHSA 1W8NA 5DMYA 3OGRA 2J1TA 5LA0A 3I97A 5G05L 4TTGA 2W1WA 1OF3A 1OF4A 1P8JA 2B4KA 3UETA 2VJXA 3E1F1 2JD9A 3MUY1 2JE8A 2J1SA 2QQOA 4CVUA 3T2OA 2JDAA 1PMHX 4MGQA 3FHQA 2J7MA 1O8SA 1EUTA 4P08A 3VDAA 3A21A 1CX1A 1JYXA 1GOHA 3VD3A 4DUXA 1LNSA 3SEPA 1JZ6A 2E26A 1JYVA 4DXSA 3VDCA 1JZ5A 1CZSA 1GMMA 3OEBA 5F7UA 3T2PA 2V5DA 2E32A 2W1QA 2WQ8A 1UY1A 1W9TA 4MOAA 3HPNA 3GGLA 1OT5A 2J1AA 1H6XA 5C7GA 3FN9A 1BHGA 4CU9A 2RVAA 1W9WA 1UY4A 2QBXA 4ZZ5A 4Z2AA 4BXSV 2W1SA 3THDA 5JXJA 4QDRA 2VCAA 3W5MA 1UMHA 4CUBA 2J1RA 3I2KA 4BDVB 2J1EA 1CZTA 1NUKA 3ECQA 3I2FA 1XPWA 1GNYA 4P5YA 2Y6KA 4M4PA 1R64A 3CQOA 3I3EA 4JKLA 2J1UA 3ZM8A 5JMOA 1DLCA 2X05A 4QDQA 2ZEZA 4QDSA 4ARXA 5HXMA 4XUOA 2EIDA 3CDZB 4LPLA 4XUTA 4L0PA 4A42A 2ZEYA 4LQRA 1WCQA 4AG4A 3OBAA 4DUVA 4GWJA 1SDDB 3HNBM 2BBAA 3OB8A 3WSOA 3K4AA 2ZEXA 3A23A 3IAPA 1ULPA 4A3ZA 4XVHA 1JZ2A 1WKYA 2Y6JA 2VTFA 2VOTA 4W8JA 4CU6A 3T0BA 4KMQA 1JYWA 1SG3A 3NNGA 2W94A 4KWUA 4BK5A 3WF3A 1KEXA 2OKXA 2VMEA 5JXHA 2C4XA 3C8XA 1O59A 4FI9A 4A41A 2B9VA 1I5PA 5EJZB 2VQUA 3CKHA 4CU8A 4OMDA 1DYOA 4PQQA 2VZSA 3CMGA 4UAPA 4DXRA 1UY2A 5JXGA 1GOGA 3U37A 1J83A 4DEVA 1L7RA 1UXXX 4QB2A 3SKVA 2VZ3A 5JUVA 4GZ9A 2WYSA 2R7EB 3HOBA 3T0AA 2QQNA 3MV01 2XQXA 3MO4A 4A4AA 3UNPA 1XNAA 2C26A 3WF1A 4QX3A 2EICA 4HG6B 3D3AA 1NKGA 1JZ7A 1SHWB 2W1UA 3I2JA 4QPWA 2VZRA 5LA2A 2Y6HA 2VZUA 3WF4A 2C9KA 1K45A 5FUIA 2WAAA 2J22A 5LCWL 1JU4A 2CDOA 2QQLA 1K12A 2PQSA 3FHAA 3PUHA 2EIBA 3P6BA 1NX9A 2WZEA 4UOJA 2WABA 4OMCA 1EUUA 1F4HA 2V72A 2WN2A 1CIYA 1UY3A 3T09A 2WBKA 2W87A 3CZJA 4XZUG 4ET7A 4BK4A 1L7QA 3BN6A 2EIEA 2W91A 3MUZ1 4W50A 2E33A 2KD7A 1XC6A 2BGOA 4D0QA 1OH4A 1UXZA 3PUIA 4QB1A 5IHRA 4A6OA 1UZ0A 3SEEA 1JI6A 3P1IA 3EYPA 3OGSA 4MGSA 3I3BA 3K77A 3I2IA 1UYZA 4A45A 3HEIA 3ACGA 4ARYA 1W0NA 1JZ4A 1W8OA 3OG2A 4XUNA 3NRUA 4XURA 3MBWA 2VZVA 3C7OA 2XHNA 2WO2A 1PMJX 4IUGA 4AAXA 3W5NA 2VZQA 4YPJA 2HYXA 3CIHA 2YC2A 4E8DA 3NQHA 2RJ2A 2Y6LA 3LQCA 1K42A 2YC4A 3IB3A 1MPXA 3THCA 4XUQA 4CU7A 2DCJA 4QX1A 3OGVA 3T2QA 3I2HA 3LE0A 3T0DA 4PT6A 1T2XA 2X09A 2RV9A 3WNKA 4QX0A 4CUAA 3VDBA 1UYYA 2WAOA 1UYXA 5IFPA 1F4AA 1JZ8A 3K75B 3A22A 2Y6GA 4JX0A 4OZOA 3WNLA 3SKJE 5C70A 2W9XA 1JYNA 2WO3A 2Y8KA 5JR2A 4P02B 2JKXA 4W4ZA 3LPFA 1US3A 3HNMA 3C7HA 4ZXEA 3K46A 4JKMA 4RYDA 3ACFA 4KI5M 3BGAA 5CZKA 1XNTA 1O8PA 4BJ0A 2VL4A 1K3IA 4OUEA 4DEQA 5HPOA 2W47A 1YQ2A 3DYMA 3ETPA 2VCCA 3LEGA 3WNOA 1US2A 4QB6A 3VD4A 3GM8A 4PF1A 2BGPA 3T08A 2J1VA 2XONA 4A44A 2ZEWA 2VO5A 3GDBA 2WN3A 4MADA 4MO3M 5A1AA 1JHJA 1JU3A 1GUIA 2BZDA 3HN3A 4ZY9A 5J1XA 1DP0A 5B4NA 2VZ1A 5EIYB 3C7FA 2VR4A 1UY0A 4ZZ8A 2Z4FA 3CZUA 3WQBA 3VD9A 1PX4A 3C7EA 3FL7A 3K4ZA 5B4XA 2VCBA 4TXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7P M;  5EJ1 B;  5LA1 A;  2VMC A;  1UMI A;  3C7G A;  3WEZ A;  3MV1 1;  5IYY A;  2VM9 A;  3DEC A;  3III A;  2VZP A;  1GU3 A;  3GXU A;  4LKS A;  1TVG A;  4QX2 A;  2HLE A;  3VD5 A;  2VZT A;  3WNN A;  2ORZ A;  2W5F A;  4M4R A;  1J84 A;  2LS6 A;  4JKK A;  1ULO A;  3LPG A;  3A7Q A;  1GOF A;  1IQD C;  3IAQ A;  3JXS A;  1JZ3 A;  2QQJ A;  2YG0 A;  1W99 A;  3K4D A;  2LW8 A;  5DPN A;  4CUC A;  3OEA A;  2E31 A;  2YFZ A;  3I3D A;  3WNM A;  4P00 B;  1KGY A;  1W9S A;  2QQI A;  3WF0 A;  4GWI A;  1RYY A;  1GQP A;  3F2Z A;  1UX7 A;  4UI9 L;  3ACI A;  1CZV A;  3HJR A;  3IDA A;  1H6Y A;  2YB7 A;  2ID4 A;  3J7H A;  3NJX A;  4DUW A;  2ZXQ A;  3HNY M;  2VZO A;  3DYO A;  2QQK A;  3UES A;  2BER A;  5G04 L;  2VC9 A;  1UWW A;  2YFU A;  4OYU A;  5DN2 A;  2WDB A;  4RN5 A;  2W92 A;  2DCK A;  4JHZ A;  2DDU A;  3I2G A;  2X10 A;  2WO1 A;  2Y64 A;  3WNP A;  5IJR A;  1HN1 A;  2VMF A;  2ORX A;  2VMD A;  2W3J A;  5JXI A;  2W46 A;  5I0D A;  3VD7 A;  4DXT A;  5CYY A;  3AC0 A;  1PX3 A;  2L9L A;  2QQM A;  2CDP A;  3ABZ A;  4D8M A;  2V4V A;  2WZ8 A;  4E8C A;  4QAW A;  1TG7 A;  1OD3 A;  3LEI A;  3EB7 A;  1NAE A;  3DYP A;  5DQ0 A;  4XUP A;  5IFT A;  3LEK A;  2W95 A;  3ACH A;  2WUH A;  3WF2 A;  2VQT A;  2XOM A;  3NJV A;  5C71 A;  4LHS A;  1W8N A;  5DMY A;  3OGR A;  2J1T A;  5LA0 A;  3I97 A;  5G05 L;  4TTG A;  2W1W A;  1OF3 A;  1OF4 A;  1P8J A;  2B4K A;  3UET A;  2VJX A;  3E1F 1;  2JD9 A;  3MUY 1;  2JE8 A;  2J1S A;  2QQO A;  4CVU A;  3T2O A;  2JDA A;  1PMH X;  4MGQ A;  3FHQ A;  2J7M A;  1O8S A;  1EUT A;  4P08 A;  3VDA A;  3A21 A;  1CX1 A;  1JYX A;  1GOH A;  3VD3 A;  4DUX A;  1LNS A;  3SEP A;  1JZ6 A;  2E26 A;  1JYV A;  4DXS A;  3VDC A;  1JZ5 A;  1CZS A;  1GMM A;  3OEB A;  5F7U A;  3T2P A;  2V5D A;  2E32 A;  2W1Q A;  2WQ8 A;  1UY1 A;  1W9T A;  4MOA A;  3HPN A;  3GGL A;  1OT5 A;  2J1A A;  1H6X A;  5C7G A;  3FN9 A;  1BHG A;  4CU9 A;  2RVA A;  1W9W A;  1UY4 A;  2QBX A;  4ZZ5 A;  4Z2A A;  4BXS V;  2W1S A;  3THD A;  5JXJ A;  4QDR A;  2VCA A;  3W5M A;  1UMH A;  4CUB A;  2J1R A;  3I2K A;  4BDV B;  2J1E A;  1CZT A;  1NUK A;  3ECQ A;  3I2F A;  1XPW A;  1GNY A;  4P5Y A;  2Y6K A;  4M4P A;  1R64 A;  3CQO A;  3I3E A;  4JKL A;  2J1U A;  3ZM8 A;  5JMO A;  1DLC A;  2X05 A;  4QDQ A;  2ZEZ A;  4QDS A;  4ARX A;  5HXM A;  4XUO A;  2EID A;  3CDZ B;  4LPL A;  4XUT A;  4L0P A;  4A42 A;  2ZEY A;  4LQR A;  1WCQ A;  4AG4 A;  3OBA A;  4DUV A;  4GWJ A;  1SDD B;  3HNB M;  2BBA A;  3OB8 A;  3WSO A;  3K4A A;  2ZEX A;  3A23 A;  3IAP A;  1ULP A;  4A3Z A;  4XVH A;  1JZ2 A;  1WKY A;  2Y6J A;  2VTF A;  2VOT A;  4W8J A;  4CU6 A;  3T0B A;  4KMQ A;  1JYW A;  1SG3 A;  3NNG A;  2W94 A;  4KWU A;  4BK5 A;  3WF3 A;  1KEX A;  2OKX A;  2VME A;  5JXH A;  2C4X A;  3C8X A;  1O59 A;  4FI9 A;  4A41 A;  2B9V A;  1I5P A;  5EJZ B;  2VQU A;  3CKH A;  4CU8 A;  4OMD A;  1DYO A;  4PQQ A;  2VZS A;  3CMG A;  4UAP A;  4DXR A;  1UY2 A;  5JXG A;  1GOG A;  3U37 A;  1J83 A;  4DEV A;  1L7R A;  1UXX X;  4QB2 A;  3SKV A;  2VZ3 A;  5JUV A;  4GZ9 A;  2WYS A;  2R7E B;  3HOB A;  3T0A A;  2QQN A;  3MV0 1;  2XQX A;  3MO4 A;  4A4A A;  3UNP A;  1XNA A;  2C26 A;  3WF1 A;  4QX3 A;  2EIC A;  4HG6 B;  3D3A A;  1NKG A;  1JZ7 A;  1SHW B;  2W1U A;  3I2J A;  4QPW A;  2VZR A;  5LA2 A;  2Y6H A;  2VZU A;  3WF4 A;  2C9K A;  1K45 A;  5FUI A;  2WAA A;  2J22 A;  5LCW L;  1JU4 A;  2CDO A;  2QQL A;  1K12 A;  2PQS A;  3FHA A;  3PUH A;  2EIB A;  3P6B A;  1NX9 A;  2WZE A;  4UOJ A;  2WAB A;  4OMC A;  1EUU A;  1F4H A;  2V72 A;  2WN2 A;  1CIY A;  1UY3 A;  3T09 A;  2WBK A;  2W87 A;  3CZJ A;  4XZU G;  4ET7 A;  4BK4 A;  1L7Q A;  3BN6 A;  2EIE A;  2W91 A;  3MUZ 1;  4W50 A;  2E33 A;  2KD7 A;  1XC6 A;  2BGO A;  4D0Q A;  1OH4 A;  1UXZ A;  3PUI A;  4QB1 A;  5IHR A;  4A6O A;  1UZ0 A;  3SEE A;  1JI6 A;  3P1I A;  3EYP A;  3OGS A;  4MGS A;  3I3B A;  3K77 A;  3I2I A;  1UYZ A;  4A45 A;  3HEI A;  3ACG A;  4ARY A;  1W0N A;  1JZ4 A;  1W8O A;  3OG2 A;  4XUN A;  3NRU A;  4XUR A;  3MBW A;  2VZV A;  3C7O A;  2XHN A;  2WO2 A;  1PMJ X;  4IUG A;  4AAX A;  3W5N A;  2VZQ A;  4YPJ A;  2HYX A;  3CIH A;  2YC2 A;  4E8D A;  3NQH A;  2RJ2 A;  2Y6L A;  3LQC A;  1K42 A;  2YC4 A;  3IB3 A;  1MPX A;  3THC A;  4XUQ A;  4CU7 A;  2DCJ A;  4QX1 A;  3OGV A;  3T2Q A;  3I2H A;  3LE0 A;  3T0D A;  4PT6 A;  1T2X A;  2X09 A;  2RV9 A;  3WNK A;  4QX0 A;  4CUA A;  3VDB A;  1UYY A;  2WAO A;  1UYX A;  5IFP A;  1F4A A;  1JZ8 A;  3K75 B;  3A22 A;  2Y6G A;  4JX0 A;  4OZO A;  3WNL A;  3SKJ E;  5C70 A;  2W9X A;  1JYN A;  2WO3 A;  2Y8K A;  5JR2 A;  4P02 B;  2JKX A;  4W4Z A;  3LPF A;  1US3 A;  3HNM A;  3C7H A;  4ZXE A;  3K46 A;  4JKM A;  4RYD A;  3ACF A;  4KI5 M;  3BGA A;  5CZK A;  1XNT A;  1O8P A;  4BJ0 A;  2VL4 A;  1K3I A;  4OUE A;  4DEQ A;  5HPO A;  2W47 A;  1YQ2 A;  3DYM A;  3ETP A;  2VCC A;  3LEG A;  3WNO A;  1US2 A;  4QB6 A;  3VD4 A;  3GM8 A;  4PF1 A;  2BGP A;  3T08 A;  2J1V A;  2XON A;  4A44 A;  2ZEW A;  2VO5 A;  3GDB A;  2WN3 A;  4MAD A;  4MO3 M;  5A1A A;  1JHJ A;  1JU3 A;  1GUI A;  2BZD A;  3HN3 A;  4ZY9 A;  5J1X A;  1DP0 A;  5B4N A;  2VZ1 A;  5EIY B;  3C7F A;  2VR4 A;  1UY0 A;  4ZZ8 A;  2Z4F A;  3CZU A;  3WQB A;  3VD9 A;  1PX4 A;  3C7E A;  3FL7 A;  3K4Z A;  5B4X A;  2VCB A;  4TXW A; 
#chains in the Genus database with same CATH topology
 5BUV A;  1NLQ A;  1OLR A;  3LSD A;  2O8O A;  3M2M A;  3WHT A;  1C1F A;  4AQ2 A;  3FFZ A;  4TN7 A;  4FPG A;  5ABJ A;  3BIW E;  3UK9 A;  1EPW A;  4FOQ A;  2RS5 1;  3B01 A;  3ZYB A;  3ZVX A;  5JZG A;  5LA1 A;  3ZLI A;  2LUW A;  5EYX A;  1FX5 A;  4D3W A;  2R0H A;  4HFS A;  5LZ6 A;  3WEZ A;  1ZA4 A;  3MV1 1;  4YFW A;  3DEC A;  3ACL A;  1H8T B;  1GU3 A;  4LKS A;  2VOX A;  4O9E A;  1XQN A;  2XML A;  1QJX 3;  4FFH A;  4R4Z A;  4BIS A;  5FWE A;  2Q30 A;  2WR9 A;  1ZRR A;  2VZT A;  1W6O A;  4QPG C;  5E1R A;  3ZYI B;  2ORZ A;  3B5L B;  3KGL A;  4X6Q B;  4RR3 A;  5FZ0 A;  1O4Y A;  2D7F A;  1CAW A;  2VUL A;  5FP3 A;  5FYB A;  1KFU L;  1W39 A;  3K4D A;  2YMZ A;  4CDQ A;  2VPV A;  5LK7 B;  3BU7 A;  1AXZ A;  1HIX A;  4QHO A;  2E31 A;  3I4I A;  3MDP A;  1GP4 A;  4NJ4 A;  5JOZ A;  1NA1 C;  1R1A 3;  5F2S A;  3H8O A;  3P3N A;  4Y1V A;  2EAA A;  2YGM A;  5A7Q A;  4LBK A;  4UI9 L;  1N1V A;  1I3H A;  2AEZ A;  3ACI A;  2XLF A;  2YB7 A;  4B8E A;  4DUW A;  2ZXQ A;  4OQ8 A;  1AHS A;  2TEP A;  3SC7 X;  1CAU B;  5CA6 A;  5GZC A;  2WNV B;  4JRL A;  2A1X A;  1O6U A;  2VC9 A;  1SBE A;  5GKA C;  1LCL A;  1UWW A;  2PHT A;  1MS3 A;  2R06 1;  3RYR A;  1LEM A;  5A7P A;  3TRS B;  4JHZ A;  3SNM A;  5IVJ A;  4FAG A;  1GNH A;  3CBN A;  1ASJ 2;  1QU0 A;  2QZ3 A;  1O4Z A;  4IEZ A;  5D21 A;  2VMF A;  3ZYP A;  1N1T A;  2ORX A;  1MQT A;  3TN9 2;  2GZW A;  3LOB A;  2XL7 A;  2UUR A;  3AP6 A;  1RUH 1;  4K8F A;  4Q8K A;  2OX0 A;  2P3I A;  4P9J A;  3VD7 A;  4F83 A;  1C57 A;  5E6H A;  1CAV B;  3OUH A;  5KBF A;  3HAG A;  4LK7 A;  5JOW A;  3OPT A;  5L36 A;  1Q3E A;  2L9L A;  3ORJ A;  4HVO A;  1LGN A;  4N43 C;  3INA A;  1UN1 A;  1D2S A;  2CDP A;  2D6K A;  1YFX A;  1D0G A;  2D43 A;  3WR0 A;  4E8C A;  3VBF B;  2EIG A;  3PMS A;  4YNI A;  4NE9 A;  5GM0 A;  4AVT A;  3SH3 A;  5EYY A;  2W95 A;  1S55 A;  3JQW A;  5E16 A;  1A8M A;  3PDQ A;  3NNJ A;  4NHX A;  1HB3 A;  5FZE A;  1WBL A;  1RHI 2;  4YZ3 A;  1QMJ A;  4XYX A;  5F3I A;  5FUP A;  5KR7 A;  3WW2 A;  3RWK X;  3I8T A;  1V6J A;  5G05 L;  2WZR 1;  3ASI A;  3FUO A;  4BQ4 A;  3H7Y A;  2IXL A;  4DQA A;  1KQR A;  4CDX A;  1P8J A;  4LKD A;  2C5D A;  1IS3 A;  1OI6 A;  3UET A;  2ATF A;  1LES A;  4BIF A;  2YPD A;  4M3C A;  2Q5T A;  5T5J A;  5DZE A;  5BNN C;  3TB0 A;  4CVU A;  4NHM A;  3T2O A;  4WVM A;  3IIA A;  5A3L A;  2JIC A;  3WZ1 A;  4Y4R A;  1IGO A;  2F4L A;  5CU1 A;  2CWS A;  2G9G A;  3ELN A;  4Q0S A;  3ZSJ A;  5L9B A;  2YBS A;  4UF0 A;  3VDA A;  3MEP A;  1CX1 A;  2YBP A;  1DQ4 A;  5EPA A;  2ERF A;  1JYX A;  3WHU A;  3VKF C;  4HVR A;  5FXX A;  5IVF A;  1EV1 3;  2WC2 A;  3VDC A;  4IEY A;  2IXJ A;  2TNF A;  1CZS A;  5FYY A;  2A3X A;  4NHL A;  4NR1 A;  5K0U A;  4JVA A;  3IN9 A;  4YG0 A;  3RFR A;  4IEW A;  5IK5 A;  1IOA A;  4GJY A;  4XFG A;  1OMI A;  1NXD 1;  4LLF A;  3T2P A;  1ZZ9 A;  2Q1Z B;  5A3M A;  3U1X A;  1S2K A;  4ITC A;  1JHN A;  1ZBE 3;  4NRM A;  1UY1 A;  3NW4 A;  1W9T A;  4LHN A;  3NL1 A;  1UKR A;  3O5S A;  3HPN A;  5H9S A;  1YEW A;  4XZP A;  1WCS A;  2DFC A;  5FRE A;  4LHK A;  2NMO A;  4YZ1 A;  1VAK A;  3QLQ A;  3FHI B;  4GAL A;  5FY1 A;  4CU9 A;  1ODN A;  2RVA A;  3MIE A;  1E5H A;  1UY4 A;  3LD8 A;  1DLL A;  5T55 A;  5FZ8 A;  4UWD A;  2R04 3;  5CEH A;  1LJ7 A;  5JXJ A;  1Y4W A;  2V09 A;  2B8M A;  4QDR A;  4HKW A;  2VCA A;  3W5M A;  4COZ A;  1UMH A;  4CUB A;  4HZF A;  2VXR A;  3GHM A;  1LHO A;  1RIN A;  2J1R A;  3J8F 1;  3OD0 A;  5KXB A;  3O1O A;  3AZV A;  4XXP A;  5IK8 A;  1GNZ A;  4Q4W 1;  1IKP A;  1NUK A;  2P3J A;  2D6L X;  3I2F A;  2Y34 A;  3QH7 A;  4DMI A;  1BK0 A;  3LKJ A;  4Q26 A;  1Y9M A;  4RQP A;  1UKG A;  2BNN A;  3SCF A;  3SCG A;  4XF3 A;  4IET A;  4Q4Y 1;  3CU7 A;  3I3E A;  3VBH B;  5TSW A;  5DAP A;  1YI9 A;  5JMO A;  5EHD A;  2VCM A;  1DLC A;  4DS0 A;  4DIN B;  4Q4W 2;  2KR2 A;  2ZEZ A;  3A0K A;  3RJR A;  1H1M A;  1S0G A;  4AHY A;  2QCS B;  4UFK A;  5JVV A;  3VHR A;  1PGL 1;  4AI8 A;  4XUT A;  2J42 A;  1VBC 1;  4L0P A;  3AP4 A;  2BOI A;  5IAX A;  3POS A;  3DPR A;  2ZEY A;  3V64 A;  4LQR A;  4AG4 A;  1H9W A;  2R49 A;  2OW4 A;  3I2D A;  2C1F A;  2K2S A;  3OBA A;  3PVN A;  3ZXG A;  3HNB M;  2BBA A;  4M3C F;  3WDY A;  1JYI A;  1K5M A;  3OB8 A;  1NYW A;  3I7D A;  2FBE A;  5D8A B;  4EZH A;  1Q43 A;  3AKT A;  3WSO A;  2A70 A;  3OYW B;  1W8F A;  1IPK A;  2YUE A;  2ZEX A;  3A23 A;  1C8M 1;  1S0I A;  4I0B A;  5FLJ A;  5FY7 A;  4OFG A;  4OUL A;  1ULP A;  1AZD A;  4YRD A;  1AYM 1;  4A3Z A;  4XET A;  1UMZ A;  1IG0 A;  4DXZ A;  5FYT A;  3MIG A;  3D0J A;  5EQU A;  2O14 A;  1WKY A;  4TSV A;  4HVQ A;  4R9B A;  3AKP A;  1QGL A;  4CU6 A;  4CP1 A;  3T0B A;  3AFK A;  1S0F A;  4Q4X 3;  1OBN A;  1RJ8 A;  4AHZ A;  5IAT A;  4LOT A;  3ES1 A;  4J6G A;  4KGG A;  2ETE A;  4DOU A;  5C8C A;  4TWT A;  1Q8O A;  1UNB A;  1PO1 1;  3HBZ A;  3D82 A;  2C4X A;  3C8X A;  3UYJ A;  1OKO A;  3VZJ A;  3P3P A;  4KG0 A;  1J1T A;  3WLU A;  1B09 A;  4CUG A;  4RS5 A;  4QU2 A;  2PHD A;  4A41 A;  2DU1 A;  5T50 A;  2QQU A;  4JDN A;  2VVF A;  1OA4 A;  2JEN A;  2RM2 3;  4OMD A;  2ZGM A;  4KU7 A;  4ZU5 A;  3POJ A;  4IV3 A;  1PO1 2;  4AXO A;  1NZC A;  1WCD J;  3FLP A;  4OHW A;  3SIT A;  1GLH A;  1QEX A;  1X33 A;  1CIW A;  4DXR A;  1H1A A;  5AC9 3;  1O91 A;  1DZT A;  3OD4 A;  4LBO A;  1DQ0 A;  1POV 3;  2F6B A;  2MPF A;  4HON A;  4FVV A;  5DDJ 2;  1V6K A;  5HXV A;  1UXX X;  4QB2 A;  3SKV A;  3G6J B;  2VZ3 A;  4OUM A;  2OUJ A;  5JUV A;  3AKR A;  2WA4 A;  3BTA A;  2HWB 1;  1BKZ A;  2WYS A;  3HQR A;  5FPL A;  4OQ9 A;  4CXX A;  2QUO A;  3MV0 1;  4IE5 A;  3PNA A;  4LO8 A;  1UIJ A;  3WW3 A;  3UNP A;  3RSJ A;  5FYI A;  3BIE A;  2XDV A;  4BQ2 A;  1COV 3;  2EIC A;  3AZX A;  1HRV 3;  4HG6 B;  4E27 A;  1SHW B;  3NAP A;  1AL2 3;  2FCT A;  2W1U A;  4UXA A;  1ZRC A;  3ETQ A;  2K46 A;  2VTX J;  5J98 B;  3ZYJ B;  4FTB A;  4QGL A;  1POQ A;  5A1F A;  3HR9 A;  3V0B B;  4QM8 A;  4BOW A;  4MV2 A;  3MYX A;  1TE1 B;  4MXV A;  1DGR N;  2J22 A;  3GZT B;  1JU4 A;  2P34 A;  3GYD A;  2AGS A;  4LIV A;  1GZT A;  1CVN A;  2KXL A;  2P2K A;  3M3O A;  5CKM A;  1KS5 A;  3ZFE A;  4XHX A;  2HWD 1;  5H9Q A;  1DQ1 A;  4CDU A;  2AEN A;  5DAB A;  2PQS A;  3FHA A;  5FZ3 A;  2EIB A;  2NYY A;  1YO8 A;  3RMX A;  1W0P A;  1QJX 2;  4URT A;  1OKQ A;  3KGZ A;  3K51 A;  1QJY 3;  1EAH 1;  2OS2 A;  1OUR A;  1EUU A;  3VL9 A;  1DQ5 A;  4L92 A;  2HWD 2;  3JBG 3;  1GV9 A;  2BNM A;  3KZ4 C;  2VOW A;  4HKO A;  1W6N B;  4B1L A;  1UY3 A;  2B7Y A;  1GP5 A;  1OFS A;  2WBK A;  3CZJ A;  4XZU G;  1EAH 2;  4KNC A;  5FP4 A;  1L7Q A;  5F5C A;  3ZXJ A;  2EIE A;  2GDF A;  5FK8 A;  5FPV A;  1VBE 1;  2JG9 C;  1X82 A;  2ZBJ A;  2CWM A;  3DL3 A;  4NHY A;  1LKN A;  2MEV 1;  5JI7 A;  4PIY A;  3N9M A;  3E97 A;  2BGO A;  3FE5 A;  1APN A;  3GHN A;  3HT1 A;  4SBV A;  5A32 B;  1OH4 A;  1QH7 A;  2X5I B;  4HN0 A;  4LNV A;  1HB1 A;  1ENX A;  5FO9 B;  1VR3 A;  4HLT A;  1SFN A;  1Z78 A;  1ZBA 2;  5IHR A;  3I3B A;  2IXI A;  3BVC A;  2ADE A;  3K77 A;  1JOJ A;  2MEV 2;  2VMH A;  5FPB A;  1F8V A;  2DCT A;  3MF9 A;  1MVE A;  3PHM A;  3WX5 A;  1Z7S 3;  3ACG A;  1BVV A;  3OGG A;  5F1R A;  2FCV A;  2HWF 2;  3DV8 A;  2ZKL A;  5E89 A;  4AVB A;  2PEL A;  1ZM1 A;  4XF1 A;  4WVZ A;  5FZ4 A;  4CEW A;  3W59 A;  3V65 A;  3ZFG B;  1C5H A;  4HK8 A;  2XHN A;  3T3Y A;  3RZZ A;  4Y5T A;  3OCP A;  3OY8 B;  1AX1 A;  4NIG A;  4AAX A;  3W5N A;  3NJY A;  1OOP C;  2VW1 A;  4YPJ A;  3LSE A;  2BP6 A;  1AX0 A;  2HYX A;  3AYA A;  4IEX A;  4L99 A;  2WWU A;  3AJY A;  1JMU B;  1H8T A;  1W2U A;  1XYO A;  4QQP A;  1XSR A;  2VQA A;  1XSQ A;  2QDN A;  2RJ2 A;  3ZXF A;  3AKS A;  3D4K A;  4HOO A;  4RGG A;  1J1L A;  4PLN A;  1VP6 A;  2UWB A;  5I8Y A;  2WRA A;  2WFP A;  3IB3 A;  1WCK A;  3THC A;  4IL7 A;  5SV5 A;  3H50 A;  3IDB B;  3NKG A;  1FNZ A;  1H0B A;  3NST A;  4ONU A;  3OGV A;  4NAO A;  1ND3 B;  1YRZ A;  1KDM A;  3T1M A;  3I2H A;  2VNO A;  4AEK A;  3QD6 A;  3M3Q A;  2ES3 A;  2VVE A;  3LE0 A;  4FXK B;  1T2X A;  4R9D A;  5FLI A;  3WNK A;  1RUN A;  2DUQ A;  4QGM A;  3LIG A;  3VDB A;  1UYY A;  4F3J A;  2WAO A;  1B35 C;  1PK6 B;  1RUF 3;  5FP7 A;  1SPP B;  3H3U A;  2OYZ A;  3WDU A;  3OPZ A;  2OA2 A;  4DNY A;  4LIU A;  3WP5 A;  5A33 B;  5F3C A;  3BPS A;  1XXN A;  5A1L A;  3JCI A;  1F9K A;  4E4D X;  4OZO A;  1RUC 1;  1C3H A;  4GB3 1;  3PTR B;  5C70 A;  1WD4 A;  2ET7 A;  4FPC A;  1O3R A;  2W9X A;  4I01 A;  2WYF A;  2Y8K A;  3UV9 A;  1WW6 A;  2FZ2 A;  1W2N A;  5JR2 A;  1PHM A;  2ZGS A;  3TEX A;  4IEV A;  4YM0 A;  1ND2 C;  4EN9 B;  1I5Z A;  3C7H A;  3K46 A;  5DZF A;  3A0N A;  3PU8 A;  3ACF A;  4QPI A;  1M06 G;  2IFR A;  1SLC A;  4D94 A;  1OUX A;  2ZAC A;  4HPK A;  1POV 0;  2E53 A;  5JCT A;  2A3Y A;  4O9G A;  4OUE A;  4Y20 A;  3U75 A;  3VN4 A;  2W52 A;  2X8K A;  3OF1 A;  4D6R A;  4JGZ A;  5HPO A;  2ARB A;  1Q8V A;  1NQD A;  2BJS A;  1BBT 3;  1RMU 1;  3N9P A;  2CYF A;  4JRA A;  5ANQ A;  5BY5 A;  1FNY A;  4QB6 A;  2RDR A;  3DGT A;  2VMI A;  5CAZ A;  2DCZ A;  2ZHM A;  2K9Z A;  4XQW A;  1JH5 A;  1CAV A;  2ZX2 A;  3GM8 A;  4R8H A;  2QNK A;  4QX7 A;  1H2L A;  1G6N A;  3SQO A;  4YZ5 A;  1BEV 3;  4XMA A;  5C8W A;  2XON A;  3VUO A;  2WS9 3;  4CEY B;  4FSJ A;  2GAU A;  4LE4 A;  1RMU 2;  4GZ9 A;  4L2N A;  2PQQ A;  4DY5 A;  3PLQ A;  2BWC A;  3B93 A;  2D44 A;  4K6B A;  3VBF A;  2RR1 1;  2W68 A;  3AK0 A;  5FO7 B;  2P1B A;  5F6L B;  4XFH A;  2R06 3;  3HN3 A;  4PLO A;  1DP0 A;  5FZG A;  2R04 2;  4K7J A;  1AR7 3;  4LBQ B;  3UKN A;  3LIH A;  4ZS3 A;  5EIY B;  1CWP A;  1N3O A;  1RJ7 A;  2VR4 A;  4NHK A;  1NA1 B;  2WLP A;  2Y6F A;  1AX2 A;  3VBU A;  4K20 A;  1HQN A;  3QH6 A;  1OFN A;  1PX4 A;  1V9U 1;  3ITQ A;  4YGB A;  3FL7 A;  3K4Z A;  1AR9 1;  3J4U H;  4HT1 T;  4CCL A;  2WII B;  4TXW A;  2D5F A;  2XWB B;  1GBG A;  3NV3 A;  1R09 3;  3BOP A;  4D7Y A;  2W0X A;  4QQ2 A;  2JJ6 A;  4HSJ A;  3THP A;  4AL9 A;  1V9U 2;  1CX4 A;  4W6Y A;  5EJ1 B;  1AXY A;  1H1I A;  2W08 A;  1STM A;  1UMI A;  1XYN A;  1YNA A;  2UYA A;  1F31 A;  3M1H A;  4GH4 A;  5FLH A;  5CFD C;  1LOC A;  2E6V A;  1Q8Q A;  1SLT A;  1M4W A;  2OZJ A;  3C7G A;  4ISR A;  1LR5 A;  1DIW A;  1RUD 3;  5A7O A;  3VBS C;  5F37 A;  5IVV A;  2Q8C A;  2ZTN A;  3III A;  3CJI C;  2JIG A;  2WFF 3;  3ZPO A;  2F17 A;  3PIG A;  2ADD A;  1TME 1;  4N7I A;  4ATF A;  3LFI A;  1PNF A;  4QX2 A;  3KT1 A;  5ACA 3;  3V0A A;  3AYC A;  2UYB A;  2WZR 3;  4AFB A;  4AFA A;  5LAT A;  2PXJ A;  1GIC A;  2VMG A;  4M4R A;  3RDI A;  4BHP A;  5A7W B;  3ZN4 A;  1ULO A;  5BV6 A;  3AMP A;  2IC1 A;  3A7Q A;  1JZ3 A;  2OQ7 A;  1RUE 1;  5DAW A;  1TME 2;  4M00 A;  2LW8 A;  1DGR A;  2RS3 3;  4XFA A;  5ABJ C;  4GQ7 A;  3GAL A;  4S2H A;  3OEA A;  3BOW A;  2HWC 3;  2YFZ A;  4IES A;  4MXW A;  5GLV A;  3O1R A;  4PDW C;  5JZG C;  1YYN A;  4GWI A;  4ISQ A;  1RYY A;  4YZ4 A;  3B3Q E;  3ROU A;  1QJU 3;  1HXS 1;  2YU1 A;  1AUY A;  1PGW 2;  2P17 A;  2VOK A;  4BQY A;  4YSF A;  5DXD A;  4FPL A;  4P9W A;  5J36 A;  2EXJ A;  1H30 A;  4XAC A;  4ZXK A;  1ULG A;  1ULC A;  2PN5 A;  3WQ1 A;  2RM2 2;  5FIX A;  4IQP A;  3HQU A;  3DYO A;  4FCA A;  1UOG A;  1X9T A;  2BER A;  1OQE A;  4YVW A;  2TUN A;  4BQW A;  1LHW A;  5HCA A;  3KSC A;  5AC9 2;  4LHL A;  4OYU A;  3DUI A;  5DN2 A;  3USU B;  4M0H A;  2PTM A;  4AVA A;  3BB6 A;  4CDQ C;  1LOE A;  2V4A A;  3WP3 A;  3ILN A;  3GZA A;  5FPU A;  4PIZ A;  2SBA A;  5KHK A;  1XE0 A;  5BNN B;  3M8L A;  3WNP A;  3M3E A;  1COV 2;  1FPN 1;  1MS8 A;  1RB8 G;  2D6N A;  3WNX A;  3CJX A;  2W3J A;  5JXI A;  1PVC 2;  1O5U A;  2QFE A;  5GZF A;  2W46 A;  4FPK A;  4MVT A;  5ERL A;  5LBE A;  1YXW A;  4DXT A;  1ZZ8 A;  2PHL A;  5AVP A;  4KWK A;  2I45 A;  4YW4 A;  3ZFF A;  2ZOE B;  1ULD A;  2NMN A;  3RZM A;  1N3Q A;  2OVU A;  1VRH 3;  2Q1F A;  3AYE A;  3ZFG C;  5F5Q A;  3I49 A;  1BQP A;  3J8F 3;  5D8A A;  2W39 A;  3HT2 A;  1QNY A;  1GWL A;  3ABZ A;  3DN7 A;  3ZYR A;  5FK7 A;  4AI0 A;  4OI1 A;  2BUK A;  1JTZ X;  4WVV A;  2KM2 A;  4IXL A;  3EB7 A;  1S4C A;  2GMM A;  2JX9 A;  1ZRI A;  2QKD A;  3H1M A;  1Y43 B;  2IVJ A;  4Q4Y 3;  2X53 S;  2WUH A;  4A7Z A;  2DFB A;  3RZH A;  5CFC C;  3W21 A;  2LTN A;  2XOM A;  3NJV A;  1GFF 2;  4MGT A;  1QJY 2;  4LHS A;  1LHV A;  3M7A A;  2GP5 A;  1UOJ A;  1H8V A;  1GKB A;  1UZW A;  1GWK A;  1N1Y A;  2XBO 3;  1S1A A;  3ZR5 A;  3I97 A;  1X7N A;  1AVB A;  4WM7 C;  1YIF A;  2VUA A;  1TMF 3;  3I59 B;  3JBG 2;  5EJ3 A;  4I3P A;  4XBQ A;  3ZPY A;  2DVA A;  4Z1V A;  2FQP A;  1QDO A;  1IG3 A;  1HB4 A;  2YPJ A;  3S7E A;  4Y1U A;  5L9R A;  2G9F A;  3SH4 A;  2B4K A;  1E5R A;  2VBB A;  4ERO A;  3PUS A;  4NWW A;  4Q8L A;  5HCB A;  3E1F 1;  3LZZ A;  1W6P A;  3NVC A;  1R08 3;  2VQ0 A;  2XKP A;  3H3Z A;  3ZSK A;  3UGF A;  1SDW A;  1VLN A;  5FP9 A;  4CCN A;  3FUQ A;  1QQP 3;  4J1X A;  3L2Y A;  3KT4 A;  4NN0 A;  4DPN A;  1QNW A;  3AXE A;  1V6L A;  3AYD A;  4MUV A;  4MGQ A;  5AFE A;  3FHQ A;  4TZD A;  5CAD A;  4WBB A;  3BCW A;  1O8S A;  1UAI A;  3LWC A;  4EQV A;  4Y22 A;  4KQ7 A;  1OC1 A;  2Q8E A;  5C6C A;  2UY8 A;  3MLL A;  1GOH A;  2QJV A;  4DUX A;  5I0D A;  4FFG A;  1PO2 3;  4AED C;  4BQ5 A;  4DXS A;  4EWD A;  2Z2S B;  5C3R A;  5HV4 A;  4Q0U A;  1J58 A;  3AB0 A;  2ILM A;  3ZXE A;  2FD8 A;  1UL9 A;  4F7Z A;  5F7U A;  1VBD 2;  2P6H A;  3QOP A;  1XNC A;  4GKX A;  1RUJ 3;  2V5D A;  2JE9 A;  4XOG A;  2W1Q A;  2C9A A;  4FPH A;  4GMP 1;  1C28 A;  1RUI 2;  1RTV A;  2JB8 A;  1F5J A;  3H1Y A;  5E8A A;  4GD4 A;  1QOT A;  3H9A A;  3GGL A;  1MAC A;  1OT5 A;  3ZMN A;  1RL3 A;  2JDY A;  4QGN A;  5F39 A;  4BXF A;  5C33 A;  1BHG A;  3AX4 A;  2A71 A;  4JZR A;  1W9W A;  2AUY A;  2RJK A;  1DG6 A;  3N9O A;  1OXC A;  5FZL A;  2BOJ A;  4CEY C;  5FTT C;  3NNM A;  2KA3 A;  1JS9 A;  4QMA A;  4BIO A;  4AHW A;  1LEN A;  5BNO C;  3BI3 A;  3I2K A;  4BDV B;  4NOT A;  2IVI B;  2J1E A;  1U0A A;  3W20 A;  1CZT A;  2D6O X;  4C91 A;  5K0U C;  2BTV C;  2BVV A;  2HKX A;  3QBQ A;  2OPW A;  5JI9 A;  1W6N A;  3MIF A;  4AVC A;  3CF6 E;  4Q27 A;  3RVH A;  4P5Y A;  2Y6K A;  4IEU A;  1NY7 1;  1QDC A;  1K5J A;  4M4P A;  4P9I A;  5T5L A;  2YRO A;  1A3K A;  1AYN 3;  2ZZJ A;  1S0B A;  3RPQ A;  1RUF 2;  4QDQ A;  3ES4 A;  4LA3 A;  3RWN A;  1EPZ A;  1G8W A;  1T6B X;  3CDZ B;  3IPV B;  1IS5 A;  2WIN B;  2FDJ A;  3HMY A;  4MGK E;  1NY7 2;  2X5I A;  1ASJ 1;  4RHV 3;  4S2G A;  2VVD A;  3HD8 B;  3ZKU A;  1D4V B;  2ZHN A;  1BLZ A;  3FLR A;  4GWJ A;  1SDD B;  3TN9 1;  2VUJ A;  5IVB A;  4NII A;  4JCK A;  3UGG A;  3TYJ A;  2PHX A;  3DXU A;  2DBI A;  2P5B A;  1IHM A;  5KXD A;  1LUL A;  3IAP A;  4LIT A;  5EWS A;  5ACA 1;  5FZC A;  1HX6 A;  5K9Y A;  4RQP C;  4XFF A;  5FY0 A;  3ZN6 B;  1ALY A;  4BME A;  1W90 A;  5F3G A;  2A73 B;  2R16 A;  4AZZ A;  2VTF A;  1KS4 A;  3AL6 A;  3TOJ A;  5KXE A;  3VV1 A;  1URX A;  1BBT 2;  4UW3 A;  1RXF A;  3VKL A;  4N9H A;  1LOA A;  4IGQ A;  1FOD 3;  4BK5 A;  5FR3 A;  3KT7 A;  4R4X A;  1KEX A;  2OKX A;  4KBZ A;  2EA7 A;  3C3V A;  3WDV A;  4FAH A;  3OBT A;  3NKT A;  1BEV 2;  1RHI 1;  3R0R A;  1MEC 3;  4XFB A;  1H2M A;  3KLS A;  2WS9 2;  2AEY A;  1HRI 3;  1JXN A;  1O59 A;  2VEC A;  1QJF A;  2B9V A;  4FI9 A;  4JAA A;  1K5M C;  2QTW B;  1FMD 3;  4LKF A;  4D69 A;  2PAM A;  5C3S A;  2XKO A;  2ZGO A;  3CKH A;  1KRI A;  1O4T A;  1DYO A;  4IE4 A;  1AJO A;  1VMF A;  4AE2 A;  4FFI A;  4GWN A;  1WW7 A;  2A75 A;  4NIA A;  2AC1 A;  2ZML A;  1QJZ A;  3GNE A;  3AKQ A;  2ARC A;  4NID A;  5JXG A;  1GOG A;  1G9D A;  1YLL A;  1TNF A;  1EY2 A;  2BWA A;  2JG9 B;  5JDB A;  3GBG A;  4XBL A;  4YW1 A;  4UFL A;  1AR8 2;  2QQN A;  2XGX A;  1PK6 A;  2XQX A;  4RFR B;  1XNA A;  3JB4 C;  2ZGL A;  4V1P A;  3S5A A;  4QX3 A;  5LY1 A;  3D3A A;  3URF A;  4CE8 A;  2WKK A;  3POF A;  1QWR A;  2XPJ A;  2ZX4 A;  4RS5 C;  1R09 2;  2VZR A;  2Q8O A;  4BQ1 A;  5FJK A;  2GH8 A;  3RI9 A;  4FFF A;  5FUI A;  1YC6 1;  1TZO A;  3T30 A;  5JR7 B;  2E63 A;  2CDO A;  3V56 A;  2EXI A;  4B7K A;  2PHW A;  2VW2 A;  3HVD A;  2JDZ A;  2ZGK A;  2QQL A;  1RUD 2;  2XG3 A;  5DAX A;  2HYK A;  2DCY A;  2IXC A;  5JPN B;  4Y1Y A;  5GZG A;  3FC0 A;  3G7D A;  4Q1P A;  2B39 A;  3N9N A;  3PUH A;  5I91 A;  3SLI A;  1J3Q A;  5A3P A;  1NX9 A;  2WZE A;  2ZGU A;  3E6C C;  4UOJ A;  1OOP B;  2WAB A;  4OMC A;  5HBA A;  1CGP A;  1GZ9 A;  3KVB A;  2RMU 3;  1PM4 A;  2FDG A;  2Q4S A;  3ZMO A;  4KBB A;  1AR6 3;  3WY6 A;  3AM2 A;  4I0W B;  4Q29 A;  4DZG A;  1RUC 3;  3AL5 A;  4BB3 A;  2RS3 2;  4QPG A;  3T09 A;  2LRO A;  2W87 A;  4Q4V 1;  4UBH A;  1FAY A;  1NCR C;  2Y0I A;  5AVA A;  2HWC 2;  4ET7 A;  4KGQ A;  1VBB 1;  3BN6 A;  5LBB A;  2ZS6 B;  4WZC A;  3RZG A;  4EWE A;  1S0D A;  1SCR A;  2W91 A;  5H9R A;  4C8D A;  1PIV 3;  4CDU C;  1HV0 A;  1MZ6 A;  4LBQ A;  3GZU C;  1RUO A;  1SFY A;  4Q4V 2;  3SHR A;  1NA1 A;  1VBB 2;  3PUI A;  4QB1 A;  5DUU A;  1B35 B;  3BAL A;  1UZ0 A;  1F15 A;  1WW5 A;  2JD4 A;  3NV2 A;  4OI4 A;  4A6O A;  1JI6 A;  3OBZ A;  4H3W A;  1UPI A;  3JB8 A;  2PYT A;  5FCC A;  5L9V A;  4A6S A;  4BYY A;  1A34 A;  4NPM A;  3WDW A;  3ZKY A;  4A2U A;  4N90 A;  5FZO A;  3QAC A;  2FDK A;  5FXZ A;  3O14 A;  3HEI A;  1W0N A;  2RDQ A;  4D6Q A;  5FRA A;  1XRU A;  1W8O A;  1ND2 B;  4XUN A;  4XUR A;  1GZC A;  3RQ0 A;  5BNP A;  1LU2 A;  1GZW B;  3M3I A;  4NAM A;  4J1W A;  1FYU A;  5E88 A;  3O0V A;  1UO9 A;  5I8S A;  4CCK A;  3M3C A;  4QKN A;  3PJQ A;  3TNP B;  1PMJ X;  1F2N A;  4IUG A;  4DY3 A;  1SBF A;  5T5O A;  3N4M A;  1JW6 A;  4XF0 A;  2VXJ A;  4YW6 A;  1YFU A;  4AI1 A;  2YC2 A;  2DF7 A;  2UWC A;  3EJK A;  5A7N A;  2D3R A;  1CON A;  4Z2W A;  1VRH 2;  3NQH A;  3IDC B;  1XU1 A;  3E5X A;  1XNK A;  2Y6L A;  4ORF A;  4FPY A;  4YYO A;  3LQC A;  4LEJ A;  4AI9 A;  1K42 A;  3LA7 A;  4B29 A;  4Z92 B;  1O3S A;  1VBA 3;  1GR3 A;  1ST8 A;  4RFT 0;  3LEM A;  3S57 A;  2DYC A;  2JXA A;  2XJS A;  4FPJ A;  2HWE 3;  2DCJ A;  3DF0 A;  4MYE A;  4QX1 A;  1AL0 G;  1PGS A;  4IV1 C;  1W8U A;  4N43 A;  2PLV 3;  1XE8 A;  2ET1 A;  1N47 A;  1EP0 A;  1ENS A;  3KF3 A;  4FP2 A;  3T0D A;  1RVF 1;  1SQ4 A;  3KMH A;  4WVW A;  4XIK A;  2IXK A;  4YM3 A;  2XBO 2;  5IVY A;  4CUA A;  4EE2 A;  1W8H A;  1MS9 A;  4P5H A;  1TMF 2;  5KWR A;  2CAU A;  1QXR A;  4CDW C;  1JZ8 A;  4DB5 A;  5DDJ 1;  4N53 B;  2JB4 A;  4QWN A;  4CCJ A;  3FLT A;  1AF9 A;  1D4M 2;  2Y6G A;  3L9J T;  4GAZ A;  3LGR A;  4JX0 A;  3WUC A;  1RVF 2;  3JD7 2;  5EV7 A;  4QHB A;  3SKJ E;  1D0H A;  1UW8 A;  2VE1 A;  4GKY A;  4WM8 C;  4XPV A;  1OQD A;  2WO3 A;  3O1M A;  5GLZ A;  1RUG 3;  2PFW A;  3VBO B;  2XVK A;  4ZKT B;  1IS4 A;  2ARA A;  3N35 A;  5K4L A;  4IER A;  3TEW A;  4JKM A;  5C9A B;  3UKV A;  3BGA A;  1VAV A;  3K2O A;  1XNT A;  1W05 A;  2QQV A;  4P9Y A;  1CAX B;  1O8P A;  1W6M A;  2DV9 A;  2WNU C;  2LM3 A;  2A7A A;  5BNN A;  3RI8 A;  4LE3 A;  3ALQ A;  1PO2 2;  2W47 A;  1YQ2 A;  2CY6 A;  5CFD B;  3DYM A;  5LBC A;  3VBS B;  2C6S A;  4BMB A;  3ZXA C;  1H2N A;  4AW7 A;  5C4W A;  1HXS 3;  3AP7 A;  3CJI B;  3JU9 A;  2Q0A A;  1U12 A;  1QJX 1;  3PTY A;  1RUJ 2;  4PF1 A;  5IAV A;  3KF5 A;  1V70 A;  4QU1 A;  2ZEW A;  2CU5 A;  5L7O B;  4D6S A;  4AEM A;  2WO7 A;  2R32 A;  5LEK A;  3AVS A;  5A1A A;  2FMY A;  4QPI C;  4RL7 A;  1W2T A;  1JU3 A;  2JG8 C;  4JGY C;  4YVS C;  3T4H B;  4D7T A;  2R07 3;  4EZ4 A;  2GAL A;  4IW3 A;  5FPZ A;  4AI2 A;  3O0W A;  5ABJ B;  1FV3 A;  4PDW B;  5JZG B;  4Q2F A;  5DUW A;  4FPE A;  2Z4F A;  4FXG B;  5LA9 A;  1ZRD A;  4F8A A;  3CZU A;  2DTY A;  1DQ6 A;  3B9C A;  1O3T A;  1VPH A;  2A6Z A;  3VD9 A;  2G1M A;  4B4Q A;  3DCQ A;  3I59 A;  3U14 A;  1D2Q A;  5JWP A;  5B4X A;  1MZ5 A;  2UY9 A;  4PIX A;  1ZBA 1;  2VCB A;  3U37 A;  1R1A 2;  1W6O B;  4KU8 A;  5LW9 A;  4UFJ A;  1KXG A;  2OZ6 A;  2RS1 3;  3FZ3 A;  5BXX A;  4C0B A;  5A3U A;  1CAW B;  2JDP A;  4FBF A;  3PVO A;  2E51 A;  3POW A;  1UZV A;  2VMC A;  2Z79 A;  4CDQ B;  5KC6 A;  3J9S A;  1LU1 A;  4EN6 B;  1PZ7 A;  2HWF 1;  1X36 A;  4N8M A;  3OJB A;  4RHV 2;  3P5B A;  2YGL A;  5IYY A;  1NXM A;  2GNM A;  3ZSE A;  5IK4 A;  2WQ4 A;  5I8T A;  4HET A;  3GXU A;  3WW1 A;  2XJP A;  4YM2 A;  1DHK B;  3QCW A;  2FMD A;  3VKO A;  5ISL A;  2FDI A;  1E5I A;  1DBN A;  3SMH A;  4FP3 A;  5SV8 A;  3AMQ A;  4S2F A;  3WNN A;  5LY2 A;  2W5F A;  2JEC A;  1NCQ C;  1IS6 A;  1V00 A;  2R30 A;  2XLG A;  3VDD C;  2A6W A;  1SFP A;  2H0V A;  2LS6 A;  4JKK A;  2P4E A;  3JXS A;  1GOF A;  3LPG A;  5FZ9 A;  3VHN A;  2OT7 A;  2YG0 A;  5HCH A;  1NE6 A;  5DPN A;  4UT5 A;  3BTZ A;  4AFD A;  2BPA 2;  2D40 A;  1ULF A;  2I74 A;  4AF9 A;  3POY A;  1EYB A;  2BU9 A;  2PAK A;  4I09 A;  1KGY A;  1UOB A;  4PJY A;  3LOI A;  4CCE A;  1A8D A;  1FOD 2;  4GH4 C;  1RGS A;  2A6V A;  1GQP A;  3GF6 A;  3U4S A;  3RYP A;  5A80 A;  4UW4 A;  1UX7 A;  2QDR A;  5CFC B;  2Y60 A;  1CZV A;  1ENR A;  1MEC 2;  3HJR A;  3IDA A;  1LOD A;  2EXH A;  1H6Y A;  3NJX A;  2ID4 A;  4CP0 A;  3U0Z A;  1FMD 2;  1PNG A;  2ZX3 A;  1REF A;  3Q8A A;  4QPY A;  4WM7 B;  2E7A A;  3HNY M;  5FXW A;  5BNQ A;  4BWO A;  4I2O A;  2GMP A;  2GC1 A;  3T1L A;  2VZO A;  2WWJ A;  4XF4 A;  4XJU A;  1NZI A;  3UES A;  3LA3 A;  4AQT A;  3K48 A;  1FT9 A;  4QT6 A;  2YFU A;  4CCM A;  2TBV A;  4HXC A;  1CJD A;  3N7L A;  3RNS A;  2RS5 3;  2VBP A;  2DCK A;  3FFQ A;  1Q8P A;  2DDU A;  2X10 A;  3HQX A;  3SH5 A;  4AQ6 A;  4XTP A;  5A6X A;  5IJR A;  4PBP A;  1HN1 A;  3KHB A;  4FOW A;  1UPS A;  3S5Q A;  1LGB A;  4XIL A;  4E4Z A;  2ZJC A;  3B7M A;  1BVP 1;  2WNE A;  4XJ8 A;  1CAU A;  2VGD A;  2WNV A;  2BFU S;  1PGL 2;  4XAB A;  5IUQ A;  5I93 A;  5CIR A;  2WQZ C;  3AC0 A;  4AED B;  4CTE A;  2B42 B;  3IM0 A;  2QQM A;  3ZO0 B;  3MLJ A;  4KWJ A;  4QM9 A;  1TNR A;  1WW4 A;  4D8M A;  4BQX A;  4SLI A;  4CPB A;  2V4V A;  2WZ8 A;  4YVW C;  3SXW A;  4CDX B;  1JYC A;  4LR4 A;  3ZN6 A;  1ZBE 1;  3LEI A;  5DQ0 A;  3VBR C;  5IFT A;  1EV1 2;  4J25 A;  4G9S B;  4XUP A;  5F32 A;  3PUR A;  4M3C B;  2VNG A;  1LEC A;  1LOF A;  1TEI A;  4K1Z A;  4KL1 A;  2GN7 A;  1S0C A;  1W8N A;  4CXY A;  3OGR A;  1KJL A;  4MGI E;  3WVJ A;  2JIJ A;  1ACC A;  1V6M A;  2GSY A;  3GJA A;  2R04 1;  4G3Y C;  4MET A;  5FMC A;  1ZBE 2;  3ATG A;  4LUL A;  4BZ4 A;  3PU3 A;  5DG2 A;  3ZFF C;  4TTG A;  2W1W A;  2JKB A;  3PVB B;  4P14 A;  4B7E A;  4FOV A;  4OHV A;  4B1M A;  5BNO B;  2JE7 A;  4QXB A;  3B9I A;  2SLI A;  3EMR A;  4Y1X A;  5CNA A;  2R0F A;  5GLT A;  5K0U B;  2JD9 A;  3Q9O A;  3BPZ A;  1DGW A;  4DRV A;  3O1T A;  3ZDV A;  4C1X A;  3NO8 A;  4E2Q A;  4N53 C;  2Z42 A;  2QQO A;  1S0E A;  2C24 A;  4LXL A;  4AR2 A;  2JDA A;  1NE4 A;  3W58 A;  1EUT A;  3VBO C;  3ZSL A;  1FI2 A;  1RUH 3;  5KC5 A;  3A21 A;  5T5P A;  4EYU A;  3VD3 A;  4YFZ A;  2ZGQ A;  1PVX A;  1JZ6 A;  1SEF A;  4Y4Y A;  5A6Z A;  2E26 A;  2B45 X;  5C9A C;  1JYV A;  3T2T A;  5JPM B;  1W2O A;  2DVB A;  4XBN A;  1UOF A;  4Y1Z A;  3VLB B;  3CEW A;  4K21 A;  3VB9 A;  3OEB A;  3Q8C A;  4XCA A;  1JOP A;  1SBD A;  5IT6 A;  4QQO A;  3T08 A;  3O12 A;  3I2O A;  3JQX A;  3RRD A;  3O1V A;  5FBZ A;  3RGB A;  2WQ8 A;  3O1S A;  1OLM E;  3POE A;  4RD7 A;  1VIW B;  1L3J A;  3PME A;  2HBU A;  4RQP B;  2N7G A;  5LB6 A;  5C7G A;  1H6X A;  5JIA A;  3AVR A;  3FN9 A;  4FTS A;  2BEO A;  2MNG A;  1KIT A;  2GU9 A;  5FZM A;  2I07 B;  3J26 N;  1WBF A;  1DZR A;  3THD A;  3ENR A;  5L7O C;  3MZH A;  3R4S A;  2ZZQ A;  4CRQ A;  4XFI A;  3BTX A;  3DPR B;  1PGW 1;  2Q8D A;  1XU2 A;  4S2D A;  2HWE 2;  3KV6 A;  2EAL A;  3CNA A;  4NMI A;  1ZYB A;  4Q4X 2;  1XPW A;  1GNY A;  1K5M B;  3IMN A;  2ZMK A;  4XDP A;  5C3Q A;  5A3O A;  4L97 A;  2XH6 A;  2RM2 1;  4DO0 A;  1RC6 A;  1W2A X;  5HV0 A;  3CQO A;  3RG0 A;  1U5Y A;  2J1U A;  2RDS A;  2JEM A;  1W8T A;  3LFM A;  3RS6 A;  5AC9 1;  1NOV A;  2X05 A;  2AAC A;  4ARX A;  1POV 1;  5C5U A;  4MH0 E;  4XUO A;  4COY A;  1VB2 A;  2EID A;  1UYP A;  4ES8 A;  4LO4 B;  1WUV A;  5KHI A;  4NVP A;  1FXZ A;  1LHU A;  1WCQ A;  2Y26 A;  3KV9 A;  3NV1 A;  4CP2 A;  4RR3 C;  3S7I A;  1B35 A;  1RUG 2;  4DUV A;  3K3N A;  2CSG A;  3VKN A;  1COV 1;  4AFC A;  4AWD A;  1G9C A;  3ZXK A;  4ASM B;  1PVC 1;  1MR5 A;  1AL2 1;  4DIQ A;  3K4A A;  4RGK A;  5FXV A;  2BDR A;  1VAL A;  2IWG B;  2XL9 A;  1DYK A;  1QHD A;  4RS5 B;  5FJH A;  3VBH A;  5H9P A;  5JOY A;  4LOR A;  3H0O A;  3KVA A;  3B02 A;  1RXG A;  4TLG A;  1ZZC A;  3PL0 A;  4FPF A;  1JZ2 A;  1ND2 A;  4XQD A;  4IV3 B;  1HRV 2;  2XJV A;  4YZ2 A;  1HQW A;  1AL2 2;  1WZX A;  3NNG A;  2G9Z A;  1T6G C;  2W94 A;  4KWU A;  2PMW B;  4HSL A;  2WLQ A;  3BU0 A;  4OVE A;  1BMV 2;  2D6M A;  3WF3 A;  3HWJ A;  3ME2 A;  5JXH A;  5LEJ A;  1QJY 1;  3OYW A;  3WDT A;  3ZYF A;  4Q4W 3;  2C0Z A;  1S2B A;  3IDE A;  5EJZ B;  1XYP A;  3HN1 A;  4OLL A;  3JBG 1;  2VQU A;  3UL2 A;  3NAP B;  1HLC A;  1SZB A;  2BGC A;  3TNQ A;  1DFQ A;  2PHR A;  3CMG A;  2XR4 A;  1KJR A;  3AZY A;  2PHU A;  4UAP A;  1NCR B;  4KWL A;  1XNB A;  4CYD A;  1MQT C;  2H6B A;  1J83 A;  4COV A;  3BUC A;  2Y38 A;  4NRP A;  1C8N A;  2VTX A;  1HJG A;  2XJR A;  1VBC 3;  4E9K A;  4B3N A;  1LTE A;  4QQH A;  2R7E B;  4XDO A;  4GIQ A;  3WIN E;  1Q5O A;  3KQ4 B;  1ULE A;  3MO4 A;  4CDU B;  4LLO A;  1WD3 A;  4JC1 A;  2CGN A;  4XC9 A;  5FMO S;  1JUH A;  3GZE A;  5CB7 A;  2ZX1 A;  5FZH A;  2JDH A;  2ZGT A;  4UFM A;  1JZ7 A;  5JSR A;  2DUP A;  3I2J A;  3VZN A;  2XJQ A;  1C8M 3;  5GZD A;  1HQL A;  3U07 A;  2VZU A;  3PJY A;  2RS1 2;  1BZW A;  2YY1 A;  3B94 A;  3WF4 A;  1AYM 3;  5A70 A;  2WAA A;  4MGY E;  4CZS A;  2E7T A;  3MF6 A;  2RG4 A;  1Z7S 1;  3J7M A;  3MPP G;  3R4U A;  1ZNP A;  4E2G A;  4HK9 A;  1VBD 1;  3E5U A;  4XEZ A;  4YGD A;  4N7U A;  1K12 A;  4AYU A;  2I2S A;  3VGI A;  3GJB A;  3WD5 A;  3O1P A;  1RUI 1;  5GZE A;  1OD5 A;  4BU2 A;  4H7M A;  1I9R A;  1NQJ A;  1ZZB A;  3U11 A;  5CIS A;  1PO1 3;  3P6B A;  4XJW A;  1W0O A;  1Z7S 2;  2ZGP A;  3OUI A;  1S2E A;  4XAA A;  4CDX C;  2WZP P;  2RHP A;  5D2A A;  4I3G A;  4OHZ A;  3POI A;  3BKZ A;  3V0B A;  4XTM A;  1F4H A;  4Q1R A;  4AAP A;  5FQ0 B;  2Q1M A;  2V72 A;  2FZ1 A;  1J3R A;  3B69 A;  1CIY A;  3OPW A;  2D5H A;  2PAE A;  5FPX A;  2GC2 A;  4PQ9 A;  4W6W A;  2ZAB A;  1XOY A;  5FP8 A;  5FZ1 A;  1PMI A;  4RGA A;  4HMZ A;  4ZS2 A;  2VU9 A;  4IV1 B;  3UT0 A;  3MUZ 1;  4RA0 A;  4E4H A;  4W50 A;  1BCX A;  2E33 A;  2HWB 3;  2KD7 A;  5IVC A;  4CEW B;  5GLU A;  2D98 A;  4D0Q A;  4OZX A;  2CV6 A;  4PDW A;  4CCC A;  1UXZ A;  1RUF 1;  3RMY A;  1DGL A;  3IMM A;  1W9F A;  4CDW B;  3S0M A;  4IEP A;  3P1I A;  1UQX A;  3EYP A;  4I0A A;  3N9Q A;  4XAE A;  2WT2 A;  4D7S A;  3I2I A;  4XJA A;  4XXA A;  2UU8 A;  1HW5 A;  1PZ8 A;  3NJZ A;  4WM8 B;  5GJ6 A;  3N7J A;  2RS5 2;  2WL1 A;  3WUD A;  1ODM A;  4A45 A;  3KB5 A;  4Y24 A;  4AQS A;  5LRS A;  1JZ4 A;  3Q8B A;  1Y3T A;  5CVR A;  1H2K A;  3NRU A;  5FYZ A;  3VZO A;  4UW6 A;  2HWD 3;  1SLL A;  3APB A;  1PZ9 A;  1VRB A;  5A32 A;  1QF3 A;  2G4I A;  1ENQ A;  2VZV A;  4Y26 A;  4Q5O A;  2BVB A;  1V6N A;  4CSW A;  1E57 A;  1YWK A;  2VZQ A;  2VD7 A;  2D6P A;  2WNU B;  1EAH 3;  1GQG A;  2BQP A;  3CIH A;  1XND A;  4MLO A;  4CP9 B;  3SCH A;  1RIR A;  1Y7B A;  5EP9 A;  3WQ0 A;  3FX3 A;  1BBT 1;  4EN8 B;  4OI0 A;  3WCR A;  2VW0 A;  5J48 A;  4PLM A;  1ZRF A;  3D5O A;  2YC4 A;  5FZA A;  4NIH A;  1OPO A;  1DF0 A;  4XUQ A;  4LT5 A;  1DZQ A;  1BEV 1;  1UX6 A;  3KCY A;  1UU6 A;  2WS9 1;  3T2Q A;  4BCU A;  1ZBA 3;  5K8S A;  3ZFG A;  1VBE 3;  4XHB A;  3OY8 A;  1JOD A;  5JMC A;  3LA2 A;  1UCX A;  3ON7 A;  3TAY A;  2MEV 3;  4PT6 A;  4BLI A;  4EWA A;  5BNP C;  4QPI B;  4YVS B;  2X09 A;  4JGY B;  2JG8 B;  2NLR A;  4LBJ A;  3DPR C;  4QX0 A;  1ZRE A;  1HKD A;  4UFH A;  2CTV A;  4YWA A;  1DQ2 A;  1AR7 1;  1UYX A;  4JTO A;  4HPK B;  3MPB A;  2HWF 3;  2V5Y A;  5CFC A;  3K75 B;  4Y20 B;  5DUX A;  3IWZ A;  4LO5 B;  2XXZ A;  2P3K A;  4YG3 A;  4C1W A;  3A22 A;  2DWR A;  5CBL A;  4JGZ B;  3TEY A;  1KFX L;  4HN1 A;  2HH9 A;  1CR7 A;  3N3H A;  4PF5 A;  1AR8 1;  4RSU A;  4WM7 A;  5FYC A;  5FO8 B;  3U4X A;  1JYN A;  2LRP A;  2R06 2;  5FYM A;  1ND3 A;  4L8Q A;  5FV3 A;  1WA4 A;  1AR7 2;  2VUC A;  3I54 A;  4W4Z A;  3ZOI A;  3LPF A;  1US3 A;  3HNM A;  2BNO A;  4XJZ A;  1C4R A;  3CO2 A;  4H2A A;  1R09 1;  4NPR A;  4RYD A;  5CZK A;  4IND A;  5C8C C;  1RUH 2;  5CKQ A;  1SPP A;  4PI0 A;  4BJ0 A;  5JSP A;  5DG1 A;  1CJP A;  4OHX A;  3ZYH A;  5A33 A;  2D3S A;  5A3N A;  4L9B A;  1YJK A;  5FKB A;  4XDQ A;  1RUD 1;  3L2H A;  1NG0 A;  3JZV A;  1MS5 A;  2WFF 1;  4AK3 A;  3LEG A;  1US2 A;  3VBU B;  5AFB A;  2D97 A;  3WQ7 A;  3H8U A;  5IWF A;  4DRR A;  3FJS A;  2BGP A;  3AFG A;  3MGU A;  1UU4 A;  4I02 A;  1HDK A;  2QQW A;  2J1V A;  4IV3 C;  5FZI A;  4AED A;  4CCD A;  1DU3 D;  5F5A A;  4ASL A;  4ZON A;  3IKW A;  4O65 A;  4AGR A;  2YBK A;  3FBM A;  1NCQ B;  2LAL A;  4MO3 M;  3VDD B;  2WFF 2;  4H55 A;  1JHJ A;  1OSG A;  4MG2 A;  5FZD A;  2RS3 1;  1GUI A;  2BZD A;  4ZY9 A;  4E4S A;  1NT0 A;  2ZX0 A;  5ACA 2;  2HWC 1;  2QE3 A;  2X29 A;  2WZR 2;  4GJZ A;  2VZ1 A;  4YG6 A;  3THT A;  4Y5S A;  2AZ5 A;  1UY0 A;  5KXC A;  4GH4 B;  4WV8 A;  2F4P A;  1AJK A;  3NAP C;  1QJU 1;  2JDN A;  3OUJ A;  1WLD A;  4IEO A;  3WOG A;  4AEJ A;  5KHG A;  2ZGN A;  4GB3 3;  3UKT A;  2WJS A;  3VD4 A;  5C4W C;  3WDX A;  5HCF A;  4CEY A;  5CG9 A;  3IT8 A;  2BW8 A;  1ZZ7 A;  4LA2 A;  5FMD A;  1REE A;  5BNO A;  3V0A B;  5EXO A;  2P3Y A;  5IW0 A;  3VL8 A;  3VHP A;  1QJU 2;  4A7K A;  2YHJ A;  3ZFE C;  4PI2 A;  1D7P M;  2WT0 A;  3CHX A;  1QKQ A;  1XB9 A;  1G9B A;  1U5X A;  4QXC A;  4YW7 A;  4MGZ E;  2GC3 A;  1MZE A;  1W6Q B;  3OTF A;  1TQ5 A;  1X8M A;  3MID A;  5FYH A;  4Y3O A;  1RMU 3;  3O0X A;  2GH2 A;  4MXW B;  5F6K A;  5CKN A;  2VM9 A;  3KD4 A;  2CGO A;  1S0J A;  5DAQ A;  2VZP A;  4UFI A;  2OPK A;  4W65 A;  1NLR A;  1W04 A;  4EJR A;  2GND A;  4U36 A;  5EZW A;  5L73 A;  1TVG A;  5KHH A;  2HLE A;  5LK5 A;  3VD5 A;  1JOB A;  3WP4 A;  5EFU A;  1MS0 A;  3FBY A;  5I0T A;  1J84 A;  1X8E A;  1VRH 1;  1WGP A;  2D3P A;  3MIH A;  2NP0 A;  4LTA A;  3VKM A;  2YDE A;  1IQD C;  3IBM A;  3IAQ A;  1PM7 A;  2QQJ A;  1W99 A;  2RR1 3;  4LK6 A;  3MW2 A;  4K3U A;  4QQL A;  5FYS A;  2FDF A;  1LOG A;  4YVW B;  4CUC A;  3A4U A;  1CPN A;  4BLJ A;  3I3D A;  5C3O A;  3WNM A;  4P00 B;  1W9S A;  2QQI A;  3MW3 A;  3WF0 A;  3VBR B;  1WWY A;  3USS A;  3ILR A;  4LKE A;  3F2Z A;  3DKQ A;  2EXK A;  3J8F 2;  2QQP A;  3F95 A;  4CXW A;  1V9U 3;  3K3O A;  5FY9 A;  5KHJ A;  2UWA A;  2XBO 1;  3J7H A;  4Q0V A;  1AR9 3;  2WT1 A;  3LB9 A;  3AMH A;  4G4F A;  1TMF 1;  1CN1 A;  5A7W A;  3VZM A;  1YUD A;  3OBR A;  3J7L A;  3S30 A;  4Q4Y 2;  5M0T A;  2JDM A;  5T3N A;  2QQK A;  3ZFF B;  4ATE A;  5FFO C;  1D4M 1;  4NO4 A;  3WCS A;  5G04 L;  2YV8 A;  1CPM A;  3JD7 1;  1ZX5 A;  5T52 A;  1H4H A;  3ZR6 A;  4CEW C;  2WDB A;  4RN5 A;  4IGO A;  2W92 A;  1R08 1;  3ST7 A;  3I2G A;  1MS4 A;  1VBC 2;  1ZZ6 A;  1YFY A;  1QQP 1;  3D0S A;  1QIQ A;  2WO1 A;  2Y64 A;  3H8X A;  2DVG A;  5J09 A;  2VNR A;  1H8T C;  4LBQ D;  3E6D A;  3VZK A;  1N3P A;  1TME 3;  3N7K A;  2VMD A;  3MFC A;  4Q0Q A;  3NNL A;  2QZ2 A;  2NPI A;  3MW4 A;  1N1S A;  1R08 2;  1C8M 2;  2JDU A;  3WV6 A;  1QOO A;  4YGC A;  5FYU A;  1PO2 1;  1QQP 2;  1SAC A;  2CAV A;  5CYY A;  5I0U A;  3ZSM A;  1AYM 2;  1PX3 A;  2R1D A;  3USU A;  3CLP A;  3S6P A;  1LAJ A;  1UZY A;  4FTE A;  4IEQ A;  1JUI A;  1WMD A;  4XJ9 A;  1O7F A;  1RUE 3;  3OSD A;  5F3E A;  1WLW A;  3OGJ A;  2VY0 A;  1RUJ 1;  5IVE A;  4QAW A;  3WP6 A;  3LDK A;  1TG7 A;  3N7M A;  1OD3 A;  4N9I A;  1NAE A;  1W6P B;  2GME A;  2VUD A;  3DYP A;  3WW4 A;  3LEK A;  2XUE A;  3ACH A;  4ZU4 A;  4QXK A;  1XJA A;  1HB2 A;  4LO7 A;  3WF2 A;  2VQT A;  3M4F A;  4HL0 A;  2OXB A;  4I30 A;  5C71 A;  3POG A;  2O1Q A;  5DMY A;  1OVP A;  2XLA A;  2XWJ B;  2J1T A;  4K1Y A;  4H7L A;  3RZL A;  5LA0 A;  5J3U A;  4LUM A;  3KWV A;  4Y22 B;  4IE0 A;  3N9L A;  4MX3 A;  2HEW F;  2WNV C;  4M3C E;  4FPO B;  1OF3 A;  3H42 B;  3ZIW A;  1OF4 A;  3E6B A;  4NRO A;  3W9A A;  2VJX A;  4QX5 A;  5FZ6 A;  3WG2 A;  4AGV A;  5LAS A;  3KV5 A;  1SLA A;  2ZHK A;  1DYP A;  1PVC 3;  5JSO A;  1A78 A;  1HV1 A;  3AMM A;  4V2V A;  1L7L A;  1MZF A;  1H9P A;  3MUY 1;  2JWP A;  2JE8 A;  1QOS A;  3N36 A;  4ZPI A;  2HWB 2;  3DKW A;  1R1A 1;  2J1S A;  3AMN A;  5DAV A;  4JQR A;  1DCS A;  1NCR A;  1AYN 1;  2WWS A;  4JGZ C;  2R6Q A;  1PMH X;  2J7M A;  3FMG A;  1LOF C;  1FPN 3;  2ZGR A;  5FOJ B;  3NWK A;  4OI2 A;  4P08 A;  4FT8 A;  1BJQ A;  2ZKN A;  4YAR A;  4X8N A;  3EQE A;  1LNS A;  1CQ9 A;  3SEP A;  4U2A A;  3AP9 A;  4QD2 A;  2DVD A;  4RHV 1;  4Y5Z 0;  2BBV A;  2DU0 A;  1JZ5 A;  1AYN 2;  1V6I A;  4E2S A;  5L19 A;  2XVG A;  1Y9G A;  5APA A;  3D8C A;  4BH9 A;  1GMM A;  4RR3 B;  1BYH A;  4FQ4 A;  2HBT A;  3VBF C;  2WNO A;  1CES A;  1UZZ A;  2BFU L;  1MS1 A;  4IGP A;  4Z8B A;  2E32 A;  4NPL A;  4FO9 A;  5GAL A;  2ARX A;  4O61 A;  2XQR A;  4MOA A;  4Q0P A;  4AOC A;  2VNV A;  2YU2 A;  1G86 A;  1YQ6 A;  4IE6 A;  3KV4 A;  2J1A A;  4R9C A;  3VBU C;  1IPJ A;  2R1B A;  2QBX A;  4TLF A;  3EHK A;  4ZZ5 A;  1OLM A;  4Z2A A;  1DDL A;  4BXS V;  2W1S A;  4L11 A;  1FOD 1;  2BRT A;  2DTW A;  3ILF A;  5T54 A;  5DUV A;  5LWB A;  1QY4 A;  3GCX A;  5D1I A;  1MEC 1;  1OH3 A;  4FOY A;  4KG8 A;  5FZB A;  1HRI 1;  3IZO A;  5FQ0 A;  3ECQ A;  1FMD 1;  1VBE 2;  1JBC A;  2B9U A;  3DEM A;  4YGE A;  3GCW A;  2YYO A;  1QH6 A;  1BK1 A;  3TWI A;  3MFA A;  1R64 A;  1WMF A;  4K9S A;  4JKL A;  1LED A;  1YQ5 A;  3ZM8 A;  4MHU A;  2VOV A;  2RE9 A;  4IV1 A;  1HRI 2;  2HJI A;  1VBD 3;  1R1Z A;  4QDS A;  3LF7 A;  1W06 A;  5HXM A;  3CL1 A;  1MQT B;  1X50 A;  2MHF A;  4LPL A;  3WG1 A;  4XFC A;  4A42 A;  1FV2 A;  3LCP A;  3ZN5 A;  1RUI 3;  4EV0 A;  5FY8 A;  4NRQ A;  1U5Z A;  1MVQ A;  4PBO A;  4Z07 A;  3NV4 A;  4BE3 A;  4CDW A;  4M0N A;  1UF2 C;  4LUK A;  4LBN A;  5FMB A;  3PIJ A;  1GAN A;  3VHO A;  2RDN A;  3NMB A;  4BPZ A;  1VB4 A;  1VMJ A;  4GMP 3;  4WM8 A;  3ZYG A;  1I1E A;  3H3L A;  2JDK A;  1OVS A;  1LGC A;  1WLT A;  2P37 A;  4XVH A;  4R9A A;  2H0B A;  2Y6J A;  1XBF A;  2FDH A;  3IPV A;  2VOT A;  3ZIX A;  2D93 A;  2RJL A;  4W8J A;  3LAG A;  1Z0H A;  1IKQ A;  4IDZ A;  4KMQ A;  1SG3 A;  1JYW A;  4JDM A;  1W9Y A;  4COU A;  1RED A;  4PHZ A;  2DVF A;  1EV1 1;  1C5I A;  1IQA A;  3X29 B;  2WNU A;  5B2G B;  4FQZ A;  2XJU A;  1LB2 A;  2EVX A;  1G7Y A;  4CP9 A;  2VBD A;  2VME A;  4AVV A;  3MHZ A;  1OA3 A;  4URA A;  5A3W A;  4OHY A;  3H8R A;  1JYT A;  2GP3 A;  2GNB A;  1IZ3 A;  2GC0 A;  4O7X A;  3WT3 A;  4AI3 A;  4CCO A;  1I5P A;  2RMU 1;  1V6O A;  2ARE A;  4JQT A;  3Q8E A;  3Q8F A;  3UJO A;  1AR6 1;  3B00 A;  3BYW A;  4CU8 A;  3VBH C;  4PQQ A;  4A7Y A;  2V73 A;  2GNT A;  2VZS A;  1WCU A;  1J3P A;  3GBW A;  1OA2 A;  1W28 A;  5FAX A;  5FWJ A;  4MHR A;  5J37 A;  3E5Q A;  2XJT A;  2ZMN A;  4V2W A;  1OHF A;  1UY2 A;  4GA9 A;  4WVM B;  3U78 A;  3H7J A;  5DZG A;  2RMU 2;  3MLK A;  1L7R A;  4UW5 A;  4YVS A;  4JGY A;  2JG8 A;  1OLQ A;  4UF0 B;  1U5I A;  1AR6 2;  2Z69 A;  1PIV 1;  1HJF A;  3MIB A;  2EF6 A;  4GXL A;  1RUC 2;  1ASJ 3;  1VE0 A;  3HOB A;  1LHN A;  4GB3 2;  3T0A A;  1O5L A;  2PA7 A;  2VAU A;  3LDB A;  1VJ2 A;  4JV4 A;  5FY4 A;  4A4A A;  1YQC A;  4PCR A;  2C26 A;  5C5T A;  2O8Q A;  2OUH A;  3TN9 3;  3WF1 A;  5D8A C;  2ZPX A;  1KDK A;  1NKG A;  2CGP A;  3ZDS A;  2PHF A;  1H4G A;  4QPW A;  5LA2 A;  4JDO A;  1ZVF A;  2Y6H A;  1PIV 2;  2C9K A;  1K45 A;  2XUM A;  4ES9 A;  5FZ7 A;  3AZZ A;  1YCI A;  5LRR A;  5C3P A;  3HBK A;  3D6E A;  4QKD A;  4XF9 A;  4BQ3 A;  5LCW L;  5ANN A;  3PVE A;  3RJ2 X;  2AH2 A;  1Q56 A;  4QPG B;  2JG9 A;  4IE7 A;  2CHH A;  3UJQ A;  4ZU7 A;  3KS7 A;  5FOB B;  2CNA A;  5FZF A;  2AYH A;  4X6R B;  3SIS A;  2ZHL A;  4XIO A;  5FYV A;  2IUW A;  4YW2 A;  1QXP A;  1WA6 X;  4Y33 A;  1HN0 A;  1RHI 3;  4NWV A;  1YFW A;  4YW3 A;  2GN3 A;  4P9X A;  3O7O A;  2HEY F;  5LBF A;  5A6Q A;  5J7M A;  3H1W A;  1SCS A;  1QXJ A;  2K0G A;  4BM8 A;  2IZW A;  2WN2 A;  5A6Y A;  2RR1 2;  3EBR A;  4LJH A;  1AR8 3;  2ENR A;  1VBA 1;  5BPX A;  3POB A;  5F2W A;  4CPB D;  5FUN A;  4BK4 A;  3BTY A;  2HWE 1;  1NCQ A;  4W6X A;  5FZO B;  5F8P A;  3VDD A;  3R4D B;  2CL2 A;  1LOB A;  1GQH A;  2PLV 1;  2QVS B;  4Q4X 1;  4DEV A;  1Q8S A;  2Z5W A;  1W3X A;  1JN2 P;  2VH9 A;  3RZK A;  1XC6 A;  1OOP A;  2XVL A;  3KCX A;  3MIC A;  4YM1 A;  5BNP B;  3DXT A;  1J59 A;  1VBA 2;  3AZW A;  1AR9 2;  1OPM A;  2IXH A;  2H6C A;  1W3V A;  5J96 B;  3C2U A;  2P6C A;  2NQY A;  3M70 A;  2PLV 2;  4JTN A;  3SEE A;  3OGS A;  4MGS A;  4DFS A;  4EN0 A;  3J7N A;  4HKL A;  4LO6 B;  1YI7 A;  1UYZ A;  4XCB A;  4XE9 A;  4LMF A;  5JIU A;  2A6Y A;  5FKC A;  5FMO L;  3GBF A;  4UYB A;  1RUG 1;  1OQ1 A;  2FCU A;  4ARY A;  4GUL A;  2WSU A;  5IK7 A;  3KHC A;  2FHR A;  1OUS A;  3TBD A;  3OG2 A;  4HAN A;  2A3W A;  4HBN A;  4NUB A;  3AXD A;  4P9L A;  1DGW X;  1WME A;  4QXH A;  5BYN A;  1GYK A;  3MBW A;  4LBL A;  5CG8 A;  4N43 B;  3C7O A;  4YLZ A;  1XE7 A;  1YQ8 A;  4AVS A;  2WO2 A;  1KD7 A;  1YJL A;  1W6Q A;  5C8C B;  2Y0O A;  5I0S A;  5HI0 A;  4H14 A;  2ZCW A;  1HRV 1;  3KM5 A;  1G9F A;  4E8D A;  4JHT A;  2HEV F;  4TYS A;  4CA9 A;  1WMX A;  4COW A;  2ZA9 A;  1UIK A;  4QKB A;  5GLW A;  1VMH A;  1BMV 1;  5F9T A;  1W8Z A;  2YXS A;  3I3M A;  1RUE 2;  3OOX A;  5FPA A;  2B46 X;  3LDR A;  1MPX A;  2XHK A;  3R05 A;  3WXP A;  1V0A A;  4P9G A;  3EXU A;  4Q4V 3;  4XQ4 A;  3ZXL A;  3PUQ A;  4CU7 A;  2AR6 A;  1VBB 3;  4GMP 0;  1GZW A;  1GP6 A;  4AFM A;  4XW3 A;  2A6X A;  3EO6 A;  3ZXD A;  1YHF A;  1F35 A;  5FBJ A;  1HXS 2;  2Y33 A;  4ZHN A;  1I6X A;  2RV9 A;  2R07 1;  2X5I C;  1W8W A;  1C1L A;  3VBR A;  2VG9 A;  1QJE A;  1SMV A;  1W6M B;  4A3X A;  1GWM A;  5IFP A;  1F4A A;  4K8R B;  4XMI A;  1RIT A;  4GWM A;  1W03 A;  4ASK A;  3WNL A;  1O3Q A;  2R07 2;  2YC0 A;  2W2I A;  4AGG A;  5C4W B;  3O1U A;  4MSV A;  1NLS A;  4P02 B;  2BV4 A;  4B4R A;  1WLC A;  2DUO A;  2NN8 A;  1CD3 G;  2JKX A;  4OCT A;  4LOS A;  2ZAH A;  1G9A A;  1FAT A;  2DBN A;  2EAK A;  4ZXE A;  3WG4 A;  3R6S A;  3ZX7 A;  4Z82 A;  5I0R A;  4KI5 M;  1IPS A;  2RS1 1;  3KCC A;  4UBG A;  3KQR A;  3ZFE B;  1FPN 2;  2OII A;  3HIF A;  3RYK A;  4C90 A;  2DUR A;  2VL4 A;  1K3I A;  4N53 A;  4DEQ A;  4QKF A;  5F5I A;  4K40 A;  1AXK A;  1E5S A;  2WA3 A;  3AJZ A;  4M01 A;  2G19 A;  1X9P A;  3AP5 A;  5K7P A;  3ETP A;  2WSV A;  3RZJ A;  2VCC A;  5FDB A;  2O0O A;  3VBO A;  3WNO A;  4AHX A;  5A3T A;  5JLV A;  4R52 A;  1UD1 A;  1Y9Q A;  1ONA A;  4BA6 A;  2IFW A;  5FY5 A;  1UU5 A;  1GSL A;  4C0H A;  1VAM A;  3NNF A;  4A44 A;  5C9A A;  2NM1 A;  1ND3 C;  1BXH A;  4B4P A;  1F5F A;  2VO5 A;  5JOX A;  3GDB A;  3UGH A;  2WN3 A;  4MAD A;  3WG3 A;  1CAX A;  1D4M 3;  3JUU A;  2B5H A;  3TEZ A;  4KH9 A;  4LBM A;  1RVF 3;  3JD7 3;  4OUS A;  4EN7 B;  3U10 A;  5J1X A;  5CFD A;  4YW5 A;  2A5Z A;  1PK6 C;  4QHZ A;  2ZAA A;  4WZF A;  5JAX A;  1YIP A;  3T4V A;  3VBS A;  5B4N A;  3C7F A;  1SLI A;  3CJI A;  5DDJ 3;  4ZZ8 A;  5A7S A;  2E7Q A;  3FWE A;  2XB6 C;  1ZA7 A;  5FZK A;  2E9Q A;  3WQB A;  2YZ4 A;  3C7E A;  2BYV E;  4QX8 A;  1LRH A;  2NZ9 A;  3I3Q A;  1A6C A;  4MZU A;  3VZL A;  5L7O A;  3PUA A;  4X8P A;  2OQ6 A;  3BOD A;  3MI8 A;  1SLB A; 
#chains in the Genus database with same CATH homology
 1D7P M;  5EJ1 B;  5LA1 A;  2VMC A;  1UMI A;  3C7G A;  3WEZ A;  3MV1 1;  5IYY A;  2VM9 A;  3DEC A;  3III A;  2VZP A;  1GU3 A;  3GXU A;  4LKS A;  1TVG A;  4QX2 A;  2HLE A;  3VD5 A;  2VZT A;  3WNN A;  2ORZ A;  2W5F A;  4M4R A;  1J84 A;  2LS6 A;  4JKK A;  1ULO A;  3LPG A;  3A7Q A;  1GOF A;  1IQD C;  3IAQ A;  3JXS A;  1JZ3 A;  2QQJ A;  2YG0 A;  1W99 A;  3K4D A;  2LW8 A;  5DPN A;  4CUC A;  3OEA A;  2E31 A;  2YFZ A;  3I3D A;  3WNM A;  4P00 B;  1KGY A;  1W9S A;  2QQI A;  3WF0 A;  4GWI A;  1RYY A;  1GQP A;  3F2Z A;  1UX7 A;  4UI9 L;  3ACI A;  1CZV A;  3HJR A;  3IDA A;  1H6Y A;  2YB7 A;  2ID4 A;  3J7H A;  3NJX A;  4DUW A;  2ZXQ A;  3HNY M;  2VZO A;  3DYO A;  2QQK A;  3UES A;  2BER A;  5G04 L;  2VC9 A;  1UWW A;  2YFU A;  4OYU A;  5DN2 A;  2WDB A;  4RN5 A;  2W92 A;  2DCK A;  4JHZ A;  2DDU A;  3I2G A;  2X10 A;  2WO1 A;  2Y64 A;  3WNP A;  5IJR A;  1HN1 A;  2VMF A;  2ORX A;  2VMD A;  2W3J A;  5JXI A;  2W46 A;  5I0D A;  3VD7 A;  4DXT A;  5CYY A;  3AC0 A;  1PX3 A;  2L9L A;  2QQM A;  2CDP A;  3ABZ A;  4D8M A;  2V4V A;  2WZ8 A;  4E8C A;  4QAW A;  1TG7 A;  1OD3 A;  3LEI A;  3EB7 A;  1NAE A;  3DYP A;  5DQ0 A;  4XUP A;  5IFT A;  3LEK A;  2W95 A;  3ACH A;  2WUH A;  3WF2 A;  2VQT A;  2XOM A;  3NJV A;  5C71 A;  4LHS A;  1W8N A;  5DMY A;  3OGR A;  2J1T A;  5LA0 A;  3I97 A;  5G05 L;  4TTG A;  2W1W A;  1OF3 A;  1OF4 A;  1P8J A;  2B4K A;  3UET A;  2VJX A;  3E1F 1;  2JD9 A;  3MUY 1;  2JE8 A;  2J1S A;  2QQO A;  4CVU A;  3T2O A;  2JDA A;  1PMH X;  4MGQ A;  3FHQ A;  2J7M A;  1O8S A;  1EUT A;  4P08 A;  3VDA A;  3A21 A;  1CX1 A;  1JYX A;  1GOH A;  3VD3 A;  4DUX A;  1LNS A;  3SEP A;  1JZ6 A;  2E26 A;  1JYV A;  4DXS A;  3VDC A;  1JZ5 A;  1CZS A;  1GMM A;  3OEB A;  5F7U A;  3T2P A;  2V5D A;  2E32 A;  2W1Q A;  2WQ8 A;  1UY1 A;  1W9T A;  4MOA A;  3HPN A;  3GGL A;  1OT5 A;  2J1A A;  1H6X A;  5C7G A;  3FN9 A;  1BHG A;  4CU9 A;  2RVA A;  1W9W A;  1UY4 A;  2QBX A;  4ZZ5 A;  4Z2A A;  4BXS V;  2W1S A;  3THD A;  5JXJ A;  4QDR A;  2VCA A;  3W5M A;  1UMH A;  4CUB A;  2J1R A;  3I2K A;  4BDV B;  2J1E A;  1CZT A;  1NUK A;  3ECQ A;  3I2F A;  1XPW A;  1GNY A;  4P5Y A;  2Y6K A;  4M4P A;  1R64 A;  3CQO A;  3I3E A;  4JKL A;  2J1U A;  3ZM8 A;  5JMO A;  1DLC A;  2X05 A;  4QDQ A;  2ZEZ A;  4QDS A;  4ARX A;  5HXM A;  4XUO A;  2EID A;  3CDZ B;  4LPL A;  4XUT A;  4L0P A;  4A42 A;  2ZEY A;  4LQR A;  1WCQ A;  4AG4 A;  3OBA A;  4DUV A;  4GWJ A;  1SDD B;  3HNB M;  2BBA A;  3OB8 A;  3WSO A;  3K4A A;  2ZEX A;  3A23 A;  3IAP A;  1ULP A;  4A3Z A;  4XVH A;  1JZ2 A;  1WKY A;  2Y6J A;  2VTF A;  2VOT A;  4W8J A;  4CU6 A;  3T0B A;  4KMQ A;  1JYW A;  1SG3 A;  3NNG A;  2W94 A;  4KWU A;  4BK5 A;  3WF3 A;  1KEX A;  2OKX A;  2VME A;  5JXH A;  2C4X A;  3C8X A;  1O59 A;  4FI9 A;  4A41 A;  2B9V A;  1I5P A;  5EJZ B;  2VQU A;  3CKH A;  4CU8 A;  4OMD A;  1DYO A;  4PQQ A;  2VZS A;  3CMG A;  4UAP A;  4DXR A;  1UY2 A;  5JXG A;  1GOG A;  3U37 A;  1J83 A;  4DEV A;  1L7R A;  1UXX X;  4QB2 A;  3SKV A;  2VZ3 A;  5JUV A;  4GZ9 A;  2WYS A;  2R7E B;  3HOB A;  3T0A A;  2QQN A;  3MV0 1;  2XQX A;  3MO4 A;  4A4A A;  3UNP A;  1XNA A;  2C26 A;  3WF1 A;  4QX3 A;  2EIC A;  4HG6 B;  3D3A A;  1NKG A;  1JZ7 A;  1SHW B;  2W1U A;  3I2J A;  4QPW A;  2VZR A;  5LA2 A;  2Y6H A;  2VZU A;  3WF4 A;  2C9K A;  1K45 A;  5FUI A;  2WAA A;  2J22 A;  5LCW L;  1JU4 A;  2CDO A;  2QQL A;  1K12 A;  2PQS A;  3FHA A;  3PUH A;  2EIB A;  3P6B A;  1NX9 A;  2WZE A;  4UOJ A;  2WAB A;  4OMC A;  1EUU A;  1F4H A;  2V72 A;  2WN2 A;  1CIY A;  1UY3 A;  3T09 A;  2WBK A;  2W87 A;  3CZJ A;  4XZU G;  4ET7 A;  4BK4 A;  1L7Q A;  3BN6 A;  2EIE A;  2W91 A;  3MUZ 1;  4W50 A;  2E33 A;  2KD7 A;  1XC6 A;  2BGO A;  4D0Q A;  1OH4 A;  1UXZ A;  3PUI A;  4QB1 A;  5IHR A;  4A6O A;  1UZ0 A;  3SEE A;  1JI6 A;  3P1I A;  3EYP A;  3OGS A;  4MGS A;  3I3B A;  3K77 A;  3I2I A;  1UYZ A;  4A45 A;  3HEI A;  3ACG A;  4ARY A;  1W0N A;  1JZ4 A;  1W8O A;  3OG2 A;  4XUN A;  3NRU A;  4XUR A;  3MBW A;  2VZV A;  3C7O A;  2XHN A;  2WO2 A;  1PMJ X;  4IUG A;  4AAX A;  3W5N A;  2VZQ A;  4YPJ A;  2HYX A;  3CIH A;  2YC2 A;  4E8D A;  3NQH A;  2RJ2 A;  2Y6L A;  3LQC A;  1K42 A;  2YC4 A;  3IB3 A;  1MPX A;  3THC A;  4XUQ A;  4CU7 A;  2DCJ A;  4QX1 A;  3OGV A;  3T2Q A;  3I2H A;  3LE0 A;  3T0D A;  4PT6 A;  1T2X A;  2X09 A;  2RV9 A;  3WNK A;  4QX0 A;  4CUA A;  3VDB A;  1UYY A;  2WAO A;  1UYX A;  5IFP A;  1F4A A;  1JZ8 A;  3K75 B;  3A22 A;  2Y6G A;  4JX0 A;  4OZO A;  3WNL A;  3SKJ E;  5C70 A;  2W9X A;  1JYN A;  2WO3 A;  2Y8K A;  5JR2 A;  4P02 B;  2JKX A;  4W4Z A;  3LPF A;  1US3 A;  3HNM A;  3C7H A;  4ZXE A;  3K46 A;  4JKM A;  4RYD A;  3ACF A;  4KI5 M;  3BGA A;  5CZK A;  1XNT A;  1O8P A;  4BJ0 A;  2VL4 A;  1K3I A;  4OUE A;  4DEQ A;  5HPO A;  2W47 A;  1YQ2 A;  3DYM A;  3ETP A;  2VCC A;  3LEG A;  3WNO A;  1US2 A;  4QB6 A;  3VD4 A;  3GM8 A;  4PF1 A;  2BGP A;  3T08 A;  2J1V A;  2XON A;  4A44 A;  2ZEW A;  2VO5 A;  3GDB A;  2WN3 A;  4MAD A;  4MO3 M;  5A1A A;  1JHJ A;  1JU3 A;  1GUI A;  2BZD A;  3HN3 A;  4ZY9 A;  5J1X A;  1DP0 A;  5B4N A;  2VZ1 A;  5EIY B;  3C7F A;  2VR4 A;  1UY0 A;  4ZZ8 A;  2Z4F A;  3CZU A;  3WQB A;  3VD9 A;  1PX4 A;  3C7E A;  3FL7 A;  3K4Z A;  5B4X A;  2VCB A;  4TXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...