2RE9A

Crystal structure of tl1a at 2.1 a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
164
Chain Sequence
LRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine, hormone/growth factor
total genus 26
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2re9A01
4KG8A 3B9IA 1OQEA 1ALYA 1OQDA 4OUMA 1JTZX 1WCKA 2WNVC 1DG6A 1PK6C 2JG9B 2WNUC 2O0OA 3AB0A 4HT1T 2JG9A 2RJLA 3FC0A 4QQ2A 1KXGA 5BNQA 1C3HA 4MXVA 4MXWB 2OIIA 2RJKA 2QE3A 1TNFA 2HEWF 4MXWA 2ZPXA 5KWRA 3MI8A 2JG9C 4DOUA 2R30A 2TUNA 2JG8B 1A8MA 2KA3A 2JG8A 4J6GA 2R6QA 5L19A 1D4VB 2TNFA 1U5ZA 4TSVA 4TWTA 3V56A 1KD7A 2Q8OA 4GIQA 1TNRA 3B93A 4G3YC 1OSGA 5KC5A 3QBQA 4D7YA 2RE9A 4E4DX 4MSVA 5CIRA 2Q1MA 3WD5A 4OULA 2ZJCA 1I9RA 2WNVB 4E4SA 1D2QA 1PK6B 4DB5A 2WNVA 1D0GA 1IQAA 2WNUB 1O91A 3TYJA 3URFA 1GR3A 1XU1A 1PK6A 1RJ8A 3ME2A 2WNUA 3L9JT 1C28A 4NN0A 1U5YA 4QQOA 3IT8A 5HBAA 3ALQA 5L36A 1XU2A 4N90A 5TSWA 5KC6A 1DU3D 2HEYF 2JG8C 2HEVF 4F3JA 4QQHA 4QQLA 4G4FA 2QDNA 3LKJA 4QQPA 2X29A 2E7AA 4OUSA 2R32A 4EN0A 2AZ5A 4RSUA 1JH5A 3B94A 4KGGA 4KGQA 1U5XA 3K51A 3QD6A 3TWIA 1RJ7A 2Z5WA 3K48A 1S55A 4QPYA
chains in the Genus database with same CATH superfamily
2YDEA 4NPRA 1GNYA 2JDKA 2BOJA 3TRSB 2B39A 3UETA 1IQDC 4YYOA 2UY8A 5FO7B 2JX9A 3TOJA 4AI2A 2NZ9A 1WCQA 1SPPB 2D6NA 2ZX2A 3AP5A 3AZXA 1PVC2 4CP9A 5JR2A 1XE7A 2XUEA 3UKNA 2EAKA 2ZGRA 1SPPA 2ZZJA 2HBUA 2ZAAA 3AJZA 4H7LA 3ZPYA 5BNPC 4CCOA 2DURA 2WS92 2XL9A 2D7FA 5C71A 1VBC1 2RS12 1VBA2 4AI0A 3E97A 2WNOA 1A78A 1LOBA 4UF0B 3W20A 3ATGA 3K77A 4DXZA 4AFAA 2O1QA 5LW9A 2XBO2 4UF0A 4R9BA 5KHGA 2WLQA 4DXSA 1PMHX 3SH3A 1HRI3 3KWVA 4X6RB 3CO2A 5EQUA 1LEDA 4A4AA 5FY5A 3JBG3 5FZEA 1WMDA 4W6WA 2VVEA 4NHXA 1GICA 1ZZBA 4HVOA 2VZVA 2YUEA 1RUF1 4J1XA 5FYSA 4FTBA 4RFT0 2NP0A 1RVF3 1Y43B 4FXKB 1JOBA 3R6SA 1C4RA 3ES4A 3VBOB 1RUH1 5LBBA 3VBUB 3M1HA 5FXVA 1AJOA 5JPNB 1W8WA 4HLTA 3VBOA 3V0AB 2CNAA 5FZAA 3VBUA 2CTVA 4ONUA 1WD3A 4AOCA 2WQ4A 2A1XA 4GIQA 3V0AA 1T6BX 1UYYA 1X82A 3ZFEB 2WUHA 3WF4A 1W0NA 1JUIA 3ZFEA 2FDKA 2HLEA 3JD72 1SFPA 1VE0A 1OVSA 2DFCA 3ST7A 3W58A 2WFPA 1SLCA 4QMAA 4PIXA 1C8M3 1VRH1 4BH9A 3ZYGA 1O3TA 1X7NA 3PUHA 5FYBA 3WD5A 3UGGA 3DV8A 1DZTA 1V9U1 2WAOA 4H14A 4V2VA 5EXOA 4AGRA 3GHMA 4XQDA 2XUMA 3Q8CA 5HPOA 2YGMA 4KWLA 1W6QB 3VL9A 5IK5A 1RUG3 5E6HA 4XPVA 4P02B 1UIJA 4LLFA 5EZWA 1W6QA 2F4LA 3ZYJB 1XNDA 2H0VA 3MIEA 2UYBA 4AFMA 2KM2A 2HEYF 2R0FA 3ZXKA 5F7UA 2A6XA 3POBA 1AR91 2BRTA 4YNIA 1BBT2 2KD7A 2BBAA 1DGWA 1GQPA 3TBDA 2BOIA 1GP4A 1YQ6A 4C1XA 1G9BA 4LJHA 5FWJA 1RITA 3EBRA 1QJX2 4PLMA 5C4WB 1ZM1A 5JMOA 3P3PA 2AZ5A 3PU8A 1VB4A 2FMDA 5C4WA 4AVBA 3B9CA 2C5DA 4W50A 1FOD1 4QWNA 3VZLA 5F5IA 1ULCA 3SMHA 3VKFC 3GCWA 4CA9A 1UY0A 1W8UA 3RMXA 1OVPA 4QX3A 2RS31 1U12A 2BNOA 4YGDA 2D6OX 3UKTA 3VKOA 2HWE2 2AUYA 2XJSA 3CJXA 1S55A 2WNEA 1IG0A 3VV1A 1L7LA 1T6GC 1YJKA 3B02A 2VW2A 1SBEA 2I07B 1OURA 1DDLA 1IZ3A 2VU9A 4OQ9A 2NM1A 2K9ZA 4A2UA 2R49A 1HB4A 1S0JA 4FTEA 4NIDA 4ZPIA 1AJKA 4KWKA 5BV6A 4AG4A 2E63A 5T3NA 2WR9A 2A75A 1APNA 1SBDA 4BQ2A 3O1OA 1I5PA 1DLLA 1YFUA 1WW7A 4N53B 2UWBA 4XDPA 5CKQA 1KRIA 5E8AA 1ND2B 5FP7A 4N53A 3RS6A 3DUIA 2DVDA 4AYUA 2RM22 3JQWA 1N3QA 1OFNA 1ND2A 2LALA 1G9AA 1LGNA 2BFUS 1CX4A 3LDBA 3HNBM 5JSRA 3LOIA 4FQ4A 1EAH3 1NXD1 2EICA 3TN91 4RQPC 3ABZA 1HXS1 1ND3B 2J1SA 3TNQA 2BEOA 3CDZB 4Z1VA 2AC1A 2R30A 4PLNA 2UURA 3K3OA 2PFWA 3EJKA 4KBBA 3A23A 2FDGA 3ZYBA 4MH0E 3MIHA 3MIFA 5A3MA 5KXDA 2MEV3 2XMLA 1V6KA 2Q5TA 5T54A 1SQ4A 3O1TA 1D4VB 4PHZA 2TNFA 3CBNA 1XNAA 3TEWA 2RR11 4M4PA 3I2DA 2WZPP 5A3OA 3WDVA 4JAAA 1LRHA 1BCXA 4KMQA 3RG0A 3USSA 5K0UB 1ND3C 1CIYA 4BQWA 1LCLA 4L8QA 2AGSA 5K0UA 4LQRA 3SXWA 1NCQB 3MO4A 4QDQA 4CDUC 2HWD1 2X8KA 4IEYA 4FTSA 1NCQA 2VZQA 4GMP3 2Q1MA 3HT2A 2ZGLA 2WAAA 4HPKB 4LO8A 1BVP1 4R8HA 2JDNA 4AFDA 2WT1A 3NW4A 3OUIA 3POJA 3DCQA 1PK6B 1DGLA 3ZPOA 4HPKA 2DBNA 4AXOA 1IQAA 3GYDA 4HANA 5DUUA 1RUD2 1RUI2 2DDUA 4QGMA 1PK6A 1SDWA 1RJ8A 1BK1A 4XUOA 3BU0A 3U1XA 4GWJA 5JUVA 4AVAA 5FWEA 1TE1B 1YQ8A 1ST8A 1VMHA 3FX3A 4Q4W1 2ZGPA 3E6BA 1IGOA 1EY2A 1MQTB 1POV1 3ZSMA 2AEYA 2N7GA 2C1FA 2VQ0A 3BOPA 3PUQA 5FPXA 1JYWA 2VUJA 2X53S 4F3JA 1PO11 1MQTA 2VC9A 3IDEA 4LIUA 2E51A 1GWKA 4AVSA 4B29A 2IVJA 1W06A 3IDCB 4IDZA 1Z7S1 1N1TA 1FXZA 3GJAA 4I02A 4LKEA 2B5HA 3K2OA 4QXCA 2JDMA 4OVEA 3M3EA 4G9SB 1W8TA 2DWRA 2UU8A 2RHPA 3IAQA 1H1IA 3KGLA 4M3CB 4CPBD 1CESA 2PXJA 4CCCA 4DMIA 1BKZA 1CR7A 1YQ2A 5LB6A 1IPJA 4CEWB 1KDKA 4M3CA 3KV4A 2X05A 1QJZA 4PLOA 4PDWC 4LK6A 3VZNA 3K46A 4CEWA 3NNJA 2BUKA 3WNMA 1HN0A 5F2SA 1UMHA 4UW3A 3S6PA 3PVOA 4CUBA 4OCTA 4BB3A 1RUC2 2P4EA 4Y3OA 1LOCA 5A7OA 2A6VA 1S2BA 4FFFA 4QM8A 2W91A 5FZFA 4I2OA 5LWBA 3NRUA 2W46A 5F32A 5FP9A 5IVFA 5JMCA 3JXSA 3OBRA 2J1EA 5DN2A 4XDQA 2XDVA 1ODNA 4HT1T 4Q0UA 1LU1A 2EIEA 4ES8A 5EFUA 5FMOL 4CEWC 1NLQA 3ZKYA 1HRI1 3WX5A 1UZZA 1JI6A 3EMRA 5CADA 2WQ8A 3JBG1 3N9OA 1NY72 1RXGA 4M0NA 4XUTA 2JICA 5FJHA 1JHJA 4KQ7A 2OXBA 5FK7A 5L9BA 1RUJ1 3BN6A 3RI8A 1ZX5A 1J3QA 5ERLA 1E57A 1H2MA 2Z79A 4GULA 2W1UA 3NJXA 4WM7C 2V5YA 3C8XA 4GXLA 3WW2A 1A6CA 1AYM3 1CWPA 1RINA 2B4KA 4RHV1 1VIWB 3MV11 1S0IA 5CFCB 1CPNA 2YMZA 3BTAA 1RIRA 2E26A 2I45A 5DPNA 4COWA 5CFCA 4IGOA 4JGZC 1BMV1 4CXYA 1QJU3 4BMEA 4TWTA 3OB8A 4HONA 2Y6JA 3VZJA 4XFBA 1JZ5A 5HCBA 2QUOA 3DECA 2FMYA 5EPAA 2JDUA 2VCCA 5A80A 2Q8OA 1DLCA 1XNKA 1C8M1 4P9LA 2ZS6B 3L2YA 1TZOA 1FPN1 2JE9A 2A71A 1CAXB 2Y64A 3IM0A 3ZN6A 5I0DA 2E9QA 2EXJA 3P6BA 3KF3A 3VHRA 1LKNA 4GH4B 1CAXA 1GP5A 2YHJA 1KJRA 5D8AC 2W92A 1RHI3 4UW6A 4GH4A 1RUG1 1Z0HA 3POFA 1KS4A 4XHXA 3ZO0B 1HV1A 3HNMA 4XQWA 4P9WA 3RPQA 5GZEA 1SLTA 3MZHA 2MPFA 4PJYA 1B35B 4OFGA 1TMF3 4XXAA 3ORJA 5FP4A 2BGPA 2RDRA 1GR3A 1B35A 4XJWA 1MVEA 3UGHA 4W4ZA 2XKPA 3BPZA 4QT6A 4A6OA 4FPCA 3MICA 1W39A 1FAYA 3IT8A 4QKNA 4PF5A 1H2KA 1XU2A 4DFSA 1JOPA 2B46X 1QEXA 3WQ7A 1C1LA 1DYPA 2DV9A 1PVC3 2V4AA 3FLRA 1XPWA 3LA3A 3MDPA 4N43C 5FZ9A 3OTFA 3J26N 4SLIA 4CPBA 5IVVA 1JZ2A 3VD3A 1DQ4A 3J8F1 2WS93 5FYMA 1ZZ9A 4S2GA 2Q30A 4ARXA 2RS13 4EN0A 1R093 1VBA3 1YNAA 4RN5A 2EIBA 4RSUA 1I1EA 2VZ1A 3MIGA 4Q2FA 3WDTA 2HJIA 5IVJA 3AFGA 3T2OA 3M8LA 3B94A 2WT0A 1Y9QA 5EV7A 3WNPA 2CDPA 1Q5OA 3NNFA 1FX5A 1GOGA 3MYXA 5G04L 2WO7A 3AXDA 4HK9A 3C7EA 3H0OA 4LA2A 4FPEA 2WLPA 3F95A 4ASLA 2IWGB 4B8EA 3NVCA 4ZZ8A 3UKVA 4B1MA 5HV4A 4FOYA 4EYUA 2P6HA 1Q43A 1S2KA 4PBPA 2VMGA 3WUDA 2QTWB 4DUVA 1LHOA 2GNMA 2WNUC 2O0OA 1CAWB 4LPLA 2UYAA 2EA7A 1JOJA 1EAH1 4PQQA 1SLIA 4QB1A 2HWF2 1CAWA 4QHZA 2XWBB 3I3BA 4MGYE 1GV9A 1VPHA 3WDYA 4QB6A 4ARYA 2VBDA 5A70A 1OMIA 2VNGA 4GD4A 2CYFA 1UZ0A 3V64A 1F35A 1OOPC 5GJ6A 1YFWA 5FYTA 3VHNA 1ZA4A 3THCA 3O1MA 1W9TA 2PELA 2FDFA 5IK8A 1E5RA 1LB2A 3KQRA 3BOWA 4XCAA 3AKRA 3NJVA 3FHAA 3K4DA 4UFHA 1QGLA 5DAPA 4R9DA 4JRLA 1VBD2 4WBBA 1ZA7A 4LUMA 5LA0A 1XQNA 2W52A 3OD4A 5BNNB 3ZSEA 3FFZA 4K8FA 2AENA 2W1SA 1FI2A 1OD3A 2XHKA 5GM0A 5BNNA 3G7DA 1JS9A 3KQ4B 1YRZA 3MLLA 1S1AA 2VCMA 2WO2A 2B45X 3K4AA 3WG1A 1AXYA 2Q4SA 3OYWB 3M3OA 4AFCA 5DMYA 3QH6A 5ACA2 1BBT3 4GMP1 2DFBA 1W9SA 3OYWA 1D7PM 2Z4FA 4AGGA 4UBGA 1O4TA 3POWA 3CJIB 1QJX3 2W2IA 2ZGTA 4RA0A 3WDXA 5BNNC 4CXXA 3CJIA 3O1VA 2QQLA 1WMXA 2OPWA 2UY9A 2VW0A 3VN4A 4LBKA 3KV6A 1OF4A 2NYYA 2HH9A 3IDAA 4GAZA 3THDA 5CFDC 1JYVA 3RVHA 4XBNA 2XQXA 3DPRB 4YVWB 1XJAA 5JSOA 5LA9A 4QDSA 3LEGA 2VBBA 2VNRA 5T5OA 4DB5A 5FZCA 2HWE3 4XJZA 4YVWA 3DPRA 3G6JB 5DUVA 1PGW2 4O9EA 4Z2WA 3JB8A 3ENRA 3WEZA 3AZWA 1VBE3 4Q4X2 4RGAA 3WW3A 4IEPA 5FPAA 4NN0A 3DKQA 3DN7A 3T0DA 1ASJ1 3OGGA 4I3GA 3T30A 1T2XA 1CZVA 4AQTA 1E5SA 2DVAA 2HEVF 2R072 1EV12 2VM9A 4YGCA 5FZDA 3FBMA 1SDDB 2ZGKA 4YVWC 2QDNA 1LTEA 4N7UA 4AVTA 1MEC3 2X29A 3FWEA 4AVCA 1YI9A 1MZFA 4MGSA 2JDYA 2V5DA 1J84A 1PMIA 1JH5A 2QZ3A 2RM23 2DCTA 2OX0A 2WJSA 3AKSA 4XUNA 4LA3A 4Q29A 4AL9A 4QX5A 1VALA 4BLIA 3P1IA 4LBQD 4NE9A 2VR4A 5FIXA 4Q0VA 2Q1ZB 5GZGA 1JZ4A 2PHDA 4EN7B 2ZACA 1F4AA 4WVWA 3J7NA 2VUAA 5F3GA 1W6MB 1WBLA 4QPYA 5FLHA 2GMEA 4YFZA 3ZYHA 3ZSKA 2VPVA 2VO5A 2RS52 5FOBB 5FFOC 1L7RA 1W6MA 4XF0A 4D94A 1GZ9A 4B1LA 1BYHA 1LOAA 2V4VA 1LOGA 3O1UA 3EB7A 3N7LA 4NR1A 1URXA 1YIPA 3RJRA 2SBAA 3GHNA 2W0XA 1ULDA 5FMCA 5DDJ1 1VBB2 1DYKA 2J42A 2P5BA 3BVCA 5HCFA 1ZRIA 3DL3A 2GALA 4S2HA 3W59A 4Y5TA 2Z69A 3FC0A 4AQ6A 1V70A 2LW8A 4YPJA 2HYXA 2YZ4A 4DUWA 4QKDA 1SZBA 4YW2A 1AR71 3JUUA 3OD0A 4UFKA 5FPZA 2GP3A 4JGYC 1G6NA 3NJZA 3OOXA 1NOVA 1FV3A 2R7EB 4ZHNA 2H0BA 2HKXA 1IS6A 1CIWA 1CJPA 3PJQA 4YZ3A 5KWRA 5FUNA 4P14A 1GZWA 1QJU1 2BTVC 4O7XA 2D93A 1RXFA 4MO3M 1JYIA 2R062 4XUQA 2AACA 5FKBA 1RUD3 1RUI3 1A8MA 1PX3A 2ARXA 1RC6A 4FAHA 2ZZQA 4Q1PA 5ANQA 5FZ7A 1QNYA 3VB9A 3U78A 3BUCA 5DAWA 2CHHA 4JQRA 3E5XA 3GZUC 4JHZA 2HWB3 3DF0A 5FZ0A 2BU9A 3EXUA 4IERA 4IE7A 5FAXA 5FY9A 3M70A 4H3WA 1MZ5A 4M0HA 2XLFA 4AI8A 1Y9MA 1G8WA 1PZ7A 5F3EA 1TNRA 3B93A 3VBRB 4M00A 2LRPA 1UPSA 4MYEA 1JBCA 4N8MA 2Q8DA 1XYPA 1AZDA 2JKXA 5DZEA 5GLZA 5I91A 4Z82A 4MGQA 3VBRA 1EPWA 1SLAA 3KT7A 4FPHA 1TMF1 2BP6A 2WFF1 3E1F1 3GBFA 3FMGA 5JZGB 1CPMA 2GSYA 4AEKA 1OLQA 2XJTA 1BJQA 3EQEA 5IAVA 2VMFA 3VBSB 5JZGA 4OULA 2QQIA 1QKQA 1QH6A 1GWMA 2BGCA 4KI5M 3VBSA 3LPFA 3O1PA 1G86A 1C5HA 4CUCA 1Q8VA 4BOWA 1O91A 1Q8PA 4C90A 4Q4Y2 1W90A 4CRQA 4UWDA 5LA1A 4C8DA 3RQ0A 2ATFA 4MGZE 4XF1A 4QQOA 1RUC3 1XNBA 4LLOA 4Y5Z0 3ALQA 2ZOEB 2RMU2 5KHIA 1DGWX 1CZTA 1R091 3WNLA 5JOWA 1F9KA 2VZ3A 2P3YA 1PO21 3T2QA 1SG3A 3FFQA 3GM8A 1MS0A 2DU1A 4GWMA 4G4FA 1A3KA 1H4GA 1U5IA 2AYHA 3RYRA 4XBLA 5FZIA 1OD5A 1QJY2 3ZFFB 4FCAA 3SNMA 3WY6A 5G05L 4FT8A 1US3A 3NMBA 3ZFFA 2BZDA 5JOXA 3D3AA 4GA9A 4H55A 1PM4A 2PA7A 4EQVA 5DAQA 3HOBA 1LHNA 2Y60A 4GALA 4IE6A 3KGZA 4LO6B 4B4RA 1BHGA 2VNVA 4OHXA 2YYOA 1RJ7A 4P9IA 3K48A 1DQ1A 1UY4A 2OW4A 1KGYA 2FZ1A 2WZ8A 3B7MA 1OQDA 4LOTA 1ZZ8A 2C4XA 4W6XA 5IUQA 5FPUA 1RGSA 1TG7A 1DGRA 3KHBA 2R1BA 1ZBA1 3MIBA 4NIAA 5LZ6A 1TME1 2J1TA 3PIGA 4KBZA 4LK7A 1DFQA 2JDHA 1AR82 4TLFA 4N9IA 4QPWA 2TBVA 2DF7A 3ITQA 3BALA 1L3JA 1UYZA 3MLKA 4LO4B 2RVAA 4MUVA 4Y20B 5A33B 4ZKTB 3APBA 1J3RA 4YM1A 4K40A 3HQRA 4Y20A 3SEPA 3ETQA 5A33A 5FO8B 2D3PA 2QVSB 4MXWB 4LBLA 4BQ4A 5C9AB 2VXRA 1F2NA 3N7KA 4ZS2A 2FCUA 4MXWA 5A1FA 1BK0A 4TLGA 1UY3A 3PLQA 5C9AA 2WIIB 2EXIA 2ARBA 3LE0A 3PNAA 1UZVA 3CZUA 1RTVA 3PVEA 1JYTA 1UOFA 2PAEA 1CN1A 1AR63 1HRV1 3PTRB 3S5AA 2D5HA 1US2A 4Y4RA 1UXZA 4DOUA 1LNSA 3AZZA 4CP9B 2EAAA 2HWC2 2GC1A 3IDBB 5LRRA 2QQNA 1BBT1 1J1TA 3H1WA 2VQUA 4CDXC 2W68A 3ASIA 4AEDB 3NV4A 2WABA 5CISA 1WLTA 2P3JA 5CB7A 1QJX1 4AGVA 5FPBA 4UOJA 4AEDA 2WZR1 3LSDA 1H1AA 4H2AA 1U0AA 3FHQA 1WKYA 3R05A 4AAXA 3O0XA 5KC5A 2GMPA 4FFGA 3ZXAC 3FLPA 5E1RA 4QU2A 1PMJX 3ACIA 2ZX4A 4RS5B 2ZGUA 1AL23 3BB6A 2VZOA 5FPVA 3MUY1 3UT0A 4AI1A 4BPZA 1NCRA 3WNXA 5IWFA 5F5AA 2GNBA 4RS5A 4ISRA 4AZZA 2O14A 1VBE1 5C70A 4NAOA 1LR5A 1GP6A 1X9TA 2W94A 4GMP0 5K8SA 1UW8A 2K0GA 3VBFA 4A7YA 5L7OB 2VUCA 2Y33A 3NV3A 3ILRA 4XOGA 1ULPA 1QJFA 2V72A 2VD7A 3CQOA 5L7OA 2VCBA 3S30A 1KDMA 5IAXA 5LK7B 4IUGA 4LKFA 1MEC1 3BCWA 3T08A 1OA4A 4Y1YA 4FAGA 4LUKA 3GJBA 4YW7A 5FY1A 5KXBA 1REDA 2XJRA 3HEIA 3ZSLA 4BXSV 2YBPA 2XR4A 4XYXA 3PHMA 1BEV3 1PIV3 3WXPA 5IK4A 4XZUG 1F5JA 2ADEA 3VBHB 5IATA 1UF2C 2BVBA 3KZ4C 3VBOC 3OPZA 3VBUC 1AYN2 4CU7A 3VBHA 3ES1A 2VOWA 1JHNA 3WSOA 1KEXA 3ETPA 2YFZA 1UWWA 5EP9A 1MZEA 1RUE2 3ZFEC 1OUSA 4KGQA 4DZGA 1U5XA 1UU6A 4Y1ZA 2JDAA 5F3CA 1RUOA 1WCSA 2VZTA 5A6YA 2YBKA 4JKMA 4DEVA 4Q4V1 5SV5A 1WW4A 3CNAA 4D0QA 4IETA 4IL7A 4E2SA 5F1RA 3RYKA 4A6SA 3WNNA 2XVLA 3F2ZA 3D4KA 5HCHA 4K21A 4HSLA 1GUIA 1K45A 1QNWA 2VUDA 4GB33 4QPIB 4AI3A 3BTZA 5ACA3 1TVGA 2R0HA 4HN1A 2XGXA 4CZSA 1ONAA 4QPIA 3BTXA 3ECQA 3HMYA 4LR4A 5BPXA 2B8MA 3AK0A 4NIGA 2VTXJ 1HLCA 3TEZA 4DS0A 4CCNA 3U4XA 1ZRFA 2YC2A 5CKNA 3A0KA 4FP3A 2HBTA 5C3RA 5FZMA 5JAXA 1M4WA 1PNFA 2HWB1 4QX1A 2JDZA 4AVVA 4P9GA 1A8DA 5C4WC 2JG8B 2Q8EA 4TZDA 3N35A 2JG8A 5H9RA 5A1LA 1VBC2 4XF3A 4Y33A 3B3QE 1H0BA 1OBNA 1MVQA 2D6MA 2JJ6A 1U5ZA 5LA2A 3KSCA 5B2GB 3MEPA 2VW1A 1CJDA 2WN3A 4YG6A 4A3ZA 1EV13 4RL7A 2XB6C 1O59A 4CU8A 3FE5A 2R043 2E33A 4I0WB 4HFSA 3E5QA 3M3CA 4X8NA 1J58A 2XOMA 4DIQA 4D7YA 4IESA 2JE7A 4XTMA 3RWKX 4NOTA 2ZTNA 5J1XA 1GSLA 5FPLA 1RUF2 1OA3A 1VMJA 2I2SA 2WWUA 5J36A 2XONA 2VZRA 1RUH2 3OEAA 3RDIA 4K20A 1XRUA 3I3EA 5I0TA 2PTMA 1OLME 4N53C 3T3YA 3RZLA 4BQ3A 1ND2C 3HR9A 1H2NA 2X10A 3TYJA 4DXRA 3KHCA 2Y6LA 4UBHA 3Q8AA 4PI0A 1HB3A 4CTEA 2ZMLA 4MLOA 5AC93 2QQPA 5F9TA 3LEIA 1UMIA 5JIAA 3IZOA 1RMU1 1DBNA 1FMD2 4LE3A 1HJFA 1R1A3 4UFMA 4XXPA 3PURA 4GKXA 1SCSA 4XURA 1VRH2 5I8YA 3DYMA 1DU3D 3N9QA 1GQGA 3OBTA 5SV8A 3UK9A 2QDRA 3DGTA 5CA6A 1ENRA 1V9U2 3O12A 1JU3A 4COUA 5EIYB 5M0TA 2MHFA 5FYVA 1NA1B 5LBCA 3VKMA 2ZGNA 5C3QA 5GALA 2DCJA 4B4PA 1IS3A 2YFUA 5BXXA 4EZ4A 1NA1A 3NAPB 2OQ7A 2ZHKA 3WF0A 4CDWB 5JXJA 1V6MA 1GFF2 4E2GA 1X36A 3NAPA 3ZIWA 3X29B 4CDWA 3LDRA 3SH4A 1V6JA 5K0UC 1ZBE3 4PIZA 1YXWA 5AFBA 4UFLA 3J7HA 3M7AA 1AR92 2AH2A 2CU5A 3ACGA 5AVPA 1NCQC 4QM9A 3LA7A 4U36A 4UYBA 5A6QA 4KH9A 4Z2AA 3NO8A 4IEQA 4BHPA 2CGPA 3TNPB 1DP0A 5T5JA 1PGL1 1DQ6A 1JODA 1H9WA 4K7JA 3HBKA 3WCRA 5FQ0B 4JDMA 3I4IA 3I2IA 3ZFGB 5A6XA 4YZ2A 3POSA 3LD8A 3VHPA 2G9ZA 1FOD2 1FNYA 1PK6C 1YQCA 3CEWA 1UMZA 3A21A 1QQP1 4NHMA 3ZFGA 2ADDA 5FQ0A 4FI9A 5H9SA 1UKGA 4MV2A 5LK5A 2RS32 5C3PA 1PZ8A 3AL6A 1LODA 2YC0A 1AR61 5FLJA 1C3HA 3AXEA 4OMDA 4CU9A 4YGBA 1MS9A 4I30A 5L9RA 2IC1A 4AEMA 1MQTC 1VR3A 4YZ4A 5I93A 5K7PA 1ENSA 2K2SA 2VVFA 5C7GA 5D21A 4HN0A 3IKWA 2F17A 1EPZA 2ARCA 3AP4A 4LKSA 4BK4A 3S0MA 1YLLA 1ULOA 1NZIA 2HYKA 2PHUA 3KV5A 4MADA 4R52A 5IYYA 4Q4Y3 4SBVA 4LHLA 3B5LB 3WQ0A 4MGTA 3WHTA 3UESA 4COZA 3GF6A 4OLLA 5FZLA 1CQ9A 1AL21 2WBKA 4YZ5A 2PQSA 2DUOA 4BM8A 2VH9A 3TN92 1DYOA 4F83A 2RDSA 3P3NA 5FLIA 1HXS2 3KS7A 3RZGA 1MS1A 2QKDA 3HAGA 3OBAA 1QJY3 4GJZA 4CYDA 1P8JA 4ZZ5A 2C6SA 3WHUA 5IVCA 1D0HA 1W3XA 3MFAA 3VD9A 2YG0A 1WZXA 1RVF1 5HV0A 1CONA 3N3HA 3RSJA 4YW5A 2CWMA 1C8NA 1HN1A 5FO9B 2DCZA 5LCWL 1LOFA 2WA4A 5KHJA 2PHLA 2Y6HA 5F6LB 2RR12 2WNVB 4E4SA 4BQYA 4JHTA 1GKBA 2OT7A 5IVYA 3WV6A 1QH7A 4R9CA 4F7ZA 4XEZA 2WNVA 2A6ZA 4NUBA 4YWAA 4QAWA 3NWKA 4KNCA 1W2UA 4KWJA 2CV6A 4WVVA 1NYWA 3UL2A 4QB2A 1DZRA 3VZMA 2DU0A 5KR7A 2D44A 1BEV1 4ASKA 4D8MA 4XQ4A 1PIV1 2B42B 3ZN6B 1U5YA 2RDNA 3VZKA 1OI6A 1W03A 4ATEA 2HWD2 2WWSA 3B01A 4M4RA 5FUIA 2WSUA 4QX2A 1W2AX 4PQ9A 4JC1A 2YU1A 3NV1A 1UX6A 4EV0A 2PN5A 1AR83 4PT6A 5FZ3A 3ZR5A 3AP6A 1VB2A 4QQLA 5CFCC 2Y0OA 4K9SA 1ULGA 2F4PA 2FCTA 3LKJA 4XJ9A 2P1BA 3RI9A 1W28A 2ZABA 3FUQA 2ERFA 4MHRA 1X8EA 2CAVA 3H3LA 1XE0A 2C26A 1XXNA 4EJRA 2DCKA 4BLJA 5IFTA 2DTWA 4Q4W2 4A7ZA 1NXMA 4FSJA 2TEPA 3H9AA 4L0PA 1NLSA 3HVDA 3J7LA 4MX3A 5FP8A 2RJ2A 3QD6A 2ZHLA 1PO12 3S57A 4O65A 3KB5A 4GH4C 2HWC3 4GB31 2BERA 4LTAA 2EIGA 1K5MB 1ZRRA 1ALYA 1Z7S2 1JTZX 3GXUA 1WWYA 4FPGA 1K5MA 3PMSA 2VY0A 1E5HA 5DAXA 2BFUL 4I0BA 1B35C 1JW6A 3ILNA 4INDA 1IPKA 4JTNA 3MW4A 4YVSB 1XNTA 4W8JA 5FMDA 4Q8LA 3IMMA 5BNQA 3LOBA 1WGPA 2XBO3 2V73A 3WF2A 1UOJA 4YVSA 3BIWE 1R64A 5LATA 1EUUA 4HKWA 2QZ2A 1PM7A 2GC0A 2ZA9A 4R4XA 3HN1A 4TYSA 3SLIA 4W6YA 3RZJA 2VOKA 2I74A 1W05A 1AUYA 3VL8A 4EWDA 2K46A 1UIKA 4LNVA 3GALA 1QU0A 1NQJA 5CVRA 3RZZA 1HRI2 2R041 5F5CA 2ZEZA 1VP6A 1J1LA 2R16A 4XILA 1UZWA 1JYCA 4V1PA 3JBG2 4Y24A 2PHTA 2YGLA 5EWSA 2XJPA 5JCTA 1OHFA 4D69A 1X33A 1RUJ2 2Q8CA 5CG8A 4W65A 3O7OA 1NQDA 2Q1FA 2P34A 3AFKA 3L2HA 4MGIE 4H7MA 1PZ9A 3FJSA 5FCCA 3O5SA 3JD73 1BZWA 2BNNA 3POGA 5FRAA 3VZOA 4E8CA 2CDOA 4RHV2 2J1VA 2VMEA 3CL1A 5B4NA 3DYPA 3MPPG 2MEV1 3KT4A 2W5FA 4RGKA 5GLVA 4OHZA 2RE9A 5DAVA 4ZS3A 3AVRA 5DQ0A 5AC91 1BMV2 5FYYA 4DXTA 3NKGA 5K4LA 4GQ7A 2WSVA 1UPIA 3AVSA 3SCGA 1R1A1 3KVBA 1LECA 3HWJA 4NHKA 1C8M2 3LWCA 3N36A 4P5YA 5IW0A 3MV01 1O3RA 1OT5A 1BXHA 1FPN2 2ZMNA 1BLZA 1G9FA 2W95A 3T0AA 2J22A 4XUPA 4AE2A 4WM8B 1LENA 4YM2A 1YEWA 1OKQA 3H1MA 5KBFA 1RB8G 1JMUB 3N7MA 4CP0A 4WM8A 2ENRA 2YPJA 1RUG2 2IFWA 5KC6A 1O5LA 3ZXEA 4BDVB 4ZU5A 4WVMB 4JV4A 4CU6A 5FZ8A 4IV1B 2VCAA 5JPMB 1ZBE1 3C7OA 4WVMA 2BQPA 2E7AA 3POEA 4XF4A 3VDCA 4E4ZA 4IV1A 1OXCA 2H6BA 3IAPA 4FPFA 3R4UA 1CVNA 4D7SA 1YI7A 1O8PA 1UQXA 4V2WA 5F37A 3VD4A 1YFXA 2VZSA 3SHRA 3POYA 1K42A 3FL7A 2DBIA 2JDPA 5FYHA 4XAEA 5KHKA 4XDOA 3OBZA 5C3OA 3HPNA 4FOVA 2X09A 3U37A 4URTA 3K51A 3CJIC 4P9JA 4FOQA 4NIHA 2C9AA 3DKWA 1N3PA 3IWZA 4NHLA 4C91A 4KG8A 3H1YA 3J8F2 5FXZA 3MIDA 4QU1A 1UX7A 1VAKA 1JYNA 2C9KA 4P5HA 2PHFA 3I3DA 3K4ZA 5DG2A 1EYBA 4QXBA 2OUJA 3DPRC 2DVFA 4HMZA 5E16A 1WW6A 4QHBA 5F2WA 3WP4A 2LROA 3U0ZA 4GWNA 1HW5A 4FPYA 3JQXA 3VDDB 2W1QA 2E7TA 2XVKA 1OQ1A 2ZCWA 4E8DA 3VDDA 3DYOA 4QQ2A 2YROA 3PDQA 2PHXA 3D6EA 1SEFA 2DYCA 2XJUA 2JIGA 4FPOB 4OI0A 3AP7A 2V09A 4Q4Y1 5LBEA 1EP0A 1S0FA 4AWDA 1D4M2 1ZZCA 4K8RB 1UOBA 2XL7A 4LE4A 4XAAA 1Z78A 3C7GA 3M3IA 1CZSA 2XWJB 4LBMA 2J1UA 2YPDA 4DUXA 3W9AA 2L9LA 2VZPA 5GKAC 4EZHA 3WNOA 3NKTA 1EAH2 4Q1RA 1MS3A 1GBGA 4IEZA 1AXKA 4RR3B 5LASA 3T1MA 3CZJA 4UW5A 4J6GA 2WQZC 2R6QA 2QQUA 1YQ5A 1QJY1 4RR3A 4XJAA 1V6LA 2G9FA 4CCJA 3I7DA 4AHXA 1FMD3 2KR2A 4Q0QA 4Q5OA 4XBQA 5ABJA 2E6VA 1KD7A 4NWVA 4QHOA 3WCSA 1W6PA 1F5FA 1GZCA 5FZKA 1G9DA 4OYUA 1AYM1 2IUWA 2VOVA 3THTA 3LAGA 4OZOA 2IXLA 4QXHA 4Q8KA 5IT6A 2FDHA 5FY7A 2WL1A 4GZ9A 1LGCA 1YWKA 1GZTA 1GZWB 2PLV2 3P5BA 4UW4A 3PUIA 2ET1A 1QXJA 2AEZA 3LFMA 4TXWA 4E4HA 4C0HA 2O8OA 3AKPA 4LBNA 2PAKA 3RYPA 2LS6A 3MPBA 1H4HA 3HNYM 1W8OA 4Y1UA 4AAPA 1QOOA 3NNMA 1ZRDA 3H7JA 1SHWB 3QH7A 1D0GA 1QXRA 1QOSA 4IE5A 4K1YA 2VJXA 4ZU4A 5FZHA 1AR81 4XMIA 3CLPA 1SFNA 1O3SA 2PHWA 4OMCA 2G4IA 3FHIB 1RHI1 1RL3A 1F8VA 1W8FA 4QD2A 5L36A 2EF6A 1XB9A 4PF1A 1ODMA 4CDQB 1UCXA 4LBJA 5J09A 4CUGA 4YARA 3R4DB 2W87A 5LY2A 3TEYA 3ZSJA 4CDQA 5GZDA 1S0GA 1QDOA 1YFYA 2A3WA 1LESA 4A3XA 3AZVA 3ZXDA 2RS33 4LORA 1AVBA 4IEXA 5FXXA 1R082 1LAJA 4JKLA 3MUZ1 4ORFA 4XFIA 1X50A 2DVGA 2A6YA 4CEYB 5FR3A 1CAVA 4LOSA 4NO4A 4Y26A 4CEYA 2IXHA 1PVC1 1ASJ2 5IVBA 2RDQA 2BBVA 3QOPA 4YW1A 3ACHA 5A7QA 1DIWA 2Y38A 4HKLA 3VBRC 1OC1A 4D6SA 1IG3A 2ZX3A 3GBWA 5JI7A 4XFCA 4COVA 1YJLA 2A6WA 1FT9A 2WS91 3O0WA 4N7IA 5A7NA 3U14A 3ZMNA 4YZ1A 1XNCA 1OH3A 3EHKA 3KV9A 3ZKUA 5GZCA 2RS11 1G9CA 5H9PA 1VBA1 4LBQB 1ZZ7A 5JZGC 2VE1A 4LIVA 2LM3A 3HT1A 3NV2A 3POIA 4DRVA 3RZHA 3LDKA 4CCKA 4LBQA 3VBSC 2XBO1 5FV3A 1AL0G 2D98A 3GZEA 3BU7A 1JXNA 1UOGA 1UU4A 2WZEA 4IV3B 3AB0A 1K3IA 3TN93 3OPTA 2QFEA 3LB9A 4CSWA 2FDJA 5FUPA 4YGEA 4IV3A 4QPGB 4JX0A 3SCFA 4BA6A 1AXZA 1LOEA 3MHZA 3NL1A 5DUXA 2WINB 5I0UA 1H8TB 3SKJE 4I0AA 2E31A 2Y0IA 4QPGA 3ZYRA 4O61A 3VDAA 2RG4A 4DO0A 5C8CB 3ILFA 1H8TA 4Q0SA 3SISA 3WW1A 2D5FA 1O4ZA 3T09A 1LHWA 2IXKA 3BODA 5CYYA 3ZXGA 5C8CA 1S2EA 4BJ0A 1E5IA 1STMA 4YM0A 2SLIA 5DDJ2 3ZFFC 3WINE 4IQPA 4TTGA 1NZCA 3LF7A 2WO1A 2YY1A 4QGNA 2OKXA 3JD71 1PNGA 3RFRA 1QJEA 2OVUA 3N9MA 2F6BA 5L19A 2VMHA 5LRSA 1AR72 3OPWA 2HWD3 1ENQA 2OA2A 5DG1A 5CKMA 3FZ3A 4DEQA 2IFRA 2CL2A 5JXIA 4J25A 4YSFA 5HCAA 1HDKA 2W1WA 1QJU2 2WN2A 1FV2A 1QHDA 2WWJA 3S5QA 1OFSA 1UNBA 4OI2A 1Y4WA 4A44A 4NPMA 4A41A 4CCEA 3CHXA 1ZZ6A 3MGUA 2GP5A 4IGQA 3C3VA 4YW3A 2D6LX 5I8SA 5A32B 2BVVA 4Q4W3 4Y1XA 3WG3A 5A3NA 4BIFA 1POV3 5A32A 3LZZA 4YW6A 4AEJA 3H8XA 4HSJA 5JWPA 2YU2A 3OF1A 3ZOIA 5BNOB 5C9AC 5IFPA 4BMBA 4Q0PA 5EYYA 1KITA 1REEA 5BNPB 1L7QA 5BNOA 4JVAA 1Z7S3 2R1DA 2ZKNA 1OPOA 1JN2P 5KHHA 5BNPA 4OUEA 2WFF2 3HD8B 3AJYA 4HVQA 3UNPA 1NCRB 4HKOA 2YC4A 3FBYA 2HWE1 5CEHA 3K75B 1NG0A 2ZGSA 4LEJA 4ET7A 2VQTA 4IEWA 2DTYA 4MZUA 3SEEA 3A22A 4JQTA 3K3NA 5JI9A 4AEDC 1LULA 5F39A 5FKCA 3VBFB 3NNGA 5BNOC 4ZONA 1AHSA 1VMFA 2P3KA 3ZR6A 1MS8A 4FP2A 3A4UA 1N1YA 1O5UA 3J9SA 1QF3A 2D6KA 1J3PA 1COV2 1MR5A 4JDOA 4BYYA 2P37A 1R092 1HV0A 1OF3A 3FUOA 5DZFA 1PO22 1NCRC 1POQA 5HI0A 5A1AA 4RS5C 4FXGB 4HBNA 3WR0A 4XHBA 3H8UA 2VTFA 4NAMA 3WVJA 2VMIA 5FY0A 2RM21 2ZHMA 1PVXA 3MBWA 3VBFC 1QY4A 1GWLA 1W2OA 3ZVXA 1WLDA 4OI4A 2D97A 4KWUA 1FYUA 1REFA 1RUJ3 2HWF3 3IIIA 4BE3A 5GLTA 5L7OC 4XJ8A 3LEMA 4MGKE 5F3IA 4P00B 1JZ6A 5FTTC 1NLRA 2FQPA 2RJLA 5JSPA 2ZAHA 4LHKA 3I8TA 4M3CF 4RHV3 4OHWA 2P6CA 3SKVA 3AYDA 4ZXKA 2OIIA 4Y5SA 3CIHA 2JB8A 4KG0A 4ASMB 2VAUA 1VBD3 2GH2A 4P9YA 1ZBA2 2ZPXA 2ZEXA 1TME2 2C24A 3MI8A 4IE4A 1FMD1 1MS4A 1CX1A 5FMOS 3VBHC 3H3UA 4BIOA 4IEVA 4O9GA 4RFRB 3ZMOA 1FPN3 4LHNA 5EYXA 3SITA 2XG3A 4JTOA 1GU3A 2KA3A 3LIGA 3ZX7A 4AQSA 5IK7A 5C5TA 1S0CA 2GC3A 1OLMA 1J59A 3I2FA 2WYFA 3ELNA 3LSEA 1GQHA 1C5IA 1ULEA 1ZYBA 2YXSA 3V0BB 3A7QA 3ACLA 5CU1A 2DVBA 2GZWA 3V0BA 1YUDA 1HRV2 5T50A 1H9PA 1H1MA 1RUD1 1RUI1 4HK8A 5HXMA 4NJ4A 4XFFA 1W8ZA 5EJ1B 5BY5A 3IB3A 4FVVA 2W39A 4QPIC 2NN8A 2WYSA 4L97A 2QQJA 4P08A 4KU7A 3RGBA 3HBZA 1IKPA 2CAUA 4BWOA 5FP3A 2WZR2 4ES9A 1QOTA 4Q4X3 3IIAA 4X6QB 2ZGQA 3VKLA 1D2QA 1S0BA 1V6IA 5LEJA 1FNZA 1PX4A 4NMIA 3URFA 4YM3A 3J8F3 3ZXJA 2IXIA 2LUWA 5FY4A 4XJUA 3ACFA 3VGIA 1WD4A 1XOYA 2RV9A 4C1WA 3BIEA 3DXUA 2R073 2JE8A 5C33A 5HBAA 2JECA 2WT2A 4NWWA 3USUB 1ENXA 1UD1A 2XH6A 1VBE2 3KLSA 3WOGA 2JG8C 2JWPA 3USUA 1W2TA 3QLQA 3PUAA 5FZOB 2Q0AA 2YBSA 4RYDA 5DZGA 5H9QA 3OGRA 3WG4A 2XPJA 1MZ6A 3C2UA 4RQPB 3MLJA 4D7TA 1A34A 5FZOA 1SBFA 2A5ZA 4RQPA 3ZYIB 5BUVA 1RUC1 2YV8A 3C7FA 1W9WA 4GJYA 5D2AA 5A3PA 2GDFA 4D3WA 3AZYA 2XLGA 1MEC2 1D4M3 3MW2A 3H50A 4S2DA 1JU4A 3MF9A 3I59B 2ZXQA 3PJYA 4AF9A 2RS53 1UYXA 3MFCA 4A45A 2Y8KA 5FMBA 3I59A 3TEXA 5C5UA 5FDBA 2EALA 2PAMA 5J7MA 2W3JA 3CF6E 2QQOA 3ZYFA 4F8AA 1NY71 2FBEA 1W0PA 1EUTA 2A3YA 1Q3EA 2NMNA 1TQ5A 1VBB3 3VD7A 1GOHA 2JKBA 5A7SA 3VKNA 3WQ1A 4AI9A 2JB4A 1ND3A 3Q8BA 4ISQA 1RUNA 2BGOA 3RZMA 4AW7A 4CDUB 1DHKB 1Q8QA 1YHFA 4HXCA 1O8SA 1ZNPA 3WP5A 4CDUA 4XF9A 4BISA 1AF9A 2GAUA 4ATFA 3EYPA 3WP6A 1UXXX 2A7AA 4MXVA 4XC9A 2PLV3 2QNKA 4Q4V2 2E7QA 4CCDA 2Y34A 3AYAA 4CCMA 3R0RA 1HB2A 4CUAA 5I0SA 2HEWF 1F4HA 2FHRA 5IJRA 2R063 3ZM8A 5JXGA 4DPNA 4GWIA 3WP3A 3ZXFA 3AYEA 4EWEA 4L2NA 4B7EA 1WMEA 1NA1C 3CKHA 4K1ZA 4HG6B 2YB7A 4NHYA 4NPLA 3AMHA 3NAPC 5AVAA 1YYNA 1V6NA 2QJVA 3KVAA 4BXFA 5A3TA 4CDWC 3HJRA 4YFWA 5A3UA 2OYZA 1HJGA 3LEKA 3KMHA 5T55A 2OPKA 2NMOA 3BPSA 3IPVB 1W6NB 4QX8A 4FBFA 5A3WA 2ARAA 3GZAA 4XABA 3VD5A 3IPVA 3I2OA 1W6NA 1W8HA 4XZPA 3SQOA 4DNYA 3U75A 3I97A 4XFGA 3S7EA 3U10A 3IBMA 2HWB2 3WF3A 2PYTA 1WUVA 4G3YC 1OSGA 4LITA 3T4VA 1YCIA 1JZ8A 1R083 4QX7A 3ZFGC 4PDWB 4E4DX 1NAEA 4WV8A 5I8TA 3WLUA 5E89A 4NRPA 3VUOA 2PQQA 2XJVA 1Y7BA 4IEOA 4PDWA 5FK8A 1NUKA 1HQWA 2GH8A 5FBZA 1ASJ3 1VRBA 2IZWA 1HX6A 4FQZA 4L9BA 5CIRA 5K9YA 3KCCA 3H8RA 1I9RA 4XETA 2BWCA 4IXLA 2CGOA 3CMGA 4XVHA 5FZGA 2X5IB 3U4SA 2RMU3 1GOFA 3ZXLA 1JYXA 4BCUA 2X5IA 3UV9A 3KCYA 3ZDSA 1WW5A 4UFJA 2WRAA 3MF6A 5T5PA 4XFAA 3RJ2X 3THPA 2IVIB 4D6RA 3W5NA 1AX2A 4S2FA 1GMMA 2J1RA 4QQHA 3I2GA 3OGVA 4LBOA 1SMVA 4MHUA 2W08A 1IS5A 4WM7B 4OUSA 3H7YA 2DUPA 2X5IC 3I2HA 1TEIA 4Q26A 4WM7A 5FBJA 2BW8A 2QCSB 4YRDA 1JZ7A 3HQXA 1WA4A 1GANA 3KM5A 4UFIA 1W2NA 1G7YA 1Y3TA 1RMU2 4JGZB 1N47A 1IHMA 4QXKA 4UAPA 2CSGA 3E6CC 5DDJ3 3WW4A 2HWF1 2VXJA 4JGZA 2Z5WA 4EN8B 1GYKA 1LOFC 3B9IA 2OZ6A 4AHYA 1LJ7A 1OQEA 1OUXA 3AMQA 4XE9A 5D1IA 1S4CA 1SLLA 4AHZA 3LQCA 2GN7A 2GC2A 1AR73 1GLHA 1YIFA 2WNVC 3PL0A 1V00A 2AREA 2GN3A 5D8AB 3LFIA 3KT1A 2JG9B 2KXLA 4QKBA 5EJ3A 1HB1A 1OA2A 2OS2A 5D8AA 3UJOA 3WZ1A 1VBD1 1ULFA 3U07A 2JG9A 4JDNA 4UXAA 4NIIA 4EN9B 3OJBA 3HQUA 3WUCA 4MG2A 2VL4A 1O4YA 4A42A 5AFEA 4M3CE 2VTXA 3H42B 3UJQA 3WDUA 3RWNA 1TNFA 3ZDVA 1KFUL 1WMFA 2PHRA 1LGBA 5DXDA 1HQNA 1PGL2 5JLVA 1W99A 5ACA1 4WZFA 1IS4A 3Q8EA 1QQP2 2JG9C 1H6YA 2TUNA 2VG9A 3ZN5A 1W3VA 2ZX0A 4N43B 3OG2A 5CAZA 4LULA 4IGPA 1OLRA 1AR62 2NLRA 3Q9OA 4N43A 2Y6GA 5APAA 1IKQA 1DQ2A 1O6UA 5DABA 2WFF3 5LBFA 1UY2A 4R4ZA 1WCUA 1WCDJ 4IW3A 2G9GA 5L73A 1JUHA 2JD9A 3SH5A 1QXPA 3GNEA 4E2QA 2FZ2A 3WNKA 1V6OA 4AR2A 5EHDA 1HQLA 4CP1A 4LT5A 4LMFA 1PGW1 2EXKA 1O7FA 1K5MC 2FDIA 2G1MA 1H6XA 5KXEA 4Q4X1 3H3ZA 4Y22B 2ETEA 2PMWB 4N9HA 4LKDA 2Y6KA 4JCKA 5I0RA 2VQAA 4WVZA 1UU5A 3AKTA 4Y22A 3AC0A 3T4HB 3LIHA 2XXZA 3VDBA 3UGFA 4OHVA 1COV3 1AL22 1EV11 2R071 1SLBA 1W9FA 1XYNA 4YVSC 1W8NA 3T0BA 1PO23 2ID4A 2VMCA 3N9PA 2XHNA 2ZEYA 2J1AA 4PBOA 2WNUB 1XSQA 5IHRA 4QDRA 2GU9A 4TN7A 1H2LA 1OPMA 4YLZA 3J7MA 3B00A 3ME2A 2WNUA 4K6BA 2VOXA 1ZVFA 4CXWA 4URAA 1RVF2 3GZTB 2P3IA 4ZY9A 4AK3A 2BWAA 3SC7X 4R9AA 1S0EA 5T52A 3D0JA 1OOPB 3N9NA 3INAA 3M3QA 1UN1A 1D4M1 4UT5A 3W5MA 3BKZA 2E32A 1AYN3 1OOPA 2OUHA 1UYPA 3MW3A 1PHMA 1WLCA 1DZQA 4QQPA 4UI9L 2RS51 1BVVA 1K5JA 3FN9A 5C6CA 3E6DA 3N7JA 3ON7A 4AHWA 1LHUA 1RUE3 4FFHA 1BEV2 5GZFA 1PIV2 1I6XA 1R1ZA 3WQBA 1AX1A 2FD8A 4XW3A 4I09A 2JEMA 3KCXA 4IEUA 1VBB1 1ZBA3 4CCLA 2CGNA 1TME3 4MVTA 5BYNA 3ZYPA 4NRMA 3FLTA 3RNSA 5FXWA 4C0BA 1SCRA 4Y4YA 3NSTA 1LHVA 1IOAA 1GNZA 2W9XA 4HL0A 1X9PA 4XCBA 4XMAA 1N1VA 1HIXA 4Z8BA 2D40A 2B9VA 5J96B 3PVNA 2ET7A 4KL1A 5A7PA 2PLV1 5FREA 1NX9A 1FATA 1W6OB 2P17A 1DG6A 3AX4A 3ZLIA 4GKYA 1W6OA 4FFIA 3O1SA 1XYOA 2R061 3SCHA 1MACA 3OY8B 1QDCA 1HRV3 5CFDB 4LO7A 4WM8C 2VULA 1KXGA 4CVUA 4U2AA 5FOJB 3OY8A 4KU8A 4Q27A 4GB32 5CFDA 5GLWA 2DUQA 1W04A 5GLUA 2RJKA 3BI3A 2JENA 2QE3A 5LY1A 4OHYA 3OCPA 3LCPA 1YC61 4XIKA 1VAMA 3NQHA 2G19A 1UKRA 4IV1C 1F15A 2WZR3 3S7IA 2ZMKA 2ORXA 1VBC3 4L11A 2VOTA 5J98B 3C7HA 3I49A 4FPJA 3D82A 4PIYA 3OUJA 5C8WA 3QCWA 3OGSA 1R081 2D43A 1N1SA 3I2JA 1SFYA 2QQWA 5FYUA 2UWAA 4TSVA 3V56A 2VGDA 2Y6FA 3PUSA 4WZCA 4B7KA 4NVPA 1OH4A 5F8PA 4META 3AYCA 5F6KA 2ORZA 3OSDA 4QKFA 2DCYA 1H30A 1RUF3 3PU3A 1I5ZA 5J3UA 2ES3A 5EJZB 2B9UA 1MS5A 1KFXL 3GGLA 1RUH3 2H6CA 3QBQA 2LTNA 5CZKA 2ZHNA 2R042 2RMU1 5L9VA 1N3OA 3VDDC 1C1FA 2A73B 4Z92B 1RYYA 4MSVA 2NQYA 3KD4A 2ZJCA 3IMNA 1KS5A 3RMYA 3LA2A 1NE4A 2EXHA 1POV0 4ZU7A 1ZRCA 1DGRN 1VJ2A 5ABJB 1CGPA 2VZUA 2NPIA 2ZKLA 4HETA 5A6ZA 2VVDA 1W6PB 1XU1A 3CU7A 1BQPA 1VRH3 2ZBJA 2MEV2 3AMMA 2XLAA 3D0SA 4OZXA 1V9U3 3KF5A 1WBFA 3T2TA 3O14A 4N90A 5TSWA 3AKQA 3AMNA 4JGYB 4HOOA 4XFHA 4XACA 5FYZA 3WF1A 3ZIXA 4DQAA 5AC92 5JXHA 3PTYA 5FZ4A 4COYA 3D8CA 1PGSA 4JGYA 4RR3C 2D3RA 4LHSA 1SACA 1R1A2 2WA3A 5CNAA 3W21A 4OI1A 5ABJC 4RD7A 1AX0A 3B69A 2EVXA 2VMDA 5JVVA 1W0OA 1DQ5A 3EO6A 4Q4V3 4Y1VA 3M4FA 5J37A 1KQRA 3OUHA 1UY1A 3I3QA 1LU2A 1UO9A 1VLNA 1AR93 2JD4A 4NROA 2BNMA 3PMEA 5JR7B 3JCIA 4A7KA 5IVEA 5A3LA 3RZKA 4KGGA 5FZ6A 4OQ8A 1X8MA 1XC6A 3TB0A 4DY3A 3D5OA 3NNLA 3DXTA 5JOZA 5FJKA 2P2KA 5HXVA 5B4XA 1ZBE2 2QQMA 2BDRA 3HIFA 1FOD3 4QGLA 2VECA 4OUMA 4P9XA 1WCKA 4J1WA 2J7MA 4DRRA 1CAVB 1HKDA 2VBPA 3E5UA 4L99A 3OEBA 1O3QA 3A0NA 5KXCA 3ROUA 3JU9A 1F31A 3U11A 2HWC1 4JZRA 3QACA 2GNDA 2QQKA 4I01A 3OGJA 4DY5A 1H8VA 2BPA2 4JRAA 4EN6B 3R4SA 1GNHA 2ZGOA 3HN3A 1IPSA 4MOAA 4CDQC 5JIUA 4AFBA 4BQ5A 1OKOA 3DEMA 3TAYA 2IXJA 3BTYA 1NT0A 4D6QA 2OZJA 1CAUB 5C3SA 1Q8OA 1CD3G 2IXCA 4QX0A 5LEKA 4FO9A 4E27A 2Z42A 4FPKA 2GMMA 1NE6A 1CAUA 4CEYC 1WLWA 1W9YA 2AR6A 2WKKA 5FYCA 3WT3A 4LO5B 2JXAA 1NKGA 1B09A 1Q8SA 1V0AA 4FPLA 5FYIA 5FZ1A 4HVRA 5CG9A 2QQVA 1C57A 3GCXA 1J83A 3N9LA 4X8PA 1YO8A 3I54A 5T5LA 2JIJA 2D3SA 3AMPA 1XSRA 1HXS3 5FZBA 2BV4A 4YG0A 2UWCA 4AQ2A 4PI2A 1DF0A 4FOWA 1K12A 1S0DA 4Z07A 3T1LA 4BQXA 1COV1 4YG3A 5FY8A 4EE2A 1QMJA 4B4QA 3T2PA 3VLBB 4LXLA 4NRQA 4B3NA 2ZX1A 4ZXEA 2OQ6A 3IN9A 4XIOA 3I2KA 2RR13 1QWRA 4HZFA 3BYWA 2XQRA 1VAVA 3LPGA 2ZGMA 4PCRA 3J4UH 5DUWA 5JDBA 4BQ1A 4I3PA 4IV3C 3I3MA 1RMU3 2O8QA 4XTPA 2Y26A 5F5QA 5J48A 3M2MA 3WDWA 4QPGC 3ZN4A 2FCVA 2BYVE 3WG2A 4CP2A 3N4MA 2VNOA 1H8TC 1AYM2 2A3XA 1Y9GA 1LEMA 5C8CC 4BZ4A 1AYN1 1MPXA 1XBFA 2ZEWA 3GDBA 3L9JT 4L92A 1C28A 4JKKA 4BK5A 4YW4A 2B7YA 3AM2A 5JOYA 3UYJA 3V65A 1M06G 3PVBB 1RUE1 4CE8A 3GBGA 1D2SA 2QBXA 2WDBA 3JZVA 3RRDA 4K3UA 5ISLA 1UAIA 1XE8A 1UL9A 2W47A 2MNGA 2WO3A 2D6PA 3O1RA 3Q8FA 5CBLA 4M01A 4BU2A 5E88A 1QIQA 2C0ZA 1UZYA 2R32A 2WC2A 2A70A 1WA6X 4RGGA 3BGAA 2XKOA 5A7WB 1KJLA 1DCSA 2E53A 3NJYA 3H8OA 2Z2SB 1RHI2 3LGRA 1PO13 4CDXB 5A7WA 2EIDA 1ZREA 4EROA 2CWSA 3VHOA 1DQ0A 2BJSA 1ACCA 4E9KA 2CY6A 3JB4C 3PIJA 3O0VA 4CDXA 4EWAA 3AP9A 1QQP3 4ITCA 3AL5A 3TWIA 2GNTA 2ILMA 2XVGA 5ANNA 4DINB 4IE0A 1I3HA 1TMF2 2XJQA 1JZ3A 1Q56A
chains in the Genus database with same CATH topology
2YDEA 4NPRA 3TRSB 2B39A 4YYOA 2UY8A 5FO7B 2JX9A 3TOJA 4AI2A 2NZ9A 2D6NA 3AP5A 2ZX2A 3AZXA 1PVC2 1XE7A 3UKNA 2EAKA 2ZGRA 2ZZJA 2ZAAA 3AJZA 4H7LA 3ZPYA 5BNPC 2DURA 2WS92 2XL9A 2D7FA 1VBC1 2RS12 1VBA2 4AI0A 3E97A 1A78A 1LOBA 3ATGA 4DXZA 4AFAA 2O1QA 2XBO2 4R9BA 5KHGA 2WLQA 3SH3A 1HRI3 4X6RB 3CO2A 1LEDA 3JBG3 1WMDA 4W6WA 2VVEA 1GICA 1ZZBA 4HVOA 2YUEA 1RUF1 4J1XA 4FTBA 4RFT0 2NP0A 1RVF3 1Y43B 4FXKB 3R6SA 3VBOB 1C4RA 3ES4A 1RUH1 3VBUB 3M1HA 1AJOA 5JPNB 4HLTA 3V0AB 3VBOA 2CNAA 3VBUA 2CTVA 4ONUA 1WD3A 3V0AA 2WQ4A 4GIQA 1X82A 3ZFEB 1JUIA 3ZFEA 3JD72 2DFCA 3ST7A 2WFPA 1SLCA 4QMAA 4PIXA 1C8M3 1VRH1 4BH9A 3ZYGA 1O3TA 1X7NA 3WD5A 3DV8A 1DZTA 1V9U1 4H14A 5EXOA 4AGRA 3GHMA 4XQDA 2XUMA 2YGMA 4KWLA 1W6QB 3VL9A 5IK5A 1RUG3 4XPVA 1UIJA 4LLFA 5EZWA 1W6QA 3ZYJB 1XNDA 2H0VA 3MIEA 2UYBA 4AFMA 2KM2A 2HEYF 2R0FA 3ZXKA 2A6XA 1AR91 4YNIA 1BBT2 1DGWA 3TBDA 4C1XA 1G9BA 1RITA 3EBRA 1QJX2 4PLMA 5C4WB 1ZM1A 3P3PA 2AZ5A 1VB4A 2FMDA 5C4WA 4AVBA 3B9CA 2C5DA 3VZLA 1FOD1 1ULCA 3SMHA 3VKFC 3RMXA 2RS31 1U12A 2BNOA 4YGDA 2D6OX 3UKTA 3VKOA 2HWE2 2AUYA 2XJSA 3CJXA 1S55A 2WNEA 3VV1A 1T6GC 1YJKA 3B02A 2VW2A 1SBEA 2I07B 1DDLA 1IZ3A 2VU9A 2NM1A 2K9ZA 4A2UA 2R49A 1S0JA 4FTEA 1AJKA 4KWKA 5BV6A 4AG4A 2E63A 5T3NA 2A75A 1APNA 1SBDA 1DLLA 1YFUA 1WW7A 4N53B 2UWBA 1KRIA 5E8AA 1ND2B 4N53A 3RS6A 3DUIA 2DVDA 4AYUA 2RM22 3JQWA 1N3QA 1OFNA 1ND2A 2LALA 1G9AA 1LGNA 2BFUS 1CX4A 5JSRA 3LOIA 4FQ4A 1EAH3 1NXD1 3TN91 4RQPC 1HXS1 1ND3B 3TNQA 2BEOA 4Z1VA 2R30A 4PLNA 2UURA 2PFWA 3EJKA 4KBBA 4MH0E 3MIHA 3MIFA 5A3MA 5KXDA 2MEV3 1V6KA 2Q5TA 5T54A 1SQ4A 1D4VB 2TNFA 2RR11 3I2DA 2WZPP 3WDVA 4JAAA 1LRHA 1BCXA 3RG0A 3USSA 5K0UB 1ND3C 1LCLA 4L8QA 2AGSA 5K0UA 3SXWA 1NCQB 4CDUC 2HWD1 2X8KA 4IEYA 4FTSA 1NCQA 4GMP3 2Q1MA 3HT2A 2ZGLA 4HPKB 4LO8A 4R8HA 1BVP1 4AFDA 2WT1A 3NW4A 1PK6B 1DGLA 4HPKA 4AXOA 1IQAA 3GYDA 4HANA 5DUUA 1RUD2 1RUI2 4QGMA 1PK6A 1SDWA 1RJ8A 1BK1A 4AVAA 1TE1B 3FX3A 4Q4W1 2ZGPA 3E6BA 1IGOA 1EY2A 1MQTB 1POV1 3ZSMA 2N7GA 2C1FA 2VQ0A 3BOPA 5FPXA 2VUJA 2X53S 4F3JA 1PO11 1MQTA 3IDEA 2E51A 4AVSA 4B29A 3IDCB 1Z7S1 1N1TA 1FXZA 4I02A 2B5HA 4OVEA 3M3EA 4G9SB 2UU8A 2DWRA 2RHPA 1H1IA 3KGLA 4M3CB 1CESA 4DMIA 1BKZA 1CR7A 1IPJA 4CEWB 1KDKA 4M3CA 1QJZA 4PLOA 4PDWC 3VZNA 4CEWA 2BUKA 4UW3A 3S6PA 3PVOA 1RUC2 1LOCA 2A6VA 1S2BA 4QM8A 4I2OA 5JMCA 3OBRA 4XDQA 4HT1T 4Q0UA 1LU1A 4ES8A 5EFUA 5FMOL 4CEWC 1HRI1 3WX5A 1UZZA 5CADA 3JBG1 1NY72 3W58A 4M0NA 2JICA 4KQ7A 1RUJ1 3RI8A 1ZX5A 1J3QA 1E57A 1H2MA 2Z79A 4GULA 4WM7C 2V5YA 4GXLA 3WW2A 1A6CA 1AYM3 1RINA 4RHV1 1VIWB 1S0IA 5CFCB 1CPNA 2YMZA 3BTAA 1RIRA 2I45A 4COWA 5CFCA 4JGZC 1BMV1 1QJU3 4BMEA 4TWTA 3VZJA 4XFBA 5HCBA 2QUOA 2FMYA 2Q8OA 1XNKA 1C8M1 4P9LA 2ZS6B 3L2YA 1FPN1 2JE9A 2A71A 1CAXB 3IM0A 3ZN6A 2E9QA 2EXJA 3VHRA 1LKNA 4GH4B 1CAXA 2YHJA 1KJRA 5D8AC 1RHI3 4UW6A 4GH4A 1RUG1 1Z0HA 1KS4A 4XHXA 3ZO0B 1HV1A 4XQWA 4P9WA 3RPQA 5GZEA 1SLTA 3MZHA 2MPFA 4PJYA 1B35B 4OFGA 1TMF3 4XXAA 1GR3A 1B35A 4XJWA 1MVEA 2XKPA 3BPZA 4QT6A 4FPCA 3MICA 1W39A 1FAYA 3IT8A 4PF5A 1H2KA 1XU2A 4DFSA 2B46X 3WQ7A 1C1LA 1DYPA 2DV9A 1PVC3 3FLRA 3LA3A 3MDPA 4N43C 3OTFA 3J26N 4SLIA 1DQ4A 3J8F1 2WS93 1ZZ9A 4S2GA 2Q30A 4EN0A 2RS13 1R093 1VBA3 1YNAA 4RSUA 1I1EA 3MIGA 4Q2FA 3WDTA 2HJIA 3AFGA 3M8LA 3B94A 2WT0A 1Y9QA 5EV7A 1Q5OA 1FX5A 3MYXA 3AXDA 4HK9A 3H0OA 4LA2A 4FPEA 2WLPA 4B8EA 4ASLA 2IWGB 3NVCA 3UKVA 4FOYA 1Q43A 1S2KA 4PBPA 2VMGA 3WUDA 1LHOA 2GNMA 2WNUC 2O0OA 1CAWB 2UYAA 2EA7A 1JOJA 1EAH1 1SLIA 2HWF2 1CAWA 2XWBB 3WDYA 4MGYE 1GV9A 1OMIA 2VNGA 2CYFA 3V64A 1OOPC 5GJ6A 1YFWA 3VHNA 1ZA4A 2PELA 5IK8A 1LB2A 3KQRA 3BOWA 3AKRA 1QGLA 4R9DA 4JRLA 1VBD2 4WBBA 4LUMA 1XQNA 2W52A 3OD4A 5BNNB 3ZSEA 3FFZA 4K8FA 2AENA 5GM0A 1FI2A 2XHKA 5BNNA 3G7DA 1YRZA 3MLLA 1S1AA 2B45X 3WG1A 4AFCA 1AXYA 2Q4SA 3OYWB 3M3OA 3QH6A 5ACA2 1BBT3 4GMP1 2DFBA 3OYWA 4AGGA 4UBGA 1O4TA 3POWA 3CJIB 1QJX3 2ZGTA 4RA0A 3WDXA 5BNNC 3CJIA 2UY9A 2VW0A 3VN4A 4LBKA 2NYYA 5CFDC 4XBNA 3DPRB 4YVWB 5JSOA 2VNRA 5T5OA 4DB5A 2HWE3 4XJZA 4YVWA 3DPRA 3G6JB 5DUVA 1PGW2 4O9EA 4Z2WA 3JB8A 3ENRA 3AZWA 1VBE3 4Q4X2 4RGAA 3WW3A 4IEPA 4NN0A 3DN7A 1ASJ1 3OGGA 4I3GA 4AQTA 2DVAA 2HEVF 2R072 1EV12 4YGCA 3FBMA 2ZGKA 4YVWC 2QDNA 1LTEA 4N7UA 4AVTA 1MEC3 2X29A 3FWEA 4AVCA 1YI9A 1MZFA 1PMIA 2RM23 1JH5A 2QZ3A 2WJSA 2DCTA 3AKSA 4LA3A 4Q29A 4QX5A 1VALA 4BLIA 4LBQD 4Q0VA 2Q1ZB 5GZGA 2PHDA 4EN7B 2ZACA 4WVWA 2VUAA 1W6MB 1WBLA 4QPYA 5FLHA 2GMEA 4YFZA 5FOBB 3ZSKA 2VPVA 2RS52 5FFOC 1W6MA 4XF0A 4D94A 1GZ9A 1BYHA 1LOAA 1LOGA 3N7LA 4NR1A 1URXA 1YIPA 3RJRA 2SBAA 3GHNA 2W0XA 1ULDA 5DDJ1 1VBB2 1DYKA 5HCFA 3DL3A 2GALA 4S2HA 3W59A 4AQ6A 2Z69A 3FC0A 1V70A 2YZ4A 4YW2A 1AR71 3JUUA 3OD0A 5FPZA 4JGYC 1G6NA 3NJZA 1NOVA 1FV3A 2H0BA 2HKXA 1IS6A 1CIWA 1CJPA 3PJQA 4YZ3A 5KWRA 4P14A 1GZWA 1QJU1 2BTVC 2D93A 1JYIA 2R062 1RUD3 1RUI3 1A8MA 2ARXA 1RC6A 4FAHA 2ZZQA 4Q1PA 1QNYA 4JQRA 3E5XA 3GZUC 2HWB3 3DF0A 5FAXA 3EXUA 4IERA 3M70A 4H3WA 1MZ5A 4M0HA 2XLFA 4AI8A 1G8WA 1PZ7A 1TNRA 3B93A 3VBRB 4M00A 4MYEA 1UPSA 1JBCA 1XYPA 1AZDA 5GLZA 5DZEA 5I91A 4Z82A 3VBRA 1EPWA 1SLAA 3KT7A 4FPHA 1TMF1 2WFF1 3GBFA 3FMGA 5JZGB 1CPMA 2GSYA 4AEKA 1OLQA 2XJTA 1BJQA 3EQEA 3VBSB 5JZGA 4OULA 1QKQA 1QH6A 2BGCA 3VBSA 1G86A 1C5HA 1Q8VA 4BOWA 1O91A 1Q8PA 4C90A 4Q4Y2 4CRQA 3RQ0A 2ATFA 4MGZE 4XF1A 4QQOA 1RUC3 1XNBA 4LLOA 4Y5Z0 3ALQA 2ZOEB 2RMU2 5KHIA 1DGWX 1R091 5JOWA 1F9KA 1PO21 3FFQA 1MS0A 2DU1A 4GWMA 4G4FA 1A3KA 1H4GA 1U5IA 2AYHA 3RYRA 4XBLA 1OD5A 1QJY2 3ZFFB 4FCAA 3SNMA 3WY6A 4FT8A 3ZFFA 5JOXA 4GA9A 4H55A 2PA7A 1LHNA 4GALA 3KGZA 4LO6B 4B4RA 4OHXA 2YYOA 1RJ7A 4P9IA 3K48A 1DQ1A 2OW4A 2FZ1A 3B7MA 1OQDA 1ZZ8A 4W6XA 5IUQA 1RGSA 1DGRA 2R1BA 1ZBA1 3MIBA 1TME1 1DFQA 1AR82 4TLFA 4N9IA 2TBVA 2DF7A 4Y20B 3BALA 1L3JA 3MLKA 4LO4B 4MUVA 5A33B 4ZKTB 3APBA 1J3RA 4YM1A 4K40A 4Y20A 3ETQA 5A33A 5FO8B 2D3PA 2QVSB 4MXWB 4LBLA 5C9AB 2VXRA 1F2NA 3N7KA 4MXWA 3PLQA 5C9AA 2WIIB 2EXIA 2ARBA 3PNAA 3PVEA 1RTVA 2PAEA 1CN1A 1AR63 1HRV1 2D5HA 4DOUA 3AZZA 2EAAA 2HWC2 2GC1A 3IDBB 5LRRA 1BBT1 1J1TA 3H1WA 4CDXC 2W68A 3ASIA 4AEDB 3NV4A 1WLTA 2P3JA 5CB7A 1QJX1 4AGVA 4AEDA 2WZR1 3LSDA 1H1AA 1U0AA 3R05A 3O0XA 5KC5A 2GMPA 3ZXAC 3FLPA 5E1RA 4QU2A 2ZX4A 4RS5B 2ZGUA 1AL23 3BB6A 4AI1A 4BPZA 1NCRA 3WNXA 2GNBA 4RS5A 4ISRA 1VBE1 1LR5A 4GMP0 5K8SA 1UW8A 2K0GA 3VBFA 4A7YA 5L7OB 3NV3A 3ILRA 4XOGA 5L7OA 3S30A 1KDMA 1MEC1 3BCWA 1OA4A 4Y1YA 4FAGA 4LUKA 5KXBA 1REDA 2XJRA 3ZSLA 4XYXA 3PHMA 1BEV3 1PIV3 3WXPA 5IK4A 1F5JA 3VBHB 1UF2C 2BVBA 3KZ4C 3VBOC 3OPZA 3VBUC 1AYN2 3VBHA 3ES1A 2VOWA 1JHNA 1MZEA 1RUE2 3ZFEC 4KGQA 4DZGA 1U5XA 1UU6A 4Y1ZA 1RUOA 1WCSA 4Q4V1 5SV5A 1WW4A 3CNAA 4IETA 4IL7A 4E2SA 5F1RA 3RYKA 2XVLA 3D4KA 4K21A 4HSLA 1QNWA 4GB33 4QPIB 4AI3A 5ACA3 2R0HA 4HN1A 2XGXA 4CZSA 1ONAA 4QPIA 3ECQA 3HMYA 4LR4A 5BPXA 2B8MA 3AK0A 1HLCA 4DS0A 3U4XA 1ZRFA 3A0KA 4FP3A 5JAXA 1M4WA 1PNFA 2HWB1 2JDZA 4AVVA 4P9GA 1A8DA 5C4WC 2JG8B 4TZDA 3N35A 2JG8A 5H9RA 1VBC2 4XF3A 3B3QE 1H0BA 1MVQA 2D6MA 2JJ6A 1U5ZA 5B2GB 3KSCA 3MEPA 2VW1A 1CJDA 4YG6A 1EV13 4RL7A 2XB6C 3FE5A 2R043 4I0WB 4HFSA 3E5QA 3M3CA 4X8NA 1J58A 4D7YA 4IESA 2JE7A 4XTMA 4NOTA 2ZTNA 1GSLA 1RUF2 1OA3A 2I2SA 5J36A 1RUH2 3RDIA 4K20A 1XRUA 5I0TA 2PTMA 4N53C 1ND2C 3HR9A 1H2NA 3TYJA 4UBHA 4CTEA 5AC93 2ZMLA 4MLOA 2QQPA 5F9TA 5JIAA 1RMU1 1DBNA 1FMD2 4LE3A 1R1A3 4XXPA 4GKXA 1SCSA 5I8YA 1VRH2 1DU3D 3OBTA 1GQGA 5SV8A 3UK9A 2QDRA 3DGTA 5CA6A 1ENRA 1V9U2 3O12A 4COUA 2MHFA 1NA1B 3VKMA 2ZGNA 5GALA 2DCJA 4B4PA 1IS3A 5BXXA 1NA1A 3NAPB 2ZHKA 4CDWB 1V6MA 1GFF2 4E2GA 1X36A 3NAPA 3ZIWA 3X29B 4CDWA 3SH4A 5K0UC 1V6JA 1ZBE3 4PIZA 1YXWA 5AFBA 3M7AA 1AR92 2AH2A 5AVPA 1NCQC 4QM9A 3LA7A 4U36A 4KH9A 3NO8A 4IEQA 4BHPA 2CGPA 3TNPB 5T5JA 1PGL1 1DQ6A 1H9WA 4K7JA 3WCRA 3ZFGB 4CYDA 5FQ0B 4JDMA 3I4IA 4YZ2A 3POSA 3VHPA 1FOD2 1FNYA 1PK6C 3CEWA 3ZFGA 1UMZA 1QQP1 4NHMA 5FQ0A 5H9SA 1UKGA 4MV2A 5LK5A 2RS32 1PZ8A 1LODA 2YC0A 1AR61 5FLJA 1C3HA 3AXEA 4YGBA 1MS9A 4I30A 4AEMA 2IC1A 1MQTC 1VR3A 4YZ4A 5I93A 5K7PA 1ENSA 2K2SA 2VVFA 4HN0A 3IKWA 3AP4A 1EPZA 3S0MA 1YLLA 2HYKA 2PHUA 4R52A 4Q4Y3 4SBVA 4LHLA 3B5LB 3WQ0A 3WHTA 4COZA 3GF6A 4OLLA 1CQ9A 1AL21 4YZ5A 2DUOA 4BM8A 2VH9A 3TN92 4F83A 3P3NA 5FLIA 1HXS2 3KS7A 1MS1A 2QKDA 3HAGA 1QJY3 3WHUA 1D0HA 3MFAA 1RVF1 1CONA 3N3HA 3RSJA 4YW5A 2CWMA 1C8NA 5FO9B 2DCZA 1LOFA 2WA4A 5KHJA 2PHLA 5F6LB 2RR12 2WNVB 4E4SA 1GKBA 3WV6A 1QH7A 4R9CA 4F7ZA 4XEZA 2WNVA 2A6ZA 3NWKA 4KNCA 1W2UA 4KWJA 2CV6A 4WVVA 1NYWA 3UL2A 3VZMA 1DZRA 2DU0A 2D44A 1BEV1 4XQ4A 1PIV1 2B42B 3ZN6B 1U5YA 3VZKA 1OI6A 4ATEA 2HWD2 2WWSA 3B01A 2WSUA 4PQ9A 4JC1A 4EV0A 3NV1A 1UX6A 2PN5A 1AR83 3AP6A 1VB2A 4QQLA 5CFCC 2Y0OA 4K9SA 1ULGA 2F4PA 3LKJA 4XJ9A 3RI9A 2ZABA 3FUQA 2ERFA 1X8EA 2CAVA 1XXNA 4EJRA 2DCKA 4BLJA 2DTWA 4Q4W2 4A7ZA 1NXMA 4FSJA 2TEPA 3H9AA 4MX3A 1NLSA 3QD6A 2ZHLA 1PO12 3KB5A 4GH4C 2HWC3 4GB31 4LTAA 2EIGA 1K5MB 1ZRRA 1ALYA 1Z7S2 1JTZX 4FPGA 1K5MA 3PMSA 2VY0A 2BFUL 4I0BA 1B35C 1JW6A 3ILNA 4INDA 1IPKA 4JTNA 3MW4A 4YVSB 4Q8LA 5BNQA 3LOBA 1WGPA 2XBO3 2V73A 4YVSA 3BIWE 4HKWA 2QZ2A 1PM7A 2GC0A 2ZA9A 4R4XA 3HN1A 4TYSA 3SLIA 4W6YA 2VOKA 2I74A 1AUYA 3VL8A 4EWDA 1UIKA 4LNVA 3GALA 1QU0A 1NQJA 5CVRA 3RZZA 1HRI2 2R041 1VP6A 1J1LA 2R16A 4XILA 4V1PA 1JYCA 4Y24A 3JBG2 2PHTA 2YGLA 5EWSA 2XJPA 5JCTA 1OHFA 4D69A 1X33A 1RUJ2 5CG8A 4W65A 3O7OA 1NQDA 3AFKA 2P34A 3L2HA 4MGIE 5FCCA 4H7MA 1PZ9A 3FJSA 3O5SA 3JD73 1BZWA 2BNNA 3VZOA 5FRAA 4RHV2 3CL1A 3MPPG 2MEV1 3KT4A 5GLVA 4OHZA 2RE9A 5AC91 1BMV2 3NKGA 4GQ7A 2WSVA 1UPIA 3SCGA 1R1A1 1LECA 3HWJA 4NHKA 1C8M2 3LWCA 3N36A 1O3RA 1BXHA 1FPN2 2ZMNA 1G9FA 4AE2A 4WM8B 1LENA 4YM2A 3H1MA 1OKQA 5KBFA 1RB8G 3N7MA 4CP0A 4WM8A 2ENRA 2YPJA 1RUG2 2IFWA 5KC6A 1O5LA 3ZXEA 4ZU5A 4WVMB 4JV4A 4IV1B 5JPMB 1ZBE1 4WVMA 4XF4A 2BQPA 2E7AA 4E4ZA 4IV1A 2H6BA 4FPFA 3R4UA 1CVNA 4D7SA 1YI7A 1YFXA 3SHRA 3POYA 5KHKA 4FOVA 4URTA 3K51A 3CJIC 4P9JA 4FOQA 2C9AA 3DKWA 1N3PA 3IWZA 4NHLA 4C91A 4KG8A 3H1YA 3J8F2 3MIDA 1VAKA 5DG2A 4P5HA 2PHFA 1EYBA 2OUJA 3DPRC 2DVFA 4HMZA 5E16A 1WW6A 4QHBA 3WP4A 3U0ZA 4GWNA 1HW5A 4FPYA 3JQXA 3VDDB 2E7TA 2XVKA 1OQ1A 2ZCWA 3VDDA 4QQ2A 2YROA 2PHXA 3D6EA 1SEFA 2DYCA 2XJUA 4FPOB 4OI0A 3AP7A 2V09A 4Q4Y1 1EP0A 1S0FA 4AWDA 1D4M2 1ZZCA 2XL7A 4LE4A 1Z78A 3M3IA 2XWJB 4LBMA 3W9AA 5GKAC 3NKTA 1EAH2 4Q1RA 1MS3A 1GBGA 4IEZA 1AXKA 4RR3B 3T1MA 4UW5A 4J6GA 2WQZC 2R6QA 4RR3A 1QJY1 4XJAA 1V6LA 2G9FA 3I7DA 4AHXA 1FMD3 4Q0QA 5ABJA 4XBQA 2E6VA 1KD7A 4NWVA 3WCSA 1W6PA 1F5FA 1GZCA 1G9DA 1AYM1 2VOVA 3THTA 4Q8KA 3LAGA 2IXLA 5IT6A 2WL1A 1LGCA 1YWKA 1GZWB 2PLV2 4UW4A 2ET1A 1QXJA 4C0HA 2O8OA 3AKPA 4LBNA 2PAKA 3RYPA 3MPBA 1H4HA 4Y1UA 1QOOA 1ZRDA 3H7JA 3QH7A 1D0GA 1QXRA 1QOSA 4K1YA 4ZU4A 1AR81 4XMIA 3CLPA 1SFNA 1O3SA 2PHWA 2G4IA 3FHIB 1RHI1 1RL3A 1F8VA 4QD2A 5L36A 2EF6A 4CDQB 1UCXA 4LBJA 5J09A 4YARA 3R4DB 3ZSJA 4CDQA 5GZDA 1S0GA 1QDOA 1YFYA 2A3WA 1LESA 4A3XA 3AZVA 3ZXDA 2RS33 1AVBA 4IEXA 1R082 4ORFA 4XFIA 1X50A 2DVGA 2A6YA 4CEYB 1CAVA 4NO4A 4Y26A 4CEYA 2IXHA 1PVC1 1ASJ2 2BBVA 3QOPA 4YW1A 1DIWA 2Y38A 4HKLA 3VBRC 2ZX3A 3GBWA 5JI7A 4XFCA 4COVA 1YJLA 2A6WA 1FT9A 2WS91 3O0WA 4N7IA 3ZMNA 4YZ1A 1XNCA 3EHKA 1G9CA 5GZCA 2RS11 5H9PA 1VBA1 4LBQB 1ZZ7A 5JZGC 2LM3A 3HT1A 3NV2A 4DRVA 4LBQA 3VBSC 2XBO1 1AL0G 2D98A 3BU7A 1JXNA 1UU4A 4IV3B 3AB0A 3TN93 2QFEA 3LB9A 4YGEA 4IV3A 4QPGB 3SCFA 4BA6A 1AXZA 1LOEA 3NL1A 5DUXA 2WINB 5I0UA 1H8TB 4I0AA 2Y0IA 4QPGA 3ZYRA 5C8CB 3ILFA 1H8TA 4Q0SA 3SISA 3WW1A 2D5FA 1O4ZA 1LHWA 2IXKA 3BODA 3ZXGA 5C8CA 4YM0A 2SLIA 5DDJ2 3ZFFC 3WINE 4IQPA 1NZCA 4QGNA 2YY1A 3JD71 1PNGA 2OVUA 2F6BA 5L19A 2VMHA 5LRSA 1AR72 2HWD3 1ENQA 2OA2A 5DG1A 3FZ3A 2IFRA 2CL2A 4YSFA 5HCAA 1HDKA 1QJU2 1FV2A 1QHDA 1OFSA 4OI2A 1ZZ6A 3MGUA 3C3VA 4YW3A 2D6LX 5I8SA 5A32B 2BVVA 4Q4W3 4Y1XA 3WG3A 5LK7B 4BIFA 1POV3 5A32A 3LZZA 4AEJA 4HSJA 5JWPA 3OF1A 5BNOB 5C9AC 4BMBA 4Q0PA 5EYYA 1KITA 1REEA 5BNPB 5BNOA 4JVAA 1Z7S3 2R1DA 2ZKNA 1OPOA 1JN2P 5KHHA 5BNPA 2WFF2 3HD8B 3AJYA 4HVQA 1NCRB 4HKOA 3FBYA 2HWE1 1NG0A 2ZGSA 4LEJA 4IEWA 2DTYA 4MZUA 5JI9A 4AEDC 1LULA 3VBFB 5BNOC 1AHSA 2P3KA 1MS8A 4FP2A 3A4UA 1N1YA 1O5UA 3J9SA 1QF3A 2D6KA 1J3PA 1COV2 1MR5A 4JDOA 4BYYA 2P37A 1R092 1HV0A 3FUOA 5DZFA 1PO22 1NCRC 5HI0A 4RS5C 4FXGB 4HBNA 3WR0A 4XHBA 3H8UA 3WVJA 2VMIA 2RM21 2ZHMA 1PVXA 3VBFC 1QY4A 3ZVXA 1WLDA 4OI4A 2D97A 1FYUA 1REFA 1RUJ3 2HWF3 4BE3A 5GLTA 5L7OC 4XJ8A 4MGKE 5FTTC 1NLRA 2FQPA 2RJLA 5JSPA 2ZAHA 4LHKA 3I8TA 4M3CF 4RHV3 4OHWA 3AYDA 4ZXKA 2OIIA 4KG0A 4ASMB 1VBD3 2GH2A 4P9YA 1ZBA2 2ZPXA 1TME2 3MI8A 1FMD1 1MS4A 5FMOS 3VBHC 3H3UA 4BIOA 4IEVA 4O9GA 3ZMOA 1FPN3 4LHNA 5EYXA 3SITA 2XG3A 4JTOA 2KA3A 3ZX7A 4AQSA 5IK7A 1S0CA 2GC3A 1J59A 3ELNA 3LSEA 1GQHA 1C5IA 1ULEA 1ZYBA 2YXSA 3V0BB 3ACLA 5CU1A 2DVBA 2GZWA 3V0BA 1YUDA 1HRV2 5T50A 1H9PA 1H1MA 1RUD1 1RUI1 4HK8A 4XFFA 5BY5A 4FVVA 2W39A 4QPIC 2NN8A 4L97A 4KU7A 3HBZA 1IKPA 2CAUA 4BWOA 4ES9A 2WZR2 1QOTA 4Q4X3 3IIAA 4X6QB 2ZGQA 3VKLA 1D2QA 1S0BA 1V6IA 5LEJA 1FNZA 3URFA 4YM3A 3J8F3 3ZXJA 2IXIA 2LUWA 4XJUA 3VGIA 1WD4A 4C1WA 2R073 5C33A 5HBAA 2JECA 2WT2A 4NWWA 3USUB 1ENXA 1UD1A 2XH6A 1VBE2 3KLSA 3WOGA 2JG8C 3USUA 3QLQA 3WG4A 5H9QA 2Q0AA 5DZGA 2XPJA 1MZ6A 3C2UA 4RQPB 3MLJA 4D7TA 1SBFA 2A5ZA 4RQPA 3ZYIB 5BUVA 1RUC1