2RE9A

Crystal structure of tl1a at 2.1 a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
164
Chain Sequence
b'LRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine, hormone/growth factor
total genus 26
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2re9A01
4KG8A 2JG8C 2WNVB 5KWRA 1PK6A 2Q1MA 2R30A 2O0OA 5L19A 1U5XA 3B93A 2HEWF 2JG9C 5KC6A 4NN0A 4DB5A 2KA3A 2AZ5A 4G3YC 4OULA 1C3HA 3AB0A 4QQ2A 1OQEA 4TSVA 2OIIA 4KGGA 1TNFA 1PK6C 1S55A 4MXVA 4QPYA 2HEYF 4MSVA 2WNVA 1U5YA 3URFA 1U5ZA 4E4DX 3ME2A 1WCKA 1O91A 4MXWA 1GR3A 4OUMA 5CIRA 4OUSA 2JG8B 1RJ7A 1JH5A 3QBQA 3TYJA 1D2QA 2WNUB 2E7AA 4E4SA 2WNVC 2JG9B 3WD5A 1DU3D 4D7YA 3B9IA 4QQHA 1OSGA 2RJKA 4TWTA 2Z5WA 1D0GA 4HT1T 5L36A 4J6GA 2TNFA 4QQPA 1A8MA 2QDNA 3K51A 1KXGA 1ALYA 3ALQA 2WNUA 1RJ8A 1C28A 1JTZX 3K48A 2R32A 2QE3A 4KGQA 4QQOA 1I9RA 2RE9A 5KC5A 1XU2A 1KD7A 2RJLA 3QD6A 3FC0A 2TUNA 5TSWA 4DOUA 3V56A 4G4FA 3B94A 1TNRA 2WNUC 2R6QA 1PK6B 4RSUA 2JG8A 4MXWB 3TWIA 1IQAA 1XU1A 4F3JA 3IT8A 2JG9A 2ZPXA 4EN0A 3L9JT 4N90A 4GIQA 2HEVF 1D4VB 2Q8OA 1DG6A 2ZJCA 1OQDA 3MI8A 3LKJA 4QQLA 5BNQA 2X29A 5HBAA
chains in the Genus database with same CATH superfamily
3J8F3 2EIBA 1J59A 3TNQA 3AMPA 1IGOA 1ENSA 2ZABA 3UV9A 5FZMA 1ENQA 1YRZA 3OEBA 3VZNA 2CDPA 5H9QA 4HPKB 2EXHA 5F7UA 4Q0PA 5C4WB 3VUOA 3IPVB 3OEAA 2GMEA 2EAAA 2G9FA 2DVAA 4ONUA 4WM7C 2BNMA 3KF5A 4L8QA 2W91A 1LHVA 4DPNA 1UOBA 3AB0A 4KQ7A 4W6WA 4RGAA 4OUEA 3O0XA 1PZ8A 1DZRA 4IV1B 2WJSA 2FBEA 2AEZA 1NCQA 3WNOA 1OQ1A 4Y1VA 1D4M2 5FY1A 4F8AA 4MSVA 5J1XA 1XQNA 3HNBM 1F9KA 3J4UH 3PUHA 3A22A 4LBLA 1MZFA 4UF0A 1XSQA 3SKVA 5JSPA 1TME1 2HWD3 1HB4A 1TE1B 1WCKA 4IV3C 3AZVA 2NMNA 2VE1A 4PCRA 4QXBA 4ZU5A 5LB6A 4BA6A 4HK9A 4Y1ZA 4HKLA 4MH0E 4OUSA 3VKMA 5F5IA 5JSOA 1F15A 1AYM2 2GH8A 4Q2FA 4YW1A 2Q1ZB 3HAGA 5FXZA 2OS2A 3ZKYA 4URTA 2XJRA 2XJPA 1WLTA 1W9YA 3NNGA 1VBE1 1W03A 4D7YA 3SCFA 3LIHA 2ZAHA 3BTZA 3VZOA 2ZGUA 4IEYA 1OA3A 4XAEA 3WDTA 4YVSB 2Y6HA 1PNFA 1QWRA 4XMIA 3WP3A 2HWE2 1BBT2 2CL2A 5G05L 2JB4A 4PIXA 2WZPP 1BLZA 3LE0A 2TBVA 5CB7A 1ENXA 4A6SA 5FMOL 1ALYA 2EALA 2R0HA 4EN7B 3OYWB 3MHZA 1A8DA 1QJX3 1YQ6A 2AUYA 4MGYE 3AKRA 2DU0A 4F7ZA 1K3IA 1QQP3 1GLHA 2QQNA 1UPIA 3LD8A 1HXS3 3GCXA 2VO5A 1YIPA 3ZIWA 3RMXA 2VBDA 2ENRA 1VBB3 5BNNB 5KC5A 1X82A 3FC0A 3FWEA 2VCMA 2WLPA 4LBQD 4Y26A 4MADA 2AEYA 4WZCA 5EXOA 4ZZ5A 5F39A 1FPN3 2JD9A 4DRVA 1GANA 3A21A 2SBAA 3WG4A 4GMP1 2QNKA 1N1SA 4AHWA 3POFA 5FTTC 1NKGA 3BTYA 4N8MA 4GB32 5LZ6A 1PGL1 4XCBA 2JG8A 4FI9A 2QQLA 4AYUA 2WFF3 5FJKA 2EAKA 4I0WB 1GV9A 4BMBA 3DXUA 3RGBA 2ZPXA 2ZGTA 5D8AC 3ECQA 4IEQA 4A3ZA 1QXPA 5L9BA 3D6EA 1YIFA 3H3LA 4TYSA 4FTBA 4K9SA 2Q8OA 1KITA 4HMZA 1QJU2 1MS1A 3WNPA 1JYCA 4NIDA 3AZZA 4Z1VA 1DQ2A 2WS92 1X8MA 2J1VA 1DF0A 1DZTA 1GWMA 3WDYA 1NCQB 1W3VA 3T2OA 3O14A 2XJSA 1D4M1 2Z42A 1XNKA 3BUCA 1J58A 1MS9A 4OCTA 2B4KA 3KGLA 5B4XA 1QDCA 4FOQA 1ZZCA 4YYOA 2BFUS 3LDBA 4K1YA 4PBOA 4Q4W2 2JDZA 3GDBA 3VBRA 5KC6A 3V0BA 2AR6A 3BU7A 4RL7A 2H6BA 2BUKA 3BB6A 5JR2A 3EXUA 3U11A 4PJYA 1RHI3 4FFGA 1GSLA 4ZONA 1O59A 2D3RA 4HG6B 1WA6X 1SEFA 5FBJA 4YGBA 1AYM1 3HBKA 2JKXA 1XJAA 2LTNA 2WO3A 4Y3OA 3SHRA 1RL3A 5FZDA 5LA1A 5F3CA 5LRRA 1MQTC 1RXGA 2OT7A 3C3VA 2WDBA 4DZGA 3GYDA 1ULDA 1H8TB 4GXLA 4ZS2A 3RPQA 1CAXA 2CGNA 1SACA 3HMYA 3RNSA 5FY0A 2VUJA 2FQPA 4P9XA 4ZXKA 3WQBA 1ZBE3 4EN6B 5GKAC 2W1WA 3JD72 3ME2A 4XJ9A 1EUUA 3MEPA 1AZDA 1UX6A 1WA4A 2VTFA 3LF7A 3E5XA 3IIIA 3H7YA 2VVDA 2W95A 5C9AA 3S5QA 1EP0A 3T1LA 2EIDA 1BBT1 4UW4A 3RZJA 1YO8A 3NAPA 4H2AA 5D2AA 1NOVA 3RS6A 1GZCA 1K45A 3ZLIA 2EXKA 3MDPA 1YLLA 2R071 4FVVA 4NAMA 4RFT0 4XF0A 1UMHA 1ZX5A 5CFDC 3BU0A 1W6PB 4FO9A 4QX3A 3WP4A 4QX7A 1MZEA 1LOAA 1UZ0A 1LJ7A 3I2JA 1LOBA 4CEWC 1W8HA 1O4ZA 2R7EB 4WM7B 3ZYJB 4N9IA 4KMQA 1F5JA 1PIV1 3QOPA 3PVOA 1W2NA 4JGZC 1OT5A 2VZPA 1S0CA 1L7LA 3NO8A 2JKBA 4FAHA 1DYOA 1UNBA 3ZFGC 2VZQA 4RA0A 2PHUA 2NLRA 3WF3A 1VBD3 4FXKB 1R083 4MX3A 3ZYHA 4COWA 2PYTA 1ND2C 4LO7A 2H0BA 4IV3B 1BCXA 2LROA 2A3YA 1XNDA 1ZA7A 4HL0A 3U75A 2GALA 4LO6B 3J7HA 2RE9A 1KRIA 4Q4X1 2BW8A 4MG2A 1RUD2 1DIWA 2J1RA 4DOUA 2BBVA 4P9LA 2VCAA 2WC2A 5D1IA 5FP7A 3VD4A 4FSJA 3OCPA 2DUQA 3AYEA 1IHMA 2UWBA 2ZA9A 3CZJA 4B8EA 3WDXA 4NHYA 2DTYA 1K12A 4OHXA 4DUXA 3KVBA 4Q4W1 4NAOA 3VBRB 4ZKTB 4XJZA 3UKTA 1PZ9A 5FFOC 1XU1A 4FQZA 4QM9A 4XHXA 4PDWB 3FN9A 4Z82A 5DAQA 3BIEA 1RUC3 4JVAA 4UFLA 5ACA2 5IK7A 1ZRCA 1AR71 2SLIA 3LPFA 1FOD2 3UT0A 1RVF2 4PI0A 1WKYA 4DNYA 3WZ1A 1H9WA 1PO13 4HFSA 4LORA 1NCRC 3AP9A 3CIHA 1URXA 4WM8A 1CAUA 4HVOA 3TBDA 5FDBA 4W50A 1P8JA 3JD71 5L19A 4LE4A 1PGSA 2A6XA 2HWC3 4XXPA 3ZR5A 3AVRA 3J7LA 3WW2A 2W08A 1PM4A 2K9ZA 4XDQA 5C9AB 4CCKA 2E63A 4JKLA 5DAVA 5A1AA 3MFAA 1BXHA 1QY4A 4AEKA 1WCUA 2WZ8A 2XVGA 5GJ6A 3TEYA 2QTWB 1ZBA2 2WZR2 3AP5A 2E31A 3N7KA 1QJY3 2KM2A 4INDA 1NLSA 3OPWA 1VRH2 2P3YA 4XFBA 3WG1A 4TLFA 3LOBA 1FNYA 2A3XA 3J8F1 3VD5A 4B7KA 4O65A 3THTA 3DECA 2JE9A 2ZEXA 1PX4A 2RS52 3I3QA 3I4IA 2BNOA 5FUNA 2J1AA 5JCTA 4XACA 5GZEA 1W9WA 4QX1A 3ZMOA 1QOSA 1JOJA 4N7UA 4DY3A 2VCBA 2DCYA 1WCQA 1VP6A 1F4AA 3OD4A 4K8FA 1UAIA 2BOIA 3EYPA 4XC9A 5FPLA 2A75A 2ARCA 1O8SA 5GZFA 1NY72 3B01A 4K1ZA 3TYJA 2F17A 2GP3A 3O1UA 3BPZA 2QDRA 2XJUA 3IDEA 1BQPA 2I2SA 5IVBA 1FMD2 1XYNA 1GZWA 2BGOA 3MPBA 3BTAA 3OGVA 4GJZA 2LW8A 4BWOA 2A5ZA 2ZS6B 2IFRA 2DVBA 4M4PA 3N35A 4QGNA 4Y20A 2CDOA 5C71A 1ZREA 3VZLA 5FYUA 1YQ5A 4I2OA 5FZIA 2RS33 5DDJ2 1GQGA 3ZDVA 5JWPA 1UL9A 2B39A 1QJZA 3I2DA 1CONA 3IB3A 1POV3 1RUJ2 2ZXQA 1AR82 4YM0A 1G6NA 2P37A 1STMA 4XDOA 1W99A 3K51A 2BWCA 2PA7A 5LBEA 2Q8DA 4D7TA 2WINB 3LA7A 1FV3A 2DVFA 2PQSA 4QPIB 2A6WA 2O14A 4LLOA 3RWNA 3MW4A 1OKQA 1MEC3 1J83A 2XL7A 1YEWA 2XH6A 1C8M3 5T52A 2QQVA 3QD6A 4M00A 3O1TA 3KT4A 3TN92 4YARA 3OBTA 5ACA1 4LBQA 5CFDB 5JPNB 2ZGOA 4SLIA 1FOD1 3NJZA 1HW5A 5I8SA 5T3NA 4CU8A 2C9AA 3KGZA 3AZXA 2MNGA 3OPZA 2BTVC 4CA9A 1TMF3 5JXIA 2D5FA 4CEWB 3WNLA 3O0WA 4LO4B 1OD3A 4WM8B 4XBNA 1CAUB 3PU3A 5FZ4A 2UWCA 1QJX1 5JZGC 3PVBB 2RDNA 3LAGA 5FLHA 5E88A 2YMZA 5BPXA 4RHV3 4XXAA 1LHUA 5I8YA 1K5MA 2B9UA 2YBSA 1HXS1 4IEXA 4KBBA 1S0JA 3KV6A 4ISRA 3N7JA 4CXXA 2GN7A 5JR7B 3ZFGB 2ORZA 2K2SA 2WR9A 1W0OA 5DUVA 4OHVA 3GCWA 1NQJA 1Z0HA 3VBFA 1ZBA1 3WQ7A 1UXXX 2WQZC 1W6NA 4DUWA 3ACHA 4EWEA 3DL3A 2NN8A 3IMMA 2QBXA 5BXXA 5F9TA 5E89A 3BIWE 2JE7A 5KHJA 2PHFA 3N9OA 5LCWL 1AXYA 2DVDA 1MZ6A 2DFCA 1VBC3 2RS51 3NQHA 4LOSA 2R30A 2WFF1 2O0OA 3H1MA 4I30A 4Y1UA 2H6CA 5A32B 4DINB 5FPUA 2GSYA 4P9IA 1LTEA 2FZ1A 3LFIA 3OUHA 1L3JA 1SLLA 2E6VA 1T2XA 4PF1A 4Q8LA 4AVCA 5C70A 4HXCA 3QLQA 2R062 1W8UA 2ZX1A 5A80A 1AX2A 4Q4Y3 4MGIE 3MUY1 5EWSA 4AL9A 1IPKA 1IG3A 4AI1A 3DPRA 3U4XA 1LULA 2RS12 4COUA 3P6BA 2W1QA 1V6OA 2OIIA 1VMFA 1UZVA 2W94A 1C8NA 1GZWB 4M01A 4HLTA 4L9BA 1BK1A 3AZYA 5JI9A 1U5ZA 3N7MA 4KNCA 2V73A 4Y20B 4YGDA 4YW2A 3DV8A 4YZ3A 4P02B 5DDJ1 4HONA 5BNPA 1C1LA 4CDXC 4AI9A 3VBSC 1UO9A 3VBOC 1NCRB 2Y0IA 5FP8A 4AHXA 1XNBA 4Z8BA 3JXSA 2GAUA 5JSRA 4BH9A 1GBGA 4GMP0 2FCTA 3QBQA 4DMIA 5FO9B 4AHZA 4JKKA 1ZZ6A 4LA3A 4HOOA 1W9TA 2R043 4PQ9A 5FZ9A 1Q5OA 4MGSA 1S2KA 2GC0A 3N9MA 1UYPA 4QPGC 5A7NA 5BY5A 4LEJA 5AC92 3T0DA 1PGW2 1VRBA 3PUQA 4HT1T 3K4ZA 3MYXA 1EAH2 3TN91 2WO2A 1QEXA 4QWNA 1UWWA 1C5HA 1G7YA 2BVVA 3NV3A 4A7KA 4HKWA 3LDRA 4Y1YA 2HBTA 5LY2A 4AZZA 3THDA 2KXLA 3W5NA 2OUJA 3PHMA 3AJYA 4HSJA 4QHZA 4BXFA 3IMNA 3S7IA 4QXCA 2L9LA 1K5MB 3K48A 2RV9A 5EJ3A 5IK4A 4A2UA 4BQ2A 1PMIA 3AYCA 3C7OA 5EHDA 5HCAA 5FP3A 4IE4A 3WINE 4XUPA 2GU9A 1RXFA 1DFQA 4DUVA 1XYPA 2W39A 1IZ3A 1LB2A 4JTOA 1VBD1 2GN3A 2J42A 3AP6A 1R081 1NE6A 2BYVE 3AK0A 3GZUC 4OHWA 4FOVA 3SCGA 1JYVA 1W3XA 4YVWC 4CU6A 1TVGA 2XG3A 1R093 5GLTA 2X53S 4K6BA 4AFDA 3ZXFA 5HV4A 4B1LA 2RG4A 2HLEA 3FX3A 2P6HA 5DUUA 1Y4WA 5T5JA 3IBMA 3SLIA 5T55A 3KHCA 2R061 5A3TA 2JX9A 2V5YA 5FPAA 1ULEA 4CDUA 4OVEA 3H0OA 2QQUA 2X5IA 1EUTA 3DPRB 1OLMA 2VR4A 3VKFC 1J1LA 3ZYPA 3J7MA 3OBAA 4AEDA 1ASJ2 3E6BA 4Z2AA 4BQYA 1CX1A 1ND3A 3I2FA 2OZ6A 1WLWA 4CU9A 1XB9A 4LUKA 3B3QE 1QDOA 4HVRA 3FJSA 2VOXA 1LESA 3RJ2X 5F6KA 5FZ1A 2XVKA 5FZ7A 1RUC1 2HEWF 2JG9C 3FUOA 2VMIA 1ZZ9A 4IUGA 4X8PA 3BN6A 1ACCA 4M3CA 2ZGSA 1W8OA 2Y8KA 5JOZA 2QJVA 3H3ZA 5FJHA 3ENRA 2JJ6A 4JTNA 5FYIA 1ZYBA 2ATFA 1V6JA 1OXCA 3E5UA 3OPTA 2RJ2A 4QX8A 1NA1A 4UWDA 5B2GB 4BLIA 4BQ4A 1WCSA 1PK6C 1SCSA 1RUNA 3VBHC 1B09A 2FCVA 2HEYF 4P5HA 3TEXA 1U5YA 1CZTA 4BLJA 1OVPA 3KT7A 4CP9A 4H7LA 4Q1PA 5B4NA 1YQ8A 1PGW1 5C8CA 4EQVA 1ZA4A 2QUOA 2XBO2 3WNKA 1EAH1 1O91A 4UYBA 1H2KA 1UY3A 4B29A 2Y6KA 3FE5A 4LBOA 2W47A 4XFIA 1GQPA 5A6YA 1QJY1 4EJRA 1RJ7A 2I45A 5HCHA 1U0AA 4PI2A 3B7MA 4P00B 5BNOA 4CEYB 1Q8QA 4YRDA 4QXKA 1H2MA 1SFYA 2E7AA 2FCUA 4Y5SA 1HIXA 5J7MA 4BK5A 2B42B 2JENA 2WRAA 5F3IA 5IVVA 5DAXA 1X36A 3OGRA 1Q8VA 2RJKA 2A71A 1BK0A 3PDQA 4TWTA 5FZGA 2OA2A 5CADA 5HCBA 1GNZA 4QX2A 3ZXDA 1V6LA 1S0FA 4HN0A 4UW3A 2DV9A 4BQWA 5A33B 3RZGA 4AWDA 2NP0A 1OBNA 1AL23 2UWAA 3DN7A 5FQ0B 5C4WA 2WWJA 2QDNA 4UFJA 1UU6A 3ALQA 4QGMA 4Q8KA 4MVTA 1RJ8A 2ZHLA 3M3QA 1T6GC 3AFKA 1WMXA 3FLRA 5FPBA 5L7OC 3WT3A 1XSRA 3NNLA 3K46A 4IW3A 4IV1A 4QB1A 1SQ4A 3MW2A 2XLAA 3GHMA 5IT6A 1H4GA 2TUNA 4CDUB 1H1MA 2A7AA 4YPJA 1POV1 4ASKA 4Y22A 1KEXA 5FYCA 2CU5A 3LPGA 4NRPA 3VHRA 2JDMA 1BMV1 3HR9A 2PMWB 1TME2 5DXDA 2JB8A 2J1SA 2WNUC 1DP0A 1JZ6A 2QZ3A 3T2PA 1W2OA 1JYIA 2D40A 5F5QA 2ZX2A 5A3MA 1I5PA 2Y6JA 3J9SA 1O5UA 3P3PA 1NXD1 1S1AA 3C7HA 2QKDA 3ETQA 5A7WB 1C8M1 2BVBA 5ANQA 1NE4A 3H9AA 4CDQC 3HNMA 3ZSMA 5I91A 1VBE2 4Y4YA 1NYWA 2C6SA 3T0BA 2Q5TA 1IS4A 4I01A 4B7EA 1OH3A 4TLGA 1TMF1 1J3QA 1IKPA 1NA1B 5I0DA 4ATFA 4YVSA 4MUVA 2VW1A 3POYA 3K4DA 4E4HA 1UY1A 4YZ2A 5F1RA 1NLRA 3E5QA 1B35B 4CP9B 2EA7A 2YFZA 4RHV1 4LUMA 1N47A 3WF2A 5A70A 5C8CB 3GBFA 1ULFA 4KU8A 4PBPA 3OBZA 5IFTA 4IXLA 3DYMA 1KQRA 2YYOA 3T2TA 2OPKA 2VOTA 4GWIA 1S0GA 4YVWB 4ZXEA 1US3A 4QKBA 2GC3A 3E97A 4GQ7A 2XONA 1KS4A 4B1MA 2MEV3 5BNNA 1I1EA 1BEV3 2EF6A 3O12A 4IGPA 4YFWA 3VB9A 4CSWA 1LGCA 1TNFA 5JDBA 2ZZQA 1S55A 1YC61 1QNYA 2JDNA 2WNVA 2Y26A 4JDOA 4JRAA 5IVCA 3HWJA 5FY7A 3I2IA 3LDKA 3N9PA 1RUG3 1YWKA 2DFBA 3AX4A 4NIIA 1PGL2 3PUIA 2NQYA 3WUCA 1QXRA 3AL6A 4Q4Y1 4IERA 4YZ1A 3BODA 1XNCA 2ZGPA 4MV2A 2WABA 2B45X 4FOYA 4IEOA 3OGGA 4OHZA 4CTEA 3O1MA 1H0BA 2P1BA 4ISQA 5CISA 2QQJA 3ZN5A 4C90A 4X6QB 1VBA2 2WWSA 3N7LA 1DBNA 1QHDA 1RIRA 2YDEA 5FUIA 5FY8A 2JG9B 3O1VA 3N36A 2A6ZA 3B9IA 2VNOA 1WW7A 4YZ4A 2PHDA 5F5CA 2PLV3 4PLOA 5CA6A 5KHGA 2Z5WA 3LCPA 2MPFA 1LENA 4LK6A 3A23A 1A3KA 1K42A 4ES8A 5CG8A 2D6OX 2TNFA 4H3WA 4Y22B 4LO8A 3H8OA 1YQ2A 1XBFA 1AR92 2VZ3A 1LRHA 1ZRFA 2XGXA 3VBHB 3VKNA 3AMMA 3ILRA 3VDAA 1RTVA 4NOTA 5I93A 5ANNA 3ZXAC 4LT5A 2DF7A 2JEMA 2KR2A 2ZX0A 3EMRA 3KMHA 2O1QA 1I6XA 2ILMA 1VLNA 2R041 3CJIA 4LKEA 3OUJA 3LWCA 4Q1RA 3WDUA 1AXZA 1XC6A 1HB3A 1JUIA 3ZM8A 3JBG3 4BOWA 2E26A 1BYHA 4DXTA 1RMU3 1H8TA 2UURA 3SC7X 2WN2A 4NRMA 2VMCA 2RJLA 5FZBA 4HKOA 1JBCA 3MLLA 3AYDA 2VZVA 2CAVA 4QKDA 3WV6A 3V56A 2FDHA 3HNYM 5A1LA 5KHIA 2Q30A 3D82A 4Q4V3 2A3WA 3T3YA 3H42B 3ZYIB 2BJSA 3Q8FA 3DGTA 3BTXA 2R6QA 1YQCA 2ZEWA 2HJIA 3VN4A 3U14A 3ZFEC 2VZOA 3J26N 2QQWA 5IK5A 2R072 4I09A 1W6MA 1WUVA 1V6MA 3VHNA 1W6PA 1V6IA 4AVVA 1GWLA 1PNGA 3FLPA 2YV8A 5KXBA 5FR3A 1QF3A 2HEVF 3SH5A 4WM7A 3U10A 1PIV2 2YC2A 4NPRA 2ZJCA 1JU3A 1LGBA 5K0UC 2NMOA 5L7OB 3AP7A 2YFUA 1HRI2 1R091 4R8HA 2G1MA 3T1MA 1AF9A 2WNVB 3U1XA 5K7PA 4FOWA 3SH3A 3WQ0A 4OLLA 5HXMA 1IPSA 3KHBA 1WBFA 1YJLA 2ZAAA 3AL5A 3VHPA 2RMU3 2DURA 2NYYA 3LEIA 3ZPOA 2WFPA 4XJAA 2JDPA 4IV3A 2XJTA 1OC1A 1IG0A 2VULA 4OMCA 5IVJA 1HB2A 4Q4X2 4RQPC 4AR2A 1VBA1 4MGZE 1UYYA 2TEPA 5C5UA 2WWUA 4CYDA 5JMOA 1VB2A 3UGHA 5FZAA 5C8WA 1MS3A 1HN0A 4KBZA 4QXHA 5HV0A 3NAPC 4XTMA 4XFGA 3RG0A 4XABA 3N4MA 2VUAA 1OLME 1JYWA 5F37A 2E32A 5CYYA 5LA9A 3HN1A 5FIXA 2RVAA 2B7YA 2ZHMA 3ZKUA 1AR91 4QKFA 2BU9A 3UYJA 3MIBA 5FYMA 3T09A 3AMQA 3IIAA 4AOCA 1DZQA 3OD0A 4GWJA 4PDWA 2BERA 1CJPA 2ZEZA 3CJIB 3KM5A 3VBUC 2XKPA 4M3CE 3HEIA 1AR72 1DU3D 4EWDA 2D6NA 3O1RA 4IEWA 4EZ4A 1VPHA 4A7ZA 4R9AA 4Y24A 3ZYGA 4LJHA 2HWF2 3PUAA 4YW3A 2D43A 1D0GA 3ZSJA 5DG1A 1Y43B 3EBRA 2VNRA 1A8MA 2ARXA 3Q8CA 2Y34A 3K4AA 4SBVA 1F8VA 2AENA 3O5SA 4BYYA 2RDRA 2BOJA 2HBUA 3KS7A 2FDKA 2WA3A 4AW7A 1W28A 2GZWA 1MS4A 4FPEA 2P6CA 3INAA 4IGOA 2YUEA 1JTZX 3VKOA 2V4VA 2PHLA 4N43C 1OI6A 1JHJA 1W6MB 3J8F2 1Z7S3 1OOPC 3E6DA 4U2AA 4ET7A 1F35A 1WCDJ 3RZMA 1ZRDA 3MO4A 4GH4C 5LASA 3HBZA 3DYOA 3WCRA 2YPJA 3GJAA 4Z2WA 1JZ4A 5JXJA 2AC1A 2ZKLA 4G4FA 1NQDA 4NUBA 2WSUA 4I02A 3UK9A 5CU1A 1HRI1 4JC1A 4F83A 4Q29A 1UMIA 2P3KA 4GA9A 4BDVB 1Y9GA 2Y38A 1EY2A 4K20A 5FO8B 1S0DA 1XOYA 4DQAA 2AYHA 3FHQA 5DAPA 1VAVA 5C3SA 4F3JA 3THPA 1R1A3 3DUIA 5IVYA 2IXCA 5JOXA 1ST8A 1V0AA 4N90A 2Y6LA 4XF9A 5T5LA 1XE8A 4LKSA 5J3UA 3WY6A 1CVNA 2D6KA 1MVQA 2HWD2 4HK8A 1H30A 1RUH3 2MHFA 3KCXA 2QQPA 1JYNA 4WBBA 4CCJA 1LOGA 1CWPA 1MQTA 3HVDA 1JZ7A 4LO5B 1CESA 1CX4A 3LB9A 4QKNA 4M3CF 1CAWA 2LS6A 4XFFA 3AXEA 3ETPA 4MO3M 2ZGKA 2XOMA 4LXLA 3KQ4B 1CAVA 2FDIA 4OZOA 4QPIA 1SBFA 1YUDA 1L7QA 1ENRA 1HX6A 4OMDA 5IUQA 1HRV3 3I3BA 4NJ4A 3I2GA 4QB6A 2W3JA 3MIGA 5CFDA 1LODA 1KJRA 5LBCA 1EYBA 3F2ZA 1TQ5A 3S5AA 5A7PA 1W0PA 1S4CA 3VDDC 1WMFA 4QAWA 4GAZA 2FHRA 1IS5A 2HWF1 3UJOA 4CEWA 1RUF3 1DQ1A 3CLPA 4FBFA 1RYYA 1QJX2 2P2KA 3ZXJA 1SHWB 4QX5A 3C7FA 3WDWA 4JGZA 5K0UB 2IVJA 1POV0 1QQP2 2YC4A 5FXXA 1HXS2 1RUE3 4JQTA 2EICA 1VBB2 2MEV1 3ZFGA 4AG4A 1AL0G 2CTVA 2P34A 3HQXA 3Q9OA 3RWKX 5JOWA 3DYPA 4V2VA 4YWAA 1FPN2 3FUQA 1ND2A 3USUA 3W58A 4JCKA 3GNEA 4CZSA 1CPNA 2A6YA 1RUG1 4PT6A 1F2NA 2PHTA 2Q8CA 2VZSA 4UI9L 2VD7A 2FD8A 4AGGA 1WMEA 5D8AB 1WZXA 2VXJA 4NRQA 5FYHA 2WFF2 3S7EA 4CCOA 4D8MA 5A32A 4QGLA 2VM9A 3NVCA 3WP5A 4OZXA 4EROA 2YG0A 3OBRA 3CL1A 1KXGA 4ZY9A 3RFRA 2ADEA 2P4EA 4MOAA 3I3MA 3H1YA 5DPNA 3HD8B 5KXDA 3MV11 1SBDA 3RJRA 1OA2A 2BFUL 1C1FA 2Q0AA 5FZEA 1DLLA 4M0HA 2VW0A 5IATA 4KGQA 2W9XA 1T6BX 4D6RA 4CP1A 5I0RA 3ACFA 4N9HA 5GLVA 1IS6A 1SLBA 4CCNA 2ZOEB 3W20A 4JDNA 3VBUB 4V1PA 4AXOA 2HWD1 1W9FA 3P3NA 4XFCA 4L11A 1RHI2 1MR5A 3MGUA 1MQTB 3HIFA 2PHWA 3MF9A 2PQQA 1NCRA 4GJYA 3RZKA 4AE2A 2CAUA 5IHRA 3JBG1 1F5FA 1AYN3 3OUIA 1CAWB 1OFSA 4LK7A 4NMIA 1RMU1 4GZ9A 4OYUA 1UIKA 2V4AA 3ZOIA 2ZZJA 4BPZA 1SLAA 4XILA 1CAVB 1ZBE2 1WW6A 4E9KA 2IXKA 3ACLA 2UU8A 1W2AX 4XTPA 4CUGA 3ZFFC 2WNEA 4UAPA 5LBBA 2OYZA 4FPHA 1DDLA 1EV13 4GWMA 3CQOA 1V9U3 2W46A 4W8JA 3WOGA 5HBAA 5L9VA 1QJEA 3N9QA 1TZOA 5JUVA 2XLGA 4R9BA 3WXPA 4GH4B 5CFCC 3POGA 2ZKNA 4W6XA 5FZFA 5FZ8A 3B93A 3OTFA 3WQ1A 3SEEA 5ABJC 4BMEA 4NN0A 4WVWA 1PVC3 4JGZB 4LOTA 5A3OA 1QQP1 3AKPA 4DXRA 2VUCA 5AFBA 5IVEA 1REDA 3G7DA 4P08A 2VL4A 4Q26A 3NJVA 1VBB1 3A0NA 3WLUA 3KWVA 2DCZA 4BIOA 2I74A 4I3GA 2XXZA 4J1WA 1FPN1 3KQRA 4R4ZA 1YXWA 1GP6A 5J96B 1O8PA 1ND2B 4MXVA 3USUB 2G9ZA 1VBD2 3W59A 4BE3A 1LOFC 1R082 2RM23 2RMU1 2XQXA 3R4SA 2Q8EA 4Q27A 3SH4A 5GZCA 2D3SA 3ZO0B 3UL2A 3WF4A 4B4RA 3VDCA 3I3DA 2JDYA 1ZZ7A 3W9AA 2BNNA 2IC1A 1SG3A 3AVSA 4MLOA 4LKFA 1X9PA 2UYBA 1VB4A 4NHMA 5AFEA 2HWB3 3KD4A 2W68A 3V64A 2ZGQA 3V65A 2QQIA 4S2GA 3PMEA 4YGCA 4XHBA 5A3WA 2VNVA 2XJVA 3WD5A 4AGVA 1XYOA 1MS5A 4KWUA 4AI3A 4CDWC 3TRSB 1COV3 1XPWA 1OSGA 4XDPA 2OQ6A 3ILNA 3ORJA 3S6PA 1QNWA 4MGTA 5T54A 1K5JA 3MFCA 4WVMB 2K0GA 2X10A 1OVSA 3HN3A 1C4RA 3NNMA 5F3GA 5IK8A 5FXWA 4CCMA 4I0BA 1S0EA 4JGYC 1APNA 2D97A 1RUC2 4A45A 4CE8A 1RHI1 3IAQA 3NV2A 1HDKA 3VDDB 1UY0A 4YLZA 1ULPA 3BYWA 4CUCA 3ZXKA 1CZVA 2H0VA 3VL9A 3OB8A 1WW5A 1XE0A 1PO12 3U37A 5JZGA 3VD9A 3T4VA 2OPWA 3QH6A 4AQ2A 4OI4A 4BQXA 1RUI3 4LR4A 1FXZA 5DUXA 3S57A 1ZBE1 1Q8OA 4JHTA 4NWVA 4BIFA 3PIJA 3KT1A 2HWC2 2OZJA 1RUE2 4RYDA 3VLBB 4R52A 2OXBA 4GULA 3RYRA 4W6YA 4CCLA 1ULGA 3D4KA 3PUSA 1TNRA 1UU4A 5FK7A 3OGSA 4A42A 2Z4FA 5C5TA 1F4HA 1H6XA 1QJY2 1W8WA 1JN2P 1REEA 3RZHA 2D98A 4CEYA 2W2IA 1X8EA 2DBNA 2LALA 4IGQA 1NG0A 1F31A 1U5IA 4HETA 5T50A 3FHAA 3WCSA 2GMMA 3MICA 3FBYA 2WO7A 1EPZA 1H2LA 4NE9A 5APAA 1PO23 1W6QB 3LKJA 4KH9A 5IAVA 1SFNA 3WW4A 5A33A 1NAEA 5KWRA 1X50A 1DQ5A 4HSLA 3KVAA 5FQ0A 2RR13 1J1TA 1OH4A 4K40A 5FZCA 5FP4A 3M3IA 5DZFA 3TAYA 3AMHA 1Y7BA 3ZIXA 4GWNA 1O4YA 1DYPA 3CHXA 3I7DA 4LBNA 2KA3A 4WVVA 4RS5C 2XWJB 3WHUA 1ZZBA 2VG9A 5LW9A 1RB8G 2ZHKA 1UY4A 2XVLA 2ZX3A 2C0ZA 3VBSA 4CDXA 1PM7A 1KS5A 5FAXA 3VBOA 1V00A 2P17A 3EB7A 2ORXA 2RS32 2W92A 2OX0A 3ST7A 3I49A 5ERLA 1ZNPA 2W1SA 1IQDC 3N9LA 5ISLA 1BMV2 5DAWA 2ZGLA 4NO4A 2XHNA 5FXVA 1TEIA 3GZTB 1XRUA 4QPGA 4CCEA 2Z2SB 5BNOC 1QU0A 1YCIA 1MEC2 1GUIA 3GF6A 4E2SA 5C3OA 4MYEA 4IE7A 4IEUA 1C8M2 1HRV1 5A7WA 3POIA 3W5MA 5FYSA 4RR3C 4LMFA 3I54A 2C1FA 5ABJB 1HJGA 2XL9A 3PMSA 1PO11 2HYXA 3K3NA 3VL8A 5JZGB 1D0HA 1TMF2 1VAMA 4NHLA 2VCCA 4QQHA 3U4SA 5IAXA 1VR3A 3MPPG 4XJWA 5FV3A 4YW7A 4W4ZA 3ACIA 4LPLA 5C33A 4B3NA 2HWC1 1B35A 2ERFA 3AKSA 3NW4A 4RHV2 2VGDA 4XFHA 1G9FA 5CKQA 1RUE1 1LECA 2VZUA 4K7JA 4IESA 1NX9A 1D4M3 2EXJA 4FTSA 3L2YA 4HN1A 4N7IA 5FRAA 1BHGA 2ZGNA 1AX0A 1QGLA 2NPIA 4R4XA 4YVWA 1UKRA 4Z07A 1SLTA 3AZWA 1JMUB 2VQUA 1DQ6A 1OHFA 2XUMA 5FWEA 3BKZA 2QE3A 3QH7A 3POEA 1VBC2 3WR0A 4JRLA 3U0ZA 1AYM3 3KSCA 1VJ2A 3OGJA 1UZZA 2C24A 1Q8PA 5E8AA 1E5IA 1W2UA 5FLJA 3WSOA 3BGAA 3AXDA 1RGSA 1LEDA 5EFUA 3H3UA 2J1EA 2Z69A 2EXIA 3LIGA 4QDQA 5CNAA 4Q4Y2 4XYXA 4K21A 4RSUA 2QQOA 2CY6A 1V70A 4MXWB 1I3HA 3CKHA 4ES9A 3HJRA 4YG0A 1IPJA 4TXWA 2HWE3 1BBT3 4JGYB 5FK8A 2JG9A 2DTWA 2JIGA 5IWFA 4CDXB 1DHKB 2YBKA 2D6LX 4UFHA 1AX1A 2VMGA 5FMCA 4GIQA 3VBOB 3VBSB 3VZKA 5JI7A 3KF3A 1GKBA 1ZM1A 4GD4A 4N53C 2RS31 4Y5TA 5FLIA 5K4LA 4BQ1A 1XNTA 2B9VA 2VQAA 1Y3TA 3UGFA 1RINA 4AEMA 2CYFA 4D7SA 4CRQA 3S30A 4Q0VA 4Y33A 2LUWA 2GNDA 4KG8A 3VKLA 5FMOS 4LHSA 2ET1A 3KV4A 4XF3A 3NL1A 1PK6A 3VBHA 3O0VA 5K9YA 2VBBA 1OF4A 3FLTA 3KLSA 1JI6A 4QPGB 3MZHA 1QXJA 2B8MA 2XMLA 4IQPA 2R042 2WKKA 3AFGA 5K8SA 3KB5A 5BNNC 3CZUA 2XWBB 2AZ5A 1H9PA 4LE3A 4R9CA 4YM2A 1MEC1 4G3YC 1SCRA 5A6XA 3JZVA 2Y0OA 4GB33 1CR7A 1EV11 4AFMA 1JW6A 3MLKA 4A7YA 1V9U1 1DGLA 3RI8A 3THCA 3WNMA 3D5OA 1UF2C 1OA4A 2LRPA 5JIAA 2VU9A 3K2OA 2R1BA 1E5SA 2IXLA 5FPVA 5CVRA 1LHWA 2BWAA 4AEJA 2ZMKA 4OI2A 1NZCA 5HCFA 1Y9QA 2JXAA 4UFIA 4XCAA 4AVTA 4E4DX 4AQ6A 1X7NA 4M4RA 5DMYA 1PVC1 1UY2A 1QJU3 1E5RA 1JZ3A 2JECA 3POJA 5CBLA 4FPOB 2BDRA 2WS93 5FY4A 4FFHA 1O4TA 4BU2A 4NPMA 2F6BA 2W0XA 3OJBA 3W21A 3C7GA 5IYYA 5FY9A 1LCLA 3ES1A 2AGSA 4LLFA 1NCQC 4C0BA 2ETEA 4XF4A 4Q4W3 3M7AA 2E7TA 3K75B 4XURA 3RI9A 1QOTA 3MV01 5HI0A 2CGOA 5EJZB 2D7FA 2RM21 3Q8BA 3TEZA 2AACA 4COYA 3I2HA 2ZGMA 4EE2A 4RS5B 1W0NA 4D69A 3WF0A 2D3PA 5L7OA 2VOVA 1VBC1 1ULOA 5FY5A 4CPBA 1R092 4LIVA 5JAXA 4IE5A 2Y33A 5L36A 4JZRA 5E6HA 1RITA 4XF1A 3TOJA 1FT9A 4MZUA 4XIKA 3CMGA 5T5PA 2HWB1 1N3QA 3PTYA 1REFA 1SBEA 2WAAA 2WL1A 5J36A 3JD73 3WX5A 1CJDA 1H8TC 2ADDA 2WNUA 3D0SA 4XPVA 3OSDA 4PHZA 4MGQA 1COV1 4J1XA 5FOJB 3M3OA 3WNNA 5LWBA 2QZ2A 1W6OA 5CKNA 2WT0A 2GMPA 2XUEA 4Q0QA 4URAA 1XU2A 1KD7A 4CDQA 3LOIA 3ATGA 3VHOA 2VTXJ 5EZWA 2GH2A 5JOYA 1WWYA 3C2UA 4BHPA 2E53A 3MUZ1 1ZRRA 5EJ1B 5DZGA 1OD5A 3NV4A 3SISA 1PK6B 2K46A 1UKGA 1U12A 3HOBA 1HQNA 1D2SA 4XBLA 1RUI1 2D6PA 3RMYA 1YFYA 3WUDA 4BCUA 1JZ8A 1W8NA 1R1ZA 2NZ9A 4COZA 4EN0A 3WG3A 4IETA 4L99A 3NRUA 1E57A 2VMDA 3POBA 4K8RB 3G6JB 3MIFA 2YHJA 2ZMLA 4O61A 2JWPA 3VZMA 4CCCA 4CP0A 4D0QA 2AREA 4XAAA 3WG2A 4AHYA 3GM8A 1JZ2A 2JG8C 1J3RA 3PVEA 4I0AA 5CZKA 3H50A 3GZEA 1GQHA 2J1UA 3L2HA 1RUD3 1JYXA 4FPJA 2OQ7A 3AMNA 1GZ9A 5LBFA 1AR63 1KFUL 2O8OA 1H4HA 1NUKA 2JDAA 3M2MA 3A0KA 1UZYA 5IFPA 2VXRA 4Q0SA 5H9SA 1S2EA 4DXSA 2VMEA 1HV1A 3UNPA 1PO21 1WD4A 4QDRA 4CVUA 1YFUA 1LNSA 2ZBJA 3PJQA 2VVEA 3SQOA 5C3RA 3ZYFA 3RZLA 1AL22 2IFWA 2R1DA 3IM0A 4XE9A 5F32A 5T5OA 3TNPB 3UJQA 5GZGA 5L73A 2JDKA 4ZS3A 5LEJA 2RR11 3MLJA 5EIYB 3URFA 2IVIB 3VBRC 3VV1A 4AVSA 2PFWA 2ET7A 2WYSA 4L0PA 4TZDA 4XW3A 4G9SB 4PDWC 5AVAA 5ACA3 4N53B 2YY1A 3WW1A 4DY5A 1DGWA 1FOD3 2GP5A 1RVF3 3I59B 4UXAA 1O3SA 4C8DA 3RQ0A 2HYKA 5LA0A 2FZ2A 1PMJX 2VZTA 4QPWA 3VGIA 5J09A 1ODNA 2WNUB 2V72A 4AI0A 1OURA 4O7XA 1JOBA 1O6UA 1DQ0A 1Q43A 3KV5A 4LITA 2WT2A 5DQ0A 4FPKA 5JVVA 3JU9A 1W6OB 5FZHA 4ZHNA 2PAMA 5A3LA 4BQ5A 3GBWA 3ZXLA 5C6CA 4ITCA 3P1IA 4HANA 3NNFA 1ZBA3 2WZR3 3ZN6A 3IAPA 4CDQB 5C9AC 3CDZB 1VRH3 2YU2A 2YXSA 4UFKA 3B5LB 3MW3A 2ZX4A 2XHKA 4RFRB 1BZWA 1M4WA 3BI3A 5EPAA 2DCKA 5BUVA 1QIQA 3VDBA 2GC2A 2RS53 2Y6GA 3M70A 3WNXA 4AQSA 4XETA 4DRRA 5FREA 5C3QA 3ZR6A 2W52A 2EIGA 3ZFEA 4PF5A 1CGPA 5LEKA 2ZMNA 2EIEA 4PLMA 3CNAA 4BISA 2XLFA 3T4HB 1ONAA 2GDFA 4FCAA 4IE0A 5SV5A 2I07B 4EZHA 3GZAA 4UT5A 2N7GA 4V2WA 3RVHA 3SMHA 2WUHA 4B4PA 4FPGA 1JOPA 5A1FA 4ARYA 1AJOA 1JYTA 5IVFA 1DQ4A 1FMD3 3NWKA 1CIYA 1FATA 4IEVA 2W5FA 3UKNA 5E16A 5K0UA 1NXMA 1V6NA 2ZCWA 4JX0A 4NR1A 4O9GA 4UF0B 4BK4A 1FYUA 1JU4A 2QCSB 2YBPA 4XQ4A 5AVPA 4D3WA 4XEZA 1WD3A 4QDSA 4X8NA 2MEV2 2R0FA 1BEV2 5DDJ3 4CXYA 2ARBA 4A44A 2J1TA 2VW2A 3EO6A 1RUJ3 5FOBB 1AR83 3GGLA 3QACA 5KHHA 2XR4A 4A3XA 3M3EA 4KWJA 3PIGA 3SNMA 1QKQA 1YYNA 3I97A 1SFPA 3BALA 1RUG2 1ZVFA 1OQDA 3MI8A 4QQLA 1JODA 1AL21 2X09A 3B69A 4WV8A 4RQPA 4XBQA 5D8AA 5F2SA 2ID4A 3Q8EA 3R4DB 4I3PA 5EYXA 5A7OA 4FQ4A 5FCCA 4FXGB 5FZOA 4XFAA 1W05A 4ZU4A 4NIGA 4QPIC 4ZZ8A 1UQXA 1W9SA 5FPZA 1U5XA 2E33A 2R16A 1GP5A 1QOOA 2HWE1 3PURA 3TN93 2UYAA 4DEVA 2Q4SA 3HT2A 2O8QA 3LSDA 3Q8AA 5DN2A 1MS8A 4HVQA 1WW4A 2DWRA 2PLV2 3ZXGA 1BKZA 2B46X 3IKWA 1UOJA 1X33A 2XB6C 2WO1A 4H14A 1QMJA 2DCJA 1NT0A 2P3IA 5G04L 4AF9A 3ELNA 2OUHA 4O9EA 5J98B 5H9PA 2VMHA 4WM8C 4XOGA 5A7SA 3VBUA 4L92A 5IJRA 1YJKA 2PAKA 2Q1FA 1DLCA 2WQ8A 3S0MA 4CUBA 3FL7A 4YG3A 2G19A 5F6LB 4K3UA 2Y60A 3B02A 4KWKA 3H1WA 3MBWA 3ZN6B 4DEQA 1J3PA 1OF3A 1L7RA 4E2GA 3E1F1 3JBG2 5FZKA 1SLIA 1CIWA 3MIDA 1GMMA 4GB31 1JUHA 1LU1A 5CIRA 2JG8B 1RMU2 1FAYA 4S2FA 1DYKA 1W8TA 2KD7A 5SV8A 4AFAA 4E2QA 3AKQA 3EHKA 4PLNA 2D44A 4QD2A 2WYFA 4MGKE 3WW3A 2IXIA 2ZACA 3DKQA 5HXVA 3UESA 3GJBA 1PHMA 3ZFEB 3NKTA 3DCQA 4P9GA 4Q4V2 4DIQA 4AVBA 1VAKA 4JKMA 2C4XA 1QJU1 2R063 4N43A 1AR62 2WAOA 1UN1A 2VH9A 3APBA 2WS91 1OOPA 1UOGA 2VECA 3GXUA 3ZSKA 3ACGA 1Z78A 2WQ4A 2RS13 4GH4A 3MIEA 4LHNA 5FPXA 2FMYA 5JXGA 3CBNA 1HB1A 1ZZ8A 4NHXA 5A3UA 5CEHA 3KCYA 5CG9A 3K77A 3SITA 3V0BB 2CWMA 4B4QA 2BQPA 4FP2A 1LOCA 4YM3A 3OOXA 3V0AA 1W8FA 1SPPA 1BEV1 2JDUA 2NM1A 5KHKA 2B5HA 4UW5A 5FYYA 4YFZA 2XQRA 4LQRA 1CD3G 3AYAA 3LQCA 4QQOA 1I9RA 4META 3RSJA 3RDIA 1UPSA 4EYUA 2WIIB 1AUYA 4AK3A 4HZFA 3UGGA 2RMU2 1CAXB 2WT1A 1OPMA 2VVFA 5LATA 3FFZA 3JB4C 3NJYA 4RQPB 3O7OA 1HQWA 4LTAA 1HLCA 3PTRB 4BJ0A 3IDCB 3ASIA 5FZOB 1E5HA 5A6QA 1W04A 5AC93 3FMGA 1EAH3 1PMHX 1GOHA 1LEMA 3NAPB 2OVUA 4A41A 2DYCA 5A7QA 4C1WA 5BV6A 3CEWA 5L9RA 4NVPA 1GNHA 2DUOA 3WDVA 1A78A 2PLV1 1VMJA 2W87A 3L9JT 3RYPA 4XJ8A 3WP6A 2CHHA 1D4VB 5LA2A 1DGRN 3ZPYA 3LEKA 4LBMA 4WVMA 3DXTA 2OKXA 2YGMA 1Q8SA 1LAJA 2UY8A 2BBAA 4GKXA 1S2BA 4QX0A 5LK5A 2VQTA 3MIHA 5BYNA 4D94A 3DKWA 4DFSA 5JXHA 1QH7A 3PJYA 4UBHA 3MF6A 2VBPA 3A7QA 5DG2A 4XZPA 3R4UA 4XUOA 4ASLA 1K5MC 3A4UA 5FKBA 3O1SA 2XPJA 4BM8A 3VDDA 1UD1A 4FPFA 3AC0A 4U36A 1FI2A 2VNGA 1UYZA 2RDSA 5DUWA 2DUPA 3UKVA 4FFFA 1JS9A 1GWKA 1C3HA 1IKQA 2YGLA 3VBFC 1GNYA 1YNAA 5GM0A 5F8PA 3M8LA 2YC0A 4COVA 1H6YA 4YGEA 1MPXA 3JQWA 3T2QA 4AI8A 3NSTA 3D8CA 2GNBA 1H1IA 5FZ6A 3IN9A 1LGNA 1HV0A 1KDMA 1RUD1 1O5LA 1I5ZA 2PHXA 4Q4V1 4CUAA 1W06A 1LKNA 3LA3A 4N43B 1AR61 2JIJA 4CXWA 1OOPB 4PIZA 5FUPA 1GP4A 4OI0A 2VMFA 3NMBA 2YU1A 1KJLA 3OF1A 3LA2A 1ASJ3 2AH2A 1AJKA 4XUQA 1GR3A 4OUMA 1Z7S2 1G8WA 4J25A 1AVBA 3DPRC 3C7EA 2QFEA 4LKDA 2GC1A 3USSA 4QHOA 2A70A 1UMZA 3GHNA 1WBLA 1H2NA 2WNOA 1CN1A 3V0AB 3R6SA 4E4SA 1SPPB 5FZ0A 5KXEA 4BB3A 3JUUA 4DO0A 1FNZA 4FT8A 1VMHA 4P9JA 2VAUA 4OQ8A 1W6QA 2BGPA 2D5HA 4NIHA 4LHKA 4UBGA 5BNPC 1RVF1 3ZYBA 2CGPA 4P9YA 5FYBA 4E27A 3RRDA 5J48A 4LA2A 4ATEA 1SDDB 1AXKA 1R1A2 1RUOA 2IXHA 1N1YA 3BOWA 1N1VA 1N3OA 1NZIA 1LOEA 2VY0A 2R49A 3LGRA 4OQ9A 3EJKA 4RGKA 2PHRA 3SKJE 4AGRA 4UOJA 3FZ3A 3M3CA 1LU2A 1UW8A 3N9NA 4W65A 4AQTA 4H55A 1BJQA 1RUH2 2XBO3 4RGGA 5JPMB 2WSVA 2P5BA 1GICA 4YNIA 1SMVA 3D0JA 3IWZA 4AI2A 1SLCA 1SZBA 2ZGRA 2WZR1 3O1OA 4P9WA 5GLWA 1UYXA 1VRH1 4FAGA 1POQA 1R64A 5TSWA 4D6SA 3PLQA 2VZRA 3AM2A 3LFMA 3PL0A 1FX5A 4LBJA 4BZ4A 1XE7A 5C7GA 1G9CA 3KZ4C 5LK7B 5FZLA 4CPBD 1WLCA 3ZFFA 3N3HA 3R05A 3B94A 4GALA 2WN3A 1C5IA 4Q5OA 4R9DA 4WVZA 5FMDA 4CEYC 1OLRA 3OG2A 2LM3A 4XMAA 4OHYA 2X8KA 3HT1A 1W2TA 2BV4A 1HRV2 2BP6A 4Z92B 4XQDA 5CFCA 4KI5M 2IXJA 1EPWA 1S0IA 4ORFA 2JICA 3J7NA 5ABJA 1HKDA 1NY71 1RUF2 1FMD1 1DG6A 5LRSA 2FDFA 3GALA 3ABZA 2JDHA 5FYTA 2BPA2 2X29A 3BVCA 5J37A 4AFBA 1ZRIA 4QU1A 5D21A 1AHSA 2F4LA 3P5BA 2UY9A 2PN5A 1V6KA 4XQWA 1W39A 5I8TA 1OFNA 1WLDA 4L2NA 3WEZA 1LOFA 1RUJ1 2DVGA 2C5DA 3NJXA 1AR81 4C1XA 1J84A 4FPCA 2G9GA 4IE6A 4C0HA 4LULA 1TME3 4CDUC 1Z7S1 4OULA 3CJXA 2FDGA 1N3PA 2X5IC 4RD7A 4MHUA 1OLQA 4DXZA 2CSGA 2Z79A 1YI9A 3HQRA 1GU3A 5FMBA 4AEDC 4QQ2A 4UW6A 5F5AA 2RDQA 4LHLA 2ZEYA 3PU8A 4NROA 1ND3C 5EP9A 1G9BA 3I3EA 1YFXA 5EQUA 2EVXA 2F4PA 1DGRA 3HQUA 2JD4A 5FO7B 1H8VA 4XIOA 5JMCA 1VIWB 2V09A 3POWA 4LBQB 4FPYA 1VBE3 2VPVA 4IL7A 4CDWA 4NWWA 3ZX7A 3ZMNA 1WGPA 2VOWA 2CNAA 5DZEA 1HJFA 3SEPA 3KCCA 2WA4A 1C57A 2FMDA 3T30A 3FBMA 4MXWA 3RYKA 1R1A1 3I2OA 4DS0A 2VQ0A 3ROUA 3X29B 5EYYA 4E4ZA 3PNAA 4AVAA 1NA1C 4JGYA 4EV0A 1D2QA 2C9KA 3WHTA 1VE0A 2WZEA 4GKYA 1LR5A 1RUH1 4IEZA 1B35C 3AJZA 5A3NA 5GLUA 2BEOA 4X6RB 4EWAA 5C8CC 4S2DA 3VBFB 4HBNA 1QJFA 2A6VA 1W6NB 2YZ4A 1HQLA 2DDUA 1WMDA 3CU7A 5JIUA 1UZWA 4J6GA 1AYN2 5H9RA 4YZ5A 1GZTA 4QQPA 3E6CC 1YHFA 4FP3A 3EQEA 3ZFFB 2VTXA 1N1TA 2QQKA 4JAAA 2P3JA 4TTGA 1A34A 1GYKA 3TEWA 4OI1A 1MZ5A 5GLZA 5GZDA 2G4IA 4EN9B 4GMP3 5M0TA 2C26A 3POSA 3CF6E 1CZSA 2IZWA 1DGWX 4QT6A 1EV12 1C28A 5FYVA 4EN8B 1YFWA 5FWJA 1V9U2 3ZN4A 5CFCB 3NKGA 3M1HA 2R32A 4LNVA 1Q56A 5CAZA 1BVVA 1PX3A 3C8XA 4XZUG 2RS11 2OW4A 4A6OA 4KL1A 1RUF1 1MS0A 2D93A 1DCSA 1VBA3 1BVP1 4YW5A 5C4WC 3T0AA 3VD7A 1PVC2 1UCXA 4L97A 3NV1A 4XUNA 4Y5Z0 4P5YA 2QVSB 3ZSEA 5KR7A 1JXNA 1RC6A 2ZTNA 3OY8A 4ARXA 2Y64A 1ULCA 4BXSV 5BNPB 2BRTA 4YW6A 3U78A 3BOPA 1OKOA 2JE8A 1KFXL 4IV1C 1KGYA 1TG7A 1IQAA 3I8TA 1AR93 1XNAA 2DCTA 4MHRA 1HN1A 3H8UA 1GOFA 2ES3A 3UETA 1GOGA 5C3PA 2CV6A 2RM22 4LBKA 4AFCA 4RS5A 4Q0UA 4FPLA 1LHOA 1NLQA 2PAEA 1QH6A 4KG0A 5BNQA 5JLVA 3QCWA 5CKMA 5KBFA 5AC91 1UXZA 3IDAA 2HWB2 5KXCA 2Q1MA 4CDWB 4KWLA 5GALA 3B00A 5FZ3A 2QQMA 3T08A 2WLQA 3O1PA 4JV4A 2PXJA 1M06G 4DB5A 4RN5A 1COV2 2PELA 4NHKA 1A6CA 2ARAA 1X9TA 4NIAA 3LEMA 4CCDA 4AAPA 2VOKA 3CO2A 4YVSC 5I0SA 1OQEA 1CPMA 2VUDA 3LEGA 3ITQA 4TSVA 4IDZA 4E8DA 3BPSA 4KGGA 1OUSA 2R073 4RR3A 4ZPIA 2VZ1A 2WBKA 3BCWA 4A4AA 1W8ZA 3D3AA 4QPYA 3WVJA 1O3QA 2A1XA 5FYZA 1G9AA 3ZDSA 3FHIB 4S2HA 1UOFA 1OUXA 1UX7A 3ZXEA 1MACA 1OPOA 4YW4A 4HPKA 4C91A 1PIV3 1AYN1 2PTMA 2YROA 3IPVA 4PIYA 1SDWA 3ZSLA 5A3PA 3H8XA 1GFF2 2XJQA 3NNJA 4M0NA 1UIJA 1RUI2 1FV2A 1MVEA 3R0RA 2J22A 1HRI3 2J7MA 4NPLA 4YSFA 2E9QA 1Y9MA 1O7FA 1JH5A 2GNTA 2RHPA 3AKTA 5IW0A 1LHNA 2YPDA 3WF1A 1PVXA 3ES4A 2VJXA 2WNVC 3I2KA 4LIUA 2YB7A 1KDKA 4XUTA 1IS3A 2X5IB 4QB2A 4Y1XA 4FFIA 1JHNA 5FKCA 3JB8A 4JDMA 3ON7A 4AEDB 1ASJ1 4CP2A 4Q4X3 4FTEA 2X05A 1ND3B 2HKXA 2V5DA 3IDBB 5E1RA 3AP4A 4YM1A 1XXNA 3VZJA 3GBGA 1G86A 4E8CA 3HPNA 4D6QA 4PQQA 4KU7A 1Q3EA 2XKOA 5I0UA 3OY8B 4YG6A 1VALA 3LZZA 3LSEA 3DF0A 3F95A 4JHZA 2ZHNA 4M3CB 1ODMA 4XVHA 1PO22 1W90A 3RZZA 5EV7A 2W1UA 1S0BA 2BZDA 2E51A 2D6MA 2Y6FA 4IEPA 3SXWA 4TN7A 3IZOA 4XJUA 3SCHA 3ZVXA 4BQ3A 3VD3A 4OFGA 3H8RA 3JCIA 2RR12 2E7QA 4QM8A 3B9CA 4Y4RA 3M4FA 4WZFA 1OMIA 4P14A 3U07A 1US2A 3KV9A 1O3RA 2FDJA 4N53A 1AR73 4H7MA 5I0TA 1UU5A 3DEMA 3I59A 3CJIC 5F2WA 1CQ9A 2DU1A 3ZYRA 2XBO1 4QU2A 2BGCA 2HWF3 4ASMB 1YI7A 3OYWA 4QHBA 3FFQA 2IUWA 2HH9A 3TWIA 5HPOA 5FBZA 1D7PM 2DBIA 1O3TA 4ZU7A 3TB0A 3IT8A 5BNOB 1G9DA 3JQXA 2XDVA 1JZ5A 4UFMA 2A73B 3ILFA 5F3EA 2VC9A 2IWGB 4QMAA 3PVNA 5A6ZA 4CU7A 3K3OA 5DABA 1PZ7A 5FP9A 1IOAA 4JQRA 5LY1A 1H1AA 2CWSA 2GNMA 4AAXA 4RR3B 3H7JA
chains in the Genus database with same CATH topology
3J8F3 1J59A 3TNQA 3AMPA 1IGOA 1ENSA 2ZABA 3UV9A 1ENQA 1YRZA 3VZNA 5H9QA 4HPKB 2EXHA 3VUOA 4Q0PA 5C4WB 3IPVB 2GMEA 2EAAA 2G9FA 2DVAA 4ONUA 4WM7C 2BNMA 4L8QA 1LHVA 4DPNA 3AB0A 4KQ7A 4W6WA 4RGAA 3O0XA 1PZ8A 1DZRA 4IV1B 2WJSA 2FBEA 1NCQA 1OQ1A 4Y1VA 1D4M2 4F8AA 4MSVA 1XQNA 1F9KA 3J4UH 4LBLA 1MZFA 5JSPA 1TME1 1WCKA 1TE1B 2HWD3 4IV3C 4PCRA 3AZVA 2NMNA 4ZU5A 4BA6A 4HK9A 4Y1ZA 4HKLA 4MH0E 4OUSA 3VKMA 5JSOA 1AYM2 2GH8A 4Q2FA 4YW1A 2Q1ZB 3HAGA 4URTA 2XJRA 2XJPA 1WLTA 1VBE1 4D7YA 3SCFA 2ZAHA 3VZOA 2ZGUA 4IEYA 1OA3A 3WDTA 4YVSB 1PNFA 1QWRA 4XMIA 3WP3A 2HWE2 1BBT2 2CL2A 4PIXA 2WZPP 5CB7A 2TBVA 1ENXA 5FMOL 1ALYA 2EALA 2R0HA 4EN7B 3OYWB 1A8DA 1QJX3 2AUYA 4MGYE 3AKRA 2DU0A 4F7ZA 1QQP3 1GLHA 1UPIA 1HXS3 3ZIWA 1YIPA 3RMXA 2ENRA 1VBB3 5BNNB 5KC5A 1X82A 3FC0A 3FWEA 2WLPA 4LBQD 4Y26A 4WZCA 5EXOA 1FPN3 4DRVA 1GANA 3WG4A 2SBAA 4GMP1 2QNKA 1N1SA 4AHWA 5FTTC 4GB32 1PGL1 2JG8A 4AYUA 2WFF3 2EAKA 4I0WB 1GV9A 4BMBA 2ZPXA 2ZGTA 5D8AC 3ECQA 4IEQA 1QXPA 4FTBA 3D6EA 1YIFA 4TYSA 4K9SA 2Q8OA 1KITA 4HMZA 1QJU2 1MS1A 1JYCA 3AZZA 4Z1VA 1DQ2A 2WS92 1X8MA 1DF0A 1DZTA 3WDYA 1NCQB 3O14A 2XJSA 1D4M1 2Z42A 1XNKA 1J58A 1MS9A 3KGLA 1QDCA 4FOQA 1ZZCA 4YYOA 2BFUS 4K1YA 4PBOA 4Q4W2 3VBRA 2JDZA 5KC6A 3V0BA 2AR6A 3BU7A 4RL7A 2H6BA 2BUKA 3BB6A 3EXUA 3U11A 4PJYA 1RHI3 1GSLA 2D3RA 1SEFA 4YGBA 1AYM1 2LTNA 3SHRA 1RL3A 5LRRA 1MQTC 3C3VA 4DZGA 3GYDA 1ULDA 1H8TB 4GXLA 3RPQA 1CAXA 1SACA 2CGNA 3HMYA 3RNSA 2VUJA 2FQPA 4P9XA 4ZXKA 4EN6B 1ZBE3 5GKAC 3JD72 3ME2A 4XJ9A 3MEPA 1AZDA 1UX6A 1WA4A 3E5XA 3H7YA 2VVDA 5C9AA 3T1LA 1EP0A 1BBT1 4UW4A 1YO8A 3NAPA 1NOVA 3RS6A 1GZCA 2EXKA 3MDPA 1YLLA 2R071 4FVVA 4RFT0 5CFDC 4XF0A 1ZX5A 1W6PB 4FO9A 3WP4A 1MZEA 1LOAA 1LJ7A 1LOBA 4CEWC 1O4ZA 3ZYJB 4WM7B 4N9IA 1F5JA 1PIV1 3QOPA 3PVOA 4JGZC 1S0CA 3NO8A 2JKBA 4FAHA 3ZFGC 4RA0A 2PHUA 2NLRA 1VBD3 4FXKB 1R083 4MX3A 4COWA 2PYTA 1ND2C 4LO7A 2H0BA 4IV3B 1BCXA 2A3YA 1XNDA 4HL0A 2GALA 4LO6B 1KRIA 2RE9A 4Q4X1 2BW8A 1RUD2 1DIWA 4DOUA 2BBVA 4P9LA 5D1IA 2WC2A 4FSJA 3OCPA 2DUQA 3AYEA 1IHMA 2UWBA 2ZA9A 4B8EA 3WDXA 2DTYA 4OHXA 3VBRB 4Q4W1 4ZKTB 4XJZA 3UKTA 1PZ9A 5FFOC 1XU1A 4FQZA 4QM9A 4XHXA 4PDWB 4Z82A 1RUC3 4JVAA 5ACA2 5IK7A 1ZRCA 1AR71 2SLIA 1FOD2 1RVF2 4DNYA 3WZ1A 1H9WA 1PO13 4HFSA 1NCRC 3AP9A 1URXA 4WM8A 1CAUA 4HVOA 3TBDA 5FDBA 3JD71 5L19A 4LE4A 1PGSA 2A6XA 2HWC3 4XXPA 3WW2A 2W08A 2K9ZA 4XDQA 5C9AB 2E63A 3MFAA 1BXHA 1QY4A 4AEKA 2XVGA 5GJ6A 1ZBA2 2WZR2 3AP5A 3N7KA 4INDA 1QJY3 2KM2A 3WG1A 1NLSA 1VRH2 4XFBA 3LOBA 4TLFA 1FNYA 2A3XA 3J8F1 4B7KA 3THTA 2JE9A 2RS52 3I4IA 2BNOA 5JCTA 5GZEA 3ZMOA 1QOSA 1JOJA 4N7UA 4DY3A 2DCYA 1VP6A 3OD4A 4K8FA 1UAIA 2A75A 5GZFA 1NY72 3B01A 4K1ZA 3TYJA 3BPZA 2QDRA 2XJUA 3IDEA 1BQPA 2I2SA 1FMD2 1XYNA 1GZWA 3MPBA 3BTAA 4BWOA 2A5ZA 2ZS6B 2IFRA 2DVBA 4QGNA 3N35A 4Y20A 1ZREA 3VZLA 4I2OA 2RS33 5DDJ2 1GQGA 5JWPA 1UL9A 2B39A 1QJZA 3I2DA 1CONA 1POV3 1RUJ2 1AR82 4YM0A 1G6NA 2P37A 3K51A 2BWCA 2PA7A 4D7TA 2WINB 3LA7A 1FV3A 2DVFA 4QPIB 2A6WA 4LLOA 3RWNA 3MW4A 1OKQA 1MEC3 2XL7A 2XH6A 1C8M3 5T52A 4M00A 3QD6A 3KT4A 3TN92 4YARA 3OBTA 5ACA1 4LBQA 5CFDB 5JPNB 2ZGOA 4SLIA 1FOD1 3NJZA 1HW5A 5I8SA 5T3NA 2C9AA 3KGZA 3AZXA 2MNGA 3OPZA 2BTVC 1TMF3 2D5FA 4CEWB 3O0WA 4LO4B 4XBNA 4WM8B 1CAUB 2UWCA 1QJX1 5JZGC 3PVBB 5FLHA 3LAGA 5E88A 2YMZA 5BPXA 4RHV3 4XXAA 1LHUA 5I8YA 1K5MA 2B9UA 4KBBA 1HXS1 4IEXA 1S0JA 4ISRA 3N7JA 2GN7A 5JR7B 3ZFGB 2K2SA 1W0OA 5DUVA 4OHVA 1NQJA 1Z0HA 3VBFA 1ZBA1 3WQ7A 2WQZC 1W6NA 4EWEA 3DL3A 2NN8A 5BXXA 5F9TA 5E89A 3BIWE 2JE7A 5KHJA 2PHFA 1AXYA 2DVDA 1MZ6A 2RS51 1VBC3 2DFCA 4Y1UA 2R30A 2WFF1 2O0OA 3H1MA 4I30A 5A32B 2H6CA 4DINB 2GSYA 4P9IA 1LTEA 2FZ1A 1L3JA 1SLLA 2E6VA 4Q8LA 4AVCA 3QLQA 2R062 2ZX1A 1AX2A 4Q4Y3 4MGIE 5EWSA 1IPKA 4AI1A 3DPRA 3U4XA 1LULA 2RS12 4COUA 1V6OA 2OIIA 1C8NA 1GZWB 4M01A 4HLTA 4L9BA 1BK1A 3AZYA 5JI9A 1U5ZA 3N7MA 4KNCA 2V73A 4Y20B 4YGDA 4YW2A 3DV8A 4YZ3A 5DDJ1 5BNPA 1C1LA 4CDXC 3VBSC 3VBOC 1NCRB 2Y0IA 4AHXA 1XNBA 4Z8BA 2GAUA 5JSRA 4BH9A 1GBGA 4GMP0 3QBQA 4DMIA 5FO9B 4AHZA 1ZZ6A 4LA3A 2R043 4PQ9A 1Q5OA 1S2KA 2GC0A 4QPGC 5BY5A 4LEJA 5AC92 1PGW2 4HT1T 3MYXA 1EAH2 3TN91 1C5HA 1G7YA 2BVVA 3NV3A 4A7KA 4HKWA 4Y1YA 2KXLA 2OUJA 3PHMA 3AJYA 4HSJA 3IMNA 3S7IA 1K5MB 3K48A 5EJ3A 5IK4A 4A2UA 1PMIA 3AYCA 5HCAA 3WINE 2GU9A 1DFQA 1XYPA 2W39A 1IZ3A 1LB2A 4JTOA 1VBD1 2GN3A 3AP6A 1R081 1NE6A 2BYVE 3AK0A 3GZUC 4OHWA 4FOVA 3SCGA 4YVWC 2XG3A 1R093 5GLTA 2X53S 4K6BA 4AFDA 3ZXFA 3FX3A 5DUUA 5T5JA 3SLIA 3IBMA 5T55A 2R061 2JX9A 2V5YA 1ULEA 4CDUA 4OVEA 3H0OA 2X5IA 3DPRB 3VKFC 1J1LA 3ZYPA 4AEDA 1ASJ2 3E6BA 1ND3A 2OZ6A 1WLWA 4LUKA 3B3QE 1QDOA 4HVRA 3FJSA 2VOXA 1LESA 3RJ2X 5F6KA 2XVKA 4CRQA 1RUC1 2HEWF 2JG9C 3FUOA 2VMIA 1ZZ9A 4X8PA 4M3CA 2ZGSA 5JOZA 2QJVA 3H3ZA 3ENRA 2JJ6A 4JTNA 1ZYBA 2ATFA 1V6JA 3E5UA 1NA1A 5B2GB 4BLIA 1WCSA 1PK6C 1SCSA 1RUNA 3VBHC 1B09A 2HEYF 4P5HA 1U5YA 4BLJA 3KT7A 4H7LA 4Q1PA 1PGW1 5C8CA 1ZA4A 2QUOA 2XBO2 1EAH1 1O91A 1H2KA 4B29A 3FE5A 4LBOA 4XFIA 1QJY1 4EJRA 1RJ7A 2I45A 1U0AA 3B7MA 5BNOA 4CEYB 1Q8QA 4YRDA 4QXKA 1H2MA 1SFYA 2E7AA 1HIXA 5J7MA 2B42B 2JENA 1X36A 1Q8VA 2RJKA 2A71A 4TWTA 2OA2A 5CADA 5HCBA 1GNZA 3ZXDA 1V6LA 1S0FA 4HN0A 4UW3A 2DV9A 5A33B 4AWDA 2NP0A 1AL23 2UWAA 3DN7A 5FQ0B 5C4WA 2QDNA 4Q8KA 1UU6A 3ALQA 4QGMA 4MVTA 1RJ8A 2ZHLA 3M3QA 1T6GC 3AFKA 3FLRA 5L7OC 3WT3A 4IV1A 1SQ4A 3MW2A 2XLAA 3GHMA 5IT6A 1H4GA 2TUNA 4CDUB 1H1MA 2A7AA 1POV1 4Y22A 3VHRA 1BMV1 3HR9A 1TME2 5DXDA 2WNUC 2QZ3A 1JYIA 2D40A 5F5QA 2ZX2A 5A3MA 3J9SA 1O5UA 3P3PA 1NXD1 1S1AA 2QKDA 3ETQA 1C8M1 2BVBA 1NE4A 3H9AA 4CDQC 3ZSMA 5I91A 1VBE2 4Y4YA 1NYWA 2Q5TA 1IS4A 4I01A 4B7EA 1TMF1 1J3QA 1IKPA 1NA1B 4ATFA 4YVSA 4MUVA 2VW1A 3POYA 4YZ2A 5F1RA 1NLRA 3E5QA 1B35B 2EA7A 4RHV1 4LUMA 1N47A 5C8CB 3GBFA 1ULFA 4KU8A 4PBPA 4IXLA 1KQRA 2YYOA 3T2TA 2OPKA 1S0GA 4YVWB 2GC3A 3E97A 4GQ7A 1KS4A 2MEV3 5BNNA 1I1EA 1BEV3 2EF6A 3O12A 4YFWA 1LGCA 1TNFA 5JDBA 2ZZQA 1S55A 1QNYA 4JDOA 2WNVA 2Y26A 4JRAA 3HWJA 1RUG3 1YWKA 2DFBA 3AX4A 1PGL2 2NQYA 3WUCA 1QXRA 4Q4Y1 4IERA 4YZ1A 3BODA 1XNCA 2ZGPA 4MV2A 2B45X 4FOYA 4IEOA 3OGGA 4OHZA 4CTEA 1H0BA 4ISQA 3ZN5A 4C90A 4X6QB 1VBA2 2WWSA 3N7LA 1DBNA 1QHDA 1RIRA 2YDEA 2JG9B 3N36A 2A6ZA 3B9IA 2VNOA 1WW7A 4YZ4A 2PHDA 2PLV3 4PLOA 5CA6A 5KHGA 2Z5WA 3LCPA 2MPFA 1LENA 1A3KA 4ES8A 5CG8A 2D6OX 2TNFA 4H3WA 4Y22B 4LO8A 1AR92 1LRHA 1ZRFA 2XGXA 3VBHB 3VKNA 3AMMA 3ILRA 1RTVA 4NOTA 5I93A 3ZXAC 4LT5A 2DF7A 2JEMA 2ZX0A 4YFZA 5KHKA 3KMHA 2O1QA 1I6XA 2ILMA 1VLNA 2R041 3CJIA 4Q1RA 3LWCA 3WDUA 1AXZA 1JUIA 3JBG3 4BOWA 1BYHA 1RMU3 1H8TA 2UURA 2RJLA 4HKOA 1JBCA 3MLLA 3AYDA 2CAVA 3WV6A 3V56A 5KHIA 2Q30A 3D82A 4Q4V3 2A3WA 3ZYIB 3DGTA 2R6QA 2HJIA 3VN4A 3ZFEC 3J26N 5IK5A 2R072 4I09A 1W6MA 1WUVA 1V6MA 3VHNA 1W6PA 1V6IA 4AVVA 1PNGA 3FLPA 2YV8A 5KXBA 1QF3A 2HEVF 3SH5A 4WM7A 3U10A 1PIV2 4NPRA 2ZJCA 1LGBA 5K0UC 2NMOA 5L7OB 3AP7A 1HRI2 1R091 4R8HA 3T1MA 5K7PA 1AF9A 2WNVB 4FOWA 3SH3A 3WQ0A 4OLLA 1WBFA 1YJLA 2ZAAA 3VHPA 2RMU3 2DURA 2NYYA 2WFPA 4XJAA 4IV3A 2XJTA 2VULA 4Q4X2 4RQPC 1VBA1 4MGZE 2TEPA 4CYDA 1VB2A 5C8WA 1MS3A 3NAPC 4XTMA 4XFGA 3RG0A 3N4MA 2VUAA 3S0MA 3HN1A 2B7YA 2ZHMA 1AR91 3MIBA 3AMQA 3IIAA 1DZQA 3OD0A 4PDWA 1CJPA 3CJIB 3KM5A 3VBUC 2XKPA 4M3CE 1AR72 1DU3D 4EWDA 2D6NA 4IEWA 4A7ZA 4R9AA 4Y24A 3ZYGA 2HWF2 4YW3A 2D43A 1D0GA 3ZSJA 5DG1A 1Y43B 3EBRA 2VNRA 1A8MA 2ARXA 4SBVA 1F8VA 2AENA 3O5SA 4BYYA 3KS7A 2WA3A 4AW7A 2GZWA 1MS4A 4FPEA 3INAA 2YUEA 1JTZX 3VKOA 2PHLA 4N43C 1OI6A 1W6MB 3J8F2 1Z7S3 1OOPC 3E6DA 4U2AA 1WCDJ 1ZRDA 4GH4C 3HBZA 3WCRA 2YPJA 4Z2WA 2ZKLA 4G4FA 1NQDA 2WSUA 4I02A 3UK9A 5CU1A 1HRI1 4JC1A 4F83A 4Q29A 2P3KA 4GA9A 2Y38A 1EY2A 4K20A 5FO8B 1S0DA 4DQAA 2AYHA 1VAVA 4F3JA 3THPA 1R1A3 3DUIA 5JOXA 2IXCA 4N90A 4XF9A 5T5LA 1XE8A 5J3UA 3WY6A 1CVNA 2D6KA 1MVQA 2HWD2 4HK8A 1H30A 1RUH3 2MHFA 3KCXA 2QQPA 4WBBA 1LOGA 1MQTA 4LO5B 1CESA 1CX4A 3LB9A 4M3CF 1CAWA 4XFFA 3AXEA 2ZGKA 1CAVA 4QPIA 1SBFA 1YUDA 1ENRA 1HX6A 5IUQA 1HRV3 3MIGA 5CFDA 1LODA 1KJRA 1EYBA 1TQ5A 1W0PA 3VDDC 1WMFA 2FHRA 1IS5A 2HWF1 3UJOA 4CEWA 1RUF3 1DQ1A 3CLPA 4FBFA 1QJX2 2P2KA 3ZXJA 4QX5A 3WDWA 5K0UB 4JGZA 1POV0 1QQP2 1HXS2 1RUE3 1VBB2 2MEV1 3ZFGA 4AG4A 1AL0G 2CTVA 2P34A 3HQXA 3Q9OA 5JOWA 1FPN2 3FUQA 1ND2A 3USUA 3W58A 4JCKA 3GNEA 4CZSA 1CPNA 2A6YA 1RUG1 1F2NA 2PHTA 4AGGA 1WMEA 5D8AB 3S7EA 2WFF2 5A32A 4QGLA 3NVCA 3WP5A 4OZXA 4EROA 3OBRA 3CL1A 1KXGA 3H1YA 3HD8B 5KXDA 3RJRA 1SBDA 1OA2A 2BFUL 1C1FA 2Q0AA 1DLLA 4M0HA 2VW0A 4KGQA 5I0RA 4CP1A 4N9HA 5GLVA 1IS6A 1SLBA 2ZOEB 4JDNA 3VBUB 4V1PA 4AXOA 2HWD1 3P3NA 4XFCA 4L11A 1RHI2 1MR5A 3MGUA 1MQTB 3HIFA 2PHWA 3MF9A 2PQQA 1NCRA 4AE2A 2CAUA 3JBG1 1F5FA 1AYN3 1CAWB 1OFSA 1RMU1 1UIKA 2ZZJA 4BPZA 1SLAA 4XILA 1CAVB 1ZBE2 1WW6A 4E9KA 2IXKA 3ACLA 2UU8A 4XTPA 3ZFFC 2WNEA 2OYZA 4FPHA 1DDLA 1EV13 4GWMA 1V9U3 3WOGA 5HBAA 2XLGA 4R9BA 3WXPA 4GH4B 5CFCC 2ZKNA 4W6XA 3B93A 3OTFA 3WQ1A 5ABJC 4BMEA 4NN0A 4WVWA 1PVC3 4JGZB 1QQP1 3AKPA 5AFBA 1REDA 3G7DA 4Q26A 1VBB1 3A0NA 3WLUA 2DCZA 4BIOA 2I74A 4I3GA 4J1WA 1FPN1 3KQRA 4R4ZA 1YXWA 5J96B 1ND2B 4MXVA 3USUB 1VBD2 3W59A 4BE3A 1LOFC 1R082 2RM23 2RMU1 3R4SA 3SH4A 4Q27A 5GZCA 2D3SA 3ZO0B 3UL2A 4B4RA 1ZZ7A 3W9AA 2BNNA 2IC1A 4MLOA 2UYBA 1VB4A 4NHMA 5AFEA 2HWB3 3KD4A 2W68A 3V64A 2ZGQA 3V65A 4S2GA 3PMEA 4YGCA 4XHBA 2XJVA 3WD5A 4AGVA 1XYOA 1MS5A 4AI3A 4CDWC 3TRSB 1COV3 1OSGA 3ILNA 3S6PA 1QNWA 5T54A 3MFCA 4WVMB 2K0GA 1C4RA 5IK8A 4I0BA 1S0EA 4JGYC 1APNA 2D97A 1RUC2 1RHI1 3NV2A 1HDKA 3VDDB 4YLZA 3ZXKA 3VL9A 2H0VA 1WW5A 5JZGA 1PO12 3QH6A 4AQ2A 4OI4A 1RUI3 4LR4A 1FXZA 5DUXA 1ZBE1 1Q8OA 4BIFA 4NWVA 3KT1A 2HWC2 2OZJA 1RUE2 3VLBB 4R52A 4GULA 3RYRA 4W6YA 1ULGA 3D4KA 1TNRA 1UU4A 1QJY2 1JN2P 1REEA 2D98A 4CEYA 1X8EA 2LALA 1NG0A 1F31A 1U5IA 4HETA 5T50A 3WCSA 2GMMA 3MICA 3FBYA 1EPZA 1H2LA 1PO23 1W6QB 3LKJA 4KH9A 3WW4A 1SFNA 5A33A 5KWRA 1X50A 1DQ5A 4HSLA 5FQ0A 2RR13 1J1TA 4K40A 3M3IA 5DZFA 3TAYA 3AMHA 1Y7BA 3ZIXA 4GWNA 1O4YA 1DYPA 3I7DA 4LBNA 2KA3A 4WVVA 4RS5C 2XWJB 3WHUA 1ZZBA 2VG9A 1RB8G 2ZHKA 2ZX3A 2XVLA 4CDXA 2C0ZA 3VBSA 1PM7A 1KS5A 5FAXA 3VBOA 1V00A 2P17A 2RS32 3ST7A 1ZNPA 1BMV2 2ZGLA 4NO4A 1TEIA 3GZTB 1XRUA 4QPGA 2Z2SB 5BNOC 1QU0A 1YCIA 1MEC2 3GF6A 4E2SA 4MYEA 4IEUA 1C8M2 1HRV1 4RR3C 3I54A 2C1FA 5ABJB 2XL9A 3PMSA 3VL8A 1PO11 5JZGB 1D0HA 1TMF2 1VAMA 4NHLA 4QQHA 1VR3A 3MPPG 4XJWA 5C33A 4B3NA 2HWC1 1B35A 2ERFA 3AKSA 3NW4A 4RHV2 2VGDA 4XFHA 1G9FA 1RUE1 1LECA 4K7JA 4IESA 1D4M3 2EXJA 4FTSA 3L2YA 4HN1A 4N7IA 5FRAA 2ZGNA 1AX0A 1QGLA 2NPIA 4R4XA 4YVWA 1UKRA 4Z07A 1SLTA 3AZWA 2XUMA 1DQ6A 1OHFA 2QE3A 3QH7A 1VBC2 3WR0A 4JRLA 3U0ZA 1AYM3 3KSCA 1VJ2A 3OGJA 1UZZA 1Q8PA 5E8AA 5FLJA 1W2UA 3AXDA 1RGSA 1LEDA 5EFUA 3H3UA 2Z69A 2EXIA 5CNAA 4Q4Y2 4XYXA 4K21A 4RSUA 2CY6A 1V70A 4MXWB 1I3HA 4ES9A 4YG0A 1IPJA 2HWE3 1BBT3 4JGYB 2JG9A 2DTWA 4CDXB 1DHKB 2D6LX 3VBSB 1AX1A 2VMGA 3VBOB 4GIQA 3VZKA 5JI7A 1GKBA 1ZM1A 4BQ1A 4N53C 2RS31 5FLIA 2VQAA 1Y3TA 1RINA 4AEMA 2CYFA 4D7SA 3S30A 4Q0VA 3VKLA 2LUWA 2GNDA 4KG8A 5FMOS 2ET1A 4XF3A 3NL1A 1PK6A 3VBHA 3O0VA 5K9YA 3FLTA 3KLSA 4QPGB 3MZHA 1QXJA 2B8MA 4IQPA 2R042 2WKKA 3AFGA 5K8SA 3KB5A 5BNNC 2XWBB 2AZ5A 1H9PA 4LE3A 4R9CA 4YM2A 1MEC1 4G3YC 1SCRA 3JZVA 2Y0OA 4GB33 1CR7A 1EV11 4AFMA 1JW6A 3MLKA 4A7YA 1V9U1 1DGLA 3RI8A 3D5OA 1UF2C 1OA4A 5JIAA 2VU9A 2R1BA 2IXLA 5CVRA 1LHWA 2BWAA 4AEJA 2ZMKA 4OI2A 1NZCA 5HCFA 1Y9QA 2JXAA 4AVTA 4E4DX 4AQ6A 1X7NA 1PVC1 1QJU3 2JECA 5CBLA 4FPOB 2WS93 1O4TA 2F6BA 2W0XA 3OJBA 1LCLA 3ES1A 2AGSA 4LLFA 1NCQC 4C0BA 2ETEA 4XF4A 4Q4W3 3M7AA 2E7TA 3RI9A 5HI0A 1QOTA 2CGOA 2D7FA 2RM21 4COYA 2ZGMA 4RS5B 4D69A 5L7OA 2D3PA 2VOVA 1VBC1 5JAXA 1R092 5L36A 1RITA 4XF1A 3TOJA 1FT9A 4MZUA 4XIKA 5T5PA 2HWB1 1N3QA 3PTYA 1REFA 1SBEA 2WL1A 5J36A 3JD73 3WX5A 1CJDA 1H8TC 2WNUA 3D0SA 4XPVA 1COV1 4J1XA 5FOJB 3M3OA 2QZ2A 1W6OA 2WT0A 2GMPA 4Q0QA 1XU2A 1KD7A 4CDQA 3LOIA 3ATGA 3VHOA 5EZWA 2GH2A 5JOYA 3C2UA 4BHPA 2E53A 1ZRRA 5DZGA 1OD5A 3NV4A 3SISA 1PK6B 1UKGA 1U12A 1HQNA 1D2SA 4XBLA 1RUI1 2D6PA 3RMYA 1YFYA 3WUDA 4BCUA 1R1ZA 2NZ9A 4COZA 4EN0A 3WG3A 4IETA 4L99A 1E57A 3G6JB 3MIFA 2YHJA 2ZMLA 3VZMA 4CP0A 2AREA 3WG2A 4AHYA 2JG8C 1J3RA 3PVEA 4I0AA 3H50A 1GQHA 3L2HA 1RUD3 4FPJA 3AMNA 1GZ9A 1AR63 1KFUL 2O8OA 1H4HA 3M2MA 3A0KA 1UZYA 2VXRA 4Q0SA 5H9SA 1HV1A 1PO21 1WD4A 1YFUA 2ZBJA 3PJQA 2VVEA 1AL22 2IFWA 2R1DA 3IM0A 4XE9A 5T5OA 3TNPB 5GZGA 3UJQA 5LEJA 5L73A 2RR11 3MLJA 3URFA 3VBRC 3VV1A 4AVSA 2PFWA 2ET7A 4TZDA 4XW3A 4G9SB 4PDWC 5AVAA 5ACA3 4N53B 2YY1A 3WW1A 4DY5A 1DGWA 1FOD3 3I59B 1RVF3 4UXAA 1O3SA 3RQ0A 2HYKA 2FZ2A 3VGIA 5J09A 2WNUB 4AI0A 1Q43A 1DQ0A 2WT2A 4FPKA 5JVVA 3JU9A 1W6OB 2PAMA 5A3LA 3GBWA 3ZXLA 5C6CA 4ITCA 4HANA 1ZBA3 2WZR3 3ZN6A 4CDQB 5C9AC 1VRH3 2YXSA 3B5LB 3MW3A 2ZX4A 2XHKA 1BZWA 1M4WA 2DCKA 5BUVA 2GC2A 2RS53 3M70A 3WNXA 4AQSA 4XETA 4DRRA 5FREA 2W52A 2EIGA 3ZFEA 4PF5A 1CGPA 5LEKA 2ZMNA 4PLMA 3CNAA 2XLFA 1ONAA 2GDFA 4FCAA 5SV5A 2I07B 3GZAA 3SMHA 2N7GA 4B4PA 4FPGA 1AJOA 1DQ4A 1FMD3 3NWKA 1FATA 4IEVA 3UKNA 5E16A 5K0UA 1NXMA 1V6NA 2ZCWA 4NR1A 4O9GA 1FYUA 2QCSB 5AVPA 4XQ4A 4D3WA 4XEZA 1WD3A 4X8NA 2MEV2 2R0FA 1BEV2 5DDJ3 2ARBA 2VW2A 3EO6A 1RUJ3 5FOBB 1AR83 3QACA 5KHHA 4A3XA 3M3EA 4KWJA 3SNMA 1QKQA 1YYNA 3BALA 1RUG2 1ZVFA 1