2RE9A

Crystal structure of tl1a at 2.1 a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
164
Chain Sequence
LRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1 A.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2re9A01
4MXVA 3K48A 4DB5A 5L19A 1U5ZA 4NN0A 1PK6B 1JH5A 4MSVA 4TSVA 3MI8A 4QQ2A 3B93A 2AZ5A 1JTZX 2R6QA 3TWIA 3WD5A 4EN0A 4OUSA 2WNVC 3QBQA 1U5XA 5KC6A 4QPYA 4OUMA 4KGQA 4MXWB 2JG8C 3L9JT 3LKJA 4G3YC 2RJKA 2WNVA 4KG8A 3ME2A 4KGGA 1ALYA 1O91A 1RJ7A 1S55A 4QQPA 4QQOA 2E7AA 2JG8A 2X29A 2O0OA 2Q8OA 2JG9B 3K51A 3IT8A 4N90A 4TWTA 4DOUA 1DU3D 4E4SA 4QQLA 2WNUB 1A8MA 1PK6C 5HBAA 1D4VB 1RJ8A 2QE3A 1GR3A 1C3HA 2ZJCA 5BNQA 2RJLA 4J6GA 3FC0A 1IQAA 4G4FA 2Q1MA 2TNFA 2WNUC 1TNRA 1U5YA 3TYJA 1PK6A 4D7YA 5TSWA 1I9RA 2HEYF 3URFA 3ALQA 1XU2A 2R30A 1KXGA 2R32A 5CIRA 2Z5WA 2HEWF 2QDNA 3B94A 1OQDA 1WCKA 4GIQA 4HT1T 4MXWA 1D2QA 1OQEA 4E4DX 2JG9C 4OULA 4QQHA 2KA3A 1D0GA 2WNVB 1C28A 4F3JA 1TNFA 1OSGA 1DG6A 2RE9A 3V56A 2JG8B 3AB0A 2JG9A 1KD7A 2OIIA 5L36A 2TUNA 2ZPXA 5KWRA 5KC5A 3QD6A 4RSUA 2WNUA 2HEVF 3B9IA 1XU1A
chains in the Genus database with same CATH superfamily
1ENRA 4AHZA 4HMZA 5FZIA 3BIEA 3A23A 5JSRA 5C71A 4YGCA 2R063 3H9AA 1OKOA 3BUCA 1J58A 1PZ7A 2BWAA 5EJ3A 1PIV2 1XB9A 2I07B 1BHGA 4L0PA 3WXPA 4C1WA 4UWDA 5FFOC 1TMF2 1LEMA 4P9JA 4XYXA 3ETPA 4UBGA 4D8MA 4C91A 3B69A 3JXSA 5FDBA 1LOEA 4BMEA 2E7QA 2Q1ZB 3T1LA 1KJLA 1JTZX 3KZ4C 3U0ZA 3ILNA 3FL7A 4S2FA 5FZFA 1W99A 1VR3A 3NW4A 3PVNA 1K45A 2Y64A 1OVSA 1WW4A 3R4DB 4IEPA 3LZZA 2QQPA 4CCJA 1COV2 3HNBM 5FPLA 5FYMA 4SBVA 1OKQA 3O1OA 4LOTA 1YC61 1OH3A 5L9RA 1BZWA 2VBPA 3PVOA 4B4RA 1WD4A 3AP7A 4KGQA 5CKQA 5L73A 4AR2A 4BXFA 2ZGOA 2R16A 1GYKA 3WLUA 1QH6A 3IN9A 1LGCA 4CEYB 5A3MA 2WO1A 2W52A 1H8TB 1ALYA 3SHRA 1NYWA 1UWWA 3DPRC 2BTVC 3NJYA 4IW3A 2W1SA 3T3YA 3ACFA 2VZRA 3FZ3A 4HANA 1ZBA3 4Y22B 2JG9B 2XUMA 3K3OA 5JXGA 2JWPA 3POJA 2QUOA 4COWA 3DV8A 2OQ7A 1ENSA 5HCBA 3AZXA 4AQ2A 3RJ2X 2UWBA 2PQQA 5IVJA 1NA1A 1YNAA 3WQ0A 4A6SA 1ULDA 5ABJC 2G19A 3KLSA 5CG8A 3RZKA 3FFQA 4XILA 5FZOB 3POYA 1SHWB 1W2NA 4RA0A 4XXAA 1UMZA 4LA3A 5BUVA 4QX0A 1UN1A 5LRRA 4AVSA 3OGSA 3WQ7A 3TEXA 3KCCA 1QDOA 3G7DA 3ZFGB 1DZTA 4TYSA 5FKBA 1DQ4A 5FYIA 2D7FA 4X8PA 1HJFA 3DECA 4LK6A 4P02B 4YG0A 1J84A 3B00A 3RYRA 3ZR6A 5BY5A 5DMYA 3I49A 1ZRCA 3GHNA 1UF2C 3JU9A 4AHXA 2Z5WA 3E97A 2NYYA 4YZ4A 2WZ8A 4QPIC 2JDKA 1GP5A 2QQJA 2Q8EA 1SLTA 2GN3A 4A3XA 1FV2A 1W9SA 1ZA7A 1GLHA 3PHMA 3BPZA 1RXGA 3T4VA 3H8XA 5J37A 4ET7A 5I0DA 4HT1T 2W87A 1D2QA 1DYPA 1H6YA 2IZWA 5DQ0A 5T5OA 1C57A 1SPPA 1W05A 4FT8A 4YFWA 5D8AA 1E5RA 5FY5A 1PM4A 4QB2A 1V6MA 2A5ZA 5DABA 2E26A 4JCKA 5DAQA 2Z4FA 3AFGA 4YVWA 5A32B 4RS5A 3R0RA 4K7JA 4BQ4A 4CXYA 1EY2A 1SQ4A 3VKNA 4BE3A 5KWRA 1VMJA 2ZGMA 1IKQA 3I2JA 4P00B 3VDAA 3ZYIB 1CIYA 1SFYA 2AUYA 3LDRA 4MGZE 4FPLA 3S0MA 4PI0A 1X33A 1NY72 1QQP2 3DPRB 4HOOA 3N4MA 4UFJA 3PVBB 4M3CE 4W6XA 2ERFA 1O4YA 1RUG3 1CPMA 4ZKTB 3WQ1A 4K40A 1V00A 3AP4A 3OPTA 4IETA 1DQ1A 1NA1C 1FX5A 2XPJA 3LQCA 4F3JA 1PO22 4Q0QA 2BPA2 1GNZA 2AZ5A 3K77A 2WFF1 1LOFA 3QOPA 5DDJ2 2RDQA 4Q29A 1W8WA 1H1MA 2JDNA 4UXAA 1DGRN 4FPJA 4TTGA 4L9BA 3WD5A 2GNMA 4GH4A 3FUQA 3IDCB 5FIXA 1JZ7A 5I0UA 1WMDA 2R7EB 4GA9A 1R1A1 4HKWA 2XBO2 1VBE1 1CJPA 1A3KA 4RGGA 1XOYA 5HV4A 1LULA 1TE1B 1VALA 1W8UA 1GZ9A 4QXHA 3ZXAC 5KR7A 3VDBA 1G8WA 2CL2A 3H7JA 3WR0A 4TZDA 3VZOA 2VOTA 1AX1A 1VBA2 2JECA 3POWA 4LO8A 4QPIB 1RUH1 2VM9A 4UFLA 5DZGA 2WAAA 3D4KA 2LM3A 1RJ7A 2ATFA 2D97A 4XOGA 1GQGA 2Q8CA 2CDPA 2R1BA 2HWB2 3THDA 5SV8A 5CADA 2ZKLA 1JZ5A 2Q8DA 4NUBA 4ORFA 1PO13 2R062 5FY4A 5FZ4A 4A7YA 3PNAA 3J7HA 5A33A 3WNXA 2FCTA 4WM8A 4P08A 4QU2A 2JXAA 4DZGA 1RHI1 3P5BA 4H7LA 1Q3EA 1R091 5EYYA 1JYCA 3I4IA 3OPZA 3BU7A 2ZACA 2ZX0A 4QMAA 5AC93 3M2MA 3M1HA 4IV3A 5FYSA 1CJDA 1RB8G 1MZ6A 1NE6A 3J7NA 1IHMA 2NQYA 1Z7S3 4DRVA 1QIQA 5FY0A 3POGA 3WVJA 1LGNA 3BVCA 4QX2A 3MIHA 2XG3A 4Y1YA 2W5FA 2XVKA 4E4HA 1CONA 1ZM1A 2WO3A 2ZCWA 4QDQA 4QXBA 3UYJA 1SCSA 1W06A 4JGYB 4ZXEA 3LEGA 5B4NA 2D6MA 1AYM1 4BYYA 2PLV3 2ZX4A 1DQ5A 3O1UA 3I2OA 2OPWA 1V6IA 2P17A 4K8FA 4YG3A 2OUJA 1RUF3 2A6VA 2IFWA 2JB8A 2WO7A 2VTFA 4EN9B 4Q4V1 1POV1 2RMU1 4R52A 5C7GA 3ZMNA 1YRZA 5K7PA 5K8SA 1WCDJ 1ZBA2 3PLQA 3ZYBA 5C3SA 4LTAA 4LBNA 2DBIA 2Z42A 5A7NA 2X5IC 4BJ0A 3OGVA 3GZTB 4META 4ATEA 2ARCA 3ENRA 2OVUA 3RSJA 2E33A 1ULPA 3MGUA 2WUHA 4CTEA 5T54A 3DKQA 4Y33A 4CP1A 2ZGSA 5JPNB 1HRV3 1R083 3CZJA 1QJX3 4D3WA 1RUJ1 5LEKA 1HW5A 3C7EA 2RS13 3H3UA 5FZCA 3ZYFA 2WFPA 2IXCA 4LKDA 4D6SA 1G9CA 4UOJA 2WNEA 1JOPA 4UW6A 3WHTA 3BGAA 4MH0E 1W8NA 4OI1A 3MV11 1OA4A 2V09A 1I1EA 3PUQA 2Z69A 4HONA 1WMEA 2FDKA 2ZX3A 5F39A 3RYPA 1FYUA 4XABA 3FBMA 3MEPA 2BRTA 3IMMA 4GULA 4FXKB 4Y4RA 3IZOA 2DF7A 2DUQA 3D82A 3LPGA 2A6WA 4AK3A 4XFFA 3BTYA 2R073 3RZGA 5A6XA 5EV7A 2EIGA 4NIHA 1QJEA 3VKOA 4AE2A 4HPKB 3N35A 4P5YA 2WYFA 1YJKA 2CGOA 3OG2A 3O1RA 1W9YA 5FXVA 5F6LB 3ES1A 4PQQA 5K0UC 1RUC3 1ZZBA 1WLCA 4LBQA 4Q4W3 2GMMA 2EVXA 3L9JT 4AW7A 2P5BA 3APBA 2VQAA 2D3RA 1L7RA 1PGW2 4DXTA 1YXWA 4MADA 4DRRA 4COZA 2DTWA 4KG8A 1UMHA 2W1QA 2PQSA 3U4XA 1VBD3 1VAKA 1S55A 1VP6A 1UYXA 4R9CA 3AKQA 4I3PA 1M4WA 2JE7A 3AMPA 4YSFA 3WT3A 5FYBA 2P4EA 4LO4B 2WZR1 1I5PA 1AX0A 1EAH1 3USUA 1JI6A 2WAOA 1D2SA 3PU8A 1LECA 2VMCA 3AKPA 4GB33 4Y26A 5FP7A 2W1UA 4HVOA 3TEYA 1OC1A 1RUG2 2MEV1 5A7OA 4FAGA 2X5IB 5JZGA 2AEZA 4H3WA 3AK0A 5DAVA 4RYDA 4XZUG 1XPWA 1BMV1 1UNBA 2HWD3 2PA7A 4QX3A 4G4FA 1FNZA 1OPMA 2TNFA 4K3UA 5KXBA 1RMU1 3R6SA 1UPSA 4XFHA 3RMYA 1PK6A 2DVDA 5J7MA 1J3QA 3D8CA 4JQRA 1XXNA 2GNBA 1W2OA 3U37A 1LENA 2P37A 1G9FA 3N9QA 4X6RB 1K3IA 3B94A 1AJOA 3HVDA 2WT1A 3IPVA 3MF6A 1OQDA 1HRI1 1LHVA 3HBKA 1GMMA 1DIWA 5FTTC 3H42B 4Y24A 4WVMA 3IDAA 4KU7A 3P3PA 2EXHA 3PJYA 5GZEA 2FDGA 1SEFA 3DF0A 1POQA 3O7OA 5HCFA 4OHWA 3KD4A 4GZ9A 4RQPA 3ILRA 5FUNA 2PAMA 3WX5A 1DHKB 3KF3A 5FZLA 2H0BA 3VBUC 3WF3A 1O8PA 2ORXA 1GWKA 4MZUA 4XDOA 1FPN3 2X09A 4IEQA 3TBDA 3U4SA 3I3MA 4CPBD 5K0UB 2RM23 1AYN1 5JXJA 3HQUA 2VXRA 5CVRA 2OIIA 2VZPA 2A6XA 5T3NA 1MS8A 2Y33A 1AL23 1PO12 4XFAA 4CU8A 2UURA 1GUIA 1H0BA 5FZDA 2B4KA 2WNUA 1E5SA 1PNFA 2ADEA 5FPZA 1MVEA 4CCNA 5DAWA 3FUOA 4LQRA 4ATFA 2D6LX 4XJWA 4L97A 4MXVA 4LR4A 3IAPA 3AL5A 1OD3A 1TME3 1BBT3 2RR11 5DUUA 1WKYA 5DG1A 1H1IA 3CHXA 1BJQA 4H7MA 1Z7S2 2Q1FA 2VD7A 2VXJA 3JBG1 4DINB 2SLIA 5JAXA 3VHOA 4KU8A 4KWKA 5FCCA 4Q27A 2CGNA 2VGDA 4WVWA 1ZRRA 4U36A 3E6CC 2UY9A 3MW2A 3O1SA 4FCAA 3VZJA 2EAAA 1ACCA 5C33A 3S57A 2WNVC 2PLV2 4S2GA 2P34A 2VO5A 4KBZA 1AXKA 3V64A 4DPNA 3RZMA 1GWLA 3MYXA 3ACGA 4ZONA 1RUF2 1BVVA 4XEZA 4XXPA 4MXWB 2BGPA 3NO8A 4LJHA 3MW4A 5FK8A 5JWPA 2VC9A 4CDUA 3ZFFA 2FHRA 3DEMA 2YGMA 1VB2A 3WEZA 5CNAA 3GZAA 3C7OA 4Y5TA 3NAPA 3SXWA 1OA2A 4S2DA 1ZVFA 4WM7A 4ARYA 4FBFA 4M4RA 2BGCA 1W8TA 2QVSB 4FI9A 2LS6A 3B9CA 3ZN6B 2IXHA 2XQXA 3N9MA 4Y5Z0 1UAIA 3CF6E 5C4WA 1MS5A 2Q5TA 4B1LA 4JDNA 4LOSA 2KD7A 4RQPC 1HRV2 1R082 2A3YA 1KS5A 3O12A 2OS2A 1QJX2 4TWTA 3I3DA 4GWMA 4GQ7A 3KT1A 5IAVA 1OH4A 3VBUB 2RS12 2XB6C 4CEWB 3LGRA 5FZHA 3Q8BA 3ROUA 1ZRFA 1ST8A 2UWCA 4IEWA 5GZFA 3U78A 4UFHA 4J25A 3NJXA 3VBHB 3Q8FA 4LBQB 1LOAA 1OQ1A 3VHPA 1E57A 4O9EA 2VCMA 3FLPA 2VCCA 2WNUC 3MLLA 1U5YA 5FV3A 1SZBA 1H4GA 4QX1A 2V5YA 3G6JB 2VZSA 4CRQA 3LB9A 4GMP3 2R072 2VBBA 3CKHA 1O7FA 1V6OA 2A6YA 2VVDA 3OF1A 3WNOA 1IS5A 1Y9QA 2PHLA 1CWPA 2BU9A 3W58A 3JQWA 2BBAA 4B29A 1GNYA 2WSUA 5C3RA 3N7MA 1ODMA 3P1IA 1VIWB 4I01A 5L7OA 1RUC2 1G86A 4PT6A 5EZWA 3T2OA 4Q4W2 4XETA 3ZLIA 2EIEA 4CP0A 3KQ4B 1VBC2 2ZBJA 3N9OA 3HAGA 3NL1A 1V6KA 1JU3A 3K4ZA 3NSTA 4IGOA 2HH9A 3WDTA 4CDQB 1WW7A 1WMXA 1V6JA 3J7MA 3BYWA 2KA3A 2ZGKA 1VBD2 2YU1A 1J3RA 4YW7A 5FUPA 5LY1A 4OUEA 3CBNA 4GWIA 2NPIA 2WNVB 1WBFA 4I02A 2VCBA 1OT5A 3VBSA 4HSJA 2YBPA 3HQXA 4Z07A 5CYYA 2KM2A 4QGNA 1N3PA 4CUGA 3QACA 3KWVA 5A7WA 3ZFFC 2QFEA 2FCVA 4UW3A 2P3IA 1Z0HA 4UFMA 4GB32 4FPFA 3NAPC 1XE8A 3EYPA 5CFDC 3BN6A 5LBFA 5I8SA 2PHUA 4WVMB 3W5MA 3CDZB 4N9HA 3SH4A 1X8MA 1N1SA 2HWD2 4Y1ZA 3K48A 4CDXA 4XBLA 2D6KA 2NZ9A 3PURA 3ZYJB 2VU9A 3WP5A 5FYTA 1B35C 2IC1A 4C1XA 1WD3A 4PLOA 1HXS1 5T5LA 4IEOA 5GLZA 4XAAA 3UKNA 3I59B 2F4LA 1REEA 2E31A 2R6QA 4JGZC 2VZTA 3O0XA 1SACA 3E5XA 4ES8A 3A21A 3LSDA 5HXMA 1NCRA 4PIYA 3N7KA 1TEIA 4C90A 5I91A 1IZ3A 3WV6A 4JVAA 1CGPA 4L92A 3S30A 2QJVA 4Q0SA 4I0AA 4LULA 3HT1A 5J36A 4NR1A 4YW2A 3OBTA 3PU3A 2JIGA 4NIIA 1QMJA 2XL7A 3KB5A 2PFWA 4LKEA 1O8SA 1O59A 4AL9A 5IT6A 2C24A 2OA2A 1IS4A 1FPN2 3OUHA 5L7OC 5CU1A 2DCJA 2RM22 4JRAA 3E6BA 2O1QA 1O91A 1OMIA 2CAVA 1W3XA 1FI2A 2JICA 3I97A 4HK8A 1WW5A 2BDRA 4QQOA 2E7AA 2O8OA 3AZZA 4J1XA 5FP9A 4YGEA 5FMOL 1OUSA 3RWNA 5DG2A 2Q4SA 3B5LB 4XZPA 5A80A 4IDZA 1Y9GA 3K51A 4CDUB 5CA6A 1OOPA 4JDMA 4QX7A 3JUUA 1AL21 3ITQA 3ZYHA 3AKSA 1GQPA 2FDFA 3VBSC 1HV0A 1TME2 1BBT2 2ARAA 4JHZA 2W3JA 3SNMA 5FPUA 2DV9A 3A0NA 4HBNA 3PDQA 4OMCA 5J98B 3WP3A 3RQ0A 2VZ3A 3MIFA 3NV3A 1GR3A 2ZZJA 3OBRA 4E8DA 1CPNA 2VTXA 3MBWA 2V72A 3OB8A 4FFHA 3OPWA 1AZDA 2W08A 1IQAA 3MLJA 3NAPB 1GNHA 1YQ2A 3I2HA 4CXXA 5CFDB 4MGTA 4YZ1A 5E16A 1GOFA 1UOGA 1W6NB 1HB3A 3H8UA 1Q5OA 4N43C 3WDYA 1WBLA 5FZBA 1DFQA 1F15A 2C9KA 4CDXC 5FLJA 4XFGA 4AVBA 3NMBA 2AH2A 4QKFA 2I45A 5A3PA 4W6WA 3MIEA 5BV6A 1W90A 1B35B 1TQ5A 5LW9A 1FNYA 4NROA 3VBFA 4GIQA 1SCRA 1HN0A 2QKDA 4EWDA 5K9YA 3HOBA 4Y5SA 4FSJA 4Q0VA 2PYTA 2W46A 4JGZB 3UGGA 1W6QB 5FO7B 5KHKA 1PVC1 1UU5A 3MUY1 3NRUA 4EN7B 1AXYA 1DLLA 1NLSA 1OPOA 1CAVA 1QXRA 3M8LA 3VL9A 5CFCC 2WFF3 3WG2A 3WG3A 3AB0A 3NNGA 3J8F1 4OI0A 1ULCA 2CSGA 4IEVA 2VNOA 4CUAA 3FE5A 3IKWA 5FJHA 1CR7A 5IVBA 3AJYA 3MUZ1 1HQLA 2EXJA 2ZPXA 2TEPA 5LY2A 4XDQA 5H9PA 3E5UA 3U14A 1EP0A 4Y20B 1QDCA 1W6OA 1R1A3 2B8MA 3JZVA 1VBE3 5FZ6A 2CU5A 5A6QA 1FV3A 1BCXA 1H2KA 1P8JA 1XNBA 2A1XA 2PHXA 1F4HA 1QJU1 2DWRA 5FY1A 5E6HA 2ZGPA 4Z92B 2PN5A 4ZS2A 1XNKA 2WT0A 4N53A 1I5ZA 3VKFC 4AI3A 1RUH3 4BQ5A 5JMOA 2VMFA 2Y38A 4MGYE 5LCWL 1U5ZA 4NN0A 1E5HA 3IAQA 4IEUA 5FY9A 4DS0A 3KF5A 5A3NA 1ZRIA 4OZOA 4QQ2A 1SLLA 2XKOA 4K6BA 1LOCA 2CNAA 5JIUA 3NQHA 2JD4A 5A7WB 3ZSJA 5L9VA 1GQHA 3HNMA 4MYEA 4NO4A 3RZJA 3NVCA 4DUXA 3T1MA 5IK5A 3T30A 1ND3A 2GZWA 4XHXA 4IE0A 1FOD1 3J7LA 4N43B 1EV11 1W0NA 1Y9MA 5GJ6A 4URTA 4QPYA 3RGBA 4M3CB 1GZWA 4PJYA 1RHI3 1IG0A 1JOBA 2IFRA 1JYWA 2QQNA 3DYMA 1R093 5LBCA 3AYAA 4AHWA 3VBOA 4R9BA 4MVTA 4QB1A 5LA0A 4LLOA 3BTZA 4LITA 3BCWA 3ZYGA 4P5HA 3ME2A 4L99A 4AEDB 1K5MA 3ZO0B 4W4ZA 1UX6A 2C9AA 3NV1A 2VH9A 1CIWA 1XRUA 5AVPA 3DXTA 1BYHA 4ARXA 1W6PA 4AAXA 2A73B 1N3QA 2F4PA 5F5QA 3IB3A 1JN2P 3LFIA 4KQ7A 2QBXA 2W1WA 3KGZA 2PMWB 1REDA 2C26A 1A8MA 3OOXA 5LA9A 3KV4A 4RR3A 2BW8A 1AYM3 3ZPOA 1JYIA 2OZ6A 5CFCB 3O5SA 4O7XA 2JJ6A 5F3CA 1AR71 4OQ8A 5FLIA 3W5NA 1RUE1 3BB6A 1EPZA 4BCUA 2HWF1 4Q4V3 4YVSA 4MUVA 1POV3 2RMU3 2VZ1A 3MW3A 2V5DA 1Q8OA 3N3HA 1NAEA 4L11A 4XHBA 1I6XA 3WW2A 1JYNA 1RVF1 2EA7A 4C0HA 4IL7A 4INDA 4MGKE 3KGLA 4R8HA 2RJ2A 4MGSA 1CZVA 5A7QA 2X05A 4BHPA 2E7TA 2AACA 3H0OA 2QQWA 4FP2A 1C5HA 1NOVA 4N53C 4BPZA 5C8CB 1AVBA 3AFKA 5JI9A 3DYOA 1RUD1 1MZEA 1FATA 2CY6A 2OYZA 3W20A 5C5UA 1AL0G 1ZX5A 5FXZA 4GAZA 2H0VA 2W2IA 3POIA 3THTA 1RUJ3 3IM0A 1ONAA 4JQTA 4RL7A 4YW6A 5FXWA 3DCQA 4IQPA 4P9YA 3V0BB 2YMZA 5F3EA 5IHRA 3MHZA 4HFSA 4OULA 4NWVA 4Z1VA 4ZU5A 1PMHX 3D6EA 1JZ2A 2VW2A 1L3JA 1FXZA 2XLAA 3PL0A 5FZMA 2WWUA 5AVAA 1YQ6A 4PDWB 3HIFA 3TB0A 4QPGA 4D7TA 2EF6A 2F6BA 5LRSA 4UI9L 1CAUA 2D6PA 1IPJA 1ND2A 2FMYA 3VBOC 2TUNA 5KBFA 1HB4A 2VUAA 2ZXQA 1WLDA 3FHAA 1YFWA 4K1ZA 4RSUA 1ULFA 1VMFA 4NRQA 2E9QA 1K5MC 1QXJA 3O1TA 2DFBA 2Y34A 5LZ6A 3LEKA 4HKLA 4XF4A 3RVHA 4LLFA 4KNCA 5F5AA 1DGWX 1VPHA 1WUVA 5F6KA 5DAXA 5JI7A 1DCSA 1S0GA 4IGQA 1CD3G 4Q0UA 4QT6A 4FPYA 1MS9A 5K4LA 1JW6A 1NXD1 1V9U1 3MIBA 3B01A 1SBDA 2WN3A 4AYUA 4LIUA 1VRH1 4MSVA 4IXLA 2Y6HA 1JZ3A 2VJXA 4MV2A 2DVBA 3B93A 2HYKA 4CVUA 5ANQA 4AFMA 5EFUA 2WZR3 2ZGTA 3TWIA 1UQXA 2XDVA 2VZUA 4TLGA 1EAH3 1YO8A 5JVVA 3S6PA 1HN1A 5GZCA 5J3UA 1JBCA 1W6MB 1RGSA 1C8NA 2QTWB 4NE9A 2MEV3 3ES4A 3DL3A 3K3NA 3SH3A 4NAMA 2IUWA 4FPOB 3OGGA 5EPAA 4P9GA 2WINB 3LKJA 5A70A 1UU4A 5I8TA 1ZBE1 2DCKA 3WF2A 1Y3TA 2RHPA 1RMU3 4NHXA 3FWEA 4HETA 2WFF2 1JHJA 2GMPA 2QNKA 1XNTA 4I3GA 4XTMA 5FYVA 3ZKYA 2GH8A 2UYBA 2ZHKA 5IAXA 1CZTA 5IVVA 1T6BX 2BFUL 3T0BA 5ABJB 2QQMA 2ZEZA 5FZEA 2XJTA 3CLPA 2R1DA 1R1A2 3LSEA 3SQOA 1VBE2 3MLKA 2BNNA 2BZDA 1GANA 1HRI3 2ET7A 5B4XA 2XJSA 3ELNA 3O1PA 2YXSA 3VD5A 3VD3A 2B9VA 1J1LA 4B3NA 1UOBA 4AZZA 1RUH2 3X29B 4BLJA 1ND2C 3WZ1A 1Y4WA 2ES3A 3LE0A 2VMHA 4NJ4A 5F8PA 1ZZ8A 3AX4A 3I2FA 4LBJA 3FX3A 1S0IA 5LATA 1TNRA 4RHV1 1IPKA 4XW3A 1HQWA 3FBYA 5DZEA 3ALQA 1AYN3 2Y0IA 5BYNA 2J1VA 3BOWA 2VECA 1ASJ1 5D8AC 5CZKA 1LHNA 4H55A 3TN91 1RHI2 2W68A 1IKPA 4A3ZA 1R092 4YM3A 4YVWC 2FDJA 2J1RA 1GWMA 3GNEA 3CJIA 1W0OA 3O0VA 4RS5C 1HB2A 1HV1A 1SG3A 4OQ9A 2RR13 1X50A 1UY4A 1GZCA 4LE4A 3O0WA 4OVEA 5CG9A 4XF9A 2WKKA 4B4QA 5IK8A 2VNGA 4FVVA 2UYAA 3JBG3 1Q8VA 5LK5A 4QHZA 1XYOA 4OMDA 4Q5OA 2KXLA 3OYWA 2E63A 4XUOA 1F8VA 4TN7A 4EV0A 3RNSA 3OGJA 2WABA 1UW8A 2YZ4A 4LHNA 4G9SB 4R9DA 5FRAA 1AYM2 3SH5A 3O1MA 5LBBA 1IQDC 2JKBA 3BIWE 3LA2A 4FPGA 4S2HA 5EIYB 2HYXA 4MG2A 1YQ8A 1FMD3 3PIGA 1NA1B 4YW4A 4LORA 1VBB1 1MS4A 3M3CA 4Q4V2 3VBRA 1LOFC 3THPA 2RMU2 4BU2A 3A4UA 1S0CA 4CCCA 2XJRA 1RTVA 5FZGA 4AI0A 3ECQA 2J42A 5E1RA 4IV1A 4GH4C 1ZNPA 4LUMA 4HKOA 2A75A 4B1MA 3M4FA 3GBGA 3UT0A 2DCTA 5FZAA 4Z2AA 2YHJA 1W2UA 4EWAA 1YQCA 4MGQA 3WDWA 3E6DA 4FPCA 5D2AA 1LB2A 4Q4Y3 4E2GA 2D6OX 5JOYA 4YM2A 5FXXA 2WYSA 1RUJ2 2ET1A 3ZR5A 4AEJA 4JRLA 4B4PA 1X36A 3TNQA 3FMGA 4W6YA 4XIOA 2YC4A 4WVZA 2JDAA 2WO2A 4R4XA 5E8AA 1H9PA 2HWE3 5FPAA 4UYBA 2LROA 5FKCA 1SPPB 1G6NA 1MPXA 3DUIA 2XJUA 5D8AB 1QGLA 3WDVA 2DVFA 2H6BA 2JEMA 5EJ1B 4CP9A 1K12A 2EALA 2RJKA 2UWAA 2OKXA 4A2UA 4A4AA 4OI4A 3WP4A 2VUCA 1X9PA 2VMGA 2CDOA 2BEOA 3CJIC 4YVWB 4JHTA 1MACA 1V0AA 4Q4X1 3U75A 1S2KA 2K9ZA 4RS5B 1CAWA 4WM8C 3PMEA 4Q1RA 5H9RA 5EP9A 5D21A 3UV9A 4I2OA 5L9BA 1XSRA 3ZFEA 3UJQA 1DZRA 5FYUA 4IV3C 1W3VA 2C0ZA 1D4VB 2FD8A 2VOWA 1HIXA 2YFUA 3WF1A 2YU2A 3ETQA 1AR61 2D93A 3ZXFA 2GN7A 4HVQA 1BQPA 3TEWA 1F9KA 3W59A 3LA7A 4AG4A 1GICA 3LDKA 4AFAA 3RI9A 3QCWA 3VV1A 2PHTA 5BPXA 5CAZA 2HEYF 3AYDA 2VCAA 2WZR2 2GC2A 3M3EA 4EZ4A 1H9WA 3VBRC 3J26N 1CX1A 1QY4A 2ZGUA 1EAH2 1JUIA 3SKVA 3J9SA 2W94A 3CO2A 1UD1A 2FCUA 3BTAA 2G9FA 4CPBA 4IV1C 2ZHLA 2MEV2 4GH4B 5FWJA 2GNTA 2JDMA 2VOXA 2VNRA 4FQZA 1GP4A 2FMDA 2PAEA 3ACHA 2ZGRA 3WW1A 1BMV2 3PMSA 4GMP0 5FOBB 4BDVB 1RMU2 5E88A 4ZZ5A 4F8AA 2NMNA 1F5JA 4EROA 1C5IA 2WQ8A 3OY8A 4KWUA 1AX2A 1HXS3 4D6QA 2HJIA 4LHLA 1YUDA 1RYYA 3V56A 4AFCA 1YYNA 4DFSA 4M00A 2Y26A 3AMQA 2ZHMA 1HRI2 2XQRA 2N7GA 4M0HA 2C4XA 4FO9A 2OPKA 3TEZA 3E1F1 1AR81 1MZFA 3V0AA 1IG3A 3WF0A 3O1VA 1MQTA 1X82A 1Q56A 2D43A 2W95A 2ZTNA 2HEVF 1U5IA 3B9IA 1XU1A 3HMYA 3AVSA 1S1AA 5FYYA 5T5JA 3DN7A 2NLRA 5BNPA 5FPXA 1LESA 5A33B 4BWOA 4QHOA 2WS91 1KFXL 2VQTA 4WM8B 4AAPA 5A3UA 5IUQA 3S5QA 4CCEA 3GXUA 4YGBA 5JCTA 2YDEA 3D0JA 4IERA 1B09A 1Z78A 4GKXA 3VZMA 5A1AA 5GZGA 1CQ9A 1CVNA 1AYN2 3N7JA 3LAGA 5CKNA 4IV3B 5I0TA 3UK9A 4YZ3A 4BQWA 3SCGA 1W9WA 2B42B 5GLUA 4BM8A 2YY1A 5D1IA 1NCQA 4NWWA 1Q8QA 3IDBB 5F2WA 5GM0A 1UX7A 1W28A 4LBQD 2WQ4A 2YROA 5FMOS 1O4ZA 3VKLA 1HJGA 2RR12 1US2A 3AZWA 1OVPA 4UT5A 3AVRA 2AYHA 1TZOA 4BA6A 5JXIA 4QGLA 2FZ2A 2J1AA 3IMNA 3Q8AA 5FZ1A 4XIKA 3GCXA 3JBG2 3WUCA 5AC92 4GXLA 4K9SA 4NHMA 5ISLA 4LBLA 5LB6A 1AR91 4WVVA 3WCRA 2X53S 4LO5B 4AGRA 1H1AA 5ANNA 4BLIA 3ILFA 3ZN5A 1MR5A 1QKQA 5JZGC 5A1FA 4ZY9A 5GLVA 2DCYA 1OLME 4TXWA 2EIBA 2DTYA 1NQJA 3KCYA 3AZVA 2ZGLA 4RN5A 1O3QA 1L7LA 4QM8A 1OA3A 1PK6C 4BISA 2O14A 1LAJA 2BVVA 4YW3A 5ACA1 1G9AA 2RDRA 4Q8KA 4NIAA 1FMD1 2VUDA 4CUCA 1S2EA 1DP0A 5GLTA 5C70A 2L9LA 5BNQA 2GDFA 4C8DA 2WA4A 1PVC3 1MQTC 1WA4A 2RVAA 2WBKA 3GDBA 4B8EA 1VAVA 4E2SA 2TBVA 2VE1A 3ORJA 5T52A 4UF0A 5BNPC 1IOAA 3UGHA 2BV4A 1W9TA 4A7KA 4XUQA 3KV6A 3J8F3 5I0RA 3NJZA 3C7HA 5C9AA 3RJRA 2VMDA 4WV8A 3POBA 5ERLA 1SLAA 2HEWF 2B46X 2GALA 4Q4Y1 1US3A 1H6XA 2BQPA 4JTOA 2ZX1A 5IVEA 4YWAA 3LEMA 1A6CA 2Q30A 3P3NA 2YBSA 1QH7A 5FR3A 5LA1A 1XBFA 5IW0A 1D7PM 4HXCA 1QJU3 1DF0A 1NCQC 2YPJA 2HWE1 4QQHA 2C6SA 3T0DA 3TAYA 1QXPA 4FPHA 1GV9A 4RFT0 4DXZA 1X7NA 1PZ9A 3VHNA 1OSGA 3ZXLA 2P3JA 3GF6A 3CJXA 5EHDA 4FPEA 1PGSA 1C8M1 5IK7A 1CAXA 4FTEA 1XNAA 3K4DA 5FZ8A 4BZ4A 3I2DA 3VGIA 4UW4A 1KFUL 2PHDA 4XBQA 5BNNA 1FOD3 1GBGA 2WWJA 2XVGA 4I09A 3USUB 1EV13 3JB8A 1XSQA 2XUEA 3PIJA 5FZ0A 2VZQA 2ZS6B 3S7IA 1K42A 1GP6A 3OTFA 5JZGB 3UJOA 1I3HA 5A3WA 2VOKA 5F5IA 3WHUA 3ACLA 2HWC1 4AGVA 1W8FA 1NZIA 1LKNA 3ASIA 2DURA 5JOZA 1C1FA 4NVPA 4R4ZA 1PK6B 4JDOA 1XE0A 1RUOA 4QKDA 4BQ2A 4FXGB 1BXHA 3RZLA 5FP4A 3MFAA 3ZM8A 4CDUC 1UZZA 1UYZA 1ENQA 2ZMKA 2ZGQA 3TOJA 4AGGA 4DO0A 3T08A 3PTRB 1KDKA 1AF9A 3EO6A 1HQNA 3IPVB 4NIGA 1PZ8A 4DQAA 1IS6A 4WM7C 2XH6A 5G04L 1BVP1 2QZ2A 5FREA 5FY8A 5BNPB 2RS51 3H50A 4IE6A 4XF1A 3KHCA 2Z79A 1AR73 2VR4A 5FYZA 5LASA 3VDDA 1RUE3 2V4VA 4YZ5A 5C4WC 3GM8A 1HXS2 2ID4A 5BNOA 5KHJA 2HWF3 4RQPB 5H9SA 1UY2A 1PX3A 1ENXA 3JD71 4GWJA 1RVF3 1W9FA 2F17A 4PCRA 5FJKA 3LWCA 3VDCA 2JG8A 4A6OA 2MHFA 2QQVA 4I0WB 1UIKA 4IEXA 4RGKA 1UO9A 1S0DA 4N90A 2C1FA 2I2SA 4AHYA 1RUD3 2OXBA 4AVTA 2WNUB 4AFDA 3BI3A 2BOIA 4KWLA 4AEKA 2WSVA 3AKRA 3HR9A 5JOXA 3KT7A 2AENA 4OI2A 4ZU7A 2E6VA 5A3LA 4QX5A 5F37A 2BERA 5IVFA 1SLCA 2RJLA 4J6GA 3EBRA 5BNNC 2JKXA 3TYJA 2DVGA 1I9RA 3WW3A 5FK7A 1RUI1 3NNFA 4RGAA 5FPBA 5C5TA 1N1VA 4GWNA 5HV0A 5IFTA 1MZ5A 1AL22 4DXRA 1H8VA 1KXGA 3GYDA 4AQTA 4HSLA 4ASMB 4EE2A 3WNKA 2XLFA 4Z8BA 5CISA 4PHZA 4D7SA 1C4RA 3UETA 3WSOA 4Z2WA 4DMIA 4Q1PA 3OUJA 3ZSLA 2D5FA 3BTXA 2WR9A 3A7QA 3S7EA 3OUIA 1BEV1 1XYPA 3OD4A 3WF4A 1NZCA 2VOVA 3GHMA 4BQ1A 1ULOA 2GH2A 4LO6B 3LOIA 4P9IA 3GJBA 4V2WA 3ZFFB 4A45A 4CEYA 2BP6A 2JE9A 4IGPA 1V9U3 3ON7A 4ZXKA 4AVAA 1H8TA 4YRDA 3NNLA 1KGYA 2PELA 4WM7B 4YPJA 1VRH3 4ONUA 2JDYA 4IEYA 3HT2A 2AEYA 1O3TA 4I30A 4XBNA 2FBEA 3T2TA 5LA2A 1XNDA 4BIOA 4COUA 4Y22A 5C3QA 2JG9A 1VRBA 4LK7A 5C4WB 5BNOC 2BVBA 3RYKA 4B7EA 2BUKA 3FJSA 4FOYA 3WDXA 2A7AA 3QD6A 3ZPYA 4FFIA 3UNPA 3WQBA 1JZ4A 3LD8A 4UW5A 1QOSA 4QXCA 5FZOA 1LU2A 1LJ7A 1PVC2 1JXNA 1H4HA 1W8ZA 1ZBE3 2SBAA 3FFZA 2ZZQA 4Q2FA 5L19A 1JYTA 1NCRC 3ZFGA 2Y6LA 2MPFA 4PI2A 5JR2A 3J8F2 1KITA 1MS1A 3N36A 1Q8PA 1W03A 3I3EA 5FMBA 3RWKX 1MEC1 2W9XA 2CYFA 1DGLA 2WA3A 2R041 2A70A 3ATGA 5A6ZA 1YI9A 5IVCA 4AVCA 4EN0A 1WLWA 3N9PA 4AF9A 2BFUS 4XF3A 1AXZA 1LHWA 1QJU2 4V1PA 2WZPP 3ZSMA 5L7OB 5M0TA 1ZREA 2YBKA 1GFF2 1LGBA 1O3SA 1QJY1 4OUMA 1OFNA 1VMHA 4IE7A 4UFIA 2B45X 3JB4C 3IBMA 4Q0PA 3RMXA 1DZQA 1O5UA 1ZZ9A 3B7MA 4XMAA 5KHHA 4XQWA 4CCOA 1OOPC 5FQ0A 2VBDA 1X8EA 2XMLA 4JTNA 2IXLA 2DDUA 1OF3A 4RHV3 3H3ZA 5A32A 2J1TA 4DEQA 4EYUA 3HN1A 2P1BA 3GZUC 1UL9A 3NV2A 3VBSB 2DUOA 1DLCA 2YUEA 1H2LA 4HZFA 3VD7A 4E2QA 2JD9A 1JZ6A 4PF1A 2EAKA 1DDLA 4GALA 2CV6A 5E89A 1ASJ3 1FOD2 5CEHA 1SFNA 2OUHA 4CEYC 3ZYPA 1LNSA 1EV12 1OBNA 2BOJA 1S0EA 3TN93 4MHRA 2KR2A 3F2ZA 3KS7A 1UZ0A 4F83A 5I93A 2FQPA 4GJZA 1JOJA 1WCUA 3C7GA 3DPRA 4XUPA 2QE3A 1E5IA 1QOTA 1C3HA 4CDXB 1LOGA 3AYEA 2YC0A 1SMVA 3B02A 4QAWA 1D4M1 2YB7A 2BGOA 3H7YA 5HI0A 3VBFC 3BODA 2WLQA 1UXZA 2GU9A 2P3KA 4BOWA 1UCXA 2J1UA 3KVBA 3MO4A 4N7UA 5J1XA 2R32A 2XR4A 5APAA 1QHDA 2G1MA 4YG6A 1SBEA 2C5DA 2VVFA 1NCRB 2VQUA 1SDDB 4HL0A 4QM9A 5J09A 4WZFA 1AR72 1F31A 3ZSKA 2QCSB 1RUE2 3GALA 2RS31 4LBMA 5C8WA 2PAKA 2D98A 2XXZA 1PGL1 1OQEA 1H2MA 1VBB3 3UKTA 2HWF2 5EQUA 1YJLA 4E8CA 2QQIA 5F2SA 4QPIA 3JCIA 1RVF2 2MNGA 2BNOA 3KHBA 3IDEA 4N7IA 4ISRA 4XTPA 2G9ZA 1PIV1 1RITA 4DNYA 1TNFA 2D5HA 5I0SA 2ZAAA 1DBNA 1A78A 1TMF1 2X8KA 2ZMNA 4FTSA 2ZAHA 2QDRA 3MIGA 5F5CA 2ARXA 4ZHNA 2VVEA 2IXJA 3A0KA 1RUD2 2ZKNA 1JZ8A 3PTYA 2ZHNA 4FTBA 2BYVE 2VULA 1OOPB 3GCWA 2OX0A 1WW6A 4RFRB 4AI2A 1ZZ6A 5G05L 1APNA 3VUOA 3HD8B 1RINA 1Y43B 1COV1 1OXCA 4OHXA 1S2BA 4NHLA 1UY0A 1FT9A 1KS4A 5FWEA 2CHHA 2E51A 2EXKA 3VZLA 1JMUB 1ND3C 4A44A 2XJQA 5DXDA 2WWSA 1JH5A 1NLQA 4P9LA 2DYCA 5HXVA 4Q4X3 1IPSA 3MF9A 4PLMA 3NKGA 4ZS3A 4LBOA 4NHYA 3NWKA 1EYBA 3T4HB 3KT4A 2WDBA 2IXIA 3EXUA 4FOWA 2JE8A 1YEWA 4BQYA 2PHWA 5FZ9A 1WGPA 2DVAA 4JGYA 4NPLA 4MX3A 3H1MA 3VBFB 3ABZA 2D44A 3WG1A 4BB3A 1REFA 4EN8B 1S0FA 1AR63 1S4CA 1V9U2 5IFPA 2VW0A 3H3LA 3POEA 1EUTA 2PTMA 1VRH2 3U11A 3FLRA 4NRMA 3DGTA 3MPPG 3VD4A 4XVHA 2YFZA 1WMFA 3AZYA 4RR3C 3SISA 1CAVB 3IWZA 1HDKA 2VMEA 4C0BA 4QB6A 1OLMA 1W2TA 1NX9A 2GNDA 1SLIA 4PIZA 3IT8A 4XE9A 3WNMA 2QZ3A 3ZSEA 3I3QA 1RUNA 5JXHA 4YVSC 2J1SA 4QQLA 3T2QA 4KH9A 4O9GA 5FMCA 2WZEA 4EN6B 4YZ2A 1W6OB 5HBAA 2W91A 5IJRA 5IVYA 1UOFA 1QEXA 2Y0OA 1ZBE2 4Q26A 2HBTA 5FUIA 3UGFA 1H2NA 4ASLA 1MVQA 5HPOA 2WQZC 2ZJCA 4XCBA 2B9UA 3WP6A 4K20A 3ZXKA 5FQ0B 1Y7BA 4N53B 1HLCA 1NG0A 2AGSA 3LFMA 3M70A 3MDPA 4ZU4A 3WY6A 1JUHA 4AQSA 3C2UA 5FMDA 4NOTA 1F35A 2DFCA 2IVJA 2XJPA 3D0SA 4HVRA 1GOGA 5FBJA 3KMHA 4V2VA 3RRDA 5LK7B 3VZKA 1JYXA 1GKBA 5LBEA 2VNVA 4M01A 4Y3OA 2BNMA 4K1YA 1AR83 3NV4A 5DUXA 2XWJB 2FDIA 3VN4A 4HPKA 1KJRA 4AFBA 1YFXA 1ND3B 1URXA 2RDSA 4YW5A 2Y6KA 2A3XA 1Q43A 1G9DA 2WS93 4QPGC 1GZWB 1RC6A 3SCHA 1HX6A 3SITA 4RHV2 2ZABA 4LO7A 4Y1VA 2AC1A 3AM2A 3KV9A 4OFGA 1NY71 1QQP1 3VBOB 3ZXDA 4JGYC 3R4SA 4X6QB 3ZDVA 2Q0AA 3DKWA 1EUUA 1ZYBA 3RDIA 5IATA 1DG6A 1K5MB 2RE9A 3HN3A 1ASJ2 1WLTA 3I54A 4FFFA 2YG0A 2YPDA 4CU7A 1ZA4A 1PX4A 1KD7A 2ENRA 4OCTA 3HBZA 3TN92 3ZXGA 3H1WA 1Q8SA 1W6PB 1UY3A 1PO21 1LEDA 4QDSA 1KRIA 5DDJ1 3TNPB 1QWRA 4B7KA 1G7YA 2D40A 2PHFA 3H8RA 2CWMA 2X5IA 1XE7A 4H2AA 4RR3B 2IXKA 1O5LA 2G4IA 2XBO1 4CYDA 3HWJA 4J1WA 2ZA9A 5FZ3A 4M4PA 4YW1A 2JX9A 1DQ6A 1X9TA 4YVSB 1C1LA 5FLHA 1AR93 2I74A 3SEPA 1LODA 4OHYA 2VQ0A 1VBA1 3OD0A 2LUWA 1QNYA 4MOAA 2GMEA 3RI8A 3MICA 1CZSA 2E32A 2CWSA 4NAOA 2JDHA 5KHGA 3RZZA 3L2YA 3T2PA 4AI8A 2R49A 1LCLA 1OURA 2HLEA 2V4AA 4M3CF 1O4TA 5FOJB 4CZSA 4Z82A 1VBB2 2HWB1 5FBZA 1JODA 5ACA3 5B2GB 2JDZA 2XLGA 4JX0A 4U2AA 3ZIXA 4Q8LA 1M06G 5CKMA 2R061 1YWKA 2GC3A 1KDMA 2ZGNA 4G3YC 3WW4A 3SKJE 4DEVA 4O61A 3LA3A 5K0UA 4SLIA 4QQPA 4WZCA 5FP8A 1PM7A 4QPGB 4FPKA 5JR7B 1FAYA 2DU0A 5DZFA 5FZKA 2YYOA 1CAUB 2CAUA 4Y4YA 1ND2B 2QQUA 4EQVA 4IE5A 1DU3D 1D0HA 2XHKA 2VG9A 2ZEWA 1DYOA 3AP9A 4HK9A 4QD2A 3OJBA 3EJKA 3ST7A 1OLQA 4QU1A 3LOBA 1PMIA 4I0BA 5GZDA 3T0AA 3K75B 3W9AA 5FO8B 4XDPA 5FP3A 3WUDA 3ZVXA 2D6NA 2A6ZA 2LTNA 3CMGA 3FN9A 4LNVA 3UESA 4A41A 4Q4X2 3I2IA 4EZHA 3N9NA 4JV4A 4A42A 4CU9A 3QH6A 5KHIA 4YM0A 1YFUA 4LXLA 1C8M3 2WRAA 2P3YA 1ZBA1 5C6CA 3AYCA 5KXCA 2QDNA 5FAXA 3OCPA 4CCMA 1UU6A 4XJ9A 3U1XA 1UMIA 4OZXA 4D6RA 1ZRDA 4LT5A 1YQ5A 3IIIA 2B7YA 1AR62 5C3OA 5J48A 4IE4A 3VB9A 4CCKA 3FLTA 4MXWA 5LEJA 1JU4A 2OW4A 4QKBA 1SDWA 1KEXA 2RV9A 2Z2SB 3CIHA 2UY8A 2OT7A 4AI1A 1VJ2A 2HWC3 3MFCA 5A7PA 1A34A 1OD5A 4PQ9A 1VAMA 3KCXA 4R9AA 3ZN6A 5BXXA 5FZ7A 1WA6X 1QJFA 3PUAA 5LWBA 4ES9A 1LTEA 3HJRA 3LPFA 4QDRA 3U10A 3R4UA 3WOGA 2V73A 4YFZA 3RZHA 4XJUA 3K2OA 1J59A 3A22A 2FZ1A 4XCAA 3VBUA 4CEWA 4FAHA 2CGPA 4XFBA 4CDWA 2ZOEB 1RL3A 2JDUA 2RS53 3ACIA 4QGMA 5C3PA 3C8XA 3GJAA 1DGRA 3VBHA 1OUXA 1UYYA 1TVGA 1VBC3 4DB5A 2LRPA 1W0PA 2ADDA 3POFA 4NRPA 3RPQA 2Y60A 3JD73 1TG7A 3MPBA 3I2GA 3CL1A 1PGW1 3F95A 3MIDA 5JDBA 1NT0A 1YLLA 1AR82 3GZEA 4UFKA 3GGLA 5KXEA 3PUIA 3PJQA 3M3IA 4COYA 1GU3A 3UL2A 4CP2A 1YHFA 4COVA 2R0HA 4OUSA 2W0XA 5AFBA 2WS92 5A3OA 1LU1A 4BMBA 2PHRA 5EXOA 2DU1A 5KC6A 3Q9OA 3AP6A 3DXUA 3CJIB 4W50A 5T50A 1YI7A 5FO9B 3AJZA 4BH9A 4CDQA 1S0JA 1U0AA 4JKLA 1RUG1 3AMNA 1MS3A 2WNVA 3ZFEC 1UXXX 2G9GA 1RUI3 2VW1A 1STMA 4KI5M 3POSA 1ULGA 3GBWA 5JMCA 3OYWB 1ZZCA 4MO3M 1UY1A 2X29A 2JDPA 2HKXA 2O0OA 3R05A 4XFIA 2ZX2A 4XUTA 4PF5A 1F2NA 5FY7A 4AI9A 4BQXA 4GJYA 4DOUA 4AQ6A 3AMMA 4Y1UA 3SC7X 1A8DA 2OQ6A 3VKMA 1NXMA 4E27A 3S5AA 2XWBB 4P14A 4XACA 4XMIA 1BEV3 4D0QA 5JSPA 1GSLA 2UU8A 2WLPA 5DAPA 5GLWA 1W2AX 3RFRA 5JOWA 3VBRB 2H6CA 1ODNA 2P6HA 1AR92 2ZEXA 4LE3A 4MLOA 1XQNA 2Q1MA 5A3TA 5CBLA 4CEWC 4IV1B 4HG6B 5TSWA 4CDWC 4LBKA 3I59A 4PIXA 4XF0A 2XKPA 4DIQA 3VBHC 1XC6A 3D3AA 2R30A 3ZXEA 2XVLA 1LHOA 4QPWA 5DPNA 3C7FA 5GKAC 3AKTA 1UZYA 3E5QA 4OHVA 4UBHA 1PHMA 5ACA2 5FYCA 1YCIA 4XQ4A 1FMD2 2P6CA 2J1EA 3ZDSA 5AFEA 5F7UA 3FHQA 1UKRA 1PO11 1GZTA 1F4AA 2IVIB 3RG0A 4DY3A 1NQDA 2GSYA 3AL6A 4N9IA 1W04A 4E4DX 2BWCA 4CE8A 4KG0A 3BKZA 1OLRA 3EQEA 4FP3A 4CP9B 2ZEYA 3PVEA 5AC91 2LW8A 3HQRA 4YNIA 4LKSA 5JIAA 2WJSA 2O8QA 4Q4Y2 2QQKA 1MEC3 1Z7S1 2W92A 2W47A 3PUHA 4CDQC 4L2NA 3LDBA 2J22A 1CAWB 2ETEA 2R043 3CZUA 5L36A 1NLRA 3INAA 3AMHA 2OZJA 1N1TA 2WNOA 4NPMA 2B39A 2JB4A 1J3PA 4OHZA 2XOMA 3ZFEB 1QOOA 3USSA 2JENA 1RIRA 3EHKA 3GBFA 2HWE2 5IK4A 1QJY3 1AHSA 4KMQA 1BK1A 2PLV1 4EWEA 1K5JA 5EWSA 1RUF1 1BK0A 3VHRA 4FQ4A 4LHSA 1DQ0A 5CFDA 2ZMLA 3OGRA 4ZPIA 5JUVA 4ITCA 1W6NA 4JC1A 1C8M2 1YIFA 4TSVA 4CA9A 1GOHA 3I7DA 4PBPA 1N47A 3JQXA 4Y1XA 1LOBA 1UKGA 4D69A 3M3OA 1B35A 4BQ3A 4LIVA 2K0GA 5JPMB 4PLNA 4H14A 3AXEA 5SV5A 3DYPA 3QBQA 4JKKA 4CXWA 3AXDA 1HRV1 1R081 2NM1A 1U5XA 4CDWB 1KQRA 1QJX1 1ULEA 4CCDA 2HWC2 3P6BA 1UZVA 1DYKA 1WCSA 1WWYA 2RS11 3O14A 4XAEA 4JGZA 4QX8A 2D3SA 5J96B 3V65A 3BU0A 2BBVA 1W6QA 4XJAA 1UZWA 1SBFA 3EB7A 4YLZA 3HEIA 3H8OA 1EPWA 1D4M3 2D3PA 3OY8B 3TRSB 4CCLA 3D5OA 4KGGA 4BIFA 1L7QA 4GD4A 2VL4A 5KXDA 1NUKA 2P2KA 2WC2A 2Q8OA 2VZVA 4IEZA 2R071 4A7ZA 5GALA 1H30A 3SLIA 4Y20A 1O3RA 3V0AB 2RS52 5EJZB 5F9TA 2X10A 1MQTB 4P9WA 3W21A 4JAAA 1DQ2A 2RS33 2VMIA 3BALA 3ZMOA 2Y6GA 4E9KA 1RJ8A 1CESA 1QJZA 1WCQA 4K21A 1T2XA 5IYYA 1RUC1 2XGXA 3K46A 5C9AC 4Q4W1 2NP0A 3JD72 4LEJA 4QXKA 1VBC1 1CN1A 3I3BA 2VAUA 1ZZ7A 3KV5A 3MV01 1PIV3 1WZXA 3AP5A 3KVAA 3M7AA 1TMF3 1VBD1 3URFA 2AR6A 4IUGA 1XU2A 2VPVA 1LRHA 1SLBA 2ORZA 2NMOA 1NCQB 3Q8EA 1AJKA 5EYXA 3SMHA 1WCKA 3K4AA 2XL9A 1QNWA 2JIJA 2YV8A 4M0NA 1XNCA 4N43A 3CU7A 1HKDA 2RDNA 4GB31 2QQLA 3LIGA 4M3CA 4XFCA 4OYUA 2VTXJ 1DGWA 1UPIA 1COV3 3MZHA 5DN2A 1JHNA 3HPNA 2DUPA 1CX4A 4FOQA 4RD7A 2XHNA 1RUI2 2WT2A 4NMIA 2HWD1 3AC0A 4XUNA 3VL8A 1OFSA 1D0GA 1RXFA 4HLTA 5A7SA 3WNLA 4AEDA 1C28A 4XPVA 5F32A 4NIDA 4HN0A 4L8QA 4LUKA 4AXOA 4YM1A 1UIJA 4DY5A 2ARBA 2QQOA 4TLFA 4CSWA 3OEBA 4GKYA 2NN8A 4QHBA 2DBNA 3WG4A 5KC5A 4CUBA 1BEV2 2LALA 4LA2A 1BLZA 1IGOA 1POV0 4DUWA 1NE4A 1OF4A 5CFCA 4CU6A 3C3VA 1PNGA 1PMJX 2Y8KA 4KBBA 2K46A 2WN2A 1V70A 1JS9A 2RG4A 3OBZA 1UOJA 1W8OA 4AOCA 3T09A 4FFGA 3OBAA 1OI6A 2GC1A 4IESA 3VZNA 3ZOIA 4BK5A 2Y6FA 3LIHA 1N3OA 1U12A 5JSOA 1FPN1 3LCPA 4UF0B 5H9QA 3MI8A 1T6GC 2W39A 1VLNA 1HB1A 2A3WA 2RM21 3KQRA 3NKTA 4LMFA 5T55A 3VDDC 5C9AB 5C8CA 3H1YA 3OSDA 3PUSA 5FYHA 3OEAA 3WINE 2GAUA 2Y6JA 4QWNA 4N8MA 4FOVA 2VUJA 4QKNA 1VE0A 3ZIWA 1J83A 5HCHA 1R64A 3B3QE 5HCAA 1LHUA 2IWGB 3V0BA 3BOPA 2WL1A 3N7LA 5F3GA 3FHIB 2JG8C 3HNYM 1N1YA 4ISQA 2CTVA 4NHKA 4URAA 1TME1 4NPRA 1BBT1 3L2HA 3Q8CA 4MGIE 1F5FA 3SEEA 2E53A 2DCZA 4YGDA 3ZXJA 1MEC2 2K2SA 4PDWA 3BPSA 4XQDA 2B5HA 2EIDA 2R042 1PVXA 3N9LA 5A1LA 2XONA 1MS0A 1G9BA 4DXSA 3ZN4A 2AREA 4LPLA 1V6LA 1NKGA 2PXJA 4D94A 2HBUA 2XJVA 4WBBA 1CAXB 1AUYA 3WCSA 4XURA 2GP3A 4ZZ8A 4E4SA 3WDUA 1QJY2 1XYNA 4W65A 5FPVA 5IWFA 4AEDC 4X8NA 5BNNB 4EJRA 1QF3A 1W8HA 4AWDA 4LHKA 3ZYRA 5I8YA 2VY0A 4F7ZA 2FDHA 3I2KA 4O65A 4UAPA 4BK4A 3M3QA 2YGLA 1YFYA 3RS6A 4ASKA 1QQP3 3SCFA 2A71A 1VB4A 3FC0A 3VD9A 3CNAA 1LR5A 3NNJA 4D7YA 1UYPA 1QU0A 3KM5A 5DUWA 3ZKUA 3LEIA 5DUVA 4DUVA 4XJ8A 3WNNA 1R1ZA 4JZRA 3UKVA 5JLVA 5CIRA 5F1RA 1PO23 4HN1A 3QLQA 3ZX7A 4PBOA 5DDJ3 1S0BA 1XJAA 3U07A 5T5PA 1W6MA 4XJZA 3NJVA 4OLLA 1H8TC 1OHFA 2WIIB 4XC9A 3I8TA 2BJSA 3VLBB 4YARA 4KL1A 1D4M2 2XBO3 1IS3A 3NNMA 2JG9C 4YYOA 3J4UH 3VDDB 5C8CC 2ILMA 1BKZA 4KWJA 2GP5A 3CQOA 2R0FA 4P9XA 5BNOB 4W8JA 4BXSV 2VZOA 1JYVA 1SFPA 2EICA 2GC0A 1J1TA 3WNPA 3EMRA 1O6UA 1VBA3 3THCA 4GMP1 1V6NA 3KSCA 4LKFA 5ABJA 5F3IA 4E4ZA 2JG8B 1W39A 3CEWA 3IIAA 4MHUA 4AEMA 1YIPA 2YC2A 4AVVA 3LF7A 4JKMA 2RS32 3QH7A 2J7MA 4K8RB 5A6YA 1PGL2 3ZFGC 5CB7A 2EXIA 4PDWC 2HWB3
chains in the Genus database with same CATH topology
1ENRA 4AHZA 4HMZA 5JSRA 4YGCA 2R063 3H9AA 1J58A 1PZ7A 2BWAA 5EJ3A 1PIV2 2I07B 3WXPA 4C1WA 5FFOC 1TMF2 1LEMA 4P9JA 4XYXA 4UBGA 4C91A 3B69A 5FDBA 1LOEA 4BMEA 2E7QA 2Q1ZB 3T1LA 1KJLA 1JTZX 3KZ4C 3U0ZA 3ILNA 4S2FA 3PVNA 1VR3A 3NW4A 1WW4A 3R4DB 4IEPA 3LZZA 2QQPA 1COV2 4SBVA 1OKQA 1BZWA 3PVOA 4B4RA 1WD4A 3AP7A 4KGQA 5L73A 2ZGOA 2R16A 1GYKA 3WLUA 1QH6A 3IN9A 1LGCA 4CEYB 5A3MA 2W52A 1H8TB 1ALYA 3SHRA 1NYWA 3DPRC 2BTVC 3FZ3A 4HANA 1ZBA3 4Y22B 2JG9B 2XUMA 2QUOA 4COWA 3DV8A 1ENSA 5HCBA 3AZXA 4AQ2A 3RJ2X 2UWBA 2PQQA 1NA1A 1YNAA 3WQ0A 1ULDA 5ABJC 3KLSA 5CG8A 3FFQA 4XILA 3POYA 4RA0A 4XXAA 1UMZA 4LA3A 5BUVA 1UN1A 5LRRA 4AVSA 3WQ7A 3KCCA 1QDOA 3G7DA 3ZFGB 1DZTA 4TYSA 1DQ4A 2D7FA 4X8PA 4YG0A 3RYRA 5BY5A 3B00A 1ZRCA 3GHNA 1UF2C 3JU9A 4AHXA 2Z5WA 3E97A 2NYYA 4YZ4A 4QPIC 1SLTA 2GN3A 4A3XA 1FV2A 1GLHA 3PHMA 3BPZA 5J37A 4HT1T 1D2QA 1DYPA 2IZWA 5T5OA 1C57A 4FT8A 4YFWA 5D8AA 1V6MA 2A5ZA 4JCKA 5A32B 3AFGA 4YVWA 4RS5A 3R0RA 4K7JA 1EY2A 1SQ4A 3VKNA 4BE3A 5KWRA 2ZGMA 1IKQA 3ZYIB 1SFYA 2AUYA 4MGZE 4FPLA 3S0MA 1X33A 1NY72 1QQP2 3DPRB 3N4MA 3PVBB 4M3CE 4W6XA 2ERFA 1O4YA 1RUG3 1CPMA 4ZKTB 3WQ1A 4K40A 1V00A 3AP4A 4IETA 1DQ1A 1NA1C 1FX5A 2XPJA 1PO22 4Q0QA 2BPA2 1GNZA 2AZ5A 2WFF1 1LOFA 3QOPA 5DDJ2 4Q29A 4UXAA 1H1MA 1DGRN 4FPJA 4L9BA 3WD5A 2GNMA 4GH4A 3FUQA 3IDCB 5I0UA 1WMDA 4GA9A 1R1A1 4HKWA 2XBO2 1VBE1 1CJPA 1A3KA 4RGGA 1LULA 1TE1B 1VALA 1GZ9A 3ZXAC 1G8WA 2CL2A 3H7JA 3WR0A 3VZOA 4LO8A 1AX1A 1VBA2 2JECA 3POWA 4QPIB 1RUH1 5DZGA 3D4KA 2LM3A 1RJ7A 2ATFA 2D97A 4XOGA 1GQGA 2R1BA 2HWB2 5SV8A 5CADA 2ZKLA 4ORFA 1PO13 2R062 4A7YA 3PNAA 5A33A 3WNXA 4DZGA 4WM8A 4QU2A 2JXAA 1RHI1 4H7LA 1Q3EA 1R091 5EYYA 1JYCA 3I4IA 3OPZA 3BU7A 2ZACA 2ZX0A 4QMAA 5AC93 3M2MA 3M1HA 4IV3A 1CJDA 1RB8G 1MZ6A 1NE6A 1IHMA 2NQYA 1Z7S3 4DRVA 3WVJA 1LGNA 4Y1YA 3MIHA 2XG3A 2XVKA 1CONA 1ZM1A 2ZCWA 1SCSA 4JGYB 2D6MA 1AYM1 4BYYA 2PLV3 2ZX4A 1DQ5A 1V6IA 2P17A 4K8FA 4YG3A 2OUJA 1RUF3 2A6VA 2IFWA 4EN9B 4Q4V1 1POV1 2RMU1 4R52A 3ZMNA 1YRZA 5K7PA 5K8SA 1WCDJ 1ZBA2 3PLQA 4LTAA 4LBNA 2Z42A 2X5IC 3GZTB 4META 4ATEA 3ENRA 2OVUA 3RSJA 3MGUA 4CTEA 5T54A 4CP1A 5JPNB 2ZGSA 1HRV3 1R083 1QJX3 4D3WA 1RUJ1 5LEKA 1HW5A 3H3UA 2RS13 2WFPA 2IXCA 1G9CA 2WNEA 4UW6A 3WHTA 4MH0E 4OI1A 1OA4A 2V09A 1I1EA 2Z69A 1WMEA 2ZX3A 3RYPA 1FYUA 3FBMA 3MEPA 4GULA 4FXKB 2DF7A 2DUQA 3D82A 2A6WA 4AK3A 4XFFA 2R073 5EV7A 2EIGA 3VKOA 4AE2A 4HPKB 3N35A 1YJKA 2CGOA 5F6LB 3ES1A 5K0UC 1RUC3 1ZZBA 1WLCA 4LBQA 4Q4W3 2GMMA 2EVXA 3L9JT 4AW7A 3APBA 2VQAA 2D3RA 1PGW2 1YXWA 4DRRA 4COZA 2DTWA 4KG8A 3U4XA 1VBD3 1VAKA 1S55A 1VP6A 4R9CA 3AKQA 4I3PA 1M4WA 2JE7A 3AMPA 4YSFA 3WT3A 4LO4B 2WZR1 1AX0A 1EAH1 3USUA 1D2SA 1LECA 4GB33 3AKPA 4Y26A 4HVOA 1RUG2 2MEV1 4FAGA 2X5IB 5JZGA 4H3WA 3AK0A 1BMV1 2HWD3 2PA7A 4G4FA 1FNZA 1OPMA 2TNFA 4K3UA 5KXBA 1RMU1 3R6SA 1UPSA 4XFHA 3RMYA 1PK6A 2DVDA 5J7MA 1J3QA 3D8CA 4JQRA 1XXNA 2GNBA 1LENA 2P37A 1G9FA 4X6RB 3B94A 1AJOA 2WT1A 3IPVA 3MF6A 1OQDA 1HRI1 1LHVA 1DIWA 5FTTC 4Y24A 4WVMA 4KU7A 3P3PA 2EXHA 3PJYA 5GZEA 1SEFA 3DF0A 3O7OA 5HCFA 4OHWA 3KD4A 4RQPA 3ILRA 2PAMA 3WX5A 1DHKB 2H0BA 3VBUC 4MZUA 1FPN3 4IEQA 3TBDA 5K0UB 2RM23 1AYN1 2VXRA 5CVRA 2OIIA 2A6XA 5T3NA 1MS8A 1AL23 1PO12 4XFAA 2UURA 1H0BA 2WNUA 1PNFA 5FPZA 1MVEA 3FUOA 4ATFA 2D6LX 4XJWA 4L97A 4MXVA 4LR4A 1TME3 5DUUA 1BBT3 2RR11 5DG1A 1H1IA 1BJQA 4H7MA 1Z7S2 3JBG1 4DINB 2SLIA 5JAXA 3VHOA 4KU8A 4KWKA 5FCCA 4Q27A 2CGNA 2VGDA 4WVWA 1ZRRA 4U36A 3E6CC 2UY9A 3MW2A 4FCAA 3VZJA 2EAAA 5C33A 2WNVC 2PLV2 4S2GA 2P34A 3V64A 4DPNA 1AXKA 3MYXA 1RUF2 1BVVA 4XEZA 4XXPA 4MXWB 3NO8A 3MW4A 5JWPA 4CDUA 3ZFFA 2FHRA 2YGMA 1VB2A 5CNAA 3GZAA 3NAPA 3SXWA 1OA2A 4S2DA 1ZVFA 4WM7A 4FBFA 2BGCA 2QVSB 3B9CA 3ZN6B 2IXHA 4Y5Z0 1UAIA 3CF6E 5C4WA 1MS5A 2Q5TA 4JDNA 4RQPC 4TWTA 1HRV2 1R082 2A3YA 1KS5A 3O12A 1QJX2 4GWMA 4GQ7A 3KT1A 3VBUB 2RS12 2XB6C 4CEWB 3LGRA 3ROUA 1ZRFA 4IEWA 2UWCA 5GZFA 3VBHB 4LBQB 1LOAA 1OQ1A 3VHPA 1E57A 4O9EA 3FLPA 2WNUC 3MLLA 1U5YA 1H4GA 2V5YA 3G6JB 4CRQA 3LB9A 4GMP3 2R072 1O7FA 1V6OA 2A6YA 2VVDA 3OF1A 1IS5A 1Y9QA 2PHLA 3W58A 3JQWA 4B29A 2WSUA 3N7MA 1VIWB 4I01A 5L7OA 1RUC2 1G86A 5EZWA 4Q4W2 4XETA 4CP0A 1VBC2 2ZBJA 3NSTA 3HAGA 3NL1A 1V6KA 3ZVXA 3WDTA 4CDQB 1WW7A 1V6JA 2KA3A 2ZGKA 1VBD2 1J3RA 2NPIA 2WNVB 1WBFA 4I02A 3VBSA 4HSJA 3HQXA 4Z07A 2KM2A 4QGNA 1N3PA 3QACA 3ZFFC 2QFEA 4UW3A 2P3IA 1Z0HA 4GB32 4FPFA 3NAPC 1XE8A 5CFDC 5I8SA 2PHUA 4WVMB 4N9HA 3SH4A 1X8MA 1N1SA 2HWD2 4Y1ZA 3K48A 4CDXA 4XBLA 2D6KA 2NZ9A 3ZYJB 2VU9A 3WP5A 1B35C 2IC1A 4C1XA 1WD3A 4PLOA 1HXS1 5T5LA 4IEOA 5GLZA 3UKNA 3I59B 1REEA 2R6QA 4JGZC 3O0XA 1SACA 3E5XA 4ES8A 3LSDA 1NCRA 4PIYA 3N7KA 1TEIA 4C90A 5I91A 1IZ3A 3WV6A 4JVAA 1CGPA 4L92A 3S30A 2QJVA 4Q0SA 4I0AA 4LULA 3HT1A 5J36A 4NR1A 4YW2A 3OBTA 1QMJA 2XL7A 3KB5A 2PFWA 5IT6A 2OA2A 1IS4A 1FPN2 5L7OC 5CU1A 2DCJA 2RM22 4JRAA 3E6BA 2O1QA 1O91A 1OMIA 2CAVA 2JICA 1FI2A 4HK8A 1WW5A 4QQOA 2E7AA 2O8OA 3AZZA 4J1XA 4YGEA 5FMOL 3RWNA 5DG2A 2Q4SA 3B5LB 4XZPA 3K51A 1OOPA 4JDMA 3JUUA 1AL21 3AKSA 3VBSC 1HV0A 1TME2 1BBT2 3SNMA 2DV9A 3A0NA 4HBNA 5J98B 3WP3A 3RQ0A 3MIFA 3NV3A 1GR3A 2ZZJA 3OBRA 1CPNA 1AZDA 2W08A 1IQAA 3MLJA 3NAPB 1GNHA 5CFDB 4YZ1A 5E16A 3H8UA 1W6NB 1Q5OA 4N43C 3WDYA 1WBLA 1DFQA 4CDXC 5FLJA 4XFGA 4AVBA 2AH2A 2I45A 4W6WA 3MIEA 5BV6A 1B35B 1TQ5A 1FNYA 3VBFA 4GIQA 1SCRA 2QKDA 4EWDA 5K9YA 4FSJA 4Q0VA 2PYTA 4JGZB 1W6QB 5FO7B 5KHKA 1PVC1 1UU5A 4EN7B 1AXYA 1DLLA 1NLSA 1OPOA 1CAVA 1QXRA 3M8LA 3VL9A 5CFCC 2WFF3 3WG2A 3WG3A 3AB0A 4OI0A 3J8F1 1ULCA 4IEVA 2VNOA 3FE5A 3IKWA 1CR7A 3AJYA 1HQLA 2EXJA 2ZPXA 2TEPA 4XDQA 5H9PA 3E5UA 1EP0A 4Y20B 1QDCA 1W6OA 1R1A3 2B8MA 3JZVA 1VBE3 1FV3A 1BCXA 1H2KA 1XNBA 2PHXA 1QJU1 2DWRA 4Z92B 2ZGPA 2PN5A 1XNKA 2WT0A 4N53A 1I5ZA 3VKFC 4AI3A 1RUH3 2Y38A 4MGYE 1U5ZA 4NN0A 4IEUA 4DS0A 4QQ2A 1SLLA 2XKOA 4K6BA 1LOCA 2CNAA 5JIUA 2JD4A 3ZSJA 1GQHA 4MYEA 4NO4A 3NVCA 3T1MA 5IK5A 1ND3A 2GZWA 4XHXA 1FOD1 4N43B 1EV11 5GJ6A 4URTA 4QPYA 4M3CB 1GZWA 4PJYA 1RHI3 2IFRA 1R093 3AYAA 4AHWA 3VBOA 4R9BA 4MVTA 4LLOA 3ZYGA 3BCWA 4AEDB 4P5HA 3ME2A 4L99A 1K5MA 3ZO0B 1UX6A 2C9AA 3NV1A 2VH9A 1CIWA 1XRUA 5AVPA 1BYHA 1W6PA 2A73B 1N3QA 2F4PA 5F5QA 1JN2P 4KQ7A 3RI9A 3KGZA 1REDA 1A8MA 4RR3A 2BW8A 1AYM3 1JYIA 2OZ6A 5CFCB 3O5SA 2JJ6A 1AR71 5FLIA 1RUE1 3BB6A 1EPZA 4BCUA 2HWF1 4Q4V3 4YVSA 4MUVA 1POV3 2RMU3 3MW3A 1Q8OA 3N3HA 4L11A 4XHBA 1I6XA 3WW2A 1RVF1 2EA7A 4C0HA 4IL7A 4INDA 4MGKE 3KGLA 4R8HA 4BHPA 2E7TA 4FP2A 3H0OA 4N53C 1C5HA 1NOVA 4BPZA 5C8CB 1AVBA 3AFKA 5JI9A 1RUD1 1MZEA 1FATA 2CY6A 2OYZA 1AL0G 1ZX5A 2H0VA 3THTA 1RUJ3 3IM0A 1ONAA 4RL7A 4P9YA 4IQPA 3V0BB 2YMZA 4HFSA 4OULA 4NWVA 4Z1VA 4ZU5A 3D6EA 2VW2A 1L3JA 1FXZA 2XLAA 5AVAA 4PDWB 3HIFA 3TB0A 4QPGA 4D7TA 2EF6A 2F6BA 5LRSA 1CAUA 2D6PA 1IPJA 1ND2A 2FMYA 3VBOC 2TUNA 5KBFA 2VUAA 1WLDA 1YFWA 4K1ZA 4RSUA 1ULFA 2E9QA 1K5MC 1QXJA 2DFBA 4HKLA 4XF4A 4LLFA 4KNCA 1DGWX 1WUVA 5F6KA 5JI7A 4QT6A 1S0GA 1CD3G 4Q0UA 4FPYA 1MS9A 1JW6A 1NXD1 1V9U1 3MIBA 3B01A 1SBDA 4AYUA 1VRH1 4MSVA 4IXLA 4MV2A 2DVBA 3B93A 2HYKA 4AFMA 5EFUA 2WZR3 2ZGTA 3TWIA 1EAH3 1YO8A 5JVVA 3S6PA 5J3UA 1JBCA 1W6MB 1RGSA 1C8NA 2MEV3 3ES4A 3DL3A 3SH3A 4FPOB 3OGGA 4P9GA 2WINB 3LKJA 1UU4A 5I8TA 1ZBE1 2DCKA 1Y3TA 2RHPA 1RMU3 3FWEA 4HETA 2WFF2 2GMPA 2QNKA 4I3GA 4XTMA 2GH8A 2UYBA 2ZHKA 2BFUL 5ABJB 2XJTA 3CLPA 2R1DA 1R1A2 3LSEA 1VBE2 3MLKA 2BNNA 1GANA 1HRI3 2ET7A 2XJSA 3ELNA 2YXSA 1J1LA 4B3NA 1RUH2 3X29B 4BLJA 1ND2C 3WZ1A 2ES3A 2VMHA 1ZZ8A 3AX4A 4LBJA 3FX3A 1S0IA 1TNRA 4RHV1 1IPKA 4XW3A 1HQWA 3FBYA 5DZEA 3ALQA 1AYN3 2Y0IA 5BYNA 3BOWA 2VECA 1ASJ1 5D8AC 1LHNA 4H55A 3TN91 1RHI2 2W68A 1IKPA 4YM3A 1R092 4YVWC 3GNEA 3CJIA 1W0OA 3O0VA 4RS5C 1HV1A 2RR13 1X50A 1GZCA 4LE4A 3O0WA 4OVEA 5CG9A 4XF9A 2WKKA 4B4QA 5IK8A 2VNGA 4FVVA 2UYAA 3JBG3 1Q8VA 5LK5A 1XYOA 2KXLA 3OYWA 2E63A 1F8VA 4EV0A 3RNSA 3OGJA 1UW8A 2YZ4A 4LHNA 4G9SB 4R9DA 5FRAA 1AYM2 3SH5A 3BIWE 2JKBA 3LA2A 4FPGA 4S2HA 1FMD3 1NA1B 4YW4A 1VBB1 1MS4A 3M3CA 4Q4V2 3VBRA 1LOFC 3THPA 2RMU2 3A4UA 1S0CA 2XJRA 1RTVA 4AI0A 3ECQA 5E1RA 4IV1A 4GH4C 1ZNPA 4LUMA 4HKOA 2A75A 3M4FA 3GBGA 2DCTA 2YHJA 1W2UA 4EWAA 3WDWA 3E6DA 4FPCA 1LB2A 4Q4Y3 4E2GA 2D6OX 5JOYA 4YM2A 1RUJ2 2ET1A 4AEJA 4JRLA 4B4PA 1X36A 3TNQA 3FMGA 4W6YA 4XIOA 4WVZA 4R4XA 5E8AA 1H9PA 2HWE3 1G6NA 3DUIA 2XJUA 5D8AB 1QGLA 3WDVA 2DVFA 2H6BA 2JEMA 2EALA 2RJKA 2UWAA 4A2UA 4OI4A 3WP4A 2VMGA 2BEOA 3CJIC 4YVWB 1MACA 4Q4X1 1S2KA 2K9ZA 4RS5B 1CAWA 4WM8C 3PMEA 4Q1RA 5H9RA 4I2OA 3UV9A 3ZFEA 3UJQA 1DZRA 4IV3C 2C0ZA 1D4VB 2VOWA 1HIXA 3ETQA 1AR61 2D93A 3ZXFA 2GN7A 4HVQA 1BQPA 1F9KA 3W59A 3LA7A 4AG4A 1GICA 4AFAA 3QCWA 3VV1A 2PHTA 5BPXA 5CAZA 2HEYF 3AYDA 2WZR2 2GC2A 3M3EA 1H9WA 3VBRC 3J26N 1QY4A 2ZGUA 1EAH2 1JUIA 3J9SA 3CO2A 1UD1A 3BTAA 2G9FA 4IV1C 2ZHLA 2MEV2 4GH4B 2GNTA 2VOXA 2VNRA 4FQZA 2FMDA 2PAEA 3WW1A 2ZGRA 1BMV2 3PMSA 4GMP0 5FOBB 1RMU2 5E88A 4F8AA 2NMNA 1F5JA 4EROA 1C5IA 3OY8A 1AX2A 1HXS3 2HJIA 4LHLA 1YUDA 4AFCA 3V56A 1YYNA 4DFSA 4M00A 2Y26A 3AMQA 2ZHMA 1HRI2 2N7GA 4M0HA 4FO9A 2OPKA 1AR81 1MZFA 3V0AA 1MQTA 1X82A 1Q56A 2D43A 3HMYA 2ZTNA 2HEVF 1U5IA 3B9IA 1XU1A 5T5JA 1S1AA 3DN7A 2NLRA 5BNPA 5FPXA 1LESA 5A33B 4BWOA 2WS91 1KFXL 4WM8B 5IUQA 4YGBA 5JCTA 2YDEA 3D0JA 4IERA 1B09A 1Z78A 4GKXA 3VZMA 5GZGA 1CQ9A 1CVNA 1AYN2 3N7JA 3LAGA 4IV3B 5I0TA 3UK9A 4YZ3A 3SCGA 2B42B 5GLUA 4BM8A 2YY1A 5D1IA 1NCQA 4NWWA 1Q8QA 3IDBB 5GM0A 4LBQD 2WQ4A 2YROA 5FMOS 1O4ZA 3VKLA 2RR12 3AZWA 4BA6A 2AYHA 4QGLA 2FZ2A 3IMNA 4XIKA 3JBG2 3WUCA 5AC92 4GXLA 4K9SA 4NHMA 4LBLA 3WCRA 1AR91 4WVVA 4AGRA 2X53S 4LO5B 1H1AA 4BLIA 3ILFA 3ZN5A 1MR5A 1QKQA 5JZGC 5GLVA 2DCYA 2DTYA 1NQJA 3KCYA 3AZVA 2ZGLA 1O3QA 4QM8A 1OA3A 1PK6C 2BVVA 4YW3A 5ACA1 1G9AA 4Q8KA 1FMD1 5GLTA 5BNQA 2GDFA 2WA4A 1PVC3 1MQTC 1WA4A 4B8EA 1VAVA 4E2SA 2TBVA 5T52A 5BNPC 1IOAA 4A7KA 3J8F3 5I0RA 3NJZA 5C9AA 3RJRA 4WV8A 1SLAA 2HEWF 2B46X 2GALA 4Q4Y1 2BQPA 4JTOA 2ZX1A 1A6CA 2Q30A 3P3NA 1QH7A 1QJU3 1DF0A 1NCQC 2YPJA 2HWE1 4QQHA 3TAYA 1QXPA 4FPHA 1GV9A 4RFT0 4DXZA 1X7NA 1PZ9A 3VHNA 1OSGA 3ZXLA 2P3JA 3GF6A 3CJXA 4FPEA 1PGSA 1C8M1 5IK7A 1CAXA 4FTEA 4BZ4A 3I2DA 3VGIA 4UW4A 1KFUL 2PHDA 4XBQA 5BNNA 1FOD3 1GBGA 2XVGA 4I09A 3USUB 1EV13 3JB8A 3S7IA 2ZS6B 3OTFA 5JZGB 3UJOA 1I3HA 2VOKA 3WHUA 3ACLA 2HWC1 4AGVA 1LKNA 3ASIA 2DURA 5JOZA 1C1FA 4NVPA 4R4ZA 1PK6B 4JDOA 1RUOA 4FXGB 1BXHA 3MFAA 4CDUC 1UZZA 3TOJA 1ENQA 2ZMKA 2ZGQA 4AGGA 4TZDA 1KDKA 1AF9A 3EO6A 1HQNA 3IPVB 1PZ8A 4DQAA 1IS6A 4WM7C 2XH6A 1BVP1 2QZ2A 5FREA 5BNPB 2RS51 3H50A 4XF1A 2Z79A 1AR73 3VDDA 1RUE3 4YZ5A 5C4WC 1HXS2 5KHJA 5BNOA 2HWF3 4RQPB 5H9SA 1ENXA 3JD71 1RVF3 4PCRA 3LWCA 2JG8A 2MHFA 4I0WB 1UIKA 4IEXA 1S0DA 4N90A 2C1FA 2I2SA 4AHYA 1RUD3 4AVTA 2WNUB 4AFDA 4KWLA 4AEKA 2WSVA 3AKRA 3HR9A 5JOXA 3KT7A 2AENA 4OI2A 4ZU7A 2E6VA 5A3LA 4QX5A 1SLCA 2RJLA 4J6GA 3EBRA 5BNNC 3TYJA 2DVGA 1I9RA 3WW3A 1RUI1 4RGAA 1N1VA 4GWNA 1MZ5A 1AL22 1H8VA 1KXGA 3GYDA 4AQTA 4HSLA 4ASMB 4Z8BA 2XLFA 4D7SA 1C4RA 4Z2WA 4DMIA 4Q1PA 3ZSLA 2D5FA 3S7EA 1BEV1 1XYPA 3OD4A 1NZCA 2VOVA 3GHMA 4BQ1A 5CA6A 2GH2A 4LO6B 3LOIA 4P9IA 3ZFFB 4CDUB 4CEYA 4ZXKA 2JE9A 1V9U3 4AVAA 1H8TA 4YRDA 4F3JA 2PELA 4WM7B 1VRH3 4ONUA 4IEYA 3HT2A 1O3TA 4I30A 4XBNA 2FBEA 3T2TA 1XNDA 4BIOA 4COUA 4Y22A 2JG9A 5C4WB 5BNOC 2BVBA 3RYKA 4B7EA 2BUKA 3FJSA 4FOYA 3WDXA 2A7AA 3QD6A 3ZPYA 4UW5A 1QOSA 1LU2A 1LJ7A 1PVC2 1JXNA 1H4HA 1ZBE3 2SBAA 3FFZA 2ZZQA 4Q2FA 5L19A 1NCRC 3ZFGA 2MPFA 3J8F2 1KITA 1MS1A 3N36A 1Q8PA 1MEC1 2CYFA 1DGLA 2WA3A 2R041 2A70A 3ATGA 1YI9A 4AVCA 4EN0A 1WLWA 4AF9A 2BFUS 4XF3A 1AXZA 1LHWA 1QJU2 4V1PA 2WZPP 3ZSMA 5L7OB 1ZREA 1GFF2 1LGBA 1O3SA 1QJY1 4OUMA 1OFNA 2B45X 3JB4C 3IBMA 4Q0PA 3RMXA 1DZQA 1O5UA 1ZZ9A 3B7MA 4XMAA 5KHHA 4XQWA 1OOPC 5FQ0A 1X8EA 4JTNA 4RHV3 2IXLA 3H3ZA 5A32A 3HN1A 3GZUC 1UL9A 3NV2A 3VBSB 2DUOA 2YUEA 4HZFA 1H2LA 4E2QA 1DDLA 2EAKA 4GALA 2CV6A 5E89A 1ASJ3 1FOD2 1SFNA 2OUHA 4CEYC 3ZYPA 1EV12 1S0EA 3TN93 3KS7A 4F83A 5I93A 2FQPA 1JOJA 3DPRA 2QE3A 1QOTA 1C3HA 4CDXB 1LOGA 3AYEA 2YC0A 1SMVA 3B02A 1D4M1 3H7YA 5HI0A 3VBFC 3BODA 2WLQA 2GU9A 2P3KA 4BOWA 1UCXA 4N7UA 2R32A 1QHDA 4YG6A 1SBEA 2C5DA 2VVFA 1NCRB 4HL0A 4QM9A 5J09A 4WZFA 1AR72 1F31A 3ZSKA 2QCSB 1RUE2 3GALA 2RS31 4LBMA 5C8WA 2PAKA 2D98A 1PGL1 1OQEA 1H2MA 1VBB3 3UKTA 2HWF2 1YJLA 4QPIA 3JCIA 1RVF2 2MNGA 2BNOA 3IDEA 4N7IA 4ISRA 4XTPA 1PIV1 1RITA 4DNYA 1TNFA 2D5HA 5I0SA 2ZAAA 1DBNA 1A78A 1TMF1 2X8KA 2ZMNA 4FTSA 2ZAHA 2QDRA 3MIGA 2ARXA 2VVEA 2IXJA 3A0KA 1RUD2 2ZKNA 3PTYA 2ZHNA 4FTBA 2BYVE 2VULA 1OOPB 1WW6A 4AI2A 1ZZ6A 1APNA 3VUOA 3HD8B 1RINA 1Y43B 1COV1 4OHXA 1S2BA 4NHLA 1FT9A 1KS4A 2E51A 2EXKA 3VZLA 1ND3C 2XJQA 5DXDA 2WWSA 1JH5A 4P9LA 2DYCA 5HXVA 4Q4X3 3MF9A 4PLMA 3NKGA 4LBOA 3NWKA 1EYBA 3KT4A 3EXUA 2IXIA 4FOWA 2PHWA 1WGPA 2DVAA 4JGYA 4MX3A 3H1MA 3VBFB 2D44A 3WG1A 1REFA 4EN8B 1S0FA 1AR63 1V9U2 2VW0A 3U11A 2PTMA 1VRH2 3FLRA 3DGTA 3MPPG 1WMFA 3AZYA 4RR3C 3SISA 1CAVB 3IWZA 1HDKA 4C0BA 2GNDA 1SLIA 4PIZA 3IT8A 4XE9A 3ZSEA 2QZ3A 1RUNA 4YVSC 4QQLA 4KH9A 4O9GA 4EN6B 4YZ2A 1W6OB 5HBAA 2Y0OA 1ZBE2 4Q26A 4ASLA 1H2NA 1MVQA 2WQZC 2ZJCA 2B9UA 3WP6A 4K20A 3ZXKA 5FQ0B 1Y7BA 4N53B 1HLCA 1NG0A 2AGSA 3M70A 4ZU4A 3MDPA 3WY6A 1JUHA 4AQSA 3C2UA 4NOTA 2DFCA 2XJPA 3D0SA 4HVRA