4J6GA

Crystal structure of light and dcr3 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
139
Chain Sequence
VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCASTITHGLYKRTPRYPEELELLVSQQSPCGRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 139
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j6gA00
4DB5A 1JTZX 4OUMA 2HEWF 5TSWA 1PK6C 4KG8A 2TNFA 4N90A 1D4VB 1GR3A 4QPYA 2QE3A 2WNVB 2HEVF 4D7YA 1OQDA 3QBQA 4OUSA 4E4DX 2WNUA 2R6QA 3WD5A 3QD6A 2JG8A 4QQLA 1D0GA 4E4SA 4F3JA 2RJKA 3V56A 1IQAA 2WNUB 2JG9C 4TWTA 4MXWA 4NN0A 3B94A 4QQHA 4G3YC 1TNFA 2JG8B 1C3HA 2AZ5A 1D2QA 3FC0A 1C28A 4KGQA 5BNQA 5L36A 3TYJA 3L9JT 4MXWB 4EN0A 4QQPA 3URFA 4HT1T 1A8MA 1U5YA 2HEYF 4G4FA 2JG9A 3K51A 3K48A 4GIQA 2ZPXA 1XU2A 2R32A 1PK6A 1DU3D 3LKJA 1OQEA 2OIIA 4RSUA 2R30A 2Q1MA 3MI8A 4TSVA 4KGGA 3B93A 2WNVC 1PK6B 1DG6A 1RJ7A 2E7AA 1OSGA 1KXGA 2O0OA 1U5XA 3ALQA 2X29A 1O91A 2ZJCA 2WNUC 5L19A 2RE9A 2Q8OA 4DOUA 4QQ2A 1JH5A 1TNRA 1U5ZA 2JG8C 5HBAA 1XU1A 4OULA 3IT8A 4MSVA 3TWIA 2JG9B 5KC5A 1RJ8A 5KWRA 1S55A 1KD7A 2KA3A 3B9IA 4MXVA 2Z5WA 1I9RA 4J6GA 2QDNA 3ME2A 4QQOA 1ALYA 1WCKA 3AB0A 5CIRA 5KC6A 2RJLA 2TUNA 2WNVA
chains in the Genus database with same CATH superfamily
5F5QA 1IS5A 3DCQA 5EXOA 3OEBA 2HWF3 3DYPA 4W65A 5CNAA 1AR81 1L7RA 1LOAA 1LJ7A 3DKWA 1H2MA 1CQ9A 4IEYA 4M0HA 2RDRA 1UD1A 3C7OA 2P4EA 3IPVA 2QE3A 1TMF2 4IUGA 1E5SA 1IS4A 1MS8A 1UZYA 3K3NA 4QD2A 2A71A 2RS53 5FPBA 1PVXA 1O4ZA 4BB3A 1C5HA 1QJY2 4ZXEA 4YW7A 3UGGA 2J1AA 3GHNA 4MGKE 4XUPA 3NV1A 3AMMA 3ABZA 3E6DA 3IPVB 3KB5A 4JGZA 4UW5A 4Y20A 4CDQC 3I2JA 4TZDA 3RPQA 1YFWA 5FZIA 1DGWA 1AJKA 4MHUA 2XKOA 4RHV2 3D4KA 1H8VA 3F95A 3NRUA 2VAUA 4UFIA 4WM7C 4YGDA 4ZS2A 1WMEA 4LUKA 4A7KA 1ZBA3 5JPMB 2W39A 4RS5A 3LFIA 3CKHA 5T5OA 2J1SA 5FP3A 4CYDA 4JGZB 4DS0A 2D5FA 3CMGA 3HPNA 5L9RA 1WUVA 5J09A 1RMU2 1OH4A 2BVVA 5GZFA 1D2QA 3WQ7A 1KQRA 5C3SA 4NRMA 5FMOL 4OVEA 4WVVA 3OGVA 4GJZA 4KWKA 5FYCA 1G7YA 4FT8A 4RS5B 5GZDA 4IL7A 3S57A 2WSUA 4L0PA 4O9EA 4QDQA 5FBJA 5FTTC 2VU9A 1X9PA 3NV3A 4R4ZA 2HWE2 5IFPA 3ZFEA 1XU2A 5IVVA 2R32A 1VRH1 2IWGB 4FQZA 3UKTA 4GB31 1W2TA 4A7YA 5IVEA 3PTYA 2ZGMA 1OQEA 3C7GA 3D3AA 3ZSLA 4PI0A 5GM0A 2JDHA 1W06A 3TRSB 3THTA 3ZYBA 4O65A 4XJ9A 2XONA 4YW4A 2BV4A 2D44A 1W9FA 3RQ0A 5C5UA 3ZFEB 2GC1A 2V73A 4IXLA 4BU2A 4FXKB 3W5MA 3LEKA 1LOFC 4CDWA 1ENSA 3N9NA 4YG3A 1IHMA 1AYN2 2D3RA 5BNOC 2FDHA 1TME2 2Z69A 3RZLA 4LBMA 2QZ3A 1RYYA 3S7EA 2XBO1 3KF5A 5FAXA 4FPYA 5DMYA 4IEPA 5IVYA 4CDWB 2MHFA 4Q4X1 2Y64A 3ELNA 1OLRA 2WWUA 4JZRA 4MH0E 4MHRA 4QKDA 1O5LA 2XWBB 1K5MC 2QVSB 3WNMA 3Q9OA 4E4HA 1OLMA 4XF3A 4L11A 3D82A 5I8TA 1W8NA 4JTNA 4AFBA 2JG9B 2ZGRA 4BISA 5AC93 4FTSA 1JOJA 1X9TA 3LEMA 4HOOA 1Q8PA 3RYRA 3VL9A 1XNAA 4U2AA 3PUAA 2DTWA 3WW3A 3DV8A 4CEWA 4MOAA 4UW3A 1NX9A 2J1VA 1CAVA 2Z5WA 3MF9A 5BPXA 1POQA 3M2MA 5I0DA 1QJZA 3ZXDA 1CPMA 1I9RA 2Z42A 1ST8A 4ES9A 4Q29A 3U75A 3IDAA 4I3GA 4HONA 4D0QA 1G9BA 3MW3A 2ZS6B 1ND3C 3JBG3 1CAVB 4Z2AA 3KVAA 1RUH2 4JHTA 4HL0A 1ENXA 3MIBA 2TNFA 3M8LA 4INDA 3N4MA 3PUSA 2PLV1 1JZ7A 4YZ5A 4XBNA 2HBTA 4BMBA 5EFUA 4MUVA 1TVGA 4LA3A 1S2BA 4A45A 3WNLA 1M06G 1EUTA 2CAUA 1RTVA 1V00A 4R4XA 2VUDA 3DUIA 2R6QA 4EWAA 3TEYA 1H2NA 1PO21 1UYZA 2PHUA 2ARCA 2K2SA 3RVHA 3WD5A 3M3CA 4DXSA 4QT6A 1HRV1 3U4XA 5DAVA 2VVFA 3N9MA 1OLME 5CFDB 3TN93 2QQVA 4NRQA 2YDEA 3GGLA 5KXDA 3JB8A 1UU4A 3PL0A 4YZ3A 5FV3A 3WXPA 1KEXA 1NCQB 4R9CA 4XETA 3Q8AA 1GSLA 1FPN1 2JWPA 2MNGA 4PDWB 3NAPC 4Q4Y1 5HCAA 1QOSA 3APBA 3ILNA 1Q8VA 3T2OA 1NA1A 2Z79A 4OHZA 1KFUL 4AEJA 2Q1FA 4BIOA 2E7TA 3PNAA 4FPEA 5K7PA 4QQPA 2X05A 4BQXA 2RS31 5J7MA 4CCEA 1RUG3 2D6KA 5FLIA 3U10A 5ANNA 2EVXA 5T54A 2DVDA 2OX0A 4LO7A 1NA1B 5DG1A 2GMEA 3DEMA 4QPWA 3LD8A 4W8JA 3VBRA 3JD72 3MI8A 3I54A 3KCCA 5FZ8A 4UFHA 5JIUA 2WLPA 1VBA3 3J8F2 3MLLA 1JBCA 2ADDA 2J7MA 2Y38A 5FZ7A 3SHRA 5IK7A 2VE1A 1HV0A 2P3JA 2WABA 4AFMA 3AMQA 1QJEA 1V9U3 3KCXA 3EBRA 2YYOA 3VBSA 1YI9A 4YVSA 4B4QA 1IPKA 1KRIA 4P9GA 4IEZA 1K45A 1RUC1 1OOPA 3PUQA 4CP2A 3O5SA 5F6LB 1X7NA 2X29A 4XF1A 3RMXA 2HWC2 1J1TA 4FPHA 1F35A 4XFHA 1HX6A 1N1TA 2DFCA 5A3WA 3O1MA 1T6BX 3WUDA 4FOQA 2WO1A 4JKMA 2W68A 4YVSB 3S7IA 3TOJA 1S0JA 1SCRA 4BQ1A 5JAXA 2QQWA 4JGZC 4NROA 3VHOA 1OOPB 1OF4A 3I3BA 3PJQA 4JDNA 1Y7BA 1H6YA 3J9SA 4LEJA 5C8CA 2JICA 3NW4A 1Y4WA 3ZXKA 5FYBA 2IC1A 2W1SA 3R4UA 4WV8A 4FAHA 5CFCA 4PF1A 4D8MA 4RS5C 4XJWA 2P1BA 3RGBA 4TLGA 4H14A 4AG4A 1OT5A 1Q43A 1WD4A 3N36A 1SHWB 2XJPA 5C8CB 4IGPA 3EYPA 3WR0A 2B7YA 3LA7A 1VP6A 1R1A2 1D4M1 3ME2A 4IEWA 2ZAAA 3WF1A 1J1LA 4CDXA 5CIRA 2WZ8A 4E4ZA 2QQKA 1NE4A 4D7TA 4L97A 3LOIA 4M3CB 4GWMA 2FDFA 3MIEA 4BQWA 2VG9A 3ZFEC 4RFT0 2D3PA 5FY8A 3O7OA 5FZGA 2DCTA 2ZGOA 3OD4A 1F31A 2JDYA 1EAH3 3M3QA 4N90A 2WIIB 2R0FA 2VW0A 4QX2A 3VZNA 4FVVA 4CDXB 2P17A 4H3WA 5JSRA 1GBGA 4ARXA 3MGUA 4LIUA 1CAXA 2WA4A 4QHOA 1QJX1 4X8PA 1RUJ2 1YFXA 3NV4A 5FUIA 4CDWC 3KS7A 1HQWA 1PIV1 1X8EA 1VBB2 2C24A 2RS11 2UWBA 4LO8A 4MGQA 1ODNA 1PO13 1WD3A 1S4CA 4C1XA 1JYTA 2RV9A 4YPJA 1IOAA 1CAXB 2XHNA 3N9LA 1LGCA 3A0NA 3FFZA 4DUXA 2ZGLA 2BU9A 1JHJA 2JG9C 3WG4A 4JAAA 5A6YA 2WT1A 5FR3A 3TEWA 3BUCA 4XABA 5IAXA 1SLTA 4PIZA 3UT0A 3NWKA 4HMZA 1AR73 1GFF2 2VTXA 5BNQA 1W8ZA 3E5XA 1LECA 3BVCA 3PVNA 3WP4A 2VNVA 5IVCA 3BTXA 2WT2A 3D0SA 5EIYB 2BZDA 1A8MA 3O1RA 1ASJ3 1O59A 1CD3G 3QH7A 5M0TA 5HCBA 2ZOEB 2PTMA 4P9WA 4CUGA 3HBZA 3ZYPA 1DU3D 5DG2A 5FZCA 2W5FA 4LE3A 5A3MA 1YJLA 1W3XA 4EV0A 4F8AA 4NVPA 4FFFA 3WG3A 3AZVA 1ZZBA 1HLCA 1BBT3 2HWF2 4I0WB 1AUYA 5A1AA 2VXRA 4J25A 1LHUA 1GOFA 1U0AA 3K4ZA 4EN9B 4YM2A 4I09A 4A2UA 2P2KA 4Q8KA 3OD0A 4PQQA 3DYMA 2E26A 2RS52 2HYXA 3SCFA 4OQ9A 2XHKA 4UFKA 4X6RB 3I3EA 1KXGA 2YPDA 4YG0A 2ETEA 1HKDA 4ASLA 5F3CA 3FE5A 2I45A 4DXRA 5IK5A 1G8WA 1UYXA 2KD7A 4QX5A 3BODA 1WBLA 3VB9A 2VZ3A 3RSJA 2GNTA 3OJBA 4LITA 4Q4V3 3VKOA 1NCQC 2YPJA 3GBGA 3NKTA 2RE9A 4FOYA 3WQ1A 4UW6A 4RGKA 5E16A 3SISA 2VZQA 1ZBA2 1RUNA 2PXJA 4YGEA 3S5AA 2AUYA 1FOD1 3HAGA 1ZBE2 2VUJA 4XHBA 1UZZA 2BYVE 4LBOA 3BPSA 3C7FA 4LXLA 4AZZA 4EYUA 3O1UA 3O1PA 3ILFA 4CXWA 1R083 4AFAA 2R073 4PT6A 1TMF3 2YUEA 1HN1A 3FWEA 4YZ2A 1NAEA 1WBFA 3BGAA 3LCPA 3CLPA 1PGW2 1VBE3 3B5LB 4Q1PA 3OB8A 1NA1C 1UWWA 2DUQA 1S0BA 2QDNA 1D2SA 3FJSA 2OS2A 1VALA 2WFF1 1VPHA 4XEZA 2VUCA 2EA7A 2SLIA 1HB4A 5JOXA 3AMHA 2EALA 1XE0A 5A3NA 4NIGA 1W05A 4WVZA 2WNOA 3H0OA 1DLLA 5LB6A 4HN1A 3VBRC 3T3YA 4LO4B 5FP4A 3LEGA 1EPZA 1XNCA 4ET7A 4A42A 4LQRA 4OHYA 1XRUA 4LLOA 1HB1A 3IAQA 1AR93 2BBVA 4I3PA 3GYDA 3MFAA 3I2HA 4DNYA 3CJXA 5AFEA 1N1VA 2RR11 3VGIA 3FUQA 4FPJA 4YVSC 2BPA2 1WMFA 4N8MA 4BE3A 2HWE3 1OOPC 1QF3A 1STMA 2ENRA 1D0GA 3NMBA 2GN3A 3OCPA 2W46A 4CTEA 3E5UA 1Z7S3 3H42B 1CJDA 4PLOA 1H4GA 5D2AA 3POGA 3EJKA 2WKKA 2VNOA 1LCLA 2XR4A 4Z92B 4UFJA 2H6BA 3KV6A 5AC92 3ON7A 3ZXLA 3R4DB 3B01A 1Q8OA 2AH2A 5JXGA 1IPSA 4AI3A 1UY4A 2YU2A 3HWJA 5C8CC 1FMD3 4OMDA 4FP2A 1AYN3 2VZ1A 3HVDA 1AX1A 4CXXA 1U5IA 4G4FA 1NT0A 3CO2A 5JI9A 2PHLA 4L99A 3CBNA 3K48A 1UKRA 2CGOA 3AYDA 1QU0A 4A6OA 4CU9A 4NIHA 5K0UB 5F6KA 2UU8A 5LY2A 3JBG2 5BNPA 1W2UA 1X8MA 3IIAA 4CDXC 5ACA3 4YW6A 4OI4A 4YW3A 4NAMA 3POFA 4COWA 2B9VA 3IWZA 4LBLA 1UO9A 5CFCC 2JDKA 4UWDA 3U11A 4CCDA 1QJFA 4QXBA 3TEXA 1BMV1 2DTYA 1YEWA 1MQTB 5BNPB 2DDUA 3VBHA 3HQXA 2BW8A 1HXS3 5J37A 1U5XA 4QB2A 2AC1A 3OBAA 4N7UA 3K4DA 1ZNPA 1CN1A 3I2IA 1QGLA 3KT7A 4BCUA 1MZEA 2E63A 2BOJA 1JMUB 3MV11 5FFOC 3UYJA 3VBHB 5T5LA 5FP8A 3TN92 5C8WA 4PCRA 5CYYA 1W0NA 1MZFA 4A7ZA 1DGWX 4SLIA 3OSDA 1U5ZA 2JE9A 2VMDA 1RUH3 1C4RA 4BXFA 2O8QA 5LY1A 1REEA 2D6NA 2W0XA 2VMHA 3K46A 3OBRA 3PU3A 4C90A 4XUNA 4ZU7A 3UNPA 5KWRA 4IETA 4UYBA 1H1AA 5AVPA 3WCSA 1YQ8A 1AXYA 4MXVA 2RM21 3OGGA 2LM3A 2VVEA 3FN9A 4FPCA 3KCYA 3ZDSA 1RUG2 5FYTA 1RUF3 4ATEA 1JUHA 4LKFA 3OTFA 2C5DA 2H0BA 4XACA 4S2FA 4BQ3A 3MIGA 4CSWA 3H1WA 5EP9A 1NYWA 3AB0A 2WL1A 4AVTA 4FTBA 2FCTA 3B7MA 1NY72 4XQDA 3RZZA 1PVC1 1GQGA 1IKPA 3Q8BA 5EJ3A 5A6XA 3AJYA 3N7MA 4K20A 4OUMA 5TSWA 3SKJE 3T1MA 4CDQB 2QDRA 5C7GA 3OEAA 5J96B 1CPNA 1PNFA 3NQHA 3KLSA 5DZEA 4ASMB 1VBA2 3FFQA 3RFRA 3UJQA 1LESA 2YBPA 3I49A 1ULOA 1V9U2 1W9SA 4R9DA 2MPFA 4XAEA 3BYWA 3VD5A 4GMP1 4NOTA 1GMMA 1VRBA 2B4KA 3WX5A 2UY9A 1XYNA 5JDBA 3DXTA 1SLBA 1GP5A 1O7FA 5FYSA 1W39A 3AYAA 1UZ0A 2A70A 3WV6A 4Z2WA 4P9YA 2P3KA 2OQ6A 4NR1A 3UK9A 3VL8A 4FTEA 1UN1A 2D97A 4ONUA 4NPMA 1F8VA 3J7LA 3BU7A 4CP1A 4AHWA 2KR2A 5GKAC 5JOWA 3KQRA 1VLNA 4B4PA 1SPPA 2J42A 2QQNA 1DGRA 3PIJA 2XMLA 2E9QA 2GC2A 4JDOA 4QPIA 2LUWA 3OPZA 4QKNA 3M3IA 1H1MA 2ZACA 3LDKA 4CE8A 1JU3A 5FY0A 3J8F3 2YC4A 3I2OA 4GD4A 1E5RA 3FC0A 4N43A 5ISLA 2BGPA 2ZBJA 4YFZA 2HH9A 3H3LA 3RYKA 1Z0HA 2IFRA 4P9JA 4B7EA 3ZPOA 1LB2A 2EXJA 1TE1B 5HI0A 5BNOB 1VAVA 3KMHA 2OZJA 3T4HB 2ADEA 1WW4A 3PVOA 4N43B 2ERFA 1O3SA 2IXJA 5LWBA 4B1LA 1ZRCA 4QX0A 3ZXFA 4KG0A 1XYOA 3R0RA 1KFXL 4LPLA 4C0HA 4CZSA 2CGPA 1EAH2 2HWD1 4AQTA 2IVIB 2NQYA 4NWWA 1JYNA 4EWEA 4QGNA 5FO7B 4ASKA 3I8TA 4IEOA 5FY4A 3VZLA 2C9KA 2EIGA 4P9XA 3WP3A 3ALQA 1H4HA 1SBDA 3MPPG 4I01A 3X29B 4AW7A 1CONA 4HETA 5FYYA 4GMP0 5E1RA 3UV9A 3CL1A 4QM8A 3LB9A 1PO12 4HVQA 4QX1A 2PHTA 1QQP1 1R1A3 5FP9A 5FYHA 3RNSA 4DEVA 5CG9A 2BWCA 3I2GA 3I59A 2QJVA 2VOWA 4GXLA 2Q8OA 1GZWA 2VULA 3VHRA 2D93A 3KGZA 5KHJA 4LUMA 4ZU4A 2X10A 3MUZ1 1RUE1 1RUI3 3C7EA 2PA7A 2XLFA 4CCLA 1AR72 3GZUC 4Q2FA 3ZLIA 3I59B 1GZWB 1UPSA 2NMNA 3A7QA 3L2HA 1ASJ2 3KSCA 1TZOA 4XAAA 4XMIA 2HWC1 1DZQA 4H2AA 5K0UC 5HXMA 3H8UA 2D6LX 3P1IA 4B1MA 3LIHA 4TYSA 1WCKA 4DO0A 3U07A 3K2OA 2DCJA 2TUNA 4ISQA 3KGLA 3J7MA 1FV2A 1W6PA 1ZM1A 1BBT2 4JRAA 4YWAA 3ZXEA 4ZHNA 1F4AA 2WQ8A 5B4NA 4ISRA 5FZOA 1MQTC 5BNPC 1WCUA 1AR83 4QAWA 2ZGTA 1G9DA 2Y0IA 3G6JB 4FXGB 3BTZA 1DDLA 3KWVA 1LENA 3AKPA 3U78A 1W6PB 4XXPA 4AE2A 2N7GA 3NAPB 3VDDA 2YGMA 5FZOB 3VBHC 2OPWA 4GWJA 1TQ5A 3VZJA 4EN7B 4UT5A 2JDPA 2RDQA 1R091 4A6SA 4AGRA 1P8JA 1COV3 1W3VA 2DWRA 4KBZA 4LK7A 4Q4V2 3T08A 3WDUA 4KL1A 1FYUA 1YNAA 2ZX2A 1V6LA 2CWSA 2EXIA 4XIOA 5HCHA 2YMZA 3VDDB 3U14A 3ZO0B 1LGNA 2BFUS 5KXCA 2VMFA 1DGRN 4DEQA 1H1IA 1WLTA 2GDFA 3ETPA 3H1MA 5F9TA 2YC0A 2XH6A 4G3YC 2VCCA 3MUY1 4LIVA 2EXHA 5FZ1A 3USUA 5I91A 1EUUA 4E27A 3USSA 1U12A 1R082 1QDCA 4QPGB 2AYHA 2R072 3WEZA 1AR62 3J7HA 4IE7A 3AX4A 3I2FA 3WQBA 4PF5A 2ZCWA 1VBE2 1DCSA 1DLCA 1LU2A 3GZEA 4K1ZA 3W58A 1Y9QA 1OVPA 1YCIA 2IXKA 2LRPA 5FK8A 3USUB 4Z8BA 2EAAA 5H9QA 5C5TA 4QXCA 3MLJA 4UOJA 1LOCA 1VRH3 2PHRA 4MZUA 4GB33 5CZKA 1QXRA 3M3OA 4MGSA 4RQPA 2P37A 5I0RA 3O1VA 4QMAA 2VZSA 3ATGA 5FJKA 3UESA 1QJU1 1Z78A 1DYKA 2VZVA 2XXZA 5BV6A 1O3RA 5FZFA 4K6BA 4Y20B 3B3QE 3UETA 1ZBE3 3ZFFA 1B35A 1GICA 2CHHA 2JKBA 3CIHA 4RQPB 4XDOA 1AR92 1PGL2 4V1PA 1SLAA 2E6VA 2DVFA 4QU1A 4YGCA 1UAIA 2BJSA 3H8OA 1OFNA 1VBC1 1O91A 2YFUA 1SLLA 5JVVA 3ZFFB 1J59A 3BIEA 3I7DA 2G1MA 5GLTA 1HJFA 1B35B 5KBFA 1W6MA 4HKLA 4PIYA 4Q4X3 4M00A 1Z7S2 4LBKA 3WVJA 4LMFA 2HWF1 5EJ1B 3WG1A 1K3IA 4CP9A 3WNXA 5HBAA 1ONAA 1C57A 1CZSA 3NVCA 4LBQA 3WW1A 1GOHA 3RRDA 2ZHNA 4TTGA 2BOIA 3NNJA 4AWDA 5KXBA 1W6MB 1NLRA 1RITA 2RS51 2A6ZA 2WS92 1AL21 1ZRDA 2KA3A 2WZR1 4QPIC 3BTAA 3B9IA 5LEJA 2FZ2A 1X50A 1FMD2 4CP9B 3UJOA 3I2KA 5FJHA 1FNZA 1UXXX 4N43C 1FT9A 2W52A 4UF0A 3I97A 4NHLA 2GMPA 2A7AA 4QQOA 4GQ7A 1EV12 3MBWA 3R4SA 2ID4A 2ZMLA 3LA3A 3FL7A 4COZA 4M0NA 1N1SA 3EXUA 3K4AA 3ZOIA 5ACA2 3ACGA 4UF0B 5L9BA 2FZ1A 3HJRA 5EPAA 3T2TA 1RGSA 2QQJA 2CY6A 2PLV3 4D6SA 1UZWA 2CWMA 2VQTA 1LHOA 2YB7A 3OUIA 4MGZE 4W50A 1I1EA 1V6KA 1HXS2 1G9AA 1QXPA 1AXZA 4OUSA 4KU7A 2XL7A 4WZFA 5JOZA 2TBVA 1PO23 2HKXA 3LEIA 5J48A 2WWSA 5CKQA 3RZKA 2FBEA 4AVVA 2JG8A 1ZREA 1HRV3 4V2WA 1WW5A 4CEWB 2RJKA 1FV3A 3U1XA 5JOYA 3HQUA 2XB6C 5LA2A 1L7QA 2D3SA 3W5NA 4I2OA 4BQ2A 3SCGA 2JG8B 4XE9A 1FPN3 1VMJA 1JYVA 5FZKA 4Q4Y3 5FZ0A 4Q4W1 4QWNA 3QACA 1H9PA 1PNGA 3TB0A 1OUXA 2KM2A 1NQDA 1N3QA 1RUF2 2BNMA 1NCRA 1NZCA 2BNOA 1EY2A 4J1WA 4Q8LA 1LEMA 4L2NA 2ZMKA 3THDA 5C9AA 3WDTA 2Y8KA 3ZN6A 1H9WA 4AL9A 5FP7A 2DV9A 2YBKA 3RG0A 4BXSV 3H50A 2R30A 4X8NA 1N1YA 1NCRB 2IZWA 3VUOA 4BLJA 2J1UA 3THCA 1ZX5A 3B93A 4XVHA 5C9AB 4H7MA 2DF7A 3ZN6B 3GJAA 4BWOA 3FMGA 1UOGA 2AREA 1GLHA 1I3HA 5JR2A 2B39A 3BN6A 4AVSA 1GNYA 4YNIA 5DQ0A 3ZN5A 2UWCA 1LHVA 1SFNA 4FPOB 1JOPA 2DVBA 1WMDA 3ECQA 4UFMA 5EV7A 2F4LA 4BM8A 3D0JA 1O8PA 2F4PA 3VDDC 3HQRA 3FBMA 3FHAA 3T4VA 4B29A 2NM1A 4LR4A 1BHGA 2R061 3DECA 5GZCA 2K46A 4C0BA 2A1XA 4LA2A 5FYUA 3VDBA 2GC3A 3LF7A 5DDJ3 4P9LA 1ULDA 1IG0A 1JS9A 2OKXA 4QPGC 3MICA 2VL4A 2YGLA 2QKDA 2W47A 1I5ZA 3VV1A 5FO8B 4LNVA 1FNYA 3VBRB 2UWAA 4RGGA 5ERLA 3WHTA 2RMU1 1WCSA 2BTVC 5FYVA 5GLWA 1AYM1 3ZMOA 1LRHA 3PLQA 1B09A 1UOFA 1ZZCA 2VW2A 4B3NA 2WAAA 1YFUA 3TN91 2I07B 4H7LA 1D4M3 2ARXA 3CHXA 2R041 2RJLA 3VBSB 1MR5A 4ATFA 3JQXA 5LASA 4HANA 4L92A 4GAZA 2Y6LA 2YG0A 2UYBA 3S0MA 3KVBA 1BYHA 1NQJA 4RQPC 1LOBA 4BK4A 3LWCA 3U37A 2NMOA 3VBFA 1RHI3 4Q0UA 3JXSA 1QOOA 1UY0A 2V4AA 1MS4A 3W59A 4D7SA 5ABJA 1RUG1 4PLNA 1MEC1 1NG0A 4JV4A 1V6IA 1W0PA 1ZA7A 3PTRB 5LBBA 3ZFFC 3ZDVA 1B35C 2DBNA 1S2KA 4XOGA 3QH6A 1PGSA 3LPFA 3QLQA 2WBKA 3LOBA 1YRZA 5CFCB 3VBFB 3ZYJB 4NO4A 4QQLA 1GANA 4B8EA 4AR2A 2A6VA 4K3UA 1OURA 5KHIA 2QQPA 3NJZA 1VBA1 4ES8A 1R1ZA 1TNFA 1RUI2 1ULEA 3B69A 5GLVA 3ITQA 5D1IA 2BGOA 4KGQA 1BEV1 4XJAA 4Y1XA 3TYJA 3LDBA 4NWVA 5FKBA 5JMOA 1PMJX 4P5HA 2VM9A 1HDKA 2RVAA 1YXWA 4ORFA 4XZUG 5IATA 2QQOA 2A6XA 4NAOA 5IVJA 4YGBA 3ZSKA 5I0SA 1W9TA 3BIWE 4XF9A 3JUUA 4H55A 4XBLA 1S0CA 3VZKA 1WLCA 1PM7A 1VIWB 4AEDA 4XFIA 3AP5A 4ZKTB 3ZXJA 1FX5A 4QX3A 3O0XA 1RUD1 1AR82 3AZYA 3O14A 4NHXA 2CDPA 1JYIA 1MZ5A 4MYEA 4AI1A 1DFQA 1VBD1 1RVF1 2FDJA 4DMIA 1HW5A 2DURA 3IN9A 1QY4A 4FCAA 1NXMA 2O0OA 2EIEA 3LZZA 1J84A 2VECA 3MIFA 4HLTA 3B02A 2Q8EA 5A80A 3RZGA 2ORZA 4TN7A 5JUVA 4CUCA 3VBUA 4QX8A 4E8CA 1COV2 2LTNA 4CEWC 4XF0A 1SQ4A 2XVLA 4CCNA 5DUXA 5DUVA 4RL7A 1NZIA 3AKRA 4DOUA 1JH5A 1TNRA 1PX3A 1S0DA 2JG8C 2JENA 3E5QA 3PJYA 5F3EA 2W1UA 3VBUB 1APNA 2ZABA 3C8XA 3TWIA 3ASIA 4Q5OA 1UMHA 2MEV3 4Y5SA 2ZAHA 2YXSA 1YQ6A 2Y0OA 5A3LA 3I3QA 1XYPA 3ROUA 4K21A 2FDIA 4D69A 2ZGSA 4FFGA 1YLLA 1WW7A 3SH5A 2VY0A 3VD7A 4BDVB 1A78A 2HYKA 4J6GA 1GOGA 4QKBA 5I93A 4LO6B 4IQPA 4GWIA 2F6BA 1ALYA 2WINB 5LRRA 1VRH2 4K1YA 1NCRC 2WJSA 4GB32 2WFF3 2ZHLA 3HMYA 2WNVA 1IPJA 4QB1A 1Q56A 1QKQA 1V6NA 4HBNA 4LHLA 5C9AC 4AVBA 3DXUA 3OUHA 4ITCA 2OW4A 2ZX3A 1UYPA 4QKFA 3U0ZA 2GC0A 4N53A 5D8AA 2ZKNA 1D4VB 1LOGA 5A3UA 1AR71 1Q8SA 5HPOA 3LGRA 4YZ4A 2D98A 2VOVA 2XJQA 2CYFA 4NE9A 5LBEA 1DHKB 2WNVB 1O3QA 3AKSA 2WN2A 1AR63 4JCKA 4BA6A 1ZA4A 2G4IA 4N53B 5D8AB 4IESA 2B5HA 3ZX7A 2G9FA 2XBO2 3W20A 1IKQA 2GN7A 1ZZ8A 2RR13 2OXBA 3CEWA 3WDWA 1SFYA 4P08A 1QNYA 2XJVA 1E57A 1F4HA 2Q1ZB 4Q4X2 4AHXA 1OD3A 4URAA 3VHPA 4IV1A 1UY2A 4W6XA 5G04L 3MEPA 5FZ9A 2OA2A 1W0OA 4Y1UA 5FYIA 2BFUL 5IW0A 1SLIA 2W9XA 1HRI1 4OUEA 4N7IA 2V4VA 4FAGA 1H0BA 4FO9A 4GZ9A 1IG3A 5F7UA 2BRTA 5L36A 3N35A 3POWA 5FMBA 3ZFGA 5JSOA 1X33A 4IV1B 3ZIWA 2XLAA 5C6CA 2AEYA 1Y9MA 5C3QA 4BPZA 1OVSA 1T2XA 1SDWA 5AFBA 1NLSA 3VBSC 1REFA 4Q4V1 2G19A 3R05A 4FBFA 1MS1A 4XJUA 4XFFA 4PBPA 1JI6A 1VE0A 2E7QA 3GM8A 1X82A 3M1HA 3AZXA 3ZFGB 4BLIA 2VCBA 4IDZA 4O7XA 2JD9A 4XTMA 2ZX1A 2Y6FA 4RD7A 4SBVA 3O1TA 2HWB3 2UY8A 1A3KA 2VNGA 3LA2A 4KWJA 3T0BA 4COUA 3EO6A 2PLV2 2FMYA 2WC2A 3VD9A 1XSRA 4XJZA 1TMF1 4FPLA 4XHXA 4XQWA 2XWJB 3JZVA 2WS93 1VBE1 1POV1 1QNWA 3MPBA 1BZWA 1QJY1 3BPZA 5T55A 1C8M3 4FFHA 3HD8B 2V09A 2W94A 4WBBA 5FKCA 1A8DA 1XJAA 3VBFC 4HKWA 4IERA 3IKWA 3ZKYA 4A44A 1PO22 1DBNA 3GBFA 3GDBA 1NLQA 3BTYA 1H6XA 3WF4A 3GALA 4P9IA 2LROA 2VMEA 1GUIA 3AP6A 1HRV2 1HB2A 3VN4A 1EV13 4RHV1 4K7JA 3S5QA 3I3MA 3WNNA 4D94A 4KQ7A 1JYXA 1QEXA 2XDVA 1JOBA 1CX4A 1CZVA 1XU1A 5DPNA 3N7LA 5T52A 1RMU1 3U4SA 5C3RA 3T0DA 5K9YA 5FREA 1FPN2 3O12A 3SXWA 3SKVA 2C26A 2H6CA 3MLKA 1W8UA 4K9SA 2DU1A 4Q4Y2 3L2YA 3WCRA 4NIDA 4KU8A 3WW2A 1LAJA 1SG3A 5CKMA 2JIJA 2RM23 2B45X 2Y6HA 1UOBA 3ZSJA 1OI6A 2HWE1 4FSJA 3ZIXA 4ZS3A 3FX3A 3VD4A 5JSPA 3HR9A 4MX3A 1Z7S1 3SNMA 3FZ3A 3NNFA 3ZYFA 4AQ6A 1YJKA 1SEFA 5C70A 1PVC3 1JTZX 2BUKA 3VDCA 3RI8A 3WDYA 5F1RA 4WM8A 2ZHMA 4C91A 1DQ6A 3J7NA 1OLQA 3HEIA 4AEDC 4PIXA 3GJBA 4IGQA 3JCIA 3TNPB 1WA4A 1XXNA 4Q26A 1AYN1 2GH2A 2A73B 1TME1 3ACIA 4NMIA 4WM8B 4GMP3 3VD3A 1JZ2A 3AVRA 2JDMA 5GJ6A 5F32A 4AI9A 1GWMA 2AR6A 4UW4A 4JX0A 1WA6X 4XFBA 2Y6JA 2Z2SB 3WNOA 1O5UA 2W92A 4Y33A 3RYPA 3WT3A 2R7EB 3V0AA 3VBUC 3H8RA 3V56A 1IQAA 2FCVA 3ETQA 2W91A 3B94A 4MGTA 5DDJ2 4A4AA 2VZRA 2PQSA 3IMNA 3D6EA 4K8RB 4QXKA 4RR3A 5FXWA 5T5PA 3SH4A 1UQXA 2I74A 5FDBA 4Y4YA 5IUQA 1OPOA 2HBUA 1QMJA 5F8PA 3V0AB 4QX7A 1GWKA 4LULA 2GSYA 5J3UA 1VMHA 3URFA 1U5YA 4MLOA 3BALA 2PHXA 2RJ2A 2ZX4A 3AP7A 4HSJA 1MPXA 5FY9A 2O1QA 2JD4A 3PIGA 1PK6A 1D4M2 3ZM8A 3RZMA 1K42A 2PFWA 2L9LA 1W03A 3K77A 1NXD1 1Y3TA 1RUH1 2D6MA 3N9QA 5CA6A 3HT2A 4J1XA 5A7NA 4XIKA 1Y43B 3ZMNA 4A41A 5IWFA 2WNVC 4N9IA 4LOSA 3ST7A 2OT7A 1PK6B 3WY6A 1GQHA 1GKBA 4P5YA 1PHMA 2FMDA 1ULCA 1RHI2 1F2NA 1S1AA 2JEMA 3VBOA 1F15A 4N53C 5D8AC 1RXGA 4YVWA 2VZOA 1RUOA 1SPPB 1RUF1 1YFYA 5F3GA 1PMHX 3DYOA 4I0AA 3NSTA 1VR3A 5FPLA 3UKVA 4QPIB 2NP0A 4U36A 3LPGA 5LK5A 3K3OA 3VBOB 1MZ6A 2WNEA 1MACA 2WYSA 4YVWB 5DABA 4I30A 1F9KA 4CDUA 4I0BA 2DCZA 3JQWA 4MO3M 3ILRA 4OZXA 5A3OA 4BQ5A 5SV8A 3ACHA 3MIDA 2P5BA 3AMPA 1AZDA 2A5ZA 4UFLA 5LZ6A 4PLMA 4DXZA 3R6SA 5HCFA 5BNNA 4MG2A 1A6CA 3Q8EA 4IV1C 4CDUB 3A21A 1VJ2A 2VO5A 3AL6A 1AXKA 4RYDA 4AGGA 2PN5A 4Y4RA 1OH3A 1NE6A 2YFZA 1Y9GA 3BOWA 2PHFA 4QHZA 5FLJA 1C5IA 2VTXJ 5BNNB 1W6QA 4ZXKA 3ZFGC 3AKTA 3WINE 4W6WA 5IK4A 5JIAA 4Y24A 5I0UA 3AC0A 4AFDA 5LW9A 1J3PA 2EIDA 3MF6A 5KC6A 3RJRA 3D5OA 1W8WA 4X6QB 3JD71 3MO4A 4OQ8A 5IVFA 4IE4A 4QB6A 2GP3A 4KG8A 3KHBA 5FZ3A 4KH9A 3IIIA 4XDQA 1XNBA 1W6QB 4Z07A 4CU7A 3J8F1 5K8SA 2C9AA 4QPYA 4NIIA 3ZR6A 2SBAA 5F5IA 2PELA 3MW4A 3RWKX 3I3DA 3VLBB 4BQYA 1YQCA 2QUOA 2ZGQA 4CPBD 2E51A 4UXAA 2HJIA 2ZHKA 5A7OA 3SMHA 2VGDA 5CVRA 3WDVA 4AEKA 4COYA 4E8DA 2HEVF 2ZZJA 2BERA 2WNUA 4R8HA 2XLGA 3WP5A 1OF3A 1ULGA 5CKNA 2AENA 2J1RA 3NO8A 5SV5A 3RJ2X 3BCWA 1QDOA 2OVUA 4XFGA 1R093 1S0IA 4IEQA 4CPBA 2ES3A 2WNUB 4IV3A 3ZR5A 4LJHA 4HK9A 1W8TA 2JB8A 3GHMA 3WG2A 2IXHA 3FLTA 3BU0A 5DAQA 3W21A 1FOD2 2MEV2 3OBZA 3VKNA 3KT4A 1C3HA 3E6CC 5FXXA 3BI3A 5LCWL 3FBYA 5EZWA 1JW6A 2VH9A 1IS6A 3O0WA 4Q0SA 4IV3B 1FAYA 3FLRA 4EN0A 4JQTA 4YW2A 1KITA 1H30A 4FPGA 5A33A 3VDAA 2ORXA 4Y1YA 3O1OA 3IM0A 5FY7A 3IDCB 1R1A1 2QQIA 2NYYA 2A3YA 1ULPA 5CEHA 1ENRA 1YI7A 3M4FA 4ZY9A 4D3WA 2WFF2 1SDDB 2CV6A 4OI2A 4GALA 4XBQA 4XW3A 4Z82A 4RSUA 5HV4A 3IDBB 5A33B 4HXCA 2AACA 1CIYA 2BNNA 4MADA 1HQLA 1W6NA 1DZRA 5CG8A 1QJU3 2JIGA 1JU4A 4M4PA 3ZVXA 1ZVFA 3F2ZA 1JYCA 5JXHA 1GYKA 2CU5A 4WM8C 2ZGPA 4IGOA 3T2QA 1XBFA 3E1F1 1TG7A 4JTOA 5IFTA 5DUUA 4K40A 4HN0A 5A7SA 2CDOA 2DBIA 1RUJ1 1LULA 4XFAA 5LA0A 4LKDA 2R1DA 1W6NB 4CU8A 3N9PA 2JDUA 3MZHA 4QXHA 4TXWA 1VBB1 2VZTA 2X5IA 5EYYA 2BWAA 2NZ9A 4LHKA 4WZCA 2RR12 4Y1ZA 1JZ3A 2ZJCA 4AQSA 1DGLA 4Y26A 1OXCA 5L19A 2WWJA 5IAVA 2Y33A 3UKNA 4LKSA 4N9HA 2D5HA 4XJ8A 1KJLA 5FZEA 3B00A 2X5IB 1ULFA 5IT6A 2WDBA 1WW6A 5KC5A 3PUIA 4UBGA 4AVCA 5CU1A 4CA9A 3LE0A 3POEA 3VKMA 1YO8A 4W4ZA 1KD7A 2OQ7A 1AL23 4MGIE 2WZR3 4RR3C 2P34A 1US2A 2VNRA 2HLEA 3I4IA 2RDNA 5LBFA 4Y22A 4META 1BQPA 1QOTA 4C1WA 2WAOA 4Z1VA 3S6PA 2PHDA 1COV1 3T1LA 4ZZ5A 2XBO3 4LBQD 4HVOA 2X53S 1KS4A 1MVQA 5F39A 3PUHA 2O14A 1DP0A 1OA2A 2ZZQA 3DPRA 5F5AA 4O9GA 4Y22B 3WUCA 2HWB2 1PK6C 3HN3A 2QNKA 1I5PA 1JZ8A 1SBFA 1W2AX 2XL9A 3J26N 5FZDA 2P3IA 4XUTA 4Y3OA 1OBNA 3N7JA 2ARBA 4AQ2A 4NPRA 4LE4A 5FMDA 1BMV2 2WQ4A 5B2GB 3DPRB 1EYBA 1OMIA 4XDPA 3DF0A 1G6NA 5H9RA 4AGVA 1DQ4A 1C8M2 2W87A 2VQ0A 3JU9A 4OFGA 3VBOC 2VXJA 1BXHA 5F2WA 1GQPA 4YVWC 4LBQB 1UW8A 4FPKA 1OA4A 2JJ6A 2VQUA 2WA3A 4RGAA 5FUNA 2FDGA 5JLVA 3ZYGA 5G05L 1J58A 1Q3EA 4JKKA 4LT5A 4CVUA 1UKGA 2VBBA 2C1FA 1OA3A 2LALA 1ZBA1 4QQHA 3OPWA 1C8NA 1SLCA 3A4UA 3PVEA 1CJPA 2XVGA 4OHWA 5DAWA 1ZBE1 4CUBA 4YRDA 4CDUC 3THPA 2BQPA 1WWYA 3H9AA 4HK8A 3KV5A 1KDKA 5JPNB 4DFSA 4NIAA 2B42B 1GP4A 5L7OA 3UGFA 5KHKA 1SCSA 2FQPA 1ZRFA 2RM22 1PGW1 4Q4W3 4BJ0A 5BNNC 3BKZA 1XQNA 4Q0VA 3WP6A 1SMVA 2W1QA 1JZ5A 2ZGKA 2JG9A 3K51A 4GULA 2Q8CA 4AI2A 4GIQA 3J4UH 2ZEYA 1FATA 4QDRA 5FOJB 1GP6A 5L7OB 3LKJA 2BBAA 1PVC2 3LSDA 2OIIA 3VZOA 3AFKA 4LKEA 2J1EA 2ZKLA 3POSA 2FDKA 4G9SB 4TSVA 5C4WA 1W9YA 4OMCA 4KWUA 3TNQA 3WNKA 3ZKUA 3MW2A 4QGLA 3SH3A 3POBA 5GLUA 1HQNA 2WYFA 5KXEA 1BKZA 1DQ0A 1IS3A 4HG6B 2XJTA 3H7YA 4Q0PA 4ZONA 2A3XA 2G9GA 2GNMA 1X36A 5A3PA 3GF6A 1UX6A 4IE5A 2PMWB 4BMEA 5D21A 3AL5A 5C4WB 2R0HA 3HOBA 2OPKA 2GNDA 5AVAA 1CESA 2RS33 5DZFA 3ACFA 2QTWB 2YROA 1WCDJ 1XC6A 1UY1A 2WNUC 1W8HA 3W9AA 4FOVA 2IVJA 3E6BA 4JC1A 4AAPA 2YBSA 2Q4SA 2R063 4WVWA 5E89A 5JCTA 1WCQA 3WSOA 1O4TA 4QQ2A 1L3JA 5JXIA 3POJA 1C1LA 3WW4A 4ZPIA 3M3EA 5AC91 1OHFA 1XE7A 1BK0A 2NN8A 2NPIA 3AJZA 2VOKA 4GH4A 4XILA 3SCHA 3V65A 4DUWA 5FZMA 1DQ5A 3OGRA 2DUOA 4IV3C 4Q27A 2ET7A 1JODA 3M70A 2C4XA 5FY5A 5F37A 3AYEA 1DQ1A 1W8OA 2VBPA 1V0AA 1ZRIA 5CFDA 5FO9B 1Q8QA 3AKQA 4YLZA 3BOPA 2FCUA 2WZPP 5FMCA 3WF0A 5BYNA 5IVBA 2ATFA 3RMYA 4JKLA 4OHXA 5EWSA 2RMU3 4Y1VA 1NCQA 4GH4B 5JZGA 5L73A 1RUC3 1AYM3 2GAUA 5FCCA 2UURA 1WLDA 3P3PA 4PDWA 2XPJA 2W2IA 1V6OA 5FPUA 2J1TA 2VQAA 3JBG1 3OBTA 4HZFA 3NKGA 4DB5A 2R043 3FUOA 5CISA 2P6CA 5JZGB 3G7DA 4PBOA 1A34A 5BUVA 2HWD2 1BCXA 2UYAA 4GKXA 4GWNA 1WMXA 4LTAA 1NUKA 2Y60A 3BB6A 4XCBA 2WSVA 2QCSB 2J22A 3ES4A 4FQ4A 3ACLA 3ZSMA 1JYWA 1LKNA 1MVEA 3DL3A 2B9UA 3EMRA 3WF3A 4D7YA 1R64A 1LHNA 1MEC3 2Y34A 1ENQA 2YHJA 5FY1A 2OYZA 2ZX0A 4OYUA 4YZ1A 3OGSA 2ZEWA 4Q1RA 1MS3A 1UZVA 1QQP2 1TEIA 3GZAA 3RI9A 2X5IC 4ARYA 5FPXA 4MXWA 3C3VA 2GH8A 3GBWA 5A1FA 1OKQA 3PHMA 1LGBA 3PU8A 1RUE2 5FZHA 1LR5A 1BVVA 3CZUA 2ZA9A 1C1FA 2AEZA 4QDSA 3AXDA 1IZ3A 1BEV3 3L9JT 4MXWB 2V5DA 4EZ4A 2DVGA 2VMGA 3AZWA 4R9AA 4E9KA 1QJX3 4BQ4A 2VVDA 3AM2A 1ZZ6A 4EJRA 3CF6E 2CAVA 3OUJA 1N3OA 2ZPXA 3NNMA 1PIV3 2RS13 4QGMA 1K12A 1NY71 5DAXA 1F5JA 1MS0A 5FZBA 5JR7B 4EN8B 5CB7A 4AK3A 4JGYA 4YYOA 1GNZA 3PVBB 4CU6A 2YC2A 5DDJ1 3WOGA 5ABJB 5KR7A 3CZJA 2JDZA 3IB3A 1CX1A 4M01A 4KGGA 2BGCA 2QQLA 3LSEA 1YQ2A 1SZBA 2WN3A 4AHYA 2EXKA 2I2SA 2ZGNA 1RUD3 3DPRC 3NNGA 4HSLA 2F17A 1DG6A 2CNAA 5GLZA 1RJ7A 1V9U1 2BVBA 4JGYB 2A75A 3KM5A 4IW3A 2E7AA 1GWLA 1VBD3 4M3CA 4P14A 5FRAA 4LBJA 1RVF3 4DY3A 2DCYA 3MFCA 1LEDA 1AX2A 2P3YA 1ZRRA 1CWPA 1ZZ7A 5A3TA 3KHCA 1UXZA 1R092 1G86A 4XFCA 2W95A 3KF3A 5CAZA 3FHQA 1GZTA 2P6HA 1O3TA 4JDMA 1S2EA 4Q0QA 1SBEA 4P02B 4UAPA 4XPVA 4OULA 1O8SA 2ZXQA 3HNMA 1RHI1 4HKOA 5T5JA 2YV8A 1W28A 4P00B 2WO7A 4FFIA 1AJOA 1AX0A 3Q8FA 2VPVA 3OF1A 3HIFA 4AEDB 1ND2A 2Q5TA 2Y26A 3UGHA 4CEYA 4WVMA 5BY5A 1O4YA 1OD5A 2VD7A 4EZHA 1WZXA 2DFBA 2ARAA 1PZ9A 1DF0A 5L7OC 1W8FA 5LA9A 5EHDA 5C33A 1LOEA 2WZEA 2QFEA 2ZMNA 3H7JA 1S0GA 3WNPA 4LLFA 3T30A 4OLLA 2EICA 1ND2B 2VOTA 3QCWA 4AF9A 4CEYB 4WVMB 3NNLA 2C6SA 1KDMA 2HEWF 4DIQA 4DY5A 1EAH1 2A6WA 4EQVA 2WLQA 2D40A 1QJU2 2Q0AA 2JX9A 3ENRA 4YM1A 1GR3A 3VHNA 1JN2P 3AP9A 1V6MA 4M3CE 1GZCA 2WRAA 1FOD3 1DZTA 1O6UA 3O0VA 5C4WC 3Q8CA 2XGXA 3GCXA 4BIFA 4ZZ8A 3V0BA 2ILMA 4BH9A 2O8OA 4CCCA 1UX7A 2VR4A 3E97A 4BOWA 1OQDA 4IE6A 5I0TA 4E4DX 1OC1A 2X8KA 5LATA 5GALA 5H9SA 2JE7A 2VCAA 2VOXA 1PO11 3POIA 1VBC2 2G9ZA 2XG3A 1AL0G 5FPVA 1V6JA 5T50A 4AVAA 4BHPA 4BZ4A 3V0BB 1BVP1 5C3PA 2CL2A 4JQRA 3ZSEA 5EJZB 1XNDA 2AGSA 3SC7X 1RXFA 2GP5A 2IUWA 4TWTA 4URTA 1XE8A 2VBDA 4R9BA 4YM0A 5FXZA 2KXLA 3CDZB 5FMOS 4CXYA 2D43A 2DYCA 1ACCA 2K9ZA 1CR7A 5FZAA 3SITA 1F5FA 1MS9A 3MIHA 1HRI3 1XOYA 3P6BA 4JVAA 5DN2A 2XJRA 4DRVA 1AL22 4E2SA 2WZR2 4GH4C 4XUOA 1ASJ1 2VCMA 5A7QA 4YW1A 1DQ2A 4XYXA 4AFCA 5CFDC 5I8YA 1NOVA 4OI0A 3IZOA 1H8TA 4KNCA 2JECA 4RN5A 4D6QA 3VKLA 5J36A 2D6OX 4XZPA 5JZGC 1MS5A 2DU0A 1HB3A 2VZPA 1DYPA 3H1YA 1BBT1 1UOJA 3HT1A 2LS6A 4PDWC 5CBLA 2PHWA 1HIXA 2MEV1 3NJYA 4EWDA 3H3UA 4DRRA 3WF2A 1H8TB 1UYYA 4JHZA 1AHSA 3MYXA 4XF4A 4EROA 2BDRA 2K0GA 2WR9A 1URXA 1W99A 2BEOA 3DKQA 4RA0A 4UBHA 1YHFA 5FZ4A 3VKFC 4EN6B 3ZN4A 4AHZA 1L7LA 1OQ1A 2PAKA 2IXCA 4DQAA 1POV3 1RB8G 2TEPA 3WZ1A 1OFSA 1QJY3 5FIXA 5T3NA 1OKOA 3JB4C 1S0FA 3ZYRA 2CTVA 1G9FA 3K75B 4XUQA 5B4XA 1RINA 1HJGA 3CU7A 4KMQA 1ZYBA 4NRPA 5K4LA 4E2GA 5FXVA 3KV9A 2QZ2A 2ZEXA 1T6GC 4BYYA 1JZ6A 1W6OA 3TAYA 4RHV3 2XOMA 4R52A 1VMFA 2OUHA 2VUAA 4LHSA 3KD4A 2IXIA 1EP0A 1LU1A 3INAA 4CUAA 2CGNA 2VMIA 3PURA 2YZ4A 4TLFA 1RMU3 1D0HA 2IXLA 4Y5TA 2EIBA 2B46X 2W08A 1R081 1AR61 1PX4A 2R071 2X09A 3WDXA 1W6OB 3WLUA 5DZGA 2YU1A 4AEMA 1BLZA 1DYOA 3RDIA 4Q4W2 2JXAA 2WQZC 3S30A 3V64A 5GZGA 3FLPA 2WT0A 5A7PA 5I8SA 3RS6A 3ORJA 5APAA 3NL1A 5FOBB 3GCWA 4BK5A 4XCAA 4NUBA 4OHVA 1UU5A 2XUEA 1UY3A 1W9WA 5FWEA 5ABJC 3P5BA 3EB7A 4GKYA 1UPIA 4KI5M 3RWNA 1XNKA 1QH6A 1D7PM 1J83A 2JKXA 3AYCA 1CAUA 3LAGA 4YM3A 4C8DA 4XTPA 2VTFA 2WFPA 2WO3A 3LQCA 4JGYC 1UCXA 3C7HA 4AI0A 5IYYA 4XC9A 3AXEA 4D6RA 1OPMA 1JXNA 3PMSA 5K0UA 2VJXA 1E5IA 4O61A 1AR91 5C71A 1PGL1 2R49A 1CAUB 4NHKA 1XB9A 1TME3 1GNHA 3T2PA 3QBQA 2JDAA 3VZMA 4DINB 2QQMA 2IFWA 5FQ0A 2RS32 4OCTA 4YFWA 4L9BA 2EAKA 2JDNA 4AI8A 4NPLA 4HPKA 2C0ZA 2XUMA 4DXTA 1N3PA 1MQTA 1NKGA 1PMIA 3ZPYA 3OY8A 2R062 4E4SA 2HWB1 3CQOA 5E8AA 3OG2A 1WLWA 3CJIA 3O1SA 1YUDA 3HNBM 5FQ0B 3DN7A 1M4WA 3EHKA 3LIGA 4B4RA 4LK6A 1QHDA 3C2UA 2XKPA 5JWPA 3A23A 4CP0A 5DUWA 4HPKB 2AZ5A 1LHWA 5F5CA 4F7ZA 2RDSA 3IMMA 2WS91 4LORA 2YY1A 5A7WA 1C28A 2JE8A 3OY8B 4LHNA 4OI1A 2H0VA 3KT1A 1C8M1 1FMD1 5E6HA 3CJIB 1PZ7A 4YARA 5IK8A 3IDEA 1UF2C 1J3RA 4GA9A 4K8FA 1CIWA 2RMU2 2PYTA 3TBDA 1LTEA 1SACA 1RUC2 1AYM2 1POV0 1ND2C 3POYA 5A7WB 1EV11 1GV9A 4CEYC 3D8CA 1KS5A 4S2DA 4QU2A 3ZYIB 4AXOA 2RHPA 2VC9A 3M7AA 1BK1A 3WQ0A 3KQ4B 4IEVA 2R042 4XQ4A 3OPTA 4COVA 5ACA1 1W90A 2RG4A 2R16A 2LW8A 2ZGUA 1JUIA 1W2OA 4YW5A 1ODMA 5A32A 5GZEA 4E2QA 3AVSA 1QXJA 2A3WA 2WO2A 2XJSA 2GNBA 1RIRA 4QM9A 2ZEZA 1HXS1 2CSGA 2GU9A 3TEZA 1OSGA 2GZWA 2OZ6A 2VMCA 5FZ6A 2PQQA 3NJXA 3RZHA 3I2DA 4CDQA 1UNBA 1MEC2 5A32B 1KGYA 4RFRB 1G9CA 1EPWA 1UU6A 4RR3B 4W6YA 3SQOA 2XQRA 2BP6A 4WM7A 4A3XA 4I02A 4S2HA 5CADA 3PMEA 4M3CF 1YQ5A 4NHMA 1YIPA 4NJ4A 4CCKA 4FOWA 3AP4A 3N9OA 5A70A 4PHZA 3IT8A 4WM7B 4PJYA 4UI9L 1PZ8A 5FBZA 5HXVA 4CCJA 2HWD3 3HBKA 3DGTA 2EF6A 3RZJA 1XSQA 1QWRA 1BEV2 1QH7A 4EE2A 3MV01 3KZ4C 3OOXA 3N7KA 4FP3A 2A6YA 2W1WA 1QJX2 5J1XA 2PAMA 3AK0A 5JI7A 1RL3A 4IEXA 2OUJA 1YIFA 1UMZA 2JB4A 1PIV2 2RS12 3ES1A 3QOPA 1KJRA 5HV0A 2QQUA 5DXDA 5FK7A 1QQP3 1WKYA 1JHNA 5FUPA 2W3JA 1US3A 1W2NA 1H8TC 2E53A 2Q30A 3JD73 4XURA 3HNYM 1LOFA 5KHGA 4MGYE 3A0KA 5FZLA 1PM4A 4Y5Z0 5BNOA 1LODA 1HN0A 1RUD2 2WUHA 3H3ZA 5A1LA 5FWJA 1RUE3 2ET1A 5LEKA 1VBD2 1RVF2 1W04A 3P3NA 4DPNA 1SFPA 4ZU5A 4PQ9A 5FLHA 1VAMA 1AF9A 3KV4A 5LBCA 2HWC3 1K5MA 3QD6A 1XNTA 2E33A 4LO5B 4CCMA 1XPWA 3AMNA 3WHUA 5H9PA 4F3JA 3NJVA 4DUVA 1VAKA 4NN0A 4IE0A 2V72A 1UL9A 1LNSA 4PI2A 2R1BA 5F2SA 1K5MB 5A6QA 3B9CA 4YG6A 3OYWA 5IJRA 4OZOA 2PAEA 4NHYA 1ZZ9A 1S0EA 4KBBA 3HN1A 3GNEA 4XXAA 3UL2A 1N47A 1WGPA 4M4RA 1FXZA 2Z4FA 4HT1T 3ZXGA 1H2KA 5JXJA 5FYMA 2HEYF 2XQXA 4A3ZA 4F83A 1DIWA 1ND3A 4V2VA 2DVAA 1AVBA 5EQUA 1OUSA 2NLRA 3OYWB 1UIJA 4GJYA 3T09A 4XMAA 3IBMA 5FPAA 5J98B 5A6ZA 4MVTA 4AYUA 1GZ9A 2D6PA 3AZZA 3N3HA 4LBNA 1Q5OA 4L8QA 2FHRA 2Q1MA 5EYXA 1BJQA 3NV2A 2E31A 4B7KA 1CZTA 1YYNA 2XVKA 5IHRA 1ND3B 2GALA 2QBXA 3CNAA 1IQDC 1UMIA 5FYZA 4CCOA 5JMCA 1IGOA 5F3IA 2FD8A 3LFMA 1CAWA 3LDRA 3EQEA 4HFSA 4MV2A 4CRQA 5DAPA 1V70A 3H8XA 5LK7B 4FI9A 5E88A 4AOCA 1J3QA 1RUJ3 1YC61 4S2GA 4JRLA 4DZGA 1HV1A 4QHBA 3OGJA 2Q8DA 2B8MA 1VBB3 2Y6GA 1CAWB 3SEEA 3T0AA 4LOTA 5LA1A 3SEPA 2E32A 3SLIA 5C3OA 1FI2A 1VB2A 3NAPA 2GMMA 3FHIB 4FPFA 5BXXA 3PDQA 3ZXAC 3A22A 1CVNA 1RUI1 4IEUA 2V5YA 4MSVA 4HVRA 4KWLA 2DCKA 1REDA 1RJ8A 3CJIC 2Y6KA 3GXUA 2D7FA 2DUPA 1HRI2 1S55A 1K5JA 1QIQA 5FPZA 3AFGA 1I6XA 1GU3A 4AAXA 2VZUA 1H2LA 5L9VA 3MDPA 2XJUA 5ANQA 3MHZA 3ZYHA 5KHHA 1UIKA 1CGPA 3IAPA 2VW1A 1YWKA 3GZTB 5LRSA 1VBC3 4YSFA 1E5HA 1RC6A 2ZTNA 4QPGA 1VB4A 1JZ4A
chains in the Genus database with same CATH topology
5F5QA 1IS5A 5EXOA 2HWF3 4W65A 5CNAA 1AR81 1LOAA 1LJ7A 3DKWA 1H2MA 1CQ9A 4IEYA 4M0HA 1UD1A 3IPVA 2QE3A 1TMF2 4QD2A 1UZYA 1IS4A 1MS8A 2A71A 2RS53 1PVXA 1O4ZA 1C5HA 1QJY2 4MGKE 3GHNA 3NV1A 3AMMA 3KB5A 3E6DA 3IPVB 4JGZA 4UW5A 4Y20A 4CDQC 4TZDA 3RPQA 1YFWA 1DGWA 1AJKA 2XKOA 4RHV2 3D4KA 1H8VA 4WM7C 4YGDA 1WMEA 4LUKA 4A7KA 1ZBA3 5JPMB 2W39A 4RS5A 5T5OA 4DS0A 4CYDA 4JGZB 2D5FA 1WUVA 5J09A 1RMU2 2BVVA 5GZFA 1D2QA 3WQ7A 1KQRA 5FMOL 4OVEA 4WVVA 4KWKA 1G7YA 4FT8A 4RS5B 5GZDA 4IL7A 2WSUA 5FTTC 4O9EA 2VU9A 3NV3A 4R4ZA 2HWE2 3ZFEA 1XU2A 2R32A 1VRH1 2IWGB 4FQZA 3UKTA 4GB31 4A7YA 3PTYA 2ZGMA 1OQEA 3ZSLA 5GM0A 3TRSB 3THTA 4XJ9A 4YW4A 2D44A 3RQ0A 3ZFEB 2GC1A 2V73A 4IXLA 4FXKB 1LOFC 4CDWA 1ENSA 4YG3A 1IHMA 1AYN2 2D3RA 5BNOC 1TME2 2Z69A 4LBMA 2QZ3A 3S7EA 2XBO1 5FAXA 4FPYA 4IEPA 4CDWB 2MHFA 4Q4X1 3ELNA 1OLRA 4MH0E 1O5LA 2XWBB 1K5MC 2QVSB 3Q9OA 4XF3A 4L11A 3D82A 5I8TA 4JTNA 4AFBA 2JG9B 2ZGRA 5AC93 4FTSA 1JOJA 3RYRA 3VL9A 1Q8PA 4U2AA 2DTWA 3WW3A 3DV8A 4CEWA 4UW3A 2Z5WA 5BPXA 1CAVA 3MF9A 3M2MA 1QJZA 3ZXDA 1CPMA 1I9RA 2Z42A 4ES9A 4Q29A 4I3GA 1G9BA 3MW3A 2ZS6B 1ND3C 3JBG3 1CAVB 1RUH2 4HL0A 1ENXA 3MIBA 2TNFA 3M8LA 4INDA 3N4MA 2PLV1 4YZ5A 4XBNA 4BMBA 5EFUA 4MUVA 4LA3A 1S2BA 1M06G 2CAUA 1RTVA 1V00A 4R4XA 3DUIA 2R6QA 4EWAA 1H2NA 1PO21 3WD5A 2PHUA 2K2SA 3M3CA 4QT6A 1HRV1 3U4XA 2VVFA 5CFDB 3TN93 2YDEA 5KXDA 3JB8A 1UU4A 4YZ3A 3WXPA 1NCQB 4R9CA 4XETA 1GSLA 1FPN1 2MNGA 4PDWB 3NAPC 4Q4Y1 5HCAA 1QOSA 3APBA 3ILNA 1Q8VA 1NA1A 2Z79A 4OHZA 1KFUL 4AEJA 4BIOA 2E7TA 3PNAA 4FPEA 5K7PA 4QQPA 2RS31 5J7MA 1RUG3 2D6KA 5FLIA 3U10A 2EVXA 5T54A 2DVDA 4LO7A 1NA1B 5DG1A 2GMEA 3VBRA 3JD72 3MI8A 3I54A 3KCCA 5JIUA 2WLPA 1VBA3 3J8F2 3MLLA 1JBCA 2Y38A 3SHRA 5IK7A 1HV0A 2P3JA 4AFMA 3AMQA 1V9U3 3KCXA 3EBRA 2YYOA 3VBSA 1YI9A 4YVSA 4B4QA 1IPKA 1KRIA 4P9GA 4IEZA 1RUC1 1OOPA 4CP2A 3O5SA 5F6LB 1X7NA 2X29A 4XF1A 3RMXA 2HWC2 1J1TA 4FPHA 4XFHA 1HX6A 1N1TA 2DFCA 3WUDA 4FOQA 3S7IA 2W68A 4YVSB 3TOJA 4BQ1A 1S0JA 1SCRA 5JAXA 4JGZC 3VHOA 1OOPB 3PJQA 4JDNA 1Y7BA 3J9SA 4LEJA 5C8CA 2JICA 3NW4A 3ZXKA 5CFCA 2IC1A 3R4UA 4WV8A 4FAHA 4RS5C 4XJWA 4H14A 4AG4A 1Q43A 1WD4A 3N36A 2XJPA 5C8CB 3WR0A 2B7YA 3LA7A 1VP6A 1R1A2 1D4M1 3ME2A 4IEWA 2ZAAA 4CDXA 1J1LA 5CIRA 4E4ZA 1NE4A 4D7TA 4L97A 3LOIA 4M3CB 4GWMA 3MIEA 2VG9A 3ZFEC 4RFT0 2D3PA 3O7OA 4C0BA 2DCTA 2ZGOA 3OD4A 1F31A 1EAH3 3M3QA 4N90A 2WIIB 2R0FA 2VW0A 3VZNA 4FVVA 4CDXB 2P17A 4H3WA 5JSRA 1GBGA 3MGUA 1CAXA 2WA4A 1QJX1 4X8PA 1RUJ2 1YFXA 3NV4A 4CDWC 3KS7A 1HQWA 1PIV1 1X8EA 1VBB2 2RS11 2UWBA 4LO8A 4DY5A 1PO13 1WD3A 4C1XA 1IOAA 1CAXB 1LGCA 3A0NA 3FFZA 2ZGLA 3WG4A 2JG9C 4JAAA 2WT1A 1SLTA 4PIZA 3NWKA 4HMZA 1AR73 1GFF2 5BNQA 3E5XA 1LECA 3PVNA 3WP4A 2WT2A 3D0SA 1A8MA 1ASJ3 1CD3G 3QH7A 5HCBA 2ZOEB 2PTMA 4P9WA 3HBZA 3ZYPA 1DU3D 5DG2A 4LE3A 5A3MA 1YJLA 4EV0A 4F8AA 4NVPA 3WG3A 3AZVA 1ZZBA 1HLCA 1BBT3 2HWF2 4I0WB 1AUYA 2VXRA 1LHUA 1U0AA 4EN9B 4YM2A 4I09A 4A2UA 2P2KA 4Q8KA 3OD0A 2RS52 3SCFA 2XHKA 4X6RB 1KXGA 4YG0A 2ETEA 1HKDA 4ASLA 3FE5A 2I45A 5IK5A 1G8WA 4QX5A 3BODA 1WBLA 3RSJA 2GNTA 3OJBA 4Q4V3 1NCQC 2YPJA 3GBGA 3NKTA 2RE9A 4FOYA 3WQ1A 4UW6A 5E16A 3SISA 1ZBA2 1RUNA 4YGEA 2AUYA 1FOD1 3HAGA 1ZBE2 2VUJA 4XHBA 1UZZA 2BYVE 4LBOA 3ILFA 1R083 4AFAA 2R073 1TMF3 2YUEA 3FWEA 4YZ2A 1WBFA 3LCPA 3CLPA 1PGW2 1VBE3 3B5LB 4Q1PA 1NA1C 2QDNA 2DUQA 1S0BA 1D2SA 3FJSA 1VALA 2WFF1 4XEZA 2EA7A 2SLIA 5JOXA 3AMHA 2EALA 4WVZA 3H0OA 1DLLA 4HN1A 3VBRC 4LO4B 1EPZA 1XNCA 4OHYA 1XRUA 4LLOA 1AR93 2BBVA 4I3PA 3GYDA 3MFAA 4DNYA 3CJXA 5AFEA 1N1VA 2RR11 3VGIA 3FUQA 4FPJA 4YVSC 2BPA2 1WMFA 4BE3A 2HWE3 1OOPC 1QF3A 2ENRA 1D0GA 2GN3A 3OCPA 4CTEA 3E5UA 1Z7S3 4PLOA 1CJDA 1H4GA 3EJKA 2WKKA 2VNOA 1LCLA 4Z92B 2H6BA 5AC92 3ZXLA 3R4DB 3B01A 1Q8OA 2AH2A 4AI3A 3HWJA 5C8CC 1FMD3 4FP2A 1AYN3 1AX1A 1U5IA 4G4FA 3CO2A 5JI9A 2PHLA 4L99A 3K48A 1UKRA 2CGOA 3AYDA 1QU0A 5K0UB 5F6KA 2UU8A 3JBG2 5BNPA 1W2UA 1X8MA 3IIAA 4CDXC 5ACA3 4OI4A 4YW3A 4COWA 3IWZA 4LBLA 3U11A 1BMV1 2DTYA 1MQTB 5BNPB 3VBHA 3HQXA 2BW8A 1HXS3 5J37A 1U5XA 4N7UA 1ZNPA 1CN1A 3KT7A 1QGLA 4BCUA 1MZEA 2E63A 5FFOC 3VBHB 5T5LA 3TN92 5C8WA 4PCRA 1MZFA 4A7ZA 1DGWX 4SLIA 1U5ZA 2JE9A 1RUH3 1C4RA 2O8QA 1REEA 2D6NA 2W0XA 2VMHA 3OBRA 4ZU7A 4C90A 5KWRA 4IETA 1H1AA 5AVPA 3WCSA 1AXYA 4MXVA 2RM21 3OGGA 2LM3A 2VVEA 4FPCA 3KCYA 3ZDSA 1RUG2 1RUF3 4ATEA 1JUHA 3OTFA 2C5DA 2H0BA 4S2FA 3MIGA 3H1WA 1NYWA 3AB0A 2WL1A 4AVTA 4FTBA 3B7MA 1NY72 4XQDA 3RZZA 1PVC1 1GQGA 1IKPA 5EJ3A 3AJYA 3N7MA 4K20A 4OUMA 5TSWA 4CDQB 3T1MA 2QDRA 5J96B 1CPNA 1PNFA 3KLSA 5DZEA 4ASMB 1VBA2 3FFQA 3UJQA 1LESA 1V9U2 4R9DA 2MPFA 4GMP1 4NOTA 3WX5A 2UY9A 1XYNA 5JDBA 1SLBA 1O7FA 1W39A 3AYAA 3WV6A 2A70A 4Z2WA 5CG8A 4P9YA 2P3KA 4NR1A 3UK9A 3VL8A 4FTEA 1UN1A 2D97A 4ONUA 1F8VA 3BU7A 4CP1A 4AHWA 5GKAC 5JOWA 3KQRA 1VLNA 4B4PA 1DGRA 2E9QA 2GC2A 4JDOA 4QPIA 2LUWA 3OPZA 3M3IA 1H1MA 2ZACA 3J8F3 3FC0A 4N43A 2ZBJA 4YFZA 3RYKA 1Z0HA 2IFRA 4P9JA 2EXJA 1TE1B 5HI0A 5BNOB 1VAVA 3KMHA 2OZJA 3PVOA 1WW4A 4N43B 2ERFA 2IXJA 1ZRCA 3ZXFA 4KG0A 1XYOA 3R0RA 1KFXL 4C0HA 4CZSA 2CGPA 1EAH2 2HWD1 4AQTA 2NQYA 4NWWA 4EWEA 4QGNA 5FO7B 3I8TA 4IEOA 3VZLA 4P9XA 2EIGA 3WP3A 3ALQA 1H4HA 1SBDA 3MPPG 4I01A 3X29B 4AW7A 1CONA 4HETA 3UV9A 4GMP0 5E1RA 3CL1A 4QM8A 3LB9A 1PO12 4HVQA 2PHTA 1QQP1 1R1A3 3RNSA 5CG9A 2BWCA 3I59A 2QJVA 2VOWA 4GXLA 2Q8OA 1GZWA 2VULA 3VHRA 2D93A 3KGZA 5KHJA 4LUMA 4ZU4A 1RUE1 1RUI3 2PA7A 2XLFA 1AR72 3GZUC 4Q2FA 3I59B 1GZWB 1UPSA 2NMNA 3L2HA 1ASJ2 3KSCA 4XMIA 2HWC1 1DZQA 5K0UC 3H8UA 2D6LX 4TYSA 1WCKA 3U07A 2DCJA 2TUNA 4ISQA 3KGLA 1FV2A 1W6PA 1ZM1A 1BBT2 4JRAA 3ZXEA 4ISRA 1MQTC 5BNPC 1AR83 2ZGTA 1G9DA 2Y0IA 3G6JB 4FXGB 1DDLA 1LENA 3AKPA 1W6PB 4XXPA 4AE2A 2N7GA 3NAPB 3VDDA 2YGMA 3VBHC 1TQ5A 3VZJA 4EN7B 1R091 4AGRA 1COV3 2DWRA 4Q4V2 3WDUA 4KL1A 1FYUA 1YNAA 2ZX2A 1V6LA 2CWSA 2EXIA 4XIOA 2YMZA 3VDDB 5KXCA 3ZO0B 1LGNA 2BFUS 1O3SA 1DGRN 1H1IA 1WLTA 2GDFA 3H1MA 5F9TA 2YC0A 2XH6A 4G3YC 2EXHA 3USUA 5I91A 4E27A 3USSA 1U12A 1R082 1QDCA 4QPGB 2AYHA 2R072 1AR62 3AX4A 4PF5A 2ZCWA 1VBE2 1LU2A 4K1ZA 3W58A 1Y9QA 1YCIA 2IXKA 3USUB 4Z8BA 2EAAA 5H9QA 3MLJA 1LOCA 1VRH3 2PHRA 4MZUA 4GB33 1QXRA 3M3OA 5I0RA 4RQPA 2P37A 4QMAA 3ATGA 1QJU1 1Z78A 1DYKA 5BV6A 1O3RA 4K6BA 4Y20B 3B3QE 1ZBE3 3ZFFA 1B35A 1GICA 2JKBA 4RQPB 1AR92 1PGL2 4V1PA 1SLAA 2E6VA 2DVFA 4YGCA 1UAIA 1OFNA 1VBC1 1O91A 1J59A 1SLLA 5JVVA 3ZFFB 3I7DA 5GLTA 1B35B 5KBFA 1W6MA 4HKLA 4PIYA 4Q4X3 4M00A 1Z7S2 4LBKA 3WVJA 2HWF1 3WG1A 3WNXA 5HBAA 1ONAA 1C57A 3NVCA 4LBQA 3WW1A 3RRDA 2ZHNA 4AWDA 5KXBA 2RS51 1W6MB 1NLRA 1RITA 2A6ZA 2WS92 1AL21 1ZRDA 2KA3A 2WZR1 4QPIC 3BTAA 3B9IA 5LEJA 2FZ2A 1X50A 1FMD2 3UJOA 1FNZA 4N43C 1FT9A 2W52A 4NHLA 2GMPA 2A7AA 4QQOA 4GQ7A 1EV12 3R4SA 2ZMLA 3LA3A 4COZA 4M0NA 1N1SA 3EXUA 5ACA2 2FZ1A 3T2TA 1RGSA 2CY6A 2PLV3 2CWMA 1LHOA 4MGZE 1I1EA 1V6KA 1HXS2 1G9AA 1QXPA 1AXZA 4OUSA 4KU7A 2XL7A 4WZFA 5JOZA 2TBVA 1PO23 2HKXA 5J48A 2WWSA 2FBEA 4AVVA 2JG8A 1ZREA 1HRV3 1WW5A 4CEWB 2RJKA 1FV3A 5JOYA 2XB6C 2D3SA 4I2OA 3SCGA 2JG8B 4XE9A 1FPN3 4Q4Y3 4Q4W1 3QACA 1H9PA 1PNGA 3TB0A 2KM2A 1NQDA 1N3QA 1RUF2 2BNMA 1NCRA 1NZCA 2BNOA 1EY2A 4J1WA 4Q8LA 1LEMA 4L2NA 2ZMKA 5C9AA 3WDTA 3ZN6A 1H9WA 2DV9A 3RG0A 3H50A 2R30A 4X8NA 1N1YA 1NCRB 2IZWA 3VUOA 4BLJA 1ZX5A 3B93A 5C9AB 4H7MA 2DF7A 3ZN6B 4BWOA 3FMGA 2AREA 1GLHA 1I3HA 2B39A 4AVSA 4YNIA 3ZN5A 2UWCA 1LHVA 1SFNA 4FPOB 2DVBA 1WMDA 3ECQA 5EV7A 4BM8A 3D0JA 2F4PA 3VDDC 3FBMA 4B29A 2NM1A 4LR4A 2R061 5GZCA 4LA2A 2GC3A 5DDJ3 4P9LA 1ULDA 4QPGC 3MICA 2YGLA 2QKDA 1I5ZA 3VV1A 5FO8B 4LNVA 1FNYA 3VBRB 2UWAA 4RGGA 3WHTA 2RMU1 1WCSA 2BTVC 5GLWA 1AYM1 3ZMOA 1LRHA 3PLQA 1B09A 1ZZCA 2VW2A 4B3NA 1YFUA 3TN91 2I07B 4H7LA 1D4M3 2ARXA 2R041 2RJLA 3VBSB 1MR5A 4ATFA 3JQXA 4HANA 4L92A 2UYBA 3S0MA 1BYHA 1NQJA 4RQPC 1LOBA 3LWCA 2NMOA 3VBFA 1RHI3 4Q0UA 1QOOA 1MS4A 3W59A 4D7SA 5ABJA 1RUG1 4PLNA 1MEC1 1NG0A 4JV4A 1V6IA 1W0PA 3ZFFC 1B35C 4XOGA 1S2KA 3QH6A 1PGSA 3QLQA 3LOBA 1YRZA 5CFCB 3VBFB 3ZYJB 4NO4A 4QQLA 1GANA 4B8EA 2A6VA 4K3UA 5KHIA 2QQPA 3NJZA 1VBA1 4ES8A 1R1ZA 1TNFA 1RUI2 1ULEA 3B69A 5GLVA 5D1IA 4KGQA 1BEV1 4XJAA 4Y1XA 3TYJA 4NWVA 4P5HA 1HDKA 1YXWA 4ORFA 2A6XA 4YGBA 3ZSKA 5I0SA 3BIWE 4XF9A 3JUUA 4H55A 4XBLA 1S0CA 3VZKA 1WLCA 1PM7A 1VIWB 4AEDA 4XFIA 3AP5A 4ZKTB 3ZXJA 1FX5A 3O0XA 1RUD1 1AR82 3AZYA 3O14A 1JYIA 1MZ5A 4MYEA 4AI1A 1DFQA 1VBD1 1RVF1 4DMIA 1HW5A 2DURA 3IN9A 1QY4A 4FCAA 1NXMA 2O0OA 3LZZA 2VECA 3MIFA 4HLTA 3B02A 3VBUA 1COV2 2LTNA 4CEWC 4XF0A 1SQ4A 2XVLA 5DUXA 5DUVA 4RL7A 3AKRA 4DOUA 1JH5A 1TNRA 2JG8C 1S0DA 2JENA 3E5QA 3PJYA 5JCTA 3VBUB 4D94A 1APNA 2ZABA 3TWIA 3ASIA 2MEV3 2ZAHA 2YXSA 2Y0OA 5A3LA 1XYPA 3ROUA 4K21A 4D69A 2ZGSA 1YLLA 1WW7A 3SH5A 2VY0A 1A78A 2HYKA 4J6GA 5I93A 4LO6B 4IQPA 2F6BA 1ALYA 2WINB 5LRRA 1VRH2 4K1YA 1NCRC 2WJSA 4GB32 2WFF3 2ZHLA 3HMYA 2WNVA 1IPJA 1Q56A 1QKQA 1V6NA 4HBNA 4LHLA 5C9AC 4AVBA 4ITCA 3U0ZA 2OW4A 2ZX3A 2GC0A 4N53A 5D8AA 2ZKNA 1D4VB 1LOGA 1AR71 1Q8SA 3LGRA 4YZ4A 2D98A 2VOVA 2XJQA 2CYFA 1DHKB 2WNVB 1O3QA 3AKSA 1AR63 4JCKA 4BA6A 1ZA4A 2G4IA 4N53B 5D8AB 4IESA 2B5HA 3ZX7A 2G9FA 2XBO2 1IKQA 2GN7A 1ZZ8A 2RR13 3CEWA 3WDWA 1SFYA 1QNYA 2XJVA 1E57A 4AHXA 2Q1ZB 4Q4X2 3VHPA 4IV1A 4W6XA 3MEPA 2OA2A 1W0OA 4Y1UA 2BFUL 1SLIA 1HRI1 4N7IA 4FAGA 1H0BA 4FO9A 5L36A 3N35A 3POWA 3ZFGA 5JSOA 1X33A 4IV1B 3ZIWA 2XLAA 5C6CA 4BPZA 1SDWA 5AFBA 1NLSA 3VBSC 1REFA 4Q4V1 3R05A 4FBFA 1MS1A 4XJUA 4XFFA 4PBPA 2E7QA 1X82A 3M1HA 3AZXA 3ZFGB 4BLIA 4XTMA 2ZX1A 4RD7A 4SBVA 2HWB3 2UY8A 1A3KA 2VNGA 3LA2A 4KWJA 4COUA 3EO6A 2PLV2 2FMYA 2WC2A 4XJZA 1TMF1 4FPLA 4XHXA 4XQWA 2XWJB 3JZVA 2WS93 1VBE1 1POV1 1QNWA 3MPBA 1BZWA 1QJY1 3BPZA 5T55A 1C8M3 3HD8B 2V09A 4WBBA 5CFCC 1A8DA 3VBFC 4HKWA 4IERA 3IKWA 1PO22 1DBNA 3GBFA 3GALA 4P9IA 3AP6A 1HRV2 3VN4A 1EV13 4RHV1 4K7JA 4KQ7A 1XU1A 1CX4A 5T52A 3N7LA 1RMU1 5K9YA 5FREA 1FPN2 3O12A 3SXWA 2H6CA 3MLKA 4Q4Y2 4K9SA 2DU1A 3WCRA 3L2YA 4KU8A 3WW2A 2RM23 2B45X 3ZSJA 1OI6A 2HWE1 4FSJA 3ZIXA 3FX3A 5JSPA 3HR9A 4MX3A 1Z7S1 3SNMA 3FZ3A 4AQ6A 1YJKA 1SEFA 5F1RA 1PVC3 1JTZX 2BUKA 3WDYA 3RI8A 4WM8A 2ZHMA 4C91A 1DQ6A 1OLQA 4AEDC 4PIXA 3JCIA 3TNPB 1WA4A 1XXNA 4Q26A 1AYN1 2GH2A 2A73B 1TME1 4WM8B 4GMP3 5GJ6A 2AR6A 4UW4A 4XFBA 2Z2SB 1O5UA 3RYPA 3WT3A 3V0AA 3VBUC 3V56A 1IQAA 3ETQA 3B94A 5DDJ2 3IMNA 3D6EA 4QXKA 4RR3A 5T5PA 3SH4A 2I74A 5FDBA 4Y4YA 5IUQA 1OPOA 1QMJA 3V0AB 4LULA 2GSYA 5J3UA 3URFA 1U5YA 4MLOA 3BALA 2PHXA 2ZX4A 3AP7A 4HSJA 2O1QA 2JD4A 1PK6A 1D4M2 2PFWA 1NXD1 1Y3TA 1RUH1 2D6MA 5CA6A 3HT2A 4J1XA 4XIKA 1Y43B 3ZMNA 2WNVC 4N9IA 3ST7A 1PK6B 3WY6A 1GQHA 1GKBA 1PHMA 1ULCA 2FMDA 1RHI2 1F2NA 1S1AA 2JEMA 3VBOA 4N53C 5D8AC 4YVWA 1RUOA 1RUF1 1YFYA 4I0AA 3NSTA 1VR3A 3UKVA 4QPIB 2NP0A 4U36A 5LK5A 3VBOB 1MZ6A 2WNEA 1MACA 4YVWB 4I30A 1F9KA 4CDUA 4I0BA 2DCZA 3JQWA 4OZXA 3ILRA 5SV8A 3MIDA 3AMPA 1AZDA 2A5ZA 4PLMA 4DXZA 3R6SA 5HCFA 5BNNA 1A6CA 4IV1C 4CDUB 1VJ2A 1AXKA 4AGGA 2PN5A 1NE6A 1LB2A 3BOWA 2PHFA 5FLJA 1C5IA 5BNNB 1W6QA 4ZXKA 3ZFGC 3AKTA 3WINE 4W6WA 5IK4A 5JIAA 4Y24A 5I0UA 4AFDA 1J3PA 3MF6A 5KC6A 3RJRA 3D5OA 4X6QB 3JD71 4KG8A 4KH9A 4Z07A 4XDQA 1XNBA 1W6QB 5K8SA 3J8F1 2C9AA 4QPYA 2SBAA 3VLBB 2PELA 3MW4A 2ZGQA 2QUOA 2E51A 4UXAA 2HJIA 2ZHKA 3SMHA 3WDVA 2VGDA 5CVRA 4AEKA 4COYA 2HEVF 2ZZJA 2WNUA 4R8HA 2XLGA 3WP5A 1ULGA 2AENA 3NO8A 5SV5A 3RJ2X 3BCWA 1QDOA 2OVUA 4XFGA 1R093 1S0IA 4IEQA 2ES3A 2WNUB 4IV3A 4HK9A 3GHMA 3WG2A 2IXHA 3FLTA 1FOD2 2MEV2 3E6CC 3VKNA 3KT4A 1C3HA 3FBYA 5EZWA 1JW6A 2VH9A 1IS6A 3O0WA 4Q0SA 4IV3B 1FAYA 3FLRA 4EN0A 4YW2A 1KITA 1H30A 4FPGA 5A33A 4Y1YA 3IM0A 3IDCB 1R1A1 2NYYA 2A3YA 1ENRA 1YI7A 3M4FA 4D3WA 2WFF2 2CV6A 4OI2A 4XBQA 4GALA 4XW3A 4Z82A 4RSUA 3IDBB 5A33B 2BNNA 1HQLA 1W6NA 1DZRA 1QJU3 3ZVXA 1ZVFA 1JYCA 1GYKA 4WM8C 2ZGPA 4JTOA 5DUUA 4K40A 4HN0A 1RUJ1 1LULA 4XFAA 2R1DA 1W6NB 3MZHA 1VBB1 2X5IA 5EYYA 2BWAA 2NZ9A 4LHKA 4WZCA 2RR12 4Y1ZA 2ZJCA 4AQSA 1DGLA 4Y26A 5L19A 3UKNA 4N9HA 2D5HA 4XJ8A 1KJLA 3B00A 2X5IB 1ULFA 5IT6A 5KC5A 1WW6A 4UBGA 4AVCA 5CU1A 3VKMA 1YO8A 1KD7A 1AL23 4MGIE 2WZR3 4RR3C 2P34A 3I4IA 2VNRA 4Y22A 4META 1BQPA 1QOTA 4C1WA 4Z1VA 3S6PA 2PHDA 1COV1 3T1LA 2XBO3 4LBQD 4HVOA 2X53S 1KS4A 1MVQA 1OA2A 2ZZQA 3DPRA 4O9GA 4Y22B 3WUCA 2HWB2 1PK6C 2QNKA 1SBFA 2XL9A 3J26N 2P3IA 3N7JA 2ARBA 4AQ2A 4NPRA 4LE4A 1BMV2 2WQ4A 5B2GB 3DPRB 1EYBA 1OMIA 4AGVA 3DF0A 1G6NA 5H9RA 1DQ4A 1C8M2 2VQ0A 3JU9A 4OFGA 3VBOC 1BXHA 4YVWC 4LBQB 1UW8A 4FPKA 1OA4A 2JJ6A 4RGAA 2WA3A 5JLVA 3ZYGA 1J58A 1Q3EA 4LT5A 1UKGA 2C1FA 1OA3A 2LALA 1ZBA1 4QQHA 1C8NA 1SLCA 3A4UA 3PVEA 1CJPA 2XVGA 4OHWA 1ZBE1 4YRDA 4CDUC 3THPA 2BQPA 3H9AA 4HK8A 1KDKA 5JPNB 4DFSA 2B42B 5L7OA 5KHKA 1SCSA 2FQPA 1ZRFA 2RM22 1PGW1 4Q4W3 5BNNC 1XQNA 4Q0VA 3WP6A 1SMVA 2ZGKA 2JG9A 3K51A 4GULA 4AI2A 4GIQA 3J4UH 1FATA 5FOJB 5L7OB 3LKJA 1PVC2 3LSDA 2OIIA 3VZOA 3AFKA 3POSA 2ZKLA 4G9SB 4TSVA 5C4WA 3TNQA 3MW2A 4QGLA 3SH3A 5GLUA 1HQNA 5KXEA 1BKZA 1DQ0A 1IS3A 2XJTA 3H7YA 4Q0PA 2A3XA 2GNMA 1X36A 2G9GA 3GF6A 1UX6A 4BMEA 5C4WB 2R0HA 2OPKA 2GNDA 5AVAA 1CESA 2RS33 5DZFA 2YROA 1WCDJ 2WNUC 3W9AA 4FOVA 3E6BA 4JC1A 2Q4SA 2R063 4WVWA 5E89A 1O4TA 4QQ2A 1L3JA 1C1LA 3WW4A 3M3EA 5AC91 1OHFA 1XE7A 3V65A 2NN8A 2NPIA 3AJZA 2VOKA 4GH4A 4XILA 3SCHA 1DQ5A