4J6GA

Crystal structure of light and dcr3 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
139
Chain Sequence
b'VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCASTITHGLYKRTPRYPEELELLVSQQSPCGRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 14
molecule tags Immune system
source organism Homo sapiens
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
total genus 25
structure length 139
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j6gA00
2ZJCA 1S55A 5L36A 2JG9B 2R6QA 4G4FA 1XU1A 2HEVF 5KC6A 2ZPXA 3MI8A 4N90A 1I9RA 3LKJA 2X29A 2WNVA 2O0OA 2HEYF 2WNVB 1PK6C 4DB5A 3TWIA 1DG6A 3K48A 4MSVA 4TWTA 2R30A 2WNUC 4E4DX 3B9IA 3L9JT 1XU2A 4GIQA 4QQPA 2E7AA 2Z5WA 2R32A 3WD5A 3URFA 2Q8OA 1KD7A 2KA3A 1C3HA 4MXWA 4OUMA 4D7YA 5HBAA 1U5YA 1D4VB 2RJLA 2OIIA 1GR3A 3B93A 2Q1MA 1C28A 1ALYA 4OUSA 1D2QA 1OQEA 1KXGA 2WNUA 1U5XA 4QQ2A 1D0GA 5TSWA 1OSGA 5KC5A 2JG8A 1DU3D 1A8MA 2TUNA 1JH5A 4QPYA 2WNVC 4QQOA 1IQAA 1OQDA 4OULA 3TYJA 1RJ7A 1PK6A 1WCKA 2RE9A 4NN0A 4J6GA 1O91A 1RJ8A 1JTZX 5CIRA 2JG8B 4KG8A 2HEWF 2JG9C 4KGGA 2AZ5A 4TSVA 2QDNA 5BNQA 4QQLA 3ME2A 3V56A 1PK6B 3K51A 4QQHA 3QD6A 5L19A 4RSUA 4F3JA 4KGQA 4G3YC 4HT1T 2JG8C 2QE3A 2RJKA 3AB0A 3QBQA 4MXWB 3ALQA 5KWRA 1TNFA 3FC0A 2WNUB 3B94A 2TNFA 1U5ZA 4E4SA 2JG9A 4EN0A 3IT8A 1TNRA 4MXVA 4DOUA
chains in the Genus database with same CATH superfamily
3ZYJB 2CDPA 2YU1A 4FOVA 3GYDA 4B1MA 3B9CA 1X8MA 2OPWA 1IOAA 3KS7A 4XJWA 4NMIA 3UETA 3VZOA 3JCIA 1AZDA 5B4NA 1J84A 1WLTA 1YHFA 3ES1A 2O0OA 3GBFA 2JWPA 2VPVA 4KWJA 1JZ4A 4URTA 2MEV1 4FVVA 5F37A 1GOFA 4HL0A 2D93A 1PZ9A 4TLFA 1RUI1 1N1SA 3KHBA 5GZEA 2VQUA 1HKDA 3ZVXA 1YXWA 4YG0A 3PL0A 1BHGA 2VU9A 2WNUC 4XJ9A 1PNGA 1LNSA 1CAUB 3ZX7A 3GCWA 3O5SA 2HWC3 2PAMA 4UFLA 1RHI1 4CU9A 1ULPA 2PHFA 1PO22 1OMIA 4YFZA 2GMPA 2ZHNA 4QB6A 3ACHA 5JMCA 1LOFA 4Y22A 5I0TA 4MXWA 2WO1A 1UL9A 1ENSA 5A7QA 1XNTA 3D82A 1IKQA 1DBNA 1AR83 4M01A 3MICA 1W90A 2D6KA 4H3WA 3FHIB 4IE4A 3M3OA 4Q4V2 2A73B 4C0HA 4Z2WA 2ZGMA 1ND3A 2V72A 5FLJA 4ES9A 2HYXA 1H2NA 2WBKA 4KWLA 1JUHA 4LKSA 2EIBA 1D0HA 1MEC2 4K6BA 2ZCWA 2JICA 2QNKA 3HBKA 3HBZA 2ZAAA 3ASIA 1SLIA 4Q29A 3SITA 2VOVA 4I0AA 3VBUC 3ZOIA 4AL9A 4LK6A 4OQ8A 2BYVE 5FZ7A 1PO13 2VD7A 3I54A 3ENRA 1ND2A 3CJIB 4LO6B 4UT5A 3N9NA 3ZFGA 2XBO1 4H2AA 3ZSEA 4P9IA 5FYIA 4WM7A 4LOTA 4Y20B 1LODA 1ODNA 2X53S 3NNMA 4IXLA 2A70A 1WLDA 4LMFA 4PDWC 4A45A 1S0JA 1BMV1 4M3CE 3VBUB 2DUPA 1IS5A 2OX0A 3SKVA 1QH6A 3WR0A 3WOGA 3RI9A 4CXWA 2DV9A 1WW4A 5B2GB 1QXPA 2P6HA 4K1YA 2H6BA 4JGYC 4MGQA 2W08A 1NY71 5A3OA 4COVA 2VL4A 4XFCA 5JSRA 4KNCA 1EV12 1OFNA 4HN0A 2W92A 1EUTA 3W21A 5KR7A 2EIEA 2BBAA 2D6NA 3PMEA 5DUXA 5H9QA 4EWDA 4HG6B 5FP4A 3MFAA 2FDKA 3JXSA 3KT1A 3HAGA 4BB3A 2AACA 3HN3A 1E5SA 4FPJA 5ABJB 3FL7A 1QJX3 3ST7A 3PTRB 4BPZA 2QFEA 4XZPA 2D44A 2P1BA 1W8ZA 3AYCA 1RUG2 4R9AA 2DDUA 2JG9A 2X5IB 1U5IA 2G9GA 5JZGA 1NUKA 3CQOA 4FPHA 4DUXA 1XC6A 3C8XA 1IKPA 1ZVFA 4OI2A 5T3NA 3ZN4A 2VMCA 4LOSA 5FYCA 3J7NA 4G9SB 2RM23 1MS9A 5AFBA 3PIJA 3PTYA 1GFF2 2WNOA 3HWJA 2JDHA 4ASLA 1JMUB 1UOJA 5ACA3 1PGW1 3M1HA 1CZVA 2GNBA 1MQTB 4HXCA 4W6WA 3OCPA 3TN91 5SV5A 1XYPA 1J3QA 2BOIA 2BZDA 2VZTA 3APBA 5M0TA 1O4YA 2J1EA 1GNYA 1XJAA 1OVPA 4JGZA 3I2DA 4K7JA 4YNIA 3AMNA 1PVXA 4XABA 4JHTA 1AR61 2GC2A 1NCQB 4E4DX 4O7XA 4EQVA 2FMDA 2D43A 4XEZA 1ZZ8A 2IXIA 1RMU3 3JBG2 3THTA 5CG9A 4QHBA 4GJYA 5GJ6A 2R043 3M3EA 2R32A 3VKNA 4LEJA 4HMZA 1O59A 2GH8A 3B7MA 3UJOA 3A23A 3URFA 3VN4A 4ZU7A 1DYOA 3U78A 3FBYA 3VKMA 1ACCA 4XUOA 4D7TA 2J1AA 4UFJA 1ZRIA 4D7YA 3H3LA 5DQ0A 3WHTA 2RV9A 3GM8A 1RVF3 1POQA 4EWEA 3WP4A 2I74A 5LATA 3R4UA 5JXHA 2J7MA 4QKBA 1IPKA 2EXIA 1XYOA 2OIIA 1NLRA 3BB6A 3ZN6A 1NE6A 4XETA 3OEAA 4GKXA 2WC2A 2HWF1 3WDUA 2D5HA 1KDKA 3WV6A 3OBZA 4N43B 1VMHA 5FMCA 3VZLA 1TG7A 3T2OA 1T6GC 5ABJA 1US3A 1ZBA2 1NG0A 3AK0A 4KMQA 5C9AA 2GC1A 1PX3A 1ULDA 2FCVA 3D5OA 4E4ZA 4RL7A 4N53A 4S2DA 3IM0A 1UN1A 3ROUA 1EY2A 1YIFA 2PHLA 4LA3A 3WNOA 3KCYA 2D6LX 5A32B 5F32A 2RE9A 4CDUA 4RQPC 5JR7B 3WF2A 4HVOA 2HWB1 1MS8A 2FDIA 2RHPA 4C1WA 5T52A 1IZ3A 2WZR1 4META 3KWVA 3O1TA 5JLVA 3N36A 5FBJA 3U0ZA 1AXKA 1HB3A 4DEQA 3RWKX 4C0BA 3CKHA 2Q1FA 4IETA 4DINB 4A42A 4JGZB 4K8RB 3RS6A 1BVVA 3VZNA 4ISQA 2QTWB 1N1TA 4KGQA 1LHOA 2PA7A 3DKWA 1RITA 4AI2A 1VMFA 5K7PA 2JG8C 2R073 3ORJA 2R0FA 5GLUA 1JOPA 3DYOA 2CAVA 2JIGA 2HJIA 3LPFA 4ZONA 1NXMA 4CUGA 3AFGA 1D2SA 1JN2P 1UXXX 3O0WA 4HPKB 5IVVA 3SNMA 2KXLA 1UZWA 3S7EA 1RXFA 3LOBA 2JDKA 5EJZB 3AMPA 1ZZ6A 2Z42A 1U12A 4UFIA 1VBA3 3JD73 2A71A 4QDSA 3VDDB 3HD8B 4AW7A 1AL23 4XHBA 4F7ZA 4I0WB 5F9TA 2DCKA 4ES8A 1REEA 1PMJX 1TNRA 3WQ7A 3HNYM 5FZ9A 4BWOA 4CP2A 4IEPA 3ACIA 2RDRA 1XNDA 1SACA 4I09A 2WKKA 4NHLA 4OHYA 4H7MA 2RS13 5LK5A 1HXS1 1MZEA 1X7NA 1G9CA 3AYAA 1BVP1 3MHZA 1AX0A 2EIDA 3MI8A 3OGVA 1WD4A 1F31A 4XFAA 4M3CA 5GZGA 2GNTA 3KGLA 4WV8A 4ZZ5A 1WW7A 1XE7A 5FDBA 2Y60A 3NVCA 2FMYA 4I2OA 2W1WA 5FY0A 1FATA 4TWTA 4ZXEA 4B4RA 1G9BA 4FTSA 5FUNA 1KJLA 1A6CA 2C0ZA 5E1RA 2DVGA 3IN9A 2Q8EA 5EWSA 4Y22B 4PIYA 3VKFC 4KWKA 4AVTA 4CCCA 1HDKA 4Y1UA 3S7IA 4QQPA 1ENQA 1RGSA 2VGDA 1C1FA 1BKZA 4FOYA 1RXGA 3ZYHA 4CE8A 1R093 5E16A 1QXJA 4AEKA 3H8RA 3LFMA 3H42B 1ULEA 1W6MB 1U0AA 1ZA4A 3TB0A 1UYPA 5FP9A 1UOGA 4KL1A 4CDWA 3VDBA 1U5YA 4CUAA 1ZYBA 5A1AA 3WQ1A 1AR72 3LSEA 5F2WA 5IT6A 2CGNA 4DY5A 5IFTA 4CDXB 2WR9A 2DURA 2X5IA 4PBOA 3IZOA 3VL8A 2HWE1 1ULFA 2YC4A 4R9CA 1GWMA 2AEZA 2HWF3 5L9RA 2XJRA 4LK7A 4ZKTB 2W95A 3D6EA 2VMGA 1YC61 4Q26A 1SG3A 4NPMA 2ORXA 3AP7A 4AGRA 4B4PA 5KHIA 2BNOA 3WUDA 1JODA 3BU7A 3ZXGA 3DUIA 1FV2A 2RS33 1G7YA 2JD4A 1TMF3 2YZ4A 1K3IA 1CQ9A 1H2LA 1H9PA 1UU6A 4MLOA 2OZJA 4BQ4A 2BTVC 1W8OA 1SLTA 2P2KA 4BM8A 4WM8B 3RMYA 4M3CB 3H8UA 1LOEA 1DQ0A 2A5ZA 1RUC3 3CO2A 1Q8SA 5A3UA 1OQ1A 4ATFA 4XUNA 4CCMA 4N9IA 4YZ5A 3LQCA 5SV8A 2I2SA 1AHSA 3DEMA 3NV3A 1LOFC 2QZ2A 3MFCA 2A3XA 1UU4A 3HR9A 4B1LA 2XUEA 4P9JA 2CSGA 1CPMA 3M3CA 3O0XA 5CFDA 1CAVA 3I2IA 4BOWA 1OUXA 1HQLA 1UO9A 4Y4YA 4AYUA 4QGMA 3JQXA 4AFAA 3VBSB 1GWKA 1MACA 2Z79A 4Z1VA 3NAPB 3AMQA 3ZR6A 1WKYA 1FOD1 2Y33A 3SHRA 3RNSA 2R16A 4YGDA 3PU8A 5IW0A 3WNKA 1AYM1 2A3WA 3H50A 1H30A 4LBMA 5C5UA 4FPLA 2WJSA 4O65A 3KT4A 4OMCA 1S4CA 2ID4A 2VUDA 3LDKA 4EZHA 1LOGA 2JE7A 2IUWA 2ARBA 2ENRA 2XJUA 3DF0A 1AJKA 1GU3A 1QKQA 4XDOA 5FYZA 3T2TA 4IE7A 1IS4A 1JHNA 2WO3A 5J1XA 2XJTA 1DZQA 3OBAA 4WM7C 5E8AA 2HEYF 2FCTA 4DPNA 2AEYA 4I0BA 3HOBA 2RDSA 1OBNA 2QZ3A 2ZXQA 2UYAA 2JE8A 4NHYA 3UGFA 2WN3A 3UJQA 4LE4A 2J42A 1RUE1 1UIJA 2OT7A 3S5QA 1VBE3 2VMFA 1TZOA 5CEHA 1REFA 5LEJA 2C4XA 4XJZA 5JIUA 3SH4A 5IK7A 3GZEA 4FTBA 4JCKA 2K46A 3O14A 5IVEA 4Q4V1 1OPOA 5LRRA 5BNOC 1J1LA 5JAXA 2VZUA 3R4SA 2ERFA 1CJDA 3WNPA 3I59B 1V70A 1KD7A 5HPOA 4BLIA 3PMSA 4PI2A 4E4HA 5L7OC 3LA7A 2W91A 2PXJA 4CCLA 4COZA 5HBAA 1C8M1 1RUOA 3AJZA 2RS32 3M3IA 1LCLA 2GZWA 1O5UA 1VE0A 1O4TA 2BWCA 4OZOA 4XXAA 2QDRA 3JB4C 1JYNA 3FLPA 5F3IA 3TNPB 1R083 2R1BA 4N53B 3FFQA 3OUHA 1PMHX 1KGYA 2PQSA 1RYYA 4FXGB 3N9QA 5DUUA 5DDJ1 4XJAA 5AFEA 4AI9A 2VZRA 2VZ1A 3UGGA 3RRDA 1CAXB 4ET7A 1VBB1 4W8JA 3CJIC 3MIFA 1VP6A 2D6PA 2ARAA 1MZ6A 4HBNA 3V65A 3ZN6B 5IAXA 1DU3D 3A0KA 1JZ3A 1Y9QA 4QXKA 3O1MA 1JH5A 3CZUA 1YQ2A 5IATA 2PHTA 4QB1A 3LF7A 3MIHA 4NOTA 5ANQA 4YVSA 1MPXA 1SZBA 4QD2A 2VOKA 4LULA 5IJRA 3WNNA 4B8EA 4AI3A 1I1EA 5IYYA 1UX7A 4GWNA 3FN9A 1VBD1 5B4XA 1JS9A 4HVQA 4A6OA 1TMF2 4PHZA 2VCBA 5GLTA 3IDAA 1WCSA 1WLWA 1POV0 1RUH3 3K51A 3KSCA 4INDA 3WVJA 1OHFA 2D6OX 3JQWA 2WFF3 5FXZA 2ZGQA 1BBT2 1J58A 3BGAA 3KGZA 4FFFA 4FO9A 1N1VA 4WVMB 4E27A 4XDQA 5KBFA 5D1IA 1UXZA 2Y0OA 3O1PA 4IDZA 4GKYA 2XVLA 5JI7A 2Y64A 5C8CB 4YRDA 3IDEA 4PIZA 4CEYA 1D4M1 1W0OA 4KU8A 1LTEA 1TME1 2DFCA 3WF4A 4COYA 2QQWA 5JXIA 2R042 3SEPA 2LRPA 5HV4A 3NSTA 3N9MA 1FPN1 1X9PA 5C4WB 3VDDC 1SQ4A 2W94A 3G7DA 4CP0A 4WBBA 3ETQA 3BPSA 2ZEYA 3OF1A 4PDWB 4FSJA 5FZ4A 3VHOA 5C9AC 1RUF3 4YYOA 4MXVA 2JJ6A 1LKNA 2P3IA 1JOJA 1SDDB 3T30A 2IVIB 5FYVA 3WZ1A 3WG4A 5BXXA 1A34A 1XU1A 3NNGA 3LOIA 3WDXA 4CDUC 1IS6A 1DLLA 3VBUA 4LBLA 2E7QA 2RMU1 3FZ3A 4FPGA 4Y4RA 4IV1B 3VBRA 1ND2C 3HN1A 4P9YA 4IW3A 2BNNA 4C1XA 4BQWA 1Q43A 3VBFB 3OYWB 1SPPA 3KQ4B 1AXZA 1LESA 5FUPA 1ND3C 5I8SA 2R30A 5D8AC 1UWWA 2VECA 2RR13 2RS53 2WS92 4ZPIA 3LIGA 2Y6LA 3ZXJA 4Q0PA 3K3OA 5A70A 1VMJA 2WT1A 5DDJ2 4LBOA 1OFSA 2UY9A 2Z5WA 1VBE2 3O1RA 1H0BA 4U2AA 3IAQA 2VM9A 1DZTA 3AP5A 1V6JA 1X36A 3J8F1 4AZZA 4Q4Y1 2Q8OA 1A3KA 2WUHA 5FQ0A 1V6OA 4WVVA 4CDXA 4H14A 5A6XA 3V0AB 3ZYIB 5LW9A 1AF9A 2K0GA 1GP4A 3CJXA 4Q4W3 5FR3A 2BP6A 2X05A 4MO3M 3UYJA 5FPUA 5KXBA 2A1XA 4L97A 4LKEA 5FY5A 2XHNA 4GZ9A 4N8MA 1DQ6A 2XDVA 3H1YA 5GLWA 1W6MA 5FIXA 5GZCA 1JYCA 1WA4A 4TYSA 1Q56A 1POV1 2FDGA 1MQTA 2C6SA 2XH6A 3T0BA 4PI0A 1APNA 3BTXA 2KR2A 2G9ZA 2GSYA 2HWB2 3AZXA 4XCBA 3RZGA 2HBTA 4OQ9A 3J7LA 5D8AB 5DZFA 4OFGA 2XL7A 2DVBA 1JOBA 5TSWA 4J25A 4WZCA 4BA6A 2EICA 1XOYA 1B09A 1R1A2 2EXKA 3NNJA 3WSOA 5KC5A 2V73A 3DPRB 4KBZA 3BU0A 1EAH1 2OPKA 4BDVB 2YBKA 4B3NA 4CU8A 1S0BA 1LOBA 1OA3A 1WCKA 2BRTA 2WWUA 4PLOA 4IEZA 4CDUB 3DKQA 3ZFFA 1JTZX 2DCYA 3VBOC 4OLLA 1W06A 4GALA 1AYM2 2F4LA 2BEOA 2JG9C 2VZOA 4KG8A 2DFBA 5F3GA 5F39A 3M2MA 5FKCA 1TVGA 4P5HA 3T4HB 4DRVA 1P8JA 1FOD2 1W6OA 2XBO3 4KG0A 3VHRA 4AFCA 2C9KA 4QU2A 4AFDA 5CADA 3THCA 2W3JA 1XE0A 1HB1A 5CBLA 4QX5A 4JX0A 1QJX2 1VRH1 1F9KA 3BOPA 1I3HA 3UKTA 3OYWA 3GHNA 5C7GA 3N7LA 1VJ2A 2EALA 1W04A 4LBQB 4F3JA 3N35A 4JDOA 4LLOA 5BNPC 3K2OA 4AQTA 4BMBA 3CLPA 3BTYA 2WFF1 3P3PA 2VH9A 1GWLA 2L9LA 4CDWC 1RUI3 4BQ1A 1TNFA 4YW5A 1S0GA 2FHRA 3ZSKA 1ZRRA 2A6XA 3BYWA 3NO8A 3OOXA 1FNYA 2X5IC 3POBA 1UCXA 2HWC1 3ACFA 4XFGA 2YGMA 3AX4A 1QJX1 1VRH2 3KVAA 3EQEA 3M3QA 4DNYA 1QJY3 1FPN3 1CN1A 4D6RA 1JZ8A 5IK4A 5J36A 3BOWA 2PN5A 1YQCA 4L99A 5FP3A 1KFXL 3WDYA 2R062 1NLSA 4ASMB 3IPVB 5C8WA 4XFFA 2ZX2A 1UNBA 4QDQA 1ST8A 4A7KA 2VC9A 2HEVF 1PIV2 3USSA 5FJKA 3OG2A 4WVWA 5JOYA 2RDNA 3BODA 1X9TA 2WNVA 3N3HA 1W0PA 3MW3A 5F7UA 3ZM8A 2ZGUA 5LB6A 1MZFA 3MIGA 4BIFA 2DCJA 4LBJA 4MSVA 4Q1PA 4YW2A 4YARA 2DVFA 2VUAA 3MO4A 3QH6A 2XJQA 1GSLA 4GQ7A 1MS4A 2WT0A 2A75A 1ZRCA 1H4HA 1ZZCA 2PELA 2VQ0A 3AYEA 1JU3A 5GKAC 3ZYFA 2PMWB 2PHWA 4HPKA 5LY1A 2GNDA 4IEWA 1W6OB 4M0NA 3WINE 1KS5A 1W9SA 1ZA7A 2R041 5DAQA 5KXDA 3NJXA 4PQQA 3LZZA 1YLLA 4OUMA 1RUC2 3OGSA 5C8CA 2VNGA 3QLQA 4JRLA 3W5MA 5FKBA 2WYSA 2AR6A 1ZREA 4Q4X1 4FFGA 2RVAA 2VCMA 4FPFA 5K4LA 2NZ9A 1O8PA 5FO7B 3ZFEB 2XVKA 4DXRA 1ALYA 1J3PA 4KQ7A 2W5FA 4NPRA 2XJPA 1QOTA 1H6XA 2QQMA 4FFIA 3H0OA 2BFUS 2WS91 5LBCA 2VMHA 3RFRA 2Q5TA 4Q0VA 2EAKA 1LRHA 1RVF2 1POV3 4JKKA 4YW4A 1PIV3 4Z92B 5LEKA 1ZM1A 4XC9A 5A7NA 2FBEA 4FI9A 4FBFA 4PT6A 4XILA 1DQ4A 2VNVA 1IGOA 4AHXA 4IUGA 1LAJA 4IEOA 4N9HA 1NCRA 1N3OA 1V9U1 4DXSA 3A0NA 2BBVA 3CZJA 3H3UA 2WZ8A 3VD5A 1OI6A 1HXS2 1YIPA 2WAOA 3VBHB 1H8TC 1LOCA 4P14A 5FPBA 2F6BA 2RM21 3V56A 4Y1XA 5C4WC 1STMA 2W39A 4QQHA 1FYUA 2BQPA 1HN1A 2P6CA 4KU7A 5FMOL 4PF1A 5FREA 5L19A 2ADEA 1PVC1 5HV0A 1K42A 1MR5A 1W6PB 4H7LA 2OQ7A 1SBEA 1W9FA 5GM0A 1OD5A 1YFYA 4XMAA 1I5PA 1VPHA 3PUQA 1BCXA 3AZYA 2RJKA 3J7MA 2CV6A 2WDBA 3OJBA 1Q5OA 4MXWB 5HCFA 1RHI2 5I8YA 2RDQA 4AXOA 2TNFA 3J7HA 1AJOA 3K4DA 5A6ZA 2XLFA 3N9PA 4ZS2A 1GV9A 4UBHA 3FLRA 1S0FA 3ABZA 3POYA 2VMIA 4A6SA 1ONAA 1S0CA 2EXJA 5IVBA 3RZMA 5JPNB 1L3JA 5BNOB 3WP6A 3RSJA 2ZEWA 4COUA 1PGL2 1VBA1 3ZLIA 4BQ2A 1AL21 4XBNA 1K5MB 1H8TB 2PAKA 1DGRN 4LORA 3SXWA 4AQSA 3WG2A 5FXWA 2CGPA 1QQP1 2HBUA 4QMAA 1QJU3 1I6XA 4N90A 3ETPA 3MYXA 3QOPA 4XBLA 1Q8PA 2IC1A 3RYKA 3IB3A 5J37A 1H1MA 2WQZC 1G6NA 2VTFA 3L2YA 4NIIA 3BUCA 1NZCA 1ZBA1 4XAAA 1RINA 3S30A 5AC91 2XG3A 3LCPA 1DG6A 4PQ9A 2YYOA 4CUCA 4YWAA 1JYTA 1SFYA 5T5LA 2ZGKA 2Q1ZB 2A6YA 1S0IA 1BXHA 5DAVA 1WWYA 4IV1A 3VBRB 1ZNPA 2ZA9A 1S2EA 1VB4A 2H0BA 5CFDB 2ZGPA 1E5RA 5LY2A 4B29A 4IGQA 5DZEA 2XJSA 4DXTA 3LEGA 5JIAA 4R9DA 4RS5C 5K0UA 4QGLA 1TE1B 5JI9A 4DFSA 1H9WA 1EUUA 2B7YA 2ATFA 4JQTA 1GP6A 3WF3A 4O61A 4BH9A 2OUHA 3IWZA 5FZ1A 5CFDC 1D4VB 2ZHKA 3OTFA 5H9SA 1H1AA 2YB7A 3ZIWA 1AUYA 3ZPOA 2Q0AA 4E2GA 3K4ZA 4LHLA 1LB2A 1FAYA 3V0AA 1BYHA 5FZLA 4HK9A 3HQXA 3NKTA 3OUIA 3K4AA 2Y0IA 3AKTA 4X6RB 4Y26A 1OXCA 1PHMA 1D0GA 1GICA 5JDBA 4AI0A 1WMXA 2RJ2A 3EO6A 3KF3A 4GH4C 4YW7A 3Q8AA 3OB8A 1E57A 4BK4A 5FZMA 1MS0A 2WS93 3CNAA 5CZKA 1AR73 4AK3A 4XF1A 4YSFA 1JYWA 1KRIA 3VDCA 3TEYA 1FI2A 4W6XA 3RVHA 4DQAA 3MPPG 1GYKA 3C7GA 1PIV1 4D94A 1IQAA 4AF9A 1RMU2 4BQYA 1PK6A 1SMVA 3WHUA 2GC3A 3I97A 3OPZA 2HWD2 1ASJ2 3H3ZA 1RUG3 4E9KA 5IVJA 4A3XA 2AZ5A 2XONA 1R64A 1CIYA 4N7IA 2JX9A 2CHHA 2XWBB 2VTXA 2VUCA 3P3NA 1QMJA 2ZEZA 2I45A 1HXS3 5BYNA 1DQ2A 1KS4A 1SEFA 3K77A 1XSQA 1UYYA 5DAPA 3GNEA 4Q4X2 2YFZA 3JU9A 2FDJA 2YROA 2CY6A 3USUA 2HH9A 2YHJA 1AR92 1HRV3 3F2ZA 5ACA2 1OH4A 1RUC1 2GAUA 5FZ3A 4LXLA 2D6MA 3MW4A 1JU4A 1EV11 3QBQA 4A3ZA 3T0DA 4FPOB 1OKQA 1AR91 4CEYB 2VY0A 1QHDA 1JBCA 1XNBA 4LO7A 2IXHA 3KHCA 1W9YA 3JBG3 2ZGSA 4XW3A 1JI6A 1ZZ9A 2GDFA 3CU7A 4P5YA 2QVSB 1CAWB 2GU9A 3NV2A 4P9WA 3B01A 1RUE2 3IKWA 2IFRA 4PDWA 5DUVA 3S6PA 2WQ8A 3S57A 4X8PA 1JYVA 5F3EA 3GBWA 4C8DA 2ZJCA 2JDYA 1WCUA 2HWD1 5L36A 4L8QA 1FOD3 2XBO2 4JGYA 3WLUA 3IIAA 4C91A 2X09A 4CDQC 2NLRA 2JB8A 4FPCA 1XRUA 3DYMA 2E7TA 3PU3A 1H2MA 5JSPA 1GP5A 3KVBA 1R1A1 1NA1A 2ZTNA 3VZKA 3O1VA 5T5JA 2A6VA 2GMMA 1F8VA 3IPVA 3E5QA 4XAEA 4LTAA 1H1IA 1BJQA 2W1SA 5FXXA 3U10A 3TEZA 4WVMA 3VV1A 4EN9B 4BE3A 2P5BA 5F3CA 1W8UA 4D3WA 3PIGA 4FAHA 1ZBA3 4ZU4A 4LPLA 5CB7A 3L9JT 2WT2A 2PLV3 5BNNC 2JECA 5F5IA 1WD3A 3HT1A 3I2FA 5FPLA 1QNYA 1HW5A 4K40A 4ORFA 2JKBA 3BPZA 1W99A 2QKDA 2WFF2 4XURA 1O3SA 5FO9B 1C3HA 5CFCA 2BWAA 1MVEA 4S2FA 2D3SA 3P1IA 3AXEA 1DGWX 1FMD1 2XWJB 4CEYC 3ZSLA 3NNLA 2FCUA 2Y26A 1HN0A 3B5LB 3HT2A 3DXUA 4UW4A 5IAVA 4OUSA 3VDDA 4CCKA 2DCTA 5JOXA 3M4FA 4LT5A 2JDAA 2VMDA 1RUI2 1GOGA 4QQ2A 3KD4A 3OSDA 3TRSB 4QT6A 3MZHA 1ZRDA 3AZZA 2QBXA 4CRQA 3WDVA 4V2VA 5AC92 1OLQA 3OBTA 4YGEA 2D5FA 1SBDA 1CGPA 1VBB3 4OI0A 1C57A 4COWA 4RHV3 2WNVC 1OLMA 5J3UA 3NJZA 1LHWA 1RJ7A 2XLAA 4J1WA 5A3NA 3Q8CA 5CIRA 3VBRC 2VNRA 3VBHC 1VBA2 1RUNA 2HEWF 1X82A 1O5LA 4L11A 4IEXA 4LKDA 2Q8DA 3A22A 3OUJA 5A1FA 2QDNA 4GA9A 1B35C 2E6VA 1Y7BA 2G19A 4JRAA 1GZCA 1UY4A 2ZX0A 1PGL1 5FQ0B 1VBD3 3PVNA 4QAWA 1ZBE3 2ZGTA 3UV9A 3VHNA 4AGGA 1OA2A 1CIWA 3BALA 2F17A 1CZTA 1F4AA 4I3PA 1QEXA 1OVSA 1D4M2 3UK9A 4HETA 4G3YC 3TBDA 5FZCA 1WW5A 5AVAA 2VQAA 1PO23 3AVSA 1JHJA 4OHXA 5JMOA 5E6HA 2BU9A 2ZGOA 1BQPA 3FLTA 4NWWA 5FZGA 1VBE1 2K9ZA 4GD4A 5C3SA 5IK5A 1W6QB 1K5MA 5D8AA 3BCWA 4AVVA 4Q8KA 1LULA 4RN5A 2ZX1A 1UMZA 2WO2A 3I2JA 5BV6A 2B9UA 4XIOA 4Q4V3 5LA1A 3JBG1 2DVAA 5FTTC 1W05A 2ZZJA 3KZ4C 1JZ7A 1YQ5A 2ZMKA 2Y6JA 3BKZA 3UL2A 3GZUC 3MDPA 1NT0A 5FYYA 4H55A 3U4SA 4CDXC 5HCHA 5KC6A 1YCIA 2EXHA 1BEV1 2VW2A 4DMIA 1NCRC 1ODMA 4LBKA 4DUWA 2YBSA 3LKJA 2X29A 2YDEA 3THPA 3UKNA 3CBNA 4CP9A 2ZABA 3W9AA 3POIA 1V0AA 3WDTA 1XNKA 1S1AA 4BK5A 4M3CF 4Z8BA 4LBQA 5FRAA 4YW1A 3IIIA 5L73A 5A3PA 1MQTC 1I5ZA 1QDOA 4FPYA 1W2NA 1YUDA 2C26A 4K8FA 3W58A 2Q30A 5IVFA 1CONA 4ATEA 4MG2A 4LITA 3FFZA 2WWJA 2DBIA 3FUQA 1F5FA 3R0RA 4QKFA 2DUQA 2O1QA 5FYBA 1H2KA 1QU0A 1Z7S3 2VUJA 1W6NB 2YC0A 3C7EA 5D2AA 5I91A 2PLV1 4GB33 3LGRA 4MZUA 5FV3A 5JOWA 5F6KA 5A7SA 4PIXA 3V0BA 5DAWA 2HKXA 3J8F3 4XYXA 1S2BA 3ZFFC 2DU1A 3VBOA 4FAGA 4KI5M 3E5XA 1AX2A 1QOOA 1UPSA 3M7AA 4XE9A 5FPVA 1W9WA 4Y33A 4AE2A 1UKRA 1UY0A 1LEMA 4AOCA 2UWAA 1RUH1 1IS3A 2C1FA 3G6JB 2NYYA 5K0UB 1ZRFA 3WT3A 1DLCA 4AVAA 1FMD3 3GCXA 5FZ0A 3P6BA 3WG1A 3NKGA 2AGSA 3BIWE 5DABA 5CG8A 4CCOA 2YPDA 1PM4A 1KXGA 4XQ4A 4UXAA 4W50A 2Z69A 1ULGA 2P3JA 3SCGA 2ET1A 3J9SA 5FY7A 2XQRA 2JDNA 4Q4W2 3WP5A 4AQ6A 3I49A 1QJY2 3PURA 2VCAA 1D4M3 3M8LA 1YFUA 5KHKA 2R063 4QPYA 4XQDA 1ENXA 2YFUA 3POEA 4DZGA 4GULA 1YNAA 3TYJA 4BQ3A 5JCTA 3IBMA 1NCRB 1EAH3 4MHUA 2H0VA 4M4RA 3RZZA 3D0SA 1GNZA 3USUB 1AVBA 1S0EA 1HRI2 3I3EA 3EMRA 4IQPA 5LBBA 3FHAA 3BN6A 1DZRA 1FXZA 3K46A 3N7JA 5FYTA 4BLJA 3W20A 3LDBA 2HWC2 2YPJA 2R0HA 2ZMLA 1PK6B 4QX1A 4UYBA 5CU1A 2CYFA 2PHRA 5EJ3A 4SLIA 3QD6A 4CP9B 3AZVA 4TXWA 3T0AA 1WUVA 3DPRC 3B02A 2VZSA 4JKMA 4EWAA 2W52A 1WBFA 4WZFA 2RMU3 2ZGNA 4LE3A 2GH2A 4CYDA 1BLZA 3N7KA 5A6YA 1VRH3 1W6PA 4CCEA 5FMBA 2GP3A 2AREA 5L7OA 3D0JA 1O7FA 1O8SA 1SLBA 3ZXFA 4DO0A 5ERLA 4YM1A 1W39A 2EA7A 1AR82 3RMXA 4EYUA 1AR63 2RR11 3I3DA 1PO21 2K2SA 5JSOA 2P3YA 1OH3A 1S0DA 5EPAA 5FYMA 5ANNA 2PQQA 5C3RA 4UF0B 3PLQA 5I0RA 1OLME 1JZ6A 5CKNA 5CISA 2O8OA 2QQUA 1CAXA 5FWEA 3SKJE 4URAA 3ZXKA 3J26N 1OC1A 3WW3A 4BQ5A 1F5JA 5GLVA 1G8WA 4R4XA 5KHGA 2YBPA 3WP3A 1W3VA 4AVCA 5GLZA 3RQ0A 3I4IA 4AAPA 4UI9L 4IEUA 4QM9A 5J98B 3DL3A 3C2UA 1BK0A 1VRBA 2XQXA 2E63A 4OI4A 4QXBA 5F8PA 2XMLA 5LRSA 3K3NA 4IE0A 1AL22 1E5IA 1YYNA 2XR4A 1W2TA 2WABA 5A3LA 4WVZA 4YZ3A 3B9IA 3PJYA 5CFCB 1VBC3 5LCWL 2OXBA 3U4XA 1OKOA 3RZHA 2VCCA 4JVAA 3NJYA 2P3KA 4LR4A 4CDQB 1OLRA 1Y3TA 4NAOA 4QPGC 1ZX5A 1FT9A 4GXLA 4OZXA 2BOJA 2GNMA 3VZJA 3U11A 4Q0UA 3WQBA 3NQHA 3GBGA 1CZSA 5T5PA 1SFPA 5CYYA 3AC0A 4YLZA 3MW2A 3RPQA 4DXZA 4YG3A 4XFBA 3WCRA 1AL0G 4Z2AA 5ACA1 1NY72 4LO4B 4ASKA 5EJ1B 2ZHMA 3ZYGA 4E2SA 2NQYA 4RR3C 3LEKA 4GWIA 4NRMA 4CDWB 3J8F2 1H8TA 2R49A 1KFUL 1HRI3 4QX7A 1LGNA 2VTXJ 1HJFA 3H9AA 2A7AA 4UFHA 5C4WA 3RZKA 2QQNA 1UKGA 1BMV2 5C3OA 3E6DA 4L92A 3AKPA 2RM22 5T54A 2JDUA 3T2QA 1WZXA 4XVHA 5FYSA 2VG9A 1RIRA 1WMDA 2WZR2 4IERA 4CXYA 2ILMA 1RMU1 2RMU2 2DF7A 3GXUA 1A8MA 4AQ2A 4UF0A 2G4IA 1KDMA 3EJKA 3POFA 2J22A 1IPJA 1JUIA 4YGCA 3S0MA 1V6NA 3EB7A 3ZKYA 3H8XA 3AVRA 4NRPA 1XQNA 2BGPA 1RVF1 3D4KA 3AMHA 4QQLA 2H6CA 2HLEA 3KV9A 4I3GA 4MGKE 4X6QB 5EQUA 4BJ0A 1QOSA 4NR1A 1LHNA 3T08A 3N4MA 4IEQA 4CZSA 1UF2C 1KITA 2R1DA 1HB4A 3D8CA 2HWF2 1G9FA 2V4VA 2EVXA 4IV1C 4RSUA 1DCSA 2WA4A 4NRQA 2OYZA 3THDA 5IHRA 1SFNA 1KJRA 3HJRA 4EV0A 4GH4B 3POSA 1RB8G 2IXLA 2VOXA 2ZBJA 3C7OA 3E6CC 4OUEA 3AL5A 2W1UA 2QE3A 1IPSA 3E97A 1IG3A 2B4KA 2GALA 3LWCA 3POJA 4NHXA 4NUBA 3VLBB 2IZWA 2NN8A 3FHQA 5IVCA 1WCQA 3NWKA 2WINB 3Q9OA 4MHRA 3V64A 3VHPA 1L7RA 1UZZA 2BV4A 3VD3A 4CA9A 5F2SA 5FAXA 5L9BA 2LTNA 4NIGA 1S2KA 2BW8A 2VZVA 3ZSMA 2QJVA 1RL3A 1QJU2 3LAGA 4MV2A 3I7DA 4Y5Z0 1K5JA 1RUD3 1UMHA 2MHFA 4JDMA 4P08A 4QKDA 1UZ0A 1J1TA 3PHMA 5CVRA 3QCWA 2WZR3 4ZY9A 1VBD2 1UMIA 3GZTB 3POWA 3WW4A 4DEVA 2P17A 3KV5A 3O7OA 2QQIA 3TAYA 4IV3C 4RS5A 1C5IA 2IVJA 1RUJ1 5FZBA 4ITCA 1DF0A 5JVVA 4Y5SA 4AI8A 4F83A 3TN92 5BPXA 4M0HA 4QB2A 4QPIC 4MGIE 3VKOA 4GWJA 4SBVA 1SBFA 5KHHA 1HV0A 3HPNA 1PGW2 1HV1A 1PK6C 2R071 3PVOA 2KM2A 1GOHA 2ZACA 4CUBA 4OVEA 1PM7A 1NCQA 5JR2A 2VXRA 5FZOA 1EPZA 2PHUA 5F5CA 1PZ7A 3WNMA 1JYIA 5IVYA 1XU2A 5FFOC 5C71A 1LENA 4QWNA 1W2AX 1VBC1 1DHKB 1V6IA 1COV1 2VNOA 4OYUA 2WSUA 1DYPA 4LBQD 2RS31 4RFRB 3R05A 4YFWA 3MLLA 2F4PA 3ZN5A 2AUYA 3U14A 4P02B 5KXEA 3O0VA 5J96B 5C6CA 4JZRA 4FOWA 1ZBE2 1M4WA 2WZEA 3C3VA 5LA9A 1G9AA 5I0SA 2E51A 4XTMA 4ARXA 4BYYA 4XBQA 3JD72 4LIUA 2B45X 3BVCA 1GR3A 5E89A 1C1LA 4BXSV 1JZ2A 3KLSA 5GZFA 2JENA 3RG0A 3RI8A 1OQEA 4Q5OA 2Y6GA 1CWPA 1NA1B 2DU0A 1VB2A 4XZUG 3U75A 1W8FA 2V09A 3VL9A 1CESA 3ON7A 4OHWA 4CCNA 3FMGA 1UIKA 5FZAA 2ET7A 4DY3A 4ZZ8A 2DWRA 4CCJA 2V4AA 2JE9A 4QQOA 5LWBA 1MS3A 1WW6A 4YGBA 4LNVA 3SCFA 4YVSB 1UYZA 4IV3B 4EJRA 1ENRA 2VZPA 1GNHA 2ARXA 3LPGA 2E33A 1YFXA 2V5DA 2VE1A 3INAA 2VBPA 5BNQA 1W8NA 2BPA2 3FUOA 2J1SA 2O14A 1ZZBA 1DGRA 3ILNA 3AP6A 1SLAA 3L2HA 2G1MA 3ME2A 5CKQA 1RUG1 5I0UA 3VZMA 3LIHA 4MGYE 3OGGA 1MS1A 1NAEA 2VVDA 3H1MA 4FXKB 2IXJA 4XF0A 3MF6A 1Y9GA 3OD0A 5BNNA 3EYPA 4CDQA 2FDHA 2XLGA 2DVDA 3SCHA 3BIEA 4YVWC 4AEJA 4XQWA 4IESA 5FZOB 4CU7A 2JD9A 2WSVA 1NA1C 3CHXA 1LJ7A 4P9LA 4HANA 4BISA 3RZJA 1GLHA 2Y34A 2ZX3A 5CFCC 3KV6A 4JGZC 3B94A 2DUOA 4AEDC 1W28A 1COV2 4CPBD 2ZS6B 3B00A 2OA2A 2YU2A 3K75B 1L7LA 1AR93 3PJQA 3VD7A 4E2QA 3NAPC 3ZFEA 2BDRA 2B42B 1R082 1YWKA 2OQ6A 4W4ZA 4HVRA 5FP7A 4HONA 4GMP0 1XNAA 2CAUA 5FY1A 4FPEA 2NM1A 1K45A 2NP0A 5FLHA 4UFKA 1ASJ1 1H6YA 4QKNA 3WNLA 4LKFA 3PUHA 4HSLA 4CEWC 1C8M3 4D6SA 2HWD3 1O3TA 1F35A 4FFHA 5FK8A 3LEMA 2NMNA 2QQJA 4N7UA 3DYPA 2D40A 5JWPA 4WM7B 4NPLA 2AYHA 3I3MA 3WW1A 5T50A 4B4QA 1LECA 4MGZE 1NXD1 2HWE2 5FZDA 3ELNA 3SISA 1Z0HA 3TWIA 5EYXA 3BTAA 4Q2FA 3VBHA 5FOBB 2FQPA 3NL1A 4CEWB 4XACA 2LROA 2YG0A 3C7HA 5ABJC 2UY8A 5D21A 3ZXEA 1HRV2 3WY6A 3SMHA 1KQRA 4HLTA 4J1XA 5GZDA 1AR71 4Y24A 5T55A 4FTEA 4Z82A 1NX9A 2VQTA 3WD5A 3MEPA 1W6QA 5G04L 4GWMA 1NOVA 4LA2A 2BVBA 1PX4A 5FZKA 1BBT3 4F8AA 5A1LA 5K9YA 4UWDA 1TME2 2OW4A 2QQOA 3RGBA 1M06G 5C33A 4QU1A 4BHPA 1WLCA 4RQPA 3O12A 1COV3 1YQ8A 1W8WA 3VBOB 1Q8QA 1SCSA 3PUSA 1B35A 2A6WA 2WLPA 4RHV2 4QX2A 2C24A 1N1YA 2XXZA 3HMYA 2BGCA 3HEIA 4K21A 4EN6B 3ZPYA 1UZVA 1U5XA 3ACLA 4EZ4A 4XOGA 2MEV2 2PYTA 4ONUA 5BNPB 3JUUA 1Y9MA 4Q27A 2JG8A 1CJPA 2I07B 4P00B 4D69A 1FV3A 4PLMA 3CF6E 4WM8C 4CTEA 2LS6A 1XB9A 3AM2A 3MPBA 1K12A 1OQDA 1RHI3 1UY1A 2AENA 2ZKNA 1QF3A 2W0XA 4IGPA 1MEC1 4XF3A 3WF0A 1JZ5A 1K5MC 3ES4A 3RYRA 1OPMA 5C8CC 2PFWA 1WA6X 3KCCA 4YPJA 3J4UH 5EV7A 2FD8A 1OOPC 1GZWA 1EPWA 3POGA 1VBB2 2W47A 4GMP1 4W65A 1YI9A 2Z2SB 3NRUA 4Q0SA 5DXDA 3UT0A 3AJYA 3U37A 5J7MA 2B9VA 1UYXA 2R7EB 4QPGA 2O8QA 3AKSA 3MLKA 4IEYA 4XMIA 4ZU5A 3ZIXA 3LE0A 3MGUA 3ZDVA 5DDJ3 3X29B 3MIEA 4BMEA 4E8CA 5J48A 3LDRA 1R1A3 2BUKA 1ZBE1 2ZGLA 1GBGA 1XBFA 3SQOA 4CSWA 1UY3A 1C8M2 4QXHA 5JUVA 2EAAA 3AB0A 3KT7A 4Q4Y2 2YGLA 1VBC2 4N43C 5A7WA 1NYWA 3C7FA 3AZWA 4IE6A 3WF1A 4RD7A 1VR3A 4JC1A 4AI1A 4EROA 2WNUB 4RA0A 4BZ4A 3H7JA 2BERA 1GKBA 2VZQA 1U5ZA 3LA3A 1Q3EA 2LALA 4TTGA 2ZMNA 4CU6A 2BVVA 5JOZA 3PUAA 2N7GA 3PUIA 3H7YA 5A3WA 3ZYRA 4GAZA 1GZTA 5DUWA 4MVTA 5FMOS 2YY1A 1S55A 1B35B 1F2NA 4XXPA 3M70A 4LBNA 1NKGA 5H9PA 2VR4A 1J59A 1OD3A 1W8TA 1AX1A 4LO8A 3N7MA 4O9GA 4EE2A 3MLJA 2NPIA 1A8DA 1I9RA 2ZOEB 3RJRA 1YEWA 2V5YA 4XHXA 1PNFA 2WNVB 2HYKA 1PO12 3ZO0B 1DYKA 2XB6C 4DB5A 4GB32 5EFUA 1AYN3 2GP5A 4GJZA 4RGKA 3VBFC 3K48A 3OY8B 3O1SA 2JXAA 1XXNA 2DTWA 1FNZA 4FQ4A 3OEBA 3SH5A 4RGAA 2JIJA 1SLCA 4DS0A 1OF4A 1OA4A 2B8MA 2JEMA 4LIVA 1WCDJ 3HIFA 4MYEA 1QWRA 4RHV1 5LASA 3U1XA 3ZDSA 4D6QA 3AMMA 3H1WA 3I2KA 5A3MA 1W2OA 1QGLA 1MS5A 1RUF1 2G9FA 5ISLA 3T2PA 1AR81 2A3YA 1Z7S1 2XHKA 3RDIA 2VJXA 3DECA 4XTPA 3R4DB 2VOWA 2RS12 3LB9A 4CP1A 1GUIA 2VXJA 1BBT1 2XKPA 4YM0A 4A44A 4S2HA 2X10A 3T3YA 1LHVA 3WG3A 5FOJB 2QQPA 4AR2A 1CX1A 4BU2A 3TN93 1C8NA 4PJYA 5FPXA 2Q1MA 1C28A 3DGTA 2KD7A 5JZGC 2W87A 4FCAA 3KCXA 4R9BA 1CAWA 3EXUA 1AR62 2AH2A 4KH9A 1URXA 4L9BA 2WNUA 1Z78A 1LGCA 1F15A 3N9OA 4IV3A 2E53A 3IMMA 3IDCB 2B46X 3IAPA 5HCAA 1JW6A 2RS51 1GQPA 1QJFA 1N47A 3DV8A 4Y3OA 4XJUA 2XJVA 5FY4A 2WLQA 3W59A 1R092 4JGYB 1CX4A 3SH3A 2WAAA 3R6SA 1JXNA 1LU2A 1NE4A 1NZIA 1TEIA 1W2UA 4IEVA 1V00A 4QPWA 4S2GA 4XPVA 3U07A 5K0UC 5C5TA 4Q4Y3 4CVUA 4AG4A 1O4ZA 4J6GA 4JDNA 1QH7A 2R061 1NCQC 1QJY1 2OVUA 2GMEA 2UURA 2Y6KA 2WYFA 3I2HA 2RS52 4HKWA 1MEC3 1T2XA 2J1UA 4Q4W1 4EN8B 2MPFA 3OBRA 2CL2A 5LBEA 3UNPA 1MVQA 3PVBB 1DQ5A 1YI7A 5IK8A 2ES3A 3E5UA 3QACA 4AVBA 4YW6A 1JYXA 4FQZA 5I0DA 5EP9A 2VO5A 5CAZA 4Q1RA 1GMMA 3WCSA 3O1OA 3TEXA 1T6BX 4B7EA 3NV4A 4GH4A 4NHKA 5FZEA 4HT1T 1HX6A 4YM3A 4PLNA 2VW1A 1UW8A 1V6MA 4E8DA 2WO7A 2LM3A 1H4GA 3ZFGC 4C90A 3VD9A 2PLV2 4Y1VA 5FZFA 5BY5A 2CNAA 2ZZQA 3CEWA 1W3XA 3Q8FA 1AYN2 1QJEA 2P4EA 3DCQA 3WW2A 1LGBA 3NJVA 5A33B 2HWB3 4NIDA 4W6YA 1YO8A 3I3BA 5BNOA 3ACGA 2FZ1A 1OURA 3CDZB 4R8HA 3LA2A 2QQLA 3WUCA 4G4FA 2J1TA 2VMEA 1ND3B 2WWSA 1EAH2 2YMZA 4NWVA 2NMOA 4Y1YA 4QGNA 1TQ5A 1O6UA 4DRRA 5IFPA 4RR3A 3MUZ1 2VVEA 3CMGA 1W03A 4XUQA 2MNGA 1BEV2 1OT5A 2LW8A 4FOQA 2VULA 3HQUA 3PNAA 1SPPB 2EIGA 3GHMA 1SDWA 4K1ZA 1QIQA 1A78A 1HQWA 4NAMA 4A41A 2BJSA 2DYCA 1RTVA 1CAUA 3IMNA 1E5HA 1WGPA 1AYN1 4D0QA 5HXMA 5C3PA 4B7KA 3VD4A 3JD71 2BFUL 5DG1A 4HK8A 4L2NA 2RR12 2ZAHA 5A7OA 1GQHA 5I93A 4V1PA 4NVPA 2UWCA 3AFKA 3ITQA 1V9U3 4A7ZA 2UYBA 2WZPP 2RS11 3D3AA 5IUQA 3ZXLA 1D7PM 1WMFA 5H9RA 4AFMA 2VBBA 2TBVA 1XPWA 2WNEA 1UY2A 3KB5A 3T09A 5LA0A 3FX3A 5BUVA 1KEXA 2RJLA 5DZGA 4BXFA 3NAPA 4QX8A 4U36A 2CDOA 3VBSC 4MGSA 4A2UA 4YZ1A 4OI1A 2YXSA 3GDBA 1DIWA 3A7QA 1PVC3 2UU8A 2UWBA 3OPTA 4RQPB 5DPNA 4FP2A 4MGTA 1QY4A 5JXGA 3ECQA 1HRI1 2E9QA 3TNQA 2W68A 1SHWB 1OUSA 3WDWA 3QH7A 4HKLA 1UZYA 1LOAA 3VDAA 1R1ZA 3RJ2X 4XF4A 2YC2A 3EBRA 4D7SA 2TUNA 4MH0E 2ADDA 4Q0QA 4JKLA 4QXCA 5A33A 3NW4A 5FY9A 1LHUA 1R091 1VAVA 4OULA 3ZFGB 2TEPA 1GZ9A 1GQGA 4KBBA 3ZKUA 4Y5TA 1X33A 3VB9A 5A6QA 2XUMA 2FZ2A 4QPIA 1RUJ2 4UOJA 4MOAA 2JG8B 4KGGA 4NO4A 5LK7B 1G9DA 3B69A 3EHKA 5JPMB 3I2OA 5A3TA 2ORZA 4D8MA 1UOBA 3I8TA 4XJ8A 5F1RA 4AVSA 2WL1A 4Q4X3 2DCZA 4PBPA 1NQJA 5HXVA 3ZMNA 4M00A 1FPN2 5FCCA 3T1LA 2QUOA 4XFHA 4BIOA 4XFIA 5I8TA 1QJU1 4LJHA 3RZLA 3H8OA 5F5AA 3UESA 5BNNB 2HWE3 1DFQA 1GZWB 2DBNA 2XPJA 1IHMA 4AEDB 1FMD2 4N53C 2XL9A 5FUIA 4P9XA 4TZDA 1LEDA 3MF9A 4YM2A 5HI0A 1O3RA 1HIXA 3V0BB 4OCTA 3HQRA 4IL7A 2EF6A 4ZS3A 5IWFA 4YZ2A 3TOJA 4JHZA 5KWRA 1YJKA 2Z4FA 3ZMOA 2CGOA 2X8KA 2JB4A 2CWMA 3PDQA 4YVWB 2JDPA 2ARCA 3CIHA 1PVC2 3JB8A 4A7YA 4HKOA 4YZ4A 3WXPA 2OS2A 1TMF1 3IT8A 1BZWA 5DG2A 5A7PA 2W46A 3KV4A 1L7QA 3E6BA 3RWNA 5FK7A 1US2A 1YFWA 1RUD1 2W1QA 3MUY1 3P5BA 3BI3A 1AXYA 5KXCA 1QXRA 2IXCA 4LHKA 5FWJA 3FE5A 1HJGA 2W9XA 3F95A 4KWUA 4RFT0 1RUJ3 2VZ3A 4TLGA 4DIQA 4ISRA 1SCRA 4LO5B 4LLFA 4ZHNA 3AP4A 3NNFA 1DDLA 2Y38A 1J3RA 4LUMA 2QCSB 1V6LA 4XUPA 5F5QA 3T1MA 3LSDA 1Y4WA 4FT8A 4K20A 1LU1A 4AAXA 2OZ6A 1UPIA 2XKOA 4FPKA 2ZKLA 1C4RA 2Q4SA 3SC7X 2E32A 4IE5A 4I30A 1UU5A 3MV01 2Q8CA 2YV8A 5L7OB 2P37A 3AXDA 2SLIA 2XOMA 4NJ4A 1QQP3 4V2WA 2P34A 4K9SA 1XYNA 5FZ6A 2XGXA 2DTYA 4QHZA 1N3PA 3PVEA 4NE9A 4QX3A 3KQRA 5LBFA 3LFIA 5LA2A 4AEDA 4LHSA 4HOOA 2ZGRA 5FP8A 2Y6FA 1HRV1 5AC93 1VLNA 1Q8OA 2VVFA 3A21A 1RUE3 3ZYPA 4EN7B 5C9AB 2VBDA 1ULCA 1UD1A 1CPNA 2ZEXA 3OPWA 3OGRA 4IGOA 4NHMA 4UBGA 4P9GA 3MIDA 1EV13 4YVWA 1H8VA 1OSGA 2C5DA 5BNPA 3AKQA 2PHDA 4JTOA 3BTZA 5EIYB 3W5NA 1UX6A 1MZ5A 4XCAA 4CEWA 5CNAA 5AVPA 3MBWA 3AYDA 2WN2A 5E88A 4NN0A 3GZAA 3I3QA 3AKRA 1RJ8A 3DXTA 3B3QE 3MV11 4JTNA 4OMDA 4RR3B 5GALA 1VAMA 2GC0A 3RYPA 3VBFA 5G05L 4AWDA 3ZFEC 4TSVA 4YW3A 4NIAA 3O1UA 3ILFA 1R081 4XUTA 2VOTA 4Z07A 4QPGB 3VUOA 1XE8A 2WA3A 5FMDA 5FO8B 1HLCA 4PCRA 3SEEA 1OOPB 5J09A 5F6LB 5FPAA 4LHNA 4X8NA 1W0NA 2D3RA 3CL1A 1CD3G 5EHDA 5EXOA 2PHXA 2PTMA 1RC6A 5C70A 5A7WB 3FC0A 4JV4A 2GN7A 3Q8BA 4AEMA 4NIHA 1DGWA 1NLQA 4CCDA 3S5AA 3KF5A 4R4ZA 1AYM3 1VALA 1WBLA 2JDMA 3GGLA 1DGLA 4EN0A 2J1RA 5KHJA 1QNWA 5FYHA 2A6ZA 4AHZA 4OHZA 2D7FA 4R52A 4DOUA 1YQ6A 4UAPA 2ZX4A 4FP3A 5APAA 1N3QA 3FWEA 2SBAA 3DPRA 2RG4A 2WIIB 2JG9B 2R6QA 4K3UA 5JZGB 1REDA 2BNMA 3WX5A 2ZPXA 2MEV3 5FZIA 3DN7A 1OF3A 3N9LA 4Y1ZA 1WMEA 4Q8LA 5C3QA 1IG0A 5L9VA 3ZFFB 4O9EA 5A80A 1QQP2 2Y6HA 2LUWA 4Y20A 4I01A 4AGVA 1CVNA 4PF5A 5FZ8A 1UQXA 4QDRA 1SLLA 1TME3 2FDFA 3GF6A 3NMBA 1C5HA 2CTVA 4HN1A 3FJSA 2WQ4A 3KM5A 5FPZA 3HVDA 1PGSA 4GIQA 2E7AA 2YUEA 4JQRA 5EZWA 4AHWA 2OUJA 3NV1A 5DN2A 1RUH2 2E26A 4WM8A 3UGHA 1BK1A 1W6NA 2AC1A 3ILRA 4QM8A 3WNXA 4ZXKA 5FJHA 1PMIA 2KA3A 1YJLA 3T4VA 1X50A 2B5HA 2D3PA 4OHVA 2BGOA 5T5OA 5JXJA 1Y43B 3LEIA 3JZVA 3HNBM 1F4HA 4XDPA 5FBZA 4ARYA 1OOPA 1W8HA 1DQ1A 5DAXA 5FZHA 3UKVA 2IWGB 3HNMA 3B93A 3GJBA 4TN7A 2E31A 1XSRA 4L0PA 4HSJA 1FX5A 1V6KA 4HFSA 1D2QA 3OD4A 1UOFA 4UW6A 4LQRA 1CAVB 2QQKA 5FLIA 5FY8A 2W2IA 1IQDC 4QX0A 1HB2A 2Y8KA 1DP0A 3AL6A 5A32A 3FBMA 3GJAA 1PO11 2CWSA 4MX3A 5EYYA 4BCUA 4QPIB 5DMYA 1G86A 3WQ0A 1EP0A 2C9AA 2R072 4NROA 4RS5B 4UW3A 1CR7A 3E1F1 3OGJA 4UFMA 3OY8A 5FYUA 3SLIA 4N43A 3ZSJA 3ZXDA 4CPBA 1V9U2 2CU5A 5K8SA 2GN3A 1VIWB 1O91A 1LR5A 1RUD2 2WRAA 3TEWA 1HQNA 1ULOA 5LZ6A 1PZ8A 1VAKA 3GALA 2IFWA 4AFBA 3ZR5A 1W9TA 1Q8VA 5CA6A 5FXVA 1ASJ3 1XNCA 2J1VA 3ATGA 3IDBB 4I02A 1EYBA 2WFPA 3AP9A 2OKXA 1ZZ7A 1X8EA 5CKMA 4YG6A 1BEV3 2JDZA 1QDCA 1QJZA 2IXKA 4GMP3 1YRZA 4RYDA 3ZXAC 1O3QA 4XIKA 2XVGA 4UW5A 4BQXA 3WEZA 1Z7S2 2PAEA 4MUVA 3LD8A 4M4PA 2JKXA 4A4AA 4CXXA 1RUF2 4HZFA 3ALQA 2B39A 2ZHLA 3KMHA 4YVSC 3VGIA 4DUVA 2QQVA 3Q8EA 3VBSA 2VW0A 3ZYBA 1GANA 3I59A 3VKLA 2ETEA 4RGGA 2VAUA 3MIBA 4XF9A 4E4SA 4QHOA 5HCBA 4LUKA 1UAIA 1J83A 3A4UA 4JAAA 4MADA 2D98A 2D97A 1ND2B 3CJIA 1NQDA 3I2GA 4AHYA 4GB31
chains in the Genus database with same CATH topology
3ZYJB 4FOVA 3GYDA 3B9CA 1X8MA 1IOAA 3KS7A 4XJWA 3VZOA 3JCIA 1AZDA 1WLTA 1YHFA 3ES1A 2O0OA 3GBFA 2VPVA 4KWJA 4URTA 2MEV1 4FVVA 4HL0A 2D93A 1PZ9A 4TLFA 1RUI1 1N1SA 5GZEA 3ZVXA 1HKDA 1YXWA 4YG0A 2VU9A 2WNUC 3ZX7A 4XJ9A 1PNGA 1CAUB 3O5SA 2HWC3 2PAMA 1RHI1 2PHFA 1PO22 1OMIA 4YFZA 2GMPA 2ZHNA 5JMCA 1LOFA 4Y22A 5I0TA 4MXWA 1UL9A 1ENSA 3D82A 1IKQA 1DBNA 1AR83 4M01A 3MICA 2D6KA 4H3WA 3FHIB 3M3OA 4Q4V2 2A73B 4C0HA 4Z2WA 2ZGMA 1ND3A 5FLJA 4ES9A 1H2NA 4KWLA 1JUHA 1D0HA 1MEC2 4K6BA 2ZCWA 2JICA 2QNKA 3HBZA 3ASIA 2ZAAA 1SLIA 4Q29A 3SITA 2VOVA 4I0AA 3VBUC 2BYVE 1PO13 3I54A 3ENRA 1ND2A 3CJIB 4LO6B 3ZFGA 2XBO1 3ZSEA 4P9IA 4WM7A 4Y20B 1LODA 2X53S 4IXLA 2A70A 1WLDA 1BMV1 4PDWC 1S0JA 4M3CE 3VBUB 2DUPA 1IS5A 1QH6A 3WR0A 3WOGA 3RI9A 2DV9A 1WW4A 5B2GB 1QXPA 4K1YA 2H6BA 4JGYC 2W08A 1NY71 4COVA 4XFCA 5JSRA 4KNCA 1EV12 1OFNA 4HN0A 5DUXA 5H9QA 2D6NA 3PMEA 4EWDA 3MFAA 3KT1A 3HAGA 4FPJA 5ABJB 1QJX3 3ST7A 4BPZA 2QFEA 4XZPA 2D44A 3AYCA 1RUG2 4R9AA 2JG9A 2X5IB 1U5IA 2G9GA 5JZGA 4FPHA 5T3NA 1IKPA 1ZVFA 4OI2A 3ZN4A 4G9SB 2RM23 1MS9A 5AFBA 3PTYA 4ASLA 1GFF2 3HWJA 5ACA3 1PGW1 3M1HA 2GNBA 1MQTB 4W6WA 3OCPA 3TN91 5SV5A 1XYPA 1J3QA 3APBA 1O4YA 4JGZA 3I2DA 4K7JA 4YNIA 3AMNA 1PVXA 1AR61 2GC2A 1NCQB 4E4DX 2FMDA 2D43A 4XEZA 1ZZ8A 2IXIA 1RMU3 3JBG2 3THTA 5CG9A 4QHBA 5GJ6A 2R043 3M3EA 2R32A 3VKNA 4LEJA 4HMZA 2GH8A 3UJOA 3B7MA 3URFA 3VN4A 4ZU7A 3FBYA 3VKMA 4D7TA 4D7YA 3WHTA 1RVF3 4EWEA 3WP4A 2I74A 3R4UA 1IPKA 2EXIA 1XYOA 2OIIA 1NLRA 3BB6A 3ZN6A 1NE6A 4XETA 4GKXA 2WC2A 2HWF1 3WDUA 2D5HA 1KDKA 3WV6A 4N43B 3VZLA 1T6GC 5ABJA 1ZBA2 3AK0A 1NG0A 5C9AA 2GC1A 3D5OA 1ULDA 4E4ZA 4RL7A 4N53A 4S2DA 3IM0A 1UN1A 3ROUA 1EY2A 1YIFA 2PHLA 4LA3A 3KCYA 2D6LX 5A32B 4CDUA 2RE9A 4RQPC 5JR7B 4HVOA 2HWB1 1MS8A 2RHPA 4C1WA 5T52A 1IZ3A 2WZR1 4META 5JLVA 3N36A 3U0ZA 1AXKA 4C0BA 4IETA 4DINB 4JGZB 3RS6A 3VZNA 1BVVA 4ISQA 1N1TA 4KGQA 1LHOA 2PA7A 3DKWA 1RITA 4AI2A 5K7PA 2JG8C 2R073 2R0FA 5GLUA 2CAVA 2HJIA 1NXMA 3AFGA 1D2SA 1JN2P 3O0WA 4HPKB 3SNMA 2KXLA 3S7EA 3LOBA 3AMPA 1ZZ6A 2Z42A 1U12A 1VBA3 3JD73 2A71A 4AW7A 3VDDB 3HD8B 1AL23 4XHBA 4F7ZA 4I0WB 5F9TA 2DCKA 4ES8A 1REEA 1TNRA 3WQ7A 4BWOA 4CP2A 4IEPA 1XNDA 1SACA 4I09A 2WKKA 4NHLA 4OHYA 4H7MA 2RS13 5LK5A 1HXS1 1MZEA 1X7NA 1G9CA 3AYAA 1BVP1 1AX0A 3MI8A 1WD4A 1F31A 4XFAA 4M3CA 5GZGA 2GNTA 3KGLA 4WV8A 1WW7A 1XE7A 5FDBA 3NVCA 2FMYA 4I2OA 1FATA 4TWTA 4B4RA 1G9BA 4FTSA 1KJLA 1A6CA 2C0ZA 5E1RA 2DVGA 3IN9A 5EWSA 4Y22B 4PIYA 3VKFC 4KWKA 4AVTA 1HDKA 4Y1UA 3S7IA 4QQPA 1ENQA 1RGSA 2VGDA 1C1FA 1BKZA 4FOYA 1R093 5E16A 1QXJA 4AEKA 1ULEA 1W6MB 1U0AA 1ZA4A 3TB0A 4KL1A 4CDWA 1U5YA 1ZYBA 3WQ1A 1AR72 3LSEA 5IT6A 2CGNA 4DY5A 4CDXB 2DURA 2X5IA 4PBOA 3VL8A 2HWE1 1ULFA 4R9CA 2HWF3 2XJRA 4ZKTB 3D6EA 2VMGA 4Q26A 3AP7A 4AGRA 4B4PA 2BNOA 3WUDA 3ZXGA 3BU7A 3DUIA 1FV2A 2RS33 1G7YA 2JD4A 1TMF3 2YZ4A 1CQ9A 1H2LA 1UU6A 1H9PA 4MLOA 2OZJA 2BTVC 4BM8A 1SLTA 2P2KA 4WM8B 3RMYA 4M3CB 3H8UA 1LOEA 1DQ0A 2A5ZA 1RUC3 3CO2A 1Q8SA 1OQ1A 4ATFA 4N9IA 5SV8A 2I2SA 1AHSA 3NV3A 1LOFC 2QZ2A 3MFCA 2A3XA 1UU4A 3HR9A 4P9JA 1CPMA 3M3CA 3O0XA 5CFDA 1CAVA 4BOWA 1HQLA 4Y4YA 4AYUA 4QGMA 3JQXA 4AFAA 3VBSB 1MACA 2Z79A 4Z1VA 3NAPB 3AMQA 1FOD1 3SHRA 3RNSA 2R16A 4YGDA 1AYM1 2A3WA 3H50A 1H30A 4LBMA 4FPLA 2WJSA 3KT4A 1LOGA 2JE7A 2ENRA 3DF0A 2XJUA 2ARBA 1AJKA 1QKQA 3T2TA 1IS4A 1JHNA 2XJTA 1DZQA 4WM7C 5E8AA 2HEYF 4DPNA 4I0BA 2QZ3A 2UYAA 3UJQA 4LE4A 1RUE1 1UIJA 1VBE3 1REFA 5LEJA 4XJZA 5JIUA 3SH4A 5IK7A 4FTBA 4JCKA 3O14A 4Q4V1 1OPOA 5LRRA 5BNOC 1J1LA 5JAXA 3R4SA 2ERFA 1CJDA 3I59B 1V70A 1KD7A 4BLIA 3PMSA 3LA7A 4COZA 5HBAA 1C8M1 1RUOA 3AJZA 2RS32 3M3IA 1LCLA 1O5UA 2GZWA 1O4TA 2BWCA 4XXAA 2QDRA 3JB4C 3FLPA 3TNPB 1R083 2R1BA 4N53B 3FFQA 4FXGB 5DUUA 5DDJ1 4XJAA 5AFEA 3RRDA 1CAXB 1VBB1 3CJIC 3MIFA 1VP6A 2D6PA 1MZ6A 4HBNA 3V65A 3ZN6B 1DU3D 3A0KA 1Y9QA 4QXKA 1JH5A 2PHTA 4YVSA 3MIHA 5KHIA 4NOTA 4B8EA 4QD2A 1I1EA 2VOKA 4LULA 4AI3A 4GWNA 1VBD1 4HVQA 1TMF2 5GLTA 1WCSA 1WLWA 1POV0 1RUH3 3K51A 3KSCA 4INDA 3WVJA 1OHFA 2D6OX 3JQWA 2WFF3 2ZGQA 1BBT2 1J58A 3KGZA 4FO9A 4E27A 1N1VA 4WVMB 4XDQA 5KBFA 5D1IA 2Y0OA 4GKYA 2XVLA 5JI7A 5C8CB 4YRDA 3IDEA 4PIZA 4CEYA 1D4M1 1W0OA 4KU8A 1LTEA 1TME1 2DFCA 4COYA 2R042 3NSTA 1FPN1 5C4WB 3VDDC 1SQ4A 3G7DA 4CP0A 4WBBA 3ETQA 4PDWB 3OF1A 4FSJA 3VHOA 5C9AC 1RUF3 4YYOA 4MXVA 2JJ6A 1LKNA 2P3IA 1JOJA 3WZ1A 3WG4A 5BXXA 1XU1A 3LOIA 3WDXA 4CDUC 1IS6A 1DLLA 3VBUA 4LBLA 2E7QA 2RMU1 3FZ3A 4FPGA 4IV1B 3VBRA 1ND2C 3HN1A 4P9YA 2BNNA 4C1XA 1Q43A 3VBFB 3OYWB 1AXZA 1LESA 1ND3C 5I8SA 2R30A 5D8AC 2VECA 2RR13 2RS53 2WS92 3ZXJA 4Q0PA 2WT1A 5DDJ2 4LBOA 1OFSA 2UY9A 2Z5WA 1VBE2 1H0BA 4U2AA 3AP5A 1DZTA 1V6JA 1X36A 3J8F1 4Q4Y1 2Q8OA 1A3KA 5FQ0A 1V6OA 4WVVA 4CDXA 4H14A 3V0AB 3ZYIB 1AF9A 2K0GA 3CJXA 4Q4W3 5KXBA 4L97A 1DQ6A 3H1YA 5GLWA 1W6MA 5GZCA 1JYCA 1WA4A 4TYSA 1Q56A 1POV1 1MQTA 2XH6A 1APNA 2GSYA 2HWB2 3AZXA 5D8AB 5DZFA 4OFGA 2XL7A 2DVBA 5TSWA 4WZCA 4BA6A 5KC5A 1B09A 1R1A2 2EXKA 2V73A 3DPRB 1EAH1 2OPKA 4B3NA 1S0BA 1LOBA 1OA3A 1WCKA 4PLOA 4IEZA 4CDUB 3ZFFA 1JTZX 2DCYA 3VBOC 4OLLA 4GALA 1AYM2 4KG8A 2BEOA 2JG9C 5JZGC 2DFBA 3M2MA 4P5HA 4DRVA 1FOD2 1W6OA 2XBO3 4KG0A 4AFCA 4QU2A 4AFDA 5CADA 5CBLA 4QX5A 1QJX2 1VRH1 1F9KA 3BOPA 1I3HA 3UKTA 3OYWA 3GHNA 3N7LA 1VJ2A 2EALA 4LBQB 4F3JA 3N35A 4JDOA 4LLOA 5BNPC 4AQTA 4BMBA 3CLPA 2WFF1 3P3PA 2VH9A 4CDWC 1RUI3 4BQ1A 1TNFA 4YW5A 1S0GA 2FHRA 3ZSKA 1ZRRA 2A6XA 3NO8A 1FNYA 2X5IC 1UCXA 2HWC1 4XFGA 2YGMA 3AX4A 1QJX1 1VRH2 3EQEA 3M3QA 4DNYA 1QJY3 1FPN3 1CN1A 5IK4A 5J36A 3BOWA 2PN5A 4L99A 1KFXL 3WDYA 2R062 1NLSA 4ASMB 3IPVB 5C8WA 4XFFA 2ZX2A 4A7KA 2HEVF 1PIV2 3USSA 4WVWA 5JOYA 3BODA 2WNVA 3N3HA 1W0PA 3MW3A 2ZGUA 1MZFA 3MIGA 4BIFA 2DCJA 4LBJA 4MSVA 4Q1PA 4YW2A 4YARA 2DVFA 2VUAA 3QH6A 2XJQA 1GSLA 4GQ7A 1MS4A 2WT0A 2A75A 1ZRCA 1H4HA 1ZZCA 2PELA 2VQ0A 3AYEA 5GKAC 2PHWA 4HPKA 2GNDA 4IEWA 1W6OB 4M0NA 3WINE 1KS5A 2R041 5KXDA 3LZZA 1YLLA 4OUMA 1RUC2 5C8CA 2VNGA 3QLQA 4JRLA 2AR6A 1ZREA 4Q4X1 4FPFA 2NZ9A 5FO7B 3ZFEB 2XVKA 1ALYA 1J3PA 4KQ7A 4NPRA 2XJPA 1QOTA 3H0OA 2BFUS 2WS91 2VMHA 2Q5TA 4Q0VA 2EAKA 1LRHA 1RVF2 1POV3 4YW4A 1PIV3 4Z92B 5LEKA 1ZM1A 4FBFA 2FBEA 4XILA 1DQ4A 1IGOA 4AHXA 4IEOA 4N9HA 1NCRA 1N3OA 1V9U1 2BBVA 3A0NA 3H3UA 1OI6A 1HXS2 1YIPA 3VBHB 1H8TC 1LOCA 4P14A 2F6BA 2RM21 3V56A 4Y1XA 5C4WC 2W39A 4QQHA 1FYUA 2BQPA 4KU7A 5FMOL 5FREA 5L19A 1PVC1 1MR5A 1W6PB 4H7LA 1SBEA 5GM0A 1OD5A 1YFYA 4XMAA 1BCXA 3AZYA 2RJKA 2CV6A 3OJBA 4MXWB 1Q5OA 5HCFA 1RHI2 5I8YA 4AXOA 2TNFA 1AJOA 2XLFA 1GV9A 4UBHA 3FLRA 1S0FA 3POYA 2VMIA 1ONAA 1S0CA 2EXJA 5JPNB 1L3JA 5BNOB 3WP6A 3RSJA 4COUA 1PGL2 1VBA1 1AL21 4XBNA 1K5MB 1H8TB 2PAKA 1DGRN 3SXWA 4AQSA 3WG2A 2CGPA 1QQP1 4QMAA 1QJU3 1I6XA 4N90A 3MYXA 3QOPA 4XBLA 1Q8PA 2IC1A 3RYKA 5J37A 1H1MA 2WQZC 1G6NA 3L2YA 1NZCA 1ZBA1 1RINA 3S30A 5AC91 2XG3A 3LCPA 1DG6A 4PQ9A 2YYOA 1SFYA 5T5LA 2ZGKA 2Q1ZB 2A6YA 1S0IA 1BXHA 4IV1A 3VBRB 1ZNPA 2ZA9A 2H0BA 1VB4A 5CFDB 2ZGPA 4B29A 5DZEA 2XJSA 5JIAA 4R9DA 4RS5C 5K0UA 4QGLA 1TE1B 5JI9A 4DFSA 1H9WA 2B7YA 2ATFA 4BH9A 2OUHA 3IWZA 5CFDC 1D4VB 2ZHKA 3OTFA 5H9SA 1H1AA 3ZIWA 1AUYA 2Q0AA 4E2GA 4LHLA 1LB2A 1FAYA 3V0AA 1BYHA 4HK9A 3HQXA 3NKTA 2Y0IA 3AKTA 4X6RB 4Y26A 1PHMA 5JDBA 1D0GA 1GICA 4AI0A 3EO6A 4GH4C 1E57A 1MS0A 2WS93 3CNAA 1AR73 4AK3A 4XF1A 4YSFA 1KRIA 1FI2A 4W6XA 4DQAA 3MPPG 1GYKA 4D94A 1PIV1 1IQAA 4AF9A 1RMU2 1PK6A 1SMVA 3WHUA 2GC3A 3OPZA 2HWD2 1ASJ2 3H3ZA 1RUG3 4E9KA 4A3XA 2AZ5A 4N7IA 2JX9A 2XWBB 3P3NA 1QMJA 2I45A 1HXS3 5BYNA 1DQ2A 1KS4A 1SEFA 3GNEA 4Q4X2 3JU9A 2YROA 2CY6A 3USUA 2YHJA 5ACA2 1AR92 1HRV3 1RUC1 2GAUA 2D6MA 3MW4A 1EV11 3QBQA 4FPOB 1OKQA 1AR91 4CEYB 2VY0A 1QHDA 1JBCA 1XNBA 4LO7A 2IXHA 3JBG3 4XW3A 2ZGSA 1ZZ9A 2GDFA 3CU7A 2QVSB 1CAWB 2GU9A 3NV2A 4P9WA 3B01A 1RUE2 3IKWA 2IFRA 4PDWA 5DUVA 3S6PA 4X8PA 3GBWA 2ZJCA 2HWD1 5L36A 4L8QA 1FOD3 2XBO2 4JGYA 3WLUA 3IIAA 4C91A 4CDQC 2NLRA 4FPCA 1XRUA 2E7TA 5JSPA 1H2MA 1R1A1 1NA1A 2ZTNA 3VZKA 5T5JA 2A6VA 2GMMA 1F8VA 3IPVA 3E5QA 4LTAA 1H1IA 1BJQA 3U10A 4WVMA 3VV1A 4EN9B 4BE3A 4D3WA 4FAHA 1ZBA3 4ZU4A 5CB7A 3L9JT 2WT2A 2PLV3 5BNNC 2JECA 1WD3A 3HT1A 1QNYA 1HW5A 4K40A 4ORFA 2JKBA 3BPZA 2QKDA 2WFF2 5FO9B 1C3HA 5CFCA 2BWAA 1MVEA 4S2FA 2D3SA 3AXEA 1DGWX 1FMD1 2XWJB 4CEYC 3ZSLA 2Y26A 3B5LB 3HT2A 4UW4A 4OUSA 3VDDA 2DCTA 5JOXA 3M4FA 4LT5A 1RUI2 4QQ2A 3KD4A 3MZHA 4QT6A 1ZRDA 3AZZA 4CRQA 3WDVA 5AC92 1OLQA 3OBTA 4YGEA 2D5FA 1SBDA 1CGPA 1VBB3 4OI0A 1C57A 4COWA 4RHV3 2WNVC 5J3UA 3NJZA 1LHWA 1RJ7A 2XLAA 4J1WA 5CIRA 3VBRC 2VNRA 3VBHC 1VBA2 1RUNA 2HEWF 1X82A 1O5LA 4L11A 4IEXA 2QDNA 4GA9A 1B35C 2E6VA 1Y7BA 4JRAA 1GZCA 2ZX0A 1PGL1 5FQ0B 1VBD3 3PVNA 1ZBE3 2ZGTA 3UV9A 3VHNA 4AGGA 1OA2A 1CIWA 3BALA 4I3PA 3UK9A 1D4M2 4HETA 4G3YC 3TBDA 1WW5A 5AVAA 2VQAA 1PO23 4OHXA 2ZGOA 1BQPA 3FLTA 4NWWA 1VBE1 2K9ZA 5IK5A 1W6QB 1K5MA 5D8AA 3BCWA 4AVVA 4Q8KA 1LULA 2ZX1A 1UMZA 5BV6A 2B9UA 4XIOA 4Q4V3 3JBG1 2DVAA 5FTTC 2ZZJA 3KZ4C 2ZMKA 3UL2A 3GZUC 3MDPA 4CDXC 4H55A 5KC6A 1YCIA 2EXHA 1BEV1 2VW2A 4DMIA 1NCRC 4LBKA 3LKJA 2X29A 2YDEA 3THPA 3UKNA 2ZABA 3W9AA 3WDTA 1XNKA 1S1AA 4Z8BA 4M3CF 4LBQA 5FRAA 4YW1A 5L73A 1MQTC 1I5ZA 1QDOA 4FPYA 1YUDA 4K8FA 3W58A 2Q30A 1CONA 4ATEA 3FFZA 3FUQA 1F5FA 3R0RA 2DUQA 2O1QA 1H2KA 1QU0A 1Z7S3 2VUJA 1W6NB 2YC0A 5I91A 2PLV1 4GB33 3LGRA 4MZUA 5JOWA 5F6KA 4PIXA 3V0BA 2HKXA 3J8F3 4XYXA 1S2BA 3ZFFC 2DU1A 3VBOA 4FAGA 3E5XA 1AX2A 1QOOA 1UPSA 3M7AA 4XE9A 4AE2A 1UKRA 1LEMA 2UWAA 1RUH1 1IS3A 2C1FA 3G6JB 2NYYA 5K0UB 1ZRFA 3WT3A 4AVAA 1FMD3 3WG1A 3NKGA 2AGSA 3BIWE 5CG8A 1KXGA 4XQ4A 4UXAA 2Z69A 1ULGA 2P3JA 3SCGA 2ET1A 3J9SA 4Q4W2 3WP5A 4AQ6A 1QJY2 1D4M3 3M8LA 1YFUA 5KHKA 2R063 4QPYA 4XQDA 1ENXA 4DZGA 4GULA 1YNAA 3TYJA 5JCTA 3IBMA 1NCRB 1EAH3 2H0VA 3RZZA 3D0SA 1GNZA 3USUB 1AVBA 1S0EA 1HRI2 4IQPA 1DZRA 1FXZA 3N7JA 4BLJA 2HWC2 2YPJA 2R0HA 2ZMLA 1PK6B 5CU1A 5EJ3A 2CYFA 2PHRA 4SLIA 3QD6A 3AZVA 1WUVA 3DPRC 3B02A 4EWAA 2W52A 1WBFA 4WZFA 2RMU3 2ZGNA 4LE3A 2GH2A 4CYDA 3N7KA 1VRH3 1W6PA 2AREA 5L7OA 3D0JA 1O7FA 1SLBA 3ZXFA 4YM1A 1W39A 2EA7A 1AR82 3RMXA 1AR63 2RR11 1PO21 2K2SA 5JSOA 1S0DA 2PQQA 3PLQA 5I0RA 2O8OA 1CAXA 3ZXKA 3J26N 3WW3A 1F5JA 5GLVA 1G8WA 4R4XA 5KHGA 3WP3A 4AVCA 5GLZA 3RQ0A 3I4IA 4IEUA 4QM9A 5J98B 3DL3A 3C2UA 2E63A 4OI4A 5LRSA 1AL22 1YYNA 5A3LA 4WVZA 4YZ3A 3B9IA 3PJYA 5CFCB 1VBC3 3U4XA 4JVAA 4CDQB 2P3KA 4LR4A 1OLRA 1Y3TA 4QPGC 1ZX5A 1FT9A 4GXLA 4OZXA 2GNMA 3VZJA 3U11A 4Q0UA 3GBGA 5T5PA 4YLZA 3MW2A 3RPQA 4DXZA 4YG3A 4XFBA 3WCRA 1AL0G 5ACA1 1NY72 4LO4B 3ZYGA 2ZHMA 4E2SA 2NQYA 4RR3C 4CDWB 3J8F2 1H8TA 2R49A 1KFUL 1HRI3 1LGNA 3H9AA 5C4WA 2A7AA 1UKGA 1BMV2 3E6DA 4L92A 3AKPA 2RM22 5T54A 2VG9A 1RIRA 1WMDA 2WZR2 4IERA 2ILMA 1RMU1 2RMU2 2DF7A 1A8MA 4AQ2A 2G4IA 1KDMA 3EJKA 1IPJA 1JUIA 4YGCA 3S0MA 1V6NA 1XQNA 1RVF1 3D4KA 3AMHA 4QQLA 2H6CA 4I3GA 4MGKE 4X6QB 1QOSA 4NR1A 1LHNA 3N4MA 4IEQA 4CZSA 1UF2C 1KITA 2R1DA 3D8CA 2HWF2 1G9FA 4IV1C 2EVXA 4RSUA 2WA4A 2OYZA 1SFNA 1KJRA 4EV0A 4GH4B 3POSA 1RB8G 2IXLA 2VOXA 2ZBJA 3E6CC 3E97A 2QE3A 3LWCA 2GALA 3VLBB 2IZWA 2NN8A 3NWKA 3V64A 2WINB 3Q9OA 3VHPA 1UZZA 5FAXA 2LTNA 1S2KA 2BW8A 3ZSMA 2QJVA 1RL3A 1QJU2 3LAGA 4MV2A 3I7DA 4Y5Z0 1RUD3 2MHFA 4JDMA 3PHMA 1J1TA 5CVRA 3QCWA 2WZR3 1VBD2 3GZTB 3POWA 3WW4A 2P17A 3O7OA 3TAYA 4IV3C 4RS5A 1C5IA 1RUJ1 4ITCA 1DF0A 5JVVA 4AI8A 4F83A 3TN92 5BPXA 4M0HA 4QPIC 4MGIE 3VKOA 4SBVA 1SBFA 5KHHA 1HV0A 1PGW2 1HV1A 1PK6C 2R071 3PVOA 2KM2A 2ZACA 4OVEA 1PM7A 1NCQA 2VXRA 1EPZA 2PHUA 1PZ7A 1JYIA 1XU2A 5FFOC 1LENA 1VBC1 1DHKB 1V6IA 1COV1 2VNOA 4YFWA 2WSUA 1DYPA 4LBQD 2RS31 3ZN5A 3R05A 3MLLA 2F4PA 2AUYA 5KXEA 3O0VA 5J96B 5C6CA 4FOWA 1ZBE2 1M4WA 3C3VA 1G9AA 5I0SA 2E51A 4XTMA 4BYYA 4XBQA 3JD72 2B45X 1GR3A 5E89A 1C1LA 3KLSA 5GZFA 2JENA 3RG0A 3RI8A 1OQEA 1NA1B 1VB2A 2DU0A 2V09A 3VL9A 1CESA 4OHWA 3FMGA 1UIKA 4DY3A 2ET7A 2DWRA 2JE9A 4QQOA 1MS3A 1WW6A 4YGBA 4LNVA 3SCFA 4YVSB 4IV3B 4EJRA 1ENRA 1GNHA 2ARXA 1YFXA 3INAA 5BNQA 2BPA2 3FUOA 1ZZBA 1DGRA 3ILNA 3AP6A 1SLAA 3L2HA 3ME2A 5I0UA 1RUG1 3VZMA 4MGYE 3OGGA 1MS1A 4FXKB 2VVDA 3H1MA 4XF0A 2IXJA 3MF6A 3OD0A 5BNNA 4CDQA 2XLGA 2DVDA 3SCHA 4YVWC 4AEJA 4XQWA 4IESA 2WSVA 1NA1C 4P9LA 1LJ7A 4HANA 1GLHA 2ZX3A 5CFCC 4JGZC 3B94A 2DUOA 4AEDC 1COV2 2ZS6B 3B00A 2OA2A 1AR93 3PJQA 4E2QA 3NAPC 3ZFEA 2B42B 1R082 1YWKA 4HVRA 4GMP0 2CAUA 4FPEA 2NM1A 2NP0A 5FLHA 1ASJ1 4HSLA 4CEWC 1C8M3 1O3TA 2HWD3 2NMNA 4N7UA 2D40A 5JWPA 4WM7B 2AYHA 3WW1A 5T50A 4B4QA 1LECA 4MGZE 1NXD1 2HWE2 3SISA 3ELNA 3TWIA 1Z0HA 5EYXA 3BTAA 4Q2FA 3VBHA 5FOBB 2FQPA 3NL1A 4CEWB 5ABJC 2UY8A 3ZXEA 1HRV2 3WY6A 3SMHA 1KQRA 4HLTA 4J1XA 5GZDA 1AR71 4Y24A 5T55A 4FTEA 4Z82A 3WD5A 3MEPA 1W6QA 5L7OC 4GWMA 1NOVA 4LA2A 2BVBA 4F8AA 1BBT3 5K9YA 1TME2 2OW4A 1M06G 5C33A 4BHPA 1WLCA 4RQPA 3O12A 1COV3 3VBOB 1Q8QA 1SCSA 1B35A 2A6WA 2WLPA 4RHV2 1N1YA 3HMYA 2BGCA 4K21A 4EN6B 3ZPYA 1U5XA 3ACLA 4XOGA 2MEV2 2PYTA 4ONUA 5BNPB 3JUUA 4Q27A 2JG8A 1CJPA 2I07B 4D69A 1FV3A 4PLMA 3CF6E 4WM8C 4CTEA 3AM2A 3MPBA 1RHI3 1OQDA 2ZKNA 2AENA 1QF3A 2W0XA 1MEC1 4XF3A 1K5MC 3ES4A 3RYRA 1OPMA 5C8CC 2PFWA 3KCCA 3J4UH 5EV7A 1OOPC 1GZWA 1EPWA 1VBB2 4GMP1 4W65A 1YI9A 2Z2SB 4Q0SA 5DXDA 3AJYA 5J7MA 4QPGA 2O8QA 3AKSA 3MLKA 4IEYA 4XMIA 4ZU5A 3ZIXA