4J6GA

Crystal structure of light and dcr3 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
139
Chain Sequence
VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCASTITHGLYKRTPRYPEELELLVSQQSPCGRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 139
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j6gA00
1D4VB 3B9IA 4KGGA 2OIIA 3AB0A 1TNRA 1D0GA 2Q1MA 4MSVA 5KWRA 1C3HA 1JH5A 2TNFA 1OQDA 2WNVC 1PK6B 4G3YC 2R6QA 3TWIA 3QD6A 3K51A 4E4DX 2KA3A 3K48A 3MI8A 2R30A 1DG6A 4D7YA 2WNVA 2WNVB 4DOUA 5BNQA 4KGQA 1S55A 4QPYA 5TSWA 3ME2A 2JG9A 1XU1A 4OULA 3URFA 1KXGA 4QQLA 2ZJCA 2Z5WA 4QQ2A 2RJLA 1ALYA 2QDNA 3B94A 4QQPA 3L9JT 4J6GA 1GR3A 1WCKA 4MXWA 3WD5A 4MXWB 2E7AA 2JG9C 2Q8OA 5L36A 3TYJA 4QQOA 1OSGA 5HBAA 2WNUC 2RE9A 4N90A 4KG8A 4OUSA 1O91A 4EN0A 2O0OA 2JG9B 1U5ZA 5KC6A 2WNUA 1TNFA 1XU2A 2WNUB 4OUMA 4F3JA 2JG8C 1RJ8A 2RJKA 5CIRA 1D2QA 1DU3D 1U5YA 1JTZX 2HEVF 4E4SA 1OQEA 2HEWF 1C28A 2JG8A 1PK6C 2HEYF 2JG8B 1IQAA 3IT8A 3B93A 2TUNA 4G4FA 3FC0A 1RJ7A 4NN0A 3V56A 3QBQA 1PK6A 2ZPXA 3LKJA 4DB5A 4TSVA 3ALQA 4HT1T 4RSUA 4TWTA 5L19A 5KC5A 1A8MA 4GIQA 2X29A 4MXVA 1I9RA 1U5XA 4QQHA 1KD7A 2R32A 2QE3A 2AZ5A
chains in the Genus database with same CATH superfamily
1VAMA 1ZBE1 1YXWA 3ZSJA 5CFCA 2FZ1A 3AVRA 1URXA 2A3XA 1LENA 4PIZA 4S2DA 4RR3A 3ZX7A 1LNSA 3VD5A 5KWRA 4QWNA 4E8DA 1C3HA 1RXGA 2TNFA 1VBD2 5JZGC 4F83A 4Z82A 3H8OA 3BCWA 1HRV1 2CDPA 3KZ4C 1MZ6A 4AEMA 5FY5A 1R1A2 2Z69A 3WY6A 3ZYPA 4YFZA 3HT2A 2VOTA 2WT0A 3I2FA 1UIJA 4LE3A 3RFRA 4F7ZA 3WW4A 4BK5A 3W21A 3ZIXA 1AX2A 5KXBA 2W2IA 4FOWA 2V5DA 1DP0A 3AL5A 4CDWC 1OPOA 4LK6A 5J7MA 2ZEYA 1BBT2 2EAAA 2XBO2 4PBPA 4GWJA 4NRPA 5ACA3 1HJFA 1W8TA 2WAOA 2CYFA 5JI9A 4YNIA 1PIV2 4HKWA 4JRAA 2YXSA 3PL0A 1OD3A 1W6MA 4Y33A 1XQNA 5FXVA 1AVBA 2CGNA 2B7YA 1RUI2 3DYOA 4RD7A 3N7KA 2DF7A 2GH8A 4AFBA 1W2NA 3WD5A 1H2NA 5FDBA 2JE9A 3V65A 4GULA 4YWAA 3Q8BA 2ENRA 1RUD3 4N7IA 4C0BA 2UYBA 1G9CA 2Q8DA 3SC7X 4WVMA 1UD1A 3CEWA 4FPCA 2WS92 1W8UA 1W3XA 2YBSA 4XF9A 5FV3A 5HBAA 2RM22 5JOXA 5T5PA 2GC2A 1V6KA 1LU1A 4L11A 2DCJA 4JVAA 4JKMA 4RS5C 2PHTA 4DXZA 4MG2A 1GQGA 1W2UA 5T3NA 2IXHA 4YZ2A 1OLQA 4J1WA 5IVFA 5FYIA 1FYUA 4PQ9A 3WDVA 3UK9A 1Z7S3 5E16A 3WNLA 4DXTA 2C9KA 3ORJA 4LHKA 4ASKA 3A22A 4UBHA 4BB3A 3GALA 3G6JB 1YUDA 5I8SA 3OEAA 4QXHA 5FKCA 5BNOB 3RZHA 2ARXA 4JZRA 2LALA 1U5YA 5ANNA 2SBAA 1SZBA 4RGAA 4A2UA 3VV1A 1AR73 3GXUA 4LBMA 4YW4A 2HEWF 2ETEA 2JG8A 3GCXA 4XJAA 4YW2A 3KT1A 3MBWA 4X8PA 5CFDA 2WFPA 3VBOC 1JZ6A 2XLGA 5FMBA 1RUJ3 4EZHA 4JGZB 1R093 1BZWA 1JOBA 1K3IA 1NE4A 5EYXA 4LBKA 4I2OA 1JN2P 4AVCA 1MZ5A 2CNAA 4MX3A 1W04A 1Q8VA 1DIWA 1JZ8A 1F9KA 3CDZB 2L9LA 4K6BA 4PLNA 3E5XA 3C8XA 5SV5A 2ZS6B 4O9GA 2YROA 4E4HA 4XURA 1OURA 4WM7B 2OQ6A 4LK7A 3N7LA 1OBNA 2RDSA 1D2SA 2AZ5A 1DGWA 1VIWB 3H1WA 3MIGA 2JDAA 4GAZA 5BNPB 3AXDA 3SH4A 3T08A 3KF3A 2B9UA 1JW6A 5FMOS 1I1EA 2HWF2 3AVSA 2YHJA 1S0BA 5JVVA 5IFPA 3M8LA 1AR63 3N9OA 3LOBA 5C3PA 1BK0A 1ENQA 4UYBA 2XUMA 4FFIA 1FMD1 2GDFA 1ZBA2 1IPSA 1GZ9A 1WA4A 4GJYA 1GQHA 4L99A 4MV2A 1YRZA 3GCWA 1ENSA 4XCAA 4KQ7A 5FXWA 5JXIA 1UPIA 3WDTA 2PAKA 4H3WA 3FN9A 3PJYA 1W05A 5FP9A 1JYVA 3I59B 1X7NA 1OXCA 1ZX5A 2BNNA 2RM21 3AMMA 3NNFA 3OJBA 2WR9A 3NV1A 3Q8AA 2CHHA 2VG9A 2G9ZA 4W65A 1DHKB 4KGQA 5FBJA 5HCBA 2ZMKA 3EB7A 3TN92 1PO13 1QH6A 2D44A 3THCA 4M0HA 2VTFA 2XWJB 2JG9A 2ZGTA 2W0XA 1DGWX 4OULA 2VPVA 2DUPA 4JDNA 2XJSA 1AX0A 4AVVA 1DYOA 2RDNA 3B02A 3UL2A 4ZKTB 3WQ1A 4LKFA 2GMPA 2XKOA 2Y6JA 4PIYA 1GICA 5HCHA 1YQ8A 4R4XA 4XTPA 5JOZA 1PMIA 3BOWA 4XCBA 1L7LA 5FZMA 3J7HA 3BIWE 4COUA 2YFZA 4YLZA 3JD72 5IUQA 3MIEA 3VKNA 5L36A 4FO9A 3FUOA 2ARAA 3BTXA 2GN7A 3K3OA 1RUOA 3B5LB 3OUHA 4CPBA 2QNKA 3FFZA 4K3UA 4HKLA 4TLGA 4C1WA 4ZS3A 3DKQA 1CPMA 4HANA 4N43A 4GH4A 5FJHA 4Z8BA 5D8AA 2JG9B 3MPBA 2W87A 4IW3A 3ZFGC 3WF0A 1ULEA 1PNFA 4DY3A 1IGOA 2J1TA 5FR3A 4Q4X3 4Q26A 5C3RA 2EIEA 4PDWC 4P02B 3I7DA 5FZHA 5LASA 1U0AA 3JBG2 4BXSV 1LJ7A 5C33A 1DU3D 2SLIA 2QZ2A 1UYPA 5BUVA 1QGLA 5F9TA 2Q1ZB 3RZZA 3DKWA 3VL9A 2WKKA 4AQSA 4EROA 5I0DA 1IQAA 3VD4A 1NE6A 1I5ZA 2R073 5F5IA 2TUNA 1ASJ3 4IEUA 5GLUA 3NJZA 2HWF1 3EMRA 4FBFA 1QHDA 4HSLA 4DUWA 2HWD2 5BY5A 2A73B 3OGRA 1PM7A 3WR0A 3OSDA 1H1MA 5A3PA 3CJXA 5D8AB 1W6PA 4CEWB 2D6KA 2VNGA 4HSJA 1ZBA1 5LW9A 2B4KA 1DBNA 3JXSA 3P3PA 3VL8A 1ZZ8A 2P2KA 4QKNA 3AKRA 1LEMA 2BGCA 1UZ0A 3FL7A 3MV01 5IFTA 2B9VA 2AC1A 3E97A 4XC9A 4A3ZA 4FVVA 4LO5B 1XYNA 1CZSA 3HIFA 3ZSEA 1VRH3 2Y6LA 4EN9B 1WD4A 3DPRC 3K77A 1CAXA 2VZ3A 1AJKA 4GIQA 5J09A 1LOFC 2CTVA 1C1FA 4CDUA 4QPIA 1NCRC 1ONAA 2PN5A 2XVLA 4XQWA 1S0IA 1EAH2 3ST7A 1H8VA 3UGGA 4LHSA 3T2QA 1S0DA 2TBVA 4AEJA 3RWNA 2QQPA 1S1AA 1OKOA 1XYOA 4OHVA 3RSJA 2GP3A 2JDKA 5FZLA 3DXUA 2CY6A 3FLTA 1KITA 3TRSB 1VAKA 1ZYBA 2P3YA 3SHRA 5I91A 4Q0SA 2BGOA 2EIBA 5A33A 4HKOA 3WCSA 3RNSA 1NA1C 1AHSA 1UZWA 1RMU3 3D4KA 3JD71 1T6BX 4UW4A 2ZX2A 3NJYA 4RHV2 5FWEA 1DG6A 4Y5SA 1AZDA 2B39A 4JTNA 3WG2A 5C8CC 2BYVE 2IC1A 3TEXA 2QQLA 4D7YA 5KHIA 4Y1YA 3ZYBA 4LOTA 3MW3A 1DGRN 1FPN2 3HR9A 2LRPA 3KCXA 5FMDA 2I2SA 5L73A 3BU7A 3GZEA 1QJU2 3LPGA 3N9NA 5BYNA 4M4PA 1UZVA 2Z79A 2Y6FA 3FHQA 1GZWA 2HWB2 2G4IA 5A1FA 1I6XA 2FCUA 3AKPA 4YW6A 1IS5A 1QEXA 3O14A 3W5NA 1AR83 5B2GB 1V6LA 4YZ4A 4MGYE 5A33B 5FZ7A 3FUQA 2XQXA 2P4EA 2BBAA 4MXWB 2VO5A 4K1ZA 1LHNA 3ZXKA 2ZTNA 4D7SA 1W2OA 2E7AA 1WLTA 2JE8A 4UXAA 3WZ1A 2JJ6A 1HJGA 3UV9A 5DDJ3 5T5OA 5ACA1 4NWVA 5FJKA 3WNNA 2JIJA 2RE9A 2DWRA 4AHZA 5AC93 3MUZ1 5CBLA 2DFBA 5E6HA 2E33A 4GWNA 3ATGA 4QGNA 4E4ZA 2UWBA 4IDZA 3MEPA 5FPVA 1GP4A 3WSOA 1EUUA 3VDDB 4D8MA 1DZTA 1OKQA 1ULPA 5GM0A 1GBGA 2D40A 2WRAA 4Y26A 5F2SA 5JR7B 4OQ9A 3MIHA 2WNUB 4BMBA 1RVF1 3BIEA 1S0FA 2Y60A 1SQ4A 3GGLA 5FZBA 2OZ6A 2VBPA 3POBA 2VAUA 4NR1A 3UKTA 4DY5A 2CGOA 4Z2WA 4UF0A 3GM8A 1AR91 4XFFA 1UXZA 4MHUA 4S2FA 1S0JA 2WBKA 3KM5A 4TZDA 3T4HB 2P6HA 3ZLIA 4YVWB 2IFRA 5FYYA 4FSJA 1D4M3 1GUIA 4H14A 2WUHA 1S0CA 2BERA 3PVBB 5I8TA 1PVC2 4XILA 1J3PA 1R64A 1HV0A 1RUE3 1WBFA 2RG4A 2YU2A 3V56A 1J58A 1UOJA 2W92A 3V0BB 4O61A 3R05A 5FAXA 4DB5A 5FQ0B 3VD9A 1K5JA 2XKPA 3DGTA 3HQRA 3ALQA 5FZDA 3FJSA 2VUAA 2ZOEB 4ZONA 1O7FA 4CXYA 5FZOB 3KD4A 4RHV1 3SKJE 5LCWL 2J42A 5FYUA 3WINE 4CDQA 5LZ6A 3N3HA 3VBSC 5A6XA 2FDIA 4YW1A 2VOKA 1CWPA 5CZKA 4UF0B 4CP1A 1FPN1 1NLRA 1LHVA 1NT0A 2WZR3 4C8DA 1E5SA 3CZUA 5DZEA 4CU7A 1UX7A 1RUF1 4BCUA 2E6VA 1MVEA 3KS7A 3O1OA 2OX0A 3LA2A 1RUJ1 1FV3A 4ARYA 2PAMA 4FPYA 3B9IA 1ND2C 4TYSA 1KRIA 2OIIA 3THDA 3N7JA 5A3MA 1ZZ6A 4XZPA 4AAPA 2J1UA 2KD7A 1ZBE3 3ILNA 1BCXA 3EHKA 1CN1A 3QCWA 5FZFA 4N53A 3CMGA 2V4VA 4R9CA 5A6ZA 1ST8A 2P17A 3MDPA 5C9AC 2XDVA 5IK7A 2PA7A 3L2YA 3L2HA 1BEV3 1HRV3 4Q8LA 2YV8A 1A6CA 1CJPA 5J37A 3KVAA 4AE2A 3AX4A 2YYOA 2CAVA 1TZOA 3LQCA 4OMCA 5HV4A 5A32A 1K5MC 5TSWA 3J26N 1LR5A 3KV6A 3WW3A 2JE7A 4KMQA 3AP6A 2W1WA 2W91A 4CCKA 3GDBA 3VBHA 3X29B 3K2OA 3URFA 4LHNA 3DYPA 4H55A 3I3QA 3M70A 1VB4A 2RJLA 4P9YA 4A44A 4CE8A 3AKTA 2WO3A 3PHMA 5F3EA 3WP6A 1KDKA 3CLPA 1VBA2 3GJAA 4IEYA 1GKBA 1MS4A 4JQTA 5HCAA 1L7QA 1IOAA 3NW4A 1BVP1 3HN3A 3WW2A 5J36A 4W50A 5FYTA 3ZXGA 2A71A 1HB1A 1EV13 1YFUA 1G8WA 5F5AA 1ULCA 4A41A 2BQPA 2RR12 5BNNC 4COWA 5ABJA 2EIDA 4XF4A 4CCLA 4NIDA 5A32B 1C1LA 3CL1A 1AYN2 4CU9A 1DLCA 1GYKA 2YB7A 4PCRA 2JDUA 3T2PA 3VZMA 4AEDB 4Q4V2 5FFOC 4P9LA 3VBHB 4AVSA 1VE0A 1JYCA 2EAKA 2R062 4RQPA 5I0UA 2OT7A 1V9U3 2ID4A 4M3CF 4XF3A 1WCUA 3ZYGA 4FPKA 2ZABA 2Q4SA 2YGLA 4IV3C 3ZXLA 2X5IA 1JZ4A 2IVJA 3CJIA 1N1VA 3J9SA 4U36A 3T0AA 4JRLA 5DAVA 2VCMA 4HFSA 1YIFA 4H7LA 1HLCA 2HEVF 1W8FA 1YNAA 3OCPA 3J4UH 2WL1A 2X09A 3RPQA 3CF6E 1GP6A 1TME2 3ITQA 3VKLA 1N1SA 4M3CE 3I2HA 3IAPA 1ENXA 4D69A 1AX1A 1QJX2 3BN6A 3J7MA 5F3IA 4ARXA 4G4FA 5C7GA 3FC0A 1W9FA 2WT2A 4NN0A 4BM8A 1PK6A 3D8CA 3OY8B 5D21A 3LSEA 5FYCA 2ZZQA 4TSVA 5FY9A 3VBUB 3AXEA 5I8YA 4QT6A 3PNAA 4FT8A 4BQWA 3LFMA 1OUSA 1HRI1 1Y9GA 2WABA 4Q4Y1 4CA9A 2VQ0A 2X5IB 1GFF2 2C6SA 3SH5A 3Q8CA 4ET7A 2C26A 1AXYA 5FCCA 5FYBA 4N8MA 1MEC2 2E7TA 3ZFFC 2PYTA 1LOGA 1N3QA 1YFWA 3AP4A 2BP6A 1RC6A 1KDMA 4MYEA 4PBOA 2JDMA 5L9VA 3ETPA 4PF5A 1BJQA 5KHKA 3WCRA 4CCNA 1VRH1 1PK6B 2D3RA 2VECA 4ONUA 4I02A 1OLMA 3WUCA 3LAGA 3LFIA 4HN1A 5IAVA 3H1MA 1RUI3 3K48A 3MI8A 5FKBA 5A80A 4UOJA 3UESA 5GALA 2FBEA 2B8MA 2MEV2 2RMU2 1N47A 4YRDA 3I2DA 1CAUA 2JICA 2VMEA 3RDIA 5JZGB 2WWJA 4IGPA 3D0SA 2FZ2A 4XUTA 4CUAA 1LCLA 1H8TC 1W8NA 1Q56A 4O7XA 1AYM2 2ZZJA 2WS93 1X82A 3C7OA 4JKKA 4M3CB 5LRSA 4MLOA 4Q4V1 1FXZA 1AXZA 2RM23 5FY1A 4YVSC 2LTNA 2WWUA 5FK8A 2J1VA 1YCIA 2VNRA 4EN6B 4LO6B 1BMV2 1HXS2 3VDCA 3IZOA 4QXKA 5EJ1B 3S6PA 4PF1A 1GNZA 2QDNA 4CDWB 1D7PM 2XVGA 4Q29A 4PLOA 2ZHLA 1VAVA 3L9JT 3HEIA 1CR7A 3NV3A 4CEYC 1QJY1 1AR62 5JXGA 4NOTA 2OZJA 1XE0A 4AGRA 3OGVA 2ZMNA 4YGDA 2DDUA 2VVEA 3BYWA 3CZJA 3BTZA 1LOAA 3NKTA 4CDXC 1PVXA 2E9QA 2VC9A 4U2AA 2VUDA 3MUY1 2J7MA 5C4WA 2RDQA 3M3EA 1QQP2 1N3PA 2WC2A 1SFPA 3SITA 3VBFA 1YYNA 5FZKA 5FZGA 3KLSA 4D3WA 1TNFA 1MVQA 2MHFA 2UYAA 5IVVA 3H8RA 2E63A 5CEHA 2JDHA 1POV1 2CGPA 2WAAA 1QXPA 4WM8C 4QHOA 4GALA 1W6NA 2VZTA 5AC91 1DQ5A 2VGDA 3LIGA 4NAMA 3WNXA 1VBB1 4RN5A 4XDQA 3OOXA 3JZVA 2I74A 1DZRA 5GZFA 5FMCA 2O8OA 1OMIA 3ZFEC 1PGW2 3POGA 3PTRB 3F2ZA 2J1RA 4KNCA 3GF6A 2WN3A 1SPPB 5JDBA 1TG7A 1RJ7A 1MS0A 4MVTA 3WNPA 5FZ3A 2WIIB 1IS3A 2HWF3 2YBKA 4WVWA 3LDBA 4CUCA 5EIYB 2EXKA 4AQ2A 1RXFA 2RJ2A 3MF9A 3VBOB 3JQXA 1NAEA 2WT1A 4XF0A 2VW0A 1OUXA 5L7OA 4UT5A 1ZBA3 3VD7A 3WQ0A 2GNDA 1M4WA 3O0XA 2BOIA 1B35C 2C1FA 4NO4A 1U5XA 4QQHA 4QPGA 1GWLA 4N7UA 3H3UA 3S30A 4BQ4A 1H30A 4AG4A 5JSRA 1FX5A 2CWMA 2QCSB 1UU6A 3VBRA 2CSGA 3AZZA 1JYNA 5GLVA 4Y1UA 2VMIA 3THPA 1CIYA 1BMV1 2XQRA 5F8PA 3TN93 1CONA 1HN1A 2E7QA 2FCTA 5GZCA 1F8VA 1W99A 3S57A 3AYAA 5GZEA 3KF5A 3RS6A 5CYYA 1XBFA 4COZA 2G9FA 1IS6A 2D98A 4UW5A 3SNMA 3ES4A 4R9BA 2WZR1 4GB32 5CKQA 4M0NA 4UFKA 3M3OA 4Q0PA 1W9SA 3A0NA 3SMHA 2HBTA 3NAPC 1LECA 4IGOA 2OQ7A 2PLV1 4CP2A 5LBBA 3ACFA 4AI0A 4IV1C 1MACA 4QPGB 4COYA 1J59A 3JD73 4A42A 3AYEA 2Q8EA 2VZVA 1S55A 4XHXA 4YW5A 1S2KA 3HN1A 2ZGKA 4NRMA 5FZ1A 3IDAA 2GC0A 2VR4A 3E1F1 1ZM1A 5IVBA 2DYCA 2OPKA 2BJSA 2C9AA 4TLFA 1XRUA 5DPNA 4A6OA 5CKNA 4LPLA 4CU6A 4YG6A 3RYPA 4BZ4A 2OUJA 3MV11 1FOD1 4FPFA 4UFLA 1BEV1 2NM1A 4UI9L 1UY1A 2VMFA 2ZGUA 4KU8A 3GJBA 5JXHA 1RHI1 2UY9A 3FHIB 4WV8A 3I2GA 1SBFA 2IXIA 2PHLA 4R9AA 4DQAA 1QNWA 2RS11 3TYJA 4QQOA 2GNBA 3HVDA 4W8JA 4A3XA 4P08A 3PTYA 3S5AA 1FI2A 2BEOA 2DCKA 2DU0A 2Y34A 4UFMA 1JHJA 1LTEA 3NQHA 1SBEA 3LPFA 3OPWA 4OUSA 1LEDA 2VJXA 4CZSA 2YBPA 2QQJA 1H1IA 3U11A 4MGTA 3H7YA 5EWSA 1XOYA 4QDRA 2A5ZA 2ZAAA 3TOJA 1JU3A 1WD3A 1CAWA 2GH2A 5C3SA 1HQWA 1W0NA 2D6NA 1HKDA 1DCSA 2PHWA 3IPVA 4I01A 4IGQA 3UYJA 5FZ9A 4B3NA 1CX1A 1EV11 3F95A 5BNOA 4PQQA 5IVYA 2G1MA 4LE4A 1WWYA 5CIRA 4WZFA 1RVF3 5JPNB 2VZOA 3ZFGB 5JOYA 3SISA 4UWDA 1VBE1 4GQ7A 3AZWA 1BLZA 2PFWA 4MOAA 5JI7A 4V2VA 1OI6A 1AR93 4V1PA 1OA3A 3IT8A 4PDWB 5F6LB 4LMFA 4CP9B 3H3LA 1EAH3 4KBZA 4NVPA 1S0GA 2JENA 1V9U1 3AP9A 3AZVA 3HMYA 4JGZA 4FPLA 4LTAA 4QB2A 4HVQA 1EY2A 4HL0A 1W2AX 4JGYC 4AGGA 1CAWB 4PI2A 4XUPA 1B09A 3BGAA 2YG0A 3BPZA 1A34A 3RI9A 2BBVA 2ZA9A 4QGMA 1LAJA 1RUH1 3IN9A 2QQIA 4FFHA 1JZ3A 1GZCA 3IPVB 2HYXA 4BPZA 1OF3A 5LA2A 2P5BA 1TMF2 4MXVA 1DQ0A 2LUWA 2QQVA 4P9GA 4WM7A 4I3GA 4RHV3 1VMJA 3IB3A 2XG3A 4SLIA 1COV2 2NYYA 5IW0A 2AR6A 1Z0HA 1WW7A 5BNPA 4S2GA 1FPN3 2VE1A 2K2SA 1AF9A 1ZVFA 4Y4YA 1RUF3 2R16A 2VBBA 2ZBJA 4HK8A 1F15A 5AVAA 5CISA 2RVAA 4Q0VA 1MQTC 1WLDA 1IS4A 4LLOA 4Q4W2 1VBD1 4A7ZA 4QX3A 2XGXA 4OHWA 1HB2A 1NCRB 5EXOA 1VMFA 2WNVC 1W6OA 3I4IA 4O9EA 5BV6A 4N9HA 2HWE2 1R1A1 1CX4A 3ZR5A 3ZMOA 4XMAA 2DFCA 2VZUA 3WUDA 2VQTA 1LGCA 5A7NA 1JZ7A 3WX5A 1VLNA 2VNOA 3I59A 2ET7A 4YM3A 5GZGA 5H9SA 1CVNA 3SXWA 3OGSA 1ODNA 4RGKA 4OYUA 1BBT1 1NA1B 2XBO1 1LGNA 2VM9A 4XJZA 3BALA 4YFWA 1MPXA 3E6CC 1XNTA 4IEVA 1PIV1 4BISA 3KV9A 1XU1A 3HQXA 4NHLA 3WDWA 1STMA 2VXJA 2WFF2 5FYMA 3HBZA 3R6SA 3ZSLA 1CZVA 4QQ2A 2DVAA 1RUI1 2R49A 3UETA 1RB8G 4OI4A 1LODA 4KWKA 5DZFA 4QX8A 1XPWA 1JBCA 1XNAA 1UCXA 3P3NA 1NCQC 2Q5TA 2XR4A 1W6OB 4DEVA 2FCVA 4RFT0 1VPHA 5A3NA 1UZZA 3FHAA 4ZU7A 5IK5A 3LZZA 2VCAA 2FDKA 1W6QB 3WXPA 2GMEA 4AHWA 1F5FA 2W3JA 1H4HA 2WS91 4IXLA 3I2JA 5LY2A 3USUA 3OB8A 1Y4WA 1FATA 3INAA 4E8CA 1P8JA 3ECQA 3V64A 2YU1A 3EYPA 3OF1A 2PAEA 1CAVA 3O1UA 1YEWA 5FP4A 2CWSA 5GJ6A 4FPGA 1Q8PA 1JYXA 4OQ8A 1PVC3 1C8M2 1JODA 1OH4A 2EXHA 3O1PA 4MGZE 4YG3A 2P3JA 2UURA 5L9BA 4XJUA 3FWEA 4OUMA 3O1TA 1VR3A 1YO8A 1UYXA 3H9AA 1ZRIA 2PHFA 1BHGA 4QM9A 4URTA 3J7NA 4QB1A 4XAAA 1SLBA 4MADA 3AMPA 5DUWA 1HB4A 4AYUA 4ES8A 4P5YA 5FZ6A 1UU4A 4QM8A 3MHZA 4XFCA 2AENA 1OQEA 1Q3EA 4CYDA 1QJEA 4W4ZA 3HNYM 5EV7A 5J96B 5KHGA 3USUB 2V5YA 1W8OA 1OD5A 1RUG2 4PJYA 1HN0A 2I07B 2XHKA 4QKFA 2GZWA 2QFEA 1SEFA 4LO7A 4IEWA 5LBFA 2BGPA 2JD4A 2EF6A 4FFGA 1CAVB 1SHWB 2BW8A 4DXRA 2UWCA 2HLEA 3CIHA 3QBQA 2YC2A 4AFDA 4CEWA 1UYZA 4FFFA 4RGGA 5AVPA 1F4HA 3RI8A 3PURA 1W8ZA 1UMHA 3LDRA 5F39A 5A7QA 3PVEA 4QPWA 3TNPB 4Q27A 3U4SA 4XZUG 5CFCC 4OI0A 4JV4A 5DAXA 1RUC2 2X29A 1POV0 4HXCA 1GV9A 1ULFA 2P6CA 4A7YA 2WO2A 4RR3C 4Y4RA 2RS32 4QHBA 5E89A 4GWMA 1HRI3 4Q4Y3 4P14A 3I3EA 3VGIA 3ZXJA 2AEZA 1CJDA 1D4VB 2LS6A 4E9KA 2DCZA 3VBSB 3KV4A 3LWCA 5CU1A 3NRUA 4LBQD 2R1BA 4AFMA 4JDMA 1H1AA 4R9DA 4FP3A 3MLKA 5L9RA 3USSA 2Y33A 4BA6A 2Q0AA 4NIHA 4IE4A 5A7PA 3WV6A 2Z2SB 4LO8A 2ZHNA 4LORA 3TWIA 3AL6A 3OUJA 1ND2B 3ZMNA 3FZ3A 2F4LA 4XIOA 2VOWA 4LUMA 2FMYA 1XE7A 1MS9A 1L7RA 3GBWA 3LSDA 4XBQA 3V0AB 2JB8A 4YZ5A 3FBYA 1DF0A 3SLIA 3I2KA 3P6BA 1BQPA 3TN91 4B8EA 3WP4A 2XLAA 3ENRA 3OYWA 4LBLA 4QPYA 4EWEA 2DUOA 4UBGA 3KQRA 5C9AB 5LEJA 2QQWA 2WQ8A 2DVGA 5I93A 1UAIA 1PGSA 3MZHA 1SFNA 1MS5A 1XNKA 2YZ4A 4QQLA 4XBNA 5FZ4A 3W58A 4BYYA 4Q4V3 2J22A 4IEZA 2NQYA 3B94A 1YQCA 4HPKB 5LA1A 1YWKA 1RUD2 2IUWA 4M4RA 4MXWA 1XSRA 3T1LA 4Y1XA 4AWDA 1RUG1 3PU3A 1U12A 1QJY3 1S4CA 2WDBA 2XLFA 3D3AA 4JQRA 1TME3 2YPJA 3OYWB 2XMLA 4IEPA 1Z7S2 4K20A 4Q2FA 3TAYA 2QKDA 3VDDA 2VZRA 4XF1A 5KC6A 4K9SA 4C0HA 1SACA 1PZ7A 2WNUA 4B4RA 2D6MA 2XVKA 5G04L 2FDGA 4CU8A 2JG8C 1YIPA 3J7LA 2BTVC 5FYVA 3JBG1 4AW7A 3U37A 3K75B 1AR72 1I3HA 1T6GC 1V6OA 4LLFA 3M4FA 2VTXA 5LWBA 2GSYA 3MGUA 2FDJA 5CFDC 4E4SA 4YM1A 3E5UA 4OUEA 1E5IA 4L2NA 1POV3 1Y9QA 1YQ6A 2XWBB 2JDYA 4XABA 2A6ZA 2VQUA 2R0FA 4YVWA 3OPTA 3S5QA 2ZGPA 5C71A 2XB6C 3BI3A 4IV3B 5J98B 1NXD1 3ES1A 2BUKA 1O6UA 1CPNA 4AHXA 2HWD1 1VBB3 2VNVA 1TQ5A 2YC0A 2ERFA 5FTTC 3V0BA 2HWC2 3VUOA 1DQ1A 2D5FA 5FQ0A 1F2NA 2VUCA 2EXIA 3B7MA 3M3QA 3FLRA 3P1IA 2BWAA 3E6DA 3EBRA 5JSPA 3GBGA 2O1QA 4IE5A 1H9WA 1UY0A 1W06A 2A6WA 2C0ZA 4Y20A 1XJAA 2ZGMA 3POSA 5K0UA 4B7EA 1OH3A 5I0RA 1WA6X 1V6MA 1C5IA 4QKDA 1KS4A 2JKBA 3MW4A 3OUIA 4NROA 2IXLA 3WQ7A 2DVBA 4P5HA 4AI1A 1EAH1 5KXDA 2MEV3 4HN0A 5FZCA 3PJQA 4XAEA 4KI5M 3OBTA 1PO22 1ZZ7A 4I3PA 4N9IA 4XXPA 5APAA 4EWDA 5A3LA 1CZTA 2BWCA 2ZKNA 3QOPA 4K1YA 4KGGA 3JB4C 3I3BA 2W95A 5E1RA 5JMOA 2AGSA 2DBIA 3LA7A 3BU0A 1O3QA 4HOOA 3GNEA 1PMJX 4LA2A 4K7JA 5DUXA 2K46A 1YC61 3SKVA 4AAXA 4CUGA 2JX9A 3CBNA 2VZSA 4WZCA 1XNBA 4GXLA 4Y20B 3HOBA 3T2TA 5K0UB 3LF7A 3PU8A 1UY2A 4GA9A 2EIGA 3RMYA 5FOBB 1XE8A 2XOMA 2BZDA 4MGSA 2NP0A 3H0OA 1R082 4QD2A 1PO12 1ULOA 1OC1A 1QJU1 3BB6A 5A70A 4NUBA 2B42B 4R8HA 2HWB1 2PLV3 2VW1A 4FOYA 3WT3A 2GP5A 3BPSA 3E5QA 2IXKA 3TBDA 3LIHA 1MS3A 4W6XA 1QQP3 1VBC2 1IG3A 1NXMA 4XMIA 1H8TB 1QMJA 2ORXA 2D6LX 2PHUA 1YI7A 4J25A 2F17A 2VTXJ 1QH7A 4QX0A 1YJKA 1E5HA 3VZKA 2QDRA 5FP7A 2VUJA 3S0MA 3U4XA 1FOD3 4N43C 1RTVA 4GH4C 5JUVA 5D8AC 5T50A 3KWVA 1C5HA 2PTMA 1JI6A 4V2WA 5K7PA 1X9PA 1RHI3 3NJXA 3I2OA 3WP5A 2AEYA 1RIRA 2DBNA 1Q8QA 2EICA 4CEYB 2HWC1 5K4LA 2RS13 4PI0A 3HQUA 2ES3A 4AEDA 5G05L 1LHWA 4KU7A 2D3SA 2Y6KA 4Q4X2 5F1RA 1DGRA 1QOOA 3IMMA 3HWJA 3POIA 1SBDA 4CDXB 5C6CA 3WVJA 4F3JA 3ZN5A 4FQ4A 1DZQA 2QQMA 4L0PA 5H9RA 4AXOA 1GQPA 4NHXA 5CKMA 1O59A 1BXHA 3R4DB 3A23A 1W28A 5LY1A 1O8SA 2NZ9A 1Y7BA 4ITCA 2XPJA 1ASJ2 4XFHA 4YGCA 5JWPA 4DMIA 1LESA 2J1AA 1PVC1 4LULA 2VMHA 2DVDA 4YARA 4WM8B 3RVHA 1VBE3 1QXRA 3T09A 5FZ8A 3ZKUA 3OY8A 4FP2A 3A0KA 1G9AA 3S7EA 2ZPXA 3WNOA 4NHYA 1REEA 1J3QA 1MS8A 3ZDVA 4DPNA 3VBUA 4M00A 4XDPA 2WLPA 4CDUC 2O8QA 4QPIC 3AYCA 4QHZA 3EO6A 1QJFA 2JDNA 3B00A 3MIFA 5GLWA 2XJQA 1OOPA 2WA3A 3GHMA 3FMGA 5A7OA 4GB33 5IK8A 2GALA 2VULA 1I9RA 1JMUB 1RUH3 1W2TA 5FPAA 3ILFA 1KD7A 4M01A 4MUVA 3A7QA 3ZPOA 4Q1PA 1MS1A 4ATFA 1DDLA 4NPLA 4IEOA 2VBDA 1SMVA 3FLPA 4CTEA 1B35B 1TNRA 1UWWA 4LO4B 4LA3A 1UF2C 5JPMB 3VHPA 1M06G 2OS2A 4D6QA 4E4DX 3LCPA 1VBD3 2BFUS 2KXLA 5H9QA 1OOPB 2P34A 1GANA 4CPBD 4QX1A 1UW8A 1ND3C 1IKPA 3R0RA 1R1A3 4Y24A 2VW2A 4I0WB 5JZGA 3O1MA 2MNGA 4FPHA 4P9JA 4LBJA 1H6XA 4MZUA 4OHYA 5KHJA 1SFYA 5KR7A 4MGQA 4M3CA 4NIAA 1D0HA 4PLMA 5JAXA 4A6SA 5IK4A 2QBXA 2VOXA 2DTYA 3WOGA 4D7TA 5A7WA 1AR82 1BBT3 4IV1B 2GMMA 2XBO3 1ODMA 1R1ZA 2Z5WA 1PX3A 4X6QB 4FPOB 4CDWA 1PIV3 1VBA1 4ISQA 2JDPA 3NNLA 5CADA 5FXZA 2IFWA 5CAZA 3LA3A 5F2WA 4AQTA 1WCKA 3C7FA 3W9AA 4BWOA 2AH2A 4NHKA 3OBAA 1X9TA 3D0JA 4OI2A 3VLBB 4DIQA 2ZEZA 1L3JA 1W9TA 1US3A 2P3KA 4EV0A 2RR11 5LA9A 3DL3A 3U75A 3PMEA 5JXJA 2JB4A 3AJZA 1AYN1 3AP7A 1O91A 1QDOA 3G7DA 4LBNA 5FRAA 4MGKE 2A75A 2HJIA 1U5IA 2ARCA 2R061 1POQA 4LKDA 1YLLA 5EP9A 5FPLA 3QLQA 2W39A 5A7WB 4WBBA 4CCEA 4UW6A 4QGLA 5LBCA 1HW5A 1HQLA 3A21A 5FY0A 1SLCA 4RS5A 3TNQA 4KWLA 1RJ8A 4AEKA 3N9MA 1EPWA 3OG2A 2XJPA 3N7MA 2VMCA 3VZLA 1V00A 1D2QA 1G9FA 3MICA 5JIAA 4DRVA 4WVVA 1AL22 3NV2A 3OBRA 4NAOA 2FDFA 1TME1 4QAWA 4MH0E 1TMF3 1RINA 5DN2A 3C7HA 4GKYA 1RUE2 1QJX1 4ATEA 1K45A 1COV3 5A6QA 5I0SA 1ZZ9A 1SPPA 1N3OA 1WCQA 4CDQC 4K8RB 5FY4A 1X8EA 2RS52 1FNYA 3DV8A 1C8NA 3HJRA 4Y5TA 1WMFA 5JLVA 2ZEWA 4Q4W3 4FPEA 4AGVA 1LOEA 4FXKB 4A4AA 3EQEA 4RSUA 4TWTA 3TEYA 3VBOA 4PHZA 1CGPA 4RS5B 5F5CA 2DCYA 3I3DA 2HWE3 3OD4A 5F6KA 2A3YA 5FO7B 4ZY9A 2WN2A 1OVSA 3BKZA 1BK1A 1MEC1 1YFXA 4FTEA 5CG9A 1PMHX 1NY72 4L97A 5FYSA 3OPZA 4L92A 3SEEA 2XUEA 3O12A 4UW3A 2OXBA 1J3RA 1OA4A 2ZX3A 2MPFA 4EZ4A 1HIXA 3H42B 4N53C 3U0ZA 3PUIA 5A7SA 3BTYA 3RWKX 3K46A 2VVFA 4IL7A 4RYDA 5A3TA 2Q1MA 3IDCB 2ZEXA 4MSVA 1NUKA 2ZGQA 3UGFA 1PZ9A 1WCDJ 1O3TA 2BFUL 1ZREA 4YYOA 2WFF3 4EYUA 4G3YC 2VZ1A 2X53S 5FP8A 2EA7A 4LT5A 3AFGA 3QH7A 1HRV2 5I0TA 2DVFA 2V09A 3LOIA 2ADDA 2W1SA 5IWFA 4KBBA 2MEV1 2RMU1 4QU1A 3EXUA 1MQTB 2A1XA 1PGL2 3VBHC 3VZOA 2WSUA 5EZWA 4OZOA 2WNVB 1AYM1 4RL7A 5FZOA 2JKXA 3DYMA 3WG3A 4AZZA 2QJVA 4YM2A 4BJ0A 2D43A 5F3GA 4KWJA 4NPMA 1HXS1 3H7JA 1QWRA 5FUIA 4LNVA 3GHNA 2G19A 2GN3A 3DN7A 1QNYA 1SCSA 2W47A 3B69A 2R042 3K4AA 3LEMA 4Y3OA 1TEIA 4QDQA 1DFQA 1J1LA 4LBQB 2IXJA 1SDDB 3GZUC 3LGRA 4XFBA 5ABJC 4XJWA 3RJ2X 3DEMA 3KHBA 5JR2A 2NPIA 1US2A 2HH9A 1WW5A 2Y6HA 5KXEA 1KJRA 1HQNA 4AOCA 4RQPC 2JEMA 3I97A 2VOVA 1NCQB 1QQP1 3K4DA 3NL1A 4QXBA 4R4ZA 4EN8B 1O4ZA 4LITA 4ZXKA 1RUG3 5IYYA 1G7YA 3ACLA 2X5IC 5KXCA 3CJIC 4KL1A 2ZCWA 4DEQA 2GC3A 2VU9A 4DO0A 3HD8B 5DAQA 5IVCA 2QQOA 3NNMA 3ZN6A 4YZ1A 1SG3A 2WZPP 3KHCA 2P1BA 5A6YA 2PQQA 4BH9A 1LOBA 5HXVA 2E51A 3ZFGA 3AZYA 4E2GA 4CXXA 3JBG3 4Q0UA 1RUC3 1PK6C 2NLRA 4JHZA 3BVCA 3Q8FA 5ANQA 1PGW1 4PDWA 5BPXA 3H50A 2RS33 4CP9A 1DGLA 3PLQA 1H0BA 4DXSA 1HDKA 3NKGA 3ZN4A 4AFAA 2DURA 3WHUA 2WZEA 4IUGA 4P9IA 4NWWA 5K9YA 5GLZA 4LJHA 3H8XA 1I5PA 2WQZC 3FFQA 5FZIA 4C91A 3WP3A 3AM2A 4A7KA 4Z92B 2HWD3 4CUBA 3ZN6B 1LGBA 5C70A 3WDYA 2KM2A 1PGL1 3WG1A 4I0BA 3POFA 3RQ0A 1QOSA 5FPZA 1K12A 1UNBA 4XBLA 5T54A 3UNPA 2FQPA 1VJ2A 1OF4A 5KBFA 1W3VA 1TE1B 2R32A 2QE3A 2VY0A 2GNTA 1DQ6A 4EQVA 3APBA 3RZLA 1ZRFA 1F4AA 3DPRA 2IXCA 1LOFA 3IIAA 4L9BA 5CFCB 4DZGA 4TXWA 2TEPA 5DMYA 1NCRA 2R041 2XJUA 4RR3B 4AR2A 1NLQA 1RYYA 2JIGA 5IVEA 1ACCA 4GB31 1X36A 4CSWA 1SLTA 5FYZA 2DUQA 3VD3A 2KA3A 1F31A 1FMD2 2CDOA 3HAGA 3N9PA 4J1XA 3ZIWA 3LEGA 2WO7A 5HPOA 5J3UA 4XHBA 1UMIA 3O0VA 3IDBB 4OFGA 4QXCA 2UWAA 4ZXEA 1C4RA 4IESA 5A1AA 4XFAA 2NMOA 3DXTA 4B4QA 4DOUA 1ZRDA 2EVXA 4GD4A 4C90A 4E27A 1NA1A 4QX5A 1EUTA 5EYYA 4NIGA 2H6CA 5AFEA 3MLJA 2QZ3A 4ZZ8A 2ILMA 1ZZBA 4OLLA 3POJA 5C8CA 2Y0IA 4HG6B 1GMMA 4XQDA 2E53A 3DPRB 1QJU3 1S2EA 1XSQA 1BKZA 3ON7A 2X10A 3ZYJB 1X8MA 1W6MB 2HWB3 4META 4BLIA 1NG0A 1O3SA 1XC6A 3WDXA 4CCDA 5C3OA 5FUNA 4W6WA 3T4VA 2W68A 1QY4A 1PHMA 1DYKA 1YJLA 3LEKA 4XJ9A 1GR3A 1G6NA 2WWSA 1W6QA 4NPRA 5C4WC 3HPNA 3B3QE 3QH6A 1QDCA 4GJZA 1NOVA 2H0VA 4LKSA 3VBFC 4YW7A 1GLHA 1N1TA 3SCGA 4EN7B 4WVMB 1O4TA 3CU7A 3KT4A 4P9XA 1XYPA 3ACHA 1GZTA 2A7AA 3C7GA 1E5RA 4N90A 4C1XA 3T0DA 1LULA 3Q8EA 2VH9A 2E31A 4ASLA 4Z1VA 5J48A 1ZA7A 1TVGA 4OHXA 4BE3A 5C8CB 3KGZA 3PUAA 4CCCA 2CAUA 2HBUA 3VZNA 1IPKA 4B4PA 5C3QA 2NMNA 2HWC3 4FOQA 2QQUA 5DXDA 5FZAA 4XIKA 5FYHA 2C4XA 3ZM8A 1UOFA 3MIBA 5CB7A 1IQDC 3UT0A 3AC0A 1J83A 1EP0A 2RV9A 4BDVB 4AHYA 2JDZA 4INDA 4BQXA 3ETQA 4TTGA 4XQ4A 3MPPG 4XETA 5LRRA 5DQ0A 2HEYF 2CV6A 4MO3M 2JG8B 2K0GA 1JXNA 3T30A 2JECA 4BK4A 1XB9A 4AQ6A 1PO23 3OTFA 1JYIA 1KEXA 4KH9A 5CFDB 5L7OC 4DRRA 2R7EB 2OA2A 1SLIA 4QPGC 2O14A 1XNDA 4B7KA 5B4NA 5C5TA 2E26A 2KR2A 4QU2A 4OZXA 2D97A 1O4YA 4F8AA 1OPMA 2WNOA 3VBRC 5KC5A 4LR4A 5LB6A 2OPWA 1TMF1 4UAPA 4AVTA 3U14A 4UFIA 5FZ0A 1NKGA 2XONA 3NNJA 3P5BA 5FPUA 2W1QA 1COV1 1QIQA 5EJZB 1A8DA 2PELA 3FBMA 4JTOA 1R083 3ZDSA 5B4XA 3O0WA 3VBSA 3PIJA 4AL9A 4OI1A 2CU5A 5FY7A 3AB0A 4Q4W1 1APNA 2G9GA 2V73A 5D2AA 2XH6A 4XUQA 2ZX1A 3J8F2 5F32A 3ACGA 1JH5A 4Y22A 4CVUA 2HWE1 3AKSA 1V6NA 1VBC3 1EPZA 2FHRA 3AZXA 1ND2A 1YI9A 3I8TA 4XYXA 5FUPA 2GC1A 4IERA 4FQZA 3ZR6A 3AMQA 5A1LA 3MF6A 2AUYA 1RGSA 2W46A 2BPA2 1IZ3A 2XL7A 1LOCA 4JAAA 1WMEA 4XW3A 4MGIE 3V0AA 5BNQA 5KHHA 5EQUA 3DUIA 3W20A 1DYPA 2UY8A 2Q30A 4XTMA 5C9AA 3H8UA 1KJLA 3IM0A 2Q8CA 2VD7A 5JIUA 1NX9A 2WFF1 5T5LA 5DUVA 2QUOA 3T2OA 1Q43A 1KXGA 1LB2A 3ZO0B 4CRQA 4Y1ZA 1K5MA 4QQPA 4Y22B 4AVAA 5LEKA 4HPKA 2D5HA 5FLIA 3MW2A 5F3CA 4J6GA 2P37A 1S2BA 3JB8A 4XPVA 1UKRA 3KVBA 1IHMA 2V4AA 1VBA3 5FO8B 5JMCA 1N1YA 1UZYA 3LE0A 3D5OA 2F4PA 1ZZCA 4PIXA 3AK0A 5FPBA 3C2UA 5F5QA 3UKVA 3KGLA 2VMDA 2ZAHA 5ACA2 3HNBM 5J1XA 3K3NA 2BDRA 2RR13 2WSVA 2O0OA 4BMEA 1C8M1 4N43B 5BNOC 4GH4B 2BV4A 1U5ZA 2HKXA 1AYN3 1JOPA 1GU3A 5BNNA 1CQ9A 2A6YA 3MO4A 2B46X 2VCBA 3VDBA 1K5MB 3U07A 3NO8A 1RVF2 2R063 3GZTB 5F37A 3U1XA 1QKQA 3WG4A 4CXWA 1K42A 2RJKA 3LD8A 5CG8A 1F5JA 4FPJA 2ZGNA 4DS0A 1AR92 4H2AA 3RG0A 2I45A 4JGZC 3ZVXA 4GMP1 3I54A 3AJYA 4IV3A 1OQ1A 1T2XA 3PUQA 2CL2A 4JDOA 5FMOL 3SCFA 4CP0A 4UFJA 3KMHA 1ULDA 4P00B 3ZXEA 3J8F1 3POEA 2RDRA 4NE9A 2AREA 1SDWA 2EALA 2H0BA 1GOGA 3MFAA 5IHRA 3NJVA 1JOJA 1QJX3 2BNMA 1E57A 5DUUA 2DU1A 4URAA 4WM7C 1S0EA 3N9LA 1W6PB 2OW4A 4GWIA 3ZXDA 4HT1T 2F6BA 5SV8A 3HNMA 3IIIA 3VKFC 1Y3TA 3ZSMA 5BNNB 3OBZA 5L19A 1YHFA 4YPJA 5BNPC 4RA0A 1RUC1 2BVVA 2NN8A 4IEQA 1FAYA 1LU2A 5FWJA 1Q8OA 4K8FA 5T5JA 2RS31 1CAXB 1VP6A 3D82A 4X6RB 4DFSA 2XHNA 4YM0A 1W03A 4CDUB 4QPIB 1WUVA 2VZQA 1RUF2 1SLAA 3CKHA 3FE5A 3N4MA 3ABZA 3KCYA 2YFUA 1W0OA 1MEC3 4BHPA 1RUJ2 3ZYIB 1ND3A 1IG0A 2W94A 3RZMA 1R092 3CNAA 5ISLA 3ZOIA 1WLWA 3N9QA 5HCFA 3UGHA 5FY8A 3B9CA 4Z07A 2FMDA 2Z4FA 2OYZA 3ZFFA 3M3IA 2R1DA 2VL4A 1VB2A 4D94A 4IEXA 3I2IA 3K51A 1WZXA 3H3ZA 1H2LA 3M7AA 3PIGA 5FREA 2XXZA 5FZEA 4BQ3A 3VHRA 1ULGA 3ILRA 4NHMA 1HB3A 3W5MA 4NIIA 4CCMA 2DV9A 2RMU3 3PDQA 4XXAA 2GU9A 2ZXQA 1KS5A 3BTAA 2ZGSA 4GKXA 3IMNA 3DCQA 1AYM3 3WW1A 5HV0A 1GZWB 1ND3B 1NLSA 1QOTA 2OUHA 3RRDA 1REFA 3MIDA 4JHTA 4E2QA 3OGJA 2ORZA 1H8TA 4GZ9A 4DINB 1ALYA 4XOGA 1DQ4A 1H2MA 3IWZA 2FD8A 1HXS3 4FCAA 5GZDA 3ZFFB 1RUD1 2JXAA 2DTWA 3K4ZA 4P9WA 4YVSA 2IWGB 2WQ4A 1NZIA 3RMXA 2C24A 3VDAA 5JSOA 2OVUA 3AMHA 5FIXA 1IKQA 4JCKA 3JQWA 1XXNA 2JG9C 3AMNA 4YG0A 5C5UA 4ZPIA 2D93A 2Y38A 1UL9A 4QKBA 4BQYA 1AL23 1MZFA 4CEYA 1KQRA 1Z7S1 1UX6A 1GWMA 4FAGA 3PUSA 5E88A 2EXJA 1GOFA 5EFUA 2GNMA 4ZS2A 1VRBA 2WJSA 5FXXA 3KV5A 1JYTA 1A78A 1CESA 2RS53 3Q9OA 3T1MA 3WNKA 4CDXA 1W0PA 4DUXA 3M1HA 2YMZA 3ZXAC 1AR71 1GP5A 3BOPA 1PZ8A 1UU5A 3LB9A 4I30A 4QX2A 4FXGB 1CD3G 1UY3A 2ZMLA 4YVSB 3O1SA 2A3WA 4KWUA 3U78A 2PXJA 3ACIA 4OCTA 4CCOA 2Q1FA 5EJ3A 3VHNA 1UKGA 4CEWC 1SCRA 3NNGA 2JD9A 2YGMA 4R52A 4AK3A 1R091 3CQOA 1GWKA 4XJ8A 3B93A 4WM8A 4OMDA 3ZYFA 4AFCA 2XL9A 4BIOA 4Q8KA 4RFRB 2YDEA 3RZGA 2WNEA 1Y9MA 3DF0A 1FT9A 2XJRA 4AVBA 2V72A 3LKJA 3IBMA 2B45X 3SH3A 3TEZA 2ZGRA 3CHXA 3ZFEA 4QDSA 2Z42A 3VKOA 4ES9A 4ZHNA 1PNGA 3NMBA 4Q5OA 4CDQB 1QXJA 3RGBA 3JU9A 1AJOA 3GZAA 3QACA 4Q4Y2 1HRI2 2N7GA 3MLLA 4QB6A 2YPDA 1LHUA 3NWKA 4LXLA 3UJOA 4DNYA 4D0QA 2R072 1PO21 3O1VA 1UXXX 1W9WA 2BVBA 5F7UA 1AR61 3PVNA 4LHLA 1B35A 5ERLA 1D0GA 5JCTA 1QU0A 4HVOA 5GKAC 5A3WA 1KFXL 4MHRA 4YZ3A 3O5SA 1J84A 4BXFA 2P3IA 2PHDA 3VKMA 4NMIA 4IE7A 1VRH2 1H6YA 4IQPA 4YGBA 1OT5A 3ZFEB 1W9YA 4N53B 1UY4A 2R043 1ZA4A 4HBNA 4BQ5A 2X8KA 3ZXFA 1DQ2A 2PQSA 3WF4A 1JZ5A 1R081 4B1MA 1PO11 1WCSA 4Q0QA 1ZRRA 2IVIB 3AKQA 3UJQA 3AFKA 5LK7B 2FDHA 1JU4A 1LKNA 3HBKA 3ROUA 2ARBA 3U10A 5IVJA 3ME2A 1H2KA 4PT6A 5IT6A 4Y5Z0 3NAPA 1VBC1 3SCHA 4IV1A 3GYDA 3ZYRA 5T55A 3B01A 3IKWA 3ELNA 4XFIA 4A45A 1G86A 3MYXA 1YFYA 1RMU2 3SEPA 3S7IA 1OLRA 2DCTA 1OFNA 2ZGOA 3OGGA 4HETA 3EJKA 5A3OA 4LOSA 2YUEA 4O65A 1V70A 1OHFA 3WEZA 1QJY2 4W6YA 1H4GA 3VDDC 2ZGLA 4HMZA 5DG2A 2ZACA 3KQ4B 4BOWA 2D6PA 2A6VA 1LHOA 2WNUC 4S2HA 1HV1A 2Y6GA 1YQ5A 2LW8A 2BOJA 4AI9A 3VHOA 4IETA 5ABJB 2VZPA 1X50A 4EN0A 4FTSA 4Q4X1 2VQAA 3NAPB 1BYHA 4HZFA 1UPSA 1VALA 1AL0G 5HI0A 5IATA 4HK9A 3I3MA 4LQRA 3M3CA 2A6XA 2C5DA 3O1RA 4RQPB 1MZEA 2Y26A 4I0AA 1WMXA 3PUHA 3DECA 4LIVA 4YVWC 4FAHA 1OLME 5DG1A 2LROA 2ZX0A 3NVCA 4HVRA 3WNMA 4COVA 2D3PA 3CJIB 3KT7A 2R071 5DDJ2 1NQDA 1Y43B 4XFGA 1ASJ1 2AACA 2VVDA 4ISRA 3POWA 2BRTA 5D1IA 5AC92 1OVPA 3RZJA 5HXMA 4KG0A 4BU2A 4TN7A 3A4UA 2Y64A 3TB0A 1VBB2 4D6RA 2RHPA 1XNCA 1O3RA 3SQOA 1WBLA 4WVZA 1OA2A 5K0UC 4AI8A 2UU8A 3JUUA 4XVHA 1HX6A 3PVOA 3BUCA 5H9PA 3HT1A 3RYRA 4AI2A 3CO2A 1WKYA 2W52A 2ZHKA 3WLUA 3T0BA 4XACA 5EPAA 1W8HA 2GAUA 1UQXA 5FLJA 5LK5A 2BNOA 4I09A 1V6JA 2Y0OA 5M0TA 4EWAA 5C8WA 1RUNA 5FO9B 2ZHMA 1JS9A 5JOWA 3D6EA 5FBZA 1FMD3 4JGYA 5CA6A 2H6BA 1D4M2 5DAPA 2ATFA 5DABA 2ZX4A 2AYHA 5BXXA 4D6SA 3H1YA 1RL3A 5GLTA 4XUNA 3OD0A 3UKNA 1ZRCA 1OFSA 1V6IA 4GMP0 1Q8SA 3C3VA 5DAWA 1NQJA 3LDKA 4CCJA 1UOGA 2HYKA 3RJRA 5FLHA 1VMHA 1RMU1 1WLCA 1IPJA 2WLQA 1WMDA 1CIWA 1GNHA 5T52A 2Y8KA 5AFBA 1OQDA 2WINB 5IAXA 1QF3A 3PMSA 3POYA 2R6QA 3QD6A 3VN4A 3IDEA 3AYDA 1UYYA 3ZSKA 1O5UA 2QTWB 2R30A 2WZR2 1MQTA 2W1UA 1REDA 4LIUA 2WZ8A 4ZZ5A 1X33A 3ZPYA 2B5HA 2ZKLA 2WNVA 3C7EA 5IJRA 3WQBA 1CAUB 1KGYA 2PLV2 4SBVA 4JGYB 3NV4A 4UFHA 4ZU4A 1JYWA 1F35A 1UO9A 2XJVA 3KB5A 4FI9A 5E8AA 2VXRA 2W9XA 3BODA 2A70A 4HONA 4XUOA 3LEIA 2YY1A 1AR81 1JZ2A 4LEJA 1ZBE2 4LBOA 1SLLA 3ZYHA 4AI3A 1WGPA 2VCCA 1BVVA 2ZJCA 4DUVA 3RZKA 2WO1A 1PM4A 4L8QA 4QX7A 1RITA 4ORFA 2WA4A 3AP5A 4LBQA 1LRHA 3R4SA 4IE6A 4OVEA 3VB9A 5FOJB 1FOD2 3I49A 5DDJ1 1UMZA 4XDOA 1BEV2 1EYBA 4NRQA 4B1LA 1JUHA 1NYWA 1W39A 4LUKA 3W59A 4YSFA 1AXKA 5A3UA 1RHI2 4EJRA 1JHNA 2QQNA 4K40A 2W08A 2PHRA 2PMWB 4Y1VA 2Q8OA 4AEDC 4BIFA 3WDUA 4EE2A 4E2SA 2BU9A 1MR5A 1OSGA 1O5LA 5FK7A 1NCQA 4G9SB 3T3YA 2RS12 3VZJA 3WHTA 4IE0A 2ADEA 5FP3A 4KG8A 1KFUL 2J1SA 4ZU5A 5LA0A 4HLTA 4FTBA 5C4WB 3ZKYA 3MFCA 1JUIA 4Q1RA 2PHXA 3NSTA 5CNAA 3VBFB 4BQ2A 1Z78A 2WYSA 3R4UA 4Z2AA 3GBFA 1ENRA 3OEBA 4X8NA 2D6OX 2JWPA 1XU2A 2LM3A 1UN1A 2QQKA 3M2MA 4XEZA 5DZGA 2YC4A 1GSLA 4XE9A 1C8M3 3KSCA 5EHDA 1V0AA 1D4M1 4JKLA 1W8WA 1AL21 1EV12 1GNYA 3KCCA 4BQ1A 4ASMB 1JTZX 1W6NB 2QVSB 1G9DA 4OHZA 1FNZA 5CVRA 4FOVA 1C28A 1RUE1 1W90A 3FX3A 1C57A 1VBE2 4K21A 5LBEA 1NZCA 1FV2A 1GOHA 2D7FA 4H7MA 4JX0A 1UOBA 3VBUC 2WYFA 1G9BA 5LATA 2RS51 2X05A 1UIKA 1OOPC 1PX4A 1WW6A 2IZWA 4GMP3 4LKEA 3WF1A 1O8PA 2J1EA 4NJ4A 2ET1A 3O7OA 3THTA 1V9U2 2VMGA 3N35A 4JC1A 3N36A 3J8F3 3WF2A 3TEWA 2K9ZA 2R0HA 4QMAA 4YW3A 1QJZA 2E32A 1A3KA 1A8MA 1Q5OA 1RUH2 3JCIA 3IAQA 4B29A 1AUYA 4AF9A 1WW4A 5L7OB 3RYKA 1NY71 3ASIA 1YQ2A 4YGEA 3E6BA 5K8SA 2XJTA 2OKXA 1H9PA 2W5FA 1ZNPA 3WF3A 4BLJA 1DLLA 3VBRB 5FPXA 1J1TA
chains in the Genus database with same CATH topology
1VAMA 1ZBE1 1YXWA 3ZSJA 5CFCA 2FZ1A 1URXA 2A3XA 1LENA 4PIZA 4S2DA 4RR3A 3ZX7A 5KWRA 1C3HA 2TNFA 1VBD2 5JZGC 4F83A 4Z82A 3BCWA 1HRV1 3KZ4C 1MZ6A 4AEMA 1R1A2 2Z69A 3WY6A 3ZYPA 4YFZA 3HT2A 2WT0A 1UIJA 4LE3A 4F7ZA 3WW4A 5KXBA 3ZIXA 1AX2A 4FOWA 4CDWC 1OPOA 5J7MA 1BBT2 2EAAA 2XBO2 4PBPA 5ACA3 5JI9A 2CYFA 4YNIA 1PIV2 4HKWA 4JRAA 2YXSA 1W6MA 1XQNA 1AVBA 2CGNA 2B7YA 1RUI2 4RD7A 3N7KA 2DF7A 2GH8A 4AFBA 3WD5A 1H2NA 5FDBA 2JE9A 3V65A 4GULA 2ENRA 1RUD3 4N7IA 4C0BA 2UYBA 1G9CA 4WVMA 1UD1A 3CEWA 4FPCA 2WS92 5HBAA 4XF9A 2RM22 5JOXA 5T5PA 2GC2A 1V6KA 1LU1A 4L11A 2DCJA 4JVAA 4RS5C 2PHTA 4DXZA 1GQGA 1W2UA 5T3NA 2IXHA 4YZ2A 1OLQA 4J1WA 1FYUA 4PQ9A 3WDVA 3UK9A 1Z7S3 5E16A 4LHKA 4UBHA 3GALA 3G6JB 1YUDA 5I8SA 5BNOB 2ARXA 2LALA 1U5YA 4A2UA 2SBAA 4RGAA 3VV1A 1AR73 4LBMA 4YW4A 2HEWF 2ETEA 2JG8A 4XJAA 4YW2A 3KT1A 4X8PA 5CFDA 2WFPA 3VBOC 2XLGA 1RUJ3 4JGZB 1R093 1BZWA 1NE4A 5EYXA 4LBKA 4I2OA 1JN2P 4AVCA 1MZ5A 2CNAA 4MX3A 1Q8VA 1DIWA 1F9KA 4PLNA 4K6BA 3E5XA 5SV5A 2ZS6B 4O9GA 2YROA 4WM7B 3N7LA 1D2SA 2AZ5A 1DGWA 1VIWB 3H1WA 3MIGA 5BNPB 3AXDA 3SH4A 2B9UA 1JW6A 5FMOS 1I1EA 2HWF2 2YHJA 1S0BA 5JVVA 3M8LA 1AR63 3LOBA 1ENQA 2XUMA 1FMD1 2GDFA 1ZBA2 1GZ9A 1WA4A 1GQHA 4L99A 4MV2A 1YRZA 1ENSA 4KQ7A 1UPIA 3WDTA 2PAKA 4H3WA 3PJYA 3I59B 1X7NA 2RM21 1ZX5A 2BNNA 3AMMA 3OJBA 3NV1A 2VG9A 4W65A 1DHKB 4KGQA 5HCBA 2ZMKA 3TN92 1PO13 1QH6A 2D44A 4M0HA 2XWJB 2JG9A 2ZGTA 2W0XA 1DGWX 4OULA 2VPVA 2DUPA 4JDNA 2XJSA 1AX0A 4AVVA 3B02A 3UL2A 4ZKTB 3WQ1A 2GMPA 2XKOA 4PIYA 1GICA 4R4XA 4XTPA 5JOZA 1PMIA 3BOWA 3BIWE 4COUA 4YLZA 3JD72 5IUQA 3MIEA 3VKNA 5L36A 4FO9A 3FUOA 2GN7A 1RUOA 3B5LB 2QNKA 3FFZA 4K3UA 4HKLA 4C1WA 1CPMA 4HANA 4N43A 4GH4A 4Z8BA 5D8AA 2JG9B 3MPBA 3ZFGC 1ULEA 1PNFA 4DY3A 1IGOA 4Q4X3 4Q26A 4PDWC 3I7DA 1U0AA 3JBG2 1LJ7A 5C33A 1DU3D 2SLIA 2QZ2A 5BUVA 1QGLA 5F9TA 2Q1ZB 3RZZA 3DKWA 3VL9A 2WKKA 4AQSA 4EROA 1IQAA 1NE6A 1I5ZA 2R073 2TUNA 1ASJ3 4IEUA 5GLUA 3NJZA 2HWF1 4FBFA 1QHDA 4HSLA 2HWD2 5BY5A 2A73B 1PM7A 3WR0A 1H1MA 3CJXA 5D8AB 1W6PA 4CEWB 2D6KA 2VNGA 4HSJA 1ZBA1 1DBNA 3P3PA 3VL8A 1ZZ8A 2P2KA 3AKRA 1LEMA 2BGCA 3E97A 4FVVA 4LO5B 1XYNA 3HIFA 3ZSEA 1VRH3 4EN9B 1WD4A 3DPRC 1CAXA 4GIQA 1AJKA 5J09A 1LOFC 2CTVA 1C1FA 4CDUA 4QPIA 1NCRC 1ONAA 2PN5A 2XVLA 4XQWA 1S0IA 1EAH2 3ST7A 1H8VA 1S0DA 2TBVA 4AEJA 3RWNA 2QQPA 1S1AA 1XYOA 4OHVA 3RSJA 2CY6A 3FLTA 1KITA 3TRSB 1VAKA 1ZYBA 3SHRA 5I91A 4Q0SA 5A33A 4HKOA 3WCSA 3RNSA 1NA1C 1AHSA 1RMU3 3D4KA 3JD71 4UW4A 2ZX2A 4RHV2 1DG6A 1AZDA 2B39A 4JTNA 3WG2A 5C8CC 2BYVE 2IC1A 4D7YA 5KHIA 4Y1YA 3MW3A 1DGRN 1FPN2 3HR9A 3KCXA 2I2SA 5L73A 3BU7A 1QJU2 5BYNA 2Z79A 1GZWA 2HWB2 2G4IA 1I6XA 3AKPA 1IS5A 3O14A 1AR83 5B2GB 1V6LA 4YZ4A 4MGYE 5A33B 3FUQA 4MXWB 4K1ZA 1LHNA 3ZXKA 2ZTNA 4D7SA 2E7AA 1WLTA 4UXAA 3WZ1A 2JJ6A 3UV9A 5DDJ3 5T5OA 5ACA1 4NWVA 2RE9A 2DWRA 4AHZA 5AC93 5CBLA 2DFBA 4GWNA 3ATGA 4QGNA 4E4ZA 2UWBA 3MEPA 3VDDB 1DZTA 1OKQA 5GM0A 1GBGA 2D40A 4Y26A 5JR7B 3MIHA 2WNUB 4BMBA 1RVF1 1S0FA 1SQ4A 2OZ6A 3UKTA 4DY5A 4NR1A 2CGOA 4Z2WA 1AR91 4XFFA 4S2FA 1S0JA 3KM5A 4TZDA 4YVWB 2IFRA 4FSJA 1D4M3 4H14A 1S0CA 3PVBB 5I8TA 1PVC2 4XILA 1J3PA 1HV0A 1RUE3 1WBFA 3V56A 1J58A 3V0BB 5FAXA 3R05A 4DB5A 5FQ0B 2XKPA 3DGTA 3ALQA 3FJSA 2VUAA 2ZOEB 1O7FA 3KD4A 4RHV1 3WINE 4CDQA 3N3HA 3VBSC 4YW1A 2VOKA 4CP1A 1FPN1 1NLRA 1LHVA 2WZR3 5DZEA 1RUF1 4BCUA 2E6VA 1MVEA 3KS7A 3LA2A 1RUJ1 1FV3A 2PAMA 4FPYA 3B9IA 1ND2C 4TYSA 1KRIA 2OIIA 3N7JA 5A3MA 1ZZ6A 4XZPA 3ILNA 1ZBE3 1BCXA 3EHKA 1CN1A 3QCWA 4N53A 4R9CA 2P17A 3MDPA 5C9AC 5IK7A 2PA7A 3L2YA 3L2HA 1BEV3 1HRV3 4Q8LA 2YV8A 1A6CA 1CJPA 5J37A 4AE2A 3AX4A 2YYOA 2CAVA 5A32A 1K5MC 5TSWA 3J26N 1LR5A 3WW3A 2JE7A 3AP6A 3VBHA 3X29B 3URFA 4LHNA 4H55A 3M70A 1VB4A 2RJLA 4P9YA 3AKTA 3PHMA 3WP6A 1KDKA 3CLPA 1VBA2 4IEYA 1GKBA 1MS4A 5HCAA 1IOAA 3NW4A 1BVP1 3WW2A 5J36A 3ZXGA 2A71A 1EV13 1YFUA 1G8WA 1ULCA 2BQPA 2RR12 5BNNC 4COWA 5ABJA 4XF4A 5A32B 1C1LA 3CL1A 1AYN2 4PCRA 1GYKA 3VZMA 4AEDB 4Q4V2 5FFOC 4P9LA 3VBHB 4AVSA 2EAKA 1JYCA 5I0UA 2R062 4RQPA 1V9U3 4XF3A 4M3CF 3ZYGA 4FPKA 2ZABA 2Q4SA 2YGLA 4IV3C 3ZXLA 2X5IA 3CJIA 1N1VA 3J9SA 4U36A 4JRLA 4HFSA 1YIFA 4H7LA 1HLCA 2HEVF 1YNAA 3OCPA 3J4UH 2WL1A 3RPQA 3CF6E 1TME2 3VKLA 1N1SA 4M3CE 1ENXA 4D69A 1AX1A 1QJX2 4G4FA 3FC0A 2WT2A 4NN0A 4BM8A 1PK6A 3D8CA 3OY8B 3LSEA 2ZZQA 4TSVA 3VBUB 3AXEA 5I8YA 4QT6A 3PNAA 4FT8A 4Q4Y1 1HRI1 2VQ0A 2X5IB 1GFF2 3SH5A 1AXYA 5FCCA 1MEC2 2E7TA 3ZFFC 2PYTA 1LOGA 1N3QA 1YFWA 3AP4A 1RC6A 1KDMA 4MYEA 4PBOA 4PF5A 1BJQA 5KHKA 3WCRA 1VRH1 1PK6B 2D3RA 2VECA 4ONUA 4I02A 3WUCA 3LAGA 4HN1A 3H1MA 1RUI3 3K48A 3MI8A 5GALA 2FBEA 2B8MA 2MEV2 2RMU2 1N47A 4YRDA 3I2DA 1CAUA 2JICA 3RDIA 2FZ2A 5JZGB 3D0SA 1LCLA 1H8TC 1Q56A 1AYM2 2ZZJA 2WS93 1X82A 4M3CB 5LRSA 4MLOA 4Q4V1 1FXZA 1AXZA 2RM23 4YVSC 2LTNA 1YCIA 2VNRA 4EN6B 4LO6B 1BMV2 1HXS2 4QXKA 3S6PA 1GNZA 2QDNA 4CDWB 2XVGA 4Q29A 4PLOA 2ZHLA 1VAVA 3L9JT 1CR7A 3NV3A 4CEYC 1QJY1 4NOTA 2OZJA 4AGRA 2ZMNA 4YGDA 2VVEA 1LOAA 3NKTA 4CDXC 1PVXA 2E9QA 4U2AA 5C4WA 3M3EA 1QQP2 1N3PA 2WC2A 3SITA 3VBFA 1YYNA 3KLSA 4D3WA 1TNFA 1MVQA 2MHFA 2UYAA 2E63A 1POV1 2CGPA 1QXPA 4WM8C 4GALA 1W6NA 5AC91 1DQ5A 2VGDA 3WNXA 1VBB1 4XDQA 5GZFA 3JZVA 2I74A 1DZRA 2O8OA 1OMIA 3ZFEC 1PGW2 4KNCA 3GF6A 5JDBA 1RJ7A 1MS0A 4MVTA 2WIIB 1IS3A 2HWF3 4WVWA 2EXKA 4AQ2A 3VBOB 3MF9A 3JQXA 4XF0A 2WT1A 5L7OA 2VW0A 1ZBA3 3WQ0A 2GNDA 1M4WA 3O0XA 4NO4A 1B35C 2C1FA 4QPGA 1U5XA 4QQHA 4N7UA 3H3UA 3S30A 5JSRA 1H30A 4AG4A 1FX5A 2CWMA 2QCSB 1UU6A 3VBRA 3AZZA 5GLVA 4Y1UA 2VMIA 3THPA 1BMV1 3TN93 1CONA 2E7QA 1F8VA 5GZCA 3AYAA 5GZEA 3RS6A 4COZA 2G9FA 1IS6A 2D98A 4UW5A 3SNMA 3ES4A 4R9BA 2WZR1 4GB32 4M0NA 3M3OA 4Q0PA 3A0NA 3SMHA 3NAPC 1LECA 2PLV1 4CP2A 4AI0A 4IV1C 1MACA 4QPGB 4COYA 1J59A 3JD73 3AYEA 1S55A 4XHXA 4YW5A 1S2KA 3HN1A 2ZGKA 2BBVA 2GC0A 1ZM1A 2DYCA 2OPKA 2C9AA 4TLFA 1XRUA 4YG6A 3RYPA 4BZ4A 2OUJA 4FPFA 1FOD1 1BEV1 2NM1A 2ZGUA 4KU8A 1RHI1 2UY9A 3FHIB 4WV8A 1SBFA 2IXIA 2PHLA 4R9AA 4DQAA 1QNWA 2RS11 3TYJA 4QQOA 2GNBA 4A3XA 3PTYA 1FI2A 2BEOA 2DCKA 2DU0A 1LTEA 1SBEA 4OUSA 1LEDA 4CZSA 3U11A 1H1IA 3H7YA 5EWSA 2A5ZA 2ZAAA 1WD3A 1CAWA 2GH2A 1HQWA 2D6NA 1HKDA 2PHWA 3IPVA 4I01A 4B3NA 1EV11 5BNOA 4LE4A 5CIRA 4WZFA 1RVF3 5JPNB 3ZFGB 5JOYA 3SISA 1VBE1 4GQ7A 3AZWA 2PFWA 5JI7A 1OI6A 1AR93 4V1PA 1OA3A 3IT8A 4PDWB 5F6LB 1EAH3 4NVPA 1S0GA 2JENA 1V9U1 3AP9A 3AZVA 3HMYA 4JGZA 4FPLA 4LTAA 4HVQA 1EY2A 4HL0A 4JGYC 4AGGA 1CAWB 1B09A 3BPZA 3RI9A 2ZA9A 4QGMA 1RUH1 3IN9A 1GZCA 3IPVB 4BPZA 1TMF2 4MXVA 1DQ0A 2LUWA 4P9GA 4WM7A 4I3GA 4RHV3 2XG3A 4SLIA 1COV2 2NYYA 2AR6A 1Z0HA 1WW7A 5BNPA 4S2GA 1FPN3 2K2SA 1AF9A 1ZVFA 4Y4YA 1RUF3 2R16A 2ZBJA 4HK8A 5AVAA 4Q0VA 1MQTC 1WLDA 1IS4A 4LLOA 4Q4W2 1VBD1 4A7ZA 2XGXA 4OHWA 1NCRB 5EXOA 2WNVC 1W6OA 3I4IA 4O9EA 5BV6A 4N9HA 2HWE2 1R1A1 1CX4A 3ZMOA 4XMAA 2DFCA 3WUDA 1LGCA 3WX5A 1VLNA 2VNOA 3I59A 2ET7A 4YM3A 5GZGA 5H9SA 1CVNA 3SXWA 1BBT1 1NA1B 2XBO1 1LGNA 4XJZA 3BALA 4YFWA 3E6CC 4IEVA 1PIV1 1XU1A 3HQXA 4NHLA 3WDWA 2WFF2 3R6SA 3HBZA 3ZSLA 4QQ2A 2DVAA 1RUI1 2R49A 1RB8G 4OI4A 1LODA 4KWKA 5DZFA 1JBCA 1UCXA 3P3NA 1NCQC 2Q5TA 1W6OB 4RFT0 5IK5A 1UZZA 4ZU7A 3LZZA 1W6QB 3WXPA 2GMEA 4AHWA 1F5FA 1H4HA 2WS91 4IXLA 3USUA 1FATA 3INAA 3ECQA 3V64A 3OF1A 2PAEA 1CAVA 2CWSA 5GJ6A 4FPGA 1Q8PA 1PVC3 1C8M2 2EXHA 4MGZE 4YG3A 2P3JA 2UURA 4XJUA 3FWEA 4OUMA 1VR3A 1YO8A 3H9AA 2PHFA 4QM9A 4URTA 1SLBA 5DUWA 3AMPA 4AYUA 4ES8A 1UU4A 4QM8A 4XFCA 2AENA 1OQEA 1Q3EA 4CYDA 5EV7A 5J96B 5KHGA 3USUB 2V5YA 1OD5A 1RUG2 4PJYA 2I07B 2XHKA 2GZWA 2QFEA 1SEFA 4LO7A 4IEWA 2JD4A 2EF6A 1CAVB 2BW8A 2UWCA 3QBQA 4AFDA 4CEWA 4RGGA 5AVPA 3RI8A 3PVEA 3TNPB 4Q27A 5CFCC 4OI0A 4JV4A 1RUC2 2X29A 1POV0 1GV9A 1ULFA 4A7YA 4RR3C 2RS32 4QHBA 5E89A 4GWMA 1HRI3 4Q4Y3 4P14A 3VGIA 3ZXJA 1CJDA 1D4VB 4E9KA 2DCZA 3VBSB 3LWCA 5CU1A 4LBQD 2R1BA 4AFMA 4JDMA 1H1AA 4R9DA 4FP3A 3MLKA 3USSA 4BA6A 2Q0AA 3WV6A 2Z2SB 4LO8A 2ZHNA 3TWIA 1ND2B 3ZMNA 3FZ3A 4XIOA 2VOWA 4LUMA 2FMYA 1XE7A 1MS9A 4XBQA 3GBWA 3LSDA 3V0AB 4YZ5A 3FBYA 1DF0A 3SLIA 4B8EA 1BQPA 3TN91 3WP4A 2XLAA 3ENRA 3OYWA 4LBLA 4QPYA 4EWEA 2DUOA 4UBGA 3KQRA 5C9AB 5LEJA 2DVGA 5I93A 1UAIA 1PGSA 3MZHA 1SFNA 1MS5A 1XNKA 2YZ4A 4QQLA 4XBNA 3W58A 4BYYA 4Q4V3 4IEZA 2NQYA 3B94A 4HPKB 1YWKA 1RUD2 4MXWA 3T1LA 4Y1XA 4AWDA 1RUG1 1U12A 1QJY3 2XLFA 4JQRA 1TME3 2YPJA 3OYWB 4IEPA 1Z7S2 4K20A 4Q2FA 3TAYA 2QKDA 3VDDA 4XF1A 5KC6A 4K9SA 4C0HA 1SACA 1PZ7A 2WNUA 4B4RA 2D6MA 2XVKA 2JG8C 1YIPA 2BTVC 3JBG1 4AW7A 4LLFA 1AR72 1I3HA 1T6GC 1V6OA 3M4FA 2GSYA 3MGUA 5CFDC 4E4SA 4YM1A 3E5UA 4L2NA 1POV3 1Y9QA 2XWBB 4YVWA 2A6ZA 2R0FA 2ZGPA 2XB6C 4IV3B 5J98B 1NXD1 3ES1A 2BUKA 1CPNA 4AHXA 2HWD1 1VBB3 1TQ5A 2YC0A 2ERFA 5FTTC 3V0BA 2HWC2 3VUOA 1DQ1A 2D5FA 5FQ0A 1F2NA 3B7MA 2EXIA 3M3QA 3FLRA 2BWAA 3E6DA 3EBRA 5JSPA 3GBGA 2O1QA 4Y20A 1H9WA 2C0ZA 2A6WA 2ZGMA 3POSA 5K0UA 4B7EA 5I0RA 1V6MA 1C5IA 1KS4A 2JKBA 3MW4A 2IXLA 3WQ7A 2DVBA 4P5HA 4AI1A 1EAH1 5KXDA 2MEV3 4HN0A 3PJQA 3OBTA 1PO22 1ZZ7A 4I3PA 4N9IA 4XXPA 4EWDA 5A3LA 2BWCA 2ZKNA 3QOPA 4KGGA 4K1YA 3JB4C 5E1RA 2AGSA 3LA7A 1O3QA 3GNEA 4LA2A 4K7JA 5DUXA 2JX9A 4WZCA 1XNBA 4GXLA 4Y20B 3T2TA 5K0UB 4GA9A 2EIGA 3RMYA 5FOBB 1XE8A 2NP0A 3H0OA 1R082 4QD2A 1PO12 1QJU1 3BB6A 2B42B 4R8HA 2HWB1 2PLV3 2VW1A 4FOYA 3WT3A 3TBDA 3E5QA 2IXKA 1MS3A 4W6XA 1QQP3 1VBC2 1NXMA 4XMIA 1H8TB 1QMJA 2D6LX 2PHUA 1YI7A 1QH7A 1YJKA 3VZKA 2QDRA 3S0MA 2VUJA 3U4XA 1FOD3 4N43C 1RTVA 4GH4C 5D8AC 5T50A 1C5HA 2PTMA 5K7PA 1RHI3 3WP5A 1RIRA 1Q8QA 4CEYB 2HWC1 2RS13 2ES3A 4AEDA 1LHWA 4KU7A 2D3SA 4Q4X2 5F1RA 1DGRA 1QOOA 3HWJA 1SBDA 4CDXB 5C6CA 3WVJA 4F3JA 3ZN5A 4FQ4A 1DZQA 5H9RA 4AXOA 1BXHA 3R4DB 2NZ9A 1Y7BA 4ITCA 2XPJA 1ASJ2 4XFHA 4YGCA 5JWPA 4DMIA 1LESA 1PVC1 4LULA 2VMHA 2DVDA 4YARA 4WM8B 1VBE3 1QXRA 3OY8A 4FP2A 3A0KA 1G9AA 3S7EA 2ZPXA 4DPNA 1REEA 1J3QA 1MS8A 3VBUA 4M00A 2WLPA 4CDUC 2O8QA 4QPIC 3AYCA 3TOJA 3EO6A 3B00A 3MIFA 5GLWA 2XJQA 1OOPA 2WA3A 3GHMA 3FMGA 5IK8A 4GB33 2GALA 2VULA 1I9RA 1RUH3 3ILFA 1KD7A 4M01A 4MUVA 4Q1PA 1MS1A 4ATFA 1DDLA 4IEOA 1SMVA 3FLPA 4CTEA 1B35B 1TNRA 4LO4B 4LA3A 1UF2C 5JPMB 3VHPA 1M06G 4E4DX 3LCPA 1VBD3 2BFUS 2KXLA 5H9QA 1OOPB 2P34A 1GANA 1UW8A 1ND3C 1IKPA 3R0RA 1R1A3 4Y24A 2VW2A 4I0WB 5JZGA 2MNGA 4FPHA 4P9JA 4LBJA 4MZUA 4OHYA 5KHJA 1SFYA 4M3CA 5JAXA 1D0HA 4PLMA 5IK4A 2VOXA 2DTYA 3WOGA 4D7TA 1AR82 1BBT3 4IV1B 2GMMA 2XBO3 1R1ZA 2Z5WA 4X6QB 4FPOB 4CDWA 1PIV3 1VBA1 4ISQA 5CADA 2IFWA 5CAZA 3LA3A 4AQTA 1WCKA 3W9AA 4BWOA 2AH2A 4NHKA 3D0JA 4OI2A 3VLBB 1L3JA 2P3KA 4EV0A 2RR11 3DL3A 3PMEA 3AJZA 1AYN1 3AP7A 1O91A 1QDOA 3G7DA 4LBNA 5FRAA 4MGKE 2A75A 2HJIA 1U5IA 2R061 1YLLA 3QLQA 2W39A 4WBBA 4UW6A 4QGLA 1HW5A 1HQLA 1SLCA 4RS5A 3TNQA 4KWLA 1RJ8A 4AEKA 1EPWA 2XJPA 3N7MA 3VZLA 1V00A 1D2QA 1G9FA 3MICA 5JIAA 4DRVA 4WVVA 1AL22 3NV2A 3OBRA 1TME1 4MH0E 1TMF3 1RINA 4GKYA 1RUE2 1QJX1 4ATEA 1COV3 5I0SA 1ZZ9A 1N3OA 4CDQC 1X8EA 2RS52 1FNYA 3DV8A 1C8NA 1WMFA 5JLVA 4Q4W3 4FPEA 4AGVA 1LOEA 4FXKB 3EQEA 4RSUA 4TWTA 3VBOA 1CGPA 4RS5B 2DCYA 2HWE3 3OD4A 5F6KA 2A3YA 5FO7B 1BK1A 1MEC1 1YFXA 4FTEA 5CG9A 1NY72 4L97A 3OPZA 4L92A 3O12A 4UW3A 1J3RA 1OA4A 2ZX3A 2MPFA 1HIXA 4N53C 3U0ZA 4IL7A 2VVFA 2Q1MA 3IDCB 4MSVA 2ZGQA 1PZ9A 1WCDJ 1O3TA 2BFUL 1ZREA 4YYOA 2WFF3 4G3YC 2X53S 2EA7A 4LT5A 3AFGA 3QH7A 1HRV2 5I0TA 2DVFA 2V09A 3LOIA 4KBBA 2MEV1 2RMU1 3EXUA 1MQTB 1PGL2 3VBHC 3VZOA 2WSUA 5EZWA 2WNVB 1AYM1 4RL7A 3WG3A 2QJVA 4YM2A 2D43A 4KWJA 1HXS1 3H7JA 1QWRA 4LNVA 3GHNA 2GN3A 3DN7A 1QNYA 1SCSA 3B69A 2R042 1TEIA 1DFQA 1J1LA 4LBQB 2IXJA 3GZUC 4XFBA 3LGRA 5ABJC 4XJWA 3RJ2X 2NPIA 1WW5A 5KXEA 1KJRA 1HQNA 4RQPC 2JEMA 2VOVA 1NCQB 1QQP1 3NL1A 4R4ZA 4EN8B 1O4ZA 4ZXKA 1RUG3 1G7YA 3ACLA 2X5IC 5KXCA 3CJIC 4KL1A 2ZCWA 2GC3A 2VU9A 3HD8B 3ZN6A 4YZ1A 2WZPP 2PQQA 4BH9A 1LOBA 5HXVA 2E51A 3ZFGA 3AZYA 4E2GA 3JBG3 4Q0UA 1RUC3 1PK6C 2NLRA 5BPXA 1PGW1 4PDWA 3H50A 2RS33 1DGLA 3PLQA 1H0BA 1HDKA 3NKGA 3ZN4A 4AFAA 2DURA 3WHUA 4P9IA 5K9YA 4NWWA 5GLZA 2WQZC 3FFQA 4C91A 3WP3A 3AM2A 4A7KA 4Z92B 2HWD3 3ZN6B 1LGBA 3WDYA 2KM2A 1PGL1 3WG1A 4I0BA 3RQ0A 1QOSA 5FPZA 4XBLA 5T54A 2FQPA 1VJ2A 5KBFA 1TE1B 2R32A 2QE3A 2VY0A 2GNTA 1DQ6A 3APBA 1ZRFA 3DPRA 2IXCA 1LOFA 3IIAA 4L9BA 5CFCB 4DZGA 2TEPA 1NCRA 2R041 2XJUA 4RR3B 4GB31 1X36A 1SLTA 2DUQA 2KA3A 1F31A 1FMD2 3ZIWA 3HAGA 4J1XA 5J3UA 4XHBA 3O0VA 3IDBB 4OFGA 2UWAA 1C4RA 4IESA 4XFAA 2NMOA 4B4QA 4DOUA 1ZRDA 2EVXA 4C90A 4E27A 1NA1A 4QX5A 5EYYA 2H6CA 5AFEA 3MLJA 2QZ3A 2ILMA 1ZZBA 4OLLA 5C8CA 2Y0IA 4XQDA 2E53A 3DPRB 1QJU3 1BKZA 3ZYJB 1X8MA 1W6MB 2HWB3 4META 4BLIA 1NG0A 1O3SA 3WDXA 4W6WA 2W68A 1QY4A 1PHMA 1DYKA 1YJLA 4XJ9A 1GR3A 1G6NA 2WWSA 1W6QA 4NPRA 5C4WC 3B3QE 3QH6A 1QDCA 1NOVA 2H0VA 3VBFC 1GLHA 1N1TA 3SCGA 4EN7B 4WVMB 1O4TA 3CU7A 3KT4A 4P9XA 1XYPA 4C1XA 2A7AA 4N90A 1LULA 2VH9A 4ASLA 4Z1VA 5J48A 4OHXA 4BE3A 5C8CB 3KGZA 2CAUA 3VZNA 4B4PA 1IPKA 2NMNA 2HWC3 4FOQA 5DXDA 4XIKA 3MIBA 5CB7A 1EP0A 4AHYA 2JDZA 4INDA 3ETQA 4XQ4A 3MPPG 4XETA 5LRRA 2HEYF 2CV6A 2JG8B 2K0GA 1JXNA 2JECA 4AQ6A 1PO23 3OTFA 1JYIA 4KH9A 5CFDB 5L7OC 4DRRA 2OA2A 1SLIA 4QPGC 4B7KA 1XNDA 4QU2A 4OZXA 2D97A 1O4YA 4F8AA 1OPMA 5KC5A 3VBRC 4LR4A 1TMF1 4AVTA 1COV1 1A8DA 2PELA 3FBMA 4JTOA 1R083 3ZDSA 3VBSA 3O0WA 4OI1A 3AB0A 4Q4W1