4J6GA

Crystal structure of light and dcr3 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
139
Chain Sequence
VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCASTITHGLYKRTPRYPEELELLVSQQSPCGRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 139
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j6gA00
3TYJA 2HEWF 3LKJA 1A8MA 1XU2A 3FC0A 5CIRA 3MI8A 2WNVB 3B93A 4TWTA 4NN0A 2TUNA 2WNVA 2JG8C 2AZ5A 2OIIA 4GIQA 1U5YA 2QDNA 2E7AA 3QD6A 1WCKA 1OSGA 2RE9A 4MSVA 2WNVC 4QQLA 2X29A 4HT1T 2RJLA 2WNUB 5L36A 2TNFA 2R6QA 1PK6B 4OUMA 4QQHA 2WNUA 4EN0A 4QQOA 5KC5A 1PK6A 1ALYA 3B9IA 5L19A 1TNFA 2QE3A 1D4VB 4OUSA 3B94A 2ZJCA 3URFA 2ZPXA 3TWIA 2WNUC 4DOUA 4D7YA 1KXGA 1S55A 1IQAA 4E4SA 1D0GA 4E4DX 3WD5A 3K48A 2HEVF 5HBAA 4KGGA 1C3HA 2O0OA 1O91A 4G4FA 4J6GA 1OQDA 4G3YC 4TSVA 1RJ7A 4QQ2A 4N90A 1JH5A 2R30A 2R32A 1KD7A 3AB0A 1XU1A 1TNRA 1OQEA 1DU3D 1JTZX 2Z5WA 3ME2A 2Q1MA 4QPYA 1PK6C 4MXVA 4KG8A 1RJ8A 4MXWB 3V56A 1GR3A 2JG9B 1D2QA 2HEYF 5TSWA 3ALQA 4DB5A 5BNQA 5KC6A 4RSUA 4MXWA 2Q8OA 2JG9A 3QBQA 2RJKA 1U5XA 1U5ZA 5KWRA 1I9RA 4F3JA 2KA3A 2JG8B 1DG6A 2JG9C 3K51A 1C28A 2JG8A 4KGQA 4OULA 3IT8A 3L9JT 4QQPA
chains in the Genus database with same CATH superfamily
3SH3A 2HEWF 1A3KA 5A7WA 3TN91 1XU2A 3U1XA 1JYTA 4CP9A 3JD71 2FDFA 1BMV2 2VUDA 4TWTA 4OUEA 4M01A 1DP0A 2VMFA 4NVPA 1BYHA 4M00A 1W8WA 2PA7A 2ZKNA 1MS1A 1C57A 1GBGA 3J7LA 5FZ3A 1CVNA 3RZLA 5F37A 5CISA 3T4VA 1PZ8A 3ZX7A 4NHYA 1C5IA 4GIQA 4XIOA 1HB1A 4LO8A 1JHNA 1STMA 3QD6A 4Z2AA 4C91A 3OJBA 4F8AA 4I30A 1CZSA 4XJAA 1GFF2 1PO13 1WW6A 5D2AA 2G1MA 5GLTA 4ARXA 4BXSV 1VMFA 4GD4A 5CNAA 4IETA 3ENRA 2HWC2 5GLUA 2R073 3UKVA 2VECA 2G19A 3RFRA 1X33A 5FO8B 1TME3 5L36A 3ES4A 5FQ0B 1PK6B 3VDDC 4XUTA 4C0BA 4Z92B 2OZJA 3MV11 3V0BB 2YGLA 4CCCA 5FQ0A 1PK6A 4IEVA 2RS32 2YYOA 1S2KA 1WWYA 5IVJA 3V0BA 2VY0A 2CNAA 1PVXA 2D43A 3AVSA 4RGKA 3AZZA 2ZMKA 1LGBA 1N1VA 1OA3A 3HIFA 5IATA 1VBC2 2ZX1A 3O14A 1W99A 2Z4FA 4PIZA 3U14A 4B7EA 1MS8A 2XVLA 4CEWB 2ORZA 3SKVA 1W2TA 4CCLA 3HN3A 5DZGA 5J1XA 3WUDA 5CAZA 4CEWA 3B69A 1QOSA 4NOTA 1BVP1 3MIBA 1BHGA 1HRV3 3NNFA 4Q4W2 2BOIA 5E88A 1CIYA 1DLCA 2H6CA 5IVFA 3S30A 5FOBB 1LEMA 2VC9A 3WDTA 5KHIA 4W6YA 1OA2A 1NE4A 4N90A 2J22A 4DXTA 1H9PA 2QKDA 5G04L 4A6OA 1Q56A 5BNNB 2VW0A 3CO2A 1ULPA 4JZRA 2FDHA 4GULA 5HCFA 4LKDA 4QXCA 1R083 2WJSA 4YG3A 2DUOA 4QDQA 1PVC3 1S0IA 1S0DA 5FZEA 1BEV3 5BNNA 2XJRA 3QH6A 4L97A 1ULDA 2VZOA 4AHZA 3IB3A 4XIKA 1COV3 5J98B 3FZ3A 3MPBA 1QXRA 4HZFA 5FBJA 2WLPA 2GC2A 3K4AA 4XBQA 1UOJA 2HWD3 1AR82 3WP5A 4NHXA 1S0EA 2WAAA 4RSUA 3KHBA 2B39A 3J9SA 2GMEA 3QBQA 2CSGA 5IW0A 5DQ0A 4OVEA 3MLKA 4DS0A 1L7QA 3FE5A 1UD1A 4JHZA 1QJFA 1QJY2 1HLCA 2JDHA 2YFZA 4QPGB 4C1XA 3BU7A 3VKNA 3TN93 1F31A 4FPYA 2WC2A 2PMWB 4IV1B 4O9EA 4QPGA 3V0AB 3VKMA 4IGOA 1GUIA 2VVEA 2XUEA 5DDJ2 3V0AA 4IV1A 4ES9A 2EXIA 3U07A 2W68A 5FUIA 5ABJC 1RHI1 2GZWA 2LROA 1WCQA 1N1YA 1XBFA 1KGYA 3LKJA 1I6XA 1YFWA 3O1MA 3LDBA 4JGYB 2WIIB 4EZ4A 1OPOA 4NWWA 5DUXA 2B4KA 5C5UA 1QNYA 2YC0A 4DPNA 5LY2A 5T3NA 4JGYA 3I3QA 4M4PA 1BBT2 2GP5A 3D82A 4HKWA 4XJ8A 3N9LA 3I2DA 2ZBJA 1AYN2 4N43C 5FMDA 4GWMA 1UMZA 1BXHA 2OX0A 4Y1ZA 1VRBA 3GZEA 2XJVA 5H9SA 2OW4A 1HQWA 2VXRA 1RMU3 3WCSA 3O1UA 2V5DA 1OD5A 3EHKA 2NZ9A 3H1YA 1DYKA 4QQLA 1BMV1 5FREA 2XLGA 2D97A 1V70A 1JYVA 3ES1A 3PNAA 1ZRCA 5FRAA 5KHHA 2HWB2 4BDVB 5LCWL 4K6BA 3I97A 3PMSA 4QB1A 4FAGA 3DXTA 5C8CB 4OQ8A 4HVQA 4AEKA 2ES3A 2XL7A 5C8CA 1GYKA 3BI3A 1WW7A 5JZGC 3VD4A 2VNGA 2YFUA 2BP6A 2ETEA 3I4IA 4HMZA 3WDUA 3TOJA 4H55A 3P3NA 1QEXA 4FT8A 5FKCA 3NQHA 4JAAA 4Y4RA 3MF9A 1L7RA 3HN1A 1V6IA 2J1TA 4UFKA 2DDUA 4WVWA 5C33A 4HSJA 5FYVA 3S0MA 3IMNA 3D0JA 3PDQA 4QXKA 2XDVA 2XONA 4A41A 1H6YA 1WBFA 2RS31 2D5FA 5E89A 2VOTA 5FZCA 5FYIA 1NCRB 2E7QA 4CUGA 1OBNA 4YM3A 1W8FA 1YQ6A 2W95A 3P1IA 3POIA 3V64A 4R4ZA 1TE1B 1NCRA 2FDIA 2ZEZA 1VBC1 3EMRA 2C4XA 1XOYA 4L8QA 1ZZ9A 2E7TA 2GAUA 3UESA 4BISA 1YI9A 4CDWB 3D3AA 4YVWC 5GKAC 3AJZA 1RUG2 2BVBA 1CAUB 3NJXA 3MFCA 4BWOA 2VXJA 4LE3A 4CDWA 4QKDA 3WNMA 5FYHA 1H2LA 2GNMA 2IFWA 1Y7BA 1CAUA 1PK6C 1LODA 1Y4WA 3MLLA 1MS3A 1OURA 3M2MA 1JYIA 3T0DA 4YZ3A 2ZAHA 1JI6A 1UMHA 4Y4YA 3ZSEA 3QACA 1S4CA 4LO4B 4XFGA 2RDRA 5EXOA 4RFT0 1R1A2 3WW4A 1JBCA 1C8M3 5C4WC 3POYA 1H8TC 5CG8A 1SG3A 4A7ZA 3O1PA 4IGQA 1VBB1 3DKQA 5F32A 2UURA 2BTVC 2OT7A 4XDPA 4DZGA 2D3SA 3B00A 4NAMA 5A7PA 4XFHA 3LE0A 3RJRA 1AR81 4WVMB 1RVF3 3DL3A 3WF4A 1DDLA 5F5IA 1JHJA 4OULA 3J4UH 4FBFA 2ZX2A 1FOD2 2BUKA 4OZOA 1OFNA 2G4IA 2FDKA 4WVMA 4IEXA 4FFHA 2DFBA 3FC0A 4ZONA 2HLEA 4UFIA 3WW1A 2YMZA 1PIV2 2GC3A 5GM0A 5FP4A 1BK1A 3FLTA 5DUUA 4ARYA 4LO7A 5T5JA 3T2PA 4OI0A 2BWCA 4A7KA 4LLOA 4EN7B 2VMHA 4AE2A 4AQ2A 5DDJ1 5JR2A 2WO3A 4QB6A 2WKKA 4LKSA 1WCKA 4E8DA 2K46A 2AEZA 5CFDB 1K5MC 1RXGA 1UL9A 3KB5A 4XTMA 5IT6A 3AZXA 5BV6A 4I0BA 2DUQA 4J25A 5CFDA 3WQ0A 4ASMB 4XW3A 3NNMA 3PIGA 4HLTA 4QPIB 2UY9A 3J7MA 1BBT1 1DCSA 3OEBA 3MZHA 2VCAA 2HWC3 3CEWA 4QPIA 5FK7A 2Q8DA 4BZ4A 5CA6A 5JXIA 1BKZA 1AYN1 4CUBA 3WR0A 4YZ1A 3K2OA 3PLQA 3J7HA 1ODNA 4IV1C 5JWPA 3AKQA 1ODMA 1A78A 2XJUA 4LT5A 4N53B 4OUSA 1RUI2 5T5LA 2JB8A 1OH3A 3GJBA 2R062 2RS33 3W5MA 1OOPB 4BIFA 3MIGA 1IS6A 1NQJA 4I0WB 4N53A 2HWE2 2Q1FA 2BBAA 1G86A 1OOPA 3LA7A 4Y22B 4Y5Z0 5AVPA 5FYYA 4E8CA 4TZDA 1VBC3 5FO9B 4JGYC 1S55A 3D8CA 1D0GA 1ULFA 3PJQA 1ACCA 1AR91 4Y22A 4L92A 5FR3A 2C9KA 2WRAA 2VH9A 1C5HA 2E33A 4LNVA 1O8SA 5DG1A 4NIAA 2JDMA 4G4FA 3RSJA 3RVHA 3E6DA 4QX5A 5FY7A 3T0AA 1V6NA 2TEPA 4DUWA 5HCAA 1VALA 4Q4W3 2W39A 3BTZA 1X7NA 3AMPA 3S7EA 2VM9A 2WSVA 4IEQA 4K1YA 4B8EA 4AR2A 4DINB 5A6XA 4RD7A 2WQ4A 3ELNA 1OQEA 3IN9A 2P34A 5F2SA 2RS52 2BV4A 4LXLA 2BU9A 1OI6A 2GNDA 4XZUG 1CN1A 4QX0A 3SISA 3B01A 3ZN5A 2PTMA 2P1BA 2VUAA 4P02B 2H6BA 2WSUA 4YG0A 4YW1A 4AGRA 5C5TA 1LHOA 3NVCA 1EV12 3K77A 5I8SA 3GXUA 1AZDA 2DTWA 3ZYRA 4ES8A 5DUWA 1SLIA 4XF9A 3ZMNA 1LJ7A 3T2QA 5A6ZA 1R091 2JKXA 3WQBA 4B4RA 1AR83 1UZWA 1RUG1 1F15A 1NE6A 4WVZA 5FBZA 4R9CA 5AC91 3KT7A 3DEMA 4RR3C 1EP0A 1Z78A 3ZM8A 2VQAA 4XE9A 3ASIA 5DAXA 4C1WA 2A73B 1UQXA 2YU1A 5FY0A 1WLCA 2ZX4A 3JU9A 1IKPA 3FFQA 1RUNA 1QJY3 2VMCA 3MO4A 4YZ4A 2GALA 4FPFA 1NCRC 1W3XA 5JLVA 2YZ4A 3ZYBA 3ZXAC 3SXWA 4ATEA 3TEWA 3TYJA 4URTA 4U2AA 5DDJ3 1XJAA 3DV8A 5IVVA 1J1LA 1POQA 1GQPA 4ZZ5A 1UWWA 2JJ6A 4E2QA 1DGWA 1X9PA 5I0TA 3NMBA 5JCTA 1NCQC 4YM0A 3VBUB 1YI7A 5EWSA 1RUE2 2XXZA 5FYMA 1TVGA 4OLLA 4YGEA 2YBKA 1UYPA 4NAOA 2Q4SA 3VBUA 3LA2A 4PCRA 2Y8KA 3SH5A 1TZOA 3KSCA 4JGZB 5I0UA 1QXPA 1BBT3 5A3TA 3WY6A 1WUVA 4H14A 3A7QA 2ARCA 1YXWA 1Y9MA 2RM22 3NJVA 4JGZA 1AYN3 4JVAA 1JYNA 1I1EA 4P9IA 2WBKA 5EIYB 1W9YA 2WNUB 3ETQA 2ZGKA 5DAQA 2WNUA 2YC4A 3RNSA 1BJQA 1LECA 1UZ0A 1UYXA 4AWDA 4UYBA 3RZKA 1VMHA 1XE0A 2W2IA 5FCCA 2ZX3A 1KJLA 2HWB3 4MVTA 1RXFA 1AXZA 1K5JA 2CAUA 5A3WA 1CJDA 2ZHLA 4NE9A 4NHMA 3GCXA 4AK3A 2VQUA 2FDJA 1J84A 3N9MA 5D8AC 3ACGA 3WDVA 3NAPB 4YW5A 5DG2A 1LB2A 3GZAA 1T6BX 3KGZA 4CTEA 4ASKA 4S2HA 1EY2A 2VVDA 3NAPA 4XAEA 5KHKA 3KCXA 1IQAA 5FMCA 3N36A 5LATA 3N9OA 3MLJA 3OBAA 5FZAA 1G9CA 1IPJA 2V73A 4XHBA 4IE4A 5F3CA 2O0OA 4RS5C 1O91A 2RMU2 1W04A 4XABA 4FXKB 2JENA 1UKGA 4TSVA 4QHOA 4CPBD 2R7EB 1H9WA 1EUTA 1RUI1 3DUIA 5FOJB 2E32A 4E9KA 2R061 1KS4A 2ZMNA 1BCXA 2AH2A 4GZ9A 5E1RA 4S2DA 5I0DA 5KXDA 2HWE1 5FAXA 4GWNA 1JXNA 2Q30A 4QM9A 2DCTA 1TNRA 1X36A 2VNRA 1KRIA 4B7KA 1S0FA 1WD3A 1WGPA 4K9SA 3AP5A 2E53A 4AQTA 3BN6A 4K20A 1RUG3 2Y6JA 1K45A 1D2QA 5TSWA 4AYUA 3AMMA 4XFFA 4JHTA 1OH4A 2DVAA 4HK8A 4YPJA 3VBOB 4QX1A 4FSJA 1YFXA 4BQ3A 3CKHA 4AFBA 3VBOA 4BQ5A 5A7NA 3WF3A 3NRUA 4BJ0A 1VRH1 2V09A 2WDBA 4P9GA 4YSFA 3KZ4C 4GMP0 1CQ9A 3WP3A 5A1LA 2JB4A 1D4M1 5LRSA 4QHZA 5JSRA 1AJOA 1LOCA 3WF0A 1NLRA 1R1A3 1DG6A 2JG9C 4CEYC 3WG4A 3AJYA 1FI2A 4COYA 1DQ1A 2OUJA 3OGSA 4BMBA 1EV11 2RVAA 3WHUA 5C9AC 5EPAA 3N7LA 4QX8A 4FO9A 4BU2A 3I3EA 1LCLA 2A7AA 3T09A 1UW8A 4X8NA 3ZIWA 4FP3A 1GICA 2YU2A 2ZHKA 3VZJA 3HOBA 3R4DB 4IE0A 2OS2A 1FOD3 1OXCA 3IIAA 4XYXA 4GMP1 4XC9A 2D98A 4XETA 5A33B 1OLRA 5FDBA 2EF6A 3ZKUA 3A22A 2FMDA 2LW8A 1PIV3 2RDQA 4HONA 5EYXA 3VDDA 3OG2A 1XSRA 2EICA 1CX1A 5IJRA 1LOGA 2VTFA 4FVVA 4MZUA 1AR62 4YGBA 3KMHA 2WZ8A 3OTFA 4Z07A 4OI1A 1PX4A 4KU7A 3ZO0B 4RL7A 1O3RA 3OEAA 4GAZA 1IOAA 1V00A 1JOBA 4C8DA 1G9DA 3R4UA 5EP9A 3K3OA 3VD3A 1SZBA 4AI8A 2W3JA 3ZXLA 1MS0A 1O5LA 2JE8A 1PGW2 2IWGB 1RUE1 2ORXA 4OQ9A 5FPLA 3LEIA 3SEEA 4NRQA 1ZBE2 3C8XA 3A4UA 3B9IA 3OPZA 4DUXA 5KHGA 2G9FA 3MV01 3WQ1A 2Y6HA 1H2NA 2RM21 2CY6A 3LPGA 4CVUA 2A75A 4Q1PA 3VD5A 1W6QB 4EZHA 1S2BA 2J1SA 3AP7A 2LM3A 2NYYA 2D6KA 1MR5A 3C7HA 3I3BA 4D7YA 2ET7A 3WHTA 4WZFA 4EJRA 1RUI3 3WDWA 2UWBA 2R063 2PHXA 1C1FA 2R043 3DGTA 3ZFGA 3I3MA 4HPKB 4E4DX 2X5IB 2HWE3 3GM8A 1UAIA 2GDFA 2O14A 1H30A 3RZMA 2X5IA 3TRSB 2EIGA 4E2SA 4Y33A 1POV0 1ZZ8A 3VGIA 2AYHA 1HRI2 1YQCA 2QQJA 3LAGA 4LHLA 2XB6C 5FLJA 3VD9A 5LRRA 1LU2A 3OBTA 4CDXC 2R071 4JGZC 3UL2A 4JQRA 5K8SA 2QUOA 1SBFA 2ILMA 4MUVA 5FK8A 3VBSB 2CAVA 5A6QA 3WNXA 2CHHA 5ACA2 3OD0A 3BU0A 4IDZA 1GZCA 3IBMA 5IWFA 3U75A 1RIRA 2PQQA 3K75B 3VBSA 3WUCA 4AFAA 1JTZX 1VBE2 2OUHA 3ZN4A 2H0VA 4KNCA 3KVAA 5FXZA 5JPMB 1GWMA 2VD7A 2RMU1 3H7YA 1RUJ2 1H2MA 3VBFC 4FTBA 1POV1 3EJKA 4DB5A 1GOFA 2RS53 4V1PA 5FUPA 3GBFA 3JZVA 4LOTA 2UWCA 3ZYIB 1B35C 4AF9A 3T3YA 5ABJB 3IKWA 2RJKA 4XJ9A 2XLAA 3GBWA 5ABJA 2A71A 2C9AA 1EV13 4GJYA 4ORFA 2VJXA 4B1MA 1FMD2 1ZBA2 3OD4A 5JOXA 4YNIA 1US3A 2BOJA 1NLQA 2BEOA 5FY4A 4YYOA 2A3WA 3WNKA 4URAA 4F83A 1WW4A 1W9SA 2D3RA 1HDKA 1GSLA 4N43B 1NA1B 1SEFA 3NNLA 3P3PA 4GMP3 2VUJA 4LO6B 4K40A 4N43A 1QH7A 1NA1A 1A8DA 2JD4A 2WABA 5JR7B 4BM8A 4FTSA 3DF0A 3GZUC 2VU9A 3SNMA 4UT5A 3WG1A 4COUA 4UF0B 1R081 3VKFC 4A2UA 3AZWA 3CF6E 1BEV1 3H1WA 4YVSB 3THTA 3UJQA 4UF0A 4P00B 3WCRA 5A1FA 2VCCA 4AHYA 4YVSA 5A3LA 2HWD1 4A6SA 1SFNA 2QVSB 4H2AA 2OZ6A 4XXPA 4EQVA 2OYZA 4CRQA 1RUE3 3LSEA 5JZGB 3EBRA 4YFZA 3MYXA 4A45A 2WNVC 5EFUA 3HNYM 5T55A 5JZGA 3H3ZA 3TAYA 3KT1A 2PHUA 2JDYA 3MPPG 2RM23 3T1LA 1XB9A 2Y0IA 4IXLA 3F2ZA 1PMJX 4IV3C 2QBXA 4YGDA 2CV6A 1YQ8A 4DRRA 1ALYA 1H1AA 1XSQA 1E5SA 3PIJA 5FZ4A 2HBTA 1HXS2 1TNFA 4PQ9A 1HQLA 1DZQA 1AR61 3IDCB 5JXGA 1MEC2 2Y6FA 2ZZQA 2A3YA 4O65A 1PO22 4XACA 5F3GA 1UU6A 4DXZA 2WWSA 3NV3A 3ZFFC 5KBFA 2ZGNA 4R9AA 5FZ0A 3B7MA 1V9U2 2BERA 2YROA 3G6JB 4DOUA 5BNPC 3N7MA 1JZ6A 4YVWB 1PMIA 3MF6A 1PGW1 2J7MA 3AP6A 1OF3A 3FWEA 3H1MA 4YW6A 4ZS2A 2WLQA 3DYOA 3VUOA 4YVWA 1ZBE1 4D6RA 1JMUB 1UY3A 1HJGA 1FNYA 3ZYJB 3PTRB 2WR9A 1GU3A 3A23A 5FP7A 3RMYA 2X53S 5H9RA 1RMU1 5B4XA 4PBOA 2NP0A 2BFUL 2I2SA 4YM1A 2VR4A 1C1LA 3BALA 5C3PA 5HXMA 3BOPA 4JRAA 3AZYA 5LA9A 3ZPOA 1GNHA 2RMU3 1ZM1A 4FPLA 4BMEA 5A3NA 3SCFA 2IXCA 1GWLA 1POV3 4BQ1A 3MUY1 4XJWA 1KQRA 5C4WB 1ND3C 1OUSA 2JWPA 2WQ8A 1H8TB 1FAYA 1OFSA 4IEOA 3UT0A 2VW2A 4CCNA 4MXVA 2JDAA 4LJHA 1XRUA 5C4WA 1H8TA 1J58A 1QQP2 4K8FA 1GWKA 2JDZA 5B2GB 1J3RA 3ZDSA 3SITA 3UGGA 5KC6A 3ZVXA 3WF1A 1RGSA 3O1OA 1OLMA 5I0RA 1S1AA 3DKWA 2D6PA 5ACA1 2YY1A 1FATA 2VNVA 2VZSA 4TLFA 3CL1A 5D21A 3FHQA 1QJX2 2XVKA 4AFDA 5J37A 5FYTA 2F17A 2ZABA 3M1HA 4E27A 2LUWA 1GANA 5FPUA 4FCAA 4UFJA 3N9NA 5JMOA 3VZOA 1RUJ1 3CZJA 1G9BA 4TTGA 5LK7B 2X5IC 1F9KA 3AKPA 3LA3A 4Y26A 5FPAA 4R52A 3Q9OA 1S0BA 2W47A 4CXWA 1HB2A 1J3PA 5LK5A 1D7PM 2IXIA 4BLIA 1K5MB 1UU5A 2EXHA 2Q5TA 2DCJA 5FZHA 1LESA 3MI8A 1ENRA 1K3IA 4JDMA 4XOGA 1BZWA 1V6OA 5C3QA 5IK7A 4W65A 2QFEA 1I5PA 1FMD1 1K5MA 1ZBA1 2IXLA 4DO0A 3AL5A 3BIEA 4K8RB 3VBSC 5BYNA 2AZ5A 2VCMA 5L7OC 4QM8A 1QU0A 1DGLA 1HV0A 4RYDA 1XNTA 4EWAA 1DIWA 2P6CA 1SCRA 2WS92 3POFA 3HJRA 4OI4A 3WNLA 4BIOA 4OCTA 5A32B 3NKTA 5J09A 5DUVA 3UNPA 1Y3TA 5FZLA 3KF3A 3ZKYA 5A32A 1LOEA 2G9ZA 2QQOA 2GC0A 3BTAA 2Y6KA 3MFAA 1AR63 1C8M1 2O8QA 4DIQA 1TEIA 2QCSB 1LGCA 2ADEA 2QQMA 4AFCA 5DXDA 1AR72 3E5UA 2NLRA 5KXBA 4LK6A 2I07B 2ZGQA 4P14A 1UY1A 1YQ2A 1FX5A 3IDBB 2XBO2 1SFPA 5K9YA 1C8NA 1RVF1 4ONUA 2VZRA 1LULA 1IZ3A 4KQ7A 1FV2A 4FXGB 4FPOB 1AHSA 3R05A 3E1F1 1NA1C 1ZBE3 1QH6A 1G6NA 1W6OB 1Z0HA 1QJZA 1YJLA 4A4AA 4DNYA 1PZ7A 2VCBA 3AC0A 3AXEA 2RHPA 1ST8A 1W6OA 1CAVB 4XUNA 3O12A 4CPBA 1MZ6A 3KM5A 1BK0A 1CPNA 3DYPA 2WN3A 1CAVA 1QY4A 2HEVF 4NWVA 4YW7A 1OUXA 4Y24A 4YVSC 3GBGA 1HXS1 3N3HA 4COZA 4QX2A 3CMGA 2WO7A 3CQOA 4LITA 4J6GA 3ACFA 4LHNA 2FZ2A 4KWLA 1RJ7A 3FMGA 2FMYA 2Z69A 5FP9A 4CXYA 5LA0A 1QDOA 5LW9A 2JICA 4HOOA 2R30A 3TNPB 2VZPA 1LHVA 1KD7A 2F6BA 2IXHA 4PIYA 1ASJ2 1HRI3 2VBBA 5IVEA 3T2OA 2HWC1 4ISRA 4Y20B 4RR3B 1ND2B 4LBOA 1SDWA 3JB4C 4E4HA 2YBSA 4Y20A 4RR3A 1U12A 5ACA3 2QQIA 5J7MA 3SMHA 2IXJA 1W05A 5J36A 1W6MB 1VBE3 4AI3A 1DQ2A 1DQ5A 3SEPA 4HFSA 2C24A 1JUHA 4C90A 1W6MA 4HL0A 1RUJ3 4JV4A 4AQSA 1AYM2 4AW7A 2GC1A 2VNOA 3RMXA 5JIUA 1UO9A 2MEV2 2E26A 2W92A 1RINA 3P5BA 4LIUA 1JYXA 1QMJA 2JXAA 2VZQA 1V6MA 2ZXQA 1SHWB 1NCQB 4UFLA 2F4PA 1NY72 4EN9B 2XKPA 5HV0A 1UN1A 3H8OA 1NCQA 1UYYA 1FMD3 1ZBA3 3EB7A 1LHWA 1YIFA 3PUIA 5CFCC 4XURA 4RQPC 5K0UC 4Q4W1 1ZRFA 1W9WA 3L9JT 3NWKA 5F6KA 1JS9A 2A6XA 1NG0A 2V4VA 3BIWE 3KD4A 2PHFA 3B3QE 1JZ2A 4IEWA 4YFWA 2JD9A 4F7ZA 4PHZA 3FLRA 2RDNA 3M3CA 3PHMA 4NIIA 1VIWB 5GZFA 1JW6A 2R0FA 1DLLA 3PJYA 1X8EA 1N3QA 5FZOB 4LBQD 3HAGA 1UX7A 5AFBA 4AGVA 5FZOA 4CYDA 4Z2WA 1ONAA 1WLTA 2YPJA 1MPXA 3VD7A 4GH4B 4A3ZA 2G9GA 1NXD1 5JPNB 4MSVA 2R0HA 3O0WA 2BGCA 5D8AB 3D4KA 2HJIA 1RUOA 5FZKA 2IZWA 4GH4A 1WMFA 3HT2A 4FPHA 1BVVA 2WT2A 4FP2A 5LEJA 5IHRA 5D8AA 5JXHA 2R1DA 5HPOA 4QQHA 1GV9A 1N1SA 2VQTA 3IMMA 3EQEA 2WN2A 2CGOA 1QJY1 4DFSA 3AKTA 5FP3A 4BLJA 5BY5A 5GZGA 2ZAAA 2WS91 4RS5B 4DMIA 2A1XA 2AGSA 3PUSA 2ZZJA 2DWRA 4RA0A 1M4WA 1KFUL 1X82A 4Q1RA 3W5NA 2Z2SB 4RS5A 1HXS3 1KDKA 4MX3A 4P9LA 2GSYA 1MEC3 2X10A 4HN0A 1XE7A 2Q8EA 3TEZA 4W4ZA 1PO23 2FBEA 3ACHA 4O61A 4XZPA 5CADA 3W58A 5FY5A 3WD5A 2NMNA 1V9U3 1W2NA 2EAAA 4FOYA 2XBO1 3QOPA 1DHKB 1QOTA 4DY5A 3I2OA 4KU8A 4Q4Y2 3H3UA 2KD7A 3LZZA 1CZVA 4XBNA 4G3YC 1OT5A 1Q8SA 2XMLA 4CU7A 2JX9A 3C2UA 5JUVA 5FYBA 1JN2P 1LTEA 2CU5A 3JBG3 4CCDA 5F5AA 2P3YA 5FYZA 4BQYA 2WZR2 3N35A 3PUAA 4HBNA 3VLBB 1JZ3A 3CZUA 5ANQA 3BYWA 3NNJA 2IVJA 5JI7A 3AYCA 1OLME 2MHFA 3UV9A 4AL9A 2R042 1DZTA 1YJKA 4I2OA 1GP4A 5LY1A 4HKOA 1QF3A 1IQDC 2XVGA 4MADA 4IESA 4K7JA 4QPYA 4TLGA 3WG2A 5C71A 5KXEA 2HWB1 1UU4A 4E4ZA 3KCYA 2VUCA 3VZKA 4AAXA 1IS3A 1DBNA 2JE7A 2JG9B 3MW3A 4CEYB 5LA1A 1IS4A 2PHRA 3HMYA 1WMDA 1QGLA 1LHNA 1NUKA 2JG9A 4GALA 2WO2A 4NJ4A 4A7YA 4CEYA 1HJFA 5C9AB 4ATFA 3GCWA 4P9XA 1QQP3 5FPVA 1ASJ1 1W8TA 3ZN6B 5C9AA 4XCAA 3Q8FA 3WNPA 1WMEA 3T2TA 2B9VA 5LEKA 2WNOA 1RUC2 3ZN6A 1JOJA 1ULGA 4F3JA 1US2A 1YO8A 1E5HA 3NSTA 1W9FA 4CU6A 3OUHA 3KGLA 1UZVA 4XEZA 2TBVA 1VPHA 3VDCA 5I0SA 1QJX3 3LEKA 5JOWA 3MBWA 5FYSA 1XC6A 5FXXA 5HCBA 5BXXA 2A6WA 3SCGA 1AX2A 1S0CA 4OZXA 5FZDA 3E6CC 4I0AA 3ZXDA 1AYM1 4LK7A 2KR2A 1ZZ6A 5CIRA 3WX5A 2MEV1 4META 4KWKA 4YRDA 3VL9A 3ZXJA 1CONA 1EUUA 1NYWA 4LULA 5KXCA 3GJAA 4Q8LA 2BRTA 4HVOA 1FNZA 3RZGA 1IG0A 3RYKA 2OKXA 1YC61 2ID4A 1NY71 3T0BA 3AX4A 2QQVA 5DAWA 3TB0A 1DYOA 5HV4A 2D6MA 1RUD2 1ND2C 3KLSA 2BDRA 4QWNA 5AVAA 3U0ZA 1AL22 4NMIA 2D44A 1H1IA 3N4MA 3KT4A 1N3PA 3IAQA 3ZXGA 3ZFEC 1PZ9A 2BFUS 1RC6A 3FX3A 4JRLA 3PUQA 4NIDA 2WS93 2CGPA 2XJPA 1LEDA 3SQOA 1V6KA 3SHRA 4OFGA 5E8AA 4YZ5A 2VZ1A 5FMOL 2XJTA 1R1A1 3MIHA 2PLV2 1ZZ7A 2ZGRA 2PAKA 4ZY9A 3VZNA 1VBA3 3KQRA 2UWAA 1AR73 1NX9A 2ZGOA 4GB32 3M3OA 1CR7A 1SLAA 1SLLA 1Z7S2 4P5HA 3OUJA 5F5CA 2C26A 5DAVA 2VMEA 4ZU7A 2XBO3 4CDXB 4M4RA 1NAEA 1FOD1 3C3VA 5EJ1B 5F3EA 1XYPA 1UPSA 3AZVA 4BYYA 1W8NA 4FI9A 4CDXA 1QXJA 3IAPA 3PU8A 2EXKA 4Q0SA 4XUQA 4YM2A 5C7GA 1DYPA 1PIV1 5A33A 4E2GA 5IYYA 1DGRA 3U78A 3POWA 4W6XA 2GMPA 2AEYA 2DBIA 3I7DA 4BHPA 3PTYA 1UX6A 4NPLA 3VBFB 3HNMA 1QJU2 2DURA 4LR4A 4PIXA 1B35B 2W1UA 3VBFA 2PYTA 5KHJA 4CCJA 2D7FA 2WFPA 5AFEA 4GH4C 1G9FA 4N9IA 4QDSA 1B35A 4FPJA 2B45X 5A3MA 1W06A 2VMIA 3L2HA 4QAWA 2RDSA 4LTAA 1OQ1A 2X8KA 4J1WA 4SLIA 2PQSA 2VW1A 4JQTA 1MACA 1PHMA 1J83A 1TMF2 1ASJ3 1LR5A 3J8F2 4KG8A 4Q4Y1 3C7FA 5JMCA 2P3KA 1IHMA 4AFMA 1WA6X 2LS6A 2DCZA 3ALQA 5LA2A 1RB8G 3LF7A 1LRHA 4UW5A 1DGWX 2WZR1 1CWPA 2P5BA 4N9HA 4IQPA 3GHNA 4INDA 4D94A 1Q5OA 4K1ZA 1WKYA 2BVVA 2Y33A 3ZYFA 2R041 3FBYA 3VBHC 3FFZA 1AYM3 1KS5A 2KA3A 2IC1A 2NN8A 2CGNA 2MEV3 1YWKA 3OGVA 5JOZA 5GLVA 4BA6A 4JX0A 2CDPA 1C28A 2P17A 4OHZA 5BUVA 4CU8A 1F8VA 2MPFA 3RJ2X 4Y5TA 4LBJA 4NPRA 4L9BA 4Q8KA 1ULCA 2P4EA 2Y0OA 1KITA 2RJ2A 2WNVB 3NJYA 2V72A 4NHKA 3I49A 2WNEA 3WF2A 1RUC1 4DUVA 2YV8A 1FXZA 2WNVA 3W21A 1GZTA 3VBRC 5J3UA 5A7SA 1NZCA 2DFCA 5A6YA 4IV3B 4AOCA 1X50A 3LGRA 1VP6A 4M3CF 4PT6A 1U0AA 4IGPA 4P9YA 2RS51 4KMQA 3R0RA 2DTYA 2WWJA 3EO6A 4IV3A 1ENXA 4PLOA 3VDAA 3ZSMA 4UFMA 3ZFFB 2WYSA 4HT1T 4AVTA 3C7EA 2DVGA 4RFRB 3HQXA 4CZSA 2XJSA 3FUOA 4EN6B 2XLFA 3ZFFA 5BNPB 4QKFA 4R9BA 3PVBB 4NR1A 2ERFA 1JUIA 4OUMA 4AI2A 2Z79A 5K4LA 5BNPA 2GP3A 4J1XA 1RUD1 2QQLA 5KC5A 3C7GA 5L19A 4JKLA 1DGRN 3W20A 1WMXA 3QH7A 4Y3OA 1RL3A 2RS12 2W1SA 3MUZ1 1RITA 1QJEA 1XNBA 4AVVA 3PVNA 3ZIXA 3BUCA 2UYAA 2WA4A 3BOWA 5CKMA 3H42B 5FPBA 4WM7C 5F7UA 4OYUA 1SCSA 5JXJA 2IVIB 3GYDA 3RPQA 4CCKA 4JDNA 1W6PB 1YHFA 2YPDA 4LE4A 4E4SA 3CBNA 2PLV1 3K48A 3HD8B 3HR9A 4XHXA 1ND3B 4KGGA 3WW2A 3THDA 1W6PA 3TEYA 3CJIB 4UAPA 1FPN2 5F6LB 3NJZA 2JIJA 2JDPA 2W1QA 1W9TA 1ND3A 2P3IA 3A0NA 4GB31 3S6PA 4MGTA 3CJIA 1Z7S1 3FUQA 1NQDA 1DQ6A 2FCUA 3HT1A 4QXBA 4CUAA 3D0SA 5GLZA 1DZRA 3SH4A 1ZRRA 2YHJA 4Q4Y3 4B29A 5JVVA 3ITQA 3AB0A 3VHOA 4MG2A 1J3QA 3RZHA 1L7LA 3USUB 4FAHA 1O3SA 3E97A 1C4RA 2WO1A 5FYCA 1WD4A 2WZR3 4FQZA 3USUA 2WT0A 1OKQA 4RN5A 4ZU4A 4NROA 3VB9A 4D6QA 2BPA2 1W6QA 4XQ4A 1LKNA 4Q0VA 2ZHMA 2ZKLA 4O7XA 3V56A 2HEYF 3RYRA 1GNYA 2CL2A 2Y6GA 1QNWA 2E63A 3I2FA 4Q4V2 4OHVA 5L73A 3U11A 3DXUA 5I8YA 4HPKA 5FLIA 2ZEXA 1GQGA 2FCVA 2C6SA 1W28A 1UF2C 4IE5A 4AEDB 4O9GA 3MIEA 1U5ZA 3B02A 4LKEA 2DU1A 4B1LA 2VZTA 3ACIA 5EHDA 4AEDA 5CKQA 5FLHA 1VBD2 4Q0QA 4AEMA 1ZNPA 3IWZA 4CP9B 3L2YA 3J8F1 2ZMLA 5GALA 5L7OB 4GQ7A 3NW4A 4ZHNA 5FUNA 5A80A 3BTYA 3ACLA 3K51A 1RUC3 4JC1A 4AI1A 3LOBA 1Q3EA 5L7OA 3IT8A 4XFCA 5CYYA 3R6SA 1P8JA 4LBQB 3RQ0A 1GZWB 2EIBA 2B46X 3CDZB 1SLTA 1ENSA 2ZEYA 4LBQA 5FTTC 3PVOA 3VKLA 1GQHA 2JECA 1GZWA 1GOGA 2PHWA 4ZPIA 1AXKA 3O1TA 1XXNA 3E5QA 1UMIA 4CU9A 1XE8A 5KR7A 1JU3A 3DYMA 4CDQB 1ZA7A 4I02A 2AC1A 2D3PA 4IW3A 4DEVA 1RUH2 1U5YA 4WV8A 3FL7A 2FZ1A 2BZDA 4CDQA 2WFF3 4HVRA 4AI9A 4AVCA 4AXOA 2WWUA 1SACA 2RE9A 1UZYA 5IK5A 1RUD3 4HK9A 1IS5A 3D6EA 4AVSA 5IVBA 1AL23 2X29A 4AVAA 2E6VA 2VTXA 4HG6B 4B3NA 4MO3M 1W3VA 3PURA 5FFOC 5T5OA 3P6BA 2JKBA 1W8HA 3NL1A 1UY2A 1K12A 4JCKA 3ZYPA 2XGXA 1OF4A 4LO5B 3OOXA 2QE3A 3IDEA 4XJUA 4RGGA 2BQPA 3MEPA 2A70A 2PLV3 2HYKA 4XILA 4NRPA 4NUBA 5E6HA 4Y1VA 4PJYA 3ZPYA 4BE3A 1LENA 2J1EA 3N9PA 1O3QA 3ZXKA 1XNKA 4GB33 4IE6A 1N1TA 1LAJA 3HQUA 1Z7S3 4WZCA 2W08A 3ST7A 4D3WA 2XQRA 4JTNA 5JOYA 3CJXA 1GNZA 2EALA 3VHRA 3I2GA 5C3SA 5HBAA 2Q1ZB 3MGUA 3LOIA 1RHI2 1UOGA 4WVVA 2ZX0A 2AREA 4IEZA 5FZIA 3WSOA 3VDBA 2W5FA 1JODA 2RS11 3M8LA 4LBMA 2DVDA 4HSLA 1AL0G 3KV6A 5C8WA 1NLSA 1JH5A 5JI9A 1TQ5A 1UYZA 1UOFA 1HW5A 5FZ8A 1MS4A 2QZ3A 4KWUA 2E9QA 3WZ1A 5T52A 2VOWA 1QJU3 1REEA 3RGBA 1DU3D 2PN5A 2YGMA 1FPN1 1JZ7A 4LBKA 4LMFA 1YLLA 2ZGSA 2W9XA 4YWAA 3D5OA 3JBG2 5CFCB 4RQPB 1Q43A 3VZMA 1LOFC 5K0UB 1TMF3 3RI8A 3RWKX 3J8F3 2NM1A 3PMEA 4HN1A 2EAKA 5CFCA 4RQPA 5K0UA 5FWJA 1URXA 4D6SA 1YQ5A 1VAVA 5LB6A 2YC2A 5KWRA 2WUHA 1S2EA 4PLNA 3SLIA 4AGGA 5I8TA 3UYJA 4QHBA 4YLZA 5F1RA 5GZDA 2Y64A 1B09A 5FMOS 1D0HA 5EJ3A 4JTOA 4DY3A 1WCSA 4Q4V1 1GLHA 4GJZA 2DVBA 2NPIA 2Y60A 1YCIA 3CJIC 4I3GA 1XNCA 2RG4A 3RS6A 5A7QA 4YGCA 4QKNA 2YDEA 3QLQA 3BPZA 2VAUA 1HRI1 4EV0A 3B93A 4Q0PA 3F95A 4KBZA 4NHLA 3LFIA 1YFUA 3NNGA 3NV1A 1VBD1 1Q8PA 3WVJA 1W8UA 5APAA 1MS9A 1WA4A 4AAPA 3RYPA 1RYYA 3UGFA 4FTEA 2VBDA 1VBE1 4BB3A 3JCIA 3Q8BA 3M3EA 4QMAA 3I2JA 5GZCA 4MH0E 5CEHA 5HI0A 1AJKA 3MW4A 1GMMA 4RGAA 1IG3A 3POJA 3B9CA 1JZ8A 4NO4A 4AEDC 4CXXA 3LD8A 5C70A 3C7OA 4RHV2 4AZZA 2VL4A 2JDNA 1V6JA 5BPXA 1X8MA 4L99A 1JU4A 1RUH1 2Q0AA 4YW4A 3KF5A 1REDA 4TYSA 1UCXA 4Q0UA 1JZ4A 3ZSLA 4YARA 4UOJA 3URFA 2ZPXA 4MGSA 1OC1A 2CWSA 4XVHA 2SBAA 4Y5SA 3AMNA 5ISLA 2RS13 4W50A 4V2VA 1VBB2 4XPVA 3ZR5A 2WA3A 4LKFA 1Y9QA 2EIEA 2B5HA 2KXLA 4PDWC 3ZOIA 1VBA2 3AL6A 2JIGA 1KJRA 3U37A 5F9TA 1J1TA 2VVFA 4GA9A 2QQWA 4ASLA 4MYEA 3AYEA 4HXCA 4CDQC 3BCWA 1BLZA 4N7IA 3E5XA 5CZKA 5LBBA 1H8VA 3OGJA 1FPN3 3POEA 1LHUA 1XNAA 3DPRC 2ZACA 3Q8EA 3BKZA 3JD73 5T54A 2FDGA 1XYOA 3E6BA 4AHXA 2ARXA 4JKMA 4YZ2A 4H7MA 2EVXA 2KM2A 4Y1XA 4NIHA 2DCYA 5K7PA 4NIGA 1O4ZA 4XAAA 1RJ8A 4LQRA 2C1FA 2PHLA 4MGYE 3V65A 3CHXA 3U4SA 4PLMA 1AF9A 4L2NA 1YFYA 2W46A 2Q8OA 4CDUC 1I3HA 2GN3A 5LBCA 1MEC1 3IZOA 1U5XA 1PX3A 1WCUA 3HNBM 5CVRA 5JAXA 2J1UA 4Q4V3 2QQUA 3INAA 1AXYA 1PO21 1W0NA 3MICA 3LDKA 3PUHA 4FPKA 3WDXA 4GWJA 2J1VA 1H6XA 4NPMA 5CU1A 5IAXA 4IL7A 1V9U1 2PHDA 4JDOA 2GH8A 4LHKA 1CX4A 2DVFA 5L9RA 1PGL2 2VG9A 3UJOA 4Q27A 4QQPA 1O5UA 5G05L 4MHUA 1H0BA 1VBD3 3JBG1 5GZEA 3M3QA 5BNOC 5JSPA 4XXAA 1A6CA 1E57A 3O0XA 2EXJA 1H4GA 2PELA 1ND2A 2WAOA 2W91A 1ZA4A 4LA3A 4CCMA 3ZFEB 1UY4A 1AR92 1CAWB 3MW2A 4COVA 2BNNA 5C3OA 3K3NA 4MGQA 3WEZA 4BH9A 2GH2A 4R9DA 4QKBA 4ZXEA 3W59A 3ZFEA 2BNOA 1CAWA 2JG8C 4QT6A 3BPSA 3FLPA 4R4XA 3WV6A 3QCWA 2CYFA 3ZFGC 2C0ZA 2K9ZA 3AMHA 4JKKA 5H9QA 2EA7A 2UY8A 2W87A 3VKOA 4D0QA 1OHFA 4M0HA 5H9PA 5A1AA 3GNEA 2JEMA 3H8XA 2XKOA 3LWCA 2E31A 1QQP1 2ZGPA 1N47A 1RUH3 1APNA 1Q8VA 1W90A 2XQXA 5A3PA 1UY0A 4ZU5A 2VGDA 3GGLA 4BXFA 5CKNA 1NOVA 3ZYGA 3N7KA 2R6QA 2IFRA 2K0GA 2R49A 5FZGA 1OLQA 2B7YA 4FFGA 2PXJA 1I5ZA 2ARBA 2FCTA 4XF0A 1NT0A 5GLWA 4BOWA 1QJX1 1PNGA 2ZGTA 3I59B 4AG4A 2JDUA 4OHYA 1KEXA 1PM4A 3ROUA 5CG9A 2DU0A 1OVPA 3W9AA 1D4VB 5FY9A 2L9LA 3I59A 5I93A 5FIXA 4EWDA 1R092 3ATGA 4BK5A 4EN8B 4DRVA 1W39A 1OD3A 4H7LA 1VE0A 4K3UA 2BGOA 5AC92 4QU2A 1LGNA 3OSDA 3TNQA 2VZUA 1SPPB 1AX1A 5J96B 3LDRA 3AM2A 3ZDVA 4KBBA 1HV1A 1SPPA 3WP4A 4RHV1 1PM7A 4LUMA 4QXHA 1MQTB 2X05A 3WT3A 3KWVA 1UIKA 2OQ6A 1BQPA 2ZS6B 3POBA 4MGZE 3LSDA 4UFHA 1ZREA 2B9UA 3AVRA 1MQTA 1OQDA 4NRMA 5FZ9A 1AUYA 2VOXA 3KV5A 4QQ2A 4CA9A 3HPNA 3HWJA 3KS7A 5T50A 2DBNA 4XMAA 1VAKA 2VMDA 1IKQA 2OA2A 1RHI3 4CEWC 2WZEA 1QOOA 3AP4A 3LB9A 4OHXA 1IPSA 3WNOA 1YNAA 1WBLA 3AFGA 3AXDA 4QGMA 1W8OA 1XU1A 4YW3A 1CIWA 3S5QA 4A3XA 2VO5A 3AFKA 5SV5A 2X09A 5ANNA 2QQPA 1MVEA 3TBDA 2NMOA 3VBHB 3M4FA 3ME2A 2Z5WA 1GP6A 1VBA1 4S2GA 5LBEA 5FO7B 3IIIA 5JSOA 3VBHA 1AR71 3OCPA 1GR3A 1EAH2 4DEQA 2ZGMA 1OA4A 5BNQA 2I74A 4DQAA 2VOKA 4A44A 4QGLA 2YXSA 3ZYHA 3RRDA 1CAXB 3VZLA 5BNNC 4LLFA 2OPKA 3O7OA 3A21A 1K42A 4M3CB 1U5IA 1CAXA 1MZFA 1Q8QA 3OGRA 1UZZA 1R1ZA 2ZCWA 2QQKA 2QDRA 3JXSA 1FT9A 1UXZA 4HANA 1I9RA 2BJSA 2DCKA 2XH6A 4M3CA 5FMBA 1KDMA 1V6LA 4P5YA 5A3UA 3OUIA 4LHSA 5CB7A 3T4HB 3VBRB 4BCUA 2DV9A 3ZMOA 1OPMA 5F39A 4GKXA 3O1SA 2Y26A 4PI0A 4UI9L 3VBRA 5FZ7A 2RR12 2JDKA 5F3IA 1VAMA 3FHAA 2K2SA 4KWJA 4B4QA 4MLOA 1CD3G 1G8WA 1ZYBA 1T2XA 4QPGC 4FOQA 3ZSJA 5B4NA 1F4HA 5HXVA 4COWA 2XUMA 2TUNA 3WINE 1IPKA 1SBDA 5FP8A 3M7AA 1PGL1 3I54A 4W8JA 1HN1A 4UW4A 3ZXEA 3VHPA 3O0VA 4LA2A 2XWJB 3WDYA 2P37A 1D2SA 3CLPA 5FZMA 3PL0A 3VN4A 2DYCA 3FBMA 2AACA 3ILFA 3N7JA 3OY8B 1OSGA 1WLWA 4PF5A 2AUYA 3HBKA 1JZ5A 2V5YA 3ZXFA 1PGSA 5EYYA 3AKSA 2YB7A 3OY8A 4P08A 2ZGUA 2RJLA 1O4YA 1VLNA 5DABA 5FV3A 3SKJE 4WM7B 2PHTA 2Z42A 2CWMA 2ZOEB 4N8MA 2PFWA 4EN0A 1VJ2A 2RV9A 3AK0A 4WM7A 3OB8A 2A6YA 1ZRDA 2O1QA 3BVCA 1R64A 3OPTA 4EE2A 3BODA 1LOAA 4QX7A 2DF7A 2WFF2 2A6ZA 2D6NA 2HKXA 3OGGA 4HKLA 4RHV3 4XQWA 4CSWA 3LFMA 1EPWA 3B94A 3DCQA 4OMCA 5DZFA 1VRH2 2GMMA 2ZJCA 4GKYA 4GWIA 2GNBA 3TWIA 1JYWA 2IXKA 1D4M2 3J26N 4G9SB 2J1RA 3THPA 1O8PA 1WW5A 4IEYA 2VQ0A 1NKGA 5C8CC 2Y38A 1ZZCA 3EYPA 4FFFA 1RUF2 1W0PA 2XJQA 5IK4A 2XHNA 4Y1YA 1VBB3 2XR4A 1N3OA 5DAPA 3LQCA 1YYNA 4CCEA 5I91A 3ILRA 3JUUA 4CP2A 1HX6A 4B4PA 4PQQA 1WCDJ 2OXBA 3LCPA 2LRPA 1JYCA 2H0BA 2P2KA 4PI2A 4XDQA 3EXUA 3OYWB 4XFBA 5EV7A 5IAVA 3H7JA 3UKNA 4LBLA 1ZZBA 4XUOA 1DQ4A 5IVCA 2ZA9A 4MOAA 3NO8A 1YUDA 3OYWA 2BGPA 3T1MA 4U36A 3ORJA 4XFIA 2Q1MA 3ECQA 1Q8OA 3MDPA 2J42A 3ON7A 1YEWA 4X6QB 1F5JA 3POSA 3ETPA 4Q4X2 1SMVA 1PNFA 1H1MA 4XF1A 1UIJA 1W2UA 1ULEA 2QTWB 4Q29A 3T08A 5FXWA 4CDWC 2VOVA 2R1BA 3AMQA 4MGKE 5HCHA 4X6RB 3K4DA 2QJVA 4ZKTB 2XG3A 2HWF2 4HETA 2GU9A 3IDAA 4N7UA 4Q26A 5FZ6A 1Y9GA 1S0GA 2W52A 1HB3A 5L9VA 4IEPA 2QQNA 3RWNA 1CZTA 3RDIA 1EAH1 3VL8A 4QB2A 4LIVA 1MQTC 4CP1A 3TEXA 1F5FA 2YUEA 3NKGA 3IM0A 1UNBA 4ITCA 4K21A 4C0HA 5FY1A 1UKRA 3LPFA 1A8MA 2HYXA 4BPZA 2VPVA 3PU3A 5F8PA 1ZRIA 4S2FA 5LZ6A 5IK8A 2ATFA 5A3OA 4GXLA 1NXMA 2Q8CA 5FPZA 3KV9A 3THCA 3HEIA 5FPXA 1W03A 4AVBA 2OIIA 5LWBA 4IE7A 5D1IA 1PO12 3WLUA 1AR93 2VE1A 4MHRA 5A70A 4UW3A 2E7AA 2R072 1W6NB 4D7SA 3JQXA 2RR11 2FQPA 3I2KA 2E51A 1QKQA 4MGIE 4XQDA 1TME2 4ZZ8A 1SFYA 5CBLA 3KHCA 2D5HA 1A34A 5FJKA 3DN7A 1W6NA 2AENA 4Q5OA 5SV8A 2QNKA 1GP5A 4WM8B 4BQ4A 4Z82A 1VR3A 4CE8A 5FZFA 4EWEA 2AR6A 4WM8A 3UETA 4Q2FA 1CESA 2TNFA 1M06G 3POGA 1UXXX 2XL9A 3OPWA 4UBGA 2I45A 1H4HA 2ET1A 1WZXA 3VV1A 4QQOA 2ZEWA 2XPJA 5FYUA 4XJZA 2IUWA 4AHWA 4KL1A 3K4ZA 1AVBA 3LIGA 3AP9A 1MS5A 3OBRA 5CFDC 4L0PA 2A6VA 1QHDA 2WT1A 4QX3A 2GNTA 4OMDA 1IGOA 4QPWA 3ZSKA 5J48A 4XF3A 1HRV2 5E16A 2OQ7A 4QPIC 1H2KA 1R093 1NZIA 4KI5M 5AC93 2WL1A 3H0OA 1PMHX 3GHMA 4XF4A 4ET7A 3H8UA 3I2IA 2W0XA 2XWBB 4FOVA 3KCCA 3USSA 4AI0A 1O4TA 4IEUA 4UBHA 2HBUA 4TN7A 2WFF1 3BB6A 4N53C 2D6OX 4FOWA 3K46A 4OI2A 1O6UA 3H9AA 1V0AA 2ZGLA 1OOPC 1R082 1SDDB 3Q8AA 4ZXKA 1PVC2 1O3TA 1AL21 1BEV2 3MIDA 4EYUA 1COV2 3I2HA 3ZR6A 1F4AA 1LOFA 4FFIA 3S7IA 1QIQA 5FY8A 2LTNA 4Z8BA 2B42B 2HWD2 1SBEA 2C5DA 1RUF1 4XDOA 1SLCA 1G9AA 1T6GC 3M3IA 1HQNA 1WLDA 1LU1A 4M3CE 1ENQA 2ARAA 4DXRA 1JOPA 3KQ4B 3AYAA 4I01A 4MXWB 4QD2A 3PVEA 2YG0A 1F2NA 2BYVE 1VB2A 3FHIB 2ADDA 3MIFA 4MXWA 1LNSA 3O1RA 2ENRA 3TN92 3CU7A 3VDDB 2EIDA 3JD72 1EAH3 4D8MA 2HH9A 2BWAA 3FJSA 2UU8A 1RTVA 2D93A 4M0NA 4XBLA 1O59A 2Y34A 4SBVA 2WZPP 4AQ6A 3GALA 2A3XA 1X9TA 3CIHA 2B8MA 4L11A 3HQRA 4UW6A 2OVUA 2R16A 4Y1UA 5EJZB 3OF1A 4ISQA 4XFAA 4Q4X1 4UXAA 2J1AA 1VB4A 1UPIA 1HN0A 3S5AA 3I8TA 2Y6LA 4ZS3A 1GOHA 4LOSA 3WG3A 2VBPA 1MZEA 1XNDA 4MV2A 3LEGA 3VHNA 4D7TA 2VULA 2N7GA 3N9QA 3MHZA 4Z1VA 3ILNA 2RR13 2HWF1 1QJU1 3M70A 4NN0A 4CUCA 2SLIA 4WBBA 2CDOA 5T5PA 1S0JA 2XHKA 5FZ1A 3U10A 4A42A 4LPLA 1CPMA 3H50A 4BK4A 1RMU2 4P9JA 1CGPA 5DPNA 3WNNA 2QDNA 2W94A 4XMIA 3JB8A 3UK9A 3B5LB 1E5RA 4IUGA 1TMF1 1ULOA 1W2AX 2VZVA 1FV3A 3G7DA 5F5QA 4DXSA 3S57A 1REFA 1XYNA 1UOBA 5JDBA 5IFTA 5IFPA 4W6WA 1O7FA 1YRZA 2OPWA 3ABZA 3LIHA 1ZX5A 3AKRA 3ZLIA 1OMIA 3O1VA 2BBVA 5A7OA 2A5ZA 3UKTA 3I3DA 3RZJA 3VBUC 1GZ9A 4PF1A 3AYDA 1HB4A 1OKOA 5EZWA 1PO11 4EROA 3WP6A 3RI9A 2NQYA 3OBZA 2V4AA 2ZTNA 4XUPA 4P9WA 4PDWB 3IPVB 4LBNA 3X29B 2P3JA 2VZ3A 2QZ2A 1W0OA 4PBPA 5JIAA 3A0KA 1TME1 1HKDA 3R4SA 4PDWA 1XPWA 3IPVA 3SC7X 2YBPA 4BQWA 4CCOA 3JQWA 2WYFA 3HVDA 4X8PA 3BGAA 1W2OA 2DUPA 2FHRA 2WNUC 5M0TA 5ERLA 3DPRB 3T30A 1EYBA 4FPEA 3WXPA 2D6LX 1EPZA 1GKBA 1KXGA 1QDCA 1VRH3 1XQNA 1F35A 3DPRA 1W8ZA 4KH9A 5L9BA 2O8OA 4UWDA 1D4M3 2D40A 2F4LA 2VMGA 5EQUA 5C6CA 1C3HA 2BW8A 2JE9A 2LALA 3KVBA 4FQ4A 5F2WA 4V2WA 3RG0A 2PAMA 3SCHA 5FKBA 1YIPA 3WOGA 4IERA 3KV4A 1MZ5A 3NV2A 1FYUA 1LOBA 1RUF3 3GDBA 3H3LA 4I3PA 4LUKA 5IVYA 1MVQA 4AEJA 3NAPC 2R32A 1L3JA 1QWRA 1HRV1 4CDUB 3FN9A 4QGNA 5DMYA 1KFXL 1J59A 2MNGA 3RZZA 4WM8C 1DFQA 3U4XA 5DZEA 3NV4A 4CDUA 5IUQA 1HIXA 4XCBA 1G7YA 2GN7A 1ZVFA 2P6HA 1DQ0A 1SLBA 4YW2A 2XOMA 1Y43B 4R8HA 5FZBA 3CNAA 3O5SA 2FD8A 4KG0A 2VTXJ 1SQ4A 3GF6A 3HBZA 3LEMA 4FPCA 3WQ7A 4BQ2A 2WQZC 4CP0A 1C8M2 5BNOB 1PVC1 2W1WA 3WW3A 3GZTB 1E5IA 1COV1 2WINB 5DN2A 5BNOA 5GJ6A 5FJHA 5C3RA 4BQXA 3Q8CA 4LORA 3BTXA 4YG6A 4OHWA 4H3WA 4Q4X3 4QU1A 3H8RA 1CJPA 5LBFA 4D69A 4LEJA 5LASA 1RVF2 2CTVA 5FWEA 2ZHNA 1AX0A 4FPGA 3UGHA 2JG8B 2BNMA 4XTPA 3J7NA 4TXWA 2HWF3 3DECA 2PAEA 3ZFGB 2JG8A 1VMJA 4QDRA 1OVSA 5A7WB 4KGQA 3VBOC 3APBA 4I09A 1TG7A 5FXVA 2UYBA 1DF0A
chains in the Genus database with same CATH topology
3SH3A 2HEWF 1A3KA 3TN91 1XU2A 3JD71 1BMV2 4TWTA 4M01A 4NVPA 1BYHA 4M00A 2PA7A 2ZKNA 1MS1A 1C57A 1GBGA 1CVNA 1PZ8A 3ZX7A 1C5IA 4GIQA 4XIOA 4LO8A 1JHNA 3QD6A 4C91A 3OJBA 4F8AA 4I30A 4XJAA 1GFF2 1PO13 1WW6A 5GLTA 5CNAA 4IETA 3ENRA 2HWC2 5GLUA 2R073 3UKVA 2VECA 1X33A 5FO8B 1TME3 5L36A 3ES4A 5FQ0B 1PK6B 3VDDC 4C0BA 4Z92B 2OZJA 3V0BB 2YGLA 5FQ0A 1PK6A 4IEVA 2RS32 2YYOA 1S2KA 3V0BA 2VY0A 2CNAA 1PVXA 2D43A 3AZZA 2ZMKA 1LGBA 1N1VA 1OA3A 3HIFA 1VBC2 2ZX1A 3O14A 4PIZA 4B7EA 1MS8A 2XVLA 4CEWB 5DZGA 3WUDA 5CAZA 4CEWA 3B69A 1QOSA 4NOTA 1BVP1 3MIBA 1HRV3 4Q4W2 5E88A 2H6CA 3S30A 5FOBB 1LEMA 3WDTA 5KHIA 4W6YA 1OA2A 1NE4A 4N90A 1H9PA 2QKDA 1Q56A 5BNNB 2VW0A 3CO2A 4GULA 5HCFA 1R083 2WJSA 4YG3A 2DUOA 5BNNA 1PVC3 1S0IA 1S0DA 1BEV3 2XJRA 3QH6A 4L97A 1ULDA 4AHZA 4XIKA 1COV3 5J98B 3FZ3A 3MPBA 1QXRA 4HZFA 2WLPA 2GC2A 4XBQA 2HWD3 1AR82 3WP5A 1S0EA 4RSUA 2B39A 3J9SA 2GMEA 3QBQA 4OVEA 3MLKA 4DS0A 3FE5A 1UD1A 4QPGB 1QJY2 1HLCA 4C1XA 3BU7A 3VKNA 3TN93 1F31A 4FPYA 2WC2A 3V0AB 4IV1B 4O9EA 4QPGA 3VKMA 2VVEA 5DDJ2 3V0AA 4IV1A 4ES9A 2EXIA 3U07A 2W68A 5ABJC 1RHI1 2GZWA 1N1YA 3LKJA 1I6XA 1YFWA 4JGYB 2WIIB 1OPOA 4NWWA 5DUXA 1QNYA 2YC0A 4DPNA 5T3NA 4JGYA 1BBT2 3D82A 4XJ8A 4HKWA 3I2DA 2ZBJA 1AYN2 4N43C 4GWMA 1UMZA 1BXHA 4Y1ZA 2XJVA 5H9SA 2OW4A 1HQWA 2VXRA 1RMU3 3WCSA 1OD5A 3EHKA 2NZ9A 3H1YA 1DYKA 4QQLA 1BMV1 5FREA 2XLGA 2D97A 1V70A 3ES1A 3PNAA 1ZRCA 5FRAA 5KHHA 2HWB2 4K6BA 3PMSA 5C8CB 4HVQA 4AEKA 2ES3A 2XL7A 5C8CA 1GYKA 1WW7A 5JZGC 2VNGA 2ETEA 3I4IA 4HMZA 3WDUA 3TOJA 4H55A 3P3NA 4FT8A 4JAAA 3MF9A 3HN1A 1V6IA 4WVWA 5C33A 4HSJA 3S0MA 3IMNA 3D0JA 4QXKA 1WBFA 2RS31 2D5FA 5E89A 1NCRB 2E7QA 4YM3A 3V64A 4R4ZA 1TE1B 1NCRA 1VBC1 4L8QA 1ZZ9A 2E7TA 2GAUA 1YI9A 4CDWB 4YVWC 5GKAC 3AJZA 1RUG2 2BVBA 1CAUB 4BWOA 3MFCA 4CDWA 4LE3A 1H2LA 2GNMA 2IFWA 1Y7BA 1CAUA 1PK6C 1LODA 3MLLA 1MS3A 3M2MA 1JYIA 4YZ3A 2ZAHA 3ZSEA 4Y4YA 3QACA 4LO4B 4XFGA 5EXOA 4RFT0 1R1A2 3WW4A 1JBCA 1C8M3 5C4WC 3POYA 1H8TC 5CG8A 4A7ZA 1VBB1 2UURA 2BTVC 4DZGA 2D3SA 3B00A 3RJRA 4XFHA 1AR81 4WVMB 1RVF3 3DL3A 1DDLA 4OULA 3J4UH 4FBFA 2ZX2A 1FOD2 2BUKA 1OFNA 2G4IA 4WVMA 4IEXA 2DFBA 3FC0A 3WW1A 2YMZA 1PIV2 2GC3A 5GM0A 1BK1A 3FLTA 5DUUA 4LO7A 5T5JA 4OI0A 2BWCA 4A7KA 4LLOA 4EN7B 2VMHA 4AE2A 4AQ2A 5DDJ1 2WKKA 1WCKA 5CFDB 1K5MC 1UL9A 3KB5A 4XTMA 5IT6A 3AZXA 5BV6A 4I0BA 2DUQA 5CFDA 3WQ0A 4ASMB 4XW3A 4HLTA 4QPIB 2UY9A 1BBT1 3MZHA 2HWC3 3CEWA 4QPIA 4BZ4A 5CA6A 1BKZA 1AYN1 3WR0A 4YZ1A 3PLQA 4IV1C 5JWPA 3AKQA 1A78A 2XJUA 4LT5A 4N53B 4OUSA 1RUI2 5T5LA 2R062 2RS33 1OOPB 4BIFA 3MIGA 1IS6A 1NQJA 4I0WB 4N53A 2HWE2 1G86A 1OOPA 3LA7A 4Y22B 4Y5Z0 5AVPA 4TZDA 1VBC3 5FO9B 4JGYC 1S55A 3D8CA 1D0GA 1ULFA 3PJQA 1AR91 4Y22A 4L92A 2VH9A 1C5HA 4LNVA 3RSJA 5DG1A 4G4FA 3E6DA 4QX5A 1V6NA 2TEPA 1VALA 4Q4W3 2W39A 1X7NA 3AMPA 3S7EA 2WSVA 4IEQA 4K1YA 4B8EA 4DINB 4RD7A 2WQ4A 3ELNA 1OQEA 3IN9A 2P34A 2RS52 1OI6A 2GNDA 3SISA 1CN1A 3ZN5A 3B01A 2PTMA 2VUAA 2H6BA 2WSUA 4YG0A 4YW1A 4AGRA 1LHOA 3NVCA 1EV12 5I8SA 1AZDA 2DTWA 3ZYRA 4ES8A 5DUWA 1SLIA 4XF9A 3ZMNA 1LJ7A 1R091 4B4RA 1AR83 1RUG1 4WVZA 1NE6A 5FBZA 4R9CA 5AC91 3KT7A 4RR3C 1EP0A 1Z78A 2VQAA 4XE9A 3ASIA 4C1WA 2A73B 1WLCA 2ZX4A 3JU9A 1IKPA 3FFQA 1RUNA 1QJY3 4YZ4A 2GALA 4FPFA 1NCRC 5JLVA 2YZ4A 3ZXAC 3SXWA 4ATEA 3TYJA 4URTA 4U2AA 5DDJ3 3DV8A 1J1LA 2JJ6A 4E2QA 1DGWA 5I0TA 5JCTA 1NCQC 4YM0A 3VBUB 1YI7A 5EWSA 1RUE2 4OLLA 4YGEA 2Q4SA 3VBUA 3LA2A 4PCRA 3SH5A 4JGZB 3KSCA 5I0UA 1QXPA 1BBT3 3WY6A 1WUVA 4H14A 1YXWA 2RM22 4JVAA 1I1EA 4JGZA 1AYN3 4P9IA 2WNUB 3ETQA 2ZGKA 2WNUA 3RNSA 1BJQA 1LECA 4AWDA 5FCCA 2ZX3A 1KJLA 2HWB3 4MVTA 1AXZA 2CAUA 1CJDA 2ZHLA 4NHMA 4AK3A 5D8AC 3WDVA 3NAPB 4YW5A 5DG2A 1LB2A 3GZAA 3KGZA 4CTEA 4S2HA 1EY2A 2VVDA 3NAPA 5KHKA 3KCXA 1IQAA 3N36A 3MLJA 1G9CA 1IPJA 2V73A 4XHBA 2O0OA 4RS5C 1O91A 2RMU2 4FXKB 2JENA 1UKGA 4TSVA 1H9WA 3DUIA 1RUI1 5FOJB 4E9KA 2R061 1KS4A 2ZMNA 1BCXA 2AH2A 5E1RA 4S2DA 5KXDA 2HWE1 5FAXA 4GWNA 1JXNA 2Q30A 4QM9A 2DCTA 1TNRA 2VNRA 1X36A 1KRIA 4B7KA 1S0FA 1WD3A 1WGPA 4K9SA 3AP5A 2E53A 4AQTA 4K20A 1RUG3 1D2QA 5TSWA 4AYUA 3AMMA 4XFFA 3VBOB 2DVAA 4HK8A 4FSJA 1YFXA 4AFBA 3VBOA 1VRH1 2V09A 4P9GA 4YSFA 3KZ4C 4GMP0 1CQ9A 3WP3A 1D4M1 5LRSA 5JSRA 1AJOA 1LOCA 1NLRA 1R1A3 1DG6A 2JG9C 4CEYC 3WG4A 3AJYA 1FI2A 4COYA 1DQ1A 2OUJA 4BMBA 1EV11 3WHUA 5C9AC 3N7LA 4FO9A 1LCLA 2A7AA 1UW8A 4X8NA 3ZIWA 4FP3A 1GICA 2ZHKA 3VZJA 3R4DB 1FOD3 3IIAA 4XYXA 4GMP1 4XETA 2D98A 5FDBA 1OLRA 2EF6A 2FMDA 1PIV3 5EYXA 3VDDA 1LOGA 4MZUA 4FVVA 1AR62 4YGBA 3KMHA 3OTFA 4Z07A 4OI1A 4KU7A 3ZO0B 4RL7A 1O3RA 1IOAA 1V00A 1G9DA 3R4UA 4AI8A 3ZXLA 1MS0A 1O5LA 1PGW2 2IWGB 1RUE1 1ZBE2 3OPZA 3A4UA 3B9IA 5KHGA 2G9FA 3WQ1A 1H2NA 2RM21 2CY6A 2A75A 4Q1PA 1W6QB 1S2BA 3AP7A 2LM3A 2NYYA 2D6KA 1MR5A 4D7YA 2ET7A 3WHTA 4WZFA 4EJRA 1RUI3 3WDWA 2UWBA 2R063 2PHXA 1C1FA 2R043 3DGTA 3ZFGA 4HPKB 4E4DX 2X5IB 2HWE3 1UAIA 2GDFA 1H30A 2X5IA 3TRSB 2EIGA 4E2SA 1POV0 1ZZ8A 3VGIA 2AYHA 1HRI2 3LAGA 5FLJA 4LHLA 2XB6C 5LRRA 1LU2A 3OBTA 4CDXC 2R071 4JGZC 3UL2A 4JQRA 5K8SA 2QUOA 1SBFA 2ILMA 4MUVA 3VBSB 2CAVA 3WNXA 5ACA2 3OD0A 1GZCA 3IBMA 3VBSA 4AFAA 1RIRA 2PQQA 3WUCA 4B29A 1JTZX 1VBE2 2OUHA 3ZN4A 2H0VA 4KNCA 5JPMB 3H7YA 2RMU1 1RUJ2 1H2MA 3VBFC 4FTBA 1POV1 3EJKA 4DB5A 2RS53 4V1PA 3GBFA 3JZVA 2UWCA 3ZYIB 1B35C 4AF9A 5ABJB 3IKWA 2RJKA 4XJ9A 2XLAA 3GBWA 5ABJA 2A71A 2C9AA 1EV13 4ORFA 5JOXA 1FMD2 1ZBA2 3OD4A 4YNIA 2BEOA 4YYOA 2A3WA 4F83A 1WW4A 2D3RA 1GSLA 1HDKA 4N43B 1NA1B 1SEFA 3P3PA 4GMP3 2VUJA 4LO6B 4K40A 4N43A 1QH7A 1NA1A 1A8DA 2JD4A 4FTSA 5JR7B 4BM8A 3DF0A 3GZUC 2VU9A 3SNMA 3WG1A 4COUA 1R081 3VKFC 4A2UA 3AZWA 3CF6E 1BEV1 3H1WA 4YVSB 3THTA 3UJQA 3WCRA 4AHYA 4YVSA 5A3LA 2HWD1 1SFNA 2QVSB 2OZ6A 4XXPA 2OYZA 4CRQA 1RUE3 3LSEA 5JZGB 3EBRA 4YFZA 3MYXA 2WNVC 5EFUA 5T55A 5JZGA 3H3ZA 3TAYA 3KT1A 2PHUA 3MPPG 2RM23 3T1LA 2Y0IA 4IXLA 4YGDA 4IV3C 2CV6A 4DRRA 1ALYA 1H1AA 1HXS2 1TNFA 4PQ9A 1HQLA 1DZQA 1AR61 3IDCB 1MEC2 2ZZQA 2A3YA 1PO22 1UU6A 4DXZA 2WWSA 3NV3A 3ZFFC 5KBFA 2ZGNA 4R9AA 3B7MA 1V9U2 2YROA 3G6JB 4DOUA 5BNPC 3N7MA 4YVWB 1PMIA 3MF6A 1PGW1 3AP6A 3FWEA 3H1MA 2WLQA 3VUOA 4YVWA 1ZBE1 1FNYA 3ZYJB 3RMYA 2X53S 5H9RA 1RMU1 2NP0A 4PBOA 2BFUL 2I2SA 4YM1A 1C1LA 3BALA 3BOPA 4JRAA 3AZYA 1GNHA 2RMU3 1ZM1A 4FPLA 4BMEA 3SCFA 2IXCA 1POV3 4BQ1A 4XJWA 1KQRA 5C4WB 1ND3C 1H8TB 1FAYA 1OFSA 4IEOA 2VW2A 4MXVA 1XRUA 5C4WA 1H8TA 1J58A 1QQP2 4K8FA 2JDZA 5B2GB 1J3RA 3ZDSA 3SITA 5KC6A 3ZVXA 1RGSA 5I0RA 1S1AA 3DKWA 2D6PA 5ACA1 2YY1A 1FATA 4TLFA 3CL1A 5J37A 1QJX2 2XVKA 4AFDA 2ZABA 3M1HA 4E27A 2LUWA 1GANA 4FCAA 3VZOA 1RUJ1 1G9BA 5LK7B 2X5IC 1F9KA 3AKPA 3LA3A 4Y26A 4R52A 3Q9OA 1S0BA 1J3PA 5LK5A 2IXIA 4BLIA 2Q5TA 1K5MB 1UU5A 2EXHA 2DCJA 1LESA 3MI8A 1ENRA 4XOGA 4JDMA 1BZWA 1V6OA 5IK7A 4W65A 2QFEA 1K5MA 1FMD1 1ZBA1 2IXLA 3VBSC 5BYNA 2AZ5A 5L7OC 4QM8A 1QU0A 1DGLA 1HV0A 4EWAA 1DIWA 1SCRA 2WS92 4OI4A 4BIOA 5A32B 3NKTA 5J09A 5DUVA 1Y3TA 5A32A 1LOEA 3MFAA 2GC0A 3BTAA 1AR63 1C8M1 2O8QA 1TEIA 2QCSB 1LGCA 4AFCA 5DXDA 1AR72 3E5UA 2NLRA 5KXBA 2I07B 2ZGQA 4P14A 3IDBB 1FX5A 2XBO2 5K9YA 1C8NA 1RVF1 4ONUA 1LULA 1IZ3A 4KQ7A 1FV2A 4FXGB 4FPOB 1AHSA 3R05A 1NA1C 1ZBE3 1QH6A 1G6NA 1W6OB 1Z0HA 1QJZA 1YJLA 4DNYA 1PZ7A 3AXEA 2RHPA 1W6OA 1CAVB 3O12A 1MZ6A 3KM5A 1CPNA 1CAVA 1QY4A 2HEVF 4NWVA 4Y24A 4YVSC 3GBGA 1HXS1 3N3HA 4COZA 4J6GA 4LHNA 2FZ2A 4KWLA 1RJ7A 3FMGA 2FMYA 2Z69A 1QDOA 2JICA 2R30A 3TNPB 1LHVA 1KD7A 2F6BA 2IXHA 4PIYA 1ASJ2 1HRI3 2HWC1 4ISRA 4Y20B 4RR3B 1ND2B 4LBOA 1SDWA 3JB4C 4Y20A 4RR3A 1U12A 5ACA3 5J7MA 3SMHA 2IXJA 5J36A 1W6MB 1VBE3 4AI3A 1DQ2A 1DQ5A 4HFSA 1JUHA 4C90A 1W6MA 4HL0A 1RUJ3 4JV4A 4AQSA 1AYM2 4AW7A 2GC1A 2VNOA 3RMXA 5JIUA 2MEV2 1RINA 1QMJA 2JXAA 1V6MA 1NCQB 2F4PA 1NY72 4EN9B 2XKPA 1UN1A 1NCQA 1FMD3 1ZBA3 1LHWA 1YIFA 5CFCC 4RQPC 5K0UC 4Q4W1 1ZRFA 3L9JT 3NWKA 5F6KA 2A6XA 1NG0A 3BIWE 3KD4A 2PHFA 3B3QE 4IEWA 4YFWA 4F7ZA 3FLRA 3M3CA 3PHMA 1VIWB 5GZFA 1JW6A 2R0FA 1DLLA 3PJYA 1X8EA 1N3QA 4LBQD 3HAGA 5AFBA 4AGVA 4CYDA 4Z2WA 1ONAA 1WLTA 2YPJA 4GH4B 2G9GA 1NXD1 5JPNB 4MSVA 2R0HA 3O0WA 2BGCA 5D8AB 3D4KA 2HJIA 1RUOA 2IZWA 4GH4A 1WMFA 3HT2A 4FPHA 1BVVA 2WT2A 4FP2A 5LEJA 5D8AA 2R1DA 4QQHA 1GV9A 1N1SA 3EQEA 2CGOA 1QJY1 4DFSA 3AKTA 4BLJA 5BY5A 5GZGA 2ZAAA 2WS91 4RS5B 4DMIA 2AGSA 2ZZJA 2DWRA 4RA0A 1M4WA 1KFUL 1X82A 4Q1RA 2Z2SB 4RS5A 1HXS3 1KDKA 4MX3A 4P9LA 2GSYA 1MEC3 4HN0A 1XE7A 1PO23 2FBEA 4XZPA 5CADA 3W58A 3WD5A 2NMNA 1V9U3 2EAAA 4FOYA 2XBO1 3QOPA 1DHKB 1QOTA 4DY5A 4KU8A 4Q4Y2 3H3UA 3LZZA 4XBNA 4G3YC 1Q8SA 2JX9A 3C2UA 1JN2P 1LTEA 3JBG3 2WZR2 3N35A 4HBNA 3VLBB 3UV9A 5JI7A 3AYCA 2MHFA 2R042 1DZTA 1YJKA 4I2OA 4HKOA 1QF3A 2XVGA 3WG2A 4IESA 4K7JA 4QPYA 5KXEA 2HWB1 1UU4A 4E4ZA 3KCYA 3VZKA 1IS3A 1DBNA 2JE7A 2JG9B 3MW3A 4CEYB 1IS4A 2PHRA 3HMYA 1WMDA 1QGLA 1LHNA 2JG9A 4GALA 4A7YA 4CEYA 5C9AB 4ATFA 4P9XA 1QQP3 1ASJ1 3ZN6B 5C9AA 1WMEA 3T2TA 5LEKA 1RUC2 3ZN6A 1JOJA 1ULGA 4F3JA 3NSTA 1YO8A 3KGLA 4XEZA 2TBVA 5I0SA 1QJX3 5JOWA 5HCBA 5BXXA 2A6WA 3SCGA 1AX2A 1S0CA 4OZXA 3E6CC 4I0AA 3ZXDA 1AYM1 1ZZ6A 5CIRA 3WX5A 2MEV1 4META 4KWKA 4YRDA 3VL9A 3ZXJA 1CONA 1NYWA 4LULA 5KXCA 4Q8LA 4HVOA 1FNZA 3RYKA 1NY71 3AX4A 3TB0A 2D6MA 1RUD2 1ND2C 3KLSA 5AVAA 3U0ZA 1AL22 2D44A 1H1IA 3N4MA 3KT4A 1N3PA 3ZXGA 3ZFEC 1PZ9A 2BFUS 1RC6A 3FX3A 4JRLA 2WS93 2CGPA 2XJPA 1LEDA 1V6KA 3SHRA 4OFGA 5E8AA 4YZ5A 5FMOL 2XJTA 1R1A1 3MIHA 2PLV2 1ZZ7A 2ZGRA 2PAKA 3VZNA 1VBA3 3KQRA 2UWAA 1AR73 2ZGOA 4GB32 3M3OA 1CR7A 1SLAA 1SLLA 1Z7S2 4P5HA 4ZU7A 2XBO3 4CDXB 1FOD1 3C3VA 1XYPA 1UPSA 3AZVA 4BYYA 5A33B 4CDXA 5HCAA 1QXJA 4Q0SA 2EXKA 4YM2A 1DYPA 1PIV1 5A33A 4E2GA 1DGRA 3POWA 4W6XA 2GMPA 3I7DA 4BHPA 3PTYA 1UX6A 3VBFB 1QJU2 2DURA 4LR4A 4PIXA 1B35B 3VBFA 2PYTA 5KHJA 2D7FA 2WFPA 5AFEA 4GH4C 1G9FA 4N9IA 5A3MA 1B35A 4FPJA 2B45X 2VMIA 3L2HA 4LTAA 1OQ1A 2X8KA 4J1WA 4SLIA 2VW1A 1MACA 1PHMA 1TMF2 1ASJ3 1LR5A 3J8F2 4KG8A 4Q4Y1 5JMCA 2P3KA 1IHMA 4AFMA 2DCZA 3ALQA 1RB8G 1LRHA 4UW5A 1DGWX 2WZR1 4N9HA 4IQPA 3GHNA 4INDA 4D94A 1Q5OA 4K1ZA 2BVVA 2R041 3FBYA 3VBHC 3FFZA 1AYM3 1KS5A 2KA3A 2IC1A 2NN8A 2CGNA 2MEV3 1YWKA 5JOZA 5GLVA 4BA6A 1C28A 2P17A 4OHZA 5BUVA 1F8VA 2MPFA 3RJ2X 4LBJA 4NPRA 4L9BA 4Q8KA 1ULCA 2Y0OA 1KITA 2WNVB 4NHKA 2WNEA 1RUC1 2YV8A 1FXZA 2WNVA 3VBRC 5J3UA 1NZCA 2DFCA 4IV3B 1X50A 3LGRA 1VP6A 4M3CF 1U0AA 4P9YA 2RS51 3R0RA 2DTYA 4IV3A 3EO6A 1ENXA 4PLOA 3ZSMA 3ZFFB 4HT1T 4AVTA 2DVGA 3HQXA 4CZSA 2XJSA 3FUOA 4EN6B 2XLFA 3ZFFA 5BNPB 4R9BA 3PVBB 4NR1A 2ERFA 1JUIA 4OUMA 4AI2A 2Z79A 5KC5A 5BNPA 4J1XA 1RUD1 5L19A 1DGRN 3QH7A 1RL3A 2RS12 1RITA 1XNBA 4AVVA 3PVNA 3ZIXA 2UYAA 2WA4A 3BOWA 4WM7C 1SCSA 3GYDA 3RPQA 4JDNA 1W6PB 1YHFA 4LE4A 4E4SA 2PLV1 3K48A 3HD8B 3HR9A 4XHXA 1ND3B 4KGGA 3WW2A 1W6PA 3CJIB 1FPN2 5F6LB 3NJZA 2P3IA 1ND3A 4GB31 3A0NA 3S6PA 3CJIA 1Z7S1 3FUQA 1NQDA 1DQ6A 3HT1A 3D0SA 5GLZA 1DZRA 3SH4A 1ZRRA 2YHJA 4Q4Y3 5JVVA 3AB0A 3VHOA 1J3QA 3USUB 4FAHA 1O3SA 3E97A 1C4RA 1WD4A 2WZR3 4FQZA 3USUA 2WT0A 1OKQA 4ZU4A 2BPA2 1W6QA 4XQ4A 1LKNA 4Q0VA 2ZHMA 2ZKLA 3V56A 2HEYF 3RYRA 2CL2A 4Q4V2 1QNWA 2E63A 5L73A 3U11A 4OHVA 5I8YA 4HPKA 5FLIA 1GQGA 1UF2C 4AEDB 4O9GA 3MIEA 1U5ZA 3B02A 2DU1A 4AEDA 5FLHA 1VBD2 4Q0QA 4AEMA 1ZNPA 3IWZA 3L2YA 3J8F1 2ZMLA 5GALA 5L7OB 4GQ7A 3NW4A 3ACLA 3K51A 1RUC3 4JC1A 4AI1A 3LOBA 1Q3EA 5L7OA 3IT8A 4XFCA 3R6SA 4LBQB 3RQ0A 1GZWB 2B46X 1SLTA 1ENSA 4LBQA 5FTTC 3PVOA 3VKLA 1GQHA 2JECA 1GZWA 2PHWA 1AXKA 1XXNA 3E5QA 1XE8A 4CDQB 4I02A 2D3PA 1RUH2 1U5YA 4WV8A 2FZ1A 4CDQA 2WFF3 4HVRA 4AVCA 4AXOA 1SACA 2RE9A 1UZYA 5IK5A 1RUD3 4HK9A 1IS5A 3D6EA 4AVSA 1AL23 2X29A 4AVAA 2E6VA 4B3NA 5FFOC 5T5OA 2JKBA 3NL1A 4JCKA 3ZYPA 2XGXA 4LO5B 2QE3A 3IDEA 4XJUA 4RGGA 2BQPA 3MEPA 2A70A 2PLV3 2HYKA 4XILA 3ZPYA 4Y1VA 4PJYA 4BE3A 1LENA 1O3QA 3ZXKA 1XNKA 4GB33 1N1TA 1Z7S3 4WZCA 2W08A 3ST7A 4D3WA 4JTNA 5JOYA 3CJXA 1GNZA 2EALA 3VHRA 5HBAA 2Q1ZB 3MGUA 3LOIA 1RHI2 4WVVA 2ZX0A 2AREA 4IEZA 2RS11 3M8LA 4LBMA 2DVDA 4HSLA 1AL0G 5C8WA 1NLSA 1JH5A 5JI9A 1TQ5A 1HW5A 1MS4A 2QZ3A 2E9QA 3WZ1A 5T52A 2VOWA 1QJU3 1REEA 1DU3D 2PN5A 2YGMA 1FPN1 4LBKA 1YLLA 2ZGSA 3D5OA 3JBG2 5CFCB 4RQPB 1Q43A 3VZMA 1LOFC 5K0UB 1TMF3 3RI8A 3J8F3 2NM1A 3PMEA 4HN1A 2EAKA 5CFCA 4RQPA 5K0UA 1URXA 1VAVA 5KWRA 4PLNA 3SLIA 4AGGA 5I8TA 4QHBA 4YLZA 5F1RA 5GZDA 1B09A 5FMOS 1D0HA 5EJ3A 4JTOA 4DY3A 1WCSA 4Q4V1 1GLHA 2DVBA 2NPIA 4I3GA 1YCIA 3CJIC 1XNCA 3RS6A 4YGCA 2YDEA 3QLQA 3BPZA 1HRI1 4EV0A 3B93A 4Q0PA 4NHLA 1YFUA 3NV1A 1VBD1 1Q8PA 3WVJA 1MS9A 1WA4A 3RYPA 4FTEA 1VBE1 3JCIA 3M3EA 4QMAA 5GZCA 4MH0E 5HI0A 1AJKA 3MW4A 4RGAA 3B9CA 4NO4A 4AEDC 4RHV2 1V6JA 5BPXA 1X8MA 4L99A 1RUH1 2Q0AA 4YW4A 1REDA 4TYSA 1UCXA 4Q0UA 3ZSLA 4YARA 3URFA 2ZPXA 2CWSA 2SBAA 3AMNA 2RS13 4XPVA 1VBB2 2WA3A 1Y9QA 2B5HA 2KXLA 4PDWC 1VBA2 1KJRA 5F9TA 1J1TA 2VVFA 4GA9A 4ASLA 4MYEA 3AYEA 4CDQC 3BCWA 4N7IA 3E5XA 1H8VA 3OGJA 1FPN3 1LHUA 3DPRC 2ZACA 3JD73 5T54A 1XYOA 3E6BA 4AHXA 2ARXA 4YZ2A 4H7MA 2EVXA 2KM2A 4Y1XA 2DCYA 5K7PA 1O4ZA 1RJ8A 2C1FA 2PHLA 4MGYE 3V65A 4PLMA 1AF9A 4L2NA 1YFYA 2Q8OA 4CDUC 1I3HA 2GN3A 1MEC1 1U5XA 5CVRA 5JAXA 4Q4V3 3WDXA 3INAA 1AXYA 1PO21 3MICA 4FPKA 5CU1A 4IL7A 1V9U1 2PHDA 4JDOA 2GH8A 4LHKA 1CX4A 2DVFA 1PGL2 2VG9A 3UJOA 4Q27A 1O5UA 1H0BA 1VBD3 3JBG1 5GZEA