5A7OA

Crystal structure of human jmjd2a in complex with compound 42
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
351
structure length
351
Chain Sequence
b'ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
total genus 112
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7oA01
4TN7A 5FZOA 4LIVA 5FZLA 4HONA 3PUQA 5FP7A 5A7SA 3PU3A 5A1FA 5A3PA 2YU2A 4Y33A 2YBPA 3N9PA 3KVAA 5FV3A 5IVYA 5FY1A 5FZ1A 3NJYA 5FXXA 5FYMA 5FY8A 3U78A 4CCMA 5LWBA 2XXZA 5IW0A 5A7OA 3UYJA 5FUPA 5FZGA 3PTRB 4LITA 4GD4A 5IVFA 4Y3OA 4QXBA 3KV9A 4BXFA 5FP8A 3AVRA 5FZOB 4GAZA 5F37A 5LY1A 3DXTA 2XUEA 3K3NA 5FZ0A 5A7WB 4D6QA 5KR7A 4GJZA 4UF0B 5FYHA 3N9OA 5FPLA 3N9LA 5FZAA 5FY9A 2WWJA 5LY2A 5FYUA 5FZ3A 2GP3A 3OPWA 5A3WA 4LIUA 4AI9A 4URAA 5A7QA 5FXWA 5FZBA 5IVCA 4QWNA 5IVBA 5FJKA 5A3NA 5FYTA 4DO0A 4QU1A 4IGOA 5F5CA 3PURA 5CEHA 5ISLA 3OPTA 5FXZA 4C8DA 5FYVA 3PUAA 5F32A 5FYIA 5FY5A 5FPVA 3AL6A 4XDOA 5FYZA 2Q8CA 3N9MA 3AVSA 5FYCA 5IWFA 2WWUA 5F3EA 5F39A 1VRBA 5FY0A 5K4LA 4EYUA 3N9QA 5IVEA 5IVJA 5FYBA 4ASKA 3ZLIA 2YBKA 3ZPOA 5ANQA 5FZHA 5A80A 5FPUA 3KV6A 3KVBA 3PDQA 4IGPA 5FZIA 4CCJA 2Q8DA 4XDPA 5F2WA 4CCLA 4CSWA 5F3IA 5A7WA 5FZMA 2OS2A 4QX7A 4V2WA 3RVHA 5FZEA 2OQ7A 4D6SA 4IGQA 3U4SA 5F5IA 5FUNA 5FWJA 2P5BA 2W2IA 2GP5A 3AL5A 5F2SA 5FBJA 5FPBA 5LW9A 4V2VA 4Y4RA 4CUGA 2OX0A 4E4HA 5F5AA 5FZ8A 5FZ6A 4HOOA 5FYSA 4NUBA 3DXUA 2VD7A 4BU2A 5FP3A 5FY4A 5FZDA 3KV4A 5FZCA 4EZHA 4QX8A 5FZ7A 5A7PA 5FWEA 2OQ6A 3PU8A 5FXVA 4CCOA 3LD8A 2Q8EA 4UF0A 4D6RA 4GJYA 5F3CA 5A1LA 4LXLA 4BISA 2XMLA 5A7NA 5FPAA 4QXCA 5FY7A 4CCKA 3N9NA 5F3GA 3PUSA 4EZ4A 5FZKA 4AAPA 2YPDA 4QXHA 5FZFA 4DIQA 5IVVA 3LDBA 2PXJA 2YU1A 3KV5A 3K2OA 5FYYA 5FZ4A 5A3TA 4CCNA 5FP9A 5E6HA 5FP4A 5FZ9A 2YBSA 3K3OA 2OT7A 2XDVA 5FJHA
chains in the Genus database with same CATH superfamily
3Q8BA 2VNVA 3ON7A 1WLDA 5LBCA 2GAUA 4GWMA 3AP9A 3SKJE 1POV3 4EN7B 4Y33A 5IVYA 3DYPA 4C8DA 1DYPA 3NJYA 1GOHA 1TMF1 2Y6KA 3U78A 5JAXA 3UYJA 1JYNA 1QIQA 1XU1A 2QQOA 2RR11 3V0BB 3W5NA 2R073 1NZCA 1R1A3 4RGAA 4CEWA 4N53B 1NT0A 3ZO0B 1LHNA 4E4DX 2VOVA 5ACA2 1AL23 4ASMB 3IMMA 1O6UA 3H7JA 2D5HA 1OD5A 4CCDA 1DGWX 2DCZA 1UY0A 1MS9A 1E5IA 4XQWA 1ENQA 2XB6C 2XUMA 4QPGA 5I8TA 5J98B 2FCUA 1W0NA 1BBT1 1I3HA 5LEJA 3GNEA 1HRV3 5FXWA 4MVTA 2JENA 5FTTC 4QPIA 5DUXA 3T1LA 4K21A 1BMV2 2QQWA 1DYOA 5FJKA 2A3WA 1AR83 4EWAA 3KB5A 1BHGA 3FL7A 3S7EA 3VL8A 1BVVA 1EYBA 1LOFC 1XYOA 2ARXA 3DF0A 1CQ9A 1ODNA 4ASLA 4E2GA 2WZ8A 1AX2A 4LKSA 4XAAA 1B35C 3OY8A 4TWTA 1NCQC 1LU1A 4RFRB 3UL2A 3VB9A 1VMJA 2VW1A 2XG3A 4JQRA 4D69A 3NNMA 1NE4A 1OUSA 3OTFA 3WCSA 3OBTA 3NL1A 1ZZBA 3DN7A 1GWLA 1QJU2 1D0GA 1O4ZA 1YFXA 3D3AA 2PHUA 4SBVA 4YM1A 5FDBA 1QJU1 3VN4A 2X53S 2ADDA 4A2UA 2CTVA 2R1BA 4B4PA 5C6CA 1RVF2 3GHNA 4XDPA 2A6YA 3SNMA 2FZ2A 2K9ZA 2W94A 4YZ3A 1ZBA2 3WQ1A 1C3HA 2ZX1A 3ELNA 1OOPA 3O0WA 1POV0 2IVIB 5LB6A 2OUJA 5JI7A 1LECA 1CX4A 1MQTC 4I30A 1R083 4ZXKA 2P6HA 2G9GA 3M7AA 4HMZA 5DZEA 2DFCA 5GLTA 4YPJA 2OX0A 1R64A 3RNSA 2YHJA 1VBE2 1JZ7A 1H30A 1XB9A 3MEPA 1U0AA 1WMDA 4DNYA 1CD3G 1PIV1 5GJ6A 4RR3C 5M0TA 2D6MA 3V56A 1HB1A 3K4DA 1NLRA 4Z92B 1ULFA 2X5IB 1UXXX 1JOPA 2VOXA 4YW6A 4CEWB 1VMFA 1AL22 4XF9A 5DG1A 2W91A 4MXWA 1EV13 5EJ3A 1SDDB 2Q8EA 5IK8A 5A1LA 4FVVA 1JYTA 4DB5A 1N1YA 4Y1XA 1OLME 1Q5OA 2J1RA 2RS31 3J9SA 3PMSA 4MZUA 3VBHA 3LEMA 3WF0A 3T0BA 4AVTA 1JYCA 2D3SA 1RMU1 2WO1A 4Z82A 5DDJ3 1LENA 1PX3A 1MR5A 1X9PA 2D6LX 5CFDC 3RZMA 1F31A 3KV5A 1FNZA 3APBA 2WAOA 4A4AA 1YJKA 3E5QA 4XABA 5LK7B 3BOWA 4I0WB 4O9GA 1O8PA 2FHRA 1KD7A 2XJRA 3RWNA 3BUCA 2WQ8A 3T0DA 2VNRA 1CX1A 1IKQA 1ZA4A 3WHTA 4RHV1 3WG4A 2DTWA 1K12A 1WA4A 2JECA 2VZRA 2ZZQA 3DPRC 4AEDC 4BWOA 4AZZA 4WZFA 2GSYA 1CAWB 3CZUA 1CESA 1NLSA 4CE8A 2QQIA 4AGRA 2HWC3 2QCSB 4QXBA 4FPGA 2O0OA 4IV3C 1YFUA 2WL1A 3MFCA 5DAPA 1C8NA 1TZOA 1YQ5A 5JXIA 2G1MA 3N9OA 5E89A 4XJ8A 3VBOA 2R041 2WWJA 5I0SA 1JTZX 4MYEA 5F7UA 2YFZA 3GZAA 4P5HA 4Q1RA 3IBMA 5L7OC 4PLOA 3I2FA 2WNOA 4RGGA 5J96B 1NA1B 4YVSB 3SHRA 2XHNA 3LFMA 3M70A 3HNMA 4OHVA 4ZPIA 3KHCA 1A8DA 1J3PA 4CXYA 1SHWB 4WM7C 4AK3A 1Y9GA 1PM4A 2MEV1 3WOGA 1RUE1 3MV01 4Q4X2 2EXHA 5A1AA 2GMPA 1KJRA 2GNBA 4JKKA 1GWKA 2PN5A 4LUMA 2R16A 4Z07A 2XLFA 5EIYB 1EP0A 5GLZA 1PO11 2P6CA 5JSPA 1VJ2A 2DUPA 5F8PA 3O1PA 5CFDA 3VBSA 2Q8CA 4ARYA 2WNEA 3H3LA 3QOPA 4BXSV 3HWJA 1CPNA 1NZIA 5K4LA 1HB4A 1VRBA 2D44A 4O7XA 3VBOC 5IVEA 4Z8BA 2JG8C 3K46A 3POJA 4Y5SA 4RQPC 1OH3A 3TNPB 3ZFFB 3KLSA 4BB3A 3VKFC 2G9ZA 2VOTA 4IL7A 5JWPA 1HRI3 1W6QB 1YRZA 3T2TA 3VZLA 4MGSA 1LJ7A 4N53C 3D5OA 5T3NA 5A7WA 4N43C 1UCXA 1SACA 3AZYA 4NRPA 4XUQA 3N3HA 4L2NA 4AF9A 1V6KA 3U10A 1VBE3 1OH4A 3WQ0A 5FUNA 4AL9A 1AYM2 4AI3A 3AL5A 3JQXA 4XF4A 2ZHLA 2HWF3 2OXBA 1Q8SA 1O5UA 1WKYA 1WW4A 2HBUA 3M3QA 2JDYA 2DCYA 2G19A 1Q8PA 4HK9A 4OMDA 2RMU3 3MIFA 1J58A 5CU1A 3QBQA 3GBFA 1W99A 3ZFEA 1GUIA 3UGHA 1US2A 4ZU5A 4QGMA 3KF3A 3BTYA 1WCSA 2ARCA 2VZ3A 1VLNA 2ET1A 3GCXA 5I93A 4WM8A 2JICA 5K0UB 2XJSA 1KDMA 5FCCA 2B42B 5I0TA 2VULA 2G4IA 3M3EA 1MS4A 4PIXA 1YWKA 5CISA 5I91A 3K4ZA 3VKNA 1FYUA 1DIWA 1SLIA 5FPZA 2OZ6A 4FI9A 1E5SA 3ZXJA 4IEOA 1F5JA 4AW7A 1C1LA 2H0VA 2NYYA 2OPKA 2AR6A 2YBSA 3ILRA 1R081 4FPEA 5E88A 2XDVA 1MEC3 4PDWC 3WDUA 1OPMA 2Z79A 1NA1C 4LIVA 4XDQA 4YVSC 4MOAA 1U12A 4Y1ZA 4XCBA 1X8MA 4O61A 2C5DA 2EXIA 5H9PA 3PUHA 5A3PA 3OBRA 2YPJA 3JBG3 5DAXA 4C0BA 2QQMA 3LAGA 3N9PA 5I8YA 1C1FA 1TQ5A 1UOBA 4CCMA 2YXSA 4CDUB 4WM7B 3BOPA 3RRDA 4FBFA 1OD3A 2BW8A 2RJLA 1UX6A 4GD4A 1AHSA 4GMP0 3KSCA 4LO5B 3ZFGB 4BQ5A 5C8CC 1M06G 3A0KA 2AH2A 5KWRA 4YFWA 3AZWA 2BNNA 3M8LA 4FQ4A 4XJZA 3W9AA 1PMJX 1VBE1 5FZ0A 1SLCA 3DL3A 2XPJA 1QDOA 1PMIA 3BODA 4FPYA 2WABA 3AMQA 2WAAA 2UWCA 4UW5A 3OD4A 1PMHX 1S4CA 2D3PA 4LKEA 2YG0A 2RJ2A 1HDKA 3ZIXA 5GZEA 1GV9A 1MS8A 2WDBA 3GXUA 3KMHA 1GQHA 4URAA 3OUJA 1EAH2 2PAEA 3RS6A 1QJU3 1W2AX 2DF7A 1GZWB 1H9PA 4QGLA 4P9LA 1IPJA 4DO0A 4NN0A 3IMNA 4GWIA 4IW3A 1EY2A 4LBJA 4LHSA 4GB33 4Q0VA 5ERLA 5BPXA 5C5TA 4YGBA 2DVFA 3IIIA 1GR3A 3E6BA 1W8HA 4L97A 2IXIA 2UY9A 4COUA 1OVPA 1Q3EA 4LE3A 1R1ZA 1A6CA 4Y22B 3O1RA 3H0OA 5FY5A 2R0FA 1OOPB 3HD8B 3MPBA 2RS52 3B9IA 3ETPA 3PUIA 1W8ZA 4QX3A 1J1TA 1WLTA 3IDEA 4L9BA 5ANQA 3EJKA 1AVBA 1NCRC 4J6GA 5FPUA 2WNUB 4I3PA 4AR2A 5AC92 3WQBA 5A33A 2J7MA 2WN3A 1VP6A 4BIOA 1AXYA 4XUOA 1HV0A 2RE9A 4BK5A 2X5IA 4LO4B 1SBDA 2A3XA 4FP3A 4MGZE 2XL7A 1LKNA 1OC1A 4CUBA 3CNAA 3H7YA 2DWRA 1D4VB 1DLCA 4DUWA 4FFFA 5F2SA 3VKLA 4Y4RA 3QCWA 5FZ8A 3ZYPA 2VQ0A 4LTAA 1OKQA 2BPA2 5AFEA 1MZ5A 3OUIA 1SPPA 3LA3A 2NZ9A 2XONA 3KV4A 1FOD2 5K9YA 1LTEA 1BBT2 1W3XA 4M3CE 5KXBA 1YLLA 4AEDA 1VAVA 4U36A 4LXLA 2HWD2 2WNVA 1W9WA 4BISA 2D6PA 2WLPA 4LQRA 4RL7A 2F6BA 2J1EA 4PQ9A 3THCA 3ZKUA 4R9BA 4NOTA 3WXPA 1W6NB 4GZ9A 4IE4A 1W03A 4IV3A 1N3PA 4DIQA 2VQTA 1GICA 2Z5WA 2ZMNA 3VDDB 3VBRA 4WVZA 4HKOA 1C4RA 4CCNA 1D2SA 1DU3D 1ZREA 4MGTA 2WKKA 1KS5A 3JBG2 1PVC2 1QNWA 5JLVA 1RUC3 3RZGA 3LCPA 4YW2A 4TN7A 4D7SA 4BM8A 2HWE3 4U2AA 3FBYA 3AZZA 3U0ZA 2A70A 2DVBA 4BMBA 2GMEA 1RUH1 5GLVA 3B02A 4Y5TA 3JB8A 3KVAA 4YZ5A 4RS5B 2JG9B 4AQTA 4QQLA 1FMD2 4OZXA 3BB6A 4XURA 1J83A 1CONA 3ES1A 5T5PA 5L9BA 3RZHA 3NVCA 5C8CB 2Y6GA 1HB2A 1RJ8A 1S0BA 2GN7A 4XVHA 2ZGQA 4CU6A 5LY1A 1H9WA 5BNNA 1W9SA 2DDUA 4B7EA 4C91A 2ADEA 3FZ3A 1UY4A 3A4UA 3OSDA 4UOJA 1QKQA 5C3QA 1SCRA 2DYCA 2A6ZA 5GM0A 4UXAA 2B7YA 5LY2A 1ZRRA 1BK0A 4NO4A 1RMU3 3OPWA 3P1IA 4ONUA 1PIV2 4BQ1A 4UFHA 1KFXL 5BNOA 1W2TA 4XBNA 4QKNA 1UWWA 4MGIE 4P5YA 4CDXC 2V73A 4CRQA 1RUC2 2H0BA 2W92A 4R9DA 5FMOL 4QU1A 1J84A 3R4SA 2ZMKA 3TNQA 2VQUA 4K8RB 3CMGA 1BBT3 4LKFA 4MGKE 2ID4A 3K75B 3CKHA 1P8JA 4H55A 2CGNA 3AYEA 5FK7A 2EIDA 1YFWA 1A3KA 3PLQA 4FPJA 4OUEA 1H1MA 4XDOA 4JKMA 2WNVB 2WZEA 3PTYA 5GALA 2UYAA 1OFSA 4IE0A 4YNIA 1W6NA 3ASIA 2GMMA 1OA4A 3TEWA 3ZLIA 1OQEA 2AUYA 3H50A 4IV3B 1C8M1 4NPLA 4W6XA 5C70A 5H9SA 2WT1A 3VDDA 4E27A 1DP0A 4CDXA 2HH9A 3WHUA 4DUXA 2BRTA 2J42A 4DZGA 2ET7A 1N3QA 2R1DA 2JG9C 1OQDA 4MV2A 4RHV3 4K6BA 4AHZA 1UU5A 3TYJA 4V2WA 3FLRA 4YZ2A 1TEIA 1Y43B 3EMRA 5K8SA 3HBKA 3NNFA 5F5IA 4D7TA 3ZXLA 2VBPA 4LHNA 4ZS2A 5IJRA 2EIBA 2ZGNA 3POEA 4NWVA 5FBJA 5FPBA 1ZRIA 3TEZA 2W1WA 1OURA 4UFIA 3O12A 1RL3A 2NP0A 2DVGA 2W52A 5FQ0A 5FK8A 5JR2A 5FZDA 1EAH1 3J7MA 2QQVA 4RQPB 3AKQA 5JXGA 4QX8A 5FZ7A 2IC1A 3H3ZA 3KGLA 3PU8A 1PX4A 1ENSA 5EXOA 2VL4A 4BQ3A 4AI8A 4ZS3A 4Q4Y2 1ZNPA 1R1A2 3PIGA 4W6WA 5L9VA 1VBB2 1RUI2 3W5MA 2H6BA 1EPWA 4XETA 2EVXA 1BEV3 3ZSKA 3KD4A 1SLTA 1RHI1 4AAPA 1NKGA 2JDNA 4BA6A 1QOOA 1VRH3 3I54A 2ZABA 1N1SA 5LA0A 2NN8A 1FPN3 3RPQA 2DV9A 1SZBA 2UY8A 1S0FA 3HNBM 1CJDA 1QQP1 2F4PA 3KF5A 5DMYA 4HXCA 2VPVA 1G7YA 1QQP2 5FP7A 1IS4A 1XNKA 3NAPB 4Q4V1 5FMCA 3USSA 1CJPA 1UY2A 2VUDA 1CIYA 3U4XA 5EJ1B 4HG6B 2DCKA 3WP4A 2EIGA 2QUOA 2KD7A 2CYFA 2B8MA 3USUA 1QJY3 4ORFA 1HRI1 3WCRA 2CDOA 4QMAA 4Q5OA 5JR7B 1QMJA 2XXZA 4BQWA 1JZ2A 3AFGA 2ZHMA 1U5ZA 2AZ5A 2JDKA 3PTRB 2OYZA 5IAVA 4YVWB 2WFF1 3UNPA 2E7QA 1UPIA 4CEYC 3ACFA 5BUVA 1QJX1 3KM5A 4FFIA 4GIQA 5KR7A 1YHFA 1LR5A 3I2GA 3MIHA 2AGSA 5I0RA 4QD2A 4KG8A 1Z78A 2D97A 2ZEZA 4TSVA 4A7ZA 4ISRA 4LIUA 3GCWA 1FX5A 3ZKYA 1CWPA 5A7QA 1UYYA 1B35A 4Q26A 2J1AA 1OLMA 2YUEA 3I2DA 3RDIA 5C4WB 1QNYA 4IE6A 2GC2A 5HPOA 4OZOA 4BQYA 2JX9A 2PMWB 4OI1A 5CADA 2VW2A 4IEQA 1WD3A 1W6OA 4IGOA 4LO6B 4AI0A 4FOYA 3PURA 4X6RB 1HKDA 1NQDA 4S2HA 5JPNB 3OPTA 1ZZCA 5DAVA 3CF6E 1G6NA 2Y6JA 3ACGA 4JGZA 4D8MA 1ND2A 3ZYIB 5F32A 5FYIA 2PTMA 2A6WA 2CY6A 4NPRA 4P9IA 2YY1A 3RZKA 2NMOA 3WEZA 4JZRA 3LZZA 1HB3A 4R9AA 1AYN3 2JB8A 2UU8A 2YBKA 4XJ9A 4TZDA 2WIIB 3VBUB 1XNCA 1RUH2 2CHHA 2RR13 4XAEA 2O8OA 3ZXGA 2VMCA 4CSWA 1L7LA 3HEIA 3ETQA 3TOJA 4B3NA 1FOD3 1W9YA 2FCTA 1XPWA 4AHYA 3DKQA 2EA7A 4D6SA 4OVEA 3GDBA 2G9FA 3AXDA 4AEDB 3MW2A 2W2IA 1GWMA 2J22A 5I0DA 5EWSA 3VHRA 3POWA 4PF1A 1U5YA 3AKPA 1Y3TA 3CLPA 1K3IA 2P3JA 2W39A 5A6YA 4CZSA 3MFAA 3OB8A 3SMHA 4UW6A 1K5MB 3S5AA 1IS3A 1VBA2 1OUXA 4BQ2A 3H8XA 1WWYA 2VNOA 3IIAA 3SH3A 4D6RA 3WDYA 4FPFA 2RR12 4M4RA 4XEZA 3MYXA 3QACA 3UESA 3URFA 1D2QA 5GLUA 3IZOA 3LEGA 3PUSA 4A7YA 2Y33A 3MICA 3JQWA 2YDEA 4LBOA 4QXHA 2GDFA 1QJZA 3ZMOA 3B69A 5JCTA 1U5IA 2VUAA 2LRPA 4RS5A 4QPYA 1WA6X 4LJHA 3RFRA 2VY0A 1UIKA 2WO7A 4I02A 5FBZA 5FP9A 1UNBA 1BZWA 4KG0A 3ZXKA 2OT7A 1MACA 3PIJA 4Y1VA 3A21A 2XBO1 4I0AA 5FZLA 4QPGC 4HONA 3PUQA 4JX0A 2ZEWA 3MO4A 3OEAA 1LHWA 3C7FA 1RGSA 4Q4X3 3VZOA 4G4FA 5FR3A 4XHBA 1DZTA 1V9U3 3K48A 5CBLA 2CAUA 2YU2A 3AC0A 1AYM3 1REEA 4NPMA 1PIV3 5FV3A 2XQRA 5JMCA 1AYN2 1NX9A 4K9SA 1UYPA 1VBA3 2W9XA 2CWMA 4PHZA 3S5QA 4AVCA 3VBUA 3ABZA 3AP7A 4ES9A 4YVWC 1MS0A 1ZM1A 5DZFA 2C1FA 4N9HA 2XVGA 4BCUA 1UW8A 2VM9A 1SFNA 4MHUA 1ST8A 2QQKA 2JXAA 5FYHA 2HKXA 3ZYRA 4BJ0A 5DG2A 3NNJA 1VRH1 1PZ9A 3IDAA 1UL9A 1PK6C 2A3YA 2VJXA 1FV3A 2ZBJA 4AFBA 3VV1A 2EAKA 1LRHA 2WA4A 5A6ZA 1YXWA 2WR9A 3VDDC 4AI1A 5HI0A 3ZXDA 4Q27A 4DRVA 5IVBA 4WZCA 3LGRA 1WMXA 3LPGA 4JQTA 5LA1A 3H8OA 3DECA 3V0AB 4OYUA 4OLLA 4AFMA 3POYA 1ONAA 1TME1 1SLBA 2RMU1 2V5YA 1JUHA 2PELA 5FYVA 3CL1A 2GNTA 4LUKA 2E6VA 2RMU2 5FFOC 1GMMA 2AACA 4Q8KA 4EN8B 4K1YA 3AVSA 1BLZA 5IWFA 4XC9A 3NV2A 1IS6A 4DY3A 2QTWB 3ZDSA 4EYUA 4AEJA 3POIA 3KQ4B 1PO22 5CZKA 2P4EA 1JZ5A 3J7LA 1LOFA 5FMDA 2OVUA 3AM2A 5TSWA 2Y8KA 4CU7A 4XF0A 2OA2A 5CNAA 1JUIA 5F9TA 2V4VA 1V6JA 4P9XA 4AE2A 1A78A 4L8QA 5CYYA 5A3MA 3RVHA 1NYWA 2C6SA 4R8HA 2AEYA 5A70A 4KWUA 1QJX2 4XFFA 3O1OA 1H8TC 5A3OA 4LBMA 1IQDC 4GH4B 1AF9A 3NV4A 1O4YA 1AX0A 2XLAA 4MADA 5F5AA 4AHXA 3KCXA 4DS0A 3O0XA 1FNYA 1DCSA 4MXVA 1J59A 4BU2A 2NQYA 1TG7A 1VR3A 1GFF2 1WCDJ 1X36A 2JE8A 3T4HB 4CDQC 1A8MA 5JSRA 1VB2A 3N7JA 1WCQA 4LO7A 4BZ4A 3U14A 5F3CA 1AR92 1L7QA 2X05A 5EFUA 1NY71 5BYNA 3M3OA 3POGA 2PAMA 1UZYA 3D6EA 3NKGA 3VD3A 4FPLA 2ZCWA 5F3GA 1GZ9A 4BYYA 4YWAA 2CDPA 1UF2C 4O9EA 1HRV1 4XFAA 5FZFA 1YCIA 3ZFFC 5IVVA 1ULEA 3C8XA 2JE9A 4KGGA 4IESA 3LDRA 4S2DA 1UY1A 3Q8FA 5FYYA 3TN93 4E4ZA 1AR81 3I2JA 3N4MA 5FZ9A 1JN2P 1UQXA 5APAA 3WNKA 2D5FA 1ND3C 5C3RA 2WQ4A 3HNYM 2VXJA 2YYOA 2HEWF 2Z2SB 1LULA 3K77A 5D2AA 4KI5M 1UXZA 2IXKA 3LSDA 3T30A 2XJQA 3MUZ1 4NIDA 2VZPA 1YI7A 2XH6A 3J7NA 3M4FA 5FY8A 3ORJA 3UK9A 4C0HA 4B7KA 5FO7B 3AKRA 2ZXQA 4AGGA 3IDCB 3OF1A 3FBMA 3MF9A 5C8WA 3E6CC 1RUJ2 3LOBA 3BU7A 3IN9A 3J8F2 2BVBA 2JDMA 3IM0A 3PVBB 1PGL1 1DQ2A 1RUJ1 1FMD3 3K3NA 4GH4C 3VBRC 3WF1A 2X09A 4H3WA 1ZX5A 1XC6A 3N9LA 1DLLA 2ZGOA 4L92A 1FAYA 3LE0A 3ME2A 3B5LB 2QQNA 4AAXA 4K20A 1AXZA 1OSGA 1UD1A 3WP3A 4AI9A 2EICA 5C9AC 1BK1A 5CVRA 4HETA 5L9RA 3VZJA 4CCEA 1JYVA 3FUQA 4COVA 1MZEA 2Q0AA 4N53A 4W50A 4XTMA 3EBRA 5FMBA 1SLAA 1RTVA 3O1UA 1T2XA 4JRLA 4JDNA 2Z69A 3ZYGA 3M3IA 3KZ4C 1PVC3 3G7DA 4FTBA 5IK4A 3BVCA 3GZEA 5BNPB 1IKPA 4D3WA 1OMIA 1W8FA 5D8AB 2XKOA 4CP9B 4BIFA 3TBDA 1VMHA 2ZGSA 4QPIB 2JIGA 4LPLA 2RDQA 2WT2A 4XIKA 2IXHA 4PI2A 3WY6A 4ASKA 5C5UA 5HCAA 3FWEA 4JHTA 3PMEA 3IB3A 1PNFA 2QE3A 1YIFA 4LBLA 3P5BA 3QD6A 3VD9A 3NJZA 3WNPA 1RUF1 5SV8A 1O3TA 1RITA 4CUAA 1F8VA 1NLQA 2K0GA 1K5MA 4Y20A 2ORXA 4A6SA 3NAPC 3VHPA 1G9AA 1MZFA 3GF6A 1WGPA 4RGKA 2AEZA 2D93A 2QVSB 5T52A 5LW9A 3F2ZA 4ZKTB 4TTGA 4EROA 4AVSA 2VAUA 4GXLA 4D7YA 1RUH3 3KCYA 2WA3A 5FO9B 4HOOA 1XNDA 4BLIA 4Q2FA 1ZZ9A 2LTNA 2HBTA 1TNRA 4CPBD 4XBQA 3J8F3 1Q8OA 4Z2AA 3D82A 2E51A 3N36A 3A7QA 2FDHA 2JDZA 1QHDA 1ZBA1 1PHMA 5A7PA 4CCOA 2QJVA 5L36A 5FREA 3AYDA 4UF0A 3ZDVA 3X29B 4AVAA 2FBEA 4AQ2A 4WV8A 4YSFA 4HSJA 2X10A 1SCSA 2PYTA 3S7IA 4CCKA 1KS4A 4KL1A 3MI8A 3CEWA 4A3XA 5IT6A 4B4RA 3ECQA 4E2SA 1OI6A 3VGIA 3WX5A 1BYHA 2HLEA 1Z7S1 5A3TA 3ILNA 1STMA 2RHPA 4QPIC 5E6HA 3L2YA 5L7OA 1IZ3A 1D7PM 1SFYA 2GALA 3CHXA 2VTFA 2R042 5FZOA 4OQ8A 2D6KA 3WF4A 4P14A 3QH6A 3A22A 1ULGA 1ULPA 3CJIA 3UKVA 3T09A 4H14A 1I5ZA 2BGOA 5T54A 2RM21 2ZAHA 4XXAA 3RQ0A 3U75A 4QX0A 4KWKA 3ZX7A 2PA7A 2Y64A 5JMOA 4YW4A 2XQXA 1C8M3 3LIGA 4DEQA 1ZBE3 4IEUA 4XFCA 2L9LA 5FP8A 1JYIA 3OGRA 2PLV3 4GAZA 2IUWA 4XMAA 5BNPC 1JHNA 2QQJA 3IDBB 1S2BA 2FD8A 4HFSA 4CU9A 4R4XA 1RUOA 5JPMB 4IERA 1QU0A 2IZWA 4OHXA 4S2GA 1W8OA 2P3YA 3E5UA 3NO8A 4COYA 3LEKA 5EPAA 4WVMA 1MVQA 1UU4A 4N7UA 1NY72 4XJUA 5IVCA 1JYXA 4FP2A 1K42A 1PO23 4EQVA 1J1LA 1N1TA 4KH9A 3HOBA 5HV0A 1CAXA 1SFPA 2RS12 3C7OA 2ZGRA 5SV5A 1WZXA 2ZX4A 3EXUA 3VDCA 2JDAA 4PJYA 2VZQA 2HJIA 2DVDA 4LK7A 3VKMA 1XJAA 2QZ3A 3GYDA 2KM2A 1GZCA 4WBBA 1ZBE2 5F39A 5FYCA 1YQ6A 4Y26A 3SEPA 1KEXA 1EUTA 3MV11 1KFUL 1DG6A 3ZPOA 3P6BA 2CGPA 1SEFA 1ALYA 1E5RA 2XBO3 3LEIA 2WJSA 3UT0A 4CCCA 1CZVA 2RDRA 4LA2A 2F17A 3PJQA 4N7IA 1ZYBA 1RB8G 3WW4A 5J3UA 2BFUL 1LNSA 1JU3A 1NE6A 1W06A 2O8QA 3ZYBA 3NJVA 3RWKX 4TXWA 4Q4V3 5FZEA 1AR93 1ASJ3 1OXCA 2LS6A 4UBGA 4URTA 1O3QA 2E31A 1UZZA 2ZS6B 4FT8A 4AXOA 3AFKA 2GP5A 1CPMA 2VO5A 3WF3A 1MVEA 1S0CA 2GH2A 4XQ4A 4A44A 3NKTA 3JBG1 5HV4A 1IG0A 2I2SA 5I0UA 2R6QA 2FMDA 2VZ1A 1LOEA 2ZHKA 4NRMA 1R082 5GZFA 3HBZA 3ITQA 4XPVA 3MW3A 3ATGA 2ZGMA 4KU7A 3CDZB 4RD7A 4AWDA 4FPCA 1X33A 4WVWA 3ALQA 3WT3A 1HXS3 5IAXA 1QOSA 4F8AA 5A3UA 1D0HA 3ENRA 3ZYFA 4OHWA 5GZCA 1PK6B 2BBVA 2HWB3 3HPNA 2B39A 4W65A 3T3YA 2VZTA 2VMEA 5LRSA 3LDBA 1S0GA 1W9TA 3B3QE 3ZFEB 3NMBA 2JDPA 2HEYF 2WSUA 1RHI2 2J1UA 3F95A 2VMHA 4DPNA 4M3CB 5FP4A 4META 1CAUB 5IYYA 3T2OA 2B9VA 4W4ZA 4PLNA 4TLGA 3D0JA 4WM8B 4FAGA 2MPFA 1MS5A 5A1FA 5KXCA 5A6QA 4KWJA 2A73B 3EB7A 3LF7A 1S55A 1WUVA 2J1VA 3ACLA 5FZ1A 5ABJC 3H42B 1ZZ7A 3KHBA 2XJUA 3VHNA 4QX2A 5DZGA 1COV3 1QH6A 2RG4A 2WINB 2CNAA 3GBGA 3N7KA 4M01A 2W95A 2CGOA 4Q4Y3 3H8RA 1NCRB 1RC6A 2WWSA 4YM0A 1RMU2 2ORZA 1ASJ1 1W6MB 2A5ZA 2WRAA 3AKTA 1GNHA 3LDKA 3OUHA 4MXWB 1W2OA 2FZ1A 2C0ZA 2XJTA 2YC2A 2OZJA 3AZXA 2WN2A 1G9DA 1OOPC 2PHDA 1XQNA 2CWSA 2VVDA 1RHI3 3HQUA 2HEVF 3FMGA 4JGYC 3AK0A 3OBAA 5A3WA 4CDUA 1I1EA 4JV4A 3OBZA 5DXDA 2D3RA 1RUD1 2ZKNA 1YC61 1Y7BA 3AKSA 5BV6A 3PHMA 5FAXA 3VBFA 2D6NA 2NLRA 1C5IA 2RJKA 2VMGA 3KQRA 2E26A 1G8WA 4W6YA 3VZNA 1CZTA 3SEEA 2BOIA 4BH9A 1DQ0A 2JG8A 2HWF1 1H8TA 4YRDA 5LASA 5JVVA 1IGOA 5A32B 3CQOA 2WUHA 4F83A 2GH8A 3TB0A 2BWAA 3WG1A 4UYBA 5EP9A 4HN1A 3FE5A 3VBHC 5LWBA 1GZWA 2DCJA 4H7LA 1CAWA 1MQTA 4UI9L 3T0AA 1EV12 2ETEA 3IAPA 3U07A 2DU0A 5HXVA 1JI6A 4ZHNA 2ZGUA 5FZHA 1Q56A 2QQUA 2WYSA 1F4AA 1WMFA 3IAQA 3ACHA 3PNAA 3KVBA 4MLOA 4ZXEA 3Q8CA 2Q1ZB 5J48A 4INDA 2HWC1 5DUUA 3B00A 2ES3A 4C1XA 4DXSA 1J3QA 2XGXA 5EZWA 1OF3A 4HL0A 2OQ7A 1RUE2 2WSVA 4Q4X1 3ZXFA 1PGW2 2HWE1 4OHZA 5GZGA 4LBQA 4PF5A 5C7GA 3JB4C 4XUTA 3HIFA 1COV1 1UMZA 4MUVA 4V2VA 4E4SA 4IE5A 4CUGA 4H2AA 5CKMA 4BQ4A 1PGL2 1JZ6A 4AQSA 5A33B 4QB2A 1Y9MA 5GZDA 4AEMA 4FPOB 3O1VA 2VUCA 5H9QA 1DGLA 1PVC1 2X29A 3BTZA 3ZIWA 5JOYA 1RYYA 2ARBA 5LA9A 1SDWA 2RV9A 1U5XA 3KGZA 3EO6A 3T08A 2UYBA 4X8NA 3M3CA 3WNOA 2ZA9A 3O1TA 2V72A 4HZFA 3S57A 4O65A 2EALA 4UBHA 5BNNC 3Q8AA 1R092 1BKZA 4W8JA 3ZSJA 4IEZA 1SPPB 4AVBA 4B1LA 4CXWA 3POSA 2YU1A 3TEXA 5IFTA 2NPIA 3K2OA 5JXJA 1GP4A 1ULDA 1W6QA 5T55A 1F4HA 2CV6A 3P3PA 1W04A 5GKAC 2YROA 1JW6A 2YGMA 2XVKA 4LMFA 1FOD1 2JG8B 4LBKA 5FJHA 1XU2A 2BQPA 1H8VA 1XXNA 5A32A 4HLTA 4HKWA 4FO9A 3OY8B 2PAKA 1RUG1 1GSLA 4XFGA 4A42A 1WW7A 2ZPXA 5T5JA 4YM2A 2I45A 1X9TA 2HWD1 3VUOA 2CU5A 1G9FA 2QQLA 5CG8A 3WW2A 2B46X 3VBRB 4PIYA 2AYHA 2MHFA 3HAGA 4AGVA 4MH0E 3NV1A 1G9CA 4BLJA 3BGAA 1CZSA 4WVMB 5LCWL 1BJQA 3VZMA 2PHXA 1UKGA 4N8MA 4LHKA 4QHBA 1JXNA 1LGCA 2FDJA 1Q8QA 4COZA 2BDRA 3VKOA 1H4GA 3R0RA 1NCQB 4GJZA 1CAXB 3PVOA 4X8PA 2Y60A 5DDJ2 1IHMA 4BE3A 1V70A 4TYSA 5FUIA 4OUSA 3AB0A 4FSJA 2ILMA 2CAVA 5LZ6A 1O7FA 1VBC2 1RVF1 1WCUA 1XSRA 1C8M2 4V1PA 3O1MA 2FCVA 5LK5A 5FKCA 5C3SA 2BP6A 1Y4WA 2YC0A 2VMDA 5GLWA 1NUKA 1UOJA 1QXJA 2Y0OA 1V9U2 2ZX0A 4ARXA 1GOFA 2VZUA 5D21A 2OW4A 4FFHA 2BOJA 2BYVE 2ZOEB 4P08A 3VL9A 4AQ6A 5FO8B 3O0VA 1YIPA 5EV7A 3JD73 4MSVA 3BCWA 4YFZA 1KGYA 1UZVA 2XWBB 3FC0A 3LOIA 3VBHB 1QJEA 2EIEA 2R30A 5IVJA 1BXHA 4DRRA 4PDWB 2QNKA 3R6SA 3NV3A 4NHLA 1XE8A 1ZRFA 2VVEA 1KITA 3I97A 2PLV1 1W2UA 1S0EA 4CCJA 3LIHA 4DXTA 4A6OA 4Q0SA 4CCLA 3CZJA 4XCAA 5JOXA 1S2KA 1L3JA 4QX7A 3ZYHA 1VBD3 1KRIA 4ET7A 5KHJA 2WFF3 2RM23 3G6JB 1DBNA 1CIWA 1YNAA 2Y0IA 4FCAA 4PBPA 5CKNA 2IVJA 3MDPA 1VAKA 3H8UA 2P5BA 1OT5A 4Z1VA 3NNGA 1OKOA 5FLJA 4S2FA 5JDBA 5FZ6A 1H2LA 3PL0A 3WW3A 3DXUA 1W2NA 5HBAA 2BEOA 3I3MA 1H1AA 4CDWC 2YZ4A 3RZZA 1V6NA 4RHV2 1XNAA 1GNZA 1GOGA 2BERA 5C9AB 3N7LA 3DPRB 4D0QA 2VXRA 1V00A 4Y22A 2Q8OA 4Q4V2 4YG3A 1CAUA 1KQRA 5FXVA 2ZX3A 3SCFA 3WNMA 2QZ2A 3VBSC 2SBAA 3O7OA 1RUJ3 5B2GB 3WZ1A 4COWA 4EWEA 5FPAA 4QXCA 1NG0A 4NWWA 5FY7A 3V65A 5HCHA 1HRI2 5CG9A 1REFA 1S0DA 2VNGA 3LSEA 1YQCA 4NR1A 2LROA 1QJY2 2WO3A 2ZGKA 1YUDA 2ZX2A 2IFRA 2Y38A 4FPHA 2WNUA 4IQPA 3KT1A 4XJWA 5B4NA 3BYWA 4B8EA 4UFMA 5DAWA 5KHHA 2AENA 3OGJA 2C9KA 4K3UA 4JAAA 5FIXA 2BFUS 1GP6A 2QBXA 1UU6A 3MUY1 2YB7A 1MZ6A 5G05L 4PLMA 3IKWA 4ATEA 2PQSA 3PJYA 1W6MA 4LK6A 3JU9A 3M2MA 2HWC2 1RUI3 4EV0A 5KXEA 1V6LA 1JU4A 3QLQA 4Q1PA 3WUDA 2DVAA 2YBPA 2W68A 1BMV1 5FY1A 1GKBA 2W3JA 1AR73 3DV8A 5IW0A 2PQQA 2R0HA 4PQQA 3SC7X 1PO12 4IE7A 4P9WA 1O3SA 3ZFFA 2PHFA 2RS53 2WYFA 2W1SA 1VBD1 4KMQA 3BALA 3AP6A 5CFCA 3THDA 3RZJA 3B7MA 2XUEA 5A7WB 1LOCA 5T50A 4ATFA 1DGRA 1OA2A 1WBLA 2Y34A 4WM8C 1V6IA 4IDZA 2R063 3UETA 4AYUA 1QXPA 4CXXA 4AFCA 3MLLA 2WS93 1RIRA 1MS1A 3MZHA 1PNGA 4J1XA 4FOQA 1LHVA 1RINA 2FDKA 3AMMA 5F5CA 4JRAA 1NAEA 1LHOA 4FTSA 2E9QA 4DFSA 5ACA3 5ISLA 2A71A 1CGPA 4ITCA 3M1HA 1W6PA 1ZBA3 3AMHA 3DPRA 4NHXA 3WINE 3T4VA 4PBOA 5LBFA 3RG0A 2XJPA 3CO2A 5C71A 2Y6HA 5FYZA 5I8SA 3OJBA 4MO3M 2JD4A 4BK4A 2JG9A 1JZ4A 1LCLA 3RI9A 1JOJA 4LBQB 2ZEYA 3PVNA 1OVSA 1W39A 4I01A 1DHKB 2BTVC 1W6OB 1OQ1A 2R071 1W0PA 4HBNA 2VE1A 1W8NA 3NW4A 3UJQA 2ERFA 1MEC1 1DZQA 1CN1A 2ZGTA 2Q8DA 3SQOA 2TUNA 4NMIA 3WW1A 5BY5A 1UX7A 1AL21 3I59B 1MEC2 2UWAA 5F3IA 1RXFA 1VBA1 5FZMA 1GANA 3DGTA 4F3JA 1POV1 4Q4W1 2OS2A 4KNCA 5JIAA 1F35A 1O3RA 3VD4A 2WZR2 4Q4W2 3N7MA 3GJAA 3U4SA 1WW5A 4QX1A 4EN6B 5BNOB 1RJ7A 5FOBB 5DDJ1 1O5LA 5D1IA 4I2OA 3U37A 4Q29A 4EWDA 4KGQA 4QQPA 1ASJ2 1OPOA 3MGUA 3QH7A 3SCHA 4NJ4A 4LA3A 3ZFGA 1UYXA 4NRQA 3BTXA 4QQ2A 1VE0A 2VR4A 1AR62 4K1ZA 1HLCA 4XF1A 5CFCB 1OA3A 2XR4A 1ENXA 4HSLA 3ZN6A 2O14A 4NHMA 4XBLA 1LGBA 3HR9A 3IPVA 3DCQA 2RDSA 4QT6A 2HYKA 3GZTB 2DFBA 2E33A 1YYNA 5FOJB 3MLJA 3TWIA 3ZR6A 2GN3A 1M4WA 5FZKA 1WLWA 2YPDA 4KQ7A 3VDBA 1W3VA 5FKBA 4XFIA 2UURA 2Q5TA 3J26N 3ZM8A 4BOWA 1C57A 2VCAA 2ZGLA 4UAPA 1Z0HA 5DUVA 4DEVA 4R4ZA 5L73A 1RXGA 1SMVA 1J3RA 4QAWA 1NXD1 4LLOA 5KHIA 2I74A 3BPSA 3CU7A 1W6PB 2BVVA 1ZA7A 3SCGA 2BWCA 1NCQA 2C4XA 3T2QA 3D0SA 1R093 1VBC3 5FXXA 4UW4A 3H1WA 4XIOA 1DGWA 4PT6A 5F1RA 1NA1A 2IXJA 4LITA 4YVSA 2P17A 2BV4A 1X7NA 4XOGA 1Q43A 1VBB1 2OIIA 2ZHNA 2VCCA 4CUCA 2SLIA 1S0JA 1K5JA 4IEXA 1S2EA 1UZWA 1XSQA 3I3DA 3EYPA 1PZ7A 4AHWA 1CVNA 3JD71 2XBO2 4I3GA 3FJSA 5FPLA 5FY9A 3FUOA 4UFLA 4YGDA 3VHOA 4QHZA 5FYUA 2BNOA 1QXRA 4P9JA 4XUPA 4GALA 1POQA 5FLHA 1HXS2 2EXJA 4ISQA 1LOAA 4QM9A 5FZBA 3BIEA 4ZZ8A 2GNDA 1I5PA 3MHZA 2VH9A 1OHFA 1O4TA 2D43A 4PDWA 4Q8LA 5A3NA 4Z2WA 3C2UA 2F4LA 3C3VA 5J37A 3JXSA 2W08A 4LE4A 3ST7A 4R9CA 1UKRA 2VMIA 3VD7A 3IPVB 1DGRN 2WFF2 3NJXA 1UO9A 4L0PA 3AJYA 4ES8A 4NIHA 2WO2A 5AC93 2VBBA 1V6OA 3FHAA 4I0BA 5EJZB 2YC4A 3N9QA 2JE7A 1ZBE1 2R49A 2V09A 4KWLA 1D4M1 1NQJA 4SLIA 3ZR5A 4NIIA 1D4M2 2GU9A 4GMP3 4IV1A 3WDVA 5A3LA 2MEV2 1RUG2 1UMIA 2VC9A 1SBEA 2JJ6A 3LWCA 2OPWA 4QKBA 4XFBA 3RI8A 4QDRA 2VTXJ 3LA2A 4RS5C 1F2NA 2R043 1ZRCA 1QF3A 2Q30A 1LESA 3OEBA 1TME2 4FPKA 1XNBA 5G04L 5EQUA 3KS7A 4JGZC 3WG2A 4IGQA 1LODA 2DUQA 2VU9A 3OD0A 1JYWA 3V64A 1LEMA 2JKXA 3H9AA 5K0UA 5HCBA 1HRV2 2VCBA 4LULA 1PO21 3T2PA 4NUBA 1AR82 2O1QA 2V4AA 5LBBA 4DXZA 3AMPA 2FMYA 1FV2A 2JDUA 3Q8EA 5FP3A 4GWJA 2IXCA 4YZ1A 5BNNB 4M0HA 5CB7A 4QB6A 4CP1A 2Z4FA 1DQ1A 5JOZA 2X8KA 3WG3A 2EXKA 5FMOS 1VAMA 4HN0A 3FFQA 3ZSEA 3N9NA 3H1YA 2GC3A 1XYPA 3K4AA 2W47A 4BPZA 4EE2A 1LU2A 3ZN5A 2AREA 4OI2A 3P3NA 2DURA 5AVPA 2P3KA 3GM8A 4WM7A 3I3EA 5IK7A 1GLHA 3TAYA 4LORA 2CL2A 1HIXA 1QH7A 1IQAA 2RS33 2ZACA 1GU3A 4DINB 3ZSMA 2GC0A 2QFEA 3UJOA 3RMYA 1HN1A 2WFPA 4HKLA 4LOTA 3WNLA 5A7SA 5FRAA 1AR91 5B4XA 3B94A 2VTXA 2ZTNA 5H9RA 5FYMA 3OGSA 4P9GA 3WP5A 1WD4A 4GMP1 2XWJB 4B29A 4XILA 5IVFA 3HMYA 4GULA 1QOTA 1LHUA 2Q1MA 2JD9A 3HT1A 4LLFA 2VOWA 4BXFA 5KHGA 3I8TA 4IV1B 5JSOA 4CYDA 1BCXA 3ZOIA 5F37A 4YW5A 4XE9A 3U11A 3UGGA 3AXEA 1F15A 1FI2A 1BEV2 3CJIC 1MPXA 4I09A 4RA0A 1RUF3 1QGLA 1X8EA 3HQXA 5K7PA 1FPN2 5EHDA 2GP3A 2P1BA 1VIWB 1PM7A 3GGLA 1L7RA 3S6PA 3WR0A 4HVRA 3I4IA 5CA6A 1X50A 5E16A 3PVEA 1C28A 5DAQA 2VQAA 1AXKA 2DBIA 2A6XA 2QDRA 3C7HA 3LKJA 3L9JT 3MIEA 2YFUA 3RJ2X 3S30A 4ZZ5A 4Q0QA 4OHYA 5EYYA 1FATA 1OF4A 4OFGA 3MW4A 3B01A 3D8CA 3NRUA 1LEDA 2KR2A 1XBFA 3GBWA 3I59A 1QDCA 4IEYA 4XF3A 3PUAA 1S0IA 4YM3A 3LA7A 1JOBA 1H4HA 2UWBA 3N9MA 3NQHA 5FY0A 1TE1B 1XNTA 2JDHA 2K46A 4C1WA 1VRH2 2RVAA 3I49A 1H6YA 5A80A 1H0BA 1SG3A 2MNGA 4Q4Y1 5LBEA 5E1RA 3CJXA 1UIJA 2BGPA 4JTOA 1W8UA 4XZUG 1TVGA 3I3QA 1O8SA 5ABJB 1OFNA 5D8AA 3ZVXA 2PFWA 2VMFA 3MF6A 1RUNA 4QM8A 3D4KA 1PZ8A 2XVLA 4J1WA 4F7ZA 3ZN6B 4B4QA 4YYOA 4QB1A 4UFJA 1ND3A 4DUVA 3BKZA 1AL0G 2TNFA 5JOWA 3NSTA 2WC2A 1AJOA 2RS51 5DUWA 2FDFA 4UWDA 4WVVA 4YG0A 3SKVA 1COV2 5J36A 1XOYA 3OG2A 4KBBA 5DABA 1AUYA 1Z7S2 1HXS1 3V0AA 1SBFA 3POBA 4P02B 5FPXA 1I9RA 1UYZA 4YVWA 4NIGA 2HWB1 4C90A 3HN1A 3VLBB 4YGCA 4MHRA 2VZOA 1SLLA 5KC5A 1HV1A 2WZR3 3KT7A 1ACCA 4JC1A 1DF0A 1H6XA 2WBKA 3BIWE 5A6XA 4BDVB 2A1XA 2BUKA 3I3BA 3NNLA 4IETA 4XQDA 1REDA 4RR3B 4A41A 5AVAA 1RVF3 3CBNA 1FMD1 4P00B 4LT5A 3T1MA 2DTYA 1IOAA 1G86A 3E1F1 1B35B 2YMZA 4QKDA 2OUHA 4DY5A 2R32A 4CEYA 3HN3A 2KA3A 1H2MA 3UGFA 3NWKA 2W0XA 1TMF3 2D6OX 5C8CA 3MPPG 1RUD2 3Q9OA 5F6LB 1W8TA 2H6CA 4XZPA 4FFGA 1F5FA 1ND2B 2E7AA 2W1QA 4NAOA 4QGNA 5DQ0A 4MG2A 2Q1FA 2DU1A 3WVJA 4GH4A 3E6DA 5KBFA 2QQPA 4CTEA 3KCCA 4N43B 4XTPA 4UFKA 5DPNA 3ZXEA 4M3CF 1F9KA 1T6BX 3SITA 2JKBA 5FZGA 1GYKA 1W05A 1YQ2A 2P34A 2GNMA 3KV9A 2XJVA 1HJGA 5ANNA 5FZOB 1IPSA 1DQ4A 1GBGA 3FN9A 1Q8VA 2EAAA 2PHWA 3CJIB 4YW7A 4E2QA 3KWVA 1AR71 5FZAA 3WV6A 1GNYA 1KJLA 4N9IA 4JDOA 3H1MA 4QDSA 4XJAA 5FZ3A 5T5LA 4OI4A 4CU8A 5C3OA 1AJKA 3AYCA 4NHKA 1OBNA 4QXKA 3KT4A 4XYXA 2RM22 1NXMA 4CPBA 4QKFA 2R062 5JI9A 3I2HA 2JEMA 3ZN4A 4RFT0 4LNVA 2R061 2WS92 3WNNA 3O5SA 2QDNA 5T5OA 1WBFA 5HCFA 3THTA 5J7MA 1XE0A 3R4UA 2WS91 4CDXB 3H3UA 3ZSLA 1QY4A 1ZZ8A 4FAHA 2CSGA 4QU2A 2AC1A 4JDMA 4OUMA 2J1SA 3SISA 1JS9A 4DMIA 3AL6A 2JIJA 5K0UC 1TNFA 3J8F1 4Y24A 4L99A 4XACA 5F3EA 4GA9A 3WP6A 2VZSA 1LAJA 1LB2A 4RR3A 5LA2A 3WSOA 1APNA 4GKYA 1V6MA 1S1AA 1UY3A 3VBUC 5JUVA 2LW8A 3L2HA 2A75A 4IUGA 4XXPA 4Y1UA 4EN9B 3ZFEC 2WQZC 1AZDA 3UV9A 5BNOC 1TMF2 4CEYB 3BU0A 3OYWA 5CIRA 5FQ0B 3UKNA 2BBAA 2ZGPA 1EUUA 1R1A1 2VZVA 4RQPA 3RMXA 1AYM1 3I2KA 1Z7S3 3HJRA 4JGYA 3AX4A 1RUI1 3TRSB 3GALA 2BZDA 1W28A 3WUCA 4CVUA 4YG6A 2Y26A 2WNVC 1VBB3 1BEV1 4A3ZA 3WNXA 4N43A 2A6VA 4HPKA 1FPN1 4Q4W3 5FYSA 2VG9A 3POFA 2ZEXA 2VD7A 2IFWA 2MEV3 3A23A 4XFHA 3JD72 2V5DA 4HVOA 2E63A 5JZGB 4GB32 4PCRA 5FZCA 1XRUA 2I07B 3ROUA 2OKXA 1UAIA 2P2KA 1ODMA 1PO13 1E57A 2XLGA 4JHZA 1AYN1 4OCTA 1ULCA 1YJLA 3LD8A 4JTNA 4GJYA 4YARA 5AC91 3O1SA 3ACIA 2XMLA 2LUWA 1JBCA 4QQHA 4HT1T 3NAPA 1O59A 2TBVA 1JH5A 2N7GA 5F6KA 3IT8A 3J4UH 4M00A 4EZ4A 2ATFA 3AZVA 1RUD3 4J25A 2PHTA 1GZTA 2PXJA 2DCTA 5CKQA 5E8AA 3FLTA 3USUB 3ILFA 5FZ4A 2WZPP 4ZY9A 3UKTA 1N47A 1VB4A 3JZVA 3ZPYA 1KXGA 3JUUA 1QJX3 4CDUC 4GQ7A 3WDXA 2XOMA 4ZU4A 4K40A 1NOVA 1O91A 5A7NA 4QPWA 5C33A 4L11A 3PU3A 4Y20B 1UZ0A 3BI3A 2WLQA 1PK6A 5IUQA 2GZWA 4KBZA 2FDIA 3INAA 3B93A 3TEYA 2B5HA 2P37A 2LM3A 5LEKA 4YGEA 1GP5A 3A0NA 3ZXAC 3AMNA 4AFDA 1DDLA 1JZ8A 3IWZA 2D7FA 5KC6A 5A7OA 4YLZA 2E32A 1WLCA 4FOVA 4Y3OA 2WNUC 4CDQA 2ZMLA 5C4WA 1QEXA 2Z42A 3VZKA 4QHOA 4AI2A 3GHMA 2D98A 1BVP1 1AR63 1X82A 1VBD2 3HQRA 3OYWB 4D6QA 4UF0B 1FXZA 2QKDA 1W9FA 1YI9A 2BGCA 2Y6FA 3DEMA 3S0MA 1OLRA 4FXKB 4K8FA 4MGQA 4XMIA 4FXGB 4JGZB 4XHXA 3TN92 5C3PA 5KHKA 1EV11 3WD5A 2XL9A 4K7JA 3V0BA 4NIAA 2TEPA 3RYKA 4RN5A 2E7TA 1XYNA 3LB9A 1NCRA 4QWNA 2DUOA 1K45A 2J1TA 1LGNA 2A7AA 5LRRA 3I2OA 5L7OB 4G3YC 1SQ4A 4JVAA 4UT5A 1BQPA 5FXZA 3SLIA 1DYKA 2E53A 2W46A 4OULA 3MIGA 4QPGB 3E5XA 1PGW1 2HWE2 5ABJA 1HX6A 3RYPA 4PI0A 2R7EB 3B9CA 3EHKA 5BXXA 4BHPA 1DFQA 4LOSA 4Q0UA 1ND3B 5FYBA 2W5FA 2VOKA 1B09A 1YO8A 2HWD3 4QDQA 2B45X 1HQWA 3AYAA 3KV6A 4HK8A 1H8TB 4IGPA 5EYXA 3I7DA 3W20A 4N90A 2YV8A 1HQLA 1WMEA 2ZAAA 4DQAA 1RUC1 4OI0A 1UN1A 4MGYE 1MS3A 4YZ4A 2HWF2 5IK5A 2VW0A 2VBDA 3E97A 1D4M3 2ZZJA 3DUIA 1MQTB 1DQ5A 3VD5A 1C5HA 2VUJA 3O14A 2RS11 4FOWA 5IHRA 3FX3A 4H7MA 1R091 1YFYA 1AR72 3HT2A 4AVVA 4D94A 5CFDB 3DYOA 4E4HA 4QQOA 5ACA1 3W58A 4DOUA 1DQ6A 1DZRA 1ULOA 4NHYA 5F5QA 2Q4SA 4A45A 1GQPA 5HXMA 3WDTA 4QX5A 5FWEA 1RUE3 3RSJA 2D40A 2HYXA 3FFZA 4NVPA 3MBWA 4Y4YA 2C26A 4KU8A 4TLFA 1G9BA 5JIUA 1ZVFA 1CAVB 4ZONA 4E8DA 4E9KA 1QJFA 1EAH3 1GQGA 3ES4A 4LKDA 3AJZA 2VCMA 3OGVA 5IATA 3FHQA 2EF6A 4CDWA 4B1MA 2ENRA 4Q0PA 1KDKA 2BU9A 1JZ3A 4UW3A 3VBFC 1W0OA 4M4PA 2VVFA 4JCKA 2B4KA 2WT0A 3LFIA 3I2IA 1CR7A 1ENRA 1W90A 4YW1A 1V0AA 2XHKA 1ND2C 5BNPA 3MLKA 4AEKA 3AP4A 4HANA 3K51A 4GWNA 4Y1YA 4CA9A 3SH4A 4CP9A 2ZJCA 1URXA 1IG3A 3RGBA 4JKLA 4YW3A 4X6QB 1UMHA 4ZU7A 5BNQA 4GKXA 1QQP3 2NM1A 1E5HA 4LR4A 4NAMA 5FUPA 1YQ8A 1JODA 2FDGA 3OCPA 3EQEA 2ZKLA 2Y6LA 4IXLA 3WF2A 5J1XA 3AVRA 4AFAA 5J09A 1LOGA 2RDNA 5FLIA 3DXTA 1FT9A 4FQZA 2IWGB 5IFPA 4LBQD 3JCIA 3RYRA 2W87A 2DBNA 1Y9QA 4GB31 2R072 4Y5Z0 4AOCA 1JHJA 1RUG3 4IEVA 1OLQA 3WQ7A 1HW5A 2PHRA 5LATA 2C24A 3RJRA 3OPZA 1ZZ6A 2K2SA 1N3OA 2HWB2 1LOBA 1W8WA 3DYMA 3LPFA 5D8AC 1RUF2 4LHLA 5FYTA 3VDAA 1XE7A 4R52A 2WZR1 4M3CA 2FQPA 2LALA 5CEHA 3U1XA 1A34A 2RS32 1I6XA 3MIDA 3VBOB 1UOGA 3ZMNA 3GZUC 1VALA 2BNMA 1ZRDA 2ARAA 5AFBA 4P9YA 1K5MC 5FPVA 4LO8A 3N35A 4CP0A 5JXHA 4EN0A 2WWUA 3ZYJB 3BPZA 1CAVA 4JGYB 3R4DB 1VBC1 2KXLA 1JMUB 1PGSA 1UPSA 1AR61 1WW6A 2W1UA 4IEPA 5KXDA 4LEJA 1IS5A 1HQNA 4CDWB 3PDQA 5FZIA 4HPKB 3W21A 4IEWA 4RSUA 5F2WA 3WDWA 3SH5A 1V9U1 5JZGA 2YGLA 3VBSB 4G9SB 1QWRA 4OQ9A 4BMEA 3C7EA 2JB4A 4E8CA 5FWJA 4XW3A 1US3A 4MX3A 4A7KA 4PIZA 3DKWA 4LBNA 1QJY1 3J7HA 2NMNA 2B9UA 3C7GA 1WCKA 3VBFB 3R05A 3TN91 3AP5A 2P3IA 3OOXA 2PLV2 4OMCA 5FY4A 2VGDA 4IV1C 4FTEA 4EZHA 3WLUA 1T6GC 1YEWA 2BJSA 2C9AA 3CIHA 3LQCA 3MIBA 3W59A 1UOFA 2OQ6A 2VECA 5L19A 4CP2A 4M0NA 4BQXA 4NE9A 4EJRA 3HVDA 1H2KA 1VPHA 5JZGC 1H2NA 1PVXA 3FHIB 2GC1A 3BN6A 3OGGA 3THPA 5CFCC 2X5IC 4CEWC 3FLPA 5DN2A 3ZFGC 5C4WC 3SXWA 1EPZA 4NROA 1TME3 5CAZA 4XUNA 4HVQA 3GJBA 2IXLA 1IPKA 4AG4A 5C9AA 1H1IA 1HN0A 1N1VA 2JWPA 3BTAA 3K3OA 4DXRA 1HJFA 2RS13 4CDQB 4RYDA 3RZLA 2XKPA 1AX1A 2PHLA
chains in the Genus database with same CATH topology
4TN7A 5FZOA 4LIVA 5FZLA 4HONA 3PUQA 5FP7A 5A7SA 3PU3A 5A1FA 5A3PA 2YU2A 4Y33A 2YBPA 3N9PA 3KVAA 5FV3A 5IVYA 5FY1A 5FZ1A 3NJYA 5FXXA 5FYMA 5FY8A 3U78A 4CCMA 5LWBA 2XXZA 5IW0A 5A7OA 3UYJA 5FUPA 5FZGA 3PTRB 4LITA 4GD4A 5IVFA 4Y3OA 4QXBA 3KV9A 4BXFA 5FP8A 3AVRA 5FZOB 4GAZA 5F37A 5LY1A 3DXTA 2XUEA 3K3NA 5FZ0A 5A7WB 4D6QA 5KR7A 4GJZA 4UF0B 5FYHA 3N9OA 5FPLA 3N9LA 5FZAA 5FY9A 2WWJA 5LY2A 5FYUA 5FZ3A 2GP3A 3OPWA 5A3WA 4LIUA 4AI9A 4URAA 5A7QA 5FXWA 5FZBA 5IVCA 4QWNA 5IVBA 5FJKA 5A3NA 5FYTA 4DO0A 4QU1A 4IGOA 5F5CA 3PURA 5CEHA 5ISLA 3OPTA 5FXZA 4C8DA 5FYVA 3PUAA 5F32A 5FYIA 5FY5A 5FPVA 3AL6A 4XDOA 5FYZA 2Q8CA 3N9MA 3AVSA 5FYCA 5IWFA 2WWUA 5F3EA 5F39A 1VRBA 5FY0A 5K4LA 4EYUA 3N9QA 5IVEA 5IVJA 5FYBA 4ASKA 3ZLIA 2YBKA 3ZPOA 5ANQA 5FZHA 5A80A 5FPUA 3KV6A 3KVBA 3PDQA 4IGPA 5FZIA 4CCJA 2Q8DA 4XDPA 5F2WA 4CCLA 4CSWA 5F3IA 5A7WA 5FZMA 2OS2A 4QX7A 4V2WA 3RVHA 5FZEA 2OQ7A 4D6SA 4IGQA 3U4SA 5F5IA 5FUNA 5FWJA 2P5BA 2W2IA 2GP5A 3AL5A 5F2SA 5FBJA 5FPBA 5LW9A 4V2VA 4Y4RA 4CUGA 2OX0A 4E4HA 5F5AA 5FZ8A 5FZ6A 4HOOA 5FYSA 4NUBA 3DXUA 2VD7A 4BU2A 5FP3A 5FY4A 5FZDA 3KV4A 5FZCA 4EZHA 4QX8A 5FZ7A 5A7PA 5FWEA 2OQ6A 3PU8A 5FXVA 4CCOA 3LD8A 2Q8EA 4UF0A 4D6RA 4GJYA 5F3CA 5A1LA 4LXLA 4BISA 2XMLA 5A7NA 5FPAA 4QXCA 5FY7A 4CCKA 3N9NA 5F3GA 3PUSA 4EZ4A 5FZKA 4AAPA 2YPDA 4QXHA 5FZFA 4DIQA 5IVVA 3LDBA 2PXJA 2YU1A 3KV5A 3K2OA 5FYYA 5FZ4A 5A3TA 4CCNA 5FP9A 5E6HA 5FP4A 5FZ9A 2YBSA 3K3OA 2OT7A 2XDVA 5FJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN7 A;  5FZO A;  4LIV A;  5FZL A;  4HON A;  3PUQ A;  5FP7 A;  5A7S A;  3PU3 A;  5A1F A;  5A3P A;  2YU2 A;  4Y33 A;  2YBP A;  3N9P A;  3KVA A;  5FV3 A;  5IVY A;  5FY1 A;  5FZ1 A;  3NJY A;  5FXX A;  5FYM A;  5FY8 A;  3U78 A;  4CCM A;  5LWB A;  2XXZ A;  5IW0 A;  5A7O A;  3UYJ A;  5FUP A;  5FZG A;  3PTR B;  4LIT A;  4GD4 A;  5IVF A;  4Y3O A;  4QXB A;  3KV9 A;  4BXF A;  5FP8 A;  3AVR A;  5FZO B;  4GAZ A;  5F37 A;  5LY1 A;  3DXT A;  2XUE A;  3K3N A;  5FZ0 A;  5A7W B;  4D6Q A;  5KR7 A;  4GJZ A;  4UF0 B;  5FYH A;  3N9O A;  5FPL A;  3N9L A;  5FZA A;  5FY9 A;  2WWJ A;  5LY2 A;  5FYU A;  5FZ3 A;  2GP3 A;  3OPW A;  5A3W A;  4LIU A;  4AI9 A;  4URA A;  5A7Q A;  5FXW A;  5FZB A;  5IVC A;  4QWN A;  5IVB A;  5FJK A;  5A3N A;  5FYT A;  4DO0 A;  4QU1 A;  4IGO A;  5F5C A;  3PUR A;  5CEH A;  5ISL A;  3OPT A;  5FXZ A;  4C8D A;  5FYV A;  3PUA A;  5F32 A;  5FYI A;  5FY5 A;  5FPV A;  3AL6 A;  4XDO A;  5FYZ A;  2Q8C A;  3N9M A;  3AVS A;  5FYC A;  5IWF A;  2WWU A;  5F3E A;  5F39 A;  1VRB A;  5FY0 A;  5K4L A;  4EYU A;  3N9Q A;  5IVE A;  5IVJ A;  5FYB A;  4ASK A;  3ZLI A;  2YBK A;  3ZPO A;  5ANQ A;  5FZH A;  5A80 A;  5FPU A;  3KV6 A;  3KVB A;  3PDQ A;  4IGP A;  5FZI A;  4CCJ A;  2Q8D A;  4XDP A;  5F2W A;  4CCL A;  4CSW A;  5F3I A;  5A7W A;  5FZM A;  2OS2 A;  4QX7 A;  4V2W A;  3RVH A;  5FZE A;  2OQ7 A;  4D6S A;  4IGQ A;  3U4S A;  5F5I A;  5FUN A;  5FWJ A;  2P5B A;  2W2I A;  2GP5 A;  3AL5 A;  5F2S A;  5FBJ A;  5FPB A;  5LW9 A;  4V2V A;  4Y4R A;  4CUG A;  2OX0 A;  4E4H A;  5F5A A;  5FZ8 A;  5FZ6 A;  4HOO A;  5FYS A;  4NUB A;  3DXU A;  2VD7 A;  4BU2 A;  5FP3 A;  5FY4 A;  5FZD A;  3KV4 A;  5FZC A;  4EZH A;  4QX8 A;  5FZ7 A;  5A7P A;  5FWE A;  2OQ6 A;  3PU8 A;  5FXV A;  4CCO A;  3LD8 A;  2Q8E A;  4UF0 A;  4D6R A;  4GJY A;  5F3C A;  5A1L A;  4LXL A;  4BIS A;  2XML A;  5A7N A;  5FPA A;  4QXC A;  5FY7 A;  4CCK A;  3N9N A;  5F3G A;  3PUS A;  4EZ4 A;  5FZK A;  4AAP A;  2YPD A;  4QXH A;  5FZF A;  4DIQ A;  5IVV A;  3LDB A;  2PXJ A;  2YU1 A;  3KV5 A;  3K2O A;  5FYY A;  5FZ4 A;  5A3T A;  4CCN A;  5FP9 A;  5E6H A;  5FP4 A;  5FZ9 A;  2YBS A;  3K3O A;  2OT7 A;  2XDV A;  5FJH A; 
#chains in the Genus database with same CATH topology
 3Q8B A;  2VNV A;  3ON7 A;  1WLD A;  5LBC A;  2GAU A;  4GWM A;  3AP9 A;  3SKJ E;  1POV 3;  4EN7 B;  4Y33 A;  5IVY A;  3DYP A;  4C8D A;  1DYP A;  3NJY A;  1GOH A;  1TMF 1;  2Y6K A;  3U78 A;  5JAX A;  3UYJ A;  1JYN A;  1QIQ A;  1XU1 A;  2QQO A;  2RR1 1;  3V0B B;  3W5N A;  2R07 3;  1NZC A;  1R1A 3;  4RGA A;  4CEW A;  4N53 B;  1NT0 A;  3ZO0 B;  1LHN A;  4E4D X;  2VOV A;  5ACA 2;  1AL2 3;  4ASM B;  3IMM A;  1O6U A;  3H7J A;  2D5H A;  1OD5 A;  4CCD A;  1DGW X;  2DCZ A;  1UY0 A;  1MS9 A;  1E5I A;  4XQW A;  1ENQ A;  2XB6 C;  2XUM A;  4QPG A;  5I8T A;  5J98 B;  2FCU A;  1W0N A;  1BBT 1;  1I3H A;  5LEJ A;  3GNE A;  1HRV 3;  5FXW A;  4MVT A;  2JEN A;  5FTT C;  4QPI A;  5DUX A;  3T1L A;  4K21 A;  1BMV 2;  2QQW A;  1DYO A;  5FJK A;  2A3W A;  1AR8 3;  4EWA A;  3KB5 A;  1BHG A;  3FL7 A;  3S7E A;  3VL8 A;  1BVV A;  1EYB A;  1LOF C;  1XYO A;  2ARX A;  3DF0 A;  1CQ9 A;  1ODN A;  4ASL A;  4E2G A;  2WZ8 A;  1AX2 A;  4LKS A;  4XAA A;  1B35 C;  3OY8 A;  4TWT A;  1NCQ C;  1LU1 A;  4RFR B;  3UL2 A;  3VB9 A;  1VMJ A;  2VW1 A;  2XG3 A;  4JQR A;  4D69 A;  3NNM A;  1NE4 A;  1OUS A;  3OTF A;  3WCS A;  3OBT A;  3NL1 A;  1ZZB A;  3DN7 A;  1GWL A;  1QJU 2;  1D0G A;  1O4Z A;  1YFX A;  3D3A A;  2PHU A;  4SBV A;  4YM1 A;  5FDB A;  1QJU 1;  3VN4 A;  2X53 S;  2ADD A;  4A2U A;  2CTV A;  2R1B A;  4B4P A;  5C6C A;  1RVF 2;  3GHN A;  4XDP A;  2A6Y A;  3SNM A;  2FZ2 A;  2K9Z A;  2W94 A;  4YZ3 A;  1ZBA 2;  3WQ1 A;  1C3H A;  2ZX1 A;  3ELN A;  1OOP A;  3O0W A;  1POV 0;  2IVI B;  5LB6 A;  2OUJ A;  5JI7 A;  1LEC A;  1CX4 A;  1MQT C;  4I30 A;  1R08 3;  4ZXK A;  2P6H A;  2G9G A;  3M7A A;  4HMZ A;  5DZE A;  2DFC A;  5GLT A;  4YPJ A;  2OX0 A;  1R64 A;  3RNS A;  2YHJ A;  1VBE 2;  1JZ7 A;  1H30 A;  1XB9 A;  3MEP A;  1U0A A;  1WMD A;  4DNY A;  1CD3 G;  1PIV 1;  5GJ6 A;  4RR3 C;  5M0T A;  2D6M A;  3V56 A;  1HB1 A;  3K4D A;  1NLR A;  4Z92 B;  1ULF A;  2X5I B;  1UXX X;  1JOP A;  2VOX A;  4YW6 A;  4CEW B;  1VMF A;  1AL2 2;  4XF9 A;  5DG1 A;  2W91 A;  4MXW A;  1EV1 3;  5EJ3 A;  1SDD B;  2Q8E A;  5IK8 A;  5A1L A;  4FVV A;  1JYT A;  4DB5 A;  1N1Y A;  4Y1X A;  1OLM E;  1Q5O A;  2J1R A;  2RS3 1;  3J9S A;  3PMS A;  4MZU A;  3VBH A;  3LEM A;  3WF0 A;  3T0B A;  4AVT A;  1JYC A;  2D3S A;  1RMU 1;  2WO1 A;  4Z82 A;  5DDJ 3;  1LEN A;  1PX3 A;  1MR5 A;  1X9P A;  2D6L X;  5CFD C;  3RZM A;  1F31 A;  3KV5 A;  1FNZ A;  3APB A;  2WAO A;  4A4A A;  1YJK A;  3E5Q A;  4XAB A;  5LK7 B;  3BOW A;  4I0W B;  4O9G A;  1O8P A;  2FHR A;  1KD7 A;  2XJR A;  3RWN A;  3BUC A;  2WQ8 A;  3T0D A;  2VNR A;  1CX1 A;  1IKQ A;  1ZA4 A;  3WHT A;  4RHV 1;  3WG4 A;  2DTW A;  1K12 A;  1WA4 A;  2JEC A;  2VZR A;  2ZZQ A;  3DPR C;  4AED C;  4BWO A;  4AZZ A;  4WZF A;  2GSY A;  1CAW B;  3CZU A;  1CES A;  1NLS A;  4CE8 A;  2QQI A;  4AGR A;  2HWC 3;  2QCS B;  4QXB A;  4FPG A;  2O0O A;  4IV3 C;  1YFU A;  2WL1 A;  3MFC A;  5DAP A;  1C8N A;  1TZO A;  1YQ5 A;  5JXI A;  2G1M A;  3N9O A;  5E89 A;  4XJ8 A;  3VBO A;  2R04 1;  2WWJ A;  5I0S A;  1JTZ X;  4MYE A;  5F7U A;  2YFZ A;  3GZA A;  4P5H A;  4Q1R A;  3IBM A;  5L7O C;  4PLO A;  3I2F A;  2WNO A;  4RGG A;  5J96 B;  1NA1 B;  4YVS B;  3SHR A;  2XHN A;  3LFM A;  3M70 A;  3HNM A;  4OHV A;  4ZPI A;  3KHC A;  1A8D A;  1J3P A;  4CXY A;  1SHW B;  4WM7 C;  4AK3 A;  1Y9G A;  1PM4 A;  2MEV 1;  3WOG A;  1RUE 1;  3MV0 1;  4Q4X 2;  2EXH A;  5A1A A;  2GMP A;  1KJR A;  2GNB A;  4JKK A;  1GWK A;  2PN5 A;  4LUM A;  2R16 A;  4Z07 A;  2XLF A;  5EIY B;  1EP0 A;  5GLZ A;  1PO1 1;  2P6C A;  5JSP A;  1VJ2 A;  2DUP A;  5F8P A;  3O1P A;  5CFD A;  3VBS A;  2Q8C A;  4ARY A;  2WNE A;  3H3L A;  3QOP A;  4BXS V;  3HWJ A;  1CPN A;  1NZI A;  5K4L A;  1HB4 A;  1VRB A;  2D44 A;  4O7X A;  3VBO C;  5IVE A;  4Z8B A;  2JG8 C;  3K46 A;  3POJ A;  4Y5S A;  4RQP C;  1OH3 A;  3TNP B;  3ZFF B;  3KLS A;  4BB3 A;  3VKF C;  2G9Z A;  2VOT A;  4IL7 A;  5JWP A;  1HRI 3;  1W6Q B;  1YRZ A;  3T2T A;  3VZL A;  4MGS A;  1LJ7 A;  4N53 C;  3D5O A;  5T3N A;  5A7W A;  4N43 C;  1UCX A;  1SAC A;  3AZY A;  4NRP A;  4XUQ A;  3N3H A;  4L2N A;  4AF9 A;  1V6K A;  3U10 A;  1VBE 3;  1OH4 A;  3WQ0 A;  5FUN A;  4AL9 A;  1AYM 2;  4AI3 A;  3AL5 A;  3JQX A;  4XF4 A;  2ZHL A;  2HWF 3;  2OXB A;  1Q8S A;  1O5U A;  1WKY A;  1WW4 A;  2HBU A;  3M3Q A;  2JDY A;  2DCY A;  2G19 A;  1Q8P A;  4HK9 A;  4OMD A;  2RMU 3;  3MIF A;  1J58 A;  5CU1 A;  3QBQ A;  3GBF A;  1W99 A;  3ZFE A;  1GUI A;  3UGH A;  1US2 A;  4ZU5 A;  4QGM A;  3KF3 A;  3BTY A;  1WCS A;  2ARC A;  2VZ3 A;  1VLN A;  2ET1 A;  3GCX A;  5I93 A;  4WM8 A;  2JIC A;  5K0U B;  2XJS A;  1KDM A;  5FCC A;  2B42 B;  5I0T A;  2VUL A;  2G4I A;  3M3E A;  1MS4 A;  4PIX A;  1YWK A;  5CIS A;  5I91 A;  3K4Z A;  3VKN A;  1FYU A;  1DIW A;  1SLI A;  5FPZ A;  2OZ6 A;  4FI9 A;  1E5S A;  3ZXJ A;  4IEO A;  1F5J A;  4AW7 A;  1C1L A;  2H0V A;  2NYY A;  2OPK A;  2AR6 A;  2YBS A;  3ILR A;  1R08 1;  4FPE A;  5E88 A;  2XDV A;  1MEC 3;  4PDW C;  3WDU A;  1OPM A;  2Z79 A;  1NA1 C;  4LIV A;  4XDQ A;  4YVS C;  4MOA A;  1U12 A;  4Y1Z A;  4XCB A;  1X8M A;  4O61 A;  2C5D A;  2EXI A;  5H9P A;  3PUH A;  5A3P A;  3OBR A;  2YPJ A;  3JBG 3;  5DAX A;  4C0B A;  2QQM A;  3LAG A;  3N9P A;  5I8Y A;  1C1F A;  1TQ5 A;  1UOB A;  4CCM A;  2YXS A;  4CDU B;  4WM7 B;  3BOP A;  3RRD A;  4FBF A;  1OD3 A;  2BW8 A;  2RJL A;  1UX6 A;  4GD4 A;  1AHS A;  4GMP 0;  3KSC A;  4LO5 B;  3ZFG B;  4BQ5 A;  5C8C C;  1M06 G;  3A0K A;  2AH2 A;  5KWR A;  4YFW A;  3AZW A;  2BNN A;  3M8L A;  4FQ4 A;  4XJZ A;  3W9A A;  1PMJ X;  1VBE 1;  5FZ0 A;  1SLC A;  3DL3 A;  2XPJ A;  1QDO A;  1PMI A;  3BOD A;  4FPY A;  2WAB A;  3AMQ A;  2WAA A;  2UWC A;  4UW5 A;  3OD4 A;  1PMH X;  1S4C A;  2D3P A;  4LKE A;  2YG0 A;  2RJ2 A;  1HDK A;  3ZIX A;  5GZE A;  1GV9 A;  1MS8 A;  2WDB A;  3GXU A;  3KMH A;  1GQH A;  4URA A;  3OUJ A;  1EAH 2;  2PAE A;  3RS6 A;  1QJU 3;  1W2A X;  2DF7 A;  1GZW B;  1H9P A;  4QGL A;  4P9L A;  1IPJ A;  4DO0 A;  4NN0 A;  3IMN A;  4GWI A;  4IW3 A;  1EY2 A;  4LBJ A;  4LHS A;  4GB3 3;  4Q0V A;  5ERL A;  5BPX A;  5C5T A;  4YGB A;  2DVF A;  3III A;  1GR3 A;  3E6B A;  1W8H A;  4L97 A;  2IXI A;  2UY9 A;  4COU A;  1OVP A;  1Q3E A;  4LE3 A;  1R1Z A;  1A6C A;  4Y22 B;  3O1R A;  3H0O A;  5FY5 A;  2R0F A;  1OOP B;  3HD8 B;  3MPB A;  2RS5 2;  3B9I A;  3ETP A;  3PUI A;  1W8Z A;  4QX3 A;  1J1T A;  1WLT A;  3IDE A;  4L9B A;  5ANQ A;  3EJK A;  1AVB A;  1NCR C;  4J6G A;  5FPU A;  2WNU B;  4I3P A;  4AR2 A;  5AC9 2;  3WQB A;  5A33 A;  2J7M A;  2WN3 A;  1VP6 A;  4BIO A;  1AXY A;  4XUO A;  1HV0 A;  2RE9 A;  4BK5 A;  2X5I A;  4LO4 B;  1SBD A;  2A3X A;  4FP3 A;  4MGZ E;  2XL7 A;  1LKN A;  1OC1 A;  4CUB A;  3CNA A;  3H7Y A;  2DWR A;  1D4V B;  1DLC A;  4DUW A;  4FFF A;  5F2S A;  3VKL A;  4Y4R A;  3QCW A;  5FZ8 A;  3ZYP A;  2VQ0 A;  4LTA A;  1OKQ A;  2BPA 2;  5AFE A;  1MZ5 A;  3OUI A;  1SPP A;  3LA3 A;  2NZ9 A;  2XON A;  3KV4 A;  1FOD 2;  5K9Y A;  1LTE A;  1BBT 2;  1W3X A;  4M3C E;  5KXB A;  1YLL A;  4AED A;  1VAV A;  4U36 A;  4LXL A;  2HWD 2;  2WNV A;  1W9W A;  4BIS A;  2D6P A;  2WLP A;  4LQR A;  4RL7 A;  2F6B A;  2J1E A;  4PQ9 A;  3THC A;  3ZKU A;  4R9B A;  4NOT A;  3WXP A;  1W6N B;  4GZ9 A;  4IE4 A;  1W03 A;  4IV3 A;  1N3P A;  4DIQ A;  2VQT A;  1GIC A;  2Z5W A;  2ZMN A;  3VDD B;  3VBR A;  4WVZ A;  4HKO A;  1C4R A;  4CCN A;  1D2S A;  1DU3 D;  1ZRE A;  4MGT A;  2WKK A;  1KS5 A;  3JBG 2;  1PVC 2;  1QNW A;  5JLV A;  1RUC 3;  3RZG A;  3LCP A;  4YW2 A;  4TN7 A;  4D7S A;  4BM8 A;  2HWE 3;  4U2A A;  3FBY A;  3AZZ A;  3U0Z A;  2A70 A;  2DVB A;  4BMB A;  2GME A;  1RUH 1;  5GLV A;  3B02 A;  4Y5T A;  3JB8 A;  3KVA A;  4YZ5 A;  4RS5 B;  2JG9 B;  4AQT A;  4QQL A;  1FMD 2;  4OZX A;  3BB6 A;  4XUR A;  1J83 A;  1CON A;  3ES1 A;  5T5P A;  5L9B A;  3RZH A;  3NVC A;  5C8C B;  2Y6G A;  1HB2 A;  1RJ8 A;  1S0B A;  2GN7 A;  4XVH A;  2ZGQ A;  4CU6 A;  5LY1 A;  1H9W A;  5BNN A;  1W9S A;  2DDU A;  4B7E A;  4C91 A;  2ADE A;  3FZ3 A;  1UY4 A;  3A4U A;  3OSD A;  4UOJ A;  1QKQ A;  5C3Q A;  1SCR A;  2DYC A;  2A6Z A;  5GM0 A;  4UXA A;  2B7Y A;  5LY2 A;  1ZRR A;  1BK0 A;  4NO4 A;  1RMU 3;  3OPW A;  3P1I A;  4ONU A;  1PIV 2;  4BQ1 A;  4UFH A;  1KFX L;  5BNO A;  1W2T A;  4XBN A;  4QKN A;  1UWW A;  4MGI E;  4P5Y A;  4CDX C;  2V73 A;  4CRQ A;  1RUC 2;  2H0B A;  2W92 A;  4R9D A;  5FMO L;  4QU1 A;  1J84 A;  3R4S A;  2ZMK A;  3TNQ A;  2VQU A;  4K8R B;  3CMG A;  1BBT 3;  4LKF A;  4MGK E;  2ID4 A;  3K75 B;  3CKH A;  1P8J A;  4H55 A;  2CGN A;  3AYE A;  5FK7 A;  2EID A;  1YFW A;  1A3K A;  3PLQ A;  4FPJ A;  4OUE A;  1H1M A;  4XDO A;  4JKM A;  2WNV B;  2WZE A;  3PTY A;  5GAL A;  2UYA A;  1OFS A;  4IE0 A;  4YNI A;  1W6N A;  3ASI A;  2GMM A;  1OA4 A;  3TEW A;  3ZLI A;  1OQE A;  2AUY A;  3H50 A;  4IV3 B;  1C8M 1;  4NPL A;  4W6X A;  5C70 A;  5H9S A;  2WT1 A;  3VDD A;  4E27 A;  1DP0 A;  4CDX A;  2HH9 A;  3WHU A;  4DUX A;  2BRT A;  2J42 A;  4DZG A;  2ET7 A;  1N3Q A;  2R1D A;  2JG9 C;  1OQD A;  4MV2 A;  4RHV 3;  4K6B A;  4AHZ A;  1UU5 A;  3TYJ A;  4V2W A;  3FLR A;  4YZ2 A;  1TEI A;  1Y43 B;  3EMR A;  5K8S A;  3HBK A;  3NNF A;  5F5I A;  4D7T A;  3ZXL A;  2VBP A;  4LHN A;  4ZS2 A;  5IJR A;  2EIB A;  2ZGN A;  3POE A;  4NWV A;  5FBJ A;  5FPB A;  1ZRI A;  3TEZ A;  2W1W A;  1OUR A;  4UFI A;  3O12 A;  1RL3 A;  2NP0 A;  2DVG A;  2W52 A;  5FQ0 A;  5FK8 A;  5JR2 A;  5FZD A;  1EAH 1;  3J7M A;  2QQV A;  4RQP B;  3AKQ A;  5JXG A;  4QX8 A;  5FZ7 A;  2IC1 A;  3H3Z A;  3KGL A;  3PU8 A;  1PX4 A;  1ENS A;  5EXO A;  2VL4 A;  4BQ3 A;  4AI8 A;  4ZS3 A;  4Q4Y 2;  1ZNP A;  1R1A 2;  3PIG A;  4W6W A;  5L9V A;  1VBB 2;  1RUI 2;  3W5M A;  2H6B A;  1EPW A;  4XET A;  2EVX A;  1BEV 3;  3ZSK A;  3KD4 A;  1SLT A;  1RHI 1;  4AAP A;  1NKG A;  2JDN A;  4BA6 A;  1QOO A;  1VRH 3;  3I54 A;  2ZAB A;  1N1S A;  5LA0 A;  2NN8 A;  1FPN 3;  3RPQ A;  2DV9 A;  1SZB A;  2UY8 A;  1S0F A;  3HNB M;  1CJD A;  1QQP 1;  2F4P A;  3KF5 A;  5DMY A;  4HXC A;  2VPV A;  1G7Y A;  1QQP 2;  5FP7 A;  1IS4 A;  1XNK A;  3NAP B;  4Q4V 1;  5FMC A;  3USS A;  1CJP A;  1UY2 A;  2VUD A;  1CIY A;  3U4X A;  5EJ1 B;  4HG6 B;  2DCK A;  3WP4 A;  2EIG A;  2QUO A;  2KD7 A;  2CYF A;  2B8M A;  3USU A;  1QJY 3;  4ORF A;  1HRI 1;  3WCR A;  2CDO A;  4QMA A;  4Q5O A;  5JR7 B;  1QMJ A;  2XXZ A;  4BQW A;  1JZ2 A;  3AFG A;  2ZHM A;  1U5Z A;  2AZ5 A;  2JDK A;  3PTR B;  2OYZ A;  5IAV A;  4YVW B;  2WFF 1;  3UNP A;  2E7Q A;  1UPI A;  4CEY C;  3ACF A;  5BUV A;  1QJX 1;  3KM5 A;  4FFI A;  4GIQ A;  5KR7 A;  1YHF A;  1LR5 A;  3I2G A;  3MIH A;  2AGS A;  5I0R A;  4QD2 A;  4KG8 A;  1Z78 A;  2D97 A;  2ZEZ A;  4TSV A;  4A7Z A;  4ISR A;  4LIU A;  3GCW A;  1FX5 A;  3ZKY A;  1CWP A;  5A7Q A;  1UYY A;  1B35 A;  4Q26 A;  2J1A A;  1OLM A;  2YUE A;  3I2D A;  3RDI A;  5C4W B;  1QNY A;  4IE6 A;  2GC2 A;  5HPO A;  4OZO A;  4BQY A;  2JX9 A;  2PMW B;  4OI1 A;  5CAD A;  2VW2 A;  4IEQ A;  1WD3 A;  1W6O A;  4IGO A;  4LO6 B;  4AI0 A;  4FOY A;  3PUR A;  4X6R B;  1HKD A;  1NQD A;  4S2H A;  5JPN B;  3OPT A;  1ZZC A;  5DAV A;  3CF6 E;  1G6N A;  2Y6J A;  3ACG A;  4JGZ A;  4D8M A;  1ND2 A;  3ZYI B;  5F32 A;  5FYI A;  2PTM A;  2A6W A;  2CY6 A;  4NPR A;  4P9I A;  2YY1 A;  3RZK A;  2NMO A;  3WEZ A;  4JZR A;  3LZZ A;  1HB3 A;  4R9A A;  1AYN 3;  2JB8 A;  2UU8 A;  2YBK A;  4XJ9 A;  4TZD A;  2WII B;  3VBU B;  1XNC A;  1RUH 2;  2CHH A;  2RR1 3;  4XAE A;  2O8O A;  3ZXG A;  2VMC A;  4CSW A;  1L7L A;  3HEI A;  3ETQ A;  3TOJ A;  4B3N A;  1FOD 3;  1W9Y A;  2FCT A;  1XPW A;  4AHY A;  3DKQ A;  2EA7 A;  4D6S A;  4OVE A;  3GDB A;  2G9F A;  3AXD A;  4AED B;  3MW2 A;  2W2I A;  1GWM A;  2J22 A;  5I0D A;  5EWS A;  3VHR A;  3POW A;  4PF1 A;  1U5Y A;  3AKP A;  1Y3T A;  3CLP A;  1K3I A;  2P3J A;  2W39 A;  5A6Y A;  4CZS A;  3MFA A;  3OB8 A;  3SMH A;  4UW6 A;  1K5M B;  3S5A A;  1IS3 A;  1VBA 2;  1OUX A;  4BQ2 A;  3H8X A;  1WWY A;  2VNO A;  3IIA A;  3SH3 A;  4D6R A;  3WDY A;  4FPF A;  2RR1 2;  4M4R A;  4XEZ A;  3MYX A;  3QAC A;  3UES A;  3URF A;  1D2Q A;  5GLU A;  3IZO A;  3LEG A;  3PUS A;  4A7Y A;  2Y33 A;  3MIC A;  3JQW A;  2YDE A;  4LBO A;  4QXH A;  2GDF A;  1QJZ A;  3ZMO A;  3B69 A;  5JCT A;  1U5I A;  2VUA A;  2LRP A;  4RS5 A;  4QPY A;  1WA6 X;  4LJH A;  3RFR A;  2VY0 A;  1UIK A;  2WO7 A;  4I02 A;  5FBZ A;  5FP9 A;  1UNB A;  1BZW A;  4KG0 A;  3ZXK A;  2OT7 A;  1MAC A;  3PIJ A;  4Y1V A;  3A21 A;  2XBO 1;  4I0A A;  5FZL A;  4QPG C;  4HON A;  3PUQ A;  4JX0 A;  2ZEW A;  3MO4 A;  3OEA A;  1LHW A;  3C7F A;  1RGS A;  4Q4X 3;  3VZO A;  4G4F A;  5FR3 A;  4XHB A;  1DZT A;  1V9U 3;  3K48 A;  5CBL A;  2CAU A;  2YU2 A;  3AC0 A;  1AYM 3;  1REE A;  4NPM A;  1PIV 3;  5FV3 A;  2XQR A;  5JMC A;  1AYN 2;  1NX9 A;  4K9S A;  1UYP A;  1VBA 3;  2W9X A;  2CWM A;  4PHZ A;  3S5Q A;  4AVC A;  3VBU A;  3ABZ A;  3AP7 A;  4ES9 A;  4YVW C;  1MS0 A;  1ZM1 A;  5DZF A;  2C1F A;  4N9H A;  2XVG A;  4BCU A;  1UW8 A;  2VM9 A;  1SFN A;  4MHU A;  1ST8 A;  2QQK A;  2JXA A;  5FYH A;  2HKX A;  3ZYR A;  4BJ0 A;  5DG2 A;  3NNJ A;  1VRH 1;  1PZ9 A;  3IDA A;  1UL9 A;  1PK6 C;  2A3Y A;  2VJX A;  1FV3 A;  2ZBJ A;  4AFB A;  3VV1 A;  2EAK A;  1LRH A;  2WA4 A;  5A6Z A;  1YXW A;  2WR9 A;  3VDD C;  4AI1 A;  5HI0 A;  3ZXD A;  4Q27 A;  4DRV A;  5IVB A;  4WZC A;  3LGR A;  1WMX A;  3LPG A;  4JQT A;  5LA1 A;  3H8O A;  3DEC A;  3V0A B;  4OYU A;  4OLL A;  4AFM A;  3POY A;  1ONA A;  1TME 1;  1SLB A;  2RMU 1;  2V5Y A;  1JUH A;  2PEL A;  5FYV A;  3CL1 A;  2GNT A;  4LUK A;  2E6V A;  2RMU 2;  5FFO C;  1GMM A;  2AAC A;  4Q8K A;  4EN8 B;  4K1Y A;  3AVS A;  1BLZ A;  5IWF A;  4XC9 A;  3NV2 A;  1IS6 A;  4DY3 A;  2QTW B;  3ZDS A;  4EYU A;  4AEJ A;  3POI A;  3KQ4 B;  1PO2 2;  5CZK A;  2P4E A;  1JZ5 A;  3J7L A;  1LOF A;  5FMD A;  2OVU A;  3AM2 A;  5TSW A;  2Y8K A;  4CU7 A;  4XF0 A;  2OA2 A;  5CNA A;  1JUI A;  5F9T A;  2V4V A;  1V6J A;  4P9X A;  4AE2 A;  1A78 A;  4L8Q A;  5CYY A;  5A3M A;  3RVH A;  1NYW A;  2C6S A;  4R8H A;  2AEY A;  5A70 A;  4KWU A;  1QJX 2;  4XFF A;  3O1O A;  1H8T C;  5A3O A;  4LBM A;  1IQD C;  4GH4 B;  1AF9 A;  3NV4 A;  1O4Y A;  1AX0 A;  2XLA A;  4MAD A;  5F5A A;  4AHX A;  3KCX A;  4DS0 A;  3O0X A;  1FNY A;  1DCS A;  4MXV A;  1J59 A;  4BU2 A;  2NQY A;  1TG7 A;  1VR3 A;  1GFF 2;  1WCD J;  1X36 A;  2JE8 A;  3T4H B;  4CDQ C;  1A8M A;  5JSR A;  1VB2 A;  3N7J A;  1WCQ A;  4LO7 A;  4BZ4 A;  3U14 A;  5F3C A;  1AR9 2;  1L7Q A;  2X05 A;  5EFU A;  1NY7 1;  5BYN A;  3M3O A;  3POG A;  2PAM A;  1UZY A;  3D6E A;  3NKG A;  3VD3 A;  4FPL A;  2ZCW A;  5F3G A;  1GZ9 A;  4BYY A;  4YWA A;  2CDP A;  1UF2 C;  4O9E A;  1HRV 1;  4XFA A;  5FZF A;  1YCI A;  3ZFF C;  5IVV A;  1ULE A;  3C8X A;  2JE9 A;  4KGG A;  4IES A;  3LDR A;  4S2D A;  1UY1 A;  3Q8F A;  5FYY A;  3TN9 3;  4E4Z A;  1AR8 1;  3I2J A;  3N4M A;  5FZ9 A;  1JN2 P;  1UQX A;  5APA A;  3WNK A;  2D5F A;  1ND3 C;  5C3R A;  2WQ4 A;  3HNY M;  2VXJ A;  2YYO A;  2HEW F;  2Z2S B;  1LUL A;  3K77 A;  5D2A A;  4KI5 M;  1UXZ A;  2IXK A;  3LSD A;  3T30 A;  2XJQ A;  3MUZ 1;  4NID A;  2VZP A;  1YI7 A;  2XH6 A;  3J7N A;  3M4F A;  5FY8 A;  3ORJ A;  3UK9 A;  4C0H A;  4B7K A;  5FO7 B;  3AKR A;  2ZXQ A;  4AGG A;  3IDC B;  3OF1 A;  3FBM A;  3MF9 A;  5C8W A;  3E6C C;  1RUJ 2;  3LOB A;  3BU7 A;  3IN9 A;  3J8F 2;  2BVB A;  2JDM A;  3IM0 A;  3PVB B;  1PGL 1;  1DQ2 A;  1RUJ 1;  1FMD 3;  3K3N A;  4GH4 C;  3VBR C;  3WF1 A;  2X09 A;  4H3W A;  1ZX5 A;  1XC6 A;  3N9L A;  1DLL A;  2ZGO A;  4L92 A;  1FAY A;  3LE0 A;  3ME2 A;  3B5L B;  2QQN A;  4AAX A;  4K20 A;  1AXZ A;  1OSG A;  1UD1 A;  3WP3 A;  4AI9 A;  2EIC A;  5C9A C;  1BK1 A;  5CVR A;  4HET A;  5L9R A;  3VZJ A;  4CCE A;  1JYV A;  3FUQ A;  4COV A;  1MZE A;  2Q0A A;  4N53 A;  4W50 A;  4XTM A;  3EBR A;  5FMB A;  1SLA A;  1RTV A;  3O1U A;  1T2X A;  4JRL A;  4JDN A;  2Z69 A;  3ZYG A;  3M3I A;  3KZ4 C;  1PVC 3;  3G7D A;  4FTB A;  5IK4 A;  3BVC A;  3GZE A;  5BNP B;  1IKP A;  4D3W A;  1OMI A;  1W8F A;  5D8A B;  2XKO A;  4CP9 B;  4BIF A;  3TBD A;  1VMH A;  2ZGS A;  4QPI B;  2JIG A;  4LPL A;  2RDQ A;  2WT2 A;  4XIK A;  2IXH A;  4PI2 A;  3WY6 A;  4ASK A;  5C5U A;  5HCA A;  3FWE A;  4JHT A;  3PME A;  3IB3 A;  1PNF A;  2QE3 A;  1YIF A;  4LBL A;  3P5B A;  3QD6 A;  3VD9 A;  3NJZ A;  3WNP A;  1RUF 1;  5SV8 A;  1O3T A;  1RIT A;  4CUA A;  1F8V A;  1NLQ A;  2K0G A;  1K5M A;  4Y20 A;  2ORX A;  4A6S A;  3NAP C;  3VHP A;  1G9A A;  1MZF A;  3GF6 A;  1WGP A;  4RGK A;  2AEZ A;  2D93 A;  2QVS B;  5T52 A;  5LW9 A;  3F2Z A;  4ZKT B;  4TTG A;  4ERO A;  4AVS A;  2VAU A;  4GXL A;  4D7Y A;  1RUH 3;  3KCY A;  2WA3 A;  5FO9 B;  4HOO A;  1XND A;  4BLI A;  4Q2F A;  1ZZ9 A;  2LTN A;  2HBT A;  1TNR A;  4CPB D;  4XBQ A;  3J8F 3;  1Q8O A;  4Z2A A;  3D82 A;  2E51 A;  3N36 A;  3A7Q A;  2FDH A;  2JDZ A;  1QHD A;  1ZBA 1;  1PHM A;  5A7P A;  4CCO A;  2QJV A;  5L36 A;  5FRE A;  3AYD A;  4UF0 A;  3ZDV A;  3X29 B;  4AVA A;  2FBE A;  4AQ2 A;  4WV8 A;  4YSF A;  4HSJ A;  2X10 A;  1SCS A;  2PYT A;  3S7I A;  4CCK A;  1KS4 A;  4KL1 A;  3MI8 A;  3CEW A;  4A3X A;  5IT6 A;  4B4R A;  3ECQ A;  4E2S A;  1OI6 A;  3VGI A;  3WX5 A;  1BYH A;  2HLE A;  1Z7S 1;  5A3T A;  3ILN A;  1STM A;  2RHP A;  4QPI C;  5E6H A;  3L2Y A;  5L7O A;  1IZ3 A;  1D7P M;  1SFY A;  2GAL A;  3CHX A;  2VTF A;  2R04 2;  5FZO A;  4OQ8 A;  2D6K A;  3WF4 A;  4P14 A;  3QH6 A;  3A22 A;  1ULG A;  1ULP A;  3CJI A;  3UKV A;  3T09 A;  4H14 A;  1I5Z A;  2BGO A;  5T54 A;  2RM2 1;  2ZAH A;  4XXA A;  3RQ0 A;  3U75 A;  4QX0 A;  4KWK A;  3ZX7 A;  2PA7 A;  2Y64 A;  5JMO A;  4YW4 A;  2XQX A;  1C8M 3;  3LIG A;  4DEQ A;  1ZBE 3;  4IEU A;  4XFC A;  2L9L A;  5FP8 A;  1JYI A;  3OGR A;  2PLV 3;  4GAZ A;  2IUW A;  4XMA A;  5BNP C;  1JHN A;  2QQJ A;  3IDB B;  1S2B A;  2FD8 A;  4HFS A;  4CU9 A;  4R4X A;  1RUO A;  5JPM B;  4IER A;  1QU0 A;  2IZW A;  4OHX A;  4S2G A;  1W8O A;  2P3Y A;  3E5U A;  3NO8 A;  4COY A;  3LEK A;  5EPA A;  4WVM A;  1MVQ A;  1UU4 A;  4N7U A;  1NY7 2;  4XJU A;  5IVC A;  1JYX A;  4FP2 A;  1K42 A;  1PO2 3;  4EQV A;  1J1L A;  1N1T A;  4KH9 A;  3HOB A;  5HV0 A;  1CAX A;  1SFP A;  2RS1 2;  3C7O A;  2ZGR A;  5SV5 A;  1WZX A;  2ZX4 A;  3EXU A;  3VDC A;  2JDA A;  4PJY A;  2VZQ A;  2HJI A;  2DVD A;  4LK7 A;  3VKM A;  1XJA A;  2QZ3 A;  3GYD A;  2KM2 A;  1GZC A;  4WBB A;  1ZBE 2;  5F39 A;  5FYC A;  1YQ6 A;  4Y26 A;  3SEP A;  1KEX A;  1EUT A;  3MV1 1;  1KFU L;  1DG6 A;  3ZPO A;  3P6B A;  2CGP A;  1SEF A;  1ALY A;  1E5R A;  2XBO 3;  3LEI A;  2WJS A;  3UT0 A;  4CCC A;  1CZV A;  2RDR A;  4LA2 A;  2F17 A;  3PJQ A;  4N7I A;  1ZYB A;  1RB8 G;  3WW4 A;  5J3U A;  2BFU L;  1LNS A;  1JU3 A;  1NE6 A;  1W06 A;  2O8Q A;  3ZYB A;  3NJV A;  3RWK X;  4TXW A;  4Q4V 3;  5FZE A;  1AR9 3;  1ASJ 3;  1OXC A;  2LS6 A;  4UBG A;  4URT A;  1O3Q A;  2E31 A;  1UZZ A;  2ZS6 B;  4FT8 A;  4AXO A;  3AFK A;  2GP5 A;  1CPM A;  2VO5 A;  3WF3 A;  1MVE A;  1S0C A;  2GH2 A;  4XQ4 A;  4A44 A;  3NKT A;  3JBG 1;  5HV4 A;  1IG0 A;  2I2S A;  5I0U A;  2R6Q A;  2FMD A;  2VZ1 A;  1LOE A;  2ZHK A;  4NRM A;  1R08 2;  5GZF A;  3HBZ A;  3ITQ A;  4XPV A;  3MW3 A;  3ATG A;  2ZGM A;  4KU7 A;  3CDZ B;  4RD7 A;  4AWD A;  4FPC A;  1X33 A;  4WVW A;  3ALQ A;  3WT3 A;  1HXS 3;  5IAX A;  1QOS A;  4F8A A;  5A3U A;  1D0H A;  3ENR A;  3ZYF A;  4OHW A;  5GZC A;  1PK6 B;  2BBV A;  2HWB 3;  3HPN A;  2B39 A;  4W65 A;  3T3Y A;  2VZT A;  2VME A;  5LRS A;  3LDB A;  1S0G A;  1W9T A;  3B3Q E;  3ZFE B;  3NMB A;  2JDP A;  2HEY F;  2WSU A;  1RHI 2;  2J1U A;  3F95 A;  2VMH A;  4DPN A;  4M3C B;  5FP4 A;  4MET A;  1CAU B;  5IYY A;  3T2O A;  2B9V A;  4W4Z A;  4PLN A;  4TLG A;  3D0J A;  4WM8 B;  4FAG A;  2MPF A;  1MS5 A;  5A1F A;  5KXC A;  5A6Q A;  4KWJ A;  2A73 B;  3EB7 A;  3LF7 A;  1S55 A;  1WUV A;  2J1V A;  3ACL A;  5FZ1 A;  5ABJ C;  3H42 B;  1ZZ7 A;  3KHB A;  2XJU A;  3VHN A;  4QX2 A;  5DZG A;  1COV 3;  1QH6 A;  2RG4 A;  2WIN B;  2CNA A;  3GBG A;  3N7K A;  4M01 A;  2W95 A;  2CGO A;  4Q4Y 3;  3H8R A;  1NCR B;  1RC6 A;  2WWS A;  4YM0 A;  1RMU 2;  2ORZ A;  1ASJ 1;  1W6M B;  2A5Z A;  2WRA A;  3AKT A;  1GNH A;  3LDK A;  3OUH A;  4MXW B;  1W2O A;  2FZ1 A;  2C0Z A;  2XJT A;  2YC2 A;  2OZJ A;  3AZX A;  2WN2 A;  1G9D A;  1OOP C;  2PHD A;  1XQN A;  2CWS A;  2VVD A;  1RHI 3;  3HQU A;  2HEV F;  3FMG A;  4JGY C;  3AK0 A;  3OBA A;  5A3W A;  4CDU A;  1I1E A;  4JV4 A;  3OBZ A;  5DXD A;  2D3R A;  1RUD 1;  2ZKN A;  1YC6 1;  1Y7B A;  3AKS A;  5BV6 A;  3PHM A;  5FAX A;  3VBF A;  2D6N A;  2NLR A;  1C5I A;  2RJK A;  2VMG A;  3KQR A;  2E26 A;  1G8W A;  4W6Y A;  3VZN A;  1CZT A;  3SEE A;  2BOI A;  4BH9 A;  1DQ0 A;  2JG8 A;  2HWF 1;  1H8T A;  4YRD A;  5LAS A;  5JVV A;  1IGO A;  5A32 B;  3CQO A;  2WUH A;  4F83 A;  2GH8 A;  3TB0 A;  2BWA A;  3WG1 A;  4UYB A;  5EP9 A;  4HN1 A;  3FE5 A;  3VBH C;  5LWB A;  1GZW A;  2DCJ A;  4H7L A;  1CAW A;  1MQT A;  4UI9 L;  3T0A A;  1EV1 2;  2ETE A;  3IAP A;  3U07 A;  2DU0 A;  5HXV A;  1JI6 A;  4ZHN A;  2ZGU A;  5FZH A;  1Q56 A;  2QQU A;  2WYS A;  1F4A A;  1WMF A;  3IAQ A;  3ACH A;  3PNA A;  3KVB A;  4MLO A;  4ZXE A;  3Q8C A;  2Q1Z B;  5J48 A;  4IND A;  2HWC 1;  5DUU A;  3B00 A;  2ES3 A;  4C1X A;  4DXS A;  1J3Q A;  2XGX A;  5EZW A;  1OF3 A;  4HL0 A;  2OQ7 A;  1RUE 2;  2WSV A;  4Q4X 1;  3ZXF A;  1PGW 2;  2HWE 1;  4OHZ A;  5GZG A;  4LBQ A;  4PF5 A;  5C7G A;  3JB4 C;  4XUT A;  3HIF A;  1COV 1;  1UMZ A;  4MUV A;  4V2V A;  4E4S A;  4IE5 A;  4CUG A;  4H2A A;  5CKM A;  4BQ4 A;  1PGL 2;  1JZ6 A;  4AQS A;  5A33 B;  4QB2 A;  1Y9M A;  5GZD A;  4AEM A;  4FPO B;  3O1V A;  2VUC A;  5H9Q A;  1DGL A;  1PVC 1;  2X29 A;  3BTZ A;  3ZIW A;  5JOY A;  1RYY A;  2ARB A;  5LA9 A;  1SDW A;  2RV9 A;  1U5X A;  3KGZ A;  3EO6 A;  3T08 A;  2UYB A;  4X8N A;  3M3C A;  3WNO A;  2ZA9 A;  3O1T A;  2V72 A;  4HZF A;  3S57 A;  4O65 A;  2EAL A;  4UBH A;  5BNN C;  3Q8A A;  1R09 2;  1BKZ A;  4W8J A;  3ZSJ A;  4IEZ A;  1SPP B;  4AVB A;  4B1L A;  4CXW A;  3POS A;  2YU1 A;  3TEX A;  5IFT A;  2NPI A;  3K2O A;  5JXJ A;  1GP4 A;  1ULD A;  1W6Q A;  5T55 A;  1F4H A;  2CV6 A;  3P3P A;  1W04 A;  5GKA C;  2YRO A;  1JW6 A;  2YGM A;  2XVK A;  4LMF A;  1FOD 1;  2JG8 B;  4LBK A;  5FJH A;  1XU2 A;  2BQP A;  1H8V A;  1XXN A;  5A32 A;  4HLT A;  4HKW A;  4FO9 A;  3OY8 B;  2PAK A;  1RUG 1;  1GSL A;  4XFG A;  4A42 A;  1WW7 A;  2ZPX A;  5T5J A;  4YM2 A;  2I45 A;  1X9T A;  2HWD 1;  3VUO A;  2CU5 A;  1G9F A;  2QQL A;  5CG8 A;  3WW2 A;  2B46 X;  3VBR B;  4PIY A;  2AYH A;  2MHF A;  3HAG A;  4AGV A;  4MH0 E;  3NV1 A;  1G9C A;  4BLJ A;  3BGA A;  1CZS A;  4WVM B;  5LCW L;  1BJQ A;  3VZM A;  2PHX A;  1UKG A;  4N8M A;  4LHK A;  4QHB A;  1JXN A;  1LGC A;  2FDJ A;  1Q8Q A;  4COZ A;  2BDR A;  3VKO A;  1H4G A;  3R0R A;  1NCQ B;  4GJZ A;  1CAX B;  3PVO A;  4X8P A;  2Y60 A;  5DDJ 2;  1IHM A;  4BE3 A;  1V70 A;  4TYS A;  5FUI A;  4OUS A;  3AB0 A;  4FSJ A;  2ILM A;  2CAV A;  5LZ6 A;  1O7F A;  1VBC 2;  1RVF 1;  1WCU A;  1XSR A;  1C8M 2;  4V1P A;  3O1M A;  2FCV A;  5LK5 A;  5FKC A;  5C3S A;  2BP6 A;  1Y4W A;  2YC0 A;  2VMD A;  5GLW A;  1NUK A;  1UOJ A;  1QXJ A;  2Y0O A;  1V9U 2;  2ZX0 A;  4ARX A;  1GOF A;  2VZU A;  5D21 A;  2OW4 A;  4FFH A;  2BOJ A;  2BYV E;  2ZOE B;  4P08 A;  3VL9 A;  4AQ6 A;  5FO8 B;  3O0V A;  1YIP A;  5EV7 A;  3JD7 3;  4MSV A;  3BCW A;  4YFZ A;  1KGY A;  1UZV A;  2XWB B;  3FC0 A;  3LOI A;  3VBH B;  1QJE A;  2EIE A;  2R30 A;  5IVJ A;  1BXH A;  4DRR A;  4PDW B;  2QNK A;  3R6S A;  3NV3 A;  4NHL A;  1XE8 A;  1ZRF A;  2VVE A;  1KIT A;  3I97 A;  2PLV 1;  1W2U A;  1S0E A;  4CCJ A;  3LIH A;  4DXT A;  4A6O A;  4Q0S A;  4CCL A;  3CZJ A;  4XCA A;  5JOX A;  1S2K A;  1L3J A;  4QX7 A;  3ZYH A;  1VBD 3;  1KRI A;  4ET7 A;  5KHJ A;  2WFF 3;  2RM2 3;  3G6J B;  1DBN A;  1CIW A;  1YNA A;  2Y0I A;  4FCA A;  4PBP A;  5CKN A;  2IVJ A;  3MDP A;  1VAK A;  3H8U A;  2P5B A;  1OT5 A;  4Z1V A;  3NNG A;  1OKO A;  5FLJ A;  4S2F A;  5JDB A;  5FZ6 A;  1H2L A;  3PL0 A;  3WW3 A;  3DXU A;  1W2N A;  5HBA A;  2BEO A;  3I3M A;  1H1A A;  4CDW C;  2YZ4 A;  3RZZ A;  1V6N A;  4RHV 2;  1XNA A;  1GNZ A;  1GOG A;  2BER A;  5C9A B;  3N7L A;  3DPR B;  4D0Q A;  2VXR A;  1V00 A;  4Y22 A;  2Q8O A;  4Q4V 2;  4YG3 A;  1CAU A;  1KQR A;  5FXV A;  2ZX3 A;  3SCF A;  3WNM A;  2QZ2 A;  3VBS C;  2SBA A;  3O7O A;  1RUJ 3;  5B2G B;  3WZ1 A;  4COW A;  4EWE A;  5FPA A;  4QXC A;  1NG0 A;  4NWW A;  5FY7 A;  3V65 A;  5HCH A;  1HRI 2;  5CG9 A;  1REF A;  1S0D A;  2VNG A;  3LSE A;  1YQC A;  4NR1 A;  2LRO A;  1QJY 2;  2WO3 A;  2ZGK A;  1YUD A;  2ZX2 A;  2IFR A;  2Y38 A;  4FPH A;  2WNU A;  4IQP A;  3KT1 A;  4XJW A;  5B4N A;  3BYW A;  4B8E A;  4UFM A;  5DAW A;  5KHH A;  2AEN A;  3OGJ A;  2C9K A;  4K3U A;  4JAA A;  5FIX A;  2BFU S;  1GP6 A;  2QBX A;  1UU6 A;  3MUY 1;  2YB7 A;  1MZ6 A;  5G05 L;  4PLM A;  3IKW A;  4ATE A;  2PQS A;  3PJY A;  1W6M A;  4LK6 A;  3JU9 A;  3M2M A;  2HWC 2;  1RUI 3;  4EV0 A;  5KXE A;  1V6L A;  1JU4 A;  3QLQ A;  4Q1P A;  3WUD A;  2DVA A;  2YBP A;  2W68 A;  1BMV 1;  5FY1 A;  1GKB A;  2W3J A;  1AR7 3;  3DV8 A;  5IW0 A;  2PQQ A;  2R0H A;  4PQQ A;  3SC7 X;  1PO1 2;  4IE7 A;  4P9W A;  1O3S A;  3ZFF A;  2PHF A;  2RS5 3;  2WYF A;  2W1S A;  1VBD 1;  4KMQ A;  3BAL A;  3AP6 A;  5CFC A;  3THD A;  3RZJ A;  3B7M A;  2XUE A;  5A7W B;  1LOC A;  5T50 A;  4ATF A;  1DGR A;  1OA2 A;  1WBL A;  2Y34 A;  4WM8 C;  1V6I A;  4IDZ A;  2R06 3;  3UET A;  4AYU A;  1QXP A;  4CXX A;  4AFC A;  3MLL A;  2WS9 3;  1RIR A;  1MS1 A;  3MZH A;  1PNG A;  4J1X A;  4FOQ A;  1LHV A;  1RIN A;  2FDK A;  3AMM A;  5F5C A;  4JRA A;  1NAE A;  1LHO A;  4FTS A;  2E9Q A;  4DFS A;  5ACA 3;  5ISL A;  2A71 A;  1CGP A;  4ITC A;  3M1H A;  1W6P A;  1ZBA 3;  3AMH A;  3DPR A;  4NHX A;  3WIN E;  3T4V A;  4PBO A;  5LBF A;  3RG0 A;  2XJP A;  3CO2 A;  5C71 A;  2Y6H A;  5FYZ A;  5I8S A;  3OJB A;  4MO3 M;  2JD4 A;  4BK4 A;  2JG9 A;  1JZ4 A;  1LCL A;  3RI9 A;  1JOJ A;  4LBQ B;  2ZEY A;  3PVN A;  1OVS A;  1W39 A;  4I01 A;  1DHK B;  2BTV C;  1W6O B;  1OQ1 A;  2R07 1;  1W0P A;  4HBN A;  2VE1 A;  1W8N A;  3NW4 A;  3UJQ A;  2ERF A;  1MEC 1;  1DZQ A;  1CN1 A;  2ZGT A;  2Q8D A;  3SQO A;  2TUN A;  4NMI A;  3WW1 A;  5BY5 A;  1UX7 A;  1AL2 1;  3I59 B;  1MEC 2;  2UWA A;  5F3I A;  1RXF A;  1VBA 1;  5FZM A;  1GAN A;  3DGT A;  4F3J A;  1POV 1;  4Q4W 1;  2OS2 A;  4KNC A;  5JIA A;  1F35 A;  1O3R A;  3VD4 A;  2WZR 2;  4Q4W 2;  3N7M A;  3GJA A;  3U4S A;  1WW5 A;  4QX1 A;  4EN6 B;  5BNO B;  1RJ7 A;  5FOB B;  5DDJ 1;  1O5L A;  5D1I A;  4I2O A;  3U37 A;  4Q29 A;  4EWD A;  4KGQ A;  4QQP A;  1ASJ 2;  1OPO A;  3MGU A;  3QH7 A;  3SCH A;  4NJ4 A;  4LA3 A;  3ZFG A;  1UYX A;  4NRQ A;  3BTX A;  4QQ2 A;  1VE0 A;  2VR4 A;  1AR6 2;  4K1Z A;  1HLC A;  4XF1 A;  5CFC B;  1OA3 A;  2XR4 A;  1ENX A;  4HSL A;  3ZN6 A;  2O14 A;  4NHM A;  4XBL A;  1LGB A;  3HR9 A;  3IPV A;  3DCQ A;  2RDS A;  4QT6 A;  2HYK A;  3GZT B;  2DFB A;  2E33 A;  1YYN A;  5FOJ B;  3MLJ A;  3TWI A;  3ZR6 A;  2GN3 A;  1M4W A;  5FZK A;  1WLW A;  2YPD A;  4KQ7 A;  3VDB A;  1W3V A;  5FKB A;  4XFI A;  2UUR A;  2Q5T A;  3J26 N;  3ZM8 A;  4BOW A;  1C57 A;  2VCA A;  2ZGL A;  4UAP A;  1Z0H A;  5DUV A;  4DEV A;  4R4Z A;  5L73 A;  1RXG A;  1SMV A;  1J3R A;  4QAW A;  1NXD 1;  4LLO A;  5KHI A;  2I74 A;  3BPS A;  3CU7 A;  1W6P B;  2BVV A;  1ZA7 A;  3SCG A;  2BWC A;  1NCQ A;  2C4X A;  3T2Q A;  3D0S A;  1R09 3;  1VBC 3;  5FXX A;  4UW4 A;  3H1W A;  4XIO A;  1DGW A;  4PT6 A;  5F1R A;  1NA1 A;  2IXJ A;  4LIT A;  4YVS A;  2P17 A;  2BV4 A;  1X7N A;  4XOG A;  1Q43 A;  1VBB 1;  2OII A;  2ZHN A;  2VCC A;  4CUC A;  2SLI A;  1S0J A;  1K5J A;  4IEX A;  1S2E A;  1UZW A;  1XSQ A;  3I3D A;  3EYP A;  1PZ7 A;  4AHW A;  1CVN A;  3JD7 1;  2XBO 2;  4I3G A;  3FJS A;  5FPL A;  5FY9 A;  3FUO A;  4UFL A;  4YGD A;  3VHO A;  4QHZ A;  5FYU A;  2BNO A;  1QXR A;  4P9J A;  4XUP A;  4GAL A;  1POQ A;  5FLH A;  1HXS 2;  2EXJ A;  4ISQ A;  1LOA A;  4QM9 A;  5FZB A;  3BIE A;  4ZZ8 A;  2GND A;  1I5P A;  3MHZ A;  2VH9 A;  1OHF A;  1O4T A;  2D43 A;  4PDW A;  4Q8L A;  5A3N A;  4Z2W A;  3C2U A;  2F4L A;  3C3V A;  5J37 A;  3JXS A;  2W08 A;  4LE4 A;  3ST7 A;  4R9C A;  1UKR A;  2VMI A;  3VD7 A;  3IPV B;  1DGR N;  2WFF 2;  3NJX A;  1UO9 A;  4L0P A;  3AJY A;  4ES8 A;  4NIH A;  2WO2 A;  5AC9 3;  2VBB A;  1V6O A;  3FHA A;  4I0B A;  5EJZ B;  2YC4 A;  3N9Q A;  2JE7 A;  1ZBE 1;  2R49 A;  2V09 A;  4KWL A;  1D4M 1;  1NQJ A;  4SLI A;  3ZR5 A;  4NII A;  1D4M 2;  2GU9 A;  4GMP 3;  4IV1 A;  3WDV A;  5A3L A;  2MEV 2;  1RUG 2;  1UMI A;  2VC9 A;  1SBE A;  2JJ6 A;  3LWC A;  2OPW A;  4QKB A;  4XFB A;  3RI8 A;  4QDR A;  2VTX J;  3LA2 A;  4RS5 C;  1F2N A;  2R04 3;  1ZRC A;  1QF3 A;  2Q30 A;  1LES A;  3OEB A;  1TME 2;  4FPK A;  1XNB A;  5G04 L;  5EQU A;  3KS7 A;  4JGZ C;  3WG2 A;  4IGQ A;  1LOD A;  2DUQ A;  2VU9 A;  3OD0 A;  1JYW A;  3V64 A;  1LEM A;  2JKX A;  3H9A A;  5K0U A;  5HCB A;  1HRV 2;  2VCB A;  4LUL A;  1PO2 1;  3T2P A;  4NUB A;  1AR8 2;  2O1Q A;  2V4A A;  5LBB A;  4DXZ A;  3AMP A;  2FMY A;  1FV2 A;  2JDU A;  3Q8E A;  5FP3 A;  4GWJ A;  2IXC A;  4YZ1 A;  5BNN B;  4M0H A;  5CB7 A;  4QB6 A;  4CP1 A;  2Z4F A;  1DQ1 A;  5JOZ A;  2X8K A;  3WG3 A;  2EXK A;  5FMO S;  1VAM A;  4HN0 A;  3FFQ A;  3ZSE A;  3N9N A;  3H1Y A;  2GC3 A;  1XYP A;  3K4A A;  2W47 A;  4BPZ A;  4EE2 A;  1LU2 A;  3ZN5 A;  2ARE A;  4OI2 A;  3P3N A;  2DUR A;  5AVP A;  2P3K A;  3GM8 A;  4WM7 A;  3I3E A;  5IK7 A;  1GLH A;  3TAY A;  4LOR A;  2CL2 A;  1HIX A;  1QH7 A;  1IQA A;  2RS3 3;  2ZAC A;  1GU3 A;  4DIN B;  3ZSM A;  2GC0 A;  2QFE A;  3UJO A;  3RMY A;  1HN1 A;  2WFP A;  4HKL A;  4LOT A;  3WNL A;  5A7S A;  5FRA A;  1AR9 1;  5B4X A;  3B94 A;  2VTX A;  2ZTN A;  5H9R A;  5FYM A;  3OGS A;  4P9G A;  3WP5 A;  1WD4 A;  4GMP 1;  2XWJ B;  4B29 A;  4XIL A;  5IVF A;  3HMY A;  4GUL A;  1QOT A;  1LHU A;  2Q1M A;  2JD9 A;  3HT1 A;  4LLF A;  2VOW A;  4BXF A;  5KHG A;  3I8T A;  4IV1 B;  5JSO A;  4CYD A;  1BCX A;  3ZOI A;  5F37 A;  4YW5 A;  4XE9 A;  3U11 A;  3UGG A;  3AXE A;  1F15 A;  1FI2 A;  1BEV 2;  3CJI C;  1MPX A;  4I09 A;  4RA0 A;  1RUF 3;  1QGL A;  1X8E A;  3HQX A;  5K7P A;  1FPN 2;  5EHD A;  2GP3 A;  2P1B A;  1VIW B;  1PM7 A;  3GGL A;  1L7R A;  3S6P A;  3WR0 A;  4HVR A;  3I4I A;  5CA6 A;  1X50 A;  5E16 A;  3PVE A;  1C28 A;  5DAQ A;  2VQA A;  1AXK A;  2DBI A;  2A6X A;  2QDR A;  3C7H A;  3LKJ A;  3L9J T;  3MIE A;  2YFU A;  3RJ2 X;  3S30 A;  4ZZ5 A;  4Q0Q A;  4OHY A;  5EYY A;  1FAT A;  1OF4 A;  4OFG A;  3MW4 A;  3B01 A;  3D8C A;  3NRU A;  1LED A;  2KR2 A;  1XBF A;  3GBW A;  3I59 A;  1QDC A;  4IEY A;  4XF3 A;  3PUA A;  1S0I A;  4YM3 A;  3LA7 A;  1JOB A;  1H4H A;  2UWB A;  3N9M A;  3NQH A;  5FY0 A;  1TE1 B;  1XNT A;  2JDH A;  2K46 A;  4C1W A;  1VRH 2;  2RVA A;  3I49 A;  1H6Y A;  5A80 A;  1H0B A;  1SG3 A;  2MNG A;  4Q4Y 1;  5LBE A;  5E1R A;  3CJX A;  1UIJ A;  2BGP A;  4JTO A;  1W8U A;  4XZU G;  1TVG A;  3I3Q A;  1O8S A;  5ABJ B;  1OFN A;  5D8A A;  3ZVX A;  2PFW A;  2VMF A;  3MF6 A;  1RUN A;  4QM8 A;  3D4K A;  1PZ8 A;  2XVL A;  4J1W A;  4F7Z A;  3ZN6 B;  4B4Q A;  4YYO A;  4QB1 A;  4UFJ A;  1ND3 A;  4DUV A;  3BKZ A;  1AL0 G;  2TNF A;  5JOW A;  3NST A;  2WC2 A;  1AJO A;  2RS5 1;  5DUW A;  2FDF A;  4UWD A;  4WVV A;  4YG0 A;  3SKV A;  1COV 2;  5J36 A;  1XOY A;  3OG2 A;  4KBB A;  5DAB A;  1AUY A;  1Z7S 2;  1HXS 1;  3V0A A;  1SBF A;  3POB A;  4P02 B;  5FPX A;  1I9R A;  1UYZ A;  4YVW A;  4NIG A;  2HWB 1;  4C90 A;  3HN1 A;  3VLB B;  4YGC A;  4MHR A;  2VZO A;  1SLL A;  5KC5 A;  1HV1 A;  2WZR 3;  3KT7 A;  1ACC A;  4JC1 A;  1DF0 A;  1H6X A;  2WBK A;  3BIW E;  5A6X A;  4BDV B;  2A1X A;  2BUK A;  3I3B A;  3NNL A;  4IET A;  4XQD A;  1RED A;  4RR3 B;  4A41 A;  5AVA A;  1RVF 3;  3CBN A;  1FMD 1;  4P00 B;  4LT5 A;  3T1M A;  2DTY A;  1IOA A;  1G86 A;  3E1F 1;  1B35 B;  2YMZ A;  4QKD A;  2OUH A;  4DY5 A;  2R32 A;  4CEY A;  3HN3 A;  2KA3 A;  1H2M A;  3UGF A;  3NWK A;  2W0X A;  1TMF 3;  2D6O X;  5C8C A;  3MPP G;  1RUD 2;  3Q9O A;  5F6L B;  1W8T A;  2H6C A;  4XZP A;  4FFG A;  1F5F A;  1ND2 B;  2E7A A;  2W1Q A;  4NAO A;  4QGN A;  5DQ0 A;  4MG2 A;  2Q1F A;  2DU1 A;  3WVJ A;  4GH4 A;  3E6D A;  5KBF A;  2QQP A;  4CTE A;  3KCC A;  4N43 B;  4XTP A;  4UFK A;  5DPN A;  3ZXE A;  4M3C F;  1F9K A;  1T6B X;  3SIT A;  2JKB A;  5FZG A;  1GYK A;  1W05 A;  1YQ2 A;  2P34 A;  2GNM A;  3KV9 A;  2XJV A;  1HJG A;  5ANN A;  5FZO B;  1IPS A;  1DQ4 A;  1GBG A;  3FN9 A;  1Q8V A;  2EAA A;  2PHW A;  3CJI B;  4YW7 A;  4E2Q A;  3KWV A;  1AR7 1;  5FZA A;  3WV6 A;  1GNY A;  1KJL A;  4N9I A;  4JDO A;  3H1M A;  4QDS A;  4XJA A;  5FZ3 A;  5T5L A;  4OI4 A;  4CU8 A;  5C3O A;  1AJK A;  3AYC A;  4NHK A;  1OBN A;  4QXK A;  3KT4 A;  4XYX A;  2RM2 2;  1NXM A;  4CPB A;  4QKF A;  2R06 2;  5JI9 A;  3I2H A;  2JEM A;  3ZN4 A;  4RFT 0;  4LNV A;  2R06 1;  2WS9 2;  3WNN A;  3O5S A;  2QDN A;  5T5O A;  1WBF A;  5HCF A;  3THT A;  5J7M A;  1XE0 A;  3R4U A;  2WS9 1;  4CDX B;  3H3U A;  3ZSL A;  1QY4 A;  1ZZ8 A;  4FAH A;  2CSG A;  4QU2 A;  2AC1 A;  4JDM A;  4OUM A;  2J1S A;  3SIS A;  1JS9 A;  4DMI A;  3AL6 A;  2JIJ A;  5K0U C;  1TNF A;  3J8F 1;  4Y24 A;  4L99 A;  4XAC A;  5F3E A;  4GA9 A;  3WP6 A;  2VZS A;  1LAJ A;  1LB2 A;  4RR3 A;  5LA2 A;  3WSO A;  1APN A;  4GKY A;  1V6M A;  1S1A A;  1UY3 A;  3VBU C;  5JUV A;  2LW8 A;  3L2H A;  2A75 A;  4IUG A;  4XXP A;  4Y1U A;  4EN9 B;  3ZFE C;  2WQZ C;  1AZD A;  3UV9 A;  5BNO C;  1TMF 2;  4CEY B;  3BU0 A;  3OYW A;  5CIR A;  5FQ0 B;  3UKN A;  2BBA A;  2ZGP A;  1EUU A;  1R1A 1;  2VZV A;  4RQP A;  3RMX A;  1AYM 1;  3I2K A;  1Z7S 3;  3HJR A;  4JGY A;  3AX4 A;  1RUI 1;  3TRS B;  3GAL A;  2BZD A;  1W28 A;  3WUC A;  4CVU A;  4YG6 A;  2Y26 A;  2WNV C;  1VBB 3;  1BEV 1;  4A3Z A;  3WNX A;  4N43 A;  2A6V A;  4HPK A;  1FPN 1;  4Q4W 3;  5FYS A;  2VG9 A;  3POF A;  2ZEX A;  2VD7 A;  2IFW A;  2MEV 3;  3A23 A;  4XFH A;  3JD7 2;  2V5D A;  4HVO A;  2E63 A;  5JZG B;  4GB3 2;  4PCR A;  5FZC A;  1XRU A;  2I07 B;  3ROU A;  2OKX A;  1UAI A;  2P2K A;  1ODM A;  1PO1 3;  1E57 A;  2XLG A;  4JHZ A;  1AYN 1;  4OCT A;  1ULC A;  1YJL A;  3LD8 A;  4JTN A;  4GJY A;  4YAR A;  5AC9 1;  3O1S A;  3ACI A;  2XML A;  2LUW A;  1JBC A;  4QQH A;  4HT1 T;  3NAP A;  1O59 A;  2TBV A;  1JH5 A;  2N7G A;  5F6K A;  3IT8 A;  3J4U H;  4M00 A;  4EZ4 A;  2ATF A;  3AZV A;  1RUD 3;  4J25 A;  2PHT A;  1GZT A;  2PXJ A;  2DCT A;  5CKQ A;  5E8A A;  3FLT A;  3USU B;  3ILF A;  5FZ4 A;  2WZP P;  4ZY9 A;  3UKT A;  1N47 A;  1VB4 A;  3JZV A;  3ZPY A;  1KXG A;  3JUU A;  1QJX 3;  4CDU C;  4GQ7 A;  3WDX A;  2XOM A;  4ZU4 A;  4K40 A;  1NOV A;  1O91 A;  5A7N A;  4QPW A;  5C33 A;  4L11 A;  3PU3 A;  4Y20 B;  1UZ0 A;  3BI3 A;  2WLQ A;  1PK6 A;  5IUQ A;  2GZW A;  4KBZ A;  2FDI A;  3INA A;  3B93 A;  3TEY A;  2B5H A;  2P37 A;  2LM3 A;  5LEK A;  4YGE A;  1GP5 A;  3A0N A;  3ZXA C;  3AMN A;  4AFD A;  1DDL A;  1JZ8 A;  3IWZ A;  2D7F A;  5KC6 A;  5A7O A;  4YLZ A;  2E32 A;  1WLC A;  4FOV A;  4Y3O A;  2WNU C;  4CDQ A;  2ZML A;  5C4W A;  1QEX A;  2Z42 A;  3VZK A;  4QHO A;  4AI2 A;  3GHM A;  2D98 A;  1BVP 1;  1AR6 3;  1X82 A;  1VBD 2;  3HQR A;  3OYW B;  4D6Q A;  4UF0 B;  1FXZ A;  2QKD A;  1W9F A;  1YI9 A;  2BGC A;  2Y6F A;  3DEM A;  3S0M A;  1OLR A;  4FXK B;  4K8F A;  4MGQ A;  4XMI A;  4FXG B;  4JGZ B;  4XHX A;  3TN9 2;  5C3P A;  5KHK A;  1EV1 1;  3WD5 A;  2XL9 A;  4K7J A;  3V0B A;  4NIA A;  2TEP A;  3RYK A;  4RN5 A;  2E7T A;  1XYN A;  3LB9 A;  1NCR A;  4QWN A;  2DUO A;  1K45 A;  2J1T A;  1LGN A;  2A7A A;  5LRR A;  3I2O A;  5L7O B;  4G3Y C;  1SQ4 A;  4JVA A;  4UT5 A;  1BQP A;  5FXZ A;  3SLI A;  1DYK A;  2E53 A;  2W46 A;  4OUL A;  3MIG A;  4QPG B;  3E5X A;  1PGW 1;  2HWE 2;  5ABJ A;  1HX6 A;  3RYP A;  4PI0 A;  2R7E B;  3B9C A;  3EHK A;  5BXX A;  4BHP A;  1DFQ A;  4LOS A;  4Q0U A;  1ND3 B;  5FYB A;  2W5F A;  2VOK A;  1B09 A;  1YO8 A;  2HWD 3;  4QDQ A;  2B45 X;  1HQW A;  3AYA A;  3KV6 A;  4HK8 A;  1H8T B;  4IGP A;  5EYX A;  3I7D A;  3W20 A;  4N90 A;  2YV8 A;  1HQL A;  1WME A;  2ZAA A;  4DQA A;  1RUC 1;  4OI0 A;  1UN1 A;  4MGY E;  1MS3 A;  4YZ4 A;  2HWF 2;  5IK5 A;  2VW0 A;  2VBD A;  3E97 A;  1D4M 3;  2ZZJ A;  3DUI A;  1MQT B;  1DQ5 A;  3VD5 A;  1C5H A;  2VUJ A;  3O14 A;  2RS1 1;  4FOW A;  5IHR A;  3FX3 A;  4H7M A;  1R09 1;  1YFY A;  1AR7 2;  3HT2 A;  4AVV A;  4D94 A;  5CFD B;  3DYO A;  4E4H A;  4QQO A;  5ACA 1;  3W58 A;  4DOU A;  1DQ6 A;  1DZR A;  1ULO A;  4NHY A;  5F5Q A;  2Q4S A;  4A45 A;  1GQP A;  5HXM A;  3WDT A;  4QX5 A;  5FWE A;  1RUE 3;  3RSJ A;  2D40 A;  2HYX A;  3FFZ A;  4NVP A;  3MBW A;  4Y4Y A;  2C26 A;  4KU8 A;  4TLF A;  1G9B A;  5JIU A;  1ZVF A;  1CAV B;  4ZON A;  4E8D A;  4E9K A;  1QJF A;  1EAH 3;  1GQG A;  3ES4 A;  4LKD A;  3AJZ A;  2VCM A;  3OGV A;  5IAT A;  3FHQ A;  2EF6 A;  4CDW A;  4B1M A;  2ENR A;  4Q0P A;  1KDK A;  2BU9 A;  1JZ3 A;  4UW3 A;  3VBF C;  1W0O A;  4M4P A;  2VVF A;  4JCK A;  2B4K A;  2WT0 A;  3LFI A;  3I2I A;  1CR7 A;  1ENR A;  1W90 A;  4YW1 A;  1V0A A;  2XHK A;  1ND2 C;  5BNP A;  3MLK A;  4AEK A;  3AP4 A;  4HAN A;  3K51 A;  4GWN A;  4Y1Y A;  4CA9 A;  3SH4 A;  4CP9 A;  2ZJC A;  1URX A;  1IG3 A;  3RGB A;  4JKL A;  4YW3 A;  4X6Q B;  1UMH A;  4ZU7 A;  5BNQ A;  4GKX A;  1QQP 3;  2NM1 A;  1E5H A;  4LR4 A;  4NAM A;  5FUP A;  1YQ8 A;  1JOD A;  2FDG A;  3OCP A;  3EQE A;  2ZKL A;  2Y6L A;  4IXL A;  3WF2 A;  5J1X A;  3AVR A;  4AFA A;  5J09 A;  1LOG A;  2RDN A;  5FLI A;  3DXT A;  1FT9 A;  4FQZ A;  2IWG B;  5IFP A;  4LBQ D;  3JCI A;  3RYR A;  2W87 A;  2DBN A;  1Y9Q A;  4GB3 1;  2R07 2;  4Y5Z 0;  4AOC A;  1JHJ A;  1RUG 3;  4IEV A;  1OLQ A;  3WQ7 A;  1HW5 A;  2PHR A;  5LAT A;  2C24 A;  3RJR A;  3OPZ A;  1ZZ6 A;  2K2S A;  1N3O A;  2HWB 2;  1LOB A;  1W8W A;  3DYM A;  3LPF A;  5D8A C;  1RUF 2;  4LHL A;  5FYT A;  3VDA A;  1XE7 A;  4R52 A;  2WZR 1;  4M3C A;  2FQP A;  2LAL A;  5CEH A;  3U1X A;  1A34 A;  2RS3 2;  1I6X A;  3MID A;  3VBO B;  1UOG A;  3ZMN A;  3GZU C;  1VAL A;  2BNM A;  1ZRD A;  2ARA A;  5AFB A;  4P9Y A;  1K5M C;  5FPV A;  4LO8 A;  3N35 A;  4CP0 A;  5JXH A;  4EN0 A;  2WWU A;  3ZYJ B;  3BPZ A;  1CAV A;  4JGY B;  3R4D B;  1VBC 1;  2KXL A;  1JMU B;  1PGS A;  1UPS A;  1AR6 1;  1WW6 A;  2W1U A;  4IEP A;  5KXD A;  4LEJ A;  1IS5 A;  1HQN A;  4CDW B;  3PDQ A;  5FZI A;  4HPK B;  3W21 A;  4IEW A;  4RSU A;  5F2W A;  3WDW A;  3SH5 A;  1V9U 1;  5JZG A;  2YGL A;  3VBS B;  4G9S B;  1QWR A;  4OQ9 A;  4BME A;  3C7E A;  2JB4 A;  4E8C A;  5FWJ A;  4XW3 A;  1US3 A;  4MX3 A;  4A7K A;  4PIZ A;  3DKW A;  4LBN A;  1QJY 1;  3J7H A;  2NMN A;  2B9U A;  3C7G A;  1WCK A;  3VBF B;  3R05 A;  3TN9 1;  3AP5 A;  2P3I A;  3OOX A;  2PLV 2;  4OMC A;  5FY4 A;  2VGD A;  4IV1 C;  4FTE A;  4EZH A;  3WLU A;  1T6G C;  1YEW A;  2BJS A;  2C9A A;  3CIH A;  3LQC A;  3MIB A;  3W59 A;  1UOF A;  2OQ6 A;  2VEC A;  5L19 A;  4CP2 A;  4M0N A;  4BQX A;  4NE9 A;  4EJR A;  3HVD A;  1H2K A;  1VPH A;  5JZG C;  1H2N A;  1PVX A;  3FHI B;  2GC1 A;  3BN6 A;  3OGG A;  3THP A;  5CFC C;  2X5I C;  4CEW C;  3FLP A;  5DN2 A;  3ZFG C;  5C4W C;  3SXW A;  1EPZ A;  4NRO A;  1TME 3;  5CAZ A;  4XUN A;  4HVQ A;  3GJB A;  2IXL A;  1IPK A;  4AG4 A;  5C9A A;  1H1I A;  1HN0 A;  1N1V A;  2JWP A;  3BTA A;  3K3O A;  4DXR A;  1HJF A;  2RS1 3;  4CDQ B;  4RYD A;  3RZL A;  2XKP A;  1AX1 A;  2PHL A; 
#chains in the Genus database with same CATH homology
 4TN7 A;  5FZO A;  4LIV A;  5FZL A;  4HON A;  3PUQ A;  5FP7 A;  5A7S A;  3PU3 A;  5A1F A;  5A3P A;  2YU2 A;  4Y33 A;  2YBP A;  3N9P A;  3KVA A;  5FV3 A;  5IVY A;  5FY1 A;  5FZ1 A;  3NJY A;  5FXX A;  5FYM A;  5FY8 A;  3U78 A;  4CCM A;  5LWB A;  2XXZ A;  5IW0 A;  5A7O A;  3UYJ A;  5FUP A;  5FZG A;  3PTR B;  4LIT A;  4GD4 A;  5IVF A;  4Y3O A;  4QXB A;  3KV9 A;  4BXF A;  5FP8 A;  3AVR A;  5FZO B;  4GAZ A;  5F37 A;  5LY1 A;  3DXT A;  2XUE A;  3K3N A;  5FZ0 A;  5A7W B;  4D6Q A;  5KR7 A;  4GJZ A;  4UF0 B;  5FYH A;  3N9O A;  5FPL A;  3N9L A;  5FZA A;  5FY9 A;  2WWJ A;  5LY2 A;  5FYU A;  5FZ3 A;  2GP3 A;  3OPW A;  5A3W A;  4LIU A;  4AI9 A;  4URA A;  5A7Q A;  5FXW A;  5FZB A;  5IVC A;  4QWN A;  5IVB A;  5FJK A;  5A3N A;  5FYT A;  4DO0 A;  4QU1 A;  4IGO A;  5F5C A;  3PUR A;  5CEH A;  5ISL A;  3OPT A;  5FXZ A;  4C8D A;  5FYV A;  3PUA A;  5F32 A;  5FYI A;  5FY5 A;  5FPV A;  3AL6 A;  4XDO A;  5FYZ A;  2Q8C A;  3N9M A;  3AVS A;  5FYC A;  5IWF A;  2WWU A;  5F3E A;  5F39 A;  1VRB A;  5FY0 A;  5K4L A;  4EYU A;  3N9Q A;  5IVE A;  5IVJ A;  5FYB A;  4ASK A;  3ZLI A;  2YBK A;  3ZPO A;  5ANQ A;  5FZH A;  5A80 A;  5FPU A;  3KV6 A;  3KVB A;  3PDQ A;  4IGP A;  5FZI A;  4CCJ A;  2Q8D A;  4XDP A;  5F2W A;  4CCL A;  4CSW A;  5F3I A;  5A7W A;  5FZM A;  2OS2 A;  4QX7 A;  4V2W A;  3RVH A;  5FZE A;  2OQ7 A;  4D6S A;  4IGQ A;  3U4S A;  5F5I A;  5FUN A;  5FWJ A;  2P5B A;  2W2I A;  2GP5 A;  3AL5 A;  5F2S A;  5FBJ A;  5FPB A;  5LW9 A;  4V2V A;  4Y4R A;  4CUG A;  2OX0 A;  4E4H A;  5F5A A;  5FZ8 A;  5FZ6 A;  4HOO A;  5FYS A;  4NUB A;  3DXU A;  2VD7 A;  4BU2 A;  5FP3 A;  5FY4 A;  5FZD A;  3KV4 A;  5FZC A;  4EZH A;  4QX8 A;  5FZ7 A;  5A7P A;  5FWE A;  2OQ6 A;  3PU8 A;  5FXV A;  4CCO A;  3LD8 A;  2Q8E A;  4UF0 A;  4D6R A;  4GJY A;  5F3C A;  5A1L A;  4LXL A;  4BIS A;  2XML A;  5A7N A;  5FPA A;  4QXC A;  5FY7 A;  4CCK A;  3N9N A;  5F3G A;  3PUS A;  4EZ4 A;  5FZK A;  4AAP A;  2YPD A;  4QXH A;  5FZF A;  4DIQ A;  5IVV A;  3LDB A;  2PXJ A;  2YU1 A;  3KV5 A;  3K2O A;  5FYY A;  5FZ4 A;  5A3T A;  4CCN A;  5FP9 A;  5E6H A;  5FP4 A;  5FZ9 A;  2YBS A;  3K3O A;  2OT7 A;  2XDV A;  5FJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...