5A7OA

Crystal structure of human jmjd2a in complex with compound 42
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7oA01
5A7PA 5FY9A 2YPDA 5IVCA 3PURA 3U4SA 3PU8A 4CCNA 5FZ1A 2XDVA 4GD4A 5FPBA 4CCLA 5FZLA 4Y4RA 2Q8CA 5IVFA 2P5BA 4GAZA 5IVJA 4D6QA 5FZHA 1VRBA 5A3PA 5A7WA 2WWUA 5E6HA 2Q8DA 4LIUA 5FWEA 3NJYA 2YU1A 5FXZA 5A3WA 5A7OA 5FYHA 5F3EA 4HONA 3UYJA 5FYBA 4LITA 5FZ8A 4XDOA 5FYZA 5IVBA 5FZFA 5FPUA 2WWJA 4NUBA 5FP4A 3N9MA 5LW9A 3K3OA 4QX7A 4D6RA 3LD8A 5A1FA 5ANQA 4UF0B 5FWJA 5IW0A 4BISA 4CCMA 4AI9A 5ISLA 5LY1A 4LIVA 5KR7A 5FY0A 5F3GA 3PU3A 3KV9A 5F5AA 5LWBA 2XUEA 4V2WA 3DXUA 5FYSA 5FYMA 4Y33A 5FPAA 3N9PA 5FP8A 5IVYA 5F37A 4QU1A 4BU2A 4CCJA 3N9OA 4IGPA 5A7SA 3AVRA 5IVVA 3PDQA 5FY7A 4DO0A 3KV4A 5FUPA 3PUAA 5FZDA 4IGQA 5FZ7A 5FYYA 3N9LA 5F5IA 3OPTA 5FZOA 5FUNA 5LY2A 5IVEA 2OQ7A 3OPWA 4XDPA 5FJKA 3PUSA 2GP3A 5FZ0A 5FXVA 4IGOA 5F2WA 5FP7A 3U78A 3ZLIA 5FZ3A 5A7WB 4GJYA 2YU2A 3ZPOA 5FY5A 5A1LA 5FZAA 4BXFA 5FZ6A 2VD7A 4V2VA 5FY1A 2OQ6A 3KVAA 5FP3A 2OX0A 4ASKA 2OS2A 5FZMA 2GP5A 3PTRB 2PXJA 2Q8EA 5FXXA 3KVBA 4QXCA 5F2SA 4EZ4A 2W2IA 3AVSA 4CCOA 2XXZA 5FJHA 5FZ9A 4AAPA 4HOOA 4QX8A 5FY8A 3DXTA 4LXLA 5FYVA 3RVHA 2OT7A 5F3CA 5FY4A 5FXWA 4QWNA 4CUGA 5FPLA 4EYUA 4CCKA 5FYCA 5FV3A 5F5CA 4C8DA 2YBPA 5F32A 5FZCA 5IWFA 2YBSA 5A80A 5FYIA 4CSWA 4QXBA 4GJZA 5CEHA 5FZEA 5A3TA 5FZBA 3AL5A 4UF0A 3N9NA 3K3NA 5FZIA 5FYTA 5FZ4A 3KV6A 5FZOB 5A3NA 4URAA 3N9QA 2XMLA 5FBJA 2YBKA 5K4LA 4E4HA 3LDBA 5A7NA 5A7QA 4TN7A 3K2OA 4Y3OA 4QXHA 5FZKA 4EZHA 3PUQA 5F39A 5FPVA 5FYUA 3KV5A 5FZGA 4DIQA 4D6SA 5FP9A 5F3IA 3AL6A
chains in the Genus database with same CATH superfamily
2K2SA 5FLHA 4OI0A 1VB2A 2Q1ZB 1FPN2 4OZXA 3AXEA 2P3IA 1W39A 4Y20A 2VUJA 2ZX4A 4QQHA 1R093 2A1XA 2QDRA 4LNVA 3W9AA 5I8TA 4CCLA 2Y6KA 3BN6A 1W9TA 3FE5A 3VBRC 4CDQB 1YYNA 1WMDA 2BDRA 3M3IA 4Q4W1 4Q2FA 3AFKA 4Y4RA 4MXWA 4JCKA 2UWAA 3RZJA 1COV3 3N7KA 2R16A 4MX3A 3UKTA 1HB4A 4JKMA 3SITA 2J1UA 3LFIA 3J7NA 2WFF1 2I74A 2WZR2 1MZ6A 3THCA 3LB9A 2BV4A 2CU5A 3H3ZA 4XUPA 4A6OA 1GZWB 1OA3A 4LITA 1EV11 4Z2AA 1RTVA 4PT6A 4BHPA 4YW6A 2WQ8A 1OUSA 5EQUA 3K3OA 1NT0A 5HCBA 5J98B 3SXWA 3TOJA 5BNNA 3IT8A 2YDEA 5IW0A 2V5DA 2PYTA 1NY71 1R091 4P9WA 1MS1A 2ZAHA 3WCSA 3ZYHA 3CJIB 4PDWB 5I8YA 2FDJA 5CG9A 1DDLA 3GALA 2ARAA 1N1SA 2VQAA 1S2EA 1COV1 3WF4A 1D0GA 1WCDJ 1PMIA 4YM1A 1X8EA 1DYPA 4CCJA 4HSJA 4RQPA 1AYM2 5CIRA 4AOCA 1M4WA 2CGNA 5FK7A 4DO0A 3NRUA 1HLCA 1WD3A 2JDHA 4FPCA 4DOUA 5T55A 2CAUA 4JDOA 3HQRA 5FO9B 1TEIA 5FZOA 5LY2A 2A6WA 3ACLA 1IS4A 4H14A 2BOIA 2B9VA 5FXVA 4FXGB 1Z7S1 2Z69A 2Y0OA 1C28A 4CDWC 1UOJA 2GU9A 3WG3A 4HG6B 3LF7A 3FLRA 5A7WB 4QPGB 2C26A 2W92A 1W6PB 4GA9A 1ZZ6A 1NYWA 4UYBA 2IFRA 5DUUA 4RD7A 4UFLA 3VBFB 2OQ6A 2DFBA 4ASKA 2B5HA 2C24A 4NPRA 1VMJA 5A3LA 3AJYA 4WVZA 2A6VA 2WYSA 2JDZA 4EZ4A 4Q4V3 4NR1A 4BQ3A 2HWE3 3UL2A 2B42B 5CB7A 1DYOA 1HB3A 2GSYA 5F3CA 1G9BA 4LXLA 4I30A 3KCCA 2Y34A 2UY8A 2XL7A 5FPLA 2WO7A 4IETA 4PIXA 1PIV3 5A6XA 2B46X 1BLZA 1G86A 1UW8A 1SG3A 3THPA 4B4PA 3X29B 2CSGA 3CKHA 1D7PM 1AXYA 4CU7A 4GH4C 2WS92 3H1MA 3IBMA 5FZEA 3RSJA 2QKDA 3AMQA 3AL5A 3MGUA 3HR9A 5BPXA 5SV5A 4LLOA 3OCPA 2E7QA 5C71A 1W99A 3WZ1A 1F35A 3HAGA 3OBZA 3TNPB 1LAJA 5JLVA 4A7YA 3BALA 2VZUA 4Q4V1 4XAEA 3ME2A 1NCQC 1JTZX 2HWE1 1AJKA 3DPRB 5I0UA 3HIFA 1SMVA 3SH5A 1QNWA 3OEAA 3U11A 4RYDA 3B9IA 5F39A 4GXLA 5FPVA 3WR0A 1G9AA 1PIV1 4QPYA 4E2GA 3DF0A 3M3QA 1WLWA 2E9QA 2F17A 2WFPA 2Y33A 5GZFA 4A42A 4BQ2A 4YFZA 1LHUA 2F4PA 4FP2A 2Y6JA 1ZRCA 3OUIA 4YVWB 3Q8CA 1OBNA 4F83A 4GD4A 1AR82 4Q26A 1W0PA 2XOMA 1BYHA 5LA9A 5F6KA 4KBBA 4WM8C 4I0BA 1NQDA 4Q1PA 1JOBA 2H6BA 4XF1A 2XLAA 1UU5A 3IPVA 1ALYA 1W6NA 2HEVF 1RUH3 3ILRA 3B3QE 2ZABA 3VZLA 4FQ4A 1Q8QA 1DQ5A 1QIQA 4OHXA 3W5NA 3MI8A 3TNQA 5FOJB 3WNPA 2UYBA 4PI2A 3CQOA 2FDFA 2J7MA 1LJ7A 1O8SA 4D8MA 4EROA 2VMIA 3IAQA 1JYTA 4G9SB 5C9AB 3J9SA 3MICA 3OJBA 3UKVA 4Y26A 4UOJA 1TNFA 1PO12 1NLQA 3PTYA 5C3SA 4DRVA 3S0MA 4FFGA 3KLSA 1YFXA 1HDKA 3NW4A 3KF3A 3BU0A 3J8F3 5FMOS 1LODA 2VTXJ 3RYRA 5FYMA 2R0FA 5DG2A 1RUH1 4QU1A 1O3RA 1TME2 3JCIA 5FRAA 2ZEXA 4LULA 1H9PA 5LB6A 4WM8A 4Q4X2 1YRZA 3GYDA 5FZDA 4M00A 5FZ7A 2GALA 3NMBA 1NA1A 2ZEYA 1F5JA 4XFIA 4OFGA 1SCSA 2YC0A 2G19A 3OPWA 3O0XA 1PZ9A 4TLGA 1GBGA 4ZXKA 1MVQA 2WAOA 3VKLA 5F2WA 1DBNA 4MXWB 1AHSA 4Q4W2 1L7LA 4L92A 3SC7X 1HXS3 1DQ0A 4ZONA 3POEA 1GUIA 2BWCA 5DPNA 4XFHA 4IEQA 2VC9A 4I3GA 1G9CA 4V2VA 1ZBE2 2VMGA 1NOVA 2P3YA 4QAWA 1VRH3 1KDMA 3FWEA 5LBEA 1MS5A 2Z79A 3AC0A 5LEKA 2PXJA 2KA3A 4XILA 5F2SA 2WT1A 5BNNB 5GLTA 1QNYA 1RIRA 2W2IA 5L7OA 1AJOA 1ZZ9A 1DGLA 1MEC3 1GP6A 1UL9A 3IMMA 3WNMA 4D7TA 3RMXA 1PX3A 1W8OA 2O1QA 2XJUA 2YROA 3N7JA 3BCWA 3IDBB 4MGZE 2QZ3A 4QKFA 4QWNA 4HL0A 4PF5A 5EPAA 4IEUA 5FV3A 1PVC3 2BVVA 4KU7A 1HXS1 1YFUA 2IXLA 3EB7A 4HBNA 3OGSA 5IWFA 4RQPB 1YIPA 3FLTA 4KWUA 1PK6A 3VBRB 1OI6A 3T0AA 5FLJA 3ST7A 1KD7A 5EZWA 1VRH1 1PX4A 4J1XA 5HCFA 5HBAA 4XACA 4IL7A 4QHOA 4BWOA 5K0UA 5J37A 1K5JA 5FZOB 1RHI3 1UY0A 5JOXA 1MEC1 1VBA3 5FUIA 4HKOA 1MS9A 5JSOA 4AI2A 1OOPA 1YNAA 1RUF2 4AVAA 4ZU4A 1EUUA 3A4UA 3SH3A 3W59A 2ZGTA 1F4HA 4QB6A 4QQOA 3UKNA 2G4IA 2YC2A 3AZVA 5DQ0A 1DQ6A 1PVC1 2P34A 2R49A 4U36A 4YW4A 5FP9A 3ILFA 2W39A 1JW6A 1LOCA 1CONA 4XBQA 3GHMA 5IVCA 1LGNA 2NQYA 2VH9A 1I6XA 2Q4SA 2YV8A 3M2MA 1SEFA 4QHBA 3ITQA 4MVTA 1W8WA 3KQRA 3I2DA 2GZWA 3QACA 3KT7A 3MF6A 1RHI1 1MS4A 3VV1A 4QX3A 3C8XA 4EQVA 4LO5B 1VBA1 1VRBA 4NO4A 1UF2C 1V6MA 2K0GA 3NV4A 5A7OA 1W6QA 3FHAA 3EMRA 2Y38A 5FYBA 4UW5A 4YVSA 3UYJA 2HBTA 5JMCA 1LOEA 1DGWA 1F4AA 5ACA1 3WDUA 3RQ0A 2B7YA 1AX1A 1H8TA 3AKQA 4IV1C 3UESA 1V9U2 3S7EA 2WZEA 4OQ8A 2GN3A 3KHCA 4YW5A 2VR4A 2J1VA 3WG2A 1S55A 4RL7A 4OI2A 3ZYIB 3GBGA 4AEJA 5BNPC 4M0HA 3A21A 1KDKA 1ENSA 4N9HA 5T54A 3ROUA 4KG8A 1XNCA 2WKKA 2VXRA 3C7HA 4NIAA 3B7MA 3ZO0B 4NHMA 5LK7B 1K45A 4BU2A 3OOXA 3T4VA 3I4IA 4IGPA 1JUIA 4YG6A 5IVVA 1Q3EA 4PQ9A 3WW1A 3AP9A 5H9SA 5FUPA 4E4SA 4YSFA 1AXKA 2YFUA 5HV4A 3E6CC 3RJRA 2ORXA 3OPTA 1CESA 5IVEA 4GB33 1W9SA 3BU7A 3FFQA 1MS3A 5J3UA 4F3JA 4IV1A 1DCSA 5I0SA 1QJEA 2GC1A 3IPVB 4UWDA 3O14A 1W6NB 3BKZA 1OKQA 4GJYA 1QJX2 3GZUC 5BNPA 4LJHA 3P1IA 3VD7A 3A23A 4QPIA 5BNOA 5C8CA 5FP3A 5I91A 2NYYA 2OS2A 3POFA 5FZMA 3T30A 3AMNA 2OUHA 2VUDA 1NCQB 3T2TA 3I49A 2D3SA 1RGSA 4FPFA 3ZR5A 4K3UA 2AGSA 4Q0SA 3S5QA 1RUNA 2WR9A 2JE7A 2VBDA 3H1YA 2HBUA 3POGA 3WQ0A 3FJSA 4Q5OA 5CYYA 1UYXA 4GB31 4LKSA 1IHMA 4CCKA 2NP0A 3WNLA 4FBFA 5DXDA 3ZSJA 1O7FA 4LBMA 4URTA 4XABA 4MGSA 1LTEA 2A75A 3TN93 3ZN4A 4A3XA 1LU2A 1RUH2 3DGTA 1J1LA 4HANA 1WCSA 1C5HA 1NE6A 4WM8B 2VZRA 4Q29A 1W8ZA 1NA1B 1S0CA 4P9GA 3POJA 1TG7A 4LHKA 2OZ6A 1AX0A 4BZ4A 1G6NA 1O5UA 3CU7A 1WLDA 4HVQA 3LDBA 5A7QA 1HJGA 3GJBA 3HEIA 3JQXA 1FMD3 4EN7B 3OEBA 4QXHA 5FZKA 2AACA 5F9TA 4GULA 3D8CA 1OQDA 1E5HA 2VOVA 3E97A 3KV5A 3QOPA 2GNBA 4HPKA 4GWMA 1A6CA 4RGKA 3VL8A 2QFEA 1F31A 1YLLA 3J8F2 1CX4A 1ND2A 2CNAA 4LKDA 3TN91 1QHDA 3UETA 3CO2A 4GMP3 4TXWA 4XQ4A 4KU8A 4UFIA 5M0TA 4TZDA 2HWC2 4CDUA 5FPBA 5FMDA 1W04A 4TLFA 3ZYBA 5L7OB 3L2YA 1GWKA 4DINB 1LRHA 5IVFA 5IVJA 4GAZA 4HN1A 1H0BA 4HFSA 3FBMA 4LBQB 3UV9A 2RM21 5BXXA 3ZFFA 4LEJA 1JYVA 1X8MA 1GANA 3MW4A 4CZSA 3WP3A 2E63A 1CIYA 5FPUA 1LHVA 3N36A 1HXS2 2IXIA 1PK6B 3F95A 4FPHA 2IZWA 2W46A 2YGLA 3A0KA 4HZFA 4DRRA 3LOBA 3VBSC 4Z2WA 3AXDA 1V6OA 3VZNA 4U2AA 4GMP1 2O0OA 4IW3A 4RA0A 1DQ2A 4PBPA 5K0UB 3PHMA 4LIVA 4H7LA 4ET7A 4TWTA 3WW4A 3Q9OA 5JUVA 1D2QA 1FT9A 2J1AA 5CFDA 3ZFGC 4FTSA 1NZCA 4CEYA 4XFBA 3MHZA 4XPVA 4Y33A 5FP8A 1OOPB 2HYKA 1L7RA 1WZXA 2VW1A 5DZEA 3NVCA 4AI0A 2FDKA 4E8DA 3VBHA 3JB4C 1XU2A 4ZPIA 3V65A 3WOGA 4M3CF 2QBXA 4XXAA 4MLOA 1IKQA 5A3MA 2Z2SB 4XF4A 3R4UA 3OUHA 5JOYA 5FDBA 1C3HA 1G7YA 4Q0VA 2EIBA 2YPJA 3FUOA 4DQAA 4WVWA 5JI9A 1IS3A 1LEMA 4AFBA 2VNRA 2DVDA 1J83A 1X36A 3ZXAC 4OULA 1W6QB 1WKYA 1KEXA 1GOHA 4YVSB 1QH7A 3VDDC 1XB9A 2PHRA 5FO7B 1GZTA 3SKVA 3KMHA 4BK4A 1H8TB 5IHRA 2A73B 2HWD3 3R6SA 1PO23 1JZ6A 4HVRA 3TWIA 5FQ0A 5FY8A 4BH9A 2G1MA 1Q8OA 1YQ8A 4QKBA 1MR5A 1JZ5A 2LRPA 4HMZA 4FCAA 1W8UA 3CZJA 5EJ1B 1UOGA 1UZZA 4CSWA 4L9BA 2LS6A 4FPJA 4MYEA 1XE7A 4HXCA 1SDDB 3ZIWA 3UJQA 2QQVA 1ASJ2 2ZEZA 1AL23 3PUIA 2VOKA 1AR93 1IS6A 1GZ9A 1QGLA 2IC1A 3MFCA 3MPPG 1S2BA 1XE0A 2VZVA 1UIJA 5FZIA 2F4LA 5FZ4A 2HWD1 4A4AA 3SHRA 1PO21 5E8AA 1BBT2 1OPMA 2EAAA 3VDDA 1AXZA 4BQWA 2A6YA 3K2OA 5G04L 1G9DA 4IV1B 2Y8KA 5EHDA 4K6BA 4QQPA 5A6ZA 4FVVA 3U37A 5BNPB 1WLCA 5DAPA 4AQSA 1QJU3 4NWWA 4LK6A 1ZYBA 4QDQA 4QPIB 2Q5TA 5BNOB 5C8CB 4JGZC 2V4VA 5DMYA 2YPDA 2ZGNA 5LRSA 4LO6B 3KS7A 3H9AA 1QDOA 3ZXJA 5JCTA 1O91A 2W52A 1AL21 1NLSA 1AR91 2JXAA 4S2HA 3LZZA 3CNAA 2UYAA 4UFHA 3FLPA 1XYNA 2ENRA 2VZQA 3WT3A 1VIWB 5ANNA 3VDCA 1CZSA 2GH2A 2JWPA 1D2SA 1LKNA 1VBE3 2ZX3A 3OF1A 5APAA 4YWAA 3WDWA 3CJIA 4PDWA 4OHYA 1T6BX 2IXKA 2CTVA 4GB32 4OHVA 3I2FA 4HONA 2OZJA 1KS5A 1OLMA 2GC3A 2RJLA 1DQ4A 2ID4A 4PI0A 1SFNA 4COWA 4D0QA 1QJU1 4XW3A 3USUA 4HKLA 5LBFA 1WUVA 5A1FA 4RFT0 1RXFA 4AI9A 3WHTA 5E1RA 3WDXA 2PHUA 2VBPA 3QBQA 5DABA 5KR7A 4PCRA 1POV3 2MEV3 3EJKA 3MO4A 4N7IA 4QHZA 4YGCA 4B4QA 4W50A 2VOTA 1W9FA 1NCRA 2VO5A 4AFMA 4XVHA 3WF2A 3DXUA 2O14A 2V4AA 5FPAA 4W65A 5ERLA 1VBE1 2BNOA 4SLIA 1YUDA 1DQ1A 4CVUA 2RS13 4HPKB 4JHZA 3UK9A 3PDQA 1IPSA 1N1TA 4QPGA 1ND2B 1O8PA 1QQP2 2VNGA 2G9FA 3VD3A 2JECA 2KM2A 2ZHNA 5FYYA 1ZREA 1JOPA 3VD5A 2CWSA 1SBEA 4ASMB 4RS5A 3DKWA 1VMFA 1R1A2 2Y6HA 1IQAA 4ZS3A 4CDUB 1HQWA 2C9AA 1WWYA 1UPSA 3OTFA 2WA4A 4OCTA 5CG8A 2X05A 4KL1A 4R8HA 1ZZ7A 1POV1 2MEV1 4QX1A 1N1YA 3J4UH 4FFIA 2GC2A 2VD7A 3FC0A 1FMD2 1OD3A 2J42A 4QKNA 4JGYA 2VZTA 2RS11 3BODA 5JWPA 2FMYA 5FKCA 4CCEA 1H2KA 3BGAA 4ATFA 4IV3C 1XOYA 3D0SA 3MFAA 4LHLA 5AFBA 1SLLA 1WA6X 3KGLA 4Y1UA 2LTNA 4CEWA 4DZGA 2X5IC 2WO2A 1SBDA 3MIFA 5H9PA 3MIHA 3P5BA 1DYKA 3P3PA 4FPGA 1WD4A 4CEYB 2CGPA 1OPOA 1XJAA 3VDAA 3MLLA 5A80A 5KBFA 1CWPA 2BEOA 1C8M3 1CQ9A 1D4M1 3FHQA 3VBHB 5IYYA 5CFCC 5GJ6A 5A3TA 1ULGA 4FPEA 2CDOA 5AVPA 4ZS2A 3VZJA 1S0BA 5FYTA 3GBFA 4P5HA 1HRI3 5JZGC 5A3NA 2L9LA 4YZ3A 3W21A 1VALA 1ZX5A 2ZTNA 5K4LA 3WQBA 1JZ2A 5D8AC 1WW5A 4BM8A 1RUI2 5A7NA 4DY5A 2DVGA 4TN7A 4DUWA 2FBEA 3FN9A 2A6XA 2Z4FA 5GKAC 4QM8A 4B4RA 1IG3A 4YZ2A 1AR62 4NVPA 4XMIA 1XNBA 2IFWA 2PHWA 4BA6A 1URXA 1JYXA 3BB6A 5LATA 3ACHA 2ZGQA 3RNSA 2HJIA 3OB8A 3APBA 4QQ2A 1W90A 1C8M1 2WNUC 2RS33 3MIEA 4XUOA 2JE8A 1HN1A 1W8NA 1WMXA 3WNNA 2GDFA 4IEWA 2XDVA 5CVRA 5FZLA 3ZFEA 2ZACA 3B94A 1U5IA 4PQQA 2XJSA 1HRI1 5A32A 1Z78A 4COYA 2IVIB 5FZHA 1DZRA 2BVBA 1HJFA 1QOOA 4Z82A 3WHUA 1A34A 3FMGA 3NJYA 1A78A 3JZVA 5KHHA 4XOGA 3O1TA 1UNBA 1RYYA 4L8QA 5GZGA 4CTEA 5JZGA 5FZFA 5J1XA 2WABA 2WWJA 4INDA 4NUBA 5FKBA 1GSLA 2R062 2JIGA 3HN1A 3QLQA 4R52A 4LO4B 1IGOA 1CJDA 2RS31 2JD4A 1SLAA 2E53A 4N9IA 1PMJX 2RVAA 2VECA 4FXKB 1ODNA 1ZRRA 5F5QA 3SISA 4CXYA 1PO22 1FXZA 5EXOA 3VDDB 4UAPA 2IWGB 5CKNA 1JXNA 2SLIA 3A0NA 2Z42A 2GNMA 1YQ2A 3JD72 2WZ8A 1H6YA 1RUE1 2PMWB 4DXZA 4K40A 4JTOA 3I2IA 2OVUA 1TE1B 2VVFA 5F5IA 3WP5A 2AH2A 2WJSA 3VHRA 4YYOA 3WP6A 3HPNA 2OQ7A 4QDRA 4LE4A 4KG0A 1PGW1 4DXSA 4Q0UA 1Y43B 5FJKA 3VKNA 1AL22 2E32A 3VKFC 4XQWA 4C1WA 4O65A 5TSWA 1FV3A 3JXSA 2HEWF 3OYWB 4OVEA 5BV6A 1PZ7A 5FLIA 2D6LX 3WNOA 5T3NA 3WG1A 2UU8A 1MQTC 3M3EA 1Z7S3 2FMDA 3POWA 4QT6A 2QQIA 4AF9A 4PLNA 3POYA 1XU1A 5A1LA 3NQHA 1J3PA 1MZFA 1RUD3 5FY1A 4S2FA 1LHWA 2WLPA 3VBOC 4AK3A 1H2NA 2VG9A 3TB0A 3MBWA 4AG4A 4LMFA 3L9JT 2Q8EA 4QB1A 3FBYA 1PGL1 3LFMA 3KGZA 3USUB 1GQGA 1R64A 3VBRA 3USSA 4D7SA 1WBLA 2CL2A 4Z92B 1OKOA 1RB8G 2CWMA 1Y9QA 5DUWA 1VP6A 1UZYA 2ZX1A 2GC0A 4AI3A 1JHNA 4BB3A 5FY4A 2DCZA 4IEOA 1UY3A 3KD4A 2W1WA 1C1LA 2XR4A 1NCRB 3MLKA 4AHYA 2P6CA 3KHBA 1T2XA 3R05A 3IMNA 4PF1A 5JXHA 1EAH3 4QPWA 5FO8B 5FYIA 2DCJA 1RUD1 1NXD1 1REDA 1BK1A 3AX4A 2W91A 1BVVA 2QQLA 4AEMA 3UGHA 3MUY1 3WF1A 1CZVA 4RS5B 2QQPA 3KCYA 1JI6A 2GN7A 4URAA 1XQNA 1Q8VA 1OH4A 3IIAA 4FI9A 4LBKA 4NIIA 4JAAA 2ES3A 1U12A 5A1AA 2Q0AA 5EYYA 1YWKA 3VB9A 4AVSA 5JVVA 1YCIA 1Y9GA 2WT2A 5FZGA 2OXBA 2MEV2 1DP0A 2R1DA 2RHPA 1EAH1 2DFCA 1JHJA 1EUTA 4XFGA 1AYN3 3NV1A 4JGYB 4AVCA 1VLNA 2W47A 2RS12 1FNYA 4QM9A 4YM0A 2EXJA 5FZ1A 1CD3G 1UZWA 4GIQA 2W5FA 1CAWA 5IK4A 3OBAA 3VLBB 4XHXA 4O9GA 1YFYA 4CDWA 5IFPA 2XG3A 3LIGA 2A71A 4CEWB 5IK7A 4PHZA 1V6IA 3PVBB 1KITA 2ZGOA 3LEIA 3WW2A 5KXEA 4ES9A 3O0VA 1BQPA 4KH9A 4BIOA 4DXRA 3N4MA 1UKGA 2ZPXA 4FT8A 1OFSA 3OD4A 3I59A 4RGAA 1ULOA 4AHXA 2ZGLA 4YG3A 2UWCA 2W94A 4QKDA 1W2TA 2XVLA 3GCXA 3GGLA 2XBO2 1AYN1 3GHNA 2HYXA 3RMYA 4XJAA 3ZMOA 1ACCA 2HWF2 1ZM1A 2ILMA 4YRDA 5D21A 2FDIA 3OPZA 1SFPA 2GNTA 3I2HA 3FX3A 1W2OA 2FDGA 3KT4A 2UURA 2JB8A 3I2GA 2RMU2 2KXLA 3IDEA 5KHJA 3BTAA 3PMEA 3DYOA 2JDUA 4GH4A 1W0NA 3VZOA 4IV3B 2JG8C 1U0AA 2BGPA 3AKPA 3AK0A 4IE5A 5CISA 2EA7A 4FQZA 2JIJA 1CPMA 5KXDA 5IJRA 5FMCA 5AC93 5BYNA 4A7ZA 4P9YA 4RN5A 4XDPA 1NCQA 3ZFEB 4UFJA 1LR5A 5A32B 1ZRFA 1RUJ3 3SKJE 4LE3A 4A2UA 5CFCB 1OLME 1EPZA 4DNYA 2JDNA 1IPKA 4MGYE 3WEZA 3ZDSA 3ZPOA 3T2PA 2XL9A 5JZGB 2JDKA 1LOFC 3ZVXA 4AEDC 1B35C 1VMHA 2V73A 1DGRA 1CAVA 2EIDA 2MHFA 4CDXC 5IFTA 1GWLA 1NUKA 1WLTA 4AVTA 1UKRA 4K8RB 2RS32 3RI9A 4NIHA 2EVXA 1NG0A 3WY6A 5AC91 3ASIA 2WO1A 5KC6A 3P6BA 1AVBA 2JG8A 2OT7A 5EYXA 1PNFA 2MPFA 3MEPA 4EYUA 2OW4A 3DYMA 1M06G 5H9RA 1PHMA 1RUJ1 3IIIA 4EWDA 1W2NA 2YBPA 3T0BA 2ZKLA 4NPMA 2XONA 1CAXA 4GJZA 4ZU5A 5B4NA 4LQRA 3NNMA 4W6YA 3E6BA 3OY8A 2VULA 1QWRA 4PBOA 4CPBA 1F8VA 3ECQA 2WFF2 3M4FA 3ZIXA 1XSRA 3KM5A 1EV12 5A33B 2JB4A 2WQ4A 3FL7A 4NMIA 3P3NA 3HJRA 3ALQA 2ORZA 1MS0A 1JYIA 2IXJA 3HT1A 1DLCA 2LM3A 2Y6FA 1UY1A 1N3OA 2YG0A 3G7DA 1TNRA 1GMMA 3T08A 4LBQA 1NY72 1R092 3T09A 3B01A 2QJVA 2R6QA 3AL6A 2AYHA 1HV0A 4OHWA 3NAPC 1BZWA 2HWB3 1COV2 1KJLA 1LOGA 2Y64A 1FAYA 5C7GA 3DUIA 3CIHA 2YFZA 5T5OA 1LULA 2IXHA 3NKTA 4MSVA 2P5BA 4Y22A 3V64A 3NL1A 4W6XA 2WO3A 4L99A 5E6HA 3VBUC 5HV0A 5I0TA 2RR13 5EIYB 2X53S 3B5LB 3JQWA 2ZEWA 3LA3A 2BUKA 5JOZA 1Z7S2 4OQ9A 1YJKA 3LEKA 4TTGA 2VBBA 4ISQA 1ZBA3 4MZUA 1Y3TA 3RYPA 2J1RA 2HWB1 2XWBB 2VQ0A 2OYZA 5LY1A 5C6CA 3E6DA 5BY5A 4V2WA 3WSOA 3V56A 3CJXA 3KCXA 3I2OA 4CU9A 3EYPA 4HKWA 1Q56A 2Q8OA 1JYNA 2RR11 1LOBA 1RXGA 5C5TA 2VZOA 2XHKA 1QY4A 3H0OA 4D69A 3OGVA 4NN0A 1EAH2 5BUVA 5GALA 4EN9B 2ZS6B 5LA2A 1ZBA1 3L2HA 3ZYFA 1JU3A 3B69A 1CAWB 1E5IA 1WCQA 4LBOA 1WCKA 4GALA 3HBZA 5SV8A 1SLIA 4N7UA 5HXMA 1O59A 1C57A 2VMDA 2VZPA 3AP5A 4GWJA 4YZ5A 3M1HA 4B7KA 1V6JA 5FZ6A 1NAEA 3U1XA 4Q4V2 1OD5A 1YQ6A 2OX0A 3CLPA 2BFUL 2HWE2 3I59B 3I3DA 3NJVA 4M01A 4MGQA 4QXKA 3T2OA 4MV2A 5CKMA 1SLCA 4RHV3 4CXWA 1TMF3 2XKPA 2Y0IA 2DUQA 1K12A 1PIV2 2GMMA 4LT5A 1H2MA 3POBA 1F15A 2YXSA 4HLTA 2PTMA 4CUGA 4C91A 3H8OA 3R4DB 4EN6B 1S0EA 1IG0A 3E5XA 5F5CA 2D44A 1BHGA 1BXHA 3IZOA 5C3PA 5F32A 2VMFA 3AM2A 2X10A 2YBSA 5FZCA 3AKTA 4GH4B 1QXJA 2VUCA 1RITA 4YARA 1DGRN 2P2KA 4CCDA 1S0GA 5CEHA 3ZKUA 1NLRA 1Z0HA 3AZYA 4CP9A 4OI1A 3RZZA 3NV2A 4RFRB 1TMF1 4RHV1 4CE8A 3ZXKA 3LDRA 2RDQA 2NPIA 3MIGA 1Q8PA 1QMJA 2ZMLA 4XZUG 3LE0A 4F7ZA 1BMV1 1BEV3 2VMHA 3LKJA 2HH9A 2VXJA 3ZYJB 1YIFA 4CA9A 2F6BA 2UWBA 4MGTA 1FOD3 4XCAA 1G8WA 2XJQA 3ZXFA 3GZEA 2Q1MA 2BQPA 3BIEA 2WRAA 1UMHA 2YB7A 5EWSA 1HB1A 2WL1A 5GZCA 2ZGPA 1JMUB 3U4SA 1IKPA 3MPBA 3N35A 1LESA 1UMIA 2ZZJA 2FHRA 4JDNA 1CAVB 1OT5A 4YGDA 2OPWA 4IQPA 4NRPA 2VM9A 4LUMA 4DXTA 4R4ZA 1GNZA 2JG8B 3LWCA 5AC92 4FPLA 5CU1A 1Q43A 1ZA4A 1YC61 1BEV1 5FXZA 1O5LA 1K5MC 1CPNA 5A6QA 2H6CA 4K20A 3D0JA 1PM4A 2RM23 1J1TA 4UW3A 4AHZA 4D7YA 4Q8KA 1FOD1 2D98A 3WP4A 1V6NA 1W2UA 1CAXB 1KRIA 3N9MA 1DGWX 3OY8B 3WNKA 4D6RA 5ANQA 2ZKNA 1W05A 2ATFA 2YHJA 2JDMA 4X6RB 1RVF3 1X50A 5FCCA 5GM0A 3TYJA 4B1LA 1H4GA 2RJ2A 1KXGA 4AW7A 1ND3C 4IE4A 4D3WA 4AFDA 4AGRA 5CBLA 4MHUA 5FYSA 1OLRA 2D93A 5DDJ1 1HRV1 4HK8A 3WF3A 1GU3A 2QUOA 2A3XA 2RE9A 3O0WA 3RJ2X 4S2GA 2JKBA 1SZBA 4XCBA 4I3PA 3ZSMA 5JMOA 3EQEA 4FOVA 3N9LA 2WN2A 4H2AA 1I3HA 1QOSA 3G6JB 4MOAA 2BRTA 2ZHKA 2AC1A 1RVF1 2WSVA 1AZDA 3KQ4B 5CNAA 5IAVA 1JH5A 5IT6A 4Y22B 1HN0A 1VRH2 2WWSA 1SQ4A 3RWNA 3SMHA 1VBC3 1ZA7A 4H7MA 3DN7A 1JZ7A 3T0DA 4K8FA 2JICA 4XJZA 4QGNA 4B7EA 5FY5A 2GMEA 1W9YA 3KF5A 1QH6A 2W68A 1L7QA 2Z5WA 4RSUA 4UBHA 5FTTC 2R1BA 5T50A 3H8XA 1MEC2 1SLTA 1JN2P 4EWAA 4FTBA 1WW4A 2DBIA 1PGSA 3B00A 4XIOA 2W95A 4XTMA 5JR7B 4BXSV 1UOFA 4LR4A 1UY4A 3FHIB 2JEMA 3GZAA 3ATGA 1PVC2 1UOBA 2ZMNA 2EIEA 5FYVA 1STMA 1A3KA 4YW2A 5JSPA 2OIIA 4IDZA 5FXWA 3MZHA 5GZDA 2A7AA 1X9TA 3Q8EA 4XJUA 1YI7A 3GNEA 3NAPB 2ET7A 4B8EA 4Z8BA 4BMBA 1VBC1 5JSRA 5KC5A 4C1XA 1UX6A 1HB2A 1ODMA 1RHI2 2K46A 1UXZA 3D3AA 1PZ8A 1K3IA 3VBSA 1E5SA 2AEYA 5HPOA 1VBA2 1CVNA 1VBD3 2EXIA 2VVDA 4FFHA 2B8MA 2D7FA 1POQA 1NZIA 1XNAA 3AP6A 1UU4A 2RS53 3LIHA 4MGKE 3ZFGA 1CGPA 1GOFA 1GOGA 4R9BA 5ACA2 4K1ZA 4JTNA 1GP5A 1GR3A 1QDCA 1R083 5LBBA 3ZN5A 2AREA 4R9DA 3PMSA 1SHWB 4KBZA 2VNVA 4QU2A 4N53C 4KGGA 2B9UA 5T5PA 3WXPA 4BQ4A 2QQWA 3S5AA 1MZ5A 4XEZA 1VBD1 1S0JA 1X7NA 4LOSA 1CN1A 3LDKA 3MW3A 2C0ZA 1FPN3 4CDQC 4I2OA 5AFEA 4JRAA 4XBNA 3UJOA 2RS51 3V0AA 4X8PA 2NM1A 2Y6GA 2Q8DA 3M7AA 2V5YA 2VJXA 5CZKA 2YU1A 3S57A 1R081 4LHNA 3WUDA 2XVGA 3H8UA 3CEWA 2V72A 4P08A 2WZR3 4JZRA 4DUXA 1LGCA 1GLHA 4Q27A 1XNKA 3ZOIA 3CBNA 3BPZA 4I0AA 4CCMA 2OA2A 1W28A 4Y24A 3W5MA 2DDUA 4CP9B 2BJSA 4LO8A 3VZKA 4RHV2 1TMF2 3VKOA 2VPVA 3PU3A 4K7JA 1FPN1 2XJRA 4COUA 4H3WA 4E4HA 4AL9A 4I09A 4OUSA 4CPBD 2C5DA 3ZXDA 1IQDC 1HIXA 2VQUA 3OYWA 1NQJA 3AYAA 3AZXA 3W58A 4HN0A 4MO3M 3O1MA 1RC6A 2BYVE 3KV4A 3DV8A 4AAXA 3MF9A 1J84A 1OFNA 3RI8A 1JU4A 3RGBA 3RS6A 1CIWA 2QQKA 4NIDA 4FSJA 1SLBA 1W0OA 2WZR1 4N8MA 3OUJA 4MG2A 1HQLA 3U10A 2DBNA 5DN2A 3ZM8A 4LA3A 4LBQD 2RDRA 2VOWA 3U78A 4DB5A 3LAGA 3GJAA 4NPLA 1N47A 1DFQA 3NWKA 1OVPA 3UNPA 1BCXA 3VHPA 3RZHA 1JOJA 2XQXA 5FZAA 3U0ZA 2PQQA 4WM7C 1REEA 4JGZA 1BEV2 3VBFC 3MIDA 3EHKA 5LBCA 3OGRA 1SFYA 4L2NA 2GNDA 3TEYA 3K77A 2DYCA 1AX2A 4P9XA 3ZDVA 3O7OA 2XH6A 4XJ8A 4C90A 1AF9A 2ZZQA 1ONAA 1XRUA 3C3VA 3JB8A 3VN4A 1US3A 2ZGSA 3FUQA 5FZ9A 3TN92 4AWDA 2BW8A 2J1EA 3WNXA 4KWKA 1POV0 3I3EA 4WV8A 4YW7A 2ZGKA 5I0RA 2IUWA 3BTYA 4HVOA 4K9SA 3NV3A 2VOXA 4LHSA 3PL0A 4N90A 2I07B 1IZ3A 5B4XA 4A41A 1D4M3 3DEMA 3VDBA 1NKGA 3ABZA 3RZGA 1JS9A 2RM22 4XYXA 2RDSA 4ZY9A 5D1IA 2WS93 2ZGMA 1G9FA 1RUC3 2XMLA 1K5MB 4Y5TA 2QVSB 1H8VA 2WA3A 4NRMA 3SCFA 4JV4A 2D40A 2JJ6A 2CHHA 1UZ0A 1OF4A 1H1IA 1ZNPA 2WYFA 3DPRC 2B45X 2WBKA 1TVGA 2TNFA 2WAAA 4ISRA 1F2NA 4I01A 1WCUA 4R4XA 3ZSKA 3PUQA 1IS5A 3O1OA 1X82A 4GQ7A 3C7GA 5F3IA 1SACA 2NMNA 2QQJA 4W6WA 4E2QA 1HQNA 3OD0A 3OSDA 3I3QA 3CZUA 1H30A 4ORFA 5FY9A 4AQTA 3I7DA 3S7IA 2HKXA 1ULFA 1BK0A 3HOBA 4CCNA 1VE0A 3ILNA 1V6LA 2WS91 5FMOL 4D94A 3V0BA 1OURA 4FOYA 4JRLA 2TBVA 1RUC1 1ZZBA 2X29A 1H6XA 4C0HA 4COVA 3O1UA 3AP4A 3H1WA 3ZYGA 2C4XA 1EPWA 3AMHA 3BYWA 5FWEA 1D4VB 3K48A 1HW5A 4WBBA 1S0FA 4GKYA 3ACIA 4PLOA 5FZ8A 1GQHA 1HX6A 1KFUL 4YG0A 2JG9C 4E4DX 2CDPA 2Q1FA 4CP2A 2XLGA 3VBSB 3H7YA 5E88A 1EY2A 1V6KA 3AFGA 3LD8A 1C1FA 1H1MA 1QOTA 4IEPA 2DCYA 4IV3A 3UT0A 4P02B 3RPQA 4YNIA 1OXCA 4OUEA 2X5IA 2ZGUA 1QXPA 5LEJA 2ERFA 4YZ4A 4BK5A 4Q0QA 4CUCA 3ZFGB 5LWBA 2XGXA 1CZTA 2PELA 4M4PA 5FMBA 4AYUA 1PO13 1VPHA 1O4TA 4JKLA 3BTZA 2NLRA 4CRQA 4YM3A 1AR81 4XIKA 2YZ4A 1QJY3 3KT1A 4GKXA 5CFCA 4XUNA 4ES8A 4SBVA 1HV1A 3T3YA 2QTWB 1UIKA 4HETA 2PQSA 2XQRA 3LPGA 2ZOEB 3A22A 3UGGA 5JDBA 1RUE3 1TME3 3AKSA 3PVEA 5L9BA 5GLVA 2W08A 4EJRA 2FQPA 4FPKA 4CXXA 3ZSEA 4UW6A 4CU6A 5D8AA 3TEXA 1K42A 2E51A 5I0DA 3HQUA 2GP3A 4QX0A 3ORJA 4FPYA 2LROA 3ZN6A 5DAVA 2IXCA 2JG9A 4QX2A 5EJ3A 4C0BA 4LUKA 3V0AB 1UU6A 4IEYA 5GLZA 1PO11 1UMZA 4PJYA 3WVJA 2HWD2 2P3KA 3IB3A 2PHLA 4ASLA 4CU8A 1LEDA 1JODA 2WNUA 1QJY1 3VZMA 3F2ZA 3AYDA 1RL3A 4OZOA 3PTRB 4KWJA 4RGGA 4CCCA 5L9RA 4ARYA 1O4ZA 2R30A 1ZBE3 5BNNC 4XFFA 1TME1 5KHIA 2VE1A 3H3UA 3HNYM 3AMMA 2D6PA 3DXTA 3C7FA 1Y4WA 4E4ZA 4DFSA 3LA7A 3O1SA 1VB4A 5A33A 4MXVA 2VY0A 1BJQA 1S2KA 1UCXA 5IAXA 1JZ8A 1AR92 3HT2A 2D3RA 4XF9A 1UY2A 4RQPC 5JOWA 5K9YA 2I2SA 3I97A 3PJYA 4N43C 3NNFA 4XJ9A 5FZBA 1C8NA 3K4ZA 2H0BA 1UPIA 4IUGA 5IK8A 1UD1A 4IE7A 2WNEA 3WD5A 1PMHX 4Y1XA 2JD9A 1IPJA 1GP4A 3N9QA 2DTWA 1I5PA 1ZBE1 2YBKA 2PLV3 4WVMA 5K7PA 3LPFA 2VQTA 1GV9A 1QJU2 3SCGA 3C7EA 2PN5A 1ZRDA 5FIXA 4Y3OA 3WQ7A 1XPWA 5DAQA 1TQ5A 5FYUA 2BBVA 4Y1VA 1VAKA 4QDSA 2D6KA 4AI8A 5LZ6A 1O3TA 1J3QA 4AGGA 4R9CA 4O9EA 3MW2A 4JGZB 2CYFA 2IVJA 3NJXA 1RUF3 5LA1A 2VMEA 4OHZA 4YFWA 1O6UA 1OQ1A 5D2AA 5CA6A 1XSQA 2YYOA 5K8SA 1YXWA 1VBE2 2AR6A 4BCUA 3R0RA 2P6HA 2ZAAA 3PJQA 2RDNA 3NNJA 3ZXLA 4Z07A 4M0NA 2WINB 1FYUA 2A6ZA 2O8OA 3AYEA 2Q8CA 3ZXGA 1DU3D 2DF7A 1YHFA 4XC9A 2AUYA 1MQTA 3MLJA 2PLV1 2ET1A 4N43A 2WWUA 1S0IA 5KXCA 3ACGA 4YLZA 4KNCA 4YGEA 3VBOA 1W06A 3E5UA 4LBNA 1WMEA 4P9IA 1I9RA 3AJZA 4NIGA 4NHKA 3VD9A 2CV6A 1RUF1 4CP0A 1JZ4A 1X9PA 2PAMA 5IK5A 1PM7A 2OPKA 1V9U3 2WSUA 4FP3A 4OYUA 5F3GA 4WM7B 5CKQA 2XUEA 2ZGRA 5E89A 2BNMA 4FOQA 2VMCA 3TEWA 4XUQA 2A3WA 1GICA 3AMPA 5I8SA 3SEEA 3BIWE 4J25A 3DYPA 1GQPA 5A7SA 4ZU7A 5FY7A 2C6SA 4AE2A 1TZOA 4TSVA 1QJFA 5A70A 2BP6A 3W20A 1RUG3 5ACA3 4OUMA 2RV9A 4DY3A 5F6LB 2MNGA 1ZZCA 1D4M2 2EF6A 3I3MA 4IGOA 3V0BB 1GNYA 2FCTA 1MVEA 1V9U1 2WLQA 1H4HA 3T1LA 4AVBA 1W8HA 4CUBA 3NJZA 1RUC2 3ZPYA 1CX1A 2E33A 1UAIA 3TAYA 1JZ3A 4IERA 1JYWA 2W1SA 2W1UA 2X8KA 3QCWA 3WDTA 3HD8B 5CAZA 2FDHA 4LTAA 3NO8A 1VBB3 3AZZA 5FBZA 1C4RA 2D6MA 5FXXA 3THDA 1IOAA 1QJX3 2PHFA 1JYCA 3EO6A 3BVCA 2WQZC 1W3XA 4Q1RA 1AR73 1RUG1 5C4WC 2X5IB 2PFWA 1J3RA 5C33A 2VUAA 2WUHA 5EJZB 3ETQA 1C8M2 1W8FA 4O7XA 5L19A 2DVAA 5FFOC 1DF0A 1RJ8A 3SCHA 2CY6A 4TYSA 4QGLA 2VTXA 5FPXA 2O8QA 2JDAA 2DVBA 3LCPA 1HRI2 3VGIA 2QZ2A 5LCWL 1XNDA 2D43A 2FCUA 2OKXA 4UF0A 2DUPA 4QX5A 1VBB1 5L9VA 1NA1C 1QJX1 1DHKB 4XF3A 2VCBA 3HN3A 1LHOA 3AB0A 1N1VA 1QF3A 5D8AB 1DG6A 4ONUA 3WDYA 1YI9A 1AR71 4XBLA 4A6SA 2WZPP 3Q8BA 3ZN6B 4UFKA 4WZFA 2JG9B 1VJ2A 2XUMA 2NMOA 1FX5A 1L3JA 1W6MA 1LOAA 3FZ3A 2DCTA 4JQTA 2E7TA 4L11A 4DIQA 3IDAA 1GZCA 3JBG3 4PLMA 5C4WA 2D3PA 1YJLA 2WNUB 3IAPA 2DURA 2E7AA 1QJY2 2VNOA 2ZXQA 4S2DA 2GH8A 5J96B 2LW8A 2XJVA 3ENRA 3JU9A 2ADEA 4UT5A 1W6OA 2WN3A 4GWNA 3GBWA 4WVVA 3WQ1A 5F1RA 5L7OC 2C9KA 1RUE2 2HWC3 1KQRA 3CMGA 4W8JA 2FD8A 2XWJB 4ZHNA 1S1AA 2W9XA 3N7MA 1PGW2 4XETA 4Y20B 3SH4A 4HT1T 2A5ZA 1LOFA 4AEDA 3H3LA 1B35A 1PK6C 1DZTA 2EICA 3JBG1 3VD4A 4XMAA 4BDVB 3IKWA 4CDXA 5FWJA 4Y1ZA 4YM2A 2B39A 3J8F1 1U5XA 5K0UC 3BOWA 4Q0PA 4WVMB 2EIGA 1XE8A 5LK5A 1PGL2 2BBAA 4I0WB 3N9PA 2HWC1 5H9QA 4LK7A 5F37A 1OOPC 1ST8A 1OLQA 1ULCA 1CJPA 2VL4A 2BPA2 4J6GA 4QQLA 2JENA 1J58A 3UGFA 5CADA 1LCLA 2K9ZA 2LUWA 3JUUA 4W4ZA 4QMAA 5LA0A 1I5ZA 2VW0A 3U14A 5C3RA 4IE0A 4META 1I1EA 4NOTA 5A3UA 3LEMA 1Q5OA 1RUD2 2TEPA 1A8MA 3GM8A 1O3SA 2ZHMA 4ZXEA 3PVOA 1MQTB 3CDZB 3WLUA 4N43B 1XC6A 1ENRA 3GXUA 4KGQA 1MACA 2PLV2 3K46A 3NNLA 2GAUA 2P4EA 4XXPA 4YPJA 3ZYRA 1RUOA 2FCVA 3AYCA 3VBOB 1GFF2 3NAPA 4FO9A 4YVSC 3ELNA 3T1MA 1RJ7A 2GP5A 4BPZA 3SNMA 5J09A 1ZRIA 1D0HA 4Y4YA 4EE2A 2QDNA 3KVBA 1H8TC 3IN9A 2YMZA 3ZXEA 1VAVA 4XF0A 5GLUA 5T5LA 1LB2A 4RR3C 2TUNA 1MS8A 2BERA 5L73A 3BPSA 3RVHA 3VBUA 1RMU3 2YUEA 5HXVA 3CL1A 2YGMA 4K21A 2D97A 4Q8LA 2VCCA 3D82A 4UW4A 2W87A 4XFAA 3B93A 1O4YA 2XKOA 4NJ4A 3VL9A 3CHXA 3U4XA 2PHTA 3I2KA 2XJPA 3D4KA 2AENA 3ZX7A 4PIZA 4COZA 1LENA 5A3OA 4BQ1A 4P14A 1LHNA 4E9KA 3OGGA 1Y7BA 2W3JA 4BIFA 2VZ3A 1ASJ3 4LBLA 2D5FA 3R4SA 4AHWA 5HCHA 5F7UA 1N3PA 2JKXA 3ACFA 1NXMA 1AYN2 1RMU1 3ZSLA 4EZHA 4AZZA 4QB2A 5EV7A 4CUAA 3I54A 1V0AA 1BBT3 1ULPA 4ZZ5A 2DU0A 4RR3A 1H2LA 4JKKA 1OQEA 4QPIC 5BNOC 5C8CC 4LBJA 2VGDA 4YZ1A 3S30A 5C8WA 1Q8SA 2BGOA 4DEVA 1X33A 1U5YA 4BYYA 3C2UA 5DAXA 4D6QA 4GWIA 1OMIA 1RUG2 4AFAA 2JDYA 1ASJ1 4JHTA 5A3PA 5FOBB 2DV9A 1LECA 1S4CA 4XDQA 4LIUA 4ITCA 4LKEA 4AFCA 4XURA 3K4AA 5A3WA 1OF3A 2DUOA 1DZQA 1FATA 2BU9A 5F3EA 2D6NA 4DEQA 3AZWA 5FYZA 4BLIA 3RFRA 5IVBA 1BBT1 4LORA 3MUZ1 1KGYA 2ADDA 3S6PA 5GLWA 4B1MA 3LA2A 4LA2A 4QX7A 4FAGA 4XUTA 1CAUA 3J7LA 1R1ZA 4UF0B 4BISA 3BI3A 1A8DA 1FV2A 1T6GC 4O61A 1LU1A 1VBB2 2R32A 4ZKTB 3DCQA 1AR72 2SBAA 2P1BA 1WW6A 4M3CA 1F5FA 1UO9A 1C5IA 1W6MB 3N9OA 5DDJ3 5JR2A 1HRV3 2VZSA 4MUVA 3U07A 3M3CA 3IDCB 1ND2C 5C4WB 1YQCA 3I3BA 1NX9A 4OMCA 5DG1A 3H42B 1JBCA 1RUJ2 3Q8AA 4R9AA 3QH6A 4Y5Z0 2E31A 4XFCA 3IWZA 4CDUC 1QQP3 1DIWA 3PUSA 1SCRA 4MGIE 1V70A 1W6OB 4NAMA 4AR2A 1XBFA 5FP7A 3NKGA 4Z1VA 3QH7A 3WG4A 4MADA 5FZ3A 2VU9A 4XJWA 1R1A3 3KSCA 3ZLIA 3SQOA 1J59A 3ZFFC 1P8JA 5ABJC 2BTVC 3H8RA 3WDVA 4AEDB 4DMIA 1V00A 1EP0A 2J1TA 4HK9A 1B35B 2PHXA 5JXGA 3VUOA 4E27A 2Y6LA 5DZGA 5EFUA 4UFMA 1PNGA 5KHKA 3JBG2 4CDXB 3T4HB 3SLIA 5FR3A 4A45A 2XXZA 2JX9A 1RINA 5E16A 4AGVA 2UY9A 4HOOA 4QX8A 4FPOB 3ZKYA 1QQP1 4GMP0 2R073 2EALA 2J22A 2WDBA 3PIJA 2LALA 1K5MA 2D6OX 5C3OA 5CFDC 2XLFA 4FOWA 4BLJA 1XNTA 3QD6A 4CEYC 1R1A1 2A70A 1NE4A 2VTFA 2ZHLA 4NAOA 4QXBA 3HVDA 2JE9A 3VBHC 3TEZA 1MPXA 4DUVA 3C7OA 4FFFA 2XB6C 3M3OA 3N9NA 4NWVA 3K3NA 1SBFA 3DKQA 1Y9MA 5C3QA 1ND3A 4AXOA 5FPZA 4Y1YA 3J26N 5FBJA 4ZZ8A 5ABJA 5JAXA 1FMD1 2BNNA 3LSDA 4BQ5A 1QU0A 1REFA 2EAKA 3A7QA 2R043 3VHOA 5I93A 5LRRA 2VAUA 1FNZA 2R071 2HWB2 3RRDA 4ARXA 1ZVFA 5B2GB 1RUI3 3GCWA 5A7PA 1ULDA 2NZ9A 2CAVA 4P9JA 1AR63 5JPMB 3O1RA 4UI9L 3HMYA 3PURA 4AEKA 3PU8A 2VZ1A 3E1F1 4MHRA 2WNVC 2YY1A 1F9KA 2RR12 1LGBA 2GMPA 2QCSB 3ETPA 3GDBA 4YW1A 1ENXA 3I2JA 3J7MA 3MIBA 5LASA 1SPPA 4LLFA 4UXAA 4Q4Y3 3VBUB 5JXJA 2R041 2Y26A 1H9WA 1ZBA2 5FYHA 5JIUA 4UBGA 4XDOA 3LOIA 1QJZA 1WMFA 2J1SA 5FK8A 1RUI1 4FAHA 1PVXA 2CGOA 3HWJA 3OGJA 4OLLA 5DUVA 5LW9A 3MV01 5JI7A 1UZVA 4DS0A 1VR3A 1AR61 2XHNA 4YW3A 2ZCWA 2DWRA 5BNQA 2R063 2KD7A 1YO8A 2ZA9A 2BGCA 3ZR6A 1ENQA 4IEXA 2BOJA 3BOPA 4P5YA 3RZKA 1APNA 3B02A 4CDWB 2QQOA 4EN0A 4LPLA 2RJKA 3MDPA 2QE3A 5IVYA 4Q4Y1 4IEZA 2ZJCA 3POIA 2XJTA 3IM0A 4DPNA 1RMU2 3ZYPA 2WNVA 1W3VA 1UWWA 1S0DA 3AVRA 4G3YC 2ZMKA 2V09A 4NROA 3PUAA 4RR3B 4IGQA 4ATEA 4X6QB 2VCAA 3N3HA 4QD2A 4Y5SA 2BWAA 3WUCA 5FUNA 3BTXA 3JD73 2R0HA 5FZ0A 4JVAA 4KWLA 2R061 2WIIB 4L0PA 5JPNB 4NRQA 3U75A 1AUYA 1WBFA 3AKRA 3RYKA 3HNBM 3VHNA 2DTYA 4XHBA 4N53A 2YU2A 3CJIC 4PDWC 3HQXA 1XYOA 5HI0A 4BXFA 3D5OA 3WV6A 2KR2A 3WW3A 2ZX0A 3KVAA 1UQXA 1GWMA 4NHLA 2PAEA 1BMV2 3E5QA 4QXCA 4CYDA 1YEWA 1CAUB 3AVSA 4CDQA 3EXUA 4AVVA 4IESA 1QKQA 3N7LA 4CCOA 5FJHA 3JD71 4B29A 4X8NA 1AYM3 2PAKA 1HKDA 1OVSA 2XPJA 2P3JA 3URFA 2P17A 2ZX2A 5FYCA 1NCRC 4BE3A 1GZWA 1QXRA 2ZBJA 4M3CB 4YGBA 3O12A 2NN8A 2W1QA 1SDWA 4LO7A 3ON7A 2W0XA 4KQ7A 1AL0G 4PIYA 2WNOA 4I02A 4QPGC 2BFUS 2EXKA 1W9WA 1OA2A 2BZDA 4M4RA 2YC4A 5J48A 5HCAA 1UN1A 1XYPA 4JX0A 1O3QA 2C1FA 3AP7A 4RS5C 3NNGA 3SEPA 1E57A 4BQYA 1FOD2 2VW2A 5FAXA 5G05L 5EP9A 4EV0A 4JDMA 2EXHA 3OG2A 3O5SA 4KMQA 1DLLA 1AYM1 2AEZA 3J7HA 4XZPA 5J7MA 1U5ZA 3B9CA 4H55A 5A6YA 3NSTA 1B09A 4F8AA 1W03A 1E5RA 4JGYC 5C70A 3LGRA 1OC1A 4EWEA 5DDJ2 1HRV2 3K75B 3HBKA 2I45A 3PUHA 2R7EB 1OA4A 1W2AX 3RG0A 2QQMA 3VKMA 4XTPA 4E8CA 3LQCA 4OMDA 3MYXA 4CEWC 3ES1A 5A7WA 4AI1A 1UYYA 1W6PA 3WINE 3KZ4C 3PLQA 4WM7A 4BJ0A 5IUQA 3VBFA 1OH3A 1WW7A 2DU1A 4LOTA 5F8PA 3PVNA 4B3NA 1RVF2 4L97A 2VCMA 5FP4A 1ULEA 2AZ5A 3LSEA 1JUHA 2HLEA 1MZEA 3CF6E 2P37A 3OBTA 3HNMA 4BMEA 5DAWA 3RZMA 4IXLA 2D5HA 4V1PA 5IATA 2H0VA 4K1YA 5ISLA 1WA4A 4AQ6A 1ND3B 2A3YA 4HSLA 2Q30A 4IEVA 3ZFFB 2RG4A 5FY0A 2FZ2A 1OSGA 2XBO3 3KB5A 3KV9A 3POSA 4YVWC 5F5AA 2QQNA 4JQRA 5ABJB 1BKZA 2HWF3 2X09A 3TBDA 4NHXA 1LNSA 4GZ9A 3M8LA 1KS4A 1W8TA 3D6EA 3RDIA 2FZ1A 2R072 3K4DA 1BVP1 3THTA 4CP1A 5J36A 1AR83 4MH0E 4BOWA 2XVKA 2RMU3 3OBRA 5KHGA 2OUJA 4P00B 1XXNA 4IE6A 3DL3A 3ZMNA 4BQXA 2QQUA 3H50A 4NE9A 1VBC2 1ZZ8A 2ARCA 2B4KA 2JDPA 5CFDB 3K51A 3BUCA 2WC2A 3DPRA 3ZFEC 5C9AC 1CR7A 4LKFA 5JXIA 5C5UA 5T5JA 4A44A 5JIAA 1SPPB 2XBO1 4KI5M 1EYBA 3TRSB 2HWF1 4NHYA 1US2A 4J1WA 3O1VA 2R042 4XAAA 5KWRA 3O1PA 2PA7A 5KXBA 2E6VA 1GKBA 2PHDA 1QEXA 1UYZA 4WZCA 4YVWA 2G9GA 1KFXL 2N7GA 2RMU1 2Y60A 1UX7A 3I8TA 3EBRA 3RWKX 1H1AA 1WGPA 1YFWA 3RZLA 2VVEA 2G9ZA 2WT0A 4AAPA 3FFZA 3DECA 1YQ5A 3LEGA 4M3CE 1VAMA 3T2QA 4OI4A 4Q4X3 1KJRA 3PNAA 3Q8FA 4G4FA 3WX5A 1VBD2 4FTEA 4C8DA 1GYKA 2ETEA 2E26A 4Q4Y2 3GZTB 3M70A 2DCKA 2WNVB 5C9AA 2RS52 5GZEA 2QNKA 2ARBA 4A3ZA 4XE9A 3ES4A 3INAA 5T52A 1OUXA 4QGMA 5FQ0B 4Q4W3 1R082 3WF0A 3KV6A 1N3QA 3GF6A 2DVFA 3KWVA 3MV11 5AVAA 1FI2A 3WCRA 1OHFA 5FREA 3H7JA 4JC1A 2HEYF 1UXXX 5L36A 1UYPA 2ARXA 2WFF3 5DZFA 4P9LA 1EV13 4EN8B 4Q4X1 1GNHA 4N53B 4XQDA 4AQ2A 4D6SA 3PIGA 4A7KA 4E2SA 5DUXA
chains in the Genus database with same CATH topology
5A7PA 5FY9A 2YPDA 5IVCA 3PURA 3U4SA 3PU8A 4CCNA 5FZ1A 2XDVA 4GD4A 5FPBA 4CCLA 5FZLA 4Y4RA 2Q8CA 5IVFA 2P5BA 4GAZA 5IVJA 4D6QA 5FZHA 1VRBA 5A3PA 5A7WA 2WWUA 5E6HA 2Q8DA 4LIUA 5FWEA 3NJYA 2YU1A 5FXZA 5A3WA 5A7OA 5FYHA 5F3EA 4HONA 3UYJA 5FYBA 4LITA 5FZ8A 4XDOA 5FYZA 5IVBA 5FZFA 5FPUA 2WWJA 4NUBA 5FP4A 3N9MA 5LW9A 3K3OA 4QX7A 4D6RA 3LD8A 5A1FA 5ANQA 4UF0B 5FWJA 5IW0A 4BISA 4CCMA 4AI9A 5ISLA 5LY1A 4LIVA 5KR7A 5FY0A 5F3GA 3PU3A 3KV9A 5F5AA 5LWBA 2XUEA 4V2WA 3DXUA 5FYSA 5FYMA 4Y33A 5FPAA 3N9PA 5FP8A 5IVYA 5F37A 4QU1A 4BU2A 4CCJA 3N9OA 4IGPA 5A7SA 3AVRA 5IVVA 3PDQA 5FY7A 4DO0A 3KV4A 5FUPA 3PUAA 5FZDA 4IGQA 5FZ7A 5FYYA 3N9LA 5F5IA 3OPTA 5FZOA 5FUNA 5LY2A 5IVEA 2OQ7A 3OPWA 4XDPA 5FJKA 3PUSA 2GP3A 5FZ0A 5FXVA 4IGOA 5F2WA 5FP7A 3U78A 3ZLIA 5FZ3A 5A7WB 4GJYA 2YU2A 3ZPOA 5FY5A 5A1LA 5FZAA 4BXFA 5FZ6A 2VD7A 4V2VA 5FY1A 2OQ6A 3KVAA 5FP3A 2OX0A 4ASKA 2OS2A 5FZMA 2GP5A 3PTRB 2PXJA 2Q8EA 5FXXA 3KVBA 4QXCA 5F2SA 4EZ4A 2W2IA 3AVSA 4CCOA 2XXZA 5FJHA 5FZ9A 4AAPA 4HOOA 4QX8A 5FY8A 3DXTA 4LXLA 5FYVA 3RVHA 2OT7A 5F3CA 5FY4A 5FXWA 4QWNA 4CUGA 5FPLA 4EYUA 4CCKA 5FYCA 5FV3A 5F5CA 4C8DA 2YBPA 5F32A 5FZCA 5IWFA 2YBSA 5A80A 5FYIA 4CSWA 4QXBA 4GJZA 5CEHA 5FZEA 5A3TA 5FZBA 3AL5A 4UF0A 3N9NA 3K3NA 5FZIA 5FYTA 5FZ4A 3KV6A 5FZOB 5A3NA 4URAA 3N9QA 2XMLA 5FBJA 2YBKA 5K4LA 4E4HA 3LDBA 5A7NA 5A7QA 4TN7A 3K2OA 4Y3OA 4QXHA 5FZKA 4EZHA 3PUQA 5F39A 5FPVA 5FYUA 3KV5A 5FZGA 4DIQA 4D6SA 5FP9A 5F3IA 3AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7P A;  5FY9 A;  2YPD A;  5IVC A;  3PUR A;  3U4S A;  3PU8 A;  4CCN A;  5FZ1 A;  2XDV A;  4GD4 A;  5FPB A;  4CCL A;  5FZL A;  4Y4R A;  2Q8C A;  5IVF A;  2P5B A;  4GAZ A;  5IVJ A;  4D6Q A;  5FZH A;  1VRB A;  5A3P A;  5A7W A;  2WWU A;  5E6H A;  2Q8D A;  4LIU A;  5FWE A;  3NJY A;  2YU1 A;  5FXZ A;  5A3W A;  5A7O A;  5FYH A;  5F3E A;  4HON A;  3UYJ A;  5FYB A;  4LIT A;  5FZ8 A;  4XDO A;  5FYZ A;  5IVB A;  5FZF A;  5FPU A;  2WWJ A;  4NUB A;  5FP4 A;  3N9M A;  5LW9 A;  3K3O A;  4QX7 A;  4D6R A;  3LD8 A;  5A1F A;  5ANQ A;  4UF0 B;  5FWJ A;  5IW0 A;  4BIS A;  4CCM A;  4AI9 A;  5ISL A;  5LY1 A;  4LIV A;  5KR7 A;  5FY0 A;  5F3G A;  3PU3 A;  3KV9 A;  5F5A A;  5LWB A;  2XUE A;  4V2W A;  3DXU A;  5FYS A;  5FYM A;  4Y33 A;  5FPA A;  3N9P A;  5FP8 A;  5IVY A;  5F37 A;  4QU1 A;  4BU2 A;  4CCJ A;  3N9O A;  4IGP A;  5A7S A;  3AVR A;  5IVV A;  3PDQ A;  5FY7 A;  4DO0 A;  3KV4 A;  5FUP A;  3PUA A;  5FZD A;  4IGQ A;  5FZ7 A;  5FYY A;  3N9L A;  5F5I A;  3OPT A;  5FZO A;  5FUN A;  5LY2 A;  5IVE A;  2OQ7 A;  3OPW A;  4XDP A;  5FJK A;  3PUS A;  2GP3 A;  5FZ0 A;  5FXV A;  4IGO A;  5F2W A;  5FP7 A;  3U78 A;  3ZLI A;  5FZ3 A;  5A7W B;  4GJY A;  2YU2 A;  3ZPO A;  5FY5 A;  5A1L A;  5FZA A;  4BXF A;  5FZ6 A;  2VD7 A;  4V2V A;  5FY1 A;  2OQ6 A;  3KVA A;  5FP3 A;  2OX0 A;  4ASK A;  2OS2 A;  5FZM A;  2GP5 A;  3PTR B;  2PXJ A;  2Q8E A;  5FXX A;  3KVB A;  4QXC A;  5F2S A;  4EZ4 A;  2W2I A;  3AVS A;  4CCO A;  2XXZ A;  5FJH A;  5FZ9 A;  4AAP A;  4HOO A;  4QX8 A;  5FY8 A;  3DXT A;  4LXL A;  5FYV A;  3RVH A;  2OT7 A;  5F3C A;  5FY4 A;  5FXW A;  4QWN A;  4CUG A;  5FPL A;  4EYU A;  4CCK A;  5FYC A;  5FV3 A;  5F5C A;  4C8D A;  2YBP A;  5F32 A;  5FZC A;  5IWF A;  2YBS A;  5A80 A;  5FYI A;  4CSW A;  4QXB A;  4GJZ A;  5CEH A;  5FZE A;  5A3T A;  5FZB A;  3AL5 A;  4UF0 A;  3N9N A;  3K3N A;  5FZI A;  5FYT A;  5FZ4 A;  3KV6 A;  5FZO B;  5A3N A;  4URA A;  3N9Q A;  2XML A;  5FBJ A;  2YBK A;  5K4L A;  4E4H A;  3LDB A;  5A7N A;  5A7Q A;  4TN7 A;  3K2O A;  4Y3O A;  4QXH A;  5FZK A;  4EZH A;  3PUQ A;  5F39 A;  5FPV A;  5FYU A;  3KV5 A;  5FZG A;  4DIQ A;  4D6S A;  5FP9 A;  5F3I A;  3AL6 A; 
#chains in the Genus database with same CATH topology
 2K2S A;  5FLH A;  4OI0 A;  1VB2 A;  2Q1Z B;  1FPN 2;  4OZX A;  3AXE A;  2P3I A;  1W39 A;  4Y20 A;  2VUJ A;  2ZX4 A;  4QQH A;  1R09 3;  2A1X A;  2QDR A;  4LNV A;  3W9A A;  5I8T A;  4CCL A;  2Y6K A;  3BN6 A;  1W9T A;  3FE5 A;  3VBR C;  4CDQ B;  1YYN A;  1WMD A;  2BDR A;  3M3I A;  4Q4W 1;  4Q2F A;  3AFK A;  4Y4R A;  4MXW A;  4JCK A;  2UWA A;  3RZJ A;  1COV 3;  3N7K A;  2R16 A;  4MX3 A;  3UKT A;  1HB4 A;  4JKM A;  3SIT A;  2J1U A;  3LFI A;  3J7N A;  2WFF 1;  2I74 A;  2WZR 2;  1MZ6 A;  3THC A;  3LB9 A;  2BV4 A;  2CU5 A;  3H3Z A;  4XUP A;  4A6O A;  1GZW B;  1OA3 A;  4LIT A;  1EV1 1;  4Z2A A;  1RTV A;  4PT6 A;  4BHP A;  4YW6 A;  2WQ8 A;  1OUS A;  5EQU A;  3K3O A;  1NT0 A;  5HCB A;  5J98 B;  3SXW A;  3TOJ A;  5BNN A;  3IT8 A;  2YDE A;  5IW0 A;  2V5D A;  2PYT A;  1NY7 1;  1R09 1;  4P9W A;  1MS1 A;  2ZAH A;  3WCS A;  3ZYH A;  3CJI B;  4PDW B;  5I8Y A;  2FDJ A;  5CG9 A;  1DDL A;  3GAL A;  2ARA A;  1N1S A;  2VQA A;  1S2E A;  1COV 1;  3WF4 A;  1D0G A;  1WCD J;  1PMI A;  4YM1 A;  1X8E A;  1DYP A;  4CCJ A;  4HSJ A;  4RQP A;  1AYM 2;  5CIR A;  4AOC A;  1M4W A;  2CGN A;  5FK7 A;  4DO0 A;  3NRU A;  1HLC A;  1WD3 A;  2JDH A;  4FPC A;  4DOU A;  5T55 A;  2CAU A;  4JDO A;  3HQR A;  5FO9 B;  1TEI A;  5FZO A;  5LY2 A;  2A6W A;  3ACL A;  1IS4 A;  4H14 A;  2BOI A;  2B9V A;  5FXV A;  4FXG B;  1Z7S 1;  2Z69 A;  2Y0O A;  1C28 A;  4CDW C;  1UOJ A;  2GU9 A;  3WG3 A;  4HG6 B;  3LF7 A;  3FLR A;  5A7W B;  4QPG B;  2C26 A;  2W92 A;  1W6P B;  4GA9 A;  1ZZ6 A;  1NYW A;  4UYB A;  2IFR A;  5DUU A;  4RD7 A;  4UFL A;  3VBF B;  2OQ6 A;  2DFB A;  4ASK A;  2B5H A;  2C24 A;  4NPR A;  1VMJ A;  5A3L A;  3AJY A;  4WVZ A;  2A6V A;  2WYS A;  2JDZ A;  4EZ4 A;  4Q4V 3;  4NR1 A;  4BQ3 A;  2HWE 3;  3UL2 A;  2B42 B;  5CB7 A;  1DYO A;  1HB3 A;  2GSY A;  5F3C A;  1G9B A;  4LXL A;  4I30 A;  3KCC A;  2Y34 A;  2UY8 A;  2XL7 A;  5FPL A;  2WO7 A;  4IET A;  4PIX A;  1PIV 3;  5A6X A;  2B46 X;  1BLZ A;  1G86 A;  1UW8 A;  1SG3 A;  3THP A;  4B4P A;  3X29 B;  2CSG A;  3CKH A;  1D7P M;  1AXY A;  4CU7 A;  4GH4 C;  2WS9 2;  3H1M A;  3IBM A;  5FZE A;  3RSJ A;  2QKD A;  3AMQ A;  3AL5 A;  3MGU A;  3HR9 A;  5BPX A;  5SV5 A;  4LLO A;  3OCP A;  2E7Q A;  5C71 A;  1W99 A;  3WZ1 A;  1F35 A;  3HAG A;  3OBZ A;  3TNP B;  1LAJ A;  5JLV A;  4A7Y A;  3BAL A;  2VZU A;  4Q4V 1;  4XAE A;  3ME2 A;  1NCQ C;  1JTZ X;  2HWE 1;  1AJK A;  3DPR B;  5I0U A;  3HIF A;  1SMV A;  3SH5 A;  1QNW A;  3OEA A;  3U11 A;  4RYD A;  3B9I A;  5F39 A;  4GXL A;  5FPV A;  3WR0 A;  1G9A A;  1PIV 1;  4QPY A;  4E2G A;  3DF0 A;  3M3Q A;  1WLW A;  2E9Q A;  2F17 A;  2WFP A;  2Y33 A;  5GZF A;  4A42 A;  4BQ2 A;  4YFZ A;  1LHU A;  2F4P A;  4FP2 A;  2Y6J A;  1ZRC A;  3OUI A;  4YVW B;  3Q8C A;  1OBN A;  4F83 A;  4GD4 A;  1AR8 2;  4Q26 A;  1W0P A;  2XOM A;  1BYH A;  5LA9 A;  5F6K A;  4KBB A;  4WM8 C;  4I0B A;  1NQD A;  4Q1P A;  1JOB A;  2H6B A;  4XF1 A;  2XLA A;  1UU5 A;  3IPV A;  1ALY A;  1W6N A;  2HEV F;  1RUH 3;  3ILR A;  3B3Q E;  2ZAB A;  3VZL A;  4FQ4 A;  1Q8Q A;  1DQ5 A;  1QIQ A;  4OHX A;  3W5N A;  3MI8 A;  3TNQ A;  5FOJ B;  3WNP A;  2UYB A;  4PI2 A;  3CQO A;  2FDF A;  2J7M A;  1LJ7 A;  1O8S A;  4D8M A;  4ERO A;  2VMI A;  3IAQ A;  1JYT A;  4G9S B;  5C9A B;  3J9S A;  3MIC A;  3OJB A;  3UKV A;  4Y26 A;  4UOJ A;  1TNF A;  1PO1 2;  1NLQ A;  3PTY A;  5C3S A;  4DRV A;  3S0M A;  4FFG A;  3KLS A;  1YFX A;  1HDK A;  3NW4 A;  3KF3 A;  3BU0 A;  3J8F 3;  5FMO S;  1LOD A;  2VTX J;  3RYR A;  5FYM A;  2R0F A;  5DG2 A;  1RUH 1;  4QU1 A;  1O3R A;  1TME 2;  3JCI A;  5FRA A;  2ZEX A;  4LUL A;  1H9P A;  5LB6 A;  4WM8 A;  4Q4X 2;  1YRZ A;  3GYD A;  5FZD A;  4M00 A;  5FZ7 A;  2GAL A;  3NMB A;  1NA1 A;  2ZEY A;  1F5J A;  4XFI A;  4OFG A;  1SCS A;  2YC0 A;  2G19 A;  3OPW A;  3O0X A;  1PZ9 A;  4TLG A;  1GBG A;  4ZXK A;  1MVQ A;  2WAO A;  3VKL A;  5F2W A;  1DBN A;  4MXW B;  1AHS A;  4Q4W 2;  1L7L A;  4L92 A;  3SC7 X;  1HXS 3;  1DQ0 A;  4ZON A;  3POE A;  1GUI A;  2BWC A;  5DPN A;  4XFH A;  4IEQ A;  2VC9 A;  4I3G A;  1G9C A;  4V2V A;  1ZBE 2;  2VMG A;  1NOV A;  2P3Y A;  4QAW A;  1VRH 3;  1KDM A;  3FWE A;  5LBE A;  1MS5 A;  2Z79 A;  3AC0 A;  5LEK A;  2PXJ A;  2KA3 A;  4XIL A;  5F2S A;  2WT1 A;  5BNN B;  5GLT A;  1QNY A;  1RIR A;  2W2I A;  5L7O A;  1AJO A;  1ZZ9 A;  1DGL A;  1MEC 3;  1GP6 A;  1UL9 A;  3IMM A;  3WNM A;  4D7T A;  3RMX A;  1PX3 A;  1W8O A;  2O1Q A;  2XJU A;  2YRO A;  3N7J A;  3BCW A;  3IDB B;  4MGZ E;  2QZ3 A;  4QKF A;  4QWN A;  4HL0 A;  4PF5 A;  5EPA A;  4IEU A;  5FV3 A;  1PVC 3;  2BVV A;  4KU7 A;  1HXS 1;  1YFU A;  2IXL A;  3EB7 A;  4HBN A;  3OGS A;  5IWF A;  4RQP B;  1YIP A;  3FLT A;  4KWU A;  1PK6 A;  3VBR B;  1OI6 A;  3T0A A;  5FLJ A;  3ST7 A;  1KD7 A;  5EZW A;  1VRH 1;  1PX4 A;  4J1X A;  5HCF A;  5HBA A;  4XAC A;  4IL7 A;  4QHO A;  4BWO A;  5K0U A;  5J37 A;  1K5J A;  5FZO B;  1RHI 3;  1UY0 A;  5JOX A;  1MEC 1;  1VBA 3;  5FUI A;  4HKO A;  1MS9 A;  5JSO A;  4AI2 A;  1OOP A;  1YNA A;  1RUF 2;  4AVA A;  4ZU4 A;  1EUU A;  3A4U A;  3SH3 A;  3W59 A;  2ZGT A;  1F4H A;  4QB6 A;  4QQO A;  3UKN A;  2G4I A;  2YC2 A;  3AZV A;  5DQ0 A;  1DQ6 A;  1PVC 1;  2P34 A;  2R49 A;  4U36 A;  4YW4 A;  5FP9 A;  3ILF A;  2W39 A;  1JW6 A;  1LOC A;  1CON A;  4XBQ A;  3GHM A;  5IVC A;  1LGN A;  2NQY A;  2VH9 A;  1I6X A;  2Q4S A;  2YV8 A;  3M2M A;  1SEF A;  4QHB A;  3ITQ A;  4MVT A;  1W8W A;  3KQR A;  3I2D A;  2GZW A;  3QAC A;  3KT7 A;  3MF6 A;  1RHI 1;  1MS4 A;  3VV1 A;  4QX3 A;  3C8X A;  4EQV A;  4LO5 B;  1VBA 1;  1VRB A;  4NO4 A;  1UF2 C;  1V6M A;  2K0G A;  3NV4 A;  5A7O A;  1W6Q A;  3FHA A;  3EMR A;  2Y38 A;  5FYB A;  4UW5 A;  4YVS A;  3UYJ A;  2HBT A;  5JMC A;  1LOE A;  1DGW A;  1F4A A;  5ACA 1;  3WDU A;  3RQ0 A;  2B7Y A;  1AX1 A;  1H8T A;  3AKQ A;  4IV1 C;  3UES A;  1V9U 2;  3S7E A;  2WZE A;  4OQ8 A;  2GN3 A;  3KHC A;  4YW5 A;  2VR4 A;  2J1V A;  3WG2 A;  1S55 A;  4RL7 A;  4OI2 A;  3ZYI B;  3GBG A;  4AEJ A;  5BNP C;  4M0H A;  3A21 A;  1KDK A;  1ENS A;  4N9H A;  5T54 A;  3ROU A;  4KG8 A;  1XNC A;  2WKK A;  2VXR A;  3C7H A;  4NIA A;  3B7M A;  3ZO0 B;  4NHM A;  5LK7 B;  1K45 A;  4BU2 A;  3OOX A;  3T4V A;  3I4I A;  4IGP A;  1JUI A;  4YG6 A;  5IVV A;  1Q3E A;  4PQ9 A;  3WW1 A;  3AP9 A;  5H9S A;  5FUP A;  4E4S A;  4YSF A;  1AXK A;  2YFU A;  5HV4 A;  3E6C C;  3RJR A;  2ORX A;  3OPT A;  1CES A;  5IVE A;  4GB3 3;  1W9S A;  3BU7 A;  3FFQ A;  1MS3 A;  5J3U A;  4F3J A;  4IV1 A;  1DCS A;  5I0S A;  1QJE A;  2GC1 A;  3IPV B;  4UWD A;  3O14 A;  1W6N B;  3BKZ A;  1OKQ A;  4GJY A;  1QJX 2;  3GZU C;  5BNP A;  4LJH A;  3P1I A;  3VD7 A;  3A23 A;  4QPI A;  5BNO A;  5C8C A;  5FP3 A;  5I91 A;  2NYY A;  2OS2 A;  3POF A;  5FZM A;  3T30 A;  3AMN A;  2OUH A;  2VUD A;  1NCQ B;  3T2T A;  3I49 A;  2D3S A;  1RGS A;  4FPF A;  3ZR5 A;  4K3U A;  2AGS A;  4Q0S A;  3S5Q A;  1RUN A;  2WR9 A;  2JE7 A;  2VBD A;  3H1Y A;  2HBU A;  3POG A;  3WQ0 A;  3FJS A;  4Q5O A;  5CYY A;  1UYX A;  4GB3 1;  4LKS A;  1IHM A;  4CCK A;  2NP0 A;  3WNL A;  4FBF A;  5DXD A;  3ZSJ A;  1O7F A;  4LBM A;  4URT A;  4XAB A;  4MGS A;  1LTE A;  2A75 A;  3TN9 3;  3ZN4 A;  4A3X A;  1LU2 A;  1RUH 2;  3DGT A;  1J1L A;  4HAN A;  1WCS A;  1C5H A;  1NE6 A;  4WM8 B;  2VZR A;  4Q29 A;  1W8Z A;  1NA1 B;  1S0C A;  4P9G A;  3POJ A;  1TG7 A;  4LHK A;  2OZ6 A;  1AX0 A;  4BZ4 A;  1G6N A;  1O5U A;  3CU7 A;  1WLD A;  4HVQ A;  3LDB A;  5A7Q A;  1HJG A;  3GJB A;  3HEI A;  3JQX A;  1FMD 3;  4EN7 B;  3OEB A;  4QXH A;  5FZK A;  2AAC A;  5F9T A;  4GUL A;  3D8C A;  1OQD A;  1E5H A;  2VOV A;  3E97 A;  3KV5 A;  3QOP A;  2GNB A;  4HPK A;  4GWM A;  1A6C A;  4RGK A;  3VL8 A;  2QFE A;  1F31 A;  1YLL A;  3J8F 2;  1CX4 A;  1ND2 A;  2CNA A;  4LKD A;  3TN9 1;  1QHD A;  3UET A;  3CO2 A;  4GMP 3;  4TXW A;  4XQ4 A;  4KU8 A;  4UFI A;  5M0T A;  4TZD A;  2HWC 2;  4CDU A;  5FPB A;  5FMD A;  1W04 A;  4TLF A;  3ZYB A;  5L7O B;  3L2Y A;  1GWK A;  4DIN B;  1LRH A;  5IVF A;  5IVJ A;  4GAZ A;  4HN1 A;  1H0B A;  4HFS A;  3FBM A;  4LBQ B;  3UV9 A;  2RM2 1;  5BXX A;  3ZFF A;  4LEJ A;  1JYV A;  1X8M A;  1GAN A;  3MW4 A;  4CZS A;  3WP3 A;  2E63 A;  1CIY A;  5FPU A;  1LHV A;  3N36 A;  1HXS 2;  2IXI A;  1PK6 B;  3F95 A;  4FPH A;  2IZW A;  2W46 A;  2YGL A;  3A0K A;  4HZF A;  4DRR A;  3LOB A;  3VBS C;  4Z2W A;  3AXD A;  1V6O A;  3VZN A;  4U2A A;  4GMP 1;  2O0O A;  4IW3 A;  4RA0 A;  1DQ2 A;  4PBP A;  5K0U B;  3PHM A;  4LIV A;  4H7L A;  4ET7 A;  4TWT A;  3WW4 A;  3Q9O A;  5JUV A;  1D2Q A;  1FT9 A;  2J1A A;  5CFD A;  3ZFG C;  4FTS A;  1NZC A;  4CEY A;  4XFB A;  3MHZ A;  4XPV A;  4Y33 A;  5FP8 A;  1OOP B;  2HYK A;  1L7R A;  1WZX A;  2VW1 A;  5DZE A;  3NVC A;  4AI0 A;  2FDK A;  4E8D A;  3VBH A;  3JB4 C;  1XU2 A;  4ZPI A;  3V65 A;  3WOG A;  4M3C F;  2QBX A;  4XXA A;  4MLO A;  1IKQ A;  5A3M A;  2Z2S B;  4XF4 A;  3R4U A;  3OUH A;  5JOY A;  5FDB A;  1C3H A;  1G7Y A;  4Q0V A;  2EIB A;  2YPJ A;  3FUO A;  4DQA A;  4WVW A;  5JI9 A;  1IS3 A;  1LEM A;  4AFB A;  2VNR A;  2DVD A;  1J83 A;  1X36 A;  3ZXA C;  4OUL A;  1W6Q B;  1WKY A;  1KEX A;  1GOH A;  4YVS B;  1QH7 A;  3VDD C;  1XB9 A;  2PHR A;  5FO7 B;  1GZT A;  3SKV A;  3KMH A;  4BK4 A;  1H8T B;  5IHR A;  2A73 B;  2HWD 3;  3R6S A;  1PO2 3;  1JZ6 A;  4HVR A;  3TWI A;  5FQ0 A;  5FY8 A;  4BH9 A;  2G1M A;  1Q8O A;  1YQ8 A;  4QKB A;  1MR5 A;  1JZ5 A;  2LRP A;  4HMZ A;  4FCA A;  1W8U A;  3CZJ A;  5EJ1 B;  1UOG A;  1UZZ A;  4CSW A;  4L9B A;  2LS6 A;  4FPJ A;  4MYE A;  1XE7 A;  4HXC A;  1SDD B;  3ZIW A;  3UJQ A;  2QQV A;  1ASJ 2;  2ZEZ A;  1AL2 3;  3PUI A;  2VOK A;  1AR9 3;  1IS6 A;  1GZ9 A;  1QGL A;  2IC1 A;  3MFC A;  3MPP G;  1S2B A;  1XE0 A;  2VZV A;  1UIJ A;  5FZI A;  2F4L A;  5FZ4 A;  2HWD 1;  4A4A A;  3SHR A;  1PO2 1;  5E8A A;  1BBT 2;  1OPM A;  2EAA A;  3VDD A;  1AXZ A;  4BQW A;  2A6Y A;  3K2O A;  5G04 L;  1G9D A;  4IV1 B;  2Y8K A;  5EHD A;  4K6B A;  4QQP A;  5A6Z A;  4FVV A;  3U37 A;  5BNP B;  1WLC A;  5DAP A;  4AQS A;  1QJU 3;  4NWW A;  4LK6 A;  1ZYB A;  4QDQ A;  4QPI B;  2Q5T A;  5BNO B;  5C8C B;  4JGZ C;  2V4V A;  5DMY A;  2YPD A;  2ZGN A;  5LRS A;  4LO6 B;  3KS7 A;  3H9A A;  1QDO A;  3ZXJ A;  5JCT A;  1O91 A;  2W52 A;  1AL2 1;  1NLS A;  1AR9 1;  2JXA A;  4S2H A;  3LZZ A;  3CNA A;  2UYA A;  4UFH A;  3FLP A;  1XYN A;  2ENR A;  2VZQ A;  3WT3 A;  1VIW B;  5ANN A;  3VDC A;  1CZS A;  2GH2 A;  2JWP A;  1D2S A;  1LKN A;  1VBE 3;  2ZX3 A;  3OF1 A;  5APA A;  4YWA A;  3WDW A;  3CJI A;  4PDW A;  4OHY A;  1T6B X;  2IXK A;  2CTV A;  4GB3 2;  4OHV A;  3I2F A;  4HON A;  2OZJ A;  1KS5 A;  1OLM A;  2GC3 A;  2RJL A;  1DQ4 A;  2ID4 A;  4PI0 A;  1SFN A;  4COW A;  4D0Q A;  1QJU 1;  4XW3 A;  3USU A;  4HKL A;  5LBF A;  1WUV A;  5A1F A;  4RFT 0;  1RXF A;  4AI9 A;  3WHT A;  5E1R A;  3WDX A;  2PHU A;  2VBP A;  3QBQ A;  5DAB A;  5KR7 A;  4PCR A;  1POV 3;  2MEV 3;  3EJK A;  3MO4 A;  4N7I A;  4QHZ A;  4YGC A;  4B4Q A;  4W50 A;  2VOT A;  1W9F A;  1NCR A;  2VO5 A;  4AFM A;  4XVH A;  3WF2 A;  3DXU A;  2O14 A;  2V4A A;  5FPA A;  4W65 A;  5ERL A;  1VBE 1;  2BNO A;  4SLI A;  1YUD A;  1DQ1 A;  4CVU A;  2RS1 3;  4HPK B;  4JHZ A;  3UK9 A;  3PDQ A;  1IPS A;  1N1T A;  4QPG A;  1ND2 B;  1O8P A;  1QQP 2;  2VNG A;  2G9F A;  3VD3 A;  2JEC A;  2KM2 A;  2ZHN A;  5FYY A;  1ZRE A;  1JOP A;  3VD5 A;  2CWS A;  1SBE A;  4ASM B;  4RS5 A;  3DKW A;  1VMF A;  1R1A 2;  2Y6H A;  1IQA A;  4ZS3 A;  4CDU B;  1HQW A;  2C9A A;  1WWY A;  1UPS A;  3OTF A;  2WA4 A;  4OCT A;  5CG8 A;  2X05 A;  4KL1 A;  4R8H A;  1ZZ7 A;  1POV 1;  2MEV 1;  4QX1 A;  1N1Y A;  3J4U H;  4FFI A;  2GC2 A;  2VD7 A;  3FC0 A;  1FMD 2;  1OD3 A;  2J42 A;  4QKN A;  4JGY A;  2VZT A;  2RS1 1;  3BOD A;  5JWP A;  2FMY A;  5FKC A;  4CCE A;  1H2K A;  3BGA A;  4ATF A;  4IV3 C;  1XOY A;  3D0S A;  3MFA A;  4LHL A;  5AFB A;  1SLL A;  1WA6 X;  3KGL A;  4Y1U A;  2LTN A;  4CEW A;  4DZG A;  2X5I C;  2WO2 A;  1SBD A;  3MIF A;  5H9P A;  3MIH A;  3P5B A;  1DYK A;  3P3P A;  4FPG A;  1WD4 A;  4CEY B;  2CGP A;  1OPO A;  1XJA A;  3VDA A;  3MLL A;  5A80 A;  5KBF A;  1CWP A;  2BEO A;  1C8M 3;  1CQ9 A;  1D4M 1;  3FHQ A;  3VBH B;  5IYY A;  5CFC C;  5GJ6 A;  5A3T A;  1ULG A;  4FPE A;  2CDO A;  5AVP A;  4ZS2 A;  3VZJ A;  1S0B A;  5FYT A;  3GBF A;  4P5H A;  1HRI 3;  5JZG C;  5A3N A;  2L9L A;  4YZ3 A;  3W21 A;  1VAL A;  1ZX5 A;  2ZTN A;  5K4L A;  3WQB A;  1JZ2 A;  5D8A C;  1WW5 A;  4BM8 A;  1RUI 2;  5A7N A;  4DY5 A;  2DVG A;  4TN7 A;  4DUW A;  2FBE A;  3FN9 A;  2A6X A;  2Z4F A;  5GKA C;  4QM8 A;  4B4R A;  1IG3 A;  4YZ2 A;  1AR6 2;  4NVP A;  4XMI A;  1XNB A;  2IFW A;  2PHW A;  4BA6 A;  1URX A;  1JYX A;  3BB6 A;  5LAT A;  3ACH A;  2ZGQ A;  3RNS A;  2HJI A;  3OB8 A;  3APB A;  4QQ2 A;  1W90 A;  1C8M 1;  2WNU C;  2RS3 3;  3MIE A;  4XUO A;  2JE8 A;  1HN1 A;  1W8N A;  1WMX A;  3WNN A;  2GDF A;  4IEW A;  2XDV A;  5CVR A;  5FZL A;  3ZFE A;  2ZAC A;  3B94 A;  1U5I A;  4PQQ A;  2XJS A;  1HRI 1;  5A32 A;  1Z78 A;  4COY A;  2IVI B;  5FZH A;  1DZR A;  2BVB A;  1HJF A;  1QOO A;  4Z82 A;  3WHU A;  1A34 A;  3FMG A;  3NJY A;  1A78 A;  3JZV A;  5KHH A;  4XOG A;  3O1T A;  1UNB A;  1RYY A;  4L8Q A;  5GZG A;  4CTE A;  5JZG A;  5FZF A;  5J1X A;  2WAB A;  2WWJ A;  4IND A;  4NUB A;  5FKB A;  1GSL A;  2R06 2;  2JIG A;  3HN1 A;  3QLQ A;  4R52 A;  4LO4 B;  1IGO A;  1CJD A;  2RS3 1;  2JD4 A;  1SLA A;  2E53 A;  4N9I A;  1PMJ X;  2RVA A;  2VEC A;  4FXK B;  1ODN A;  1ZRR A;  5F5Q A;  3SIS A;  4CXY A;  1PO2 2;  1FXZ A;  5EXO A;  3VDD B;  4UAP A;  2IWG B;  5CKN A;  1JXN A;  2SLI A;  3A0N A;  2Z42 A;  2GNM A;  1YQ2 A;  3JD7 2;  2WZ8 A;  1H6Y A;  1RUE 1;  2PMW B;  4DXZ A;  4K40 A;  4JTO A;  3I2I A;  2OVU A;  1TE1 B;  2VVF A;  5F5I A;  3WP5 A;  2AH2 A;  2WJS A;  3VHR A;  4YYO A;  3WP6 A;  3HPN A;  2OQ7 A;  4QDR A;  4LE4 A;  4KG0 A;  1PGW 1;  4DXS A;  4Q0U A;  1Y43 B;  5FJK A;  3VKN A;  1AL2 2;  2E32 A;  3VKF C;  4XQW A;  4C1W A;  4O65 A;  5TSW A;  1FV3 A;  3JXS A;  2HEW F;  3OYW B;  4OVE A;  5BV6 A;  1PZ7 A;  5FLI A;  2D6L X;  3WNO A;  5T3N A;  3WG1 A;  2UU8 A;  1MQT C;  3M3E A;  1Z7S 3;  2FMD A;  3POW A;  4QT6 A;  2QQI A;  4AF9 A;  4PLN A;  3POY A;  1XU1 A;  5A1L A;  3NQH A;  1J3P A;  1MZF A;  1RUD 3;  5FY1 A;  4S2F A;  1LHW A;  2WLP A;  3VBO C;  4AK3 A;  1H2N A;  2VG9 A;  3TB0 A;  3MBW A;  4AG4 A;  4LMF A;  3L9J T;  2Q8E A;  4QB1 A;  3FBY A;  1PGL 1;  3LFM A;  3KGZ A;  3USU B;  1GQG A;  1R64 A;  3VBR A;  3USS A;  4D7S A;  1WBL A;  2CL2 A;  4Z92 B;  1OKO A;  1RB8 G;  2CWM A;  1Y9Q A;  5DUW A;  1VP6 A;  1UZY A;  2ZX1 A;  2GC0 A;  4AI3 A;  1JHN A;  4BB3 A;  5FY4 A;  2DCZ A;  4IEO A;  1UY3 A;  3KD4 A;  2W1W A;  1C1L A;  2XR4 A;  1NCR B;  3MLK A;  4AHY A;  2P6C A;  3KHB A;  1T2X A;  3R05 A;  3IMN A;  4PF1 A;  5JXH A;  1EAH 3;  4QPW A;  5FO8 B;  5FYI A;  2DCJ A;  1RUD 1;  1NXD 1;  1RED A;  1BK1 A;  3AX4 A;  2W91 A;  1BVV A;  2QQL A;  4AEM A;  3UGH A;  3MUY 1;  3WF1 A;  1CZV A;  4RS5 B;  2QQP A;  3KCY A;  1JI6 A;  2GN7 A;  4URA A;  1XQN A;  1Q8V A;  1OH4 A;  3IIA A;  4FI9 A;  4LBK A;  4NII A;  4JAA A;  2ES3 A;  1U12 A;  5A1A A;  2Q0A A;  5EYY A;  1YWK A;  3VB9 A;  4AVS A;  5JVV A;  1YCI A;  1Y9G A;  2WT2 A;  5FZG A;  2OXB A;  2MEV 2;  1DP0 A;  2R1D A;  2RHP A;  1EAH 1;  2DFC A;  1JHJ A;  1EUT A;  4XFG A;  1AYN 3;  3NV1 A;  4JGY B;  4AVC A;  1VLN A;  2W47 A;  2RS1 2;  1FNY A;  4QM9 A;  4YM0 A;  2EXJ A;  5FZ1 A;  1CD3 G;  1UZW A;  4GIQ A;  2W5F A;  1CAW A;  5IK4 A;  3OBA A;  3VLB B;  4XHX A;  4O9G A;  1YFY A;  4CDW A;  5IFP A;  2XG3 A;  3LIG A;  2A71 A;  4CEW B;  5IK7 A;  4PHZ A;  1V6I A;  3PVB B;  1KIT A;  2ZGO A;  3LEI A;  3WW2 A;  5KXE A;  4ES9 A;  3O0V A;  1BQP A;  4KH9 A;  4BIO A;  4DXR A;  3N4M A;  1UKG A;  2ZPX A;  4FT8 A;  1OFS A;  3OD4 A;  3I59 A;  4RGA A;  1ULO A;  4AHX A;  2ZGL A;  4YG3 A;  2UWC A;  2W94 A;  4QKD A;  1W2T A;  2XVL A;  3GCX A;  3GGL A;  2XBO 2;  1AYN 1;  3GHN A;  2HYX A;  3RMY A;  4XJA A;  3ZMO A;  1ACC A;  2HWF 2;  1ZM1 A;  2ILM A;  4YRD A;  5D21 A;  2FDI A;  3OPZ A;  1SFP A;  2GNT A;  3I2H A;  3FX3 A;  1W2O A;  2FDG A;  3KT4 A;  2UUR A;  2JB8 A;  3I2G A;  2RMU 2;  2KXL A;  3IDE A;  5KHJ A;  3BTA A;  3PME A;  3DYO A;  2JDU A;  4GH4 A;  1W0N A;  3VZO A;  4IV3 B;  2JG8 C;  1U0A A;  2BGP A;  3AKP A;  3AK0 A;  4IE5 A;  5CIS A;  2EA7 A;  4FQZ A;  2JIJ A;  1CPM A;  5KXD A;  5IJR A;  5FMC A;  5AC9 3;  5BYN A;  4A7Z A;  4P9Y A;  4RN5 A;  4XDP A;  1NCQ A;  3ZFE B;  4UFJ A;  1LR5 A;  5A32 B;  1ZRF A;  1RUJ 3;  3SKJ E;  4LE3 A;  4A2U A;  5CFC B;  1OLM E;  1EPZ A;  4DNY A;  2JDN A;  1IPK A;  4MGY E;  3WEZ A;  3ZDS A;  3ZPO A;  3T2P A;  2XL9 A;  5JZG B;  2JDK A;  1LOF C;  3ZVX A;  4AED C;  1B35 C;  1VMH A;  2V73 A;  1DGR A;  1CAV A;  2EID A;  2MHF A;  4CDX C;  5IFT A;  1GWL A;  1NUK A;  1WLT A;  4AVT A;  1UKR A;  4K8R B;  2RS3 2;  3RI9 A;  4NIH A;  2EVX A;  1NG0 A;  3WY6 A;  5AC9 1;  3ASI A;  2WO1 A;  5KC6 A;  3P6B A;  1AVB A;  2JG8 A;  2OT7 A;  5EYX A;  1PNF A;  2MPF A;  3MEP A;  4EYU A;  2OW4 A;  3DYM A;  1M06 G;  5H9R A;  1PHM A;  1RUJ 1;  3III A;  4EWD A;  1W2N A;  2YBP A;  3T0B A;  2ZKL A;  4NPM A;  2XON A;  1CAX A;  4GJZ A;  4ZU5 A;  5B4N A;  4LQR A;  3NNM A;  4W6Y A;  3E6B A;  3OY8 A;  2VUL A;  1QWR A;  4PBO A;  4CPB A;  1F8V A;  3ECQ A;  2WFF 2;  3M4F A;  3ZIX A;  1XSR A;  3KM5 A;  1EV1 2;  5A33 B;  2JB4 A;  2WQ4 A;  3FL7 A;  4NMI A;  3P3N A;  3HJR A;  3ALQ A;  2ORZ A;  1MS0 A;  1JYI A;  2IXJ A;  3HT1 A;  1DLC A;  2LM3 A;  2Y6F A;  1UY1 A;  1N3O A;  2YG0 A;  3G7D A;  1TNR A;  1GMM A;  3T08 A;  4LBQ A;  1NY7 2;  1R09 2;  3T09 A;  3B01 A;  2QJV A;  2R6Q A;  3AL6 A;  2AYH A;  1HV0 A;  4OHW A;  3NAP C;  1BZW A;  2HWB 3;  1COV 2;  1KJL A;  1LOG A;  2Y64 A;  1FAY A;  5C7G A;  3DUI A;  3CIH A;  2YFZ A;  5T5O A;  1LUL A;  2IXH A;  3NKT A;  4MSV A;  2P5B A;  4Y22 A;  3V64 A;  3NL1 A;  4W6X A;  2WO3 A;  4L99 A;  5E6H A;  3VBU C;  5HV0 A;  5I0T A;  2RR1 3;  5EIY B;  2X53 S;  3B5L B;  3JQW A;  2ZEW A;  3LA3 A;  2BUK A;  5JOZ A;  1Z7S 2;  4OQ9 A;  1YJK A;  3LEK A;  4TTG A;  2VBB A;  4ISQ A;  1ZBA 3;  4MZU A;  1Y3T A;  3RYP A;  2J1R A;  2HWB 1;  2XWB B;  2VQ0 A;  2OYZ A;  5LY1 A;  5C6C A;  3E6D A;  5BY5 A;  4V2W A;  3WSO A;  3V56 A;  3CJX A;  3KCX A;  3I2O A;  4CU9 A;  3EYP A;  4HKW A;  1Q56 A;  2Q8O A;  1JYN A;  2RR1 1;  1LOB A;  1RXG A;  5C5T A;  2VZO A;  2XHK A;  1QY4 A;  3H0O A;  4D69 A;  3OGV A;  4NN0 A;  1EAH 2;  5BUV A;  5GAL A;  4EN9 B;  2ZS6 B;  5LA2 A;  1ZBA 1;  3L2H A;  3ZYF A;  1JU3 A;  3B69 A;  1CAW B;  1E5I A;  1WCQ A;  4LBO A;  1WCK A;  4GAL A;  3HBZ A;  5SV8 A;  1SLI A;  4N7U A;  5HXM A;  1O59 A;  1C57 A;  2VMD A;  2VZP A;  3AP5 A;  4GWJ A;  4YZ5 A;  3M1H A;  4B7K A;  1V6J A;  5FZ6 A;  1NAE A;  3U1X A;  4Q4V 2;  1OD5 A;  1YQ6 A;  2OX0 A;  3CLP A;  2BFU L;  2HWE 2;  3I59 B;  3I3D A;  3NJV A;  4M01 A;  4MGQ A;  4QXK A;  3T2O A;  4MV2 A;  5CKM A;  1SLC A;  4RHV 3;  4CXW A;  1TMF 3;  2XKP A;  2Y0I A;  2DUQ A;  1K12 A;  1PIV 2;  2GMM A;  4LT5 A;  1H2M A;  3POB A;  1F15 A;  2YXS A;  4HLT A;  2PTM A;  4CUG A;  4C91 A;  3H8O A;  3R4D B;  4EN6 B;  1S0E A;  1IG0 A;  3E5X A;  5F5C A;  2D44 A;  1BHG A;  1BXH A;  3IZO A;  5C3P A;  5F32 A;  2VMF A;  3AM2 A;  2X10 A;  2YBS A;  5FZC A;  3AKT A;  4GH4 B;  1QXJ A;  2VUC A;  1RIT A;  4YAR A;  1DGR N;  2P2K A;  4CCD A;  1S0G A;  5CEH A;  3ZKU A;  1NLR A;  1Z0H A;  3AZY A;  4CP9 A;  4OI1 A;  3RZZ A;  3NV2 A;  4RFR B;  1TMF 1;  4RHV 1;  4CE8 A;  3ZXK A;  3LDR A;  2RDQ A;  2NPI A;  3MIG A;  1Q8P A;  1QMJ A;  2ZML A;  4XZU G;  3LE0 A;  4F7Z A;  1BMV 1;  1BEV 3;  2VMH A;  3LKJ A;  2HH9 A;  2VXJ A;  3ZYJ B;  1YIF A;  4CA9 A;  2F6B A;  2UWB A;  4MGT A;  1FOD 3;  4XCA A;  1G8W A;  2XJQ A;  3ZXF A;  3GZE A;  2Q1M A;  2BQP A;  3BIE A;  2WRA A;  1UMH A;  2YB7 A;  5EWS A;  1HB1 A;  2WL1 A;  5GZC A;  2ZGP A;  1JMU B;  3U4S A;  1IKP A;  3MPB A;  3N35 A;  1LES A;  1UMI A;  2ZZJ A;  2FHR A;  4JDN A;  1CAV B;  1OT5 A;  4YGD A;  2OPW A;  4IQP A;  4NRP A;  2VM9 A;  4LUM A;  4DXT A;  4R4Z A;  1GNZ A;  2JG8 B;  3LWC A;  5AC9 2;  4FPL A;  5CU1 A;  1Q43 A;  1ZA4 A;  1YC6 1;  1BEV 1;  5FXZ A;  1O5L A;  1K5M C;  1CPN A;  5A6Q A;  2H6C A;  4K20 A;  3D0J A;  1PM4 A;  2RM2 3;  1J1T A;  4UW3 A;  4AHZ A;  4D7Y A;  4Q8K A;  1FOD 1;  2D98 A;  3WP4 A;  1V6N A;  1W2U A;  1CAX B;  1KRI A;  3N9M A;  1DGW X;  3OY8 B;  3WNK A;  4D6R A;  5ANQ A;  2ZKN A;  1W05 A;  2ATF A;  2YHJ A;  2JDM A;  4X6R B;  1RVF 3;  1X50 A;  5FCC A;  5GM0 A;  3TYJ A;  4B1L A;  1H4G A;  2RJ2 A;  1KXG A;  4AW7 A;  1ND3 C;  4IE4 A;  4D3W A;  4AFD A;  4AGR A;  5CBL A;  4MHU A;  5FYS A;  1OLR A;  2D93 A;  5DDJ 1;  1HRV 1;  4HK8 A;  3WF3 A;  1GU3 A;  2QUO A;  2A3X A;  2RE9 A;  3O0W A;  3RJ2 X;  4S2G A;  2JKB A;  1SZB A;  4XCB A;  4I3P A;  3ZSM A;  5JMO A;  3EQE A;  4FOV A;  3N9L A;  2WN2 A;  4H2A A;  1I3H A;  1QOS A;  3G6J B;  4MOA A;  2BRT A;  2ZHK A;  2AC1 A;  1RVF 1;  2WSV A;  1AZD A;  3KQ4 B;  5CNA A;  5IAV A;  1JH5 A;  5IT6 A;  4Y22 B;  1HN0 A;  1VRH 2;  2WWS A;  1SQ4 A;  3RWN A;  3SMH A;  1VBC 3;  1ZA7 A;  4H7M A;  3DN7 A;  1JZ7 A;  3T0D A;  4K8F A;  2JIC A;  4XJZ A;  4QGN A;  4B7E A;  5FY5 A;  2GME A;  1W9Y A;  3KF5 A;  1QH6 A;  2W68 A;  1L7Q A;  2Z5W A;  4RSU A;  4UBH A;  5FTT C;  2R1B A;  5T50 A;  3H8X A;  1MEC 2;  1SLT A;  1JN2 P;  4EWA A;  4FTB A;  1WW4 A;  2DBI A;  1PGS A;  3B00 A;  4XIO A;  2W95 A;  4XTM A;  5JR7 B;  4BXS V;  1UOF A;  4LR4 A;  1UY4 A;  3FHI B;  2JEM A;  3GZA A;  3ATG A;  1PVC 2;  1UOB A;  2ZMN A;  2EIE A;  5FYV A;  1STM A;  1A3K A;  4YW2 A;  5JSP A;  2OII A;  4IDZ A;  5FXW A;  3MZH A;  5GZD A;  2A7A A;  1X9T A;  3Q8E A;  4XJU A;  1YI7 A;  3GNE A;  3NAP B;  2ET7 A;  4B8E A;  4Z8B A;  4BMB A;  1VBC 1;  5JSR A;  5KC5 A;  4C1X A;  1UX6 A;  1HB2 A;  1ODM A;  1RHI 2;  2K46 A;  1UXZ A;  3D3A A;  1PZ8 A;  1K3I A;  3VBS A;  1E5S A;  2AEY A;  5HPO A;  1VBA 2;  1CVN A;  1VBD 3;  2EXI A;  2VVD A;  4FFH A;  2B8M A;  2D7F A;  1POQ A;  1NZI A;  1XNA A;  3AP6 A;  1UU4 A;  2RS5 3;  3LIH A;  4MGK E;  3ZFG A;  1CGP A;  1GOF A;  1GOG A;  4R9B A;  5ACA 2;  4K1Z A;  4JTN A;  1GP5 A;  1GR3 A;  1QDC A;  1R08 3;  5LBB A;  3ZN5 A;  2ARE A;  4R9D A;  3PMS A;  1SHW B;  4KBZ A;  2VNV A;  4QU2 A;  4N53 C;  4KGG A;  2B9U A;  5T5P A;  3WXP A;  4BQ4 A;  2QQW A;  3S5A A;  1MZ5 A;  4XEZ A;  1VBD 1;  1S0J A;  1X7N A;  4LOS A;  1CN1 A;  3LDK A;  3MW3 A;  2C0Z A;  1FPN 3;  4CDQ C;  4I2O A;  5AFE A;  4JRA A;  4XBN A;  3UJO A;  2RS5 1;  3V0A A;  4X8P A;  2NM1 A;  2Y6G A;  2Q8D A;  3M7A A;  2V5Y A;  2VJX A;  5CZK A;  2YU1 A;  3S57 A;  1R08 1;  4LHN A;  3WUD A;  2XVG A;  3H8U A;  3CEW A;  2V72 A;  4P08 A;  2WZR 3;  4JZR A;  4DUX A;  1LGC A;  1GLH A;  4Q27 A;  1XNK A;  3ZOI A;  3CBN A;  3BPZ A;  4I0A A;  4CCM A;  2OA2 A;  1W28 A;  4Y24 A;  3W5M A;  2DDU A;  4CP9 B;  2BJS A;  4LO8 A;  3VZK A;  4RHV 2;  1TMF 2;  3VKO A;  2VPV A;  3PU3 A;  4K7J A;  1FPN 1;  2XJR A;  4COU A;  4H3W A;  4E4H A;  4AL9 A;  4I09 A;  4OUS A;  4CPB D;  2C5D A;  3ZXD A;  1IQD C;  1HIX A;  2VQU A;  3OYW A;  1NQJ A;  3AYA A;  3AZX A;  3W58 A;  4HN0 A;  4MO3 M;  3O1M A;  1RC6 A;  2BYV E;  3KV4 A;  3DV8 A;  4AAX A;  3MF9 A;  1J84 A;  1OFN A;  3RI8 A;  1JU4 A;  3RGB A;  3RS6 A;  1CIW A;  2QQK A;  4NID A;  4FSJ A;  1SLB A;  1W0O A;  2WZR 1;  4N8M A;  3OUJ A;  4MG2 A;  1HQL A;  3U10 A;  2DBN A;  5DN2 A;  3ZM8 A;  4LA3 A;  4LBQ D;  2RDR A;  2VOW A;  3U78 A;  4DB5 A;  3LAG A;  3GJA A;  4NPL A;  1N47 A;  1DFQ A;  3NWK A;  1OVP A;  3UNP A;  1BCX A;  3VHP A;  3RZH A;  1JOJ A;  2XQX A;  5FZA A;  3U0Z A;  2PQQ A;  4WM7 C;  1REE A;  4JGZ A;  1BEV 2;  3VBF C;  3MID A;  3EHK A;  5LBC A;  3OGR A;  1SFY A;  4L2N A;  2GND A;  3TEY A;  3K77 A;  2DYC A;  1AX2 A;  4P9X A;  3ZDV A;  3O7O A;  2XH6 A;  4XJ8 A;  4C90 A;  1AF9 A;  2ZZQ A;  1ONA A;  1XRU A;  3C3V A;  3JB8 A;  3VN4 A;  1US3 A;  2ZGS A;  3FUQ A;  5FZ9 A;  3TN9 2;  4AWD A;  2BW8 A;  2J1E A;  3WNX A;  4KWK A;  1POV 0;  3I3E A;  4WV8 A;  4YW7 A;  2ZGK A;  5I0R A;  2IUW A;  3BTY A;  4HVO A;  4K9S A;  3NV3 A;  2VOX A;  4LHS A;  3PL0 A;  4N90 A;  2I07 B;  1IZ3 A;  5B4X A;  4A41 A;  1D4M 3;  3DEM A;  3VDB A;  1NKG A;  3ABZ A;  3RZG A;  1JS9 A;  2RM2 2;  4XYX A;  2RDS A;  4ZY9 A;  5D1I A;  2WS9 3;  2ZGM A;  1G9F A;  1RUC 3;  2XML A;  1K5M B;  4Y5T A;  2QVS B;  1H8V A;  2WA3 A;  4NRM A;  3SCF A;  4JV4 A;  2D40 A;  2JJ6 A;  2CHH A;  1UZ0 A;  1OF4 A;  1H1I A;  1ZNP A;  2WYF A;  3DPR C;  2B45 X;  2WBK A;  1TVG A;  2TNF A;  2WAA A;  4ISR A;  1F2N A;  4I01 A;  1WCU A;  4R4X A;  3ZSK A;  3PUQ A;  1IS5 A;  3O1O A;  1X82 A;  4GQ7 A;  3C7G A;  5F3I A;  1SAC A;  2NMN A;  2QQJ A;  4W6W A;  4E2Q A;  1HQN A;  3OD0 A;  3OSD A;  3I3Q A;  3CZU A;  1H30 A;  4ORF A;  5FY9 A;  4AQT A;  3I7D A;  3S7I A;  2HKX A;  1ULF A;  1BK0 A;  3HOB A;  4CCN A;  1VE0 A;  3ILN A;  1V6L A;  2WS9 1;  5FMO L;  4D94 A;  3V0B A;  1OUR A;  4FOY A;  4JRL A;  2TBV A;  1RUC 1;  1ZZB A;  2X29 A;  1H6X A;  4C0H A;  4COV A;  3O1U A;  3AP4 A;  3H1W A;  3ZYG A;  2C4X A;  1EPW A;  3AMH A;  3BYW A;  5FWE A;  1D4V B;  3K48 A;  1HW5 A;  4WBB A;  1S0F A;  4GKY A;  3ACI A;  4PLO A;  5FZ8 A;  1GQH A;  1HX6 A;  1KFU L;  4YG0 A;  2JG9 C;  4E4D X;  2CDP A;  2Q1F A;  4CP2 A;  2XLG A;  3VBS B;  3H7Y A;  5E88 A;  1EY2 A;  1V6K A;  3AFG A;  3LD8 A;  1C1F A;  1H1M A;  1QOT A;  4IEP A;  2DCY A;  4IV3 A;  3UT0 A;  4P02 B;  3RPQ A;  4YNI A;  1OXC A;  4OUE A;  2X5I A;  2ZGU A;  1QXP A;  5LEJ A;  2ERF A;  4YZ4 A;  4BK5 A;  4Q0Q A;  4CUC A;  3ZFG B;  5LWB A;  2XGX A;  1CZT A;  2PEL A;  4M4P A;  5FMB A;  4AYU A;  1PO1 3;  1VPH A;  1O4T A;  4JKL A;  3BTZ A;  2NLR A;  4CRQ A;  4YM3 A;  1AR8 1;  4XIK A;  2YZ4 A;  1QJY 3;  3KT1 A;  4GKX A;  5CFC A;  4XUN A;  4ES8 A;  4SBV A;  1HV1 A;  3T3Y A;  2QTW B;  1UIK A;  4HET A;  2PQS A;  2XQR A;  3LPG A;  2ZOE B;  3A22 A;  3UGG A;  5JDB A;  1RUE 3;  1TME 3;  3AKS A;  3PVE A;  5L9B A;  5GLV A;  2W08 A;  4EJR A;  2FQP A;  4FPK A;  4CXX A;  3ZSE A;  4UW6 A;  4CU6 A;  5D8A A;  3TEX A;  1K42 A;  2E51 A;  5I0D A;  3HQU A;  2GP3 A;  4QX0 A;  3ORJ A;  4FPY A;  2LRO A;  3ZN6 A;  5DAV A;  2IXC A;  2JG9 A;  4QX2 A;  5EJ3 A;  4C0B A;  4LUK A;  3V0A B;  1UU6 A;  4IEY A;  5GLZ A;  1PO1 1;  1UMZ A;  4PJY A;  3WVJ A;  2HWD 2;  2P3K A;  3IB3 A;  2PHL A;  4ASL A;  4CU8 A;  1LED A;  1JOD A;  2WNU A;  1QJY 1;  3VZM A;  3F2Z A;  3AYD A;  1RL3 A;  4OZO A;  3PTR B;  4KWJ A;  4RGG A;  4CCC A;  5L9R A;  4ARY A;  1O4Z A;  2R30 A;  1ZBE 3;  5BNN C;  4XFF A;  1TME 1;  5KHI A;  2VE1 A;  3H3U A;  3HNY M;  3AMM A;  2D6P A;  3DXT A;  3C7F A;  1Y4W A;  4E4Z A;  4DFS A;  3LA7 A;  3O1S A;  1VB4 A;  5A33 A;  4MXV A;  2VY0 A;  1BJQ A;  1S2K A;  1UCX A;  5IAX A;  1JZ8 A;  1AR9 2;  3HT2 A;  2D3R A;  4XF9 A;  1UY2 A;  4RQP C;  5JOW A;  5K9Y A;  2I2S A;  3I97 A;  3PJY A;  4N43 C;  3NNF A;  4XJ9 A;  5FZB A;  1C8N A;  3K4Z A;  2H0B A;  1UPI A;  4IUG A;  5IK8 A;  1UD1 A;  4IE7 A;  2WNE A;  3WD5 A;  1PMH X;  4Y1X A;  2JD9 A;  1IPJ A;  1GP4 A;  3N9Q A;  2DTW A;  1I5P A;  1ZBE 1;  2YBK A;  2PLV 3;  4WVM A;  5K7P A;  3LPF A;  2VQT A;  1GV9 A;  1QJU 2;  3SCG A;  3C7E A;  2PN5 A;  1ZRD A;  5FIX A;  4Y3O A;  3WQ7 A;  1XPW A;  5DAQ A;  1TQ5 A;  5FYU A;  2BBV A;  4Y1V A;  1VAK A;  4QDS A;  2D6K A;  4AI8 A;  5LZ6 A;  1O3T A;  1J3Q A;  4AGG A;  4R9C A;  4O9E A;  3MW2 A;  4JGZ B;  2CYF A;  2IVJ A;  3NJX A;  1RUF 3;  5LA1 A;  2VME A;  4OHZ A;  4YFW A;  1O6U A;  1OQ1 A;  5D2A A;  5CA6 A;  1XSQ A;  2YYO A;  5K8S A;  1YXW A;  1VBE 2;  2AR6 A;  4BCU A;  3R0R A;  2P6H A;  2ZAA A;  3PJQ A;  2RDN A;  3NNJ A;  3ZXL A;  4Z07 A;  4M0N A;  2WIN B;  1FYU A;  2A6Z A;  2O8O A;  3AYE A;  2Q8C A;  3ZXG A;  1DU3 D;  2DF7 A;  1YHF A;  4XC9 A;  2AUY A;  1MQT A;  3MLJ A;  2PLV 1;  2ET1 A;  4N43 A;  2WWU A;  1S0I A;  5KXC A;  3ACG A;  4YLZ A;  4KNC A;  4YGE A;  3VBO A;  1W06 A;  3E5U A;  4LBN A;  1WME A;  4P9I A;  1I9R A;  3AJZ A;  4NIG A;  4NHK A;  3VD9 A;  2CV6 A;  1RUF 1;  4CP0 A;  1JZ4 A;  1X9P A;  2PAM A;  5IK5 A;  1PM7 A;  2OPK A;  1V9U 3;  2WSU A;  4FP3 A;  4OYU A;  5F3G A;  4WM7 B;  5CKQ A;  2XUE A;  2ZGR A;  5E89 A;  2BNM A;  4FOQ A;  2VMC A;  3TEW A;  4XUQ A;  2A3W A;  1GIC A;  3AMP A;  5I8S A;  3SEE A;  3BIW E;  4J25 A;  3DYP A;  1GQP A;  5A7S A;  4ZU7 A;  5FY7 A;  2C6S A;  4AE2 A;  1TZO A;  4TSV A;  1QJF A;  5A70 A;  2BP6 A;  3W20 A;  1RUG 3;  5ACA 3;  4OUM A;  2RV9 A;  4DY3 A;  5F6L B;  2MNG A;  1ZZC A;  1D4M 2;  2EF6 A;  3I3M A;  4IGO A;  3V0B B;  1GNY A;  2FCT A;  1MVE A;  1V9U 1;  2WLQ A;  1H4H A;  3T1L A;  4AVB A;  1W8H A;  4CUB A;  3NJZ A;  1RUC 2;  3ZPY A;  1CX1 A;  2E33 A;  1UAI A;  3TAY A;  1JZ3 A;  4IER A;  1JYW A;  2W1S A;  2W1U A;  2X8K A;  3QCW A;  3WDT A;  3HD8 B;  5CAZ A;  2FDH A;  4LTA A;  3NO8 A;  1VBB 3;  3AZZ A;  5FBZ A;  1C4R A;  2D6M A;  5FXX A;  3THD A;  1IOA A;  1QJX 3;  2PHF A;  1JYC A;  3EO6 A;  3BVC A;  2WQZ C;  1W3X A;  4Q1R A;  1AR7 3;  1RUG 1;  5C4W C;  2X5I B;  2PFW A;  1J3R A;  5C33 A;  2VUA A;  2WUH A;  5EJZ B;  3ETQ A;  1C8M 2;  1W8F A;  4O7X A;  5L19 A;  2DVA A;  5FFO C;  1DF0 A;  1RJ8 A;  3SCH A;  2CY6 A;  4TYS A;  4QGL A;  2VTX A;  5FPX A;  2O8Q A;  2JDA A;  2DVB A;  3LCP A;  1HRI 2;  3VGI A;  2QZ2 A;  5LCW L;  1XND A;  2D43 A;  2FCU A;  2OKX A;  4UF0 A;  2DUP A;  4QX5 A;  1VBB 1;  5L9V A;  1NA1 C;  1QJX 1;  1DHK B;  4XF3 A;  2VCB A;  3HN3 A;  1LHO A;  3AB0 A;  1N1V A;  1QF3 A;  5D8A B;  1DG6 A;  4ONU A;  3WDY A;  1YI9 A;  1AR7 1;  4XBL A;  4A6S A;  2WZP P;  3Q8B A;  3ZN6 B;  4UFK A;  4WZF A;  2JG9 B;  1VJ2 A;  2XUM A;  2NMO A;  1FX5 A;  1L3J A;  1W6M A;  1LOA A;  3FZ3 A;  2DCT A;  4JQT A;  2E7T A;  4L11 A;  4DIQ A;  3IDA A;  1GZC A;  3JBG 3;  4PLM A;  5C4W A;  2D3P A;  1YJL A;  2WNU B;  3IAP A;  2DUR A;  2E7A A;  1QJY 2;  2VNO A;  2ZXQ A;  4S2D A;  2GH8 A;  5J96 B;  2LW8 A;  2XJV A;  3ENR A;  3JU9 A;  2ADE A;  4UT5 A;  1W6O A;  2WN3 A;  4GWN A;  3GBW A;  4WVV A;  3WQ1 A;  5F1R A;  5L7O C;  2C9K A;  1RUE 2;  2HWC 3;  1KQR A;  3CMG A;  4W8J A;  2FD8 A;  2XWJ B;  4ZHN A;  1S1A A;  2W9X A;  3N7M A;  1PGW 2;  4XET A;  4Y20 B;  3SH4 A;  4HT1 T;  2A5Z A;  1LOF A;  4AED A;  3H3L A;  1B35 A;  1PK6 C;  1DZT A;  2EIC A;  3JBG 1;  3VD4 A;  4XMA A;  4BDV B;  3IKW A;  4CDX A;  5FWJ A;  4Y1Z A;  4YM2 A;  2B39 A;  3J8F 1;  1U5X A;  5K0U C;  3BOW A;  4Q0P A;  4WVM B;  2EIG A;  1XE8 A;  5LK5 A;  1PGL 2;  2BBA A;  4I0W B;  3N9P A;  2HWC 1;  5H9Q A;  4LK7 A;  5F37 A;  1OOP C;  1ST8 A;  1OLQ A;  1ULC A;  1CJP A;  2VL4 A;  2BPA 2;  4J6G A;  4QQL A;  2JEN A;  1J58 A;  3UGF A;  5CAD A;  1LCL A;  2K9Z A;  2LUW A;  3JUU A;  4W4Z A;  4QMA A;  5LA0 A;  1I5Z A;  2VW0 A;  3U14 A;  5C3R A;  4IE0 A;  4MET A;  1I1E A;  4NOT A;  5A3U A;  3LEM A;  1Q5O A;  1RUD 2;  2TEP A;  1A8M A;  3GM8 A;  1O3S A;  2ZHM A;  4ZXE A;  3PVO A;  1MQT B;  3CDZ B;  3WLU A;  4N43 B;  1XC6 A;  1ENR A;  3GXU A;  4KGQ A;  1MAC A;  2PLV 2;  3K46 A;  3NNL A;  2GAU A;  2P4E A;  4XXP A;  4YPJ A;  3ZYR A;  1RUO A;  2FCV A;  3AYC A;  3VBO B;  1GFF 2;  3NAP A;  4FO9 A;  4YVS C;  3ELN A;  3T1M A;  1RJ7 A;  2GP5 A;  4BPZ A;  3SNM A;  5J09 A;  1ZRI A;  1D0H A;  4Y4Y A;  4EE2 A;  2QDN A;  3KVB A;  1H8T C;  3IN9 A;  2YMZ A;  3ZXE A;  1VAV A;  4XF0 A;  5GLU A;  5T5L A;  1LB2 A;  4RR3 C;  2TUN A;  1MS8 A;  2BER A;  5L73 A;  3BPS A;  3RVH A;  3VBU A;  1RMU 3;  2YUE A;  5HXV A;  3CL1 A;  2YGM A;  4K21 A;  2D97 A;  4Q8L A;  2VCC A;  3D82 A;  4UW4 A;  2W87 A;  4XFA A;  3B93 A;  1O4Y A;  2XKO A;  4NJ4 A;  3VL9 A;  3CHX A;  3U4X A;  2PHT A;  3I2K A;  2XJP A;  3D4K A;  2AEN A;  3ZX7 A;  4PIZ A;  4COZ A;  1LEN A;  5A3O A;  4BQ1 A;  4P14 A;  1LHN A;  4E9K A;  3OGG A;  1Y7B A;  2W3J A;  4BIF A;  2VZ3 A;  1ASJ 3;  4LBL A;  2D5F A;  3R4S A;  4AHW A;  5HCH A;  5F7U A;  1N3P A;  2JKX A;  3ACF A;  1NXM A;  1AYN 2;  1RMU 1;  3ZSL A;  4EZH A;  4AZZ A;  4QB2 A;  5EV7 A;  4CUA A;  3I54 A;  1V0A A;  1BBT 3;  1ULP A;  4ZZ5 A;  2DU0 A;  4RR3 A;  1H2L A;  4JKK A;  1OQE A;  4QPI C;  5BNO C;  5C8C C;  4LBJ A;  2VGD A;  4YZ1 A;  3S30 A;  5C8W A;  1Q8S A;  2BGO A;  4DEV A;  1X33 A;  1U5Y A;  4BYY A;  3C2U A;  5DAX A;  4D6Q A;  4GWI A;  1OMI A;  1RUG 2;  4AFA A;  2JDY A;  1ASJ 1;  4JHT A;  5A3P A;  5FOB B;  2DV9 A;  1LEC A;  1S4C A;  4XDQ A;  4LIU A;  4ITC A;  4LKE A;  4AFC A;  4XUR A;  3K4A A;  5A3W A;  1OF3 A;  2DUO A;  1DZQ A;  1FAT A;  2BU9 A;  5F3E A;  2D6N A;  4DEQ A;  3AZW A;  5FYZ A;  4BLI A;  3RFR A;  5IVB A;  1BBT 1;  4LOR A;  3MUZ 1;  1KGY A;  2ADD A;  3S6P A;  5GLW A;  4B1M A;  3LA2 A;  4LA2 A;  4QX7 A;  4FAG A;  4XUT A;  1CAU A;  3J7L A;  1R1Z A;  4UF0 B;  4BIS A;  3BI3 A;  1A8D A;  1FV2 A;  1T6G C;  4O61 A;  1LU1 A;  1VBB 2;  2R32 A;  4ZKT B;  3DCQ A;  1AR7 2;  2SBA A;  2P1B A;  1WW6 A;  4M3C A;  1F5F A;  1UO9 A;  1C5I A;  1W6M B;  3N9O A;  5DDJ 3;  5JR2 A;  1HRV 3;  2VZS A;  4MUV A;  3U07 A;  3M3C A;  3IDC B;  1ND2 C;  5C4W B;  1YQC A;  3I3B A;  1NX9 A;  4OMC A;  5DG1 A;  3H42 B;  1JBC A;  1RUJ 2;  3Q8A A;  4R9A A;  3QH6 A;  4Y5Z 0;  2E31 A;  4XFC A;  3IWZ A;  4CDU C;  1QQP 3;  1DIW A;  3PUS A;  1SCR A;  4MGI E;  1V70 A;  1W6O B;  4NAM A;  4AR2 A;  1XBF A;  5FP7 A;  3NKG A;  4Z1V A;  3QH7 A;  3WG4 A;  4MAD A;  5FZ3 A;  2VU9 A;  4XJW A;  1R1A 3;  3KSC A;  3ZLI A;  3SQO A;  1J59 A;  3ZFF C;  1P8J A;  5ABJ C;  2BTV C;  3H8R A;  3WDV A;  4AED B;  4DMI A;  1V00 A;  1EP0 A;  2J1T A;  4HK9 A;  1B35 B;  2PHX A;  5JXG A;  3VUO A;  4E27 A;  2Y6L A;  5DZG A;  5EFU A;  4UFM A;  1PNG A;  5KHK A;  3JBG 2;  4CDX B;  3T4H B;  3SLI A;  5FR3 A;  4A45 A;  2XXZ A;  2JX9 A;  1RIN A;  5E16 A;  4AGV A;  2UY9 A;  4HOO A;  4QX8 A;  4FPO B;  3ZKY A;  1QQP 1;  4GMP 0;  2R07 3;  2EAL A;  2J22 A;  2WDB A;  3PIJ A;  2LAL A;  1K5M A;  2D6O X;  5C3O A;  5CFD C;  2XLF A;  4FOW A;  4BLJ A;  1XNT A;  3QD6 A;  4CEY C;  1R1A 1;  2A70 A;  1NE4 A;  2VTF A;  2ZHL A;  4NAO A;  4QXB A;  3HVD A;  2JE9 A;  3VBH C;  3TEZ A;  1MPX A;  4DUV A;  3C7O A;  4FFF A;  2XB6 C;  3M3O A;  3N9N A;  4NWV A;  3K3N A;  1SBF A;  3DKQ A;  1Y9M A;  5C3Q A;  1ND3 A;  4AXO A;  5FPZ A;  4Y1Y A;  3J26 N;  5FBJ A;  4ZZ8 A;  5ABJ A;  5JAX A;  1FMD 1;  2BNN A;  3LSD A;  4BQ5 A;  1QU0 A;  1REF A;  2EAK A;  3A7Q A;  2R04 3;  3VHO A;  5I93 A;  5LRR A;  2VAU A;  1FNZ A;  2R07 1;  2HWB 2;  3RRD A;  4ARX A;  1ZVF A;  5B2G B;  1RUI 3;  3GCW A;  5A7P A;  1ULD A;  2NZ9 A;  2CAV A;  4P9J A;  1AR6 3;  5JPM B;  3O1R A;  4UI9 L;  3HMY A;  3PUR A;  4AEK A;  3PU8 A;  2VZ1 A;  3E1F 1;  4MHR A;  2WNV C;  2YY1 A;  1F9K A;  2RR1 2;  1LGB A;  2GMP A;  2QCS B;  3ETP A;  3GDB A;  4YW1 A;  1ENX A;  3I2J A;  3J7M A;  3MIB A;  5LAS A;  1SPP A;  4LLF A;  4UXA A;  4Q4Y 3;  3VBU B;  5JXJ A;  2R04 1;  2Y26 A;  1H9W A;  1ZBA 2;  5FYH A;  5JIU A;  4UBG A;  4XDO A;  3LOI A;  1QJZ A;  1WMF A;  2J1S A;  5FK8 A;  1RUI 1;  4FAH A;  1PVX A;  2CGO A;  3HWJ A;  3OGJ A;  4OLL A;  5DUV A;  5LW9 A;  3MV0 1;  5JI7 A;  1UZV A;  4DS0 A;  1VR3 A;  1AR6 1;  2XHN A;  4YW3 A;  2ZCW A;  2DWR A;  5BNQ A;  2R06 3;  2KD7 A;  1YO8 A;  2ZA9 A;  2BGC A;  3ZR6 A;  1ENQ A;  4IEX A;  2BOJ A;  3BOP A;  4P5Y A;  3RZK A;  1APN A;  3B02 A;  4CDW B;  2QQO A;  4EN0 A;  4LPL A;  2RJK A;  3MDP A;  2QE3 A;  5IVY A;  4Q4Y 1;  4IEZ A;  2ZJC A;  3POI A;  2XJT A;  3IM0 A;  4DPN A;  1RMU 2;  3ZYP A;  2WNV A;  1W3V A;  1UWW A;  1S0D A;  3AVR A;  4G3Y C;  2ZMK A;  2V09 A;  4NRO A;  3PUA A;  4RR3 B;  4IGQ A;  4ATE A;  4X6Q B;  2VCA A;  3N3H A;  4QD2 A;  4Y5S A;  2BWA A;  3WUC A;  5FUN A;  3BTX A;  3JD7 3;  2R0H A;  5FZ0 A;  4JVA A;  4KWL A;  2R06 1;  2WII B;  4L0P A;  5JPN B;  4NRQ A;  3U75 A;  1AUY A;  1WBF A;  3AKR A;  3RYK A;  3HNB M;  3VHN A;  2DTY A;  4XHB A;  4N53 A;  2YU2 A;  3CJI C;  4PDW C;  3HQX A;  1XYO A;  5HI0 A;  4BXF A;  3D5O A;  3WV6 A;  2KR2 A;  3WW3 A;  2ZX0 A;  3KVA A;  1UQX A;  1GWM A;  4NHL A;  2PAE A;  1BMV 2;  3E5Q A;  4QXC A;  4CYD A;  1YEW A;  1CAU B;  3AVS A;  4CDQ A;  3EXU A;  4AVV A;  4IES A;  1QKQ A;  3N7L A;  4CCO A;  5FJH A;  3JD7 1;  4B29 A;  4X8N A;  1AYM 3;  2PAK A;  1HKD A;  1OVS A;  2XPJ A;  2P3J A;  3URF A;  2P17 A;  2ZX2 A;  5FYC A;  1NCR C;  4BE3 A;  1GZW A;  1QXR A;  2ZBJ A;  4M3C B;  4YGB A;  3O12 A;  2NN8 A;  2W1Q A;  1SDW A;  4LO7 A;  3ON7 A;  2W0X A;  4KQ7 A;  1AL0 G;  4PIY A;  2WNO A;  4I02 A;  4QPG C;  2BFU S;  2EXK A;  1W9W A;  1OA2 A;  2BZD A;  4M4R A;  2YC4 A;  5J48 A;  5HCA A;  1UN1 A;  1XYP A;  4JX0 A;  1O3Q A;  2C1F A;  3AP7 A;  4RS5 C;  3NNG A;  3SEP A;  1E57 A;  4BQY A;  1FOD 2;  2VW2 A;  5FAX A;  5G05 L;  5EP9 A;  4EV0 A;  4JDM A;  2EXH A;  3OG2 A;  3O5S A;  4KMQ A;  1DLL A;  1AYM 1;  2AEZ A;  3J7H A;  4XZP A;  5J7M A;  1U5Z A;  3B9C A;  4H55 A;  5A6Y A;  3NST A;  1B09 A;  4F8A A;  1W03 A;  1E5R A;  4JGY C;  5C70 A;  3LGR A;  1OC1 A;  4EWE A;  5DDJ 2;  1HRV 2;  3K75 B;  3HBK A;  2I45 A;  3PUH A;  2R7E B;  1OA4 A;  1W2A X;  3RG0 A;  2QQM A;  3VKM A;  4XTP A;  4E8C A;  3LQC A;  4OMD A;  3MYX A;  4CEW C;  3ES1 A;  5A7W A;  4AI1 A;  1UYY A;  1W6P A;  3WIN E;  3KZ4 C;  3PLQ A;  4WM7 A;  4BJ0 A;  5IUQ A;  3VBF A;  1OH3 A;  1WW7 A;  2DU1 A;  4LOT A;  5F8P A;  3PVN A;  4B3N A;  1RVF 2;  4L97 A;  2VCM A;  5FP4 A;  1ULE A;  2AZ5 A;  3LSE A;  1JUH A;  2HLE A;  1MZE A;  3CF6 E;  2P37 A;  3OBT A;  3HNM A;  4BME A;  5DAW A;  3RZM A;  4IXL A;  2D5H A;  4V1P A;  5IAT A;  2H0V A;  4K1Y A;  5ISL A;  1WA4 A;  4AQ6 A;  1ND3 B;  2A3Y A;  4HSL A;  2Q30 A;  4IEV A;  3ZFF B;  2RG4 A;  5FY0 A;  2FZ2 A;  1OSG A;  2XBO 3;  3KB5 A;  3KV9 A;  3POS A;  4YVW C;  5F5A A;  2QQN A;  4JQR A;  5ABJ B;  1BKZ A;  2HWF 3;  2X09 A;  3TBD A;  4NHX A;  1LNS A;  4GZ9 A;  3M8L A;  1KS4 A;  1W8T A;  3D6E A;  3RDI A;  2FZ1 A;  2R07 2;  3K4D A;  1BVP 1;  3THT A;  4CP1 A;  5J36 A;  1AR8 3;  4MH0 E;  4BOW A;  2XVK A;  2RMU 3;  3OBR A;  5KHG A;  2OUJ A;  4P00 B;  1XXN A;  4IE6 A;  3DL3 A;  3ZMN A;  4BQX A;  2QQU A;  3H50 A;  4NE9 A;  1VBC 2;  1ZZ8 A;  2ARC A;  2B4K A;  2JDP A;  5CFD B;  3K51 A;  3BUC A;  2WC2 A;  3DPR A;  3ZFE C;  5C9A C;  1CR7 A;  4LKF A;  5JXI A;  5C5U A;  5T5J A;  4A44 A;  5JIA A;  1SPP B;  2XBO 1;  4KI5 M;  1EYB A;  3TRS B;  2HWF 1;  4NHY A;  1US2 A;  4J1W A;  3O1V A;  2R04 2;  4XAA A;  5KWR A;  3O1P A;  2PA7 A;  5KXB A;  2E6V A;  1GKB A;  2PHD A;  1QEX A;  1UYZ A;  4WZC A;  4YVW A;  2G9G A;  1KFX L;  2N7G A;  2RMU 1;  2Y60 A;  1UX7 A;  3I8T A;  3EBR A;  3RWK X;  1H1A A;  1WGP A;  1YFW A;  3RZL A;  2VVE A;  2G9Z A;  2WT0 A;  4AAP A;  3FFZ A;  3DEC A;  1YQ5 A;  3LEG A;  4M3C E;  1VAM A;  3T2Q A;  4OI4 A;  4Q4X 3;  1KJR A;  3PNA A;  3Q8F A;  4G4F A;  3WX5 A;  1VBD 2;  4FTE A;  4C8D A;  1GYK A;  2ETE A;  2E26 A;  4Q4Y 2;  3GZT B;  3M70 A;  2DCK A;  2WNV B;  5C9A A;  2RS5 2;  5GZE A;  2QNK A;  2ARB A;  4A3Z A;  4XE9 A;  3ES4 A;  3INA A;  5T52 A;  1OUX A;  4QGM A;  5FQ0 B;  4Q4W 3;  1R08 2;  3WF0 A;  3KV6 A;  1N3Q A;  3GF6 A;  2DVF A;  3KWV A;  3MV1 1;  5AVA A;  1FI2 A;  3WCR A;  1OHF A;  5FRE A;  3H7J A;  4JC1 A;  2HEY F;  1UXX X;  5L36 A;  1UYP A;  2ARX A;  2WFF 3;  5DZF A;  4P9L A;  1EV1 3;  4EN8 B;  4Q4X 1;  1GNH A;  4N53 B;  4XQD A;  4AQ2 A;  4D6S A;  3PIG A;  4A7K A;  4E2S A;  5DUX A; 
#chains in the Genus database with same CATH homology
 5A7P A;  5FY9 A;  2YPD A;  5IVC A;  3PUR A;  3U4S A;  3PU8 A;  4CCN A;  5FZ1 A;  2XDV A;  4GD4 A;  5FPB A;  4CCL A;  5FZL A;  4Y4R A;  2Q8C A;  5IVF A;  2P5B A;  4GAZ A;  5IVJ A;  4D6Q A;  5FZH A;  1VRB A;  5A3P A;  5A7W A;  2WWU A;  5E6H A;  2Q8D A;  4LIU A;  5FWE A;  3NJY A;  2YU1 A;  5FXZ A;  5A3W A;  5A7O A;  5FYH A;  5F3E A;  4HON A;  3UYJ A;  5FYB A;  4LIT A;  5FZ8 A;  4XDO A;  5FYZ A;  5IVB A;  5FZF A;  5FPU A;  2WWJ A;  4NUB A;  5FP4 A;  3N9M A;  5LW9 A;  3K3O A;  4QX7 A;  4D6R A;  3LD8 A;  5A1F A;  5ANQ A;  4UF0 B;  5FWJ A;  5IW0 A;  4BIS A;  4CCM A;  4AI9 A;  5ISL A;  5LY1 A;  4LIV A;  5KR7 A;  5FY0 A;  5F3G A;  3PU3 A;  3KV9 A;  5F5A A;  5LWB A;  2XUE A;  4V2W A;  3DXU A;  5FYS A;  5FYM A;  4Y33 A;  5FPA A;  3N9P A;  5FP8 A;  5IVY A;  5F37 A;  4QU1 A;  4BU2 A;  4CCJ A;  3N9O A;  4IGP A;  5A7S A;  3AVR A;  5IVV A;  3PDQ A;  5FY7 A;  4DO0 A;  3KV4 A;  5FUP A;  3PUA A;  5FZD A;  4IGQ A;  5FZ7 A;  5FYY A;  3N9L A;  5F5I A;  3OPT A;  5FZO A;  5FUN A;  5LY2 A;  5IVE A;  2OQ7 A;  3OPW A;  4XDP A;  5FJK A;  3PUS A;  2GP3 A;  5FZ0 A;  5FXV A;  4IGO A;  5F2W A;  5FP7 A;  3U78 A;  3ZLI A;  5FZ3 A;  5A7W B;  4GJY A;  2YU2 A;  3ZPO A;  5FY5 A;  5A1L A;  5FZA A;  4BXF A;  5FZ6 A;  2VD7 A;  4V2V A;  5FY1 A;  2OQ6 A;  3KVA A;  5FP3 A;  2OX0 A;  4ASK A;  2OS2 A;  5FZM A;  2GP5 A;  3PTR B;  2PXJ A;  2Q8E A;  5FXX A;  3KVB A;  4QXC A;  5F2S A;  4EZ4 A;  2W2I A;  3AVS A;  4CCO A;  2XXZ A;  5FJH A;  5FZ9 A;  4AAP A;  4HOO A;  4QX8 A;  5FY8 A;  3DXT A;  4LXL A;  5FYV A;  3RVH A;  2OT7 A;  5F3C A;  5FY4 A;  5FXW A;  4QWN A;  4CUG A;  5FPL A;  4EYU A;  4CCK A;  5FYC A;  5FV3 A;  5F5C A;  4C8D A;  2YBP A;  5F32 A;  5FZC A;  5IWF A;  2YBS A;  5A80 A;  5FYI A;  4CSW A;  4QXB A;  4GJZ A;  5CEH A;  5FZE A;  5A3T A;  5FZB A;  3AL5 A;  4UF0 A;  3N9N A;  3K3N A;  5FZI A;  5FYT A;  5FZ4 A;  3KV6 A;  5FZO B;  5A3N A;  4URA A;  3N9Q A;  2XML A;  5FBJ A;  2YBK A;  5K4L A;  4E4H A;  3LDB A;  5A7N A;  5A7Q A;  4TN7 A;  3K2O A;  4Y3O A;  4QXH A;  5FZK A;  4EZH A;  3PUQ A;  5F39 A;  5FPV A;  5FYU A;  3KV5 A;  5FZG A;  4DIQ A;  4D6S A;  5FP9 A;  5F3I A;  3AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...