5A7OA

Crystal structure of human jmjd2a in complex with compound 42
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7oA01
5FZHA 4IGOA 4QXCA 4QX8A 5ISLA 3N9MA 3N9NA 5IVJA 2W2IA 3K3OA 5FYVA 3AL5A 3PU8A 5FJHA 4UF0B 4XDOA 2WWJA 3AL6A 5F2WA 4EYUA 3UYJA 4CCJA 5FXXA 5FXWA 5CEHA 2OQ7A 5F3EA 4LIUA 3LDBA 2YPDA 5A3TA 5FJKA 4UF0A 3PUAA 3N9QA 5FPBA 5FZAA 5IW0A 5F2SA 2Q8CA 4EZHA 5FZ8A 4V2VA 5FZMA 2XDVA 2YBPA 3DXTA 3KVAA 3PUQA 5FP3A 5A3WA 5FYZA 4D6RA 5F3GA 5FWEA 5FBJA 2OS2A 2Q8EA 5FZLA 5A7SA 4LXLA 5FV3A 4GJYA 4E4HA 4D6SA 4GAZA 5FZFA 3AVRA 4HONA 4IGQA 5A7QA 5IWFA 5A7OA 5FZIA 5F5IA 4ASKA 3KV6A 2VD7A 3PUSA 4V2WA 5FZ0A 4LIVA 5FZ6A 2GP3A 5FYSA 5F39A 5F3CA 2OT7A 4HOOA 5FYYA 5IVEA 4CUGA 3KV5A 4C8DA 5FP9A 2YBKA 5FYHA 2Q8DA 5F32A 5A7NA 5LY2A 5FXVA 4CCMA 5A1FA 5FWJA 4CSWA 3KVBA 3PURA 5FZDA 5FZGA 4DO0A 5FXZA 5A7WB 4QXHA 5IVCA 3PDQA 5IVVA 5FYMA 4GD4A 4LITA 3N9LA 4CCLA 5FPVA 2YU1A 5FY0A 3OPTA 2GP5A 4QWNA 5FUPA 5FPLA 2OX0A 5FZ4A 2OQ6A 4QU1A 5FY9A 5FZBA 4NUBA 4Y33A 5A7WA 4URAA 5FP7A 3AVSA 3KV9A 4TN7A 2PXJA 4Y4RA 5LY1A 3N9OA 3DXUA 3OPWA 5FZEA 4D6QA 5IVFA 5FP4A 5FZ3A 3NJYA 5LW9A 5F5CA 3ZPOA 4CCOA 3N9PA 5FZ7A 4CCKA 5ANQA 2XMLA 5FYCA 5FY4A 4QXBA 5FZOB 5FY7A 2YU2A 4QX7A 5KR7A 5FY5A 3U4SA 5A7PA 5FYTA 3U78A 4BISA 4BXFA 5FZ1A 4AAPA 5FZCA 2YBSA 5F3IA 5FPAA 5LWBA 2WWUA 5FY1A 5FZOA 4CCNA 4XDPA 4BU2A 1VRBA 3PTRB 5FYIA 2XUEA 5FYUA 5A3PA 2P5BA 4IGPA 5FUNA 4AI9A 5F37A 5FPUA 4DIQA 5A1LA 3LD8A 3PU3A 5FZ9A 5E6HA 5IVBA 4EZ4A 3RVHA 5A3NA 5K4LA 2XXZA 3K3NA 4GJZA 5A80A 5FYBA 5FY8A 3ZLIA 3K2OA 3KV4A 4Y3OA 5FP8A 5IVYA 5FZKA 5F5AA
chains in the Genus database with same CATH superfamily
1PHMA 1ZBE2 2QCSB 4YGDA 3LE0A 1SLIA 1OSGA 2VGDA 3OGGA 5DPNA 4Q1RA 2BDRA 1IHMA 3N7MA 3WUDA 5A1AA 1Q8QA 2WLPA 5FLIA 3A4UA 1LEDA 3DF0A 3OEBA 4Z92B 2TEPA 5T54A 5L7OB 1UW8A 4FQZA 1DIWA 4MHUA 1UPIA 1SLBA 3EXUA 3IKWA 2ZHLA 3LGRA 3OCPA 4QPGB 1XNTA 5IFPA 3LEKA 3T2QA 4FFHA 2YPDA 4RSUA 3DPRC 2OZ6A 4WZCA 1VALA 2ZACA 3AZVA 4HXCA 1W9TA 2D93A 3IBMA 3B69A 3O7OA 5F2SA 3TB0A 2EIDA 1ULOA 1LB2A 2XOMA 3NRUA 2OIIA 3EJKA 2D5HA 4PJYA 4QM8A 2ZKLA 3E97A 4XQWA 4B29A 2GN7A 4JGZC 1HXS2 2SLIA 1W0PA 2ZGRA 1HW5A 2E9QA 3HT2A 1W03A 3VHOA 3EMRA 4H7MA 4EV0A 2CWMA 1KJRA 2ADEA 2ZEXA 3FE5A 5FPZA 5LCWL 2Y6GA 4CP2A 3J7HA 3VBOB 5JAXA 1SLAA 2A1XA 2F4PA 4Y1UA 3TOJA 2GNMA 1O5LA 2ZX3A 4X6QB 1PK6A 4LE4A 5KBFA 4DNYA 3UETA 2V5YA 5G05L 2WFF3 5L73A 1OURA 5HPOA 1W9FA 1RUH2 1O3SA 4NRPA 2BEOA 4W50A 5FXZA 4ES9A 4CDUC 5IVVA 1XNCA 2VUJA 4XIKA 2ZA9A 3K4ZA 2UWCA 4QWNA 3LKJA 1H30A 4QU1A 4ZKTB 4AI0A 4NUBA 2JECA 1AR61 2EXHA 1COV2 2UU8A 4RA0A 2FMYA 4IEWA 3THDA 1NXD1 2GC3A 5A3UA 1EPWA 1LEMA 2E7TA 3AYEA 3CHXA 4KBBA 2J1TA 2RJLA 1ZX5A 5FZ3A 3ZX7A 1NCQC 5LW9A 3I7DA 4QHOA 1ZRCA 5FMBA 1HDKA 2Y33A 4Y24A 1YNAA 4XXPA 1XE7A 1IOAA 4QX3A 5JSPA 3KHCA 1RMU2 3BKZA 1W6MB 3WHTA 2ZKNA 4LBKA 4LT5A 3L2HA 3O1TA 1FXZA 1YCIA 3T3YA 1ODMA 5FO9B 4LTAA 2YGMA 4X6RB 2AENA 2ZPXA 4A6SA 3E5QA 3N3HA 4CCNA 1XYOA 4DOUA 1G9FA 4FSJA 2DFCA 1H2KA 1RGSA 4IGPA 3VDDA 4CE8A 4K9SA 2Y0OA 4DIQA 3IAPA 3OGVA 4XJ9A 5JZGA 1PO22 1RC6A 3WOGA 1RUE2 4IV1B 3DCQA 1H1MA 2ZEYA 2XXZA 1MS5A 2R043 3NNLA 5FY8A 5FP8A 5IVYA 4BQ1A 4IDZA 4CUGA 2Y34A 2ZGNA 2B4KA 3O1OA 1KXGA 3H8UA 1UIKA 4UFJA 2VO5A 1LULA 5FK7A 3ZFGA 5KXDA 1PX4A 1W99A 5IJRA 4NRMA 2IUWA 1EUTA 1WBLA 3HNBM 5T5PA 1QEXA 3AL5A 2UWBA 4LBOA 4NE9A 4XEZA 5CFDC 4CUAA 4A3ZA 4HK8A 1AX0A 1O4TA 3BALA 2HWD2 3OEAA 4YSFA 5FAXA 4PF5A 2XVGA 3H42B 2VPVA 4Q0VA 3ZDSA 4CCJA 1O5UA 3APBA 5KHHA 1CAWB 4I0AA 1ZRDA 4LIUA 3RS6A 3LDBA 4BK4A 5FJKA 1SCSA 2E53A 1CZTA 2YFUA 3SMHA 2JG8C 4B4PA 3B01A 1QJU2 2ZGUA 3B7MA 1IPKA 1FV3A 1GP5A 1QH6A 1SG3A 3K4AA 4K40A 5FBJA 5HI0A 1JUIA 3OGJA 4XUPA 1XNAA 2VBPA 4F8AA 1HXS1 1W8OA 3LFIA 3U37A 3BU0A 1HXS3 2D6LX 5A7QA 1H9PA 3QH6A 1F15A 3GALA 4LOTA 5DG2A 3HJRA 5LBCA 3WD5A 1TNFA 4YGBA 1ULCA 5A3OA 1AUYA 2XJPA 2J42A 1UKRA 1ZRFA 2BERA 1DQ6A 1VBD1 1HRI3 1V70A 3DPRB 2TNFA 1VBD3 3ZIXA 4IE0A 3VZLA 3MW4A 1KFXL 4B3NA 2CGOA 1X9TA 1FNYA 2J1EA 3VD7A 4RGGA 4S2DA 4G4FA 4HFSA 1AXYA 2X10A 1H8TC 3I4IA 1PGW1 2WQ8A 1UU6A 2R1BA 4XXAA 5JPMB 2PA7A 5FY0A 4JGZB 2A71A 1WCQA 2YY1A 4A42A 2RHPA 4DXTA 2HWE2 1FMD1 3KCCA 1C8M2 4FOWA 3LDKA 4YG3A 1FMD3 1HIXA 1T2XA 1V00A 3NV4A 4LHKA 4CZSA 5T50A 5C3QA 3GCXA 3ZFFC 2G9FA 4AVAA 1IPJA 2W5FA 3O0WA 4MADA 4N53A 4D6QA 1RTVA 2WQ4A 3OPWA 4GMP1 1DU3D 5GLZA 1N1YA 4GMP3 1GOFA 1PIV1 2LRPA 2XUMA 1PIV3 4BQ4A 1OMIA 4EJRA 2KM2A 5FMOS 1DGLA 3KZ4C 3D6EA 4QGNA 1V6MA 4XVHA 3VZJA 4Y4YA 1RMU1 3ZO0B 1F4AA 5JLVA 5KR7A 3PUHA 3B9IA 4CDQA 2B9UA 2A6ZA 2EXJA 2QVSB 4NPRA 1QWRA 5APAA 3SISA 3OGRA 2ARCA 1LOEA 3FHAA 2WNVC 3IDAA 2KR2A 2VQ0A 4CDUB 4XF4A 3AP6A 1H1AA 1C4RA 4IEXA 4RYDA 4YYOA 2IVIB 2PQSA 1AX1A 3MPBA 1G86A 2O8QA 1O3QA 5CFCC 1VMJA 3NJVA 2FDGA 1UXZA 2VG9A 4ZONA 1RUE1 5DG1A 5T3NA 4MH0E 4CP0A 1RUD2 4EZ4A 5BY5A 1REDA 2MNGA 1MZEA 4NN0A 3UGGA 4NO4A 4YFWA 5J09A 4ZZ8A 2W0XA 1ENQA 1B09A 1NCQB 3O1PA 1A3KA 4OMDA 4FBFA 2ORXA 4QQ2A 1L7LA 3NWKA 2ILMA 4DQAA 2JENA 3USUB 1V6OA 1DG6A 2CAVA 2WQZC 4HSLA 1KDKA 1JZ8A 4Z2WA 3VBRC 2XJTA 2WWJA 4ORFA 4OQ8A 3R0RA 5BNOA 5I8TA 2HWD1 1J84A 1CR7A 4MGSA 4GMP0 4QKNA 2XBO2 1SZBA 3BTXA 4WM7C 4XABA 2VZUA 4V1PA 3PTYA 4YRDA 5JVVA 3OUIA 5DZFA 1E5RA 1QJU1 2XVKA 2J1AA 3S6PA 4EZHA 4LMFA 1QJU3 1M06G 2G19A 1YJKA 2BU9A 3MV11 2GAUA 3WNKA 5JOWA 1AVBA 2YYOA 3P5BA 3HNYM 5GLUA 2ORZA 5GLTA 4P02B 3LWCA 3VBSA 1UMIA 5H9RA 3VL9A 4GAZA 4DRRA 4AHWA 3AJZA 4FPEA 2QQWA 2ZX0A 3AK0A 4W6YA 2YROA 4P9JA 3C7OA 2R30A 5CFDB 1UYZA 2GMEA 3CDZB 2IXKA 4OUMA 3FHIB 2QE3A 3ZOIA 4RQPC 3Q8CA 4HKWA 4CEWA 1YIFA 2ZHMA 5H9SA 5E88A 4C8DA 1NAEA 1OVSA 1WMFA 5FMOL 2DFBA 2XLGA 4BM8A 3VV1A 5JCTA 3ENRA 3S5QA 1Y9MA 4R4XA 4CCMA 4R9AA 4JX0A 2JG8B 1YQ2A 3RJRA 2ZHNA 2PAMA 1Q5OA 4IEYA 4LBQD 4PBOA 5DAQA 3AM2A 2X05A 4CXYA 5FYMA 1VBA3 2I45A 2OUJA 3RPQA 4MGYE 2BOIA 2DVAA 3FLTA 5FPLA 1ENRA 4OCTA 2HWE1 4GZ9A 4W8JA 1C8M1 4DXSA 2HWE3 4QGMA 1MS8A 4HVRA 2YUEA 4MO3M 4AEDA 4URAA 5FP7A 3ZSEA 3VZMA 1B35C 4QPIA 5JPNB 3MO4A 2NMNA 4Y4RA 5F5QA 2PHFA 3UJQA 2OXBA 4EN9B 3POBA 2XLFA 1J59A 1RUI2 1OF4A 3JQWA 3KT4A 4COWA 4LKEA 2WN3A 3WQ0A 1G9AA 1RUNA 2HEYF 5BYNA 5LA2A 3AZZA 2QKDA 3GXUA 2GDFA 5FZOB 4WVZA 4FOQA 4LBQA 3JB4C 3SH4A 3GM8A 2VNOA 2J22A 4BISA 3RRDA 4IW3A 1U5XA 4M3CA 1H8TB 2ET1A 3N36A 4CEYA 1DFQA 3A0KA 4JQTA 4A44A 4EWDA 4GWIA 3ILFA 1MPXA 2WWSA 4LO4B 1V0AA 3HPNA 5HXMA 3GZTB 4LE3A 3NV3A 4QKDA 2P5BA 2GZWA 2WAAA 1URXA 2WKKA 1AR72 2D6OX 3ES1A 1QHDA 3I59A 4JGYC 4NPMA 1GUIA 5EIYB 4K3UA 4LPLA 5F6KA 3GZAA 1Q8SA 2WINB 4N9HA 3ZFFB 4B4QA 1RUD1 3OBZA 4YG0A 2ZJCA 3WW1A 4Q27A 1UO9A 3H3ZA 2PELA 1Q8PA 1OI6A 2R062 3ZN5A 4HT1T 2Q1ZB 4I30A 3MFCA 4Q8LA 2X8KA 1O59A 5LEJA 1XRUA 4OI4A 1KDMA 2VCBA 2GU9A 3K3OA 2VVDA 4DEQA 1WW4A 2DVGA 2VH9A 4Q2FA 1IZ3A 2HH9A 4PI0A 4E2QA 3I2DA 4PDWC 4AQ6A 2VXJA 2WNVB 3MIFA 4BXSV 2LTNA 1HRV3 2HBTA 5EV7A 4MZUA 5FXWA 3VLBB 3OUJA 3K51A 5JXJA 4Y5Z0 1TE1B 4DEVA 5A33B 1SPPB 5CFCB 4YM0A 1JYVA 2DBNA 1ND3C 1WW6A 4DINB 1ULGA 2RDRA 2VU9A 3CJXA 3MV01 4PCRA 5LBEA 4AEJA 2D3SA 3PUQA 3VBUA 1G6NA 3I8TA 4AFAA 3JBG2 1R1A3 2I07B 3I2JA 2OS2A 5LA0A 1QJY2 3M2MA 2P1BA 5GZFA 5HV4A 5A6YA 2C0ZA 2CGNA 3SEEA 4LR4A 3SLIA 2IFWA 2GC2A 4Z2AA 2C6SA 4E4ZA 1OPMA 5FZIA 3VBRB 4KNCA 2ZGPA 3EBRA 3H7JA 2ZMLA 2XR4A 5FQ0A 2VM9A 4OUEA 2C1FA 3I3QA 4GKYA 3BB6A 1FPN2 3GBGA 4LLOA 2Q1MA 4Q29A 4WVVA 5F39A 4AZZA 5JOYA 2HWF2 3WDYA 3T2TA 2P37A 4RR3A 1W8NA 4WM7B 2WYSA 2WZR1 2WZR3 5EJ1B 5LY2A 4XBNA 3TNQA 3NMBA 4ISRA 3ILRA 1ZBA3 5C4WA 1R082 2WT0A 5F9TA 4HVQA 5A7WB 1UYXA 1CQ9A 1LOCA 1W8FA 3SKVA 3ZDVA 1QDOA 2VCCA 3GBWA 5DAPA 2GP5A 1H9WA 4XURA 4LO6B 1XXNA 4H14A 4BMEA 1OLQA 1GFF2 2WL1A 1RYYA 1L7QA 3AP9A 1HB4A 1NE6A 5E16A 2BYVE 1TME2 4YM1A 3ZYFA 5CZKA 4LOSA 3IIIA 3TEWA 1R092 3PLQA 3DXUA 1S0FA 4R8HA 3RWNA 2XGXA 4RQPB 3V0AB 2BOJA 2VW0A 1SQ4A 1ZZ6A 1KRIA 4CCKA 3ALQA 2CDPA 3AYDA 4A3XA 2O0OA 4QX0A 4M0HA 3ILNA 2YC0A 4RR3C 4HETA 3WP6A 4O65A 4Q26A 2YBSA 3TN92 3NVCA 3WW2A 1AYN2 1RIRA 1S2KA 4I3PA 2BQPA 3OTFA 1BKZA 1NOVA 4AI9A 3SCGA 3QD6A 5FPUA 3GF6A 3MI8A 1AR71 4JDOA 1JODA 3PU3A 4Q4X2 3CO2A 1JH5A 3KS7A 3ZR5A 5L19A 2DV9A 4G3YC 4XF0A 3BPSA 1SFNA 3K3NA 4N9IA 5CISA 1V6JA 4AHZA 1BXHA 2B9VA 5FZKA 5C5UA 2BP6A 1KS5A 1QIQA 4CDWC 1CX1A 3FMGA 5LEKA 4YZ4A 1D4VB 4GXLA 4WBBA 4Q4Y2 3Q9OA 5E89A 5EFUA 3RZKA 5IVJA 2VL4A 5GLWA 2W2IA 3O1VA 2CL2A 2NP0A 1GANA 1QDCA 1D4M2 4AFBA 5FOJB 4AG4A 2QQLA 1W3VA 5C8CA 1YIPA 2XJSA 3CEWA 3J7MA 4FOYA 3EO6A 1NCRC 3MUY1 2WA3A 3ON7A 1RITA 3T1MA 2XL9A 2ZGLA 1A8MA 1W6OA 5I93A 4GWMA 5LB6A 2QQNA 5BNQA 1OH3A 2GNBA 1GZTA 1ZYBA 5BNPA 4JGYB 3WNXA 3ACHA 3WP3A 5FUIA 3I97A 3QCWA 4Q0PA 5JR7B 1UAIA 1SBEA 3SH5A 1UX6A 4FVVA 2FBEA 3VBHC 5F3GA 3WF1A 1IS6A 4J25A 3O12A 3JBG1 5FWEA 3KQRA 4D69A 1RHI2 4XFBA 2W1SA 3DYPA 5EPAA 5IUQA 2ZMKA 2WS93 4GJYA 1D0GA 1DLLA 1XU1A 2PHDA 2QJVA 2EICA 1SLTA 4YG6A 1NA1C 4BK5A 5A7OA 4ITCA 3LQCA 1CX4A 4PDWB 3ZM8A 2RDNA 4HSJA 1Y7BA 3AB0A 4V2WA 1DLCA 2XJVA 1NE4A 1FPN1 3WP4A 1P8JA 1XB9A 2W95A 3RG0A 5A32A 4IXLA 2DCKA 1C8NA 3VDAA 1JN2P 2VMCA 5FP9A 4JTOA 3CLPA 1W6QB 5C8CC 5FFOC 2BUKA 1VRH2 2WO1A 4YLZA 2W08A 1AXZA 1ND3B 3PL0A 3NAPC 1R081 4OZXA 4CP9B 3U11A 5J98B 5T55A 1AR91 3X29B 4KWKA 1AR93 2OX0A 4K21A 2Y60A 1W9YA 4O9GA 2DCYA 2DCZA 4KQ7A 2ZGMA 5LA1A 1Q8VA 3KGZA 1AR82 1CESA 5FRAA 4X8NA 1G9CA 1QMJA 1TMF3 2BZDA 5LY1A 3HN3A 1YYNA 3W9AA 4N8MA 2BJSA 4GQ7A 3ZKUA 1PNFA 1X82A 1OOPC 2DBIA 2W9XA 5LA9A 1CPNA 1POQA 3HN1A 4OVEA 4NIDA 4FTBA 4XFIA 3JD72 4AFDA 4AQSA 3J7LA 1SFPA 1M4WA 4GIQA 4HPKA 2QQOA 4RHV1 4RHV3 4YWAA 5FZCA 5IK7A 3V64A 1OQDA 2WABA 5L9VA 4COZA 4KWJA 1N3PA 2V4AA 3AXEA 5FPAA 3TN91 3UKTA 3TN93 5D8AA 1CN1A 2RE9A 3OJBA 4BMBA 2EF6A 2CSGA 1EPZA 4Y1VA 1U5IA 2XH6A 3ZXJA 2Z79A 2Z4FA 3FZ3A 4Y1XA 2PTMA 5DUWA 5K4LA 4B7KA 3ZLIA 4Y3OA 1W6NA 3QLQA 1S2BA 2EIGA 3LDRA 4P5YA 1W8UA 4MGZE 3THTA 4A45A 5C5TA 2D43A 3MGUA 4WV8A 2O14A 4Q4Y1 4DY5A 2IXIA 5ACA2 4KMQA 4Q4Y3 3WV6A 4QDSA 3W5MA 1ULPA 2A70A 2HEVF 2P2KA 3LSEA 3T0AA 3FFQA 3RDIA 3IPVB 1HQNA 3RFRA 3WG2A 5BNNA 5FKBA 5EXOA 1YFWA 1H4HA 2EAKA 3A22A 1Q43A 3JCIA 2ZHKA 4AGVA 5C71A 4BHPA 1I1EA 2VW2A 4BLJA 2R072 1JYTA 1WCKA 3DL3A 4QQOA 4LO8A 3AKQA 4UBHA 4LA3A 5FZAA 3FLPA 2EXIA 3FBYA 1PGL1 1ALYA 1DYKA 3FJSA 5BUVA 1FV2A 2B5HA 4L9BA 3AMNA 1AL21 4CDWB 3KSCA 1AL23 3Q8AA 1RHI1 4LXLA 2I74A 3ZKYA 1RHI3 3CJIB 4TWTA 5EP9A 4BWOA 4YNIA 5J48A 1UY2A 3E6BA 5JOXA 4GA9A 2CYFA 4LULA 4WM8A 2BFUS 3CL1A 3NKGA 3KV6A 1I5PA 3PUSA 4FP3A 1JI6A 1RL3A 3LFMA 1NCRB 3J7NA 1FNZA 4NR1A 2DCJA 4ZS3A 3ZYIB 3I2GA 2ENRA 4COVA 2WLQA 1FYUA 2YBKA 4QAWA 3MZHA 4OMCA 5F32A 4AEMA 4H7LA 1WZXA 1YLLA 2DUPA 4XAAA 1YFYA 5C3OA 4B8EA 3R4UA 3OUHA 2AR6A 1W0NA 2VUDA 3VBHB 2FCVA 3PDQA 3HMYA 1QJX2 3MFAA 4GD4A 1ZRRA 2BBVA 3DKQA 2ZGSA 5KC6A 5FPVA 1BCXA 5LATA 2VMEA 5DDJ2 2JEMA 4PIZA 3M70A 1Y43B 2VUAA 1NA1B 3KV9A 1AR81 3P3NA 3T2PA 3AP5A 4Y22A 1AR83 2R6QA 1S1AA 2PFWA 4RS5A 1BK1A 2DURA 3NJZA 1V9U2 3BTYA 3VBFB 5C33A 2P6CA 1BVVA 3ETQA 5JWPA 4X8PA 1DBNA 3DYMA 5IAVA 5K0UA 1DGRA 3WINE 4AFMA 2ZEWA 2XKPA 4FPFA 5FY7A 5LBBA 5IAXA 2Y26A 4EWAA 3D82A 3NAPB 4BXFA 1DDLA 3T2OA 3LIHA 1OVPA 2F6BA 1K5MA 1REEA 3EQEA 1V6KA 3ZFEA 2VY0A 5CG8A 2D3RA 1YI7A 2IZWA 2BGPA 2CWSA 2WR9A 2DU1A 4KG8A 4JTNA 4BOWA 1JXNA 5L36A 1JOJA 1F31A 5A3LA 1AR63 1MQTA 1IKPA 1LJ7A 3RVHA 1E57A 1TZOA 1KEXA 5CNAA 4RGAA 4XJ8A 4ASLA 1OOPB 3BCWA 1WBFA 4TSVA 2E32A 2ZZJA 2VOVA 3M8LA 1S0IA 1XQNA 1XBFA 4JKLA 2W1WA 4UI9L 3AMPA 3BTAA 2K46A 3MEPA 3TRSB 4RS5C 3PU8A 1IKQA 2P3KA 3M3OA 3WEZA 3T4HB 2BFUL 2Y38A 1WMDA 5FJHA 2HYKA 2IVJA 3T08A 1PK6C 3ZN6A 4ASMB 1LOFA 1QY4A 1XE8A 3AL6A 5T5OA 2I2SA 5A3MA 5JMOA 1U5ZA 4QB6A 2JB4A 2VQTA 4EYUA 3GNEA 5JR2A 5FXXA 1G9BA 2CGPA 3BOPA 1CAVB 2XHKA 3JUUA 4PF1A 2OQ7A 1BZWA 2WO3A 3WW4A 4XMAA 3H50A 4ZU4A 1O8SA 3FUOA 3RJ2X 3VKOA 5KXBA 3HWJA 1K3IA 3WCSA 3WNLA 1CZSA 3HQUA 3ZYJB 4JHTA 4FI9A 1H0BA 1XYPA 3H1WA 1GV9A 2D97A 4J1WA 1ZBE1 4XTMA 5AVPA 5GJ6A 3ZPYA 4YVSA 1PM4A 1ZBE3 4W6WA 3LF7A 4XUNA 1KD7A 3HVDA 5FPXA 2QQJA 4RL7A 4E8CA 4JRLA 4Q0UA 4XE9A 2X53S 3PVOA 2JDKA 3SQOA 4Z8BA 3KCXA 1DF0A 5JI9A 3HIFA 1N1VA 1XJAA 3TWIA 1S55A 2DUOA 2R0HA 5FZ6A 1NX9A 3LAGA 1PVC2 2W87A 2OUHA 3WLUA 5EJZB 3WHUA 3UJOA 1L3JA 4AWDA 1OUSA 1YQ6A 4QMAA 2EALA 1GZWB 1I5ZA 1WLDA 4IL7A 4QD2A 4C90A 4Y5SA 3A7QA 2CTVA 3KVBA 3VDDC 3OYWA 4Z82A 3SH3A 1W2OA 5LZ6A 2C24A 3R4DB 2QFEA 1Z0HA 3I3BA 1J1TA 3THPA 4M0NA 2VZQA 3HNMA 5A6XA 5JZGC 2WDBA 2CNAA 1PM7A 2H6CA 1UYYA 1V6IA 4DRVA 4NROA 1ND2A 2P6HA 5FZ4A 2OQ6A 4ZXEA 1BMV2 3T30A 1UWWA 2NQYA 2EIBA 3LSDA 3SNMA 2WN2A 3ZFGC 4YVSC 1GYKA 2E7QA 2TUNA 1D0HA 4PIXA 4CP1A 2P34A 3GHMA 4EN0A 4TYSA 4WVMB 1SBFA 1N1SA 3P6BA 3BIEA 4JRAA 1V9U1 1DZRA 1AL0G 1V6NA 4CTEA 1CGPA 1MS9A 4IEOA 2Y6HA 5JSRA 1X33A 2D6NA 2JG9A 2V4VA 4UW6A 3ZXEA 4BIFA 1RUH1 4XPVA 2AEYA 2SBAA 5ANNA 1RUH3 3M3CA 2GH8A 4NMIA 1GMMA 2V73A 2J1UA 4CDXA 5JIAA 5LK5A 1FOD2 1QXPA 4TXWA 1WLTA 1E5HA 2DUQA 1JYXA 3AYCA 1YUDA 1GP4A 1RXFA 3WG3A 5F37A 1S0DA 2RS52 3ACGA 3LD8A 1COV1 2D6MA 5FZ9A 1O91A 3POEA 4IV3A 2XJUA 3MPPG 1COV3 3KMHA 1GU3A 4AVCA 4ATEA 4CXXA 2YZ4A 4COUA 5A3NA 3VD5A 1ND2C 4UT5A 3VUOA 5T52A 5JXGA 3C2UA 4L2NA 4XUQA 1PGSA 4N43A 5F5AA 1RUF2 1OFNA 4PLMA 2RS12 4FQ4A 1STMA 2ZX4A 2DVBA 3A23A 1RMU3 2Y6KA 1XOYA 3KQ4B 3L2YA 4FTSA 1GWLA 1ULFA 1OHFA 2VMHA 3WDVA 3W21A 1DQ2A 3JB8A 3O5SA 1R1ZA 3AYAA 3WY6A 1UPSA 1ZZ9A 3OY8A 5FK8A 1LTEA 3HBKA 2D6PA 3LA2A 1OD5A 1QQP2 4NRQA 4DPNA 3C7HA 5DZGA 3MIGA 2WNOA 3PNAA 4XILA 1PO21 1WLWA 3W5NA 4GWNA 1PO23 4YM3A 1RUE3 1F9KA 1GNZA 2JE9A 2WO7A 5FZ8A 1HV0A 1DYOA 3HT1A 5FOBB 4Q4V2 2WFPA 2XLAA 1C3HA 2CU5A 3VDCA 4LBLA 3AC0A 4N53C 2OPKA 1HJFA 3UGHA 1H6XA 4YGCA 1CJPA 2RS32 3AVRA 2YV8A 4IQPA 4KL1A 2JDNA 4B1MA 5ABJA 5F5IA 1PK6B 1JU4A 3T09A 3ZYRA 3M3IA 3ROUA 1C5IA 5I0SA 2HWD3 4UW3A 1JHNA 4CDQC 1C57A 1PVC1 1OPOA 2LALA 5ERLA 1PVC3 4LUKA 4EE2A 5B4NA 1CZVA 2UYBA 4M4PA 4FFFA 5AC92 5J96B 5JSOA 1KFUL 5FZDA 3F95A 1SACA 1J1LA 2E26A 2VMIA 5C9AA 3O1MA 5FCCA 4MXWA 4IE6A 2VAUA 2WT2A 4XQ4A 4M00A 5CBLA 4LK7A 3T0BA 2VZTA 1N1TA 3LEGA 4ARXA 2QDNA 5FY9A 5FZBA 4DS0A 5F7UA 2VOXA 3CF6E 3MLLA 4YZ2A 2ZX1A 2LW8A 1W6PA 1EY2A 3TEXA 1ULEA 3PIGA 1JYCA 4YW6A 1OUXA 1R64A 4LKSA 1PZ9A 1UU5A 3WDXA 4ET7A 4P14A 1J3PA 4QDRA 2PHXA 4ISQA 2R49A 1ASJ2 4FPCA 4BE3A 3TBDA 4FPGA 3QBQA 5CB7A 5BNOC 1GZ9A 5F8PA 5L9BA 3WF0A 1UY4A 3ZXAC 2VR4A 1W28A 2ID4A 3BI3A 1EV12 1W9WA 3PHMA 3U78A 2J1VA 3VDDB 5FZ1A 3SKJE 4IERA 4Q0SA 3BIWE 1YQCA 1FOD1 5JZGB 3MIEA 1FOD3 2NM1A 1SHWB 5HCFA 1VR3A 5CKMA 2AGSA 3ZMNA 2IXJA 2MEV2 1QKQA 1C8M3 3RYPA 2BBAA 5CADA 2ZAAA 3LOIA 3ZFGB 2Y64A 1MS4A 1VMFA 4CUBA 1WW7A 5E6HA 5IVBA 3ZXLA 3N4MA 5SV8A 3FL7A 5A80A 3VBSC 4GJZA 4YARA 2WNUA 3K4DA 5TSWA 1LCLA 1WCSA 4UFKA 3ZYPA 2JDYA 2FCTA 2ZGTA 4QX2A 1RUF1 2DCTA 1WD4A 3RMXA 5FDBA 4JKMA 4XBLA 4A4AA 3UT0A 2QQVA 3N9NA 4AGRA 2VUCA 4CEWC 4K6BA 4K8FA 5FYVA 4Q0QA 4LBJA 4XDQA 4CYDA 1WW5A 4Q1PA 5IHRA 2JD4A 3R6SA 2PMWB 3VHPA 5F2WA 3U0ZA 4YVWA 1IS5A 3UYJA 1QOOA 4HN1A 4CU6A 4BCUA 5BV6A 1QQP1 5A6ZA 4CCEA 1QQP3 4FPOB 1BJQA 1H4GA 5BXXA 4UF0A 3O0XA 4C91A 4E9KA 1ZZ8A 2RJKA 2VW1A 5FO8B 1Y3TA 4INDA 3BOWA 3GZUC 3DV8A 1RUD3 1SDDB 2Q8CA 5DAVA 1RXGA 2XDVA 2YBPA 1ENXA 3DXTA 3KVAA 2DVDA 1VP6A 1U5YA 4AEDC 3PMEA 2QQPA 4Q4V1 4QPIC 1AF9A 4XFAA 5GM0A 2JDPA 1Z78A 2QNKA 3AKTA 4M3CE 4QX5A 5FV3A 1QNWA 3ZSKA 3POFA 3H7YA 4HONA 3TEZA 5IWFA 1MS0A 1DQ4A 1VAMA 1WUVA 3WSOA 3ZYBA 1BBT2 1DQ5A 4TZDA 1ZA7A 3B93A 4E2SA 4AQ2A 2Q4SA 3V0BA 1PVXA 2XBO1 3GCWA 2HEWF 2XBO3 5IVEA 2JWPA 3VD4A 4CEYC 2Q8DA 3NSTA 3MBWA 1HN0A 1G8WA 2ARAA 5AC91 4DFSA 1E5IA 1XU2A 2H0BA 3RI9A 5AC93 2GMMA 3VZNA 1VBB2 2D40A 4YGEA 3L9JT 5E8AA 3H1MA 3M3QA 4NAMA 4QXHA 4LQRA 2XWBB 2X5IA 4AAXA 1RUG2 3UNPA 2GMPA 2JIGA 2VZVA 3N9LA 4SLIA 3VKLA 4HKOA 4N53B 4Y20A 5JI7A 3MF6A 1KS4A 1QH7A 2C9KA 2D7FA 1LAJA 4JV4A 1PZ8A 2RM22 2JB8A 2RDQA 4TLFA 5I8YA 2WZEA 4JHZA 1W2NA 2BNNA 3DECA 2VTXJ 3WNPA 4TN7A 4GH4A 4HZFA 1K45A 3ITQA 4P9LA 1AZDA 1KJLA 4YW4A 5IVFA 1LNSA 2V72A 4BQWA 5KHIA 4D7YA 4HN0A 4CDQB 2PHRA 3B9CA 3GDBA 2RR12 3G7DA 4R9DA 2K2SA 2PQQA 5AFEA 2OZJA 2QTWB 4C0BA 4DUWA 5JXIA 4XC9A 5HV0A 2FZ1A 1EV11 5FY5A 3J8F2 3EB7A 1ZZBA 1JZ6A 4NHLA 2QBXA 4HG6B 3U07A 1OLMA 1HQLA 2W1QA 4P9XA 4XDPA 2VTFA 1VRBA 4Y1YA 5GZDA 1CAUA 3VBUC 4YW5A 1LGBA 2MEV1 3C3VA 3UL2A 1Q8OA 4HL0A 4QM9A 3WDTA 4O9EA 1JTZX 4W65A 4IEZA 1VBC2 3MW2A 1D2QA 5J37A 3OD0A 1JYNA 3OPZA 1JW6A 1QJFA 3ZYGA 2GALA 5GKAC 3KB5A 1RUI1 4RFT0 3KWVA 2YG0A 4SBVA 1RUI3 1OXCA 1YWKA 4XHXA 4XQDA 4FPHA 3LEMA 1X9PA 3FBMA 5BNOB 4LHNA 4QXCA 4PLOA 1W2TA 3ST7A 5IK8A 1F5FA 1NXMA 3ZMOA 4FAGA 2FZ2A 3WG1A 2P4EA 1OBNA 3IB3A 1WWYA 3J9SA 2DU0A 1MS1A 1SEFA 3H9AA 1YXWA 1LOAA 4LA2A 3MICA 4M3CF 5C4WC 4LKDA 5FLJA 1ST8A 2B42B 1UOBA 2E7AA 1WCUA 3NNJA 4NVPA 3POJA 1Y4WA 5C70A 1GP6A 2VC9A 1AR73 1B35B 1GNYA 3B00A 3VD9A 5L7OA 3BUCA 4MG2A 1ZZCA 4ZS2A 4U36A 2P3YA 4QPGA 4YW1A 1NQJA 2P3IA 3FC0A 3PVEA 3VBSB 4V2VA 1GNHA 3CKHA 4HVOA 5FP3A 4AXOA 4C0HA 1LODA 1UYPA 2R061 1RINA 2NZ9A 5FZLA 1SFYA 2R063 3AMMA 2J1RA 4FPKA 4EWEA 4HMZA 1JZ3A 4QKBA 2OW4A 4IGQA 2Y6JA 1H1IA 1GZCA 3GZEA 3R05A 1TQ5A 4YW7A 1BBT1 2A6XA 1W9SA 1VPHA 3M1HA 2GP3A 2XQXA 1BEV2 3FX3A 4HOOA 4JQRA 1IS4A 5FYYA 2FDHA 5FREA 2DTYA 2ERFA 4AVVA 3W20A 1OA2A 3HOBA 1VIWB 1NUKA 1J58A 1XE0A 1T6GC 2ZABA 2WUHA 4FP2A 1GKBA 2VVFA 5FWJA 3VBOA 4OHVA 1TNRA 3FN9A 1VBB1 2W47A 1F4HA 1VBB3 3CNAA 3KT7A 4QPIB 2C9AA 3JBG3 1RUG1 4LITA 4BA6A 1QJY1 1S4CA 1MR5A 1RUG3 1US2A 2G4IA 4KH9A 4AOCA 1QJY3 2OA2A 3RZHA 1W8TA 4XF9A 1AJOA 1KITA 1NLRA 1UY0A 2AC1A 3ZSJA 4CCDA 1H2LA 1UMHA 1OF3A 3OD4A 1VAKA 4UFHA 2PXJA 1TEIA 1VJ2A 2VVEA 4XACA 2QQKA 5FMDA 3MHZA 3AMHA 1MVEA 2HWC2 2RDSA 4LBQB 1FPN3 2JIJA 4BIOA 2HWF1 1W0OA 1WLCA 3USSA 2ZX2A 2HWF3 4M3CB 4RGKA 2HLEA 1VB2A 3LB9A 5ANQA 4UAPA 3VKNA 4CEYB 2ATFA 4XETA 2VBBA 4WZFA 2YU2A 3NJXA 4QX7A 2E51A 3SCHA 3D5OA 5FYTA 1R083 2GNTA 1O4YA 1OA3A 2Q5TA 5A7PA 1IGOA 1HQWA 4R4ZA 3I59B 5BNPC 2B46X 5LK7B 4NIGA 2VQAA 1UL9A 5I0RA 2PYTA 3K77A 1XSQA 2QDRA 3J4UH 4PHZA 3U1XA 4CVUA 1W6MA 1SDWA 4H3WA 4GULA 4QB2A 1SCRA 4XYXA 5FYIA 3UESA 1X7NA 1GICA 2GC1A 3WNNA 1TME1 1VBC1 4AI2A 1TME3 1VBC3 3J26N 2N7GA 1ENSA 1R091 3I54A 4FT8A 1R093 3JU9A 5G04L 2X29A 1YQ8A 2VULA 3H8RA 3KF5A 4L8QA 4CUCA 1VBE2 4MOAA 2AACA 5EHDA 2Y6FA 5KXEA 2A3YA 1CAXB 5DUXA 1UOFA 4IV1A 4ZXKA 4XHBA 2AZ5A 3PJYA 1X36A 4B7EA 2E31A 4UFIA 2BWCA 3IDBB 3POIA 4OLLA 1KGYA 3G6JB 1AYN1 2BV4A 3V0BB 1AYN3 4Y1ZA 3NNFA 5IK4A 1FI2A 1IQDC 2F4LA 3AKPA 3VBUB 1EAH2 4QDQA 4JAAA 2OVUA 3RGBA 3D0JA 4Q4X1 4COYA 2Z42A 4GB32 3TAYA 4Q4X3 2EXKA 2WFF2 4KGGA 2VTXA 1MVQA 1DGRN 1CAWA 1K12A 1CVNA 3PJQA 1OLRA 4YW3A 2WC2A 3WF4A 4BLIA 4CA9A 1PO12 5EYXA 1NG0A 1JOPA 2QQMA 5FQ0B 2CHHA 4DUVA 3ETPA 1O7FA 4D6SA 4MYEA 1D4M1 2LM3A 4RR3B 4PQ9A 4XFFA 1D4M3 2ETEA 4XFHA 1C1LA 4D7SA 1GQGA 4F83A 1GSLA 4MX3A 4XJUA 1E5SA 5C4WB 1WMXA 1JU3A 5F3CA 1XYNA 2JD9A 1BEV1 5LRRA 4XZPA 1S0JA 5EZWA 5B4XA 1XC6A 1U0AA 3URFA 4AI3A 3MIBA 4CRQA 5D8AC 5FKCA 2DF7A 5HXVA 3S30A 5A70A 3AFKA 2H6BA 3IMNA 3RSJA 1GR3A 4EQVA 1LRHA 3DPRA 4LO7A 3D0SA 1G9DA 2B45X 2XB6C 4MUVA 4ES8A 4FTEA 4XJAA 1RUJ2 2JE8A 4FFGA 2P17A 2A7AA 4MHRA 3FUQA 3S5AA 5I91A 3F2ZA 3OB8A 5HCAA 1SLLA 3KCYA 2LUWA 1X50A 2R16A 2R042 4JGZA 5FBZA 5C3PA 3N9OA 2E6VA 2IXLA 4IUGA 1JZ5A 1OQ1A 3POSA 1T6BX 2WSVA 3AKSA 1XNBA 3T1LA 1RUOA 3ZPOA 1QOSA 2ZEZA 1EYBA 3N9PA 5BNNC 2B39A 4MGQA 1S0CA 1VRH1 5FYCA 5IYYA 1QXRA 2XWJB 3UV9A 3S57A 1VRH3 2EIEA 4OHZA 4XMIA 1Q3EA 2BW8A 4LKFA 1GWKA 1MACA 1W05A 4IE7A 1UCXA 2CAUA 3PUIA 2K9ZA 1JYIA 4ARYA 3FFZA 3HQXA 2JE7A 3WQBA 5LWBA 2EA7A 2PHUA 4B4RA 1S0EA 1QGLA 3PTRB 3WCRA 4AK3A 2W91A 3O0VA 4L99A 1EP0A 2VNGA 4CDUA 4AHYA 4B1LA 2JDAA 4META 4BH9A 3LA7A 4FOVA 2D5FA 5CVRA 3KF3A 4P9WA 3ZYHA 5H9PA 4LEJA 4YFZA 1CIYA 2NN8A 1OKOA 1UZYA 1UZWA 2PHTA 3ZXFA 1VBE1 4AQTA 4WM8C 1SLCA 4EN7B 5C8CB 4KG0A 1VBE3 3WT3A 3WDUA 4BQ2A 2JDZA 3C7EA 3VZOA 2KXLA 5ISLA 3JD71 2WSUA 1OH4A 4QX8A 2A5ZA 3UKNA 4BQXA 4D3WA 3JD73 4AHXA 1A6CA 3FHQA 1W6OB 5DUUA 2PAEA 2VOWA 3LIGA 4O61A 1A8DA 1NCQA 4NWWA 2PN5A 1AX2A 3IIAA 3ZSMA 5BNPB 1O3TA 3ME2A 4K1ZA 5CYYA 3B3QE 2A6VA 4C1WA 3USUA 2ZBJA 5LASA 4NOTA 2WZ8A 2VMGA 5IFTA 4HBNA 1W04A 4Y5TA 3B94A 5FTTC 1EAH1 1KQRA 1RVF2 1PMIA 5A3TA 3GGLA 1EAH3 1HRI2 4HLTA 3T0DA 1VBD2 3PUAA 4GB31 5FPBA 2WFF1 1O4ZA 4GB33 2XHNA 2BGOA 2AUYA 5FYZA 1PGW2 1BYHA 4BQ3A 1PO11 4MGTA 2VOKA 3LCPA 1PO13 5ACA1 4E4HA 1YFUA 5T5LA 4MLOA 3RZZA 1FMD2 3ASIA 1UU4A 1ZNPA 4FPLA 5A32B 5ACA3 1LHUA 3JQXA 3POWA 3WP5A 4ZU5A 1IS3A 2VJXA 3PVBB 2W94A 1NQDA 3RYRA 1NLSA 2DTWA 1LOGA 3BU7A 4AEKA 5J7MA 5K0UC 4XW3A 3EHKA 4Z1VA 5F1RA 4LIVA 5CG9A 1RB8G 1SMVA 5K7PA 2JDHA 2R071 3QOPA 3VHNA 1HKDA 1OFSA 1PIV2 1YFXA 2R073 1K5MC 2W46A 2JX9A 3HAGA 2JKBA 4FFIA 4QXKA 5FYHA 5CFDA 3SC7X 3ZFEC 1O3RA 2G9GA 1VLNA 1BVP1 1TG7A 1UOJA 3OG2A 5A7NA 5A1FA 4FPYA 3RMYA 2OKXA 5KHJA 3VN4A 4LHLA 5HCHA 3BVCA 1ONAA 2MPFA 5C8WA 4DO0A 3Q8FA 4JCKA 2HBUA 1MQTC 5LRSA 2AYHA 2B8MA 1BLZA 1F8VA 1DGWA 4D94A 3IDCB 2BPA2 4Q5OA 3OPTA 5FUPA 2JG8A 3Q8EA 2D3PA 2ADDA 4LHSA 1RUJ1 4EN8B 3LZZA 2J1SA 1RUJ3 5HCBA 3BN6A 4E4SA 1FX5A 5AVAA 4NWVA 5C7GA 3W58A 2R041 2R0FA 3RNSA 5FZEA 4HPKB 3ELNA 4L11A 2FHRA 3W59A 3WZ1A 4D7TA 4CCOA 1JZ4A 1LOFC 1WMEA 4I0BA 2DWRA 3INAA 4R9CA 4XUOA 4QXBA 5D8AB 5K9YA 1UY1A 3IT8A 1V6LA 4LORA 3U4SA 2PAKA 2VCAA 3ZSLA 1QJX1 2RJ2A 3DGTA 5F3IA 1QJX3 1RJ7A 3DUIA 5FZOA 3U10A 3DN7A 5DDJ1 4AVBA 5J3UA 1WKYA 1W6NB 5DDJ3 5FYUA 5GALA 4NIIA 1H8TA 4UXAA 4XBQA 4K7JA 2E33A 4P9GA 1N3QA 2AREA 2C26A 4PBPA 4GWJA 1HV1A 4XF1A 2QUOA 2EAAA 4FCAA 4KGQA 3TEYA 1DP0A 2GSYA 2CY6A 3AX4A 3KM5A 4IEUA 2BNMA 2GH2A 3PMSA 4Q8KA 1V9U3 2VBDA 5KHGA 5SV5A 1W3XA 1YI9A 5BNNB 5C3RA 3K48A 3ZFFA 3I2HA 3SCFA 2W1UA 3I2FA 5I0TA 1UZVA 3GJBA 1K5JA 1H2NA 3H3LA 2YPJA 1NLQA 4UFLA 1N47A 2XJRA 1VB4A 4FPJA 3K75B 1CJDA 3AP4A 3NKTA 2YC2A 4AVTA 3BYWA 4E2GA 4JVAA 4OUSA 1RVF1 4BJ0A 4XJZA 1UMZA 1HRI1 2WNVA 3RZMA 1LOBA 1RVF3 4L97A 1MZ5A 1C1FA 4QQLA 5IW0A 4ZU7A 1O6UA 1US3A 2XJQA 2GNDA 4QKFA 4LJHA 4JKKA 2HJIA 4WM8B 1VBA2 3B5LB 1FT9A 3M7AA 1SPPA 4QQPA 5A33A 2Q8EA 5CFCA 1FATA 2VZOA 3MUZ1 3QH7A 4IEVA 4DB5A 2A6YA 3CU7A 1GLHA 3I3DA 3AZXA 4QGLA 3OOXA 1J83A 4NHKA 2VQUA 3JZVA 4A6OA 5LBFA 2VNVA 3C8XA 1HX6A 2JG9C 4FXGB 4AR2A 4TLGA 1X8EA 5KHKA 2WT1A 3CZUA 4XFCA 1Z7S2 2VMFA 2ZCWA 3K46A 4XOGA 4NIAA 4CDXC 3KV5A 4OFGA 5J1XA 3ZXKA 4OQ9A 2JDUA 4S2HA 1REFA 3VBRA 5JXHA 2FQPA 4JDMA 2WRAA 2ZMNA 4OHWA 3CIHA 1LENA 4P08A 3KT1A 1XPWA 5I8SA 3VL8A 3S0MA 1FAYA 1RJ8A 4WM7A 5D1IA 3FLRA 4IV3C 1PZ7A 1GQHA 1YHFA 2XKOA 1HJGA 3VHRA 4Y22B 3VKFC 2A73B 2ZOEB 1RUC2 5DZEA 4QPWA 2VZRA 2WIIB 1DQ0A 3I2OA 5I0DA 4RS5B 3S7EA 4XFGA 3DKWA 4N43C 5A7WA 1F5JA 4AVSA 4PIYA 2VXRA 4KU7A 3H8OA 5T5JA 1DHKB 1UF2C 1W06A 3O14A 4F7ZA 5K0UB 2XG3A 4F3JA 4AI1A 4UBGA 2WAOA 2DVFA 3A0NA 4PQQA 2D6KA 4DMIA 4E8DA 4W6XA 2QQUA 3CMGA 4KBZA 4NJ4A 1I6XA 3E1F1 1K5MB 2R32A 2VZ3A 3ZFEB 4IETA 1MZFA 1VMHA 2G1MA 1DQ1A 5FY4A 1D7PM 4UW5A 4ONUA 4DXZA 3WUCA 4P00B 3V0AA 2WJSA 4RQPA 2BVVA 2LROA 3OSDA 4BPZA 1MQTB 4E4DX 1S0GA 4BB3A 3ZXGA 1BK0A 4W4ZA 2GN3A 1HRV2 3NNGA 4AL9A 3CQOA 2ZTNA 1W8HA 1DZTA 1XNKA 1BMV1 3VZKA 2XPJA 4MXVA 5GLVA 4UYBA 1OA4A 5I0UA 3B02A 5CKNA 4OYUA 3CZJA 3PIJA 2E63A 1QJEA 3GBFA 5GZGA 2FDFA 4I01A 1HB1A 1WD3A 4JZRA 3RQ0A 4A41A 4FAHA 3P3PA 3AXDA 5FLHA 1WA4A 1R1A2 2NMOA 3ZN6B 5ABJC 3MYXA 1B35A 1QNYA 4XUTA 5FZHA 2IC1A 4P9IA 4ZHNA 1LU1A 3IDEA 2UY9A 2FDJA 2WNEA 1C28A 4PI2A 3IM0A 2TBVA 4AYUA 3THCA 2UWAA 3D8CA 5B2GB 1W2AX 4N90A 1OQEA 4LNVA 3PVNA 1QJZA 1C5HA 3ZVXA 1ODNA 3M3EA 4H2AA 3ZIWA 1JS9A 1CONA 1LESA 3NL1A 3WDWA 5EYYA 3ES4A 4N7UA 3RWKX 4CU9A 3RI8A 1JOBA 2RS51 4R9BA 5C9AC 1F2NA 1NYWA 2RS53 2WZR2 4YVSB 1ZBA2 2CV6A 5D2AA 4MV2A 1K42A 3E6CC 5FZMA 3SXWA 1ZM1A 2YMZA 2UURA 4FXKB 1RUF3 1VBA1 2RS11 2RV9A 3AP7A 2HKXA 4JGYA 5CKQA 5A7SA 2RS13 2YDEA 3O1UA 3MLKA 4XIOA 3O1SA 2AEZA 3R4SA 5FMCA 1VE0A 4LK6A 3SHRA 4LO5B 3BODA 4Y26A 3D3AA 4QQHA 1UZZA 1Z7S1 1UXXX 2B7YA 1DZQA 1BHGA 1LR5A 1YRZA 2RG4A 1YQ5A 1Z7S3 2G9ZA 3OYWB 4OHYA 1GBGA 4CU7A 4PDWA 2CDOA 1ND2B 1PMJX 1CWPA 2Y6LA 1GOGA 5FZGA 2Q30A 3OF1A 2J7MA 5IVCA 1I9RA 3AKRA 1W6QA 4Q4V3 3IAQA 4L0PA 3AMQA 5JIUA 2BNOA 4YZ5A 1UZ0A 1OD3A 2V09A 1ND3A 2WNUC 1RUC1 2ZAHA 4A2UA 4DZGA 2RS31 3D4KA 1RUC3 4CP9A 2DYCA 2RS33 4I02A 4EROA 4MVTA 5DXDA 3E6DA 4I3GA 3AVSA 2IFRA 2WA4A 1WA6X 1N3OA 3U14A 3DYOA 5JMCA 2JG9B 1JZ2A 2Q8OA 3I49A 4Q4W2 1VAVA 4ZPIA 3ACLA 1POV1 3HQRA 3NJYA 4HKLA 1CPMA 1UQXA 1POV3 4CDXB 2W3JA 2W92A 3AZYA 4QPYA 4E27A 4ATFA 1WCDJ 4YVWC 5DN2A 3V65A 2BRTA 4ZZ5A 2VOTA 4GKXA 1UX7A 1I3HA 2D98A 4P9YA 4EN6B 1JZ7A 4IV3B 5FY1A 1CAXA 1HRV1 1W8ZA 4IE5A 2ZS6B 4JC1A 1YEWA 4CCCA 2RVAA 2XUEA 3U75A 1DYPA 2XQRA 2IXHA 5FUNA 2YFZA 2BWAA 1H8VA 4KWLA 4N43B 5A1LA 5JUVA 1NKGA 2A3WA 3KHBA 1A34A 5FYBA 3K2OA 3KV4A 1D2SA 1ASJ1 3Q8BA 1R1A1 2OPWA 1ASJ3 4HK9A 1MZ6A 3FWEA 4XZUG 5EWSA 5DAWA 4IGOA 4D8MA 1XNDA 1UD1A 1HN1A 2QZ3A 2Q1FA 1S2EA 2WS92 3N9MA 3OY8B 5CIRA 2PHLA 2VZ1A 3RZJA 1EV13 1UNBA 1TVGA 3U4XA 2Z5WA 4I0WB 1QXJA 1UN1A 3KD4A 4KU8A 4XDOA 5EJ3A 2OYZA 3WX5A 3NV2A 3WNOA 5AFBA 3NV1A 4LUMA 5M0TA 1CIWA 1POV0 1W8WA 5F3EA 2MEV3 2X5IC 3VGIA 2XONA 1UOGA 1DGWX 2PLV2 2ZXQA 3IPVA 2YB7A 3N9QA 4PLNA 2A3XA 1IG3A 4CPBD 1ZBA1 2KA3A 1YJLA 4M01A 2IXCA 4G9SB 1QU0A 3P1IA 3RYKA 1LKNA 1ULDA 3N7KA 3VB9A 4OHXA 1Q56A 2W52A 1APNA 2WO2A 3MF9A 3ZR6A 5ABJB 2EVXA 2FD8A 4GH4C 5F6LB 1QF3A 1ZA4A 4D0QA 2JXAA 1AR92 1PX3A 1W2UA 1AYM2 4CU8A 1IPSA 3HBZA 1OLME 4A7ZA 3BPZA 5FZFA 4OULA 1LU2A 4XF3A 3VDBA 3POYA 4CDWA 1MEC2 4TTGA 4N7IA 3O1RA 3HD8B 5A6QA 4DUXA 1TMF2 3T4VA 3KGLA 5FZ0A 3S7IA 1LHOA 2VMDA 3VKMA 3CJIA 3QACA 2JICA 2OT7A 3H3UA 3H1YA 1A78A 2NYYA 4YZ1A 2FDKA 1BQPA 1HB3A 4Z07A 3WF2A 2FMDA 5L9RA 4H55A 5C9AB 4MXWB 4CPBA 1DCSA 3RZGA 3DEMA 2Y0IA 5FXVA 4J6GA 5D21A 4AF9A 1JBCA 3M4FA 1NCRA 4CSWA 4K1YA 5J36A 3PURA 3WQ7A 2VZSA 4RHV2 5DMYA 4ZY9A 1W6PB 2A75A 1W90A 3V56A 3LA3A 2JDMA 4AFCA 1YC61 4P5HA 2JKXA 4CEWB 2WBKA 4DXRA 4LLFA 4I2OA 2YXSA 1PNGA 3MIDA 3VBHA 3EYPA 3WG4A 3OBRA 3I2KA 1BBT3 3UK9A 2Z69A 4IESA 1HLCA 4QX1A 5IT6A 5K8SA 1LHWA 2ARBA 2Y8KA 2UYAA 4Q4W1 4U2AA 3WQ1A 4Q4W3 3A21A 2KD7A 2VZPA 4WVWA 1NY72 4K8RB 1NA1A 5F5CA 5FZ7A 2JJ6A 1UIJA 3NW4A 1S0BA 2VECA 2XL7A 2XMLA 4OI1A 3SITA 4AW7A 4BZ4A 2HWB2 3BGAA 4OI0A 1GQPA 4XCAA 3LOBA 5DAXA 4K20A 3CJIC 4DY3A 5FR3A 2C5DA 3AFGA 2ET7A 3H8XA 2HYXA 4AEDB 3IZOA 1F35A 2UY8A 3VBFA 3VD3A 1GOHA 2ES3A 4UWDA 4IEPA 5L7OC 2WWUA 4LBNA 4BQ5A 4OZOA 3MLJA 4QPGC 4BU2A 1AXKA 3HEIA 2WNUB 2ZGOA 5JDBA 4AE2A 2QZ2A 2RM21 3NAPA 3POGA 5A3PA 5CAZA 2RM23 4BYYA 5E1RA 1LGCA 4MGKE 2R7EB 2RMU2 4GALA 1LHNA 2Q0AA 3OBTA 5IK5A 2WZPP 1PGL2 3GYDA 4ASKA 2RR11 3MDPA 2D44A 4MGIE 3WNMA 1AL22 1O8PA 2RR13 3HR9A 4QHZA 4YM2A 3TYJA 3UGFA 1QOTA 1Y9QA 4S2FA 3WR0A 4YVWB 2WS91 4NHYA 3ATGA 4PT6A 4UOJA 1LHVA 2WYFA 3J8F1 5KC5A 2XVLA 1AHSA 1JMUB 3J8F3 4FO9A 1OOPA 1ZVFA 3WW3A 1L7RA 4UF0B 1OT5A 2L9LA 1JUHA 4QHBA 4A7KA 4NPLA 3VBOC 3I2IA 3MW3A 4AI8A 4BQYA 3AZWA 5CEHA 3TNPB 1XSRA 3VBFC 3MIHA 3ORJA 1LECA 2PLV1 2K0GA 2PHWA 4HANA 2PLV3 4OI2A 1PMHX 2ZZQA 4O7XA 4YPJA 1MS3A 2NLRA 1CAVA 3I3EA 5A3WA 4KI5M 3GJAA 4NHMA 4D6RA 2YHJA 2QQIA 1WGPA 5FO7B 5BPXA 1UKGA 3NNMA 3ACIA 5HBAA 5C3SA 2W68A 2BVBA 1IQAA 1AYM1 2VCMA 3ECQA 1NZCA 5EQUA 1OC1A 2AH2A 4XAEA 1AYM3 1IG0A 2BTVC 4UFMA 4RFRB 2YGLA 1ZREA 2IWGB 3LPFA 4NHXA 1MEC1 5JOZA 2ZGKA 1MEC3 2VD7A 3WXPA 1TMF1 4QT6A 4C1XA 2O8OA 3C7FA 5KWRA 3RZLA 5FYSA 4RN5A 2C4XA 1NT0A 4J1XA 2X09A 1JHJA 4XTPA 2X5IB 4LBMA 2BGCA 3E5UA 3IWZA 4KWUA 4UW4A 5DABA 5H9QA 3E5XA 4Y20B 1SBDA 4S2GA 1OKQA 2ZGQA 1AJKA 4QB1A 3ZXDA 1ACCA 2A6WA 1U12A 4AGGA 4GH4B 3N35A 4CCLA 2YU1A 1ZZ7A 3KLSA 1GZWA 2H0VA 5DQ0A 3LEIA 2FDIA 2O1QA 1J3QA 3OBAA 5CA6A 3CBNA 1G7YA 3WVJA 4M4RA 4IE4A 4Y33A 1ZRIA 1AR62 3ABZA 3ZN4A 3NO8A 2GC0A 4IV1C 2Z2SB 2R1DA 3IN9A 5FP4A 1W39A 1BEV3 2NPIA 2VE1A 4QU2A 5GZCA 1NZIA 4CXWA 4MSVA 1NY71 3LPGA 4L92A 2FCUA 3UKVA 1YO8A 1EUUA 2P3JA 3SEPA 3ACFA 2HWB1 3AJYA 2LS6A 4NIHA 2YC4A 1CAUB 1X8MA 2HWB3 4YW2A 2V5DA 5IATA 4WVMA 3C7GA 4JDNA 3WF3A 4I09A 4AAPA 3GHNA 4BDVB 1H6YA 4NAOA 4XJWA 3BTZA 5KXCA 1HB2A 3H0OA 5FIXA 1CD3G 5DUVA 4R52A 3NQHA 5CU1A 4YZ3A 4A7YA 1UY3A 4RD7A 2W39A 1GWMA 3JXSA 2VNRA 1H2MA 5C6CA 2F17A 1Y9GA 2RMU1 1J3RA 2RMU3 3OGSA 2MHFA 3N7JA 2HWC1 4URTA 5GZEA 2ARXA 1JYWA 2DDUA 2HWC3 3N7LA 3IMMA 4IEQA 3I3MA 1LGNA 4XCBA
chains in the Genus database with same CATH topology
5FZHA 4IGOA 4QXCA 4QX8A 5ISLA 3N9MA 3N9NA 5IVJA 2W2IA 3K3OA 5FYVA 3AL5A 3PU8A 5FJHA 4UF0B 4XDOA 2WWJA 3AL6A 5F2WA 4EYUA 3UYJA 4CCJA 5FXXA 5FXWA 5CEHA 2OQ7A 5F3EA 4LIUA 3LDBA 2YPDA 5A3TA 5FJKA 4UF0A 3PUAA 3N9QA 5FPBA 5FZAA 5IW0A 5F2SA 2Q8CA 4EZHA 5FZ8A 4V2VA 5FZMA 2XDVA 2YBPA 3DXTA 3KVAA 3PUQA 5FP3A 5A3WA 5FYZA 4D6RA 5F3GA 5FWEA 5FBJA 2OS2A 2Q8EA 5FZLA 5A7SA 4LXLA 5FV3A 4GJYA 4E4HA 4D6SA 4GAZA 5FZFA 3AVRA 4HONA 4IGQA 5A7QA 5IWFA 5A7OA 5FZIA 5F5IA 4ASKA 3KV6A 2VD7A 3PUSA 4V2WA 5FZ0A 4LIVA 5FZ6A 2GP3A 5FYSA 5F39A 5F3CA 2OT7A 4HOOA 5FYYA 5IVEA 4CUGA 3KV5A 4C8DA 5FP9A 2YBKA 5FYHA 2Q8DA 5F32A 5A7NA 5LY2A 5FXVA 4CCMA 5A1FA 5FWJA 4CSWA 3KVBA 3PURA 5FZDA 5FZGA 4DO0A 5FXZA 5A7WB 4QXHA 5IVCA 3PDQA 5IVVA 5FYMA 4GD4A 4LITA 3N9LA 4CCLA 5FPVA 2YU1A 5FY0A 3OPTA 2GP5A 4QWNA 5FUPA 5FPLA 2OX0A 5FZ4A 2OQ6A 4QU1A 5FY9A 5FZBA 4NUBA 4Y33A 5A7WA 4URAA 5FP7A 3AVSA 3KV9A 4TN7A 2PXJA 4Y4RA 5LY1A 3N9OA 3DXUA 3OPWA 5FZEA 4D6QA 5IVFA 5FP4A 5FZ3A 3NJYA 5LW9A 5F5CA 3ZPOA 4CCOA 3N9PA 5FZ7A 4CCKA 5ANQA 2XMLA 5FYCA 5FY4A 4QXBA 5FZOB 5FY7A 2YU2A 4QX7A 5KR7A 5FY5A 3U4SA 5A7PA 5FYTA 3U78A 4BISA 4BXFA 5FZ1A 4AAPA 5FZCA 2YBSA 5F3IA 5FPAA 5LWBA 2WWUA 5FY1A 5FZOA 4CCNA 4XDPA 4BU2A 1VRBA 3PTRB 5FYIA 2XUEA 5FYUA 5A3PA 2P5BA 4IGPA 5FUNA 4AI9A 5F37A 5FPUA 4DIQA 5A1LA 3LD8A 3PU3A 5FZ9A 5E6HA 5IVBA 4EZ4A 3RVHA 5A3NA 5K4LA 2XXZA 3K3NA 4GJZA 5A80A 5FYBA 5FY8A 3ZLIA 3K2OA 3KV4A 4Y3OA 5FP8A 5IVYA 5FZKA 5F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZH A;  4IGO A;  4QXC A;  4QX8 A;  5ISL A;  3N9M A;  3N9N A;  5IVJ A;  2W2I A;  3K3O A;  5FYV A;  3AL5 A;  3PU8 A;  5FJH A;  4UF0 B;  4XDO A;  2WWJ A;  3AL6 A;  5F2W A;  4EYU A;  3UYJ A;  4CCJ A;  5FXX A;  5FXW A;  5CEH A;  2OQ7 A;  5F3E A;  4LIU A;  3LDB A;  2YPD A;  5A3T A;  5FJK A;  4UF0 A;  3PUA A;  3N9Q A;  5FPB A;  5FZA A;  5IW0 A;  5F2S A;  2Q8C A;  4EZH A;  5FZ8 A;  4V2V A;  5FZM A;  2XDV A;  2YBP A;  3DXT A;  3KVA A;  3PUQ A;  5FP3 A;  5A3W A;  5FYZ A;  4D6R A;  5F3G A;  5FWE A;  5FBJ A;  2OS2 A;  2Q8E A;  5FZL A;  5A7S A;  4LXL A;  5FV3 A;  4GJY A;  4E4H A;  4D6S A;  4GAZ A;  5FZF A;  3AVR A;  4HON A;  4IGQ A;  5A7Q A;  5IWF A;  5A7O A;  5FZI A;  5F5I A;  4ASK A;  3KV6 A;  2VD7 A;  3PUS A;  4V2W A;  5FZ0 A;  4LIV A;  5FZ6 A;  2GP3 A;  5FYS A;  5F39 A;  5F3C A;  2OT7 A;  4HOO A;  5FYY A;  5IVE A;  4CUG A;  3KV5 A;  4C8D A;  5FP9 A;  2YBK A;  5FYH A;  2Q8D A;  5F32 A;  5A7N A;  5LY2 A;  5FXV A;  4CCM A;  5A1F A;  5FWJ A;  4CSW A;  3KVB A;  3PUR A;  5FZD A;  5FZG A;  4DO0 A;  5FXZ A;  5A7W B;  4QXH A;  5IVC A;  3PDQ A;  5IVV A;  5FYM A;  4GD4 A;  4LIT A;  3N9L A;  4CCL A;  5FPV A;  2YU1 A;  5FY0 A;  3OPT A;  2GP5 A;  4QWN A;  5FUP A;  5FPL A;  2OX0 A;  5FZ4 A;  2OQ6 A;  4QU1 A;  5FY9 A;  5FZB A;  4NUB A;  4Y33 A;  5A7W A;  4URA A;  5FP7 A;  3AVS A;  3KV9 A;  4TN7 A;  2PXJ A;  4Y4R A;  5LY1 A;  3N9O A;  3DXU A;  3OPW A;  5FZE A;  4D6Q A;  5IVF A;  5FP4 A;  5FZ3 A;  3NJY A;  5LW9 A;  5F5C A;  3ZPO A;  4CCO A;  3N9P A;  5FZ7 A;  4CCK A;  5ANQ A;  2XML A;  5FYC A;  5FY4 A;  4QXB A;  5FZO B;  5FY7 A;  2YU2 A;  4QX7 A;  5KR7 A;  5FY5 A;  3U4S A;  5A7P A;  5FYT A;  3U78 A;  4BIS A;  4BXF A;  5FZ1 A;  4AAP A;  5FZC A;  2YBS A;  5F3I A;  5FPA A;  5LWB A;  2WWU A;  5FY1 A;  5FZO A;  4CCN A;  4XDP A;  4BU2 A;  1VRB A;  3PTR B;  5FYI A;  2XUE A;  5FYU A;  5A3P A;  2P5B A;  4IGP A;  5FUN A;  4AI9 A;  5F37 A;  5FPU A;  4DIQ A;  5A1L A;  3LD8 A;  3PU3 A;  5FZ9 A;  5E6H A;  5IVB A;  4EZ4 A;  3RVH A;  5A3N A;  5K4L A;  2XXZ A;  3K3N A;  4GJZ A;  5A80 A;  5FYB A;  5FY8 A;  3ZLI A;  3K2O A;  3KV4 A;  4Y3O A;  5FP8 A;  5IVY A;  5FZK A;  5F5A A; 
#chains in the Genus database with same CATH topology
 1PHM A;  1ZBE 2;  2QCS B;  4YGD A;  3LE0 A;  1SLI A;  1OSG A;  2VGD A;  3OGG A;  5DPN A;  4Q1R A;  2BDR A;  1IHM A;  3N7M A;  3WUD A;  5A1A A;  1Q8Q A;  2WLP A;  5FLI A;  3A4U A;  1LED A;  3DF0 A;  3OEB A;  4Z92 B;  2TEP A;  5T54 A;  5L7O B;  1UW8 A;  4FQZ A;  1DIW A;  4MHU A;  1UPI A;  1SLB A;  3EXU A;  3IKW A;  2ZHL A;  3LGR A;  3OCP A;  4QPG B;  1XNT A;  5IFP A;  3LEK A;  3T2Q A;  4FFH A;  2YPD A;  4RSU A;  3DPR C;  2OZ6 A;  4WZC A;  1VAL A;  2ZAC A;  3AZV A;  4HXC A;  1W9T A;  2D93 A;  3IBM A;  3B69 A;  3O7O A;  5F2S A;  3TB0 A;  2EID A;  1ULO A;  1LB2 A;  2XOM A;  3NRU A;  2OII A;  3EJK A;  2D5H A;  4PJY A;  4QM8 A;  2ZKL A;  3E97 A;  4XQW A;  4B29 A;  2GN7 A;  4JGZ C;  1HXS 2;  2SLI A;  1W0P A;  2ZGR A;  1HW5 A;  2E9Q A;  3HT2 A;  1W03 A;  3VHO A;  3EMR A;  4H7M A;  4EV0 A;  2CWM A;  1KJR A;  2ADE A;  2ZEX A;  3FE5 A;  5FPZ A;  5LCW L;  2Y6G A;  4CP2 A;  3J7H A;  3VBO B;  5JAX A;  1SLA A;  2A1X A;  2F4P A;  4Y1U A;  3TOJ A;  2GNM A;  1O5L A;  2ZX3 A;  4X6Q B;  1PK6 A;  4LE4 A;  5KBF A;  4DNY A;  3UET A;  2V5Y A;  5G05 L;  2WFF 3;  5L73 A;  1OUR A;  5HPO A;  1W9F A;  1RUH 2;  1O3S A;  4NRP A;  2BEO A;  4W50 A;  5FXZ A;  4ES9 A;  4CDU C;  5IVV A;  1XNC A;  2VUJ A;  4XIK A;  2ZA9 A;  3K4Z A;  2UWC A;  4QWN A;  3LKJ A;  1H30 A;  4QU1 A;  4ZKT B;  4AI0 A;  4NUB A;  2JEC A;  1AR6 1;  2EXH A;  1COV 2;  2UU8 A;  4RA0 A;  2FMY A;  4IEW A;  3THD A;  1NXD 1;  2GC3 A;  5A3U A;  1EPW A;  1LEM A;  2E7T A;  3AYE A;  3CHX A;  4KBB A;  2J1T A;  2RJL A;  1ZX5 A;  5FZ3 A;  3ZX7 A;  1NCQ C;  5LW9 A;  3I7D A;  4QHO A;  1ZRC A;  5FMB A;  1HDK A;  2Y33 A;  4Y24 A;  1YNA A;  4XXP A;  1XE7 A;  1IOA A;  4QX3 A;  5JSP A;  3KHC A;  1RMU 2;  3BKZ A;  1W6M B;  3WHT A;  2ZKN A;  4LBK A;  4LT5 A;  3L2H A;  3O1T A;  1FXZ A;  1YCI A;  3T3Y A;  1ODM A;  5FO9 B;  4LTA A;  2YGM A;  4X6R B;  2AEN A;  2ZPX A;  4A6S A;  3E5Q A;  3N3H A;  4CCN A;  1XYO A;  4DOU A;  1G9F A;  4FSJ A;  2DFC A;  1H2K A;  1RGS A;  4IGP A;  3VDD A;  4CE8 A;  4K9S A;  2Y0O A;  4DIQ A;  3IAP A;  3OGV A;  4XJ9 A;  5JZG A;  1PO2 2;  1RC6 A;  3WOG A;  1RUE 2;  4IV1 B;  3DCQ A;  1H1M A;  2ZEY A;  2XXZ A;  1MS5 A;  2R04 3;  3NNL A;  5FY8 A;  5FP8 A;  5IVY A;  4BQ1 A;  4IDZ A;  4CUG A;  2Y34 A;  2ZGN A;  2B4K A;  3O1O A;  1KXG A;  3H8U A;  1UIK A;  4UFJ A;  2VO5 A;  1LUL A;  5FK7 A;  3ZFG A;  5KXD A;  1PX4 A;  1W99 A;  5IJR A;  4NRM A;  2IUW A;  1EUT A;  1WBL A;  3HNB M;  5T5P A;  1QEX A;  3AL5 A;  2UWB A;  4LBO A;  4NE9 A;  4XEZ A;  5CFD C;  4CUA A;  4A3Z A;  4HK8 A;  1AX0 A;  1O4T A;  3BAL A;  2HWD 2;  3OEA A;  4YSF A;  5FAX A;  4PF5 A;  2XVG A;  3H42 B;  2VPV A;  4Q0V A;  3ZDS A;  4CCJ A;  1O5U A;  3APB A;  5KHH A;  1CAW B;  4I0A A;  1ZRD A;  4LIU A;  3RS6 A;  3LDB A;  4BK4 A;  5FJK A;  1SCS A;  2E53 A;  1CZT A;  2YFU A;  3SMH A;  2JG8 C;  4B4P A;  3B01 A;  1QJU 2;  2ZGU A;  3B7M A;  1IPK A;  1FV3 A;  1GP5 A;  1QH6 A;  1SG3 A;  3K4A A;  4K40 A;  5FBJ A;  5HI0 A;  1JUI A;  3OGJ A;  4XUP A;  1XNA A;  2VBP A;  4F8A A;  1HXS 1;  1W8O A;  3LFI A;  3U37 A;  3BU0 A;  1HXS 3;  2D6L X;  5A7Q A;  1H9P A;  3QH6 A;  1F15 A;  3GAL A;  4LOT A;  5DG2 A;  3HJR A;  5LBC A;  3WD5 A;  1TNF A;  4YGB A;  1ULC A;  5A3O A;  1AUY A;  2XJP A;  2J42 A;  1UKR A;  1ZRF A;  2BER A;  1DQ6 A;  1VBD 1;  1HRI 3;  1V70 A;  3DPR B;  2TNF A;  1VBD 3;  3ZIX A;  4IE0 A;  3VZL A;  3MW4 A;  1KFX L;  4B3N A;  2CGO A;  1X9T A;  1FNY A;  2J1E A;  3VD7 A;  4RGG A;  4S2D A;  4G4F A;  4HFS A;  1AXY A;  2X10 A;  1H8T C;  3I4I A;  1PGW 1;  2WQ8 A;  1UU6 A;  2R1B A;  4XXA A;  5JPM B;  2PA7 A;  5FY0 A;  4JGZ B;  2A71 A;  1WCQ A;  2YY1 A;  4A42 A;  2RHP A;  4DXT A;  2HWE 2;  1FMD 1;  3KCC A;  1C8M 2;  4FOW A;  3LDK A;  4YG3 A;  1FMD 3;  1HIX A;  1T2X A;  1V00 A;  3NV4 A;  4LHK A;  4CZS A;  5T50 A;  5C3Q A;  3GCX A;  3ZFF C;  2G9F A;  4AVA A;  1IPJ A;  2W5F A;  3O0W A;  4MAD A;  4N53 A;  4D6Q A;  1RTV A;  2WQ4 A;  3OPW A;  4GMP 1;  1DU3 D;  5GLZ A;  1N1Y A;  4GMP 3;  1GOF A;  1PIV 1;  2LRP A;  2XUM A;  1PIV 3;  4BQ4 A;  1OMI A;  4EJR A;  2KM2 A;  5FMO S;  1DGL A;  3KZ4 C;  3D6E A;  4QGN A;  1V6M A;  4XVH A;  3VZJ A;  4Y4Y A;  1RMU 1;  3ZO0 B;  1F4A A;  5JLV A;  5KR7 A;  3PUH A;  3B9I A;  4CDQ A;  2B9U A;  2A6Z A;  2EXJ A;  2QVS B;  4NPR A;  1QWR A;  5APA A;  3SIS A;  3OGR A;  2ARC A;  1LOE A;  3FHA A;  2WNV C;  3IDA A;  2KR2 A;  2VQ0 A;  4CDU B;  4XF4 A;  3AP6 A;  1H1A A;  1C4R A;  4IEX A;  4RYD A;  4YYO A;  2IVI B;  2PQS A;  1AX1 A;  3MPB A;  1G86 A;  2O8Q A;  1O3Q A;  5CFC C;  1VMJ A;  3NJV A;  2FDG A;  1UXZ A;  2VG9 A;  4ZON A;  1RUE 1;  5DG1 A;  5T3N A;  4MH0 E;  4CP0 A;  1RUD 2;  4EZ4 A;  5BY5 A;  1RED A;  2MNG A;  1MZE A;  4NN0 A;  3UGG A;  4NO4 A;  4YFW A;  5J09 A;  4ZZ8 A;  2W0X A;  1ENQ A;  1B09 A;  1NCQ B;  3O1P A;  1A3K A;  4OMD A;  4FBF A;  2ORX A;  4QQ2 A;  1L7L A;  3NWK A;  2ILM A;  4DQA A;  2JEN A;  3USU B;  1V6O A;  1DG6 A;  2CAV A;  2WQZ C;  4HSL A;  1KDK A;  1JZ8 A;  4Z2W A;  3VBR C;  2XJT A;  2WWJ A;  4ORF A;  4OQ8 A;  3R0R A;  5BNO A;  5I8T A;  2HWD 1;  1J84 A;  1CR7 A;  4MGS A;  4GMP 0;  4QKN A;  2XBO 2;  1SZB A;  3BTX A;  4WM7 C;  4XAB A;  2VZU A;  4V1P A;  3PTY A;  4YRD A;  5JVV A;  3OUI A;  5DZF A;  1E5R A;  1QJU 1;  2XVK A;  2J1A A;  3S6P A;  4EZH A;  4LMF A;  1QJU 3;  1M06 G;  2G19 A;  1YJK A;  2BU9 A;  3MV1 1;  2GAU A;  3WNK A;  5JOW A;  1AVB A;  2YYO A;  3P5B A;  3HNY M;  5GLU A;  2ORZ A;  5GLT A;  4P02 B;  3LWC A;  3VBS A;  1UMI A;  5H9R A;  3VL9 A;  4GAZ A;  4DRR A;  4AHW A;  3AJZ A;  4FPE A;  2QQW A;  2ZX0 A;  3AK0 A;  4W6Y A;  2YRO A;  4P9J A;  3C7O A;  2R30 A;  5CFD B;  1UYZ A;  2GME A;  3CDZ B;  2IXK A;  4OUM A;  3FHI B;  2QE3 A;  3ZOI A;  4RQP C;  3Q8C A;  4HKW A;  4CEW A;  1YIF A;  2ZHM A;  5H9S A;  5E88 A;  4C8D A;  1NAE A;  1OVS A;  1WMF A;  5FMO L;  2DFB A;  2XLG A;  4BM8 A;  3VV1 A;  5JCT A;  3ENR A;  3S5Q A;  1Y9M A;  4R4X A;  4CCM A;  4R9A A;  4JX0 A;  2JG8 B;  1YQ2 A;  3RJR A;  2ZHN A;  2PAM A;  1Q5O A;  4IEY A;  4LBQ D;  4PBO A;  5DAQ A;  3AM2 A;  2X05 A;  4CXY A;  5FYM A;  1VBA 3;  2I45 A;  2OUJ A;  3RPQ A;  4MGY E;  2BOI A;  2DVA A;  3FLT A;  5FPL A;  1ENR A;  4OCT A;  2HWE 1;  4GZ9 A;  4W8J A;  1C8M 1;  4DXS A;  2HWE 3;  4QGM A;  1MS8 A;  4HVR A;  2YUE A;  4MO3 M;  4AED A;  4URA A;  5FP7 A;  3ZSE A;  3VZM A;  1B35 C;  4QPI A;  5JPN B;  3MO4 A;  2NMN A;  4Y4R A;  5F5Q A;  2PHF A;  3UJQ A;  2OXB A;  4EN9 B;  3POB A;  2XLF A;  1J59 A;  1RUI 2;  1OF4 A;  3JQW A;  3KT4 A;  4COW A;  4LKE A;  2WN3 A;  3WQ0 A;  1G9A A;  1RUN A;  2HEY F;  5BYN A;  5LA2 A;  3AZZ A;  2QKD A;  3GXU A;  2GDF A;  5FZO B;  4WVZ A;  4FOQ A;  4LBQ A;  3JB4 C;  3SH4 A;  3GM8 A;  2VNO A;  2J22 A;  4BIS A;  3RRD A;  4IW3 A;  1U5X A;  4M3C A;  1H8T B;  2ET1 A;  3N36 A;  4CEY A;  1DFQ A;  3A0K A;  4JQT A;  4A44 A;  4EWD A;  4GWI A;  3ILF A;  1MPX A;  2WWS A;  4LO4 B;  1V0A A;  3HPN A;  5HXM A;  3GZT B;  4LE3 A;  3NV3 A;  4QKD A;  2P5B A;  2GZW A;  2WAA A;  1URX A;  2WKK A;  1AR7 2;  2D6O X;  3ES1 A;  1QHD A;  3I59 A;  4JGY C;  4NPM A;  1GUI A;  5EIY B;  4K3U A;  4LPL A;  5F6K A;  3GZA A;  1Q8S A;  2WIN B;  4N9H A;  3ZFF B;  4B4Q A;  1RUD 1;  3OBZ A;  4YG0 A;  2ZJC A;  3WW1 A;  4Q27 A;  1UO9 A;  3H3Z A;  2PEL A;  1Q8P A;  1OI6 A;  2R06 2;  3ZN5 A;  4HT1 T;  2Q1Z B;  4I30 A;  3MFC A;  4Q8L A;  2X8K A;  1O59 A;  5LEJ A;  1XRU A;  4OI4 A;  1KDM A;  2VCB A;  2GU9 A;  3K3O A;  2VVD A;  4DEQ A;  1WW4 A;  2DVG A;  2VH9 A;  4Q2F A;  1IZ3 A;  2HH9 A;  4PI0 A;  4E2Q A;  3I2D A;  4PDW C;  4AQ6 A;  2VXJ A;  2WNV B;  3MIF A;  4BXS V;  2LTN A;  1HRV 3;  2HBT A;  5EV7 A;  4MZU A;  5FXW A;  3VLB B;  3OUJ A;  3K51 A;  5JXJ A;  4Y5Z 0;  1TE1 B;  4DEV A;  5A33 B;  1SPP B;  5CFC B;  4YM0 A;  1JYV A;  2DBN A;  1ND3 C;  1WW6 A;  4DIN B;  1ULG A;  2RDR A;  2VU9 A;  3CJX A;  3MV0 1;  4PCR A;  5LBE A;  4AEJ A;  2D3S A;  3PUQ A;  3VBU A;  1G6N A;  3I8T A;  4AFA A;  3JBG 2;  1R1A 3;  2I07 B;  3I2J A;  2OS2 A;  5LA0 A;  1QJY 2;  3M2M A;  2P1B A;  5GZF A;  5HV4 A;  5A6Y A;  2C0Z A;  2CGN A;  3SEE A;  4LR4 A;  3SLI A;  2IFW A;  2GC2 A;  4Z2A A;  2C6S A;  4E4Z A;  1OPM A;  5FZI A;  3VBR B;  4KNC A;  2ZGP A;  3EBR A;  3H7J A;  2ZML A;  2XR4 A;  5FQ0 A;  2VM9 A;  4OUE A;  2C1F A;  3I3Q A;  4GKY A;  3BB6 A;  1FPN 2;  3GBG A;  4LLO A;  2Q1M A;  4Q29 A;  4WVV A;  5F39 A;  4AZZ A;  5JOY A;  2HWF 2;  3WDY A;  3T2T A;  2P37 A;  4RR3 A;  1W8N A;  4WM7 B;  2WYS A;  2WZR 1;  2WZR 3;  5EJ1 B;  5LY2 A;  4XBN A;  3TNQ A;  3NMB A;  4ISR A;  3ILR A;  1ZBA 3;  5C4W A;  1R08 2;  2WT0 A;  5F9T A;  4HVQ A;  5A7W B;  1UYX A;  1CQ9 A;  1LOC A;  1W8F A;  3SKV A;  3ZDV A;  1QDO A;  2VCC A;  3GBW A;  5DAP A;  2GP5 A;  1H9W A;  4XUR A;  4LO6 B;  1XXN A;  4H14 A;  4BME A;  1OLQ A;  1GFF 2;  2WL1 A;  1RYY A;  1L7Q A;  3AP9 A;  1HB4 A;  1NE6 A;  5E16 A;  2BYV E;  1TME 2;  4YM1 A;  3ZYF A;  5CZK A;  4LOS A;  3III A;  3TEW A;  1R09 2;  3PLQ A;  3DXU A;  1S0F A;  4R8H A;  3RWN A;  2XGX A;  4RQP B;  3V0A B;  2BOJ A;  2VW0 A;  1SQ4 A;  1ZZ6 A;  1KRI A;  4CCK A;  3ALQ A;  2CDP A;  3AYD A;  4A3X A;  2O0O A;  4QX0 A;  4M0H A;  3ILN A;  2YC0 A;  4RR3 C;  4HET A;  3WP6 A;  4O65 A;  4Q26 A;  2YBS A;  3TN9 2;  3NVC A;  3WW2 A;  1AYN 2;  1RIR A;  1S2K A;  4I3P A;  2BQP A;  3OTF A;  1BKZ A;  1NOV A;  4AI9 A;  3SCG A;  3QD6 A;  5FPU A;  3GF6 A;  3MI8 A;  1AR7 1;  4JDO A;  1JOD A;  3PU3 A;  4Q4X 2;  3CO2 A;  1JH5 A;  3KS7 A;  3ZR5 A;  5L19 A;  2DV9 A;  4G3Y C;  4XF0 A;  3BPS A;  1SFN A;  3K3N A;  4N9I A;  5CIS A;  1V6J A;  4AHZ A;  1BXH A;  2B9V A;  5FZK A;  5C5U A;  2BP6 A;  1KS5 A;  1QIQ A;  4CDW C;  1CX1 A;  3FMG A;  5LEK A;  4YZ4 A;  1D4V B;  4GXL A;  4WBB A;  4Q4Y 2;  3Q9O A;  5E89 A;  5EFU A;  3RZK A;  5IVJ A;  2VL4 A;  5GLW A;  2W2I A;  3O1V A;  2CL2 A;  2NP0 A;  1GAN A;  1QDC A;  1D4M 2;  4AFB A;  5FOJ B;  4AG4 A;  2QQL A;  1W3V A;  5C8C A;  1YIP A;  2XJS A;  3CEW A;  3J7M A;  4FOY A;  3EO6 A;  1NCR C;  3MUY 1;  2WA3 A;  3ON7 A;  1RIT A;  3T1M A;  2XL9 A;  2ZGL A;  1A8M A;  1W6O A;  5I93 A;  4GWM A;  5LB6 A;  2QQN A;  5BNQ A;  1OH3 A;  2GNB A;  1GZT A;  1ZYB A;  5BNP A;  4JGY B;  3WNX A;  3ACH A;  3WP3 A;  5FUI A;  3I97 A;  3QCW A;  4Q0P A;  5JR7 B;  1UAI A;  1SBE A;  3SH5 A;  1UX6 A;  4FVV A;  2FBE A;  3VBH C;  5F3G A;  3WF1 A;  1IS6 A;  4J25 A;  3O12 A;  3JBG 1;  5FWE A;  3KQR A;  4D69 A;  1RHI 2;  4XFB A;  2W1S A;  3DYP A;  5EPA A;  5IUQ A;  2ZMK A;  2WS9 3;  4GJY A;  1D0G A;  1DLL A;  1XU1 A;  2PHD A;  2QJV A;  2EIC A;  1SLT A;  4YG6 A;  1NA1 C;  4BK5 A;  5A7O A;  4ITC A;  3LQC A;  1CX4 A;  4PDW B;  3ZM8 A;  2RDN A;  4HSJ A;  1Y7B A;  3AB0 A;  4V2W A;  1DLC A;  2XJV A;  1NE4 A;  1FPN 1;  3WP4 A;  1P8J A;  1XB9 A;  2W95 A;  3RG0 A;  5A32 A;  4IXL A;  2DCK A;  1C8N A;  3VDA A;  1JN2 P;  2VMC A;  5FP9 A;  4JTO A;  3CLP A;  1W6Q B;  5C8C C;  5FFO C;  2BUK A;  1VRH 2;  2WO1 A;  4YLZ A;  2W08 A;  1AXZ A;  1ND3 B;  3PL0 A;  3NAP C;  1R08 1;  4OZX A;  4CP9 B;  3U11 A;  5J98 B;  5T55 A;  1AR9 1;  3X29 B;  4KWK A;  1AR9 3;  2OX0 A;  4K21 A;  2Y60 A;  1W9Y A;  4O9G A;  2DCY A;  2DCZ A;  4KQ7 A;  2ZGM A;  5LA1 A;  1Q8V A;  3KGZ A;  1AR8 2;  1CES A;  5FRA A;  4X8N A;  1G9C A;  1QMJ A;  1TMF 3;  2BZD A;  5LY1 A;  3HN3 A;  1YYN A;  3W9A A;  4N8M A;  2BJS A;  4GQ7 A;  3ZKU A;  1PNF A;  1X82 A;  1OOP C;  2DBI A;  2W9X A;  5LA9 A;  1CPN A;  1POQ A;  3HN1 A;  4OVE A;  4NID A;  4FTB A;  4XFI A;  3JD7 2;  4AFD A;  4AQS A;  3J7L A;  1SFP A;  1M4W A;  4GIQ A;  4HPK A;  2QQO A;  4RHV 1;  4RHV 3;  4YWA A;  5FZC A;  5IK7 A;  3V64 A;  1OQD A;  2WAB A;  5L9V A;  4COZ A;  4KWJ A;  1N3P A;  2V4A A;  3AXE A;  5FPA A;  3TN9 1;  3UKT A;  3TN9 3;  5D8A A;  1CN1 A;  2RE9 A;  3OJB A;  4BMB A;  2EF6 A;  2CSG A;  1EPZ A;  4Y1V A;  1U5I A;  2XH6 A;  3ZXJ A;  2Z79 A;  2Z4F A;  3FZ3 A;  4Y1X A;  2PTM A;  5DUW A;  5K4L A;  4B7K A;  3ZLI A;  4Y3O A;  1W6N A;  3QLQ A;  1S2B A;  2EIG A;  3LDR A;  4P5Y A;  1W8U A;  4MGZ E;  3THT A;  4A45 A;  5C5T A;  2D43 A;  3MGU A;  4WV8 A;  2O14 A;  4Q4Y 1;  4DY5 A;  2IXI A;  5ACA 2;  4KMQ A;  4Q4Y 3;  3WV6 A;  4QDS A;  3W5M A;  1ULP A;  2A70 A;  2HEV F;  2P2K A;  3LSE A;  3T0A A;  3FFQ A;  3RDI A;  3IPV B;  1HQN A;  3RFR A;  3WG2 A;  5BNN A;  5FKB A;  5EXO A;  1YFW A;  1H4H A;  2EAK A;  3A22 A;  1Q43 A;  3JCI A;  2ZHK A;  4AGV A;  5C71 A;  4BHP A;  1I1E A;  2VW2 A;  4BLJ A;  2R07 2;  1JYT A;  1WCK A;  3DL3 A;  4QQO A;  4LO8 A;  3AKQ A;  4UBH A;  4LA3 A;  5FZA A;  3FLP A;  2EXI A;  3FBY A;  1PGL 1;  1ALY A;  1DYK A;  3FJS A;  5BUV A;  1FV2 A;  2B5H A;  4L9B A;  3AMN A;  1AL2 1;  4CDW B;  3KSC A;  1AL2 3;  3Q8A A;  1RHI 1;  4LXL A;  2I74 A;  3ZKY A;  1RHI 3;  3CJI B;  4TWT A;  5EP9 A;  4BWO A;  4YNI A;  5J48 A;  1UY2 A;  3E6B A;  5JOX A;  4GA9 A;  2CYF A;  4LUL A;  4WM8 A;  2BFU S;  3CL1 A;  3NKG A;  3KV6 A;  1I5P A;  3PUS A;  4FP3 A;  1JI6 A;  1RL3 A;  3LFM A;  1NCR B;  3J7N A;  1FNZ A;  4NR1 A;  2DCJ A;  4ZS3 A;  3ZYI B;  3I2G A;  2ENR A;  4COV A;  2WLQ A;  1FYU A;  2YBK A;  4QAW A;  3MZH A;  4OMC A;  5F32 A;  4AEM A;  4H7L A;  1WZX A;  1YLL A;  2DUP A;  4XAA A;  1YFY A;  5C3O A;  4B8E A;  3R4U A;  3OUH A;  2AR6 A;  1W0N A;  2VUD A;  3VBH B;  2FCV A;  3PDQ A;  3HMY A;  1QJX 2;  3MFA A;  4GD4 A;  1ZRR A;  2BBV A;  3DKQ A;  2ZGS A;  5KC6 A;  5FPV A;  1BCX A;  5LAT A;  2VME A;  5DDJ 2;  2JEM A;  4PIZ A;  3M70 A;  1Y43 B;  2VUA A;  1NA1 B;  3KV9 A;  1AR8 1;  3P3N A;  3T2P A;  3AP5 A;  4Y22 A;  1AR8 3;  2R6Q A;  1S1A A;  2PFW A;  4RS5 A;  1BK1 A;  2DUR A;  3NJZ A;  1V9U 2;  3BTY A;  3VBF B;  5C33 A;  2P6C A;  1BVV A;  3ETQ A;  5JWP A;  4X8P A;  1DBN A;  3DYM A;  5IAV A;  5K0U A;  1DGR A;  3WIN E;  4AFM A;  2ZEW A;  2XKP A;  4FPF A;  5FY7 A;  5LBB A;  5IAX A;  2Y26 A;  4EWA A;  3D82 A;  3NAP B;  4BXF A;  1DDL A;  3T2O A;  3LIH A;  1OVP A;  2F6B A;  1K5M A;  1REE A;  3EQE A;  1V6K A;  3ZFE A;  2VY0 A;  5CG8 A;  2D3R A;  1YI7 A;  2IZW A;  2BGP A;  2CWS A;  2WR9 A;  2DU1 A;  4KG8 A;  4JTN A;  4BOW A;  1JXN A;  5L36 A;  1JOJ A;  1F31 A;  5A3L A;  1AR6 3;  1MQT A;  1IKP A;  1LJ7 A;  3RVH A;  1E57 A;  1TZO A;  1KEX A;  5CNA A;  4RGA A;  4XJ8 A;  4ASL A;  1OOP B;  3BCW A;  1WBF A;  4TSV A;  2E32 A;  2ZZJ A;  2VOV A;  3M8L A;  1S0I A;  1XQN A;  1XBF A;  4JKL A;  2W1W A;  4UI9 L;  3AMP A;  3BTA A;  2K46 A;  3MEP A;  3TRS B;  4RS5 C;  3PU8 A;  1IKQ A;  2P3K A;  3M3O A;  3WEZ A;  3T4H B;  2BFU L;  2Y38 A;  1WMD A;  5FJH A;  2HYK A;  2IVJ A;  3T08 A;  1PK6 C;  3ZN6 A;  4ASM B;  1LOF A;  1QY4 A;  1XE8 A;  3AL6 A;  5T5O A;  2I2S A;  5A3M A;  5JMO A;  1U5Z A;  4QB6 A;  2JB4 A;  2VQT A;  4EYU A;  3GNE A;  5JR2 A;  5FXX A;  1G9B A;  2CGP A;  3BOP A;  1CAV B;  2XHK A;  3JUU A;  4PF1 A;  2OQ7 A;  1BZW A;  2WO3 A;  3WW4 A;  4XMA A;  3H50 A;  4ZU4 A;  1O8S A;  3FUO A;  3RJ2 X;  3VKO A;  5KXB A;  3HWJ A;  1K3I A;  3WCS A;  3WNL A;  1CZS A;  3HQU A;  3ZYJ B;  4JHT A;  4FI9 A;  1H0B A;  1XYP A;  3H1W A;  1GV9 A;  2D97 A;  4J1W A;  1ZBE 1;  4XTM A;  5AVP A;  5GJ6 A;  3ZPY A;  4YVS A;  1PM4 A;  1ZBE 3;  4W6W A;  3LF7 A;  4XUN A;  1KD7 A;  3HVD A;  5FPX A;  2QQJ A;  4RL7 A;  4E8C A;  4JRL A;  4Q0U A;  4XE9 A;  2X53 S;  3PVO A;  2JDK A;  3SQO A;  4Z8B A;  3KCX A;  1DF0 A;  5JI9 A;  3HIF A;  1N1V A;  1XJA A;  3TWI A;  1S55 A;  2DUO A;  2R0H A;  5FZ6 A;  1NX9 A;  3LAG A;  1PVC 2;  2W87 A;  2OUH A;  3WLU A;  5EJZ B;  3WHU A;  3UJO A;  1L3J A;  4AWD A;  1OUS A;  1YQ6 A;  4QMA A;  2EAL A;  1GZW B;  1I5Z A;  1WLD A;  4IL7 A;  4QD2 A;  4C90 A;  4Y5S A;  3A7Q A;  2CTV A;  3KVB A;  3VDD C;  3OYW A;  4Z82 A;  3SH3 A;  1W2O A;  5LZ6 A;  2C24 A;  3R4D B;  2QFE A;  1Z0H A;  3I3B A;  1J1T A;  3THP A;  4M0N A;  2VZQ A;  3HNM A;  5A6X A;  5JZG C;  2WDB A;  2CNA A;  1PM7 A;  2H6C A;  1UYY A;  1V6I A;  4DRV A;  4NRO A;  1ND2 A;  2P6H A;  5FZ4 A;  2OQ6 A;  4ZXE A;  1BMV 2;  3T30 A;  1UWW A;  2NQY A;  2EIB A;  3LSD A;  3SNM A;  2WN2 A;  3ZFG C;  4YVS C;  1GYK A;  2E7Q A;  2TUN A;  1D0H A;  4PIX A;  4CP1 A;  2P34 A;  3GHM A;  4EN0 A;  4TYS A;  4WVM B;  1SBF A;  1N1S A;  3P6B A;  3BIE A;  4JRA A;  1V9U 1;  1DZR A;  1AL0 G;  1V6N A;  4CTE A;  1CGP A;  1MS9 A;  4IEO A;  2Y6H A;  5JSR A;  1X33 A;  2D6N A;  2JG9 A;  2V4V A;  4UW6 A;  3ZXE A;  4BIF A;  1RUH 1;  4XPV A;  2AEY A;  2SBA A;  5ANN A;  1RUH 3;  3M3C A;  2GH8 A;  4NMI A;  1GMM A;  2V73 A;  2J1U A;  4CDX A;  5JIA A;  5LK5 A;  1FOD 2;  1QXP A;  4TXW A;  1WLT A;  1E5H A;  2DUQ A;  1JYX A;  3AYC A;  1YUD A;  1GP4 A;  1RXF A;  3WG3 A;  5F37 A;  1S0D A;  2RS5 2;  3ACG A;  3LD8 A;  1COV 1;  2D6M A;  5FZ9 A;  1O91 A;  3POE A;  4IV3 A;  2XJU A;  3MPP G;  1COV 3;  3KMH A;  1GU3 A;  4AVC A;  4ATE A;  4CXX A;  2YZ4 A;  4COU A;  5A3N A;  3VD5 A;  1ND2 C;  4UT5 A;  3VUO A;  5T52 A;  5JXG A;  3C2U A;  4L2N A;  4XUQ A;  1PGS A;  4N43 A;  5F5A A;  1RUF 2;  1OFN A;  4PLM A;  2RS1 2;  4FQ4 A;  1STM A;  2ZX4 A;  2DVB A;  3A23 A;  1RMU 3;  2Y6K A;  1XOY A;  3KQ4 B;  3L2Y A;  4FTS A;  1GWL A;  1ULF A;  1OHF A;  2VMH A;  3WDV A;  3W21 A;  1DQ2 A;  3JB8 A;  3O5S A;  1R1Z A;  3AYA A;  3WY6 A;  1UPS A;  1ZZ9 A;  3OY8 A;  5FK8 A;  1LTE A;  3HBK A;  2D6P A;  3LA2 A;  1OD5 A;  1QQP 2;  4NRQ A;  4DPN A;  3C7H A;  5DZG A;  3MIG A;  2WNO A;  3PNA A;  4XIL A;  1PO2 1;  1WLW A;  3W5N A;  4GWN A;  1PO2 3;  4YM3 A;  1RUE 3;  1F9K A;  1GNZ A;  2JE9 A;  2WO7 A;  5FZ8 A;  1HV0 A;  1DYO A;  3HT1 A;  5FOB B;  4Q4V 2;  2WFP A;  2XLA A;  1C3H A;  2CU5 A;  3VDC A;  4LBL A;  3AC0 A;  4N53 C;  2OPK A;  1HJF A;  3UGH A;  1H6X A;  4YGC A;  1CJP A;  2RS3 2;  3AVR A;  2YV8 A;  4IQP A;  4KL1 A;  2JDN A;  4B1M A;  5ABJ A;  5F5I A;  1PK6 B;  1JU4 A;  3T09 A;  3ZYR A;  3M3I A;  3ROU A;  1C5I A;  5I0S A;  2HWD 3;  4UW3 A;  1JHN A;  4CDQ C;  1C57 A;  1PVC 1;  1OPO A;  2LAL A;  5ERL A;  1PVC 3;  4LUK A;  4EE2 A;  5B4N A;  1CZV A;  2UYB A;  4M4P A;  4FFF A;  5AC9 2;  5J96 B;  5JSO A;  1KFU L;  5FZD A;  3F95 A;  1SAC A;  1J1L A;  2E26 A;  2VMI A;  5C9A A;  3O1M A;  5FCC A;  4MXW A;  4IE6 A;  2VAU A;  2WT2 A;  4XQ4 A;  4M00 A;  5CBL A;  4LK7 A;  3T0B A;  2VZT A;  1N1T A;  3LEG A;  4ARX A;  2QDN A;  5FY9 A;  5FZB A;  4DS0 A;  5F7U A;  2VOX A;  3CF6 E;  3MLL A;  4YZ2 A;  2ZX1 A;  2LW8 A;  1W6P A;  1EY2 A;  3TEX A;  1ULE A;  3PIG A;  1JYC A;  4YW6 A;  1OUX A;  1R64 A;  4LKS A;  1PZ9 A;  1UU5 A;  3WDX A;  4ET7 A;  4P14 A;  1J3P A;  4QDR A;  2PHX A;  4ISQ A;  2R49 A;  1ASJ 2;  4FPC A;  4BE3 A;  3TBD A;  4FPG A;  3QBQ A;  5CB7 A;  5BNO C;  1GZ9 A;  5F8P A;  5L9B A;  3WF0 A;  1UY4 A;  3ZXA C;  2VR4 A;  1W28 A;  2ID4 A;  3BI3 A;  1EV1 2;  1W9W A;  3PHM A;  3U78 A;  2J1V A;  3VDD B;  5FZ1 A;  3SKJ E;  4IER A;  4Q0S A;  3BIW E;  1YQC A;  1FOD 1;  5JZG B;  3MIE A;  1FOD 3;  2NM1 A;  1SHW B;  5HCF A;  1VR3 A;  5CKM A;  2AGS A;  3ZMN A;  2IXJ A;  2MEV 2;  1QKQ A;  1C8M 3;  3RYP A;  2BBA A;  5CAD A;  2ZAA A;  3LOI A;  3ZFG B;  2Y64 A;  1MS4 A;  1VMF A;  4CUB A;  1WW7 A;  5E6H A;  5IVB A;  3ZXL A;  3N4M A;  5SV8 A;  3FL7 A;  5A80 A;  3VBS C;  4GJZ A;  4YAR A;  2WNU A;  3K4D A;  5TSW A;  1LCL A;  1WCS A;  4UFK A;  3ZYP A;  2JDY A;  2FCT A;  2ZGT A;  4QX2 A;  1RUF 1;  2DCT A;  1WD4 A;  3RMX A;  5FDB A;  4JKM A;  4XBL A;  4A4A A;  3UT0 A;  2QQV A;  3N9N A;  4AGR A;  2VUC A;  4CEW C;  4K6B A;  4K8F A;  5FYV A;  4Q0Q A;  4LBJ A;  4XDQ A;  4CYD A;  1WW5 A;  4Q1P A;  5IHR A;  2JD4 A;  3R6S A;  2PMW B;  3VHP A;  5F2W A;  3U0Z A;  4YVW A;  1IS5 A;  3UYJ A;  1QOO A;  4HN1 A;  4CU6 A;  4BCU A;  5BV6 A;  1QQP 1;  5A6Z A;  4CCE A;  1QQP 3;  4FPO B;  1BJQ A;  1H4G A;  5BXX A;  4UF0 A;  3O0X A;  4C91 A;  4E9K A;  1ZZ8 A;  2RJK A;  2VW1 A;  5FO8 B;  1Y3T A;  4IND A;  3BOW A;  3GZU C;  3DV8 A;  1RUD 3;  1SDD B;  2Q8C A;  5DAV A;  1RXG A;  2XDV A;  2YBP A;  1ENX A;  3DXT A;  3KVA A;  2DVD A;  1VP6 A;  1U5Y A;  4AED C;  3PME A;  2QQP A;  4Q4V 1;  4QPI C;  1AF9 A;  4XFA A;  5GM0 A;  2JDP A;  1Z78 A;  2QNK A;  3AKT A;  4M3C E;  4QX5 A;  5FV3 A;  1QNW A;  3ZSK A;  3POF A;  3H7Y A;  4HON A;  3TEZ A;  5IWF A;  1MS0 A;  1DQ4 A;  1VAM A;  1WUV A;  3WSO A;  3ZYB A;  1BBT 2;  1DQ5 A;  4TZD A;  1ZA7 A;  3B93 A;  4E2S A;  4AQ2 A;  2Q4S A;  3V0B A;  1PVX A;  2XBO 1;  3GCW A;  2HEW F;  2XBO 3;  5IVE A;  2JWP A;  3VD4 A;  4CEY C;  2Q8D A;  3NST A;  3MBW A;  1HN0 A;  1G8W A;  2ARA A;  5AC9 1;  4DFS A;  1E5I A;  1XU2 A;  2H0B A;  3RI9 A;  5AC9 3;  2GMM A;  3VZN A;  1VBB 2;  2D40 A;  4YGE A;  3L9J T;  5E8A A;  3H1M A;  3M3Q A;  4NAM A;  4QXH A;  4LQR A;  2XWB B;  2X5I A;  4AAX A;  1RUG 2;  3UNP A;  2GMP A;  2JIG A;  2VZV A;  3N9L A;  4SLI A;  3VKL A;  4HKO A;  4N53 B;  4Y20 A;  5JI7 A;  3MF6 A;  1KS4 A;  1QH7 A;  2C9K A;  2D7F A;  1LAJ A;  4JV4 A;  1PZ8 A;  2RM2 2;  2JB8 A;  2RDQ A;  4TLF A;  5I8Y A;  2WZE A;  4JHZ A;  1W2N A;  2BNN A;  3DEC A;  2VTX J;  3WNP A;  4TN7 A;  4GH4 A;  4HZF A;  1K45 A;  3ITQ A;  4P9L A;  1AZD A;  1KJL A;  4YW4 A;  5IVF A;  1LNS A;  2V72 A;  4BQW A;  5KHI A;  4D7Y A;  4HN0 A;  4CDQ B;  2PHR A;  3B9C A;  3GDB A;  2RR1 2;  3G7D A;  4R9D A;  2K2S A;  2PQQ A;  5AFE A;  2OZJ A;  2QTW B;  4C0B A;  4DUW A;  5JXI A;  4XC9 A;  5HV0 A;  2FZ1 A;  1EV1 1;  5FY5 A;  3J8F 2;  3EB7 A;  1ZZB A;  1JZ6 A;  4NHL A;  2QBX A;  4HG6 B;  3U07 A;  1OLM A;  1HQL A;  2W1Q A;  4P9X A;  4XDP A;  2VTF A;  1VRB A;  4Y1Y A;  5GZD A;  1CAU A;  3VBU C;  4YW5 A;  1LGB A;  2MEV 1;  3C3V A;  3UL2 A;  1Q8O A;  4HL0 A;  4QM9 A;  3WDT A;  4O9E A;  1JTZ X;  4W65 A;  4IEZ A;  1VBC 2;  3MW2 A;  1D2Q A;  5J37 A;  3OD0 A;  1JYN A;  3OPZ A;  1JW6 A;  1QJF A;  3ZYG A;  2GAL A;  5GKA C;  3KB5 A;  1RUI 1;  4RFT 0;  3KWV A;  2YG0 A;  4SBV A;  1RUI 3;  1OXC A;  1YWK A;  4XHX A;  4XQD A;  4FPH A;  3LEM A;  1X9P A;  3FBM A;  5BNO B;  4LHN A;  4QXC A;  4PLO A;  1W2T A;  3ST7 A;  5IK8 A;  1F5F A;  1NXM A;  3ZMO A;  4FAG A;  2FZ2 A;  3WG1 A;  2P4E A;  1OBN A;  3IB3 A;  1WWY A;  3J9S A;  2DU0 A;  1MS1 A;  1SEF A;  3H9A A;  1YXW A;  1LOA A;  4LA2 A;  3MIC A;  4M3C F;  5C4W C;  4LKD A;  5FLJ A;  1ST8 A;  2B42 B;  1UOB A;  2E7A A;  1WCU A;  3NNJ A;  4NVP A;  3POJ A;  1Y4W A;  5C70 A;  1GP6 A;  2VC9 A;  1AR7 3;  1B35 B;  1GNY A;  3B00 A;  3VD9 A;  5L7O A;  3BUC A;  4MG2 A;  1ZZC A;  4ZS2 A;  4U36 A;  2P3Y A;  4QPG A;  4YW1 A;  1NQJ A;  2P3I A;  3FC0 A;  3PVE A;  3VBS B;  4V2V A;  1GNH A;  3CKH A;  4HVO A;  5FP3 A;  4AXO A;  4C0H A;  1LOD A;  1UYP A;  2R06 1;  1RIN A;  2NZ9 A;  5FZL A;  1SFY A;  2R06 3;  3AMM A;  2J1R A;  4FPK A;  4EWE A;  4HMZ A;  1JZ3 A;  4QKB A;  2OW4 A;  4IGQ A;  2Y6J A;  1H1I A;  1GZC A;  3GZE A;  3R05 A;  1TQ5 A;  4YW7 A;  1BBT 1;  2A6X A;  1W9S A;  1VPH A;  3M1H A;  2GP3 A;  2XQX A;  1BEV 2;  3FX3 A;  4HOO A;  4JQR A;  1IS4 A;  5FYY A;  2FDH A;  5FRE A;  2DTY A;  2ERF A;  4AVV A;  3W20 A;  1OA2 A;  3HOB A;  1VIW B;  1NUK A;  1J58 A;  1XE0 A;  1T6G C;  2ZAB A;  2WUH A;  4FP2 A;  1GKB A;  2VVF A;  5FWJ A;  3VBO A;  4OHV A;  1TNR A;  3FN9 A;  1VBB 1;  2W47 A;  1F4H A;  1VBB 3;  3CNA A;  3KT7 A;  4QPI B;  2C9A A;  3JBG 3;  1RUG 1;  4LIT A;  4BA6 A;  1QJY 1;  1S4C A;  1MR5 A;  1RUG 3;  1US2 A;  2G4I A;  4KH9 A;  4AOC A;  1QJY 3;  2OA2 A;  3RZH A;  1W8T A;  4XF9 A;  1AJO A;  1KIT A;  1NLR A;  1UY0 A;  2AC1 A;  3ZSJ A;  4CCD A;  1H2L A;  1UMH A;  1OF3 A;  3OD4 A;  1VAK A;  4UFH A;  2PXJ A;  1TEI A;  1VJ2 A;  2VVE A;  4XAC A;  2QQK A;  5FMD A;  3MHZ A;  3AMH A;  1MVE A;  2HWC 2;  2RDS A;  4LBQ B;  1FPN 3;  2JIJ A;  4BIO A;  2HWF 1;  1W0O A;  1WLC A;  3USS A;  2ZX2 A;  2HWF 3;  4M3C B;  4RGK A;  2HLE A;  1VB2 A;  3LB9 A;  5ANQ A;  4UAP A;  3VKN A;  4CEY B;  2ATF A;  4XET A;  2VBB A;  4WZF A;  2YU2 A;  3NJX A;  4QX7 A;  2E51 A;  3SCH A;  3D5O A;  5FYT A;  1R08 3;  2GNT A;  1O4Y A;  1OA3 A;  2Q5T A;  5A7P A;  1IGO A;  1HQW A;  4R4Z A;  3I59 B;  5BNP C;  2B46 X;  5LK7 B;  4NIG A;  2VQA A;  1UL9 A;  5I0R A;  2PYT A;  3K77 A;  1XSQ A;  2QDR A;  3J4U H;  4PHZ A;  3U1X A;  4CVU A;  1W6M A;  1SDW A;  4H3W A;  4GUL A;  4QB2 A;  1SCR A;  4XYX A;  5FYI A;  3UES A;  1X7N A;  1GIC A;  2GC1 A;  3WNN A;  1TME 1;  1VBC 1;  4AI2 A;  1TME 3;  1VBC 3;  3J26 N;  2N7G A;  1ENS A;  1R09 1;  3I54 A;  4FT8 A;  1R09 3;  3JU9 A;  5G04 L;  2X29 A;  1YQ8 A;  2VUL A;  3H8R A;  3KF5 A;  4L8Q A;  4CUC A;  1VBE 2;  4MOA A;  2AAC A;  5EHD A;  2Y6F A;  5KXE A;  2A3Y A;  1CAX B;  5DUX A;  1UOF A;  4IV1 A;  4ZXK A;  4XHB A;  2AZ5 A;  3PJY A;  1X36 A;  4B7E A;  2E31 A;  4UFI A;  2BWC A;  3IDB B;  3POI A;  4OLL A;  1KGY A;  3G6J B;  1AYN 1;  2BV4 A;  3V0B B;  1AYN 3;  4Y1Z A;  3NNF A;  5IK4 A;  1FI2 A;  1IQD C;  2F4L A;  3AKP A;  3VBU B;  1EAH 2;  4QDQ A;  4JAA A;  2OVU A;  3RGB A;  3D0J A;  4Q4X 1;  4COY A;  2Z42 A;  4GB3 2;  3TAY A;  4Q4X 3;  2EXK A;  2WFF 2;  4KGG A;  2VTX A;  1MVQ A;  1DGR N;  1CAW A;  1K12 A;  1CVN A;  3PJQ A;  1OLR A;  4YW3 A;  2WC2 A;  3WF4 A;  4BLI A;  4CA9 A;  1PO1 2;  5EYX A;  1NG0 A;  1JOP A;  2QQM A;  5FQ0 B;  2CHH A;  4DUV A;  3ETP A;  1O7F A;  4D6S A;  4MYE A;  1D4M 1;  2LM3 A;  4RR3 B;  4PQ9 A;  4XFF A;  1D4M 3;  2ETE A;  4XFH A;  1C1L A;  4D7S A;  1GQG A;  4F83 A;  1GSL A;  4MX3 A;  4XJU A;  1E5S A;  5C4W B;  1WMX A;  1JU3 A;  5F3C A;  1XYN A;  2JD9 A;  1BEV 1;  5LRR A;  4XZP A;  1S0J A;  5EZW A;  5B4X A;  1XC6 A;  1U0A A;  3URF A;  4AI3 A;  3MIB A;  4CRQ A;  5D8A C;  5FKC A;  2DF7 A;  5HXV A;  3S30 A;  5A70 A;  3AFK A;  2H6B A;  3IMN A;  3RSJ A;  1GR3 A;  4EQV A;  1LRH A;  3DPR A;  4LO7 A;  3D0S A;  1G9D A;  2B45 X;  2XB6 C;  4MUV A;  4ES8 A;  4FTE A;  4XJA A;  1RUJ 2;  2JE8 A;  4FFG A;  2P17 A;  2A7A A;  4MHR A;  3FUQ A;  3S5A A;  5I91 A;  3F2Z A;  3OB8 A;  5HCA A;  1SLL A;  3KCY A;  2LUW A;  1X50 A;  2R16 A;  2R04 2;  4JGZ A;  5FBZ A;  5C3P A;  3N9O A;  2E6V A;  2IXL A;  4IUG A;  1JZ5 A;  1OQ1 A;  3POS A;  1T6B X;  2WSV A;  3AKS A;  1XNB A;  3T1L A;  1RUO A;  3ZPO A;  1QOS A;  2ZEZ A;  1EYB A;  3N9P A;  5BNN C;  2B39 A;  4MGQ A;  1S0C A;  1VRH 1;  5FYC A;  5IYY A;  1QXR A;  2XWJ B;  3UV9 A;  3S57 A;  1VRH 3;  2EIE A;  4OHZ A;  4XMI A;  1Q3E A;  2BW8 A;  4LKF A;  1GWK A;  1MAC A;  1W05 A;  4IE7 A;  1UCX A;  2CAU A;  3PUI A;  2K9Z A;  1JYI A;  4ARY A;  3FFZ A;  3HQX A;  2JE7 A;  3WQB A;  5LWB A;  2EA7 A;  2PHU A;  4B4R A;  1S0E A;  1QGL A;  3PTR B;  3WCR A;  4AK3 A;  2W91 A;  3O0V A;  4L99 A;  1EP0 A;  2VNG A;  4CDU A;  4AHY A;  4B1L A;  2JDA A;  4MET A;  4BH9 A;  3LA7 A;  4FOV A;  2D5F A;  5CVR A;  3KF3 A;  4P9W A;  3ZYH A;  5H9P A;  4LEJ A;  4YFZ A;  1CIY A;  2NN8 A;  1OKO A;  1UZY A;  1UZW A;  2PHT A;  3ZXF A;  1VBE 1;  4AQT A;  4WM8 C;  1SLC A;  4EN7 B;  5C8C B;  4KG0 A;  1VBE 3;  3WT3 A;  3WDU A;  4BQ2 A;  2JDZ A;  3C7E A;  3VZO A;  2KXL A;  5ISL A;  3JD7 1;  2WSU A;  1OH4 A;  4QX8 A;  2A5Z A;  3UKN A;  4BQX A;  4D3W A;  3JD7 3;  4AHX A;  1A6C A;  3FHQ A;  1W6O B;  5DUU A;  2PAE A;  2VOW A;  3LIG A;  4O61 A;  1A8D A;  1NCQ A;  4NWW A;  2PN5 A;  1AX2 A;  3IIA A;  3ZSM A;  5BNP B;  1O3T A;  3ME2 A;  4K1Z A;  5CYY A;  3B3Q E;  2A6V A;  4C1W A;  3USU A;  2ZBJ A;  5LAS A;  4NOT A;  2WZ8 A;  2VMG A;  5IFT A;  4HBN A;  1W04 A;  4Y5T A;  3B94 A;  5FTT C;  1EAH 1;  1KQR A;  1RVF 2;  1PMI A;  5A3T A;  3GGL A;  1EAH 3;  1HRI 2;  4HLT A;  3T0D A;  1VBD 2;  3PUA A;  4GB3 1;  5FPB A;  2WFF 1;  1O4Z A;  4GB3 3;  2XHN A;  2BGO A;  2AUY A;  5FYZ A;  1PGW 2;  1BYH A;  4BQ3 A;  1PO1 1;  4MGT A;  2VOK A;  3LCP A;  1PO1 3;  5ACA 1;  4E4H A;  1YFU A;  5T5L A;  4MLO A;  3RZZ A;  1FMD 2;  3ASI A;  1UU4 A;  1ZNP A;  4FPL A;  5A32 B;  5ACA 3;  1LHU A;  3JQX A;  3POW A;  3WP5 A;  4ZU5 A;  1IS3 A;  2VJX A;  3PVB B;  2W94 A;  1NQD A;  3RYR A;  1NLS A;  2DTW A;  1LOG A;  3BU7 A;  4AEK A;  5J7M A;  5K0U C;  4XW3 A;  3EHK A;  4Z1V A;  5F1R A;  4LIV A;  5CG9 A;  1RB8 G;  1SMV A;  5K7P A;  2JDH A;  2R07 1;  3QOP A;  3VHN A;  1HKD A;  1OFS A;  1PIV 2;  1YFX A;  2R07 3;  1K5M C;  2W46 A;  2JX9 A;  3HAG A;  2JKB A;  4FFI A;  4QXK A;  5FYH A;  5CFD A;  3SC7 X;  3ZFE C;  1O3R A;  2G9G A;  1VLN A;  1BVP 1;  1TG7 A;  1UOJ A;  3OG2 A;  5A7N A;  5A1F A;  4FPY A;  3RMY A;  2OKX A;  5KHJ A;  3VN4 A;  4LHL A;  5HCH A;  3BVC A;  1ONA A;  2MPF A;  5C8W A;  4DO0 A;  3Q8F A;  4JCK A;  2HBU A;  1MQT C;  5LRS A;  2AYH A;  2B8M A;  1BLZ A;  1F8V A;  1DGW A;  4D94 A;  3IDC B;  2BPA 2;  4Q5O A;  3OPT A;  5FUP A;  2JG8 A;  3Q8E A;  2D3P A;  2ADD A;  4LHS A;  1RUJ 1;  4EN8 B;  3LZZ A;  2J1S A;  1RUJ 3;  5HCB A;  3BN6 A;  4E4S A;  1FX5 A;  5AVA A;  4NWV A;  5C7G A;  3W58 A;  2R04 1;  2R0F A;  3RNS A;  5FZE A;  4HPK B;  3ELN A;  4L11 A;  2FHR A;  3W59 A;  3WZ1 A;  4D7T A;  4CCO A;  1JZ4 A;  1LOF C;  1WME A;  4I0B A;  2DWR A;  3INA A;  4R9C A;  4XUO A;  4QXB A;  5D8A B;  5K9Y A;  1UY1 A;  3IT8 A;  1V6L A;  4LOR A;  3U4S A;  2PAK A;  2VCA A;  3ZSL A;  1QJX 1;  2RJ2 A;  3DGT A;  5F3I A;  1QJX 3;  1RJ7 A;  3DUI A;  5FZO A;  3U10 A;  3DN7 A;  5DDJ 1;  4AVB A;  5J3U A;  1WKY A;  1W6N B;  5DDJ 3;  5FYU A;  5GAL A;  4NII A;  1H8T A;  4UXA A;  4XBQ A;  4K7J A;  2E33 A;  4P9G A;  1N3Q A;  2ARE A;  2C26 A;  4PBP A;  4GWJ A;  1HV1 A;  4XF1 A;  2QUO A;  2EAA A;  4FCA A;  4KGQ A;  3TEY A;  1DP0 A;  2GSY A;  2CY6 A;  3AX4 A;  3KM5 A;  4IEU A;  2BNM A;  2GH2 A;  3PMS A;  4Q8K A;  1V9U 3;  2VBD A;  5KHG A;  5SV5 A;  1W3X A;  1YI9 A;  5BNN B;  5C3R A;  3K48 A;  3ZFF A;  3I2H A;  3SCF A;  2W1U A;  3I2F A;  5I0T A;  1UZV A;  3GJB A;  1K5J A;  1H2N A;  3H3L A;  2YPJ A;  1NLQ A;  4UFL A;  1N47 A;  2XJR A;  1VB4 A;  4FPJ A;  3K75 B;  1CJD A;  3AP4 A;  3NKT A;  2YC2 A;  4AVT A;  3BYW A;  4E2G A;  4JVA A;  4OUS A;  1RVF 1;  4BJ0 A;  4XJZ A;  1UMZ A;  1HRI 1;  2WNV A;  3RZM A;  1LOB A;  1RVF 3;  4L97 A;  1MZ5 A;  1C1F A;  4QQL A;  5IW0 A;  4ZU7 A;  1O6U A;  1US3 A;  2XJQ A;  2GND A;  4QKF A;  4LJH A;  4JKK A;  2HJI A;  4WM8 B;  1VBA 2;  3B5L B;  1FT9 A;  3M7A A;  1SPP A;  4QQP A;  5A33 A;  2Q8E A;  5CFC A;  1FAT A;  2VZO A;  3MUZ 1;  3QH7 A;  4IEV A;  4DB5 A;  2A6Y A;  3CU7 A;  1GLH A;  3I3D A;  3AZX A;  4QGL A;  3OOX A;  1J83 A;  4NHK A;  2VQU A;  3JZV A;  4A6O A;  5LBF A;  2VNV A;  3C8X A;  1HX6 A;  2JG9 C;  4FXG B;  4AR2 A;  4TLG A;  1X8E A;  5KHK A;  2WT1 A;  3CZU A;  4XFC A;  1Z7S 2;  2VMF A;  2ZCW A;  3K46 A;  4XOG A;  4NIA A;  4CDX C;  3KV5 A;  4OFG A;  5J1X A;  3ZXK A;  4OQ9 A;  2JDU A;  4S2H A;  1REF A;  3VBR A;  5JXH A;  2FQP A;  4JDM A;  2WRA A;  2ZMN A;  4OHW A;  3CIH A;  1LEN A;  4P08 A;  3KT1 A;  1XPW A;  5I8S A;  3VL8 A;  3S0M A;  1FAY A;  1RJ8 A;  4WM7 A;  5D1I A;  3FLR A;  4IV3 C;  1PZ7 A;  1GQH A;  1YHF A;  2XKO A;  1HJG A;  3VHR A;  4Y22 B;  3VKF C;  2A73 B;  2ZOE B;  1RUC 2;  5DZE A;  4QPW A;  2VZR A;  2WII B;  1DQ0 A;  3I2O A;  5I0D A;  4RS5 B;  3S7E A;  4XFG A;  3DKW A;  4N43 C;  5A7W A;  1F5J A;  4AVS A;  4PIY A;  2VXR A;  4KU7 A;  3H8O A;  5T5J A;  1DHK B;  1UF2 C;  1W06 A;  3O14 A;  4F7Z A;  5K0U B;  2XG3 A;  4F3J A;  4AI1 A;  4UBG A;  2WAO A;  2DVF A;  3A0N A;  4PQQ A;  2D6K A;  4DMI A;  4E8D A;  4W6X A;  2QQU A;  3CMG A;  4KBZ A;  4NJ4 A;  1I6X A;  3E1F 1;  1K5M B;  2R32 A;  2VZ3 A;  3ZFE B;  4IET A;  1MZF A;  1VMH A;  2G1M A;  1DQ1 A;  5FY4 A;  1D7P M;  4UW5 A;  4ONU A;  4DXZ A;  3WUC A;  4P00 B;  3V0A A;  2WJS A;  4RQP A;  2BVV A;  2LRO A;  3OSD A;  4BPZ A;  1MQT B;  4E4D X;  1S0G A;  4BB3 A;  3ZXG A;  1BK0 A;  4W4Z A;  2GN3 A;  1HRV 2;  3NNG A;  4AL9 A;  3CQO A;  2ZTN A;  1W8H A;  1DZT A;  1XNK A;  1BMV 1;  3VZK A;  2XPJ A;  4MXV A;  5GLV A;  4UYB A;  1OA4 A;  5I0U A;  3B02 A;  5CKN A;  4OYU A;  3CZJ A;  3PIJ A;  2E63 A;  1QJE A;  3GBF A;  5GZG A;  2FDF A;  4I01 A;  1HB1 A;  1WD3 A;  4JZR A;  3RQ0 A;  4A41 A;  4FAH A;  3P3P A;  3AXD A;  5FLH A;  1WA4 A;  1R1A 2;  2NMO A;  3ZN6 B;  5ABJ C;  3MYX A;  1B35 A;  1QNY A;  4XUT A;  5FZH A;  2IC1 A;  4P9I A;  4ZHN A;  1LU1 A;  3IDE A;  2UY9 A;  2FDJ A;  2WNE A;  1C28 A;  4PI2 A;  3IM0 A;  2TBV A;  4AYU A;  3THC A;  2UWA A;  3D8C A;  5B2G B;  1W2A X;  4N90 A;  1OQE A;  4LNV A;  3PVN A;  1QJZ A;  1C5H A;  3ZVX A;  1ODN A;  3M3E A;  4H2A A;  3ZIW A;  1JS9 A;  1CON A;  1LES A;  3NL1 A;  3WDW A;  5EYY A;  3ES4 A;  4N7U A;  3RWK X;  4CU9 A;  3RI8 A;  1JOB A;  2RS5 1;  4R9B A;  5C9A C;  1F2N A;  1NYW A;  2RS5 3;  2WZR 2;  4YVS B;  1ZBA 2;  2CV6 A;  5D2A A;  4MV2 A;  1K42 A;  3E6C C;  5FZM A;  3SXW A;  1ZM1 A;  2YMZ A;  2UUR A;  4FXK B;  1RUF 3;  1VBA 1;  2RS1 1;  2RV9 A;  3AP7 A;  2HKX A;  4JGY A;  5CKQ A;  5A7S A;  2RS1 3;  2YDE A;  3O1U A;  3MLK A;  4XIO A;  3O1S A;  2AEZ A;  3R4S A;  5FMC A;  1VE0 A;  4LK6 A;  3SHR A;  4LO5 B;  3BOD A;  4Y26 A;  3D3A A;  4QQH A;  1UZZ A;  1Z7S 1;  1UXX X;  2B7Y A;  1DZQ A;  1BHG A;  1LR5 A;  1YRZ A;  2RG4 A;  1YQ5 A;  1Z7S 3;  2G9Z A;  3OYW B;  4OHY A;  1GBG A;  4CU7 A;  4PDW A;  2CDO A;  1ND2 B;  1PMJ X;  1CWP A;  2Y6L A;  1GOG A;  5FZG A;  2Q30 A;  3OF1 A;  2J7M A;  5IVC A;  1I9R A;  3AKR A;  1W6Q A;  4Q4V 3;  3IAQ A;  4L0P A;  3AMQ A;  5JIU A;  2BNO A;  4YZ5 A;  1UZ0 A;  1OD3 A;  2V09 A;  1ND3 A;  2WNU C;  1RUC 1;  2ZAH A;  4A2U A;  4DZG A;  2RS3 1;  3D4K A;  1RUC 3;  4CP9 A;  2DYC A;  2RS3 3;  4I02 A;  4ERO A;  4MVT A;  5DXD A;  3E6D A;  4I3G A;  3AVS A;  2IFR A;  2WA4 A;  1WA6 X;  1N3O A;  3U14 A;  3DYO A;  5JMC A;  2JG9 B;  1JZ2 A;  2Q8O A;  3I49 A;  4Q4W 2;  1VAV A;  4ZPI A;  3ACL A;  1POV 1;  3HQR A;  3NJY A;  4HKL A;  1CPM A;  1UQX A;  1POV 3;  4CDX B;  2W3J A;  2W92 A;  3AZY A;  4QPY A;  4E27 A;  4ATF A;  1WCD J;  4YVW C;  5DN2 A;  3V65 A;  2BRT A;  4ZZ5 A;  2VOT A;  4GKX A;  1UX7 A;  1I3H A;  2D98 A;  4P9Y A;  4EN6 B;  1JZ7 A;  4IV3 B;  5FY1 A;  1CAX A;  1HRV 1;  1W8Z A;  4IE5 A;  2ZS6 B;  4JC1 A;  1YEW A;  4CCC A;  2RVA A;  2XUE A;  3U75 A;  1DYP A;  2XQR A;  2IXH A;  5FUN A;  2YFZ A;  2BWA A;  1H8V A;  4KWL A;  4N43 B;  5A1L A;  5JUV A;  1NKG A;  2A3W A;  3KHB A;  1A34 A;  5FYB A;  3K2O A;  3KV4 A;  1D2S A;  1ASJ 1;  3Q8B A;  1R1A 1;  2OPW A;  1ASJ 3;  4HK9 A;  1MZ6 A;  3FWE A;  4XZU G;  5EWS A;  5DAW A;  4IGO A;  4D8M A;  1XND A;  1UD1 A;  1HN1 A;  2QZ3 A;  2Q1F A;  1S2E A;  2WS9 2;  3N9M A;  3OY8 B;  5CIR A;  2PHL A;  2VZ1 A;  3RZJ A;  1EV1 3;  1UNB A;  1TVG A;  3U4X A;  2Z5W A;  4I0W B;  1QXJ A;  1UN1 A;  3KD4 A;  4KU8 A;  4XDO A;  5EJ3 A;  2OYZ A;  3WX5 A;  3NV2 A;  3WNO A;  5AFB A;  3NV1 A;  4LUM A;  5M0T A;  1CIW A;  1POV 0;  1W8W A;  5F3E A;  2MEV 3;  2X5I C;  3VGI A;  2XON A;  1UOG A;  1DGW X;  2PLV 2;  2ZXQ A;  3IPV A;  2YB7 A;  3N9Q A;  4PLN A;  2A3X A;  1IG3 A;  4CPB D;  1ZBA 1;  2KA3 A;  1YJL A;  4M01 A;  2IXC A;  4G9S B;  1QU0 A;  3P1I A;  3RYK A;  1LKN A;  1ULD A;  3N7K A;  3VB9 A;  4OHX A;  1Q56 A;  2W52 A;  1APN A;  2WO2 A;  3MF9 A;  3ZR6 A;  5ABJ B;  2EVX A;  2FD8 A;  4GH4 C;  5F6L B;  1QF3 A;  1ZA4 A;  4D0Q A;  2JXA A;  1AR9 2;  1PX3 A;  1W2U A;  1AYM 2;  4CU8 A;  1IPS A;  3HBZ A;  1OLM E;  4A7Z A;  3BPZ A;  5FZF A;  4OUL A;  1LU2 A;  4XF3 A;  3VDB A;  3POY A;  4CDW A;  1MEC 2;  4TTG A;  4N7I A;  3O1R A;  3HD8 B;  5A6Q A;  4DUX A;  1TMF 2;  3T4V A;  3KGL A;  5FZ0 A;  3S7I A;  1LHO A;  2VMD A;  3VKM A;  3CJI A;  3QAC A;  2JIC A;  2OT7 A;  3H3U A;  3H1Y A;  1A78 A;  2NYY A;  4YZ1 A;  2FDK A;  1BQP A;  1HB3 A;  4Z07 A;  3WF2 A;  2FMD A;  5L9R A;  4H55 A;  5C9A B;  4MXW B;  4CPB A;  1DCS A;  3RZG A;  3DEM A;  2Y0I A;  5FXV A;  4J6G A;  5D21 A;  4AF9 A;  1JBC A;  3M4F A;  1NCR A;  4CSW A;  4K1Y A;  5J36 A;  3PUR A;  3WQ7 A;  2VZS A;  4RHV 2;  5DMY A;  4ZY9 A;  1W6P B;  2A75 A;  1W90 A;  3V56 A;  3LA3 A;  2JDM A;  4AFC A;  1YC6 1;  4P5H A;  2JKX A;  4CEW B;  2WBK A;  4DXR A;  4LLF A;  4I2O A;  2YXS A;  1PNG A;  3MID A;  3VBH A;  3EYP A;  3WG4 A;  3OBR A;  3I2K A;  1BBT 3;  3UK9 A;  2Z69 A;  4IES A;  1HLC A;  4QX1 A;  5IT6 A;  5K8S A;  1LHW A;  2ARB A;  2Y8K A;  2UYA A;  4Q4W 1;  4U2A A;  3WQ1 A;  4Q4W 3;  3A21 A;  2KD7 A;  2VZP A;  4WVW A;  1NY7 2;  4K8R B;  1NA1 A;  5F5C A;  5FZ7 A;  2JJ6 A;  1UIJ A;  3NW4 A;  1S0B A;  2VEC A;  2XL7 A;  2XML A;  4OI1 A;  3SIT A;  4AW7 A;  4BZ4 A;  2HWB 2;  3BGA A;  4OI0 A;  1GQP A;  4XCA A;  3LOB A;  5DAX A;  4K20 A;  3CJI C;  4DY3 A;  5FR3 A;  2C5D A;  3AFG A;  2ET7 A;  3H8X A;  2HYX A;  4AED B;  3IZO A;  1F35 A;  2UY8 A;  3VBF A;  3VD3 A;  1GOH A;  2ES3 A;  4UWD A;  4IEP A;  5L7O C;  2WWU A;  4LBN A;  4BQ5 A;  4OZO A;  3MLJ A;  4QPG C;  4BU2 A;  1AXK A;  3HEI A;  2WNU B;  2ZGO A;  5JDB A;  4AE2 A;  2QZ2 A;  2RM2 1;  3NAP A;  3POG A;  5A3P A;  5CAZ A;  2RM2 3;  4BYY A;  5E1R A;  1LGC A;  4MGK E;  2R7E B;  2RMU 2;  4GAL A;  1LHN A;  2Q0A A;  3OBT A;  5IK5 A;  2WZP P;  1PGL 2;  3GYD A;  4ASK A;  2RR1 1;  3MDP A;  2D44 A;  4MGI E;  3WNM A;  1AL2 2;  1O8P A;  2RR1 3;  3HR9 A;  4QHZ A;  4YM2 A;  3TYJ A;  3UGF A;  1QOT A;  1Y9Q A;  4S2F A;  3WR0 A;  4YVW B;  2WS9 1;  4NHY A;  3ATG A;  4PT6 A;  4UOJ A;  1LHV A;  2WYF A;  3J8F 1;  5KC5 A;  2XVL A;  1AHS A;  1JMU B;  3J8F 3;  4FO9 A;  1OOP A;  1ZVF A;  3WW3 A;  1L7R A;  4UF0 B;  1OT5 A;  2L9L A;  1JUH A;  4QHB A;  4A7K A;  4NPL A;  3VBO C;  3I2I A;  3MW3 A;  4AI8 A;  4BQY A;  3AZW A;  5CEH A;  3TNP B;  1XSR A;  3VBF C;  3MIH A;  3ORJ A;  1LEC A;  2PLV 1;  2K0G A;  2PHW A;  4HAN A;  2PLV 3;  4OI2 A;  1PMH X;  2ZZQ A;  4O7X A;  4YPJ A;  1MS3 A;  2NLR A;  1CAV A;  3I3E A;  5A3W A;  4KI5 M;  3GJA A;  4NHM A;  4D6R A;  2YHJ A;  2QQI A;  1WGP A;  5FO7 B;  5BPX A;  1UKG A;  3NNM A;  3ACI A;  5HBA A;  5C3S A;  2W68 A;  2BVB A;  1IQA A;  1AYM 1;  2VCM A;  3ECQ A;  1NZC A;  5EQU A;  1OC1 A;  2AH2 A;  4XAE A;  1AYM 3;  1IG0 A;  2BTV C;  4UFM A;  4RFR B;  2YGL A;  1ZRE A;  2IWG B;  3LPF A;  4NHX A;  1MEC 1;  5JOZ A;  2ZGK A;  1MEC 3;  2VD7 A;  3WXP A;  1TMF 1;  4QT6 A;  4C1X A;  2O8O A;  3C7F A;  5KWR A;  3RZL A;  5FYS A;  4RN5 A;  2C4X A;  1NT0 A;  4J1X A;  2X09 A;  1JHJ A;  4XTP A;  2X5I B;  4LBM A;  2BGC A;  3E5U A;  3IWZ A;  4KWU A;  4UW4 A;  5DAB A;  5H9Q A;  3E5X A;  4Y20 B;  1SBD A;  4S2G A;  1OKQ A;  2ZGQ A;  1AJK A;  4QB1 A;  3ZXD A;  1ACC A;  2A6W A;  1U12 A;  4AGG A;  4GH4 B;  3N35 A;  4CCL A;  2YU1 A;  1ZZ7 A;  3KLS A;  1GZW A;  2H0V A;  5DQ0 A;  3LEI A;  2FDI A;  2O1Q A;  1J3Q A;  3OBA A;  5CA6 A;  3CBN A;  1G7Y A;  3WVJ A;  4M4R A;  4IE4 A;  4Y33 A;  1ZRI A;  1AR6 2;  3ABZ A;  3ZN4 A;  3NO8 A;  2GC0 A;  4IV1 C;  2Z2S B;  2R1D A;  3IN9 A;  5FP4 A;  1W39 A;  1BEV 3;  2NPI A;  2VE1 A;  4QU2 A;  5GZC A;  1NZI A;  4CXW A;  4MSV A;  1NY7 1;  3LPG A;  4L92 A;  2FCU A;  3UKV A;  1YO8 A;  1EUU A;  2P3J A;  3SEP A;  3ACF A;  2HWB 1;  3AJY A;  2LS6 A;  4NIH A;  2YC4 A;  1CAU B;  1X8M A;  2HWB 3;  4YW2 A;  2V5D A;  5IAT A;  4WVM A;  3C7G A;  4JDN A;  3WF3 A;  4I09 A;  4AAP A;  3GHN A;  4BDV B;  1H6Y A;  4NAO A;  4XJW A;  3BTZ A;  5KXC A;  1HB2 A;  3H0O A;  5FIX A;  1CD3 G;  5DUV A;  4R52 A;  3NQH A;  5CU1 A;  4YZ3 A;  4A7Y A;  1UY3 A;  4RD7 A;  2W39 A;  1GWM A;  3JXS A;  2VNR A;  1H2M A;  5C6C A;  2F17 A;  1Y9G A;  2RMU 1;  1J3R A;  2RMU 3;  3OGS A;  2MHF A;  3N7J A;  2HWC 1;  4URT A;  5GZE A;  2ARX A;  1JYW A;  2DDU A;  2HWC 3;  3N7L A;  3IMM A;  4IEQ A;  3I3M A;  1LGN A;  4XCB A; 
#chains in the Genus database with same CATH homology
 5FZH A;  4IGO A;  4QXC A;  4QX8 A;  5ISL A;  3N9M A;  3N9N A;  5IVJ A;  2W2I A;  3K3O A;  5FYV A;  3AL5 A;  3PU8 A;  5FJH A;  4UF0 B;  4XDO A;  2WWJ A;  3AL6 A;  5F2W A;  4EYU A;  3UYJ A;  4CCJ A;  5FXX A;  5FXW A;  5CEH A;  2OQ7 A;  5F3E A;  4LIU A;  3LDB A;  2YPD A;  5A3T A;  5FJK A;  4UF0 A;  3PUA A;  3N9Q A;  5FPB A;  5FZA A;  5IW0 A;  5F2S A;  2Q8C A;  4EZH A;  5FZ8 A;  4V2V A;  5FZM A;  2XDV A;  2YBP A;  3DXT A;  3KVA A;  3PUQ A;  5FP3 A;  5A3W A;  5FYZ A;  4D6R A;  5F3G A;  5FWE A;  5FBJ A;  2OS2 A;  2Q8E A;  5FZL A;  5A7S A;  4LXL A;  5FV3 A;  4GJY A;  4E4H A;  4D6S A;  4GAZ A;  5FZF A;  3AVR A;  4HON A;  4IGQ A;  5A7Q A;  5IWF A;  5A7O A;  5FZI A;  5F5I A;  4ASK A;  3KV6 A;  2VD7 A;  3PUS A;  4V2W A;  5FZ0 A;  4LIV A;  5FZ6 A;  2GP3 A;  5FYS A;  5F39 A;  5F3C A;  2OT7 A;  4HOO A;  5FYY A;  5IVE A;  4CUG A;  3KV5 A;  4C8D A;  5FP9 A;  2YBK A;  5FYH A;  2Q8D A;  5F32 A;  5A7N A;  5LY2 A;  5FXV A;  4CCM A;  5A1F A;  5FWJ A;  4CSW A;  3KVB A;  3PUR A;  5FZD A;  5FZG A;  4DO0 A;  5FXZ A;  5A7W B;  4QXH A;  5IVC A;  3PDQ A;  5IVV A;  5FYM A;  4GD4 A;  4LIT A;  3N9L A;  4CCL A;  5FPV A;  2YU1 A;  5FY0 A;  3OPT A;  2GP5 A;  4QWN A;  5FUP A;  5FPL A;  2OX0 A;  5FZ4 A;  2OQ6 A;  4QU1 A;  5FY9 A;  5FZB A;  4NUB A;  4Y33 A;  5A7W A;  4URA A;  5FP7 A;  3AVS A;  3KV9 A;  4TN7 A;  2PXJ A;  4Y4R A;  5LY1 A;  3N9O A;  3DXU A;  3OPW A;  5FZE A;  4D6Q A;  5IVF A;  5FP4 A;  5FZ3 A;  3NJY A;  5LW9 A;  5F5C A;  3ZPO A;  4CCO A;  3N9P A;  5FZ7 A;  4CCK A;  5ANQ A;  2XML A;  5FYC A;  5FY4 A;  4QXB A;  5FZO B;  5FY7 A;  2YU2 A;  4QX7 A;  5KR7 A;  5FY5 A;  3U4S A;  5A7P A;  5FYT A;  3U78 A;  4BIS A;  4BXF A;  5FZ1 A;  4AAP A;  5FZC A;  2YBS A;  5F3I A;  5FPA A;  5LWB A;  2WWU A;  5FY1 A;  5FZO A;  4CCN A;  4XDP A;  4BU2 A;  1VRB A;  3PTR B;  5FYI A;  2XUE A;  5FYU A;  5A3P A;  2P5B A;  4IGP A;  5FUN A;  4AI9 A;  5F37 A;  5FPU A;  4DIQ A;  5A1L A;  3LD8 A;  3PU3 A;  5FZ9 A;  5E6H A;  5IVB A;  4EZ4 A;  3RVH A;  5A3N A;  5K4L A;  2XXZ A;  3K3N A;  4GJZ A;  5A80 A;  5FYB A;  5FY8 A;  3ZLI A;  3K2O A;  3KV4 A;  4Y3O A;  5FP8 A;  5IVY A;  5FZK A;  5F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...