5A7OA

Crystal structure of human jmjd2a in complex with compound 42
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 112
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7oA01
3KV6A 5A7SA 4ASKA 4Y33A 5IVFA 3PUSA 4CCKA 3RVHA 4CCLA 5LWBA 4CCMA 5FXXA 3NJYA 2YBPA 4QWNA 3PUAA 3N9PA 5FYBA 5FZAA 4AI9A 5A7QA 4D6QA 5FZ1A 5FZOA 3AL5A 4EZ4A 5IVCA 5F5IA 5FZFA 5FZ6A 2XUEA 5FZ4A 2OQ7A 3PU8A 5FJHA 2W2IA 5FY1A 3AVSA 5F5CA 5FZ8A 5FY5A 5FY8A 2YBSA 4URAA 4GAZA 5FY7A 4HONA 5A1LA 5IW0A 4CCJA 5FPUA 5FYYA 5A7WA 5A7WB 5FXZA 2Q8DA 2XXZA 2XDVA 2YU2A 3ZLIA 2GP5A 5FZEA 4CUGA 5FZKA 2XMLA 3PUQA 5FYSA 5F3GA 3PDQA 3PURA 4QXBA 4QXCA 3K3OA 5IWFA 4C8DA 5FYZA 4V2VA 4CCOA 1VRBA 3N9QA 3N9NA 5F3EA 4E4HA 3DXTA 3K3NA 5FZBA 5LW9A 5ANQA 2YPDA 5A3WA 5A7OA 3K2OA 3AL6A 3PU3A 5FYIA 5A7PA 2YU1A 5FWJA 5FZ9A 3OPWA 3DXUA 4Y3OA 4QU1A 4TN7A 5IVEA 5FY4A 4NUBA 3LDBA 4BISA 5KR7A 3KVBA 5FZ0A 5ISLA 3KV4A 3N9MA 5IVVA 4IGQA 5F2SA 4LIVA 5FPLA 4LITA 5F2WA 5FYTA 2OT7A 5FZCA 4EYUA 5FZ3A 4LIUA 5F3CA 5FPAA 4LXLA 5FYUA 2VD7A 2YBKA 3N9LA 4UF0B 5FZLA 5FYMA 3KV5A 5FP8A 5LY2A 4GD4A 2P5BA 4XDPA 5FYCA 5FXVA 5A3TA 5FXWA 3LD8A 5F39A 5FYVA 4CSWA 3U4SA 5A3PA 5F3IA 3UYJA 4CCNA 5FZGA 5FY0A 5F5AA 5FPBA 5FY9A 4GJYA 4BXFA 5FWEA 5FYHA 4QX7A 5A1FA 5IVJA 5FZOB 4EZHA 3AVRA 4Y4RA 5FV3A 5A80A 3ZPOA 2PXJA 4DIQA 3PTRB 5FP9A 4DO0A 3KVAA 5FUNA 5A7NA 5A3NA 5F37A 4UF0A 5FP4A 2Q8CA 2OQ6A 4XDOA 5FJKA 5FPVA 2GP3A 5FBJA 4D6RA 4IGPA 5FZ7A 2WWUA 4GJZA 5E6HA 5LY1A 5FZDA 5K4LA 4HOOA 4QXHA 5FP3A 4BU2A 5CEHA 4V2WA 3N9OA 5F32A 5FZMA 4IGOA 5IVBA 5FZIA 2OS2A 5FZHA 5FP7A 4AAPA 2Q8EA 3U78A 3KV9A 5FUPA 3OPTA 4D6SA 4QX8A 2WWJA 5IVYA 2OX0A
chains in the Genus database with same CATH superfamily
1UMIA 3KV6A 1HXS3 2JG9C 3SCGA 5A7SA 4HKLA 5HPOA 4R9AA 3E5QA 1UZZA 2AREA 3CNAA 3SEEA 5IT6A 2P3YA 3LE0A 2YBPA 3VBSA 1HQLA 1R093 3PUAA 1ND3A 4CXXA 4LBKA 3ZXFA 4AHZA 4JGZB 3MW3A 3O14A 5IJRA 2J1RA 4YFZA 4JGYC 3AYEA 1POV3 3N7JA 3PU8A 3PUHA 5GZCA 1YLLA 2VOWA 4KNCA 3O12A 4N7UA 2RM21 2BEOA 3I4IA 1JZ5A 3KZ4C 5FY7A 2QDNA 5LBFA 3MICA 2XQXA 5DMYA 1R081 5FPUA 4OZXA 2DCKA 1IQAA 4IEXA 4JRLA 5IAVA 5FPZA 4YW3A 4BPZA 2WO3A 4PLOA 2C0ZA 2ZTNA 3MPPG 3FWEA 4MGKE 3V0AB 3MZHA 4H3WA 4INDA 2R0FA 2RE9A 1DZQA 4GKXA 2RMU2 1UXZA 5BY5A 1Z7S2 2D97A 2DVDA 3JZVA 5D2AA 1XNCA 1U0AA 1JZ4A 2VCMA 1QJX1 2VQUA 3DN7A 1UL9A 4URTA 1EYBA 5EJ1B 1GNHA 3C2UA 2DVGA 2QQMA 4IUGA 1NA1A 3OSDA 2YU1A 4TXWA 4YGDA 3QACA 1ZZ8A 2HWD1 4GALA 1C3HA 4Z1VA 5GM0A 2Z4FA 3M3EA 3PIJA 5K9YA 1AX0A 1DZRA 5T52A 3ZYJB 4ZS2A 3C7OA 4XQDA 4QHBA 2R072 4B3NA 5C5UA 2PYTA 3VBRB 1LNSA 5HCFA 1MZEA 4UW6A 1GZWB 4NHMA 4XFGA 4FVVA 2DURA 3EMRA 4FAGA 5IVFA 1AR63 4XIKA 1UY4A 3BGAA 4U36A 1HRI2 1YRZA 3FC0A 4IEPA 4JGYA 5D8AC 4MHUA 4E2GA 3KV5A 3VZNA 1ZZBA 3AP7A 4Q4V2 3ST7A 1XYOA 1M06G 2ZMLA 4MGIE 2EXKA 5FXWA 2QBXA 5FYVA 1SLTA 4P02B 1JOBA 3VBSC 2ZHMA 3LSDA 4XHXA 1PZ8A 2PAKA 5CG9A 2WNEA 3MDPA 5F5AA 4W65A 2YY1A 2JG9A 4XMAA 1DYKA 4S2FA 2RR13 2YZ4A 2VZSA 3GJAA 5FZOB 5LK5A 1I5ZA 4C1WA 4EZHA 2HWE3 1OA4A 2VUAA 3ACGA 3ALQA 4NRQA 4XXPA 1CD3G 4HSLA 1RUF2 2IXKA 1OBNA 3SHRA 2YDEA 4IV1B 5E1RA 2CGNA 1K12A 3CIHA 1UW8A 1MS9A 1NCQC 2O14A 4K9SA 4R8HA 5AVPA 3OYWA 1IPKA 4YGCA 5JDBA 3M3IA 4LBQB 3RDIA 1VR3A 3OBZA 2C26A 2HEYF 2X53S 4LBNA 5AFBA 1W6OB 1WZXA 3HT2A 4IGOA 5CB7A 5CFCA 5IVBA 2WFF3 1D7PM 3A0NA 5I0SA 1DP0A 2KA3A 3HN3A 2CDPA 4D69A 3UV9A 4Z2AA 1PO23 2J1EA 1KEXA 3DECA 4PIXA 2QQLA 2P3KA 2ZGNA 5IVYA 3SEPA 3AP5A 3V56A 3AYDA 4EN9B 1UY1A 2VUDA 3H3UA 1JOPA 1Q8QA 3HAGA 1CJPA 2H6BA 3ILNA 4M0NA 4Y33A 5EP9A 2Y0OA 1C4RA 2B4KA 3OGSA 1I3HA 1VBD3 1WMXA 5FMDA 4RGKA 4EN8B 4ES9A 2W47A 2BJSA 3LF7A 2PLV2 2ZX2A 5FZ1A 3M3CA 3LPGA 1MEC2 4E9KA 3V0BB 3SLIA 2R49A 3NRUA 3B93A 3CKHA 3L2YA 5FZFA 4PF1A 4DUXA 5FZ4A 1MQTC 5KBFA 2R061 2W2IA 3J26N 3WDTA 4HANA 3LFIA 3TWIA 3NNFA 1O4TA 5A6YA 4AFAA 1O4ZA 4RHV1 1QJFA 3VLBB 2VULA 1HLCA 4XUNA 1PO12 4D94A 5FZKA 3UNPA 4O7XA 1YQ5A 1GKBA 4GULA 4Q2FA 3GZUC 1NAEA 2DBIA 1D0GA 2BTVC 1WLWA 2CGPA 1W3XA 2QKDA 3OD4A 2CWSA 4CU6A 2W46A 5F8PA 4AFMA 1C5HA 2GN7A 2LTNA 1DCSA 2QE3A 2RS31 4LNVA 2UWAA 3UGGA 1WKYA 3HQUA 5FFOC 2A6WA 4QT6A 1OA3A 1X8EA 3K48A 4AVSA 3C7HA 4XJWA 2FD8A 2XHNA 3R0RA 3BU0A 4BOWA 5EYXA 2D43A 4XTMA 1V6LA 2QZ3A 1AR91 5I0RA 2BRTA 2VCBA 2DUOA 2ZGMA 4WM8B 1GFF2 1S4CA 2YC2A 4HVOA 5C3SA 2PHXA 3ZO0B 4F8AA 1W8FA 2BGCA 4XFHA 2RS51 4GH4B 4YG3A 3WF3A 2WT0A 4IV3C 4XUTA 5C8WA 1YXWA 1UZYA 2CWMA 2VD7A 2C1FA 2PHFA 2XHKA 5FYUA 5FZLA 2ZBJA 3PNAA 4PHZA 2WL1A 2WAAA 3Q8BA 3WP6A 2GZWA 1GWLA 1NQJA 1STMA 1RUD2 1WLDA 5FK7A 5FYCA 4YYOA 4UFIA 2R0HA 3KSCA 1RMU2 1SLIA 2ZGSA 4JQRA 1UX7A 1XNTA 2XOMA 3LKJA 4FI9A 4RS5B 4CEWA 2BGOA 3AKPA 1K42A 4QPWA 2MEV1 3BB6A 2F4PA 4U2AA 4ARYA 4SLIA 2VCAA 1H6YA 2BUKA 2OPWA 4CCCA 4RQPA 4YZ4A 4NRMA 1C28A 1SPPA 1UU6A 5DPNA 4BXSV 1AYM1 1JYXA 4DO0A 3WNOA 4A7KA 1YUDA 2Q8CA 2XJVA 1PX3A 5BNOA 4YZ2A 4S2GA 3V0BA 2WO2A 3KT7A 1FYUA 1AYN1 4IGPA 4ZPIA 1OVSA 4DOUA 4BWOA 3VBRC 2FQPA 4XCBA 3HT1A 4QGNA 1RUD1 3WW3A 5CFDB 1GBGA 2Y33A 4HLTA 3NNLA 3KCCA 2EICA 4XJAA 2W68A 2X10A 4K40A 3ZN5A 1BHGA 1N47A 2D3PA 5L9VA 3ZPYA 2V5YA 4PI0A 3WLUA 1Z7S1 4HG6B 5EZWA 3LIHA 3WDUA 3TN92 4RA0A 2WO7A 4CDWC 4GQ7A 1OHFA 2R1BA 1CQ9A 2VZQA 2VJXA 3KMHA 4ZZ5A 2D7FA 2ORXA 2QQJA 1EP0A 2BWCA 2MEV3 4Q1PA 1W3VA 4AEKA 1MS4A 3GF6A 3JB4C 3LEMA 2OQ7A 3HR9A 4N8MA 4Y5SA 4CDQB 4COWA 2A1XA 3VL9A 1LOFC 2J1SA 4IV1C 4QPGA 1V9U1 5A1LA 2ZZJA 3GZEA 1SHWB 3G7DA 2CGOA 4LLFA 4G9SB 2PN5A 3WP5A 3W5MA 5BNNC 4PIYA 1UYZA 3TAYA 3WCSA 2WKKA 3O1PA 3GZAA 4WV8A 1S0FA 3Q8FA 3ZDVA 1YNAA 2BDRA 1EUTA 2IXJA 4YW5A 1COV1 4Q0PA 2W1WA 3E6CC 1WGPA 3AYAA 1ZA7A 5FYZA 3WV6A 1D4M3 1VRBA 1XSRA 3N9QA 4BQWA 2BBAA 2QUOA 3Q8AA 3J8F1 4MGYE 4HK9A 1PX4A 2GNDA 2ZHLA 3RQ0A 2VBBA 3MPBA 2YG0A 1ENRA 5FWJA 3PLQA 5ACA2 4AE2A 1YQ6A 1Z7S3 2XVKA 2WUHA 5T5LA 1S0BA 1G9DA 4XFBA 1IS3A 4QKNA 3VBRA 4QD2A 4LOTA 1RVF2 5JMOA 3C7EA 4Y22B 4ZKTB 5FOJB 1PNGA 1K5JA 1QU0A 1RMU3 4MYEA 1JUHA 3GHMA 3H3LA 4LT5A 4LIUA 1AR93 2CHHA 4HKWA 3W9AA 3M7AA 3WDXA 4NHKA 4E4SA 3WF4A 4CEYB 4CP1A 4CDWA 3MW2A 1CPMA 4ZU4A 5LY2A 3V64A 4N90A 2QQIA 1BVVA 2KR2A 1AL23 4PT6A 1UY0A 2UWCA 4KBZA 1J59A 4NN0A 2FDKA 1VBA2 1W0PA 1GQPA 3RS6A 4W6WA 1OPMA 2YB7A 4LJHA 2VZ3A 2IXCA 2QQOA 2Y6JA 2A6VA 3V0AA 1BMV2 1C1FA 2R1DA 1VALA 2CU5A 2WZEA 3IMMA 1LENA 1D4VB 2E7TA 4YVSB 4XFFA 4QQ2A 1RTVA 5L73A 3USUA 4AFBA 5FUIA 2SLIA 1H9PA 3WY6A 3PTRB 1GQHA 4MUVA 4OYUA 1PM4A 3H50A 4JKLA 4LA2A 3KF5A 4CEYC 5JOYA 2NP0A 1JN2P 2Y60A 2HWC1 4J1XA 4LKFA 3K4AA 4KL1A 1NLQA 1XU1A 1VMHA 3TRSB 2ZEZA 3O1VA 4CPBA 2WFF1 1JZ6A 1CAWA 2HWE2 2I2SA 1ND3B 2ADEA 4JTNA 4FQZA 1NLRA 5F32A 2RM23 3ZYFA 3ZR5A 5A3MA 3T0AA 1FV2A 4HK8A 1KDKA 4BA6A 1FNYA 1RMU1 4DINB 3U78A 2WN3A 5CIRA 4NIIA 2HWB1 4JAAA 2WC2A 3MEPA 4NIAA 1NXMA 5IK5A 2EF6A 3VHRA 1SLBA 4P9WA 3RNSA 3B01A 1NUKA 2XWBB 2D6MA 3D8CA 4IEUA 4YVWA 2XJRA 1HB1A 3DV8A 1T2XA 2P6HA 4AL9A 2HWF1 4FOVA 1DYPA 1WUVA 3VHOA 4AW7A 1Q56A 4X8NA 2NQYA 1Y4WA 2P2KA 2VXRA 4ASLA 2N7GA 5HBAA 3ORJA 2ARXA 4Q0UA 3LEGA 1HRV3 3WT3A 3RZHA 1RUF3 5A6QA 2QQKA 2WFF2 2EAKA 2J42A 4PF5A 2Q1MA 1OLMA 2KM2A 2W87A 4EWEA 3I59B 4HONA 2GSYA 4DUVA 1DQ0A 2JDAA 1HJFA 2A6XA 1APNA 1DIWA 1QOOA 3I2HA 1OOPB 1ZRDA 2WA4A 2VOXA 2ZA9A 1XNAA 4JZRA 4YM1A 1AR61 5JXIA 3LSEA 1ND2B 1OQEA 4LBLA 3H7JA 1POV0 1O3QA 4GH4A 4DZGA 3KM5A 1YIFA 4RGAA 3CU7A 1QDCA 1G6NA 2ZHKA 5DUUA 3W59A 5KXEA 3KT1A 3VD9A 2RJKA 3PIGA 3K2OA 3SCFA 4FPFA 4CU8A 2YPJA 3OTFA 1MQTB 1UYPA 2DCZA 4Q4W3 5BNNA 4NOTA 3VGIA 2D93A 1HB4A 3WHTA 4Z82A 4Y24A 3KD4A 2DFBA 1G7YA 3E6BA 1LHUA 3AKSA 2Y34A 4QGLA 4YGBA 3N9MA 4CP2A 3RZGA 3IDEA 5I0UA 1RUE1 4YZ5A 1NY72 2VE1A 2JX9A 5KXCA 3H3ZA 3IAQA 2E53A 4YRDA 1WA4A 1COV2 2Y6FA 3N9LA 2NLRA 3VZJA 1YO8A 2Z5WA 5LZ6A 1ZBE3 5CFDC 1RUE2 1TMF2 4HXCA 1J83A 3OOXA 1R083 1H2MA 1PIV3 1PK6B 1MS0A 5KXBA 4Z2WA 1L7QA 1YHFA 3Q9OA 4NVPA 2WNUA 4X6QB 4YFWA 5A1AA 1RUJ2 5FDBA 2W5FA 3VBFB 1TE1B 2ET1A 5J98B 1FNZA 4IQPA 5A80A 3TN91 3ZPOA 4XIOA 4WVVA 5D8AA 2W91A 5FMCA 4CDWB 3FBYA 3VUOA 5JXGA 4OCTA 2JKBA 5ABJB 4A6SA 5JPMB 1RUJ1 1OPOA 4LUKA 1OLME 4DXSA 1W2OA 3RMXA 5FJKA 4O61A 2JDMA 3P6BA 5AVAA 3AKQA 5HV4A 4N53B 2FMDA 1A34A 2PAEA 2XG3A 3ZFFA 3Q8CA 2IFRA 3PMEA 4Q0SA 3PVOA 4COYA 2ZEXA 4R4XA 4E8CA 5FZHA 4AEJA 5C8CA 1G86A 3KV9A 3WDVA 2BGPA 1NA1C 1CAXA 4COUA 2W94A 4FOWA 3VZLA 3B5LB 4XETA 4LBQA 1TMF3 4K1YA 3ZYIB 4CDXC 2BNNA 1SLLA 1GSLA 2VOVA 3KQRA 4JRAA 3WF1A 4L92A 1IZ3A 1ULOA 2WSVA 3PHMA 4KQ7A 4Q4Y3 2VOTA 3I2KA 4A42A 4QB2A 4MGQA 1DQ5A 2TEPA 5A7QA 3C8XA 5FZOA 2HWC2 2DBNA 1UY2A 2HWF3 5A6ZA 1US3A 5I8TA 1MACA 1BEV3 3N7LA 1E5RA 3N3HA 4P9GA 5DAPA 4A3ZA 3FZ3A 3I3EA 1YEWA 3OGRA 3LDKA 3POGA 2DU1A 1QHDA 2JDNA 4NWWA 5HCBA 2JDPA 3WNLA 1S55A 1RVF1 2ZXQA 4AYUA 5BNPA 4FO9A 1OQ1A 4GIQA 2E63A 3NNMA 3NNGA 5FYYA 4WBBA 1VBB1 3FHAA 5DAWA 2ZMNA 2E31A 2GP5A 1AJKA 1RUG3 4FTSA 1I6XA 1UMHA 1ND3C 5TSWA 3T09A 1XE7A 1F2NA 4AHWA 3PURA 3GCXA 3LA3A 4QXCA 1WCQA 2IXIA 1PGW2 2OVUA 2Y6LA 3O1OA 5T55A 4RS5C 5ANQA 1NT0A 1QJU1 5C7GA 3T2PA 4I09A 1ULDA 2JWPA 2PHDA 2XL9A 2W1QA 4RSUA 2JENA 5E8AA 1IPSA 3JD73 1IQDC 1BBT3 3RGBA 4P08A 2ZOEB 1ST8A 2ZGRA 5H9QA 1O6UA 3B02A 2WQ8A 3ZSKA 2EIEA 1A78A 2E51A 1N1SA 1FPN1 1BEV2 2AACA 5FCCA 5FYTA 2WFPA 3J4UH 4HN0A 2VBPA 4Y1ZA 3ZKUA 3AFKA 3CJIA 1W6QB 4L0PA 5DDJ1 1CAXB 3MHZA 2QJVA 2G9GA 1N3QA 4A45A 4D7YA 5GALA 3J7HA 4V1PA 2LS6A 1CZVA 3MIEA 5CKQA 1FMD3 1HB2A 2VNGA 4XDPA 5LA9A 3RWNA 4OZOA 1VB2A 2NM1A 3P1IA 5BPXA 1ZYBA 2WDBA 3LEKA 3U4SA 3PTYA 1ND2C 3T30A 2D44A 1QNWA 4BDVB 2P3JA 5FZGA 5JUVA 5LBCA 1TNRA 2XKPA 4BK5A 1OURA 1UYYA 4ISQA 3ZFEA 5CFCC 4MVTA 1DQ6A 3CJIC 5C70A 4UAPA 1TZOA 4ITCA 4ATEA 4CDXB 5LEKA 4BE3A 2RDSA 1PIV1 4DIQA 3DPRC 4XFIA 1D0HA 1FOD1 4IETA 1W8ZA 2FDFA 2JICA 3OJBA 1REEA 4JQTA 1H2LA 4UF0A 2IFWA 1OLQA 3H9AA 3WQ7A 1Y9MA 3HN1A 2HYXA 1ZRRA 1TQ5A 2ZHNA 3GDBA 3MYXA 4NR1A 5FREA 4AVCA 4I01A 4WM8A 2A73B 3ETPA 2BBVA 5LBEA 1W9TA 3A4UA 5HI0A 1U5YA 5CEHA 4AG4A 2ERFA 3FFZA 3THCA 5A70A 2NN8A 5DQ0A 4YG0A 1VMJA 1TEIA 4E8DA 2B45X 3ZSLA 4IW3A 4GKYA 2HEWF 3ZFGA 1V6MA 2HWE1 4QKDA 1LJ7A 4N7IA 1HB3A 3AB0A 4AR2A 2QCSB 1HQWA 1LTEA 3NQHA 2Y6KA 4AAXA 4XYXA 1PK6C 5FK8A 2BQPA 4AI8A 4L99A 1MZ6A 3NO8A 1OH3A 4CXWA 5LBBA 2GALA 1MZFA 2J22A 4AEDA 2WYFA 4L8QA 4AVBA 1FI2A 3AL5A 1OI6A 1RXFA 3PJQA 2GNBA 2VAUA 3VDDB 1XSQA 4XF9A 3PVBB 4H14A 4AGVA 1AL21 5FY1A 2VC9A 2D98A 5FY8A 4C91A 4O9EA 5BNOB 1DYOA 3WX5A 5JLVA 5A3OA 1PO22 2B8MA 2Z79A 2WQ4A 3AC0A 4GWNA 3ACIA 3NMBA 5JMCA 4XVHA 1OOPA 3JBG2 1Q8VA 4YW2A 3FFQA 1DG6A 5F6KA 1KQRA 1TG7A 1K45A 4RD7A 2B7YA 3ZN6B 5C8CC 1AYN3 4CU7A 3OGVA 1NYWA 4DNYA 2XVGA 1YWKA 1DF0A 2VUJA 2P37A 2EIGA 2RR12 2DTYA 2ZPXA 4GB32 3AL6A 4JV4A 4E2SA 2RMU1 4EJRA 3VD5A 3T3YA 3SITA 4FSJA 4QDQA 2OKXA 4JTOA 1UKGA 2R042 3VBFC 4JGZC 5FY4A 4NUBA 1FXZA 3LDBA 5JPNB 2ZZQA 5T3NA 1W2NA 3QH6A 5KR7A 1NKGA 4UFHA 4NRPA 1B35C 1ZX5A 2XLGA 2WNVC 3QH7A 1BLZA 2V72A 4LITA 3H0OA 4EYUA 4WVZA 4LBQD 1QJY3 3WEZA 1O59A 3URFA 3ETQA 2QTWB 1GV9A 2DVAA 2V4AA 4IDZA 1X33A 2YBKA 3WF2A 1FX5A 1HV1A 1UOJA 1GICA 2BW8A 1BJQA 5LRRA 3DL3A 4RL7A 4QM8A 3ZVXA 3U4XA 1SBFA 2FDJA 3OCPA 1QJU2 3ZYBA 2DCJA 1NY71 1ZM1A 1PZ9A 4LR4A 4YNIA 1R091 2K2SA 4HKOA 1NCRC 5F3IA 4IEVA 2VMHA 4LMFA 1HRV1 4CUBA 4XW3A 3I2GA 1JMUB 4LBOA 1J1TA 1PMIA 3IDCB 5FY0A 4D0QA 3ZIWA 4Q0QA 1NZIA 2RG4A 3RZLA 4K8FA 1W2UA 4CU9A 5KXDA 5CYYA 2HYKA 1JYWA 1Y9QA 5LASA 2EVXA 2EXIA 3FJSA 5DZGA 2CV6A 1SCSA 1H4GA 2RMU3 3CLPA 1LOGA 4MGTA 3MLJA 2OQ6A 4WVMA 3H8RA 1RUC2 2SBAA 3CMGA 5FO8B 1QXPA 3R05A 2ORZA 2H0BA 3KLSA 1OVPA 4NROA 3K77A 1NCRB 4K3UA 4XHBA 5L9RA 4BU2A 3CJXA 3MW4A 1QJY2 1GQGA 3OY8B 4HN1A 4A2UA 4C0HA 2Q8OA 3I3DA 4LOSA 4AQSA 4Y4YA 4WVWA 1O91A 1V6KA 1AHSA 3IMNA 2P34A 3ZIXA 4NIDA 4QX8A 3SCHA 2OUHA 3NV1A 3T4HB 3OY8A 2ZX0A 2ES3A 2WJSA 2JEMA 4Q4Y1 1PGW1 2AENA 3AZYA 4FQ4A 5HCHA 4B7EA 4XE9A 4NIHA 4WVMB 5J1XA 1H8TB 2JE9A 1EV11 2ENRA 2VG9A 1XJAA 5FQ0B 3D4KA 3BI3A 4EZ4A 1UIKA 3LPFA 1QNYA 4CDUB 2WT2A 3PJYA 3TB0A 2LROA 4JKMA 1Y3TA 4FPYA 3H7YA 4IE6A 5FZ8A 4XXAA 5LA2A 5CAZA 4KGGA 3I7DA 1LHWA 2V73A 4I0AA 1OC1A 4OVEA 3DKQA 5GLUA 1B35B 1V9U3 5L19A 5DDJ2 3ZLIA 4Q27A 1KJRA 3OEBA 4HVQA 4Y5Z0 4KBBA 4LO7A 1LKNA 3PDQA 1YYNA 3U07A 4CZSA 1H8TC 1SFNA 2CL2A 2P17A 2ZX4A 3K3OA 4FCAA 4Q4Y2 4XJ8A 3ZMNA 4AI3A 4V2VA 1VBE2 1COV3 4R4ZA 4XABA 5EWSA 4DEVA 5CNAA 3B7MA 4R9CA 4K7JA 4AFDA 4MOAA 3AM2A 4MSVA 2YC0A 4AQ6A 5IK8A 4ZXEA 2ARAA 4META 4JGYB 5IVEA 1MVQA 1WW4A 5M0TA 4UFKA 2A6YA 1H8VA 1O5UA 4UYBA 1ZZ6A 2H0VA 2VW0A 4OUMA 3VHNA 2LUWA 3T4VA 2AYHA 1I5PA 3E5XA 3WZ1A 1JZ7A 4LA3A 1JYIA 2UYBA 4W50A 1SMVA 2Q1FA 1YI9A 3UJOA 3JCIA 4OHZA 1TVGA 1OT5A 3CEWA 5FYMA 1WCUA 2BP6A 1X9TA 5T54A 2BOJA 2WNVA 3S30A 5LA0A 1B35A 2VY0A 3RFRA 1W8UA 4LLOA 5K0UC 2EALA 1NA1B 4NO4A 4KMQA 4O9GA 4RFT0 4NIGA 3O1TA 1L7RA 4GMP1 1UN1A 4I30A 2QQVA 4BLJA 4RYDA 1GP5A 3THTA 4ARXA 2ZMKA 4OI2A 3TYJA 1V6OA 4MX3A 4C90A 3E5UA 4I2OA 2A71A 2I74A 1JH5A 3WCRA 5IVJA 3AP6A 1MPXA 2HBTA 1ZRFA 2Z69A 4QKBA 1X82A 1H30A 1FV3A 3ACFA 3N7MA 3HBZA 4XF3A 3JD72 4OQ8A 1OUSA 1VBB3 1X9PA 1KITA 2NMOA 3ASIA 1SACA 5A7NA 3DYMA 1E5IA 5F37A 4HSJA 1U5IA 2PHLA 1WLTA 3WG2A 4EV0A 2XJUA 4OULA 1AZDA 1VBD1 1XRUA 3AKTA 5LY1A 4QXHA 5JAXA 5KHKA 1N1TA 1CZTA 4YVSC 5I8YA 2UY8A 3BOWA 3FLRA 1W6PA 4HPKB 5B4NA 1LHOA 2KXLA 2PHWA 2DUQA 1QXRA 2BWAA 3VBSB 1GP4A 1XNBA 2BERA 2HH9A 4YM2A 3C7GA 4RFRB 3OPTA 4RHV3 4LKSA 2GMEA 1F5FA 3IAPA 2W92A 5SV8A 4QPIB 2OX0A 2VVDA 3NV3A 3WDWA 3DPRB 3BODA 3MUZ1 4AQ2A 1J3QA 4KU7A 1S0IA 2XB6C 5L7OB 1O3RA 5GZGA 4JDOA 3NJYA 2LALA 4M4PA 2RR11 3F95A 3O1RA 4EN0A 5FO7B 1GNZA 4N53A 4UT5A 2YUEA 3ZXAC 3JBG3 4DXTA 1NCQB 1H4HA 3N4MA 4JDNA 1JHNA 1VBB2 1NX9A 5CA6A 2Y6HA 4LK6A 1YI7A 4YLZA 3POYA 1DLLA 4IXLA 3WD5A 1V6NA 2GC1A 4NAMA 4OI1A 1SQ4A 1Z78A 4GAZA 3ZYGA 1H6XA 1TME1 3I59A 3KHBA 4URAA 4IE0A 4ZU7A 1OH4A 1UIJA 3BTXA 2PELA 4P5HA 2J1TA 3FUQA 5AC91 5KC6A 2JB8A 3ZXDA 4WM8C 2XXZA 2GU9A 3K46A 2OIIA 4JCKA 4MXVA 2WZR2 5JCTA 5JZGB 1AL22 2EAAA 3PVEA 5D1IA 5F9TA 4XURA 1ONAA 4LE3A 4QXBA 5CISA 1LGBA 4AI2A 1QXJA 4QQHA 2JIGA 2VZPA 3DPRA 2WWSA 1XXNA 4GWJA 2OA2A 3U1XA 3D0SA 4OHVA 5FMOL 4WZCA 3RYRA 2R30A 1PO13 5F5QA 4AK3A 1ZZCA 4ZHNA 1NQDA 4I3GA 1F8VA 3RI8A 3OEAA 3ZX7A 5BNOC 5HV0A 2ATFA 1RUJ3 3DKWA 3IKWA 1ASJ2 3BU7A 4XDQA 2BPA2 1KDMA 2IXHA 1ZZ9A 4CDQC 3WNXA 1G9FA 5ACA1 5FLIA 2CSGA 1GOHA 5F2SA 3RJRA 3WQBA 3LOIA 1UWWA 3MF9A 3ZN6A 1VBA1 4KWJA 1AYM3 3VL8A 1JODA 5F3CA 4Y1YA 1D4M2 1YFXA 4LXLA 3RI9A 4KG8A 3EQEA 2DDUA 3U10A 3U75A 3LGRA 5I0DA 5FP8A 1QOSA 2E26A 1W6OA 4HL0A 5L9BA 1QH7A 1YC61 4CRQA 1I1EA 2JD4A 2QDRA 4D7SA 3VBHB 2C24A 4XUPA 2VZOA 2ZX3A 1YIPA 5ERLA 5T5OA 3WXPA 1DHKB 1OUXA 2LRPA 1UKRA 3VKLA 1DDLA 1A3KA 4LK7A 1RC6A 2IWGB 3MUY1 2Q4SA 2VL4A 2YFZA 3J9SA 4QPIC 3BN6A 3B00A 1F4AA 1UPIA 1EAH1 4K8RB 5LATA 4EROA 1F4HA 1S0DA 4P9XA 2A3XA 4PDWC 1RXGA 5BYNA 1BEV1 3S6PA 3BOPA 2RDQA 5C71A 3WNKA 5I91A 2O8OA 4KH9A 1J84A 3C3VA 4NJ4A 4Q8KA 1Y9GA 3OF1A 1XC6A 5LA1A 1S2KA 3USSA 3LQCA 2DCTA 1DGWA 3ZFGB 4BQYA 3AYCA 5I0TA 5K4LA 2G9FA 3W5NA 3AZVA 2PQQA 3SH4A 3OGGA 1UD1A 3I3QA 5JR2A 5LEJA 1RUH3 4A4AA 5JSRA 1ACCA 2VUCA 3E1F1 2XVLA 3INAA 3POSA 4EN6B 1G9CA 4LHSA 2PQSA 3O1SA 4PDWA 1F15A 2GMPA 1IHMA 2WLPA 2F6BA 4BK4A 5J7MA 5JXHA 4Q0VA 3BIEA 1XQNA 1OQDA 2VZUA 3VDDC 1CAVA 2WR9A 1QH6A 3VBUC 1VPHA 3RZKA 2C9KA 3BIWE 2MNGA 3T2OA 1ODNA 2B9UA 5GLWA 2VMGA 2R6QA 4IEZA 3H42B 3I2OA 2FDHA 3CHXA 4CDXA 1CGPA 2VMDA 3MV01 4TLFA 4IESA 1XE0A 3H8UA 5JSPA 4CUAA 4QDRA 1FPN3 1KJLA 3D5OA 1WCDJ 1AUYA 1JHJA 1S0CA 3MF6A 2JB4A 5DAXA 2WT1A 3AVSA 1EAH3 4FFGA 5E16A 3VDBA 4GWIA 5A3LA 1VAKA 1SCRA 4FPKA 5C33A 1GMMA 3USUB 4CDUA 1QJX2 4N43B 3AX4A 2OXBA 4COZA 2Q8DA 3SC7X 5IATA 1K3IA 3I2JA 3WSOA 4OUSA 5FKCA 1G9AA 4LHNA 1RUG2 4AFCA 1REDA 1CONA 4N43A 4QDSA 2FMYA 3D3AA 2ARBA 3IDBB 2D6KA 4ISRA 4TTGA 4NPLA 2RDRA 3N7KA 3N9NA 4D8MA 1RJ8A 3AFGA 1F31A 4QGMA 5JOZA 4FTBA 2AGSA 1JYNA 2WAOA 5FAXA 5FZ9A 1C5IA 3KS7A 1V70A 2NPIA 4PIZA 4UBGA 1ZREA 2GDFA 4Y3OA 1HKDA 3LA2A 5E88A 3QOPA 2GAUA 4A41A 2YV8A 4YZ1A 1ZVFA 3CL1A 3ON7A 1V9U2 2NZ9A 1PGSA 3ELNA 4LTAA 2Z2SB 3A0KA 5CFDA 1UU4A 4XUQA 3UETA 2R7EB 1RHI2 4XZPA 1HDKA 1Q8OA 1XE8A 1PVXA 2WZR1 4CVUA 4Q5OA 3KCXA 3LDRA 4NMIA 1PGL2 2G19A 3O0XA 2VO5A 3IPVB 3M8LA 1AJOA 1ZRCA 1ASJ3 4PBOA 4DS0A 1RGSA 1V0AA 3EXUA 3BKZA 3I97A 4FPEA 3JXSA 1LU2A 1LGNA 3BTAA 1W6NA 4RQPB 1Q8PA 1QWRA 3LEIA 3UYJA 3PUIA 4AGGA 5EJ3A 2A70A 4XJUA 2C4XA 2OZJA 2YROA 4FXKB 1PVC3 2E7AA 4L11A 4Q1RA 3MIDA 3WP3A 1KS4A 5BV6A 5FTTC 2XJPA 3OUHA 4H55A 4MH0E 1RL3A 2J1UA 3P3NA 1VRH3 4MXWA 3NNJA 1W9FA 1WBLA 2VQAA 2JXAA 3FLPA 3P5BA 4P14A 1FMD1 3KGZA 4MG2A 1HRI1 1WA6X 5APAA 3EJKA 4FPJA 3WR0A 3VBHA 2O0OA 3A22A 4I0WB 4N9IA 4YVWB 2DU0A 4G4FA 3PVNA 3VN4A 4UFMA 2VTXA 4V2WA 3GHNA 4YM0A 2CTVA 5FZMA 1UOFA 2EXJA 3ZXLA 5FZIA 4B1MA 1AXYA 1C8M2 4LUMA 5CVRA 3TEYA 2EXHA 4QHZA 1BVP1 2W95A 3ZSMA 3MLLA 5EJZB 5G05L 3THDA 4WM7C 2W39A 3A23A 4UBHA 3VB9A 3NAPA 4DPNA 1PZ7A 5KHIA 3LIGA 3OD0A 4LE4A 5T5JA 4CCEA 3V65A 1WWYA 4E4ZA 4XQ4A 1Q5OA 2MHFA 4Y1VA 2VMCA 4YVWC 2R32A 3N9PA 1LU1A 4CPBD 4FXGB 4RHV2 4D6QA 4DB5A 2YFUA 5CBLA 5IAXA 3IDAA 5IVCA 2CNAA 4TWTA 1PMJX 3GNEA 2C9AA 5FO9B 4FAHA 2CYFA 3SISA 1ZNPA 1RITA 2ZGTA 1ULEA 4J1WA 3O5SA 4M3CF 4NHLA 2YBSA 2VPVA 3OG2A 4IE5A 1YFYA 2PLV1 1H2NA 4CCJA 5BXXA 1C8M1 4Y20B 4M0HA 4FT8A 2BVVA 3L9JT 5KHGA 3HPNA 1FT9A 1MS1A 1QJX3 2K46A 1JU3A 2FCTA 2RS52 2ZACA 3D82A 3EYPA 3KQ4B 4AEDB 1T6GC 2WS92 5FYSA 4OI0A 2I07B 5I93A 4ORFA 3HIFA 4FP2A 2ET7A 4LHKA 5J3UA 4KWKA 4UFLA 1QQP3 1ZBA1 3GXUA 1CVNA 1TME3 3O1MA 2YPDA 4GB33 4JX0A 5A7OA 2AC1A 1G9BA 1RJ7A 1D2SA 4BLIA 3NAPB 2ZEWA 5L36A 1H1AA 4Y22A 1RUI3 4I3PA 2R043 2O1QA 1GANA 1LAJA 1C57A 1W39A 4QU1A 4HBNA 3VD3A 3IIAA 2WBKA 1BCXA 5AFEA 4J25A 5H9RA 4NE9A 1WD3A 3KVBA 1VJ2A 5JR7B 2FZ2A 3H1MA 1XOYA 4PLNA 1CJDA 4LIVA 2JG8C 5GJ6A 5C4WA 1GZTA 3NJZA 1PO11 4DEQA 4TZDA 1JBCA 5DAQA 3FN9A 4B8EA 1W6PB 1S0EA 1W8NA 2ZX1A 4HPKA 1SBEA 4XJZA 2D6OX 2V09A 2CAUA 3ZR6A 1ZBA2 4R9BA 5FXVA 2AR6A 4LPLA 3ATGA 2RS32 2F4LA 5F39A 4B7KA 3R4SA 2W0XA 3ILRA 2XONA 4PJYA 1CESA 4CCNA 2LM3A 1AR73 4OMDA 5C3QA 5CKNA 1BK0A 5FWEA 4WZFA 4EN7B 1PNFA 2ZS6B 1L3JA 3B9IA 4COVA 3TEZA 3MGUA 3RJ2X 3AVRA 3BUCA 3OBRA 4FFHA 4Q4V3 2HWF2 1CIYA 3QCWA 1UO9A 5F7UA 1AL0G 1OA2A 4M4RA 2E7QA 2VTXJ 3HMYA 3WQ0A 4X8PA 1W6QA 3D6EA 2DUPA 1Z0HA 1V00A 4AVTA 2GP3A 1PGL1 2A3YA 3AMNA 1DGRA 4FPLA 4XF4A 3GBFA 2VNOA 4SBVA 1POQA 3WDYA 3AZZA 1DFQA 2RV9A 3BVCA 1DGWX 2HLEA 3POFA 4OQ9A 1O5LA 3M2MA 5JI9A 1UNBA 2VECA 2VVFA 3DF0A 3MI8A 1W03A 2FCUA 2JDUA 4HT1T 3VHPA 2ZGOA 1U12A 3KF3A 5FUPA 2GH8A 2X5IA 3LZZA 1PVC2 3EBRA 3MIGA 1JYCA 5JI7A 3S7EA 1ZRIA 5BUVA 2LW8A 1W2TA 4ASKA 3RSJA 2G4IA 2D40A 1AR72 3PUSA 3OBAA 4R52A 5CADA 1AYM2 3WG4A 1NG0A 4YG6A 3W21A 4KWUA 1LOBA 1X8MA 5FIXA 5FR3A 1FMD2 1W9YA 2VH9A 1CPNA 2A3WA 1AR81 3S7IA 3UJQA 3E97A 5DXDA 5JZGC 1EY2A 2Y26A 2RDNA 4IE7A 5SV5A 5BNPB 4AXOA 1H1MA 1KFXL 4AVVA 4YWAA 1W2AX 1UXXX 3FE5A 1AX1A 3LCPA 2XLFA 2R071 3AMMA 3H1YA 3UT0A 5JZGA 5IW0A 2Y8KA 4GA9A 4FFIA 1QDOA 3POWA 4LO5B 2YHJA 3SKVA 5F1RA 1V6JA 2YU2A 4NWVA 4B4QA 3WG1A 1EUUA 1CN1A 1K5MA 1QY4A 2RS33 2WN2A 3PUQA 2WZPP 1MS8A 2BFUS 3MV11 4JGZA 5EPAA 4CA9A 4UWDA 3I2DA 1W6NB 1IKQA 2XPJA 5F3EA 5AC92 4E4HA 5LW9A 3T2QA 2WZ8A 5LB6A 1P8JA 1TMF1 3IZOA 5HXVA 1W9WA 1YQCA 4RQPC 4WM7B 2X5IC 3PU3A 5FYIA 3IPVA 2PHTA 4AGRA 3POJA 2PMWB 4LO6B 5L7OA 3LA7A 1H8TA 1BMV1 4TN7A 1AVBA 4PDWB 1GZWA 1A8MA 3HEIA 4AHYA 4QX2A 1MS3A 5C3OA 1D4M1 3ZYPA 3NJVA 1RUI1 4JKKA 3NWKA 1WMDA 4BQ5A 2VNVA 2JE7A 4MV2A 2YC4A 2VNRA 1UY3A 1DGRN 1X7NA 1W9SA 2BVBA 1EPZA 4ZY9A 1LR5A 4Q26A 1ASJ1 5C3PA 2Y6GA 3FL7A 1ULCA 5FPXA 4TLGA 2WABA 4FP3A 4DMIA 1O7FA 4MZUA 1H1IA 2VCCA 5IK4A 2QQPA 2Y64A 2F17A 4BB3A 3GBWA 5GLZA 3WG3A 1EAH2 1ZZ7A 3B9CA 3NV4A 4CYDA 4QX0A 1PK6A 1QMJA 2XBO3 4D3WA 1FOD2 1W8TA 1S2BA 3ME2A 5DZEA 1OFSA 2HBUA 1OKQA 4A44A 1VBC2 2Y0IA 4BQ2A 4X6RB 3AMHA 1SEFA 3KT4A 3OUJA 1IGOA 4JDMA 5FUNA 3ABZA 1UF2C 2XJTA 4QQPA 4XFCA 3VDAA 1NE4A 1JZ3A 1Y43B 5C4WC 2G1MA 1GNYA 2RS12 3A7QA 3MIBA 5GKAC 4CTEA 5IFTA 2QFEA 4QX1A 1TNFA 3AZWA 2HWB2 3I8TA 3MIHA 4KGQA 5FZDA 1SLCA 1RUOA 2JDYA 4XBNA 4YZ3A 5FJHA 5FLHA 3SH3A 4B29A 3M3QA 5FP7A 1Q43A 3AKRA 4QB6A 1UCXA 1MQTA 3PL0A 4W4ZA 5DZFA 3VKOA 4A3XA 4DRVA 4D6SA 2YGMA 1JOJA 1REFA 1UOGA 2W08A 5B2GB 3E6DA 3C7FA 3AMPA 2AZ5A 1V6IA 1PIV2 1DQ4A 2OZ6A 2TNFA 4Q4X1 3WW4A 4QX3A 1JXNA 1ND2A 2I45A 2GC2A 5C8CB 3ZXJA 4FBFA 4DFSA 1AF9A 4AI9A 3VBOA 4M01A 1RINA 2W3JA 3ES1A 3KGLA 2JG8A 1VE0A 3DEMA 4OUEA 1YQ8A 4Y1XA 2XUEA 2V5DA 3BPZA 2D6LX 3HQRA 3UGFA 4CP9A 2UU8A 2E6VA 2OPKA 5F5CA 3JU9A 4XUOA 3RRDA 1AR92 1E5SA 3ACLA 5EYYA 5IHRA 4FPHA 5K7PA 3JQWA 1KGYA 1AR83 1WBFA 1MEC1 2JG8B 3AZXA 1SFYA 2E33A 4GXLA 4K21A 2P4EA 2XDVA 2OW4A 5FZEA 2XJSA 2XMLA 4IEOA 1NCQA 2WZR3 1VRH2 1W0OA 3VBFA 2Q1ZB 2H6CA 2P6CA 2ZGQA 3BPSA 1YCIA 1R082 4AWDA 4CCOA 3K3NA 3GBGA 5I8SA 3VZOA 2B9VA 5JSOA 1IPJA 1WCKA 4S2DA 1K5MC 1XNKA 5FQ0A 3IM0A 3VKNA 5BNQA 3WNMA 2TUNA 1XU2A 3VD4A 2EIDA 1OKOA 1UPSA 1GYKA 3ZMOA 1NOVA 3DGTA 3VKMA 2VBDA 3IN9A 4FFFA 4BIFA 5LCWL 4BMBA 1NXD1 1ULGA 2VZ1A 3JD71 2DYCA 3NKTA 2D3RA 3ZSEA 5ISLA 4XEZA 4DRRA 2ZCWA 1IKPA 3ZDSA 5ACA3 1XB9A 2R16A 2WLQA 3GCWA 1CR7A 3KCYA 1DBNA 2Y38A 1VBD2 2ETEA 4RGGA 3MFCA 4G3YC 1NE6A 2DCYA 3BALA 4HFSA 1QGLA 1LESA 4M3CB 2QZ2A 3DCQA 4YGEA 3NAPC 1JTZX 5FMOS 5KWRA 4CSWA 1IS5A 2YGLA 2GNMA 2NMNA 4Y26A 2WNOA 5FPBA 3ZM8A 4Q4V1 4HETA 4IE4A 4QX7A 5FKBA 1L7LA 1RUC1 3FHIB 4Y5TA 2VMEA 2AEZA 3TBDA 1LEMA 3R6SA 3X29B 1J3PA 1RUI2 1SLAA 4UXAA 1UZ0A 1HXS1 5E89A 3KVAA 1R1ZA 1G8WA 1JYTA 5C9AC 5FPVA 2XR4A 5FZ7A 5K8SA 2BFUL 1RUF1 1UAIA 2XKOA 4ONUA 3TN93 3ZYRA 4LULA 2GH2A 4XTPA 4YW4A 3WNNA 3CBNA 3RMYA 1ULFA 3FHQA 3NW4A 1O3TA 3AJYA 2Q8EA 4AZZA 1OMIA 4BM8A 5K0UB 3B94A 4E27A 1XYNA 4GZ9A 3NL1A 2WWJA 1GOGA 2VVEA 3CZUA 4B1LA 1HV0A 1HJGA 2PHRA 3OYWB 4W8JA 5DABA 2CAVA 3IB3A 4PI2A 3ZXGA 1RUNA 1BKZA 2JDZA 3RWKX 2J1AA 1VB4A 2WNUC 2ZGLA 3IT8A 3MO4A 3OUIA 3ZXKA 4MXWB 3RVHA 4CCKA 5CG8A 1X36A 2DV9A 3I3BA 4LHLA 4FOYA 1JU4A 4HMZA 5ANNA 5JVVA 4LBJA 4GB31 2PHUA 3IWZA 4O65A 4UW3A 2AUYA 2WRAA 3FLTA 5FZAA 1N1YA 2GC3A 4QAWA 5EHDA 2X29A 5JWPA 4YW6A 1LHVA 1W28A 1R1A1 1NZCA 3AP9A 2R041 3IIIA 4KWLA 3T1MA 4AVAA 5FZ6A 3T2TA 4H2AA 3P3PA 1IS4A 3J7NA 5DUWA 2WS91 4LKEA 4DXRA 2ZKLA 1VBE3 1GLHA 4IV3B 3BTZA 5JIAA 2PAMA 1AR82 4NAOA 5A7WA 2B46X 2K0GA 4PBPA 3MBWA 1RUE3 4XBLA 3VDCA 2XUMA 4M3CE 5FMBA 4Z07A 1JZ8A 2QVSB 3ZSJA 3MFAA 4BYYA 1SDWA 2VOKA 4E4DX 1LULA 3VDDA 3I3MA 3DXTA 4Q4X2 1ENXA 1H9WA 1RVF3 4HZFA 4P9YA 5KHHA 1S2EA 1HW5A 2NYYA 2A7AA 3WOGA 4YPJA 3HJRA 5DDJ3 1BXHA 2JDKA 4A7YA 4QMAA 3OPWA 4CDUC 4GH4C 3OPZA 3MIFA 4BQXA 4XAAA 5J36A 2V4VA 3HOBA 3QBQA 1VBC1 4XOGA 5D21A 3RYPA 4P9LA 2XJQA 4AOCA 2OUJA 3TNPB 4J6GA 3SKJE 5J37A 5FZCA 2OT7A 3VZKA 4W6XA 5GLVA 5FZ3A 5ABJC 2RS11 2XL7A 3RG0A 2UURA 1LOAA 3BYWA 2GN3A 3J7MA 2MEV2 3NVCA 4MGZE 5LK7B 1VBE1 3SNMA 2JE8A 2ZABA 1I9RA 3DYOA 1LECA 4IEYA 4LO8A 3UKNA 1MZ5A 4WM7A 3THPA 5G04L 3H1WA 2UY9A 4LBMA 1T6BX 4RS5A 4CEWB 1LB2A 5GZFA 5L7OC 5GZEA 1LOCA 3AXDA 2FZ1A 5ABJA 4XZUG 5IK7A 5A1FA 3TEXA 1M4WA 4Y4RA 1MS5A 3ZFEB 1S1AA 5D8AB 1O3SA 2W52A 3FBMA 3VBHC 2PXJA 4BHPA 2ZJCA 2VW1A 4MADA 2HJIA 3D0JA 5FP9A 3GZTB 2ILMA 5BNPC 1RUC3 4A7ZA 1CZSA 2X09A 1CAVB 3ZFFC 2DFCA 2IXLA 1N1VA 1PHMA 1SZBA 4JHTA 2VMFA 3HQXA 3M4FA 4RR3A 5CU1A 2WINB 4CDQA 1RIRA 2WWUA 1B09A 2D5FA 2ZAAA 5E6HA 3TNQA 1VBC3 3I49A 1Q3EA 4HOOA 4K1ZA 1Y7BA 4OI4A 4QPIA 2RJLA 4YM3A 4I0BA 1UQXA 2OS2A 1LOEA 2R063 1FOD3 4YARA 2UYAA 3AMQA 4CXYA 2A75A 4CUCA 3IBMA 5HXMA 2D6NA 2W1UA 3M1HA 1FATA 1F35A 3WNPA 2IZWA 4DY5A 2X5IB 4Q4W1 3SQOA 1BBT2 5LWBA 5FXXA 4IEWA 5GLTA 4BIOA 3CQOA 3T0BA 1WMEA 3KHCA 3ILFA 2FCVA 1YFUA 4LORA 1GWKA 3I2IA 4XF1A 5BNNB 5T5PA 2JJ6A 1ALYA 2RJ2A 4Y20A 1Q8SA 1ULPA 1VP6A 3WW2A 1BBT1 4C0BA 2WA3A 3NV2A 1BQPA 3O0WA 2B5HA 1RUG1 2A5ZA 2EA7A 3POIA 1GZCA 4QKFA 2JD9A 3AK0A 1CIWA 1HIXA 1R1A3 4QXKA 4GMP0 1LHNA 2BNOA 3ES4A 1UYXA 3GJBA 5CKMA 5A7WB 3WHUA 1SPPB 2GC0A 3HWJA 2WS93 4CUGA 1WW5A 2BNMA 2RM22 1W8OA 2ZGKA 2WNVB 1MR5A 3K75B 2BZDA 3UK9A 1AR71 5DG1A 4N43C 4M00A 4QQLA 3SXWA 3VBUB 3JQXA 3K4ZA 2VQTA 2WIIB 1LGCA 4JC1A 1KXGA 3A21A 1OFNA 4IL7A 2Q0AA 3VBOB 2QQNA 5C9AA 1YFWA 1W0NA 1O4YA 1CAUA 4ZXKA 3ZN4A 3OGJA 4FOQA 4UFJA 5LRSA 3HNYM 5FRAA 2VZTA 3AP4A 4PLMA 1GU3A 1W06A 4UOJA 5EFUA 5FZ0A 2FDGA 4KG0A 3KV4A 1HX6A 4R9DA 2ADDA 4XBQA 5DAVA 1PMHX 3UGHA 1PO21 2IVIB 2J7MA 3RZZA 5EQUA 4EQVA 1OSGA 1DLCA 4RR3B 1DGLA 3WVJA 5A3TA 1J58A 2P3IA 1LOFA 1R092 3R4UA 4IV1A 5FPAA 5C3RA 5C9AB 3ZFFB 3QD6A 5H9SA 1QJZA 4Q4X3 3BCWA 4QM9A 4UF0B 3H8OA 3FUOA 3KWVA 1UMZA 1VAMA 1S0GA 4LKDA 3VBUA 2D3SA 4FTEA 1US2A 1RB8G 1CAWB 2BYVE 1AXKA 3J7LA 4LQRA 2HWD3 3UKTA 2ID4A 1OD3A 4MHRA 1WCSA 4XMIA 1CWPA 4P00B 5FYHA 4YW1A 5JOXA 3DYPA 3I2FA 4Q8LA 1GWMA 2JDHA 5FV3A 2VTFA 4XCAA 3BTYA 2FHRA 2YXSA 1KRIA 2HKXA 4BQ3A 2TBVA 1N3PA 3ECQA 1SG3A 3UL2A 1W99A 2E32A 1DZTA 1EV12 5HCAA 4BQ1A 5EXOA 2HEVF 4XDOA 5A6XA 1JUIA 3S57A 4P9JA 5FBZA 2C6SA 1HXS2 1R64A 1WW6A 2UWBA 3VZMA 3FX3A 4NPRA 3GGLA 4BZ4A 5A33B 5JOWA 2P1BA 3HVDA 4GMP3 4AEMA 4DXZA 4CEYA 4BCUA 4D7TA 2AH2A 3KB5A 3LFMA 3B3QE 4FPCA 3ZOIA 1JYVA 5J09A 2XWJB 1QJU3 2PTMA 5DUVA 1OF3A 1J3RA 4RN5A 1KS5A 1RHI3 1JS9A 4QPYA 1QF3A 1N3OA 3CZJA 4QQOA 5C6CA 3K51A 2XBO2 4AF9A 4S2HA 3WF0A 3M70A 4CCLA 4CEWC 4QB1A 3T1LA 4AQTA 4XILA 2D5HA 5CFCB 2BOIA 2VR4A 1ZBE2 2YMZA 2YYOA 2QQWA 5EIYB 2C5DA 4NHYA 5F5IA 2Q5TA 1QKQA 2XBO1 1GR3A 2RVAA 3APBA 3VBOC 1URXA 1JI6A 3HD8B 1AR62 4IV3A 4ASMB 4C1XA 1POV1 1HN0A 3H8XA 1SFPA 1WW7A 1OF4A 1UZVA 4EWDA 1C1LA 4EWAA 1R1A2 3FMGA 5FXZA 1K5MB 2R073 4OHWA 4ZS3A 3WINE 4DQAA 1RUD3 1RUH1 2ZEYA 5C5TA 5FLJA 5F3GA 3J8F3 4OFGA 4CP9B 2VZVA 4XFAA 5AC93 4C8DA 5FZBA 2J1VA 5FOBB 4IERA 5H9PA 3VKFC 3U37A 1FAYA 3CO2A 4DUWA 1VRH1 1O8SA 1YJLA 2RHPA 1S0JA 1SBDA 2ZGPA 5DUXA 3M3OA 1RHI1 1HRI3 1BK1A 3CJIB 2MPFA 3NJXA 1VLNA 4FPGA 4GWMA 3S5QA 2WO1A 4ZU5A 2XQRA 2B39A 3OBTA 4IGQA 2FDIA 4ES8A 5F2WA 4NPMA 1VIWB 1IG0A 4K20A 1LRHA 4N53C 5J48A 1PM7A 1ZA4A 4FPOB 4QPGC 2DVFA 2QQUA 3UESA 5IFPA 1E5HA 2X05A 1AYN2 4P5YA 4PCRA 2HWC3 3ROUA 1BYHA 1LEDA 1JW6A 3W20A 3S0MA 1VBA3 3HBKA 1UOBA 3MLKA 2ZAHA 4L97A 3WUDA 1O8PA 3OB8A 5B4XA 5A3PA 3GYDA 4JVAA 1UZWA 2GMMA 3S5AA 3SMHA 2HWD2 2WNUB 1E57A 4XQWA 5FY9A 4MO3M 5J96B 1CX1A 4BH9A 3CF6E 4YVSA 2G9ZA 1UU5A 4Q29A 3EHKA 3CDZB 2ZGUA 1JZ2A 1WD4A 1J1LA 2WSUA 2JKXA 1EPWA 1H0BA 1C8M3 4BJ0A 5A3NA 2BU9A 4XPVA 5FP4A 5GZDA 3U0ZA 4H7MA 1EV13 2QNKA 1A8DA 1W04A 3Q8EA 3G6JB 4KU8A 2VMIA 1OLRA 1QEXA 3QLQA 4ZONA 1F5JA 2ZKNA 4MGSA 4NHXA 3LOBA 3N9OA 1RYYA 5IUQA 4B4RA 5A32B 2IUWA 2Z42A 3PMSA 3UKVA 5A33A 1ODMA 3RYKA 3WP4A 1X50A 1GZ9A 2VU9A 3I54A 4Y1UA 2DTWA 2VZRA 1NCRA 2PLV3 3JBG1 3T0DA 2IC1A 5C4WB 1OXCA 3WW1A 5K0UA 4DY3A 3U11A 3DUIA 1DQ2A 4QHOA 5F6LB 4F83A 4ZZ8A 2IVJA 1W6MB 5EV7A 4CCMA 3N36A 4QWNA 2DF7A 4BMEA 3RZMA 1XPWA 1D2QA 4XJ9A 1PVC1 1OOPC 2RS13 2VGDA 2VXJA 5DN2A 5FYBA 1QQP1 1ZBA3 3W58A 3VD7A 3HNBM 2EIBA 2W9XA 4Z8BA 1GOFA 2W1SA 5DG2A 1GP6A 4ATFA 2X8KA 4Q4W2 2CY6A 1LODA 2XLAA 4W6YA 4AHXA 4MLOA 5FY5A 4YSFA 1QJY1 3LB9A 3TEWA 1CX4A 4JHZA 1QQP2 2VM9A 3LWCA 1MVEA 2DWRA 5T50A 4LO4B 3K4DA 3GM8A 4L2NA 1YJKA 4RR3C 1W8WA 1W05A 1MEC3 3O7OA 4K6BA 2A6ZA 2Q30A 1W8HA 4IEQA 4QPGB 2PFWA 4OLLA 4UW4A 4B4PA 1XYPA 4Z92B 4I02A 5CZKA 3VV1A 5IWFA 1NLSA 1HQNA 5A3UA 3NSTA 4YW7A 5A3WA 2CDOA 4M3CA 1WLCA 1VMFA 4UI9L 4XC9A 1H2KA 5A7PA 2KD7A 4LEJA 4CP0A 4A6OA 1YQ2A 1HRV2 1LCLA 1ZBE1 2RS53 4HVRA 4PQ9A 4XF0A 3JUUA 3DXUA 1CAUB 5IYYA 3POBA 4XACA 4AI1A 1DU3D 3J8F2 4OHXA 3WQ1A 5A32A 1UX6A 2R062 3ACHA 4OMCA 3ITQA 4BISA 5JIUA 2VW2A 1TME2 4OHYA 4H7LA 2ARCA 5IVVA 1HN1A 5FPLA 2HWB3 3HNMA 3LAGA 4PQQA 3T08A 4TYSA 4AEDC 3AXEA 3ENRA 3N35A 1RUH2 3NKGA 2D6PA 3EO6A 3RPQA 1A6CA 3GALA 3JB8A 2FBEA 5KHJA 3R4DB 1F9KA 3O1UA 2E9QA 2P5BA 4GD4A 2OYZA 3ZFEC 1XNDA 3LD8A 1QIQA 4AI0A 5KC5A 1SDDB 3U14A 3ZFGC 3F2ZA 4QX5A 5JXJA 1GUIA 3AJZA 1IG3A 4BXFA 2XGXA 2DVBA 4GJYA 1ENQA 2WYSA 1KD7A 1VAVA 2JECA 1IOAA 3EB7A 4TSVA 4CE8A 2K9ZA 4UW5A 1U5ZA 2L9LA 3ZKYA 3RZJA 1U5XA 3L2HA 1DQ1A 4P9IA 2AEYA 1AXZA 2JIJA 4KI5M 1ENSA 3POEA 4BQ4A 1FPN2 2BV4A 4QU2A 1WMFA 2JG9B 2GNTA 4N9HA 2PA7A 1QJEA 3O0VA 2B42B 2O8QA 3WUCA 1KFUL 5FBJA 3ZXEA 4D6RA 1OD5A 1IS6A 4GJZA 4F7ZA 1XBFA 5FP3A 3B69A 2XH6A 2WQZC 4L9BA 1W90A 3TOJA 4AAPA 4ET7A 4CCDA 1AX2A 1C8NA 2VQ0A 4XAEA 3ZYHA 4EE2A 1QOTA 1W6MA 4F3JA 3SH5A 4E2QA 1BZWA
chains in the Genus database with same CATH topology
3KV6A 5A7SA 4ASKA 4Y33A 5IVFA 3PUSA 4CCKA 3RVHA 4CCLA 5LWBA 4CCMA 5FXXA 3NJYA 2YBPA 4QWNA 3PUAA 3N9PA 5FYBA 5FZAA 4AI9A 5A7QA 4D6QA 5FZ1A 5FZOA 3AL5A 4EZ4A 5IVCA 5F5IA 5FZFA 5FZ6A 2XUEA 5FZ4A 2OQ7A 3PU8A 5FJHA 2W2IA 5FY1A 3AVSA 5F5CA 5FZ8A 5FY5A 5FY8A 2YBSA 4URAA 4GAZA 5FY7A 4HONA 5A1LA 5IW0A 4CCJA 5FPUA 5FYYA 5A7WA 5A7WB 5FXZA 2Q8DA 2XXZA 2XDVA 2YU2A 3ZLIA 2GP5A 5FZEA 4CUGA 5FZKA 2XMLA 3PUQA 5FYSA 5F3GA 3PDQA 3PURA 4QXBA 4QXCA 3K3OA 5IWFA 4C8DA 5FYZA 4V2VA 4CCOA 1VRBA 3N9QA 3N9NA 5F3EA 4E4HA 3DXTA 3K3NA 5FZBA 5LW9A 5ANQA 2YPDA 5A3WA 5A7OA 3K2OA 3AL6A 3PU3A 5FYIA 5A7PA 2YU1A 5FWJA 5FZ9A 3OPWA 3DXUA 4Y3OA 4QU1A 4TN7A 5IVEA 5FY4A 4NUBA 3LDBA 4BISA 5KR7A 3KVBA 5FZ0A 5ISLA 3KV4A 3N9MA 5IVVA 4IGQA 5F2SA 4LIVA 5FPLA 4LITA 5F2WA 5FYTA 2OT7A 5FZCA 4EYUA 5FZ3A 4LIUA 5F3CA 5FPAA 4LXLA 5FYUA 2VD7A 2YBKA 3N9LA 4UF0B 5FZLA 5FYMA 3KV5A 5FP8A 5LY2A 4GD4A 2P5BA 4XDPA 5FYCA 5FXVA 5A3TA 5FXWA 3LD8A 5F39A 5FYVA 4CSWA 3U4SA 5A3PA 5F3IA 3UYJA 4CCNA 5FZGA 5FY0A 5F5AA 5FPBA 5FY9A 4GJYA 4BXFA 5FWEA 5FYHA 4QX7A 5A1FA 5IVJA 5FZOB 4EZHA 3AVRA 4Y4RA 5FV3A 5A80A 3ZPOA 2PXJA 4DIQA 3PTRB 5FP9A 4DO0A 3KVAA 5FUNA 5A7NA 5A3NA 5F37A 4UF0A 5FP4A 2Q8CA 2OQ6A 4XDOA 5FJKA 5FPVA 2GP3A 5FBJA 4D6RA 4IGPA 5FZ7A 2WWUA 4GJZA 5E6HA 5LY1A 5FZDA 5K4LA 4HOOA 4QXHA 5FP3A 4BU2A 5CEHA 4V2WA 3N9OA 5F32A 5FZMA 4IGOA 5IVBA 5FZIA 2OS2A 5FZHA 5FP7A 4AAPA 2Q8EA 3U78A 3KV9A 5FUPA 3OPTA 4D6SA 4QX8A 2WWJA 5IVYA 2OX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  5A7S A;  4ASK A;  4Y33 A;  5IVF A;  3PUS A;  4CCK A;  3RVH A;  4CCL A;  5LWB A;  4CCM A;  5FXX A;  3NJY A;  2YBP A;  4QWN A;  3PUA A;  3N9P A;  5FYB A;  5FZA A;  4AI9 A;  5A7Q A;  4D6Q A;  5FZ1 A;  5FZO A;  3AL5 A;  4EZ4 A;  5IVC A;  5F5I A;  5FZF A;  5FZ6 A;  2XUE A;  5FZ4 A;  2OQ7 A;  3PU8 A;  5FJH A;  2W2I A;  5FY1 A;  3AVS A;  5F5C A;  5FZ8 A;  5FY5 A;  5FY8 A;  2YBS A;  4URA A;  4GAZ A;  5FY7 A;  4HON A;  5A1L A;  5IW0 A;  4CCJ A;  5FPU A;  5FYY A;  5A7W A;  5A7W B;  5FXZ A;  2Q8D A;  2XXZ A;  2XDV A;  2YU2 A;  3ZLI A;  2GP5 A;  5FZE A;  4CUG A;  5FZK A;  2XML A;  3PUQ A;  5FYS A;  5F3G A;  3PDQ A;  3PUR A;  4QXB A;  4QXC A;  3K3O A;  5IWF A;  4C8D A;  5FYZ A;  4V2V A;  4CCO A;  1VRB A;  3N9Q A;  3N9N A;  5F3E A;  4E4H A;  3DXT A;  3K3N A;  5FZB A;  5LW9 A;  5ANQ A;  2YPD A;  5A3W A;  5A7O A;  3K2O A;  3AL6 A;  3PU3 A;  5FYI A;  5A7P A;  2YU1 A;  5FWJ A;  5FZ9 A;  3OPW A;  3DXU A;  4Y3O A;  4QU1 A;  4TN7 A;  5IVE A;  5FY4 A;  4NUB A;  3LDB A;  4BIS A;  5KR7 A;  3KVB A;  5FZ0 A;  5ISL A;  3KV4 A;  3N9M A;  5IVV A;  4IGQ A;  5F2S A;  4LIV A;  5FPL A;  4LIT A;  5F2W A;  5FYT A;  2OT7 A;  5FZC A;  4EYU A;  5FZ3 A;  4LIU A;  5F3C A;  5FPA A;  4LXL A;  5FYU A;  2VD7 A;  2YBK A;  3N9L A;  4UF0 B;  5FZL A;  5FYM A;  3KV5 A;  5FP8 A;  5LY2 A;  4GD4 A;  2P5B A;  4XDP A;  5FYC A;  5FXV A;  5A3T A;  5FXW A;  3LD8 A;  5F39 A;  5FYV A;  4CSW A;  3U4S A;  5A3P A;  5F3I A;  3UYJ A;  4CCN A;  5FZG A;  5FY0 A;  5F5A A;  5FPB A;  5FY9 A;  4GJY A;  4BXF A;  5FWE A;  5FYH A;  4QX7 A;  5A1F A;  5IVJ A;  5FZO B;  4EZH A;  3AVR A;  4Y4R A;  5FV3 A;  5A80 A;  3ZPO A;  2PXJ A;  4DIQ A;  3PTR B;  5FP9 A;  4DO0 A;  3KVA A;  5FUN A;  5A7N A;  5A3N A;  5F37 A;  4UF0 A;  5FP4 A;  2Q8C A;  2OQ6 A;  4XDO A;  5FJK A;  5FPV A;  2GP3 A;  5FBJ A;  4D6R A;  4IGP A;  5FZ7 A;  2WWU A;  4GJZ A;  5E6H A;  5LY1 A;  5FZD A;  5K4L A;  4HOO A;  4QXH A;  5FP3 A;  4BU2 A;  5CEH A;  4V2W A;  3N9O A;  5F32 A;  5FZM A;  4IGO A;  5IVB A;  5FZI A;  2OS2 A;  5FZH A;  5FP7 A;  4AAP A;  2Q8E A;  3U78 A;  3KV9 A;  5FUP A;  3OPT A;  4D6S A;  4QX8 A;  2WWJ A;  5IVY A;  2OX0 A; 
#chains in the Genus database with same CATH topology
 1UMI A;  3KV6 A;  1HXS 3;  2JG9 C;  3SCG A;  5A7S A;  4HKL A;  5HPO A;  4R9A A;  3E5Q A;  1UZZ A;  2ARE A;  3CNA A;  3SEE A;  5IT6 A;  2P3Y A;  3LE0 A;  2YBP A;  3VBS A;  1HQL A;  1R09 3;  3PUA A;  1ND3 A;  4CXX A;  4LBK A;  3ZXF A;  4AHZ A;  4JGZ B;  3MW3 A;  3O14 A;  5IJR A;  2J1R A;  4YFZ A;  4JGY C;  3AYE A;  1POV 3;  3N7J A;  3PU8 A;  3PUH A;  5GZC A;  1YLL A;  2VOW A;  4KNC A;  3O12 A;  4N7U A;  2RM2 1;  2BEO A;  3I4I A;  1JZ5 A;  3KZ4 C;  5FY7 A;  2QDN A;  5LBF A;  3MIC A;  2XQX A;  5DMY A;  1R08 1;  5FPU A;  4OZX A;  2DCK A;  1IQA A;  4IEX A;  4JRL A;  5IAV A;  5FPZ A;  4YW3 A;  4BPZ A;  2WO3 A;  4PLO A;  2C0Z A;  2ZTN A;  3MPP G;  3FWE A;  4MGK E;  3V0A B;  3MZH A;  4H3W A;  4IND A;  2R0F A;  2RE9 A;  1DZQ A;  4GKX A;  2RMU 2;  1UXZ A;  5BY5 A;  1Z7S 2;  2D97 A;  2DVD A;  3JZV A;  5D2A A;  1XNC A;  1U0A A;  1JZ4 A;  2VCM A;  1QJX 1;  2VQU A;  3DN7 A;  1UL9 A;  4URT A;  1EYB A;  5EJ1 B;  1GNH A;  3C2U A;  2DVG A;  2QQM A;  4IUG A;  1NA1 A;  3OSD A;  2YU1 A;  4TXW A;  4YGD A;  3QAC A;  1ZZ8 A;  2HWD 1;  4GAL A;  1C3H A;  4Z1V A;  5GM0 A;  2Z4F A;  3M3E A;  3PIJ A;  5K9Y A;  1AX0 A;  1DZR A;  5T52 A;  3ZYJ B;  4ZS2 A;  3C7O A;  4XQD A;  4QHB A;  2R07 2;  4B3N A;  5C5U A;  2PYT A;  3VBR B;  1LNS A;  5HCF A;  1MZE A;  4UW6 A;  1GZW B;  4NHM A;  4XFG A;  4FVV A;  2DUR A;  3EMR A;  4FAG A;  5IVF A;  1AR6 3;  4XIK A;  1UY4 A;  3BGA A;  4U36 A;  1HRI 2;  1YRZ A;  3FC0 A;  4IEP A;  4JGY A;  5D8A C;  4MHU A;  4E2G A;  3KV5 A;  3VZN A;  1ZZB A;  3AP7 A;  4Q4V 2;  3ST7 A;  1XYO A;  1M06 G;  2ZML A;  4MGI E;  2EXK A;  5FXW A;  2QBX A;  5FYV A;  1SLT A;  4P02 B;  1JOB A;  3VBS C;  2ZHM A;  3LSD A;  4XHX A;  1PZ8 A;  2PAK A;  5CG9 A;  2WNE A;  3MDP A;  5F5A A;  4W65 A;  2YY1 A;  2JG9 A;  4XMA A;  1DYK A;  4S2F A;  2RR1 3;  2YZ4 A;  2VZS A;  3GJA A;  5FZO B;  5LK5 A;  1I5Z A;  4C1W A;  4EZH A;  2HWE 3;  1OA4 A;  2VUA A;  3ACG A;  3ALQ A;  4NRQ A;  4XXP A;  1CD3 G;  4HSL A;  1RUF 2;  2IXK A;  1OBN A;  3SHR A;  2YDE A;  4IV1 B;  5E1R A;  2CGN A;  1K12 A;  3CIH A;  1UW8 A;  1MS9 A;  1NCQ C;  2O14 A;  4K9S A;  4R8H A;  5AVP A;  3OYW A;  1IPK A;  4YGC A;  5JDB A;  3M3I A;  4LBQ B;  3RDI A;  1VR3 A;  3OBZ A;  2C26 A;  2HEY F;  2X53 S;  4LBN A;  5AFB A;  1W6O B;  1WZX A;  3HT2 A;  4IGO A;  5CB7 A;  5CFC A;  5IVB A;  2WFF 3;  1D7P M;  3A0N A;  5I0S A;  1DP0 A;  2KA3 A;  3HN3 A;  2CDP A;  4D69 A;  3UV9 A;  4Z2A A;  1PO2 3;  2J1E A;  1KEX A;  3DEC A;  4PIX A;  2QQL A;  2P3K A;  2ZGN A;  5IVY A;  3SEP A;  3AP5 A;  3V56 A;  3AYD A;  4EN9 B;  1UY1 A;  2VUD A;  3H3U A;  1JOP A;  1Q8Q A;  3HAG A;  1CJP A;  2H6B A;  3ILN A;  4M0N A;  4Y33 A;  5EP9 A;  2Y0O A;  1C4R A;  2B4K A;  3OGS A;  1I3H A;  1VBD 3;  1WMX A;  5FMD A;  4RGK A;  4EN8 B;  4ES9 A;  2W47 A;  2BJS A;  3LF7 A;  2PLV 2;  2ZX2 A;  5FZ1 A;  3M3C A;  3LPG A;  1MEC 2;  4E9K A;  3V0B B;  3SLI A;  2R49 A;  3NRU A;  3B93 A;  3CKH A;  3L2Y A;  5FZF A;  4PF1 A;  4DUX A;  5FZ4 A;  1MQT C;  5KBF A;  2R06 1;  2W2I A;  3J26 N;  3WDT A;  4HAN A;  3LFI A;  3TWI A;  3NNF A;  1O4T A;  5A6Y A;  4AFA A;  1O4Z A;  4RHV 1;  1QJF A;  3VLB B;  2VUL A;  1HLC A;  4XUN A;  1PO1 2;  4D94 A;  5FZK A;  3UNP A;  4O7X A;  1YQ5 A;  1GKB A;  4GUL A;  4Q2F A;  3GZU C;  1NAE A;  2DBI A;  1D0G A;  2BTV C;  1WLW A;  2CGP A;  1W3X A;  2QKD A;  3OD4 A;  2CWS A;  4CU6 A;  2W46 A;  5F8P A;  4AFM A;  1C5H A;  2GN7 A;  2LTN A;  1DCS A;  2QE3 A;  2RS3 1;  4LNV A;  2UWA A;  3UGG A;  1WKY A;  3HQU A;  5FFO C;  2A6W A;  4QT6 A;  1OA3 A;  1X8E A;  3K48 A;  4AVS A;  3C7H A;  4XJW A;  2FD8 A;  2XHN A;  3R0R A;  3BU0 A;  4BOW A;  5EYX A;  2D43 A;  4XTM A;  1V6L A;  2QZ3 A;  1AR9 1;  5I0R A;  2BRT A;  2VCB A;  2DUO A;  2ZGM A;  4WM8 B;  1GFF 2;  1S4C A;  2YC2 A;  4HVO A;  5C3S A;  2PHX A;  3ZO0 B;  4F8A A;  1W8F A;  2BGC A;  4XFH A;  2RS5 1;  4GH4 B;  4YG3 A;  3WF3 A;  2WT0 A;  4IV3 C;  4XUT A;  5C8W A;  1YXW A;  1UZY A;  2CWM A;  2VD7 A;  2C1F A;  2PHF A;  2XHK A;  5FYU A;  5FZL A;  2ZBJ A;  3PNA A;  4PHZ A;  2WL1 A;  2WAA A;  3Q8B A;  3WP6 A;  2GZW A;  1GWL A;  1NQJ A;  1STM A;  1RUD 2;  1WLD A;  5FK7 A;  5FYC A;  4YYO A;  4UFI A;  2R0H A;  3KSC A;  1RMU 2;  1SLI A;  2ZGS A;  4JQR A;  1UX7 A;  1XNT A;  2XOM A;  3LKJ A;  4FI9 A;  4RS5 B;  4CEW A;  2BGO A;  3AKP A;  1K42 A;  4QPW A;  2MEV 1;  3BB6 A;  2F4P A;  4U2A A;  4ARY A;  4SLI A;  2VCA A;  1H6Y A;  2BUK A;  2OPW A;  4CCC A;  4RQP A;  4YZ4 A;  4NRM A;  1C28 A;  1SPP A;  1UU6 A;  5DPN A;  4BXS V;  1AYM 1;  1JYX A;  4DO0 A;  3WNO A;  4A7K A;  1YUD A;  2Q8C A;  2XJV A;  1PX3 A;  5BNO A;  4YZ2 A;  4S2G A;  3V0B A;  2WO2 A;  3KT7 A;  1FYU A;  1AYN 1;  4IGP A;  4ZPI A;  1OVS A;  4DOU A;  4BWO A;  3VBR C;  2FQP A;  4XCB A;  3HT1 A;  4QGN A;  1RUD 1;  3WW3 A;  5CFD B;  1GBG A;  2Y33 A;  4HLT A;  3NNL A;  3KCC A;  2EIC A;  4XJA A;  2W68 A;  2X10 A;  4K40 A;  3ZN5 A;  1BHG A;  1N47 A;  2D3P A;  5L9V A;  3ZPY A;  2V5Y A;  4PI0 A;  3WLU A;  1Z7S 1;  4HG6 B;  5EZW A;  3LIH A;  3WDU A;  3TN9 2;  4RA0 A;  2WO7 A;  4CDW C;  4GQ7 A;  1OHF A;  2R1B A;  1CQ9 A;  2VZQ A;  2VJX A;  3KMH A;  4ZZ5 A;  2D7F A;  2ORX A;  2QQJ A;  1EP0 A;  2BWC A;  2MEV 3;  4Q1P A;  1W3V A;  4AEK A;  1MS4 A;  3GF6 A;  3JB4 C;  3LEM A;  2OQ7 A;  3HR9 A;  4N8M A;  4Y5S A;  4CDQ B;  4COW A;  2A1X A;  3VL9 A;  1LOF C;  2J1S A;  4IV1 C;  4QPG A;  1V9U 1;  5A1L A;  2ZZJ A;  3GZE A;  1SHW B;  3G7D A;  2CGO A;  4LLF A;  4G9S B;  2PN5 A;  3WP5 A;  3W5M A;  5BNN C;  4PIY A;  1UYZ A;  3TAY A;  3WCS A;  2WKK A;  3O1P A;  3GZA A;  4WV8 A;  1S0F A;  3Q8F A;  3ZDV A;  1YNA A;  2BDR A;  1EUT A;  2IXJ A;  4YW5 A;  1COV 1;  4Q0P A;  2W1W A;  3E6C C;  1WGP A;  3AYA A;  1ZA7 A;  5FYZ A;  3WV6 A;  1D4M 3;  1VRB A;  1XSR A;  3N9Q A;  4BQW A;  2BBA A;  2QUO A;  3Q8A A;  3J8F 1;  4MGY E;  4HK9 A;  1PX4 A;  2GND A;  2ZHL A;  3RQ0 A;  2VBB A;  3MPB A;  2YG0 A;  1ENR A;  5FWJ A;  3PLQ A;  5ACA 2;  4AE2 A;  1YQ6 A;  1Z7S 3;  2XVK A;  2WUH A;  5T5L A;  1S0B A;  1G9D A;  4XFB A;  1IS3 A;  4QKN A;  3VBR A;  4QD2 A;  4LOT A;  1RVF 2;  5JMO A;  3C7E A;  4Y22 B;  4ZKT B;  5FOJ B;  1PNG A;  1K5J A;  1QU0 A;  1RMU 3;  4MYE A;  1JUH A;  3GHM A;  3H3L A;  4LT5 A;  4LIU A;  1AR9 3;  2CHH A;  4HKW A;  3W9A A;  3M7A A;  3WDX A;  4NHK A;  4E4S A;  3WF4 A;  4CEY B;  4CP1 A;  4CDW A;  3MW2 A;  1CPM A;  4ZU4 A;  5LY2 A;  3V64 A;  4N90 A;  2QQI A;  1BVV A;  2KR2 A;  1AL2 3;  4PT6 A;  1UY0 A;  2UWC A;  4KBZ A;  1J59 A;  4NN0 A;  2FDK A;  1VBA 2;  1W0P A;  1GQP A;  3RS6 A;  4W6W A;  1OPM A;  2YB7 A;  4LJH A;  2VZ3 A;  2IXC A;  2QQO A;  2Y6J A;  2A6V A;  3V0A A;  1BMV 2;  1C1F A;  2R1D A;  1VAL A;  2CU5 A;  2WZE A;  3IMM A;  1LEN A;  1D4V B;  2E7T A;  4YVS B;  4XFF A;  4QQ2 A;  1RTV A;  5L73 A;  3USU A;  4AFB A;  5FUI A;  2SLI A;  1H9P A;  3WY6 A;  3PTR B;  1GQH A;  4MUV A;  4OYU A;  1PM4 A;  3H50 A;  4JKL A;  4LA2 A;  3KF5 A;  4CEY C;  5JOY A;  2NP0 A;  1JN2 P;  2Y60 A;  2HWC 1;  4J1X A;  4LKF A;  3K4A A;  4KL1 A;  1NLQ A;  1XU1 A;  1VMH A;  3TRS B;  2ZEZ A;  3O1V A;  4CPB A;  2WFF 1;  1JZ6 A;  1CAW A;  2HWE 2;  2I2S A;  1ND3 B;  2ADE A;  4JTN A;  4FQZ A;  1NLR A;  5F32 A;  2RM2 3;  3ZYF A;  3ZR5 A;  5A3M A;  3T0A A;  1FV2 A;  4HK8 A;  1KDK A;  4BA6 A;  1FNY A;  1RMU 1;  4DIN B;  3U78 A;  2WN3 A;  5CIR A;  4NII A;  2HWB 1;  4JAA A;  2WC2 A;  3MEP A;  4NIA A;  1NXM A;  5IK5 A;  2EF6 A;  3VHR A;  1SLB A;  4P9W A;  3RNS A;  3B01 A;  1NUK A;  2XWB B;  2D6M A;  3D8C A;  4IEU A;  4YVW A;  2XJR A;  1HB1 A;  3DV8 A;  1T2X A;  2P6H A;  4AL9 A;  2HWF 1;  4FOV A;  1DYP A;  1WUV A;  3VHO A;  4AW7 A;  1Q56 A;  4X8N A;  2NQY A;  1Y4W A;  2P2K A;  2VXR A;  4ASL A;  2N7G A;  5HBA A;  3ORJ A;  2ARX A;  4Q0U A;  3LEG A;  1HRV 3;  3WT3 A;  3RZH A;  1RUF 3;  5A6Q A;  2QQK A;  2WFF 2;  2EAK A;  2J42 A;  4PF5 A;  2Q1M A;  1OLM A;  2KM2 A;  2W87 A;  4EWE A;  3I59 B;  4HON A;  2GSY A;  4DUV A;  1DQ0 A;  2JDA A;  1HJF A;  2A6X A;  1APN A;  1DIW A;  1QOO A;  3I2H A;  1OOP B;  1ZRD A;  2WA4 A;  2VOX A;  2ZA9 A;  1XNA A;  4JZR A;  4YM1 A;  1AR6 1;  5JXI A;  3LSE A;  1ND2 B;  1OQE A;  4LBL A;  3H7J A;  1POV 0;  1O3Q A;  4GH4 A;  4DZG A;  3KM5 A;  1YIF A;  4RGA A;  3CU7 A;  1QDC A;  1G6N A;  2ZHK A;  5DUU A;  3W59 A;  5KXE A;  3KT1 A;  3VD9 A;  2RJK A;  3PIG A;  3K2O A;  3SCF A;  4FPF A;  4CU8 A;  2YPJ A;  3OTF A;  1MQT B;  1UYP A;  2DCZ A;  4Q4W 3;  5BNN A;  4NOT A;  3VGI A;  2D93 A;  1HB4 A;  3WHT A;  4Z82 A;  4Y24 A;  3KD4 A;  2DFB A;  1G7Y A;  3E6B A;  1LHU A;  3AKS A;  2Y34 A;  4QGL A;  4YGB A;  3N9M A;  4CP2 A;  3RZG A;  3IDE A;  5I0U A;  1RUE 1;  4YZ5 A;  1NY7 2;  2VE1 A;  2JX9 A;  5KXC A;  3H3Z A;  3IAQ A;  2E53 A;  4YRD A;  1WA4 A;  1COV 2;  2Y6F A;  3N9L A;  2NLR A;  3VZJ A;  1YO8 A;  2Z5W A;  5LZ6 A;  1ZBE 3;  5CFD C;  1RUE 2;  1TMF 2;  4HXC A;  1J83 A;  3OOX A;  1R08 3;  1H2M A;  1PIV 3;  1PK6 B;  1MS0 A;  5KXB A;  4Z2W A;  1L7Q A;  1YHF A;  3Q9O A;  4NVP A;  2WNU A;  4X6Q B;  4YFW A;  5A1A A;  1RUJ 2;  5FDB A;  2W5F A;  3VBF B;  1TE1 B;  2ET1 A;  5J98 B;  1FNZ A;  4IQP A;  5A80 A;  3TN9 1;  3ZPO A;  4XIO A;  4WVV A;  5D8A A;  2W91 A;  5FMC A;  4CDW B;  3FBY A;  3VUO A;  5JXG A;  4OCT A;  2JKB A;  5ABJ B;  4A6S A;  5JPM B;  1RUJ 1;  1OPO A;  4LUK A;  1OLM E;  4DXS A;  1W2O A;  3RMX A;  5FJK A;  4O61 A;  2JDM A;  3P6B A;  5AVA A;  3AKQ A;  5HV4 A;  4N53 B;  2FMD A;  1A34 A;  2PAE A;  2XG3 A;  3ZFF A;  3Q8C A;  2IFR A;  3PME A;  4Q0S A;  3PVO A;  4COY A;  2ZEX A;  4R4X A;  4E8C A;  5FZH A;  4AEJ A;  5C8C A;  1G86 A;  3KV9 A;  3WDV A;  2BGP A;  1NA1 C;  1CAX A;  4COU A;  2W94 A;  4FOW A;  3VZL A;  3B5L B;  4XET A;  4LBQ A;  1TMF 3;  4K1Y A;  3ZYI B;  4CDX C;  2BNN A;  1SLL A;  1GSL A;  2VOV A;  3KQR A;  4JRA A;  3WF1 A;  4L92 A;  1IZ3 A;  1ULO A;  2WSV A;  3PHM A;  4KQ7 A;  4Q4Y 3;  2VOT A;  3I2K A;  4A42 A;  4QB2 A;  4MGQ A;  1DQ5 A;  2TEP A;  5A7Q A;  3C8X A;  5FZO A;  2HWC 2;  2DBN A;  1UY2 A;  2HWF 3;  5A6Z A;  1US3 A;  5I8T A;  1MAC A;  1BEV 3;  3N7L A;  1E5R A;  3N3H A;  4P9G A;  5DAP A;  4A3Z A;  3FZ3 A;  3I3E A;  1YEW A;  3OGR A;  3LDK A;  3POG A;  2DU1 A;  1QHD A;  2JDN A;  4NWW A;  5HCB A;  2JDP A;  3WNL A;  1S55 A;  1RVF 1;  2ZXQ A;  4AYU A;  5BNP A;  4FO9 A;  1OQ1 A;  4GIQ A;  2E63 A;  3NNM A;  3NNG A;  5FYY A;  4WBB A;  1VBB 1;  3FHA A;  5DAW A;  2ZMN A;  2E31 A;  2GP5 A;  1AJK A;  1RUG 3;  4FTS A;  1I6X A;  1UMH A;  1ND3 C;  5TSW A;  3T09 A;  1XE7 A;  1F2N A;  4AHW A;  3PUR A;  3GCX A;  3LA3 A;  4QXC A;  1WCQ A;  2IXI A;  1PGW 2;  2OVU A;  2Y6L A;  3O1O A;  5T55 A;  4RS5 C;  5ANQ A;  1NT0 A;  1QJU 1;  5C7G A;  3T2P A;  4I09 A;  1ULD A;  2JWP A;  2PHD A;  2XL9 A;  2W1Q A;  4RSU A;  2JEN A;  5E8A A;  1IPS A;  3JD7 3;  1IQD C;  1BBT 3;  3RGB A;  4P08 A;  2ZOE B;  1ST8 A;  2ZGR A;  5H9Q A;  1O6U A;  3B02 A;  2WQ8 A;  3ZSK A;  2EIE A;  1A78 A;  2E51 A;  1N1S A;  1FPN 1;  1BEV 2;  2AAC A;  5FCC A;  5FYT A;  2WFP A;  3J4U H;  4HN0 A;  2VBP A;  4Y1Z A;  3ZKU A;  3AFK A;  3CJI A;  1W6Q B;  4L0P A;  5DDJ 1;  1CAX B;  3MHZ A;  2QJV A;  2G9G A;  1N3Q A;  4A45 A;  4D7Y A;  5GAL A;  3J7H A;  4V1P A;  2LS6 A;  1CZV A;  3MIE A;  5CKQ A;  1FMD 3;  1HB2 A;  2VNG A;  4XDP A;  5LA9 A;  3RWN A;  4OZO A;  1VB2 A;  2NM1 A;  3P1I A;  5BPX A;  1ZYB A;  2WDB A;  3LEK A;  3U4S A;  3PTY A;  1ND2 C;  3T30 A;  2D44 A;  1QNW A;  4BDV B;  2P3J A;  5FZG A;  5JUV A;  5LBC A;  1TNR A;  2XKP A;  4BK5 A;  1OUR A;  1UYY A;  4ISQ A;  3ZFE A;  5CFC C;  4MVT A;  1DQ6 A;  3CJI C;  5C70 A;  4UAP A;  1TZO A;  4ITC A;  4ATE A;  4CDX B;  5LEK A;  4BE3 A;  2RDS A;  1PIV 1;  4DIQ A;  3DPR C;  4XFI A;  1D0H A;  1FOD 1;  4IET A;  1W8Z A;  2FDF A;  2JIC A;  3OJB A;  1REE A;  4JQT A;  1H2L A;  4UF0 A;  2IFW A;  1OLQ A;  3H9A A;  3WQ7 A;  1Y9M A;  3HN1 A;  2HYX A;  1ZRR A;  1TQ5 A;  2ZHN A;  3GDB A;  3MYX A;  4NR1 A;  5FRE A;  4AVC A;  4I01 A;  4WM8 A;  2A73 B;  3ETP A;  2BBV A;  5LBE A;  1W9T A;  3A4U A;  5HI0 A;  1U5Y A;  5CEH A;  4AG4 A;  2ERF A;  3FFZ A;  3THC A;  5A70 A;  2NN8 A;  5DQ0 A;  4YG0 A;  1VMJ A;  1TEI A;  4E8D A;  2B45 X;  3ZSL A;  4IW3 A;  4GKY A;  2HEW F;  3ZFG A;  1V6M A;  2HWE 1;  4QKD A;  1LJ7 A;  4N7I A;  1HB3 A;  3AB0 A;  4AR2 A;  2QCS B;  1HQW A;  1LTE A;  3NQH A;  2Y6K A;  4AAX A;  4XYX A;  1PK6 C;  5FK8 A;  2BQP A;  4AI8 A;  4L99 A;  1MZ6 A;  3NO8 A;  1OH3 A;  4CXW A;  5LBB A;  2GAL A;  1MZF A;  2J22 A;  4AED A;  2WYF A;  4L8Q A;  4AVB A;  1FI2 A;  3AL5 A;  1OI6 A;  1RXF A;  3PJQ A;  2GNB A;  2VAU A;  3VDD B;  1XSQ A;  4XF9 A;  3PVB B;  4H14 A;  4AGV A;  1AL2 1;  5FY1 A;  2VC9 A;  2D98 A;  5FY8 A;  4C91 A;  4O9E A;  5BNO B;  1DYO A;  3WX5 A;  5JLV A;  5A3O A;  1PO2 2;  2B8M A;  2Z79 A;  2WQ4 A;  3AC0 A;  4GWN A;  3ACI A;  3NMB A;  5JMC A;  4XVH A;  1OOP A;  3JBG 2;  1Q8V A;  4YW2 A;  3FFQ A;  1DG6 A;  5F6K A;  1KQR A;  1TG7 A;  1K45 A;  4RD7 A;  2B7Y A;  3ZN6 B;  5C8C C;  1AYN 3;  4CU7 A;  3OGV A;  1NYW A;  4DNY A;  2XVG A;  1YWK A;  1DF0 A;  2VUJ A;  2P37 A;  2EIG A;  2RR1 2;  2DTY A;  2ZPX A;  4GB3 2;  3AL6 A;  4JV4 A;  4E2S A;  2RMU 1;  4EJR A;  3VD5 A;  3T3Y A;  3SIT A;  4FSJ A;  4QDQ A;  2OKX A;  4JTO A;  1UKG A;  2R04 2;  3VBF C;  4JGZ C;  5FY4 A;  4NUB A;  1FXZ A;  3LDB A;  5JPN B;  2ZZQ A;  5T3N A;  1W2N A;  3QH6 A;  5KR7 A;  1NKG A;  4UFH A;  4NRP A;  1B35 C;  1ZX5 A;  2XLG A;  2WNV C;  3QH7 A;  1BLZ A;  2V72 A;  4LIT A;  3H0O A;  4EYU A;  4WVZ A;  4LBQ D;  1QJY 3;  3WEZ A;  1O59 A;  3URF A;  3ETQ A;  2QTW B;  1GV9 A;  2DVA A;  2V4A A;  4IDZ A;  1X33 A;  2YBK A;  3WF2 A;  1FX5 A;  1HV1 A;  1UOJ A;  1GIC A;  2BW8 A;  1BJQ A;  5LRR A;  3DL3 A;  4RL7 A;  4QM8 A;  3ZVX A;  3U4X A;  1SBF A;  2FDJ A;  3OCP A;  1QJU 2;  3ZYB A;  2DCJ A;  1NY7 1;  1ZM1 A;  1PZ9 A;  4LR4 A;  4YNI A;  1R09 1;  2K2S A;  4HKO A;  1NCR C;  5F3I A;  4IEV A;  2VMH A;  4LMF A;  1HRV 1;  4CUB A;  4XW3 A;  3I2G A;  1JMU B;  4LBO A;  1J1T A;  1PMI A;  3IDC B;  5FY0 A;  4D0Q A;  3ZIW A;  4Q0Q A;  1NZI A;  2RG4 A;  3RZL A;  4K8F A;  1W2U A;  4CU9 A;  5KXD A;  5CYY A;  2HYK A;  1JYW A;  1Y9Q A;  5LAS A;  2EVX A;  2EXI A;  3FJS A;  5DZG A;  2CV6 A;  1SCS A;  1H4G A;  2RMU 3;  3CLP A;  1LOG A;  4MGT A;  3MLJ A;  2OQ6 A;  4WVM A;  3H8R A;  1RUC 2;  2SBA A;  3CMG A;  5FO8 B;  1QXP A;  3R05 A;  2ORZ A;  2H0B A;  3KLS A;  1OVP A;  4NRO A;  3K77 A;  1NCR B;  4K3U A;  4XHB A;  5L9R A;  4BU2 A;  3CJX A;  3MW4 A;  1QJY 2;  1GQG A;  3OY8 B;  4HN1 A;  4A2U A;  4C0H A;  2Q8O A;  3I3D A;  4LOS A;  4AQS A;  4Y4Y A;  4WVW A;  1O91 A;  1V6K A;  1AHS A;  3IMN A;  2P34 A;  3ZIX A;  4NID A;  4QX8 A;  3SCH A;  2OUH A;  3NV1 A;  3T4H B;  3OY8 A;  2ZX0 A;  2ES3 A;  2WJS A;  2JEM A;  4Q4Y 1;  1PGW 1;  2AEN A;  3AZY A;  4FQ4 A;  5HCH A;  4B7E A;  4XE9 A;  4NIH A;  4WVM B;  5J1X A;  1H8T B;  2JE9 A;  1EV1 1;  2ENR A;  2VG9 A;  1XJA A;  5FQ0 B;  3D4K A;  3BI3 A;  4EZ4 A;  1UIK A;  3LPF A;  1QNY A;  4CDU B;  2WT2 A;  3PJY A;  3TB0 A;  2LRO A;  4JKM A;  1Y3T A;  4FPY A;  3H7Y A;  4IE6 A;  5FZ8 A;  4XXA A;  5LA2 A;  5CAZ A;  4KGG A;  3I7D A;  1LHW A;  2V73 A;  4I0A A;  1OC1 A;  4OVE A;  3DKQ A;  5GLU A;  1B35 B;  1V9U 3;  5L19 A;  5DDJ 2;  3ZLI A;  4Q27 A;  1KJR A;  3OEB A;  4HVQ A;  4Y5Z 0;  4KBB A;  4LO7 A;  1LKN A;  3PDQ A;  1YYN A;  3U07 A;  4CZS A;  1H8T C;  1SFN A;  2CL2 A;  2P17 A;  2ZX4 A;  3K3O A;  4FCA A;  4Q4Y 2;  4XJ8 A;  3ZMN A;  4AI3 A;  4V2V A;  1VBE 2;  1COV 3;  4R4Z A;  4XAB A;  5EWS A;  4DEV A;  5CNA A;  3B7M A;  4R9C A;  4K7J A;  4AFD A;  4MOA A;  3AM2 A;  4MSV A;  2YC0 A;  4AQ6 A;  5IK8 A;  4ZXE A;  2ARA A;  4MET A;  4JGY B;  5IVE A;  1MVQ A;  1WW4 A;  5M0T A;  4UFK A;  2A6Y A;  1H8V A;  1O5U A;  4UYB A;  1ZZ6 A;  2H0V A;  2VW0 A;  4OUM A;  3VHN A;  2LUW A;  3T4V A;  2AYH A;  1I5P A;  3E5X A;  3WZ1 A;  1JZ7 A;  4LA3 A;  1JYI A;  2UYB A;  4W50 A;  1SMV A;  2Q1F A;  1YI9 A;  3UJO A;  3JCI A;  4OHZ A;  1TVG A;  1OT5 A;  3CEW A;  5FYM A;  1WCU A;  2BP6 A;  1X9T A;  5T54 A;  2BOJ A;  2WNV A;  3S30 A;  5LA0 A;  1B35 A;  2VY0 A;  3RFR A;  1W8U A;  4LLO A;  5K0U C;  2EAL A;  1NA1 B;  4NO4 A;  4KMQ A;  4O9G A;  4RFT 0;  4NIG A;  3O1T A;  1L7R A;  4GMP 1;  1UN1 A;  4I30 A;  2QQV A;  4BLJ A;  4RYD A;  1GP5 A;  3THT A;  4ARX A;  2ZMK A;  4OI2 A;  3TYJ A;  1V6O A;  4MX3 A;  4C90 A;  3E5U A;  4I2O A;  2A71 A;  2I74 A;  1JH5 A;  3WCR A;  5IVJ A;  3AP6 A;  1MPX A;  2HBT A;  1ZRF A;  2Z69 A;  4QKB A;  1X82 A;  1H30 A;  1FV3 A;  3ACF A;  3N7M A;  3HBZ A;  4XF3 A;  3JD7 2;  4OQ8 A;  1OUS A;  1VBB 3;  1X9P A;  1KIT A;  2NMO A;  3ASI A;  1SAC A;  5A7N A;  3DYM A;  1E5I A;  5F37 A;  4HSJ A;  1U5I A;  2PHL A;  1WLT A;  3WG2 A;  4EV0 A;  2XJU A;  4OUL A;  1AZD A;  1VBD 1;  1XRU A;  3AKT A;  5LY1 A;  4QXH A;  5JAX A;  5KHK A;  1N1T A;  1CZT A;  4YVS C;  5I8Y A;  2UY8 A;  3BOW A;  3FLR A;  1W6P A;  4HPK B;  5B4N A;  1LHO A;  2KXL A;  2PHW A;  2DUQ A;  1QXR A;  2BWA A;  3VBS B;  1GP4 A;  1XNB A;  2BER A;  2HH9 A;  4YM2 A;  3C7G A;  4RFR B;  3OPT A;  4RHV 3;  4LKS A;  2GME A;  1F5F A;  3IAP A;  2W92 A;  5SV8 A;  4QPI B;  2OX0 A;  2VVD A;  3NV3 A;  3WDW A;  3DPR B;  3BOD A;  3MUZ 1;  4AQ2 A;  1J3Q A;  4KU7 A;  1S0I A;  2XB6 C;  5L7O B;  1O3R A;  5GZG A;  4JDO A;  3NJY A;  2LAL A;  4M4P A;  2RR1 1;  3F95 A;  3O1R A;  4EN0 A;  5FO7 B;  1GNZ A;  4N53 A;  4UT5 A;  2YUE A;  3ZXA C;  3JBG 3;  4DXT A;  1NCQ B;  1H4H A;  3N4M A;  4JDN A;  1JHN A;  1VBB 2;  1NX9 A;  5CA6 A;  2Y6H A;  4LK6 A;  1YI7 A;  4YLZ A;  3POY A;  1DLL A;  4IXL A;  3WD5 A;  1V6N A;  2GC1 A;  4NAM A;  4OI1 A;  1SQ4 A;  1Z78 A;  4GAZ A;  3ZYG A;  1H6X A;  1TME 1;  3I59 A;  3KHB A;  4URA A;  4IE0 A;  4ZU7 A;  1OH4 A;  1UIJ A;  3BTX A;  2PEL A;  4P5H A;  2J1T A;  3FUQ A;  5AC9 1;  5KC6 A;  2JB8 A;  3ZXD A;  4WM8 C;  2XXZ A;  2GU9 A;  3K46 A;  2OII A;  4JCK A;  4MXV A;  2WZR 2;  5JCT A;  5JZG B;  1AL2 2;  2EAA A;  3PVE A;  5D1I A;  5F9T A;  4XUR A;  1ONA A;  4LE3 A;  4QXB A;  5CIS A;  1LGB A;  4AI2 A;  1QXJ A;  4QQH A;  2JIG A;  2VZP A;  3DPR A;  2WWS A;  1XXN A;  4GWJ A;  2OA2 A;  3U1X A;  3D0S A;  4OHV A;  5FMO L;  4WZC A;  3RYR A;  2R30 A;  1PO1 3;  5F5Q A;  4AK3 A;  1ZZC A;  4ZHN A;  1NQD A;  4I3G A;  1F8V A;  3RI8 A;  3OEA A;  3ZX7 A;  5BNO C;  5HV0 A;  2ATF A;  1RUJ 3;  3DKW A;  3IKW A;  1ASJ 2;  3BU7 A;  4XDQ A;  2BPA 2;  1KDM A;  2IXH A;  1ZZ9 A;  4CDQ C;  3WNX A;  1G9F A;  5ACA 1;  5FLI A;  2CSG A;  1GOH A;  5F2S A;  3RJR A;  3WQB A;  3LOI A;  1UWW A;  3MF9 A;  3ZN6 A;  1VBA 1;  4KWJ A;  1AYM 3;  3VL8 A;  1JOD A;  5F3C A;  4Y1Y A;  1D4M 2;  1YFX A;  4LXL A;  3RI9 A;  4KG8 A;  3EQE A;  2DDU A;  3U10 A;  3U75 A;  3LGR A;  5I0D A;  5FP8 A;  1QOS A;  2E26 A;  1W6O A;  4HL0 A;  5L9B A;  1QH7 A;  1YC6 1;  4CRQ A;  1I1E A;  2JD4 A;  2QDR A;  4D7S A;  3VBH B;  2C24 A;  4XUP A;  2VZO A;  2ZX3 A;  1YIP A;  5ERL A;  5T5O A;  3WXP A;  1DHK B;  1OUX A;  2LRP A;  1UKR A;  3VKL A;  1DDL A;  1A3K A;  4LK7 A;  1RC6 A;  2IWG B;  3MUY 1;  2Q4S A;  2VL4 A;  2YFZ A;  3J9S A;  4QPI C;  3BN6 A;  3B00 A;  1F4A A;  1UPI A;  1EAH 1;  4K8R B;  5LAT A;  4ERO A;  1F4H A;  1S0D A;  4P9X A;  2A3X A;  4PDW C;  1RXG A;  5BYN A;  1BEV 1;  3S6P A;  3BOP A;  2RDQ A;  5C71 A;  3WNK A;  5I91 A;  2O8O A;  4KH9 A;  1J84 A;  3C3V A;  4NJ4 A;  4Q8K A;  1Y9G A;  3OF1 A;  1XC6 A;  5LA1 A;  1S2K A;  3USS A;  3LQC A;  2DCT A;  1DGW A;  3ZFG B;  4BQY A;  3AYC A;  5I0T A;  5K4L A;  2G9F A;  3W5N A;  3AZV A;  2PQQ A;  3SH4 A;  3OGG A;  1UD1 A;  3I3Q A;  5JR2 A;  5LEJ A;  1RUH 3;  4A4A A;  5JSR A;  1ACC A;  2VUC A;  3E1F 1;  2XVL A;  3INA A;  3POS A;  4EN6 B;  1G9C A;  4LHS A;  2PQS A;  3O1S A;  4PDW A;  1F15 A;  2GMP A;  1IHM A;  2WLP A;  2F6B A;  4BK4 A;  5J7M A;  5JXH A;  4Q0V A;  3BIE A;  1XQN A;  1OQD A;  2VZU A;  3VDD C;  1CAV A;  2WR9 A;  1QH6 A;  3VBU C;  1VPH A;  3RZK A;  2C9K A;  3BIW E;  2MNG A;  3T2O A;  1ODN A;  2B9U A;  5GLW A;  2VMG A;  2R6Q A;  4IEZ A;  3H42 B;  3I2O A;  2FDH A;  3CHX A;  4CDX A;  1CGP A;  2VMD A;  3MV0 1;  4TLF A;  4IES A;  1XE0 A;  3H8U A;  5JSP A;  4CUA A;  4QDR A;  1FPN 3;  1KJL A;  3D5O A;  1WCD J;  1AUY A;  1JHJ A;  1S0C A;  3MF6 A;  2JB4 A;  5DAX A;  2WT1 A;  3AVS A;  1EAH 3;  4FFG A;  5E16 A;  3VDB A;  4GWI A;  5A3L A;  1VAK A;  1SCR A;  4FPK A;  5C33 A;  1GMM A;  3USU B;  4CDU A;  1QJX 2;  4N43 B;  3AX4 A;  2OXB A;  4COZ A;  2Q8D A;  3SC7 X;  5IAT A;  1K3I A;  3I2J A;  3WSO A;  4OUS A;  5FKC A;  1G9A A;  4LHN A;  1RUG 2;  4AFC A;  1RED A;  1CON A;  4N43 A;  4QDS A;  2FMY A;  3D3A A;  2ARB A;  3IDB B;  2D6K A;  4ISR A;  4TTG A;  4NPL A;  2RDR A;  3N7K A;  3N9N A;  4D8M A;  1RJ8 A;  3AFG A;  1F31 A;  4QGM A;  5JOZ A;  4FTB A;  2AGS A;  1JYN A;  2WAO A;  5FAX A;  5FZ9 A;  1C5I A;  3KS7 A;  1V70 A;  2NPI A;  4PIZ A;  4UBG A;  1ZRE A;  2GDF A;  4Y3O A;  1HKD A;  3LA2 A;  5E88 A;  3QOP A;  2GAU A;  4A41 A;  2YV8 A;  4YZ1 A;  1ZVF A;  3CL1 A;  3ON7 A;  1V9U 2;  2NZ9 A;  1PGS A;  3ELN A;  4LTA A;  2Z2S B;  3A0K A;  5CFD A;  1UU4 A;  4XUQ A;  3UET A;  2R7E B;  1RHI 2;  4XZP A;  1HDK A;  1Q8O A;  1XE8 A;  1PVX A;  2WZR 1;  4CVU A;  4Q5O A;  3KCX A;  3LDR A;  4NMI A;  1PGL 2;  2G19 A;  3O0X A;  2VO5 A;  3IPV B;  3M8L A;  1AJO A;  1ZRC A;  1ASJ 3;  4PBO A;  4DS0 A;  1RGS A;  1V0A A;  3EXU A;  3BKZ A;  3I97 A;  4FPE A;  3JXS A;  1LU2 A;  1LGN A;  3BTA A;  1W6N A;  4RQP B;  1Q8P A;  1QWR A;  3LEI A;  3UYJ A;  3PUI A;  4AGG A;  5EJ3 A;  2A70 A;  4XJU A;  2C4X A;  2OZJ A;  2YRO A;  4FXK B;  1PVC 3;  2E7A A;  4L11 A;  4Q1R A;  3MID A;  3WP3 A;  1KS4 A;  5BV6 A;  5FTT C;  2XJP A;  3OUH A;  4H55 A;  4MH0 E;  1RL3 A;  2J1U A;  3P3N A;  1VRH 3;  4MXW A;  3NNJ A;  1W9F A;  1WBL A;  2VQA A;  2JXA A;  3FLP A;  3P5B A;  4P14 A;  1FMD 1;  3KGZ A;  4MG2 A;  1HRI 1;  1WA6 X;  5APA A;  3EJK A;  4FPJ A;  3WR0 A;  3VBH A;  2O0O A;  3A22 A;  4I0W B;  4N9I A;  4YVW B;  2DU0 A;  4G4F A;  3PVN A;  3VN4 A;  4UFM A;  2VTX A;  4V2W A;  3GHN A;  4YM0 A;  2CTV A;  5FZM A;  1UOF A;  2EXJ A;  3ZXL A;  5FZI A;  4B1M A;  1AXY A;  1C8M 2;  4LUM A;  5CVR A;  3TEY A;  2EXH A;  4QHZ A;  1BVP 1;  2W95 A;  3ZSM A;  3MLL A;  5EJZ B;  5G05 L;  3THD A;  4WM7 C;  2W39 A;  3A23 A;  4UBH A;  3VB9 A;  3NAP A;  4DPN A;  1PZ7 A;  5KHI A;  3LIG A;  3OD0 A;  4LE4 A;  5T5J A;  4CCE A;  3V65 A;  1WWY A;  4E4Z A;  4XQ4 A;  1Q5O A;  2MHF A;  4Y1V A;  2VMC A;  4YVW C;  2R32 A;  3N9P A;  1LU1 A;  4CPB D;  4FXG B;  4RHV 2;  4D6Q A;  4DB5 A;  2YFU A;  5CBL A;  5IAX A;  3IDA A;  5IVC A;  2CNA A;  4TWT A;  1PMJ X;  3GNE A;  2C9A A;  5FO9 B;  4FAH A;  2CYF A;  3SIS A;  1ZNP A;  1RIT A;  2ZGT A;  1ULE A;  4J1W A;  3O5S A;  4M3C F;  4NHL A;  2YBS A;  2VPV A;  3OG2 A;  4IE5 A;  1YFY A;  2PLV 1;  1H2N A;  4CCJ A;  5BXX A;  1C8M 1;  4Y20 B;  4M0H A;  4FT8 A;  2BVV A;  3L9J T;  5KHG A;  3HPN A;  1FT9 A;  1MS1 A;  1QJX 3;  2K46 A;  1JU3 A;  2FCT A;  2RS5 2;  2ZAC A;  3D82 A;  3EYP A;  3KQ4 B;  4AED B;  1T6G C;  2WS9 2;  5FYS A;  4OI0 A;  2I07 B;  5I93 A;  4ORF A;  3HIF A;  4FP2 A;  2ET7 A;  4LHK A;  5J3U A;  4KWK A;  4UFL A;  1QQP 3;  1ZBA 1;  3GXU A;  1CVN A;  1TME 3;  3O1M A;  2YPD A;  4GB3 3;  4JX0 A;  5A7O A;  2AC1 A;  1G9B A;  1RJ7 A;  1D2S A;  4BLI A;  3NAP B;  2ZEW A;  5L36 A;  1H1A A;  4Y22 A;  1RUI 3;  4I3P A;  2R04 3;  2O1Q A;  1GAN A;  1LAJ A;  1C57 A;  1W39 A;  4QU1 A;  4HBN A;  3VD3 A;  3IIA A;  2WBK A;  1BCX A;  5AFE A;  4J25 A;  5H9R A;  4NE9 A;  1WD3 A;  3KVB A;  1VJ2 A;  5JR7 B;  2FZ2 A;  3H1M A;  1XOY A;  4PLN A;  1CJD A;  4LIV A;  2JG8 C;  5GJ6 A;  5C4W A;  1GZT A;  3NJZ A;  1PO1 1;  4DEQ A;  4TZD A;  1JBC A;  5DAQ A;  3FN9 A;  4B8E A;  1W6P B;  1S0E A;  1W8N A;  2ZX1 A;  4HPK A;  1SBE A;  4XJZ A;  2D6O X;  2V09 A;  2CAU A;  3ZR6 A;  1ZBA 2;  4R9B A;  5FXV A;  2AR6 A;  4LPL A;  3ATG A;  2RS3 2;  2F4L A;  5F39 A;  4B7K A;  3R4S A;  2W0X A;  3ILR A;  2XON A;  4PJY A;  1CES A;  4CCN A;  2LM3 A;  1AR7 3;  4OMD A;  5C3Q A;  5CKN A;  1BK0 A;  5FWE A;  4WZF A;  4EN7 B;  1PNF A;  2ZS6 B;  1L3J A;  3B9I A;  4COV A;  3TEZ A;  3MGU A;  3RJ2 X;  3AVR A;  3BUC A;  3OBR A;  4FFH A;  4Q4V 3;  2HWF 2;  1CIY A;  3QCW A;  1UO9 A;  5F7U A;  1AL0 G;  1OA2 A;  4M4R A;  2E7Q A;  2VTX J;  3HMY A;  3WQ0 A;  4X8P A;  1W6Q A;  3D6E A;  2DUP A;  1Z0H A;  1V00 A;  4AVT A;  2GP3 A;  1PGL 1;  2A3Y A;  3AMN A;  1DGR A;  4FPL A;  4XF4 A;  3GBF A;  2VNO A;  4SBV A;  1POQ A;  3WDY A;  3AZZ A;  1DFQ A;  2RV9 A;  3BVC A;  1DGW X;  2HLE A;  3POF A;  4OQ9 A;  1O5L A;  3M2M A;  5JI9 A;  1UNB A;  2VEC A;  2VVF A;  3DF0 A;  3MI8 A;  1W03 A;  2FCU A;  2JDU A;  4HT1 T;  3VHP A;  2ZGO A;  1U12 A;  3KF3 A;  5FUP A;  2GH8 A;  2X5I A;  3LZZ A;  1PVC 2;  3EBR A;  3MIG A;  1JYC A;  5JI7 A;  3S7E A;  1ZRI A;  5BUV A;  2LW8 A;  1W2T A;  4ASK A;  3RSJ A;  2G4I A;  2D40 A;  1AR7 2;  3PUS A;  3OBA A;  4R52 A;  5CAD A;  1AYM 2;  3WG4 A;  1NG0 A;  4YG6 A;  3W21 A;  4KWU A;  1LOB A;  1X8M A;  5FIX A;  5FR3 A;  1FMD 2;  1W9Y A;  2VH9 A;  1CPN A;  2A3W A;  1AR8 1;  3S7I A;  3UJQ A;  3E97 A;  5DXD A;  5JZG C;  1EY2 A;  2Y26 A;  2RDN A;  4IE7 A;  5SV5 A;  5BNP B;  4AXO A;  1H1M A;  1KFX L;  4AVV A;  4YWA A;  1W2A X;  1UXX X;  3FE5 A;  1AX1 A;  3LCP A;  2XLF A;  2R07 1;  3AMM A;  3H1Y A;  3UT0 A;  5JZG A;  5IW0 A;  2Y8K A;  4GA9 A;  4FFI A;  1QDO A;  3POW A;  4LO5 B;  2YHJ A;  3SKV A;  5F1R A;  1V6J A;  2YU2 A;  4NWV A;  4B4Q A;  3WG1 A;  1EUU A;  1CN1 A;  1K5M A;  1QY4 A;  2RS3 3;  2WN2 A;  3PUQ A;  2WZP P;  1MS8 A;  2BFU S;  3MV1 1;  4JGZ A;  5EPA A;  4CA9 A;  4UWD A;  3I2D A;  1W6N B;  1IKQ A;  2XPJ A;  5F3E A;  5AC9 2;  4E4H A;  5LW9 A;  3T2Q A;  2WZ8 A;  5LB6 A;  1P8J A;  1TMF 1;  3IZO A;  5HXV A;  1W9W A;  1YQC A;  4RQP C;  4WM7 B;  2X5I C;  3PU3 A;  5FYI A;  3IPV A;  2PHT A;  4AGR A;  3POJ A;  2PMW B;  4LO6 B;  5L7O A;  3LA7 A;  1H8T A;  1BMV 1;  4TN7 A;  1AVB A;  4PDW B;  1GZW A;  1A8M A;  3HEI A;  4AHY A;  4QX2 A;  1MS3 A;  5C3O A;  1D4M 1;  3ZYP A;  3NJV A;  1RUI 1;  4JKK A;  3NWK A;  1WMD A;  4BQ5 A;  2VNV A;  2JE7 A;  4MV2 A;  2YC4 A;  2VNR A;  1UY3 A;  1DGR N;  1X7N A;  1W9S A;  2BVB A;  1EPZ A;  4ZY9 A;  1LR5 A;  4Q26 A;  1ASJ 1;  5C3P A;  2Y6G A;  3FL7 A;  1ULC A;  5FPX A;  4TLG A;  2WAB A;  4FP3 A;  4DMI A;  1O7F A;  4MZU A;  1H1I A;  2VCC A;  5IK4 A;  2QQP A;  2Y64 A;  2F17 A;  4BB3 A;  3GBW A;  5GLZ A;  3WG3 A;  1EAH 2;  1ZZ7 A;  3B9C A;  3NV4 A;  4CYD A;  4QX0 A;  1PK6 A;  1QMJ A;  2XBO 3;  4D3W A;  1FOD 2;  1W8T A;  1S2B A;  3ME2 A;  5DZE A;  1OFS A;  2HBU A;  1OKQ A;  4A44 A;  1VBC 2;  2Y0I A;  4BQ2 A;  4X6R B;  3AMH A;  1SEF A;  3KT4 A;  3OUJ A;  1IGO A;  4JDM A;  5FUN A;  3ABZ A;  1UF2 C;  2XJT A;  4QQP A;  4XFC A;  3VDA A;  1NE4 A;  1JZ3 A;  1Y43 B;  5C4W C;  2G1M A;  1GNY A;  2RS1 2;  3A7Q A;  3MIB A;  5GKA C;  4CTE A;  5IFT A;  2QFE A;  4QX1 A;  1TNF A;  3AZW A;  2HWB 2;  3I8T A;  3MIH A;  4KGQ A;  5FZD A;  1SLC A;  1RUO A;  2JDY A;  4XBN A;  4YZ3 A;  5FJH A;  5FLH A;  3SH3 A;  4B29 A;  3M3Q A;  5FP7 A;  1Q43 A;  3AKR A;  4QB6 A;  1UCX A;  1MQT A;  3PL0 A;  4W4Z A;  5DZF A;  3VKO A;  4A3X A;  4DRV A;  4D6S A;  2YGM A;  1JOJ A;  1REF A;  1UOG A;  2W08 A;  5B2G B;  3E6D A;  3C7F A;  3AMP A;  2AZ5 A;  1V6I A;  1PIV 2;  1DQ4 A;  2OZ6 A;  2TNF A;  4Q4X 1;  3WW4 A;  4QX3 A;  1JXN A;  1ND2 A;  2I45 A;  2GC2 A;  5C8C B;  3ZXJ A;  4FBF A;  4DFS A;  1AF9 A;  4AI9 A;  3VBO A;  4M01 A;  1RIN A;  2W3J A;  3ES1 A;  3KGL A;  2JG8 A;  1VE0 A;  3DEM A;  4OUE A;  1YQ8 A;  4Y1X A;  2XUE A;  2V5D A;  3BPZ A;  2D6L X;  3HQR A;  3UGF A;  4CP9 A;  2UU8 A;  2E6V A;  2OPK A;  5F5C A;  3JU9 A;  4XUO A;  3RRD A;  1AR9 2;  1E5S A;  3ACL A;  5EYY A;  5IHR A;  4FPH A;  5K7P A;  3JQW A;  1KGY A;  1AR8 3;  1WBF A;  1MEC 1;  2JG8 B;  3AZX A;  1SFY A;  2E33 A;  4GXL A;  4K21 A;  2P4E A;  2XDV A;  2OW4 A;  5FZE A;  2XJS A;  2XML A;  4IEO A;  1NCQ A;  2WZR 3;  1VRH 2;  1W0O A;  3VBF A;  2Q1Z B;  2H6C A;  2P6C A;  2ZGQ A;  3BPS A;  1YCI A;  1R08 2;  4AWD A;  4CCO A;  3K3N A;  3GBG A;  5I8S A;  3VZO A;  2B9V A;  5JSO A;  1IPJ A;  1WCK A;  4S2D A;  1K5M C;  1XNK A;  5FQ0 A;  3IM0 A;  3VKN A;  5BNQ A;  3WNM A;  2TUN A;  1XU2 A;  3VD4 A;  2EID A;  1OKO A;  1UPS A;  1GYK A;  3ZMO A;  1NOV A;  3DGT A;  3VKM A;  2VBD A;  3IN9 A;  4FFF A;  4BIF A;  5LCW L;  4BMB A;  1NXD 1;  1ULG A;  2VZ1 A;  3JD7 1;  2DYC A;  3NKT A;  2D3R A;  3ZSE A;  5ISL A;  4XEZ A;  4DRR A;  2ZCW A;  1IKP A;  3ZDS A;  5ACA 3;  1XB9 A;  2R16 A;  2WLQ A;  3GCW A;  1CR7 A;  3KCY A;  1DBN A;  2Y38 A;  1VBD 2;  2ETE A;  4RGG A;  3MFC A;  4G3Y C;  1NE6 A;  2DCY A;  3BAL A;  4HFS A;  1QGL A;  1LES A;  4M3C B;  2QZ2 A;  3DCQ A;  4YGE A;  3NAP C;  1JTZ X;  5FMO S;  5KWR A;  4CSW A;  1IS5 A;  2YGL A;  2GNM A;  2NMN A;  4Y26 A;  2WNO A;  5FPB A;  3ZM8 A;  4Q4V 1;  4HET A;  4IE4 A;  4QX7 A;  5FKB A;  1L7L A;  1RUC 1;  3FHI B;  4Y5T A;  2VME A;  2AEZ A;  3TBD A;  1LEM A;  3R6S A;  3X29 B;  1J3P A;  1RUI 2;  1SLA A;  4UXA A;  1UZ0 A;  1HXS 1;  5E89 A;  3KVA A;  1R1Z A;  1G8W A;  1JYT A;  5C9A C;  5FPV A;  2XR4 A;  5FZ7 A;  5K8S A;  2BFU L;  1RUF 1;  1UAI A;  2XKO A;  4ONU A;  3TN9 3;  3ZYR A;  4LUL A;  2GH2 A;  4XTP A;  4YW4 A;  3WNN A;  3CBN A;  3RMY A;  1ULF A;  3FHQ A;  3NW4 A;  1O3T A;  3AJY A;  2Q8E A;  4AZZ A;  1OMI A;  4BM8 A;  5K0U B;  3B94 A;  4E27 A;  1XYN A;  4GZ9 A;  3NL1 A;  2WWJ A;  1GOG A;  2VVE A;  3CZU A;  4B1L A;  1HV0 A;  1HJG A;  2PHR A;  3OYW B;  4W8J A;  5DAB A;  2CAV A;  3IB3 A;  4PI2 A;  3ZXG A;  1RUN A;  1BKZ A;  2JDZ A;  3RWK X;  2J1A A;  1VB4 A;  2WNU C;  2ZGL A;  3IT8 A;  3MO4 A;  3OUI A;  3ZXK A;  4MXW B;  3RVH A;  4CCK A;  5CG8 A;  1X36 A;  2DV9 A;  3I3B A;  4LHL A;  4FOY A;  1JU4 A;  4HMZ A;  5ANN A;  5JVV A;  4LBJ A;  4GB3 1;  2PHU A;  3IWZ A;  4O65 A;  4UW3 A;  2AUY A;  2WRA A;  3FLT A;  5FZA A;  1N1Y A;  2GC3 A;  4QAW A;  5EHD A;  2X29 A;  5JWP A;  4YW6 A;  1LHV A;  1W28 A;  1R1A 1;  1NZC A;  3AP9 A;  2R04 1;  3III A;  4KWL A;  3T1M A;  4AVA A;  5FZ6 A;  3T2T A;  4H2A A;  3P3P A;  1IS4 A;  3J7N A;  5DUW A;  2WS9 1;  4LKE A;  4DXR A;  2ZKL A;  1VBE 3;  1GLH A;  4IV3 B;  3BTZ A;  5JIA A;  2PAM A;  1AR8 2;  4NAO A;  5A7W A;  2B46 X;  2K0G A;  4PBP A;  3MBW A;  1RUE 3;  4XBL A;  3VDC A;  2XUM A;  4M3C E;  5FMB A;  4Z07 A;  1JZ8 A;  2QVS B;  3ZSJ A;  3MFA A;  4BYY A;  1SDW A;  2VOK A;  4E4D X;  1LUL A;  3VDD A;  3I3M A;  3DXT A;  4Q4X 2;  1ENX A;  1H9W A;  1RVF 3;  4HZF A;  4P9Y A;  5KHH A;  1S2E A;  1HW5 A;  2NYY A;  2A7A A;  3WOG A;  4YPJ A;  3HJR A;  5DDJ 3;  1BXH A;  2JDK A;  4A7Y A;  4QMA A;  3OPW A;  4CDU C;  4GH4 C;  3OPZ A;  3MIF A;  4BQX A;  4XAA A;  5J36 A;  2V4V A;  3HOB A;  3QBQ A;  1VBC 1;  4XOG A;  5D21 A;  3RYP A;  4P9L A;  2XJQ A;  4AOC A;  2OUJ A;  3TNP B;  4J6G A;  3SKJ E;  5J37 A;  5FZC A;  2OT7 A;  3VZK A;  4W6X A;  5GLV A;  5FZ3 A;  5ABJ C;  2RS1 1;  2XL7 A;  3RG0 A;  2UUR A;  1LOA A;  3BYW A;  2GN3 A;  3J7M A;  2MEV 2;  3NVC A;  4MGZ E;  5LK7 B;  1VBE 1;  3SNM A;  2JE8 A;  2ZAB A;  1I9R A;  3DYO A;  1LEC A;  4IEY A;  4LO8 A;  3UKN A;  1MZ5 A;  4WM7 A;  3THP A;  5G04 L;  3H1W A;  2UY9 A;  4LBM A;  1T6B X;  4RS5 A;  4CEW B;  1LB2 A;  5GZF A;  5L7O C;  5GZE A;  1LOC A;  3AXD A;  2FZ1 A;  5ABJ A;  4XZU G;  5IK7 A;  5A1F A;  3TEX A;  1M4W A;  4Y4R A;  1MS5 A;  3ZFE B;  1S1A A;  5D8A B;  1O3S A;  2W52 A;  3FBM A;  3VBH C;  2PXJ A;  4BHP A;  2ZJC A;  2VW1 A;  4MAD A;  2HJI A;  3D0J A;  5FP9 A;  3GZT B;  2ILM A;  5BNP C;  1RUC 3;  4A7Z A;  1CZS A;  2X09 A;  1CAV B;  3ZFF C;  2DFC A;  2IXL A;  1N1V A;  1PHM A;  1SZB A;  4JHT A;  2VMF A;  3HQX A;  3M4F A;  4RR3 A;  5CU1 A;  2WIN B;  4CDQ A;  1RIR A;  2WWU A;  1B09 A;  2D5F A;  2ZAA A;  5E6H A;  3TNQ A;  1VBC 3;  3I49 A;  1Q3E A;  4HOO A;  4K1Z A;  1Y7B A;  4OI4 A;  4QPI A;  2RJL A;  4YM3 A;  4I0B A;  1UQX A;  2OS2 A;  1LOE A;  2R06 3;  1FOD 3;  4YAR A;  2UYA A;  3AMQ A;  4CXY A;  2A75 A;  4CUC A;  3IBM A;  5HXM A;  2D6N A;  2W1U A;  3M1H A;  1FAT A;  1F35 A;  3WNP A;  2IZW A;  4DY5 A;  2X5I B;  4Q4W 1;  3SQO A;  1BBT 2;  5LWB A;  5FXX A;  4IEW A;  5GLT A;  4BIO A;  3CQO A;  3T0B A;  1WME A;  3KHC A;  3ILF A;  2FCV A;  1YFU A;  4LOR A;  1GWK A;  3I2I A;  4XF1 A;  5BNN B;  5T5P A;  2JJ6 A;  1ALY A;  2RJ2 A;  4Y20 A;  1Q8S A;  1ULP A;  1VP6 A;  3WW2 A;  1BBT 1;  4C0B A;  2WA3 A;  3NV2 A;  1BQP A;  3O0W A;  2B5H A;  1RUG 1;  2A5Z A;  2EA7 A;  3POI A;  1GZC A;  4QKF A;  2JD9 A;  3AK0 A;  1CIW A;  1HIX A;  1R1A 3;  4QXK A;  4GMP 0;  1LHN A;  2BNO A;  3ES4 A;  1UYX A;  3GJB A;  5CKM A;  5A7W B;  3WHU A;  1SPP B;  2GC0 A;  3HWJ A;  2WS9 3;  4CUG A;  1WW5 A;  2BNM A;  2RM2 2;  1W8O A;  2ZGK A;  2WNV B;  1MR5 A;  3K75 B;  2BZD A;  3UK9 A;  1AR7 1;  5DG1 A;  4N43 C;  4M00 A;  4QQL A;  3SXW A;  3VBU B;  3JQX A;  3K4Z A;  2VQT A;  2WII B;  1LGC A;  4JC1 A;  1KXG A;  3A21 A;  1OFN A;  4IL7 A;  2Q0A A;  3VBO B;  2QQN A;  5C9A A;  1YFW A;  1W0N A;  1O4Y A;  1CAU A;  4ZXK A;  3ZN4 A;  3OGJ A;  4FOQ A;  4UFJ A;  5LRS A;  3HNY M;  5FRA A;  2VZT A;  3AP4 A;  4PLM A;  1GU3 A;  1W06 A;  4UOJ A;  5EFU A;  5FZ0 A;  2FDG A;  4KG0 A;  3KV4 A;  1HX6 A;  4R9D A;  2ADD A;  4XBQ A;  5DAV A;  1PMH X;  3UGH A;  1PO2 1;  2IVI B;  2J7M A;  3RZZ A;  5EQU A;  4EQV A;  1OSG A;  1DLC A;  4RR3 B;  1DGL A;  3WVJ A;  5A3T A;  1J58 A;  2P3I A;  1LOF A;  1R09 2;  3R4U A;  4IV1 A;  5FPA A;  5C3R A;  5C9A B;  3ZFF B;  3QD6 A;  5H9S A;  1QJZ A;  4Q4X 3;  3BCW A;  4QM9 A;  4UF0 B;  3H8O A;  3FUO A;  3KWV A;  1UMZ A;  1VAM A;  1S0G A;  4LKD A;  3VBU A;  2D3S A;  4FTE A;  1US2 A;  1RB8 G;  1CAW B;  2BYV E;  1AXK A;  3J7L A;  4LQR A;  2HWD 3;  3UKT A;  2ID4 A;  1OD3 A;  4MHR A;  1WCS A;  4XMI A;  1CWP A;  4P00 B;  5FYH A;  4YW1 A;  5JOX A;  3DYP A;  3I2F A;  4Q8L A;  1GWM A;  2JDH A;  5FV3 A;  2VTF A;  4XCA A;  3BTY A;  2FHR A;  2YXS A;  1KRI A;  2HKX A;  4BQ3 A;  2TBV A;  1N3P A;  3ECQ A;  1SG3 A;  3UL2 A;  1W99 A;  2E32 A;  1DZT A;  1EV1 2;  5HCA A;  4BQ1 A;  5EXO A;  2HEV F;  4XDO A;  5A6X A;  1JUI A;  3S57 A;  4P9J A;  5FBZ A;  2C6S A;  1HXS 2;  1R64 A;  1WW6 A;  2UWB A;  3VZM A;  3FX3 A;  4NPR A;  3GGL A;  4BZ4 A;  5A33 B;  5JOW A;  2P1B A;  3HVD A;  4GMP 3;  4AEM A;  4DXZ A;  4CEY A;  4BCU A;  4D7T A;  2AH2 A;  3KB5 A;  3LFM A;  3B3Q E;  4FPC A;  3ZOI A;  1JYV A;  5J09 A;  2XWJ B;  1QJU 3;  2PTM A;  5DUV A;  1OF3 A;  1J3R A;  4RN5 A;  1KS5 A;  1RHI 3;  1JS9 A;  4QPY A;  1QF3 A;  1N3O A;  3CZJ A;  4QQO A;  5C6C A;  3K51 A;  2XBO 2;  4AF9 A;  4S2H A;  3WF0 A;  3M70 A;  4CCL A;  4CEW C;  4QB1 A;  3T1L A;  4AQT A;  4XIL A;  2D5H A;  5CFC B;  2BOI A;  2VR4 A;  1ZBE 2;  2YMZ A;  2YYO A;  2QQW A;  5EIY B;  2C5D A;  4NHY A;  5F5I A;  2Q5T A;  1QKQ A;  2XBO 1;  1GR3 A;  2RVA A;  3APB A;  3VBO C;  1URX A;  1JI6 A;  3HD8 B;  1AR6 2;  4IV3 A;  4ASM B;  4C1X A;  1POV 1;  1HN0 A;  3H8X A;  1SFP A;  1WW7 A;  1OF4 A;  1UZV A;  4EWD A;  1C1L A;  4EWA A;  1R1A 2;  3FMG A;  5FXZ A;  1K5M B;  2R07 3;  4OHW A;  4ZS3 A;  3WIN E;  4DQA A;  1RUD 3;  1RUH 1;  2ZEY A;  5C5T A;  5FLJ A;  5F3G A;  3J8F 3;  4OFG A;  4CP9 B;  2VZV A;  4XFA A;  5AC9 3;  4C8D A;  5FZB A;  2J1V A;  5FOB B;  4IER A;  5H9P A;  3VKF C;  3U37 A;  1FAY A;  3CO2 A;  4DUW A;  1VRH 1;  1O8S A;  1YJL A;  2RHP A;  1S0J A;  1SBD A;  2ZGP A;  5DUX A;  3M3O A;  1RHI 1;  1HRI 3;  1BK1 A;  3CJI B;  2MPF A;  3NJX A;  1VLN A;  4FPG A;  4GWM A;  3S5Q A;  2WO1 A;  4ZU5 A;  2XQR A;  2B39 A;  3OBT A;  4IGQ A;  2FDI A;  4ES8 A;  5F2W A;  4NPM A;  1VIW B;  1IG0 A;  4K20 A;  1LRH A;  4N53 C;  5J48 A;  1PM7 A;  1ZA4 A;  4FPO B;  4QPG C;  2DVF A;  2QQU A;  3UES A;  5IFP A;  1E5H A;  2X05 A;  1AYN 2;  4P5Y A;  4PCR A;  2HWC 3;  3ROU A;  1BYH A;  1LED A;  1JW6 A;  3W20 A;  3S0M A;  1VBA 3;  3HBK A;  1UOB A;  3MLK A;  2ZAH A;  4L97 A;  3WUD A;  1O8P A;  3OB8 A;  5B4X A;  5A3P A;  3GYD A;  4JVA A;  1UZW A;  2GMM A;  3S5A A;  3SMH A;  2HWD 2;  2WNU B;  1E57 A;  4XQW A;  5FY9 A;  4MO3 M;  5J96 B;  1CX1 A;  4BH9 A;  3CF6 E;  4YVS A;  2G9Z A;  1UU5 A;  4Q29 A;  3EHK A;  3CDZ B;  2ZGU A;  1JZ2 A;  1WD4 A;  1J1L A;  2WSU A;  2JKX A;  1EPW A;  1H0B A;  1C8M 3;  4BJ0 A;  5A3N A;  2BU9 A;  4XPV A;  5FP4 A;  5GZD A;  3U0Z A;  4H7M A;  1EV1 3;  2QNK A;  1A8D A;  1W04 A;  3Q8E A;  3G6J B;  4KU8 A;  2VMI A;  1OLR A;  1QEX A;  3QLQ A;  4ZON A;  1F5J A;  2ZKN A;  4MGS A;  4NHX A;  3LOB A;  3N9O A;  1RYY A;  5IUQ A;  4B4R A;  5A32 B;  2IUW A;  2Z42 A;  3PMS A;  3UKV A;  5A33 A;  1ODM A;  3RYK A;  3WP4 A;  1X50 A;  1GZ9 A;  2VU9 A;  3I54 A;  4Y1U A;  2DTW A;  2VZR A;  1NCR A;  2PLV 3;  3JBG 1;  3T0D A;  2IC1 A;  5C4W B;  1OXC A;  3WW1 A;  5K0U A;  4DY3 A;  3U11 A;  3DUI A;  1DQ2 A;  4QHO A;  5F6L B;  4F83 A;  4ZZ8 A;  2IVJ A;  1W6M B;  5EV7 A;  4CCM A;  3N36 A;  4QWN A;  2DF7 A;  4BME A;  3RZM A;  1XPW A;  1D2Q A;  4XJ9 A;  1PVC 1;  1OOP C;  2RS1 3;  2VGD A;  2VXJ A;  5DN2 A;  5FYB A;  1QQP 1;  1ZBA 3;  3W58 A;  3VD7 A;  3HNB M;  2EIB A;  2W9X A;  4Z8B A;  1GOF A;  2W1S A;  5DG2 A;  1GP6 A;  4ATF A;  2X8K A;  4Q4W 2;  2CY6 A;  1LOD A;  2XLA A;  4W6Y A;  4AHX A;  4MLO A;  5FY5 A;  4YSF A;  1QJY 1;  3LB9 A;  3TEW A;  1CX4 A;  4JHZ A;  1QQP 2;  2VM9 A;  3LWC A;  1MVE A;  2DWR A;  5T50 A;  4LO4 B;  3K4D A;  3GM8 A;  4L2N A;  1YJK A;  4RR3 C;  1W8W A;  1W05 A;  1MEC 3;  3O7O A;  4K6B A;  2A6Z A;  2Q30 A;  1W8H A;  4IEQ A;  4QPG B;  2PFW A;  4OLL A;  4UW4 A;  4B4P A;  1XYP A;  4Z92 B;  4I02 A;  5CZK A;  3VV1 A;  5IWF A;  1NLS A;  1HQN A;  5A3U A;  3NST A;  4YW7 A;  5A3W A;  2CDO A;  4M3C A;  1WLC A;  1VMF A;  4UI9 L;  4XC9 A;  1H2K A;  5A7P A;  2KD7 A;  4LEJ A;  4CP0 A;  4A6O A;  1YQ2 A;  1HRV 2;  1LCL A;  1ZBE 1;  2RS5 3;  4HVR A;  4PQ9 A;  4XF0 A;  3JUU A;  3DXU A;  1CAU B;  5IYY A;  3POB A;  4XAC A;  4AI1 A;  1DU3 D;  3J8F 2;  4OHX A;  3WQ1 A;  5A32 A;  1UX6 A;  2R06 2;  3ACH A;  4OMC A;  3ITQ A;  4BIS A;  5JIU A;  2VW2 A;  1TME 2;  4OHY A;  4H7L A;  2ARC A;  5IVV A;  1HN1 A;  5FPL A;  2HWB 3;  3HNM A;  3LAG A;  4PQQ A;  3T08 A;  4TYS A;  4AED C;  3AXE A;  3ENR A;  3N35 A;  1RUH 2;  3NKG A;  2D6P A;  3EO6 A;  3RPQ A;  1A6C A;  3GAL A;  3JB8 A;  2FBE A;  5KHJ A;  3R4D B;  1F9K A;  3O1U A;  2E9Q A;  2P5B A;  4GD4 A;  2OYZ A;  3ZFE C;  1XND A;  3LD8 A;  1QIQ A;  4AI0 A;  5KC5 A;  1SDD B;  3U14 A;  3ZFG C;  3F2Z A;  4QX5 A;  5JXJ A;  1GUI A;  3AJZ A;  1IG3 A;  4BXF A;  2XGX A;  2DVB A;  4GJY A;  1ENQ A;  2WYS A;  1KD7 A;  1VAV A;  2JEC A;  1IOA A;  3EB7 A;  4TSV A;  4CE8 A;  2K9Z A;  4UW5 A;  1U5Z A;  2L9L A;  3ZKY A;  3RZJ A;  1U5X A;  3L2H A;  1DQ1 A;  4P9I A;  2AEY A;  1AXZ A;  2JIJ A;  4KI5 M;  1ENS A;  3POE A;  4BQ4 A;  1FPN 2;  2BV4 A;  4QU2 A;  1WMF A;  2JG9 B;  2GNT A;  4N9H A;  2PA7 A;  1QJE A;  3O0V A;  2B42 B;  2O8Q A;  3WUC A;  1KFU L;  5FBJ A;  3ZXE A;  4D6R A;  1OD5 A;  1IS6 A;  4GJZ A;  4F7Z A;  1XBF A;  5FP3 A;  3B69 A;  2XH6 A;  2WQZ C;  4L9B A;  1W90 A;  3TOJ A;  4AAP A;  4ET7 A;  4CCD A;  1AX2 A;  1C8N A;  2VQ0 A;  4XAE A;  3ZYH A;  4EE2 A;  1QOT A;  1W6M A;  4F3J A;  3SH5 A;  4E2Q A;  1BZW A; 
#chains in the Genus database with same CATH homology
 3KV6 A;  5A7S A;  4ASK A;  4Y33 A;  5IVF A;  3PUS A;  4CCK A;  3RVH A;  4CCL A;  5LWB A;  4CCM A;  5FXX A;  3NJY A;  2YBP A;  4QWN A;  3PUA A;  3N9P A;  5FYB A;  5FZA A;  4AI9 A;  5A7Q A;  4D6Q A;  5FZ1 A;  5FZO A;  3AL5 A;  4EZ4 A;  5IVC A;  5F5I A;  5FZF A;  5FZ6 A;  2XUE A;  5FZ4 A;  2OQ7 A;  3PU8 A;  5FJH A;  2W2I A;  5FY1 A;  3AVS A;  5F5C A;  5FZ8 A;  5FY5 A;  5FY8 A;  2YBS A;  4URA A;  4GAZ A;  5FY7 A;  4HON A;  5A1L A;  5IW0 A;  4CCJ A;  5FPU A;  5FYY A;  5A7W A;  5A7W B;  5FXZ A;  2Q8D A;  2XXZ A;  2XDV A;  2YU2 A;  3ZLI A;  2GP5 A;  5FZE A;  4CUG A;  5FZK A;  2XML A;  3PUQ A;  5FYS A;  5F3G A;  3PDQ A;  3PUR A;  4QXB A;  4QXC A;  3K3O A;  5IWF A;  4C8D A;  5FYZ A;  4V2V A;  4CCO A;  1VRB A;  3N9Q A;  3N9N A;  5F3E A;  4E4H A;  3DXT A;  3K3N A;  5FZB A;  5LW9 A;  5ANQ A;  2YPD A;  5A3W A;  5A7O A;  3K2O A;  3AL6 A;  3PU3 A;  5FYI A;  5A7P A;  2YU1 A;  5FWJ A;  5FZ9 A;  3OPW A;  3DXU A;  4Y3O A;  4QU1 A;  4TN7 A;  5IVE A;  5FY4 A;  4NUB A;  3LDB A;  4BIS A;  5KR7 A;  3KVB A;  5FZ0 A;  5ISL A;  3KV4 A;  3N9M A;  5IVV A;  4IGQ A;  5F2S A;  4LIV A;  5FPL A;  4LIT A;  5F2W A;  5FYT A;  2OT7 A;  5FZC A;  4EYU A;  5FZ3 A;  4LIU A;  5F3C A;  5FPA A;  4LXL A;  5FYU A;  2VD7 A;  2YBK A;  3N9L A;  4UF0 B;  5FZL A;  5FYM A;  3KV5 A;  5FP8 A;  5LY2 A;  4GD4 A;  2P5B A;  4XDP A;  5FYC A;  5FXV A;  5A3T A;  5FXW A;  3LD8 A;  5F39 A;  5FYV A;  4CSW A;  3U4S A;  5A3P A;  5F3I A;  3UYJ A;  4CCN A;  5FZG A;  5FY0 A;  5F5A A;  5FPB A;  5FY9 A;  4GJY A;  4BXF A;  5FWE A;  5FYH A;  4QX7 A;  5A1F A;  5IVJ A;  5FZO B;  4EZH A;  3AVR A;  4Y4R A;  5FV3 A;  5A80 A;  3ZPO A;  2PXJ A;  4DIQ A;  3PTR B;  5FP9 A;  4DO0 A;  3KVA A;  5FUN A;  5A7N A;  5A3N A;  5F37 A;  4UF0 A;  5FP4 A;  2Q8C A;  2OQ6 A;  4XDO A;  5FJK A;  5FPV A;  2GP3 A;  5FBJ A;  4D6R A;  4IGP A;  5FZ7 A;  2WWU A;  4GJZ A;  5E6H A;  5LY1 A;  5FZD A;  5K4L A;  4HOO A;  4QXH A;  5FP3 A;  4BU2 A;  5CEH A;  4V2W A;  3N9O A;  5F32 A;  5FZM A;  4IGO A;  5IVB A;  5FZI A;  2OS2 A;  5FZH A;  5FP7 A;  4AAP A;  2Q8E A;  3U78 A;  3KV9 A;  5FUP A;  3OPT A;  4D6S A;  4QX8 A;  2WWJ A;  5IVY A;  2OX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...