4LE4A

Crystal structure of pagluc131a with cellotriose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
248
Chain Sequence
GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Crystal Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 60
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le4A00
3W9AA 4LE4A 4LE3A
chains in the Genus database with same CATH superfamily
1C1FA 4LKDA 4JTOA 4QAWA 3PTYA 2A6VA 3MHZA 4XBNA 3WDUA 1Z78A 2O1QA 1CZTA 1ZBE1 2WLQA 3ZLIA 1PO22 1ZBA1 4IE0A 1CAXB 1XYOA 2VU9A 2VG9A 2WWJA 3N3HA 5BNPC 2WT0A 4HBNA 3WHUA 2FCVA 2RR13 2WS92 2CAVA 2D6KA 2D3RA 4QKFA 3AZXA 3G7DA 4QXCA 3ILNA 5CKQA 5FY9A 2FDJA 2C6SA 2Q1ZB 2PN5A 3EYPA 4LE4A 1DLCA 3TOJA 1D7PM 4XYXA 1HJFA 3BKZA 1MS4A 4LO4B 1W9WA 3O14A 5FLIA 4CDWB 1T6BX 4BB3A 1GWLA 4JX0A 3VZKA 3HN3A 5I8YA 5CIRA 3T2PA 4MZUA 2LALA 5M0TA 5KC5A 4AFBA 1QJU1 3RJRA 1AR92 4OVEA 1A34A 1RMU3 4K8FA 2Y0IA 3OBZA 1BZWA 4P9WA 3PJYA 1OH3A 3OTFA 2AH2A 3BPZA 4QDRA 1E57A 1GZWB 2B9VA 3MPBA 2XG3A 3WQ1A 3FHAA 5J48A 2P6CA 3BN6A 3HQRA 3JD72 4DZGA 1HN0A 1YQ8A 2BOIA 2E7TA 5FFOC 3KHCA 1QJX3 2AEZA 1QXJA 5G04L 2W52A 4XVHA 3LDKA 4DQAA 1MS0A 1X8MA 5JPMB 2QQLA 2GH8A 2W39A 2XJRA 4AFMA 3WG1A 4AVSA 4FCAA 1QJEA 2CYFA 5JMCA 3C7OA 1VMFA 1PVC2 1ND3B 1PIV3 5GZEA 3VKLA 3V65A 2E6VA 2XJTA 3ZSLA 4AI9A 2A6WA 3OOXA 3ZN6A 4DOUA 3ZYFA 3UGHA 1UOFA 5FOJB 1C8M2 2DUQA 3LF7A 4XJAA 2ARCA 4YARA 5DDJ2 4UFKA 5D8AA 2DUOA 4MVTA 1A8MA 3AYDA 4YLZA 4OHVA 1YO8A 4DUWA 1SMVA 1RUJ3 2R043 4G9SB 2ZGMA 3POBA 3VBHA 4GJZA 3LDBA 1MS8A 1UPSA 2ZGLA 3A23A 2XB6C 4COUA 4ONUA 1FOD1 3RPQA 3T0BA 5A7WA 1HB3A 1LEMA 4EROA 5C3QA 3VN4A 3CEWA 3KT1A 2WNUB 3V56A 2I07B 4J1XA 1UMIA 3AP4A 5CZKA 3QH6A 4DNYA 1IG0A 4G4FA 4DXTA 1S0JA 3KV5A 2ZGUA 3LPFA 4WV8A 1SDDB 4Q4V1 4CCLA 4Y3OA 3CF6E 3Q8EA 4M01A 3ZSMA 1XE8A 5C70A 4YVWC 1MS1A 3V0BB 1AVBA 3HJRA 2UURA 1VBE1 2BZDA 2D6NA 3WG3A 3ACIA 3KGLA 4KWKA 4WVZA 4JTNA 4IEOA 1ZBE2 3PHMA 4ZKTB 5KWRA 1H9PA 1NE4A 3C7FA 1ZBA2 5D1IA 2HWF1 2IXIA 4YG3A 3SEPA 2Y38A 3U1XA 5DUWA 1RB8G 3EO6A 2WUHA 1MEC3 4UF0A 4FPHA 1F5JA 4AHWA 3TN91 1W8ZA 4UXAA 5BNQA 1C5IA 2BPA2 2H0BA 2FD8A 1FPN1 5C6CA 2O14A 3AKSA 3CJIB 3M3OA 1K3IA 4Q0QA 2LW8A 4BZ4A 4CEWC 5L7OC 2AACA 4B1MA 2DCZA 1Q56A 2E63A 5FZ6A 1QH6A 3IMMA 3DYMA 4KBZA 1AZDA 1NCQB 4KG0A 2RDQA 4BK5A 1NAEA 1UYZA 2ZS6B 4COWA 4QM9A 3POEA 4RS5B 4LXLA 4Y1XA 4CDUC 1W28A 3BIWE 3B00A 4UBHA 5JWPA 4K20A 2WINB 3WSOA 4A7KA 4GH4A 1DFQA 2HEYF 2ZAHA 2J1VA 2ZOEB 2OT7A 3C7GA 5FZFA 1YRZA 4R9AA 4TZDA 4ARYA 1OA3A 1NLRA 3OBRA 4GZ9A 1HDKA 3RSJA 4BOWA 5FZ8A 3TAYA 3A21A 3E6DA 3KD4A 2E7QA 3ETQA 3EB7A 5GZGA 4IUGA 1UKGA 2CGOA 1GU3A 1IS4A 1LU1A 3D82A 3M1HA 4HT1T 5FYUA 1L3JA 3KT7A 1H1MA 5FPBA 4K8RB 3AXEA 5D2AA 2VY0A 2VAUA 4COVA 1O3SA 1NLSA 4YVSA 1SPPB 3T0DA 1LGCA 3C7EA 1WCQA 3J8F3 1N1YA 4P00B 2YGLA 3M3IA 4XHXA 5DZEA 4JKKA 1VJ2A 4FO9A 5DMYA 5FYCA 4QDSA 2CHHA 4PLMA 4WM7B 4OQ8A 4BU2A 4CTEA 3H8XA 1P8JA 1ND2B 3IKWA 1JOPA 1US2A 4IE4A 4KL1A 4Y5SA 3S30A 4FPCA 4A3ZA 1LGBA 4GMP1 4A42A 2VMGA 2E26A 2HEWF 1PGSA 3VBSC 4BQ3A 1FOD2 1DYKA 3K46A 1HRV2 3DYPA 4P9LA 2W91A 3I7DA 4LLOA 3KQRA 3POWA 4DRRA 2KR2A 5KBFA 2HWD1 4C8DA 3UJQA 1K42A 3SKJE 2VTXA 3H1MA 4I30A 3HNYM 1UZ0A 2OZJA 4BMBA 1W2UA 5BXXA 4Q4V2 3NL1A 1NXMA 2JKXA 4X8PA 1FAYA 2RJ2A 2BP6A 1XB9A 4V1PA 5IVFA 3UKNA 1VBE2 1UMZA 4OUSA 3W59A 3WDTA 1OQ1A 5A3PA 3D0SA 4PIXA 1WW6A 4GD4A 1WGPA 1PMHX 2HWF2 4IV1C 5KHGA 2OX0A 1GICA 5FZIA 1CAVA 2EXKA 4Y20B 2YZ4A 1X7NA 2LTNA 1W8HA 1FMD1 4HVRA 1EPWA 5CFCA 2DYCA 4FTEA 1Q5OA 1BK0A 2DTYA 3IPVA 1FPN2 4XQWA 2ENRA 3ZIXA 1RUE1 3AMNA 1AR71 4GIQA 1XJAA 4XF1A 2ES3A 3O1UA 3ZFFC 1V9U3 3VDDC 3RZKA 1GP4A 2UWBA 3B93A 3HR9A 4I02A 4IEPA 4LTAA 4BA6A 5I0DA 1L7RA 2XBO1 2XJQA 2E51A 5J36A 2R16A 1CONA 2W94A 2DVDA 2OVUA 3UT0A 1ONAA 3ZXEA 2RMU3 5JSRA 1AXZA 3ZSKA 1FI2A 2MEV1 5F32A 3WDVA 4ASKA 4GJYA 5FWJA 3FE5A 2MHFA 1ULEA 2JG8A 4O9GA 3VBRA 1YFUA 3O1VA 3ES4A 5FXWA 5SV5A 4N43B 1RUF2 2QQVA 3MIFA 3WW1A 4R4XA 3P6BA 5K4LA 4A7ZA 2F17A 3RDIA 3LD8A 5JIUA 1H2MA 4JAAA 4Y1VA 1RJ7A 2WWSA 3PUQA 3S7EA 1RUOA 2V09A 1IKPA 4CEYC 3L2YA 1F4AA 4UFJA 3RRDA 4A7YA 5KC6A 1K5MA 4OLLA 4X8NA 5GLUA 3M3QA 3ZYBA 3UNPA 3RYKA 1HB2A 2VD7A 4MGSA 4KQ7A 4OHZA 1ZZCA 1G9BA 5FZCA 1ZRIA 2D43A 1DYOA 3N9LA 4LBKA 5LBFA 1GOGA 1EAH2 1UU4A 2Y64A 5FZ9A 4NIGA 4QU1A 3IM0A 5IUQA 1LHVA 3WNLA 4ZZ5A 5K0UC 5A6ZA 1LHWA 2D6OX 2LM3A 2XUEA 1YI7A 4NRQA 2RR11 2DU0A 2ZA9A 3KV9A 2VQUA 1GFF2 3I2FA 4QXKA 4P5YA 3N9PA 2RE9A 4QKBA 4HKOA 1X50A 5FZ0A 1HIXA 4JGYB 2Q8OA 4KWJA 3MBWA 4XZUG 4PDWC 3PUIA 1R1ZA 2VPVA 2C5DA 1PZ9A 2VXRA 4ATFA 4FPKA 3S7IA 5BNOC 4D69A 2QZ3A 3K77A 4UAPA 2XL7A 5BNPA 3RWNA 1RMU1 4JGZB 1GMMA 1CAWA 1V6JA 3PVNA 1N3OA 2HWD2 2JJ6A 4RQPC 2XQRA 5FPZA 1BHGA 3U78A 4COZA 4LT5A 3QACA 3NJZA 4CDQC 4XF3A 3VD9A 2UY8A 1BVP1 3ZFEC 2FZ1A 5LY2A 1YJLA 3M70A 3ZYIB 5T55A 3RJ2X 4K1YA 1QJX1 3AK0A 4MO3M 3ZXKA 2ETEA 1BK1A 4FPJA 1XE0A 1Z7S2 2RJKA 4RR3C 4Y4YA 3N9MA 5JAXA 4AEMA 1RUG3 3ELNA 3IT8A 4LO5B 4AEDB 2R32A 1FMD2 1O8SA 1ULCA 3APBA 2FMDA 4CPBD 5APAA 1PIV1 1LJ7A 1JZ8A 2PQQA 4XPVA 4S2GA 3DEMA 1XSRA 1RUE2 4QX1A 2Q30A 1STMA 4KG8A 2P5BA 2BDRA 4IV3C 4UFMA 3GALA 2WZR3 4O7XA 3NNLA 2NMOA 1R083 2JG9A 3H7YA 4PCRA 4FPGA 2TNFA 4ATEA 3GBGA 4NAMA 1RHI3 4D8MA 1O4ZA 2JEMA 2ZGOA 3MO4A 4DY3A 1GKBA 2I2SA 5FTTC 2WKKA 1X9PA 3FLRA 3WCRA 1PK6B 5HBAA 3C3VA 1RUJ1 5A6XA 2R041 1HB1A 2WFF3 3UGGA 5A1LA 4FFHA 4NWWA 1FXZA 4KU7A 3USSA 2ZTNA 4RFT0 2XVGA 4H7MA 1ZA4A 5FPVA 1GLHA 4OZXA 1IGOA 3POJA 1QNYA 4MADA 3RQ0A 1G86A 4QX3A 1TME3 2YFUA 2XR4A 4LJHA 2C0ZA 4RGKA 5IHRA 3KQ4B 1MPXA 4Q1RA 4CUCA 4ZU4A 3WF1A 1TVGA 2BEOA 2GN3A 1RUH2 1RC6A 3BPSA 3DCQA 3WHTA 3T08A 1F5FA 1XNBA 2VTFA 2MNGA 1JU4A 3B7MA 3ZO0B 2VZTA 4JC1A 4NOTA 4BQWA 5IT6A 5FYHA 2FDGA 2IXHA 2VUCA 1NOVA 4LBQD 4Q0SA 5EQUA 5J09A 2ZXQA 2YBPA 4M3CA 4MOAA 1MR5A 3KV4A 4LBMA 1F8VA 3H1WA 2ZZJA 5HV0A 3KZ4C 1A3KA 4XACA 4XF0A 1HJGA 2V72A 3MUY1 1MEC1 5FCCA 1IG3A 3NKTA 1NZCA 1JTZX 2YHJA 4MSVA 1LEDA 2D3SA 2O8QA 3ACGA 3AMPA 5DN2A 3I59B 2C1FA 5EV7A 4Y1YA 3RYRA 4JHTA 5A32A 2QE3A 5IK8A 4AK3A 3RS6A 2ZACA 2F4PA 5HCBA 2Z4FA 3C8XA 4XDPA 4COYA 1JZ3A 1HQLA 4I3GA 2BQPA 5FBZA 1NG0A 4HXCA 4M3CE 4LOSA 1N1TA 2XHNA 1N1VA 4LITA 3ZYHA 1NX9A 3JZVA 5JUVA 1V6IA 1W2TA 2AZ5A 2GNTA 2VJXA 3KVAA 1RMU2 2L9LA 4ZU7A 2H0VA 3AMHA 1PGL1 1EV13 1HXS3 1N1SA 1VB4A 2RS53 4Q5OA 3DV8A 3DXUA 5KXCA 5L7OA 3H3LA 1W0OA 4CEWA 3U37A 5FZKA 2O0OA 4NRMA 4YW2A 5DZFA 1LKNA 2R30A 3AZZA 3J26N 3PIJA 1FNZA 2IXKA 2ZABA 1B35C 1LTEA 1QJX2 4QQPA 1JZ2A 1W0NA 1WCKA 4GWMA 2VZSA 2SBAA 4HVOA 2JD9A 4XBQA 4A44A 4CDUA 5C8WA 2GDFA 2HWC2 5ACA3 5C3RA 5LCWL 2GMPA 3B3QE 4AHZA 3SH3A 3E6CC 1J1LA 2GH2A 2VOKA 4EN8B 5ISLA 1H9WA 3KV6A 4QPYA 5A3WA 2X5IC 3E5XA 1JYWA 5EHDA 2WAAA 4FP2A 1GNHA 5FP9A 1IQAA 1NLQA 2RDRA 4UOJA 4AQ6A 4MYEA 4CUBA 3J8F1 2WWUA 1AX0A 1MQTC 1PMJX 2ARBA 3J4UH 4FPYA 4H55A 5JR2A 1PGW1 1VMJA 5DQ0A 3S6PA 5DUUA 4ES8A 1WZXA 4OQ9A 4MGQA 5F3GA 3FFZA 3WW4A 1PNGA 1W6QA 4A6OA 5LA9A 1CJPA 4K1ZA 1W39A 2R042 4YVWB 1QU0A 3MZHA 4GKXA 4PBPA 2BFUS 2W87A 4CXXA 3ACHA 4DS0A 3WUCA 5JI9A 4NIHA 1IPSA 4QX5A 5TSWA 1DHKB 2PQSA 1QJZA 1CVNA 3ZXDA 5C4WB 1VALA 4TWTA 1SBDA 1MZ6A 4ZONA 3JBG3 2VBDA 4NIDA 3SXWA 3KF3A 3I3MA 1YQ2A 4CP1A 5C71A 3J7NA 3AC0A 2W1WA 1EY2A 4YFWA 2YFZA 4Q4W2 4CCNA 4Q4Y3 1ZRRA 1UW8A 2YG0A 2Q1FA 2YU2A 3J7MA 1JYCA 5A7OA 2DV9A 4JZRA 1MZFA 4NPLA 3K3OA 1I5PA 2VVFA 1W2AX 5DAXA 1HW5A 3B02A 5HXMA 4TN7A 1JZ7A 3LEKA 2QQKA 4DPNA 3LOIA 2A70A 1XQNA 5DXDA 5FO7B 3AYCA 1OC1A 1OUSA 3I97A 3JUUA 3ZXAC 5IYYA 1DG6A 2P3IA 3QLQA 2GNMA 4E2QA 1LOGA 1SCRA 1TNRA 1A78A 3CZJA 1VBB2 1V9U1 4MXVA 4Q4X3 2CL2A 5BNNA 4HMZA 3O0XA 1KS5A 3VD3A 3LFMA 1F9KA 3POIA 3BOPA 4URTA 3TEYA 5FZHA 4ET7A 4IESA 3T09A 5EXOA 2GNBA 2A6XA 1ZA7A 2A71A 2RMU1 2WN3A 3VV1A 3ILRA 2W95A 3JQXA 1WLCA 2R063 1WLDA 4H14A 4IV1A 2QQMA 4V2VA 3R4UA 4PIYA 4OCTA 4FFFA 3NAPB 4K9SA 1DF0A 1OKOA 2D44A 2PHDA 1PGL2 2D7FA 2E7AA 4QD2A 2JIJA 1F15A 2OPKA 4XTPA 2JENA 3IBMA 1IHMA 4QX2A 1KJRA 3ZFFA 2WZEA 3VDDA 5ABJB 1GP6A 4MGZE 2WO1A 4XETA 4BQ4A 4FFGA 1AX1A 1WMXA 1SLLA 4LPLA 2JDZA 3R4DB 3LB9A 3D8CA 3GCWA 2QUOA 4NR1A 2OZ6A 2GC3A 3N4MA 2ET7A 1DDLA 2OQ6A 3FN9A 1UN1A 4GWIA 4YGBA 2WO2A 5DUXA 1JMUB 2B39A 1OOPB 1LULA 3VBSB 1GQHA 2XVKA 4OI4A 4FP3A 1YFXA 2VVEA 3Q8FA 4IEQA 5FXZA 4YPJA 2FCTA 3OGVA 1OURA 3FHIB 3J8F2 1UXZA 4XURA 4ZY9A 4CEYA 5JXJA 4UW5A 3H8OA 2CY6A 4E8CA 4ITCA 1YHFA 4LNVA 4DXSA 3A22A 5FZBA 1PNFA 3J7LA 4LHKA 1BEV3 4IGPA 4YNIA 4DFSA 2VO5A 5KHKA 4AOCA 3R4SA 1JN2P 4UW4A 4HVQA 5A70A 1D0GA 2VOTA 3MIGA 3Q8CA 3VZMA 4AI1A 2HEVF 3OJBA 1CZSA 3OG2A 3SMHA 2NP0A 1GR3A 4GQ7A 4MXWB 2VL4A 3I3BA 3QH7A 1O8PA 5K0UA 1W3VA 2J1UA 3RYPA 2PFWA 4WVMA 2HWB3 3TNQA 4QX7A 1W9TA 5FLJA 4BWOA 4KU8A 1MZ5A 1J84A 2PAEA 5FY8A 1JW6A 3IAQA 3SNMA 1S0IA 4PF5A 3ZFFB 3O1PA 1O3QA 3HNBM 2JG8C 3VBRC 4IGQA 2C24A 4CP9A 2JD4A 4B29A 1J1TA 4YW5A 2ZEYA 2PHTA 5BNOA 5H9SA 4IE7A 5IFTA 5J96B 4IQPA 4TSVA 4ZZ8A 3MPPG 4XF9A 5J37A 1PX3A 2JDAA 3OBAA 1RUG1 3VBFB 3WXPA 3WNOA 2ZGTA 3LOBA 4XABA 2VNRA 5G05L 4HPKA 1QQP3 1VBA3 4HKLA 2JE7A 2QQUA 4CDQA 1U5ZA 2P3YA 2VMDA 2JX9A 2P4EA 2P17A 1UF2C 2ZGKA 4XBLA 3H1YA 4XFHA 4NIIA 3ZFEA 5KR7A 2JDUA 4C1WA 2WZR1 1ZX5A 5BYNA 1JS9A 4ARXA 1R081 2E32A 2J1SA 1YQ5A 1DBNA 3TNPB 1JYXA 4XCAA 1OPOA 1RHI1 4FSJA 1XE7A 3ZXGA 3H0OA 2V4VA 4NROA 5C8CC 2WFF1 3DPRC 1E5HA 2JXAA 4UFHA 3ZXFA 2YBSA 1C57A 2W46A 1QJY3 4LR4A 4BHPA 1W6MB 4NMIA 2D97A 1KEXA 1TME1 3I2GA 3MFAA 3RG0A 3OYWB 4IV3A 1IOAA 4CU8A 2ZX2A 5EJ3A 1A6CA 2Y6KA 4NE9A 3VBUC 2J1AA 3VDBA 2Q8EA 3L9JT 4C0HA 4WVVA 4A3XA 3VHOA 3DGTA 4FTBA 4XQDA 1BCXA 4PDWB 2RS13 5IVYA 5F3CA 1LECA 3GXUA 4IW3A 4IEUA 2WJSA 2ZEWA 3RZLA 1DP0A 1R1A2 3HVDA 2C9AA 3VLBB 3P1IA 3B01A 4AI8A 1S1AA 2PHXA 1OQEA 2BGCA 2YDEA 5FY0A 4IXLA 2X09A 3USUB 1J3RA 3PVBB 3AKRA 4RQPB 3VDAA 4BQ2A 4F83A 4EZ4A 2WAOA 3IAPA 1KDMA 1XSQA 2D5HA 4AAPA 2IFWA 5C9AB 3W21A 3WINE 2VOWA 3LA3A 4LLFA 1S4CA 3TEXA 2WO3A 5HCHA 3THDA 4EE2A 5CAZA 1QOOA 1FYUA 3D6EA 1KQRA 2WZPP 1AR62 3IDEA 4RR3B 3PU3A 4BDVB 3IDAA 2OYZA 1WCUA 1BXHA 4CCEA 3VL8A 1XU2A 3E97A 2IXJA 3FMGA 5CG8A 4FVVA 1EV11 1HXS1 5FPAA 2RS51 4D7TA 1X82A 5FYIA 3M4FA 1E5RA 4LA2A 1OVPA 1VE0A 2JG9C 1IQDC 2WQ4A 3GNEA 5EJZB 3T30A 4IEZA 1JHNA 3U14A 3POFA 5J98B 1WW4A 1NA1A 2EVXA 1BBT3 3T1MA 2VCBA 1SLAA 1SLCA 2J22A 5T5PA 3AMMA 3OCPA 4B1LA 1UL9A 5ACA1 4XQ4A 4ZS2A 2FCUA 1RUG2 1HRI3 4Y5TA 1SFPA 3JB4C 1KFUL 4AGRA 1JBCA 1DZQA 2QZ2A 2A6ZA 4N7UA 2VECA 3WCSA 5DUVA 5FMOS 4ISQA 4RL7A 2BGPA 3NJVA 3CJXA 2A1XA 1RUC3 4CPBA 5EFUA 3ZYJB 4IEXA 3LEMA 1S2BA 4AEJA 1B35A 1R082 2VBPA 1RTVA 4BM8A 2CGPA 3PUSA 4KWUA 5CBLA 1YJKA 5IVVA 1B09A 3ZFGC 5LBCA 2WFF2 4MH0E 1SLBA 4M00A 2JB4A 1DGWA 1NCRA 3DKWA 2X5IA 2ZMKA 3O1RA 2JDNA 3DKQA 4ES9A 4I2OA 3OUJA 4YFZA 4EN6B 3VBOA 5CYYA 1XRUA 1A8DA 2ID4A 2JDMA 2O8OA 2VW0A 4Q0UA 3ZSEA 4E27A 3OD0A 2XUMA 1MQTA 2DCTA 1G8WA 1YWKA 2DWRA 3JBG1 1YUDA 2Z42A 4HZFA 2GC1A 2GMMA 3E5UA 4YGDA 5JMOA 5FY4A 3R0RA 1JHJA 4Q4Y1 4QPGC 1H4GA 5A7SA 4DXRA 4RSUA 3THCA 5EYXA 2DVBA 4PLNA 1V0AA 4AAXA 4E4HA 1OA2A 4GB33 4LBOA 3MYXA 1GYKA 4LBQA 5F2WA 3UKTA 2H6BA 3MDPA 1QXRA 3WF2A 3ZN6B 4LO6B 4Z1VA 5IK5A 1RVF3 1TMF3 1U5IA 2X8KA 3HNMA 4N53A 1C4RA 5FZ3A 4BLIA 1ENXA 4X6QB 4D0QA 4NPMA 3ZX7A 1UCXA 5D8AB 3WY6A 5H9PA 1COV3 1GWKA 4CP2A 3JB8A 5IVEA 5DAWA 2FHRA 1C28A 5GKAC 5IVJA 2ZHLA 1QJU2 4Q4X1 5FOBB 1ZZBA 5FZLA 1B35B 3VBHB 2C4XA 1UZYA 2XMLA 5FK7A 2YUEA 4EWEA 3AX4A 2QDNA 1V00A 5A7WB 3LSDA 2R061 1HN1A 2NZ9A 4QB6A 4XUPA 4Q0PA 1EV12 3WT3A 2RS52 4YW7A 3V0AA 1DQ0A 1QY4A 4XDQA 1OI6A 4MGIE 4FAHA 3WNMA 3MV01 2BNNA 5FV3A 2R49A 1BQPA 1OT5A 1S0BA 5JDBA 2HYKA 3H8UA 4B4PA 4LMFA 3MF9A 1SFNA 4EN9B 1X9TA 2VMEA 2W0XA 1GBGA 2PXJA 3KCXA 5C33A 2QQPA 4J25A 1LR5A 4HL0A 2EXHA 4UF0B 4JQRA 1QNWA 3WNNA 1MS5A 5CU1A 1KD7A 5F6LB 4XJWA 3U07A 4Z2WA 4FAGA 5JXIA 2QDRA 1QEXA 4I0AA 4XUNA 1RUI3 4W4ZA 1O7FA 2ZEZA 2CAUA 2XWBB 2BVVA 3GBWA 3I2JA 2UWAA 3GDBA 4N90A 5I0SA 3V64A 2VZUA 3FC0A 5J3UA 2D6LX 2K2SA 4Z2AA 2WNVC 4CP0A 3WF3A 1BEV1 4FOYA 4XFBA 1XPWA 1H6XA 5FKCA 3LQCA 3LZZA 4KMQA 2VW1A 1SLTA 2WRAA 3LEIA 4GH4B 1JOBA 4KNCA 3TBDA 3OY8A 1QDOA 2B4KA 1ST8A 1WMEA 4S2DA 1O4TA 1TG7A 5FDBA 5LBBA 1AR83 1UXXX 4YG0A 3SCHA 1MS9A 2QFEA 5BNNC 5LBEA 3ASIA 4I3PA 2HWB1 4A41A 3I2DA 1R64A 1YQCA 2ZMLA 3NV4A 2ZZQA 3I2IA 4QMAA 3ZYPA 1W8UA 1HKDA 2EA7A 2YC4A 1VP6A 1W8TA 5EIYB 1W04A 2E33A 2YMZA 2D6PA 2ILMA 2WC2A 1ZYBA 2DCKA 4Q4Y2 2HBUA 4UW3A 5IK7A 1QIQA 1JZ6A 3TWIA 2YY1A 3SKVA 4IETA 3ZDVA 3WLUA 3TN92 5F5IA 1F31A 1WW7A 3POYA 4IERA 1RJ8A 2HWE3 4QQHA 4YVSB 4NIAA 5JOYA 1H2KA 5FZMA 4EWAA 1YLLA 5LK5A 1EPZA 1GOFA 3WDWA 4QPIC 5GLZA 2QQOA 1QQP1 3AKTA 1YNAA 1VBA1 2QQNA 4TYSA 2NM1A 1H8TC 4A6SA 5JOZA 3AFGA 1J58A 5FUNA 3D5OA 5E8AA 4Q4X2 2HKXA 3PURA 3TRSB 2VMFA 3FLPA 1WBFA 2UYBA 1LAJA 2PTMA 1S2KA 5KXBA 2R062 4NWVA 2BW8A 1S0GA 2WABA 3WZ1A 2ZX1A 4E4DX 4NHXA 3BCWA 2DU1A 5I0TA 1SCSA 3KWVA 1WWYA 1QJY1 4LBJA 2OXBA 2EAKA 1LOCA 4XFIA 2YC0A 4B4RA 4QWNA 3MGUA 2AENA 4AVTA 3GJAA 3FLTA 5F3EA 4ZU5A 3WG4A 4WVWA 2WT2A 2WL1A 1AYM3 3UKVA 5JSOA 2GN7A 4N9HA 2RS11 2I45A 2DBNA 2IVIB 5C8CA 1CAVB 5CFDA 4Q8LA 5F1RA 3DPRA 4PHZA 3C7HA 5CFCB 3AL5A 1W06A 3IPVB 3ZYGA 3U0ZA 2XHKA 2JDHA 3OEBA 2AGSA 4XW3A 1GP5A 1KITA 1IS6A 1UNBA 3GM8A 4XE9A 1AX2A 2AR6A 1SFYA 3AZWA 2YGMA 4WM8C 3VBUA 5JZGC 2BBAA 3NNGA 1K45A 1W6OA 2F6BA 1WA4A 4Q2FA 2V5DA 3ATGA 3NKGA 2WS93 5F7UA 3FBMA 4YRDA 1W9YA 2ERFA 2IUWA 2JG8B 1BEV2 3VBRB 5T52A 4QX8A 2ZX4A 1LOAA 5JPNB 2E53A 3AP6A 1CESA 2CDOA 4K6BA 1POQA 3TEWA 3WD5A 1BMV1 3WG2A 1CD3G 2VULA 5FIXA 2GZWA 2YPJA 2WO7A 3F95A 4LHLA 2XQXA 3ACFA 2WBKA 2BOJA 4CA9A 1EP0A 1AR93 3E6BA 4H2AA 1W6PA 4Y5Z0 2BVBA 4D7SA 2D6MA 4BPZA 5B4NA 2FBEA 1HX6A 1K5MB 1ACCA 2VCCA 3NVCA 3PIGA 5FZEA 4E8DA 2OQ7A 2J7MA 3W9AA 4SLIA 3ZM8A 2NN8A 4QQLA 4A4AA 4EZHA 1O5LA 1J59A 4PT6A 1BBT1 3JD73 3QOPA 3SITA 2Q1MA 2PHUA 4OI0A 1JODA 2PLV3 4AVBA 2A3XA 2XONA 4CDWC 2VQAA 1AR72 4P08A 1UAIA 1HRI1 1R093 2VUJA 1Y3TA 1K12A 3ROUA 5L19A 2QTWB 1REEA 3K51A 1QQP2 2XBO2 3GZTB 4JV4A 4L2NA 3N7JA 2OKXA 5L9VA 3ON7A 3OPTA 1RUC1 1XNKA 1WLTA 1XYNA 2MEV2 2WSVA 1VIWB 4XAEA 3ALQA 1G9AA 1JYNA 2F4LA 1WKYA 1TNFA 3O1SA 2XH6A 3RGBA 1VBC3 4Y1UA 4YM0A 1NY71 2H6CA 4B4QA 4LKSA 4XFFA 4D6QA 5BNPB 2OW4A 2YROA 1URXA 2DURA 1CAWB 3VZNA 4FPFA 1RXFA 4FQZA 4R9DA 1UMHA 1WMFA 4PF1A 1ASJ3 1QJY2 5A7QA 1ULOA 5CG9A 1F4HA 2RDNA 4XF4A 1WBLA 2PHWA 3WDYA 3ZIWA 1ND3C 2VZ1A 4DXZA 1DGRN 4YGCA 2Y6JA 5C5TA 4EQVA 3AB0A 5E1RA 4L11A 3MIBA 2BBVA 3P5BA 1W8FA 3OPWA 3K2OA 3TEZA 4MUVA 3ZFGA 2RS12 2WQZC 1XU1A 2DF7A 1EUUA 1GNZA 1UOJA 3LIHA 4YM3A 1DQ1A 1SBFA 4HANA 3WEZA 2CSGA 4W6XA 2QVSB 2DUPA 1W6NA 2RR12 4GB31 3ZYRA 2NPIA 4FOQA 1FX5A 2BERA 4PJYA 2PAMA 1VLNA 3HT1A 1OF3A 1RVF1 1TMF1 2EIGA 1I3HA 1YFYA 2P34A 2KXLA 4GULA 2SLIA 1NA1C 4YM1A 1AL23 2JG9B 1OHFA 2IC1A 2W47A 3GZEA 1XNAA 1CX4A 2WNUC 5B4XA 1COV1 4P14A 2VZ3A 3NWKA 3WF0A 2ZCWA 1W8WA 1G9FA 4QPGA 2ZBJA 5FWEA 2BNOA 4CZSA 2JB8A 1AF9A 4MGYE 1W0PA 2Z2SB 3WNXA 3W5NA 1AL0G 3UK9A 3AP5A 4FFIA 2WA3A 2UYAA 2EICA 3UV9A 1S0EA 2XLFA 4AGGA 2EXJA 3PU8A 1REFA 4XFGA 1PZ7A 3RZMA 2DCJA 5HPOA 4DUXA 2ZGRA 4QU2A 2Y26A 1UYXA 1ULFA 3OGRA 1TZOA 3KLSA 4GWNA 1KFXL 3PUHA 3JU9A 5CADA 3CJIC 4G3YC 4YG6A 5A7PA 4W6YA 4L92A 4M3CB 3RNSA 3VZLA 1BBT2 3W58A 4AG4A 5GZCA 1LU2A 3WX5A 1NCRC 5LK7B 2A75A 5F37A 1W2NA 1PIV2 1TEIA 5FK8A 4TXWA 3VBOC 1NCQC 5KXDA 1UZWA 3ZR5A 1RXGA 4AFAA 1ENRA 1HRI2 2PHRA 3RZJA 1ULDA 3ST7A 3WW2A 3NNJA 4XUTA 3OBTA 4BXSV 5A32B 1U5XA 4AZZA 2ET1A 5FO9B 4FT8A 4OFGA 1DQ5A 2R073 1RUC2 5LEJA 5CKNA 4S2FA 4QQOA 5FYTA 4M3CF 1RUI1 3KCCA 4I0BA 1RUJ2 1PO13 1MVEA 2AYHA 3EBRA 3D4KA 1RUD3 2ZKNA 3LGRA 3N7KA 3VD5A 1T2XA 3GJBA 1NY72 4XIKA 1W90A 5DAQA 1OFNA 3BGAA 3FZ3A 2VQ0A 2XDVA 4NHYA 3LDRA 5FZOA 3VHRA 4AR2A 4BIFA 4XC9A 3S5QA 2Q5TA 4N53C 1U0AA 2XPJA 5IAXA 1DGLA 3GYDA 5L9RA 3POGA 3TYJA 1SDWA 5L7OB 3AFKA 4CEWB 2VNVA 4RGGA 1JZ5A 4CU6A 1OFSA 1AR81 1MVQA 3D3AA 4R9CA 1HRV3 5JI7A 2W2IA 2DVAA 5FP4A 5HXVA 5KHJA 3N7LA 5FYMA 1CX1A 4QX0A 4LK6A 3IN9A 3H8RA 4CDUB 2WNVA 2XXZA 2ZPXA 1DYPA 3AJZA 1GZTA 1MEC2 1CIYA 1NUKA 1FV2A 4J6GA 4WM7C 5DZGA 4KWLA 4GB32 5FP7A 4AHYA 3VDCA 1ND2C 3Q8BA 3C2UA 2HWE1 4CDXA 2GAUA 2XLGA 1W99A 4B3NA 1RVF2 2YPDA 3ZXJA 2FDKA 1I1EA 3HQXA 4UFIA 2J42A 1AYN3 1UWWA 2B45X 2V4AA 1VB2A 3H7JA 3O0WA 1W6QB 1LGNA 3HIFA 4JRAA 3RFRA 4CRQA 4AHXA 3OGJA 4ASMB 1GNYA 1JYIA 2HJIA 3CZUA 4OMCA 2Y6GA 4IE6A 4QQ2A 2W68A 1QOSA 2UWCA 3CBNA 2NYYA 3T2TA 4JCKA 4MHRA 4YZ4A 1FNYA 4O9EA 4AVVA 5IFPA 4UW6A 4HKWA 4HOOA 3VHPA 4U36A 4JVAA 4XFAA 4QPIA 2LRPA 2Q8CA 3I4IA 1H8TA 5DG1A 4OHYA 1RUF3 1UPIA 1VMHA 3NQHA 4KGGA 4XJ9A 4CU7A 2VR4A 2FMYA 4GALA 5JOWA 3HN1A 4N8MA 4META 1AYM1 1YEWA 5E89A 3KT4A 4GXLA 1RYYA 1N3QA 2EAAA 2Y6LA 1ZRFA 4UT5A 5JVVA 5FZDA 3EQEA 2J1EA 4IEWA 1LENA 4MGTA 1PMIA 4LORA 4E4ZA 4E9KA 1PGW2 1CWPA 1Q8QA 3BB6A 4GKYA 5FQ0A 4QHZA 1VRH3 5KHIA 4N43C 1NZIA 3MIEA 5L9BA 5BNNB 1CQ9A 1RUI2 3H9AA 3HPNA 4H3WA 1H1IA 4JKMA 5A33A 3WW3A 5AC93 3ES1A 1U12A 1OLMA 1HV1A 3GCXA 4FPEA 4WBBA 2WS91 2JE8A 1DQ6A 1RL3A 3MIHA 1Y43B 3AVRA 2D40A 4IV1B 2MPFA 2ORZA 3HEIA 4CCMA 3WQ7A 3DUIA 2YC2A 4HK8A 4K7JA 2D93A 3CLPA 3HBZA 4Y22A 1S0CA 2QQIA 4INDA 1RITA 1GANA 3T2OA 2OS2A 1LOFC 1ZZ8A 2A6YA 2EIBA 4AEKA 4CCKA 3NSTA 1D4M3 3KF5A 5BY5A 1AR82 1VBD3 3I2KA 4LHSA 5KHHA 3VDDB 1FV3A 4WZFA 1AR91 5F3IA 3O1MA 3GF6A 1OD3A 4WM8A 3RVHA 1JUHA 5IK4A 4RGAA 2PA7A 3O12A 5JZGA 4LK7A 4Q8KA 3GZAA 3MIDA 1C5HA 1OLME 3AZYA 3BU7A 5DAVA 2YV8A 2ZHMA 3CHXA 1D0HA 2KM2A 2Z5WA 4QXBA 2BNMA 3VKOA 4NHLA 1UU5A 3JD71 1YXWA 2CNAA 3D0JA 4UBGA 1Q43A 1PM4A 2PHFA 1W2OA 2VVDA 4OZOA 3OB8A 2PLV1 1H0BA 4FXKB 2Y6HA 2HWE2 3DF0A 4M4RA 4AWDA 2P2KA 1R091 1Z7S3 4NHMA 4W6WA 2VNGA 1V9U2 3FUQA 1CAXA 3AXDA 5A3UA 4HN0A 3UGFA 4CEYB 3URFA 2WR9A 5AFBA 3OD4A 3OUIA 2WQ8A 3A0NA 2JDKA 2RMU2 4BIOA 3H3UA 1Y9GA 1LRHA 2J1RA 2JICA 2IXLA 4FOVA 4FBFA 3T1LA 3AYAA 5FYVA 5CFDC 1ZM1A 5T5JA 1VBC1 4CU9A 2ZEXA 1NYWA 2HYXA 2WYSA 4YZ1A 1W9FA 4BXFA 1S55A 3BI3A 4CDWA 3HWJA 1DGRA 5K0UB 2AUYA 2B7YA 2IFRA 3ORJA 1G9DA 4XILA 3T2QA 4Z8BA 3ZDSA 1ZRCA 4WVMB 4Z07A 1VAMA 2HH9A 3LE0A 2V5YA 1ASJ1 4XMIA 3A0KA 2ZGQA 1PHMA 5CKMA 4NVPA 3Q9OA 1BYHA 4I09A 2VTXJ 1LNSA 1GZWA 1Q8OA 4GAZA 1O91A 4MV2A 1UZZA 3K4ZA 1K5JA 3OGSA 4CP9B 1GWMA 2BFUL 3MLLA 1QGLA 1YYNA 4J1WA 4L8QA 3SC7X 4W8JA 1AYM2 1O4YA 5BNOB 3CU7A 3SCGA 4CCDA 1I9RA 2JDYA 4CCCA 1RUH3 2CGNA 3W5MA 3N9NA 3M3EA 5FP8A 4XAAA 1GZ9A 5FLHA 5A3MA 3KMHA 3WP3A 3FWEA 5JXGA 4HPKB 3N36A 4P9IA 1ENQA 2OUJA 1HQNA 4XJ8A 5DABA 5LATA 4CDQB 4YZ2A 3ZFEB 1WCSA 3NV1A 1D2QA 1ND3A 5A3LA 4XUOA 1NKGA 1AL21 1X33A 4JHZA 1NXD1 4QPWA 2K46A 5SV8A 4K21A 2WN2A 4DB5A 4NHKA 2CTVA 1V6LA 5I93A 4NO4A 3HD8B 1POV3 4KBBA 1H8VA 3LKJA 2BRTA 1RIRA 1LHOA 3NV2A 4XJZA 3KB5A 5F5AA 3LEGA 3RI8A 5JCTA 2FDHA 4DO0A 3OPZA 5EPAA 4IV3B 5GZFA 3WDXA 5CVRA 5L73A 2ZGSA 4P9JA 2WNUA 4D7YA 3AL6A 2GSYA 3L2HA 2VXJA 2VCAA 4OUEA 3JQWA 4YM2A 1UYPA 4Z92B 4DUVA 3P3PA 3WNPA 2R0FA 1MS3A 2VW2A 1I5ZA 4DINB 3RZHA 4XEZA 2YXSA 3V0BA 2PLV2 1SEFA 1SZBA 4LKFA 4YW1A 3B69A 1WW5A 3DECA 2OA2A 3J9SA 4OI1A 4QM8A 5LW9A 2HWC3 4K3UA 1R092 5T5OA 2WZR2 4AQTA 1XNDA 4EN0A 5E16A 5A6QA 4P9YA 1AJKA 4E2GA 5C5UA 1RHI2 5LZ6A 1RINA 2XWJB 2R071 4BISA 1W03A 3DL3A 1DZTA 1RGSA 4XOGA 3Q8AA 4Z82A 2WLPA 3CJIA 1PO11 1UQXA 1CGPA 2EF6A 1YIPA 2QQWA 5FMBA 1VBC2 1JYTA 1OH4A 2Z79A 1RUD1 2YB7A 4ORFA 1IS5A 1YFWA 3SCFA 4Y33A 3LSEA 2VZRA 1NCQA 1S2EA 4PI2A 1TME2 2NMNA 2CU5A 3MW3A 3AYEA 1DIWA 4RS5A 2P1BA 1XNTA 4O65A 4I01A 5FJKA 3K4AA 5I8SA 3WV6A 1NE6A 1ASJ2 1J3PA 4F7ZA 3ZKUA 3P3NA 1HB4A 1C3HA 2BGOA 4QKNA 2VOXA 2VZPA 4XIOA 1HRV1 3B94A 2R0HA 1NA1B 3OGGA 1G7YA 2JDPA 3FX3A 5F39A 4AI3A 1QF3A 2OIIA 4WZCA 1QWRA 1ZZ9A 3OSDA 5FXXA 2NLRA 1KRIA 2VGDA 5FZ1A 4XXPA 2VC9A 4FOWA 1REDA 5GJ6A 4URAA 1WA6X 2RVAA 2JECA 4KH9A 4Q4W3 3T4VA 1SHWB 1T6GC 3CNAA 1Z0HA 4XCBA 1QMJA 2RS33 2CWSA 2ZMNA 3BTZA 4YZ5A 1HLCA 3PNAA 4PLOA 1GZCA 3UESA 3EHKA 5C3PA 3BTYA 3HMYA 3ILFA 3PVOA 3WQBA 1SPPA 5C4WC 1AL22 2G9GA 2GP3A 3EXUA 1W9SA 1AYN1 2ATFA 1F2NA 2X29A 2XKPA 4LA3A 5FYZA 2BV4A 5GM0A 5T50A 4XMAA 5LASA 5A1FA 4ZPIA 3I49A 4AVAA 4YGEA 5AFEA 5A3OA 3SISA 1NCRB 1CIWA 1D2SA 1HXS2 1O5UA 1VBB3 1VPHA 2X5IB 4N7IA 4WM7A 2XLAA 3O5SA 3NRUA 3PTRB 1ND2A 4YSFA 3VBOB 1CPMA 3ZN4A 4O61A 1H4HA 2VCMA 5D21A 4LQRA 3NO8A 1MQTB 2CDPA 3WP4A 3FFQA 3KM5A 2WIIB 2Y8KA 4IDZA 4AXOA 1RUF1 3IIIA 4M0HA 3ZR6A 5BUVA 5ACA2 5ANNA 5GLTA 4BQYA 4OI2A 1CZVA 4BLJA 2VMIA 5FUPA 4CCOA 1QJFA 4XJUA 2Y60A 3POSA 3BALA 4LBQB 2DFBA 4P9GA 2Y33A 3KCYA 5EJ1B 4DMIA 1LHNA 1DU3D 2XJPA 4TLGA 4N53B 2CV6A 1SQ4A 4RYDA 3SQOA 3AZVA 3LA2A 1E5IA 1PX4A 4W50A 5FZ4A 4PBOA 4Y20A 1LODA 3NAPC 3QD6A 4DIQA 1VRH1 2QNKA 4JDOA 1EAH1 2R072 4PQ9A 3M8LA 1PO12 5FYYA 1HQWA 4LKEA 4EV0A 3IIAA 1E5SA 2GC2A 4GWJA 4AYUA 5AC91 1RUD2 5C7GA 5ABJC 3VB9A 4Q0VA 3HT2A 1JU3A 2LROA 5FYBA 4CDXC 2KD7A 4RN5A 3WP6A 1XNCA 4C90A 2P37A 1DGWX 3WP5A 3I2OA 5EZWA 3DYOA 3V0AB 1OXCA 3PLQA 2DTWA 1V6NA 3JBG2 2D5FA 4AL9A 2TBVA 2W9XA 4QDQA 3R05A 4N43A 2PHLA 1D4M1 2TUNA 4Y1ZA 1OOPC 1OVSA 1VBD1 2XJUA 4YWAA 4AW7A 3ECQA 1OMIA 4QT6A 5A7NA 3ZXLA 2IXCA 3KVBA 4ZXEA 2B42B 2ZGNA 4LO8A 1QH7A 3N9QA 1OD5A 2JE9A 2RM23 3GHMA 4NUBA 4XUQA 4A45A 4Q27A 4GA9A 4RFRB 3HOBA 3VL9A 1UY1A 4OUMA 3PUAA 5T3NA 1AJOA 5A80A 2PELA 3PL0A 4D94A 3WR0A 1VAKA 3IDBB 5ERLA 3ENRA 5FMDA 2R7EB 1GOHA 1LOFA 2B9UA 3RZZA 3CMGA 5FRAA 1Z7S1 5C3SA 1UD1A 1YQ6A 4OMDA 3ZMNA 1I6XA 4CUAA 1UOGA 2YBKA 4LE3A 4N9IA 4SBVA 3VD4A 4ZHNA 1JH5A 2X53S 1U5YA 1YI9A 4HLTA 1AYN2 1W8NA 1W05A 3KHBA 2P3KA 5LEKA 2HBTA 5FP3A 3CIHA 1QOTA 1SG3A 4JGYA 3SH5A 4P5HA 1V70A 5EWSA 3OY8B 1WD3A 2XJVA 3LPGA 3N35A 4YW6A 5FMOL 4JKLA 3IB3A 4XFCA 2ORXA 1KS4A 1O6UA 4BJ0A 2ARXA 5T54A 3ZMOA 5C3OA 3KSCA 3QBQA 2RDSA 3I2HA 3NMBA 4JGZA 3VBFC 2B5HA 1O59A 1ZREA 2K9ZA 1CN1A 4AFDA 2XVLA 5JIAA 4D6SA 3NW4A 1MZEA 3ITQA 4RHV3 3CDZB 5CEHA 2K0GA 5T5LA 3WQ0A 5JLVA 1US3A 4QHOA 4W65A 4LHNA 4LIVA 4Q1PA 4JDMA 3S5AA 1UY3A 1RUH1 2W1SA 5HCAA 3FL7A 4AQ2A 1ZZ7A 1WMDA 2VQTA 2E9QA 1PO23 3RI9A 5JOXA 2VMCA 3LIGA 4NAOA 3A4UA 2UU8A 3MLJA 5IJRA 2EALA 4DEVA 2GU9A 4AEDA 1R1A3 4KI5M 1BJQA 5FJHA 2GNDA 4XTMA 1VRH2 1LB2A 1LOBA 2X10A 2DDUA 3BU0A 3GBFA 1JZ4A 4QB1A 5HCFA 4AI0A 1DQ2A 5LB6A 2A5ZA 3U75A 1H2NA 3BIEA 2LUWA 2NQYA 1J83A 1Q8VA 2V73A 3GGLA 5F2SA 2EIEA 4CXWA 5AC92 1L7QA 3UL2A 4GMP0 4M4PA 5CISA 1VAVA 2P6HA 2VE1A 1IZ3A 3ZPOA 5A3TA 4XDOA 3PJQA 1V6OA 2R1BA 4L99A 2A3YA 4YYOA 4DRVA 1SLIA 1H30A 1POV1 2W92A 2Z69A 4OHXA 3I3DA 2JKBA 1PK6A 3U4SA 2HWB2 1JI6A 1M4WA 1TE1B 3I3QA 4PQQA 1LHUA 4C91A 4LUKA 2ZX0A 4NPRA 1AR63 3LWCA 4YZ3A 1UY4A 4BH9A 1D4M2 1VBD2 4MX3A 4XXAA 1AHSA 4BQ5A 3ABZA 4F8AA 2WFPA 1XC6A 3OUHA 4TTGA 1WLWA 2PMWB 5C8CB 1DQ4A 5C9AC 5CFDB 3BVCA 3DPRB 3VUOA 3FUOA 4Q26A 3E5QA 4RA0A 4D6RA 5BV6A 2D98A 3UJOA 2VBBA 2AC1A 2A3WA 3AMQA 1VBA2 3M3CA 5FXVA 3E1F1 1PVC3 5F6KA 1Y9MA 2HWC1 4EWDA 3BOWA 5LA2A 3VBUB 4XHBA 4K40A 2WNOA 4EYUA 1W6OB 4BQ1A 5LA1A 1H1AA 4DY5A 2B46X 1C8M3 1KJLA 5GLVA 2W5FA 3JXSA 5IW0A 1XYPA 5DDJ3 1QXPA 1OKQA 3I59A 3HQUA 2WSUA 2BTVC 3ZKYA 1IPKA 4RD7A 5A6YA 3I54A 2GMEA 4MHUA 3ME2A 2WA4A 5GALA 4HN1A 1EYBA 5IVCA 2G9ZA 4LULA 1W8OA 1UOBA 3ZPYA 1M06G 4FPOB 4FXGB 4QB2A 1W6PB 4X6RB 3HAGA 1BLZA 4R52A 2BUKA 2XKOA 4AGVA 4AE2A 2ZAAA 1Y9QA 5FAXA 4MLOA 1LESA 1SACA 1JYVA 2BYVE 4YW4A 2G4IA 1IKQA 3INAA 3MW2A 1EUTA 2XL9A 4L97A 3LA7A 5BPXA 3U11A 1Y4WA 3VKMA 1GUIA 1CAUA 3IWZA 1ZBE3 2BWCA 2ZX3A 3NNMA 1APNA 5I0RA 3PDQA 1GQPA 1ZBA3 4Q4W1 2TEPA 2RS31 1GV9A 2DVGA 2XJSA 4LO7A 4ZXKA 1DZRA 5HV4A 2R6QA 2JWPA 3EJKA 4P9XA 1BKZA 5HI0A 3CKHA 4QXHA 3MW4A 2RG4A 3AKQA 3IDCB 3X29B 4BE3A 1POV0 5FZ7A 3MF6A 1ZZ6A 5E6HA 3VKFC 1BMV2 1OF4A 3CL1A 2HLEA 2QKDA 2PYTA 5GZDA 3K75B 1X36A 4LBLA 3EMRA 1AXKA 1C1LA 1QJU3 1VBB1 3CQOA 3H50A 3K3NA 2VH9A 3SEEA 4YVWA 3NNFA 4LEJA 4BQXA 5I91A 3MEPA 1UKRA 1OSGA 4B8EA 1WD4A 1OQDA 2LS6A 1W3XA 3MICA 1ODNA 1J3QA 3SHRA 3FJSA 1PVXA 2VUAA 4FI9A 1YC61 5DG2A 5FYSA 2GALA 5C4WA 3TB0A 5GLWA 3O1OA 3GZUC 5DAPA 2ZKLA 1G9CA 2DFCA 1SBEA 3PVEA 3ZFGB 1L7LA 3G6JB 5D8AC 3AP7A 4JDNA 5J7MA 1UO9A 5FZGA 1Q8SA 4AI2A 4RS5C 2FDIA 5B2GB 5FPUA 1W6NB 1UIKA 2W3JA 2Y34A 4QGLA 4Y26A 1IPJA 3B5LB 4C0BA 5CA6A 1X8EA 4MGKE 3GHNA 5CB7A 3VBHC 1QDCA 3LAGA 4UI9L 1RUNA 1CAUB 1UY2A 3RZGA 5FY1A 2C9KA 2W1UA 4HSLA 1O3RA 4UFLA 1DLLA 3AM2A 3NJXA 5H9RA 4E4SA 2WT1A 3K4DA 1XXNA 2ZHNA 3MV11 1NQJA 1OA4A 4QPGB 2IZWA 2AREA 4I0WB 4BMEA 3LCPA 3RMYA 2EXIA 4PI0A 4AFCA 2Q8DA 2XOMA 4UWDA 2BWAA 2CWMA 5AVPA 2VUDA 1FOD3 2N7GA 1VRBA 5IVBA 2VOVA 1ZNPA 3ZOIA 5F5CA 4S2HA 5DPNA 2ARAA 3T0AA 4EN7B 3KGZA 1F35A 3NAPA 3UETA 5EP9A 5FBJA 2EIDA 1ULGA 4A2UA 4LIUA 2G9FA 1H6YA 1VR3A 3NJYA 4HFSA 2ZHKA 4R8HA 3IZOA 1KDKA 4Q4V3 3O7OA 3KS7A 2RM21 5ABJA 3SH4A 2W08A 4L0PA 4AQSA 2DBIA 5CNAA 1GSLA 1VBE3 3R6SA 2ADEA 3B9IA 2IWGB 3AP9A 3MFCA 1UY0A 3QCWA 3T3YA 1FATA 3S57A 1TMF2 2GP5A 2PAKA 3I8TA 2HWF3 4JQTA 3K48A 4IEYA 2RS32 3PMEA 4AVCA 3ACLA 2JIGA 1OBNA 5FPLA 1AXYA 1G6NA 1ZVFA 1COV2 1KGYA 3OF1A 2G19A 4Q29A 3B9CA 4GH4C 4HG6B 3TN93 1ODMA 1OOPA 2W1QA 1FPN3 3VBSA 1O3TA 1ZRDA 4KGQA 4CSWA 4BCUA 3VGIA 2Q4SA 4FPLA 3NV3A 3MUZ1 4LOTA 3RMXA 1D4VB 1H2LA 2FZ2A 2RHPA 3ZVXA 5IATA 4Y24A 4ISRA 2KA3A 2B8MA 4HK9A 1AUYA 4QGNA 5FZOB 3BYWA 4EJRA 3WNKA 4XZPA 3FHQA 3UYJA 2VZOA 3DXTA 2WYFA 4IE5A 4UYBA 5F9TA 3DN7A 2QBXA 3H42B 1OPMA 1S0DA 2AEYA 2FQPA 3CO2A 4P02B 4CYDA 4JRLA 4AF9A 4R9BA 5K9YA 4B7EA 4MXWA 4YVSC 1GQGA 2BU9A 2A7AA 4D3WA 5LWBA 2WNVB 4RHV1 5EYYA 4FTSA 3ZN5A 3WUDA 4R4ZA 2QQJA 2VNOA 5FPXA 5LA0A 2GC0A 2WNEA 3A7QA 4F3JA 4ASLA 3IMNA 4CDXB 5K8SA 5JR7B 5K7PA 1Y7BA 2ZJCA 4IGOA 1EAH3 4PIZA 3T4HB 4CXYA 1IS3A 1PO21 2VM9A 2VMHA 2Q0AA 5FUIA 3WF4A 1QKQA 2P3JA 3VBFA 1UIJA 1R1A1 5FR3A 1CR7A 2RJLA 3I3EA 3RWKX 4B7KA 1DCSA 2WZ8A 5J1XA 4BK4A 1JOJA 3BTXA 5F5QA 3LFIA 3VZJA 1NQDA 3AKPA 4LUMA 2E31A 5AVAA 3N9OA 2OUHA 1HV0A 1UX6A 1LCLA 2R1DA 2Y6FA 5KXEA 5ANQA 4GMP3 1ALYA 4Y4RA 1OUXA 4FQ4A 1UYYA 3BUCA 4YW3A 4QPIB 5FZAA 3M2MA 2XGXA 1YCIA 3OEAA 4NN0A 1CPNA 1WCDJ 1V6KA 1H8TB 3FBYA 2HWD3 1JUIA 4L9BA 5A3NA 5CFCC 3F2ZA 1AR61 1QHDA 1WUVA 3THTA 4CVUA 3J7HA 3PMSA 2X05A 1UX7A 1W6MA 4V2WA 4QHBA 1UU6A 1Q3EA 3VHNA 3S0MA 4OULA 4JGYC 5H9QA 2C26A 3OYWA 5FMCA 4CCJA 2A73B 2RM22 2UY9A 1PM7A 1ENSA 4HONA 1LOEA 1XBFA 2IVJA 2G1MA 4OYUA 1NT0A 2VZVA 3VZOA 1N47A 3BODA 4PDWA 3U10A 2QCSB 2ZGPA 3H3ZA 4OHWA 3SLIA 4E2SA 5JSPA 1C8NA 1N3PA 3AVSA 4JGZC 5FQ0B 1MACA 4TLFA 1FMD3 5E88A 2WDBA 5JXHA 4LBNA 1PVC1 2BJSA 4U2AA 5FREA 4DEQA 1XOYA 2RV9A 3MI8A 1KXGA 1Q8PA 2OPWA 2VZQA 2I74A 1RUE3 2DCYA 2J1TA 3N7MA 1AR73 3O0VA 4HETA 4CE8A 3U4XA 5A33B 3USUA 4IEVA 3JCIA 1C8M1 3BTAA 4RQPA 4ZS3A 5L36A 2FDFA 3THPA 2XBO3 4HSJA 5DDJ1 2YYOA 2DVFA 4QKDA 4C1XA 5C9AA 5I0UA 1ULPA 1S0FA 1V6MA 2MEV3 1K5MC 4NJ4A 4QGMA 1TQ5A 2ADDA 4Y22B 4CUGA 1FT9A 4M0NA 4AEDC 1UZVA 5IWFA 3ZSJA 3AJYA 4IL7A 5IAVA 5LY1A 3W20A 2QJVA 4RR3A 5A1AA 1YIFA 1BVVA 4WM8B 3VD7A 5JZGB 2Y0OA 5LRSA 5FKBA 1CJDA 5FO8B 3MLKA 3HBKA 5LRRA 4NRPA 3M7AA 4BYYA 1JXNA 5FY7A 4RHV2 1PZ8A 4MG2A 1OLRA 3ETPA 3WVJA 2D3PA 5FY5A 3WOGA 5F8PA 4H7LA 2YU1A 1OLQA 3VKNA 5I8TA 3O1TA 1PK6C
chains in the Genus database with same CATH topology
1C1FA 4JTOA 4XBNA 3PTYA 2A6VA 3WDUA 1Z78A 2O1QA 1ZBE1 2WLQA 1PO22 1ZBA1 1CAXB 1XYOA 2VU9A 2VG9A 3N3HA 5BNPC 2WT0A 4HBNA 3WHUA 2RR13 2WS92 2CAVA 2D6KA 2D3RA 3AZXA 3G7DA 3ILNA 2Q1ZB 2PN5A 4LE4A 3TOJA 4XYXA 1MS4A 4LO4B 3O14A 5FLIA 4CDWB 3VZKA 5I8YA 5CIRA 4MZUA 2LALA 5KC5A 4AFBA 1QJU1 3RJRA 1AR92 4OVEA 1RMU3 4K8FA 2Y0IA 1BZWA 4P9WA 3PJYA 3OTFA 2AH2A 3BPZA 1E57A 1GZWB 3MPBA 2XG3A 3WQ1A 5J48A 4DZGA 3JD72 2E7TA 5FFOC 1QJX3 1QXJA 2W52A 4DQAA 1MS0A 1X8MA 5JPMB 2GH8A 2W39A 2XJRA 4AFMA 3WG1A 4AVSA 4FCAA 2CYFA 5JMCA 1PVC2 1ND3B 1PIV3 5GZEA 3VKLA 3V65A 2E6VA 2XJTA 3ZSLA 2A6WA 3ZN6A 4DOUA 5FOJB 1C8M2 2DUQA 4XJAA 4YARA 5DDJ2 5D8AA 2DUOA 4MVTA 1A8MA 3AYDA 4YLZA 4OHVA 1YO8A 1SMVA 1RUJ3 2R043 4G9SB 2ZGMA 3VBHA 1MS8A 1UPSA 2ZGLA 2XB6C 4COUA 4ONUA 1FOD1 3RPQA 1LEMA 4EROA 3VN4A 3CEWA 3KT1A 2WNUB 3V56A 2I07B 4J1XA 3AP4A 3QH6A 4DNYA 4G4FA 1S0JA 2ZGUA 4WV8A 4Q4V1 3CF6E 4M01A 3ZSMA 1XE8A 3V0BB 4YVWC 1MS1A 1AVBA 2UURA 1VBE1 2D6NA 3WG3A 3KGLA 4KWKA 4WVZA 4JTNA 4IEOA 1ZBE2 3PHMA 4ZKTB 5KWRA 1H9PA 1NE4A 5D1IA 1ZBA2 2HWF1 2IXIA 4YG3A 2Y38A 5DUWA 1RB8G 3EO6A 1MEC3 4FPHA 1F5JA 4AHWA 3TN91 4UXAA 5BNQA 1C5IA 2BPA2 2H0BA 1FPN1 5C6CA 3AKSA 3CJIB 3M3OA 4BZ4A 4Q0QA 4CEWC 5L7OC 2DCZA 1Q56A 2E63A 1QH6A 1AZDA 1NCQB 4KG0A 2ZS6B 4COWA 4QM9A 4RS5B 4Y1XA 4CDUC 3BIWE 3B00A 4UBHA 5JWPA 4K20A 2WINB 4A7KA 4GH4A 1DFQA 2HEYF 2ZAHA 2ZOEB 1YRZA 4R9AA 4TZDA 1OA3A 1NLRA 3OBRA 1HDKA 3RSJA 4BOWA 3TAYA 3E6DA 3KD4A 2E7QA 3ETQA 5GZGA 1UKGA 2CGOA 1IS4A 1LU1A 3D82A 3M1HA 4HT1T 1L3JA 3KT7A 1H1MA 3AXEA 2VY0A 4COVA 1O3SA 1NLSA 4YVSA 1LGCA 3J8F3 1N1YA 2YGLA 3M3IA 4XHXA 5DZEA 1VJ2A 4FO9A 4PLMA 4WM7B 4CTEA 1ND2B 3IKWA 4KL1A 3S30A 4FPCA 1LGBA 4GMP1 2VMGA 2HEWF 1PGSA 3VBSC 1FOD2 1DYKA 1HRV2 4P9LA 3I7DA 4LLOA 3KQRA 3POWA 4DRRA 5KBFA 2HWD1 3UJQA 3H1MA 4I30A 2OZJA 4BMBA 1W2UA 5BXXA 4Q4V2 3NL1A 1NXMA 4X8PA 1FAYA 4V1PA 3UKNA 1VBE2 1UMZA 4OUSA 3W59A 3WDTA 1OQ1A 3D0SA 4PIXA 1WW6A 1WGPA 2HWF2 4IV1C 5KHGA 1GICA 1CAVA 2EXKA 4Y20B 2YZ4A 1X7NA 2LTNA 1FMD1 4HVRA 1EPWA 5CFCA 2DYCA 4FTEA 1Q5OA 2DTYA 3IPVA 1FPN2 4XQWA 2ENRA 3ZIXA 1RUE1 3AMNA 1AR71 4GIQA 4XF1A 2ES3A 3ZFFC 1V9U3 3VDDC 2UWBA 3B93A 3HR9A 4I02A 4IEPA 4LTAA 4BA6A 2XBO1 2XJQA 2E51A 5J36A 2R16A 1CONA 2DVDA 2OVUA 1ONAA 3ZXEA 2RMU3 5JSRA 1AXZA 3ZSKA 1FI2A 2MEV1 3WDVA 3FE5A 2MHFA 1ULEA 2JG8A 4O9GA 3VBRA 1YFUA 3ES4A 5SV5A 4N43B 1RUF2 3MIFA 4A7ZA 3WW1A 4R4XA 3RDIA 5JIUA 1H2MA 4JAAA 4Y1VA 1RJ7A 2WWSA 3S7EA 1RUOA 2V09A 1IKPA 4CEYC 3L2YA 3RRDA 4A7YA 5KC6A 1K5MA 4OLLA 4X8NA 5GLUA 3M3QA 3RYKA 4KQ7A 4OHZA 1ZZCA 1G9BA 2D43A 4LBKA 1EAH2 1UU4A 3IM0A 5IUQA 1LHVA 5K0UC 1LHWA 2D6OX 2LM3A 1YI7A 2RR11 2DU0A 2ZA9A 1GFF2 4QXKA 2RE9A 4HKOA 1X50A 1HIXA 4JGYB 2Q8OA 4KWJA 4PDWC 1R1ZA 2VPVA 2C5DA 1PZ9A 2VXRA 4ATFA 4FPKA 3S7IA 5BNOC 4D69A 2QZ3A 2XL7A 5BNPA 3RWNA 1RMU1 4JGZB 1CAWA 1V6JA 3PVNA 1N3OA 2HWD2 2JJ6A 4RQPC 5FPZA 4COZA 4LT5A 3QACA 3NJZA 4CDQC 4XF3A 2UY8A 1BVP1 3ZFEC 2FZ1A 3ZYIB 1YJLA 3M70A 5T55A 3RJ2X 4K1YA 1QJX1 3AK0A 3ZXKA 2ETEA 1BK1A 4FPJA 1Z7S2 2RJKA 4RR3C 4Y4YA 5JAXA 4AEMA 1RUG3 3ELNA 3IT8A 4LO5B 4AEDB 2R32A 1FMD2 1ULCA 3APBA 2FMDA 1PIV1 1LJ7A 2PQQA 4XPVA 4S2GA 1RUE2 2Q30A 4KG8A 4IV3C 3GALA 2WZR3 2NMOA 1R083 2JG9A 3H7YA 4PCRA 4FPGA 2TNFA 4ATEA 3GBGA 1RHI3 1O4ZA 2JEMA 2ZGOA 4DY3A 5HBAA 1GKBA 2I2SA 5FTTC 2WKKA 3FLRA 3WCRA 1PK6B 3C3VA 1RUJ1 2R041 2WFF3 4NWWA 1FXZA 4KU7A 3USSA 2ZTNA 4RFT0 2XVGA 4H7MA 1ZA4A 1GLHA 4OZXA 1IGOA 1QNYA 3RQ0A 1G86A 1TME3 2C0ZA 4Q1RA 4ZU4A 2BEOA 2GN3A 1RUH2 1RC6A 3WHTA 1F5FA 1XNBA 2MNGA 3B7MA 3ZO0B 5IT6A 4JC1A 4NOTA 2IXHA 4Q0SA 1NOVA 4LBQD 5J09A 4M3CA 1MR5A 4LBMA 1F8VA 3H1WA 2ZZJA 3KZ4C 1A3KA 4XF0A 1MEC1 5FCCA 3NKTA 1NZCA 1JTZX 2YHJA 4MSVA 1LEDA 2D3SA 2O8QA 4A3XA 3AMPA 5A32A 3I59B 2C1FA 5EV7A 4Y1YA 3RYRA 5IK8A 2QE3A 4AK3A 3RS6A 2ZACA 2F4PA 5HCBA 4COYA 1HQLA 4I3GA 2BQPA 5FBZA 1NG0A 4M3CE 1N1TA 1N1VA 3JZVA 1V6IA 2AZ5A 2GNTA 1RMU2 4ZU7A 2H0VA 3AMHA 1PGL1 1EV13 1HXS3 1N1SA 1VB4A 2RS53 3DV8A 5KXCA 5L7OA 1W0OA 4CEWA 2O0OA 4YW2A 5DZFA 1LKNA 2R30A 3AZZA 3J26N 1FNZA 2IXKA 2ZABA 1B35C 1LTEA 1QJX2 4QQPA 1WCKA 4GWMA 4HVOA 2SBAA 4XBQA 5C8WA 4CDUA 2GDFA 2HWC2 5ACA3 2GMPA 3B3QE 4AHZA 3SH3A 3E6CC 1J1LA 2GH2A 2VOKA 4EN8B 1H9WA 4QPYA 2X5IC 3E5XA 4FP2A 1GNHA 1IQAA 4AQ6A 4MYEA 3J8F1 1AX0A 1MQTC 2ARBA 3J4UH 4FPYA 4H55A 1PGW1 3S6PA 5DUUA 4ES8A 3FFZA 3WW4A 1PNGA 1W6QA 1CJPA 4K1ZA 1W39A 2R042 4YVWB 1QU0A 4GKXA 4PBPA 2BFUS 4DS0A 3WUCA 5JI9A 4QX5A 5TSWA 1DHKB 5C4WB 1QJZA 1CVNA 3ZXDA 1VALA 4TWTA 1SBDA 1MZ6A 3JBG3 3SXWA 4CP1A 1EY2A 4YFWA 4Q4W2 4Q4Y3 1ZRRA 1UW8A 1JYCA 2DV9A 1MZFA 2VVFA 1HW5A 3B02A 4DPNA 3LOIA 2A70A 1XQNA 5DXDA 5FO7B 3AYCA 3JUUA 3ZXAC 1DG6A 2P3IA 3QLQA 2GNMA 4E2QA 1LOGA 1SCRA 1TNRA 1A78A 1VBB2 1V9U1 4MXVA 4Q4X3 2CL2A 5BNNA 4HMZA 3O0XA 1KS5A 1F9KA 3BOPA 4URTA 4IESA 5EXOA 2GNBA 2A6XA 2A71A 2RMU1 3VV1A 3ILRA 3JQXA 1WLCA 2R063 1WLDA 4H14A 4IV1A 3R4UA 4PIYA 3NAPB 4K9SA 1DF0A 2D44A 2PHDA 1PGL2 2D7FA 2E7AA 4QD2A 2OPKA 4XTPA 2JENA 3IBMA 1IHMA 1KJRA 3ZFFA 3VDDA 5ABJB 4MGZE 4XETA 1AX1A 1SLLA 2JDZA 3R4DB 3LB9A 3D8CA 2QUOA 4NR1A 2OZ6A 2GC3A 3N4MA 2ET7A 1DDLA 1UN1A 4YGBA 5DUXA 2B39A 3VBSB 1OOPB 1LULA 1GQHA 2XVKA 4OI4A 4FP3A 1YFXA 2VVEA 4IEQA 3FHIB 3J8F2 4CEYA 4UW5A 2CY6A 4ITCA 1YHFA 4LNVA 1PNFA 4LHKA 1BEV3 4YNIA 4DFSA 5KHKA 3R4SA 1JN2P 4UW4A 4HVQA 1D0GA 3MIGA 3VZMA 4AI1A 2HEVF 3OJBA 3SMHA 2NP0A 1GR3A 4GQ7A 4MXWB 5K0UA 3QH7A 3RYPA 2PFWA 4WVMA 2HWB3 3TNQA 5FLJA 4BWOA 4KU8A 1MZ5A 2PAEA 1JW6A 3SNMA 1S0IA 4PF5A 3ZFFB 1O3QA 2JG8C 3VBRC 2JD4A 4B29A 1J1TA 4YW5A 2PHTA 5BNOA 5H9SA 5J96B 4IQPA 4TSVA 3MPPG 4XF9A 5J37A 1RUG1 3VBFB 3WXPA 2ZGTA 3LOBA 2VNRA 4HPKA 1QQP3 1VBA3 4HKLA 2JE7A 4CDQA 1U5ZA 2JX9A 4XFHA 2P17A 1UF2C 2ZGKA 4XBLA 3H1YA 3ZFEA 4C1WA 2WZR1 1ZX5A 5BYNA 1R081 4FSJA 1DBNA 3TNPB 1OPOA 1RHI1 1XE7A 3ZXGA 3H0OA 5C8CC 2WFF1 3DPRC 2JXAA 3ZXFA 1C57A 1QJY3 4LR4A 4BHPA 1W6MB 2D97A 1TME1 3MFAA 3OYWB 4IV3A 1IOAA 2ZX2A 5EJ3A 1A6CA 3VBUC 3L9JT 4C0HA 4WVVA 3VHOA 3DGTA 4FTBA 4XQDA 1BCXA 4PDWB 2RS13 1LECA 4IEUA 2WJSA 1R1A2 2C9AA 3VLBB 3B01A 4AI8A 1S1AA 2PHXA 1OQEA 2BGCA 2YDEA 4IXLA 3USUB 1J3RA 3PVBB 3AKRA 4RQPB 4F83A 1KDMA 2D5HA 5C9AB 2IFWA 3WINE 2VOWA 3LA3A 4LLFA 5CAZA 1QOOA 1FYUA 3D6EA 1KQRA 2WZPP 1AR62 3IDEA 4RR3B 2OYZA 1BXHA 3VL8A 1XU2A 3E97A 2IXJA 3FMGA 5CG8A 4FVVA 1EV11 1HXS1 4D7TA 2RS51 1X82A 3M4FA 4LA2A 2WQ4A 2JG9C 3GNEA 4IEZA 1JHNA 5J98B 1WW4A 1NA1A 2EVXA 1BBT3 3T1MA 1SLAA 1SLCA 5T5PA 3AMMA 3OCPA 1UL9A 5ACA1 4XQ4A 1RUG2 1HRI3 3JB4C 1KFUL 4AGRA 1JBCA 1DZQA 2QZ2A 2A6ZA 4N7UA 2VECA 3WCSA 5DUVA 5FMOS 4ISQA 4RL7A 3CJXA 1RUC3 5EFUA 3ZYJB 4IEXA 1S2BA 4AEJA 1B35A 1R082 1RTVA 4BM8A 2CGPA 5CBLA 1YJKA 1B09A 3ZFGC 2WFF2 4MH0E 1SLBA 4M00A 1DGWA 1NCRA 3DKWA 2X5IA 2ZMKA 4ES9A 4I2OA 4YFZA 4EN6B 3VBOA 1XRUA 1A8DA 2O8OA 2VW0A 4Q0UA 4E27A 3ZSEA 3OD0A 2XUMA 1MQTA 2DCTA 1G8WA 1YWKA 2DWRA 3JBG1 1YUDA 2Z42A 4HZFA 2GC1A 2GMMA 3E5UA 4YGDA 3R0RA 4Q4Y1 4QPGC 1H4GA 4RSUA 5EYXA 2DVBA 4PLNA 1OA2A 4GB33 4LBOA 3MYXA 1GYKA 4LBQA 3UKTA 2H6BA 3MDPA 1QXRA 3ZN6B 4Z1VA 4LO6B 5IK5A 1RVF3 1TMF3 1U5IA 2X8KA 4N53A 1C4RA 4BLIA 1ENXA 4X6QB 3ZX7A 1UCXA 5D8AB 3WY6A 5H9PA 1COV3 4CP2A 3JB8A 2FHRA 1C28A 5GKAC 2ZHLA 1QJU2 4Q4X1 5FOBB 1ZZBA 1B35B 3VBHB 1UZYA 2YUEA 4EWEA 3AX4A 2QDNA 1V00A 3LSDA 2R061 2NZ9A 4Q0PA 1EV12 3WT3A 2RS52 3V0AA 1DQ0A 1QY4A 4XDQA 1OI6A 4MGIE 4FAHA 2BNNA 2R49A 1BQPA 1S0BA 5JDBA 2HYKA 3H8UA 4B4PA 3MF9A 1SFNA 4EN9B 2W0XA 1GBGA 3KCXA 5C33A 2QQPA 1LR5A 4HL0A 2EXHA 4JQRA 1QNWA 1MS5A 5CU1A 1KD7A 5F6LB 4XJWA 3U07A 4Z2WA 4FAGA 2QDRA 4I0AA 1RUI3 1O7FA 3GBWA 2CAUA 2XWBB 2BVVA 5I0SA 2UWAA 4N90A 3V64A 3FC0A 5J3UA 2D6LX 2K2SA 2WNVC 4CP0A 1BEV1 4FOYA 4XFBA 3LZZA 2VW1A 1SLTA 4GH4B 4KNCA 3TBDA 3OY8A 1QDOA 1WMEA 4S2DA 1O4TA 5FDBA 1AR83 4YG0A 3SCHA 1MS9A 2QFEA 5BNNC 3ASIA 4I3PA 2HWB1 3I2DA 3NV4A 2ZMLA 4QMAA 2ZZQA 3ZYPA 1HKDA 2EA7A 1VP6A 2YMZA 2D6PA 2ILMA 2WC2A 1ZYBA 2DCKA 4Q4Y2 4UW3A 5IK7A 3TWIA 2YY1A 4IETA 3WLUA 3TN92 1F31A 1WW7A 3POYA 4IERA 1RJ8A 2HWE3 4QQHA 4YVSB 5JOYA 1H2KA 4EWAA 1YLLA 5LK5A 1EPZA 3WDWA 4QPIC 5GLZA 1QQP1 3AKTA 1YNAA 1VBA1 4TYSA 2NM1A 1H8TC 5JOZA 3AFGA 1J58A 3D5OA 5E8AA 4Q4X2 2HKXA 3TRSB 3FLPA 1WBFA 2UYBA 2PTMA 1S2KA 5KXBA 2R062 4NWVA 2BW8A 1S0GA 4E4DX 3WZ1A 2ZX1A 3BCWA 2DU1A 5I0TA 1SCSA 1QJY1 4LBJA 2EAKA 1LOCA 4XFIA 2YC0A 4B4RA 3MGUA 2AENA 4AVTA 3FLTA 4ZU5A 3WG4A 4WVWA 2WT2A 2WL1A 1AYM3 3UKVA 5JSOA 2GN7A 4N9HA 2RS11 2I45A 5C8CA 1CAVB 5CFDA 4Q8LA 5F1RA 3DPRA 5CFCB 3ZYGA 3IPVB 3U0ZA 2XHKA 4XW3A 2AGSA 1KITA 1IS6A 4XE9A 1AX2A 2AR6A 1SFYA 3AZWA 2YGMA 4WM8C 3VBUA 5JZGC 1W6OA 2F6BA 1WA4A 4Q2FA 3NKGA 3ATGA 2WS93 3FBMA 4YRDA 2ERFA 2JG8B 1BEV2 3VBRB 5T52A 2ZX4A 1LOAA 5JPNB 2E53A 3AP6A 1CESA 4K6BA 3WD5A 1BMV1 3WG2A 1CD3G 2VULA 2GZWA 2YPJA 4LHLA 1EP0A 1AR93 3E6BA 4Y5Z0 1W6PA 2BVBA 4D7SA 2D6MA 4BPZA 2FBEA 1HX6A 1K5MB 3NVCA 3W9AA 4SLIA 2NN8A 4QQLA 1O5LA 1J59A 1BBT1 3JD73 3QOPA 3SITA 2Q1MA 2PHUA 4OI0A 2PLV3 4AVBA 2A3XA 4CDWC 2VQAA 1AR72 1UAIA 1HRI1 1R093 2VUJA 1Y3TA 3ROUA 5L19A 1REEA 3K51A 1QQP2 2XBO2 3GZTB 4JV4A 4L2NA 3N7JA 1RUC1 1XNKA 1WLTA 1XYNA 2MEV2 2WSVA 1VIWB 3ALQA 1G9AA 1TNFA 2XH6A 1VBC3 4Y1UA 4YM0A 1NY71 2H6CA 4B4QA 4XFFA 5BNPB 2OW4A 2YROA 1URXA 2DURA 1CAWB 3VZNA 4FPFA 4FQZA 4R9DA 1WMFA 1ASJ3 1QJY2 5CG9A 4XF4A 1WBLA 2PHWA 3WDYA 3ZIWA 1ND3C 4DXZA 1DGRN 4YGCA 3AB0A 5E1RA 4L11A 3MIBA 2BBVA 4MUVA 3ZFGA 2RS12 2WQZC 1XU1A 2DF7A 1GNZA 1DQ1A 1SBFA 4HANA 4W6XA 2QVSB 2DUPA 1W6NA 2RR12 4GB31 3ZYRA 2NPIA 4FOQA 1FX5A 4PJYA 2PAMA 1VLNA 3HT1A 1RVF1 1TMF1 2EIGA 1I3HA 1YFYA 2P34A 2KXLA 4GULA 2SLIA 1NA1C 4YM1A 1AL23 2JG9B 1OHFA 2IC1A 1CX4A 2WNUC 1COV1 4P14A 3NWKA 2ZCWA 1G9FA 4QPGA 2ZBJA 2BNOA 4CZSA 1AF9A 4MGYE 1W0PA 2Z2SB 3WNXA 1AL0G 3UK9A 3AP5A 2WA3A 2UYAA 3UV9A 1S0EA 2XLFA 4AGGA 2EXJA 4XFGA 1REFA 1PZ7A 2DCJA 2ZGRA 4QU2A 2Y26A 1ULFA 3KLSA 4GWNA 1KFXL 3JU9A 5CADA 3CJIC 4G3YC 4YG6A 3RNSA 4W6YA 4L92A 4M3CB 3VZLA 3W58A 1BBT2 4AG4A 5GZCA 1LU2A 3WX5A 1NCRC 5LK7B 2A75A 1PIV2 1TEIA 3VBOC 1NCQC 5KXDA 4AFAA 1ENRA 1HRI2 2PHRA 1ULDA 3ST7A 3WW2A 3OBTA 5A32B 1U5XA 2ET1A 5FO9B 4FT8A 4OFGA 1DQ5A 2R073 1RUC2 5LEJA 4S2FA 4QQOA 4M3CF 1RUI1 3KCCA 4I0BA 1RUJ2 1PO13 1MVEA 2AYHA 3EBRA 3D4KA 1RUD3 2ZKNA 3LGRA 3N7KA 4XIKA 1NY72 1OFNA 3FZ3A 2VQ0A 3VHRA 4BIFA 2XPJA 2Q5TA 4N53C 1U0AA 1DGLA 3GYDA 3TYJA 1SDWA 5L7OB 3AFKA 4CEWB 4RGGA 1OFSA 1AR81 1MVQA 4R9CA 1HRV3 5JI7A 2DVAA 5HXVA 5KHJA 3N7LA 3IN9A 4CDUB 2WNVA 2ZPXA 1DYPA 3AJZA 1MEC2 4WM7C 1FV2A 4J6GA 5DZGA 4AHYA 4KWLA 4GB32 1ND2C 3C2UA 2HWE1 4CDXA 2GAUA 2XLGA 4B3NA 1RVF2 3ZXJA 1I1EA 3HQXA 1AYN3 3H7JA 2B45X 3RG0A 1VB2A 3O0WA 1W6QB 1LGNA 3HIFA 4JRAA 4CRQA 4AHXA 3OGJA 4ASMB 1JYIA 2HJIA 4QQ2A 2W68A 1QOSA 2UWCA 2NYYA 3T2TA 4JCKA 4YZ4A 1FNYA 4O9EA 4AVVA 4UW6A 4HKWA 3VHPA 4U36A 4JVAA 4XFAA 4QPIA 3I4IA 1H8TA 5DG1A 4OHYA 1RUF3 1UPIA 4KGGA 4XJ9A 2FMYA 4GALA 5JOWA 3HN1A 4META 1AYM1 5E89A 3KT4A 4GXLA 1N3QA 2EAAA 1ZRFA 3EQEA 4IEWA 1LENA 1PMIA 4E4ZA 4E9KA 1PGW2 1Q8QA 3BB6A 4GKYA 5FQ0A 1VRH3 5KHIA 4N43C 3MIEA 5BNNB 1CQ9A 1RUI2 3H9AA 4H3WA 1H1IA 5A33A 3WW3A 5AC93 3ES1A 1U12A 1HV1A 4FPEA 4WBBA 2WS91 1DQ6A 1RL3A 3MIHA 1Y43B 4IV1B 2D40A 2MPFA 3WQ7A 3DUIA 4HK8A 4K7JA 2D93A 3CLPA 3HBZA 4Y22A 1S0CA 4INDA 1RITA 1GANA 1LOFC 1ZZ8A 2A6YA 4AEKA 5BY5A 3NSTA 1D4M3 1AR82 1VBD3 5KHHA 3VDDB 1FV3A 4WZFA 1AR91 3GF6A 4WM8A 1JUHA 5IK4A 4RGAA 2PA7A 3O12A 5JZGA 4Q8KA 3GZAA 3MIDA 1C5HA 3AZYA 3BU7A 2YV8A 2ZHMA 1D0HA 2KM2A 2Z5WA 2BNMA 3VKOA 4NHLA 1UU5A 3JD71 1YXWA 2CNAA 3D0JA 4UBGA 1Q43A 2PHFA 2VVDA 2PLV1 1H0BA 4FXKB 2HWE2 3DF0A 4AWDA 2P2KA 1R091 1Z7S3 4NHMA 4W6WA 2VNGA 1V9U2 3FUQA 1CAXA 3AXDA 4HN0A 4CEYB 3URFA 5AFBA 3OD4A 3A0NA 2RMU2 4BIOA 3H3UA 1LRHA 2JICA 2IXLA 4FOVA 4FBFA 3T1LA 3AYAA 5CFDC 1ZM1A 5T5JA 1VBC1 1NYWA 4YZ1A 1S55A 4CDWA 3HWJA 1DGRA 5K0UB 2AUYA 2B7YA 2IFRA 1G9DA 4XILA 4Z8BA 3ZDSA 1ZRCA 4WVMB 4Z07A 1VAMA 2V5YA 1ASJ1 4XMIA 3A0KA 2ZGQA 1PHMA 4NVPA 3Q9OA 1BYHA 4I09A 5JVVA 1Q8OA 1GZWA 4MV2A 1O91A 1UZZA 2BFUL 3MLLA 4YM3A 1QGLA 1YYNA 4J1WA 4L8QA 1AYM2 1O4YA 5BNOB 3CU7A 3SCGA 1I9RA 1RUH3 2CGNA 3M3EA 1GZ9A 5FLHA 5A3MA 3KMHA 3WP3A 3FWEA 4HPKB 3N36A 4P9IA 2OUJA 1ENQA 1HQNA 4XJ8A 4CDQB 4YZ2A 3ZFEB 1WCSA 3NV1A 1D2QA 1ND3A 5A3LA 1AL21 1X33A 1NXD1 5SV8A 4K21A 4DB5A 4NHKA 2CTVA 1V6LA 5I93A 4NO4A 3HD8B 1POV3 4KBBA 1H8VA 3LKJA 1RIRA 1LHOA 3NV2A 4XJZA 3KB5A 5JCTA 3RI8A 3OPZA 4IV3B 5GZFA 3WDXA 5CVRA 5L73A 2ZGSA 4P9JA 2WNUA 4D7YA 2GSYA 3L2HA 3JQWA 4YM2A 4Z92B 3P3PA 2R0FA 1MS3A 2VW2A 1I5ZA 4DINB 4XEZA 2YXSA 3V0BA 2PLV2 1SEFA 4YW1A 3B69A 1WW5A 3J9SA 2OA2A 4OI1A 4QM8A 2HWC3 4K3UA 1R092 5T5OA 2WZR2 4AQTA 1XNDA 4EN0A 5E16A 4P9YA 1AJKA 4E2GA 1RHI2 1RINA 2XWJB 2R071 4XOGA 3DL3A 1DZTA 1RGSA 4Z82A 2WLPA 3CJIA 1PO11 1CGPA 2EF6A 1YIPA 1VBC2 2Z79A 1RUD1 4ORFA 1IS5A 1YFWA 3SCFA 3LSEA 1NCQA 1TME2 2NMNA 3MW3A 3AYEA 1DIWA 4RS5A 4I01A 5I8SA 3WV6A 1NE6A 1ASJ2 1J3PA 4F7ZA 3P3NA 1C3HA 2VOXA 4XIOA 1HRV1 3B94A 2R0HA 1NA1B 3OGGA 1G7YA 3FX3A 4AI3A 1QF3A 2OIIA 4WZCA 1QWRA 1ZZ9A 1KRIA 2NLRA 2VGDA 4XXPA 4FOWA 1REDA 5GJ6A 2JECA 4KH9A 4Q4W3 1T6GC 3CNAA 1Z0HA 1QMJA 2RS33 2CWSA 2ZMNA 4YZ5A 1HLCA 3PNAA 4PLOA 1GZCA 3EHKA 3HMYA 3ILFA 3PVOA 5C4WC 1AL22 2G9GA 3EXUA 2ATFA 1AYN1 2X29A 1F2NA 4LA3A 2XKPA 5GM0A 5T50A 4XMAA 4AVAA 4YGEA 5AFEA 3SISA 1NCRB 1CIWA 1D2SA 1HXS2 1O5UA 1VBB3 2X5IB 4N7IA 4WM7A 2XLAA 3O5SA 1ND2A 4YSFA 3VBOB 1CPMA 3ZN4A 1H4HA 3NO8A 1MQTB 3WP4A 3FFQA 3KM5A 2WIIB 4AXOA 1RUF1 4M0HA 5BUVA 5ACA2 5GLTA 4OI2A 4BLJA 2VMIA 4XJUA 3POSA 4LBQB 3BALA 4P9GA 2DFBA 3KCYA 4DMIA 1LHNA 1DU3D 2XJPA 4N53B 2CV6A 1SQ4A 3AZVA 3LA2A 4PBOA 4Y20A 1LODA 3NAPC 3QD6A 1VRH1 2QNKA 4JDOA 1EAH1 2R072 4PQ9A 3M8LA 1PO12 1HQWA 4EV0A 3IIAA 2GC2A 4AYUA 5AC91 1RUD2 5ABJC 4Q0VA 3HT2A 4CDXC 4C90A 3WP6A 1XNCA 2P37A 1DGWX 3WP5A 5EZWA 3V0AB 3PLQA 2DTWA 1V6NA 3JBG2 2D5FA 2TBVA 3R05A 4N43A 2PHLA 1D4M1 2TUNA 4Y1ZA 1OOPC 1VBD1 2XJUA 4AW7A 3ECQA 1OMIA 4QT6A 3ZXLA 2IXCA 2B42B 2ZGNA 4LO8A 1QH7A 1OD5A 2JE9A 2RM23 3GHMA 4Q27A 4GA9A 3VL9A 4OUMA 5T3NA 1AJOA 2PELA 4D94A