4LE4A

Crystal structure of pagluc131a with cellotriose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
248
Chain Sequence
GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucanase
publication title Crystal Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
total genus 60
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le4A00
4LE3A 4LE4A 3W9AA
chains in the Genus database with same CATH superfamily
1QJX3 3T30A 1BEV2 3F95A 4BJ0A 2EVXA 2R063 4O61A 2ZHKA 5IK8A 4P9IA 3KVAA 2VZPA 2PFWA 3KT4A 2V5YA 4BK4A 2GNDA 5AC92 4RS5A 4M0HA 2WINB 4RGKA 2HWB2 4QPIA 2C24A 2BFUL 1Q56A 4CA9A 4CU8A 1B35C 1RHI1 3ACLA 2WNUC 5JZGA 2HH9A 1CAUB 1ULCA 1KD7A 2BEOA 3LA3A 2A73B 2XLFA 3GZEA 4YVWB 3VL9A 1YFWA 5JVVA 3U11A 1ZRCA 1N3PA 4YZ2A 1MZEA 1HKDA 1Q8SA 3MYXA 3OJBA 3T0AA 4AAXA 3GBWA 4RQPC 4OHYA 2VTXA 4Q0UA 3J7MA 5BNQA 2SBAA 4JQRA 4QXHA 3T2TA 5C3SA 4R9CA 4N7IA 1AYN2 3T4VA 1W6QB 1NY71 2IXHA 3VV1A 4U2AA 1YQ2A 1VBD3 3PLQA 4HVRA 3I2JA 4AEJA 4COZA 4BIFA 5BNPC 1GNYA 3I8TA 2YBPA 4HBNA 1DGWX 3AFKA 3PMEA 3QH7A 4XAEA 2ARAA 2YG0A 1REDA 3NNFA 4Y4YA 3R0RA 4G9SB 1Q8OA 3Q8CA 1KJRA 2OPWA 4WVZA 5JOXA 1YC61 1RJ8A 3AL6A 1JOBA 3NV4A 1UMZA 5JMCA 3VD4A 1ACCA 2P2KA 2PHXA 4FVVA 2G19A 4E8DA 4Q8KA 2BVBA 4LJHA 1UAIA 2ATFA 1WBLA 2HWE1 3VL8A 5BNNA 5JSOA 5K0UB 2ZGTA 2ZZJA 4WZCA 4LBKA 4A4AA 1VIWB 2ZJCA 5I0RA 5T54A 2ID4A 2VCBA 4EN9B 2GZWA 2PYTA 4EN8B 2PHRA 1LGNA 4OI0A 3P6BA 2OZ6A 1DFQA 3IMMA 2WO2A 5I8SA 2X09A 3ZSLA 3USUB 4QKNA 1U12A 1QJZA 1UZVA 2A7AA 1OF4A 3RFRA 3JU9A 4OULA 4P08A 1SLBA 4AHXA 2I2SA 3INAA 4IDZA 2HWD3 5T5OA 5C5TA 2A6XA 2Q30A 4XBQA 3AX4A 4AOCA 5A3TA 1O4YA 2QQPA 1SMVA 2HEWF 2ZX1A 3RI9A 1EUUA 2D98A 2R1DA 3AJYA 2R043 3EBRA 2ZGNA 3I2GA 2WLPA 4TWTA 1R1ZA 2YU2A 3DV8A 3O1PA 1RMU3 5D8AA 3WHUA 3DECA 1UMHA 5C7GA 3ZXKA 3IZOA 4BHPA 5FPUA 1NCRC 4FFFA 1FXZA 3WDVA 3SMHA 2UWCA 5IK7A 3GBFA 1W6NB 2VC9A 2J7MA 2Y6KA 1LB2A 4KGGA 4M3CF 3T2PA 4AVVA 1AL21 5K7PA 3OF1A 4ZU4A 3JZVA 4HETA 3M1HA 1WMXA 3GXUA 3UNPA 5C33A 2ARBA 4Z92B 1TEIA 1NXD1 1DGRN 2W68A 1OKQA 4RYDA 4WZFA 5FUNA 1QJX2 1CPMA 3K51A 3Q8EA 1QH7A 4UF0B 1PHMA 2WNVB 4Y4RA 1DQ1A 4B1MA 2RJKA 2Z42A 3DXUA 3TNPB 4CU9A 3UYJA 1MS4A 3ETQA 4XUPA 5KXCA 4CDWB 4S2FA 2GMEA 2Q1FA 4IE6A 4LHNA 1GU3A 1CAXA 2P3KA 5HCFA 5F1RA 5LCWL 4TXWA 4LO4B 3C7OA 3ZFEA 4E4DX 2ET7A 4UXAA 1OPOA 3EJKA 2O8OA 3RMXA 1O8SA 3RZZA 3JBG2 5HCHA 2NP0A 2VOTA 2R6QA 1JZ3A 1W28A 1C8M3 4PCRA 1SZBA 1HV1A 5FZ3A 1NAEA 1AX0A 2F4LA 1LOFC 5A7WB 1D4M1 3VDDA 3AZWA 3ALQA 1M06G 4E4ZA 3GDBA 1WUVA 4FXKB 1NYWA 1LTEA 1ULEA 1XE0A 1CONA 5A7WA 1ENQA 4LBLA 1VBD2 5CBLA 3GZAA 2JEMA 3MFCA 3VBSB 5EQUA 2JXAA 2BOJA 4Q4W3 4K6BA 3AP4A 1AF9A 1F9KA 1GZCA 1VB2A 1VMFA 2B9UA 5FYSA 2VZVA 4AGGA 2EIBA 3W5MA 4MH0E 3WDUA 1GYKA 1L7QA 1SFYA 5C4WB 4M3CE 1K5JA 2WJSA 2VW0A 4ASLA 3EB7A 2IXCA 3IDEA 1O8PA 4OHZA 4N53C 1CAVB 2P4EA 1GZWA 1QQP1 1R081 1AXYA 2AREA 2YGLA 5IFTA 1X36A 5JCTA 3DXTA 5EP9A 2ZPXA 3K75B 3P1IA 1SPPB 4GMP1 1SLIA 4GJZA 1PIV3 1VAMA 1POQA 2A3XA 2W87A 3LOIA 3S6PA 3SEEA 3U10A 3UETA 4AI2A 3LDRA 4ZXEA 4Q0QA 3UGFA 4NAOA 3O12A 1IG0A 5FKBA 2PLV3 2VZ3A 1KS5A 1CR7A 4JAAA 2R32A 4GALA 1IKQA 2RM22 1QJY1 4A45A 5C3PA 3FE5A 1H2LA 4XBLA 3VD5A 4TTGA 5ABJC 2VZSA 4BQ4A 3ZFGB 3ZXEA 2QQLA 2HWD2 2A3YA 4HK8A 1X8EA 2XOMA 5T3NA 1WCKA 4DMIA 1QXRA 4EROA 2GC0A 3IPVB 5J1XA 3KHBA 1VRBA 4RS5C 2WUHA 1H1AA 3OSDA 4QPIC 4AQTA 3MV01 5BNOB 4LMFA 1F35A 1RMU2 3FZ3A 3PUSA 5JZGC 1Y9MA 2D40A 1QEXA 4NPRA 3FBYA 3Q8AA 4EN0A 2QBXA 4P5HA 1F15A 3O0WA 1BCXA 3TRSB 4AL9A 2DBNA 5JDBA 3ON7A 2NPIA 4IUGA 3HBZA 4CDQB 1ST8A 1NLQA 5IHRA 4O65A 2EIGA 1AR93 1N1YA 4C1XA 3FHIB 4PLNA 1GANA 4CUAA 1OQDA 3U75A 3EHKA 3C2UA 3TEXA 1ZA7A 4QXBA 2DCTA 4YVSB 4QPGB 5DUWA 4HANA 4PDWA 4XPVA 4QGMA 2TBVA 5IVFA 5I0TA 1WA4A 1JOPA 2IFWA 3ACIA 2HJIA 2OUJA 4WM8B 4NRMA 5F8PA 4Q4X3 4FPYA 4FOQA 2WA3A 5HCBA 1TMF3 1MQTA 4MSVA 2XJUA 3HD8B 4R52A 2R061 5A7NA 1GZ9A 5FZOB 1RUC3 1MACA 4BLJA 3WNMA 4DEQA 4HPKB 4GQ7A 4AF9A 1C8M2 2PQQA 4KG8A 4OCTA 4V1PA 5BNNC 1FX5A 3MLJA 4AGRA 2VNGA 3R4DB 4K1YA 3ZXDA 4AG4A 2IZWA 1SFNA 4ZU5A 2W46A 4OQ8A 5CEHA 2V5DA 2XGXA 2WN3A 3MFAA 4ISRA 4HSJA 4N43B 1QDCA 4XUNA 2OS2A 2Y6LA 3A21A 1YIPA 2OA2A 3MDPA 5F5AA 5FP9A 4Q4W2 1VBC1 1QNWA 3ZN5A 3ACFA 2RDSA 4P14A 4NVPA 3WQ0A 5TSWA 4AFCA 4IE5A 3AB0A 4HN0A 5H9PA 4XETA 2ZGUA 5FZBA 4AE2A 2PHDA 4TLFA 1VBB3 2BJSA 3VZJA 5I0DA 4NHLA 1GOHA 4GMP0 1SDWA 3T08A 4BWOA 4CXYA 4DOUA 2QQIA 4NN0A 4YZ5A 1NOVA 2XH6A 3THCA 4GKXA 4LXLA 5CVRA 3DYPA 2Y26A 1HXS3 2PHUA 5D8AC 4CCJA 2QDNA 4CUBA 1UOFA 4IEXA 1PIV2 2H0VA 5IAXA 4FFIA 2P1BA 3VBFA 5AC91 3N7LA 3UKNA 3L2HA 2OXBA 2ZKNA 2P5BA 1EV13 4ONUA 2AH2A 5I0UA 4KH9A 4P9XA 4PF1A 3SH5A 4BB3A 4FBFA 3M4FA 1O4TA 3KCCA 4IE4A 4P00B 4N8MA 3IIAA 2JIGA 1YNAA 5LY2A 1QOTA 4YLZA 3WV6A 1PO21 3KMHA 1MZ5A 2D6LX 3OGJA 3POWA 3M70A 4LO6B 4DS0A 2JE9A 5KC5A 2VMFA 1DZRA 2PHFA 2VAUA 4AHYA 1QIQA 3U4SA 3ZKYA 1BBT3 2JKXA 1GP4A 3MHZA 1Q8QA 5FZ9A 2GP5A 2PELA 3AJZA 2VQTA 1Y9QA 4QQLA 5A7QA 3U14A 3WP3A 5CFDA 1PO13 2X05A 3X29B 1R1A1 1ND2B 1DHKB 2FZ1A 4J25A 1U5YA 1US2A 4YGBA 3ZYBA 3AMMA 4UFLA 1HB3A 1S0FA 2YROA 3DKQA 1K5MB 3NW4A 4GWNA 4XF9A 5EV7A 1W8OA 2R041 5C3QA 2JG8B 3IT8A 2GAUA 1Z78A 3SITA 3VDDC 3CJIB 4YFWA 1XNTA 2WSUA 2X29A 3TEYA 1AR92 1AHSA 3PIGA 3ZFFB 2W1QA 3NL1A 4Y33A 4PJYA 2D5HA 3TWIA 5DAWA 2VOXA 1UZWA 1TNFA 5H9QA 3TAYA 3N35A 1UKRA 4A3XA 1H8TA 2WZR3 3OBTA 5EWSA 5DUVA 4XFHA 2WZPP 4XBNA 4MGYE 5FIXA 2XKPA 2XLAA 4MYEA 1ND3A 3MLKA 2VNVA 2DTYA 4V2VA 3SXWA 4Q27A 4Q4X2 5IVEA 2CGOA 3RZKA 1MPXA 1Q8PA 4XF4A 1W05A 1TMF2 1W8NA 2OQ6A 2BNMA 3IDCB 1VP6A 2GN7A 3OGSA 4H7LA 4M3CB 5FY7A 1RUC2 3RDIA 1OH4A 1US3A 1AYM1 4DO0A 1U5ZA 5FYUA 3DYMA 5CFCB 3NVCA 2LROA 4WV8A 1GSLA 4L8QA 3ITQA 4KU7A 4NO4A 4AQSA 1S2EA 4ZS3A 3HVDA 5F32A 1W6OB 2C9KA 3OTFA 5I8TA 3QLQA 4JCKA 2V72A 1QKQA 4ISQA 5F7UA 3KF5A 3MZHA 2PN5A 1RHI3 2PA7A 1RB8G 1STMA 3VKLA 2AUYA 5FOJB 2EF6A 1HV0A 1WMEA 5GZDA 1H4HA 2QKDA 3KF3A 5FZFA 4F3JA 4N9IA 5A7OA 3VD9A 2IXLA 4LLOA 4RR3B 3RSJA 2R071 3OGGA 4YZ1A 1I5PA 1V6OA 2AENA 2J1TA 1XBFA 1W6PB 1OA3A 2N7GA 2XJTA 3AYAA 4LE4A 2WAAA 1J83A 3AZVA 4OVEA 4Q5OA 4QDRA 3I3BA 4R9DA 1S2KA 3MF6A 5HI0A 4MGIE 4BU2A 1EP0A 2CHHA 2EXIA 1UYZA 4YW2A 4FAGA 1G8WA 1HXS2 3OPTA 3LWCA 2UY9A 1H30A 3T2QA 3AMQA 4QM8A 3RYKA 2I07B 5FPLA 1EV12 2B46X 4C91A 4EWAA 1NE4A 3PUIA 3MLLA 2D93A 2XUEA 1FT9A 5EJ3A 1Q8VA 5FZKA 5LBEA 2ZGSA 1B35B 3UV9A 2WKKA 5FK8A 1PZ7A 2WNUB 3K46A 4GAZA 4AI8A 3WG4A 2HWE3 5FZ4A 1JN2P 1Q43A 3FWEA 2PLV1 5FQ0B 3ZX7A 2A6VA 2G9GA 4GA9A 5B4NA 2BP6A 4PDWC 5A33B 5C3OA 1BBT2 2EICA 4C0BA 4K1ZA 4LHLA 2AR6A 1W9TA 1QOSA 3OYWA 4YFZA 4PT6A 3OPZA 1LCLA 1IPKA 2ZHLA 4NHYA 4QPGC 1AR61 1BVVA 5FZ1A 3J7HA 2J1VA 3GJAA 3U1XA 1OD5A 3HBKA 3RMYA 1MQTC 1X8MA 5CKQA 2YFZA 4FOVA 5FPZA 4YW1A 4NIHA 4HN1A 5BNPB 1W90A 5FZLA 5J36A 4KMQA 1OOPA 4CEYA 5IK5A 5E6HA 1GP6A 3CHXA 3H3LA 5HCAA 4XE9A 5A7PA 3T1MA 3JUUA 4QHZA 1V9U1 2JDNA 2EIDA 4A7YA 5DDJ1 1UYYA 1S0DA 3ZN4A 5EXOA 3QH6A 1UMIA 5FREA 1RJ7A 2D97A 3PTRB 2PAKA 1C4RA 3B69A 1ULFA 1X33A 4AHZA 2WZR2 5IJRA 4N43C 3KSCA 4UYBA 4NOTA 3SKVA 1BLZA 5FO7B 1ZZ6A 4IL7A 5SV5A 4XFCA 2DDUA 2Q4SA 1Y7BA 3LDKA 2VE1A 1Z7S3 3ZYRA 1S4CA 5FJHA 1S0EA 2NN8A 3B7MA 3J9SA 4CP9A 4L2NA 3RNSA 4OHXA 1ONAA 4FI9A 2VO5A 1W0OA 4HT1T 2GN3A 4IEZA 1ZRFA 3AKTA 1QJU3 1HX6A 4JKMA 4BIOA 3DYOA 4QQHA 3ZYIB 4Y5TA 4Y1VA 3VBFC 2KR2A 4Q4Y3 4ORFA 4LT5A 2VMDA 3M3IA 4QMAA 4LBJA 1CJDA 2H0BA 3W9AA 4OI1A 1RHI2 2EAAA 1PGL1 1LHNA 4MX3A 2RS51 2ZEYA 1N3QA 2WBKA 1RUD1 1WKYA 2VMGA 4E27A 1AX2A 2ZHMA 2HWF1 4UW3A 1UN1A 1RL3A 1C5HA 1CJPA 1UZZA 1NCRB 1LOCA 1WW6A 3KLSA 3R6SA 5C71A 1O3QA 3POBA 5DZEA 3FFQA 5EHDA 4XABA 3N9OA 4JZRA 4DXSA 3M3OA 4BXSV 1QGLA 5FZDA 1RVF1 4FPLA 2VBBA 3NJVA 3MICA 2K2SA 4J1XA 3ELNA 1NY72 3WVJA 4XF0A 3AKRA 3ZM8A 4QDQA 2HYKA 4XDPA 3CNAA 4XJAA 3WW1A 4A41A 1LU1A 1ENRA 2QVSB 3GGLA 4R4XA 1WLCA 5FMOS 1UU4A 1S2BA 2G9FA 2V73A 4N9HA 5FLIA 1HRI1 5T50A 3KQ4B 1VBB1 2D43A 2WA4A 3NQHA 2XVKA 4IEWA 5FMDA 2VM9A 4CPBA 3HOBA 4BQ3A 1CIWA 1DP0A 3QBQA 2ZX3A 2ZTNA 1DLCA 4CTEA 2F17A 3O1UA 2CNAA 3RZGA 4LEJA 1YJKA 5LEJA 1NXMA 1K5MC 3N9NA 2JDYA 4IE0A 4FTBA 2PAMA 3ZYGA 2HWE2 4XDOA 1UIJA 4Q4V3 3SQOA 4GMP3 3BU0A 3H9AA 1H8TC 2ZMLA 4ARYA 4YW6A 1UY4A 3ETPA 5JAXA 3LAGA 2R1BA 4GWJA 3WINE 1PVC3 1CAWB 1QJEA 1XXNA 4L92A 5IT6A 5F6KA 2D6PA 4AHWA 4F7ZA 1REEA 4Y20B 4EQVA 3VDBA 1QJY3 4C90A 2K0GA 2F6BA 5BXXA 2Q1ZB 5IVCA 4IERA 4DRRA 1WMFA 2CDPA 2YBSA 5LWBA 2W0XA 1IS6A 3FHAA 4GWIA 2UYAA 1SBDA 2OYZA 3O1OA 5CG8A 2C6SA 2ZBJA 3POIA 4JDMA 4JX0A 1RUG1 5CAZA 1G6NA 1PO11 2WS91 2VOKA 3ATGA 3POSA 3VD3A 5DG2A 2CAVA 1IZ3A 1GWLA 1LEMA 3U4XA 4BQXA 3AKSA 2AC1A 2AZ5A 4LA3A 1W39A 3MF9A 3WDWA 3BKZA 4NPLA 2Q0AA 3D5OA 3CL1A 4LNVA 4XZPA 4B7EA 3O0VA 1AL22 1F2NA 2ZABA 1BYHA 2LW8A 5KBFA 4XF1A 2JDMA 4GKYA 1Z7S2 3N9PA 2QNKA 2YDEA 4RR3C 4B3NA 1J3RA 5FPBA 3N7MA 2E51A 4Q0SA 4QQ2A 1M4WA 2W1WA 3T09A 5FY1A 3I2IA 5ABJB 5KXBA 4CDUA 2VG9A 4IQPA 4YGDA 2XQXA 1W2NA 4KWKA 5FAXA 3ZSKA 4EN6B 1DQ4A 4Q4Y2 5IK4A 1V6MA 2FDGA 4KWLA 1QNYA 1A6CA 3ZYPA 3MV11 3THTA 2CDOA 1HIXA 3QCWA 1OT5A 3KGLA 4RS5B 3UESA 2QQVA 4QPIB 4QGNA 5FK7A 4IEVA 1AL0G 4WM7A 1IOAA 3RZLA 1W9YA 4HMZA 4UW4A 1W04A 1JU3A 2J22A 2JDPA 4BA6A 5JZGB 1OF3A 3BTAA 1XE7A 3KB5A 2ET1A 1D4M2 2WABA 5AFEA 2CYFA 1SBEA 1W8TA 3BU7A 3KGZA 3WCSA 1QWRA 4D6RA 2ZKLA 3PURA 5FZMA 4XJUA 3SLIA 4EE2A 3AKPA 3HR9A 2IVIB 3IM0A 2GC3A 4QDSA 2YB7A 4FCAA 1DF0A 1DQ6A 2I45A 1FNZA 1S0BA 2G4IA 3BN6A 3CEWA 3J7NA 4TLGA 4TZDA 1VBC3 4DNYA 2PHTA 5C8WA 1VJ2A 2ERFA 3VB9A 1AR81 1JZ4A 5HPOA 2HBUA 4K20A 4MVTA 2Z2SB 1S0GA 4OUEA 2BWCA 1JHNA 3V56A 4BZ4A 2BV4A 2JG9A 3RG0A 4W8JA 1F5JA 3ME2A 4CEYC 1OOPC 3WUCA 1ASJ1 2XQRA 4NJ4A 4Q2FA 3I3MA 1W8UA 2C4XA 3HT2A 1EPWA 3OUHA 4NR1A 2W47A 2VBDA 3IAPA 1QQP2 1R082 1HW5A 1J1TA 4GWMA 4META 4GZ9A 1WZXA 2BFUS 5FDBA 1ZX5A 4Y22A 1D0GA 2XXZA 1FPN1 2FD8A 3GZUC 3MPBA 4JGZA 4K8RB 1WCDJ 1LU2A 3H8OA 3QD6A 5BNNB 5AC93 4KNCA 4YGEA 3IN9A 4LORA 3VN4A 1KJLA 2OT7A 5FYVA 5ISLA 1CGPA 5K8SA 4X8NA 5I93A 5FXVA 1NLSA 1QJY2 1R64A 1O3TA 2A6ZA 3IDBB 2LRPA 4JDOA 2D3RA 4XQDA 1COV1 3IDAA 3VBRA 1PO23 3NJXA 1XSRA 1NQDA 3FMGA 3AXDA 1I5ZA 3D82A 3EMRA 3KZ4C 3LFMA 4FPFA 1C1LA 2DBIA 4QX1A 5B4XA 4BQ1A 4MHUA 1OD3A 1W0NA 2TEPA 2JICA 4OLLA 3MIFA 1IQDC 1SLCA 4JGYA 5APAA 5F2SA 3I2OA 3O5SA 4K21A 4CVUA 2W92A 3QACA 1W9FA 5D2AA 5A6ZA 1DIWA 3O1VA 1GQPA 5IVYA 3A4UA 3ILNA 1BKZA 4AFDA 1RTVA 1R1A3 5SV8A 2W52A 5D8AB 3IAQA 3MIGA 4ZS2A 2VUAA 3UKVA 1XSQA 4BQWA 2FBEA 1OLMA 4N7UA 3OPWA 2JE8A 2WC2A 3PVBB 1JBCA 2Y6HA 2JENA 5CKMA 1NCQA 2X8KA 2ZGOA 2ZOEB 3WF1A 4LO8A 1JW6A 1H8VA 2QQKA 1OUXA 3GHNA 3HQUA 4INDA 2GALA 4JTOA 4LUKA 2H6BA 5ANNA 2QCSB 4QQPA 2VQ0A 1OA2A 2VU9A 1RXGA 1X50A 3GBGA 1Z7S1 2GNMA 1IG3A 5FYTA 5C70A 1JZ5A 2B9VA 2YPDA 4CXWA 1T6GC 3RYRA 3D3AA 4UOJA 1BMV1 3W21A 1WLWA 4B4RA 1C3HA 3RVHA 4ATEA 3TN91 1CAXB 2R062 1O3SA 4JKKA 3J8F1 1QJU1 3B3QE 4LHSA 5DPNA 3ZFEB 1AYM3 5JXJA 5JXGA 4E8CA 5DZGA 4Q4Y1 4IV1A 3VZNA 1OFSA 1ZZ9A 4AK3A 5FYMA 1LHVA 1MS1A 2AYHA 2BU9A 1N1VA 2O1QA 2XBO1 4B1LA 1BXHA 3VDDB 3S7IA 2VVDA 1NX9A 4DUXA 2FDFA 2XVLA 4XJZA 2VZOA 3ASIA 1VBC2 4I0WB 5JUVA 1NQJA 1EPZA 1H1IA 3GHMA 5F5QA 5FWJA 4YG6A 5JPMB 1SEFA 1J58A 2NYYA 1ULDA 5FO9B 3H1MA 2R073 4KL1A 3BPZA 2XJRA 1E5HA 1RUE1 1UU6A 4BQYA 1WCUA 2UYBA 2VMHA 4ES8A 3DPRA 4ASMB 3C7FA 4ASKA 1NUKA 2XJPA 3NAPA 1VBA1 5LRSA 3E1F1 1JZ7A 2FMDA 2C9AA 1PM4A 2XWJB 5FPAA 3VZKA 1GZWB 4FTSA 2UY8A 4IEPA 5FJKA 4NHKA 1ZRDA 4XVHA 1K12A 5FXXA 2VL4A 2RDNA 1LOGA 2BW8A 2J1AA 3KV6A 5LRRA 2EXHA 2RR11 2ZX2A 1SCRA 1LECA 2AACA 2EXKA 3BOPA 3HNMA 3MO4A 2Q8EA 2WLQA 3H7JA 2HBTA 3I2HA 3W59A 4KBZA 2G1MA 3RZHA 1C1FA 4FOYA 4Q4V1 4M0NA 2XJSA 4EV0A 3LZZA 3I59A 1GZTA 3POFA 5JPNB 1PO22 4XCAA 2RG4A 4AFMA 4Y5SA 1ZNPA 2EALA 2WR9A 3OGRA 3ZO0B 1PVC1 1OC1A 1XNCA 4MXVA 4XYXA 4CDUC 2VXJA 3RZJA 1IS5A 2MNGA 1WCQA 3ZMNA 3O1SA 3APBA 3WDTA 1UX6A 2XG3A 5FWEA 2NZ9A 2B39A 2VUJA 3FUQA 2WT0A 3PU8A 3M3QA 2QDRA 1UL9A 3IKWA 1Z0HA 3ES1A 2XPJA 5CFDC 2L9LA 1AR63 3H50A 4URTA 3OUIA 1X9PA 1R1A2 4HKOA 4WM7C 2FQPA 3VKMA 3SH4A 4CEWB 3SH3A 5FZCA 4GD4A 2R042 5M0TA 2H6CA 4AGVA 1TG7A 1VMJA 1OQEA 4EYUA 4CEWA 3AP7A 3BGAA 1V9U3 5DDJ3 1H6XA 2YC2A 5C9AA 1YFXA 3ZYJB 3ZYFA 4QKDA 1YQCA 1VAKA 2DYCA 3D4KA 2VOWA 3IB3A 4Q1RA 4H3WA 3LB9A 2VGDA 1Q5OA 2IXJA 5DG1A 3VBHA 3K4AA 3PIJA 5FRAA 1GWKA 4AVBA 2JG9C 5A3UA 4PDWB 2OIIA 4GB31 3RZMA 4LHKA 5IVBA 1QF3A 2WNEA 5CB7A 5J37A 3H42B 3I4IA 2HYXA 4JRAA 4LITA 4MG2A 4E4SA 1AYM2 2JB4A 2KM2A 1FMD3 1YRZA 1MQTB 3JB8A 3GZTB 3N3HA 2ZGQA 3SNMA 4QX0A 3HT1A 5JSRA 3OY8A 4UFJA 3SHRA 3R4SA 3ORJA 1PK6A 4JGZC 5E1RA 5KXDA 5L36A 4A2UA 3N9LA 3PVNA 1S0JA 2WZEA 4FPKA 3I49A 4DFSA 4NAMA 3M3EA 4CXXA 5JIUA 1ZRRA 1UD1A 3A0KA 3WP4A 1SHWB 1MS8A 2RS53 5IUQA 4LBOA 1NT0A 2VH9A 4OFGA 1RUD3 5DAVA 4F83A 5J09A 2LALA 2ZMNA 4I01A 2HWF3 4QWNA 4Y1UA 4QXKA 5E88A 3H8UA 3D0JA 1ZZBA 3VBRC 1VMHA 2IC1A 4RD7A 4XFBA 3ZVXA 2R072 4PQQA 4QU1A 1DDLA 3GJBA 1RVF3 3LIHA 5LASA 5ANQA 2Q8CA 5G04L 1H2KA 1PNFA 1UXZA 4JGYC 2P37A 1V6NA 5DZFA 4GH4B 4YRDA 2P3IA 5LY1A 4PBOA 3VDAA 5L9VA 3EQEA 4FPEA 4YW4A 4UAPA 2GH8A 3IIIA 3ZIWA 1HRI3 2ZZQA 4GH4A 4OYUA 2RVAA 4K3UA 3PUHA 4QT6A 1REFA 5GLWA 1UWWA 2YXSA 5FXZA 4LULA 3VBFB 3NJZA 1CN1A 1FOD1 4PIZA 3S30A 5BUVA 4UFHA 3WG2A 4EJRA 4OQ9A 2ZEWA 4QPWA 4SBVA 1PZ8A 3GCXA 1OH3A 4AW7A 2BBVA 2BWAA 1W03A 4MO3M 1LGCA 2NMOA 1WLTA 1NCQC 2JD4A 3BCWA 4FP3A 2PLV2 5FZ7A 1U5XA 1UYXA 3U78A 5F5CA 3HNYM 3MEPA 3P5BA 4JQTA 1WW4A 2QTWB 1MS5A 2LM3A 4P9YA 4V2WA 3M2MA 4CE8A 1JS9A 4M4RA 1G7YA 2DVBA 1HB1A 4NRPA 4NROA 2ZGKA 4P5YA 4B29A 4CU7A 1AR62 2Y0IA 3RQ0A 4DQAA 2A6YA 3MUY1 2Y0OA 3NKTA 5LW9A 5CFDB 2D6OX 1W6MB 3BOWA 4JDNA 2J1SA 4AEMA 1JH5A 2Y6GA 1IHMA 5T55A 4IV1C 2PQSA 5FP7A 1E5SA 1ULOA 2C1FA 2JDKA 2P34A 1LULA 2PXJA 1RUG3 2GDFA 1NLRA 1V9U2 1W6MA 2WS93 3I7DA 4PIXA 5DDJ2 3I97A 2CWSA 1OPMA 3ZFEC 4EWEA 5D21A 3BIEA 2WYFA 4FAHA 1I3HA 2R30A 1WLDA 4MXWB 1QHDA 3D8CA 4K7JA 1AX1A 3BODA 4FPJA 4A3ZA 3ES4A 3K77A 1UW8A 1PZ9A 2VULA 4LK7A 3ZIXA 2VMEA 5GZEA 4HVQA 2MEV3 1H8TB 4MXWA 4D0QA 2YFUA 3NMBA 5FO8B 1UY3A 3ILRA 4OHVA 2Y8KA 1ND3B 1TZOA 1WD3A 4DRVA 3VHOA 3CIHA 3NAPC 2VOVA 3RYPA 3RPQA 3K3NA 4LBNA 4E4HA 3U0ZA 4Z07A 4D7YA 4ZY9A 4IV3A 1HDKA 1X82A 2OW4A 3I2DA 3R05A 3RWNA 3DUIA 3VHPA 4H7MA 1H0BA 3ZSMA 1OI6A 4XILA 5F37A 4HL0A 4ITCA 5CU1A 3ZKUA 3NNJA 4HKLA 3C7GA 4AVTA 1W2UA 2IXIA 2YUEA 4J6GA 1PGL2 2E53A 2YC4A 2RS52 4IEYA 4CCNA 2JDAA 4OI4A 1RUD2 3AVSA 1ZZ7A 1KQRA 1FV3A 2WT1A 3DN7A 4AXOA 2HWF2 4CCLA 3H1WA 4B8EA 2IVJA 4FP2A 3EXUA 3MIBA 4GIQA 3BIWE 4XF3A 5GZFA 4MGZE 3AL5A 3WXPA 2E32A 2RE9A 4A6OA 1CZTA 4D7TA 5DABA 2B4KA 1UY0A 2RJLA 4HZFA 1RVF2 2DVAA 1IS3A 4CCMA 1OFNA 4MADA 1LNSA 4OUSA 4HSLA 4P9LA 4CSWA 2GP3A 2R0HA 3B9CA 3SCHA 4LE3A 3H8XA 4Y1ZA 3UL2A 1HB2A 1AR83 3H1YA 1HRI2 1POV1 1JYNA 1VBB2 1SLTA 2DVDA 3ZXJA 4AEDA 3WUDA 1DG6A 4LKFA 1GMMA 1AR73 3A7QA 2BERA 1QXJA 4CDXB 1ASJ3 1PGSA 3ZN6A 5JLVA 2YMZA 4AI3A 2PHWA 1ODMA 5LBFA 4CEWC 3L2YA 5HXVA 1PNGA 4CDXA 5C9AC 3QOPA 4GXLA 4P9JA 4CRQA 4PLOA 4OI2A 1R091 1FPN3 1O59A 5H9SA 3H3UA 4DY5A 3WW2A 2Z79A 3LPGA 5IAVA 3N36A 2Q8OA 1FV2A 3MI8A 4XQWA 1V6KA 4CPBD 1PGW1 1HRV1 4I0BA 2NMNA 1K3IA 3ZPYA 4J1WA 4TYSA 3VBHC 1ULPA 1ZYBA 4Z8BA 5L73A 3Q8BA 1ZBA3 4O7XA 2W5FA 2BPA2 5KWRA 4Z82A 1RC6A 3OYWB 1AVBA 1H9WA 2JE7A 3JQXA 3AZXA 3K4DA 3LKJA 5CADA 1COV3 2KXLA 4JRLA 1HN1A 1H2NA 4QX2A 4TN7A 2DURA 4XAAA 1KGYA 3RWKX 1W99A 5EIYB 3BTYA 1UY1A 1WGPA 4NHXA 4QB2A 5LZ6A 1RUJ1 4D7SA 1A34A 4HG6B 4BLIA 2OUHA 1PM7A 5KC6A 1RUG2 1OOPB 2WS92 1PO12 2JDUA 3LD8A 3LPFA 3KQRA 2ZX0A 2RS13 4RHV3 1HLCA 4H55A 5FP3A 1MS0A 2JWPA 3OBRA 1GLHA 1UKGA 4UBHA 3AK0A 4KGQA 3CZJA 4AQ2A 5FYBA 1A8DA 4CZSA 3HN3A 4MZUA 1CPNA 4D6SA 2W08A 2FDHA 4WVWA 3CLPA 1AZDA 4YW7A 5FTTC 2MHFA 1OKOA 1XU2A 4Z2AA 4ZHNA 1H6YA 4YGCA 1DQ5A 4ZZ5A 1CWPA 5L9RA 2D7FA 3PJYA 2NQYA 2Z4FA 1XC6A 1YIFA 2ENRA 1UOBA 3WNPA 5AFBA 3C7HA 1N3OA 4HXCA 1XNDA 2HWC1 4BXFA 5IWFA 3T4HB 5FPVA 4CU6A 4PBPA 1W2AX 3AC0A 3JB4C 3S7EA 4CP9B 2ETEA 2JECA 4HKWA 1DYKA 5EZWA 1TVGA 1CVNA 3EYPA 4GH4C 4PLMA 3ILFA 3USSA 4CP1A 4ZU7A 4Q8LA 4MHRA 3WQ7A 4LBQD 4LTAA 1NA1A 3OUJA 3UKTA 2RJ2A 1DGRA 1FMD1 2ZEZA 2BTVC 5E16A 4WVMA 1YXWA 3LFIA 5A7SA 3TN93 4RFRB 3WHTA 5A6QA 3J8F3 4LBMA 3TEZA 4QGLA 3KM5A 4KWUA 5DAPA 1OLME 5F2WA 2X5IA 2VQUA 3FC0A 4IESA 5FYZA 4XJWA 2KD7A 2ZX4A 1JYTA 1DYPA 1LESA 2GC2A 2XBO3 1POV0 3LSEA 2XJQA 2Q5TA 3MW2A 2XR4A 5JXIA 2B7YA 1BK1A 1MS9A 2B45X 3NNLA 3N9QA 5F5IA 5T52A 1XB9A 5FYYA 5BY5A 3I2KA 3ZLIA 5LBCA 1XNKA 2JDZA 4BQ5A 1JZ6A 1AR82 1JYWA 4LKDA 4S2GA 3V0AA 2A6WA 1UCXA 3LQCA 1RXFA 5JXHA 4I0AA 5ACA1 4Q29A 3MIHA 1ASJ2 2ZMKA 4XZUG 1RUE3 3TB0A 3POYA 1X9TA 4XFGA 1LHWA 5FXWA 3B5LB 4MGQA 5FY5A 3TOJA 1VBA3 4KWJA 4QD2A 1H9PA 3BB6A 4OHWA 3W5NA 3ZPOA 1JOJA 2W91A 2XHKA 2Y33A 4TSVA 4AQ6A 1UNBA 2CWMA 3KD4A 1FPN2 3E97A 4XQ4A 3LEGA 4A6SA 5LA1A 5F3CA 1ZBE3 4CCEA 3GYDA 2FCUA 4NE9A 4PHZA 4IGOA 5JR7B 2RR13 1K42A 2QZ2A 4HOOA 3UT0A 1PMHX 4Y1YA 1V00A 2VNRA 1A78A 2XVGA 5T5PA 3WNNA 4BCUA 1YYNA 1TME3 3KVBA 1QJFA 2IFRA 1XOYA 2VXRA 1X7NA 1JHJA 1COV2 5JOWA 2ZS6B 2Q8DA 4W6XA 1G9AA 2E6VA 1ND3C 5IATA 4XIKA 5J48A 1JZ2A 4QX8A 1LJ7A 4COVA 3PU3A 2QUOA 1GOGA 1S55A 2YZ4A 5FMCA 2P3YA 4DPNA 4AAPA 4CYDA 3FFZA 1S0CA 1KEXA 2BOIA 2OX0A 1WCSA 2E7QA 3O7OA 1IKPA 2XJVA 5B2GB 2VY0A 4OMCA 2G9ZA 1RITA 1AXKA 5A3PA 4KBBA 4RGGA 1EAH1 2WYSA 2W39A 1L7RA 5BV6A 1ZM1A 2XHNA 3O1RA 3VHNA 1BQPA 3M3CA 1U0AA 2IWGB 4P02B 2RS31 3W58A 5I8YA 1QMJA 2D6NA 5JIAA 2A1XA 4EWDA 1W3VA 2VBPA 2DFCA 4LBQB 1JXNA 2D6KA 1LOAA 4RN5A 3SCGA 3OD4A 3U37A 5FFOC 5DAQA 2MEV1 3HQXA 4AI9A 3P3PA 1CZSA 4LBQA 5CZKA 1XNBA 1K45A 2BQPA 4AEDC 1IPJA 5CYYA 5L19A 2V09A 3POEA 1OXCA 4CDUB 5L7OA 5EJZB 5HBAA 1BMV2 2ZGRA 3W20A 4ARXA 1MEC1 4GB33 3WF0A 3N4MA 3ZDVA 1HQLA 2XKOA 1ZZCA 2W3JA 3JD71 3TN92 3J8F2 1QJU2 2XONA 3KWVA 5KR7A 4CDXC 2D5FA 3V0BA 4WM7B 3V64A 2P3JA 3H0OA 4R9AA 1F8VA 4XMIA 5CA6A 2JB8A 2K9ZA 3DEMA 3JCIA 1V6JA 4HK9A 2XBO2 1AXZA 2C26A 1KDMA 1PMJX 1YO8A 2W9XA 4UBGA 3WOGA 4O9GA 4WBBA 1C28A 4URAA 1DU3D 4YW5A 4K9SA 5C8CC 1TE1B 3JQWA 4XACA 3VGIA 3CMGA 2WFF3 3VZLA 2PTMA 1OMIA 3NRUA 3AP9A 1GQGA 4IW3A 3I3EA 5LATA 1RUE2 3WF2A 2FZ2A 1E57A 4R4ZA 2JG9B 5EJ1B 3KV5A 3F2ZA 4I02A 1VBA2 1YCIA 2J1EA 2GMMA 4GULA 4W4ZA 2BVVA 1WMDA 4EN7B 3WP6A 4D6QA 2EA7A 2WO7A 5A32A 1AR71 1CD3G 4PIYA 5JI7A 4RA0A 4MV2A 3MUZ1 1YUDA 5GALA 1ZBE2 1IQAA 3B00A 3N7KA 4Y22B 2XL9A 1W8ZA 1RUF1 2RR12 4IGQA 1YFUA 2VW2A 4P9GA 4W6YA 4JGZB 3VZOA 3BTXA 3HMYA 1UX7A 1RGSA 1TME2 4FFHA 3JBG3 4NWWA 2ES3A 4Q4V2 1FOD3 3VUOA 1MVEA 2O8QA 1KFXL 3VBUB 1OVSA 1UYPA 1XYOA 2YHJA 5GLUA 1D4VB 4FQZA 3DKWA 1CAUA 1RUH1 3AZYA 2W1SA 1YLLA 3D6EA 2E7TA 4YVWA 1QXPA 1XNAA 3DGTA 3T3YA 2CY6A 3ROUA 4COUA 5DXDA 1PVC2 3VBUA 3WX5A 3VBRB 1ZBA1 3N9MA 1Y4WA 2QQWA 2VMCA 1J59A 2VZTA 1CESA 3FLTA 1UZYA 3HN1A 4M00A 1J3PA 3SEPA 4ZONA 2VJXA 5FUIA 1NA1C 4JGYB 1H2MA 2WQZC 4FT8A 1IPSA 1W6QA 4OZXA 5DN2A 5T5JA 4BISA 1RUOA 5G05L 2XWBB 5KHKA 3T2OA 2P17A 4Q1PA 2JKBA 3A0NA 3AP6A 1L3JA 3AXEA 2VUCA 3SKJE 4NHMA 3BALA 4KG0A 2GH2A 1YFYA 2RS11 2X5IC 4RHV1 4XUTA 1LGBA 1DQ2A 4JVAA 1ZZ8A 2GC1A 2JJ6A 4FQ4A 4RSUA 5CG9A 1UOJA 1W3XA 1XU1A 2W95A 4QPYA 1WD4A 3ABZA 4BDVB 5LEKA 1DQ0A 4RFT0 5LBBA 1Y3TA 1AJOA 2D3SA 3K3OA 1DCSA 3N7JA 1W9WA 1V0AA 4YSFA 1NCQB 1W06A 2XB6C 3HPNA 1WBFA 1E5RA 2VD7A 3M7AA 5K0UA 2CTVA 2B8MA 3ACGA 1KITA 2GNBA 3AMHA 5DUUA 3CF6E 5HV4A 2RM23 3M8LA 3S5QA 1T6BX 4GB32 4IEUA 5FZGA 3PVEA 5CIRA 2WO1A 3LGRA 1OVPA 2RHPA 2W1UA 3FHQA 3BTZA 4UFMA 3DL3A 5F3GA 1BK0A 3E5XA 4AVSA 3USUA 2J1UA 1ZVFA 2ZGMA 3WD5A 1VRH1 4B4QA 4YM0A 5J98B 4L97A 2PHLA 1LOBA 1HJGA 3NV2A 5A80A 1H1MA 1F5FA 4IEOA 4IV1B 4LK6A 4Z1VA 2AGSA 4Y26A 2ZACA 4NWVA 2A71A 2DVGA 1NE6A 1WW5A 3LE0A 3LIGA 5JOZA 1SQ4A 4P9WA 1JUHA 5KHJA 2DTWA 3EO6A 3FJSA 1VBE1 1F4AA 3PHMA 3GCWA 4ZKTB 2WFF2 3V65A 2DV9A 1TQ5A 3K48A 4DY3A 3LSDA 2VTFA 5J96B 4S2DA 2YBKA 1JI6A 5F6LB 1W6NA 4BE3A 3T0DA 3URFA 4L9BA 1OUSA 3E6CC 1RUNA 4C0HA 5A1AA 3WDXA 1LKNA 3DPRB 1PMIA 5FLJA 3NAPB 1GWMA 3NO8A 1DBNA 1SLLA 2RMU1 4OUMA 4D69A 3GNEA 2DF7A 3ST7A 4LPLA 1POV3 4UF0A 2WNVA 3PTYA 5FR3A 3CJXA 4BMBA 3CKHA 4BQ2A 2WFPA 2A5ZA 1XPWA 2Q1MA 1DGWA 3C8XA 3CBNA 4COWA 1LHOA 1BEV1 2ZEXA 5LK5A 5AVAA 4HONA 3KT7A 1W8WA 4CDWA 1OSGA 3MW4A 1JYVA 1FOD2 4W50A 2OQ7A 3ZXFA 4LUMA 5EYXA 1JODA 1ZBE1 4SLIA 2VCAA 2HWB1 2J1RA 3BVCA 3AMPA 1I9RA 1I1EA 2EIEA 4BPZA 3VBOB 1R093 3I59B 4FPHA 3WP5A 3NV3A 4UI9L 1TME1 3SISA 1B09A 1UXXX 1CIYA 5KXEA 1HRV3 1F4HA 2OZJA 2KA3A 1KXGA 4XXPA 1GKBA 3AKQA 3VBOA 4UW6A 5L7OC 2ZHNA 1D2QA 4UW5A 2Y6FA 4CP0A 3AP5A 3JXSA 2FDIA 3TEWA 4E2SA 1AYN1 3VBSA 1SDDB 3C3VA 4XFAA 1QH6A 3WNLA 2QE3A 3HWJA 3NJYA 1QY4A 2Y38A 2DUOA 4MUVA 3VD7A 5C4WA 1RUJ3 1ZRIA 4AWDA 4DB5A 5FPXA 3OBZA 4QM9A 4U36A 1UIKA 4YZ3A 1DZTA 4YZ4A 1LODA 5FP4A 3NKGA 5J3UA 2BUKA 4Y1XA 3GALA 5GLTA 1CAVA 4LLFA 1RIRA 2HEVF 5C9AB 1UO9A 1O91A 1UF2C 2WDBA 1D2SA 3OEBA 2HKXA 3ZR5A 5J7MA 1LR5A 4ZPIA 5F3IA 4E2GA 5JR2A 3BPSA 2J42A 3WLUA 1J3QA 4D8MA 4DXZA 3NNMA 1SPPA 1QOOA 4IEQA 4M01A 1JYIA 2D6MA 3CU7A 4NPMA 4AFAA 4DUVA 4FPOB 4MGSA 4WVVA 1T2XA 3VBHB 3FLPA 3ACHA 2VMIA 5LA9A 1N1SA 3GF6A 3KV4A 3UK9A 2E63A 2WWJA 5C8CA 3KHCA 4FPCA 2UWBA 2BGPA 1BJQA 3IMNA 1O5LA 2HWC3 4LA2A 3KS7A 3FUOA 5EYYA 1LHUA 3WF3A 4CCOA 3ZFGA 1D0HA 3OG2A 5FYCA 4NIIA 4BH9A 2ADDA 4DZGA 2GSYA 3OY8B 3VKNA 1W2TA 3IPVA 1PK6B 2Y60A 5CNAA 3OGVA 1AJKA 3WG3A 2VECA 2E26A 4XC9A 4YWAA 3AFGA 4FFGA 5BNOA 1CX4A 3THPA 5LB6A 3T1LA 2UU8A 4NMIA 4AYUA 3I3QA 1V6IA 2E31A 4QHBA 1ODNA 4YVWC 3UGGA 1UY2A 1CZVA 3VBUC 1OA4A 2BDRA 4CDQA 1JYCA 1FYUA 3A23A 2QQOA 3CDZB 3IBMA 4XFFA 4AVCA 4B7KA 1VAVA 2E7AA 2WO3A 2WN2A 4A7KA 1GOFA 4NIGA 2DUQA 3FL7A 2WFF1 5FY4A 1UU5A 5FP8A 3ZDSA 3LDBA 4YPJA 3MBWA 2VR4A 3E6DA 1VLNA 3E5QA 2VNOA 2ORZA 2W94A 2AEZA 3VDCA 4YVSA 2ZAAA 4A7ZA 4QPGA 4JKLA 3Q9OA 1KDKA 5A3WA 4CUGA 1MZFA 4MOAA 4X8PA 5ACA3 1QJX1 4BK5A 4H2AA 2EAKA 4WM8A 1HJFA 3I54A 3MIEA 4F8AA 2CL2A 2PAEA 4LOSA 3NSTA 2TNFA 2SLIA 5HXMA 1PX4A 3HIFA 2BNOA 3HAGA 4CEYB 5FZOA 4HVOA 5D1IA 3WCRA 1R092 4HPKA 2IUWA 2A70A 4I09A 1QU0A 2V4VA 5EFUA 1LENA 2BRTA 1Y9GA 2WT2A 1JU4A 3PVOA 1V70A 3JBG1 4XTMA 1PGW2 1HRV2 5K0UC 3T0BA 1J84A 2QQNA 1SFPA 4JV4A 4DUWA 3B02A 3P3NA 4JTNA 4NIAA 4ATFA 4N43A 2GNTA 2LTNA 2C0ZA 2VTXJ 2VVFA 1HB4A 4XMAA 3WDYA 4UT5A 2HEYF 4LIUA 5IW0A 1GNZA 4KI5M 1YI7A 1N47A 2DFBA 1VBD1 2CV6A 3PNAA 4XW3A 1LOEA 1YI9A 3ZMOA 2ZCWA 4PI2A 3HNBM 1N1TA 2NLRA 1RUJ2 1MR5A 3PDQA 5A3NA 2LUWA 4L11A 4YW3A 3BUCA 1NZIA 4YYOA 2EXJA 1ENSA 3CQOA 2Z69A 4PF5A 5FLHA 2ORXA 2RDQA 5FV3A 3WNKA 3L9JT 1MZ6A 4YM3A 3OBAA 2WWUA 3HQRA 1DZQA 2FDKA 5GM0A 3GM8A 3O0XA 5DQ0A 4DXTA 1EAH3 1XYNA 3B01A 3MW3A 3UGHA 2XUMA 3ENRA 2Y64A 3TYJA 4OMDA 2FMYA 2RS33 3PL0A 1GNHA 3K4ZA 5A1FA 2XLGA 3B93A 3KCYA 4COYA 3PUAA 4YG0A 5DMYA 5GZGA 5JWPA 2CGPA 5FZ0A 1W2OA 4QU2A 4XJ9A 5I91A 5E89A 2GU9A 2MPFA 2R49A 3U07A 5KHIA 1QDOA 3B94A 1APNA 2HWC2 1W8HA 3AMNA 1VPHA 2ZXQA 3I3DA 4DXRA 4AVAA 4E9KA 1BZWA 3J7LA 2RM21 4X6RB 2X53S 3BYWA 3VKFC 1KFUL 4IV3B 2DWRA 3CO2A 2XDVA 3ZXLA 5FBZA 2AEYA 4RGAA 3DPRC 2WNVC 2HWD1 3UJOA 1D7PM 1S1AA 1RUI3 4KU8A 4HFSA 4QKBA 4R8HA 3WNOA 3ZSJA 1FMD2 1MEC3 4KQ7A 1O7FA 4M4PA 1ENXA 1OLRA 4Q26A 4CDWC 4FSJA 3DCQA 3OCPA 3VHRA 1BHGA 3JD73 2E9QA 2CGNA 2YY1A 5A6XA 3NV1A 1ND2A 1O3RA 1RMU1 3HEIA 3LA2A 5FMBA 1K5MA 4QHOA 1DLLA 3OOXA 2OKXA 2JG8A 2YPJA 1GP5A 4OZOA 4XHBA 2YGMA 5LA0A 1JZ8A 1UQXA 3OB8A 3PJQA 3CJIA 5E8AA 4EZHA 1VALA 2JDHA 4W6WA 3VBOC 2F4PA 3ZFFA 5LK7B 1KS4A 4IXLA 3WW3A 1ZA4A 5EPAA 4ET7A 1EYBA 4A44A 4EZ4A 1SLAA 2A3WA 3RGBA 3VBSC 2QQMA 2JX9A 5DUXA 5GLVA 2E33A 3OD0A 1GBGA 4K40A 4YM2A 5ACA2 3J4UH 2P6CA 1HQNA 3AYEA 4AEDB 1YQ6A 3ZXAC 1XRUA 4CP2A 2YU1A 3B9IA 5C4WC 4I3GA 4ES9A 4Q0PA 2BGCA 4QXCA 1LRHA 3ZN6B 1O4ZA 3SC7X 1FAYA 1Y43B 3THDA 3WR0A 1P8JA 4LOTA 4QB1A 4M3CA 5GLZA 3ZYHA 5FCCA 3VZMA 3C7EA 4QKFA 2Y34A 4L0PA 3AYCA 1OLQA 4ZXKA 5CFCA 1RUF3 4AI1A 1C8M1 1HN0A 3S5AA 4XHXA 4LO7A 4QX5A 3S57A 4CUCA 3KT1A 1W6OA 2ZAHA 3AM2A 1NZCA 5C5UA 4C1WA 4QQOA 4PQ9A 5H9RA 5AVPA 5BYNA 1W0PA 1CQ9A 1YJLA 1JUIA 4RL7A 2WIIB 1F31A 1GV9A 3G7DA 5K9YA 2VPVA 1RUH3 5C8CB 1TNRA 1XE8A 5IFPA 4Q4W1 2A75A 3ZFGC 1UPIA 4RR3A 1RINA 5KHHA 3ZXGA 2JD9A 5GJ6A 1VR3A 4LKEA 2BGOA 5CKNA 1J1LA 4AI0A 1PX3A 2WL1A 5GKAC 1W6PA 4FOWA 4PI0A 4DEVA 2WAOA 3AYDA 3HJRA 2IXKA 4UWDA 4N90A 5FZ8A 2V4AA 2WQ8A 5A70A 3NNGA 4FXGB 5FBJA 2LS6A 4QX3A 1MS3A 5BNOC 1EAH2 1G86A 3K2OA 1PK6C 2YC0A 5JSPA 4BOWA 4DIQA 1C8NA 2RS32 5FZIA 1W9SA 4AEKA 1AUYA 2Z5WA 1PIV1 5JOYA 2DVFA 2CU5A 4CDQC 5C6CA 5HV0A 3H8RA 3FX3A 1B35A 4CCDA 2UURA 4BM8A 5LA2A 3PMSA 2O0OA 2MEV2 3WW4A 2R16A 5F39A 2WNUA 4RQPB 4XDQA 4IETA 4LR4A 3KV9A 5A3MA 2X10A 1GQHA 2WRAA 2VZUA 3WF4A 3VLBB 5ERLA 5FQ0A 4LO5B 5K4LA 4XTPA 4YVSC 3RI8A 1YWKA 1RUI2 1LAJA 3FN9A 1C57A 2ZGLA 3CZUA 4RQPA 5BPXA 2D44A 5A33A 5FOBB 1MEC2 2RDRA 4FPGA 5JMOA 2FCTA 2OVUA 4WM8C 4A42A 4NRQA 4YM1A 1NA1B 3JD72 1MVQA 1YEWA 2OPKA 1E5IA 4LKSA 4WVMB 1IS4A 4AZZA 5F9TA 1VRH3 1YHFA 3POGA 1XYPA 2FCVA 2YYOA 4G3YC 5FY9A 5BNPA 4Z2WA 4JC1A 4JHTA 3WQ1A 2X5IB 5F3EA 2WSVA 4MLOA 5FUPA 4Y5Z0 1A3KA 2WWSA 5FKCA 1LEDA 1HQWA 2FHRA 2TUNA 1OQ1A 3H3ZA 4IE7A 2ARCA 3E5UA 3MGUA 4XXAA 3WY6A 2VW1A 5GZCA 2I74A 1AR91 1VBE3 2C5DA 1S0IA 1G9BA 2DUPA 1AL23 1O5UA 3E6BA 1Q3EA 3TBDA 3O1MA 1UOGA 1A8MA 1OHFA 1YQ5A 4I2OA 3V0AB 2QJVA 4XEZA 4XIOA 4YARA 1JYXA 2VUDA 1UPSA 3OEAA 4GJYA 3G6JB 3VKOA 4I3PA 3WG1A 2RV9A 1GICA 3LF7A 2WZ8A 4C8DA 1FNYA 3R4UA 1GUIA 4Q4X1 2NM1A 4B4PA 2QQJA 4QAWA 1AR72 4MGTA 3AVRA 2RMU3 5FMOL 1G9DA 1TMF1 3J26N 4BMEA 2BYVE 3O1TA 3NWKA 1YQ8A 1RUF2 1RUC1 5KHGA 3WZ1A 4O9EA 2BZDA 2JIJA 4XUQA 4XJ8A 3LCPA 1DYOA 5IVVA 1BVP1 1BEV3 4QB6A 1IGOA 3TNQA 2DU1A 2CSGA 3H7YA 4CCCA 1FI2A 1W8FA 3RRDA 1OBNA 1EUTA 2HWB3 3AZZA 2ARXA 2XMLA 1D4M3 2PMWB 4Y24A 5FZEA 3UJQA 1RUH2 1ZREA 2VZRA 1JMUB 3FLRA 2P6HA 3WT3A 2CAUA 1NCRA 3SCFA 4E2QA 1ZBA2 2QZ3A 4S2HA 4LIVA 1NKGA 3KCXA 4G4FA 2DCKA 3LEIA 1SG3A 3PUQA 3FBMA 3ZOIA 4IGPA 2BNNA 2ILMA 4IV3C 1O6UA 2WQ4A 5L9BA 3RJRA 1AYN3 4I30A 4R9BA 3IWZA 4MGKE 4X6QB 3WQBA 1VB4A 4UFKA 2VZQA 2VCCA 1ND2C 2D3PA 2RS12 4RHV2 3LOBA 4YG3A 1HXS1 2W2IA 1ALYA 1QQP3 1R083 5FY8A 2DCZA 1ULGA 2GMPA 4JHZA 5FZAA 2JG8C 5FYIA 5IYYA 4YNIA 1UZ0A 1JTZX 4W65A 5FYHA 2B5HA 2VCMA 1EV11 3CJIC 1OURA 4NIDA 1URXA 2UWAA 3ZFFC 2FDJA 2QQUA 2O14A 4XURA 2DU0A 3O14A 3BI3A 5A3OA 3WEZA 1LOFA 1WA6X 4HLTA 5A3LA 5A1LA 3LEMA 1GR3A 4NUBA 3WNXA 1PVXA 5A6YA 5FZ6A 5L7OB 1U5IA 1CAWA 1FATA 1BBT1 1WW7A 1XQNA 4Y20A 4DINB 4D3WA 1L7LA 1XJAA 2ZA9A 1VRH2 3MPPG 1C5IA 1RUI1 1SACA 2VVEA 3V0BB 4Y3OA 3POJA 2Y6JA 2WNOA 2QFEA 4N53B 3RS6A 5CFCC 3S0MA 2VQAA 4FO9A 4ZZ8A 1DGLA 3LEKA 4FTEA 3RJ2X 3DF0A 1V6LA 4QX7A 3ECQA 1H4GA 2K46A 2R0FA 4H14A 1WWYA 3A22A 3MIDA 4N53A 4XCBA 4CCKA 1CX1A 1G9CA 5I0SA 1VBE2 2VZ1A 4XOGA 4AFBA 4D94A 1RYYA 3LA7A 5JI9A 2ADEA 5CISA 3Q8FA 4L99A 4UFIA 3D0SA 4BYYA 1G9FA 3ZR6A 2HLEA 1GFF2 5C3RA 1KRIA 2WZR1 5T5LA 4AR2A 1I6XA 4Q0VA 2XL7A 1NG0A 3WSOA 5IVJA 2BBAA 2B42B 2ZGPA 1VE0A 5DAXA 2DCYA 1EY2A 2RMU2 5FZHA 2R7EB 1SBFA 3I2FA 4XUOA 5A32B 4XFIA 5ABJA 3ZSEA 1SCSA 4K8FA 4LQRA 2YV8A 2DCJA 5FY0A
chains in the Genus database with same CATH topology
1QJX3 1BEV2 2EVXA 2R063 2ZHKA 5IK8A 4P9IA 3KT4A 2PFWA 2V5YA 2GNDA 4RS5A 4M0HA 2WINB 2HWB2 4QPIA 2BFUL 1Q56A 1B35C 1RHI1 3ACLA 2WNUC 5JZGA 1CAUB 1ULCA 1KD7A 2BEOA 3LA3A 2A73B 2XLFA 4YVWB 3VL9A 1YFWA 5JVVA 3U11A 1ZRCA 1N3PA 4YZ2A 1MZEA 1HKDA 1Q8SA 3MYXA 3OJBA 3GBWA 4RQPC 4OHYA 4Q0UA 5BNQA 2SBAA 4JQRA 3T2TA 4R9CA 4N7IA 1AYN2 1W6QB 1NY71 2IXHA 3VV1A 4U2AA 1VBD3 3PLQA 4HVRA 4COZA 4AEJA 4BIFA 5BNPC 3I8TA 4HBNA 1DGWX 3AFKA 3PMEA 3QH7A 1REDA 4Y4YA 3R0RA 4G9SB 1Q8OA 1KJRA 4WVZA 5JOXA 1RJ8A 3NV4A 1UMZA 5JMCA 2P2KA 2PHXA 4FVVA 4Q8KA 2BVBA 1UAIA 2ATFA 1WBLA 2HWE1 3VL8A 5BNNA 5JSOA 5K0UB 2ZGTA 2ZZJA 4WZCA 4LBKA 1VIWB 2ZJCA 5I0RA 5T54A 4EN9B 2GZWA 2PYTA 4EN8B 2PHRA 1LGNA 4OI0A 2OZ6A 1DFQA 5I8SA 3ZSLA 3USUB 1U12A 1QJZA 2A7AA 3JU9A 4OULA 1SLBA 4AHXA 2I2SA 3INAA 2HWD3 5T5OA 2A6XA 2Q30A 4XBQA 3AX4A 1O4YA 2QQPA 1SMVA 2HEWF 2ZX1A 3RI9A 2D98A 2R1DA 3AJYA 2R043 3EBRA 2ZGNA 2WLPA 4TWTA 1R1ZA 3DV8A 1RMU3 5D8AA 3WHUA 3ZXKA 4BHPA 1NCRC 1FXZA 3WDVA 3SMHA 2UWCA 5IK7A 3GBFA 1W6NB 1LB2A 4KGGA 4M3CF 4AVVA 1AL21 5K7PA 3OF1A 4ZU4A 3JZVA 4HETA 3M1HA 5C33A 2ARBA 4Z92B 1TEIA 1NXD1 1DGRN 2W68A 1OKQA 4WZFA 1QJX2 1CPMA 3K51A 1QH7A 1PHMA 2WNVB 1DQ1A 2RJKA 2Z42A 3TNPB 1MS4A 3ETQA 5KXCA 4CDWB 4S2FA 2GMEA 4LHNA 2P3KA 1CAXA 5HCFA 5F1RA 4LO4B 3ZFEA 4E4DX 2ET7A 4UXAA 1OPOA 3EJKA 2O8OA 3RMXA 3RZZA 3JBG2 2NP0A 2R6QA 1C8M3 4PCRA 1HV1A 1AX0A 1LOFC 1D4M1 3VDDA 3AZWA 3ALQA 1M06G 4E4ZA 4FXKB 1WUVA 1NYWA 1LTEA 1ULEA 5CBLA 1CONA 1ENQA 4LBLA 1VBD2 3GZAA 2JEMA 3MFCA 3VBSB 2JXAA 4Q4W3 4K6BA 3AP4A 1AF9A 1F9KA 1GZCA 1VB2A 2B9UA 4AGGA 4MH0E 3WDUA 1GYKA 1SFYA 5C4WB 4M3CE 2WJSA 2VW0A 4ASLA 2IXCA 3IDEA 4OHZA 4N53C 1CAVB 1GZWA 1QQP1 1R081 1AXYA 2AREA 2YGLA 1X36A 5JCTA 2ZPXA 4GMP1 1SLIA 1PIV3 1VAMA 2A3XA 3LOIA 3S6PA 3U10A 4Z2WA 4AI2A 4Q0QA 3O12A 2PLV3 1KS5A 1CR7A 4JAAA 2R32A 4GALA 1IKQA 2RM22 1QJY1 3FE5A 1H2LA 4XBLA 5ABJC 3ZFGB 3ZXEA 2HWD2 2A3YA 4HK8A 1X8EA 5T3NA 4DMIA 1WCKA 1QXRA 4EROA 2GC0A 3IPVB 4RS5C 1H1AA 4QPIC 4AQTA 5BNOB 1RMU2 3FZ3A 5JZGC 4NPRA 2D40A 3FBYA 4EN0A 4P5HA 3O0WA 1BCXA 3TRSB 5JDBA 2NPIA 3HBZA 4CDQB 2EIGA 1AR93 1N1YA 4C1XA 3FHIB 4PLNA 1GANA 1OQDA 3EHKA 3C2UA 2DCTA 4YVSB 4QPGB 5DUWA 4HANA 4PDWA 4XPVA 4QGMA 2TBVA 5I0TA 1WA4A 4WM8B 2IFWA 2HJIA 2OUJA 4Q4X3 4FPYA 4FOQA 2WA3A 5HCBA 1TMF3 1MQTA 4MSVA 2XJUA 3HD8B 4R52A 2R061 1GZ9A 1RUC3 1MACA 4BLJA 4HPKB 4GQ7A 4AF9A 1C8M2 2PQQA 4KG8A 4V1PA 5BNNC 1FX5A 3MLJA 4AGRA 2VNGA 3R4DB 4K1YA 3ZXDA 4AG4A 2IZWA 1SFNA 4ZU5A 2XGXA 3MFAA 4ISRA 4HSJA 4N43B 1QDCA 1YIPA 2OA2A 3MDPA 4Q4W2 1VBC1 1QNWA 3ZN5A 4P14A 4NVPA 3WQ0A 5TSWA 4AFCA 3AB0A 4HN0A 4XETA 2ZGUA 4AE2A 2PHDA 4TLFA 1VBB3 3VZJA 4NHLA 4GMP0 4BWOA 1SDWA 4DOUA 4NN0A 4YZ5A 1NOVA 2XH6A 4GKXA 5CVRA 2Y26A 1HXS3 2PHUA 5D8AC 2QDNA 4IEXA 1PIV2 2H0VA 3VBFA 5AC91 3N7LA 3UKNA 3L2HA 2ZKNA 1EV13 4ONUA 2AH2A 5I0UA 4KH9A 4P9XA 3SH5A 4FBFA 3M4FA 1O4TA 3KCCA 3IIAA 1YNAA 1QOTA 4YLZA 3WV6A 1PO21 3KMHA 1MZ5A 2D6LX 3OGJA 3POWA 3M70A 4LO6B 4DS0A 2JE9A 5KC5A 1DZRA 2PHFA 4AHYA 1BBT3 1Q8QA 2PELA 3AJZA 4QQLA 1Y9QA 3WP3A 5CFDA 1PO13 3X29B 1R1A1 1ND2B 1DHKB 2FZ1A 4YGBA 1U5YA 3AMMA 5EV7A 2YROA 1S0FA 4GWNA 1K5MB 3NW4A 4XF9A 2R041 2JG8B 3IT8A 2GAUA 1Z78A 3SITA 3VDDC 3CJIB 4YFWA 2WSUA 2X29A 1AR92 1AHSA 3ZFFB 3NL1A 4PJYA 2D5HA 3TWIA 2VOXA 1TNFA 5H9QA 3TAYA 3N35A 1UKRA 4A3XA 1H8TA 2WZR3 3OBTA 5EWSA 5DUVA 4XFHA 2WZPP 4XBNA 4MGYE 2XKPA 2XLAA 4MYEA 1ND3A 3MLKA 2DTYA 3SXWA 4Q27A 4Q4X2 2CGOA 1Q8PA 4XF4A 1TMF2 3IDCB 2BNMA 1VP6A 2GN7A 4H7LA 4M3CB 1RUC2 3RDIA 1AYM1 1U5ZA 5CFCB 3NVCA 4WV8A 1GSLA 4L8QA 4KU7A 4NO4A 4AQSA 1W6OB 3OTFA 5I8TA 3QLQA 4JCKA 4ISQA 1QKQA 3MZHA 1RB8G 2PN5A 1RHI3 2PA7A 3VKLA 2AUYA 5FOJB 2EF6A 1HV0A 1WMEA 5GZDA 1H4HA 2QKDA 4F3JA 4N9IA 2IXLA 4LLOA 4RR3B 3RSJA 2R071 3OGGA 4YZ1A 2AENA 1V6OA 4LE4A 1W6PB 1OA3A 2N7GA 2XJTA 3AYAA 3AZVA 4OVEA 4R9DA 1S2KA 3MF6A 5HI0A 4MGIE 1EP0A 2EXIA 4YW2A 4FAGA 1G8WA 1HXS2 3LWCA 2UY9A 1H30A 3AMQA 4QM8A 3RYKA 2I07B 1EV12 2B46X 4C91A 4EWAA 1NE4A 3MLLA 2D93A 1FT9A 5EJ3A 1Q8VA 2ZGSA 1B35B 3UV9A 2WKKA 4AI8A 1PZ7A 2WNUB 3WG4A 2HWE3 1JN2P 1Q43A 3FWEA 2PLV1 5FQ0B 3ZX7A 2A6VA 2G9GA 4GA9A 4PDWC 5A33B 1BBT2 4C0BA 4K1ZA 4LHLA 2AR6A 1QOSA 3OYWA 4YFZA 3OPZA 1LCLA 1IPKA 2ZHLA 4CEYB 4QPGC 1AR61 1BVVA 1OD5A 3RMYA 1MQTC 1X8MA 5FPZA 4FOVA 4YW1A 4HN1A 5BNPB 5J36A 4CEYA 1OOPA 5IK5A 5HCAA 4XE9A 3T1MA 3JUUA 1V9U1 4A7YA 5DDJ1 1S0DA 3ZN4A 5EXOA 3QH6A 5FREA 1RJ7A 2D97A 2PAKA 1C4RA 3B69A 1ULFA 1X33A 4AHZA 2WZR2 4N43C 3KSCA 4NOTA 5FO7B 1ZZ6A 4IL7A 5SV5A 4XFCA 2Q4SA 1Y7BA 1Z7S3 3ZYRA 1S0EA 2NN8A 3B7MA 3J9SA 4L2NA 3RNSA 4OHXA 1ONAA 1W0OA 4HT1T 2GN3A 4IEZA 1ZRFA 3AKTA 1QJU3 1HX6A 4BIOA 4QQHA 3ZYIB 4Y1VA 3VBFC 4Q4Y3 4ORFA 4LT5A 4QMAA 3M3IA 4LBJA 1CJDA 2H0BA 3W9AA 4OI1A 1RHI2 2EAAA 1PGL1 1LHNA 4MX3A 2RS51 1N3QA 4E27A 1RUD1 2VMGA 1AX2A 2ZHMA 2HWF1 4UW3A 1UN1A 1RL3A 1C5HA 1CJPA 1UZZA 1NCRB 1LOCA 1WW6A 3KLSA 3R6SA 1O3QA 5DZEA 3FFQA 3M3OA 1QGLA 1RVF1 4FPLA 3MICA 2K2SA 4J1XA 3ELNA 1NY72 3WVJA 4XF0A 3AKRA 2HYKA 4XJAA 3CNAA 3WW1A 5CFDC 1LU1A 1ENRA 2QVSB 4R4XA 5FMOS 1WLCA 1UU4A 1S2BA 2G9FA 2V73A 4N9HA 5FLIA 1HRI1 5T50A 4IEWA 1VBB1 2D43A 2WA4A 2XVKA 1CIWA 3QBQA 2ZX3A 2ZTNA 4CTEA 2CNAA 4LEJA 1YJKA 5LEJA 1NXMA 1K5MC 4FTBA 2PAMA 3ZYGA 2HWE2 1UIJA 4Q4V3 4GMP3 3H9AA 1H8TC 2ZMLA 5JAXA 3LAGA 2R1BA 3WINE 1PVC3 1CAWB 1XXNA 4L92A 5IT6A 5F6KA 2D6PA 4AHWA 4F7ZA 1REEA 4Y20B 1QJY3 4C90A 2K0GA 2F6BA 5BXXA 2Q1ZB 4IERA 4DRRA 1WMFA 2W0XA 1IS6A 2UYAA 1SBDA 2OYZA 5CG8A 2ZBJA 4JDMA 1RUG1 5CAZA 1G6NA 1PO11 2WS91 2VOKA 3ATGA 3POSA 5DG2A 2CAVA 1IZ3A 1LEMA 3U4XA 3AKSA 2AZ5A 4LA3A 1W39A 3MF9A 3WDWA 2Q0AA 3D5OA 3CL1A 4LNVA 4XZPA 4B7EA 3O0VA 1AL22 1F2NA 2ZABA 1BYHA 5KBFA 4XF1A 4GKYA 1Z7S2 2QNKA 2YDEA 4RR3C 4B3NA 1J3RA 3N7MA 2E51A 4Q0SA 4QQ2A 1M4WA 5ABJB 5KXBA 4CDUA 2VG9A 4IQPA 4YGDA 4KWKA 5FAXA 3ZSKA 4EN6B 5IK4A 1DQ4A 4Q4Y2 1V6MA 4KWLA 1QNYA 1A6CA 3ZYPA 3THTA 1HIXA 3QCWA 3KGLA 4RS5B 4QPIB 4QGNA 4IEVA 1AL0G 4WM7A 1IOAA 4HMZA 4UW4A 4BA6A 5JZGB 3BTAA 1XE7A 3KB5A 2ET1A 1D4M2 5AFEA 2CYFA 1SBEA 3BU7A 3KGZA 3WCSA 1QWRA 2ZKLA 4XJUA 3SLIA 3AKPA 3HR9A 3IM0A 2GC3A 4FCAA 1DF0A 1DQ6A 2I45A 1FNZA 1S0BA 2G4IA 3CEWA 4TZDA 1VBC3 4DNYA 2PHTA 5C8WA 1VJ2A 2ERFA 1AR81 4K20A 4MVTA 2Z2SB 1S0GA 2BWCA 1JHNA 3V56A 4BZ4A 2JG9A 3RG0A 1F5JA 3ME2A 4CEYC 1OOPC 3WUCA 1ASJ1 4Q2FA 3HT2A 1EPWA 4NR1A 1QQP2 1R082 1HW5A 1J1TA 4GWMA 4META 2BFUS 5FDBA 1ZX5A 4Y22A 1D0GA 1FPN1 3GZUC 3MPBA 4JGZA 1WCDJ 1LU2A 3QD6A 5BNNB 5AC93 4KNCA 4YGEA 3IN9A 3VN4A 1KJLA 1CGPA 5K8SA 4X8NA 5I93A 1NLSA 1QJY2 1O3TA 2A6ZA 3IDBB 4JDOA 2D3RA 4XQDA 1COV1 3VBRA 1PO23 1NQDA 3FMGA 3AXDA 1I5ZA 3D82A 3KZ4C 4FPFA 4XILA 4AK3A 1C1LA 4BQ1A 2TEPA 2JICA 4OLLA 3MIFA 4JGYA 1SLCA 3O5SA 4K21A 3QACA 1DIWA 3A4UA 3ILNA 1BKZA 4AFDA 1RTVA 1R1A3 5SV8A 2W52A 5D8AB 3MIGA 2VUAA 3UKVA 2FBEA 4N7UA 2WC2A 3PVBB 1JBCA 2JENA 1NCQA 2X8KA 2ZGOA 2ZOEB 4LO8A 1JW6A 1H8VA 3GHNA 4JTOA 4INDA 4LUKA 5H9PA 2GALA 2H6BA 2QCSB 4QQPA 2VQ0A 1OA2A 2VU9A 3GBGA 1X50A 1Z7S1 2GNMA 1BMV1 1T6GC 3RYRA 1WLWA 4B4RA 1C3HA 4ATEA 3TN91 1CAXB 2R062 1O3SA 3J8F1 1QJU1 3B3QE 3ZFEB 1AYM3 5DZGA 4Q4Y1 4IV1A 3VZNA 1OFSA 1ZZ9A 1LHVA 1MS1A 2AYHA 2O1QA 1N1VA 2XBO1 1BXHA 3VDDB 3S7IA 2VVDA 2XVLA 4XJZA 3ASIA 1VBC2 4I0WB 1NQJA 1EPZA 1H1IA 3GHMA 5F5QA 4YG6A 5JPMB 1SEFA 1J58A 2NYYA 1ULDA 5FO9B 3H1MA 2R073 4KL1A 3BPZA 2XJRA 1RUE1 1UU6A 2UYBA 2VMHA 4ES8A 3DPRA 4ASMB 2XJPA 3NAPA 1VBA1 5LRSA 2FMDA 2C9AA 2XWJB 3VZKA 1GZWB 4FTSA 2UY8A 4IEPA 4NHKA 1ZRDA 1LOGA 2BW8A 5LRRA 2EXHA 2RR11 2ZX2A 1SCRA 1LECA 3BOPA 2EXKA 3WDYA 5AC92 2WLQA 3H7JA 3W59A 1C1FA 4FOYA 4Q4V1 4M0NA 2XJSA 4EV0A 3LZZA 3I59A 5JPNB 1PO22 4AFMA 1ZNPA 2EALA 3ZO0B 1PVC1 4XYXA 1XNCA 4MXVA 4CDUC 1IS5A 2MNGA 3ZMNA 3APBA 3WDTA 1UX6A 2XG3A 2NZ9A 2B39A 2VUJA 3FUQA 2WT0A 3M3QA 2QDRA 1UL9A 3IKWA 1Z0HA 3ES1A 2XPJA 1AR63 3H50A 4URTA 1R1A2 4HKOA 4WM7C 2FQPA 2DCJA 3VKMA 3SH4A 4CEWB 3SH3A 2R042 2H6CA 4AGVA 1OQEA 4CEWA 3AP7A 1V9U3 5DDJ3 5C9AA 1YFXA 3ZYJB 1VAKA 2DYCA 3D4KA 2VOWA 4Q1RA 4H3WA 3LB9A 2VGDA 1Q5OA 2IXJA 5DG1A 3VBHA 5FRAA 4AVBA 2JG9C 4PDWB 2OIIA 4GB31 4LHKA 1QF3A 2WNEA 5CB7A 5J37A 3I4IA 4JRAA 4E4SA 1AYM2 2KM2A 1FMD3 1YRZA 1MQTB 3JB8A 3GZTB 3N3HA 2ZGQA 3SNMA 3HT1A 5JSRA 3OY8A 3SHRA 3R4SA 1PK6A 4JGZC 5E1RA 5KXDA 5L36A 4A2UA 3PVNA 1S0JA 4FPKA 4DFSA 3M3EA 5JIUA 1ZRRA 1UD1A 3A0KA 3WP4A 1MS8A 2RS53 5IUQA 4LBOA 2VH9A 4OFGA 1RUD3 4F83A 5J09A 2LALA 2ZMNA 4I01A 2HWF3 4Y1UA 4QXKA 5E88A 3H8UA 3D0JA 1ZZBA 3VBRC 2IC1A 4RD7A 4XFBA 3ZVXA 2R072 1DDLA 1RVF3 1H2KA 1PNFA 4JGYC 2P37A 1V6NA 5DZFA 4GH4B 4YRDA 2P3IA 4PBOA 3EQEA 4FPEA 4YW4A 2GH8A 3ZIWA 1HRI3 2ZZQA 4GH4A 4K3UA 4QT6A 1REFA 5GLWA 2YXSA 4LULA 3VBFB 3NJZA 1CN1A 1FOD1 4PIZA 3S30A 5BUVA 3WG2A 4EJRA 4SBVA 1PZ8A 4AW7A 2BBVA 2BWAA 1LGCA 2NMOA 1WLTA 1NCQC 2JD4A 3BCWA 4FP3A 2PLV2 1U5XA 3MEPA 1WW4A 1MS5A 2LM3A 4P9YA 3M2MA 1G7YA 2DVBA 2ZGKA 4B29A 1AR62 2Y0IA 3RQ0A 4DQAA 2A6YA 2Y0OA 3NKTA 5CFDB 2D6OX 1W6MB 3BOWA 4JDNA 4AEMA 1JH5A 1IHMA 5T55A 4IV1C 2C1FA 2P34A 1LULA 1RUG3 2GDFA 1NLRA 1V9U2 1W6MA 2WS93 3I7DA 4PIXA 5DDJ2 3ZFEC 2CWSA 1OPMA 4EWEA 4FAHA 1I3HA 2R30A 1WLDA 4MXWB 1QHDA 3D8CA 4K7JA 1AX1A 3BODA 4FPJA 3ES4A 1UW8A 1PZ9A 2VULA 3ZIXA 5GZEA 4HVQA 2MEV3 1H8TB 4MXWA 5FO8B 3ILRA 4OHVA 1ND3B 1WD3A 4DRVA 3VHOA 3NAPC 2VOVA 3RYPA 3RPQA 4LBNA 3U0ZA 4Z07A 4D7YA 4IV3A 1HDKA 1X82A 2OW4A 3I2DA 3R05A 3RWNA 3DUIA 3VHPA 4H7MA 1H0BA 3ZSMA 1OI6A 4HL0A 4ITCA 5CU1A 4HKLA 4AVTA 1W2UA 2IXIA 2YUEA 4J6GA 1PGL2 2E53A 4IEYA 2RS52 4OI4A 1RUD2 1ZZ7A 1KQRA 1FV3A 2WT1A 3DN7A 4AXOA 2HWF2 3H1WA 4B8EA 4FP2A 3EXUA 3MIBA 4GIQA 3BIWE 4XF3A 5GZFA 4MGZE 3WXPA 2RE9A 4D7TA 2RJLA 4HZFA 1RVF2 2DVAA 1IS3A 1OFNA 4OUSA 4HSLA 4P9LA 2R0HA 3B9CA 3SCHA 4LE3A 4Y1ZA 3UL2A 1AR83 3H1YA 1HRI2 1POV1 1VBB2 1SLTA 2DVDA 3ZXJA 4AEDA 3WUDA 1DG6A 1AR73 1QXJA 4CDXB 1ASJ3 1PGSA 3ZN6A 5JLVA 2YMZA 4AI3A 2PHWA 4CEWC 3L2YA 5HXVA 1PNGA 4CDXA 5C9AC 3QOPA 4GXLA 4P9JA 4CRQA 4PLOA 4OI2A 1R091 1FPN3 5H9SA 4DY5A 3H3UA 3WW2A 2Z79A 3N36A 2Q8OA 1FV2A 3MI8A 4XQWA 1V6KA 1PGW1 1HRV1 4I0BA 2NMNA 3ZPYA 4J1WA 4TYSA 3VBHC 1ZYBA 4Z8BA 5L73A 1ZBA3 2BPA2 5KWRA 4Z82A 1RC6A 3OYWB 1AVBA 1H9WA 2JE7A 3JQXA 3AZXA 3LKJA 5C8CA 5CADA 1COV3 2KXLA 4JRLA 1H2NA 2DURA 1WGPA 1RUJ1 4D7SA 4BLIA 2OUHA 1PM7A 5KC6A 1RUG2 1OOPB 2WS92 1PO12 3KQRA 2ZX0A 2RS13 4RHV3 1HLCA 4H55A 1MS0A 3OBRA 1GLHA 1UKGA 4UBHA 3AK0A 4KGQA 4AQ2A 1A8DA 4CZSA 4MZUA 1CPNA 2W08A 4WVWA 3CLPA 1AZDA 5FTTC 2MHFA 1XU2A 4YGCA 1DQ5A 2D7FA 3PJYA 2NQYA 1YIFA 2ENRA 5AFBA 1N3OA 1XNDA 2HWC1 4PBPA 3JB4C 3S7EA 2ETEA 2JECA 4HKWA 1DYKA 5EZWA 3USSA 1CVNA 4PLMA 4GH4C 4CP1A 3ILFA 4ZU7A 4Q8LA 3WQ7A 4LBQD 4LTAA 1NA1A 3UKTA 1DGRA 1FMD1 2BTVC 5E16A 4WVMA 1YXWA 3WHTA 3TN93 3J8F3 4LBMA 4QGLA 3KM5A 2X5IA 3FC0A 4IESA 4XJWA 2ZX4A 1DYPA 1LESA 2GC2A 2XBO3 1POV0 3LSEA 2XJQA 2Q5TA 3MW2A 2B7YA 1BK1A 1MS9A 2B45X 5T52A 5BY5A 1XNKA 2JDZA 1AR82 4S2GA 3V0AA 2A6WA 1UCXA 4I0AA 5ACA1 4Q29A 3MIHA 1ASJ2 2ZMKA 1RUE3 3TB0A 3POYA 4XFGA 1LHWA 3B5LB 3TOJA 1VBA3 4KWJA 4QD2A 1H9PA 3BB6A 4OHWA 1JOJA 2XHKA 4AQ6A 4TSVA 2CWMA 3KD4A 1FPN2 3E97A 4XQ4A 1ZBE3 3GYDA 5JR7B 2RR13 2QZ2A 4Y1YA 1V00A 2VNRA 1A78A 2XVGA 5T5PA 4BCUA 1YYNA 1TME3 2IFRA 2VXRA 1X7NA 1COV2 5JOWA 2ZS6B 4W6XA 1G9AA 2E6VA 1ND3C 4XIKA 5J48A 1LJ7A 4COVA 2QUOA 1S55A 2YZ4A 4DPNA 4CYDA 3FFZA 1S0CA 3O7OA 1WCSA 2E7QA 1IKPA 2XJVA 5B2GB 2VY0A 1RITA 1AXKA 4KBBA 4RGGA 1EAH1 2W39A 5BV6A 1ZM1A 3VHNA 1BQPA 3M3CA 1U0AA 2IWGB 2RS31 3W58A 5I8YA 1QMJA 2D6NA 5JIAA 4EWDA 2DFCA 4LBQB 1JXNA 2D6KA 1LOAA 3SCGA 3OD4A 5FFOC 2MEV1 3HQXA 3P3PA 4LBQA 1XNBA 2BQPA 4AEDC 1IPJA 5L19A 2V09A 4CDUB 5L7OA 5HBAA 1BMV2 2ZGRA 1MEC1 4GB33 3N4MA 1HQLA 2XKOA 1ZZCA 3TN92 3JD71 3J8F2 1QJU2 4CDXC 2D5FA 3V0BA 4WM7B 3V64A 2P3JA 3H0OA 4R9AA 1F8VA 4XMIA 5CA6A 2K9ZA 3JCIA 1V6JA 4HK9A 2XBO2 1AXZA 1KDMA 1YO8A 4UBGA 3WOGA 4O9GA 4WBBA 1C28A 1DU3D 4YW5A 4K9SA 5C8CC 1TE1B 3JQWA 3VGIA 2WFF3 3VZLA 2PTMA 1OMIA 3AP9A 1GQGA 1RUE2 2FZ2A 1E57A 4R4ZA 2JG9B 4I02A 1VBA2 1YCIA 4GULA 2GMMA 2BVVA 1WMDA 4EN7B 3WP6A 2EA7A 5A32A 1AR71 1CD3G 4PIYA 5JI7A 4RA0A 4MV2A 1YUDA 5GALA 1ZBE2 1IQAA 3B00A 3N7KA 4Y22B 2XL9A 1RUF1 2RR12 1YFUA 2VW2A 4P9GA 4W6YA 4JGZB 3VZOA 3HMYA 1RGSA 1TME2 3JBG3 4NWWA 2ES3A 4Q4V2 1FOD3 3VUOA 1MVEA 2O8QA 1KFXL 3VBUB 1XYOA 2YHJA 5GLUA 1D4VB 4FQZA 3DKWA 1CAUA 1RUH1 3AZYA 1YLLA 3D6EA 2E7TA 4YVWA 1QXPA 4COUA 3DGTA 2CY6A 3ROUA 5DXDA 1PVC2 3VBUA 3WX5A 3VBRB 1ZBA1 1J59A 1CESA 3FLTA 1UZYA 3HN1A 4M00A 1J3PA 1NA1C 4JGYB 1H2MA 2WQZC 4FT8A 1W6QA 4OZXA 5T5JA 1RUOA 2XWBB 5KHKA 2P17A 4Q1PA 2JKBA 3A0NA 3AP6A 1L3JA 3AXEA 4NHMA 3BALA 4KG0A 2GH2A 1YFYA 2RS11 2X5IC 4RHV1 1LGBA 1DQ2A 4JVAA 1ZZ8A 2GC1A 2JJ6A 4FQ4A 4RSUA 5CG9A 1XU1A 4QPYA 1WD4A 5LEKA 1DQ0A 4RFT0 1Y3TA 1AJOA 2D3SA 3N7JA 4YSFA 1NCQB 2XB6C 1WBFA 3M7AA 5K0UA 2CTVA 2B8MA 5DUUA 1KITA 2GNBA 3AMHA 3CF6E 2RM23 3M8LA 4GB32 4IEUA 3PVEA 5CIRA 3LGRA 2RHPA 3DL3A 3E5XA 4AVSA 3USUA 1ZVFA 2ZGMA 3WD5A 1VRH1 4B4QA 4YM0A 5J98B 4L97A 2PHLA 1LOBA 3NV2A 1H1MA 1F5FA 4IEOA 4IV1B 4Z1VA 2AGSA 4Y26A 2ZACA 4NWVA 2A71A 2DVGA 1NE6A 1WW5A 5JOZA 1SQ4A 4P9WA 1JUHA 5KHJA 2DTWA 3EO6A 3FJSA 1VBE1 3PHMA 4ZKTB 2WFF2 3V65A 2DV9A 1TQ5A 3K48A 4DY3A 3LSDA 5J96B 4S2DA 5F6LB 1W6NA 4BE3A 3URFA 4L9BA 3E6CC 1RUNA 4C0HA 3WDXA 1LKNA 3DPRB 1PMIA 5FLJA 3NAPB 3NO8A 1DBNA 1SLLA 2RMU1 4OUMA 4D69A 3GNEA 2DF7A 3ST7A 1POV3 2WNVA 3PTYA 3CJXA 4BMBA 2WFPA 2A5ZA 2Q1MA 1DGWA 4COWA 1LHOA 1BEV1 5LK5A 5AVAA 4CDWA 3KT7A 1OSGA 3MW4A 1FOD2 3ZXFA 4LUMA 5EYXA 1ZBE1 4SLIA 2HWB1 3AMPA 1I9RA 1I1EA 4BPZA 3VBOB 1R093 3I59B 4FPHA 3WP5A 3NV3A 1TME1 3SISA 1B09A 5KXEA 1HRV3 2OZJA 2KA3A 1KXGA 4XXPA 1GKBA 3AKQA 3VBOA 4UW6A 5L7OC 2ZHNA 1D2QA 4UW5A 4CP0A 3AP5A 4E2SA 1AYN1 3VBSA 3C3VA 4XFAA 1QH6A 2QE3A 3HWJA 1QY4A 2Y38A 2DUOA 4MUVA 5FPXA 5C4WA 1RUJ3 4DB5A 4AWDA 4QM9A 4U36A 1UIKA 4YZ3A 1DZTA 4YZ4A 1LODA 3NKGA 5J3UA 2BUKA 4Y1XA 3GALA 5GLTA 1CAVA 4LLFA 1RIRA 2HEVF 5C9AB 1O91A 1UF2C 1D2SA 2HKXA 5J7MA 1LR5A 4E2GA 3WLUA 4DXZA 1J3QA 1QOOA 4IEQA 4M01A 1JYIA 2D6MA 3CU7A 4AFAA 4FPOB 4WVVA