4LE4A

Crystal structure of pagluc131a with cellotriose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
248
Chain Sequence
b'GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Crystal Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 60
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le4A00
4LE3A 4LE4A 3W9AA
chains in the Genus database with same CATH superfamily
4NUBA 2WNOA 2H0VA 4BJ0A 5C70A 2W9XA 1FV2A 4EN8B 3AZXA 4OI0A 3DXTA 4WVMA 1F2NA 3V0BA 5LEKA 2J22A 2Y33A 1QQP2 4XZUG 1ULPA 2QTWB 3VBSA 5C9AB 1H2KA 1CAVB 3FHQA 3VBOB 1DGWX 2WABA 3UKTA 3U0ZA 1AYN2 5KBFA 1DQ6A 3BALA 3H7JA 4QXCA 1OMIA 4XIKA 3MPBA 4YGDA 4FO9A 2ZGPA 2VO5A 1UYZA 1W05A 1WA6X 3NO8A 2PELA 2R063 4HK8A 4I02A 1D2QA 2D43A 1RUF3 2D98A 4R4ZA 5I0UA 4FPJA 2HLEA 4V2WA 5JOYA 1GANA 2DVBA 3NAPA 2R071 4AEDA 1VP6A 1MZFA 1YJLA 1PO13 2VQ0A 4HXCA 1LHWA 4YW7A 4L92A 3K3OA 2P6CA 3KQRA 3UK9A 4AHYA 1RUH3 2W39A 2OT7A 4CTEA 4IE7A 1U5YA 2A5ZA 3FHAA 1AF9A 5KWRA 2R6QA 2ZX0A 2XJVA 5FLIA 4BOWA 4QXBA 4ORFA 1NY71 3MDPA 1POV3 1IS4A 3D6EA 4Z2WA 2VBBA 2EAKA 2HWD2 3KD4A 4YZ4A 3PTYA 2W1QA 1NOVA 2WQ4A 4YG0A 1QEXA 1SCSA 2PHWA 1NY72 2DCZA 2FDHA 1WLCA 1RMU2 4JTOA 4XCAA 3OUJA 1VBC1 5C5UA 4OQ8A 3IM0A 5C3RA 1ST8A 5FCCA 4E9KA 1UKGA 3VKOA 2WINB 3N36A 2R0FA 3WG4A 1DQ2A 1VBD2 1EYBA 2ZAAA 5LY2A 5ANNA 3ACLA 3AKRA 1YNAA 5FZLA 4CP1A 1A78A 3DKWA 1GNYA 3HBZA 3L9JT 2BEOA 2GMEA 3EHKA 4OUEA 4R9BA 1S0BA 5FAXA 4FOYA 4XFFA 1W2UA 3LPFA 5J48A 2XPJA 4OI1A 4F8AA 4FSJA 2EF6A 3WEZA 1OHFA 4YW5A 5IVJA 3D82A 4GWIA 1ZRFA 4P9YA 2HEWF 1RXGA 1O4TA 5DMYA 2OPWA 2ZBJA 2P3YA 1MR5A 2WT1A 5LRRA 4AFAA 4W8JA 5F3CA 2W92A 5AC91 2CGNA 4E2SA 4NMIA 4LIUA 4M00A 3VBUC 5HCAA 1R091 2OQ7A 5DAWA 4XUTA 5DDJ3 4PDWA 5JXIA 1UX6A 1V6IA 3Q9OA 4IV3C 3ES4A 4XBNA 3AP9A 3VBRA 5AC92 5FKBA 4XUOA 5B4XA 3VHNA 3AZWA 2W91A 5DUWA 2GNMA 4XABA 3BPSA 4XDOA 4Y5SA 1PNGA 1J3QA 3AMQA 1PMJX 2JD4A 3O12A 1LHUA 2QQKA 2IXJA 4GULA 1NKGA 5GKAC 5ABJB 2HWB3 1TME3 2RJKA 1ULOA 3OBZA 3VBFC 5ISLA 3U1XA 2Q1MA 1RB8G 2NM1A 2YC0A 3H1WA 5EJ1B 1GNZA 4G9SB 2ZEWA 2UYAA 1CAWA 5TSWA 3WF2A 3ZKYA 4QX5A 4GAZA 4CDXC 4O65A 4YW2A 5L19A 3NV3A 5C9AA 3HN1A 1CAVA 2F4PA 3FZ3A 3VBOA 3S5AA 3U78A 3WNPA 4Y20B 3ILNA 3Q8AA 5EXOA 3GJAA 1CPNA 4WM8B 2HBUA 3HN3A 4UFMA 3H3ZA 5F2SA 3WNXA 3CDZB 3OYWB 1HRV3 3KVBA 3MZHA 4CXYA 5F5AA 1LKNA 1WWYA 1F4HA 4PQ9A 2OPKA 3DEMA 4DMIA 2WNUC 1OLMA 2VVDA 1O3QA 4I01A 1AJKA 4YLZA 2WC2A 4FBFA 4A7KA 4ISRA 2G9GA 3C7GA 4OI2A 3WNMA 3BOWA 2Q8EA 2J1VA 4ZS3A 2OYZA 4BQ5A 5EQUA 3UYJA 4YM1A 2VNGA 1HV0A 3AKSA 2W0XA 4N43C 4CCMA 1SLAA 2BWAA 3MGUA 4Y4RA 2LROA 3ZFEB 5HV4A 4J1XA 4CE8A 1JYVA 3M2MA 3WDUA 2R32A 4N8MA 3EB7A 5FP8A 1LGNA 3MEPA 4AEMA 4YFZA 1DHKB 4IL7A 5C3SA 3NVCA 1KS4A 3WP4A 1GLHA 1H2LA 5AVPA 2WO1A 2BPA2 3POFA 1JUHA 2OX0A 2BJSA 1CD3G 1NXD1 2AH2A 3J7MA 5BYNA 3DCQA 2JE7A 2UY9A 3O1PA 4RHV3 4HSJA 4LKDA 5FZ8A 2VMHA 5I8TA 3AZZA 3PURA 1W28A 2RS51 3LE0A 2JDMA 1O59A 2OA2A 1OD3A 1F5JA 3U4XA 2WFF3 4YVWB 1JI6A 1EAH3 4I3GA 1RTVA 2FCUA 4CDQA 2X53S 3Q8CA 1VMHA 5T55A 3VHOA 4LIVA 5A7QA 2VD7A 2RJ2A 1KQRA 1DFQA 4YZ2A 2DFCA 2J1SA 3A22A 1LEMA 3NMBA 3ZSLA 3PMEA 4BQ3A 2WNVC 5T50A 3ZKUA 1SLLA 4QGNA 1XNCA 2Q0AA 2Q5TA 1O8SA 3MICA 4MXWB 4Q4W2 4YW4A 3KWVA 5JIAA 1L7LA 1ZZBA 3PU3A 1I1EA 4IGPA 3TNQA 3W58A 2CAVA 2YY1A 4OHVA 3I2FA 1G9CA 1ZX5A 1JZ8A 3QOPA 4AQSA 5D8AB 1XYPA 2R30A 4Q27A 2I07B 1WKYA 5A1LA 3BODA 4DUVA 3WF3A 3NNLA 1Y9MA 5DPNA 5H9RA 2W52A 4H2AA 5ACA1 4KMQA 3MLLA 2GAUA 2ORZA 4XCBA 1I3HA 4GMP0 5FO8B 2BBAA 5LBCA 4LLOA 4XAEA 3O1OA 1XU2A 2ZABA 2VQAA 3Q8BA 5FBZA 1S0CA 5ACA2 1W8TA 4XBLA 3KT7A 1IPSA 1VBC3 4UF0B 3T08A 3JZVA 2W2IA 2GMPA 2AEYA 4GXLA 2VJXA 4XTMA 5ABJA 4QX2A 1V00A 2IXHA 4W4ZA 1UF2C 2IXKA 1CGPA 2ARCA 4UW3A 4Z2AA 1B35B 5IYYA 1UOJA 3ZYJB 3PUAA 4A4AA 1JU4A 3ITQA 1N3OA 1RYYA 3B9CA 5FO9B 1JS9A 3WUDA 4B1LA 1ND3C 4W6YA 3RPQA 4CU8A 1LOFC 4IEUA 1IPKA 4E2GA 3KSCA 3JB8A 2A3WA 4WM8A 5FLJA 3RYPA 2IC1A 1QY4A 1X50A 3ASIA 3N9LA 4LEJA 4D94A 2W87A 1OLRA 2XONA 1R083 4WVZA 1LR5A 2Z4FA 2XUEA 1G7YA 3ZSJA 2Z2SB 4HPKB 1DZRA 5T52A 2AENA 4JDOA 4L9BA 3SISA 4UBGA 3GGLA 4AE2A 2PLV3 1OPMA 4PJYA 3SCGA 4CEWA 1R093 4LXLA 4LHLA 2KR2A 3ZFFC 2XXZA 3MIBA 1DU3D 2VZTA 2LM3A 1MS0A 2VZRA 4DO0A 3VLBB 5FV3A 2RR11 3GHMA 2Y26A 5LK5A 3E6DA 1SBEA 1ZZ9A 4K7JA 3ZIXA 5BNNC 3G6JB 2Z42A 1KDMA 1Q8PA 1D0GA 3OEAA 2Q1ZB 5LZ6A 2VMIA 4BQWA 5DQ0A 2RR12 3N7MA 4K1YA 3INAA 2VVEA 4B29A 4IXLA 3WR0A 1NG0A 2O1QA 3AFKA 5KXDA 3HBKA 4N53B 3B00A 3ZLIA 1V6LA 1XJAA 4ZZ8A 3RYKA 5SV5A 4ZU4A 4HKWA 1HXS1 2XDVA 2W95A 3HMYA 2ENRA 4D3WA 5IWFA 5J96B 1EPWA 1WLTA 1G9FA 3LQCA 2BFUS 2C24A 2HYXA 4LKSA 5LCWL 3TEZA 1HN1A 3FX3A 2X05A 2B39A 4LBKA 1Z0HA 4DOUA 1M4WA 4JQRA 4QKDA 2I45A 1UU4A 4YVWA 4QGLA 1MS3A 1JYCA 2DCYA 2ZMKA 5JI9A 1MEC1 4W6WA 5FZMA 5IAXA 5B4NA 3IIAA 4R8HA 5CEHA 1YIPA 3I59B 4EWDA 3AXDA 2H6CA 1VBA1 4XTPA 1JOPA 1RIRA 4O9EA 5CYYA 1GR3A 4FAHA 2W1WA 1MEC2 2K9ZA 1T2XA 4KI5M 4MXWA 3O0XA 2WZPP 4A3XA 1UO9A 5L9VA 1D0HA 4QX0A 4YZ5A 2HWC1 2Y60A 4AHXA 5J1XA 4XC9A 3JXSA 2DV9A 4AQTA 4Q8LA 1NE4A 4GKYA 1XU1A 3MFAA 5FDBA 2D3RA 4QKNA 2HWC2 1JZ3A 3UL2A 4XDQA 5FP9A 1DLCA 1QXRA 2WL1A 2OKXA 4CCLA 2VMCA 5JXGA 3ETPA 4XAAA 3WNOA 2B7YA 4CU7A 1XC6A 3WQ0A 1K3IA 1XNBA 1ASJ3 2X10A 2Y6JA 4UF0A 3O1MA 3HAGA 1NLQA 2EIGA 1YXWA 3THDA 2UWBA 1QJX2 4Y1YA 2QQUA 1JH5A 1B35A 1BBT1 3RS6A 3VZJA 2J1RA 3W5MA 1O3RA 1OVSA 2VBDA 3MW4A 5GJ6A 1QH6A 5DABA 2X5IC 1WA4A 3CJIA 3OPWA 2F6BA 2RS53 3B7MA 3ZR6A 1VMFA 1PO23 2QQWA 2V72A 3VBHB 3AP4A 3MIFA 3R4SA 3HNBM 3LF7A 2QQOA 4QXKA 3POEA 1GQGA 3M3QA 1Z7S3 4JC1A 3U07A 2WS91 3ZFGB 1ZZCA 1GZWB 1V6JA 1BEV1 5E88A 1VAKA 1WCQA 1DGLA 4NIHA 4HPKA 5FZIA 5LA1A 5FJKA 1XSRA 4UYBA 5JPMB 5A7NA 2AYHA 4Q1PA 4RYDA 2VY0A 2VOXA 2BU9A 2WS92 4K20A 4EZHA 4Y1UA 1BEV2 2A7AA 3WT3A 1KRIA 1TQ5A 1RUG1 5K7PA 3B5LB 5KXBA 1Y9GA 4HT1T 5APAA 4BYYA 3FBMA 3VDCA 5IATA 2GH2A 4IETA 4RFT0 4I0WB 5FZ3A 1JYIA 3ME2A 3N7KA 2YHJA 3A23A 1Q3EA 3I3DA 5EHDA 2YMZA 4XJ9A 2HEYF 4KNCA 4N53A 4W65A 2D6NA 4SLIA 4NRPA 1I5ZA 4JX0A 1O3SA 4JGYB 3ZXLA 1NXMA 3SMHA 4WVWA 5F6KA 4Y5Z0 4NPMA 2QQLA 4WV8A 3FJSA 4K8FA 3SNMA 1RUD1 5I0RA 2UWCA 2FDIA 3POIA 1BZWA 1QJY1 3AX4A 2WSVA 3CIHA 1DQ4A 3LEMA 5IK7A 4IE6A 1KFUL 2A71A 4BQXA 2ZTNA 1DQ0A 2BWCA 5JOXA 1VRH1 1OA2A 1LOCA 4CP9B 3GZUC 4MUVA 1NAEA 4KH9A 4W6XA 2HWE1 3OTFA 4JHTA 2WBKA 4CUGA 3H7YA 5IVBA 3FWEA 3I59A 4KG0A 1OUSA 4M4RA 2JECA 3VZNA 5L7OC 2QZ3A 4FPCA 2QJVA 1JZ5A 4YFWA 3MYXA 1YQ8A 5A32B 3THCA 2HWE2 1ZBE3 1W0NA 1MS9A 4WM7B 2EICA 2LALA 2Y64A 2GNTA 1CONA 3ACHA 3SXWA 4LJHA 2HEVF 3CZJA 4INDA 3BGAA 2PHRA 1QIQA 4CCJA 3LZZA 1AR61 4XFIA 1STMA 1GWKA 2MPFA 4EN6B 1IKPA 5E8AA 4XJUA 2IUWA 4Y1ZA 5FMDA 5GLWA 3JU9A 4N9IA 5FK8A 4AI0A 1AR62 1S0JA 1R1A3 5FYUA 4C1WA 4Q0UA 2ZGKA 2XHNA 1HRI3 3VD3A 4F3JA 3A0KA 3ZFEC 3USSA 1RUE3 4YG6A 2DUOA 3IDAA 3LGRA 4ZXKA 4COZA 4LOTA 2PXJA 2EXIA 3WZ1A 1G8WA 1YQ5A 1HXS3 3AJYA 1EV11 1XOYA 1OA4A 5CKNA 5FIXA 4LOSA 2DTYA 2Y6KA 2CU5A 4GMP3 2GC1A 5F2WA 3WF1A 4CPBD 3PUHA 3M3CA 4D7SA 3IDBB 4QHZA 4NHYA 1GOHA 1DGRN 2OXBA 2P34A 5EV7A 3WLUA 2P6HA 1XNDA 3A4UA 5FRAA 2YPDA 4YVSB 4CXWA 5GLTA 1DLLA 1UKRA 1VBA3 3ZFGA 3N4MA 1RUF1 1PZ8A 4BZ4A 1UY3A 4JZRA 3IPVA 4QQ2A 4B4QA 3DXUA 3OPZA 2R062 2PFWA 1YCIA 5BV6A 3DYOA 3RVHA 4IEQA 1PO11 3I8TA 4LBQB 2VCCA 1FMD3 5GZEA 3WP6A 4PLMA 4AZZA 1DYPA 1REFA 2TEPA 1JZ6A 1N3PA 2UWAA 1I6XA 1POV1 1LTEA 1RUH2 3PL0A 4BU2A 1NCRC 1VMJA 1UY4A 3NL1A 4RS5B 2CL2A 4Q4V3 4RGAA 5D8AC 4CEYA 3BIEA 3PUIA 2WWUA 2I74A 2ZGMA 3AM2A 4FPHA 1LOGA 2DCTA 3AP5A 2RS13 1MS8A 5FY8A 4PI2A 1LODA 2YG0A 2VM9A 3BU7A 3PIGA 3WSOA 3K3NA 4JGYA 4UFHA 4I2OA 1YQ2A 1S0DA 4KU7A 4QQPA 5FYMA 5IFTA 1D2SA 3GYDA 3MLKA 2W46A 1E5SA 3P6BA 1UY0A 2WR9A 3UETA 1A34A 1FPN1 1NQJA 2WZR1 1OF4A 3KLSA 2G9ZA 4LK7A 4AI8A 1UU6A 2IWGB 4AOCA 4LPLA 2JDHA 2E7AA 5IT6A 5LBBA 1H9PA 1PZ9A 2OVUA 3WY6A 4AGRA 5A3NA 4XFAA 2YFUA 4M01A 3QH7A 4NPLA 4CP9A 5FMBA 2A6XA 5F3IA 3N7LA 1LNSA 5F39A 5J36A 1E5RA 3SKJE 4AQ6A 2CSGA 1KDKA 3IB3A 4RN5A 5LA0A 2GP5A 3A7QA 3NV1A 3QBQA 1ZZ6A 3H1YA 3TN91 1UZVA 5L7OB 2NQYA 1LAJA 4ZZ5A 4WM7A 3HQUA 1RUI3 3I2KA 3J26N 2ZGNA 5FZ6A 1G9AA 4NIIA 2WZ8A 1RUG3 3I2IA 2DU0A 5DDJ1 2QQNA 4GQ7A 2BNMA 1BXHA 1C8M3 1UYPA 4YW3A 5L9BA 5A6YA 2A6VA 3VDBA 3ES1A 1XE8A 1F9KA 1AXZA 4IGOA 3CLPA 5IUQA 5F5QA 3AJZA 3MBWA 4IGQA 4RGGA 3AB0A 2JJ6A 2OW4A 2E53A 3FFQA 3H8RA 4A41A 1TME1 1HB2A 3TEWA 3OGGA 2A3XA 1ND2A 2C1FA 2DVGA 2MEV3 1YO8A 3I3BA 3OSDA 3S5QA 1RUD3 4NHXA 3WW4A 2H0BA 2HWB2 3I3EA 1LHNA 1QJY3 1TME2 5FOJB 2VU9A 3K77A 5GZCA 1JMUB 1TG7A 1Q5OA 1VBE2 2ARAA 2GP3A 2W08A 2YC2A 4XF4A 4BK5A 1OOPA 1HKDA 1VALA 3IDEA 1VRH3 3NJZA 3MI8A 3Q8EA 5HCBA 3W21A 2Y6GA 3ZSKA 3TNPB 5IHRA 4XE9A 4YVSA 1ZA4A 4Q0QA 4EJRA 5IK8A 1HRV1 2BDRA 1H4GA 3RDIA 1UD1A 1SPPA 4PLOA 1TEIA 4P9IA 4EROA 3FL7A 1JYWA 3BTYA 3A21A 4MOAA 1UYYA 1HRV2 3CZUA 5A6QA 5FFOC 1NZCA 5JSOA 4LBQA 1ZZ7A 4ASLA 1GUIA 3WDYA 4MV2A 1W04A 5EPAA 5DAXA 2VQTA 4Q2FA 4PDWB 2ORXA 4HVQA 3LB9A 4OQ9A 2VCBA 1WCUA 3BIWE 4X8PA 3N3HA 5T54A 2YYOA 5FXZA 2LTNA 4MXVA 4Q4Y3 3B93A 1UPIA 4RS5A 4CCOA 4XHBA 4CSWA 2GN3A 5KHHA 2VQUA 1FV3A 5JI7A 4CCDA 2Y6LA 2GZWA 1W2TA 3IN9A 1IG3A 5DZEA 5C3QA 1BHGA 3FE5A 5FZAA 1QOTA 3J7HA 2Y38A 3UJOA 1I9RA 1ZA7A 5FKCA 1XNTA 1EV13 4OMDA 3VD9A 1CAWB 4AVCA 1BJQA 2C4XA 1V6KA 2G19A 1UZZA 4FI9A 3D3AA 2HBTA 2QQMA 2DF7A 2JKBA 4COWA 1OPOA 2WNEA 4RHV1 3L2HA 1YFUA 4XUNA 4X8NA 5CG8A 1UMHA 4K21A 3MO4A 1E5HA 5EYXA 2WFF1 3IMNA 3K2OA 5T5JA 1MZ5A 1RUJ3 2PAKA 1EAH1 5CBLA 4CDUA 3IT8A 1X9PA 5FWEA 1DP0A 3VBHC 1WMFA 4A2UA 2ET7A 2WFF2 1EAH2 1SACA 1PK6A 5F37A 1US2A 2J1UA 3IAQA 4FCAA 4GKXA 2WT2A 5L7OA 1TE1B 3P3NA 3PLQA 2VOTA 1W6NA 2R072 5FYTA 2B45X 4UT5A 4XPVA 4XJAA 2BBVA 3OUHA 3RWNA 4QMAA 4ET7A 4LO4B 1ENXA 1ULFA 2IFRA 3AC0A 1QU0A 4LE4A 4H7MA 5EFUA 3N9MA 5FZ7A 5EIYB 5KHGA 3W5NA 1CJPA 3T09A 1A8DA 1N1TA 1OT5A 2ZMLA 3R05A 4NHKA 3RQ0A 3EYPA 2E32A 1NX9A 3KHBA 3ZDSA 2D6OX 5F5IA 1SLIA 2XWJB 4AHWA 1ENRA 5C4WA 5FWJA 2JENA 2A6ZA 2DCJA 3NJXA 2XL9A 4XETA 2B4KA 1EUUA 3ZYHA 1FPN3 1VBC2 2WZR3 2ZGTA 5CB7A 4B7KA 1FYUA 4XYXA 5DG2A 3TWIA 3MV01 4CDWC 1UOGA 3KT4A 5KXCA 2VUAA 3WP5A 4RR3C 3LDRA 1IZ3A 2XB6C 4GZ9A 4COUA 2PHLA 3KV6A 1W06A 3VZLA 1QF3A 2XGXA 5FMCA 4Q1RA 5FY7A 1QKQA 1ZZ8A 2DBNA 1BMV1 1MQTB 2XH6A 1SCRA 3N7JA 3POYA 4CDQB 1JYXA 3O1SA 4FTSA 1ULCA 1C28A 3KCCA 4CU9A 1PVC3 4TZDA 1ZRIA 4HZFA 1BMV2 5FMOL 1R081 4QX1A 5A7OA 5D2AA 4QU1A 1W90A 5BNPC 5DUVA 2XLFA 3TN93 3VZMA 4F83A 5DUUA 3AYEA 4D6RA 2GNDA 3K46A 3B9IA 2V73A 5KHJA 3APBA 1QNWA 2PLV1 3ZO0B 3V0AA 4IE5A 1SBDA 3OUIA 3UV9A 3TEXA 3DN7A 5FP7A 2VMFA 2ILMA 4LBQD 3ZMOA 1OURA 2PLV2 2VECA 3T4HB 1CVNA 2K0GA 4HVRA 1R092 1SDWA 5BNOB 4BK4A 1MACA 4UFIA 2EA7A 3PJQA 4JGZB 4UW6A 4CYDA 4DEVA 5I0SA 3DYMA 5F8PA 3B01A 2XJSA 3T0AA 3AP7A 3O5SA 2SLIA 2ZHMA 4AI1A 5EYYA 2WLPA 3FN9A 2YB7A 1JYTA 5CFDB 1BCXA 1J58A 4PIXA 1TZOA 2CGPA 1KGYA 1ENQA 3SCHA 1ZVFA 3GXUA 3E6CC 4XHXA 1LU1A 4ZU7A 2FCVA 3JUUA 4XDPA 5FPAA 2B42B 1IG0A 1RVF3 2WQ8A 2RG4A 1X8EA 3HOBA 4OULA 2WUHA 3O14A 4XXAA 4ITCA 2I2SA 3KGLA 3IKWA 2VMDA 4PF5A 2GC3A 1CN1A 3RWKX 3U37A 4YNIA 3SH4A 3WQBA 2D93A 2WO7A 4GJYA 4NO4A 2Z79A 3CNAA 3LAGA 4HK9A 4K8RB 1YI7A 4QAWA 4CCNA 5IVFA 5JZGB 3LEIA 3OB8A 5T3NA 3Q8FA 4XEZA 1D4M1 4E2QA 1SLTA 4OMCA 4U2AA 3V0BB 1TNRA 4CEWB 1OH3A 1AJOA 2E9QA 1VPHA 5LW9A 3PHMA 1W8FA 4Q4X3 4TTGA 1DQ1A 4AK3A 4FTBA 3JQWA 4P08A 1CX4A 3ZXDA 1FNZA 1SDDB 5FXWA 3PIJA 4OUMA 4QU2A 5K4LA 4DRRA 2YBSA 3SQOA 3W9AA 5FY1A 3BTZA 4K3UA 1YQ6A 2R043 1AR93 1X36A 2XVLA 5H9QA 1BKZA 1FATA 4BQ2A 4NRQA 1CJDA 2WN3A 3ZDVA 5LWBA 1DBNA 4IV1A 1HQNA 2V5YA 3PJYA 1VAMA 1ASJ1 4BQ1A 2WQZC 3KMHA 1NCQA 2V5DA 1F4AA 2GNBA 4AYUA 5A80A 3LA7A 3RNSA 1D4VB 3F2ZA 4QQLA 5AFBA 4WZCA 2E31A 2AREA 3N9QA 1AHSA 5FZFA 5CFCB 2A75A 2HKXA 3KF3A 3RRDA 4QQHA 4BXSV 1W99A 3C7OA 3SH3A 3AYCA 3VBSC 5LY1A 1PO21 5JAXA 1MQTA 2JDAA 3AP6A 4LHSA 4NIAA 5A3MA 4OHYA 5L36A 1QQP3 3ILRA 3C3VA 2B9VA 2RS52 2D97A 4OI4A 5DXDA 4DS0A 5C3OA 5FZGA 3I2OA 2DVAA 1WW6A 4MVTA 5FPBA 1Z7S1 1OVPA 1YIFA 3I2DA 2NZ9A 3L2YA 4Y4YA 4AFCA 4AXOA 4BWOA 1Z7S2 1M06G 3D4KA 4EWEA 4LHKA 4LLFA 1N1VA 3MIHA 3NAPC 4AEDC 4BM8A 4Y1XA 3FUOA 3UKVA 4QPIB 2FDGA 4RQPA 2PAEA 4HL0A 5CKQA 5BNOA 2D40A 4YRDA 5E89A 2VUJA 4JGZA 5GZGA 2JB8A 1U0AA 2E7QA 1LB2A 2QQVA 3NWKA 2PA7A 4XMIA 1E57A 1SZBA 2PAMA 2B8MA 4PIYA 2ZEXA 2JG8B 4ES8A 1T6GC 3JBG1 1FXZA 2WA3A 5CFDA 3MF6A 2RDQA 1NE6A 4UW5A 1TMF3 1K5MB 1WMDA 4RA0A 5IJRA 2JG9B 2XOMA 3RI9A 5D21A 3DPRB 4BPZA 1JBCA 4EE2A 2PTMA 1HQLA 2DVDA 2WN2A 3CJIB 3J8F1 4K1ZA 3VDDB 4BHPA 3IWZA 3N9OA 4MO3M 1DZTA 4M3CE 3WP3A 1OUXA 2A1XA 4PIZA 5IVVA 5KR7A 4Z92B 5T5PA 4Z07A 3RJ2X 4FTEA 4MSVA 1A8MA 1CZTA 3LPGA 5FPLA 4M0NA 4YARA 3UGFA 2W94A 5JZGA 4XURA 3ZN6B 1WW5A 5FY0A 4GD4A 1YJKA 3ZYBA 2BYVE 2EIBA 2ZX4A 1OD5A 4XXPA 3PTRB 1GZ9A 5EP9A 5K0UB 1O4YA 1QJZA 1H4HA 1K5JA 1V6NA 1ZBE1 4TWTA 1JODA 4BMEA 5C33A 3C7HA 3KHCA 1W9FA 4IW3A 1ULDA 2AC1A 1MVEA 1W2AX 4COVA 1GOFA 5KHKA 1PHMA 4IUGA 3VD4A 1BVP1 1ZBE2 3DECA 1YLLA 3K51A 1MVQA 4HOOA 1WMEA 1DDLA 3ENRA 4PF1A 2WO3A 3T2TA 5FUNA 1ZM1A 4GA9A 4PDWC 3URFA 4P9XA 1G9BA 3E5UA 1GMMA 2WAAA 3IDCB 3PNAA 1WCSA 2R1DA 3VBRC 3LA2A 2XJUA 1PGL1 1R1A1 2GMMA 4SBVA 4CVUA 4MGZE 1UX7A 1W6OA 3WDWA 1HRI1 5FZCA 2JE9A 1Q8QA 1RUE1 1R1A2 4QKFA 5ANQA 4S2HA 5JPNB 1X9TA 1ODNA 2GU9A 2VUDA 1HRI2 4BISA 2JDZA 5CFCA 4D7YA 2HH9A 2XBO1 1RUE2 4MGSA 1O3TA 4GALA 3VD7A 4GMP1 1W03A 1HXS2 3MIGA 4CUBA 4DINB 5C9AC 4W50A 2FDFA 2PHTA 3UGGA 2XUMA 5H9SA 3VBOC 1AYM3 1VR3A 4RSUA 3K48A 4LKEA 1YWKA 3P1IA 3LSEA 2FBEA 5T5LA 2ZPXA 3C7FA 1LRHA 5FXXA 5GALA 1XYOA 4AG4A 2WT0A 4P9GA 5JDBA 2VGDA 3FFZA 4EN9B 1D4M3 3UKNA 4AFBA 5F32A 3M4FA 5JVVA 1HLCA 1Q8VA 1W3VA 1MS4A 1VBA2 3CBNA 3HQRA 3MW3A 2RDSA 4C90A 1FMD1 3LOIA 2JD9A 2JXAA 1P8JA 1ZNPA 4MYEA 1GP4A 1RITA 4XJWA 3M3OA 4QPIA 2YZ4A 3KS7A 3KGZA 1JZ2A 3K75B 1FMD2 1LESA 2XL7A 3GZEA 1SFPA 4XOGA 3DL3A 1IS3A 1CZSA 4U36A 3AYAA 4YGCA 4Q4V1 1LGBA 4KQ7A 1WD4A 2EIEA 2QDRA 4YSFA 4IEZA 2JG8A 4AFMA 1L7QA 1IKQA 5FP3A 2F4LA 2A73B 2RS11 2ZX2A 4D0QA 2BQPA 4Q4V2 1K5MA 4GH4B 2XJRA 2JG9A 4MH0E 4YYOA 4MGYE 2C9AA 2JX9A 4GB31 3ZYPA 3DPRA 2JDKA 1IQDC 5FMOS 2ZX3A 3VDDA 5I0DA 1BBT2 4FP2A 1U5IA 3WQ1A 1W8NA 1TVGA 1PNFA 4YGEA 2P4EA 4EN0A 2RVAA 5GM0A 1YYNA 4O9GA 3S0MA 2W3JA 3WCSA 1X8MA 3MIEA 4LA3A 2KD7A 2JKXA 1FNYA 3D5OA 4Q0SA 4BE3A 4V2VA 1G6NA 3ZN6A 3PDQA 3ACGA 2BUKA 2Y6HA 3CJXA 1XRUA 4FFHA 4CDQC 3RZMA 1IOAA 2ADDA 2VR4A 2B5HA 3IPVB 2HYKA 1VRBA 1AR83 4QX8A 5J98B 3IZOA 5K0UA 3WF0A 4UW4A 1N1SA 4QB1A 1W6PB 2AEZA 1W39A 3CU7A 1RUI1 3SH5A 4TLFA 3VD5A 1H6XA 4PBPA 4A7YA 3MLJA 2BTVC 5FXVA 4AVSA 1HJGA 1U12A 3ABZA 4GWNA 2EAAA 3BYWA 4JV4A 1V0AA 2BP6A 2ZAHA 4Q4W3 5F1RA 1C8M1 1RUI2 1QH7A 1H2NA 1RUG2 2E33A 3U75A 5CIRA 4CEYB 3QACA 4XF1A 5LEJA 4XFGA 1UZWA 1C8M2 2DVFA 2WO2A 3JBG3 3CL1A 1HB1A 2QZ2A 5A6XA 1B09A 4NAMA 3M3IA 5JCTA 3NNMA 3GJBA 5LBFA 4AHZA 4LO6B 5LB6A 3OJBA 4LMFA 4HKLA 4UAPA 1UY1A 1LHVA 3AFGA 2MEV1 1OI6A 1AZDA 4HBNA 4HN1A 4XUPA 3SLIA 2ERFA 1RINA 5ABJC 1Y7BA 2FD8A 3DKQA 3J8F3 4UFJA 1DZQA 1YEWA 2ARBA 4YM3A 2RMU3 4UWDA 4H55A 3RYRA 3UJQA 4QDRA 5A3PA 2MEV2 3CF6E 2VCMA 4K9SA 1HJFA 5CU1A 1ULEA 3HIFA 1RUD2 4QM9A 5FY4A 2IFWA 1QJY2 1V70A 4CCKA 2ID4A 4YW1A 2VPVA 1KJLA 1XE7A 2YDEA 3OGRA 2RS33 3RZGA 3P5BA 3QLQA 4WM8C 5E16A 1VRH2 3H42B 3R0RA 1WW4A 3WW2A 3NNJA 4Y3OA 3ZR5A 1BQPA 1NT0A 4QPGA 5FUPA 3RMXA 2DWRA 4Q0VA 3JD71 1VBB3 5BNQA 5A3TA 1BVVA 5EJ3A 4IE4A 5T5OA 2K2SA 4IEWA 4MADA 2R1BA 5FBJA 5H9PA 1OF3A 2Y0OA 2VZOA 3D0SA 1J3PA 5JSRA 2XJTA 4LBLA 1RUC1 4LA2A 4OUSA 4XZPA 4C1XA 4CEWC 3RSJA 3LFIA 5F6LB 3OBAA 3WDXA 3ZPYA 1H2MA 3HNMA 4FPOB 2QQPA 2XMLA 2YGMA 1GZTA 1UNBA 4Q4Y1 2D6MA 2JB4A 3WHUA 5FPXA 2D3PA 1DYOA 2DCKA 3E1F1 4FPLA 2E51A 4Q8KA 1O5LA 2VW1A 4IV3B 4FFIA 3ZXAC 4E4DX 4H7LA 4Q4Y2 1W6MB 2WWJA 1OKQA 1PGW1 3M70A 1ND2B 4AGGA 1H8VA 3R4DB 4GH4A 2ZJCA 1UIJA 2ZKNA 3SEEA 3WHTA 2QNKA 5CISA 1HV1A 2XBO3 3E97A 2NMOA 4IEPA 4XUQA 3O1RA 2JDYA 4OZXA 5DG1A 5FZBA 3OBRA 1EV12 1OOPB 5DAVA 1JXNA 4H14A 3VBFB 3HD8B 1IS5A 1S0FA 2Q8CA 3NV2A 4D69A 2VZSA 2ZZQA 5FZEA 1RUJ1 4IEYA 3HEIA 5LA9A 3S7EA 3CO2A 3WG1A 1FOD3 5BY5A 1NYWA 1SPPB 4YVWC 5F9TA 4H3WA 2IVJA 5CZKA 1RUJ2 2J7MA 4ZU5A 1NA1B 5LATA 1W0OA 5FPUA 5DN2A 1RUF2 2XJPA 1W6PA 2BV4A 2D6KA 3I49A 2WYSA 3AMNA 5A3WA 5K8SA 1KS5A 3SITA 3R4UA 3RZHA 2BVVA 4NR1A 1UCXA 1PO12 4QWNA 3ZIWA 4NE9A 1W8HA 2VZUA 2XLAA 2JDNA 2P3JA 4P9WA 4XFBA 3CMGA 1TNFA 3T2QA 3WD5A 2CDOA 2YROA 4DRVA 1T6BX 3U14A 3KV4A 4URAA 3WXPA 2QE3A 1CAUA 4QXHA 1JHNA 1N3QA 2R49A 3UGHA 1W2NA 3GM8A 4NWWA 2VNOA 2NMNA 4OCTA 3AKPA 5M0TA 4YM0A 3O1VA 4XJ8A 1YHFA 2C6SA 3S7IA 2CGOA 3LWCA 2D44A 1LENA 2DFBA 4DXTA 2XQXA 2Q4SA 4GB33 4HKOA 3DGTA 2RDNA 3LA3A 3EJKA 2EXHA 2GN7A 4XW3A 4B8EA 4P00B 1B35C 3VV1A 2A6YA 2JG9C 1V9U3 2IXCA 2BW8A 2UU8A 3WV6A 1FPN2 2DUPA 2WZR2 2YBKA 3PVNA 4KU8A 5BPXA 4JVAA 1H1MA 1HW5A 2XG3A 3V65A 4BB3A 3CJIC 4PCRA 2Z5WA 3U10A 4C8DA 4P9JA 2G4IA 4CDUB 3CQOA 1ENSA 3GBGA 4D7TA 2VOKA 3U4SA 1PVC1 3WNKA 1BLZA 4Y24A 4S2FA 1YUDA 1W9SA 1PK6B 1PVC2 2VNRA 4LUMA 4JRAA 1E5IA 1Q8SA 2P3IA 4JRLA 4MGKE 2CTVA 3TEYA 5CG9A 1W6NB 2FDJA 2D5HA 4Y22B 1LHOA 3TN92 4BQYA 2RV9A 1ACCA 3ROUA 4NROA 3T2OA 5JMOA 1XXNA 2P2KA 4MLOA 3B02A 3KM5A 3BVCA 4TSVA 2WNVB 5L73A 2B9UA 4A3ZA 3FLRA 2WLQA 1KFXL 5DDJ2 2RM21 2ATFA 1H9WA 2FMYA 2WYFA 2HWF1 4FPGA 3OF1A 3VBUA 4P5YA 2XVGA 2ZGQA 3S30A 1QGLA 3OY8A 4BLIA 4IV3A 4RGKA 4MGTA 2VZPA 1W6MA 5C4WB 3KVAA 3AKTA 3JB4C 1AR73 2OZ6A 2QBXA 3ECQA 5FYBA 4N53C 3ACFA 2E6VA 1AL23 3OOXA 2VW2A 1IQAA 2C0ZA 2GC0A 1RVF1 2A6WA 2V09A 4NHMA 1XE0A 2LS6A 2JDPA 4HVOA 4O7XA 3BPZA 3VBFA 2VUCA 3RZJA 1F15A 2JICA 1RVF2 1F31A 4CDXA 1BK1A 2ZX1A 2VW0A 2VMEA 3VGIA 1GFF2 4C0HA 4TXWA 1S0GA 3FLPA 1XQNA 5A3OA 3TAYA 2YV8A 4FXKB 3JD73 4N90A 1UZ0A 3ZXGA 1JTZX 4IE0A 1J84A 1ND3B 1XBFA 3POGA 5I0TA 1LECA 3D0JA 1OLME 1NA1A 3EXUA 3RJRA 3WDVA 4BIOA 5CA6A 3NKTA 2OZJA 2P37A 3QD6A 4IQPA 4DZGA 3VUOA 1F35A 3ILFA 4LORA 2IXIA 4XVHA 1W8WA 3V0AB 3FLTA 1MS5A 3RG0A 4E8DA 5AFEA 4Q4X1 2XLGA 2A3YA 2V4AA 4ARYA 2R16A 2ZCWA 4LKFA 3AMMA 1RUC3 4LBJA 1R64A 3VHRA 2QFEA 2WNUA 3PUSA 5IW0A 1VB4A 5DAQA 4Q4X2 5DAPA 3UESA 3J4UH 2R041 1AR91 3OGVA 2ETEA 3T1MA 4ASMB 1LULA 4JQTA 4JCKA 1WD3A 5EZWA 3ZFFB 2O0OA 3THTA 2ZKLA 2Q1FA 2GDFA 4Y33A 5L9RA 1J3RA 4AL9A 4L2NA 2R042 1AR92 3M3EA 3UT0A 4N43A 5BNNB 1JOJA 4LUKA 5CNAA 2Y6FA 3HNYM 3ZN5A 2NYYA 4N9HA 3VKNA 1COV3 1JHJA 3VZOA 3C2UA 4LBOA 1US3A 1MPXA 1S0EA 4Q29A 5JIUA 3WG2A 4Y26A 5I8SA 2VAUA 2BOIA 5BXXA 4QX7A 4JTNA 2PHDA 4XMAA 5IVCA 2RE9A 3WDTA 2WWSA 4RHV2 5A7SA 2X09A 1QQP1 4KWLA 1RHI3 1FAYA 3LFMA 2VZ3A 5FO7B 3HPNA 4A6OA 1QMJA 2PQSA 1GWLA 2BNOA 2VTFA 1U5ZA 2D5FA 1AYN1 2Z69A 1AUYA 2IZWA 1RGSA 4FPYA 3RI8A 4DNYA 1Q8OA 3ACIA 3IMMA 4LO5B 5C71A 3GDBA 1NLSA 1Z78A 3ZFGC 4FXGB 4J25A 3ZSEA 4B4PA 1W8UA 4AGVA 3FBYA 4Y22A 2PQQA 2FHRA 3O1UA 1PX4A 3ZPOA 2WZEA 5LA2A 2WNVA 1S2KA 1PIV3 2TBVA 1CWPA 1QNYA 4FOVA 4DY3A 1RJ7A 2W1SA 2PHFA 4J6GA 4P14A 5HXVA 2QCSB 2BFUL 4ZONA 3BB6A 2FZ2A 2JDUA 3TBDA 4IV1B 3X29B 3OGSA 3EQEA 2KXLA 5LK7B 4I30A 4JHZA 1EUTA 4HLTA 3AYDA 3DYPA 1NCQB 4QQOA 4CEYC 1BK0A 2W5FA 5FZDA 3TYJA 1YQCA 5FYIA 5JWPA 3ZOIA 4LT5A 2EVXA 2HWD1 4DXRA 1TMF1 1S0IA 3H3LA 1OFNA 1C1LA 2VTXA 4R9CA 4XF0A 1W6QB 2ZGRA 1RMU1 3M7AA 3PVEA 3E6BA 4JGYC 2VL4A 4CP0A 4EV0A 4XF3A 1TMF2 2PMWB 1UOBA 1C5HA 1XYNA 4AWDA 2H6BA 2KM2A 2RHPA 1FX5A 2TUNA 1CAXA 1PMIA 3VN4A 4M0HA 1NQDA 1O4ZA 1VBD1 2Y34A 2VMGA 2X5IB 4GJZA 5JSPA 1UAIA 1UIKA 2AGSA 2PHXA 4P5HA 5CKMA 1KITA 3MUZ1 2C26A 4CCCA 1ND3A 2XJQA 3ELNA 4UFKA 1LOFA 3OGJA 5HCFA 3VDAA 5C3PA 1R082 3SEPA 1EPZA 3WG3A 1W9TA 2BNNA 1SMVA 1S1AA 3ON7A 3GNEA 1AXYA 3FUQA 4AEJA 4EQVA 2Y8KA 1H8TB 2ZMNA 1X82A 2BOJA 2VZ1A 1WCDJ 3K4ZA 4RQPB 4WM7C 2Q8DA 4G4FA 1A6CA 5AVAA 4B7EA 2BZDA 4TYSA 4CUCA 2GH8A 5B2GB 1QJEA 2RM23 4JDMA 3BTAA 1URXA 2HWF3 3USUA 1MS1A 2D7FA 4QB6A 3W59A 5FTTC 3GCWA 3ZFFA 2BRTA 3I97A 4AAPA 4QHOA 5JUVA 2WJSA 1XB9A 3E5QA 5E1RA 1W9YA 1YC61 5DZFA 5CVRA 5BNNA 5HI0A 4MG2A 1DYKA 2LW8A 4BXFA 4UFLA 4ZS2A 1JYNA 2D6LX 4EN7B 2FCTA 2ZACA 2EALA 2WSUA 4B4RA 4PI0A 2P5BA 4LE3A 3H8XA 1UYXA 1ND2C 2QKDA 3AKQA 3H1MA 4UOJA 5FY9A 4DPNA 4MHRA 1SFNA 4YM2A 2VXJA 1X7NA 5I91A 3ZXEA 1L3JA 4ATFA 5C8WA 1AYM1 1OSGA 2YBPA 5F5CA 5FZ0A 2PYTA 4LITA 4MX3A 4BMBA 1OOPC 4OLLA 4RD7A 4ZHNA 4OZOA 1ODMA 4AI2A 1VBE3 1AYM2 4DIQA 4YGBA 4YVSC 4C91A 4S2DA 2NP0A 2FDKA 1HN0A 5CADA 4QGMA 1O91A 1SLCA 4YZ3A 1REEA 5A33B 1QJFA 4WZFA 4E27A 1G9DA 3TRSB 4LO8A 3VL8A 4HMZA 5C8CB 5KHIA 2YFZA 2ZZJA 1A3KA 1D4M2 1NA1C 3A0NA 1GQPA 1IS6A 5JMCA 4CRQA 3J7NA 2BGOA 5E6HA 1LU2A 4FT8A 3ZYIB 2F17A 2CY6A 1ZYBA 5HXMA 2ZGOA 1W0PA 1CQ9A 1ZBA3 1S2BA 3HVDA 1WMXA 1XPWA 2XKOA 2Q30A 4BIFA 1PMHX 3PMSA 4L11A 3V64A 5KC5A 1W6OB 1OQDA 5J3UA 3FHIB 3ZYFA 4YZ1A 2Y0IA 4RS5C 4IEOA 1JU3A 1VB2A 1Y9QA 1ASJ2 1Y4WA 1ZREA 3GCXA 3VB9A 3VKLA 1QJU3 1W6QA 2P17A 3GHNA 2JIGA 1NZIA 5IVYA 2NN8A 2N7GA 4COYA 4XQWA 5KC6A 1KXGA 4M4PA 4OYUA 1W8OA 3NRUA 4FQZA 2WDBA 4QT6A 3BKZA 2WAOA 1PO22 3LKJA 1QDCA 1HQWA 1N1YA 2X5IA 2ZGSA 3PUQA 3NNFA 3SCFA 1HX6A 3BOPA 4J1WA 4ISQA 1AYN3 2W47A 1POQA 1SLBA 2IXLA 2WA4A 5FZ4A 4CDUC 1IGOA 4XF9A 3MIDA 3NNGA 3QH6A 1AR81 1RJ8A 3I4IA 1DCSA 3DV8A 1JUIA 4RL7A 2EIDA 1YFYA 3IIIA 1C57A 1PK6C 4YW6A 1OH4A 2JIJA 2RJLA 2ZA9A 3NJVA 4LBMA 4FVVA 1H8TA 5FZ9A 4ZXEA 1AR82 1GSLA 1NUKA 2HJIA 2FZ1A 4TN7A 3ZYGA 1FI2A 4OHWA 2VVFA 3BU0A 4TLGA 1EP0A 3RZLA 4EYUA 1U5XA 3PVOA 4HONA 1WUVA 2PHUA 4P02B 4Q4W1 2SBAA 4FFFA 1S55A 1SFYA 1QDOA 4JDNA 4JAAA 5FLHA 5FP4A 4R4XA 2MNGA 1KD7A 5F3EA 5IVEA 4DQAA 3M8LA 2MHFA 2R073 5I93A 2VC9A 3WNNA 1PZ7A 3U11A 3FMGA 4HN0A 4FP3A 1JZ4A 3AZVA 3MUY1 4AF9A 1ZRCA 3VZKA 4LBNA 3GF6A 2JE8A 3DUIA 2HWD3 4A7ZA 1IPJA 3B3QE 4NOTA 4ARXA 1NCRB 4HSLA 4I3PA 3JBG2 2D6PA 4QX3A 4R9AA 1RMU3 3AZYA 2AUYA 5C4WC 4D6SA 1O6UA 2JWPA 4Q5OA 2ZXQA 4IEVA 2UY8A 2RMU1 4L0PA 2L9LA 1K12A 1UW8A 4QPYA 3CEWA 1G86A 1VLNA 2P1BA 4KGQA 1VIWB 3HT2A 1REDA 3J8F2 4AVBA 5K9YA 1ZRDA 1VBD3 4NRMA 3NQHA 2RMU2 4B3NA 1DGWA 1CZVA 3OD0A 4AVTA 1QXPA 3V56A 2K46A 2RS31 3H9AA 2XVKA 4N7UA 1I5PA 4DY5A 3BCWA 4Z82A 1X33A 4XQDA 1VBB1 3GBFA 2RS32 2DYCA 1EY2A 5A33A 1LEDA 3RGBA 2ET1A 4DEQA 3WUCA 1JOBA 4Y20A 1C5IA 3OG2A 2YU1A 5IK4A 2YU2A 4LHNA 5C8CA 3K4AA 1VBB2 4URTA 4QKBA 1D7PM 1OA3A 4NVPA 1H1AA 5FZHA 3LDBA 2J1AA 3ZVXA 3OYWA 5FPZA 3TOJA 2ZHLA 3O1TA 4XILA 3AXEA 3ZXFA 3LD8A 3ZN4A 1LOEA 1HDKA 3WINE 5J37A 3IBMA 1YFXA 3T4VA 3N35A 4MGQA 1GWMA 5ERLA 5BUVA 1MZEA 4QPWA 3AL6A 4K6BA 4NIDA 3O7OA 4NHLA 5AC93 3MPPG 1GOGA 5A7WB 3T2PA 1PGL2 2BGPA 3S6PA 1DGRA 3MF9A 4R9DA 5FYZA 4B1MA 4YPJA 4OHZA 5C5TA 4WBBA 5JLVA 4KL1A 5FYSA 3B94A 1XNAA 1GICA 4I0AA 2VOVA 1W2OA 3THPA 3ZFEA 5FYHA 4A45A 2QQJA 1HB4A 2XBO2 2AACA 2ES3A 5A6ZA 3VKFC 3JQXA 2BVBA 5JXHA 3ZYRA 2CAUA 2DUQA 3N9NA 4AI3A 1WZXA 4CXXA 1FOD1 1DQ5A 3ZMNA 1CIWA 1RXFA 3BI3A 4QPGB 1WBFA 2W1UA 4KGGA 4A42A 2CWMA 3I2HA 1FOD2 4EWAA 2P3KA 4M3CB 4AEKA 5A3LA 1O5UA 2B46X 4IESA 5FZOB 5HPOA 1QHDA 3LIHA 2VULA 3ORJA 4QB2A 2ZEYA 3I2JA 1FT9A 1H0BA 3LCPA 2OQ6A 4FPEA 4O61A 3AVRA 3FC0A 3POBA 3RZZA 2OUJA 3EO6A 2DTWA 4KWJA 5GZFA 5A70A 3ST7A 2YPJA 3KV5A 3NJYA 4OHXA 4KBBA 3BUCA 2LUWA 4I0BA 4IV1C 4L97A 3T1LA 4FPKA 4M3CF 4LNVA 1YFWA 4Y5TA 1NCRA 3GZAA 3OD4A 5DUXA 2XHKA 5GZDA 1NCQC 2XR4A 2RS12 5D8AA 4YG3A 1UMIA 5CAZA 4XBQA 2BERA 2RDRA 5FZKA 1UL9A 3T0DA 5FQ0B 1WCKA 2GC2A 2VOWA 4GB32 1V9U1 2CHHA 1V6MA 2WRAA 1QJX1 2Q8OA 1CESA 1GZCA 1ONAA 1UPSA 5J7MA 1GV9A 1J1TA 1PGSA 1H6YA 3G7DA 1GQHA 1WBLA 1Q43A 1V9U2 5J09A 3H0OA 3I2GA 1MQTC 2DURA 5GLVA 1GP5A 4CU6A 4RFRB 4CPBA 3H3UA 4DFSA 3AVSA 4PLNA 3I3MA 3GBWA 4KWUA 3WVJA 3KV9A 4XFHA 4Q26A 2ZS6B 2XKPA 3ETQA 2VG9A 1SBFA 4ES9A 4I09A 3WOGA 4NJ4A 2VE1A 1XSQA 1OBNA 4L8QA 5FJHA 3ZXKA 4XIOA 1H8TC 2UYBA 3B69A 1CAUB 2G9FA 4AAXA 1Y43B 2BGCA 4RQPC 2GALA 2G1MA 5BNOC 1VE0A 3BTXA 3MFCA 4JGZC 2VZQA 2QUOA 1UWWA 3PVBB 1PX3A 5A7WA 1UXZA 4A6SA 2ARXA 1W8ZA 5A7PA 1JN2P 3TB0A 1QOOA 1AR71 2QQIA 1LOAA 5CFDC 2JEMA 1MZ6A 3C8XA 1AL21 3MHZA 4JKLA 5FZ1A 4BQ4A 1AX1A 3HJRA 3NW4A 5ACA3 3D8CA 4DXSA 1GBGA 1QWRA 1AR72 1LCLA 2CWSA 4PQQA 3OEBA 2KA3A 4UXAA 1L7RA 2QVSB 1AL22 2R7EB 2VBPA 1S4CA 3VKMA 2VTXJ 3LEKA 2CYFA 4HG6B 1PM4A 4AI9A 4FPFA 3H50A 4LTAA 4KBZA 2PN5A 5IFPA 4CDWB 4HFSA 4QDQA 4RR3B 1LJ7A 4Z8BA 3LSDA 1F5FA 4QD2A 3KF5A 5JZGC 2C5DA 3SKVA 4HETA 1CR7A 1DIWA 1OLQA 2GSYA 3R6SA 4BLJA 4M3CA 3VHPA 2E26A 5FZOA 3T30A 2V4VA 3JD72 1K45A 5D1IA 4MZUA 4DB5A 1K42A 2CNAA 1H1IA 4BDVB 3MV11 2VZVA 4KG8A 3ZX7A 5FY5A 4CUAA 2O14A 1PM7A 3T0BA 5BNPB 5HV0A 3WCRA 4D8MA 1OKOA 2O8OA 4ATEA 1POV0 2C9KA 3KB5A 4GWMA 2WKKA 2DDUA 5C8CC 1GNHA 1XNKA 4HANA 1RUC2 5EJZB 3VBUB 4AQ2A 3VL9A 2VNVA 4PT6A 5JR2A 3HWJA 3OY8B 3LDKA 4MHUA 5SV8A 3SHRA 1JW6A 1QOSA 3ATGA 3HR9A 5JXJA 1UOFA 4ZY9A 1YRZA 2RR13 1DF0A 3KQ4B 5IAVA 4UBHA 4X6RB 3PU8A 1COV1 1ZRRA 3I7DA 1PGW2 1W3XA 1Y3TA 3I54A 5FQ0A 3CKHA 5LBEA 1QXJA 3BN6A 5FYYA 1R1ZA 1COV2 4ZKTB 5CFCC 1LGCA 3POSA 2VCAA 3WNLA 4CDXB 4DUWA 4FOQA 4DUXA 1WLDA 1HB3A 4XFCA 2YC4A 1DG6A 5JOZA 1RHI1 4CCEA 3O0WA 4UI9L 3AK0A 3POJA 2CDPA 4C0BA 5G04L 1UMZA 2X8KA 4ASKA 3AMPA 4OFGA 2W68A 4XACA 4META 1GYKA 1RHI2 4LULA 1PVXA 1UY2A 3E5XA 3WQ7A 4D6QA 3LEGA 3VBHA 3ZSMA 4E8CA 3H8UA 3SC7X 5GLZA 5LRSA 4X6QB 2CV6A 2WNUB 4Z1VA 1UQXA 1MEC3 5IK5A 1CX1A 2YGLA 1PIV1 2XQRA 4IEXA 1UU5A 2R061 5KXEA 1J59A 1BYHA 3EMRA 2NPIA 1J83A 1F8VA 4QPIC 1OQEA 1GZWA 2NLRA 3OCPA 4NAOA 4AR2A 1GKBA 5A3UA 4KWKA 2A70A 4GIQA 3WF4A 1PIV2 4WVVA 1CPMA 4LQRA 5HBAA 3H8OA 1C4RA 3NV4A 4Y1VA 5F3GA 4N43B 1V6OA 4JKMA 4BA6A 1RUH1 1C3HA 2HWC3 3HT1A 2JG8C 3IAPA 2O8QA 2R0HA 1ULGA 4AW7A 1JZ7A 5C6CA 1AXKA 1K5MC 4FOWA 4NWVA 2XWBB 5DZGA 5C7GA 1QJX3 2AZ5A 2YXSA 3DPRC 4NN0A 2X29A 4BCUA 3VDDC 1GU3A 4XJZA 3QCWA 3ZXJA 3W20A 1O8PA 2E63A 4AFDA 2AR6A 4CDWA 4NIGA 4QDSA 3J7LA 1BBT3 4MGIE 4RR3A 4WVMB 1YI9A 1OFSA 1LOBA 3J9SA 1APNA 3P3PA 3RFRA 3VBSB 4XQ4A 2DBIA 4F7ZA 4IDZA 3OPTA 2VXRA 4S2GA 1UN1A 1UXXX 4A44A 2EXKA 3C7EA 3UNPA 1CIYA 2FQPA 5K0UC 4JKKA 3LIGA 4E4ZA 1WW7A 3RMYA 5BNPA 3KT1A 1RL3A 5EWSA 1Q56A 2WS93 2J1TA 3MW2A 1BEV3 3K4DA 3OBTA 2ZGUA 3HQXA 3GALA 5FOBB 4FFGA 2ZEZA 2YUEA 1C8NA 2TNFA 3NAPB 4IERA 5FK7A 3T3YA 3ZM8A 4AEDB 5A32A 2RM22 5F7UA 1SQ4A 4L99A 4PHZA 3WW3A 2DU1A 2HWF2 2IVIB 4NPRA 4FAGA 3S57A 2ZGLA 3AMHA 1UZYA 4AVAA 4N7IA 5GLUA 3GZTB 5HCHA 3KZ4C 5FREA 4E4SA 4ONUA 1H30A 4LO7A 4GWJA 1OQ1A 4E4HA 1RC6A 2WIIB 3F95A 4G3YC 4PBOA 5JR7B 5JOWA 2EXJA 3M1HA 4LK6A 1NLRA 5G05L 5A1AA 1CAXB 2UURA 4K40A 4R52A 5FYVA 3ALQA 3EBRA 1RUOA 4V1PA 3WW1A 1AVBA 1N47A 1SEFA 5FPVA 1IHMA 2HWB1 3O0VA 1HIXA 1RUNA 1OXCA 1VBE1 2ZOEB 3RZKA 1GP6A 3CHXA 4FQ4A 1VJ2A 3AL5A 4DXZA 1O7FA 3WX5A 2D3SA 2LRPA 4QPGC 3NSTA 2ADEA 3DF0A 5A1FA 3KCXA 1J1LA 2WFPA 3JCIA 4OVEA 2ZHNA 4P9LA 1WGPA 1C1FA 2QDNA 4QM8A 5FR3A 2HWE3 5I8YA 2OS2A 4AVVA 1SG3A 3USUB 5LASA 2ZHKA 1ZBA1 2OIIA 2E7TA 3N9PA 4ZPIA 4YWAA 2OUHA 4CP2A 3I3QA 1OC1A 3LOBA 3KCYA 2VH9A 3POWA 3NKGA 1ZBA2 4CZSA 1VAVA 5FUIA 4BH9A 4CA9A 1ALYA 2FMDA 1W9WA 1AR63 1S2EA 1SHWB 1KJRA 3VBRB 1AX0A 1AL0G 2J42A 1QJU1 5FYCA 4QHBA 4GH4C 4EZ4A 4LR4A 1WLWA 4Q0PA 2J1EA 1AX2A 1QJU2 1KEXA
chains in the Genus database with same CATH topology
2H0VA 1FV2A 4EN8B 3AZXA 4OI0A 4WVMA 1F2NA 3V0BA 5LEKA 1QQP2 3VBSA 5C9AB 1H2KA 1CAVB 3VBOB 1DGWX 3UKTA 3U0ZA 1AYN2 5KBFA 1DQ6A 3BALA 3H7JA 1OMIA 4XIKA 3MPBA 4YGDA 4FO9A 2ZGPA 3NO8A 2PELA 2R063 4HK8A 4I02A 1D2QA 2D43A 1RUF3 2D98A 4R4ZA 5I0UA 4FPJA 5JOYA 1GANA 2DVBA 3NAPA 2R071 4AEDA 1VP6A 1MZFA 1PO13 1YJLA 2VQ0A 4E2QA 1LHWA 4AHYA 4L92A 3KQRA 3UK9A 1RUH3 2W39A 4CTEA 1U5YA 2A5ZA 1AF9A 5KWRA 2R6QA 2ZX0A 2XJVA 5FLIA 4BOWA 4ORFA 1NY71 3MDPA 1POV3 1IS4A 3D6EA 4Z2WA 2EAKA 2HWD2 3KD4A 4YZ4A 3PTYA 2WQ4A 1NOVA 4YG0A 1SCSA 2PHWA 1NY72 2DCZA 1WLCA 1RMU2 4JTOA 1VBC1 3IM0A 5FCCA 4E9KA 1UKGA 3VKOA 2WINB 3N36A 2R0FA 3WG4A 1DQ2A 1VBD2 1EYBA 2ZAAA 3ACLA 3AKRA 1YNAA 4CP1A 1A78A 3DKWA 3HBZA 3L9JT 2BEOA 2GMEA 3EHKA 4R9BA 1S0BA 5FAXA 4FOYA 4XFFA 1W2UA 5J48A 2XPJA 4OI1A 4F8AA 4FSJA 2EF6A 1OHFA 4YW5A 3D82A 1ZRFA 4P9YA 2HEWF 1O4TA 2ZBJA 5LRRA 1MR5A 2WT1A 4AFAA 5AC91 2CGNA 4E2SA 4M00A 3VBUC 5HCAA 1R091 5DDJ3 4PDWA 1UX6A 1V6IA 3Q9OA 4IV3C 3ES4A 4XBNA 3AP9A 3VBRA 5AC92 3VHNA 3AZWA 5DUWA 2GNMA 1PNGA 1J3QA 3AMQA 2JD4A 3O12A 1LHUA 2IXJA 4GULA 5GKAC 5ABJB 2HWB3 1TME3 2RJKA 3VBFC 1RB8G 2Q1MA 2NM1A 2YC0A 3H1WA 1GNZA 4G9SB 2UYAA 1CAWA 5TSWA 5L19A 4QX5A 4CDXC 4YW2A 3NV3A 5C9AA 3HN1A 1CAVA 2F4PA 3FZ3A 3VBOA 4Y20B 3ILNA 5EXOA 1CPNA 4WM8B 3H3ZA 3WNXA 3OYWB 1HRV3 3MZHA 1LKNA 4PQ9A 2OPKA 4DMIA 2WNUC 2VVDA 1O3QA 4I01A 1AJKA 4YLZA 2WC2A 4FBFA 4A7KA 4ISRA 2G9GA 4OI2A 3BOWA 2OYZA 4YM1A 2VNGA 1HV0A 3AKSA 2W0XA 4N43C 1SLAA 2BWAA 3MGUA 3ZFEB 4J1XA 3M2MA 3WDUA 2R32A 1LGNA 3MEPA 4YFZA 1DHKB 4IL7A 3NVCA 1KS4A 3WP4A 1GLHA 1H2LA 5AVPA 2BPA2 1JUHA 1CD3G 1NXD1 2AH2A 5BYNA 2JE7A 2UY9A 4RHV3 4HSJA 2VMHA 5I8TA 3AZZA 2RS51 2OA2A 3U4XA 1F5JA 2WFF3 4YVWB 1EAH3 4I3GA 1RTVA 4CDQA 2X53S 5T55A 3VHOA 1KQRA 1DFQA 4YZ2A 2DFCA 1LEMA 3ZSLA 3PMEA 2WNVC 5T50A 1SLLA 4QGNA 1XNCA 2Q0AA 2Q5TA 4MXWB 3MICA 4Q4W2 4YW4A 5JIAA 1ZZBA 1I1EA 3TNQA 3W58A 2CAVA 2YY1A 4OHVA 1ZX5A 3QOPA 4AQSA 5D8AB 1XYPA 2R30A 4Q27A 2I07B 3BODA 5H9RA 2W52A 5ACA1 3MLLA 2GAUA 1I3HA 4GMP0 5FO8B 4LLOA 1XU2A 2ZABA 2VQAA 5FBZA 1S0CA 5ACA2 4XBLA 3KT7A 1VBC3 3JZVA 2GMPA 4GXLA 5ABJA 4XTMA 1V00A 2IXHA 1UF2C 2IXKA 1CGPA 4UW3A 1B35B 3ZYJB 1N3OA 3B9CA 5FO9B 3WUDA 1ND3C 4W6YA 3RPQA 4E2GA 1LOFC 4IEUA 1IPKA 3KSCA 3JB8A 2A3WA 4WM8A 5FLJA 3RYPA 2IC1A 1QY4A 1X50A 3ASIA 4LEJA 4D94A 1OLRA 1R083 4WVZA 1LR5A 1G7YA 3ZSJA 2Z2SB 4HPKB 1DZRA 5T52A 2AENA 4JDOA 4L9BA 3SISA 4UBGA 4AE2A 2PLV3 1OPMA 4PJYA 3SCGA 4CEWA 1R093 4LHLA 3ZFFC 3MIBA 1DU3D 2LM3A 1MS0A 3VLBB 2RR11 3GHMA 2Y26A 5LK5A 3E6DA 1SBEA 1ZZ9A 4K7JA 3ZIXA 5BNNC 3G6JB 2Z42A 1KDMA 1Q8PA 1D0GA 2Q1ZB 2VMIA 2RR12 3N7MA 4K1YA 3INAA 2VVEA 4B29A 4IXLA 3WR0A 1NG0A 2O1QA 3AFKA 5KXDA 4N53B 3B00A 1V6LA 3RYKA 5SV5A 4ZU4A 4HKWA 1HXS1 3HMYA 2ENRA 4D3WA 5J96B 1EPWA 1WLTA 1G9FA 2BFUS 3FX3A 2B39A 4LBKA 1Z0HA 4DOUA 1M4WA 4JQRA 2I45A 1UU4A 4YVWA 4QGLA 1MS3A 1JYCA 2DCYA 2ZMKA 5JI9A 1MEC1 4W6WA 3IIAA 4R8HA 1YIPA 3I59B 4EWDA 3AXDA 2H6CA 1VBA1 4XTPA 4O9EA 1RIRA 1GR3A 4FAHA 1MEC2 2K9ZA 4MXWA 3O0XA 2WZPP 4A3XA 1D0HA 4YZ5A 2HWC1 4AHXA 2DV9A 4AQTA 4Q8LA 1NE4A 4GKYA 1XU1A 3MFAA 5FDBA 2D3RA 2HWC2 3UL2A 4XDQA 1QXRA 2WL1A 2B7YA 3WQ0A 1XNBA 1ASJ3 3HAGA 2EIGA 1YXWA 2UWBA 1QJX2 4Y1YA 1JH5A 1B35A 1BBT1 3RS6A 3VZJA 1O3RA 3MW4A 5GJ6A 1QH6A 2X5IC 1WA4A 3CJIA 2F6BA 2RS53 3B7MA 1PO23 3VBHB 3AP4A 3MIFA 3R4SA 4QXKA 1GQGA 3M3QA 1Z7S3 4JC1A 3U07A 2WS91 3ZFGB 1ZZCA 1GZWB 1V6JA 1BEV1 5E88A 1VAKA 1DGLA 4HPKA 5JPMB 2AYHA 4Q1PA 2VY0A 2WS92 2VOXA 4K20A 4Y1UA 1BEV2 2A7AA 3WT3A 1KRIA 1TQ5A 1RUG1 5K7PA 3B5LB 5KXBA 4HT1T 4BYYA 3FBMA 2GH2A 4IETA 4RFT0 4I0WB 1JYIA 3ME2A 3N7KA 2YHJA 1Q3EA 2YMZA 4XJ9A 2HEYF 4KNCA 4N53A 4W65A 2D6NA 4SLIA 1I5ZA 1O3SA 4JGYB 3ZXLA 1NXMA 3SMHA 4WVWA 5F6KA 4Y5Z0 4WV8A 3FJSA 4K8FA 3SNMA 1RUD1 5I0RA 2UWCA 1BZWA 1QJY1 3AX4A 2WSVA 1DQ4A 5IK7A 1KFUL 2A71A 2ZTNA 1DQ0A 2BWCA 5JOXA 1VRH1 1OA2A 1LOCA 3GZUC 4MUVA 4KH9A 4W6XA 2HWE1 3OTFA 3H7YA 3FWEA 3I59A 4KG0A 3VZNA 2JECA 2QZ3A 4FPCA 2QJVA 4YFWA 3MYXA 5A32B 2HWE2 1ZBE3 1MS9A 4WM7B 2LALA 2GNTA 1CONA 3SXWA 2HEVF 4INDA 2PHRA 3LZZA 1AR61 4XFIA 2MPFA 4EN6B 1IKPA 5E8AA 4XJUA 4Y1ZA 5GLWA 3JU9A 4N9IA 4AI0A 1AR62 1S0JA 1R1A3 4C1WA 4Q0UA 2ZGKA 1HRI3 4F3JA 3A0KA 3ZFEC 3USSA 1RUE3 4YG6A 2DUOA 3LGRA 4ZXKA 4COZA 2EXIA 3WZ1A 1G8WA 1HXS3 3AJYA 1EV11 1OA4A 2DTYA 4GMP3 2GC1A 4D7SA 3M3CA 3IDBB 2P34A 1DGRN 3WLUA 5EV7A 1XNDA 3A4UA 5FRAA 4YVSB 5GLTA 1DLLA 1UKRA 1VBA3 3ZFGA 3N4MA 1RUF1 1PZ8A 4BZ4A 3IPVA 4QQ2A 4B4QA 3OPZA 2R062 2PFWA 1YCIA 5BV6A 4IEQA 1PO11 3I8TA 4LBQB 5GZEA 1FMD3 3WP6A 4PLMA 1DYPA 1REFA 2TEPA 1N3PA 2UWAA 1I6XA 1POV1 1LTEA 1RUH2 1NCRC 3NL1A 4RS5B 2CL2A 4Q4V3 4RGAA 5D8AC 4CEYA 2I74A 2ZGMA 3AM2A 4FPHA 1LOGA 2DCTA 3AP5A 2RS13 1MS8A 1LODA 3BU7A 4JGYA 4I2OA 4QQPA 1S0DA 4KU7A 3V0BB 1D2SA 3GYDA 3MLKA 1FPN1 1NQJA 2WZR1 3KLSA 4AI8A 1UU6A 2IWGB 2E7AA 5IT6A 1H9PA 1PZ9A 2OVUA 3WY6A 4AGRA 4XFAA 4M01A 3QH7A 2A6XA 3N7LA 5J36A 4AQ6A 1KDKA 3NV1A 3QBQA 1ZZ6A 3H1YA 3TN91 5L7OB 2NQYA 4WM7A 1RUI3 3J26N 2ZGNA 1G9AA 1RUG3 2DU0A 5DDJ1 4GQ7A 2BNMA 1BXHA 1C8M3 4YW3A 2A6VA 3ES1A 1XE8A 1F9KA 1AXZA 3CLPA 5IUQA 5F5QA 3AJZA 4RGGA 3AB0A 2JJ6A 2OW4A 2E53A 3FFQA 1TME1 3OGGA 2A3XA 1ND2A 2C1FA 2DVGA 2MEV3 1YO8A 1RUD3 3WW4A 2H0BA 2HWB2 5FOJB 1LHNA 1QJY3 1TME2 2VU9A 5GZCA 4XF4A 4BPZA 1Q5OA 1VBE2 2W08A 1OOPA 1HKDA 1VALA 3IDEA 1VRH3 3NJZA 3MI8A 5HCBA 3ZSKA 3TNPB 4XE9A 4YVSA 1ZA4A 4Q0QA 4EJRA 5IK8A 1HRV1 1H4GA 3RDIA 1UD1A 4PLOA 1TEIA 4P9IA 4EROA 1HRV2 5FFOC 1NZCA 5JSOA 4LBQA 1ZZ7A 4ASLA 3WDYA 4MV2A 4Q2FA 4PDWB 4HVQA 3LB9A 3BIWE 4X8PA 3N3HA 5T54A 2YYOA 2LTNA 4MXVA 4Q4Y3 3B93A 1UPIA 4RS5A 4XHBA 2GN3A 5KHHA 1FV3A 5JI7A 2GZWA 3IN9A 5DZEA 3FE5A 1QOTA 3UJOA 2Y38A 1I9RA 1EV13 1CAWB 4AVCA 1BJQA 1V6KA 1UZZA 2DF7A 2JKBA 4COWA 1OPOA 2WNEA 4RHV1 3L2HA 1YFUA 4X8NA 5CG8A 4K21A 5EYXA 2WFF1 3IMNA 5T5JA 1MZ5A 1RUJ3 2PAKA 1EAH1 5CBLA 4CDUA 3IT8A 3VBHC 1WMFA 4A2UA 2ET7A 2WFF2 1EAH2 1SACA 1PK6A 4FCAA 4GKXA 2WT2A 5L7OA 1TE1B 3P3NA 3PLQA 1W6NA 2R072 2B45X 2BBVA 4XPVA 4XJAA 3RWNA 4QMAA 4LO4B 1ENXA 1ULFA 2IFRA 1QU0A 4LE4A 4H7MA 5EFUA 5KHGA 1CJPA 1A8DA 1N1TA 2ZMLA 3R05A 4NHKA 3RQ0A 3ZDSA 2D6OX 1SLIA 2XWJB 4AHWA 1ENRA 5C4WA 2JENA 2A6ZA 2DCJA 2XL9A 4XETA 1FPN3 1VBC2 2WZR3 2ZGTA 5CB7A 4B7KA 1FYUA 4XYXA 5DG2A 3TWIA 4CDWC 5KXCA 3KT4A 2VUAA 3WP5A 4RR3C 1IZ3A 2XB6C 4COUA 2PHLA 3VZLA 1QF3A 2XGXA 1BMV1 4Q1RA 1QKQA 1ZZ8A 1MQTB 2XH6A 1SCRA 3N7JA 3POYA 4CDQB 4FTSA 1ULCA 1C28A 3KCCA 1PVC3 4TZDA 4HZFA 1BMV2 5FMOL 1R081 5BNPC 5DUVA 2XLFA 3TN93 3VZMA 4F83A 5DUUA 3AYEA 2GNDA 3B9IA 2V73A 5KHJA 3APBA 1QNWA 2PLV1 3ZO0B 3V0AA 1SBDA 3UV9A 3DN7A 4LBQD 2ILMA 3ZMOA 2VECA 2PLV2 5BNOB 1CVNA 2K0GA 4HVRA 1R092 1SDWA 1MACA 4CYDA 2EA7A 3PJQA 4JGZB 4UW6A 5I0SA 3B01A 2XJSA 3AP7A 3O5SA 2SLIA 2ZHMA 4AI1A 5EYYA 2WLPA 5CFDB 1BCXA 1J58A 4PIXA 2CGPA 1ENQA 3SCHA 1ZVFA 3E6CC 4XHXA 1LU1A 4ZU7A 3JUUA 2B42B 1RVF3 1X8EA 4OULA 3O14A 4XXAA 4ITCA 2I2SA 3KGLA 3IKWA 4PF5A 2GC3A 1CN1A 1G9CA 4YNIA 3SH4A 2D93A 4NO4A 2Z79A 3CNAA 3LAGA 4HK9A 1YI7A 5JZGB 5T3NA 4XEZA 1D4M1 1SLTA 4U2AA 1TNRA 4CEWB 2E9QA 1AJOA 3PHMA 4Q4X3 1DQ1A 4AK3A 4FTBA 3JQWA 1CX4A 3ZXDA 1FNZA 4QU2A 4OUMA 3W9AA 4K3UA 2R043 1AR93 1X36A 2XVLA 5H9QA 1BKZA 1FATA 1CJDA 1DBNA 4IV1A 1HQNA 2V5YA 3PJYA 1VAMA 1ASJ1 4BQ1A 2WQZC 3KMHA 1NCQA 2GNBA 4AYUA 3LA7A 3RNSA 1D4VB 4QQLA 5AFBA 4WZCA 2AREA 1AHSA 5CFCB 2A75A 2HKXA 3RRDA 4QQHA 3SH3A 3AYCA 3VBSC 1PO21 5JAXA 1MQTA 3AP6A 5A3MA 4OHYA 5L36A 1QQP3 3ILRA 3C3VA 2RS52 4OI4A 2D97A 5DXDA 4DS0A 2DVAA 1WW6A 4MVTA 1Z7S1 1YIFA 3I2DA 2NZ9A 3L2YA 4Y4YA 4AFCA 4AXOA 4BWOA 1Z7S2 1M06G 3D4KA 4EWEA 4LHKA 4LLFA 1N1VA 3MIHA 3NAPC 4AEDC 4BM8A 4Y1XA 3FUOA 3UKVA 4QPIB 4RQPA 2PAEA 4HL0A 5BNOA 2D40A 4YRDA 5E89A 2VUJA 4JGZA 5GZGA 1U0AA 2E7QA 1LB2A 3NWKA 2PA7A 4XMIA 1E57A 2PAMA 2B8MA 4PIYA 2JG8B 4ES8A 1T6GC 3JBG1 1FXZA 2WA3A 5CFDA 3MF6A 1NE6A 4UW5A 1TMF3 1K5MB 1WMDA 4RA0A 2JG9B 3RI9A 3DPRB 1JBCA 2PTMA 1HQLA 2DVDA 3CJIB 3J8F1 4K1ZA 3VDDB 4BHPA 3IWZA 3WP3A 1DZTA 4M3CE 4PIZA 4Z92B 5T5PA 4Z07A 3RJ2X 4FTEA 4MSVA 1A8MA 4M0NA 4YARA 5JZGA 3ZN6B 1WW5A 1YJKA 2BYVE 2ZX4A 1OD5A 4XXPA 1GZ9A 5K0UB 1O4YA 1QJZA 1H4HA 1V6NA 1ZBE1 4TWTA 4BMEA 5C33A 1ULDA 1MVEA 4COVA 5KHKA 1PHMA 1BVP1 1ZBE2 3K51A 1YLLA 1MVQA 1DDLA 1WMEA 3ENRA 3T2TA 3URFA 1ZM1A 4GA9A 4PDWC 1G9BA 4P9XA 3E5UA 3IDCB 3PNAA 1WCSA 2R1DA 3VBRC 3LA2A 2XJUA 1PGL1 1R1A1 2GMMA 4SBVA 4MGZE 1W6OA 3WDWA 1HRI1 2JE9A 1Q8QA 1RUE1 1R1A2 4S2HA 5JPNB 2GU9A 1HRI2 2JDZA 5CFCA 4D7YA 2XBO1 1RUE2 1O3TA 4GALA 4GMP1 1HXS2 3MIGA 4DINB 5C9AC 2PHTA 3VBOC 2XUMA 5H9SA 1AYM3 1VR3A 4RSUA 3K48A 1YWKA 3LSEA 2FBEA 5T5LA 2ZPXA 1LRHA 5GALA 1XYOA 4AG4A 2WT0A 4P9GA 5JDBA 2VGDA 3FFZA 4EN9B 1D4M3 3UKNA 4AFBA 5JVVA 3M4FA 1HLCA 1Q8VA 1MS4A 1VBA2 3MW3A 4C90A 1FMD1 3LOIA 4MYEA 2JXAA 1ZNPA 1RITA 4XJWA 3M3OA 4QPIA 2YZ4A 3KS7A 3KGZA 1FMD2 1LESA 2XL7A 4XOGA 3DL3A 1IS3A 4U36A 3AYAA 4YGCA 4Q4V1 1LGBA 4KQ7A 1WD4A 4YSFA 2QDRA 4IEZA 2JG8A 4AFMA 1IKQA 2RS11 2A73B 2ZX2A 2BQPA 4Q4V2 1K5MA 4GH4B 2XJRA 2JG9A 4MH0E 4YYOA 4MGYE 2C9AA 2JX9A 4GB31 3ZYPA 3DPRA 5FMOS 2ZX3A 3VDDA 1BBT2 4FP2A 1U5IA 3WQ1A 1PNFA 4YGEA 4EN0A 5GM0A 1YYNA 4O9GA 3S0MA 3WCSA 1X8MA 3MIEA 4LA3A 1FNYA 3D5OA 4Q0SA 4BE3A 3ZN6A 1G6NA 2BUKA 3CJXA 1XRUA 4CDQC 1IOAA 3IPVB 2B5HA 2HYKA 1AR83 5J98B 5K0UA 4UW4A 1N1SA 1W6PB 1W39A 3CU7A 1RUI1 3SH5A 4TLFA 4PBPA 4A7YA 3MLJA 2BTVC 4AVSA 1U12A 4GWNA 2EAAA 4JV4A 5F1RA 2ZAHA 4Q4W3 1C8M1 1RUI2 1QH7A 1H2NA 1RUG2 5CIRA 4CEYB 3QACA 4XF1A 5LEJA 4XFGA 1C8M2 2DVFA 3JBG3 3CL1A 2QZ2A 5JCTA 1B09A 3M3IA 4AHZA 4LO6B 3OJBA 4HKLA 1LHVA 3AFGA 2MEV1 1OI6A 1AZDA 4HBNA 4HN1A 3SLIA 2ERFA 1RINA 5ABJC 1Y7BA 3J8F3 1DZQA 2ARBA 4YM3A 2RMU3 4H55A 3RYRA 3UJQA 2MEV2 3CF6E 4K9SA 5CU1A 1ULEA 3HIFA 1RUD2 4QM9A 2IFWA 1QJY2 1V70A 4YW1A 2VPVA 1KJLA 1XE7A 2YDEA 2RS33 3QLQA 4WM8C 5E16A 1VRH2 3R0RA 1WW4A 3WW2A 1BQPA 4QPGA 3RMXA 2DWRA 4Q0VA 3JD71 1VBB3 5BNQA 1BVVA 5EJ3A 5T5OA 2K2SA 4IEWA 2R1BA 5H9PA 2Y0OA 3D0SA 1J3PA 5JSRA 2XJTA 4LBLA 1RUC1 4LA2A 4OUSA 4XZPA 4C1XA 4CEWC 3RSJA 3ZPYA 5F6LB 3WDXA 1H2MA 4FPOB 2QQPA 2YGMA 4Q4Y1 2D6MA 3WHUA 5FPXA 2D3PA 2DCKA 4FPLA 2E51A 4Q8KA 1O5LA 2VW1A 4IV3B 3ZXAC 4E4DX 4H7LA 4Q4Y2 1W6MB 1OKQA 1PGW1 3M70A 1ND2B 4AGGA 1H8VA 3R4DB 4GH4A 2ZJCA 1UIJA 2ZKNA 3WHTA 2QNKA 1HV1A 2XBO3 3E97A 2NMOA 4IEPA 4OZXA 5DG1A 3OBRA 1EV12 1OOPB 1JXNA 4H14A 3VBFB 3HD8B 1IS5A 1S0FA 3NV2A 4D69A 2ZZQA 1RUJ1 4IEYA 3S7EA 3CO2A 3WG1A 1FOD3 5BY5A 1NYWA 4YVWC 5F9TA 4H3WA 1RUJ2 4ZU5A 1NA1B 1W0OA 1RUF2 2XJPA 1W6PA 2D6KA 3AMNA 5K8SA 1KS5A 3SITA 3R4UA 2BVVA 4NR1A 1UCXA 1PO12 3ZIWA 4P9WA 2XLAA 4XFBA 2P3JA 3WD5A 1TNFA 4DRVA 2YROA 3WXPA 2QE3A 1CAUA 1JHNA 1N3QA 2R49A 4NWWA 2VNOA 2NMNA 3AKPA 4YM0A 4XJ8A 1YHFA 3S7IA 2CGOA 3LWCA 2D44A 1LENA 2DFBA 2Q4SA 4GB33 4HKOA 3DGTA 3LA3A 3EJKA 2EXHA 2GN7A 4XW3A 4B8EA 1B35C 3VV1A 2A6YA 2JG9C 1V9U3 2IXCA 2BW8A 2UU8A 3WV6A 1FPN2 2DUPA 2WZR2 3PVNA 4KU8A 5BPXA 3V65A 4JVAA 1H1MA 1HW5A 2XG3A 4DRRA 3CJIC 4PCRA 2Z5WA 3U10A 4P9JA 2G4IA 4CDUB 1ENSA 3GBGA 4D7TA 2VOKA 1PVC1 4Y24A 4S2FA 1YUDA 1PK6B 1PVC2 2VNRA 4LUMA 4JRAA 1Q8SA 4JRLA 2P3IA 4MGKE 2CTVA 5CG9A 1W6NB 2D5HA 4Y22B 1LHOA 3TN92 3ROUA 1XXNA 2P2KA 4MLOA 3B02A 3KM5A 4TSVA 2WNVB 5L73A 2B9UA 3FLRA 2WLQA 1KFXL 5DDJ2 2RM21 2ATFA 1H9WA 2FMYA 4FPGA 2HWF1 3OF1A 3VBUA 2XVGA 2ZGQA 3S30A 1QGLA 3OY8A 4BLIA 4IV3A 1W6MA 5C4WB 3AKTA 3JB4C 1AR73 2OZ6A 3ECQA 4N53C 2E6VA 1AL23 2VW2A 1IQAA 2C0ZA 2GC0A 1RVF1 2A6WA 2V09A 4NHMA 4HVOA 3BPZA 3VBFA 2JICA 1RVF2 1F31A 4CDXA 1BK1A 2ZX1A 2VW0A 3VGIA 1GFF2 4C0HA 1S0GA 3FLPA 1XQNA 3TAYA 2YV8A 4FXKB 3JD73 4N90A 3ZXGA 1JTZX 1ND3B 5I0TA 5CA6A 1LECA 3D0JA 3EXUA 1NA1A 3RJRA 3WDVA 4BIOA 5JWPA 3NKTA 2OZJA 2P37A 3QD6A 4IQPA 4DZGA 3VUOA 3ILFA 2IXIA 3V0AB 3FLTA 1MS5A 3RG0A 5AFEA 4Q4X1 2XLGA 2A3YA 2R16A 2ZCWA 3AMMA 1RUC3 4LBJA 3VHRA 2QFEA 2WNUA 1VB4A 4Q4X2 3J4UH 2R041 1AR91 2ETEA 3T1MA 4ASMB 1LULA 4JCKA 1WD3A 5EZWA 3ZFFB 2O0OA 3THTA 2ZKLA 2GDFA 1J3RA 4L2NA 2R042 1AR92 3M3EA 4N43A 5BNNB 1JOJA 4LUKA 5CNAA 3ZN5A 2NYYA 4N9HA 3VKNA 1COV3 3VZOA 3C2UA 4LBOA 4Q29A 1S0EA 5JIUA 3WG2A 4Y26A 5I8SA 5BXXA 4JTNA 2PHDA 4XMAA 2RE9A 3WDTA 2WWSA 4RHV2 1QQP1 4KWLA 1RHI3 1FAYA 5FO7B 1QMJA 2BNOA 1U5ZA 2D5FA 1AYN1 2Z69A 1AUYA 2IZWA 1RGSA 4FPYA 3RI8A 4DNYA 1Q8OA 4LO5B 1NLSA 1Z78A 3ZFGC 4FXGB 4B4PA 3ZSEA 4AGVA 3FBYA 4Y22A 2PQQA 2FHRA 2WNVA 1S2KA 2TBVA 1PIV3 1QNYA 4FOVA 4DY3A 1RJ7A 4J6GA 2PHFA 2FZ2A 4P14A 5HXVA 2QCSB 2BFUL 3BB6A 3TBDA 4IV1B 3X29B 3EQEA 2KXLA 5LK7B 4I30A 4HLTA 3AYDA 1NCQB 4QQOA 4CEYC 3TYJA 4LT5A 2EVXA 2HWD1 1TMF1 1S0IA 1OFNA 1C1LA 4R9CA 4XF0A 1W6QB 2ZGRA 1RMU1 3M7AA 3PVEA 3E6BA 4JGYC 4EV0A 4CP0A 4XF3A 1TMF2 1C5HA 1XYNA 4AWDA 2H6BA 2KM2A 2RHPA 1FX5A 2TUNA 1CAXA 1PMIA 3VN4A 4M0HA 1NQDA 1O4ZA 1VBD1 2VMGA 2X5IB 5JSPA 1UAIA 1UIKA 2AGSA 2PHXA 4P5HA 1KITA 1ND3A 2XJQA 3ELNA 1LOFA 3OGJA 5HCFA 1R082 1EPZA 3WG3A 2BNNA 1SMVA 1S1AA 3GNEA 1AXYA 3FUQA 4AEJA 1H8TB 2ZMNA 1X82A 1WCDJ 4RQPB 4WM7C 4B7EA 4G4FA 1A6CA 5AVAA 4TYSA 5B2GB 2GH8A 2RM23 4JDMA 3BTAA 1URXA 2HWF3 3USUA 1MS1A 2D7FA 3W59A 5FTTC 3ZFFA 2WJSA 3E5QA 5E1RA 5DZFA 5CVRA 5BNNA 5HI0A 1DYKA 2D6LX 4EN7B 2ZACA 2EALA 2WSUA 4B4RA 4LE3A 3H1MA 1ND2C 2QKDA 3AKQA 4DPNA 1SFNA 4YM2A 1X7NA 5I91A 3ZXEA 1L3JA 4ATFA 5C8WA 1AYM1 1OSGA 2PYTA 4MX3A 4BMBA 1OOPC 4OLLA 4RD7A 4AI2A 1VBE3 1AYM2 4YGBA 4YVSC 4C91A 4S2DA 2NP0A 5CADA 4QGMA 1O91A 1SLCA 4YZ3A 1REEA 5A33B 4WZFA 4E27A 1G9DA 3TRSB 4LO8A 3VL8A 4HMZA 5C8CB 5KHIA 2ZZJA 1A3KA 1D4M2 1NA1C 3A0NA 1IS6A 5JMCA 4CRQA 1LU2A 4FT8A 3ZYIB 2CY6A 1ZYBA 2ZGOA 1W0PA 1CQ9A 1ZBA3 1S2BA 2XKOA 2Q30A 4BIFA 3PMSA 4L11A 3V64A 5KC5A 1W6OB 1OQDA 5J3UA 3FHIB 4YZ1A 2Y0IA 4RS5C 4IEOA 1VB2A 1Y9QA 1ASJ2 1ZREA 3VKLA 1QJU3 1W6QA 2P17A 3GHNA 2NN8A 2N7GA 4COYA 4XQWA 5KC6A 1KXGA 4QT6A 4FQZA 1PO22 3LKJA 1QDCA 1HQWA 1N1YA 2X5IA 2ZGSA 3ST7A 3SCFA 1HX6A 3BOPA 4J1WA 4ISQA 1AYN3 2IXLA 1SLBA 2WA4A 4CDUC 1IGOA 4XF9A 3MIDA 3QH6A 1AR81 1RJ8A 3I4IA 3DV8A 1JUIA 4RL7A 1YFYA 4AEMA 1C57A 1PK6C 2RJLA 2ZA9A 4LBMA 4FVVA 1H8TA 3ZYGA 1AR82 1GSLA