3FBMA

D431n mutant vp2 protein of infectious bursal disease virus; derived t=1 particles
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
433
structure length
428
Chain Sequence
b'TQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVANLNSPLKIAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Autoproteolytic Activity Derived from the Infectious Bursal Disease Virus Capsid Protein
pubmed doi rcsb
source organism Avian infectious bursal disease virus
molecule tags Virus
total genus 94
structure length 428
sequence length 433
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fbmA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3fbmA02
4N43B 4QPIA 4Q4W3 4RR3C 1F8VA 5ABJC 5AC91 4AEDB 5ACA3 3LOBA 4GMP1 4RHV3 1C8M1 1EV11 2XBO1 3JD72 1AR82 1AR71 1VBE1 2WWSA 1OOPC 3DPRB 4Z92B 1EAH2 1RUH1 1QJX1 2HWC1 4YVSC 5C8CB 1V9U1 1VBD3 2MEV3 5JZGB 2RMU2 3FBMA 4N43A 1TME1 4Q4Y2 1AL22 1ZBE1 1BBT1 4AEDA 4LLFA 1HRV2 2R073 1K5MC 1AR61 4GMP0 5CFDB 3DPRA 1RUI2 4JGYB 1QJY2 5C8CA 5JZGA 3VBSC 1R1A1 1RUJ1 1BEV1 4RQPC 4QPGB 1PO23 1TMF3 2HWB3 4Q4X3 2RR13 1RHI1 5FOJB 4YVWC 1C8NA 1D4M1 4Y4YA 1AR93 1AYN2 4GB33 2PLV2 3JB8A 5CFDA 4Q4W1 1AYM2 5C9AC 1R083 1VBC3 4JGYA 5ACA1 5AC92 4RS5C 3HAGA 4RHV1 2XBO2 1F2NA 1MQTB 1PIV3 4QPGA 4WM8B 1AR72 2RS53 1VBE2 1QJZA 3ZFGB 1ZBA3 4SBVA 2HWC2 1RUH2 1QJX2 5BNOB 1VBD1 2MEV1 3VBRB 1DDLA 1TME2 1ZBE2 5A33B 1CJDA 3M8LA 5C4WC 4RFT0 1ND2B 2R071 1MQTA 1RUF2 4WM8A 1PVC1 1AR62 5DDJ3 1Z7S3 3ZFGA 1R091 2WLPA 2GH8A 4CDUC 5BNOA 4RR3B 1R1A2 1NA1B 1RUJ2 1BEV2 2HWD3 1EAH1 3VBRA 4PDWC 1PO21 5A33A 1TMF1 2HWB1 2RMU1 2RR11 1RUE3 3ZFEC 1RHI2 1SMVA 1VB4A 5D8AB 1ND2A 2X5IB 2BBVA 1D4M2 1AR91 4NWVA 4GB31 4Y5Z0 1PGW1 4FTEA 1RB8G 4Q4W2 1R081 1VBC1 4GH4C 4RR3A 4Q4V3 1NA1A 5ACA2 4RHV2 1PIV1 1NCQC 2R063 2WZR3 1K5MB 2RS51 5D8AA 1RUC3 1ZBA1 2WS93 2X5IA 1RUG3 4CDXC 2HWF3 5L7OB 1VBD2 2MEV2 1PGL1 2BUKA 1H8TB 3VDDC 2PLV1 3VBFB 1AYM1 1QJU3 2R072 1HQNA 1PO13 3CJIB 4YVWB 1K5MA 1PVC2 5DDJ1 1Z7S1 4WM7C 1R092 1HXS3 1HRI1 1RMU3 5L7OA 2HWD1 1H8TA 5BNPC 1PO22 1TMF2 1NY71 2HWB2 4Q4X2 3VBFA 2RR12 1ND3B 2DF7A 1POV3 1COV3 3CJIA 4YVWA 1AR92 4GB32 3VBUB 1PGW2 1RUF1 1A6CA 4CDWC 3J8F3 1R082 1VBC2 1W39A 3ZFFB 1VBB3 1PIV2 2R061 2RS52 1ND3A 2R043 1FPN3 1RUC1 2WS91 1ZBA2 3TN93 4IV3B 1PGL2 3VBUA 2BFUS 4CEYB 1QJU1 4N53B 3ZFFA 2WFF3 1PO11 1AUYA 5DDJ2 1Z7S2 2RM23 1VBA3 3NAPC 2RS33 4N43C 1HRI2 1RMU1 4JGZB 4IV3A 2QQPA 1X36A 2HWD2 4AEDC 4CEYA 1NY72 1RUE2 5FMOS 4CDQB 1POV1 4N53A 4BCUA 4CDXB 4CEWB 2XPJA 3ZXAC 3J8F1 1B35C 3JBG3 4JGZA 1GFF2 3VBHB 1QQP3 1VRH3 1VBB1 2R062 2WZR2 5ABJB 1NCRC 4CDQA 1ASJ3 1RVF3 2R041 1FPN1 1RUC2 2WS92 1WCDJ 4Q4X1 1RUG2 5CFDC 4IV1C 4CDXA 2HWF2 1POV0 2HWE3 3VBOC 1OOPB 4CEWA 4YVSB 5BNPB 3VBHA 4QPGC 1C8M3 1EV13 1QJU2 2WFF1 1PO12 2BFUL 5ABJA 5J98B 5A32B 2RM21 2BPA2 1VBA1 1VAKA 1HXS2 1V9U3 2RS31 4FTSA 4CDWB 1RMU2 5K0UC 1CD3G 1OOPA 3JB4C 5BNNC 1BBT3 4YVSA 5BNPA 1M06G 3VBSB 1MQTC 4FTBA 4WM8C 4RQPB 1COV2 3ZFGC 5GKAC 5A32A 1MEC3 5FMOL 1OHFA 2ZZQA 3VBRC 3J8F2 4EJRA 3JBG1 4CDWA 2FZ1A 1QQP1 1VRH1 1FOD3 1VBB2 5C9AB 3VBSA 1ASJ1 4RS5B 1RVF1 2R042 1FPN2 4RQPA 3TN92 1RUE1 1OPOA 2HWE1 5CFCC 1NA1C 5C9AA 2WFF2 5D8AC 2RS13 4Q4V1 1RUD3 2X5IC 5C4WB 1BMV1 1FMD3 4RS5A 2RM22 1VBA2 2IZWA 2WZR1 3NAPA 2RS32 1B35B 1NG0A 1RUG1 4QPIC 2HWF1 1AL0G 4CDUB 5J96B 1NCRB 2VQ0A 3IDEA 4PDWB 1PVC3 2FZ2A 3JD73 1AR83 5C4WA 1R093 3ZFEB 4IV1B 1MEC1 3VBOB 5L7OC 4NWWA 1HX6A 2TBVA 3JBG2 1H8TC 1B35A 1EAH3 1HXS1 2Y26A 3VBFC 1QQP2 1VRH2 1FOD1 2RMU3 4Q4Y3 1AL23 4GH4B 4CDUA 3CJIC 1ASJ2 1NCRA 2ZAHA 1RVF2 1NCQB 4PDWA 1HRV3 1IHMA 3ZFEA 4IV1A 1COV1 2HWE2 5K0UB 3VBOA 3DPRC 3S6PA 5BNNB 5C8CC 5JZGC 1C8M2 1EV12 1RUI3 1QJY3 1E57A 1ND3C 3VDDB 2RS11 1RUD1 4GH4A 4Q4V2 1BMV2 1FMD1 1NOVA 2ZTNA 1NCQA 1V9U2 3VBUC 4WM7B 1VB2A 5K0UA 3TN91 1AYN3 2PLV3 3ZFFC 1AYM3 1BBT2 5BNNA 5LK7B 4JGYC 5AC93 4GMP3 3VDDA 2XBO3 3JD71 1AR81 1AR73 1MEC2 1VBE3 1HRI3 4IV3C 5CFCB 4CEYC 2HWC3 1RUH3 1QJX3 4WM7A 1FOD2 4Q4Y1 1AL21 1TME3 4N53C 1ZBE3 1X33A 1HRV1 1RUF3 1AR63 4JGZC 5CFCA 4QPIB 5BNOC 4FSJA 1RUI1 1QJY1 2GSYA 1R1A3 4CDQC 1RUJ3 1BEV3 2RS12 1RUD2 1FMD2 1RHI3 1ND2C 4CEWC 3NAPB 1D4M3 3VBHC 1AYN1
chains in the Genus database with same CATH superfamily
4IESA 4N43B 5FYCA 2BV4A 2W1SA 2EF6A 3WNKA 4CUAA 5JAXA 2JG8C 3NNFA 3DKQA 2PAKA 1GMMA 2E33A 1ACCA 2WT0A 3N7LA 4D0QA 3OUJA 4MHRA 2WWJA 5ABJC 3KM5A 4PCRA 1A34A 3NNGA 4RHV3 1CZVA 4XJWA 3J7MA 2XUMA 3QACA 3TBDA 1AR71 3KV4A 1VBE1 3R4DB 4R9AA 4A6SA 2QDNA 1DCSA 3DPRB 3I2GA 5EHDA 1T2XA 5JXGA 1EAH2 2B8MA 1QJX1 2HWC1 4O61A 5JZGB 3C2UA 4Q0VA 1MZEA 1UYZA 1OF4A 1OLME 1NX9A 2RMU2 3M3IA 4Q4Y2 3T3YA 4F8AA 1AL22 1WA4A 1ZBE1 3KQ4B 3VDBA 5HCHA 5KHJA 4MGYE 5DAVA 3B69A 4AEDA 1JYNA 2D6KA 1UMZA 3VHRA 5I93A 3AP9A 4E2QA 4WZFA 4A3XA 1BVP1 5JLVA 1UL9A 2VUCA 3PVNA 2ZHLA 1LU2A 4XOGA 4CU9A 5CFDB 2DWRA 3PJQA 4AVAA 4CCLA 2DBNA 1I5PA 3S0MA 4K9SA 2QQUA 4FQZA 4W6XA 4CYDA 3VBSC 3ZX7A 5L9VA 4Y26A 4OZXA 4LBNA 5A70A 4QPGB 5J37A 1NQJA 1PO23 1H9PA 1UPIA 5T50A 4AXOA 4E8CA 1CX1A 2Y8KA 3ES1A 1V6MA 4FP3A 4KBZA 4NROA 5C3SA 4CEYC 3SCFA 1PM7A 5IJRA 4AWDA 4QQOA 5A3WA 1ZREA 4QHBA 2XVKA 1D4M1 4G4FA 4GB33 4CVUA 4AQTA 5F9TA 2YFUA 4YG6A 3WHTA 5GJ6A 4HK8A 4BJ0A 1ZZ7A 4L0PA 1GWLA 1JW6A 2NYYA 4R4ZA 2VCCA 4JAAA 1VALA 2GP5A 4MH0E 5APAA 1H1IA 3RMXA 3WT3A 3ZIXA 2XBO2 4NRPA 2BOIA 1PZ8A 2D5HA 4WM8B 2RS53 3OEBA 3ZFGB 4UF0B 5FZFA 1A3KA 1AX0A 1K12A 1U5YA 4W6WA 1ZBA3 2BWCA 5FY8A 2WYFA 4F83A 5A3OA 4CP9B 3BN6A 2MEV1 5DABA 1ULPA 4JRLA 4R4XA 1H2NA 3EJKA 2W5FA 1F4AA 1H1MA 3O1RA 2DCZA 1O3TA 3E6BA 2XOMA 4P08A 4CU8A 1ND2B 4HG6B 1SCRA 2RDNA 3KHBA 2VGDA 4FFFA 4HXCA 4EN9B 5A6XA 5DAQA 1KDKA 4GIQA 3H8RA 1R091 3KCCA 5H9RA 4K8FA 5F1RA 5FK7A 1LOFC 2GH8A 2JG8B 1YXWA 4CDUC 5BNOA 2WO7A 5AVPA 1C5IA 3ELNA 2HWD3 5FZMA 1UMIA 1EAH1 2RDSA 3USUB 1ENXA 1KJRA 3OUHA 4PDWC 5FUNA 5A33A 3RRDA 1TMF1 3BIWE 3SEEA 1F5FA 2RMU1 1VRBA 5C3QA 4YLZA 1JUHA 4RSUA 3IAQA 3B02A 2QTWB 2W47A 2OA2A 2B42B 3E6DA 1C28A 1XE7A 5FZ7A 2JDAA 3GCWA 4S2GA 4Y5Z0 1PGW1 2D44A 3LD8A 1RB8G 3KV5A 3JZVA 2BU9A 4NRQA 1VBC1 2JDKA 1E5RA 3VZKA 1J3RA 1ZM1A 4WVZA 4HOOA 4DY3A 1HB3A 1RUNA 1I6XA 5ACA2 1NA1A 4KWUA 1PHMA 3IAPA 1NCQC 1QEXA 4R9CA 4KH9A 3AMPA 4PLMA 4QB2A 3U4XA 5FQ0A 1Q8OA 4J1WA 3PHMA 3WR0A 2X5IA 5JUVA 4LULA 4CDXC 1NT0A 5FZ4A 3T1LA 1VBD2 3GZAA 3CKHA 4FQ4A 4I3GA 4PJYA 5IUQA 4H55A 5L36A 3W9AA 3VDDC 4HSLA 5F3IA 3A4UA 4XJ9A 3LCPA 5LBBA 1B09A 3N7KA 1O5UA 3AKTA 2R072 1G9AA 3MIDA 2QZ2A 3OOXA 4XZPA 1LRHA 1PO13 3CJIB 1CWPA 4FO9A 3AMHA 4XURA 2ZOEB 5DDJ1 2DCKA 3BU0A 2YHJA 2GNDA 4WM7C 3WSOA 5A7WA 4YGCA 1LJ7A 5FZ3A 1MS5A 1RMU3 1JTZX 3T2PA 5L7OA 1PK6A 3A21A 1DGWX 4LKEA 4NN0A 5A3MA 5KC6A 4IE0A 2GC1A 4L2NA 1W0OA 5LEJA 1IPSA 1SQ4A 4GKXA 4YGDA 3VBFA 5T3NA 2DF7A 2Z2SB 5C7GA 2EXKA 1JHJA 1COV3 5FY9A 3PIJA 1FI2A 1CAVB 2FCVA 1R1ZA 2VZTA 4LO6B 3TEZA 1AR92 2KXLA 1W8NA 3A7QA 3VBUB 2IXIA 4WVMB 4IGOA 1SPPA 4CDWC 3WQ1A 4M01A 3NNMA 3SMHA 3B9IA 5FZ6A 5F39A 1SLLA 2VOTA 1DQ5A 4XF4A 3VKFC 1LHUA 1W39A 1W9TA 5FYTA 5FXWA 1JYWA 1PIV2 2Z69A 2R061 3KWVA 1V70A 2FMDA 3DYPA 1UD1A 2FQPA 5GALA 3RMYA 1F5JA 3H8OA 4CTEA 1RUC1 2WS91 2UYAA 3LPGA 3TN93 2RDRA 4BQ3A 4ZU7A 3KSCA 1Y9GA 1GQGA 3VKOA 3PVOA 3QH6A 1AVBA 3AMMA 3QH7A 3B5LB 4V1PA 4ET7A 1ENSA 4BIFA 5ERLA 1DQ1A 3WP4A 1QJU1 2D40A 5F6KA 5DMYA 4JHZA 3RWKX 3ZFFA 5FXVA 5FZ9A 3WLUA 1QNYA 4LBQB 2HKXA 4LHNA 4LORA 2BWAA 4EYUA 4LK6A 4HANA 4XUOA 5C5UA 2WA4A 1Z7S2 1MACA 2W0XA 4DB5A 5FWEA 4XFBA 3VDDA 2G9FA 1SFNA 4JGZB 1CAUA 3AZWA 3HT1A 4XUTA 3GCXA 1X36A 4OQ9A 4L97A 3LAGA 3W58A 1XBFA 4OUMA 2VC9A 2A6ZA 1NY72 1RUE2 5FMOS 3C7GA 2QJVA 1KD7A 2DURA 3FX3A 3NJYA 3RVHA 4BCUA 1LHWA 3I2IA 4CDXB 1EUUA 5A6QA 1BK0A 1AX2A 1TQ5A 3TEWA 4CEWB 4R9BA 1DYOA 5FKCA 3LF7A 4IL7A 4FAGA 3VBHB 1BYHA 4LITA 4NHXA 3VL8A 1D7PM 1RUOA 3PU3A 3WF0A 4MGKE 2CAUA 4W50A 4FAHA 1MZ5A 1OA2A 1QXRA 5IK8A 2E63A 1W6OA 1AXZA 1Y9QA 3AYCA 1XB9A 1XNAA 4BDVB 4Y5TA 4DPNA 4YM3A 5F37A 1YFYA 1O91A 2JE9A 3T0AA 5LY1A 3O5SA 2HWF2 3FLRA 3V0BA 1POV0 1S0DA 2CWSA 2GNMA 3G7DA 2HEVF 2Q1ZB 1GQHA 2VVFA 2OUJA 2OQ7A 4QMAA 3HQUA 4S2HA 1KRIA 3OCPA 1JMUB 3INAA 5JSRA 4PIZA 1QJEA 4Q2FA 2D3RA 5ABJA 3FN9A 2W87A 3PVEA 4A6OA 1RTVA 2RM21 3C7OA 4PLNA 3VKMA 4YM2A 2BPA2 4LO4B 5FPLA 2R7EB 3ST7A 2RS31 2ZGUA 4EWAA 5GZEA 2JE8A 4LKFA 4CDWB 4COVA 1W06A 2D5FA 1VMJA 1CD3G 3OBTA 1ZZCA 4OQ8A 3WW2A 4D8MA 3WNMA 3M7AA 4CXYA 5BNPA 3M1HA 5T55A 1MQTC 4LBQD 4JDNA 4AVCA 2P34A 3EMRA 3O1TA 3KVBA 3AMQA 5A32A 3TAYA 4HLTA 3AZXA 1DZTA 2DVDA 5HV4A 4QGMA 3VBRC 1JYTA 3J8F2 2ZXQA 4EJRA 5CG9A 5CNAA 2FZ1A 3Q9OA 5FV3A 5GLTA 1QQP1 1R64A 1VRH1 3C8XA 3WG4A 1FOD3 4AI2A 4QQHA 2AC1A 4BMEA 4JTNA 1W6NA 3VBSA 1ASJ1 4RS5B 4MZUA 4SLIA 2B46X 1QH7A 1FPN2 2GC3A 2R042 4JC1A 2XR4A 1RUE1 3RWNA 3WHUA 1NLQA 2ZAAA 3AP7A 4B7EA 4BLJA 1XSQA 4LA2A 3HWJA 3AK0A 4MV2A 1YYNA 4GQ7A 2VCAA 4YW7A 1MZFA 3IB3A 4IUGA 4HN0A 5F7UA 4IDZA 1ULOA 3NVCA 2VBDA 3WDTA 2QDRA 2WFF2 2J42A 4L92A 4Q4V1 1RUD3 5D8AC 1BMV1 4GJYA 3HN3A 5A1AA 4H14A 4FFGA 4G3YC 1VBA2 1UZVA 3ZYGA 3ZYFA 5IK4A 1O3SA 3B94A 3O7OA 5I91A 5EP9A 5IVFA 1NG0A 2QKDA 1G7YA 4AHXA 3D5OA 1ZRIA 2HWF1 5LZ6A 4RFRB 4C8DA 3VZNA 2PHLA 2W95A 5A3PA 4IEOA 4LIUA 3U07A 5CKMA 3PUAA 3IDEA 3CQOA 3LZZA 1HQLA 3QLQA 4FI9A 4I0WB 4QXHA 2JKBA 5EPAA 1C4RA 2ZHMA 5FTTC 3K75B 1R093 4Y1XA 4QX2A 3FHAA 2ZHNA 4LKDA 2ZGSA 1X9PA 3ZYBA 4P5HA 4NHKA 2VVDA 1NXMA 2TBVA 1SCSA 3JBG2 1H8TC 2RG4A 3WUDA 2Y6GA 1EAH3 3IN9A 3VGIA 3JUUA 4ISRA 3HN1A 4LBMA 2RMU3 4Q4Y3 1AL23 5BV6A 4GH4B 1LOFA 4CDUA 2A6XA 4E4DX 1RVF2 4YW2A 1UYYA 4PDWA 1UOFA 2YPDA 2VO5A 3BVCA 1IHMA 2VE1A 1LOCA 2YGMA 4BISA 4P9XA 1KFXL 2P6CA 2HEWF 4KMQA 2OW4A 4Y1YA 1DQ6A 2FDJA 4HBNA 4FBFA 4D7SA 2ZEXA 1OFNA 3GJAA 3ZDVA 4XFHA 1EV12 4AI9A 1JN2P 2TEPA 2VZSA 4TSVA 4AHYA 4EV0A 4NPRA 5J3UA 2RS11 3ZXLA 2GMEA 1W8TA 5H9PA 3N9LA 3NV2A 4BQ2A 2W08A 5JXHA 3WEZA 1VMHA 4AAPA 2CAVA 1NCQA 2Y64A 3VD3A 5EQUA 4E8DA 1GZWB 3LEIA 5IFPA 4NJ4A 3NKGA 4X6RB 1XE0A 3VZLA 3IBMA 3POFA 5BNNA 2P3KA 1H2LA 1OURA 2G9ZA 1SLCA 4HKOA 2C26A 4I02A 4DOUA 2FDHA 3H1MA 3DEMA 4LHSA 4NHYA 2XBO3 1OPMA 5K4LA 3P3PA 1AR81 1GNZA 5FUIA 4YFZA 2DTYA 1GYKA 4XETA 1MEC2 4UBGA 2A3XA 4IV3C 4M3CF 4ARXA 3HBKA 4P14A 1QDCA 3A0NA 1YFWA 2CGOA 2R1BA 4WM7A 1W6QB 5H9QA 1SLIA 3SNMA 3T0DA 3A23A 4MO3M 4N53C 2P6HA 4UWDA 1CPMA 4XTMA 5J36A 2AGSA 3KS7A 1LTEA 2YBKA 4BH9A 1JZ2A 2BZDA 3MEPA 4FPYA 3WQ0A 4KG0A 4FPFA 5F8PA 4YZ2A 4S2DA 3FHQA 2ADDA 2ZX4A 3H3UA 3OY8A 1X8EA 2WQ4A 2Z4FA 4P9YA 5FUPA 3KVAA 5DZFA 4C90A 4AVTA 4FPGA 5FYBA 3T4VA 5CFCA 3D3AA 1ULFA 2DUQA 4META 5BNOC 2GSYA 3AP5A 4IEZA 4MLOA 4CDQC 1ZZ9A 4FPOB 3WQBA 3DUIA 3HT2A 3P6BA 5FYHA 1X82A 2W91A 2R16A 4KI5M 3AZZA 1OKOA 2L9LA 3J7LA 5HBAA 2V5YA 1IOAA 4HKWA 4Z07A 2JWPA 3AX4A 2XJUA 3ZYJB 1WLWA 1RXGA 4XMIA 2DCYA 3AMNA 1OBNA 1GZ9A 3GALA 1LB2A 4QPIA 4PIXA 4TWTA 5JMCA 4OZOA 2XL9A 4K40A 5J09A 5LASA 2CYFA 4CP1A 3MFAA 4M3CA 3RFRA 4AEDB 5ACA3 4GMP1 5BY5A 3GZEA 3KF3A 1EV11 3OBZA 5KXEA 2WKKA 3QD6A 4GWMA 4KU7A 4FFIA 5FKBA 4DINB 3BPZA 2PN5A 3N9QA 3O1MA 1E5SA 4EROA 2VL4A 1RUH1 1W3XA 1VBD3 2Z79A 5CVRA 2JE7A 2PHRA 4Q8KA 4Q26A 3H0OA 4RD7A 4L8QA 2C0ZA 5JIAA 5K9YA 2AH2A 4OLLA 5CKNA 3RJ2X 3ZM8A 2R073 5CZKA 1GU3A 1S0BA 4OYUA 5EXOA 1W8HA 2QQWA 4BQ5A 2XJSA 2WZPP 2JECA 1WBFA 3S7EA 5A1LA 2Q30A 3ILFA 1HB4A 4QT6A 5HCAA 4YGEA 2VZQA 2VCBA 1PK6C 2A6WA 5BPXA 1QJY2 2MPFA 4LBLA 2Y0OA 1VJ2A 4TN7A 3QBQA 3I59A 4RQPC 3ZVXA 5FLHA 1L7RA 4UFJA 4LBKA 1HLCA 4EN0A 3ZSLA 4OHYA 2YB7A 3IMMA 3H8XA 4FXKB 1UPSA 5FPUA 1AR93 1AYN2 3E97A 5KHHA 1JUIA 4Q4W1 1AYM2 2W68A 3DYOA 1ONAA 1NUKA 2ES3A 2JG9A 3PVBB 4JGYA 5EZWA 1J84A 5FO8B 5FXXA 4HZFA 4RGGA 1KQRA 3HAGA 1Y7BA 2QQLA 4QKBA 3KGZA 1PIV3 2A75A 3KT1A 3PTYA 3WG3A 4B7KA 2ID4A 5GZCA 3IDCB 4LBOA 1AR72 1H6YA 1VBE2 4FP2A 1Q43A 4KBBA 4XJUA 3VZOA 1H6XA 4SBVA 1UF2C 3RI8A 1XNKA 3PMEA 3AVRA 2HWC2 3RI9A 1QJX2 1UY3A 3ACGA 4DRVA 5BNOB 1MS0A 3W21A 1A8DA 4ASKA 3EHKA 3C3VA 1HB2A 2W1WA 4F3JA 3WCSA 1ZBE2 4J25A 2WNOA 5A33B 3PDQA 1DU3D 1CJDA 4LNVA 4LR4A 5FPAA 1JOPA 1FT9A 4AI0A 2DV9A 5GLZA 5C4WC 1WMFA 5JOWA 2ZGPA 2OXBA 2NMNA 4RFT0 3WCRA 5LWBA 1MQTA 1QKQA 1PVC1 2ZX0A 1YI7A 1Z7S3 2IXLA 3UKVA 5FZOA 5LCWL 4LE3A 4DEQA 4P9LA 2JXAA 3EQEA 2YG0A 5FBJA 3K2OA 3OPZA 2ET1A 3VL9A 4LHLA 3WF2A 5FBZA 1NA1B 3AKSA 4CA9A 4D7TA 4PI2A 3VBRA 4CU7A 4ZU5A 1UX7A 2H6BA 4HVOA 1D0HA 3IWZA 2HWB1 3LOIA 4N7IA 2RR11 3GHMA 1C1FA 1HB1A 1RUE3 3M4FA 5FQ0B 3ZFEC 2VMGA 2ARBA 2X5IB 5F2SA 2XLFA 5FK8A 2IXJA 2OZJA 4K1ZA 2UURA 4XABA 1D4M2 5L9BA 2IFRA 3WF4A 2VQAA 4FTEA 3NNJA 3HNYM 3OGVA 3OSDA 1R081 1QDOA 2WINB 1GNHA 2P2KA 3IT8A 4QX0A 2I74A 4Q4V3 4RR3A 5C5TA 3AJZA 1CESA 5T5OA 5EYXA 1IGOA 3ETQA 4CUGA 1KXGA 3MW3A 3BTZA 1IKPA 3OYWA 1Z0HA 1FNZA 2CU5A 5D8AA 2CDOA 1BZWA 5A7WB 1OLQA 2IXCA 4KU8A 2HWF3 5A7OA 4QQ2A 4OHXA 2MEV2 5L7OB 1OXCA 1PK6B 2QQNA 2WZEA 1WLDA 2BGCA 3I54A 2VW1A 1CAXA 4HMZA 3I2FA 2Y0IA 5IATA 4FFHA 4IGPA 2VMDA 5FMBA 3VBFB 1AYM1 3B9CA 3BUCA 2E32A 1ST8A 4XF0A 5DAXA 2XLAA 2WN2A 1JYCA 3OPTA 5CAZA 2WNUC 2P3YA 5I0RA 1SHWB 1K5MA 2BEOA 5FP8A 1GOHA 3TYJA 3ZXKA 5M0TA 1IS4A 1R092 4LPLA 2ZGQA 3LE0A 1SPPB 3WXPA 4CXXA 3W5NA 4BWOA 3O0WA 1SBDA 4YRDA 5FYVA 3I2DA 3WX5A 1JZ4A 2BP6A 1H8TA 4ZXEA 3LFMA 5BNPC 3CJXA 5IVCA 1TMF2 3RZKA 1XE8A 3RZMA 3L2HA 1JH5A 1POV3 4NUBA 1W2AX 1RINA 5JOYA 3OGJA 2D93A 2ZGRA 2BGPA 3PJYA 1XPWA 1ZZ6A 1MS8A 2IVIB 3HOBA 4J6GA 2JJ6A 2RJKA 3CEWA 4YVWA 5JOXA 3BIEA 4F7ZA 2XL7A 1PNGA 4A2UA 1PGW2 3V65A 4K1YA 4AVSA 3J8F3 1U12A 1VBC2 3GDBA 1G6NA 2KD7A 2LUWA 5JPNB 1GUIA 1UIJA 1WCSA 2WSVA 3D4KA 5G04L 3ZFFB 5FY1A 3DL3A 1N1VA 4LBJA 4YW5A 3T1MA 1GZTA 1QNWA 1W0NA 1LCLA 2D6MA 3MIGA 2R043 1FPN3 1W05A 2VZ3A 1UOJA 3ZSJA 1ZA7A 1PM4A 3E5QA 5A7PA 1CAUB 3LDRA 5IYYA 3N9NA 1HV1A 1L7QA 1YWKA 2JB8A 3KB5A 2LTNA 1UXXX 4XW3A 3DGTA 1W2OA 2P5BA 4C0HA 1LOBA 1KFUL 3OG2A 4C1WA 4M0HA 3CMGA 5FXZA 3VB9A 5JSPA 1VE0A 2WFF3 3I7DA 3ITQA 4M3CE 1O6UA 5DDJ2 4KGQA 1VBA3 4AI3A 5FYZA 4ZHNA 3BTXA 4QXBA 1JZ6A 4IE5A 2PA7A 3VZMA 4IV3A 4BM8A 1IS3A 1P8JA 4UXAA 2D98A 2EXIA 1H4GA 2RJ2A 5F3CA 4IEQA 1V6IA 1G9DA 2QQMA 4V2WA 4D6SA 3LDKA 1W6OB 2ZX2A 3WUCA 1QU0A 4N53A 2E6VA 2N7GA 1SEFA 3R0RA 3SCGA 5E6HA 2ZX1A 4DUVA 4UW6A 1LKNA 4XCBA 4MXVA 3V0BB 3V64A 3U14A 1YC61 4QD2A 3VHOA 2GNTA 4OMDA 3ZXAC 3ZSEA 3JBG3 2WAAA 1GFF2 2DVGA 4HK9A 2HJIA 5FJKA 3NRUA 4HPKA 1VBB1 4IEVA 4IEPA 5ANQA 2R062 5ABJB 5JDBA 4QDQA 1VPHA 4M4RA 1ODNA 4CDQA 1RVF3 2E7AA 1H9WA 2VTXA 4XF1A 1RUC2 1ULCA 2WS92 2KM2A 4B8EA 3ZN6A 1AX1A 2VXRA 1DHKB 2K2SA 1KITA 3OGSA 4EN7B 2VM9A 4KL1A 3DXUA 2O14A 5LBCA 3RJRA 4AF9A 3SH4A 5LA0A 4TZDA 3PURA 5BNPB 1EV13 1FV3A 1GANA 1QJU2 3RS6A 1TZOA 4OI2A 2OYZA 1GLHA 5DZGA 5FY0A 3ZYRA 3VD5A 5J98B 2J1VA 1MS4A 4FVVA 4JKMA 5A32B 3ORJA 5LEKA 3H8UA 4Y33A 2QVSB 4XQWA 5FPBA 5A80A 2JIGA 3WNXA 1GBGA 2WA3A 3L9JT 1HKDA 5FCCA 1REFA 1S0CA 3FFZA 2ZS6B 5F32A 1BCXA 1N47A 1LECA 4QHZA 4IEWA 5BNNC 5FZCA 1W6NB 5JXJA 1UW8A 3VBSB 1M06G 2VUDA 3KF5A 1BXHA 3VKNA 4OI4A 4BQYA 4FTBA 3D6EA 3I2HA 1BK1A 2BNOA 3GZTB 4BU2A 1XSRA 5GKAC 1N1SA 1MEC3 2WO2A 4DFSA 3RZGA 5FMOL 2K0GA 1AXYA 1OHFA 2J1UA 5F5IA 1CIYA 5IFTA 1OT5A 1O5LA 1DIWA 2WJSA 5IAVA 4AQSA 1OVSA 3MFCA 4NRMA 2HEYF 3ZXJA 2ZMKA 1QIQA 4Q0SA 4FOVA 4AI8A 1SBEA 3MO4A 5E8AA 1F4HA 1RGSA 4RQPA 4YZ5A 4ZZ8A 1SDDB 4OHVA 3WF3A 2NZ9A 3PL0A 4DXRA 3ZIWA 3HEIA 3K51A 2HWE1 3R4SA 5DAPA 2VQUA 5CFCC 2PELA 1S2BA 5FDBA 5IT6A 4Y3OA 4QXCA 5KWRA 2EAAA 1S0FA 1XQNA 2XG3A 3OJBA 3P5BA 2E51A 4BHPA 4Z82A 1MVQA 2YFZA 4KGGA 4ZU4A 5DG2A 2IWGB 4KWKA 4BK4A 1W9YA 2TUNA 3A0KA 4I3PA 1TNFA 3NKTA 4IEXA 2RM22 4XBQA 5KHGA 2BGOA 2E7QA 2IZWA 3E5XA 5FZHA 3SKVA 3NAPA 4XMAA 2RS32 3NV1A 4YSFA 4YW4A 3N9MA 3POYA 1YQ6A 5KC5A 1CJPA 2DUOA 2XDVA 3GNEA 5KXDA 1CAWA 4MHUA 4P9JA 5FLIA 1UYPA 4QPIC 4YM1A 4ASLA 4CDUB 1UWWA 4DQAA 4IETA 4LXLA 2VD7A 4PDWB 5F5CA 1PVC3 3AXDA 2WSUA 2Q1MA 3AKRA 4R52A 5C4WA 3ABZA 3I2OA 3IDBB 2R49A 2AUYA 2ILMA 2PHFA 3VHNA 3GBFA 3VV1A 4NWWA 3WVJA 4XUPA 1D2SA 1JI6A 2YXSA 2Q1FA 4XUNA 1Q56A 3MDPA 1EYBA 3M3OA 3HVDA 1QQP2 1VRH2 5KXCA 4E2GA 2ZEYA 3POEA 2QQIA 3D8CA 1LNSA 3UJQA 1ASJ2 2WC2A 2YV8A 2ZAHA 2JDZA 1DBNA 2VW0A 2X29A 1NCQB 2XUEA 4LJHA 5F3GA 4WBBA 2NQYA 3ILRA 3ZFEA 4IV1A 2VVEA 3CNAA 3UKTA 3UYJA 3SISA 3VBOA 4MGTA 3S6PA 1S2KA 3MPBA 5LRRA 5BNNB 4Z1VA 2P37A 1IQAA 1NZCA 1C8M2 3FUOA 3DECA 1OKQA 1QJY3 2XJVA 3ON7A 5CYYA 1BLZA 1ND3C 3VDDB 5LA1A 3FZ3A 4Q4V2 4QPYA 4UW3A 4YWAA 1BMV2 1FMD1 4OHZA 2JICA 4NPLA 2C9AA 3LB9A 4P00B 1V9U2 4CU6A 3OGRA 4C1XA 1OC1A 4LMFA 1PMHX 3I2JA 4D69A 1JHNA 1DQ4A 2WIIB 4XDOA 4KQ7A 4WM7B 5K0UA 1F31A 2XMLA 3SXWA 3T30A 1AYN3 3MBWA 3VUOA 1AYM3 2JG9C 3O12A 3U37A 1Q8SA 4JGYC 1U5IA 3SHRA 2WBKA 4ISQA 4OUSA 3MIBA 1WGPA 3UJOA 4NHMA 5KR7A 1YQCA 1I9RA 2B5HA 3OY8B 5JIUA 2VOVA 3JD71 4OULA 3E1F1 5CKQA 4RN5A 3ZSKA 5A3UA 5C33A 1AR73 2GALA 1VBE3 3K4ZA 2WQZC 4GALA 5C8WA 2XQRA 4UOJA 2WNUA 2DTWA 2C24A 4DIQA 5CFCB 3CLPA 2LROA 3I3BA 5D1IA 3MPPG 4LK7A 5CIRA 2HWC3 1UZYA 1QJX3 3AFKA 3OPWA 5E88A 1AJOA 1IQDC 3WNNA 4LTAA 4YNIA 2ORXA 3ROUA 5K8SA 2XH6A 2LM3A 4K20A 1OSGA 4O65A 1UX6A 1RXFA 1ZBE3 2UY8A 4MVTA 1I3HA 1W6PA 1S0GA 2W3JA 3GHNA 4CXWA 1ZZ8A 4FOWA 4NO4A 2I45A 4XJAA 1LOGA 5CBLA 4ZS3A 1HRV1 4BXSV 5HPOA 4PHZA 4XDPA 2Q8OA 4QX3A 5HI0A 2WNVC 5I0TA 1WMDA 4QPIB 4CP0A 5J1XA 4AZZA 1XU2A 1RUI1 5F5QA 5FYUA 4LEJA 1OQ1A 2Q5TA 4Q27A 4M3CB 2VTXJ 3SITA 3WNOA 4BA6A 2RS12 1EPWA 4NPMA 4XFCA 4ZY9A 5T5PA 4QX1A 2D97A 2GAUA 2RE9A 3I4IA 1S1AA 3USSA 1TG7A 3MIFA 1RIRA 3HR9A 2J1RA 1C57A 4IGQA 5FWJA 1D4M3 1RC6A 5FMCA 3HQRA 5IK5A 5FPXA 2V4VA 1QJFA 3M70A 1FX5A 4Q29A 3T0BA 3LWCA 4RR3C 1J58A 5IHRA 2V4AA 5LA2A 3PUIA 1ZYBA 4EWDA 2JD4A 2EALA 2FCUA 3MICA 3TOJA 1SLBA 5AC91 3LOBA 1C8M1 1DQ2A 4HL0A 2QNKA 1V6LA 1AR82 3RSJA 3WW1A 3WD5A 5ISLA 1RJ8A 5E16A 3O0XA 4DZGA 1FAYA 4XC9A 2Y6HA 4XE9A 1OOPC 3RPQA 2WUHA 2DBIA 3DXTA 4YVSC 2D7FA 5FZEA 1V9U1 1WW7A 2AACA 2MEV3 2VECA 3GBWA 4OHWA 4CCDA 2JDYA 2ZGTA 4DXSA 4AFBA 1TME1 3I59B 5I0SA 3B01A 1LEDA 3LIHA 4QDRA 1HN0A 2XXZA 2WRAA 2CL2A 2VMIA 2Y6FA 5CG8A 1KS4A 1YJLA 2XKOA 4JKKA 4ATEA 4CPBA 2WR9A 3BU7A 1JYVA 1K5MC 3H7JA 1AR61 5EFUA 1PNFA 3R4UA 3I3DA 4GMP0 1VMFA 2VY0A 4DNYA 1LENA 5EIYB 4HFSA 2Y38A 2JG9B 4JGYB 5C8CA 1R1A1 3ZXGA 3VD4A 4IE7A 1RUJ1 1BEV1 1F9KA 2WO1A 3T09A 1YQ2A 1DF0A 2C5DA 4QKNA 4TTGA 1TMF3 5LY2A 3PTRB 1RHI1 3A22A 1X9TA 2EVXA 3GXUA 4YVWC 1C8NA 2ERFA 5IW0A 4DXZA 1C5HA 1NLRA 1CVNA 2YC2A 1MR5A 3ETPA 3FWEA 2PLV2 1G9FA 2R0FA 3M3CA 1IPKA 3B00A 1IPJA 2V09A 3X29B 5C9AC 4DUXA 1VBC3 1JS9A 3UNPA 4AGVA 4B1LA 4E4ZA 1JYXA 4RHV1 5IAXA 1F2NA 1MQTB 1QY4A 3C7EA 1SLTA 1UU5A 3K46A 4D3WA 1IKQA 1QJZA 5FZOB 5FPZA 4QGLA 1W9WA 4QXKA 1AJKA 1RUH2 3MGUA 2DYCA 4EQVA 2D6NA 5IK7A 5FLJA 5FP7A 4E2SA 3VBRB 1DDLA 5FY7A 2RJLA 2R1DA 4HSJA 1H30A 4B4PA 3H1WA 3OB8A 3ECQA 3M8LA 2D6OX 2V5DA 1XU1A 2CY6A 4XIKA 5JR7B 2VNRA 1XNDA 3LSEA 4Y4RA 2Q8DA 3TRSB 3E6CC 1LHOA 4XILA 1RUF2 1W90A 5JMOA 4V2VA 2ZEWA 5DDJ3 1ZRDA 3ZXFA 1CX4A 1RJ7A 3L2YA 4JRAA 4XVHA 3FC0A 1FXZA 2Y6KA 1DYPA 1EY2A 3B3QE 4RR3B 4CCCA 1Q5OA 1UY4A 4LUKA 2RDQA 4Q0UA 3DN7A 1YJKA 1OI6A 4Y22A 2PAMA 1PO21 1URXA 2UWAA 4CSWA 4UFLA 4XXPA 4LT5A 1UYXA 3OYWB 3OBAA 3H3ZA 1SMVA 5DUXA 1LOEA 1VB4A 4XJZA 5D8AB 5FZKA 2BBVA 2JENA 5FO9B 4AFDA 2FDKA 2QQVA 4B4RA 4AAXA 4NWVA 4GB31 4OCTA 2YUEA 1CAXB 3MW4A 4Q4W2 2BVVA 3Q8FA 3KMHA 4XZUG 3WDWA 1WCUA 2F17A 3IMNA 4IERA 1YFUA 1NZIA 2OS2A 4U36A 1U0AA 1X7NA 3TB0A 3O1VA 5A3NA 2R063 3GZUC 5DZEA 4DY5A 1K5MB 1OLMA 1XC6A 1O7FA 2RS51 4PT6A 3RGBA 4N8MA 1RUC3 1ZBA1 2WS93 3MUZ1 4YGBA 3IKWA 1SZBA 4UW4A 5A7NA 3ZN5A 1OVPA 2RHPA 1GOGA 1PGL1 4QX5A 2BUKA 3ZMOA 1H8TB 3W20A 2ZGKA 2WNEA 4Y1VA 4O7XA 1LOAA 2AYHA 2PLV1 3MLKA 4CUCA 2VXJA 1QJU3 3E5UA 1W9FA 3LGRA 1E5IA 1DFQA 4ITCA 5FPVA 3MZHA 4EE2A 4DUWA 2V73A 1HQNA 2XJRA 4YVWB 1PVC2 2PTMA 3BTYA 3LEMA 4PBPA 2C9KA 1K42A 3ES4A 4ONUA 4UFKA 2B9UA 1HRI1 2VQTA 4PLOA 4INDA 2HWD1 2XHNA 2B7YA 4GA9A 4Q8LA 2P17A 3AP6A 2OX0A 5FZ0A 4A4AA 2GNBA 1US2A 3D82A 2HWB2 4N7UA 4Q4X2 3WNLA 2RR12 3ZSMA 4WV8A 5CEHA 4G9SB 1J1LA 5K7PA 4KG8A 1SBFA 4H2AA 3F95A 4YZ1A 1W3VA 1W2UA 2GU9A 1ZNPA 2PMWB 2VULA 1RUF1 1REDA 2GC0A 4QU1A 5IVBA 1R082 4XFAA 4COYA 1BKZA 4XF3A 2JIJA 2PHDA 2YY1A 2I07B 3H9AA 4YW6A 2PXJA 2KA3A 1WMXA 1HIXA 1SDWA 4A7ZA 4JQRA 1UAIA 4Y1ZA 2FHRA 3H1YA 3RG0A 5JSOA 1ND3A 1YFXA 4Z2WA 1V6JA 3THDA 1STMA 3WP5A 1SFPA 2BRTA 4QPWA 1L7LA 1XJAA 2J1SA 4NIAA 1F8VA 3U10A 5C70A 4YM0A 5JI7A 4AFCA 4IV3B 5ANNA 4BQWA 3J9SA 3MLJA 4O9GA 5B4NA 2B4KA 4W65A 1OH4A 1OA3A 1UO9A 2BFUS 3B93A 4GXLA 2YBSA 2ZJCA 3LIGA 1XNBA 2QQJA 1BVVA 1UZWA 4PQQA 4CCEA 3ACHA 1NKGA 2ZCWA 2ZKLA 4BXFA 4N53B 4LHKA 3V0AA 1IS5A 1AUYA 1PO11 2D43A 3T08A 1J59A 2GMMA 3WZ1A 2RM23 2BYVE 1J1TA 3NAPC 1JZ3A 1MS9A 2BQPA 2D6LX 3NJXA 2HYKA 2ZGLA 2RS33 3B7MA 3Q8EA 4N43C 3J4UH 1RMU1 3S5QA 3RZJA 2F4LA 2CNAA 5A7QA 2F6BA 3POWA 1WCQA 4HPKB 3T4HB 3ZXDA 4FPEA 4CCJA 4EZ4A 4X8PA 4CEYA 4ORFA 3Q8CA 4XQDA 2EIGA 2VMEA 5FP4A 2FCTA 2OKXA 4CDQB 3FFQA 5JCTA 2DVAA 1Y3TA 2WZ8A 2Z5WA 3AKQA 3RYPA 4XIOA 2P1BA 2BERA 4Q0QA 5DQ0A 3ZN6B 1TVGA 1UCXA 3UL2A 4QGNA 3N7JA 1F35A 1UOGA 1GNYA 4Y24A 1UKGA 2XPJA 4TYSA 4BQ4A 2WYSA 5H9SA 1DG6A 1DP0A 3TEYA 2WNVA 3JU9A 1G86A 1UN1A 3AJYA 1QQP3 1QHDA 1VRH3 2WLQA 5FREA 2D3SA 3KV6A 3AVSA 3AKPA 1J3QA 3I49A 2WZR2 5JWPA 2ZX3A 5FR3A 1ASJ3 3MF6A 2ZMLA 1PMIA 4AI1A 1UMHA 1APNA 4GKYA 3UT0A 4Q4X1 1WCDJ 4Y1UA 1RUG2 2EXHA 1HW5A 4IE4A 5G05L 3TNQA 4IV1C 4A44A 5A3TA 5CFDC 4XXAA 4LIVA 3VBOC 4H7LA 1PX4A 2MHFA 5A3LA 1IZ3A 4AFMA 5JR2A 1A8MA 2WO3A 4AOCA 2PHUA 4QPGC 1C8M3 5FY4A 1LGNA 1Y4WA 2IXKA 2HLEA 5FOBB 3AL5A 5L9RA 4XQ4A 4L11A 2EXJA 5FJHA 1CR7A 1CONA 4URTA 4AEMA 4AVBA 4DMIA 3GJBA 1WA6X 3OTFA 4BZ4A 2YC0A 4XYXA 1VAKA 5DN2A 3OUIA 2OPWA 2VBPA 1HXS2 3GM8A 4AQ6A 1V9U3 4XFGA 2A73B 4FTSA 4K6BA 3SCHA 5K0UC 2ZGOA 1UNBA 4MSVA 2Q8EA 1H2MA 2Z42A 3H42B 5FP9A 4ES9A 1OOPA 2V72A 3JB4C 4GWIA 4YVSA 1CGPA 5L19A 1FYUA 2VZOA 2XLGA 2Y6JA 3CO2A 4WM8C 4M00A 1DLLA 4RQPB 4AYUA 5C6CA 2WL1A 3ZFGC 3J7HA 3M3EA 2NN8A 2J7MA 2X09A 1L3JA 5HCBA 1M4WA 1J3PA 5C71A 3MV11 4Y20A 4H3WA 5LB6A 4K21A 2FDGA 1W6QA 4MGSA 4PBOA 3TEXA 4JTOA 3U1XA 1XXNA 1OLRA 3J7NA 4PI0A 1REEA 4QM9A 1WZXA 3KT4A 3O1OA 2WABA 4CCMA 4JDOA 1VBB2 4LO5B 4D94A 2H0VA 4Q5OA 4NR1A 2UWCA 1PX3A 3MLLA 1D4VB 3AXEA 2GC2A 5JPMB 1ULGA 2E9QA 2JDNA 3K4DA 4ES8A 3IPVA 1W8WA 1YEWA 2JB4A 1OPOA 1OD5A 2XWBB 1CAWB 2VTFA 1LAJA 1GQPA 3WP6A 3K3OA 1WLCA 2QQKA 3I97A 1JBCA 2VZVA 1DGRA 3SEPA 3U75A 3AFGA 1UZ0A 5C9AA 3P3NA 4AG4A 3ZLIA 2RS13 4XFIA 2R30A 3LA2A 5C4WB 3CZJA 3J26N 4WVWA 4XFFA 4CRQA 2LS6A 4DXTA 2NMOA 2WZR1 2XHKA 3DCQA 4COUA 3K3NA 3BALA 4UAPA 4ZPIA 1N3OA 2DDUA 2UYBA 4UW5A 3WV6A 3POBA 1RUG1 5FZAA 3THCA 5DUUA 2EIEA 3EBRA 2CHHA 2RV9A 1YQ8A 3OF1A 3URFA 1AL0G 1W8OA 2W46A 4LLOA 3PIGA 1OH3A 1IS6A 1G9BA 2TNFA 2VQ0A 4TXWA 5EJ3A 2FBEA 4PF5A 4MXWA 2FZ2A 1AR83 3ZFEB 1GWKA 4IV1B 4HONA 1W04A 4LOTA 1H8VA 4DRRA 1NE4A 2EICA 3FE5A 3VBOB 1G9CA 1W8FA 1WD3A 2OIIA 4XAEA 1DYKA 1YI9A 1JZ8A 1B35A 1HXS1 4JZRA 1FOD1 2H6CA 3ZPYA 1YLLA 3S30A 5GLWA 4Z2AA 2YU2A 4GZ9A 3BGAA 3ZR6A 3CJIC 1NCRA 3KCYA 2W2IA 3O0VA 2B39A 4NIGA 3WDYA 1N3QA 4W6YA 2XWJB 1OA4A 3LFIA 3T2TA 3H7YA 4HVRA 4CUBA 4N9HA 3FLTA 3R05A 2HWE2 5K0UB 1LEMA 3MF9A 3UESA 1LODA 1UIKA 1DGRN 4AFAA 5C8CC 2G1MA 3S57A 4A41A 1C1LA 1E57A 4MUVA 3RYKA 4QQLA 4OUEA 5EYYA 2BNNA 1AZDA 3FUQA 4UYBA 1RUD1 1BHGA 5C3OA 3MYXA 1UXZA 1WLTA 2VOXA 5J7MA 3NV4A 1NOVA 2ZTNA 5FZ8A 3WG1A 2WNUB 3OD0A 2P4EA 1K5JA 2DVBA 2VOKA 3VBUC 2X05A 3NNLA 3JQWA 4AGGA 5IVVA 1NQDA 2VMHA 3FJSA 1AF9A 2PYTA 4JKLA 4QWNA 2EA7A 2A5ZA 2AREA 5T5JA 2P3IA 2PLV3 1GSLA 2ZGMA 3H50A 1BBT2 5LK7B 2E26A 4P9GA 3HJRA 1W6PB 1W6MA 2W52A 1W03A 2JEMA 1O8SA 2I2SA 2IXHA 4N90A 1QF3A 4D7YA 2VNVA 4GMP3 5LRSA 1UKRA 4JVAA 5GZGA 3VZJA 2QE3A 1NXD1 5FP3A 3RDIA 4YG0A 1OFSA 2F4PA 2NP0A 1HRI3 1HV0A 3CU7A 1WW6A 3EO6A 3THTA 1NE6A 4UFMA 1JZ5A 4OFGA 4QAWA 2EIDA 3AYAA 3RZLA 1RUH3 4PF1A 5JI9A 4FPHA 3CHXA 2DFBA 4WVVA 2ETEA 4HN1A 5D2AA 3U11A 4Q4Y1 5EWSA 1AL21 1W28A 3N35A 2ZZJA 4D6QA 4ZS2A 2GMPA 1X33A 4QX7A 3BPSA 2VZUA 4OI1A 4ASMB 3UV9A 2B9VA 1UY2A 3MIHA 4UT5A 3GGLA 1LHVA 2G19A 4NOTA 3WDXA 2R32A 1IG0A 1RUF3 3I3EA 3LKJA 4JGZC 2YBPA 1O8PA 5BXXA 2XQXA 5LBEA 3U0ZA 2WN3A 3KD4A 5T52A 1LGBA 2HYXA 5TSWA 5AFEA 2EAKA 1D2QA 4YW1A 3N9PA 4XPVA 1EP0A 4IE6A 1VAVA 1RL3A 4QB6A 4A3ZA 4XTPA 2VPVA 1PZ7A 2JD9A 3KHCA 1FMD2 1NLSA 3HNBM 4AHWA 4BIOA 1UU4A 4R8HA 2AEZA 3BB6A 3U4SA 4CEWC 2VOWA 2PHXA 3G6JB 1GP5A 3P1IA 4MYEA 2HH9A 3GF6A 4N9IA 3VBHC 2YDEA 3ACFA 4Q4W3 2A6YA 1K3IA 3IIIA 3KGLA 2Q0AA 3SLIA 2UY9A 2XGXA 3AC0A 1UQXA 2XBO1 2DU1A 5E89A 3Q8BA 3JD72 2YGLA 3NW4A 5HCFA 2OT7A 4E4HA 3KCXA 4XCAA 5T5LA 3O1UA 2K46A 4FCAA 1CZSA 1HDKA 4ZONA 5FYMA 3MV01 4FPKA 1IG3A 2WWSA 4Z92B 2LRPA 5FYIA 4PQ9A 5C8CB 4UFIA 2ZKNA 4ATFA 4GULA 3FBMA 4N43A 2YZ4A 4I2OA 2J1TA 1XYOA 2CGNA 4XHBA 1BBT1 4AQ2A 4AGRA 5KHKA 4LLFA 4CZSA 1HRV2 4JQTA 2JDHA 4BB3A 4YARA 1XYNA 3ME2A 4GJZA 3LSDA 3SKJE 5HV0A 3KT7A 3CF6E 3W59A 5LA9A 3WY6A 1CPNA 3DPRA 2HBUA 2PHWA 1JOJA 3PUSA 1XRUA 1RUI2 4P5YA 1DZRA 1H2KA 5JZGA 2VZRA 2DCTA 2O1QA 2QFEA 3NJVA 3PUHA 3N4MA 4AR2A 3NL1A 1W0PA 4QDSA 3DKWA 2IFWA 4YPJA 1JU4A 2HWB3 1ZVFA 4Q4X3 4CCOA 2RR13 4YZ3A 1QOTA 1YIPA 4Q1PA 2UWBA 4YYOA 3C7FA 1ULDA 5FOJB 1VLNA 5KBFA 2XONA 3WQ7A 1F15A 4XDQA 2PFWA 4Y4YA 2OQ6A 3V56A 3JB8A 1HJGA 1Q8VA 4RA0A 5CFDA 4U2AA 1KJLA 3HNMA 1R083 1RYYA 1YNAA 2WQ8A 4K3UA 1ODMA 2SBAA 4YG3A 5ACA1 5AC92 1S55A 4RS5C 5FZBA 4QPGA 3UETA 2IUWA 2X8KA 4A7KA 2J1EA 2WT2A 2DU0A 4AK3A 1YRZA 4E9KA 3I2KA 5FYSA 1GICA 3VN4A 4E27A 2NPIA 1VBD1 3POSA 2KR2A 1TME2 4Y22B 4I30A 3N36A 4CPBD 3DF0A 2WFPA 3I8TA 1W99A 4B3NA 4COWA 1XOYA 2QQOA 1ENQA 2R071 1DGWA 1LESA 1U5ZA 2ORZA 3UKNA 3PNAA 3ZKUA 3ZR5A 4WM8A 1X50A 1W9SA 2O8OA 1AR62 3ZFGA 1TEIA 4UF0A 4P9IA 5EV7A 3HD8B 1EPZA 3IZOA 3KZ4C 1A78A 1BJQA 2WLPA 3BYWA 4LE4A 5DAWA 1KDMA 4W8JA 5IVJA 4CP9A 1I1EA 1R1A2 5FYYA 2OZ6A 5A1FA 2ZPXA 1RUJ2 1BEV2 3BOWA 2ATFA 5LW9A 2VZPA 4B4QA 5F6LB 3K4AA 3FHIB 1N1YA 3LEGA 2VUAA 3OEAA 1OD3A 1RHI2 3M2MA 3WDVA 1ZA4A 2O8QA 2PQQA 2W92A 1ND2A 2OVUA 3SH5A 4A42A 3MW2A 4WZCA 4AEKA 4Z8BA 4KWLA 1WUVA 4FOQA 4K8RB 1Z78A 1AR91 1C3HA 2G9GA 4GAZA 4AVVA 3JCIA 3EYPA 1OF3A 4LO7A 4E4SA 4BK5A 1BQPA 1NAEA 3CZUA 1QH6A 1YQ5A 4GH4C 2JG8A 4HT1T 5F2WA 2C1FA 2ZHKA 1QOSA 1LU1A 3AM2A 3F2ZA 4IQPA 4O9EA 3RZZA 3BODA 4RHV2 3USUA 5BNQA 5CA6A 1PIV1 2BBAA 4LKSA 3AP4A 4FT8A 2WZR3 2VCMA 4EZHA 2VMFA 3JQXA 3LA7A 2MNGA 1D0GA 3FBYA 4NMIA 4BLIA 1RUG3 2VMCA 2WDBA 3TWIA 4AHZA 3C7HA 4IXLA 1S4CA 4MGIE 1Q3EA 3PUQA 1UY0A 4LQRA 1MZ6A 3K48A 2GP3A 4EN6B 5DXDA 1H1AA 1OQEA 2XJQA 3MHZA 1SFYA 1VR3A 1VAMA 3MI8A 1T6GC 4J1XA 4ZZ5A 1SACA 4DO0A 1H0BA 3AB0A 4GD4A 4HVQA 1XNCA 5I8TA 1Z7S1 2DVFA 2VH9A 3AYDA 2Q8CA 1FNYA 2YPJA 1O3RA 4RL7A 1HXS3 5A6YA 2A71A 1G8WA 4UFHA 2AENA 1WD4A 1WBLA 3WG2A 3FMGA 2XKPA 1MS3A 3ZN4A 2W39A 5DG1A 1SG3A 3PMSA 1K45A 2Y60A 2BNMA 4GWNA 2LALA 5JVVA 1PO22 3BI3A 2BDRA 1NY71 1YUDA 2VBBA 4YW3A 3LA3A 1ND3B 5FZGA 3FLPA 1V00A 4RGAA 2X10A 3POGA 5DPNA 1HQWA 3LDBA 3CJIA 5F5AA 5FZDA 2NLRA 4BE3A 1S2EA 5HXMA 3BTAA 5LATA 4GB32 4CP2A 1UZZA 1A6CA 4QKFA 5F3EA 2CSGA 2P3JA 4XF9A 4FOYA 2GDFA 2FMYA 4MG2A 1QWRA 2DFCA 3UGHA 2R6QA 3V0AB 1VBB3 3SH3A 2C4XA 3Q8AA 4HETA 4XHXA 1PVXA 4C91A 1GOFA 4KWJA 1ZRFA 5FAXA 2RS52 2YMZA 4XJ8A 1ZBA2 3WW3A 1CAVA 2O0OA 3I3MA 4ARYA 2VNGA 4ZXKA 1GWMA 4AW7A 3NWKA 2YC4A 1CN1A 1QGLA 1TE1B 1T6BX 2JDPA 4OMCA 3VBUA 4WVMA 1PGL2 5DUWA 4QB1A 4QKDA 1XYPA 5FY5A 4CEYB 3ZXEA 1JODA 2C6SA 1QMJA 2ZA9A 5GM0A 2VZ1A 5LBFA 1US3A 3AYEA 2W9XA 1Y9MA 1JZ7A 1LGCA 4W4ZA 5AVAA 4OVEA 1UY1A 5C3PA 1HRI2 3UGFA 5FMDA 2XB6C 3O1PA 5I0UA 2QQPA 2WNVB 3IIAA 3ACLA 4IEYA 2HWD2 4XBLA 4XBNA 4AEDC 1DGLA 4H7MA 2YROA 3BCWA 4BOWA 4XAAA 1POQA 1POV1 5C3RA 5JXIA 1CQ9A 1PGSA 1GP4A 4CE8A 4LBQA 4HKLA 2RVAA 3ZMNA 3RYRA 4BPZA 3JXSA 3WNPA 4TLFA 5GZDA 1FATA 1WKYA 4QM8A 3HPNA 1JOBA 5IVYA 3VKLA 3J8F1 1B35C 3N3HA 4JGZA 1AHSA 5B2GB 3O1SA 2VJXA 5JOZA 4MGQA 3VD9A 5CISA 1CIWA 4QQPA 2ADEA 2VW2A 3BOPA 3T2OA 2VNOA 3GYDA 1S0EA 3HMYA 3ZYHA 2WWUA 3W5MA 1NCRC 3SC7X 3N9OA 4LA3A 4JV4A 4EWEA 3POJA 4NAOA 4I09A 1E5HA 1FPN1 2R041 2W94A 5BYNA 1AXKA 2GN7A 4CDXA 3HQXA 2QCSB 2PAEA 1GKBA 2YYOA 2HWE3 1YCIA 3ALQA 5FRAA 4IW3A 5AFBA 1OOPB 4CEWA 4LUMA 4RGKA 4NIIA 3UK9A 2WT1A 3OD4A 4YVSB 2IC1A 3LEKA 4C0BA 3VBHA 4I0AA 2B45X 2VU9A 3CIHA 4B29A 4BQ1A 2LW8A 1N3PA 2ENRA 2WFF1 3ZPOA 3POIA 1PO12 3NSTA 2BFUL 3WINE 2NM1A 3VDCA 3IDAA 4X8NA 1GP6A 2CGPA 1VBA1 2ARCA 4Y20B 2A70A 5SV8A 3IM0A 5FFOC 1O3QA 1RMU2 1GZCA 4LOSA 3CL1A 4MGZE 2D3PA 3VLBB 4QHOA 1MPXA 1X8MA 1BBT3 2Y34A 3QOPA 5SV5A 2A1XA 3SQOA 5GLVA 2GH2A 3ENRA 2JKXA 5LK5A 2J22A 4AL9A 2R0HA 1COV2 3ZO0B 2Y33A 4NHLA 1ULEA 4L9BA 3IPVB 4JDMA 3RZHA 1XNTA 2HBTA 4ZKTB 1LULA 2CTVA 3ZOIA 5FO7B 2XVGA 2ZZQA 4QX8A 2GN3A 2JDMA 1YIFA 2ZACA 3JBG1 4L99A 4CDWA 3QCWA 2A3WA 2QUOA 1ENRA 3TNPB 3O14A 1QOOA 3THPA 1LHNA 1WMEA 5C9AB 4D6RA 5J48A 1KS5A 2DCJA 2PQSA 1ZX5A 4EN8B 3KV9A 2K9ZA 3ZYIB 4PIYA 1RVF1 2WAOA 5A6ZA 1OMIA 2QZ3A 2FD8A 3TN92 2EIBA 4GWJA 2D6PA 1WW5A 4K7JA 3I3QA 2CV6A 1N1TA 1NA1C 1V0AA 2PHTA 3GBGA 3MIEA 4BYYA 5CADA 5I0DA 2H0BA 3NO8A 3DV8A 1ZRRA 3RNSA 1MS1A 5B4XA 2X53S 5D21A 4M4PA 4MXWB 2CDPA 1CZTA 2X5IC 3WW4A 1FMD3 4RS5A 1DZQA 1U5XA 5IVEA 3VHPA 1V6NA 3HBZA 2FDFA 4R9DA 1V6KA 1B35B 4I01A 4YFWA 2AEYA 1HJFA 5I8SA 3RQ0A 1QXJA 3NQHA 4Q0PA 5KXBA 1QXPA 1V6OA 1ZZBA 5J96B 4CCNA 1NCRB 1Q8PA 2Y6LA 3ILNA 2ET7A 5T54A 2BTVC 3LPFA 2ZABA 4JCKA 3AL6A 1ZRCA 2XVLA 2ARAA 3ATGA 3JD73 5FZLA 2G4IA 1UOBA 4IEUA 4XUQA 4URAA 1MEC1 5L7OC 2IVJA 1NYWA 1HX6A 3NV3A 4KNCA 1Q8QA 2BVBA 4AE2A 4NIHA 2UU8A 2Y26A 3VBFC 2GZWA 1PZ9A 4FPJA 1J83A 5IWFA 1VP6A 4A7YA 4OI0A 2E53A 1HN1A 1SLAA 4COZA 3OBRA 1HRV3 1EUTA 3H3LA 3DYMA 1JU3A 2OPKA 4LO8A 3ZDSA 1UU6A 2YU1A 1Y43B 4MADA 1COV1 3CDZB 2JX9A 4UBHA 1WWYA 4P9WA 3DPRC 1H4HA 1OQDA 2BW8A 1W6MB 5JZGC 4BMBA 4Q1RA 1RUI3 3AZVA 3KQRA 3T2QA 1W8ZA 3ZKYA 3EB7A 5E1RA 1WCKA 1O59A 1MVEA 2QBXA 4NVPA 4GH4A 3WP3A 5BUVA 1PMJX 2BJSA 1YO8A 4XEZA 4JX0A 3K77A 2XJTA 3APBA 1RITA 2JDUA 3HIFA 4UI9L 5CU1A 4QU2A 1O4YA 2BOJA 5DUVA 2A3YA 3M3QA 1VB2A 1YHFA 3TN91 3D0JA 3PLQA 5L73A 3ZFFC 2VAUA 3AZYA 1GR3A 4BQXA 4FPLA 3PU8A 3WOGA 5AC93 3BKZA 2A7AA 3D0SA 2ZGNA 4DS0A 1VIWB 4FXGB 1KEXA 4AEJA 1W2TA 3VD7A 2E31A 4NIDA 4XACA 1WW4A 4NAMA 5EJ1B 3WF1A 1W8UA 1DLCA 1GZWA 2Q4SA 2SLIA 5FZ1A 3U78A 2ZEZA 4MX3A 2DUPA 2AZ5A 4FPCA 5A7SA 3NMBA 4M0NA 1FOD2 4P02B 1TME3 4B1MA 2VG9A 3LQCA 2XJPA 1W2NA 5EJZB 2AR6A 2W1UA 4MOAA 4NE9A 5HXVA 3ASIA 3R6SA 3NJZA 4CCKA 1KGYA 2E7TA 3OGGA 1S0IA 2ZBJA 3CBNA 4YZ4A 3FL7A 1I5ZA 1OUXA 1AR63 1TNRA 4S2FA 1DQ0A 5GLUA 2FDIA 2CWMA 3EXUA 4RYDA 3KLSA 2J1AA 3MUY1 1JYIA 4FSJA 3N7MA 1QJY1 4JHTA 1O4TA 2ZMNA 4X6QB 1R1A3 2VR4A 4DEVA 1LR5A 1RUJ3 1BEV3 1FV2A 1O4ZA 3S7IA 5FIXA 3UGGA 5FZIA 1RUD2 2A6VA 4I0BA 3S5AA 5I8YA 1OUSA 2ARXA 1ALYA 3ACIA 1RHI3 4Y5SA 4TLGA 1ND2C 2OUHA 2W1QA 5GZFA 3WDUA 5CB7A 3ZYPA 3NAPB 1S0JA 5KHIA 2VUJA 1JXNA 1GV9A 1AYN1 3VDAA 4A45A
chains in the Genus database with same CATH topology
4IESA 4N43B 2EF6A 5JAXA 2JG8C 2PAKA 1F8VA 5ABJC 2WT0A 3N7LA 3KM5A 4PCRA 4RHV3 4XJWA 2XUMA 3QACA 3TBDA 1AR71 4R9AA 1VBE1 3R4DB 2QDNA 3DPRB 1EAH2 2B8MA 1QJX1 2HWC1 5JZGB 3C2UA 4Q0VA 1MZEA 3M3IA 2RMU2 4F8AA 4Q4Y2 1AL22 1WA4A 1ZBE1 5KHJA 4MGYE 3B69A 4AEDA 2D6KA 1UMZA 3VHRA 5I93A 3AP9A 4E2QA 4WZFA 4A3XA 1BVP1 5JLVA 1UL9A 3PVNA 2ZHLA 1LU2A 4XOGA 5CFDB 2DWRA 3PJQA 4AVAA 3S0MA 4K9SA 4W6XA 4FQZA 4CYDA 3VBSC 3ZX7A 4Y26A 4OZXA 4LBNA 4QPGB 5J37A 1NQJA 1PO23 1H9PA 1UPIA 5T50A 4AXOA 3ES1A 1V6MA 4FP3A 3SCFA 1PM7A 4AWDA 1ZREA 4QQOA 4QHBA 2XVKA 1D4M1 4G4FA 4GB33 4AQTA 5F9TA 4YG6A 3WHTA 5GJ6A 4HK8A 1ZZ7A 1JW6A 2NYYA 4R4ZA 4JAAA 4MH0E 1VALA 3WT3A 3RMXA 1H1IA 3ZIXA 2XBO2 1PZ8A 2D5HA 4WM8B 2RS53 3ZFGB 1A3KA 1AX0A 4W6WA 1U5YA 1ZBA3 2BWCA 4F83A 2MEV1 4JRLA 4R4XA 1H2NA 3EJKA 1H1MA 2DCZA 1O3TA 3E6BA 1ND2B 1SCRA 4EN9B 2VGDA 1KDKA 4GIQA 1R091 3KCCA 5H9RA 4K8FA 5F1RA 1LOFC 2GH8A 2JG8B 1YXWA 4CDUC 5BNOA 5AVPA 1C5IA 3ELNA 2HWD3 1EAH1 3USUB 1ENXA 1KJRA 4PDWC 3RRDA 5A33A 1TMF1 3BIWE 1F5FA 2RMU1 4YLZA 1JUHA 4RSUA 3B02A 2OA2A 2B42B 3E6DA 1C28A 1XE7A 4S2GA 4Y5Z0 1PGW1 2D44A 1RB8G 3JZVA 1VBC1 3VZKA 1J3RA 1ZM1A 4WVZA 4DY3A 1RUNA 1I6XA 5ACA2 1NA1A 1PHMA 1NCQC 4R9CA 4KH9A 3AMPA 4PLMA 3U4XA 5FQ0A 1Q8OA 4J1WA 3PHMA 3WR0A 2X5IA 4LULA 4CDXC 3T1LA 1VBD2 3GZAA 4FQ4A 4I3GA 4PJYA 5IUQA 4H55A 5L36A 3W9AA 3VDDC 4HSLA 3A4UA 4XJ9A 3LCPA 1B09A 3N7KA 1O5UA 3AKTA 2R072 1G9AA 3MIDA 2QZ2A 4XZPA 1LRHA 1PO13 3CJIB 4FO9A 3AMHA 2ZOEB 5DDJ1 2DCKA 2YHJA 2GNDA 4WM7C 4YGCA 1LJ7A 1MS5A 1RMU3 1JTZX 5L7OA 1PK6A 1DGWX 4NN0A 5A3MA 5KC6A 2GC1A 4L2NA 1W0OA 5LEJA 1SQ4A 4GKXA 4YGDA 3VBFA 5T3NA 2DF7A 2Z2SB 2EXKA 1COV3 1FI2A 1CAVB 1R1ZA 4LO6B 1AR92 2KXLA 3VBUB 2IXIA 4WVMB 4CDWC 3WQ1A 4M01A 3SMHA 3B9IA 3VKFC 1SLLA 4XF4A 1DQ5A 1LHUA 1W39A 1PIV2 2Z69A 2R061 1V70A 2FMDA 1UD1A 2FQPA 5GALA 3RMYA 1F5JA 4CTEA 1RUC1 2WS91 2UYAA 3TN93 4ZU7A 3KSCA 1GQGA 3VKOA 3PVOA 3QH6A 1AVBA 3AMMA 3QH7A 3B5LB 4V1PA 1ENSA 4BIFA 1DQ1A 3WP4A 1QJU1 2D40A 5F6KA 3ZFFA 3WLUA 1QNYA 4LBQB 2HKXA 4LHNA 2BWAA 4HANA 2WA4A 1Z7S2 1MACA 2W0XA 4DB5A 4XFBA 2G9FA 1SFNA 4JGZB 1CAUA 3AZWA 3HT1A 1X36A 4L97A 3LAGA 3W58A 4OUMA 2A6ZA 1NY72 1RUE2 5FMOS 2QJVA 1KD7A 2DURA 3FX3A 4BCUA 1LHWA 4CDXB 1AX2A 1TQ5A 4CEWB 4R9BA 4IL7A 4FAGA 3VBHB 1BYHA 1RUOA 3VL8A 4MGKE 2CAUA 4FAHA 1MZ5A 1OA2A 1QXRA 5IK8A 2E63A 1W6OA 1AXZA 1Y9QA 3AYCA 4DPNA 5KHIA 4YM3A 1YFYA 1O91A 2JE9A 3O5SA 2HWF2 3FLRA 3V0BA 1POV0 1S0DA 2CWSA 2GNMA 3G7DA 2HEVF 2Q1ZB 1GQHA 2VVFA 2OUJA 4QMAA 4S2HA 1KRIA 3OCPA 3INAA 5JSRA 4PIZA 4Q2FA 2D3RA 5ABJA 3PVEA 1RTVA 2RM21 4PLNA 3VKMA 2BPA2 4YM2A 4LO4B 4EWAA 3ST7A 2RS31 2ZGUA 5GZEA 4CDWB 4COVA 2D5FA 1CD3G 3OBTA 1ZZCA 3WW2A 3M7AA 5BNPA 3M1HA 5T55A 1MQTC 4LBQD 4JDNA 4AVCA 2P34A 3AMQA 5A32A 3TAYA 4HLTA 3AZXA 1DZTA 2DVDA 4QGMA 3VBRC 3J8F2 4EJRA 5CG9A 5CNAA 2FZ1A 3Q9OA 5GLTA 1QQP1 1VRH1 3WG4A 1FOD3 4AI2A 4QQHA 4BMEA 4JTNA 1W6NA 3VBSA 1ASJ1 4RS5B 4MZUA 4SLIA 2B46X 1QH7A 1FPN2 2GC3A 2R042 4JC1A 1RUE1 3RWNA 3WHUA 2ZAAA 3AP7A 4B7EA 4BLJA 4LA2A 3HWJA 3AK0A 4MV2A 1YYNA 4GQ7A 1MZFA 4HN0A 3NVCA 3WDTA 2QDRA 2WFF2 4L92A 5D8AC 4Q4V1 1RUD3 1BMV1 4H14A 4G3YC 1VBA2 3ZYGA 5IK4A 1O3SA 3B94A 3O7OA 5I91A 1NG0A 2QKDA 1G7YA 4AHXA 3D5OA 2HWF1 3VZNA 2PHLA 4IEOA 3U07A 3IDEA 3QLQA 3LZZA 1HQLA 4I0WB 5GLZA 2JKBA 5FTTC 1C4RA 2ZHMA 4Y1XA 1R093 2ZHNA 2ZGSA 4P5HA 4NHKA 2VVDA 1NXMA 2TBVA 1SCSA 3JBG2 1H8TC 3WUDA 1EAH3 3IN9A 3VGIA 3JUUA 4ISRA 3HN1A 4LBMA 2RMU3 4Q4Y3 1AL23 5BV6A 4GH4B 1LOFA 4CDUA 2A6XA 4E4DX 1RVF2 4YW2A 4PDWA 1IHMA 2YGMA 1LOCA 4P9XA 1KFXL 2HEWF 2OW4A 4Y1YA 1DQ6A 4HBNA 4FBFA 4D7SA 1OFNA 4XFHA 1EV12 1JN2P 2TEPA 4TSVA 4AHYA 4EV0A 4NPRA 5J3UA 2RS11 3ZXLA 2GMEA 5H9PA 3NV2A 2W08A 2CAVA 1NCQA 1GZWB 3NKGA 4X6RB 3VZLA 3IBMA 5BNNA 2P3KA 1H2LA 4HKOA 1SLCA 4I02A 4DOUA 3H1MA 3VDDA 5KHGA 2XBO3 1OPMA 3P3PA 1AR81 1GNZA 4YFZA 2DTYA 1GYKA 4XETA 1MEC2 4UBGA 2A3XA 4IV3C 4M3CF 4P14A 1QDCA 3A0NA 1YFWA 2CGOA 2R1BA 4WM7A 1W6QB 5H9QA 1SLIA 3SNMA 4N53C 5J36A 1CPMA 4XTMA 2AGSA 3KS7A 1LTEA 4BH9A 3MEPA 4FPYA 3WQ0A 4KG0A 4FPFA 4YZ2A 4S2DA 3H3UA 4P9YA 2ZX4A 3OY8A 1X8EA 2WQ4A 5DZFA 4C90A 4AVTA 4FPGA 5CFCA 1ULFA 2DUQA 4META 5BNOC 2GSYA 3AP5A 4IEZA 4MLOA 4CDQC 1ZZ9A 4FPOB 3DUIA 3HT2A 1X82A 2R16A 3AZZA 5HBAA 2V5YA 1IOAA 4HKWA 4Z07A 3AX4A 3ZYJB 2XJUA 1WLWA 4XMIA 2DCYA 3AMNA 1GZ9A 3GALA 1LB2A 4QPIA 4PIXA 4TWTA 5JMCA 2XL9A 4K40A 5J09A 2CYFA 4CP1A 3MFAA 4M3CA 4AEDB 5ACA3 5BY5A 4GMP1 1EV11 5KXEA 2WKKA 3QD6A 4GWMA 4KU7A 4DINB 3BPZA 2PN5A 4EROA 1RUH1 1VBD3 2Z79A 5CVRA 2JE7A 2PHRA 4Q8KA 4Q26A 3H0OA 4RD7A 4L8QA 2C0ZA 5JIAA 5K9YA 2AH2A 4OLLA 3RJ2X 2R073 1S0BA 5EXOA 2XJSA 2WZPP 2JECA 1WBFA 3S7EA 2Q30A 3ILFA 4QT6A 5HCAA 4YGEA 1PK6C 2A6WA 5BPXA 1QJY2 2MPFA 4LBLA 2Y0OA 1VJ2A 3QBQA 3I59A 4RQPC 3ZVXA 5FLHA 4LBKA 1HLCA 4EN0A 3ZSLA 4OHYA 4FXKB 1UPSA 1AR93 1AYN2 3E97A 5KHHA 1JUIA 4Q4W1 1AYM2 2W68A 1ONAA 2ES3A 2JG9A 3PVBB 4JGYA 5EZWA 5FO8B 4HZFA 4RGGA 1KQRA 3HAGA 1Y7BA 3KGZA 1PIV3 2A75A 3KT1A 3PTYA 3WG3A 4B7KA 5GZCA 3IDCB 4LBOA 1AR72 4FP2A 1VBE2 1Q43A 4KBBA 4XJUA 3VZOA 3RI8A 4SBVA 1UF2C 1XNKA 3PMEA 2HWC2 3RI9A 1QJX2 4DRVA 5BNOB 1MS0A 1A8DA 3EHKA 3C3VA 4F3JA 3WCSA 1ZBE2 5A33B 1DU3D 1CJDA 4LNVA 4LR4A 4AI0A 5JOWA 1FT9A 5C4WC 2DV9A 1WMFA 2ZGPA 2NMNA 4RFT0 3WCRA 1MQTA 1QKQA 1PVC1 2ZX0A 1YI7A 1Z7S3 2IXLA 3UKVA 4LE3A 4P9LA 2JXAA 3EQEA 3OPZA 2ET1A 3VL9A 4LHLA 5FBZA 1NA1B 3AKSA 4D7TA 3VBRA 4ZU5A 2H6BA 4HVOA 1D0HA 3IWZA 2HWB1 3LOIA 4N7IA 2RR11 3GHMA 1C1FA 1RUE3 3M4FA 5FQ0B 3ZFEC 2VMGA 2ARBA 2X5IB 2XLFA 2IXJA 2OZJA 4K1ZA 2UURA 1D4M2 2IFRA 2VQAA 4FTEA 1R081 1QDOA 2WINB 1GNHA 2P2KA 3IT8A 4RR3A 2I74A 4Q4V3 3AJZA 1CESA 5T5OA 5EYXA 1IGOA 3ETQA 1KXGA 3MW3A 1IKPA 3OYWA 1Z0HA 1FNZA 5D8AA 1BZWA 1OLQA 2IXCA 4KU8A 2HWF3 4QQ2A 4OHXA 2MEV2 5L7OB 1PK6B 1WLDA 2BGCA 3I54A 2VW1A 1CAXA 4HMZA 2Y0IA 3VBFB 1AYM1 3B9CA 4XF0A 2XLAA 5CAZA 1JYCA 2WNUC 5I0RA 1K5MA 2BEOA 3TYJA 3ZXKA 1IS4A 1R092 2ZGQA 3WXPA 4BWOA 3O0WA 1SBDA 4YRDA 3I2DA 3WX5A 1H8TA 5BNPC 3CJXA 1TMF2 1XE8A 3L2HA 1JH5A 1POV3 5JOYA 1RINA 3OGJA 2D93A 2ZGRA 3PJYA 1ZZ6A 1MS8A 4J6GA 2JJ6A 2RJKA 3CEWA 4YVWA 5JOXA 4F7ZA 2XL7A 1PNGA 4A2UA 1PGW2 3V65A 4K1YA 4AVSA 3J8F3 1U12A 1VBC2 1G6NA 2LUWA 5JPNB 1WCSA 1UIJA 2WSVA 3D4KA 3ZFFB 3DL3A 1N1VA 4LBJA 4YW5A 3T1MA 1QNWA 1LCLA 2D6MA 3MIGA 2R043 1FPN3 3ZSJA 3E5QA 1CAUB 1HV1A 1YWKA 3KB5A 2LTNA 4XW3A 3DGTA 4C0HA 1LOBA 1KFUL 4C1WA 4M0HA 5JSPA 2WFF3 3I7DA 4M3CE 5DDJ2 4KGQA 1VBA3 4AI3A 2PA7A 3VZMA 4IV3A 4BM8A 1IS3A 4UXAA 2D98A 2EXIA 1H4GA 4IEQA 1V6IA 1G9DA 1W6OB 2ZX2A 3WUCA 1QU0A 4N53A 2E6VA 2N7GA 1SEFA 3R0RA 3SCGA 2ZX1A 4UW6A 1LKNA 3V0BB 4MXVA 3V64A 4QD2A 3VHOA 2GNTA 3ZXAC 3ZSEA 3JBG3 1GFF2 2DVGA 4HK9A 2HJIA 4HPKA 1VBB1 4IEVA 4IEPA 2R062 5ABJB 5JDBA 4CDQA 1RVF3 2E7AA 1H9WA 4XF1A 1RUC2 1ULCA 2WS92 2KM2A 4B8EA 3ZN6A 1AX1A 2VXRA 1DHKB 2K2SA 1KITA 4EN7B 4KL1A 4AF9A 3RJRA 3SH4A 5BNPB 1EV13 1FV3A 1GANA 1QJU2 3RS6A 4OI2A 2OYZA 1GLHA 5DZGA 3ZYRA 5J98B 1MS4A 4FVVA 5A32B 5LEKA 3H8UA 2QVSB 4XQWA 3WNXA 1GBGA 2WA3A 3L9JT 1HKDA 5FCCA 1REFA 1S0CA 3FFZA 2ZS6B 1BCXA 1N47A 1LECA 4IEWA 5BNNC 1W6NB 1M06G 1UW8A 3VBSB 3VKNA 1BXHA 4FTBA 4OI4A 3D6EA 1BK1A 2BNOA 3GZTB 5GKAC 1N1SA 1MEC3 4DFSA 5FMOL 2K0GA 1AXYA 1OHFA 1O5LA 1DIWA 2WJSA 4AQSA 3MFCA 2HEYF 3ZXJA 2ZMKA 4Q0SA 4FOVA 4AI8A 1SBEA 5E8AA 1RGSA 4RQPA 4YZ5A 4OHVA 2NZ9A 3ZIWA 3K51A 2HWE1 3R4SA 5CFCC 2PELA 1S2BA 5FDBA 5IT6A 5KWRA 2EAAA 1S0FA 1XQNA 2XG3A 3OJBA 2E51A 4BHPA 4Z82A 1MVQA 4KGGA 4ZU4A 5DG2A 2IWGB 4KWKA 2TUNA 3A0KA 4I3PA 1TNFA 3NKTA 4IEXA 2RM22 4XBQA 2E7QA 2IZWA 3E5XA 3NAPA 4XMAA 2RS32 3NV1A 4YSFA 4YW4A 3POYA 5KC5A 1CJPA 2DUOA 3GNEA 5KXDA 1CAWA 4P9JA 5FLIA 4QPIC 4YM1A 4ASLA 4CDUB 4DQAA 4IETA 4PDWB 1PVC3 3AXDA 2WSUA 2Q1MA 3AKRA 4R52A 5C4WA 3IDBB 2R49A 2AUYA 2ILMA 2PHFA 3VHNA 3GBFA 3VV1A 4NWWA 3WVJA 1D2SA 2YXSA 1Q56A 3MDPA 1EYBA 3M3OA 1QQP2 1VRH2 5KXCA 4E2GA 3D8CA 3UJQA 1ASJ2 2WC2A 2YV8A 2ZAHA 2JDZA 1DBNA 2VW0A 2X29A 1NCQB 4WBBA 2NQYA 3ILRA 3ZFEA 4IV1A 2VVEA 3CNAA 3UKTA 3SISA 3VBOA 3S6PA 1S2KA 3MPBA 5LRRA 5BNNB 4Z1VA 2P37A 1IQAA 1NZCA 1C8M2 3FUOA 1OKQA 1QJY3 2XJVA 1ND3C 3VDDB 3FZ3A 4Q4V2 4QPYA 4UW3A 1BMV2 1FMD1 4OHZA 2JICA 2C9AA 3LB9A 1V9U2 4C1XA 4D69A 1JHNA 1DQ4A 2WIIB 3SXWA 4KQ7A 4WM7B 5K0UA 1F31A 1AYN3 3VUOA 1AYM3 2JG9C 3O12A 1Q8SA 4JGYC 1U5IA 3SHRA 4ISQA 4OUSA 3MIBA 1WGPA 3UJOA 4NHMA 1I9RA 2B5HA 3OY8B 2VOVA 3JD71 4OULA 3ZSKA 5C33A 1AR73 2GALA 1VBE3 4GALA 2WQZC 5C8WA 2WNUA 2DTWA 5CFCB 3CLPA 5D1IA 3MPPG 5CIRA 4CEYC 2HWC3 1UZYA 1QJX3 3AFKA 5E88A 1AJOA 4LTAA 4YNIA 3ROUA 5K8SA 2XH6A 2LM3A 4K20A 1OSGA 1UX6A 1ZBE3 2UY8A 4MVTA 1I3HA 1W6PA 1S0GA 3GHNA 1ZZ8A 4FOWA 4NO4A 2I45A 4XJAA 1LOGA 5CBLA 1HRV1 2Q8OA 5HI0A 2WNVC 5I0TA 1WMDA 4QPIB 4CP0A 1XU2A 1RUI1 5F5QA 4LEJA 1OQ1A 2Q5TA 4Q27A 4M3CB 3SITA 2RS12 1EPWA 4XFCA 5T5PA 2D97A 2GAUA 2RE9A 3I4IA 1S1AA 3USSA 3MIFA 5JIUA 1RIRA 3HR9A 1C57A 1D4M3 1RC6A 5IK5A 5FPXA 3M70A 1FX5A 4Q29A 3LWCA 4RR3C 1J58A 1ZYBA 4EWDA 2JD4A 2EALA 3MICA 5AC91 3TOJA 1SLBA 3LOBA 1C8M1 1DQ2A 4HL0A 2QNKA 1V6LA 1AR82 3RSJA 3WW1A 3WD5A 1RJ8A 5E16A 3O0XA 4DZGA 1FAYA 4XE9A 1OOPC 3RPQA 4YVSC 2D7FA 1V9U1 1WW7A 2MEV3 2VECA 3GBWA 4OHWA 2ZGTA 4AFBA 1TME1 3I59B 5I0SA 3B01A 1LEDA 2CL2A 2VMIA 5CG8A 1KS4A 1YJLA 2XKOA 4ATEA 3BU7A 1K5MC 3H7JA 1AR61 5EFUA 1PNFA 3R4UA 4GMP0 2VY0A 4DNYA 1LENA 4HFSA 2Y38A 2JG9B 4JGYB 5C8CA 1R1A1 3ZXGA 1RUJ1 1BEV1 1F9KA 1DF0A 2C5DA 1TMF3 1RHI1 2EVXA 4YVWC 1C8NA 2ERFA 4DXZA 1C5HA 1NLRA 1CVNA 3FWEA 1MR5A 2PLV2 1G9FA 2R0FA 3M3CA 1IPKA 3B00A 1IPJA 2V09A 3X29B 5C9AC 1VBC3 4AGVA 4E4ZA 4RHV1 1F2NA 1MQTB 1QY4A 1SLTA 1UU5A 4D3WA 1IKQA 1QJZA 5FPZA 4QGLA 4QXKA 1AJKA 1RUH2 3MGUA 2DYCA 5IK7A 2D6NA 5FLJA 4E2SA 3VBRB 1DDLA 2RJLA 2R1DA 4HSJA 1H30A 4B4PA 3H1WA 3ECQA 3M8LA 2D6OX 1XU1A 2CY6A 4XIKA 5JR7B 2VNRA 1XNDA 3LSEA 3TRSB 3E6CC 1LHOA 4XILA 1RUF2 1ZRDA 5DDJ3 3ZXFA 1CX4A 1RJ7A 3L2YA 4JRAA 3FC0A 1FXZA 1DYPA 1EY2A 3B3QE 4RR3B 1Q5OA 4Q0UA 4LUKA 3DN7A 1YJKA 1OI6A 4Y22A 2PAMA 1PO21 1URXA 2UWAA 4XXPA 4LT5A 3OYWB 3H3ZA 1SMVA 5DUXA 1LOEA 1VB4A 4XJZA 5D8AB 2BBVA 2JENA 5FO9B 4AFDA 4B4RA 4NWVA 4GB31 2YUEA 1CAXB 3MW4A 4Q4W2 2BVVA 3KMHA 3WDWA 3IMNA 4IERA 1YFUA 4U36A 1U0AA 1X7NA 3TB0A 2R063 3GZUC 5DZEA 4DY5A 1K5MB 2RS51 1O7FA 1RUC3 1ZBA1 2WS93 4YGBA 3IKWA 4UW4A 3ZN5A 2RHPA 1PGL1 4QX5A 2BUKA 3ZMOA 1H8TB 2ZGKA 2WNEA 4Y1VA 1LOAA 2AYHA 2PLV1 3MLKA 1QJU3 3E5UA 3LGRA 3MZHA 1DFQA 4ITCA 2V73A 1HQNA 2XJRA 4YVWB 1PVC2 2PTMA 4PBPA 3ES4A 4ONUA 2B9UA 1HRI1 4PLOA 4INDA 2HWD1 2B7YA