3FBMA

D431n mutant vp2 protein of infectious bursal disease virus; derived t=1 particles
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
433
structure length
428
Chain Sequence
TQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVANLNSPLKIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Polyprotein
publication title Autoproteolytic Activity Derived from the Infectious Bursal Disease Virus Capsid Protein
pubmed doi rcsb
source organism Avian infectious bursal disease virus
total genus 94
structure length 428
sequence length 433
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fbmA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3fbmA02
4GH4C 1PIV1 1RUI2 2HWB1 5CFDA 4EJRA 1EV11 1HRI2 2HWF3 2HWD1 1VBB2 1AL23 1W39A 2MEV1 2RS12 4QPIA 1NCQA 1VBD2 4Y4YA 3NAPB 1TME1 4JGZC 1AYN3 1RB8G 1AYM1 5AC92 1RUC3 1PIV2 1QJX3 3VBOA 2HWB2 4NWVA 1R081 2Y26A 5CFDB 1RUH3 1Z7S3 2HWD2 1QJY3 1V9U3 2MEV2 4FSJA 1TME2 4QPIB 1NCQB 3TN91 5DDJ1 5BNOA 5FOJB 2XBO3 2PLV3 1AYM2 2RS31 4CDUC 1BMV1 2HWE3 2BFUS 5D8AC 1R082 1VBC3 3VBOB 1F2NA 1NCRC 5L7OA 1C8M1 3DPRC 5D8AA 1BBT1 3VBRC 3VBSC 1K5MC 2RR11 2RM21 4GB31 4NWWA 3JBG1 5DDJ2 4WM7A 2RS32 4Q4W3 4WM8C 3VBRA 5BNOB 3VBSA 1BMV2 1AR91 1HRV1 1R093 1QQP1 1ND2B 1VRH3 1EAH3 4WM8A 1ZBE1 5BNPA 1C8M2 1BBT2 2RMU3 2RR12 5L7OB 1ND3A 5CFCA 3VBUA 3JBG2 4N53C 4CDQB 5C8CA 1PGL1 1AR92 1HRV2 4WM7B 4CDXC 1VAKA 1QQP2 1RMU3 1PO21 1ZBE2 1HQNA 1MEC1 2R061 4YVWA 1H8TC 1HXS1 4Q4X1 4N43C 5BNPB 4YVSB 1POV3 2WFF3 1ND3B 2WLPA 5CFCB 1PGL2 3VBUB 2WZR1 5C8CB 4IV1A 3J8F3 4RQPC 1COV1 2HWC1 1PO22 5GKAC 1MEC2 1HXS2 4FTEA 4GMP0 4Q4X2 1SMVA 1DDLA 4YVWB 3VDDC 3VBFA 1AL21 1ZBA3 5JZGA 3VDDA 5ACA3 2WZR2 2RS53 4IV3A 4Q4Y3 5C4WA 4CEYA 1RUJ3 1RUE3 1VBE3 1AYN1 3ZFGC 2WS93 4IV1B 1RUC1 1COV2 2X5IC 3ZFFC 2HWC2 5BNNC 3M8LA 1OHFA 5A32A 4SBVA 1QJX1 4GH4A 3ZFGA 1MQTC 1RUD2 4RR3C 5BNNA 1HX6A 1RUH1 4CEWC 1Z7S1 1AL22 1QJY1 2R073 1QJU3 1V9U1 3ZXAC 3VBFB 1NA1C 5JZGB 1OOPC 4IV3B 1TMF3 2XBO1 2PLV1 1AYN2 4JGZA 5C4WB 1RUC2 4CEYB 1FOD3 1VBB3 1EV12 2HWE1 3S6PA 1QJX2 1VBD3 5A32B 3CJIC 4FTBA 1VBC1 4GH4B 1RUH2 1Z7S2 1IHMA 1QJY2 1AR83 4PDWC 1V9U2 5ABJC 4Y5Z0 4AEDC 4QPGC 2XBO2 4Q4W1 3VBHC 1ASJ3 2BBVA 1R091 4JGZB 4CDUA 2HWE2 4RS5C 1VRH1 1PO13 1EAH1 2XPJA 2R043 1VBC2 2FZ2A 2TBVA 5A33A 3TN92 1NCRA 2RMU1 1PVC1 4Z92B 1RUF3 1VBA3 1BEV3 3DPRA 5C9AC 1AUYA 1K5MA 4Q4W2 4JGYC 4CDWC 5C9AA 1FPN3 1RHI3 3ZFEC 1FMD3 1VRH2 4CDUB 1EAH2 1D4M1 1RMU1 2RM22 4GB32 5D8AB 2RMU2 1PVC2 5A33B 1POV1 1NCRB 2WFF1 3FBMA 1AR73 3DPRB 3VBRB 3VBSB 4N53A 1K5MB 1RUG3 5LK7B 3J8F1 4CDXA 1A6CA 2WWSA 4WM8B 1D4M2 1RMU2 4RHV3 1B35C 3JD73 5FMOL 1H8TA 3HAGA 4GMP3 4N43A 2WFF2 1B35A 1ZBA1 4Q4V3 5ACA1 2RS51 4Q4Y1 4N53B 1RUJ1 3J8F2 1RUE1 1VBE1 2R062 2QQPA 4CDXB 4RQPA 1QJZA 5K0UC 2HWF1 1X36A 1H8TB 5K0UA 4N43B 2R071 1QJU1 5ACA2 2RS52 4Q4Y2 3NAPC 1RUJ2 1RVF3 1TMF1 1RUE2 1VBE2 2BFUL 1FOD1 2GSYA 2X5IA 3ZFFA 1VBD1 2HWF2 4RQPB 5J98B 1R1A3 1GFF2 1E57A 1AR63 1MQTA 4RR3A 5CFDC 1RUI3 1AR81 2VQ0A 2R072 3VDDB 1QJU2 4CEWA 1HRI3 4RFT0 1NA1A 1RUD3 1NCQC 1TMF2 3IDEA 4QPIC 1ASJ1 1OOPA 2RS13 1FOD2 5FMOS 3ZFGB 5AC93 1PO11 1WCDJ 2X5IB 3ZFFB 5BNNB 2BPA2 2R041 3CJIA 3VBOC 1PIV3 2ZZQA 1AR82 1C8NA 1MQTB 2HWB3 4RR3B 5J96B 1EV13 2PLV2 4PDWA 1RUF1 1VBA1 1BEV1 4LLFA 4CEWB 2GH8A 5ABJA 2HWD3 4AEDA 1ASJ2 2MEV3 1NA1B 4QPGA 5BNOC 1M06G 3VBHA 1TME3 1FPN1 1OOPB 1RHI1 1ND2C 1FMD1 1AYM3 1PO12 4RS5A 2R042 1ND2A 3CJIB 2ZAHA 1R083 1RUF2 1VBA2 1BEV2 5L7OC 1R092 1OPOA 4PDWB 4CDQC 1AR71 3JB4C 5ABJB 1RUG1 3JB8A 4AEDB 4WM7C 1FPN2 4QPGB 2FZ1A 3TN93 1RHI2 5DDJ3 1FMD2 4JGYA 4CDWA 3VBHB 2RS33 4CDQA 3ZFEA 4RHV1 3JD71 1VB4A 4RS5B 2IZWA 5BNPC 1CD3G 1PGW1 4GMP1 4YVSC 3LOBA 1AR72 1NY71 1C8M3 1ND3C 1BBT3 4Q4V1 5CFCC 3VBUC 1RUG2 2RR13 5C9AB 2RM23 4GB33 4YVSA 5C8CC 3JBG3 1PVC3 2DF7A 1AR93 1HRV3 4JGYB 4RHV2 4CDWB 1QQP3 3ZFEB 3JD72 1VB2A 1CJDA 4YVWC 1PGW2 1ZBE3 1AL0G 1D4M3 1NY72 4Q4V2 1NOVA 2WS91 1RVF1 4IV1C 2BUKA 1X33A 2ZTNA 1R1A1 1AR61 1ZBA2 1PO23 1B35B 1MEC3 2R063 1HXS3 1RUI1 1POV0 4Q4X3 3VBFC 1HRI1 2WS92 5JZGC 1RUD1 1RVF2 1VBB1 4BCUA 4IV3C 3NAPA 2RS11 5C4WC 2WZR3 4CEYC 4FTSA 1F8VA 5AC91 1R1A2 1NG0A 1COV3 1AR62 2HWC3 5K0UB
chains in the Genus database with same CATH superfamily
2YBSA 4GJYA 4JKMA 4BQXA 4PLNA 1MZFA 3HN3A 4E4DX 2EIDA 2HWB1 3I2IA 3JUUA 5CFDA 4JTNA 1O8PA 2FDHA 5LBFA 1GOFA 3USUB 1C3HA 2HWF3 1VMHA 3RJRA 1AL23 2QDRA 4NMIA 3SITA 3MIEA 2PN5A 2IXCA 1O7FA 2NPIA 1RUOA 1XNKA 2DUQA 1ULEA 1AYN3 2E51A 2VUJA 4KMQA 2B9UA 4HZFA 4UW6A 2PAMA 4DS0A 5J48A 3E97A 5FZIA 1CZSA 4B8EA 2QQKA 1OURA 3BOPA 3VBOA 1GR3A 1W8TA 2RJKA 1R081 2Y26A 3H7JA 1DQ6A 1WKYA 1GYKA 1QGLA 2ZABA 1SBDA 1RUH3 1WWYA 4XF9A 2HWD2 5H9SA 3TEZA 1QJY3 5FZ1A 1LOAA 3MPBA 1S2EA 5HV0A 4FPGA 2AENA 5FJKA 2XBO3 3NJVA 2ZGTA 2Y33A 3H3UA 5KXEA 1CPMA 1XYNA 4CDUC 1ZRFA 1FAYA 2D6KA 4AQTA 3T08A 2BFUS 4ZXEA 4C0HA 3FZ3A 2Y64A 4NO4A 2Y8KA 4CSWA 3OY8B 5GLUA 1Q5OA 3O1MA 2DCZA 4BQWA 2D97A 4DFSA 2EICA 1O4TA 1XNDA 2A70A 2VBBA 1TG7A 2QKDA 2Y6LA 3BU7A 3MFCA 1F4AA 1C8M1 1RJ8A 3ACHA 1ZVFA 5IVYA 4NIIA 1M4WA 1A8MA 1V6OA 2VH9A 3OGJA 4FI9A 2JG9A 3HEIA 3JBG1 3URFA 4YGCA 1DQ0A 1UZVA 2RS32 4Q4W3 4P14A 3VBRA 3VBSA 1HRV1 1LHVA 3B9IA 3TEYA 2A6WA 4EN6B 3ASIA 4YSFA 1UCXA 4QXHA 1LGNA 1UAIA 1YLLA 2VCCA 3WDWA 3OOXA 1O4ZA 1YCIA 4WM8A 1D0HA 5A3OA 3KCCA 2HEYF 4Y5TA 3PMSA 5BNPA 3KV9A 4CU7A 3BU0A 1O3TA 2RMU3 3ZYFA 2RR12 1MS9A 4JRLA 2ILMA 2JDZA 4A4AA 5JWPA 2G9GA 4Z8BA 2D6LX 2OUJA 4B4PA 3IDBB 4LHLA 4LKFA 4OMDA 4BIOA 1PGL1 3H9AA 1VE0A 2OVUA 5FZDA 1AR92 4WM7B 4CDXC 2CYFA 1QQP2 2E7TA 1WGPA 1HV0A 2FD8A 5JXHA 2WINB 2NLRA 1V6IA 3ZSEA 3AYAA 1PK6A 1ULFA 5KXDA 1LOFA 1ZBE2 2V5YA 4NRPA 4YVWA 4BMEA 4JC1A 2VUDA 1MVQA 4PBPA 1MZ6A 4Y1UA 3AYDA 4DO0A 4DRRA 4H55A 4QMAA 2R32A 2CTVA 4FVVA 2WFF3 1LOGA 1ZRDA 1ND3B 3ZMNA 2WLPA 3LDBA 4URAA 5CFCB 4HOOA 2V72A 1LU2A 2C6SA 5C8CB 3EYPA 5FPZA 3LA2A 1IS6A 3D0SA 3PJQA 4O61A 5FZFA 2A3YA 4RQPC 3DUIA 1Y43B 4AHZA 3AFKA 2HWC1 5IT6A 5BUVA 5FZAA 2N7GA 4BIFA 5CYYA 5HI0A 5FYHA 4Q4X2 2YC2A 1MVEA 3VDDC 4AVSA 1XE8A 4YM3A 2JG8C 2XWBB 1YQ2A 1JTZX 5EJ1B 4JX0A 1IS4A 5A6YA 1S0DA 4XHBA 5JZGA 1QOOA 4XHXA 1W6PA 2A3WA 3K46A 4GWIA 1GZWB 2D3PA 1QJEA 2O8QA 4OCTA 4XILA 5C4WA 1DCSA 2XGXA 4XUNA 4CEYA 5FO8B 4K20A 4K6BA 1RUE3 4PT6A 4UFLA 3KVAA 3ZFGC 3NJZA 2WS93 3VKFC 2WUHA 4AYUA 2PHLA 2J1AA 4QQ2A 3RI9A 2IXJA 1OHFA 2H0BA 3M8LA 4NVPA 4PF1A 4CA9A 1SPPB 4LHKA 1QJX1 2CWMA 1ULOA 4RR3C 3OYWB 1OBNA 2OT7A 1H6XA 1RITA 5BNNA 1WA4A 4CEWC 4MHUA 1AHSA 1Z7S1 2GC0A 3B94A 1XPWA 1QJU3 3I97A 4UOJA 3O0WA 3VBFB 1NA1C 3C7GA 3MIDA 2DYCA 1T2XA 3AL6A 3I2KA 4YW3A 4JVAA 4NROA 4EYUA 2R49A 4UFMA 2WDBA 1RUC2 4FAHA 1O3RA 4LLOA 5A6QA 3B69A 5JUVA 3IIIA 2PAEA 3CF6E 2YC4A 4ISQA 2XHNA 3MV11 2Z4FA 2O8OA 2I07B 5A32B 2P3KA 3CJIC 5CEHA 4IL7A 1DBNA 3WX5A 1EY2A 4ZONA 3H3ZA 4Z2WA 5FR3A 1UXXX 5GZGA 3S5AA 4NIDA 4C1WA 3H8OA 1H4HA 2GU9A 4HT1T 4Y22A 3EMRA 2WT1A 4TLGA 3WXPA 4TXWA 5ABJC 5GZEA 3MIBA 5FLJA 5FZOB 3CDZB 2P1BA 2B9VA 3I8TA 3WNPA 1KDMA 5L36A 4V1PA 5LBEA 3VBHC 3BTXA 2FCTA 2VECA 1GNZA 5E16A 1WA6X 1R091 1ZZBA 2BBVA 4JGZB 1SZBA 3S7IA 4CDUA 2HWE2 3OSDA 4RS5C 5K4LA 1VRH1 3FUQA 4R4XA 4ZS3A 1PO13 1O5LA 2IC1A 1Q43A 3N35A 1VBC2 4KL1A 1RGSA 2K9ZA 4W6XA 4Q1PA 1GQHA 5A3PA 3OGRA 1NE6A 2WNUB 4X6RB 1G9DA 2EA7A 5KXCA 1CPNA 3TN92 3UESA 2DTYA 3JXSA 1GZ9A 1PVC1 5SV8A 2FDKA 1RUF3 1C4RA 5BPXA 2DCYA 1W0OA 1AUYA 2WIIB 1LU1A 5HCFA 1QOTA 3KV6A 1W8OA 3MIHA 2JEMA 1JN2P 1UU6A 2BGPA 2ES3A 2WAOA 4LOTA 1FPN3 3THTA 3ZXLA 3ZFEC 2WL1A 1HLCA 4JRAA 4LO4B 1BVP1 2V73A 2EVXA 1RMU1 1LB2A 1IKQA 2ERFA 5K7PA 5D8AB 4GB32 4JV4A 4HBNA 3AJZA 3WVJA 3WHUA 4RSUA 3C8XA 1W6OB 2B7YA 4QDQA 3U78A 1NCRB 5GLTA 5I91A 3FBMA 3TBDA 2GN3A 4INDA 1JUHA 3LB9A 1XU2A 3MV01 4DIQA 4Y5SA 2EXHA 5LK7B 2XXZA 2VTXA 5LZ6A 3VD9A 5CIRA 2VNVA 4CDXA 1NZCA 1GMMA 3DKQA 1GOGA 3ZO0B 1A8DA 1TNRA 5F2WA 4LA3A 3WP6A 3OBZA 3OBTA 4AI2A 1NUKA 5A7OA 1S0IA 2AREA 3PJYA 4QKNA 3QACA 4BYYA 1OFSA 1W9TA 1WBLA 4QD2A 3SEPA 2OZJA 1L3JA 2HJIA 3Q9OA 3R4SA 4GWJA 4AI1A 4OFGA 4C0BA 5LA2A 4CXYA 5FJHA 2XLFA 2XJSA 2RS51 2QQLA 2VZTA 1OVSA 2C9AA 4AXOA 3UGGA 1HB2A 1ZX5A 2PHTA 1RUJ1 4UFIA 5HCAA 5BNQA 1IZ3A 2LALA 5FXZA 1ZREA 2QE3A 2JE7A 2VUAA 4RQPA 1FV3A 4XFCA 2JIJA 3MGUA 2Q1ZB 4NIGA 2HWF1 4H7MA 1OA3A 4ES8A 4QB2A 3VL8A 4EWDA 1IQDC 2HBUA 4RA0A 4FCAA 2YYOA 2VOWA 4XFGA 1X36A 2LRPA 2JG8A 5K0UA 2DFCA 2ZACA 3WW1A 2W46A 4H7LA 5A3LA 4ARYA 1OD3A 4JDNA 1UOBA 1V6MA 2JECA 1KS4A 4ZZ5A 3MHZA 4S2DA 2TNFA 3POGA 4LO7A 4BQ1A 1ULPA 1RVF3 1TMF1 4ZZ8A 1VBE2 5JMOA 2QQJA 1H4GA 2BFUL 3U75A 4D6SA 2VNGA 1YIPA 4ITCA 3J7NA 1NXMA 3LIHA 3VHRA 1CQ9A 4K21A 5JPMB 2Y6JA 5E1RA 2XB6C 2WWUA 1E57A 1JU3A 4RYDA 2QJVA 5IK5A 4XJWA 4RR3A 4JAAA 4EN8B 3SCFA 5FV3A 3BB6A 5JXJA 3FHAA 1RUI3 1AR81 1S0FA 2VQTA 2R072 4CEWA 5I0DA 5FK8A 3MF9A 4COYA 5FPUA 4RFT0 4A6SA 2OXBA 1N1SA 4TWTA 1NA1A 3RNSA 4QPIC 1NCQC 2P5BA 5F7UA 2ADDA 5JXGA 3HPNA 1HJGA 1UNBA 4IQPA 1QHDA 3CKHA 1ASJ1 2DWRA 2RS13 3EHKA 4W6WA 1FOD2 3HN1A 1VP6A 4B1MA 4I0BA 5FMOS 5A3TA 2BP6A 2W1QA 1YYNA 2QQOA 2X5IB 2Y6HA 2O14A 2R041 3CJIA 5A7WB 4AWDA 1L7RA 4DUXA 4XJ9A 4AL9A 2PELA 3IN9A 2ZZQA 1QH6A 4RFRB 4Q8KA 2HWB3 5J96B 1OLMA 3KQRA 4XOGA 2VOXA 1URXA 1U5YA 2PLV2 2B46X 3KT4A 1BEV1 3OY8A 4U36A 3ZSJA 3AZWA 5FDBA 4XFHA 5ABJA 1Y9GA 5JIAA 1JZ2A 1SCSA 3FFQA 2JD4A 4XEZA 3O1PA 1RXFA 4LHNA 5T5LA 3HNBM 4FFFA 4XF0A 4BQ4A 3R0RA 3VBHA 4XC9A 1RHI1 1ND2C 1JHJA 3BCWA 1FMD1 1LULA 4M00A 1S55A 4LBOA 4RS5A 1CVNA 2YPJA 3CZUA 3AYEA 5FYVA 4AK3A 2DURA 1LGBA 4CYDA 2W1UA 3PTRB 3N7MA 2VZOA 2ZAHA 4URTA 4DEVA 1R083 4YRDA 2WFPA 2JKXA 4I01A 3A7QA 4UT5A 2VE1A 2XH6A 2P3IA 4YGBA 4ZXKA 1OPOA 5L7OC 5F5AA 3JB4C 1UZZA 4P5HA 2CY6A 2GMMA 4X6QB 2WA4A 2PMWB 2ZKNA 1VIWB 1LTEA 3N9QA 2V5DA 3ZYPA 5EIYB 4QPGB 4ASMB 1JHNA 1G9BA 2E32A 3WF3A 1J59A 2XUEA 1ENXA 3OUIA 3ZFEA 5DMYA 3ABZA 2Y34A 4PF5A 4CUBA 5HXMA 3JD71 3OCPA 4I2OA 3LZZA 2PHUA 1CD3G 1XOYA 4H3WA 1QXRA 2CGNA 1UWWA 3HQUA 4R9DA 2LTNA 1S0BA 4NE9A 1AR72 1NY71 2HLEA 1C8M3 3NV4A 3OUHA 3QD6A 4M3CB 3HBZA 3RWNA 4GALA 3T2PA 5IYYA 2VBPA 1RUG2 1GP5A 2ZEYA 1S1AA 4V2WA 5FMDA 4ZKTB 5C9AB 4TLFA 2GMEA 3JBG3 2YY1A 3LA7A 5GLVA 3ZN6B 5F32A 1W8WA 1G8WA 3OD4A 1GZTA 2RDQA 4XBLA 1HRV3 4JGYB 3A21A 4CDWB 1OA2A 3RZLA 2GC1A 2JX9A 2DU0A 1GANA 1Z0HA 1VB2A 3BIWE 2ATFA 2I2SA 2XJPA 3RGBA 1UMZA 1SBEA 2WQZC 4TSVA 2ZGOA 1XNBA 5DUVA 4HFSA 4XDOA 4R9AA 3D3AA 3P6BA 4YYOA 1YJLA 3VGIA 1YNAA 4Q4V2 1ULGA 2QQUA 2ZCWA 2MNGA 2WS91 4QT6A 4PQ9A 2JDUA 3T2OA 2YUEA 3U14A 3ZDVA 1SQ4A 5GZCA 5KHHA 4Z1VA 1ZZCA 4IV1C 4IERA 1ULCA 2PHDA 4WVVA 1ZA4A 2XUMA 5DZEA 2ZTNA 3P3NA 1R1A1 1ULDA 2G19A 2ORXA 4CP2A 1CX4A 1S0JA 3LWCA 2QFEA 1B35B 2JDNA 4O7XA 2VMCA 1AJKA 2VW0A 4MH0E 1GBGA 1OH4A 2WT2A 3VZOA 3O1UA 1HRI1 3SKJE 2QQVA 2V4VA 4BCUA 1JU4A 4ISRA 5A3UA 1RJ7A 2ZKLA 2BOJA 3WG1A 4RGGA 3RDIA 4EWAA 2YXSA 3AX4A 4BK5A 3JQXA 3Q8BA 1BHGA 2RJ2A 2JE8A 2A73B 2VNOA 4Q0UA 1AR62 2HWC3 3I3DA 1DQ2A 3ACIA 3PDQA 4J25A 2BDRA 2W08A 2ZZJA 5FPAA 4UBGA 3TEWA 4EJRA 4WVMB 2ARAA 1W8NA 2EAKA 4EN9B 3ORJA 1X9TA 4CPBD 3CLPA 5FUPA 1W9FA 4W50A 2XMLA 3RQ0A 4YW2A 4YLZA 1UYPA 1NCQA 2ZHLA 1JOBA 4QPIA 4XF1A 5APAA 2KXLA 5FP3A 2K0GA 4OI0A 1UYZA 1UOGA 3VD4A 1LHUA 3T30A 5AC92 1UZ0A 3MW2A 4OMCA 3AB0A 5FZ4A 3I2OA 1PIV2 2VJXA 4EZHA 1YFXA 2BVVA 1QJX3 2W68A 4NWVA 3K4ZA 5FMBA 3OB8A 5FYUA 4AGGA 3NWKA 1Z7S3 3RFRA 1HB1A 2W0XA 2W39A 2WNUA 3ZXEA 2WNEA 2VXRA 1DGRA 2MEV2 2DU1A 4BWOA 1DP0A 4UFHA 4IEQA 1TME2 1RXGA 1V6KA 3TN91 3C2UA 5DDJ1 1N1VA 1T6BX 2HEWF 1AYM2 3EQEA 2P3YA 5AVPA 1BMV1 3CQOA 2R30A 4IETA 4AZZA 5FWJA 4U2AA 2ZBJA 5L9BA 4P08A 1AF9A 4OZXA 2Q8OA 2NM1A 1LRHA 4M01A 1N3PA 3HT1A 1UYXA 2Q1FA 2WNVB 5HXVA 3WCSA 3WDVA 4Q0QA 5L7OA 1W3VA 1DYPA 2X8KA 1KJLA 2XVLA 1BBT1 3DPRC 5D8AA 3RVHA 3VBSC 3VBRC 4DQAA 1K5MC 3HNYM 5T5PA 1H6YA 4GB31 1OT5A 3CJXA 4D69A 3G6JB 3GZTB 5FRAA 4CUAA 4DUVA 4WM8C 4XBNA 3LE0A 5M0TA 5BNOB 2SLIA 1R093 3OF1A 3O7OA 3FFZA 1J3PA 2O0OA 1ACCA 1W2OA 4QKDA 3RZMA 5JAXA 1JI6A 4CCNA 1VRH3 1OUSA 2ORZA 1YI7A 1DGWA 3K3NA 4BK4A 4GD4A 3S57A 4CDQA 2BV4A 2P6CA 3JCIA 5JOZA 1U5XA 1EYBA 3DV8A 3RSJA 5EPAA 3BIEA 1SDDB 1ENQA 5J36A 5EYYA 4R4ZA 3DF0A 3JZVA 1SCRA 2BTVC 1KDKA 2VUCA 2G9FA 2WZEA 3T2QA 4XJUA 4MX3A 2VQAA 1OKQA 2GAUA 1VAKA 3N3HA 4FPLA 4IEVA 4BJ0A 1PNFA 3OPWA 2VMHA 3DCQA 3NNMA 3TB0A 3VKLA 4KG0A 2CSGA 4AQ6A 3ZXKA 5JLVA 4I3GA 4W6YA 1RMU3 4IEZA 2W87A 1REEA 3BTAA 1HQNA 4K1YA 1MEC1 5LRSA 5KHJA 5CAZA 4QQOA 1XE7A 3GBFA 4A6OA 2W92A 4N43C 1OLRA 4BXSV 1W04A 2ZMLA 2ARCA 5GLZA 1LENA 3WNMA 4ZHNA 3I3EA 3IDCB 1UF2C 4NJ4A 2XJTA 5AFBA 1JZ3A 4Y20B 1XRUA 4F3JA 4WBBA 3VBUB 3VV1A 2B8MA 1E5IA 2F4LA 3OGVA 3IAPA 1FX5A 4IV1A 4BLJA 2DCTA 2I74A 4HVQA 4CP1A 1H9PA 5BV6A 3S5QA 1J1LA 4ES9A 1CGPA 1COV1 2RDNA 1BQPA 1PO22 3SC7X 1ZM1A 2ZX3A 1HXS2 4FTEA 5A80A 1SMVA 2ZA9A 4G9SB 1DQ4A 5IFPA 3SHRA 1JYNA 4QPYA 2VMIA 4PIYA 1F31A 3VZMA 1HN0A 3WINE 4MOAA 4ZU7A 4Q5OA 4UI9L 2R0HA 5E6HA 2WZR2 2RS53 3C7EA 4A3XA 1Q8PA 1BKZA 1OLME 2BVBA 4LBQA 1RUJ3 4YFWA 1X9PA 1BZWA 4BMBA 4NAOA 1WLDA 5BNNC 4XURA 2OPKA 5FKCA 2H6CA 3MIFA 1DYKA 2WNOA 3WZ1A 1WMXA 4AFMA 4XF4A 5DXDA 2VZ3A 3SISA 3HD8B 4Y1ZA 1Q8OA 1RUD2 3N36A 1C1LA 5KR7A 3OJBA 1H1IA 1HX6A 5FIXA 5A7WA 4CTEA 1UY1A 3AJYA 1AL22 3KMHA 3SH5A 2KR2A 3N9NA 2CV6A 1V9U1 3DGTA 3ZXAC 4CCMA 5KC5A 5KHIA 3KGZA 2JKBA 5JR2A 1ODNA 4QXCA 1OOPC 1PX3A 4IV3B 1TMF3 2HEVF 2PLV1 1AYN2 1ZNPA 3B5LB 4JHZA 1V70A 3UJOA 3V65A 4FPEA 3TAYA 5ISLA 1YO8A 4I0AA 4QX5A 3THPA 1EV12 1QJFA 3THCA 1ZZ7A 2XDVA 1MZEA 3S6PA 1C1FA 1ENSA 1TE1B 3HVDA 3P1IA 4FQZA 4AHWA 4M3CF 2GMPA 4FTBA 1KFUL 2Q30A 5FUNA 1LEMA 4FOQA 3NVCA 4GH4B 3BI3A 1K42A 1RUH2 1V6NA 4HL0A 2A6XA 2JDHA 3RJ2X 1IHMA 1QJY2 1AR83 2EIEA 1AVBA 2ARBA 2NQYA 1MACA 3DXUA 4FO9A 4MADA 1E5HA 3WUDA 4DEQA 4DNYA 4Y5Z0 2PHWA 4AEDC 3PUIA 3Q8EA 4IGPA 1KS5A 2ZJCA 4PLOA 2XBO2 3CEWA 4COWA 2E63A 3K75B 5I0SA 1UPSA 3L2YA 1ASJ3 5A7PA 3W21A 1I3HA 1WMFA 4KGGA 4BQ2A 2F17A 2D3RA 2ZX1A 3ELNA 1IKPA 5LRRA 1Q8VA 4CP9B 1EAH1 1QWRA 1K3IA 2R043 4QXBA 3LFMA 1UD1A 3MLLA 5LA0A 1G6NA 4J1WA 3MO4A 2PFWA 5CBLA 2WKKA 1W0PA 1FI2A 5JOXA 2F4PA 4HANA 4XACA 4AG4A 4D8MA 4Z92B 2R1BA 1QIQA 3LEGA 1BEV3 2RHPA 3DPRA 4H2AA 5CKQA 1QF3A 5BYNA 1K5MA 1AXZA 2AEYA 3O14A 4JHTA 1UPIA 4Q4W2 4M3CA 5FP8A 4DRVA 2AGSA 5DUWA 4AI0A 1QNYA 2ZAAA 3O12A 1PM7A 5C9AA 3ETPA 1RHI3 4BPZA 3K3OA 4ZU4A 1FMD3 3KWVA 2PA7A 3ZN6A 4B1LA 5A6ZA 3A0NA 3ZIXA 4CRQA 3V0BB 3AP9A 1H0BA 5FYCA 2WABA 2D3SA 2PQQA 1OPMA 1UMIA 2DVGA 4QAWA 4XCBA 1F5FA 3UL2A 4B7KA 2RMU2 4YZ1A 4FT8A 5A33B 2VMEA 3POIA 3TNPB 5A3WA 3AP5A 4Y4RA 1XU1A 2Y0IA 4CXWA 2J1EA 4LORA 1UOJA 2GALA 1O6UA 4OUMA 3NKTA 4OULA 3SH4A 5LEJA 5F5IA 1W9SA 1CR7A 1WUVA 3ACLA 5A7NA 4BXFA 1CAVA 4F7ZA 3J8F1 3VD5A 3MFAA 4MGQA 4D3WA 2A1XA 2WN3A 1D4M2 1DIWA 2DUOA 3AP4A 4FQ4A 4M4RA 4A44A 4DXSA 5A1AA 5FYIA 3TYJA 3JD73 3NMBA 1Q3EA 2JB8A 4UF0A 4UAPA 4XIOA 1X8EA 1DGWX 2HH9A 2L9LA 3HAGA 1CAWB 3H8RA 1QU0A 4N43A 1MS8A 2WFF2 4FPOB 1B35A 1J84A 4XXPA 4MV2A 4SLIA 5JXIA 3NJYA 4AI9A 5ACA1 5I0RA 4LHSA 4Q4Y1 2VBDA 4CUGA 1REFA 1VMJA 1BCXA 4N53B 2C4XA 2IVIB 3PURA 2R062 1W2UA 3LPGA 4YGDA 3WD5A 3BTZA 1YFYA 3NW4A 4GKYA 5K0UC 1OMIA 1UKGA 4NN0A 2Z2SB 5KHGA 2XLGA 3T2TA 3FHQA 4XFAA 3FLRA 3SEEA 3WP5A 4UFJA 1NQJA 4W4ZA 4AE2A 1H8TB 5J7MA 5FY8A 1WW5A 3E5XA 2CWSA 1D0GA 5FZ7A 1UYYA 1RL3A 3WP4A 4WVMA 2Q8CA 4LKDA 4G4FA 3EB7A 2ZHNA 4OI1A 4OI4A 3VZKA 5J1XA 1RUE2 1UO9A 1PX4A 1SFYA 3ZPYA 4AQSA 3N4MA 5FOBB 4FAGA 2QVSB 2R16A 3WDXA 1D2QA 5IVCA 2QCSB 5KC6A 4E27A 2C26A 4RD7A 5L19A 4TZDA 4LBNA 4LJHA 4JCKA 1R1A3 4QQPA 3LKJA 2VTFA 5FUIA 3N7LA 4BM8A 3AL5A 3KGLA 1RTVA 3KF5A 1V6LA 3KM5A 3ZDSA 1I5PA 5DAVA 1MS4A 2VQ0A 4LE4A 1QJU2 5F8PA 3ZVXA 1HRI3 1W2AX 1DLCA 2ZGPA 3AMPA 1HJFA 3I2GA 3M3CA 4JDOA 5FP7A 3O1SA 3BVCA 2VZSA 5GZFA 1OOPA 4IE0A 3DEMA 1B09A 2A6VA 1DQ1A 1G9AA 3ZSMA 3I59B 3TNQA 1UX7A 5E89A 4IE4A 3VN4A 4YZ3A 3RZZA 2J42A 4I02A 3ZFFB 4QPWA 3EO6A 3VHPA 1DZQA 1TVGA 1Y9QA 4LBJA 4QGLA 3FLTA 4GULA 1NAEA 1MQTB 5F5QA 4DXTA 4DINB 4PDWA 1VBA1 3I2HA 4LLFA 4HSLA 2XQXA 3ZKUA 2WNVA 3IB3A 4AEDA 1H9WA 2XL9A 3ZKYA 1ONAA 1YXWA 2GNDA 4L9BA 4A2UA 1UZWA 1SFNA 3DKWA 5D21A 5HCBA 4BU2A 2F6BA 2CHHA 3B02A 1PMIA 5IFTA 1PO12 1JYXA 4IE6A 3ZN5A 5A3NA 3KT7A 3AZZA 2WO3A 3I4IA 3ITQA 2RV9A 4FP2A 3VZNA 1OVPA 2W1SA 3BTYA 4BH9A 4GJZA 5CISA 3AKQA 5FXXA 4GIQA 4NPRA 3IM0A 1RUF2 4Z2AA 4JDMA 1GNHA 1ZA7A 3IT8A 2ADEA 2Z5WA 2YV8A 4HLTA 3U07A 4YW4A 2CDOA 2YZ4A 2YMZA 4MXWB 4LITA 4QX8A 4WM7C 3WV6A 4QM8A 1FPN2 5JOYA 3KV4A 4ONUA 5DDJ3 3TN93 3ZYHA 5H9QA 3OEBA 5F39A 1IS5A 2P2KA 3I3MA 4RHV1 1NLRA 5J09A 1W9WA 2W1WA 1PM4A 3DYMA 4BA6A 2BYVE 1RINA 1PZ9A 2EF6A 4GAZA 2ENRA 2Z79A 1PGW1 2UYBA 4GMP1 4HMZA 2J1VA 2V09A 2P3JA 3GXUA 1KITA 3LOBA 4LBQD 1CN1A 1SACA 1ND3C 4N8MA 1BBT3 4RL7A 1UMHA 4KGQA 4XF3A 5CFCC 4Q27A 3POJA 4YNIA 2A3XA 4GB33 3PIGA 5C8CC 3MBWA 1H2KA 3VUOA 5FPBA 1TQ5A 2OA2A 3I7DA 1LJ7A 1SG3A 1U12A 2X10A 4CCEA 3V0AA 3JU9A 3WDTA 3RMYA 5IWFA 2JENA 4B3NA 3AMQA 5LK5A 4CCLA 2W91A 4NHKA 1KEXA 1LAJA 2Z42A 2WO2A 5T54A 3RYKA 5LATA 2YBKA 5T5JA 4BQ3A 3WNKA 1GQPA 4ZPIA 4FXKB 2VZ1A 2FDGA 2EIBA 1NOVA 3O0XA 5JVVA 4E4ZA 1WD4A 4BB3A 2XG3A 4HXCA 3HWJA 3BALA 3D6EA 3BPSA 5FYBA 1W2NA 2XL7A 1IGOA 3U0ZA 4Q0PA 2VMDA 4AGRA 3PTYA 2B5HA 2GC2A 4XDQA 1N47A 1FT9A 4J6GA 1L7QA 4N9IA 1ZBA2 3M3QA 1GWMA 2DBNA 1WW6A 1MEC3 3UK9A 4E2QA 3KCYA 2J22A 2ZGSA 4FPYA 3USUA 4A3ZA 4LO8A 4G3YC 4LK7A 2W47A 3MIGA 4LKSA 4NRQA 4RN5A 3LEKA 3VBFC 5C3OA 1K5JA 2YDEA 4LULA 4A41A 4CP0A 2JWPA 3VDCA 4BZ4A 2ZMNA 4P9LA 2Y38A 1RUD1 1RVF2 3AFGA 3M4FA 3USSA 5GLWA 1EPWA 4D6RA 4HK9A 3UNPA 4AVTA 5FREA 2RJLA 3KHCA 2FCVA 2VY0A 1FATA 4HK8A 4ASKA 5EV7A 1D4VB 3R05A 1COV3 2Q8DA 5G05L 3P3PA 4KU7A 2OS2A 1SHWB 3NNLA 4XFBA 1BYHA 1RUI2 1UW8A 4X8NA 5CNAA 5LW9A 3H1MA 1EV11 4Q0SA 2Q4SA 5FZ8A 2VNRA 2HWD1 2RG4A 1VBB2 4HKLA 2BWAA 1IG0A 3M3IA 4XTMA 5DZFA 5EHDA 3ZXFA 1NQDA 2RS12 4KG8A 4Y4YA 1VBD2 3SH3A 4L97A 5CA6A 4X8PA 3PIJA 3NAPB 4JGZC 1A78A 1GP4A 2Z69A 4KBZA 5KBFA 1DYOA 1APNA 3FJSA 4LUMA 1OXCA 1OA4A 4M3CE 4XUQA 2QQNA 2JDAA 2WNUC 4I0WB 2HWB2 3LSEA 4WVWA 5I8SA 3M3EA 4CP9A 3HIFA 5CFDB 4FXGB 4MGTA 2WQ8A 2D98A 5DQ0A 1CESA 3L2HA 1OF4A 1HDKA 3NRUA 3T3YA 3B3QE 1V9U3 4FSJA 2FDJA 2ZX4A 1F5JA 3AVRA 5J37A 2J1UA 1DGRN 4XJAA 2PLV3 1K45A 2RS31 1VAVA 3PVNA 4FPFA 3QH6A 4R8HA 3DL3A 4XJZA 1UU5A 2DVAA 5F3CA 4UW3A 1GWLA 5FZHA 2DV9A 1XXNA 3IAQA 2HKXA 5D8AC 5BY5A 1R082 4YZ4A 3SNMA 1XC6A 3U11A 2V4AA 3VBOB 3V0BA 2BRTA 1ZRRA 1NCRC 2D5FA 2YGMA 3O5SA 2ZGUA 4IEWA 5FAXA 5EWSA 4AW7A 3PUSA 2QDNA 1C5IA 4YG0A 3K4DA 2RR11 4NRMA 3C3VA 4EZ4A 2VR4A 3FHIB 1V6JA 4NWWA 2AUYA 1W8FA 3VZLA 1WBFA 4WM7A 2XKOA 4XFIA 4LXLA 1AR91 2AYHA 1DLLA 3CU7A 4QX2A 5DG1A 4OHZA 5FYSA 1QQP1 1QXPA 5FZBA 4FOWA 1W99A 1OUXA 4Y3OA 1EAH3 3TEXA 4O65A 1AXYA 1JYCA 1ZBE1 3ATGA 3ROUA 1G9FA 2C5DA 4YW6A 5A7QA 1SFPA 3V64A 3GGLA 1C8M2 4LA2A 4BE3A 4COVA 1LNSA 2EAAA 3GBWA 3MLKA 3LA3A 3MZHA 5GALA 3EXUA 3AP7A 5TSWA 3HNMA 2JDPA 1ND3A 3M7AA 2YFZA 5CFCA 2WSVA 3ZXDA 1KRIA 3JBG2 4CDQB 4LMFA 4QHZA 2G1MA 2JG9B 3ZSLA 5C8CA 4D6QA 1O91A 1HRV2 1GUIA 3WR0A 2VOKA 4LUKA 3J9SA 3KCXA 3THDA 4XIKA 5FZMA 1YUDA 2K46A 4JKLA 4YZ5A 5LCWL 1W6MB 2Q1MA 2R061 2ZHMA 5FYMA 2QZ3A 4MUVA 2ZX0A 3VDAA 1J3QA 4Q4X1 5LBCA 1JZ5A 5BNPB 2GDFA 4YVSB 1J58A 4L92A 2VVFA 3ZLIA 1DU3D 1QXJA 3KS7A 1GZWA 4XTPA 1PGL2 4CUCA 5DZGA 5EQUA 4UXAA 4XZPA 5LB6A 5A7SA 5C5UA 1UIKA 2P4EA 3WW2A 5C3QA 3D4KA 3J8F3 2ZX2A 1R64A 1W8UA 3ZPOA 2VOVA 5KWRA 1SPPA 2NMNA 1S0EA 5EP9A 1FNYA 1PK6B 3OYWA 2BBAA 1SLBA 3PUAA 3VHNA 1A34A 1DDLA 4YVWB 5BXXA 5JOWA 3IPVB 4DPNA 2WWJA 3HBKA 2VZUA 3PUHA 3VBFA 5JDBA 4OQ8A 4XAEA 1PVXA 4IGQA 5FLHA 5A3MA 4AEKA 1QH7A 5ACA3 4Q4Y3 5D1IA 1JUIA 2Q5TA 3N7JA 3H0OA 3LDRA 2WA3A 2A75A 1RUC1 2X5IC 3BN6A 2HWC2 5FY1A 4YG6A 5A32A 1STMA 4KH9A 1W3XA 4SBVA 1CZVA 1K12A 3X29B 2B42B 4MHRA 4CZSA 1H2LA 4HVOA 2E9QA 4E4HA 2WC2A 3AKSA 1MS0A 3B01A 2G4IA 4LR4A 1POQA 1S4CA 4IE5A 3RRDA 1NZIA 1VRBA 2VGDA 3ZN4A 5FPXA 5JMCA 1PHMA 1XBFA 3QCWA 5FZOA 3AXEA 5JZGB 3CL1A 1W6PB 4N7IA 5FCCA 2HBTA 4JGZA 1TEIA 5C4WB 5A70A 4LIUA 3ZR5A 4CEYB 3BODA 1CAUB 4XQDA 3PVEA 4OLLA 1XQNA 2HWE1 1QJX2 1P8JA 5B4XA 2BQPA 2LROA 1VBC1 5G04L 2ZPXA 1BVVA 1Z7S2 2PAKA 2WAAA 1YQ5A 1LCLA 3KQ4B 4R52A 5DAWA 3I2FA 3RS6A 5LA1A 2ZGNA 3PU8A 3GNEA 1W28A 2EXJA 3AYCA 1H2NA 3DXTA 4XPVA 3NV2A 2D40A 4QPGC 4AEJA 4QU2A 5LEKA 3WSOA 3RI8A 2XJUA 4DY3A 3PU3A 4MXWA 1E5SA 4ORFA 3ILFA 4DB5A 4NR1A 2VC9A 4P00B 5JI9A 3E5QA 5JSOA 1QEXA 1XYOA 5B2GB 4MLOA 2QQIA 1LEDA 1QNWA 3OTFA 5DAXA 4CCCA 5IK7A 3AZXA 1W6OA 3K2OA 4ZS2A 1NCRA 3P5BA 2VD7A 2QQMA 2WYFA 4W8JA 4Y22B 2PHRA 1VBA3 5C9AC 1NLSA 2OIIA 3HMYA 4QKFA 1WLTA 4A45A 1I1EA 4KWJA 3F95A 3ME2A 2Q0AA 2ZHKA 3BOWA 4DZGA 1N1YA 4LK6A 4JGYC 4CDWC 3VZJA 1VRH2 4QQLA 3NSTA 4CDUB 4LEJA 4UYBA 1GKBA 2XJRA 2WSUA 3AMNA 4MZUA 4OZOA 1G86A 2FMYA 4OUSA 4P9XA 2IFWA 3FX3A 1KJRA 5T3NA 2RM22 5L9RA 4IUGA 3DYOA 4B7EA 2DBIA 4KQ7A 1PVC2 1SLIA 3OBAA 1POV1 4FOVA 4COZA 3KV5A 3WLUA 3ACGA 3I3BA 2MHFA 4ET7A 4LNVA 1XSRA 1KGYA 3MDPA 4XQWA 4EV0A 5A1LA 4QU1A 4E9KA 2EIGA 4L99A 3O1TA 3GBGA 5LY2A 3WDUA 1W2TA 2BGOA 2TUNA 3C7OA 1RMU2 5DG2A 1RYYA 4RHV3 3CO2A 3UV9A 1CIYA 4GKXA 1B35C 4META 4C8DA 4PBOA 3U4SA 2X09A 2UWCA 5FMOL 1WLWA 3SCHA 3GJAA 4NHMA 4YW5A 4GMP3 4DMIA 1IPJA 1OD5A 1PMJX 2RDSA 2WYSA 2YU2A 4LBMA 4AFCA 1H30A 3CHXA 3RMXA 2PYTA 4N7UA 1ZBA1 1H2MA 5HPOA 2ZXQA 4LIVA 1HQLA 1VBE1 1YQ8A 2AEZA 2LS6A 4IGOA 4UW4A 4P9IA 2QQPA 3LF7A 5FKBA 4CDXB 3M1HA 1OLQA 2BWCA 1PGSA 2VCMA 1QJZA 4LKEA 1BXHA 4XQ4A 2WZPP 3KVBA 3FLPA 3J4UH 2A5ZA 4L11A 1X82A 4QWNA 2Y6GA 2XKPA 1XNCA 3WG4A 4I30A 1GOHA 2EALA 3RZGA 4PCRA 4YG3A 3E6CC 1MZ5A 1WCQA 2A6ZA 5FY9A 4HKOA 3GM8A 4JQRA 2GNTA 2R071 2VXJA 3M2MA 4OHYA 2C9KA 2RS52 4XDPA 3HR9A 5FZKA 5LBBA 1RUJ2 3FUOA 3ZYJB 1WMDA 4YM2A 2YC0A 1AJOA 4O9GA 1FOD1 3N9MA 4K8FA 1QDCA 2GSYA 1F35A 2X5IA 1BLZA 1VBD1 2HWF2 3RZHA 3LEIA 4RQPB 2AH2A 4Y1VA 5H9RA 1GFF2 2AR6A 5DABA 4FFIA 3FN9A 5FY5A 1O4YA 2OX0A 4OYUA 3NV3A 2NP0A 4CVUA 3FMGA 4IDZA 3WQ0A 4HETA 3VDDB 5J3UA 3Q8FA 1HN1A 2JG8B 3H50A 4AVVA 1YEWA 2WZ8A 3AKPA 1IPKA 4MSVA 5FO9B 2BW8A 4YFZA 4PLMA 2X53S 1RUD3 3GZUC 1TMF2 5IJRA 2W5FA 3T0BA 2ZOEB 1H1AA 5JIUA 4DUWA 4CE8A 1TZOA 2VW2A 4JZRA 3LGRA 3I49A 2E53A 2CAVA 3SKVA 2JDYA 3J7HA 3WY6A 3ZFGB 3AKRA 2P37A 5IK4A 1WCUA 3U4XA 5EXOA 3KD4A 2BPA2 5FP9A 1RC6A 4FOYA 4MG2A 1WMEA 2D7FA 3GZEA 2D6MA 2WNVC 4PQQA 1AR82 1YQ6A 5I8YA 1C8NA 1X7NA 3E6BA 4RR3B 1JZ4A 2FDFA 1UX6A 1EV13 4JQTA 1I9RA 3A23A 4CEWB 4PI2A 5GJ6A 4DXZA 2HWD3 1S0GA 5ERLA 1QMJA 1QDOA 3N9PA 1NT0A 3DECA 2W2IA 1ASJ2 4QPGA 1NA1B 1LR5A 1T6GC 1XYPA 1W6NB 4HPKB 1IPSA 5CZKA 5BNOC 5I8TA 1M06G 2WO7A 4P9JA 4QX7A 1OF3A 2LW8A 3HQRA 1F15A 3T0DA 1RIRA 1O5UA 2R042 3AMMA 4WZCA 3ZXGA 1CWPA 3LOIA 2E26A 3A4UA 3B93A 3CJIB 2DVDA 4NHLA 4GA9A 2OQ7A 3HOBA 1Q8QA 1BEV2 1U0AA 2WT0A 1S0CA 2YG0A 3IMMA 1H1MA 5LWBA 5AVAA 1AR71 2VZRA 3SXWA 3WF2A 4E4SA 2W94A 5ABJB 3W5NA 2CGOA 1RUG1 2HYXA 4L2NA 4NHYA 3JB8A 1VR3A 3OBRA 4R9CA 4WV8A 4UBHA 4XXAA 5FK7A 2FZ1A 4V2VA 1RHI2 2TEPA 3TRSB 4ASLA 1FMD2 1KD7A 1PMHX 1GZCA 2RS33 2BNOA 2E7AA 2W52A 4JGYA 3VBHB 1LHNA 5I93A 4MGKE 3W9AA 4K7JA 5F37A 5A1FA 4RS5B 3C7FA 3CIHA 2IZWA 4BOWA 3C7HA 4LPLA 5FYZA 2VTXJ 4BISA 2R6QA 1W6MA 4GXLA 3PLQA 1N3OA 5C70A 4Q4V1 3VBUC 3I3QA 2RR13 5CADA 5FZ9A 2YROA 4CU6A 2H0VA 4YVSA 1OFNA 2E33A 3ETQA 3PUQA 3H7YA 1SLAA 4O9EA 4QGNA 3E6DA 1VALA 4D7TA 2FQPA 5IUQA 4CXXA 1KFXL 1AR93 5SV5A 2YBPA 4L8QA 5FO7B 2VULA 3VD3A 1QQP3 5H9PA 3ZFEB 3JD72 2W9XA 2C1FA 4HN1A 5K9YA 4LBKA 4QKBA 1YHFA 4CCJA 2EXKA 3RZKA 4LTAA 1ZBE3 3ZMOA 4KWUA 4OVEA 1JZ6A 3L9JT 2IXKA 1AL0G 1D4M3 1NY72 4LOSA 3ES4A 1WLCA 2Y6KA 4K1ZA 3IPVA 5T52A 3IBMA 4XABA 5DPNA 4OHXA 2BZDA 3IKWA 4CU8A 4LT5A 5CG9A 3ES1A 3M70A 1UN1A 1J3RA 3M3OA 2NN8A 3QBQA 1OQEA 2CAUA 1W8ZA 2ET1A 2QBXA 1UY0A 3ZYRA 1AR61 4PI0A 4XAAA 1BK0A 2R063 1EP0A 5DN2A 4AAXA 2YB7A 4Q4X3 2BNMA 5C3SA 2J1TA 4M0NA 3OGSA 2WS92 3POWA 5CB7A 2ETEA 4P9YA 3BKZA 4QDRA 4IV3C 3GHMA 1JH5A 1LKNA 5DUUA 3UT0A 5LY1A 2O1QA 1Y3TA 4FTSA 4BDVB 1F8VA 1D7PM 1GNYA 1WW7A 4MVTA 1YJKA 1EUTA 2JD9A 4OI2A 4S2GA 5AC91 1R1A2 1US3A 3R4UA 1CZTA 1CJPA 3K51A 2FBEA 5HCHA 1CAUA 4GH4C 2C0ZA 1PIV1 2UWAA 5DAQA 3U10A 5IATA 1WCKA 3WW4A 4YPJA 4H14A 3B00A 2IXLA 3O1RA 1HRI2 5F3EA 2ZEZA 1VAMA 2XLAA 4A7KA 5C3PA 1W39A 4E2SA 1NX9A 2MEV1 3O0VA 4BQ5A 3AXDA 5FPVA 5FZEA 4UFKA 1TME1 3RYPA 1GWKA 2ARXA 2PTMA 4MGZE 3F2ZA 2IUWA 3CBNA 4M0HA 1RB8G 1AYM1 1RUC3 4OHWA 4Q8LA 1WD3A 1O3QA 3KSCA 4YM1A 3WF0A 1BJQA 1W06A 5FZ6A 5IVJA 2DUPA 4M4PA 1MR5A 1CAXB 3BUCA 2JICA 2D6OX 1ZRCA 1W0NA 3J26N 1US2A 1UKRA 1FYUA 3NJXA 4E2GA 2PXJA 1R1ZA 2J1RA 1AXKA 1NLQA 1W05A 3B7MA 3Q8CA 4NUBA 5FPLA 2UU8A 4Y33A 4HN0A 5CU1A 5I0UA 3W20A 1JOJA 1NCQB 2VG9A 4QPIB 5JI7A 3KLSA 5CVRA 5BNOA 5FOJB 2GH2A 4OUEA 3POBA 4IEOA 4AEMA 2J7MA 2NMOA 3QLQA 2D93A 3T1LA 2WQ4A 1W6QB 3MICA 4IEPA 2CU5A 3OEAA 2HWE3 4BHPA 3NNGA 5F6LB 1Q56A 1XNAA 4S2FA 2IWGB 4QM9A 2BOIA 1VBC3 3RZJA 2VMFA 1F2NA 3IWZA 4KWLA 4XFFA 4QX0A 4XW3A 4FPKA 1GICA 4A7YA 5FZCA 2RM21 2WN2A 3GCWA 2UURA 5DDJ2 1OI6A 2RDRA 2IXHA 3SCGA 3WT3A 4MGYE 3UGHA 1BMV2 5D2AA 1CONA 3UKNA 3W58A 2P6HA 5C6CA 1DHKB 1ND2B 2UY9A 5C3RA 4CPBA 5IVBA 3KB5A 2AACA 3I2DA 3I54A 2Q8EA 2VCAA 4DXRA 5C5TA 1OQDA 4HKWA 2LM3A 3D8CA 4B4RA 1YFUA 1G7YA 5ANNA 1SBFA 5KXBA 2Y0OA 3FC0A 1HIXA 1BBT2 4IXLA 1JS9A 3LD8A 4Y20A 2XONA 3U37A 4E8CA 1O3SA 5L7OB 3WG3A 3VKNA 3AM2A 2ZGLA 3VBUA 4N53C 3ZR6A 2CNAA 1HB4A 4YW7A 2A71A 4LQRA 4QB1A 5T50A 1J1TA 2XWJB 1I6XA 5FQ0B 4TTGA 2VOTA 4TYSA 2KA3A 1UZYA 2OYZA 3POYA 2DCKA 4D94A 1PO21 2OKXA 2FDIA 3WNNA 3GALA 4AVCA 3G7DA 1H8TC 1HXS1 5F6KA 1UQXA 3VB9A 3EJKA 2HYKA 2KM2A 5FZ0A 5GM0A 3WDYA 1DF0A 1POV3 5FXWA 4AR2A 1LHOA 3FBYA 2YU1A 2BNNA 3Q8AA 5E8AA 5A6XA 3ZSKA 2WZR1 2D6PA 3K77A 3N9LA 3WW3A 1YWKA 2CGPA 4WVZA 3UJQA 4NPLA 4B29A 3AMHA 4A7ZA 4FFGA 4IEXA 4KI5M 2VQUA 3ENRA 1PZ8A 5EJZB 1UU4A 5GKAC 3ST7A 1ALYA 1MEC2 2FCUA 3BYWA 1Y9MA 1LGCA 3RPQA 4D7YA 4Q1RA 4GMP0 4CCKA 1L7LA 4NIHA 4IESA 1PZ7A 3QH7A 4QHOA 2VZVA 2OQ6A 3HT2A 1C5HA 1KXGA 4I09A 4FBFA 1AL21 3GYDA 4K9SA 4XE9A 1ZBA3 3HQXA 3H8UA 3ECQA 1N1TA 3VDDA 4P9GA 3WNXA 4IV3A 4YW1A 3WF1A 3SQOA 4Y24A 1W90A 1LOEA 5GZDA 1X50A 1U5IA 3VHOA 2WRAA 2A7AA 1VBE3 3IMNA 1AYN1 3W59A 4IV1B 1COV2 3ZFFC 2QQWA 5L9VA 4LBLA 4COUA 4GH4A 3ZXJA 3ZFGA 1MQTC 2KD7A 3GJBA 3O1OA 1JYWA 3ZYBA 4Z82A 1RUH1 5FTTC 1NKGA 1QJY1 2WO1A 3VKMA 1SLTA 2R073 3DYPA 5K8SA 1DG6A 1EPZA 4QXKA 1O59A 4NOTA 1ENRA 2GNBA 3IIAA 5FYTA 3WNOA 4LO6B 3OD0A 3WNLA 2I45A 2XBO1 4R9BA 4LBQB 1D2SA 4QB6A 4XYXA 2ZEWA 2EXIA 1FNZA 1FOD3 3POSA 5IVFA 3T0AA 1VBB3 5FZ3A 3UGFA 4HPKA 1SEFA 1W6NA 2DVFA 3LEMA 4QGMA 1VBD3 4IE7A 5F3GA 3AK0A 3A22A 2WR9A 1ST8A 3AZYA 3RWKX 3T4HB 1YC61 5FY0A 2UY8A 3PNAA 1V9U2 4Q29A 4QHBA 3MW3A 5FWEA 3UKTA 4GZ9A 2D5HA 4PIZA 2IFRA 5FP4A 2BERA 1LOCA 5IAXA 3FWEA 4WZFA 4Q4W1 1Q8SA 1Y7BA 3CZJA 3K48A 4OQ9A 1DGLA 5JCTA 2PHFA 2E31A 5LASA 1JMUB 3WQ1A 4QX1A 5IVVA 4Q2FA 4ATEA 3ILRA 5FYYA 1IS3A 2J1SA 2XQRA 4DOUA 2XPJA 4IEYA 3PVOA 5DAPA 2FZ2A 2TBVA 2UYAA 1UXZA 3LSDA 4KNCA 5CKMA 1HW5A 5C33A 5JR7B 5A33A 2P34A 4FFHA 1H8VA 3PVBB 4TN7A 5B4NA 3K4AA 2RMU1 2B4KA 4Y1XA 4XVHA 3AVSA 1UY2A 4AAPA 3D5OA 3LDKA 3D82A 5CKNA 3AKTA 3IDAA 2NZ9A 1MS5A 2IVJA 3WUCA 1UY4A 2ZGKA 2BJSA 3OG2A 2OW4A 1G9CA 4D7SA 2BGCA 5JSRA 1V0AA 3NNJA 4KU8A 4LO5B 2ID4A 4Q0VA 2OPWA 1JYTA 1EAH2 1D4M1 1JOPA 3A0KA 4EE2A 2OUHA 1RUNA 1W8HA 2VPVA 1W03A 5T55A 4XUTA 1JXNA 3MI8A 1CAWA 1JODA 1UL9A 3WQBA 5HV4A 3LFIA 1VLNA 1TNFA 2YPDA 4W65A 4AOCA 1QKQA 1YIFA 3MUZ1 3CMGA 1UIJA 2WFF1 3OUJA 4OHVA 4MXVA 4PJYA 4FPJA 1AR73 3DPRB 4F83A 3VBRB 3VBSB 4N53A 4AVBA 1K5MB 1RUG3 3ZX7A 4EN7B 2QUOA 2QZ2A 2UWBA 4FPCA 4N90A 1OH3A 4NHXA 3VDBA 1A6CA 2RE9A 2WWSA 3POFA 4WM8B 3OGGA 1QOSA 3NKGA 3VD7A 2AC1A 4IEUA 2D6NA 4MYEA 5IK8A 4HONA 4PDWC 4HG6B 2WJSA 5IHRA 4P9WA 3MLJA 4XUPA 4J1XA 1JZ7A 1H8TA 3T4VA 2JDKA 3NO8A 3POEA 5FFOC 4YZ2A 2XR4A 4FPHA 1UY3A 3WP3A 3O1VA 2GNMA 4AHXA 4Q4V3 3MYXA 2R7EB 3T1MA 1HQWA 4P5YA 5FLIA 5KHKA 2FMDA 3SLIA 3MW4A 5E88A 3J8F2 2GZWA 1WZXA 1RUE1 1AX2A 2BEOA 2YHJA 3MUY1 1CAVB 2RVAA 4K40A 1BK1A 1WW4A 5FY7A 2VZQA 2NYYA 3D0JA 4E8DA 1LOBA 1WCSA 1YQCA 3E5UA 4PHZA 3ACFA 3FE5A 4I3PA 2A6YA 3WHTA 2YFUA 3NNFA 2DTWA 3ON7A 4XCAA 1MS3A 4UF0B 5DUXA 4AFBA 4ATFA 1LHWA 2VO5A 1FXZA 4N43B 3GCXA 3TWIA 3OPTA 5LA9A 1QJU1 2XVKA 1DZRA 4LE3A 5EYXA 1SLLA 1Z78A 5ACA2 4Q4Y2 3V56A 3H42B 1X8MA 3NAPC 1E5RA 2H6BA 5C7GA 3LPFA 5L73A 1VPHA 1OKOA 1XNTA 4AVAA 3UKVA 1GLHA 3I59A 4XBQA 2WLQA 3NV1A 1F9KA 2Y6FA 3GHNA 3ZFFA 3ZYIB 5J98B 1LECA 4XMAA 3BPZA 4AHYA 3RYRA 1AR63 1NE4A 4QX3A 3ZOIA 3S7EA 3H8XA 1MQTA 2B39A 5CFDC 4AFDA 4XMIA 4AQ2A 3AZVA 3BGAA 1CAXA 3WCRA 1JYVA 2VZPA 4UWDA 1HV1A 5FZLA 3QOPA 1NYWA 3DN7A 4Y1YA 4QDSA 3IDEA 3MPPG 3J7LA 1OSGA 4KWKA 3VKOA 3ZYGA 3KHBA 5FBZA 2P17A 3N7KA 3MEPA 5JSPA 2XVGA 1JBCA 4F8AA 3WEZA 1C57A 2VCBA 1NXD1 3I2JA 3KZ4C 5AC93 1PO11 1CX1A 1WCDJ 1SLCA 2VW1A 3E1F1 3H3LA 4MO3M 3TOJA 5BNNB 2C24A 4IW3A 5EJ3A 3VBOC 1PIV3 4EWEA 1W6QA 4FP3A 3KT1A 4GWNA 2W3JA 5F5CA 2X29A 1RUF1 3S30A 2MPFA 2GH8A 2FHRA 3INAA 1XJAA 3CNAA 1VJ2A 2QNKA 4Q26A 4CU9A 1GV9A 1IQAA 5F1RA 2DVBA 2LUWA 2MEV3 2VL4A 4YM0A 1CIWA 1DQ5A 1HKDA 4NIAA 1TME3 1FPN1 1OOPB 2E6VA 2XHKA 3WOGA 5FMCA 5I0TA 4AF9A 1AYM3 2GP3A 1XSQA 1GU3A 4P02B 4UW5A 4YWAA 1ND2A 2ZS6B 3SMHA 1VMFA 4ZY9A 2ET7A 2JIGA 1VBA2 2JXAA 1O8SA 4GWMA 1V00A 3NQHA 2JDMA 5IAVA 2K2SA 1R092 2GP5A 3EBRA 4PDWB 5ANQA 4EQVA 1OQ1A 1UOFA 4MGSA 4CDQC 3AC0A 2W95A 2QTWB 2JG9C 3APBA 3PMEA 4S2HA 2VVDA 1YFWA 4DY5A 2DCJA 4AEDB 1JZ8A 4EROA 3PL0A 3ZM8A 3W5MA 1S2KA 3KF3A 2CDPA 1QY4A 4XZUG 4AFAA 5HBAA 3ALQA 4MGIE 2YGLA 4NPMA 1ZRIA 2AZ5A 1W9YA 1I5ZA 1XE0A 4C1XA 2PQSA 3GF6A 2GC3A 3LQCA 1MS1A 2Y60A 1VB4A 5FQ0A 4RGAA 1PNGA 3AP6A 4KBBA 4A42A 1ZZ9A 5IW0A 1LESA 1DZTA 2ZGQA 2XJQA 5BNPC 2VVEA 2ZEXA 4YVSC 1S2BA 2IXIA 5F3IA 1LODA 3RG0A 1N3QA 1HB3A 1ZZ8A 4CCDA 1AX1A 3H1YA 2RM23 5EFUA 1KQRA 3J7MA 1PVC3 2GN7A 1SDWA 2VMGA 2DF7A 4JKKA 1ODMA 4YARA 2CL2A 4AGVA 1IOAA 1REDA 4RHV2 3R6SA 2OZ6A 3H1WA 4NAMA 2XOMA 4PIXA 5FY4A 2R0FA 3LIGA 3IZOA 5IVEA 1XB9A 1PK6C 2D44A 2B45X 3LCPA 4YGEA 3S0MA 1AZDA 1ZZ6A 1CJDA 1LOFC 4QQHA 1GQGA 4YVWC 4GQ7A 3VLBB 4C90A 1PGW2 1YRZA 3ILNA 3LAGA 3U1XA 1A3KA 3PHMA 4RGKA 4HSJA 4CCOA 4Y26A 2JJ6A 5AFEA 2D43A 4B4QA 5C71A 1AX0A 2ZGRA 1RVF1 2JE9A 4CDWA 4AI8A 4L0PA 2E7QA 2ZGMA 2DFBA 3VL9A 1YI9A 3NL1A 3FL7A 2BUKA 2DDUA 2VU9A 3ZIWA 4BQYA 3V0AB 4K8RB 1X33A 4HVRA 3WG2A 4BLIA 2PHXA 4K3UA 4Z07A 2WBKA 1EUUA 3R4DB 3N9OA 3OPZA 1PO23 2VM9A 1F4HA 5FXVA 2X05A 2ZMKA 5F2SA 4D0QA 1HXS3 1RUI1 2BU9A 1JYIA 1POV0 1J83A 5EZWA 1DFQA 5C8WA 1U5ZA 1OC1A 3UETA 4C91A 2SBAA 3WQ7A 4AI3A 5JZGC 3MF6A 2G9ZA 4XETA 5CG8A 1GSLA 1VBB1 3T09A 1Y4WA 3JQWA 5F9TA 4XUOA 1MPXA 1C28A 2XJVA 3NAPA 3UYJA 2RS11 5C4WC 5FBJA 3WF4A 2WZR3 4CEYC 5JPNB 5T5OA 4EN0A 4ZU5A 5FZGA 3GDBA 2JB4A 1JW6A 2R1DA 4JTOA 2VAUA 4XJ8A 4ARXA 3B9CA 3GZAA 3HJRA 1IG3A 1FV2A 1NG0A 1ZYBA 4N9HA 1GP6A 5K0UB
chains in the Genus database with same CATH topology
4PLNA 1MZFA 4E4DX 2HWB1 3JUUA 5CFDA 4JTNA 3USUB 1C3HA 2HWF3 3RJRA 1AL23 2QDRA 3SITA 3MIEA 2PN5A 2IXCA 1O7FA 2NPIA 1RUOA 1XNKA 2DUQA 1ULEA 1AYN3 2E51A 2VUJA 2B9UA 4HZFA 4UW6A 2PAMA 4DS0A 5J48A 3E97A 4B8EA 3BOPA 3VBOA 1GR3A 2RJKA 1R081 2Y26A 3H7JA 1DQ6A 1GYKA 1QGLA 2ZABA 1SBDA 1RUH3 4XF9A 2HWD2 5H9SA 1QJY3 1LOAA 3MPBA 4FPGA 2AENA 2XBO3 2ZGTA 3H3UA 5KXEA 1CPMA 1XYNA 4CDUC 1ZRFA 1FAYA 2D6KA 4AQTA 2BFUS 4C0HA 3FZ3A 4NO4A 3OY8B 5GLUA 1Q5OA 2DCZA 4DFSA 2D97A 1O4TA 1XNDA 2A70A 3MFCA 2QKDA 3BU7A 1C8M1 1RJ8A 1ZVFA 1M4WA 1A8MA 1V6OA 2VH9A 3OGJA 2JG9A 3JBG1 3URFA 4YGCA 1DQ0A 2RS32 4Q4W3 4P14A 3VBRA 3VBSA 1HRV1 1LHVA 3B9IA 2A6WA 4EN6B 3ASIA 4YSFA 1UCXA 1LGNA 1UAIA 1YLLA 3WDWA 1O4ZA 1YCIA 4WM8A 1D0HA 3KCCA 2HEYF 3PMSA 5BNPA 1O3TA 2RMU3 2RR12 1MS9A 4JRLA 2ILMA 2JDZA 5JWPA 2G9GA 4Z8BA 2D6LX 2OUJA 4B4PA 3IDBB 4LHLA 1PGL1 4BIOA 3H9AA 2OVUA 1AR92 4WM7B 4CDXC 2CYFA 1QQP2 2E7TA 1WGPA 1HV0A 2WINB 2NLRA 1V6IA 3ZSEA 3AYAA 1PK6A 1ULFA 5KXDA 1LOFA 1ZBE2 2V5YA 4YVWA 4BMEA 4JC1A 1MVQA 4PBPA 1MZ6A 4Y1UA 3AYDA 4DRRA 4H55A 4QMAA 2R32A 2CTVA 4FVVA 2WFF3 1LOGA 1ZRDA 1ND3B 3ZMNA 2WLPA 5CFCB 1LU2A 5C8CB 5FPZA 3LA2A 1IS6A 3D0SA 3PJQA 2A3YA 4RQPC 3DUIA 1Y43B 4AHZA 3AFKA 2HWC1 5IT6A 5BUVA 2N7GA 4BIFA 5HI0A 4Q4X2 1MVEA 3VDDC 4AVSA 1XE8A 4YM3A 2JG8C 2XWBB 1JTZX 1IS4A 1S0DA 4XHBA 5JZGA 1QOOA 4XHXA 1W6PA 2A3WA 1GZWB 2D3PA 2O8QA 4XILA 5C4WA 5FO8B 2XGXA 4CEYA 4K20A 4K6BA 1RUE3 3ZFGC 3NJZA 2WS93 3VKFC 4AYUA 2PHLA 4QQ2A 3RI9A 2IXJA 1OHFA 2H0BA 3M8LA 4NVPA 4LHKA 1QJX1 2CWMA 4RR3C 3OYWB 1RITA 5BNNA 1WA4A 4CEWC 1AHSA 1Z7S1 2GC0A 3B94A 1QJU3 3VBFB 3O0WA 1NA1C 3MIDA 2DYCA 4YW3A 4JVAA 4FAHA 2R49A 1RUC2 1O3RA 4LLOA 3B69A 2PAEA 3CF6E 4ISQA 2O8OA 2I07B 5A32B 2P3KA 3CJIC 4IL7A 1DBNA 3WX5A 1EY2A 4Z2WA 3H3ZA 5GZGA 4C1WA 1H4HA 2GU9A 4HT1T 4Y22A 3WXPA 2WT1A 5ABJC 5GZEA 3MIBA 5FLJA 3I8TA 5L36A 1KDMA 4V1PA 3VBHC 2VECA 5E16A 1GNZA 2BBVA 1R091 1ZZBA 4JGZB 3S7IA 4CDUA 2HWE2 4RS5C 1VRH1 3FUQA 4R4XA 1PO13 1O5LA 2IC1A 1Q43A 3N35A 1VBC2 4KL1A 1RGSA 2K9ZA 4W6XA 4Q1PA 1GQHA 1NE6A 2WNUB 4X6RB 1G9DA 2EA7A 5KXCA 1CPNA 3TN92 2DTYA 1GZ9A 1PVC1 5SV8A 1RUF3 1C4RA 5BPXA 2DCYA 1W0OA 1AUYA 2WIIB 1LU1A 5HCFA 1QOTA 3MIHA 2JEMA 1JN2P 1UU6A 2ES3A 3THTA 1FPN3 3ZXLA 3ZFEC 2WL1A 1HLCA 4JRAA 4LO4B 1BVP1 2V73A 2EVXA 1RMU1 1LB2A 1IKQA 2ERFA 5K7PA 5D8AB 4GB32 4JV4A 4HBNA 3AJZA 3WVJA 3WHUA 4RSUA 1W6OB 2B7YA 1NCRB 5GLTA 5I91A 3FBMA 3TBDA 2GN3A 4INDA 1JUHA 3LB9A 1XU2A 2EXHA 5LK7B 5CIRA 4CDXA 1NZCA 3ZO0B 1A8DA 1TNRA 4LA3A 3WP6A 3OBTA 4AI2A 1S0IA 2AREA 3PJYA 3QACA 4BYYA 1OFSA 4QD2A 1WBLA 2OZJA 1L3JA 2HJIA 3Q9OA 3R4SA 4AI1A 4OFGA 4C0BA 2XLFA 2XJSA 2RS51 2C9AA 4AXOA 1ZX5A 2PHTA 1RUJ1 5HCAA 5BNQA 1IZ3A 2LALA 1ZREA 2QE3A 2JE7A 2VUAA 4RQPA 1FV3A 4XFCA 3MGUA 2Q1ZB 2HWF1 4H7MA 1OA3A 4ES8A 3VL8A 4EWDA 4RA0A 4XFGA 4FCAA 2YYOA 2VOWA 1X36A 2JG8A 5K0UA 2DFCA 2ZACA 3WW1A 4H7LA 5A3LA 4JDNA 1V6MA 2JECA 1KS4A 4S2DA 2TNFA 4LO7A 4BQ1A 1RVF3 1TMF1 1VBE2 1H4GA 2BFUL 2VNGA 1YIPA 4ITCA 3VHRA 1NXMA 1CQ9A 4K21A 5JPMB 5E1RA 2XB6C 1E57A 2QJVA 5IK5A 4XJWA 4RR3A 4JAAA 4EN8B 3SCFA 3BB6A 1RUI3 1AR81 1S0FA 4CEWA 2R072 3MF9A 4COYA 4RFT0 1N1SA 4TWTA 1NA1A 3RNSA 4QPIC 1NCQC 4IQPA 4W6WA 1QHDA 1ASJ1 2DWRA 2RS13 3EHKA 1FOD2 3HN1A 1VP6A 4I0BA 5FMOS 1YYNA 2X5IB 2R041 3CJIA 4AWDA 4XJ9A 2PELA 3IN9A 2ZZQA 1QH6A 4Q8KA 2HWB3 5J96B 4XOGA 3KQRA 2VOXA 1URXA 1U5YA 2PLV2 2B46X 3KT4A 1BEV1 3OY8A 4U36A 3ZSJA 3AZWA 5FDBA 4XFHA 5ABJA 5JIAA 1SCSA 3FFQA 2JD4A 4XEZA 4LHNA 5T5LA 4XF0A 3R0RA 3VBHA 1RHI1 1ND2C 3BCWA 1FMD1 1LULA 4M00A 1S55A 4LBOA 4RS5A 1CVNA 2YPJA 3AYEA 4AK3A 2DURA 1LGBA 4CYDA 3N7MA 2ZAHA 4URTA 1R083 4YRDA 2WFPA 4I01A 4YGBA 5L7OC 2XH6A 4ZXKA 2P3IA 1OPOA 3JB4C 1UZZA 4P5HA 2CY6A 2GMMA 4X6QB 2WA4A 2ZKNA 1VIWB 1LTEA 3ZYPA 4QPGB 4ASMB 1JHNA 1G9BA 1J59A 1ENXA 3ZFEA 4PF5A 3JD71 3OCPA 4I2OA 3LZZA 2PHUA 1CD3G 4H3WA 1QXRA 2CGNA 4R9DA 2LTNA 1S0BA 1AR72 1NY71 4M3CB 1C8M3 3NV4A 3QD6A 3RWNA 3HBZA 4GALA 1RUG2 5C9AB 1S1AA 4ZKTB 4TLFA 2GMEA 3JBG3 2YY1A 3LA7A 5GLVA 3ZN6B 1G8WA 3OD4A 4XBLA 1HRV3 4JGYB 4CDWB 1OA2A 2GC1A 2JX9A 2DU0A 1GANA 1Z0HA 1VB2A 3BIWE 2ATFA 2I2SA 2XJPA 1UMZA 1SBEA 2WQZC 4TSVA 2ZGOA 1XNBA 5DUVA 4HFSA 4R9AA 4YYOA 1YJLA 3VGIA 1YNAA 4Q4V2 1ULGA 2ZCWA 4QT6A 2MNGA 2WS91 4PQ9A 2YUEA 1SQ4A 5GZCA 5KHHA 4Z1VA 1ZZCA 4IV1C 4IERA 1ULCA 2PHDA 4WVVA 1ZA4A 2XUMA 5DZEA 2ZTNA 3P3NA 1R1A1 1ULDA 4CP2A 1CX4A 1S0JA 3LWCA 2QFEA 1B35B 1AJKA 2VW0A 4MH0E 1GBGA 2WT2A 3VZOA 1HRI1 4BCUA 4ISRA 1RJ7A 2ZKLA 3WG1A 4RGGA 3RDIA 4EWAA 2YXSA 3AX4A 3JQXA 2A73B 2VNOA 4Q0UA 1AR62 2HWC3 1DQ2A 2W08A 2ZZJA 4UBGA 4EJRA 4WVMB 2EAKA 4EN9B 3CLPA 3RQ0A 4YW2A 4YLZA 4QPIA 1NCQA 2ZHLA 4XF1A 2KXLA 2K0GA 4OI0A 1LHUA 5AC92 3MW2A 3AB0A 1PIV2 1YFXA 2BVVA 1QJX3 2W68A 4NWVA 4AGGA 3NWKA 1Z7S3 2W0XA 2W39A 2WNUA 3ZXEA 2WNEA 2VXRA 1DGRA 2MEV2 2DU1A 4BWOA 4IEQA 1TME2 1V6KA 3TN91 3C2UA 5DDJ1 1N1VA 2HEWF 1AYM2 3EQEA 5AVPA 1BMV1 2R30A 4IETA 4U2AA 2ZBJA 1AF9A 4OZXA 2Q8OA 2NM1A 1LRHA 4M01A 1N3PA 3HT1A 5HXVA 2WNVB 3WCSA 3WDVA 4Q0QA 5L7OA 2X8KA 1DYPA 2XVLA 1KJLA 3DPRC 1BBT1 5D8AA 3VBRC 3VBSC 4DQAA 1K5MC 5T5PA 4GB31 3CJXA 4D69A 3G6JB 3GZTB 5FRAA 4WM8C 4XBNA 5BNOB 2SLIA 1R093 3OF1A 3O7OA 3FFZA 1J3PA 2O0OA 5JAXA 1VRH3 1YI7A 1DGWA 4CDQA 3JCIA 5JOZA 1U5XA 1EYBA 3DV8A 3RSJA 1ENQA 5J36A 5EYYA 4R4ZA 3DF0A 3JZVA 1SCRA 2BTVC 1KDKA 2G9FA 4XJUA 4MX3A 2VQAA 1OKQA 2GAUA 1VAKA 3N3HA 4FPLA 4IEVA 1PNFA 3TB0A 2VMHA 3VKLA 4KG0A 4AQ6A 3ZXKA 5JLVA 4I3GA 4W6YA 1RMU3 4IEZA 1REEA 3BTAA 1HQNA 4K1YA 1MEC1 5LRSA 5KHJA 5CAZA 4QQOA 1XE7A 3GBFA 4N43C 1OLRA 2ZMLA 5GLZA 1LENA 3IDCB 1UF2C 5AFBA 2XJTA 4Y20B 1XRUA 4F3JA 4WBBA 3VBUB 3VV1A 2B8MA 1FX5A 4IV1A 4BLJA 2DCTA 2I74A 4HVQA 4CP1A 1H9PA 5BV6A 1J1LA 4ES9A 1CGPA 1COV1 1BQPA 1PO22 1ZM1A 2ZX3A 1HXS2 4FTEA 1SMVA 2ZA9A 4G9SB 1DQ4A 3SHRA 4QPYA 2VMIA 4PIYA 1F31A 3VZMA 3WINE 4ZU7A 2R0HA 2WZR2 2RS53 4A3XA 1Q8PA 1BKZA 2BVBA 4LBQA 1RUJ3 4YFWA 1BZWA 4BMBA 1WLDA 5BNNC 2OPKA 2H6CA 3MIFA 1DYKA 3WZ1A 4AFMA 4XF4A 5DXDA 3SISA 3HD8B 4Y1ZA 1Q8OA 1RUD2 3N36A 1C1LA 3OJBA 1H1IA 1HX6A 4CTEA 3SH5A 3AJYA 1AL22 3KMHA 2CV6A 1V9U1 3DGTA 3ZXAC 5KC5A 5KHIA 3KGZA 2JKBA 1OOPC 4IV3B 1TMF3 2HEVF 2PLV1 1AYN2 1ZNPA 3B5LB 3UJOA 1V70A 3V65A 4FPEA 3TAYA 1YO8A 4I0AA 4QX5A 3THPA 1EV12 1ZZ7A 1MZEA 3S6PA 1C1FA 1ENSA 1TE1B 4AHWA 4FQZA 4M3CF 2GMPA 4FTBA 1KFUL 2Q30A 1LEMA 4FOQA 3NVCA 4GH4B 1RUH2 1V6NA 4HL0A 2A6XA 3RJ2X 1IHMA 1QJY2 1AR83 4FO9A 1AVBA 2ARBA 2NQYA 1MACA 4PDWC 3WUDA 4DNYA 4Y5Z0 2PHWA 4AEDC 4COWA 1KS5A 2ZJCA 4PLOA 2XBO2 3CEWA 5I0SA 2E63A 1UPSA 3L2YA 1ASJ3 1I3HA 1WMFA 4KGGA 2ZX1A 2D3RA 3ELNA 1IKPA 5LRRA 1Q8VA 1EAH1 1QWRA 2R043 1UD1A 3MLLA 1G6NA 4J1WA 2PFWA 5CBLA 2WKKA 1W0PA 1FI2A 5JOXA 2F4PA 4HANA 4AG4A 4Z92B 2R1BA 1BEV3 2RHPA 3DPRA 1QF3A 5BYNA 1K5MA 1AXZA 3O14A 1UPIA 4Q4W2 4M3CA 4DRVA 2AGSA 5DUWA 4AI0A 1QNYA 2ZAAA 3O12A 1PM7A 5C9AA 1RHI3 4BPZA 4ZU4A 1FMD3 2PA7A 3ZN6A 3A0NA 3ZIXA 4CRQA 3V0BB 3AP9A 1H0BA 2D3SA 2PQQA 1OPMA 3UL2A 2DVGA 1F5FA 4B7KA 2RMU2 4YZ1A 4FT8A 5A33B 3TNPB 3AP5A 1XU1A 2Y0IA 2GALA 4OUMA 3NKTA 4OULA 3SH4A 1CR7A 1WUVA 3ACLA 4F7ZA 1CAVA 3J8F1 3MFAA 4D3WA 1D4M2 1DIWA 2DUOA 3AP4A 4FQ4A 3TYJA 3JD73 1Q3EA 4XIOA 1X8EA 1DGWX 3HAGA 1CAWB 1QU0A 4N43A 1MS8A 2WFF2 4FPOB 1B35A 4XXPA 4MV2A 4SLIA 5ACA1 5I0RA 4Q4Y1 1REFA 1BCXA 4N53B 2R062 1W2UA 4YGDA 3WD5A 1YFYA 3NW4A 4GKYA 5K0UC 1OMIA 1UKGA 4NN0A 2Z2SB 5KHGA 2XLGA 3T2TA 4XFAA 3FLRA 3WP5A 1NQJA 4AE2A 1H8TB 5J7MA 1WW5A 3E5XA 2CWSA 1D0GA 1RL3A 3WP4A 4WVMA 4G4FA 4OI1A 2ZHNA 4OI4A 3VZKA 1RUE2 1SFYA 3ZPYA 4AQSA 3N4MA 5FOBB 4FAGA 2QVSB 2R16A 3WDXA 1D2QA 2QCSB 5KC6A 4E27A 4RD7A 5L19A 4TZDA 4LBNA 4JCKA 1R1A3 4QQPA 3LKJA 3N7LA 4BM8A 3KGLA 1RTVA 3KM5A 1V6LA 3ZDSA 1MS4A 2VQ0A 4LE4A 1QJU2 3ZVXA 1HRI3 2ZGPA 3AMPA 3M3CA 4JDOA 5GZFA 1OOPA 1B09A 2A6VA 1DQ1A 1G9AA 3ZSMA 3I59B 3TNQA 3VN4A 5E89A 4YZ3A 3RZZA 4I02A 3ZFFB 3VHPA 3EO6A 1DZQA 1Y9QA 4LBJA 4QGLA 3FLTA 4GULA 1MQTB 5F5QA 4DINB 4PDWA 1VBA1 4LLFA 4HSLA 2WNVA 4AEDA 1H9WA 2XL9A 1ONAA 1YXWA 2GNDA 4L9BA 4A2UA 5HCBA 1SFNA 3DKWA 2F6BA 3B02A 1PMIA 1PO12 3ZN5A 3KT7A 3AZZA 3I4IA 4FP2A 3VZNA 4BH9A 3AKQA 4GIQA 4NPRA 3IM0A 1RUF2 4JDMA 1GNHA 3IT8A 2Z5WA 2YV8A 4HLTA 3U07A 4YW4A 2YZ4A 2YMZA 4MXWB 4WM7C 3WV6A 5JOYA 4QM8A 1FPN2 3TN93 4ONUA 5DDJ3 5H9QA 1IS5A 2P2KA 4RHV1 1NLRA 5J09A 4BA6A 2BYVE 1RINA 1PZ9A 2EF6A 2ENRA 2Z79A 1PGW1 2UYBA 4GMP1 4HMZA 2V09A 2P3JA 1KITA 3LOBA 4LBQD 1CN1A 1SACA 1ND3C 1BBT3 4RL7A 5CFCC 4KGQA 4XF3A 4Q27A 4YNIA 2A3XA 4GB33 5C8CC 1H2KA 3VUOA 1TQ5A 2OA2A 3I7DA 1LJ7A 1U12A 3V0AA 3JU9A 3WDTA 3RMYA 4B3NA 2JENA 3AMQA 5LK5A 4NHKA 2Z42A 5T54A 3RYKA 5T5JA 4FXKB 3O0XA 1NOVA 5JVVA 4E4ZA 1WD4A 2XG3A 3HWJA 3BALA 3D6EA 2XL7A 1IGOA 3U0ZA 4Q0PA 4AGRA 3PTYA 2B5HA 2GC2A 4XDQA 1N47A 1FT9A 4J6GA 4N9IA 1ZBA2 3M3QA 1WW6A 1MEC3 3UK9A 4E2QA 3KCYA 2ZGSA 4FPYA 3USUA 4LO8A 4G3YC 3MIGA 3VBFC 2YDEA 4LULA 4CP0A 4BZ4A 2ZMNA 4P9LA 2Y38A 1RUD1 1RVF2 3AFGA 3M4FA 3USSA 5GLWA 1EPWA 4HK9A 4AVTA 5FREA 2RJLA 2VY0A 1FATA 4HK8A 5EV7A 1D4VB 3R05A 1COV3 3P3PA 4KU7A 4XFBA 1BYHA 1RUI2 1UW8A 4X8NA 5CNAA 3H1MA 1EV11 4Q0SA 2Q4SA 2VNRA 2HWD1 1VBB2 4HKLA 2BWAA 4XTMA 3M3IA 5DZFA 3ZXFA 1NQDA 2RS12 4KG8A 4Y4YA 1VBD2 3SH3A 4L97A 5CA6A 4X8PA 3NAPB 4JGZC 1A78A 2Z69A 5KBFA 1APNA 3FJSA 4LUMA 1OA4A 4M3CE 2WNUC 4I0WB 2HWB2 3LSEA 4WVWA 5I8SA 3M3EA 3HIFA 5CFDB 4FXGB 2D98A 1CESA 3L2HA 1HDKA 3B3QE 1V9U3 4FSJA 5J37A 2ZX4A 1F5JA 1DGRN 4XJAA 2PLV3 4FPFA 2RS31 1VAVA 3PVNA 3QH6A 4R8HA 3DL3A 4XJZA 1UU5A 2DVAA 4UW3A 2DV9A 1XXNA 2HKXA 5D8AC 5BY5A 1R082 4YZ4A 3U11A 3VBOB 3V0BA 5FAXA 1ZRRA 1NCRC 2D5FA 2YGMA 3O5SA 2ZGUA 4IEWA 4AW7A 5EWSA 2QDNA 1C5IA 4YG0A 2RR11 3C3VA 3FHIB 1V6JA 4NWWA 2AUYA 3VZLA 1WBFA 4WM7A 2XKOA 4XFIA 1AR91 2AYHA 1DLLA 3CU7A 5DG1A 4OHZA 1QQP1 1QXPA 4FOWA 1EAH3 1AXYA 1JYCA 1ZBE1 3ATGA 3ROUA 1G9FA 2C5DA 3V64A 4COVA 1C8M2 4LA2A 4BE3A 3MZHA 3GBWA 2EAAA 3MLKA 3LA3A 5GALA 3EXUA 3AP7A 5TSWA 1ND3A 3M7AA 5CFCA 2WSVA 3ZXDA 1KRIA 3JBG2 4CDQB 2JG9B 3ZSLA 5C8CA 1O91A 1HRV2 3WR0A 2VOKA 4LUKA 3J9SA 3KCXA 4XIKA 1YUDA 4YZ5A 1W6MB 2Q1MA 2R061 2ZHMA 2QZ3A 4MUVA 2ZX0A 1J3QA 4Q4X1 5BNPB 2GDFA 4YVSB 1J58A 4L92A 2VVFA 1DU3D 1QXJA 3KS7A 1GZWA 4XTPA 1PGL2 5DZGA 4UXAA 4XZPA 1UIKA 3WW2A 3D4KA 3J8F3 2ZX2A 2VOVA 5KWRA 2NMNA 1S0EA 1FNYA 1PK6B 3OYWA 1SLBA 3VHNA 1DDLA 4YVWB 5BXXA 5JOWA 3IPVB 4DPNA 3VBFA 5JDBA 1PVXA 5FLHA 5A3MA 5ACA3 4AEKA 1QH7A 4Q4Y3 5D1IA 1JUIA 2Q5TA 3N7JA 3H0OA 2WA3A 2A75A 1RUC1 2X5IC 2HWC2 4YG6A 5A32A 4KH9A 4SBVA 3X29B 2B42B 4CZSA 1H2LA