3FBMA

D431n mutant vp2 protein of infectious bursal disease virus; derived t=1 particles
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
433
structure length
428
Chain Sequence
TQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVANLNSPLKIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Autoproteolytic Activity Derived from the Infectious Bursal Disease Virus Capsid Protein
pubmed doi rcsb
source organism Avian infectious bursal disease virus
molecule tags Virus
total genus 94
structure length 428
sequence length 433
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fbmA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3fbmA02
4RS5C 1AR71 2WFF2 4RQPB 4RS5A 1VBA2 4N53C 3JBG3 4N53A 3JD72 3TN93 4RHV2 4Q4V1 1AL22 1MEC3 5ACA3 5AC93 4RHV1 1QJY1 3HAGA 1AL21 1TMF2 1RUC2 1FPN3 4CDQB 2QQPA 1AR73 3VBFC 1TMF1 5K0UC 1RUC1 1C8M2 3VBFA 5K0UA 1A6CA 1ZBE3 4JGYB 1HX6A 1HRV3 1RVF1 4RQPC 1BMV2 4RQPA 4Q4V3 3M8LA 1R081 4RHV3 1QJY3 4CDXB 1GFF2 2RR11 2DF7A 5ABJC 1AR62 5ABJA 1AR61 4Q4W2 1EAH3 4RFT0 2WS92 4CDQC 1E57A 1HXS3 1RVF3 5C8CB 1AL0G 1QJU3 4CDQA 1DDLA 1R083 4GB32 4IV3B 4WM7B 3ZFGB 1QJX1 4JGYC 1BEV2 4Y4YA 1VB2A 4JGYA 1QQP1 2RR13 1BEV1 1WCDJ 1VB4A 1B35B 2Y26A 5FOJB 4CDXC 1RUF2 3ZFEB 4CDXA 1RHI1 4PDWC 4FTEA 1NY72 1TME1 1VBE1 4PDWA 1ASJ1 1QJX3 1W39A 4QPGB 3VBOB 4GMP3 5CFDB 5C8CC 2XPJA 2HWE2 1NA1C 1QQP3 1HRI2 4Q4X1 2MEV1 2X5IB 5C8CA 1Z7S1 1NA1A 1PO12 1X33A 1PVC2 1HRI1 3IDEA 2HWC1 4IV3C 4WM7C 3ZFGC 2WZR1 2PLV2 4IV3A 4WM7A 3ZFGA 1RMU1 1RHI3 1FOD3 1VBE3 1TME3 1B35C 1C8NA 1EV12 5GKAC 3CJIB 2HWF1 1ASJ3 1RUD2 1B35A 1EV11 3ZFEC 4CEWC 1R092 3ZFEA 4Q4X3 2MEV3 4CEWA 1Z7S3 2TBVA 5DDJ2 2R072 2HWC3 1BBT2 4QPGC 3VBOC 2WZR3 2R071 5DDJ1 5CFDC 1BBT1 2BFUL 1ND2B 4QPGA 3VBOA 1CJDA 1RMU3 5CFDA 1IHMA 2X5IC 4FTSA 1RUJ2 2X5IA 1AYM2 1RUI1 4Q4Y1 2RS32 2HWF3 2WFF1 1AYM1 2HWD2 1VBA1 4RR3C 2BPA2 2HWD1 2RS52 2XBO2 5A32A 4RR3A 2RM22 1VBC2 3JD71 1VBB2 3CJIC 5C9AB 4CDUB 2R043 1AYN2 1VBB1 3CJIA 5L7OB 1RUI3 4Q4Y3 2WFF3 4Y5Z0 1AR92 1C8M1 1ND2C 1VBA3 1COV2 1ND2A 4N43B 5LK7B 2HWB2 4BCUA 4NWVA 2RS12 3JD73 2RMU2 1R1A2 2RMU1 4IV1B 1BMV1 3ZFFB 1AL23 4FTBA 1PIV2 1RUE2 1PIV1 2FZ2A 1TMF3 1RUC3 4GH4B 5J98B 4CDUC 5C9AC 4Z92B 5C9AA 5L7OC 1C8M3 4CDUA 5L7OA 5BNOB 1QJZA 4Q4W1 2WS91 4AEDB 3DPRB 4NWWA 4CEYB 5D8AB 1HQNA 4N43C 4GB31 1VAKA 4N43A 2ZAHA 1MQTB 1NG0A 4IV1C 4JGZB 1AR63 3FBMA 3NAPB 3ZFFC 5BNNB 1M06G 2ZTNA 4IV1A 1VBD2 4Q4W3 3ZFFA 2WWSA 2WS93 1RUF1 4GH4C 1PGW2 1PGW1 1NY71 5BNOC 1OHFA 4GB33 3VDDB 5BNOA 4AEDC 1BEV3 3DPRC 2R062 4CEYC 1SMVA 1H8TB 1AR82 1RUG2 5D8AC 2HWE1 4AEDA 3VBHB 3DPRA 2R061 4CEYA 5D8AA 1AR81 1X36A 1PO11 1PVC1 5BNPB 1RUF3 2PLV1 1MQTC 4JGZC 1MQTA 3NAPC 1FMD2 1VRH2 4JGZA 2BFUS 3NAPA 1FMD1 1D4M2 1RUD1 1ZBA2 1RUH2 1R091 2HWE3 4RS5B 1ZBA1 1HRI3 1RUH1 1PO13 1PVC3 5FMOL 3VDDC 3VDDA 2PLV3 1H8TC 3VBHC 3JBG2 1H8TA 4FSJA 4YVSB 1RUJ1 1EV13 1ND3B 2RS31 5BNPC 1RUD3 3TN92 1OOPB 5BNPA 1R093 1CD3G 3TN91 4YVWB 1MEC2 5ACA2 5AC92 2RS51 2XBO1 2RM21 1VBC1 2R073 5DDJ3 2GH8A 1BBT3 1FPN2 1AYN1 1AR72 2FZ1A 5JZGB 1NCQB 1RUJ3 1ZBE2 1AYM3 2RS33 1HRV2 1ZBE1 2HWD3 1AR91 2BUKA 2BBVA 1HRV1 1COV1 4Q4V2 2RS53 2XBO3 5ABJB 1QJY2 2HWB1 4YVSC 2RM23 1VBC3 1NCRB 1ND3C 1VBB3 2RS11 4LLFA 4YVSA 1R1A1 1AYN3 3JB8A 1ND3A 1OOPC 1OOPA 4YVWC 1EAH2 4YVWA 1RUE1 2ZZQA 1EAH1 1PGL2 1HXS2 1RVF2 1AR93 1QJU2 5JZGC 1PGL1 1NOVA 1HXS1 1COV3 1NCQC 1QJU1 1R082 5JZGA 1AUYA 1NCQA 2HWB3 1K5MB 2RS13 3VBUB 2RMU3 4EJRA 5J96B 1R1A3 2RR12 1PIV3 4PDWB 1RUE3 4QPIB 1NCRC 1NCRA 5CFCB 4GMP0 1NA1B 1VBD1 4SBVA 3J8F2 1QJX2 4GH4A 3J8F1 1OPOA 1QQP2 4GMP1 5C4WB 1V9U2 4WM8B 4CDWB 1K5MC 1V9U1 3VBUC 1F8VA 1F2NA 3VBSB 1K5MA 1POV0 1RUG1 3VBUA 5A33B 1RHI2 4CEWB 1FOD2 1VBE2 1TME2 1VBD3 2VQ0A 4QPIC 1FOD1 3VBRB 1ASJ2 3JB4C 5BNNC 3J8F3 4QPIA 5FMOS 5CFCC 1POV1 5BNNA 4Q4X2 1RB8G 2MEV2 5CFCA 1PO22 1VRH1 1Z7S2 3LOBA 1D4M1 1PO21 2HWC2 1V9U3 2WZR2 2R063 1AR83 1RUG3 4N53B 1RMU2 5C4WC 5A32B 4CDWC 4RR3B 4WM8C 5C4WA 3ZXAC 4WM8A 2HWF2 4CDWA 3VBSC 1POV3 3VBHA 3VBSA 3JBG1 1FMD3 1VRH3 5A33A 1D4M3 1PO23 3VBRC 1ZBA3 2R042 3VBFB 1RUH3 4Q4Y2 3VBRA 3S6PA 5K0UB 2R041 1MEC1 5ACA1 5AC91 2GSYA 2WLPA 1RUI2 2IZWA 1FPN1
chains in the Genus database with same CATH superfamily
1GZTA 4GKXA 3HN3A 1LOFA 4CXWA 1VBA2 2WQ4A 5T50A 3RI9A 1W8NA 5IFPA 4IDZA 4AEMA 1KJRA 1JZ3A 4ONUA 4N53A 4YZ2A 2L9LA 2WUHA 4HK9A 2K9ZA 3Q8EA 3WF2A 1UMHA 5DN2A 1LRHA 4Q4V1 4LQRA 4MGQA 1NZIA 4HKLA 4O65A 4OQ9A 5AC93 3ETPA 4NROA 1QJY1 3HAGA 4M00A 5KC5A 2FDFA 2ARXA 2JG8C 5A7PA 3LA2A 2BV4A 1DZRA 4CDQB 1FPN3 4PT6A 2QQPA 1WLTA 1YIFA 1AR73 1JU4A 2CNAA 2W52A 1W0NA 4XIOA 5K0UC 1APNA 1C8M2 4HKWA 3VBFA 4FPYA 4UAPA 2BBAA 3E6BA 2G1MA 1A6CA 3D8CA 4JGYB 1QGLA 2DU1A 3RJ2X 1GOHA 1HRV3 4ISRA 1AF9A 3RWKX 2QUOA 3K4AA 4HVOA 4XPVA 3E6CC 3HD8B 4RQPA 3ZYIB 1SBFA 4RHV3 2UURA 4FPEA 4QPYA 5CADA 1W28A 1V6MA 4UI9L 3DECA 4EN6B 3FC0A 3SITA 3M3QA 3ZSEA 5B2GB 1UZZA 3WQ0A 2PAMA 3O0WA 1BLZA 1D2SA 4IERA 1O8PA 4LK7A 1AR62 3WEZA 5A6XA 1X82A 2XGXA 4LBMA 1AR61 3CO2A 1EAH3 4QT6A 5FPAA 2IXJA 2YBPA 2O8QA 4XUPA 1YI9A 3B69A 3MZHA 3B9CA 4CDQC 1SCRA 1CESA 1E57A 4NHLA 2OQ6A 1AL0G 1OFSA 1QJU3 4AE2A 1DDLA 2FD8A 1XBFA 1UNBA 2D6NA 3RJRA 5A7WA 5I8YA 3A0NA 3FHQA 1UW8A 4JGYC 2BNMA 3N7JA 1VB2A 1LGBA 5CG8A 4FFFA 3DN7A 1UPSA 1GP4A 2E6VA 4LHKA 4ZONA 3SH4A 4AFBA 4KBBA 2ZGUA 1UN1A 5H9QA 3CEWA 2ZX1A 3ZX7A 3IPVA 5HV0A 1WCSA 3PVNA 3ZFEB 3OSDA 4CUCA 1OD5A 3IDAA 4OCTA 1DQ5A 1AX2A 1RINA 1RHI1 3SNMA 1CAUA 4FXKB 2G9FA 1NY72 1TME1 1VBE1 2VTXA 1OURA 4COVA 4QB1A 2TEPA 3ACFA 1S4CA 5A3NA 4QPGB 1W39A 1PK6A 2C9AA 2GMPA 2V72A 3M3EA 1DGWX 1YI7A 2HWE2 1NA1C 4TZDA 2Q8CA 4Y22A 3SCHA 4O61A 1KQRA 2J1UA 1Z7S1 2D6MA 2OIIA 4FPFA 1GWLA 5IAXA 1DBNA 4M3CF 3R4UA 5LASA 3TWIA 1CAWA 1CZSA 3WVJA 2JG9A 1YUDA 2VCMA 1N3OA 3POIA 4IV3A 1UY0A 4WM7A 3MYXA 5FZ1A 5LRRA 3ZFGA 1HKDA 1XNDA 1JOPA 4UW6A 4UOJA 5FUIA 2PHDA 3WINE 2WYSA 5FY1A 4B4RA 4D6QA 2LW8A 2W91A 4BHPA 4CZSA 2YY1A 1UL9A 2HWF1 4E4DX 1NLRA 3FBYA 2ET1A 5GLUA 2OKXA 3ZFEC 3LDBA 3HNMA 5IVBA 4E9KA 1ZRCA 2VNGA 4D69A 1CX1A 3WG4A 4CEWA 4IGOA 1RXGA 3LCPA 3M1HA 3M4FA 4RA0A 5FAXA 3B3QE 5FZ3A 3WP5A 1BBT2 3IIIA 4QPGC 2EAKA 2W92A 5LA2A 1QIQA 3NO8A 1V0AA 3VV1A 5JDBA 1BBT1 3OGRA 4GKYA 4BQXA 2DDUA 1ENSA 1S2KA 1GV9A 3M70A 4HT1T 4MGYE 3H3ZA 4OUEA 4Q5OA 4Y3OA 3OYWA 2R1DA 4MLOA 3NMBA 2NMOA 4UYBA 4OHVA 4YG6A 2WFF1 2AR6A 1H0BA 4TWTA 2HWD2 4NPMA 4XFAA 3WUDA 5KXDA 3NW4A 1GZ9A 1J3RA 5IK5A 3THPA 3NJYA 2HWD1 4ZXEA 5A70A 4LLOA 2VMFA 1PX4A 4DY5A 2ZEZA 2VOKA 5LB6A 2ET7A 2VGDA 4P08A 1B09A 2HJIA 2AC1A 5A3PA 4X6QB 3L2HA 2FCVA 4NN0A 5FYUA 4CUBA 2Y6KA 4CCOA 4A4AA 1URXA 4XZUG 1RUI3 4CU6A 3I97A 2IXCA 3U11A 2XJSA 2K2SA 3O5SA 4QM9A 4AVVA 4PCRA 1AR92 4O9GA 4EZ4A 3EXUA 3WR0A 1UOFA 2VMDA 4Q0SA 3GYDA 4ES9A 1ND2A 3E5UA 3HMYA 4OYUA 3U4SA 5A1FA 5T3NA 3O1VA 3LSDA 5FXWA 2ZEYA 4SLIA 3E5QA 5I91A 1ENXA 4IGPA 1QJEA 4LO4B 4KL1A 3BB6A 4R9CA 3WDVA 4CRQA 5E16A 5F5CA 5FPUA 5C8WA 2QTWB 5JSPA 4EE2A 3TRSB 4A7KA 1RUC3 1ZX5A 3PTRB 3ZDSA 3ZIXA 5FK7A 2VOVA 3I2IA 5FZCA 2GN3A 3CMGA 4CDUA 5A3TA 1WKYA 4H7LA 5BNOB 4QX8A 2LUWA 4AG4A 1JBCA 2WS91 4EROA 5FQ0A 2IFWA 3AYDA 3ZPOA 2RVAA 2GC2A 2HEYF 3LPGA 1QXPA 2EALA 2VZ3A 3V64A 3I2DA 4RN5A 5JXIA 2WR9A 1RTVA 1UXXX 5K4LA 5C3QA 4GB31 1GU3A 1O7FA 5FZ6A 4Z1VA 2BW8A 5DAVA 5IW0A 2QQNA 3AYCA 4B3NA 2V09A 2B45X 1MS8A 2ZAHA 4LHSA 1YLLA 2PFWA 3N7MA 4FXGB 3B9IA 4MZUA 3O1SA 1VLNA 1I3HA 3KV6A 3NAPB 4QQHA 5IVJA 1NQJA 1KRIA 4MOAA 1CPNA 1W6NA 1XQNA 1DLCA 2X05A 2UWBA 3CLPA 3OBAA 4JC1A 4Q4W3 2BGCA 4YM1A 2ATFA 3ZXGA 3WW4A 1FX5A 4CCJA 3ZYFA 2Q1FA 4KU7A 2HH9A 4P00B 3TYJA 5DMYA 2J1EA 4QGNA 5DXDA 4AAXA 1YJLA 3AJZA 3FUQA 3O1PA 5BNOC 4A45A 1IG0A 3ST7A 5A3OA 3ZR5A 4Q1PA 3H7YA 1U12A 5FZ0A 4DRRA 2ZX0A 5CNAA 3W20A 1QDOA 1WCUA 3LA3A 4KI5M 3E5XA 2PHXA 3N7LA 1OA4A 2YU2A 3OJBA 4AEDA 1CWPA 2DBNA 3PJQA 4OVEA 2WA3A 3DYPA 5EJZB 1FATA 5C3SA 3AB0A 1AVBA 2PLV1 1GZWB 1YRZA 3CL1A 4D3WA 4XHBA 1DHKB 1MQTA 3NAPC 1WLDA 3N9OA 1SDDB 4IW3A 3AK0A 4JGZA 4AQSA 5IVFA 3IMNA 4D0QA 1Y9QA 3AYAA 3GZTB 4YZ5A 1F4HA 1RUD1 4AHYA 1H1AA 3T1MA 4JQRA 1R091 2D3SA 2XVGA 4OULA 4RS5B 4ZPIA 3UV9A 4LTAA 2DURA 2VXRA 4P5HA 1PO13 1PVC3 2ADEA 2QNKA 2W2IA 3FLTA 5T5JA 3FJSA 2YBKA 4B4PA 3FL7A 3JU9A 1ZRFA 3U10A 4BQ4A 2QBXA 4ZU4A 1W6OA 4IEVA 1FV3A 4XDQA 1UOBA 5JOZA 2C4XA 3R0RA 4QX5A 4B1MA 4YVSB 1RITA 1O4ZA 1RUJ1 1POQA 4XF4A 5L36A 1WLWA 4XBLA 2YG0A 1BXHA 3SEPA 1Z0HA 5ERLA 4AQ6A 1CD3G 4HMZA 4QKFA 3BGAA 3USUA 5AC92 4XACA 1HN1A 2XBO1 3IB3A 3VHPA 3NRUA 1G6NA 2QQIA 4DZGA 2GH8A 1FPN2 5E6HA 1E5RA 1AR72 2YUEA 4MXWB 4L99A 5T55A 4FAGA 2ZKNA 3POFA 2H6CA 1X7NA 2P3KA 4NUBA 4Y20B 1LEDA 1UOGA 2R0FA 2E9QA 5FZGA 3H50A 4QX3A 2RS33 4ES8A 1CIWA 1YC61 1HIXA 1HRV2 2WIIB 3GZEA 3E1F1 2BUKA 2BBVA 2WAAA 2H0BA 1UYPA 1HRV1 1U0AA 1Q8PA 3GCXA 1KITA 4YVSC 1YJKA 2RM23 1VBC3 3FZ3A 4JCKA 2W87A 5IYYA 1ODMA 5HCAA 3HT1A 5FYVA 1LU1A 2D44A 1AYN3 3JB8A 4Y5TA 3KCYA 5A1LA 1MS3A 2JE7A 2NMNA 1PM7A 1OOPA 2I74A 1NZCA 2XL9A 4LULA 4BXSV 2G4IA 1IQAA 5LCWL 1EAH2 3P3PA 1RUE1 2ZHNA 2X53S 2Y38A 3FFQA 1EAH1 3AKTA 1YWKA 2YGLA 4W6YA 3KT7A 3H7JA 4BQWA 1L7RA 1QJU2 1UZYA 2P17A 1COV3 2W08A 3N9NA 3CIHA 1QJU1 4UW4A 4PBOA 2GC3A 3Q8FA 1AUYA 1KS4A 4YGBA 4YWAA 2D6LX 1RC6A 3K51A 3I3QA 4QDQA 5K8SA 3MUY1 2WNVB 1Q8SA 1WMEA 2E31A 4FPGA 1DGRA 1PIV3 1XC6A 2VECA 1CAVA 4QU1A 4PDWB 4Q0VA 5HCBA 3H8RA 3VZMA 1C1FA 3LZZA 3U75A 4Q8KA 4M0NA 2NPIA 4QKNA 1NCRA 2JJ6A 2X8KA 3DL3A 3U1XA 4BQ3A 4KGQA 5JI7A 5F8PA 4LE3A 2E7TA 4BA6A 2Y34A 4ISQA 2P3JA 2O0OA 4ZHNA 3J8F2 1YFXA 1JZ7A 3AFGA 2YXSA 2K0GA 2UWAA 4TSVA 5DZGA 3N9PA 2GH2A 2VZTA 3J8F1 4YARA 3DXTA 4I0BA 2Y60A 4Y26A 4PIZA 2MNGA 3RZMA 5C4WB 1ULPA 4YW7A 4JVAA 3ZSKA 4ATEA 4B7EA 5CKMA 3I54A 1UOJA 2I2SA 1S0BA 2LM3A 4XJ9A 1CGPA 1AX1A 3VBSB 1QDCA 4GJYA 1H2NA 2WNVC 2YDEA 5FP4A 1GYKA 2ZHKA 5I0TA 5SV5A 2VNVA 1XYOA 1Z78A 2WT0A 4H55A 4NE9A 3NKGA 3BU7A 4OHYA 2VMIA 3VBRB 3AMHA 4ZS2A 1XB9A 3N9QA 4LBQB 4QPIA 4OUSA 4GZ9A 4L92A 1V00A 1DGRN 1RB8G 5CFCA 1VRH1 1Y9MA 5J7MA 1UYXA 1QMJA 1D4M1 4HK8A 4N8MA 4FFGA 4HG6B 3URFA 2OQ7A 2A6ZA 1NLQA 2EF6A 1W8TA 5J48A 2Q4SA 1AR83 1CVNA 3VD5A 5CAZA 1BVP1 1QKQA 2A71A 1O3RA 5C4WC 3MIGA 2BQPA 1BYHA 1GOGA 3GNEA 1QOTA 1CAXA 4ZZ8A 4C0HA 2DVDA 2WDBA 4WM8A 4CDWA 3MFCA 1W2NA 1XNCA 4RYDA 3VBSC 3MF6A 1V6JA 5DUUA 1HB2A 4JQTA 5FV3A 1OQ1A 3FUOA 5AVAA 2RJ2A 5LA9A 3VBHA 3T1LA 3JBG1 1FMD3 3WT3A 1LU2A 2OX0A 1NE6A 3C2UA 5F3CA 2BVVA 1PO23 5FBZA 4LUKA 3VBRC 1W6PA 3TOJA 3UYJA 1FT9A 1W04A 1OQEA 5IT6A 1UZVA 2GMMA 3UGHA 1IPKA 3JQWA 3ILFA 4QKDA 2CWSA 5EJ1B 2VXJA 2GSYA 3VKOA 1BJQA 1N1YA 2WLPA 5T52A 1RUI2 4L8QA 4YG3A 3T0BA 3UNPA 5L19A 1O3TA 2AUYA 1UQXA 4MGTA 5H9PA 1T2XA 3OPWA 4XHXA 4YZ3A 4AGVA 1F9KA 4ATFA 4LIUA 1IKQA 4Z2AA 3O7OA 2VL4A 3N9LA 4WZFA 2ILMA 3EMRA 4EWAA 1W6MB 3VZKA 4IEUA 4UFLA 1LAJA 3TN93 1DG6A 4XABA 4Y1ZA 2ZXQA 3R6SA 1K12A 1JUIA 1H8VA 1G9BA 4DY3A 2W46A 2YC2A 3H1WA 3BN6A 1OC1A 3J7MA 3K3OA 4IE7A 1HB1A 1RUC2 2E33A 2QKDA 2JG8A 4LOSA 2DUPA 1LNSA 5I8TA 1HJFA 1RUC1 1OLME 1E5SA 2JWPA 5K0UA 3U14A 1OLRA 2OXBA 3AP6A 2RDSA 2WLQA 4H7MA 2GNMA 4FPJA 1IQDC 1Y4WA 2WNEA 3FN9A 3L2YA 4R52A 5LY1A 3KM5A 1RVF1 4QX2A 4OMCA 4O9EA 1MS9A 5FLIA 3ZN6B 3KHCA 2WSUA 1C57A 2FDKA 1BMV2 2DU0A 3AM2A 4X8NA 2OYZA 2D43A 1DU3D 2GN7A 3HQXA 4LA3A 2DCTA 3PUIA 4LEJA 1UMIA 3K2OA 4KG8A 5FYYA 3DEMA 4CP1A 1O3QA 2VC9A 1GFF2 1UX6A 3ACHA 3CBNA 1X8MA 2RR11 1J3PA 2DF7A 4LJHA 4A44A 4CP9A 5ABJC 5BNQA 5FPXA 2Q5TA 4Q4W2 4BM8A 1S0CA 2PXJA 3J7LA 2DCZA 4K7JA 5FZOB 5T5LA 1O59A 3EBRA 4KH9A 3T2PA 5C8CB 5A6YA 4CDQA 3FWEA 5JOWA 1JZ8A 2WJSA 4L0PA 2PN5A 2ZGQA 3RNSA 1KDMA 4UBHA 1R083 1UKRA 3DKQA 3C7HA 2XB6C 1QJX1 2BRTA 1RL3A 3VB9A 1JYWA 3D0JA 4LHLA 3MGUA 5DUXA 3VZNA 4JGYA 3HT2A 1QQP1 4MUVA 3AKSA 1AHSA 1F5FA 2VBDA 3RFRA 1HW5A 1V70A 3AP9A 3GZUC 1NXD1 4K21A 3U0ZA 1G9AA 1H9PA 2WN3A 1LOCA 1MVQA 2UYAA 1L7LA 4LBKA 3IAQA 3S7IA 4OQ8A 5F32A 4BQ1A 1N1SA 5C3RA 4MVTA 3B00A 4QGMA 4I3PA 2JKXA 5JXGA 4UFKA 2Z5WA 3IM0A 4YGDA 2OVUA 1MS1A 4FTEA 1YQ8A 3DKWA 1Q43A 3HQUA 4K40A 1YNAA 4FFHA 4Q2FA 2UU8A 5FYTA 1JZ4A 3OF1A 1ASJ1 3VBOB 5CU1A 1X9PA 4V2VA 5CFDB 5KBFA 5C8CC 4UFHA 4LMFA 3H8XA 3WNLA 4Q4X1 4IE4A 1SBEA 2HYXA 3WP6A 4NRMA 1NA1A 1PO12 1X33A 1PVC2 4JV4A 5FPZA 3V0AB 3IDEA 2G9ZA 3WXPA 2GAUA 1JYCA 4FQZA 1SPPB 1RJ8A 4NRQA 4W6XA 2A3WA 3PUSA 4MO3M 3LIHA 1LCLA 1LOAA 4TYSA 3AMQA 4MADA 3ITQA 3UGFA 2CU5A 3BPZA 1C8NA 1DQ6A 5GKAC 3CJIB 4KWUA 1VMHA 1HV1A 2XLFA 5FBJA 1GP6A 4ZY9A 2XHNA 3ZFEA 5JWPA 2MEV3 3N35A 3AP5A 5CKNA 3POWA 1T6BX 2TBVA 2VOWA 3W58A 3CJXA 4COYA 2HWC3 5IUQA 2ZABA 4DUXA 3VBOC 2WZR3 5CFDC 4FOYA 1SFNA 1OUSA 4IE5A 3X29B 4QPGA 3RZZA 2HBUA 1LKNA 4QDSA 1RMU3 2ORZA 3AYEA 1IHMA 4IETA 4Q29A 2Z79A 1QNYA 3V65A 4EYUA 5F1RA 1FV2A 1ZZCA 4B29A 3PVOA 4Q4Y1 4L9BA 2RS32 3IZOA 1LENA 1OPMA 2ARBA 3TEYA 2YU1A 5EJ3A 2P3IA 3I2HA 3EQEA 5FK8A 1DCSA 4OZOA 1VBA1 4TN7A 4ARXA 4RR3C 4AI8A 4EN0A 2R30A 4G4FA 4PQ9A 2BZDA 3MW3A 2BJSA 5FY9A 4A3XA 4XFFA 4LO8A 2RM22 1VBC2 3ZO0B 5FMDA 3CJIC 3AX4A 2X29A 5C9AB 1ULOA 1AYN2 1PGSA 3PUHA 1SLAA 3JZVA 5L7OB 1JOBA 2GU9A 3LWCA 1UX7A 4MYEA 5FKBA 3O1RA 1QU0A 1YXWA 2J1RA 4BU2A 1ZREA 1QJFA 1CR7A 1UF2C 1UIKA 3UJOA 2W5FA 3OBZA 4HANA 1C4RA 4AVSA 3OUIA 5JUVA 4XFHA 5LBCA 3MW4A 3NSTA 1SDWA 1C8M1 1SHWB 1COV2 3NJVA 1ZRIA 5EFUA 3RZHA 2OUHA 2P1BA 3NVCA 5J36A 4I30A 3GZAA 4N43B 3POGA 4Y24A 5FZ9A 4BCUA 4J6GA 1LJ7A 2AH2A 2QQWA 3JD73 4KBZA 4OHXA 2JICA 1O91A 3ON7A 2WYFA 3VD4A 3MICA 2KR2A 1A34A 3AFKA 4P9LA 4IV1B 4Q0QA 1Q8OA 2WT2A 3MPPG 3MHZA 1AL23 3R4DB 4FTBA 3NV2A 1PIV2 2Q8EA 4C1XA 1OLMA 2ENRA 3VGIA 4CE8A 5HBAA 2R0HA 4Z8BA 1C1LA 3WG1A 1PIV1 5F9TA 5F3GA 1CONA 1TMF3 1YQ2A 5C9AC 4GH4B 5J98B 4Z92B 1XJAA 2MHFA 5L7OC 2AGSA 2AACA 2CY6A 3ZVXA 2ZKLA 3IBMA 3HOBA 5FZAA 3FFZA 2GMEA 1V6NA 3MIDA 4FAHA 3GJAA 2JIJA 2Q8DA 4CP0A 3JXSA 3PURA 1ULEA 1ZZ6A 1QEXA 4NWWA 2D5FA 5FWEA 4AGGA 5G04L 4CEYB 5EIYB 1DZTA 1GLHA 1HQNA 5F37A 2QQMA 1X8EA 3HQRA 5FZKA 1WBFA 2FDGA 4UXAA 4N43C 4BISA 3K3NA 2B9VA 4HN1A 5FYIA 3CQOA 5LBFA 1VAKA 1XSRA 3KGZA 5C71A 5IVVA 3QBQA 4PLNA 4IV1C 4ZS3A 3FBMA 4DINB 5BNNB 3O14A 4CPBA 1M06G 3I3MA 4K3UA 1J1LA 3PVBB 5FYMA 5HCFA 1JTZX 2WWSA 3MIHA 4D7SA 4GH4C 4QX7A 1PGW2 4Q26A 4HLTA 3I8TA 4I02A 2OA2A 1PGW1 2G9GA 2VUCA 5FPBA 4WZCA 1NY71 4R9DA 2YHJA 3OD0A 3VDDB 1GICA 4Q27A 4AI0A 4AEKA 4B4QA 5CBLA 1BCXA 1EYBA 4BXFA 4CCLA 5BNOA 1BEV3 4NRPA 1PZ8A 4IGQA 1SMVA 1H8TB 1AR82 3SCFA 4CEYC 2HWE1 1XRUA 1XNBA 4AYUA 1AR81 3WQ7A 2A5ZA 3B5LB 3KF3A 3FE5A 2P5BA 4PIYA 3WNXA 2IXKA 4XCAA 3EO6A 5DZEA 1RXFA 5BNPB 1RUF3 4GD4A 3AP4A 3AC0A 4FPLA 4KWKA 2ZGTA 2DUQA 3K46A 5LZ6A 5FY8A 4Q8LA 1U5XA 1FMD2 2O8OA 4DOUA 1LECA 1ZA4A 3QCWA 2BFUS 2VD7A 3NAPA 4Z82A 1FMD1 2J1AA 2VU9A 4DQAA 4COWA 2DCYA 2HBTA 5BUVA 4AFAA 1QF3A 2K46A 3CDZB 3O0VA 1HRI3 1R1ZA 1WZXA 2FCUA 2MPFA 3VZJA 4N7IA 5FP7A 3WW1A 3I2OA 2VBBA 1UXZA 2EIDA 2W39A 5FMOL 4BQ2A 3VDDC 1LGNA 5M0TA 3RS6A 3M7AA 4AVCA 2QFEA 1NYWA 3RVHA 2WNUB 4AI3A 1H8TC 5I93A 4HPKB 2PTMA 4HZFA 5FLHA 1UWWA 4Z07A 1W3VA 2O14A 1W8WA 4QPWA 4NOTA 2BP6A 5ISLA 5A3WA 1ND3B 1ULDA 4WVMB 2WAOA 5BNPC 5HXVA 3TB0A 5LA0A 4IL7A 3TN92 1UU5A 4GIQA 1XOYA 1X50A 3OB8A 1HJGA 1SFPA 3POYA 1JZ2A 3TN91 2JDNA 3POEA 1GZWA 4N90A 4OZXA 4BE3A 5A3LA 3VDAA 5JOXA 5I0SA 4HONA 5JXHA 1L7QA 2XXZA 3H0OA 1RIRA 2VBPA 3ZMOA 1OKOA 2ZBJA 1OVPA 5IATA 2XUEA 1IZ3A 2FZ1A 4NAMA 5JZGB 3POJA 3C7EA 3LF7A 4NHMA 5C7GA 4CYDA 3N9MA 2ZCWA 3PNAA 1UYZA 3LFMA 4XE9A 4HVRA 2J22A 2R7EB 1VIWB 1H6YA 3K77A 3MIEA 4Y1UA 3ZXJA 1EPZA 4YM0A 4S2GA 2JE9A 2WNUC 4IEQA 1AR91 2WQ8A 4XEZA 1LHWA 4XDOA 3O1UA 1GNZA 1OVSA 2OT7A 3AP7A 1MZ5A 4P9JA 2WSVA 1LEMA 2RS53 2J1SA 3K4DA 4L2NA 1BKZA 5I0RA 3C3VA 1ND3C 1VBB3 3ZYGA 3BOWA 4YVSA 4L97A 2PELA 5FFOC 1PMHX 2QZ2A 5LBBA 3WF3A 4WBBA 2QQLA 5FOBB 2VTXJ 3LSEA 1E5IA 3T2OA 4BK5A 1TEIA 5KR7A 4AI2A 2ADDA 5DAWA 1H4HA 3OPTA 5A7WB 3KT1A 5T54A 1UU4A 4EZHA 3THTA 1C5IA 1PGL2 2F4LA 4BB3A 1QH7A 3Q8CA 5FMCA 1WMFA 4A6OA 4C0BA 3VL9A 1K5JA 2PHRA 5JZGC 4COZA 1PGL1 4MXWA 4AF9A 3ZXDA 3G6JB 1PHMA 1R082 3WF4A 2PHTA 5F39A 4MSVA 4LITA 2HWB3 4Y20A 1K5MB 1D7PM 1OXCA 2LRPA 2RS13 2RMU3 3VBUB 3WNOA 3C7OA 1R1A3 1N1TA 1UPIA 4PI0A 5EWSA 1JZ5A 3ZKYA 2RDRA 3B01A 4FP2A 5FZMA 2WC2A 1QXJA 4B7KA 4Z2WA 1GANA 1ULGA 1YHFA 2EIGA 2XJVA 5JLVA 1GSLA 2D6OX 1QHDA 2RHPA 3O0XA 5JR7B 4BYYA 4H3WA 5F5QA 4GMP0 2JDUA 4E8CA 4OHWA 1V6LA 2Z42A 1NQDA 3TNQA 1CZVA 1GZCA 3S30A 4SBVA 1VAVA 3BALA 2ZOEB 3MLJA 3IWZA 5A80A 3ZN4A 3PHMA 5KXEA 4OFGA 3RZGA 1ZM1A 1HQWA 1EUTA 1OLQA 3OG2A 1OPOA 2D3RA 3SCGA 2CSGA 2ZGLA 3DYMA 4COUA 2Q8OA 3I2KA 4NR1A 2ZMNA 3B7MA 1V9U2 4YW6A 3S5QA 3U07A 4XZPA 4BMBA 1K5MC 4NHKA 3BTZA 1V9U1 3VBUC 1W8HA 4W8JA 2XHKA 1VP6A 1POV0 2VQTA 2XKPA 4E27A 2C1FA 5DPNA 4AWDA 4CCDA 4RGKA 5A33B 3P1IA 3GF6A 4XF0A 1W9SA 1OMIA 1OA3A 2WNVA 4CEWB 1DYOA 1VBD3 3QACA 2A7AA 4HXCA 2VQ0A 2Y64A 3PLQA 2EXIA 2W1SA 3JB4C 3D4KA 3KVAA 5FZ7A 3SMHA 4ASMB 3OPZA 1S1AA 2OS2A 5F3EA 3PIJA 3MFAA 3WQ1A 1I9RA 3V0BB 2MEV2 3OCPA 1OT5A 5EYYA 1JYXA 4OUMA 2D97A 2QZ3A 1WW5A 4FFIA 1H2KA 2HWC2 5A7OA 3VZOA 2WO1A 5HXMA 1MR5A 5FKCA 5F3IA 2WZR2 2R063 2UY8A 1ZYBA 2XL7A 1RUG3 2YC0A 5KHHA 1WA6X 1YCIA 1D4VB 4AVBA 1RMU2 1G9DA 3ACIA 2W0XA 4YW2A 3WP4A 4YZ4A 2XLAA 1XPWA 2ZX3A 1W3XA 2AEZA 2XVKA 4IUGA 4XFGA 5FYCA 1NX9A 5GM0A 3I2GA 5GZDA 5C4WA 1BK1A 1S0DA 3RQ0A 1JYIA 3OEAA 4JHZA 3SHRA 2VW2A 1POV3 4QHOA 4LXLA 5FR3A 3VBSA 1NE4A 3JCIA 3OGJA 1W6QB 4LKEA 2OW4A 1MS0A 5FO8B 3LEKA 3BU0A 4KG0A 1NXMA 1ZBA3 2TNFA 2VTFA 4YGCA 1J58A 3RGBA 2FMDA 3VBRA 2HKXA 3C8XA 4LBLA 3ZYHA 4MGSA 4QAWA 4LBQA 1PZ7A 3RYKA 1VJ2A 4A7ZA 5AC91 2B8MA 1UZ0A 2RDNA 4A42A 1O5UA 4UFJA 1WLCA 1CX4A 2IZWA 1W06A 3AKQA 1FPN1 2DVFA 3LPFA 4RS5C 3HVDA 1AR71 4EWEA 2FDJA 3QH6A 4NVPA 2I45A 1GNYA 2JDZA 2ZGNA 1IPSA 5D21A 4UT5A 3IN9A 5LEJA 4QGLA 3HNYM 3JD72 4LA2A 4HETA 5FZFA 5JI9A 4XYXA 4RHV2 1ACCA 2NP0A 4XFCA 1AL22 1MEC3 1Q5OA 4G9SB 5ACA3 2EIEA 1DGWA 4RHV1 2XQRA 3I49A 2VY0A 4XF9A 4GWMA 1AL21 1J3QA 4UWDA 1C5HA 1NT0A 1RYYA 1TMF2 2E7AA 3I4IA 5DG2A 5EXOA 3I59B 4MV2A 3RI8A 4A6SA 1TMF1 2QE3A 1DQ0A 2XJQA 2UWCA 3I3DA 4FOQA 1SQ4A 4MH0E 3LAGA 3WDTA 3LB9A 4E2SA 1PM4A 2P37A 4DPNA 1F31A 5JSRA 2VW1A 3S5AA 3KCXA 4M4PA 4GALA 4ASKA 2QDRA 4LBOA 4QD2A 5F2SA 1VALA 4PLOA 4H14A 4N9IA 1NAEA 2AYHA 4QDRA 5KHJA 3WNMA 1HN0A 5JOYA 1U5IA 4Q4V3 2GALA 3M8LA 1W6NB 1QJY3 2I07B 2JB8A 3SQOA 3ZYJB 4Y4RA 5HI0A 4CDXB 1KXGA 3KV5A 3NJZA 4U2AA 1W6MA 3INAA 4NJ4A 3LKJA 1W99A 4EN8B 4QXKA 4K9SA 5ABJA 3H8OA 1DQ2A 5FXVA 1TG7A 2QQJA 3C7GA 3K4ZA 3I2FA 3IT8A 4PHZA 1JI6A 4RFT0 1S55A 5DABA 3DUIA 3BODA 1S2BA 1XXNA 2ZMLA 3VHOA 1JYNA 3IIAA 1ZZ7A 4A7YA 3WX5A 3QLQA 2W1UA 4FOWA 5FRAA 3H8UA 3OGGA 4M3CB 4J1XA 3SEEA 3AVRA 5FJKA 4A3ZA 4DMIA 1ENQA 2VUDA 1BEV2 4NAOA 5JAXA 1ZRDA 4BDVB 2CAUA 1XYPA 5EP9A 1KEXA 5DUVA 1BEV1 2DTWA 3AVSA 4U36A 5CZKA 2Z4FA 2RE9A 1WCDJ 1VB4A 1W03A 1IS3A 1CIYA 3CHXA 1B35B 3OEBA 2WRAA 4YW3A 4CDXC 3WDWA 1RUF2 5FOJB 2BEOA 4AHZA 3MI8A 2Y6LA 5FP8A 3WUCA 3S0MA 2BWAA 3AKPA 3TAYA 1JZ6A 2YV8A 4NIIA 3MV01 4PDWC 3VDBA 3KQ4B 2QQVA 3WDXA 4I2OA 4YRDA 1QOSA 1O8SA 3CZJA 2O1QA 1PMJX 2VZPA 3PDQA 3PUAA 5FZOA 1G8WA 1O5LA 3PIGA 5DG1A 1HRI2 1I5ZA 2X5IB 4Y5SA 3RDIA 2V5DA 5C8CA 1W9YA 1HRI1 1DLLA 3GCWA 1FNZA 4LBNA 3KHBA 5EYXA 4I01A 1W2TA 5FY5A 3VDCA 3A23A 1LB2A 1D0HA 2WWJA 4LOTA 3WZ1A 1RHI3 3WG3A 3TBDA 4JKLA 4IQPA 1S0JA 1TME3 1VBE3 3IKWA 1B35C 4EN9B 4R9AA 1PX3A 3W59A 1REDA 1S0GA 2A75A 1HLCA 2P4EA 2VZOA 4RD7A 1MACA 1VAMA 3RPQA 2CDOA 3WDUA 1MS5A 2A1XA 1Z7S3 3L9JT 5DAPA 4PF5A 2F6BA 4AZZA 5E88A 2GC1A 4JHTA 2ZX2A 4BZ4A 2X09A 3VLBB 5FZIA 1Q8VA 4LKDA 3VBOA 2PA7A 1CJDA 3A4UA 2OUJA 5CFDA 1AJOA 2X5IC 5IK4A 3USSA 4V2WA 4MG2A 4ASLA 1CN1A 1RUI1 2B46X 4LNVA 1L3JA 5I8SA 2HWF3 2XH6A 5FWJA 1BVVA 2OZ6A 3FLPA 3V0AA 5E8AA 1SPPA 4WVZA 2XQXA 5EV7A 1AZDA 4DNYA 2QJVA 4JKMA 1JOJA 2XJTA 2RS52 5A32A 4RR3A 5GALA 3T08A 4AGRA 1CPMA 4YM3A 1W2UA 1MVEA 3KGLA 3VZLA 2JKBA 1VBB2 3A7QA 5CYYA 1O4TA 2R043 4EN7B 3NNFA 3S7EA 4ZKTB 1VBB1 3CJIA 5LY2A 4YSFA 5FYSA 3OY8A 4I09A 2ARAA 5CEHA 2ZGOA 3BKZA 3K75B 1HV0A 3HR9A 1W9WA 2QQUA 1S0IA 2V5YA 4PLMA 4QB2A 5E89A 2WFF3 4IEWA 4LKFA 4OI4A 4Y5Z0 5FO9B 3AZXA 5JMCA 4BLJA 1W8OA 3VUOA 1LGCA 4R8HA 3ZYPA 4Y1XA 3NV4A 1UO9A 2J7MA 2XJRA 2HWB2 1W2AX 3N7KA 4M0HA 4CCMA 4CP2A 2RS12 2RMU2 2Y0IA 4H2AA 1R1A2 2H6BA 1H1IA 4XF1A 2RMU1 1NKGA 1P8JA 3P5BA 4K8FA 3ZFFB 1BMV1 5FLJA 1Y9GA 4X8PA 4KWJA 3ILRA 2JDMA 1JYVA 4YFZA 1YQ6A 5JPNB 2D7FA 4F3JA 3DGTA 3ZIWA 4S2FA 2E7QA 4RFRB 5C9AA 1ZZBA 3W9AA 2XDVA 4E2GA 4BOWA 1JUHA 5C5TA 5L7OA 2PHLA 1EY2A 4Q4W1 5J09A 1QH6A 3LE0A 5B4XA 2FBEA 2D3PA 3PU8A 1DFQA 3DPRB 2ZGKA 3AZZA 5D8AB 3DXUA 4AFMA 5KHKA 1XE8A 5IVYA 1OBNA 2YC4A 3FHAA 4JRAA 4XXPA 3HNBM 5FZDA 2NQYA 2G19A 3ATGA 4IE0A 4QMAA 1C3HA 3ELNA 1GR3A 4N43A 4CPBD 1Q56A 3ZOIA 1NG0A 4GULA 4DEVA 1W9FA 1JODA 2IUWA 4FQ4A 2GC0A 2VZQA 4UF0B 3ZFFC 2KD7A 2J42A 4IV1A 1VBD2 3UETA 2P34A 2ZGMA 1ODNA 3OTFA 2LS6A 2WS93 5FZLA 1W2OA 1IS5A 5LEKA 4NIGA 1LR5A 3FLRA 5JPMB 2HYKA 3MW2A 4HN0A 5A7NA 3F95A 3LDRA 2E26A 1GQHA 4FPOB 4IEYA 2CHHA 4ITCA 2BWCA 5CVRA 1US3A 4NIDA 1OFNA 3LD8A 4GB33 4E4HA 2WZPP 4LK6A 3SLIA 4NIHA 4YW1A 3DPRC 4NIAA 2R062 5D8AC 5KHGA 1RUG2 2R16A 4XJUA 4UFIA 4F7ZA 4CU9A 2ID4A 3VBHB 2R061 4CEYA 1X36A 5AVPA 5JMOA 1PO11 1PVC1 3ZXEA 2BVBA 2DVAA 2V73A 3KT4A 2JD9A 3WF0A 4JTOA 1XU1A 3GHMA 5FCCA 1H6XA 3WY6A 3ZXLA 2XKOA 4LR4A 3POBA 2EIBA 2VMGA 5GLZA 3D6EA 3SH3A 3UKVA 4ARYA 1R64A 3POSA 1FNYA 5FXXA 4DO0A 4IEPA 2YBSA 2W47A 2VG9A 2VM9A 2VR4A 2EICA 1YYNA 4ET7A 4AXOA 2WO3A 1ZBA2 4P9GA 3BTAA 4FO9A 1H2LA 1DZQA 4XIKA 3UJQA 1ZBA1 4QU2A 3T3YA 1YFWA 4YLZA 4LIVA 1KJLA 2VCBA 3IDBB 1DP0A 4PBPA 4XURA 1JH5A 2ZMKA 3A21A 2BNOA 4LKSA 3MDPA 3VDDA 2PLV3 5FUPA 3PTYA 4BIFA 1GUIA 4I3GA 3VN4A 4LORA 2YPJA 3VBHC 1U5YA 1H8TA 1JW6A 4UBGA 1YFYA 2A70A 2CL2A 2YFUA 3EHKA 4MGZE 3IAPA 4QX1A 3WLUA 1EV13 2E53A 3J26N 1H4GA 2DYCA 2RS31 2DV9A 3GGLA 3SH5A 3VHRA 1RUD3 5GZFA 4AQ2A 1A8DA 5BNPA 1R093 5FZEA 3ROUA 1UCXA 3H3UA 3OUJA 1N3QA 4XUTA 4LO7A 2CWMA 5KXBA 4YVWB 1MEC2 1X9TA 2ZHMA 5FY7A 3HEIA 5CIRA 3CF6E 5FZHA 5ACA2 4GA9A 3S57A 2RM21 1VBC1 2R073 2R6QA 2VCAA 5DDJ3 3VKNA 3LIGA 4C8DA 4D8MA 3VHNA 1SACA 1AYN1 2NYYA 4XETA 2FQPA 4UFMA 1NCQB 2A3YA 1PVXA 3RMXA 1RUJ3 1XYNA 1YFUA 1AYM3 4KU8A 4QHZA 2JENA 3U4XA 2VNOA 3WNPA 4XF3A 4P02B 5LK5A 1PNFA 4CP9B 1COV1 2WNUA 4Q4V2 3W21A 2E63A 4E8DA 2IVIB 3BTYA 4HPKA 2XBO3 1WMDA 1QJY2 2BDRA 2Z2SB 3OBRA 4ORFA 1OSGA 4W65A 3PU3A 4LPLA 1F15A 2LTNA 5GZGA 1ND3A 4WVMA 2ES3A 2DFCA 2B9UA 3HIFA 3ES1A 4YVWC 1KFXL 2VUAA 4BMEA 5FPVA 3W5MA 2ZX4A 4YZ1A 4FT8A 2XOMA 4AAPA 4CCKA 3UKTA 1F4AA 4XFIA 4XMAA 1TZOA 5KXCA 1E5HA 2YPDA 5IK8A 4WVVA 4AQTA 1WW7A 3LEGA 1NCQC 3ZSJA 2ZA9A 1AXKA 5A7QA 3WCSA 5JZGA 2IC1A 3KF5A 2JDKA 4GAZA 4WV8A 3W5NA 4EJRA 1IGOA 2ZGSA 2EXKA 4W50A 4BJ0A 2VH9A 3MPBA 4NPRA 5FJHA 2RDQA 2ORXA 1KDKA 4W6WA 2CGPA 3KSCA 5BY5A 3MBWA 2W95A 3TEWA 1RUE3 4Y1VA 3TEXA 2TUNA 2FHRA 3WOGA 3AMPA 1WD4A 4D7TA 2GDFA 1NA1B 4BH9A 1H2MA 1JMUB 2JDYA 3WW3A 4CSWA 5C3PA 4XBQA 3AJYA 2DCKA 1W8FA 2WQZC 1PMIA 5A3MA 1CZTA 5BPXA 4INDA 4PI2A 1F5JA 4GWJA 4LUMA 1SLBA 4XQWA 3RYPA 1D0GA 1S2EA 4CUGA 2C0ZA 3UKNA 2IXLA 3LOIA 2BYVE 4JKKA 3RZJA 3HBZA 2QDNA 4BQYA 2Q1MA 3H9AA 1K5MA 4R9BA 3VBUA 2YFZA 3ENRA 1RHI2 3Q8AA 4K8RB 4XAEA 5FMBA 2J1TA 2ZGPA 1VBE2 1TME2 4URTA 4CXXA 4M3CE 1KFUL 1OH3A 1I1EA 3PUQA 4AHWA 2R49A 1DF0A 1V6OA 5BNNC 3H1MA 3J8F3 3JQXA 3E97A 3RZLA 1KS5A 1TNFA 1I6XA 2YGMA 4AHXA 1PO22 1UIJA 1Z7S2 2D40A 3ALQA 3LOBA 3NNMA 4FP3A 2FMYA 3D3AA 1GBGA 1PO21 2JE8A 2JDAA 1O4YA 4C1WA 1SLIA 4XW3A 1W0OA 3UESA 2JX9A 3VD9A 4Q0PA 1H30A 1LODA 4QHBA 2D6KA 2CGOA 2KM2A 3ES4A 4N53B 4XAAA 3K48A 1HQLA 2CYFA 4JTNA 4P9YA 2UY9A 1SLCA 4EQVA 2OPKA 4S2DA 4MGIE 3ZXAC 2HWF2 1J83A 1LTEA 2EXHA 2VULA 3LGRA 5EPAA 1CJPA 2KA3A 4DS0A 5IFTA 2X10A 3AMMA 4MHRA 5K7PA 2C6SA 1VRH3 4KMQA 2A6XA 3SC7X 4XTMA 5A33A 5BV6A 2C26A 4HBNA 1D4M3 2LROA 2FDIA 4LBQD 1F35A 2R042 5J37A 3VBFB 1RUH3 3EJKA 4HL0A 3S6PA 4A2UA 1C28A 2R041 5FREA 2WNOA 2V4AA 2SBAA 3NV3A 2A6YA 3VKFC 3V0BA 5H9RA 5FP9A 4AVAA 1LOFC 4BWOA 2XUMA 2WFF2 4AEJA 4RQPB 4DXSA 3MF9A 1JXNA 2Y33A 4RS5A 4N53C 4RSUA 3ECQA 3JBG3 3PJYA 2WZ8A 4EWDA 4XCBA 3TNPB 3A0KA 4DXZA 1TE1B 2JB4A 3P3NA 4YW4A 3UL2A 1OUXA 1STMA 2P6CA 4FVVA 1UY3A 2B42B 2GZWA 2W1WA 1QXRA 5IWFA 3WP3A 3KCCA 4DUVA 3O1MA 1GNHA 5GLVA 5LATA 3JUUA 4IESA 1N47A 3I3BA 4JZRA 5JCTA 1WW4A 4XOGA 1FYUA 4JRLA 5LA1A 1W6QA 2XMLA 1J59A 3VBFC 2IFRA 5B4NA 2BGOA 4XUNA 1BQPA 3AL6A 5F6KA 2WO7A 3E6DA 3NQHA 1YEWA 2ERFA 2WINB 4DFSA 3Q9OA 1Y7BA 3QD6A 1ZBE3 4O7XA 2GNTA 3NJXA 3SISA 4OI0A 1WCQA 1HX6A 1HDKA 4J1WA 4AOCA 4QQLA 4RQPC 4NHYA 3CNAA 5KHIA 2EA7A 2DWRA 2VPVA 5JSOA 1O3SA 1REEA 4XBNA 3B02A 1R081 3HWJA 2VJXA 3IPVB 1UAIA 4QWNA 3ZSMA 1I5PA 1VRBA 4FPKA 5C6CA 3ME2A 2PAEA 3KS7A 1EP0A 1WW6A 2RG4A 4GWIA 2B4KA 1GMMA 1CAUB 1HB4A 1XU2A 4URAA 4D7YA 3IDCB 3GBFA 3QOPA 4KNCA 1DYPA 2PMWB 2YZ4A 4J25A 3ZYBA 1PK6B 3AXEA 3TEZA 4YNIA 2VE1A 2WS92 2ZEWA 4JDOA 4N9HA 4Y22B 1HXS3 1RVF3 4Q0UA 3J9SA 2VMHA 4ZU5A 3I59A 3WQBA 3R4SA 3KQRA 1CAWB 1O6UA 3A22A 4LO6B 2JG9B 2CAVA 3G7DA 4GB32 2WABA 4IV3B 4WM7B 3ZFGB 1JHJA 2DCJA 4AFDA 3T0DA 3OGSA 4QQOA 4Y4YA 4NO4A 3UT0A 2A6VA 1JS9A 2BOJA 5F6LB 1LHVA 2XONA 2RR13 2Q30A 1PNGA 2YYOA 2PQQA 2W9XA 3M3OA 2P2KA 5A7SA 1UMZA 1IKPA 2VQAA 3VL8A 4LT5A 4XC9A 5GLWA 4BK4A 3OGVA 2Y26A 5J1XA 3OUHA 2NLRA 2WL1A 1D2QA 4BQ5A 5IK7A 4CDXA 1IS6A 3D82A 4Q1RA 1FXZA 2VCCA 3ACGA 3H1YA 3I3EA 2W1QA 2VQUA 4AK3A 5EZWA 2WKKA 3ORJA 1PK6C 4XMIA 3UGGA 2Q1ZB 4PDWA 4G3YC 1IS4A 2DVBA 4LHNA 5D2AA 3T2TA 4AFCA 1QJX3 5F7UA 4BLIA 4GMP3 1RGSA 2ZACA 2XPJA 1YQ5A 2VAUA 1QQP3 2XLGA 2VZSA 3GDBA 3OYWB 2BGPA 2MEV1 2OZJA 1VPHA 4OI1A 2JG9C 4YPJA 3J4UH 1W0PA 2HWC1 1ULFA 3WCRA 4IV3C 4WM7C 1XNAA 2JECA 4JDMA 4YW5A 3ZFGC 3NWKA 1UYYA 2WZR1 4M3CA 5A6ZA 3AZYA 2PLV2 5CKQA 1QY4A 4MX3A 3KMHA 1TVGA 2VMEA 1RMU1 1XNKA 2R1BA 2W3JA 2Y6HA 4B8EA 2F17A 1FOD3 2C9KA 3FX3A 2RJKA 1EV12 1JHNA 3WW2A 1MZFA 2B39A 1ASJ3 4QQ2A 1RUD2 4DB5A 1B35A 1EV11 2WZEA 5IVCA 4MGKE 4CEWC 1R092 2AZ5A 2VNRA 4Q4X3 1J84A 2DBIA 1GWKA 1ZVFA 4FCAA 1IOAA 4I0WB 3MO4A 5BXXA 2VZVA 3BVCA 4YG0A 2R072 4RGGA 4XILA 5DDJ2 4AI1A 4CU8A 4OI2A 4HSJA 4TLGA 2D93A 2R071 4V1PA 5DDJ1 5IJRA 5J3UA 5HPOA 2BFUL 1ND2B 4FPHA 1LOBA 2A73B 4GWNA 4FTSA 4PQQA 2E51A 4NPLA 4P9IA 3H42B 3PMSA 5HCHA 2FCTA 1TQ5A 4E2QA 1RUJ2 2X5IA 5LRSA 1AYM2 3MV11 4IE6A 1H1MA 1U5ZA 5L9VA 3VKLA 1AYM1 4FI9A 2GP5A 2XWBB 4Y1YA 5FY0A 1DYKA 4CCEA 4CTEA 2LALA 4DXRA 3LEMA 1UU6A 3WNNA 2BPA2 4AI9A 2XBO2 4AVTA 2YMZA 1V6IA 3JD71 3WHTA 3CKHA 4PF1A 4CDUB 4F83A 2CDPA 4F8AA 3ZXKA 1WCKA 1LHUA 3D0SA 1H9WA 3T30A 4EV0A 4DEQA 4CVUA 5LWBA 3J7HA 1BHGA 3MEPA 5FQ0B 4AR2A 1W90A 4Q4Y3 3F2ZA 3EYPA 2WA4A 4R4XA 2P6HA 4CXYA 2GNBA 1QOOA 4C90A 1LHNA 1OF4A 1ND2C 1W05A 1VBA3 3T0AA 4YM2A 3HN1A 1K42A 1WBLA 4DIQA 5F5AA 5D1IA 5LK7B 4JAAA 5JVVA 2J1VA 1AX0A 2HEWF 4NWVA 4Y33A 1ENRA 3WHUA 4E4ZA 4ZZ5A 2ETEA 3ZLIA 3SKJE 3SXWA 5EHDA 4B1LA 1QNWA 1GQPA 2Y6GA 2ZGRA 4QQPA 1UY2A 1OKQA 2PAKA 2B5HA 1HB3A 4CCNA 1ONAA 1RUE2 3N36A 4IEXA 3WDYA 2FZ2A 4P14A 1WD3A 4CDUC 2UYBA 2SLIA 2IXHA 3ABZA 1C8M3 2IXIA 2VOTA 4K20A 5TSWA 3RMYA 1G9FA 5HV4A 2WT1A 3ZN5A 3NNLA 4LE4A 5FYBA 4XFBA 1QJZA 4TTGA 1OQDA 1N3PA 3C7FA 1UY1A 2ZJCA 5DAXA 2CV6A 3OOXA 4AEDB 2WN2A 1S0EA 1Y3TA 2GP3A 2VO5A 4N7UA 1G86A 3WNKA 2EVXA 3KV4A 3PMEA 3ZSLA 1SCSA 1SLLA 4TLFA 2DTYA 4CCCA 1XE0A 3M2MA 1OA2A 5JR2A 3BI3A 5FP3A 2B7YA 3LQCA 5LBEA 3J7NA 1GKBA 2D6PA 1LHOA 3GBGA 3GM8A 1MQTB 3ZXFA 3ETQA 4C91A 2D98A 4JGZB 4PIXA 1AR63 2BU9A 4P5YA 3ZN6A 5F5IA 5KC6A 2ZTNA 2YROA 2NN8A 3THCA 1ZA7A 3LA7A 3ZFFA 3AL5A 1UKGA 2WWUA 2NM1A 3BYWA 3V56A 1RUF1 3T4VA 3HBKA 1LOGA 4XQ4A 2YB7A 5EQUA 5C33A 1J1TA 2QQKA 1OD3A 1IG3A 2VW0A 1SZBA 2AREA 2VVDA 5IVEA 1OHFA 3FMGA 1W6OB 4QXCA 4XJWA 5G05L 3R05A 4AL9A 4HVQA 4AEDC 1WUVA 4CUAA 2OPWA 4UW5A 3WG2A 1G9CA 2W94A 4IXLA 4W4ZA 2JXAA 3DPRA 4XXAA 5D8AA 3U78A 2JDPA 4XVHA 3MIFA 4YGEA 5FZ8A 1US2A 3NNGA 4P9XA 4QXHA 5IAVA 1T6GC 3ZPYA 5T5OA 2ARCA 5FYHA 2PQSA 3OBTA 4R4ZA 5FO7B 4RL7A 1NLSA 1MQTC 1OI6A 2QQOA 3KWVA 3ZDVA 3BOPA 3USUB 5IHRA 4JGZC 3LEIA 4RGAA 1W8ZA 1VRH2 2VUJA 1ST8A 1RJ7A 4ZXKA 4UF0A 1V6KA 3DV8A 1D4M2 3WD5A 3RSJA 5AFEA 1BK0A 1K3IA 3KV9A 4TXWA 1RUH2 2HWE3 4HKOA 1MZ6A 3BTXA 1RUH1 1LOEA 2XJUA 5FZBA 4CU7A 3ASIA 2AENA 3ZYRA 1W9TA 4YFWA 1OH4A 2CTVA 1AJKA 3GHNA 5JIAA 3H3LA 5FPLA 1MS4A 3JBG2 1VMJA 2W68A 4FSJA 4MHUA 2VMCA 2P3YA 3M3IA 4QM8A 4BPZA 2R32A 2Y0OA 3ACLA 4NHXA 1M4WA 4A41A 3HPNA 2C24A 5FY4A 4XJ8A 1ALYA 5K9YA 2Q0AA 1OOPB 4D6RA 1RUNA 5JIUA 3KZ4C 2Y6JA 1XE7A 4X6RB 1XNTA 5ANQA 1JU3A 2RS51 3AXDA 4P9WA 4FPCA 3B94A 2XJPA 4L11A 1A8MA 1BBT3 1DQ4A 2DFBA 2H0VA 5C5UA 1WA4A 2RV9A 4HSLA 5C3OA 3NV1A 2ZAAA 4LBJA 3T2QA 5FDBA 4FBFA 4XJZA 4META 4GJZA 5H9SA 2VVFA 2A3XA 1N1VA 1XSQA 5FTTC 2DVGA 4QX0A 1ZBE2 3I2JA 5GLTA 4BIOA 2PHUA 1DQ1A 1FAYA 1EPWA 1K45A 1ZBE1 3DF0A 4S2HA 2HWD3 3ZKUA 1JN2P 5A6QA 2BOIA 2EAAA 3QH7A 4IEZA 2BERA 4I0AA 1CAVB 3KVBA 4KQ7A 4XQDA 3AKRA 4XJAA 5E1RA 4JX0A 5ABJB 5CB7A 2HWB1 2PYTA 3BIEA 1CQ9A 3BCWA 1NCRB 2RS11 4LLFA 4OHZA 5FYZA 1R1A1 2Y8KA 2WO2A 3APBA 3GXUA 5FIXA 1OOPC 2VZRA 1GOFA 4YYOA 4KWLA 3ZR6A 1SEFA 4MXVA 2XVLA 2VZUA 5DZFA 3VD7A 4K1ZA 2DUOA 2BTVC 2V4VA 5JXJA 1MZEA 3I7DA 1SFYA 4YVWA 4DRVA 3MIBA 1Y43B 3GBWA 2ZZQA 3WV6A 2JIGA 4DUWA 2Y6FA 1HXS2 1RVF2 5LW9A 2JD4A 1AR93 2ZEXA 1TNRA 3RWNA 1NOVA 1HXS1 5DQ0A 3CZUA 4ZU7A 5BYNA 1EUUA 1YIPA 2GNDA 1NCQA 2AEYA 2VOXA 4M01A 1A78A 3RRDA 1AXZA 5J96B 3IMMA 2RR12 3VD3A 1FI2A 1ZZ8A 3MUZ1 3N3HA 4D6SA 4OMDA 1KD7A 4NMIA 3HJRA 1NCRC 4QPIB 3T4HB 3NL1A 5A1AA 2XR4A 3NNJA 4XUOA 1KGYA 5FUNA 5CFCB 2D5HA 4QXBA 2PHWA 2BNNA 3BPSA 1WGPA 5GJ6A 1ZZ9A 4M4RA 3WF1A 1ZRRA 3KB5A 5F2WA 4E4SA 1VBD1 2CGNA 1SLTA 3U37A 2FDHA 3T09A 2XG3A 3BUCA 1QJX2 3UK9A 4GH4A 2ZZJA 3O12A 1UZWA 1RUOA 1QQP2 4GMP1 4PJYA 2HLEA 3OD4A 1CAXB 1UD1A 3LFIA 5FXZA 2A6WA 4FOVA 1G7YA 4HFSA 4WM8B 2VZ1A 4CDWB 3ILNA 1A3KA 1Q8QA 5AFBA 4XTPA 5ANNA 1W8UA 1F8VA 2F4PA 1SG3A 1F2NA 1RUG1 3PL0A 1GQGA 1DIWA 4GXLA 4XDPA 2JEMA 3AMNA 3P6BA 1FOD2 1W6PB 1WWYA 2ZHLA 4HOOA 5L9RA 2WBKA 1WMXA 3D5OA 2VVEA 2XWJB 3RG0A 4QPIC 1LESA 3FHIB 1FOD1 4XUQA 1ASJ2 5DUWA 3EB7A 3RZKA 3B93A 3PVEA 1QWRA 5I0DA 4QKBA 5FMOS 4LO5B 5CFCC 3O1TA 1POV1 1Q3EA 5BNNA 3GJBA 4Q4X2 1ZNPA 3DYOA 5CISA 1NUKA 4D94A 3RYRA 1IPJA 3GALA 3DCQA 5C70A 5DAQA 3THDA 5CA6A 1V9U3 5FZ4A 2RJLA 4KGGA 5APAA 1MPXA 3LDKA 4QB6A 3VKMA 3N4MA 2NZ9A 4K1YA 1LULA 2KXLA 2JDHA 1ULCA 5L73A 2IWGB 5A32B 4CDWC 1SBDA 4RR3B 3MLLA 4WM8C 5L9BA 3WSOA 3O1OA 3CU7A 4WVWA 1PZ9A 5SV8A 4IEOA 1YO8A 2QVSB 5CG9A 4GQ7A 5A3UA 4DXTA 3Q8BA 3BIWE 1VE0A 1S0FA 3OY8B 1GP5A 4K6BA 3KLSA 4CA9A 2EXJA 2HEVF 3AZVA 2JG8B 1OF3A 3NKTA 1UY4A 3AZWA 4UW3A 2C5DA 3KD4A 5T5PA 2WFPA 1JYTA 1VMFA 2E32A 3M3CA 3ZMNA 1BZWA 4JDNA 5K0UB 1DGLA 2PHFA 1REFA 5GZEA 3ZM8A 3SKVA 4AW7A 2ZS6B 4OLLA 1MEC1 5ACA1 1AXYA 2IVJA 3MLKA 2Z69A 5I0UA 2ZPXA 5GZCA 2N7GA 5KWRA 2QCSB 4Q4Y2 1VR3A 1GWMA 1YQCA
chains in the Genus database with same CATH topology
4GKXA 1LOFA 1VBA2 2WQ4A 5T50A 3RI9A 4AEMA 1KJRA 4ONUA 4N53A 4YZ2A 4HK9A 2K9ZA 1LRHA 4Q4V1 5AC93 4HKLA 4OI0A 5KC5A 1QJY1 3HAGA 4M00A 2ARXA 2JG8C 3LA2A 1DZRA 4CDQB 1FPN3 2QQPA 1WLTA 1YIFA 1AR73 2CNAA 2W52A 4XIOA 5K0UC 1APNA 1C8M2 4HKWA 3VBFA 4FPYA 3E6BA 1A6CA 3D8CA 4JGYB 1QGLA 2DU1A 3RJ2X 1HRV3 4ISRA 1AF9A 2QUOA 4HVOA 4XPVA 3E6CC 3HD8B 4RQPA 3ZYIB 1SBFA 4RHV3 2UURA 4FPEA 4QPYA 5CADA 1V6MA 4EN6B 3FC0A 3SITA 3M3QA 3ZSEA 5B2GB 1UZZA 3WQ0A 2PAMA 3O0WA 1D2SA 4IERA 1AR62 1X82A 2XGXA 4LBMA 1AR61 3CO2A 1EAH3 4QT6A 2IXJA 2O8QA 1YI9A 3B69A 3MZHA 3B9CA 4CDQC 1SCRA 1CESA 1E57A 4NHLA 1AL0G 1OFSA 1QJU3 4AE2A 1DDLA 2D6NA 3RJRA 5I8YA 3A0NA 1UW8A 4JGYC 2BNMA 3N7JA 1VB2A 1LGBA 5CG8A 3DN7A 1UPSA 2E6VA 4LHKA 3SH4A 4AFBA 4KBBA 2ZGUA 1UN1A 5H9QA 3CEWA 2ZX1A 3ZX7A 3IPVA 1WCSA 3PVNA 3ZFEB 1OD5A 1DQ5A 1AX2A 1RINA 1RHI1 3SNMA 1CAUA 4FXKB 2G9FA 1NY72 1TME1 1VBE1 4COVA 2TEPA 4QPGB 1W39A 1PK6A 2C9AA 2GMPA 3M3EA 1DGWX 1YI7A 2HWE2 1NA1C 4TZDA 4Y22A 3SCHA 1KQRA 1Z7S1 2D6MA 2OIIA 4FPFA 1DBNA 4M3CF 3R4UA 3TWIA 1CAWA 3WVJA 2JG9A 1YUDA 1N3OA 4IV3A 4WM7A 5LRRA 3MYXA 3ZFGA 1HKDA 1XNDA 4UW6A 2PHDA 3WINE 4B4RA 4BHPA 4CZSA 2YY1A 1UL9A 2HWF1 4E4DX 1NLRA 3FBYA 2ET1A 5GLUA 3ZFEC 4E9KA 1ZRCA 2VNGA 4D69A 3WG4A 4CEWA 3M1HA 3LCPA 3M4FA 4RA0A 5FAXA 3B3QE 3WP5A 1BBT2 4QPGC 2EAKA 3NO8A 3VV1A 5JDBA 1BBT1 4GKYA 1ENSA 1S2KA 1GV9A 3M70A 4HT1T 4MGYE 3H3ZA 3OYWA 2R1DA 4MLOA 2NMOA 4OHVA 4YG6A 2WFF1 2AR6A 1H0BA 4TWTA 2HWD2 4XFAA 3WUDA 5KXDA 3NW4A 1GZ9A 1J3RA 5IK5A 3THPA 2HWD1 4LLOA 4DY5A 2VOKA 2ET7A 2VGDA 1B09A 2HJIA 4X6QB 3L2HA 4NN0A 1URXA 1RUI3 2IXCA 3U11A 2XJSA 2K2SA 3O5SA 4QM9A 4AVVA 4PCRA 1AR92 4O9GA 3EXUA 3WR0A 4Q0SA 3GYDA 4ES9A 1ND2A 3E5UA 3HMYA 5T3NA 3LSDA 4SLIA 3E5QA 5I91A 1ENXA 4LO4B 4KL1A 3BB6A 4R9CA 3WDVA 4CRQA 5E16A 5C8WA 5JSPA 3TRSB 4A7KA 1RUC3 1ZX5A 3ZDSA 3ZIXA 2VOVA 4CDUA 2GN3A 4H7LA 5BNOB 2LUWA 4AG4A 1JBCA 2WS91 4EROA 5FQ0A 2IFWA 3AYDA 2GC2A 2HEYF 1QXPA 2EALA 3V64A 3I2DA 1RTVA 4GB31 1O7FA 4Z1VA 2BW8A 4B3NA 3AYCA 2V09A 2B45X 1MS8A 2ZAHA 1YLLA 2PFWA 3N7MA 4FXGB 3B9IA 4MZUA 1VLNA 1I3HA 3NAPB 4QQHA 1NQJA 1KRIA 1CPNA 1W6NA 1XQNA 2UWBA 3CLPA 4JC1A 4Q4W3 4YM1A 2BGCA 3ZXGA 2ATFA 3WW4A 1FX5A 4KU7A 3TYJA 4QGNA 5DXDA 1YJLA 3AJZA 3FUQA 5BNOC 3ST7A 4Q1PA 3H7YA 1U12A 4DRRA 2ZX0A 5CNAA 1QDOA 3LA3A 3E5XA 2PHXA 3N7LA 1OA4A 4AEDA 3OJBA 3PJQA 4OVEA 2WA3A 1FATA 3AB0A 1AVBA 2PLV1 1GZWB 1YRZA 3CL1A 4D3WA 4XHBA 1DHKB 1MQTA 3NAPC 1WLDA 3AK0A 4JGZA 4AQSA 3IMNA 1Y9QA 3AYAA 3GZTB 4YZ5A 1RUD1 4AHYA 1H1AA 3T1MA 4JQRA 1R091 2D3SA 2XVGA 4OULA 4RS5B 3UV9A 4LTAA 2DURA 2VXRA 4P5HA 1PO13 1PVC3 2QNKA 3FLTA 5T5JA 3FJSA 4B4PA 3JU9A 1ZRFA 3U10A 4ZU4A 1W6OA 4IEVA 1FV3A 4XDQA 5JOZA 3R0RA 4QX5A 4YVSB 1RITA 1O4ZA 1RUJ1 4XF4A 5L36A 1WLWA 4XBLA 1BXHA 1Z0HA 1CD3G 4HMZA 3USUA 5AC92 2XBO1 3VHPA 1G6NA 4DZGA 2GH8A 1FPN2 2YUEA 1AR72 4MXWB 4FAGA 4L99A 5T55A 2ZKNA 2H6CA 1X7NA 2P3KA 4Y20B 1LEDA 2R0FA 2E9QA 3H50A 2RS33 4ES8A 1CIWA 2WIIB 1HIXA 1HRV2 2BUKA 2BBVA 2H0BA 1HRV1 1U0AA 1Q8PA 1KITA 4YVSC 1YJKA 2RM23 1VBC3 3FZ3A 4JCKA 5HCAA 3HT1A 1LU1A 2D44A 1AYN3 3JB8A 3KCYA 1MS3A 2JE7A 2NMNA 1PM7A 1OOPA 2I74A 1NZCA 2XL9A 4LULA 2G4IA 1IQAA 1EAH2 3P3PA 1RUE1 2ZHNA 2X53S 2Y38A 3FFQA 1EAH1 3AKTA 1YWKA 2YGLA 4W6YA 3KT7A 3H7JA 1UZYA 1QJU2 2P17A 1COV3 2W08A 4UW4A 1QJU1 4PBOA 2GC3A 1AUYA 1KS4A 4YGBA 2D6LX 1RC6A 3K51A 5K8SA 2WNVB 1Q8SA 1WMEA 4FPGA 1DGRA 1PIV3 2VECA 1CAVA 4PDWB 4Q0VA 5HCBA 3VZMA 1C1FA 3LZZA 4Q8KA 4M0NA 2NPIA 1NCRA 2JJ6A 2X8KA 3DL3A 4KGQA 5JI7A 4LE3A 2E7TA 4BA6A 4ISQA 2P3JA 2O0OA 3J8F2 1YFXA 3AFGA 2YXSA 2K0GA 2UWAA 4TSVA 5DZGA 4YARA 2GH2A 3J8F1 4I0BA 4Y26A 4PIZA 2MNGA 5C4WB 4JVAA 3ZSKA 4ATEA 4B7EA 3I54A 2I2SA 1S0BA 2LM3A 4XJ9A 1CGPA 1AX1A 3VBSB 1QDCA 1H2NA 2WNVC 2YDEA 1GYKA 2ZHKA 5I0TA 5SV5A 1XYOA 1Z78A 2WT0A 4H55A 3NKGA 3BU7A 4OHYA 2VMIA 3VBRB 3AMHA 4LBQB 4QPIA 4OUSA 4L92A 1V00A 1DGRN 1RB8G 5CFCA 1VRH1 5J7MA 1QMJA 1D4M1 4HK8A 3URFA 2A6ZA 2EF6A 5J48A 2Q4SA 1AR83 1CVNA 5CAZA 1BVP1 1QKQA 2A71A 1O3RA 5C4WC 3MIGA 2BQPA 1BYHA 3GNEA 1QOTA 1CAXA 4C0HA 2DVDA 4CDWA 4WM8A 3MFCA 1XNCA 3VBSC 3MF6A 1V6JA 5DUUA 1OQ1A 3FUOA 5AVAA 3VBHA 3T1LA 3JBG1 1FMD3 3WT3A 1LU2A 1NE6A 3C2UA 2BVVA 1PO23 5FBZA 4LUKA 3VBRC 1W6PA 3TOJA 1FT9A 1OQEA 5IT6A 2GMMA 1IPKA 3JQWA 3ILFA 2CWSA 2GSYA 3VKOA 1BJQA 1N1YA 2WLPA 5T52A 1RUI2 4L8QA 4YG3A 1O3TA 5L19A 2AUYA 5H9PA 4XHXA 4YZ3A 4AGVA 1F9KA 4ATFA 1IKQA 3O7OA 4WZFA 2ILMA 4EWAA 1W6MB 3VZKA 4IEUA 3TN93 1DG6A 4Y1ZA 3R6SA 1JUIA 1H8VA 1G9BA 4DY3A 3H1WA 1RUC2 2QKDA 2JG8A 2DUPA 5I8TA 1RUC1 5K0UA 1OLRA 3AP6A 2WLQA 4H7MA 2GNMA 4FPJA 4R52A 2WNEA 3L2YA 3KM5A 1RVF1 4O9EA 1MS9A 5FLIA 3ZN6B 2WSUA 1C57A 1BMV2 2DU0A 3AM2A 4X8NA 2OYZA 2D43A 1DU3D 2GN7A 3HQXA 4LA3A 2DCTA 4LEJA 4KG8A 4CP1A 1O3QA 1GFF2 1UX6A 1X8MA 2RR11 1J3PA 2DF7A 5ABJC 5BNQA 5FPXA 2Q5TA 4Q4W2 4BM8A 1S0CA 2DCZA 4K7JA 5T5LA 3EBRA 4KH9A 5C8CB 4CDQA 3FWEA 5JOWA 2WJSA 2PN5A 2ZGQA 3RNSA 1KDMA 4UBHA 1R083 1UKRA 2XB6C 1QJX1 1RL3A 3D0JA 4LHLA 3MGUA 5DUXA 3VZNA 4JGYA 3HT2A 1QQP1 4MUVA 3AKSA 1AHSA 1F5FA 1HW5A 1V70A 3AP9A 3GZUC 1NXD1 4K21A 3U0ZA 1G9AA 1H9PA 1LOCA 1MVQA 2UYAA 4LBKA 3S7IA 4BQ1A 1N1SA 4MVTA 3B00A 4QGMA 4I3PA 4YGDA 2Z5WA 3IM0A 2OVUA 1MS1A 4FTEA 3DKWA 1Q43A 4K40A 1YNAA 4Q2FA 2UU8A 3OF1A 1ASJ1 3VBOB 5CU1A 5CFDB 5KBFA 5C8CC 4Q4X1 1SBEA 3WP6A 1NA1A 1PO12 1X33A 1PVC2 4JV4A 5FPZA 3V0AB 3IDEA 3WXPA 2GAUA 1JYCA 4FQZA 1RJ8A 4W6XA 2A3WA 1LCLA 1LOAA 4TYSA 3AMQA 3BPZA 1C8NA 1DQ6A 5GKAC 3CJIB 1HV1A 2XLFA 3ZFEA 2MEV3 3N35A 3AP5A 3POWA 2TBVA 2VOWA 3W58A 3CJXA 4COYA 2HWC3 5IUQA 2ZABA 3VBOC 2WZR3 5CFDC 4FOYA 1SFNA 3X29B 4QPGA 3RZZA 1LKNA 1RMU3 3AYEA 1IHMA 4IETA 4Q29A 2Z79A 1QNYA 3V65A 5F1RA 1FV2A 1ZZCA 4B29A 3PVOA 4Q4Y1 4L9BA 2RS32 1LENA 1OPMA 2ARBA 5EJ3A 2P3IA 3EQEA 1VBA1 4RR3C 4AI8A 4EN0A 2R30A 4G4FA 4PQ9A 3MW3A 4A3XA 4XFFA 4LO8A 2RM22 1VBC2 3ZO0B 3CJIC 3AX4A 2X29A 5C9AB 1AYN2 1PGSA 1SLAA 3JZVA 5L7OB 2GU9A 3LWCA 4MYEA 1QU0A 1YXWA 1ZREA 1CR7A 1UF2C 1UIKA 3UJOA 4HANA 1C4RA 4AVSA 4XFHA 3MW4A 3NSTA 1SDWA 1C8M1 1COV2 5EFUA 2OUHA 3NVCA 5J36A 4I30A 3GZAA 4N43B 4Y24A 4BCUA 4J6GA 1LJ7A 2AH2A 3JD73 4OHXA 2JICA 1O91A 3MICA 3AFKA 4P9LA 4IV1B 4Q0QA 1Q8OA 2WT2A 3MPPG 1AL23 3R4DB 4FTBA 3NV2A 1PIV2 4C1XA 2ENRA 3VGIA 5HBAA 2R0HA 4Z8BA 1C1LA 3WG1A 1PIV1 5F9TA 1CONA 1TMF3 5C9AC 4GH4B 5J98B 4Z92B 2MHFA 5L7OC 2AGSA 2CY6A 3ZVXA 2ZKLA 3IBMA 3FFZA 2GMEA 1V6NA 3MIDA 4FAHA 4CP0A 1ULEA 1ZZ6A 4NWWA 4AGGA 2D5FA 4CEYB 1DZTA 1GLHA 1HQNA 1X8EA 1WBFA 4UXAA 4N43C 4HN1A 1VAKA 3KGZA 3QBQA 4PLNA 4IV1C 5BNNB 3FBMA 4DINB 1M06G 3O14A 4K3UA 1J1LA 3PVBB 5HCFA 1JTZX 2WWSA 3MIHA 4D7SA 4GH4C 1PGW2 4Q26A 4HLTA 3I8TA 4I02A 2OA2A 1PGW1 2G9GA 4WZCA 1NY71 4R9DA 2YHJA 3OD0A 3VDDB 1GICA 4Q27A 4AI0A 4AEKA 4B4QA 5CBLA 1BCXA 1EYBA 5BNOA 1BEV3 1PZ8A 4CEYC 1SMVA 1H8TB 1AR82 3SCFA 2HWE1 1XRUA 1XNBA 4AYUA 1AR81 3WQ7A 2A5ZA 3B5LB 3FE5A 4PIYA 3WNXA 2IXKA 5DZEA 3EO6A 5BNPB 1RUF3 3AP4A 4FPLA 4KWKA 2ZGTA 2DUQA 4Q8LA 1U5XA 1FMD2 2O8OA 4DOUA 1LECA 1ZA4A 3QCWA 2BFUS 3NAPA 4Z82A 1FMD1 2VU9A 4DQAA 4COWA 2DCYA 5BUVA 4AFAA 1QF3A 3O0VA 1HRI3 1R1ZA 3VZJA 2MPFA 4N7IA 3WW1A 2W39A 5FMOL 3VDDC 1LGNA 3RS6A 3M7AA 4AVCA 2QFEA 1NYWA 5I93A 2WNUB 4AI3A 1H8TC 4HPKB 2PTMA 4HZFA 5FLHA 4Z07A 4NOTA 1ND3B 1ULDA 4WVMB 5BNPC 5HXVA 3TB0A 4IL7A 3TN92 1UU5A 4GIQA 1X50A 3POYA 3TN91 5A3LA 4N90A 1GZWA 4OZXA 4BE3A 5JOXA 5I0SA 3H0OA 1RIRA 3ZMOA 2ZBJA 1IZ3A 2FZ1A 5JZGB 4NHMA 4CYDA 2ZCWA 3PNAA 4XE9A 4HVRA 3ZXJA 1VIWB 3MIEA 4Y1UA 1EPZA 4YM0A 4S2GA 2JE9A 2WNUC 4IEQA 1AR91 4XEZA 1LHWA 1GNZA 3AP7A 1MZ5A 4P9JA 2WSVA 1LEMA 2RS53 4L2NA 1BKZA 5I0RA 3C3VA 1ND3C 1VBB3 3ZYGA 3BOWA 4YVSA 4L97A 2PELA 5FFOC 2QZ2A 4WBBA 5FOBB 3LSEA 1TEIA 4AI2A 1H4HA 5T54A 3KT1A 1UU4A 3THTA 1C5IA 1PGL2 1QH7A 4C0BA 1WMFA 3VL9A 2PHRA 5JZGC 4COZA 1PGL1 4MXWA 4AF9A 3ZXDA 3G6JB 1PHMA 1R082 2PHTA 4MSVA 2HWB3 4Y20A 1K5MB 2RS13 3VBUB 2RMU3 1R1A3 1N1TA 1UPIA 5EWSA 3B01A 4FP2A 2WC2A 1QXJA 4B7KA 4Z2WA 1GANA 1ULGA 1YHFA 2EIGA 2XJVA 5JLVA 1GSLA 2D6OX 1QHDA 2RHPA 3O0XA 5JR7B 4BYYA 4H3WA 5F5QA 4GMP0 4OHWA 1V6LA 2Z42A 1NQDA 3TNQA 1GZCA 3S30A 4SBVA 1VAVA 3BALA 2ZOEB 3MLJA 3IWZA 3ZN4A 3PHMA 5KXEA 4OFGA 1ZM1A 1HQWA 1OLQA 3SCGA 1OPOA 2D3RA 2ZGLA 4COUA 2Q8OA 4NR1A 2ZMNA 3B7MA 1V9U2 3U07A 4XZPA 4BMBA 1K5MC 4NHKA 1V9U1 3VBUC 2XHKA 1VP6A 1POV0 2XKPA 4E27A 2C1FA 4AWDA 5A33B 3GF6A 4XF0A 2WNVA 1OMIA 1OA3A 4CEWB 1VBD3 3QACA 2A7AA 2VQ0A 3PLQA 2EXIA 3SMHA 3JB4C 3D4KA 4ASMB 3OPZA 1S1AA 3MFAA 3WQ1A 1I9RA 3V0BB 2MEV2 3OCPA 5EYYA 4OUMA 2D97A 2QZ3A 1WW5A 1H2KA 2HWC2 3VZOA 1MR5A 2WZR2 2YC0A 2UY8A 2R063 2XL7A 1ZYBA 1RUG3 5KHHA 1YCIA 1D4VB 4AVBA 1RMU2 1G9DA 4YW2A 2W0XA 3WP4A 4YZ4A 2XLAA 2ZX3A 2XVKA 4XFGA 5C4WA 5GM0A 5GZDA 1BK1A 1S0DA 3RQ0A 1JYIA 3SHRA 2VW2A 1POV3 3VBSA 1NE4A 3JCIA 3OGJA 1W6QB 2OW4A 1MS0A 5FO8B 4KG0A 1NXMA 1ZBA3 2TNFA 4YGCA 1J58A 2FMDA 3VBRA 2HKXA 4LBLA 3RYKA 4LBQA 1PZ7A 4A7ZA 1VJ2A 5AC91 2B8MA 1O5UA 1WLCA 2IZWA 1CX4A 3AKQA 1FPN1 2DVFA 4RS5C 1AR71 4EWEA 3QH6A 4NVPA 2I45A 2JDZA 2ZGNA 3IN9A 5LEJA 4QGLA 3JD72 4LA2A 4HETA 5JI9A 4XYXA 4RHV2 2NP0A 4XFCA 1AL22 1MEC3 1Q5OA 4G9SB 5ACA3 4RHV1 1DGWA 2VY0A 4XF9A 4GWMA 1AL21 1J3QA 1C5HA 1TMF2 5DG2A 2E7AA 3I4IA 5EXOA 3RI8A 3I59B 4MV2A 1TMF1 2QE3A 1DQ0A 2XJQA 2UWCA 4FOQA 1SQ4A 4MH0E 3LAGA 3WDTA 3LB9A 4E2SA 2P37A 4DPNA 1F31A 5JSRA 2VW1A 3KCXA 4GALA 2QDRA 4LBOA 4QD2A 1VALA 4PLOA 4H14A 4N9IA 2AYHA 5KHJA 5JOYA 1U5IA 4Q4V3 2GALA 3M8LA 1W6NB 1QJY3 2I07B 3ZYJB 5HI0A 4CDXB 1KXGA 3NJZA 4U2AA 1W6MA 3INAA 3LKJA 4EN8B 4QXKA 4K9SA 5ABJA 1DQ2A 3IT8A 4RFT0 1S55A 3DUIA 3BODA 1S2BA 1XXNA 2ZMLA 3VHOA 3IIAA 1ZZ7A 4A7YA 3WX5A 3QLQA 4FOWA 5FRAA 3H8UA 3OGGA 4M3CB 4J1XA 4DMIA 1ENQA 1ZRDA 1BEV2 5JAXA 2CAUA 1XYPA 5DUVA 1BEV1 2DTWA 4U36A 2RE9A 1WCDJ 1VB4A 1IS3A 1B35B 5FOJB 4YW3A 4CDXC 3WDWA 1RUF2 2BEOA 4AHZA 3MI8A 3WUCA 3S0MA 2BWAA 3AKPA 3TAYA 2YV8A 4PDWC 3WDXA 4I2OA 4YRDA 1QOSA 2O1QA 1G8WA 1O5LA 5DG1A 1HRI2 1I5ZA 2X5IB 3RDIA 5C8CA 1HRI1 1DLLA 4LBNA 1FNZA 5EYXA 4I01A 1LB2A 1D0HA 3WZ1A 1RHI3 3WG3A 3TBDA 4IQPA 1S0JA 1TME3 1VBE3 3IKWA 1B35C 4EN9B 4R9AA 3W59A 1REDA 1S0GA 2A75A 1HLCA 4RD7A 1MACA 1VAMA 3RPQA 3WDUA 1MS5A 1Z7S3 3L9JT 4PF5A 2F6BA 5E88A 2GC1A 2ZX2A 4BZ4A 3VLBB 1Q8VA 3VBOA 2PA7A 1CJDA 3A4UA 2OUJA 5CFDA 1AJOA 2X5IC 5IK4A 3USSA 4ASLA 1CN1A 1RUI1 2B46X 4LNVA 1L3JA 5I8SA 2HWF3 2XH6A 3V0AA 1BVVA 2OZ6A 3FLPA 5E8AA 4WVZA 5EV7A 1AZDA 4DNYA 2QJVA 1JOJA 2XJTA 2RS52 5A32A 4RR3A 5GALA 4AGRA 4YM3A 1CPMA 1W2UA 1MVEA 3KGLA 3VZLA 2JKBA 1VBB2 1O4TA