3FBMA

D431n mutant vp2 protein of infectious bursal disease virus; derived t=1 particles
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
433
structure length
428
Chain Sequence
TQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVANLNSPLKIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autoproteolytic Activity Derived from the Infectious Bursal Disease Virus Capsid Protein
pubmed doi rcsb
source organism Avian infectious bursal disease virus
molecule tags Virus
molecule keywords Polyprotein
total genus 94
structure length 428
sequence length 433
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fbmA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3fbmA02
4Q4Y3 4RQPA 1OOPA 2PLV1 1POV1 5CFCC 5C8CC 2XPJA 4CDWC 1AR81 2WFF3 5C9AC 4JGYC 1CJDA 1RUC2 1ND3A 1TME3 2WFF2 1RUI1 3VBHA 4RS5B 1RUE1 3VDDA 1RUD1 1ASJ1 4QPIA 1RVF3 3TN92 1VBB1 2BFUS 1AL0G 2HWF2 4GB31 3JB8A 1VB4A 1NOVA 1QJU2 5BNOA 1K5MB 1E57A 1C8M1 2R041 5C8CA 2HWD1 1HRV3 3VBRB 2X5IB 3VBOB 1PO13 1VBA2 1HXS2 4GH4B 1PIV2 1V9U2 1QJY1 4Q4W1 5C4WB 1PGW2 4IV1A 1QJX2 1ND3C 3JD72 1PVC2 2ZAHA 3JD71 3VBFB 2WLPA 4FTBA 1D4M2 2R071 3S6PA 1B35A 3VBSC 1R081 1H8TA 1MEC3 4RR3B 1VRH1 5D8AB 3DPRB 4YVWB 1CD3G 4BCUA 1AR72 5AC91 1Z7S1 3J8F2 2RS12 4QPGA 4YVSC 3TN91 1NA1B 1AYM1 1POV3 5ABJB 4WM7C 2WS93 3ZFGA 1EV12 1FPN2 1ZBE3 4RHV3 1AR82 3M8LA 3NAPB 1FOD3 1ASJ3 2PLV2 5CFDC 1COV3 2BFUL 2WS92 5BNOC 1RUF2 2RM21 1VAKA 1BMV2 2TBVA 1HRI1 5A33A 5L7OB 2WWSA 1TMF1 2RR11 5ACA1 1PIV3 1V9U3 1VBA3 1RUC3 1X33A 4Q4V2 1BEV1 1OOPB 1HX6A 2R072 1NCQC 1AR61 1MEC2 3ZXAC 5GKAC 1QJX1 1QJZA 3VBHB 3ZFEA 2FZ1A 1PGW1 1ZBA2 1FMD1 2RMU2 1C8NA 5D8AC 1HQNA 1RUJ2 1OOPC 1HXS1 4QPIB 1TME2 1VBD3 1RHI3 1VB2A 1AL23 1K5MA 2QQPA 3VBHC 4FSJA 5ACA2 1R1A3 1TMF2 2RR12 3VBRA 2RS11 3J8F1 1HRI2 2RS52 5AC92 4GH4A 2PLV3 1ASJ2 4WM8A 3ZFFA 4AEDB 5JZGA 2RS53 2HWF3 1AR83 2WFF1 1ZBE2 1NY72 2IZWA 3VBFA 3JBG2 1R082 1IHMA 1TME1 1D4M1 2R061 1B35B 3JBG1 3VBFC 1NY71 1H8TB 4RFT0 1K5MC 2RMU3 3TN93 1NCQB 2RM23 5K0UC 1QJY2 1X36A 1AYM2 3DPRA 4Q4W2 3LOBA 2FZ2A 1C8M3 2ZZQA 1PIV1 1V9U1 2DF7A 1VBA1 4GMP0 1AR71 1HRV1 1BEV2 3IDEA 5FMOL 4FTSA 4QPGB 1NA1A 2WZR1 1PO11 1MQTC 3CJIC 4N53C 1RMU3 4QPIC 4N43A 1RUG1 1AR63 4AEDC 2RM22 4Q4V3 1F2NA 1NA1C 1VBB2 1AYN2 4GMP3 4WM7B 4N53A 1FMD2 4JGYA 1RB8G 1AR93 3NAPA 3DPRC 2GSYA 4CDXA 2HWE1 5BNPC 5DDJ3 1MQTB 2HWC1 3CJIB 2XBO3 1MEC1 1AR62 4Z92B 1FOD2 1VBE1 4CDXC 5A33B 5BNPA 5J96B 1FPN3 1W39A 2HWD2 5FMOS 5AC93 1C8M2 5DDJ2 4CDUB 4CDQC 1Z7S2 1AYM3 1BMV1 1B35C 3VBSA 1RUF1 1EAH1 2RS51 2WS91 1AYN3 4JGZB 3VBUA 1RHI2 2VQ0A 1RUD2 1H8TC 3ZFEB 1RUI2 4RS5C 1FOD1 3JBG3 5ABJC 1ND2C 1RUJ1 2HWC2 1EV11 2MEV1 2HWB1 3ZFGC 1RUH1 1ZBA1 4FTEA 4CDQA 1HRI3 1TMF3 1R093 1NCRC 2RR13 4CEWA 1PVC3 5ACA3 1M06G 4PDWB 4CEYA 1F8VA 4Q4Y1 3VBUC 2WZR3 1VBC3 4IV1C 5CFDB 2BUKA 4CDUC 1RMU1 1BBT2 4WM8B 1RUG3 3ZFFB 1PGL1 4CDWB 4AEDA 1OHFA 4Q4X3 5JZGB 1NCRA 4CEWC 2WZR2 1NG0A 5C9AB 5A32B 4GMP1 1RUE3 4IV3B 1OPOA 4RQPC 1ND2A 1RVF1 5BNNB 1RUE2 5LK7B 2HWC3 4GH4C 5CFCA 4RHV2 4WM8C 3ZFFC 4RR3C 1VBD1 4Y5Z0 1VBE3 1NCQA 4Q4X2 4QPGC 4YVSA 4CEYC 1VBD2 1VBC2 3VDDC 5K0UB 2X5IC 2RS13 2HWE2 3J8F3 4RQPB 1R092 1RUF3 1QJU1 4N43B 1COV2 2HWF1 1ND3B 1QQP3 4WM7A 4N53B 5J98B 4RS5A 2R073 4JGYB 3VDDB 1D4M3 1PO23 2R063 3HAGA 4CDXB 1MQTA 3CJIA 1EV13 1VRH3 4N43C 1BBT3 5BNOB 2BPA2 2RMU1 2BBVA 2RS31 5C8CB 5BNPB 5C4WC 4YVWC 1R091 1PVC1 1Z7S3 2X5IA 1AR73 3FBMA 3NAPC 1VBC1 3VBOA 4CDUA 2R062 3VBSB 5C4WA 4Q4X1 4IV1B 4JGZA 3VBUB 4Q4V1 1ZBE1 4RHV1 4NWWA 1DDLA 2R042 1POV0 1RVF2 1RUI3 4IV3C 1AR91 4GB32 1RUD3 1COV1 2HWE3 5BNNC 5DDJ1 4EJRA 1VBB3 5FOJB 2XBO1 4RR3A 4GB33 5D8AA 3VBRC 4CDQB 2ZTNA 1WCDJ 4YVWA 3ZFEC 2R043 1VBE2 1RUC1 5L7OC 4CEWB 2HWD3 1FPN1 1GFF2 2GH8A 4PDWA 3VBOC 4CEYB 5JZGC 4JGZC 1BEV3 5CFDA 5ABJA 1QJU3 3ZFGB 1QJY3 4Q4W3 4CDWA 2Y26A 1EAH3 2RS32 2XBO2 1NCRB 1RUH2 2HWB2 2MEV2 1AYN1 1R1A2 1SMVA 5A32A 5C9AA 1QQP1 3JD73 1QJX3 1AR92 4IV3A 1FMD3 1RUG2 1AL22 1PO21 1VRH2 1HXS3 1ND2B 1PO12 5BNNA 5CFCB 1AUYA 1R083 1RHI1 1PGL2 1RUJ3 4SBVA 1HRV2 1BBT1 4Y4YA 1AL21 1PO22 2MEV3 1RMU2 2HWB3 1RUH3 1EAH2 1ZBA3 2RS33 4YVSB 4Q4Y2 5L7OA 1QQP2 1R1A1 4PDWC 3JB4C 1A6CA 4LLFA 5K0UA 4NWVA
chains in the Genus database with same CATH superfamily
3ETQA 2EXKA 4RQPA 4BIOA 5LBCA 1POQA 5CFCC 4Q0UA 1KS4A 4YNIA 2ZX0A 3TBDA 1VMHA 4FOYA 4W6XA 4RA0A 3P3NA 2XUEA 4AHWA 3VZLA 1TME3 3NQHA 3WP5A 3GALA 4P5HA 1Y43B 3MFCA 4EN7B 2C26A 4Y20B 4UAPA 4NR1A 1RVF3 3K4ZA 2ZX4A 4HKOA 5LCWL 2WO1A 2BFUS 1AL0G 4FPLA 2HWF2 3WNPA 5FYIA 5CG9A 3C7OA 1ULCA 5LA1A 2YC4A 1XE8A 3OF1A 2VNGA 4DFSA 1E57A 4E2GA 1UO9A 2YROA 2CHHA 4G3YC 2VW2A 4I01A 5C8CA 3UL2A 3KHBA 2YG0A 3QCWA 4HK8A 4XBQA 2FCUA 4R9AA 5FZ0A 2VW1A 2JWPA 4XFGA 5CAZA 4Y22A 3POJA 1WUVA 3E6CC 1PO13 4GH4B 1C28A 1R64A 3TNPB 4Z8BA 1ODNA 1UYXA 2Z2SB 4PJYA 4XC9A 2EXHA 1PGW2 4Q0QA 4YW5A 2ZGLA 4A7ZA 4XW3A 1QXPA 1HV1A 3JD72 3VBFB 3JD71 4Z82A 1TZOA 1J3PA 1K45A 4YGEA 1UZZA 2FQPA 1S0IA 2ZGUA 1LOFA 2CDPA 4NRMA 1YHFA 4UFMA 1XXNA 1KRIA 3S7EA 3B7MA 3CHXA 3VBSC 1LU2A 4LBNA 1R081 2B7YA 4XFIA 5IK8A 3RMXA 4RR3B 1LHVA 4Z07A 1DIWA 4OCTA 1ZZ9A 1W8NA 2PQSA 4YVWB 1W03A 4BCUA 3NNJA 4DY5A 4LO7A 1PZ7A 2JE9A 5IVJA 4FFFA 1NA1B 4I30A 5I0TA 5C3RA 1YQ6A 2CTVA 3VB9A 3FZ3A 2XVGA 4WM7C 2HEWF 1XYOA 3VKFC 4BXSV 3ILNA 1CX1A 3A22A 2VBDA 3H50A 2Q8CA 1YEWA 1PNFA 1KD7A 3VHRA 1A8DA 3MF6A 3N36A 3OCPA 1GKBA 1YXWA 1QDOA 3VLBB 1H1AA 3R05A 2JIGA 2VECA 3KMHA 3BIEA 3VUOA 5F5AA 5FZAA 2D6MA 3OBAA 2PLV2 4XMAA 3RWNA 4LPLA 3ZO0B 3HQUA 1CX4A 5CEHA 1GUIA 4FPCA 4KBZA 1T6BX 5HV4A 2B9UA 2YXSA 4RGAA 5FYUA 3WUDA 1YQ2A 3GZAA 3V64A 2HJIA 1NXD1 3OEBA 4YM1A 3UK9A 1DP0A 1HRI1 4I0BA 4LIUA 3LZZA 1JZ8A 4ATFA 5LW9A 2P3YA 2QUOA 3VKLA 1SACA 1V70A 4Q4V2 2DCKA 2FMDA 4AGGA 4DINB 1PMJX 3FUQA 5DZGA 2Y6JA 2WABA 4MHUA 3WD5A 1W6QA 2Y6KA 4LKDA 3FX3A 2R072 2DU1A 1PK6B 5I8SA 3ST7A 2FDFA 2VAUA 1AR61 2WQ4A 5JCTA 1OC1A 1BK0A 2J42A 2Z4FA 3AMQA 1PM7A 5AFBA 1UKGA 4PBPA 2NQYA 3T2PA 1QJZA 3ZFEA 4E4ZA 4P9YA 1ZBA2 2WA3A 5C70A 2W87A 1CN1A 1G9FA 1LENA 2RMU2 2H6CA 5FYHA 4LUKA 4LBJA 1HQNA 1WA4A 1OOPC 2WZEA 1RGSA 3RZMA 3AB0A 3WHTA 5IAXA 1IPSA 2JEMA 1H6XA 5JAXA 2VNRA 1V6NA 3AM2A 2IVIB 1UMHA 5JOYA 1A78A 4LHKA 4AFDA 4CCEA 3AP5A 4MUVA 3PUAA 4LK6A 5FXXA 1AJOA 3I59A 4FPJA 4MSVA 4LTAA 3CO2A 3L2YA 5H9PA 5LY2A 4QPYA 5ACA2 1R1A3 5JSRA 1HRI2 1W05A 4UBGA 2JDPA 3H8OA 1RJ8A 3KV6A 2JG9A 4TWTA 5AC92 2AYHA 3KD4A 3OUHA 1ASJ2 1LR5A 1QNYA 4ZS3A 3ZFFA 2EAKA 4AEDB 4L9BA 1OKOA 2HWF3 3GM8A 4N7UA 1UMIA 1UZWA 1YCIA 5FP4A 2WFF1 4AHYA 1MS4A 3K2OA 3AYAA 4E8DA 1OQ1A 5FK8A 1X50A 2BGCA 4GA9A 3E97A 5DQ0A 4HL0A 2VNOA 2RHPA 1MS1A 5FPZA 1NE4A 2VVEA 1LAJA 1LHNA 5J1XA 3LFMA 3WG3A 3H1YA 1MZ6A 4DXRA 1B35B 4O7XA 4A7KA 5F1RA 1W8HA 3WG1A 1XBFA 4RFT0 4BH9A 3MUZ1 2ERFA 1QJY2 4Q4W2 1AYM2 3AXEA 1VIWB 4QQHA 3VD5A 4LHSA 3WDUA 4DEVA 5FDBA 3IT8A 1YJKA 1VBA1 2VOVA 5FP7A 2GNBA 2Z79A 4BISA 3W5MA 4OQ8A 3IDEA 3ES1A 3PTRB 2WZR1 3KZ4C 3V65A 1H0BA 4N53C 4DXZA 3W9AA 5KR7A 4XJ8A 2Q1FA 1AR63 1VPHA 1W0NA 3D4KA 5FMDA 3VKMA 3GCWA 4M3CE 3MDPA 3M3EA 2C9KA 1NA1C 2BNMA 4LO8A 2VM9A 1I1EA 4GMP3 4WM7B 3V0BB 3HQRA 1FMD2 2OA2A 4BQ1A 1ZRCA 4IEOA 1RB8G 2CAVA 4YZ3A 4DUWA 1VR3A 3W5NA 1KITA 4CDXA 1OQDA 2HWE1 3CDZB 5DDJ3 1BQPA 3LKJA 1MQTB 2HWC1 5FUPA 5FQ0A 3I2OA 2XBO3 4J6GA 2KM2A 3MO4A 3ZYFA 1FOD2 4O61A 4HSJA 1O4ZA 3BUCA 3ZM8A 4EZHA 4XFAA 2WZ8A 2WFPA 1FATA 5FREA 2Y6FA 3AFKA 3H1WA 2F4PA 5AC93 3PNAA 2TUNA 5FYMA 5DDJ2 4OVEA 3ZN4A 3WHUA 1NYWA 2AZ5A 4IEWA 3IB3A 5A70A 5JPNB 3SH4A 4Y1ZA 5FZ9A 1RUF1 4Q8KA 1OKQA 2RS51 4HN0A 5EPAA 4FPYA 4CCJA 1JYXA 4YW7A 4AVVA 2OQ6A 3AZYA 3FC0A 3RZLA 3WG4A 1H8TC 1RUI2 4XQDA 5LB6A 4RS5C 3KSCA 1XSRA 1CZVA 4IEZA 2A6VA 5HV0A 1O3QA 3K3OA 5DPNA 2W1UA 1QHDA 3T4VA 4K1YA 4C8DA 1WKYA 1Q8VA 5FZ4A 5KHJA 1JOJA 2P1BA 1UPSA 1W6MB 3SH5A 3USUA 5A7WB 4BHPA 2DBNA 4FTEA 3DKWA 3WF3A 1GWKA 1G9BA 5CKMA 5GM0A 5DAWA 5J3UA 4WVMA 5GALA 4IW3A 3LOIA 4GULA 5F6KA 4CEWA 4QQ2A 1M06G 1GV9A 1WWYA 2JDUA 2R30A 1FNYA 2WZR3 4Y33A 5CFDB 4XILA 4RN5A 4OHVA 4AEMA 4CYDA 5FP8A 1IPJA 3ZFFB 2J1UA 5FO8B 5EYXA 1D7PM 1FV3A 3Q8FA 1OHFA 3IIAA 4FPKA 3ECQA 1YYNA 2QQKA 3NV2A 3MW2A 4CP1A 5JMOA 5KXBA 2D5HA 3U1XA 1NG0A 3FBYA 4YG3A 5A32B 1G9DA 2BV4A 2IXKA 3VDCA 1K3IA 1T2XA 1Y3TA 2KR2A 3NV1A 1SLTA 4XFHA 4AVCA 1OLME 2YDEA 3AFGA 3INAA 1WZXA 2YUEA 4ZXKA 4EROA 4CCCA 1OH3A 2K0GA 1WBLA 3B93A 2WNUC 4HT1T 5A6XA 2HWC3 2VTFA 4GH4C 4OZOA 2I74A 4XQ4A 1GU3A 3V0AA 1J84A 4YG0A 1RL3A 1US2A 4GIQA 5GLZA 1XE0A 4LO6B 4A44A 1IOAA 4BK5A 2H0VA 2GNTA 1YLLA 3S57A 3WCRA 3T0DA 4QX7A 1CESA 1DCSA 2ZX1A 4QKDA 1OBNA 4MXVA 4XUOA 2JDKA 3E5QA 5KC5A 3VDDC 1SLLA 1WW5A 3PHMA 2MHFA 1DGRA 1LKNA 1NUKA 2OS2A 3MGUA 4NJ4A 4PIXA 4A3XA 4W8JA 4DZGA 1V6KA 4NAOA 3BTXA 2C4XA 2CDOA 1RUF3 3FLPA 4YGCA 1UN1A 2D44A 2YGMA 1Y7BA 5CIRA 1GMMA 4N43B 3WF4A 3T30A 2W1QA 3TEWA 1O5LA 3AP6A 1LEMA 4A7YA 1OH4A 1UNBA 3UGFA 1K12A 1RYYA 4A45A 2W39A 2BDRA 3O0WA 2BRTA 3WZ1A 3AJZA 4XJWA 3WINE 4W6WA 2WT1A 3LSEA 3BU0A 2R073 4U36A 2XJVA 4M3CB 4XCBA 2DCZA 3ZXEA 2XMLA 3HAGA 3VD7A 2W52A 4ORFA 4O9EA 5L9VA 1QMJA 4XDQA 1MQTA 4KU8A 1YI7A 2VCCA 4XTPA 4D69A 4N43C 1H2LA 4I0AA 1S0JA 2JB8A 4J1WA 1BBT3 2BPA2 3EJKA 1LODA 2RMU1 5I0RA 3OGJA 2O1QA 1A8MA 1LRHA 2VZRA 1CAWA 2ZGRA 4JHTA 4QB2A 1OD3A 5C4WC 3LFIA 3UGHA 1Z7S3 3U11A 1AR73 3FBMA 3UGGA 1VBC1 3VBOA 4CDUA 4IEUA 1RITA 2P6CA 3THCA 4OFGA 3VDBA 4CCLA 3PTYA 2CU5A 3ENRA 4FAGA 1ULDA 1N3PA 2E7TA 3ON7A 3VZMA 4BQ2A 4HZFA 5BXXA 3PVNA 4C91A 3VD3A 2A6XA 4PIYA 1RVF2 2ZEXA 3O1OA 1LHWA 4HKLA 4LA3A 1BHGA 3APBA 1ZRDA 2VY0A 5DG2A 2XQXA 3O14A 1OVSA 5FR3A 5GZGA 5I8TA 2Y6GA 2BZDA 5T52A 4NHKA 3IWZA 4GZ9A 5A1LA 2VCAA 4CDQB 1VRBA 3WQ0A 2FD8A 1F31A 1VMFA 1WCDJ 1W9WA 4J25A 4EZ4A 2IFRA 3E5XA 1ULFA 1VBE2 2A7AA 2B42B 1W6OA 1CPNA 4CEWB 2HWD3 3GXUA 2GH8A 2QZ2A 3VBOC 2LUWA 2HYKA 4JGZC 1BEV3 1MS5A 4B7EA 2YZ4A 5I93A 3THPA 3LEKA 1W8WA 2D7FA 2R6QA 3CMGA 5A6QA 2GC1A 1LHUA 1DLCA 1JZ2A 2Y6LA 1VLNA 2Y26A 2RS32 4BQWA 3T3YA 1OF4A 1RUH2 3BTAA 2HWB2 1W04A 4BZ4A 1SMVA 2VBBA 4EE2A 4K40A 3BODA 3JD73 2DWRA 3T2QA 3AVRA 4BK4A 5A3LA 4LKFA 2YB7A 3ZLIA 3AC0A 3B00A 1CAVA 3HBZA 4JQTA 3WOGA 4AVBA 4CXYA 4FFIA 3KV5A 1RUG2 3E5UA 3ETPA 1KDMA 1AL22 3I3QA 3WXPA 3PU3A 3WUCA 3FN9A 1OI6A 4AE2A 4EWEA 1PO12 4QKFA 4A41A 4AFCA 3UJQA 4F3JA 1DHKB 1ZZ8A 3H0OA 4XFCA 4DIQA 1CGPA 5GLVA 2VZ3A 1RUJ3 2YFUA 2NLRA 1BBT1 5A1FA 1AL21 2MEV3 3I3DA 4NHYA 4AWDA 5JLVA 5FYTA 3M3IA 2CGOA 4Q4Y2 5C33A 1IQDC 1JXNA 3H9AA 4IE7A 3EHKA 5EZWA 2RJLA 3LGRA 1D2QA 3MF9A 3MLLA 3JB4C 2VMDA 3ZN5A 2BW8A 4LLFA 5K0UA 3VHPA 4D3WA 1RINA 1E5IA 4D6QA 4Q4Y3 1DZTA 3PU8A 2PLV1 4ES9A 5FKCA 2ZEZA 2OKXA 1U5ZA 3PVBB 3M3CA 2Z5WA 4IXLA 1PK6A 4B4RA 5H9SA 4TYSA 3ES4A 3TEZA 1H6YA 5FY7A 1I6XA 4BDVB 5A7SA 5I0DA 4G9SB 4Y24A 4XUTA 5EJZB 3BU7A 3I4IA 5A7OA 3UESA 4N8MA 4RS5B 4Y1UA 4EN0A 5FY4A 1N1SA 1WLTA 3GZUC 3ZIWA 4MGTA 4AL9A 1V6IA 1V6JA 2D3PA 3H3ZA 1BZWA 3DF0A 3O1PA 3DYMA 3PUHA 3QH7A 2XR4A 2J7MA 1DU3D 3NNMA 3QLQA 5IUQA 4XMIA 4BLJA 1WLWA 1NOVA 2B4KA 4MVTA 1K5MB 3AP9A 2BWAA 1C8M1 4META 4NE9A 4EN8B 4KG0A 2XLAA 1LNSA 5D2AA 1JHJA 1HRV3 2HWD1 4AK3A 4AI0A 1YNAA 2GAUA 3MYXA 3Q8BA 1XNDA 1N1VA 2ET7A 5GZEA 3VBOB 1W9FA 2ZPXA 1PIV2 1V9U2 4FPFA 4LE3A 4R4XA 5EJ3A 1HIXA 3IIIA 1HW5A 3WP3A 1XNTA 4JDNA 5C4WB 3GBGA 4DPNA 3OBZA 5DUVA 4HOOA 3LPFA 3L2HA 3POIA 2V4VA 4MGSA 4NROA 4XCAA 3SH3A 2D97A 3DECA 1PVC2 2A6WA 4CP9B 1GLHA 4Y1VA 4FTBA 3LWCA 5DXDA 5FZHA 3TWIA 2Y6HA 2ZHNA 3WNNA 3FJSA 1HN0A 1ZZ7A 3ZR5A 1Y4WA 3FLRA 4EV0A 5C3QA 4MADA 3BPZA 5IVEA 1UIJA 4JKMA 3ASIA 3IDBB 1CAUB 1B35A 4LXLA 1NQJA 2I07B 3BGAA 3WV6A 4E8CA 1JN2P 2X05A 1JHNA 3CIHA 1MEC3 4PLNA 3WDYA 3RSJA 2P3JA 3CU7A 5B4NA 3MLKA 4ITCA 4LUMA 4E9KA 2VMCA 4W65A 1O8SA 5D8AB 2VMEA 5D21A 1BJQA 1QJFA 3CL1A 3C7FA 3AP4A 4H3WA 4S2HA 3LD8A 4M4RA 1AR72 1O8PA 4NN0A 2RV9A 3J8F2 4KWJA 2J1EA 2D40A 4Q29A 3UV9A 4QQLA 2AENA 2B46X 2R0HA 4LHLA 4P14A 4XE9A 4PIZA 3HN1A 1MPXA 3ZFGA 2VZSA 2UYBA 1F5JA 3SCFA 2ZHKA 3B94A 1IS6A 4ARYA 4Q0PA 2XVKA 4QXCA 3AYDA 2J1AA 1FPN2 4Y3OA 3GHMA 4RHV3 5EV7A 3O1MA 4QM9A 2QQOA 3JZVA 5A80A 2VMGA 3FFZA 4LBKA 3M8LA 1UYPA 4A42A 5LATA 2E53A 1BVP1 4UF0A 1G9AA 3DV8A 1DGWA 2A3XA 2YPJA 4IE5A 3T1MA 4DMIA 4D94A 4FFHA 2ENRA 3ROUA 4FAHA 4Q1RA 2V5DA 4MG2A 2EIGA 4OULA 2E7AA 2WZPP 1WLCA 2A6ZA 1J3QA 3I3BA 4M4PA 4YFZA 3GZTB 4TLGA 5IK4A 2WS92 4YYOA 4Y1YA 5BNOC 4MGQA 5A3OA 1HJFA 3DGTA 1RUF2 5FK7A 5FYBA 1F5FA 2VVFA 4WV8A 3VZOA 4K7JA 1BMV2 2DDUA 2GMMA 1AX0A 1CZSA 2TBVA 1SPPB 2RR11 4ET7A 3WQ7A 3ZKUA 1VBA3 1YWKA 1RUC3 3Q8AA 4KMQA 4G4FA 1GZCA 1YIFA 1ZRIA 2WDBA 1REEA 3QBQA 1S0FA 3L9JT 2X10A 4UI9L 5FZMA 1ZYBA 2W68A 5EXOA 5FO7B 5DUUA 4BQXA 3LDBA 4ISRA 3OEAA 3RYPA 1OUSA 3ZXAC 3SHRA 5GKAC 5T5LA 5KC6A 2X53S 1OSGA 5FY1A 5K4LA 3RWKX 1RXGA 1QJX1 4MZUA 3WNKA 3CNAA 1Q8OA 4QKBA 3VHNA 3JU9A 3VD9A 1FMD1 3CJXA 1C8NA 5D8AC 2VZVA 3KCXA 5FMOL 4Y20A 4AFAA 1HXS1 5A3PA 1L7RA 1RHI3 1UY0A 3IZOA 2D6OX 2BWCA 1K5MA 3KQ4B 2XHNA 5IWFA 4C90A 1JYTA 4LR4A 4A6SA 4LO5B 3WQBA 2R1BA 1BXHA 2DTYA 4NIDA 3VZKA 4D8MA 3VBHC 3LAGA 4L0PA 2QQMA 2R0FA 2NZ9A 1L7LA 2RS11 1DGLA 2AC1A 2AH2A 2RS52 4WVWA 1NAEA 1JI6A 1QF3A 3RNSA 1SHWB 4Q0VA 5FZ7A 1GBGA 1O4TA 5DAQA 1W9TA 5JI7A 1UU5A 5JZGA 4Z2AA 2RS53 4YZ2A 3KF3A 3H7YA 2LTNA 5FTTC 4CPBD 5F3EA 2QQJA 5ERLA 2IZWA 2HBTA 3ZYIB 4K8FA 4NHXA 1IHMA 4Y4RA 4CTEA 1UKRA 2DVGA 5IVCA 4YW2A 3PUIA 1D4M1 2ARBA 3C2UA 4CUCA 3NV3A 3H8XA 4CCOA 4N7IA 3VBFC 3MFAA 3BN6A 1H2KA 1H8TB 5J09A 4U2AA 1W06A 4ZONA 1K5MC 2EALA 1NCQB 2VD7A 4CDUB 1QJEA 3OUIA 2XLGA 1UWWA 3CZJA 3DPRA 1IZ3A 2WNUB 5GLWA 4L11A 3MV11 3LOBA 2FZ2A 5LZ6A 1ZA7A 1PIV1 1V9U1 4GMP0 4AI9A 3KVBA 1YRZA 4GQ7A 4AI3A 4HFSA 1RXFA 3ZSLA 3JUUA 4B1MA 1OF3A 2X29A 5F2WA 1DQ1A 3U10A 1D0GA 5BY5A 5JI9A 3CJIC 1O59A 4E2QA 2FBEA 4RFRB 4NUBA 2HLEA 5I91A 3OPTA 2OX0A 3R4UA 4IEXA 5EJ1B 2WAAA 1AJKA 5FKBA 3MBWA 2RM22 1IS5A 3RYRA 3H1MA 1NXMA 1RUOA 1V6MA 2DCYA 2VZPA 1BVVA 2P4EA 1SFNA 1F2NA 2PAEA 3J7NA 3PIJA 4IE0A 4JRAA 3OPWA 4W4ZA 4YFWA 4UYBA 2OPKA 4IESA 1YFWA 5ANQA 4JGYA 1AR93 1ZZCA 3W58A 2DFBA 5GJ6A 1O6UA 5BNPC 4DXSA 2O0OA 4HPKB 1JU4A 4XAEA 2KXLA 3E1F1 3CJIB 4N9HA 4OQ9A 5C71A 5A7PA 3BPSA 4M3CF 4DQAA 1LB2A 1AR62 5HCHA 1C5HA 1V0AA 4FO9A 4P00B 3I3EA 5C3SA 1GANA 4DXTA 1UX6A 2X09A 4RGGA 4LJHA 2ADDA 5A33B 1WD4A 5T54A 3AL6A 5DMYA 1WGPA 1FPN3 4DRRA 1W39A 1OQEA 5FMOS 4GWNA 2XL7A 1OLQA 2FMYA 5FLHA 2NYYA 1AYM3 3EQEA 1BMV1 3ACFA 2WSVA 2XUMA 3TOJA 2E32A 3VBSA 1W6QB 2VTXJ 2FDKA 1EAH1 1RTVA 1WMDA 5L73A 2WS91 5F9TA 1WMEA 2O14A 4D0QA 1AYN3 3ZX7A 4JGZB 1AXYA 1Q8SA 3P6BA 4QX5A 1YQCA 1KDKA 1IS3A 5FOBB 1GWMA 1F4HA 1LCLA 1LU1A 2DUOA 2VQ0A 4JKKA 2V73A 4LMFA 5SV5A 4B7KA 1DGRN 5F8PA 3QACA 2WAOA 1JH5A 3BYWA 3VN4A 4LULA 4DOUA 4ES8A 2J22A 4LLOA 1QNWA 3JXSA 1JZ4A 4QDQA 5T3NA 3BTZA 1TVGA 1ND2C 2WWJA 3VZNA 4BPZA 4IEQA 4XVHA 2W91A 3DYOA 2BTVC 1UD1A 1LGBA 3LE0A 4UFIA 5GZFA 3LPGA 3M4FA 2B5HA 3UYJA 3T2TA 4ATEA 3O0XA 4JV4A 1N1YA 4CUGA 5JSOA 3U75A 3PLQA 1HRI3 1WLDA 1R093 1NCRC 4FI9A 4GXLA 1PVC3 2BERA 5ACA3 3PVEA 5A3TA 4PDWB 1LGCA 3WW1A 3AYEA 1VBC3 2BUKA 4CDUC 5JXIA 1MS3A 1LULA 4AGRA 4XDOA 1JUIA 2BP6A 2VMFA 4Y5TA 1NT0A 1RUG3 1FI2A 4FCAA 4WM8B 4CDWB 4AEDA 1PGL1 4YWAA 3AKPA 1UCXA 1H2MA 4XEZA 4E2SA 1VE0A 3KCCA 1M4WA 2QQNA 3HNYM 3WX5A 2PXJA 1C1LA 4QGNA 2XG3A 3I2DA 5T50A 1H4GA 1ZRRA 5F3IA 4LBMA 5FV3A 3N9PA 4YSFA 5F7UA 3KWVA 1UF2C 5C3PA 3K3NA 4RQPC 1ND2A 1RVF1 2QQIA 3R6SA 4AVTA 5BNNB 5CFCA 1SCSA 4HLTA 5FZGA 2UWBA 4WM8C 1ODMA 2PHXA 1VBD1 2HBUA 5JMCA 1VBE3 1ENXA 2GALA 4MX3A 5BYNA 2K2SA 2LS6A 2Y38A 3DKQA 1H30A 5JOXA 2Q1ZB 3SCHA 5IT6A 1H4HA 1VBD2 1CVNA 1VBC2 4XFBA 1G6NA 4M0NA 2X5IC 4K8RB 1N3OA 1AX2A 5FZIA 1R092 3AK0A 3BI3A 3ZYRA 4KL1A 2BNOA 3BOPA 5E6HA 3J7LA 4CCKA 1IGOA 1MZ5A 1SZBA 3KM5A 5E88A 1C57A 5A3NA 2VBPA 2QNKA 5JDBA 4GD4A 1D4VB 2F4LA 5J98B 1CQ9A 5I8YA 3V0BA 3GF6A 4LQRA 3VDDB 2P5BA 2WNVA 2CGNA 2JDNA 2WA4A 5FPBA 3WDTA 4SLIA 4IGQA 4CDXB 1LJ7A 1LECA 3KVAA 5EFUA 2RJ2A 5F6LB 3SEPA 1O3SA 5FBZA 4QX2A 5EP9A 5CZKA 1T6GC 4NIHA 1OUXA 1W2NA 2O8OA 5LASA 4AF9A 5IK5A 1QXJA 2ZEWA 5FP9A 2BBVA 4CCDA 5GLTA 2QDRA 3M3OA 2VW0A 2D6LX 3MIGA 4Q0SA 4NO4A 1R091 1PVC1 4PCRA 3LSDA 2X5IA 4KI5M 1O5UA 2VXJA 3NAPC 5KHIA 4NIGA 2JIJA 3ZPOA 4GJZA 2X8KA 4QX0A 2Q8DA 2VQAA 3ZXKA 2ZZJA 3WP6A 1MZEA 4QPWA 2E26A 3DN7A 4ZKTB 1PK6C 5ANNA 5J48A 1W99A 2UWCA 2AACA 3PVOA 3PMSA 3GBWA 3ZVXA 3SLIA 1ZBE1 2ARXA 2QFEA 3R4SA 3D0SA 2PQQA 5FZ6A 1GQPA 3S5AA 2GMPA 2NN8A 1UYZA 5FBJA 2C1FA 4IV3C 2E31A 1ULOA 1RUD3 2JJ6A 1W6NB 3HJRA 1DBNA 2A70A 4NAMA 1COV1 5BNNC 5DDJ1 4EJRA 5FOJB 3GHNA 1ZA4A 4B29A 4AEJA 4RR3A 4AFMA 1EYBA 4HVQA 1S4CA 2GP5A 2B39A 4OYUA 2RDSA 2ZTNA 1SLIA 2GN7A 1V00A 3J7MA 4OLLA 1MR5A 2XH6A 2ZKNA 4FOQA 4CRQA 4H14A 5L7OC 2LM3A 1UX7A 3T08A 3WF2A 1GFF2 3RS6A 4CEYB 5JZGC 2PAMA 2QE3A 5CBLA 4UXAA 2P17A 3ZYJB 1UY4A 4D7TA 5FUNA 2VQUA 5ABJA 4AI1A 2AREA 1W6PA 3ZN6A 1BK1A 1W3VA 1NCRB 1SBDA 5LWBA 2GU9A 4Q27A 4C0BA 5C9AA 1QQP1 2BOJA 2XJQA 3BB6A 4M0HA 4QU1A 5LBBA 3X29B 2WINB 1YQ8A 2JDZA 4CCNA 4I2OA 2QTWB 2BU9A 4IV3A 4I0WB 4CE8A 2A3YA 2UWAA 3VKNA 1KQRA 3LDRA 1PO21 2YC0A 1BLZA 3VDAA 3CKHA 4JX0A 2WQZC 4NVPA 1ND2B 1O4YA 2BOIA 2WYFA 4KQ7A 4NHMA 5FZ8A 4NIIA 5BNNA 1UU4A 1J83A 5A3WA 3DCQA 5F3CA 2XL9A 1PGL2 1GNHA 1VAVA 4MGIE 2E7QA 1A3KA 1RMU2 2MPFA 5L9BA 1XU1A 4B3NA 1KEXA 4BE3A 1EAH2 1UW8A 1Z0HA 1OMIA 2Q5TA 3AMNA 1O3TA 5L7OA 4HVOA 3FFQA 1KJRA 1R1A1 3RDIA 1A6CA 1H1MA 2VOXA 4QX8A 3WF1A 4UFKA 3P3PA 2WO7A 3TN93 3ZXJA 3N7LA 4IEVA 4NOTA 1OOPA 1S2EA 2JE8A 3U14A 5KXCA 1DFQA 5CYYA 3RGBA 1XOYA 4X8NA 1QEXA 4CU8A 2XPJA 4BQ5A 1S0DA 1AR81 1QH7A 4JAAA 2ZOEB 2IXLA 4JGYC 5DUXA 5C9AC 1CJDA 3BVCA 3QH6A 1ALYA 2VZTA 1ENRA 2VOKA 3QOPA 5DG1A 2WFF2 1FT9A 1YFUA 1GSLA 1RUE1 3MHZA 4M3CA 2CWMA 2JICA 4NMIA 2VXRA 5JWPA 1RUD1 2HEYF 2WNVB 1QY4A 3D5OA 1GOGA 4I02A 4QPIA 2V4AA 1C5IA 3UT0A 4GWJA 4LITA 1EP0A 4R52A 2K9ZA 4ZZ8A 3JB8A 1VB4A 2HEVF 2XLFA 1WCQA 3A0KA 1IG0A 5FZ3A 3TB0A 4YZ5A 5BNOA 2Y34A 1MVEA 4QQPA 4COWA 5C3OA 3OG2A 4LKSA 5LBEA 2UURA 1PMHX 3SKVA 2X5IB 1UZYA 3WW4A 2ZHLA 2PYTA 1QOSA 1WCSA 1VBA2 1HXS2 4IUGA 4AAPA 4AFBA 4YM3A 1OFSA 3NNGA 3B01A 4QT6A 4OI2A 4RL7A 4JTOA 3IDAA 4R9BA 5BNQA 5FPUA 3MIDA 2EIBA 3KLSA 4COYA 3GBFA 4IV1A 3A21A 1QJX2 4XIOA 4RD7A 1W28A 4XJAA 2C24A 4WZFA 5FY0A 4XACA 4Q5OA 4DNYA 1WW6A 3ME2A 1MACA 2GC3A 2C0ZA 3POYA 3M1HA 1YQ5A 1D4M2 3OY8B 3S6PA 1MVQA 2VOWA 1N1TA 4CZSA 2IC1A 3MLJA 1VAMA 5LK5A 4ZU7A 1GZ9A 4XPVA 3O1VA 2GMEA 1VRH1 2SLIA 1LOFC 2W2IA 1Q8QA 3H3LA 3AKQA 3ZR6A 2VC9A 3WT3A 3DPRB 4ASKA 5JXGA 5D1IA 4MGKE 1H9PA 2OUJA 2VULA 3I2GA 2YV8A 4H55A 1UOGA 2WN3A 1JYVA 1W6OB 3EMRA 3PUQA 1Z7S1 1SLBA 2RS12 4QPGA 4YVSC 3TN91 5C7GA 2NPIA 4OHWA 5IVBA 2V09A 4XZUG 3M3QA 3ACLA 2Y33A 1POV3 4J1XA 1TQ5A 1LOEA 5ABJB 1W0PA 3O1UA 4XXAA 2DV9A 2GDFA 3O1SA 2BBAA 4XBNA 3IMNA 1EV12 2PHDA 3T4HB 1D0HA 2YU2A 3OD4A 1W8ZA 3GYDA 3W59A 3AVSA 3K46A 2JG8B 4O9GA 1REFA 1SQ4A 5EQUA 1HQWA 1U5IA 2C9AA 1OA2A 1QXRA 1WMXA 1N3QA 3BALA 4FP3A 3UJOA 1U5XA 2VJXA 1FOD3 1ASJ3 2ARAA 5LY1A 5FXWA 3MIEA 5CFDC 4P02B 2EIDA 2O8QA 5JSPA 2VGDA 3AZWA 1YIPA 2W1WA 4JVAA 3M7AA 2BFUL 5C5UA 2JECA 2YBSA 4X6QB 1JYNA 4K21A 4YW3A 2WBKA 1QKQA 3EXUA 1QWRA 3WQ1A 2VZQA 1ZZ6A 5K8SA 1ZVFA 4AI2A 1TMF1 4GAZA 2XJSA 3PMEA 4LKEA 3RPQA 1PIV3 1V9U3 3LA3A 4F7ZA 4N90A 4UW6A 4UWDA 5JR7B 4UBHA 3DXTA 1LOBA 1W2OA 1HX6A 4NRPA 4FT8A 3EO6A 1YO8A 4WBBA 1F15A 1US3A 1DGWX 3C7GA 5T5OA 1A34A 2R7EB 1NCQC 3SCGA 3EB7A 4FQZA 4ZZ5A 3GJBA 1I5PA 2VZOA 2HH9A 5C6CA 1CAXB 3Q9OA 3AZVA 1J58A 3C7HA 3H8RA 3N4MA 2QQUA 1JYIA 1WMFA 1XSQA 2FZ1A 3HT1A 4XF3A 4MXWB 1PGSA 2CY6A 5KXDA 4Y1XA 4ZY9A 4D6SA 5CADA 4QPIB 4WVVA 3GGLA 1GR3A 4AI8A 2P3KA 2VE1A 2CL2A 5J7MA 4MOAA 5F39A 3USUB 1VB2A 2E63A 1S1AA 4OI1A 3LIGA 2DURA 3OD0A 2UY8A 5FMCA 4TN7A 1ULGA 2YY1A 2A5ZA 4CP0A 2QQPA 1Q43A 2WO3A 4COVA 1O3RA 1TMF2 3J8F1 3NWKA 3KGZA 4Y22B 4JCKA 4GH4A 4XETA 4HMZA 1LOCA 2PLV3 1LOAA 3KT7A 1TG7A 4LE4A 5J36A 2Y0OA 5FYVA 4LIVA 5B2GB 1BYHA 1F9KA 3JQXA 1OD5A 5JIUA 2XVLA 3RZJA 1IS4A 2PA7A 2W9XA 3IAQA 1AXZA 1HB3A 1HLCA 1SFPA 1ZM1A 4JHZA 3MEPA 1UQXA 1JS9A 4E4DX 4B4PA 1TME1 2P37A 4DRVA 1XQNA 3RI8A 4TSVA 5HXVA 2R061 4XOGA 1X8EA 2PHFA 4DS0A 1XRUA 4ZXEA 1S55A 4C1WA 1N47A 2I2SA 3K51A 4E4SA 5JUVA 1W9SA 3FMGA 3AP7A 2PTMA 4QB1A 3WCSA 4HK9A 4L97A 1LHOA 1S0CA 1WD3A 2GH2A 2D5FA 2RMU3 4ZU5A 4CXWA 3H8UA 3HT2A 5K0UC 4XYXA 3O5SA 1X36A 2V5YA 5I0UA 2XJUA 1RC6A 2WNEA 2Z42A 1EUUA 3I7DA 5LEKA 1CZTA 3K77A 2NP0A 5FMBA 5KHGA 1HRV1 1BEV2 3AXDA 3P5BA 3Q8CA 1UXZA 2G19A 4HBNA 4OMCA 4PT6A 4QPGB 1NA1A 4FTSA 3R4DB 4M01A 1PVXA 1U12A 1S2BA 1PO11 1MQTC 2AEYA 3N9LA 1RMU3 1U0AA 1UPIA 2ARCA 1RUG1 4N43A 4AEDC 3ACIA 3RZZA 1HB4A 4FOWA 3LF7A 4Q4V3 1NLSA 1ULPA 4IE6A 2J1TA 4A4AA 3K75B 5T55A 4DUXA 4XJZA 4N53A 2F17A 2PHLA 5CVRA 1RUNA 3KV9A 2G4IA 2WIIB 2D6KA 3R0RA 3DPRC 5AVAA 3G7DA 2DUQA 3OB8A 3MUY1 2YMZA 3HR9A 4XAAA 4AR2A 3H3UA 3ORJA 3WNMA 1MEC1 1SBEA 1NZCA 2WJSA 4Z92B 4PLMA 4JZRA 3HPNA 1VBE1 4GALA 4ZU4A 2P6HA 4V1PA 3T0AA 4CUBA 1S2KA 2JB4A 2ORXA 4GKXA 4CCMA 2ID4A 4QDSA 3NKGA 4YGBA 4CDXC 2DVFA 2SBAA 2VQTA 3FHAA 4CPBA 5J96B 4EYUA 4GJYA 2P34A 1GICA 4FPOB 4YM0A 4BQ4A 4QXKA 3RFRA 4X8PA 1XB9A 1C8M2 4LBQB 1URXA 3LIHA 1IKPA 4KWUA 4QGMA 3WEZA 4C0HA 1Z7S2 4JTNA 4CDQC 3AZZA 2ZGOA 4BQYA 1W2AX 2XJRA 1B35C 1UZVA 4D7YA 4XF9A 4Q2FA 3S7IA 1JW6A 2DVBA 4LBOA 5CA6A 3JQWA 1W3XA 3I2JA 5GZDA 2XKOA 3VBUA 3HVDA 1C1FA 2W0XA 1XNCA 2A3WA 1LESA 3AMHA 3C3VA 1RUD2 3J26N 3OYWA 4R9DA 4R8HA 5CKNA 4XJ9A 4L99A 2LW8A 4B4QA 1KS5A 4MV2A 4R4ZA 4H7MA 1OPMA 5E89A 1I3HA 1H8VA 4MXWA 2DBIA 4XF0A 2I45A 4CU6A 2W3JA 3N3HA 3JBG3 5EIYB 4XQWA 2FHRA 1RUJ1 2OW4A 1YFXA 4HXCA 3ZSKA 1GOFA 1X82A 2MEV1 1NKGA 2HWB1 4COUA 2A71A 3ZFGC 1RUH1 2V72A 5A3MA 2D6PA 1W8UA 1ZBA1 3I2KA 5LA0A 4YM2A 2FDIA 2IXCA 2J1SA 1H1IA 3OOXA 3ZPYA 5TSWA 1UOBA 4UFHA 1XPWA 3RRDA 2RR13 4MGZE 5IFTA 4TTGA 4PQ9A 4AOCA 2JDYA 3D3AA 1ONAA 1F8VA 4Q4Y1 2OUHA 5C5TA 1D2SA 1ULEA 1X9TA 2JG9B 4IV1C 4IEPA 5K9YA 1RMU1 1W90A 2MNGA 3N9OA 3VZJA 4YG6A 5FZBA 1GOHA 1JZ6A 5FYSA 5JZGB 4CEWC 1PZ8A 1GP5A 4AZZA 1UMZA 3OGVA 4QX1A 2YBPA 3WW2A 4HETA 4BA6A 1LEDA 5C9AB 2Q30A 1GZTA 3BOWA 3N9QA 1Y9MA 4HONA 2ZMNA 1JZ3A 2BEOA 1CAVB 3LEMA 3ZXGA 1G9CA 2D3SA 3WF0A 1SLCA 4QHOA 1QOTA 1OPOA 1UU6A 3B02A 2FDGA 3ZYHA 2VO5A 1ST8A 4KNCA 5KWRA 1QIQA 2NMNA 1JBCA 3SKJE 5FFOC 3PIGA 4C1XA 1E5SA 4JDMA 4L8QA 2EF6A 3ELNA 4LA2A 3ZDVA 3ZFFC 4RR3C 1P8JA 4Y5Z0 4N9IA 5LA2A 2OQ7A 4IETA 2N7GA 4QPGC 4YVSA 2VCBA 3LB9A 3ZXDA 2WNUA 4FVVA 1Q3EA 3THDA 1DZQA 1YJLA 2PN5A 2VZ1A 4JQRA 3G6JB 4LOSA 2W08A 4BU2A 1TEIA 5HBAA 2Q8EA 4BB3A 1FNZA 1FYUA 5FJHA 5K0UB 2RS13 1TNFA 3AL5A 3FUOA 4Q8LA 2BVBA 3DXUA 3K48A 1OVPA 3FLTA 4JKLA 3UNPA 4EWAA 4YGDA 5LRRA 2CYFA 2Q0AA 1C4RA 2YU1A 1COV2 4LEJA 1W8TA 1LTEA 1Z78A 2HWF1 4RYDA 1H9WA 4P9XA 4OHZA 1QQP3 3I2IA 2XJTA 4WM7A 4FPEA 5IAVA 2VPVA 4N53B 1X9PA 4IDZA 1VMJA 3UETA 4S2DA 3WR0A 1D4M3 1PO23 4NRQA 5T5PA 3WDXA 4CU9A 2BGPA 2RE9A 1UY1A 4HPKA 2XOMA 1YUDA 3DYPA 3C7EA 1J1LA 2CSGA 3OPZA 5G05L 4IL7A 1HN1A 2Y0IA 4YPJA 2P2KA 4PI0A 2WRAA 1GQHA 1WW7A 2ZABA 3MV01 3OGSA 5BNPB 4YVWC 4AQTA 2AR6A 2IXJA 1G8WA 3WNXA 3POWA 3KB5A 1JOPA 3OBRA 3LEIA 1LGNA 1W9YA 5HI0A 1SLAA 4LBQA 2J1RA 4S2FA 4EWDA 2G9ZA 2R062 3K4AA 3WDWA 1SDWA 3ZXLA 3VBSB 5K7PA 5C4WA 3ZSEA 2RDQA 4INDA 4S2GA 4Q4X1 3RG0A 4UW3A 3OSDA 1XYPA 3PJYA 2RG4A 3IDCB 2ZCWA 4XBLA 3VBUB 5IVFA 1STMA 4RHV1 1POV0 1CPMA 5FUIA 3H7JA 3AMPA 2DCTA 1ZREA 4HG6B 1AR91 2R32A 1V6OA 2VNVA 2EXIA 2WO2A 4UOJA 3ZYGA 4COZA 1CAUA 5LRSA 3NVCA 2HWE3 2W47A 3J9SA 4FXKB 1LOGA 4Z2WA 2XBO1 1W2TA 1XU2A 2OPWA 1GQGA 3RZKA 4GB33 4BMBA 5A7WA 5B4XA 4K3UA 4MO3M 5A7NA 3OGGA 3GDBA 4ARXA 4YVWA 2ZGNA 2YHJA 4OUEA 4WVMB 4ISQA 2R043 3ZFEC 5IVVA 5BV6A 4ZPIA 2QQWA 4NPLA 1ACCA 2DYCA 1OURA 1UY3A 4Y26A 2IFWA 5JPMB 4YW6A 2DTWA 2ZAAA 3POSA 4HN1A 4V2VA 1QJU3 2WKKA 2XWJB 3ZFGB 1QJY3 4Q4W3 4CDWA 3KQRA 1EAH3 5APAA 5KBFA 1PM4A 1JODA 2TNFA 2C5DA 2R1DA 1AYN1 3POBA 4A2UA 3GNEA 2VUJA 4URAA 5A32A 5F3GA 1OXCA 1QJX3 2UY9A 1J1TA 4P9LA 4YW1A 3CBNA 1AR92 1F35A 4HANA 3O12A 1DQ2A 4DB5A 2HKXA 4OHYA 3LCPA 4NPRA 3VV1A 1F4AA 5IATA 3RI9A 5FYYA 3BTYA 1W0OA 1VRH2 3RJ2X 1HXS3 2GP3A 1TE1B 4I3PA 5CKQA 3N7MA 1QGLA 5CFCB 2D93A 1AUYA 5FYCA 3V0AB 4DUVA 2VTXA 1V6LA 4SBVA 3LA7A 4Y4YA 2JDMA 2WN2A 4ZS2A 3PUSA 4HSLA 3U37A 4YVSB 2XDVA 1KXGA 5HCBA 4OHXA 4XABA 4OI0A 2VH9A 4PLOA 3T0BA 3ZSJA 3ZIXA 5GZCA 1CONA 2DVAA 4LK7A 5HPOA 3WNOA 2L9LA 5J37A 4NWVA 3PURA 4XHXA 5G04L 3AKRA 3RJRA 2QBXA 3O1TA 4IGOA 1POV1 1FXZA 5FZOA 4P9GA 5C8CC 2FCTA 4CA9A 4CDWC 5DAVA 3VD4A 4LT5A 2VUCA 2WFF3 5CISA 4K9SA 1C3HA 1DYOA 3E6BA 4KWKA 1RUC2 5IJRA 1ND3A 2W95A 3HEIA 3NRUA 3WLUA 4AW7A 5A3UA 1RUI1 2PHTA 3VBHA 2QDNA 1PNGA 3ZYPA 2D6NA 2YPDA 1R1ZA 5JXJA 3VDDA 1UL9A 3A0NA 3T09A 1ASJ1 4UT5A 4KWLA 1YC61 2BNNA 1DYKA 1AX1A 3TN92 1L7QA 1VBB1 3IPVB 4YLZA 4BM8A 1SG3A 4YRDA 3LQCA 1WA6X 4GB31 2F6BA 1SCRA 5FCCA 2XWBB 3O1RA 1QJU2 2ZMKA 3NJVA 4AQSA 1GP6A 1Y9GA 3AX4A 5DAPA 3MI8A 2R041 1CAWB 2ZX2A 3VBRB 4GWMA 3KT4A 5KXEA 1AZDA 4Q1PA 2ZJCA 4XHBA 1UXXX 3A4UA 2ZXQA 2ZGMA 1UOJA 3AMMA 3DL3A 2IWGB 3ILFA 3U78A 1QJY1 2QKDA 4MHRA 4Q4W1 5E8AA 3LA2A 2CAUA 2ZGTA 5BPXA 3I2FA 3B9IA 2FCVA 1ND3C 2ZAHA 5HCFA 3SXWA 1PX4A 1WCKA 4YZ1A 2WLPA 1HDKA 3FHIB 4KGGA 3O7OA 2TEPA 4P08A 3RZGA 2A73B 5KHHA 2R071 2G9FA 2VUDA 2JE7A 4P9JA 1W6NA 2AEZA 4XJUA 3OTFA 1UOFA 1H8TA 1VP6A 1CR7A 1FAYA 3ZSMA 1NX9A 2PHUA 3DUIA 4F8AA 2WSUA 3ZDSA 4OZXA 1SDDB 2QVSB 2E9QA 4EQVA 2C6SA 3NW4A 1CD3G 1HKDA 4XXPA 4QGLA 4DEQA 4UFJA 1HB1A 1XC6A 4FOVA 5AC91 3ZYBA 5FO9B 3TEYA 3U4SA 2QQVA 5IFPA 2UYAA 3QD6A 1AYM1 4FPGA 3CLPA 4QXBA 4RGKA 3K4DA 1NLQA 1DYPA 2BQPA 1EPZA 2PELA 4HVRA 1GZWB 2WS93 4JRLA 4QD2A 3I8TA 4XF1A 2OZJA 2LROA 2WNVC 4LNVA 2OVUA 4AQ6A 4BLIA 1ZBE3 4B1LA 1CJPA 4QWNA 1O7FA 1AR82 1QH6A 2EIEA 2J1VA 3NJXA 2VMIA 4ONUA 4JC1A 4LBQD 5F5IA 4LO4B 4LOTA 2XKPA 3NAPB 3IM0A 3I3MA 3HQXA 1JZ5A 3RYKA 4XURA 5CB7A 3HN3A 3NV4A 4V2WA 3D8CA 3VKOA 4URTA 5FQ0B 1SBFA 1COV3 4FQ4A 1ENQA 1HJGA 5FXVA 5FXZA 5EWSA 3KF5A 4CSWA 1W2UA 2BGOA 2OT7A 2DUPA 4KG8A 5FZCA 4CXXA 5FJKA 2RM21 1VAKA 2ZBJA 3ACHA 2LALA 5A33A 3ALQA 4OI4A 5L7OB 2WWSA 2ZKLA 4FXGB 5JXHA 3HD8B 5ACA1 1JZ7A 1JYWA 1FV2A 3M2MA 1ENSA 5IVYA 5JOZA 1W8OA 1X33A 2JENA 4QM8A 5E16A 3ZKYA 2A6YA 2ETEA 1BEV1 4PF1A 1OOPB 2KA3A 1QOOA 4BQ3A 3TYJA 1FX5A 3ITQA 3MZHA 2E6VA 4K6BA 1MEC2 2GC0A 4ASMB 4K20A 4BJ0A 4XF4A 1ZX5A 1YI9A 2Y60A 4P9IA 4XFFA 3IAPA 1S0BA 4CUAA 3OYWB 2EICA 2RDRA 5DN2A 3D82A 4QKNA 1KFXL 3VBHB 2ORZA 2NM1A 1PGW1 4AG4A 4I09A 5A6YA 1APNA 5L9RA 3EYPA 3CQOA 1RUJ2 3VGIA 4MYEA 3IPVA 2H0BA 5HXMA 1L3JA 1TME2 2YFZA 1HV0A 1JMUB 1VBD3 5FRAA 1W6MA 2AUYA 1RJ7A 2XB6C 1AL23 1MS0A 5DUWA 1JYCA 1XYNA 1G86A 3IKWA 1IG3A 2HYXA 4NPMA 4XTMA 3GZEA 3LEGA 4DY3A 3E6DA 1GNYA 2NMOA 2ET1A 4AHXA 1PMIA 2OXBA 2QZ3A 3MIFA 3NO8A 2RR12 4IERA 4PI2A 3VBRA 4FSJA 3OBTA 1XNBA 4GWIA 4L92A 1GNZA 1NQDA 3HMYA 4OUMA 1REDA 5FZDA 4AQ2A 4H2AA 5C8WA 3BIWE 5FZLA 3MW4A 2XJPA 2XXZA 3A7QA 4WM8A 3NMBA 3N9MA 3JCIA 1DQ5A 4MH0E 5F5CA 4AVAA 1JUHA 3I49A 1AR83 1ZBE2 1NY72 2JKXA 3VBFA 3JBG2 4ASLA 4CP9A 2ILMA 1R082 3MICA 1GYKA 3GCXA 2BYVE 4AGVA 4B8EA 2DFCA 4AXOA 1H2NA 3SISA 3J4UH 2CWSA 3RMYA 4Q26A 3UKTA 3UKVA 2GZWA 2OIIA 1O91A 1BCXA 4AVSA 3TAYA 4PQQA 3JBG1 1NY71 4YW4A 1WW4A 4CVUA 2R49A 3IBMA 2VUAA 4FP2A 2UU8A 3ATGA 4UW4A 5FWEA 2Q8OA 2ES3A 2RM23 4TZDA 5HCAA 2VR4A 2ZX3A 3TEXA 4AHZA 5L36A 2PMWB 1C8M3 2ZZQA 2W46A 4I3GA 2DF7A 4XZPA 2Q4SA 1WBFA 1AR71 3S0MA 1CWPA 1E5RA 2K46A 4UW5A 4Z1VA 4IEYA 2B8MA 2XQRA 4MGYE 2ZACA 4LBLA 4QPIC 5FPXA 2PHWA 1GZWA 3FWEA 3PL0A 4KU7A 5FY5A 5ISLA 1NZIA 3N7JA 4OMDA 2OYZA 3N7KA 3MIHA 3RQ0A 2ADEA 1OA4A 3J7HA 1NE6A 4AYUA 4M00A 3NKTA 1VBB2 1AYN2 5FLIA 5F2SA 2JG8A 4OUSA 2RVAA 5A7QA 3NAPA 1AVBA 2DU0A 4UF0B 1UAIA 4BMEA 3W21A 5F37A 2GSYA 2EXJA 5DZEA 2A1XA 2ZHMA 4P5YA 2A75A 3CEWA 1CIYA 1OLRA 1MS9A 3AKTA 3N9NA 2RDNA 1G7YA 1RIRA 1DF0A 5BNPA 2VU9A 1GWLA 3TNQA 3TRSB 2XHKA 2HWD2 2G9GA 5FZEA 1B09A 3B69A 5JR2A 2DCJA 2Y8KA 3USSA 1J3RA 3FL7A 4FPHA 4XUQA 2WT2A 4FFGA 4W6YA 3ZMOA 4D6RA 3RVHA 4GKYA 1VALA 4EN9B 1AHSA 5IHRA 2QQLA 2CNAA 4MLOA 1U5YA 1EUTA 1RHI2 2BVVA 3I97A 2JG8C 1CAXA 2WNOA 3V56A 4BWOA 4LORA 5IYYA 1ZRFA 3VHOA 3ZFEB 1EY2A 3S5QA 1DG6A 3VL9A 1KGYA 1UY2A 2LRPA 2WYSA 2WLQA 4UFLA 1FOD1 4DO0A 4QHZA 1IPKA 3KHCA 3B3QE 3WDVA 3ZXFA 5ABJC 3HWJA 4K1ZA 1KJLA 2Q1MA 1QU0A 3AJYA 4PHZA 2JKBA 2HWC2 1EV11 1DQ6A 3ABZA 5F32A 3WVJA 2R16A 2D3RA 3ZOIA 1GP4A 1X8MA 2WL1A 5BUVA 4CDQA 3I54A 1CIWA 3WG2A 1JU3A 4XUNA 2YYOA 3HNMA 1TMF3 3FHQA 3I59B 2VCMA 2WC2A 2KD7A 3POFA 5JOWA 5KHKA 4CEYA 1HQLA 3BKZA 3VBUC 4KBBA 2OZ6A 2JX9A 3F95A 1XE7A 5FZFA 3WNLA 1W6PB 1BBT2 3ZN6B 4A6OA 1JOBA 1X7NA 5DZFA 2GNDA 4Q4X3 1OLMA 1NCRA 5C8CB 2WZR2 3AYCA 3FE5A 2E51A 2JXAA 2PHRA 2YBKA 2ZEYA 5H9QA 1J59A 3OGRA 5FAXA 2GN3A 1AXKA 1Q5OA 4GMP1 2P3IA 3NJYA 3CF6E 1SFYA 2W94A 1RUE3 2ZGQA 2WUHA 4IV3B 5FY8A 1Y9QA 1OT5A 2WT0A 4QX3A 5DAXA 5FPAA 3U07A 3WSOA 4L2NA 1MZFA 5LK7B 1RUE2 5CG8A 1SEFA 2WWUA 2BJSA 5GLUA 3Q8EA 2EAAA 5FZ1A 1HB2A 4RHV2 5I0SA 1VJ2A 2PFWA 3A23A 4O65A 1NCQA 1XNAA 2WR9A 4Q4X2 2QCSB 4H7LA 1Q56A 5EYYA 2WQ8A 5JVVA 3OJBA 1Q8PA 4PF5A 4CEYC 3D0JA 3PJQA 3WW3A 2IXIA 3MPBA 4KGQA 5L19A 3J8F3 2AGSA 2HWE2 5AVPA 4RQPB 5E1RA 3NNLA 2VL4A 5FZOB 3SEEA 1QJU1 3I2HA 2ZS6B 3SQOA 3KS7A 3W20A 3AKSA 3M70A 2D43A 4EN6B 1IQAA 2G1MA 3N35A 5IW0A 1ND3B 2GC2A 5EHDA 1PZ9A 2CV6A 1K5JA 2Y64A 4CP2A 1UIKA 4RS5A 4JGYB 2ZGSA 2ZA9A 2JDHA 5FZKA 4AAXA 4E27A 2R063 3POGA 1BKZA 2JDAA 2CGPA 1IKQA 3CJIA 1JTZX 3KV4A 3UKNA 4E4HA 1EV13 3P1IA 4FBFA 4YARA 4NIAA 1VRH3 5BNOB 2FDJA 3EBRA 5FWJA 3SITA 4Y5SA 3U0ZA 2W5FA 3HNBM 2RS31 4QQOA 3O0VA 2YC2A 3BCWA 3C8XA 5FP3A 5FYZA 5T5JA 4YZ4A 3IN9A 2VVDA 2VZUA 4CU7A 1UZ0A 3ILRA 4BIFA 3NL1A 3MW3A 1I5ZA 3SNMA 3HBKA 3SC7X 4R9CA 4AEKA 2RJKA 5F5QA 3NSTA 1YFYA 1KFUL 2JG9C 3POEA 4IV1B 1NLRA 1DQ0A 2IUWA 4JGZA 4Q4V1 3PDQA 4QHBA 4JDOA 4TXWA 2ZMLA 4NWWA 3RZHA 1DDLA 2XONA 4W50A 2R042 2PAKA 3SMHA 4QXHA 5H9RA 1RUI3 2IVJA 2JD4A 3LDKA 1PX3A 1TNRA 3OY8A 4X6RB 4GB32 5A1AA 2QJVA 3THTA 3DEMA 2EVXA 3B5LB 4P9WA 1VBB3 2W1SA 1XNKA 3F2ZA 4QU2A 2IXHA 1E5HA 1OFNA 4BYYA 5LBFA 1UYYA 5CNAA 4RSUA 5D8AA 3T1LA 1I9RA 3VBRC 1OA3A 4QAWA 5LEJA 2H6BA 2B9VA 5JIAA 2JD9A 1DLLA 3S30A 3CZUA 1MS8A 3KCYA 1RUC1 5FPVA 4WZCA 1FPN1 2ATFA 5IK7A 1S0EA 4PDWA 4IGPA 4IE4A 2YGLA 3AZXA 4XUPA 1K42A 1QDCA 3H42B 5CFDA 2B45X 5DABA 4BOWA 5M0TA 2Z69A 3HIFA 2D98A 5FLJA 2GNMA 2W92A 3NJZA 4WVZA 4HKWA 3ACGA 2XBO2 4XIKA 4NHLA 2VG9A 3VL8A 2MEV2 3ZMNA 3OUJA 1R1A2 2DVDA 1ZZBA 2XGXA 3MIBA 4LHNA 5AFEA 1DZRA 3GJAA 1S0GA 2VMHA 5FY9A 2EA7A 1FMD3 2ZGKA 4TLFA 4PBOA 2E33A 3KGLA 5CU1A 3U4XA 4ZHNA 2ZGPA 5FPLA 2FDHA 4IQPA 3MPPG 1ZNPA 3IMMA 1AF9A 5FIXA 3URFA 1R083 1RHI1 1XJAA 4F83A 3B9CA 4KH9A 3WY6A 1HRV2 2VOTA 1PO22 5SV8A 5LA9A 2HWB3 1RUH3 3HOBA 2RS33 1ZBA3 4XDPA 1PHMA 1WCUA 4D7SA 4QDRA 5A6ZA 3NNFA 1SPPA 4QB6A 3D6EA 1QQP2 1W8FA 3KT1A 4PDWC 4QMAA 3T2OA 1EPWA 4BXFA 4A3ZA 1DQ4A 3WP4A
chains in the Genus database with same CATH topology
3ETQA 2EXKA 4RQPA 4BIOA 5CFCC 4Q0UA 1KS4A 4YNIA 2ZX0A 3TBDA 4W6XA 4FOYA 4RA0A 3P3NA 4AHWA 3VZLA 1TME3 3WP5A 3GALA 4P5HA 1Y43B 3MFCA 4EN7B 4Y20B 4NR1A 1RVF3 4HKOA 2ZX4A 2BFUS 1AL0G 4FPLA 2HWF2 5CG9A 1ULCA 1XE8A 3OF1A 2VNGA 4DFSA 1E57A 4E2GA 2YROA 4G3YC 2VW2A 4I01A 5C8CA 3UL2A 3QCWA 4HK8A 4XBQA 5CAZA 4R9AA 2VW1A 4XFGA 4Y22A 1WUVA 3E6CC 1PO13 4GH4B 1C28A 3TNPB 4Z8BA 2Z2SB 4PJYA 4YW5A 2EXHA 1PGW2 4Q0QA 2ZGLA 4A7ZA 4XW3A 1QXPA 1HV1A 3JD72 3VBFB 3JD71 4Z82A 1J3PA 4YGEA 2ZGUA 1UZZA 1S0IA 2FQPA 1LOFA 1YHFA 1XXNA 1KRIA 3S7EA 3B7MA 3VBSC 1LU2A 4LBNA 1R081 2B7YA 4XFIA 5IK8A 3RMXA 4RR3B 1LHVA 4Z07A 1DIWA 1ZZ9A 4YVWB 4BCUA 4DY5A 4LO7A 1PZ7A 2JE9A 1NA1B 4I30A 5I0TA 2CTVA 3FZ3A 2XVGA 4WM7C 2HEWF 1XYOA 3VKFC 3ILNA 3H50A 3VHRA 1PNFA 1KD7A 1A8DA 3MF6A 3N36A 3OCPA 1GKBA 1YXWA 1QDOA 3VLBB 1H1AA 3R05A 2VECA 3KMHA 3VUOA 2D6MA 2PLV2 4XMAA 3RWNA 3ZO0B 1CX4A 4FPCA 2B9UA 2YXSA 4RGAA 3WUDA 3GZAA 3V64A 2HJIA 1NXD1 4YM1A 3UK9A 4I0BA 1HRI1 3LZZA 4ATFA 2QUOA 3VKLA 1SACA 1V70A 4Q4V2 2DCKA 2FMDA 4AGGA 4DINB 3FUQA 5DZGA 3WD5A 1W6QA 3FX3A 2R072 2DU1A 1PK6B 5I8SA 3ST7A 5JCTA 1AR61 2WQ4A 3AMQA 1PM7A 5AFBA 1UKGA 4PBPA 2NQYA 1QJZA 3ZFEA 4E4ZA 4P9YA 1ZBA2 2WA3A 1CN1A 1G9FA 1LENA 2RMU2 2H6CA 4LUKA 4LBJA 1HQNA 1WA4A 1OOPC 1RGSA 3AB0A 3WHTA 2JEMA 5JAXA 2VNRA 3AM2A 1V6NA 5JOYA 1A78A 4LHKA 4AFDA 3AP5A 4MUVA 1AJOA 3I59A 4FPJA 4MSVA 4LTAA 3CO2A 3L2YA 5H9PA 4QPYA 5ACA2 1R1A3 5JSRA 1HRI2 4UBGA 1RJ8A 2JG9A 4TWTA 5AC92 2AYHA 3KD4A 1ASJ2 1LR5A 1QNYA 3ZFFA 2EAKA 4AEDB 4L9BA 2HWF3 4N7UA 1YCIA 4AHYA 2WFF1 1MS4A 3AYAA 1OQ1A 1X50A 2BGCA 4GA9A 3E97A 4HL0A 2VNOA 2RHPA 1MS1A 5FPZA 1NE4A 2VVEA 1LHNA 3WG3A 3H1YA 1MZ6A 1B35B 4A7KA 5F1RA 3WG1A 4RFT0 4BH9A 2ERFA 1QJY2 4Q4W2 1AYM2 3AXEA 1VIWB 4QQHA 5FDBA 3WDUA 3IT8A 1YJKA 1VBA1 2VOVA 2GNBA 2Z79A 3IDEA 3ES1A 2WZR1 3KZ4C 3V65A 1H0BA 4N53C 4DXZA 3W9AA 4XJ8A 1AR63 3D4KA 3VKMA 4M3CE 3MDPA 3M3EA 1NA1C 2BNMA 4LO8A 1I1EA 4GMP3 4WM7B 3V0BB 1FMD2 2OA2A 4BQ1A 1ZRCA 4IEOA 1RB8G 2CAVA 4YZ3A 1VR3A 1KITA 4CDXA 1OQDA 2HWE1 5DDJ3 1BQPA 3LKJA 1MQTB 2HWC1 5FQ0A 2XBO3 4J6GA 2KM2A 1FOD2 4HSJA 1O4ZA 4XFAA 2WFPA 1FATA 5FREA 3AFKA 3H1WA 2F4PA 5AC93 3PNAA 2TUNA 5DDJ2 4OVEA 3ZN4A 3WHUA 1NYWA 2AZ5A 4IEWA 5JPNB 3SH4A 4Y1ZA 1RUF1 4Q8KA 1OKQA 2RS51 4HN0A 4FPYA 4AVVA 3AZYA 3FC0A 3WG4A 1H8TC 1RUI2 4XQDA 4RS5C 3KSCA 4IEZA 2A6VA 1O3QA 1QHDA 4K1YA 5KHJA 1Q8VA 1JOJA 1UPSA 1W6MB 3SH5A 3USUA 4BHPA 4FTEA 3DKWA 1G9BA 5GM0A 5J3UA 4WVMA 5GALA 3LOIA 4GULA 5F6KA 4CEWA 4QQ2A 1M06G 1GV9A 2R30A 1FNYA 2WZR3 5CFDB 4XILA 4OHVA 4AEMA 4CYDA 1IPJA 3ZFFB 5FO8B 5EYXA 1FV3A 1OHFA 3IIAA 4FPKA 3ECQA 1YYNA 4CP1A 3NV2A 3MW2A 5KXBA 2D5HA 1NG0A 3FBYA 4YG3A 5A32B 1G9DA 2IXKA 1Y3TA 3NV1A 1SLTA 4XFHA 4AVCA 2YDEA 3AFGA 3INAA 4ZXKA 2YUEA 4EROA 2K0GA 3B93A 1WBLA 2WNUC 4HT1T 2HWC3 4GH4C 4XQ4A 2I74A 3V0AA 4YG0A 1RL3A 5GLZA 4GIQA 4LO6B 1IOAA 2H0VA 2GNTA 1YLLA 3WCRA 1CESA 2ZX1A 4MXVA 3E5QA 5KC5A 3VDDC 1SLLA 1WW5A 3PHMA 2MHFA 1DGRA 1LKNA 3MGUA 4DZGA 4PIXA 4A3XA 1V6KA 1RUF3 3FLPA 4YGCA 1UN1A 2D44A 2YGMA 1Y7BA 5CIRA 4N43B 1O5LA 3AP6A 1LEMA 4A7YA 2W39A 3O0WA 3WZ1A 3AJZA 4XJWA 3WINE 4W6WA 2WT1A 3LSEA 2R073 4U36A 2XJVA 4M3CB 2DCZA 3ZXEA 3HAGA 2W52A 4ORFA 4O9EA 1QMJA 4XDQA 1MQTA 4KU8A 1YI7A 4XTPA 4D69A 4N43C 1H2LA 4I0AA 1S0JA 4J1WA 1BBT3 2BPA2 3EJKA 1LODA 2RMU1 5I0RA 3OGJA 2O1QA 1A8MA 1LRHA 2ZGRA 1CAWA 5C4WC 5C8CB 1Z7S3 3U11A 1AR73 3FBMA 1VBC1 3VBOA 4CDUA 4IEUA 1RITA 4OFGA 3PTYA 3ENRA 4FAGA 1ULDA 1N3PA 2E7TA 3VZMA 4HZFA 5BXXA 3PVNA 4C91A 2A6XA 4PIYA 1RVF2 1LHWA 4HKLA 4LA3A 3APBA 1ZRDA 2VY0A 5DG2A 3O14A 5GZGA 5I8TA 5T52A 4NHKA 3IWZA 4CDQB 3WQ0A 1F31A 1WCDJ 2IFRA 3E5XA 1ULFA 1VBE2 2A7AA 2B42B 1W6OA 1CPNA 4CEWB 2HWD3 2GH8A 2QZ2A 3VBOC 2LUWA 2HYKA 4JGZC 1BEV3 1MS5A 4B7EA 2YZ4A 5I93A 3THPA 2D7FA 2R6QA 2GC1A 1LHUA 1VLNA 2Y26A 2RS32 1RUH2 3BTAA 2HWB2 4BZ4A 1SMVA 4K40A 3BODA 3JD73 2DWRA 5A3LA 3B00A 1CAVA 3HBZA 3WOGA 4AVBA 1RUG2 3E5UA 1KDMA 1AL22 3WXPA 4AE2A 3WUCA 1OI6A 4EWEA 1PO12 4AFCA 3UJQA 4F3JA 1DHKB 1ZZ8A 3H0OA 4XFCA 1CGPA 5GLVA 1RUJ3 2NLRA 1BBT1 1AL21 2MEV3 5JLVA 4AWDA 3M3IA 2CGOA 4Q4Y2 5C33A 1JXNA 3H9AA 3EHKA 5EZWA 2RJLA 3LGRA 1D2QA 3MF9A 3MLLA 3JB4C 3ZN5A 2BW8A 4LLFA 5K0UA 3VHPA 4D3WA 1RINA 4Q4Y3 1DZTA 2PLV1 4ES9A 1U5ZA 3PVBB 3M3CA 2Z5WA 4IXLA 1PK6A 4B4RA 5H9SA 4TYSA 3ES4A 1I6XA 4G9SB 4Y24A 3BU7A 3I4IA 4RS5B 4Y1UA 4EN0A 1N1SA 1WLTA 3GZUC 3ZIWA 1V6IA 1V6JA 2D3PA 3H3ZA 1BZWA 3DF0A 3QH7A 1DU3D 3QLQA 5IUQA 4XMIA 4BLJA 1WLWA 1NOVA 4MVTA 1K5MB 3AP9A 2BWAA 1C8M1 4META 4EN8B 4KG0A 2XLAA 2HWD1 1HRV3 4AK3A 4AI0A 1YNAA 2GAUA 3MYXA 1XNDA 1N1VA 2ET7A 5GZEA 3VBOB 5EJ3A 2ZPXA 1PIV2 1V9U2 4FPFA 4LE3A 4R4XA 1HIXA 1HW5A 3WP3A 4JDNA 5C4WB 3GBGA 4DPNA 5DUVA 3L2HA 3SH3A 2D97A 1PVC2 2A6WA 1GLHA 4Y1VA 4FTBA 3LWCA 5DXDA 3TWIA 2ZHNA 3FJSA 1ZZ7A 3FLRA 4EV0A 3BPZA 1UIJA 3ASIA 3IDBB 1CAUB 1B35A 3WV6A 1NQJA 2I07B 1JN2P 1JHNA 1MEC3 4PLNA 3WDYA 3RSJA 2P3JA 3CU7A 3MLKA 4ITCA 4LUMA 4E9KA 4W65A 5D8AB 1BJQA 3CL1A 3AP4A 4H3WA 4S2HA 1AR72 4NN0A 3J8F2 4KWJA 2D40A 4Q29A 3UV9A 4QQLA 2AENA 2B46X 2R0HA 4LHLA 4P14A 4XE9A 4PIZA 3HN1A 3ZFGA 2UYBA 1F5JA 3SCFA 2ZHKA 3B94A 1IS6A 4Q0PA 2XVKA 3AYDA 1FPN2 3GHMA 4RHV3 5EV7A 4QM9A 3JZVA 2VMGA 3FFZA 4LBKA 3M8LA 2E53A 1BVP1 1G9AA 3DV8A 1DGWA 2A3XA 2YPJA 3T1MA 4D94A 4DMIA 2ENRA 3ROUA 4FAHA 4Q1RA 2EIGA 4OULA 2E7AA 2WZPP 1WLCA 2A6ZA 1J3QA 4YFZA 3GZTB 5IK4A 2WS92 4YYOA 4Y1YA 5BNOC 3DGTA 1RUF2 1F5FA 2VVFA 4WV8A 3VZOA 4K7JA 1BMV2 2TBVA 2GMMA 1AX0A 2RR11 3WQ7A 1VBA3 1YWKA 1RUC3 4G4FA 1GZCA 1YIFA 1REEA 3QBQA 1S0FA 3L9JT 1ZYBA 2W68A 5EXOA 5FO7B 5DUUA 4ISRA 3RYPA 3ZXAC 3SHRA 5GKAC 5T5LA 5KC6A 2X53S 1OSGA 1QJX1 4MZUA 3CNAA 1Q8OA 3VHNA 3JU9A 1FMD1 3CJXA 1C8NA 5D8AC 3KCXA 4Y20A 4AFAA 1HXS1 1RHI3 2D6OX 2BWCA 1K5MA 4C90A 4LR4A 4LO5B 2R1BA 1BXHA 2DTYA 3VZKA 3VBHC 3LAGA 2R0FA 2NZ9A 2RS11 1DGLA 2AH2A 2RS52 4WVWA 1QF3A 3RNSA 4Q0VA 1GBGA 1O4TA 5JI7A 1UU5A 5JZGA 2RS53 4YZ2A 3H7YA 2LTNA 5FTTC 2IZWA 3ZYIB 4K8FA 1IHMA 4CTEA 1UKRA 2DVGA 4YW2A 1D4M1 2ARBA 3C2UA 3NV3A 4N7IA 3VBFC 3MFAA 1H2KA 1H8TB 5J09A 4U2AA 1K5MC 2EALA 1NCQB 2XLGA 3DPRA 1IZ3A 2WNUB 5GLWA 4L11A 3LOBA 2FZ2A 1PIV1 1V9U1 4GMP0 4GQ7A 1YRZA 4AI3A 4HFSA 3ZSLA 3JUUA 2X29A 1DQ1A 3U10A 1D0GA 5BY5A 5JI9A 3CJIC 4E2QA 2FBEA 5I91A 3R4UA 4IEXA 1AJKA 2RM22 1IS5A 3RYRA 3H1MA 1NXMA 1RUOA 1V6MA 2DCYA 1BVVA 1SFNA 1F2NA 2PAEA 4AQSA 4JRAA 4YFWA 2OPKA 4IESA 1YFWA 4JGYA 1AR93 1ZZCA 3W58A 2DFBA 5GJ6A 5BNPC 2O0OA 4HPKB 2KXLA 3CJIB 4N9HA 4M3CF 4DQAA 1LB2A 1AR62 1C5HA 4FO9A 1GANA 1UX6A 4RGGA 5A33B 1WD4A 5T54A 1WGPA 1FPN3 4DRRA 1W39A 1OQEA 5FMOS 4GWNA 2XL7A 1OLQA 2FMYA 5FLHA 2NYYA 1AYM3 3EQEA 1BMV1 2WSVA 2XUMA 3TOJA 3VBSA 1W6QB 1EAH1 1RTVA 1WMDA 5L73A 2WS91 5F9TA 1WMEA 1AYN3 3ZX7A 4JGZB 1AXYA 1Q8SA 4QX5A 1KDKA 1IS3A 5FOBB 1LCLA 2DUOA 2VQ0A 1LU1A 2V73A 5SV5A 4B7KA 1DGRN 3QACA 1JH5A 3VN4A 4LULA 4DOUA 4LLOA 1QNWA 5T3NA 1ND2C 3VZNA 4BPZA 4IEQA 2BTVC 1UD1A 1LGBA 5GZFA 3M4FA 2B5HA 3T2TA 4ATEA 3O0XA 4JV4A 1N1YA 5JSOA 3PLQA 1HRI3 1WLDA 1R093 1NCRC 5ACA3 4GXLA 1PVC3 3PVEA 4PDWB 1LGCA 3WW1A 3AYEA 1VBC3 2BUKA 4CDUC 1MS3A 1LULA 4AGRA 1JUIA 4FCAA 1RUG3 1FI2A 4WM8B 1PGL1 4CDWB 4AEDA 3AKPA 1UCXA 1H2MA 4XEZA 4E2SA 3KCCA 1M4WA 3WX5A 1C1LA 4QGNA 2XG3A 3I2DA 5T50A 1H4GA 1ZRRA 4LBMA 4YSFA 1UF2C 4RQPC 1ND2A 1RVF1 3R6SA 4AVTA 5BNNB 5CFCA 1SCSA 4HLTA 2UWBA 4WM8C 2PHXA 1VBD1 5JMCA 1VBE3 1ENXA 2GALA 4MX3A 5BYNA 2K2SA 2Y38A 1H30A 5JOXA 2Q1ZB 3SCHA 5IT6A 1H4HA 1VBD2 1CVNA 1VBC2 4XFBA 1G6NA 4M0NA 2X5IC 1N3OA 1AX2A 1R092 3AK0A 3ZYRA 4KL1A 2BNOA 3BOPA 1IGOA 1MZ5A 3KM5A 5E88A 1C57A 2QNKA 5JDBA 3V0BA 1D4VB 5I8YA 5J98B 1CQ9A 3GF6A 3VDDB 2WNVA 2CGNA 2WA4A 3WDTA 4CDXB 4SLIA 1LJ7A 1LECA 1O3SA 5EFUA 5F6LB 5FBZA 1T6GC 4AF9A 2O8OA 5IK5A 1QXJA 2BBVA 5GLTA 2QDRA 3M3OA 2VW0A 2D6LX 3MIGA 4Q0SA 4NO4A 1R091 1PVC1 4PCRA 3LSDA 2X5IA 1O5UA 3NAPC 5KHIA 2X8KA 2VQAA 3ZXKA 2ZZJA 3WP6A 1MZEA 3DN7A 4ZKTB 1PK6C 5J48A 2UWCA 3ZVXA 3PVOA 3PMSA 3GBWA 3SLIA 1ZBE1 2ARXA 2QFEA 3R4SA 3D0SA 2PQQA 2GMPA 2NN8A 2C1FA 4IV3C 1RUD3 2JJ6A 1W6NB 1DBNA 2A70A 1COV1 5BNNC 5DDJ1 4EJRA 5FOJB 3GHNA 1ZA4A 4B29A 4AEJA 4RR3A 4AFMA 1EYBA 4HVQA 2B39A 2ZTNA 1SLIA 2GN7A 1V00A 4OLLA 1MR5A 2XH6A 2ZKNA 4FOQA 4CRQA 4H14A 5L7OC 2LM3A 1GFF2 3RS6A 4CEYB 5JZGC 2PAMA 2QE3A 5CBLA 4UXAA 2P17A 3ZYJB 4D7TA 5ABJA 4AI1A 2AREA 1W6PA 3ZN6A 1BK1A 1NCRB 1SBDA 2GU9A 4Q27A 4C0BA 5C9AA 1QQP1 2XJQA 3BB6A 4M0HA 3X29B 2WINB 2JDZA 4I2OA 4IV3A 4I0WB 2A3YA 2UWAA 3VKNA 1KQRA 1PO21 2YC0A 2WQZC 4NVPA 1ND2B 1O4YA 4KQ7A 4NHMA 5BNNA 1UU4A 2XL9A 1PGL2 1GNHA 1VAVA 4MGIE 2E7QA 1A3KA 1RMU2 2MPFA 4B3NA 1XU1A 4BE3A 1EAH2 1UW8A 1Z0HA 1OMIA 2Q5TA 3AMNA 1O3TA 5L7OA 4HVOA 3FFQA 1KJRA 1R1A1 3RDIA 1A6CA 1H1MA 2VOXA 3P3PA 3TN93 3ZXJA 3N7LA 4IEVA 4NOTA 1OOPA 5KXCA 1DFQA 4X8NA 2XPJA 1S0DA 1AR81 1QH7A 4JAAA 2ZOEB 2IXLA 4JGYC 5DUXA 5C9AC 1CJDA 3QH6A 1ALYA 1ENRA 2VOKA 3QOPA 5DG1A 2WFF2 1FT9A 1YFUA 1GSLA 1RUE1 4M3CA 2CWMA 2JICA 5JWPA 2VXRA 1RUD1 2HEYF 2WNVB 1QY4A 3D5OA 4I02A 4QPIA 1C5IA 4R52A 1EP0A 2K9ZA 3JB8A 1VB4A 2HEVF 2XLFA 3A0KA 3TB0A 4YZ5A 5BNOA 1MVEA 4QQPA 4COWA 2UURA 2X5IB 1UZYA 3WW4A 2ZHLA 2PYTA 1QOSA 1WCSA 1VBA2 1HXS2 4AFBA 4YM3A 1OFSA 3B01A 4QT6A 4OI2A 4RL7A 4JTOA 4R9BA 5BNQA 3MIDA 4COYA 3KLSA 3GBFA 4IV1A 1QJX2 4XIOA 4RD7A 4XJAA 4WZFA 4DNYA 1WW6A 3ME2A 1MACA 2GC3A 2C0ZA 3POYA 3M1HA 1D4M2 3OY8B 3S6PA 1MVQA 2VOWA 1N1TA 4CZSA 2IC1A 3MLJA 1VAMA 5LK5A 4ZU7A 1GZ9A 4XPVA 2GMEA 1VRH1 2SLIA 1LOFC 1Q8QA 3AKQA 3WT3A 3DPRB 5D1IA 4MGKE 1H9PA 2OUJA 2VULA 2YV8A 4H55A 1W6OB 1Z7S1 1SLBA 2RS12 4QPGA 4YVSC 3TN91 2NPIA 4OHWA 2V09A 3M3QA 3ACLA 1POV3 4J1XA 1TQ5A 1LOEA 5ABJB 1W0PA 4XXAA 2DV9A 2GDFA 4XBNA 3IMNA 1EV12 2PHDA 1D0HA 3OD4A 3GYDA 3W59A 2JG8B 4O9GA 1REFA 1SQ4A 1HQWA 1U5IA 2C9AA 1OA2A 1QXRA 3BALA 1N3QA 4FP3A 3UJOA 1U5XA 1FOD3 1ASJ3 3MIEA 5CFDC 2O8QA 5JSPA 2VGDA 3AZWA 1YIPA 4JVAA 3M7AA 2BFUL 2JECA 4X6QB 4K21A 4YW3A 3EXUA 1QKQA 3WQ1A 1QWRA 1ZZ6A 5K8SA 1ZVFA 4AI2A 1TMF1 3RPQA 2XJSA 3PMEA 1PIV3 1V9U3 3LA3A 4F7ZA 4N90A 4UW6A 5JR7B 4UBHA 1LOBA 4ES8A 1HX6A 4FT8A 3EO6A 1YO8A 4WBBA 5T5OA 1DGWX 1NCQC 3SCGA 4FQZA 5C6CA 1CAXB 3Q9OA 3AZVA 1J58A 3N4MA 1JYIA 1WMFA 2FZ1A 3HT1A 4XF3A 4MXWB 1PGSA 2CY6A 5KXDA 4Y1XA 5CADA 4QPIB 4WVVA 1GR3A 4AI8A 2P3KA 5J7MA 2CL2A 3USUB 1VB2A 2E63A 1S1AA 4OI1A 2DURA 3OD0A 2UY8A 1ULGA 2YY1A 2A5ZA 4CP0A 2QQPA 1Q43A 4COVA 1O3RA 1TMF2 3J8F1 3NWKA 3KGZA 4Y22B 4JCKA 4GH4A 4XETA 4HMZA 1LOCA 2PLV3 1LOAA 3KT7A 4LE4A 5J36A 2Y0OA 5B2GB 1BYHA 1F9KA 3JQXA 1OD5A 5J