2DFBA

Xylanase ii from tricoderma reesei at 100k
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title Structure of an orthorhombic form of xylanase II from Trichoderma reesei and analysis of thermal displacement.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dfbA00
1M4WA 1IGOA 3VZKA 1XNKA 4H7MA 1QH7A 1XXNA 4XQ4A 4HKOA 1XNCA 1C5IA 1HV0A 1REFA 3AKPA 3RI8A 3VHNA 1H8VA 2DFBA 3LB9A 2VULA 3B7MA 4IXLA 3VGIA 3WP4A 2DCKA 1XNBA 2QZ2A 3LGRA 1QH6A 4NPRA 4XQDA 5EJ3A 3WR0A 2JEMA 3MF9A 1BVVA 3MF6A 1BK1A 1UU5A 2B46X 1OA4A 4HKWA 1REEA 2BWCA 2F6BA 2VUJA 3VZOA 2BW8A 1TE1B 4S2HA 2B42B 3AMNA 3WY6A 3WQ7A 2DCZA 2NQYA 4HK9A 4HKLA 4S2GA 2VGDA 3MFCA 1H1AA 2BVVA 2C1FA 5HXVA 3AMHA 3AMMA 2JICA 1H0BA 3WP3A 5K9YA 2VG9A 3VLBB 3WXPA 3HD8B 1UU4A 1OLQA 2DCJA 3VHPA 1NLRA 3MFAA 1HIXA 1PVXA 3ZSEA 1UU6A 3B5LB 4XPVA 3VZMA 1OLRA 3AMPA 3VL8A 3WP5A 1YNAA 5K7PA 1XYNA 4HK8A 1XYOA 1KS4A 3AMQA 3VZNA 2DCYA 3AKQA 2D97A 1OA3A 4S2FA 3VHOA 3M4FA 3EXUA 4S2DA 3WX5A 1UKRA 3VL9A 2BWAA 4XQWA 1W2UA 1KS5A 3WQ0A 2D98A 1C5HA 3AKTA 1XNDA 1F5JA 3AKRA 2NLRA 3WQ1A 3RI9A 1AXKA 1HV1A 1REDA 3O7OA 1OA2A 2Z79A 1ENXA 3WT3A 1BCXA 1XYPA 3WP6A 2B45X 2JENA 2QZ3A 1H4HA 1H4GA 2DFCA 3VZJA 1T6GC 3AKSA 3VZLA
chains in the Genus database with same CATH superfamily
5IHRA 2Y6KA 2FCVA 2DU1A 2PMWB 2Z2SB 4CSWA 2UURA 1WWYA 1HKDA 2RDRA 3KCXA 4SLIA 3UL2A 3WVJA 2YY1A 4ATEA 4DRRA 1S2BA 4I3GA 1W0NA 1VBD2 2LTNA 2R071 4D6RA 5KHHA 1Q5OA 4FTEA 5GKAC 3CQOA 2Y6LA 3N9NA 4I0AA 3RI8A 5CEHA 3AZXA 3J26N 1G9CA 3THCA 4IGOA 3LB9A 2XJQA 1FXZA 1XRUA 2HEWF 2RVAA 4PIYA 5H9SA 3ZYGA 2CAUA 1NAEA 2UWBA 4TSVA 1GZWA 1QH6A 4TLGA 4ZXKA 2DVFA 5FZDA 1HXS3 1UYYA 4R9CA 3I59A 3WR0A 3UKVA 1K42A 1BVP1 2JEMA 4BK4A 3VBSB 1OVPA 5HBAA 2BERA 2C0ZA 1SBDA 4OHVA 2VOTA 3A22A 3ABZA 4E27A 2VR4A 3OGVA 4JGYA 4QT6A 2DBNA 3SXWA 4E2GA 4YZ1A 4W6YA 4COUA 5B4XA 4JCKA 4YNIA 1CAXA 1PO21 2H0BA 3FLTA 3LCPA 2WZR2 1KXGA 4E2QA 1O3RA 4XTPA 5LA1A 1DBNA 1AYN3 1HLCA 1S0GA 2W1UA 2DUOA 3G7DA 4R8HA 5JZGC 5C3SA 4RS5C 3S0MA 4HG6B 3GGLA 1HRV1 3DPRB 4QQPA 4QHOA 5F9TA 1IS3A 5HCFA 1YQ8A 2W68A 3DXTA 3IN9A 2R1DA 2WNUB 3A4UA 4XXPA 4BH9A 4HKLA 4L2NA 2ZGRA 2RR12 1WMDA 1MZ5A 1W6MB 3MFCA 3RZJA 1SQ4A 1SLAA 2C1FA 1PO11 3MBWA 1F5FA 3J8F1 2AREA 1LR5A 4W8JA 1RUE2 3ZXFA 4QXBA 1GNZA 3WW3A 4A42A 3D6EA 3HD8B 4QKBA 1B35A 1B09A 1TMF1 1UU4A 1UXZA 2PHDA 4NPLA 3HN3A 2I45A 1D7PM 4P5YA 5FKBA 4W6WA 1OURA 3B5LB 3FWEA 4AGVA 2ZX3A 3MIHA 4XHBA 4K20A 1C4RA 3GZEA 1HB2A 3VL8A 4UF0B 1UPIA 4CA9A 4HSLA 2PN5A 1MQTB 4MGIE 4XE9A 4NIDA 1D2SA 1ZZ7A 4I2OA 4GJZA 5JR7B 5A7WB 1RB8G 4L9BA 1S0EA 2R072 5EJZB 1XB9A 5SV8A 3ZX7A 4AVTA 1H2NA 3I2OA 4IUGA 1CESA 2R49A 3NMBA 2GMPA 4LXLA 2RE9A 4MGTA 2JDAA 4OMDA 1CZSA 2CDOA 4N7UA 3SH5A 4AEKA 4B1MA 5IVCA 3H50A 1OA2A 4P5HA 2ORZA 2WC2A 3ZO0B 4QMAA 1X33A 1YQ6A 3NJXA 1WMXA 4IV3C 4UOJA 3UYJA 5FZHA 2HJIA 2Q1ZB 5DUVA 1PO22 1OOPB 2BGOA 5FZBA 2P6HA 3QACA 2D43A 1AF9A 3MIFA 4MYEA 5IT6A 2R061 3PTYA 1J84A 3OUJA 1C8M3 5LASA 1ASJ3 4A41A 4COWA 1S0IA 5J98B 1LODA 1FPN2 1ACCA 3OGJA 3GXUA 1ZNPA 3DYPA 2J1EA 3ZXDA 4AI0A 4H7MA 1GZTA 2VBBA 1PO12 3ILNA 1X8MA 4QGMA 4W4ZA 5FY0A 5BV6A 4N43A 3PIGA 4LA2A 5GALA 4LBQB 2W95A 3MHZA 2D6KA 1ALYA 2O14A 2XJUA 1S0CA 1TMF2 2IXIA 5CG8A 4PF5A 2CTVA 4QPGB 4GB31 3RVHA 4IEZA 5F5IA 3LFIA 1ZRDA 1VBC2 3MI8A 5FQ0A 2K46A 1QIQA 2BTVC 1BK1A 3ZDVA 5LA9A 5A6ZA 1QKQA 4PLNA 5C71A 2WYSA 3ZOIA 1KJLA 1D4M3 3T2OA 4Q1RA 3H8RA 4FFHA 5BY5A 5C70A 1YQ5A 3RYKA 1UZZA 2BW8A 1CQ9A 4LOTA 5FBZA 4D3WA 2Z42A 3HPNA 1MEC2 5A7QA 3E5UA 1Y43B 2UWAA 2Z4FA 3OGSA 4RD7A 2B5HA 3VKNA 1JZ7A 4UW3A 1PMIA 5FZKA 5JCTA 4JRAA 5A1FA 3ZYBA 3KVAA 1NLSA 4ITCA 3C8XA 5J09A 3OEAA 1GNHA 4EN0A 4FSJA 3BOPA 3DYOA 1NZCA 1ZBE1 2CU5A 4IERA 4HPKB 1LHOA 4Y20B 5DAQA 3R0RA 4AAXA 3L9JT 3PVBB 5JPNB 4FXGB 3EO6A 2P6CA 4OI1A 5FP9A 4NRQA 2Q8EA 4J25A 4CDXA 4OHYA 3E6CC 3URFA 4AW7A 1AL21 1PO23 1WD4A 5FZ7A 1PZ7A 2A73B 3NV3A 1JZ3A 1PVXA 1URXA 4KBBA 4BA6A 1W05A 4M3CA 4YVWA 5FYBA 5DMYA 1ULOA 1V6IA 4CCNA 3K77A 1AR93 3LWCA 1DQ1A 3ES4A 1HRV3 4N9IA 5DDJ1 1RUD1 2YC0A 3BU7A 5DUUA 5J37A 4QKNA 1GQPA 5A1LA 1ND2A 3AMQA 5JDBA 3I3MA 3HT1A 2VO5A 4CXYA 4ZU5A 3WNMA 4B4RA 1AJOA 5A70A 1GICA 2OUHA 3J8F3 1U0AA 2VXRA 5E8AA 2CNAA 4META 1QXJA 3T2TA 2A6XA 3K48A 1CONA 3OUHA 3L2YA 3PVOA 4ZU7A 2OW4A 1E5IA 5FZIA 1CX1A 4OUEA 4GB32 5C4WB 4WVZA 5JUVA 5M0TA 1GWKA 5KR7A 1BCXA 2LRPA 1XU1A 2P4EA 3FMGA 3H3UA 1AXYA 5FZAA 3WNOA 1WMFA 2R0HA 3BCWA 2OXBA 1LHNA 3NKGA 1OLMA 4HBNA 1Q8VA 4JHZA 2BYVE 4Q0VA 3VBUA 4LKSA 3MIGA 3Q8CA 1G7YA 1ZZ8A 4FFFA 4CUGA 2VNOA 4XUTA 4EWEA 1FOD1 3WDTA 5DAPA 3RZZA 4CU7A 5AC91 5D8AB 4CCCA 2XPJA 4FOYA 3RYPA 1COV3 3OSDA 2P3JA 3GJAA 4JKMA 2AYHA 2IWGB 4IV1C 5IJRA 4DXTA 2R16A 2RJKA 3LSEA 4RR3A 5FO8B 4P9IA 1R1A2 1QQP2 2ZMNA 3LD8A 4AVBA 3N9MA 1O4YA 2CSGA 5BNPC 3FHIB 4Y33A 2JG8C 1XJAA 1ZBE2 5GZEA 1SLCA 4XILA 1HN1A 3BALA 3R6SA 4WM7C 4BQ5A 1LOCA 5K0UC 2XKPA 4LO8A 5IK4A 1SLTA 1YFWA 4FI9A 1RL3A 2BNMA 1W04A 1AL22 2KD7A 1XNBA 4XQDA 3ZSJA 4NPRA 3CO2A 4DPNA 1ZVFA 2RS53 2WJSA 1XQNA 2YC4A 4KBZA 5I0UA 3LA2A 4PHZA 1OT5A 2WWJA 1KD7A 5FZFA 3WHUA 1RHI2 1VBB1 4CEYA 4DQAA 2R063 4N8MA 1BKZA 1HB1A 5H9RA 1FX5A 3ETQA 2OKXA 1U5XA 4IEVA 5FAXA 3VKOA 5DDJ2 3KGZA 1RUD2 3EB7A 3JBG3 3VZOA 2XJPA 4NO4A 4MGZE 1TE1B 3DKWA 3U14A 1A34A 3PVEA 3SKVA 2ZHKA 2ZS6B 2ZACA 3ZN6A 1SCRA 3ZKUA 3VN4A 5FP4A 5EYXA 4NRPA 3MIDA 5JZGB 1YQCA 1JU4A 4RS5B 1JBCA 5K8SA 2R041 2VGDA 5FCCA 5G05L 5A6YA 3PDQA 2VTXJ 4A3ZA 4XDOA 4AXOA 4X8PA 4RHV3 4YG6A 5F8PA 3BIEA 4TZDA 2GNTA 3ZMNA 3PUAA 1X50A 5CKQA 2VG9A 3POWA 4IE5A 2W9XA 3GBWA 4QX0A 5FFOC 3VLBB 5BNOC 2D5HA 5C3PA 1RUNA 3ETPA 3ZXEA 3PIJA 5AFBA 1LNSA 3LKJA 3OF1A 4XBLA 4Y5Z0 5JVVA 4PDWC 3IMMA 3RRDA 1UU6A 5AC92 2MEV2 1ZREA 1JUHA 3EBRA 4JVAA 4ZPIA 3EHKA 5IFPA 1WBLA 4LO7A 1UOFA 1W8OA 5JMOA 1BBT2 3AVRA 2A5ZA 4EZ4A 3GALA 3IBMA 2HWE3 3WW4A 4Q26A 3WQBA 2D97A 1LOBA 3VBRB 3L2HA 2DTYA 3ACHA 4Y1ZA 3ES1A 1AX2A 1SMVA 4XQWA 1W8NA 1KS5A 4C1XA 4OFGA 1MZEA 4ONUA 1PIV1 5J48A 5FWEA 4BLJA 4P00B 1A78A 5EIYB 3WV6A 2PHRA 1D0HA 3OCPA 4M4PA 3FC0A 3VDDC 1OPOA 1EPZA 4MXVA 4MLOA 2Z79A 3D4KA 5HXMA 1Y9QA 3WDXA 5JXIA 2IFRA 2LM3A 1YLLA 2PHXA 3VBSA 3IAQA 4RGKA 4B4QA 4M3CE 5DDJ3 3ZSKA 2GC0A 4IV3B 1UY1A 4CTEA 3QLQA 5KXCA 2RDNA 4LE3A 4D6SA 4P9JA 5A33B 4IEYA 1W3VA 4IEUA 4L99A 2A75A 5ANQA 3BPSA 4K6BA 3T08A 3SISA 1DF0A 2EIBA 4FFGA 4K7JA 4DXSA 1S2KA 2ATFA 2I07B 2HWD2 4H2AA 1Q8SA 3V56A 3DPRA 1L7LA 2ZCWA 3I3BA 3P3NA 2ZBJA 4XVHA 1IS5A 3ACIA 5EV7A 2WNUA 2JE8A 2ZEZA 3OOXA 4I09A 5FJKA 5GLZA 5LW9A 1C5IA 1W6MA 3MW2A 4YM1A 3ZLIA 2EIGA 3NNLA 5A6QA 3S57A 1NZIA 4EZHA 1IG0A 4YVSC 2XVGA 1RVF1 2V5YA 4RSUA 4XABA 4CP9B 5B4NA 3NKTA 1FT9A 5EJ3A 5FZ3A 1LGCA 2WWUA 4NAMA 3JQWA 5FY4A 5F37A 1OLME 2GMEA 1FOD3 1PMHX 4LO4B 5GLVA 1AZDA 2BFUL 4MXWB 1CJDA 1QOTA 2E63A 2VZRA 2RDQA 4QU2A 2R6QA 3B69A 1RUOA 3B9IA 4MGSA 2F6BA 3AP9A 4HXCA 4XTMA 3U78A 3OPWA 1NE6A 1W6PB 1VMFA 4UF0A 2G9GA 3MUY1 4CPBD 5I8YA 3O1OA 2J1VA 4MADA 1MQTA 5GM0A 3AFKA 3I49A 2B42B 4YARA 3WY6A 5BYNA 4LO5B 1OH3A 5KWRA 5A7WA 2JKXA 1JTZX 2WS92 1PGL2 4AEMA 3T0AA 1R081 1LOFC 4XAEA 3FFZA 4NPMA 3LAGA 4V2WA 2P17A 2QQMA 2IXLA 4Y5TA 1J58A 2WO1A 3U1XA 1ZRFA 4QX3A 5DABA 4D7YA 4P14A 3WW2A 3N9LA 1MS8A 1BJQA 1PK6C 2PQSA 4HMZA 5T5LA 2CGPA 1UY3A 3ATGA 1UY2A 1VBB3 2JDUA 4LBMA 1C28A 3WXPA 1DZQA 1GP4A 3CNAA 4LUKA 4WZFA 5F32A 3W5NA 1DZTA 3WNPA 1UNBA 2D5FA 2FDHA 3F2ZA 3CL1A 3PURA 3MPBA 2GH2A 2YGLA 1HIXA 1N1VA 3K4DA 1OOPA 1RINA 1SCSA 4UW6A 1OLRA 4QQLA 4A44A 5C7GA 4X8NA 5FK8A 1H6XA 4AFAA 1YNAA 4EJRA 1RITA 2WRAA 4HK8A 4YW4A 1XNTA 2AEYA 4AR2A 4MSVA 4ZY9A 3O1PA 2R043 5A3MA 1VMJA 1ZA4A 4CP2A 3IB3A 4CVUA 1X8EA 3KF5A 3CZUA 2KA3A 4NMIA 3NRUA 1UZ0A 4I0BA 1ENRA 2ZGMA 1ZA7A 4D7SA 1CZVA 1F4HA 1SLBA 2BDRA 1RVF2 2ZAHA 2PHFA 2XR4A 2YBKA 4LBQA 3LEKA 3VUOA 3IDAA 1HV1A 5FZ0A 4PT6A 1ENXA 3V0BB 5FWJA 4QPGA 3MO4A 2D3PA 1XOYA 1ZRCA 1V9U1 1NCQC 4EV0A 1R64A 1U5YA 1YJKA 1YUDA 3HNYM 5FIXA 3MZHA 2WFF3 1Q56A 5KXEA 2JENA 4AE2A 1UMZA 4UFJA 4AVSA 3RZKA 3V64A 4EN7B 4RFRB 3SKJE 3BU0A 3RJRA 1XE0A 3AP5A 3VZLA 4LR4A 4HVOA 3FX3A 4IQPA 5CISA 1PIV3 4YW3A 2Y38A 1M4WA 2P3IA 3J4UH 5LBEA 5C3RA 2NMNA 4CDWC 4ZZ5A 3LDKA 4Z2AA 4XQ4A 4QDQA 2W1SA 4IV1B 3IT8A 1V6KA 1VAVA 3AL6A 5IUQA 3PJQA 1HV0A 2C6SA 1Y9GA 5L7OC 1FNZA 3HT2A 2OZJA 4Y20A 2WLQA 4HPKA 5BNPB 2YUEA 5JOWA 4IXLA 4LKFA 2JG8B 2ADEA 4Q4Y3 4C8DA 2UY8A 2ZXQA 4C0HA 5LZ6A 2VCAA 2QZ2A 1OKQA 2A7AA 2EAKA 2PYTA 3Q8FA 4RGGA 4WM7B 5FYMA 2VZQA 4PI2A 1MACA 3JD71 4HL0A 2KM2A 3J7HA 5T3NA 3USUB 4Q2FA 3ZYHA 3AK0A 5ANNA 2FDKA 2QFEA 2G4IA 4IL7A 1UY4A 2AUYA 2P1BA 3SITA 2IXHA 3PUQA 5FXWA 1PNFA 2D7FA 1QF3A 4P9LA 3SMHA 2QQLA 1LJ7A 4AOCA 5A3LA 1BEV2 3FHQA 2AZ5A 1O5UA 1LHUA 1RMU2 4H14A 2IXCA 2V4AA 3KLSA 3ZXKA 1OHFA 2GNMA 4XFHA 1YCIA 4YFWA 1KJRA 1XPWA 5T5OA 2QQUA 1NXMA 3M3EA 2BU9A 1UOBA 4NWVA 3LF7A 2DCZA 3M3OA 3S5AA 1O4TA 2VPVA 1CVNA 3POFA 1RVF3 2QVSB 1PM7A 3P1IA 4ZKTB 1DQ0A 3B9CA 2OYZA 1JUIA 3E5QA 1H0BA 2JECA 4F83A 5FDBA 3GYDA 4JC1A 2P37A 2PHTA 2J7MA 4UT5A 2RM21 4DUVA 1AVBA 2DF7A 1HRI3 4Y5SA 5DG2A 5C4WA 3ZFEC 1I9RA 5FMDA 1YI7A 3B00A 3OUIA 1UWWA 3SC7X 2RG4A 5AVAA 3PU3A 1DQ4A 5BNOB 3H1WA 1GP6A 2E7AA 4XJAA 5C9AC 1EPWA 1VBE1 1I6XA 3ASIA 1VR3A 2FDJA 1Z0HA 2CGOA 3ZMOA 5DZEA 4KU7A 5GLUA 3HNBM 4PDWB 4CCLA 5K7PA 1UW8A 5D8AA 1LESA 3J7NA 3ZPOA 1LGNA 1R083 4XACA 1N1TA 1F35A 2AENA 3AKQA 3D3AA 2D93A 4EQVA 2ZX2A 4NJ4A 4S2FA 5CKNA 1VBD1 2Y6HA 2YB7A 1IS6A 2NZ9A 3OY8B 4Q4W2 3P3PA 3VD9A 1PM4A 3I2DA 3GCWA 1VJ2A 1GV9A 1V6JA 3LDRA 1HX6A 4B1LA 4F3JA 2FBEA 1OFSA 3C7FA 5JR2A 3HBZA 2YXSA 3HQUA 1UQXA 2IFWA 4LPLA 5C5TA 3RI9A 1AXKA 5T55A 3AZVA 2K2SA 2Q30A 5LY1A 4GD4A 4Q0UA 4GWJA 1PMJX 3JD72 1PGSA 2SBAA 3VDDB 1S0DA 1FNYA 2YHJA 2ZTNA 4R9BA 1AR73 4A7ZA 3BTZA 4QXCA 2PHWA 3MICA 3HWJA 4IDZA 4QAWA 5JXGA 2WABA 3KQRA 4KWUA 2Z5WA 2VAUA 5EPAA 3T4VA 3WNLA 3JQXA 3GDBA 3O1UA 2JWPA 1C8NA 3ZDSA 3LEGA 2JE9A 1O8PA 3ON7A 5FZ1A 4XFCA 2ES3A 5LA2A 2RR11 5KHIA 4DEVA 1G9AA 1N3OA 3HAGA 5EYYA 5I0RA 5JZGA 4AHZA 4RS5A 3ZR6A 4BMEA 1PX4A 3ZFGC 4QM9A 1DLCA 3AKPA 4XC9A 4JDOA 1QJY1 3AZZA 4UFIA 1TZOA 2ZABA 3D0JA 3THDA 2A6YA 2QUOA 3WZ1A 4DOUA 1BMV2 1V9U3 5IATA 5DQ0A 2Y33A 1DYPA 4N90A 1OF3A 3CLPA 4N9HA 1W8HA 2WAOA 4YVSB 3HNMA 4P9XA 1YI9A 1VBE2 1KDKA 4HLTA 1GZ9A 1GMMA 1SFPA 3K4ZA 3PL0A 4XJ8A 1RUC2 2ZGSA 3SHRA 1VBA1 4Z2WA 1GUIA 3AP4A 1DQ5A 4L0PA 4RQPB 1UIJA 2ZJCA 1IPKA 1ULDA 2J42A 2YG0A 5C6CA 1NXD1 1TNFA 3AMNA 1WBFA 3VBRA 2YC2A 2E53A 3ALQA 5DG1A 3HBKA 1LGBA 3CJXA 5F6KA 2RDSA 5JOXA 4OHZA 3AMMA 4LKEA 2WQ8A 5LY2A 5FPZA 4WVVA 4YW2A 2F4LA 3DCQA 2CYFA 1F8VA 4LULA 1W6NB 2DWRA 1G6NA 4F7ZA 4Q0SA 1PK6B 2JB8A 4AWDA 3V0AB 4XBQA 2IVIB 3N9QA 4OLLA 3VHPA 3P5BA 4ARYA 2OA2A 4PIZA 5FLIA 2O8OA 4QHZA 1AXZA 1BHGA 2VQ0A 3NVCA 4MGKE 4IV3A 2BV4A 1WCQA 2CAVA 4FOQA 3SH3A 4O65A 1N1SA 2ZZQA 1HDKA 1FPN1 2Y0OA 5H9QA 5A33A 2ZKNA 1C1FA 1WA6X 2B9VA 2VBPA 4Y26A 2LALA 5IVJA 1O8SA 4QB2A 4E4HA 3IIAA 3NAPC 1UO9A 5CB7A 3H8XA 4QHBA 5IVEA 2RV9A 3OJBA 1JZ8A 2RM23 1QJY2 5E1RA 3MLJA 4CDUC 1C57A 3AKTA 1K5MC 1RTVA 1OF4A 4FBFA 4EN8B 2H6CA 2XWBB 4AVVA 1O3QA 4LBJA 4QDRA 2HYKA 2VZVA 1H8TC 1VBC1 3AJZA 2Z69A 3GM8A 5FMOL 5GLTA 4CP9A 1AUYA 2VZPA 5FZEA 4NN0A 4URAA 1DGWX 1VBE3 2EIDA 1GWLA 3ZM8A 5BXXA 1NQDA 5CBLA 5FUIA 4GULA 1VB2A 3BTXA 4CU9A 4CE8A 1VBA2 5GJ6A 4OYUA 5ACA2 2OT7A 1RUF2 2ZGTA 4MXWA 1Z7S1 4FPCA 4BZ4A 4NUBA 3U37A 5I93A 4XFFA 2QE3A 2GH8A 1NCQB 1JOJA 1MEC1 4LBKA 4LK6A 5A7NA 2ID4A 1VBD3 1W6PA 2IZWA 1SG3A 3UK9A 4FPKA 4ATFA 3U11A 4Z8BA 4A3XA 3U4XA 3I54A 4YZ3A 2PQQA 3JUUA 1FV2A 2ZHNA 3KM5A 4MX3A 4AI9A 5BNNC 3H8UA 3SQOA 4QPIC 1UYZA 3OGGA 1YXWA 5BUVA 4EWDA 2G1MA 1O3SA 2WWSA 5LEJA 1LULA 2VMHA 5T5JA 1REFA 2KR2A 4CDWB 3IM0A 1ULCA 3ENRA 4CYDA 1RJ8A 3WUDA 1QJX2 2VCCA 4B4PA 1O91A 1NY71 2JB4A 4E8CA 1DLLA 1I5ZA 1JU3A 1QJFA 4DS0A 3MPPG 3LGRA 3T2PA 5L7OB 2HWB1 2WZR3 2D44A 3AYCA 2QQKA 2IC1A 4LHNA 4CXXA 3KVBA 4Q4V2 2W39A 5FTTC 3UGHA 1JODA 5FKCA 2PLV2 3TEWA 4EWAA 4I0WB 5FYUA 4BQ4A 4B29A 2RR13 3N4MA 2X29A 4LIVA 1MS3A 3ACFA 3CKHA 4TWTA 1LB2A 4E2SA 1US3A 3VBHC 4ISQA 4FXKB 2BPA2 1QJY3 1RUE3 2NQYA 3EJKA 2EIEA 4HK9A 4IEPA 3SCFA 3VDBA 1STMA 5A80A 5AFEA 1Y3TA 1L3JA 5ABJC 2XQXA 3POEA 2YROA 5CZKA 1U5ZA 4KWLA 4QX2A 1V00A 3PHMA 3BVCA 2FCUA 4CEWC 3V0BA 1W8WA 1VBA3 1OQ1A 2HBTA 1ZX5A 1QU0A 1Z7S2 1E57A 1VP6A 3ZFEB 2HEVF 3NJZA 4OQ9A 2R073 3C2UA 2XUMA 1CPMA 1NA1C 5C9AB 3INAA 3UJOA 4UBHA 3F95A 1R1A1 3WG2A 1QQP1 4ES9A 5A3NA 5I0TA 5JI7A 2E7QA 2DURA 2VZSA 4CCOA 1E5HA 2F4PA 4SBVA 3WX5A 1N47A 1UKRA 3IZOA 2CGNA 4IV1A 4AQSA 3GZTB 4AFDA 1GOHA 2QDNA 5C8CC 1NY72 2BUKA 2TBVA 2VQUA 5FZ8A 3PUHA 5BNPA 4UI9L 4QX7A 3AL5A 2JG8A 2HWB2 4WZCA 1H1MA 1JYXA 1RHI1 5F2SA 3C7EA 1MS9A 1UX7A 4WM7A 1TVGA 4M01A 4FAHA 1VLNA 2HYXA 4PQQA 4C91A 4AEJA 4JTOA 5E88A 3MV01 1FPN3 3USUA 1NYWA 1VMHA 4OCTA 4UWDA 2NYYA 1KITA 4YWAA 1TG7A 2XBO2 1H4GA 2XJVA 5IVYA 2JDKA 3W21A 2GNDA 3M7AA 2XLFA 2NM1A 2TUNA 1PO13 1IHMA 3M3QA 2WNVC 1VRBA 2WQ4A 5L9RA 1CPNA 3HOBA 3RFRA 2VE1A 3VKFC 4RYDA 4KH9A 1ENQA 4XF9A 1ZZBA 4H3WA 4PLMA 4P9YA 1UY0A 1TMF3 4OZOA 3WF2A 1CIWA 4E9KA 5FUNA 4PCRA 5FXVA 2EAAA 4OZXA 3WF1A 3BUCA 5FZCA 3NV4A 3JCIA 3G6JB 1VBC3 3R4UA 5FPXA 4MO3M 3DXUA 4OHWA 4D0QA 2RMU1 1W9FA 3NJYA 1OC1A 3WDUA 3WF4A 4NAOA 3ZFGB 3K75B 3LEIA 2YBSA 3KT4A 5FZLA 2Q5TA 3MW3A 3KD4A 4AEDC 2E9QA 4XEZA 1YC61 1YO8A 1X9TA 2ZKLA 2VXJA 1AJKA 1AYM2 2DV9A 1VPHA 1LENA 2MEV1 3RZHA 4K8RB 1MEC3 5BNOA 1FMD1 1EUTA 2CWMA 2ZX1A 2XKOA 2C24A 1BBT1 2ET1A 3VB9A 4DB5A 2GP3A 1XE7A 5HCAA 4L92A 4PDWA 2PHLA 4A7KA 1SBFA 2QJVA 1I3HA 1T6BX 3N7JA 1DQ2A 3KMHA 1VAKA 1ND3C 1UIKA 5FZOB 1NOVA 2VOXA 3GBGA 4TYSA 5DZGA 5GLWA 1VE0A 3AZYA 3I7DA 3OY8A 4XOGA 3U4SA 4FPFA 3TNQA 1FATA 3QBQA 4COYA 2VOVA 3VD4A 3LQCA 4DMIA 4AGRA 4COZA 4IE6A 3VD5A 5FO7B 3POBA 5EQUA 1GNYA 4I3PA 4Z07A 4A45A 3MUZ1 1OLQA 4XMIA 3VDDA 2DCTA 3FUOA 2NPIA 4Y4RA 1LEDA 2JDHA 4QX1A 5JI9A 4G3YC 2D3SA 2ARCA 2LW8A 2XL9A 4MGYE 2WZPP 2ZX0A 1IS4A 2BQPA 5IFTA 5KBFA 1S0JA 5T50A 3TYJA 2HWD1 1MPXA 1XYNA 2XDVA 5F3EA 4YZ5A 1S0BA 2WO3A 5IVBA 2RS11 4HANA 4QKFA 2BGCA 1MR5A 4QXHA 3SH4A 4GB33 1V6MA 2PAKA 5HCHA 1E5SA 3IKWA 3POYA 5A3OA 1ZBA1 2D98A 2RMU2 4BIOA 3NAPB 3ACGA 3GHNA 1V0AA 3ELNA 3OTFA 4L97A 2G9FA 3WQ1A 5FY1A 3R4DB 4B7EA 1JS9A 5LK5A 4CDUB 1K5MB 3X29B 1W0PA 3VBFC 1LTEA 1WCUA 3J9SA 3NNJA 5FZ9A 1K3IA 1ULPA 4YVSA 1FMD2 4NHXA 3VBUC 2CDPA 1H8TB 4DINB 2FMYA 3N7KA 2DVDA 1AR81 3AXEA 4KGGA 2DYCA 2RS31 5T54A 4FO9A 2WN2A 1R1A3 1SFYA 1QQP3 2WN3A 3KWVA 5L9BA 1H4HA 5FYSA 4RQPA 4N53C 1ZBE3 5IVVA 1WW6A 2DU0A 2WA4A 4NR1A 1PGL1 3THPA 2WS91 4XHXA 2A6ZA 2YPDA 5ERLA 2DVGA 4ZU4A 4TTGA 2Y60A 3ZXAC 1ZRIA 4XETA 2YU1A 5I8SA 1QH7A 3FJSA 1AL23 3KT1A 1QOOA 1JXNA 2ZX4A 1N3PA 2VQTA 4EE2A 2ZHLA 1W9TA 5BNNB 4C0BA 4Y3OA 3E97A 1RHI3 4INDA 1U5IA 4YG0A 3GZAA 3PUSA 4QPIB 1AR61 4A2UA 5IVFA 4OI2A 3B7MA 2X05A 1PX3A 4G4FA 2QBXA 3S5QA 4XIOA 5CIRA 1N3QA 1W6NA 2DCKA 4AG4A 1RUD3 5EXOA 2W1QA 1PK6A 1JH5A 1QJU1 2FQPA 3HQRA 3V0AA 1SEFA 5FP8A 5SV5A 1UU5A 2E51A 1OA4A 1OVSA 2BP6A 3Q8BA 4B8EA 5JSPA 1G9DA 1V6LA 3DUIA 4FPGA 5C33A 3N36A 2QQNA 2RS12 4COVA 3RDIA 3ZXGA 3FBMA 2JE7A 3BB6A 3HEIA 4K40A 1GSLA 3O0WA 5ISLA 3E1F1 4YGBA 1JZ4A 1WW5A 3CJIC 3Q8AA 3D5OA 3WLUA 4BMBA 1SACA 3ZFFC 1ZBA2 1GQHA 1QMJA 5G04L 5A7PA 4M00A 4QQOA 3LZZA 2WT1A 3VBHB 2QQPA 2JDZA 3VDCA 1A3KA 2Y6FA 3ZYPA 2JX9A 3RNSA 5AC93 2MEV3 3H3LA 2VJXA 2GU9A 4FPHA 4CU6A 3WHTA 1FMD3 5ABJB 3RZGA 2VQAA 4PBPA 3DGTA 1BBT3 1J3RA 2LS6A 4TXWA 2VTFA 1AR82 5FXXA 4W65A 1RGSA 2DTWA 2RS32 1W2NA 1ZZ6A 5EWSA 4CEWB 5LBBA 1PNGA 4FFIA 1SFNA 3ZSEA 4NIGA 3BGAA 2FZ1A 2BJSA 3I4IA 3FUQA 1YIFA 1IZ3A 2OVUA 3QD6A 5FYIA 1F4AA 5FXZA 5J36A 4LLOA 3S6PA 1NCQA 3GJBA 5C5UA 1XNAA 3FBYA 1OSGA 3RZMA 4DUXA 1KS4A 3RPQA 3VZNA 3HJRA 2QDRA 3TOJA 4HONA 3SNMA 4BQWA 1NA1B 1EP0A 2IUWA 2Q0AA 2YDEA 1D4VB 1PVC1 2BWAA 4R4ZA 4XF3A 5GZGA 3OPZA 4HN1A 3K3OA 1AR62 5JXJA 4DUWA 3OBTA 2D6OX 2QQVA 2K0GA 3H1MA 4CDWA 1QOSA 3E5XA 3LPFA 2XLGA 4AHXA 1I1EA 1D2QA 3E6DA 1RUJ1 4AZZA 3DN7A 2Y26A 1OUSA 4CDQC 1CAWB 4ES8A 1QJU2 1SLLA 4DFSA 5C8CB 3I2JA 3HVDA 5IWFA 2YGMA 3ITQA 3ZVXA 4BLIA 5L7OA 1JYVA 3RG0A 4Q4X2 5IK5A 1XYPA 5EHDA 4GKXA 3H7JA 4LLFA 2HWD3 3NO8A 1BEV1 1LU1A 1RMU1 1H2LA 4JKKA 1POV1 4UAPA 1PZ8A 3C7HA 2XB6C 4AI2A 2XQRA 1RUG2 3KT7A 1GWMA 1FAYA 2JIJA 2WT0A 4GALA 3N3HA 3VV1A 3ZIXA 2UY9A 4OVEA 1CAVB 3AJYA 2WNVB 4LHSA 2AGSA 3RWNA 4DXRA 2UWCA 5A7SA 3BN6A 2WZ8A 1LKNA 2WYFA 5FYHA 1TME2 5FLJA 4AL9A 4G9SB 4OMCA 4OQ8A 2VZOA 3USSA 2VULA 3RJ2X 1OFNA 1WMEA 2E31A 2WKKA 3I8TA 2ZGKA 2AEZA 2FZ2A 4BU2A 2WSUA 1AR83 3H9AA 3R4SA 1C1LA 4EYUA 4K9SA 3CDZB 2BNOA 3WSOA 1VIWB 4CCJA 3UNPA 2Y6JA 4PIXA 4AEDB 3NWKA 1JYTA 1UMIA 2HWF1 2GAUA 1UYPA 3ZFEA 4BOWA 1KFXL 5A7OA 1GQGA 3AXDA 3UGFA 4HN0A 2WS93 4LQRA 4CXWA 3A0KA 1YRZA 1DGLA 3T09A 5C9AA 1FV3A 3R05A 5KXDA 1UD1A 1CIYA 4Q4W1 1Q8PA 2B4KA 1PVC2 3WQ7A 3ZXLA 2OUJA 3DYMA 3P6BA 3ZYIB 1JW6A 2ZGPA 4JV4A 5KXBA 3T0DA 3CIHA 4Q5OA 1QJEA 1ND3B 4Y24A 5J1XA 3VHRA 5HXVA 1RUJ2 1KEXA 4YGDA 4AQTA 4RL7A 5K0UB 4GH4C 1P8JA 2VMGA 1KDMA 4MV2A 1GP5A 3GHMA 2ZPXA 1J59A 2CV6A 3LOBA 4JX0A 2OPWA 1IQAA 1D0GA 3LE0A 2Q8OA 3ZSMA 1GANA 4BHPA 1QHDA 3OGRA 1JMUB 5K4LA 3TN92 2K9ZA 4XZUG 5I8TA 3LOIA 3OG2A 2YPJA 2JIGA 2H6BA 4PF1A 3S7IA 3O1TA 2J1AA 4JAAA 5LB6A 3FE5A 3RWKX 2DCYA 1OA3A 4UFKA 2PXJA 3VHOA 2W91A 1NE4A 3CHXA 3LEMA 1SLIA 4JKLA 3NNFA 4JHTA 2Q8DA 4JGZC 1C5HA 2D6MA 4HZFA 4GZ9A 1WCSA 3RZLA 3AKRA 2VECA 1WCDJ 2MNGA 5FR3A 3FN9A 3D0SA 1JZ2A 3ZFGA 5KHGA 2WAAA 4BK5A 1M06G 3J7MA 2A3WA 1CAUB 3WDYA 1JHNA 3HN1A 1ZYBA 2HWF2 1RUC1 3FZ3A 5E16A 4NIHA 2ZGOA 1XBFA 3I2HA 4KMQA 5BNQA 3VBFB 3RYRA 4UFLA 3S30A 2YYOA 3WP6A 3OBAA 3M3CA 2GALA 3KV6A 2WL1A 5CFCC 1NLQA 5L73A 1CN1A 1ZZCA 4Q0QA 4EROA 1K12A 3VKLA 1BZWA 4AHWA 1ONAA 1S0FA 1UCXA 1QXRA 2X53S 5FZOA 5FOJB 2WT2A 4N53B 5FPLA 1RJ7A 1RUJ3 1R091 2C26A 2TNFA 2JDYA 2JG9C 4LHLA 4M3CF 4D6QA 4XUOA 2GN7A 4XUQA 3VD3A 4C1WA 4CP0A 5LEKA 5LCWL 4JQTA 2XG3A 4E8DA 1YQ2A 1BEV3 2GP5A 4CPBA 2E32A 4RA0A 1RMU3 4Z92B 3SLIA 3TRSB 3T2QA 1POV3 1S2EA 4FQZA 1HB4A 2BZDA 2QQJA 1ZM1A 1WD3A 4GAZA 3I3DA 1UN1A 1REEA 3ZYJB 1VB4A 5GZDA 3CEWA 1JYCA 3CF6E 1C3HA 3B02A 1POV0 3W20A 2X5IC 1ULGA 1CJPA 2XMLA 5DZFA 2W0XA 1QXPA 4WM8C 4KWKA 5FP7A 1JYWA 4I02A 3C3VA 1AYN2 2Y34A 4AQ6A 2I2SA 1GOFA 1K5JA 2VNGA 2WFPA 1Y7BA 5FYTA 1C8M1 3CJIB 1ASJ1 3NAPA 5FYCA 1NUKA 3ORJA 4LA3A 3ZYRA 1FI2A 1X82A 3OEBA 4U36A 3ZFFB 5TSWA 5K9YA 5KC6A 5DPNA 1GBGA 1QNYA 1JN2P 4CDUA 4Y1VA 4MH0E 1K5MA 5F3GA 2XJSA 5LBCA 2EXIA 4QB1A 1WLCA 5ACA1 3I3QA 1RUF1 3Q9OA 4NHMA 3W59A 3U10A 1NLRA 2BOJA 1W2TA 4BXFA 2O0OA 5LA0A 1JYNA 1H8TA 2BBVA 5FP3A 2JJ6A 4YRDA 1JOPA 4IE0A 3KS7A 4AK3A 4XFGA 4Q4W3 4FOVA 4BDVB 2JDMA 1OXCA 5CYYA 3WP5A 1LOEA 3O14A 4JTNA 2Q1MA 3IDBB 5F1RA 1YIPA 2W5FA 1EY2A 4XFIA 5FV3A 2TEPA 5KC5A 5FMOS 3VBOC 3H7YA 4WVMB 4RGAA 3A23A 4BQ2A 1WW7A 3LA7A 1UZWA 1R092 2W46A 5CFDC 2VW1A 3K51A 2GC1A 2OZ6A 3JD73 2ZOEB 1QJX1 1XU2A 2VZ1A 4XCAA 1W99A 4QKDA 2XGXA 1G86A 5BNNA 3MYXA 4QPIA 2XVLA 2NLRA 2YFZA 4QGNA 4JDMA 4J1WA 2G19A 4J1XA 1REDA 1GZCA 2NMOA 3JXSA 4YM2A 1YFUA 1J1LA 2W2IA 3NW4A 4YM3A 3T0BA 1V70A 4IEOA 4Q4V1 4D69A 4CDQB 1TQ5A 1TNRA 2PA7A 2PLV1 2WO7A 4FPOB 3ILRA 3TAYA 4PQ9A 2W92A 1UMHA 3K46A 2DVAA 3Q8EA 2ET7A 4XF4A 4EN6B 3A21A 1IPSA 4XCBA 3WF3A 4DY3A 1T6GC 4CRQA 1AX1A 1Q3EA 3QCWA 4YZ4A 2FMDA 3K2OA 2FD8A 2PAEA 2ZEYA 1NCRC 2VZ3A 4YSFA 2NP0A 1H1IA 3DF0A 4K1ZA 3SCHA 4LT5A 3LFMA 2A70A 2EICA 1W28A 3JZVA 4Q1PA 3ZR5A 3UESA 5L19A 1AR91 2BVBA 1C8M2 1LU2A 1ASJ2 4FT8A 3ZPYA 3A0NA 3VBHA 4IESA 2L9LA 2VVEA 1MZFA 2BEOA 5FMCA 2WINB 3MV11 2V09A 3VGIA 5FYZA 2WUHA 1RUC3 4UFHA 4XJUA 3CZJA 4LBLA 3GCXA 4ORFA 4IEXA 3ZN4A 5ABJA 4LEJA 2J1TA 4YPJA 4A6SA 2KXLA 4GKYA 1L7RA 2B46X 1OD3A 2WA3A 1OH4A 2AACA 3ZYFA 3ZN5A 4CEWA 2VBDA 3WG4A 3KB5A 1F9KA 2VUAA 4UXAA 4HFSA 4IE7A 4O9EA 1YYNA 1IG3A 3PJYA 3PUIA 5IYYA 1JYIA 1BMV1 4JRLA 3I2KA 2X8KA 3M3IA 1F31A 4O7XA 3WW1A 4XJZA 4ZONA 2OIIA 1R093 1GOGA 1NA1A 4ASMB 3EMRA 4NE9A 3VBRC 5LRSA 1D4M2 2AR6A 2FCTA 1H30A 4Q27A 2R7EB 4PJYA 2ZGNA 3PNAA 1W9WA 2ENRA 2BVVA 3ILFA 1Q43A 4DEQA 3AX4A 3QH6A 2ADDA 3AMHA 2SLIA 1COV1 1LOAA 4LOSA 2F17A 2JICA 3WCRA 5FO9B 5JSOA 2JDPA 1ULEA 3WP3A 3IPVB 4A6OA 1CAWA 5F7UA 4JGYC 5C8CA 5CA6A 2O8QA 1V6OA 3KV5A 3UGGA 4BQYA 3O12A 3M1HA 1WGPA 1H6YA 4GH4B 5LK7B 4DY5A 1F2NA 2VZUA 2XBO1 3OYWB 4YG3A 4E4SA 2Y0IA 4GMP1 5JAXA 5D21A 2Q1FA 4V2VA 4FPJA 5I0DA 2W52A 3CMGA 1W06A 1O4ZA 2VH9A 5FPBA 1SDDB 2RS51 4RFT0 1DG6A 5FY5A 1Y4WA 3RS6A 2O1QA 4QXKA 1R1ZA 2VCMA 4JQRA 1MVEA 3M4FA 1EUUA 1AR92 3UKNA 4XDQA 1CAVA 2CHHA 5JOYA 3OPTA 2WNVA 2VOWA 4LTAA 2ZGQA 4LO6B 3RGBA 1HRV2 4XIKA 1ULFA 4BE3A 4D7TA 4E4DX 3JBG1 2EALA 1RXFA 1JZ5A 3NQHA 3WDVA 1F5JA 1W8ZA 4XJ9A 5D1IA 5DAXA 1B35C 5ACA3 3DL3A 4XAAA 3WEZA 1RUF3 4QWNA 2D6PA 5IW0A 1LHWA 4JGZB 1AYM1 1IQDC 1S1AA 1UX6A 3J8F2 5HV4A 1V6NA 3WT3A 5HI0A 3IWZA 4DIQA 4BB3A 4FAGA 2YFUA 3T1MA 4AEDA 4K3UA 3U0ZA 1UF2C 1LHVA 3WDWA 1EYBA 4O61A 4RHV1 4AFCA 5FOBB 5F2WA 2J22A 2A71A 3BYWA 5I0SA 3WG1A 5CNAA 4RN5A 3VZJA 1BYHA 2I74A 2VTXA 5C8WA 3JB4C 4KWJA 1VAMA 1DDLA 2A1XA 2ZMKA 4LBOA 4UW5A 1OPMA 2D3RA 3NNGA 5FZ4A 3AYDA 2E26A 4NHYA 5CFCB 2WQZC 1QJX3 2EA7A 4QGLA 1G9BA 3S7EA 2DDUA 1RUI1 4XXAA 5JLVA 1WA4A 3BODA 2FHRA 3IMNA 1XNCA 3GF6A 3O0XA 1ND3A 1COV2 1Y9MA 1BQPA 4AQ2A 4BIFA 5F3CA 3KQ4B 4P02B 3POJA 5DXDA 2VCBA 5F39A 2HWE1 3N9PA 5K0UA 4Z1VA 4BCUA 4Q4V3 3WP4A 1J83A 1JHJA 2PLV3 1SPPB 2JD9A 1ODNA 2VL4A 1Q8OA 1SHWB 3JB8A 3IIIA 4Y22B 1O5LA 2JG9B 2JD4A 3KHBA 2VMCA 4QX5A 3WF0A 1HQNA 1WUVA 2W08A 4XZPA 5A32B 2VMDA 1W8TA 2WIIB 3LSDA 3B3QE 3MF9A 5CADA 1EV11 5L9VA 3MLLA 1W3XA 2VM9A 1POQA 1UOGA 3LA3A 4OHXA 4XBNA 3ST7A 1W9SA 4HSJA 4HKWA 1O6UA 1SBEA 2QQIA 2VUJA 2R0FA 2B8MA 1LCLA 2RS52 3BTAA 1KQRA 2V4VA 4CP1A 3BI3A 1HB3A 2IXJA 4P9GA 4GJYA 4NIIA 2R062 4O9GA 1JZ6A 4I01A 4MHRA 4B7KA 2P3YA 3PMSA 4N43C 4FPYA 1QDCA 2X5IB 2XUEA 1OI6A 3K3NA 3JBG2 4QX8A 2J1UA 2VOKA 4TN7A 4IGQA 4XDPA 4CCMA 3FHAA 4WM8B 4KG8A 3TNPB 5LATA 4AGGA 1QWRA 1JI6A 1W6OB 1Z7S3 1W03A 4AFMA 2X10A 1W39A 1W8UA 2ZMLA 1CWPA 2WLPA 1WW4A 1CAUA 2VMIA 3KV4A 4XJWA 2VW0A 2ZEXA 3KHCA 3MFAA 3KCYA 4RHV2 2Y64A 4FQ4A 2UYAA 3VBFA 2HLEA 5CG9A 2WNEA 5HCBA 4AAPA 4LORA 1XC6A 2EXHA 4XW3A 5A3WA 2VMFA 3AMPA 2ERFA 1UL9A 4P9WA 3I2FA 5DUXA 1KRIA 1ZRRA 3RMXA 5L36A 2YMZA 1BK0A 2GC2A 3DV8A 4GWNA 4BQ1A 1O59A 5HV0A 2E7TA 4LBNA 1W6QB 1RUI2 3MGUA 5JMCA 2WZEA 2HWB3 3AVSA 4N53A 4FPEA 1OUXA 4GA9A 4Y1UA 3V65A 2W3JA 3VBOB 2VZTA 4YGCA 4CDXC 2EXJA 2HWE2 4KL1A 1MS4A 5I91A 2IVJA 2YU2A 4L8QA 5CFDB 1GKBA 2ZGLA 2EVXA 1HN0A 4PBOA 4XUNA 3O7OA 5E89A 1W0OA 2XBO3 4CCDA 1K45A 4BQXA 4YVWC 2Y8KA 4Q29A 1EV12 2H0VA 4GMP3 4ZS3A 1VALA 1YEWA 4KI5M 4YW1A 4M0NA 3PTRB 1PGW1 2P3KA 1UKGA 2B45X 4OULA 3KZ4C 4ISRA 4X6QB 5IAVA 1ND2C 4LBQD 2XONA 4QM8A 3AFGA 2VUDA 5CU1A 4GMP0 3I2GA 5J3UA 4HVRA 3UJQA 4AVAA 1S4CA 5C3OA 3WD5A 3C7OA 4KQ7A 5FPVA 5A3PA 2ZGUA 2XWJB 1NQJA 5HPOA 1DIWA 5FY9A 1JOBA 2HWC1 4GXLA 2C5DA 5APAA 3ROUA 5KHJA 4BYYA 1XNKA 2LUWA 4XUPA 1XXNA 4QQ2A 1NCRB 4MG2A 1N1YA 5JIAA 1T2XA 5A3UA 1AYM3 3RSJA 4E4ZA 3CJIA 5IK8A 1YJLA 3ZFFA 5FLHA 5EFUA 4ZS2A 1TEIA 1W90A 2C9KA 3I3EA 3VDAA 4LUMA 1U12A 4FTSA 1MS1A 1LOGA 2FDGA 1BXHA 3BOWA 2A6WA 3QH7A 3HQXA 3RQ0A 3PLQA 4BQ3A 1MZ6A 1KGYA 2LROA 1US2A 2V73A 2W87A 1E5RA 3FFQA 3THTA 4BXSV 1QDOA 4AI3A 4CCEA 1WLDA 5J7MA 1MS5A 2GZWA 4R4XA 4K21A 4RR3C 5T5PA 5JPMB 4HT1T 4Y1XA 4HVQA 1FOD2 2C9AA 3NJVA 4L11A 1RUI3 5EZWA 3W5MA 3WNKA 2BFUS 3T1LA 4M4RA 3O1MA 3SEEA 2VW2A 1O7FA 2PELA 4WVMA 5DAWA 4AI1A 4YFZA 4ZZ8A 1LRHA 4XFBA 4YM0A 2RJ2A 1XSRA 2WFF1 1LOFA 2YBPA 1AX0A 4MZUA 2GMMA 2XHKA 5FBJA 1HQLA 2BBAA 4DXZA 2OPKA 2ILMA 1DYOA 4Q0PA 4XF0A 4YW6A 1YHFA 2W94A 1IOAA 5CKMA 1DYKA 4CEYC 3OBRA 3PVNA 1EV13 4ET7A 2HKXA 1GZWB 4Q4X1 1WZXA 5F5AA 2D6LX 3I59B 1PGW2 3PMEA 2UYBA 4CDQA 3GBFA 4TLFA 4JGYB 4Y4YA 4ASKA 3UV9A 2ARBA 4NROA 1VBB2 5J96B 2FDFA 1CAXB 5BPXA 4CU8A 4Q4Y1 3KF3A 5JWPA 1RUG1 2QTWB 2RMU3 2ETEA 2HWC2 2VY0A 1PHMA 3D8CA 1UZYA 2XLAA 2VU9A 4S2DA 5EP9A 1TME1 4QU1A 5FZMA 2QNKA 3MIBA 4BJ0A 1GU3A 2WSVA 4V1PA 4QD2A 4AF9A 1OQEA 2HEYF 2R042 2B39A 3N9OA 4QB6A 2E6VA 3IAPA 4A4AA 5CVRA 2DUPA 4BPZA 3IDCB 5A6XA 3BKZA 2D6NA 2VC9A 3MLKA 4NHKA 5FPAA 5GZFA 1H2KA 4LKDA 4IEWA 2NN8A 4ASLA 1B35B 4OUMA 2IXKA 1GFF2 1UZVA 2ZZJA 1OKOA 4NOTA 4YLZA 2Y6GA 1WKYA 2GDFA 2QKDA 5JOZA 4AVCA 4LNVA 1IPJA 4LMFA 1XSQA 2VD7A 1I5PA 2DFCA 3LIHA 3FL7A 4BISA 1HRI1 1QY4A 2HH9A 2QCSB 2XJTA 1CX4A 3OD4A 4RQPC 4MGQA 5GZCA 1NT0A 5F5CA 2ZHMA 1HQWA 1GR3A 2ARXA 3TWIA 1BLZA 4A7YA 2WFF2 2CWSA 5F5QA 1YWKA 5LWBA 3BTYA 1IGOA 3VZKA 2VVDA 1H9WA 2P2KA 3WUCA 2B9UA 1UXXX 4CCKA 3W58A 4HKOA 5E6HA 5FRAA 3T4HB 1DFQA 2R32A 2RHPA 4DRVA 3VHNA 2JDNA 1W2AX 1OD5A 3KSCA 1PIV2 3PU8A 3LPGA 4UBGA 3VBSC 4CUAA 1AHSA 1CD3G 3AP6A 3IPVA 4ZXEA 2E33A 1RUH1 4YZ2A 2ORXA 1WLTA 3ACLA 3MW4A 2RS13 2ZA9A 1ENSA 3B93A 4GH4A 5FK7A 3K4AA 3TN91 1BVVA 3MF6A 4UFMA 1DGRN 5JIUA 3WOGA 3LIGA 3POGA 1J3PA 5IK7A 2XJRA 3OYWA 4Q4Y2 1W9YA 2GN3A 3VKMA 3A7QA 4CZSA 1ZBA3 1OQDA 4I30A 3UETA 3DPRC 2HWC3 1DCSA 4PI0A 3POSA 2WNUC 4S2HA 5DN2A 4HOOA 4JDNA 3DECA 1AR71 1W2OA 4FCAA 4QPWA 4X6RB 3E6BA 4OI4A 1DU3D 4LK7A 1X9PA 4R9DA 5FUPA 4S2GA 3NV2A 2V5DA 1H1AA 4EN9B 2FDIA 5AVPA 4CUBA 4N43B 5H9PA 2JXAA 3WNXA 4W6XA 2RS33 1ZZ9A 5FMBA 3C7GA 3WG3A 2CY6A 4BM8A 3WCSA 3OD0A 4JGZA 4KG0A 1SZBA 3N7LA 1W8FA 2N7GA 4GIQA 1S55A 4FP3A 4XFAA 1NKGA 5D2AA 1VRH1 2GSYA 3B01A 2X09A 5FQ0B 3KCCA 2G9ZA 1EAH1 2W47A 2GNBA 1UPSA 3LDBA 2VNVA 2BGPA 4M0HA 3TB0A 4NVPA 3VZMA 4BWOA 4IGPA 1HRI2 1MQTC 3QOPA 3GNEA 4AI8A 4IW3A 1NX9A 3NNMA 3J7LA 4LJHA 4Y1YA 1UOJA 2MHFA 1AR63 1G8WA 4WVWA 3ZSLA 5CFCA 1DZRA 1GLHA 1RYYA 4QPYA 2OQ6A 1A8MA 2W1WA 3I97A 4LHKA 5LBFA 5DUWA 3RMYA 3AYEA 1QJU3 2PTMA 1LEMA 4NWWA 1FYUA 3TBDA 2VVFA 3TEZA 2VUCA 4Q8KA 3TEYA 1IKQA 2PFWA 1R082 4URTA 1Q8QA 3M70A 4Q4X3 1GYKA 1RUH2 2AH2A 1RXGA 2ARAA 1PZ9A 4CDXB 1J1TA 1SPPA 3NL1A 2DVBA 4XYXA 4Y22A 4NHLA 2WR9A 4NRMA 2MPFA 1OOPC 2JG9A 5KHKA 2CL2A 1A6CA 1CR7A 5A32A 4GWIA 4AYUA 1OBNA 3W9AA 2D40A 3OB8A 1RUG3 3HR9A 4IETA 4KU8A 4LITA 4MVTA 4B3NA 1O3TA 3ECQA 4M3CB 4YVWB 1HXS1 3N7MA 4DZGA 5JSRA 4YW5A 4N7IA 3H1YA 3WINE 3H3ZA 2RJLA 1L7QA 2QQOA 2GC3A 3AKSA 1TME3 3O0VA 1AR72 1ND2B 1CGPA 2BRTA 1QGLA 3EQEA 1DQ6A 3AZWA 3GZUC 4GWMA 4IE4A 5C3QA 4FOWA 4XMAA 1X7NA 3SEPA 1AYN1 2P34A 4WBBA 2X5IA 2DBIA 2Q4SA 3N35A 2OQ7A 4W50A 1YFXA 5FZ6A 4F8AA 4FPLA 4XURA 1A8DA 4YW7A 5FYVA 5DAVA 2YV8A 1H8VA 4WM8A 5FY7A 4QPGC 2DFBA 1W6OA 2Q8CA 4DNYA 2B7YA 1UYXA 4R52A 2A6VA 4DO0A 4JZRA 4H7LA 4QQHA 2XHNA 3NSTA 1X36A 2A3XA 1VRH2 2WDBA 5EJ1B 1OMIA 4AFBA 3VD7A 1QEXA 1LAJA 5FREA 5F3IA 1EAH2 2ZEWA 5T52A 1LECA 1HJFA 3VBUB 3APBA 4U2AA 4H55A 2WO2A 1CZTA 3AYAA 1DHKB 3BIWE 1V9U2 1PVC3 5LRRA 3POIA 1RIRA 2R30A 4ARXA 2BWCA 2JKBA 2ZAAA 3AP7A 3TEXA 2P5BA 1APNA 3SCGA 2VNRA 2V72A 4UW4A 5FYYA 3I2IA 4FVVA 1XE8A 5FZGA 2A3YA 3MDPA 4MUVA 4RR3B 2EXKA 2QQWA 4WV8A 3WNNA 3ZXJA 3H42B 1W6QA 3O1VA 4CUCA 4FTBA 4K8FA 4P08A 4QDSA 2VMEA 3AM2A 1KFUL 3JU9A 4AHYA 4HETA 1HW5A 3AB0A 4KGQA 3VBOA 1WLWA 4XF1A 2BNNA 1UAIA 1RUH3 3HMYA 1F15A 4K1YA 5CFDA 1AL0G 4KNCA 3TN93 3BPZA 3DKQA 4FP2A 3H8OA 1ODMA 4Z82A 1QJZA 4UYBA 3HIFA 2C4XA 2DCJA 4D8MA 4YYOA 2HBUA 4CEYB 5CAZA 5IAXA 1WCKA 1HXS2 3H0OA 2XH6A 3ZIWA 4XPVA 5FPUA 2J1SA 4YGEA 1HJGA 1ST8A 2PAMA 3T3YA 2AC1A 4ZHNA 4IEQA 4OI0A 1YFYA 4R9AA 2EF6A 2OS2A 3KGLA 3IDEA 4J6GA 5FY8A 2WZR1 1XYOA 3KV9A 2DUQA 1MS0A 2PHUA 2WNOA 1J3QA 2UU8A 2XOMA 4D94A 3EXUA 3FLPA 3MIEA 4MHUA 3U75A 3DEMA 1Z78A 5FJHA 3M2MA 3UT0A 3ZN6B 3D82A 3OBZA 3NV1A 3VL9A 1W2UA 1MVQA 1NCRA 3WQ0A 4OUSA 3T30A 2XXZA 1H9PA 3AC0A 3EYPA 3ZKYA 1NG0A 1XNDA 2HWF3 5C4WC 2R1BA 3B94A 5B2GB 3CBNA 1QNWA 1VRH3 2BOIA 1G9FA 1H2MA 3O5SA 5A3TA 1EAH3 1DP0A 3ME2A 3UKTA 4MOAA 3O1SA 1RUE1 2RM22 3FLRA 4C90A 1DGRA 2YZ4A 4LIUA 3CU7A 2WBKA 4PLOA 4LE4A 1RC6A 5D8AC 4GQ7A 5JXHA 1DGWA 2XL7A 2QZ3A 2OX0A 4NIAA 1SDWA 1IKPA 3MEPA 2J1RA 5F6LB 2XVKA 3O1RA 3U07A 3M8LA 5A1AA 4Q8LA 1D4M1
chains in the Genus database with same CATH topology
2DU1A 2Z2SB 2UURA 3KCXA 1HKDA 4SLIA 3UL2A 3WVJA 2YY1A 4ATEA 4DRRA 1S2BA 4I3GA 2LTNA 1VBD2 2R071 5KHHA 1Q5OA 4FTEA 5GKAC 4I0AA 3RI8A 3AZXA 3J26N 1G9CA 3LB9A 2XJQA 1FXZA 1XRUA 2HEWF 4PIYA 5H9SA 3ZYGA 2CAUA 2UWBA 4TSVA 1GZWA 1QH6A 4ZXKA 2DVFA 1HXS3 4R9CA 3WR0A 3I59A 3UKVA 1BVP1 2JEMA 3VBSB 5HBAA 2C0ZA 1SBDA 4OHVA 4E27A 4JGYA 3SXWA 4QT6A 4E2GA 4YZ1A 4W6YA 4COUA 4JCKA 4YNIA 1CAXA 1PO21 2H0BA 3FLTA 3LCPA 2WZR2 1KXGA 4E2QA 1O3RA 4XTPA 1DBNA 1AYN3 1HLCA 1S0GA 2DUOA 3G7DA 4R8HA 5JZGC 4RS5C 3S0MA 1HRV1 3DPRB 4QQPA 5F9TA 1IS3A 5HCFA 2W68A 3IN9A 2R1DA 2WNUB 3A4UA 4XXPA 4BH9A 4HKLA 4L2NA 2ZGRA 2RR12 1WMDA 1MZ5A 1W6MB 3MFCA 1SQ4A 1SLAA 2C1FA 1PO11 1F5FA 3J8F1 2AREA 1LR5A 1RUE2 3ZXFA 3WW3A 1GNZA 3D6EA 3HD8B 1B35A 1B09A 1TMF1 1UU4A 2PHDA 2I45A 4W6WA 3B5LB 3FWEA 4AGVA 2ZX3A 3MIHA 4XHBA 4K20A 1C4RA 3VL8A 1UPIA 4HSLA 2PN5A 1MQTB 4MGIE 4XE9A 1D2SA 1ZZ7A 4I2OA 5JR7B 1RB8G 4L9BA 1S0EA 2R072 5SV8A 3ZX7A 4AVTA 1H2NA 1CESA 2R49A 2GMPA 2RE9A 4N7UA 3SH5A 4AEKA 3H50A 1OA2A 4P5HA 2WC2A 3ZO0B 4QMAA 1X33A 4IV3C 2HJIA 2Q1ZB 5DUVA 1PO22 1OOPB 3QACA 2D43A 1AF9A 3MIFA 4MYEA 2R061 3PTYA 1C8M3 1ASJ3 4COWA 1S0IA 5J98B 1LODA 1FPN2 3OGJA 1ZNPA 3ZXDA 4AI0A 4H7MA 1PO12 3ILNA 1X8MA 4QGMA 5BV6A 4N43A 4LA2A 5GALA 4LBQB 2D6KA 1ALYA 2XJUA 1S0CA 1TMF2 2IXIA 5CG8A 4PF5A 2CTVA 4QPGB 4GB31 4IEZA 1ZRDA 1VBC2 3MI8A 5FQ0A 2BTVC 1BK1A 1QKQA 4PLNA 1KJLA 1D4M3 4Q1RA 5BY5A 3RYKA 1UZZA 2BW8A 1CQ9A 5FBZA 4D3WA 2Z42A 1MEC2 3E5UA 1Y43B 2UWAA 4RD7A 2B5HA 3VKNA 4UW3A 1PMIA 5JCTA 4JRAA 1NLSA 4ITCA 5J09A 1GNHA 4EN0A 4FSJA 3BOPA 1NZCA 1ZBE1 4IERA 4Y20B 4HPKB 1LHOA 3R0RA 3L9JT 3PVBB 5JPNB 4FXGB 3EO6A 4OI1A 4CDXA 4OHYA 3E6CC 3URFA 4AW7A 1AL21 1PO23 1WD4A 1PZ7A 2A73B 3NV3A 1PVXA 1URXA 4KBBA 4BA6A 4M3CA 4YVWA 1V6IA 1AR93 3LWCA 1DQ1A 3ES4A 1HRV3 4N9IA 5DDJ1 1RUD1 2YC0A 3BU7A 5DUUA 5J37A 1ND2A 3AMQA 5JDBA 3HT1A 4ZU5A 4B4RA 1AJOA 1GICA 2OUHA 3J8F3 1U0AA 2VXRA 5E8AA 2CNAA 4META 1QXJA 3T2TA 2A6XA 3K48A 1CONA 3PVOA 3L2YA 4ZU7A 2OW4A 4GB32 5C4WB 4WVZA 1BCXA 1XU1A 3H3UA 3FMGA 1AXYA 1WMFA 2R0HA 3BCWA 3NKGA 1LHNA 4Q0VA 3VBUA 4HBNA 1Q8VA 2BYVE 3MIGA 1G7YA 1ZZ8A 2VNOA 4EWEA 1FOD1 3WDTA 5AC91 3RZZA 5D8AB 2XPJA 4FOYA 3RYPA 1COV3 2P3JA 2AYHA 2IWGB 4IV1C 2R16A 2RJKA 3LSEA 4RR3A 5FO8B 4P9IA 1R1A2 1QQP2 2ZMNA 4AVBA 1O4YA 5BNPC 3FHIB 2JG8C 1ZBE2 5GZEA 1SLCA 4XILA 3BALA 3R6SA 4WM7C 1LOCA 5K0UC 2XKPA 4LO8A 5IK4A 1SLTA 1YFWA 1RL3A 2BNMA 3ZSJA 1AL22 1XNBA 4XQDA 4NPRA 3CO2A 4DPNA 1ZVFA 2RS53 2WJSA 1XQNA 4A3XA 3WHUA 5I0UA 3LA2A 1KD7A 1RHI2 1VBB1 4CEYA 4DQAA 2R063 1BKZA 5H9RA 1FX5A 3ETQA 1U5XA 4IEVA 5FAXA 3VKOA 5DDJ2 3KGZA 1RUD2 3JBG3 3VZOA 2XJPA 4NO4A 4MGZE 1TE1B 3DKWA 3PVEA 2ZHKA 2ZS6B 2ZACA 3ZN6A 1SCRA 3VN4A 5K8SA 5EYXA 5JZGB 3MIDA 4RS5B 1JBCA 2R041 2VGDA 5FCCA 4AXOA 4X8PA 4RHV3 4YG6A 4TZDA 2GNTA 3ZMNA 1X50A 2VG9A 3POWA 5FFOC 3VLBB 3GBWA 5BNOC 2D5HA 1RUNA 3ZXEA 5AFBA 3LKJA 3OF1A 4XBLA 4Y5Z0 5JVVA 4PDWC 3RRDA 1UU6A 5AC92 2MEV2 1ZREA 1JUHA 3EBRA 4JVAA 3EHKA 1WBLA 4LO7A 1BBT2 2A5ZA 3GALA 3IBMA 2HWE3 3WW4A 4Q26A 2D97A 1LOBA 3VBRB 3L2HA 2DTYA 4Y1ZA 3ES1A 1AX2A 1SMVA 4XQWA 1KS5A 4C1XA 4OFGA 1MZEA 4ONUA 1PIV1 5J48A 4BLJA 1A78A 3WV6A 2PHRA 1D0HA 3OCPA 3FC0A 3VDDC 1OPOA 1EPZA 4MXVA 4MLOA 2Z79A 3D4KA 1Y9QA 3WDXA 2IFRA 2LM3A 1YLLA 2PHXA 3VBSA 4B4QA 4M3CE 5DDJ3 3ZSKA 2GC0A 4IV3B 4CTEA 3QLQA 5KXCA 4LE3A 4P9JA 5A33B 4IEYA 4IEUA 4L99A 2A75A 4K6BA 3SISA 1DF0A 4K7JA 1S2KA 2ATFA 2I07B 2HWD2 1Q8SA 3V56A 3DPRA 2ZCWA 3P3NA 2ZBJA 5EV7A 1IS5A 2WNUA 4I09A 5GLZA 1C5IA 1W6MA 3MW2A 4YM1A 2EIGA 4YVSC 2XVGA 1RVF1 2V5YA 4RSUA 3NKTA 1FT9A 5EJ3A 1LGCA 3JQWA 2GMEA 1FOD3 4LO4B 5GLVA 1AZDA 2BFUL 4MXWB 1CJDA 1QOTA 2E63A 4QU2A 2R6QA 3B69A 1RUOA 3B9IA 4XTMA 2F6BA 3AP9A 1NE6A 1W6PB 2G9GA 5I8YA 1MQTA 5GM0A 3AFKA 2B42B 4YARA 3WY6A 5BYNA 4LO5B 5KWRA 1PGL2 1JTZX 2WS92 4AEMA 1R081 1LOFC 3FFZA 3LAGA 2P17A 2IXLA 1J58A 1ZRFA 4D7YA 4P14A 3WW2A 1MS8A 1BJQA 1PK6C 4HMZA 5T5LA 2CGPA 3ATGA 1VBB3 4LBMA 1C28A 3WXPA 1DZQA 3CNAA 4LUKA 4WZFA 1DZTA 2D5FA 3CL1A 3MPBA 2GH2A 2YGLA 1HIXA 1N1VA 1OOPA 1RINA 1SCSA 4UW6A 1OLRA 4QQLA 4X8NA 4AFAA 1YNAA 4EJRA 1RITA 4HK8A 4YW4A 4MSVA 2R043 5A3MA 1ZA4A 4CP2A 1X8EA 2KA3A 4I0BA 1ENRA 2ZGMA 4D7SA 1SLBA 2ZAHA 1RVF2 2PHFA 4LBQA 3VUOA 1HV1A 1ENXA 3V0BB 4QPGA 2D3PA 1ZRCA 1V9U1 1NCQC 4EV0A 1U5YA 1YJKA 1YUDA 3MZHA 2WFF3 1Q56A 5KXEA 2JENA 4AE2A 1UMZA 4AVSA 3V64A 4EN7B 3RJRA 3AP5A 3VZLA 4LR4A 4HVOA 3FX3A 4IQPA 1PIV3 4YW3A 2Y38A 1M4WA 2P3IA 3J4UH 2NMNA 4CDWC 4XQ4A 4IV1B 3IT8A 1V6KA 1VAVA 5IUQA 3PJQA 1HV0A 5L7OC 1FNZA 3HT2A 2OZJA 4Y20A 2WLQA 4HPKA 5BNPB 2YUEA 5JOWA 4IXLA 2JG8B 4Q4Y3 2UY8A 4C0HA 2QZ2A 1OKQA 2A7AA 2EAKA 2PYTA 4RGGA 4WM7B 1MACA 3JD71 4HL0A 2KM2A 3USUB 5T3NA 4Q2FA 3AK0A 2QFEA 2G4IA 4IL7A 2AUYA 3SITA 2IXHA 1PNFA 2D7FA 1QF3A 4P9LA 3SMHA 5A3LA 1LJ7A 1BEV2 2AZ5A 1O5UA 1LHUA 1RMU2 4H14A 2IXCA 3KLSA 3ZXKA 1OHFA 2GNMA 4XFHA 1YCIA 4YFWA 1KJRA 5T5OA 3M3EA 1NXMA 4NWVA 2DCZA 3M3OA 1O4TA 2VPVA 1CVNA 1RVF3 2QVSB 1PM7A 4ZKTB 1DQ0A 3B9CA 2OYZA 1JUIA 3E5QA 1H0BA 2JECA 4F83A 5FDBA 3GYDA 4JC1A 2P37A 2PHTA 2RM21 1AVBA 2DF7A 1HRI3 5DG2A 5C4WA 3ZFEC 1I9RA 1YI7A 3B00A 5AVAA 1DQ4A 5BNOB 3H1WA 2E7AA 4XJAA 5C9AC 1EPWA 1VBE1 1I6XA 3ASIA 1VR3A 3ZMOA 1Z0HA 2CGOA 5DZEA 4KU7A 5GLUA 4PDWB 5K7PA 1UW8A 5D8AA 1LESA 1LGNA 1R083 1N1TA 2AENA 3AKQA 2D93A 2ZX2A 4S2FA 1VBD1 1IS6A 2NZ9A 3OY8B 4Q4W2 3P3PA 3I2DA 1VJ2A 1GV9A 1V6JA 1HX6A 4F3JA 2FBEA 1OFSA 3HBZA 2YXSA 2IFWA 3RI9A 1AXKA 5T55A 3AZVA 2K2SA 2Q30A 4Q0UA 3JD72 1PGSA 2SBAA 3VDDB 1S0DA 1FNYA 2YHJA 2ZTNA 4R9BA 1AR73 4A7ZA 2PHWA 3MICA 3HWJA 3KQRA 2Z5WA 3JQXA 1C8NA 3ZDSA 2JE9A 4XFCA 2ES3A 2RR11 5KHIA 1G9AA 1N3OA 3HAGA 5EYYA 5I0RA 5JZGA 4AHZA 4RS5A 4BMEA 3ZFGC 4QM9A 3AKPA 4JDOA 1QJY1 3AZZA 2ZABA 3D0JA 3WZ1A 2A6YA 2QUOA 4DOUA 1V9U3 1DYPA 4N90A 3CLPA 4N9HA 4YVSB 4P9XA 1YI9A 1VBE2 1KDKA 4HLTA 1GZ9A 4XJ8A 1RUC2 2ZGSA 3SHRA 1VBA1 4Z2WA 3AP4A 1DQ5A 4RQPB 1UIJA 2ZJCA 1IPKA 1ULDA 5C6CA 1NXD1 1TNFA 3AMNA 1WBFA 3VBRA 2E53A 3ALQA 5DG1A 1LGBA 3CJXA 5F6KA 5JOXA 4OHZA 3AMMA 5FPZA 4WVVA 4YW2A 1F8VA 2CYFA 4LULA 1W6NB 2DWRA 1G6NA 4F7ZA 4Q0SA 1PK6B 4AWDA 3V0AB 4XBQA 4OLLA 3VHPA 2OA2A 4PIZA 5FLIA 2O8OA 1AXZA 2VQ0A 3NVCA 4MGKE 4IV3A 2CAVA 4FOQA 3SH3A 1N1SA 2ZZQA 1HDKA 1FPN1 2Y0OA 5H9QA 5A33A 2ZKNA 1C1FA 4Y26A 2LALA 3IIAA 3NAPC 5CB7A 4QHBA 3OJBA 2RM23 1QJY2 5E1RA 3MLJA 4CDUC 1C57A 3AKTA 1K5MC 1RTVA 4FBFA 4EN8B 2H6CA 2XWBB 4AVVA 1O3QA 4LBJA 2HYKA 1H8TC 1VBC1 3AJZA 2Z69A 5FMOL 5GLTA 1AUYA 4NN0A 1DGWX 1VBE3 5BXXA 1NQDA 5CBLA 4GULA 1VB2A 1VBA2 5GJ6A 5ACA2 1RUF2 2ZGTA 4MXWA 1Z7S1 4FPCA 4BZ4A 5I93A 4XFFA 2QE3A 2GH8A 1NCQB 1JOJA 1MEC1 4LBKA 5IT6A 1VBD3 1W6PA 2IZWA 3UK9A 4FPKA 4ATFA 3U11A 4Z8BA 3U4XA 3I54A 4YZ3A 2PQQA 3JUUA 1FV2A 2ZHNA 3KM5A 4MX3A 5BNNC 3H8UA 4QPIC 3OGGA 1YXWA 5BUVA 4EWDA 1O3SA 2WWSA 5LEJA 1LULA 2VMHA 5T5JA 1REFA 4CDWB 3IM0A 1ULCA 3ENRA 4CYDA 1RJ8A 3WUDA 1QJX2 4B4PA 1O91A 1NY71 1DLLA 1I5ZA 4DS0A 3MPPG 3LGRA 5L7OB 2HWB1 2WZR3 2D44A 3AYCA 2IC1A 4LHNA 4Q4V2 2W39A 5FTTC 2PLV2 4EWAA 4I0WB 4B29A 2RR13 3N4MA 2X29A 1MS3A 4TWTA 1LB2A 4E2SA 3VBHC 4ISQA 4FXKB 2BPA2 1QJY3 1RUE3 2NQYA 3EJKA 4HK9A 4IEPA 3SCFA 5AFEA 1Y3TA 1L3JA 5ABJC 2YROA 1U5ZA 4KWLA 1V00A 3PHMA 4CEWC 3V0BA 1VBA3 1OQ1A 1ZX5A 1QU0A 1Z7S2 1E57A 1VP6A 3ZFEB 2HEVF 3NJZA 2R073 3C2UA 2XUMA 1CPMA 1NA1C 5C9AB 3INAA 3UJOA 4UBHA 3WG2A 1R1A1 4ES9A 1QQP1 5I0TA 5JI7A 2E7QA 2DURA 2F4PA 4SBVA 3WX5A 1N47A 1UKRA 2CGNA 4IV1A 4AQSA 3GZTB 4AFDA 2QDNA 5C8CC 1NY72 2BUKA 2TBVA 5BNPA 2JG8A 2HWB2 4WZCA 1H1MA 1RHI1 1MS9A 4WM7A 4M01A 4FAHA 1VLNA 4C91A 4AEJA 4JTOA 5E88A 1FPN3 3USUA 1NYWA 2NYYA 1KITA 2XBO2 1H4GA 2XJVA 2GNDA 3M7AA 2XLFA 2NM1A 2TUNA 1PO13 1IHMA 3M3QA 2WNVC 2WQ4A 1CPNA 3VKFC 4KH9A 1ENQA 4XF9A 1ZZBA 4H3WA 4PLMA 4P9YA 1TMF3 1CIWA 4E9KA 4PCRA 2EAAA 4OZXA 3NV4A 3JCIA 3G6JB 1VBC3 3R4UA 5FPXA 4OHWA 2RMU1 3WDUA 3ZFGB 2NP0A 3KT4A 4AEDC 5CAZA 2Q5TA 3MW3A 3KD4A 2E9QA 4XEZA 1YO8A 2ZKLA 1AJKA 1AYM2 2DV9A 1LENA 2MEV1 1MEC3 5BNOA 1FMD1 2CWMA 2ZX1A 2XKOA 1BBT1 2ET1A 4DB5A 1XE7A 5HCAA 4L92A 4PDWA 2PHLA 4A7KA 1SBFA 2QJVA 1I3HA 3N7JA 1DQ2A 3KMHA 1VAKA 1ND3C 1UIKA 1NOVA 2VOXA 3GBGA 4TYSA 5DZGA 5GLWA 3AZYA 3I7DA 3OY8A 4XOGA 4FPFA 3TNQA 1FATA 3QBQA 4COYA 2VOVA 4DMIA 4AGRA 4COZA 5FO7B 4I3PA 4Z07A 1OLQA 4XMIA 3VDDA 2DCTA 3FUOA 2NPIA 5JI9A 1LEDA 4G3YC 2D3SA 2XL9A 4MGYE 2WZPP 2ZX0A 1IS4A 2BQPA 5KBFA 1S0JA 5T50A 3TYJA 2HWD1 1XYNA 4YZ5A 1S0BA 2RS11 4HANA 2BGCA 1MR5A 3SH4A 4GB33 1V6MA 2PAKA 3IKWA 3POYA 1ZBA1 2D98A 2RMU2 4BIOA 3NAPB 3GHNA 3ELNA 3OTFA 4L97A 2G9FA 3WQ1A 3R4DB 4B7EA 5LK5A 4CDUB 1K5MB 3X29B 1W0PA 3VBFC 1LTEA 3J9SA 4YVSA 1FMD2 3VBUC 1H8TB 4DINB 2FMYA 3N7KA 2DVDA 1AR81 3AXEA 4KGGA 2DYCA 2RS31 5T54A 4FO9A 1R1A3 1SFYA 1QQP3 1H4HA 4RQPA 4N53C 1ZBE3 1WW6A 2DU0A 2WA4A 4NR1A 1PGL1 3THPA 2WS91 4XHXA 2A6ZA 4ZU4A 2DVGA 3ZXAC 4XETA 5I8SA 1QH7A 3FJSA 1AL23 3KT1A 1QOOA 1JXNA 2ZX4A 1N3PA 2ZHLA 5BNNB 4C0BA 3E97A 1RHI3 4INDA 1U5IA 4YG0A 3GZAA 4QPIB 1AR61 4A2UA 4OI2A 3B7MA 4G4FA 4XIOA 5CIRA 1N3QA 1W6NA 2DCKA 4AG4A 1RUD3 5EXOA 1PK6A 1JH5A 1QJU1 2FQPA 3V0AA 1SEFA 5SV5A 1UU5A 2E51A 1OA4A 4B8EA 5JSPA 1G9DA 1V6LA 3DUIA 4FPGA 5C33A 3N36A 2RS12 4COVA 3RDIA 3ZXGA 3FBMA 2JE7A 3BB6A 4K40A 1GSLA 3O0WA 4YGBA 1WW5A 3CJIC 3WLUA 3D5OA 4BMBA 1SACA 3ZFFC 1ZBA2 1GQHA 1QMJA 4M00A 4QQOA 3LZZA 2WT1A 3VBHB 2QQPA 2JDZA 1A3KA 3ZYPA 2JX9A 3RNSA 5AC93 2MEV3 2GU9A 4FPHA 3WHTA 1FMD3 5ABJB 2VQAA 4PBPA 3DGTA 1BBT3 1J3RA 1AR82 4W65A 1RGSA 2DTWA 2RS32 1ZZ6A 5EWSA 4CEWB 3ZSEA 1PNGA 1SFNA 2FZ1A 3I4IA 3FUQA 1YIFA 1IZ3A 2OVUA 3QD6A 5J36A 4LLOA 3S6PA 1NCQA 3FBYA 1OSGA 1KS4A 3RPQA 3VZNA 2QDRA 3TOJA 3SNMA 1NA1B 1EP0A 2YDEA 2Q0AA 1D4VB 1PVC1 2BWAA 4R4ZA 4XF3A 5GZGA 3OPZA 4HN1A 1AR62 3OBTA 2D6OX 2K0GA 3H1MA 4CDWA 1QOSA 3E5XA 1I1EA 2XLGA 4AHXA 1D2QA 3E6DA 1RUJ1 3DN7A 2Y26A 4CDQC 1CAWB 4ES8A 1QJU2 1SLLA 4DFSA 5C8CB 5L7OA 2YGMA 3ZVXA 4BLIA 3RG0A 4Q4X2 5IK5A 1XYPA 4GKXA 3H7JA 4LLFA 2HWD3 3NO8A 1BEV1 1LU1A 1RMU1 1H2LA 1POV1 1PZ8A 2XB6C 4AI2A 1RUG2 3KT7A 1FAYA 2WT0A 4GALA 3VV1A 3N3HA 3ZIXA 2UY9A 4OVEA 1CAVB 3AJYA 2WNVB 2AGSA 3RWNA 2UWCA 1LKNA 1TME2 5FLJA 4G9SB 3USSA 2VULA 3RJ2X 1OFNA 1WMEA 2WKKA 3I8TA 2ZGKA 2FZ2A 2WSUA 1AR83 3H9AA 3R4SA 1C1LA 4K9SA 2BNOA 1VIWB 4PIXA 4AEDB 3NWKA 2HWF1 2GAUA 3ZFEA 4BOWA 1KFXL 1GQGA 3AXDA 4HN0A 2WS93 3A0KA 1YRZA 1DGLA 5C9AA 1FV3A 3R05A 5KXDA 1UD1A 4Q4W1 1Q8PA 1PVC2 3WQ7A 3ZXLA 2OUJA 3ZYIB 1JW6A 2ZGPA 4JV4A 5KXBA 1ND3B 4Y24A 3VHRA 5HXVA 1RUJ2 4YGDA 4AQTA 4RL7A 5K0UB 4GH4C 2VMGA 1KDMA 4MV2A 3GHMA 2ZPXA 1J59A 2CV6A 3LOBA 1IQAA 1D0GA 3ZSMA 2Q8OA 1GANA 4BHPA 1QHDA 3TN92 2K9ZA 5I8TA 3LOIA 2YPJA 2H6BA 3S7IA 4JAAA 3FE5A 2DCYA 1OA3A 3VHOA 1NE4A 1SLIA 4JGZC 1C5HA 2D6MA 4HZFA 1WCSA 3AKRA 2VECA 1WCDJ 2MNGA 3D0SA 3ZFGA 5KHGA 1M06G 1CAUB 2A3WA 3WDYA 1JHNA 3HN1A 1ZYBA 2HWF2 1RUC1 3FZ3A 5E16A 2ZGOA 5BNQA 3VBFB 3RYRA 3S30A 3WP6A 2YYOA 3M3CA 2GALA 2WL1A 5CFCC 5L73A 1CN1A 1ZZCA 4Q0QA 4EROA 3VKLA 1BZWA 4AHWA 1ONAA 1S0FA 1UCXA 1QXRA 2X53S 5FOJB 2WT2A 4N53B 1RJ7A 1RUJ3 1R091 2TNFA 2JG9C 4LHLA 4M3CF 2GN7A 4C1WA 4CP0A 5LEKA 2XG3A 1BEV3 4RA0A 1RMU3 4Z92B 3SLIA 3TRSB 1POV3 4FQZA 1ZM1A 1WD3A 1UN1A 1REEA 3ZYJB 1VB4A 5GZDA 3CEWA 1JYCA 3CF6E 1C3HA 3B02A 1POV0 2X5IC 1ULGA 1CJPA 5DZFA 2W0XA 1QXPA 4WM8C 4KWKA 4I02A 3C3VA 1AYN2 4AQ6A 2I2SA 2WFPA 2VNGA 1Y7BA 1C8M1 3CJIB 1ASJ1 3NAPA 4LA3A 3ZYRA 1FI2A 1X82A 4U36A 3ZFFB 5TSWA 5K9YA 5KC6A 1GBGA 1QNYA 1JN2P 4CDUA 4Y1VA 4MH0E 1K5MA 2XJSA 2EXIA 1WLCA 5ACA1 1RUF1 3Q9OA 4NHMA 3W59A 3U10A 1NLRA 2BBVA 2O0OA 1H8TA 2JJ6A 4YRDA 3KS7A 4AK3A 4XFGA 4Q4W3 4FOVA 3WP5A 1LOEA 3O14A 4JTNA 2Q1MA 3IDBB 5F1RA 1YIPA 1EY2A 4XFIA 2TEPA 5KC5A 5FMOS 3VBOC 3H7YA 4WVMB 4RGAA 1WW7A 3LA7A 1R092 5CFDC 2VW1A 3K51A 2GC1A 2OZ6A 3JD73 2ZOEB 1QJX1 1XU2A 5BNNA 2XGXA 1G86A 3MYXA 4QPIA 2XVLA 2NLRA 4QGNA 4JDMA 4J1WA 4J1XA 1REDA 1GZCA 2NMOA 4YM2A 1YFUA 1J1LA 3NW4A 4YM3A 1V70A 4IEOA 4Q4V1 4D69A 4CDQB 1TQ5A 1TNRA 2PA7A 2PLV1 4FPOB 3ILRA 3TAYA 4PQ9A 2DVAA 2ET7A 4XF4A 4EN6B 4DY3A 1T6GC 4CRQA 1AX1A 1Q3EA 3QCWA 4YZ4A 2FMDA 2PAEA 1NCRC 4YSFA 1H1IA 3DF0A 4K1ZA 3SCHA 4LT5A 2A70A 3JZVA 4Q1PA 5L19A 1AR91 2BVBA 1C8M2 1LU2A 1ASJ2 4FT8A 3ZPYA 3A0NA 3VBHA 4IESA 2VVEA 1MZFA 2BEOA 2WINB 2V09A 3VGIA 1RUC3 4XJUA 4LBLA 4ORFA 4IEXA 3ZN4A 5ABJA 4LEJA 2KXLA 4GKYA 2B46X 2WA3A 4CEWA 3ZN5A 3WG4A 3KB5A 1F9KA 2VUAA 4UXAA 4HFSA 4O9EA 1YYNA 3PJYA 1JYIA 1BMV1 4JRLA 2X8KA 3M3IA 1F31A 3WW1A 4XJZA 2OIIA 1R093 1NA1A 4ASMB 3VBRC 5LRSA 1D4M2 2AR6A 1H30A 4Q27A 4PJYA 2ZGNA 3PNAA 2ENRA 2BVVA 3ILFA 1Q43A 3AX4A 3QH6A 3AMHA 2SLIA 1COV1 1LOAA 3WCRA 2JICA 5FO9B 5JSOA 1ULEA 3WP3A 3IPVB 1CAWA 4JGYC 5C8CA 5CA6A 2O8QA 1V6OA 3O12A 3M1HA 1WGPA 4GH4B 5LK7B 4DY5A 1F2NA 2XBO1 3OYWB 4YG3A 4E4SA 2Y0IA 4GMP1 5JAXA 4FPJA 2W52A 2VH9A 1O4ZA 2RS51 4RFT0 1DG6A 3RS6A 2O1QA 4QXKA 1R1ZA 4JQRA 1MVEA 3M4FA 1AR92 3UKNA 4XDQA 1CAVA 5JOYA 4LTAA 2WNVA 2VOWA 2ZGQA 4LO6B 1HRV2 4XIKA 1ULFA 4BE3A 4D7TA 4E4DX 3JBG1 2EALA 3WDVA 1F5JA 4XJ9A 5D1IA 1B35C 5ACA3 3DL3A 1RUF3 2D6PA 1LHWA 4JGZB 1AYM1 1S1AA 1UX6A 3J8F2 1V6NA 3WT3A 5HI0A 3IWZA 4FAGA 3T1MA 4AEDA 4K3UA 3U0ZA