2DFBA

Xylanase ii from tricoderma reesei at 100k
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title Structure of an orthorhombic form of xylanase II from Trichoderma reesei and analysis of thermal displacement.
pubmed doi rcsb
total genus 54
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dfbA00
1M4WA 4H7MA 3RI8A 2VUJA 1HV0A 3MF6A 5HXVA 2B46X 3VZMA 3WP6A 3WT3A 3VZNA 3LB9A 4XQWA 2D97A 1REDA 3WR0A 3VL9A 1REEA 5K7PA 1XNDA 3AKSA 3MFAA 2DCKA 1C5IA 1UKRA 3WXPA 1ENXA 3WP4A 2NQYA 1C5HA 3HD8B 2D98A 5K9YA 1NLRA 1OLRA 3AKQA 4HK9A 1OA2A 1XNBA 1KS5A 1XNKA 4HKOA 3AKTA 3AMQA 2JENA 3AMMA 2B42B 1H0BA 3VGIA 3ZSEA 3RI9A 3AMPA 3B5LB 3MF9A 1PVXA 1UU4A 1HIXA 1IGOA 5EJ3A 4XQ4A 1BK1A 2BWAA 2BWCA 1OA3A 2JICA 1UU6A 3VLBB 2BVVA 2DFCA 2NLRA 1H8VA 1TE1B 1BVVA 4XQDA 1KS4A 4HKLA 2Z79A 2F6BA 3VZOA 1H4GA 1XYPA 1YNAA 1QH6A 4S2DA 3WY6A 1XYOA 2QZ3A 3MFCA 3WQ1A 3M4FA 1XNCA 3VHNA 3VHOA 3VZKA 2DFBA 2B45X 1XXNA 1F5JA 3B7MA 4NPRA 4S2HA 2VULA 2VG9A 4S2GA 1QH7A 3WP3A 2C1FA 3WX5A 2QZ2A 1H4HA 2DCZA 3O7OA 4IXLA 4XPVA 3WQ0A 3LGRA 4HK8A 1W2UA 1OA4A 4S2FA 4HKWA 3AMNA 2DCJA 3AMHA 1XYNA 1AXKA 3EXUA 1UU5A 3WQ7A 1BCXA 1H1AA 2VGDA 2BW8A 3WP5A 3VZJA 1REFA 1HV1A 2JEMA 1OLQA 3AKRA 3AKPA 2DCYA 3VL8A 3VHPA 1T6GC 3VZLA
chains in the Genus database with same CATH superfamily
1GOFA 4QHOA 5FZCA 4KBBA 4R4XA 1MS1A 4E8DA 4NIHA 1PVC1 4AEMA 2ZAHA 1RVF2 2BEOA 1EV12 3WNNA 4OI0A 4EN6B 1TNFA 4FXGB 1O3SA 1A3KA 1HDKA 4FPGA 2AR6A 3J8F2 1DF0A 4AGVA 1ENRA 2WWJA 4R9AA 5EP9A 2QQPA 1GP6A 3RZKA 3W20A 1VBE3 2XPJA 4Q4W2 2JECA 2J1TA 1XNDA 4WVWA 4ZPIA 1COV1 1LGCA 1ZBE3 3ON7A 1BMV1 2GC3A 4LIUA 2YGLA 3T2OA 3FBMA 4Q1RA 2WS91 1OOPA 3NSTA 4QM9A 2YFUA 4QPIA 3PTYA 1GUIA 1S0CA 1BYHA 4N90A 1DGRN 5T5OA 3VBUA 2XJVA 2JG8A 1FMD2 4MGZE 1HB1A 1OLMA 1UNBA 1OURA 3M3CA 5L7OB 3I97A 3MYXA 1SLBA 1DQ5A 1J58A 2ZEYA 3ASIA 2Y38A 2ZXQA 1PVC2 2VZOA 3RJRA 1OHFA 4LBLA 4RQPA 4BZ4A 4L9BA 5F3CA 3DEMA 2EF6A 1UYYA 3KZ4C 1OF3A 5JZGA 1WMFA 1UU4A 1WD4A 4B8EA 1OUSA 3ALQA 1YFXA 2Y8KA 4CU7A 5L9RA 1GWLA 3MUY1 1NE6A 4LBJA 2P5BA 2DWRA 3ZSJA 2E51A 5GLTA 1YFWA 2X5IB 4UFMA 4JV4A 2ZZJA 4B4PA 4Y4YA 1C8M2 1COV2 1CR7A 2QQVA 1BMV2 4FPJA 2BBAA 4U2AA 4YW6A 3ZSLA 4EN0A 3NVCA 3K51A 4P9YA 3K3NA 2WS92 2GN3A 2XWJB 3QH6A 5KXDA 4GB33 3V0AB 2VAUA 4YW7A 3TRSB 4C1XA 2VZPA 2RV9A 1ALYA 1E5SA 1NCQA 5L36A 4LBMA 3N7KA 2QZ3A 3T08A 3HR9A 4HFSA 4UW6A 3GCWA 5KHGA 4UAPA 2ZKLA 3LZZA 3VHOA 3ZDVA 4FSJA 1RUD2 1F5JA 3RYPA 1WBFA 1L7RA 3HVDA 3A0NA 3KGLA 2OKXA 3WF4A 1D2QA 3T2QA 3TB0A 4YM3A 5BXXA 2C9AA 2ZJCA 3MO4A 4QX5A 3WD5A 4J1XA 4NO4A 5LCWL 3J7NA 5A1FA 3BU0A 1RUOA 2HEYF 2NMOA 5JXHA 2VM9A 1XNAA 4HL0A 4JDMA 3N9MA 3PUHA 4SLIA 2P4EA 3NNFA 3VKMA 1W9SA 1WZXA 1VPHA 2BRTA 5F3GA 3WQ7A 2YROA 2QNKA 4BOWA 3SH4A 5FZMA 3IBMA 2ZGRA 3B93A 1I5ZA 1W3VA 4INDA 4R9BA 5TSWA 1V9U3 2Q0AA 2YC2A 1R64A 4ZXEA 4KBZA 1C1FA 3MHZA 4MO3M 5IK8A 2GMPA 2QQNA 2UYAA 2VVFA 4P00B 4CUAA 4RD7A 1NY71 2IFWA 3OUHA 3VBHC 2EXHA 4YVWB 2HWF3 5FBZA 3H8RA 4M4PA 3IMMA 1SFPA 4UBGA 2VCAA 1BHGA 2VUJA 1CAXA 4FPFA 1W2AX 4IEUA 2FDFA 2OYZA 5HXVA 1T6BX 4ASMB 3AX4A 4Q4V3 2Q1MA 2NMNA 3WG1A 3ZN4A 4HG6B 1MVEA 1Q8OA 4LBKA 5FWEA 4H7LA 4P9LA 2Z2SB 4QGNA 2WIIB 3TEXA 1QJU3 1S1AA 1RUG3 1CN1A 4XBNA 3MDPA 4TZDA 1G9CA 1DQ0A 1B35B 1MS9A 2ZGQA 3TNPB 5K7PA 1GOGA 3CO2A 5E16A 5FY5A 3AKSA 1CJPA 5T3NA 1I3HA 1XSQA 1O6UA 4JAAA 2XVLA 3ZIXA 3ZXLA 2DV9A 4I01A 2ENRA 3J7HA 3H8XA 4IV3C 4QPGB 2A6YA 2FCUA 1LODA 2NM1A 2WNOA 3X29B 1DYPA 1NY72 3AKQA 4HK9A 4YVSC 4NIGA 3VD3A 4COYA 4OI4A 1W9TA 3QH7A 4BQ1A 3VBSC 4XXAA 4EN7B 2A3XA 2JDAA 5ERLA 3PHMA 2VQUA 2I74A 3POIA 3WNLA 5FJHA 5A3PA 1H0BA 3AP4A 4BJ0A 2W1UA 4CCDA 3LA7A 4META 2W1QA 5A33B 2YU1A 5LW9A 4XXPA 3UGHA 1C57A 5I0RA 2D3PA 1O4YA 3RQ0A 2DFCA 1MPXA 3N3HA 1ULCA 3GBWA 4K8FA 4D6SA 1GNHA 4CU6A 4QX7A 5LBCA 1ENSA 2RMU3 2ZPXA 3KQRA 3MUZ1 1DQ2A 2I45A 1SBDA 2RJLA 3VDBA 1O91A 1LTEA 1LOFC 2Y0IA 1K3IA 1IPSA 2VE1A 3FZ3A 4BPZA 5FZBA 4Y20A 5LA9A 1JZ4A 2XQRA 4JGYA 3N7JA 2CGOA 4AVTA 3CQOA 4K1YA 1XXNA 4LHLA 5F8PA 4XYXA 4NPRA 4S2HA 4AHZA 4QQPA 1VBC3 4Q0VA 4QXBA 3OJBA 1YI9A 1ZRCA 4NUBA 1ZBE1 2C1FA 3PU3A 3FHIB 2D5FA 4LITA 4XIKA 2JE9A 3ELNA 4XPVA 3C7OA 2C6SA 3WX5A 4CDWA 3ZFFC 1Q56A 1RC6A 3VB9A 2DTWA 2E26A 2OS2A 5A3LA 3AMNA 2LUWA 1QQP3 4HONA 4PDWA 1DG6A 5J7MA 4DZGA 2W2IA 1L3JA 2CDPA 4N53A 4XFAA 4PIXA 2ZCWA 3T1LA 4BM8A 1N3PA 1J3RA 1FV3A 1WW5A 3GBGA 1RUI3 2V09A 4IV1C 1WCKA 4M3CF 4OZOA 2E7AA 3H3ZA 1BEV2 2BTVC 3PDQA 1CONA 1REFA 4XILA 3E5UA 5FO8B 4QB6A 5JWPA 1WLDA 4A7YA 5APAA 1YQCA 2J1EA 4ASKA 4XDQA 5JR7B 2CWMA 4PLOA 2XBO3 1GZCA 1GICA 1N1TA 2VD7A 1D4VB 3WUDA 1H2LA 1P8JA 5FZFA 4YLZA 4PI2A 5LBFA 3VZMA 3WP6A 3ACIA 1ZBE2 2BNOA 1NCRB 3ZFGC 1TQ5A 3SC7X 2G19A 4MSVA 3N9NA 4UBHA 4YPJA 4XUNA 2EXKA 3ZXDA 3R0RA 4GB31 2R042 1D0HA 2CWSA 4XMAA 3HN1A 4YNIA 5H9PA 4AEDC 5A6ZA 5BPXA 4AI3A 5JOYA 3THPA 5IVFA 3GYDA 4YYOA 3VD5A 5LY1A 5E1RA 3OD0A 3GDBA 2VVEA 4GMP3 4KWLA 3S7IA 2JIGA 5C9AA 1UIKA 4RS5C 1H8TB 1NAEA 1QHDA 5EHDA 3IDBB 4H2AA 3LKJA 1C5HA 4OMCA 1UMIA 1ZBA3 4I02A 4FPEA 1OLRA 3GJAA 3VD7A 4ZS2A 3V0BB 4UFKA 2YY1A 4YM1A 5BNOA 1Z7S3 1CPNA 2EAAA 3IT8A 1XNKA 4Y5Z0 1VAMA 5FK7A 3OEAA 1VRBA 2RJKA 3RMYA 3AKTA 2AZ5A 1AR81 2YZ4A 3ETQA 2CU5A 3AZXA 1JODA 4OCTA 1PK6C 3NMBA 2G9GA 3FBYA 3VGIA 3CZJA 1PMIA 2VXJA 1SLLA 2JKXA 5FZHA 1JZ2A 2PHRA 5FK8A 1TNRA 4O9EA 4XDOA 5FYTA 4L99A 2Y0OA 1V9U1 4Q0UA 4OHZA 2H6CA 3CKHA 3B02A 1IG0A 2JX9A 3HAGA 3W5MA 4HSJA 5I0TA 4XBLA 1SACA 1WCQA 1OQDA 1ULOA 2GALA 2P3JA 4YFWA 5HCAA 2WAOA 2YHJA 1H8VA 3Q8EA 4UYBA 2HWF1 1TE1B 3H9AA 4LR4A 1POV0 5CG8A 2W0XA 2UY9A 4GH4B 5BV6A 3ZN5A 4LXLA 4XVHA 1XQNA 4EQVA 4COVA 4Q4V1 5JPMB 4IGQA 3O0WA 2P3IA 3OY8B 4S2DA 4YGEA 5FOBB 1AXZA 3VHNA 4FPCA 3UGGA 1RUG1 1AR82 3D4KA 3VDAA 1RXGA 1UMZA 5I0SA 2VZ3A 3FFZA 4MZUA 5C3OA 1RYYA 1UZVA 2B7YA 1STMA 2JDYA 4OFGA 1X8EA 3HJRA 4XJ8A 4S2GA 4NAOA 4XJAA 1Y4WA 2Y64A 4FOVA 4MV2A 4DXSA 2R1DA 1OOPC 1UOBA 4LT5A 1H4HA 1R092 1S2BA 4QM8A 3T4VA 4M00A 3VBUC 4L97A 2JG8C 2FZ1A 3D0SA 1QEXA 2DCJA 3SEEA 3VBHB 1AXKA 1G9FA 2W3JA 4CPBD 4XJ9A 2A3WA 2HWF2 4OQ8A 1W2TA 5T54A 2VMGA 5JXGA 3P6BA 4BMBA 1VRH3 5FKBA 2ZHKA 1TZOA 1XSRA 1AJOA 1YJLA 1A78A 2YBSA 2WO2A 1BBT3 1KEXA 3SKVA 3WHTA 2QE3A 3ZYIB 4NRPA 5GJ6A 3OGRA 3ZLIA 3E1F1 2ORXA 2WZEA 3HQXA 3VD9A 1VB4A 5IT6A 3ZXGA 4AE2A 1OVSA 1SQ4A 3ABZA 5FZIA 5A3WA 2B46X 4FQZA 3POWA 4PF1A 4DQAA 1BXHA 3WDUA 5DUWA 2QDNA 2RMU1 1CAWA 3JQWA 4IV3B 4WBBA 3IZOA 2EXJA 4B4RA 1DGRA 1NCQC 2DVBA 5L73A 2PAKA 2R16A 4LBOA 3KV6A 1RMU3 2TBVA 4R4ZA 4YVSB 4CCMA 4ES9A 1MR5A 1XB9A 1JZ5A 3LFIA 1NUKA 1ZZBA 4Q1PA 2XJRA 4LBQB 4LOSA 4XUOA 2R0HA 1Y9GA 2E31A 1H6XA 1ND2A 2Y6KA 3JXSA 3PIGA 5FREA 5LATA 4BA6A 1ENXA 4YZ1A 1TME3 2XVKA 4CP1A 4DXRA 1VBB1 1F2NA 1VBC1 1AVBA 1W0OA 4COUA 1G7YA 2ZMNA 3CJIC 1OA2A 3VBRB 3MBWA 1GQHA 4XZPA 5FP9A 3BKZA 1X8MA 3SQOA 2XL7A 3AFGA 2R073 4LK7A 1GWMA 5LASA 1ZREA 1DCSA 2BFUL 2AC1A 3AMMA 2B42B 1QQP1 5FCCA 3FLTA 1QNYA 1YQ8A 3O0XA 3ZKYA 3B5LB 5F3EA 1CD3G 4R8HA 4AQ2A 1IGOA 3KD4A 4H14A 4AFCA 5I0DA 1RUI1 2IVIB 1XPWA 4GWJA 4N9IA 1LENA 4I3GA 1XC6A 1JU4A 3H1YA 4CP0A 1RUF3 4ORFA 4XFIA 3BI3A 2A7AA 4QX2A 4NMIA 4TSVA 2Q1FA 3ACHA 2UY8A 1CPMA 3Q9OA 4W6WA 1ZVFA 2GP3A 3MIFA 3WF0A 2RM23 4TLGA 2V73A 2YB7A 2CV6A 2J1AA 4PCRA 1VBB2 4Q4Y3 3BYWA 5FMBA 3POSA 4NR1A 4ZS3A 3S6PA 2JDKA 4FPKA 4E4DX 1ZA7A 2H0VA 2WA3A 4FT8A 4D7YA 3DKWA 3WQ1A 1X9PA 2WT1A 4LPLA 3SCFA 2XH6A 4D7TA 2AYHA 2VZ1A 1LOGA 3PJYA 2B45X 3SXWA 3I2JA 3MW2A 1EP0A 1ND3C 1G8WA 1Y7BA 5IFPA 3CIHA 3KVBA 3I3MA 1WW6A 2AREA 3KF5A 4Q4X3 1DZQA 1O4TA 2X8KA 4JC1A 5FYUA 3USUB 3ZN6B 4CEYB 4CDXB 4AGRA 2VECA 3O7OA 5FQ0B 2Y6JA 3JBG3 3POEA 2KM2A 4OUSA 3I3EA 3T0BA 3WG3A 1W2UA 1Q8QA 1ZBA1 4P14A 4DUVA 4ONUA 3MI8A 2HEWF 1IKQA 2VTXA 2OQ6A 2KD7A 4QQLA 1SPPB 3FN9A 2JD4A 1Z7S1 1ST8A 4COWA 5DUXA 2WA4A 3AJZA 3N7MA 4BQ3A 1N1SA 1CZSA 3DCQA 4W8JA 3APBA 5FYHA 2VMFA 3AM2A 2W95A 4AFMA 4QPYA 3SCHA 3LWCA 1IHMA 1TMF2 4JTNA 4MX3A 3FLPA 4OHYA 2VMCA 3KV9A 2R063 4D8MA 2VO5A 3LEIA 1PGW2 3LIGA 2ZACA 3ST7A 2AGSA 4QXCA 4YW5A 5C7GA 1ZZCA 1H1MA 4KG0A 2GMMA 3IPVA 4AFBA 1NG0A 3U0ZA 3NV3A 4M0NA 3D3AA 1RUJ1 1VBA2 3TOJA 3VBSA 5KWRA 4JX0A 1POV3 2IFRA 3GGLA 3UK9A 1ZBA2 3BU7A 5I0UA 4OULA 4Z8BA 4KGQA 1W6QB 1N1YA 4JGYC 1AX2A 1UIJA 3I2GA 5C8WA 3PUSA 3ZYJB 4HVOA 2WYSA 2CY6A 2VNOA 1S0EA 5A3TA 5G05L 5CFDB 2GMEA 3K75B 5JMCA 1PK6B 5EWSA 2O1QA 1W6MB 1YEWA 1GKBA 1HJGA 2HWB3 4LK6A 2WRAA 1AR71 4LKSA 4UI9L 1SCRA 3O1RA 4M0HA 3BIWE 4MXVA 4UFHA 4CDWC 1ZA4A 2YPDA 4DXZA 2ZMLA 1ULPA 3OB8A 5GZDA 1NT0A 5ANNA 3O12A 4LA2A 4PDWC 3TAYA 1K5MA 2YC0A 3DECA 1CZVA 2YU2A 1OKOA 5FWJA 3NV4A 2ES3A 3KT1A 3UESA 3ZSEA 5BUVA 1NLSA 1W03A 4NN0A 4RGGA 4YRDA 1RUJ2 4IEYA 4WVMA 4BIFA 2AEYA 2PYTA 5F5AA 5FBJA 3P5BA 4XQ4A 3U11A 5LK7B 3J7LA 2TUNA 4BIOA 1FOD3 1OA3A 2BWCA 4MGYE 1BBT1 1V6JA 4BXSV 1GSLA 1K5JA 2VJXA 1LHWA 2XKOA 4HLTA 4YZ3A 1BVVA 2OW4A 3OGGA 4A44A 4ZU7A 1H2MA 3HT2A 1BK0A 4E2GA 1AR72 1ZYBA 5JCTA 2WO3A 4LHKA 3O14A 3E6CC 1Q3EA 2XWBB 2ZX4A 1H4GA 3A0KA 1DQ4A 4QPIB 3HMYA 1HRV2 4QB2A 4GWIA 1A34A 3BB6A 4AI1A 4NJ4A 3AZWA 3HNBM 3OPTA 1HQWA 1OT5A 1UPSA 2XHNA 4HN0A 4XTPA 3IIIA 5T52A 2XQXA 3B7MA 1US2A 5FZ6A 1US3A 4D7SA 5ABJC 2D6OX 5DQ0A 1RUC3 2FDHA 3WINE 5A3NA 4RQPB 3B01A 2WABA 4D0QA 5GLZA 3UJQA 5DN2A 3TYJA 1LU2A 3C7FA 3GZTB 1ONAA 3I7DA 1IS3A 4FCAA 2TEPA 5JZGB 2ET1A 4HPKA 3JB8A 1BBT2 5BNOC 4QB1A 4JVAA 2CL2A 3C2UA 4KL1A 5FFOC 3T2TA 1UN1A 4HSLA 1RJ8A 5LB6A 3EJKA 5KC6A 1UAIA 4JQTA 3H3LA 4UWDA 3EO6A 2D6KA 5FZ4A 1S0JA 1JYVA 3I2IA 4DFSA 1NX9A 4JRAA 4E27A 2OPKA 5BNNA 1X7NA 3MV01 4DUXA 4NHYA 1T6GC 2EICA 3Q8AA 3AVSA 2EIDA 4B3NA 2WC2A 2B8MA 4LKEA 1HV0A 1OSGA 1RUF1 4YG3A 5A3OA 3WG4A 1ACCA 2A6WA 3VBFA 3NRUA 5FXXA 3I2OA 1MQTC 1KRIA 2WSVA 4QKBA 3EQEA 4NROA 2WR9A 1FI2A 4CA9A 4LORA 3WOGA 2RM21 3WT3A 3K46A 4LLFA 1JHJA 2Q8EA 3L2YA 1EUUA 4ATEA 2QQUA 1REDA 5FDBA 1EUTA 1AX1A 1NZCA 2D5HA 3W59A 4XZUG 4FTBA 1W6NA 1VLNA 4A3XA 2VC9A 4TLFA 1J3PA 3LPGA 3ZFEC 2VBPA 3WNOA 1XE0A 5AFBA 1C5IA 4EE2A 2PMWB 2SBAA 3ZMNA 4QX8A 5KXCA 5DXDA 2WFF2 4Q8KA 5C8CC 2D98A 3KF3A 5LA1A 2VMDA 5FP4A 2PLV3 5GLWA 3SISA 4Q4X1 3ZOIA 5L9VA 3AL5A 1NKGA 1LJ7A 2Z5WA 4PIZA 3JBG1 3WW1A 1KQRA 1RUF2 1MS3A 2RS53 5FAXA 3O1TA 1E5RA 1SBEA 4J1WA 3DPRA 3THCA 5I8TA 1CAVB 1JOJA 3IDAA 1CAXB 3AMPA 1LHNA 4M4RA 1HB3A 1SEFA 4SBVA 2ERFA 4YG0A 5LA2A 5LRRA 3WDYA 4FOQA 4AR2A 5C3PA 4C8DA 3EYPA 2A3YA 4RFT0 4V2VA 2WZPP 3RPQA 5SV8A 4Q0SA 2VMEA 4CXXA 3WNKA 1XRUA 2JICA 3PMSA 1J1LA 1APNA 2ZX1A 1GZWA 3PMEA 5F5CA 1FX5A 4L0PA 5LK5A 4ASLA 3MLKA 2LTNA 3AJYA 2W68A 3M7AA 2ZGSA 3NV2A 1I5PA 4QHZA 5JMOA 2WNUB 5KXEA 1QY4A 3H8OA 4XUQA 2Y34A 2XLAA 5CVRA 5J1XA 4FPYA 1NYWA 3H0OA 4PQ9A 4Q4X2 1YQ5A 1XYPA 3PVBB 4AQSA 4Q29A 4P08A 2VVDA 1Z78A 3HOBA 1POV1 3AP7A 5FZ1A 3I59A 1CAUB 2JDMA 3OSDA 4YW4A 2UWAA 3ZIWA 3PUQA 4ZHNA 5C4WB 3I3DA 3BCWA 5FP3A 5A80A 2HH9A 2DTYA 2DCTA 1VB2A 2XONA 3PLQA 2QVSB 2VOTA 1ND2C 1CX1A 2IWGB 4DEVA 2HWD3 4B1LA 3AB0A 1D0GA 4MH0E 4N9HA 4KI5M 4PF5A 4FFGA 1OA4A 3W5NA 3RZHA 1XE8A 1XYNA 3RVHA 2VNGA 5IVYA 1UZWA 3HBKA 2BP6A 5DAPA 5F2WA 4TN7A 3LSEA 2E7QA 2ETEA 2VW1A 4R9DA 3WDWA 3EHKA 3ZPYA 2TNFA 4GMP0 5CG9A 3HNMA 3VHRA 1O3RA 4F3JA 3J4UH 3DF0A 3IKWA 4EWAA 2R49A 5LRSA 5D8AB 5CNAA 3HN3A 3RGBA 1HXS3 4QHBA 2AH2A 1RXFA 4CDQC 1H1IA 4Y20B 3ZYHA 1OUXA 4IEXA 2PHTA 4JGYB 4DEQA 1FOD1 2Q4SA 2BFUS 3CJIA 2BDRA 3K2OA 2H0BA 5A6XA 4K1ZA 4FTSA 5FZGA 4CEWA 4O61A 5FYZA 2XLGA 3AL6A 3SHRA 5K0UA 5HV4A 4XQWA 5DABA 3POYA 3LAGA 1ASJ1 3GALA 4QQOA 2C26A 5I91A 1AL23 4CDWB 2VCMA 4XFHA 2BYVE 4G9SB 2BJSA 4J6GA 4MHUA 1JN2P 3C7EA 3E6BA 5ACA3 2HWC3 4CDUB 2WNEA 2ADDA 5FZ3A 2C5DA 3WLUA 3THDA 4FBFA 1UKRA 2WZR3 1IPKA 4Y26A 1R1ZA 4N53B 3WP4A 3LCPA 4HBNA 3U10A 1W28A 3NNLA 1Y9MA 1RUC1 1PGSA 5A7SA 2VBBA 4AVVA 1CWPA 4CTEA 5FY9A 5CFCA 1FPN1 4K40A 1ZNPA 4LO4B 1G9DA 1H30A 3I54A 1GNYA 1N1VA 1XNTA 3NV1A 3JB4C 4IUGA 3GXUA 4HOOA 1WCSA 1AXYA 3RI9A 3O1OA 3E97A 2VY0A 4Z82A 1FT9A 1QJY3 2ZS6B 3ILFA 4QX3A 1VMJA 2J22A 1ND3A 3FHQA 1UZ0A 1W0PA 2FQPA 1ASJ2 2V5YA 2ZGUA 1O3QA 3LSDA 2XLFA 3HNYM 1ZRFA 2DBNA 2A6ZA 3D8CA 4K6BA 2ZHNA 3ZXJA 3VN4A 1BJQA 3GZAA 5T50A 2IUWA 5FMDA 4CU8A 3QOPA 1UO9A 5IK7A 1W8ZA 4KMQA 2K0GA 2D6PA 2D40A 4UF0A 3I2FA 2BGOA 1VAKA 2MHFA 4IGOA 3VDDB 4HKLA 5C9AB 2DBIA 1GU3A 1HW5A 3WF2A 2VNRA 4OLLA 3UJOA 2O0OA 2JB4A 3U78A 4AF9A 4OMDA 1AZDA 2Y6FA 3EMRA 3ORJA 3UKVA 1FPN2 1WMXA 2RS13 1SFYA 3VZKA 2WNVC 1NXD1 1WUVA 2VQ0A 3HT1A 4I3PA 4AHYA 4BWOA 4TTGA 1UZYA 4XAEA 4RYDA 5IW0A 5A7WA 3C8XA 4IERA 3MIDA 1RUH3 3WF3A 2ET7A 3P3NA 5F39A 1EAH3 3R05A 3SMHA 3CEWA 2DCZA 1SLCA 2GH2A 5B4XA 3PTRB 4I0AA 5FLHA 2PQSA 1UQXA 2JXAA 4OI2A 2O8QA 2PLV1 1Q5OA 1O8SA 4QKDA 2C4XA 5DZFA 5J36A 4KWJA 2X5IA 3W21A 1OH3A 4MXWB 1K5MC 1ULGA 1AYM3 2Q8CA 3LIHA 4WM7C 3QLQA 3ZSMA 3I4IA 2DYCA 2RS51 4I30A 3VBOC 1YI7A 2J7MA 4YARA 2JD9A 3OF1A 1Q8SA 3NAPA 1RUNA 3JD73 1VBE1 1PX3A 2GC2A 2Y6GA 4GAZA 3FLRA 3FC0A 1AF9A 2AACA 5BNQA 3RI8A 1V6OA 2VMHA 3GF6A 1LGBA 5DDJ3 5M0TA 2WZ8A 3DV8A 4BQ4A 4CCEA 3NO8A 3VUOA 2DVGA 4P5HA 3KQ4B 1W3XA 1AYN3 2DF7A 5T55A 1AR63 3CL1A 1IKPA 2SLIA 4URTA 5D1IA 4E2SA 2XDVA 5GZGA 4ARYA 1VE0A 1FYUA 2QUOA 4IEWA 1CGPA 3V64A 5FYCA 1XU2A 3VL9A 2D6MA 2E7TA 5T5LA 2IZWA 3V56A 3ITQA 1JH5A 1LEMA 3FWEA 2PHLA 3MFAA 2E32A 4CXYA 4Y1ZA 1W99A 4WVVA 4BLJA 5C70A 4V1PA 1QGLA 4LHNA 1LHOA 2FCTA 2XHKA 5FLJA 2GNDA 2EVXA 2ZEXA 4HT1T 1UF2C 1RTVA 5FKCA 1X82A 3T2PA 2DU1A 4KGGA 4NHMA 2XUEA 3WW4A 1VBE2 3ZYRA 2DUOA 4D3WA 1T2XA 2IXHA 2HWD1 3AK0A 5ANQA 3PUAA 1OD5A 2VUDA 4YVWA 1AX0A 1ZRDA 1UY1A 2QQMA 5FMCA 2PN5A 1A8MA 3ZKUA 5CBLA 4Q5OA 1UL9A 3S30A 3DXUA 4BYYA 1QU0A 3MF9A 5T5PA 1QXRA 3CBNA 4CCKA 4RFRB 5FXVA 4N43C 4C90A 3MLJA 2V72A 3AZYA 5BNNC 3VKNA 5ABJA 4LBQD 4QKNA 2RDNA 3E5XA 4NHXA 2H6BA 3NL1A 1OFSA 3WUCA 5FZ9A 2BVVA 3AP5A 3DYMA 3LFMA 1UKGA 2ZOEB 1LU1A 1QDOA 1MZEA 3DYOA 3P1IA 4JRLA 1UD1A 1GP4A 1HXS1 3WEZA 4Z2WA 4CVUA 1UXZA 3LD8A 4QXKA 4C0BA 2JG9C 1PNFA 4Z2AA 3VBFC 4EYUA 3O1UA 2ORZA 2DVDA 4XFFA 1SCSA 4Q2FA 1ND2B 3G6JB 1MEC3 1WLTA 5LZ6A 3AVRA 5CB7A 3AZZA 2HWD2 1W8NA 5FZOB 3CLPA 4DRRA 4NPMA 4NOTA 4I0BA 4FP2A 3PJQA 1LECA 1AL21 3NW4A 4GB32 3J9SA 3I8TA 4P9IA 5CZKA 1QH7A 2HWC1 1D4M3 3T30A 5ACA1 1DBNA 4NWVA 1FAYA 4IE7A 2OZJA 1DZRA 1IG3A 2QZ2A 3WQ0A 1WBLA 1V6LA 2WZR1 5FY8A 3SKJE 1DGLA 3LGRA 3UV9A 1AJKA 4B7KA 5A33A 1MQTA 2DUPA 3SH3A 3MW4A 1M06G 3VKFC 4JHZA 3POGA 4IE5A 5AC93 1JI6A 2BERA 3U75A 1DQ1A 1H1AA 5G04L 4OYUA 3DPRC 5FP7A 5GLUA 3WP5A 5JIUA 2Y33A 3BTXA 4IW3A 1CJDA 4DRVA 5IHRA 3H1MA 1QJU1 2HWE3 3RRDA 2LM3A 1OLQA 1ULDA 3ZFEA 4BXFA 1UY3A 3FJSA 3S0MA 4CRQA 1QJY1 4OHVA 3R6SA 1GNZA 5FPLA 4BLIA 4Y24A 5EXOA 3U4XA 5C8CA 2RS33 1D2SA 5IAXA 3WF1A 4JGZC 1QNWA 1V9U2 3R4SA 1GOHA 4A6OA 5JOWA 1NA1C 3BOPA 2VW2A 1WWYA 4OUEA 3RZZA 4B4QA 2WZR2 1C28A 3LB9A 4Z1VA 1OKQA 1YIFA 5DAXA 1OQ1A 1F31A 1KJRA 2WLQA 1DGWX 5FO7B 2E53A 4TXWA 5FR3A 2QQIA 2ZGPA 1NQDA 5IUQA 4Q4V2 2WQZC 2NPIA 1UY4A 4XDPA 2YUEA 1O5UA 4FFFA 2BQPA 2RS11 1RINA 3SCGA 2MPFA 4E8CA 3B9IA 3R4DB 5CKNA 1QJU2 1RUG2 4PJYA 1JOPA 1RIRA 3RYRA 3JCIA 5K9YA 2IXKA 4BMEA 4IL7A 1RUH1 3PL0A 4JDNA 3B69A 2XUMA 1EAH1 4XHBA 5FYYA 4OZXA 3J7MA 3I3QA 1LOCA 3HEIA 2FMDA 4Y22B 4B29A 4W6XA 1R1A3 5FY4A 4XUTA 2JENA 1UYPA 5HBAA 5IK5A 4AI2A 1VBD3 3WW3A 3RZGA 1UYZA 3IPVB 2HLEA 4XACA 1LHVA 4XHXA 1NCRA 3VBSB 2O14A 1LNSA 4RA0A 5BNPA 5IWFA 2BWAA 2P6CA 2WN2A 2RDRA 2UU8A 1MACA 3JD71 5FXZA 4IE6A 1MVQA 2QFEA 2VQTA 2JE7A 1OPOA 2RS12 1WA6X 4XQDA 2ZA9A 4M3CB 1IQDC 5J96B 1K42A 4LJHA 1GQGA 1H8TA 1V6IA 1RUH2 4CEWC 1FATA 2BGPA 2Z42A 2OIIA 4FPHA 5K0UC 1OC1A 1AYN1 3GHMA 5D2AA 3M2MA 4XABA 1XNCA 4IESA 1N3QA 1WKYA 4GA9A 3ZO0B 3MZHA 2W92A 3SEPA 2RMU2 2F4LA 3LDBA 4Y1YA 4YZ5A 1NXMA 3WDXA 4AL9A 2R7EB 2WFPA 4JHTA 4AOCA 2V4AA 3ETPA 4AI9A 5C5TA 1CIYA 1PZ7A 3JQXA 4WZCA 5I8YA 3CDZB 2ZTNA 3ECQA 4ISQA 4CDQA 3QD6A 4ZU4A 3WHUA 2GNTA 2Q8DA 4RGAA 4WVMB 4XCBA 4MGTA 5DMYA 2XBO1 3PIJA 4G3YC 3HIFA 4NHKA 4QQ2A 4C91A 4L92A 4OUMA 5F5QA 5E8AA 1BLZA 2ZX3A 2W47A 5CFCC 3N9QA 1VBC2 1KDMA 1UWWA 1X9TA 3BODA 5A3MA 1ZM1A 3JUUA 1QJEA 3VZJA 3ZFFB 5JR2A 5AVAA 3DN7A 3KGZA 1EV13 3OBTA 4FFIA 5J98B 1G86A 1AYN2 2DCYA 4FXKB 1QQP2 3CHXA 1PIV3 3J8F3 3RNSA 1PNGA 3OY8A 4LO7A 3SH5A 3AYEA 2F4PA 4XJZA 3KCYA 3UETA 3VZLA 3N9PA 4ZZ8A 5J48A 2PHWA 4F8AA 4IV1B 4GMP1 1NE4A 2BZDA 1RUI2 1W6PA 2WL1A 1N3OA 4Q4W3 1Q43A 4YM0A 4XF1A 2W5FA 4LOTA 3OBRA 3ES4A 1B09A 5BYNA 5HV0A 1RL3A 1GANA 2XBO2 3ILRA 4A2UA 2PELA 4URAA 3BTYA 3B3QE 3BALA 1HX6A 1FMD3 1ZZ6A 2XJPA 2I2SA 4IGPA 4BCUA 4HPKB 2K46A 5GZEA 3CZUA 1V70A 1Y9QA 2HBUA 5DUVA 5L7OC 2W94A 3ZFGB 2FDKA 1YFUA 4FP3A 4LMFA 4AW7A 2YG0A 2DDUA 4AEDB 1F8VA 1YYNA 4F7ZA 3UT0A 3LDKA 1D4M1 3BPZA 3KMHA 4N7IA 3O1SA 4MUVA 1DLCA 1SG3A 3KT4A 4K20A 2BVBA 1W04A 1K12A 1LHUA 4AVSA 4FAHA 3U1XA 1GV9A 2VZVA 4RS5B 1S2KA 4E9KA 5A1LA 2DU0A 2OZ6A 4BH9A 3IM0A 2X5IC 1C8M3 1D7PM 2I07B 1COV3 1G9BA 4EWEA 2W9XA 2DUQA 3LEGA 5AC91 3UKNA 4JDOA 3URFA 4OHXA 1JZ6A 1WLCA 2WNVA 1LRHA 1U12A 1V0AA 1Z7S2 3NAPC 4WV8A 4L8QA 1QJZA 4A7KA 1IS4A 2D6LX 2HWE1 2PXJA 1QJFA 2VNVA 4CUBA 4CSWA 2FDGA 4AWDA 1HLCA 4QDQA 4LIVA 2NLRA 5AVPA 1KGYA 1ZRRA 1L7LA 3ZMOA 1LR5A 1RUD3 2GP5A 3MLLA 2RS31 1LOAA 3O1VA 4W50A 4LBQA 5FOJB 1CX4A 1OQEA 2Z79A 3FMGA 2WQ4A 3BTAA 5CYYA 1QXJA 3RG0A 1QH6A 5C71A 4WM7A 4TWTA 1JYXA 3IDCB 2HYKA 2JIJA 3M4FA 4TYSA 5KHKA 3TEZA 3OYWA 3VBOA 3VBRA 2VQAA 2V5DA 3ACLA 2MEV3 5CIRA 4EZ4A 3KCXA 1H2KA 1VRH1 3NJVA 4O7XA 2AEZA 3CMGA 4ZY9A 5AC92 3ME2A 2IXJA 3DPRB 4P9GA 4BB3A 1ODMA 1F15A 3MEPA 2FZ2A 2Q5TA 4MGSA 5HCHA 2D3RA 1C8NA 2HWE2 1JZ7A 1S0BA 1U5YA 1YIPA 4DPNA 4KNCA 4E4SA 1WGPA 2JDPA 1W90A 3NWKA 4PBPA 4DO0A 1GP5A 1VP6A 4YVWC 2EA7A 5F6KA 1GZWB 1OOPB 2ARBA 2RS32 5IVJA 3U07A 2WUHA 3BIEA 4MYEA 2VZSA 3KLSA 3VBUB 3O0VA 4MG2A 1R1A1 2YDEA 4AQ6A 2JG8B 2ZZQA 5A7NA 3WQBA 3AKRA 5DG2A 3J26N 1ODNA 5CEHA 1VR3A 4XBQA 4PBOA 1RMU1 1VBD1 4RR3A 4DUWA 1UMHA 3FX3A 3N36A 4QGMA 5KXBA 1DDLA 5JI9A 3VD4A 2GC0A 5GZFA 2NN8A 3H1WA 1B35C 1VRH2 4JCKA 3I59B 5FY7A 1G9AA 4Q0PA 3IDEA 1TME1 1JZ8A 3ES1A 4LQRA 2QCSB 3VZNA 2ARXA 3Q8FA 4BISA 3ZN6A 3USUA 1BQPA 3DXTA 5C3SA 3T0AA 5FRAA 5FQ0A 3PVOA 2R071 2J1VA 2XJTA 1BKZA 5EJZB 1O59A 3BTZA 1REEA 4DINB 1OH4A 4N43A 4GWNA 1ZZ8A 2WO1A 1FV2A 1SLAA 2D3SA 1MS4A 2X53S 4CPBA 2P6HA 1PX4A 5A70A 4DIQA 3C7GA 1UOFA 3FFQA 3GHNA 5JVVA 3FE5A 3OUJA 1NCQB 1W2OA 1F35A 1JUHA 1O8PA 4DXTA 1JTZX 2X05A 3RWNA 1RMU2 1VBD2 1HQLA 4MHRA 3H42B 4EROA 4V2WA 5EYYA 2JG9A 4R9CA 3MV11 1KS5A 4FPOB 4X8PA 3MPPG 2PAEA 5K4LA 4I09A 4A3ZA 2AENA 3ZSKA 4E2QA 5ISLA 4XJWA 4K7JA 3ZM8A 4JTOA 2UWCA 1S0FA 4GJZA 1TME2 4AXOA 2NP0A 2W1SA 4Q4Y1 4JKLA 1V6KA 3HQRA 5C3RA 2QBXA 3CJIB 3GCXA 3VDCA 3QBQA 4XUPA 2XJQA 4IE4A 4CEWB 3A7QA 4LA3A 2R072 1EV11 1PHMA 5E88A 5K0UB 3OEBA 4FO9A 4HZFA 3VLBB 3NKTA 4D6QA 3N9OA 5LWBA 4WM8A 1ZRIA 1PIV1 1V6NA 4ES8A 2WYFA 5FZKA 4EWDA 2VR4A 1F5FA 1DYKA 2JB8A 4Q4W1 5CFDA 2R32A 2F6BA 5EV7A 3VZOA 1W6OA 2ZX0A 1SBFA 5HCFA 1W6MA 2A73B 4LHSA 2VBDA 4HANA 4BU2A 3NNMA 3MFCA 4LULA 5FZLA 3MICA 5CAZA 3AP6A 3B00A 1YHFA 5FV3A 2WT2A 2A1XA 3PUIA 4HMZA 2LALA 4MGQA 4PT6A 2RM22 5F5IA 1FMD1 4Q4Y2 2QJVA 2VULA 5J09A 1RHI3 3WP3A 5EYXA 5DAWA 2RHPA 4XC9A 2KR2A 4H55A 2VOWA 4JGZA 1BEV3 5IVVA 4HK8A 5FYSA 3ACFA 4LUMA 2R061 4ZKTB 1ND3B 4U36A 1NA1A 2FMYA 3E5QA 2A71A 4H3WA 1W9WA 1PIV2 2GH8A 4UFLA 3D0JA 2XOMA 4FQ4A 3BGAA 4YGCA 3H50A 2VGDA 3LA3A 4K8RB 4AI8A 1IOAA 3RSJA 3JBG2 2GAUA 4UF0B 1C8M1 2B9VA 4J25A 1PMHX 4NE9A 5FZAA 2WDBA 1V6MA 2HKXA 3KT7A 1NCRC 1OBNA 5FPUA 3ROUA 2R043 4ZU5A 5BNPC 3HWJA 1WW4A 1W8OA 2W46A 1UXXX 2OVUA 1I1EA 2EIGA 5FMOS 1S2EA 4LUKA 1XE7A 1VMHA 3OGSA 1JHNA 5F3IA 4YSFA 4QWNA 2HWB1 2XVGA 4I0WB 2HEVF 2J1SA 1QKQA 2VTXJ 5A7WB 4CP9A 3ENRA 1RUD1 3UYJA 4JKKA 5KHIA 1DIWA 1U5XA 1H8TC 1POQA 1U5ZA 4LO8A 4C1WA 1WMDA 2R062 1EYBA 1MS5A 1YWKA 2BUKA 3R4UA 1YUDA 3L2HA 1OFNA 2RVAA 2VOVA 4P9WA 4XFCA 3V65A 4AAPA 4BQ5A 1W8WA 2WAAA 3N35A 2VU9A 1J84A 2G9FA 3K3OA 4M01A 4YZ4A 5H9RA 5KHHA 1JOBA 5FPXA 5A7OA 2EXIA 1MZ5A 2MEV1 4XW3A 2UYBA 3LEMA 1HKDA 1YQ2A 4EJRA 1PO13 2VZTA 1GLHA 3BVCA 4ZXKA 3NAPB 5FPZA 3U14A 1YO8A 2HJIA 4NIAA 3A4UA 3MIGA 1WCDJ 2EIBA 2YBKA 2VZQA 2ZGKA 3QACA 4QDRA 1YRZA 2BBVA 5D21A 1HRI3 1GFF2 2P37A 4RHV3 2HWB2 2OT7A 4DY5A 2JDUA 2WSUA 3GM8A 3OBAA 4GH4C 1F9KA 1HJFA 4PDWB 3TN93 4P02B 2PHXA 5C3QA 4GKYA 1UU6A 2IXIA 3OPZA 1Q8VA 1QIQA 4RGKA 5EJ1B 5EQUA 2VMIA 3ZXFA 2ZGOA 4CCOA 1AR83 5A32A 4LTAA 1KJLA 5GM0A 4UFIA 2MEV2 4RSUA 4BQXA 2WO7A 1SFNA 1NZIA 3ZYFA 2YFZA 3MIBA 4QKFA 1JYWA 1MS0A 2IVJA 2GNBA 3AZVA 3OGJA 4XMIA 3Q8BA 1YNAA 2Z69A 1FOD2 4LKDA 3WY6A 4COZA 3AXDA 2Q1ZB 4C0HA 3BUCA 1UCXA 1R093 3KHCA 2C0ZA 1VJ2A 2XXZA 5DUUA 3RJ2X 2RDQA 3IIAA 3DUIA 3B9CA 4AHWA 1HN1A 2PHUA 1S4CA 1LEDA 3O1PA 3I3BA 1NQJA 1W9FA 1WA4A 2QTWB 3HPNA 4FPLA 3H7JA 1CQ9A 4MADA 4N7UA 4NRQA 5GLVA 3USSA 2R6QA 1CAVA 3TWIA 4A42A 4CE8A 5C33A 2B9UA 1DU3D 1Z0HA 1ZZ7A 2W1WA 3KB5A 4X6QB 4E4ZA 2ID4A 1WW7A 4Y1UA 4AK3A 2JDHA 1HQNA 1UYXA 3AMHA 4IEQA 4NPLA 5IJRA 4HVQA 3AYDA 5ABJB 2Z4FA 1UU5A 5H9QA 3N4MA 1OD3A 4NRMA 4CXWA 3K4AA 3VV1A 1RJ7A 1RUC2 2HYXA 1BCXA 5A3UA 4QU1A 5FJKA 2CDOA 1FNZA 1AHSA 4GQ7A 2WNUA 2WWSA 4XFGA 4O65A 2JEMA 1CESA 4A45A 4CUCA 5BNOB 1C3HA 3WV6A 4KG8A 4YW3A 1S0IA 4HETA 1U5IA 1UW8A 5L7OA 5J37A 3O5SA 3K4DA 3WSOA 1W06A 5I93A 3UKTA 3ZR6A 2BGCA 2ZGLA 1OMIA 1X36A 4K21A 2QQJA 3WDVA 1CAUA 3KV4A 5KC5A 3TEWA 4AG4A 4QD2A 4YW1A 1X33A 2XR4A 5C4WA 4W4ZA 3ZX7A 5DAVA 5FUNA 2RR13 5DZGA 3T0DA 1S0GA 2P3YA 4LNVA 4MGKE 3DL3A 4DY3A 1H2NA 5IK4A 4AEKA 1J1TA 1O7FA 4Q8LA 4BQWA 2R30A 1Y3TA 1SMVA 1ENQA 3WNXA 2X10A 4XFBA 4IEZA 1MQTB 1JU3A 3VBRC 3V0AA 2D43A 2KA3A 3NQHA 4X6RB 4YZ2A 2B5HA 2UURA 5B2GB 5FLIA 4IEVA 1MS8A 3N7LA 4PLNA 1DQ6A 2QQKA 1JS9A 3OTFA 4CCJA 1EY2A 4PLMA 3FUQA 3NNGA 1GR3A 5IVEA 1UX7A 1OF4A 5A7PA 2G1MA 1GMMA 1NLRA 1RHI1 1E57A 2O8OA 1RUE3 5KR7A 4LE3A 1TVGA 3D6EA 4XURA 1W05A 2CTVA 4JZRA 4KQ7A 1SDWA 1BEV1 4PIYA 4UFJA 5D8AA 5GALA 3ZFEB 5JXIA 4FTEA 1E5IA 4QT6A 1X50A 5T5JA 3ZYPA 5DZEA 5C8CB 3I2KA 4LO5B 3PURA 2OA2A 4AYUA 1KD7A 1PO23 3JU9A 3M3EA 2PLV2 4QQHA 3OG2A 2LROA 5HXMA 5EJ3A 4GKXA 1SLIA 4O9GA 2OUJA 1VBB3 3WNPA 3TBDA 2VZUA 4CCLA 3GZUC 4YG6A 4K3UA 1Y43B 4ARXA 4G4FA 3BN6A 4RR3C 2RS52 3HBZA 4GXLA 3MPBA 2OX0A 2GC1A 4A7ZA 1G6NA 4QMAA 4OQ9A 5LY2A 3OPWA 1JMUB 2BPA2 2R041 4CYDA 1MZ6A 3N9LA 3WCSA 4CDUA 1W2NA 5E6HA 2NYYA 1W8TA 4BQ2A 4XOGA 4YW2A 4BK5A 1RHI2 4UXAA 2VOKA 1ULEA 3LF7A 1DFQA 3UL2A 1O5LA 1V00A 4CEYC 4EN9B 4CDXC 3H8UA 4RL7A 2D93A 1QJX3 5CADA 3LOBA 4AAXA 5JIAA 3M3QA 4Y4RA 4QPWA 1LOEA 1VIWB 2PAMA 4LEJA 4ET7A 5JOXA 2E9QA 5IATA 1CAWB 5IFTA 3S57A 2J42A 2ZEWA 4KU7A 1VALA 1AR93 2BNNA 5L9BA 1JZ3A 1C4RA 2ZGTA 1B35A 1LAJA 1HB4A 1WCUA 2FHRA 1KFUL 4S2FA 2LW8A 2G9ZA 4BQYA 1TMF3 3ILNA 1PO11 5EIYB 5BNPB 2VUAA 2ZGMA 1CZTA 2MNGA 2YXSA 1NOVA 1SLTA 2PQQA 3OCPA 3LE0A 4QPGA 3K77A 5IVBA 2E63A 3SNMA 3ZVXA 1YFYA 1RB8G 2D7FA 4M3CE 1S0DA 4RN5A 1JUIA 1HRI1 1OI6A 4YGDA 2WWUA 4XAAA 4RHV1 3SLIA 1JYTA 3VDDA 4I2OA 1VBA3 5H9SA 4UOJA 3KM5A 4KWUA 1VAVA 3VHPA 4UW5A 3A22A 4BE3A 4CU9A 2ILMA 1PM7A 1M4WA 5FZ0A 3TN91 5CA6A 1OXCA 4FI9A 4WM8C 5FZ8A 3RDIA 3MF6A 3ZYGA 4NIIA 4Q26A 1LGNA 2B4KA 3ZXKA 2QKDA 4FOWA 4B7EA 5CFDC 1QOOA 3POJA 1GZTA 1IPJA 2W08A 1DYOA 1GQPA 2VH9A 5FZDA 2LS6A 4CDQB 1HXS2 5F2SA 1W39A 3CU7A 1DP0A 2D97A 3MIEA 4WZFA 3UNPA 4FAGA 2P3KA 1PO12 1KITA 3K4ZA 3KSCA 4ITCA 4QU2A 4CZSA 4MGIE 4AI0A 1R091 4XIOA 4P5YA 2FDJA 2DCKA 3INAA 2XL9A 4AVCA 4DNYA 1GWKA 3M70A 4GJYA 1OVPA 1HRI2 4MXWA 1JYNA 5A1AA 4RHV2 4JKMA 3C3VA 2ZHLA 1RUJ3 5F7UA 1GBGA 2BNMA 3PU8A 1AL22 4NAMA 4QX1A 2JDZA 3M8LA 1UOGA 5ACA2 1XNBA 2HWC2 2A6VA 4HKOA 5LEKA 3TN92 2B39A 3GJBA 3AMQA 4GZ9A 1WMEA 2DVAA 1W6PB 3M3OA 2XJSA 2EAKA 3AC0A 2GZWA 1PVXA 1PZ9A 2A70A 5FPVA 3THTA 1XOYA 2CAVA 5F6LB 5HI0A 1AR73 5JSOA 1BK1A 4WVZA 1F4AA 1W0NA 1HRV3 3C7HA 1CIWA 4QPIC 3M3IA 3S5AA 3LDRA 1SDDB 1QJY2 2BOJA 2QQOA 5GZCA 1DGWA 3RYKA 4XJUA 4D6RA 2ZBJA 1YXWA 4Y3OA 4IQPA 2FCVA 5JOZA 5FMOL 2EALA 3POBA 3ATGA 2RR11 5C6CA 4Y1XA 3AYAA 4RQPC 4W6YA 1UX6A 3LEKA 2GNMA 5JDBA 4QXHA 5FY0A 5JZGC 3GZEA 1AYM1 1PZ8A 1R083 5B4NA 3WW2A 1WD3A 1YC61 2Y26A 2CGNA 5IVCA 2RG4A 2LRPA 3NKGA 4AHXA 5JAXA 3I49A 2ZKNA 3RFRA 1LKNA 2VUCA 1YQ6A 4CCNA 4X8NA 2YPJA 1J59A 3RWKX 3PVEA 3WG2A 2FDIA 1DZTA 5F1RA 2CGPA 5FY1A 2WNVB 5FZ7A 4AGGA 1ULFA 5JSRA 4GWMA 2QQLA 3LQCA 1KXGA 3E6DA 3KCCA 4D69A 1RUE1 1QOTA 4GD4A 2VZRA 3ZXEA 5DDJ1 4UW3A 4IETA 2VCCA 2YV8A 2BV4A 1EAH2 4XCAA 5F32A 1UZZA 1YLLA 3FUOA 1AR61 1JW6A 4HVRA 3UGFA 1QF3A 3DYPA 3V0BA 2E6VA 2W52A 5FUIA 5A6QA 1ZZ9A 2JE8A 3P3PA 1PO21 2RR12 2ADEA 1TEIA 3AKPA 4NHLA 3CF6E 1I6XA 3AXEA 4NIDA 5FYBA 1K5MB 3G7DA 3EBRA 4WM7B 5FZOA 1AYM2 1N47A 2VPVA 4H7MA 3MW3A 5A7QA 3S7EA 3W58A 3OYWB 2EIEA 1WLWA 2DURA 4XF3A 3VBOB 5C5UA 3OD4A 4HXCA 1O3TA 3PVNA 1JYIA 2UWBA 2A75A 3DGTA 3JD72 1QMJA 4D94A 1YCIA 2WFF3 3OUIA 2GU9A 2JDNA 2XKPA 3WR0A 1RUE2 1K45A 1KDKA 3OGVA 5K8SA 3OOXA 5E89A 5IYYA 4LLOA 5DDJ2 5L19A 1RVF3 4GH4A 4LBNA 3EB7A 2J1RA 4NWWA 1QJX1 2W87A 1PMJX 3T09A 3WXPA 1AR62 2X09A 5SV5A 2XJUA 4XF0A 2IXLA 1BVP1 2NQYA 3D5OA 1IQAA 1PO22 1OLME 4BHPA 3IN9A 4Q0QA 3SITA 3S5QA 1W9YA 4AVBA 5I8SA 2CNAA 2X29A 1AR91 5FPBA 3WCRA 1YJKA 2FBEA 2FD8A 5FIXA 4B1MA 3LPFA 4RR3B 4FOYA 4Y33A 1LESA 2CSGA 4AEJA 1J3QA 2W91A 1TMF1 3M1HA 3KVAA 2ZMKA 2CAUA 3ZDSA 4YM2A 3T1MA 1HIXA 4XEZA 2P34A 1A8DA 1PGW1 2WNUC 1MEC1 4GULA 5IAVA 1O4ZA 2ZEZA 4QAWA 1XJAA 4XF4A 5DPNA 3VBHA 1AUYA 1F4HA 1QDCA 1H9WA 1PVC3 1W8UA 5FP8A 1VBA1 5LBBA 3W9AA 4EV0A 4QX0A 3AYCA 2Q30A 1QJX2 4DMIA 4AFDA 2Q8OA 2XMLA 4N43B 5JPNB 1E5HA 4ISRA 3JZVA 5C4WC 2IC1A 2OUHA 3GBFA 5BNNB 2Y6LA 3KHBA 3AP9A 1BZWA 3WVJA 5FYMA 4OVEA 1PGL1 1EPZA 4ZONA 1XYOA 1AR92 3NJXA 2KXLA 3BOWA 5GKAC 2RJ2A 1J83A 5EFUA 2JG9B 2K2SA 2WS93 4HN1A 5CKMA 2RE9A 1Q8PA 3IAQA 3U37A 3VBFB 3MIHA 3RZJA 2VOXA 2VG9A 4Y22A 4IDZA 2BOIA 2GSYA 4IV3A 5JSPA 1UY2A 2A6XA 2C9KA 1MEC2 4IXLA 2WKKA 2OPWA 5JLVA 4YVSA 1W6NB 2D6NA 3O1MA 2L9LA 5LBEA 1IS6A 2ATFA 1A6CA 2VTFA 4HKWA 4MLOA 4AVAA 5D8AC 5FYIA 5FYVA 4YWAA 2ZABA 2IXCA 2VXRA 4IEOA 4MVTA 4F83A 1LB2A 1D4M2 3A23A 2A5ZA 3H7YA 2WT0A 4WM8B 1DLLA 2R0FA 4PQQA 2VL4A 4BDVB 3RZLA 2PFWA 1HV1A 2ZAAA 4QDSA 1QXPA 1PGL2 2JWPA 3VKOA 4IE0A 4M3CA 3IWZA 5DG1A 2P1BA 4K9SA 4P9XA 5FUPA 3ZYBA 1W6OB 2Y60A 2PA7A 2ARCA 1U0AA 2GN7A 3ZXAC 5HCBA 2AUYA 1LULA 4YFZA 3LA2A 1HRV1 3Q8CA 4L11A 4NVPA 1RGSA 1UY0A 2R1BA 5FZEA 5J3UA 1H6YA 3F2ZA 4R52A 4XTMA 4CDUC 2HBTA 2CYFA 5CKQA 2W39A 1LOFA 1OPMA 2YYOA 1UOJA 4ATFA 2GDFA 5LEJA 1H9PA 3TNQA 3CNAA 4W65A 4N53C 1NLQA 2JJ6A 3H3UA 4GALA 3RMXA 2Y6HA 1S55A 4JGZB 4L2NA 5F37A 1TG7A 1FXZA 1XBFA 2WINB 2JKBA 1CVNA 2ZHMA 5F9TA 1NA1B 3I2DA 3K48A 1AL0G 4A6SA 3T3YA 1JXNA 5FPAA 4DS0A 3LOIA 3WNMA 1QOSA 1DHKB 4N8MA 1SHWB 4ZZ5A 4CP2A 2QQWA 4CCCA 1R081 3IAPA 3HD8B 2F17A 2V4VA 3ZFFA 1QWRA 3WDTA 1C1LA 2YBPA 4DOUA 3HQUA 3U4SA 2CHHA 1RITA 1W8FA 3T4HB 4KU8A 2D44A 3CJXA 1ASJ3 1PM4A 4OHWA 3IB3A 2PTMA 4LKFA 2WN3A 2YC4A 2YMZA 2WQ8A 2OQ7A 2XB6C 3NJYA 3BPSA 3OBZA 4CEYA 4CUGA 4CDXA 4IV1A 5FO9B 2RDSA 3KWVA 4QPGC 2K9ZA 2XG3A 2XGXA 5EZWA 3VKLA 4JQRA 4A4AA 4QGLA 2NZ9A 4LO6B 3TEYA 4UT5A 3A21A 4Y5TA 2BU9A 4CP9B 1LCLA 1XU1A 1HB2A 3IMNA 3VDDC 5C9AC 1SPPA 4XE9A 1FNYA 1R1A2 2ARAA 4Q27A 4Z07A 5CISA 1ZX5A 4A41A 5JI7A 3DKQA 3KS7A 1FPN3 4KWKA 3ZR5A 5JXJA 3D82A 1HN0A 3QCWA 1R082 5DAQA 2WBKA 3ZFGA 1KS4A 2N7GA 1IS5A 1SZBA 2YGMA 4OI1A 4Y5SA 4AZZA 1L7QA 1IZ3A 4PI0A 4AEDA 3RZMA 2PHDA 1VMFA 1GYKA 4BK4A 4FFHA 3FL7A 2J1UA 2P2KA 3WZ1A 2WFF1 1KFXL 4KH9A 2QDRA 4XF9A 4MOAA 2DFBA 3ACGA 2VW0A 3AFKA 5KBFA 2WLPA 2ZGNA 3KV5A 3PNAA 4DB5A 5FTTC 2VCBA 4RS5A 2WJSA 1RVF1 4YGBA 1W8HA 5AFEA 2DVFA 3RS6A 2ZX2A 2C24A 2P17A 5CU1A 3NJZA 3GNEA 5LA0A 2G4IA 5FXWA 1JYCA 3J8F1 3FHAA 4E4HA 1W6QA 3I2HA 5JUVA 3L9JT 4EZHA 3POFA 4FVVA 4LE4A 5HPOA 1EPWA 1I9RA 3EXUA 4PHZA 5A6YA 1LOBA 1PK6A 2OXBA 4P9JA 4AQTA 5EPAA 2BW8A 1JBCA 3ZPOA 5BY5A 2E33A 4EN8B 5KHJA 4GIQA 4Y1VA 5A32B 2PHFA 4AFAA 1GZ9A 4Z92B 3MGUA 1UPIA 3B94A 3NNJA 1URXA 3F95A 4IEPA 3VL8A 5CFCB 1MZFA 4XETA 4UW4A
chains in the Genus database with same CATH topology
4KBBA 4R4XA 1MS1A 1PVC1 4AEMA 2ZAHA 1RVF2 2BEOA 1EV12 4OI0A 4EN6B 1TNFA 4FXGB 1O3SA 1A3KA 1HDKA 4FPGA 2AR6A 3J8F2 1DF0A 4AGVA 1ENRA 4R9AA 2QQPA 1VBE3 2XPJA 4Q4W2 2JECA 4WVWA 1XNDA 1COV1 1LGCA 1ZBE3 1BMV1 2GC3A 2YGLA 3FBMA 4Q1RA 2WS91 1OOPA 3NSTA 4QM9A 4QPIA 3PTYA 1S0CA 4N90A 1BYHA 1DGRN 5T5OA 3VBUA 2XJVA 2JG8A 1FMD2 4MGZE 3M3CA 5L7OB 3MYXA 1SLBA 1DQ5A 1J58A 3ASIA 2Y38A 1PVC2 3RJRA 1OHFA 4LBLA 4RQPA 4BZ4A 4L9BA 2EF6A 3KZ4C 5JZGA 1WMFA 1UU4A 1WD4A 4B8EA 3ALQA 1YFXA 1NE6A 4LBJA 2DWRA 3ZSJA 2E51A 5GLTA 1YFWA 2X5IB 4B4PA 4JV4A 2ZZJA 4Y4YA 1C8M2 1COV2 1CR7A 1BMV2 4FPJA 4EN0A 4U2AA 3ZSLA 3NVCA 3K51A 4P9YA 2WS92 2GN3A 2XWJB 3QH6A 5KXDA 4GB33 3V0AB 4C1XA 3TRSB 1ALYA 1NCQA 5L36A 4LBMA 3N7KA 2QZ3A 3HR9A 4HFSA 4UW6A 5KHGA 3VHOA 2ZKLA 3LZZA 4FSJA 1RUD2 1F5JA 3RYPA 1WBFA 3A0NA 3KGLA 1D2QA 3TB0A 4YM3A 5BXXA 2C9AA 2ZJCA 3WD5A 4QX5A 4J1XA 4NO4A 1RUOA 2HEYF 2NMOA 4HL0A 4JDMA 4SLIA 3VKMA 3WQ7A 2YROA 2QNKA 4BOWA 3SH4A 3IBMA 2ZGRA 3B93A 1I5ZA 4INDA 4R9BA 5TSWA 1V9U3 2Q0AA 1C1FA 5IK8A 2GMPA 2UYAA 2VVFA 4RD7A 1NY71 2IFWA 3VBHC 2EXHA 4YVWB 2HWF3 5FBZA 4UBGA 2VUJA 1CAXA 4FPFA 4IEUA 2OYZA 5HXVA 4ASMB 3AX4A 4Q4V3 2Q1MA 2NMNA 3WG1A 3ZN4A 1MVEA 1Q8OA 4LBKA 4H7LA 4P9LA 2Z2SB 4QGNA 2WIIB 1QJU3 1S1AA 1RUG3 1CN1A 4XBNA 3MDPA 4TZDA 1G9CA 1DQ0A 1B35B 1MS9A 2ZGQA 3TNPB 5K7PA 3CO2A 5E16A 3AKSA 1CJPA 5T3NA 1I3HA 4JAAA 3ZIXA 2XVLA 3ZXLA 2DV9A 4I01A 2ENRA 4IV3C 4QPGB 2A6YA 1LODA 2NM1A 3X29B 1DYPA 1NY72 3AKQA 4HK9A 4YVSC 4COYA 4OI4A 3QH7A 4BQ1A 3VBSC 4XXAA 4EN7B 2A3XA 3PHMA 2I74A 1H0BA 3AP4A 3LA7A 4META 5A33B 4XXPA 1C57A 5I0RA 2D3PA 1O4YA 3RQ0A 2DFCA 3N3HA 1ULCA 3GBWA 4K8FA 1GNHA 1ENSA 2RMU3 2ZPXA 3KQRA 1DQ2A 2I45A 1SBDA 2RJLA 1O91A 1LTEA 1LOFC 2Y0IA 3FZ3A 4BPZA 4Y20A 4JGYA 3N7JA 2CGOA 4AVTA 4K1YA 1XXNA 4LHLA 4XYXA 4NPRA 4S2HA 4AHZA 4QQPA 1VBC3 4Q0VA 3OJBA 1YI9A 1ZRCA 1ZBE1 2C1FA 3FHIB 2D5FA 4XIKA 3WX5A 2JE9A 3ELNA 4XPVA 4CDWA 3ZFFC 1Q56A 1RC6A 2DTWA 5A3LA 3AMNA 2LUWA 1QQP3 4PDWA 1DG6A 5J7MA 4DZGA 1L3JA 4XFAA 4N53A 4PIXA 2ZCWA 3T1LA 4BM8A 1N3PA 1J3RA 1FV3A 1WW5A 3GBGA 1RUI3 2V09A 4IV1C 1WCKA 4M3CF 2E7AA 3H3ZA 1BEV2 2BTVC 4XILA 1CONA 1REFA 5FO8B 3E5UA 5JWPA 1WLDA 4A7YA 4XDQA 5JR7B 2CWMA 4PLOA 2XBO3 1GZCA 1GICA 1N1TA 1D4VB 3WUDA 1H2LA 4YLZA 3VZMA 3WP6A 1ZBE2 2BNOA 1NCRB 3ZFGC 1TQ5A 3ZXDA 4MSVA 4UBHA 2EXKA 3R0RA 4GB31 2R042 1D0HA 2CWSA 4XMAA 3HN1A 4YNIA 5H9PA 4AEDC 5BPXA 4AI3A 5JOYA 3THPA 3GYDA 4YYOA 5E1RA 3OD0A 2VVEA 4GMP3 4KWLA 3S7IA 5C9AA 1UIKA 4RS5C 1H8TB 1QHDA 3IDBB 3LKJA 1C5HA 4I02A 1ZBA3 4FPEA 1OLRA 3V0BB 2YY1A 4YM1A 5BNOA 1Z7S3 1CPNA 2EAAA 3IT8A 1XNKA 4Y5Z0 1VAMA 2RJKA 3RMYA 3AKTA 2AZ5A 1AR81 2YZ4A 3ETQA 3AZXA 1PK6C 2G9GA 3FBYA 3VGIA 1PMIA 1SLLA 2PHRA 1TNRA 4O9EA 4L99A 2Y0OA 1V9U1 4Q0UA 4OHZA 2H6CA 3B02A 2JX9A 3HAGA 4HSJA 5I0TA 4XBLA 1SACA 1OQDA 2GALA 4YFWA 2P3JA 5HCAA 2YHJA 1H8VA 2HWF1 1TE1B 3H9AA 4LR4A 1POV0 5CG8A 2W0XA 2UY9A 4GH4B 5BV6A 3ZN5A 1XQNA 4COVA 4Q4V1 5JPMB 3O0WA 2P3IA 3OY8B 4S2DA 4YGEA 5FOBB 1AXZA 3VHNA 4FPCA 1RUG1 1AR82 3D4KA 1UMZA 5I0SA 3FFZA 4MZUA 2B7YA 4OFGA 1X8EA 4XJ8A 4S2GA 4XJAA 4FOVA 4MV2A 2R1DA 1OOPC 4LT5A 1H4HA 1R092 1S2BA 4QM8A 4M00A 3VBUC 4L97A 2JG8C 2FZ1A 3D0SA 2DCJA 3VBHB 1AXKA 1G9FA 4XJ9A 2A3WA 2HWF2 5T54A 2VMGA 4BMBA 1VRH3 2ZHKA 1AJOA 1YJLA 1A78A 1BBT3 3WHTA 2QE3A 3ZYIB 5GJ6A 3HQXA 1VB4A 5IT6A 3ZXGA 4AE2A 1SQ4A 2B46X 4FQZA 3POWA 4DQAA 1BXHA 3WDUA 5DUWA 2QDNA 2RMU1 1CAWA 3JQWA 4IV3B 4WBBA 2EXJA 4B4RA 1DGRA 1NCQC 2DVBA 5L73A 2PAKA 2R16A 4LBOA 1RMU3 2TBVA 4R4ZA 4YVSB 4ES9A 1MR5A 1ZZBA 4Q1PA 2XJRA 4LBQB 2R0HA 1ND2A 4YZ1A 5FREA 4BA6A 1ENXA 1TME3 2XVKA 4CP1A 1VBB1 1F2NA 1VBC1 1AVBA 1W0OA 4COUA 1G7YA 2ZMNA 3CJIC 1OA2A 3VBRB 1GQHA 4XZPA 1X8MA 2XL7A 3AFGA 2R073 1ZREA 2BFUL 3AMMA 2B42B 1QQP1 5FCCA 3FLTA 1QNYA 3O0XA 3B5LB 1CD3G 4R8HA 4AQ2A 1IGOA 3KD4A 4H14A 4AFCA 1RUI1 4N9IA 1LENA 4I3GA 3H1YA 4CP0A 1RUF3 4ORFA 4XFIA 2A7AA 4TSVA 2UY8A 1CPMA 3Q9OA 4W6WA 1ZVFA 3MIFA 2RM23 2V73A 2CV6A 4Q4Y3 4PCRA 1VBB2 3S6PA 3POSA 4NR1A 4FPKA 4E4DX 2H0VA 4FT8A 2WA3A 4D7YA 3DKWA 3WQ1A 2WT1A 3SCFA 2XH6A 4D7TA 2AYHA 1LOGA 3PJYA 2B45X 3SXWA 3MW2A 1EP0A 1ND3C 1G8WA 1Y7BA 1WW6A 2AREA 4Q4X3 1DZQA 1O4TA 2X8KA 4JC1A 3ZN6B 3USUB 4CEYB 4CDXB 4AGRA 2VECA 3O7OA 5FQ0B 3JBG3 4OUSA 2KM2A 3WG3A 1W2UA 1Q8QA 1ZBA1 4P14A 4ONUA 3MI8A 2HEWF 1IKQA 4QQLA 2JD4A 1Z7S1 4COWA 5DUXA 2WA4A 3AJZA 3N7MA 1N1SA 3APBA 3AM2A 4AFMA 4QPYA 3SCHA 3LWCA 1IHMA 1TMF2 4JTNA 4MX3A 3FLPA 4OHYA 2R063 1PGW2 3ST7A 2ZACA 2AGSA 4YW5A 1ZZCA 1H1MA 4KG0A 2GMMA 3IPVA 4AFBA 1NG0A 3U0ZA 3NV3A 4M0NA 3VBSA 1RUJ1 1VBA2 3TOJA 5KWRA 1POV3 2IFRA 3UK9A 1ZBA2 3BU7A 5I0UA 4OULA 4Z8BA 4KGQA 1W6QB 1N1YA 4JGYC 1AX2A 1UIJA 5C8WA 3ZYJB 4HVOA 2CY6A 2VNOA 1S0EA 5CFDB 2GMEA 5JMCA 1PK6B 5EWSA 2O1QA 1W6MB 1GKBA 2HWB3 1AR71 1SCRA 4M0HA 3BIWE 4MXVA 4CDWC 1ZA4A 4DXZA 2ZMLA 5GZDA 3O12A 4LA2A 4PDWC 3TAYA 1K5MA 2YC0A 3NV4A 2ES3A 3KT1A 3ZSEA 5BUVA 1NLSA 4RGGA 4NN0A 4YRDA 1RUJ2 4IEYA 4WVMA 4BIFA 2PYTA 4XQ4A 3U11A 5LK7B 2TUNA 4BIOA 1FOD3 1OA3A 2BWCA 4MGYE 1BBT1 1V6JA 1GSLA 4YZ3A 1LHWA 2XKOA 4HLTA 1BVVA 2OW4A 3OGGA 4ZU7A 1H2MA 3HT2A 4E2GA 1AR72 1ZYBA 5JCTA 4LHKA 3O14A 3E6CC 1Q3EA 2XWBB 2ZX4A 1H4GA 3A0KA 1DQ4A 4QPIB 3HMYA 1HRV2 3BB6A 4AI1A 3AZWA 4XTPA 1HQWA 1UPSA 4HN0A 5T52A 3B7MA 5ABJC 4D7SA 2D6OX 1RUC3 3WINE 4RQPB 3B01A 5GLZA 3UJQA 3TYJA 1LU2A 3GZTB 3I7DA 1ONAA 4FCAA 1IS3A 5JZGB 2TEPA 2ET1A 4HPKA 3JB8A 1BBT2 5BNOC 4JVAA 2CL2A 3C2UA 4KL1A 5FFOC 3T2TA 1UN1A 4HSLA 1RJ8A 3EJKA 5KC6A 1UAIA 3EO6A 2D6KA 1S0JA 4DFSA 4JRAA 4E27A 2OPKA 5BNNA 1X7NA 1T6GC 4B3NA 2WC2A 2B8MA 1HV0A 1OSGA 1RUF1 4YG3A 3WG4A 2A6WA 3VBFA 1MQTC 1KRIA 2WSVA 3EQEA 1FI2A 3WT3A 3WOGA 2RM21 4LLFA 3L2YA 4ATEA 1REDA 5FDBA 2D5HA 1AX1A 1NZCA 3W59A 4FTBA 1W6NA 1VLNA 4A3XA 4TLFA 1J3PA 3ZFEC 5AFBA 1C5IA 2SBAA 3ZMNA 5KXCA 5DXDA 2WFF2 4Q8KA 5C8CC 2D98A 2PLV3 5GLWA 3SISA 4Q4X1 1LJ7A 2Z5WA 4PIZA 3JBG1 3WW1A 1KQRA 1RUF2 1MS3A 2RS53 5FAXA 1SBEA 4J1WA 3DPRA 5I8TA 1CAVB 1JOJA 1CAXB 3AMPA 1LHNA 1SEFA 4SBVA 4YG0A 2ERFA 5LRRA 3WDYA 4FOQA 2A3YA 4RFT0 2WZPP 3RPQA 5SV8A 4Q0SA 1XRUA 2JICA 3PMSA 1J1LA 1APNA 2ZX1A 1GZWA 3PMEA 1FX5A 5LK5A 4ASLA 3MLKA 2LTNA 3AJYA 2W68A 3M7AA 2ZGSA 3NV2A 5KXEA 2WNUB 1QY4A 2XLAA 5CVRA 4FPYA 1NYWA 3H0OA 4PQ9A 4Q4X2 1XYPA 3PVBB 4AQSA 4Q29A 2VVDA 1Z78A 1POV1 3AP7A 3I59A 1CAUB 4YW4A 2UWAA 3ZIWA 5C4WB 3BCWA 2DTYA 2DCTA 1VB2A 3PLQA 2QVSB 1ND2C 2IWGB 2HWD3 3AB0A 1D0GA 4MH0E 4N9HA 4PF5A 1OA4A 1XE8A 1XYNA 2VNGA 3LSEA 2E7QA 2ETEA 2VW1A 4R9DA 3WDWA 3EHKA 3ZPYA 2TNFA 4GMP0 3VHRA 1O3RA 4F3JA 3J4UH 3DF0A 3IKWA 4EWAA 2R49A 5LRSA 5D8AB 5CNAA 1HXS3 4QHBA 2AH2A 4CDQC 1H1IA 4Y20B 4IEXA 2PHTA 4JGYB 1FOD1 2Q4SA 2BFUS 3CJIA 2H0BA 4K1ZA 4FTSA 4CEWA 2XLGA 3SHRA 5K0UA 4XQWA 3POYA 3LAGA 1ASJ1 3GALA 4QQOA 5I91A 1AL23 4CDWB 4XFHA 2BYVE 4G9SB 4J6GA 1JN2P 3E6BA 5ACA3 2HWC3 4CDUB 2WNEA 2C5DA 3WLUA 4FBFA 1UKRA 2WZR3 1IPKA 4Y26A 1R1ZA 4N53B 3WP4A 3LCPA 4HBNA 3U10A 1RUC1 1PGSA 4AVVA 4CTEA 5CFCA 1FPN1 4K40A 1ZNPA 4LO4B 1G9DA 1H30A 3I54A 1N1VA 3NV1A 3JB4C 1WCSA 1AXYA 3RI9A 3E97A 2VY0A 4Z82A 1FT9A 1QJY3 2ZS6B 3ILFA 1ND3A 1W0PA 2FQPA 1ASJ2 2V5YA 2ZGUA 1O3QA 3LSDA 2XLFA 1ZRFA 4K6BA 2A6ZA 3D8CA 2ZHNA 3ZXJA 3VN4A 1BJQA 3GZAA 5T50A 3QOPA 5IK7A 2K0GA 2D6PA 2D40A 1VAKA 2MHFA 3VDDB 4HKLA 5C9AB 1HW5A 2VNRA 4OLLA 3UJOA 2O0OA 4AF9A 1AZDA 3UKVA 1FPN2 2RS13 1SFYA 3VZKA 2WNVC 1NXD1 1WUVA 2VQ0A 3HT1A 4I3PA 4AHYA 4BWOA 1UZYA 4IERA 3MIDA 1RUH3 2ET7A 3P3NA 1EAH3 3R05A 3SMHA 3CEWA 2DCZA 1SLCA 2GH2A 4I0AA 5FLHA 2JXAA 4OI2A 2O8QA 2PLV1 1Q5OA 5DZFA 5J36A 4KWJA 2X5IA 4MXWB 1K5MC 1ULGA 1AYM3 3ZSMA 4WM7C 3QLQA 3I4IA 2DYCA 2RS51 4I30A 3VBOC 1YI7A 4YARA 3OF1A 1Q8SA 3NAPA 3JD73 1VBE1 2GC2A 3FLRA 3FC0A 1AF9A 5BNQA 3RI8A 1V6OA 2VMHA 3GF6A 1LGBA 5DDJ3 3DV8A 3NO8A 3VUOA 2DVGA 4P5HA 5T55A 1AYN3 2DF7A 1AR63 3CL1A 1IKPA 2SLIA 4URTA 5D1IA 4E2SA 5GZGA 1FYUA 2QUOA 4IEWA 1CGPA 3V64A 3VL9A 1XU2A 2D6MA 2E7TA 5T5LA 2IZWA 3V56A 1JH5A 1LEMA 3FWEA 2PHLA 3MFAA 4Y1ZA 4WVVA 4BLJA 4V1PA 1QGLA 4LHNA 1LHOA 2XHKA 5FLJA 2GNDA 2EVXA 4HT1T 1UF2C 1RTVA 1X82A 2DU1A 4KGGA 4NHMA 3WW4A 1VBE2 3ZYRA 2DUOA 4D3WA 2IXHA 2HWD1 3AK0A 1OD5A 4YVWA 1AX0A 1ZRDA 2PN5A 1A8MA 5CBLA 1UL9A 3S30A 4BYYA 1QU0A 3MF9A 5T5PA 1QXRA 4N43C 4C90A 3MLJA 3AZYA 5BNNC 3VKNA 5ABJA 4LBQD 3E5XA 2H6BA 3NL1A 1OFSA 3WUCA 2BVVA 3AP5A 1UKGA 2ZOEB 1LU1A 1QDOA 1MZEA 4JRLA 1UD1A 1HXS1 4Z2WA 4QXKA 4C0BA 2JG9C 1PNFA 3VBFC 2DVDA 4XFFA 1SCSA 4Q2FA 1ND2B 3G6JB 1MEC3 1WLTA 5CB7A 3AZZA 2HWD2 4DRRA 3CLPA 4NOTA 4I0BA 4FP2A 3PJQA 1LECA 1AL21 3NW4A 4GB32 3J9SA 3I8TA 4P9IA 5ACA1 1QH7A 2HWC1 1D4M3 1DBNA 4NWVA 1FAYA 2OZJA 1DZRA 2QZ2A 3WQ0A 1WBLA 1V6LA 2WZR1 1DGLA 3LGRA 3UV9A 1AJKA 4B7KA 5A33A 1MQTA 2DUPA 3SH3A 3MW4A 1M06G 3VKFC 5AC93 1DQ1A 1H1AA 3DPRC 5JIUA 5GLUA 3WP5A 1CJDA 4DRVA 3H1MA 1QJU1 2HWE3 3RRDA 2LM3A 1OLQA 1ULDA 3ZFEA 3S0MA 3FJSA 4CRQA 1QJY1 4OHVA 3R6SA 1GNZA 4BLIA 4Y24A 5EXOA 3U4XA 5C8CA 2RS33 1D2SA 4JGZC 1QNWA 1V9U2 3R4SA 5JOWA 1NA1C 3BOPA 2VW2A 4B4QA 3RZZA 2WZR2 1C28A 3LB9A 4Z1VA 1OKQA 1YIFA 1OQ1A 1F31A 1KJRA 2WLQA 1DGWX 5FO7B 2E53A 2ZGPA 1NQDA 5IUQA 4Q4V2 2WQZC 2NPIA 2YUEA 1O5UA 2BQPA 2RS11 1RINA 3SCGA 2MPFA 3B9IA 3R4DB 1QJU2 1RUG2 4PJYA 1RIRA 3RYRA 5K9YA 3JCIA 2IXKA 4BMEA 4IL7A 1RUH1 4JDNA 3B69A 2XUMA 1EAH1 4XHBA 4OZXA 1LOCA 2FMDA 4Y22B 4B29A 4W6XA 1R1A3 5HBAA 2JENA 5IK5A 4AI2A 1VBD3 3WW3A 3IPVB 1LHVA 4XHXA 1NCRA 3VBSB 4RA0A 5BNPA 2BWAA 2UU8A 1MACA 3JD71 1MVQA 2QFEA 2JE7A 1OPOA 2RS12 4XQDA 2ZA9A 4M3CB 5J96B 1GQGA 1H8TA 1V6IA 1RUH2 4CEWC 1FATA 2Z42A 2OIIA 4FPHA 5K0UC 1AYN1 3GHMA 3M2MA 1XNCA 4IESA 1N3QA 4GA9A 3ZO0B 3MZHA 2RMU2 4Y1YA 4YZ5A 1NXMA 3WDXA 2WFPA 1RUNA 1PZ7A 3JQXA 4WZCA 5I8YA 2ZTNA 3ECQA 4ISQA 4CDQA 3QD6A 4ZU4A 3WHUA 2GNTA 4RGAA 4WVMB 2XBO1 4G3YC 4NHKA 3HIFA 4QQ2A 4C91A 4L92A 4OUMA 5F5QA 5E8AA 2ZX3A 5CFCC 1VBC2 1KDMA 3BODA 5A3MA 1ZM1A 3JUUA 3VZJA 3ZFFB 5AVAA 3DN7A 3KGZA 1EV13 3OBTA 5J98B 1G86A 1AYN2 2DCYA 4FXKB 1QQP2 1PIV3 3J8F3 3RNSA 1PNGA 3OY8A 4LO7A 3SH5A 3AYEA 2F4PA 4XJZA 3KCYA 3VZLA 5J48A 2PHWA 4F8AA 4IV1B 4GMP1 1NE4A 1RUI2 1W6PA 2WL1A 1N3OA 4Q4W3 1Q43A 4YM0A 4XF1A 3OBRA 3ES4A 1B09A 5BYNA 1RL3A 1GANA 2XBO2 3ILRA 4A2UA 2PELA 3B3QE 3BALA 1HX6A 1FMD3 1ZZ6A 2XJPA 2I2SA 4BCUA 4HPKB 5GZEA 1V70A 1Y9QA 5DUVA 5L7OC 3ZFGB 1YFUA 4FP3A 4AW7A 4AEDB 1F8VA 1YYNA 4F7ZA 1D4M1 3BPZA 3KMHA 4N7IA 4MUVA 4K20A 3KT4A 2BVBA 4AVSA 1LHUA 4FAHA 1GV9A 4RS5B 1S2KA 4E9KA 2DU0A 2OZ6A 4BH9A 3IM0A 2X5IC 1C8M3 2I07B 1COV3 1G9BA 4EWEA 2DUQA 5AC91 3UKNA 4JDOA 3URFA 4OHXA 1WLCA 2WNVA 1LRHA 1U12A 1Z7S2 3NAPC 4WV8A 4L8QA 1QJZA 4A7KA 1IS4A 2D6LX 2HWE1 4AWDA 1HLCA 5AVPA 2NLRA 1ZRRA 3ZMOA 1LR5A 1RUD3 3MLLA 2RS31 1LOAA 4LBQA 5FOJB 1CX4A 1OQEA 2Z79A 3FMGA 2WQ4A 3BTAA 3RG0A 1QXJA 1QH6A 4WM7A 4TWTA 3IDCB 2HYKA 3M4FA 4TYSA 5KHKA 3OYWA 3VBOA 3VBRA 2VQAA 3ACLA 2MEV3 5CIRA 3KCXA 1H2KA 1VRH1 5AC92 3ME2A 2IXJA 3DPRB 4P9GA 3MEPA 2FZ2A 2Q5TA 2D3RA 1C8NA 2HWE2 1S0BA 1U5YA 1YIPA 4DPNA 4KNCA 4E4SA 1WGPA 3NWKA 4PBPA 1VP6A 4YVWC 2EA7A 5F6KA 1GZWB 1OOPB 2ARBA 2RS32 3U07A 4MYEA 3KLSA 3VBUB 3O0VA 2YDEA 1R1A1 4AQ6A 2JG8B 2ZZQA 3AKRA 5DG2A 3J26N 1VR3A 4XBQA 4PBOA 1RMU1 1VBD1 4RR3A 3N36A 3FX3A 4QGMA 5KXBA 1DDLA 5JI9A 2GC0A 5GZFA 2NN8A 3H1WA 1B35C 1VRH2 4JCKA 3I59B 1G9AA 4Q0PA 3IDEA 1TME1 3ES1A 2QCSB 3VZNA 2ARXA 3ZN6A 3USUA 1BQPA 5FRAA 5FQ0A 3PVOA 2R071 2XJTA 1BKZA 1REEA 4DINB 4N43A 4GWNA 1ZZ8A 2X53S 1FV2A 1SLAA 2D3SA 1MS4A 3FFQA 3GHNA 5JVVA 3FE5A 1NCQB 1JUHA 1JTZX 3RWNA 1RMU2 1VBD2 1HQLA 4EROA 5EYYA 2JG9A 4R9CA 1KS5A 4FPOB 4X8PA 3MPPG 2PAEA 4I09A 2AENA 3ZSKA 4E2QA 4XJWA 4K7JA 4JTOA 2UWCA 1S0FA 1TME2 4AXOA 2NP0A 4Q4Y1 1V6KA 3CJIB 3QBQA 2XJQA 4CEWB 4LA3A 2R072 1EV11 1PHMA 5E88A 5K0UB 4FO9A 4HZFA 3VLBB 3NKTA 4WM8A 1PIV1 1V6NA 4ES8A 4EWDA 5CFDA 1F5FA 1DYKA 4Q4W1 2R32A 2F6BA 5EV7A 3VZOA 1W6OA 2ZX0A 1SBFA 5HCFA 1W6MA 2A73B 4HANA 4LULA 3MFCA 3MICA 5CAZA 3AP6A 3B00A 1YHFA 2WT2A 4HMZA 2LALA 2RM22 1FMD1 4Q4Y2 2QJVA 2VULA 5J09A 1RHI3 3WP3A 5EYXA 2RHPA 4H55A 2VOWA 4JGZA 1BEV3 4HK8A 4LUMA 2R061 4ZKTB 1ND3B 4U36A 1NA1A 2FMYA 3E5QA 2A71A 4H3WA 1PIV2 2GH8A 3D0JA 4FQ4A 4YGCA 3H50A 2VGDA 3LA3A 4AI8A 1IOAA 3RSJA 3JBG2 2GAUA 1C8M1 1V6MA 2HKXA 3KT7A 1NCRC 3ROUA 2R043 4ZU5A 5BNPC 3HWJA 1WW4A 2OVUA 1I1EA 2EIGA 5FMOS 4YSFA 4LUKA 1XE7A 1JHNA 2HWB1 2XVGA 4I0WB 2HEVF 1QKQA 3ENRA 1RUD1 5KHIA 1DIWA 1U5XA 1H8TC 1U5ZA 4LO8A 4C1WA 1WMDA 2R062 1EYBA 1MS5A 1YWKA 2BUKA 3R4UA 1YUDA 3L2HA 1OFNA 2VOVA 4P9WA 4XFCA 3V65A 3N35A 2VU9A 2G9FA 4YZ4A 4M01A 5H9RA 5KHHA 5FPXA 2EXIA 1MZ5A 2MEV1 4XW3A 2UYBA 1HKDA 4EJRA 1PO13 1GLHA 4ZXKA 3NAPB 5FPZA 1YO8A 2HJIA 3A4UA 3MIGA 1WCDJ 2ZGKA 3QACA 2BBVA 1YRZA 1HRI3 1GFF2 2P37A 4RHV3 2HWB2 4DY5A 2WSUA 4GH4C 1F9KA 4PDWB 3TN93 2PHXA 4GKYA 1UU6A 2IXIA 3OPZA 1Q8VA 3ZXFA 2VMIA 2ZGOA 1AR83 5A32A 4LTAA 1KJLA 5GM0A 2MEV2 4RSUA 1SFNA 3MIBA 1MS0A 3AZVA 2GNBA 3OGJA 4XMIA 4COZA 3WY6A 1YNAA 2Z69A 1FOD2 3AXDA 2Q1ZB 4C0HA 1UCXA 1R093 2C0ZA 1VJ2A 5DUUA 3RJ2X 3IIAA 3DUIA 3B9CA 4AHWA 2PHUA 1LEDA 1NQJA 1WA4A 4N7UA 4FPLA 3H7JA 1CQ9A 3USSA 5GLVA 2R6QA 1CAVA 3TWIA 5C33A 2B9UA 1DU3D 1Z0HA 1ZZ7A 3KB5A 4X6QB</