1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
2B9UA 2PHDA 2GAUA 2PQQA 4RD7A 1O7FA 4H7LA 1ZZCA 3LOIA 4JVAA 2IXHA 4AQ2A 1ZRDA 1J58A 1O4TA 4PJYA 3E5UA 5I8TA 2QCSB 3SXWA 1RL3A 3L2HA 4IEUA 3KSCA 3QACA 3PVBB 1HW5A 2GH2A 1YHFA 5HI0A 2Q4SA 1EPZA 2IXIA 4XEZA 4KU7A 3FX3A 2KXLA 4IETA 2V09A 4QGNA 3HQXA 2QDRA 3CO2A 2EVXA 4UBHA 2UY8A 3MZHA 5FLJA 2ATFA 4Q0VA 4KL1A 1CAXA 3LA7A 2PTMA 3GBFA 4O9EA 2QJVA 4I09A 4AXOA 1XE7A 4LLOA 3ACLA 4WVZA 4MZUA 5LRRA 3IDCB 4QXKA 5I0TA 1CAWA 3TNPB 2D5HA 2ET7A 1VR3A 5J7MA 4XFAA 2GC0A 4UXAA 3DKWA 4IEWA 2FQPA 4BHPA 1X82A 5LEJA 2XLFA 2P17A 3SCFA 4EWDA 1NZCA 4MGYE 4E2SA 4MGZE 1LB2A 2IXLA 1V70A 5FLHA 1ZZBA 1O5UA 3LWCA 5KBFA 3RYKA 5LRSA 3C3VA 3H7JA 4HBNA 5FCCA 4FT8A 5FQ0B 2VPVA 1EYBA 1VJ2A 1ZREA 5FDBA 4QGMA 1LKNA 5F1RA 3UKNA 1I5ZA 3OCPA 4Z82A 1VP6A 3ST7A 5K8SA 4I02A 1OI6A 2IXCA 5D1IA 2OYZA 4QMAA 3WW1A 4IEVA 4I01A 5JR7B 1G6NA 5JSRA 5KHIA 2D93A 3EQEA 4EWAA 1YFYA 1OFNA 3LA3A 4I0BA 4META 1JUHA 1UIJA 5CADA 4XF0A 3H50A 2GC1A 1I6XA 5KHJA 2B8MA 3D0JA 3BPZA 4P9GA 3MDPA 4O9GA 5EFUA 3WW4A 3BU7A 1Q3EA 1XRUA 3H9AA 4MGKE 4IERA 4WZCA 1YUDA 2GC3A 3BCWA 2UYAA 3IDBB 4LEJA 4D7TA 3GYDA 4J1WA 1SEFA 1U12A 1DZRA 1CAUB 4XF9A 3SCHA 4F8AA 4MV2A 1DGWA 4KWJA 1RUOA 3OD0A 4XFIA 3EO6A 1ZNPA 2MPFA 5BV6A 3E97A 4ZU5A 4I2OA 3USSA 2QNKA 2IC1A 2XLGA 5I0SA 2XL9A 2BNOA 1CX4A 1GQGA 1J3PA 1WA4A 1ZRFA 4MGIE 1O3QA 4JTOA 4QM9A 1CAVA 2XKPA 4R52A 3CLPA 5JSPA 2PAMA 4PIZA 2D40A 3NKTA 2PFWA 4JV4A 4HVOA 2ZCWA 4F7ZA 2XGXA 1X8EA 2Y0OA 3H3ZA 5CU1A 4R8HA 4I0AA 1GQHA 3DL3A 3E6DA 3G7DA 3I7DA 3S7EA 2ET1A 4Q0QA 3RPQA 3S0MA 3I59B 4XFHA 1QXJA 4XFCA 4Q29A 4XFFA 2H6CA 2O1QA 3ES1A 4XF1A 1SQ4A 3M3IA 3HT1A 1H1MA 5KHGA 1WLTA 2I45A 3PLQA 1XE8A 4ONUA 4KWKA 1IPKA 1UPIA 3E6BA 4PIYA 5BY5A 4IEQA 3UKVA 4A2UA 5BPXA 3NSTA 2PAEA 4BIFA 1RC6A 1O3TA 1RTVA 4IEYA 1IPJA 2EA7A 1Y9QA 3LA2A 4KU8A 1FT9A 4IEOA 1Q43A 2WC2A 2BGCA 3FWEA 4YARA 1X8MA 4IEZA 2BYVE 1YFUA 4UBGA 1O5LA 5I8YA 1ZZ9A 3H8UA 2XLAA 4J1XA 3KMHA 2H0VA 2DCTA 4HVQA 4WBBA 4HMZA 1O3SA 3H1WA 4YNIA 4HZFA 4L11A 3CJXA 4LUMA 5E1RA 5JSOA 3BALA 1NE4A 3OF1A 1Q5OA 1J3RA 5BXXA 4HN1A 5KHHA 2Z69A 3CEWA 4HVRA 5E16A 4Q0UA 1UD1A 5FLIA 1X7NA 3FJSA 3ZDSA 5C8WA 2MHFA 4HN0A 2ZKLA 4FAGA 4LUKA 4N9HA 4XF4A 2Z2SB 1YFWA 2PA7A 3QOPA 3FZ3A 5J48A 1UIKA 4QGLA 3U0ZA 2O8QA 3E5XA 2EAAA 1OMIA 2PHLA 4ORFA 4KWLA 4LA2A 1J1LA 1ZRCA 1NYWA 4MH0E 2BNNA 3WW3A 1J3QA 2HKXA 1ZZ6A 3DN7A 3FFQA 4XF3A 4XFGA 3SCGA 2Q30A 4BYYA 5EZWA 3IWZA 3KGZA 4LULA 3CF6E 5FQ0A 1YLLA 5C6CA 3EHKA 4JTNA 2OA2A 3RDIA 2CAUA 4PIXA 4D7SA 4IEPA 5CVRA 1UW8A 2K9ZA 3ROUA 3S7IA 3OGJA 1FI2A 1RUNA 3H1MA 3RYPA 1CAXB 3H3UA 3ETQA 3R6SA 1LRHA 2ETEA 3KCCA 3SHRA 2OZJA 1SFNA 3NVCA 4AVBA 3U10A 4GULA 2E9QA 1CAWB 1ZRRA 2K0GA 3TNQA 3ES4A 4TLFA 2Q1ZB 3NJZA 2H6BA 4YSFA 4IESA 5J3UA 1TQ5A 3NW4A 4LA3A 3HT2A 4AQ6A 1QY4A 2IXKA 2CV6A 2PAKA 3LZZA 4MX3A 3HIFA 2OPKA 1YWKA 1YFXA 5KHKA 3OTFA 3RZZA 1PMIA 1RGSA 3WW2A 1CAUA 5JCTA 3RNSA 2N7GA 2BNMA 4E2GA 3ELNA 3O14A 1ZVFA 4QX5A 2D5FA 5FPXA 3U11A 5I0UA 3M70A 2XKOA 3UKTA 2GU9A 4ZU4A 2CGPA 4B29A 2VECA 4CYDA 1EY2A 1WGPA 2Q0AA 1QWRA 4EWEA 5I93A 2VQAA 3H1YA 4QM8A 4NVPA 3N4MA 4E2QA 2C0ZA 4AVCA 3MYXA 1EP0A 1J59A 1NXMA 3KGLA 4BH9A 3CL1A 4FAHA 1O3RA 2BEOA 2FMYA 2QVSB 1L3JA 5JAXA 3RYRA 1OD5A 2HJIA 3DV8A 4Q0PA 4X6QB 4EV0A 3SMHA 4HLTA 3PNAA 3FE5A 4L2NA 4Z07A 3I59A 3LAGA 4I3PA 4Q0SA 4XFBA 1DGRA 2XL7A 1CGPA 3E5QA 2UYBA 1UCXA 4YRDA 3D0SA 3D82A 1ZX5A 5FPZA 1H1IA 5AVPA 4DINB 3B02A 4MUVA 3EJKA 3E6CC 2F4PA 2OZ6A 2IXJA 4N9IA 1QXRA 3NL1A 1CAVB 4IEXA 5BUVA 2MNGA 3EBRA 2B5HA 5LEKA 3BB6A 4HSJA 4AVAA 3FHIB 4OFGA 1NE6A 3IBMA 2GZWA 5I0RA 1FXZA 4K8FA 2PYTA 3IIAA 2XHKA 4XETA 4HSLA 1LR5A 4OLLA 5I8SA 5T3NA 4YYOA 4FBFA 2UY9A 2WFPA 3H7YA 1DZTA 2CAVA 5I91A 4ZU7A 1ZZ8A 2GC2A 4EROA 3JZVA 4LTAA 3I54A 1Y3TA 3VHRA 3MPBA 4X6RB 1ZZ7A 1PM7A
chains in the Genus database with same CATH superfamily
2B9UA 1XOYA 2GAUA 4WM7C 4AGVA 4RD7A 1WW6A 1ZZCA 2HWD1 1ULDA 5T50A 4PCRA 1LOFC 3FFZA 4AQ2A 5K9YA 2A6WA 1J58A 3AKQA 4A45A 1O4TA 1ZBE1 2AR6A 3S5QA 1KRIA 1RUC1 3E5UA 1OH3A 3ZXAC 5I8TA 1MR5A 1N1SA 3G6JB 3SXWA 2K46A 1DQ1A 1NCRB 3ILFA 3RVHA 1W0NA 4XTPA 1HW5A 1OKOA 3AVRA 1YHFA 5HI0A 2Q4SA 2IXIA 1NCQA 1QMJA 2W46A 4XEZA 2KXLA 4CCJA 1TMF3 5LATA 1PGSA 2A6VA 1KDKA 4CU6A 2AYHA 1ND2C 2BDRA 4CEYC 2RVAA 3C7HA 1IS6A 1W39A 2UY8A 1CIWA 1L7LA 4LHSA 1I3HA 5IJRA 4LK7A 4HK8A 3VHOA 5JIAA 3RMYA 4QDRA 5FOBB 1N1YA 1DYPA 3WHTA 2VAUA 3M1HA 3PU8A 3T0AA 3VKFC 2ZX1A 2YG0A 1CAXA 1XE0A 1A34A 2PELA 2VUDA 3EMRA 1W6QB 3MUZ1 5DAXA 2D6PA 4O9EA 3JB4C 2BV4A 3CIHA 1FYUA 3IT8A 1ULFA 4KMQA 2Z5WA 4QPIC 2ZMLA 3RQ0A 1UPSA 1XE7A 4MZUA 4L97A 4QXKA 2BVBA 5FZIA 1C4RA 1OOPC 2CDOA 1ENRA 4CDXB 3TNPB 5FJHA 4DXRA 2ZA9A 3PUHA 2ET7A 1VBE3 3JXSA 4W4ZA 5E8AA 1TMF2 2G9FA 3T09A 3PL0A 2XUMA 2GC0A 4NOTA 4UXAA 4IEWA 3ZX7A 4TN7A 2JIJA 3VLBB 1ONAA 3KCYA 5L73A 3EYPA 3NNFA 2XONA 2RR13 3SCFA 2QQUA 5L9VA 3RZKA 1DQ6A 5C9AB 2GN3A 4MGZE 2ZMNA 2YBKA 4GALA 1ENSA 1PGL2 1V70A 2F17A 5KBFA 1UU6A 4RGAA 4BXFA 2X53S 2BFUL 3C3VA 4NRQA 1W6NB 4HBNA 4CP9A 4MGQA 1GP6A 3K4DA 5A80A 1VJ2A 3VBFB 1JXNA 4JDOA 4URAA 3ZSLA 4Q4X1 3ILRA 4LKFA 1JUIA 4KH9A 5KC5A 4CUGA 1ASJ1 5A3LA 2GALA 3OCPA 4H2AA 5DPNA 3ST7A 1QJY1 5C8CA 1LGNA 1VBE2 5C71A 1X36A 4KQ7A 3V0BB 1IG3A 1V6LA 1G8WA 1S0JA 3RWKX 3T1LA 2YBPA 5CKQA 4MXWA 5FP3A 4QB2A 3MIEA 5CFCB 5JR7B 5KHIA 1LGCA 4LHKA 4Z8BA 4EWAA 2DCYA 3OYWA 2ZGLA 4FPYA 3ZN4A 1OFNA 3LA3A 4FPLA 1MVEA 3VV1A 5FXXA 2YFZA 2Q1FA 2WQ4A 4L0PA 4TXWA 5F2SA 1Q8VA 1S1AA 2WKKA 2Z4FA 2D6KA 3BTXA 2ZAHA 1UQXA 1ALYA 4JCKA 5EFUA 3WW4A 2O14A 5FYSA 4BQ3A 3C7FA 3JBG3 1E57A 5I0DA 3D4KA 4WZCA 5C7GA 2UYAA 5FZCA 2VTXJ 4D7TA 1EV13 3AKSA 4LEJA 2A3WA 2PHWA 2P5BA 4FOQA 4IE0A 4ISQA 4E27A 1F8VA 1CAUB 2D6NA 3C7OA 2X5IB 4GMP0 1Z0HA 3SCHA 2QZ2A 4AFMA 4F8AA 3AL5A 2GP5A 4OHYA 2AACA 1PVC3 4QPYA 4DMIA 4KWJA 1GOFA 4YVSA 1DLLA 2VBBA 2DYCA 4XFIA 2R0HA 3TEWA 2VH9A 2WNVA 3SC7X 4FFGA 5FY8A 1SLAA 4QX2A 2BP6A 3HNYM 4XBNA 3TWIA 2RHPA 3B00A 2WAAA 4Y4RA 2RJ2A 2IC1A 5DQ0A 2XLGA 4OMDA 2XL9A 2Y6JA 1RUH1 5LK5A 4M0HA 4BXSV 3ZR6A 4BISA 2AEZA 2MEV1 1WA4A 1JYWA 2XG3A 4MSVA 4QQ2A 2WDBA 1XNBA 4IV3B 2JDKA 4UOJA 1AVBA 1EV12 3CLPA 1W3XA 4ISRA 4B7KA 5FZKA 3KT1A 1LECA 1UKGA 5L7OB 1DP0A 3BUCA 3NKTA 4AHYA 4XQWA 5IUQA 3TYJA 2DU0A 2VCMA 1BEV1 5F6KA 5H9RA 1NG0A 2JG8B 2ZGOA 5ABJC 3MI8A 1R1A1 2B46X 2XGXA 3H3ZA 1KFUL 2ZHLA 3LEKA 1FMD1 5EXOA 5LY2A 4D94A 2WZEA 3ZFEC 1JU3A 1X9TA 3TEZA 3N9LA 5FREA 1XQNA 3N7LA 2ENRA 2LALA 2V4VA 5CAZA 3S30A 1SQ4A 4DXZA 2RM23 5LK7B 1AYN2 3IAQA 4DY3A 5KHGA 1WWYA 4LHLA 3AYCA 4LQRA 3GALA 4CU9A 3VBSB 2YYOA 1OT5A 1OUXA 3JCIA 3J7LA 1QKQA 5FYMA 1XPWA 2R042 3VB9A 2DUQA 2FMDA 3E6BA 1LOAA 5KXDA 5BY5A 5JOWA 3Q8AA 4FXGB 3OSDA 1VE0A 4A2UA 3GZUC 1ND2B 4BIFA 3IIIA 2PHXA 4RQPC 2P37A 5G05L 5C4WA 2AREA 1SG3A 2EA7A 2I07B 1Y9QA 4Y24A 2A75A 5KWRA 1HIXA 1QGLA 4IEOA 4IV1C 4AL9A 1LULA 4A7KA 5BNQA 1LOBA 2ARCA 1C8NA 2CL2A 1UX6A 1SZBA 3ACFA 2Y26A 4PT6A 1YFUA 2XBO3 3H8UA 4D6SA 3VBHC 3O0VA 1BZWA 3APBA 1BYHA 3WG3A 4J1XA 5C5TA 2ZGPA 2RJLA 1US3A 1UU4A 2VQUA 3LPFA 4A7ZA 3C2UA 3GJBA 3O1OA 4L11A 1H9PA 4G4FA 4P9IA 3W58A 3V0AA 2YMZA 2NZ9A 3SKVA 3BALA 2HEWF 3RI9A 4EQVA 5B4NA 4AEJA 2WO7A 2CSGA 1YYNA 3B9CA 5BXXA 1IS3A 4HN1A 5IFPA 3AB0A 5KHHA 2Z69A 3CEWA 1WW5A 4HVRA 4LXLA 4YW4A 4GXLA 1ST8A 3SH5A 3THPA 3OGSA 5A3MA 2BBAA 3WQ0A 4WM8A 2ILMA 1VALA 4LKEA 3N7JA 4HN0A 2ZKLA 4Q26A 4LUKA 4K6BA 2E32A 2R16A 4NE9A 4XF4A 4EN6B 3ZXDA 1F5JA 3UGHA 3AKPA 1RUG3 2XBO2 4IE6A 1F5FA 3UJQA 3QOPA 3BU0A 4OQ8A 1W6OB 4MGSA 5LBEA 4QGLA 3E5XA 3ZN6B 4KWLA 2WABA 4L99A 4QQHA 1VPHA 1IZ3A 5A3OA 1J1LA 2CGOA 4CDWA 5JIUA 4RFRB 4PLOA 1GZWB 5DZGA 5A1AA 4MHUA 1WMDA 4CDUA 2NYYA 2BNNA 2WLQA 4LO4B 5IK8A 3SCGA 5FZFA 4CEWA 2YGMA 2Q30A 3KCXA 5FZ0A 3ZO0B 3IM0A 3B94A 3KGZA 3CF6E 3TN92 1QU0A 1YLLA 2ZACA 1AX1A 1GV9A 3EHKA 4NO4A 4JTNA 2W47A 2WJSA 3O5SA 2ZEXA 1QNWA 4XXAA 4PIXA 4FQ4A 3NMBA 3AYDA 1NLSA 4UYBA 5CVRA 3J7MA 3WDWA 1UW8A 3ZFFC 3LEGA 2Q5TA 1LEMA 4IW3A 3DPRA 3ROUA 1QF3A 2Q1MA 4TSVA 3S7IA 4BB3A 2JE7A 2BUKA 1RUNA 2BWCA 2XOMA 3ETQA 3R6SA 5IVBA 2ETEA 2RS33 2LROA 4ES9A 1RHI2 1DCSA 2WA4A 3N9OA 4IE5A 3O0XA 3JUUA 1SMVA 1DQ4A 4FPKA 2BPA2 1YIPA 3PHMA 3ECQA 3MLLA 4RR3A 2K0GA 4F83A 3JD71 1PGL1 4DEVA 1YJLA 3TNQA 1X50A 1PO12 1GR3A 4OMCA 4TLFA 5K0UA 4E9KA 5CFDC 2XVKA 2H6BA 1ZA7A 1BQPA 1MS5A 4A6OA 3I2IA 2BJSA 2XB6C 1BK1A 1WMXA 1HQWA 4U2AA 1WZXA 1YQ2A 4Y1VA 4Y5SA 5LASA 4EN7B 4COZA 3TB0A 3HMYA 3J9SA 2CV6A 1PHMA 2PAKA 3SEEA 2PHTA 4QKDA 2JG9C 3HIFA 1YWKA 1YFXA 1QJX3 4CUBA 1W90A 2OS2A 3RZZA 3NJYA 5GZFA 1RUE2 2VOVA 1PMIA 4EN0A 1GLHA 2XQXA 1DQ5A 2WYFA 2VOTA 5GLWA 1GKBA 1XNAA 4HETA 2P34A 4ASMB 3AZWA 4XJZA 1L7RA 1W6PA 2D5FA 2VNVA 1HRV2 2HWD3 3Q8EA 2DF7A 1TZOA 5FYCA 1B35A 5DN2A 4YW7A 5ABJB 3LOBA 2XKOA 1JZ4A 4JKLA 1DBNA 1ZBE3 3MF9A 4NPRA 3UV9A 1SFYA 1M4WA 1OLME 3ZFGA 2VECA 4K7JA 4CYDA 3IPVA 2VNRA 1GU3A 4HXCA 3MIBA 4BMBA 3BODA 3R4SA 4WVMB 5IWFA 2WWUA 2ZEZA 2VOKA 4QT6A 1FX5A 1V6IA 2E51A 5FO7B 3PVOA 1QJX2 4ZZ5A 2OX0A 3N4MA 1NOVA 1G9CA 1RUD2 4M3CF 1H2LA 1H8TA 1UZYA 3MYXA 1SLTA 1AJKA 1EP0A 1J59A 1HJFA 1QXPA 2J1TA 4QPGA 4NHKA 1HXS2 4YW2A 2WUHA 3DUIA 4AFCA 2VVDA 1C28A 3CL1A 3WUDA 2BEOA 2HWD2 4FAHA 3VUOA 1O3RA 1S0BA 3VZNA 1OSGA 4P08A 5T5PA 5LY1A 1ZBE2 2WN3A 5CG8A 5BNNC 1WBLA 1RUC2 2Q8EA 3WEZA 4ES8A 4Z07A 3I59A 3ZPOA 4IV1B 3AL6A 5BNOC 1OKQA 2QQIA 4XTMA 1PMJX 3LB9A 1HB4A 3PVNA 5BYNA 5J98B 1DU3D 2C5DA 3KB5A 2D6MA 3B69A 4L8QA 4XXPA 1IPSA 2UYBA 3UGFA 3CQOA 3VBHB 3K3OA 5F8PA 3D0SA 3WINE 2HEYF 1ACCA 4CDQB 3OGRA 4BA6A 4Z1VA 5C3RA 1SBDA 2W08A 4XCAA 5FMOL 4E4DX 4AVTA 4MUVA 1W05A 5GZEA 5LB6A 1MVQA 2G1MA 5JMCA 3LEIA 2W91A 2LW8A 3EJKA 2F4PA 3K48A 4XAEA 3SNMA 2WNUB 1QXRA 3MLKA 1CAVB 4QAWA 2D3SA 1V9U2 5EYXA 3WNXA 3HJRA 2WYSA 4N90A 5B4XA 1Z78A 2B5HA 2CU5A 3OY8A 3AVSA 3GNEA 3O7OA 4Q4X3 1MZ6A 3BTAA 3MLJA 1NCQC 1WW4A 3VD4A 1XC6A 1LESA 1ASJ3 1HX6A 3AFGA 3FHIB 5FMBA 1NE6A 2Q8CA 4NWWA 3OPWA 1AYN1 2A70A 3GCXA 1KDMA 4BK5A 3IBMA 1F4HA 1QJY3 3BYWA 3VBOA 2QFEA 4K8FA 4CXWA 1LGBA 1MACA 3ASIA 2AZ5A 2PHUA 3IDEA 2OPWA 2R041 4HSLA 1LR5A 1GOGA 4NUBA 3PJYA 1YC61 4NHYA 5J96B 1O6UA 4LK6A 5DDJ1 5T3NA 3K3NA 5FZOB 2UY9A 2VMDA 4JGYC 4YYOA 1GP4A 2ADDA 1WD3A 4UFMA 1OD3A 3WUCA 4ZPIA 1F15A 1S4CA 2E7QA 2ZGKA 3N35A 3OBAA 5AC92 3I49A 3K51A 5IYYA 4XJ8A 5ANQA 2W87A 1CZVA 5A6ZA 1YI7A 1JZ6A 1QJEA 1ND3B 2EF6A 4ZXKA 5A7SA 1MPXA 2R1BA 3I54A 5IVCA 4ZY9A 3RGBA 3FLRA 4EJRA 1ASJ2 1YNAA 5HV4A 1PM7A 2PHDA 1UN1A 2X8KA 5FPAA 2PQQA 1QJY2 1NT0A 1AR92 1UY4A 3LOIA 4H7LA 1K5MA 1Y7BA 2BQPA 3M7AA 3BVCA 2WIIB 2RJKA 1OBNA 1NX9A 2WR9A 4PI2A 5IW0A 3PU3A 3POIA 1REFA 1SLLA 2CNAA 2G4IA 1WCKA 1OURA 3MF6A 5CA6A 4HT1T 3FBMA 4AI1A 5AFBA 3W5MA 2AUYA 5A3NA 3RZMA 3PTRB 1HB2A 2PXJA 3WZ1A 1C1FA 1TG7A 3KSCA 1E5HA 1NQJA 2VBPA 2RG4A 3PVBB 3NAPB 4JDNA 4CU8A 5C3OA 2GH2A 1E5RA 1UXZA 4CSWA 3ZOIA 1RUH3 2J7MA 5FRAA 1VBC1 1GZTA 1Y4WA 2MEV3 2WL1A 1UL9A 3AZYA 5AFEA 2QDRA 3CO2A 2WBKA 1UYXA 2QQMA 4C91A 4Q4Y1 2FDKA 3T30A 2R061 1SFPA 4OVEA 5CG9A 2B4KA 3LF7A 2ZGQA 5FLJA 2XWJB 5IVEA 2FCTA 1JYTA 1OC1A 1RIRA 5H9SA 5CBLA 3WVJA 4Q0VA 1RITA 2DVBA 3FC0A 3N9MA 1HB1A 1BEV3 4PLNA 1OXCA 2FZ1A 3LA7A 3I3EA 1R1A3 1VBA1 3UJOA 4EN8B 4YLZA 5T54A 4B4RA 2D98A 2VUCA 1FMD3 4AQSA 4WVZA 2R0FA 3AYAA 5I0TA 1KS4A 2E31A 3QH6A 4N53A 5EV7A 2JE9A 3OJBA 3RS6A 1D4M1 2WT2A 4COWA 5A6XA 3WNLA 1VR3A 1AXKA 3NNGA 2J22A 4JAAA 2MEV2 3WNOA 3B3QE 3HBKA 2FQPA 1CPNA 5EJZB 4RFT0 1W2TA 3P3NA 1D4VB 1UXXX 4YVSC 2R49A 4IE7A 3K77A 3FMGA 4YZ5A 3KLSA 3DXTA 1W8NA 2WNVC 1YCIA 1PX4A 1O5UA 1IKPA 4G3YC 3IKWA 5FY5A 1BEV2 5A33A 3RYKA 4AYUA 3N3HA 3ZVXA 5FCCA 1RHI1 4W6XA 5KXCA 4YM1A 1R1A2 4DEQA 3U4XA 1TNFA 1UKRA 1UAIA 3VZOA 1UZZA 2Z79A 3CZJA 1URXA 1FMD2 4KG0A 5HPOA 2HWE1 1U5IA 4SLIA 3CU7A 4Z2WA 1WCDJ 4UWDA 3T0BA 3RRDA 1ZYBA 2R30A 3O1VA 3AMMA 1PO11 1NZIA 2VXRA 1I5ZA 2Y34A 3C8XA 4Z82A 4GWMA 1VP6A 4LNVA 4P9WA 2QQOA 4NMIA 1Z7S2 5BNNB 4DNYA 4FFHA 4I02A 1VMJA 1PX3A 2R32A 3ATGA 4XJWA 4Y33A 3LDRA 4ET7A 1VBB2 1D2SA 4YG0A 1G6NA 3VBRC 3GZTB 1D0GA 2P3YA 3KHCA 4U36A 4AVVA 4GH4C 4I0BA 3WSOA 4E8DA 4ZZ8A 2WT0A 2WWJA 3ZYPA 1GWKA 1QH7A 3WQ1A 1RUE1 4Q27A 4UFLA 1U5XA 2BBVA 4FO9A 5KHJA 2B8MA 3BPZA 1APNA 4N43A 3HNBM 2UWBA 1Q3EA 5CKMA 3H9AA 1GMMA 1KJRA 4MGKE 5EYYA 3JU9A 2W0XA 1YUDA 5C5UA 2GC3A 1QJU2 3BCWA 2OUHA 3DYMA 1H8VA 3T2TA 3VKNA 5L36A 5DUVA 4J1WA 3ZSEA 1GOHA 2AENA 1U12A 1Q8QA 3FLPA 1CZTA 3SH4A 1R64A 3LKJA 4NHXA 4M3CA 5BNPA 2ZAAA 3HR9A 4GWJA 3OD0A 4JRLA 1UY2A 3RZHA 3EO6A 3B9IA 3WY6A 5BV6A 1OUSA 4ZU5A 1RUD1 3POGA 2QNKA 4TLGA 2D3PA 3NRUA 1PK6A 1DGWX 4XACA 3PVEA 3F95A 3TOJA 2P6HA 1HXS1 2EXKA 2WO2A 3Q8CA 1MQTB 1KEXA 2GSYA 2ARXA 1AL21 5FY9A 4JGYB 1LCLA 5ERLA 5C3QA 1LHUA 4QXCA 4JTOA 4QM9A 4IL7A 3WG2A 1O3QA 2XKPA 4R52A 2FD8A 3AFKA 5JSPA 4PIZA 5TSWA 3ZMOA 4EN9B 2HLEA 1JYNA 1YIFA 3SKJE 1F35A 1V6KA 4YWAA 4LE3A 4Y22A 4BQ4A 2HEVF 5GZGA 3LFIA 3AP6A 1PZ8A 1W99A 5GALA 1RJ8A 3PUQA 1AR72 4QX0A 1X8EA 3TAYA 2Y6FA 4C8DA 1K42A 3DGTA 4GKYA 4R8HA 2BRTA 2YHJA 3DL3A 2VU9A 4RS5B 3VBUB 1SPPB 2ET1A 4QU1A 3RPQA 3I2OA 1ENQA 4WM8C 1ZBA2 4C1WA 3POFA 3S0MA 1EAH2 2ERFA 2WSVA 4XFHA 4XFCA 3LEMA 4BQ2A 4Q29A 4XFFA 2H6CA 3KZ4C 2O1QA 3RWNA 3ZKYA 5DXDA 3U1XA 1BHGA 3POBA 3M3IA 5JOZA 3HT1A 3W5NA 1V9U1 3INAA 4YZ3A 2I45A 3NO8A 4OUMA 5L9BA 5HXMA 5J37A 1JYXA 3WF2A 1JZ2A 1COV2 1XJAA 1GICA 1T6GC 1YQ5A 3H3LA 2QQWA 3OGGA 4JRAA 2E26A 4HK9A 4RHV1 3UKVA 5BPXA 3QLQA 3NSTA 1K12A 3DEMA 4CDWC 4LIUA 1MS8A 1RUJ2 2D6OX 3RI8A 2J1VA 1KJLA 1HV1A 4AK3A 1RTVA 4CDUC 4GJYA 2ZX0A 4MXWB 2ZKNA 4CEWC 2VQTA 4JQRA 3OGVA 4HPKB 2WC2A 2XJQA 1XNTA 4CPBD 1SLIA 3NJXA 3JD72 2FCUA 4UFIA 1UZ0A 1KS5A 1W2OA 4YM0A 1YI9A 1HRI1 5F5CA 5AC91 1ZZ9A 2VNOA 1NCRA 1SCRA 2XLAA 5A7OA 1KQRA 3CJIB 1OVSA 3AYEA 2K2SA 3DPRC 1RUF2 2DFCA 1QEXA 4HMZA 4PDWC 3H1WA 4CRQA 4YNIA 1OLQA 2UURA 1LHNA 4LUMA 5E1RA 2EIGA 3NKGA 3USUB 1RXFA 2AC1A 2B42B 4YGCA 1Q5OA 2IVIB 2YU1A 3QCWA 5FFOC 2RS52 1AR91 3E1F1 2WAOA 2YUEA 4XZPA 5F3EA 1DF0A 3W21A 4A6SA 1TME1 2F6BA 1JYIA 2Y8KA 4DXSA 1X7NA 5F5IA 5FOJB 1HLCA 2JD9A 5DG1A 2WNEA 5FP4A 1H1AA 2MHFA 1ODNA 3HEIA 3WP6A 5K0UC 4B4QA 1AR81 1JYVA 1W6QA 4N9HA 3I97A 2KA3A 5ACA2 5D8AB 1JU4A 3MIDA 3N7KA 3OB8A 3HNMA 1NUKA 2RDNA 5EJ3A 4CPBA 2Z2SB 1N47A 2UWCA 1YFWA 4CDXA 3WLUA 4CCEA 3POJA 2OQ6A 2OW4A 5J48A 1QDOA 4CZSA 1JN2P 4FQZA 1AR62 4XUTA 1VAMA 2EAAA 1OMIA 2NPIA 4FTEA 5LCWL 2XJPA 3M3OA 4BQ5A 5FPBA 3VN4A 1STMA 4D8MA 4Q4V1 3WNKA 1ZRCA 4XOGA 1Q56A 2VJXA 3U07A 2QQJA 1PO21 1NYWA 2ZBJA 1IGOA 2JB4A 3BOPA 2WQZC 4Q4W2 4XDPA 5A32B 5C9AA 1OFSA 2HKXA 1ZZ6A 2XJRA 1H9WA 3VBRB 4LOSA 1S2BA 1B35C 4GH4B 4CCKA 3ZYJB 4NIHA 1ULEA 3ZYIB 4PF5A 5CADA 4LULA 1W6NA 3WDVA 4TYSA 1Y9MA 5C6CA 3ZFGC 1C1LA 1XYNA 3VBFA 5JLVA 3M3CA 5FMCA 1W2UA 5FXVA 2OA2A 3RDIA 2VW0A 3DECA 2VL4A 4JGZC 3VZKA 3O1SA 3HQUA 1OQDA 4IEPA 3VZJA 4LHNA 3ZXGA 1FATA 5FPUA 2K9ZA 1POV0 2PLV1 1LTEA 2VG9A 3I2DA 1UY1A 2YPDA 5JSOA 4NIDA 1P8JA 3LDKA 1PMHX 4P02B 2EXHA 2EALA 1OHFA 2DTWA 1JZ8A 3V0BA 3LCPA 3T3YA 2GN7A 4HOOA 4AG4A 1LRHA 4OCTA 1QJFA 4BZ4A 2DV9A 5FUNA 2VVEA 1AYN3 3UGGA 4LOTA 2ADEA 4XBLA 3RG0A 3SHRA 1H8TC 2JJ6A 4XDOA 1IQDC 4AEDC 1H0BA 2XXZA 1SFNA 3IZOA 5CFCA 3NVCA 5FY0A 4QPGC 1CD3G 1NA1C 2YC0A 2R043 2CYFA 2VZQA 4S2GA 4DS0A 2XMLA 3A22A 1CAWB 5JPMB 4LO5B 1CPMA 1S55A 2XJTA 1V6JA 3ES4A 5DDJ3 4UAPA 2PHRA 5F37A 1N3PA 4D7YA 4IESA 2W5FA 3GZEA 1O91A 2W68A 4K1YA 1SACA 4LO8A 5J3UA 1EUUA 1TQ5A 1D0HA 4WM7B 3UETA 1JOJA 3NW4A 3LFMA 1QY4A 2V72A 1HN1A 4FCAA 4UW6A 4C1XA 1CVNA 1H6XA 3FL7A 4P14A 5EJ1B 2OPKA 5GLVA 1QJZA 2G19A 2O0OA 4K1ZA 1Z7S1 3ZSMA 4N8MA 5JZGC 1CAUA 1G9DA 2X5IA 1XNCA 1VBB1 5JCTA 3DXUA 3RNSA 2N7GA 3O14A 4LIVA 3WOGA 1ZVFA 2VUAA 3C7GA 5DAWA 2VE1A 4QB1A 1AL0G 2Y60A 4PBOA 5FPXA 4E4HA 4AW7A 2WA3A 3UKTA 4YW3A 2GU9A 3AP9A 3ZMNA 5FZEA 5DDJ2 4QX8A 1LJ7A 2Y33A 3FLTA 3VDCA 4B29A 4ITCA 4AR2A 2BFUS 4CEYB 3T1MA 4CA9A 2ID4A 4N7UA 1EY2A 1W0PA 2XUEA 2EIDA 5JI9A 1WGPA 1JTZX 1BLZA 2V5DA 5JXIA 4D0QA 4OI2A 4BOWA 5DMYA 1FNZA 5I93A 2E33A 1DFQA 1VBC3 1QJU1 3WR0A 2YC4A 1N3OA 2VTXA 3H1YA 1WBFA 2JX9A 4IV3A 4H3WA 1FPN1 4QM8A 3VBOC 3LGRA 4BQWA 5IVVA 5FP8A 3R4DB 2WS91 4E2QA 2A1XA 2R063 1EPWA 4Q1PA 4QPIB 5L7OA 1D7PM 1PIV1 3KGLA 2HH9A 4RYDA 2Y0IA 1OOPB 5LA2A 2D7FA 4ATFA 1SLBA 2JG8A 2B7YA 2QVSB 1L3JA 2I74A 4Y26A 4TTGA 2HJIA 3H8RA 2DCKA 4EV0A 4XJ9A 4XUOA 4IE4A 3B01A 4C0BA 4IXLA 4MXVA 4LBKA 5J36A 3FE5A 1W8TA 4L2NA 3T2PA 2GNDA 1DZQA 3AM2A 2BTVC 4Q0SA 4LO7A 1IG0A 4AFDA 1Y43B 1D4M3 2XL7A 1DQ2A 3I2HA 5FP7A 5JWPA 1VBC2 3TN93 4YM3A 2XPJA 3E5QA 1S0DA 5FPVA 3VBSA 5A6YA 3D6EA 3RFRA 4FPFA 3BTYA 4Q4Y2 1K5MC 4CCDA 3BIWE 2R062 5FPZA 5K4LA 3A0NA 2R7EB 4LO6B 3EB7A 3M2MA 4NWVA 5AVPA 4OHZA 4CTEA 2RMU1 4PDWB 4DINB 4UF0B 3RMXA 1AR71 3RJRA 1MZEA 2L9LA 1ND2A 2OZ6A 1PM4A 1IKQA 1VBD1 2IXJA 5A7WB 3KQ4B 4IEXA 1RHI3 4Y1ZA 1VBA2 3HVDA 2CHHA 2RDRA 1LHOA 2VQ0A 1K45A 1W9FA 1YO8A 1ZBA1 2HWE3 3BB6A 4AQTA 4GIQA 5LEKA 2QQNA 4B7EA 1EAH1 4A42A 4AVAA 2VZSA 2JDHA 5EHDA 5F3CA 1PO13 1A3KA 1D4M2 3ZYBA 5I0RA 1NXD1 2GZWA 3FBYA 3J8F2 2PYTA 1OA4A 2W95A 5IVJA 4XETA 4XABA 1WCUA 4LBQB 4Q5OA 3CNAA 4QQOA 4QQPA 4LBMA 4CVUA 1COV1 4OLLA 5I8SA 4AGGA 1V6OA 5FWJA 1NKGA 4K9SA 4FBFA 1QIQA 3JQXA 2W1QA 2WFPA 1RUJ1 4RN5A 5HCBA 4BE3A 4AFAA 1RUE3 2CAVA 1XYOA 4V2VA 1G86A 2DCJA 3Q9OA 3IB3A 1UX7A 5I91A 4FTSA 4S2FA 1XB9A 4W65A 3IMMA 5LWBA 3VL8A 1DYOA 4OYUA 2HWE2 1HRV3 1SBEA 2GC2A 5FYUA 3JZVA 2E63A 3AMHA 5A7NA 3LQCA 3U4SA 3UL2A 4A7YA 5FYHA 1G9FA 3M8LA 4XIKA 2CDPA 3MPBA 5C33A 3T2OA 1OLRA 2NLRA 5F5QA 1DGRN 2ZEWA 5FR3A 5F5AA 4JGZB 5SV8A 4JVAA 1W6OA 2PN5A 2RV9A 1RUF1 2IXHA 4H55A 1W8OA 1O8SA 1X9PA 2ZX2A 3C7EA 5EQUA 2HWC2 3ZN6A 1HQNA 3MEPA 4PJYA 3GM8A 4COVA 2QCSB 2RS51 1GZWA 4AI8A 5FZBA 1RUD3 1NLRA 4XHXA 4AEDB 3NNMA 3L2HA 3QACA 3I3QA 1NA1B 1JW6A 2C6SA 4NN0A 2ZHNA 2WFF1 3X29B 1HXS3 2D44A 1EPZA 1XSQA 4UI9L 4KU7A 4OZXA 3FX3A 3GCWA 1OQEA 3O12A 4IETA 3WG4A 1W6MB 2V09A 1AL23 1HN0A 3HQXA 2QE3A 4QGNA 5ACA1 4UBHA 2OT7A 2X29A 4M3CE 3BIEA 2ZGSA 3VDDC 3TRSB 4ZS2A 4GWIA 5APAA 1DQ0A 1RUC3 1X33A 2Y38A 5DUWA 3ZFEB 1N1VA 1RINA 2EXJA 2WZR1 4CCOA 3A21A 5KXEA 1AR61 2ATFA 1AX0A 2A71A 3AP4A 4OHVA 4ZKTB 1XSRA 3KVAA 3OEBA 4BU2A 5EIYB 3NV3A 5KR7A 5FIXA 2QJVA 5IT6A 1EUTA 4Q4W1 2TNFA 3P5BA 4Q8LA 4LLOA 3ACLA 4WV8A 1UOJA 4YVWC 3IDCB 5LRRA 3RZLA 4ZONA 4LLFA 5M0TA 3J4UH 5FZLA 4WVWA 3QH7A 1G9AA 1G9BA 3KT4A 2VMEA 1J84A 2D5HA 4K40A 2W39A 3PJQA 2FDGA 3ME2A 2W1WA 1AL22 2DU1A 3WT3A 4HONA 2VZPA 2A7AA 3DKWA 4BHPA 1V9U3 2AGSA 3WHUA 4RQPB 1W8UA 4LR4A 4X8NA 1A6CA 4MGYE 2VY0A 4BM8A 1WCSA 4XQDA 2IUWA 4G9SB 3DYOA 4YGEA 4RHV3 5LRSA 4BLJA 3FN9A 5FQ0B 1JZ3A 4FT8A 1EYBA 1XYPA 1ZREA 3W59A 4L92A 2DBNA 4QGMA 2ES3A 5GM0A 4NRPA 3PTYA 3AKRA 4QKNA 3J7HA 4AAXA 4CCMA 1HB3A 5F1RA 3I3BA 1REDA 5ABJA 1VIWB 3HQRA 2P6CA 2W2IA 1BBT1 5FY7A 5LA0A 4NIIA 1YXWA 2JDZA 1OI6A 4NHLA 5AC93 3I2GA 2A6ZA 2VNGA 3AJYA 4B1LA 1AYM1 1FOD2 2JXAA 3JBG1 4I01A 4WVMA 3VD5A 3WW1A 3ZSKA 3PMSA 3NV2A 5JSRA 3EQEA 1BKZA 1YFYA 4META 1JUHA 1UIJA 2C24A 2NMOA 4OHWA 3OD4A 4PBPA 4XF0A 1UO9A 3H50A 4B1MA 4EE2A 4RHV2 3MICA 1U5YA 2GC1A 1I6XA 1PVC1 2GH8A 3D0JA 1AR93 4URTA 1LU2A 1UOBA 4ZHNA 4JDMA 2VGDA 4O9GA 4AEMA 3AMNA 3BU7A 3AMPA 3PDQA 1XRUA 4M4RA 5JPNB 5A3UA 4TZDA 2W94A 3BI3A 4CE8A 5FZ7A 3R05A 2J1EA 4GB31 1ZA4A 3ZYFA 2FCVA 2GP3A 1AR83 1D2QA 1JI6A 2GDFA 3IDBB 4R9BA 4BIOA 1SEFA 5IFTA 3ABZA 1DZRA 5IVYA 3V56A 2XVGA 3OPTA 1HRI2 4Y1UA 4EZ4A 3KS7A 2IWGB 1US2A 4QX1A 1DGWA 4IV1A 4AHXA 2QUOA 1W2AX 1ZNPA 2C4XA 1XU2A 3W20A 4ZXEA 2A3XA 3E97A 3V64A 3VBHA 4I2OA 4K20A 4AZZA 3B7MA 1W9SA 4CDQA 3F2ZA 2BGOA 4H7MA 4Q4V3 3ZR5A 3A7QA 3BN6A 4WVVA 1PO23 2QDNA 1I5PA 3ZXFA 2IVJA 4XPVA 3T2QA 1AHSA 3VZLA 3ZFFB 1TME2 2BNOA 4P5YA 4S2HA 1GQGA 3ZDVA 3NV4A 1J3PA 3HN1A 4MGIE 2HWB2 4DRVA 2JKBA 2WNUA 3OG2A 3SLIA 3PIGA 1CAVA 4C90A 3AP7A 4JZRA 1AR82 4ARYA 1NCRC 4B3NA 1O4ZA 2PAMA 3N9PA 5IVFA 5FZDA 3M4FA 2WZ8A 3D8CA 4FOWA 4D6RA 1HJGA 1OPMA 2Y6GA 3JB8A 1JS9A 1XBFA 2ZGUA 5JVVA 2PFWA 4LPLA 1BVVA 2PLV3 3DKQA 3POYA 4HVOA 4NIAA 1YQ6A 4F7ZA 3A4UA 4I3GA 5CFDB 1CONA 5C8CC 2V5YA 4Q2FA 4OHXA 4P9XA 1GQHA 3PIJA 3PMEA 3WP4A 4W6YA 3U37A 2ZHKA 3S7EA 4Q4V2 1UNBA 1Y9GA 4QDQA 3V65A 4Q0QA 1PO22 4OULA 3GGLA 2CY6A 1TNRA 3KQRA 5FZOA 5F3GA 2JDNA 1QXJA 1WLWA 3ES1A 1RUI2 2JG9B 2KM2A 5FJKA 2OIIA 1DLCA 1I1EA 1WMFA 2QKDA 1H1MA 1WLTA 4QPWA 5H9PA 3PLQA 1XE8A 1POQA 1RXGA 4CDXC 1F31A 4JQTA 3WP5A 1ND3A 5KXBA 3RZGA 3Q8BA 5FXZA 5FWEA 3LIGA 3ZXJA 1UPIA 2LRPA 1A8MA 4PIYA 3N9QA 2PLV2 2PMWB 1MEC1 1CZSA 4IEQA 3H42B 2WZPP 3RJ2X 4BJ0A 3J8F1 3VDDB 1Z7S3 5A6QA 1RC6A 1OF3A 3ACGA 3I3DA 4IEYA 2WO1A 5C9AC 1IPJA 2JDMA 2ZHMA 4YW1A 1VBB3 2YB7A 3KV6A 4IGQA 1FT9A 4KBZA 5FMOS 1Q43A 4QXHA 2VCBA 1RMU2 3WNMA 4YARA 4MOAA 5FTTC 2BYVE 1S0GA 2A6YA 3WXPA 4PLMA 3THTA 2DWRA 4YVWB 3NAPA 2H0VA 1E5SA 2Y6LA 3WX5A 4KG8A 3KF5A 2DCTA 4HVQA 2P3KA 4WBBA 5FYVA 4YZ1A 4PQ9A 1S0FA 4DB5A 4JHTA 3HOBA 3CJXA 4FXKB 1N1TA 2DURA 1REEA 1RUG1 2R1DA 1QJU3 1UF2C 3NV1A 1HDKA 1NE4A 4W8JA 5FUPA 3POEA 2VO5A 2J1RA 2NN8A 2DTYA 4YZ2A 2WS93 3FHQA 5FZMA 5CFCC 3LSDA 4UW4A 2FZ2A 1UD1A 5FLIA 2J1AA 4JX0A 3FJSA 1PIV3 2HWC1 2JECA 4DOUA 1O59A 2TUNA 1LENA 3PUAA 4FAGA 5BNOB 4M4PA 4Y20B 2A5ZA 2YPJA 3KT7A 3O0WA 1KGYA 4FPJA 2DBIA 4QD2A 2CTVA 5GKAC 3H8XA 5F2WA 1QOSA 5FXWA 1CESA 2PA7A 1VMFA 3MHZA 3SQOA 1RYYA 4MVTA 4XILA 4DPNA 3B5LB 1UIKA 1H4HA 2GMPA 3MW2A 4GMP1 1UWWA 2O8QA 5F3IA 4XVHA 5FZ3A 1DDLA 4LA2A 2HYXA 5HCFA 2GMMA 2XQRA 3BGAA 1BK0A 1TEIA 2E7TA 2KR2A 2FDJA 2BOIA 2X5IC 1UY3A 1BMV1 4KNCA 4E8CA 3VD9A 1FPN2 2WLPA 2JDAA 1LODA 4MH0E 3WW3A 4CP1A 3CBNA 1J3QA 2XWBB 2WS92 4XF3A 4A3ZA 4XMAA 1JOBA 2F4LA 4UFKA 1KFXL 2NM1A 5A7PA 3SH3A 3ZXLA 1GNHA 1POV1 1PIV2 3ZKUA 1NCQB 2RMU3 1AZDA 3IWZA 5D2AA 2VMIA 4FVVA 1AR73 5T5OA 3H8OA 2HWF2 4WZFA 5LBCA 1XNDA 4Q1RA 5JOYA 2CAUA 3ILNA 4DZGA 4D7SA 5C4WC 4R9DA 3KWVA 4AI3A 2P4EA 1BCXA 1ZBA3 1Q8OA 3OGJA 1AX2A 1FI2A 1EAH3 1RVF1 4P5HA 1CJPA 1CAXB 3H3UA 4LE4A 3RYPA 4V1PA 1IHMA 3W9AA 4EYUA 1JHNA 5BNNA 3KCCA 2G9GA 4GKXA 2W3JA 4BQXA 3AP5A 4UT5A 4DUXA 2WNOA 1W8HA 3HWJA 2ZGMA 4GQ7A 4AVBA 4AF9A 3U10A 3VDBA 1ODMA 4GULA 2HYKA 2E9QA 2JG8C 4J6GA 5JI7A 1COV3 5GLZA 2W9XA 1A8DA 4OI1A 1WKYA 2RMU2 4AWDA 3NJZA 4QHBA 4BLIA 3WD5A 1RUJ3 1V6MA 2ZGRA 3ACHA 5FO9B 1VBD2 1HQLA 2RS11 2XJVA 4CUAA 2ZOEB 1UYZA 1GNZA 4W50A 3LDBA 1VB2A 5FZGA 1XNKA 2XH6A 2IXKA 3DYPA 1R091 3LZZA 4MX3A 3A0KA 3MBWA 4H14A 5KHKA 1GQPA 5HCHA 1MS1A 2ARBA 2VMFA 3JD73 4LITA 3OTFA 3WW2A 2JIGA 3FHAA 1DIWA 3VBSC 1YQ8A 3THDA 4CP9B 1PNFA 1FOD1 1FNYA 3LPGA 3T0DA 5GLUA 1W3VA 4DRRA 2BNMA 3I3MA 3ELNA 1W8ZA 3BOWA 4TWTA 2ZPXA 1VRBA 1RUF3 3BKZA 3D5OA 2Y64A 5I0UA 2VMHA 4GA9A 2JDPA 3VKOA 4ZU4A 3T08A 1VRH1 2C26A 2D3RA 5FK8A 4LBLA 5C8CB 3ITQA 3HD8B 2VTFA 5T5JA 3O1MA 1A78A 3KV5A 2RS53 4RA0A 2ZTNA 1VLNA 5FBJA 5LBBA 4AI0A 2YROA 4LKSA 3OUIA 1MQTA 4D3WA 4NHMA 2Q0AA 3OUJA 5JOXA 1LEDA 2JICA 1H6YA 1JHJA 2WFF3 3KM5A 4JGYA 3S6PA 5CNAA 3OYWB 3WDXA 4AHZA 4AE2A 5ACA3 5DAQA 1QNYA 2PHFA 3K2OA 5DAVA 3L2YA 4AVCA 2X10A 5FZ6A 2FBEA 3NNJA 4Y1XA 3AZZA 2DUPA 4CP0A 2BERA 3MIFA 4FP3A 4BH9A 2WZR3 2YGLA 3OBZA 1YEWA 1AR63 2A6XA 2FMYA 3NQHA 5JAXA 4ARXA 4LT5A 3AX4A 1OD5A 5LA1A 1R081 1U0AA 5LA9A 4AOCA 2SBAA 1NQDA 4R4XA 3QBQA 3SMHA 2IFWA 1MS9A 4M01A 4RS5A 5CYYA 4Q4W3 3VBUA 2DVGA 4GZ9A 1SPPA 5FK7A 3KD4A 2VCAA 5F7UA 3AJZA 3LAGA 3GF6A 3ZLIA 5L19A 4YVSB 4XFBA 4RR3C 2HWB1 2WFF2 2ZGTA 2WNVB 1PZ9A 4HKOA 2B9VA 1W0OA 2E6VA 4YRDA 4W6WA 5EPAA 2XHNA 4RGGA 2BZDA 4O65A 1UYYA 1ZX5A 3ON7A 5C3SA 5DZFA 1H1IA 1IS5A 3POSA 2LTNA 3B02A 3ZM8A 3MIHA 1SBFA 2EICA 2WZR2 3LD8A 1H2KA 2VD7A 2JKXA 3E6CC 1UU5A 5DG2A 4BWOA 5SV5A 4YFZA 1UMHA 1WD4A 4N9IA 2P1BA 3NL1A 2DCZA 3NWKA 5FZ8A 4AI9A 2VMGA 3GBWA 3TBDA 3MFAA 1JH5A 2MNGA 1C8M1 4GJZA 5FO8B 2RR12 4Y5Z0 3EBRA 4NIGA 2GNMA 4HPKA 2VZ1A 4LBOA 5JDBA 1W03A 1RUI1 4CXXA 1S2EA 2W92A 4OFGA 4QKFA 3ZXKA 1HKDA 4BMEA 5LW9A 1VB4A 1FXZA 1BBT3 2VZRA 3IIAA 1LOGA 5FY1A 2ZX3A 3CJIA 1UZVA 2OVUA 5FBZA 4MGTA 1AYM3 3KHBA 5E88A 1GBGA 3O1TA 2LS6A 1ZRIA 4FFFA 4XUPA 3T4VA 4CXYA 2RE9A 4IGOA 3TEXA 2QTWB 3USUA 4UW5A 3SISA 5T55A 3WF4A 3H7YA 2ORZA 2UU8A 4HG6B 1BVP1 1Q8PA 2YV8A 3N36A 4JC1A 1GSLA 4ZU7A 3WNPA 1K3IA 1ZZ8A 3I2JA 4LMFA 1RMU1 1JMUB 5JZGA 1Y3TA 3GXUA 3VHRA 4X6RB 5D8AA 4GB33 4XJUA 2OYZA 1KD7A 4HKLA 5IATA 3VDAA 1BBT2 4FOVA 1O7FA 3BTZA 1LHWA 1IS4A 1SDDB 1S0EA 5L9RA 5C4WB 3S5AA 1XXNA 2R071 1S0IA 3K46A 4M0NA 1AYM2 4AFBA 1ZRDA 3JBG2 3WF3A 4DIQA 2ZMKA 2BWAA 4IQPA 1JZ5A 2J1UA 3ETPA 4D69A 2ZZJA 2NMNA 3ACIA 1UOFA 4R9AA 4KI5M 4CCCA 1RL3A 3MGUA 4MHRA 4RGKA 1F4AA 4XBQA 2KD7A 4IEUA 4AEKA 5A32A 5CISA 1AXYA 1PVC2 2WSUA 1L7QA 2JEMA 3VBRA 4CP2A 2XJUA 4FI9A 1W06A 3N9NA 4GH4A 4FPHA 4AI2A 4KGQA 3OBTA 2Q8DA 1CR7A 4QHOA 3WCRA 4XC9A 3MV01 4I30A 1VAVA 2EVXA 5FYZA 4COUA 3V0AB 1GP5A 4GB32 4E4SA 1NY72 2YZ4A 2W52A 1JBCA 1HV0A 3MZHA 1JODA 2VOXA 2DVAA 2V73A 2DVDA 2FHRA 1OVPA 1V0AA 4KL1A 5FYIA 3ALQA 4WM8B 4V2WA 5GLTA 4QWNA 4NR1A 1MS4A 2ZX4A 4YG6A 5H9QA 2PTMA 3GBFA 3J7NA 1W9TA 4F3JA 4I09A 5G04L 4AXOA 3OPZA 2QQVA 4S2DA 3WNNA 1MS0A 2VZ3A 4Q4Y3 4D6QA 3TEYA 2V4AA 1W04A 2YXSA 1CAWA 1JYCA 3O1UA 4OUEA 3U75A 2D97A 3EXUA 5J7MA 4INDA 1Q8SA 2HWF1 4GAZA 4XFAA 5CB7A 3PUSA 1PNGA 3THCA 1QQP1 3M3EA 4XIOA 3GJAA 4KBBA 5GJ6A 1I9RA 2ZZQA 1X82A 4WM7A 4CDWB 5LEJA 1VBA3 4GD4A 1J1TA 2XLFA 2P17A 4CDUB 1VAKA 4EWDA 1NZCA 3AZXA 3WDUA 4AAPA 1CWPA 4E2SA 1G7YA 4CEWB 1LOFA 1N3QA 4MG2A 3SEPA 2IXLA 1LB2A 4MO3M 5FLHA 1ZZBA 1GZCA 3LWCA 4DXTA 2RM22 1MEC3 2LUWA 3H7JA 2OQ7A 2D43A 3PUIA 4FFIA 2VPVA 1ENXA 1DG6A 4FPOB 3J8F3 4CDQC 3FUOA 1WUVA 2P3IA 2CGNA 2XJSA 3UK9A 4A3XA 5FDBA 2EIBA 2UWAA 2VXJA 1LKNA 2Q8OA 1ULPA 1OQ1A 4I0WB 3DPRB 4DQAA 5FUIA 3UKNA 2ZABA 2QBXA 2WNUC 3K4ZA 5K8SA 2C1FA 4RSUA 3LSEA 3K75B 3MFCA 4CEYA 5JXGA 2IXCA 3R4UA 4CCLA 5D1IA 4QU2A 4QKBA 3H0OA 2ZJCA 4QMAA 3VL9A 4IEVA 4QB6A 3VGIA 4R9CA 2D93A 1S0CA 2EAKA 2ZEYA 3WP3A 4RR3B 4N7IA 5A3WA 2VM9A 4A41A 3HPNA 5K0UB 5FZ1A 4NAOA 1MEC2 2VC9A 4FPGA 2Z42A 4Q8KA 2VZUA 4QQLA 4QPIA 5JXJA 2B45X 4P9GA 5FP9A 4XW3A 1OOPA 3MDPA 3R0RA 1IOAA 1TE1B 3AZVA 2HWC3 2VUJA 3ZYGA 4IERA 1YJKA 3ORJA 3P6BA 5J09A 3MW4A 3S57A 4XURA 4K21A 3GYDA 2X09A 1J83A 3QD6A 2RDSA 4UW3A 4XF9A 4MADA 1ND3C 4MV2A 4LBJA 2QQKA 5HV0A 1ZM1A 1RUOA 4N53C 2VW1A 1W6PB 5A7QA 2VULA 3DF0A 3MUY1 4AGRA 1FV3A 4GMP3 2MPFA 1B35B 4LBQD 5FZ9A 2OKXA 4DO0A 4UFHA 2A3YA 3UT0A 5FKCA 1AJOA 3USSA 3OUHA 4NJ4A 4IUGA 1RUG2 3VD7A 3ZFGB 4L9BA 4XCBA 3IPVB 4Z2AA 4XHBA 5I0SA 3VZMA 1C5HA 4PDWA 3WF1A 1CX4A 4UF0A 4DY5A 4COYA 1TMF1 1T2XA 5F9TA 1ZRFA 3U14A 5IHRA 1M06G 1POV3 1WLCA 1LNSA 5A7WA 1CIYA 2ORXA 3UNPA 5K7PA 5C70A 5EWSA 5AVAA 3Q8FA 2JWPA 4FTBA 4NPLA 3NAPC 1H8TB 2D40A 2W1UA 4Y3OA 3WQBA 2P3JA 2C9KA 4C0HA 5CEHA 2QQLA 4QPGB 4OI4A 5CKNA 3MV11 3N7MA 1SHWB 2CWSA 3LE0A 4OZOA 1UMZA 4JV4A 5EP9A 1RVF3 2ZCWA 3CHXA 3T4HB 2Y0OA 4YGDA 5CU1A 3CZUA 4I0AA 4LBQA 3I7DA 3E6DA 3G7DA 1RJ7A 1SLCA 2R6QA 4CCNA 1BJQA 3JQWA 4LORA 4X8PA 1BMV2 2E7AA 3KV9A 4HFSA 3I59B 1O8PA 1VBE1 2JD4A 3IN9A 1NAEA 5IK5A 2ZS6B 1W28A 1LOEA 2VZVA 4XF1A 4B4PA 2P2KA 3ZIXA 4BPZA 2RS32 1QHDA 2NQYA 1SDWA 1SCSA 3MPPG 4Y4YA 5CZKA 3ZXEA 2IFRA 2X05A 4JKMA 2RR11 3HN3A 5JZGB 2RS13 4ONUA 5JXHA 3KF3A 3LIHA 4ATEA 5DZEA 4N43C 5GZCA 2QQPA 2XVLA 2WINB 3U78A 4KWKA 1IPKA 2YC2A 1PGW2 4P9LA 2ZXQA 1R093 4XJAA 1MS3A 1B09A 4ZS3A 5FZ4A 1RVF2 2PAEA 1O3TA 4JGZA 3AXEA 3M3QA 5D21A 5HXVA 1K5JA 4HL0A 5FY4A 1FOD3 5DUXA 3ENRA 3LA2A 4KU8A 5IAXA 2J42A 2JB8A 1GFF2 3OY8B 1LAJA 5BNPC 2WQ8A 3ZYRA 2BGCA 4YZ4A 3FWEA 2YDEA 4PI0A 1W9WA 1X8MA 3GBGA 4IEZA 2BW8A 2VZTA 1LHVA 4J25A 4NROA 4O7XA 4UBGA 1VRH3 4OQ9A 1O5LA 2BU9A 5I8YA 1UYPA 4OUSA 4AEDA 5HCAA 3VBOB 1W8FA 4DUVA 5FKBA 2TEPA 1NA1A 1PK6C 3KMHA 2TBVA 2RS12 4XQ4A 5F32A 3VKMA 1DGLA 2JE8A 2O8OA 3OOXA 1O3SA 5LZ6A 1W6MA 5FYYA 4HZFA 1YRZA 1QOTA 1VMHA 2WO3A 3D3AA 3WV6A 2B39A 2VCCA 1R092 1CJDA 3OF1A 4HANA 1O4YA 1J3RA 3GHMA 5E6HA 4E4ZA 1CX1A 1LU1A 5F39A 3ZFEA 4P9JA 1WW7A 4PHZA 4O61A 5E16A 1HRI3 1IQAA 1DHKB 1V6NA 4Q0UA 3NNLA 1WMEA 3ZDSA 5C8WA 5FZHA 1EV11 1ULGA 4XUNA 1LOCA 1UZWA 2OXBA 1R083 4K3UA 1QDCA 1VRH2 5FYTA 3UYJA 1JOPA 4JHZA 4AHWA 1K5MB 3I2FA 3FZ3A 4YGBA 3FUQA 1TME3 3WDTA 1ULCA 5C3PA 3ZPYA 3U0ZA 4A44A 4R4ZA 1U5ZA 2H0BA 2SLIA 4P00B 2PHLA 4ORFA 2HWB3 3HAGA 2J1SA 4BK4A 1NY71 2ZGNA 3MIGA 2PQSA 3B93A 4RQPA 4FSJA 3POWA 3FFQA 3DN7A 4XFGA 1WLDA 1GZ9A 1QH6A 2DDUA 2WN2A 5EZWA 4BYYA 4QXBA 1KXGA 3AK0A 5FQ0A 4CUCA 2GNTA 2OUJA 1R082 4UFJA 5FZAA 3GZAA 3VHNA 5LBFA 1C8M3 1GWLA 1MQTC 2JENA 3AKTA 3PURA 4Y1YA 4FPEA 5ANNA 1UOGA 1H2NA 5FPLA 4XZUG 1XU1A 2Y6KA 5F6LB 3H1MA 1AUYA 3IDAA 1RUI3 2EIEA 3GDBA 1GWMA 3SITA 1UMIA 2OZJA 3ZSJA 2GMEA 4Q4X2 5IK7A 1NLQA 4SBVA 2CWMA 4YPJA 4N53B 2XDVA 2FDHA 1ZRRA 2E53A 5DAPA 1OF4A 5CIRA 1C3HA 1GYKA 2DFBA 1TVGA 2GNBA 2XR4A 2RM21 2WWSA 2VOWA 5T5LA 2Q1ZB 2RDQA 1AF9A 1MZFA 4YSFA 3MO4A 3O1PA 5A1LA 3K4AA 4RS5C 3VBUC 5IK4A 1F9KA 3BPSA 2AEYA 5FV3A 4LA3A 1W8WA 3HT2A 1C8M2 3KVBA 2DVFA 4AQ6A 4YM2A 4QX3A 2FDIA 1F2NA 1WA6X 1QOOA 1KITA 4MYEA 1RMU3 2VMCA 3WF0A 4OI0A 3I4IA 1W9YA 5A33B 3CKHA 1OPOA 1RGSA 4DUWA 5IAVA 3AXDA 2YFUA 5E89A 4E2GA 3DCQA 4QX5A 4BQYA 2R073 1C5IA 4FP2A 4KWUA 2W1SA 3U11A 1H30A 5JUVA 2HBUA 1FAYA 3M70A 1GANA 1AXZA 3AC0A 4K8RB 2CGPA 2XBO1 2BVVA 4B8EA 2YU2A 2I2SA 1T6BX 3OBRA 5JR2A 5JMOA 1PZ7A 1JZ7A 2VZOA 1S2KA 3ZFFA 1UY0A 3I8TA 1R1ZA 3OEAA 1QWRA 4FOYA 4JKKA 3RSJA 3RZJA 4EWEA 4LBNA 3VKLA 2VQAA 1YQCA 3GHNA 3AMQA 2LM3A 4YFWA 4AVSA 3NJVA 2JDYA 4NVPA 4A4AA 1MZ5A 3VBFC 1FV2A 2C0ZA 4XMIA 3CJIC 4XE9A 5GZDA 5A3PA 3CDZB 3WQ7A 5J1XA 4N43B 1NXMA 1RUH2 3TN91 4BCUA 1GNYA 2R072 2AH2A 5FYBA 4YW5A 1GUIA 3RYRA 4NAMA 5CFDA 3DV8A 4IGPA 4X6QB 4Q0PA 4ASKA 3URFA 2A73B 1H2MA 4HLTA 3A23A 4XUQA 4P9YA 3WDYA 1ULOA 2G9ZA 1FPN3 3PNAA 4DFSA 4RL7A 4FPCA 2IZWA 2VW2A 3ZN5A 4BDVB 4I3PA 5FMDA 4M3CB 5BNPB 5B2GB 1DGRA 2JG9A 2BOJA 5D8AC 4GWNA 1OH4A 2WT1A 1CGPA 3IAPA 1OA3A 2HWF3 3CMGA 4LJHA 1UCXA 3UESA 5DABA 4QHZA 5A70A 1QQP3 3D82A 1PK6B 4Y5TA 4MLOA 2Y6HA 1CQ9A 5T52A 4KGGA 4XDQA 4YG3A 2ARAA 4PQQA 5DUUA 4EZHA 3J26N 3VDDA 3O1RA 4NPMA 2EXIA 1W2NA 3WCSA 4M00A 3ZIWA 5KC6A 2VVFA 3P3PA 5BUVA 2C9AA 4HKWA 5ISLA 2DUOA 3MW3A 2NP0A 1WCQA 3P1IA 4ASLA 4BQ1A 4PF1A 4Y22B 3KV4A 1H4GA 1RB8G 4HSJA 2BGPA 4CU7A 2YBSA 3VHPA 2HBTA 2RS31 4XAAA 2JDUA 4QX7A 5FAXA 2D6LX 1E5IA 4QDSA 5A1FA 3VD3A 5HBAA 2XHKA 1OA2A 1VBD3 4YVWA 1QQP2 1HRV1 4IDZA 1DYKA 1PGW1 4LKDA 3L9JT 2WRAA 3ZYHA 3HBZA 3WG1A 4IV3C 1BXHA 1DZTA 1PVXA 2YY1A 4YW6A 4Z92B 2VR4A 5A3TA 5L7OC 1V00A 2QZ3A 2VBDA 1OLMA 3IMNA 2FDFA 4EROA 4LTAA 5BNOA 1QJX1 3I2KA 4XYXA 4Y20A 1C57A 4NRMA 1CN1A 1ZZ7A
chains in the Genus database with same CATH topology
2B9UA 2GAUA 4WM7C 4AGVA 4RD7A 1WW6A 1ZZCA 2HWD1 1ULDA 5T50A 4PCRA 1LOFC 3FFZA 4AQ2A 5K9YA 2A6WA 1J58A 3AKQA 1O4TA 1ZBE1 2AR6A 1KRIA 1RUC1 3E5UA 3ZXAC 5I8TA 1MR5A 1N1SA 3G6JB 3SXWA 1DQ1A 1NCRB 3ILFA 4XTPA 1HW5A 1YHFA 5HI0A 2Q4SA 2IXIA 1NCQA 1QMJA 4XEZA 2KXLA 1TMF3 1PGSA 2A6VA 1KDKA 2AYHA 1ND2C 4CEYC 1IS6A 1W39A 2UY8A 1CIWA 1I3HA 4HK8A 3VHOA 5JIAA 3RMYA 5FOBB 1N1YA 1DYPA 3WHTA 3M1HA 3VKFC 2ZX1A 1CAXA 2PELA 1W6QB 2D6PA 4O9EA 3JB4C 3IT8A 1FYUA 1ULFA 2Z5WA 4QPIC 2ZMLA 3RQ0A 1UPSA 1XE7A 4MZUA 4L97A 4QXKA 2BVBA 1C4RA 1OOPC 1ENRA 4CDXB 3TNPB 2ZA9A 2ET7A 1VBE3 5E8AA 1TMF2 2G9FA 3ZX7A 2XUMA 2GC0A 4NOTA 4UXAA 4IEWA 3VLBB 1ONAA 3KCYA 5L73A 2RR13 3SCFA 1DQ6A 5C9AB 2GN3A 4MGZE 2ZMNA 4GALA 1PGL2 1ENSA 1V70A 5KBFA 1UU6A 4RGAA 2X53S 2BFUL 3C3VA 1W6NB 4HBNA 1VJ2A 3VBFB 1JXNA 4JDOA 3ZSLA 4Q4X1 3ILRA 1JUIA 4KH9A 5KC5A 1ASJ1 5A3LA 2GALA 3OCPA 3ST7A 1QJY1 5C8CA 1LGNA 1VBE2 3V0BB 1X36A 4KQ7A 1V6LA 1G8WA 1S0JA 3T1LA 4MXWA 3MIEA 5CFCB 5JR7B 5KHIA 1LGCA 4LHKA 4Z8BA 4EWAA 2DCYA 3OYWA 2ZGLA 4FPYA 3ZN4A 1OFNA 3LA3A 4FPLA 1MVEA 3VV1A 2WQ4A 1Q8VA 1S1AA 2WKKA 2D6KA 2ZAHA 1ALYA 4JCKA 5EFUA 3WW4A 3JBG3 1E57A 3D4KA 4WZCA 2UYAA 4D7TA 1EV13 3AKSA 4LEJA 2A3WA 2PHWA 4FOQA 4ISQA 4E27A 1F8VA 1CAUB 2D6NA 4GMP0 2X5IB 3SCHA 1Z0HA 4F8AA 2QZ2A 4AFMA 4OHYA 1PVC3 4QPYA 4DMIA 4KWJA 4YVSA 1DLLA 2DYCA 4XFIA 2R0HA 2VH9A 2WNVA 1SLAA 4XBNA 3TWIA 2RHPA 3B00A 2IC1A 2XLGA 2XL9A 1RUH1 5LK5A 4M0HA 2MEV1 1WA4A 2XG3A 4MSVA 4QQ2A 1XNBA 4IV3B 1AVBA 1EV12 3CLPA 4ISRA 4B7KA 3KT1A 1LECA 1UKGA 5L7OB 3NKTA 4AHYA 4XQWA 5IUQA 3TYJA 2DU0A 1BEV1 5F6KA 5H9RA 1NG0A 2JG8B 2ZGOA 5ABJC 3MI8A 1R1A1 2B46X 2XGXA 3H3ZA 1KFUL 2ZHLA 5EXOA 1FMD1 4D94A 3ZFEC 5FREA 1XQNA 3N7LA 2ENRA 2LALA 5CAZA 3S30A 1SQ4A 4DXZA 2RM23 5LK7B 1AYN2 4DY3A 5KHGA 4LHLA 3AYCA 3GALA 3VBSB 2YYOA 3JCIA 1QKQA 2R042 2DUQA 2FMDA 3E6BA 1LOAA 5KXDA 5BY5A 5JOWA 4FXGB 4A2UA 3GZUC 1ND2B 4BIFA 2PHXA 4RQPC 2P37A 5C4WA 2AREA 2EA7A 2I07B 1Y9QA 4Y24A 2A75A 5KWRA 1HIXA 1QGLA 4IEOA 4IV1C 1LULA 4A7KA 5BNQA 1LOBA 1C8NA 2CL2A 1UX6A 2Y26A 1YFUA 2XBO3 3H8UA 3VBHC 3O0VA 1BZWA 3APBA 1BYHA 3WG3A 4J1XA 2ZGPA 2RJLA 1UU4A 4A7ZA 3C2UA 4L11A 1H9PA 4G4FA 4P9IA 3W58A 3V0AA 2YMZA 2NZ9A 3BALA 2HEWF 3RI9A 4AEJA 1YYNA 3B9CA 5BXXA 1IS3A 4HN1A 3AB0A 5KHHA 2Z69A 3CEWA 1WW5A 4HVRA 4YW4A 3THPA 4GXLA 3SH5A 5A3MA 3WQ0A 4WM8A 2ILMA 1VALA 3N7JA 4HN0A 2ZKLA 4Q26A 4LUKA 4K6BA 2R16A 4XF4A 4EN6B 3ZXDA 1F5JA 3AKPA 1RUG3 2XBO2 1F5FA 3UJQA 3QOPA 1W6OB 4QGLA 3E5XA 3ZN6B 4KWLA 4L99A 4QQHA 1IZ3A 1J1LA 2CGOA 4CDWA 5JIUA 4PLOA 1GZWB 5DZGA 4CDUA 1WMDA 2NYYA 2BNNA 2WLQA 4LO4B 5IK8A 3SCGA 4CEWA 2YGMA 2Q30A 3KCXA 3ZO0B 3IM0A 3B94A 3KGZA 3CF6E 3TN92 1QU0A 1YLLA 2ZACA 1AX1A 1GV9A 3EHKA 4NO4A 4JTNA 2WJSA 3O5SA 1QNWA 4XXAA 4PIXA 4FQ4A 3AYDA 1NLSA 5CVRA 3WDWA 3ZFFC 1UW8A 2Q5TA 1LEMA 3ROUA 3DPRA 1QF3A 2Q1MA 4TSVA 3S7IA 2JE7A 2BUKA 1RUNA 2BWCA 3R6SA 3ETQA 2ETEA 2RS33 4ES9A 1RHI2 2WA4A 3O0XA 3JUUA 1SMVA 1DQ4A 4FPKA 2BPA2 1YIPA 3PHMA 3ECQA 3MLLA 4RR3A 2K0GA 4F83A 3JD71 1PGL1 1YJLA 3TNQA 1X50A 1PO12 1GR3A 4TLFA 5K0UA 4E9KA 5CFDC 2XVKA 2H6BA 1BQPA 1MS5A 2XB6C 1BK1A 1HQWA 4U2AA 4Y1VA 4EN7B 4COZA 3TB0A 3HMYA 3J9SA 2CV6A 1PHMA 2PAKA 2PHTA 2JG9C 3HIFA 1YWKA 1YFXA 1QJX3 3RZZA 5GZFA 1RUE2 2VOVA 1PMIA 4EN0A 1GLHA 1DQ5A 5GLWA 1GKBA 4HETA 2P34A 4ASMB 3AZWA 4XJZA 1W6PA 2D5FA 1HRV2 2HWD3 2DF7A 1B35A 5ABJB 3LOBA 2XKOA 3UV9A 1DBNA 1ZBE3 3MF9A 4NPRA 1SFYA 1M4WA 3ZFGA 2VECA 4K7JA 4CYDA 3IPVA 2VNRA 3MIBA 4BMBA 3BODA 3R4SA 4WVMB 2VOKA 4QT6A 1FX5A 1V6IA 2E51A 5FO7B 3PVOA 1QJX2 3N4MA 1NOVA 1G9CA 1RUD2 4M3CF 1H2LA 1H8TA 1UZYA 3MYXA 1SLTA 1AJKA 1EP0A 1J59A 1QXPA 4QPGA 4NHKA 1HXS2 4YW2A 3DUIA 4AFCA 2VVDA 1C28A 3CL1A 3WUDA 2BEOA 2HWD2 4FAHA 3VUOA 1O3RA 1S0BA 3VZNA 1OSGA 5T5PA 1ZBE2 5CG8A 5BNNC 1WBLA 1RUC2 4ES8A 4Z07A 3I59A 4IV1B 5BNOC 1OKQA 4XTMA 3LB9A 3PVNA 5BYNA 5J98B 1DU3D 2C5DA 3KB5A 2D6MA 3B69A 4L8QA 4XXPA 2UYBA 3VBHB 3WINE 5JZGA 3D0SA 4CDQB 2HEYF 4Z1VA 4BA6A 1SBDA 2W08A 5FMOL 4E4DX 4AVTA 4MUVA 5GZEA 1MVQA 5JMCA 3EJKA 2F4PA 3K48A 3SNMA 2WNUB 1QXRA 3MLKA 1CAVB 2D3SA 1V9U2 5EYXA 3WNXA 4N90A 1Z78A 2B5HA 3OY8A 3GNEA 4Q4X3 3O7OA 1MZ6A 3BTAA 3MLJA 1NCQC 1WW4A 1LESA 1ASJ3 1HX6A 3AFGA 3FHIB 1NE6A 4NWWA 1AYN1 2A70A 1KDMA 3IBMA 1QJY3 3VBOA 2QFEA 4K8FA 1LGBA 1MACA 3ASIA 2AZ5A 2PHUA 3IDEA 4HSLA 2R041 1LR5A 3PJYA 5J96B 5DDJ1 5T3NA 4YYOA 2UY9A 4JGYC 1WD3A 3WUCA 2E7QA 2ZGKA 3N35A 5AC92 3K51A 4XJ8A 1YI7A 1ND3B 2EF6A 4ZXKA 2R1BA 3I54A 4EJRA 3FLRA 1ASJ2 1YNAA 1PM7A 2PHDA 1UN1A 2X8KA 2PQQA 1QJY2 1AR92 4H7LA 3LOIA 1K5MA 1Y7BA 2BQPA 3M7AA 2WIIB 2RJKA 1REFA 1SLLA 2CNAA 2G4IA 1WCKA 3MF6A 5CA6A 4HT1T 3FBMA 4AI1A 5AFBA 2AUYA 3WZ1A 1C1FA 3KSCA 1NQJA 3PVBB 4JDNA 3NAPB 2GH2A 1RUH3 5FRAA 1VBC1 2MEV3 2WL1A 1UL9A 3AZYA 5AFEA 2QDRA 3CO2A 4C91A 4Q4Y1 2R061 4OVEA 5CG9A 2ZGQA 5FLJA 2XWJB 1RIRA 5H9SA 5CBLA 3WVJA 4Q0VA 1RITA 2DVBA 3FC0A 1BEV3 4PLNA 2FZ1A 3LA7A 1R1A3 1VBA1 3UJOA 4EN8B 4YLZA 5T54A 4B4RA 2D98A 1FMD3 4AQSA 4WVZA 2R0FA 3AYAA 5I0TA 1KS4A 3QH6A 4N53A 5EV7A 2JE9A 3OJBA 3RS6A 1D4M1 2WT2A 4COWA 1VR3A 1AXKA 4JAAA 2MEV2 3B3QE 2FQPA 1CPNA 4RFT0 3P3NA 1D4VB 4YVSC 2R49A 3FMGA 4YZ5A 3KLSA 2WNVC 1YCIA 1O5UA 1IKPA 4G3YC 3IKWA 5A33A 1BEV2 3RYKA 4AYUA 3N3HA 3ZVXA 5FCCA 1RHI1 4W6XA 5KXCA 4YM1A 1R1A2 3U4XA 1TNFA 1UKRA 1UAIA 3VZOA 1UZZA 2Z79A 1URXA 1FMD2 4KG0A 2HWE1 1U5IA 4SLIA 3CU7A 4Z2WA 1WCDJ 3RRDA 1ZYBA 2R30A 3AMMA 1PO11 2VXRA 1I5ZA 4Z82A 4GWMA 1VP6A 4LNVA 4P9WA 1Z7S2 5BNNB 4DNYA 4I02A 2R32A 3ATGA 4XJWA 1VBB2 1D2SA 4YG0A 1G6NA 3VBRC 3GZTB 1D0GA 4U36A 4AVVA 4GH4C 4I0BA 2WT0A 3ZYPA 1QH7A 3WQ1A 1RUE1 4Q27A 1U5XA 2BBVA 4FO9A 5KHJA 2B8MA 3BPZA 1APNA 4N43A 2UWBA 1Q3EA 3H9AA 1KJRA 4MGKE 5EYYA 3JU9A 2W0XA 1YUDA 2GC3A 1QJU2 3BCWA 2OUHA 3T2TA 1H8VA 5L36A 3VKNA 5DUVA 4J1WA 3ZSEA 2AENA 1U12A 1Q8QA 3FLPA 3SH4A 3LKJA 4M3CA 5BNPA 2ZAAA 3HR9A 4JRLA 3OD0A 3EO6A 3B9IA 3WY6A 5BV6A 4ZU5A 1RUD1 2QNKA 2D3PA 1PK6A 1DGWX 3PVEA 3TOJA 1HXS1 2EXKA 1MQTB 2GSYA 2ARXA 1AL21 4JGYB 1LCLA 1LHUA 3WG2A 4JTOA 4QM9A 4IL7A 1O3QA 2XKPA 4R52A 3AFKA 5JSPA 4PIZA 5TSWA 3ZMOA 4EN9B 1YIFA 1V6KA 4LE3A 4Y22A 2HEVF 5GZGA 3AP6A 1PZ8A 5GALA 1RJ8A 1AR72 1X8EA 3TAYA 3DGTA 4GKYA 4R8HA 2YHJA 3DL3A 2VU9A 4RS5B 3VBUB 2ET1A 3RPQA 1ENQA 4WM8C 1ZBA2 4C1WA 3S0MA 1EAH2 2ERFA 2WSVA 4XFHA 4XFCA 4Q29A 4XFFA 2H6CA 3KZ4C 2O1QA 3RWNA 5DXDA 3M3IA 5JOZA 3HT1A 1V9U1 3INAA 4YZ3A 2I45A 3NO8A 4OUMA 5J37A 1COV2 1GICA 1T6GC 3OGGA 4JRAA 4RHV1 4HK9A 3UKVA 5BPXA 3QLQA 3NSTA 4CDWC 1MS8A 1RUJ2 2D6OX 3RI8A 1KJLA 1HV1A 4AK3A 1RTVA 4CDUC 2ZX0A 4MXWB 2ZKNA 4CEWC 4JQRA 4HPKB 2WC2A 2XJQA 1SLIA 3JD72 1KS5A 4YM0A 1YI9A 1HRI1 5AC91 1ZZ9A 2VNOA 1NCRA 1SCRA 2XLAA 1KQRA 3CJIB 3AYEA 2K2SA 3DPRC 1RUF2 2DFCA 4HMZA 4PDWC 3H1WA 4CRQA 4YNIA 1OLQA 2UURA 1LHNA 4LUMA 5E1RA 2EIGA 3NKGA 3USUB 2B42B 4YGCA 1Q5OA 3QCWA 5FFOC 2RS52 1AR91 2YUEA 4XZPA 1DF0A 1TME1 2F6BA 1JYIA 1X7NA 5FOJB 1HLCA 5DG1A 2WNEA 1H1AA 2MHFA 3WP6A 5K0UC 4B4QA 1AR81 1W6QA 4N9HA 2KA3A 5ACA2 5D8AB 3MIDA 3N7KA 5EJ3A 2Z2SB 1N47A 2UWCA 1YFWA 4CDXA 3WLUA 5J48A 2OW4A 1QDOA 4CZSA 1JN2P 4FQZA 1AR62 1VAMA 2EAAA 1OMIA 2NPIA 4FTEA 2XJPA 3M3OA 3VN4A 4Q4V1 1ZRCA 4XOGA 1Q56A 3U07A 1PO21 1NYWA 2ZBJA 1IGOA 3BOPA 4Q4W2 2WQZC 5A32B 5C9AA 1OFSA 2HKXA 1ZZ6A 2XJRA 1H9WA 3VBRB 1S2BA 1B35C 4GH4B 3ZYJB 1ULEA 3ZYIB 4PF5A 4LULA 1W6NA 3WDVA 4TYSA 5C6CA 3ZFGC 1C1LA 1XYNA 3VBFA 5JLVA 3M3CA 1W2UA 2OA2A 3RDIA 2VW0A 3VZKA 4JGZC 3VZJA 1OQDA 4IEPA 4LHNA 3ZXGA 1FATA 2K9ZA 1POV0 2PLV1 1LTEA 2VG9A 3I2DA 2EXHA 2EALA 1OHFA 2DTWA 3V0BA 3LCPA 2GN7A 4AG4A 1LRHA 4BZ4A 2DV9A 2VVEA 1AYN3 4XBLA 3RG0A 3SHRA 1H8TC 2JJ6A 4AEDC 1H0BA 1SFNA 5CFCA 3NVCA 4QPGC 1CD3G 1NA1C 2YC0A 2R043 2CYFA 4S2GA 4DS0A 5JPMB 1CAWB 4LO5B 1CPMA 1S55A 2XJTA 1V6JA 3ES4A 5DDJ3 2PHRA 1N3PA 4D7YA 4IESA 4K1YA 1O91A 2W68A 1SACA 4LO8A 5J3UA 1TQ5A 1D0HA 4WM7B 1JOJA 3NW4A 1QY4A 4UW6A 4FCAA 4C1XA 1CVNA 4P14A 5GLVA 2OPKA 1QJZA 4K1ZA 2O0OA 1Z7S1 3ZSMA 5JZGC 1CAUA 1G9DA 2X5IA 1XNCA 1VBB1 5JCTA 3RNSA 2N7GA 3O14A 3WOGA 1ZVFA 2VUAA 1AL0G 4PBOA 5FPXA 4AW7A 2WA3A 3UKTA 4YW3A 2GU9A 3AP9A 3ZMNA 5DDJ2 1LJ7A 3FLTA 4B29A 4ITCA 2BFUS 4CEYB 3T1MA 4N7UA 1EY2A 1W0PA 5JI9A 1WGPA 1JTZX 4OI2A 4BOWA 1FNZA 5I93A 1DFQA 1VBC3 1QJU1 3WR0A 4IV3A 1N3OA 3H1YA 1WBFA 2JX9A 4H3WA 1FPN1 4QM8A 3VBOC 3LGRA 3R4DB 2WS91 4E2QA 2R063 5L7OA 1EPWA 4Q1PA 4QPIB 1PIV1 3KGLA 2Y0IA 1OOPB 2D7FA 4ATFA 1SLBA 2JG8A 2B7YA 2QVSB 1L3JA 2I74A 4Y26A 2HJIA 2DCKA 4EV0A 4XJ9A 3B01A 4C0BA 4IXLA 4MXVA 4LBKA 5J36A 3FE5A 4L2NA 2GNDA 1DZQA 3AM2A 2BTVC 4Q0SA 4LO7A 4AFDA 1Y43B 1D4M3 2XL7A 1DQ2A 5JWPA 1VBC2 3TN93 4YM3A 2XPJA 3E5QA 1S0DA 3VBSA 3D6EA 4FPFA 4Q4Y2 1K5MC 3BIWE 2R062 5FPZA 3A0NA 4LO6B 5AVPA 4DINB 3M2MA 4NWVA 4OHZA 4CTEA 2RMU1 4PDWB 3RMXA 1AR71 3RJRA 1MZEA 1ND2A 2OZ6A 1IKQA 1VBD1 2IXJA 4IEXA 1RHI3 4Y1ZA 1VBA2 1LHOA 2VQ0A 1YO8A 5LEKA 2HWE3 1ZBA1 3BB6A 4AQTA 4GIQA 4B7EA 1EAH1 4AVAA 1PO13 1A3KA 1D4M2 5I0RA 1NXD1 2GZWA 3FBYA 3J8F2 2PYTA 1OA4A 4XETA 4LBQB 3CNAA 4QQOA 4QQPA 4LBMA 1COV1 4OLLA 5I8SA 4AGGA 1V6OA 4K9SA 4FBFA 3JQXA 2WFPA 1RUJ1 5HCBA 4BE3A 4AFAA 1RUE3 2CAVA 1XYOA 1G86A 2DCJA 3Q9OA 5I91A 4FTSA 4S2FA 4W65A 3VL8A 2HWE2 1HRV3 1SBEA 2GC2A 4A7YA 3JZVA 2E63A 3AMHA 3UL2A 1G9FA 3M8LA 4XIKA 3MPBA 5C33A 1OLRA 2NLRA 5F5QA 1DGRN 4JGZB 5SV8A 4JVAA 1W6OA 2PN5A 1RUF1 2IXHA 4H55A 2ZX2A 3ZN6A 2HWC2 1HQNA 3MEPA 4PJYA 4COVA 2QCSB 2RS51 1GZWA 4AI8A 1RUD3 1NLRA 4XHXA 4AEDB 3L2HA 3QACA 1NA1B 1JW6A 4NN0A 3X29B 2ZHNA 2WFF1 1HXS3 2D44A 1EPZA 3WG4A 4KU7A 4OZXA 3FX3A 1OQEA 3O12A 4IETA 1W6MB 2V09A 1AL23 3HQXA 4QGNA 2QE3A 5ACA1 4UBHA 2X29A 4M3CE 2ZGSA 3VDDC 3TRSB 1DQ0A 1RUC3 1X33A 2Y38A 5DUWA 3ZFEB 1N1VA 1RINA 2EXJA 2WZR1 5KXEA 1AR61 2ATFA 1AX0A 2A71A 3AP4A 4OHVA 4ZKTB 3NV3A 2QJVA 5IT6A 4Q4W1 4Q8LA 2TNFA 4LLOA 3ACLA 4WV8A 4YVWC 3IDCB 5LRRA 4LLFA 3J4UH 4WVWA 3QH7A 1G9AA 1G9BA 3KT4A 2D5HA 4K40A 2W39A 3PJQA 3ME2A 1AL22 2DU1A 3WT3A 2A7AA 3DKWA 4BHPA 1V9U3 2AGSA 3WHUA 4RQPB 4LR4A 4X8NA 1A6CA 4MGYE 2VY0A 4BM8A 1WCSA 4XQDA 4G9SB 4YGEA 4RHV3 5LRSA 4BLJA 5FQ0B 4FT8A 1EYBA 1XYPA 1ZREA 3W59A 4L92A 4QGMA 2ES3A 5GM0A 3PTYA 3AKRA 5F1RA 1REDA 5ABJA 1VIWB 1BBT1 1YXWA 2JDZA 1OI6A 4NHLA 5AC93 2A6ZA 2VNGA 3AJYA 1AYM1 1FOD2 2JXAA 3JBG1