1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
b'MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
3BPZA 2B8MA 2PA7A 4XFFA 3H7YA 1I6XA 1GQHA 4IEQA 3H50A 2K9ZA 4ORFA 3UKNA 4Q0QA 2O1QA 1Q3EA 4ZU7A 4HSLA 4OLLA 4E2SA 2PAKA 5T3NA 4XF3A 4RD7A 1DZRA 2EA7A 2FMYA 5D1IA 1VP6A 1ZRRA 3IDCB 3FZ3A 1HW5A 2KXLA 1IPJA 4FAHA 2C0ZA 3H1YA 2D5HA 2ZKLA 5LEJA 3RDIA 3ETQA 4MV2A 2PHDA 5JCTA 5LRSA 4LLOA 3N4MA 1O4TA 5F1RA 4Z07A 4YYOA 1CAXB 3LAGA 3G7DA 1YWKA 4HN0A 3CF6E 4E2QA 2WFPA 4PJYA 5I0SA 4J1XA 2CGPA 3FHIB 4AVBA 4HVOA 4X6QB 2BNMA 3H9AA 2PAEA 1J3RA 5KHIA 3ST7A 4IEWA 2F4PA 2CV6A 2ET7A 4PIYA 4BH9A 1CAWB 4QX5A 1OD5A 4L11A 1DGRA 3NL1A 5KHKA 3ROUA 2H6CA 1X7NA 2EVXA 4O9GA 4XEZA 4EROA 4MGIE 3USSA 4XFIA 3L2HA 4B29A 5I93A 4IETA 4HBNA 4Z82A 4EV0A 3DKWA 4EWDA 2MNGA 3M70A 1DGWA 5JSRA 2K0GA 2XLFA 4IEYA 3ES1A 3OD0A 3PLQA 4QM8A 4ZU5A 1UIKA 3E5UA 2IXJA 2I45A 3UKVA 5KHHA 4XFGA 1NE6A 4Q0VA 2QJVA 1RUOA 3FFQA 4IESA 2XL7A 4I01A 4XF4A 2D93A 4YNIA 3NVCA 5C8WA 1ZRCA 4D7SA 1Q5OA 2EAAA 4XF9A 3DN7A 3O14A 1NYWA 4KWKA 4HZFA 4QM9A 2XKPA 5I91A 5LEKA 2UYBA 2HJIA 5BXXA 5I8TA 3WW2A 2UYAA 5I0RA 3PVBB 2B9UA 1ZZ8A 3EO6A 3U10A 3QOPA 4META 3CLPA 3ZDSA 1YFYA 4WVZA 3TNQA 1QXRA 3I7DA 3IBMA 2Z2SB 4IEXA 4JTNA 2O8QA 1LKNA 3DV8A 4P9GA 3FWEA 2OZ6A 5I8SA 4LUKA 4AXOA 4EWAA 1ZNPA 4UXAA 3KSCA 5K8SA 1CGPA 1TQ5A 4XETA 3ES4A 1X82A 4XFBA 5JAXA 5JSPA 4IEVA 4EWEA 5J7MA 2QDRA 3SXWA 1ZZBA 4XF1A 3RYPA 1CAXA 2IC1A 1SEFA 4KU7A 2XLGA 1NE4A 2PQQA 1YFXA 3DL3A 3D0SA 2OYZA 2ZCWA 3M3IA 2GC3A 3OGJA 1XE7A 2N7GA 4HMZA 2D40A 2ET1A 3IIAA 5J48A 3ACLA 2QCSB 1CAVB 4Q0UA 3H3UA 1CAWA 3BCWA 4I2OA 1OFNA 2PTMA 1GQGA 1O7FA 2HKXA 4BIFA 3I59B 2XKOA 2XLAA 3OCPA 5JR7B 1X8MA 2Q30A 3S7EA 1CAUB 3LOIA 3KGZA 1J59A 1Y9QA 4LEJA 3FJSA 2ATFA 1U12A 5FQ0B 4AQ6A 4DINB 1ZRDA 1EP0A 2BGCA 1FI2A 4E2GA 4WBBA 1I5ZA 1EY2A 2PYTA 1XE8A 2XL9A 2Z69A 4K8FA 4LA2A 5EFUA 4AVCA 2XHKA 3E5QA 3EQEA 1QWRA 5CVRA 3RNSA 5FDBA 1VJ2A 3FE5A 4KL1A 4KWLA 2OZJA 4F7ZA 4I09A 2PHLA 2MHFA 1ZRFA 3NJZA 1CX4A 3JZVA 3GBFA 4MUVA 2UY8A 4XFAA 2ETEA 2V09A 3B02A 4YRDA 2GZWA 4LA3A 3H8UA 3I54A 3UKTA 3KMHA 3R6SA 4FT8A 2PAMA 4LULA 1H1IA 2IXCA 2UY9A 4BHPA 2QVSB 4IEUA 1PM7A 3WW1A 5FPZA 4KU8A 4H7LA 3HIFA 4WZCA 1ZVFA 4AVAA 3S7IA 2CAUA 1FT9A 1IPKA 2Q1ZB 1O5UA 4J1WA 4Q0SA 2FQPA 5I8YA 5CU1A 1L3JA 4XFCA 3WW4A 3CL1A 1ZZ7A 3E6DA 1OMIA 2XGXA 1Q43A 4JV4A 5JSOA 2MPFA 4ZU4A 3E6CC 4A2UA 5LRRA 1RTVA 3GYDA 4L2NA 3BB6A 5I0UA 1QXJA 1UD1A 3U11A 3BU7A 4LTAA 4HVQA 5BY5A 5KHJA 3WW3A 4JVAA 2VQAA 3IWZA 3NKTA 2H6BA 3MDPA 1LB2A 1X8EA 4UBGA 1EYBA 4IEOA 5BPXA 5AVPA 1G6NA 5CADA 3H1WA 1ZREA 4FBFA 1NZCA 3NW4A 2D5FA 3S0MA 4I0AA 3OTFA 4I02A 1J58A 1WA4A 4N9IA 1UIJA 4R52A 3LA3A 4MGZE 3LA7A 5FLJA 5FCCA 1ZZ6A 3HQXA 2VECA 1RUNA 4YSFA 2GC2A 5HI0A 1WLTA 1J3QA 4HVRA 3I59A 1O5LA 3D82A 1CAUA 4Q0PA 1RL3A 4MX3A 4D7TA 5FQ0A 3CO2A 3SCGA 2IXKA 3RPQA 3U0ZA 3EHKA 1ZZCA 1O3QA 3C3VA 1O3RA 2B5HA 4N9HA 5E16A 1EPZA 4TLFA 2Y0OA 3RZZA 5BV6A 4PIXA 2OPKA 4MGYE 3VHRA 2GC1A 5BUVA 3E5XA 1OI6A 4MZUA 4X6RB 3RYRA 5FPXA 3NSTA 3H7JA 2BEOA 1UW8A 2IXHA 1RGSA 3LWCA 1VR3A 2CAVA 4HLTA 1NXMA 1SQ4A 3FX3A 2IXIA 1DZTA 4Q29A 5EZWA 4CYDA 4OFGA 4IEPA 3OF1A 5FLHA 5I0TA 4YARA 1ZZ9A 4O9EA 3LZZA 2GAUA 5E1RA 1J1LA 3RYKA 1SFNA 4FAGA 4UBHA 3TNPB 3EBRA 1XRUA 4IEZA 3MZHA 3E6BA 2E9QA 4HSJA 1PMIA 3IDBB 1O3TA 4F8AA 1LR5A 4MGKE 4QGLA 4XFHA 3QACA 3HT2A 3EJKA 1H1MA 2BNOA 3KCCA 4HN1A 2BYVE 3PNAA 4XF0A 2P17A 3BALA 4QGNA 4QXKA 2PFWA 4R8HA 1RC6A 1O3SA 3H3ZA 4I0BA 1YFWA 1UCXA 1WGPA 3E97A 3MYXA 1ZX5A 2GC0A 2OA2A 4QGMA 1YHFA 4BYYA 3SMHA 2DCTA 3MPBA 4PIZA 1YUDA 1V70A 3SCFA 2VPVA 2GU9A 3CJXA 1QY4A 2H0VA 2BNNA 1UPIA 4ONUA 3CEWA 2Q4SA 3LA2A 1YLLA 4AQ2A 2IXLA 1JUHA 4IERA 4QMAA 3KGLA 3ELNA 4LUMA 4I3PA 2Q0AA 3SHRA 4JTOA 5KBFA 1YFUA 1J3PA 4GULA 4NVPA 5FLIA 4MH0E 1LRHA 4KWJA 1Y3TA 3SCHA 3H1MA 1FXZA 1CAVA 2WC2A 5C6CA 3D0JA 5J3UA 2GH2A 3HT1A 2QNKA 5KHGA
chains in the Genus database with same CATH superfamily
1S4CA 3ZMNA 3VBFB 1VRBA 3BPZA 3VGIA 2PA7A 2K2SA 4Q4X1 5FXVA 1GQHA 3ME2A 5FYHA 1F8VA 5A7PA 2ZEZA 1REDA 2BQPA 1PVC2 2GN7A 4Q0QA 1CWPA 2RS13 1WLDA 1APNA 2HWC3 4LO5B 4XQ4A 2Q8EA 3TRSB 2D6KA 1H8TB 3A4UA 2CU5A 3OYWA 4JRAA 1AVBA 2VE1A 3HN1A 4XF3A 4ES8A 1DZRA 2JDHA 3PTYA 3VDCA 3D5OA 4SLIA 5ACA3 4K8RB 3KF3A 2ZHNA 1GUIA 3GHMA 5FJKA 1TMF1 3QH6A 1O6UA 1WMXA 1HW5A 1W6OA 2XQXA 1ZBE3 4W8JA 5C3PA 1AR71 3EYPA 2B42B 1A8DA 2ILMA 2B46X 1VBC1 2C0ZA 3JBG1 4OUSA 2BP6A 1RUC1 1EV11 3OUHA 4M0HA 3PUQA 4LBQA 5LEJA 4Q4W2 2RS31 1R1A2 5FZOA 2DCYA 3W59A 4PDWB 5A33B 5JVVA 4XJZA 2YG0A 2PXJA 2P6CA 3PUAA 1G86A 2RR11 3TWIA 3W5MA 1AR61 2ZX3A 5F1RA 2Q1FA 4YYOA 4DXSA 3NNFA 2WFF2 1OVPA 4S2HA 3U07A 5GZGA 4BMEA 3LAGA 3JD72 1KXGA 3CNAA 3NNLA 1RITA 5FY1A 4RYDA 1YWKA 1Y9MA 3CF6E 1XPWA 1HRI2 5CNAA 2WFPA 4PJYA 5LBFA 5J1XA 2JWPA 5I0SA 5FY7A 1XYOA 4HVOA 4Q4V2 2YGLA 1GZ9A 2WZPP 1UWWA 5DUXA 3UK9A 1GNYA 4QHOA 2G9FA 2VU9A 2DFBA 1LCLA 1Z0HA 5KHIA 2Z42A 4BH9A 2QE3A 1POV0 3IAPA 5IYYA 3ZYRA 4RS5A 1WW4A 4DB5A 4RSUA 2XVKA 1C8M2 2ZA9A 4M3CA 2VQ0A 1EAH1 2H6CA 1JU3A 1NXD1 2VMCA 2A73B 2WFF1 2ZGSA 2W5FA 3WDWA 4H2AA 4ZXEA 4EROA 1OFSA 2WN3A 3G6JB 5LW9A 3GBWA 1QH7A 3T30A 1HXS1 1MZ5A 2XHNA 2ES3A 3SH5A 3DKWA 2Y38A 2HH9A 2J1RA 2VCAA 1LTEA 4NIIA 2E7QA 2WZR2 4BQ2A 1XYPA 4AEMA 2X09A 2WA4A 3I2IA 3PU8A 2K0GA 2PMWB 3D4KA 2WS93 1VBA3 1LOFC 1N1VA 1US3A 2CDPA 2XLFA 2HWF3 2Y6JA 3HNYM 4IEYA 2XJUA 5FP4A 2ZGTA 1C8M1 2VOVA 3KCXA 4MOAA 5FYTA 1S2BA 3E5UA 2TBVA 2IXJA 3DPRA 3ZKYA 1VBB1 2VMEA 2ZX1A 2FBEA 4Y1YA 1I1EA 1CIWA 1GLHA 3IIIA 4AK3A 4XDOA 1SLLA 3HNMA 4CUGA 4Q0VA 1S0IA 2ZMLA 4BE3A 1V9U1 4O61A 4MGSA 1Q8QA 1OH4A 3I2JA 2YU2A 5LA0A 4I01A 4U36A 5E8AA 2XJRA 2JX9A 3C7GA 3CZJA 4UFLA 2PLV2 3IPVA 4W50A 4ASMB 3R4UA 4UFMA 2PQSA 5DZGA 3O14A 3J8F3 4HZFA 4QM9A 2BZDA 2WN2A 3KV9A 5FYMA 1DCSA 3WW2A 3I3MA 2UYAA 3BYWA 4PLMA 3SISA 2KR2A 4I30A 4N43C 4LNVA 4I0WB 1S0GA 3W20A 5EXOA 4XJWA 1BVVA 4J6GA 1ZZ8A 3MICA 1CZSA 3EO6A 1JYWA 4META 1YIPA 3ZPOA 2BWCA 4NE9A 2QDNA 2W68A 3RSJA 1KJLA 4UW5A 5G04L 2J1VA 5FMCA 4AE2A 3LEMA 5CYYA 3K3OA 4HG6B 5C9AB 5EJ3A 2EALA 4HL0A 2I2SA 2BRTA 3I2FA 4NHXA 4AFAA 2GNDA 3N7JA 4G9SB 3GZTB 4LJHA 5FZFA 1RJ8A 3DV8A 1PO12 5KC6A 4LUKA 2RS51 1ZNPA 3HVDA 4UF0A 5F5IA 1R082 2PHWA 3NJVA 4COWA 1B35A 3ES4A 5IK8A 4XCBA 3M7AA 2JB4A 4M4PA 3M4FA 3WF3A 4KQ7A 1O59A 1RUI1 2YMZA 1POV3 3HAGA 3LPGA 5L9BA 3SXWA 4QB6A 3K4AA 4CU7A 1R1ZA 1WMDA 4UFKA 2YHJA 3VZKA 1GNHA 3K51A 4KU7A 1RUF2 2RMU2 1YFXA 3FUQA 4P14A 4E4DX 4AI3A 4CP2A 2OYZA 3LEKA 4LO6B 3VZNA 1GWMA 2LROA 3C2UA 5ANQA 1IS5A 2NPIA 4Q4Y2 1VAMA 3M3CA 2HWB3 1H8VA 1MEC2 4HMZA 2D40A 2WUHA 3AMNA 4LK6A 4RS5C 5ABJB 1XNBA 2A6VA 4Q0UA 5IK4A 4XW3A 4A6SA 3AK0A 4URTA 4ES9A 4I2OA 1GQGA 1UF2C 4BIFA 2HKXA 3KV4A 2BOIA 3RJRA 2WR9A 5J37A 4DO0A 4A45A 2XLAA 2J7MA 3WP4A 3OCPA 3LSEA 1V6LA 4PI2A 3ZYPA 1AXZA 5JR7B 3ZXDA 4GWNA 3S57A 2RMU1 2DCZA 2HWC2 2QTWB 3OD4A 3B7MA 3GCXA 3H0OA 3VBHB 5BNQA 4AVTA 3IZOA 2ATFA 5C9AC 1DHKB 5HPOA 3I2HA 4DINB 1OOPA 2FD8A 2BGCA 1H2LA 2LRPA 4NJ4A 3Q8CA 1MEC1 1EY2A 2PYTA 3AP9A 1PO23 2HYXA 4DXTA 4LA2A 4K20A 3DYOA 2VMDA 2VCBA 2XHKA 3EQEA 3R0RA 4B7EA 3RNSA 1IS3A 2D7FA 3AX4A 4A4AA 1DQ5A 2OZJA 5LWBA 3POYA 4I09A 2PHLA 4AAXA 4MADA 2O0OA 1UKRA 4F3JA 4M00A 4YLZA 2ZHMA 1OUSA 2EICA 1NCQB 2RS11 3S6PA 2YBSA 2WT2A 3AMMA 2UWAA 5SV5A 3HEIA 1HQNA 2JDUA 2UY8A 1X9TA 2XOMA 1RUJ1 2AZ5A 1TEIA 3CIHA 5A80A 2XJQA 2JDKA 5ACA1 2GZWA 1UOGA 1QF3A 4LA3A 4RR3C 2Y6KA 3I54A 4CRQA 3KMHA 4FT8A 1HV1A 2PELA 1MS9A 1SBEA 1RVF3 2JG9A 4B3NA 1ZBE1 3ASIA 2SLIA 4IUGA 1V6NA 3PDQA 2R062 4P5YA 3ZXLA 1JTZX 2ZAHA 1XNKA 1W6MB 3HIFA 3MLLA 5FY4A 4BIOA 3WNOA 4DRVA 1ZVFA 4XJUA 2LM3A 2JG8A 1KDKA 2JDPA 2Q1ZB 3PJYA 4TYSA 1W2OA 4AG4A 4FPJA 4PCRA 4LKEA 1NY72 4IV3B 4XFCA 1UY3A 4KWUA 2W9XA 3D6EA 1GZTA 4UYBA 1AR82 2BJSA 1KITA 4XMIA 2XGXA 1Q43A 1H0BA 4JV4A 5JSOA 1B35C 1VRH2 5FYIA 4QX8A 5LRRA 3ZR6A 4W65A 1JZ4A 4NHKA 4FOWA 3U11A 3WOGA 5A7OA 5LK7B 2BVBA 2DUQA 2P3JA 5BY5A 4K7JA 2JDZA 2VQAA 3IWZA 3RZGA 1ODNA 3LFIA 5BNNC 2HLEA 4U2AA 3MDPA 5DZFA 4CEWC 5IAVA 4UBGA 1KQRA 5LA1A 4A7ZA 5D8AB 5AVPA 3VD9A 3ZIWA 3Q9OA 1OHFA 1W9SA 2W94A 3EXUA 1POQA 5F39A 1D2SA 4CDUC 2CWSA 2AEZA 3O5SA 2UU8A 3AMHA 1VBA2 2DCKA 2HWF2 2D5FA 1O4ZA 2H0BA 2VL4A 3N7MA 5A6YA 4PI0A 4I0AA 2WO1A 1VIWB 3ZYFA 3H8RA 5JXIA 2QFEA 4DXZA 3FBYA 2QQIA 4MGZE 2GNBA 3HQXA 5FUIA 2VECA 2WABA 4KH9A 1BJQA 1IKQA 1PX3A 2NMOA 3BTZA 1O5LA 1ULPA 4P9LA 2Z5WA 3CHXA 4H14A 1W0OA 2JEMA 4WM8A 3ZYIB 3VD4A 4CDWC 2X29A 4Q0PA 1RL3A 5GKAC 2B4KA 4IXLA 2WS91 4YM1A 1GR3A 2QZ2A 4AAPA 1REFA 5FQ0A 5C8CB 1QMJA 5T54A 5C33A 4P02B 3AYEA 3NMBA 1PZ9A 4LHSA 4B1LA 5CKMA 3FN9A 5CFCC 3USUB 1SDWA 3D3AA 3EHKA 1NQJA 1ZZCA 4X8NA 1KJRA 1MZEA 4ZZ5A 1O3RA 5L7OA 1TNRA 5IVEA 1VBE2 1YQ8A 1MS5A 3AP6A 3FL7A 3CZUA 1LU1A 2YFUA 4MGQA 2YY1A 3C8XA 4QAWA 5DDJ3 5F6KA 2P1BA 5F2WA 3C7HA 2Y0OA 1FNZA 4WZFA 3RZZA 1XC6A 4GB33 1TE1B 2W0XA 5EV7A 5FIXA 4G3YC 4H3WA 3O1OA 4MGYE 1SPPA 3J8F1 1W8TA 3VZMA 1A78A 2HBUA 2ZMKA 4HKLA 3NSTA 4DQAA 1W8OA 2G19A 5FZ0A 1RGSA 5E6HA 1W9YA 3HPNA 2C6SA 4AHXA 1NXMA 1SQ4A 4XACA 4CTEA 1CONA 3CKHA 2NYYA 3IMMA 1HB2A 3KS7A 4YFWA 5K0UB 2DVFA 1JHJA 2TUNA 2A3XA 1BHGA 5FAXA 3VBOC 4OFGA 2FMDA 5JWPA 1WLCA 4AYUA 3LKJA 5A6ZA 2W47A 4M3CF 3OUJA 4LBMA 3A7QA 5FLHA 2Q1MA 1HKDA 1WBFA 2GAUA 4LE4A 3LQCA 1GSLA 1J1LA 5JZGA 1BMV1 2VC9A 4V1PA 1DGWX 5C4WA 4QKFA 3ZYBA 3GCWA 3JXSA 1C28A 1OLQA 1PIV2 2OQ6A 4XILA 3B9CA 2HWB2 1YIFA 3RZJA 3LIHA 1YJKA 1HLCA 2QQLA 5F3EA 1JW6A 3U78A 2ARAA 4FCAA 4WM7A 2JE9A 1SHWB 5CFDB 2WT0A 3KB5A 3THCA 3VD3A 1V0AA 1VAKA 3CMGA 2X05A 2F17A 1QJY1 1QJU2 5FZAA 3T2TA 4QPGB 1RHI3 1LR5A 1LOAA 2R7EB 4MGKE 3RS6A 3THTA 4E4SA 3OGRA 4B4RA 5BYNA 4TTGA 4LKFA 1AJKA 3ZXFA 3ITQA 4D6QA 4YZ4A 1MQTB 3ZFEB 3J7LA 5B4NA 1LHNA 4HN1A 3OGSA 2BV4A 1ND2C 2BYVE 4CDQC 2VM9A 3BALA 2WNEA 1W9TA 1CESA 2PFWA 1XXNA 3AB0A 4R8HA 5GZEA 5H9QA 2Y6GA 5LBCA 1GV9A 4AI1A 1NA1A 3KT7A 4XJAA 5E89A 1UCXA 1WGPA 2RJLA 1COV2 4D8MA 5BNPB 4Y20B 5C5UA 2WNUB 3GALA 2GC0A 2EXIA 1FV2A 1XU2A 4QGMA 1GP6A 4UAPA 1TNFA 1AF9A 2FDFA 3HQUA 4FPCA 1ASJ2 5FPUA 5FZIA 3GBGA 4PIZA 1VMHA 3IT8A 3NAPC 2AENA 3NO8A 4YZ3A 4FTEA 1VE0A 2RG4A 2GU9A 2H0VA 3UETA 2ADDA 2WZEA 4Y1XA 1NG0A 2BNNA 5FZCA 4LE3A 4ONUA 3LA2A 1GQPA 5A3LA 1ULFA 4WM8C 2ZZJA 5BNOA 1RXFA 4CEYC 3P5BA 2XR4A 2OS2A 2RDRA 1PO21 2WO2A 3VDAA 5JUVA 1ZA4A 1G9FA 3ETPA 4XZUG 2W95A 4JRLA 3SHRA 3MV11 3GZUC 5AFEA 3KT4A 4P08A 4XTMA 1W2NA 4NVPA 4OHXA 2HEYF 3I97A 4QXHA 4XUTA 5FLIA 5FRAA 4MH0E 1PMHX 4P9XA 1ALYA 4JGYB 4E4ZA 5FZLA 1N3QA 3SCHA 4HXCA 4Y1ZA 5L7OC 2WQ8A 2R30A 3PTRB 3MW4A 2WKKA 3WF0A 2RM22 3D0JA 3HT1A 2VG9A 3WNKA 1OQ1A 3JB4C 4RFRB 4EZHA 3ACGA 3O1VA 1MVQA 3H7YA 3B5LB 4YVSC 1H2NA 1AR93 4IEQA 2K9ZA 1W8FA 1NCRA 2XBO3 4L8QA 1C8NA 4ORFA 3ZFEC 3UKNA 3JD73 2I74A 1E5SA 2R1DA 4BPZA 5CISA 4R9BA 2CDOA 2MEV2 3L9JT 4DEVA 1XNDA 3FMGA 1RVF1 2ZGQA 5T3NA 3SH4A 1RINA 2Y33A 3LSDA 1QJX2 2OXBA 2RVAA 2YUEA 2A5ZA 4GH4A 1RUD2 2DBNA 3KLSA 4Q4V3 4WVWA 5D1IA 2E53A 3T0DA 1NOVA 1ZRRA 4O65A 2DVDA 3H42B 3LEGA 3PHMA 3GDBA 1PMJX 2ZGMA 1JU4A 4I3GA 4XAEA 4FXKB 3ZN5A 1G9DA 1YCIA 1YRZA 3MIEA 1C5HA 3AZXA 5KXCA 3POWA 2R32A 3KM5A 1ACCA 5H9SA 3PVOA 1YQ2A 3JB8A 1UNBA 4LBJA 4YM0A 2ARXA 1R092 1WMFA 3KCYA 4AVSA 4DIQA 4LQRA 3VDDB 3ZMOA 4WM7C 4L9BA 3ETQA 3B01A 3ZX7A 4YZ1A 3UNPA 4FPYA 5HBAA 1UPSA 1GNZA 2DV9A 1RYYA 3I3QA 2HYKA 1A8MA 1IZ3A 5FMDA 3VBUB 1UY2A 2L9LA 5F5CA 4NROA 2VUDA 3ZN6B 1K5MA 2LTNA 3RFRA 1CAXB 3J26N 3CJIC 4W6XA 2ENRA 3C7OA 4IL7A 1DDLA 4BZ4A 2C26A 4JAAA 2WA3A 4HN0A 4E4HA 4E8DA 3WQ7A 3RZKA 1UX7A 5GLVA 2Q8OA 4DY3A 4PT6A 3VL8A 5EWSA 2VMGA 1U5ZA 3DXUA 1VBD3 4Q2FA 2WNVB 4HOOA 4X6QB 1JZ2A 2Y8KA 2BNMA 3H9AA 1PGL1 4RQPC 4YW3A 4CXYA 4NRMA 5FOJB 4ATFA 1PGW1 1XU1A 2A6YA 4PIYA 5C5TA 2PLV3 3VHOA 4QX5A 4GKYA 3VBRC 4Y5SA 3NL1A 4TWTA 4NR1A 5DDJ2 2WWSA 5KHKA 2P4EA 2VZPA 3WLUA 1X7NA 5CEHA 2EVXA 4GB32 1LODA 2C9KA 4IV1A 4MGIE 1DZQA 2QZ3A 2X8KA 2YZ4A 3L2HA 4N90A 4OHVA 4XFIA 4B29A 1H4HA 2Z4FA 3QBQA 3ZFFC 4CCOA 1UZZA 3HBZA 2QQMA 3I2GA 1D2QA 2IFWA 4W6YA 3FUOA 1SLTA 4YG6A 5FZ7A 1ENQA 2ZGNA 1W06A 2WAAA 4P5HA 2FCVA 2XXZA 1UL9A 5FKBA 4AGRA 1XBFA 5JIUA 4Q8KA 2WBKA 1PO13 3WF1A 2OIIA 3AMQA 3ES1A 2GP5A 3N35A 5K4LA 1CPMA 2ADEA 3PLQA 4MSVA 3WINE 5LY1A 5LK5A 1DYPA 4ZU5A 3WG4A 3W5NA 4YVWA 3WD5A 4CDXC 1R083 1UZYA 3MIDA 5L9VA 4GB31 5KHHA 1UMHA 3OGGA 2ZAAA 3VBFA 4IESA 1MZ6A 2XL7A 1N3PA 4B7KA 1RMU2 4IE0A 4YW2A 2D93A 5C8WA 4C0BA 1BVP1 4GWMA 1AX2A 4D7SA 3Q8EA 3O1RA 4NHMA 1RUF3 3C7FA 2R042 4XF9A 5JXGA 4KWKA 1NYWA 2D6LX 5I91A 2VTFA 5LEKA 4GALA 5DUVA 5I8TA 1NT0A 2JD9A 5I0RA 2ARCA 3T09A 4JKKA 2ZPXA 1GICA 3IDEA 5FFOC 3ZOIA 2W52A 5AC92 2X5IC 1NZIA 1FOD2 4GJZA 1YFYA 2VOWA 4WVZA 3TNQA 4NIHA 3JUUA 1QXRA 1ZBA2 2QQUA 3JU9A 4IEXA 4EYUA 2RE9A 3I3DA 2XUEA 2WRAA 2HWD2 4E8CA 1JOJA 4BOWA 1WUVA 3A21A 5I8SA 1UO9A 1DBNA 3BN6A 1RHI1 2LS6A 4K1ZA 2VZUA 5FZ9A 1TQ5A 3X29B 4CU9A 4PDWA 2V4AA 2ZHKA 4AQSA 3I4IA 5JSPA 5FZMA 2A3WA 4IEVA 1MVEA 1GWLA 2EAKA 1VAVA 5GJ6A 3TEWA 1ND3C 3MIFA 3PURA 2ID4A 2IC1A 3GZEA 1SEFA 5EPAA 4JC1A 3WNMA 5FP7A 2PQQA 5C3RA 3SEPA 1JZ5A 1PHMA 2VNRA 3TEXA 1BEV2 5FMBA 3VHNA 1PVC1 3M3IA 4QDSA 2FDHA 2ZGKA 3OGJA 3P1IA 3OGVA 4HT1T 4LHNA 2N7GA 2ET1A 1DYKA 2OUJA 3IIAA 5A7QA 3SNMA 4R9AA 1CAVB 2ZABA 5TSWA 3H3UA 2VNVA 2Z79A 3M3QA 4Y22B 3BCWA 3RG0A 1BZWA 2PTMA 1AX1A 4QPIC 3I59B 2UWCA 3U75A 1AR92 2XKOA 5FK8A 1S2KA 2XBO2 4C91A 3B9IA 2OKXA 3V56A 5DAXA 5A1LA 4CUCA 2D3RA 4XUNA 3S7EA 2OQ7A 3WG2A 5LZ6A 2R063 1KD7A 1Y9QA 4LEJA 1GYKA 3FJSA 3NWKA 3ZPYA 4UW6A 1U12A 3Q8FA 1V6IA 2R073 3QLQA 4XPVA 5J09A 3AJYA 4Q4W1 4XQWA 4MLOA 1LEDA 4OMDA 5B2GB 3LF7A 1UXXX 1R1A1 2ZEXA 2QBXA 3AYDA 1XE8A 3J7HA 3MO4A 4N43B 4QX2A 2XL9A 4K8FA 4BLIA 3BIWE 1AR83 1GBGA 3E5QA 3O7OA 1AXKA 4YVWC 4NPLA 3AYAA 4NHYA 1VRH3 3FE5A 4KL1A 5CG9A 4XUQA 2XBO1 4ZKTB 2MHFA 1ZRFA 3JD71 3NJZA 1CX4A 1SBDA 2W1WA 5KXBA 1WBLA 1MS4A 4LBOA 3WQ1A 4FPGA 4LOSA 2BOJA 2DTYA 1HRI1 2VCCA 3ZFGC 4XMAA 5AVAA 2IZWA 1RUNA 4XFAA 2ETEA 3ZLIA 4Q4V1 4ASLA 3ABZA 1LESA 1JYNA 1L7LA 3EB7A 4XQDA 5GZDA 2V73A 2GP3A 4IGPA 3PMSA 4K3UA 3UKTA 3UGGA 2CHHA 2PAMA 3LB9A 1GANA 4HK9A 4LULA 4BMBA 1H1IA 4BXFA 4XABA 3ZYJB 1BK0A 4IEUA 5GM0A 2SBAA 2YC0A 4CU6A 2GNMA 4CPBA 3B00A 5A3UA 2E6VA 2C5DA 1YJLA 5D21A 5FZDA 4BM8A 1SMVA 5FPZA 4A7KA 3BPSA 3DYMA 4YGCA 4YPJA 3VZJA 4RA0A 1VBD2 4AVAA 5IVYA 3LIGA 1FT9A 2D43A 4J1WA 1O5UA 2D98A 3MF9A 4HFSA 2FQPA 4JDOA 3POIA 3BKZA 5CU1A 3T0AA 1L3JA 4Y4RA 3WW4A 2FDKA 3H3LA 2EIBA 1W3VA 2WZR1 4Y1UA 3T3YA 1DG6A 3WG1A 3T4HB 1JOPA 4RS5B 1OUXA 4M3CB 4A2UA 4EN7B 1Q8VA 4LR4A 1RTVA 3VL9A 2HEVF 2ERFA 4TLGA 3GYDA 3BB6A 5I0UA 1GOFA 1UD1A 3SQOA 4HVQA 3GGLA 3WW3A 4JVAA 1Y9GA 3NKTA 1W05A 1S1AA 3ZM8A 1RJ7A 4NOTA 1VBD1 1D7PM 3VLBB 1D0HA 2QQOA 1FMD3 1VBE3 1X8EA 4C1WA 3OEBA 5BPXA 5CADA 2A6ZA 3H1WA 4MO3M 3NQHA 2D44A 3N3HA 2W46A 1ZREA 2YB7A 1W6PA 3RMYA 2WLQA 1GOGA 1UMZA 2PLV1 3LD8A 4FBFA 3T0BA 1L7RA 5G05L 1PX4A 3L2YA 3S0MA 2W91A 3OBTA 3TEZA 3MIHA 4YG0A 3OTFA 4EE2A 3N7LA 1UY1A 2IFRA 3ZR5A 3ZXJA 3LA3A 1KGYA 5FCCA 5FO9B 3H8XA 1BBT2 2VR4A 3K4DA 1JMUB 2Q5TA 3ZSKA 3ZXKA 5FO8B 3KF5A 1LOGA 5CG8A 5C3QA 2VOTA 5JMCA 1J3QA 3LPFA 5KXEA 3WR0A 3T2PA 1XSQA 2DURA 3T2QA 5FXZA 3V64A 3T1LA 4IE5A 4MX3A 4FOQA 3VBHA 5LBEA 1S0CA 3HWJA 3MEPA 1PO11 4R4ZA 3JQXA 2FCTA 1W9WA 4RR3B 4PF1A 4Z2WA 5IK7A 1PIV3 4BLJA 3MLJA 3NRUA 3VBSA 1R081 1WA6X 3RPQA 2JIGA 1O3QA 1JZ3A 4YGEA 3DF0A 2QQJA 3MUZ1 2D6PA 2Y26A 4BQXA 2B5HA 4MG2A 3INAA 2XVLA 3J9SA 4CP1A 1EPZA 1QJU3 2XJSA 1LOCA 3DKQA 2VTXJ 1A3KA 5FREA 3QD6A 1IS6A 3ATGA 4PIXA 1RUF1 1NCQA 1TG7A 2XONA 4WV8A 2DUPA 2TNFA 3OBZA 4JCKA 1UAIA 3VHRA 3WP3A 4MZUA 5LATA 1FV3A 2C9AA 3H7JA 4AQTA 4D94A 1I9RA 4GMP0 1KS5A 2YBPA 5CBLA 1B35B 4Q4Y1 3KHBA 4NO4A 1H1AA 2YV8A 3AYCA 5EYYA 4ARYA 3F95A 3GHNA 1G9CA 1COV3 1NUKA 4V2WA 5EZWA 2WO7A 1DF0A 3ACFA 4XTPA 3VKMA 3VKLA 5FJHA 3DPRC 5FY9A 1D4M2 3KHCA 4PBOA 2JENA 3OF1A 1L7QA 3WNPA 5I0TA 2WNOA 4CEWB 5BNNB 5F2SA 1ASJ3 4LBKA 1OSGA 5E1RA 3OPZA 1H2KA 1QH6A 3RYKA 4CDUB 2CY6A 1VB2A 2HWC1 1AZDA 2AREA 2R1BA 3B69A 3LDRA 4A7YA 4XAAA 1Y43B 2FHRA 1QQP2 4FFHA 3OOXA 2BW8A 1QDOA 5FBZA 2AR6A 3PUHA 2VVEA 3UYJA 3WXPA 1JZ6A 2Y6HA 1ULCA 2P3IA 1XRUA 4IEZA 2G1MA 5EJ1B 1ULEA 2OW4A 1XOYA 3IDBB 1Y7BA 5JLVA 1PZ8A 4F8AA 3BTXA 4R9CA 4EN0A 1LOEA 4CCCA 4WVMB 3SC7X 3SEEA 3UV9A 3ZSJA 4Z92B 1Z78A 2I07B 1H1MA 2YU1A 4CDWB 3ZVXA 3FLPA 2R072 3KCCA 2RM23 3WVJA 3PNAA 4B1MA 4XF0A 2Q8CA 1QDCA 1XQNA 1U5IA 1RUE2 5D8AA 1RC6A 3H3ZA 3U1XA 4YSFA 1HN1A 2P6HA 1RB8G 1ZM1A 2ZS6B 3E97A 1H9WA 1IG3A 1SCSA 2WSVA 1W6NB 4YG3A 1ULOA 5EP9A 5CFCB 2W1SA 1WMEA 4RHV2 1Y4WA 5E88A 2J1TA 1MR5A 4BYYA 2MEV3 3ACHA 3WDYA 2DCTA 1QJFA 2OX0A 4LBQD 4NIDA 3BU0A 5KC5A 2XVGA 2JE8A 1YUDA 1QJX3 1V70A 1QOOA 2AUYA 3LDKA 3SCFA 1RUD3 1SG3A 5IVFA 2WYSA 2E63A 2R061 3SKVA 1X9PA 2XWJB 2Q8DA 3P6BA 1FYUA 3JCIA 5FTTC 5FZ3A 4QT6A 2IXLA 2O14A 3A0KA 1GZWB 2VOKA 1FPN3 1W90A 4QPWA 4XDPA 4XXPA 1NY71 2LW8A 4I3PA 2Q0AA 2NM1A 5FZ8A 3FLRA 4FPLA 5EJZB 4BQ5A 3P3PA 3UJOA 4PLNA 5KBFA 1YFUA 1AR81 1J3PA 1RUG3 2QKDA 2ZGLA 3PL0A 4GULA 2JG9B 3FHQA 5C8CA 1R093 4MVTA 1VRH1 5FYSA 4KWJA 4LORA 4LPLA 3VBOB 1QJEA 2C1FA 4QDQA 3USUA 1F4HA 1WW7A 4D7YA 1OLME 4D6RA 3I2DA 3UGFA 1UMIA 5GLWA 4BK4A 2GH2A 5IW0A 3SMHA 5J3UA 3MUY1 5KHGA 3WP6A 2WL1A 2JG8B 4JGZA 4XFFA 1I6XA 1QNYA 4XHXA 5DN2A 2KA3A 3VD5A 3POFA 1AL22 4MXVA 1MPXA 4HSLA 4OLLA 3UESA 1OOPC 1OLRA 1VBA1 2GH8A 2PN5A 2W3JA 4XBLA 2HWF1 2BTVC 2DDUA 1NLSA 2RJKA 1WD3A 1DQ1A 4A42A 4YZ2A 4N7IA 1CQ9A 1O8PA 2FMYA 2VJXA 4ZS3A 4LIVA 5K0UA 4KG0A 3J7MA 1Z7S2 3B94A 4OI2A 1Q8SA 5T5OA 4AHWA 3FZ3A 1CZTA 3BGAA 4Y5TA 3DEMA 4CCLA 3HNBM 1FMD2 3VZLA 1PK6A 4DZGA 4YZ5A 5A7WA 2KXLA 2Y60A 2P3KA 1IPJA 1HRV3 4Y5Z0 5A32B 3THDA 3RZMA 1ND2B 4CDQB 3RZLA 2FZ2A 3OPTA 4PHZA 1C1LA 1WCQA 2ZKLA 3ZO0B 2G4IA 4AHZA 2W87A 3T4VA 4A3XA 2ZX2A 5A3TA 1YQCA 3RDIA 3WQ0A 1CIYA 1UQXA 1DP0A 4NAMA 1QXPA 1OQDA 1OVSA 1TZOA 1PM4A 2PHDA 3NV2A 5SV8A 4FVVA 2JG9C 5JCTA 5LRSA 3NAPB 1UOFA 4KNCA 3N4MA 2XJTA 1J84A 2VBBA 1O4TA 1PNFA 1FMD1 1JI6A 1VBE1 1H2MA 5FYYA 4X8PA 1LEMA 5FP9A 4WM8B 1AL0G 1KFXL 5IVBA 4LBLA 1AYM3 1G7YA 4JHTA 3MHZA 1BKZA 4CEYB 2JG8C 3RMXA 4E2QA 2E7AA 2VUJA 2YPDA 3Q8AA 5HCFA 5AFBA 3U4SA 1YC61 2FCUA 4J1XA 2CGPA 3FHIB 2WJSA 3N9OA 5JOWA 3IM0A 3LCPA 4O7XA 1AYN2 1J3RA 1RMU3 4W6WA 5FZBA 4Q27A 3HD8B 3T2OA 4IEWA 2ET7A 1MS3A 5DG2A 3PIGA 4Y20A 1CAWB 1V6JA 1OD5A 1LOBA 2D6NA 2DU1A 2JDMA 2W1QA 2WQ4A 2R043 4L11A 1CZVA 5C71A 5F3CA 5L7OB 1POV1 1LAJA 2JECA 3LFMA 2WO3A 5F3IA 2PHTA 3KV5A 1UZVA 3USSA 1K3IA 1OH3A 3NKGA 4IETA 2ZX4A 4YVSB 5AC93 5I93A 1SFYA 1FOD3 4B8EA 4Z82A 1JODA 2AC1A 2MNGA 1PIV1 3M70A 2VO5A 2VZOA 3M3OA 5FYZA 4CCDA 1ZBA3 3WCRA 3DYPA 1N47A 1KFUL 1UX6A 1UKGA 1IGOA 2HWB1 2RDQA 5T52A 3T1MA 4UW4A 2WQZC 5J96B 2VZVA 3V0BB 2HWD3 3UL2A 1N1SA 4NWVA 5CKQA 4OHZA 1VALA 4NWWA 4MXWA 1QIQA 3LEIA 1QJU1 5CB7A 4B4QA 1UIKA 2YGMA 1EPWA 4JGYA 2VUAA 2I45A 1G8WA 5T5JA 3UKVA 4DOUA 3OY8B 1JOBA 3DCQA 1X33A 4JGZC 4P9WA 4SBVA 1NE6A 5C3OA 1RUOA 3FFQA 3I49A 2W2IA 3W58A 5IK5A 1CPNA 1F2NA 1MZFA 2P3YA 4RN5A 3NVCA 4HPKB 3ECQA 1Q5OA 4WM7B 3PMEA 4OI1A 2EAAA 2J1UA 3DN7A 1UN1A 4IQPA 1COV1 4DEQA 2XKPA 2WWJA 2UYBA 5BXXA 2WLPA 1BEV3 2P37A 4LT5A 1LNSA 3AKRA 4GKXA 5ISLA 3ILFA 3N9NA 1BXHA 1SLAA 3WDXA 3K75B 1ASJ1 2B9UA 2R6QA 5HXVA 1I3HA 2BERA 2NMNA 1ONAA 3CJIB 3QOPA 3CLPA 5DG1A 1PK6C 5M0TA 4XVHA 2DBIA 5FYUA 4XDQA 1AR63 4EN9B 5A3MA 3OUIA 2R0HA 1YYNA 5A7SA 3MIBA 2PHRA 4L0PA 3IDAA 4JTNA 2XQRA 4OQ8A 2O8QA 2VZ1A 4IGOA 1ENRA 1OQEA 3MV01 4BQWA 4QQ2A 1VMFA 2W08A 2EXKA 4RQPB 4XUOA 4D0QA 4W4ZA 3FWEA 4EN8B 2OZ6A 4NRQA 5J36A 2PHUA 4AXOA 1NLQA 4EWAA 3VDDA 1HB3A 1WLWA 3O1TA 3S5AA 2X53S 5IJRA 3VBRB 4XZPA 3POSA 3MFCA 3WSOA 2IWGB 5A70A 2HWE3 1E5IA 5JAXA 3AP7A 3DUIA 3VBUA 3P3NA 3K4ZA 1H6XA 1YNAA 4UW3A 4QX7A 5FPLA 2RM21 4ET7A 4EWEA 4QHBA 2QDRA 5J7MA 2XG3A 1S0BA 3ZFFB 4YW5A 3ZN6A 4XF1A 5IVVA 4ZHNA 1CAXA 4GXLA 4INDA 2JXAA 1FPN2 1OKQA 5JZGC 2XLGA 5C4WC 5FZEA 1NE4A 4DMIA 5C3SA 1HXS3 1RUG2 4QU1A 3R4DB 2ZCWA 3ALQA 2GC3A 1FX5A 2MEV1 4IW3A 5JI7A 1E57A 4S2DA 3IB3A 1YEWA 4IGQA 1QJX1 3D8CA 5DAQA 3R4SA 1RUD1 1OXCA 3ACLA 5JPMB 2AACA 4CDXB 4OULA 1DYOA 4YGBA 1E5HA 1MS0A 3J7NA 3POEA 1UYYA 3AZWA 1PZ7A 5A7NA 1OC1A 3WDTA 4AFDA 1CJDA 5DAVA 5LA2A 2VVFA 3RQ0A 4A44A 3AJZA 4CSWA 4CUBA 1C57A 3ZXGA 2D6OX 4XE9A 5CKNA 1CAUB 1WCKA 1LGBA 4Z2AA 3GJAA 3KGZA 1XB9A 1M06G 5FYBA 4COUA 2JIJA 2VMIA 4KI5M 1U5XA 4AQ6A 1R091 1W6QA 2WAOA 1NA1C 2AGSA 2NZ9A 4QQHA 1ZRDA 1D0GA 3WF4A 4GD4A 2OT7A 1FI2A 1US2A 4WBBA 3VDBA 3ZYHA 5FOBB 1HJFA 2VQTA 4AVCA 2X5IB 4FFFA 5CVRA 5FDBA 1HRV2 5FZ6A 5KXDA 4FQ4A 4KWLA 1GZCA 3AZYA 2KM2A 2VULA 5IVJA 3NV3A 3JZVA 1WW5A 1WD4A 5BNOC 4ZONA 4M4RA 2XDVA 5GLTA 1URXA 3B02A 5GALA 1ULGA 4YRDA 1DGRN 5FWJA 1G9AA 1W03A 3GJBA 3MPPG 3H8UA 5L9RA 1XJAA 3KV6A 3R6SA 5DUUA 4AEDA 1QNWA 4GA9A 4BHPA 4DNYA 3RI8A 3BOPA 4AFCA 1W04A 1PM7A 2IVJA 5DDJ1 5DQ0A 1ND3B 4BQ1A 4IE7A 3VV1A 1AYM2 4C8DA 4YW6A 4JZRA 4KU8A 4H7LA 2NQYA 4OYUA 4N53A 4QHZA 1BBT3 3FLTA 3TN92 4FTBA 4S2GA 2CAUA 4YW1A 4Q0SA 1NCRC 2VMHA 3VKNA 5LA9A 5I8YA 5A1FA 3WF2A 1W2TA 3AL5A 1ZZ7A 3CL1A 5J98B 3NNJA 3E6DA 3JQWA 1MS1A 4D69A 1W8NA 1ODMA 1RUH2 2MPFA 4P00B 1R64A 4CP9B 1H8TA 4GH4C 3I3BA 4E27A 3E6CC 3TEYA 4L2NA 4UFJA 1QXJA 2VBPA 3OG2A 4QPIB 2YFZA 4JQTA 1W3XA 3BI3A 2V72A 2RJ2A 3WUCA 1QOSA 4LTAA 3N9LA 1TME2 1DQ2A 4NRPA 2XJVA 2H6BA 2WINB 5DPNA 1S0DA 1LB2A 3DGTA 2ZEYA 2HEWF 1EYBA 3F2ZA 3HOBA 4IEOA 1LJ7A 4GAZA 1RMU1 1Q8PA 1E5RA 1PVXA 4N7UA 5FZKA 2JE7A 4OZOA 3TYJA 1NZCA 5H9RA 3NW4A 2R041 1HX6A 4ASKA 3CDZB 2E33A 5C70A 1O8SA 5FXXA 3O0WA 5CAZA 5F37A 5JXHA 1LOFA 3VHPA 1WA4A 4N9IA 4OHWA 2GDFA 4YVWB 4AEKA 3VUOA 2R49A 1DU3D 5A33A 1TMF2 5FLJA 5AC91 4Y22A 1FOD1 3M1HA 1ZA7A 1K5MC 2GC2A 1U0AA 3SITA 1AR72 1PGSA 1UZ0A 1WLTA 4AI2A 4HVRA 4EN6B 3I59A 4AZZA 3MGUA 1Q8OA 1ZBA1 3D82A 4FFIA 3UGHA 5DMYA 3ZFGB 1D4M3 3ILRA 5FWEA 1VBC2 1JYXA 3JBG2 2VAUA 2Y0IA 1H6YA 4XXAA 2JKXA 2HBTA 4CCMA 1RUC2 1EV12 2HWD1 2WIIB 4BQ4A 3AMPA 3TBDA 2CL2A 2RS32 1ENXA 2C4XA 1RUJ3 3NJYA 2EXHA 1QQP3 5ERLA 3SCGA 2D97A 5EYXA 4UFIA 2IXKA 4ZXKA 4N43A 4V2VA 2RR12 4AFMA 3U14A 3WV6A 1AR62 2D3PA 2A70A 5FV3A 4ISQA 5F5QA 1K12A 4BWOA 4B4PA 1QGLA 5E16A 2B9VA 2XJPA 1KDMA 4IV1C 4AW7A 3WNXA 4TLFA 3WEZA 4K9SA 4YW7A 5BV6A 3N9QA 2ZMNA 1WW6A 2OPKA 4NIAA 4KMQA 2GC1A 1OI6A 3RYRA 4X6RB 1BEV1 4AI8A 3OYWB 2BEOA 3KWVA 3O1MA 2IXHA 1IS4A 2BWAA 3HJRA 4QQLA 5DAWA 2VNGA 1QKQA 1VR3A 1W8HA 2CAVA 2HWE2 1RUE3 2J1AA 4HLTA 4LIUA 2XPJA 4AEDC 4H7MA 3BTAA 2BFUS 2ZGPA 4LO7A 3S5QA 5DXDA 5GZCA 5JOXA 1DZTA 2JB8A 2JJ6A 4RFT0 5FY5A 3H8OA 1JHNA 2W1UA 4IEPA 1EAH2 1W6OB 1DQ6A 1N1TA 1W9FA 4RHV3 3PIJA 4XC9A 2QQVA 4N53C 1WKYA 2ORZA 4YARA 1AR91 4ZZ8A 4O9EA 2WYFA 3LZZA 1HXS2 1CX1A 3RRDA 5LCWL 2B45X 3VBFC 2WWUA 1DLLA 1VMJA 5FBJA 2Y34A 3WP5A 4CP0A 4LBQB 1F5JA 3RWKX 3TNPB 4DFSA 4DRRA 1PNGA 5FZOB 1SLIA 3EBRA 5CA6A 2B39A 2HWE1 3MZHA 1F35A 1H8TC 3E6BA 1PMIA 3KT1A 4KBBA 5T5PA 2A1XA 2RV9A 4DUVA 3WZ1A 5L36A 2BGOA 3N36A 4QGLA 1JN2P 4Y24A 4GWJA 1VBB2 4LLFA 3QACA 2ZGOA 4LITA 2A7AA 4Q8LA 3HT2A 3VN4A 3EMRA 4ARXA 1V9U2 2VBDA 5LB6A 1J1TA 2JDNA 3NNMA 4CU8A 4QGNA 1OD3A 2A3YA 4MHRA 4QXKA 4KGGA 5C9AA 3VB9A 4EZ4A 2DVGA 4NAOA 4Y4YA 1YFWA 4AVVA 5KR7A 1NLRA 3AVRA 3BODA 3MYXA 3R05A 4FPOB 1AL23 2WT1A 5K9YA 3AFGA 5JPNB 1JYTA 1YHFA 3I8TA 4PDWC 2DVAA 5IATA 2VXJA 2QQNA 2D3SA 5GZFA 3O1SA 1CJPA 4BQ3A 4WVVA 3AFKA 4LBNA 4FOYA 3CJXA 3ENRA 3WDUA 2DU0A 4Y1VA 3BUCA 3PUSA 3I2OA 1Z7S3 4HKOA 2EIEA 4AWDA 2XH6A 1I5PA 5D2AA 5FUPA 4IERA 3TB0A 3ZSEA 3KGLA 1C3HA 3A22A 1RXGA 3AKSA 4A3ZA 1S55A 5HXMA 2PHFA 4LUMA 1BLZA 1NX9A 3E1F1 3BTYA 2RS52 4JTOA 3WUDA 2YPJA 4LO8A 4XEZA 4COYA 2X10A 3B93A 3ZYGA 5EIYB 5JOZA 4RR3A 1GKBA 2ZACA 4LKSA 5IT6A 3RVHA 1LRHA 1D4VB 2FZ1A 5IAXA 2WDBA 4QX3A 3DPRB 1J83A 1X36A 2XUMA 5ABJA 1GFF2 5IVCA 4FXGB 4PQ9A 4AEJA 2CNAA 5JDBA 3AZZA 3NNGA 1RUI2 2VVDA 2DWRA 2QNKA 3O12A 2FDGA 4FFGA 4GJYA 1F9KA 2VZTA 2B8MA 3WNNA 4JHZA 5DUWA 4A41A 3NV4A 1OT5A 1IKPA 2VZ3A 3H50A 1IG0A 3V0AB 3IPVB 5A3OA 4LO4B 2O1QA 1Q3EA 2QQKA 4OI4A 4UT5A 4ZU7A 2PAKA 2W92A 2UWBA 1ZRIA 3KVBA 4M3CE 1HQWA 4QPYA 4RD7A 5FMOL 2EA7A 3T08A 1XNAA 1LGCA 1VB4A 4LXLA 1VP6A 4NPMA 2CYFA 1V00A 1AYN3 3V65A 3IDCB 1W2AX 4BDVB 1BBT1 1JYVA 1QJY3 3LDBA 4YM3A 1JZ7A 2VNOA 4FAHA 3URFA 4CEWA 4EQVA 5BNNA 1DQ4A 1K5JA 1VPHA 2AEYA 4QQOA 2R16A 1W6PB 3H1YA 2A6WA 4QB1A 4CDUA 4DUXA 2D5HA 3BIEA 2D6MA 1LHVA 3WHTA 1RIRA 3MBWA 4NPRA 3ZSMA 4UF0B 4BQYA 5L19A 4UFHA 5FYCA 4MV2A 3VZOA 2ZEWA 5FY0A 2ZOEB 4OUMA 5HCHA 4IDZA 4OZXA 2F6BA 3IN9A 2F4LA 4LLOA 4BISA 4E9KA 1X50A 4JX0A 2BBAA 3FHAA 4Z07A 4AFBA 4AI0A 5HCAA 1QU0A 2CGNA 4YWAA 3VD7A 4WVMA 4H55A 2P5BA 3G7DA 3ZKUA 1OLMA 2RS12 2VMFA 1WZXA 3Q8BA 5FK7A 5IHRA 2A6XA 1W6MA 4CDWA 2BPA2 2KD7A 2NP0A 3RJ2X 1F4AA 1FATA 2JICA 2VUCA 3PUIA 1RUJ2 5FY8A 1OURA 4AVBA 1NQDA 1STMA 5ACA2 1M4WA 3VBSB 3K48A 1LENA 2PAEA 4IV3A 4JDNA 3OEAA 1N3OA 1JBCA 3ST7A 2F4PA 2CV6A 1W6NA 5CFCA 3MFAA 1IHMA 3TAYA 1WCUA 1SDDB 4CE8A 1DGRA 1ZBE2 2BDRA 3FC0A 1S0JA 2XB6C 3WT3A 1N1YA 1DIWA 1TVGA 1W8UA 2YDEA 3ROUA 3GF6A 1D4M1 4O9GA 4FQZA 3U37A 1SZBA 2A75A 4HBNA 4HKWA 4S2FA 3ZN4A 2DCJA 4QB2A 3NV1A 1VLNA 2WZ8A 4P9JA 4EV0A 3PU3A 4EWDA 1OPMA 4QXBA 4CXWA 1DGWA 1JZ8A 4K40A 2OPWA 1QQP1 1OOPB 1IQDC 1GZWA 2GN3A 4GIQA 4XIOA 3AXDA 1GOHA 5JSRA 2ZHLA 1LU2A 4FPFA 2W39A 1NKGA 3FBMA 4PF5A 1KEXA 4LKDA 5T50A 1OF4A 3OD0A 4QM8A 5FYVA 4J25A 3OBRA 4QX1A 5GLZA 1ST8A 1UOJA 3VBOA 5A3NA 5ABJC 1EUTA 3I2KA 1CN1A 4XFGA 2QJVA 4ITCA 4XUPA 2R071 4CCJA 1K42A 2YYOA 2A71A 2DVBA 2EF6A 3I3EA 4XF4A 1RUE1 4YNIA 1ZRCA 3VBHC 3MW3A 4YGDA 2FDIA 4P9YA 2E31A 3K3NA 1U5YA 3MLKA 4QWNA 4ZS2A 5FZ4A 5F9TA 1W28A 2V4VA 4JKLA 2HJIA 1Q56A 3LGRA 3VBSC 1H4GA 1LHOA 4RHV1 1XNCA 3BOWA 3PVBB 1HQLA 1YQ5A 5CZKA 5HV0A 4YW4A 5FZGA 4GMP3 3U10A 1S0EA 1OKOA 1SLBA 4OVEA 3ZDSA 3AZVA 4IE6A 5FR3A 2VCMA 2YC2A 3RI9A 3I7DA 2VZQA 2BBVA 3IBMA 2Z2SB 4AGVA 4ATEA 3POBA 5A32A 1XNTA 1BK1A 1ND2A 5APAA 4KG8A 4CDQA 5GLUA 1NCQC 1WCSA 4E2SA 5FZHA 1LKNA 1WWYA 2WS92 4P9GA 2AH2A 4Y3OA 5FUNA 2VTXA 1W0NA 2EIGA 2K46A 3GNEA 5FXWA 4DY5A 1H30A 4XCAA 4BB3A 4MHUA 4HONA 3WY6A 3FFZA 4UXAA 3KSCA 3N9PA 1KRIA 4R9DA 5K8SA 1CGPA 1W39A 3WDVA 4BCUA 1W0PA 4XETA 4URAA 2XWBB 3NJXA 2V5YA 2J1SA 4BK5A 1X82A 4XFBA 4XURA 2DUOA 1DGLA 1HJGA 2O8OA 4FPHA 1JUIA 4CCEA 3NAPA 4K21A 1YO8A 4AOCA 2VOXA 1V6KA 4Q5OA 4XJ8A 1JH5A 1ZZBA 4XYXA 4FTSA 2VD7A 3RYPA 4PLOA 4CPBD 3AKPA 2DF7A 3SKJE 3U4XA 2UURA 3DL3A 3J8F2 4AF9A 4CEYA 3D0SA 3RZHA 5B4XA 1AL21 5C7GA 1UZWA 2JKBA 4IV3C 5JMOA 1XE7A 1HV0A 4QXCA 4CVUA 4NUBA 1QOTA 4NIGA 3A0NA 1CVNA 4FPEA 4XBNA 3KQ4B 2BUKA 4C0HA 5J48A 2E51A 4HANA 2QCSB 5CFDA 3APBA 1CAWA 4RGGA 4M0NA 1UY4A 2GMPA 1OFNA 1MS8A 4XJ9A 1O7FA 3ILNA 1Z7S1 3AXEA 2GNTA 3WX5A 4R4XA 4JGZB 1UYZA 4QPGA 5FPVA 3S30A 1B09A 1AHSA 1BMV2 1X8MA 1YI9A 2Q30A 2VXRA 4YVSA 4CXXA 1ZYBA 4Y33A 3LOIA 3VKOA 1MQTA 3ZFEA 1J59A 1IQAA 3OSDA 5A6XA 2GALA 5D8AC 3AKQA 5FQ0B 3HN3A 3POGA 2BFUL 4RGKA 3TN93 2CSGA 3TOJA 1EP0A 4JDMA 4E2GA 1OA2A 1I5ZA 2Y6LA 2QQWA 3UJQA 3K46A 1W8ZA 2Z69A 3ZSLA 3AL6A 3V0BA 5BNPA 5EFUA 2WNUA 1QJY2 4GQ7A 1SLCA 1QWRA 4TN7A 1T6BX 1PK6B 1VJ2A 1RUH3 2AYHA 5A7WB 4OI0A 1CD3G 4F7ZA 1GU3A 3GM8A 4OUEA 4JKMA 2RDSA 1UYPA 1QHDA 2CGOA 3OY8A 3M8LA 3SLIA 3LE0A 3WCSA 5A3PA 5F5AA 1TME3 5JOYA 1SPPB 2ZBJA 3GBFA 5LBBA 3POJA 4QQPA 4MUVA 4Q4X3 1CR7A 1JS9A 1SBFA 2V09A 4HK8A 4HPKA 4XBQA 5F6LB 4AI9A 4QDRA 3K2OA 1F15A 1AYN1 5FP3A 2RHPA 4QX0A 5C8CC 2OVUA 2PHXA 1OBNA 2J1EA 5IUQA 5F7UA 2NLRA 3BVCA 3J4UH 3WNLA 3AVSA 3HMYA 2IXCA 2QUOA 2UY9A 3GZAA 2QVSB 4QD2A 3MF6A 4KGQA 2G9GA 3WW1A 4LMFA 1NAEA 4UOJA 4GZ9A 2JD4A 3CJIA 3UT0A 4XOGA 1LHUA 5JZGB 2DFCA 1TMF3 4FP3A 3ZXEA 5LASA 4D3WA 5C4WB 1HDKA 4WZCA 3AKTA 3S7IA 1IPKA 5ANNA 1AR73 4EJRA 4N8MA 1BYHA 2FDJA 1PO22 3LOBA 4FOVA 4RGAA 1P8JA 3CU7A 3KVAA 1VBC3 1KS4A 2LUWA 3JBG3 4RQPA 4RL7A 5CIRA 1OMIA 4OQ9A 1PVC3 3ZXAC 1W8WA 1RUC3 4ZU4A 1EV13 4CA9A 1H9PA 4GWIA 5F8PA 3VBRA 4A6OA 4TZDA 2RS33 5H9PA 5K0UC 1DQ0A 3BU7A 4QKBA 1V6MA 5KHJA 3AC0A 2YBKA 5EHDA 4OHYA 2RR13 2VW0A 2XMLA 5HV4A 2J22A 5K7PA 3HBKA 4BXSV 4Y26A 3ZFFA 2WSUA 3MIGA 1W99A 5FPBA 2VGDA 3ON7A 1A6CA 1G6NA 2YROA 3SH3A 5FKCA 1NA1B 5A3WA 4DS0A 2V5DA 5JIAA 4YM2A 1RVF2 3M3EA 2EIDA 5JXJA 1DFQA 4MXWB 4OMCA 5KWRA 4PBPA 3OB8A 2CTVA 3ZIXA 4I02A 1J58A 4Q4W3 5CFDC 5DAPA 4NMIA 5JI9A 1AX0A 1R1A3 1UIJA 4R52A 5IWFA 4YFZA 3LA7A 3W9AA 1LHWA 1HB4A 1ENSA 1ZZ6A 4CDXA 5FMOS 1FNYA 1BQPA 2CWMA 2VY0A 2BGPA 3IAQA 4Q1RA 4QPGC 5F32A 3WG3A 5HI0A 5I0DA 3WQBA 3N7KA 3PJQA 5A1AA 2VQUA 1LECA 4COVA 1EAH3 3DECA 2P2KA 2WFF3 4NHLA 5BNOB 1MQTC 4ISRA 1UYXA 1O91A 4PQQA 1OF3A 4C90A 1CAUA 1FAYA 3N9MA 1GP5A 4D7TA 4Q1PA 1HRI3 2WNVA 3HR9A 1HB1A 3CO2A 3O0XA 1OA4A 5BNPC 1S0FA 1V6OA 4LHKA 2WNUC 3VKFC 3W21A 3O1UA 3U0ZA 3AP4A 1UU4A 3C3VA 2C24A 2VZSA 1OPOA 2ZGUA 2X5IA 4FI9A 4K1YA 3A23A 2LALA 4NN0A 4C1XA 5JR2A 3AP5A 3M2MA 4N9HA 1GP4A 1C8M3 2NN8A 3PVEA 3AM2A 1XE0A 4BJ0A 1JYIA 1F31A 2IUWA 3DXTA 4JQRA 1NCRB 2VW2A 1FPN1 1VBB3 1JXNA 1UY0A 4COZA 2BU9A 4L92A 2QQPA 5BUVA 1UXZA 3E5XA 1RUG1 4ZY9A 4CCNA 1REEA 5FPXA 1V9U3 5IFPA 5T5LA 4TSVA 3ACIA 1IOAA 1PGL2 1O4YA 1UW8A 5FPAA 1UU6A 2P34A 4LK7A 2VH9A 4Z8BA 1PGW2 3LWCA 4GH4B 1LULA 4QU2A 4Z1VA 2JDYA 2WZR3 4GMP1 4M01A 4FP2A 1GWKA 3FX3A 1ULDA 2IXIA 2TEPA 3IMNA 5A6QA 4Q29A 2ZX0A 1LGNA 4CYDA 1T6GC 2ORXA 2GSYA 3RWNA 4JGYC 2G9ZA 4XIKA 3B3QE 4FO9A 1BCXA 2VZRA 1ND3A 5DABA 2RDNA 4IE4A 4ZPIA 4DPNA 1ZZ9A 4AL9A 2GMEA 4L97A 3KQRA 3CQOA 4CUAA 1T2XA 3IKWA 4BA6A 4L99A 1SFNA 1SCRA 4FAGA 1C4RA 5L73A 2ARBA 2ZGRA 2ZXQA 4CZSA 4FSJA 2VW1A 4G4FA 4UBHA 5LY2A 2E32A 4AHYA 2ZKNA 4MYEA 4DXRA 3WHUA 1G9BA 2E7TA 4QKDA 4AGGA 2Y64A 4CP9A 2RS53 4HSJA 1AJOA 1K45A 1O3TA 5IFTA 4KBZA 4MGTA 1QJZA 1K5MB 1HRV1 4QPIA 2OUHA 3O1PA 4XFHA 1WCDJ 5FO7B 4LOTA 3CBNA 1EUUA 3EJKA 2J42A 1XSRA 2BNOA 4DUWA 3O0VA 1RUI3 2P17A 1W6QB 1YQ6A 3MW2A 1O3SA 3QCWA 1IPSA 4I0BA 1HIXA 2DTWA 3MI8A 1AXYA 2R0FA 2YC4A 3VDDC 1UU5A 3KD4A 2IVIB 1UOBA 1W2UA 2JDAA 1ZX5A 4UI9L 1C1FA 2OA2A 3KZ4C 3OPWA 1A34A 4TXWA 1QEXA 3OJBA 4QKNA 3MPBA 5F3GA 3QH7A 5EQUA 3THPA 3VBUC 4IV1B 1F5FA 2BVVA 1HN0A 3C7EA 4FPKA 2VPVA 4AR2A 1AYM1 4F83A 1AUYA 1QY4A 2GMMA 1XYNA 5FP8A 1JYCA 1UPIA 3HQRA 3CEWA 2Q4SA 3V0AA 1SFPA 2ZJCA 4HETA 4P9IA 1YLLA 2B7YA 4Q4X2 4UWDA 4XHBA 4BU2A 3TN91 4CCKA 4AQ2A 2E26A 1JUHA 5DZEA 4QMAA 4OCTA 3ZFGA 3K77A 1C5IA 3ELNA 2RMU3 5T55A 4D6SA 2DYCA 2WNVC 5FZ1A 4LHLA 4AEDB 1GMMA 3ORJA 1RHI2 2YXSA 2ZTNA 1SACA 1YI7A 5HCBA 1DLCA 1RUH1 3ZDVA 3RGBA 4Q4Y3 1S2EA 1MACA 1Y3TA 1MEC3 3GXUA 1OA3A 3H1MA 1FXZA 3OBAA 1CAVA 4N53B 2WC2A 4Q26A 5C6CA 2EXJA 3PVNA 2E9QA 1TME1 2ZZQA 4K6BA 1YXWA 2Y6FA
chains in the Genus database with same CATH topology
3ZMNA 3VBFB 3BPZA 3VGIA 2PA7A 2K2SA 4Q4X1 1GQHA 3ME2A 1F8VA 1REDA 2BQPA 1PVC2 2GN7A 4Q0QA 2RS13 1WLDA 1APNA 2HWC3 4LO5B 4XQ4A 3TRSB 2D6KA 1H8TB 3A4UA 3OYWA 4JRAA 1AVBA 3HN1A 4XF3A 4ES8A 1DZRA 3PTYA 3D5OA 4SLIA 5ACA3 2ZHNA 3GHMA 1TMF1 3QH6A 1HW5A 1W6OA 1ZBE3 1AR71 2B42B 1A8DA 2ILMA 2B46X 1VBC1 2C0ZA 3JBG1 4OUSA 1RUC1 1EV11 4M0HA 4LBQA 5LEJA 4Q4W2 2RS31 1R1A2 2DCYA 3W59A 4PDWB 5A33B 5JVVA 4XJZA 1G86A 2RR11 3TWIA 1AR61 2ZX3A 5F1RA 4YYOA 4S2HA 2WFF2 3U07A 5GZGA 4BMEA 3LAGA 3JD72 1KXGA 3CNAA 1RITA 1YWKA 3CF6E 5CNAA 1HRI2 2WFPA 4PJYA 5I0SA 1XYOA 4HVOA 4Q4V2 2YGLA 1GZ9A 2WZPP 5DUXA 3UK9A 2G9FA 2VU9A 2DFBA 1LCLA 1Z0HA 5KHIA 2Z42A 4BH9A 2QE3A 1POV0 3ZYRA 4RS5A 1WW4A 4DB5A 4RSUA 2XVKA 1C8M2 2ZA9A 4M3CA 2VQ0A 1EAH1 2H6CA 1NXD1 3WDWA 2A73B 2WFF1 2ZGSA 4EROA 1OFSA 3G6JB 3GBWA 1QH7A 1HXS1 1MZ5A 2ES3A 3SH5A 3DKWA 2Y38A 1LTEA 2E7QA 2WZR2 1XYPA 4AEMA 2WA4A 2K0GA 3D4KA 2WS93 1VBA3 1LOFC 1N1VA 2XLFA 4IEYA 2HWF3 2XJUA 2ZGTA 1C8M1 2VOVA 3KCXA 1S2BA 3E5UA 2TBVA 2IXJA 3DPRA 1VBB1 2ZX1A 2FBEA 4Y1YA 1I1EA 1CIWA 1GLHA 4AK3A 1SLLA 4Q0VA 1S0IA 2ZMLA 4BE3A 1V9U1 1Q8QA 4I01A 4U36A 5E8AA 2XJRA 2JX9A 2PLV2 3IPVA 4ASMB 3R4UA 5DZGA 3O14A 3J8F3 4HZFA 4QM9A 3WW2A 2UYAA 4PLMA 4I30A 4N43C 4LNVA 4I0WB 1S0GA 5EXOA 4XJWA 1BVVA 4J6GA 1ZZ8A 3MICA 3EO6A 4META 1YIPA 2BWCA 2QDNA 2W68A 3RSJA 1KJLA 4UW5A 4AE2A 5C9AB 5EJ3A 2EALA 4HL0A 2I2SA 4AFAA 2GNDA 3N7JA 4G9SB 3GZTB 1RJ8A 3DV8A 1PO12 5KC6A 4LUKA 2RS51 1ZNPA 1R082 2PHWA 4COWA 1B35A 3ES4A 5IK8A 3M7AA 3M4FA 4KQ7A 1RUI1 2YMZA 1POV3 3HAGA 3SXWA 1R1ZA 1WMDA 3VZKA 2YHJA 1GNHA 3K51A 4KU7A 1RUF2 2RMU2 1YFXA 3FUQA 4P14A 4E4DX 4AI3A 4CP2A 2OYZA 4LO6B 3VZNA 3C2UA 1IS5A 2NPIA 4Q4Y2 1VAMA 3M3CA 2HWB3 1H8VA 1MEC2 4HMZA 2D40A 3AMNA 4RS5C 5ABJB 1XNBA 2A6VA 4Q0UA 5IK4A 4XW3A 3AK0A 4URTA 4ES9A 4I2OA 1GQGA 1UF2C 4BIFA 2HKXA 3RJRA 5J37A 2XLAA 3WP4A 3OCPA 3LSEA 1V6LA 3ZYPA 1AXZA 5JR7B 3ZXDA 4GWNA 2RMU1 2DCZA 2HWC2 3OD4A 3B7MA 3H0OA 3VBHB 5BNQA 4AVTA 2ATFA 5C9AC 1DHKB 4DINB 1OOPA 2BGCA 1H2LA 1MEC1 1EY2A 2PYTA 3AP9A 1PO23 4LA2A 4K20A 2XHKA 3EQEA 3R0RA 4B7EA 3RNSA 1IS3A 2D7FA 3AX4A 1DQ5A 2OZJA 3POYA 4I09A 2PHLA 4F3JA 2O0OA 1UKRA 4M00A 4YLZA 2ZHMA 1NCQB 2RS11 3S6PA 2WT2A 3AMMA 2UWAA 5SV5A 1HQNA 2UY8A 1RUJ1 2AZ5A 1TEIA 2XJQA 5ACA1 2GZWA 4LA3A 1QF3A 4RR3C 3I54A 4CRQA 3KMHA 4FT8A 1HV1A 2PELA 1MS9A 1SBEA 1RVF3 2JG9A 4B3NA 1ZBE1 3ASIA 2SLIA 1V6NA 2R062 3ZXLA 1JTZX 2ZAHA 1XNKA 1W6MB 3HIFA 3MLLA 4BIOA 4DRVA 1ZVFA 4XJUA 2LM3A 2JG8A 1KDKA 2Q1ZB 3PJYA 4TYSA 4AG4A 4FPJA 4PCRA 1NY72 4IV3B 4XFCA 3D6EA 1AR82 1KITA 4XMIA 2XGXA 1Q43A 1H0BA 4JV4A 5JSOA 1B35C 1VRH2 5LRRA 4W65A 4NHKA 4FOWA 3U11A 3WOGA 5LK7B 2BVBA 2DUQA 2P3JA 5BY5A 4K7JA 2JDZA 2VQAA 3IWZA 5BNNC 4CEWC 4U2AA 5DZFA 3MDPA 4UBGA 1KQRA 4A7ZA 5D8AB 5AVPA 3ZIWA 3Q9OA 1OHFA 3EXUA 4CDUC 1D2SA 2CWSA 3O5SA 2UU8A 3AMHA 1VBA2 2DCKA 2HWF2 2D5FA 1O4ZA 2H0BA 3N7MA 4I0AA 1VIWB 2QFEA 4DXZA 3FBYA 4MGZE 2GNBA 3HQXA 2VECA 4KH9A 1IKQA 1BJQA 2NMOA 1O5LA 4P9LA 2Z5WA 4H14A 1W0OA 2JEMA 4WM8A 3ZYIB 4CDWC 2X29A 4Q0PA 1RL3A 5GKAC 4IXLA 2WS91 4YM1A 1GR3A 2QZ2A 1REFA 5FQ0A 5C8CB 1QMJA 5T54A 5C33A 3AYEA 1PZ9A 5CFCC 3USUB 1SDWA 3EHKA 1NQJA 1ZZCA 4X8NA 1KJRA 1MZEA 1O3RA 5L7OA 1TNRA 1VBE2 3AP6A 1MS5A 1LU1A 2YY1A 5DDJ3 5F6KA 2Y0OA 1FNZA 4WZFA 3RZZA 4GB33 1TE1B 2W0XA 5EV7A 4G3YC 4H3WA 4MGYE 3J8F1 3VZMA 1A78A 2ZMKA 4HKLA 3NSTA 4DQAA 1RGSA 4AHXA 1NXMA 1SQ4A 4CTEA 1CONA 2NYYA 4YFWA 3KS7A 5K0UB 2DVFA 2TUNA 2A3XA 5FAXA 3VBOC 4OFGA 2FMDA 5JWPA 1WLCA 4AYUA 3LKJA 4M3CF 4LBMA 5FLHA 2Q1MA 1HKDA 1WBFA 2GAUA 4LE4A 1GSLA 1J1LA 5JZGA 1BMV1 4V1PA 1DGWX 5C4WA 1C28A 1OLQA 1PIV2 4XILA 3B9CA 2HWB2 1YIFA 1YJKA 1HLCA 1JW6A 4FCAA 4WM7A 2JE9A 5CFDB 2WT0A 3KB5A 1VAKA 1QJY1 1QJU2 3T2TA 4QPGB 1RHI3 1LR5A 1LOAA 4MGKE 3THTA 3RS6A 4E4SA 4B4RA 5BYNA 1AJKA 3ZXFA 4YZ4A 1MQTB 3ZFEB 1LHNA 4HN1A 1ND2C 2BYVE 4CDQC 3BALA 2WNEA 3AB0A 1CESA 2PFWA 1XXNA 4R8HA 5GZEA 5H9QA 1GV9A 4AI1A 1NA1A 3KT7A 4XJAA 5E89A 1UCXA 1WGPA 2RJLA 1COV2 5BNPB 4Y20B 2WNUB 3GALA 2GC0A 1FV2A 2EXIA 1XU2A 4QGMA 1TNFA 1AF9A 4FPCA 1ASJ2 3GBGA 4PIZA 3IT8A 3NAPC 2AENA 3NO8A 4YZ3A 4FTEA 2GU9A 2H0VA 4Y1XA 1NG0A 2BNNA 4LE3A 4ONUA 3LA2A 5A3LA 1ULFA 4WM8C 2ZZJA 5BNOA 4CEYC 1PO21 1ZA4A 1G9FA 5AFEA 4JRLA 3SHRA 3GZUC 3KT4A 4XTMA 4OHXA 4NVPA 5FLIA 2HEYF 5FRAA 4MH0E 4P9XA 1ALYA 4JGYB 4E4ZA 3SCHA 1N3QA 4Y1ZA 5L7OC 2R30A 3MW4A 2WKKA 2RM22 3D0JA 3HT1A 2VG9A 1OQ1A 3JB4C 1MVQA 3H7YA 3B5LB 4YVSC 1H2NA 1AR93 4IEQA 2K9ZA 2XBO3 1NCRA 4L8QA 3ZFEC 1C8NA 4ORFA 3UKNA 3JD73 2I74A 2R1DA 4BPZA 4R9BA 2MEV2 3L9JT 1XNDA 3FMGA 1RVF1 2ZGQA 5T3NA 3SH4A 1RINA 3LSDA 1QJX2 2YUEA 4GH4A 2A5ZA 4Q4V3 1RUD2 3KLSA 4WVWA 5D1IA 2E53A 1NOVA 1ZRRA 2DVDA 3PHMA 2ZGMA 4I3GA 4FXKB 3ZN5A 1G9DA 1YCIA 1YRZA 3MIEA 1C5HA 3AZXA 5KXCA 3POWA 2R32A 3KM5A 5H9SA 3PVOA 3JB8A 4LBJA 4YM0A 2ARXA 1R092 1WMFA 3KCYA 4AVSA 3VDDB 3ZMOA 4WM7C 4L9BA 3ETQA 3B01A 3ZX7A 4YZ1A 4FPYA 5HBAA 1UPSA 1GNZA 2DV9A 2HYKA 1A8MA 1IZ3A 3VBUB 3ZN6B 1K5MA 2LTNA 1CAXB 3J26N 3CJIC 4W6XA 2ENRA 4IL7A 1DDLA 4BZ4A 4JAAA 2WA3A 4HN0A 3WQ7A 5GLVA 2Q8OA 4DY3A 3VL8A 5EWSA 2VMGA 1U5ZA 1VBD3 4Q2FA 2WNVB 4X6QB 1PGL1 2BNMA 3H9AA 4RQPC 4YW3A 5FOJB 4ATFA 1PGW1 1XU1A 2A6YA 4PIYA 2PLV3 3VHOA 4QX5A 4GKYA 3VBRC 3NL1A 4TWTA 4NR1A 5DDJ2 2WWSA 5KHKA 3WLUA 1X7NA 2EVXA 4GB32 1LODA 4IV1A 4XEZA 4MGIE 1DZQA 2QZ3A 2X8KA 2YZ4A 3L2HA 4N90A 4OHVA 4XFIA 4B29A 1H4HA 3QBQA 3ZFFC 1UZZA 3HBZA 1D2QA 2IFWA 4W6YA 3FUOA 1SLTA 4YG6A 1ENQA 2ZGNA 4P5HA 1UL9A 4AGRA 5JIUA 4Q8KA 1PO13 2OIIA 3AMQA 3ES1A 3N35A 4AI2A 1CPMA 4MSVA 3PLQA 3WINE 5LK5A 1DYPA 4ZU5A 3WG4A 4YVWA 3WD5A 4CDXC 1R083 1UZYA 3MIDA 4GB31 5KHHA 3OGGA 2ZAAA 3VBFA 4IESA 1MZ6A 2XL7A 1N3PA 4B7KA 1RMU2 4YW2A 2D93A 5C8WA 4C0BA 1BVP1 4GWMA 1AX2A 4D7SA 4NHMA 1RUF3 4XF9A 2R042 4KWKA 1NYWA 2D6LX 5I91A 5LEKA 4GALA 5DUVA 5I8TA 5I0RA 5FFOC 2ZPXA 1GICA 3IDEA 2W52A 5AC92 2X5IC 1FOD2 1YFYA 2VOWA 4WVZA 3TNQA 3JUUA 1QXRA 1ZBA2 3JU9A 4IEXA 2RE9A 2HWD2 1JOJA 4BOWA 1WUVA 5I8SA 1DBNA 1RHI1 4K1ZA 3X29B 1TQ5A 4PDWA 2ZHKA 4AQSA 3I4IA 5JSPA 2A3WA 4IEVA 1MVEA 2EAKA 1VAVA 5GJ6A 1ND3C 3MIFA 2IC1A 1SEFA 4JC1A 2PQQA 1PHMA 2VNRA 1BEV2 3VHNA 1PVC1 3M3IA 2ZGKA 3OGJA 4HT1T 4LHNA 2N7GA 2ET1A 1DYKA 2OUJA 3IIAA 3SNMA 4R9AA 1CAVB 2ZABA 5TSWA 3H3UA 3M3QA 2Z79A 4Y22B 3BCWA 3RG0A 1BZWA 2PTMA 1AX1A 4QPIC 3I59B 2UWCA 1AR92 2XKOA 1S2KA 2XBO2 4C91A 3B9IA 3V56A 2D3RA 3S7EA 3WG2A 2R063 1KD7A 1Y9QA 4LEJA 1GYKA 3FJSA 3NWKA 3ZPYA 4UW6A 1U12A 1V6IA 2R073 3QLQA 4XPVA 5J09A 3AJYA 4Q4W1 4XQWA 4MLOA 1LEDA 5B2GB 1R1A1 3AYDA 4N43B 1XE8A 2XL9A 4K8FA 4BLIA 3BIWE 1AR83 1GBGA 3E5QA 3O7OA 1AXKA 4YVWC 3AYAA 1VRH3 3FE5A 4KL1A 5CG9A 2XBO1 4ZKTB 2MHFA 1ZRFA 3JD71 3NJZA 1CX4A 1SBDA 5KXBA 1WBLA 1MS4A 4LBOA 3WQ1A 4FPGA 2DTYA 1HRI1 3ZFGC 4XMAA 5AVAA 2IZWA 1RUNA 4XFAA 2ETEA 4Q4V1 4ASLA 1LESA 4XQDA 5GZDA 2V73A 4K3UA 3PMSA 3UKTA 2PAMA 3LB9A 1GANA 4HK9A 4LULA 4BMBA 1H1IA 3ZYJB 5GM0A 4IEUA 2SBAA 2YC0A 2GNMA 3B00A 2E6VA 2C5DA 1YJLA 4BM8A 1SMVA 5FPZA 4A7KA 4YGCA 3VZJA 4RA0A 1VBD2 4AVAA 4J1WA 1FT9A 2D43A 4JDOA 1O5UA 2D98A 3MF9A 4HFSA 2FQPA 5CU1A 1L3JA 3WW4A 2WZR1 4Y1UA 1DG6A 3WG1A 4RS5B 4M3CB 4A2UA 4EN7B 1Q8VA 4LR4A 1RTVA 3VL9A 2HEVF 2ERFA 3GYDA 3BB6A 5I0UA 1UD1A 4HVQA 3WW3A 4JVAA 3NKTA 1S1AA 1RJ7A 4NOTA 1VBD1 3VLBB 1D0HA 1FMD3 1VBE3 1X8EA 4C1WA 5BPXA 5CADA 2A6ZA 3H1WA 2D44A 3N3HA 1ZREA 1W6PA 3RMYA 2WLQA 1UMZA 2PLV1 4FBFA 3L2YA 3S0MA 3OBTA 3MIHA 4YG0A 3OTFA 3N7LA 2IFRA 3ZXJA 3LA3A 5FCCA 5FO9B 1BBT2 2Q5TA 3ZXKA 3ZSKA 5FO8B 1LOGA 5CG8A 5JMCA 1J3QA 5KXEA 3WR0A 2DURA 3V64A 3T1LA 4MX3A 4FOQA 3VBHA 1S0CA 3HWJA 3MEPA 1PO11 4R4ZA 3JQXA 4RR3B 4Z2WA 5IK7A 1PIV3 4BLJA 3MLJA 3VBSA 1R081 3RPQA 1O3QA 4YGEA 3DF0A 2D6PA 2Y26A 2B5HA 3INAA 3J9SA 4CP1A 1EPZA 1QJU3 2XJSA 1LOCA 5FREA 1A3KA 3QD6A 1IS6A 3ATGA 4PIXA 1RUF1 1NCQA 4WV8A 2DUPA 2TNFA 4JCKA 3VHRA 1UAIA 3WP3A 4MZUA 1FV3A 2C9AA 3H7JA 4AQTA 4D94A 1I9RA 4GMP0 1KS5A 5CBLA 1B35B 4Q4Y1 4NO4A 1H1AA 2YV8A 3AYCA 5EYYA 3GHNA 1G9CA 1COV3 5EZWA 1DF0A 4XTPA 3VKMA 3VKLA 3DPRC 1D4M2 4PBOA 2JENA 3OF1A 5I0TA 5BNNB 4CEWB 1ASJ3 4LBKA 1OSGA 5E1RA 3OPZA 1H2KA 1QH6A 3RYKA 4CDUB 2CY6A 1VB2A 2HWC1 1AZDA 2AREA 2R1BA 3B69A 4A7YA 1Y43B 2FHRA 1QQP2 2BW8A 1QDOA 5FBZA 2AR6A 2VVEA 3WXPA 1ULCA 2P3IA 1XRUA 4IEZA 1ULEA 2OW4A 3IDBB 1Y7BA 5JLVA 1PZ8A 4F8AA 4R9CA 4EN0A 1LOEA 4WVMB 3UV9A 3ZSJA 4Z92B 1Z78A 2I07B 1H1MA 4CDWB 3ZVXA 3FLPA 2R072 3KCCA 2RM23 3WVJA 3PNAA 4XF0A 1QDCA 1XQNA 1U5IA 1RUE2 5D8AA 1RC6A 3H3ZA 1RB8G 1ZM1A 2ZS6B 3E97A 1H9WA 1SCSA 2WSVA 1W6NB 4YG3A 5CFCB 1WMEA 4RHV2 5E88A 1MR5A 4BYYA 2MEV3 3WDYA 2DCTA 4LBQD 5KC5A 2XVGA 1YUDA 1QJX3 1V70A 1QOOA 2AUYA 3SCFA 1RUD3 2E63A 2R061 2XWJB 1FYUA 3JCIA 5FTTC 4QT6A 2IXLA 3A0KA 1GZWB 2VOKA 1FPN3 4XXPA 1NY71 4I3PA 2Q0AA 2NM1A 3FLRA 4FPLA 3P3PA 3UJOA 4PLNA 5KBFA 1YFUA 1AR81 1J3PA 1RUG3 2QKDA 2ZGLA 4GULA 5C8CA 2JG9B 1R093 4MVTA 1VRH1 4KWJA 3VBOB 2C1FA 3USUA 1WW7A 4D7YA 3I2DA 5GLWA 5J3UA 2GH2A 3SMHA 5KHGA 3WP6A 2WL1A 2JG8B 4JGZA 4XFFA 1I6XA 1QNYA 4XHXA 2KA3A 1AL22 4MXVA 4HSLA 4OLLA 4E2SA 1OOPC 1OLRA 1VBA1 2GH8A 2PN5A 4XBLA 2HWF1 2BTVC 1NLSA 2RJKA 1WD3A 1DQ1A 4YZ2A 4N7IA 1CQ9A 2FMYA 5K0UA 4KG0A 1Z7S2 3B94A 4OI2A 1Q8SA 5T5OA 4AHWA 3FZ3A 4DZGA 1FMD2 3VZLA 1PK6A 4YZ5A 2KXLA 2P3KA 1IPJA 1HRV3 4Y5Z0 5A32B 1ND2B 4CDQB 2FZ2A 1C1LA 2ZKLA 3ZO0B 2G4IA 4AHZA 4A3XA 2ZX2A 3RDIA 3WQ0A 1QXPA 1OQDA 2PHDA 3NV2A 5SV8A 4FVVA 2JG9C 5JCTA 5LRSA 3NAPB 4KNCA 3N4MA 2XJTA 1O4TA 1PNFA 1FMD1 1VBE1 1H2MA 4X8PA 1LEMA 4WM8B 1AL0G 1KFXL 4LBLA 1AYM3 1G7YA 1BKZA 4CEYB 2JG8C 3RMXA 4E2QA 2E7AA 2VUJA 5AFBA 5HCFA 4J1XA 2CGPA 3FHIB 2WJSA 5JOWA 3IM0A 3LCPA 4W6WA 1AYN2 1J3RA 1RMU3 4Q27A 3HD8B 4IEWA 2ET7A 1MS3A 5DG2A 4Y20A 1CAWB 1V6JA 1OD5A 1LOBA 2D6NA 2DU1A 4L11A 2WQ4A 5L7OB 2R043 1POV1 2JECA 2PHTA 3USSA 5I93A 3NKGA 4IETA 2ZX4A 4YVSB 5AC93 1SFYA 1FOD3 4B8EA 4Z82A 2MNGA 3M70A 1PIV1 3M3OA 1ZBA3 3WCRA 1N47A 1KFUL 1UX6A 1UKGA 1IGOA 2HWB1 5T52A 3T1MA 4UW4A 2WQZC 5J96B 3V0BB 2HWD3 3UL2A 1N1SA 4NWVA 4OHZA 1VALA 4NWWA 4MXWA 4B4QA 1QJU1 5CB7A 1UIKA 2YGMA 1EPWA 4JGYA 2VUAA 2I45A 1G8WA 5T5JA 3UKVA 4DOUA 3OY8B 1X33A 4JGZC 4P9WA 4SBVA 1NE6A 1RUOA 3FFQA 3W58A 5IK5A 1CPNA 1F2NA 1MZFA 3NVCA 4HPKB 3ECQA 1Q5OA 4WM7B 3PMEA 4OI1A