1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
4HSJA 3WW1A 2IXJA 2Q4SA 2QVSB 4Z82A 5K8SA 4FAGA 5FLHA 5KHHA 2IXIA 5I8YA 4META 3OD0A 1WLTA 3LWCA 1LR5A 3IWZA 2FMYA 3ES4A 2B9UA 2XKOA 4ZU4A 5I8SA 1RTVA 4E2QA 4OLLA 3BPZA 1L3JA 3I59A 3I54A 2GC1A 2MPFA 4HMZA 1EYBA 1NYWA 2BNOA 4IETA 1ZX5A 1OMIA 4KWLA 3KMHA 1ZRFA 2B5HA 1I5ZA 2HKXA 4HVRA 1CAUA 2IXHA 4XFGA 4B29A 1IPKA 1YUDA 2EA7A 2PHDA 3HT2A 3FFQA 1O3QA 4E2GA 3RYPA 2CAVA 3S7IA 3E5XA 2Q30A 1YLLA 4L11A 2H6CA 2ZCWA 5KBFA 2IXLA 2XLAA 4BIFA 4IESA 2UY9A 4IERA 2OZJA 1CAVA 2HJIA 3RYRA 5BPXA 4XF9A 1Q43A 4J1WA 1J3RA 2O8QA 3M3IA 1EP0A 4Z07A 2KXLA 3I7DA 5KHKA 4QGLA 3KCCA 4LLOA 5I91A 1FT9A 1IPJA 3U11A 2ET1A 1CAWB 2UYBA 4ZU5A 1ZNPA 5T3NA 2PAMA 2GZWA 4IEOA 3EJKA 2PTMA 3H1MA 5CVRA 5FPXA 4EROA 1DGWA 2PA7A 2GH2A 4HVOA 3QOPA 3LA7A 3H8UA 5I0RA 2XL7A 4Q29A 3IIAA 4I09A 3UKVA 4EV0A 2Q0AA 3H1WA 4AVAA 3FHIB 1YFYA 4MV2A 3FZ3A 3OCPA 4HN1A 1YFWA 2XLFA 4F7ZA 1DGRA 5I0SA 1LB2A 1UCXA 2D5HA 3U10A 2BEOA 3SXWA 4PIXA 3UKTA 1CAXB 1PMIA 1QWRA 3H3UA 1RUNA 1QXJA 3IDBB 3H7YA 4JTNA 1ZRDA 5EZWA 3BB6A 3DL3A 4Q0QA 1CGPA 5CADA 1YFXA 2BNNA 2I45A 3G7DA 1ZRRA 1RUOA 1O5LA 5KHJA 1PM7A 1RC6A 4DINB 3CJXA 4MZUA 3RDIA 1NXMA 4ONUA 4KL1A 3SCGA 4XFAA 2Z69A 5J3UA 1O3SA 3NW4A 1ZZCA 4HSLA 3KGZA 1UW8A 4OFGA 4TLFA 4LEJA 4IEXA 4XFFA 4AQ6A 3DV8A 3ES1A 1UIKA 4R8HA 5I0TA 5C6CA 1J1LA 4IEQA 2PFWA 3BCWA 5E1RA 4X6RB 2E9QA 3H1YA 4MGYE 4UBHA 1XE7A 3KSCA 3E5UA 4P9GA 2ZKLA 2CV6A 5BV6A 1I6XA 5C8WA 4FBFA 1CAUB 2GAUA 4K8FA 1SQ4A 3MDPA 2XGXA 4AVCA 3NSTA 3FWEA 2F4PA 1VP6A 4YYOA 2P17A 2BGCA 2K0GA 1TQ5A 5J48A 2V09A 4QM9A 2IC1A 4QM8A 4YRDA 1CAVB 3OGJA 3E5QA 3SCHA 3HQXA 4I2OA 2VPVA 4CYDA 1LKNA 1U12A 2QCSB 3BALA 3WW4A 5I8TA 2D93A 1X7NA 2XL9A 1OD5A 2MHFA 2VQAA 1OFNA 4IEYA 5JSRA 3EBRA 4LUKA 1RGSA 1YWKA 1WA4A 1GQHA 5BY5A 1NE6A 3PLQA 2OA2A 1CX4A 3JZVA 4BH9A 3HT1A 4KWJA 1SFNA 1O7FA 4L2NA 4XF1A 3D0JA 2BNMA 4JV4A 3VHRA 4MH0E 3LA2A 3OTFA 2Q1ZB 4IEUA 4O9GA 4J1XA 5E16A 4N9HA 1ZVFA 5FQ0A 4D7SA 1RL3A 5KHIA 4XEZA 4UXAA 3LAGA 5JSOA 5D1IA 4Q0VA 1X8EA 1ZZ8A 2XKPA 5JR7B 1HW5A 5I93A 4KU7A 5LEJA 1FXZA 4BYYA 4KU8A 1ZZ7A 1O3RA 4Q0UA 1ZZ9A 3FE5A 5LRSA 3B02A 1J3QA 4AVBA 5AVPA 5J7MA 1O4TA 5HI0A 2UYAA 4LUMA 1QXRA 3E97A 4AQ2A 4JVAA 3UKNA 1LRHA 4MX3A 1EPZA 1Y9QA 2PYTA 3H7JA 3RZZA 3L2HA 3S7EA 4XFIA 1OI6A 4EWDA 4WBBA 3DN7A 4AXOA 1QY4A 3DKWA 1G6NA 4UBGA 5JCTA 1FI2A 4I02A 1NZCA 5FCCA 3CO2A 2XHKA 1UIJA 5EFUA 4ORFA 3H9AA 2EAAA 1O5UA 1VJ2A 4I0AA 3ACLA 3WW2A 1YFUA 5JSPA 4YSFA 2PQQA 4QGMA 2VECA 3CEWA 3NJZA 3TNQA 2CGPA 1V70A 4LTAA 3O14A 4I3PA 1UD1A 4EWAA 3NL1A 3MYXA 4N9IA 2GC3A 2N7GA 2C0ZA 1VR3A 1H1IA 5FPZA 4XFHA 3LZZA 2BYVE 4BHPA 4QX5A 5LEKA 1GQGA 4GULA 4H7LA 4XFCA 3PNAA 5CU1A 4R52A 4FT8A 4A2UA 3IDCB 3FX3A 4MGZE 3EHKA 5FLIA 2IXCA 3LOIA 4PJYA 1JUHA 4XF4A 1WGPA 3MPBA 4PIZA 3GYDA 4PIYA 3EQEA 1H1MA 5FQ0B 2ET7A 4MGKE 3ROUA 2PHLA 2OZ6A 4D7TA 3C3VA 5BXXA 2PAEA 4X6QB 1Y3TA 3H3ZA 4YARA 2PAKA 5I0UA 2O1QA 3NKTA 3RNSA 4MGIE 4Q0PA 2FQPA 2ATFA 3KGLA 2Z2SB 4E2SA 3USSA 4I0BA 4WZCA 3FJSA 1YHFA 2WC2A 3PVBB 3ST7A 1ZREA 4HZFA 4IEWA 3MZHA 1ZZ6A 3CL1A 4JTOA 4WVZA 4HLTA 3ELNA 2IXKA 2OPKA 2MNGA 3CF6E 2UY8A 3RYKA 3U0ZA 5LRRA 4F8AA 2D5FA 1Q3EA 3R6SA 4XETA 1J59A 3WW3A 2WFPA 1J58A 1XE8A 4LA2A 2QNKA 3IBMA 3NVCA 2Y0OA 4I01A 3ZDSA 1XRUA 3EO6A 3S0MA 4EWEA 3ETQA 5F1RA 1SEFA 2B8MA 3E6CC 4LULA 4MUVA 4XFBA 3SCFA 4XF3A 3OF1A 1EY2A 3QACA 4RD7A 4KWKA 2OYZA 1X8MA 3N4MA 1CAWA 3M70A 3LA3A 3D82A 4QMAA 1Q5OA 1ZZBA 5JAXA 2EVXA 2DCTA 3E6DA 5FLJA 4ZU7A 3H50A 5KHGA 1O3TA 4HVQA 4XF0A 2D40A 3E6BA 2H0VA 2XLGA 4LA3A 4O9EA 4FAHA 1X82A 3RPQA 5BUVA 3BU7A 2GC2A 4NVPA 3SHRA 1DZRA 4HN0A 1CAXA 4HBNA 5FDBA 2ETEA 1DZTA 2QJVA 4IEPA 2GC0A 1NE4A 2K9ZA 3SMHA 2GU9A 4QGNA 3GBFA 3TNPB 4QXKA 3CLPA 4IEZA 3HIFA 1J3PA 1UPIA 4YNIA 2QDRA 2CAUA 3D0SA 4Q0SA 4IEVA 1ZRCA 3I59B 2H6BA
chains in the Genus database with same CATH superfamily
1N47A 2RS51 4HFSA 2QVSB 2F17A 1W8WA 1HQNA 3PU3A 2E7TA 3WW1A 2HWD3 2Y64A 4WM7B 1GFF2 1C8M1 2IXIA 4P9WA 4META 5LASA 4JRLA 1EUUA 3DUIA 4YZ3A 4A7ZA 4NUBA 1WLTA 4GB31 4S2FA 2NMNA 3S5AA 1VAVA 1GU3A 2EIBA 3AMPA 5FKBA 2XPJA 3ES4A 3WF4A 1AL21 2XKOA 2YROA 2DVGA 1LEDA 4LIUA 3VBFA 4QDRA 3I8TA 3PJQA 3CU7A 4OLLA 4AEDC 2ZGKA 3F95A 3I59A 4P00B 1GSLA 1XNCA 1GOFA 1K3IA 1W8HA 3K4ZA 1AYM1 2P34A 1GYKA 1LOAA 2WN3A 4XJZA 1EYBA 3VL9A 4HOOA 2R0HA 2WBKA 3ZYHA 3AP6A 5LY2A 4ZZ8A 1DF0A 3J8F3 3KMHA 3ZKUA 4NIGA 4AQSA 2YC0A 4AHXA 4CDWC 3AJZA 1SLBA 2NQYA 1CN1A 1MR5A 2W2IA 3K3OA 1XNKA 4AGRA 4D69A 4PBOA 3SH4A 2HWC3 5FZGA 5LK7B 3J8F1 5FYYA 5T50A 1SBFA 3LOBA 1H0BA 4BQ3A 4NIAA 3OBTA 5EHDA 3ZXKA 5KBFA 2IXLA 2XLAA 1PO12 2VTXA 2Y6KA 5FP9A 4IERA 5L7OA 4NROA 2J1VA 3MICA 2AENA 3AYAA 1K45A 4DZGA 5FZEA 2VNOA 3BTAA 3FHAA 4KQ7A 1NQJA 1J3RA 3I2HA 5FZDA 1EP0A 1Q56A 4K6BA 3ZFGA 5JMCA 3NWKA 3POGA 3WOGA 2KXLA 1LEMA 2C9KA 5L9RA 3KCCA 4JQRA 1SPPB 5FREA 1O4YA 1FT9A 4HPKB 4GWNA 3WQBA 3HAGA 4CU9A 1CAWB 3ZYRA 1OOPB 2UYBA 4M01A 5FJKA 5G05L 1RUI3 5JOYA 2GZWA 3Q8AA 1JZ3A 5FZ8A 5GZGA 2WDBA 3H1MA 1NQDA 3PUAA 1K12A 4FFHA 4EROA 4C91A 5GKAC 4COVA 1RUE3 1WCSA 3LA7A 4FOWA 2XMLA 3H8UA 5I0RA 2XL7A 1GZ9A 1RUI1 1MS8A 1U5ZA 2D43A 2XWBB 5JDBA 5IK8A 2XXZA 2Q0AA 3NQHA 3DGTA 3H1WA 3VD3A 1SLCA 2K46A 5FFOC 4AVAA 1STMA 3LKJA 1URXA 1YFYA 5DXDA 1RUE1 3B01A 1YFWA 2XLFA 3WCRA 2WWUA 1HQLA 1DGRA 4PCRA 3VDDC 2VG9A 4HXCA 1PGW1 4D8MA 3U10A 4B4PA 4YZ1A 4ZXKA 5LBFA 4ASMB 4NOTA 3MV01 1H6XA 4A3ZA 1NCRC 1AR62 1QXJA 2QKDA 5GLVA 3W5NA 1ODNA 2YY1A 3H7YA 4UYBA 1PK6B 1ZRDA 1SFYA 5DG2A 2TNFA 2RV9A 4LQRA 3TN93 1KD7A 4GXLA 4CCEA 1HXS2 3UGFA 2XONA 4BPZA 1H9WA 1NT0A 2A3XA 4YFWA 2P1BA 2R072 3KF5A 1U5IA 5D8AB 5BNPC 3ZN5A 1O5LA 3TN91 3KS7A 2R6QA 4CCMA 1RC6A 4M3CB 1US2A 3IMNA 4XBNA 3QCWA 3WF2A 1MZEA 4L97A 3I2JA 2VZ1A 5ANNA 1XQNA 4TWTA 3BPSA 5C71A 2IUWA 1JS9A 4KBZA 2PXJA 1AJKA 2WN2A 2Z69A 1FMD1 3NW4A 2WNVA 3B69A 5C4WC 4HSLA 3KGZA 3ZR6A 1W9TA 4GWMA 4YVWA 4AWDA 2TEPA 4XPVA 4LO5B 1LOFA 2VTXJ 4BCUA 1XYPA 3TYJA 3V0AA 2ZGOA 4Y5TA 3E1F1 2G9FA 2D44A 1RXGA 1F8VA 3V65A 3VDCA 5LB6A 2WT1A 5A1LA 2E9QA 3SITA 4I0WB 1JHNA 5JZGC 1XOYA 1ENRA 1O8PA 5C9AB 3VBHA 3POYA 4AF9A 1UU6A 2J7MA 2NYYA 3MLKA 1Z0HA 2ZKLA 1BEV2 1DQ5A 1NX9A 1QJX3 1WKYA 2CV6A 1CZSA 3VBRB 3WINE 1FV3A 3ZSLA 1KGYA 4FBFA 2SLIA 5FP4A 1UZYA 3MW4A 1LAJA 4WV8A 1SQ4A 3MDPA 3OSDA 4CPBD 4NIDA 3WHUA 1XU2A 2B4KA 1QJX1 2JB8A 1SZBA 2F4PA 3HNYM 2E7AA 2EICA 1KITA 5FYIA 4DB5A 4YM1A 1YI9A 5GZDA 4PQ9A 5CNAA 2QZ2A 1RUJ3 4LITA 3E5QA 2YC2A 5FY1A 1SDDB 3WNXA 1X33A 2CWMA 4BXSV 2VPVA 4CYDA 1DYPA 1LKNA 1BBT2 1UU4A 1S0JA 1U12A 4LE3A 1A8DA 1MACA 1N3OA 1UYYA 1ZBA2 3RZLA 3T0DA 4D6SA 2D6OX 2ZZJA 3AX4A 4IEYA 2C1FA 5CFDB 3LFIA 5DAPA 4FPOB 2RS11 2IFRA 3BU0A 3PLQA 4EQVA 1QU0A 3JZVA 3U14A 3PUQA 1DQ0A 3DPRB 3C7GA 5FYBA 3WD5A 1IHMA 1BLZA 3C8XA 5C8CB 5JUVA 4OZXA 4O9GA 5E16A 4NJ4A 3RGBA 4FTBA 1O4ZA 3GZAA 2YDEA 3K46A 3ASIA 1OSGA 2EXHA 3TEXA 4AE2A 2AREA 2X5IC 3FLRA 3ZXEA 3AMNA 2P2KA 1S2EA 4XILA 2VZVA 3SNMA 3THPA 1ZZ8A 1MVQA 4CEYA 1A8MA 4P9LA 3JB4C 1HW5A 4NHXA 3J26N 4RS5A 5FZ3A 5JR7B 1UMIA 2W08A 4UAPA 4YFZA 3WG2A 5LEJA 5EYYA 1W2TA 1I1EA 2RR12 4LLFA 5KC5A 1ZZ7A 1O3RA 3MPPG 3FFZA 1VBD3 5ACA2 1H8TB 1NA1A 3PMEA 2JDMA 4AVBA 1WMFA 4PLMA 3DECA 1L7QA 4FOQA 5HI0A 2KA3A 4HK8A 1RUC1 5C3RA 4OHVA 5BNOC 2X10A 2ZMLA 5E89A 1YXWA 3E97A 3PVEA 1KRIA 1V00A 2HWF3 5CBLA 4FOVA 1LRHA 1UZZA 2QUOA 5GZFA 1C5IA 1QQP3 4IXLA 1RUD2 1OHFA 2VZUA 2WS92 2Y6GA 3WY6A 5LA1A 4XABA 1W8TA 1CIYA 4KBBA 4YG6A 2HWF1 4LBQB 1W03A 1OQDA 4Q4W2 5FYMA 4XDOA 1HB1A 3RFRA 1POV1 3DN7A 1QQP1 3ILNA 3PVNA 5A3TA 1UWWA 1VAMA 1WWYA 4XQ4A 5FZ1A 3SEEA 4AXOA 3BODA 3DKWA 3HQRA 4B3NA 4NAOA 2WINB 3CZJA 3IPVB 1JUIA 2IWGB 4RL7A 1PGSA 2D6KA 1IQAA 4JGZB 4OUSA 1HN1A 4DS0A 5CFCA 1TMF2 1ALYA 1KXGA 2ZX3A 4CDQC 2VH9A 2ORXA 1Y4WA 4AEMA 4PLOA 5EJ3A 4I0AA 5F5IA 3OGRA 1LNSA 4A7KA 2AR6A 5FYVA 3CIHA 4Y24A 1TEIA 1MQTB 4QGMA 2VECA 4XBLA 3CEWA 5DQ0A 3TNQA 3PTYA 2CGPA 5K0UB 2OX0A 1JOJA 1VBC1 2AUYA 2JKBA 1NY72 4I3PA 5FZ4A 3LFMA 1FOD2 5C3SA 1C8NA 1A6CA 2FBEA 2FCTA 2GC3A 2N7GA 3A7QA 3AMQA 1H1IA 4Z1VA 4XFHA 4UFLA 1VRH1 2JDUA 1PZ8A 5L9BA 4BHPA 4Y1YA 4NE9A 5AFEA 2Y33A 3C7FA 5FJHA 1W06A 2QE3A 2GDFA 4YG3A 5FWJA 5LEKA 3WDXA 1ENXA 5JZGB 3K75B 2UWCA 1QDOA 4A3XA 5A32A 1JZ6A 3PNAA 5CU1A 5JIUA 4FT8A 1OURA 1VRBA 2X53S 3R0RA 1H6YA 1W8UA 3AVRA 3EHKA 3T09A 4CVUA 4BXFA 2WQZC 5FMBA 1WW7A 1D2QA 2IXCA 4TSVA 1D0HA 1SBEA 4CTEA 1JUHA 1NZIA 3O0VA 1W04A 3MPBA 5FZ6A 5LY1A 4XE9A 1W0NA 4PIYA 4Q4X2 1IZ3A 1G8WA 4WZFA 3ZDVA 1OLQA 3UJQA 1US3A 3NAPB 2HYXA 4AFCA 2OZ6A 4RFT0 3L2YA 3ZFEC 2ZOEB 1LU1A 5AFBA 4Z92B 1GZWB 5BXXA 1COV3 1Y3TA 3M3QA 4LBMA 4YARA 5C3PA 2PAKA 1TME1 2AC1A 2W9XA 4RHV2 2O1QA 4WVMB 4CDUA 1J1TA 1J84A 1TNRA 2TUNA 4Q0PA 2Y38A 3VLBB 1G86A 3KGLA 2CL2A 2Z2SB 3AZXA 4MADA 2Q8CA 1COV1 4YVSC 2J1RA 2JKXA 1HRI1 5FZFA 3VBSB 4CCCA 5IK4A 1TNFA 2VCAA 2V4VA 4A6OA 4LOSA 1ODMA 4IEWA 1JOPA 3BOPA 1H2LA 2VOXA 5FV3A 5FZ9A 4WVZA 5LA9A 5FO7B 4EN6B 4Z8BA 1MZ5A 2VBDA 3LB9A 4XDQA 2VY0A 5A70A 4WM8C 4ATFA 2ZX0A 4FPLA 3CF6E 4AEDA 4LHLA 3GJBA 2G1MA 2AACA 2VCMA 3FLPA 2D5FA 5FRAA 3R6SA 1ND2C 3UNPA 4MXWA 1W39A 4XETA 1J59A 3B7MA 3VHOA 4EZ4A 1YIFA 5CIRA 2PHRA 1PIV3 1JYXA 5IAVA 4IGOA 1F4HA 1PO23 1XE8A 3GBGA 4LA2A 4Q26A 5FZOA 2BJSA 1H8VA 2WL1A 3ZSKA 1CZVA 2YHJA 4Q4V2 4CDWA 2XJPA 1XRUA 2GSYA 4AEKA 2JE8A 5JMOA 5JOXA 1E5HA 3T08A 4HETA 3ZMNA 4LBOA 5A1AA 1QF3A 4CDXB 1PIV1 3VHNA 3CBNA 3FUQA 2C24A 1PO21 2XG3A 1OFSA 4CCNA 4QD2A 4P5HA 4LIVA 4YM3A 5HCHA 3OF1A 2JG8A 5J1XA 2R49A 3QACA 4RD7A 4EN0A 1OKOA 1POQA 3R05A 3U4SA 4CP0A 3OUJA 1W6PA 3D82A 3WCSA 4PBPA 3JQWA 3ME2A 4Q27A 2PLV1 5F3CA 1QNYA 2DCTA 3E6DA 4Y22B 5BNOB 3JD72 3H50A 2ZGMA 1AYN1 3SISA 5FWEA 5KHGA 2XJQA 4QX2A 3SKJE 1N1VA 1VMFA 4GJZA 4ZS2A 1SFPA 4KH9A 1S55A 2D7FA 4Q8LA 5GLWA 2XLGA 3AFGA 1LGNA 1GP6A 5T54A 2PHFA 4RR3C 2DURA 1W6QB 2Q8DA 4RQPB 4IL7A 5CA6A 3NNGA 3WDYA 3LSDA 1PVXA 1UX6A 1DFQA 1OVPA 1V6KA 1ENSA 1RVF3 1C1FA 4N90A 5EWSA 3ZXFA 2GNBA 5IVJA 4YZ4A 4QPWA 1CAXA 2WQ8A 4D3WA 3TBDA 3MV11 4RSUA 4IEPA 5GM0A 3R4SA 4XURA 3HBKA 3RWKX 4BIOA 3VB9A 2GC0A 4LXLA 1NE4A 2CWSA 2WNOA 5FYZA 4QGNA 3GBFA 1RUH1 1LCLA 2IZWA 1H1AA 4WM7C 3KT1A 3CLPA 2GNTA 3AMMA 3I3MA 1QEXA 2HWE2 2WSVA 3VDDA 4IUGA 1PMHX 2D97A 2CNAA 2I07B 3IB3A 2RMU3 1DHKB 1NCRA 5FP8A 4Q0SA 3T30A 1D4M3 3I59B 4N7UA 1G9AA 3O1SA 4AYUA 2IXJA 2Q4SA 1W2OA 4LE4A 4XVHA 3M3CA 5FLHA 5KHHA 5I8YA 1FPN3 2A70A 2VQ0A 4DQAA 1CR7A 2BFUL 1T2XA 1XSQA 4N43B 1X36A 4DIQA 5HPOA 1GNYA 4LBJA 2FCUA 2RVAA 1MEC1 2XJUA 3OPZA 5BNPA 2B9UA 3DF0A 4JCKA 4V2WA 2LROA 2P3IA 4XIOA 5A3WA 1GR3A 3RS6A 1IS6A 3POJA 4MSVA 1ASJ3 1L7RA 2ZPXA 3PUIA 1RTVA 3HD8B 4AFBA 5GZCA 5KXCA 3BPZA 1Z7S2 3I54A 2G9GA 4AG4A 3S57A 1RYYA 1PZ9A 5CFCB 4WVWA 3WUCA 4RFRB 1VBB2 1K5JA 4PI0A 4HONA 3I3BA 1OMIA 4KWLA 5C4WA 4Q5OA 4ES8A 2B5HA 2GP3A 1OD3A 4XYXA 1HRV3 1JYVA 1JHJA 3KM5A 4AI9A 1CAUA 1NLSA 2MEV2 1SBDA 4A41A 1WMDA 2W95A 2BERA 1W05A 1AXYA 1YUDA 4M0HA 4N53B 3H42B 2NM1A 5A3OA 1SG3A 3ZFGB 4EZHA 5IATA 3VD4A 3RYPA 5DN2A 1YLLA 1HRV1 4QB2A 1OPOA 2ZCWA 4DUVA 3GZUC 4QPYA 2DUOA 2YPJA 2CGOA 3VZJA 3O7OA 2UY9A 3KV6A 1OOPC 4PF5A 5D21A 1O8SA 1QJU2 1G9CA 1CAVA 3AFKA 4H3WA 3OJBA 2HJIA 3MF6A 3ZFFB 5AC92 1RXFA 4OQ9A 2RS52 3GZTB 4XF9A 5BPXA 4AHZA 3HWJA 2O8QA 3W9AA 1MS4A 1V6LA 4Z07A 5HCBA 1C8M2 1GBGA 4JKKA 2JDNA 5A6QA 4GMP3 5IVVA 4GB32 5LWBA 1AR71 2VE1A 4LLOA 5I91A 1EAH3 3B9IA 3FBYA 5DPNA 4EN7B 4HKWA 4L0PA 3WUDA 1IPJA 1ULFA 3OGVA 3U11A 2O0OA 2HWD2 2FZ1A 2FDKA 1DGLA 5B2GB 2PAMA 4E4HA 4IEOA 2WT0A 1AHSA 3EJKA 3BUCA 2LUWA 1EAH1 3VGIA 2W46A 3U07A 5FPXA 1UAIA 1E5RA 4V1PA 3GNEA 5DDJ3 3L9JT 4JAAA 4G3YC 4OUEA 2WNUB 3UKVA 3WP6A 1SCSA 3DCQA 5A3UA 5A33B 3OCPA 2ZGSA 4HN1A 2VBBA 3U75A 5F6LB 2KD7A 1M06G 2R7EB 1UCXA 4JGYB 3VKNA 3J8F2 2BEOA 5JI7A 3VD5A 1TE1B 2BOJA 3RRDA 3VKFC 3VZMA 5BNQA 3GCWA 4GKYA 3WT3A 1RUNA 2DU0A 4S2DA 3C7OA 1R1ZA 3JXSA 3J7NA 2HWC2 1OA4A 1R091 4LHSA 3DL3A 1WBFA 5GLZA 4Y1UA 4Q1PA 1MPXA 3MIEA 1V9U3 2X5IA 3WDWA 2YC4A 3M3EA 5DUWA 5F2SA 1LESA 1ZRRA 1RUOA 4QPGB 1LGCA 5FMOS 2R042 2W3JA 3I4IA 3WDTA 1YQ2A 1W9YA 1PM7A 4URAA 5J37A 1F5FA 1UY2A 4PDWB 4E4ZA 2GMEA 1CD3G 1QNWA 1YJLA 2P5BA 3CJXA 1Q8QA 4JDNA 4Y20B 2XJSA 4DINB 5FOJB 3N3HA 4XBQA 2FDHA 3AP9A 1ZM1A 2WJSA 5C9AC 1O3SA 3RZMA 2SBAA 1AR91 2UWAA 5A3PA 2JENA 3VBRC 1JI6A 5J09A 2DFBA 4TLFA 4ISRA 5FBJA 2Y34A 3HOBA 1RUI2 4FQ4A 4QX8A 4BDVB 3OYWB 2YFZA 5FZCA 1LHOA 3INAA 2FDIA 4LKSA 1OVSA 4AQ6A 3DV8A 5E88A 1UIKA 4R8HA 3CJIB 5A7PA 4DXSA 4IEQA 1RUE2 3HR9A 4XCAA 3BCWA 2PN5A 2W91A 1AL23 4MGYE 4OI0A 1PGW2 2FDJA 5A7SA 4FFGA 4LO8A 5A80A 1AYM3 1JYTA 1KFXL 3GHNA 5FMCA 4B7EA 1FNZA 1UMHA 3Q8CA 5CB7A 3MEPA 3WQ0A 5JXIA 5B4XA 1GANA 5JXJA 1SDWA 3FUOA 4FCAA 4GALA 4FPJA 2XVLA 3WX5A 4BOWA 3BTZA 4W50A 2WABA 2GNDA 4NMIA 3WEZA 4DXRA 4YYOA 2P17A 2BGCA 1PNGA 3ZSJA 2R30A 3PU8A 3AK0A 2V09A 4QHOA 2BBVA 3I97A 4YM0A 4CDQA 5CFDC 4QM8A 3OY8B 3RZJA 4OYUA 4QQOA 4CA9A 2A3WA 2WRAA 3HQXA 5FUNA 3Q8EA 2R061 4JZRA 4I2OA 4OMDA 2WLPA 5KR7A 2RS33 1CONA 5FUIA 3DPRC 2JDHA 3WP5A 4W65A 2WYFA 5C8CC 4ASLA 2WO1A 1AR81 4V2VA 3KQRA 3WW4A 5I8TA 1X7NA 2W1WA 2QQNA 2ZHMA 1QJY1 2D3SA 3FBMA 5F3GA 2RM23 3AMHA 2RS31 4U36A 2L9LA 4COZA 4LUKA 1YWKA 3R4UA 5FBZA 4CXWA 5BY5A 1UYPA 1CX4A 1T6GC 4KWJA 1U5YA 4L2NA 1BCXA 1DQ6A 2RM21 5F32A 3RI9A 3D0JA 2BNMA 4IV3B 4EN9B 3LA2A 2Q1ZB 4IEUA 3K4AA 3USUA 1R083 4BQYA 1OPMA 4QHZA 1W6NB 2CDOA 3CKHA 5FQ0A 1RL3A 3T2OA 2BGOA 2ZGLA 1IOAA 4QXCA 4UXAA 2E33A 3CZUA 5JSOA 3D6EA 3LPFA 4OHWA 5D1IA 4Q0VA 4XUTA 5A6ZA 1H8TC 3B3QE 1R081 1QJX2 3K48A 4CUAA 1WCUA 2QQUA 5J98B 3OUIA 2Y6LA 5AVAA 2DWRA 5H9QA 2XJVA 4XTPA 4AFAA 1G9FA 3HN3A 3ZYFA 5JLVA 4MXVA 4NHLA 1UL9A 1FAYA 3FE5A 3ZN4A 2Z42A 4UW5A 3B02A 5A1FA 2Y6JA 5AVPA 1RUJ2 3VZOA 1O4TA 3DEMA 2JDKA 2BGPA 1BHGA 1QKQA 1QXRA 1LECA 4XMAA 4KGGA 3ORJA 1BZWA 2WQ4A 2OPWA 3SQOA 5T5PA 4Y1VA 3UKNA 3K2OA 3BIWE 1EPZA 1Y9QA 2PYTA 3H7JA 4UFJA 1E57A 3L2HA 4XJUA 2BWAA 1DQ2A 2EALA 2ZTNA 3AL5A 4XW3A 5KXEA 2YBSA 1VIWB 4JGZC 4JDMA 4XFIA 5SV5A 2E31A 4QX7A 4BQ2A 2E7QA 3PIGA 4D6RA 5BNNA 2VZPA 4AHYA 2JDAA 2C9AA 3OBZA 2IFWA 3AZWA 1H9PA 3AC0A 4BE3A 2FDFA 4NAMA 2ZEZA 4WM8A 4MHRA 3PUHA 3LDRA 1FMD3 4DXZA 1ACCA 5JXGA 2WFF3 1WW4A 4M0NA 4J25A 1XB9A 1MQTC 4COWA 5IAXA 1FI2A 1HV1A 1ND2A 4I02A 5K0UC 5FCCA 1ZA7A 2E32A 1Q8PA 2JEMA 2XHKA 4LBLA 4FQZA 4CXXA 1JU4A 3GALA 5FK8A 4Y4YA 2WFF1 4ZHNA 1OKQA 2HLEA 4XQWA 3VBUB 1VJ2A 1XNDA 5IHRA 2DFCA 1YFUA 3A0NA 1O6UA 4UF0B 3ZX7A 4QQPA 1RITA 2FZ2A 2YG0A 1PGL1 2ARAA 1VB2A 5CKMA 4EWAA 5I0DA 3BTXA 1GNZA 3OPTA 1F31A 2W92A 2FHRA 3ITQA 2JDYA 2VULA 4K40A 4QQHA 4LBKA 4S2HA 1VBD2 5F37A 4W6WA 5APAA 2A6VA 1VR3A 5FPZA 3JUUA 4Z2WA 1YEWA 2BYVE 1PO11 4OVEA 4NHYA 4QKFA 1ND3B 1GQGA 1R1A2 2HWF2 5EJZB 4XFCA 4PI2A 1C1LA 1KS4A 4BQXA 2JB4A 3NAPC 5HXVA 3N7MA 1RB8G 1U0AA 4A2UA 1QQP2 1IS5A 1LOBA 5A7WA 1CZTA 1UPSA 1GUIA 3FLTA 4FPGA 1K5MB 1F9KA 2HYKA 1LOGA 2W39A 4PJYA 3WP3A 5F8PA 1NAEA 4XF4A 4PIZA 4Z2AA 1ZBE3 3GZEA 3GYDA 3HEIA 2RS13 4QB1A 4AR2A 3EQEA 1GICA 1H1MA 3GHMA 4GWIA 3OG2A 3WG4A 1MS5A 4M3CF 5JOZA 1XYNA 2ZBJA 3LEIA 2AZ5A 4WM7A 3VBSC 2PAEA 1MVEA 1ZBE1 3JBG2 1MZFA 2QQKA 1GOHA 4S2GA 5LCWL 3FN9A 1YCIA 1QOTA 3HMYA 3AYEA 3PUSA 1CWPA 4UW6A 3KF3A 5EP9A 3A0KA 1B35B 3MIHA 2VZSA 4IV1A 5T52A 2K2SA 5H9PA 3ZN6B 2WWJA 2VMGA 4AI0A 2JIJA 4WZCA 3GDBA 2ZGTA 1Y9MA 1MS0A 3PVBB 5FMOL 1ZREA 1AR61 2EIEA 4CP9B 3O0WA 2CTVA 3CL1A 4P9YA 4B7KA 5DUUA 1DP0A 2W0XA 4RGKA 4XOGA 2OPKA 4CCKA 1HXS1 2BFUS 1AF9A 1LOEA 3C7EA 2UY8A 4NIHA 1XNTA 2WYSA 3ZOIA 3ON7A 4CDXC 4QPIB 2OKXA 1LHUA 3RSJA 2RDQA 4CEWB 1RUC3 4NR1A 2JJ6A 3URFA 4ES9A 4CU6A 3N9QA 1OQEA 3J9SA 4NPMA 2WFPA 3WW3A 5IK5A 4JX0A 3THCA 4L9BA 2G9ZA 4KI5M 3IBMA 1PZ7A 4I01A 4AAPA 4BWOA 2RG4A 3EO6A 2UURA 1LHNA 4OI2A 1SEFA 2ZHLA 3RZGA 4Q1RA 1WMEA 3E6CC 1JYCA 4INDA 2ZA9A 4XFBA 3WVJA 1YIPA 3SCFA 3AKTA 3NJVA 2WR9A 1KDMA 1POV3 4Y33A 2OS2A 1EY2A 2RJLA 1SPPA 4HPKA 3U78A 1JMUB 1GZTA 3FC0A 4KWKA 4A4AA 3TEZA 2RDRA 2ZACA 1QHDA 1X8MA 1WW6A 3IN9A 1CAWA 3JB8A 1OOPA 4RQPC 1XNBA 4YW7A 2A6WA 4TTGA 4QMAA 1COV2 2E26A 4NPRA 2Y0IA 1YNAA 1SMVA 1UOGA 4ZU7A 5F39A 4PHZA 2VMHA 1BEV1 2ZKNA 3ACIA 3QD6A 4W6XA 2RE9A 1C28A 2P3JA 3S6PA 3KHBA 2XH6A 1O3TA 1ULEA 2D6MA 1NCQB 1W8NA 2DCJA 5HV0A 5L9VA 1JZ8A 2H0VA 3T4HB 4FAHA 4YG0A 4O65A 3MLJA 1BK1A 2CHHA 5FUPA 4JC1A 1VLNA 2D6LX 1VBC3 5JPNB 2ZABA 4XQDA 1XYOA 3VZNA 3T2TA 3ZSMA 4GWJA 4LOTA 4QWNA 4AI8A 4XDPA 3SHRA 1DZRA 4XUOA 4CUCA 4BQ1A 2YU1A 4C1WA 1W6OB 2PHUA 3JCIA 5FR3A 3OEAA 3J7HA 1RJ7A 2XHNA 3LCPA 1W3VA 4HBNA 1KEXA 4RGGA 5A7QA 3SC7X 3P3NA 3VDAA 5FDBA 1DZTA 2QJVA 1RHI3 1S0CA 1Y43B 1TG7A 2BV4A 3A4UA 2A6ZA 1PK6A 3WR0A 4FTEA 1VRH3 1NG0A 1I3HA 2GU9A 1UOJA 3AB0A 1AL0G 4NHKA 1LULA 1QMJA 4Q8KA 3OBRA 3H3LA 3LF7A 3N7KA 3VBOB 1J3PA 1UPIA 1C3HA 2CGNA 2YMZA 1PIV2 1RHI1 1KJRA 2BVBA 2JX9A 4N43C 1OT5A 1PO22 4FOYA 1W99A 5D8AA 3O1RA 2YPDA 2CAUA 4AOCA 4B4QA 3WXPA 4M3CA 2LS6A 4FTSA 4HSJA 2X29A 4AI2A 5CFCC 4OCTA 1JZ5A 5DUVA 3OD0A 2DCYA 1L7LA 4ZPIA 4XZPA 5F6KA 1V6OA 4MLOA 4YW6A 5L7OC 4OHYA 1BMV1 1UF2C 1LR5A 1W8OA 1PNFA 4AAXA 3T3YA 1BQPA 5A3LA 1F4AA 2FMYA 4DFSA 4CP1A 1CX1A 2BDRA 1Y9GA 1AX1A 4FI9A 5F5CA 4ZU4A 3ZFGC 4N53C 4DY5A 3VZKA 5CG8A 2ORZA 5F3IA 1TME3 4HL0A 3T4VA 3ZMOA 2C6SA 4ATEA 4DY3A 1IG3A 4HKOA 2BNOA 1UN1A 4NWVA 5EQUA 4MO3M 3RVHA 3QLQA 1S0FA 4C0HA 5C9AA 2A75A 4Y5Z0 1FATA 5ABJB 4OHXA 2VGDA 1HRI3 1SACA 3ACFA 3VBRA 2QQMA 3V0BA 5DAVA 4QXBA 4BK5A 1OA3A 5A7OA 4D6QA 3O1OA 2IXHA 4ITCA 3RG0A 3ZFFC 1RVF2 4FFFA 5GLTA 4GH4B 5ACA1 4YZ5A 1IPKA 4LO7A 4G9SB 3HT2A 1O3QA 3FFQA 2QQJA 2CAVA 3QH6A 2RJKA 3S7IA 3E5XA 4L92A 2Q30A 4M3CE 1UYZA 4NHMA 4B1MA 5KC6A 2WSUA 2WZR3 1N1YA 4EN8B 1HLCA 1JZ7A 1PHMA 1WW5A 1RUD1 2WS91 2OUJA 3LEMA 1RUG3 4EYUA 2WZR1 3M3IA 4UFMA 3MF9A 3WQ7A 1DBNA 2RMU2 4Q4W1 4LHNA 5KHKA 4QGLA 2BQPA 1MS9A 1D4M2 2DBIA 2JG9B 2WNUC 2YBPA 3VKLA 1RUG1 1S1AA 3POWA 4GD4A 5FPLA 2ET1A 5CFDA 4QKBA 3ZXLA 3KLSA 3Q8BA 4YZ2A 1ZNPA 5A7NA 5T3NA 1W8FA 1FPN2 2W68A 2VNRA 4LNVA 3IDAA 4MOAA 4JGYC 2B45X 3I3EA 4COYA 3DPRA 1TMF1 1S0EA 1UZVA 3QOPA 5T55A 1F35A 3MW3A 4U2AA 5C8CA 5L36A 2VUAA 3ZM8A 1ASJ2 4QB6A 2DUPA 2PLV3 2VW2A 4Q29A 1OUXA 3IIAA 3WNLA 3WNKA 3D3AA 4EV0A 5IFPA 1AYN3 4MV2A 3FZ3A 1XJAA 1YC61 2B39A 4F7ZA 2VOVA 2OT7A 5I0SA 2DF7A 2D5HA 3NV2A 2HWB3 2NP0A 1GNHA 4PIXA 1NXD1 2HEVF 1VBE3 2YYOA 2AEYA 1HRV2 4QPGC 1FOD1 1D4VB 1PMIA 1QWRA 2I2SA 3CHXA 2JICA 5IVCA 4JHZA 3ACGA 3TOJA 5IK7A 3BI3A 2JD9A 3AYCA 3J4UH 4FP3A 4JTNA 3GJAA 4PDWC 5DABA 1W9FA 5EZWA 4DPNA 2XB6C 3BB6A 2HWB1 3AKPA 3AL6A 1CGPA 1VBE1 5CADA 1YFXA 1YJKA 2HEYF 4AGVA 1W6MB 5IFTA 3POEA 5FOBB 2V4AA 3B5LB 2YZ4A 1H8TA 4RA0A 1QXPA 5GJ6A 3W59A 4BMEA 3VUOA 1RUH3 5E8AA 5KHJA 1WCDJ 2D3RA 2XR4A 3MIGA 4BQ5A 5IVFA 2WO3A 3TB0A 1EPWA 1JOBA 4MZUA 3CJIC 3RDIA 4C90A 2YU2A 1NXMA 4ONUA 4KL1A 3SCGA 4YGCA 3WNOA 2B9VA 4XFAA 4Q4X1 1EAH2 3ZYGA 4BLIA 1FX5A 4ZY9A 1GMMA 1ZZCA 2VC9A 4E4SA 4LBQA 2A71A 4A6SA 1ULGA 2VMCA 2JXAA 1E5IA 4P5YA 2RJ2A 4UI9L 1QDCA 2A5ZA 4UT5A 4FPFA 3VBFB 4LEJA 3W58A 4AVSA 4K8RB 1CJPA 4IEXA 2JIGA 1IPSA 3OUHA 4XFFA 1E5SA 3ABZA 1T6BX 3ES1A 5C6CA 5I0TA 1MEC3 4K1YA 2DVBA 4RHV1 3UYJA 2R16A 3WP4A 3ZLIA 5JR2A 1HKDA 5DDJ2 3IPVA 1VALA 3H1YA 2BTVC 2ZMNA 2A7AA 4UBHA 3KSCA 2VZ3A 1DDLA 2DV9A 3UT0A 4JGZA 4P9GA 2VR4A 5IUQA 5BV6A 1I6XA 4CCDA 3LIGA 3N9PA 3EXUA 5C3OA 5C8WA 2GAUA 3D8CA 4LMFA 4I3GA 1GP5A 1NLQA 1JN2P 2XGXA 4AVCA 4IE4A 1MQTA 1POV0 3NNLA 1DYKA 1XXNA 2Q5TA 2A3YA 2EXJA 2IVIB 3AZZA 2VO5A 2DCZA 3FWEA 3OB8A 5K0UA 1VP6A 4BZ4A 2E51A 1FYUA 1TQ5A 2EF6A 5FY5A 5J48A 4M4RA 4AVVA 3ALQA 2QQOA 4QM9A 1VBA3 5L7OB 4CUBA 3KB5A 4Y1ZA 2H0BA 3SCHA 1V9U2 2QQLA 4FSJA 3DYOA 3AKQA 5FK7A 4DXTA 1P8JA 2DU1A 4LJHA 3N36A 3CQOA 2LRPA 3HN1A 1RUF3 1VBA1 4IV3C 4IGQA 3D5OA 4MVTA 2D93A 3SKVA 5JZGA 2XL9A 1OD5A 3MIDA 4PF1A 2MHFA 1APNA 2LTNA 2O8OA 2VQAA 3A21A 4XUNA 1EUTA 2QQPA 2YV8A 1LJ7A 1RGSA 1RUF1 3UK9A 1AR73 2XBO3 4YW5A 4FPEA 3O1UA 4BH9A 4AHWA 3DXUA 2VUJA 3VKMA 4MG2A 1C5HA 3OBAA 4COUA 4MH0E 3OTFA 2YFUA 2DVDA 4AI1A 2XBO1 1X50A 4XJAA 3MW2A 1GKBA 4N9HA 2OQ7A 2BU9A 3NAPA 4D7SA 4OULA 5KHIA 4XEZA 4XJ8A 1AL22 3UETA 1GZWA 2ZAHA 5IVBA 3WG3A 2R1DA 1N1TA 1X8EA 1BVVA 3OGGA 5ERLA 1HDKA 4IE7A 4O61A 2F6BA 2XKPA 1AYM2 3O1VA 4WVMA 2QQWA 1S0IA 3ZR5A 2VUCA 3APBA 4XJ9A 5I93A 4D0QA 4FFIA 1OA2A 2VMEA 4KU7A 4F83A 1FXZA 1DG6A 2ZEYA 4BQ4A 1D2SA 3AYDA 4Q4Y3 5DG1A 3VBSA 1ZZ9A 4A7YA 2JDZA 4XUPA 5LRSA 1C4RA 2EAKA 2FMDA 5BNNB 4R9DA 3A23A 1J3QA 1R093 1S2KA 5FKCA 5J7MA 5GLUA 2ARBA 3ZXAC 2B7YA 2W1UA 4H14A 2ZGPA 2QZ3A 4Q4Y1 5FMDA 2HWE1 4KG0A 3RJRA 1UZWA 2RS32 2E63A 2P4EA 3GGLA 5LBEA 4AQ2A 2WNEA 2HEWF 4MX3A 3ZSEA 5C7GA 5LA0A 1VMJA 2X05A 5FAXA 3S7EA 1ONAA 3DYPA 1UY0A 2WNVB 1OI6A 1QH7A 2RM22 4FO9A 4RGAA 2EIGA 1PVC3 2P6HA 2DYCA 2VOTA 2WZ8A 3LE0A 3PURA 4YVWB 4ASKA 3VBUC 3SEPA 1W9SA 4WBBA 1G7YA 1OXCA 4F3JA 3V0AB 1W2AX 1QIQA 2G19A 1AR93 1HX6A 1UKRA 4LKDA 5IWFA 4CDXA 1G6NA 1RMU3 5GALA 1UY1A 5JCTA 2B42B 1PVC1 1NZCA 1DYOA 1SHWB 3CO2A 2J42A 3HVDA 1WLCA 1R082 2AEZA 3ETPA 3K51A 3VBHB 4B8EA 5EFUA 4BISA 4OQ8A 4KG8A 3ZIWA 5T5JA 5IW0A 4MYEA 1BK0A 1H2MA 2EAAA 1DLLA 2YBKA 1O5UA 2AH2A 1RMU1 2VCCA 1WCKA 4MHUA 1GQPA 3B93A 1NKGA 2ERFA 4Y22A 5BNOA 4ARXA 5EIYB 5FO9B 2R1BA 4Y4RA 5JSPA 2XJTA 5FZ0A 4YSFA 1ST8A 4X8PA 2QTWB 2XUEA 1JW6A 2FCVA 2ZEXA 2XJRA 1V70A 2OVUA 1LHVA 5FP7A 1ND3C 4WVVA 2GN3A 1AXKA 4CU7A 3NV1A 1QOSA 1W9WA 2YB7A 3J7MA 3M8LA 3NL1A 5FY8A 2PHTA 1W6QA 2ARCA 4RQPA 4OUMA 4QQLA 2ZGQA 4N9IA 2XVGA 3MHZA 3N7JA 2XDVA 1K5MC 3ZVXA 2V72A 2C0ZA 2VBPA 1ULOA 1YRZA 3LIHA 3Q8FA 1XU1A 2GALA 4BQWA 2BRTA 5IJRA 1GV9A 1QJU1 4PT6A 5FPAA 4QX5A 3ZXGA 1O59A 2JE7A 2GP5A 2PHXA 3RMYA 5C5UA 1W2NA 4MGTA 1OF4A 3M4FA 5AC91 2R063 2WLQA 5DMYA 4GULA 4H7LA 1Q8SA 1DCSA 4R52A 3TN92 2FD8A 3IT8A 3IDCB 1AR83 4HT1T 5FLIA 5IT6A 3MIFA 1QJY3 3WV6A 4UW4A 2ZHNA 1RJ8A 4L99A 4H7MA 3N9OA 2GMMA 2HWD1 3WF3A 4IV1B 5T5OA 2ZGUA 1B35C 4NIIA 1UQXA 5EXOA 1FMD2 2WFF2 4LPLA 4O7XA 1I9RA 3UV9A 3TWIA 1ZRIA 2ET7A 3ROUA 2PHLA 4E27A 2BWCA 1DQ1A 1WD3A 1KQRA 1ZYBA 3C3VA 3LEKA 3R4DB 5K4LA 1GZCA 5LATA 3NMBA 3NNMA 2XQRA 3H3ZA 2W94A 2VNGA 5FY9A 1XBFA 1YI7A 2DBNA 3NV3A 4N43A 2OQ6A 4CEYB 3KD4A 5EYXA 4K7JA 4HG6B 3FMGA 3IAQA 3NKTA 3KHCA 5FIXA 3RNSA 1OH4A 4RS5B 1PGL2 3NNJA 4CCLA 1PMJX 5GZEA 3LGRA 2X09A 2VMDA 4FPHA 3FJSA 3JU9A 4QPIC 1DQ4A 5IVEA 4CEWC 1F15A 2VD7A 3BN6A 1YHFA 2JG8C 2RDSA 2WC2A 1ULCA 5F2WA 3ST7A 3S5QA 3AM2A 4HZFA 4BJ0A 3W5MA 3MZHA 1ZZ6A 1NA1B 1EV13 3NKGA 2G4IA 2HWC1 2R043 4K9SA 4DO0A 5C70A 2BZDA 1JZ2A 3LSEA 5F5AA 5IYYA 3POSA 4XHXA 1ULDA 2HBTA 2V73A 2ZMKA 4JKLA 1HIXA 1XC6A 2CU5A 4N53A 3RYKA 2LW8A 4URTA 2JE9A 3CDZB 4RN5A 3VKOA 1HJFA 1EV11 3ATGA 2I74A 3ECQA 4GAZA 4LBNA 2R041 4AQTA 2P6CA 1CJDA 2LALA 3C7HA 5FYSA 1KS5A 3ZFEA 3BGAA 2J1UA 2C26A 3WZ1A 3D4KA 1D7PM 1J58A 1REFA 3B00A 4E8DA 3QBQA 4K21A 1DGRN 3KVAA 2QNKA 5FP3A 5B4NA 5KXBA 3C2UA 2Y0OA 3ZDSA 3ZFFA 3S0MA 3ETQA 1QH6A 2VVFA 4Y1XA 5F1RA 5JWPA 3BVCA 3SH3A 1BJQA 1JH5A 1AZDA 3ILRA 2VW0A 4MUVA 3MUZ1 4YVSA 3POIA 4XF3A 2ZGNA 3TEWA 1ZBE2 4Y5SA 3O1TA 2RS12 3AKSA 1NCQC 3J7LA 1A78A 4GIQA 4QX3A 4AFMA 3I3DA 3M70A 1FNYA 2DTWA 3I2FA 1CESA 4ISQA 1Q5OA 1ZZBA 4QDSA 1GP4A 2QQIA 3AZVA 5JAXA 5FYCA 1BVP1 5FLJA 5FTTC 3ILFA 4AI3A 1YQCA 1JXNA 2Z5WA 1ZA4A 4ZS3A 4Y26A 2EIDA 4XF0A 5DUXA 4HK9A 4HVQA 3MLLA 4QKNA 3X29B 2VVDA 2VZOA 2WNUA 2VM9A 3RQ0A 5HCFA 4K20A 4FP2A 1HN0A 1SLIA 5A33A 1WLWA 3RPQA 5BUVA 2AGSA 2XOMA 3VBOC 3MFCA 2GC2A 1H30A 2WZEA 4IE6A 3KCXA 4M00A 2D6PA 1JODA 4NVPA 4JGYA 4XTMA 2PELA 4HN0A 1RINA 1JU3A 1LODA 2W5FA 3MFAA 4GMP0 5CYYA 3PHMA 3VL8A 3THDA 1IS4A 2E53A 2ZHKA 5FYUA 3KV9A 2J1EA 3WNMA 1GOGA 2ID4A 4YGBA 3ACHA 4N7IA 3SMHA 5A32B 4LR4A 2WT2A 1PO13 2D3PA 1RUC2 3IM0A 1SLLA 3M2MA 1U5XA 4IGPA 4P14A 4QXKA 3WSOA 2WAAA 3U4XA 3VHPA 2ZGRA 4XAEA 4YM2A 5CEHA 4DNYA 4BMBA 2WWSA 2VZQA 1Q8VA 4QPGA 4OZOA 3EMRA 2QDRA 5F9TA 1XPWA 2CYFA 3D0SA 5FZBA 4PDWA 1ZRCA 4R9AA 4H2AA 3POBA 2CY6A 1G9DA 3FL7A 4Y20A 4Z82A 4RR3A 5K8SA 1J83A 4FAGA 5F7UA 2EXIA 2Q8EA 1SLTA 4D7YA 4YLZA 1LTEA 2ZEWA 2ZX2A 1N3QA 3CMGA 3LWCA 4KMQA 5ABJC 3IWZA 3UKTA 2GNMA 4XCBA 4C8DA 4UWDA 4CDUB 3V0BB 4BA6A 1DIWA 1DU3D 4NWWA 3ZIXA 3OYWA 4GH4C 5I8SA 4E2QA 1W8ZA 1CPMA 1L3JA 2KM2A 1S0GA 4I30A 3WQ1A 3CJIA 2GC1A 3ZKYA 3P6BA 2MPFA 1I5PA 2WAOA 1NYWA 4HMZA 4IETA 4JHTA 3V56A 2V5YA 1ZX5A 2YGLA 4W4ZA 5CISA 5LK5A 3I49A 1ZRFA 3W20A 3UGGA 1I5ZA 1UY3A 2VVEA 2W52A 2HKXA 4HVRA 1VBC2 2HH9A 4XFGA 1AR63 3OOXA 3WDVA 4B29A 4E8CA 1W28A 2FDGA 4XZUG 3PIJA 1PX3A 3BIEA 2EA7A 2PHDA 4AEDB 1A3KA 1S0DA 4E2GA 4TYSA 2HBUA 1RUJ1 1XSRA 3HJRA 1X9PA 4NPLA 2RHPA 1S4CA 4NO4A 4P9XA 4MXWB 3U37A 2IVJA 3ZYJB 4AGGA 1HXS3 1RHI2 2NN8A 4L11A 4P9IA 1VPHA 2JG9C 2H6CA 3F2ZA 2DDUA 1VRH2 3I2GA 3LQCA 4OI4A 2DVAA 2R073 1HB2A 2VU9A 4G4FA 4IESA 4XIKA 5FZOB 4BIFA 3OY8A 4CDWB 2OZJA 2VZRA 4JDOA 2BPA2 3RYRA 1REDA 2VQTA 3K3NA 1Q43A 4J1WA 2ES3A 4BB3A 2D98A 5J36A 2R071 3I7DA 3AZYA 1NUKA 2VMFA 2WA3A 2JG8B 1BMV2 5LBBA 3SH5A 3N35A 4MGSA 1XE0A 4TZDA 4D94A 4YW1A 2VZTA 4ET7A 4QU1A 3GF6A 1W6PB 5EV7A 4ZU5A 4DUXA 2WIIB 3M3OA 2QDNA 2V5DA 2PTMA 5CVRA 1S0BA 1DGWA 4CZSA 1NOVA 2VL4A 5FPVA 3I2KA 4CUGA 2PA7A 2GH2A 4HVOA 5CG9A 4IV3A 2OXBA 2R0FA 3B94A 3ZO0B 2DUQA 2ZX4A 4I09A 4JQTA 4YGEA 1V6JA 1SCRA 5ANQA 1TME2 1W6NA 3KCYA 5FYTA 1BEV3 4LBQD 5DZGA 3FHIB 1QOOA 3LEGA 5DZEA 1LB2A 4YGDA 2J22A 4OHZA 4DRRA 1HRI2 3O12A 4YPJA 1DGWX 1N1SA 1BYHA 4ZONA 1CAXB 5FZLA 5JIAA 1B09A 3H3UA 5HXMA 1LU2A 1R1A3 1VBD1 2UU8A 1AXZA 2Z79A 3IDBB 3KQ4B 4UFHA 3WDUA 4LKFA 1MS1A 1V6MA 3AVSA 3M1HA 4NN0A 2A1XA 5IVYA 2NPIA 2QFEA 4Q0QA 4QAWA 4CXYA 4DUWA 3I2OA 1OF3A 1UZ0A 5A3NA 2NLRA 3UJOA 3VDDB 4N8MA 1UXZA 2BNNA 1R1A1 2WZR2 2I45A 3G7DA 1OH3A 1YQ8A 1YQ5A 3PMSA 5A6XA 1BBT3 1AUYA 2C5DA 3AXEA 1UYXA 1NCRB 3VBFC 1ZBA3 1IKQA 1RUG2 3BYWA 2XQXA 1K42A 4FVVA 5K9YA 2Y6HA 5C33A 1V6IA 2ZS6B 5L19A 1WBLA 2Y6FA 3QH7A 1BBT1 3JBG3 4LK6A 4QX0A 5J3UA 4B4RA 1ZBA1 2A6XA 3NJYA 4P9JA 1JYWA 4CRQA 1AVBA 2KR2A 1UW8A 3I3QA 4IQPA 4OFGA 4QQ2A 4R9CA 5BNPB 1VAKA 5CAZA 1M4WA 4A45A 1UY4A 3GBWA 2Q8OA 3N9NA 3JBG1 1PM4A 3O1MA 4LO4B 3IKWA 1J1LA 5JPMB 1UU5A 2PFWA 5E1RA 4X6RB 2Q1FA 3MI8A 2BP6A 2PLV2 1XE7A 2JECA 5FY7A 3E5UA 3WLUA 1IS3A 1DZQA 1UKGA 3AP4A 2BUKA 5C4WB 1AYN2 1CQ9A 1GWKA 2Q1MA 1IQDC 3S30A 3VBUA 4LK7A 1CAUB 3G6JB 4NRPA 3LDKA 4K8FA 2HWB2 1IGOA 3ZYPA 3KV4A 4DOUA 5FPUA 3NSTA 1VBE2 4L8QA 4ZKTB 5HCAA 2RR13 4UF0A 4XHBA 4YWAA 3P1IA 3RJ2X 1W3XA 1PX4A 4KGQA 2K0GA 3PDQA 5ACA3 3N9MA 3NV4A 5FZ7A 3LDBA 4KNCA 2IC1A 5TSWA 3NNFA 4YW3A 1JYNA 5FXWA 2VUDA 4YRDA 1CAVB 3OGJA 2RR11 4AFDA 4XXPA 3ENRA 5JVVA 3A22A 3IMMA 2J1TA 1IG0A 3N7LA 4MGQA 1RUH2 3ZYIB 4R4XA 2J1AA 2Y60A 1VB4A 2QCSB 5CKQA 3BALA 4R9BA 1RUD3 2WS93 1TZOA 4IE5A 3BKZA 3ZXJA 1WCQA 1ND3A 1V6NA 5FZKA 4PQQA 1OFNA 5JSRA 2C4XA 3EBRA 4CP2A 4Q4W3 1WZXA 3I2DA 1WA4A 1GQHA 2GH8A 1NE6A 1K5MA 1QJEA 2CSGA 2OA2A 3HT1A 2YGMA 1SFNA 5FXZA 2ZXQA 1O7FA 4GJYA 5M0TA 4XF1A 3T0BA 3VHRA 4JV4A 1HB4A 4XXAA 2ADDA 5FXXA 1KFUL 3MO4A 4J1XA 3WG1A 4CPBA 1C57A 3T0AA 2PQSA 1HQWA 1ZVFA 1CIWA 1MEC2 1TMF3 3HQUA 3DXTA 4CU8A 4YW2A 3LAGA 5JOWA 1FV2A 5F5QA 5BNNC 1YYNA 3VV1A 5F3EA 5JXHA 1HJGA 2ILMA 4LO6B 3OEBA 1ENQA 5DAQA 1KDKA 1B35A 1QJFA 3HNBM 3BOWA 3IZOA 3ZN6A 1QGLA 1Y7BA 3EYPA 4BYYA 5A6YA 3MUY1 4KU8A 3KWVA 3DYMA 1Z78A 4FPYA 5FYHA 1FOD3 1WD4A 3H0OA 4PLNA 4Q0UA 1X9TA 4RYDA 3VDBA 4LT5A 1JYIA 4XACA 1VMHA 3OGSA 2X5IB 3W21A 2QQVA 2WO7A 4CP9A 4CCOA 4DEQA 2WNVC 1MS3A 1DLCA 1NY71 4LORA 1VBA2 4AEJA 3AP7A 3AP5A 5FZIA 1BKZA 1MZ6A 2WKKA 2UYAA 4XUQA 4NRQA 4YVWC 1W90A 5HBAA 4LUMA 1LOFC 3MIBA 3PJYA 3BTYA 2W1SA 3JQXA 1OBNA 3MBWA 1LHWA 4JVAA 3K77A 1F2NA 3KZ4C 1UX7A 2P37A 4AL9A 4QPIA 2YUEA 1RUF2 4QT6A 3RZZA 4CEWA 1WA6X 2J1SA 3NRUA 4FXKB 3VBHC 4HKLA 2ENRA 2UWBA 4EWDA 4TN7A 5C3QA 1H2KA 2WA4A 1HV0A 1OLMA 3LD8A 2ZX1A 1AR72 2XBO2 2WZPP 3UL2A 4Q4X3 2OW4A 1H4GA 2F4LA 1IKPA 4P02B 1QY4A 5FPBA 4QKDA 5L73A 2QBXA 1N3PA 4IW3A 4UBGA 3VD9A 4EJRA 4AZZA 3P5BA 1UIJA 4LHKA 2VAUA 4FXGB 2EXKA 3O5SA 4AW7A 4UW3A 4ORFA 3H8OA 3H9AA 4RHV3 3POFA 1JBCA 1W0OA 2BOIA 2Y26A 3AJYA 1AX2A 2XUMA 3ACLA 3GM8A 4JKMA 3WW2A 3H8RA 4M4PA 1H4HA 4LKEA 3WHTA 5C5TA 2PQQA 3NJZA 5LA2A 4ARYA 1WMXA 2DTYA 3DKQA 4DEVA 2ZZQA 1NCQA 4XJWA 4LTAA 5DAWA 1RVF1 2Y8KA 3O14A 4D7TA 1UD1A 1HB3A 3OD4A 3WF0A 3MYXA 4CDQB 1TVGA 4Q4Y2 3PVOA 2VJXA 1A34A 5A3MA 3B9CA 5FXVA 4EE2A 3RZHA 1UO9A 3HPNA 2VQUA 1R092 2VMIA 2VCBA 3LZZA 5EJ1B 1OLRA 1OLME 1W6OA 1RIRA 3T2QA 4A44A 1W2UA 2NMOA 4IV1C 2VW1A 5G04L 3ZXDA 3HNMA 1XNAA 1W0PA 4CE8A 4BM8A 4CCJA 4ZZ5A 5FZAA 2XWJB 3FX3A 2RMU1 4MGZE 4Q4V3 2BBAA 4XMIA 3VBOA 3NO8A 3I2IA 1UNBA 1D4M1 2DCKA 5DZFA 4CEYC 3LOIA 3P3PA 4OMCA 1PVC2 3KT7A 3KT4A 1WGPA 5FZMA 3ZPOA 3RWNA 4RS5C 5LBCA 1FPN1 4QX1A 1GLHA 4Q4V1 5CZKA 3USUB 3NJXA 4A42A 4TLGA 2TBVA 1SLAA 1AR92 5FQ0B 2D6NA 4GQ7A 4MGKE 1RMU2 4OI1A 5J96B 1YQ6A 1CPNA 4QDQA 1OC1A 4X6QB 1ASJ1 2B46X 1NA1C 3PL0A 2W47A 1JZ4A 2XVKA 3JD73 1S2BA 2ZJCA 2OIIA 4HANA 4ZXEA 5I0UA 4C0BA 3RZKA 4MGIE 4YW4A 1LENA 1LGBA 2FQPA 4X8NA 2ATFA 3T1MA 2R32A 2W87A 2WUHA 2PMWB 3IAPA 1WLDA 3V64A 2Z4FA 5E6HA 3USSA 4I0BA 4E2SA 5K7PA 4IE0A 2GN7A 3JD71 4BK4A 3ZFEB 1Q8OA 4SLIA 4E9KA 1LOCA 5SV8A 2P3KA 5KXDA 2ARXA 4JTOA 4SBVA 1G9BA 2JWPA 4HLTA 3ELNA 5ABJA 2WO2A 4XC9A 2IXKA 3ZPYA 3T1LA 4BU2A 4CSWA 2MNGA 2BW8A 4QHBA 3WF1A 4GH4A 3IIIA 3HBZA 5FZHA 4YVSB 3K4DA 1CVNA 3U0ZA 4UOJA 2GMPA 5LRRA 1KJLA 4F8AA 1Q3EA 4R4ZA 3FHQA 1AJOA 1R64A 5KWRA 4W6YA 2HWE3 2RDNA 2R062 2VXJA 2ZAAA 5ISLA 2ADEA 3MGUA 1UOFA 5T5LA 3SLIA 2W1QA 1F5JA 2VOWA 3NVCA 4JRAA 3RI8A 3ZYBA 4GMP1 1AR82 5FO8B 4UFKA 4WM8B 4EWEA 3Q9OA 3PTRB 1QJY2 2B8MA 3U1XA 1UOBA 4K3UA 4UFIA 4BLJA 1UMZA 4LULA 1REEA 3IDEA 3M7AA 3GXUA 1ND2B 3O1PA 1OUSA 5FY4A 1JTZX 1AX0A 1PK6C 2JG9A 4TXWA 4DMIA 2X8KA 1D0GA 4Q2FA 3N9LA 5LW9A 1GWLA 1O91A 4GA9A 2OYZA 3N4MA 2OUHA 3LA3A 4FPKA 4C1XA 5D2AA 4NRMA 5DDJ1 5JI9A 1H2NA 2YXSA 2EVXA 5HV4A 5D8AC 5CKNA 2BVVA 3SXWA 1Z7S3 5EPAA 3LPGA 1QJZA 4KWUA 2JDPA 3OPWA 5H9RA 3VD7A 4E4DX 5BYNA 3KVBA 3T2PA 3CNAA 1VBB3 2D40A 3E6BA 3WNNA 3THTA 1UXXX 4LA3A 2A6YA 4J6GA 4O9EA 3RMXA 1BXHA 4P08A 1X82A 3AKRA 3WNPA 5DAXA 3TAYA 1Z7S1 2A73B 4IDZA 3TEYA 3KV5A 3BU7A 1YO8A 2MEV3 5H9SA 2LM3A 3TRSB 1VBB1 1NLRA 2CDPA 1EV12 1VE0A 3H8XA 5FY0A 1V0AA 4GZ9A 4AK3A 2ETEA 3UESA 1V9U1 4QXHA 4QU2A 2MEV1 4GKXA 2K9ZA 4FPCA 4Y3OA 2NZ9A 4RR3B 3GCXA 4H55A 2DVFA 2VXRA 2VNVA 1QJU3 2VOKA 4K1ZA 4XAAA 1OQ1A 1GWMA 3TNPB 5A7WB 3AXDA 1W6MA 2P3YA 4IEZA 3VZLA 3HIFA 5AC93 2E6VA 4B1LA 2RS53 3EB7A 5LZ6A 2AYHA 2O14A 4YNIA 4AVTA 1C8M3 2JD4A 1WUVA 3UGHA 4CDUC 4DRVA 2PHWA 4W8JA 3O0XA 1ULPA 3VN4A 4GB33 4IEVA 2VTFA 2H6BA
chains in the Genus database with same CATH topology
1N47A 2RS51 4HFSA 2QVSB 3WW1A 1HQNA 2E7TA 2HWD3 4WM7B 1GFF2 1C8M1 2IXIA 4P9WA 4META 4JRLA 3DUIA 4YZ3A 4A7ZA 1WLTA 4GB31 4S2FA 2NMNA 1VAVA 3AMPA 2XPJA 3ES4A 1AL21 2XKOA 2YROA 2DVGA 1LEDA 3VBFA 3I8TA 3PJQA 3CU7A 4OLLA 4AEDC 2ZGKA 3I59A 1GSLA 1XNCA 1AYM1 2P34A 1GYKA 1LOAA 4XJZA 1EYBA 3VL9A 2R0HA 3AP6A 1DF0A 3J8F3 3KMHA 4AQSA 2YC0A 4AHXA 4CDWC 3AJZA 1SLBA 2NQYA 1CN1A 1MR5A 1XNKA 4AGRA 4D69A 4PBOA 3SH4A 2HWC3 5LK7B 3J8F1 5T50A 1SBFA 3LOBA 1H0BA 3OBTA 3ZXKA 5KBFA 2IXLA 2XLAA 1PO12 5L7OA 4IERA 3MICA 2AENA 3AYAA 4DZGA 2VNOA 3BTAA 4KQ7A 1NQJA 1J3RA 3ZFGA 1EP0A 1Q56A 4K6BA 5JMCA 3NWKA 3WOGA 2KXLA 1LEMA 3KCCA 4JQRA 5FREA 1O4YA 1FT9A 4HPKB 4GWNA 3HAGA 1CAWB 3ZYRA 1OOPB 2UYBA 4M01A 1RUI3 5JOYA 2GZWA 5GZGA 3H1MA 1NQDA 4EROA 4C91A 5GKAC 4COVA 1RUE3 1WCSA 3LA7A 4FOWA 3H8UA 5I0RA 2XL7A 1GZ9A 1RUI1 1MS8A 1U5ZA 2D43A 2XWBB 5JDBA 5IK8A 2Q0AA 3DGTA 3H1WA 4AVAA 1SLCA 5FFOC 3LKJA 1URXA 1YFYA 5DXDA 1RUE1 3B01A 1YFWA 2XLFA 3WCRA 1HQLA 1DGRA 4PCRA 3VDDC 2VG9A 1PGW1 4YZ1A 3U10A 4B4PA 4ZXKA 4ASMB 4NOTA 1NCRC 1AR62 1QXJA 2QKDA 5GLVA 2YY1A 3H7YA 1ZRDA 1PK6B 1SFYA 5DG2A 2TNFA 3TN93 1KD7A 4GXLA 1HXS2 4BPZA 1H9WA 2A3XA 4YFWA 2R072 1U5IA 5D8AB 5BNPC 3ZN5A 1O5LA 3TN91 3KS7A 2R6QA 1RC6A 4M3CB 3IMNA 4XBNA 3QCWA 1MZEA 4L97A 1XQNA 4TWTA 1AJKA 2Z69A 1FMD1 3NW4A 2WNVA 3B69A 5C4WC 4HSLA 3KGZA 4GWMA 4YVWA 4AWDA 2TEPA 4XPVA 4LO5B 1LOFA 4BCUA 1XYPA 3TYJA 3V0AA 2ZGOA 2G9FA 2D44A 1F8VA 3V65A 2WT1A 2E9QA 3SITA 4I0WB 1JHNA 5JZGC 1ENRA 5C9AB 3VBHA 3POYA 4AF9A 1UU6A 3MLKA 2NYYA 1Z0HA 2ZKLA 1BEV2 1DQ5A 1QJX3 2CV6A 3VBRB 3WINE 1FV3A 3ZSLA 4FBFA 2SLIA 1UZYA 3MW4A 4WV8A 1SQ4A 3MDPA 3WHUA 1XU2A 1QJX1 2F4PA 2E7AA 1KITA 4DB5A 4YM1A 1YI9A 5GZDA 4PQ9A 5CNAA 2QZ2A 1RUJ3 3E5QA 3WNXA 1X33A 2CWMA 2VPVA 4CYDA 1DYPA 1LKNA 1BBT2 1UU4A 1S0JA 1U12A 4LE3A 1A8DA 1MACA 1N3OA 1ZBA2 2D6OX 2ZZJA 3AX4A 4IEYA 2C1FA 5CFDB 4FPOB 2RS11 2IFRA 3PLQA 1QU0A 3JZVA 1DQ0A 3DPRB 3WD5A 1IHMA 5C8CB 4OZXA 4O9GA 5E16A 4FTBA 1O4ZA 3GZAA 2YDEA 3ASIA 1OSGA 2EXHA 4AE2A 2AREA 2X5IC 3FLRA 3ZXEA 3AMNA 2P2KA 4XILA 3SNMA 3THPA 1ZZ8A 1MVQA 4CEYA 1A8MA 4P9LA 3JB4C 1HW5A 5JR7B 3J26N 4RS5A 2W08A 4YFZA 3WG2A 5LEJA 5EYYA 1I1EA 2RR12 4LLFA 5KC5A 1ZZ7A 1O3RA 3MPPG 3FFZA 1VBD3 5ACA2 1H8TB 1NA1A 3PMEA 4AVBA 1WMFA 4PLMA 4FOQA 5HI0A 2KA3A 4HK8A 1RUC1 4OHVA 5BNOC 2ZMLA 5E89A 1YXWA 3E97A 3PVEA 1KRIA 1V00A 2HWF3 5CBLA 4FOVA 1LRHA 1UZZA 2QUOA 5GZFA 1C5IA 1QQP3 4IXLA 1RUD2 1OHFA 2WS92 3WY6A 4KBBA 4YG6A 2HWF1 4LBQB 1OQDA 4Q4W2 1POV1 3DN7A 1QQP1 3ILNA 3PVNA 1VAMA 4XQ4A 4AXOA 3BODA 3DKWA 4B3NA 2WINB 3IPVB 1JUIA 2IWGB 4RL7A 1PGSA 2D6KA 1IQAA 4JGZB 4OUSA 4DS0A 1TMF2 1ALYA 1KXGA 2ZX3A 4CDQC 2VH9A 4PLOA 5EJ3A 4I0AA 4A7KA 2AR6A 4Y24A 1TEIA 1MQTB 4QGMA 2VECA 4XBLA 3CEWA 3TNQA 2CGPA 3PTYA 5K0UB 1JOJA 1VBC1 2AUYA 2JKBA 1NY72 4I3PA 1FOD2 1C8NA 1A6CA 2FBEA 2GC3A 2N7GA 3AMQA 1H1IA 4Z1VA 4XFHA 1VRH1 1PZ8A 4BHPA 4Y1YA 5AFEA 5LEKA 2QE3A 2GDFA 4YG3A 3WDXA 1ENXA 5JZGB 2UWCA 1QDOA 4A3XA 5A32A 3PNAA 5CU1A 5JIUA 4FT8A 2X53S 3R0RA 3EHKA 2WQZC 1WW7A 1D2QA 2IXCA 4TSVA 1D0HA 1SBEA 4CTEA 1JUHA 3O0VA 3MPBA 4XE9A 4PIYA 4Q4X2 1IZ3A 1G8WA 4WZFA 1OLQA 3UJQA 3NAPB 4AFCA 2OZ6A 4RFT0 3L2YA 3ZFEC 2ZOEB 1LU1A 5AFBA 4Z92B 1GZWB 5BXXA 1COV3 1Y3TA 3M3QA 4LBMA 4YARA 2PAKA 1TME1 4RHV2 4CDUA 2O1QA 4WVMB 1J1TA 2TUNA 1TNRA 4Q0PA 2Y38A 3VLBB 1G86A 3KGLA 2CL2A 2Z2SB 3AZXA 1COV1 4YVSC 1HRI1 3VBSB 5IK4A 1TNFA 4IEWA 3BOPA 1H2LA 2VOXA 4WVZA 5FO7B 4EN6B 4Z8BA 1MZ5A 3LB9A 4XDQA 2VY0A 4WM8C 4ATFA 2ZX0A 4FPLA 3CF6E 4AEDA 4LHLA 3FLPA 2D5FA 5FRAA 3R6SA 1ND2C 4MXWA 1W39A 4XETA 1J59A 3B7MA 3VHOA 1YIFA 5CIRA 2PHRA 1PIV3 1PO23 4Q26A 1XE8A 3GBGA 4LA2A 3ZSKA 4CDWA 2WL1A 1H8VA 2YHJA 4Q4V2 2XJPA 1XRUA 2GSYA 4AEKA 5JOXA 4HETA 3ZMNA 4LBOA 1QF3A 4CDXB 1PIV1 3VHNA 3FUQA 1PO21 2XG3A 1OFSA 4QD2A 4P5HA 4YM3A 3OF1A 2JG8A 2R49A 3QACA 4RD7A 4EN0A 3R05A 4CP0A 1W6PA 3D82A 3WCSA 4PBPA 3JQWA 3ME2A 4Q27A 2PLV1 1QNYA 2DCTA 3E6DA 4Y22B 5BNOB 3JD72 3H50A 2ZGMA 1AYN1 3SISA 5KHGA 2XJQA 1N1VA 4KH9A 1S55A 2D7FA 4Q8LA 5GLWA 2XLGA 3AFGA 1LGNA 5T54A 2PHFA 4RR3C 2DURA 1W6QB 4RQPB 4IL7A 5CA6A 3WDYA 3LSDA 1PVXA 1UX6A 1DFQA 1V6KA 4N90A 1ENSA 1RVF3 1C1FA 5EWSA 3ZXFA 2GNBA 4YZ4A 1CAXA 4D3WA 3TBDA 4RSUA 4IEPA 5GM0A 3R4SA 4BIOA 2GC0A 1NE4A 2CWSA 4QGNA 3GBFA 1RUH1 1LCLA 2IZWA 1H1AA 4WM7C 3KT1A 3CLPA 2GNTA 3AMMA 2HWE2 2WSVA 3VDDA 2D97A 2CNAA 2I07B 2RMU3 1DHKB 1NCRA 4Q0SA 1D4M3 3I59B 4N7UA 1G9AA 4AYUA 2IXJA 2Q4SA 4LE4A 3M3CA 5FLHA 5KHHA 5I8YA 1FPN3 2A70A 2VQ0A 4DQAA 1CR7A 2BFUL 4N43B 1X36A 4LBJA 2XJUA 1MEC1 3OPZA 5BNPA 2B9UA 3DF0A 4JCKA 3RS6A 4XIOA 2P3IA 1GR3A 1IS6A 4MSVA 1ASJ3 2ZPXA 1RTVA 3HD8B 4AFBA 5GZCA 5KXCA 3BPZA 1Z7S2 3I54A 2G9GA 4AG4A 1PZ9A 5CFCB 4WVWA 3WUCA 1VBB2 1OMIA 4KWLA 5C4WA 4ES8A 2B5HA 4XYXA 1HRV3 3KM5A 1CAUA 1NLSA 2MEV2 1SBDA 1WMDA 4M0HA 1AXYA 1YUDA 3ZFGB 4N53B 2NM1A 3RYPA 1YLLA 1HRV1 1OPOA 2ZCWA 3GZUC 4QPYA 2DUOA 2YPJA 2CGOA 3VZJA 3O7OA 2UY9A 1OOPC 4PF5A 1G9CA 1QJU2 1CAVA 3AFKA 4H3WA 3OJBA 2HJIA 3MF6A 3ZFFB 5AC92 2RS52 3GZTB 4XF9A 5BPXA 4AHZA 3HWJA 2O8QA 3W9AA 1MS4A 1V6LA 4Z07A 5HCBA 1C8M2 1GBGA 4GMP3 4GB32 1AR71 4LLOA 5I91A 1EAH3 3B9IA 3FBYA 4EN7B 4HKWA 3WUDA 1IPJA 1ULFA 3U11A 2O0OA 2HWD2 2FZ1A 1DGLA 5B2GB 2PAMA 4IEOA 2WT0A 1AHSA 3EJKA 2LUWA 1EAH1 3VGIA 5FPXA 3U07A 1UAIA 4V1PA 3GNEA 5DDJ3 3L9JT 4JAAA 4G3YC 2WNUB 3UKVA 3WP6A 1SCSA 5A33B 3OCPA 2ZGSA 4HN1A 5F6LB 1M06G 1UCXA 4JGYB 3VKNA 3J8F2 2BEOA 5JI7A 1TE1B 3RRDA 3VKFC 3VZMA 5BNQA 4GKYA 1RUNA 3WT3A 2DU0A 4S2DA 1R1ZA 2HWC2 1OA4A 1R091 3DL3A 1WBFA 5GLZA 4Y1UA 4Q1PA 3MIEA 1V9U3 2X5IA 3WDWA 3M3EA 5DUWA 1LESA 1ZRRA 1RUOA 4QPGB 1LGCA 5FMOS 2R042 3I4IA 3WDTA 1PM7A 5J37A 1F5FA 4PDWB 4E4ZA 2GMEA 1CD3G 1QNWA 1YJLA 4JDNA 3CJXA 1Q8QA 4DINB 4Y20B 2XJSA 5FOJB 3N3HA 4XBQA 3AP9A 1ZM1A 2WJSA 5C9AC 1O3SA 2SBAA 1AR91 2UWAA 5J09A 2JENA 3VBRC 2DFBA 4TLFA 4ISRA 1RUI2 4FQ4A 3OYWB 1LHOA 3INAA 4AQ6A 3DV8A 5E88A 1UIKA 4R8HA 3CJIB 4IEQA 1RUE2 3HR9A 3BCWA 2PN5A 1AL23 4MGYE 4OI0A 1PGW2 4LO8A 1AYM3 1KFXL 3GHNA 4B7EA 1FNZA 5CB7A 3MEPA 3WQ0A 1GANA 1SDWA 3FUOA 4FCAA 4GALA 4FPJA 2XVLA 3WX5A 4BOWA 2GNDA 4YYOA 2P17A 2BGCA 1PNGA 3ZSJA 2R30A 3AK0A 2V09A 2BBVA 4YM0A 4CDQA 5CFDC 4QM8A 3OY8B 4QQOA 2A3WA 3HQXA 2R061 4I2OA 2WLPA 2RS33 1CONA 3DPRC 3WP5A 4W65A 5C8CC 4ASLA 1AR81 3WW4A 3KQRA 5I8TA 1X7NA 2ZHMA 1QJY1 2D3SA 3FBMA 2RM23 3AMHA 2RS31 4U36A 4COZA 4LUKA 1YWKA 3R4UA 5FBZA 5BY5A 1CX4A 1T6GC 4KWJA 1U5YA 4L2NA 1BCXA 1DQ6A 2RM21 3RI9A 3D0JA 2BNMA 4IV3B 4EN9B 3LA2A 2Q1ZB 4IEUA 3USUA 1R083 1OPMA 1W6NB 5FQ0A 1RL3A 2ZGLA 1IOAA 4UXAA 5JSOA 3D6EA 4OHWA 5D1IA 4Q0VA 1H8TC 3B3QE 1R081 1QJX2 3K48A 5J98B 5AVAA 2DWRA 5H9QA 2XJVA 4XTPA 4AFAA 1G9FA 5JLVA 4MXVA 4NHLA 1UL9A 1FAYA 3FE5A 3ZN4A 2Z42A 4UW5A 3B02A 3VZOA 5AVPA 1RUJ2 1O4TA 1QKQA 1QXRA 1LECA 4XMAA 4KGGA 1BZWA 2WQ4A 5T5PA 4Y1VA 3UKNA 3BIWE 1EPZA 1Y9QA 2PYTA 3H7JA 1E57A 3L2HA 4XJUA 2BWAA 1DQ2A 2EALA 2ZTNA 4XW3A 5KXEA 1VIWB 4JGZC 4JDMA 4XFIA 5SV5A 5BNNA 2E7QA 4AHYA 2C9AA 2IFWA 3AZWA 1H9PA 4BE3A 4WM8A 1FMD3 4DXZA 2WFF3 1WW4A 4M0NA 1MQTC 4COWA 1FI2A 1HV1A 1ND2A 4I02A 5K0UC 5FCCA 4LBLA 1Q8PA 2JEMA 2XHKA 4FQZA 3GALA 4Y4YA 2WFF1 1OKQA 4XQWA 3VBUB 1VJ2A 1XNDA 2DFCA 1YFUA 3A0NA 3ZX7A 4QQPA 1RITA 2FZ2A 1PGL1 1VB2A 4EWAA 1GNZA 1F31A 2FHRA 4K40A 2VULA 4QQHA 4S2HA 4LBKA 1VBD2 4W6WA 2A6VA 1VR3A 5FPZA 3JUUA 4Z2WA 2BYVE 1PO11 4OVEA 1ND3B 1GQGA 1R1A2 2HWF2 4XFCA 1C1LA 1KS4A 1RB8G 3NAPC 5HXVA 3N7MA 1U0AA 4A2UA 1QQP2 1IS5A 1LOBA 1UPSA 3FLTA 4FPGA 1K5MB 1F9KA 2HYKA 1LOGA 2W39A 4PJYA 3WP3A 4XF4A 4PIZA 1ZBE3 3GYDA 2RS13 3EQEA 1GICA 1H1MA 3GHMA 3WG4A 1MS5A 4M3CF 5JOZA 1XYNA 2ZBJA 3VBSC 2AZ5A 4WM7A 2PAEA 1MVEA 1ZBE1 3JBG2 1MZFA 4S2GA 1YCIA 1QOTA 3HMYA 3AYEA 4UW6A 3A0KA 1B35B 3MIHA 3ZN6B 4IV1A 5T52A 2K2SA 5H9PA 2VMGA 4AI0A 4WZCA 2ZGTA 1MS0A 3PVBB 5FMOL 1ZREA 1AR61 3O0WA 2CTVA 3CL1A 4P9YA 4B7KA 5DUUA 2W0XA 4XOGA 2OPKA 1HXS1 2BFUS 1AF9A 1LOEA 2UY8A 4CDXC 4QPIB 1LHUA 3RSJA 4CEWB 1RUC3 4NR1A 2JJ6A 3URFA 4ES9A 1OQEA 3J9SA 3WW3A 2WFPA 5IK5A 4L9BA 3IBMA 1PZ7A 4I01A 4BWOA 3EO6A 2UURA 1LHNA 4OI2A 1SEFA 2ZHLA 4Q1RA 1WMEA 3E6CC 1JYCA 4INDA 2ZA9A 4XFBA 3WVJA 1YIPA 3SCFA 3AKTA 1KDMA 1POV3 1EY2A 2RJLA 4HPKA 3FC0A 4KWKA 2ZACA 1QHDA 1X8MA 1WW6A 3IN9A 1CAWA 3JB8A 1OOPA 4RQPC 1XNBA 2A6WA 4QMAA 1COV2 4NPRA 2Y0IA 1YNAA 1SMVA 4ZU7A 2VMHA 1BEV1 2ZKNA 3QD6A 4W6XA 2RE9A 1C28A 2P3JA 3S6PA 1O3TA 2XH6A 1ULEA 2D6MA 1NCQB 2DCJA 2H0VA 4FAHA 4YG0A 3MLJA 1BK1A 4JC1A 1VLNA 2D6LX 1VBC3 5JPNB 2ZABA 4XQDA 1XYOA 3VZNA 3T2TA 3ZSMA 4AI8A 3SHRA 1DZRA 4BQ1A 4C1WA 1W6OB 2PHUA 3JCIA 1RJ7A 3LCPA 4RGGA 4HBNA 5FDBA 3P3NA 1DZTA 2QJVA 1RHI3 1S0CA 1Y43B 3A4UA 3WR0A 2A6ZA 1PK6A 4FTEA 1VRH3 1NG0A 1I3HA 2GU9A 3AB0A 1AL0G 4NHKA 1LULA 1QMJA 4Q8KA 3OBRA 3N7KA 3VBOB 1J3PA 1UPIA 1C3HA 2CGNA 2YMZA 1PIV2 1RHI1 1KJRA 2BVBA 2JX9A 4N43C 1PO22 4FOYA 5D8AA 4B4QA 2CAUA 3WXPA 4M3CA 4FTSA 4HSJA 2X29A 4AI2A 5CFCC 5DUVA 3OD0A 2DCYA 4XZPA 5F6KA 1V6OA 4MLOA 1BMV1 5L7OC 4OHYA 1UF2C 1LR5A 1PNFA 5A3LA 1BQPA 2FMYA 4DFSA 4CP1A 4ZU4A 1AX1A 3ZFGC 4N53C 4DY5A 3VZKA 5CG8A 1TME3 4HL0A 3ZMOA 4ATEA 4DY3A 4HKOA 2BNOA 1UN1A 4NWVA 4C0HA 5C9AA 3QLQA 1S0FA 2A75A 4Y5Z0 1FATA 5ABJB 4OHXA 2VGDA 1HRI3 1SACA 3VBRA 3V0BA 1OA3A 2IXHA 4ITCA 3RG0A 3ZFFC 1RVF2 5GLTA 4GH4B 5ACA1 4YZ5A 1IPKA 4LO7A 4G9SB 3HT2A 1O3QA 3FFQA 2CAVA 3QH6A 2RJKA 3S7IA 3E5XA 4L92A 2Q30A 4M3CE 4NHMA 5KC6A 2WSUA 2WZR3 1N1YA 4EN8B 1HLCA 1PHMA 1WW5A 1RUD1 2WS91 2OUJA 1RUG3 2WZR1 3M3IA 3WQ7A 3MF9A 1DBNA 2RMU2 4Q4W1 4LHNA 5KHKA 4QGLA 2BQPA 1MS9A 1D4M2 2JG9B 2WNUC 3VKLA 1RUG1 1S1AA 3POWA 2ET1A 5CFDA 3ZXLA 3KLSA 4YZ2A 1ZNPA 5T3NA 1FPN2 2W68A 2VNRA 4LNVA 4JGYC 2B45X 4COYA 3DPRA 1TMF1 1S0EA 3QOPA 5L36A 5T55A 3MW3A 4U2AA 5C8CA 2VUAA 1ASJ2 2DUPA 2PLV3 2VW2A 4Q29A 3IIAA 4EV0A 1AYN3 4MV2A 3FZ3A 2B39A 4F7ZA 2VOVA 5I0SA 2DF7A 2D5HA 3NV2A 2HWB3 2NP0A 1GNHA 4PIXA 1NXD1 2HEVF 1VBE3 2YYOA 4QPGC 1HRV2 4AEMA 1FOD1 1D4VB 1PMIA 1QWRA 2I2SA 2JICA 3TOJA 5IK7A 3J4UH 3AYCA 4FP3A 4JTNA 4PDWC 3UK9A 4DPNA 5EZWA 2XB6C 3BB6A 2HWB1 3AKPA 1CGPA 1VBE1 5CADA 1YFXA 1YJKA 2HEYF 4AGVA 1W6MB 5FOBB 4RA0A 3B5LB 2YZ4A 1H8TA 5GJ6A 1QXPA 3W59A 4BMEA 3VUOA 1RUH3 5E8AA 5KHJA 1WCDJ 2D3RA 3MIGA 3TB0A 1EPWA 4MZUA 3CJIC 3RDIA 4C90A