1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
1ZRCA 3DL3A 2CAUA 2B5HA 5JAXA 1YLLA 4YYOA 3OGJA 1CGPA 1WA4A 2D40A 1RC6A 3LA7A 2VECA 5CVRA 1O3SA 5FLIA 4FT8A 3NL1A 1CX4A 2GC3A 3L2HA 4LA3A 4IEWA 3I59A 2D5FA 1VJ2A 4ZU4A 1RL3A 1VP6A 2GC0A 4QXKA 1UIJA 3NW4A 2ZCWA 5LRRA 3IDCB 1DZRA 4IEYA 4QGLA 1YFWA 2PAKA 1G6NA 5D1IA 1YFYA 4B29A 4EWDA 3LAGA 5I8SA 4LLOA 1TQ5A 4IEPA 5I0TA 3E5UA 1HW5A 3D0JA 5JCTA 4XF4A 2CV6A 1ZZ8A 3C3VA 1ZRFA 3H7YA 3MZHA 3EO6A 4Q0VA 1VR3A 4KWKA 1O7FA 5I0SA 5LEKA 3SCHA 3ES1A 1SFNA 3ROUA 3RZZA 1XRUA 2D5HA 3ES4A 3O14A 1DGWA 4X6RB 3S0MA 5FPXA 2ZKLA 4QMAA 3NSTA 4XFAA 4LULA 2FMYA 2D93A 2OPKA 3IWZA 3PLQA 2Z69A 2H6BA 2EAAA 3EJKA 3SCGA 3FX3A 1U12A 4I0BA 4ZU5A 3NKTA 1X8MA 5HI0A 2MPFA 5EFUA 1EY2A 4HN1A 4PIZA 4FBFA 5LEJA 2HKXA 3HT1A 5JSPA 5J48A 1ZZ9A 5KBFA 1OFNA 1RUNA 3LA3A 2Y0OA 2XL7A 3M3IA 4P9GA 3CF6E 4AVAA 2PFWA 2GC1A 3CEWA 5JR7B 3U0ZA 2IXKA 4JVAA 3USSA 2GH2A 1QXRA 3H9AA 2QVSB 1OMIA 2OYZA 2PAEA 4O9GA 4Q0SA 3R6SA 2H6CA 2XLFA 3G7DA 4XF3A 5J7MA 5I0RA 5JSOA 3ACLA 4KU8A 1CAWA 4Q0QA 4YRDA 5CADA 2QDRA 2P17A 3DV8A 3E6DA 3BALA 3WW1A 3UKNA 4XF1A 4JV4A 1J3RA 3LZZA 4KU7A 2UYAA 3H8UA 1ZVFA 4PIXA 3BPZA 1Q3EA 4YARA 3RDIA 3KSCA 1UD1A 2DCTA 3E5QA 4K8FA 4PIYA 4XFFA 4E2QA 5I8TA 4EROA 4BH9A 1GQHA 4XFBA 2O8QA 3DKWA 4R8HA 2GZWA 3H50A 1CAWB 2BNNA 2ETEA 2Z2SB 1SEFA 2I45A 2H0VA 4EV0A 3FWEA 4MGKE 2WFPA 1X7NA 5EZWA 3I54A 2UY8A 1CAVA 2K9ZA 3OTFA 5I93A 3S7IA 4ORFA 4IEOA 1X82A 3MYXA 1O5LA 5BXXA 1NYWA 1FI2A 3FHIB 5AVPA 3IIAA 1UIKA 3WW3A 4HVOA 2UYBA 4LUMA 4IEXA 4I2OA 1ZX5A 1ZRRA 4IERA 2MHFA 4NVPA 2XHKA 4E2SA 1I6XA 3EHKA 3E5XA 3H3UA 5LRSA 4HVQA 3BU7A 4X6QB 3RYRA 3SHRA 3KGZA 3UKTA 2BNOA 4AQ6A 5FQ0B 4Q0PA 1H1IA 3ZDSA 1ZNPA 5KHJA 3JZVA 1O3RA 2IXCA 1NE4A 4Z82A 4QX5A 1CAXB 2XLAA 3CO2A 3PNAA 5K8SA 1CAUB 2PHDA 4J1WA 4L11A 2Q4SA 4MGZE 4HZFA 1IPJA 2CGPA 4XF9A 3HQXA 3S7EA 3FE5A 3U10A 3FJSA 3U11A 4JTNA 3H1YA 2XL9A 4FAGA 2BEOA 2PHLA 5KHHA 4QGNA 3MDPA 4EWAA 3OF1A 4IEVA 1RUOA 4BYYA 2K0GA 3D82A 3EQEA 4HSJA 2OZ6A 1J1LA 3LA2A 3BB6A 4LUKA 2EVXA 2VQAA 3RYPA 3H1WA 4LTAA 2BNMA 2XKPA 5FCCA 1ZZCA 4AVBA 4IESA 4QGMA 4D7SA 2PAMA 1CAUA 1UPIA 1O3QA 1YUDA 1PMIA 2IXLA 4D7TA 1WLTA 1IPKA 1XE8A 2XLGA 3NJZA 4HSLA 2WC2A 3OD0A 3WW2A 2O1QA 5FQ0A 3I59B 5BY5A 2GU9A 1ZRDA 5KHIA 2Q30A 1UCXA 2IXIA 4MGIE 5KHGA 4I09A 3H7JA 2B9UA 4XFHA 1J3PA 3NVCA 1ZREA 5FLHA 2IXHA 2GAUA 4I01A 3N4MA 1YWKA 3SXWA 5T3NA 3VHRA 2ET7A 4HVRA 2HJIA 4XFGA 3WW4A 1ZZBA 2B8MA 1CAVB 3GBFA 1J59A 2QJVA 1LR5A 3E6CC 2OA2A 3RYKA 2QCSB 4MV2A 5BPXA 1LRHA 3KCCA 3TNQA 4QM8A 4XFIA 3B02A 4GULA 2C0ZA 3CL1A 1NE6A 5F1RA 3QACA 1V70A 3FFQA 5I8YA 1LB2A 4A2UA 3IDBB 4OLLA 3IBMA 1CAXA 4I0AA 1RGSA 4IEUA 3ELNA 3DN7A 4KWJA 3LOIA 3GYDA 1Q43A 4MUVA 4EWEA 3I7DA 2PQQA 4MX3A 4F7ZA 4HBNA 1J58A 2FQPA 4KWLA 1O3TA 5I0UA 2XGXA 3HT2A 4H7LA 3SCFA 3TNPB 1Y9QA 1O5UA 1YFUA 3D0SA 4UXAA 3RNSA 1ZZ7A 1Y3TA 4QM9A 2KXLA 3M70A 1PM7A 2OZJA 5JSRA 2N7GA 2CAVA 4I3PA 4AXOA 1OI6A 2F4PA 2ET1A 2E9QA 1LKNA 4META 4LEJA 1Q5OA 2MNGA 4IEZA 5BUVA 3MPBA 4YSFA 3KGLA 5CU1A 5FPZA 4Q0UA 3UKVA 4BIFA 2ATFA 2V09A 2PTMA 4N9HA 1RTVA 4HLTA 4BHPA 1FXZA 1SQ4A 1DGRA 4XF0A 4IEQA 4UBGA 5J3UA 4ONUA 2QNKA 4AQ2A 5BV6A 4CYDA 1L3JA 4XFCA 4HMZA 5C6CA 4KL1A 3E97A 1ZZ6A 2Q1ZB 3RPQA 1DZTA 4AVCA 4WBBA 4N9IA 3E6BA 2XKOA 3KMHA 4FAHA 4YNIA 3CJXA 4HN0A 4WZCA 1GQGA 1EYBA 1QY4A 5C8WA 2PA7A 4PJYA 2UY9A 1EP0A 4UBHA 4ZU7A 3FZ3A 3LWCA 3H3ZA 2EA7A 4E2GA 4OFGA 1FT9A 4MZUA 1O4TA 2IC1A 4L2NA 3QOPA 4Z07A 1J3QA 2GC2A 4O9EA 1UW8A 1YFXA 1H1MA 4LA2A 5KHKA 4DINB 4MH0E 4WVZA 1YHFA 4MGYE 2BYVE 2BGCA 3BCWA 1JUHA 1QWRA 5I91A 2Q0AA 3ETQA 4IETA 3EBRA 3CLPA 2VPVA 1X8EA 4Q29A 3ST7A 1WGPA 2PYTA 3H1MA 4XETA 1I5ZA 2IXJA 5FLJA 1QXJA 3PVBB 5FDBA 1OD5A 5E1RA 4JTOA 4XEZA 1EPZA 4F8AA 1NXMA 4J1XA 4R52A 4I02A 4RD7A 1XE7A 3SMHA 3OCPA 1NZCA 3HIFA 4TLFA 5E16A
chains in the Genus database with same CATH superfamily
1T2XA 1ACCA 1RUJ1 1RUC1 5FZ4A 3B7MA 3OOXA 2EIDA 4YG0A 5LA0A 3O1MA 3UK9A 1LU2A 1YLLA 4LBNA 1CGPA 3PU3A 5A6QA 5F39A 3BTZA 4AHWA 4TLGA 3D4KA 1AX2A 1UZYA 1QJFA 4LBQB 2I07B 3AJYA 5FYUA 4P9JA 3VZLA 1QNYA 3DGTA 4CDXA 3JBG1 1GZWB 1YXWA 3ACGA 4DO0A 1YQ8A 1L7RA 3PIJA 1VAKA 1KGYA 5LBFA 1VJ2A 2AGSA 2HBTA 4A7KA 3Q8CA 5C5UA 1MS4A 2EXKA 5GKAC 4QXKA 2DTYA 1R1A3 5FYYA 1IPSA 1LHVA 1WMEA 1YI7A 1YQ6A 2VOKA 1TMF2 2VY0A 4P9XA 5F3CA 1DZRA 1AR71 1MZEA 5C3OA 1Y4WA 2PXJA 3MW3A 1ALYA 4V2WA 2BU9A 5D1IA 3AL6A 3AP9A 4K8RB 2EAKA 2ZBJA 1C1LA 3O1SA 1AR82 4C1WA 3WDVA 1AJKA 1QJU2 2YG0A 3B94A 4XPVA 2VU9A 1ASJ1 3C3VA 3GF6A 1QHDA 1F2NA 4FFIA 3ZR5A 4ASMB 4N43A 5B4NA 2LROA 3H7YA 4RR3A 2HYXA 3WHTA 4FPCA 1JZ6A 1NCQC 4Q0VA 1VR3A 5I0SA 4MGTA 4HK9A 5ISLA 4S2HA 3ES1A 1ASJ2 1MACA 3ROUA 1W39A 3WLUA 3ILFA 1ZRIA 2D5HA 2JG8B 1DGWA 2OT7A 3FLPA 4AVTA 3MFCA 3ZPYA 5AVAA 4BISA 4FCAA 2ZKLA 4YZ3A 4QMAA 4JRAA 4P00B 4A6OA 3IN9A 2FMYA 2IVJA 5JI9A 3IWZA 4MADA 2Z69A 2EAAA 2DV9A 5FY7A 2JKXA 4U36A 3EB7A 3SCGA 3FX3A 5L7OB 1HN1A 1RUG1 3P5BA 1I1EA 1W28A 4IGPA 4Y24A 5EYXA 1W9FA 5HI0A 1AYN1 2VW0A 5C9AC 2MPFA 2E26A 5IVEA 4EN0A 1V6KA 1UWWA 3OYWB 5F3GA 3AKRA 1FNYA 4QPGC 1JUIA 2XDVA 4M3CE 4WM7C 2XG3A 4NHXA 1V6IA 1H8VA 5JSPA 3WNOA 3VKOA 4NRPA 4Z2AA 2TEPA 1VAMA 3GBWA 4UW6A 1OFNA 5FKCA 3LA3A 2X5IC 2WZR1 2XL7A 3BIWE 1UU4A 4Q26A 4C90A 4QB2A 2GC1A 1GR3A 4RN5A 4I3GA 5JR7B 1AYM1 1RUD3 2IXKA 4BXSV 4WVVA 1NCQB 4QX8A 3USUA 1DBNA 3POGA 5FPUA 3N9NA 4CP9A 2QQVA 3OGVA 4INDA 3I8TA 4XQDA 5E6HA 1W9TA 1C5IA 2RDRA 3H9AA 5FPBA 3NNGA 3D8CA 3W9AA 2P6CA 2UWCA 5GLTA 2VNRA 2PAEA 2VUDA 1BQPA 2VOVA 3ACIA 4K7JA 3WDYA 4Y5TA 1ZBE3 3BVCA 1COV1 3U4XA 1G8WA 1VBE1 3CDZB 3DF0A 4V2VA 4WVWA 4HPKB 1G86A 4IV3C 3AK0A 4XF3A 1OVPA 5D21A 4CU9A 4FOVA 3ACLA 2FZ1A 1R64A 1RUE1 2VO5A 3G6JB 3I2HA 2GMEA 1TE1B 4Q4Y3 5CKMA 4YRDA 4QQPA 1WCUA 3DV8A 3E6DA 1VBC3 1HRV2 3LEMA 3MF9A 4K6BA 5A7QA 4AHZA 5HCAA 1N47A 1ENRA 2QQKA 2WBKA 1J3RA 4KU7A 3H8OA 3IAQA 1ZVFA 2YZ4A 2ZEXA 1GBGA 1VMHA 4PIXA 1TMF1 5CEHA 4DUXA 3TEWA 1MZ5A 2UWBA 4L97A 4EROA 1M06G 2R061 3WHUA 3FMGA 2XVKA 4XFBA 4Y22B 4WM8B 2RS53 3ZSJA 1MS5A 4C8DA 5DUVA 3DKWA 2VCAA 1F4AA 4R8HA 3H50A 3WZ1A 1F35A 1CAWB 2ETEA 2Z2SB 1IG0A 3OPTA 4Q2FA 1BK1A 2YC0A 1IKQA 3WF0A 3ZXFA 1RUE3 5JZGB 3FWEA 1MS0A 1OOPA 3R05A 3N9PA 3MIDA 4UF0A 3ZN6B 5EZWA 1V6MA 3K4DA 1ENQA 1NA1B 2PLV3 3S57A 4XIKA 1OURA 3VD4A 1Y9MA 2V72A 3AMHA 1BLZA 1NCQA 1X82A 1H9WA 4H2AA 1ST8A 1DGWX 5FV3A 5JIUA 2HWB2 1FMD2 4ARXA 5AVPA 5GLZA 3VB9A 2CTVA 3BKZA 3IIAA 3ZXDA 4JGZC 1UIKA 5JZGC 3BTXA 4YM3A 2XJTA 4FQ4A 4HVOA 5LK7B 3T0DA 4IEXA 5L73A 1PVC3 2GSYA 4LPLA 4XBLA 3VZMA 1C8M3 4QKBA 2DVDA 2MHFA 1UX7A 2XHKA 3RRDA 3UJQA 3WCSA 2XBO3 4BK4A 5A33B 1AUYA 3A22A 3E5XA 1PHMA 4RFRB 3WQ0A 2A3WA 2W1UA 2B42B 3CU7A 4M3CA 4X6QB 5DAPA 3KGZA 2BNOA 3VN4A 4AK3A 3OYWA 2BRTA 1POQA 1FPN1 3ACFA 5FMDA 3WVJA 5BNOB 1E5RA 1H1IA 5FYZA 1ZNPA 5FP4A 4HKLA 3ZM8A 2FDGA 1UYXA 4C1XA 4YZ4A 3POYA 3CO2A 2A6XA 1UXXX 2OUHA 2A6WA 2PHDA 4UW5A 2JD4A 4MGZE 1H6YA 3HNYM 1XYNA 1S1AA 1OH4A 2C4XA 3HQXA 4COYA 3U78A 3WX5A 3U10A 1J1TA 3FJSA 4IUGA 4QDSA 4JTNA 4BQ3A 2VG9A 2XL9A 3DECA 2PHLA 2VVFA 4CUGA 2AEZA 4NROA 3TN91 2GN7A 5FWEA 5FK7A 4JGYA 3ZXJA 4EWAA 3NJYA 2HBUA 3VBUA 2DVAA 2ZMNA 3HN1A 1RUOA 3D82A 2HWE2 1EV13 3I3DA 4NAOA 2VZTA 1M4WA 4D7YA 4MGQA 3TN93 2DFBA 2OZ6A 1BMV2 1HB1A 3LA2A 1HLCA 3FBMA 1DLCA 2VQAA 3NRUA 1XU1A 1DDLA 4MXWB 2BNMA 3WNLA 2XKPA 1IHMA 2VTXA 4JHTA 1UMHA 1XXNA 5FCCA 5KXDA 3AKTA 1FV2A 1HKDA 2PHFA 4QX0A 1Q8PA 5FXVA 4QGMA 4AR2A 1SHWB 4NR1A 2DUQA 4CCEA 1O3QA 1YUDA 1PMIA 2IXLA 2XLGA 3NJZA 5BNPB 4Z92B 5FREA 2BVBA 1WBLA 3OD0A 4FFGA 4LITA 4G3YC 1ONAA 1BBT3 2DCYA 2G19A 2R1BA 5L9RA 2D3RA 5A7NA 4CDUA 2FDFA 3I59B 4GB32 5FMBA 4LJHA 3LSDA 2JDYA 3SEPA 4OMCA 2A6VA 1LOFA 1T6GC 1FOD3 1XNTA 1ZRDA 1OLME 5ABJA 1PGW1 1W8FA 3LE0A 4OUMA 3JD72 2A6ZA 5FZDA 4X8NA 3OY8A 2VTFA 5IVJA 2DWRA 3NVCA 3P3NA 2XVLA 1ZREA 2E31A 1X9PA 2FDJA 3THCA 4K1YA 1K5MC 4H55A 2IXHA 2ZMKA 1CZSA 1FOD2 1MQTC 2VCMA 3H8XA 1LGBA 4I01A 1ULCA 1YWKA 4AE2A 4XFGA 2GN3A 1VBB3 1BBT2 5FJHA 1E57A 1E5IA 1QOOA 3SKVA 2VZ3A 1WLDA 2B8MA 1OOPC 4HETA 1X36A 3W59A 4TTGA 2QJVA 1LR5A 5AFEA 3E6CC 2P3YA 4IGQA 3VBHC 3C2UA 1W9YA 1W9SA 3OGRA 3N7MA 1H0BA 4XCBA 1HRI3 3IMNA 2QCSB 2VGDA 5JPNB 1PVXA 1LRHA 1MS9A 2QDNA 4M4PA 4N43B 3A23A 5CFDB 1C3HA 4XFIA 3KV5A 2Q5TA 4GULA 3LIGA 4YGDA 2XQRA 5LW9A 4JDOA 3KZ4C 1BEV2 1NE6A 1WBFA 1YIPA 4D0QA 1TVGA 1U5ZA 1V70A 4YGCA 3BPSA 4XZUG 5DPNA 3VBOC 2P37A 4XOGA 1GNZA 3FFQA 5I8YA 2ES3A 3RMYA 2NZ9A 2WJSA 3K75B 3AYCA 3C7EA 4X8PA 4CDXC 1MZFA 1NY72 2YGLA 1DQ0A 4IV3B 3J7HA 1DZQA 3CZJA 4IEUA 3ELNA 4IW3A 1FPN2 2W0XA 4QKFA 5H9PA 5A7PA 4FTSA 3NV2A 4AFMA 3UETA 1H2LA 2HEVF 2Y38A 4MX3A 3JUUA 4F7ZA 1J58A 1PK6B 1APNA 4O65A 1F9KA 1ENXA 3VKFC 4DZGA 3NNJA 2R042 3RWKX 2PHTA 4IL7A 5F5IA 5C4WB 3FHQA 4M4RA 3T2PA 2YMZA 4H7LA 3TNPB 2YBSA 4UXAA 1RUG3 3J8F3 3RNSA 2ZOEB 5JR2A 4N7UA 3RZJA 4QM9A 1LHNA 5KWRA 4XDPA 1PIV2 2AZ5A 1WUVA 2VH9A 3M70A 3MIBA 3HMYA 4JGYC 2WINB 4QXCA 3MW4A 4CP9B 1Z78A 1PVC2 1UOGA 2CDPA 1UPSA 5FZHA 2HYKA 1XQNA 4AI0A 5FY0A 1Q5OA 1GSLA 3EXUA 3LDBA 1MR5A 4LKFA 1PGL1 2DVFA 1POV3 1TZOA 1DG6A 2FBEA 5FPZA 3C7HA 4NJ4A 2R32A 4Y26A 1GZCA 5JLVA 3O0WA 3GALA 3C7GA 3J4UH 3PVOA 3T2TA 4AFAA 2G1MA 4EYUA 4AGRA 2FHRA 2XJVA 4HLTA 2UU8A 1SQ4A 1JOPA 3MIEA 5FP3A 3Q8FA 1UOFA 2W92A 3WNMA 4ES9A 5HCHA 4XACA 4OZOA 4EZHA 3FLTA 3B9IA 2B4KA 4FOQA 2VNOA 4Y1XA 1L3JA 2RDQA 3TB0A 5L9BA 3W58A 4CUAA 2XJQA 4HMZA 1VBE3 4K40A 5GZFA 1N1YA 1OPOA 4BB3A 4ET7A 5DUUA 5IK8A 2AENA 2E7QA 5JXIA 4FSJA 1IS4A 3IB3A 4XW3A 4CPBD 1KJLA 1ZZ6A 2JG9B 2PN5A 2WUHA 3AP4A 4N53B 4YM2A 3ZXGA 1JZ7A 1D0HA 3JB4C 4TSVA 4AQTA 4N9IA 4AVCA 2B39A 3WT3A 4XXAA 5T54A 1MQTA 4BMEA 3LQCA 4UFHA 4FAHA 4OYUA 2Q1MA 4QT6A 2TBVA 1WW6A 4WZCA 5HCFA 3T2QA 4L0PA 4CEYB 1QY4A 3KLSA 4E4SA 1LOAA 1W6QB 3M3EA 5JMCA 1S2EA 1DU3D 3C7FA 2BPA2 4Q4Y2 3VBSA 4PJYA 2WAOA 1QMJA 4LBMA 4ZU7A 3VBHA 2LTNA 2FDKA 1AVBA 1SFYA 3R4DB 2W5FA 5FP7A 4M00A 1MQTB 2UURA 4LOTA 5F9TA 2YUEA 1FT9A 1GNHA 1R081 4MZUA 2CWSA 4IV3A 3TEYA 2IC1A 2LALA 3QOPA 1J3QA 1W9WA 4GAZA 3MIGA 3HEIA 4IGOA 1A34A 5CG9A 4XURA 5F37A 1W0NA 3ETPA 1H1MA 2BFUS 5LA9A 2ZGSA 4LNVA 4WVZA 3AXDA 4CZSA 2FMDA 4BK5A 4QU1A 4EZ4A 5FK8A 5T5LA 3WP5A 1JU4A 2FCVA 2WR9A 3T0BA 4MSVA 5BYNA 3VZOA 1N1VA 4D94A 3ETQA 3KF5A 1PIV3 2VL4A 3ZXLA 1DGRN 1XB9A 3AX4A 3KV4A 5JI7A 1X8EA 2JDNA 5FY5A 4XZPA 2WZPP 4CCDA 4D8MA 2MEV2 3H1MA 5FZ7A 5FOBB 4RS5C 1H4GA 2RS11 3UYJA 4DRVA 3OB8A 5FLJA 4YW2A 4CDWC 2ZKNA 3PVBB 1JZ4A 1OD5A 4XQWA 1ND3A 3THPA 3WNNA 1V9U2 3ZFGA 3ZYGA 1EPZA 4YW3A 4F8AA 2VM9A 4R52A 4J1XA 2BGPA 1NZCA 4XCAA 3CZUA 2JEMA 2B5HA 5DUWA 5J98B 2D7FA 4CCLA 3NV1A 1R082 3J7NA 2FD8A 4FTBA 3WG1A 1WA4A 3PVNA 3OD4A 3E1F1 3LA7A 5DUXA 1AXKA 1OT5A 4XIOA 1JXNA 1OC1A 1CX4A 3NL1A 5FXZA 2XHNA 1V6JA 1S0DA 2HWC2 4LLFA 2FDIA 3TYJA 3K4ZA 5F2WA 2K46A 4Z1VA 3PVEA 4WM7B 1AZDA 5FYCA 2P5BA 3GDBA 5BNPA 1AR72 1NUKA 5C8CA 2OPWA 4DNYA 4ZKTB 1UIJA 3NW4A 1HDKA 5LRRA 2P3JA 4QGLA 3O0XA 5A7SA 5KR7A 1YFWA 5H9RA 2ZS6B 2E33A 3IT8A 1G9FA 5I8SA 4QXHA 1GUIA 5I0TA 3FLRA 4IEPA 3AYAA 5LA1A 5ACA2 1AF9A 3R4SA 5JCTA 1Z7S1 4XF4A 1AYN3 2H0BA 3I4IA 3N35A 1PX4A 2CL2A 3RMXA 3ZMOA 5LWBA 2IFRA 2YFZA 4RR3B 4IE7A 3PL0A 3A4UA 1FX5A 4GA9A 4Q4V3 3T09A 3ZSKA 1J84A 5FZIA 1UKRA 1SLIA 2EXJA 3EO6A 2RM23 3ZYJB 5DZFA 4Y5Z0 1VRBA 4KGGA 3VBUC 1H1AA 1WLCA 3SH4A 1AR63 1XRUA 5F2SA 3ES4A 4P5HA 3O14A 5FZ9A 1RIRA 1SBDA 3S0MA 5FPXA 5FY9A 3X29B 3OPWA 1LENA 3N7LA 4GB33 4LULA 1DQ1A 3VBSC 1W0PA 5ANQA 4AL9A 2Y26A 2XH6A 4PQ9A 3ORJA 3PLQA 4S2DA 4FP3A 1S0JA 2G9ZA 3EJKA 5IVFA 4NHKA 3SH5A 4I0BA 1Z7S3 3TAYA 3W5MA 2WQZC 4ZU5A 3NKTA 1X8MA 2WSUA 2WT0A 4Q4X2 4JZRA 1EY2A 3M7AA 4HN1A 4Y1VA 1AL23 5FUNA 1JZ8A 1SLAA 4AI2A 4AGVA 5K0UB 1COV3 4CDUC 5A32B 2RVAA 2ADEA 2RM21 2J22A 1NX9A 2WS93 2JECA 3HD8B 2DU1A 2QTWB 1PMHX 4QPYA 4DY5A 5ABJB 3TN92 3ZX7A 3FUOA 2HH9A 1LOFC 1F4HA 5EYYA 1OA4A 1ZZ9A 4ISRA 5ABJC 1GICA 2J1TA 1HXS1 2Y0OA 1QJY2 4CRQA 4AZZA 3ZKYA 2VZRA 4HK8A 1AL0G 2WLQA 3N9LA 4GB31 4IDZA 4LT5A 5DDJ3 3IKWA 4JVAA 2GMPA 4RHV3 1D4M2 2R1DA 5FYMA 4ATFA 4LHSA 1K5MA 1N1TA 2D6MA 2GH2A 2WNVC 5EJ3A 4DXRA 1FV3A 3LDRA 4CDWA 1PM4A 1HRV1 2R073 2VBDA 5FYIA 1NT0A 1ND3C 1AJOA 5LBEA 2OYZA 4XAEA 4D3WA 1AL21 4KGQA 5SV8A 5A80A 3ZFGC 2Y6LA 2WNEA 2ZMLA 3R6SA 3RGBA 4G9SB 1C5HA 1PZ8A 5LA2A 4URAA 3BGAA 2VNVA 3G7DA 4TXWA 5J7MA 4NHYA 1LOEA 2A70A 3I3BA 4KU8A 2BBVA 4Q0QA 5CADA 1HX6A 2P17A 3QCWA 4LBQD 1U0AA 2OXBA 2HWB1 1BHGA 4XAAA 1C8M2 1WZXA 1YI9A 1JW6A 4GXLA 4JV4A 3GZEA 5CFCC 3LZZA 4LHNA 1QJY3 2YFUA 1WCSA 2ZPXA 3H8UA 3WP3A 2R0FA 1OXCA 1D4M1 4Z8BA 5FP8A 1KITA 2WS92 1RMU3 2HWB3 3BOWA 2HWF2 3JB8A 3KD4A 3GHNA 4K8FA 4XFFA 4UW3A 3VBOA 4AFCA 4B4PA 5I8TA 1YRZA 1QJY1 5EV7A 4BH9A 4DIQA 2D6PA 4B4QA 1FYUA 4W50A 5TSWA 5BNPC 5C8CC 3GGLA 2CNAA 2EIGA 3ZFFA 4W6WA 1Z7S2 1OHFA 4M3CB 4QB6A 2DVGA 5JUVA 4AI9A 2J1RA 4CDQB 3AMMA 3ACHA 1X7NA 2R062 4BMBA 2ILMA 2UY8A 1RUF2 5FZLA 1RUC2 2K9ZA 3MIHA 3GJBA 4MOAA 2NM1A 3S7IA 5JXJA 5FMCA 2ZZQA 1CWPA 1RVF1 3WQ7A 4QU2A 4ASLA 3LFMA 5A3OA 4K3UA 4M01A 1FI2A 1LU1A 3B5LB 3M4FA 1K12A 4YFWA 4PDWC 1CJPA 2HWC1 1HJFA 5EWSA 4COWA 4Y4YA 4PT6A 4CCCA 2VQ0A 4D6QA 5SV5A 2HWD1 1VRH3 2Q1FA 1H2KA 4LBOA 3WG3A 4BLJA 1I6XA 3KF3A 3ZYRA 1KDMA 5LRSA 4HVQA 3BU7A 3KS7A 1KS5A 4QHOA 2ZGOA 2HWD3 1VRH1 4AQ6A 5L7OA 5FQ0B 1QJU1 1ODNA 2XUMA 2YPJA 3VBOB 4XXPA 5FWJA 1DIWA 1F5JA 5KHJA 3VD3A 3H42B 2BTVC 4XJ8A 1NE4A 3CKHA 4Z82A 1O4ZA 2XLAA 1DYOA 1EUUA 2E32A 5FZ6A 4CU8A 1JODA 4ZY9A 5K8SA 3RG0A 1RVF2 4L11A 4IV1B 4AF9A 2CGPA 1IPJA 1SLLA 4HZFA 4XF9A 3UGGA 4JC1A 2A1XA 2RS12 3U1XA 4BE3A 2HWC3 4FPHA 4CEYC 3H1YA 2BEOA 4LO5B 5A6XA 1XNDA 2VULA 3VBRB 4FFHA 3WDUA 4XMAA 3FHAA 1RUC3 4Z2WA 3OF1A 1NQDA 4IEVA 4YM0A 4BYYA 1IS6A 2K0GA 2WNUC 4HOOA 4K21A 3A7QA 3URFA 4FXKB 1RXGA 4HSJA 4QDQA 5L9VA 4AI1A 1GWKA 1W0OA 4QAWA 5GM0A 4AG4A 5KXCA 2VW2A 2ZX4A 3DYPA 2YU2A 2JE8A 2BP6A 1AX0A 3H1WA 1O6UA 4LTAA 1B09A 1BJQA 5A7OA 1ZZCA 2QQPA 4CSWA 1CX1A 2JXAA 3WDWA 3Q8EA 3WD5A 4D7SA 3O1RA 1W04A 3CJIA 1CAUA 3NNLA 1UPIA 4GD4A 4CTEA 4LXLA 4D7TA 5F5QA 1XE8A 2ZAAA 1IQDC 2MEV3 5FR3A 3OBZA 4PLNA 4GWMA 4HSLA 1PX3A 4JX0A 3VDAA 1GZWA 1NLSA 4BLIA 5FQ0A 3S6PA 1Y9GA 3MPPG 2L9LA 1WA6X 2C9KA 2VR4A 5JIAA 4DUVA 4FI9A 3ZN5A 4QDRA 3VL8A 4OHYA 1UCXA 5LASA 3VL9A 4MGIE 5KHGA 4I09A 2WABA 3MV11 2RR11 1RUJ3 4EN9B 1Q8SA 2RJLA 5ACA1 4WV8A 1UY4A 1STMA 2BWCA 4BWOA 3FC0A 4ZPIA 3KWVA 3GXUA 5GZEA 3LOBA 1MS1A 5C3RA 1C4RA 4ZZ8A 2J1SA 2OX0A 4RGAA 3SXWA 5T3NA 4AAPA 3I2JA 1HRI1 1ZZBA 1W6PA 4RS5A 2JIGA 1K45A 2V4AA 4NHMA 4CDQA 5C4WC 5E8AA 4BCUA 1X33A 1J59A 2X29A 1JU3A 1SLTA 5T5OA 5FPAA 3H8RA 4IXLA 4NIAA 2QQJA 4AOCA 4MV2A 5A6ZA 5BPXA 4KBZA 5J96B 2Y6GA 4FOWA 3WG2A 2WDBA 2VXJA 2JB4A 3ZFEA 4K9SA 4S2FA 3WSOA 1WWYA 5HV0A 4M0HA 2PHRA 4PDWA 4URTA 2ZEYA 2UWAA 3GZUC 5DG2A 5K9YA 1W3VA 1XJAA 3NO8A 5E88A 5GZDA 1NAEA 2VMFA 1QU0A 4JRLA 2WL1A 2WQ8A 3J26N 4XBNA 4Y33A 4N7IA 4NWWA 1B35B 2AYHA 2WZR3 4OLLA 1SZBA 1N1SA 3IBMA 5GLVA 4CU6A 1RGSA 4JQTA 1IQAA 3L2YA 4XC9A 5L19A 3DN7A 4KWJA 1W03A 5FFOC 3LOIA 3PJQA 4O61A 3GYDA 4RQPB 4LKDA 5FUPA 5L7OC 4Q4W1 4CCKA 1AR61 2YHJA 1YEWA 1W8HA 2FCUA 4LHKA 2WNOA 5F3IA 1PMJX 3RI9A 1JYTA 2WNVB 1UU5A 1SLBA 4HFSA 4KWLA 1O3TA 4WVMA 4D69A 4LE4A 3MW2A 2VD7A 2WT1A 2EALA 4QPWA 5I0UA 3AFGA 2BWAA 4LBQA 2RM22 3HT2A 2A73B 3Q8BA 5CISA 1A8MA 4CEYA 3T1MA 5T5PA 3SCFA 1Y9QA 1O5UA 1YFUA 1W8UA 1OF4A 3FL7A 3GM8A 4Q4V2 3T1LA 1ZZ7A 2QE3A 3NJXA 5C7GA 1A8DA 1OA2A 1WLWA 1NA1C 1PM7A 1OQEA 1K5MB 1AYN2 2BOIA 1XSQA 1JOBA 2VVEA 3VZJA 4K20A 1E5HA 2CAVA 2N7GA 2W2IA 4NRMA 4I3PA 4P14A 4B3NA 1OI6A 4PHZA 4QPIB 2HWF1 4IV1A 2MNGA 3UT0A 2YXSA 3MPBA 3BN6A 1TNRA 4FPYA 4OUSA 3DPRA 2NMOA 3T4HB 5EQUA 3JU9A 3M3CA 2ZGKA 2I2SA 3PIGA 4UF0B 2R043 4Q0UA 2ORXA 2QQNA 1RYYA 1OOPB 4E27A 3UKVA 2JDMA 2QQMA 3OPZA 1CN1A 2ATFA 2JDZA 4LKEA 1LEMA 1HJGA 4N9HA 1PO22 1OLMA 3S5AA 3POSA 5JXGA 4PF1A 2CDOA 1SLCA 5EJ1B 5EHDA 1LODA 1DGRA 1ND2A 1EPWA 4IEQA 4Y22A 5J3UA 4ONUA 1VPHA 3DPRB 4U2AA 4Y4RA 4YW7A 2RMU2 1W6OA 1ZBE1 4CYDA 2CHHA 3DXUA 1Q8QA 4CXXA 2RJ2A 2WN2A 4R4ZA 4Y20B 2W52A 4QPIA 5C6CA 1R083 5IVBA 2A71A 1GZTA 1V9U1 1H6XA 4BM8A 4UFJA 4MHUA 1BEV3 1VLNA 2Y34A 2Q1ZB 1RHI2 5FRAA 2BFUL 2VQTA 2A3YA 4DEVA 3E6BA 5IVYA 4AEKA 1ZBA2 5FYVA 4NAMA 1V9U3 2ZHLA 3I2IA 1BEV1 3M2MA 2G9FA 3CJXA 1BVP1 1PNFA 2XONA 4HN0A 5FYTA 1GQGA 2ENRA 4WVMB 4HL0A 1JHJA 5C8WA 1IOAA 4UI9L 1SCSA 2WNVA 1QXPA 5C4WA 1J83A 3JQXA 2UY9A 4EQVA 2VCBA 5D8AB 2J1UA 2KA3A 3H3ZA 3WNXA 1W8OA 4YGEA 1GQPA 1QJEA 3HJRA 1DP0A 1RINA 2EA7A 2CGOA 2R16A 5C3SA 4MYEA 2XQXA 4Y1YA 2VCCA 4BQ2A 3JCIA 3TOJA 1W8TA 3OBAA 3P6BA 2CU5A 4O9EA 3ASIA 5G05L 3ZFEC 3PUHA 4MLOA 1OSGA 4XJAA 4H7MA 3AM2A 1QQP2 4YW4A 4YPJA 5C8CB 4A45A 1NXD1 1NZIA 3VLBB 4M3CF 2J7MA 3DUIA 4FPOB 1IS5A 1C8M1 3SNMA 3D3AA 5CFCA 1R092 3IDEA 3T2OA 2FDHA 1RUH3 4I0WB 4LK7A 2DTWA 3NMBA 3VDCA 1W2TA 1AX1A 1DYKA 2DURA 3VD9A 1QWRA 5I91A 4BQ4A 3WR0A 1VBA2 3OSDA 2HEYF 1QJX3 4R9CA 2DUPA 5A33A 2AEYA 5JDBA 5AC92 5FYHA 4QX1A 1O91A 2PYTA 3AB0A 4XETA 4AFBA 3IAPA 3ZFFC 2DCKA 1N3PA 1WD3A 3ZYHA 1QXJA 3P3PA 4UFLA 3ILNA 1CESA 5E1RA 2VZ1A 2XWJB 3NAPA 1V6LA 3LDKA 3RQ0A 4XEZA 4YFZA 1CZTA 5HCBA 3AZWA 4JKLA 1US3A 4RD7A 3MICA 4I02A 2ZEWA 1NCRB 1CR7A 3O7OA 3OCPA 4XVHA 4AI8A 3HIFA 2JG8A 2PMWB 1UKGA 4B1MA 4CCJA 4E2QA 2BOJA 4JGZB 2G9GA 4XJUA 3DL3A 4ARYA 1ZRCA 3THDA 3LKJA 2ARCA 2WN3A 2F17A 1KQRA 3OUIA 4ASKA 5GZCA 4FPJA 1GZ9A 3OGJA 2VMCA 2D40A 3RWNA 4CCNA 2PELA 2JENA 3APBA 1QJX1 4FPLA 1BMV1 2YBKA 4AEDB 1LHWA 5CVRA 1JYIA 5FLIA 2WFF3 3PTYA 3M1HA 3DPRC 5AC93 1UY0A 2W1QA 3LGRA 4PF5A 5F7UA 2EXIA 5GZGA 2VMHA 5LCWL 1AXYA 3I59A 1JYNA 4ZU4A 4NPMA 1AYM2 4AFDA 1RL3A 1VP6A 2GC0A 1YQ5A 1GOHA 2RS31 5EJZB 4RQPA 3UGFA 1RUH2 4OHVA 3V0AB 2VMEA 1LOBA 2XB6C 1XOYA 2ZCWA 3V0BA 1BBT1 1VMJA 3ZR6A 1LESA 2Z5WA 1DF0A 4ITCA 2NP0A 2PAKA 4JAAA 1G6NA 4LIVA 3T3YA 1YFYA 1YO8A 3AL5A 2QBXA 2RS33 1UY3A 4CP0A 4LLOA 2ZX2A 2O8OA 2VXRA 3WUDA 1TQ5A 3V65A 2JICA 3DXTA 2WSVA 1HV1A 3LCPA 1HW5A 3D0JA 4QPIC 5IK7A 2W68A 3JD71 3VBSB 1ZRFA 1KFXL 1W6QA 1ZYBA 1OD3A 2LW8A 5FZMA 5CB7A 3VGIA 4COZA 2JG9C 2WO7A 4I30A 1KJRA 1REDA 4K1ZA 4QX3A 3HWJA 5K4LA 4W4ZA 1LHOA 1GANA 2JDAA 1O7FA 1ZBA1 1QJZA 3AVSA 1SFNA 2YB7A 4Q27A 5CZKA 2XVGA 2WNUA 2OKXA 1VBB1 3MLLA 1U5IA 1RHI1 2NN8A 4X6RB 2C5DA 3SC7X 2W08A 4FXGB 2QFEA 1BXHA 1KD7A 1WCQA 2PQSA 3NV4A 1ZBA3 1VALA 5FMOL 3RFRA 3PTRB 1W6PB 3AYEA 3NAPB 3USUB 3AVRA 4ZHNA 4MG2A 4GALA 4BXFA 1RHI3 1K5JA 5K7PA 4XJWA 1WMXA 1BYHA 1G9AA 4BIOA 1URXA 3NWKA 3UJOA 3CJIC 1A6CA 4GMP1 3DKQA 5EFUA 2R071 3AP6A 4GIQA 3QLQA 4NWVA 2DBIA 2ZAHA 2OIIA 1UYYA 1JBCA 3C7OA 3K48A 1PGSA 3BTAA 5IHRA 3Q8AA 2DCJA 2X5IB 4FBFA 3POWA 5LEJA 1UO9A 2HKXA 2VMDA 1EAH3 4RHV1 5CFCB 4BDVB 4XUOA 2ID4A 4OVEA 5KBFA 1QQP1 4PLMA 2XR4A 1S55A 3WXPA 1VBD3 2WQ4A 4AW7A 2P1BA 1D7PM 4KWUA 1REEA 1AR91 5IFPA 1HRV3 2VQUA 4J25A 3TWIA 4AEMA 4W8JA 2ZGRA 1NY71 1GKBA 4A3XA 3ZYIB 1GFF2 2B46X 1PO13 1VBB2 2GH8A 4GMP0 1ENSA 1ZBE2 4QQ2A 4LE3A 3NAPC 4A4AA 3KHBA 2ZTNA 3HPNA 1RUI1 1VRH2 2QQLA 3RZHA 4AHXA 5DQ0A 5JZGA 1R093 5C5TA 1UL9A 4LBKA 5A3WA 2JG8C 5JSOA 4C0BA 5T52A 5I0RA 3TEZA 1CAWA 1P8JA 3CHXA 2DFCA 2YYOA 3J7MA 3BIEA 3VBRA 4UYBA 1R091 4ZZ5A 4PBOA 5C3QA 4XF1A 4FP2A 4W6YA 5LBCA 3CNAA 1ODMA 5A1AA 5FBZA 5J37A 2GNDA 4FTEA 1NG0A 3HR9A 5A3LA 1K3IA 3BPZA 1Q3EA 5GALA 4YARA 3J8F1 3LEIA 3A0NA 3VHOA 1W6OB 3KSCA 4AEDC 1UD1A 1XC6A 2W95A 2WZR2 4HANA 1GQHA 1MPXA 5DZEA 1LTEA 3OUJA 5CKQA 1HB3A 2O8QA 1WCDJ 1HB2A 2GZWA 1UX6A 4KI5M 4L92A 4B8EA 2BNNA 1G9BA 2X53S 5A6YA 5CA6A 3WF3A 2BDRA 4W65A 3R0RA 5DAXA 2ZGQA 1WW4A 3DYOA 4HPKA 4EV0A 2W47A 1U5YA 3ATGA 1IG3A 1MVEA 2QQUA 2ZEZA 4OI1A 2GNBA 4RL7A 3I54A 3VUOA 3GHMA 1CD3G 2Y6HA 2Y6FA 4Q1RA 3RZGA 3RZMA 3RVHA 4XMIA 2WA3A 2WAAA 5A1LA 3I2OA 3OTFA 5I0DA 3W21A 4NIHA 3H0OA 1UZWA 4IE4A 5FY1A 2Q8DA 4DRRA 1XSRA 4IEOA 3VV1A 3CQOA 1RITA 2YC2A 4GZ9A 4BZ4A 4W6XA 1NA1A 1NYWA 4P02B 4YW6A 4CEWA 5BNNC 4LO8A 4JKKA 5F32A 1C8NA 3K4AA 3O12A 3WW3A 1QOTA 3VDDB 3WNPA 5FXXA 1O8SA 2XWBB 3INAA 4FQZA 2OUJA 1ZX5A 3K2OA 1SACA 1ZRRA 4IERA 4IV1C 4NVPA 1QJU3 5EPAA 4LR4A 2R0HA 4E2SA 1Y7BA 1LECA 2F6BA 2R072 3FN9A 4NMIA 3ZPOA 1BZWA 5KC5A 1IKPA 1C1FA 3QD6A 2VBPA 1SBEA 3ABZA 5ERLA 3RYRA 1H2MA 5FBJA 3SHRA 4OZXA 3UKTA 3VKNA 4EN8B 5HBAA 4IQPA 3POFA 5LK5A 3AZXA 3V56A 4Q0PA 1F5FA 2W9XA 3ZDSA 3KB5A 4QWNA 1TME3 1O3RA 3WINE 4GKXA 1R1A2 1XYPA 4S2GA 4NPRA 2XJUA 2QZ3A 4QX5A 2OQ6A 2GMMA 4YVWB 1ND2C 2E63A 4P9IA 1JYXA 2Q4SA 4IE6A 1YYNA 2ZABA 5FUIA 3AKQA 2RV9A 3FE5A 3OBRA 1TME1 5FZFA 3ZIWA 1UU6A 1FMD3 5FZ8A 3U11A 1BKZA 2W3JA 4QGNA 3WF2A 3M3QA 4EE2A 3WY6A 3OJBA 4GH4C 3ZSMA 5IYYA 2CGNA 4DMIA 4OULA 5LY1A 4COVA 1WW5A 1QH6A 1OLQA 2G4IA 2OVUA 5B2GB 1K42A 3EQEA 4B4RA 5H9SA 2ADDA 1J1LA 2BERA 1DCSA 3I97A 4JGYB 3VZKA 3BB6A 2WZ8A 1EUTA 3F2ZA 3FFZA 5JOWA 3MIFA 4AVVA 4P9YA 4CDWB 4AVBA 2ZGPA 4IESA 1AR62 3ZO0B 3H3LA 2PAMA 4ZXEA 5A3NA 1W05A 3CMGA 3RZKA 5C70A 1WLTA 1IPKA 5IK5A 2D97A 2GDFA 5FOJB 1ULOA 5A3UA 4YVSB 2VMIA 5IT6A 2WC2A 3V0AA 4TZDA 5DN2A 2RS13 1S2BA 4P5YA 2O1QA 4FFFA 5EXOA 3AFKA 5FO7B 4D6SA 2RR13 5DZGA 3VDDC 2BJSA 3AMNA 3LEKA 2J1AA 4QHZA 1ND2B 1LAJA 4KNCA 5A70A 2IXIA 4L99A 2NQYA 1UY2A 3JBG3 5A32A 3N3HA 1ZA4A 5FIXA 2HWD2 4P9WA 5FZOB 2YROA 3R4UA 3KVAA 4PBPA 2WO1A 4AEDA 4B7KA 5F3EA 3PUIA 4YW1A 2E7AA 1F8VA 4DXZA 4GJZA 2ZHKA 5FLHA 1F31A 2BQPA 1AR73 3O1UA 1W2OA 3RSJA 4BA6A 3ZYBA 3N4MA 3VHRA 2ET7A 4HVRA 1JYWA 5FMOS 3O5SA 4PCRA 1ULDA 1QOSA 4XYXA 2DDUA 2Z4FA 5JXHA 2W94A 4NOTA 4Y1ZA 1DQ2A 5APAA 5FAXA 3RYKA 1RUD2 3AMQA 4HKWA 4JHZA 4OHXA 4Q4V1 4KQ7A 3O1TA 2QQOA 4WZFA 3KCCA 2LUWA 2XUEA 3EMRA 3HQRA 3NJVA 4N53C 3B02A 2C6SA 3T08A 4AYUA 4OQ8A 5IAVA 2JD9A 3CL1A 3MLJA 3J7LA 4GWNA 4LQRA 3I2GA 3MUY1 1GMMA 3NQHA 3POEA 5FY8A 1AHSA 1POV0 4A7ZA 1ULPA 4Y5SA 2WS91 2JIJA 4Q5OA 2JDKA 3LEGA 1LB2A 3LPFA 1UXZA 4GWIA 4TN7A 4A2UA 3GNEA 2P3IA 3IDBB 3WCRA 1G9CA 1CAXA 1NLRA 4QQOA 2HWF3 1CVNA 5F5CA 1KRIA 1Q43A 4EWEA 2EXHA 3MO4A 3I7DA 4MXWA 1HQNA 2P34A 4RQPC 4A7YA 3HOBA 5DAVA 2GNMA 3U07A 2ZZJA 1PZ7A 2V4VA 4HBNA 1UYZA 1DQ4A 1TEIA 2FQPA 4PDWB 2ZACA 2E6VA 4QX7A 4YLZA 4F83A 5C71A 1T6BX 3AC0A 4IE0A 5FO9B 1GWLA 3VZNA 3ON7A 1RUI2 2XGXA 2XPJA 4XE9A 4QQLA 3MI8A 2V5DA 4CUCA 3OEBA 3GZAA 4B1LA 5DDJ1 3VDBA 4NE9A 1Y3TA 5T5JA 2E7TA 1O59A 4GH4A 5KXEA 4XUPA 5A3PA 1JYVA 2YPDA 2JG9A 3IZOA 4H3WA 2WWSA 1VAVA 4TWTA 4E9KA 1L7LA 3UL2A 4G4FA 2F4PA 3U75A 1AR83 2NLRA 4XILA 1LKNA 3P1IA 4LEJA 4YZ2A 5CG8A 3D6EA 5BUVA 2ERFA 4CE8A 2A6YA 2O14A 1HXS3 4DQAA 1D4M3 3KHCA 5CU1A 1TMF3 2BW8A 1KFUL 2VTXJ 2YBPA 5GJ6A 1PO21 3I2KA 3N9OA 1W3XA 1XNCA 3K51A 2W91A 5F8PA 2R6QA 1CQ9A 2V09A 2RR12 3RI8A 3NV3A 5IATA 1RTVA 5DXDA 1W6MA 3KV6A 2JB8A 1FXZA 1RJ7A 2D6KA 2IZWA 1WW7A 4KH9A 3DYMA 1OKQA 2RJKA 4OMDA 4AQ2A 1WMDA 2PHXA 2ZXQA 4XHXA 1W99A 1NOVA 3VDDA 3WDTA 4AQSA 5BV6A 2X10A 1LOGA 2IUWA 4NPLA 5HPOA 1PVC1 1HIXA 4XUNA 1RMU1 1DGLA 2ARXA 5FZCA 3K3NA 4KL1A 2AUYA 2PLV1 2R063 2LRPA 4EN6B 5J1XA 1DYPA 2VZQA 3POIA 5A3MA 1L7QA 2NMNA 1XU2A 1ZA7A 1DZTA 2B45X 2A3XA 4WBBA 3AXEA 4ISQA 2P4EA 2XKOA 2A75A 1SFPA 1YJKA 2Z42A 4DFSA 3O1PA 3ZN6A 4YNIA 2WWJA 2JDUA 1S0GA 1Q8OA 5FY4A 5AFBA 2PHWA 1EYBA 5F6KA 4CU7A 4YG6A 1Y43B 3SEEA 2YDEA 3AP5A 3LSEA 1XBFA 2WYFA 4UBHA 3RJ2X 4HONA 2A7AA 5DMYA 2JE9A 4DXSA 3ZYFA 1JOJA 1WCKA 4IE5A 4LORA 5DAWA 4ES8A 4KG0A 1OBNA 5A1FA 4OFGA 1FNZA 2QZ2A 3T4VA 2ZJCA 2BZDA 3O0VA 4XBQA 1O4TA 3MEPA 4L2NA 1PGL2 3MLKA 1W6NB 1TME2 2VZOA 1RUH1 1PO12 3UESA 5F6LB 1UW8A 1UNBA 4QX2A 3J8F2 1HXS2 1YFXA 4LA2A 2JDPA 3VBRC 1OUXA 5KHKA 1BCXA 5FKBA 3OGGA 5H9QA 3BODA 1F15A 1RB8G 3IMMA 3ZDVA 4COUA 1YQ2A 5CNAA 2BYVE 2WRAA 2D98A 2BGCA 4XQ4A 4JDNA 4CVUA 2HWE1 2CY6A 1VMFA 4NHLA 1GYKA 3BCWA 1LOCA 5CFDA 5FZKA 1UQXA 2Q0AA 5A3TA 4LO4B 3EBRA 3CLPA 2ZGUA 4Q29A 3GCWA 3VBFB 2VJXA 2VZPA 2QQWA 1BK0A 5IUQA 4E4DX 2XXZA 4GJYA 1AXZA 1I5ZA 1QDCA 2ZGNA 4BU2A 5FDBA 3WF1A 4PQQA 1OA3A 1C57A 4OHWA 1S2KA 5FXWA 4CDQC 2VW1A 1UOBA 4QD2A 1NXMA 1XE7A 2D6NA 4H14A 3WOGA 3SITA 1V6NA 2DF7A 1HQLA 5E16A 2Z79A 1LCLA 2CAUA 5JVVA 2WFF1 5JAXA 4UAPA 3MBWA 4YYOA 3N7KA 1H8TA 2BVVA 2JKBA 3NNMA 1RC6A 1XNKA 2VECA 5B4XA 5BNNA 1DHKB 4CEWC 1O3SA 1Q56A 4P08A 4FT8A 3OG2A 1JZ2A 1JTZX 1LJ7A 2GC3A 3I3EA 5IVVA 5D2AA 3L2HA 3ZFFB 4YG3A 4YVWC 2V5YA 3RS6A 4LA3A 1A3KA 2D3SA 1CPNA 4IEWA 2D5FA 2ZX0A 3IM0A 1MEC3 4YVSA 4E8DA 2Y6JA 1IS3A 4SBVA 2Q8OA 2WA4A 2DVBA 3IPVA 4QPGB 3ZSLA 4Y1UA 2BBAA 3VKMA 1D2QA 3IDCB 4IEYA 4CP1A 3CJIB 4JKMA 3U37A 1GWMA 1JMUB 3AZVA 3K46A 4UT5A 4B29A 3O1VA 4EWDA 3LAGA 4L9BA 2RHPA 1S0CA 4FPEA 2W1WA 3E5UA 2SBAA 2TUNA 1SCRA 2V73A 1SG3A 1XNAA 2CV6A 1ZZ8A 3I3QA 4NUBA 4PLOA 5LZ6A 5BNNB 5ACA3 1S0IA 2LM3A 1RJ8A 2MEV1 1PGW2 4UFKA 2YY1A 3N7JA 3WQ1A 1WKYA 4BOWA 3MZHA 4Q8LA 5IK4A 1UMIA 5DAQA 3ZKUA 4AVSA 1W8WA 2D6OX 4LIUA 4GKYA 3M3OA 4KWKA 2WFF2 1CPMA 5LEKA 1JYCA 3SCHA 5JOZA 1EAH1 3RZZA 1OVSA 5L36A 3L9JT 2BGOA 4CXYA 3QH7A 1MZ6A 4O7XA 2IWGB 1GOGA 3ENRA 1G7YA 2Q8EA 4XDQA 3NSTA 4XFAA 3GZTB 4TYSA 5CBLA 3W20A 3V0BB 4Q8KA 2D93A 2OPKA 5HXVA 1EAH2 1ND3B 4RYDA 2WT2A 5K0UC 1WMFA 1Z0HA 2H6BA 2QKDA 2NPIA 4NIIA 1US2A 2ZHNA 4DEQA 3W5NA 1EV12 1U12A 2J1EA 1MS8A 4NN0A 1TG7A 4WM8C 3DCQA 2J42A 3T0AA 1VBE2 3J9SA 1LGCA 2EIEA 4Q4W3 5T50A 3TBDA 4CP2A 1NKGA 4PIZA 2SLIA 3I3MA 1VBD1 3MHZA 4XTPA 3ZXEA 4BQXA 3THTA 2EICA 4LBLA 3DEMA 3PUAA 4XJZA 1AR93 3HT1A 3QBQA 5IJRA 1QJX2 4C91A 4E4HA 1VIWB 1GU3A 4DXTA 2P2KA 3U4SA 5J48A 3PUSA 1RUNA 1MS3A 4OCTA 3WP4A 2DUOA 3M3IA 4P9GA 3CF6E 1H4HA 4AVAA 2PFWA 4CDUB 4FPKA 2A5ZA 3AP7A 3KQRA 2VUAA 3CEWA 4MHRA 4PI2A 5CFDC 4CCMA 3U0ZA 5BNQA 3MGUA 4ZONA 1NCRA 1W6NA 1RUF1 3AMPA 3LB9A 3OGSA 3USSA 5C33A 5FPLA 5FZBA 4E4ZA 1GLHA 2X09A 1KS4A 3KCYA 1QXRA 5FYBA 1O4YA 2QVSB 1JS9A 3WG4A 1OMIA 3AZZA 1V6OA 3WV6A 1I9RA 1CONA 4QQHA 1OFSA 1VB4A 1DQ5A 3ME2A 1D0GA 1N3QA 2VAUA 4O9GA 4Q0SA 4B7EA 2JDHA 2R041 4BQWA 2AR6A 2KM2A 3BUCA 1QNWA 1UZVA 2VUJA 1V0AA 2H6CA 5FZ0A 1QH7A 1RUG2 2XLFA 1GOFA 2XJRA 4A41A 1B35C 3B69A 3LIHA 3PDQA 2AC1A 2QDRA 3BU0A 4LKSA 3BALA 1H8TC 3WW1A 3UKNA 2B7YA 1QGLA 3B00A 4N53A 3TEXA 4CPBA 1AYM3 1RUD1 2PLV2 3IDAA 1SPPB 2PHUA 4HXCA 3WUCA 3RZLA 1H2NA 1UAIA 2UYAA 3EYPA 4HT1T 1E5SA 5HV4A 2K2SA 4UOJA 1VBC1 5EP9A 3UGHA 4XABA 1AR92 2GALA 3RDIA 3B93A 4SLIA 4XJ9A 1RUE2 5A7WB 2DCTA 1S0EA 3E5QA 2IVIB 4PIYA 2CSGA 3AKPA 4RGGA 1W90A 4YVSC 2FCTA 1OUSA 3A21A 5BNOA 5LATA 2WWUA 2YU1A 3GJAA 4R9AA 1UZ0A 2NYYA 1GP6A 1SEFA 2I45A 2H0VA 5GLUA 2VNGA 5IW0A 1HB4A 2HEWF 4A3ZA 5IFTA 3NKGA 2DYCA 1X50A 3F95A 3B3QE 3POJA 4MGKE 1UZZA 3ZXAC 4AI3A 2WFPA 3KT7A 1IZ3A 3QH6A 1PO23 4A44A 4CA9A 1KDKA 3KCXA 3SLIA 4F3JA 3PMSA 3ZMNA 4YZ1A 2RDNA 1CAVA 3ECQA 4CEWB 4QHBA 1REFA 2D43A 4RS5B 2C1FA 3GBGA 1HRI2 2Y8KA 5I93A 4XTMA 4OUEA 2W46A 3VBFC 5DG1A 2WIIB 4R9BA 4ORFA 3D5OA 3MYXA 2JJ6A 1PIV1 1LNSA 1O5LA 2QUOA 2VOTA 3C8XA 5FZAA 5BXXA 3U14A 1WD4A 5C3PA 3FHIB 1QF3A 2RE9A 5ANNA 3AYDA 2BUKA 2UYBA 4LUMA 4I2OA 4DY3A 2VBBA 5IWFA 4Q4X1 3EHKA 4R9DA 3H3UA 5FZGA 2OW4A 5FO8B 1PK6A 2WZEA 5K0UA 1VE0A 1W2NA 5KXBA 3WF4A 2Q8CA 4LO6B 5FYSA 5JOXA 2C24A 4GQ7A 3MFAA 3NNFA 4CCOA 3JZVA 3BI3A 2J1VA 2VZSA 2IXCA 2C9AA 1CAXB 3WEZA 3SQOA 1MEC2 3PNAA 1CAUB 4J1WA 1QIQA 3FBYA 4FOYA 5LY2A 1RXFA 2E53A 1Q8VA 2ZX1A 3S7EA 4LHLA 3HNBM 4N43C 2WNUB 3JQWA 4Q1PA 4UFMA 4FAGA 3KT1A 5KHHA 2ZA9A 1OH3A 3PHMA 3T30A 1LHUA 3ZLIA 2WYSA 3MDPA 2I74A 2XBO1 3FUQA 1VBD2 3HNMA 2XJPA 1I3HA 1YC61 3ZXKA 2JE7A 3BYWA 4CXWA 4XDOA 1TNFA 5J09A 3I2DA 1FPN3 5IAXA 1JZ5A 4LUKA 3ZVXA 2EVXA 5GLWA 4CUBA 1GP5A 2HWE3 3RYPA 1I5PA 1EV11 3ILRA 3AJZA 5F5AA 1FATA 4LMFA 3HBKA 4P9LA 5J36A 2XJSA 4ZXKA 5E89A 1SDWA 4BPZA 4AAXA 1OPMA 3HQUA 1ASJ3 4FPFA 5C9AA 4OI4A 3CIHA 5EIYB 2CYFA 1B35A 1S0FA 3IPVB 1N3OA 4QPGA 4YGBA 4DB5A 3WW2A 5FPVA 4GWJA 5G04L 4AGGA 1YCIA 1C28A 4WM7A 3OY8B 4YW5A 5BY5A 2GU9A 4R4XA 1SBFA 4HG6B 3SKJE 2F4LA 5AC91 5KHIA 2GP3A 2ZX3A 2Q30A 4RA0A 3PMEA 2FZ2A 3H7JA 5KC6A 2B9UA 4MO3M 4XFHA 1V00A 4FVVA 3OUHA 1RUJ2 2P6HA 1J3PA 3POBA 1NLQA 2WO3A 1DQ6A 3KQ4B 2XBO2 4BQ1A 5LBBA 1W8NA 4V1PA 5FZ3A 2GAUA 3N36A 1D4VB 3VHPA 4RSUA 3B9CA 3KVBA 4DUWA 2HJIA 3WW4A 1QKQA 2RS32 4OHZA 2VUCA 4MVTA 1VB2A 1CAVB 1YJLA 3GBFA 3B01A 4MGSA 3JD73 3VD5A 2OA2A 3SH3A 4AWDA 4M0NA 3HVDA 1FOD1 1XE0A 4L8QA 3MUZ1 3RJRA 1GNYA 1GP4A 2Y64A 3LPGA 3AKSA 2AREA 3I2FA 1X9TA 2DBNA 3VBFA 2R49A 4QM8A 3TNQA 2VMGA 3PUQA 2WO2A 1W8ZA 3Q9OA 2Y0IA 2C0ZA 1OQDA 1CIWA 1XNBA 1YQCA 4BJ0A 5F1RA 3QACA 4JDMA 5FP9A 3VD7A 2B9VA 4Q4W2 3PJYA 4YM1A 3ITQA 3KT4A 2RS52 2O0OA 1KXGA 1OQ1A 1PK6C 4YVWA 4YWAA 3V64A 5C9AB 4I0AA 1UN1A 2OQ7A 4FO9A 1D2SA 1ULFA 4UFIA 4GMP3 1SDDB 4MUVA 4KMQA 5CIRA 3HN3A 2ARAA 4Q4Y1 2PQQA 5D8AA 1H9PA 4CDXB 3AZYA 2X8KA 4UWDA 3SISA 3VBHB 4RFT0 1XPWA 2CWMA 4QB1A 2GNTA 2VE1A 1UOJA 1U5XA 3S30A 3N9MA 3TRSB 1H8TB 5M0TA 2YC4A 3D0SA 2LS6A 1AR81 2VOWA 1UY1A 1JHNA 1VBA3 3PU8A 2KXLA 3A0KA 3ZIXA 2ZHMA 3CBNA 2OZJA 5JSRA 4JGZA 2RS51 5T55A 1OKOA 4AXOA 2ET1A 2E9QA 3UV9A 1PO11 4META 2VZUA 1MVQA 1HN0A 4IEZA 4JCKA 1A78A 4UW4A 5FZEA 4OI0A 1OLRA 4RGKA 3LF7A 1RUI3 4YSFA 1QQP3 3BTYA 3KGLA 5FJKA 4BIFA 2IFWA 4C0HA 1RUF3 5FZOA 2PTMA 2VOXA 2VC9A 2EF6A 3ZN4A 4XUQA 1O8PA 1W6MB 4KG8A 2VVDA 2Y33A 4BHPA 2D6LX 4QKDA 5CKNA 1JZ3A 4WM8A 3M8LA 4XF0A 3ALQA 1CJDA 1VBA1 2ZGLA 4UBGA 1S0BA 2QNKA 4JQRA 2EIBA 1W2AX 5CYYA 3VHNA 4A42A 2WLPA 4NRQA 4DS0A 4XFCA 3GCXA 1YIFA 4YZ5A 5LB6A 4N90A 4AHYA 1KEXA 2W39A 3S5QA 1G9DA 1HQWA 2AACA 1IGOA 2C26A 3E97A 3IIIA 4RR3C 1POV1 2GP5A 4Y3OA 1RMU2 3RPQA 4LOSA 2RMU1 2XOMA 3WDXA 1GV9A 2KR2A 3OEAA 4OI2A 1YNAA 2R30A 5HXMA 2ZGMA 2X05A 4KBBA 2E51A 3KMHA 4GH4B 4ATEA 1BVVA 1NCRC 3K77A 4LBJA 2W87A 5CAZA 1DFQA 4NO4A 2YV8A 2RMU3 1UYPA 1UF2C 1JN2P 4N8MA 2ARBA 1W2UA 2PA7A 1DLLA 2DCZA 4MXVA 1EP0A 2D44A 3FZ3A 3LWCA 1ULEA 4ZS3A 1S4CA 3VBUB 2OS2A 2AH2A 4A6SA 2XMLA 3JXSA 3UNPA 1RVF3 1CZVA 4E2GA 1QDOA 4EJRA 1FAYA 2P3KA 2JX9A 5FTTC 2DU0A 1OF3A 5A7WA 4Z07A 2GC2A 3ZYPA 2VZVA 4AEJA 1ZM1A 1VBC2 1CIYA 1JI6A 1LEDA 3N9QA 3LFIA 2ORZA 1JH5A 2KD7A 2RG4A 1SPPA 4J6GA 4LO7A 4Y20A 5DABA 4DINB 4MH0E 4E8CA 1YHFA 4MGYE 4BQ5A 3JBG2 1HV0A 2WKKA 4RHV2 3VKLA 2R7EB 4EN7B 1W06A 4BQYA 5DDJ2 3WNKA 2X5IA 5JPMB 4HKOA 3ZFEB 4DOUA 5JOYA 2ZGTA 1PZ9A 3I49A 1JUHA 1ULGA 1UMZA 4IETA 4D6RA 3K3OA 1R1ZA 1QEXA 2D3PA 2RDSA 3KM5A 3PURA 4NIDA 2VPVA 3HBZA 2TNFA 1PNGA 4QKNA 3ST7A 1WGPA 4ZS2A 2Y60A 1NQJA 2Y6KA 5BNOC 3BOPA 4XUTA 3KV9A 1COV2 1H30A 2W1SA 4XHBA 5D8AC 4LK6A 1AL22 2IXJA 4NIGA 3WQBA 1LULA 3WP6A 3LD8A 3ZOIA 3HAGA 4Q4X3 5JWPA 2JWPA 4QXBA 1MEC1 3OBTA 4JTOA 1FMD1 5JMOA 4DPNA 5IVCA 2YGMA 1R1A1 2BV4A 3ZFGB 2HLEA 4OQ9A 1XYOA 4FPGA 4PI0A 3O1OA 3SMHA 1LGNA 2QQIA 3MF6A 3MV01 5FZ1A 3ZSEA 1SMVA 4TLFA
chains in the Genus database with same CATH topology
1RUJ1 1RUC1 3B7MA 4YG0A 3UK9A 1LU2A 1YLLA 4LBNA 1CGPA 4AHWA 3D4KA 1AX2A 1UZYA 4LBQB 2I07B 3AJYA 4P9JA 3VZLA 1QNYA 3DGTA 4CDXA 3JBG1 1GZWB 1YXWA 1VAKA 1VJ2A 2AGSA 4A7KA 1MS4A 2EXKA 5GKAC 4QXKA 2DTYA 1R1A3 1LHVA 1YI7A 1WMEA 2VOKA 1TMF2 2VY0A 4P9XA 1DZRA 1AR71 1MZEA 3MW3A 1ALYA 5D1IA 3AP9A 2EAKA 2ZBJA 1C1LA 1AR82 4C1WA 3WDVA 1AJKA 1QJU2 3B94A 4XPVA 2VU9A 1ASJ1 3C3VA 3GF6A 1QHDA 1F2NA 4ASMB 4N43A 3H7YA 4RR3A 3WHTA 4FPCA 1NCQC 4Q0VA 1VR3A 5I0SA 4HK9A 4S2HA 3ES1A 1ASJ2 1MACA 3ROUA 1W39A 3WLUA 3ILFA 2D5HA 4AVTA 2JG8B 1DGWA 3FLPA 3MFCA 3ZPYA 5AVAA 4FCAA 2ZKLA 4YZ3A 4QMAA 4JRAA 3IN9A 2FMYA 5JI9A 3IWZA 2Z69A 2EAAA 2DV9A 4U36A 3SCGA 3FX3A 5L7OB 1RUG1 1I1EA 4Y24A 5EYXA 5HI0A 1AYN1 2VW0A 5C9AC 2MPFA 4EN0A 1V6KA 3OYWB 3AKRA 1FNYA 4QPGC 1JUIA 4M3CE 4WM7C 2XG3A 1V6IA 1H8VA 5JSPA 3VKOA 2TEPA 1VAMA 3GBWA 4UW6A 1OFNA 3LA3A 2X5IC 2WZR1 2XL7A 3BIWE 1UU4A 4Q26A 4C90A 2GC1A 1GR3A 4I3GA 5JR7B 1AYM1 1RUD3 2IXKA 4WVVA 1NCQB 3USUA 1DBNA 4INDA 3I8TA 4XQDA 1C5IA 3H9AA 3D8CA 3W9AA 2UWCA 5GLTA 3WQ1A 2VNRA 2PAEA 3WDYA 1BQPA 2VOVA 4K7JA 1ZBE3 1COV1 3U4XA 1G8WA 1VBE1 3DF0A 4WVWA 4HPKB 1G86A 4IV3C 3AK0A 4XF3A 4FOVA 3ACLA 2FZ1A 3G6JB 1RUE1 4YRDA 2GMEA 1TE1B 4Q4Y3 4QQPA 3DV8A 3E6DA 1VBC3 1HRV2 3MF9A 4K6BA 4AHZA 5HCAA 1N47A 1ENRA 1J3RA 4KU7A 1ZVFA 2YZ4A 1GBGA 4PIXA 1TMF1 1MZ5A 2UWBA 4L97A 4EROA 1M06G 2R061 3WHUA 3FMGA 2XVKA 4XFBA 4Y22B 4WM8B 2RS53 3ZSJA 1MS5A 5DUVA 3DKWA 4R8HA 3H50A 3WZ1A 1CAWB 2ETEA 2Z2SB 4Q2FA 1BK1A 2YC0A 1IKQA 3ZXFA 1RUE3 5JZGB 3FWEA 1MS0A 1OOPA 3R05A 3MIDA 3ZN6B 5EZWA 1V6MA 1ENQA 1NA1B 2PLV3 4XIKA 3AMHA 1NCQA 1X82A 1H9WA 5JIUA 1DGWX 2HWB2 1FMD2 5AVPA 5GLZA 2CTVA 3IIAA 3ZXDA 4JGZC 1UIKA 4YM3A 2XJTA 4FQ4A 4HVOA 5LK7B 4IEXA 5L73A 1PVC3 2GSYA 4XBLA 3VZMA 1C8M3 2DVDA 2MHFA 3RRDA 2XHKA 3UJQA 3WCSA 2XBO3 5A33B 1AUYA 3E5XA 1PHMA 3WQ0A 2A3WA 3CU7A 2B42B 4M3CA 4X6QB 3KGZA 2BNOA 3VN4A 4AK3A 3OYWA 1FPN1 3WVJA 5BNOB 1H1IA 1ZNPA 4HKLA 4C1XA 4YZ4A 3POYA 3CO2A 2A6XA 2OUHA 2A6WA 2PHDA 4UW5A 2JD4A 4MGZE 1XYNA 1S1AA 3HQXA 4COYA 3WX5A 3U10A 1J1TA 3FJSA 4JTNA 2VG9A 2XL9A 2PHLA 2VVFA 3TN91 2GN7A 4JGYA 3ZXJA 4EWAA 3VBUA 2DVAA 2ZMNA 3HN1A 1RUOA 3D82A 2HWE2 1EV13 1M4WA 4D7YA 3TN93 2DFBA 2OZ6A 1BMV2 3LA2A 1HLCA 3FBMA 2VQAA 1XU1A 1DDLA 4MXWB 2BNMA 2XKPA 1IHMA 1XXNA 5FCCA 5KXDA 3AKTA 1FV2A 1HKDA 2PHFA 1Q8PA 4QGMA 4NR1A 2DUQA 1O3QA 1YUDA 1PMIA 2IXLA 2XLGA 3NJZA 5BNPB 4Z92B 5FREA 2BVBA 1WBLA 3OD0A 4G3YC 1ONAA 1BBT3 2DCYA 4CDUA 2R1BA 2D3RA 3I59B 4GB32 3LSDA 2A6VA 1LOFA 1T6GC 1FOD3 1ZRDA 5ABJA 1PGW1 4OUMA 3JD72 2A6ZA 4X8NA 3OY8A 2DWRA 3NVCA 3P3NA 2XVLA 1ZREA 4K1YA 1K5MC 4H55A 2IXHA 2ZMKA 1FOD2 1MQTC 1LGBA 4I01A 1ULCA 1YWKA 4AE2A 4XFGA 2GN3A 1VBB3 1BBT2 1E57A 1QOOA 1WLDA 2B8MA 1OOPC 4HETA 1X36A 3W59A 2QJVA 1LR5A 5AFEA 3E6CC 3VBHC 3C2UA 3N7MA 1H0BA 1HRI3 3IMNA 2QCSB 2VGDA 5JPNB 1PVXA 1LRHA 1MS9A 2QDNA 4N43B 5CFDB 1C3HA 4XFIA 2Q5TA 4GULA 4YGDA 4JDOA 3KZ4C 1BEV2 1NE6A 1WBFA 1YIPA 1U5ZA 1V70A 4YGCA 3VBOC 2P37A 4XOGA 1GNZA 3FFQA 5I8YA 2ES3A 3RMYA 2NZ9A 2WJSA 3AYCA 4X8PA 4CDXC 1MZFA 1NY72 2YGLA 1DQ0A 4IV3B 1DZQA 4IEUA 3ELNA 1FPN2 2W0XA 5H9PA 4FTSA 3NV2A 4AFMA 1H2LA 2HEVF 2Y38A 4MX3A 3JUUA 4F7ZA 1J58A 1PK6B 1APNA 4DZGA 1F9KA 1ENXA 3VKFC 2R042 2PHTA 4IL7A 5C4WB 2YMZA 4H7LA 3TNPB 4UXAA 1RUG3 3J8F3 3RNSA 2ZOEB 4N7UA 4QM9A 1LHNA 5KWRA 1PIV2 2VH9A 1WUVA 2AZ5A 3M70A 3MIBA 3HMYA 4JGYC 2WINB 3MW4A 1Z78A 1PVC2 1UPSA 2HYKA 1XQNA 4AI0A 1Q5OA 1GSLA 3EXUA 1MR5A 1PGL1 2DVFA 1POV3 1DG6A 2FBEA 5FPZA 2R32A 4Y26A 1GZCA 5JLVA 3O0WA 3GALA 3J4UH 3PVOA 3T2TA 4AFAA 4AGRA 2FHRA 2XJVA 4HLTA 2UU8A 1SQ4A 3MIEA 4ES9A 3FLTA 3B9IA 4FOQA 2VNOA 4Y1XA 1L3JA 3TB0A 3W58A 2XJQA 4HMZA 1VBE3 4K40A 5GZFA 1N1YA 1OPOA 5IK8A 5DUUA 2AENA 2E7QA 4FSJA 1IS4A 4XW3A 1KJLA 2PN5A 3AP4A 1ZZ6A 2JG9B 4N53B 4YM2A 3ZXGA 1D0HA 3JB4C 4TSVA 4AQTA 4N9IA 4AVCA 2B39A 3WT3A 4XXAA 5T54A 1MQTA 4BMEA 4FAHA 2Q1MA 4QT6A 2TBVA 1WW6A 4WZCA 5HCFA 4CEYB 1QY4A 3KLSA 4E4SA 1LOAA 1W6QB 3M3EA 5JMCA 1DU3D 2BPA2 4Q4Y2 3VBSA 4PJYA 1QMJA 4LBMA 4ZU7A 3VBHA 2LTNA 1AVBA 1SFYA 3R4DB 4M00A 1MQTB 2UURA 5F9TA 2YUEA 1FT9A 1GNHA 1R081 4MZUA 2CWSA 4IV3A 2IC1A 2LALA 3QOPA 1J3QA 3MIGA 5CG9A 1H1MA 2BFUS 2ZGSA 4LNVA 4WVZA 3AXDA 4CZSA 2FMDA 5T5LA 3WP5A 4MSVA 5BYNA 3VZOA 1N1VA 4D94A 3ETQA 1PIV3 3ZXLA 1DGRN 3AX4A 5JI7A 1X8EA 4XZPA 2WZPP 2MEV2 3H1MA 5FOBB 4RS5C 1H4GA 2RS11 4DRVA 5FLJA 4YW2A 4CDWC 2ZKNA 3PVBB 1OD5A 4XQWA 1ND3A 3THPA 1V9U2 3ZFGA 3ZYGA 1EPZA 4YW3A 4F8AA 4R52A 4J1XA 1NZCA 2JEMA 2B5HA 5DUWA 5J98B 2D7FA 3NV1A 1R082 4FTBA 3WG1A 1WA4A 3PVNA 3OD4A 3LA7A 5DUXA 1AXKA 4XIOA 1JXNA 3NL1A 1CX4A 1V6JA 1S0DA 2HWC2 4LLFA 3TYJA 4Z1VA 3PVEA 4WM7B 1AZDA 5BNPA 1AR72 5C8CA 4DNYA 4ZKTB 1UIJA 3NW4A 1HDKA 5LRRA 2P3JA 4QGLA 3O0XA 1YFWA 5H9RA 2ZS6B 3IT8A 1G9FA 5I8SA 5I0TA 3FLRA 4IEPA 3AYAA 5ACA2 1AF9A 3R4SA 5JCTA 1Z7S1 4XF4A 1AYN3 2H0BA 3I4IA 3N35A 3RMXA 2CL2A 3ZMOA 2IFRA 4RR3B 4GA9A 3A4UA 1FX5A 4Q4V3 3ZSKA 1UKRA 1SLIA 2EXJA 3EO6A 2RM23 3ZYJB 5DZFA 4Y5Z0 3VBUC 4KGGA 1H1AA 1WLCA 3SH4A 1AR63 1XRUA 3ES4A 4P5HA 3O14A 1RIRA 1SBDA 3S0MA 5FPXA 3X29B 1LENA 3N7LA 4GB33 4LULA 1DQ1A 3VBSC 1W0PA 2Y26A 2XH6A 4PQ9A 4S2DA 3PLQA 4FP3A 1S0JA 3EJKA 4NHKA 3SH5A 4I0BA 1Z7S3 3TAYA 2WQZC 4ZU5A 3NKTA 1X8MA 2WSUA 2WT0A 4Q4X2 1EY2A 3M7AA 4HN1A 4Y1VA 1AL23 1SLAA 4AI2A 4AGVA 5K0UB 1COV3 4CDUC 5A32B 2RM21 3HD8B 2WS93 2JECA 4DY5A 2DU1A 5ABJB 4QPYA 3TN92 3ZX7A 3FUOA 1LOFC 5EYYA 1OA4A 1ZZ9A 4ISRA 5ABJC 1GICA 1HXS1 2Y0OA 1QJY2 4CRQA 4LT5A 4HK8A 1AL0G 2WLQA 4GB31 5DDJ3 3IKWA 4JVAA 2GMPA 4RHV3 1D4M2 2R1DA 4ATFA 1K5MA 1N1TA 2D6MA 2GH2A 2WNVC 5EJ3A 1FV3A 4CDWA 1HRV1 2R073 4D3WA 1ND3C 1AJOA 2OYZA 1AL21 4KGQA 5SV8A 3ZFGC 2WNEA 2ZMLA 3R6SA 4G9SB 1C5HA 1PZ8A 3G7DA 5J7MA 1LOEA 2A70A 4KU8A 2BBVA 4Q0QA 5CADA 1HX6A 2P17A 3QCWA 4LBQD 1U0AA 2HWB1 1C8M2 1YI9A 1JW6A 4GXLA 4JV4A 5CFCC 3LZZA 4LHNA 1QJY3 1WCSA 2ZPXA 3H8UA 3WP3A 2R0FA 1D4M1 4Z8BA 1KITA 3BOWA 2WS92 1RMU3 2HWB3 2HWF2 3JB8A 3KD4A 3GHNA 4K8FA 4XFFA 4UW3A 3VBOA 4AFCA 4B4PA 5I8TA 1YRZA 1QJY1 5EV7A 4BH9A 2D6PA 4B4QA 1FYUA 5TSWA 5BNPC 5C8CC 2CNAA 2EIGA 3ZFFA 4W6WA 1Z7S2 1OHFA 4M3CB 2DVGA 4CDQB 3AMMA 1X7NA 2R062 4BMBA 2ILMA 2UY8A 1RUF2 1RUC2 2K9ZA 3MIHA 2NM1A 3S7IA 2ZZQA 1RVF1 3WQ7A 4QU2A 4ASLA 4K3UA 4M01A 1FI2A 1LU1A 3B5LB 3M4FA 4YFWA 4PDWC 1CJPA 2HWC1 5EWSA 4COWA 4Y4YA 2VQ0A 5SV5A 2HWD1 1VRH3 1H2KA 4LBOA 3WG3A 4BLJA 1I6XA 3ZYRA 1KDMA 5LRSA 4HVQA 3BU7A 3KS7A 1KS5A 2ZGOA 2HWD3 1VRH1 4AQ6A 5L7OA 5FQ0B 1QJU1 2XUMA 3VBOB 2YPJA 4XXPA 5KHJA 1DIWA 1F5JA 2BTVC 4XJ8A 1NE4A 4Z82A 1O4ZA 2XLAA 5K8SA 3RG0A 1RVF2 4L11A 4IV1B 4AF9A 2CGPA 1IPJA 1SLLA 4HZFA 4XF9A 4JC1A 2RS12 4BE3A 2HWC3 4FPHA 4CEYC 3H1YA 2BEOA 4LO5B 1XNDA 2VULA 3VBRB 3WDUA 4XMAA 1RUC3 4Z2WA 3OF1A 1NQDA 4IEVA 4YM0A 4BYYA 1IS6A 2K0GA 2WNUC 4K21A 3URFA 4FXKB 4HSJA 4AI1A 1W0OA 4AG4A 5GM0A 5KXCA 2VW2A 2ZX4A 1AX0A 3H1WA 4LTAA 1B09A 1BJQA 1ZZCA 2QQPA 2JXAA 3WDWA 3WD5A 4D7SA 3CJIA 1CAUA 1UPIA 4CTEA 4D7TA 5F5QA 1XE8A 2ZAAA 2MEV3 4PLNA 4GWMA 4HSLA 1GZWA 1NLSA 4BLIA 5FQ0A 3S6PA 3MPPG 5JIAA 3ZN5A 3VL8A 4OHYA 1UCXA 3VL9A 4MGIE 5KHGA 4I09A 2RR11 1RUJ3 4EN9B 1Q8SA 2RJLA 5ACA1 4WV8A 2BWCA 4BWOA 3FC0A 5GZEA 3LOBA 1MS1A 1C4RA 4RGAA 3SXWA 5T3NA 1HRI1 1ZZBA 1W6PA 4RS5A 4NHMA 5C4WC 5E8AA 4BCUA 1X33A 1J59A 2X29A 1SLTA 5T5OA 4IXLA 4MV2A 5BPXA 5J96B 4FOWA 3WG2A 3ZFEA 4K9SA 4S2FA 4M0HA 2PHRA 4PDWA 4URTA 2UWAA 3GZUC 5DG2A 5K9YA 3NO8A 5E88A 5GZDA 1QU0A 4JRLA 2WL1A 4XBNA 3J26N 4N7IA 4NWWA 1B35B 2AYHA 2WZR3 4OLLA 1N1SA 3IBMA 5GLVA 1RGSA 1IQAA 3L2YA 5L19A 3DN7A 4KWJA 5FFOC 3LOIA 3PJQA 4RQPB 3GYDA 5L7OC 4Q4W1 1AR61 2YHJA 4LHKA 3RI9A 2WNVB 1UU5A 1SLBA 4HFSA 4KWLA 1O3TA 4WVMA 4D69A 4LE4A 3MW2A 2WT1A 5I0UA 2EALA 3AFGA 2BWAA 4LBQA 2RM22 3HT2A 2A73B 1A8MA 4CEYA 3T1MA 5T5PA 3SCFA 1Y9QA 1O5UA 1YFUA 4Q4V2 3T1LA 1ZZ7A 2QE3A 1A8DA 1OA2A 1WLWA 1NA1C 1PM7A 1OQEA 1K5MB 1AYN2 2VVEA 3VZJA 4K20A 2N7GA 2CAVA 4P14A 4B3NA 4I3PA 1OI6A 4QPIB 2HWF1 4IV1A 2MNGA 2YXSA 3MPBA 4FPYA 1TNRA 4OUSA 3DPRA 2NMOA 3JU9A 3M3CA 2ZGKA 2I2SA 2R043 4Q0UA 4E27A 1OOPB 3UKVA 3OPZA 1CN1A 2ATFA 2JDZA 1LEMA 4N9HA 1PO22 3POSA 1SLCA 1LODA 1DGRA 1ND2A 1EPWA 4IEQA 4Y22A 5J3UA 4ONUA 3DPRB 4U2AA 2RMU2 1W6OA 1ZBE1 4CYDA 1Q8QA 4R4ZA 4Y20B 2W52A 4QPIA 5C6CA 1R083 2A71A 1V9U1 4BM8A 1BEV3 1VLNA 2Q1ZB 1RHI2 5FRAA 2BFUL 2A3YA 3E6BA 4AEKA 1ZBA2 1V9U3 2ZHLA 1BEV1 3M2MA 2G9FA 3CJXA 1BVP1 1PNFA 4HN0A 1GQGA 2ENRA 4WVMB 4HL0A 5C8WA 1IOAA 1SCSA 2WNVA 1QXPA 5C4WA 3JQXA 2UY9A 5D8AB 2KA3A 3H3ZA 3WNXA 4YGEA 1RINA 2EA7A 2CGOA 2R16A 4MYEA 4Y1YA 3JCIA 3TOJA 4O9EA 3ASIA 3ZFEC 4MLOA 1OSGA 4XJAA 4H7MA 3AM2A 1QQP2 4YW4A 5C8CB 1NXD1 3VLBB 4M3CF 3DUIA 4FPOB 1IS5A 1C8M1 3SNMA 5CFCA 1R092 3IDEA 1RUH3 4I0WB 2DTWA 1AX1A 1DYKA 2DURA 1QWRA 5I91A 3WR0A 1VBA2 2HEYF 1QJX3 4R9CA 2DUPA 5A33A 5JDBA 5AC92 1O91A 2PYTA 3AB0A 4XETA 4AFBA 3ZFFC 2DCKA 1N3PA 1WD3A 1QXJA 3P3PA 3ILNA 1CESA 5E1RA 3RQ0A 2XWJB 3NAPA 1V6LA 4YFZA 4XEZA 5HCBA 3AZWA 4RD7A 3MICA 4I02A 4AI8A 1NCRB 1CR7A 3O7OA 3OCPA 5JZGC 3HIFA 2JG8A 1UKGA 4E2QA 1ZRCA 4JGZB 2G9GA 4XJUA 3DL3A 3LKJA 1KQRA 5GZCA 4FPJA 1GZ9A 3OGJA 2D40A 3RWNA 2PELA 2JENA 3APBA 1QJX1 4FPLA 1BMV1 4AEDB 1LHWA 5CVRA 1JYIA 5FLIA 2WFF3 3PTYA 3M1HA 3DPRC 5AC93 3LGRA 4PF5A 2EXIA 5GZGA 2VMHA 1AXYA 3I59A 4ZU4A 1AYM2 4AFDA 1RL3A 1VP6A 2GC0A 2RS31 4RQPA 1RUH2 4OHVA 3V0AB 1LOBA 2XB6C 2ZCWA 3V0BA 1BBT1 1LESA 2Z5WA 1DF0A 4ITCA 2NP0A 2PAKA 4JAAA 1G6NA 1YFYA 1YO8A 2RS33 4CP0A 4LLOA 2ZX2A 2O8OA 2VXRA 3WUDA 1TQ5A 3V65A 2JICA 2WSVA 1HV1A 3LCPA 1HW5A 3D0JA 4QPIC 5IK7A 2W68A 3JD71 3VBSB 1ZRFA 1KFXL 1W6QA 1ZYBA 5CB7A 3VGIA 4COZA 2JG9C 4I30A 1KJRA 1REDA 4K1ZA 3HWJA 1LHOA 1GANA 1O7FA 1ZBA1 1QJZA 1SFNA 4Q27A 2XVGA 2WNUA 1VBB1 3MLLA 1U5IA 1RHI1 2NN8A 4X6RB 2C5DA 2W08A 4FXGB 2QFEA 1BXHA 1KD7A 3NV4A 1ZBA3 1VALA 5FMOL 3USUB 1W6PB 3AYEA 3NAPB 4GALA 1RHI3 5K7PA 4XJWA 1G9AA 1BYHA 4BIOA 1URXA 3NWKA 3UJOA 3CJIC 1A6CA 4GMP1 5EFUA 2R071 3AP6A 4GIQA 3QLQA 4NWVA 2ZAHA 2OIIA 3K48A 1JBCA 1PGSA 3BTAA 2DCJA 2X5IB 4FBFA 3POWA 5LEJA 2HKXA 1EAH3 4RHV1 5CFCB 4OVEA 5KBFA 1QQP1 4PLMA 3WXPA 1S55A 1VBD3 2WQ4A 4AW7A 1REEA 1AR91 1HRV3 3TWIA 4AEMA 2ZGRA 1NY71 1GKBA 4A3XA 3ZYIB 1GFF2 2B46X 1PO13 1VBB2 2GH8A 4GMP0 1ENSA 1ZBE2 4QQ2A 4LE3A