1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
5EZWA 2IXIA 4WBBA 3ELNA 4PJYA 2PAEA 4NVPA 5C8WA 3RYKA 3WW2A 4IEOA 4BHPA 4H7LA 2EAAA 2K0GA 3KMHA 2C0ZA 2B8MA 2IC1A 4KU7A 3NW4A 1J59A 2ETEA 1O7FA 3NKTA 4LEJA 4AQ6A 2CGPA 2GH2A 4XFIA 3RDIA 5I0TA 1SEFA 1OI6A 1NXMA 1NE4A 4XF9A 2PHDA 4HSLA 5JSRA 4META 5KHIA 2Q30A 3G7DA 4QGLA 3RYPA 1VJ2A 1IPKA 3SMHA 3H7YA 3H3ZA 3KSCA 4F8AA 3FWEA 4KU8A 2FQPA 4E2SA 1UPIA 2E9QA 1ZZCA 4IEXA 3E97A 3I59A 1X82A 2GC2A 2GC1A 2XLGA 4B29A 3C3VA 4MGZE 2FMYA 4UBHA 3E6DA 3H7JA 5J48A 3KGLA 3LA3A 4YARA 1EYBA 1V70A 4JVAA 3S0MA 2CV6A 1EP0A 4IEQA 4PIXA 4KWLA 4I09A 4Q0QA 4AQ2A 3NJZA 4BIFA 4FT8A 5FCCA 1XE8A 1YUDA 4MGYE 2MPFA 4N9IA 3WW4A 3CF6E 3BU7A 1CGPA 3FHIB 4EROA 4KWJA 2D5FA 3PVBB 1O3TA 2OA2A 5I8YA 3I7DA 3TNPB 1H1MA 5I93A 5CU1A 3HQXA 3ST7A 2PAMA 2GU9A 4MGIE 1TQ5A 5FDBA 2BNNA 4Q0UA 2BGCA 4Q29A 1J3PA 2Q1ZB 2PAKA 3LOIA 2CAVA 4Q0PA 3L2HA 3FE5A 3ES1A 2OZJA 4IETA 5LRRA 2Z69A 1YHFA 1LKNA 4XEZA 4LA2A 2EA7A 3MPBA 5KHHA 2XLAA 3U0ZA 3QOPA 3UKNA 3EJKA 3BALA 4TLFA 1I6XA 1DZRA 4X6RB 1XE7A 4EV0A 3D82A 4AXOA 4ZU5A 4HVRA 5KHJA 5T3NA 4F7ZA 2QJVA 1O3QA 1X8EA 2B9UA 4CYDA 1OFNA 3OF1A 3OD0A 1J1LA 1CAXA 1J58A 4LA3A 3I54A 4HN0A 4MV2A 2Q4SA 2VQAA 3FZ3A 4HLTA 4IEUA 4J1WA 5I0SA 1Q43A 5EFUA 5JSOA 1FI2A 2Y0OA 2MHFA 1YWKA 4IESA 3E6CC 4QMAA 1YFUA 3NVCA 1OMIA 2GAUA 3NSTA 1LRHA 1FXZA 2KXLA 2B5HA 4IERA 1H1IA 5CVRA 1NE6A 4DINB 1Q3EA 2HKXA 5CADA 5JSPA 4HMZA 4LUMA 1ZREA 3CLPA 2O8QA 2D40A 1ZRRA 1X8MA 1CAWA 2PHLA 3EO6A 3DN7A 5BPXA 2Z2SB 4HN1A 2K9ZA 4XF4A 3SCGA 3ACLA 1ZZ6A 4XFHA 4HBNA 4PIZA 4O9GA 3JZVA 3I59B 4XFAA 1O5UA 3H50A 1ZZ7A 4D7SA 1IPJA 3LAGA 2ZCWA 5KBFA 1SFNA 2VPVA 1GQHA 5KHKA 5LEJA 1O3RA 4BYYA 1FT9A 4XF1A 2MNGA 3UKTA 4MH0E 1UD1A 2H6BA 3KCCA 3CJXA 1J3RA 3CEWA 2OPKA 4X6QB 3GYDA 4YSFA 2GC0A 4Q0SA 4XFBA 4MUVA 4LULA 1WGPA 4Z82A 3UKVA 1O3SA 1YFYA 3RPQA 4ZU7A 3IWZA 4UBGA 3U10A 1CAXB 4FAHA 1JUHA 4XFGA 4FAGA 3WW1A 3RNSA 3S7EA 1Q5OA 4LUKA 3SCHA 4XF3A 4GULA 3D0SA 1YFXA 2IXHA 4UXAA 5JAXA 4N9HA 1XRUA 1YLLA 2I45A 3H1YA 2V09A 2P17A 4L11A 4AVBA 3BPZA 5I8SA 3HT2A 1CAVB 3MDPA 3MYXA 1ZZBA 3U11A 2QCSB 4L2NA 3FX3A 3OGJA 2ET7A 4E2GA 2BNMA 5FPZA 1PMIA 1UIKA 2N7GA 3NL1A 1CAWB 4JTOA 3R6SA 1ZNPA 2BNOA 1RUOA 3H8UA 3H1MA 1Y3TA 5FPXA 2PTMA 1ZX5A 3E5XA 2XKPA 5BXXA 1O4TA 2WFPA 2UYAA 1CAVA 5F1RA 3IBMA 4BH9A 4LLOA 5C6CA 1DZTA 1QWRA 4HVQA 2Q0AA 4JV4A 4A2UA 2H0VA 1QY4A 4HVOA 2IXLA 4PIYA 1RC6A 3CO2A 3ETQA 3IDCB 4QM8A 2ZKLA 4I3PA 4JTNA 2OYZA 1QXJA 5I91A 3ROUA 5E1RA 1RL3A 3TNQA 1EPZA 3N4MA 1I5ZA 3DV8A 3IIAA 4QX5A 1UCXA 3PLQA 5JR7B 3S7IA 5FQ0B 4XFCA 5J3UA 4MGKE 5D1IA 4IEWA 4R8HA 3BB6A 3EQEA 4I0AA 1RTVA 1EY2A 4I02A 3RZZA 4EWAA 1RUNA 2QDRA 2OZ6A 4KL1A 1Y9QA 3FJSA 4XFFA 3SHRA 3BCWA 2XGXA 3D0JA 2ATFA 1VR3A 1VP6A 2UY8A 4IEPA 1DGRA 4ORFA 2UY9A 5K8SA 4KWKA 3MZHA 4WVZA 4FBFA 1PM7A 5BUVA 5FQ0A 2H6CA 3QACA 5I0RA 2CAUA 2D93A 3M70A 3USSA 3LZZA 4K8FA 4MZUA 3KGZA 2O1QA 1HW5A 1LR5A 4MX3A 2IXCA 1ZRCA 3E5UA 3LWCA 3SXWA 1ZVFA 4I01A 2XHKA 3EBRA 3OTFA 2GZWA 4WZCA 4XF0A 5JCTA 1CX4A 2VECA 4I0BA 1GQGA 2XL9A 5I0UA 3O14A 4IEVA 4HZFA 3HT1A 1LB2A 2DCTA 5FLHA 5E16A 2F4PA 4QGNA 4QGMA 4QM9A 4AVAA 4LTAA 3B02A 2UYBA 5AVPA 2WC2A 4I2OA 1U12A 5BV6A 2QVSB 5BY5A 1J3QA 3FFQA 3WW3A 1ZRDA 3LA7A 3DL3A 4J1XA 3ZDSA 2EVXA 1ZRFA 4YNIA 2QNKA 1SQ4A 2XLFA 1CAUB 2GC3A 2PQQA 2XL7A 2PFWA 5KHGA 3H3UA 3M3IA 1QXRA 1G6NA 5LRSA 3H9AA 3IDBB 3DKWA 4YYOA 1DGWA 4R52A 1WLTA 4O9EA 1WA4A 3OCPA 1X7NA 2IXJA 3PNAA 4IEZA 4E2QA 3VHRA 1NZCA 2ET1A 3GBFA 2IXKA 5I8TA 1OD5A 4EWEA 3E5QA 4EWDA 4OLLA 5FLIA 3HIFA 4AVCA 4ONUA 3E6BA 2PYTA 2HJIA 4Z07A 4IEYA 4D7TA 1RGSA 2D5HA 3EHKA 4RD7A 5LEKA 4OFGA 3H1WA 1NYWA 3CL1A 1UIJA 3LA2A 4QXKA 4YRDA 5J7MA 5FLJA 1ZZ8A 4Q0VA 1O5LA 2BYVE 4HSJA 1YFWA 1UW8A 3SCFA 3RYRA 2BEOA 4P9GA 2PA7A 5HI0A 2XKOA 1L3JA 4ZU4A 4XETA 1CAUA 3ES4A 1ZZ9A
chains in the Genus database with same CATH superfamily
1COV3 1Q8SA 2VUAA 5EZWA 3RRDA 2UWCA 2IXIA 1W8HA 4WBBA 3UGHA 1PX3A 3AMMA 4PJYA 2PAEA 3VLBB 1G9CA 5C8WA 4BWOA 2VZQA 3VBUA 4QAWA 3WW2A 1V6OA 4GKYA 4CXWA 4BHPA 2BBVA 1EAH3 1FV2A 3OD4A 3M4FA 3KMHA 1GANA 2VZRA 4FP3A 4QKNA 4N7UA 4Q4W1 3FN9A 4WV8A 1EUTA 1PGL1 1FATA 4LEJA 3A0NA 5GLWA 4ATFA 4OMCA 3BI3A 2CGPA 3Q8AA 3V65A 2YU2A 2QQJA 1OUXA 2WNVC 1NE4A 3T1LA 2ZGNA 1AR71 1JTZX 4XF9A 3WEZA 1H8VA 2WNOA 3NNGA 1SLCA 5JSRA 3KHBA 3NMBA 1H1AA 1KDKA 2VMFA 3RYPA 1U5XA 5IAXA 1VJ2A 4XXAA 1XQNA 4Z2AA 2Y0IA 3K51A 2W68A 2TEPA 3AC0A 3H3ZA 3ZXAC 4YFZA 3WQBA 2VBBA 2EIEA 1TMF2 1UOGA 3WP5A 4D94A 3DGTA 1JBCA 3JQXA 2ZX1A 4AE2A 3WDUA 2E9QA 3PUIA 1UZ0A 3VD4A 1ZZCA 3E97A 2RDSA 4CDXA 5IT6A 3M3QA 1HLCA 4Y22B 2GC1A 5A3PA 2E7TA 4WVMB 5FZBA 3C3VA 2I2SA 4B4QA 3KGLA 5D21A 3LA3A 3AXEA 2DV9A 2R30A 5GZEA 4COUA 2VMEA 1ASJ1 1EP0A 1H8TB 2NYYA 2WLPA 1KITA 4KG8A 4IEQA 4PIXA 2QQKA 3S57A 4TZDA 2WNVB 4AQ2A 5DAVA 3W58A 2W9XA 1YUDA 5FO8B 1ENRA 4N90A 4YZ4A 4RQPC 4LO5B 2ZGUA 2VUDA 3POJA 3KF3A 1GU3A 1QOOA 4DZGA 2JG9A 5AFEA 5C8CC 4TTGA 1SLAA 5F5AA 4KWJA 2FDIA 1UN1A 1PK6A 5FZ8A 5F5CA 2HEYF 3I7DA 2WQ4A 1WBLA 3MW2A 1UXXX 1QDOA 2VW1A 5I93A 3MUZ1 2D97A 3ZYPA 1BEV2 3DPRB 5CZKA 2PAMA 1DG6A 1RMU1 2VTFA 1ASJ2 1OQ1A 4QB6A 1TQ5A 4R9DA 4LBLA 1V6LA 5EHDA 4LLFA 2ZAHA 4NRQA 3H8OA 4MADA 2PLV3 5JOWA 1G9BA 1OOPB 2CAVA 1OH3A 1S0JA 1MZ6A 3ETPA 1ZBA1 1DBNA 4IGPA 3NJVA 2AACA 2WINB 3NAPA 5LRRA 3ORJA 4NHKA 1FMD1 2NZ9A 4D6QA 2Z69A 1UOBA 2Y33A 1JYWA 4XEZA 1DYKA 3ZN4A 2EA7A 2QBXA 3DYPA 2Y34A 3VZNA 1E5SA 4YG3A 3C7HA 4FPGA 2XVGA 4CCOA 1KD7A 4LBJA 1URXA 1BZWA 1D7PM 4NOTA 3ACIA 1H30A 4LOTA 5FZ4A 1Q8PA 4RSUA 5F39A 4AHXA 4KGGA 4OZXA 2AREA 4CDUA 1HX6A 3AFKA 2DF7A 3KHCA 3MIFA 2C6SA 4AXOA 4AHYA 5JR2A 4R9BA 2R072 4HVRA 3OPWA 5IHRA 4LITA 4JQRA 1VBC1 2JB4A 2C9AA 4E9KA 1BBT3 2ZGTA 1AR61 1Z7S2 2JG9C 1HRV3 4QPGC 3CIHA 4CYDA 1OFNA 1POV3 1AR93 3OD0A 1AYN2 1Z0HA 1W6NA 1PK6C 2YYOA 1J58A 1LOFA 2BQPA 5A1FA 3I54A 5HCHA 2Q4SA 4OHXA 3T4HB 1Q56A 4U2AA 2V5DA 4HLTA 1YXWA 4IEUA 4J1WA 5I0SA 1Q43A 1FMD3 1W6PB 2ZEXA 1LGBA 1Y7BA 5C3SA 3AZZA 5DDJ1 4DQAA 5CG9A 3VBSC 2W1UA 1RIRA 2RR11 3UYJA 2Y0OA 1ND2B 4URTA 3VKFC 2JDKA 1QJY1 4Y1VA 3WX5A 1NCQA 1MEC2 3USUA 2CGNA 2HWF1 1AVBA 2XB6C 4IESA 1AF9A 1D0GA 3VZKA 5C7GA 1WW4A 4M4PA 1LULA 3NVCA 2PLV1 3KVAA 4IERA 4Y1UA 2XONA 3I2HA 2XPJA 1V6IA 1WW6A 4A42A 1U5YA 1V0AA 1MZEA 2RS52 2VMIA 3Q9OA 4RGGA 4OHYA 4KWUA 5GLZA 1HJFA 5K0UC 2VE1A 1W3VA 4AGRA 5ERLA 2ZGKA 1X8MA 1CAWA 3KT1A 1XXNA 4ZONA 4ASMB 5FZGA 4P00B 4Q5OA 4WZFA 4XJUA 2Z2SB 4Q4Y3 5BPXA 2DFCA 4HN1A 2D6LX 3D6EA 2BRTA 1UYYA 1TNRA 4XF4A 5FPUA 1RVF3 1IHMA 1UMIA 2PHXA 1NA1B 2A70A 3W5NA 5F3GA 5FXZA 4O9GA 3AMNA 4GJYA 1G8WA 4M0HA 4RR3C 1O5UA 3NJYA 3SH4A 4H3WA 2IVJA 2IFWA 5EXOA 3LAGA 4URAA 1GV9A 2ZCWA 2AR6A 2VJXA 3LEMA 1H4HA 1LOCA 1UY2A 2OPWA 3D4KA 3EB7A 3M3EA 1SFNA 2RS11 3BIWE 3RFRA 1REFA 1PO22 1QNYA 1HRI3 2WNVA 1F4AA 2A6WA 3OUJA 3A23A 4LKFA 4XILA 5LA2A 2WZPP 4O61A 1TNFA 3VBOC 1JYNA 1SG3A 2D6NA 2H6BA 3KCCA 3CJXA 1WCSA 4XPVA 4YGEA 4DUWA 3WG4A 4K6BA 4YSFA 1GNZA 5IVFA 4R4ZA 3ZPOA 4LULA 4CCMA 1DQ1A 3PU3A 2RR13 1GFF2 4PCRA 5FRAA 1DZQA 3UKVA 3RPQA 1MZFA 3MV11 4YVWA 1CR7A 1IKQA 1UX7A 3AKTA 4ZZ5A 2J22A 2YPDA 2FD8A 1QH6A 4XW3A 1LOGA 4FAGA 5CNAA 2BW8A 1RUG2 2J42A 3PUAA 1PIV3 1TME2 3OSDA 4XF3A 2RM22 3BKZA 2VC9A 2HWD2 1YFXA 1QJEA 4Q4X3 2IXHA 2PHRA 3AVRA 4UXAA 2V72A 5FK7A 2HWE2 5FBJA 1XPWA 5C9AA 3IPVA 5F2SA 1MVQA 5HBAA 4KMQA 5FUNA 2P17A 1R64A 4XURA 3H8RA 3AKQA 5FIXA 4UF0A 3TN92 3OUIA 4MSVA 3CU7A 4BQWA 1W6MA 1G9AA 3VKNA 2WNUA 5C4WB 2TUNA 2PHUA 1YNAA 5FOJB 5JOXA 3TN91 4L2NA 3T2TA 5L19A 1NQDA 1V00A 1UKRA 3GCWA 3OGJA 4N53A 3TWIA 1FYUA 3VZMA 4CPBA 2HWE1 5JZGA 4NO4A 4CDQA 2BNMA 1UMZA 1QHDA 3ZFGC 1UIKA 2XUMA 3N36A 4Y20B 1SPPA 2N7GA 1PVC3 5T5OA 5FXVA 4AVSA 4C1WA 3SNMA 1CAWB 4PHZA 1MS0A 2B42B 2WWUA 1GP5A 2E63A 1SCRA 5C9AC 2P3YA 3E5XA 1N1YA 1SBDA 1ZBE3 2YFZA 3K3OA 5FFOC 5FMDA 4AR2A 2XKPA 1O4TA 4O65A 4DB5A 4IE7A 5JIAA 4UF0B 5LBEA 1CAVA 4CDWA 1DHKB 1W3XA 1AZDA 1XNBA 4D6SA 4IE4A 2W0XA 4QPIC 2WWJA 1XNKA 2OT7A 3PIGA 5BNNC 5C71A 2NP0A 3GGLA 4XHBA 4HT1T 2XJPA 4LBNA 4K7JA 2PLV2 4XCBA 1W2TA 3DPRC 4HVOA 3T0BA 1CZVA 2IXLA 2O14A 4XBQA 2BDRA 3RI9A 4MLOA 3ETQA 4DUVA 2BFUS 3DXUA 3IMNA 4QM8A 2WS93 4I3PA 4QDRA 5A3UA 1QXJA 3WDXA 2RDRA 3T0DA 3MF6A 4XDPA 4YFWA 2A7AA 4XJ8A 4B1MA 1W2NA 3RZHA 1QJU3 4FFIA 2ID4A 4FO9A 3VDCA 3T4VA 5C8CB 3WT3A 4CCEA 2QQOA 1CJDA 1UCXA 4LORA 3ZMNA 3O1PA 3UNPA 5IJRA 5FJHA 3S7IA 5FQ0B 5J3UA 4MGKE 2EALA 3K4AA 5A3LA 1HXS3 4IEWA 4E4ZA 1CQ9A 3BB6A 3N9LA 4R9CA 5KXEA 5FZCA 2DU0A 1RUH3 3E1F1 3B94A 1Z7S1 1WWYA 4FTEA 5KWRA 2RV9A 4BJ0A 4B7KA 4A7KA 4CU7A 1LAJA 3AJYA 4DPNA 4DXSA 3ZSLA 2X5IA 5DN2A 4HANA 4ZKTB 2VZPA 1YQ2A 3ZR6A 1AJKA 2ATFA 1AXYA 1VP6A 2UY8A 3HN1A 4HOOA 4MXWA 3VBRA 1WLDA 4YGCA 5K8SA 4WVZA 3GZUC 2E7AA 2WN2A 2WZR1 1IKPA 2RM23 4Q4W3 5BUVA 1SLBA 5T5LA 4AFDA 2JENA 5FQ0A 5JWPA 3JU9A 4HG6B 3WDVA 3P3PA 4LBMA 1HB2A 1S1AA 1SMVA 1UZVA 2RR12 2O0OA 3GNEA 3ZYGA 4AGGA 2O1QA 4LHKA 5DDJ2 3R4UA 2JXAA 1HW5A 4NHMA 4JRAA 2QQVA 1R093 1TMF3 1PO11 2DUQA 5FY5A 1XNCA 4I01A 4XXPA 2W92A 1E5HA 2XHKA 2ZACA 3OTFA 2LTNA 1PX4A 4M3CE 2VOWA 4MXWB 1AR62 1H2MA 4A45A 1F5FA 5C3QA 4YW7A 1EV13 5A7WA 5B4NA 4HKWA 1HV0A 1C1FA 1U5ZA 3U1XA 3JB8A 4LBQA 3O14A 1MPXA 5KR7A 1W9FA 4COWA 2WSVA 5E16A 5FZ6A 4QGNA 3MW3A 1RUE1 2BVVA 2ZX2A 1YQ5A 2QQLA 2UYBA 3LEIA 3M2MA 2VW0A 1CZSA 5FMOS 1X50A 4CU9A 4XZPA 1BMV1 4LKSA 4AFAA 2VMHA 5BY5A 4QPGB 1K12A 3RZLA 2GNBA 3ZPYA 1O4YA 2WUHA 3M3CA 3ATGA 1WCUA 3ILFA 5CG8A 3ZDSA 3KV9A 4K1ZA 1ZM1A 4BXFA 5HCFA 4DXZA 4MYEA 2W1QA 4UW6A 4Q4Y1 5CIRA 2QNKA 1RXFA 1ND3C 3B7MA 2ADEA 2XLFA 1CAUB 2RS51 3ZIXA 2JDNA 2XL7A 5L36A 2D44A 4OYUA 4KH9A 4YM1A 1QXRA 4IV1B 1C8NA 4DUXA 1RMU2 4BM8A 5LRSA 2R063 1BEV1 3I3DA 3OBAA 2Q8DA 1N3PA 1AYM2 2QUOA 3HNMA 4OI2A 2LW8A 4AWDA 4JGZC 1DGWA 4C8DA 4YZ5A 1YQ6A 4R52A 1WLTA 1WA4A 5DAWA 4IEZA 1JW6A 4QPGA 5TSWA 2E33A 3P1IA 5LY2A 1DGLA 3PVNA 2V5YA 1SBFA 4PLMA 3UJQA 4RFT0 1AX1A 4J6GA 2IXKA 3AL6A 1FAYA 1B35A 1REDA 1VB2A 3B9CA 5J1XA 1GNHA 3E6BA 3HOBA 3LDRA 3FLTA 3NO8A 1Q8VA 1LGNA 1PO23 4R9AA 4CE8A 3CZJA 5DZFA 5LEKA 4QKFA 3LQCA 1NYWA 2W52A 1R1A1 1HXS2 4ISRA 2JIGA 3LA2A 2ZGLA 4JDNA 5AVAA 3TYJA 1CN1A 3MIHA 2DVDA 3I2JA 4Q4W2 2BFUL 3VV1A 4YM0A 2HYKA 2CHHA 4HSJA 1QJY3 1KQRA 2ERFA 3SCFA 3ZYRA 2EXJA 5FY9A 3SC7X 4LO8A 3RYRA 2BEOA 5HI0A 2Y6LA 4I0WB 4U36A 4Y22A 1KEXA 4XETA 4GJZA 2KA3A 3LOBA 1DGRN 1TMF1 2VNRA 3AL5A 1FMD2 4D3WA 4QDSA 4NVPA 3VBUB 1H2NA 5LA1A 5FWJA 4FFGA 5CYYA 5L73A 4IEOA 2QQNA 5FYUA 4IGQA 2C26A 2ZPXA 2C0ZA 1PZ8A 3C8XA 3VBRB 3ILRA 2WLQA 4FPHA 2JX9A 2ZEWA 4NWWA 4UYBA 3VBUC 3WUDA 3NKTA 4CU8A 3BTXA 2GH2A 4XFIA 2YY1A 4ARYA 5I0TA 3VBHB 3WQ0A 5DABA 4W6YA 1OI6A 1NXMA 3M3OA 4JX0A 1V6MA 4OUMA 1NLQA 4XAAA 3CJIC 1GICA 2PHFA 4HSLA 5FXXA 2MEV3 1G9FA 5FPVA 2RMU1 3W9AA 2Q30A 1A78A 1Z78A 3G7DA 1POV0 4FPOB 3ZLIA 5DG2A 5FREA 3WHTA 3VL8A 2YC2A 3VKMA 4S2GA 3TN93 4LBKA 1CPNA 2RS13 3H7YA 5EJ1B 4AEDC 5IUQA 5FYCA 3B01A 3LCPA 3K2OA 1LODA 2R6QA 2KR2A 3T2QA 1GOFA 2FQPA 1JOBA 2G1MA 1ULCA 5FR3A 2BU9A 4E2SA 5F8PA 1ST8A 1UPIA 3GZEA 2ZX3A 5CBLA 1A8DA 1CIYA 2JECA 2KM2A 5DAXA 1RVF1 5CFCB 4UFIA 2W3JA 4QX0A 1QMJA 2DUPA 1X82A 4HPKB 2GC2A 1QEXA 3OEAA 4WVMA 5K7PA 5M0TA 5FMBA 4BQXA 5I0DA 3H7JA 2ENRA 2XQRA 4Y3OA 5J48A 1MS1A 1EYBA 5A3WA 1NZIA 1QJZA 2CV6A 2QKDA 4Q26A 4C0BA 2FZ1A 1R1ZA 4NPMA 1IQDC 3N9OA 4KWLA 4W6WA 3ZSJA 5KC5A 3NJZA 5ISLA 3O1VA 3SLIA 4YGDA 1H8TC 2MEV1 3N7LA 5DPNA 3RG0A 2NM1A 4XOGA 1QKQA 5FCCA 1XE8A 4P9XA 3U14A 4CTEA 4LXLA 1ZA4A 2MPFA 3WW4A 3KQ4B 3PUQA 5K4LA 5LWBA 4BXSV 2WAAA 3WOGA 3FHIB 2AZ5A 2D98A 3ZFGA 5IATA 4E4DX 3OPTA 3OG2A 4EROA 1YEWA 4M3CB 4TSVA 3RZMA 4RHV3 4B1LA 3PVBB 4XACA 4FOWA 3R4DB 1D2SA 2OA2A 4YGBA 4AI9A 4W6XA 5FZHA 1H1MA 4OQ9A 3WNKA 4D69A 4YZ1A 1C5HA 5LA0A 3J26N 4M01A 4XTMA 1W05A 1SACA 1OPOA 5E6HA 1UO9A 1DQ2A 2FDJA 4JDMA 1UU5A 5J98B 3ZFFC 4F3JA 4AOCA 2EAKA 5FYTA 1NXD1 1UPSA 1AL23 3POFA 3UJOA 4LBOA 1I3HA 1ALYA 3SH3A 1BBT1 4GWNA 2XJRA 2AC1A 3L2HA 3ES1A 1OUSA 1W8UA 1OQDA 4GQ7A 1IGOA 1RUD2 4K20A 4N8MA 1AX2A 2JDMA 1KJLA 2UU8A 2IWGB 2Y6JA 3POSA 4LA2A 3SEEA 1JYTA 2ARBA 2QFEA 4QXCA 3THPA 4DEQA 4NIAA 3AMHA 4NPRA 3U0ZA 2VNGA 3EJKA 4G4FA 2WZR2 1W8FA 3BN6A 3BALA 4TLFA 5DUXA 2RJ2A 2ZAAA 1VRH1 5GLVA 2OX0A 4M00A 5IVBA 4X6RB 1YRZA 4Y33A 4EV0A 3HWJA 1S0BA 5FY4A 4FP2A 1SLIA 3WSOA 3SQOA 2W1WA 4EN6B 3ACGA 3BVCA 1O8PA 3D82A 4BPZA 4EZ4A 4CEWB 2RJLA 2WNUC 1VBD2 5KHJA 2VG9A 1GYKA 5FY1A 3B93A 5T54A 2QJVA 3R4SA 1VPHA 2B9UA 3LFIA 4JGYA 1R092 3HJRA 1D4VB 1J1LA 4M0NA 4CUBA 4LT5A 1US3A 1JMUB 1GOGA 4GWIA 3PVOA 4IV3B 4MV2A 1HRI1 1AR92 3AMPA 4AL9A 1TVGA 5IK7A 3FZ3A 2ZBJA 4QPWA 1COV2 5F5IA 1CX1A 2DVAA 4GB33 4QQPA 5JPMB 5JSOA 4UFLA 3RZGA 1F4HA 4XUOA 3J8F1 5FZ3A 4ATEA 4BCUA 4A44A 2WO3A 1S0GA 4A7YA 5C3OA 1SDDB 1NA1A 4HONA 1YWKA 3E6CC 3JBG3 3LEKA 4QMAA 5A3TA 1YFUA 3RQ0A 1JN2P 4INDA 3NSTA 4JCKA 4LO4B 5DQ0A 5F3IA 2B5HA 3CDZB 4ISQA 4RYDA 3OY8A 1GZWB 1O8SA 2HKXA 1KXGA 1E5RA 3AMQA 4MGTA 1IS4A 2VR4A 2D40A 4CCNA 1PHMA 2EIBA 4LHNA 1BYHA 2RJKA 3EO6A 3QLQA 2HLEA 5FYZA 4D6RA 4CCKA 2J1UA 5AFBA 4B8EA 3OBZA 1H6YA 1SCSA 4JQTA 1W0NA 3C7OA 2XVKA 1L7LA 2ARCA 4FSJA 3IDEA 5DAQA 4A3ZA 3S6PA 4XFHA 4HBNA 4PIZA 5FZ1A 3AZVA 3FLRA 4QHBA 3X29B 3V0AA 5BNPC 2HWF3 3FBMA 3K3NA 4PI2A 4ZHNA 3T1MA 2C9KA 2R042 5IFPA 5G04L 2OUJA 4S2HA 4JZRA 5KBFA 3LFMA 4SBVA 2VPVA 4BQ2A 3ZXKA 2VW2A 1O3RA 3U75A 1RUJ2 4XF1A 1RUD3 1ZRIA 2VZOA 5C9AB 4XBLA 4OCTA 1AHSA 1UD1A 4NWVA 4BQ5A 1W28A 1IOAA 3CEWA 1IPSA 5LATA 1BKZA 4QX8A 4W4ZA 3GYDA 3FLPA 3NKGA 4X6QB 3V64A 1QQP2 3TEZA 1LOAA 1G86A 1VBB2 4TXWA 4XFBA 3ZFGB 4QWNA 4IXLA 1UX6A 3VBOA 4CVUA 5AC91 1YFYA 3ITQA 2F17A 4LMFA 2Q8EA 1POQA 1RHI3 3OGGA 1OA2A 4UBGA 3MUY1 3K4DA 3NV2A 4XFGA 1EAH1 4JC1A 2RS53 4PDWB 5FMCA 1UY3A 4QQ2A 2VH9A 1E57A 4XJZA 3S7EA 4FPJA 2WIIB 3D0SA 2YBSA 4GMP3 5IYYA 3AX4A 3NAPC 1NCRB 5GZCA 4IE5A 3I8TA 2D43A 4K8RB 1VAVA 1FPN2 3W5MA 1YLLA 2XJQA 1AR73 3H1YA 3Q8CA 2LS6A 1FV3A 4FFHA 1M4WA 3WG1A 1BVVA 4L11A 4RGKA 5J37A 4AVBA 1SDWA 5I8SA 4NROA 1CAVB 3POIA 4CDWB 2ZGPA 4P9WA 3BU0A 3MYXA 2VQ0A 4RHV2 1QGLA 1BHGA 4HXCA 5L7OC 3JB4C 3NRUA 5FP7A 3UETA 3VDDC 4RFRB 1N1SA 3O1RA 4CDUC 1DGWX 1LU2A 2A5ZA 1IS3A 1UNBA 1OKQA 1RXGA 1T6GC 2ET7A 2DURA 4Q4V1 4E2GA 5FPZA 5DMYA 1RMU3 1W9YA 1SBEA 5FYVA 4DS0A 3J7HA 2DYCA 1AYM3 4RQPB 1RHI1 1C28A 3OJBA 3QH7A 2BNOA 3WF2A 4CDUB 3H8UA 4YM3A 3H1MA 1C8M1 1Y3TA 2NN8A 3EYPA 5FPXA 3IAQA 1AL0G 1ACCA 4LIVA 5FOBB 1JOJA 1REEA 2F4LA 2Z5WA 4KBZA 5BXXA 3RGBA 3GBWA 4XUQA 2RS32 4AYUA 3VBHA 3WF0A 2BPA2 1ENXA 1ODNA 2R49A 4YVSA 2D3PA 3WHUA 4A3XA 3IBMA 2P1BA 2PHWA 3ACFA 1JOPA 1OLME 4BH9A 2G9GA 4LLOA 5C6CA 3SKJE 4NUBA 1QWRA 2IFRA 4B4RA 4DRRA 1WKYA 4WM7B 2CWMA 3I3BA 3WINE 4A2UA 2A3XA 3F95A 3IMMA 3L9JT 2WWSA 4ASLA 3WQ1A 4HKOA 3WNLA 4FOQA 3CO2A 2DDUA 1ZA7A 4AEMA 4GIQA 5A7OA 1NOVA 4IDZA 2HWF2 4B7EA 5A7QA 2WFF2 2BJSA 1MEC1 2VBDA 4ES9A 1AR82 1AX0A 1QJY2 2R1BA 3ROUA 5I91A 3IAPA 1VBA1 1RL3A 5E1RA 4BQYA 4EN0A 5JZGC 4H55A 2BWAA 1QJU1 3IIAA 1ZYBA 4R4XA 3GHMA 4H2AA 4TWTA 4AI3A 3IZOA 4BE3A 1B35C 5LB6A 1QJU2 2DBIA 2ZMKA 1GWLA 3ZXGA 1RB8G 1VMFA 3UESA 2JKBA 4XFCA 2LROA 4LBQB 3ZYIB 1AR81 3EQEA 1AYN1 2DFBA 2UURA 1KDMA 2WFF1 1RTVA 1LOBA 3AZWA 1YI9A 4PI0A 4QKDA 5A7SA 3RS6A 2DVGA 4I02A 4EWAA 4W65A 4E8CA 4KL1A 1Y9QA 4DMIA 3O0XA 5C5TA 1WCDJ 4KBBA 4L97A 1VR3A 2XJVA 2UY9A 2WS91 3LSDA 4NIIA 2YBKA 1JYCA 3W59A 4XIKA 2QQUA 2CSGA 1PM7A 5L7OB 2AGSA 1X9TA 3BOWA 4P5YA 5E8AA 3PJYA 1J84A 2H6CA 1YC61 2YZ4A 2CAUA 2CDPA 4Y1YA 3RJ2X 1PVC2 3UGFA 4F83A 2ZTNA 3LZZA 1XU2A 2WAOA 5FYSA 4AEDA 5A6QA 1OKOA 3BODA 4OHVA 5HV4A 3POBA 1RHI2 2JDUA 2FBEA 4YG0A 4CSWA 4RS5A 1WBFA 3BGAA 2VO5A 2W39A 2VQTA 3QH6A 4LQRA 5GALA 5HXMA 5LBFA 2CYFA 3P6BA 2Y6GA 3E5UA 1O6UA 1WUVA 1ZVFA 4TN7A 3MBWA 4P08A 4V2VA 1ULEA 2HWC2 2QQIA 3QD6A 3T30A 3POYA 1ULDA 1VRBA 3ZXLA 1CX4A 5FKCA 2VECA 3PL0A 2RHPA 4I0BA 2J1VA 2XL9A 2E31A 3O0VA 4V2WA 3TEXA 4AAPA 5FY8A 1PIV1 1RUC2 1KGYA 1HN1A 1PMJX 2C1FA 4QU2A 3KT4A 3I2IA 1Y43B 5EWSA 5FLHA 5FZIA 2VUJA 4QGMA 4DIQA 2B7YA 4Y20A 1X36A 2P4EA 3B02A 4Q8KA 5CFDB 4RS5B 1VBC3 1U12A 1PNGA 3WQ7A 5BV6A 4LE3A 5FV3A 2VULA 1OF4A 1S0IA 2GMPA 3JD71 3KS7A 4PQ9A 1EAH2 4UW4A 1J3QA 3FFQA 1VAMA 5ACA3 2ZGMA 4KNCA 1ZRDA 1LEDA 3TAYA 5LA9A 2WNUB 3PURA 1W8WA 5E88A 2PQSA 4UAPA 1JHNA 2EVXA 4QX2A 2YHJA 1JS9A 3N3HA 1S0EA 2YBPA 1MQTC 3R0RA 3IIIA 5A33B 3W21A 1MS4A 2VNVA 1NKGA 2GC3A 3B3QE 2JKXA 5C70A 3MIEA 1V6NA 4V1PA 3NV1A 4BB3A 2XOMA 2W5FA 1FNYA 3THCA 5KHGA 4ZXEA 3UT0A 1G6NA 2B46X 1AXKA 1GKBA 3KT7A 1RUI2 3HEIA 3WF1A 3IDBB 3DKWA 3I2GA 3N7KA 3WUCA 3WNOA 4BMEA 4DY5A 4O9EA 5FZEA 3PJQA 3OCPA 1X7NA 2IXJA 3PNAA 1W04A 4JGYC 3VD3A 4C1XA 1S0DA 1NZCA 5I8TA 1V9U2 2WA3A 4D0QA 5KXBA 1B35B 1PVXA 5FLIA 3HIFA 4ASKA 4ONUA 3N7MA 2PYTA 5DG1A 1GZTA 1S0CA 3SITA 4IEYA 1LHNA 1RGSA 2D6PA 2D5HA 4JGZB 3I2FA 2HEWF 3BTZA 3AYEA 5KC6A 1AR72 4JHZA 3H1WA 3CL1A 1GMMA 2E32A 5F32A 5T50A 2R0FA 3FUOA 1HDKA 3DECA 1PGL2 3WNPA 1D4M1 1FX5A 2YMZA 1ND3A 2BYVE 3AZXA 3B00A 3DYMA 4ZS2A 3BOPA 1VIWB 3LDKA 4DNYA 1OOPA 2G4IA 2DCZA 5L9VA 2ZMNA 4YZ2A 3WDYA 1CPMA 3K48A 1XSRA 3AFGA 4RR3A 1VBE2 5EYXA 3T08A 4ZU4A 1W2OA 2C24A 1SFPA 3M8LA 2GNTA 4K40A 4S2FA 5FZOB 1IS5A 4NIGA 1UYXA 1MQTA 4C90A 3I3MA 2BBAA 3ELNA 4YW3A 4GB32 4FTBA 3ZX7A 5ABJB 1COV1 3APBA 5EP9A 1VLNA 2WT1A 1VE0A 3ZYHA 5DXDA 2ZEZA 4ET7A 2IC1A 4RN5A 2VGDA 1WMFA 3LD8A 4KU7A 3NW4A 3JBG2 3FHAA 3KM5A 5FZDA 2A71A 1XE0A 4BZ4A 2YB7A 2FCUA 3RSJA 2W95A 4JHTA 2HWB2 4S2DA 3S5QA 2FDFA 5JXGA 2VXJA 1W6NB 2YV8A 1YIFA 4P5HA 4QQHA 5FUIA 5KXCA 3ZXDA 2EXHA 1MS3A 4NN0A 2IUWA 5ANQA 1FOD3 2QQWA 4NPLA 4XJWA 1HRV1 1IPKA 3SMHA 4COVA 1AYN3 4E27A 5ABJA 3RMXA 3C7GA 3KSCA 1HB3A 3AJZA 3FWEA 3H42B 4KU8A 4IGOA 5HV0A 5APAA 4JRLA 4JKMA 3TB0A 1OFSA 4Y1ZA 2YROA 2J1SA 4IUGA 3MEPA 2O8OA 4AVVA 4GH4C 1YJKA 4IEXA 2WN3A 1D4M3 5JI7A 3I59A 2VVEA 3HMYA 3HN3A 2DBNA 1MEC3 3WNXA 4NRMA 1ASJ3 2XLGA 2X05A 3KVBA 4EN8B 1N47A 3LPGA 4B29A 4MGZE 2A3WA 2FMYA 2A1XA 5JI9A 1OD3A 4BOWA 2ZGRA 2FCTA 3VD9A 4IE6A 3HVDA 3OGRA 4JVAA 3S0MA 4UFKA 1JXNA 4NHYA 4UWDA 3WP4A 1G7YA 4Q27A 5FZ9A 2JDAA 4AZZA 2BUKA 4CXYA 5FWEA 1ENQA 3FMGA 4MGSA 3OBRA 4BIFA 4LE4A 3UV9A 4AEJA 3OPZA 1YI7A 4OHWA 4MGYE 4N9IA 4QU1A 2DVFA 4XIOA 4YM2A 1VBB3 1LNSA 2EXKA 3CF6E 1JZ7A 5JXHA 1EV11 5DUWA 1CGPA 4COYA 2EIDA 4Q1PA 2OW4A 1GWKA 2YGMA 3HAGA 4AHWA 2D5FA 3NNLA 4I3GA 2E26A 3ZYFA 3RJRA 4FI9A 5I8YA 2JJ6A 5FYMA 2PN5A 2AEZA 1EUUA 2W2IA 3B69A 4H7MA 4ZPIA 1V9U3 2MEV2 5CB7A 3TNPB 5LW9A 3DPRA 3HQXA 2BGPA 3NV4A 4ZS3A 5JUVA 4MGIE 1JI6A 2A6ZA 4GZ9A 3GJBA 1NAEA 2FHRA 1XNDA 3VD7A 1CESA 2BNNA 5EPAA 5BNNB 3C7FA 3ZKYA 1POV1 4AI1A 1NCRC 3ON7A 3GJAA 3THTA 1WMXA 4YW6A 5CFDC 4LJHA 4Q0PA 3ZR5A 1WW7A 2DVBA 4HKLA 1WMDA 2ADDA 2RVAA 3JD73 2OZJA 1PMHX 2GSYA 4IETA 2ZEYA 5FZKA 4DO0A 1XOYA 2I07B 4Z2WA 3F2ZA 1OVSA 5B4XA 4QPIA 4Y5Z0 5KHHA 5D8AB 3T0AA 2XLAA 4IV1A 1U0AA 3BPSA 3QOPA 5G05L 4P14A 1HKDA 2D7FA 1I6XA 3ZSEA 1DZRA 1XE7A 5EV7A 1ND3B 3P3NA 1UZZA 1XU1A 2QZ2A 3V56A 3NNMA 4GMP0 2I74A 2EIGA 2ZABA 1XJAA 4PF1A 4AW7A 2DU1A 4CZSA 1CIWA 1QU0A 4EN9B 2D3SA 1W0OA 4CCCA 1IZ3A 4WVWA 4F7ZA 2CY6A 3ASIA 4L92A 5FUPA 3KCYA 1RUC3 5BNOA 4XJAA 1X8EA 1GSLA 1QOSA 2E6VA 5FY7A 5H9SA 5F3CA 2VBPA 3HBZA 1CAXA 3SEPA 1BK0A 1WLCA 4HN0A 4K21A 5FKBA 3ZMOA 3MIGA 4DXRA 2VQAA 1PZ7A 2R32A 2XWJB 3Q8EA 3MO4A 1VB4A 5EFUA 1HQLA 1DQ4A 3RZKA 1A34A 5C33A 3WNNA 2OQ6A 4NAOA 1PZ9A 3ZYBA 2ZXQA 3TEWA 1SLLA 2WO7A 1MACA 1RUI1 4ZXKA 4PLNA 2GAUA 5BNOC 4BA6A 1LRHA 1FXZA 2KXLA 5E89A 1H1IA 4RS5C 5F3EA 1NE6A 2Y26A 4AHZA 4DINB 3IDAA 1Q3EA 2YPJA 4JKLA 5FYYA 5CADA 1LECA 4HMZA 4LUMA 1D4M2 1APNA 1ZREA 5ACA2 2O8QA 3UGGA 2FCVA 1XNTA 3MFAA 1UY4A 1ZRRA 1MR5A 3MIBA 4LBQD 4QXHA 2RE9A 3WF3A 1K5MB 2WO1A 4ARXA 4CDQC 3S5AA 1JZ4A 2XBO1 3K77A 4A4AA 3AVSA 3AB0A 3VZLA 4YW1A 2NLRA 3SCGA 2FZ2A 3ACLA 1W9TA 5C8CA 4XDQA 2C5DA 3V0BB 3AZYA 3AKRA 1VBD3 1U5IA 2W47A 5DZGA 1JZ6A 4XFAA 4AGVA 1OSGA 4DEVA 1BEV3 5LBCA 3H50A 5F37A 4AI0A 4A7ZA 1NLRA 2B39A 2HWD3 4D7SA 1IPJA 4QKBA 5EQUA 3MLKA 1XNAA 3WP3A 3WD5A 5J96B 1W0PA 4FTSA 1K5MC 3AP7A 4CDQB 2WZ8A 1A6CA 2HH9A 1H2LA 4FOVA 3G6JB 5LEJA 1LCLA 4EQVA 2MNGA 3UKTA 1P8JA 4N53C 4OZOA 3DF0A 5FZFA 2R1DA 4MH0E 1R082 2DCJA 3RVHA 4XCAA 1J3RA 3PU8A 5EIYB 2SLIA 2NQYA 4UFHA 1JZ3A 4OI4A 2UWBA 2WYSA 1OF3A 4NRPA 2GC0A 2ARXA 1QNWA 2Y6KA 4Q0SA 4QB2A 4EN7B 1W8OA 4YW4A 5FZ7A 1WGPA 4YVSB 1DYPA 5ABJC 4FPFA 2XDVA 1HJGA 2GP3A 4XDOA 2ZZJA 4ZU7A 2QQMA 4AAXA 4RGAA 2EF6A 4QX7A 3U37A 1CAXB 3VUOA 2VUCA 2VZUA 4A41A 4SLIA 2JG8A 2JWPA 2KD7A 3WDWA 4CUAA 4CDWC 1RITA 4L0PA 1ZBE2 3J7NA 4GULA 3VKLA 3T2PA 5BNPA 4MG2A 4AFBA 2VOTA 5BNNA 4DXTA 1QJX2 5JAXA 4N9HA 2A6VA 2LUWA 1XRUA 1H9PA 2I45A 3LIGA 1O59A 1RUC1 3N35A 4LK7A 5IK4A 4N43C 2ZGOA 1UWWA 1RYYA 4Y24A 3LPFA 1YQ8A 2DTWA 1LENA 1H4GA 3HT2A 4QQOA 2WRAA 3MDPA 1CWPA 4QX3A 3ZXFA 2XVLA 5DUUA 5IVYA 1ZZBA 3ALQA 3A22A 3VN4A 2QCSB 1QXPA 1BVP1 1FOD2 1PGW1 2IZWA 2ZHNA 1W8NA 3FX3A 3I97A 4OULA 1S0FA 2J1EA 3MICA 1QJX1 1GLHA 4WM7C 1H0BA 3MV01 3DUIA 1SPPB 3GZTB 2G19A 3NV3A 3NL1A 3P5BA 5JMCA 1K5MA 4JTOA 3WLUA 2Y8KA 3R05A 1ZNPA 5FXWA 1JZ8A 1GZCA 5D2AA 2WZR3 2JD4A 4TLGA 4M4RA 3FL7A 4XUTA 3OGSA 3TOJA 3KV6A 2VZVA 2X53S 2XG3A 2WFPA 5H9QA 3J9SA 2X5IC 2ZHMA 4WM8C 3ZFEB 4YVWB 1L7QA 5F1RA 2WS92 2R7EB 1KS4A 4FPCA 2EXIA 2W91A 4A6SA 1HN0A 1DZTA 1W39A 3ENRA 1R081 4HVQA 5HCAA 4WM7A 2XBO3 4UT5A 1ONAA 5T55A 2XUEA 4CEYC 2WQ8A 3HD8B 3KF5A 2D6KA 4CP9A 2WO2A 1O4ZA 3AP9A 1CVNA 1RC6A 5FBZA 2RS31 4XJ9A 3WVJA 1I5PA 3IDCB 5A3OA 5FZ0A 2ZKLA 3U07A 2OUHA 2ZA9A 4CEYB 1C4RA 5DZEA 4FVVA 3AP4A 4XZUG 3TNQA 2WQZC 2GN3A 3ZN6B 1LU1A 4L99A 4Z92B 1W06A 4QX5A 4AQSA 3PLQA 5F6KA 2VCAA 5FY0A 3WV6A 5LZ6A 1F35A 4N53B 4CU6A 1HB1A 4R8HA 3I2KA 2JG8B 2VOVA 5CKMA 5FJKA 5FZMA 1PNFA 3RZZA 1LHOA 2AUYA 4P9LA 3VBHC 5F7UA 2QDRA 5C5UA 1Q8QA 3OYWA 1FNZA 2ORXA 4QHOA 5CFDA 3VBSA 1UL9A 4QQLA 3L2YA 1EPWA 3LGRA 5L9BA 3SHRA 2HWE3 3VGIA 1JHJA 3CKHA 1AXZA 3WY6A 4BIOA 3IN9A 1GBGA 1HIXA 3D0JA 2D6OX 5C3PA 2QZ3A 4IEPA 2CWSA 4G3YC 4ORFA 3WG3A 5IVJA 2DUOA 5C3RA 3DXTA 5JIUA 3MZHA 5IVVA 1Q8OA 4IV3C 4YW2A 4FBFA 2RS33 5A3MA 1ZBE1 2OS2A 3OB8A 2W08A 4J25A 2ZMLA 4EJRA 5L9RA 2PMWB 3WDTA 1F5JA 2CNAA 1LTEA 1AL21 5DUVA 2D93A 4FXGB 3A0KA 3M70A 5H9RA 2E7QA 3USSA 4K8FA 3T09A 3MW4A 5A7PA 4N43B 5HPOA 2VVDA 4LOSA 1NQJA 3FBYA 2B4KA 5FTTC 4W50A 5K0UB 4LNVA 3VDDA 5A32A 2HBTA 2IXCA 1N1VA 1AR91 1OLQA 2E51A 2YDEA 4Y26A 1ZRCA 1DQ6A 3LWCA 3N9NA 1UZYA 2VMCA 2E53A 4NMIA 2P6CA 1NCQC 4NAMA 2GZWA 4WZCA 4QDQA 4XF0A 5JCTA 3JCIA 1OPMA 5JVVA 4GAZA 4W8JA 4BDVB 2B9VA 3I49A 1VRH3 2VZSA 4C0HA 1R1A3 3CQOA 3EMRA 4KQ7A 2P5BA 3I3QA 3HBKA 1UU4A 3CJIA 3ZDVA 1UF2C 4IEVA 3A4UA 3HT1A 4HZFA 1LB2A 4OUSA 3KV4A 4YLZA 4E4SA 4LPLA 4YZ3A 3ABZA 4YWAA 4LTAA 2HWD1 3PMSA 1AR63 4CA9A 1O91A 1W6OA 2RM21 2WFF3 2XJTA 4IE0A 4XBNA 5B2GB 1EV12 2WC2A 4I2OA 3FC0A 3A7QA 3WCSA 5SV5A 2QVSB 2XH6A 2Z4FA 2BOJA 2Q1FA 3WW3A 4BMBA 1UY0A 3ZN6A 4AK3A 1F9KA 4CXXA 2XBO2 3O5SA 3LA7A 3DL3A 4J1XA 5GZDA 4ZY9A 4DY3A 4IV1C 5AC92 1J1TA 5CEHA 3I2OA 1ZRFA 1VBB1 4RR3B 4YNIA 3U4SA 4B3NA 4YG6A 1SQ4A 5FPBA 5BYNA 4Y1XA 2R061 2JE7A 3AKPA 1J83A 1S55A 2BV4A 2SBAA 3KB5A 3LIHA 5GLUA 3VKOA 3HNYM 3KWVA 2PFWA 1RUJ1 1OA3A 4OMDA 3WXPA 1PM4A 3ZSKA 1GUIA 4BQ1A 1NCRA 1AUYA 1X9PA 4D7YA 1DQ5A 4YYOA 3VBFA 4OI1A 4XQDA 4IQPA 4Y4YA 4P9YA 2D6MA 2ZJCA 2R041 5ANNA 5A6YA 4XUNA 1XSQA 2JG8C 4CEWC 3VHRA 4MOAA 5LY1A 1YYNA 3O1UA 2PELA 3M7AA 3GBFA 2JD9A 3AKSA 1OD5A 2ZX4A 3N7JA 3VB9A 4AFCA 1RUH2 3E5QA 5FK8A 3POGA 5HXVA 4EWEA 4OLLA 1LGCA 1WCKA 1W8TA 2P2KA 5DAPA 5FZOA 4CRQA 3JQWA 2HJIA 1BK1A 1PGSA 4JGYB 4LKDA 1OXCA 4Z07A 4D7TA 1C1LA 1W2AX 1KFXL 4N43A 1OVPA 1UMHA 3EHKA 4PBPA 4GA9A 4BLIA 4OFGA 3VDDB 4RQPA 1LESA 3O1SA 2AEYA 1UIJA 4FCAA 4DRVA 4CP1A 2WT2A 4QXKA 1DYOA 3JBG1 5FLJA 2DCKA 2R073 2X09A 2ZX0A 3VHPA 4Q0VA 1IG3A 1O5LA 2GH8A 5FMOL 2A6YA 5GKAC 1YFWA 5A1AA 5K9YA 1KRIA 1DLLA 1UW8A 5T5PA 1NT0A 2YC0A 3C2UA 3NAPB 2R0HA 2ZHLA 4MGQA 1K45A 2PA7A 4P9GA 5FZLA 5GZFA 3QCWA 2XKOA 3VDAA 1L3JA 1UOFA 4BK5A 1D0HA 4I30A 2VZTA 3ZFFB 3CJIB 2BOIA 3ES4A 1S4CA 3RWNA 4YRDA 2WBKA 3AP5A 4UOJA 4YPJA 1DDLA 1C57A 1ULGA 3HNBM 1BCXA 4PF5A 4LR4A 4GD4A 3RYKA 4Y5SA 4BK4A 2WKKA 4BISA 5A6ZA 1BBT2 1W9WA 1YCIA 2A6XA 1MZ5A 4D8MA 4AF9A 4H7LA 2FDHA 1B09A 2EAAA 2GMMA 2JIJA 2K0GA 2B8MA 3MLJA 5FPAA 4ES8A 5CA6A 1J59A 4HL0A 2ETEA 1O7FA 1DFQA 4AQ6A 4OI0A 3FHQA 2HWB1 3LDBA 3PUSA 3RDIA 3HPNA 2A73B 1L7RA 1N3OA 1SEFA 2LM3A 4UW3A 2ES3A 3VD5A 1IG0A 5F2WA 1XYOA 3PIJA 4CUGA 2R071 4QX1A 4XYXA 2OVUA 4H14A 2PHDA 2BGOA 5JMOA 4META 3Q8BA 5KHIA 1OOPC 4QGLA 5BNQA 2FMDA 1Y4WA 4NHXA 4OVEA 2QE3A 2OQ7A 3LB9A 1VRH2 4LHSA 1RUH1 5BNPB 4XTPA 3H0OA 4F8AA 4XMAA 2HEVF 5FO9B 1BLZA 3ZXEA 1VAKA 2FDKA 1OBNA 3MIDA 3GALA 4PLOA 2W46A 4LKEA 5IK5A 5SV8A 4QD2A 5L7OA 1ZBA2 1W03A 2ILMA 2GNDA 1VBE3 2BP6A 3OY8B 3RI8A 2R062 1W6QB 1KS5A 5IK8A 1QOTA 1GNYA 1UZWA 2X29A 3CMGA 3E6DA 4FPYA 4QPIB 4RL7A 4UBHA 4YARA 1V70A 5F6LB 3J4UH 1OH4A 1K3IA 4I09A 3ZM8A 4Q0QA 3TRSB 1T2XA 1UY1A 3ZO0B 1R083 4AI2A 1STMA 2W1SA 3LEGA 4FT8A 4FPLA 4XAEA 5IFTA 1RINA 4GXLA 4EYUA 2YC4A 3BU7A 2K2SA 2R16A 2WABA 3IM0A 5A7WB 1YIPA 2XXZA 5FAXA 3J7LA 1HRV2 3CNAA 5FP9A 2DTYA 5A6XA 4N7IA 1DQ0A 1IQAA 1JZ2A 1S2EA 4B4PA 1O3TA 2ZKNA 2RMU2 2J7MA 2GMEA 2ZS6B 4NR1A 1W6QA 3PTYA 1PIV2 1TME3 3D5OA 3N9MA 1XYPA 4WVVA 3GM8A 5CU1A 3LSEA 1AYM1 1K5JA 2JDZA 2TBVA 1W9SA 3ST7A 5A70A 3O1OA 2GU9A 1CD3G 5EYYA 3MF9A 2LALA 2HWC1 5FDBA 1SZBA 4LHLA 2XMLA 4Q0UA 2VU9A 1WD4A 2BGCA 1RUI3 3C7EA 1J3PA 4Q29A 1A3KA 1NX9A 2Q1ZB 2XQXA 5J09A 2X10A 1JYVA 4XHXA 2NPIA 1OLMA 2PAKA 3LOIA 2W94A 1X33A 4Q4Y2 5IAVA 3MPPG 3DKQA 3FE5A 3JUUA 1RVF2 1BJQA 1MS8A 1WCQA 1NUKA 4EZHA 1VALA 5BNOB 2YUEA 4CCJA 4GB31 5LK7B 1YHFA 1GR3A 1LKNA 3AYCA 2Q5TA 3Q8FA 4QB1A 1LOEA 1QQP3 1AL22 2VNOA 4FXKB 3MPBA 4XVHA 2Y6FA 3WNMA 4EE2A 1ULFA 2OXBA 5LK5A 5T5JA 1VMHA 1VBE1 3OYWB 2Q8OA 3UKNA 2XR4A 3VBSB 2WR9A 2XHNA 1W6OB 4UFMA 2NMOA 1QH7A 4QXBA 1DCSA 4Q2FA 4G9SB 4ITCA 2W87A 2G9FA 3VHOA 2JDYA 2Y6HA 3OEBA 4ZU5A 2HBUA 2VXRA 4OHZA 4AEKA 2P34A 5T3NA 2JG9B 1OC1A 1R1A2 1YJLA 5FYHA 1UYPA 1PO13 1JU3A 3B9IA 4XUPA 1O3QA 2X8KA 1W8ZA 3OF1A 2CTVA 5JLVA 3FUQA 2BVBA 5FO7B 4LA3A 3WCRA 4RA0A 3PTRB 1SLTA 1QJFA 3EXUA 1Y9GA 1H8TA 2VZ1A 3KLSA 4JDOA 4NHLA 4A6OA 1V9U1 2CL2A 5CKQA 2QQPA 1AJOA 3MHZA 4E8DA 2BWCA 4JKKA 1FI2A 2VTXA 4BQ4A 3VBFB 2MHFA 4P9JA 4Q4X2 3M1HA 1ULOA 1NY72 3FFZA 1OA4A 5H9PA 4M3CF 1UU6A 1OMIA 2WT0A 4NIHA 2JE8A 2CDOA 5CVRA 4CDXC 1ODMA 3LKJA 2OIIA 4HPKA 1JH5A 2RG4A 3A21A 3WZ1A 5JSPA 4L8QA 4FOYA 2ZGSA 3ZKUA 1WA6X 3CLPA 4CP0A 1KFUL 1HXS1 4L9BA 4CCDA 4MHUA 4UFJA 2PHLA 3DN7A 1N1TA 2P3IA 4AFMA 5AC93 1SHWB 2BERA 2XJSA 2WA4A 2JDPA 1ND2C 1M06G 1IS6A 2K9ZA 2ORZA 4HK9A 3U78A 3B5LB 3JD72 4MXVA 5FP8A 5IWFA 1NCQB 2Y64A 1ZZ6A 3USUB 1GQPA 4LK6A 1WLWA 3VZJA 3V0BA 1BMV2 3JZVA 4BU2A 4XE9A 1W90A 3IT8A 3WP6A 2J1AA 3I59B 3J8F3 3O12A 4M3CA 4DFSA 3O1MA 3UL2A 1GP6A 3OUHA 1ZZ7A 1VBA2 1GP4A 1C8M3 1UYZA 3MI8A 1FOD1 1PGW2 2P6HA 4DOUA 2P37A 4GWMA 3VL9A 3INAA 3O7OA 1GQHA 5KHKA 2VZ3A 2NMNA 3OOXA 1JU4A 3PVEA 4HFSA 2RMU3 1I9RA 4BYYA 1FT9A 5GM0A 1S2BA 1ND2A 5GLTA 1CONA 2VOXA 3GXUA 3BTYA 2OPKA 1ENSA 3MLLA 3D8CA 1QF3A 2IVIB 4MUVA 3BYWA 5FZAA 2VTXJ 2XJUA 4Z82A 2JE9A 3KD4A 2Q8CA 3ZFEA 1O3SA 5D8AC 4GH4B 3IWZA 3N9PA 3U10A 1GZWA 1RUG3 1PVC1 4LO7A 3S30A 1JUHA 3VBFC 4FAHA 1UAIA 3GBGA 4GMP1 5FP4A 3WW1A 5C4WC 2BZDA 2Z79A 4PDWA 3RNSA 1OT5A 1Q5OA 2RDQA 4LUKA 1LHWA 2AENA 1HV1A 3SCHA 5CISA 1JUIA 4AG4A 4CUCA 5CKNA 5A1LA 1RUE2 2UWAA 2ZGQA 1TZOA 3TBDA 4MHRA 1UOJA 5JXJA 4Q4V2 3AP6A 2WNEA 2V09A 1W99A 1UKGA 1JODA 1JYIA 3BPZA 4PT6A 1DLCA 1N3QA 4QHZA 3KV5A 1YQCA 3U11A 2ZOEB 2Y38A 1QIQA 2VL4A 3NJXA 1BXHA 5JXIA 2VCBA 2YU1A 1FPN1 2VOKA 1HQWA 3CBNA 1WD3A 1PO12 2A75A 1PMIA 4XC9A 4XQWA 3VHNA 4AVTA 3THDA 4XQ4A 5JOYA 1OURA 1TME1 1TE1B 3AM2A 1VMJA 3R6SA 3UK9A 1RUOA 1WZXA 1RUG1 1XB9A 2OKXA 4WM8B 4OQ8A 1G9DA 2PTMA 1ZX5A 1RUF1 3K4ZA 4GKXA 3RWKX 3ECQA 4E4HA 3IPVB 5T52A 1H9WA 1TEIA 4QPYA 4XABA 5EJ3A 5FPLA 1ZBA3 3SH5A 1F15A 2HWC3 2WYFA 5GJ6A 5FYBA 2UYAA 1MVEA 1W6MB 4AI8A 2CU5A 1YO8A 2B45X 1CJPA 2TNFA 3O0WA 5ACA1 2Z42A 3GZAA 3CZUA 1DU3D 3URFA 2DCYA 5D8AA 3LF7A 1H2KA 2Q0AA 3TEYA 5DDJ3 2Q1MA 4JV4A 5JZGB 2H0VA 3PUHA 1MS9A 4FFFA 1QY4A 4PIYA 5K0UA 4Y4RA 4PDWC 1RUJ3 3NNFA 1PO21 4COZA 1S2KA 2JICA 3ZVXA 2VQUA 3ZOIA 4CP2A 3HQRA 4ZZ8A 1F8VA 2JEMA 3ZYJB 4JTNA 2VMGA 2OYZA 3JXSA 4CEYA 5J36A 3D3AA 4X8PA 4CEWA 1C8M2 1EPZA 3PMEA 3BUCA 3KCXA 3N4MA 1I5ZA 3DV8A 4X8NA 2R043 5LBBA 4FPKA 2WL1A 2C4XA 2H0BA 2PXJA 2HYXA 1V6JA 2VCCA 5JR7B 1JZ5A 1ULPA 3GCXA 5D1IA 1XYNA 2EICA 4JGZA 2V73A 2JB8A 1XC6A 4O7XA 4I0AA 2VMDA 2G9ZA 1LHVA 1R091 2J1RA 1RJ8A 4CPBD 1EY2A 1RUNA 2OZ6A 4MO3M 3ACHA 4RHV1 3I3EA 1QJX3 5A32B 3FJSA 3K46A 4XFFA 1T6BX 3BCWA 1FPN3 4YVSC 2YFUA 2XGXA 1I1EA 3ZN5A 3I2DA 2WSUA 3AYAA 2YGLA 2XWBB 1LEMA 1DGRA 4NJ4A 4Q1RA 5CFCC 1LHUA 3ZSMA 4KWKA 3HQUA 5A3NA 1HB4A 2ZHKA 3VBOB 3DCQA 2AH2A 1PK6B 1DIWA 1WMEA 4LIUA 4OUEA 4IL7A 1RUE3 2GN7A 5KXDA 2P3KA 3QACA 5I0RA 1RUF2 5FP3A 1F31A 3I4IA 2LRPA 4K1YA 4MZUA 3KGZA 4AEDB 3AXDA 3NQHA 2WZEA 3OBTA 1CZTA 1LR5A 4KI5M 5LASA 1MS5A 4MX3A 1W6PA 1D2QA 1GZ9A 3ZIWA 1QDCA 1QQP1 2DWRA 1HRI2 3N9QA 2FDGA 2V4VA 3SXWA 3POWA 1W2UA 4FQZA 3WF4A 3EBRA 1NA1C 3K75B 3NNJA 2WJSA 4FPEA 2PHTA 1DP0A 4YW5A 3V0AB 3BTAA 1VBC2 1GQGA 2VM9A 3IB3A 2RS12 1VBA3 5I0UA 5HCBA 3RZJA 2JDHA 3ILNA 5IW0A 2DCTA 2F6BA 4GALA 5A7NA 1LJ7A 1A8MA 2F4PA 4QT6A 3SKVA 4Z8BA 1GOHA 3H8XA 2QDNA 4QM9A 3MGUA 4LO6B 4AVAA 3GDBA 3PHMA 4HETA 2AYHA 1JYXA 5AVPA 3O1TA 5IVEA 3RMYA 2GNMA 1LOFC 4NIDA 2QTWB 1AR83 3WR0A 2P3JA 2VAUA 4PBOA 2GP5A 2D3RA 2GALA 2A3YA 2L9LA 4GWJA 1V6KA 4MVTA 1RUD1 3T3YA 4NE9A 1NG0A 3J7MA 4K9SA 4UI9L 3WG2A 5CFCA 5F5QA 3ME2A 4JAAA 3QBQA 4Z1VA 5F9TA 5GZGA 1C5IA 1TG7A 1US2A 5LCWL 3GF6A 3IKWA 2CGOA 5A33A 1C3HA 2VVFA 3BIEA 1MQTB 2PQQA 3KZ4C 1GWMA 2RDNA 3NWKA 5EJZB 2ZZQA 1F2NA 3DYOA 3H3UA 3M3IA 1E5IA 3CHXA 4AQTA 4YVWC 4CP9B 3POEA 3W20A 3MFCA 2ARAA 2X5IB 3VBRC 3H9AA 4IW3A 4WM8A 3ZFEC 4BQ3A 4Q8LA 1XBFA 3PDQA 4P9IA 4PQQA 2J1TA 3H3LA 1OHFA 4P02B 2VY0A 3OGVA 4E2QA 5JDBA 1RJ7A 2V4AA 2VD7A 3J8F2 4FQ4A 4TYSA 3SISA 3ZXJA 2ET1A 2GDFA 1Y9MA 1KJRA 2Y60A 4EWDA 2WDBA 1UQXA 3LE0A 4CDXB 1WW5A 4AVCA 1UXZA 5FYIA 4GH4A 1H6XA 1Z7S3 2YXSA 5CAZA 1OQEA 3T2OA 5A80A 3AYDA 3KQRA 4KGQA 4IV3A 1NLSA 4Q4V3 1DF0A 4RD7A 2VCMA 4XMIA 2BTVC 2K46A 4HK8A 4C91A 5JOZA 4BLJA 1VBD1 3VZOA 5J7MA 1SFYA 5IVCA 1HQNA 1ZZ8A 4UW5A 2HWB3 3HR9A 1RUF3 3VDBA 3GHNA 4Y5TA 4CCLA 5JPNB 1OLRA 4K3UA 5C4WA 1K42A 3U4XA 3ZFFA 3AK0A 1NY71 3DEMA 1CAUA 4KG0A 4Q4X1 1ZZ9A 2YG0A 1BQPA
chains in the Genus database with same CATH topology
1COV3 1Q8SA 2VUAA 5EZWA 3RRDA 2UWCA 2IXIA 4WBBA 3VLBB 3AMMA 1G9CA 4PJYA 2PAEA 5C8WA 4BWOA 3VBUA 3WW2A 1V6OA 4GKYA 2BBVA 4BHPA 1EAH3 1FV2A 3OD4A 3M4FA 3KMHA 1GANA 4FP3A 4N7UA 4Q4W1 4WV8A 1PGL1 1FATA 4LEJA 3A0NA 5GLWA 4ATFA 2CGPA 3V65A 2WNVC 3T1LA 1NE4A 2ZGNA 1AR71 1JTZX 4XF9A 1H8VA 1SLCA 5JSRA 1H1AA 1KDKA 3RYPA 1U5XA 1VJ2A 4XXAA 1XQNA 2Y0IA 3K51A 2W68A 2TEPA 3H3ZA 3ZXAC 4YFZA 1TMF2 3WP5A 4D94A 3DGTA 1JBCA 3JQXA 2ZX1A 4AE2A 3WDUA 2E9QA 1ZZCA 3E97A 4CDXA 5IT6A 3M3QA 1HLCA 4Y22B 2GC1A 2E7TA 4WVMB 3C3VA 2I2SA 4B4QA 3KGLA 3LA3A 3AXEA 2DV9A 2R30A 5GZEA 4COUA 1ASJ1 1EP0A 1H8TB 2NYYA 2WLPA 1KITA 4KG8A 4IEQA 4PIXA 4TZDA 2WNVB 4AQ2A 3W58A 1YUDA 5FO8B 1ENRA 4N90A 4YZ4A 4RQPC 4LO5B 2ZGUA 4DZGA 5AFEA 5C8CC 1QOOA 2JG9A 1SLAA 4KWJA 1UN1A 1PK6A 2HEYF 3I7DA 2WQ4A 1WBLA 3MW2A 5I93A 1QDOA 2VW1A 3ZYPA 2D97A 1BEV2 3DPRB 2PAMA 1DG6A 1RMU1 1ASJ2 1OQ1A 4R9DA 1TQ5A 4LBLA 1V6LA 4LLFA 2ZAHA 2PLV3 5JOWA 1G9BA 1OOPB 2CAVA 1S0JA 1MZ6A 1ZBA1 1DBNA 2WINB 3NAPA 5LRRA 4NHKA 1FMD1 2NZ9A 2Z69A 4XEZA 1DYKA 3ZN4A 2EA7A 3VZNA 4YG3A 4FPGA 2XVGA 1KD7A 4LBJA 1URXA 1BZWA 4NOTA 1H30A 1Q8PA 4RSUA 4AHXA 4CDUA 4KGGA 4OZXA 2AREA 1HX6A 3AFKA 2DF7A 3MIFA 4AXOA 4AHYA 4R9BA 2R072 4HVRA 4JQRA 1VBC1 2C9AA 4E9KA 1BBT3 2ZGTA 1AR61 1Z7S2 2JG9C 1HRV3 4QPGC 4CYDA 1OFNA 1POV3 1AR93 3OD0A 1AYN2 1Z0HA 1W6NA 1PK6C 2YYOA 1J58A 1LOFA 2BQPA 3I54A 2Q4SA 4OHXA 1Q56A 4U2AA 4HLTA 4IEUA 1YXWA 4J1WA 5I0SA 1Q43A 1FMD3 1W6PB 1LGBA 1Y7BA 3AZZA 5DDJ1 4DQAA 5CG9A 3VBSC 1RIRA 2RR11 2Y0OA 1ND2B 4URTA 3VKFC 4Y1VA 1QJY1 3WX5A 1NCQA 1MEC2 3USUA 2CGNA 2HWF1 1AVBA 2XB6C 4IESA 1AF9A 1D0GA 3VZKA 1WW4A 1LULA 3NVCA 2PLV1 4Y1UA 4IERA 2XPJA 1V6IA 1WW6A 1U5YA 1MZEA 2RS52 2VMIA 3Q9OA 4RGGA 4OHYA 5GLZA 5K0UC 4AGRA 2ZGKA 1X8MA 1CAWA 3KT1A 1XXNA 4ASMB 4WZFA 5BPXA 4XJUA 2Z2SB 4Q4Y3 2DFCA 4HN1A 2D6LX 3D6EA 4XF4A 1TNRA 1RVF3 1IHMA 2PHXA 1NA1B 2A70A 4O9GA 3AMNA 1G8WA 4M0HA 4RR3C 1O5UA 3SH4A 4H3WA 2IFWA 5EXOA 3LAGA 1GV9A 2ZCWA 2AR6A 3ZYRA 1H4HA 1LOCA 3D4KA 3M3EA 1SFNA 2RS11 3BIWE 1REFA 1PO22 1QNYA 1HRI3 2WNVA 2A6WA 4XILA 3VBOC 2WZPP 1TNFA 2D6NA 2H6BA 3KCCA 3CJXA 1WCSA 4XPVA 4YGEA 3WG4A 4K6BA 4YSFA 1GNZA 4R4ZA 4LULA 1DQ1A 2RR13 1GFF2 4PCRA 5FRAA 1DZQA 3UKVA 3RPQA 1MZFA 4YVWA 1CR7A 1IKQA 3AKTA 1QH6A 4XW3A 1LOGA 4FAGA 5CNAA 2BW8A 1RUG2 1PIV3 1TME2 4XF3A 2RM22 2HWD2 1YFXA 4Q4X3 2IXHA 2PHRA 4UXAA 2HWE2 5C9AA 3IPVA 1MVQA 5HBAA 2P17A 3AKQA 3TN92 4MSVA 1G9AA 3CU7A 1W6MA 3VKNA 2WNUA 5C4WB 2TUNA 2PHUA 1YNAA 5FOJB 5JOXA 3TN91 4L2NA 3T2TA 5L19A 1NQDA 1V00A 1UKRA 3OGJA 4N53A 3VZMA 1FYUA 2HWE1 5JZGA 4NO4A 4CDQA 2BNMA 1UMZA 1QHDA 3ZFGC 1UIKA 2XUMA 3N36A 4Y20B 2N7GA 1PVC3 5T5OA 4AVSA 4C1WA 3SNMA 1CAWB 1MS0A 2B42B 2E63A 1SCRA 5C9AC 3E5XA 1N1YA 1SBDA 1ZBE3 5FFOC 2XKPA 1O4TA 4DB5A 5JIAA 1CAVA 4CDWA 1DHKB 1AZDA 1XNBA 2W0XA 4QPIC 1XNKA 5BNNC 2NP0A 4XHBA 4HT1T 2XJPA 4LBNA 4K7JA 2PLV2 3DPRC 4HVOA 2IXLA 4XBQA 3RI9A 4MLOA 3ETQA 2BFUS 3IMNA 4QM8A 2WS93 4I3PA 1QXJA 3WDXA 3MF6A 4YFWA 2A7AA 4XJ8A 1QJU3 4FO9A 5C8CB 3WT3A 1CJDA 1UCXA 3ZMNA 3S7IA 5FQ0B 5J3UA 4MGKE 2EALA 5A3LA 1HXS3 4IEWA 4E4ZA 1CQ9A 3BB6A 4R9CA 5KXEA 2DU0A 1RUH3 3B94A 1Z7S1 4FTEA 5KWRA 4B7KA 4A7KA 3AJYA 4DPNA 3ZSLA 2X5IA 4HANA 4ZKTB 1AJKA 2ATFA 1AXYA 1VP6A 2UY8A 3HN1A 4MXWA 3VBRA 1WLDA 4YGCA 5K8SA 4WVZA 3GZUC 2E7AA 2WZR1 1IKPA 2RM23 4Q4W3 5BUVA 1SLBA 5T5LA 4AFDA 2JENA 5FQ0A 5JWPA 3JU9A 3WDVA 3P3PA 4LBMA 1S1AA 1SMVA 2RR12 3GNEA 3ZYGA 2O0OA 4AGGA 2O1QA 4LHKA 5DDJ2 3R4UA 2JXAA 1HW5A 4NHMA 4JRAA 1R093 1TMF3 1PO11 2DUQA 1XNCA 4I01A 4XXPA 2XHKA 2ZACA 3OTFA 2LTNA 4M3CE 4MXWB 2VOWA 1AR62 1H2MA 1F5FA 1EV13 4HKWA 1HV0A 1C1FA 1U5ZA 3JB8A 4LBQA 3O14A 4COWA 2WSVA 5E16A 4QGNA 3MW3A 1RUE1 2BVVA 2ZX2A 2UYBA 3M2MA 2VW0A 5FMOS 1X50A 4XZPA 1BMV1 4AFAA 2VMHA 5BY5A 4QPGB 2GNBA 3ZPYA 1O4YA 3M3CA 3ATGA 3ILFA 5CG8A 3ZDSA 4DXZA 4K1ZA 1ZM1A 5HCFA 4MYEA 4UW6A 4Q4Y1 5CIRA 2QNKA 1ND3C 3B7MA 2XLFA 1CAUB 2RS51 3ZIXA 5L36A 2XL7A 2D44A 4KH9A 4YM1A 1QXRA 4IV1B 1C8NA 1RMU2 4BM8A 5LRSA 2R063 1BEV1 1N3PA 1AYM2 2QUOA 4OI2A 4YZ5A 4AWDA 4JGZC 1DGWA 4R52A 1WLTA 1WA4A 5TSWA 4IEZA 1JW6A 4QPGA 1DGLA 3PVNA 2V5YA 1SBFA 4PLMA 3UJQA 4RFT0 1AX1A 4J6GA 2IXKA 1FAYA 1B35A 1REDA 1VB2A 3B9CA 1GNHA 3E6BA 3FLTA 3NO8A 1Q8VA 1LGNA 1PO23 4R9AA 5DZFA 5LEKA 1NYWA 2W52A 1R1A1 1HXS2 4ISRA 3LA2A 2ZGLA 4JDNA 5AVAA 3TYJA 1CN1A 3MIHA 2DVDA 4Q4W2 2BFUL 3VV1A 4YM0A 2HYKA 4HSJA 1QJY3 1KQRA 2ERFA 3SCFA 2EXJA 4LO8A 3RYRA 2BEOA 5HI0A 4I0WB 4U36A 4Y22A 4XETA 2KA3A 3LOBA 1DGRN 1TMF1 2VNRA 1FMD2 4D3WA 4NVPA 3VBUB 1H2NA 5L73A 4IEOA 2ZPXA 2C0ZA 1PZ8A 3VBRB 3ILRA 2WLQA 4FPHA 2JX9A 4NWWA 3VBUC 3WUDA 3NKTA 2GH2A 4XFIA 2YY1A 5I0TA 3VBHB 3WQ0A 4W6YA 1OI6A 1NXMA 3M3OA 4OUMA 1V6MA 3CJIC 1GICA 2PHFA 4HSLA 2MEV3 1G9FA 2RMU1 3W9AA 2Q30A 1A78A 1Z78A 3G7DA 1POV0 4FPOB 5DG2A 5FREA 3WHTA 3VL8A 3VKMA 4S2GA 3TN93 4LBKA 1CPNA 2RS13 3H7YA 4AEDC 5IUQA 3B01A 3LCPA 1LODA 2R6QA 2FQPA 1ULCA 4E2SA 1UPIA 5CBLA 2ZX3A 1A8DA 2JECA 2KM2A 1RVF1 5CFCB 5K7PA 1QMJA 2DUPA 1X82A 4HPKB 2GC2A 4WVMA 3H7JA 2ENRA 5J48A 1MS1A 1EYBA 1QJZA 2CV6A 2QKDA 4Q26A 4C0BA 2FZ1A 1R1ZA 4KWLA 5KC5A 4W6WA 3ZSJA 3NJZA 3SLIA 4YGDA 1H8TC 2MEV1 3N7LA 3RG0A 4CTEA 2NM1A 4XOGA 1QKQA 5FCCA 1XE8A 4P9XA 3WW4A 1ZA4A 2MPFA 3WOGA 3FHIB 2AZ5A 2D98A 3ZFGA 4E4DX 4EROA 4M3CB 4TSVA 4RHV3 3PVBB 4FOWA 3R4DB 1D2SA 2OA2A 4YGBA 4W6XA 1H1MA 4D69A 4YZ1A 1C5HA 3J26N 4M01A 4XTMA 1SACA 1OPOA 4JDMA 1DQ2A 5J98B 3ZFFC 1UU5A 4F3JA 2EAKA 1NXD1 1UPSA 1AL23 3UJOA 4LBOA 1I3HA 1ALYA 3SH3A 1BBT1 4GWNA 2XJRA 3L2HA 3ES1A 1OQDA 4GQ7A 1IGOA 1RUD2 4K20A 1AX2A 2UU8A 1KJLA 2IWGB 3POSA 4LA2A 2ARBA 2QFEA 3THPA 3AMHA 4NPRA 3U0ZA 2VNGA 3EJKA 4G4FA 2WZR2 3BALA 4TLFA 5DUXA 2ZAAA 5GLVA 1VRH1 4M00A 4X6RB 1YRZA 4EV0A 3HWJA 1S0BA 4FP2A 1SLIA 4EN6B 3D82A 4BPZA 4CEWB 2RJLA 2WNUC 1VBD2 5KHJA 2VG9A 1GYKA 5T54A 3B93A 2QJVA 3R4SA 2B9UA 4JGYA 1R092 1D4VB 1J1LA 4M0NA 4LT5A 3PVOA 4IV3B 4MV2A 1HRI1 1AR92 3AMPA 5IK7A 3FZ3A 2ZBJA 1COV2 2DVAA 4GB33 4QQPA 5JPMB 5JSOA 3J8F1 4ATEA 4BCUA 1S0GA 4A7YA 1NA1A 1YWKA 3E6CC 3JBG3 4QMAA 1YFUA 3RQ0A 1JN2P 4INDA 3NSTA 4JCKA 4LO4B 2B5HA 4ISQA 3OY8A 1GZWB 2HKXA 1KXGA 3AMQA 1IS4A 2D40A 1PHMA 4LHNA 1BYHA 2RJKA 3EO6A 3QLQA 5AFBA 4B8EA 1SCSA 2XVKA 4FSJA 3IDEA 3S6PA 4XFHA 4HBNA 4PIZA 3AZVA 3FLRA 4QHBA 3X29B 3V0AA 5BNPC 2HWF3 3FBMA 3T1MA 2R042 2OUJA 4S2HA 5KBFA 4SBVA 2VPVA 3ZXKA 2VW2A 1O3RA 1RUJ2 4XF1A 1RUD3 5C9AB 4XBLA 1AHSA 1UD1A 4NWVA 1IOAA 3CEWA 3VBRC 1BKZA 4X6QB 3V64A 3GYDA 3FLPA 3NKGA 1QQP2 1LOAA 1G86A 1VBB2 4XFBA 3ZFGB 3VBOA 4IXLA 1UX6A 5AC91 1YFYA 1RHI3 3OGGA 1OA2A 4UBGA 3NV2A 4XFGA 1EAH1 4JC1A 2RS53 4PDWB 4QQ2A 2VH9A 1E57A 4XJZA 3S7EA 4FPJA 2WIIB 3D0SA 4GMP3 3AX4A 3NAPC 1NCRB 5GZCA 3I8TA 2D43A 1VAVA 1FPN2 1YLLA 2XJQA 1AR73 3H1YA 1FV3A 1M4WA 3WG1A 1BVVA 4L11A 5J37A 4AVBA 1SDWA 5I8SA 1CAVB 4CDWB 2ZGPA 4P9WA 3MYXA 2VQ0A 4RHV2 1QGLA 5L7OC 3JB4C 3VDDC 1N1SA 4CDUC 1DGWX 1LU2A 2A5ZA 1IS3A 1OKQA 2ET7A 4Q4V1 1T6GC 4E2GA 2DURA 5FPZA 1RMU3 1SBEA 4DS0A 2DYCA 1AYM3 4RQPB 1RHI1 1C28A 3OJBA 3QH7A 2BNOA 4CDUB 3H8UA 4YM3A 3H1MA 1C8M1 1Y3TA 2NN8A 5FPXA 1AL0G 5FOBB 1JOJA 1REEA 2Z5WA 5BXXA 3GBWA 2RS32 4AYUA 3VBHA 2BPA2 1ENXA 2R49A 4YVSA 2D3PA 3WHUA 4A3XA 3IBMA 2PHWA 4BH9A 2G9GA 4LLOA 5C6CA 1QWRA 2IFRA 4B4RA 4DRRA 4WM7B 2CWMA 4A2UA 3WINE 2A3XA 3L9JT 2WWSA 4ASLA 3WQ1A 4HKOA 4FOQA 3CO2A 4AEMA 4GIQA 1NOVA 4B7EA 2HWF2 2WFF2 1MEC1 1AR82 1AX0A 1QJY2 2R1BA 3ROUA 5I91A 1VBA1 1RL3A 5E1RA 4EN0A 5JZGC 4H55A 2BWAA 1QJU1 3IIAA 1ZYBA 4R4XA 3GHMA 4AI3A 4TWTA 4BE3A 1B35C 3ZXGA 1QJU2 1RB8G 2ZMKA 2JKBA 4XFCA 4LBQB 3ZYIB 1AR81 3EQEA 1AYN1 2DFBA 2UURA 1KDMA 2WFF1 1RTVA 1LOBA 3AZWA 1YI9A 3RS6A 2DVGA 4I02A 4EWAA 4W65A 4KL1A 1Y9QA 4DMIA 3O0XA 1WCDJ 4KBBA 4L97A 1VR3A 2XJVA 2UY9A 2WS91 3LSDA 1JYCA 3W59A 4XIKA 1PM7A 5L7OB 2AGSA 3BOWA 5E8AA 3PJYA 4Y1YA 2H6CA 2YZ4A 3RJ2X 2CAUA 4F83A 1PVC2 2ZTNA 3LZZA 1XU2A 4AEDA 3BODA 4OHVA 1RHI2 2FBEA 4YG0A 4RS5A 1WBFA 2W39A 3QH6A 5GALA 2CYFA 3E5UA 1WUVA 1ZVFA 1ULEA 2HWC2 3QD6A 3POYA 1ULDA 3ZXLA 1CX4A 2VECA 2RHPA 4I0BA 2XL9A 3O0VA 1PIV1 1RUC2 2C1FA 4QU2A 5EWSA 3KT4A 5FLHA 1Y43B 2VUJA 4QGMA 2B7YA 4Y20A 1X36A 3B02A 4Q8KA 5CFDB 4RS5B 1VBC3 1U12A 1PNGA 3WQ7A 5BV6A 4LE3A 2VULA 1S0IA 2GMPA 3JD71 3KS7A 4PQ9A 1EAH2 4UW4A 1J3QA 3FFQA 1VAMA 5ACA3 2ZGMA 4KNCA 1ZRDA 1LEDA 3TAYA 2WNUB 5E88A 1JHNA 2EVXA 2YHJA 3N3HA 1S0EA 1MQTC 3R0RA 5A33B 1MS4A 3B3QE 2GC3A 3MIEA 1V6NA 4V1PA 3NV1A 5KHGA 1FNYA 1G6NA 2B46X 1AXKA 1GKBA 3KT7A 1RUI2 3IDBB 3DKWA 3N7KA 3WUCA 4DY5A 4BMEA 4O9EA 3PJQA 3OCPA 1X7NA 2IXJA 3PNAA 4JGYC 4C1XA 1S0DA 1NZCA 5I8TA 1V9U2 2WA3A 5KXBA 1B35B 1PVXA 5FLIA 3HIFA 4ONUA 3N7MA 2PYTA 5DG1A 1S0CA 3SITA 4IEYA 1LHNA 1RGSA 2D6PA 2D5HA 4JGZB 2HEWF 3AYEA 5KC6A 1AR72 3H1WA 3CL1A 5T50A 2R0FA 3FUOA 1HDKA 1PGL2 1D4M1 1FX5A 2YMZA 1ND3A 2BYVE 3AZXA 3B00A 4DNYA 4ES9A 3BOPA 1VIWB 1OOPA 2G4IA 2DCZA 2ZMNA 4YZ2A 3WDYA 1CPMA 3K48A 3AFGA 4RR3A 1VBE2 5EYXA 4ZU4A 3M8LA 4K40A 2GNTA 4S2FA 1IS5A 1MQTA 4C90A 3ELNA 4YW3A 4GB32 4FTBA 3ZX7A 5ABJB 1COV1 3APBA 1VLNA 2WT1A 5DXDA 2IC1A 2VGDA 1WMFA 4KU7A 3NW4A 3JBG2 3KM5A 2A71A 4BZ4A 3RSJA 2HWB2 4S2DA 5KXCA 1W6NB 2YV8A 1YIFA 4P5HA 4QQHA 3ZXDA 2EXHA 1MS3A 4NN0A 1FOD3 4XJWA 1HRV1 1IPKA 3SMHA 4COVA 1AYN3 4E27A 5ABJA 3RMXA 3KSCA 3AJZA 3FWEA 4KU8A 4JRLA 3TB0A 1OFSA 4Y1ZA 2YROA 3MEPA 2O8OA 4AVVA 4GH4C 1YJKA 4IEXA 1D4M3 5JI7A 3I59A 2VVEA 3HMYA 3WNXA 1MEC3 1ASJ3 2XLGA 4EN8B 1N47A 4B29A 4MGZE 2A3WA 2FMYA 5JI9A 4BOWA 2ZGRA 4JVAA 3S0MA 1JXNA 3WP4A 1G7YA 4Q27A 2BUKA 1ENQA 3FMGA 3OBRA 4BIFA 4LE4A 3UV9A 4AEJA 3OPZA 1YI7A 4OHWA 4MGYE 4N9IA 4XIOA 2DVFA 4YM2A 1VBB3 2EXKA 3CF6E 1EV11 5DUWA 1CGPA 4COYA 4Q1PA 2OW4A 3HAGA 2YGMA 4AHWA 2D5FA 4I3GA 3RJRA 5I8YA 2JJ6A 2PN5A 3B69A 4H7MA 3TNPB 1V9U3 2MEV2 5CB7A 3DPRA 3HQXA 3NV4A 4MGIE 2A6ZA 2FHRA 1XNDA 1CESA 2BNNA 5BNNB 1POV1 4AI1A 1NCRC 3THTA 5CFDC 4Q0PA 1WW7A 2DVBA 4HKLA 1WMDA 3JD73 2OZJA 2GSYA 4IETA 2I07B 4Z2WA 4QPIA 4Y5Z0 5KHHA 5D8AB 2XLAA 4IV1A 1U0AA 3QOPA 4P14A 1HKDA 2D7FA 1I6XA 3ZSEA 1DZRA 1XE7A 5EV7A 1ND3B 3P3NA 1UZZA 1XU1A 2QZ2A 3V56A 4GMP0 2I74A 2EIGA 2ZABA 4AW7A 2DU1A 4CZSA 1CIWA 1QU0A 4EN9B 2D3SA 1W0OA 1IZ3A 4WVWA 4F7ZA 2CY6A 3ASIA 4L92A 3KCYA 1RUC3 5BNOA 4XJAA 1X8EA 1GSLA 1QOSA 2E6VA