1QY4A

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with gluconate 6-phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 40
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qy4A00
4E2GA 3LZZA 4PIZA 4AQ2A 5KHKA 4IEQA 4LEJA 4AXOA 3CEWA 4AVAA 3N4MA 4KWKA 1RGSA 3FWEA 1ZRFA 4OFGA 2Q30A 2EAAA 4FAGA 3PVBB 5T3NA 1CAVB 4F8AA 4MGYE 2C0ZA 4I02A 4XFHA 5F1RA 4ORFA 1NZCA 3BPZA 5LRRA 3JZVA 2I45A 5I8YA 1QWRA 2WFPA 1XRUA 4XF9A 1X8EA 4I0BA 3H3UA 3LAGA 3VHRA 4XF4A 3RDIA 3GYDA 5JAXA 4YNIA 3HQXA 4Z07A 5EFUA 3RYPA 4Q0UA 3BCWA 3NVCA 4UBHA 4B29A 1WLTA 4R8HA 1FI2A 4Q0VA 1HW5A 5E1RA 3KGLA 3QACA 4HVOA 4XF3A 5JSPA 3KMHA 3KSCA 4META 4LUMA 1QXJA 1DZTA 1UIJA 2ET7A 4HSLA 3BALA 2XLGA 1LKNA 2FMYA 3HT1A 3MDPA 1ZZ6A 4LLOA 2N7GA 1LR5A 2PAEA 1CGPA 4DINB 5KBFA 1VR3A 2B5HA 5FQ0A 4MUVA 1EY2A 4RD7A 2UY9A 1UD1A 2Y0OA 3D82A 3ES4A 1YFYA 1CAWA 4OLLA 1DZRA 1ZNPA 4KU8A 4UBGA 4H7LA 4BH9A 5HI0A 3MPBA 3U10A 2IXCA 3NW4A 4IEXA 4HLTA 4JTNA 4X6RB 3EQEA 3E5UA 3HIFA 4MX3A 2IXLA 4YARA 4Q29A 1CAUB 1Q3EA 3ZDSA 4J1XA 1UIKA 3ROUA 1J3RA 2BYVE 2O1QA 2PAMA 4LA3A 1VJ2A 2IXKA 2K0GA 5E16A 3D0JA 4YRDA 3RYKA 3U11A 4EWAA 2BNOA 3NJZA 5JSRA 4LULA 2EA7A 4HN0A 4HVRA 2CAVA 1UPIA 1NE4A 3FJSA 3SCHA 1YHFA 5CU1A 3FFQA 1RL3A 3L2HA 4PIYA 4XF1A 4P9GA 4I01A 1FT9A 3U0ZA 3DN7A 3I59B 3ELNA 4N9HA 3IDBB 5FLJA 1ZRDA 2PYTA 3DKWA 1GQGA 3R6SA 3UKTA 1X8MA 2UY8A 3DL3A 5C6CA 3GBFA 5I0SA 3I54A 3LA7A 2IXHA 4X6QB 3NSTA 1DGWA 2PHLA 2UYAA 5I0RA 2GAUA 2H6CA 2H0VA 2DCTA 3WW2A 4FAHA 4ZU4A 4IEOA 4LA2A 5CADA 2CV6A 2WC2A 3H3ZA 1J58A 1XE7A 3FE5A 2B8MA 1QXRA 5FLIA 3NKTA 3S7EA 4D7TA 2OA2A 5I93A 1NYWA 3E5QA 2GC1A 3TNQA 1YFXA 3DV8A 4K8FA 2QJVA 2OZJA 4Q0QA 4J1WA 4HSJA 1CAXB 4EWDA 1RTVA 4TLFA 4I2OA 4JV4A 1RUNA 3EO6A 4R52A 1TQ5A 3E6BA 2IC1A 2QCSB 1WGPA 2Q0AA 3PLQA 4HZFA 1VP6A 1NXMA 1IPJA 4XFIA 3EBRA 5LRSA 3KGZA 4JVAA 2FQPA 4NVPA 2ETEA 1Q5OA 1U12A 1G6NA 4MZUA 3D0SA 4QM8A 1SQ4A 2GC3A 2V09A 1UW8A 2D5HA 1ZRRA 4IEWA 1GQHA 5AVPA 4FT8A 2VPVA 4I0AA 1OD5A 1NE6A 3H7JA 4Z82A 3BB6A 4O9EA 3LWCA 3OTFA 3BU7A 4AVCA 3IDCB 4LUKA 1SFNA 4KWJA 1LRHA 3KCCA 2XGXA 1OMIA 4A2UA 4IETA 1WA4A 3TNPB 1X7NA 1IPKA 3FZ3A 5FDBA 1CX4A 4L2NA 3EJKA 1X82A 4GULA 2BNMA 4XFBA 4QX5A 2PFWA 1H1MA 1O7FA 4XFGA 5KHJA 5J48A 1ZX5A 3RNSA 3E5XA 3WW4A 3CL1A 1PMIA 2ET1A 2H6BA 3IBMA 2CGPA 4QGMA 5FQ0B 3SCFA 2F4PA 1JUHA 3H7YA 5KHIA 1O4TA 4XF0A 3NL1A 4WBBA 2XLFA 2KXLA 3RZZA 1CAWB 1J59A 5BY5A 1ZRCA 2ATFA 1O3QA 5JCTA 1O3TA 1QY4A 2GU9A 2OYZA 2GC0A 5BV6A 3S0MA 1UCXA 4PIXA 5K8SA 3OCPA 1XE8A 1CAVA 1ZZ7A 4MGZE 5BPXA 1SEFA 3H8UA 3HT2A 3I7DA 2PHDA 1I5ZA 4XFFA 2XKOA 3IWZA 1J3QA 3B02A 1I6XA 1ZZCA 2PTMA 1Y9QA 1YUDA 4MV2A 4BYYA 1EYBA 3H1WA 4AQ6A 2PQQA 4EWEA 4QMAA 4IEZA 2Q1ZB 4QXKA 3FHIB 2D5FA 1V70A 4QGNA 2O8QA 3G7DA 3H1MA 3SCGA 3SHRA 5I8SA 4BIFA 1YFUA 1O5LA 3ST7A 4UXAA 1J1LA 2MNGA 3ETQA 2QVSB 3LOIA 4I09A 4ZU7A 3H9AA 3E6CC 2IXJA 4XFCA 3H50A 4ZU5A 2CAUA 3EHKA 4KL1A 4IEVA 5JSOA 2HJIA 5D1IA 5LEKA 3SMHA 2GH2A 3RYRA 2D93A 2XL9A 5JR7B 3CJXA 5J3UA 4KWLA 2XHKA 5C8WA 3M70A 1YWKA 1ZREA 1EPZA 4BHPA 1YLLA 2PAKA 2OZ6A 4MGIE 4WZCA 3CLPA 4HN1A 2XLAA 2GZWA 2HKXA 3PNAA 3CO2A 1ZZ8A 2MPFA 3LA2A 4IERA 3E6DA 4EV0A 4QGLA 1ZZ9A 4ONUA 1LB2A 1EP0A 4IEPA 1PM7A 4KU7A 3UKVA 3MYXA 4IEUA 3WW3A 2QNKA 3E97A 4Q0PA 5CVRA 4FBFA 3CF6E 4N9IA 5I8TA 1CAUA 3QOPA 1RUOA 4HVQA 2D40A 2QDRA 4Q0SA 1ZVFA 2ZKLA 4L11A 3OD0A 5FPXA 1DGRA 3SXWA 4I3PA 2MHFA 4WVZA 2XL7A 2K9ZA 5FPZA 2BNNA 4F7ZA 1O3RA 3USSA 4YSFA 1O5UA 2Q4SA 1OI6A 3FX3A 3O14A 1ZZBA 4HBNA 2P17A 5EZWA 2PA7A 5I0TA 4CYDA 2BEOA 5J7MA 1L3JA 4D7SA 2Z2SB 4E2SA 3H1YA 3OF1A 4XFAA 5I91A 2GC2A 5FLHA 1O3SA 5FCCA 3RPQA 5BUVA 4E2QA 3I59A 2Z69A 2IXIA 4HMZA 4MH0E 1H1IA 4XETA 3ACLA 2ZCWA 4PJYA 4IESA 3C3VA 2OPKA 4MGKE 5BXXA 4YYOA 3IIAA 3M3IA 3S7IA 5KHHA 4JTOA 3LA3A 2VECA 4AVBA 1Q43A 1YFWA 3MZHA 4O9GA 4EROA 1Y3TA 3UKNA 2BGCA 2E9QA 4IEYA 2B9UA 5KHGA 1J3PA 2XKPA 2EVXA 1RC6A 3WW1A 4XEZA 2VQAA 3OGJA 4LTAA 5I0UA 1OFNA 3ES1A 1FXZA 1CAXA 5LEJA 2UYBA 4QM9A
chains in the Genus database with same CATH superfamily
1GWMA 1IZ3A 2YY1A 1RYYA 4JRLA 4BQ3A 1QOSA 4E4DX 5DPNA 4DZGA 5GLVA 3D4KA 2A1XA 4FOWA 4S2GA 3WNXA 3N4MA 5L9BA 1FPN3 5IVYA 1BJQA 5A6ZA 3LPFA 4UW4A 1YQ8A 2EAAA 4CUAA 2YDEA 5HV4A 3WLUA 3PVBB 2QQOA 4XBNA 1JYIA 2LTNA 4INDA 1CAVB 2WNVC 2A6XA 4URTA 4F8AA 2D6KA 3TBDA 2C0ZA 5LW9A 4XFHA 1NCQB 1Z7S2 2DYCA 1NA1B 3B00A 5LWBA 3BI3A 2GP3A 3ZVXA 3GCWA 3QLQA 4MVTA 3MF9A 3WP5A 4CDUC 3IMMA 4ITCA 1XRUA 5FPVA 3RWNA 2WWSA 3IMNA 1VB4A 3S5AA 4LKEA 1AYN1 1W2TA 4ASLA 5F6KA 3AP7A 3ZM8A 3J26N 1AXYA 1J1TA 1MPXA 1JU4A 3LAGA 3MFCA 3NRUA 4QPGB 4QX7A 1MS1A 3V56A 3I49A 2WZ8A 3VDDC 4IE4A 3ZFFB 1RMU2 5JI9A 3HQXA 1QQP1 5IAXA 5EFUA 2FCVA 2LROA 2YBKA 3RYPA 2JDHA 4FPEA 4DMIA 1FAYA 1S0JA 2LUWA 1JU3A 3NVCA 4Q0UA 4UBHA 3RJ2X 3HMYA 3DYMA 2K2SA 2WKKA 4YGCA 1K5MA 3I2OA 1COV1 1EUUA 4W6WA 1AX0A 4AZZA 3MLLA 4CPBD 4Q0VA 5CG8A 3BOWA 3VBOA 4LIUA 1HW5A 2EAKA 4QQOA 2XB6C 3PU8A 5JUVA 1V0AA 2AACA 3VL9A 3KMHA 4Q1RA 3UV9A 2J1VA 4TN7A 4IV1A 2JD4A 4ASKA 1D4M2 3DKQA 4EYUA 5A1LA 1DZTA 1MS8A 1QGLA 5D21A 3SKJE 3ACIA 2ET7A 2KD7A 4HSLA 4XAEA 3ZPOA 2AEYA 2XQRA 1W8WA 1LKNA 2EIBA 3HT1A 3UGHA 5J96B 1C8M3 2P1BA 1OXCA 2D6LX 4YVSB 3BUCA 4LLOA 5FZAA 2N7GA 1LR5A 4YW7A 3VZJA 2UWBA 1CVNA 1VR3A 4QHZA 3G6JB 5GKAC 2OW4A 3WQ7A 2JG9B 4A3ZA 5JWPA 1U5ZA 1GZ9A 2VZOA 2VY0A 2ZMNA 1ENRA 2Y0OA 3UJOA 4NE9A 3ES4A 1VRH1 3ITQA 2ZX0A 1RVF1 4CDXC 1BEV1 5J37A 1NOVA 5FZ3A 2YUEA 3ZO0B 1DZRA 3BODA 4AAPA 3MI8A 2VTXJ 1JH5A 1PGW2 1MQTA 5F2WA 5HI0A 3B9CA 1FOD3 4IQPA 5FR3A 1GOFA 1OHFA 3RZJA 1P8JA 2IXCA 3NW4A 4IEXA 4PQ9A 1FPN2 4WVVA 2Y6KA 4D7YA 5DG1A 3V0BB 4CDQA 4XPVA 3WHUA 1UKRA 2HWE1 3B3QE 5L9RA 4BIOA 3AXEA 1ZRIA 1PHMA 4YARA 3VZOA 3K75B 1Q3EA 3H3LA 3OD4A 3J7HA 1OKOA 4J1XA 5DAVA 4YM3A 1VMHA 2O1QA 4L92A 3SC7X 1H9WA 5IAVA 2IXKA 3TWIA 4W6YA 1IQDC 3O1MA 2NQYA 4YRDA 1GWKA 1I9RA 2YG0A 1SHWB 2X05A 3NJZA 4EWAA 1AX1A 1XXNA 1U5IA 1RUJ3 2W1SA 2EA7A 2XQXA 1W03A 4HN0A 4HONA 2CAVA 4LO7A 4YVWB 4YW1A 3THCA 1Y7BA 3SCHA 2VOXA 1AR73 5JPMB 1YHFA 5LBFA 1DIWA 4AGGA 3I4IA 4PI0A 2DTWA 2V4AA 4CVUA 1BQPA 4PIYA 1OA3A 1E5IA 1JYXA 2CL2A 4XF1A 4P9GA 4FXKB 1FT9A 3DN7A 3VB9A 5A7WB 4N9HA 1W9WA 4NRPA 5DAPA 5FLJA 4J6GA 1XYNA 1U5YA 1ZRDA 1XB9A 3ZXKA 1GQGA 3R6SA 3MLKA 3UKTA 5K4LA 3O1PA 3VBUA 1CONA 1VBE3 3OBAA 1NAEA 1QJU3 3GBFA 5C6CA 3RZGA 3NAPC 5CFDC 1WCQA 1DGWA 3CHXA 4AHYA 4CCJA 1JODA 4Y1YA 5I0RA 2H6CA 2LW8A 3NNJA 4FTSA 3Q8FA 2H0VA 5EJ1B 4I3GA 1AR91 5CBLA 3OYWA 4FCAA 4IEOA 2WO1A 4F3JA 1VBB1 4WM8C 4Z8BA 5D8AA 2RS33 2CV6A 5FP9A 4CTEA 5FY4A 5CADA 2FMDA 1PK6B 1CIYA 1G9DA 5F3CA 1QXRA 1SLBA 2WNUA 3S7EA 1W3VA 1C8M2 2ZAAA 2YV8A 3GM8A 2VBDA 2JWPA 1YC61 1W04A 1NYWA 4QB1A 2GC1A 3W5MA 1BHGA 4LHNA 4DFSA 1NKGA 4LBJA 4HOOA 5BYNA 1I5PA 1JYTA 4Y5SA 5FZCA 4CEWC 1CAXB 2ZHKA 3U14A 1Q56A 1RUNA 1W6OB 4GJZA 3NNMA 1OF3A 3ZIXA 1YO8A 3D5OA 5BNNC 2VZRA 5FPUA 3E6BA 4Q4V3 2KM2A 1WGPA 2QCSB 2WSUA 3BGAA 2ZAHA 4RR3A 3ZYIB 2LS6A 4GMP3 4HZFA 1VP6A 1XOYA 3MPPG 1UXXX 1FOD2 1YI7A 2A6VA 4R9CA 3AFGA 2G19A 1HQLA 5FOBB 1KDKA 3AM2A 1TNRA 5FZOA 3P3NA 2UURA 4NVPA 4TLGA 4H7MA 3P3PA 4P00B 5T5LA 4YZ3A 3KD4A 1LNSA 4QKDA 1JTZX 3OGGA 4HFSA 5DUWA 1VALA 4AOCA 1QIQA 1G9BA 3VDAA 3MIFA 2QKDA 4SBVA 2YFUA 1ND2B 2JB8A 2J42A 3BIWE 1S0CA 4GZ9A 2BERA 5DG2A 3NV3A 5AVPA 5E88A 1RUJ2 2ZMLA 2J1UA 3H7JA 3GHMA 3E1F1 1AR72 3VBRC 3WNLA 4S2HA 3M1HA 3OTFA 4PF1A 4AI1A 5C33A 3SITA 1ASJ1 1A6CA 3ENRA 3IDCB 3VBRA 3WQBA 3JD71 3MIHA 5FUNA 3POYA 1JYWA 1MS0A 1UYXA 3USUB 1AL21 1W9FA 4AEDA 1POV0 5CYYA 4A2UA 4ZS3A 1ENSA 1VBE2 2ARAA 1QJU2 4PQQA 1RJ8A 2YU2A 1ST8A 3ZYGA 1ONAA 3WP3A 1IPKA 3FZ3A 4CCOA 5AC91 5KR7A 2QZ2A 4D0QA 3GZAA 2R1BA 4UWDA 5FP3A 2FZ1A 2CWSA 3ZSLA 1X82A 3AB0A 3M3EA 4B1MA 2FZ2A 2J7MA 4FPJA 4XFBA 3K4ZA 3POJA 2RS32 3DGTA 1PZ8A 2G9GA 1O7FA 2RDNA 4ZZ5A 1U0AA 2F6BA 4CP2A 5J48A 3DPRB 1KITA 3CL1A 4KGQA 5KXEA 2H6BA 2Z79A 2JEMA 3WZ1A 4AGRA 2F4PA 2G9FA 3BYWA 1ULPA 3TEWA 1GWLA 3OEAA 1O4TA 4R9DA 4X8PA 4LMFA 1H8TC 3NMBA 1G9FA 1V6IA 3RZZA 4NIAA 4MXWB 3TEXA 4BQ4A 5JOZA 4WZFA 4BK5A 4XDPA 1J59A 3WQ1A 4CDWB 3PUIA 2D6NA 2ATFA 4XMIA 1O3TA 3Q8EA 4Q4V2 3CKHA 3J8F3 4JDMA 3QD6A 4D69A 2OYZA 4BB3A 2GC0A 1QNWA 2JJ6A 1Q8OA 2RS13 5F3IA 3A0KA 5A1FA 2W08A 2V4VA 3OCPA 4B4QA 2DBNA 2PHWA 4Q8LA 1FV2A 4AEJA 4BZ4A 3VBFC 3NV1A 4M3CA 5BPXA 3BKZA 5DDJ3 1WMDA 3FBMA 1SLTA 1AR61 4BDVB 2GDFA 1I5ZA 2FDJA 5H9PA 2WFF3 3VD5A 2VO5A 1NUKA 2SBAA 3CJIB 2BDRA 2XKOA 2Y6HA 3IWZA 5FZ1A 2XPJA 3AKQA 3VZMA 5F37A 1REEA 2BUKA 3PHMA 4QX0A 4OYUA 1POQA 1UY1A 5HCFA 5L73A 1DYPA 3ZR5A 4K7JA 4AK3A 1N3QA 1YUDA 2VMFA 4MV2A 5EPAA 4BYYA 1JI6A 1UY2A 1W39A 3FC0A 5FP8A 1MZEA 4LE3A 4XZUG 4M4RA 2QDNA 3I2KA 4QMAA 5DZFA 5C5UA 4H55A 3BU0A 1S0FA 1L7QA 2Q1ZB 1LHOA 2Y6JA 5IUQA 4QXKA 1H9PA 1AR83 3T1LA 1C4RA 3V64A 4N53B 3QH6A 5CEHA 1EV11 5T5JA 1HQNA 2YGMA 4A7ZA 3C7FA 3FN9A 3VZKA 1N1VA 5I8SA 1TMF3 1YFUA 1W6PB 4IGQA 2ORZA 4KWUA 1GFF2 3ST7A 4BQWA 1J1LA 2MNGA 1W6QB 1PO11 3H42B 1UYPA 4ZXKA 1LGCA 1UYZA 1OVSA 2IXJA 3AMPA 3W58A 1IPSA 1ZBE3 3ZSEA 2X29A 4A44A 5K0UC 1W8OA 2R1DA 2HJIA 5C9AB 3MEPA 5F2SA 2WS93 3JBG3 5LK7B 1QJX1 2D6PA 4K6BA 3KS7A 5IVBA 5C8CB 2D93A 2GMPA 1QJFA 4DXTA 3EXUA 1RUI1 1BMV1 4B4PA 4UFIA 2A6YA 4GWMA 1CESA 4B7KA 2VNVA 3INAA 4PI2A 4LK7A 4KBZA 2HWC3 2WQZC 4IV3C 3KT1A 5C8WA 1KJRA 1DF0A 3IZOA 1UOJA 1XNDA 5FZDA 4BISA 2OQ7A 2VBBA 1LU1A 1EPZA 4XCBA 3D3AA 1YLLA 5EWSA 2OZ6A 1PGL1 1DP0A 5BNPA 3AYDA 4C1XA 3VDCA 2XLAA 1BCXA 2BRTA 5FXXA 4IERA 3E6DA 2ZEXA 2ZZQA 3MV01 5HXVA 4EV0A 1N1TA 4LE4A 5IATA 4LOTA 3WDYA 1LB2A 3J8F2 4JKKA 3AMNA 1PM7A 3J9SA 1JW6A 2EF6A 3LF7A 4NIHA 2RS12 4K9SA 3WW3A 1D2SA 3E97A 3MLJA 3ZYFA 1SBEA 4XURA 2WZPP 1NX9A 4FBFA 1BYHA 4N7UA 5CKNA 1OOPC 1XE0A 2QQLA 3AXDA 1FNZA 4N9IA 1RUOA 4COWA 3PVOA 1FYUA 2QUOA 3C7GA 2D40A 5DDJ2 2QBXA 2ZKLA 4RQPB 5C70A 1PZ7A 5DUXA 2WFF2 1I3HA 1OOPA 4A42A 4I3PA 1GNHA 2CHHA 3AYEA 4XABA 5LA9A 2D3RA 1XYPA 4R9AA 5DZEA 1JZ4A 1O3RA 2ZGSA 4M3CF 1SACA 2ZGUA 1QDOA 4RN5A 1RB8G 1M06G 1ZZBA 3NNFA 4HBNA 4W50A 2PA7A 3ZXDA 4BA6A 2BEOA 1QJY1 1OSGA 2IFWA 2WT2A 2Z2SB 4RS5B 4E2SA 3R0RA 1ZA4A 4DUWA 5JXIA 3N35A 1Y9GA 3OF1A 5FYMA 4XFAA 3URFA 3IM0A 4OUEA 5FMBA 4CCNA 1AR82 1A34A 5FLHA 4R9BA 1O3SA 3NKGA 3SNMA 4QHOA 2VUDA 3C7HA 4FVVA 4YZ4A 4BCUA 5BUVA 5JLVA 2GMEA 3I59A 4CP9A 2Z69A 3AVRA 5IVEA 3JU9A 4L9BA 4YW3A 2ZGQA 1TMF2 4HMZA 5DQ0A 1TVGA 1H30A 4MH0E 1H1IA 1LHNA 2C9KA 2P4EA 1VBD1 3LE0A 4AHXA 2E26A 4GWJA 1GQPA 1ZBE2 2CNAA 5LCWL 1RUC3 5GALA 3S7IA 3HBKA 4K8RB 2VECA 1LJ7A 1X9PA 1YFWA 2BP6A 3N9LA 1IS6A 3MZHA 5I0DA 2WS92 3JBG2 1RITA 1SMVA 3OG2A 2VNOA 4XJ9A 4Q27A 4XDQA 4TXWA 1SLLA 4QDRA 1U5XA 3AZYA 2Q1FA 4LO4B 3HN1A 5AVAA 4MADA 1A78A 3O0XA 4M0HA 2WA3A 1RC6A 2HWC2 3MFAA 4GWIA 1RUH3 3N7KA 4JDNA 4QQLA 3OGJA 4OI4A 4BLJA 4Z1VA 3FLRA 4MG2A 3ECQA 1OFNA 5FY9A 2WO7A 1C8NA 3C7EA 1Z7S1 2XJUA 3LIGA 5A33B 4PIZA 3N7JA 1ND3C 4AQ2A 1W28A 4C1WA 1B35B 2FHRA 5A3NA 2ZGNA 4NN0A 4XUNA 4IEQA 4AXOA 4AVAA 3CU7A 4W65A 1QH7A 1W6NA 5B4NA 2JICA 1KGYA 1RGSA 4KWKA 4ZY9A 2E53A 5IHRA 3T09A 2R061 3VBSB 2E32A 2YC4A 4OFGA 5DXDA 1YJLA 5A7OA 4FAGA 1RMU1 5T3NA 1OLQA 2YPJA 3I2GA 2IFRA 4IGPA 4MHRA 1DLCA 2YB7A 4FQ4A 4BWOA 4MGYE 2Q8OA 2RR13 4I02A 1GANA 2CYFA 3KCXA 3FHAA 4N8MA 3AMQA 4FPHA 5LBCA 3AL6A 3T2TA 1OH4A 3VKLA 5LRRA 2I45A 4W6XA 1NCRA 3OBRA 3PURA 4UFMA 5FZ6A 1X8EA 1N47A 2PHRA 5FZMA 2RVAA 1GKBA 4QPIC 4B3NA 1HLCA 4XCAA 1SPPA 4NJ4A 1AZDA 4LJHA 4I0BA 5C4WA 5F9TA 3VHRA 1DFQA 4LKFA 4NROA 4WM7B 1JBCA 1EAH3 1YIFA 4LIVA 2IZWA 4AI8A 2DFBA 4YNIA 3KT7A 1D4M1 2CY6A 1W6MB 1W9TA 1CIWA 2UWCA 1C28A 1XSQA 4CP0A 3O7OA 2MEV3 3VD3A 4P5YA 3B01A 4B29A 3QCWA 4AVVA 4L8QA 1R083 3HR9A 5GM0A 1CQ9A 1RUE3 2FCUA 4JGYC 4CUCA 5GLUA 4IE5A 5GZFA 4GH4B 2XJVA 5E1RA 4NPRA 3QACA 1DGWX 1UZYA 5L19A 4MO3M 2ID4A 4XF3A 5FKCA 1RUC2 3VV1A 3ZFGB 5KXCA 3U4XA 4ET7A 4META 2VMCA 3WG1A 2ZGTA 4XBLA 1UIJA 3LCPA 5FUIA 3IKWA 3BALA 4XC9A 2FMYA 4FQZA 2WNEA 5IW0A 5CKMA 2R043 1PGW1 1RHI3 1UYYA 3LSDA 3UYJA 5HBAA 5BNOC 1F8VA 3H8RA 2HWF2 3I8TA 2YZ4A 1FPN1 1ZA7A 1EUTA 4QU2A 4XJUA 3X29B 3K3NA 2B5HA 1RUH2 1JOPA 5BNOA 5FQ0A 4MUVA 3OEBA 4UF0B 4RD7A 1JUIA 3OUIA 2HWB3 4A4AA 1FX5A 3ZYRA 1MZFA 2DUQA 2P5BA 2E7QA 4PF5A 3LDKA 2Z5WA 2BWCA 4FPGA 3QBQA 4ISRA 5AFBA 3UNPA 4KU8A 5IK7A 3OGRA 5ABJB 4H7LA 4BH9A 4PDWB 3THPA 3MPBA 2JDUA 1DGRN 1OUXA 5ERLA 2CDOA 2XVKA 1H4GA 4X6RB 1WD4A 5JZGC 4DEQA 3E5UA 1L7LA 3AFKA 1UAIA 2IXLA 1AXKA 5GZEA 4CP1A 1XC6A 2VNRA 2ZABA 1CAUB 2WZEA 3ZDSA 4A41A 3S30A 2VXJA 5L7OC 4GA9A 2RR12 3KF3A 4E9KA 5A1AA 1JZ2A 1C5IA 5JZGA 3OY8A 5APAA 1ODNA 4DXZA 3O0WA 2X10A 4YZ1A 2B7YA 3FHQA 3VUOA 3C2UA 4DQAA 5JSRA 2BGOA 1D0GA 2DFCA 2D7FA 3H0OA 2GH8A 1Z78A 1PVXA 1NLSA 1EAH2 1X50A 2GMMA 5CKQA 3ZFEA 4CEYA 3MIGA 4Y5TA 1RL3A 3AJZA 3ILRA 3L2HA 2E31A 5KXDA 4JCKA 2PQSA 2W91A 1H2LA 3ZMNA 2BFUL 2JG8A 2MEV2 1PGSA 3UETA 3VBHB 1GNZA 1LTEA 1TE1B 4RYDA 1NCQC 3K3OA 1R082 1NA1C 1C8M1 2PYTA 2Y34A 3DKWA 5FK7A 1RUE2 2HBTA 2IWGB 3I2IA 1DQ6A 5M0TA 2GNDA 2RS53 2DV9A 3RZHA 2DUPA 3KLSA 4BQYA 4X6QB 5C3SA 4BJ0A 2BVBA 2UYAA 4NMIA 5GLZA 4CUBA 3S57A 2GAUA 3ASIA 2JDKA 3OB8A 5FWEA 3HAGA 3ZX7A 4BMBA 5LY1A 2R32A 4QPGC 4AI0A 3WW2A 2H0BA 4NWVA 4AF9A 1YRZA 3ZXGA 3T0BA 2VOVA 3ZFFC 4FOYA 5A6YA 2QQUA 4QWNA 2WLQA 3LQCA 3IAQA 2JXAA 3H3ZA 4ZPIA 2R042 1RHI2 1W90A 3PUQA 1BXHA 1FOD1 3NKTA 2WNVA 3APBA 3A23A 1EPWA 1H8VA 2EXIA 4IL7A 5FZ9A 5T5OA 4XQWA 2NMNA 4K8FA 4OMCA 1RINA 2QJVA 2A71A 2HEYF 2C6SA 1WMXA 4Q0QA 3ZIWA 3NJYA 3MUY1 2D98A 2F4LA 4CDUA 1GZCA 2HWB2 4GKXA 5FV3A 5H9RA 4JV4A 1LEMA 1SBFA 3POFA 3BPSA 3CMGA 4A7YA 4DXRA 4LHKA 4R52A 2VTXA 3VKMA 1DHKB 1PVC3 4EN8B 3J4UH 2IVIB 5FZ7A 4HL0A 1S0IA 4MXVA 2AREA 3PLQA 2RDQA 3VDDA 3U78A 4NUBA 3SISA 4XFIA 1RUJ1 2WN3A 5SV5A 4MLOA 4U36A 4JVAA 1WBLA 5KXBA 4O7XA 1AR71 2P3IA 4P9JA 4YVSC 1UU6A 2ETEA 2YU1A 5DAWA 1WW4A 2BU9A 2VE1A 2WLPA 2Y60A 5DZGA 2A6WA 1GUIA 2JG9C 4MZUA 5A3WA 2LRPA 4DUVA 3C7OA 1WW5A 4QM8A 1SQ4A 1G9AA 1W05A 4Y26A 3WXPA 3HEIA 3GALA 4Z2AA 2D5HA 1ZRRA 4QXHA 3BTYA 1GQHA 2PELA 2VCMA 1W06A 4Q8KA 1VBE1 2Y6GA 1QJU1 4QD2A 1NE6A 3B93A 3KHCA 1RXFA 2JDYA 4D6SA 1HRV2 4RFT0 5CFCB 1JYCA 2VU9A 3BB6A 4QPYA 4O9EA 1E5RA 1STMA 1UX6A 3LWCA 1CPNA 2QQWA 3NWKA 3TOJA 3ZYHA 1VB2A 4Y4YA 4OZXA 1XNCA 2CGOA 1HXS3 4DPNA 1SFNA 3D8CA 2RS31 5ANQA 4E27A 1SZBA 1K5MB 3KCCA 2XBO3 3UGFA 2C24A 3C8XA 2ZGMA 3MICA 3JCIA 1WA4A 3TNPB 3VBOB 1X7NA 4E4HA 2RS52 5EP9A 2VW0A 4CDXA 1QJZA 3LB9A 5FDBA 4DRRA 4YVWC 4IV1B 3ZXEA 2QE3A 5FBJA 3CDZB 1SDDB 3T2PA 3VZLA 5LBEA 3GBWA 1PO22 2E7TA 4F83A 4Q4V1 3SQOA 5FYYA 4HG6B 2PFWA 1H1MA 4GMP1 3I3BA 2WYFA 3E5XA 1F5FA 2O14A 1PMIA 2VUJA 2ZHLA 2CGPA 2RMU3 5CB7A 4C90A 1RXGA 5JR2A 4FTEA 3H7YA 2BV4A 1HB4A 4QX3A 5A80A 5KHIA 4WBBA 1DQ2A 4C8DA 2AUYA 3HPNA 1K42A 1URXA 3PJQA 3AP9A 1ZRCA 1PVC2 5JXHA 4Y1XA 5JCTA 3NQHA 1MQTB 2GU9A 3IPVA 3ZYJB 3U37A 2VMIA 3WDWA 4AVSA 4PIXA 2GNBA 2VOTA 1PK6C 1PNFA 4NPMA 1D0HA 2AZ5A 2E63A 3Q8AA 5FPAA 4CDQB 4DUXA 2J22A 3BTAA 3HT2A 3I7DA 5FJKA 2XWBB 3V0AA 5E6HA 5JVVA 4XUQA 2YPDA 2P3JA 4B4RA 1F2NA 5IVJA 5JMCA 2W52A 5JOXA 2Y64A 1GICA 2DVFA 3B02A 2VNGA 3NAPA 5CFDA 4EZHA 2W92A 3FFZA 1GU3A 1ZZCA 3KM5A 1Y9QA 2DBIA 1EYBA 4IE7A 2VULA 5DAQA 1XBFA 4AQ6A 2ZMKA 1BK0A 5FXWA 4EWEA 3HNBM 3U1XA 4AFDA 5C3OA 2YBPA 4LNVA 4IEZA 1SLIA 1W6OA 4QKNA 4V1PA 1VMJA 2PHXA 3HJRA 4WM8A 3POGA 5IK8A 1CZSA 2EIGA 5FK8A 3H1MA 3GZUC 2VUCA 3SCGA 2ARXA 2GNTA 4NHXA 4XOGA 1HXS2 2BW8A 1ALYA 4UFLA 1O5LA 2EICA 3ACGA 3N9PA 4MGTA 5LASA 1WCUA 2QVSB 2XBO2 4I09A 3H9AA 3VHOA 1C3HA 3WCRA 4D94A 2J1SA 4XFCA 3H50A 1ND2C 4ZU5A 2VMGA 2Y38A 3VBUB 4Y20A 4CEWA 4HT1T 4IEVA 1JHNA 5A7PA 2P3YA 5D1IA 4ASMB 2WNOA 5BNNA 5LEKA 2VW1A 1YEWA 3B5LB 1VAVA 2GH2A 2IVJA 2ZHMA 3KV4A 3OYWB 3RYRA 5DMYA 3OSDA 5D8AB 4IXLA 2D44A 1UO9A 5JR7B 3CJXA 4KH9A 1WLCA 3LDBA 3WY6A 4KWLA 3J8F1 4OZOA 2HWE3 2WNUB 1FMD3 3ON7A 4XTMA 2RDSA 2RS11 5FUPA 4YM2A 1O8PA 4CCCA 2DF7A 5FYSA 4ARXA 1IG3A 2RMU2 5LA0A 2YBSA 5DDJ1 4PLOA 5FYVA 2WO3A 2AC1A 2XJRA 2WFF1 3I3MA 4ZZ8A 1TME3 1AF9A 1X9TA 4CXWA 2FCTA 4AW7A 4RHV3 2FDGA 1ZBA3 4QGLA 3ZR6A 5IYYA 4RR3B 1OD3A 1HN0A 3TEZA 1F9KA 2AEZA 1QNYA 2NZ9A 2VQ0A 4KU7A 5FZ0A 3K77A 4IEUA 4QX1A 5A6QA 3TAYA 5FZOB 1WUVA 2VQTA 1GOGA 1NT0A 3DPRC 1AR81 2WAAA 3CF6E 3O5SA 2HBUA 3QOPA 5EQUA 4HVQA 3ZXLA 5E8AA 5FOJB 4L11A 3EB7A 5FPXA 4AR2A 1HV0A 3MV11 1MEC3 2BVVA 2Q1MA 1TMF1 2K9ZA 1XNBA 3GHNA 3HVDA 4V2VA 2VZPA 1TNFA 3ILNA 4L0PA 3H8OA 2EXKA 3FX3A 1OI6A 4CYDA 2P17A 1IHMA 5FFOC 1ZBE1 4CDWC 1AR93 1L3JA 4QXBA 2Z42A 3H1YA 1G9CA 4OCTA 4Y3OA 3WF2A 4YFWA 5FO8B 2WS91 3JBG1 3KVAA 4CDWA 5I91A 2QQVA 2W1UA 3VD9A 1HIXA 1RUD3 4OMDA 2W39A 2VAUA 3AZXA 2YROA 5A3PA 2KR2A 3JXSA 5A3OA 4XTPA 2IXIA 2PHFA 2VZVA 2XVLA 4AEDB 3WVJA 5FO9B 3CJIC 2C1FA 2DCZA 1S0GA 5CISA 2HWC1 3WR0A 5FY0A 2RJ2A 5IJRA 3B94A 1H8TA 2OPKA 5BXXA 2D43A 1HX6A 4YG6A 1V9U3 1XNTA 4JTOA 4AFMA 5GZCA 3LKJA 4QB6A 4O9GA 2X5IC 3M8LA 1Y3TA 3UKNA 3AKSA 3RG0A 2BGCA 3IIIA 4NIIA 4DIQA 2QQPA 2RV9A 1N1SA 4JRAA 2XMLA 1LOGA 1QOTA 2E9QA 4IEYA 2AR6A 2O0OA 2X5IA 3OPTA 2B9UA 2VOKA 4RA0A 5FMCA 3RFRA 1VMFA 3VBFA 2HWE2 4GB33 2XKPA 1FMD2 3ZPYA 2RM21 4AWDA 5L36A 4XEZA 4ZONA 2VQAA 3IDAA 2AGSA 2VZSA 1UY3A 3O1UA 4ISQA 2L9LA 3GJBA 1MS4A 4XE9A 4BQXA 3VDBA 1NLQA 4OI1A 1JZ8A 3WG3A 2R073 4DOUA 1IOAA 4NO4A 3WNOA 3WG2A 3LZZA 5C9AC 2BFUS 3GF6A 3NNLA 4S2DA 4YZ5A 3O1SA 1DU3D 3K51A 1TME2 1POV3 4XUOA 1QF3A 4CE8A 2DDUA 3RMXA 4UT5A 4LEJA 5JXGA 5KHKA 3AZVA 4RHV2 1ZBA2 5FIXA 3VKNA 4AHWA 1JZ5A 1RJ7A 2VZTA 3P5BA 3F2ZA 5C8CC 1F15A 3U75A 1CJDA 4NHMA 3MW4A 1XU1A 3I2DA 3M3CA 4E4ZA 3B7MA 3O1OA 3JD73 4M3CB 4NRQA 5FPBA 1LOFC 2AH2A 5EHDA 4QHBA 2WT0A 3AP4A 3L2YA 4Q1PA 3PIGA 1KJLA 3VD4A 1NZCA 2C9AA 2CDPA 4LK6A 4LO8A 1YXWA 5I8YA 1MEC2 1LULA 2VMDA 4Q4X3 4Y22A 5K0UA 4P9YA 5T54A 4XF9A 5JOWA 4UOJA 1JXNA 2XH6A 1GBGA 2VZ1A 3N9OA 3A21A 3KV5A 3CZUA 1D4VB 2OUJA 3VHNA 1UF2C 3H3UA 3T0AA 2Q5TA 1AR92 2A3YA 1RUC1 4XF4A 1OURA 3RDIA 3UESA 1IQAA 2XJPA 3MIBA 3HWJA 4CA9A 4OI2A 1WZXA 5C5TA 2XDVA 4G9SB 5FZFA 5I0SA 4QKBA 2PLV3 3HD8B 1RUD2 1KD7A 4IV3A 4YGBA 4FFIA 5HCHA 5EIYB 1O4YA 1DZQA 3NJXA 1GZWA 4A7KA 2CU5A 5SV8A 4D8MA 3CBNA 4RQPC 4UW5A 2JX9A 4XVHA 3ALQA 5FY1A 4JZRA 1APNA 2YC2A 4N43B 1QOOA 2R6QA 5JI7A 4B8EA 3RZLA 1RUH1 1MVQA 3KGLA 4YW4A 5JSPA 2WINB 3PTRB 1IGOA 5K9YA 1V9U2 3ZN6A 4OVEA 1IS4A 1N1YA 2ENRA 4RS5C 1QXJA 2HEVF 1AXZA 2RG4A 3U07A 4FPYA 2R30A 2XLGA 3AK0A 1ULGA 3I2HA 4I0WB 1W9SA 3HN3A 3MDPA 4FFFA 1ZZ6A 1WW6A 3PUAA 2PAEA 2J1AA 1VIWB 1CGPA 3OOXA 2DVBA 4DINB 4GB32 1E5HA 1W2UA 4AQSA 2FD8A 3JQXA 3TB0A 2HH9A 2W47A 3N9QA 1UY4A 4FPLA 2UY9A 1UD1A 2NYYA 1LCLA 4AI3A 2JE8A 4PLNA 5FZGA 2RR11 3IB3A 4FPFA 1YFYA 4Y24A 2R072 3GCXA 3WDXA 5BNPB 2ZGPA 1Q8PA 1CAWA 1OA2A 2DVDA 5A7NA 3NO8A 3W20A 1DGLA 3KCYA 4LKSA 4Q5OA 4JGZB 1GV9A 1LHWA 3U10A 3AX4A 5EXOA 3AMMA 1Y43B 4KNCA 4JTNA 3RZKA 5C3RA 1EAH1 3K2OA 4XMAA 5FZ4A 3HIFA 1XPWA 4MX3A 2VZ3A 5A3MA 3BTZA 1OPOA 3Q9OA 3JD72 1CX1A 4ZKTB 3OPWA 3WDVA 3WF4A 5F39A 4OQ9A 3ROUA 2ZA9A 2MEV1 1J3RA 1Q8SA 4XDOA 2ADDA 2GN3A 1YNAA 1E5SA 2D97A 2K0GA 4XW3A 1R081 4Y4RA 3D0JA 4Q4X2 3RYKA 1RUE1 5FPLA 2V5DA 3U11A 1HB1A 2WIIB 2BNOA 3LDRA 4PBOA 1B35C 4TYSA 4LULA 2DVGA 1Z0HA 3KV9A 2HWF3 1VBC3 4C0BA 2VG9A 5CU1A 3WHTA 3VBSC 3R4UA 1WLWA 4L97A 1O6UA 4X8NA 4XYXA 2WZR3 4HETA 4HANA 4XQ4A 3U0ZA 2VW2A 3I59B 2PLV2 4CP9B 1ULFA 1VLNA 2WYSA 1LHVA 5GLTA 5FREA 2R041 1JOBA 1RHI1 2DU1A 4AFCA 2WT1A 2BBVA 1AX2A 1X8MA 2UY8A 3DL3A 4IUGA 1UOGA 4Y5Z0 1Y9MA 4IW3A 3LA7A 4BMEA 1IKPA 1AYM3 3NSTA 2PHLA 4HPKA 4C0HA 3FMGA 3VD7A 5T55A 3TYJA 1ND3A 2BOJA 1UMHA 4P9LA 4OI0A 2WQ4A 2DCTA 2HWB1 3WV6A 4ZU4A 1D2QA 1PX4A 5A3TA 4A6SA 4WM7C 2HWD3 3AKTA 4ATEA 2FDKA 1SLAA 3KT4A 2ZXQA 3I97A 3ATGA 1JYVA 1RUG3 2ZBJA 3BOPA 2ZX4A 1XE7A 2C26A 2B8MA 2UWAA 3FE5A 4P9WA 3RJRA 3KHBA 5HV0A 1A3KA 3R05A 1BBT3 2OA2A 5I93A 1PIV3 1W6MA 3E5QA 3H8XA 3TNQA 1ENQA 2YC0A 3DV8A 1B09A 5H9SA 2R49A 2OZJA 2PXJA 2NP0A 4J1WA 5A3LA 4GH4C 1H1AA 4EWDA 2O8OA 1SFPA 2P34A 2Y0IA 4KGGA 4TLFA 3EO6A 4I2OA 2CWMA 3JB4C 3N7MA 4HKLA 3ZFGC 5FXVA 5FZHA 1UY0A 2YMZA 4QPIA 5GZDA 4B1LA 1TQ5A 5B4XA 2IC1A 2Q0AA 3VL8A 1QU0A 5G05L 3WF1A 1W6NB 5JIAA 3ZFGA 5F5AA 5A32A 1IPJA 1W0OA 1BVP1 1UZWA 4HK9A 2R7EB 1BKZA 3UK9A 4EE2A 1O4ZA 3LPGA 4LBQA 4UYBA 4QQHA 1KS5A 2A7AA 5FXZA 2FQPA 4KG0A 4KQ7A 5IVCA 1WLDA 4K40A 1R1A3 1Q5OA 2B4KA 1XU2A 3UT0A 1G6NA 5FZIA 4XBQA 1K5JA 3D0SA 5C3PA 4JGYA 3M7AA 4U2AA 5FZLA 2QQNA 4JC1A 3AMHA 1NCRB 1REDA 1VPHA 1TZOA 2VVFA 4K20A 2JIJA 2ZACA 1SPPB 1OUSA 4NOTA 2RS51 5C4WB 1VAMA 5JDBA 1MS5A 5ABJC 4LBNA 4A45A 2VVDA 4Z82A 4OQ8A 5EYXA 4PHZA 1VBC2 4Q4W3 2X09A 3PL0A 3KV6A 3ZYBA 1W8HA 1US3A 2OQ6A 3TN93 4DB5A 3F95A 1UU4A 3BU7A 4AVCA 5F5QA 1C1LA 2WZR2 2Y26A 1I1EA 4LUKA 2A73B 4QU1A 5FO7B 1C5HA 4OHYA 3N9NA 3WD5A 1LRHA 2B46X 5JIUA 2XGXA 3ZN5A 3W59A 1YQ2A 1OMIA 4FI9A 4IGOA 5F8PA 3N36A 4QQPA 2VL4A 2DCKA 2HEWF 3POSA 1AVBA 1AYM2 5FKBA 4OUMA 1OT5A 4CCMA 1OA4A 4L2NA 2VZUA 3PVNA 5FYTA 3ZDVA 2VGDA 2BNMA 2ORXA 2HWD2 3WINE 4BOWA 2PHUA 2I07B 3PJYA 4W4ZA 3GBGA 1CN1A 1F31A 1PVC1 1HJGA 2WO2A 4Q4Y3 4QKFA 4QX5A 1RUG2 1PMJX 5FZ8A 2HYKA 3RI8A 5KHJA 2PHTA 5FY8A 2TEPA 4SLIA 4WVMA 3AVSA 2VCAA 3WSOA 1ZX5A 3CNAA 2DVAA 3VBHC 4GQ7A 2XWJB 1BBT2 4QDSA 3O1VA 1PIV2 2ET1A 3IBMA 1NY72 5L7OA 1HDKA 5BNOB 5FQ0B 4IDZA 1T6BX 1LECA 3GZTB 4CCLA 4XF0A 1HRV3 2P3KA 2XLFA 3QH7A 4EN6B 5A6XA 5ANNA 1IKQA 2KXLA 2XOMA 4GD4A 3JQWA 5BY5A 4XJ8A 4JKMA 3P6BA 2A70A 1O3QA 4JDOA 1AJKA 1N3PA 4QT6A 3IT8A 1OLRA 1O8SA 2JKBA 5KWRA 2E7AA 2VCBA 4NR1A 1G86A 5BV6A 2TBVA 4QDQA 1UCXA 4ZS2A 4FP2A 1PM4A 4LBLA 3VLBB 4EN9B 3POIA 5K8SA 2ZEZA 3M3OA 4GIQA 1W9YA 1DYKA 1CAVA 1ZZ7A 5ACA3 3JB8A 4MGZE 1SEFA 3WNPA 5FY5A 4PCRA 4D3WA 1HRI3 1NCQA 1R1A2 4XFFA 3WF3A 1NA1A 3CQOA 3SH4A 5CA6A 2Z4FA 5IVFA 1HXS1 1KDMA 5JZGB 5LA1A 2XG3A 3PMEA 1NXD1 3ACFA 4G3YC 2OPWA 1W8NA 2XONA 4YW5A 1I6XA 2XBO1 1BK1A 2PTMA 1PO23 5E89A 4FPKA 1TG7A 3H1WA 2XVGA 4QPGA 2PQQA 2F17A 2VOWA 1JZ7A 1W2AX 2RE9A 4LHLA 4Z2WA 4LITA 3WF0A 3ZFFA 4Q4W2 1DQ4A 1V70A 3HQRA 4QGNA 3WDTA 3ZFEB 4CEYB 1O59A 3G7DA 3MW3A 5DUVA 3S5QA 2P6HA 3TN92 3WT3A 2JG8B 2WWJA 1JHJA 5DAXA 2TUNA 2DCJA 1XYOA 4Q2FA 4UXAA 3UJQA 3SH5A 3LOIA 3E6CC 4UAPA 4ZU7A 2ZEYA 3ACHA 3GXUA 4AGVA 2WDBA 2YHJA 3OJBA 4JKLA 2FDHA 4QPWA 2RMU1 2ZGKA 3A4UA 5EYYA 2WN2A 2ZX3A 3A0NA 1NZIA 3N9MA 1WBFA 3Q8BA 1C57A 1XJAA 2WAOA 2C4XA 1PNGA 4CRQA 1HV1A 2VQUA 3ZLIA 1M4WA 1R093 5EV7A 1ZYBA 4E8CA 5CFCC 4RSUA 4LORA 2R062 4CU7A 1MS9A 4Q4Y2 4ES8A 3LSEA 5J3UA 3AYAA 3PDQA 2XHKA 4COUA 5CFCA 1S0DA 4XAAA 4YVSA 2WNVB 4FP3A 2D3SA 4HKWA 1NG0A 1K5MC 1W99A 4LPLA 2JG9A 3A22A 1YWKA 1CR7A 4OHVA 1ZREA 4RGAA 4BHPA 3VN4A 4MGIE 3VBOC 1LOEA 3THTA 4CDUB 4FTBA 2VVEA 4WZCA 4CPBA 3TEYA 4HN1A 2XUMA 2GZWA 2FDIA 2YFZA 4NAMA 1ZZ8A 5FYHA 3L9JT 3LA2A 1K12A 1ZZ9A 2OVUA 4IV1C 2X8KA 3RSJA 4ONUA 2XHNA 4BXSV 4TWTA 4XHBA 3VDDB 5IK5A 1EP0A 5LBBA 1GNYA 4QB2A 3MYXA 3V0BA 2JDNA 1LAJA 1JN2P 1N3OA 2JE9A 1RUF3 1VBA3 2JDZA 1UNBA 2ARBA 2NM1A 3LEKA 5ACA2 1UX7A 3VHPA 4ATFA 3VGIA 4YFZA 2ARCA 1ZVFA 4XILA 5H9QA 1HRI2 2RDRA 5FMOL 1DQ1A 1DGRA 1NQJA 2ADEA 2GSYA 1LHUA 2XL7A 5F6LB 1UMZA 1OKQA 4AVTA 2BNNA 3KZ4C 5T50A 4E8DA 4F7ZA 5FZEA 2V72A 3USSA 1WMEA 4YSFA 2CGNA 2Q4SA 3O14A 2JE7A 2VC9A 4R4ZA 2EALA 2WWUA 2JD9A 4YVWA 1ULCA 2VJXA 1W8FA 3NNGA 5J7MA 4XXAA 5FBZA 3EYPA 1MQTC 4MYEA 4R4XA 2VXRA 4EN7B 1JS9A 4J25A 1S4CA 1YJKA 3PUSA 4K3UA 4M00A 4LKDA 5LB6A 4XUTA 4Y1VA 5JPNB 3SEPA 1ODMA 1MZ6A 4CDQC 3JUUA 5FP7A 4UW6A 5A7WA 4NHKA 1X36A 1MACA 3LEMA 3T4VA 1TEIA 2XJQA 2A5ZA 2G4IA 4BQ1A 5C3QA 1WW7A 2ZGOA 1AYN3 1FMD1 4GWNA 4XETA 1QMJA 2Q8CA 4GMP0 4IESA 4NIDA 2BPA2 3IIAA 2EXJA 5KHHA 4CDXB 3LA3A 1YCIA 2D3PA 5B2GB 1Q43A 1QQP3 3PTYA 4D6RA 2OUHA 4AEMA 2EIEA 1T2XA 2IUWA 1TME1 3AZWA 3OBZA 2ZEWA 4KMQA 1R092 2FDFA 3LFIA 1WCSA 2GNMA 2YYOA 4RHV1 1ZBA1 2W3JA 4MSVA 1PK6A 3NJVA 1COV3 5KHGA 3I3DA 4XJZA 1J3PA 3LD8A 4FFHA 1AHSA 5K7PA 4WVWA 1AL0G 5KC5A 4FOVA 3DYPA 4QAWA 4LTAA 3WG4A 5I0UA 3VBUC 3ES1A 5LA2A 1FXZA 1CAXA 4GKYA 3T2QA 4LO5B 5G04L 1CWPA 4E2GA 4LLFA 5T5PA 2BOIA 1ZM1A 3LGRA 3CIHA 1MEC1 3CEWA 3FLPA 3OBTA 4LBOA 3MBWA 1NLRA 1MS3A 3IPVB 4KBBA 5HCAA 4TZDA 1KFXL 3FWEA 3B9IA 5D8AC 2DWRA 4CCDA 4IE6A 4YW6A 1ZRFA 2Q30A 4BU2A 1FATA 2WNUC 1GP6A 1RUF2 1VBA2 1KFUL 4YG0A 4V2WA 4EJRA 1QJEA 2W0XA 3WUCA 1VRH3 2QTWB 3V0AB 1RVF3 1RUD1 5FRAA 1BEV3 1V00A 2ZX1A 2B42B 3AYCA 1UU5A 3ME2A 4ORFA 3KB5A 4Q26A 5F1RA 1ND2A 3BPZA 3JZVA 1BVVA 1QWRA 1DQ5A 2WFPA 2AYHA 2ERFA 3NAPB 5CFDB 4BM8A 3LIHA 2OT7A 3FLTA 4UW3A 2WR9A 2J1TA 3O12A 4O61A 4RGGA 2D6OX 3AP5A 4RR3C 4EN0A 2C5DA 4P14A 3DF0A 3GYDA 3T08A 1V9U1 1A8DA 5JAXA 4WM8B 3GJAA 1OVPA 4Z07A 2VMHA 3OGSA 1W8TA 5FYUA 3WX5A 2ZKNA 3WUDA 2VM9A 2R0FA 3BCWA 1E57A 3ZYPA 2QZ3A 1WLTA 4CCKA 3EMRA 1VE0A 1DCSA 3USUA 4R8HA 3AKRA 2DTYA 2ZTNA 4XIKA 4YPJA 4DS0A 1V6OA 1FI2A 3W9AA 3MO4A 4GB31 1AYN2 5F7UA 4CEWB 3GNEA 4Y20B 4MGSA 2SLIA 3BN6A 4BXFA 3POEA 4HVOA 2J1RA 4RFRB 3KSCA 3V65A 5BNNB 3ZXFA 5GLWA 2JDMA 4LUMA 1QQP2 4XJWA 1H4HA 2R071 4AYUA 1OLMA 1R64A 1W0PA 4FO9A 4YZ2A 2WJSA 1X33A 4HK8A 5EJZB 3UGGA 1D7PM 1POV1 3AL5A 4BK4A 2NMOA 1OQEA 4CU6A 2LALA 2W46A 1COV2 1V6LA 4AG4A 2Q8DA 4OUSA 3BTXA 2E6VA 3DPRA 4COZA 1GP4A 1JMUB 1LESA 5KBFA 1HB3A 3I3EA 4AL9A 1UOBA 2AENA 4AEDC 4ZHNA 2CSGA 2P2KA 1EY2A 2KA3A 5FMDA 2Q8EA 4OHZA 3D82A 3RGBA 5HXMA 2BJSA 1T6GC 4ES9A 1VBB3 3MF6A 4MXWA 1AJOA 4YW2A 4QX8A 4UFKA 4OLLA 1ZNPA 1UZZA 1CZVA 1OPMA 3R4DB 4Q4X1 4UBGA 5KC6A 3KQRA 1F5JA 4BQ2A 3VBRB 4G4FA 4KG8A 4MGQA 3ORJA 5HPOA 2W68A 4HLTA 4YM0A 3OUHA 5LK5A 1R1ZA 1RIRA 3GGLA 1YQ5A 3EQEA 1S2KA 1Q8VA 2P6CA 4ARYA 1QDCA 4WV8A 2VMEA 2W9XA 4Q29A 5J09A 5IFTA 4YM1A 4OHWA 3ZSMA 1UIKA 1VRH2 5CZKA 3CJIA 2PLV1 2W95A 1RVF2 4A3XA 2BYVE 2PAMA 1BEV2 5D2AA 5GJ6A 4LA3A 1OQ1A 1VJ2A 2Y8KA 4S2FA 5E16A 4H3WA 4DRVA 4TTGA 1OLME 3M2MA 2DURA 5A7QA 3FUOA 4JQRA 3FUQA 3N3HA 1UXZA 4DY3A 1S55A 1Q8QA 2ZGLA 4HVRA 1GSLA 1UPIA 1NE4A 3FJSA 1MR5A 4N53C 1LGBA 2XXZA 1S0BA 2RJKA 4NPLA 4B7EA 5CG9A 1QXPA 4XQDA 4MOAA 3FFQA 1UN1A 4XXPA 4Y1UA 1DLLA 2HYXA 5F32A 3RWKX 3LEGA 3J7MA 1W3XA 3K4DA 1YYNA 4LBMA 5FYZA 4N53A 2W2IA 4M0NA 4JX0A 3RMYA 1CJPA 3M3QA 4I01A 1NQDA 5IWFA 2OS2A 3ELNA 3R4SA 1OFSA 2RJLA 3LFMA 3AJYA 3AZZA 1DG6A 1W6PA 3IDBB 5FY7A 3WNMA 1OQDA 3TRSB 1W6QA 3ZOIA 2W5FA 2B39A 4QXCA 5LY2A 5AFEA 4NIGA 3I54A 2ES3A 2IXHA 2VZQA 3OPZA 1H8TB 4YLZA 2B9VA 1MZ5A 5C9AA 4COYA 1VRBA 4P9XA 1YQ6A 3DXUA 1V6MA 4FAHA 1W2NA 2I74A 1ASJ3 4LHSA 4LA2A 5C8CA 2TNFA 4I30A 3HOBA 5A7SA 4DO0A 2VBPA 2WC2A 3PVEA 3DCQA 4EZ4A 5A70A 5J1XA 1H6YA 3DXTA 2X5IB 1J58A 1AL23 3D6EA 5FLIA 1G7YA 4D7TA 3VBFB 3SKVA 2A3XA 2Y33A 1LOFA 2OXBA 3VKFC 1WD3A 1UWWA 1CPMA 1YFXA 3LEIA 3SEEA 5AC93 4P08A 5LATA 4HSJA 4N43C 4AI9A 3IDEA 1RTVA 2WUHA 3BVCA 2BWAA 2A75A 4YGEA 5F3GA 4GJYA 1VBB2 1UL9A 4N43A 4UFHA 3CZJA 3OGVA 4AAXA 1UPSA 5IK4A 1LU2A 2W94A 1A8MA 1NXMA 1US2A 5FAXA 4DXSA 1BLZA 3EBRA 3POWA 5LRSA 3KGZA 4EQVA 3THDA 2HWF1 1VBC1 2JKXA 1JZ6A 1YI9A 4GXLA 2E33A 1OH3A 4M3CE 5JXJA 1K45A 4DNYA 5T52A 1U12A 1W2OA 2VR4A 2XJTA 4MHUA 3I2JA 4RQPA 1SDWA 2WZR1 3WNKA 2DCYA 4E4SA 5DABA 1ULDA 1REFA 2GC3A 3WP4A 2JENA 4Y22B 3Q8CA 2V09A 1H2KA 5FJHA 5BNPC 5K0UB 1UW8A 4BQ5A 1HKDA 4IEWA 3UL2A 5FYBA 5HCBA 1W8UA 3WEZA 4FT8A 2VPVA 4I0AA 1LENA 1OD5A 1UKGA 2ILMA 4XHXA 4RS5A 1AYM1 3ZSKA 3ETPA 2BQPA 4FSJA 4JGZC 3WNNA 4CUGA 5IT6A 3ABZA 1GLHA 1AR63 3LOBA 2VCCA 5CAZA 4LXLA 4YG3A 2HWD1 4RL7A 2VUAA 2XR4A 4JGZA 2JDPA 4IV3B 2X53S 2RM23 1RUG1 4KWJA 1XNKA 1GZWB 3KVBA 4FPOB 4C91A 3T1MA 2DU0A 4DY5A 3K4AA 4P02B 4NRMA 4IETA 2QFEA 2EIDA 1BBT1 2P37A 1PIV1 2ZJCA 1NY71 3PMSA 4CU8A 4XJAA 2WSVA 1WKYA 1S2BA 3PUHA 4JHTA 2QQKA 1CX4A 1IS5A 3ZN6B 1K3IA 3EJKA 1H2MA 1PX3A 2BTVC 1EV13 3OUJA 1PMHX 1HJFA 4K1ZA 5FMOS 4GULA 2W1QA 3KQ4B 4COVA 1ASJ2 2G9ZA 2ZZJA 4NAOA 4LT5A 1MVEA 3I3QA 3MIEA 1SBDA 4K21A 2GN7A 4XFGA 3ZXAC 1HN1A 1PO13 1AL22 1DYOA 2ZS6B 4LO6B 1QKQA 3MHZA 4FPCA 1OOPB 1GR3A 1HQWA 3RNSA 3VZNA 3WW4A 4AI2A 1DDLA 1XQNA 3ILFA 1OC1A 4QGMA 3SCFA 1JUHA 3DYOA 1IS3A 4H2AA 4Y33A 5F5IA 5AC92 3T0DA 3S6PA 3NV2A 2UU8A 3MW2A 3NL1A 5A33A 1QJX3 1R1A1 4L99A 1QHDA 1BZWA 2WA4A 1F4AA 1KXGA 1ACCA 4FXGB 1UQXA 1B35A 1CAWB 2J1EA 1RUI3 3HNMA 3FL7A 4H14A 4RGKA 2XJSA 3POBA 5FYCA 3ZKUA 5JOYA 4AHZA 3RZMA 1QY4A 3WCSA 3ZKYA 3P1IA 2BGPA 1W0NA 1IG0A 3ZXJA 3VBSA 5A3UA 3S0MA 5F5CA 3RRDA 5FP4A 4UFJA 1XE8A 2A6ZA 4AFAA 2VTFA 2ZGRA 4Q4W1 4DEVA 1JZ3A 3H8UA 2B45X 3B69A 2YXSA 2PHDA 1F35A 1KS4A 3RVHA 3I2FA 3TN91 2W1WA 1LGNA 4N90A 5TSWA 1DBNA 3MIDA 4ZXEA 2WBKA 3A7QA 3VKOA 1J3QA 2QQMA 4HXCA 3DEMA 3SLIA 4K1YA 4CCEA 4URAA 5FYIA 1UMIA 1VAKA 3MGUA 1SG3A 1XNAA 3SH3A 1AUYA 3RS6A 5CNAA 1F4HA 4Y1ZA 2RHPA 4WM7A 1C1FA 4UI9L 3FHIB 3PIJA 2D5FA 2QQJA 3M4FA 2O8QA 4BE3A 2OIIA 4Z92B 1L7RA 1LOCA 3MUZ1 1AR62 2NLRA 2A3WA 2EXHA 3SHRA 2OKXA 4JQTA 4BIFA 4Q4Y1 1S0EA 2VH9A 1CZTA 2K46A 1G8WA 2RM22 3O0VA 2ZHNA 5LZ6A 4CZSA 2FBEA 3ETQA 5JMOA 3NV4A 2OX0A 2ZOEB 2CAUA 3EHKA 4KL1A 4GH4A 1QJY3 2XUEA 4XUPA 1NCRC 2HLEA 4QQ2A 3BIEA 4HPKB 4BPZA 5ISLA 5JSOA 1ND3B 3KWVA 2ZPXA 1V6JA 2Y6LA 3SMHA 3W21A 5C4WC 1HRV1 4CXYA 5EJ3A 1SFYA 3T3YA 1EV12 5GZGA 1UZ0A 1V6KA 2XL9A 5IFPA 2GALA 3O1RA 1UZVA 3HBZA 4LBQD 4P5HA 4XACA 3T4HB 2Y6FA 3WQ0A 5DUUA 4D6QA 4M4PA 5BNQA 4CXXA 2V5YA 1KQRA 1PO12 3RQ0A 2WRAA 1LEDA 1VBD3 4M01A 3ZMOA 2VD7A 4BLIA 3PU3A 3T30A 1SLCA 3M70A 4OULA 3WOGA 4UF0A 2JDAA 4JHZA 5FWJA 5ACA1 2PAKA 1XSRA 3IN9A 4LOSA 4AQTA 1W8ZA 1CD3G 3CLPA 5CIRA 1HRI1 1QJX2 4PDWC 2HKXA 3PNAA 5FTTC 3AC0A 3CO2A 4QPIB 2MPFA 4NWWA 1S2EA 3J7LA 1RUI2 2NN8A 5C71A 1BMV2 5ABJA 4PDWA 4IEPA 4QX2A 1PO21 3GZEA 5A32B 2ZX2A 5DN2A 1H2NA 4OHXA 3UKVA 2BBAA 2QNKA 2V73A 1GP5A 2R16A 2W87A 4LBQB 4Q0PA 3K48A 5CVRA 3O1TA 5C7GA 3T2OA 4YGDA 1LOBA 5I8TA 1J84A 1CAUA 1Z7S3 1ENXA 4LQRA 1PGL2 2QDRA 2QQIA 1J83A 1QH6A 4Q0SA 1YIPA 1KEXA 3OD0A 4JGYB 1Y4WA 1DQ0A 3SXWA 2E51A 2MHFA 4WVZA 4NHYA 4XZPA 4YWAA 5FPZA 1LOAA 4LBKA 4FOQA 1O5UA 1SCRA 5EZWA 2R063 4N7IA 5FZBA 5I0TA 4CU9A 2JECA 2R0HA 4JAAA 2DUOA 2JIGA 4LR4A 4D7SA 2BZDA 4GALA 1ULOA 2LM3A 1RMU3 2WL1A 3DUIA 4XIOA 3K46A 3ZN4A 2G1MA 2PMWB 3HNYM 4P9IA 1H0BA 1WWYA 2GC2A 4KI5M 1O91A 1ULEA 4PLMA 5FCCA 5J98B 3RPQA 3DECA 1WCKA 4E2QA 1R091 1GYKA 1GMMA 3WDUA 1KRIA 3VBHA 5F3EA 1UOFA 1QEXA 4GAZA 1FV3A 1H6XA 2WABA 3WP6A 3HQUA 1WMFA 4FFGA 3ACLA 4O65A 2ZCWA 3KF5A 1OBNA 2JB4A 4PJYA 4TSVA 4A6OA 3W5NA 1OF4A 3RI9A 1QJY2 3C3VA 4MGKE 1HB2A 4YYOA 1FNYA 3M3IA 4CSWA 4HKOA 3N7LA 5IVVA 5J36A 4AVBA 5L9VA 1D4M3 4PT6A 1LODA 1GOHA 4EROA 1S1AA 3U4SA 4W8JA 3ZSJA 4AEKA 2NPIA 3J7NA 3GDBA 1PZ9A 4PBPA 3ZFEC 1WCDJ 4CEYC 3IAPA 4IE0A 2WQ8A 4AE2A 1GZTA 2GP5A 1JYNA 1JOJA 5FZKA 4AFBA 3AKPA 3OY8B 2PN5A 4WVMB 2JG8C 2EVXA 1V6NA 3WW1A 1VBD2 2YGLA 5L7OB 3FBYA 1SCSA 2D6MA 2CTVA 1RUF1 2I2SA 1VBA1 3AP6A 1YQCA 4NHLA 5LEJA 2UYBA 4QM9A 1WA6X
chains in the Genus database with same CATH topology
1IZ3A 2YY1A 4JRLA 1QOSA 4E4DX 4DZGA 5GLVA 3D4KA 4FOWA 3WNXA 4S2GA 3N4MA 1FPN3 1BJQA 4UW4A 2EAAA 2YDEA 3WLUA 3PVBB 4XBNA 1JYIA 2LTNA 4INDA 1CAVB 2WNVC 2A6XA 4URTA 4F8AA 2D6KA 3TBDA 2C0ZA 4XFHA 1NCQB 1Z7S2 2DYCA 1NA1B 3B00A 3ZVXA 3QLQA 4MVTA 3WP5A 3MF9A 4CDUC 4ITCA 1XRUA 3RWNA 2WWSA 3IMNA 1VB4A 1AYN1 4ASLA 5F6KA 3AP7A 3J26N 1AXYA 1J1TA 3MFCA 4QPGB 3LAGA 3V56A 1MS1A 3VDDC 3ZFFB 1RMU2 5JI9A 3HQXA 1QQP1 5EFUA 3RYPA 4FPEA 4DMIA 1FAYA 1S0JA 2LUWA 4Q0UA 3NVCA 4UBHA 3RJ2X 3HMYA 2K2SA 2WKKA 4YGCA 1K5MA 1COV1 4W6WA 1AX0A 3MLLA 4Q0VA 3BOWA 3VBOA 1HW5A 2EAKA 4QQOA 2XB6C 3VL9A 3KMHA 4Q1RA 3UV9A 4IV1A 2JD4A 1D4M2 1DZTA 1MS8A 1QGLA 2ET7A 4HSLA 1LKNA 3HT1A 5J96B 1C8M3 2D6LX 4YVSB 4LLOA 2N7GA 1LR5A 3VZJA 2UWBA 1CVNA 1VR3A 3G6JB 5GKAC 2OW4A 3WQ7A 2JG9B 5JWPA 1U5ZA 1GZ9A 2VY0A 2ZMNA 1ENRA 2Y0OA 3UJOA 3ES4A 1VRH1 2ZX0A 1RVF1 4CDXC 1BEV1 5J37A 1NOVA 2YUEA 3ZO0B 1DZRA 3BODA 3MI8A 1JH5A 1PGW2 1MQTA 5HI0A 3B9CA 1FOD3 4IQPA 1OHFA 2IXCA 3NW4A 4IEXA 4PQ9A 1FPN2 4WVVA 4D7YA 5DG1A 3V0BB 4CDQA 4XPVA 3WHUA 1UKRA 2HWE1 3B3QE 4BIOA 3AXEA 4YARA 1PHMA 3VZOA 3OD4A 1Q3EA 4J1XA 4YM3A 2O1QA 4L92A 1H9WA 2IXKA 3TWIA 4W6YA 2NQYA 4YRDA 1I9RA 4EWAA 3NJZA 1AX1A 1XXNA 1U5IA 1RUJ3 4LO7A 2EA7A 4DFSA 4HN0A 5CG8A 2CAVA 4YVWB 4YW1A 1Y7BA 3SCHA 2VOXA 1AR73 5JPMB 1YHFA 1DIWA 4AGGA 3I4IA 2DTWA 1BQPA 4PIYA 1OA3A 2CL2A 4XF1A 4P9GA 4FXKB 1FT9A 3DN7A 4N9HA 5FLJA 4J6GA 1XYNA 1U5YA 1ZRDA 3ZXKA 1GQGA 3R6SA 3MLKA 3UKTA 3VBUA 1CONA 1VBE3 5C6CA 1QJU3 3GBFA 3NAPC 5CFDC 1DGWA 4AHYA 5I0RA 4Y1YA 2H6CA 4FTSA 2H0VA 4I3GA 1AR91 5CBLA 3OYWA 4FCAA 4IEOA 4F3JA 1VBB1 4WM8C 4Z8BA 5D8AA 2RS33 2CV6A 5CADA 4CTEA 2FMDA 1PK6B 1G9DA 1QXRA 1SLBA 2WNUA 3S7EA 2ZAAA 1C8M2 2YV8A 1NYWA 2GC1A 4LHNA 4LBJA 5BYNA 4CEWC 1CAXB 2ZHKA 1Q56A 1RUNA 1W6OB 3ZIXA 1YO8A 3D5OA 5BNNC 3E6BA 4Q4V3 2KM2A 2WSUA 1WGPA 2QCSB 4RR3A 2ZAHA 3ZYIB 4GMP3 4HZFA 1VP6A 3MPPG 1FOD2 1YI7A 2A6VA 4R9CA 3AFGA 5FOBB 1HQLA 1KDKA 3AM2A 1TNRA 3P3NA 2UURA 4NVPA 4H7MA 3P3PA 5T5LA 4YZ3A 3KD4A 1JTZX 3OGGA 4HFSA 5DUWA 1VALA 1G9BA 3MIFA 2QKDA 4SBVA 1ND2B 3BIWE 1S0CA 5DG2A 3NV3A 5AVPA 5E88A 1RUJ2 2ZMLA 3H7JA 3GHMA 1AR72 3VBRC 4S2HA 3M1HA 3OTFA 4AI1A 5C33A 3SITA 1ASJ1 1A6CA 3ENRA 3IDCB 3VBRA 3JD71 3MIHA 3POYA 1MS0A 3USUB 1AL21 4AEDA 1POV0 4A2UA 1ENSA 1VBE2 3ZYGA 1QJU2 1RJ8A 1ONAA 3WP3A 1IPKA 3FZ3A 5AC91 2QZ2A 3GZAA 2R1BA 2FZ1A 2CWSA 3ZSLA 1X82A 3AB0A 3M3EA 2FZ2A 4FPJA 4XFBA 2RS32 3DGTA 1PZ8A 2G9GA 1O7FA 1U0AA 2F6BA 4CP2A 5J48A 3DPRB 1KITA 3CL1A 4KGQA 5KXEA 2H6BA 2Z79A 2JEMA 3WZ1A 4AGRA 2F4PA 2G9FA 4R9DA 1O4TA 4X8PA 1H8TC 1G9FA 1V6IA 3RZZA 4MXWB 5JOZA 4WZFA 1J59A 3WQ1A 4CDWB 4XMIA 2D6NA 2ATFA 1O3TA 4Q4V2 3J8F3 4D69A 4JDMA 3QD6A 2OYZA 2GC0A 1QNWA 2JJ6A 1Q8OA 2RS13 3A0KA 2W08A 3OCPA 4B4QA 2PHWA 4Q8LA 1FV2A 4AEJA 4BZ4A 3VBFC 3NV1A 4M3CA 5BPXA 5DDJ3 1WMDA 3FBMA 1SLTA 1AR61 2GDFA 1I5ZA 5H9PA 2WFF3 2SBAA 3CJIB 2XPJA 2XKOA 3IWZA 3AKQA 3VZMA 1REEA 2BUKA 3PHMA 5HCFA 5L73A 4AK3A 1DYPA 4K7JA 1N3QA 1YUDA 4MV2A 4BYYA 1W39A 3FC0A 1MZEA 4LE3A 2QDNA 4QMAA 5DZFA 4H55A 1S0FA 2Q1ZB 1LHOA 5IUQA 4QXKA 1H9PA 1AR83 3T1LA 1C4RA 3V64A 4N53B 3QH6A 1EV11 5T5JA 1HQNA 2YGMA 4A7ZA 3VZKA 1N1VA 5I8SA 1TMF3 1YFUA 1W6PB 1GFF2 3ST7A 1J1LA 2MNGA 1W6QB 1PO11 4ZXKA 1LGCA 3W58A 2IXJA 3AMPA 1ZBE3 3ZSEA 2X29A 5K0UC 2R1DA 2HJIA 5C9AB 3MEPA 2WS93 3JBG3 5LK7B 1QJX1 2D6PA 4K6BA 3KS7A 5C8CB 2D93A 2GMPA 3EXUA 1RUI1 1BMV1 4B4PA 2A6YA 4GWMA 1CESA 4B7KA 3INAA 2HWC3 2WQZC 4IV3C 3KT1A 5C8WA 1KJRA 1DF0A 1XNDA 1LU1A 1EPZA 1YLLA 5EWSA 2OZ6A 1PGL1 5BNPA 3AYDA 4C1XA 2XLAA 1BCXA 4IERA 3E6DA 5HXVA 2ZZQA 4EV0A 1N1TA 4LE4A 3WDYA 1LB2A 3J8F2 3AMNA 1PM7A 3J9SA 1JW6A 2EF6A 2RS12 4K9SA 3WW3A 1D2SA 3E97A 3MLJA 1SBEA 2WZPP 4FBFA 1BYHA 4N7UA 1OOPC 3AXDA 1FNZA 4N9IA 1RUOA 4COWA 3PVOA 1FYUA 2QUOA 5DDJ2 2D40A 2ZKLA 4RQPB 1PZ7A 5DUXA 2WFF2 1I3HA 1OOPA 4I3PA 1GNHA 3AYEA 2D3RA 1XYPA 4R9AA 5DZEA 1O3RA 2ZGSA 4M3CF 1SACA 2ZGUA 1QDOA 1RB8G 1M06G 1ZZBA 4HBNA 2PA7A 3ZXDA 4BA6A 2BEOA 1QJY1 1OSGA 2IFWA 2WT2A 2Z2SB 4RS5B 4E2SA 3R0RA 1ZA4A 3N35A 3URFA 3OF1A 4XFAA 3IM0A 1AR82 5FLHA 4R9BA 1O3SA 3NKGA 3SNMA 5BUVA 4FVVA 4YZ4A 4BCUA 5JLVA 2GMEA 3I59A 2Z69A 3JU9A 4L9BA 4YW3A 2ZGQA 1TMF2 4HMZA 1H30A 4MH0E 1H1IA 1LHNA 1VBD1 4AHXA 1ZBE2 2CNAA 1RUC3 5GALA 3S7IA 2VECA 1LJ7A 1YFWA 1IS6A 3MZHA 2WS92 3JBG2 1RITA 1SMVA 2VNOA 4XJ9A 4Q27A 4XDQA 1SLLA 1U5XA 3AZYA 4LO4B 3HN1A 5AVAA 1A78A 3O0XA 4M0HA 2WA3A 1RC6A 2HWC2 3MFAA 1RUH3 3N7KA 4JDNA 4QQLA 3OGJA 4OI4A 4BLJA 4Z1VA 3FLRA 3ECQA 1OFNA 1C8NA 1Z7S1 2XJUA 5A33B 4PIZA 3N7JA 1ND3C 4AQ2A 4C1WA 1B35B 2FHRA 2ZGNA 4NN0A 4IEQA 4AXOA 4AVAA 3CU7A 4W65A 1QH7A 1W6NA 2JICA 4KWKA 1RGSA 2E53A 2R061 3VBSB 4OFGA 5DXDA 1YJLA 4FAGA 1RMU1 5T3NA 1OLQA 2YPJA 2IFRA 4FQ4A 4BWOA 4MGYE 2Q8OA 2RR13 4I02A 1GANA 2CYFA 3KCXA 3AMQA 4FPHA 3T2TA 3VKLA 5LRRA 2I45A 4W6XA 1NCRA 3OBRA 1X8EA 1N47A 2PHRA 1GKBA 4QPIC 4B3NA 1HLCA 1AZDA 4I0BA 5C4WA 5F9TA 3VHRA 1DFQA 4WM7B 1JBCA 1EAH3 1YIFA 2IZWA 4AI8A 2DFBA 4YNIA 3KT7A 1D4M1 2CY6A 1W6MB 1CIWA 2UWCA 1C28A 4CP0A 3O7OA 2MEV3 4B29A 3B01A 3QCWA 4AVVA 4L8QA 1R083 3HR9A 5GM0A 1CQ9A 1RUE3 4JGYC 5GLUA 5GZFA 4GH4B 2XJVA 5E1RA 4NPRA 3QACA 1DGWX 1UZYA 5L19A 4XF3A 3ZFGB 5KXCA 1RUC2 3VV1A 3U4XA 4META 3WG1A 2ZGTA 4XBLA 1UIJA 3LCPA 3IKWA 3BALA 2FMYA 4FQZA 2WNEA 2R043 1PGW1 1RHI3 3LSDA 5HBAA 5BNOC 1F8VA 2HWF2 3I8TA 2YZ4A 1FPN1 4XJUA 4QU2A 3X29B 2B5HA 1RUH2 5BNOA 5FQ0A 4MUVA 4RD7A 1JUIA 2HWB3 1FX5A 3ZYRA 1MZFA 2DUQA 2E7QA 4PF5A 2Z5WA 2BWCA 4FPGA 3QBQA 4ISRA 5AFBA 4KU8A 5IK7A 5ABJB 4H7LA 4BH9A 4PDWB 3THPA 3MPBA 1DGRN 2XVKA 1H4GA 4X6RB 1WD4A 5JZGC 3E5UA 5GZEA 3AFKA 1UAIA 2IXLA 1AXKA 4CP1A 2VNRA 2ZABA 1CAUB 3ZDSA 3S30A 5L7OC 4GA9A 2RR12 4E9KA 1C5IA 5JZGA 3OY8A 4DXZA 3O0WA 4YZ1A 2B7YA 3VUOA 3C2UA 4DQAA 5JSRA 1D0GA 2DFCA 2D7FA 3H0OA 2GH8A 1Z78A 1PVXA 1NLSA 1EAH2 1X50A 2GMMA 3ZFEA 4CEYA 3MIGA 1RL3A 3AJZA 3ILRA 3L2HA 5KXDA 4JCKA 1H2LA 3ZMNA 2BFUL 2JG8A 2MEV2 1PGSA 3VBHB 1GNZA 1LTEA 1TE1B 1NCQC 1R082 1NA1C 1C8M1 2PYTA 3DKWA 1RUE2 2IWGB 1DQ6A 2GNDA 2RS53 2DV9A 2DUPA 3KLSA 4X6QB 2BVBA 2UYAA 5GLZA 2GAUA 3ASIA 3ZX7A 4BMBA 3HAGA 2R32A 4QPGC 4AI0A 3WW2A 2H0BA 4NWVA 4AF9A 1YRZA 3ZXGA 2VOVA 3ZFFC 4FOYA 2WLQA 2JXAA 3H3ZA 2R042 1RHI2 1BXHA 1FOD1 3NKTA 2WNVA 3APBA 1EPWA 1H8VA 2EXIA 4IL7A 5T5OA 4XQWA 2NMNA 4K8FA 1RINA 2QJVA 2A71A 2HEYF 4Q0QA 3ZIWA 2D98A 4CDUA 1GZCA 2HWB2 4GKXA 5H9RA 4JV4A 1LEMA 1SBFA 4A7YA 4LHKA 4R52A 3VKMA 1DHKB 1PVC3 4EN8B 3J4UH 4HL0A 1S0IA 4MXVA 2AREA 3PLQA 3VDDA 3SISA 4XFIA 1RUJ1 5SV5A 4MLOA 4U36A 4JVAA 1WBLA 5KXBA 1AR71 2P3IA 4P9JA 4YVSC 1UU6A 2ETEA 1WW4A 2WLPA 5DZGA 2A6WA 2JG9C 4MZUA 1WW5A 4QM8A 1SQ4A 1G9AA 4Y26A 3WXPA 3GALA 2D5HA 1ZRRA 1GQHA 2PELA 4Q8KA 1VBE1 4QD2A 1QJU1 1NE6A 3B93A 1HRV2 4RFT0 5CFCB 1JYCA 2VU9A 3BB6A 4QPYA 4O9EA 1UX6A 3LWCA 1CPNA 3NWKA 3TOJA 1VB2A 4Y4YA 4OZXA 1XNCA 2CGOA 1HXS3 4DPNA 1SFNA 3D8CA 2RS31 4E27A 1K5MB 3KCCA 2XBO3 2ZGMA 3MICA 3JCIA 1WA4A 3TNPB 3VBOB 1X7NA 2RS52 2VW0A 4CDXA 1QJZA 3LB9A 5FDBA 4DRRA 4YVWC 4IV1B 3ZXEA 2QE3A 3VZLA 3GBWA 1PO22 2E7TA 4F83A 4Q4V1 2PFWA 1H1MA 4GMP1 3E5XA 1F5FA 1PMIA 2VUJA 2ZHLA 2CGPA 2RMU3 5CB7A 4C90A 4FTEA 3H7YA 5KHIA 4WBBA 1DQ2A 2AUYA 1URXA 3PJQA 3AP9A 1ZRCA 1PVC2 4Y1XA 5JCTA 1MQTB 2GU9A 3IPVA 3ZYJB 2VMIA 3WDWA 4AVSA 4PIXA 2GNBA 1PK6C 1PNFA 4CDQB 1D0HA 2AZ5A 2E63A 3BTAA 3HT2A 3I7DA 2XWBB 3V0AA 5JVVA 4B4RA 2P3JA 1F2NA 5JMCA 5JOXA 2W52A 1GICA 2DVFA 3B02A 2VNGA 3NAPA 5CFDA 3FFZA 1ZZCA 3KM5A 1Y9QA 1EYBA 2VULA 4AQ6A 2ZMKA 4EWEA 4AFDA 4LNVA 4IEZA 1SLIA 1W6OA 4V1PA 2PHXA 4WM8A 5IK8A 2EIGA 3H1MA 3GZUC 3SCGA 2ARXA 2GNTA 4XOGA 1HXS2 2BW8A 1ALYA 1O5LA 2QVSB 2XBO2 4I09A 3H9AA 3VHOA 1C3HA 3WCRA 4D94A 4XFCA 3H50A 1ND2C 4ZU5A 2VMGA 2Y38A 3VBUB 4Y20A 4CEWA 4HT1T 4IEVA 1JHNA 5D1IA 4ASMB 5BNNA 5LEKA 2VW1A 3B5LB 1VAVA 2GH2A 2ZHMA 3OYWB 3RYRA 5D8AB 4IXLA 2D44A 5JR7B 3CJXA 4KH9A 1WLCA 3WY6A 4KWLA 3J8F1 2HWE3 2WNUB 1FMD3 4XTMA 2RS11 4YM2A 2DF7A 2RMU2 5DDJ1 4PLOA 2XJRA 2WFF1 1TME3 1AF9A 4AW7A 4RHV3 1ZBA3 4QGLA 4RR3B 1F9KA 1QNYA 2NZ9A 2VQ0A 4KU7A 4IEUA 3TAYA 1WUVA 3DPRC 1AR81 3CF6E 3O5SA 3QOPA 4HVQA 3ZXLA 5E8AA 4L11A 5FPXA 1HV0A 1MEC3 2BVVA 2Q1MA 1TMF1 2K9ZA 1XNBA 3GHNA 1TNFA 3ILNA 2EXKA 3FX3A 1OI6A 4CYDA 2P17A 1IHMA 5FFOC 1ZBE1 4CDWC 1AR93 1L3JA 2Z42A 3H1YA 1G9CA 4YFWA 5FO8B 2WS91 3JBG1 5I91A 4CDWA 1HIXA 1RUD3 2W39A 3AZXA 2YROA 4XTPA 2IXIA 2PHFA 2XVLA 4AEDB 3WVJA 5FO9B 3CJIC 2C1FA 2DCZA 1S0GA 2HWC1 3WR0A 3B94A 1H8TA 2OPKA 5BXXA 2D43A 1HX6A 4YG6A 1V9U3 4JTOA 5GZCA 4AFMA 3LKJA 4O9GA 2X5IC 3M8LA 1Y3TA 3UKNA 3AKSA 3RG0A 2BGCA 2QQPA 1N1SA 4JRAA 1LOGA 1QOTA 2E9QA 4IEYA 2AR6A 2O0OA 2X5IA 4RA0A 2B9UA 2VOKA 3VBFA 2HWE2 4GB33 2XKPA 1FMD2 3ZPYA 2RM21 4AWDA 5L36A 4XEZA 2VQAA 2AGSA 4ISQA 1MS4A 4OI1A 3WG3A 2R073 4DOUA 1IOAA 4NO4A 3WG2A 3LZZA 5C9AC 2BFUS 3GF6A 4YZ5A 4S2DA 1DU3D 3K51A 1TME2 1POV3 1QF3A 5KHKA 3RMXA 4LEJA 3AZVA 4RHV2 1ZBA2 3VKNA 4AHWA 1RJ7A 5C8CC 1CJDA 4NHMA 3MW4A 1XU1A 3I2DA 3M3CA 4E4ZA 3B7MA 3JD73 4M3CB 1LOFC 2AH2A 4QHBA 2WT0A 3AP4A 3L2YA 4Q1PA 1KJLA 1NZCA 2C9AA 4LO8A 1YXWA 5I8YA 1MEC2 1LULA 4Q4X3 4Y22A 5K0UA 5T54A 4P9YA 5JOWA 4XF9A 1JXNA 2XH6A 1GBGA 1D4VB 2OUJA 3VHNA 1UF2C 3H3UA 2Q5TA 1AR92 2A3YA 1RUC1 4XF4A 3RDIA 1IQAA 2XJPA 3MIBA 3HWJA 4OI2A 4G9SB 2PLV3 3HD8B 1RUD2 1KD7A 4IV3A 4YGBA 1O4YA 1DZQA 1GZWA 4A7KA 5SV8A 4RQPC 4UW5A 2JX9A 3ALQA 1APNA 4N43B 1QOOA 2R6QA 5JI7A 4B8EA 1RUH1 1MVQA 3KGLA 4YW4A 5JSPA 2WINB 1IGOA 5K9YA 1V9U2 3ZN6A 4OVEA 1IS4A 1N1YA 2ENRA 4RS5C 1QXJA 2HEVF 1AXZA 3U07A 4FPYA 2R30A 2XLGA 3AK0A 1ULGA 4I0WB 3MDPA 1ZZ6A 1WW6A 2PAEA 1VIWB 1CGPA 2DVBA 4DINB 4GB32 1W2UA 4AQSA 3JQXA 3TB0A 4FPLA 2UY9A 1UD1A 2NYYA 1LCLA 4AI3A 4PLNA 5BNPB 2RR11 4FPFA 4Y24A 1YFYA 3WDXA 2R072 2ZGPA 1Q8PA 1CAWA 1OA2A 2DVDA 3NO8A 1DGLA 3KCYA 4JGZB 1GV9A 1LHWA 3U10A 3AX4A 5EXOA 3AMMA 1Y43B 4KNCA 4JTNA 1EAH1 4XMAA 3HIFA 4MX3A 5A3MA 1OPOA 3Q9OA 3JD72 4ZKTB 3ROUA 2ZA9A 2MEV1 1J3RA 1Q8SA 2GN3A 1YNAA 2D97A 2K0GA 4XW3A 1R081 3D0JA 4Q4X2 3RYKA 1RUE1 3U11A 2WIIB 2BNOA 4PBOA 1B35C 4TYSA 4LULA 2DVGA 1Z0HA 2HWF3 1VBC3 4C0BA 2VG9A 5CU1A 3WHTA 3VBSC 3R4UA 1WLWA 4L97A 4X8NA 4XYXA 2WZR3 4HETA 4HANA 4XQ4A 3U0ZA 2VW2A 3I59B 2PLV2 1ULFA 1VLNA 5GLTA 1LHVA 5FREA 2R041 4AFCA 1RHI1