2Y6HA

X-2 l110f cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6hA00
2VC9A 1WCQA 3K77A 2JKXA 3SEPA 1TG7A 1K45A 2J1TA 3NNGA 3SEEA 4KI5M 3IIIA 4CVUA 2DCJA 2ID4A 1GMMA 3K46A 2WN3A 2VMDA 4BJ0A 3VD9A 5JR2A 2C4XA 5G05L 2LW8A 3HN3A 4LPLA 3EB7A 3OBAA 3I2HA 4YPJA 2VQTA 4JHZA 1SDDB 4UAPA 4FI9A 1DLCA 1W99A 1CX1A 3I3EA 2W92A 4CU8A 4D0QA 5I0DA 1UYYA 4A6OA 2Y6GA 4XUTA 1O59A 2J7MA 3UESA 1JZ8A 2QBXA 3A7QA 4M4RA 4TXWA 2J1RA 3IB3A 2VCCA 1K12A 1JZ5A 3F2ZA 1KEXA 4ZZ5A 4W50A 2C9KA 5IFPA 3FHAA 2W47A 3CZJA 1PMHX 3NQHA 1UXZA 1OF3A 1OD3A 2E32A 2Y6KA 3U37A 1SG3A 2EIBA 4ARXA 2C26A 5C70A 2CDPA 3FN9A 3ABZA 3WSOA 4BK5A 4GZ9A 4ET7A 1CZSA 2VZQA 4D8MA 2YG0A 2WO3A 2JD9A 3LE0A 3VD4A 2RV9A 2Y64A 1UY3A 3C8XA 1JZ3A 4XUQA 2L9LA 3WNNA 4BDVB 4QX2A 3K75B 3T0DA 1JI6A 1UXXX 4CUAA 2DCKA 2RVAA 5G04L 3OGSA 4IUGA 2WAAA 2QQJA 4BK4A 3WF3A 3DECA 4XURA 3DYOA 3I2GA 1JZ2A 4P02B 4QDSA 4GWIA 4JKLA 1EUTA 1JYVA 4P5YA 3T08A 1JYNA 4QX3A 1H6XA 5C7GA 1NKGA 4QB2A 5EJ1B 1JZ6A 3CZUA 1HN1A 2V72A 2W1SA 4A3ZA 1P8JA 3IAQA 5IFTA 2VZSA 3LEIA 3K4AA 2VZ1A 3LPGA 4OYUA 1K42A 4DXRA 5C71A 1UYZA 4XUPA 4PQQA 5JXHA 3MV11 2WABA 4HG6B 2EIEA 1NAEA 4L0PA 2W9XA 2XQXA 3HNMA 2V5DA 2B4KA 3WNMA 1F4HA 5JUVA 2VZ3A 5DN2A 3I2KA 4M4PA 4A44A 1UX7A 4MADA 5JMOA 1GUIA 4OMDA 3VDAA 2YB7A 4JKKA 3IAPA 3I3BA 1JYXA 3T2QA 4JX0A 2W3JA 3WNKA 3MUZ1 1XNAA 4CU9A 2QQNA 2EICA 3GDBA 5A1AA 2VMCA 2CDOA 3HNBM 3VDCA 2RJ2A 4DEVA 2DDUA 4QDRA 1H6YA 3W5MA 3HPNA 3I2JA 3OEBA 2KD7A 4OMCA 1BHGA 4XUOA 1SHWB 3I97A 1O8PA 4KMQA 3HJRA 5CYYA 1UMIA 4RYDA 1YQ2A 2VJXA 2VZPA 1W8OA 3BGAA 5B4NA 2WYSA 3NJVA 2BGPA 3THDA 3E1F1 5IHRA 2BGOA 1UMHA 1RYYA 2WUHA 4LKSA 3NRUA 3WF2A 2YC4A 3CQOA 3FHQA 3NJXA 4QPWA 2YFUA 5IYYA 2X09A 1CIYA 3J7HA 4CU6A 4E8DA 3OEAA 1GOHA 5JXIA 1EUUA 2VZUA 3K4ZA 3C7HA 4CUBA 2QQLA 1US3A 2R7EB 3GM8A 4P00B 1J84A 1GNYA 2WAOA 3I3DA 2ORXA 1XC6A 2VO5A 2HYXA 4DXTA 4ZZ8A 3GXUA 3WF0A 3HOBA 2X10A 3HNYM 2WN2A 4XVHA 1GOFA 4MO3M 1JZ7A 2JDAA 2J1AA 1W9WA 4A41A 4QDQA 5DPNA 3W5NA 3T0BA 1K3IA 1PX3A 3ACIA 3ACHA 3C7GA 2QQKA 3GGLA 3UNPA 4XUNA 3C7FA 1I5PA 4UOJA 3C7EA 1UY4A 4QX0A 3T0AA 1O8SA 2ORZA 3VD5A 4LQRA 3LEKA 3DYMA 4AAXA 1DP0A 3UETA 4QB1A 4XZUG 4PT6A 1UWWA 5EIYB 3T2PA 1UY2A 1GU3A 1W0NA 2WZ8A 5HPOA 1JU3A 2W1UA 2W1QA 2JE8A 4BXSV 4TTGA 4QAWA 2BZDA 3CMGA 5F7UA 3PUHA 1L7RA 2J1EA 2VZTA 1UY0A 3C7OA 1UYXA 2VZRA 5IJRA 4MGSA 2ZEWA 3MUY1 4MOAA 4W4ZA 3MV01 5JXGA 1W8NA 5FUIA 5DMYA 2E33A 3MO4A 3I2FA 2QQIA 4QB6A 2ZEYA 3VD3A 3WNPA 1US2A 1W9SA 2YC2A 1JYWA 3JXSA 4E8CA 5JXJA 3IDAA 3LEGA 3BN6A 1JHJA 2EIDA 4QX1A 1PMJX 4OZOA 1UZ0A 3ETPA 3WF4A 3WNOA 2YFZA 2VMFA 4ZXEA 1NUKA 4DEQA 3I2IA 2W91A 2B9VA 3A21A 2PQSA 4ZY9A 1J83A 1T2XA 4A42A 3ZM8A 5LCWL 3WNLA 2VQUA 3CIHA 3A23A 3OGRA 3EYPA 3P6BA 3OGVA 2QQMA 4DUWA 2ZEXA 1WKYA 2VCBA 2HLEA 4GWJA 2BERA 2XHNA 2WBKA 1OF4A 4CU7A 4DUVA 3LPFA 3OG2A 3T09A 4A4AA 4A45A 3HEIA 3K4DA 2WO2A 4CUCA 1ULPA 4MGQA 2WQ8A 2ZXQA 3ACFA 1OT5A 1JZ4A 2WDBA 1IQDC 1D7PM 5CZKA 3OB8A 3ACGA 2J1VA 3FL7A 1DYOA 4W8JA 2Z4FA 5DQ0A 3VDBA 1PX4A 5J1XA 5B4XA 4LHSA 3PUIA 4OUEA 3LQCA 1CZVA 2WZEA 2XONA 4AG4A 5LA0A 2Y6LA 2Y8KA 2Y6JA 2VMEA 4PF1A 1GOGA 2E26A 1MPXA 1ULOA 2VZVA 3A22A 1LNSA 3P1IA 3SKVA 2ZEZA 2VR4A 2QQOA 2Y6HA 2X05A 2W46A 5EJZB 1KGYA 1F4AA 4KWUA 3CDZB 3VD7A 2W95A 1GQPA 2OKXA 2XOMA 2LS6A 1TVGA 5LA1A 1OH4A 2BBAA 3ECQA 2W1WA 2W5FA 5HXMA 4RN5A 4Z2AA 2WO1A 5LA2A 3AC0A 3MBWA 2VM9A 1CZTA 2VOTA 4JKMA 3T2OA 4ARYA 4DXSA 2J22A 3WQBA 3WEZA 2VZOA 1W9TA 3WF1A 3CKHA 4P08A 2E31A 1XPWA 1JU4A 3D3AA 4UI9L 1L7QA 2V4VA 1NX9A 2VTFA 1XNTA 1UY1A 2J1UA 2J1SA 3THCA 2W94A 3SKJE 2VCAA 2W87A 1R64A 4DUXA 2VL4A 3DYPA
chains in the Genus database with same CATH superfamily
1OUXA 3ON7A 4QPIC 4QXKA 5FBZA 2WC2A 1WLTA 4TLFA 3WZ1A 4IGPA 4XABA 1TG7A 1RUD2 3SC7X 1S0DA 4JRAA 2RS32 1W3VA 2AGSA 2ZHKA 3EHKA 5GLWA 5IW0A 5ACA1 2WFPA 5J7MA 2DV9A 2DCJA 3JU9A 5FYYA 4JGYA 3BU7A 5FY8A 4XDOA 1CJDA 4L8QA 2ET1A 3B7MA 3K46A 2WN3A 4BJ0A 1QXJA 1UU6A 3NKTA 4E9KA 3N7LA 3KMHA 1IG0A 3H8RA 4JQRA 5G05L 4WM7B 5FYZA 1ND3B 2JB4A 4GWMA 1G6NA 1AYM1 2IUWA 5FO7B 5FTTC 1LGNA 3MICA 1H1AA 1BCXA 4PLMA 2VQTA 2OX0A 4CDWB 5J96B 1LEMA 5IATA 5FBJA 4URAA 3VZKA 4UAPA 4KWJA 3OGJA 5LASA 2LALA 5L36A 2YYOA 1XSRA 1WCDJ 2RS13 3B94A 3LZZA 1CQ9A 5IVCA 1CX1A 3A0KA 5CFDC 4BQYA 2W92A 4CU8A 4D0QA 4EZHA 1RUH2 2FDFA 4LE3A 3C2UA 5LEKA 4ISQA 4XDQA 5DAQA 1RUOA 3KB5A 3VBSA 5JSOA 1UYYA 4UBGA 4Y4RA 1N1SA 1IS6A 1ODMA 3OTFA 4PDWB 4YNIA 5JWPA 3OBZA 5FPLA 1HN0A 4EN7B 4NHKA 4AEJA 3U4XA 1KS5A 1H8VA 4M4RA 1POV0 2XWBB 3IB3A 4WM8A 4K6BA 1FPN3 4XDPA 5T5PA 4Y26A 1ZA7A 5FZ3A 2WZR1 1AR81 2X8KA 1ONAA 4FOWA 5ACA2 3FHAA 1N3QA 1NE6A 1PMHX 3J8F1 3NQHA 3RZJA 1UXZA 1OF3A 2E32A 4QQPA 1H1MA 1SG3A 4ARXA 4B7KA 1RITA 3O1TA 5A3UA 1PNGA 3U78A 4YVSC 2VTXA 3V0AA 1WLWA 4PQ9A 1NLQA 1W6NA 2B9UA 2IWGB 1RUC1 1YIPA 1AYM2 2YV8A 1S0IA 2VD7A 4XCAA 4QXCA 1VE0A 2L9LA 2QCSB 4KNCA 2CSGA 5FDBA 3MPBA 2ZCWA 4JGYB 4NIAA 4CDXC 4YZ3A 5DAPA 1NY71 2FDHA 3RYKA 4Z8BA 3KV5A 4XJ9A 3DECA 1QGLA 1YUDA 3ES4A 3U07A 3B93A 1H2MA 4B4RA 4Q4V3 3I2GA 4AHYA 2OIIA 1Y43B 5GM0A 1AR93 3WW4A 4QDSA 5DDJ1 4C90A 2CTVA 1HRI1 1S0BA 3CU7A 2VVEA 2ZHNA 3MFCA 2JDNA 2Q30A 2Q8OA 2J42A 4QX3A 5DG2A 5LW9A 1OOPA 1NKGA 5EPAA 1ODNA 2DUPA 2WZR2 1AR82 1JZ6A 2BWAA 1SLLA 2WWSA 4GH4A 4IV3A 4YVWC 4AR2A 1IZ3A 4Q4W1 3TBDA 3BKZA 2D44A 4XJAA 5FY4A 3J8F2 4LOSA 5K0UC 3I49A 3VBSB 1VBC1 3LEIA 3M70A 4HPKA 4JC1A 1RUE1 3Q8EA 4P9YA 3PVBB 3EBRA 2DBNA 2ARAA 1MEC3 3MEPA 3ZR6A 4DXRA 3O1UA 1UYZA 1T6BX 2ZABA 2JDZA 5JXHA 4LOTA 4WM8B 2WABA 1CIWA 1W9YA 4XF9A 1DYPA 1VBA1 1RUC2 1W6MB 1HRV1 2EIEA 3ZYJB 2ZX4A 4LITA 1JTZX 2XH6A 1A6CA 2VW1A 4HMZA 2RJLA 5DAWA 3L2YA 1OC1A 2XKOA 1COV3 1F5JA 4AVSA 1XE8A 2C5DA 2RMU3 2PN5A 5JUVA 1BMV1 4RFT0 3T1LA 5AVAA 3EQEA 4N43C 5H9SA 1TMF3 4QKBA 5F3IA 2NPIA 3I2KA 1NY72 4FPFA 4CZSA 1TME1 4A7KA 4YZ4A 4QQ2A 1NCQC 2G1MA 1V6JA 3S7IA 4LUMA 4QGMA 1NG0A 3V0AB 4AYUA 2VW0A 2WIIB 3P3NA 4XIKA 1RJ7A 1W6NB 5DDJ2 4KBZA 5A7QA 3OBRA 2A3WA 1HRI2 4CU9A 1LAJA 2NP0A 5KHKA 1VAMA 5HCBA 1PHMA 1REEA 2WJSA 3LIHA 4LKEA 5A3LA 2IXLA 5FPAA 5JOYA 1D0GA 4NE9A 3V56A 5HI0A 5KXDA 2JX9A 1RXFA 4Q4W2 4A2UA 2VOKA 3ZXLA 1VBE1 4AI1A 3HPNA 3DCQA 4CDUA 4E4DX 1MZFA 2HWC1 3AJZA 5EJ3A 2KD7A 4OMCA 1VBC2 3RGBA 4ASMB 2VQ0A 2CY6A 1RUE2 5IVVA 2PHLA 3I97A 1G8WA 1O8PA 1ND3C 3JBG3 1GQGA 4RYDA 5CYYA 2EVXA 5FPBA 5A7WA 3U14A 2VJXA 5BNNA 3BGAA 3OY8A 4JHTA 2HEWF 3P3PA 1POV3 2P3KA 1DZRA 3K2OA 1ZNPA 1O7FA 1VBA2 1HRV2 3GF6A 1OOPB 4HKLA 3MLKA 4AFCA 2WS93 2YHJA 1YNAA 3LFIA 2WUHA 1YO8A 1AX2A 3IT8A 3KV9A 3BOPA 3NRUA 4GH4B 4IV3B 2XG3A 2DTWA 3WF2A 3D0SA 3FHQA 2K9ZA 1BMV2 4QX7A 5LZ6A 3N9OA 3KF5A 4CU6A 2A3YA 1LEDA 2Q5TA 2YBKA 4HPKB 4E8DA 3WP3A 2FDKA 1TME2 2QZ3A 2XJPA 4M3CF 3ZXEA 1GOHA 2GC0A 3AMQA 4XTMA 2XWJB 1B35C 4INDA 4AQ2A 4D94A 4HK9A 3FJSA 4YARA 4XXAA 2DCZA 5CA6A 1LHWA 2WAOA 2ORXA 5A6XA 3VHRA 4DXTA 2RS11 4UW6A 5I0SA 3BPSA 3C3VA 3HOBA 3HQRA 2TNFA 2ZPXA 4IE0A 2EALA 3IWZA 3PU3A 4RHV3 4NAOA 1GOFA 4HETA 1X9PA 3H7YA 1W9WA 4YGDA 4FAHA 1SBDA 1TQ5A 4XJ8A 3G7DA 4CP0A 3OD0A 1Q43A 3KZ4C 4N7IA 4PIZA 3QLQA 1RUJ3 1H4GA 2TBVA 4P9JA 2QQKA 2HWC2 3FHIB 1WCSA 1OPMA 4H14A 4DFSA 3JCIA 2XJRA 3C7FA 1FPN1 4UOJA 5FUNA 1LHVA 1KRIA 3V65A 2ZGLA 1UY4A 1WGPA 3ZXAC 2EIGA 1OBNA 1VRH3 2BDRA 5FZDA 4JGYC 1AX0A 1PZ8A 4AAXA 4K1YA 1DP0A 1W8FA 1N1YA 3MIDA 3H9AA 1DHKB 3USUA 4CDUB 5C8CA 1CAVA 2Z69A 5CKQA 3WR0A 4NHXA 3LB9A 1WMFA 1VBD3 5A7WB 3HQXA 3RFRA 3WDUA 5BNNB 2W1QA 2JE8A 4TTGA 5DXDA 3QCWA 3OY8B 5IT6A 4AFBA 1U0AA 2BZDA 1SCRA 3MIGA 4P9LA 2VOXA 2WKKA 3PUHA 1L7RA 1SLIA 3O0XA 4FPGA 4NRQA 2D6MA 2RS12 3ROUA 1UYXA 2XJUA 2K2SA 4PLOA 3ZDSA 1XNBA 1ZZ8A 4GJZA 1VB2A 4W4ZA 3MV01 4FFHA 4AZZA 5JXGA 3KVBA 3N7KA 1F31A 4LBKA 2A75A 2PYTA 3KVAA 1AR71 4Q4V1 1CWPA 2GN7A 1AR91 3I2FA 3GHNA 4IEVA 3SHRA 1OQEA 3FZ3A 1UQXA 3VZMA 1HB2A 3VLBB 1DBNA 1ULEA 3MZHA 1US2A 4WM8C 4NHLA 4HL0A 1WCKA 3JXSA 4NJ4A 5LWBA 5DZEA 5C3PA 3IDAA 3ILFA 1FPN2 1ZRCA 4LT5A 3QH6A 1JHJA 2EIDA 1YYNA 2XL7A 1QJU3 1LOFA 1MS3A 2W68A 1JBCA 5JZGC 2X53S 1OXCA 2GP3A 3ETPA 3WNOA 1W2TA 3VZJA 1AJKA 2VMFA 4ZXEA 4C0HA 1MS9A 3ZYHA 3VZOA 3I2IA 2D3PA 3SQOA 4XFBA 2PQSA 4ZY9A 3UGFA 5IK8A 1T2XA 2FCVA 4AXOA 3WNLA 1MEC1 1RUI3 4IDZA 4CDQA 3A23A 2ARXA 3RZZA 1JW6A 3WINE 1ULGA 4CEYC 2YDEA 3P6BA 4YFZA 1Z0HA 1UOFA 1WLDA 3KQRA 1WKYA 4DUWA 3VN4A 4F7ZA 4TSVA 2PLV3 4GWJA 1COV1 2BERA 2XHNA 4OFGA 4QPIA 2RMU1 5D2AA 1UOGA 3HMYA 4RS5A 3ZPOA 2XXZA 1DDLA 1TMF1 3LDRA 5F2SA 3S5AA 2BYVE 2DVDA 3OG2A 4PIYA 1QJY3 2IVIB 3N9MA 3PVNA 4N9HA 5FZ9A 5F8PA 5DAXA 5HBAA 4QHZA 1RB8G 2D97A 2XVLA 4WZCA 3NMBA 5C8CB 1GICA 2NMOA 1CAVB 2XJVA 3GCXA 3GJAA 4TYSA 5FP9A 3SMHA 1CAWA 4OHXA 4W6XA 5DABA 3X29B 2ZMKA 4XF4A 4Q4V2 1AR72 2VULA 3ZN5A 1AR92 2WDBA 5FLHA 3ALQA 5CZKA 1JZ4A 4I2OA 5E16A 5FO8B 2PHTA 2GC3A 1S4CA 5A3NA 2A3XA 3FL7A 1OLMA 4W6YA 1YQ8A 3AP4A 1OOPC 1C8M3 3GYDA 1AF9A 2CAVA 4AHZA 4GH4C 1PM7A 5J1XA 4JGZA 4XFAA 4QT6A 3WXPA 4KGQA 4GALA 3LOBA 3RWKX 5FYBA 4CUGA 1LENA 1HB4A 1GNHA 4NO4A 1AXKA 2WZEA 2XONA 4QM9A 4AG4A 4ATFA 1U12A 5JOZA 1XE0A 3ATGA 1PMIA 3JBG1 3M7AA 4LE4A 4OI2A 3VKFC 1RUH3 4COYA 1LOBA 1MEC2 3VZLA 2CHHA 3UYJA 1OQDA 5GZDA 4FPCA 2WNUC 1POV1 4FVVA 3ZX7A 3SITA 5JIUA 2VZVA 4YFWA 3NO8A 1LNSA 3SKVA 2VR4A 1AVBA 5B2GB 2FMYA 3HN1A 4C8DA 4M00A 4U36A 5EJZB 4MVTA 1COV2 3WP6A 1KGYA 5F5IA 5A3TA 5FYMA 2RMU2 4AAPA 4KWUA 3CDZB 2WL1A 1GQPA 3BIWE 3NKGA 3RPQA 4YG0A 1TMF2 2XOMA 4S2GA 3AMPA 1MS1A 4NRPA 4Y20A 5ACA3 2BBAA 1ASJ3 2FBEA 3ECQA 3AYDA 2H0VA 3WP5A 2W5FA 3ZLIA 5HXMA 3CBNA 2VVDA 3ZR5A 5J09A 4RN5A 4NPLA 4CDQB 4Z2AA 3VBHC 3O1RA 1F35A 5FMCA 4CP2A 1CZTA 4YM3A 5C3OA 4FPHA 4Y4YA 1FNYA 4DXSA 1RXGA 5FZEA 2FHRA 2VNGA 3PVEA 4CCNA 1PGW1 2SLIA 3N3HA 1ZX5A 2WZPP 1Q5OA 3WEZA 3ZMOA 4QPIB 3AP9A 3DF0A 4A6SA 4RHV1 4Z07A 1J1TA 2GNTA 2JIJA 1PGSA 4P08A 2ZX2A 3N35A 4R9AA 4RS5B 3UGGA 1WA4A 2R0HA 1XPWA 3R4SA 4YZ1A 4HONA 5KR7A 2V4VA 1RUJ1 1CONA 2VTFA 2P3YA 3POJA 4MGTA 1V0AA 1CAWB 4F8AA 2UU8A 2ATFA 2J1UA 5FP8A 3ZFFC 4AVCA 4OHYA 3JBG2 3SKJE 2XLGA 5BNNC 2HH9A 5DUVA 2KA3A 4XF0A 5FPUA 1ACCA 4K7JA 4NOTA 4UFJA 5FYSA 1WCQA 3MIBA 3QH7A 4FOQA 4IEWA 3PJYA 4X6RB 4FAGA 1MZEA 2EA7A 1W04A 1K45A 1RTVA 1BBT3 5D8AC 1ENQA 5EQUA 2WS92 5FYIA 3SEEA 2VUDA 4BM8A 1F2NA 4JGZB 1PZ9A 4K9SA 4MXWA 4WVMA 5E1RA 4M01A 1QOSA 2P2KA 3MF9A 3SH3A 2CU5A 3ZXFA 2GSYA 4FOVA 3MW4A 1H2KA 2JJ6A 4YM0A 4D69A 3BTZA 3WG4A 1GMMA 2I45A 3TEZA 3OPZA 1WBFA 4LBNA 4LO6B 4NHYA 1VBD1 2PHXA 4I09A 2VMDA 3NV1A 4JDOA 4D7YA 1PIV3 3J8F3 5FZAA 4FBFA 2R30A 5FZBA 4O9GA 3B9IA 1XYPA 5JR2A 2C4XA 5KXCA 1VRBA 2ZMLA 1O3TA 4AVVA 5DUXA 3EB7A 1JOBA 4XXPA 5A80A 4E2SA 1AZDA 3KWVA 5EHDA 1PGW2 2VXJA 2WSUA 3P5BA 4RHV2 4RGAA 1TEIA 3PHMA 4XF1A 4BQWA 2ZX0A 3J7LA 3WQ7A 2WA3A 1W99A 2CGPA 5L9BA 2RS53 2QUOA 4Y20B 2E6VA 2ZBJA 2VTXJ 2WNVA 1RUJ2 2RG4A 4GIQA 4KGGA 3ZFEC 1SCSA 3VV1A 3HQUA 1HV1A 4N43A 1O4TA 4AVBA 5EYYA 1YI7A 3HBKA 2J7MA 1HDKA 5AC93 3UESA 1QJU1 1NCQA 1GKBA 5IK4A 2J1RA 2VCCA 4PHZA 4MYEA 3AX4A 4KWKA 4PI2A 2P3JA 5BYNA 1AXZA 5FZ1A 3UKVA 3F2ZA 5FOBB 1HRI3 1KEXA 4B1LA 3TOJA 1UZZA 1RIRA 2AH2A 1QNWA 4CCEA 3FC0A 5C8CC 4Y1YA 3T30A 5F5CA 5FZLA 4PLNA 1RUI1 1D0HA 1S0FA 2AREA 1N1VA 3GZAA 1OD3A 4AGGA 1AXYA 1NXD1 3H1WA 3TNPB 2OQ7A 1QOTA 1VBD2 2WT1A 3G6JB 1R093 1APNA 3M1HA 5E88A 3SH4A 1JHNA 2GMPA 4GZ9A 3J4UH 2VZQA 3VB9A 1C5HA 2PLV1 4D8MA 1CPMA 5DAVA 4FPEA 3LE0A 5FREA 2JG8A 3H3UA 1JZ3A 5ANQA 4BDVB 2BVVA 4MXWB 1QJY1 4WVMB 4XCBA 3TEWA 3VBRA 4MH0E 3ENRA 1NLSA 3AZVA 1OUSA 4LBLA 3SISA 3WDXA 5BNPA 1UXXX 4XE9A 4CUAA 2RR11 2RVAA 4E4HA 3MLJA 1IPKA 4NIGA 5G04L 1SQ4A 4JQTA 4UW4A 5C4WA 3L2HA 4IUGA 3FUOA 4MG2A 1FATA 3O5SA 4BA6A 1G9DA 2VXRA 3O1PA 5KC5A 4DOUA 5CG9A 3AFGA 2ZGUA 2JE9A 3DYOA 5JLVA 1C8M1 4MHUA 1IOAA 1QJU2 1QHDA 1B35A 2Y34A 3N36A 3HWJA 4RGKA 5JOWA 3PUSA 3T08A 4LO7A 4ZKTB 3PU8A 4RR3C 1JYNA 4BQ3A 4K1ZA 2ZACA 4QQOA 3H0OA 5CVRA 5FWJA 3CZUA 2YY1A 1HN1A 1ZZ6A 2PA7A 5FY9A 2D5FA 2WNVB 2W1SA 3O12A 4JV4A 3USSA 4A3ZA 4CDQC 4IW3A 5LRRA 3TNQA 1RUI2 3ZOIA 2OW4A 1AX1A 4N43B 3VL9A 1OKOA 2OS2A 3ZVXA 4HT1T 1VBE3 1W90A 3LPGA 4ZONA 3SXWA 4OYUA 1GFF2 1K42A 3FLTA 1NCQB 3ZSLA 3GNEA 1QH6A 1IS4A 4DS0A 1GZ9A 1BK1A 4FP3A 1HKDA 4PQQA 5K4LA 4CP1A 2PLV2 1O91A 2VUAA 3MYXA 4Q4Y1 4EWAA 4RS5C 3O0WA 4Q0VA 1NAEA 1J58A 2CGNA 2UWCA 4Q4X3 1GP4A 2V5DA 1QJY2 2DUQA 3AKPA 5A6QA 2B4KA 1ASJ1 1WZXA 5FXWA 1N3OA 1MS8A 2VZ3A 1FV3A 4NHMA 5SV5A 2D6OX 4CEWA 4K3UA 1EP0A 1ULCA 4CE8A 4E2GA 5DN2A 2F6BA 5T52A 3E6BA 1D2QA 5DZGA 1XYNA 1UX7A 3O0VA 4A44A 5JMOA 1IGOA 3RZKA 4H7LA 5FOJB 1GUIA 2SBAA 3M8LA 3S6PA 3VDAA 3ITQA 1VMFA 2YB7A 3O1SA 3BI3A 2CNAA 1H9WA 2VBDA 3I3BA 3WV6A 3ZYGA 1QMJA 3O14A 4XMIA 1KD7A 1C8M2 3PDQA 3W9AA 3SNMA 1FV2A 3MUZ1 3QBQA 2JG8B 3IN9A 4I01A 4JGZC 3K51A 2QQNA 4LR4A 4XFHA 5BY5A 1BXHA 2EICA 1VLNA 5FY0A 1JOJA 2XPJA 3HNBM 5BNPB 5IVBA 1W2AX 5K8SA 4S2HA 2VU9A 3T2TA 3LKJA 4Y1UA 5F5AA 3RYRA 4QDRA 1BKZA 3RYPA 4DEVA 2QVSB 5BNOC 5C4WB 3WHUA 2P37A 3BIEA 1YQ6A 3I2JA 1NCRC 2NN8A 3OEBA 3J7NA 3PIJA 3UJOA 1J59A 3RNSA 2CYFA 2MPFA 1Q3EA 2HWE3 1UMIA 1EPZA 3VKLA 4KWLA 1YQ2A 4O65A 1HXS1 2C6SA 3ME2A 5KXBA 1BBT1 3M4FA 4NWWA 3D5OA 4Y5SA 1B35B 2WYSA 3NJVA 2IXCA 5ANNA 2BGPA 5GZEA 3E1F1 2GH8A 4HXCA 4Q4Y2 2V09A 3NAPA 3S30A 4YYOA 3H3LA 3POEA 5LB6A 3FUQA 5GKAC 3PURA 2JB8A 2HWF3 5JZGA 4XACA 3NJXA 1ASJ2 1IKQA 1SZBA 4GJYA 5FP7A 1O3SA 1PIV1 2X09A 3J7HA 2PMWB 5FZHA 3WCSA 5J48A 1UKRA 3IM0A 4NAMA 5FP3A 3M3CA 2RM23 4ATEA 5JXIA 2CWMA 2VZUA 2BW8A 5BNQA 5FJHA 4K40A 3AZZA 4H7MA 3S57A 3GM8A 4FP2A 3V0BA 1VBB3 3ZXKA 3A4UA 4YSFA 2PAMA 2YBSA 1FXZA 2PHRA 1S55A 1XB9A 2Q1ZB 4MSVA 3QOPA 2VO5A 1F15A 4CEYA 1V6OA 3AP5A 1Y4WA 5FZ7A 4ZZ8A 4G9SB 2RS51 4CPBD 1FI2A 5I91A 2D93A 2WN2A 2ZGOA 3HVDA 3KF3A 2MHFA 4Y3OA 1WMEA 4CEWB 2JDAA 5A1FA 2J1AA 4RFRB 2Q8DA 3UJQA 1YEWA 4Z92B 3KHCA 2JICA 2VCMA 1K3IA 1SBEA 5CISA 5H9QA 4COWA 3ACIA 3WNXA 4JRLA 5AC91 3ACHA 4QX8A 5FZ0A 5FYUA 3UNPA 2OT7A 3I4IA 5CEHA 4XUNA 4XFGA 3FLPA 4BXFA 1AR73 1HJFA 4UT5A 4BMBA 1MZ6A 3AL5A 1HXS2 1BBT2 3OD4A 1CAXA 4QX0A 4HSLA 5A6YA 4Q1RA 2PELA 3I59A 2IXIA 3IDBB 1NLRA 4PT6A 4XQWA 4M3CE 4XZUG 1YLLA 2QQWA 3DKQA 1JH5A 1WW7A 2BEOA 3TEXA 3TN93 3KSCA 2B7YA 5FKCA 1R091 1UWWA 2HWB1 1PIV2 2DYCA 2LM3A 2E53A 2DU0A 4K8RB 1GU3A 4LBOA 1EPWA 5HPOA 2D98A 1JUHA 2RDRA 4DY5A 4J1XA 5JCTA 5FR3A 4LHLA 2Z2SB 2FCTA 1OI6A 4QKDA 5F5QA 1IS5A 5F1RA 2GMMA 3Q8CA 2QNKA 3CMGA 4OVEA 2ZJCA 3WHTA 2FZ2A 2E7TA 2WNUA 1G86A 3WLUA 4QU1A 3H8OA 1QJEA 3GALA 2VZTA 4P14A 1UY0A 2X29A 5CB7A 3C7OA 2BQPA 2VZRA 4MHRA 2RS52 2WNVC 3W58A 2EXIA 4CXXA 2ENRA 3WX5A 2Y38A 5JZGB 2ZGPA 1OLME 2EXKA 1X8EA 2MEV1 5LA9A 2BPA2 1I3HA 3LDBA 4BQXA 3T4VA 2BFUL 4PBPA 1NYWA 5HXVA 5LY2A 2ZS6B 1RUG3 2QQIA 4NIHA 1HV0A 2ZEYA 1GZTA 2DWRA 3TWIA 5AC92 1ND2C 1PK6C 2B39A 2YC2A 4N7UA 4XIOA 3V0BB 2IXHA 5H9RA 2VOWA 3VBHA 1KQRA 4HK8A 1YHFA 3JQWA 3POWA 3BN6A 1H9PA 5IVYA 4CEYB 4QX1A 5J37A 4BQ4A 3O1OA 2F4LA 2BNMA 2GALA 1UD1A 1DZQA 1UZ0A 2R063 5DUWA 3NV3A 3WDVA 2NLRA 3CJXA 1NUKA 1UOJA 2YBPA 5GLZA 2B9VA 1DG6A 5DG1A 1QF3A 2FQPA 3A21A 3MHZA 2BU9A 1BQPA 1S0EA 1X9TA 2PHDA 2OVUA 3WG3A 3ZM8A 1R092 4A42A 5LCWL 2Y60A 3CIHA 3QACA 4NIIA 4Y5Z0 3AZWA 3OGRA 3EYPA 4GMP0 5F3GA 4QHOA 3ZFFA 2JG8C 5FYVA 3WUDA 1WW4A 1XBFA 2QQMA 2VMIA 1QXPA 2GN3A 2VCBA 1CAXB 4Q4X1 4HN0A 5ABJC 4N53C 4R4ZA 2GAUA 1SFPA 3VBRC 2HLEA 1KJRA 4QKNA 3GZUC 4X8NA 1WMXA 5LBBA 1MS5A 3E5QA 4HFSA 3GHMA 5BNPC 1CPNA 3I59B 4QPGC 4XHXA 3E6CC 4CPBA 1W2NA 3TB0A 5EZWA 1B09A 2YGLA 1UF2C 4CU7A 4HKOA 5C4WC 1V6NA 5BXXA 5D8AA 5EP9A 3T09A 3ZYBA 5FPVA 2ZGKA 3ZMNA 2MEV2 3B69A 4KQ7A 2ZOEB 4EROA 2DUOA 3JUUA 1LU2A 3AYAA 2R043 4P5HA 3THTA 2AR6A 1IQDC 3BYWA 4NVPA 2QZ2A 1UNBA 1H30A 1LRHA 3B01A 3J26N 4W8JA 4DO0A 2WNUB 4J6GA 5DQ0A 1QJX3 2VGDA 1I6XA 1SMVA 3T3YA 1PX4A 2XLFA 5DUUA 2K46A 3BALA 1SLCA 2A6YA 2CWSA 3BODA 4XEZA 4WZFA 1RUNA 4AEKA 2GC1A 1NQJA 2F17A 3AJYA 1NXMA 2XBO1 1IHMA 4IE6A 4TZDA 2WNEA 4Z1VA 4Q8KA 2Q1MA 5LA0A 2D3SA 4CCKA 2HWE1 4I0WB 2JDMA 1VBE2 1ZZ7A 2BWCA 4PF1A 3RZHA 2H6BA 2R1DA 3ZFEA 4YGEA 1GWKA 2PQQA 2R6QA 2ZA9A 4FOYA 3VBHB 3M3QA 1Q8OA 3A22A 3E5UA 1OD5A 1OVPA 4Q4X2 3I2OA 2PHFA 1YRZA 5F37A 2QQOA 2Y6HA 2X05A 3CLPA 1CJPA 3RQ0A 2HWF1 2XDVA 4G4FA 4CEWC 1PM4A 2ZHMA 5FZ4A 3VD7A 2W95A 3ACLA 1O6UA 1OFNA 5FZFA 2D5HA 1J3QA 1AJOA 1H4HA 2LS6A 5LA1A 1OH4A 1GSLA 1YQ5A 2RM21 1H8TA 2W1WA 2JDHA 2YZ4A 4Z2WA 3POGA 1FT9A 1V9U1 4IV1C 1L7LA 4LIUA 4FXGB 4QU2A 1VBB1 3MBWA 3RI8A 1W39A 2VM9A 2VOTA 4UF0A 3ZFFB 4FTBA 1CESA 2XVKA 5M0TA 3GJBA 1C8NA 4YM2A 5BPXA 1V6MA 2YU2A 4PIXA 4AVAA 4E2QA 4R4XA 1KDKA 1I1EA 2JWPA 3UGHA 1YFWA 4EN6B 4NPRA 5E8AA 4ZXKA 3N9LA 2R16A 4TWTA 3PMEA 4WVWA 5D8AB 2B45X 5JSRA 4XFFA 1W6QA 3EO6A 4LA2A 1L7QA 2XBO2 1H1IA 1NX9A 1PZ7A 3E97A 3VBUA 3NV4A 4WVZA 3ZYRA 1XNCA 1LJ7A 5APAA 5FP4A 3THCA 2HWE2 2JKBA 5JR7B 3IZOA 4WVVA 1WW6A 5CKMA 2W87A 4ASLA 1R64A 2WQ4A 1Z78A 4COUA 1YFYA 3N7JA 2NYYA 5E89A 2VC9A 2JDUA 4BPZA 3AVRA 1WMDA 3NAPC 2JKXA 4Y1ZA 1C28A 5JPMB 3R4DB 3LWCA 2J1TA 3I2DA 3ZIXA 2G9FA 4KI5M 3IIIA 4CVUA 1LR5A 4XQDA 1ZREA 3ZPYA 2V4AA 2IXJA 1BK0A 2HWF2 1OSGA 4IESA 2YGMA 3TN91 3OYWA 4RR3A 5H9PA 3ST7A 4OUSA 3BB6A 1OLRA 5FZ6A 4FO9A 5FXVA 1SFNA 3MFAA 5T3NA 4DZGA 2RM22 2XJQA 1GP6A 2WSVA 3ZFGC 5A3MA 2LRPA 1V9U2 5FV3A 3SCGA 3ZFEB 3UKNA 2NMNA 3KD4A 1VBB2 2W2IA 4DIQA 2LW8A 3HN3A 2K0GA 4W6WA 4LPLA 4UFKA 5FZOA 2FMDA 1X50A 3POSA 4C91A 1UKGA 2AYHA 2I74A 3OBAA 4YPJA 4IEQA 4LHNA 4N8MA 2IVJA 1OFSA 2VNRA 1UO9A 4NR1A 1E57A 2WLQA 1SDDB 4BMEA 3OOXA 3MW3A 4MXVA 3ETQA 5GJ6A 1GYKA 2D43A 1RINA 1F8VA 1DLLA 4V2WA 1H8TB 1RUG1 2E63A 3USUB 5I0DA 2VVFA 2IC1A 4AOCA 2ET7A 2JE7A 2RR13 4MZUA 1JODA 2GDFA 5EFUA 4UF0B 3T1MA 4A6OA 2Y6GA 3MLLA 4XUTA 1O59A 1BVP1 3N9PA 4K20A 5F6KA 2QBXA 4TXWA 3DN7A 4XAAA 3RG0A 4AWDA 2R061 1K12A 1SLAA 1W05A 3E6DA 4GAZA 4R9CA 5FK8A 3LIGA 3B00A 5JOXA 5K9YA 4ZZ5A 4W50A 4Q8LA 4XJUA 3ZKYA 1UMZA 2JENA 3DXUA 5T5JA 1W6QB 2ZKNA 4HSJA 3TN92 1X82A 2OPWA 2W47A 3CZJA 3VBUB 4YW1A 2C0ZA 1X36A 3CEWA 3J9SA 1CVNA 3U37A 5EXOA 2VAUA 2EIBA 2G9GA 1LB2A 5BNOA 3FN9A 3ABZA 2AC1A 4E27A 1PO23 3WSOA 3PIGA 4CCLA 1T6GC 1DYKA 1NCRA 3LDKA 4D7SA 1W6PA 1OA2A 2YG0A 3DKWA 3RJRA 5IAXA 5L9VA 2RV9A 2TUNA 3K3OA 1UY3A 3C8XA 2QFEA 2VNOA 5T5OA 4QX2A 2WO7A 2YXSA 4XOGA 4Q4Y3 2DTYA 5FLJA 1JI6A 3OYWB 1N1TA 1QDCA 4CCCA 1Y9QA 2DCKA 4RR3B 1SLTA 1DF0A 5C5TA 3UKTA 3INAA 5KBFA 2R041 5C9AC 3I54A 2WAAA 3EJKA 1K5MA 1RUG2 3LCPA 1W8HA 4BK4A 2ZGRA 2ILMA 4I02A 3WW2A 3S0MA 1TZOA 3HAGA 1ALYA 3ZSJA 2A1XA 1JZ2A 4P02B 4Q0SA 2GU9A 2RE9A 3AK0A 2OUHA 5FQ0A 1QJX1 5FZOB 4EZ4A 4ONUA 1VIWB 1UOBA 4GWIA 4JKLA 2JDYA 4PI0A 1JYVA 3B3QE 2LTNA 2R062 4P5YA 4N9IA 3NNLA 1Q8QA 1LOGA 1H6XA 5JAXA 4QB2A 5EJ1B 4QQHA 3MIHA 5GLVA 4ZHNA 3AL6A 2VNVA 4B4PA 4X8PA 4Q0UA 3K3NA 2G19A 1KFXL 2D7FA 2BOIA 5CAZA 5CADA 4YW6A 2EXHA 3RMYA 1W0OA 1UW8A 1E5RA 1PNFA 2UWAA 3GBGA 3H7JA 1DQ6A 2Q8EA 3WQ0A 1ULDA 4LMFA 3RS6A 3RZMA 2VZ1A 3BCWA 3KHBA 1V70A 4LA3A 2DF7A 3ZSEA 3DL3A 5KWRA 4OHVA 2BRTA 1QDOA 2E51A 2DVGA 2OA2A 3KV4A 3OUHA 4BIFA 4COZA 4JDNA 2PTMA 4IEXA 3MV11 2DBIA 2XGXA 4HG6B 1LHUA 5FZIA 1QOOA 4ES9A 1HXS3 2W9XA 2AZ5A 2XQXA 1ZA4A 3IPVA 1Y9GA 4QD2A 4MGYE 3U75A 1JUIA 2I2SA 1LU1A 4MLOA 1W6OA 4XBQA 1F4HA 1YI9A 4ZS3A 1X33A 2UWBA 5K7PA 3VZNA 2JECA 3ES1A 1WD4A 5GLTA 4MADA 2R042 1FYUA 4IETA 4AGVA 2Y0IA 3HT1A 3VKNA 5BNOB 2WWUA 4OMDA 3WVJA 4BYYA 3DXTA 3IAPA 3OBTA 2HYKA 1VJ2A 1GV9A 1NCRB 3LGRA 5I0RA 1C3HA 1W6PB 4FFGA 2A7AA 1JYXA 2WINB 3RMXA 1W3XA 1QJX2 2W3JA 1XNAA 1YWKA 4LBMA 3AP7A 1QU0A 4B8EA 3M2MA 1HIXA 4EWEA 1BVVA 1NZIA 5A1AA 4TLGA 5T55A 3ORJA 2RJ2A 1MZ5A 1ENSA 2DDUA 2VPVA 1GZCA 4CA9A 1H2NA 3SH5A 2ZMNA 1V6LA 3AVSA 4GB31 3THPA 2X5IC 3D82A 4YRDA 4BWOA 3NVCA 3BTYA 1K5MB 1KDMA 2NM1A 3NJZA 5CG8A 2AACA 4HBNA 4AHXA 1S2BA 5LEJA 1AHSA 3WW1A 1AL23 5DZFA 4XUOA 4YG6A 3HJRA 5CFCA 3MDPA 5FQ0B 2VZPA 3EXUA 1W8OA 1GR3A 5B4NA 3T4HB 2WNOA 1ND2A 3THDA 1PK6A 2A73B 3R0RA 3PLQA 4GQ7A 4V2VA 5IHRA 5HV0A 1UMHA 3Q8AA 1RYYA 4Q29A 4UFIA 2DCTA 1O5LA 4QKFA 4RQPA 4MV2A 4BLJA 4F3JA 5F9TA 5I8SA 4UFLA 4NIDA 3CJIA 1H8TC 1UZVA 3L9JT 5I0UA 4QPWA 5F6LB 4EV0A 2YFUA 1W8TA 5KC6A 1URXA 4B7EA 1CIYA 5C3QA 4XILA 1JYTA 1RHI3 4LEJA 4AEMA 3NL1A 1J3PA 4YW7A 4PF5A 1LTEA 1JOPA 4XYXA 5FKBA 1XXNA 5I8YA 1EUUA 4XHBA 4RL7A 5L73A 2HWB3 1LGCA 1E5HA 3C7HA 1QY4A 1FOD1 1DCSA 2R7EB 4YGCA 4F83A 5C8WA 2DVAA 1JYIA 3OGGA 3H50A 2VUJA 2XKPA 2A6WA 3I3DA 4W65A 1W8UA 1XC6A 2IFWA 2HYXA 1CAUA 3IPVB 4FPOB 3ZXDA 3WF0A 1RVF1 5ABJA 4N53A 4OHWA 3VBUC 1W6OB 4NMIA 4CP9A 3GBWA 4XVHA 1S0GA 1QQP3 4IL7A 1JZ7A 1QJFA 2YPDA 4QPGA 4AI3A 4QDQA 4AI8A 5DPNA 1I5ZA 5FO9B 3W5NA 3T0BA 4HZFA 4HOOA 2CAUA 1DZTA 4FQZA 1OPOA 2MEV3 3AMNA 3GGLA 2WA4A 3KGLA 5GZFA 2VE1A 1KITA 1S2EA 2P6CA 3HBZA 4DMIA 2HEVF 1PVXA 3LD8A 1PGL1 1I5PA 5HCAA 4K8FA 4Q5OA 4Q26A 3ZYIB 3T0AA 3VBOC 1CGPA 3AKQA 5EV7A 5C3RA 3ZIWA 3N4MA 3FE5A 4LQRA 3ZXGA 3JQXA 4M0NA 1R1ZA 4XF3A 4GXLA 4IE5A 3UETA 1OURA 4QB1A 4AVTA 4QGLA 3GZTB 2DVBA 5IUQA 1DGWX 1DGLA 1HQNA 2EAKA 3WD5A 2XVGA 3AP6A 3DGTA 1Q8VA 1PO21 3T2PA 1EAH3 4R9DA 1MVEA 1UY2A 2IXKA 1LECA 4FPYA 2WZ8A 2NQYA 2N7GA 4PDWA 4FPLA 4QHBA 5CFCB 3AZYA 1AYN3 1JU3A 1V6KA 2W1UA 3IBMA 2FDGA 2A6XA 5IWFA 3TRSB 2ZZJA 4L9BA 3VHPA 3WG1A 4A7ZA 4BXSV 5LATA 5BV6A 1ND2B 2XHKA 1PK6B 2EF6A 1W03A 1ZZ9A 2Z79A 4P9WA 4JVAA 4XMAA 1E5IA 2J1EA 3W20A 4RQPB 3DUIA 5I0TA 1MACA 1UIJA 4SLIA 5IJRA 1RVF2 3CJIB 4MGSA 4OI0A 3VGIA 2ZEWA 4MOAA 4S2DA 1YFXA 2RR12 4IE7A 5DMYA 5F2WA 2PAKA 4BHPA 5GALA 3POFA 3IKWA 3MO4A 4ES8A 2E7QA 4QGNA 4QB6A 1G9BA 3VD3A 4QXBA 4XAEA 2BV4A 3WNPA 5A3PA 1UPSA 3W21A 4DINB 2GNBA 2Q4SA 1JYWA 1NA1A 1MQTA 1PGL2 1JN2P 2JG9C 4IV1A 2V73A 4CXYA 1C4RA 2UY9A 3LEGA 2RHPA 3ZDVA 2OXBA 2VG9A 1GZWA 1LCLA 1CAUB 3AMMA 5LY1A 3JB8A 4OZOA 4EN9B 1UZWA 2WRAA 4N53B 4YWAA 3VBRB 5ABJB 3H1MA 2RDSA 4CP9B 2QKDA 4FXKB 2BTVC 3LSEA 2UY8A 4QPGB 2W91A 2Z42A 5ISLA 4GA9A 3RI9A 4COVA 1J83A 1HB1A 2RDNA 2ZGNA 2WT0A 5I93A 2VY0A 3R05A 2XBO3 4U2AA 1PO22 1WCUA 4MGIE 2VBBA 5FZKA 3NJYA 3OUIA 2P1BA 5IK5A 3OGVA 1D4M3 4I3GA 4NUBA 4GWNA 2ZEXA 1XOYA 5C3SA 3IDCB 4AHWA 4D6SA 1WLCA 4IXLA 3UT0A 2E9QA 1LKNA 1UZYA 5FUPA 1EV13 4MGKE 1XRUA 3BOWA 3TAYA 1KXGA 2W52A 4A4AA 1K5MC 1FX5A 1MR5A 1Q8PA 1W2OA 3H1YA 4WV8A 3R4UA 3K4DA 4AI9A 1HB3A 2PFWA 2YU1A 2FDJA 4HKWA 1ULPA 1K5JA 2WQ8A 2C1FA 2BNOA 2R0FA 3ACFA 4R9BA 1WBLA 1OT5A 5BUVA 2AUYA 3WDTA 3NW4A 3OB8A 2J1VA 3ZSKA 1V9U3 3ZFGA 3B5LB 2DCYA 5FRAA 3CNAA 3RZLA 1W6MA 4FCAA 4JTOA 5FY7A 3VDBA 2R071 3BTAA 5B4XA 2ZGSA 4OULA 3UK9A 3URFA 1Q8SA 4BCUA 4EN0A 4G3YC 1U5IA 1DQ0A 2ZX1A 4DRVA 1M4WA 1U5XA 3PTYA 3PUIA 4OUEA 2Y33A 1MS0A 1ZRFA 1O3QA 1D2SA 3LQCA 1AL21 3AFKA 1OKQA 2Y6LA 2Y8KA 5GZCA 3KM5A 3AKTA 1GOGA 5CNAA 1A8DA 3NSTA 3ZKUA 1A3KA 3R6SA 2E26A 1AUYA 1NA1B 1MQTB 3VDDA 2GNMA 2GH2A 1LGBA 2QTWB 4IV1B 1ULOA 4Y24A 2XMLA 4UFHA 1W8ZA 2O8OA 3H8XA 1GZWB 3OCPA 4FTEA 4AE2A 1HX6A 3ZSMA 1XYOA 3ZYPA 5FPXA 2P34A 2D6KA 2XUMA 2OKXA 4Q0QA 1JXNA 1VAKA 5KHJA 1RHI1 2DFBA 3PMSA 1ZBA3 5CIRA 1TVGA 1RMU3 2OUJA 5FXXA 5J36A 4HVRA 1DQ4A 4Q0PA 4AEDA 4XC9A 4XETA 4XJWA 4CCOA 4N90A 5SV8A 3FWEA 3LSDA 4LIVA 1MVQA 2WO1A 4PJYA 3WUCA 5LA2A 3HT2A 3AC0A 2OZ6A 1FAYA 2XL9A 1KFUL 4CCDA 5E6HA 5AFEA 2H0BA 2B5HA 4JKMA 3AYEA 4AQTA 3WQBA 1QXRA 1W9TA 1EY2A 3I3QA 3LEMA 5L7OC 3SCFA 2W39A 5FYCA 3FBYA 3NAPB 4R8HA 1QQP1 5IVJA 3CKHA 1HW5A 3VBFA 2R072 5A70A 4LBQD 5FYTA 4UW3A 1OVSA 3D3AA 2GZWA 5EYXA 2GNDA 1QH7A 3POYA 1YCIA 1UY1A 4KBBA 2J1SA 5CFCC 1AL22 4KG8A 2W94A 1OA3A 5CBLA 2VCAA 1TNRA 4LLOA 3N9NA 3MIFA 1BEV1 4XW3A 4BIOA 3OSDA 2HWD3 1RUF3 4I30A 1S0JA 2DFCA 5FMBA 2VL4A 3WCRA 3RSJA 5C9AA 5L19A 3ZFGB 1Y9MA 3LA7A 3K77A 4Q1PA 4QX5A 1RGSA 1YFUA 3ILNA 3MPPG 2XR4A 3HR9A 3SEPA 4IEPA 5FWEA 4RQPC 4XBNA 4OQ9A 3NNGA 4BQ1A 1IKPA 1IS3A 2A5ZA 3CJIC 3U0ZA 3DPRA 5IAVA 3WP4A 4L97A 3LOIA 2VUCA 1R083 4AGRA 4R52A 3NV2A 4PBOA 1EAH1 4UFMA 4AI2A 1RHI2 4J25A 1PVC3 5FAXA 1HQWA 1STMA 1ZBE3 2HEYF 2ID4A 4YZ2A 1IG3A 1AYN1 2HKXA 1CX4A 4H3WA 1HJGA 1ZZBA 1UCXA 2HWB2 3VD9A 4AI0A 1O4YA 1V00A 1M06G 2BFUS 2V5YA 3VDDB 2BUKA 1ZRIA 2JDKA 4Y22A 3UV9A 1Y3TA 4ZPIA 1NZCA 1SDWA 3PL0A 5T5LA 1DFQA 5CU1A 1UL9A 3KT1A 3H42B 4YM1A 3VKOA 2DU1A 2EXJA 1LHNA 4LLFA 3SLIA 3I2HA 4AFMA 3I8TA 4LULA 2A71A 1O5UA 4JHZA 5LK7B 1GWLA 1LOCA 5KHGA 2QQUA 4FI9A 1QQP2 1DLCA 1G7YA 3KCYA 4IGOA 4RA0A 3BTXA 2JD4A 1LODA 3JZVA 4ZU7A 2YPJA 2WLPA 5A3OA 1AL0G 3I3EA 1AR61 4KH9A 2XQRA 3KQ4B 2JEMA 4AEDB 1XSQA 4AQ6A 4CCJA 2HBTA 2PHWA 2CV6A 4B4QA 1SLBA 4EJRA 1S0CA 4AFAA 4WM7C 4XBLA 4CUCA 1WD3A 3MIEA 4LJHA 3OUJA 1VALA 3FFQA 2P17A 5LRSA 1BEV2 1VB4A 1ZRRA 4AL9A 1YQCA 3D6EA 1JMUB 4YW2A 2YUEA 3VL8A 4CDWC 1JZ8A 1DQ2A 3A7QA 1VPHA 2ZHLA 3Q8BA 4QMAA 2ZX3A 3PJQA 4HVQA 3POIA 1OQ1A 1OH3A 1JZ5A 2QE3A 4DQAA 2D6NA 3VBFB 3CF6E 2ETEA 1KJLA 2OZJA 2Z5WA 3W59A 4B1MA 4KL1A 4ASKA 2C9KA 2G4IA 5LBEA 3KT4A 1ZVFA 3DEMA 5IFPA 3A0NA 1C57A 2ZTNA 3AXEA 5FZGA 4C0BA 1EAH2 3I3MA 4PDWC 4X6QB 1A34A 2Y6KA 2RDQA 4LK7A 2EAAA 1REDA 1SEFA 2A70A 5JVVA 5IVFA 1AYN2 2C26A 5C70A 1D4M1 2CDPA 2X5IA 5C9AB 4OUMA 1UN1A 3FMGA 1OLQA 4ORFA 4BK5A 4ET7A 1HLCA 4Q27A 1CZSA 4Q2FA 4L11A 1R1A3 1SPPA 4AF9A 1RC6A 3UL2A 1A8MA 2P5BA 2WO3A 1EV11 2JD9A 1W8WA 3VD4A 4D3WA 2B46X 2Y64A 3I7DA 4L2NA 3S5QA 4FPJA 4XQ4A 2ZZQA 4XUQA 3DPRB 3WNNA 3K75B 3T0DA 4LBQA 3RDIA 3VHNA 2WWJA 1QNYA 3OGSA 1AR62 3H8UA 1WUVA 3KGZA 1ENRA 4AQSA 2UYBA 2VOVA 2QQJA 1YIFA 1Q56A 2I07B 4ZU5A 3WF3A 1NA1C 1MQTC 1GWMA 2C24A 4PCRA 4XURA 5I8TA 4Y22B 2D3RA 4XTPA 1UU5A 2AENA 1C5IA 1J3RA 2KM2A 4BH9A 2BOJA 3RRDA 2ZGMA 1FMD3 3M3OA 4NROA 1EUTA 3LF7A 3O7OA 4IEOA 1XU2A 1BZWA 1XNDA 3JB4C 4OCTA 1SFYA 5C33A 3S7EA 1BYHA 1G9FA 1XJAA 5C7GA 4BISA 5GZGA 2O1QA 4H55A 4AW7A 5A7OA 1JS9A 4Y33A 2V72A 1O3RA 1BLZA 1PO13 5FY5A 2OYZA 1P8JA 3IAQA 5KHHA 5IFTA 1BJQA 3MF6A 5F39A 2VZSA 5F3CA 3K4AA 4GB33 4CTEA 2WT2A 1D4M2 3M3IA 1YXWA 4QPYA 5C71A 5D21A 4XUPA 2ZGTA 3GBFA 1IPJA 2R32A 5LBCA 4OQ8A 4URTA 4CSWA 2Q8CA 3KS7A 1EV12 1XQNA 4GKXA 4L0PA 2UURA 1S1AA 4DPNA 4WBBA 2PXJA 3AYCA 3HNMA 3NNJA 1LESA 4MGZE 1ZBA1 3D0JA 4C1XA 3MW2A 3VBOA 1RMU1 1HQLA 4GKYA 4OLLA 3VBSC 3KT7A 3WNMA 3Q8FA 2ES3A 2VECA 2JIGA 3H3ZA 4HLTA 2A6VA 2NZ9A 4M4PA 5FZ8A 1X7NA 1J1LA 2BGCA 4QWNA 1V6IA 2X5IB 2WFF3 3B9CA 3MI8A 3WG2A 3M3EA 4JKKA 4AFDA 1SPPB 3AKRA 4LHKA 2B42B 3T2QA 2LUWA 4GMP3 4JX0A 3AM2A 1GNZA 3RWNA 3BPZA 4HANA 4GD4A 1DGRN 1FOD3 3RVHA 3WQ1A 3GDBA 3QD6A 3ZN6A 2VMCA 2CDOA 4LBQB 3VDCA 1W28A 2Q1FA 4NRMA 4BLIA 2YC0A 4LKFA 1H6YA 4JZRA 3TEYA 1RVF3 4EQVA 3W5MA 2W08A 1WA6X 2CGOA 2IZWA 2HWD1 4KG0A 1REFA 1RUF1 1VMJA 1CD3G 3VDDC 1BHGA 2QQPA 5JI9A 1SHWB 4KMQA 3PNAA 4UXAA 3JD73 5JPNB 1UPIA 4M3CA 1Z7S3 1ZRDA 2JDPA 3LA3A 4ITCA 1A78A 1NQDA 2Y0OA 5CKNA 1VMHA 5ERLA 4BE3A 5IVEA 3D8CA 4UBHA 2JG9A 4YZ5A 2BGOA 1RUD3 1R081 4UYBA 5T50A 3WT3A 2WYFA 3RZGA 4LKSA 1PVC1 1ZBA2 2RS33 2Y6FA 3AKSA 1ZBE1 4AEDC 1RMU2 2R1BA 2R49A 2YC4A 3CQOA 4RGGA 3U4SA 1OHFA 5FPZA 2O0OA 5IYYA 3RJ2X 1DGWA 3GCWA 3HIFA 3ELNA 2ARCA 4ZU4A 2TEPA 3OEAA 4D6RA 1GP5A 3K4ZA 1DIWA 5FMOL 4CUBA 3FBMA 3PTRB 4Y1XA 2QQLA 5FK7A 1US3A 4KU7A 4XZPA 3F95A 4P00B 3ILRA 3OJBA 4LORA 4RD7A 3VHOA 3O1VA 1J84A 3AB0A 1GNYA 1LOEA 4ISRA 3VBFC 3KCCA 4IV3C 3GXUA 2G9ZA 1NE4A 2XUEA 4V1PA 3VBOB 3BU0A 5F3EA 3OF1A 2X10A 3HNYM 2VW2A 4MO3M 1YJLA 2XJTA 2KR2A 4A41A 2ARBA 4DRRA 5FXZA 1W0PA 4D6QA 1PX3A 5FFOC 5CFDA 1D4VB 1ZM1A 2HWD2 1RUF2 3C7GA 4FPKA 5J3UA 3EMRA 3N9QA 4XFIA 2D6PA 2P4EA 2OPKA 3ZYFA 4BB3A 1NOVA 1GQHA 2Y26A 3C7EA 3PUAA 1TE1B 4I0BA 4IEUA 5FMOS 1C1LA 2WS91 3DPRC 1O8SA 1FNZA 5A33A 2ORZA 2BP6A 3VD5A 4IGQA 3ZN6B 2ZGQA 4C1WA 1W06A 4IE4A 4EYUA 3LEKA 1DQ5A 3DYMA 3WNKA 3O1MA 2E7AA 2CL2A 1R082 1DU3D 4XPVA 1GLHA 2O8QA 2OQ6A 1PVC2 4OZXA 3BVCA 1ZBE2 4FSJA 4ZS2A 4MX3A 4NWVA 3OPTA 3IIAA 4JCKA 5EIYB 2VQAA 3VKMA 4BU2A 4S2FA 1W0NA 2DVFA 4FFIA 1R1A1 3KV6A 4L92A 4M3CB 4EWDA 4DY3A 5JMCA 2ZAAA 1EYBA 4J1WA 4QAWA 4YVSA 4OI1A 5TSWA 3WW3A 2VMHA 4BOWA 5F7UA 2AEYA 2YMZA 2JG9B 2ZKLA 4L99A 4AK3A 1AYM3 2XB6C 2WR9A 4IQPA 2FZ1A 4CDUC 1S2KA 1VR3A 3MUY1 3NNFA 4YGBA 2HBUA 3U1XA 1QJZA 5T54A 1W8NA 1CN1A 4JAAA 2GMEA 3D4KA 3AZXA 5FUIA 4CDXA 4CRQA 2E33A 1GANA 4E4ZA 4EN8B 4LUKA 1X8MA 1LOAA 1H0BA 5JI7A 4O9EA 4IERA 1L3JA 1I9RA 1DGRA 1E5SA 1FMD1 4JTNA 1W9SA 5FMDA 1ZZCA 4A3XA 1UAIA 1VRH1 3IMNA 4E8CA 1RJ8A 4XFCA 5JXJA 4HN1A 5KHIA 3FFZA 4LNVA 4Y5TA 4DXZA 4P9XA 2D6LX 1G9AA 4I3PA 4LK6A 2O14A 1PMJX 4UWDA 3U10A 3GZEA 1W9FA 4HVOA 4LO4B 5AFBA 5FLIA 1MS4A 4SBVA 2YFZA 3V64A 3WF4A 5JIAA 4Z82A 1PO11 1C1FA 1QIQA 2BVBA 2DURA 2H6CA 3IDEA 3N7MA 2UYAA 2VMGA 4DEQA 5IK7A 5L7OA 2ADEA 4QXHA 2R073 2WZR3 1AR83 4DB5A 4LXLA 5A6ZA 2A6ZA 3WDWA 4YVWA 1GBGA 5CFDB 2FCUA 5GLUA 2VQUA 4YW5A 1LHOA 5K0UA 1N47A 1R1A2 4NN0A 1OA4A 4P9IA 1Y7BA 2P6HA 1YJKA 2P3IA 4I0AA 1IPSA 5A7PA 1XU1A 4FTSA 1IQAA 4CCMA 5A33B 1ENXA 2QDNA 3K48A 3FLRA 4YLZA 2RJKA 5J98B 2XJSA 1QKQA 1OF4A 1RUC3 2WBKA 3CO2A 5FZCA 4IEZA 4META 3LPFA 4DUVA 1U5ZA 3MGUA 4XJZA 3ASIA 5FJKA 3PUQA 2ERFA 4A45A 3DV8A 3HEIA 4H2AA 2PAEA 2WFF1 4IEYA 2WO2A 2YROA 3VUOA 1TNFA 1F9KA 4CXWA 2GP5A 1ST8A 4MGQA 1U5YA 2ZXQA 2ADDA 5A32A 1VAVA 5FCCA 3SCHA 3U11A 3PVOA 4FQ4A 4BQ2A 5A1LA 4GMP1 1D7PM 3WY6A 3ZO0B 1XE7A 1UU4A 1FMD2 3ACGA 3IMMA 1XNKA 1UX6A 2WQZC 1F5FA 4B29A 1H2LA 1VRH2 2QDRA 1DYOA 2W0XA 4YVSB 5HCFA 4E4SA 4FT8A 4OI4A 1SACA 1VP6A 2Z4FA 3KLSA 5DDJ3 4LKDA 2VBPA 3OPWA 3POBA 4UW5A 4D7TA 3J7MA 1O4ZA 5FZMA 4LHSA 1G9CA 1PO12 2BJSA 2FD8A 5C5UA 2JXAA 2MNGA 2C9AA 3Q9OA 4CDXB 1LULA 1CZVA 1ULFA 2GC2A 4GB32 4Q4W3 3AMHA 2Y6JA 2VMEA 3JD71 5HCHA 1WWYA 4YW4A 1Z7S1 2B8MA 4O7XA 2F4PA 1POQA 3TYJA 1VBC3 3WOGA 3KCXA 2PHUA 1OMIA 3BUCA 1RUE3 4TN7A 1MPXA 3LA2A 4YG3A 4WM7A 4CYDA 1WW5A 4O61A 1BEV3 1ND3A 2FDIA 5C6CA 1RUD1 5A3WA 3B02A 3P1IA 4QQLA 2ZEZA 2XLAA 1RL3A 3NNMA 1DQ1A 5FY1A 1QEXA 2RS31 5AVPA 4CDWA 1UYPA 2W46A 1F4AA 4LO5B 1W2UA 1VBA3 1KS4A 1HRV3 4BQ5A 5JSPA 5L7OB 2BBVA 2VH9A 1SBFA 1ZYBA 4K21A 5HV4A 4NPMA 2LROA 3LFMA 4YVWB 5A7NA 5FIXA 4A7YA 3ZXJA 4BZ4A 2WFF2 4YW3A 5LBFA 3WDYA 5LK5A 5K0UB 5L9RA 2QQVA 1QWRA 1TME3 3NWKA 4EE2A 4OHZA 4RSUA 1LOFC 2D40A 3FX3A 1JYCA 2AEZA 4LBJA 2QJVA 3APBA 3AXDA 4GULA 3T2OA 4ARYA 1FOD2 5KXEA 2IFRA 3CHXA 2J22A 4FFFA 2VZOA 4P9GA 5A7SA 3E5XA 4MUVA 3WF1A 2HJIA 4KU8A 2BNNA 2E31A 4Y1VA 2KXLA 3ZN4A 1JU4A 4UI9L 5D1IA 2ZAHA 1RUH1 3HD8B 3LAGA 4B3NA 4DNYA 5JDBA 1N3PA 1XNTA 4LO8A 2Q0AA 1UIKA 3CL1A 5F32A 5A32B 1NT0A 4QM8A 1AR63 4M0HA 4JDMA 1CR7A 3JD72 5EWSA 4DUXA 4LTAA 5FYHA 1Z7S2 2HWC3 1YC61 3DYPA
chains in the Genus database with same CATH topology
2VC9A 1WCQA 3K77A 2JKXA 3SEPA 1TG7A 1K45A 2J1TA 3NNGA 3SEEA 4KI5M 3IIIA 4CVUA 2DCJA 2ID4A 1GMMA 3K46A 2WN3A 2VMDA 4BJ0A 3VD9A 5JR2A 2C4XA 5G05L 2LW8A 3HN3A 4LPLA 3EB7A 3OBAA 3I2HA 4YPJA 2VQTA 4JHZA 1SDDB 4UAPA 4FI9A 1DLCA 1W99A 1CX1A 3I3EA 2W92A 4CU8A 4D0QA 5I0DA 1UYYA 4A6OA 2Y6GA 4XUTA 1O59A 2J7MA 3UESA 1JZ8A 2QBXA 3A7QA 4M4RA 4TXWA 2J1RA 3IB3A 2VCCA 1K12A 1JZ5A 3F2ZA 1KEXA 4ZZ5A 4W50A 2C9KA 5IFPA 3FHAA 2W47A 3CZJA 1PMHX 3NQHA 1UXZA 1OF3A 1OD3A 2E32A 2Y6KA 3U37A 1SG3A 2EIBA 4ARXA 2C26A 5C70A 2CDPA 3FN9A 3ABZA 3WSOA 4BK5A 4GZ9A 4ET7A 1CZSA 2VZQA 4D8MA 2YG0A 2WO3A 2JD9A 3LE0A 3VD4A 2RV9A 2Y64A 1UY3A 3C8XA 1JZ3A 4XUQA 2L9LA 3WNNA 4BDVB 4QX2A 3K75B 3T0DA 1JI6A 1UXXX 4CUAA 2DCKA 2RVAA 5G04L 3OGSA 4IUGA 2WAAA 2QQJA 4BK4A 3WF3A 3DECA 4XURA 3DYOA 3I2GA 1JZ2A 4P02B 4QDSA 4GWIA 4JKLA 1EUTA 1JYVA 4P5YA 3T08A 1JYNA 4QX3A 1H6XA 5C7GA 1NKGA 4QB2A 5EJ1B 1JZ6A 3CZUA 1HN1A 2V72A 2W1SA 4A3ZA 1P8JA 3IAQA 5IFTA 2VZSA 3LEIA 3K4AA 2VZ1A 3LPGA 4OYUA 1K42A 4DXRA 5C71A 1UYZA 4XUPA 4PQQA 5JXHA 3MV11 2WABA 4HG6B 2EIEA 1NAEA 4L0PA 2W9XA 2XQXA 3HNMA 2V5DA 2B4KA 3WNMA 1F4HA 5JUVA 2VZ3A 5DN2A 3I2KA 4M4PA 4A44A 1UX7A 4MADA 5JMOA 1GUIA 4OMDA 3VDAA 2YB7A 4JKKA 3IAPA 3I3BA 1JYXA 3T2QA 4JX0A 2W3JA 3WNKA 3MUZ1 1XNAA 4CU9A 2QQNA 2EICA 3GDBA 5A1AA 2VMCA 2CDOA 3HNBM 3VDCA 2RJ2A 4DEVA 2DDUA 4QDRA 1H6YA 3W5MA 3HPNA 3I2JA 3OEBA 2KD7A 4OMCA 1BHGA 4XUOA 1SHWB 3I97A 1O8PA 4KMQA 3HJRA 5CYYA 1UMIA 4RYDA 1YQ2A 2VJXA 2VZPA 1W8OA 3BGAA 5B4NA 2WYSA 3NJVA 2BGPA 3THDA 3E1F1 5IHRA 2BGOA 1UMHA 1RYYA 2WUHA 4LKSA 3NRUA 3WF2A 2YC4A 3CQOA 3FHQA 3NJXA 4QPWA 2YFUA 5IYYA 2X09A 1CIYA 3J7HA 4CU6A 4E8DA 3OEAA 1GOHA 5JXIA 1EUUA 2VZUA 3K4ZA 3C7HA 4CUBA 2QQLA 1US3A 2R7EB 3GM8A 4P00B 1J84A 1GNYA 2WAOA 3I3DA 2ORXA 1XC6A 2VO5A 2HYXA 4DXTA 4ZZ8A 3GXUA 3WF0A 3HOBA 2X10A 3HNYM 2WN2A 4XVHA 1GOFA 4MO3M 1JZ7A 2JDAA 2J1AA 1W9WA 4A41A 4QDQA 5DPNA 3W5NA 3T0BA 1K3IA 1PX3A 3ACIA 3ACHA 3C7GA 2QQKA 3GGLA 3UNPA 4XUNA 3C7FA 1I5PA 4UOJA 3C7EA 1UY4A 4QX0A 3T0AA 1O8SA 2ORZA 3VD5A 4LQRA 3LEKA 3DYMA 4AAXA 1DP0A 3UETA 4QB1A 4XZUG 4PT6A 1UWWA 5EIYB 3T2PA 1UY2A 1GU3A 1W0NA 2WZ8A 5HPOA 1JU3A 2W1UA 2W1QA 2JE8A 4BXSV 4TTGA 4QAWA 2BZDA 3CMGA 5F7UA 3PUHA 1L7RA 2J1EA 2VZTA 1UY0A 3C7OA 1UYXA 2VZRA 5IJRA 4MGSA 2ZEWA 3MUY1 4MOAA 4W4ZA 3MV01 5JXGA 1W8NA 5FUIA 5DMYA 2E33A 3MO4A 3I2FA 2QQIA 4QB6A 2ZEYA 3VD3A 3WNPA 1US2A 1W9SA 2YC2A 1JYWA 3JXSA 4E8CA 5JXJA 3IDAA 3LEGA 3BN6A 1JHJA 2EIDA 4QX1A 1PMJX 4OZOA 1UZ0A 3ETPA 3WF4A 3WNOA 2YFZA 2VMFA 4ZXEA 1NUKA 4DEQA 3I2IA 2W91A 2B9VA 3A21A 2PQSA 4ZY9A 1J83A 1T2XA 4A42A 3ZM8A 5LCWL 3WNLA 2VQUA 3CIHA 3A23A 3OGRA 3EYPA 3P6BA 3OGVA 2QQMA 4DUWA 2ZEXA 1WKYA 2VCBA 2HLEA 4GWJA 2BERA 2XHNA 2WBKA 1OF4A 4CU7A 4DUVA 3LPFA 3OG2A 3T09A 4A4AA 4A45A 3HEIA 3K4DA 2WO2A 4CUCA 1ULPA 4MGQA 2WQ8A 2ZXQA 3ACFA 1OT5A 1JZ4A 2WDBA 1IQDC 1D7PM 5CZKA 3OB8A 3ACGA 2J1VA 3FL7A 1DYOA 4W8JA 2Z4FA 5DQ0A 3VDBA 1PX4A 5J1XA 5B4XA 4LHSA 3PUIA 4OUEA 3LQCA 1CZVA 2WZEA 2XONA 4AG4A 5LA0A 2Y6LA 2Y8KA 2Y6JA 2VMEA 4PF1A 1GOGA 2E26A 1MPXA 1ULOA 2VZVA 3A22A 1LNSA 3P1IA 3SKVA 2ZEZA 2VR4A 2QQOA 2Y6HA 2X05A 2W46A 5EJZB 1KGYA 1F4AA 4KWUA 3CDZB 3VD7A 2W95A 1GQPA 2OKXA 2XOMA 2LS6A 1TVGA 5LA1A 1OH4A 2BBAA 3ECQA 2W1WA 2W5FA 5HXMA 4RN5A 4Z2AA 2WO1A 5LA2A 3AC0A 3MBWA 2VM9A 1CZTA 2VOTA 4JKMA 3T2OA 4ARYA 4DXSA 2J22A 3WQBA 3WEZA 2VZOA 1W9TA 3WF1A 3CKHA 4P08A 2E31A 1XPWA 1JU4A 3D3AA 4UI9L 1L7QA 2V4VA 1NX9A 2VTFA 1XNTA 1UY1A 2J1UA 2J1SA 3THCA 2W94A 3SKJE 2VCAA 2W87A 1R64A 4DUXA 2VL4A 3DYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VC9 A;  1WCQ A;  3K77 A;  2JKX A;  3SEP A;  1TG7 A;  1K45 A;  2J1T A;  3NNG A;  3SEE A;  4KI5 M;  3III A;  4CVU A;  2DCJ A;  2ID4 A;  1GMM A;  3K46 A;  2WN3 A;  2VMD A;  4BJ0 A;  3VD9 A;  5JR2 A;  2C4X A;  5G05 L;  2LW8 A;  3HN3 A;  4LPL A;  3EB7 A;  3OBA A;  3I2H A;  4YPJ A;  2VQT A;  4JHZ A;  1SDD B;  4UAP A;  4FI9 A;  1DLC A;  1W99 A;  1CX1 A;  3I3E A;  2W92 A;  4CU8 A;  4D0Q A;  5I0D A;  1UYY A;  4A6O A;  2Y6G A;  4XUT A;  1O59 A;  2J7M A;  3UES A;  1JZ8 A;  2QBX A;  3A7Q A;  4M4R A;  4TXW A;  2J1R A;  3IB3 A;  2VCC A;  1K12 A;  1JZ5 A;  3F2Z A;  1KEX A;  4ZZ5 A;  4W50 A;  2C9K A;  5IFP A;  3FHA A;  2W47 A;  3CZJ A;  1PMH X;  3NQH A;  1UXZ A;  1OF3 A;  1OD3 A;  2E32 A;  2Y6K A;  3U37 A;  1SG3 A;  2EIB A;  4ARX A;  2C26 A;  5C70 A;  2CDP A;  3FN9 A;  3ABZ A;  3WSO A;  4BK5 A;  4GZ9 A;  4ET7 A;  1CZS A;  2VZQ A;  4D8M A;  2YG0 A;  2WO3 A;  2JD9 A;  3LE0 A;  3VD4 A;  2RV9 A;  2Y64 A;  1UY3 A;  3C8X A;  1JZ3 A;  4XUQ A;  2L9L A;  3WNN A;  4BDV B;  4QX2 A;  3K75 B;  3T0D A;  1JI6 A;  1UXX X;  4CUA A;  2DCK A;  2RVA A;  5G04 L;  3OGS A;  4IUG A;  2WAA A;  2QQJ A;  4BK4 A;  3WF3 A;  3DEC A;  4XUR A;  3DYO A;  3I2G A;  1JZ2 A;  4P02 B;  4QDS A;  4GWI A;  4JKL A;  1EUT A;  1JYV A;  4P5Y A;  3T08 A;  1JYN A;  4QX3 A;  1H6X A;  5C7G A;  1NKG A;  4QB2 A;  5EJ1 B;  1JZ6 A;  3CZU A;  1HN1 A;  2V72 A;  2W1S A;  4A3Z A;  1P8J A;  3IAQ A;  5IFT A;  2VZS A;  3LEI A;  3K4A A;  2VZ1 A;  3LPG A;  4OYU A;  1K42 A;  4DXR A;  5C71 A;  1UYZ A;  4XUP A;  4PQQ A;  5JXH A;  3MV1 1;  2WAB A;  4HG6 B;  2EIE A;  1NAE A;  4L0P A;  2W9X A;  2XQX A;  3HNM A;  2V5D A;  2B4K A;  3WNM A;  1F4H A;  5JUV A;  2VZ3 A;  5DN2 A;  3I2K A;  4M4P A;  4A44 A;  1UX7 A;  4MAD A;  5JMO A;  1GUI A;  4OMD A;  3VDA A;  2YB7 A;  4JKK A;  3IAP A;  3I3B A;  1JYX A;  3T2Q A;  4JX0 A;  2W3J A;  3WNK A;  3MUZ 1;  1XNA A;  4CU9 A;  2QQN A;  2EIC A;  3GDB A;  5A1A A;  2VMC A;  2CDO A;  3HNB M;  3VDC A;  2RJ2 A;  4DEV A;  2DDU A;  4QDR A;  1H6Y A;  3W5M A;  3HPN A;  3I2J A;  3OEB A;  2KD7 A;  4OMC A;  1BHG A;  4XUO A;  1SHW B;  3I97 A;  1O8P A;  4KMQ A;  3HJR A;  5CYY A;  1UMI A;  4RYD A;  1YQ2 A;  2VJX A;  2VZP A;  1W8O A;  3BGA A;  5B4N A;  2WYS A;  3NJV A;  2BGP A;  3THD A;  3E1F 1;  5IHR A;  2BGO A;  1UMH A;  1RYY A;  2WUH A;  4LKS A;  3NRU A;  3WF2 A;  2YC4 A;  3CQO A;  3FHQ A;  3NJX A;  4QPW A;  2YFU A;  5IYY A;  2X09 A;  1CIY A;  3J7H A;  4CU6 A;  4E8D A;  3OEA A;  1GOH A;  5JXI A;  1EUU A;  2VZU A;  3K4Z A;  3C7H A;  4CUB A;  2QQL A;  1US3 A;  2R7E B;  3GM8 A;  4P00 B;  1J84 A;  1GNY A;  2WAO A;  3I3D A;  2ORX A;  1XC6 A;  2VO5 A;  2HYX A;  4DXT A;  4ZZ8 A;  3GXU A;  3WF0 A;  3HOB A;  2X10 A;  3HNY M;  2WN2 A;  4XVH A;  1GOF A;  4MO3 M;  1JZ7 A;  2JDA A;  2J1A A;  1W9W A;  4A41 A;  4QDQ A;  5DPN A;  3W5N A;  3T0B A;  1K3I A;  1PX3 A;  3ACI A;  3ACH A;  3C7G A;  2QQK A;  3GGL A;  3UNP A;  4XUN A;  3C7F A;  1I5P A;  4UOJ A;  3C7E A;  1UY4 A;  4QX0 A;  3T0A A;  1O8S A;  2ORZ A;  3VD5 A;  4LQR A;  3LEK A;  3DYM A;  4AAX A;  1DP0 A;  3UET A;  4QB1 A;  4XZU G;  4PT6 A;  1UWW A;  5EIY B;  3T2P A;  1UY2 A;  1GU3 A;  1W0N A;  2WZ8 A;  5HPO A;  1JU3 A;  2W1U A;  2W1Q A;  2JE8 A;  4BXS V;  4TTG A;  4QAW A;  2BZD A;  3CMG A;  5F7U A;  3PUH A;  1L7R A;  2J1E A;  2VZT A;  1UY0 A;  3C7O A;  1UYX A;  2VZR A;  5IJR A;  4MGS A;  2ZEW A;  3MUY 1;  4MOA A;  4W4Z A;  3MV0 1;  5JXG A;  1W8N A;  5FUI A;  5DMY A;  2E33 A;  3MO4 A;  3I2F A;  2QQI A;  4QB6 A;  2ZEY A;  3VD3 A;  3WNP A;  1US2 A;  1W9S A;  2YC2 A;  1JYW A;  3JXS A;  4E8C A;  5JXJ A;  3IDA A;  3LEG A;  3BN6 A;  1JHJ A;  2EID A;  4QX1 A;  1PMJ X;  4OZO A;  1UZ0 A;  3ETP A;  3WF4 A;  3WNO A;  2YFZ A;  2VMF A;  4ZXE A;  1NUK A;  4DEQ A;  3I2I A;  2W91 A;  2B9V A;  3A21 A;  2PQS A;  4ZY9 A;  1J83 A;  1T2X A;  4A42 A;  3ZM8 A;  5LCW L;  3WNL A;  2VQU A;  3CIH A;  3A23 A;  3OGR A;  3EYP A;  3P6B A;  3OGV A;  2QQM A;  4DUW A;  2ZEX A;  1WKY A;  2VCB A;  2HLE A;  4GWJ A;  2BER A;  2XHN A;  2WBK A;  1OF4 A;  4CU7 A;  4DUV A;  3LPF A;  3OG2 A;  3T09 A;  4A4A A;  4A45 A;  3HEI A;  3K4D A;  2WO2 A;  4CUC A;  1ULP A;  4MGQ A;  2WQ8 A;  2ZXQ A;  3ACF A;  1OT5 A;  1JZ4 A;  2WDB A;  1IQD C;  1D7P M;  5CZK A;  3OB8 A;  3ACG A;  2J1V A;  3FL7 A;  1DYO A;  4W8J A;  2Z4F A;  5DQ0 A;  3VDB A;  1PX4 A;  5J1X A;  5B4X A;  4LHS A;  3PUI A;  4OUE A;  3LQC A;  1CZV A;  2WZE A;  2XON A;  4AG4 A;  5LA0 A;  2Y6L A;  2Y8K A;  2Y6J A;  2VME A;  4PF1 A;  1GOG A;  2E26 A;  1MPX A;  1ULO A;  2VZV A;  3A22 A;  1LNS A;  3P1I A;  3SKV A;  2ZEZ A;  2VR4 A;  2QQO A;  2Y6H A;  2X05 A;  2W46 A;  5EJZ B;  1KGY A;  1F4A A;  4KWU A;  3CDZ B;  3VD7 A;  2W95 A;  1GQP A;  2OKX A;  2XOM A;  2LS6 A;  1TVG A;  5LA1 A;  1OH4 A;  2BBA A;  3ECQ A;  2W1W A;  2W5F A;  5HXM A;  4RN5 A;  4Z2A A;  2WO1 A;  5LA2 A;  3AC0 A;  3MBW A;  2VM9 A;  1CZT A;  2VOT A;  4JKM A;  3T2O A;  4ARY A;  4DXS A;  2J22 A;  3WQB A;  3WEZ A;  2VZO A;  1W9T A;  3WF1 A;  3CKH A;  4P08 A;  2E31 A;  1XPW A;  1JU4 A;  3D3A A;  4UI9 L;  1L7Q A;  2V4V A;  1NX9 A;  2VTF A;  1XNT A;  1UY1 A;  2J1U A;  2J1S A;  3THC A;  2W94 A;  3SKJ E;  2VCA A;  2W87 A;  1R64 A;  4DUX A;  2VL4 A;  3DYP A; 
#chains in the Genus database with same CATH topology
 1OUX A;  3ON7 A;  4QPI C;  4QXK A;  5FBZ A;  2WC2 A;  1WLT A;  4TLF A;  3WZ1 A;  4IGP A;  4XAB A;  1TG7 A;  1RUD 2;  3SC7 X;  1S0D A;  4JRA A;  2RS3 2;  1W3V A;  2AGS A;  2ZHK A;  3EHK A;  5GLW A;  5IW0 A;  5ACA 1;  2WFP A;  5J7M A;  2DV9 A;  2DCJ A;  3JU9 A;  5FYY A;  4JGY A;  3BU7 A;  5FY8 A;  4XDO A;  1CJD A;  4L8Q A;  2ET1 A;  3B7M A;  3K46 A;  2WN3 A;  4BJ0 A;  1QXJ A;  1UU6 A;  3NKT A;  4E9K A;  3N7L A;  3KMH A;  1IG0 A;  3H8R A;  4JQR A;  5G05 L;  4WM7 B;  5FYZ A;  1ND3 B;  2JB4 A;  4GWM A;  1G6N A;  1AYM 1;  2IUW A;  5FO7 B;  5FTT C;  1LGN A;  3MIC A;  1H1A A;  1BCX A;  4PLM A;  2VQT A;  2OX0 A;  4CDW B;  5J96 B;  1LEM A;  5IAT A;  5FBJ A;  4URA A;  3VZK A;  4UAP A;  4KWJ A;  3OGJ A;  5LAS A;  2LAL A;  5L36 A;  2YYO A;  1XSR A;  1WCD J;  2RS1 3;  3B94 A;  3LZZ A;  1CQ9 A;  5IVC A;  1CX1 A;  3A0K A;  5CFD C;  4BQY A;  2W92 A;  4CU8 A;  4D0Q A;  4EZH A;  1RUH 2;  2FDF A;  4LE3 A;  3C2U A;  5LEK A;  4ISQ A;  4XDQ A;  5DAQ A;  1RUO A;  3KB5 A;  3VBS A;  5JSO A;  1UYY A;  4UBG A;  4Y4R A;  1N1S A;  1IS6 A;  1ODM A;  3OTF A;  4PDW B;  4YNI A;  5JWP A;  3OBZ A;  5FPL A;  1HN0 A;  4EN7 B;  4NHK A;  4AEJ A;  3U4X A;  1KS5 A;  1H8V A;  4M4R A;  1POV 0;  2XWB B;  3IB3 A;  4WM8 A;  4K6B A;  1FPN 3;  4XDP A;  5T5P A;  4Y26 A;  1ZA7 A;  5FZ3 A;  2WZR 1;  1AR8 1;  2X8K A;  1ONA A;  4FOW A;  5ACA 2;  3FHA A;  1N3Q A;  1NE6 A;  1PMH X;  3J8F 1;  3NQH A;  3RZJ A;  1UXZ A;  1OF3 A;  2E32 A;  4QQP A;  1H1M A;  1SG3 A;  4ARX A;  4B7K A;  1RIT A;  3O1T A;  5A3U A;  1PNG A;  3U78 A;  4YVS C;  2VTX A;  3V0A A;  1WLW A;  4PQ9 A;  1NLQ A;  1W6N A;  2B9U A;  2IWG B;  1RUC 1;  1YIP A;  1AYM 2;  2YV8 A;  1S0I A;  2VD7 A;  4XCA A;  4QXC A;  1VE0 A;  2L9L A;  2QCS B;  4KNC A;  2CSG A;  5FDB A;  3MPB A;  2ZCW A;  4JGY B;  4NIA A;  4CDX C;  4YZ3 A;  5DAP A;  1NY7 1;  2FDH A;  3RYK A;  4Z8B A;  3KV5 A;  4XJ9 A;  3DEC A;  1QGL A;  1YUD A;  3ES4 A;  3U07 A;  3B93 A;  1H2M A;  4B4R A;  4Q4V 3;  3I2G A;  4AHY A;  2OII A;  1Y43 B;  5GM0 A;  1AR9 3;  3WW4 A;  4QDS A;  5DDJ 1;  4C90 A;  2CTV A;  1HRI 1;  1S0B A;  3CU7 A;  2VVE A;  2ZHN A;  3MFC A;  2JDN A;  2Q30 A;  2Q8O A;  2J42 A;  4QX3 A;  5DG2 A;  5LW9 A;  1OOP A;  1NKG A;  5EPA A;  1ODN A;  2DUP A;  2WZR 2;  1AR8 2;  1JZ6 A;  2BWA A;  1SLL A;  2WWS A;  4GH4 A;  4IV3 A;  4YVW C;  4AR2 A;  1IZ3 A;  4Q4W 1;  3TBD A;  3BKZ A;  2D44 A;  4XJA A;  5FY4 A;  3J8F 2;  4LOS A;  5K0U C;  3I49 A;  3VBS B;  1VBC 1;  3LEI A;  3M70 A;  4HPK A;  4JC1 A;  1RUE 1;  3Q8E A;  4P9Y A;  3PVB B;  3EBR A;  2DBN A;  2ARA A;  1MEC 3;  3MEP A;  3ZR6 A;  4DXR A;  3O1U A;  1UYZ A;  1T6B X;  2ZAB A;  2JDZ A;  5JXH A;  4LOT A;  4WM8 B;  2WAB A;  1CIW A;  1W9Y A;  4XF9 A;  1DYP A;  1VBA 1;  1RUC 2;  1W6M B;  1HRV 1;  2EIE A;  3ZYJ B;  2ZX4 A;  4LIT A;  1JTZ X;  2XH6 A;  1A6C A;  2VW1 A;  4HMZ A;  2RJL A;  5DAW A;  3L2Y A;  1OC1 A;  2XKO A;  1COV 3;  1F5J A;  4AVS A;  1XE8 A;  2C5D A;  2RMU 3;  2PN5 A;  5JUV A;  1BMV 1;  4RFT 0;  3T1L A;  5AVA A;  3EQE A;  4N43 C;  5H9S A;  1TMF 3;  4QKB A;  5F3I A;  2NPI A;  3I2K A;  1NY7 2;  4FPF A;  4CZS A;  1TME 1;  4A7K A;  4YZ4 A;  4QQ2 A;  1NCQ C;  2G1M A;  1V6J A;  3S7I A;  4LUM A;  4QGM A;  1NG0 A;  3V0A B;  4AYU A;  2VW0 A;  2WII B;  3P3N A;  4XIK A;  1RJ7 A;  1W6N B;  5DDJ 2;  4KBZ A;  5A7Q A;  3OBR A;  2A3W A;  1HRI 2;  4CU9 A;  1LAJ A;  2NP0 A;  5KHK A;  1VAM A;  5HCB A;  1PHM A;  1REE A;  2WJS A;  3LIH A;  4LKE A;  5A3L A;  2IXL A;  5FPA A;  5JOY A;  1D0G A;  4NE9 A;  3V56 A;  5HI0 A;  5KXD A;  2JX9 A;  1RXF A;  4Q4W 2;  4A2U A;  2VOK A;  3ZXL A;  1VBE 1;  4AI1 A;  3HPN A;  3DCQ A;  4CDU A;  4E4D X;  1MZF A;  2HWC 1;  3AJZ A;  5EJ3 A;  2KD7 A;  4OMC A;  1VBC 2;  3RGB A;  4ASM B;  2VQ0 A;  2CY6 A;  1RUE 2;  5IVV A;  2PHL A;  3I97 A;  1G8W A;  1O8P A;  1ND3 C;  3JBG 3;  1GQG A;  4RYD A;  5CYY A;  2EVX A;  5FPB A;  5A7W A;  3U14 A;  2VJX A;  5BNN A;  3BGA A;  3OY8 A;  4JHT A;  2HEW F;  3P3P A;  1POV 3;  2P3K A;  1DZR A;  3K2O A;  1ZNP A;  1O7F A;  1VBA 2;  1HRV 2;  3GF6 A;  1OOP B;  4HKL A;  3MLK A;  4AFC A;  2WS9 3;  2YHJ A;  1YNA A;  3LFI A;  2WUH A;  1YO8 A;  1AX2 A;  3IT8 A;  3KV9 A;  3BOP A;  3NRU A;  4GH4 B;  4IV3 B;  2XG3 A;  2DTW A;  3WF2 A;  3D0S A;  3FHQ A;  2K9Z A;  1BMV 2;  4QX7 A;  5LZ6 A;  3N9O A;  3KF5 A;  4CU6 A;  2A3Y A;  1LED A;  2Q5T A;  2YBK A;  4HPK B;  4E8D A;  3WP3 A;  2FDK A;  1TME 2;  2QZ3 A;  2XJP A;  4M3C F;  3ZXE A;  1GOH A;  2GC0 A;  3AMQ A;  4XTM A;  2XWJ B;  1B35 C;  4IND A;  4AQ2 A;  4D94 A;  4HK9 A;  3FJS A;  4YAR A;  4XXA A;  2DCZ A;  5CA6 A;  1LHW A;  2WAO A;  2ORX A;  5A6X A;  3VHR A;  4DXT A;  2RS1 1;  4UW6 A;  5I0S A;  3BPS A;  3C3V A;  3HOB A;  3HQR A;  2TNF A;  2ZPX A;  4IE0 A;  2EAL A;  3IWZ A;  3PU3 A;  4RHV 3;  4NAO A;  1GOF A;  4HET A;  1X9P A;  3H7Y A;  1W9W A;  4YGD A;  4FAH A;  1SBD A;  1TQ5 A;  4XJ8 A;  3G7D A;  4CP0 A;  3OD0 A;  1Q43 A;  3KZ4 C;  4N7I A;  4PIZ A;  3QLQ A;  1RUJ 3;  1H4G A;  2TBV A;  4P9J A;  2QQK A;  2HWC 2;  3FHI B;  1WCS A;  1OPM A;  4H14 A;  4DFS A;  3JCI A;  2XJR A;  3C7F A;  1FPN 1;  4UOJ A;  5FUN A;  1LHV A;  1KRI A;  3V65 A;  2ZGL A;  1UY4 A;  1WGP A;  3ZXA C;  2EIG A;  1OBN A;  1VRH 3;  2BDR A;  5FZD A;  4JGY C;  1AX0 A;  1PZ8 A;  4AAX A;  4K1Y A;  1DP0 A;  1W8F A;  1N1Y A;  3MID A;  3H9A A;  1DHK B;  3USU A;  4CDU B;  5C8C A;  1CAV A;  2Z69 A;  5CKQ A;  3WR0 A;  4NHX A;  3LB9 A;  1WMF A;  1VBD 3;  5A7W B;  3HQX A;  3RFR A;  3WDU A;  5BNN B;  2W1Q A;  2JE8 A;  4TTG A;  5DXD A;  3QCW A;  3OY8 B;  5IT6 A;  4AFB A;  1U0A A;  2BZD A;  1SCR A;  3MIG A;  4P9L A;  2VOX A;  2WKK A;  3PUH A;  1L7R A;  1SLI A;  3O0X A;  4FPG A;  4NRQ A;  2D6M A;  2RS1 2;  3ROU A;  1UYX A;  2XJU A;  2K2S A;  4PLO A;  3ZDS A;  1XNB A;  1ZZ8 A;  4GJZ A;  1VB2 A;  4W4Z A;  3MV0 1;  4FFH A;  4AZZ A;  5JXG A;  3KVB A;  3N7K A;  1F31 A;  4LBK A;  2A75 A;  2PYT A;  3KVA A;  1AR7 1;  4Q4V 1;  1CWP A;  2GN7 A;  1AR9 1;  3I2F A;  3GHN A;  4IEV A;  3SHR A;  1OQE A;  3FZ3 A;  1UQX A;  3VZM A;  1HB2 A;  3VLB B;  1DBN A;  1ULE A;  3MZH A;  1US2 A;  4WM8 C;  4NHL A;  4HL0 A;  1WCK A;  3JXS A;  4NJ4 A;  5LWB A;  5DZE A;  5C3P A;  3IDA A;  3ILF A;  1FPN 2;  1ZRC A;  4LT5 A;  3QH6 A;  1JHJ A;  2EID A;  1YYN A;  2XL7 A;  1QJU 3;  1LOF A;  1MS3 A;  2W68 A;  1JBC A;  5JZG C;  2X53 S;  1OXC A;  2GP3 A;  3ETP A;  3WNO A;  1W2T A;  3VZJ A;  1AJK A;  2VMF A;  4ZXE A;  4C0H A;  1MS9 A;  3ZYH A;  3VZO A;  3I2I A;  2D3P A;  3SQO A;  4XFB A;  2PQS A;  4ZY9 A;  3UGF A;  5IK8 A;  1T2X A;  2FCV A;  4AXO A;  3WNL A;  1MEC 1;  1RUI 3;  4IDZ A;  4CDQ A;  3A23 A;  2ARX A;  3RZZ A;  1JW6 A;  3WIN E;  1ULG A;  4CEY C;  2YDE A;  3P6B A;  4YFZ A;  1Z0H A;  1UOF A;  1WLD A;  3KQR A;  1WKY A;  4DUW A;  3VN4 A;  4F7Z A;  4TSV A;  2PLV 3;  4GWJ A;  1COV 1;  2BER A;  2XHN A;  4OFG A;  4QPI A;  2RMU 1;  5D2A A;  1UOG A;  3HMY A;  4RS5 A;  3ZPO A;  2XXZ A;  1DDL A;  1TMF 1;  3LDR A;  5F2S A;  3S5A A;  2BYV E;  2DVD A;  3OG2 A;  4PIY A;  1QJY 3;  2IVI B;  3N9M A;  3PVN A;  4N9H A;  5FZ9 A;  5F8P A;  5DAX A;  5HBA A;  4QHZ A;  1RB8 G;  2D97 A;  2XVL A;  4WZC A;  3NMB A;  5C8C B;  1GIC A;  2NMO A;  1CAV B;  2XJV A;  3GCX A;  3GJA A;  4TYS A;  5FP9 A;  3SMH A;  1CAW A;  4OHX A;  4W6X A;  5DAB A;  3X29 B;  2ZMK A;  4XF4 A;  4Q4V 2;  1AR7 2;  2VUL A;  3ZN5 A;  1AR9 2;  2WDB A;  5FLH A;  3ALQ A;  5CZK A;  1JZ4 A;  4I2O A;  5E16 A;  5FO8 B;  2PHT A;  2GC3 A;  1S4C A;  5A3N A;  2A3X A;  3FL7 A;  1OLM A;  4W6Y A;  1YQ8 A;  3AP4 A;  1OOP C;  1C8M 3;  3GYD A;  1AF9 A;  2CAV A;  4AHZ A;  4GH4 C;  1PM7 A;  5J1X A;  4JGZ A;  4XFA A;  4QT6 A;  3WXP A;  4KGQ A;  4GAL A;  3LOB A;  3RWK X;  5FYB A;  4CUG A;  1LEN A;  1HB4 A;  1GNH A;  4NO4 A;  1AXK A;  2WZE A;  2XON A;  4QM9 A;  4AG4 A;  4ATF A;  1U12 A;  5JOZ A;  1XE0 A;  3ATG A;  1PMI A;  3JBG 1;  3M7A A;  4LE4 A;  4OI2 A;  3VKF C;  1RUH 3;  4COY A;  1LOB A;  1MEC 2;  3VZL A;  2CHH A;  3UYJ A;  1OQD A;  5GZD A;  4FPC A;  2WNU C;  1POV 1;  4FVV A;  3ZX7 A;  3SIT A;  5JIU A;  2VZV A;  4YFW A;  3NO8 A;  1LNS A;  3SKV A;  2VR4 A;  1AVB A;  5B2G B;  2FMY A;  3HN1 A;  4C8D A;  4M00 A;  4U36 A;  5EJZ B;  4MVT A;  1COV 2;  3WP6 A;  1KGY A;  5F5I A;  5A3T A;  5FYM A;  2RMU 2;  4AAP A;  4KWU A;  3CDZ B;  2WL1 A;  1GQP A;  3BIW E;  3NKG A;  3RPQ A;  4YG0 A;  1TMF 2;  2XOM A;  4S2G A;  3AMP A;  1MS1 A;  4NRP A;  4Y20 A;  5ACA 3;  2BBA A;  1ASJ 3;  2FBE A;  3ECQ A;  3AYD A;  2H0V A;  3WP5 A;  2W5F A;  3ZLI A;  5HXM A;  3CBN A;  2VVD A;  3ZR5 A;  5J09 A;  4RN5 A;  4NPL A;  4CDQ B;  4Z2A A;  3VBH C;  3O1R A;  1F35 A;  5FMC A;  4CP2 A;  1CZT A;  4YM3 A;  5C3O A;  4FPH A;  4Y4Y A;  1FNY A;  4DXS A;  1RXG A;  5FZE A;  2FHR A;  2VNG A;  3PVE A;  4CCN A;  1PGW 1;  2SLI A;  3N3H A;  1ZX5 A;  2WZP P;  1Q5O A;  3WEZ A;  3ZMO A;  4QPI B;  3AP9 A;  3DF0 A;  4A6S A;  4RHV 1;  4Z07 A;  1J1T A;  2GNT A;  2JIJ A;  1PGS A;  4P08 A;  2ZX2 A;  3N35 A;  4R9A A;  4RS5 B;  3UGG A;  1WA4 A;  2R0H A;  1XPW A;  3R4S A;  4YZ1 A;  4HON A;  5KR7 A;  2V4V A;  1RUJ 1;  1CON A;  2VTF A;  2P3Y A;  3POJ A;  4MGT A;  1V0A A;  1CAW B;  4F8A A;  2UU8 A;  2ATF A;  2J1U A;  5FP8 A;  3ZFF C;  4AVC A;  4OHY A;  3JBG 2;  3SKJ E;  2XLG A;  5BNN C;  2HH9 A;  5DUV A;  2KA3 A;  4XF0 A;  5FPU A;  1ACC A;  4K7J A;  4NOT A;  4UFJ A;  5FYS A;  1WCQ A;  3MIB A;  3QH7 A;  4FOQ A;  4IEW A;  3PJY A;  4X6R B;  4FAG A;  1MZE A;  2EA7 A;  1W04 A;  1K45 A;  1RTV A;  1BBT 3;  5D8A C;  1ENQ A;  5EQU A;  2WS9 2;  5FYI A;  3SEE A;  2VUD A;  4BM8 A;  1F2N A;  4JGZ B;  1PZ9 A;  4K9S A;  4MXW A;  4WVM A;  5E1R A;  4M01 A;  1QOS A;  2P2K A;  3MF9 A;  3SH3 A;  2CU5 A;  3ZXF A;  2GSY A;  4FOV A;  3MW4 A;  1H2K A;  2JJ6 A;  4YM0 A;  4D69 A;  3BTZ A;  3WG4 A;  1GMM A;  2I45 A;  3TEZ A;  3OPZ A;  1WBF A;  4LBN A;  4LO6 B;  4NHY A;  1VBD 1;  2PHX A;  4I09 A;  2VMD A;  3NV1 A;  4JDO A;  4D7Y A;  1PIV 3;  3J8F 3;  5FZA A;  4FBF A;  2R30 A;  5FZB A;  4O9G A;  3B9I A;  1XYP A;  5JR2 A;  2C4X A;  5KXC A;  1VRB A;  2ZML A;  1O3T A;  4AVV A;  5DUX A;  3EB7 A;  1JOB A;  4XXP A;  5A80 A;  4E2S A;  1AZD A;  3KWV A;  5EHD A;  1PGW 2;  2VXJ A;  2WSU A;  3P5B A;  4RHV 2;  4RGA A;  1TEI A;  3PHM A;  4XF1 A;  4BQW A;  2ZX0 A;  3J7L A;  3WQ7 A;  2WA3 A;  1W99 A;  2CGP A;  5L9B A;  2RS5 3;  2QUO A;  4Y20 B;  2E6V A;  2ZBJ A;  2VTX J;  2WNV A;  1RUJ 2;  2RG4 A;  4GIQ A;  4KGG A;  3ZFE C;  1SCS A;  3VV1 A;  3HQU A;  1HV1 A;  4N43 A;  1O4T A;  4AVB A;  5EYY A;  1YI7 A;  3HBK A;  2J7M A;  1HDK A;  5AC9 3;  3UES A;  1QJU 1;  1NCQ A;  1GKB A;  5IK4 A;  2J1R A;  2VCC A;  4PHZ A;  4MYE A;  3AX4 A;  4KWK A;  4PI2 A;  2P3J A;  5BYN A;  1AXZ A;  5FZ1 A;  3UKV A;  3F2Z A;  5FOB B;  1HRI 3;  1KEX A;  4B1L A;  3TOJ A;  1UZZ A;  1RIR A;  2AH2 A;  1QNW A;  4CCE A;  3FC0 A;  5C8C C;  4Y1Y A;  3T30 A;  5F5C A;  5FZL A;  4PLN A;  1RUI 1;  1D0H A;  1S0F A;  2ARE A;  1N1V A;  3GZA A;  1OD3 A;  4AGG A;  1AXY A;  1NXD 1;  3H1W A;  3TNP B;  2OQ7 A;  1QOT A;  1VBD 2;  2WT1 A;  3G6J B;  1R09 3;  1APN A;  3M1H A;  5E88 A;  3SH4 A;  1JHN A;  2GMP A;  4GZ9 A;  3J4U H;  2VZQ A;  3VB9 A;  1C5H A;  2PLV 1;  4D8M A;  1CPM A;  5DAV A;  4FPE A;  3LE0 A;  5FRE A;  2JG8 A;  3H3U A;  1JZ3 A;  5ANQ A;  4BDV B;  2BVV A;  4MXW B;  1QJY 1;  4WVM B;  4XCB A;  3TEW A;  3VBR A;  4MH0 E;  3ENR A;  1NLS A;  3AZV A;  1OUS A;  4LBL A;  3SIS A;  3WDX A;  5BNP A;  1UXX X;  4XE9 A;  4CUA A;  2RR1 1;  2RVA A;  4E4H A;  3MLJ A;  1IPK A;  4NIG A;  5G04 L;  1SQ4 A;  4JQT A;  4UW4 A;  5C4W A;  3L2H A;  4IUG A;  3FUO A;  4MG2 A;  1FAT A;  3O5S A;  4BA6 A;  1G9D A;  2VXR A;  3O1P A;  5KC5 A;  4DOU A;  5CG9 A;  3AFG A;  2ZGU A;  2JE9 A;  3DYO A;  5JLV A;  1C8M 1;  4MHU A;  1IOA A;  1QJU 2;  1QHD A;  1B35 A;  2Y34 A;  3N36 A;  3HWJ A;  4RGK A;  5JOW A;  3PUS A;  3T08 A;  4LO7 A;  4ZKT B;  3PU8 A;  4RR3 C;  1JYN A;  4BQ3 A;  4K1Z A;  2ZAC A;  4QQO A;  3H0O A;  5CVR A;  5FWJ A;  3CZU A;  2YY1 A;  1HN1 A;  1ZZ6 A;  2PA7 A;  5FY9 A;  2D5F A;  2WNV B;  2W1S A;  3O12 A;  4JV4 A;  3USS A;  4A3Z A;  4CDQ C;  4IW3 A;  5LRR A;  3TNQ A;  1RUI 2;  3ZOI A;  2OW4 A;  1AX1 A;  4N43 B;  3VL9 A;  1OKO A;  2OS2 A;  3ZVX A;  4HT1 T;  1VBE 3;  1W90 A;  3LPG A;  4ZON A;  3SXW A;  4OYU A;  1GFF 2;  1K42 A;  3FLT A;  1NCQ B;  3ZSL A;  3GNE A;  1QH6 A;  1IS4 A;  4DS0 A;  1GZ9 A;  1BK1 A;  4FP3 A;  1HKD A;  4PQQ A;  5K4L A;  4CP1 A;  2PLV 2;  1O91 A;  2VUA A;  3MYX A;  4Q4Y 1;  4EWA A;  4RS5 C;  3O0W A;  4Q0V A;  1NAE A;  1J58 A;  2CGN A;  2UWC A;  4Q4X 3;  1GP4 A;  2V5D A;  1QJY 2;  2DUQ A;  3AKP A;  5A6Q A;  2B4K A;  1ASJ 1;  1WZX A;  5FXW A;  1N3O A;  1MS8 A;  2VZ3 A;  1FV3 A;  4NHM A;  5SV5 A;  2D6O X;  4CEW A;  4K3U A;  1EP0 A;  1ULC A;  4CE8 A;  4E2G A;  5DN2 A;  2F6B A;  5T52 A;  3E6B A;  1D2Q A;  5DZG A;  1XYN A;  1UX7 A;  3O0V A;  4A44 A;  5JMO A;  1IGO A;  3RZK A;  4H7L A;  5FOJ B;  1GUI A;  2SBA A;  3M8L A;  3S6P A;  3VDA A;  3ITQ A;  1VMF A;  2YB7 A;  3O1S A;  3BI3 A;  2CNA A;  1H9W A;  2VBD A;  3I3B A;  3WV6 A;  3ZYG A;  1QMJ A;  3O14 A;  4XMI A;  1KD7 A;  1C8M 2;  3PDQ A;  3W9A A;  3SNM A;  1FV2 A;  3MUZ 1;  3QBQ A;  2JG8 B;  3IN9 A;  4I01 A;  4JGZ C;  3K51 A;  2QQN A;  4LR4 A;  4XFH A;  5BY5 A;  1BXH A;  2EIC A;  1VLN A;  5FY0 A;  1JOJ A;  2XPJ A;  3HNB M;  5BNP B;  5IVB A;  1W2A X;  5K8S A;  4S2H A;  2VU9 A;  3T2T A;  3LKJ A;  4Y1U A;  5F5A A;  3RYR A;  4QDR A;  1BKZ A;  3RYP A;  4DEV A;  2QVS B;  5BNO C;  5C4W B;  3WHU A;  2P37 A;  3BIE A;  1YQ6 A;  3I2J A;  1NCR C;  2NN8 A;  3OEB A;  3J7N A;  3PIJ A;  3UJO A;  1J59 A;  3RNS A;  2CYF A;  2MPF A;  1Q3E A;  2HWE 3;  1UMI A;  1EPZ A;  3VKL A;  4KWL A;  1YQ2 A;  4O65 A;  1HXS 1;  2C6S A;  3ME2 A;  5KXB A;  1BBT 1;  3M4F A;  4NWW A;  3D5O A;  4Y5S A;  1B35 B;  2WYS A;  3NJV A;  2IXC A;  5ANN A;  2BGP A;  5GZE A;  3E1F 1;  2GH8 A;  4HXC A;  4Q4Y 2;  2V09 A;  3NAP A;  3S30 A;  4YYO A;  3H3L A;  3POE A;  5LB6 A;  3FUQ A;  5GKA C;  3PUR A;  2JB8 A;  2HWF 3;  5JZG A;  4XAC A;  3NJX A;  1ASJ 2;  1IKQ A;  1SZB A;  4GJY A;  5FP7 A;  1O3S A;  1PIV 1;  2X09 A;  3J7H A;  2PMW B;  5FZH A;  3WCS A;  5J48 A;  1UKR A;  3IM0 A;  4NAM A;  5FP3 A;  3M3C A;  2RM2 3;  4ATE A;  5JXI A;  2CWM A;  2VZU A;  2BW8 A;  5BNQ A;  5FJH A;  4K40 A;  3AZZ A;  4H7M A;  3S57 A;  3GM8 A;  4FP2 A;  3V0B A;  1VBB 3;  3ZXK A;  3A4U A;  4YSF A;  2PAM A;  2YBS A;  1FXZ A;  2PHR A;  1S55 A;  1XB9 A;  2Q1Z B;  4MSV A;  3QOP A;  2VO5 A;  1F15 A;  4CEY A;  1V6O A;  3AP5 A;  1Y4W A;  5FZ7 A;  4ZZ8 A;  4G9S B;  2RS5 1;  4CPB D;  1FI2 A;  5I91 A;  2D93 A;  2WN2 A;  2ZGO A;  3HVD A;  3KF3 A;  2MHF A;  4Y3O A;  1WME A;  4CEW B;  2JDA A;  5A1F A;  2J1A A;  4RFR B;  2Q8D A;  3UJQ A;  1YEW A;  4Z92 B;  3KHC A;  2JIC A;  2VCM A;  1K3I A;  1SBE A;  5CIS A;  5H9Q A;  4COW A;  3ACI A;  3WNX A;  4JRL A;  5AC9 1;  3ACH A;  4QX8 A;  5FZ0 A;  5FYU A;  3UNP A;  2OT7 A;  3I4I A;  5CEH A;  4XUN A;  4XFG A;  3FLP A;  4BXF A;  1AR7 3;  1HJF A;  4UT5 A;  4BMB A;  1MZ6 A;  3AL5 A;  1HXS 2;  1BBT 2;  3OD4 A;  1CAX A;  4QX0 A;  4HSL A;  5A6Y A;  4Q1R A;  2PEL A;  3I59 A;  2IXI A;  3IDB B;  1NLR A;  4PT6 A;  4XQW A;  4M3C E;  4XZU G;  1YLL A;  2QQW A;  3DKQ A;  1JH5 A;  1WW7 A;  2BEO A;  3TEX A;  3TN9 3;  3KSC A;  2B7Y A;  5FKC A;  1R09 1;  1UWW A;  2HWB 1;  1PIV 2;  2DYC A;  2LM3 A;  2E53 A;  2DU0 A;  4K8R B;  1GU3 A;  4LBO A;  1EPW A;  5HPO A;  2D98 A;  1JUH A;  2RDR A;  4DY5 A;  4J1X A;  5JCT A;  5FR3 A;  4LHL A;  2Z2S B;  2FCT A;  1OI6 A;  4QKD A;  5F5Q A;  1IS5 A;  5F1R A;  2GMM A;  3Q8C A;  2QNK A;  3CMG A;  4OVE A;  2ZJC A;  3WHT A;  2FZ2 A;  2E7T A;  2WNU A;  1G86 A;  3WLU A;  4QU1 A;  3H8O A;  1QJE A;  3GAL A;  2VZT A;  4P14 A;  1UY0 A;  2X29 A;  5CB7 A;  3C7O A;  2BQP A;  2VZR A;  4MHR A;  2RS5 2;  2WNV C;  3W58 A;  2EXI A;  4CXX A;  2ENR A;  3WX5 A;  2Y38 A;  5JZG B;  2ZGP A;  1OLM E;  2EXK A;  1X8E A;  2MEV 1;  5LA9 A;  2BPA 2;  1I3H A;  3LDB A;  4BQX A;  3T4V A;  2BFU L;  4PBP A;  1NYW A;  5HXV A;  5LY2 A;  2ZS6 B;  1RUG 3;  2QQI A;  4NIH A;  1HV0 A;  2ZEY A;  1GZT A;  2DWR A;  3TWI A;  5AC9 2;  1ND2 C;  1PK6 C;  2B39 A;  2YC2 A;  4N7U A;  4XIO A;  3V0B B;  2IXH A;  5H9R A;  2VOW A;  3VBH A;  1KQR A;  4HK8 A;  1YHF A;  3JQW A;  3POW A;  3BN6 A;  1H9P A;  5IVY A;  4CEY B;  4QX1 A;  5J37 A;  4BQ4 A;  3O1O A;  2F4L A;  2BNM A;  2GAL A;  1UD1 A;  1DZQ A;  1UZ0 A;  2R06 3;  5DUW A;  3NV3 A;  3WDV A;  2NLR A;  3CJX A;  1NUK A;  1UOJ A;  2YBP A;  5GLZ A;  2B9V A;  1DG6 A;  5DG1 A;  1QF3 A;  2FQP A;  3A21 A;  3MHZ A;  2BU9 A;  1BQP A;  1S0E A;  1X9T A;  2PHD A;  2OVU A;  3WG3 A;  3ZM8 A;  1R09 2;  4A42 A;  5LCW L;  2Y60 A;  3CIH A;  3QAC A;  4NII A;  4Y5Z 0;  3AZW A;  3OGR A;  3EYP A;  4GMP 0;  5F3G A;  4QHO A;  3ZFF A;  2JG8 C;  5FYV A;  3WUD A;  1WW4 A;  1XBF A;  2QQM A;  2VMI A;  1QXP A;  2GN3 A;  2VCB A;  1CAX B;  4Q4X 1;  4HN0 A;  5ABJ C;  4N53 C;  4R4Z A;  2GAU A;  1SFP A;  3VBR C;  2HLE A;  1KJR A;  4QKN A;  3GZU C;  4X8N A;  1WMX A;  5LBB A;  1MS5 A;  3E5Q A;  4HFS A;  3GHM A;  5BNP C;  1CPN A;  3I59 B;  4QPG C;  4XHX A;  3E6C C;  4CPB A;  1W2N A;  3TB0 A;  5EZW A;  1B09 A;  2YGL A;  1UF2 C;  4CU7 A;  4HKO A;  5C4W C;  1V6N A;  5BXX A;  5D8A A;  5EP9 A;  3T09 A;  3ZYB A;  5FPV A;  2ZGK A;  3ZMN A;  2MEV 2;  3B69 A;  4KQ7 A;  2ZOE B;  4ERO A;  2DUO A;  3JUU A;  1LU2 A;  3AYA A;  2R04 3;  4P5H A;  3THT A;  2AR6 A;  1IQD C;  3BYW A;  4NVP A;  2QZ2 A;  1UNB A;  1H30 A;  1LRH A;  3B01 A;  3J26 N;  4W8J A;  4DO0 A;  2WNU B;  4J6G A;  5DQ0 A;  1QJX 3;  2VGD A;  1I6X A;  1SMV A;  3T3Y A;  1PX4 A;  2XLF A;  5DUU A;  2K46 A;  3BAL A;  1SLC A;  2A6Y A;  2CWS A;  3BOD A;  4XEZ A;  4WZF A;  1RUN A;  4AEK A;  2GC1 A;  1NQJ A;  2F17 A;  3AJY A;  1NXM A;  2XBO 1;  1IHM A;  4IE6 A;  4TZD A;  2WNE A;  4Z1V A;  4Q8K A;  2Q1M A;  5LA0 A;  2D3S A;  4CCK A;  2HWE 1;  4I0W B;  2JDM A;  1VBE 2;  1ZZ7 A;  2BWC A;  4PF1 A;  3RZH A;  2H6B A;  2R1D A;  3ZFE A;  4YGE A;  1GWK A;  2PQQ A;  2R6Q A;  2ZA9 A;  4FOY A;  3VBH B;  3M3Q A;  1Q8O A;  3A22 A;  3E5U A;  1OD5 A;  1OVP A;  4Q4X 2;  3I2O A;  2PHF A;  1YRZ A;  5F37 A;  2QQO A;  2Y6H A;  2X05 A;  3CLP A;  1CJP A;  3RQ0 A;  2HWF 1;  2XDV A;  4G4F A;  4CEW C;  1PM4 A;  2ZHM A;  5FZ4 A;  3VD7 A;  2W95 A;  3ACL A;  1O6U A;  1OFN A;  5FZF A;  2D5H A;  1J3Q A;  1AJO A;  1H4H A;  2LS6 A;  5LA1 A;  1OH4 A;  1GSL A;  1YQ5 A;  2RM2 1;  1H8T A;  2W1W A;  2JDH A;  2YZ4 A;  4Z2W A;  3POG A;  1FT9 A;  1V9U 1;  4IV1 C;  1L7L A;  4LIU A;  4FXG B;  4QU2 A;  1VBB 1;  3MBW A;  3RI8 A;  1W39 A;  2VM9 A;  2VOT A;  4UF0 A;  3ZFF B;  4FTB A;  1CES A;  2XVK A;  5M0T A;  3GJB A;  1C8N A;  4YM2 A;  5BPX A;  1V6M A;  2YU2 A;  4PIX A;  4AVA A;  4E2Q A;  4R4X A;  1KDK A;  1I1E A;  2JWP A;  3UGH A;  1YFW A;  4EN6 B;  4NPR A;  5E8A A;  4ZXK A;  3N9L A;  2R16 A;  4TWT A;  3PME A;  4WVW A;  5D8A B;  2B45 X;  5JSR A;  4XFF A;  1W6Q A;  3EO6 A;  4LA2 A;  1L7Q A;  2XBO 2;  1H1I A;  1NX9 A;  1PZ7 A;  3E97 A;  3VBU A;  3NV4 A;  4WVZ A;  3ZYR A;  1XNC A;  1LJ7 A;  5APA A;  5FP4 A;  3THC A;  2HWE 2;  2JKB A;  5JR7 B;  3IZO A;  4WVV A;  1WW6 A;  5CKM A;  2W87 A;  4ASL A;  1R64 A;  2WQ4 A;  1Z78 A;  4COU A;  1YFY A;  3N7J A;  2NYY A;  5E89 A;  2VC9 A;  2JDU A;  4BPZ A;  3AVR A;  1WMD A;  3NAP C;  2JKX A;  4Y1Z A;  1C28 A;  5JPM B;  3R4D B;  3LWC A;  2J1T A;  3I2D A;  3ZIX A;  2G9F A;  4KI5 M;  3III A;  4CVU A;  1LR5 A;  4XQD A;  1ZRE A;  3ZPY A;  2V4A A;  2IXJ A;  1BK0 A;  2HWF 2;  1OSG A;  4IES A;  2YGM A;  3TN9 1;  3OYW A;  4RR3 A;  5H9P A;  3ST7 A;  4OUS A;  3BB6 A;  1OLR A;  5FZ6 A;  4FO9 A;  5FXV A;  1SFN A;  3MFA A;  5T3N A;  4DZG A;  2RM2 2;  2XJQ A;  1GP6 A;  2WSV A;  3ZFG C;  5A3M A;  2LRP A;  1V9U 2;  5FV3 A;  3SCG A;  3ZFE B;  3UKN A;  2NMN A;  3KD4 A;  1VBB 2;  2W2I A;  4DIQ A;  2LW8 A;  3HN3 A;  2K0G A;  4W6W A;  4LPL A;  4UFK A;  5FZO A;  2FMD A;  1X50 A;  3POS A;  4C91 A;  1UKG A;  2AYH A;  2I74 A;  3OBA A;  4YPJ A;  4IEQ A;  4LHN A;  4N8M A;  2IVJ A;  1OFS A;  2VNR A;  1UO9 A;  4NR1 A;  1E57 A;  2WLQ A;  1SDD B;  4BME A;  3OOX A;  3MW3 A;  4MXV A;  3ETQ A;  5GJ6 A;  1GYK A;  2D43 A;  1RIN A;  1F8V A;  1DLL A;  4V2W A;  1H8T B;  1RUG 1;  2E63 A;  3USU B;  5I0D A;  2VVF A;  2IC1 A;  4AOC A;  2ET7 A;  2JE7 A;  2RR1 3;  4MZU A;  1JOD A;  2GDF A;  5EFU A;  4UF0 B;  3T1M A;  4A6O A;  2Y6G A;  3MLL A;  4XUT A;  1O59 A;  1BVP 1;  3N9P A;  4K20 A;  5F6K A;  2QBX A;  4TXW A;  3DN7 A;  4XAA A;  3RG0 A;  4AWD A;  2R06 1;  1K12 A;  1SLA A;  1W05 A;  3E6D A;  4GAZ A;  4R9C A;  5FK8 A;  3LIG A;  3B00 A;  5JOX A;  5K9Y A;  4ZZ5 A;  4W50 A;  4Q8L A;  4XJU A;  3ZKY A;  1UMZ A;  2JEN A;  3DXU A;  5T5J A;  1W6Q B;  2ZKN A;  4HSJ A;  3TN9 2;  1X82 A;  2OPW A;  2W47 A;  3CZJ A;  3VBU B;  4YW1 A;  2C0Z A;  1X36 A;  3CEW A;  3J9S A;  1CVN A;  3U37 A;  5EXO A;  2VAU A;  2EIB A;  2G9G A;  1LB2 A;  5BNO A;  3FN9 A;  3ABZ A;  2AC1 A;  4E27 A;  1PO2 3;  3WSO A;  3PIG A;  4CCL A;  1T6G C;  1DYK A;  1NCR A;  3LDK A;  4D7S A;  1W6P A;  1OA2 A;  2YG0 A;  3DKW A;  3RJR A;  5IAX A;  5L9V A;  2RV9 A;  2TUN A;  3K3O A;  1UY3 A;  3C8X A;  2QFE A;  2VNO A;  5T5O A;  4QX2 A;  2WO7 A;  2YXS A;  4XOG A;  4Q4Y 3;  2DTY A;  5FLJ A;  1JI6 A;  3OYW B;  1N1T A;  1QDC A;  4CCC A;  1Y9Q A;  2DCK A;  4RR3 B;  1SLT A;  1DF0 A;  5C5T A;  3UKT A;  3INA A;  5KBF A;  2R04 1;  5C9A C;  3I54 A;  2WAA A;  3EJK A;  1K5M A;  1RUG 2;  3LCP A;  1W8H A;  4BK4 A;  2ZGR A;  2ILM A;  4I02 A;  3WW2 A;  3S0M A;  1TZO A;  3HAG A;  1ALY A;  3ZSJ A;  2A1X A;  1JZ2 A;  4P02 B;  4Q0S A;  2GU9 A;  2RE9 A;  3AK0 A;  2OUH A;  5FQ0 A;  1QJX 1;  5FZO B;  4EZ4 A;  4ONU A;  1VIW B;  1UOB A;  4GWI A;  4JKL A;  2JDY A;  4PI0 A;  1JYV A;  3B3Q E;  2LTN A;  2R06 2;  4P5Y A;  4N9I A;  3NNL A;  1Q8Q A;  1LOG A;  1H6X A;  5JAX A;  4QB2 A;  5EJ1 B;  4QQH A;  3MIH A;  5GLV A;  4ZHN A;  3AL6 A;  2VNV A;  4B4P A;  4X8P A;  4Q0U A;  3K3N A;  2G19 A;  1KFX L;  2D7F A;  2BOI A;  5CAZ A;  5CAD A;  4YW6 A;  2EXH A;  3RMY A;  1W0O A;  1UW8 A;  1E5R A;  1PNF A;  2UWA A;  3GBG A;  3H7J A;  1DQ6 A;  2Q8E A;  3WQ0 A;  1ULD A;  4LMF A;  3RS6 A;  3RZM A;  2VZ1 A;  3BCW A;  3KHB A;  1V70 A;  4LA3 A;  2DF7 A;  3ZSE A;  3DL3 A;  5KWR A;  4OHV A;  2BRT A;  1QDO A;  2E51 A;  2DVG A;  2OA2 A;  3KV4 A;  3OUH A;  4BIF A;  4COZ A;  4JDN A;  2PTM A;  4IEX A;  3MV1 1;  2DBI A;  2XGX A;  4HG6 B;  1LHU A;  5FZI A;  1QOO A;  4ES9 A;  1HXS 3;  2W9X A;  2AZ5 A;  2XQX A;  1ZA4 A;  3IPV A;  1Y9G A;  4QD2 A;  4MGY E;  3U75 A;  1JUI A;  2I2S A;  1LU1 A;  4MLO A;  1W6O A;  4XBQ A;  1F4H A;  1YI9 A;  4ZS3 A;  1X33 A;  2UWB A;  5K7P A;  3VZN A;  2JEC A;  3ES1 A;  1WD4 A;  5GLT A;  4MAD A;  2R04 2;  1FYU A;  4IET A;  4AGV A;  2Y0I A;  3HT1 A;  3VKN A;  5BNO B;  2WWU A;  4OMD A;  3WVJ A;  4BYY A;  3DXT A;  3IAP A;  3OBT A;  2HYK A;  1VJ2 A;  1GV9 A;  1NCR B;  3LGR A;  5I0R A;  1C3H A;  1W6P B;  4FFG A;  2A7A A;  1JYX A;  2WIN B;  3RMX A;  1W3X A;  1QJX 2;  2W3J A;  1XNA A;  1YWK A;  4LBM A;  3AP7 A;  1QU0 A;  4B8E A;  3M2M A;  1HIX A;  4EWE A;  1BVV A;  1NZI A;  5A1A A;  4TLG A;  5T55 A;  3ORJ A;  2RJ2 A;  1MZ5 A;  1ENS A;  2DDU A;  2VPV A;  1GZC A;  4CA9 A;  1H2N A;  3SH5 A;  2ZMN A;  1V6L A;  3AVS A;  4GB3 1;  3THP A;  2X5I C;  3D82 A;  4YRD A;  4BWO A;  3NVC A;  3BTY A;  1K5M B;  1KDM A;  2NM1 A;  3NJZ A;  5CG8 A;  2AAC A;  4HBN A;  4AHX A;  1S2B A;  5LEJ A;  1AHS A;  3WW1 A;  1AL2 3;  5DZF A;  4XUO A;  4YG6 A;  3HJR A;  5CFC A;  3MDP A;  5FQ0 B;  2VZP A;  3EXU A;  1W8O A;  1GR3 A;  5B4N A;  3T4H B;  2WNO A;  1ND2 A;  3THD A;  1PK6 A;  2A73 B;  3R0R A;  3PLQ A;  4GQ7 A;  4V2V A;  5IHR A;  5HV0 A;  1UMH A;  3Q8A A;  1RYY A;  4Q29 A;  4UFI A;  2DCT A;  1O5L A;  4QKF A;  4RQP A;  4MV2 A;  4BLJ A;  4F3J A;  5F9T A;  5I8S A;  4UFL A;  4NID A;  3CJI A;  1H8T C;  1UZV A;  3L9J T;  5I0U A;  4QPW A;  5F6L B;  4EV0 A;  2YFU A;  1W8T A;  5KC6 A;  1URX A;  4B7E A;  1CIY A;  5C3Q A;  4XIL A;  1JYT A;  1RHI 3;  4LEJ A;  4AEM A;  3NL1 A;  1J3P A;  4YW7 A;  4PF5 A;  1LTE A;  1JOP A;  4XYX A;  5FKB A;  1XXN A;  5I8Y A;  1EUU A;  4XHB A;  4RL7 A;  5L73 A;  2HWB 3;  1LGC A;  1E5H A;  3C7H A;  1QY4 A;  1FOD 1;  1DCS A;  2R7E B;  4YGC A;  4F83 A;  5C8W A;  2DVA A;  1JYI A;  3OGG A;  3H50 A;  2VUJ A;  2XKP A;  2A6W A;  3I3D A;  4W65 A;  1W8U A;  1XC6 A;  2IFW A;  2HYX A;  1CAU A;  3IPV B;  4FPO B;  3ZXD A;  3WF0 A;  1RVF 1;  5ABJ A;  4N53 A;  4OHW A;  3VBU C;  1W6O B;  4NMI A;  4CP9 A;  3GBW A;  4XVH A;  1S0G A;  1QQP 3;  4IL7 A;  1JZ7 A;  1QJF A;  2YPD A;  4QPG A;  4AI3 A;  4QDQ A;  4AI8 A;  5DPN A;  1I5Z A;  5FO9 B;  3W5N A;  3T0B A;  4HZF A;  4HOO A;  2CAU A;  1DZT A;  4FQZ A;  1OPO A;  2MEV 3;  3AMN A;  3GGL A;  2WA4 A;  3KGL A;  5GZF A;  2VE1 A;  1KIT A;  1S2E A;  2P6C A;  3HBZ A;  4DMI A;  2HEV F;  1PVX A;  3LD8 A;  1PGL 1;  1I5P A;  5HCA A;  4K8F A;  4Q5O A;  4Q26 A;  3ZYI B;  3T0A A;  3VBO C;  1CGP A;  3AKQ A;  5EV7 A;  5C3R A;  3ZIW A;  3N4M A;  3FE5 A;  4LQR A;  3ZXG A;  3JQX A;  4M0N A;  1R1Z A;  4XF3 A;  4GXL A;  4IE5 A;  3UET A;  1OUR A;  4QB1 A;  4AVT A;  4QGL A;  3GZT B;  2DVB A;  5IUQ A;  1DGW X;  1DGL A;  1HQN A;  2EAK A;  3WD5 A;  2XVG A;  3AP6 A;  3DGT A;  1Q8V A;  1PO2 1;  3T2P A;  1EAH 3;  4R9D A;  1MVE A;  1UY2 A;  2IXK A;  1LEC A;  4FPY A;  2WZ8 A;  2NQY A;  2N7G A;  4PDW A;  4FPL A;  4QHB A;  5CFC B;  3AZY A;  1AYN 3;  1JU3 A;  1V6K A;  2W1U A;  3IBM A;  2FDG A;  2A6X A;  5IWF A;  3TRS B;  2ZZJ A;  4L9B A;  3VHP A;  3WG1 A;  4A7Z A;  4BXS V;  5LAT A;  5BV6 A;  1ND2 B;  2XHK A;  1PK6 B;  2EF6 A;  1W03 A;  1ZZ9 A;  2Z79 A;  4P9W A;  4JVA A;  4XMA A;  1E5I A;  2J1E A;  3W20 A;  4RQP B;  3DUI A;  5I0T A;  1MAC A;  1UIJ A;  4SLI A;  5IJR A;  1RVF 2;  3CJI B;  4MGS A;  4OI0 A;  3VGI A;  2ZEW A;  4MOA A;  4S2D A;  1YFX A;  2RR1 2;  4IE7 A;  5DMY A;  5F2W A;  2PAK A;  4BHP A;  5GAL A;  3POF A;  3IKW A;  3MO4 A;  4ES8 A;  2E7Q A;  4QGN A;  4QB6 A;  1G9B A;  3VD3 A;  4QXB A;  4XAE A;  2BV4 A;  3WNP A;  5A3P A;  1UPS A;  3W21 A;  4DIN B;  2GNB A;  2Q4S A;  1JYW A;  1NA1 A;  1MQT A;  1PGL 2;  1JN2 P;  2JG9 C;  4IV1 A;  2V73 A;  4CXY A;  1C4R A;  2UY9 A;  3LEG A;  2RHP A;  3ZDV A;  2OXB A;  2VG9 A;  1GZW A;  1LCL A;  1CAU B;  3AMM A;  5LY1 A;  3JB8 A;  4OZO A;  4EN9 B;  1UZW A;  2WRA A;  4N53 B;  4YWA A;  3VBR B;  5ABJ B;  3H1M A;  2RDS A;  4CP9 B;  2QKD A;  4FXK B;  2BTV C;  3LSE A;  2UY8 A;  4QPG B;  2W91 A;  2Z42 A;  5ISL A;  4GA9 A;  3RI9 A;  4COV A;  1J83 A;  1HB1 A;  2RDN A;  2ZGN A;  2WT0 A;  5I93 A;  2VY0 A;  3R05 A;  2XBO 3;  4U2A A;  1PO2 2;  1WCU A;  4MGI E;  2VBB A;  5FZK A;  3NJY A;  3OUI A;  2P1B A;  5IK5 A;  3OGV A;  1D4M 3;  4I3G A;  4NUB A;  4GWN A;  2ZEX A;  1XOY A;  5C3S A;  3IDC B;  4AHW A;  4D6S A;  1WLC A;  4IXL A;  3UT0 A;  2E9Q A;  1LKN A;  1UZY A;  5FUP A;  1EV1 3;  4MGK E;  1XRU A;  3BOW A;  3TAY A;  1KXG A;  2W52 A;  4A4A A;  1K5M C;  1FX5 A;  1MR5 A;  1Q8P A;  1W2O A;  3H1Y A;  4WV8 A;  3R4U A;  3K4D A;  4AI9 A;  1HB3 A;  2PFW A;  2YU1 A;  2FDJ A;  4HKW A;  1ULP A;  1K5J A;  2WQ8 A;  2C1F A;  2BNO A;  2R0F A;  3ACF A;  4R9B A;  1WBL A;  1OT5 A;  5BUV A;  2AUY A;  3WDT A;  3NW4 A;  3OB8 A;  2J1V A;  3ZSK A;  1V9U 3;  3ZFG A;  3B5L B;  2DCY A;  5FRA A;  3CNA A;  3RZL A;  1W6M A;  4FCA A;  4JTO A;  5FY7 A;  3VDB A;  2R07 1;  3BTA A;  5B4X A;  2ZGS A;  4OUL A;  3UK9 A;  3URF A;  1Q8S A;  4BCU A;  4EN0 A;  4G3Y C;  1U5I A;  1DQ0 A;  2ZX1 A;  4DRV A;  1M4W A;  1U5X A;  3PTY A;  3PUI A;  4OUE A;  2Y33 A;  1MS0 A;  1ZRF A;  1O3Q A;  1D2S A;  3LQC A;  1AL2 1;  3AFK A;  1OKQ A;  2Y6L A;  2Y8K A;  5GZC A;  3KM5 A;  3AKT A;  1GOG A;  5CNA A;  1A8D A;  3NST A;  3ZKU A;  1A3K A;  3R6S A;  2E26 A;  1AUY A;  1NA1 B;  1MQT B;  3VDD A;  2GNM A;  2GH2 A;  1LGB A;  2QTW B;  4IV1 B;  1ULO A;  4Y24 A;  2XML A;  4UFH A;  1W8Z A;  2O8O A;  3H8X A;  1GZW B;  3OCP A;  4FTE A;  4AE2 A;  1HX6 A;  3ZSM A;  1XYO A;  3ZYP A;  5FPX A;  2P34 A;  2D6K A;  2XUM A;  2OKX A;  4Q0Q A;  1JXN A;  1VAK A;  5KHJ A;  1RHI 1;  2DFB A;  3PMS A;  1ZBA 3;  5CIR A;  1TVG A;  1RMU 3;  2OUJ A;  5FXX A;  5J36 A;  4HVR A;  1DQ4 A;  4Q0P A;  4AED A;  4XC9 A;  4XET A;  4XJW A;  4CCO A;  4N90 A;  5SV8 A;  3FWE A;  3LSD A;  4LIV A;  1MVQ A;  2WO1 A;  4PJY A;  3WUC A;  5LA2 A;  3HT2 A;  3AC0 A;  2OZ6 A;  1FAY A;  2XL9 A;  1KFU L;  4CCD A;  5E6H A;  5AFE A;  2H0B A;  2B5H A;  4JKM A;  3AYE A;  4AQT A;  3WQB A;  1QXR A;  1W9T A;  1EY2 A;  3I3Q A;  3LEM A;  5L7O C;  3SCF A;  2W39 A;  5FYC A;  3FBY A;  3NAP B;  4R8H A;  1QQP 1;  5IVJ A;  3CKH A;  1HW5 A;  3VBF A;  2R07 2;  5A70 A;  4LBQ D;  5FYT A;  4UW3 A;  1OVS A;  3D3A A;  2GZW A;  5EYX A;  2GND A;  1QH7 A;  3POY A;  1YCI A;  1UY1 A;  4KBB A;  2J1S A;  5CFC C;  1AL2 2;  4KG8 A;  2W94 A;  1OA3 A;  5CBL A;  2VCA A;  1TNR A;  4LLO A;  3N9N A;  3MIF A;  1BEV 1;  4XW3 A;  4BIO A;  3OSD A;  2HWD 3;  1RUF 3;  4I30 A;  1S0J A;  2DFC A;  5FMB A;  2VL4 A;  3WCR A;  3RSJ A;  5C9A A;  5L19 A;  3ZFG B;  1Y9M A;  3LA7 A;  3K77 A;  4Q1P A;  4QX5 A;  1RGS A;  1YFU A;  3ILN A;  3MPP G;  2XR4 A;  3HR9 A;  3SEP A;  4IEP A;  5FWE A;  4RQP C;  4XBN A;  4OQ9 A;  3NNG A;  4BQ1 A;  1IKP A;  1IS3 A;  2A5Z A;  3CJI C;  3U0Z A;  3DPR A;  5IAV A;  3WP4 A;  4L97 A;  3LOI A;  2VUC A;  1R08 3;  4AGR A;  4R52 A;  3NV2 A;  4PBO A;  1EAH 1;  4UFM A;  4AI2 A;  1RHI 2;  4J25 A;  1PVC 3;  5FAX A;  1HQW A;  1STM A;  1ZBE 3;  2HEY F;  2ID4 A;  4YZ2 A;  1IG3 A;  1AYN 1;  2HKX A;  1CX4 A;  4H3W A;  1HJG A;  1ZZB A;  1UCX A;  2HWB 2;  3VD9 A;  4AI0 A;  1O4Y A;  1V00 A;  1M06 G;  2BFU S;  2V5Y A;  3VDD B;  2BUK A;  1ZRI A;  2JDK A;  4Y22 A;  3UV9 A;  1Y3T A;  4ZPI A;  1NZC A;  1SDW A;  3PL0 A;  5T5L A;  1DFQ A;  5CU1 A;  1UL9 A;  3KT1 A;  3H42 B;  4YM1 A;  3VKO A;  2DU1 A;  2EXJ A;  1LHN A;  4LLF A;  3SLI A;  3I2H A;  4AFM A;  3I8T A;  4LUL A;  2A71 A;  1O5U A;  4JHZ A;  5LK7 B;  1GWL A;  1LOC A;  5KHG A;  2QQU A;  4FI9 A;  1QQP 2;  1DLC A;  1G7Y A;  3KCY A;  4IGO A;  4RA0 A;  3BTX A;  2JD4 A;  1LOD A;  3JZV A;  4ZU7 A;  2YPJ A;  2WLP A;  5A3O A;  1AL0 G;  3I3E A;  1AR6 1;  4KH9 A;  2XQR A;  3KQ4 B;  2JEM A;  4AED B;  1XSQ A;  4AQ6 A;  4CCJ A;  2HBT A;  2PHW A;  2CV6 A;  4B4Q A;  1SLB A;  4EJR A;  1S0C A;  4AFA A;  4WM7 C;  4XBL A;  4CUC A;  1WD3 A;  3MIE A;  4LJH A;  3OUJ A;  1VAL A;  3FFQ A;  2P17 A;  5LRS A;  1BEV 2;  1VB4 A;  1ZRR A;  4AL9 A;  1YQC A;  3D6E A;  1JMU B;  4YW2 A;  2YUE A;  3VL8 A;  4CDW C;  1JZ8 A;  1DQ2 A;  3A7Q A;  1VPH A;  2ZHL A;  3Q8B A;  4QMA A;  2ZX3 A;  3PJQ A;  4HVQ A;  3POI A;  1OQ1 A;  1OH3 A;  1JZ5 A;  2QE3 A;  4DQA A;  2D6N A;  3VBF B;  3CF6 E;  2ETE A;  1KJL A;  2OZJ A;  2Z5W A;  3W59 A;  4B1M A;  4KL1 A;  4ASK A;  2C9K A;  2G4I A;  5LBE A;  3KT4 A;  1ZVF A;  3DEM A;  5IFP A;  3A0N A;  1C57 A;  2ZTN A;  3AXE A;  5FZG A;  4C0B A;  1EAH 2;  3I3M A;  4PDW C;  4X6Q B;  1A34 A;  2Y6K A;  2RDQ A;  4LK7 A;  2EAA A;  1RED A;  1SEF A;  2A70 A;  5JVV A;  5IVF A;  1AYN 2;  2C26 A;  5C70 A;  1D4M 1;  2CDP A;  2X5I A;  5C9A B;  4OUM A;  1UN1 A;  3FMG A;  1OLQ A;  4ORF A;  4BK5 A;  4ET7 A;  1HLC A;  4Q27 A;  1CZS A;  4Q2F A;  4L11 A;  1R1A 3;  1SPP A;  4AF9 A;  1RC6 A;  3UL2 A;  1A8M A;  2P5B A;  2WO3 A;  1EV1 1;  2JD9 A;  1W8W A;  3VD4 A;  4D3W A;  2B46 X;  2Y64 A;  3I7D A;  4L2N A;  3S5Q A;  4FPJ A;  4XQ4 A;  2ZZQ A;  4XUQ A;  3DPR B;  3WNN A;  3K75 B;  3T0D A;  4LBQ A;  3RDI A;  3VHN A;  2WWJ A;  1QNY A;  3OGS A;  1AR6 2;  3H8U A;  1WUV A;  3KGZ A;  1ENR A;  4AQS A;  2UYB A;  2VOV A;  2QQJ A;  1YIF A;  1Q56 A;  2I07 B;  4ZU5 A;  3WF3 A;  1NA1 C;  1MQT C;  1GWM A;  2C24 A;  4PCR A;  4XUR A;  5I8T A;  4Y22 B;  2D3R A;  4XTP A;  1UU5 A;  2AEN A;  1C5I A;  1J3R A;  2KM2 A;  4BH9 A;  2BOJ A;  3RRD A;  2ZGM A;  1FMD 3;  3M3O A;  4NRO A;  1EUT A;  3LF7 A;  3O7O A;  4IEO A;  1XU2 A;  1BZW A;  1XND A;  3JB4 C;  4OCT A;  1SFY A;  5C33 A;  3S7E A;  1BYH A;  1G9F A;  1XJA A;  5C7G A;  4BIS A;  5GZG A;  2O1Q A;  4H55 A;  4AW7 A;  5A7O A;  1JS9 A;  4Y33 A;  2V72 A;  1O3R A;  1BLZ A;  1PO1 3;  5FY5 A;  2OYZ A;  1P8J A;  3IAQ A;  5KHH A;  5IFT A;  1BJQ A;  3MF6 A;  5F39 A;  2VZS A;  5F3C A;  3K4A A;  4GB3 3;  4CTE A;  2WT2 A;  1D4M 2;  3M3I A;  1YXW A;  4QPY A;  5C71 A;  5D21 A;  4XUP A;  2ZGT A;  3GBF A;  1IPJ A;  2R32 A;  5LBC A;  4OQ8 A;  4URT A;  4CSW A;  2Q8C A;  3KS7 A;  1EV1 2;  1XQN A;  4GKX A;  4L0P A;  2UUR A;  1S1A A;  4DPN A;  4WBB A;  2PXJ A;  3AYC A;  3HNM A;  3NNJ A;  1LES A;  4MGZ E;  1ZBA 1;  3D0J A;  4C1X A;  3MW2 A;  3VBO A;  1RMU 1;  1HQL A;  4GKY A;  4OLL A;  3VBS C;  3KT7 A;  3WNM A;  3Q8F A;  2ES3 A;  2VEC A;  2JIG A;  3H3Z A;  4HLT A;  2A6V A;  2NZ9 A;  4M4P A;  5FZ8 A;  1X7N A;  1J1L A;  2BGC A;  4QWN A;  1V6I A;  2X5I B;  2WFF 3;  3B9C A;  3MI8 A;  3WG2 A;  3M3E A;  4JKK A;  4AFD A;  1SPP B;  3AKR A;  4LHK A;  2B42 B;  3T2Q A;  2LUW A;  4GMP 3;  4JX0 A;  3AM2 A;  1GNZ A;  3RWN A;  3BPZ A;  4HAN A;  4GD4 A;  1DGR N;  1FOD 3;  3RVH A;  3WQ1 A;  3GDB A;  3QD6 A;  3ZN6 A;  2VMC A;  2CDO A;  4LBQ B;  3VDC A;  1W28 A;  2Q1F A;  4NRM A;  4BLI A;  2YC0 A;  4LKF A;  1H6Y A;  4JZR A;  3TEY A;  1RVF 3;  4EQV A;  3W5M A;  2W08 A;  1WA6 X;  2CGO A;  2IZW A;  2HWD 1;  4KG0 A;  1REF A;  1RUF 1;  1VMJ A;  1CD3 G;  3VDD C;  1BHG A;  2QQP A;  5JI9 A;  1SHW B;  4KMQ A;  3PNA A;  4UXA A;  3JD7 3;  5JPN B;  1UPI A;  4M3C A;  1Z7S 3;  1ZRD A;  2JDP A;  3LA3 A;  4ITC A;  1A78 A;  1NQD A;  2Y0O A;  5CKN A;  1VMH A;  5ERL A;  4BE3 A;  5IVE A;  3D8C A;  4UBH A;  2JG9 A;  4YZ5 A;  2BGO A;  1RUD 3;  1R08 1;  4UYB A;  5T50 A;  3WT3 A;  2WYF A;  3RZG A;  4LKS A;  1PVC 1;  1ZBA 2;  2RS3 3;  2Y6F A;  3AKS A;  1ZBE 1;  4AED C;  1RMU 2;  2R1B A;  2R49 A;  2YC4 A;  3CQO A;  4RGG A;  3U4S A;  1OHF A;  5FPZ A;  2O0O A;  5IYY A;  3RJ2 X;  1DGW A;  3GCW A;  3HIF A;  3ELN A;  2ARC A;  4ZU4 A;  2TEP A;  3OEA A;  4D6R A;  1GP5 A;  3K4Z A;  1DIW A;  5FMO L;  4CUB A;  3FBM A;  3PTR B;  4Y1X A;  2QQL A;  5FK7 A;  1US3 A;  4KU7 A;  4XZP A;  3F95 A;  4P00 B;  3ILR A;  3OJB A;  4LOR A;  4RD7 A;  3VHO A;  3O1V A;  1J84 A;  3AB0 A;  1GNY A;  1LOE A;  4ISR A;  3VBF C;  3KCC A;  4IV3 C;  3GXU A;  2G9Z A;  1NE4 A;  2XUE A;  4V1P A;  3VBO B;  3BU0 A;  5F3E A;  3OF1 A;  2X10 A;  3HNY M;  2VW2 A;  4MO3 M;  1YJL A;  2XJT A;  2KR2 A;  4A41 A;  2ARB A;  4DRR A;  5FXZ A;  1W0P A;  4D6Q A;  1PX3 A;  5FFO C;  5CFD A;  1D4V B;  1ZM1 A;  2HWD 2;  1RUF 2;  3C7G A;  4FPK A;  5J3U A;  3EMR A;  3N9Q A;  4XFI A;  2D6P A;  2P4E A;  2OPK A;  3ZYF A;  4BB3 A;  1NOV A;  1GQH A;  2Y26 A;  3C7E A;  3PUA A;  1TE1 B;  4I0B A;  4IEU A;  5FMO S;  1C1L A;  2WS9 1;  3DPR C;  1O8S A;  1FNZ A;  5A33 A;  2ORZ A;  2BP6 A;  3VD5 A;  4IGQ A;  3ZN6 B;  2ZGQ A;  4C1W A;  1W06 A;  4IE4 A;  4EYU A;  3LEK A;  1DQ5 A;  3DYM A;  3WNK A;  3O1M A;  2E7A A;  2CL2 A;  1R08 2;  1DU3 D;  4XPV A;  1GLH A;  2O8Q A;  2OQ6 A;  1PVC 2;  4OZX A;  3BVC A;  1ZBE 2;  4FSJ A;  4ZS2 A;  4MX3 A;  4NWV A;  3OPT A;  3IIA A;  4JCK A;  5EIY B;  2VQA A;  3VKM A;  4BU2 A;  4S2F A;  1W0N A;  2DVF A;  4FFI A;  1R1A 1;  3KV6 A;  4L92 A;  4M3C B;  4EWD A;  4DY3 A;  5JMC A;  2ZAA A;  1EYB A;  4J1W A;  4QAW A;  4YVS A;  4OI1 A;  5TSW A;  3WW3 A;  2VMH A;  4BOW A;  5F7U A;  2AEY A;  2YMZ A;  2JG9 B;  2ZKL A;  4L99 A;  4AK3 A;  1AYM 3;  2XB6 C;  2WR9 A;  4IQP A;  2FZ1 A;  4CDU C;  1S2K A;  1VR3 A;  3MUY 1;  3NNF A;  4YGB A;  2HBU A;  3U1X A;  1QJZ A;  5T54 A;  1W8N A;  1CN1 A;  4JAA A;  2GME A;  3D4K A;  3AZX A;  5FUI A;  4CDX A;  4CRQ A;  2E33 A;  1GAN A;  4E4Z A;  4EN8 B;  4LUK A;  1X8M A;  1LOA A;  1H0B A;  5JI7 A;  4O9E A;  4IER A;  1L3J A;  1I9R A;  1DGR A;  1E5S A;  1FMD 1;  4JTN A;  1W9S A;  5FMD A;  1ZZC A;  4A3X A;  1UAI A;  1VRH 1;  3IMN A;  4E8C A;  1RJ8 A;  4XFC A;  5JXJ A;  4HN1 A;  5KHI A;  3FFZ A;  4LNV A;  4Y5T A;  4DXZ A;  4P9X A;  2D6L X;  1G9A A;  4I3P A;  4LK6 A;  2O14 A;  1PMJ X;  4UWD A;  3U10 A;  3GZE A;  1W9F A;  4HVO A;  4LO4 B;  5AFB A;  5FLI A;  1MS4 A;  4SBV A;  2YFZ A;  3V64 A;  3WF4 A;  5JIA A;  4Z82 A;  1PO1 1;  1C1F A;  1QIQ A;  2BVB A;  2DUR A;  2H6C A;  3IDE A;  3N7M A;  2UYA A;  2VMG A;  4DEQ A;  5IK7 A;  5L7O A;  2ADE A;  4QXH A;  2R07 3;  2WZR 3;  1AR8 3;  4DB5 A;  4LXL A;  5A6Z A;  2A6Z A;  3WDW A;  4YVW A;  1GBG A;  5CFD B;  2FCU A;  5GLU A;  2VQU A;  4YW5 A;  1LHO A;  5K0U A;  1N47 A;  1R1A 2;  4NN0 A;  1OA4 A;  4P9I A;  1Y7B A;  2P6H A;  1YJK A;  2P3I A;  4I0A A;  1IPS A;  5A7P A;  1XU1 A;  4FTS A;  1IQA A;  4CCM A;  5A33 B;  1ENX A;  2QDN A;  3K48 A;  3FLR A;  4YLZ A;  2RJK A;  5J98 B;  2XJS A;  1QKQ A;  1OF4 A;  1RUC 3;  2WBK A;  3CO2 A;  5FZC A;  4IEZ A;  4MET A;  3LPF A;  4DUV A;  1U5Z A;  3MGU A;  4XJZ A;  3ASI A;  5FJK A;  3PUQ A;  2ERF A;  4A45 A;  3DV8 A;  3HEI A;  4H2A A;  2PAE A;  2WFF 1;  4IEY A;  2WO2 A;  2YRO A;  3VUO A;  1TNF A;  1F9K A;  4CXW A;  2GP5 A;  1ST8 A;  4MGQ A;  1U5Y A;  2ZXQ A;  2ADD A;  5A32 A;  1VAV A;  5FCC A;  3SCH A;  3U11 A;  3PVO A;  4FQ4 A;  4BQ2 A;  5A1L A;  4GMP 1;  1D7P M;  3WY6 A;  3ZO0 B;  1XE7 A;  1UU4 A;  1FMD 2;  3ACG A;  3IMM A;  1XNK A;  1UX6 A;  2WQZ C;  1F5F A;  4B29 A;  1H2L A;  1VRH 2;  2QDR A;  1DYO A;  2W0X A;  4YVS B;  5HCF A;  4E4S A;  4FT8 A;  4OI4 A;  1SAC A;  1VP6 A;  2Z4F A;  3KLS A;  5DDJ 3;  4LKD A;  2VBP A;  3OPW A;  3POB A;  4UW5 A;  4D7T A;  3J7M A;  1O4Z A;  5FZM A;  4LHS A;  1G9C A;  1PO1 2;  2BJS A;  2FD8 A;  5C5U A;  2JXA A;  2MNG A;  2C9A A;  3Q9O A;  4CDX B;  1LUL A;  1CZV A;  1ULF A;  2GC2 A;  4GB3 2;  4Q4W 3;  3AMH A;  2Y6J A;  2VME A;  3JD7 1;  5HCH A;  1WWY A;  4YW4 A;  1Z7S 1;  2B8M A;  4O7X A;  2F4P A;  1POQ A;  3TYJ A;  1VBC 3;  3WOG A;  3KCX A;  2PHU A;  1OMI A;  3BUC A;  1RUE 3;  4TN7 A;  1MPX A;  3LA2 A;  4YG3 A;  4WM7 A;  4CYD A;  1WW5 A;  4O61 A;  1BEV 3;  1ND3 A;  2FDI A;  5C6C A;  1RUD 1;  5A3W A;  3B02 A;  3P1I A;  4QQL A;  2ZEZ A;  2XLA A;  1RL3 A;  3NNM A;  1DQ1 A;  5FY1 A;  1QEX A;  2RS3 1;  5AVP A;  4CDW A;  1UYP A;  2W46 A;  1F4A A;  4LO5 B;  1W2U A;  1VBA 3;  1KS4 A;  1HRV 3;  4BQ5 A;  5JSP A;  5L7O B;  2BBV A;  2VH9 A;  1SBF A;  1ZYB A;  4K21 A;  5HV4 A;  4NPM A;  2LRO A;  3LFM A;  4YVW B;  5A7N A;  5FIX A;  4A7Y A;  3ZXJ A;  4BZ4 A;  2WFF 2;  4YW3 A;  5LBF A;  3WDY A;  5LK5 A;  5K0U B;  5L9R A;  2QQV A;  1QWR A;  1TME 3;  3NWK A;  4EE2 A;  4OHZ A;  4RSU A;  1LOF C;  2D40 A;  3FX3 A;  1JYC A;  2AEZ A;  4LBJ A;  2QJV A;  3APB A;  3AXD A;  4GUL A;  3T2O A;  4ARY A;  1FOD 2;  5KXE A;  2IFR A;  3CHX A;  2J22 A;  4FFF A;  2VZO A;  4P9G A;  5A7S A;  3E5X A;  4MUV A;  3WF1 A;  2HJI A;  4KU8 A;  2BNN A;  2E31 A;  4Y1V A;  2KXL A;  3ZN4 A;  1JU4 A;  4UI9 L;  5D1I A;  2ZAH A;  1RUH 1;  3HD8 B;  3LAG A;  4B3N A;  4DNY A;  5JDB A;  1N3P A;  1XNT A;  4LO8 A;  2Q0A A;  1UIK A;  3CL1 A;  5F32 A;  5A32 B;  1NT0 A;  4QM8 A;  1AR6 3;  4M0H A;  4JDM A;  1CR7 A;  3JD7 2;  5EWS A;  4DUX A;  4LTA A;  5FYH A;  1Z7S 2;  2HWC 3;  1YC6 1;  3DYP A; 
#chains in the Genus database with same CATH homology
 2VC9 A;  1WCQ A;  3K77 A;  2JKX A;  3SEP A;  1TG7 A;  1K45 A;  2J1T A;  3NNG A;  3SEE A;  4KI5 M;  3III A;  4CVU A;  2DCJ A;  2ID4 A;  1GMM A;  3K46 A;  2WN3 A;  2VMD A;  4BJ0 A;  3VD9 A;  5JR2 A;  2C4X A;  5G05 L;  2LW8 A;  3HN3 A;  4LPL A;  3EB7 A;  3OBA A;  3I2H A;  4YPJ A;  2VQT A;  4JHZ A;  1SDD B;  4UAP A;  4FI9 A;  1DLC A;  1W99 A;  1CX1 A;  3I3E A;  2W92 A;  4CU8 A;  4D0Q A;  5I0D A;  1UYY A;  4A6O A;  2Y6G A;  4XUT A;  1O59 A;  2J7M A;  3UES A;  1JZ8 A;  2QBX A;  3A7Q A;  4M4R A;  4TXW A;  2J1R A;  3IB3 A;  2VCC A;  1K12 A;  1JZ5 A;  3F2Z A;  1KEX A;  4ZZ5 A;  4W50 A;  2C9K A;  5IFP A;  3FHA A;  2W47 A;  3CZJ A;  1PMH X;  3NQH A;  1UXZ A;  1OF3 A;  1OD3 A;  2E32 A;  2Y6K A;  3U37 A;  1SG3 A;  2EIB A;  4ARX A;  2C26 A;  5C70 A;  2CDP A;  3FN9 A;  3ABZ A;  3WSO A;  4BK5 A;  4GZ9 A;  4ET7 A;  1CZS A;  2VZQ A;  4D8M A;  2YG0 A;  2WO3 A;  2JD9 A;  3LE0 A;  3VD4 A;  2RV9 A;  2Y64 A;  1UY3 A;  3C8X A;  1JZ3 A;  4XUQ A;  2L9L A;  3WNN A;  4BDV B;  4QX2 A;  3K75 B;  3T0D A;  1JI6 A;  1UXX X;  4CUA A;  2DCK A;  2RVA A;  5G04 L;  3OGS A;  4IUG A;  2WAA A;  2QQJ A;  4BK4 A;  3WF3 A;  3DEC A;  4XUR A;  3DYO A;  3I2G A;  1JZ2 A;  4P02 B;  4QDS A;  4GWI A;  4JKL A;  1EUT A;  1JYV A;  4P5Y A;  3T08 A;  1JYN A;  4QX3 A;  1H6X A;  5C7G A;  1NKG A;  4QB2 A;  5EJ1 B;  1JZ6 A;  3CZU A;  1HN1 A;  2V72 A;  2W1S A;  4A3Z A;  1P8J A;  3IAQ A;  5IFT A;  2VZS A;  3LEI A;  3K4A A;  2VZ1 A;  3LPG A;  4OYU A;  1K42 A;  4DXR A;  5C71 A;  1UYZ A;  4XUP A;  4PQQ A;  5JXH A;  3MV1 1;  2WAB A;  4HG6 B;  2EIE A;  1NAE A;  4L0P A;  2W9X A;  2XQX A;  3HNM A;  2V5D A;  2B4K A;  3WNM A;  1F4H A;  5JUV A;  2VZ3 A;  5DN2 A;  3I2K A;  4M4P A;  4A44 A;  1UX7 A;  4MAD A;  5JMO A;  1GUI A;  4OMD A;  3VDA A;  2YB7 A;  4JKK A;  3IAP A;  3I3B A;  1JYX A;  3T2Q A;  4JX0 A;  2W3J A;  3WNK A;  3MUZ 1;  1XNA A;  4CU9 A;  2QQN A;  2EIC A;  3GDB A;  5A1A A;  2VMC A;  2CDO A;  3HNB M;  3VDC A;  2RJ2 A;  4DEV A;  2DDU A;  4QDR A;  1H6Y A;  3W5M A;  3HPN A;  3I2J A;  3OEB A;  2KD7 A;  4OMC A;  1BHG A;  4XUO A;  1SHW B;  3I97 A;  1O8P A;  4KMQ A;  3HJR A;  5CYY A;  1UMI A;  4RYD A;  1YQ2 A;  2VJX A;  2VZP A;  1W8O A;  3BGA A;  5B4N A;  2WYS A;  3NJV A;  2BGP A;  3THD A;  3E1F 1;  5IHR A;  2BGO A;  1UMH A;  1RYY A;  2WUH A;  4LKS A;  3NRU A;  3WF2 A;  2YC4 A;  3CQO A;  3FHQ A;  3NJX A;  4QPW A;  2YFU A;  5IYY A;  2X09 A;  1CIY A;  3J7H A;  4CU6 A;  4E8D A;  3OEA A;  1GOH A;  5JXI A;  1EUU A;  2VZU A;  3K4Z A;  3C7H A;  4CUB A;  2QQL A;  1US3 A;  2R7E B;  3GM8 A;  4P00 B;  1J84 A;  1GNY A;  2WAO A;  3I3D A;  2ORX A;  1XC6 A;  2VO5 A;  2HYX A;  4DXT A;  4ZZ8 A;  3GXU A;  3WF0 A;  3HOB A;  2X10 A;  3HNY M;  2WN2 A;  4XVH A;  1GOF A;  4MO3 M;  1JZ7 A;  2JDA A;  2J1A A;  1W9W A;  4A41 A;  4QDQ A;  5DPN A;  3W5N A;  3T0B A;  1K3I A;  1PX3 A;  3ACI A;  3ACH A;  3C7G A;  2QQK A;  3GGL A;  3UNP A;  4XUN A;  3C7F A;  1I5P A;  4UOJ A;  3C7E A;  1UY4 A;  4QX0 A;  3T0A A;  1O8S A;  2ORZ A;  3VD5 A;  4LQR A;  3LEK A;  3DYM A;  4AAX A;  1DP0 A;  3UET A;  4QB1 A;  4XZU G;  4PT6 A;  1UWW A;  5EIY B;  3T2P A;  1UY2 A;  1GU3 A;  1W0N A;  2WZ8 A;  5HPO A;  1JU3 A;  2W1U A;  2W1Q A;  2JE8 A;  4BXS V;  4TTG A;  4QAW A;  2BZD A;  3CMG A;  5F7U A;  3PUH A;  1L7R A;  2J1E A;  2VZT A;  1UY0 A;  3C7O A;  1UYX A;  2VZR A;  5IJR A;  4MGS A;  2ZEW A;  3MUY 1;  4MOA A;  4W4Z A;  3MV0 1;  5JXG A;  1W8N A;  5FUI A;  5DMY A;  2E33 A;  3MO4 A;  3I2F A;  2QQI A;  4QB6 A;  2ZEY A;  3VD3 A;  3WNP A;  1US2 A;  1W9S A;  2YC2 A;  1JYW A;  3JXS A;  4E8C A;  5JXJ A;  3IDA A;  3LEG A;  3BN6 A;  1JHJ A;  2EID A;  4QX1 A;  1PMJ X;  4OZO A;  1UZ0 A;  3ETP A;  3WF4 A;  3WNO A;  2YFZ A;  2VMF A;  4ZXE A;  1NUK A;  4DEQ A;  3I2I A;  2W91 A;  2B9V A;  3A21 A;  2PQS A;  4ZY9 A;  1J83 A;  1T2X A;  4A42 A;  3ZM8 A;  5LCW L;  3WNL A;  2VQU A;  3CIH A;  3A23 A;  3OGR A;  3EYP A;  3P6B A;  3OGV A;  2QQM A;  4DUW A;  2ZEX A;  1WKY A;  2VCB A;  2HLE A;  4GWJ A;  2BER A;  2XHN A;  2WBK A;  1OF4 A;  4CU7 A;  4DUV A;  3LPF A;  3OG2 A;  3T09 A;  4A4A A;  4A45 A;  3HEI A;  3K4D A;  2WO2 A;  4CUC A;  1ULP A;  4MGQ A;  2WQ8 A;  2ZXQ A;  3ACF A;  1OT5 A;  1JZ4 A;  2WDB A;  1IQD C;  1D7P M;  5CZK A;  3OB8 A;  3ACG A;  2J1V A;  3FL7 A;  1DYO A;  4W8J A;  2Z4F A;  5DQ0 A;  3VDB A;  1PX4 A;  5J1X A;  5B4X A;  4LHS A;  3PUI A;  4OUE A;  3LQC A;  1CZV A;  2WZE A;  2XON A;  4AG4 A;  5LA0 A;  2Y6L A;  2Y8K A;  2Y6J A;  2VME A;  4PF1 A;  1GOG A;  2E26 A;  1MPX A;  1ULO A;  2VZV A;  3A22 A;  1LNS A;  3P1I A;  3SKV A;  2ZEZ A;  2VR4 A;  2QQO A;  2Y6H A;  2X05 A;  2W46 A;  5EJZ B;  1KGY A;  1F4A A;  4KWU A;  3CDZ B;  3VD7 A;  2W95 A;  1GQP A;  2OKX A;  2XOM A;  2LS6 A;  1TVG A;  5LA1 A;  1OH4 A;  2BBA A;  3ECQ A;  2W1W A;  2W5F A;  5HXM A;  4RN5 A;  4Z2A A;  2WO1 A;  5LA2 A;  3AC0 A;  3MBW A;  2VM9 A;  1CZT A;  2VOT A;  4JKM A;  3T2O A;  4ARY A;  4DXS A;  2J22 A;  3WQB A;  3WEZ A;  2VZO A;  1W9T A;  3WF1 A;  3CKH A;  4P08 A;  2E31 A;  1XPW A;  1JU4 A;  3D3A A;  4UI9 L;  1L7Q A;  2V4V A;  1NX9 A;  2VTF A;  1XNT A;  1UY1 A;  2J1U A;  2J1S A;  3THC A;  2W94 A;  3SKJ E;  2VCA A;  2W87 A;  1R64 A;  4DUX A;  2VL4 A;  3DYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...