2Y6HA

X-2 l110f cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6hA00
2W92A 3WF3A 2VMDA 2ID4A 3CZJA 3ECQA 2W1QA 3OGSA 4CU7A 2EICA 2DCKA 4QDRA 5IYYA 3WNLA 3MO4A 2CDPA 2VCAA 3CDZB 3I3DA 2EIEA 2ZXQA 2VMFA 4GWIA 1OH4A 1CZTA 2VQTA 5C70A 4DXRA 3IIIA 4ARYA 4W8JA 3I2FA 2Y6GA 2W94A 2J1VA 3A21A 1SHWB 1GQPA 2WAOA 4W50A 1W9WA 2W87A 3E1F1 3ACGA 1W8NA 2BZDA 2WBKA 2ZEXA 4GZ9A 3VDBA 1K45A 3MV11 2ZEZA 3OEBA 4ARXA 3DYPA 4QX3A 3T0AA 1UYXA 2JE8A 1GOFA 4MOAA 2VZUA 4FI9A 4DXSA 4ET7A 2JKXA 3T2QA 2VZRA 2J1TA 1OF4A 1ULOA 2PQSA 3I3EA 4RN5A 2VZSA 2XHNA 1H6XA 2WO3A 1RYYA 2RVAA 3VDCA 1W9SA 3K4ZA 2JDAA 4JKLA 2VR4A 3W5NA 5JR2A 5DQ0A 4BK5A 2V4VA 3I2KA 4CU9A 4LHSA 3T08A 4AG4A 4BK4A 3WNKA 2VQUA 1CX1A 2VTFA 1JYWA 1F4AA 3WF4A 4E8CA 3GM8A 3IDAA 3F2ZA 5JXJA 2QQMA 3LEIA 4M4RA 3CQOA 5B4NA 1EUTA 4LKSA 2WN3A 5IHRA 2E32A 1GMMA 3D3AA 3ZM8A 3MUY1 4PF1A 2RV9A 3WQBA 2VMCA 2WN2A 3VD3A 4OYUA 1K12A 1CZVA 3GXUA 1O59A 4LQRA 5LA1A 4TTGA 2KD7A 3J7HA 2J1SA 3HNMA 3IAPA 5LA2A 1UXZA 3OB8A 3HJRA 1CIYA 2LW8A 5DMYA 1W99A 4P00B 2OKXA 1F4HA 2Y8KA 2W1SA 1JZ8A 1I5PA 4KWUA 3BGAA 4XUNA 1NUKA 4OUEA 5G05L 4JKKA 4KMQA 3VD5A 3NRUA 2WUHA 1JYNA 3C7GA 2LS6A 3K77A 2C26A 2ZEWA 1DLCA 4MGQA 2Y6HA 2BGPA 3P1IA 4QDSA 5JXGA 2EIBA 2ZEYA 3K4DA 3LEGA 3LEKA 5HXMA 4QX2A 3UNPA 2VZVA 1PMHX 4HG6B 3MUZ1 4QPWA 5IFTA 2J1EA 4A44A 4QB2A 3WNMA 1UWWA 1TVGA 2VCCA 3PUIA 3WF0A 1UZ0A 4DEVA 2J1UA 4DXTA 2XONA 1H6YA 1JYVA 4A42A 3IB3A 4DUWA 1ULPA 2J1RA 5LA0A 3T0BA 1US2A 1SG3A 2J22A 5A1AA 1W9TA 3JXSA 4P5YA 1MPXA 1KEXA 3C7HA 4P08A 3C7EA 2VC9A 4CU6A 3VD7A 1NAEA 3U37A 2L9LA 2WQ8A 4L0PA 3CMGA 3HN3A 3SEEA 4DEQA 5F7UA 3UESA 4UAPA 3EYPA 4A41A 3WSOA 3A7QA 3WNPA 1JU3A 3OG2A 2E26A 1UYZA 5JXHA 2VZTA 4RYDA 4CU8A 2X05A 1JZ6A 2Y6LA 2JD9A 1PX4A 3WNNA 1JYXA 2HYXA 4ZY9A 1IQDC 5LCWL 5JMOA 2BGOA 5G04L 2WYSA 3CKHA 4XZUG 2W9XA 2YC2A 1UX7A 3T2OA 4BDVB 1W0NA 5B4XA 1GNYA 3NJVA 1LNSA 3I2GA 4PT6A 2W95A 3C8XA 5JUVA 2W1UA 5CYYA 3SKJE 1XC6A 3FHAA 3LPFA 4IUGA 3ABZA 3FHQA 1DYOA 4UI9L 3OEAA 3THDA 3T0DA 1JHJA 3ACHA 4PQQA 1UY0A 3HPNA 1EUUA 5FUIA 4BJ0A 2ORXA 4XVHA 3PUHA 4OMDA 3IAQA 3OGVA 4ZXEA 2EIDA 2YFUA 3K4AA 3EB7A 2VL4A 1OF3A 3HNYM 5DPNA 1BHGA 4JHZA 3AC0A 2C9KA 4QB1A 3DYOA 3VD9A 4QB6A 4TXWA 3FN9A 2WO2A 1PX3A 1K3IA 2V5DA 2VZOA 3A22A 5EJ1B 1O8SA 2V72A 1XNAA 4MO3M 2B4KA 2W46A 5IJRA 3LQCA 1JU4A 1US3A 4XUQA 4OZOA 2QQOA 2QQNA 2DCJA 2YFZA 3FL7A 3CZUA 4OMCA 4CUCA 5EIYB 1OT5A 3HNBM 3ACFA 5IFPA 3LPGA 2VCBA 2QQJA 1UMHA 2ORZA 2W47A 2W5FA 1GOHA 3HEIA 3WF2A 4JKMA 1JZ5A 4QDQA 3WNOA 4BXSV 2E33A 1JZ2A 2R7EB 3A23A 4AAXA 3I2IA 2E31A 1WKYA 1W8OA 2Y64A 1L7QA 1JZ7A 3UETA 5C71A 4CUBA 1UXXX 1J84A 1KGYA 4JX0A 4MGSA 4LPLA 1XPWA 3CIHA 4D8MA 3P6BA 1OD3A 3OGRA 4A4AA 3GGLA 3I2HA 2VZQA 2QQLA 3SEPA 5HPOA 2QBXA 3C7OA 4DUVA 4Z2AA 2W91A 1GUIA 3K46A 1UY1A 2VZ3A 3DECA 4GWJA 3SKVA 1JZ3A 1PMJX 2J7MA 4A6OA 1NX9A 3NQHA 3I2JA 3MBWA 1UY3A 2BERA 1UMIA 2W1WA 2VJXA 2X09A 2YC4A 1WCQA 1NKGA 4XUPA 3I3BA 2RJ2A 1UY2A 1DP0A 1JZ4A 2XQXA 2W3JA 3WF1A 4MADA 2VO5A 1P8JA 3WEZA 2WDBA 2YB7A 3W5MA 4UOJA 4CVUA 2WABA 4YPJA 3LE0A 4A3ZA 2XOMA 3ETPA 1UY4A 3THCA 4XUTA 1YQ2A 2DDUA 1JI6A 3OBAA 2VOTA 2Z4FA 1R64A 3BN6A 1K42A 5EJZB 2VM9A 3GDBA 1GOGA 1HN1A 2YG0A 4P02B 1O8PA 3C7FA 3NJXA 2B9VA 2QQKA 2QQIA 4E8DA 2VZ1A 2WO1A 5JXIA 2WZEA 4QAWA 4XURA 3NNGA 2WZ8A 2WAAA 3MV01 3T09A 5J1XA 1CZSA 5C7GA 4M4PA 3DYMA 4QX0A 1UYYA 2Y6KA 3I97A 4DUXA 4A45A 4CUAA 3HOBA 2J1AA 1SDDB 4ZZ5A 1J83A 1L7RA 2BBAA 1D7PM 4XUOA 5DN2A 4D0QA 5I0DA 3VDAA 3ACIA 5CZKA 3VD4A 4W4ZA 4KI5M 3K75B 2VMEA 2X10A 1TG7A 2CDOA 1GU3A 4ZZ8A 2Y6JA 1XNTA 1T2XA 2HLEA 2C4XA 4QX1A 2VZPA 3T2PA
chains in the Genus database with same CATH superfamily
2W92A 2XVKA 3VHRA 2ZAHA 2Z2SB 1UYPA 2DURA 4RHV2 3CZJA 1H4GA 4GWNA 3ECQA 3NO8A 1DYKA 2YYOA 4UWDA 5BNNB 5JZGA 2EICA 3EMRA 1VJ2A 2D6MA 3ZYGA 4Y1UA 1HLCA 2GDFA 4LOSA 1UD1A 4YG3A 2RS11 2IVIB 3H8XA 1RUI2 3MPBA 2EIEA 2QQUA 3NL1A 2VMFA 4GWIA 2ZGNA 1K5MC 5TSWA 5DXDA 1W2UA 1IS6A 1CZTA 1OA4A 3IBMA 2WO7A 4UW5A 1QJX2 1CQ9A 1QJY3 4HT1T 4LBOA 4ARYA 4W8JA 4P9GA 2HBUA 1ODMA 3SCFA 4HANA 1RMU1 3J7NA 5I0RA 2XPJA 1G9CA 1AR61 1K5MA 2A6ZA 2GC3A 1MEC2 2Q8CA 2W87A 1COV1 1OQ1A 2NM1A 4KGGA 5DAPA 1W8NA 1Q8OA 2ZEXA 5FQ0A 1DZRA 4AXOA 3VDBA 1HB3A 4P14A 2ZEZA 1LOEA 3RI8A 4R9CA 3AVRA 1GYKA 1N1VA 2O1QA 3OEBA 3DYPA 1Q56A 5JR7B 3V65A 4Q4Y3 4DQAA 1LHNA 2VZUA 4FI9A 3VKLA 3VHNA 2VGDA 2PMWB 1O5UA 1Z0HA 2VZRA 2J1TA 5KXCA 5FZIA 5F5QA 4NAOA 5AC91 2O8QA 2VZSA 3VZLA 1AZDA 3B00A 2WO3A 3M7AA 2RVAA 3ZIXA 1CAUA 5A70A 2CU5A 2P6HA 3OOXA 2VR4A 4FTEA 1NLQA 1AXZA 4GB31 3U07A 1SBEA 4YW5A 4LUMA 2V4VA 1EAH1 1RUJ2 4GH4B 3T08A 1Y43B 1YC61 3WR0A 2P2KA 1W6QB 3BU0A 1BVP1 3WQ7A 3HBZA 1JMUB 2IXJA 4DRVA 1VRH2 3M1HA 1V6NA 2C0ZA 4YNIA 3R0RA 1DGWA 3HWJA 2EALA 3ILNA 3OPZA 2C5DA 3D6EA 1UL9A 4W65A 2W08A 1T6GC 4Y4RA 1POV3 2YC0A 1RUH2 1GZCA 1W6NA 1GICA 3CJXA 3LEIA 4LBJA 2WA4A 3CQOA 4Y5SA 1W2OA 1EUTA 3B3QE 2WN3A 1CAWB 2R073 1H1MA 1FV2A 2CTVA 4XTPA 1XQNA 4CYDA 4CP2A 3HT2A 4OUMA 3D3AA 2B8MA 3JUUA 2A75A 1MVEA 1OH3A 2P3KA 3JQXA 2BQPA 2VVEA 4IEPA 4NPRA 1CX4A 1RHI1 1K12A 2JB8A 4IE0A 1Z7S1 2PHFA 2NYYA 3WVJA 1HQNA 1ZZ9A 5T50A 4XFHA 1AL22 4MGYE 1PZ7A 1YIFA 5IK7A 3I49A 2KD7A 2A3XA 4WVZA 4XQWA 4GKYA 4XJZA 1XE7A 1YHFA 1YJLA 2E63A 4YVWC 2PYTA 3HJRA 4CCEA 1CVNA 2QTWB 3NNLA 5CA6A 4I2OA 4KH9A 3FBMA 4Q26A 2JXAA 2Y26A 1F4HA 2HJIA 1BK1A 1YIPA 2Q8DA 4CDUC 1AR82 1MQTC 4KWUA 3B01A 3BGAA 4XUNA 3ZPOA 1NUKA 2VW0A 5L7OC 3OY8A 2PHRA 5JLVA 1AX0A 1ONAA 3LOBA 1BVVA 1VBB2 2LS6A 2DFCA 2ZEWA 4MGQA 2JDZA 5FZMA 2Y6HA 5I0UA 2QJVA 4GJZA 4QDSA 4XBNA 4CEWB 2XKOA 2BYVE 3P3PA 1PGL2 2SLIA 5HXMA 2TBVA 3ZMNA 2VZVA 3UNPA 2WZR1 5LRSA 3I2OA 1PMHX 4U2AA 4YW7A 1OD5A 3ATGA 3AP5A 4QXKA 1WCDJ 5IFTA 4QPWA 3LEMA 1OC1A 3OBZA 1SFYA 5F6KA 3ZSJA 3AYDA 5T5OA 3WNMA 4OQ8A 2O14A 5EFUA 2VCCA 5IAXA 1RC6A 1VAKA 1LR5A 3AM2A 3PVBB 4GD4A 2J1UA 4P9XA 3RJRA 1GLHA 1N3QA 1ODNA 4UFJA 1IG3A 3KF3A 4DXTA 1BYHA 2HWE2 3ZFFC 4I3PA 2HWD3 1NLSA 2RS33 3IB3A 3RG0A 5A3OA 3WDTA 4AI0A 3OGGA 4QU2A 5CB7A 1QNYA 4NIDA 2Q5TA 1US2A 2N7GA 1HX6A 1ASJ1 4LA3A 5IATA 4JDMA 4JGZC 5LK7B 5BYNA 5A1AA 3HQXA 5D8AC 2VOKA 3VLBB 1BKZA 1WLDA 4P08A 1HW5A 2VMIA 4N43B 1SACA 1GR3A 1W6PA 5C3QA 1FMD1 1V6JA 1ZRDA 2UYBA 4IV1B 3JZVA 1S0JA 2VULA 2WNUC 3VDDA 5GLTA 4RHV1 2UURA 1E5SA 1GWLA 2L9LA 4EYUA 1GBGA 1V9U2 4HONA 5JOWA 1GP6A 4ZU5A 2ZPXA 1W8WA 4IETA 4IE7A 3VN4A 2QQWA 1KITA 3SCGA 1I1EA 2FDIA 3ORJA 4BA6A 3RRDA 2WNUA 2EXJA 1OUSA 1OURA 5I8YA 4I3GA 1RUG2 1U12A 5ACA2 2VOXA 4LEJA 1VMFA 3WP5A 2DU0A 4IEWA 2VNVA 2X05A 4Q0VA 3TBDA 1JZ6A 2FZ2A 1G9BA 3IDCB 4M3CA 4IW3A 2Y6LA 2YGLA 4OFGA 2ZGUA 4CCJA 3LD8A 2HYXA 1WW5A 5LCWL 3ZX7A 3LFMA 2BGOA 5HV4A 1MEC1 2R062 4WVVA 3CL1A 2DTYA 1AYM3 1NA1B 3S5QA 1DGLA 3GJAA 1PZ9A 1V00A 2RS13 4Q1RA 4FO9A 4E2GA 4EWAA 2WZPP 5B4XA 1ND3B 4NUBA 2FBEA 3IT8A 3QBQA 4Y1VA 4BM8A 3AJZA 3FFZA 2G4IA 1DFQA 2A3YA 1LGCA 1UQXA 2P37A 2W95A 3RGBA 5BY5A 2LROA 4HPKB 2IXIA 4XDQA 1CAVA 1KJRA 4YVSA 1LGBA 3ILRA 5EHDA 2OPWA 4C1WA 4IUGA 4OHXA 1MZFA 4CCOA 3UK9A 1AXKA 1RMU3 3VKMA 4YARA 4HN1A 5I91A 1AR71 1AR63 3OEAA 3THDA 3WHUA 2ATFA 4O9EA 1EV11 5JVVA 1LOFC 2W52A 5FBJA 4B29A 3ZYJB 2IVJA 1EYBA 4D7SA 5DDJ3 3HPNA 1M4WA 1W2AX 5FUIA 4YW3A 3GNEA 2ZJCA 4AHWA 1D0GA 4C91A 2JG9B 4LT5A 4BCUA 1RUJ1 1UU4A 3Q8AA 5DUWA 1UZVA 2R042 4HVOA 5FY1A 3O1MA 1LOFA 3PUHA 5BNOC 3VB9A 2XJUA 4MHRA 4W6WA 4ZXEA 3ZVXA 2EIDA 1DU3D 1NQJA 2YFUA 4NIIA 3J26N 2XUMA 5EP9A 3S5AA 3K4AA 3EB7A 3KQRA 2AR6A 3PURA 4XABA 4ES9A 2FDKA 3LA7A 2D98A 1RUOA 1HXS1 5BNOA 4MV2A 2WWSA 1RVF1 1QHDA 2R6QA 5LY1A 1JBCA 4BQWA 3AC0A 3W21A 1KDKA 5IUQA 5DZEA 4A6SA 2GAUA 1PX3A 3MPPG 1Y9GA 1UOFA 1K3IA 2B46X 1AL0G 2GC0A 3B69A 3HD8B 3KVAA 5F5IA 4YZ3A 1PZ8A 1S2KA 4B8EA 4YW6A 2XJSA 4FFGA 1XNAA 5FK7A 1FOD3 5EPAA 1X9PA 2RDNA 1TNRA 3ILFA 4IL7A 2GMPA 2CAUA 1YQ5A 4Q2FA 4AQ6A 1D4M1 1AL21 5A33B 3GYDA 5GM0A 3ZXDA 2XWJB 2RM22 2NPIA 3H3LA 1QJU3 3KZ4C 1FXZA 3HQRA 3SHRA 3ZXAC 1V70A 4GAZA 2A5ZA 4CUCA 1PVC2 3J7LA 1OT5A 1IKPA 4Z07A 3ZXFA 5E6HA 4WM8B 2VCBA 1LOCA 4H14A 4D6SA 2VOVA 2QZ3A 5I0SA 3GBGA 2QQJA 2YMZA 4AWDA 3NSTA 5FV3A 4Y22B 5LW9A 3ON7A 3VBUC 5KHGA 3AB0A 4NIGA 4BB3A 2R7EB 5F9TA 3A23A 4HMZA 4I0WB 2JDNA 2VPVA 2WT1A 4JDNA 4L97A 4YGBA 5FYZA 1NE4A 1XYOA 4RQPC 1PIV1 1W8OA 4UFIA 3RMYA 2VNGA 4B4RA 3VBSB 2ILMA 3AYCA 3B5LB 4Q4W2 1RXGA 5H9QA 3UETA 1TE1B 3D82A 1J3RA 2HWC3 2WINB 5A3WA 1MR5A 3IM0A 5FPVA 4RS5C 4JX0A 2HWF3 3Q8EA 2X8KA 4RQPA 4GMP0 1SCSA 2XVGA 3P6BA 3AMNA 3R4UA 3T4VA 4A4AA 1G9DA 1XYPA 2ZX2A 1KJLA 1SLIA 5A6XA 5HPOA 1WD4A 1OQEA 2ZHKA 1DZTA 2JE7A 2W91A 4G4FA 3PIJA 3K46A 4LJHA 4SLIA 2CV6A 3M2MA 1JW6A 1UY1A 4NMIA 2HBTA 2ZBJA 3OUIA 3FJSA 4ZU4A 3X29B 1SBFA 4TLGA 1HDKA 4ZONA 4XFGA 3ZSLA 3SKVA 4MXWB 4FPGA 4AW7A 3JB4C 3LGRA 3KCCA 1WWYA 3I2JA 5FPAA 4LORA 5FPBA 4RFRB 3WQ0A 3NAPC 4CEWA 1WA4A 3AP4A 1OOPB 3ZO0B 1LOAA 2KR2A 2WFPA 1HRI1 1REEA 2CWSA 1DP0A 4YZ1A 1GQGA 3V0AB 4G9SB 4XFFA 1S2BA 3GHNA 1G9FA 2HEWF 2P3YA 3NAPA 4YZ4A 1P8JA 4LA2A 3WEZA 3S0MA 5SV5A 3N3HA 4CDXB 1AXYA 1YRZA 1RUG1 2A6WA 4CVUA 3SXWA 2Q4SA 3K2OA 4UFMA 5FUNA 4DS0A 1XU1A 1E5RA 2ET1A 2DFBA 2P6CA 2QFEA 2ET7A 4QGMA 1NCRC 4XUTA 3SCHA 1YQ2A 3T1MA 1WLTA 2VCMA 5FZDA 5FYVA 1FMD3 5FYBA 3BIEA 3H8OA 5BPXA 2OT7A 5B2GB 1HQWA 1DYPA 4N7UA 5A1LA 4I09A 4Q8LA 4RHV3 2VU9A 4GA9A 3KV6A 3H50A 1U5XA 3TRSB 2DUQA 1H2LA 4YLZA 1NCRA 1EP0A 4W6YA 1YFYA 1HRV2 1BZWA 3FLPA 5FTTC 2B9VA 4YYOA 3RYRA 3WG4A 2DTWA 4DXZA 1RUI3 4CXWA 3AZWA 4WVWA 4X6RB 3MFCA 1D2SA 2DVDA 2GNDA 1QJEA 2LUWA 2D6OX 2EA7A 3JBG1 3TEXA 3SNMA 3POEA 4K21A 4IEOA 1SLLA 1QJX3 1K5MB 1RUE2 4XURA 5FYMA 3WW2A 5J1XA 2QQVA 4LHLA 1OQDA 5C9AC 5L36A 4GXLA 5EWSA 5C7GA 2FCVA 2WR9A 3O1OA 4FAHA 3BTXA 2QNKA 2DVGA 1S55A 2WSVA 4ZXKA 2E6VA 4DUXA 3KHBA 3KHCA 4BMBA 1W8ZA 1MEC3 4P5HA 2ZGLA 3MIFA 3AP7A 4OI0A 2FHRA 3MGUA 2QE3A 1IPSA 5FUPA 3SLIA 4KU8A 3ZFGC 1VB4A 1WW6A 3HOBA 1SDDB 1XNKA 2J42A 4URTA 1XYNA 4A7YA 4BQ1A 4DZGA 1J83A 5C9AA 3ES4A 1GP5A 2JWPA 1L7RA 1AJOA 2BBAA 2BW8A 2DCTA 5DN2A 5I0DA 4FPCA 2R041 2BGCA 2QDRA 1OBNA 3ZFGA 2VG9A 1IHMA 5FZOA 1XXNA 4C0HA 3MLLA 2A73B 2UY9A 5D1IA 4NHXA 4FOQA 1ND3A 2VMEA 2Y34A 1CAUB 3J4UH 1PM7A 2X10A 1TG7A 2CDOA 1QXRA 3UGFA 4NWVA 1V6OA 5CKMA 4CCCA 3POFA 3IDBB 5A3UA 2C4XA 4HOOA 4M01A 1VR3A 4PIZA 3KT7A 1COV2 5JR2A 1LHVA 2YXSA 3NKTA 3T2PA 3WF3A 2QUOA 2VMDA 1SLAA 4CE8A 2EXIA 1DQ6A 1RUJ3 1H9WA 1UN1A 2ERFA 2W1QA 3JU9A 3ME2A 5A32B 2RJLA 1CPMA 1FT9A 2DCKA 3LA3A 3U10A 3PVOA 2VCAA 5KHKA 1VRH3 1ZZBA 1FX5A 2JG9A 1W04A 4NWWA 1S0GA 2R16A 1W6NB 2GN3A 2IXLA 4YRDA 5C5UA 5AFEA 4S2DA 3BCWA 2WFF1 1UU6A 5AC92 2UWAA 2VQTA 4I30A 5FMBA 1RUH3 3POYA 4DXRA 4NPMA 1PVC1 3MW4A 4XIOA 4FP2A 2Q0AA 3MEPA 1X9TA 2Y6FA 1BBT2 5JSPA 4GB32 1GQPA 2E7QA 4QMAA 5FMOS 1EAH2 1W9WA 3LB9A 4AFDA 3E1F1 4CCDA 5FZLA 4ZS3A 1IS5A 2BZDA 2NN8A 2OIIA 3KCYA 4UW4A 2Z5WA 4GQ7A 4AI8A 1DQ2A 1X8EA 3NJYA 2D6KA 4EZHA 2VNRA 1AL23 2XLAA 4XMIA 4QX3A 1PNGA 2TNFA 1NYWA 1JS9A 4J6GA 4UT5A 1VAMA 4K1YA 3ZYBA 4DXSA 1RITA 5HBAA 2PA7A 4OULA 2V4AA 2JKXA 3T2QA 4JDOA 1OFNA 4H7LA 1OF4A 2JEMA 2JIGA 4KNCA 3OY8B 5E1RA 4TSVA 2DF7A 3S6PA 3ZR5A 4I01A 1T6BX 4NHYA 4P9IA 4Y20A 1RYYA 1AR83 3T1LA 3GBWA 4Q1PA 3VZKA 3V0BA 2PTMA 1OSGA 3TNQA 3K4ZA 4CDUB 4IE5A 3DXUA 3W5NA 5L7OB 4NHMA 5DQ0A 4GALA 4GULA 4BK5A 3FX3A 4LHSA 4UBHA 2HWB2 1VBB3 4AZZA 2JD4A 2ARBA 4HSLA 4AG4A 5CIRA 3EXUA 1W8FA 4LHNA 4ONUA 4RFT0 4K8FA 2VBPA 4OHZA 2P3JA 5SV8A 3O5SA 3MIDA 4AVCA 1BEV1 3EHKA 5ERLA 5FLHA 3BTZA 2VTFA 1JYWA 3OF1A 2YROA 3WCRA 1ZBE1 4OLLA 3GM8A 3IDAA 1RINA 5H9RA 2QQMA 5FP8A 2OA2A 4M4RA 1R092 2E51A 1W39A 2HWE3 3SH5A 2ZGOA 4XQ4A 1ST8A 5LBEA 3RYKA 2WSUA 4CP9A 4HKLA 1Q8QA 4NROA 3ZFFB 3MUY1 4PF1A 5A7WB 3WQBA 3UGGA 2MHFA 2YGMA 2FDGA 1W6PB 4EN0A 3VD3A 1YJKA 4XJ8A 2CHHA 1I6XA 1OLRA 1BCXA 2PQQA 5J3UA 5FP7A 1O59A 4JGZB 3N9OA 3V64A 2WZR2 3H9AA 5LA1A 5D8AB 1LENA 2J1SA 3HNMA 5GLVA 4BE3A 5LA2A 5FOBB 3OB8A 1A6CA 4CPBA 1LESA 1O4ZA 5FZ7A 1CIYA 5LY2A 4RL7A 1V9U3 4E4SA 2WNUB 4K1ZA 1JODA 3AFKA 4TLFA 2BVVA 1HRV1 2OKXA 4CDQC 1L7LA 2WLPA 5FZKA 5FZAA 1ENRA 5HCAA 1C1LA 3QOPA 4XBLA 1ZRCA 5DAVA 4M3CB 5CG9A 1RUG3 3OD4A 4JKKA 4MZUA 5ACA3 4J25A 3V0AA 4KMQA 3NRUA 1BK0A 5JPMB 1ASJ2 1RIRA 1X36A 2WUHA 3AVSA 1JYNA 1IKQA 4I02A 2MNGA 4N53C 2P17A 4XZPA 4XXAA 1UOBA 4CDQA 1S0BA 2HEVF 1WMEA 4M3CF 5JMCA 3WNXA 5AVPA 2EIBA 3H8RA 3O14A 3LEKA 4L2NA 3VV1A 2ZX4A 3O0WA 4QX2A 3KV4A 4UFLA 2R063 4H3WA 1SFNA 2R1DA 3MIHA 1JHNA 3MIEA 3NNMA 4FFIA 3H8UA 5A7SA 3MUZ1 2PELA 2WNVC 3IWZA 1OVPA 3KVBA 4OI4A 1HJFA 1DGWX 2D44A 3VKOA 4QB2A 1NCQC 2QQPA 1TVGA 5FZ8A 2VUJA 3WF0A 1HB2A 1CAVB 4YVSB 3Q8CA 2ARCA 2XONA 3ALQA 4YZ2A 1SFPA 4A42A 1Y9QA 2WNVA 1Q8VA 4FT8A 3MW3A 5JIAA 1R081 2HKXA 3O1SA 3I3MA 4GMP1 1UPIA 3VUOA 5IT6A 1NCQA 3TOJA 5LA0A 2IFWA 4FPHA 3ZN5A 1LHOA 5ANNA 4AFAA 3GCXA 4P5YA 3JXSA 1Y3TA 1MPXA 3WP6A 1KEXA 4F83A 1QOSA 4CTEA 4COUA 2VC9A 2E53A 1NXMA 3K3OA 3VD7A 1R1ZA 4CU6A 1GWKA 4JGYC 3E97A 4O9GA 2ADEA 1C5HA 5GZCA 4UF0A 4A2UA 4CCLA 3ZYIB 2R043 3FLTA 1SEFA 4R52A 4BQ4A 4D6QA 1Q3EA 2XMLA 3CMGA 3HN3A 4X8NA 5DZGA 3SEEA 5CVRA 3MI8A 4DEQA 1O3RA 1FPN2 1YFXA 4UAPA 4JGYA 4YWAA 5F2WA 4KU7A 3A7QA 3E5UA 5FLIA 5BNOB 3CLPA 3GZUC 2IFRA 1LHUA 3UKTA 4IEYA 3OG2A 4R9AA 5C4WC 5FBZA 4E4HA 1VBD2 4CDWC 3USUA 3WUCA 1BJQA 3OD0A 4BHPA 1U5ZA 1FI2A 2VZTA 1AR72 1C1FA 2XG3A 2Z42A 3KWVA 4RYDA 3N7KA 4LO5B 4BWOA 4DMIA 1EV12 5J96B 4MUVA 4INDA 1MS3A 4CPBD 3RNSA 5C3RA 5IVVA 4ZHNA 1JYXA 1NZCA 3R6SA 5C4WA 4CDWA 2RS52 1BBT1 1LKNA 3I8TA 4CCKA 3ZMOA 1H4HA 1XU2A 4LBLA 3NVCA 1F9KA 4LKDA 3U1XA 4AEMA 1X33A 4B1LA 1C28A 3CKHA 3DN7A 5ANQA 2IZWA 1O6UA 2A3WA 3T2OA 4BZ4A 1KD7A 2DWRA 2LTNA 3KMHA 2JDUA 1W0NA 4XDOA 5FY5A 3WG3A 3NJZA 4FAGA 2FDJA 5A32A 1GFF2 1GNYA 2ZHLA 3KLSA 2RM23 4EWDA 4AEDC 2ZGKA 4BLJA 5BV6A 3NJVA 4EN7B 3I2GA 1HXS2 5JUVA 3C8XA 3P5BA 1WCKA 1LU2A 1SDWA 1RVF2 5FCCA 2OQ7A 1DGRA 4CSWA 1PVC3 2CSGA 3LPFA 4Q4V1 4DO0A 2RMU1 2GP3A 3ABZA 4QPIC 3U11A 2YPJA 4UI9L 5FYSA 3RZZA 5FRAA 4CP9B 2GC2A 4PF5A 1JUHA 2G1MA 2RHPA 5GZDA 4L8QA 4NE9A 1ZZ7A 2WYFA 4KWLA 4PQQA 5JOXA 3VBUB 4QPIA 2HH9A 2I74A 1ULDA 2HWB1 2BWAA 2ORXA 4Q4W3 1G9AA 4JTNA 1D4M2 1VBC1 4LE4A 4RQPB 4EV0A 4YM3A 3L2YA 2GNMA 3EBRA 3LOIA 4NO4A 5K7PA 3TEWA 4XFBA 1M06G 3JCIA 1APNA 5FYUA 3IDEA 3THTA 3PVEA 2XWBB 3FE5A 1SLCA 3M3EA 4RS5B 1DLLA 3INAA 4ORFA 2VW2A 1OF3A 1CJDA 1KS5A 3HNYM 5DPNA 5A80A 2YZ4A 3A4UA 3WP4A 4CA9A 2KA3A 4NIHA 1PGW2 4CUGA 1DZQA 2OW4A 3B9IA 2IC1A 4U36A 4OI1A 4F3JA 5J98B 2X5IC 2AH2A 5DZFA 4YVWA 5CFCC 5A7PA 4QB6A 1R091 3AKRA 3ZOIA 2WO2A 3ZXEA 2QDNA 3UYJA 2YV8A 3QACA 3WHTA 4Q0QA 1PIV2 2OS2A 2ZCWA 1VRBA 3A22A 3WUDA 3PL0A 5EJ1B 3VBFC 2D3PA 2V72A 5FZEA 4CDUA 1RUNA 1MQTA 5CFCA 1DQ1A 5L7OA 2B4KA 2ZTNA 2W46A 5IJRA 2BJSA 3ZSKA 3LQCA 4IGPA 4IE6A 5IWFA 1OPMA 1WBLA 1F31A 1UO9A 5BNQA 3GZTB 3ZDSA 5EZWA 3RQ0A 3VBFA 2QQOA 3ROUA 2FCTA 3POJA 1VBA2 5E8AA 4QGNA 1ZNPA 3NAPB 2ETEA 4FVVA 5JI7A 4XJ9A 4OMCA 3UJOA 2BVBA 2LM3A 2JDMA 3M3QA 5GJ6A 5FOJB 1HQLA 5J48A 4Y5Z0 3M8LA 3AL5A 5FZGA 5JCTA 2W5FA 1W3XA 2JKBA 3VBRC 4QDQA 5F37A 4S2HA 3AKQA 4Q8KA 5JPNB 1SZBA 2EF6A 5HXVA 1O7FA 4COWA 1G6NA 4H7MA 2Y64A 2R1BA 1LOGA 2BTVC 2WC2A 4IEUA 5A7WA 3ZFFA 4BISA 1X8MA 1JZ7A 3VBRA 2MEV2 1NCRB 4E4ZA 2PLV2 4BIOA 4CUBA 4BQ2A 4Y1YA 5LRRA 1HIXA 1KGYA 3WDWA 3RZMA 5FPZA 4PQ9A 4LPLA 2D3RA 1XPWA 4AK3A 4JGZA 3CIHA 1HRI2 4HL0A 1O3TA 3OGRA 1OD3A 5D8AA 1WW4A 2VXRA 2LRPA 3Q9OA 2XVLA 5AVAA 1QQP2 2VZQA 2QQLA 3KQ4B 2GC1A 4LO7A 3O1VA 4HK8A 3W59A 4EWEA 5FAXA 4P9JA 4Z2AA 3RYPA 1ULCA 1VIWB 1UOJA 5LA9A 4XF9A 3B93A 3LDRA 3N7MA 1TMF2 1RUE3 4I0AA 4AVSA 3PTRB 4GWJA 1NY71 2XBO1 1JZ3A 2ZS6B 3TEZA 2J7MA 5C9AB 2AEYA 5FR3A 2YBKA 2ZACA 1POV0 3OCPA 4Q0UA 1BXHA 4HXCA 4BIFA 3GZEA 3J9SA 1BLZA 2X09A 1C5IA 3WINE 1WCQA 3ZFGB 1FNYA 1NKGA 4BQXA 3I3BA 5FZOB 3FWEA 5A3MA 1W90A 3RFRA 2MPFA 1UY2A 3U4XA 4UFHA 3N9MA 5APAA 5C33A 1OPOA 2V73A 3WDYA 3JBG2 1FPN1 1ZZCA 3D4KA 2VO5A 1AYN2 4PCRA 3SC7X 2AYHA 2B42B 2NLRA 2WDBA 1DCSA 2YB7A 2WJSA 3W5MA 4UOJA 1VBD1 4K9SA 3AL6A 2WABA 4YPJA 2JB4A 3HR9A 3LE0A 5K8SA 3ETPA 3THCA 3U0ZA 2JENA 1N3OA 3RI9A 5F39A 2DDUA 1AR91 5FZHA 5A3LA 1COV3 1H1AA 5T52A 1JI6A 2WNEA 2D7FA 3WV6A 1W28A 2RS51 1XSQA 3AFGA 1PM4A 4NR1A 4TWTA 1K42A 5EJZB 3PUQA 2VM9A 3N9LA 1REDA 2AGSA 1U0AA 1HN1A 2BU9A 2E7TA 5GLUA 3AXDA 4LO8A 3G6JB 4P02B 5GLZA 1E5IA 1F5JA 3WG2A 2BFUL 4DFSA 1UF2C 2ZZQA 3CEWA 4TYSA 4E9KA 4MH0E 4TZDA 1X50A 2Q30A 3WOGA 4E8DA 3ZN6A 4HETA 2VZ1A 2WO1A 4PI0A 4AHZA 5AC93 5JXIA 2WZEA 1L3JA 1YNAA 3PHMA 4LUKA 3SH3A 3NNGA 2ZX1A 2WZ8A 2DVBA 3MF6A 4HZFA 5FXWA 3MV01 4NHLA 1QMJA 2D93A 2ZMKA 3AMPA 3K51A 4Y4YA 4AHXA 4D7YA 1QJZA 3RZLA 1BBT3 4GB33 3BOPA 4QX0A 4A45A 1EAH3 3HN1A 1DF0A 3C2UA 2PHDA 3ZYFA 4CCMA 1QIQA 5C3OA 3D8CA 4CUAA 4QQHA 4LIVA 1PO11 2J1AA 3IZOA 1VBE1 2TUNA 3H7JA 1CN1A 4QQPA 4RR3C 5J36A 1C8M1 1C57A 1JH5A 1ENQA 2G9FA 1G8WA 1H8VA 1QDCA 2WFF2 4FFHA 4XF0A 5CZKA 4YM1A 3K75B 2IXCA 3JD71 4Y20B 2P4EA 4ZS2A 5L9BA 3VGIA 4ASLA 4DRRA 3V0BB 1WBFA 5ABJC 4CCNA 4AI2A 4RR3A 3GBFA 3RSJA 4GIQA 4GH4C 4B7KA 5CFDC 4M00A 1PGW1 4QD2A 4HSJA 3N9PA 4Y26A 5E16A 5ABJA 2VBBA 3EJKA 4QHBA 1RHI3 1Z7S3 2NMNA 3AXEA 2HWB3 1XJAA 4LR4A 4RA0A 5HV0A 3I3QA 3BTAA 4UBGA 4CU7A 3PUAA 2HYKA 3L2HA 3UL2A 1CGPA 3PIGA 1ND2C 5IYYA 3ENRA 3WNLA 3MO4A 3CDZB 3VBUA 5LEJA 3N4MA 1S0CA 1AF9A 4B3NA 3I3DA 3BUCA 4E4DX 4L92A 5CADA 4LK7A 1V6KA 2VY0A 3ASIA 5IVEA 5FO7B 3POGA 5KC6A 5FYHA 2BNOA 1AX1A 3S57A 2PXJA 1RJ8A 2WS92 1IZ3A 1OH4A 1VBA1 5FZBA 1ND2A 3F95A 4CP1A 3ZR6A 1S2EA 3IIIA 4XF3A 3JB8A 4MGIE 1J1TA 3I2FA 4RS5A 1ZBA1 2R30A 1R093 3UJQA 1F15A 3O0VA 1J1LA 3A21A 4Q0PA 4XFIA 1UZZA 5CG8A 1GKBA 1AJKA 3WX5A 1GP4A 2WAOA 1I3HA 2CNAA 2AC1A 2GSYA 3J8F2 4Q4X2 1Y9MA 4FP3A 4AF9A 5ISLA 2BBVA 4XIKA 3ACGA 5I8TA 4LBKA 1RUF1 2UWBA 4JHTA 4MGZE 4P9WA 1OUXA 1WMXA 1UPSA 2WBKA 3ZXJA 3ES1A 1K45A 1W6OB 1URXA 3MV11 4QKDA 3LAGA 2VUDA 2UWCA 2WZR3 3LWCA 4K3UA 4ARXA 1BEV2 4XCBA 1TZOA 1UYXA 4PLOA 4Q5OA 1ENXA 2MEV1 1GOFA 3T0AA 4WM7C 1W0OA 4ET7A 2PLV1 3AK0A 3KV9A 5I8SA 1ZBE2 3OYWA 1ULOA 3I3EA 4N9HA 5JI9A 4J1WA 1A78A 4NRPA 1QQP1 4JQRA 4RGKA 2XHNA 1H6XA 3WZ1A 3VDCA 1W9SA 2YPDA 2BWCA 3TAYA 4R9BA 4A3XA 4CDQB 2JDAA 2VD7A 5A3PA 4JKLA 2EAAA 4MLOA 2CWMA 1ASJ3 1TMF1 1XRUA 4A7KA 1WW7A 5FP3A 4B4QA 1LECA 4N53B 5IK5A 4IV3C 1QWRA 1GZ9A 1OA3A 1TME1 2NQYA 4BK4A 4TN7A 1RB8G 3WNKA 5GZEA 4IGQA 4N9IA 1B35C 4DINB 1IPJA 2DV9A 5FYTA 4META 4IV3A 1NT0A 5JAXA 3BB6A 3TN91 1NOVA 1QEXA 2WNVB 2H6CA 3WF4A 5LATA 5A3TA 5LWBA 5KWRA 5FJKA 4LHKA 2VBDA 4QKNA 5FY0A 5JXJA 1B35A 2VTXJ 1NCQB 4D94A 3KD4A 4ISQA 1OA2A 4ZKTB 5IVBA 5K0UC 3U75A 4F7ZA 4GKXA 1K5JA 2E32A 4FPEA 4D6RA 1AYN1 5CBLA 3ZM8A 5CU1A 2Z79A 2RV9A 3H3UA 3LIHA 1LTEA 3FUQA 2C1FA 3IN9A 3LIGA 3PVNA 2VMCA 1S0DA 2WN2A 5DAQA 4LKEA 4OYUA 5K0UA 4JZRA 2H6BA 4LQRA 5JIUA 2DBIA 3AMHA 4XACA 4UF0B 5E88A 4YGDA 3MDPA 2ENRA 4Q27A 5K9YA 2VXJA 3WLUA 2CGOA 3IAPA 5A7NA 1WCSA 3AZVA 3FFQA 4HK9A 1WLCA 4Y1ZA 4JGYB 2B5HA 2ZGSA 2LW8A 5DMYA 2PAKA 1QU0A 1W99A 1XE8A 2XXZA 5FY9A 2JDPA 4Y1XA 1QOOA 3BALA 4O61A 3USUB 1FPN3 1S4CA 4IEQA 4LE3A 3W20A 4URAA 2PHWA 4Z2WA 1ZRIA 1WA6X 1QJY1 2W1SA 1I5PA 2BNNA 2GALA 1R082 5C8CC 1KRIA 3RWKX 4BQ5A 1LB2A 4WVMA 3PJYA 5L19A 1MS4A 2AREA 3ZKUA 5DG1A 5C4WB 1AR73 4CDWB 3BIWE 2V09A 1EV13 1WZXA 3B9CA 3ZYHA 1HB1A 2C26A 3NWKA 1DLCA 4QXBA 4AEDB 5FLJA 3KV5A 2VUCA 1QH7A 3DGTA 5JXGA 2RS53 2ZEYA 3QCWA 4ATEA 2WQZC 5D21A 1LHWA 1MS9A 3FHIB 3I59A 4HG6B 3OUHA 5FZ6A 1KDMA 3FBYA 3WD5A 1N1SA 4N7IA 4YG0A 2ARAA 3NV2A 1RJ7A 3NNFA 4R8HA 4A44A 2ZGMA 4AAPA 1O4YA 2G19A 4DOUA 1XE0A 1JXNA 2WWJA 1IQAA 1ZX5A 2RG4A 4PIXA 1HXS3 2GN7A 4LULA 2ZX0A 1RVF3 4DUWA 5IVJA 4MG2A 4AGGA 5FPUA 2NP0A 1JOJA 2WA3A 5FXXA 3T0BA 4FPKA 2ZHMA 1J58A 1QDOA 1QJFA 2OXBA 2E9QA 2Q1MA 4LBNA 1YYNA 4QPIB 2AUYA 1SLTA 1CWPA 3CJIC 3RZGA 4FFFA 5FZ4A 1W8TA 3HAGA 4R4XA 4EQVA 2A71A 3H7YA 3ZFEC 1NAEA 1YWKA 3FC0A 2ES3A 4MGKE 5FP4A 2BFUS 5C8WA 1AX2A 2YDEA 3ITQA 1D4M3 1RL3A 2R0HA 5FZ1A 3CJIA 2VQ0A 3KT4A 1W06A 1H2MA 3UESA 5CNAA 3RMXA 4BYYA 3EYPA 3ZFEA 4A41A 4PDWC 2R49A 2P5BA 3WSOA 1QXPA 4CEYC 1JU3A 1W05A 1W6MA 5D2AA 3BI3A 3RZHA 2E26A 1QY4A 2JG8C 3MF9A 4Q4V2 4YVWB 1G7YA 2RMU2 2WS91 2R071 1UYZA 3DPRC 1NG0A 5JXHA 4CU8A 4WZCA 5KC5A 4Y33A 1C4RA 2BNMA 1VAVA 2VAUA 4QKFA 2JD9A 4DB5A 1PX4A 2JG8A 4PBOA 1MQTB 2X5IB 5FZFA 3WNNA 1IQDC 5CFCB 5JMOA 4XAEA 3DPRA 2PHUA 1UNBA 1PIV3 4Q4X1 3J8F1 2DVAA 3OBRA 4FXGB 1IG0A 4AQ2A 4BQYA 3O1PA 5G04L 1VBC2 1ULFA 1YXWA 4XZUG 5M0TA 3T3YA 3OTFA 1OLME 1WMDA 3VBFB 4XFCA 3T30A 3VZMA 4XJUA 4IE4A 1TEIA 1RUC2 2EXHA 5FYCA 4JRAA 5FPXA 2I2SA 5CAZA 1VBA3 2BRTA 4PT6A 5IVFA 2W1UA 4X8PA 3SKJE 2GMEA 1XC6A 5FKBA 1TQ5A 3P3NA 1UIJA 3HBKA 4LBQD 1J3QA 3VBSC 1H1IA 2P1BA 3UKNA 5IK4A 2ZHNA 4UW3A 3T0DA 3VBHC 1JHJA 3GCWA 4EN9B 1QOTA 2IXHA 1VMJA 3OPTA 1NQDA 4Z82A 3L9JT 5FPLA 3VBRB 2WLQA 3IIAA 1MACA 1EUUA 4AQTA 2HWF2 1UU5A 1YCIA 5K4LA 2FZ1A 2PHXA 2FD8A 4R9DA 3NKGA 1GWMA 3O7OA 3GJBA 2MEV3 3IAQA 2ZOEB 5I93A 5LEKA 2PLV3 5F1RA 3NW4A 3QD6A 1W6OA 4QU1A 4PLMA 1WLWA 5KR7A 1YO8A 1LAJA 1HRI3 4Q0SA 4QQ2A 1N1TA 3MYXA 3PMEA 3IMNA 2O8OA 3CO2A 3U14A 1XBFA 4C1XA 1QQP3 1AR62 3MZHA 1PO22 2RS31 4JHZA 1BQPA 5CEHA 3DUIA 4XJWA 1N3PA 3LCPA 2D6LX 1YQ6A 2C9KA 1KXGA 1XNCA 1OI6A 2YY1A 3DYOA 4V2WA 2B9UA 4TXWA 3FN9A 4FBFA 1H2NA 4NRMA 4FCAA 1TMF3 4MYEA 3WQ1A 4YM2A 1AUYA 1SBDA 1PK6C 2XGXA 3GALA 3T2TA 1VALA 3LSDA 5HCFA 2VZOA 2OYZA 4QM9A 1O8SA 2BOIA 3DXTA 3DCQA 4HBNA 3U4SA 3FMGA 4KBBA 4MO3M 4AL9A 4A7ZA 5BUVA 5KBFA 3MW2A 1JU4A 2AACA 4AVAA 4FOWA 1GSLA 2DBNA 3CHXA 1US3A 1V6LA 2C6SA 4N53A 4OZOA 5L9RA 2D3SA 3ETQA 2QQNA 4XF4A 3AP6A 1CJPA 3H3ZA 4L99A 2VQAA 1ZZ8A 1ENSA 2BEOA 3FL7A 2JICA 5EIYB 5DG2A 4AGRA 3HNBM 3ACFA 1YQ8A 3LPGA 5IFPA 3JBG3 1I9RA 4UYBA 2F4PA 1AYN3 5C3SA 5JZGC 2ORZA 2W47A 1GOHA 4XILA 3WF2A 4LTAA 4OHWA 4BXSV 2A6VA 1JZ2A 4COVA 4KQ7A 1NY72 2OZ6A 2XBO2 3A0NA 3KF5A 5F3GA 3VL9A 4HKWA 3LZZA 4W6XA 2A70A 5T55A 1UZWA 2XKPA 4AVBA 3ZSEA 4QQLA 1L7QA 5F5AA 4M0HA 2JIJA 1AYM1 3ELNA 1XSRA 3POSA 5JSOA 1QF3A 5KXBA 1C3HA 4YGCA 4QKBA 3VL8A 1UXXX 5A7QA 1J84A 3W9AA 1UOGA 3UT0A 4E2SA 3SQOA 4D8MA 2D40A 4MXVA 1W03A 2D97A 1HKDA 3ZN6B 3K3NA 2DCYA 1NLRA 3N7JA 3ZXGA 4K6BA 3C7OA 1G86A 5T5PA 4DUVA 1GNZA 4OHYA 3WP3A 1GUIA 4FPJA 5FK8A 2BP6A 1EPWA 2R0FA 2PHLA 4BU2A 2CYFA 5FY8A 4P9YA 3K48A 3AZXA 2KM2A 3WG1A 5C6CA 1TNFA 2VZ3A 3DECA 4XCAA 2D5FA 3M3CA 3TNPB 5DDJ1 1AR92 1PMJX 1KQRA 3N9QA 1OMIA 4KGQA 1V0AA 1A34A 3BTYA 3J7MA 3N9NA 3GHMA 1WMFA 1NX9A 3NQHA 3LDBA 3ZYPA 2F17A 3W58A 4YFWA 3MBWA 4IESA 1UY3A 4AEDA 1UMIA 2Y0IA 1HV0A 2W1WA 1CAXA 4QX7A 2VJXA 4COYA 5FKCA 1Q8SA 2YC4A 4PBPA 4AYUA 2ZZJA 1OXCA 2PAEA 4XUPA 1UKRA 1UW8A 4HLTA 2RJ2A 4MX3A 3ZSMA 1OKQA 4IEZA 3O1TA 4QXHA 1MZ5A 4RR3B 2W3JA 3KGLA 3ZYRA 4YSFA 3WF1A 2WFF3 4EROA 2XLFA 3EQEA 4F8AA 2FMYA 1MVQA 4QT6A 4XHBA 3VZNA 5CISA 4YM0A 5LB6A 4UXAA 4XC9A 4S2GA 1OFSA 2XLGA 5ABJB 2XOMA 1UY4A 4XJAA 3LFIA 5CFDB 3AYAA 1FV3A 3O0XA 2CGPA 1YQCA 2DCZA 2ZKNA 1FOD1 2JDYA 1PO12 3OBAA 3LKJA 4H2AA 4HVQA 2K0GA 5DUXA 2YBPA 2Z4FA 1R64A 3POBA 1VBE2 1QXJA 3I54A 2AENA 1GOGA 2B45X 1QJU1 2IWGB 3URFA 1JUIA 1YEWA 4D3WA 1C8M2 1ZREA 1MZ6A 4DIQA 1SPPA 3AKSA 1ND2B 2QQKA 1ZA7A 3JD72 5DUVA 1RUC1 3WDVA 5A6YA 5IVYA 5IVCA 1R1A2 2VMHA 2WS93 3R4DB 1GQHA 4AEJA 2EIGA 1QGLA 5FXZA 4BOWA 3T09A 2F6BA 3VHOA 3KCXA 3R4SA 5T3NA 1VB2A 5KHIA 3OSDA 5L9VA 2K2SA 2ZA9A 4M4PA 3D0SA 4QXCA 1GZTA 1UYYA 3I97A 4Q4X3 2YHJA 3J8F3 5L73A 4KG8A 4FOYA 5GALA 4AFBA 4OQ9A 2VNOA 3POWA 2JECA 4JC1A 4LOTA 2HWC1 1HV1A 4C8DA 4NPLA 2X5IA 1VPHA 4JVAA 2G9GA 2HWF1 3TYJA 3THPA 4XUOA 1CIWA 1OLQA 4LLFA 1BEV3 4OCTA 5IW0A 2JX9A 3OYWB 3H1MA 4UW6A 3M70A 3H1YA 4J1XA 5FREA 1SLBA 1NZIA 3VD4A 1MZEA 4KI5M 4WM7B 3Q8FA 1ZBE3 2D6PA 1IS4A 4LXLA 1GZWA 4OZXA 3S7EA 1ZBA2 5F3EA 4AFCA 3CF6E 1PO21 2D6NA 4JTOA 4L9BA 4QPYA 2D5HA 2HLEA 4FQ4A 4QX1A 1U5YA 4L11A 2YU2A 5F5CA 4ATFA 1RUF2 1FNZA 5FIXA 3O12A 2XUEA 5C5TA 1N1YA 3HMYA 2P3IA 4ES8A 1ZRRA 2ID4A 4YZ5A 4R4ZA 3KSCA 3OGSA 4YW2A 4KWKA 4IXLA 4QDRA 2NMOA 4WBBA 2ZGPA 3USSA 2VOWA 2CDPA 1PGSA 1ZM1A 3OPWA 3POIA 1Q5OA 2WIIB 3E5XA 4G3YC 4IV3B 4O7XA 4BQ3A 3DL3A 3AMQA 2ZXQA 4Y5TA 4XDPA 2BV4A 3ZN4A 1W9YA 5FYYA 3QH6A 1B35B 2QCSB 5BXXA 5FWEA 1HRV3 1REFA 1Z78A 1H2KA 1RUD2 5C70A 5F3CA 2RR12 4FTBA 2Y60A 2Y6GA 4I0BA 2A6XA 1JYCA 2J1VA 2W94A 3C3VA 3VDDC 4CRQA 1SHWB 4NAMA 1H0BA 1ZZ6A 4NJ4A 2A7AA 1AHSA 1H8TC 5K0UB 1XNDA 4QPGC 4W50A 2ZGTA 4JQTA 3V56A 3G7DA 1JOBA 4WV8A 5F8PA 2DVFA 4LNVA 3WT3A 1TME2 1UIKA 1MS5A 4GZ9A 4EN8B 2BOJA 4XMAA 5BNPC 1H8TA 1CPNA 4XQDA 5FZ9A 4QPGA 2QKDA 4IEVA 3VBOC 3WW1A 2C24A 2JE8A 3ZIWA 2OPKA 1DIWA 4MOAA 3RWNA 1BMV2 2OQ6A 1RUI1 5FDBA 5FWJA 4NRQA 1EY2A 3PNAA 3TN92 4JAAA 5LZ6A 1SQ4A 4RSUA 1OLMA 5BNPA 3VKFC 3WW3A 2PQSA 4RN5A 4WVMB 4CXYA 3VBOA 3WDUA 2BUKA 1QJX1 5AFBA 2VVFA 1A8DA 2W0XA 2X29A 4B1MA 4Z8BA 2YBSA 4ZU7A 1R083 2XH6A 4GMP3 3ZLIA 3VHPA 5C8CB 4EN6B 1UMZA 1UX6A 3DV8A 1OHFA 1CESA 5BNNC 3I2KA 3UV9A 4CU9A 4QX8A 3AYEA 3ST7A 5A3NA 4LBQB 1LOBA 3I59B 5FJHA 1Q43A 4XYXA 5CKQA 3WW4A 1QKQA 4EJRA 4YVSC 3OGJA 5IAVA 4FPFA 3IMMA 5BNNA 4Q29A 2VQUA 1CX1A 3PU3A 3DKWA 5KHHA 4M0NA 1MS0A 1F4AA 5A6ZA 1SCRA 2WWUA 3OJBA 4E8CA 1HN0A 1QJY2 3F2ZA 4KL1A 4AGVA 2I45A 3S30A 5B4NA 5A1FA 5KXDA 4LKSA 3UKVA 5IHRA 1DQ5A 1STMA 1D0HA 1GMMA 4AI3A 1MS8A 4NOTA 5FFOC 5JOYA 2PHTA 1RGSA 2KXLA 5LASA 3NNJA 3TB0A 3ZKYA 2XJTA 5FMOL 1CZVA 3GXUA 2Q1FA 4HN0A 4YGEA 3S7IA 2WNOA 4AVVA 4TTGA 1DDLA 3J7HA 2JJ6A 3CJIB 4Q4Y2 2IXKA 4D69A 1UXZA 1VRH1 1XB9A 3ZFEB 1W6MB 1Y7BA 2WL1A 3T4HB 1LEDA 4S2FA 1QH6A 4P00B 2Q8OA 4IGOA 2G9ZA 4K8RB 4LBMA 2Y8KA 2DUPA 1RUH1 1JZ8A 5FMCA 3B94A 3JQWA 4CEYB 4OUEA 4PDWB 4Q4V3 4XOGA 5G05L 4B7EA 5FO8B 2GH2A 1R1A1 2RMU3 5F32A 3VD5A 2JG8B 2FMDA 4LK6A 5HCHA 3DPRB 3C7GA 3E5QA 3K77A 2FCUA 4QHZA 3IPVB 1V6IA 2RE9A 2I07B 5FMDA 2BGPA 3P1IA 4N90A 1FYUA 2VH9A 1O3SA 1DHKB 1S0EA 4LO6B 4AVTA 3K4DA 3LEGA 1O5LA 5LBBA 2SBAA 2F4LA 3RJ2X 4GH4A 5CFDA 3AJYA 3PDQA 4XETA 1VBC3 1O4TA 4FSJA 2GZWA 1W6QA 4OUSA 3AKPA 3BVCA 4C90A 2J1EA 3DF0A 2FQPA 1IS3A 3FLRA 1UWWA 3AX4A 3KGZA 4O65A 3PUIA 5FP9A 2Z69A 1RUC3 1UZ0A 1LRHA 4HKOA 1ZYBA 4DEVA 4DNYA 1H6YA 1H30A 3HQUA 1JYVA 4FQZA 2R072 2Q1ZB 1WD3A 1AR81 1ALYA 4RD7A 1ULPA 3FUOA 3GZAA 2J1RA 3M4FA 3AMMA 5DUUA 4GWMA 1DGRN 5C3PA 1SG3A 2JDKA 1CAWA 2GP5A 3MLJA 2ZABA 4MGTA 2J22A 4MSVA 1V6MA 1W9TA 1LODA 4JRLA 2ZGRA 1VBB1 3KM5A 4KG0A 1YLLA 3C7HA 4HVRA 3C7EA 4KWJA 3O1UA 3PU8A 3VBHB 3PUSA 1POQA 4D7TA 3LA2A 4ASKA 1PGL1 2EXKA 2JDHA 1PNFA 1XNBA 4LITA 4AI9A 1E57A 1GANA 1YFWA 2Y0OA 3U37A 3VKNA 4CXXA 3H42B 4LKFA 2WQ8A 4L0PA 5LBCA 3UGHA 2CY6A 5F7UA 3NV1A 1J3PA 1KFXL 3EO6A 3N36A 3NMBA 1D4VB 2K46A 3M3IA 2OZJA 4K40A 4LIUA 3WNPA 3ZXLA 4AOCA 5GZGA 4NIAA 2ZMLA 4AEKA 3BU7A 4ITCA 3WY6A 2HWE1 2E7AA 1W9FA 4FOVA 4X6QB 1PO23 3GF6A 4OHVA 5HCBA 1RUD1 3RZJA 4YFZA 1VE0A 1W8UA 2RR11 3I7DA 4WM7A 4ZPIA 4CEWC 4Z1VA 3SITA 3N7LA 1VP6A 3D0JA 1N47A 4FPOB 3LSEA 5EYYA 2OX0A 4ZY9A 2Q8EA 4PJYA 5DAXA 3SMHA 4AQSA 4P9LA 1UCXA 2UYAA 5FO9B 4PLNA 1PK6B 2WYSA 2PAMA 1IOAA 2W9XA 2YC2A 1UX7A 2RDQA 4BDVB 1WCUA 1IGOA 2RJKA 4IEXA 3MHZA 1V9U1 2UU8A 3HT1A 2DYCA 3RPQA 1ZVFA 2XR4A 5FZ3A 1W2TA 1OVSA 1BMV1 4NHKA 1LNSA 5A7OA 2HWD2 5CYYA 1CD3G 2RS32 2WKKA 2Y33A 3FHAA 3O1RA 1H9PA 1CR7A 4RGGA 5ACA1 5A6QA 3FHQA 1DYOA 1KS4A 2B39A 3BYWA 4N43C 2YU1A 1Y4WA 4GJYA 3ACHA 3I2DA 3N35A 4B4PA 3CU7A 4IV1C 5JZGB 4OVEA 3TEYA 2XBO3 1HJGA 1UY0A 2DUOA 1KFUL 2VUAA 4BLIA 3CBNA 4DPNA 4BJ0A 1S0FA 1W8HA 2R061 1VLNA 2XJQA 3SISA 2BPA2 1PVXA 4N43A 4XVHA 5F6LB 5H9SA 1LCLA 1UAIA 4IV1A 2V5YA 2R32A 3OGVA 3Q8BA 3LF7A 4OMDA 1F35A 1ZA4A 2VMGA 3ZXKA 4AE2A 2ZGQA 4NN0A 4XHXA 4LO4B 2VL4A 2ZMNA 1DBNA 2QVSB 4XPVA 1BHGA 1GNHA 5JDBA 1NXD1 2DU1A 4QB1A 1OKOA 2RDRA 4FPYA 1NE6A 1WGPA 5I0TA 3VD9A 3H1WA 1VBD3 5FQ0B 4PHZA 4AR2A 2V5DA 2VW1A 2VECA 3VZOA 1NA1C 3MICA 1JTZX 1AR93 1DQ4A 1AYM2 3MIBA 5J37A 5C8CA 3AZZA 1CAXB 1W0PA 1A3KA 4MVTA 1F8VA 1ND3C 1I5ZA 3OBTA 2RS12 2H0BA 1O3QA 2VTXA 5LBFA 3ACLA 3ZDVA 4LBQA 4XUQA 2D43A 4YW1A 1NA1A 1D2QA 2C9AA 4QQOA 2XB6C 4Q4Y1 1YUDA 4QM8A 1LEMA 2DCJA 2YFZA 5CKNA 3CZUA 1YI9A 1FAYA 4XAAA 1RMU2 1ULGA 4HPKA 1F5FA 2CL2A 3QLQA 1UKGA 1UMHA 2TEPA 4XFAA 4XXPA 3HEIA 3TWIA 1JZ5A 4JKMA 3WNOA 2ZX3A 2E33A 2OUHA 4E27A 2XL9A 3PJQA 1RXFA 2EVXA 2NZ9A 4N8MA 5DDJ2 4AAXA 2JG9C 1Q8PA 2E31A 1WKYA 3I2IA 3OUJA 4FPLA 3RVHA 2XJRA 4XTMA 2YUEA 2BDRA 2A1XA 3RDIA 2ARXA 3WCSA 1W3VA 1LU1A 2X53S 1AVBA 2HEYF 2GNBA 5E89A 1PO13 5C71A 5FZCA 3MFAA 5JWPA 2CGNA 1SPPB 4MGSA 1LGNA 1VBE3 1MS1A 4HFSA 4KBZA 4JCKA 3SH4A 1JYIA 2RM21 4OI2A 1WUVA 1PMIA 5FY7A 3GGLA 3B02A 3I2HA 1C8M3 4DY3A 3SEPA 3FZ3A 4BPZA 3ZPYA 2QBXA 1JYTA 1FATA 1POV1 3JD73 3H0OA 2GH8A 5EV7A 1E5HA 5J09A 1DG6A 2FDHA 1R1A3 3AZYA 4IQPA 4ASMB 3E6DA 2XQRA 4K20A 2OVUA 2GU9A 4E2QA 2XJVA 4IDZA 1O91A 4LLOA 3DKQA 2VE1A 4DY5A 1X7NA 4CP0A 4CEYA 4PDWA 4BMEA 2XL7A 4AI1A 5F2SA 1FOD2 4A6OA 2OUJA 3HIFA 4EE2A 4Q4W1 4XEZA 3RZKA 2BERA 3IPVA 2ZKLA 4QGLA 1SMVA 4XF1A 4BXFA 4PIYA 1U5IA 1B09A 1QJU2 1X82A 2VVDA 2WQ4A 1ULEA 3PMSA 3IKWA 3BODA 2ADDA 5A33A 1VMHA 4WM8C 5FZ0A 2H0VA 5JSRA 1JZ4A 1ZRFA 1GZWB 4M3CE 5GLWA 2XQXA 4FXKB 4AHYA 4MADA 3QH7A 2CAVA 3E6CC 1QNWA 2AEZA 2WT0A 2WRAA 1XOYA 1LULA 3AKTA 1S1AA 2P34A 1YFUA 2K9ZA 4WM8A 3KS7A 4COZA 1ZBA3 2FDFA 5EYXA 1RHI2 3U78A 4A3ZA 1CONA 1Z7S2 3BPZA 5F3IA 2LALA 3WDXA 2A6YA 4Y22A 1A8MA 3LDKA 1RUF3 5GKAC 1GV9A 2HWC2 2PN5A 1LJ7A 3BOWA 3E6BA 2VOTA 5LK5A 3APBA 3VBSA 3MIGA 3BN6A 5T5LA 4MHUA 5J7MA 4K7JA 2AZ5A 4JV4A 4LMFA 1F2NA 4XBQA 3DEMA 2IUWA 3GDBA 3VBHA 2YG0A 3B7MA 1JN2P 5EXOA 1UZYA 1O8PA 3C7FA 3NJXA 4Z92B 4YW4A 4RGAA 4EZ4A 4Y3OA 4XE9A 5EJ3A 2W2IA 2QQIA 3NV4A 3RS6A 5KHJA 4V2VA 3PLQA 3I4IA 4C0BA 4H55A 4UFKA 3KT1A 1ACCA 2HWD1 1RUD3 4QAWA 4Y24A 2O0OA 2RR13 2QZ2A 2XHKA 4YG6A 2WAAA 5FXVA 5T5JA 2XJPA 2W39A 1CZSA 1YI7A 3NV3A 4V1PA 3DYMA 4PI2A 4IERA 2Y6KA 3D5OA 1DQ0A 3BPSA 4QWNA 2UY8A 1EPZA 3HVDA 3VDDB 4MXWA 1H8TB 3CNAA 4QPGB 1OOPC 2Y38A 2GNTA 1TME3 2EAKA 4XW3A 3M3OA 5DAWA 5T54A 4ZZ5A 5IK8A 1J59A 3KB5A 5DABA 1S0IA 5KXEA 1D7PM 4QHOA 4D0QA 5EQUA 1C8NA 1PK6A 5BNPB 3VDAA 1RTVA 3ACIA 2GMMA 5FYIA 1OOPA 2JE9A 3VBOB 4CDXC 3BKZA 4W4ZA 3TN93 4WZFA 5FY4A 1JOPA 5GZFA 3A0KA 4CZSA 5H9PA 4SBVA 2ZAAA 5JOZA 2RDSA 2WT2A 1IPKA 1W2NA 1GU3A 4NVPA 2Y6JA 2W68A 4ZZ8A 1XNTA 1RUE1 1T2XA 2PFWA 4ISRA 4BH9A 1PHMA 3WXPA 4CDXA 3PTYA 3VZJA 3MLKA 4FTSA 2B7YA 2XDVA 3AP9A 1FMD2 4AFMA 3R05A 1HB4A 4QX5A 2VZPA 5HI0A
chains in the Genus database with same CATH topology
2W92A 3WF3A 2VMDA 2ID4A 3CZJA 3ECQA 2W1QA 3OGSA 4CU7A 2EICA 2DCKA 4QDRA 5IYYA 3WNLA 3MO4A 2CDPA 2VCAA 3CDZB 3I3DA 2EIEA 2ZXQA 2VMFA 4GWIA 1OH4A 1CZTA 2VQTA 5C70A 4DXRA 3IIIA 4ARYA 4W8JA 3I2FA 2Y6GA 2W94A 2J1VA 3A21A 1SHWB 1GQPA 2WAOA 4W50A 1W9WA 2W87A 3E1F1 3ACGA 1W8NA 2BZDA 2WBKA 2ZEXA 4GZ9A 3VDBA 1K45A 3MV11 2ZEZA 3OEBA 4ARXA 3DYPA 4QX3A 3T0AA 1UYXA 2JE8A 1GOFA 4MOAA 2VZUA 4FI9A 4DXSA 4ET7A 2JKXA 3T2QA 2VZRA 2J1TA 1OF4A 1ULOA 2PQSA 3I3EA 4RN5A 2VZSA 2XHNA 1H6XA 2WO3A 1RYYA 2RVAA 3VDCA 1W9SA 3K4ZA 2JDAA 4JKLA 2VR4A 3W5NA 5JR2A 5DQ0A 4BK5A 2V4VA 3I2KA 4CU9A 4LHSA 3T08A 4AG4A 4BK4A 3WNKA 2VQUA 1CX1A 2VTFA 1JYWA 1F4AA 3WF4A 4E8CA 3GM8A 3IDAA 3F2ZA 5JXJA 2QQMA 3LEIA 4M4RA 3CQOA 5B4NA 1EUTA 4LKSA 2WN3A 5IHRA 2E32A 1GMMA 3D3AA 3ZM8A 3MUY1 4PF1A 2RV9A 3WQBA 2VMCA 2WN2A 3VD3A 4OYUA 1K12A 1CZVA 3GXUA 1O59A 4LQRA 5LA1A 4TTGA 2KD7A 3J7HA 2J1SA 3HNMA 3IAPA 5LA2A 1UXZA 3OB8A 3HJRA 1CIYA 2LW8A 5DMYA 1W99A 4P00B 2OKXA 1F4HA 2Y8KA 2W1SA 1JZ8A 1I5PA 4KWUA 3BGAA 4XUNA 1NUKA 4OUEA 5G05L 4JKKA 4KMQA 3VD5A 3NRUA 2WUHA 1JYNA 3C7GA 2LS6A 3K77A 2C26A 2ZEWA 1DLCA 4MGQA 2Y6HA 2BGPA 3P1IA 4QDSA 5JXGA 2EIBA 2ZEYA 3K4DA 3LEGA 3LEKA 5HXMA 4QX2A 3UNPA 2VZVA 1PMHX 4HG6B 3MUZ1 4QPWA 5IFTA 2J1EA 4A44A 4QB2A 3WNMA 1UWWA 1TVGA 2VCCA 3PUIA 3WF0A 1UZ0A 4DEVA 2J1UA 4DXTA 2XONA 1H6YA 1JYVA 4A42A 3IB3A 4DUWA 1ULPA 2J1RA 5LA0A 3T0BA 1US2A 1SG3A 2J22A 5A1AA 1W9TA 3JXSA 4P5YA 1MPXA 1KEXA 3C7HA 4P08A 3C7EA 2VC9A 4CU6A 3VD7A 1NAEA 3U37A 2L9LA 2WQ8A 4L0PA 3CMGA 3HN3A 3SEEA 4DEQA 5F7UA 3UESA 4UAPA 3EYPA 4A41A 3WSOA 3A7QA 3WNPA 1JU3A 3OG2A 2E26A 1UYZA 5JXHA 2VZTA 4RYDA 4CU8A 2X05A 1JZ6A 2Y6LA 2JD9A 1PX4A 3WNNA 1JYXA 2HYXA 4ZY9A 1IQDC 5LCWL 5JMOA 2BGOA 5G04L 2WYSA 3CKHA 4XZUG 2W9XA 2YC2A 1UX7A 3T2OA 4BDVB 1W0NA 5B4XA 1GNYA 3NJVA 1LNSA 3I2GA 4PT6A 2W95A 3C8XA 5JUVA 2W1UA 5CYYA 3SKJE 1XC6A 3FHAA 3LPFA 4IUGA 3ABZA 3FHQA 1DYOA 4UI9L 3OEAA 3THDA 3T0DA 1JHJA 3ACHA 4PQQA 1UY0A 3HPNA 1EUUA 5FUIA 4BJ0A 2ORXA 4XVHA 3PUHA 4OMDA 3IAQA 3OGVA 4ZXEA 2EIDA 2YFUA 3K4AA 3EB7A 2VL4A 1OF3A 3HNYM 5DPNA 1BHGA 4JHZA 3AC0A 2C9KA 4QB1A 3DYOA 3VD9A 4QB6A 4TXWA 3FN9A 2WO2A 1PX3A 1K3IA 2V5DA 2VZOA 3A22A 5EJ1B 1O8SA 2V72A 1XNAA 4MO3M 2B4KA 2W46A 5IJRA 3LQCA 1JU4A 1US3A 4XUQA 4OZOA 2QQOA 2QQNA 2DCJA 2YFZA 3FL7A 3CZUA 4OMCA 4CUCA 5EIYB 1OT5A 3HNBM 3ACFA 5IFPA 3LPGA 2VCBA 2QQJA 1UMHA 2ORZA 2W47A 2W5FA 1GOHA 3HEIA 3WF2A 4JKMA 1JZ5A 4QDQA 3WNOA 4BXSV 2E33A 1JZ2A 2R7EB 3A23A 4AAXA 3I2IA 2E31A 1WKYA 1W8OA 2Y64A 1L7QA 1JZ7A 3UETA 5C71A 4CUBA 1UXXX 1J84A 1KGYA 4JX0A 4MGSA 4LPLA 1XPWA 3CIHA 4D8MA 3P6BA 1OD3A 3OGRA 4A4AA 3GGLA 3I2HA 2VZQA 2QQLA 3SEPA 5HPOA 2QBXA 3C7OA 4DUVA 4Z2AA 2W91A 1GUIA 3K46A 1UY1A 2VZ3A 3DECA 4GWJA 3SKVA 1JZ3A 1PMJX 2J7MA 4A6OA 1NX9A 3NQHA 3I2JA 3MBWA 1UY3A 2BERA 1UMIA 2W1WA 2VJXA 2X09A 2YC4A 1WCQA 1NKGA 4XUPA 3I3BA 2RJ2A 1UY2A 1DP0A 1JZ4A 2XQXA 2W3JA 3WF1A 4MADA 2VO5A 1P8JA 3WEZA 2WDBA 2YB7A 3W5MA 4UOJA 4CVUA 2WABA 4YPJA 3LE0A 4A3ZA 2XOMA 3ETPA 1UY4A 3THCA 4XUTA 1YQ2A 2DDUA 1JI6A 3OBAA 2VOTA 2Z4FA 1R64A 3BN6A 1K42A 5EJZB 2VM9A 3GDBA 1GOGA 1HN1A 2YG0A 4P02B 1O8PA 3C7FA 3NJXA 2B9VA 2QQKA 2QQIA 4E8DA 2VZ1A 2WO1A 5JXIA 2WZEA 4QAWA 4XURA 3NNGA 2WZ8A 2WAAA 3MV01 3T09A 5J1XA 1CZSA 5C7GA 4M4PA 3DYMA 4QX0A 1UYYA 2Y6KA 3I97A 4DUXA 4A45A 4CUAA 3HOBA 2J1AA 1SDDB 4ZZ5A 1J83A 1L7RA 2BBAA 1D7PM 4XUOA 5DN2A 4D0QA 5I0DA 3VDAA 3ACIA 5CZKA 3VD4A 4W4ZA 4KI5M 3K75B 2VMEA 2X10A 1TG7A 2CDOA 1GU3A 4ZZ8A 2Y6JA 1XNTA 1T2XA 2HLEA 2C4XA 4QX1A 2VZPA 3T2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W92 A;  3WF3 A;  2VMD A;  2ID4 A;  3CZJ A;  3ECQ A;  2W1Q A;  3OGS A;  4CU7 A;  2EIC A;  2DCK A;  4QDR A;  5IYY A;  3WNL A;  3MO4 A;  2CDP A;  2VCA A;  3CDZ B;  3I3D A;  2EIE A;  2ZXQ A;  2VMF A;  4GWI A;  1OH4 A;  1CZT A;  2VQT A;  5C70 A;  4DXR A;  3III A;  4ARY A;  4W8J A;  3I2F A;  2Y6G A;  2W94 A;  2J1V A;  3A21 A;  1SHW B;  1GQP A;  2WAO A;  4W50 A;  1W9W A;  2W87 A;  3E1F 1;  3ACG A;  1W8N A;  2BZD A;  2WBK A;  2ZEX A;  4GZ9 A;  3VDB A;  1K45 A;  3MV1 1;  2ZEZ A;  3OEB A;  4ARX A;  3DYP A;  4QX3 A;  3T0A A;  1UYX A;  2JE8 A;  1GOF A;  4MOA A;  2VZU A;  4FI9 A;  4DXS A;  4ET7 A;  2JKX A;  3T2Q A;  2VZR A;  2J1T A;  1OF4 A;  1ULO A;  2PQS A;  3I3E A;  4RN5 A;  2VZS A;  2XHN A;  1H6X A;  2WO3 A;  1RYY A;  2RVA A;  3VDC A;  1W9S A;  3K4Z A;  2JDA A;  4JKL A;  2VR4 A;  3W5N A;  5JR2 A;  5DQ0 A;  4BK5 A;  2V4V A;  3I2K A;  4CU9 A;  4LHS A;  3T08 A;  4AG4 A;  4BK4 A;  3WNK A;  2VQU A;  1CX1 A;  2VTF A;  1JYW A;  1F4A A;  3WF4 A;  4E8C A;  3GM8 A;  3IDA A;  3F2Z A;  5JXJ A;  2QQM A;  3LEI A;  4M4R A;  3CQO A;  5B4N A;  1EUT A;  4LKS A;  2WN3 A;  5IHR A;  2E32 A;  1GMM A;  3D3A A;  3ZM8 A;  3MUY 1;  4PF1 A;  2RV9 A;  3WQB A;  2VMC A;  2WN2 A;  3VD3 A;  4OYU A;  1K12 A;  1CZV A;  3GXU A;  1O59 A;  4LQR A;  5LA1 A;  4TTG A;  2KD7 A;  3J7H A;  2J1S A;  3HNM A;  3IAP A;  5LA2 A;  1UXZ A;  3OB8 A;  3HJR A;  1CIY A;  2LW8 A;  5DMY A;  1W99 A;  4P00 B;  2OKX A;  1F4H A;  2Y8K A;  2W1S A;  1JZ8 A;  1I5P A;  4KWU A;  3BGA A;  4XUN A;  1NUK A;  4OUE A;  5G05 L;  4JKK A;  4KMQ A;  3VD5 A;  3NRU A;  2WUH A;  1JYN A;  3C7G A;  2LS6 A;  3K77 A;  2C26 A;  2ZEW A;  1DLC A;  4MGQ A;  2Y6H A;  2BGP A;  3P1I A;  4QDS A;  5JXG A;  2EIB A;  2ZEY A;  3K4D A;  3LEG A;  3LEK A;  5HXM A;  4QX2 A;  3UNP A;  2VZV A;  1PMH X;  4HG6 B;  3MUZ 1;  4QPW A;  5IFT A;  2J1E A;  4A44 A;  4QB2 A;  3WNM A;  1UWW A;  1TVG A;  2VCC A;  3PUI A;  3WF0 A;  1UZ0 A;  4DEV A;  2J1U A;  4DXT A;  2XON A;  1H6Y A;  1JYV A;  4A42 A;  3IB3 A;  4DUW A;  1ULP A;  2J1R A;  5LA0 A;  3T0B A;  1US2 A;  1SG3 A;  2J22 A;  5A1A A;  1W9T A;  3JXS A;  4P5Y A;  1MPX A;  1KEX A;  3C7H A;  4P08 A;  3C7E A;  2VC9 A;  4CU6 A;  3VD7 A;  1NAE A;  3U37 A;  2L9L A;  2WQ8 A;  4L0P A;  3CMG A;  3HN3 A;  3SEE A;  4DEQ A;  5F7U A;  3UES A;  4UAP A;  3EYP A;  4A41 A;  3WSO A;  3A7Q A;  3WNP A;  1JU3 A;  3OG2 A;  2E26 A;  1UYZ A;  5JXH A;  2VZT A;  4RYD A;  4CU8 A;  2X05 A;  1JZ6 A;  2Y6L A;  2JD9 A;  1PX4 A;  3WNN A;  1JYX A;  2HYX A;  4ZY9 A;  1IQD C;  5LCW L;  5JMO A;  2BGO A;  5G04 L;  2WYS A;  3CKH A;  4XZU G;  2W9X A;  2YC2 A;  1UX7 A;  3T2O A;  4BDV B;  1W0N A;  5B4X A;  1GNY A;  3NJV A;  1LNS A;  3I2G A;  4PT6 A;  2W95 A;  3C8X A;  5JUV A;  2W1U A;  5CYY A;  3SKJ E;  1XC6 A;  3FHA A;  3LPF A;  4IUG A;  3ABZ A;  3FHQ A;  1DYO A;  4UI9 L;  3OEA A;  3THD A;  3T0D A;  1JHJ A;  3ACH A;  4PQQ A;  1UY0 A;  3HPN A;  1EUU A;  5FUI A;  4BJ0 A;  2ORX A;  4XVH A;  3PUH A;  4OMD A;  3IAQ A;  3OGV A;  4ZXE A;  2EID A;  2YFU A;  3K4A A;  3EB7 A;  2VL4 A;  1OF3 A;  3HNY M;  5DPN A;  1BHG A;  4JHZ A;  3AC0 A;  2C9K A;  4QB1 A;  3DYO A;  3VD9 A;  4QB6 A;  4TXW A;  3FN9 A;  2WO2 A;  1PX3 A;  1K3I A;  2V5D A;  2VZO A;  3A22 A;  5EJ1 B;  1O8S A;  2V72 A;  1XNA A;  4MO3 M;  2B4K A;  2W46 A;  5IJR A;  3LQC A;  1JU4 A;  1US3 A;  4XUQ A;  4OZO A;  2QQO A;  2QQN A;  2DCJ A;  2YFZ A;  3FL7 A;  3CZU A;  4OMC A;  4CUC A;  5EIY B;  1OT5 A;  3HNB M;  3ACF A;  5IFP A;  3LPG A;  2VCB A;  2QQJ A;  1UMH A;  2ORZ A;  2W47 A;  2W5F A;  1GOH A;  3HEI A;  3WF2 A;  4JKM A;  1JZ5 A;  4QDQ A;  3WNO A;  4BXS V;  2E33 A;  1JZ2 A;  2R7E B;  3A23 A;  4AAX A;  3I2I A;  2E31 A;  1WKY A;  1W8O A;  2Y64 A;  1L7Q A;  1JZ7 A;  3UET A;  5C71 A;  4CUB A;  1UXX X;  1J84 A;  1KGY A;  4JX0 A;  4MGS A;  4LPL A;  1XPW A;  3CIH A;  4D8M A;  3P6B A;  1OD3 A;  3OGR A;  4A4A A;  3GGL A;  3I2H A;  2VZQ A;  2QQL A;  3SEP A;  5HPO A;  2QBX A;  3C7O A;  4DUV A;  4Z2A A;  2W91 A;  1GUI A;  3K46 A;  1UY1 A;  2VZ3 A;  3DEC A;  4GWJ A;  3SKV A;  1JZ3 A;  1PMJ X;  2J7M A;  4A6O A;  1NX9 A;  3NQH A;  3I2J A;  3MBW A;  1UY3 A;  2BER A;  1UMI A;  2W1W A;  2VJX A;  2X09 A;  2YC4 A;  1WCQ A;  1NKG A;  4XUP A;  3I3B A;  2RJ2 A;  1UY2 A;  1DP0 A;  1JZ4 A;  2XQX A;  2W3J A;  3WF1 A;  4MAD A;  2VO5 A;  1P8J A;  3WEZ A;  2WDB A;  2YB7 A;  3W5M A;  4UOJ A;  4CVU A;  2WAB A;  4YPJ A;  3LE0 A;  4A3Z A;  2XOM A;  3ETP A;  1UY4 A;  3THC A;  4XUT A;  1YQ2 A;  2DDU A;  1JI6 A;  3OBA A;  2VOT A;  2Z4F A;  1R64 A;  3BN6 A;  1K42 A;  5EJZ B;  2VM9 A;  3GDB A;  1GOG A;  1HN1 A;  2YG0 A;  4P02 B;  1O8P A;  3C7F A;  3NJX A;  2B9V A;  2QQK A;  2QQI A;  4E8D A;  2VZ1 A;  2WO1 A;  5JXI A;  2WZE A;  4QAW A;  4XUR A;  3NNG A;  2WZ8 A;  2WAA A;  3MV0 1;  3T09 A;  5J1X A;  1CZS A;  5C7G A;  4M4P A;  3DYM A;  4QX0 A;  1UYY A;  2Y6K A;  3I97 A;  4DUX A;  4A45 A;  4CUA A;  3HOB A;  2J1A A;  1SDD B;  4ZZ5 A;  1J83 A;  1L7R A;  2BBA A;  1D7P M;  4XUO A;  5DN2 A;  4D0Q A;  5I0D A;  3VDA A;  3ACI A;  5CZK A;  3VD4 A;  4W4Z A;  4KI5 M;  3K75 B;  2VME A;  2X10 A;  1TG7 A;  2CDO A;  1GU3 A;  4ZZ8 A;  2Y6J A;  1XNT A;  1T2X A;  2HLE A;  2C4X A;  4QX1 A;  2VZP A;  3T2P A; 
#chains in the Genus database with same CATH topology
 2W92 A;  2XVK A;  3VHR A;  2ZAH A;  2Z2S B;  1UYP A;  2DUR A;  4RHV 2;  3CZJ A;  1H4G A;  4GWN A;  3ECQ A;  3NO8 A;  1DYK A;  2YYO A;  4UWD A;  5BNN B;  5JZG A;  2EIC A;  3EMR A;  1VJ2 A;  2D6M A;  3ZYG A;  4Y1U A;  1HLC A;  2GDF A;  4LOS A;  1UD1 A;  4YG3 A;  2RS1 1;  2IVI B;  3H8X A;  1RUI 2;  3MPB A;  2EIE A;  2QQU A;  3NL1 A;  2VMF A;  4GWI A;  2ZGN A;  1K5M C;  5TSW A;  5DXD A;  1W2U A;  1IS6 A;  1CZT A;  1OA4 A;  3IBM A;  2WO7 A;  4UW5 A;  1QJX 2;  1CQ9 A;  1QJY 3;  4HT1 T;  4LBO A;  4ARY A;  4W8J A;  4P9G A;  2HBU A;  1ODM A;  3SCF A;  4HAN A;  1RMU 1;  3J7N A;  5I0R A;  2XPJ A;  1G9C A;  1AR6 1;  1K5M A;  2A6Z A;  2GC3 A;  1MEC 2;  2Q8C A;  2W87 A;  1COV 1;  1OQ1 A;  2NM1 A;  4KGG A;  5DAP A;  1W8N A;  1Q8O A;  2ZEX A;  5FQ0 A;  1DZR A;  4AXO A;  3VDB A;  1HB3 A;  4P14 A;  2ZEZ A;  1LOE A;  3RI8 A;  4R9C A;  3AVR A;  1GYK A;  1N1V A;  2O1Q A;  3OEB A;  3DYP A;  1Q56 A;  5JR7 B;  3V65 A;  4Q4Y 3;  4DQA A;  1LHN A;  2VZU A;  4FI9 A;  3VKL A;  3VHN A;  2VGD A;  2PMW B;  1O5U A;  1Z0H A;  2VZR A;  2J1T A;  5KXC A;  5FZI A;  5F5Q A;  4NAO A;  5AC9 1;  2O8Q A;  2VZS A;  3VZL A;  1AZD A;  3B00 A;  2WO3 A;  3M7A A;  2RVA A;  3ZIX A;  1CAU A;  5A70 A;  2CU5 A;  2P6H A;  3OOX A;  2VR4 A;  4FTE A;  1NLQ A;  1AXZ A;  4GB3 1;  3U07 A;  1SBE A;  4YW5 A;  4LUM A;  2V4V A;  1EAH 1;  1RUJ 2;  4GH4 B;  3T08 A;  1Y43 B;  1YC6 1;  3WR0 A;  2P2K A;  1W6Q B;  3BU0 A;  1BVP 1;  3WQ7 A;  3HBZ A;  1JMU B;  2IXJ A;  4DRV A;  1VRH 2;  3M1H A;  1V6N A;  2C0Z A;  4YNI A;  3R0R A;  1DGW A;  3HWJ A;  2EAL A;  3ILN A;  3OPZ A;  2C5D A;  3D6E A;  1UL9 A;  4W65 A;  2W08 A;  1T6G C;  4Y4R A;  1POV 3;  2YC0 A;  1RUH 2;  1GZC A;  1W6N A;  1GIC A;  3CJX A;  3LEI A;  4LBJ A;  2WA4 A;  3CQO A;  4Y5S A;  1W2O A;  1EUT A;  3B3Q E;  2WN3 A;  1CAW B;  2R07 3;  1H1M A;  1FV2 A;  2CTV A;  4XTP A;  1XQN A;  4CYD A;  4CP2 A;  3HT2 A;  4OUM A;  3D3A A;  2B8M A;  3JUU A;  2A75 A;  1MVE A;  1OH3 A;  2P3K A;  3JQX A;  2BQP A;  2VVE A;  4IEP A;  4NPR A;  1CX4 A;  1RHI 1;  1K12 A;  2JB8 A;  4IE0 A;  1Z7S 1;  2PHF A;  2NYY A;  3WVJ A;  1HQN A;  1ZZ9 A;  5T50 A;  4XFH A;  1AL2 2;  4MGY E;  1PZ7 A;  1YIF A;  5IK7 A;  3I49 A;  2KD7 A;  2A3X A;  4WVZ A;  4XQW A;  4GKY A;  4XJZ A;  1XE7 A;  1YHF A;  1YJL A;  2E63 A;  4YVW C;  2PYT A;  3HJR A;  4CCE A;  1CVN A;  2QTW B;  3NNL A;  5CA6 A;  4I2O A;  4KH9 A;  3FBM A;  4Q26 A;  2JXA A;  2Y26 A;  1F4H A;  2HJI A;  1BK1 A;  1YIP A;  2Q8D A;  4CDU C;  1AR8 2;  1MQT C;  4KWU A;  3B01 A;  3BGA A;  4XUN A;  3ZPO A;  1NUK A;  2VW0 A;  5L7O C;  3OY8 A;  2PHR A;  5JLV A;  1AX0 A;  1ONA A;  3LOB A;  1BVV A;  1VBB 2;  2LS6 A;  2DFC A;  2ZEW A;  4MGQ A;  2JDZ A;  5FZM A;  2Y6H A;  5I0U A;  2QJV A;  4GJZ A;  4QDS A;  4XBN A;  4CEW B;  2XKO A;  2BYV E;  3P3P A;  1PGL 2;  2SLI A;  5HXM A;  2TBV A;  3ZMN A;  2VZV A;  3UNP A;  2WZR 1;  5LRS A;  3I2O A;  1PMH X;  4U2A A;  4YW7 A;  1OD5 A;  3ATG A;  3AP5 A;  4QXK A;  1WCD J;  5IFT A;  4QPW A;  3LEM A;  1OC1 A;  3OBZ A;  1SFY A;  5F6K A;  3ZSJ A;  3AYD A;  5T5O A;  3WNM A;  4OQ8 A;  2O14 A;  5EFU A;  2VCC A;  5IAX A;  1RC6 A;  1VAK A;  1LR5 A;  3AM2 A;  3PVB B;  4GD4 A;  2J1U A;  4P9X A;  3RJR A;  1GLH A;  1N3Q A;  1ODN A;  4UFJ A;  1IG3 A;  3KF3 A;  4DXT A;  1BYH A;  2HWE 2;  3ZFF C;  4I3P A;  2HWD 3;  1NLS A;  2RS3 3;  3IB3 A;  3RG0 A;  5A3O A;  3WDT A;  4AI0 A;  3OGG A;  4QU2 A;  5CB7 A;  1QNY A;  4NID A;  2Q5T A;  1US2 A;  2N7G A;  1HX6 A;  1ASJ 1;  4LA3 A;  5IAT A;  4JDM A;  4JGZ C;  5LK7 B;  5BYN A;  5A1A A;  3HQX A;  5D8A C;  2VOK A;  3VLB B;  1BKZ A;  1WLD A;  4P08 A;  1HW5 A;  2VMI A;  4N43 B;  1SAC A;  1GR3 A;  1W6P A;  5C3Q A;  1FMD 1;  1V6J A;  1ZRD A;  2UYB A;  4IV1 B;  3JZV A;  1S0J A;  2VUL A;  2WNU C;  3VDD A;  5GLT A;  4RHV 1;  2UUR A;  1E5S A;  1GWL A;  2L9L A;  4EYU A;  1GBG A;  1V9U 2;  4HON A;  5JOW A;  1GP6 A;  4ZU5 A;  2ZPX A;  1W8W A;  4IET A;  4IE7 A;  3VN4 A;  2QQW A;  1KIT A;  3SCG A;  1I1E A;  2FDI A;  3ORJ A;  4BA6 A;  3RRD A;  2WNU A;  2EXJ A;  1OUS A;  1OUR A;  5I8Y A;  4I3G A;  1RUG 2;  1U12 A;  5ACA 2;  2VOX A;  4LEJ A;  1VMF A;  3WP5 A;  2DU0 A;  4IEW A;  2VNV A;  2X05 A;  4Q0V A;  3TBD A;  1JZ6 A;  2FZ2 A;  1G9B A;  3IDC B;  4M3C A;  4IW3 A;  2Y6L A;  2YGL A;  4OFG A;  2ZGU A;  4CCJ A;  3LD8 A;  2HYX A;  1WW5 A;  5LCW L;  3ZX7 A;  3LFM A;  2BGO A;  5HV4 A;  1MEC 1;  2R06 2;  4WVV A;  3CL1 A;  2DTY A;  1AYM 3;  1NA1 B;  3S5Q A;  1DGL A;  3GJA A;  1PZ9 A;  1V00 A;  2RS1 3;  4Q1R A;  4FO9 A;  4E2G A;  4EWA A;  2WZP P;  5B4X A;  1ND3 B;  4NUB A;  2FBE A;  3IT8 A;  3QBQ A;  4Y1V A;  4BM8 A;  3AJZ A;  3FFZ A;  2G4I A;  1DFQ A;  2A3Y A;  1LGC A;  1UQX A;  2P37 A;  2W95 A;  3RGB A;  5BY5 A;  2LRO A;  4HPK B;  2IXI A;  4XDQ A;  1CAV A;  1KJR A;  4YVS A;  1LGB A;  3ILR A;  5EHD A;  2OPW A;  4C1W A;  4IUG A;  4OHX A;  1MZF A;  4CCO A;  3UK9 A;  1AXK A;  1RMU 3;  3VKM A;  4YAR A;  4HN1 A;  5I91 A;  1AR7 1;  1AR6 3;  3OEA A;  3THD A;  3WHU A;  2ATF A;  4O9E A;  1EV1 1;  5JVV A;  1LOF C;  2W52 A;  5FBJ A;  4B29 A;  3ZYJ B;  2IVJ A;  1EYB A;  4D7S A;  5DDJ 3;  3HPN A;  1M4W A;  1W2A X;  5FUI A;  4YW3 A;  3GNE A;  2ZJC A;  4AHW A;  1D0G A;  4C91 A;  2JG9 B;  4LT5 A;  4BCU A;  1RUJ 1;  1UU4 A;  3Q8A A;  5DUW A;  1UZV A;  2R04 2;  4HVO A;  5FY1 A;  3O1M A;  1LOF A;  3PUH A;  5BNO C;  3VB9 A;  2XJU A;  4MHR A;  4W6W A;  4ZXE A;  3ZVX A;  2EID A;  1DU3 D;  1NQJ A;  2YFU A;  4NII A;  3J26 N;  2XUM A;  5EP9 A;  3S5A A;  3K4A A;  3EB7 A;  3KQR A;  2AR6 A;  3PUR A;  4XAB A;  4ES9 A;  2FDK A;  3LA7 A;  2D98 A;  1RUO A;  1HXS 1;  5BNO A;  4MV2 A;  2WWS A;  1RVF 1;  1QHD A;  2R6Q A;  5LY1 A;  1JBC A;  4BQW A;  3AC0 A;  3W21 A;  1KDK A;  5IUQ A;  5DZE A;  4A6S A;  2GAU A;  1PX3 A;  3MPP G;  1Y9G A;  1UOF A;  1K3I A;  2B46 X;  1AL0 G;  2GC0 A;  3B69 A;  3HD8 B;  3KVA A;  5F5I A;  4YZ3 A;  1PZ8 A;  1S2K A;  4B8E A;  4YW6 A;  2XJS A;  4FFG A;  1XNA A;  5FK7 A;  1FOD 3;  5EPA A;  1X9P A;  2RDN A;  1TNR A;  3ILF A;  4IL7 A;  2GMP A;  2CAU A;  1YQ5 A;  4Q2F A;  4AQ6 A;  1D4M 1;  1AL2 1;  5A33 B;  3GYD A;  5GM0 A;  3ZXD A;  2XWJ B;  2RM2 2;  2NPI A;  3H3L A;  1QJU 3;  3KZ4 C;  1FXZ A;  3HQR A;  3SHR A;  3ZXA C;  1V70 A;  4GAZ A;  2A5Z A;  4CUC A;  1PVC 2;  3J7L A;  1OT5 A;  1IKP A;  4Z07 A;  3ZXF A;  5E6H A;  4WM8 B;  2VCB A;  1LOC A;  4H14 A;  4D6S A;  2VOV A;  2QZ3 A;  5I0S A;  3GBG A;  2QQJ A;  2YMZ A;  4AWD A;  3NST A;  5FV3 A;  4Y22 B;  5LW9 A;  3ON7 A;  3VBU C;  5KHG A;  3AB0 A;  4NIG A;  4BB3 A;  2R7E B;  5F9T A;  3A23 A;  4HMZ A;  4I0W B;  2JDN A;  2VPV A;  2WT1 A;  4JDN A;  4L97 A;  4YGB A;  5FYZ A;  1NE4 A;  1XYO A;  4RQP C;  1PIV 1;  1W8O A;  4UFI A;  3RMY A;  2VNG A;  4B4R A;  3VBS B;  2ILM A;  3AYC A;  3B5L B;  4Q4W 2;  1RXG A;  5H9Q A;  3UET A;  1TE1 B;  3D82 A;  1J3R A;  2HWC 3;  2WIN B;  5A3W A;  1MR5 A;  3IM0 A;  5FPV A;  4RS5 C;  4JX0 A;  2HWF 3;  3Q8E A;  2X8K A;  4RQP A;  4GMP 0;  1SCS A;  2XVG A;  3P6B A;  3AMN A;  3R4U A;  3T4V A;  4A4A A;  1G9D A;  1XYP A;  2ZX2 A;  1KJL A;  1SLI A;  5A6X A;  5HPO A;  1WD4 A;  1OQE A;  2ZHK A;  1DZT A;  2JE7 A;  2W91 A;  4G4F A;  3PIJ A;  3K46 A;  4LJH A;  4SLI A;  2CV6 A;  3M2M A;  1JW6 A;  1UY1 A;  4NMI A;  2HBT A;  2ZBJ A;  3OUI A;  3FJS A;  4ZU4 A;  3X29 B;  1SBF A;  4TLG A;  1HDK A;  4ZON A;  4XFG A;  3ZSL A;  3SKV A;  4MXW B;  4FPG A;  4AW7 A;  3JB4 C;  3LGR A;  3KCC A;  1WWY A;  3I2J A;  5FPA A;  4LOR A;  5FPB A;  4RFR B;  3WQ0 A;  3NAP C;  4CEW A;  1WA4 A;  3AP4 A;  1OOP B;  3ZO0 B;  1LOA A;  2KR2 A;  2WFP A;  1HRI 1;  1REE A;  2CWS A;  1DP0 A;  4YZ1 A;  1GQG A;  3V0A B;  4G9S B;  4XFF A;  1S2B A;  3GHN A;  1G9F A;  2HEW F;  2P3Y A;  3NAP A;  4YZ4 A;  1P8J A;  4LA2 A;  3WEZ A;  3S0M A;  5SV5 A;  3N3H A;  4CDX B;  1AXY A;  1YRZ A;  1RUG 1;  2A6W A;  4CVU A;  3SXW A;  2Q4S A;  3K2O A;  4UFM A;  5FUN A;  4DS0 A;  1XU1 A;  1E5R A;  2ET1 A;  2DFB A;  2P6C A;  2QFE A;  2ET7 A;  4QGM A;  1NCR C;  4XUT A;  3SCH A;  1YQ2 A;  3T1M A;  1WLT A;  2VCM A;  5FZD A;  5FYV A;  1FMD 3;  5FYB A;  3BIE A;  3H8O A;  5BPX A;  2OT7 A;  5B2G B;  1HQW A;  1DYP A;  4N7U A;  5A1L A;  4I09 A;  4Q8L A;  4RHV 3;  2VU9 A;  4GA9 A;  3KV6 A;  3H50 A;  1U5X A;  3TRS B;  2DUQ A;  1H2L A;  4YLZ A;  1NCR A;  1EP0 A;  4W6Y A;  1YFY A;  1HRV 2;  1BZW A;  3FLP A;  5FTT C;  2B9V A;  4YYO A;  3RYR A;  3WG4 A;  2DTW A;  4DXZ A;  1RUI 3;  4CXW A;  3AZW A;  4WVW A;  4X6R B;  3MFC A;  1D2S A;  2DVD A;  2GND A;  1QJE A;  2LUW A;  2D6O X;  2EA7 A;  3JBG 1;  3TEX A;  3SNM A;  3POE A;  4K21 A;  4IEO A;  1SLL A;  1QJX 3;  1K5M B;  1RUE 2;  4XUR A;  5FYM A;  3WW2 A;  5J1X A;  2QQV A;  4LHL A;  1OQD A;  5C9A C;  5L36 A;  4GXL A;  5EWS A;  5C7G A;  2FCV A;  2WR9 A;  3O1O A;  4FAH A;  3BTX A;  2QNK A;  2DVG A;  1S55 A;  2WSV A;  4ZXK A;  2E6V A;  4DUX A;  3KHB A;  3KHC A;  4BMB A;  1W8Z A;  1MEC 3;  4P5H A;  2ZGL A;  3MIF A;  3AP7 A;  4OI0 A;  2FHR A;  3MGU A;  2QE3 A;  1IPS A;  5FUP A;  3SLI A;  4KU8 A;  3ZFG C;  1VB4 A;  1WW6 A;  3HOB A;  1SDD B;  1XNK A;  2J42 A;  4URT A;  1XYN A;  4A7Y A;  4BQ1 A;  4DZG A;  1J83 A;  5C9A A;  3ES4 A;  1GP5 A;  2JWP A;  1L7R A;  1AJO A;  2BBA A;  2BW8 A;  2DCT A;  5DN2 A;  5I0D A;  4FPC A;  2R04 1;  2BGC A;  2QDR A;  1OBN A;  3ZFG A;  2VG9 A;  1IHM A;  5FZO A;  1XXN A;  4C0H A;  3MLL A;  2A73 B;  2UY9 A;  5D1I A;  4NHX A;  4FOQ A;  1ND3 A;  2VME A;  2Y34 A;  1CAU B;  3J4U H;  1PM7 A;  2X10 A;  1TG7 A;  2CDO A;  1QXR A;  3UGF A;  4NWV A;  1V6O A;  5CKM A;  4CCC A;  3POF A;  3IDB B;  5A3U A;  2C4X A;  4HOO A;  4M01 A;  1VR3 A;  4PIZ A;  3KT7 A;  1COV 2;  5JR2 A;  1LHV A;  2YXS A;  3NKT A;  3T2P A;  3WF3 A;  2QUO A;  2VMD A;  1SLA A;  4CE8 A;  2EXI A;  1DQ6 A;  1RUJ 3;  1H9W A;  1UN1 A;  2ERF A;  2W1Q A;  3JU9 A;  3ME2 A;  5A32 B;  2RJL A;  1CPM A;  1FT9 A;  2DCK A;  3LA3 A;  3U10 A;  3PVO A;  2VCA A;  5KHK A;  1VRH 3;  1ZZB A;  1FX5 A;  2JG9 A;  1W04 A;  4NWW A;  1S0G A;  2R16 A;  1W6N B;  2GN3 A;  2IXL A;  4YRD A;  5C5U A;  5AFE A;  4S2D A;  3BCW A;  2WFF 1;  1UU6 A;  5AC9 2;  2UWA A;  2VQT A;  4I30 A;  5FMB A;  1RUH 3;  3POY A;  4DXR A;  4NPM A;  1PVC 1;  3MW4 A;  4XIO A;  4FP2 A;  2Q0A A;  3MEP A;  1X9T A;  2Y6F A;  1BBT 2;  5JSP A;  4GB3 2;  1GQP A;  2E7Q A;  4QMA A;  5FMO S;  1EAH 2;  1W9W A;  3LB9 A;  4AFD A;  3E1F 1;  4CCD A;  5FZL A;  4ZS3 A;  1IS5 A;  2BZD A;  2NN8 A;  2OII A;  3KCY A;  4UW4 A;  2Z5W A;  4GQ7 A;  4AI8 A;  1DQ2 A;  1X8E A;  3NJY A;  2D6K A;  4EZH A;  2VNR A;  1AL2 3;  2XLA A;  4XMI A;  4QX3 A;  1PNG A;  2TNF A;  1NYW A;  1JS9 A;  4J6G A;  4UT5 A;  1VAM A;  4K1Y A;  3ZYB A;  4DXS A;  1RIT A;  5HBA A;  2PA7 A;  4OUL A;  2V4A A;  2JKX A;  3T2Q A;  4JDO A;  1OFN A;  4H7L A;  1OF4 A;  2JEM A;  2JIG A;  4KNC A;  3OY8 B;  5E1R A;  4TSV A;  2DF7 A;  3S6P A;  3ZR5 A;  4I01 A;  1T6B X;  4NHY A;  4P9I A;  4Y20 A;  1RYY A;  1AR8 3;  3T1L A;  3GBW A;  4Q1P A;  3VZK A;  3V0B A;  2PTM A;  1OSG A;  3TNQ A;  3K4Z A;  4CDU B;  4IE5 A;  3DXU A;  3W5N A;  5L7O B;  4NHM A;  5DQ0 A;  4GAL A;  4GUL A;  4BK5 A;  3FX3 A;  4LHS A;  4UBH A;  2HWB 2;  1VBB 3;  4AZZ A;  2JD4 A;  2ARB A;  4HSL A;  4AG4 A;  5CIR A;  3EXU A;  1W8F A;  4LHN A;  4ONU A;  4RFT 0;  4K8F A;  2VBP A;  4OHZ A;  2P3J A;  5SV8 A;  3O5S A;  3MID A;  4AVC A;  1BEV 1;  3EHK A;  5ERL A;  5FLH A;  3BTZ A;  2VTF A;  1JYW A;  3OF1 A;  2YRO A;  3WCR A;  1ZBE 1;  4OLL A;  3GM8 A;  3IDA A;  1RIN A;  5H9R A;  2QQM A;  5FP8 A;  2OA2 A;  4M4R A;  1R09 2;  2E51 A;  1W39 A;  2HWE 3;  3SH5 A;  2ZGO A;  4XQ4 A;  1ST8 A;  5LBE A;  3RYK A;  2WSU A;  4CP9 A;  4HKL A;  1Q8Q A;  4NRO A;  3ZFF B;  3MUY 1;  4PF1 A;  5A7W B;  3WQB A;  3UGG A;  2MHF A;  2YGM A;  2FDG A;  1W6P B;  4EN0 A;  3VD3 A;  1YJK A;  4XJ8 A;  2CHH A;  1I6X A;  1OLR A;  1BCX A;  2PQQ A;  5J3U A;  5FP7 A;  1O59 A;  4JGZ B;  3N9O A;  3V64 A;  2WZR 2;  3H9A A;  5LA1 A;  5D8A B;  1LEN A;  2J1S A;  3HNM A;  5GLV A;  4BE3 A;  5LA2 A;  5FOB B;  3OB8 A;  1A6C A;  4CPB A;  1LES A;  1O4Z A;  5FZ7 A;  1CIY A;  5LY2 A;  4RL7 A;  1V9U 3;  4E4S A;  2WNU B;  4K1Z A;  1JOD A;  3AFK A;  4TLF A;  2BVV A;  1HRV 1;  2OKX A;  4CDQ C;  1L7L A;  2WLP A;  5FZK A;  5FZA A;  1ENR A;  5HCA A;  1C1L A;  3QOP A;  4XBL A;  1ZRC A;  5DAV A;  4M3C B;  5CG9 A;  1RUG 3;  3OD4 A;  4JKK A;  4MZU A;  5ACA 3;  4J25 A;  3V0A A;  4KMQ A;  3NRU A;  1BK0 A;  5JPM B;  1ASJ 2;  1RIR A;  1X36 A;  2WUH A;  3AVS A;  1JYN A;  1IKQ A;  4I02 A;  2MNG A;  4N53 C;  2P17 A;  4XZP A;  4XXA A;  1UOB A;  4CDQ A;  1S0B A;  2HEV F;  1WME A;  4M3C F;  5JMC A;  3WNX A;  5AVP A;  2EIB A;  3H8R A;  3O14 A;  3LEK A;  4L2N A;  3VV1 A;  2ZX4 A;  3O0W A;  4QX2 A;  3KV4 A;  4UFL A;  2R06 3;  4H3W A;  1SFN A;  2R1D A;  3MIH A;  1JHN A;  3MIE A;  3NNM A;  4FFI A;  3H8U A;  5A7S A;  3MUZ 1;  2PEL A;  2WNV C;  3IWZ A;  1OVP A;  3KVB A;  4OI4 A;  1HJF A;  1DGW X;  2D44 A;  3VKO A;  4QB2 A;  1NCQ C;  2QQP A;  1TVG A;  5FZ8 A;  2VUJ A;  3WF0 A;  1HB2 A;  1CAV B;  4YVS B;  3Q8C A;  2ARC A;  2XON A;  3ALQ A;  4YZ2 A;  1SFP A;  4A42 A;  1Y9Q A;  2WNV A;  1Q8V A;  4FT8 A;  3MW3 A;  5JIA A;  1R08 1;  2HKX A;  3O1S A;  3I3M A;  4GMP 1;  1UPI A;  3VUO A;  5IT6 A;  1NCQ A;  3TOJ A;  5LA0 A;  2IFW A;  4FPH A;  3ZN5 A;  1LHO A;  5ANN A;  4AFA A;  3GCX A;  4P5Y A;  3JXS A;  1Y3T A;  1MPX A;  3WP6 A;  1KEX A;  4F83 A;  1QOS A;  4CTE A;  4COU A;  2VC9 A;  2E53 A;  1NXM A;  3K3O A;  3VD7 A;  1R1Z A;  4CU6 A;  1GWK A;  4JGY C;  3E97 A;  4O9G A;  2ADE A;  1C5H A;  5GZC A;  4UF0 A;  4A2U A;  4CCL A;  3ZYI B;  2R04 3;  3FLT A;  1SEF A;  4R52 A;  4BQ4 A;  4D6Q A;  1Q3E A;  2XML A;  3CMG A;  3HN3 A;  4X8N A;  5DZG A;  3SEE A;  5CVR A;  3MI8 A;  4DEQ A;  1O3R A;  1FPN 2;  1YFX A;  4UAP A;  4JGY A;  4YWA A;  5F2W A;  4KU7 A;  3A7Q A;  3E5U A;  5FLI A;  5BNO B;  3CLP A;  3GZU C;  2IFR A;  1LHU A;  3UKT A;  4IEY A;  3OG2 A;  4R9A A;  5C4W C;  5FBZ A;  4E4H A;  1VBD 2;  4CDW C;  3USU A;  3WUC A;  1BJQ A;  3OD0 A;  4BHP A;  1U5Z A;  1FI2 A;  2VZT A;  1AR7 2;  1C1F A;  2XG3 A;  2Z42 A;  3KWV A;  4RYD A;  3N7K A;  4LO5 B;  4BWO A;  4DMI A;  1EV1 2;  5J96 B;  4MUV A;  4IND A;  1MS3 A;  4CPB D;  3RNS A;  5C3R A;  5IVV A;  4ZHN A;  1JYX A;  1NZC A;  3R6S A;  5C4W A;  4CDW A;  2RS5 2;  1BBT 1;  1LKN A;  3I8T A;  4CCK A;  3ZMO A;  1H4H A;  1XU2 A;  4LBL A;  3NVC A;  1F9K A;  4LKD A;  3U1X A;  4AEM A;  1X33 A;  4B1L A;  1C28 A;  3CKH A;  3DN7 A;  5ANQ A;  2IZW A;  1O6U A;  2A3W A;  3T2O A;  4BZ4 A;  1KD7 A;  2DWR A;  2LTN A;  3KMH A;  2JDU A;  1W0N A;  4XDO A;  5FY5 A;  3WG3 A;  3NJZ A;  4FAG A;  2FDJ A;  5A32 A;  1GFF 2;  1GNY A;  2ZHL A;  3KLS A;  2RM2 3;  4EWD A;  4AED C;  2ZGK A;  4BLJ A;  5BV6 A;  3NJV A;  4EN7 B;  3I2G A;  1HXS 2;  5JUV A;  3C8X A;  3P5B A;  1WCK A;  1LU2 A;  1SDW A;  1RVF 2;  5FCC A;  2OQ7 A;  1DGR A;  4CSW A;  1PVC 3;  2CSG A;  3LPF A;  4Q4V 1;  4DO0 A;  2RMU 1;  2GP3 A;  3ABZ A;  4QPI C;  3U11 A;  2YPJ A;  4UI9 L;  5FYS A;  3RZZ A;  5FRA A;  4CP9 B;  2GC2 A;  4PF5 A;  1JUH A;  2G1M A;  2RHP A;  5GZD A;  4L8Q A;  4NE9 A;  1ZZ7 A;  2WYF A;  4KWL A;  4PQQ A;  5JOX A;  3VBU B;  4QPI A;  2HH9 A;  2I74 A;  1ULD A;  2HWB 1;  2BWA A;  2ORX A;  4Q4W 3;  1G9A A;  4JTN A;  1D4M 2;  1VBC 1;  4LE4 A;  4RQP B;  4EV0 A;  4YM3 A;  3L2Y A;  2GNM A;  3EBR A;  3LOI A;  4NO4 A;  5K7P A;  3TEW A;  4XFB A;  1M06 G;  3JCI A;  1APN A;  5FYU A;  3IDE A;  3THT A;  3PVE A;  2XWB B;  3FE5 A;  1SLC A;  3M3E A;  4RS5 B;  1DLL A;  3INA A;  4ORF A;  2VW2 A;  1OF3 A;  1CJD A;  1KS5 A;  3HNY M;  5DPN A;  5A80 A;  2YZ4 A;  3A4U A;  3WP4 A;  4CA9 A;  2KA3 A;  4NIH A;  1PGW 2;  4CUG A;  1DZQ A;  2OW4 A;  3B9I A;  2IC1 A;  4U36 A;  4OI1 A;  4F3J A;  5J98 B;  2X5I C;  2AH2 A;  5DZF A;  4YVW A;  5CFC C;  5A7P A;  4QB6 A;  1R09 1;  3AKR A;  3ZOI A;  2WO2 A;  3ZXE A;  2QDN A;  3UYJ A;  2YV8 A;  3QAC A;  3WHT A;  4Q0Q A;  1PIV 2;  2OS2 A;  2ZCW A;  1VRB A;  3A22 A;  3WUD A;  3PL0 A;  5EJ1 B;  3VBF C;  2D3P A;  2V72 A;  5FZE A;  4CDU A;  1RUN A;  1MQT A;  5CFC A;  1DQ1 A;  5L7O A;  2B4K A;  2ZTN A;  2W46 A;  5IJR A;  2BJS A;  3ZSK A;  3LQC A;  4IGP A;  4IE6 A;  5IWF A;  1OPM A;  1WBL A;  1F31 A;  1UO9 A;  5BNQ A;  3GZT B;  3ZDS A;  5EZW A;  3RQ0 A;  3VBF A;  2QQO A;  3ROU A;  2FCT A;  3POJ A;  1VBA 2;  5E8A A;  4QGN A;  1ZNP A;  3NAP B;  2ETE A;  4FVV A;  5JI7 A;  4XJ9 A;  4OMC A;  3UJO A;  2BVB A;  2LM3 A;  2JDM A;  3M3Q A;  5GJ6 A;  5FOJ B;  1HQL A;  5J48 A;  4Y5Z 0;  3M8L A;  3AL5 A;  5FZG A;  5JCT A;  2W5F A;  1W3X A;  2JKB A;  3VBR C;  4QDQ A;  5F37 A;  4S2H A;  3AKQ A;  4Q8K A;  5JPN B;  1SZB A;  2EF6 A;  5HXV A;  1O7F A;  4COW A;  1G6N A;  4H7M A;  2Y64 A;  2R1B A;  1LOG A;  2BTV C;  2WC2 A;  4IEU A;  5A7W A;  3ZFF A;  4BIS A;  1X8M A;  1JZ7 A;  3VBR A;  2MEV 2;  1NCR B;  4E4Z A;  2PLV 2;  4BIO A;  4CUB A;  4BQ2 A;  4Y1Y A;  5LRR A;  1HIX A;  1KGY A;  3WDW A;  3RZM A;  5FPZ A;  4PQ9 A;  4LPL A;  2D3R A;  1XPW A;  4AK3 A;  4JGZ A;  3CIH A;  1HRI 2;  4HL0 A;  1O3T A;  3OGR A;  1OD3 A;  5D8A A;  1WW4 A;  2VXR A;  2LRP A;  3Q9O A;  2XVL A;  5AVA A;  1QQP 2;  2VZQ A;  2QQL A;  3KQ4 B;  2GC1 A;  4LO7 A;  3O1V A;  4HK8 A;  3W59 A;  4EWE A;  5FAX A;  4P9J A;  4Z2A A;  3RYP A;  1ULC A;  1VIW B;  1UOJ A;  5LA9 A;  4XF9 A;  3B93 A;  3LDR A;  3N7M A;  1TMF 2;  1RUE 3;  4I0A A;  4AVS A;  3PTR B;  4GWJ A;  1NY7 1;  2XBO 1;  1JZ3 A;  2ZS6 B;  3TEZ A;  2J7M A;  5C9A B;  2AEY A;  5FR3 A;  2YBK A;  2ZAC A;  1POV 0;  3OCP A;  4Q0U A;  1BXH A;  4HXC A;  4BIF A;  3GZE A;  3J9S A;  1BLZ A;  2X09 A;  1C5I A;  3WIN E;  1WCQ A;  3ZFG B;  1FNY A;  1NKG A;  4BQX A;  3I3B A;  5FZO B;  3FWE A;  5A3M A;  1W90 A;  3RFR A;  2MPF A;  1UY2 A;  3U4X A;  4UFH A;  3N9M A;  5APA A;  5C33 A;  1OPO A;  2V73 A;  3WDY A;  3JBG 2;  1FPN 1;  1ZZC A;  3D4K A;  2VO5 A;  1AYN 2;  4PCR A;  3SC7 X;  2AYH A;  2B42 B;  2NLR A;  2WDB A;  1DCS A;  2YB7 A;  2WJS A;  3W5M A;  4UOJ A;  1VBD 1;  4K9S A;  3AL6 A;  2WAB A;  4YPJ A;  2JB4 A;  3HR9 A;  3LE0 A;  5K8S A;  3ETP A;  3THC A;  3U0Z A;  2JEN A;  1N3O A;  3RI9 A;  5F39 A;  2DDU A;  1AR9 1;  5FZH A;  5A3L A;  1COV 3;  1H1A A;  5T52 A;  1JI6 A;  2WNE A;  2D7F A;  3WV6 A;  1W28 A;  2RS5 1;  1XSQ A;  3AFG A;  1PM4 A;  4NR1 A;  4TWT A;  1K42 A;  5EJZ B;  3PUQ A;  2VM9 A;  3N9L A;  1RED A;  2AGS A;  1U0A A;  1HN1 A;  2BU9 A;  2E7T A;  5GLU A;  3AXD A;  4LO8 A;  3G6J B;  4P02 B;  5GLZ A;  1E5I A;  1F5J A;  3WG2 A;  2BFU L;  4DFS A;  1UF2 C;  2ZZQ A;  3CEW A;  4TYS A;  4E9K A;  4MH0 E;  4TZD A;  1X50 A;  2Q30 A;  3WOG A;  4E8D A;  3ZN6 A;  4HET A;  2VZ1 A;  2WO1 A;  4PI0 A;  4AHZ A;  5AC9 3;  5JXI A;  2WZE A;  1L3J A;  1YNA A;  3PHM A;  4LUK A;  3SH3 A;  3NNG A;  2ZX1 A;  2WZ8 A;  2DVB A;  3MF6 A;  4HZF A;  5FXW A;  3MV0 1;  4NHL A;  1QMJ A;  2D93 A;  2ZMK A;  3AMP A;  3K51 A;  4Y4Y A;  4AHX A;  4D7Y A;  1QJZ A;  3RZL A;  1BBT 3;  4GB3 3;  3BOP A;  4QX0 A;  4A45 A;  1EAH 3;  3HN1 A;  1DF0 A;  3C2U A;  2PHD A;  3ZYF A;  4CCM A;  1QIQ A;  5C3O A;  3D8C A;  4CUA A;  4QQH A;  4LIV A;  1PO1 1;  2J1A A;  3IZO A;  1VBE 1;  2TUN A;  3H7J A;  1CN1 A;  4QQP A;  4RR3 C;  5J36 A;  1C8M 1;  1C57 A;  1JH5 A;  1ENQ A;  2G9F A;  1G8W A;  1H8V A;  1QDC A;  2WFF 2;  4FFH A;  4XF0 A;  5CZK A;  4YM1 A;  3K75 B;  2IXC A;  3JD7 1;  4Y20 B;  2P4E A;  4ZS2 A;  5L9B A;  3VGI A;  4ASL A;  4DRR A;  3V0B B;  1WBF A;  5ABJ C;  4CCN A;  4AI2 A;  4RR3 A;  3GBF A;  3RSJ A;  4GIQ A;  4GH4 C;  4B7K A;  5CFD C;  4M00 A;  1PGW 1;  4QD2 A;  4HSJ A;  3N9P A;  4Y26 A;  5E16 A;  5ABJ A;  2VBB A;  3EJK A;  4QHB A;  1RHI 3;  1Z7S 3;  2NMN A;  3AXE A;  2HWB 3;  1XJA A;  4LR4 A;  4RA0 A;  5HV0 A;  3I3Q A;  3BTA A;  4UBG A;  4CU7 A;  3PUA A;  2HYK A;  3L2H A;  3UL2 A;  1CGP A;  3PIG A;  1ND2 C;  5IYY A;  3ENR A;  3WNL A;  3MO4 A;  3CDZ B;  3VBU A;  5LEJ A;  3N4M A;  1S0C A;  1AF9 A;  4B3N A;  3I3D A;  3BUC A;  4E4D X;  4L92 A;  5CAD A;  4LK7 A;  1V6K A;  2VY0 A;  3ASI A;  5IVE A;  5FO7 B;  3POG A;  5KC6 A;  5FYH A;  2BNO A;  1AX1 A;  3S57 A;  2PXJ A;  1RJ8 A;  2WS9 2;  1IZ3 A;  1OH4 A;  1VBA 1;  5FZB A;  1ND2 A;  3F95 A;  4CP1 A;  3ZR6 A;  1S2E A;  3III A;  4XF3 A;  3JB8 A;  4MGI E;  1J1T A;  3I2F A;  4RS5 A;  1ZBA 1;  2R30 A;  1R09 3;  3UJQ A;  1F15 A;  3O0V A;  1J1L A;  3A21 A;  4Q0P A;  4XFI A;  1UZZ A;  5CG8 A;  1GKB A;  1AJK A;  3WX5 A;  1GP4 A;  2WAO A;  1I3H A;  2CNA A;  2AC1 A;  2GSY A;  3J8F 2;  4Q4X 2;  1Y9M A;  4FP3 A;  4AF9 A;  5ISL A;  2BBV A;  4XIK A;  3ACG A;  5I8T A;  4LBK A;  1RUF 1;  2UWB A;  4JHT A;  4MGZ E;  4P9W A;  1OUX A;  1WMX A;  1UPS A;  2WBK A;  3ZXJ A;  3ES1 A;  1K45 A;  1W6O B;  1URX A;  3MV1 1;  4QKD A;  3LAG A;  2VUD A;  2UWC A;  2WZR 3;  3LWC A;  4K3U A;  4ARX A;  1BEV 2;  4XCB A;  1TZO A;  1UYX A;  4PLO A;  4Q5O A;  1ENX A;  2MEV 1;  1GOF A;  3T0A A;  4WM7 C;  1W0O A;  4ET7 A;  2PLV 1;  3AK0 A;  3KV9 A;  5I8S A;  1ZBE 2;  3OYW A;  1ULO A;  3I3E A;  4N9H A;  5JI9 A;  4J1W A;  1A78 A;  4NRP A;  1QQP 1;  4JQR A;  4RGK A;  2XHN A;  1H6X A;  3WZ1 A;  3VDC A;  1W9S A;  2YPD A;  2BWC A;  3TAY A;  4R9B A;  4A3X A;  4CDQ B;  2JDA A;  2VD7 A;  5A3P A;  4JKL A;  2EAA A;  4MLO A;  2CWM A;  1ASJ 3;  1TMF 1;  1XRU A;  4A7K A;  1WW7 A;  5FP3 A;  4B4Q A;  1LEC A;  4N53 B;  5IK5 A;  4IV3 C;  1QWR A;  1GZ9 A;  1OA3 A;  1TME 1;  2NQY A;  4BK4 A;  4TN7 A;  1RB8 G;  3WNK A;  5GZE A;  4IGQ A;  4N9I A;  1B35 C;  4DIN B;  1IPJ A;  2DV9 A;  5FYT A;  4MET A;  4IV3 A;  1NT0 A;  5JAX A;  3BB6 A;  3TN9 1;  1NOV A;  1QEX A;  2WNV B;  2H6C A;  3WF4 A;  5LAT A;  5A3T A;  5LWB A;  5KWR A;  5FJK A;  4LHK A;  2VBD A;  4QKN A;  5FY0 A;  5JXJ A;  1B35 A;  2VTX J;  1NCQ B;  4D94 A;  3KD4 A;  4ISQ A;  1OA2 A;  4ZKT B;  5IVB A;  5K0U C;  3U75 A;  4F7Z A;  4GKX A;  1K5J A;  2E32 A;  4FPE A;  4D6R A;  1AYN 1;  5CBL A;  3ZM8 A;  5CU1 A;  2Z79 A;  2RV9 A;  3H3U A;  3LIH A;  1LTE A;  3FUQ A;  2C1F A;  3IN9 A;  3LIG A;  3PVN A;  2VMC A;  1S0D A;  2WN2 A;  5DAQ A;  4LKE A;  4OYU A;  5K0U A;  4JZR A;  2H6B A;  4LQR A;  5JIU A;  2DBI A;  3AMH A;  4XAC A;  4UF0 B;  5E88 A;  4YGD A;  3MDP A;  2ENR A;  4Q27 A;  5K9Y A;  2VXJ A;  3WLU A;  2CGO A;  3IAP A;  5A7N A;  1WCS A;  3AZV A;  3FFQ A;  4HK9 A;  1WLC A;  4Y1Z A;  4JGY B;  2B5H A;  2ZGS A;  2LW8 A;  5DMY A;  2PAK A;  1QU0 A;  1W99 A;  1XE8 A;  2XXZ A;  5FY9 A;  2JDP A;  4Y1X A;  1QOO A;  3BAL A;  4O61 A;  3USU B;  1FPN 3;  1S4C A;  4IEQ A;  4LE3 A;  3W20 A;  4URA A;  2PHW A;  4Z2W A;  1ZRI A;  1WA6 X;  1QJY 1;  2W1S A;  1I5P A;  2BNN A;  2GAL A;  1R08 2;  5C8C C;  1KRI A;  3RWK X;  4BQ5 A;  1LB2 A;  4WVM A;  3PJY A;  5L19 A;  1MS4 A;  2ARE A;  3ZKU A;  5DG1 A;  5C4W B;  1AR7 3;  4CDW B;  3BIW E;  2V09 A;  1EV1 3;  1WZX A;  3B9C A;  3ZYH A;  1HB1 A;  2C26 A;  3NWK A;  1DLC A;  4QXB A;  4AED B;  5FLJ A;  3KV5 A;  2VUC A;  1QH7 A;  3DGT A;  5JXG A;  2RS5 3;  2ZEY A;  3QCW A;  4ATE A;  2WQZ C;  5D21 A;  1LHW A;  1MS9 A;  3FHI B;  3I59 A;  4HG6 B;  3OUH A;  5FZ6 A;  1KDM A;  3FBY A;  3WD5 A;  1N1S A;  4N7I A;  4YG0 A;  2ARA A;  3NV2 A;  1RJ7 A;  3NNF A;  4R8H A;  4A44 A;  2ZGM A;  4AAP A;  1O4Y A;  2G19 A;  4DOU A;  1XE0 A;  1JXN A;  2WWJ A;  1IQA A;  1ZX5 A;  2RG4 A;  4PIX A;  1HXS 3;  2GN7 A;  4LUL A;  2ZX0 A;  1RVF 3;  4DUW A;  5IVJ A;  4MG2 A;  4AGG A;  5FPU A;  2NP0 A;  1JOJ A;  2WA3 A;  5FXX A;  3T0B A;  4FPK A;  2ZHM A;  1J58 A;  1QDO A;  1QJF A;  2OXB A;  2E9Q A;  2Q1M A;  4LBN A;  1YYN A;  4QPI B;  2AUY A;  1SLT A;  1CWP A;  3CJI C;  3RZG A;  4FFF A;  5FZ4 A;  1W8T A;  3HAG A;  4R4X A;  4EQV A;  2A71 A;  3H7Y A;  3ZFE C;  1NAE A;  1YWK A;  3FC0 A;  2ES3 A;  4MGK E;  5FP4 A;  2BFU S;  5C8W A;  1AX2 A;  2YDE A;  3ITQ A;  1D4M 3;  1RL3 A;  2R0H A;  5FZ1 A;  3CJI A;  2VQ0 A;  3KT4 A;  1W06 A;  1H2M A;  3UES A;  5CNA A;  3RMX A;  4BYY A;  3EYP A;  3ZFE A;  4A41 A;  4PDW C;  2R49 A;  2P5B A;  3WSO A;  1QXP A;  4CEY C;  1JU3 A;  1W05 A;  1W6M A;  5D2A A;  3BI3 A;  3RZH A;  2E26 A;  1QY4 A;  2JG8 C;  3MF9 A;  4Q4V 2;  4YVW B;  1G7Y A;  2RMU 2;  2WS9 1;  2R07 1;  1UYZ A;  3DPR C;  1NG0 A;  5JXH A;  4CU8 A;  4WZC A;  5KC5 A;  4Y33 A;  1C4R A;  2BNM A;  1VAV A;  2VAU A;  4QKF A;  2JD9 A;  4DB5 A;  1PX4 A;  2JG8 A;  4PBO A;  1MQT B;  2X5I B;  5FZF A;  3WNN A;  1IQD C;  5CFC B;  5JMO A;  4XAE A;  3DPR A;  2PHU A;  1UNB A;  1PIV 3;  4Q4X 1;  3J8F 1;  2DVA A;  3OBR A;  4FXG B;  1IG0 A;  4AQ2 A;  4BQY A;  3O1P A;  5G04 L;  1VBC 2;  1ULF A;  1YXW A;  4XZU G;  5M0T A;  3T3Y A;  3OTF A;  1OLM E;  1WMD A;  3VBF B;  4XFC A;  3T30 A;  3VZM A;  4XJU A;  4IE4 A;  1TEI A;  1RUC 2;  2EXH A;  5FYC A;  4JRA A;  5FPX A;  2I2S A;  5CAZ A;  1VBA 3;  2BRT A;  4PT6 A;  5IVF A;  2W1U A;  4X8P A;  3SKJ E;  2GME A;  1XC6 A;  5FKB A;  1TQ5 A;  3P3N A;  1UIJ A;  3HBK A;  4LBQ D;  1J3Q A;  3VBS C;  1H1I A;  2P1B A;  3UKN A;  5IK4 A;  2ZHN A;  4UW3 A;  3T0D A;  3VBH C;  1JHJ A;  3GCW A;  4EN9 B;  1QOT A;  2IXH A;  1VMJ A;  3OPT A;  1NQD A;  4Z82 A;  3L9J T;  5FPL A;  3VBR B;  2WLQ A;  3IIA A;  1MAC A;  1EUU A;  4AQT A;  2HWF 2;  1UU5 A;  1YCI A;  5K4L A;  2FZ1 A;  2PHX A;  2FD8 A;  4R9D A;  3NKG A;  1GWM A;  3O7O A;  3GJB A;  2MEV 3;  3IAQ A;  2ZOE B;  5I93 A;  5LEK A;  2PLV 3;  5F1R A;  3NW4 A;  3QD6 A;  1W6O A;  4QU1 A;  4PLM A;  1WLW A;  5KR7 A;  1YO8 A;  1LAJ A;  1HRI 3;  4Q0S A;  4QQ2 A;  1N1T A;  3MYX A;  3PME A;  3IMN A;  2O8O A;  3CO2 A;  3U14 A;  1XBF A;  4C1X A;  1QQP 3;  1AR6 2;  3MZH A;  1PO2 2;  2RS3 1;  4JHZ A;  1BQP A;  5CEH A;  3DUI A;  4XJW A;  1N3P A;  3LCP A;  2D6L X;  1YQ6 A;  2C9K A;  1KXG A;  1XNC A;  1OI6 A;  2YY1 A;  3DYO A;  4V2W A;  2B9U A;  4TXW A;  3FN9 A;  4FBF A;  1H2N A;  4NRM A;  4FCA A;  1TMF 3;  4MYE A;  3WQ1 A;  4YM2 A;  1AUY A;  1SBD A;  1PK6 C;  2XGX A;  3GAL A;  3T2T A;  1VAL A;  3LSD A;  5HCF A;  2VZO A;  2OYZ A;  4QM9 A;  1O8S A;  2BOI A;  3DXT A;  3DCQ A;  4HBN A;  3U4S A;  3FMG A;  4KBB A;  4MO3 M;  4AL9 A;  4A7Z A;  5BUV A;  5KBF A;  3MW2 A;  1JU4 A;  2AAC A;  4AVA A;  4FOW A;  1GSL A;  2DBN A;  3CHX A;  1US3 A;  1V6L A;  2C6S A;  4N53 A;  4OZO A;  5L9R A;  2D3S A;  3ETQ A;  2QQN A;  4XF4 A;  3AP6 A;  1CJP A;  3H3Z A;  4L99 A;  2VQA A;  1ZZ8 A;  1ENS A;  2BEO A;  3FL7 A;  2JIC A;  5EIY B;  5DG2 A;  4AGR A;  3HNB M;  3ACF A;  1YQ8 A;  3LPG A;  5IFP A;  3JBG 3;  1I9R A;  4UYB A;  2F4P A;  1AYN 3;  5C3S A;  5JZG C;  2ORZ A;  2W47 A;  1GOH A;  4XIL A;  3WF2 A;  4LTA A;  4OHW A;  4BXS V;  2A6V A;  1JZ2 A;  4COV A;  4KQ7 A;  1NY7 2;  2OZ6 A;  2XBO 2;  3A0N A;  3KF5 A;  5F3G A;  3VL9 A;  4HKW A;  3LZZ A;  4W6X A;  2A70 A;  5T55 A;  1UZW A;  2XKP A;  4AVB A;  3ZSE A;  4QQL A;  1L7Q A;  5F5A A;  4M0H A;  2JIJ A;  1AYM 1;  3ELN A;  1XSR A;  3POS A;  5JSO A;  1QF3 A;  5KXB A;  1C3H A;  4YGC A;  4QKB A;  3VL8 A;  1UXX X;  5A7Q A;  1J84 A;  3W9A A;  1UOG A;  3UT0 A;  4E2S A;  3SQO A;  4D8M A;  2D40 A;  4MXV A;  1W03 A;  2D97 A;  1HKD A;  3ZN6 B;  3K3N A;  2DCY A;  1NLR A;  3N7J A;  3ZXG A;  4K6B A;  3C7O A;  1G86 A;  5T5P A;  4DUV A;  1GNZ A;  4OHY A;  3WP3 A;  1GUI A;  4FPJ A;  5FK8 A;  2BP6 A;  1EPW A;  2R0F A;  2PHL A;  4BU2 A;  2CYF A;  5FY8 A;  4P9Y A;  3K48 A;  3AZX A;  2KM2 A;  3WG1 A;  5C6C A;  1TNF A;  2VZ3 A;  3DEC A;  4XCA A;  2D5F A;  3M3C A;  3TNP B;  5DDJ 1;  1AR9 2;  1PMJ X;  1KQR A;  3N9Q A;  1OMI A;  4KGQ A;  1V0A A;  1A34 A;  3BTY A;  3J7M A;  3N9N A;  3GHM A;  1WMF A;  1NX9 A;  3NQH A;  3LDB A;  3ZYP A;  2F17 A;  3W58 A;  4YFW A;  3MBW A;  4IES A;  1UY3 A;  4AED A;  1UMI A;  2Y0I A;  1HV0 A;  2W1W A;  1CAX A;  4QX7 A;  2VJX A;  4COY A;  5FKC A;  1Q8S A;  2YC4 A;  4PBP A;  4AYU A;  2ZZJ A;  1OXC A;  2PAE A;  4XUP A;  1UKR A;  1UW8 A;  4HLT A;  2RJ2 A;  4MX3 A;  3ZSM A;  1OKQ A;  4IEZ A;  3O1T A;  4QXH A;  1MZ5 A;  4RR3 B;  2W3J A;  3KGL A;  3ZYR A;  4YSF A;  3WF1 A;  2WFF 3;  4ERO A;  2XLF A;  3EQE A;  4F8A A;  2FMY A;  1MVQ A;  4QT6 A;  4XHB A;  3VZN A;  5CIS A;  4YM0 A;  5LB6 A;  4UXA A;  4XC9 A;  4S2G A;  1OFS A;  2XLG A;  5ABJ B;  2XOM A;  1UY4 A;  4XJA A;  3LFI A;  5CFD B;  3AYA A;  1FV3 A;  3O0X A;  2CGP A;  1YQC A;  2DCZ A;  2ZKN A;  1FOD 1;  2JDY A;  1PO1 2;  3OBA A;  3LKJ A;  4H2A A;  4HVQ A;  2K0G A;  5DUX A;  2YBP A;  2Z4F A;  1R64 A;  3POB A;  1VBE 2;  1QXJ A;  3I54 A;  2AEN A;  1GOG A;  2B45 X;  1QJU 1;  2IWG B;  3URF A;  1JUI A;  1YEW A;  4D3W A;  1C8M 2;  1ZRE A;  1MZ6 A;  4DIQ A;  1SPP A;  3AKS A;  1ND2 B;  2QQK A;  1ZA7 A;  3JD7 2;  5DUV A;  1RUC 1;  3WDV A;  5A6Y A;  5IVY A;  5IVC A;  1R1A 2;  2VMH A;  2WS9 3;  3R4D B;  1GQH A;  4AEJ A;  2EIG A;  1QGL A;  5FXZ A;  4BOW A;  3T09 A;  2F6B A;  3VHO A;  3KCX A;  3R4S A;  5T3N A;  1VB2 A;  5KHI A;  3OSD A;  5L9V A;  2K2S A;  2ZA9 A;  4M4P A;  3D0S A;  4QXC A;  1GZT A;  1UYY A;  3I97 A;  4Q4X 3;  2YHJ A;  3J8F 3;  5L73 A;  4KG8 A;  4FOY A;  5GAL A;  4AFB A;  4OQ9 A;  2VNO A;  3POW A;  2JEC A;  4JC1 A;  4LOT A;  2HWC 1;  1HV1 A;  4C8D A;  4NPL A;  2X5I A;  1VPH A;  4JVA A;  2G9G A;  2HWF 1;  3TYJ A;  3THP A;  4XUO A;  1CIW A;  1OLQ A;  4LLF A;  1BEV 3;  4OCT A;  5IW0 A;  2JX9 A;  3OYW B;  3H1M A;  4UW6 A;  3M70 A;  3H1Y A;  4J1X A;  5FRE A;  1SLB A;  1NZI A;  3VD4 A;  1MZE A;  4KI5 M;  4WM7 B;  3Q8F A;  1ZBE 3;  2D6P A;  1IS4 A;  4LXL A;  1GZW A;  4OZX A;  3S7E A;  1ZBA 2;  5F3E A;  4AFC A;  3CF6 E;  1PO2 1;  2D6N A;  4JTO A;  4L9B A;  4QPY A;  2D5H A;  2HLE A;  4FQ4 A;  4QX1 A;  1U5Y A;  4L11 A;  2YU2 A;  5F5C A;  4ATF A;  1RUF 2;  1FNZ A;  5FIX A;  3O12 A;  2XUE A;  5C5T A;  1N1Y A;  3HMY A;  2P3I A;  4ES8 A;  1ZRR A;  2ID4 A;  4YZ5 A;  4R4Z A;  3KSC A;  3OGS A;  4YW2 A;  4KWK A;  4IXL A;  4QDR A;  2NMO A;  4WBB A;  2ZGP A;  3USS A;  2VOW A;  2CDP A;  1PGS A;  1ZM1 A;  3OPW A;  3POI A;  1Q5O A;  2WII B;  3E5X A;  4G3Y C;  4IV3 B;  4O7X A;  4BQ3 A;  3DL3 A;  3AMQ A;  2ZXQ A;  4Y5T A;  4XDP A;  2BV4 A;  3ZN4 A;  1W9Y A;  5FYY A;  3QH6 A;  1B35 B;  2QCS B;  5BXX A;  5FWE A;  1HRV 3;  1REF A;  1Z78 A;  1H2K A;  1RUD 2;  5C70 A;  5F3C A;  2RR1 2;  4FTB A;  2Y60 A;  2Y6G A;  4I0B A;  2A6X A;  1JYC A;  2J1V A;  2W94 A;  3C3V A;  3VDD C;  4CRQ A;  1SHW B;  4NAM A;  1H0B A;  1ZZ6 A;  4NJ4 A;  2A7A A;  1AHS A;  1H8T C;  5K0U B;  1XND A;  4QPG C;  4W50 A;  2ZGT A;  4JQT A;  3V56 A;  3G7D A;  1JOB A;  4WV8 A;  5F8P A;  2DVF A;  4LNV A;  3WT3 A;  1TME 2;  1UIK A;  1MS5 A;  4GZ9 A;  4EN8 B;  2BOJ A;  4XMA A;  5BNP C;  1H8T A;  1CPN A;  4XQD A;  5FZ9 A;  4QPG A;  2QKD A;  4IEV A;  3VBO C;  3WW1 A;  2C24 A;  2JE8 A;  3ZIW A;  2OPK A;  1DIW A;  4MOA A;  3RWN A;  1BMV 2;  2OQ6 A;  1RUI 1;  5FDB A;  5FWJ A;  4NRQ A;  1EY2 A;  3PNA A;  3TN9 2;  4JAA A;  5LZ6 A;  1SQ4 A;  4RSU A;  1OLM A;  5BNP A;  3VKF C;  3WW3 A;  2PQS A;  4RN5 A;  4WVM B;  4CXY A;  3VBO A;  3WDU A;  2BUK A;  1QJX 1;  5AFB A;  2VVF A;  1A8D A;  2W0X A;  2X29 A;  4B1M A;  4Z8B A;  2YBS A;  4ZU7 A;  1R08 3;  2XH6 A;  4GMP 3;  3ZLI A;  3VHP A;  5C8C B;  4EN6 B;  1UMZ A;  1UX6 A;  3DV8 A;  1OHF A;  1CES A;  5BNN C;  3I2K A;  3UV9 A;  4CU9 A;  4QX8 A;  3AYE A;  3ST7 A;  5A3N A;  4LBQ B;  1LOB A;  3I59 B;  5FJH A;  1Q43 A;  4XYX A;  5CKQ A;  3WW4 A;  1QKQ A;  4EJR A;  4YVS C;  3OGJ A;  5IAV A;  4FPF A;  3IMM A;  5BNN A;  4Q29 A;  2VQU A;  1CX1 A;  3PU3 A;  3DKW A;  5KHH A;  4M0N A;  1MS0 A;  1F4A A;  5A6Z A;  1SCR A;  2WWU A;  3OJB A;  4E8C A;  1HN0 A;  1QJY 2;  3F2Z A;  4KL1 A;  4AGV A;  2I45 A;  3S30 A;  5B4N A;  5A1F A;  5KXD A;  4LKS A;  3UKV A;  5IHR A;  1DQ5 A;  1STM A;  1D0H A;  1GMM A;  4AI3 A;  1MS8 A;  4NOT A;  5FFO C;  5JOY A;  2PHT A;  1RGS A;  2KXL A;  5LAS A;  3NNJ A;  3TB0 A;  3ZKY A;  2XJT A;  5FMO L;  1CZV A;  3GXU A;  2Q1F A;  4HN0 A;  4YGE A;  3S7I A;  2WNO A;  4AVV A;  4TTG A;  1DDL A;  3J7H A;  2JJ6 A;  3CJI B;  4Q4Y 2;  2IXK A;  4D69 A;  1UXZ A;  1VRH 1;  1XB9 A;  3ZFE B;  1W6M B;  1Y7B A;  2WL1 A;  3T4H B;  1LED A;  4S2F A;  1QH6 A;  4P00 B;  2Q8O A;  4IGO A;  2G9Z A;  4K8R B;  4LBM A;  2Y8K A;  2DUP A;  1RUH 1;  1JZ8 A;  5FMC A;  3B94 A;  3JQW A;  4CEY B;  4OUE A;  4PDW B;  4Q4V 3;  4XOG A;  5G05 L;  4B7E A;  5FO8 B;  2GH2 A;  1R1A 1;  2RMU 3;  5F32 A;  3VD5 A;  2JG8 B;  2FMD A;  4LK6 A;  5HCH A;  3DPR B;  3C7G A;  3E5Q A;  3K77 A;  2FCU A;  4QHZ A;  3IPV B;  1V6I A;  2RE9 A;  2I07 B;  5FMD A;  2BGP A;  3P1I A;  4N90 A;  1FYU A;  2VH9 A;  1O3S A;  1DHK B;  1S0E A;  4LO6 B;  4AVT A;  3K4D A;  3LEG A;  1O5L A;  5LBB A;  2SBA A;  2F4L A;  3RJ2 X;  4GH4 A;  5CFD A;  3AJY A;  3PDQ A;  4XET A;  1VBC 3;  1O4T A;  4FSJ A;  2GZW A;  1W6Q A;  4OUS A;  3AKP A;  3BVC A;  4C90 A;  2J1E A;  3DF0 A;  2FQP A;  1IS3 A;  3FLR A;  1UWW A;  3AX4 A;  3KGZ A;  4O65 A;  3PUI A;  5FP9 A;  2Z69 A;  1RUC 3;  1UZ0 A;  1LRH A;  4HKO A;  1ZYB A;  4DEV A;  4DNY A;  1H6Y A;  1H30 A;  3HQU A;  1JYV A;  4FQZ A;  2R07 2;  2Q1Z B;  1WD3 A;  1AR8 1;  1ALY A;  4RD7 A;  1ULP A;  3FUO A;  3GZA A;  2J1R A;  3M4F A;  3AMM A;  5DUU A;  4GWM A;  1DGR N;  5C3P A;  1SG3 A;  2JDK A;  1CAW A;  2GP5 A;  3MLJ A;  2ZAB A;  4MGT A;  2J22 A;  4MSV A;  1V6M A;  1W9T A;  1LOD A;  4JRL A;  2ZGR A;  1VBB 1;  3KM5 A;  4KG0 A;  1YLL A;  3C7H A;  4HVR A;  3C7E A;  4KWJ A;  3O1U A;  3PU8 A;  3VBH B;  3PUS A;  1POQ A;  4D7T A;  3LA2 A;  4ASK A;  1PGL 1;  2EXK A;  2JDH A;  1PNF A;  1XNB A;  4LIT A;  4AI9 A;  1E57 A;  1GAN A;  1YFW A;  2Y0O A;  3U37 A;  3VKN A;  4CXX A;  3H42 B;  4LKF A;  2WQ8 A;  4L0P A;  5LBC A;  3UGH A;  2CY6 A;  5F7U A;  3NV1 A;  1J3P A;  1KFX L;  3EO6 A;  3N36 A;  3NMB A;  1D4V B;  2K46 A;  3M3I A;  2OZJ A;  4K40 A;  4LIU A;  3WNP A;  3ZXL A;  4AOC A;  5GZG A;  4NIA A;  2ZML A;  4AEK A;  3BU7 A;  4ITC A;  3WY6 A;  2HWE 1;  2E7A A;  1W9F A;  4FOV A;  4X6Q B;  1PO2 3;  3GF6 A;  4OHV A;  5HCB A;  1RUD 1;  3RZJ A;  4YFZ A;  1VE0 A;  1W8U A;  2RR1 1;  3I7D A;  4WM7 A;  4ZPI A;  4CEW C;  4Z1V A;  3SIT A;  3N7L A;  1VP6 A;  3D0J A;  1N47 A;  4FPO B;  3LSE A;  5EYY A;  2OX0 A;  4ZY9 A;  2Q8E A;  4PJY A;  5DAX A;  3SMH A;  4AQS A;  4P9L A;  1UCX A;  2UYA A;  5FO9 B;  4PLN A;  1PK6 B;  2WYS A;  2PAM A;  1IOA A;  2W9X A;  2YC2 A;  1UX7 A;  2RDQ A;  4BDV B;  1WCU A;  1IGO A;  2RJK A;  4IEX A;  3MHZ A;  1V9U 1;  2UU8 A;  3HT1 A;  2DYC A;  3RPQ A;  1ZVF A;  2XR4 A;  5FZ3 A;  1W2T A;  1OVS A;  1BMV 1;  4NHK A;  1LNS A;  5A7O A;  2HWD 2;  5CYY A;  1CD3 G;  2RS3 2;  2WKK A;  2Y33 A;  3FHA A;  3O1R A;  1H9P A;  1CR7 A;  4RGG A;  5ACA 1;  5A6Q A;  3FHQ A;  1DYO A;  1KS4 A;  2B39 A;  3BYW A;  4N43 C;  2YU1 A;  1Y4W A;  4GJY A;  3ACH A;  3I2D A;  3N35 A;  4B4P A;  3CU7 A;  4IV1 C;  5JZG B;  4OVE A;  3TEY A;  2XBO 3;  1HJG A;  1UY0 A;  2DUO A;  1KFU L;  2VUA A;  4BLI A;  3CBN A;  4DPN A;  4BJ0 A;  1S0F A;  1W8H A;  2R06 1;  1VLN A;  2XJQ A;  3SIS A;  2BPA 2;  1PVX A;  4N43 A;  4XVH A;  5F6L B;  5H9S A;  1LCL A;  1UAI A;  4IV1 A;  2V5Y A;  2R32 A;  3OGV A;  3Q8B A;  3LF7 A;  4OMD A;  1F35 A;  1ZA4 A;  2VMG A;  3ZXK A;  4AE2 A;  2ZGQ A;  4NN0 A;  4XHX A;  4LO4 B;  2VL4 A;  2ZMN A;  1DBN A;  2QVS B;  4XPV A;  1BHG A;  1GNH A;  5JDB A;  1NXD 1;  2DU1 A;  4QB1 A;  1OKO A;  2RDR A;  4FPY A;  1NE6 A;  1WGP A;  5I0T A;  3VD9 A;  3H1W A;  1VBD 3;  5FQ0 B;  4PHZ A;  4AR2 A;  2V5D A;  2VW1 A;  2VEC A;  3VZO A;  1NA1 C;  3MIC A;  1JTZ X;  1AR9 3;  1DQ4 A;  1AYM 2;  3MIB A;  5J37 A;  5C8C A;  3AZZ A;  1CAX B;  1W0P A;  1A3K A;  4MVT A;  1F8V A;  1ND3 C;  1I5Z A;  3OBT A;  2RS1 2;  2H0B A;  1O3Q A;  2VTX A;  5LBF A;  3ACL A;  3ZDV A;  4LBQ A;  4XUQ A;  2D43 A;  4YW1 A;  1NA1 A;  1D2Q A;  2C9A A;  4QQO A;  2XB6 C;  4Q4Y 1;  1YUD A;  4QM8 A;  1LEM A;  2DCJ A;  2YFZ A;  5CKN A;  3CZU A;  1YI9 A;  1FAY A;  4XAA A;  1RMU 2;  1ULG A;  4HPK A;  1F5F A;  2CL2 A;  3QLQ A;  1UKG A;  1UMH A;  2TEP A;  4XFA A;  4XXP A;  3HEI A;  3TWI A;  1JZ5 A;  4JKM A;  3WNO A;  2ZX3 A;  2E33 A;  2OUH A;  4E27 A;  2XL9 A;  3PJQ A;  1RXF A;  2EVX A;  2NZ9 A;  4N8M A;  5DDJ 2;  4AAX A;  2JG9 C;  1Q8P A;  2E31 A;  1WKY A;  3I2I A;  3OUJ A;  4FPL A;  3RVH A;  2XJR A;  4XTM A;  2YUE A;  2BDR A;  2A1X A;  3RDI A;  2ARX A;  3WCS A;  1W3V A;  1LU1 A;  2X53 S;  1AVB A;  2HEY F;  2GNB A;  5E89 A;  1PO1 3;  5C71 A;  5FZC A;  3MFA A;  5JWP A;  2CGN A;  1SPP B;  4MGS A;  1LGN A;  1VBE 3;  1MS1 A;  4HFS A;  4KBZ A;  4JCK A;  3SH4 A;  1JYI A;  2RM2 1;  4OI2 A;  1WUV A;  1PMI A;  5FY7 A;  3GGL A;  3B02 A;  3I2H A;  1C8M 3;  4DY3 A;  3SEP A;  3FZ3 A;  4BPZ A;  3ZPY A;  2QBX A;  1JYT A;  1FAT A;  1POV 1;  3JD7 3;  3H0O A;  2GH8 A;  5EV7 A;  1E5H A;  5J09 A;  1DG6 A;  2FDH A;  1R1A 3;  3AZY A;  4IQP A;  4ASM B;  3E6D A;  2XQR A;  4K20 A;  2OVU A;  2GU9 A;  4E2Q A;  2XJV A;  4IDZ A;  1O91 A;  4LLO A;  3DKQ A;  2VE1 A;  4DY5 A;  1X7N A;  4CP0 A;  4CEY A;  4PDW A;  4BME A;  2XL7 A;  4AI1 A;  5F2S A;  1FOD 2;  4A6O A;  2OUJ A;  3HIF A;  4EE2 A;  4Q4W 1;  4XEZ A;  3RZK A;  2BER A;  3IPV A;  2ZKL A;  4QGL A;  1SMV A;  4XF1 A;  4BXF A;  4PIY A;  1U5I A;  1B09 A;  1QJU 2;  1X82 A;  2VVD A;  2WQ4 A;  1ULE A;  3PMS A;  3IKW A;  3BOD A;  2ADD A;  5A33 A;  1VMH A;  4WM8 C;  5FZ0 A;  2H0V A;  5JSR A;  1JZ4 A;  1ZRF A;  1GZW B;  4M3C E;  5GLW A;  2XQX A;  4FXK B;  4AHY A;  4MAD A;  3QH7 A;  2CAV A;  3E6C C;  1QNW A;  2AEZ A;  2WT0 A;  2WRA A;  1XOY A;  1LUL A;  3AKT A;  1S1A A;  2P34 A;  1YFU A;  2K9Z A;  4WM8 A;  3KS7 A;  4COZ A;  1ZBA 3;  2FDF A;  5EYX A;  1RHI 2;  3U78 A;  4A3Z A;  1CON A;  1Z7S 2;  3BPZ A;  5F3I A;  2LAL A;  3WDX A;  2A6Y A;  4Y22 A;  1A8M A;  3LDK A;  1RUF 3;  5GKA C;  1GV9 A;  2HWC 2;  2PN5 A;  1LJ7 A;  3BOW A;  3E6B A;  2VOT A;  5LK5 A;  3APB A;  3VBS A;  3MIG A;  3BN6 A;  5T5L A;  4MHU A;  5J7M A;  4K7J A;  2AZ5 A;  4JV4 A;  4LMF A;  1F2N A;  4XBQ A;  3DEM A;  2IUW A;  3GDB A;  3VBH A;  2YG0 A;  3B7M A;  1JN2 P;  5EXO A;  1UZY A;  1O8P A;  3C7F A;  3NJX A;  4Z92 B;  4YW4 A;  4RGA A;  4EZ4 A;  4Y3O A;  4XE9 A;  5EJ3 A;  2W2I A;  2QQI A;  3NV4 A;  3RS6 A;  5KHJ A;  4V2V A;  3PLQ A;  3I4I A;  4C0B A;  4H55 A;  4UFK A;  3KT1 A;  1ACC A;  2HWD 1;  1RUD 3;  4QAW A;  4Y24 A;  2O0O A;  2RR1 3;  2QZ2 A;  2XHK A;  4YG6 A;  2WAA A;  5FXV A;  5T5J A;  2XJP A;  2W39 A;  1CZS A;  1YI7 A;  3NV3 A;  4V1P A;  3DYM A;  4PI2 A;  4IER A;  2Y6K A;  3D5O A;  1DQ0 A;  3BPS A;  4QWN A;  2UY8 A;  1EPZ A;  3HVD A;  3VDD B;  4MXW A;  1H8T B;  3CNA A;  4QPG B;  1OOP C;  2Y38 A;  2GNT A;  1TME 3;  2EAK A;  4XW3 A;  3M3O A;  5DAW A;  5T54 A;  4ZZ5 A;  5IK8 A;  1J59 A;  3KB5 A;  5DAB A;  1S0I A;  5KXE A;  1D7P M;  4QHO A;  4D0Q A;  5EQU A;  1C8N A;  1PK6 A;  5BNP B;  3VDA A;  1RTV A;  3ACI A;  2GMM A;  5FYI A;  1OOP A;  2JE9 A;  3VBO B;  4CDX C;  3BKZ A;  4W4Z A;  3TN9 3;  4WZF A;  5FY4 A;  1JOP A;  5GZF A;  3A0K A;  4CZS A;  5H9P A;  4SBV A;  2ZAA A;  5JOZ A;  2RDS A;  2WT2 A;  1IPK A;  1W2N A;  1GU3 A;  4NVP A;  2Y6J A;  2W68 A;  4ZZ8 A;  1XNT A;  1RUE 1;  1T2X A;  2PFW A;  4ISR A;  4BH9 A;  1PHM A;  3WXP A;  4CDX A;  3PTY A;  3VZJ A;  3MLK A;  4FTS A;  2B7Y A;  2XDV A;  3AP9 A;  1FMD 2;  4AFM A;  3R05 A;  1HB4 A;  4QX5 A;  2VZP A;  5HI0 A; 
#chains in the Genus database with same CATH homology
 2W92 A;  3WF3 A;  2VMD A;  2ID4 A;  3CZJ A;  3ECQ A;  2W1Q A;  3OGS A;  4CU7 A;  2EIC A;  2DCK A;  4QDR A;  5IYY A;  3WNL A;  3MO4 A;  2CDP A;  2VCA A;  3CDZ B;  3I3D A;  2EIE A;  2ZXQ A;  2VMF A;  4GWI A;  1OH4 A;  1CZT A;  2VQT A;  5C70 A;  4DXR A;  3III A;  4ARY A;  4W8J A;  3I2F A;  2Y6G A;  2W94 A;  2J1V A;  3A21 A;  1SHW B;  1GQP A;  2WAO A;  4W50 A;  1W9W A;  2W87 A;  3E1F 1;  3ACG A;  1W8N A;  2BZD A;  2WBK A;  2ZEX A;  4GZ9 A;  3VDB A;  1K45 A;  3MV1 1;  2ZEZ A;  3OEB A;  4ARX A;  3DYP A;  4QX3 A;  3T0A A;  1UYX A;  2JE8 A;  1GOF A;  4MOA A;  2VZU A;  4FI9 A;  4DXS A;  4ET7 A;  2JKX A;  3T2Q A;  2VZR A;  2J1T A;  1OF4 A;  1ULO A;  2PQS A;  3I3E A;  4RN5 A;  2VZS A;  2XHN A;  1H6X A;  2WO3 A;  1RYY A;  2RVA A;  3VDC A;  1W9S A;  3K4Z A;  2JDA A;  4JKL A;  2VR4 A;  3W5N A;  5JR2 A;  5DQ0 A;  4BK5 A;  2V4V A;  3I2K A;  4CU9 A;  4LHS A;  3T08 A;  4AG4 A;  4BK4 A;  3WNK A;  2VQU A;  1CX1 A;  2VTF A;  1JYW A;  1F4A A;  3WF4 A;  4E8C A;  3GM8 A;  3IDA A;  3F2Z A;  5JXJ A;  2QQM A;  3LEI A;  4M4R A;  3CQO A;  5B4N A;  1EUT A;  4LKS A;  2WN3 A;  5IHR A;  2E32 A;  1GMM A;  3D3A A;  3ZM8 A;  3MUY 1;  4PF1 A;  2RV9 A;  3WQB A;  2VMC A;  2WN2 A;  3VD3 A;  4OYU A;  1K12 A;  1CZV A;  3GXU A;  1O59 A;  4LQR A;  5LA1 A;  4TTG A;  2KD7 A;  3J7H A;  2J1S A;  3HNM A;  3IAP A;  5LA2 A;  1UXZ A;  3OB8 A;  3HJR A;  1CIY A;  2LW8 A;  5DMY A;  1W99 A;  4P00 B;  2OKX A;  1F4H A;  2Y8K A;  2W1S A;  1JZ8 A;  1I5P A;  4KWU A;  3BGA A;  4XUN A;  1NUK A;  4OUE A;  5G05 L;  4JKK A;  4KMQ A;  3VD5 A;  3NRU A;  2WUH A;  1JYN A;  3C7G A;  2LS6 A;  3K77 A;  2C26 A;  2ZEW A;  1DLC A;  4MGQ A;  2Y6H A;  2BGP A;  3P1I A;  4QDS A;  5JXG A;  2EIB A;  2ZEY A;  3K4D A;  3LEG A;  3LEK A;  5HXM A;  4QX2 A;  3UNP A;  2VZV A;  1PMH X;  4HG6 B;  3MUZ 1;  4QPW A;  5IFT A;  2J1E A;  4A44 A;  4QB2 A;  3WNM A;  1UWW A;  1TVG A;  2VCC A;  3PUI A;  3WF0 A;  1UZ0 A;  4DEV A;  2J1U A;  4DXT A;  2XON A;  1H6Y A;  1JYV A;  4A42 A;  3IB3 A;  4DUW A;  1ULP A;  2J1R A;  5LA0 A;  3T0B A;  1US2 A;  1SG3 A;  2J22 A;  5A1A A;  1W9T A;  3JXS A;  4P5Y A;  1MPX A;  1KEX A;  3C7H A;  4P08 A;  3C7E A;  2VC9 A;  4CU6 A;  3VD7 A;  1NAE A;  3U37 A;  2L9L A;  2WQ8 A;  4L0P A;  3CMG A;  3HN3 A;  3SEE A;  4DEQ A;  5F7U A;  3UES A;  4UAP A;  3EYP A;  4A41 A;  3WSO A;  3A7Q A;  3WNP A;  1JU3 A;  3OG2 A;  2E26 A;  1UYZ A;  5JXH A;  2VZT A;  4RYD A;  4CU8 A;  2X05 A;  1JZ6 A;  2Y6L A;  2JD9 A;  1PX4 A;  3WNN A;  1JYX A;  2HYX A;  4ZY9 A;  1IQD C;  5LCW L;  5JMO A;  2BGO A;  5G04 L;  2WYS A;  3CKH A;  4XZU G;  2W9X A;  2YC2 A;  1UX7 A;  3T2O A;  4BDV B;  1W0N A;  5B4X A;  1GNY A;  3NJV A;  1LNS A;  3I2G A;  4PT6 A;  2W95 A;  3C8X A;  5JUV A;  2W1U A;  5CYY A;  3SKJ E;  1XC6 A;  3FHA A;  3LPF A;  4IUG A;  3ABZ A;  3FHQ A;  1DYO A;  4UI9 L;  3OEA A;  3THD A;  3T0D A;  1JHJ A;  3ACH A;  4PQQ A;  1UY0 A;  3HPN A;  1EUU A;  5FUI A;  4BJ0 A;  2ORX A;  4XVH A;  3PUH A;  4OMD A;  3IAQ A;  3OGV A;  4ZXE A;  2EID A;  2YFU A;  3K4A A;  3EB7 A;  2VL4 A;  1OF3 A;  3HNY M;  5DPN A;  1BHG A;  4JHZ A;  3AC0 A;  2C9K A;  4QB1 A;  3DYO A;  3VD9 A;  4QB6 A;  4TXW A;  3FN9 A;  2WO2 A;  1PX3 A;  1K3I A;  2V5D A;  2VZO A;  3A22 A;  5EJ1 B;  1O8S A;  2V72 A;  1XNA A;  4MO3 M;  2B4K A;  2W46 A;  5IJR A;  3LQC A;  1JU4 A;  1US3 A;  4XUQ A;  4OZO A;  2QQO A;  2QQN A;  2DCJ A;  2YFZ A;  3FL7 A;  3CZU A;  4OMC A;  4CUC A;  5EIY B;  1OT5 A;  3HNB M;  3ACF A;  5IFP A;  3LPG A;  2VCB A;  2QQJ A;  1UMH A;  2ORZ A;  2W47 A;  2W5F A;  1GOH A;  3HEI A;  3WF2 A;  4JKM A;  1JZ5 A;  4QDQ A;  3WNO A;  4BXS V;  2E33 A;  1JZ2 A;  2R7E B;  3A23 A;  4AAX A;  3I2I A;  2E31 A;  1WKY A;  1W8O A;  2Y64 A;  1L7Q A;  1JZ7 A;  3UET A;  5C71 A;  4CUB A;  1UXX X;  1J84 A;  1KGY A;  4JX0 A;  4MGS A;  4LPL A;  1XPW A;  3CIH A;  4D8M A;  3P6B A;  1OD3 A;  3OGR A;  4A4A A;  3GGL A;  3I2H A;  2VZQ A;  2QQL A;  3SEP A;  5HPO A;  2QBX A;  3C7O A;  4DUV A;  4Z2A A;  2W91 A;  1GUI A;  3K46 A;  1UY1 A;  2VZ3 A;  3DEC A;  4GWJ A;  3SKV A;  1JZ3 A;  1PMJ X;  2J7M A;  4A6O A;  1NX9 A;  3NQH A;  3I2J A;  3MBW A;  1UY3 A;  2BER A;  1UMI A;  2W1W A;  2VJX A;  2X09 A;  2YC4 A;  1WCQ A;  1NKG A;  4XUP A;  3I3B A;  2RJ2 A;  1UY2 A;  1DP0 A;  1JZ4 A;  2XQX A;  2W3J A;  3WF1 A;  4MAD A;  2VO5 A;  1P8J A;  3WEZ A;  2WDB A;  2YB7 A;  3W5M A;  4UOJ A;  4CVU A;  2WAB A;  4YPJ A;  3LE0 A;  4A3Z A;  2XOM A;  3ETP A;  1UY4 A;  3THC A;  4XUT A;  1YQ2 A;  2DDU A;  1JI6 A;  3OBA A;  2VOT A;  2Z4F A;  1R64 A;  3BN6 A;  1K42 A;  5EJZ B;  2VM9 A;  3GDB A;  1GOG A;  1HN1 A;  2YG0 A;  4P02 B;  1O8P A;  3C7F A;  3NJX A;  2B9V A;  2QQK A;  2QQI A;  4E8D A;  2VZ1 A;  2WO1 A;  5JXI A;  2WZE A;  4QAW A;  4XUR A;  3NNG A;  2WZ8 A;  2WAA A;  3MV0 1;  3T09 A;  5J1X A;  1CZS A;  5C7G A;  4M4P A;  3DYM A;  4QX0 A;  1UYY A;  2Y6K A;  3I97 A;  4DUX A;  4A45 A;  4CUA A;  3HOB A;  2J1A A;  1SDD B;  4ZZ5 A;  1J83 A;  1L7R A;  2BBA A;  1D7P M;  4XUO A;  5DN2 A;  4D0Q A;  5I0D A;  3VDA A;  3ACI A;  5CZK A;  3VD4 A;  4W4Z A;  4KI5 M;  3K75 B;  2VME A;  2X10 A;  1TG7 A;  2CDO A;  1GU3 A;  4ZZ8 A;  2Y6J A;  1XNT A;  1T2X A;  2HLE A;  2C4X A;  4QX1 A;  2VZP A;  3T2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...