2Y6HA

X-2 l110f cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6hA00
1L7QA 2RV9A 2Y6JA 3CQOA 2KD7A 3C7HA 3ZM8A 4D8MA 1UY3A 4BDVB 2W9XA 4YPJA 3NJVA 2WAOA 3GDBA 3IDAA 1OH4A 4XUPA 3ETPA 4TTGA 4P02B 3MUY1 2QQLA 3T09A 5JXHA 4AAXA 1PMJX 2EIEA 3T0BA 3LEIA 4OMCA 4A3ZA 3JXSA 3OGSA 1NAEA 2DDUA 4QAWA 4BK4A 3I97A 2EIDA 1PX3A 1K12A 3WF0A 2C26A 4JKMA 4CU7A 1UZ0A 1UY4A 4TXWA 1GU3A 1OT5A 2WZEA 2VTFA 1UYXA 1OF3A 3C7OA 3I2GA 4DUXA 3OGRA 1D7PM 1H6XA 2BBAA 3BN6A 3THCA 1LNSA 4ZY9A 1JZ8A 5DPNA 4KMQA 4QX1A 5JUVA 2ORXA 5LCWL 1NKGA 1JZ6A 2C4XA 2VZSA 1JYXA 1JHJA 3DECA 1O8PA 4A4AA 1UY2A 3T08A 1GMMA 4CU9A 2VZOA 5IFTA 3VD4A 1R64A 3DYPA 2VR4A 4MO3M 4MOAA 3CMGA 4ARYA 2QQOA 5IFPA 2V72A 2W1QA 1GQPA 1JZ5A 3J7HA 2QQNA 2V4VA 4OYUA 4AG4A 3UNPA 3NJXA 4MGQA 4UOJA 2E26A 2X09A 4LKSA 3K46A 1JZ2A 2WAAA 1K3IA 2DCKA 4OZOA 5JR2A 1J84A 1US3A 3MBWA 4QB1A 2WQ8A 3C7FA 3SEEA 2L9LA 2WO2A 4LPLA 1O59A 2ZEZA 2B9VA 1L7RA 2WYSA 2V5DA 4GZ9A 4ARXA 3FHQA 4RYDA 1CZVA 2JE8A 2VJXA 3W5MA 4XURA 2W91A 2Y64A 2W1SA 2ORZA 2VC9A 4XUOA 5HXMA 1XNAA 4MGSA 3IAQA 3P6BA 4QDQA 2W46A 2Z4FA 2EICA 2W95A 1SHWB 3VD7A 1UY1A 3CZUA 3I3EA 2BGPA 3OEAA 2ZXQA 2QQMA 3WQBA 5JMOA 2HLEA 2W1UA 1IQDC 4DXRA 4L0PA 1YQ2A 2J1RA 5EIYB 4UI9L 2VOTA 3CDZB 2VO5A 3LQCA 1JYNA 2QBXA 3LEGA 1XPWA 2WZ8A 2YC2A 4A41A 1H6YA 2LW8A 2DCJA 1ULOA 2W5FA 3IB3A 3ACIA 2OKXA 2VZTA 5CYYA 3HOBA 3A23A 3EYPA 3ACHA 1CZTA 3VD9A 5C70A 1GUIA 1EUTA 4QDRA 1EUUA 2XOMA 4FI9A 4M4RA 4DXTA 3CZJA 3WF3A 2B4KA 2ZEYA 3D3AA 3HJRA 4W4ZA 2QQKA 2J1TA 1T2XA 1PMHX 1UMHA 3U37A 2YC4A 2LS6A 4D0QA 4QPWA 2YFUA 4QX3A 1W9WA 3LE0A 4XZUG 4OMDA 2BGOA 3VDCA 2WUHA 2JD9A 1O8SA 4CVUA 2YFZA 4PT6A 3FL7A 2HYXA 4XUTA 1NUKA 1OF4A 2XONA 3K77A 1W8OA 1K42A 2VZ1A 1JYWA 3CIHA 4QB6A 3C7GA 3HNYM 4E8CA 3GGLA 3WNOA 3ECQA 1TG7A 1UWWA 4DUWA 3IIIA 3DYOA 1W0NA 2XHNA 3ACGA 1HN1A 4QX0A 2ZEXA 2VZQA 2WDBA 2R7EB 1UX7A 2WBKA 3HPNA 2VZPA 3BGAA 1I5PA 4W8JA 1XC6A 2WO1A 2WO3A 3MUZ1 3MV01 2VCAA 3UESA 2J22A 2QQJA 3T2PA 5C71A 3VD5A 2VMEA 1WKYA 3WF2A 1CZSA 2VCCA 5B4XA 3I3BA 1CIYA 3OEBA 4JKLA 2Y6LA 4JKKA 3EB7A 1SG3A 4A45A 5JXJA 2E31A 4ZXEA 5J1XA 2W1WA 3WNNA 3VD3A 3NRUA 3GXUA 4GWJA 2VZUA 1MPXA 2VZRA 2Y6KA 4MADA 4UAPA 3IAPA 4P5YA 3I2FA 3T2QA 2YG0A 2W87A 3VDAA 2VMCA 3A22A 1JZ7A 4PQQA 1UMIA 3WEZA 5IYYA 5LA1A 1OD3A 3P1IA 1PX4A 5JXGA 2J7MA 1XNTA 2WN3A 2XQXA 3MO4A 5FUIA 2BZDA 2WABA 2E32A 4KI5M 4BJ0A 4DEVA 5EJZB 2ZEWA 5I0DA 4CU6A 1W8NA 3LEKA 4QB2A 3NNGA 1JU4A 4CUAA 3C8XA 2W3JA 3AC0A 2J1UA 3OB8A 4QDSA 1J83A 3CKHA 3LPGA 5F7UA 5HPOA 1CX1A 3F2ZA 1JI6A 1RYYA 3WNMA 4XVHA 1UY0A 3WF1A 4DXSA 3WNKA 3VDBA 2Y8KA 2VZVA 4DEQA 5JXIA 3HNMA 4CUCA 2W94A 3DYMA 4PF1A 4CU8A 4GWIA 1P8JA 1ULPA 2J1SA 2W92A 5DMYA 2Y6GA 3ABZA 3WNLA 5LA0A 4A6OA 2WN2A 3A7QA 3GM8A 2J1AA 1W9TA 3WF4A 5EJ1B 4ET7A 3K4ZA 4M4PA 3PUHA 3MV11 4P00B 4JHZA 2X10A 2QQIA 3K75B 1DP0A 3UETA 2W47A 4ZZ5A 4IUGA 2VM9A 1JZ3A 4A42A 5DN2A 3T0DA 2VQUA 2VZ3A 3SKVA 3I2HA 5C7GA 4ZZ8A 2BERA 1JZ4A 5DQ0A 1GOFA 3I2JA 2VQTA 3SKJE 2EIBA 4XUQA 1SDDB 3E1F1 4Z2AA 1F4AA 1BHGA 1TVGA 1KEXA 2J1EA 2J1VA 1UXZA 5G04L 2JDAA 4BK5A 1UYZA 5IJRA 3I3DA 2RVAA 4E8DA 5IHRA 2VCBA 4HG6B 1JYVA 3C7EA 3FHAA 4JX0A 2CDOA 4CUBA 4W50A 3LPFA 3FN9A 1US2A 5LA2A 5B4NA 1NX9A 3I2IA 1JU3A 3WNPA 2C9KA 1F4HA 4LQRA 4KWUA 2VMDA 4QX2A 1GNYA 1WCQA 3OBAA 4LHSA 2JKXA 1KGYA 1UXXX 2E33A 3OGVA 2ID4A 5CZKA 4A44A 1K45A 5A1AA 3A21A 3W5NA 4DUVA 2VL4A 4RN5A 3T0AA 3WSOA 2PQSA 1UYYA 2VMFA 4XUNA 1GOGA 3HN3A 3ACFA 3HEIA 2X05A 5G05L 1W99A 3PUIA 3T2OA 1DLCA 2RJ2A 2Y6HA 3K4DA 2YB7A 3HNBM 3NQHA 1GOHA 3SEPA 2CDPA 3OG2A 4OUEA 4P08A 4BXSV 1W9SA 3I2KA 3THDA 3K4AA 1DYOA
chains in the Genus database with same CATH superfamily
2IC1A 3I2DA 1RC6A 2RV9A 2AACA 1VPHA 2GMMA 5D21A 4D8MA 1SCSA 2D98A 5EWSA 5IVYA 4B7KA 5ACA3 3NJVA 1V6KA 4CRQA 1WD3A 3LFMA 1UOJA 2IZWA 2WAOA 3GDBA 4NE9A 4F83A 1XOYA 5LW9A 3O7OA 1VBB1 4QXHA 4FP2A 3O1UA 1OH4A 3UK9A 4AXOA 4NUBA 4XUPA 2DVGA 5BNNC 1IPKA 4IEYA 5BNNB 5JLVA 3P5BA 4RR3C 3ILRA 1BJQA 3PMSA 2VVEA 4RR3B 3VBRC 3V0BA 1LGBA 3BOPA 2D3PA 3LEIA 4WZFA 5H9PA 1MS8A 2GH8A 4A3ZA 3AP4A 4LO8A 1NAEA 3N7JA 2XUMA 2WO7A 2XWBB 3T1LA 1IKQA 1KFXL 2DUPA 2EIDA 4YM0A 1HQLA 3ON7A 2HWC1 2RMU3 3QBQA 4TLGA 3RRDA 1IQAA 3TRSB 1HJGA 5T5JA 4CU7A 1BCXA 1OXCA 4I30A 4MZUA 4F7ZA 2OPWA 3ACLA 1GR3A 1RUH1 1SPPB 4R4ZA 5KXEA 1ZBE3 1UYXA 3D0JA 1RUI2 1W0PA 2AEZA 3I2GA 2BOJA 4IETA 3OGRA 1W2TA 4MUVA 4HONA 2BBAA 3BN6A 1QXPA 2GNBA 4LBMA 4Y5SA 2WS91 3MIEA 3THCA 1LNSA 3RZZA 1RJ7A 1AYN2 3QOPA 4QX7A 1D4VB 5D8AC 1BMV2 5D8AB 5CFCA 5JI7A 4I2OA 1U0AA 3ZMNA 4QX5A 4E4HA 5JUVA 4FTSA 5A3LA 3ZX7A 5T50A 4R4XA 3S7IA 5FY5A 1O8PA 1GMMA 2P6CA 4IXLA 1GZWA 1R1A2 2NPIA 4Q5OA 1EPWA 1R64A 1VMJA 4W6YA 2VR4A 1OOPA 4L97A 3M8LA 5SV5A 4Q1RA 5IFPA 3TN92 2W1QA 4OULA 4QQHA 1OH3A 2V4VA 2ZMKA 4DOUA 3AKTA 1Q5OA 3FFQA 4MVTA 4UT5A 4LBNA 4MGQA 3WHTA 2ZZJA 3S0MA 2GNMA 3H3UA 4Q4Y2 1VBA3 3LA3A 1UD1A 3WUDA 4LKSA 1Z7S1 4QKDA 3K46A 3VKOA 4CTEA 2WAAA 5D1IA 4QKFA 4W65A 3UYJA 5JR2A 4NRPA 3ZXKA 3MBWA 4PIXA 4B4QA 4LPLA 4QQOA 1AJOA 4HKOA 4V2WA 1R081 1XSQA 4QT6A 2EA7A 5FYYA 1YI9A 1QJEA 1OLMA 4NVPA 4AQ6A 5TSWA 3NAPC 4OI4A 1S0JA 3NAPB 1REDA 3RZGA 1SBDA 1RUJ1 1CZVA 1HIXA 2QQWA 5GM0A 1R092 2HKXA 2YGMA 3N35A 3UJOA 1QU0A 2W1SA 4AYUA 5FY7A 1W8ZA 2BVVA 3K51A 3ZVXA 5KWRA 4EN8B 2R062 4JGZA 1XSRA 5GZFA 4QDQA 4LUMA 3SNMA 2ZTNA 1D4M3 1WW4A 1GBGA 1RITA 4XW3A 3CNAA 3KLSA 3ZXEA 3H8XA 1UY1A 3CZUA 3I3EA 4B1MA 4MGTA 1YUDA 3RJRA 3ST7A 4HZFA 2RM22 2QQMA 4CYDA 1ZZ6A 5JMOA 1SCRA 2HWE2 4HANA 4Y24A 1K5MC 5FZ9A 2RJLA 5FYZA 1ENSA 1K5MB 5CKNA 3L2YA 4L0PA 2YY1A 4COYA 3J7LA 4NWWA 5EFUA 3BU7A 4QPIC 2JB8A 4AFDA 5KC5A 1FMD1 2VOTA 3EO6A 2BU9A 4NMIA 2XB6C 3ES1A 1W6OA 4QPIB 1S2KA 1H1IA 2EAKA 4JQRA 5DDJ2 5A7WA 5LRSA 1QQP3 2YYOA 4FO9A 4A41A 1QJY2 1QNYA 1COV1 2XBO2 4RHV2 5ANNA 2G19A 2OS2A 4AEKA 4BCUA 4XYXA 1VBC3 1Z78A 2DV9A 5KXBA 1QH6A 3IB3A 1FYUA 4IEZA 4RS5A 3ZSJA 1EYBA 2XVGA 2IXLA 4N7IA 4LE3A 4RQPA 5CYYA 5FYHA 3KT7A 3T3YA 3A23A 3NKGA 2FMYA 1MZ5A 1W9YA 2PAEA 2ZX0A 3SQOA 2Y33A 5AFEA 1AHSA 2OYZA 1YFUA 5KBFA 1HRI1 1EUUA 1MEC2 3DCQA 3E6BA 5FZ0A 1SLTA 2VQ0A 4M4RA 3UL2A 3T1MA 4CEWA 4FOYA 3SLIA 1UZVA 3RZJA 5FO9B 4FPOB 2XLFA 5FZ6A 1QNWA 3N9QA 2XGXA 4UF0B 1T2XA 1HXS3 4K40A 1HQWA 1PMHX 3MFCA 4UFHA 1NLSA 1XU1A 3OUJA 3ZIWA 4R52A 5LK7B 2ZGRA 2WZPP 2PXJA 3KS7A 2PLV2 3LA2A 2BGOA 2WUHA 2JD9A 4ISRA 1CAVB 1O8SA 4CVUA 1ULEA 5KHKA 5HV0A 3VKNA 1ACCA 2R073 4GMP1 1OF4A 2YBSA 3MF9A 3EHKA 3MIFA 4N8MA 2P5BA 2WSUA 3H1YA 1NLQA 5HV4A 4URAA 1W04A 4ASLA 1D0GA 2Y0OA 2VOWA 4J1WA 5A3PA 3CIHA 5E16A 4NIDA 1GNHA 4BM8A 1HB3A 1MZ6A 1V9U3 3PU8A 2YU1A 4FCAA 4E8CA 5FXXA 5CA6A 4Q4X1 3VDDC 3ZDSA 3GGLA 1UWWA 3VDDB 2F4LA 3MDPA 3ZSKA 3RGBA 2GC1A 4K8FA 1HKDA 1O5UA 4XJ8A 3TEXA 2EXKA 4YG6A 3ZSMA 1A34A 1W8WA 3WHUA 3JBG2 4QX0A 5A3NA 4BQ5A 1SBFA 2EXIA 5JVVA 3ZMOA 4AHXA 3IDEA 3K3OA 2VG9A 3TWIA 5JOYA 3J9SA 4RA0A 1LU2A 1OUXA 1RXFA 1XC6A 2A3YA 2HWB1 3TBDA 1OMIA 3MV01 2J22A 3ELNA 3VZOA 2D6NA 3HBZA 5K8SA 2VBBA 2VMEA 4E4ZA 5FOJB 3WF2A 1H9WA 4BPZA 2UY8A 1ODMA 4XF4A 4WVMA 3WQ0A 2ZHLA 4XE9A 1RUF1 3OEBA 5F6LB 1RB8G 3M3QA 4JKLA 4A7ZA 4F8AA 2BBVA 5FDBA 2Y6LA 1W6MA 1W90A 4LBQD 3MI8A 2FCTA 4CEYA 4OQ8A 1LEDA 3J8F3 4GKYA 4EN9B 4P9YA 3MIBA 1BZWA 5A6YA 3B9CA 4AEDC 2W1WA 5J1XA 4AEDB 3P3PA 3I49A 2DTYA 3GCXA 1WW7A 4GIQA 2P2KA 4IE5A 3O12A 4KU8A 4LO4B 3KZ4C 2HH9A 1HV1A 5GZDA 1AR71 2VMGA 1MPXA 2VZUA 2BJSA 2DTWA 2X5IA 3B02A 3IDBB 4MADA 1PZ8A 2HEWF 4KWLA 3KHBA 4QPGA 4UAPA 4XTMA 2P3IA 3A0NA 3WDWA 3H1MA 1S55A 5IVEA 2W52A 2FCVA 4Y1XA 1F2NA 1QJZA 1VAMA 2GALA 3VLBB 2JDYA 3ES4A 4S2DA 1HB2A 1U5XA 1FX5A 5EP9A 3GBWA 2P34A 1PIV3 3I54A 2JX9A 2JEMA 4AVAA 5IYYA 3PUAA 4YW3A 1AR63 4AFCA 4XIOA 4ZPIA 3USSA 1S2BA 1VBD2 2J7MA 3U07A 5A32B 4M01A 2GMPA 4I0AA 2OQ6A 2PHDA 4BLJA 3SH5A 4XF3A 3B5LB 3N3HA 2ATFA 2WABA 4AFBA 4NIGA 3M1HA 5A33B 5FPVA 1RMU2 2E32A 5L7OC 1LHUA 1RUG3 5L7OB 3LDKA 1VRH1 3H7YA 4P9JA 1TMF3 4TWTA 2HWF3 5EJZB 4CU6A 1AR81 2JG9A 1AX2A 1NY72 1ND2A 1REFA 4YZ1A 1DF0A 5BXXA 1V6OA 1O4YA 1G86A 3JD73 3NNFA 5BNNA 1UIJA 1Y4WA 3H7JA 3QACA 2D6MA 2P17A 5JIAA 3VBRA 3AC0A 4AHYA 1W8TA 5F7UA 3NWKA 2PHWA 1YIFA 4XJ9A 4Z07A 1CX1A 2D3RA 1DHKB 1RYYA 4XJAA 4YZ5A 1DLLA 2D97A 1WBLA 1XYNA 4CCKA 1HW5A 1ZYBA 2WNEA 1DZRA 3NJYA 1SLLA 2GDFA 4YZ4A 1HX6A 4CXXA 4DINB 3AP6A 5JXIA 2ES3A 4E2QA 1F5JA 1OI6A 4XAEA 5F39A 1OQEA 1I1EA 1PGL1 2TEPA 3DYMA 4K20A 3DEMA 4PF1A 3N9PA 5DUUA 1P8JA 4Y1VA 3V0BB 1OD5A 5C9AA 4XF9A 2Q0AA 2IXJA 2O14A 4UXAA 1ZBA2 5IUQA 1DQ2A 1SZBA 2WC2A 5JOWA 3OYWA 3KCYA 3KF5A 3VHNA 3CU7A 3GM8A 4C1WA 4CCJA 1AXYA 1W9TA 5EJ1B 1GQHA 1C1FA 3AYEA 1MS3A 3B3QE 3FZ3A 3VN4A 4P00B 3GHMA 3CLPA 3D6EA 2WFF3 4ES9A 2DUQA 3PU3A 5IAXA 4IEQA 3NL1A 2IFRA 3K75B 4XPVA 4YRDA 1CJDA 5GALA 1AYM3 1JYCA 2D40A 5LY2A 3CEWA 4IUGA 3SISA 1JZ3A 1XJAA 4LR4A 3MLJA 1LOEA 4DY5A 2NQYA 2VZ3A 2VQUA 5M0TA 3L9JT 5IVFA 4KL1A 2K0GA 5C7GA 4ZZ8A 3N36A 5CFCC 5IATA 4YFWA 5CFCB 2MEV3 5BY5A 5DQ0A 2Q8CA 5B2GB 3KM5A 2RS51 4HBNA 1CJPA 5ERLA 2YC0A 5FYTA 2EIBA 4OQ9A 4Z2AA 4LO7A 3ZXLA 4H7MA 2C6SA 3MPBA 5C8WA 5FMDA 2J1EA 4JQTA 1BEV3 1GZWB 1UXZA 1AR92 1KXGA 2QVSB 2WJSA 3U14A 1OOPC 5F2SA 2ZX2A 2RVAA 1OOPB 4UFLA 4W6XA 1N3OA 1BBT3 2CV6A 1DCSA 4XFHA 4CP1A 3FHAA 4M0NA 4BQ1A 5FZ3A 4F3JA 2Z5WA 4W50A 3AZZA 4K7JA 2YBKA 3IMNA 5ACA1 1RUNA 4BU2A 1HN0A 5JSOA 4WVZA 3SXWA 3KQRA 3FWEA 4YFZA 5A7SA 1NZIA 4UFKA 1NG0A 2OIIA 4UW4A 4DY3A 4KBBA 1PVC3 2C9AA 4IL7A 1NZCA 4D7YA 4IEWA 1FOD2 1G7YA 1JU3A 1WCUA 1MS4A 2Q1FA 1X82A 4KWUA 4COUA 1FPN2 4DNYA 2VMDA 3OBAA 4LHSA 2VVFA 3RZKA 1KGYA 4C8DA 3M3CA 4U36A 1YQ5A 5CZKA 4MH0E 2RMU1 4HT1T 1TME3 3O1PA 1AL23 5FPBA 4JVAA 1CWPA 4KGGA 4PDWA 2YHJA 2DYCA 3OF1A 4JGZC 3IWZA 4AGRA 4XQWA 4JGZB 3ZYIB 5FPAA 1S0DA 3SCGA 3R05A 3ACFA 3ZYBA 3S5AA 1Q8SA 3PJYA 3NSTA 3KV9A 1UW8A 1JTZX 4LK6A 5G05L 3PLQA 2R042 1ULGA 1OA2A 1PO12 1RHI2 1W99A 4IGOA 4LIUA 4MGIE 1RVF1 3T2OA 2WT0A 3KT4A 5H9RA 3WUCA 2Y6HA 4AZZA 2E9QA 5T5PA 1A6CA 2OPKA 3NQHA 3HT1A 5F5CA 2BWAA 3OUHA 1UNBA 4LBLA 4XETA 3OG2A 4OUEA 3KVBA 1Q8VA 1ZM1A 1V6JA 3U10A 3VB9A 3HR9A 5J37A 2ARAA 2PHLA 4LTAA 5KHGA 5ABJA 2IUWA 1W6OB 5T52A 5CG8A 5A7WB 2DU1A 2GSYA 3JCIA 1KDKA 1L7QA 1GICA 1OA4A 1HRV3 1YI7A 3CQOA 3LF7A 4PF5A 4RS5C 3V0AA 2VPVA 4BDVB 4RS5B 4GA9A 2W9XA 2Q30A 1ZRCA 1NE6A 2BGCA 2Y60A 4RQPC 4OHVA 2DVFA 1VBA1 4RQPB 2R0FA 3LAGA 4LO6B 3JB4C 4PJYA 4MGZE 1RINA 1ZZCA 5CVRA 5DUXA 4TTGA 4EZHA 2CSGA 2FDKA 2ZMLA 3WINE 3K2OA 2HBUA 4AE2A 4HOOA 1UOBA 5FPZA 4AAXA 4AVSA 2Z79A 1MQTA 3ZYPA 4OMCA 1JUIA 4Q2FA 3RMXA 4CEWC 4DRRA 4CCMA 2ET1A 4CEWB 4FPCA 1JYIA 2NLRA 1CD3G 2DDUA 3DV8A 1YO8A 3E5UA 3I4IA 3I97A 4NR1A 4BK4A 3OY8A 3C3VA 1S0IA 5E88A 1PX3A 5HCAA 1FV3A 3WDXA 2C26A 3MHZA 4YM2A 3WW1A 4UWDA 1AXZA 2ERFA 1VRBA 1CIWA 3IMMA 5F5IA 2G1MA 4K8RB 3UT0A 1UZ0A 1IS6A 1JOPA 1NT0A 4TXWA 3C2UA 3N7KA 5SV8A 1X7NA 3ZDVA 2FDIA 3ZXGA 5FWEA 4DUXA 2P3KA 3C7OA 5IK8A 3WCRA 1D4M1 4Q26A 1KS5A 4HK8A 2OUJA 5C6CA 1H6XA 1XE7A 1C28A 1FT9A 3B7MA 1A8MA 3MW4A 5FO8B 4W6WA 4MYEA 5DPNA 1FMD2 1RUI3 4FBFA 1YC61 1YJLA 2XLGA 2BDRA 4IGPA 2EF6A 2C4XA 3M7AA 2JD4A 1FXZA 2MHFA 3DECA 4Y5Z0 2E53A 2HEVF 4CU9A 1AYN3 4C90A 3AKSA 1K5JA 2H0BA 3Q8AA 2VBDA 1QQP1 4RSUA 3CMGA 4YW4A 4PQ9A 1JUHA 5A7PA 2V72A 1VBC1 2RDQA 3OPWA 3J7HA 3LA7A 2Y38A 4CDQA 2QQNA 1R1A3 4JTNA 4LIVA 4QMAA 3H8UA 3UNPA 1YQCA 1QEXA 3ALQA 3AX4A 3NJXA 1HRI2 5FCCA 2QDRA 1ULDA 1LHWA 3UGFA 1ZZ7A 2WA4A 5F6KA 4GKXA 4ASKA 3TN93 5A6XA 1MACA 1US3A 3NVCA 4QB1A 2Q1ZB 3C7FA 5FXVA 2WZR2 1XE8A 4WVMB 2DCTA 1O59A 5A70A 3PUQA 5FREA 2DVDA 4OHZA 4Q4Y3 2B9VA 3RWNA 1WMEA 3G6JB 4CEYC 4FAHA 1W6MB 2ADDA 2D43A 2WYSA 3WDYA 4CEYB 4ARXA 1X33A 4ASMB 4G9SB 3ZKYA 1I5ZA 1HXS1 4M00A 4RYDA 1W06A 1Q8OA 3JQXA 5F3CA 1AF9A 4MG2A 4OFGA 4OI0A 2ORZA 2XJUA 3FJSA 2RS32 2VC9A 4XUOA 1H8TA 4Q4V2 4GXLA 1OC1A 4Y1ZA 1OLME 2KXLA 3M2MA 3W9AA 5HXMA 5FLJA 1DZQA 2X5IC 3DGTA 4QPGC 1VBE2 4I02A 2X5IB 3GJBA 4QPGB 5EYYA 5ISLA 1EV12 2Z4FA 4PI2A 4DFSA 3RI9A 2EICA 1OFNA 1R093 4G4FA 1EY2A 2W95A 1SHWB 2VUDA 3WP6A 1E5SA 3KSCA 3WG3A 2OX0A 2FDJA 1UKRA 2F4PA 5FP7A 1KDMA 1XNKA 2R063 2YGLA 4CSWA 2VUCA 1X9PA 1S1AA 4LNVA 2RS12 4DXRA 2ZKNA 1GNZA 3POSA 3NO8A 5GLZA 3ZN4A 4U2AA 1V9U1 5EIYB 3HQUA 4N9IA 4XBNA 1UL9A 4YM1A 2VXRA 4UI9L 2RM23 3HN1A 3PDQA 1H4GA 5C33A 4RGGA 2HWE3 3N9OA 2VXJA 4EN0A 1O3RA 3AKQA 1XPWA 2A75A 1Q3EA 4HPKA 4XILA 4I0WB 4XHXA 4GB31 3ZSEA 2DCJA 5KHJA 3GZTB 1LGNA 4NO4A 3BI3A 2JG9C 2VAUA 4LO5B 1ND2C 1UOGA 2JG9B 2RR11 4UW5A 5DDJ3 1ND2B 5DAWA 1RUF2 4K21A 2P37A 2V5YA 1QJY3 2XBO3 3TYJA 3EYPA 4JV4A 2HWD2 3TNPB 5FYVA 5GZGA 1GSLA 3VD9A 2WINB 4IE7A 3UGGA 3VBRB 2BVBA 3VKLA 5A1FA 1EUTA 4QDRA 5K7PA 3WD5A 1QF3A 2XOMA 1CESA 1VMHA 2WT2A 3GALA 4Q29A 3X29B 5FPXA 1Y43B 1WD4A 3GF6A 2B4KA 2ZEYA 3D3AA 3N9LA 2SLIA 1IPSA 3HJRA 3J8F1 5F32A 3ZR5A 4FAGA 2W2IA 4LLFA 5CBLA 3ME2A 1O3SA 1XXNA 2VH9A 3TAYA 4XC9A 1OPOA 2AH2A 1YFYA 2YC4A 3S6PA 3I3MA 1ASJ2 4B29A 1MEC3 1ZRIA 5FP9A 4YW6A 2YFUA 4QX3A 5C9AC 2DVBA 5C71A 5C9AB 2OT7A 1G9FA 2V09A 2VW1A 5FZHA 1PGW2 3ILFA 3VDCA 3FLTA 5F3GA 2B42B 1Y7BA 1V6NA 3OYWB 2ZCWA 3BYWA 3PVEA 2DU0A 1JH5A 2HYKA 4AI0A 2HYXA 2DCYA 3O1MA 1E57A 2XL9A 1ZZBA 1LOGA 2PLV3 4YZ2A 3SH4A 4QM9A 3K77A 4BQ4A 2XDVA 1PIV1 1WLTA 2TNFA 1LJ7A 2ZGUA 2GN3A 3ITQA 1RUE2 2FBEA 1AR61 2A73B 1VE0A 3HNYM 1QJU2 3ZYGA 4NIHA 5DUWA 1ZZ9A 1TG7A 4LXLA 2P4EA 3H9AA 1RXGA 1PGSA 4QGMA 3IIIA 4QQ2A 1CR7A 4XMIA 3LIGA 5JSPA 1W0NA 4IDZA 3ZFFA 1Y3TA 2GC0A 1HN1A 1W2UA 1XYPA 4HN0A 4M3CA 2XQRA 3WXPA 4YNIA 1MZFA 1NA1A 2R7EB 1LEMA 4RD7A 4BMBA 4UW6A 4OHXA 4MXWA 3HPNA 1RUG1 5KC6A 1OLRA 1TMF1 1DU3D 2HWF1 2PTMA 1PM7A 4AI8A 2Q8OA 2WO3A 2JDZA 1LGCA 3JBG3 3UESA 3WOGA 4YG3A 3T2PA 1W8HA 3JD71 4AQSA 1PNGA 4BXFA 2A3XA 3VD5A 4I01A 3BVCA 2JDHA 2ZGTA 3PURA 3N7MA 5FZ7A 4DXZA 1UU6A 3HAGA 1VAVA 2VCCA 2JDPA 3FHIB 3MZHA 2OVUA 3RZMA 4XCBA 1GZCA 2E7TA 2Y26A 1RL3A 2V4AA 3KCXA 4JKKA 2CWSA 4OLLA 4UFMA 4YWAA 3NNMA 1SG3A 4X6QB 5LBBA 4BH9A 2E31A 4A7YA 1U5ZA 4P9LA 1Q8QA 2VW0A 4Q0UA 4L2NA 2AEYA 3AP7A 3TNQA 5K0UA 2ZZQA 5LA9A 1MS0A 3OTFA 5E8AA 3VD3A 3NRUA 4JRAA 4OCTA 4J25A 2CGOA 3R4SA 5CISA 1SBEA 3M3IA 4B3NA 3VDBA 4CCLA 1W03A 4P5YA 3AFGA 1ZRDA 3GYDA 4KG0A 1S0BA 2PHXA 5FXZA 1DQ5A 3U78A 3GHNA 4LLOA 5A7QA 4PDWC 3HT2A 4HFSA 4HSLA 2ARBA 1UAIA 3A22A 4IW3A 4PDWB 4S2FA 1F5FA 1JZ7A 4PQQA 4O61A 1V0AA 5FJHA 3R0RA 1G6NA 1AYM1 4NHYA 3AL5A 4NROA 3BIWE 4RL7A 3LWCA 4BE3A 4TYSA 4YLZA 4CDWA 4XEZA 4XQ4A 4TSVA 5FXWA 3MO4A 4IE0A 5AC92 4A3XA 5EYXA 4INDA 1QWRA 1W2AX 3OJBA 1O5LA 2ZGPA 4LOTA 2MEV1 3MEPA 4YW5A 3L2HA 5AVAA 4DEVA 1VBD3 4QHBA 1YIPA 4KWKA 1TQ5A 5I0DA 1ZX5A 4QQLA 1PO22 2C0ZA 5HCBA 3VZJA 5ABJC 1YFWA 5ABJB 1G9DA 1BEV1 3VBHA 2QZ3A 1JHNA 4CUAA 1RUC2 1RMU3 3WT3A 1POV3 3WX5A 1PM4A 1IS3A 2A3WA 1BBT1 3CF6E 5DXDA 5A7NA 5KR7A 2ZBJA 2UWBA 4QDSA 3AVRA 3V0AB 1JI6A 2IFWA 4X8NA 5FY9A 4WM7A 1QMJA 4EJRA 1UY0A 1NCQA 4JDMA 5JR7B 3WF1A 3CHXA 3WNKA 4E2SA 5L9VA 3ZFEA 2VZVA 2CAUA 3J4UH 1PVC1 4DEQA 4CUCA 5BUVA 1GANA 4GH4A 2W94A 4N90A 5ANQA 2BNOA 1O3QA 1MQTC 1X50A 2QTWB 1MQTB 2JG8A 3AP9A 1CPNA 2Y6GA 5LA0A 2ZHKA 3I59A 2WN2A 2W0XA 5J36A 3H8RA 3OY8B 3B69A 2D7FA 1O4ZA 1ALYA 4ZKTB 1W6PA 1S2EA 5FWJA 1TME1 5LB6A 4M4PA 2K2SA 4AR2A 2B8MA 4ET7A 4QHZA 1AL21 1C8M2 4L9BA 5IVJA 1ZBA3 1XU2A 5HBAA 3HQRA 3O14A 4N53A 1KJRA 3NNJA 2X10A 2QQIA 3NV4A 2JE7A 3WG2A 3N9NA 4A6SA 1RVF2 1OUSA 2XJPA 3POBA 4FPYA 4NPMA 1H2KA 2W68A 3F95A 5LRRA 2VM9A 1JODA 1UZWA 2PHUA 4ZZ5A 4XBLA 1QY4A 3UV9A 2E6VA 4A42A 4BHPA 4Q0QA 4CDUA 3T0DA 4BQYA 2SBAA 3KT1A 4UFJA 5FO7B 3D5OA 2XKOA 5FBJA 3U4SA 1Y9QA 2NZ9A 2Z2SB 2OW4A 2CL2A 1RTVA 3TOJA 1GZTA 5I93A 1GOFA 1D2SA 2XKPA 3I2JA 3SKJE 3HBKA 2ZX4A 4CA9A 2FZ2A 3RFRA 2B5HA 4HLTA 4KG8A 4Z1VA 1S0CA 2VGDA 2E7AA 4N9HA 1N3PA 2QDNA 1LKNA 3KV5A 1UYZA 4E8DA 3I3DA 2I07B 3PIGA 1I9RA 1MVQA 1HRV1 1LHNA 1JYVA 5FK8A 3C7EA 1LECA 2K9ZA 2I74A 3KCCA 3LFIA 4JX0A 3VBSC 4CDQC 2XL7A 3VBSB 3LPFA 4CDQB 2LALA 1H30A 1AR93 5DABA 4PIYA 3LB9A 1US2A 5LA2A 4JTOA 5FZIA 1NX9A 3OGGA 4Q4W2 3I2IA 2CTVA 3I2OA 3BTAA 5H9QA 3DKWA 2KA3A 1PMIA 3HQXA 5FYBA 3WNPA 2C9KA 1LOFA 4A7KA 4XXPA 1GP4A 2VCMA 3DL3A 4WZCA 1EAH2 1XNDA 3V56A 5JSRA 3E6DA 1F31A 1OVPA 2K46A 5LEJA 2YPDA 1UXXX 2VVDA 3SC7X 1RUD2 1A78A 1GWKA 1FOD3 3ZYJB 2PFWA 1W8FA 1K45A 2VMIA 4N7UA 1FPN3 3ZPOA 1H8TC 1H8TB 3QH6A 1CVNA 4A2UA 3WSOA 1C5IA 2IWGB 1M06G 1F35A 3T4HB 3WP3A 4Z82A 4KQ7A 5EPAA 2VMFA 4YYOA 4XUNA 2CGPA 2R16A 4X6RB 5EZWA 1TEIA 2X05A 3PMEA 5T3NA 3BIEA 4BISA 1ZVFA 2IVJA 3PUIA 1MS9A 4NIAA 1SLBA 1W3XA 3IBMA 1UYPA 2RJ2A 1F9KA 4R9DA 5E6HA 5LK5A 2VW2A 1OURA 1RUI1 4S2GA 1VJ2A 2YROA 2WWUA 5BNPA 2BV4A 2R043 5I91A 1PO13 1RHI3 4ZONA 4BXSV 1AX1A 1W9SA 2ILMA 3THDA 1AYN1 1ENQA 2DVAA 5BNOA 1XRUA 1GV9A 4HPKB 1XNCA 1LOBA 1WW5A 1QGLA 2Y6JA 5GLVA 3C7HA 5FUPA 4QKNA 3ZM8A 3LZZA 4AI1A 3AMQA 1UY3A 3AYCA 3R4DB 4P9WA 2BFUL 4FSJA 3J26N 3KWVA 4YPJA 1R1A1 1E5IA 4XF0A 3UKNA 2RJKA 2Y0IA 1W05A 1YLLA 5J98B 2VBPA 5A6QA 1IS4A 2O8OA 3IDAA 2Q5TA 4NHXA 1N1YA 5FYIA 1LAJA 3IPVA 2IXCA 3TN91 3ETPA 3PVNA 4OZXA 4P02B 2PHFA 3MUY1 1RUOA 2QQLA 4MXVA 4XDQA 5J3UA 1U5IA 3WW3A 5JXHA 4Y5TA 4YVWA 1PMJX 1JMUB 4EYUA 1R1ZA 2R30A 4Q4Y1 5A3WA 3E5QA 2A71A 4P9GA 5A7OA 1JOJA 5HCFA 4QAWA 1FNZA 4DO0A 2WNVA 2I2SA 3M70A 4LKFA 3POFA 4BIFA 4CXWA 5A6ZA 5F9TA 2UYAA 2BQPA 3USUA 4LBQA 1QJX2 5FPUA 5JWPA 4LA3A 3WF0A 3B9IA 3LD8A 4D3WA 1LTEA 2ARXA 2QCSB 2EIGA 3VZMA 5JOXA 2RHPA 2IXHA 5A80A 2WWSA 3VBUC 2ZGNA 1GU3A 3VBUB 1BXHA 4ISQA 4SLIA 2WZEA 2ZGSA 2WNUA 1R091 2DFBA 5FK7A 4QKBA 5EXOA 4ZU5A 1UOFA 3D0SA 3AZXA 4HVOA 5FZ4A 5T55A 5JI9A 2Z42A 3K3NA 1CAWB 2R061 3FLRA 4ZY9A 1JZ8A 1XE0A 2CGNA 2RDRA 4QX1A 4S2HA 4LBOA 4LBJA 2ZOEB 2WNOA 1OBNA 4E2GA 2B7YA 1Z0HA 4MHRA 1NKGA 4QQPA 4IGQA 2XVKA 4GB32 2NYYA 1JHJA 4NRMA 1L7LA 4B4PA 1UY2A 2RM21 3T08A 4A4AA 2FDHA 4FQZA 2VQAA 2HWE1 5IFTA 3VD4A 1FMD3 3ZFFC 1YRZA 3WG4A 2GN7A 1WLCA 5FY8A 3ZFFB 4BQWA 1C1LA 2RR12 4M3CB 1NA1C 3BPZA 1VBB2 4JAAA 4EN6B 1NA1B 4LA2A 2QQOA 4QX8A 3RYKA 1EPZA 1JZ5A 1GQPA 4MXWB 4K9SA 5FR3A 3AJZA 4AG4A 4L11A 5DZGA 4XFFA 5DDJ1 4UOJA 2BRTA 4Y33A 1QJY1 1WLWA 2XBO1 2X09A 4KU7A 1JZ2A 4XTPA 1C57A 1K3IA 2DCKA 4FVVA 2N7GA 2ADEA 2PQQA 2D44A 5IK7A 1WCSA 2HWC2 2L9LA 4URTA 4XDOA 1S4CA 2D6KA 1POV0 4OI1A 2YU2A 3PUSA 1HRI3 2ZEZA 1L7RA 1VB2A 2JDNA 1A8DA 4ORFA 4GZ9A 4WBBA 3W20A 1AZDA 1RUH2 3FHQA 1KRIA 4FFFA 1VB4A 5FTTC 5FZLA 2Q1MA 1LRHA 2VJXA 2WZR3 3RWKX 4XURA 4C91A 3VZNA 5K0UC 2Y64A 1MEC1 5K0UB 4BQ3A 2AYHA 1STMA 2WR9A 1REEA 2VNGA 3LSEA 2MNGA 2R49A 1FNYA 2D93A 2WS92 4FPJA 4Y26A 3AL6A 4BMEA 1C3HA 1ZBE1 4GQ7A 4MGSA 4IESA 3IAQA 5GLTA 2W46A 1YQ8A 2BNMA 4ONUA 4PBPA 4Q8KA 2AC1A 3VD7A 4MX3A 1H1MA 2RS33 4Q4V3 4XIKA 1UX6A 4LHLA 3T2TA 2BGPA 3I8TA 1OPMA 2PLV1 2ZXQA 3OEAA 4NRQA 4XFIA 5C5TA 1DYKA 3WQBA 1VBE3 2HLEA 4OUMA 3W58A 3BTXA 2W1UA 1EV13 2JDUA 4JC1A 4YW2A 1CX4A 1YQ2A 4IV1C 1UN1A 3JU9A 2FD8A 4IV1B 3RJ2X 4HK9A 3KQ4B 4CDWC 4CDWB 2BYVE 3CDZB 2VO5A 5JDBA 3AMMA 3THPA 1KD7A 2RS13 3POWA 4QU2A 1JYNA 2QBXA 2WSVA 3H3ZA 3LEGA 4CXYA 4M0HA 1Z7S2 3JD72 5BNQA 1GP5A 2LW8A 1M4WA 2VY0A 3KD4A 5GJ6A 5J96B 2W5FA 3ACIA 4XABA 2KM2A 1IZ3A 2WRAA 1R082 2WT1A 2JJ6A 3VBHC 4CPBD 5KXDA 3JBG1 3MF6A 3VBHB 4YARA 5FZMA 1J1TA 3ZLIA 4CDXA 3ACHA 3WR0A 4B7EA 2GNDA 5C70A 1RUJ2 2LROA 4XMAA 1GUIA 3ZFGA 3ZYRA 1YNAA 4HSJA 3BODA 5APAA 5I8YA 3GBGA 3AVSA 4WM7C 3CZJA 5DG2A 4DXTA 1NCQC 4WM7B 3O0XA 1NCQB 2HWD3 2GU9A 1SDWA 5FYCA 3ZFEC 4Z8BA 4YG0A 1IOAA 4W4ZA 2QQKA 2J1TA 4XDPA 3AZWA 3W21A 3ZFEB 3O1RA 5HCHA 4GH4C 4GD4A 1YYNA 3BALA 4GH4B 2LS6A 2UURA 5CEHA 1HV0A 2JG8C 4CCCA 1URXA 4OMDA 2JG8B 3VL8A 4DRVA 3R4UA 3I59B 3MLKA 4NN0A 5C5UA 2P3JA 3SH3A 4ZS2A 1ASJ3 4XBQA 1B35A 2CAVA 4XHBA 3WZ1A 4KNCA 4C0HA 1W6PB 1LCLA 2QE3A 4Y1YA 5CG9A 2A7AA 1NUKA 4YSFA 1TE1B 2XONA 4N53C 1GYKA 5KXCA 2BFUS 4N53B 2WIIB 1W8OA 5CU1A 4LKDA 1K42A 2VZ1A 2YUEA 1JYWA 3C7GA 5FUNA 4DPNA 1COV2 1OHFA 3QCWA 3WNXA 4DUWA 3ECQA 2ZHNA 4CDUC 1LHOA 4CDUB 2LM3A 3DYOA 3FBMA 3WQ1A 1TZOA 1GKBA 5FY4A 2XHNA 5FZOB 3O5SA 2OZ6A 4LULA 2WL1A 3ACGA 1RUE3 3FBYA 4LBKA 1HB1A 2XR4A 3LIHA 5JIUA 3TEWA 4MHUA 4COWA 4D69A 1QJU3 3OSDA 2Z69A 2R0HA 2WBKA 4MV2A 3VBSA 1VBD1 1GWLA 2VZPA 5F2WA 4Y3OA 1H2MA 3RS6A 1I3HA 3ETQA 3MUZ1 4YGBA 4LHNA 4E4DX 3Q8CA 4FFGA 4M3CE 5K4LA 5FZ8A 4MGYE 3SHRA 1RMU1 2YPJA 1POV1 2PMWB 3CL1A 4GWMA 4NJ4A 5DAQA 1W39A 1CZSA 3NMBA 1V6LA 3I3BA 4HN1A 3H1WA 3AYDA 1PVC2 1CIYA 1CPMA 2X29A 1NY71 4IE4A 4YW1A 1ZA4A 3WP5A 4AEMA 4EWAA 5I8TA 4CCEA 4DS0A 1WUVA 1SLAA 5C3SA 3OD0A 2ET7A 1VIWB 2A6YA 4A45A 5JXJA 5C3OA 3LKJA 5CFDA 1G9AA 2WKKA 2A6VA 2EAAA 1LOFC 2BOIA 2QJVA 3B94A 3LSDA 5DAXA 3WNNA 4GULA 1PVXA 2ZGOA 3A0KA 3MYXA 3RZHA 4Q0VA 3U0ZA 1IPJA 2JXAA 2VZRA 2Y6KA 2XWJB 3I2FA 3T2QA 2PAMA 3FUOA 3H3LA 4Q8LA 2R071 5A1LA 2GP5A 1O91A 2YG0A 3BB6A 1QOSA 2YZ4A 3FMGA 4BQ2A 2W87A 1UPIA 4Q4X2 3PHMA 1YWKA 5C4WA 4MGKE 1ZBA1 2ENRA 5JPMB 2VMCA 3KV4A 2Q8EA 5IT6A 1UMIA 1WA4A 3SITA 4UBHA 2H0VA 4AI3A 1XB9A 5LA1A 1UZZA 2D6OX 3M4FA 1SQ4A 3P1IA 4R9AA 1WLDA 2VTXJ 1NQJA 4FOWA 5LEKA 5I0TA 2XH6A 1QH7A 1XNTA 2XUEA 1DGWX 1WZXA 1N47A 1SLIA 1OA3A 1YXWA 1RIRA 3WY6A 3ZIXA 2HWB2 2ZHMA 4CE8A 2JIJA 2BZDA 4E9KA 1S0FA 1QIQA 3ASIA 2PN5A 2DBNA 4XACA 5FQ0A 2YMZA 3D8CA 4BJ0A 5BNPC 5BNPB 2RDNA 3VBOA 1SFPA 4PIZA 1YCIA 2PAKA 2KR2A 3KGLA 4YVSA 3G7DA 5IW0A 5A3UA 5F3IA 1IG3A 5AC93 2P3YA 3KF3A 3LEKA 4QB2A 3FUQA 3NNGA 4RHV3 2D3SA 1JU4A 3LDRA 2ZGQA 5BNOC 2EXJA 5BNOB 4SBVA 2ARCA 1H0BA 1H2NA 3C8XA 3SMHA 5F5AA 1BKZA 1PNFA 5LBFA 4MLOA 4ATEA 3APBA 3KGZA 2XPJA 5FKBA 3ZXJA 2J1UA 3OB8A 5HPOA 2QUOA 3FFZA 4NAOA 3SCFA 1PO23 3AKPA 3F2ZA 3HMYA 3QLQA 4NOTA 2VNVA 1AR91 2CWMA 3WNMA 1RUC3 4AQTA 4DXSA 1RGSA 1WMXA 4RGKA 1ZA7A 2VTXA 2NP0A 1AR72 2BTVC 5DZEA 3S7EA 1QKQA 2Y8KA 5FZFA 3KHCA 2G9FA 3HNMA 1CONA 1F15A 2PHTA 2W39A 3IPVB 5LY1A 2BUKA 2VECA 1D2QA 2XJSA 3AK0A 3B01A 2LUWA 2QZ2A 4YVWC 4CU8A 1ULPA 1N3QA 4YVWB 1QOOA 1UZYA 5DAPA 2W92A 4O65A 5F3EA 3VBUA 4C0BA 1XNBA 3ABZA 3WCSA 4NHKA 3WNLA 3TEZA 2C24A 2WNVC 4A6OA 5IVVA 1C5HA 2WNVB 3VHOA 3WW2A 3PJQA 4GWNA 4PLNA 4LEJA 3WV6A 3HWJA 2BEOA 5C3RA 2J1AA 3USUB 4LBQB 1FOD1 3WF4A 4JHTA 1ONAA 1FPN1 3IKWA 3PUHA 1CAWA 3OCPA 2GZWA 2BPA2 1MVEA 5FIXA 1UIKA 3DUIA 4HL0A 2ZA9A 3E97A 4BB3A 1BVP1 2WNUC 3U11A 1NYWA 2WNUB 4QXKA 1CAUA 1PHMA 2E51A 4LITA 1C8M3 5JZGA 1F8VA 1ENXA 1VRH2 2AZ5A 5FY0A 4LOSA 3SKVA 1AR82 2EALA 3I2HA 2VOKA 4ZXKA 1ULCA 1RVF3 1AUYA 1W8UA 2VNRA 2OQ7A 4FFHA 4IV3A 1W6NA 3POIA 5FMBA 4ATFA 1ZRRA 4GMP0 4AI2A 1DYPA 5GZEA 4FTEA 5LBEA 4CZSA 4BA6A 2VQTA 4DMIA 2R041 1FI2A 2OA2A 3E1F1 3H42B 3P3NA 1F4AA 1PO11 1RHI1 2FCUA 4P5HA 5LWBA 5F37A 1TVGA 5D2AA 5L36A 4LT5A 1KEXA 2C5DA 4Y4RA 5G04L 4IEPA 2A1XA 2JDAA 5FZEA 2WLPA 4BK5A 1AX0A 2DWRA 3AMNA 4GALA 5IHRA 1JXNA 2VCBA 3WDTA 1W2OA 4AOCA 1VALA 3RYPA 5AVPA 2O8QA 1PGL2 3PIJA 1AJKA 1LOAA 2BWCA 2LRPA 1YEWA 4DIQA 5E1RA 2WQ4A 1MS5A 5B4NA 5L9RA 1O3TA 5FV3A 2GC3A 5A3OA 2A6XA 5DZFA 3AB0A 3VL9A 3RYRA 2F6BA 3DN7A 4RGAA 5EJ3A 1W3VA 2JWPA 4IEUA 1F4HA 3IM0A 1DGLA 1UU4A 1IG0A 4I3GA 4QX2A 1LENA 1CAXA 1GNYA 1SLCA 1WCQA 4FFIA 4Q0SA 1ZRFA 2X8KA 4DQAA 2ZX3A 4Q4W3 2JKXA 1POQA 4WVVA 4AL9A 4KGQA 4JGYA 4Q1PA 2Q8DA 4AF9A 2A6ZA 2E33A 2JE9A 4YM3A 4Z2WA 3ORJA 3OGVA 3E5XA 4AK3A 1YQ6A 2ID4A 4FXGB 4X8PA 2DURA 2A5ZA 5FBZA 5A1AA 3MIHA 3ILNA 1ST8A 2GNTA 3A21A 4XXAA 2WFF1 3OPZA 4IEXA 4IE6A 4RN5A 1AXKA 1EAH3 3T0AA 3A4UA 1LODA 4EE2A 3LGRA 4MSVA 1UYYA 3PL0A 1RUD3 3AMPA 4IV1A 4JRLA 1QDOA 1LULA 3HN3A 4ES8A 5A3MA 3HEIA 4IEVA 4BLIA 1WWYA 2RS52 2W08A 4V1PA 5F8PA 1JS9A 1HDKA 3GJAA 1DLCA 1T6GC 2XJQA 2WWJA 2YB7A 4FQ4A 2UYBA 3HNBM 4YW7A 3AXDA 1W28A 3KVAA 1QXJA 3CJXA 4HETA 4TZDA 3I2KA 4Y20A 2OXBA 5ACA2 3BTZA 3ZKUA 1JYTA 4WM8A 4Y22A 3AXEA 3K4AA 3PVBB 1DYOA 1WCKA 4AQ2A 1H9PA 3OBRA 5FKCA 3AKRA 4OHWA 4D7TA 2KD7A 4FOVA 4C1XA 1J3RA 4AAPA 4XFAA 4NAMA 3HVDA 2HJIA 5FAXA 2X53S 4LE4A 3URFA 4FP3A 5FZ1A 3AZVA 4QXBA 4FPFA 4IEOA 4CCOA 1FAYA 4CDXC 1QOTA 3OPTA 4CDXB 5I0RA 1H8VA 4BQXA 1GWMA 1UKGA 3HD8B 5H9SA 1HB4A 5I0UA 3ZFGC 2R32A 1X36A 3T09A 3ZFGB 2RMU2 3O0WA 1DQ1A 3ZSLA 2EIEA 1APNA 4CP2A 2R6QA 5FZDA 3T0BA 2OUHA 3JXSA 3OGSA 1L3JA 4M3CF 4TLFA 3TEYA 5FLIA 1YJKA 4HVRA 4BYYA 3ATGA 1LR5A 1LU1A 2IVIB 1ZBE2 2GH2A 1JW6A 1K12A 2WZR1 5CADA 3DF0A 4H3WA 4YGDA 3NW4A 4JKMA 3NKTA 4ZU4A 3D82A 3RPQA 3OBZA 1UY4A 4XCAA 1ULFA 5HXVA 5BYNA 1DGRA 1ZREA 1OT5A 1ZZ8A 1UPSA 4FPKA 2VTFA 1NE4A 1QJX3 4P9XA 2QQPA 1OF3A 4EZ4A 1HJFA 2CYFA 1B35C 1VMFA 4BZ4A 5F5QA 1B35B 1D7PM 3EBRA 5JMCA 2RS31 4Q4V1 2D6PA 2RDSA 5FZOA 3MIGA 3EXUA 2B39A 5C8CA 1W0OA 1G9CA 5J48A 5LATA 1VBE1 3INAA 2QKDA 1WMFA 4KMQA 1EV11 2YV8A 5E89A 4ZU7A 3S5QA 1IKPA 4XOGA 5DUVA 2NMOA 1FV2A 3AM2A 4O7XA 2ORXA 2I45A 1DFQA 5LCWL 5EQUA 3GZEA 1NCRA 4JDOA 1X8EA 2VZSA 2VE1A 1JYXA 1MZEA 4N43A 1DG6A 1UU5A 2VZOA 3N7LA 4YGCA 1ND3A 5HI0A 1KS4A 1LOCA 2EVXA 4CP9B 2RS11 4OUSA 2NN8A 3DYPA 4P9IA 5KHIA 3JZVA 1GFF2 4MO3M 1VBA2 4MOAA 4QGNA 4ARYA 3MFAA 1W6QA 3ZN6A 1W2NA 3POJA 4GB33 4D6RA 2XJRA 3CBNA 4DB5A 5CB7A 1GLHA 3IT8A 4NHMA 4OYUA 1KJLA 2XVLA 3ZYFA 2G9GA 1BYHA 3DXTA 2E26A 1PZ9A 2RR13 5L19A 1VBB3 3TB0A 3THTA 2RE9A 5FZCA 3DPRA 3B00A 3J7NA 4OZOA 1BLZA 1J84A 3V64A 2QNKA 1BVVA 2WQ8A 1I6XA 3CJIA 5FMOL 2WO2A 3SEEA 3VBFA 5CAZA 2GP3A 1O7FA 4B4RA 2ZAHA 4H7LA 5FOBB 2CY6A 2DBIA 2V5DA 2HWD1 4QGLA 1X8MA 4IERA 5CFDC 2YDEA 2HWC3 3MICA 2JE8A 3RMYA 2BNNA 5CFDB 5I0SA 2W91A 3W5MA 4P14A 1D4M2 3UKVA 4L92A 4FXKB 2WQZC 3BPSA 5A3TA 2Y34A 2ZGKA 4NPRA 4XFGA 2ZAAA 1RUH3 4FTBA 1CN1A 1XNAA 4AW7A 4O9GA 3U4XA 1O4TA 3FE5A 3P6BA 4V2VA 1OQ1A 4COZA 1ASJ1 5CNAA 4LHKA 1DQ0A 3UGHA 3MLLA 1Y9MA 3D4KA 5J7MA 5C4WC 2WS93 4J1XA 1DBNA 3Q9OA 4LMFA 4NHLA 1PGW1 5C4WB 4PCRA 5BV6A 4EV0A 1SACA 2EXHA 1O6UA 5L9BA 1IQDC 5T5OA 4I0BA 1QQP2 3AJYA 3VKMA 3KMHA 2J1RA 1H2LA 3WG1A 1MR5A 1PK6C 3AZYA 1VBC2 3QH7A 1PK6B 3Q8FA 4OHYA 1J3QA 4ZHNA 3R6SA 3VZLA 1BMV1 3PVOA 3LQCA 1S0GA 4AGVA 2DF7A 1OQDA 5F1RA 5IK4A 2DCZA 2B45X 4TN7A 1RUE1 2WZ8A 2YC2A 3RQ0A 5FP8A 5FQ0B 2G4IA 2WFPA 1Q8PA 1QJU1 1H6YA 2JDMA 3VBOC 1DZTA 3NV1A 1ULOA 2VNOA 1N1TA 3PNAA 4K1YA 4YVSC 2OKXA 3VBOB 4AVCA 4B8EA 1UO9A 4YVSB 5LZ6A 1JBCA 3NNLA 1WA6X 2WYFA 4EWEA 1VLNA 2QQVA 2VZTA 3ZYHA 1KQRA 1NXD1 2RG4A 2DUOA 3BCWA 1Z7S3 3EMRA 1VR3A 3HOBA 2C1FA 1CZTA 3K48A 4HMZA 1NLRA 2WLQA 1HXS2 2XLAA 4L99A 5T5LA 1C8NA 4RR3A 3VHRA 1R083 4XFBA 4CCDA 3ZO0B 3ZXFA 2P6HA 4FI9A 3OGJA 3WF3A 3GCWA 4FPHA 4D6SA 3I7DA 3M3OA 2DFCA 3M3EA 2BP6A 4XJWA 1HLCA 5FPLA 4G3YC 4PBOA 1RUJ3 1MS1A 1UMHA 2FHRA 2PELA 4I3PA 5FYSA 2VU9A 3U37A 3UKTA 1DGWA 1WW6A 1GZ9A 4QPWA 4D0QA 4HVQA 4XF1A 1GQGA 2R072 2CU5A 1W9WA 4Y1UA 5IWFA 1J59A 3LE0A 4XZUG 1N1VA 4AFMA 1WCDJ 5CKQA 1SPPA 2FZ1A 3H8OA 3H50A 3Q8BA 3RSJA 2YFZA 3VGIA 2D6LX 3BOWA 1GP6A 3FL7A 4PT6A 1V9U2 3IZOA 4XUTA 4NIIA 3I3QA 4J6GA 3UJQA 1HQNA 1SFNA 2NMNA 5D8AA 3ROUA 3W59A 1KFUL 2JECA 1E5RA 4QB6A 2R1DA 4B1LA 1DQ4A 2ZX1A 5JZGC 1CAUB 2JKBA 3U1XA 2E63A 5JZGB 3WNOA 3Q8EA 2F17A 5CKMA 5JPNB 2V73A 2YBPA 5KHHA 3N9MA 5FZBA 2AUYA 2ZEXA 2G9ZA 4IV3C 5FYMA 3VKFC 2VZQA 2WDBA 1YFXA 4IV3B 1COV3 1UX7A 1V6IA 1W6NB 2ZJCA 2IXIA 4PLMA 1IHMA 1WMDA 3BGAA 5JOZA 4Z92B 1I5PA 4W8JA 3WW4A 2JENA 3N4MA 2ETEA 2WO1A 4KH9A 2A70A 5AC91 2VCAA 2QQJA 4RHV1 5BPXA 2XJVA 1E5HA 1SMVA 3H0OA 1OKQA 4IQPA 1OVSA 3WDVA 1G8WA 1QDCA 3ZN5A 1JZ6A 2H6BA 3J8F2 3AFKA 1V00A 5FP3A 1WKYA 4E27A 4XQDA 4EWDA 5B4XA 2NM1A 3WDUA 2VULA 4PLOA 4AI9A 1PO21 2IXKA 3BUCA 4ITCA 4RFT0 4PI0A 1NQDA 2JICA 4JZRA 2MPFA 4K1ZA 1RUC1 2P1BA 4R9BA 3NAPA 5I8SA 3EB7A 3EJKA 2LTNA 3WP4A 5J09A 3BTYA 3NV2A 2WA3A 1XBFA 4ZXEA 5FZAA 3GNEA 2UY9A 3RZLA 3V65A 2VOXA 2ZKLA 2CHHA 2R1BA 1UMZA 4WVWA 3GZUC 4FPEA 3GXUA 3O1TA 1CAXB 1J58A 2JB4A 4GWJA 3EQEA 1S0EA 4JGYC 1PIV2 4JGYB 2ZACA 3IAPA 3ZR6A 1DQ6A 3ZOIA 4COVA 1AR62 5FY1A 1U12A 4GMP3 5GLWA 3VDAA 5JCTA 1H4HA 2TUNA 3JB8A 3KB5A 2O0OA 4GAZA 4JCKA 1EP0A 1K5MA 1TNFA 3JQWA 3WEZA 2XXZA 1B09A 1OD3A 4I09A 2YXSA 1PX4A 5JXGA 2ZGLA 4META 5DG1A 4ZS3A 5GLUA 4Q4X3 5GKAC 1OSGA 1C8M1 2UWCA 1RUG2 2WN3A 4HKWA 4QPIA 2XQXA 1TMF2 3NJZA 2HWF2 2ZGMA 1QJFA 4L8QA 5FMOS 1G9BA 5LBCA 5FUIA 2OZJA 4LK7A 1BQPA 4E4SA 3MW2A 4LKEA 2H6CA 4KI5M 3VZKA 2PA7A 2XG3A 2J42A 2ZMNA 1J1LA 3MW3A 4H2AA 4AHZA 3AMHA 4QXCA 1X9TA 2ZEWA 1LHVA 5FFOC 4CUGA 3HIFA 2VUAA 3BKZA 2HWB3 1W8NA 4QWNA 1A3KA 4Y20B 4WM8C 3NV3A 3VV1A 2VUJA 2XJTA 3FC0A 4WM8B 4Y22B 2FDGA 4AGGA 3O1VA 2AENA 4Q27A 5IVBA 3MPPG 4EQVA 3RDIA 3J7MA 5IAVA 3OUIA 2Y6FA 2W3JA 3FLPA 1J83A 1N1SA 3CKHA 3LPGA 1RUF3 2JIGA 3RI8A 4AFAA 1Y9GA 2QFEA 5FZKA 4D94A 3LOBA 1VAKA 5IK5A 1UCXA 2FQPA 4XVHA 2VMHA 1V6MA 4NWVA 3LEMA 2B9UA 3LCPA 4UF0A 4YZ3A 2XMLA 5FJKA 3RVHA 3AP5A 2ZPXA 1OFSA 1OLQA 5FLHA 1ODNA 4RFRB 4WV8A 4GWIA 3B93A 3ZXDA 2J1SA 3E6CC 1CQ9A 3LOIA 2GC2A 1UQXA 5DMYA 1AR73 4XFCA 5C3QA 1CAVA 2WFF2 3IN9A 4H55A 4Q4W1 4HKLA 5FP4A 4BIOA 3A7QA 3OBTA 3GZAA 3OD4A 4UBGA 3S57A 1DDLA 1AYM2 2GMEA 5FYUA 1ZNPA 3O1OA 3U75A 5FMCA 3K4ZA 1PZ7A 1DIWA 1V70A 3MV11 1QHDA 1IGOA 2Q4SA 4JHZA 1LB2A 1EAH1 1XYOA 4GJYA 3RNSA 1TNRA 5IVCA 5C3PA 3GBFA 1NXMA 3KV6A 4QPYA 1RUD1 1DP0A 4AHWA 4PHZA 5DAVA 3BU0A 4H14A 3UETA 4XJUA 2W47A 4DZGA 2MEV2 3ZPYA 3ZXAC 2ZS6B 3VDDA 4KBZA 2UWAA 2A6WA 4OVEA 3IDCB 5DN2A 4CP9A 4Y4YA 5L73A 5CIRA 1IS5A 1QXRA 5C8CC 1ENRA 5C8CB 2BERA 3SCHA 3DKQA 1BEV2 4GJZA 1JZ4A 3T30A 4BOWA 4XAAA 1JOBA 1BK1A 4HXCA 1FATA 1BBT2 3WQ7A 2FMDA 1D0HA 1VRH3 1NCRC 1SDDB 4XUQA 2ZABA 1XQNA 2BW8A 5EHDA 1NCRB 1AR83 1SEFA 1BHGA 4N43C 4UYBA 2FDFA 1CGPA 1KITA 4N43B 4UFIA 1ND3C 2J1VA 1ND3B 2E7QA 3OOXA 5IJRA 5LASA 1JN2P 4FOQA 1W9FA 3AYAA 1W6QB 4HG6B 3ZN6B 2O1QA 3POYA 4FT8A 2CDOA 3S30A 1C4RA 4CUBA 4D7SA 4AVTA 1Q56A 2AREA 5EV7A 4YGEA 1U5YA 4LUKA 4EROA 4AVBA 3FN9A 4JDNA 4NPLA 1BK0A 1OKOA 4FPLA 4AEJA 1H1AA 3DPRC 5AFBA 3DPRB 4LORA 4CPBA 3CJIC 4AEDA 1T6BX 3VBFC 3CJIB 4AVVA 2VD7A 5GZCA 2PYTA 2B46X 5FRAA 3VBFB 2D5HA 1TME2 4LQRA 3WLUA 4AWDA 5K9YA 4KWJA 1AL22 3POEA 1NOVA 4CP0A 5T54A 4XZPA 2UU8A 4K3UA 5FZGA 4O9EA 4UW3A 4K6BA 3MIDA 4A44A 4QD2A 3POGA 3DXUA 2HBTA 3JUUA 3W5NA 2TBVA 1YHFA 3ENRA 4R8HA 4DUVA 3PTYA 1J3PA 2VL4A 3PTRB 2PQSA 4LJHA 1DGRN 4EN7B 4OI2A 2XHKA 3O0VA 1GOGA 1QJX1 2HEYF 1WGPA 3WVJA 1PK6A 2D5FA 3FX3A 4Q0PA 5A32A 2AGSA 4BWOA 1LESA 4R9CA 3T4VA 2PHRA 1UF2C 2JDKA 4QU1A 4QHOA 3QD6A 2QQUA 3IIAA 1AL0G 1Q43A 1SFYA 3K4DA 4QM8A 5A33A 1AVBA 4D6QA 2AR6A 3LDBA 3RG0A 1GOHA 2RS53 3SEPA 4CCNA 2CDPA 1HRV2 4P08A 1VP6A 1WBFA 2GAUA 5L7OA 1RJ8A 5JAXA 2VOVA 3VHPA 4XJZA 3VUOA 3MGUA 4FPGA 2CNAA 3CO2A 3O1SA
chains in the Genus database with same CATH topology
1L7QA 2RV9A 2Y6JA 3CQOA 2KD7A 3C7HA 3ZM8A 4D8MA 1UY3A 4BDVB 2W9XA 4YPJA 3NJVA 2WAOA 3GDBA 3IDAA 1OH4A 4XUPA 3ETPA 4TTGA 4P02B 3MUY1 2QQLA 3T09A 5JXHA 4AAXA 1PMJX 2EIEA 3T0BA 3LEIA 4OMCA 4A3ZA 3JXSA 3OGSA 1NAEA 2DDUA 4QAWA 4BK4A 3I97A 2EIDA 1PX3A 1K12A 3WF0A 2C26A 4JKMA 4CU7A 1UZ0A 1UY4A 4TXWA 1GU3A 1OT5A 2WZEA 2VTFA 1UYXA 1OF3A 3C7OA 3I2GA 4DUXA 3OGRA 1D7PM 1H6XA 2BBAA 3BN6A 3THCA 1LNSA 4ZY9A 1JZ8A 5DPNA 4KMQA 4QX1A 5JUVA 2ORXA 5LCWL 1NKGA 1JZ6A 2C4XA 2VZSA 1JYXA 1JHJA 3DECA 1O8PA 4A4AA 1UY2A 3T08A 1GMMA 4CU9A 2VZOA 5IFTA 3VD4A 1R64A 3DYPA 2VR4A 4MO3M 4MOAA 3CMGA 4ARYA 2QQOA 5IFPA 2V72A 2W1QA 1GQPA 1JZ5A 3J7HA 2QQNA 2V4VA 4OYUA 4AG4A 3UNPA 3NJXA 4MGQA 4UOJA 2E26A 2X09A 4LKSA 3K46A 1JZ2A 2WAAA 1K3IA 2DCKA 4OZOA 5JR2A 1J84A 1US3A 3MBWA 4QB1A 2WQ8A 3C7FA 3SEEA 2L9LA 2WO2A 4LPLA 1O59A 2ZEZA 2B9VA 1L7RA 2WYSA 2V5DA 4GZ9A 4ARXA 3FHQA 4RYDA 1CZVA 2JE8A 2VJXA 3W5MA 4XURA 2W91A 2Y64A 2W1SA 2ORZA 2VC9A 4XUOA 5HXMA 1XNAA 4MGSA 3IAQA 3P6BA 4QDQA 2W46A 2Z4FA 2EICA 2W95A 1SHWB 3VD7A 1UY1A 3CZUA 3I3EA 2BGPA 3OEAA 2ZXQA 2QQMA 3WQBA 5JMOA 2HLEA 2W1UA 1IQDC 4DXRA 4L0PA 1YQ2A 2J1RA 5EIYB 4UI9L 2VOTA 3CDZB 2VO5A 3LQCA 1JYNA 2QBXA 3LEGA 1XPWA 2WZ8A 2YC2A 4A41A 1H6YA 2LW8A 2DCJA 1ULOA 2W5FA 3IB3A 3ACIA 2OKXA 2VZTA 5CYYA 3HOBA 3A23A 3EYPA 3ACHA 1CZTA 3VD9A 5C70A 1GUIA 1EUTA 4QDRA 1EUUA 2XOMA 4FI9A 4M4RA 4DXTA 3CZJA 3WF3A 2B4KA 2ZEYA 3D3AA 3HJRA 4W4ZA 2QQKA 2J1TA 1T2XA 1PMHX 1UMHA 3U37A 2YC4A 2LS6A 4D0QA 4QPWA 2YFUA 4QX3A 1W9WA 3LE0A 4XZUG 4OMDA 2BGOA 3VDCA 2WUHA 2JD9A 1O8SA 4CVUA 2YFZA 4PT6A 3FL7A 2HYXA 4XUTA 1NUKA 1OF4A 2XONA 3K77A 1W8OA 1K42A 2VZ1A 1JYWA 3CIHA 4QB6A 3C7GA 3HNYM 4E8CA 3GGLA 3WNOA 3ECQA 1TG7A 1UWWA 4DUWA 3IIIA 3DYOA 1W0NA 2XHNA 3ACGA 1HN1A 4QX0A 2ZEXA 2VZQA 2WDBA 2R7EB 1UX7A 2WBKA 3HPNA 2VZPA 3BGAA 1I5PA 4W8JA 1XC6A 2WO1A 2WO3A 3MUZ1 3MV01 2VCAA 3UESA 2J22A 2QQJA 3T2PA 5C71A 3VD5A 2VMEA 1WKYA 3WF2A 1CZSA 2VCCA 5B4XA 3I3BA 1CIYA 3OEBA 4JKLA 2Y6LA 4JKKA 3EB7A 1SG3A 4A45A 5JXJA 2E31A 4ZXEA 5J1XA 2W1WA 3WNNA 3VD3A 3NRUA 3GXUA 4GWJA 2VZUA 1MPXA 2VZRA 2Y6KA 4MADA 4UAPA 3IAPA 4P5YA 3I2FA 3T2QA 2YG0A 2W87A 3VDAA 2VMCA 3A22A 1JZ7A 4PQQA 1UMIA 3WEZA 5IYYA 5LA1A 1OD3A 3P1IA 1PX4A 5JXGA 2J7MA 1XNTA 2WN3A 2XQXA 3MO4A 5FUIA 2BZDA 2WABA 2E32A 4KI5M 4BJ0A 4DEVA 5EJZB 2ZEWA 5I0DA 4CU6A 1W8NA 3LEKA 4QB2A 3NNGA 1JU4A 4CUAA 3C8XA 2W3JA 3AC0A 2J1UA 3OB8A 4QDSA 1J83A 3CKHA 3LPGA 5F7UA 5HPOA 1CX1A 3F2ZA 1JI6A 1RYYA 3WNMA 4XVHA 1UY0A 3WF1A 4DXSA 3WNKA 3VDBA 2Y8KA 2VZVA 4DEQA 5JXIA 3HNMA 4CUCA 2W94A 3DYMA 4PF1A 4CU8A 4GWIA 1P8JA 1ULPA 2J1SA 2W92A 5DMYA 2Y6GA 3ABZA 3WNLA 5LA0A 4A6OA 2WN2A 3A7QA 3GM8A 2J1AA 1W9TA 3WF4A 5EJ1B 4ET7A 3K4ZA 4M4PA 3PUHA 3MV11 4P00B 4JHZA 2X10A 2QQIA 3K75B 1DP0A 3UETA 2W47A 4ZZ5A 4IUGA 2VM9A 1JZ3A 4A42A 5DN2A 3T0DA 2VQUA 2VZ3A 3SKVA 3I2HA 5C7GA 4ZZ8A 2BERA 1JZ4A 5DQ0A 1GOFA 3I2JA 2VQTA 3SKJE 2EIBA 4XUQA 1SDDB 3E1F1 4Z2AA 1F4AA 1BHGA 1TVGA 1KEXA 2J1EA 2J1VA 1UXZA 5G04L 2JDAA 4BK5A 1UYZA 5IJRA 3I3DA 2RVAA 4E8DA 5IHRA 2VCBA 4HG6B 1JYVA 3C7EA 3FHAA 4JX0A 2CDOA 4CUBA 4W50A 3LPFA 3FN9A 1US2A 5LA2A 5B4NA 1NX9A 3I2IA 1JU3A 3WNPA 2C9KA 1F4HA 4LQRA 4KWUA 2VMDA 4QX2A 1GNYA 1WCQA 3OBAA 4LHSA 2JKXA 1KGYA 1UXXX 2E33A 3OGVA 2ID4A 5CZKA 4A44A 1K45A 5A1AA 3A21A 3W5NA 4DUVA 2VL4A 4RN5A 3T0AA 3WSOA 2PQSA 1UYYA 2VMFA 4XUNA 1GOGA 3HN3A 3ACFA 3HEIA 2X05A 5G05L 1W99A 3PUIA 3T2OA 1DLCA 2RJ2A 2Y6HA 3K4DA 2YB7A 3HNBM 3NQHA 1GOHA 3SEPA 2CDPA 3OG2A 4OUEA 4P08A 4BXSV 1W9SA 3I2KA 3THDA 3K4AA 1DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7Q A;  2RV9 A;  2Y6J A;  3CQO A;  2KD7 A;  3C7H A;  3ZM8 A;  4D8M A;  1UY3 A;  4BDV B;  2W9X A;  4YPJ A;  3NJV A;  2WAO A;  3GDB A;  3IDA A;  1OH4 A;  4XUP A;  3ETP A;  4TTG A;  4P02 B;  3MUY 1;  2QQL A;  3T09 A;  5JXH A;  4AAX A;  1PMJ X;  2EIE A;  3T0B A;  3LEI A;  4OMC A;  4A3Z A;  3JXS A;  3OGS A;  1NAE A;  2DDU A;  4QAW A;  4BK4 A;  3I97 A;  2EID A;  1PX3 A;  1K12 A;  3WF0 A;  2C26 A;  4JKM A;  4CU7 A;  1UZ0 A;  1UY4 A;  4TXW A;  1GU3 A;  1OT5 A;  2WZE A;  2VTF A;  1UYX A;  1OF3 A;  3C7O A;  3I2G A;  4DUX A;  3OGR A;  1D7P M;  1H6X A;  2BBA A;  3BN6 A;  3THC A;  1LNS A;  4ZY9 A;  1JZ8 A;  5DPN A;  4KMQ A;  4QX1 A;  5JUV A;  2ORX A;  5LCW L;  1NKG A;  1JZ6 A;  2C4X A;  2VZS A;  1JYX A;  1JHJ A;  3DEC A;  1O8P A;  4A4A A;  1UY2 A;  3T08 A;  1GMM A;  4CU9 A;  2VZO A;  5IFT A;  3VD4 A;  1R64 A;  3DYP A;  2VR4 A;  4MO3 M;  4MOA A;  3CMG A;  4ARY A;  2QQO A;  5IFP A;  2V72 A;  2W1Q A;  1GQP A;  1JZ5 A;  3J7H A;  2QQN A;  2V4V A;  4OYU A;  4AG4 A;  3UNP A;  3NJX A;  4MGQ A;  4UOJ A;  2E26 A;  2X09 A;  4LKS A;  3K46 A;  1JZ2 A;  2WAA A;  1K3I A;  2DCK A;  4OZO A;  5JR2 A;  1J84 A;  1US3 A;  3MBW A;  4QB1 A;  2WQ8 A;  3C7F A;  3SEE A;  2L9L A;  2WO2 A;  4LPL A;  1O59 A;  2ZEZ A;  2B9V A;  1L7R A;  2WYS A;  2V5D A;  4GZ9 A;  4ARX A;  3FHQ A;  4RYD A;  1CZV A;  2JE8 A;  2VJX A;  3W5M A;  4XUR A;  2W91 A;  2Y64 A;  2W1S A;  2ORZ A;  2VC9 A;  4XUO A;  5HXM A;  1XNA A;  4MGS A;  3IAQ A;  3P6B A;  4QDQ A;  2W46 A;  2Z4F A;  2EIC A;  2W95 A;  1SHW B;  3VD7 A;  1UY1 A;  3CZU A;  3I3E A;  2BGP A;  3OEA A;  2ZXQ A;  2QQM A;  3WQB A;  5JMO A;  2HLE A;  2W1U A;  1IQD C;  4DXR A;  4L0P A;  1YQ2 A;  2J1R A;  5EIY B;  4UI9 L;  2VOT A;  3CDZ B;  2VO5 A;  3LQC A;  1JYN A;  2QBX A;  3LEG A;  1XPW A;  2WZ8 A;  2YC2 A;  4A41 A;  1H6Y A;  2LW8 A;  2DCJ A;  1ULO A;  2W5F A;  3IB3 A;  3ACI A;  2OKX A;  2VZT A;  5CYY A;  3HOB A;  3A23 A;  3EYP A;  3ACH A;  1CZT A;  3VD9 A;  5C70 A;  1GUI A;  1EUT A;  4QDR A;  1EUU A;  2XOM A;  4FI9 A;  4M4R A;  4DXT A;  3CZJ A;  3WF3 A;  2B4K A;  2ZEY A;  3D3A A;  3HJR A;  4W4Z A;  2QQK A;  2J1T A;  1T2X A;  1PMH X;  1UMH A;  3U37 A;  2YC4 A;  2LS6 A;  4D0Q A;  4QPW A;  2YFU A;  4QX3 A;  1W9W A;  3LE0 A;  4XZU G;  4OMD A;  2BGO A;  3VDC A;  2WUH A;  2JD9 A;  1O8S A;  4CVU A;  2YFZ A;  4PT6 A;  3FL7 A;  2HYX A;  4XUT A;  1NUK A;  1OF4 A;  2XON A;  3K77 A;  1W8O A;  1K42 A;  2VZ1 A;  1JYW A;  3CIH A;  4QB6 A;  3C7G A;  3HNY M;  4E8C A;  3GGL A;  3WNO A;  3ECQ A;  1TG7 A;  1UWW A;  4DUW A;  3III A;  3DYO A;  1W0N A;  2XHN A;  3ACG A;  1HN1 A;  4QX0 A;  2ZEX A;  2VZQ A;  2WDB A;  2R7E B;  1UX7 A;  2WBK A;  3HPN A;  2VZP A;  3BGA A;  1I5P A;  4W8J A;  1XC6 A;  2WO1 A;  2WO3 A;  3MUZ 1;  3MV0 1;  2VCA A;  3UES A;  2J22 A;  2QQJ A;  3T2P A;  5C71 A;  3VD5 A;  2VME A;  1WKY A;  3WF2 A;  1CZS A;  2VCC A;  5B4X A;  3I3B A;  1CIY A;  3OEB A;  4JKL A;  2Y6L A;  4JKK A;  3EB7 A;  1SG3 A;  4A45 A;  5JXJ A;  2E31 A;  4ZXE A;  5J1X A;  2W1W A;  3WNN A;  3VD3 A;  3NRU A;  3GXU A;  4GWJ A;  2VZU A;  1MPX A;  2VZR A;  2Y6K A;  4MAD A;  4UAP A;  3IAP A;  4P5Y A;  3I2F A;  3T2Q A;  2YG0 A;  2W87 A;  3VDA A;  2VMC A;  3A22 A;  1JZ7 A;  4PQQ A;  1UMI A;  3WEZ A;  5IYY A;  5LA1 A;  1OD3 A;  3P1I A;  1PX4 A;  5JXG A;  2J7M A;  1XNT A;  2WN3 A;  2XQX A;  3MO4 A;  5FUI A;  2BZD A;  2WAB A;  2E32 A;  4KI5 M;  4BJ0 A;  4DEV A;  5EJZ B;  2ZEW A;  5I0D A;  4CU6 A;  1W8N A;  3LEK A;  4QB2 A;  3NNG A;  1JU4 A;  4CUA A;  3C8X A;  2W3J A;  3AC0 A;  2J1U A;  3OB8 A;  4QDS A;  1J83 A;  3CKH A;  3LPG A;  5F7U A;  5HPO A;  1CX1 A;  3F2Z A;  1JI6 A;  1RYY A;  3WNM A;  4XVH A;  1UY0 A;  3WF1 A;  4DXS A;  3WNK A;  3VDB A;  2Y8K A;  2VZV A;  4DEQ A;  5JXI A;  3HNM A;  4CUC A;  2W94 A;  3DYM A;  4PF1 A;  4CU8 A;  4GWI A;  1P8J A;  1ULP A;  2J1S A;  2W92 A;  5DMY A;  2Y6G A;  3ABZ A;  3WNL A;  5LA0 A;  4A6O A;  2WN2 A;  3A7Q A;  3GM8 A;  2J1A A;  1W9T A;  3WF4 A;  5EJ1 B;  4ET7 A;  3K4Z A;  4M4P A;  3PUH A;  3MV1 1;  4P00 B;  4JHZ A;  2X10 A;  2QQI A;  3K75 B;  1DP0 A;  3UET A;  2W47 A;  4ZZ5 A;  4IUG A;  2VM9 A;  1JZ3 A;  4A42 A;  5DN2 A;  3T0D A;  2VQU A;  2VZ3 A;  3SKV A;  3I2H A;  5C7G A;  4ZZ8 A;  2BER A;  1JZ4 A;  5DQ0 A;  1GOF A;  3I2J A;  2VQT A;  3SKJ E;  2EIB A;  4XUQ A;  1SDD B;  3E1F 1;  4Z2A A;  1F4A A;  1BHG A;  1TVG A;  1KEX A;  2J1E A;  2J1V A;  1UXZ A;  5G04 L;  2JDA A;  4BK5 A;  1UYZ A;  5IJR A;  3I3D A;  2RVA A;  4E8D A;  5IHR A;  2VCB A;  4HG6 B;  1JYV A;  3C7E A;  3FHA A;  4JX0 A;  2CDO A;  4CUB A;  4W50 A;  3LPF A;  3FN9 A;  1US2 A;  5LA2 A;  5B4N A;  1NX9 A;  3I2I A;  1JU3 A;  3WNP A;  2C9K A;  1F4H A;  4LQR A;  4KWU A;  2VMD A;  4QX2 A;  1GNY A;  1WCQ A;  3OBA A;  4LHS A;  2JKX A;  1KGY A;  1UXX X;  2E33 A;  3OGV A;  2ID4 A;  5CZK A;  4A44 A;  1K45 A;  5A1A A;  3A21 A;  3W5N A;  4DUV A;  2VL4 A;  4RN5 A;  3T0A A;  3WSO A;  2PQS A;  1UYY A;  2VMF A;  4XUN A;  1GOG A;  3HN3 A;  3ACF A;  3HEI A;  2X05 A;  5G05 L;  1W99 A;  3PUI A;  3T2O A;  1DLC A;  2RJ2 A;  2Y6H A;  3K4D A;  2YB7 A;  3HNB M;  3NQH A;  1GOH A;  3SEP A;  2CDP A;  3OG2 A;  4OUE A;  4P08 A;  4BXS V;  1W9S A;  3I2K A;  3THD A;  3K4A A;  1DYO A; 
#chains in the Genus database with same CATH topology
 2IC1 A;  3I2D A;  1RC6 A;  2RV9 A;  2AAC A;  1VPH A;  2GMM A;  5D21 A;  4D8M A;  1SCS A;  2D98 A;  5EWS A;  5IVY A;  4B7K A;  5ACA 3;  3NJV A;  1V6K A;  4CRQ A;  1WD3 A;  3LFM A;  1UOJ A;  2IZW A;  2WAO A;  3GDB A;  4NE9 A;  4F83 A;  1XOY A;  5LW9 A;  3O7O A;  1VBB 1;  4QXH A;  4FP2 A;  3O1U A;  1OH4 A;  3UK9 A;  4AXO A;  4NUB A;  4XUP A;  2DVG A;  5BNN C;  1IPK A;  4IEY A;  5BNN B;  5JLV A;  3P5B A;  4RR3 C;  3ILR A;  1BJQ A;  3PMS A;  2VVE A;  4RR3 B;  3VBR C;  3V0B A;  1LGB A;  3BOP A;  2D3P A;  3LEI A;  4WZF A;  5H9P A;  1MS8 A;  2GH8 A;  4A3Z A;  3AP4 A;  4LO8 A;  1NAE A;  3N7J A;  2XUM A;  2WO7 A;  2XWB B;  3T1L A;  1IKQ A;  1KFX L;  2DUP A;  2EID A;  4YM0 A;  1HQL A;  3ON7 A;  2HWC 1;  2RMU 3;  3QBQ A;  4TLG A;  3RRD A;  1IQA A;  3TRS B;  1HJG A;  5T5J A;  4CU7 A;  1BCX A;  1OXC A;  4I30 A;  4MZU A;  4F7Z A;  2OPW A;  3ACL A;  1GR3 A;  1RUH 1;  1SPP B;  4R4Z A;  5KXE A;  1ZBE 3;  1UYX A;  3D0J A;  1RUI 2;  1W0P A;  2AEZ A;  3I2G A;  2BOJ A;  4IET A;  3OGR A;  1W2T A;  4MUV A;  4HON A;  2BBA A;  3BN6 A;  1QXP A;  2GNB A;  4LBM A;  4Y5S A;  2WS9 1;  3MIE A;  3THC A;  1LNS A;  3RZZ A;  1RJ7 A;  1AYN 2;  3QOP A;  4QX7 A;  1D4V B;  5D8A C;  1BMV 2;  5D8A B;  5CFC A;  5JI7 A;  4I2O A;  1U0A A;  3ZMN A;  4QX5 A;  4E4H A;  5JUV A;  4FTS A;  5A3L A;  3ZX7 A;  5T50 A;  4R4X A;  3S7I A;  5FY5 A;  1O8P A;  1GMM A;  2P6C A;  4IXL A;  1GZW A;  1R1A 2;  2NPI A;  4Q5O A;  1EPW A;  1R64 A;  1VMJ A;  4W6Y A;  2VR4 A;  1OOP A;  4L97 A;  3M8L A;  5SV5 A;  4Q1R A;  5IFP A;  3TN9 2;  2W1Q A;  4OUL A;  4QQH A;  1OH3 A;  2V4V A;  2ZMK A;  4DOU A;  3AKT A;  1Q5O A;  3FFQ A;  4MVT A;  4UT5 A;  4LBN A;  4MGQ A;  3WHT A;  2ZZJ A;  3S0M A;  2GNM A;  3H3U A;  4Q4Y 2;  1VBA 3;  3LA3 A;  1UD1 A;  3WUD A;  4LKS A;  1Z7S 1;  4QKD A;  3K46 A;  3VKO A;  4CTE A;  2WAA A;  5D1I A;  4QKF A;  4W65 A;  3UYJ A;  5JR2 A;  4NRP A;  3ZXK A;  3MBW A;  4PIX A;  4B4Q A;  4LPL A;  4QQO A;  1AJO A;  4HKO A;  4V2W A;  1R08 1;  1XSQ A;  4QT6 A;  2EA7 A;  5FYY A;  1YI9 A;  1QJE A;  1OLM A;  4NVP A;  4AQ6 A;  5TSW A;  3NAP C;  4OI4 A;  1S0J A;  3NAP B;  1RED A;  3RZG A;  1SBD A;  1RUJ 1;  1CZV A;  1HIX A;  2QQW A;  5GM0 A;  1R09 2;  2HKX A;  2YGM A;  3N35 A;  3UJO A;  1QU0 A;  2W1S A;  4AYU A;  5FY7 A;  1W8Z A;  2BVV A;  3K51 A;  3ZVX A;  5KWR A;  4EN8 B;  2R06 2;  4JGZ A;  1XSR A;  5GZF A;  4QDQ A;  4LUM A;  3SNM A;  2ZTN A;  1D4M 3;  1WW4 A;  1GBG A;  1RIT A;  4XW3 A;  3CNA A;  3KLS A;  3ZXE A;  3H8X A;  1UY1 A;  3CZU A;  3I3E A;  4B1M A;  4MGT A;  1YUD A;  3RJR A;  3ST7 A;  4HZF A;  2RM2 2;  2QQM A;  4CYD A;  1ZZ6 A;  5JMO A;  1SCR A;  2HWE 2;  4HAN A;  4Y24 A;  1K5M C;  5FZ9 A;  2RJL A;  5FYZ A;  1ENS A;  1K5M B;  5CKN A;  3L2Y A;  4L0P A;  2YY1 A;  4COY A;  3J7L A;  4NWW A;  5EFU A;  3BU7 A;  4QPI C;  2JB8 A;  4AFD A;  5KC5 A;  1FMD 1;  2VOT A;  3EO6 A;  2BU9 A;  4NMI A;  2XB6 C;  3ES1 A;  1W6O A;  4QPI B;  1S2K A;  1H1I A;  2EAK A;  4JQR A;  5DDJ 2;  5A7W A;  5LRS A;  1QQP 3;  2YYO A;  4FO9 A;  4A41 A;  1QJY 2;  1QNY A;  1COV 1;  2XBO 2;  4RHV 2;  5ANN A;  2G19 A;  2OS2 A;  4AEK A;  4BCU A;  4XYX A;  1VBC 3;  1Z78 A;  2DV9 A;  5KXB A;  1QH6 A;  3IB3 A;  1FYU A;  4IEZ A;  4RS5 A;  3ZSJ A;  1EYB A;  2XVG A;  2IXL A;  4N7I A;  4LE3 A;  4RQP A;  5CYY A;  5FYH A;  3KT7 A;  3T3Y A;  3A23 A;  3NKG A;  2FMY A;  1MZ5 A;  1W9Y A;  2PAE A;  2ZX0 A;  3SQO A;  2Y33 A;  5AFE A;  1AHS A;  2OYZ A;  1YFU A;  5KBF A;  1HRI 1;  1EUU A;  1MEC 2;  3DCQ A;  3E6B A;  5FZ0 A;  1SLT A;  2VQ0 A;  4M4R A;  3UL2 A;  3T1M A;  4CEW A;  4FOY A;  3SLI A;  1UZV A;  3RZJ A;  5FO9 B;  4FPO B;  2XLF A;  5FZ6 A;  1QNW A;  3N9Q A;  2XGX A;  4UF0 B;  1T2X A;  1HXS 3;  4K40 A;  1HQW A;  1PMH X;  3MFC A;  4UFH A;  1NLS A;  1XU1 A;  3OUJ A;  3ZIW A;  4R52 A;  5LK7 B;  2ZGR A;  2WZP P;  2PXJ A;  3KS7 A;  2PLV 2;  3LA2 A;  2BGO A;  2WUH A;  2JD9 A;  4ISR A;  1CAV B;  1O8S A;  4CVU A;  1ULE A;  5KHK A;  5HV0 A;  3VKN A;  1ACC A;  2R07 3;  4GMP 1;  1OF4 A;  2YBS A;  3MF9 A;  3EHK A;  3MIF A;  4N8M A;  2P5B A;  2WSU A;  3H1Y A;  1NLQ A;  5HV4 A;  4URA A;  1W04 A;  4ASL A;  1D0G A;  2Y0O A;  2VOW A;  4J1W A;  5A3P A;  3CIH A;  5E16 A;  4NID A;  1GNH A;  4BM8 A;  1HB3 A;  1MZ6 A;  1V9U 3;  3PU8 A;  2YU1 A;  4FCA A;  4E8C A;  5FXX A;  5CA6 A;  4Q4X 1;  3VDD C;  3ZDS A;  3GGL A;  1UWW A;  3VDD B;  2F4L A;  3MDP A;  3ZSK A;  3RGB A;  2GC1 A;  4K8F A;  1HKD A;  1O5U A;  4XJ8 A;  3TEX A;  2EXK A;  4YG6 A;  3ZSM A;  1A34 A;  1W8W A;  3WHU A;  3JBG 2;  4QX0 A;  5A3N A;  4BQ5 A;  1SBF A;  2EXI A;  5JVV A;  3ZMO A;  4AHX A;  3IDE A;  3K3O A;  2VG9 A;  3TWI A;  5JOY A;  3J9S A;  4RA0 A;  1LU2 A;  1OUX A;  1RXF A;  1XC6 A;  2A3Y A;  2HWB 1;  3TBD A;  1OMI A;  3MV0 1;  2J22 A;  3ELN A;  3VZO A;  2D6N A;  3HBZ A;  5K8S A;  2VBB A;  2VME A;  4E4Z A;  5FOJ B;  3WF2 A;  1H9W A;  4BPZ A;  2UY8 A;  1ODM A;  4XF4 A;  4WVM A;  3WQ0 A;  2ZHL A;  4XE9 A;  1RUF 1;  3OEB A;  5F6L B;  1RB8 G;  3M3Q A;  4JKL A;  4A7Z A;  4F8A A;  2BBV A;  5FDB A;  2Y6L A;  1W6M A;  1W90 A;  4LBQ D;  3MI8 A;  2FCT A;  4CEY A;  4OQ8 A;  1LED A;  3J8F 3;  4GKY A;  4EN9 B;  4P9Y A;  3MIB A;  1BZW A;  5A6Y A;  3B9C A;  4AED C;  2W1W A;  5J1X A;  4AED B;  3P3P A;  3I49 A;  2DTY A;  3GCX A;  1WW7 A;  4GIQ A;  2P2K A;  4IE5 A;  3O12 A;  4KU8 A;  4LO4 B;  3KZ4 C;  2HH9 A;  1HV1 A;  5GZD A;  1AR7 1;  2VMG A;  1MPX A;  2VZU A;  2BJS A;  2DTW A;  2X5I A;  3B02 A;  3IDB B;  4MAD A;  1PZ8 A;  2HEW F;  4KWL A;  3KHB A;  4QPG A;  4UAP A;  4XTM A;  2P3I A;  3A0N A;  3WDW A;  3H1M A;  1S55 A;  5IVE A;  2W52 A;  2FCV A;  4Y1X A;  1F2N A;  1QJZ A;  1VAM A;  2GAL A;  3VLB B;  2JDY A;  3ES4 A;  4S2D A;  1HB2 A;  1U5X A;  1FX5 A;  5EP9 A;  3GBW A;  2P34 A;  1PIV 3;  3I54 A;  2JX9 A;  2JEM A;  4AVA A;  5IYY A;  3PUA A;  4YW3 A;  1AR6 3;  4AFC A;  4XIO A;  4ZPI A;  3USS A;  1S2B A;  1VBD 2;  2J7M A;  3U07 A;  5A32 B;  4M01 A;  2GMP A;  4I0A A;  2OQ6 A;  2PHD A;  4BLJ A;  3SH5 A;  4XF3 A;  3B5L B;  3N3H A;  2ATF A;  2WAB A;  4AFB A;  4NIG A;  3M1H A;  5A33 B;  5FPV A;  1RMU 2;  2E32 A;  5L7O C;  1LHU A;  1RUG 3;  5L7O B;  3LDK A;  1VRH 1;  3H7Y A;  4P9J A;  1TMF 3;  4TWT A;  2HWF 3;  5EJZ B;  4CU6 A;  1AR8 1;  2JG9 A;  1AX2 A;  1NY7 2;  1ND2 A;  1REF A;  4YZ1 A;  1DF0 A;  5BXX A;  1V6O A;  1O4Y A;  1G86 A;  3JD7 3;  3NNF A;  5BNN A;  1UIJ A;  1Y4W A;  3H7J A;  3QAC A;  2D6M A;  2P17 A;  5JIA A;  3VBR A;  3AC0 A;  4AHY A;  1W8T A;  5F7U A;  3NWK A;  2PHW A;  1YIF A;  4XJ9 A;  4Z07 A;  1CX1 A;  2D3R A;  1DHK B;  1RYY A;  4XJA A;  4YZ5 A;  1DLL A;  2D97 A;  1WBL A;  1XYN A;  4CCK A;  1HW5 A;  1ZYB A;  2WNE A;  1DZR A;  3NJY A;  1SLL A;  2GDF A;  4YZ4 A;  1HX6 A;  4CXX A;  4DIN B;  3AP6 A;  5JXI A;  2ES3 A;  4E2Q A;  1F5J A;  1OI6 A;  4XAE A;  5F39 A;  1OQE A;  1I1E A;  1PGL 1;  2TEP A;  3DYM A;  4K20 A;  3DEM A;  4PF1 A;  3N9P A;  5DUU A;  1P8J A;  4Y1V A;  3V0B B;  1OD5 A;  5C9A A;  4XF9 A;  2Q0A A;  2IXJ A;  2O14 A;  4UXA A;  1ZBA 2;  5IUQ A;  1DQ2 A;  1SZB A;  2WC2 A;  5JOW A;  3OYW A;  3KCY A;  3KF5 A;  3VHN A;  3CU7 A;  3GM8 A;  4C1W A;  4CCJ A;  1AXY A;  1W9T A;  5EJ1 B;  1GQH A;  1C1F A;  3AYE A;  1MS3 A;  3B3Q E;  3FZ3 A;  3VN4 A;  4P00 B;  3GHM A;  3CLP A;  3D6E A;  2WFF 3;  4ES9 A;  2DUQ A;  3PU3 A;  5IAX A;  4IEQ A;  3NL1 A;  2IFR A;  3K75 B;  4XPV A;  4YRD A;  1CJD A;  5GAL A;  1AYM 3;  1JYC A;  2D40 A;  5LY2 A;  3CEW A;  4IUG A;  3SIS A;  1JZ3 A;  1XJA A;  4LR4 A;  3MLJ A;  1LOE A;  4DY5 A;  2NQY A;  2VZ3 A;  2VQU A;  5M0T A;  3L9J T;  5IVF A;  4KL1 A;  2K0G A;  5C7G A;  4ZZ8 A;  3N36 A;  5CFC C;  5IAT A;  4YFW A;  5CFC B;  2MEV 3;  5BY5 A;  5DQ0 A;  2Q8C A;  5B2G B;  3KM5 A;  2RS5 1;  4HBN A;  1CJP A;  5ERL A;  2YC0 A;  5FYT A;  2EIB A;  4OQ9 A;  4Z2A A;  4LO7 A;  3ZXL A;  4H7M A;  2C6S A;  3MPB A;  5C8W A;  5FMD A;  2J1E A;  4JQT A;  1BEV 3;  1GZW B;  1UXZ A;  1AR9 2;  1KXG A;  2QVS B;  2WJS A;  3U14 A;  1OOP C;  5F2S A;  2ZX2 A;  2RVA A;  1OOP B;  4UFL A;  4W6X A;  1N3O A;  1BBT 3;  2CV6 A;  1DCS A;  4XFH A;  4CP1 A;  3FHA A;  4M0N A;  4BQ1 A;  5FZ3 A;  4F3J A;  2Z5W A;  4W50 A;  3AZZ A;  4K7J A;  2YBK A;  3IMN A;  5ACA 1;  1RUN A;  4BU2 A;  1HN0 A;  5JSO A;  4WVZ A;  3SXW A;  3KQR A;  3FWE A;  4YFZ A;  5A7S A;  1NZI A;  4UFK A;  1NG0 A;  2OII A;  4UW4 A;  4DY3 A;  4KBB A;  1PVC 3;  2C9A A;  4IL7 A;  1NZC A;  4D7Y A;  4IEW A;  1FOD 2;  1G7Y A;  1JU3 A;  1WCU A;  1MS4 A;  2Q1F A;  1X82 A;  4KWU A;  4COU A;  1FPN 2;  4DNY A;  2VMD A;  3OBA A;  4LHS A;  2VVF A;  3RZK A;  1KGY A;  4C8D A;  3M3C A;  4U36 A;  1YQ5 A;  5CZK A;  4MH0 E;  2RMU 1;  4HT1 T;  1TME 3;  3O1P A;  1AL2 3;  5FPB A;  4JVA A;  1CWP A;  4KGG A;  4PDW A;  2YHJ A;  2DYC A;  3OF1 A;  4JGZ C;  3IWZ A;  4AGR A;  4XQW A;  4JGZ B;  3ZYI B;  5FPA A;  1S0D A;  3SCG A;  3R05 A;  3ACF A;  3ZYB A;  3S5A A;  1Q8S A;  3PJY A;  3NST A;  3KV9 A;  1UW8 A;  1JTZ X;  4LK6 A;  5G05 L;  3PLQ A;  2R04 2;  1ULG A;  1OA2 A;  1PO1 2;  1RHI 2;  1W99 A;  4IGO A;  4LIU A;  4MGI E;  1RVF 1;  3T2O A;  2WT0 A;  3KT4 A;  5H9R A;  3WUC A;  2Y6H A;  4AZZ A;  2E9Q A;  5T5P A;  1A6C A;  2OPK A;  3NQH A;  3HT1 A;  5F5C A;  2BWA A;  3OUH A;  1UNB A;  4LBL A;  4XET A;  3OG2 A;  4OUE A;  3KVB A;  1Q8V A;  1ZM1 A;  1V6J A;  3U10 A;  3VB9 A;  3HR9 A;  5J37 A;  2ARA A;  2PHL A;  4LTA A;  5KHG A;  5ABJ A;  2IUW A;  1W6O B;  5T52 A;  5CG8 A;  5A7W B;  2DU1 A;  2GSY A;  3JCI A;  1KDK A;  1L7Q A;  1GIC A;  1OA4 A;  1HRV 3;  1YI7 A;  3CQO A;  3LF7 A;  4PF5 A;  4RS5 C;  3V0A A;  2VPV A;  4BDV B;  4RS5 B;  4GA9 A;  2W9X A;  2Q30 A;  1ZRC A;  1NE6 A;  2BGC A;  2Y60 A;  4RQP C;  4OHV A;  2DVF A;  1VBA 1;  4RQP B;  2R0F A;  3LAG A;  4LO6 B;  3JB4 C;  4PJY A;  4MGZ E;  1RIN A;  1ZZC A;  5CVR A;  5DUX A;  4TTG A;  4EZH A;  2CSG A;  2FDK A;  2ZML A;  3WIN E;  3K2O A;  2HBU A;  4AE2 A;  4HOO A;  1UOB A;  5FPZ A;  4AAX A;  4AVS A;  2Z79 A;  1MQT A;  3ZYP A;  4OMC A;  1JUI A;  4Q2F A;  3RMX A;  4CEW C;  4DRR A;  4CCM A;  2ET1 A;  4CEW B;  4FPC A;  1JYI A;  2NLR A;  1CD3 G;  2DDU A;  3DV8 A;  1YO8 A;  3E5U A;  3I4I A;  3I97 A;  4NR1 A;  4BK4 A;  3OY8 A;  3C3V A;  1S0I A;  5E88 A;  1PX3 A;  5HCA A;  1FV3 A;  3WDX A;  2C26 A;  3MHZ A;  4YM2 A;  3WW1 A;  4UWD A;  1AXZ A;  2ERF A;  1VRB A;  1CIW A;  3IMM A;  5F5I A;  2G1M A;  4K8R B;  3UT0 A;  1UZ0 A;  1IS6 A;  1JOP A;  1NT0 A;  4TXW A;  3C2U A;  3N7K A;  5SV8 A;  1X7N A;  3ZDV A;  2FDI A;  3ZXG A;  5FWE A;  4DUX A;  2P3K A;  3C7O A;  5IK8 A;  3WCR A;  1D4M 1;  4Q26 A;  1KS5 A;  4HK8 A;  2OUJ A;  5C6C A;  1H6X A;  1XE7 A;  1C28 A;  1FT9 A;  3B7M A;  1A8M A;  3MW4 A;  5FO8 B;  4W6W A;  4MYE A;  5DPN A;  1FMD 2;  1RUI 3;  4FBF A;  1YC6 1;  1YJL A;  2XLG A;  2BDR A;  4IGP A;  2EF6 A;  2C4X A;  3M7A A;  2JD4 A;  1FXZ A;  2MHF A;  3DEC A;  4Y5Z 0;  2E53 A;  2HEV F;  4CU9 A;  1AYN 3;  4C90 A;  3AKS A;  1K5J A;  2H0B A;  3Q8A A;  2VBD A;  1QQP 1;  4RSU A;  3CMG A;  4YW4 A;  4PQ9 A;  1JUH A;  5A7P A;  2V72 A;  1VBC 1;  2RDQ A;  3OPW A;  3J7H A;  3LA7 A;  2Y38 A;  4CDQ A;  2QQN A;  1R1A 3;  4JTN A;  4LIV A;  4QMA A;  3H8U A;  3UNP A;  1YQC A;  1QEX A;  3ALQ A;  3AX4 A;  3NJX A;  1HRI 2;  5FCC A;  2QDR A;  1ULD A;  1LHW A;  3UGF A;  1ZZ7 A;  2WA4 A;  5F6K A;  4GKX A;  4ASK A;  3TN9 3;  5A6X A;  1MAC A;  1US3 A;  3NVC A;  4QB1 A;  2Q1Z B;  3C7F A;  5FXV A;  2WZR 2;  1XE8 A;  4WVM B;  2DCT A;  1O59 A;  5A70 A;  3PUQ A;  5FRE A;  2DVD A;  4OHZ A;  4Q4Y 3;  2B9V A;  3RWN A;  1WME A;  3G6J B;  4CEY C;  4FAH A;  1W6M B;  2ADD A;  2D43 A;  2WYS A;  3WDY A;  4CEY B;  4ARX A;  1X33 A;  4ASM B;  4G9S B;  3ZKY A;  1I5Z A;  1HXS 1;  4M00 A;  4RYD A;  1W06 A;  1Q8O A;  3JQX A;  5F3C A;  1AF9 A;  4MG2 A;  4OFG A;  4OI0 A;  2ORZ A;  2XJU A;  3FJS A;  2RS3 2;  2VC9 A;  4XUO A;  1H8T A;  4Q4V 2;  4GXL A;  1OC1 A;  4Y1Z A;  1OLM E;  2KXL A;  3M2M A;  3W9A A;  5HXM A;  5FLJ A;  1DZQ A;  2X5I C;  3DGT A;  4QPG C;  1VBE 2;  4I02 A;  2X5I B;  3GJB A;  4QPG B;  5EYY A;  5ISL A;  1EV1 2;  2Z4F A;  4PI2 A;  4DFS A;  3RI9 A;  2EIC A;  1OFN A;  1R09 3;  4G4F A;  1EY2 A;  2W95 A;  1SHW B;  2VUD A;  3WP6 A;  1E5S A;  3KSC A;  3WG3 A;  2OX0 A;  2FDJ A;  1UKR A;  2F4P A;  5FP7 A;  1KDM A;  1XNK A;  2R06 3;  2YGL A;  4CSW A;  2VUC A;  1X9P A;  1S1A A;  4LNV A;  2RS1 2;  4DXR A;  2ZKN A;  1GNZ A;  3POS A;  3NO8 A;  5GLZ A;  3ZN4 A;  4U2A A;  1V9U 1;  5EIY B;  3HQU A;  4N9I A;  4XBN A;  1UL9 A;  4YM1 A;  2VXR A;  4UI9 L;  2RM2 3;  3HN1 A;  3PDQ A;  1H4G A;  5C33 A;  4RGG A;  2HWE 3;  3N9O A;  2VXJ A;  4EN0 A;  1O3R A;  3AKQ A;  1XPW A;  2A75 A;  1Q3E A;  4HPK A;  4XIL A;  4I0W B;  4XHX A;  4GB3 1;  3ZSE A;  2DCJ A;  5KHJ A;  3GZT B;  1LGN A;  4NO4 A;  3BI3 A;  2JG9 C;  2VAU A;  4LO5 B;  1ND2 C;  1UOG A;  2JG9 B;  2RR1 1;  4UW5 A;  5DDJ 3;  1ND2 B;  5DAW A;  1RUF 2;  4K21 A;  2P37 A;  2V5Y A;  1QJY 3;  2XBO 3;  3TYJ A;  3EYP A;  4JV4 A;  2HWD 2;  3TNP B;  5FYV A;  5GZG A;  1GSL A;  3VD9 A;  2WIN B;  4IE7 A;  3UGG A;  3VBR B;  2BVB A;  3VKL A;  5A1F A;  1EUT A;  4QDR A;  5K7P A;  3WD5 A;  1QF3 A;  2XOM A;  1CES A;  1VMH A;  2WT2 A;  3GAL A;  4Q29 A;  3X29 B;  5FPX A;  1Y43 B;  1WD4 A;  3GF6 A;  2B4K A;  2ZEY A;  3D3A A;  3N9L A;  2SLI A;  1IPS A;  3HJR A;  3J8F 1;  5F32 A;  3ZR5 A;  4FAG A;  2W2I A;  4LLF A;  5CBL A;  3ME2 A;  1O3S A;  1XXN A;  2VH9 A;  3TAY A;  4XC9 A;  1OPO A;  2AH2 A;  1YFY A;  2YC4 A;  3S6P A;  3I3M A;  1ASJ 2;  4B29 A;  1MEC 3;  1ZRI A;  5FP9 A;  4YW6 A;  2YFU A;  4QX3 A;  5C9A C;  2DVB A;  5C71 A;  5C9A B;  2OT7 A;  1G9F A;  2V09 A;  2VW1 A;  5FZH A;  1PGW 2;  3ILF A;  3VDC A;  3FLT A;  5F3G A;  2B42 B;  1Y7B A;  1V6N A;  3OYW B;  2ZCW A;  3BYW A;  3PVE A;  2DU0 A;  1JH5 A;  2HYK A;  4AI0 A;  2HYX A;  2DCY A;  3O1M A;  1E57 A;  2XL9 A;  1ZZB A;  1LOG A;  2PLV 3;  4YZ2 A;  3SH4 A;  4QM9 A;  3K77 A;  4BQ4 A;  2XDV A;  1PIV 1;  1WLT A;  2TNF A;  1LJ7 A;  2ZGU A;  2GN3 A;  3ITQ A;  1RUE 2;  2FBE A;  1AR6 1;  2A73 B;  1VE0 A;  3HNY M;  1QJU 2;  3ZYG A;  4NIH A;  5DUW A;  1ZZ9 A;  1TG7 A;  4LXL A;  2P4E A;  3H9A A;  1RXG A;  1PGS A;  4QGM A;  3III A;  4QQ2 A;  1CR7 A;  4XMI A;  3LIG A;  5JSP A;  1W0N A;  4IDZ A;  3ZFF A;  1Y3T A;  2GC0 A;  1HN1 A;  1W2U A;  1XYP A;  4HN0 A;  4M3C A;  2XQR A;  3WXP A;  4YNI A;  1MZF A;  1NA1 A;  2R7E B;  1LEM A;  4RD7 A;  4BMB A;  4UW6 A;  4OHX A;  4MXW A;  3HPN A;  1RUG 1;  5KC6 A;  1OLR A;  1TMF 1;  1DU3 D;  2HWF 1;  2PTM A;  1PM7 A;  4AI8 A;  2Q8O A;  2WO3 A;  2JDZ A;  1LGC A;  3JBG 3;  3UES A;  3WOG A;  4YG3 A;  3T2P A;  1W8H A;  3JD7 1;  4AQS A;  1PNG A;  4BXF A;  2A3X A;  3VD5 A;  4I01 A;  3BVC A;  2JDH A;  2ZGT A;  3PUR A;  3N7M A;  5FZ7 A;  4DXZ A;  1UU6 A;  3HAG A;  1VAV A;  2VCC A;  2JDP A;  3FHI B;  3MZH A;  2OVU A;  3RZM A;  4XCB A;  1GZC A;  2E7T A;  2Y26 A;  1RL3 A;  2V4A A;  3KCX A;  4JKK A;  2CWS A;  4OLL A;  4UFM A;  4YWA A;  3NNM A;  1SG3 A;  4X6Q B;  5LBB A;  4BH9 A;  2E31 A;  4A7Y A;  1U5Z A;  4P9L A;  1Q8Q A;  2VW0 A;  4Q0U A;  4L2N A;  2AEY A;  3AP7 A;  3TNQ A;  5K0U A;  2ZZQ A;  5LA9 A;  1MS0 A;  3OTF A;  5E8A A;  3VD3 A;  3NRU A;  4JRA A;  4OCT A;  4J25 A;  2CGO A;  3R4S A;  5CIS A;  1SBE A;  3M3I A;  4B3N A;  3VDB A;  4CCL A;  1W03 A;  4P5Y A;  3AFG A;  1ZRD A;  3GYD A;  4KG0 A;  1S0B A;  2PHX A;  5FXZ A;  1DQ5 A;  3U78 A;  3GHN A;  4LLO A;  5A7Q A;  4PDW C;  3HT2 A;  4HFS A;  4HSL A;  2ARB A;  1UAI A;  3A22 A;  4IW3 A;  4PDW B;  4S2F A;  1F5F A;  1JZ7 A;  4PQQ A;  4O61 A;  1V0A A;  5FJH A;  3R0R A;  1G6N A;  1AYM 1;  4NHY A;  3AL5 A;  4NRO A;  3BIW E;  4RL7 A;  3LWC A;  4BE3 A;  4TYS A;  4YLZ A;  4CDW A;  4XEZ A;  4XQ4 A;  4TSV A;  5FXW A;  3MO4 A;  4IE0 A;  5AC9 2;  4A3X A;  5EYX A;  4IND A;  1QWR A;  1W2A X;  3OJB A;  1O5L A;  2ZGP A;  4LOT A;  2MEV 1;  3MEP A;  4YW5 A;  3L2H A;  5AVA A;  4DEV A;  1VBD 3;  4QHB A;  1YIP A;  4KWK A;  1TQ5 A;  5I0D A;  1ZX5 A;  4QQL A;  1PO2 2;  2C0Z A;  5HCB A;  3VZJ A;  5ABJ C;  1YFW A;  5ABJ B;  1G9D A;  1BEV 1;  3VBH A;  2QZ3 A;  1JHN A;  4CUA A;  1RUC 2;  1RMU 3;  3WT3 A;  1POV 3;  3WX5 A;  1PM4 A;  1IS3 A;  2A3W A;  1BBT 1;  3CF6 E;  5DXD A;  5A7N A;  5KR7 A;  2ZBJ A;  2UWB A;  4QDS A;  3AVR A;  3V0A B;  1JI6 A;  2IFW A;  4X8N A;  5FY9 A;  4WM7 A;  1QMJ A;  4EJR A;  1UY0 A;  1NCQ A;  4JDM A;  5JR7 B;  3WF1 A;  3CHX A;  3WNK A;  4E2S A;  5L9V A;  3ZFE A;  2VZV A;  2CAU A;  3J4U H;  1PVC 1;  4DEQ A;  4CUC A;  5BUV A;  1GAN A;  4GH4 A;  2W94 A;  4N90 A;  5ANQ A;  2BNO A;  1O3Q A;  1MQT C;  1X50 A;  2QTW B;  1MQT B;  2JG8 A;  3AP9 A;  1CPN A;  2Y6G A;  5LA0 A;  2ZHK A;  3I59 A;  2WN2 A;  2W0X A;  5J36 A;  3H8R A;  3OY8 B;  3B69 A;  2D7F A;  1O4Z A;  1ALY A;  4ZKT B;  1W6P A;  1S2E A;  5FWJ A;  1TME 1;  5LB6 A;  4M4P A;  2K2S A;  4AR2 A;  2B8M A;  4ET7 A;  4QHZ A;  1AL2 1;  1C8M 2;  4L9B A;  5IVJ A;  1ZBA 3;  1XU2 A;  5HBA A;  3HQR A;  3O14 A;  4N53 A;  1KJR A;  3NNJ A;  2X10 A;  2QQI A;  3NV4 A;  2JE7 A;  3WG2 A;  3N9N A;  4A6S A;  1RVF 2;  1OUS A;  2XJP A;  3POB A;  4FPY A;  4NPM A;  1H2K A;  2W68 A;  3F95 A;  5LRR A;  2VM9 A;  1JOD A;  1UZW A;  2PHU A;  4ZZ5 A;  4XBL A;  1QY4 A;  3UV9 A;  2E6V A;  4A42 A;  4BHP A;  4Q0Q A;  4CDU A;  3T0D A;  4BQY A;  2SBA A;  3KT1 A;  4UFJ A;  5FO7 B;  3D5O A;  2XKO A;  5FBJ A;  3U4S A;  1Y9Q A;  2NZ9 A;  2Z2S B;  2OW4 A;  2CL2 A;  1RTV A;  3TOJ A;  1GZT A;  5I93 A;  1GOF A;  1D2S A;  2XKP A;  3I2J A;  3SKJ E;  3HBK A;  2ZX4 A;  4CA9 A;  2FZ2 A;  3RFR A;  2B5H A;  4HLT A;  4KG8 A;  4Z1V A;  1S0C A;  2VGD A;  2E7A A;  4N9H A;  1N3P A;  2QDN A;  1LKN A;  3KV5 A;  1UYZ A;  4E8D A;  3I3D A;  2I07 B;  3PIG A;  1I9R A;  1MVQ A;  1HRV 1;  1LHN A;  1JYV A;  5FK8 A;  3C7E A;  1LEC A;  2K9Z A;  2I74 A;  3KCC A;  3LFI A;  4JX0 A;  3VBS C;  4CDQ C;  2XL7 A;  3VBS B;  3LPF A;  4CDQ B;  2LAL A;  1H30 A;  1AR9 3;  5DAB A;  4PIY A;  3LB9 A;  1US2 A;  5LA2 A;  4JTO A;  5FZI A;  1NX9 A;  3OGG A;  4Q4W 2;  3I2I A;  2CTV A;  3I2O A;  3BTA A;  5H9Q A;  3DKW A;  2KA3 A;  1PMI A;  3HQX A;  5FYB A;  3WNP A;  2C9K A;  1LOF A;  4A7K A;  4XXP A;  1GP4 A;  2VCM A;  3DL3 A;  4WZC A;  1EAH 2;  1XND A;  3V56 A;  5JSR A;  3E6D A;  1F31 A;  1OVP A;  2K46 A;  5LEJ A;  2YPD A;  1UXX X;  2VVD A;  3SC7 X;  1RUD 2;  1A78 A;  1GWK A;  1FOD 3;  3ZYJ B;  2PFW A;  1W8F A;  1K45 A;  2VMI A;  4N7U A;  1FPN 3;  3ZPO A;  1H8T C;  1H8T B;  3QH6 A;  1CVN A;  4A2U A;  3WSO A;  1C5I A;  2IWG B;  1M06 G;  1F35 A;  3T4H B;  3WP3 A;  4Z82 A;  4KQ7 A;  5EPA A;  2VMF A;  4YYO A;  4XUN A;  2CGP A;  2R16 A;  4X6R B;  5EZW A;  1TEI A;  2X05 A;  3PME A;  5T3N A;  3BIE A;  4BIS A;  1ZVF A;  2IVJ A;  3PUI A;  1MS9 A;  4NIA A;  1SLB A;  1W3X A;  3IBM A;  1UYP A;  2RJ2 A;  1F9K A;  4R9D A;  5E6H A;  5LK5 A;  2VW2 A;  1OUR A;  1RUI 1;  4S2G A;  1VJ2 A;  2YRO A;  2WWU A;  5BNP A;  2BV4 A;  2R04 3;  5I91 A;  1PO1 3;  1RHI 3;  4ZON A;  4BXS V;  1AX1 A;  1W9S A;  2ILM A;  3THD A;  1AYN 1;  1ENQ A;  2DVA A;  5BNO A;  1XRU A;  1GV9 A;  4HPK B;  1XNC A;  1LOB A;  1WW5 A;  1QGL A;  2Y6J A;  5GLV A;  3C7H A;  5FUP A;  4QKN A;  3ZM8 A;  3LZZ A;  4AI1 A;  3AMQ A;  1UY3 A;  3AYC A;  3R4D B;  4P9W A;  2BFU L;  4FSJ A;  3J26 N;  3KWV A;  4YPJ A;  1R1A 1;  1E5I A;  4XF0 A;  3UKN A;  2RJK A;  2Y0I A;  1W05 A;  1YLL A;  5J98 B;  2VBP A;  5A6Q A;  1IS4 A;  2O8O A;  3IDA A;  2Q5T A;  4NHX A;  1N1Y A;  5FYI A;  1LAJ A;  3IPV A;  2IXC A;  3TN9 1;  3ETP A;  3PVN A;  4OZX A;  4P02 B;  2PHF A;  3MUY 1;  1RUO A;  2QQL A;  4MXV A;  4XDQ A;  5J3U A;  1U5I A;  3WW3 A;  5JXH A;  4Y5T A;  4YVW A;  1PMJ X;  1JMU B;  4EYU A;  1R1Z A;  2R30 A;  4Q4Y 1;  5A3W A;  3E5Q A;  2A71 A;  4P9G A;  5A7O A;  1JOJ A;  5HCF A;  4QAW A;  1FNZ A;  4DO0 A;  2WNV A;  2I2S A;  3M70 A;  4LKF A;  3POF A;  4BIF A;  4CXW A;  5A6Z A;  5F9T A;  2UYA A;  2BQP A;  3USU A;  4LBQ A;  1QJX 2;  5FPU A;  5JWP A;  4LA3 A;  3WF0 A;  3B9I A;  3LD8 A;  4D3W A;  1LTE A;  2ARX A;  2QCS B;  2EIG A;  3VZM A;  5JOX A;  2RHP A;  2IXH A;  5A80 A;  2WWS A;  3VBU C;  2ZGN A;  1GU3 A;  3VBU B;  1BXH A;  4ISQ A;  4SLI A;  2WZE A;  2ZGS A;  2WNU A;  1R09 1;  2DFB A;  5FK7 A;  4QKB A;  5EXO A;  4ZU5 A;  1UOF A;  3D0S A;  3AZX A;  4HVO A;  5FZ4 A;  5T55 A;  5JI9 A;  2Z42 A;  3K3N A;  1CAW B;  2R06 1;  3FLR A;  4ZY9 A;  1JZ8 A;  1XE0 A;  2CGN A;  2RDR A;  4QX1 A;  4S2H A;  4LBO A;  4LBJ A;  2ZOE B;  2WNO A;  1OBN A;  4E2G A;  2B7Y A;  1Z0H A;  4MHR A;  1NKG A;  4QQP A;  4IGQ A;  2XVK A;  4GB3 2;  2NYY A;  1JHJ A;  4NRM A;  1L7L A;  4B4P A;  1UY2 A;  2RM2 1;  3T08 A;  4A4A A;  2FDH A;  4FQZ A;  2VQA A;  2HWE 1;  5IFT A;  3VD4 A;  1FMD 3;  3ZFF C;  1YRZ A;  3WG4 A;  2GN7 A;  1WLC A;  5FY8 A;  3ZFF B;  4BQW A;  1C1L A;  2RR1 2;  4M3C B;  1NA1 C;  3BPZ A;  1VBB 2;  4JAA A;  4EN6 B;  1NA1 B;  4LA2 A;  2QQO A;  4QX8 A;  3RYK A;  1EPZ A;  1JZ5 A;  1GQP A;  4MXW B;  4K9S A;  5FR3 A;  3AJZ A;  4AG4 A;  4L11 A;  5DZG A;  4XFF A;  5DDJ 1;  4UOJ A;  2BRT A;  4Y33 A;  1QJY 1;  1WLW A;  2XBO 1;  2X09 A;  4KU7 A;  1JZ2 A;  4XTP A;  1C57 A;  1K3I A;  2DCK A;  4FVV A;  2N7G A;  2ADE A;  2PQQ A;  2D44 A;  5IK7 A;  1WCS A;  2HWC 2;  2L9L A;  4URT A;  4XDO A;  1S4C A;  2D6K A;  1POV 0;  4OI1 A;  2YU2 A;  3PUS A;  1HRI 3;  2ZEZ A;  1L7R A;  1VB2 A;  2JDN A;  1A8D A;  4ORF A;  4GZ9 A;  4WBB A;  3W20 A;  1AZD A;  1RUH 2;  3FHQ A;  1KRI A;  4FFF A;  1VB4 A;  5FTT C;  5FZL A;  2Q1M A;  1LRH A;  2VJX A;  2WZR 3;  3RWK X;  4XUR A;  4C91 A;  3VZN A;  5K0U C;  2Y64 A;  1MEC 1;  5K0U B;  4BQ3 A;  2AYH A;  1STM A;  2WR9 A;  1REE A;  2VNG A;  3LSE A;  2MNG A;  2R49 A;  1FNY A;  2D93 A;  2WS9 2;  4FPJ A;  4Y26 A;  3AL6 A;  4BME A;  1C3H A;  1ZBE 1;  4GQ7 A;  4MGS A;  4IES A;  3IAQ A;  5GLT A;  2W46 A;  1YQ8 A;  2BNM A;  4ONU A;  4PBP A;  4Q8K A;  2AC1 A;  3VD7 A;  4MX3 A;  1H1M A;  2RS3 3;  4Q4V 3;  4XIK A;  1UX6 A;  4LHL A;  3T2T A;  2BGP A;  3I8T A;  1OPM A;  2PLV 1;  2ZXQ A;  3OEA A;  4NRQ A;  4XFI A;  5C5T A;  1DYK A;  3WQB A;  1VBE 3;  2HLE A;  4OUM A;  3W58 A;  3BTX A;  2W1U A;  1EV1 3;  2JDU A;  4JC1 A;  4YW2 A;  1CX4 A;  1YQ2 A;  4IV1 C;  1UN1 A;  3JU9 A;  2FD8 A;  4IV1 B;  3RJ2 X;  4HK9 A;  3KQ4 B;  4CDW C;  4CDW B;  2BYV E;  3CDZ B;  2VO5 A;  5JDB A;  3AMM A;  3THP A;  1KD7 A;  2RS1 3;  3POW A;  4QU2 A;  1JYN A;  2QBX A;  2WSV A;  3H3Z A;  3LEG A;  4CXY A;  4M0H A;  1Z7S 2;  3JD7 2;  5BNQ A;  1GP5 A;  2LW8 A;  1M4W A;  2VY0 A;  3KD4 A;  5GJ6 A;  5J96 B;  2W5F A;  3ACI A;  4XAB A;  2KM2 A;  1IZ3 A;  2WRA A;  1R08 2;  2WT1 A;  2JJ6 A;  3VBH C;  4CPB D;  5KXD A;  3JBG 1;  3MF6 A;  3VBH B;  4YAR A;  5FZM A;  1J1T A;  3ZLI A;  4CDX A;  3ACH A;  3WR0 A;  4B7E A;  2GND A;  5C70 A;  1RUJ 2;  2LRO A;  4XMA A;  1GUI A;  3ZFG A;  3ZYR A;  1YNA A;  4HSJ A;  3BOD A;  5APA A;  5I8Y A;  3GBG A;  3AVS A;  4WM7 C;  3CZJ A;  5DG2 A;  4DXT A;  1NCQ C;  4WM7 B;  3O0X A;  1NCQ B;  2HWD 3;  2GU9 A;  1SDW A;  5FYC A;  3ZFE C;  4Z8B A;  4YG0 A;  1IOA A;  4W4Z A;  2QQK A;  2J1T A;  4XDP A;  3AZW A;  3W21 A;  3ZFE B;  3O1R A;  5HCH A;  4GH4 C;  4GD4 A;  1YYN A;  3BAL A;  4GH4 B;  2LS6 A;  2UUR A;  5CEH A;  1HV0 A;  2JG8 C;  4CCC A;  1URX A;  4OMD A;  2JG8 B;  3VL8 A;  4DRV A;  3R4U A;  3I59 B;  3MLK A;  4NN0 A;  5C5U A;  2P3J A;  3SH3 A;  4ZS2 A;  1ASJ 3;  4XBQ A;  1B35 A;  2CAV A;  4XHB A;  3WZ1 A;  4KNC A;  4C0H A;  1W6P B;  1LCL A;  2QE3 A;  4Y1Y A;  5CG9 A;  2A7A A;  1NUK A;  4YSF A;  1TE1 B;  2XON A;  4N53 C;  1GYK A;  5KXC A;  2BFU S;  4N53 B;  2WII B;  1W8O A;  5CU1 A;  4LKD A;  1K42 A;  2VZ1 A;  2YUE A;  1JYW A;  3C7G A;  5FUN A;  4DPN A;  1COV 2;  1OHF A;  3QCW A;  3WNX A;  4DUW A;  3ECQ A;  2ZHN A;  4CDU C;  1LHO A;  4CDU B;  2LM3 A;  3DYO A;  3FBM A;  3WQ1 A;  1TZO A;  1GKB A;  5FY4 A;  2XHN A;  5FZO B;  3O5S A;  2OZ6 A;  4LUL A;  2WL1 A;  3ACG A;  1RUE 3;  3FBY A;  4LBK A;  1HB1 A;  2XR4 A;  3LIH A;  5JIU A;  3TEW A;  4MHU A;  4COW A;  4D69 A;  1QJU 3;  3OSD A;  2Z69 A;  2R0H A;  2WBK A;  4MV2 A;  3VBS A;  1VBD 1;  1GWL A;  2VZP A;  5F2W A;  4Y3O A;  1H2M A;  3RS6 A;  1I3H A;  3ETQ A;  3MUZ 1;  4YGB A;  4LHN A;  4E4D X;  3Q8C A;  4FFG A;  4M3C E;  5K4L A;  5FZ8 A;  4MGY E;  3SHR A;  1RMU 1;  2YPJ A;  1POV 1;  2PMW B;  3CL1 A;  4GWM A;  4NJ4 A;  5DAQ A;  1W39 A;  1CZS A;  3NMB A;  1V6L A;  3I3B A;  4HN1 A;  3H1W A;  3AYD A;  1PVC 2;  1CIY A;  1CPM A;  2X29 A;  1NY7 1;  4IE4 A;  4YW1 A;  1ZA4 A;  3WP5 A;  4AEM A;  4EWA A;  5I8T A;  4CCE A;  4DS0 A;  1WUV A;  1SLA A;  5C3S A;  3OD0 A;  2ET7 A;  1VIW B;  2A6Y A;  4A45 A;  5JXJ A;  5C3O A;  3LKJ A;  5CFD A;  1G9A A;  2WKK A;  2A6V A;  2EAA A;  1LOF C;  2BOI A;  2QJV A;  3B94 A;  3LSD A;  5DAX A;  3WNN A;  4GUL A;  1PVX A;  2ZGO A;  3A0K A;  3MYX A;  3RZH A;  4Q0V A;  3U0Z A;  1IPJ A;  2JXA A;  2VZR A;  2Y6K A;  2XWJ B;  3I2F A;  3T2Q A;  2PAM A;  3FUO A;  3H3L A;  4Q8L A;  2R07 1;  5A1L A;  2GP5 A;  1O91 A;  2YG0 A;  3BB6 A;  1QOS A;  2YZ4 A;  3FMG A;  4BQ2 A;  2W87 A;  1UPI A;  4Q4X 2;  3PHM A;  1YWK A;  5C4W A;  4MGK E;  1ZBA 1;  2ENR A;  5JPM B;  2VMC A;  3KV4 A;  2Q8E A;  5IT6 A;  1UMI A;  1WA4 A;  3SIT A;  4UBH A;  2H0V A;  4AI3 A;  1XB9 A;  5LA1 A;  1UZZ A;  2D6O X;  3M4F A;  1SQ4 A;  3P1I A;  4R9A A;  1WLD A;  2VTX J;  1NQJ A;  4FOW A;  5LEK A;  5I0T A;  2XH6 A;  1QH7 A;  1XNT A;  2XUE A;  1DGW X;  1WZX A;  1N47 A;  1SLI A;  1OA3 A;  1YXW A;  1RIR A;  3WY6 A;  3ZIX A;  2HWB 2;  2ZHM A;  4CE8 A;  2JIJ A;  2BZD A;  4E9K A;  1S0F A;  1QIQ A;  3ASI A;  2PN5 A;  2DBN A;  4XAC A;  5FQ0 A;  2YMZ A;  3D8C A;  4BJ0 A;  5BNP C;  5BNP B;  2RDN A;  3VBO A;  1SFP A;  4PIZ A;  1YCI A;  2PAK A;  2KR2 A;  3KGL A;  4YVS A;  3G7D A;  5IW0 A;  5A3U A;  5F3I A;  1IG3 A;  5AC9 3;  2P3Y A;  3KF3 A;  3LEK A;  4QB2 A;  3FUQ A;  3NNG A;  4RHV 3;  2D3S A;  1JU4 A;  3LDR A;  2ZGQ A;  5BNO C;  2EXJ A;  5BNO B;  4SBV A;  2ARC A;  1H0B A;  1H2N A;  3C8X A;  3SMH A;  5F5A A;  1BKZ A;  1PNF A;  5LBF A;  4MLO A;  4ATE A;  3APB A;  3KGZ A;  2XPJ A;  5FKB A;  3ZXJ A;  2J1U A;  3OB8 A;  5HPO A;  2QUO A;  3FFZ A;  4NAO A;  3SCF A;  1PO2 3;  3AKP A;  3F2Z A;  3HMY A;  3QLQ A;  4NOT A;  2VNV A;  1AR9 1;  2CWM A;  3WNM A;  1RUC 3;  4AQT A;  4DXS A;  1RGS A;  1WMX A;  4RGK A;  1ZA7 A;  2VTX A;  2NP0 A;  1AR7 2;  2BTV C;  5DZE A;  3S7E A;  1QKQ A;  2Y8K A;  5FZF A;  3KHC A;  2G9F A;  3HNM A;  1CON A;  1F15 A;  2PHT A;  2W39 A;  3IPV B;  5LY1 A;  2BUK A;  2VEC A;  1D2Q A;  2XJS A;  3AK0 A;  3B01 A;  2LUW A;  2QZ2 A;  4YVW C;  4CU8 A;  1ULP A;  1N3Q A;  4YVW B;  1QOO A;  1UZY A;  5DAP A;  2W92 A;  4O65 A;  5F3E A;  3VBU A;  4C0B A;  1XNB A;  3ABZ A;  3WCS A;  4NHK A;  3WNL A;  3TEZ A;  2C24 A;  2WNV C;  4A6O A;  5IVV A;  1C5H A;  2WNV B;  3VHO A;  3WW2 A;  3PJQ A;  4GWN A;  4PLN A;  4LEJ A;  3WV6 A;  3HWJ A;  2BEO A;  5C3R A;  2J1A A;  3USU B;  4LBQ B;  1FOD 1;  3WF4 A;  4JHT A;  1ONA A;  1FPN 1;  3IKW A;  3PUH A;  1CAW A;  3OCP A;  2GZW A;  2BPA 2;  1MVE A;  5FIX A;  1UIK A;  3DUI A;  4HL0 A;  2ZA9 A;  3E97 A;  4BB3 A;  1BVP 1;  2WNU C;  3U11 A;  1NYW A;  2WNU B;  4QXK A;  1CAU A;  1PHM A;  2E51 A;  4LIT A;  1C8M 3;  5JZG A;  1F8V A;  1ENX A;  1VRH 2;  2AZ5 A;  5FY0 A;  4LOS A;  3SKV A;  1AR8 2;  2EAL A;  3I2H A;  2VOK A;  4ZXK A;  1ULC A;  1RVF 3;  1AUY A;  1W8U A;  2VNR A;  2OQ7 A;  4FFH A;  4IV3 A;  1W6N A;  3POI A;  5FMB A;  4ATF A;  1ZRR A;  4GMP 0;  4AI2 A;  1DYP A;  5GZE A;  4FTE A;  5LBE A;  4CZS A;  4BA6 A;  2VQT A;  4DMI A;  2R04 1;  1FI2 A;  2OA2 A;  3E1F 1;  3H42 B;  3P3N A;  1F4A A;  1PO1 1;  1RHI 1;  2FCU A;  4P5H A;  5LWB A;  5F37 A;  1TVG A;  5D2A A;  5L36 A;  4LT5 A;  1KEX A;  2C5D A;  4Y4R A;  5G04 L;  4IEP A;  2A1X A;  2JDA A;  5FZE A;  2WLP A;  4BK5 A;  1AX0 A;  2DWR A;  3AMN A;  4GAL A;  5IHR A;  1JXN A;  2VCB A;  3WDT A;  1W2O A;  4AOC A;  1VAL A;  3RYP A;  5AVP A;  2O8Q A;  1PGL 2;  3PIJ A;  1AJK A;  1LOA A;  2BWC A;  2LRP A;  1YEW A;  4DIQ A;  5E1R A;  2WQ4 A;  1MS5 A;  5B4N A;  5L9R A;  1O3T A;  5FV3 A;  2GC3 A;  5A3O A;  2A6X A;  5DZF A;  3AB0 A;  3VL9 A;  3RYR A;  2F6B A;  3DN7 A;  4RGA A;  5EJ3 A;  1W3V A;  2JWP A;  4IEU A;  1F4H A;  3IM0 A;  1DGL A;  1UU4 A;  1IG0 A;  4I3G A;  4QX2 A;  1LEN A;  1CAX A;  1GNY A;  1SLC A;  1WCQ A;  4FFI A;  4Q0S A;  1ZRF A;  2X8K A;  4DQA A;  2ZX3 A;  4Q4W 3;  2JKX A;  1POQ A;  4WVV A;  4AL9 A;  4KGQ A;  4JGY A;  4Q1P A;  2Q8D A;  4AF9 A;  2A6Z A;  2E33 A;  2JE9 A;  4YM3 A;  4Z2W A;  3ORJ A;  3OGV A;  3E5X A;  4AK3 A;  1YQ6 A;  2ID4 A;  4FXG B;  4X8P A;  2DUR A;  2A5Z A;  5FBZ A;  5A1A A;  3MIH A;  3ILN A;  1ST8 A;  2GNT A;  3A21 A;  4XXA A;  2WFF 1;  3OPZ A;  4IEX A;  4IE6 A;  4RN5 A;  1AXK A;  1EAH 3;  3T0A A;  3A4U A;  1LOD A;  4EE2 A;  3LGR A;  4MSV A;  1UYY A;  3PL0 A;  1RUD 3;  3AMP A;  4IV1 A;  4JRL A;  1QDO A;  1LUL A;  3HN3 A;  4ES8 A;  5A3M A;  3HEI A;  4IEV A;  4BLI A;  1WWY A;  2RS5 2;  2W08 A;  4V1P A;  5F8P A;  1JS9 A;  1HDK A;  3GJA A;  1DLC A;  1T6G C;  2XJQ A;  2WWJ A;  2YB7 A;  4FQ4 A;  2UYB A;  3HNB M;  4YW7 A;  3AXD A;  1W28 A;  3KVA A;  1QXJ A;  3CJX A;  4HET A;  4TZD A;  3I2K A;  4Y20 A;  2OXB A;  5ACA 2;  3BTZ A;  3ZKU A;  1JYT A;  4WM8 A;  4Y22 A;  3AXE A;  3K4A A;  3PVB B;  1DYO A;  1WCK A;  4AQ2 A;  1H9P A;  3OBR A;  5FKC A;  3AKR A;  4OHW A;  4D7T A;  2KD7 A;  4FOV A;  4C1X A;  1J3R A;  4AAP A;  4XFA A;  4NAM A;  3HVD A;  2HJI A;  5FAX A;  2X53 S;  4LE4 A;  3URF A;  4FP3 A;  5FZ1 A;  3AZV A;  4QXB A;  4FPF A;  4IEO A;  4CCO A;  1FAY A;  4CDX C;  1QOT A;  3OPT A;  4CDX B;  5I0R A;  1H8V A;  4BQX A;  1GWM A;  1UKG A;  3HD8 B;  5H9S A;  1HB4 A;  5I0U A;  3ZFG C;  2R32 A;  1X36 A;  3T09 A;  3ZFG B;  2RMU 2;  3O0W A;  1DQ1 A;  3ZSL A;  2EIE A;  1APN A;  4CP2 A;  2R6Q A;  5FZD A;  3T0B A;  2OUH A;  3JXS A;  3OGS A;  1L3J A;  4M3C F;  4TLF A;  3TEY A;  5FLI A;  1YJK A;  4HVR A;  4BYY A;  3ATG A;  1LR5 A;  1LU1 A;  2IVI B;  1ZBE 2;  2GH2 A;  1JW6 A;  1K12 A;  2WZR 1;  5CAD A;  3DF0 A;  4H3W A;  4YGD A;  3NW4 A;  4JKM A;  3NKT A;  4ZU4 A;  3D82 A;  3RPQ A;  3OBZ A;  1UY4 A;  4XCA A;  1ULF A;  5HXV A;  5BYN A;  1DGR A;  1ZRE A;  1OT5 A;  1ZZ8 A;  1UPS A;  4FPK A;  2VTF A;  1NE4 A;  1QJX 3;  4P9X A;  2QQP A;  1OF3 A;  4EZ4 A;  1HJF A;  2CYF A;  1B35 C;  1VMF A;  4BZ4 A;  5F5Q A;  1B35 B;  1D7P M;  3EBR A;  5JMC A;  2RS3 1;  4Q4V 1;  2D6P A;  2RDS A;  5FZO A;  3MIG A;  3EXU A;  2B39 A;  5C8C A;  1W0O A;  1G9C A;  5J48 A;  5LAT A;  1VBE 1;  3INA A;  2QKD A;  1WMF A;  4KMQ A;  1EV1 1;  2YV8 A;  5E89 A;  4ZU7 A;  3S5Q A;  1IKP A;  4XOG A;  5DUV A;  2NMO A;  1FV2 A;  3AM2 A;  4O7X A;  2ORX A;  2I45 A;  1DFQ A;  5LCW L;  5EQU A;  3GZE A;  1NCR A;  4JDO A;  1X8E A;  2VZS A;  2VE1 A;  1JYX A;  1MZE A;  4N43 A;  1DG6 A;  1UU5 A;  2VZO A;  3N7L A;  4YGC A;  1ND3 A;  5HI0 A;  1KS4 A;  1LOC A;  2EVX A;  4CP9 B;  2RS1 1;  4OUS A;  2NN8 A;  3DYP A;  4P9I A;  5KHI A;  3JZV A;  1GFF 2;  4MO3 M;  1VBA 2;  4MOA A;  4QGN A;  4ARY A;  3MFA A;  1W6Q A;  3ZN6 A;  1W2N A;  3POJ A;  4GB3 3;  4D6R A;  2XJR A;  3CBN A;  4DB5 A;  5CB7 A;  1GLH A;  3IT8 A;  4NHM A;  4OYU A;  1KJL A;  2XVL A;  3ZYF A;  2G9G A;  1BYH A;  3DXT A;  2E26 A;  1PZ9 A;  2RR1 3;  5L19 A;  1VBB 3;  3TB0 A;  3THT A;  2RE9 A;  5FZC A;  3DPR A;  3B00 A;  3J7N A;  4OZO A;  1BLZ A;  1J84 A;  3V64 A;  2QNK A;  1BVV A;  2WQ8 A;  1I6X A;  3CJI A;  5FMO L;  2WO2 A;  3SEE A;  3VBF A;  5CAZ A;  2GP3 A;  1O7F A;  4B4R A;  2ZAH A;  4H7L A;  5FOB B;  2CY6 A;  2DBI A;  2V5D A;  2HWD 1;  4QGL A;  1X8M A;  4IER A;  5CFD C;  2YDE A;  2HWC 3;  3MIC A;  2JE8 A;  3RMY A;  2BNN A;  5CFD B;  5I0S A;  2W91 A;  3W5M A;  4P14 A;  1D4M 2;  3UKV A;  4L92 A;  4FXK B;  2WQZ C;  3BPS A;  5A3T A;  2Y34 A;  2ZGK A;  4NPR A;  4XFG A;  2ZAA A;  1RUH 3;  4FTB A;  1CN1 A;  1XNA A;  4AW7 A;  4O9G A;  3U4X A;  1O4T A;  3FE5 A;  3P6B A;  4V2V A;  1OQ1 A;  4COZ A;  1ASJ 1;  5CNA A;  4LHK A;  1DQ0 A;  3UGH A;  3MLL A;  1Y9M A;  3D4K A;  5J7M A;  5C4W C;  2WS9 3;  4J1X A;  1DBN A;  3Q9O A;  4LMF A;  4NHL A;  1PGW 1;  5C4W B;  4PCR A;  5BV6 A;  4EV0 A;  1SAC A;  2EXH A;  1O6U A;  5L9B A;  1IQD C;  5T5O A;  4I0B A;  1QQP 2;  3AJY A;  3VKM A;  3KMH A;  2J1R A;  1H2L A;  3WG1 A;  1MR5 A;  1PK6 C;  3AZY A;  1VBC 2;  3QH7 A;  1PK6 B;  3Q8F A;  4OHY A;  1J3Q A;  4ZHN A;  3R6S A;  3VZL A;  1BMV 1;  3PVO A;  3LQC A;  1S0G A;  4AGV A;  2DF7 A;  1OQD A;  5F1R A;  5IK4 A;  2DCZ A;  2B45 X;  4TN7 A;  1RUE 1;  2WZ8 A;  2YC2 A;  3RQ0 A;  5FP8 A;  5FQ0 B;  2G4I A;  2WFP A;  1Q8P A;  1QJU 1;  1H6Y A;  2JDM A;  3VBO C;  1DZT A;  3NV1 A;  1ULO A;  2VNO A;  1N1T A;  3PNA A;  4K1Y A;  4YVS C;  2OKX A;  3VBO B;  4AVC A;  4B8E A;  1UO9 A;  4YVS B;  5LZ6 A;  1JBC A;  3NNL A;  1WA6 X;  2WYF A;  4EWE A;  1VLN A;  2QQV A;  2VZT A;  3ZYH A;  1KQR A;  1NXD 1;  2RG4 A;  2DUO A;  3BCW A;  1Z7S 3;  3EMR A;  1VR3 A;  3HOB A;  2C1F A;  1CZT A;  3K48 A;  4HMZ A;  1NLR A;  2WLQ A;  1HXS 2;  2XLA A;  4L99 A;  5T5L A;  1C8N A;  4RR3 A;  3VHR A;  1R08 3;  4XFB A;  4CCD A;  3ZO0 B;  3ZXF A;  2P6H A;  4FI9 A;  3OGJ A;  3WF3 A;  3GCW A;  4FPH A;  4D6S A;  3I7D A;  3M3O A;  2DFC A;  3M3E A;  2BP6 A;  4XJW A;  1HLC A;  5FPL A;  4G3Y C;  4PBO A;  1RUJ 3;  1MS1 A;  1UMH A;  2FHR A;  2PEL A;  4I3P A;  5FYS A;  2VU9 A;  3U37 A;  3UKT A;  1DGW A;  1WW6 A;  1GZ9 A;  4QPW A;  4D0Q A;  4HVQ A;  4XF1 A;  1GQG A;  2R07 2;  2CU5 A;  1W9W A;  4Y1U A;  5IWF A;  1J59 A;  3LE0 A;  4XZU G;  1N1V A;  4AFM A;  1WCD J;  5CKQ A;  1SPP A;  2FZ1 A;  3H8O A;  3H50 A;  3Q8B A;  3RSJ A;  2YFZ A;  3VGI A;  2D6L X;  3BOW A;  1GP6 A;  3FL7 A;  4PT6 A;  1V9U 2;  3IZO A;  4XUT A;  4NII A;  3I3Q A;  4J6G A;  3UJQ A;  1HQN A;  1SFN A;  2NMN A;  5D8A A;  3ROU A;  3W59 A;  1KFU L;  2JEC A;  1E5R A;  4QB6 A;  2R1D A;  4B1L A;  1DQ4 A;  2ZX1 A;  5JZG C;  1CAU B;  2JKB A;  3U1X A;  2E63 A;  5JZG B;  3WNO A;  3Q8E A;  2F17 A;  5CKM A;  5JPN B;  2V73 A;  2YBP A;  5KHH A;  3N9M A;  5FZB A;  2AUY A;  2ZEX A;  2G9Z A;  4IV3 C;  5FYM A;  3VKF C;  2VZQ A;  2WDB A;  1YFX A;  4IV3 B;  1COV 3;  1UX7 A;  1V6I A;  1W6N B;  2ZJC A;  2IXI A;  4PLM A;  1IHM A;  1WMD A;  3BGA A;  5JOZ A;  4Z92 B;  1I5P A;  4W8J A;  3WW4 A;  2JEN A;  3N4M A;  2ETE A;  2WO1 A;  4KH9 A;  2A70 A;  5AC9 1;  2VCA A;  2QQJ A;  4RHV 1;  5BPX A;  2XJV A;  1E5H A;  1SMV A;  3H0O A;  1OKQ A;  4IQP A;  1OVS A;  3WDV A;  1G8W A;  1QDC A;  3ZN5 A;  1JZ6 A;  2H6B A;  3J8F 2;  3AFK A;  1V00 A;  5FP3 A;  1WKY A;  4E27 A;  4XQD A;  4EWD A;  5B4X A;  2NM1 A;  3WDU A;  2VUL A;  4PLO A;  4AI9 A;  1PO2 1;  2IXK A;  3BUC A;  4ITC A;  4RFT 0;  4PI0 A;  1NQD A;  2JIC A;  4JZR A;  2MPF A;  4K1Z A;  1RUC 1;  2P1B A;  4R9B A;  3NAP A;  5I8S A;  3EB7 A;  3EJK A;  2LTN A;  3WP4 A;  5J09 A;  3BTY A;  3NV2 A;  2WA3 A;  1XBF A;  4ZXE A;  5FZA A;  3GNE A;  2UY9 A;  3RZL A;  3V65 A;  2VOX A;  2ZKL A;  2CHH A;  2R1B A;  1UMZ A;  4WVW A;  3GZU C;  4FPE A;  3GXU A;  3O1T A;  1CAX B;  1J58 A;  2JB4 A;  4GWJ A;  3EQE A;  1S0E A;  4JGY C;  1PIV 2;  4JGY B;  2ZAC A;  3IAP A;  3ZR6 A;  1DQ6 A;  3ZOI A;  4COV A;  1AR6 2;  5FY1 A;  1U12 A;  4GMP 3;  5GLW A;  3VDA A;  5JCT A;  1H4H A;  2TUN A;  3JB8 A;  3KB5 A;  2O0O A;  4GAZ A;  4JCK A;  1EP0 A;  1K5M A;  1TNF A;  3JQW A;  3WEZ A;  2XXZ A;  1B09 A;  1OD3 A;  4I09 A;  2YXS A;  1PX4 A;  5JXG A;  2ZGL A;  4MET A;  5DG1 A;  4ZS3 A;  5GLU A;  4Q4X 3;  5GKA C;  1OSG A;  1C8M 1;  2UWC A;  1RUG 2;  2WN3 A;  4HKW A;  4QPI A;  2XQX A;  1TMF 2;  3NJZ A;  2HWF 2;  2ZGM A;  1QJF A;  4L8Q A;  5FMO S;  1G9B A;  5LBC A;  5FUI A;  2OZJ A;  4LK7 A;  1BQP A;  4E4S A;  3MW2 A;  4LKE A;  2H6C A;  4KI5 M;  3VZK A;  2PA7 A;  2XG3 A;  2J42 A;  2ZMN A;  1J1L A;  3MW3 A;  4H2A A;  4AHZ A;  3AMH A;  4QXC A;  1X9T A;  2ZEW A;  1LHV A;  5FFO C;  4CUG A;  3HIF A;  2VUA A;  3BKZ A;  2HWB 3;  1W8N A;  4QWN A;  1A3K A;  4Y20 B;  4WM8 C;  3NV3 A;  3VV1 A;  2VUJ A;  2XJT A;  3FC0 A;  4WM8 B;  4Y22 B;  2FDG A;  4AGG A;  3O1V A;  2AEN A;  4Q27 A;  5IVB A;  3MPP G;  4EQV A;  3RDI A;  3J7M A;  5IAV A;  3OUI A;  2Y6F A;  2W3J A;  3FLP A;  1J83 A;  1N1S A;  3CKH A;  3LPG A;  1RUF 3;  2JIG A;  3RI8 A;  4AFA A;  1Y9G A;  2QFE A;  5FZK A;  4D94 A;  3LOB A;  1VAK A;  5IK5 A;  1UCX A;  2FQP A;  4XVH A;  2VMH A;  1V6M A;  4NWV A;  3LEM A;  2B9U A;  3LCP A;  4UF0 A;  4YZ3 A;  2XML A;  5FJK A;  3RVH A;  3AP5 A;  2ZPX A;  1OFS A;  1OLQ A;  5FLH A;  1ODN A;  4RFR B;  4WV8 A;  4GWI A;  3B93 A;  3ZXD A;  2J1S A;  3E6C C;  1CQ9 A;  3LOI A;  2GC2 A;  1UQX A;  5DMY A;  1AR7 3;  4XFC A;  5C3Q A;  1CAV A;  2WFF 2;  3IN9 A;  4H55 A;  4Q4W 1;  4HKL A;  5FP4 A;  4BIO A;  3A7Q A;  3OBT A;  3GZA A;  3OD4 A;  4UBG A;  3S57 A;  1DDL A;  1AYM 2;  2GME A;  5FYU A;  1ZNP A;  3O1O A;  3U75 A;  5FMC A;  3K4Z A;  1PZ7 A;  1DIW A;  1V70 A;  3MV1 1;  1QHD A;  1IGO A;  2Q4S A;  4JHZ A;  1LB2 A;  1EAH 1;  1XYO A;  4GJY A;  3RNS A;  1TNR A;  5IVC A;  5C3P A;  3GBF A;  1NXM A;  3KV6 A;  4QPY A;  1RUD 1;  1DP0 A;  4AHW A;  4PHZ A;  5DAV A;  3BU0 A;  4H14 A;  3UET A;  4XJU A;  2W47 A;  4DZG A;  2MEV 2;  3ZPY A;  3ZXA C;  2ZS6 B;  3VDD A;  4KBZ A;  2UWA A;  2A6W A;  4OVE A;  3IDC B;  5DN2 A;  4CP9 A;  4Y4Y A;  5L73 A;  5CIR A;  1IS5 A;  1QXR A;  5C8C C;  1ENR A;  5C8C B;  2BER A;  3SCH A;  3DKQ A;  1BEV 2;  4GJZ A;  1JZ4 A;  3T30 A;  4BOW A;  4XAA A;  1JOB A;  1BK1 A;  4HXC A;  1FAT A;  1BBT 2;  3WQ7 A;  2FMD A;  1D0H A;  1VRH 3;  1NCR C;  1SDD B;  4XUQ A;  2ZAB A;  1XQN A;  2BW8 A;  5EHD A;  1NCR B;  1AR8 3;  1SEF A;  1BHG A;  4N43 C;  4UYB A;  2FDF A;  1CGP A;  1KIT A;  4N43 B;  4UFI A;  1ND3 C;  2J1V A;  1ND3 B;  2E7Q A;  3OOX A;  5IJR A;  5LAS A;  1JN2 P;  4FOQ A;  1W9F A;  3AYA A;  1W6Q B;  4HG6 B;  3ZN6 B;  2O1Q A;  3POY A;  4FT8 A;  2CDO A;  3S30 A;  1C4R A;  4CUB A;  4D7S A;  4AVT A;  1Q56 A;  2ARE A;  5EV7 A;  4YGE A;  1U5Y A;  4LUK A;  4ERO A;  4AVB A;  3FN9 A;  4JDN A;  4NPL A;  1BK0 A;  1OKO A;  4FPL A;  4AEJ A;  1H1A A;  3DPR C;  5AFB A;  3DPR B;  4LOR A;  4CPB A;  3CJI C;  4AED A;  1T6B X;  3VBF C;  3CJI B;  4AVV A;  2VD7 A;  5GZC A;  2PYT A;  2B46 X;  5FRA A;  3VBF B;  2D5H A;  1TME 2;  4LQR A;  3WLU A;  4AWD A;  5K9Y A;  4KWJ A;  1AL2 2;  3POE A;  1NOV A;  4CP0 A;  5T54 A;  4XZP A;  2UU8 A;  4K3U A;  5FZG A;  4O9E A;  4UW3 A;  4K6B A;  3MID A;  4A44 A;  4QD2 A;  3POG A;  3DXU A;  2HBT A;  3JUU A;  3W5N A;  2TBV A;  1YHF A;  3ENR A;  4R8H A;  4DUV A;  3PTY A;  1J3P A;  2VL4 A;  3PTR B;  2PQS A;  4LJH A;  1DGR N;  4EN7 B;  4OI2 A;  2XHK A;  3O0V A;  1GOG A;  1QJX 1;  2HEY F;  1WGP A;  3WVJ A;  1PK6 A;  2D5F A;  3FX3 A;  4Q0P A;  5A32 A;  2AGS A;  4BWO A;  1LES A;  4R9C A;  3T4V A;  2PHR A;  1UF2 C;  2JDK A;  4QU1 A;  4QHO A;  3QD6 A;  2QQU A;  3IIA A;  1AL0 G;  1Q43 A;  1SFY A;  3K4D A;  4QM8 A;  5A33 A;  1AVB A;  4D6Q A;  2AR6 A;  3LDB A;  3RG0 A;  1GOH A;  2RS5 3;  3SEP A;  4CCN A;  2CDP A;  1HRV 2;  4P08 A;  1VP6 A;  1WBF A;  2GAU A;  5L7O A;  1RJ8 A;  5JAX A;  2VOV A;  3VHP A;  4XJZ A;  3VUO A;  3MGU A;  4FPG A;  2CNA A;  3CO2 A;  3O1S A; 
#chains in the Genus database with same CATH homology
 1L7Q A;  2RV9 A;  2Y6J A;  3CQO A;  2KD7 A;  3C7H A;  3ZM8 A;  4D8M A;  1UY3 A;  4BDV B;  2W9X A;  4YPJ A;  3NJV A;  2WAO A;  3GDB A;  3IDA A;  1OH4 A;  4XUP A;  3ETP A;  4TTG A;  4P02 B;  3MUY 1;  2QQL A;  3T09 A;  5JXH A;  4AAX A;  1PMJ X;  2EIE A;  3T0B A;  3LEI A;  4OMC A;  4A3Z A;  3JXS A;  3OGS A;  1NAE A;  2DDU A;  4QAW A;  4BK4 A;  3I97 A;  2EID A;  1PX3 A;  1K12 A;  3WF0 A;  2C26 A;  4JKM A;  4CU7 A;  1UZ0 A;  1UY4 A;  4TXW A;  1GU3 A;  1OT5 A;  2WZE A;  2VTF A;  1UYX A;  1OF3 A;  3C7O A;  3I2G A;  4DUX A;  3OGR A;  1D7P M;  1H6X A;  2BBA A;  3BN6 A;  3THC A;  1LNS A;  4ZY9 A;  1JZ8 A;  5DPN A;  4KMQ A;  4QX1 A;  5JUV A;  2ORX A;  5LCW L;  1NKG A;  1JZ6 A;  2C4X A;  2VZS A;  1JYX A;  1JHJ A;  3DEC A;  1O8P A;  4A4A A;  1UY2 A;  3T08 A;  1GMM A;  4CU9 A;  2VZO A;  5IFT A;  3VD4 A;  1R64 A;  3DYP A;  2VR4 A;  4MO3 M;  4MOA A;  3CMG A;  4ARY A;  2QQO A;  5IFP A;  2V72 A;  2W1Q A;  1GQP A;  1JZ5 A;  3J7H A;  2QQN A;  2V4V A;  4OYU A;  4AG4 A;  3UNP A;  3NJX A;  4MGQ A;  4UOJ A;  2E26 A;  2X09 A;  4LKS A;  3K46 A;  1JZ2 A;  2WAA A;  1K3I A;  2DCK A;  4OZO A;  5JR2 A;  1J84 A;  1US3 A;  3MBW A;  4QB1 A;  2WQ8 A;  3C7F A;  3SEE A;  2L9L A;  2WO2 A;  4LPL A;  1O59 A;  2ZEZ A;  2B9V A;  1L7R A;  2WYS A;  2V5D A;  4GZ9 A;  4ARX A;  3FHQ A;  4RYD A;  1CZV A;  2JE8 A;  2VJX A;  3W5M A;  4XUR A;  2W91 A;  2Y64 A;  2W1S A;  2ORZ A;  2VC9 A;  4XUO A;  5HXM A;  1XNA A;  4MGS A;  3IAQ A;  3P6B A;  4QDQ A;  2W46 A;  2Z4F A;  2EIC A;  2W95 A;  1SHW B;  3VD7 A;  1UY1 A;  3CZU A;  3I3E A;  2BGP A;  3OEA A;  2ZXQ A;  2QQM A;  3WQB A;  5JMO A;  2HLE A;  2W1U A;  1IQD C;  4DXR A;  4L0P A;  1YQ2 A;  2J1R A;  5EIY B;  4UI9 L;  2VOT A;  3CDZ B;  2VO5 A;  3LQC A;  1JYN A;  2QBX A;  3LEG A;  1XPW A;  2WZ8 A;  2YC2 A;  4A41 A;  1H6Y A;  2LW8 A;  2DCJ A;  1ULO A;  2W5F A;  3IB3 A;  3ACI A;  2OKX A;  2VZT A;  5CYY A;  3HOB A;  3A23 A;  3EYP A;  3ACH A;  1CZT A;  3VD9 A;  5C70 A;  1GUI A;  1EUT A;  4QDR A;  1EUU A;  2XOM A;  4FI9 A;  4M4R A;  4DXT A;  3CZJ A;  3WF3 A;  2B4K A;  2ZEY A;  3D3A A;  3HJR A;  4W4Z A;  2QQK A;  2J1T A;  1T2X A;  1PMH X;  1UMH A;  3U37 A;  2YC4 A;  2LS6 A;  4D0Q A;  4QPW A;  2YFU A;  4QX3 A;  1W9W A;  3LE0 A;  4XZU G;  4OMD A;  2BGO A;  3VDC A;  2WUH A;  2JD9 A;  1O8S A;  4CVU A;  2YFZ A;  4PT6 A;  3FL7 A;  2HYX A;  4XUT A;  1NUK A;  1OF4 A;  2XON A;  3K77 A;  1W8O A;  1K42 A;  2VZ1 A;  1JYW A;  3CIH A;  4QB6 A;  3C7G A;  3HNY M;  4E8C A;  3GGL A;  3WNO A;  3ECQ A;  1TG7 A;  1UWW A;  4DUW A;  3III A;  3DYO A;  1W0N A;  2XHN A;  3ACG A;  1HN1 A;  4QX0 A;  2ZEX A;  2VZQ A;  2WDB A;  2R7E B;  1UX7 A;  2WBK A;  3HPN A;  2VZP A;  3BGA A;  1I5P A;  4W8J A;  1XC6 A;  2WO1 A;  2WO3 A;  3MUZ 1;  3MV0 1;  2VCA A;  3UES A;  2J22 A;  2QQJ A;  3T2P A;  5C71 A;  3VD5 A;  2VME A;  1WKY A;  3WF2 A;  1CZS A;  2VCC A;  5B4X A;  3I3B A;  1CIY A;  3OEB A;  4JKL A;  2Y6L A;  4JKK A;  3EB7 A;  1SG3 A;  4A45 A;  5JXJ A;  2E31 A;  4ZXE A;  5J1X A;  2W1W A;  3WNN A;  3VD3 A;  3NRU A;  3GXU A;  4GWJ A;  2VZU A;  1MPX A;  2VZR A;  2Y6K A;  4MAD A;  4UAP A;  3IAP A;  4P5Y A;  3I2F A;  3T2Q A;  2YG0 A;  2W87 A;  3VDA A;  2VMC A;  3A22 A;  1JZ7 A;  4PQQ A;  1UMI A;  3WEZ A;  5IYY A;  5LA1 A;  1OD3 A;  3P1I A;  1PX4 A;  5JXG A;  2J7M A;  1XNT A;  2WN3 A;  2XQX A;  3MO4 A;  5FUI A;  2BZD A;  2WAB A;  2E32 A;  4KI5 M;  4BJ0 A;  4DEV A;  5EJZ B;  2ZEW A;  5I0D A;  4CU6 A;  1W8N A;  3LEK A;  4QB2 A;  3NNG A;  1JU4 A;  4CUA A;  3C8X A;  2W3J A;  3AC0 A;  2J1U A;  3OB8 A;  4QDS A;  1J83 A;  3CKH A;  3LPG A;  5F7U A;  5HPO A;  1CX1 A;  3F2Z A;  1JI6 A;  1RYY A;  3WNM A;  4XVH A;  1UY0 A;  3WF1 A;  4DXS A;  3WNK A;  3VDB A;  2Y8K A;  2VZV A;  4DEQ A;  5JXI A;  3HNM A;  4CUC A;  2W94 A;  3DYM A;  4PF1 A;  4CU8 A;  4GWI A;  1P8J A;  1ULP A;  2J1S A;  2W92 A;  5DMY A;  2Y6G A;  3ABZ A;  3WNL A;  5LA0 A;  4A6O A;  2WN2 A;  3A7Q A;  3GM8 A;  2J1A A;  1W9T A;  3WF4 A;  5EJ1 B;  4ET7 A;  3K4Z A;  4M4P A;  3PUH A;  3MV1 1;  4P00 B;  4JHZ A;  2X10 A;  2QQI A;  3K75 B;  1DP0 A;  3UET A;  2W47 A;  4ZZ5 A;  4IUG A;  2VM9 A;  1JZ3 A;  4A42 A;  5DN2 A;  3T0D A;  2VQU A;  2VZ3 A;  3SKV A;  3I2H A;  5C7G A;  4ZZ8 A;  2BER A;  1JZ4 A;  5DQ0 A;  1GOF A;  3I2J A;  2VQT A;  3SKJ E;  2EIB A;  4XUQ A;  1SDD B;  3E1F 1;  4Z2A A;  1F4A A;  1BHG A;  1TVG A;  1KEX A;  2J1E A;  2J1V A;  1UXZ A;  5G04 L;  2JDA A;  4BK5 A;  1UYZ A;  5IJR A;  3I3D A;  2RVA A;  4E8D A;  5IHR A;  2VCB A;  4HG6 B;  1JYV A;  3C7E A;  3FHA A;  4JX0 A;  2CDO A;  4CUB A;  4W50 A;  3LPF A;  3FN9 A;  1US2 A;  5LA2 A;  5B4N A;  1NX9 A;  3I2I A;  1JU3 A;  3WNP A;  2C9K A;  1F4H A;  4LQR A;  4KWU A;  2VMD A;  4QX2 A;  1GNY A;  1WCQ A;  3OBA A;  4LHS A;  2JKX A;  1KGY A;  1UXX X;  2E33 A;  3OGV A;  2ID4 A;  5CZK A;  4A44 A;  1K45 A;  5A1A A;  3A21 A;  3W5N A;  4DUV A;  2VL4 A;  4RN5 A;  3T0A A;  3WSO A;  2PQS A;  1UYY A;  2VMF A;  4XUN A;  1GOG A;  3HN3 A;  3ACF A;  3HEI A;  2X05 A;  5G05 L;  1W99 A;  3PUI A;  3T2O A;  1DLC A;  2RJ2 A;  2Y6H A;  3K4D A;  2YB7 A;  3HNB M;  3NQH A;  1GOH A;  3SEP A;  2CDP A;  3OG2 A;  4OUE A;  4P08 A;  4BXS V;  1W9S A;  3I2K A;  3THD A;  3K4A A;  1DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...