2Y6HA

X-2 l110f cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6hA00
5IFPA 1UX7A 3WSOA 4DUVA 4OUEA 2BZDA 4OMCA 4A3ZA 3I3EA 1US3A 3VD5A 2WAAA 2VZVA 3WNLA 1US2A 2QQNA 2VMFA 2R7EB 3NJXA 1UMHA 2WQ8A 2W3JA 3GXUA 3A21A 4LKSA 3ABZA 4ZZ5A 3JXSA 4QDSA 1UMIA 2ZXQA 3J7HA 3LPGA 1JZ5A 3ACGA 3SKJE 1WKYA 3GM8A 3IIIA 5CZKA 3AC0A 5JXIA 1JYWA 2X05A 2CDOA 3E1F1 2E33A 3I2KA 4P08A 1K42A 3P1IA 5I0DA 5CYYA 3EYPA 1GNYA 4JKMA 2EIEA 1CZSA 2Y64A 5JXHA 1GOHA 3I3DA 4MO3M 2Y8KA 3VD9A 4YPJA 2VMCA 3VDAA 3HNBM 4P5YA 4BK5A 4AAXA 1UY2A 3DYMA 1H6XA 3K4ZA 3I2IA 5B4NA 4KI5M 1XNAA 2J22A 4TXWA 2VMEA 1JZ4A 2WZEA 3CQOA 3T2OA 2LS6A 2XHNA 2WAOA 2KD7A 2X10A 3IB3A 3BGAA 4OYUA 1NUKA 4CUCA 1O8PA 2W95A 2YB7A 3MBWA 1H6YA 4E8DA 1GOFA 1CIYA 1XC6A 3I2JA 3C7HA 1XPWA 2WO3A 3T09A 5FUIA 1O59A 2DCKA 3BN6A 1OD3A 2QQOA 2ORXA 2JKXA 4XURA 1UXZA 3A7QA 1D7PM 2J1RA 1GUIA 2L9LA 2ZEWA 4ZZ8A 2VQTA 3UETA 5G05L 4QDRA 3HJRA 4Z2AA 5JXJA 3VDBA 2W94A 1O8SA 4LPLA 1SDDB 4JKKA 2VR4A 1RYYA 1UYXA 4P00B 2QQJA 1JZ7A 2C9KA 3K46A 4W4ZA 2HYXA 2VZRA 2QQLA 3UNPA 5EJZB 4XUPA 2BERA 2QQMA 1NX9A 2Y6GA 2YG0A 2VZUA 3OGVA 4LQRA 2XONA 1UWWA 1T2XA 2YFZA 1KGYA 4HG6B 5IFTA 2VCBA 3WF2A 3LEGA 3FL7A 4UI9L 1GMMA 1SG3A 2VZQA 3NRUA 2YC2A 2RV9A 4XUQA 3U37A 3WNKA 2VC9A 4QDQA 2WUHA 3THDA 4ZXEA 3C8XA 4L0PA 3I97A 3T2QA 1JYVA 2Z4FA 1LNSA 1JZ3A 3T0AA 4QPWA 1GOGA 3DECA 4D8MA 3LQCA 5JXGA 2JDAA 1PMHX 2VM9A 4QX0A 5EJ1B 2VZ1A 4M4RA 4TTGA 5LA1A 3T0BA 4QB6A 5JUVA 2W9XA 2Y6KA 2LW8A 3EB7A 3WNPA 2CDPA 2DCJA 3WNNA 3ECQA 2W1QA 1F4HA 2VTFA 1R64A 2J7MA 2E32A 4QX3A 1JI6A 4BXSV 1JYNA 1WCQA 4JKLA 3PUHA 3MO4A 2HLEA 4CU8A 1P8JA 5B4XA 2ORZA 4A42A 1OH4A 4QB1A 3SEEA 3LEIA 4KWUA 4PQQA 2Y6HA 3LEKA 4OMDA 1K12A 3VDCA 4XUNA 2VCCA 4DXRA 3NNGA 3GGLA 4E8CA 4DXTA 3I2FA 3MV11 3LE0A 2B4KA 2VZTA 5DPNA 1UY0A 2BGOA 4QB2A 4QX2A 3WEZA 2C26A 3NJVA 5LA2A 1NKGA 3C7GA 5IYYA 2VO5A 4MGSA 3CIHA 4AG4A 2VZOA 4P02B 1W9SA 1K3IA 3CDZB 2VQUA 1OF4A 2EICA 2VZ3A 2VZSA 4W8JA 3OB8A 4DEVA 1YQ2A 3VD3A 3I3BA 1UY1A 2V4VA 2W1WA 3MUY1 1EUTA 2J1VA 1UYYA 4MGQA 3CZJA 5LCWL 1UZ0A 1UY4A 4CUBA 3VD4A 3OBAA 3A22A 4JHZA 2J1UA 1UYZA 3NQHA 3F2ZA 2VCAA 4JX0A 2W46A 4CU9A 4ZY9A 3C7OA 4ET7A 3ACHA 2BBAA 4D0QA 1SHWB 3MV01 3K4AA 2W92A 2E26A 1BHGA 3W5NA 4QX1A 2X09A 4GWIA 2WN3A 3CMGA 1JHJA 2WDBA 1PMJX 5JMOA 3SEPA 3WF1A 4DXSA 2ZEZA 3ZM8A 1CZVA 1DYOA 2W5FA 4A6OA 3OEAA 2RJ2A 2ZEXA 3ETPA 4KMQA 3C7EA 2ID4A 1KEXA 2B9VA 2J1EA 1TG7A 3OG2A 2XQXA 1JZ8A 4PT6A 3CKHA 4FI9A 2YC4A 3D3AA 2WYSA 5C70A 3UESA 1PX3A 1IQDC 2XOMA 3K75B 3K4DA 2J1AA 4PF1A 3FN9A 1NAEA 2VMDA 2VZPA 2YFUA 3DYPA 2WO1A 4BJ0A 4LHSA 1W9TA 4CVUA 3HN3A 1OT5A 4DUWA 1DLCA 2VL4A 2JD9A 2JE8A 4M4PA 4BK4A 2WBKA 1OF3A 4A4AA 4A41A 5C7GA 1W8NA 4UAPA 4MADA 4OZOA 2VOTA 3T08A 3ACFA 3OGRA 2J1TA 1J83A 2WABA 1W0NA 4MOAA 3HNMA 2PQSA 3A23A 4DUXA 2WO2A 2VJXA 1JZ6A 1W8OA 3HPNA 2WZ8A 2OKXA 2EIBA 2QQIA 1CZTA 4GWJA 5EIYB 5HPOA 1PX4A 1DP0A 2E31A 3IAQA 3WNOA 4GZ9A 3HNYM 5A1AA 2WN2A 2Y6LA 3WF3A 5G04L 3WNMA 1GQPA 1HN1A 4CUAA 5C71A 4A44A 5F7UA 4XUOA 3CZUA 3THCA 4W50A 5DMYA 5IJRA 3LPFA 3VD7A 2J1SA 4BDVB 1L7QA 4IUGA 3W5MA 5DN2A 3ACIA 3I2HA 5JR2A 4CU6A 2W91A 1K45A 1XNTA 2V72A 1JU3A 4RN5A 4XVHA 1ULOA 1L7RA 2BGPA 2C4XA 3P6BA 2W1UA 2EIDA 3I2GA 3PUIA 1MPXA 3GDBA 3FHQA 1I5PA 3OEBA 1EUUA 1CX1A 2Y6JA 2W47A 5LA0A 5J1XA 3K77A 3WF4A 3SKVA 1GU3A 3MUZ1 4UOJA 4RYDA 3FHAA 1TVGA 4ARXA 1W9WA 3WF0A 3IDAA 3T0DA 2RVAA 4QAWA 1UXXX 4ARYA 3IAPA 1JU4A 1UY3A 3C7FA 3WQBA 2QQKA 1F4AA 4XZUG 4XUTA 2ZEYA 3OGSA 2DDUA 4DEQA 1ULPA 3HEIA 5DQ0A 5IHRA 2W1SA 3DYOA 1JYXA 4A45A 4CU7A 1JZ2A 1J84A 2QBXA 1W99A 3HOBA 2V5DA 5HXMA 2W87A 3T2PA
chains in the Genus database with same CATH superfamily
4QKNA 4Q8KA 5IFPA 4R4ZA 4FT8A 2JICA 3JD71 2HWE3 2YROA 4OUEA 4PIXA 5A3MA 5LY2A 1ZBA2 3UL2A 2VZVA 2XHKA 1W8UA 4UWDA 2QQNA 2VMFA 5AC92 4Y26A 2R7EB 4X8PA 4AK3A 1LOEA 1A78A 1FPN1 1EV13 2VUCA 2XVLA 4AEDC 1QQP2 1Y9QA 4LKSA 4FOWA 1OA4A 3IMNA 3ROUA 3O0WA 4JC1A 1Q5OA 4YZ3A 4C90A 4QDSA 1X33A 1QNWA 2ZXQA 3J7HA 4HN1A 4YVWB 4HK8A 2JG8B 2JENA 5DUXA 3RPQA 1JZ5A 1FNZA 3K3NA 3V64A 5K0UC 1REEA 2O0OA 3ZPYA 3ACGA 1RXFA 3M3QA 3S57A 1F9KA 1JS9A 4IV3A 1T6BX 3UJQA 1VBD1 3QD6A 5FZKA 5CZKA 5KC5A 1D2SA 4YG0A 2WR9A 2AENA 2HBUA 3IT8A 5JXIA 2X05A 1B35C 4TYSA 1RUE3 5FPZA 1MR5A 3VL8A 1DQ1A 3LIGA 3I2KA 2P3JA 4P08A 1OOPB 3V65A 1GWMA 4LBQA 3RFRA 1RHI1 1RUI3 1GNYA 1CZSA 2C24A 2Y64A 2PAKA 1OOPA 3FUOA 2D6NA 4MO3M 2Y8KA 1QDCA 4OZXA 3TN92 4IGQA 1OLMA 2RMU3 4CRQA 1MVQA 1O3SA 1SLIA 5FYCA 2RDNA 4B7KA 2WQZC 5FYZA 3HNBM 2VW2A 3D0SA 3POBA 2P1BA 5T5OA 2JE7A 2JKBA 2CGPA 3KSCA 4XF3A 1JOPA 4IEOA 4META 3S7IA 5I91A 3MICA 2WLPA 3NAPA 4JTOA 3SQOA 3CQOA 1D0HA 2UWCA 1PIV3 5FYMA 2DU0A 3BU7A 2LS6A 2R1DA 2AH2A 3WG2A 2E51A 1DHKB 1XOYA 1S55A 1VBC2 2X10A 2ZHKA 1UOBA 1HJGA 2GN3A 4EN7B 2W95A 5FAXA 1YI7A 3JQXA 4BM8A 1AR93 5CADA 2VTXA 2D3PA 3LSDA 5FZ9A 2RR11 1POV3 1NQDA 1XC6A 4B1LA 4XC9A 5FO9B 3FX3A 2KR2A 1QXRA 5L7OA 3WDVA 4Q8LA 1AUYA 3VHRA 5T54A 1ZNPA 3WP6A 5T52A 5E16A 2GN7A 4AFDA 5DZGA 1AR62 1OA3A 2HWC1 2ZEWA 1NA1B 2P5BA 3EO6A 5CIRA 3RS6A 4A7ZA 4N7IA 2ZKLA 2E9QA 1Q56A 1CAUB 1WMDA 1TME3 3HJRA 3NW4A 3ZSKA 4QPIC 2A75A 4PI2A 4XHXA 1VPHA 4XJWA 5A6ZA 4G4FA 1SDDB 3S7EA 4LKFA 2XJQA 1UYXA 3GZUC 4JDMA 3ZSMA 4XBLA 3ZSLA 4AEKA 3HVDA 1GYKA 1EAH3 4HN0A 4B4QA 3H8RA 4QPGA 1HXS2 3BODA 2VNOA 3WQ0A 2P3YA 2VZRA 2WNEA 3E6CC 3GCXA 5EJZB 4HSLA 1IKQA 4UF0A 5BNPC 3BTZA 4N53A 1LHWA 1MEC2 2YG0A 3ENRA 2VZUA 3CJIC 2VMIA 5IVJA 3OGVA 1JN2P 1RINA 2Q5TA 3T1LA 1T2XA 3RZGA 2YFZA 5FZHA 4SLIA 4RQPB 1SBFA 4HONA 3TNQA 1OURA 1WBFA 1KFXL 1R093 4KGQA 4HANA 2PQQA 3O1PA 2RHPA 2DV9A 3IDCB 3MIEA 3NRUA 1GZWA 1FATA 5DUWA 4E4SA 2ZGUA 3TB0A 2HKXA 2RS32 1W0PA 2GC1A 5FZAA 4YGBA 4EROA 1NE4A 3AZVA 1R083 4QX7A 1CJDA 3WG1A 2AUYA 2UWBA 1LOFC 1LOFA 1VBA3 4UFKA 5C4WC 4LOTA 5ISLA 5BV6A 3G6JB 3WNKA 3DL3A 1CJPA 1NOVA 1W8WA 2P4EA 1AR81 2VC9A 1HN0A 1DG6A 5FQ0B 3THDA 4DMIA 2UU8A 4NJ4A 5IK8A 2PFWA 3RSJA 3C8XA 3N9NA 2JDHA 3I97A 1FOD3 2WO7A 1TMF3 5C3OA 2IXHA 4AAPA 3OUHA 1JYVA 1JTZX 3MLJA 1H1IA 1SPPB 5L7OC 1BBT3 1AL0G 3RJ2X 3R0RA 3BKZA 2CL2A 2G19A 4D8MA 2QQPA 2YPDA 4OQ8A 4HKWA 4QX0A 1UNBA 1VBE3 5EJ1B 2YPJA 4Q0PA 2HYKA 1X9TA 1LAJA 2NP0A 5A7PA 2IFWA 2ZAAA 4GIQA 5F6KA 3VBUA 2W9XA 2FDIA 1GP6A 2XBO3 1QJU3 3HBZA 2LW8A 1V6LA 1YC61 5LBBA 1HQLA 3ZN6B 2X5IA 3WNNA 3WCRA 3H1WA 1F4HA 2VBBA 4GWMA 2EXKA 4YW2A 1QJY3 3NKGA 1SZBA 1Y9MA 2ZX4A 4XTPA 3ZSJA 4LBQD 3IN9A 4LLFA 4J1WA 2Q8DA 1PO13 2Z2SB 4AI1A 4XDQA 4ZU7A 1RC6A 1BK0A 5KXBA 4M00A 2QQVA 4O65A 4YW1A 3AL6A 2ORZA 5FXVA 1O3QA 1IOAA 5DG2A 3J9SA 1URXA 2I45A 2YXSA 4KWUA 5BNPA 4TWTA 1VMHA 2JWPA 5FP9A 1CN1A 4FPJA 1SFPA 1H9PA 3LEKA 4HMZA 1TNFA 4Y22B 5F5IA 1SCRA 1D4M2 1K12A 5FZ3A 3TNPB 3LB9A 4GXLA 2BP6A 2R063 1MQTA 3I2FA 3ZYHA 4GB31 3MV11 5FY0A 4BQ5A 4LBJA 1AYN3 4NOTA 1PVXA 1Q8PA 5FYUA 2UYAA 4RR3B 2BGOA 3VB9A 4QB2A 3AKSA 4CDXC 2PTMA 4QU2A 3WEZA 2XJUA 5LA2A 2ZCWA 4CE8A 1NKGA 3C7GA 5FDBA 1EAH2 2FCUA 4MGSA 4XJ8A 4AFMA 2P6CA 2VZOA 1LOCA 2UYBA 3DXUA 2BOJA 2VQUA 5J7MA 2H0VA 2VZSA 3OB8A 2FQPA 3ZDVA 4DEVA 3NL1A 2HH9A 3IMMA 2N7GA 1SLBA 3KF5A 3MIGA 4IV1A 2IVJA 5FLIA 2J1VA 1CQ9A 4MGQA 3CZJA 5FWEA 4F7ZA 1UZYA 2OA2A 5HCFA 4GMP1 1W9FA 4LK7A 3AJYA 3O1VA 4DZGA 2WFF3 3H8OA 1N3QA 2YBPA 2IXIA 2QVSB 4I0AA 2OQ6A 1PZ8A 1CAXA 4Q5OA 2RS33 4ZPIA 3AL5A 2PHUA 2D7FA 3KV6A 3NQHA 4IW3A 4Y1YA 3S30A 1ONAA 4XOGA 3F2ZA 3LOBA 3S5QA 3QH7A 2PHXA 1H0BA 4CU9A 1WCDJ 4JDNA 4L11A 1W6PB 4ZY9A 3O0VA 4HBNA 3AVRA 4BMBA 1GZTA 3C7OA 3KD4A 1CAVA 2P34A 1UIJA 2WA3A 2XVKA 1SHWB 2A70A 4I0WB 4P14A 1TE1B 2YY1A 2D44A 2JG8C 2DVFA 2GALA 2WSUA 3M4FA 4QX1A 4KGGA 4CDQB 3DXTA 4IEPA 2R49A 4CSWA 5LY1A 1PHMA 2WN3A 1BLZA 1RMU2 4R4XA 2WDBA 5FZIA 1Q3EA 1SLCA 5JMOA 3GNEA 5T50A 2XXZA 4X6QB 1LGBA 1WBLA 3GJAA 2ZEZA 2XKPA 3ZM8A 3P3NA 1DYOA 4A6OA 3AKQA 5F5AA 1UZWA 4AFCA 1LODA 3AMQA 4LNVA 1I5ZA 2R0HA 3E5XA 1XB9A 1QOOA 4HKOA 3I54A 3R4DB 4PBOA 5A1LA 4Q4Y1 3CJIB 3WT3A 1F5FA 4LA2A 4M0NA 4WM7A 5L73A 4K40A 3J26N 1AYM3 1SDWA 1HDKA 2B9VA 4RR3C 2ZMKA 1NCQA 1NA1C 1JZ8A 3LAGA 5C8CB 4FI9A 4CDXA 4CZSA 2E63A 2WYSA 4AEDB 4AVBA 3I2OA 3UESA 1PX3A 1IQDC 1IS3A 2XOMA 4UT5A 3VBFC 2A5ZA 2J1AA 3FLRA 1S0EA 3FN9A 1W8FA 4E4ZA 4OUMA 2WT1A 2VZPA 2XLAA 2ARBA 4GJZA 3TAYA 3VKNA 1R1A2 3JD72 4BJ0A 1W9TA 1CPNA 3AMNA 5JIUA 4CVUA 4QQPA 1E5HA 4MGKE 4NO4A 1DLCA 4NRMA 4FXGB 2JD9A 2JE8A 1AX1A 4M4PA 2E7TA 1ND2B 1OF3A 1QNYA 1VALA 2FHRA 2WKKA 2YUEA 3GHNA 4A41A 4UAPA 4OZOA 1DGRA 2E53A 1LHVA 2VOTA 2ZX2A 3WDYA 3I2DA 4XJZA 1MZ6A 4PIZA 1JYTA 1FPN3 1ZRRA 4ASMB 1LJ7A 3WY6A 1J83A 2RM23 3H7YA 1Z7S3 4Y22A 3D8CA 3D4KA 5FY1A 5GZFA 5LBCA 2E7QA 2EAAA 3NO8A 4P9WA 4FAGA 1UU6A 1PGSA 4FPGA 4AVAA 3DUIA 3Q9OA 4M3CF 3POYA 5FZ6A 3ZYIB 4ASKA 3JB8A 5FZBA 2VJXA 3TEZA 4MVTA 3RQ0A 1W8OA 3RZMA 3KLSA 3AZXA 2MHFA 3AX4A 4AE2A 2OKXA 2EIBA 4GWJA 5K8SA 4ZXKA 1QMJA 2DYCA 4QWNA 2CGNA 4UFMA 3OPZA 4GZ9A 3ZOIA 4GB32 4LO6B 1OA2A 2JDPA 5JR7B 4B4RA 3E6BA 1JMUB 2LUWA 4COWA 3LGRA 4M0HA 5C3PA 1NXMA 4XE9A 4CEYA 2VBDA 2VVDA 2JECA 3RG0A 3B9IA 3MIFA 4H7LA 1VP6A 2Z42A 3NV2A 5FZOB 1H8VA 5FYYA 3JBG2 3JZVA 2HWC2 4Y5TA 1RUF3 5FK7A 3WDXA 4HPKA 3PMEA 4MXWB 5HCBA 5H9QA 2UY9A 3W5MA 2VOKA 4Z2WA 3IIAA 1JOBA 2HWD3 2IXLA 1NY71 3I2HA 1HV0A 2BOIA 2HWB3 2LRPA 4CU6A 2W39A 5FPXA 4PQ9A 5FYTA 2ZJCA 3VBOB 4H3WA 4B7EA 1OH3A 1POQA 1BEV2 2V72A 4PDWC 3DF0A 1JU3A 5HV0A 3WCSA 3CHXA 1ASJ3 3WP5A 3SNMA 2BGPA 2EIGA 3VBRA 3VBFA 3IKWA 4UW3A 2Q8CA 5JZGC 1GWKA 1WW5A 3PUIA 1MPXA 5HV4A 3FHQA 2KM2A 1I5PA 1CAVB 1PVC3 1VBB2 4EN9B 1UO9A 1RUG3 2VVFA 2Y6JA 4KU7A 1ST8A 1GZWB 4LK6A 4Q26A 1ND2C 3SH3A 2OUJA 4CP1A 3K77A 1ZZ6A 1LOBA 4UOJA 5E88A 5A80A 3DPRB 3LA7A 3HAGA 2EALA 1AHSA 4MZUA 4URAA 1TVGA 3ES1A 4HL0A 1W9WA 4FPCA 3IDAA 1C1FA 2OW4A 4LE4A 1RJ8A 4IETA 4TN7A 5FMCA 5HCHA 1FX5A 5JOZA 4Y4RA 1AYM1 4ARYA 4ZU4A 1JU4A 4GMP3 1QJFA 4AQ2A 4MH0E 4QX8A 2EA7A 1NXD1 1XSRA 2R072 4K6BA 4UFHA 4NAMA 2QQKA 3CLPA 5C33A 1F31A 4NAOA 4BXFA 3GZAA 3ZFGB 4JGZB 4MSVA 1JYIA 3OGSA 4JZRA 4QXHA 4NPMA 1ULPA 1S0GA 2G1MA 3HEIA 3SISA 5DQ0A 4B8EA 3DYOA 1FYUA 2ZGLA 1VAVA 5APAA 4A45A 5FY9A 2I2SA 4NHKA 2CYFA 4K21A 1DFQA 1J3RA 1UF2C 4CDWA 3BTYA 2QBXA 3ZXGA 2BFUL 3POJA 5FMOS 1W99A 5JI9A 3VD9A 1GNZA 1E5SA 2VU9A 1KDKA 3U11A 1FPN2 4AI3A 4EWAA 2OYZA 4B29A 1V6NA 3EQEA 5IVEA 5M0TA 3P5BA 2VGDA 4BIOA 4EN8B 2XJVA 4OMCA 5F3EA 3I3EA 4XEZA 3VD5A 2WAAA 3LDRA 3VKOA 1US2A 2WNOA 3WNLA 1B35A 2RS31 4A2UA 4XCAA 5FKBA 2R30A 3HR9A 5DABA 3N7JA 3VBOC 1ZBA3 4O61A 1YXWA 2A3WA 4Z07A 2JG9B 1XNDA 5A7QA 3HIFA 2Q1FA 4K20A 5FY8A 1C4RA 2CV6A 5C9AB 1QQP3 1UMIA 2DTYA 2JDNA 4GB33 4COUA 2DWRA 2JEMA 3GBGA 4KQ7A 4LIUA 3I7DA 1PK6C 1G8WA 3MYXA 4O9GA 4D7YA 1KXGA 5L9BA 3SKJE 1K5MA 5FO8B 5IK5A 2FZ2A 4LHLA 1OOPC 2ZGPA 3GM8A 5DDJ1 2PLV3 4QQHA 1J3PA 1MQTB 4K1ZA 1QHDA 5D21A 1YCIA 2NMNA 3U07A 1L3JA 1HRI1 4ES9A 3AB0A 4FSJA 2E33A 2TUNA 5F37A 3V0BA 2R32A 3P1IA 1KQRA 1PNGA 1RUE2 2XQRA 3N7LA 4XF0A 2PYTA 5I0DA 5J3UA 1COV1 1BQPA 3EYPA 3V0AB 4X6RB 2HEVF 3L2YA 1YYNA 1FMD1 1I6XA 5JXHA 1FAYA 1TZOA 1W2OA 2TNFA 3I8TA 3VBHA 1KRIA 1XU1A 3V0AA 4XXPA 1E5IA 4MX3A 2VOXA 5HI0A 3NAPC 3WW4A 4YPJA 2F6BA 4YGCA 3ZKUA 2XB6C 4JV4A 2RS13 1QF3A 1UKRA 2WZR3 1S2BA 1W2UA 3ZFGA 4EWDA 1YLLA 4P5YA 1AX2A 4AAXA 4CCNA 5FPVA 1UY2A 3K4ZA 1H6XA 4FFHA 1GP4A 3I2IA 3MEPA 4KI5M 4XYXA 1XNAA 5KHGA 5KXCA 5DUVA 1DZRA 5JLVA 2J22A 3LA3A 3MFAA 3GALA 4H14A 1JZ4A 2H6BA 2KA3A 2RR12 1MS4A 3TN91 1W8HA 3OPWA 3T2OA 4WM7C 4HPKB 2WAOA 4MHRA 3WD5A 3ZFFC 1FMD2 2JDZA 3BGAA 1DGRN 2D5HA 4XFCA 1MZEA 2Y26A 1NUKA 2R043 1O8PA 3O1UA 2WQ4A 3GZEA 3BTXA 2K46A 1QJX3 3ZYJB 2R1BA 1HRI2 4I30A 4E8DA 3APBA 3OGGA 3FBYA 1CAWA 5LK7B 3IDEA 3I2JA 3LFIA 4QGLA 3D82A 5EFUA 2WO3A 3ZMOA 1LB2A 4TLGA 1G9FA 2ZGQA 4YWAA 2ORXA 3OBRA 1UZZA 3PU8A 1W6NA 1UXZA 3A7QA 5D8AC 2IUWA 4FPOB 4DNYA 3MLLA 1LEDA 4AZZA 2GH2A 2L9LA 4FPYA 2VQTA 2WL1A 1OUXA 1POV0 4UW4A 5C5UA 5JXJA 3PJYA 2WS91 1W6MB 2VD7A 1Y7BA 2A73B 2QQWA 2VCMA 2Y0IA 3WHTA 1QJEA 2IVIB 3AKPA 2V09A 3CF6E 4LEJA 5J96B 2GC3A 3K46A 5IATA 1YQ6A 2Y6FA 4OUSA 4CEWB 4YNIA 2RDRA 3D5OA 4OULA 3CL1A 1NCRB 4XUPA 4P9JA 3B02A 4NIIA 4P9YA 4ZONA 1UPIA 4IE7A 2DBNA 3WP4A 3N9LA 3OYWB 1YI9A 1UWWA 2EAKA 2XJSA 2XONA 1MEC3 1R1ZA 5F39A 3FBMA 5FP8A 4V2WA 3FL7A 3RWNA 3NJZA 3WQ7A 4YLZA 3MZHA 1Q43A 2HWB1 5JIAA 1GMMA 3RWKX 1G9BA 2B7YA 1R092 2EXIA 4OQ9A 1PNFA 4Q4V3 1Y3TA 4NWWA 2DU1A 4AQSA 1QJY1 3ETQA 1UIKA 3E6DA 3BU0A 3POEA 1ALYA 1OKOA 2XPJA 3I59A 5JSRA 4XUQA 1APNA 1SEFA 1GR3A 4YM2A 5LK5A 3U37A 4AQTA 1NZIA 4E4DX 2G9GA 4QDQA 4GA9A 4YSFA 3DEMA 3QLQA 3BVCA 3FZ3A 4IEWA 2B39A 1DBNA 3OF1A 3T2QA 3MFCA 2ZHNA 1DCSA 2RJKA 4M3CA 1O4TA 1VMJA 2Z4FA 2OT7A 1BZWA 4OI0A 4CDUA 2GMMA 3J7NA 1HIXA 1O91A 1W6OA 3T0AA 5BNNA 2XKOA 4TZDA 1YO8A 3E5QA 1LEMA 4IXLA 4KL1A 4YW5A 2QDNA 2B45X 2NLRA 3MIHA 2PHFA 1PMHX 1W6QB 1O4YA 4B4PA 4M4RA 5LA1A 2ES3A 5I0TA 5GJ6A 1V6MA 1GKBA 2WZR2 3E97A 5JUVA 3S5AA 4CEYC 4MG2A 3VZKA 3QBQA 4AHXA 4IERA 2V73A 2LTNA 3LSEA 5F2SA 1N1TA 2XL7A 2NMOA 5FZ7A 4QPGC 4CEYB 1VBA1 1GP5A 3EB7A 4UW6A 4Z8BA 2CDPA 4BMEA 2PLV1 4KG8A 2RR13 1U0AA 3ECQA 4QKDA 5IVYA 1QY4A 4BB3A 1W2NA 1D4VB 5F3GA 4YW3A 3RJRA 3NV1A 4YW7A 4F3JA 3W58A 2VTFA 4EV0A 4UBHA 3ZVXA 3T2TA 5A7OA 1OKQA 2MEV3 2ZS6B 1X8MA 2J7MA 5FYHA 3LZZA 2XJPA 5I8SA 1PO22 4IV1B 5FXWA 1OI6A 1QJX2 1SFNA 4H2AA 3LEMA 4CU8A 1JHNA 1G6NA 1DQ5A 5FZ1A 4A42A 2OX0A 4QB1A 2YGLA 3SEEA 3K51A 1RXGA 1F2NA 3LEIA 4FOVA 3GBFA 1I3HA 4PQQA 4XIOA 5BNOB 4NIDA 2Y6HA 2YYOA 1BVVA 2CU5A 2V4AA 4OMDA 2K0GA 4FPEA 4XUNA 5FZ4A 4BQ1A 5A3PA 1M4WA 1MS0A 2BU9A 4I3PA 2FDKA 3JUUA 4CP2A 1OVPA 5B2GB 3RYPA 2RMU1 4N53B 4E8CA 2ET7A 3U1XA 3URFA 3LA2A 4GH4B 1IPJA 1LHNA 2B4KA 4LJHA 4YM3A 1HQNA 4Q0SA 3FWEA 3PDQA 1C57A 4AEMA 3ACLA 1XRUA 4BYYA 2ZZQA 4HK9A 3MW3A 3NJVA 4ONUA 1YFWA 4FAHA 4JTNA 3SLIA 1RITA 2C6SA 4ASLA 2NM1A 1GQGA 3CIHA 4AG4A 4AHWA 3W9AA 5IYYA 1V9U3 4QGNA 3SC7X 4COZA 4QKFA 4CTEA 1W6MA 5CAZA 4OHYA 1HB3A 5LRSA 2QTWB 2XWJB 3LDBA 4W8JA 3PNAA 5FPBA 4AHZA 2VUDA 3VD3A 2K9ZA 4D3WA 3I3BA 4FFGA 1WA4A 1UCXA 5KHHA 3WV6A 4CCJA 4DIQA 1DQ6A 3LF7A 4Q4W3 1O5LA 4XF4A 1NQJA 1H8TA 4JGYC 3KHCA 1UZ0A 2JE9A 2Q30A 4FQZA 4W6WA 5FZLA 4INDA 4DOUA 2A71A 4CUBA 4JCKA 5EWSA 3ZFEA 3OBAA 3MW4A 4EJRA 2XJRA 3ASIA 1HRV1 5LZ6A 5LWBA 4I2OA 1QOSA 2OQ7A 1RVF1 4MGZE 4Q4V2 1LESA 3B01A 3NNMA 4CDWC 2PXJA 1GICA 2HWF1 1RTVA 3VZMA 3N36A 3ZKYA 3VZNA 2AR6A 3KV4A 4JX0A 1W05A 1ZM1A 4IEVA 1QIQA 3H8UA 4ISQA 4RHV2 1GBGA 1E5RA 1KD7A 2PHDA 1UOFA 1ZZCA 2GZWA 3N9PA 2D6OX 5EPAA 3K4AA 2W92A 4LR4A 3W5NA 3AJZA 2X09A 4RGKA 3R05A 5DZEA 5IVCA 3U0ZA 4LUMA 2VW1A 4MYEA 2JB8A 1IS6A 1JHJA 2WS93 5IW0A 2GP5A 1PMJX 3VDDB 3WX5A 4BQWA 4MXWA 5JAXA 3BB6A 4P9LA 1BMV2 3WF1A 4BIFA 4DXSA 2Y34A 4E2GA 1HXS1 4BQ3A 1C5HA 2VXJA 1ZZBA 3AYCA 4YFZA 5KWRA 5FY7A 1A8MA 2JG9C 3OEAA 1JODA 1SLAA 3GJBA 1ZZ8A 4BCUA 2ZEXA 2RJLA 2ZZJA 1HX6A 3ZFEC 1BXHA 3SH4A 3KQRA 1NY72 5GLUA 2GSYA 4RL7A 2ZACA 3C7EA 3KVBA 4DRRA 4OHVA 2BNOA 3SHRA 4CCMA 2HJIA 3OY8B 4PF5A 3INAA 1NYWA 4YVWC 2J1EA 1TG7A 5LBFA 3OG2A 2XQXA 3MDPA 4LE3A 3B5LB 5A7NA 2YC4A 3F95A 1VAKA 5A6XA 4ES8A 4N9HA 1UKGA 4EN0A 3O1TA 4CXWA 4FTEA 2WIIB 4PF1A 1NAEA 3SCGA 1EV11 2X5IC 2WT0A 4RS5C 1W3VA 2EVXA 1ZRIA 3AXDA 4AGGA 2JB4A 4BPZA 2ZX1A 2WNVB 2FZ1A 1BYHA 4JQTA 3ZR5A 3HN3A 1R1A3 3JQWA 1AL21 1MQTC 4Y1UA 2HEYF 1W8NA 5EHDA 1J1TA 4BOWA 1W8TA 2XUEA 1VAMA 3TRSB 5BNNC 1DF0A 4QXCA 3OGRA 2AGSA 1OQ1A 2YV8A 1YWKA 3FFZA 3AP4A 3FC0A 4NPLA 4D7SA 1IG3A 4YZ1A 5F3CA 2AEYA 1RUC2 1LULA 1TNRA 2IC1A 4MOAA 1SBEA 1XE7A 5T3NA 4CP9B 3AXEA 4DUXA 3QH6A 1U5IA 1F8VA 3T4VA 5IAVA 1QXPA 3TBDA 4GH4A 1CZTA 1QH7A 1W0OA 2D97A 2QDRA 5FXXA 5EIYB 1COV2 1J3QA 1OD5A 2PMWB 3AMMA 3IAQA 4PBPA 3U75A 1GLHA 3VBRC 3HNYM 3WDWA 3KB5A 1IPSA 1S1AA 1YHFA 3RMYA 1ULGA 3WOGA 1A6CA 4GWNA 4LA3A 1ULCA 1O7FA 1EV12 1RIRA 1W6PA 3OUIA 4EWEA 4NIGA 5F3IA 4XFHA 5G04L 2GNBA 1QEXA 1UU5A 2C5DA 1HN1A 3PUSA 4Q4X1 2AACA 2ERFA 4CPBD 3N4MA 4XBQA 2BEOA 4R9BA 5F7UA 5KHJA 3PL0A 1UX6A 4N43A 2W2IA 5IJRA 4BDVB 2XLFA 5I8YA 4IUGA 5K4LA 1TMF2 1RUJ1 4GJYA 4N43B 1V6KA 2D98A 3ZFEB 1JOJA 4OLLA 4CEWA 3VBSA 4YFWA 3VL9A 1L7LA 2XWBB 2YBSA 3NNJA 4AI8A 2UURA 1ZBA1 4RS5A 1I1EA 3SMHA 4AEJA 1ULOA 4DINB 2C4XA 5ACA2 4FOQA 4IGPA 1BMV1 4LO5B 4QGMA 1K5JA 1QJU1 4EYUA 1QGLA 4NHYA 4BQYA 2XJTA 5FWJA 2XG3A 2WS92 4RA0A 3NV3A 1HB2A 3ALQA 3ZXAC 2A6ZA 1NA1A 1CX1A 3EMRA 2P17A 2FCTA 4J1XA 4RR3A 2OXBA 3FFQA 4HSJA 2AREA 1ZREA 5LA0A 5FBZA 4A6SA 1RUH2 4GAZA 2BWAA 1UW8A 1S0DA 5J1XA 5J37A 3SKVA 4EQVA 4XMAA 1U12A 4K8FA 4RYDA 4J25A 3FHAA 3KHBA 3PIGA 4EZHA 1PO12 3T0DA 5CKNA 3M2MA 4GALA 5J36A 1PGW2 1IZ3A 1SACA 4XDPA 5GKAC 4QAWA 3BIEA 2VY0A 3IAPA 5C8WA 4IEUA 4HOOA 3IM0A 1AR92 3UGGA 2YZ4A 2ZABA 2A7AA 1ZRFA 1AR73 2XBO1 3N7KA 3WW2A 4YZ5A 2GNMA 1F4AA 4XZUG 5DZFA 5A7SA 4YARA 4DY3A 5FZ0A 4MXVA 5KHKA 3CU7A 1W2TA 3KM5A 5DDJ3 5LRRA 5J48A 1OHFA 5KXEA 2R062 1AXKA 1ZBE3 1WLWA 4LO8A 3UYJA 1RUNA 2W1SA 5FTTC 3U4XA 2WFF1 3Q8EA 2Q0AA 2H6CA 1CAWB 1YFYA 4LBMA 4LHNA 4Q4X3 5HXVA 4AQ6A 4CU7A 3DPRC 3ZXJA 3KV5A 2YGMA 2WC2A 2A6WA 3BCWA 1DU3D 1AL22 4Q0QA 3U10A 4WM8B 3USUB 4C0BA 2JIGA 2V5DA 1EP0A 1WLDA 5FIXA 1T6GC 5T55A 2ZGNA 1HXS3 3WSOA 3ZFFA 5IVFA 4C8DA 1UAIA 2BZDA 3IWZA 4A3ZA 4R9CA 2Y33A 2K2SA 2QZ3A 4QHOA 3AMPA 3HQUA 1GNHA 3RDIA 2WWUA 4KH9A 1EPZA 3NJXA 4CCDA 3R4SA 1ZVFA 5HBAA 1REFA 2ZGMA 2G9FA 2AZ5A 3MF6A 1DGWA 1COV3 3ABZA 4ZZ5A 2YBKA 3JXSA 4Y3OA 4XACA 3LPGA 1VRH1 3B7MA 1VRH2 4DQAA 1X7NA 4CXYA 4N90A 1RUF1 4B1MA 1YQ5A 1XNBA 4YW6A 1WKYA 2VBPA 3PUQA 3VBUB 1PMIA 3WW1A 1NCQB 5FPLA 4AOCA 3JU9A 4Q29A 1XSQA 3AC0A 2HBTA 5F8PA 1RVF3 1JYWA 4CDXB 5A3OA 2CDOA 2ZGKA 4W6YA 3ZN6A 4WVVA 4UF0B 1PZ9A 1YFXA 2F17A 4GMP0 4YGEA 4AVCA 1ND3A 3GCWA 3ES4A 3X29B 1X36A 1OQDA 5CYYA 3RI8A 4JKMA 4MGTA 3J8F1 2D6PA 1N47A 1GOHA 3RMXA 1GV9A 5CFDC 3I3DA 3KCCA 3H1YA 3O5SA 1H8TC 4JGYA 4E2SA 3BPSA 2X29A 1D2QA 3AM2A 3RZZA 1HV1A 5CG9A 1WW7A 2CTVA 3KF3A 1AJKA 5FPAA 5ABJC 4LLOA 5LW9A 2A3YA 5C8CC 1U5YA 2VMCA 5A3NA 3VDAA 5ACA3 3H1MA 1NLRA 3Q8BA 4BK5A 1BK1A 1RL3A 3VHNA 4AGRA 3DYMA 1Q8SA 2RDSA 5J98B 1VBE2 2SLIA 2OVUA 3WDUA 2ZX3A 4TXWA 2DCZA 2VMEA 2VUJA 3FE5A 4UFLA 1C1LA 2PA7A 5F1RA 4FPHA 2D6MA 5BUVA 2NZ9A 1OVSA 3AYEA 2DFCA 2PHWA 1MS1A 3PLQA 2XBO2 3EXUA 1QJU2 3IB3A 2DBIA 1H2LA 4OYUA 3S6PA 2PELA 1H1MA 4IL7A 1VE0A 4GQ7A 3WG4A 4CUCA 1GSLA 4AL9A 3WVJA 2YB7A 5D8AB 1H6YA 1LCLA 3LFMA 4UYBA 4FO9A 5A3WA 1JYCA 3C7HA 1XYPA 2BUKA 4NE9A 5T5LA 3T09A 1HRI3 1WD3A 2QQOA 5BNOC 2QJVA 4XURA 2LALA 3WZ1A 1RUD2 1D7PM 1WGPA 2J1RA 4M01A 4W6XA 4PHZA 5AFBA 3WXPA 5EYYA 3UETA 2EXJA 3Q8FA 1CD3G 5G05L 4QDRA 3A0NA 5A70A 5E1RA 1REDA 1CPMA 1AXZA 5JOYA 3UKNA 1MZ5A 4W65A 4S2GA 3BOWA 1O8SA 4X8NA 3OBTA 3J8F2 4JKKA 4E9KA 1JW6A 4P00B 4Q4X2 2QQJA 4L97A 4P9XA 3ZMNA 2SBAA 1MVEA 2JXAA 2WWSA 3VN4A 1RHI3 1RUI1 5F9TA 1RUG1 2JDMA 2A6YA 4W4ZA 3HMYA 2HYXA 3NSTA 4SBVA 1YJKA 2D5FA 4BHPA 3ITQA 5FZEA 3ZO0B 2Q8EA 2JIJA 4QPYA 4BU2A 5KR7A 1NX9A 2BQPA 2Y6GA 1LKNA 4RFT0 1WMEA 4QQ2A 2MPFA 1KDMA 4Q0UA 4BQ2A 3OGJA 1S2KA 3H50A 4H7MA 4HG6B 5LEKA 2VCBA 1O6UA 1SLLA 4WM8A 4FQ4A 2ARCA 4MUVA 4OI2A 4FVVA 1UN1A 1SG3A 4LBNA 4COVA 1Z0HA 2A3XA 2BDRA 3VHPA 1FT9A 4GKYA 4Q4W1 3LCPA 4PDWB 5JOWA 3T30A 3AFKA 4XQDA 2VOWA 1WLCA 4U36A 4C91A 3RZKA 2TEPA 2RV9A 5CFCB 1GZ9A 1MS9A 1WMFA 2CAVA 4CEWC 2VOVA 1W90A 3UKTA 3VBSB 3B94A 5BXXA 3RYKA 5CFDB 2WYFA 2WUHA 3ZXLA 5A6QA 2CY6A 3VGIA 5JDBA 1F5JA 4B3NA 5JSOA 4EE2A 1A3KA 5DAPA 2Q8OA 1RUC1 2BWCA 4YYOA 3ZYFA 1LNSA 3POSA 1JZ3A 2ETEA 5D8AA 4IE6A 5H9SA 5BNOA 3ILNA 1Y9GA 5GALA 4YVSC 2F4PA 2BBVA 1W2AX 1DQ0A 1V6IA 4XIKA 1N1SA 5H9PA 3P3PA 4DPNA 5FUNA 4CDQC 3LDKA 5HCAA 3VBRB 4WVMA 1BCXA 4QB6A 5FREA 4BE3A 4EN6B 4LHKA 2HEWF 3FHIB 4XJUA 5FYVA 3OOXA 1WUVA 2BTVC 3CJXA 3C2UA 4XJ9A 1VBC3 5A33A 2Y6KA 2BVVA 2ZGRA 3BALA 1DGLA 5E89A 3WNPA 4QXKA 1AYN1 3PHMA 2DCJA 5AVPA 2FMDA 1ASJ1 1PO11 4A3XA 1YQCA 4LMFA 2W1QA 5A33B 3IBMA 3CBNA 5AVAA 2WRAA 1ZBE1 2NN8A 5CISA 5FKCA 2ZGOA 2O14A 4QQOA 4V2VA 3NV4A 4QX3A 3EJKA 2E32A 3FLPA 4AI2A 5F5CA 1WCQA 2BGCA 5GZGA 1JYNA 2BVBA 2ATFA 3DV8A 3PMSA 2MEV2 3MO4A 3PUHA 2HLEA 4ZKTB 5BNPB 1RGSA 1AR63 1I9RA 5B4XA 2A1XA 1PO23 1OH4A 4QU1A 4N53C 4RGGA 2DCYA 5LASA 1ZA7A 2IFRA 4Q27A 2W68A 5BNQA 5AC91 5ACA1 3BPZA 3JD73 2VCCA 4R9AA 3VDCA 1YRZA 3MF9A 1XE8A 1TEIA 2X53S 4JGZA 4Q4V1 5BY5A 4DXTA 2YDEA 3IPVA 3ZXKA 1PZ7A 1UL9A 2YMZA 5DPNA 2VZTA 1UY0A 4NROA 5A7WB 2VNVA 3J8F3 3LD8A 5I0SA 1VB4A 4QM8A 2Y0OA 2O8OA 2RS52 4MV2A 2CHHA 1JUHA 2VO5A 1AR83 3O12A 4BA6A 5GM0A 5JVVA 2RM22 1VBE1 5FQ0A 1W9SA 1K3IA 4CCOA 1S0JA 1RUD1 2ZTNA 1OF4A 5K0UB 3ZDSA 3FUQA 4V1PA 1ZA4A 3KT1A 5ANQA 2ZMNA 1XYOA 2IXJA 1UY1A 2HWE2 2V4VA 2W1WA 3VBOA 3ZPOA 2BW8A 5FZDA 4YVWA 5ABJB 4Y1XA 2WLQA 4Q1PA 5FY4A 1EUTA 4Y5Z0 5FMDA 1CAUA 4NHLA 3H3ZA 2WNVC 5JSPA 5LCWL 4YZ2A 2BNMA 4AW7A 1NG0A 1RUJ3 3H0OA 3VD4A 1D0GA 1OBNA 4CPBA 3O1RA 4M3CB 1IKPA 4Y1VA 1CR7A 2J1UA 4YVSB 1UYZA 3M3OA 3KWVA 5C6CA 3ST7A 1CIWA 1ODNA 3IDBB 3PVEA 4L2NA 1G9DA 1NZCA 2JX9A 1YJLA 3BOPA 4XQ4A 1XBFA 2VMHA 4Y1ZA 5FZFA 3AP6A 4URTA 2QUOA 4K7JA 1G9CA 4LUKA 5FP7A 5FUPA 1FOD2 2JD4A 2C1FA 2UY8A 4E4HA 1X82A 1RUF2 1AX0A 3ACHA 3OD4A 4JVAA 1PK6B 4RHV3 2MEV1 2QKDA 3MV01 3UJOA 1BBT2 4EZ4A 2P3IA 1BHGA 2D6LX 4BWOA 3W59A 4GWIA 3M3EA 4HVRA 2ZHLA 3PVNA 2RS12 5EZWA 1DGWX 5FOJB 3CMGA 4LORA 5CVRA 1LHUA 5LA9A 1ULEA 3DCQA 3TN93 3WUDA 4BQXA 3KT7A 1ND3C 4F83A 2RMU2 1S0BA 4LBLA 5DAXA 5JWPA 1CZVA 4LKDA 5CKMA 2W5FA 2TBVA 2Y38A 4FPLA 4PJYA 3WW3A 5D2AA 4AGVA 4DB5A 5C5TA 3POFA 2OS2A 4LTAA 4CXXA 4KMQA 1EYBA 4NVPA 5I8TA 3RZLA 5LB6A 2ID4A 5DUUA 3ZN4A 4IV3B 2NQYA 1GWLA 2YHJA 1KEXA 1ENRA 4RD7A 5F32A 2OIIA 1QJX1 4FTBA 3D6EA 1QKQA 5CEHA 1QOTA 4IE4A 2QE3A 1YIFA 5GZEA 2XR4A 1BJQA 4A7KA 4NN0A 4PT6A 4RSUA 3UV9A 3CKHA 5A6YA 4WVMB 2R16A 1NLQA 5C70A 5I0UA 1ZZ9A 2ENRA 4HXCA 4LO7A 3K75B 3K4DA 4KBZA 1W28A 5FFOC 5C8CA 4LBQB 3ZXDA 1S4CA 4FXKB 1J58A 3DYPA 3G7DA 2WO1A 2E7AA 4LHSA 4JGYB 4OCTA 4XJAA 3WR0A 1MACA 4CCCA 4FTSA 5CA6A 4LULA 3AK0A 3M3IA 4NHMA 1DQ2A 2CNAA 2V5YA 3WLUA 1H1AA 5C7GA 4LOSA 4QQLA 1ACCA 5IK7A 1TME2 3N9OA 4XW3A 1OFSA 1M06G 5E6HA 2GC0A 3DPRA 1PIV1 1PM4A 3T08A 1R091 3ACFA 3TEYA 4YVSA 1S2EA 2KXLA 1FOD1 1LECA 3I3QA 4RHV1 3VKLA 1AXYA 1KJLA 3H9AA 5FLHA 5BYNA 2DVAA 1PVC1 2VAUA 2P37A 1LU2A 2W0XA 3O0XA 1WMXA 2PQSA 4UFJA 1W04A 5CNAA 1G7YA 4R8HA 3J7LA 2WO2A 3VUOA 1JZ6A 2CWMA 4IEZA 1AR82 1WD4A 3GBWA 3ZYRA 4E27A 2WZ8A 5FOBB 5IAXA 1HRV2 3WINE 2QQIA 2VQAA 1MS5A 4XZPA 2QFEA 4AYUA 1DYKA 1PX4A 5HPOA 1DP0A 1W6QA 2E31A 1Y43B 3AFGA 3WNOA 4XDOA 4D7TA 2PAMA 4XQWA 4PDWA 4JHTA 1JH5A 1XE0A 1OSGA 5IT6A 4XHBA 3N35A 1RUJ2 1XJAA 2JJ6A 2ZOEB 4LIVA 4N8MA 2HWF3 3POWA 4LKEA 5FP4A 1UZVA 3VBHB 4XUOA 3CZUA 3GHMA 3THCA 5L9VA 5DMYA 5FZCA 3NNFA 4O7XA 3WNXA 1BKZA 4JRLA 3PUAA 1AR71 1SQ4A 3CJIA 3POGA 1W8ZA 4KG0A 4U2AA 4WVWA 3ACIA 2WINB 2FD8A 1H30A 1QQP1 3MGUA 3HT1A 1UD1A 2BV4A 5IWFA 3ZYPA 3T3YA 1AF9A 1RMU3 4L99A 1CAXB 2NYYA 1K45A 1XNTA 4FP3A 5DG1A 4AVTA 4RN5A 1B09A 1LGNA 2WFPA 4PLOA 2R6QA 3BIWE 5D1IA 1G9AA 2VG9A 2EIDA 2W1UA 3LIHA 1RMU1 4D94A 1OUSA 3I2GA 4FOYA 1OPOA 1C8M2 1IQAA 4LO4B 4RQPC 3K48A 3N9MA 3VBFB 3OEBA 1EUUA 1Z78A 3JBG1 3H7JA 2OUHA 5DAQA 3C3VA 4OI1A 4FFFA 1AR61 3MPPG 3ELNA 2WSVA 2ZAHA 3MIDA 5FY5A 3R4UA 5A32A 3WF4A 1OFNA 2ZX0A 3MUZ1 5LBEA 1MS8A 2XVGA 1RUH3 4XBNA 5ERLA 4BQ4A 4ARXA 2GMPA 2IWGB 3MIBA 4K3UA 2VECA 4IESA 5A3LA 1C3HA 4CCLA 2Z5WA 2R042 2G9ZA 1NCRA 1WWYA 1OLRA 3B9CA 5FJKA 1UY3A 5JZGA 1XNCA 2ZGSA 3AZYA 2QCSB 4K1YA 5KC6A 3KV9A 2DUPA 4QPIA 4XAEA 4XUTA 2JG8A 4QX5A 3K2OA 3RRDA 4AHYA 4IEXA 1VBD3 2C0ZA 2EF6A 1R081 4RS5B 2DDUA 2FMYA 5FYBA 3IPVB 4PI0A 3MHZA 4Y4YA 4BH9A 2VULA 1F15A 3J7MA 5EV7A 5DDJ2 4QD2A 5CBLA 2ZHMA 2YU2A 3H3LA 5A7WA 3UK9A 4PLMA 1AVBA 4WM8C 1D4M3 5IVBA 1N1YA 1X8EA 3E5UA 3BI3A 3SXWA 2GC2A 3KCYA 1KJRA 1JZ2A 4GKXA 4C0HA 4R52A 4D6QA 5A1FA 3PJQA 1J84A 1Z7S2 2ZPXA 4AFAA 1ND3B 3ZSEA 2JDKA 2A6VA 4OHZA 1A34A 3HQXA 1V6JA 5FZOA 3HOBA 5KBFA 4Z82A 1SLTA 4F8AA 3AKTA 2ZEYA 3I59B 5HXMA 1QDOA 3T2PA 4IEQA 1AL23 4ORFA 2PHTA 3ZR6A 4CCEA 1UX7A 4XCBA 1OLQA 4DUVA 1WCSA 1W9YA 4NUBA 1R1A1 1H4GA 2D93A 5A3UA 1US3A 4HZFA 5FYIA 1AJOA 4L92A 4Q4W2 1PGL2 4ZS3A 3WQ1A 1YEWA 4XFGA 3OTFA 1DLLA 5JOXA 1UMHA 4G9SB 3AKRA 2WQ8A 1HRV3 2W3JA 3A21A 3GXUA 3ON7A 4QPGB 4TLFA 3LKJA 1WLTA 3FLTA 3TEXA 3V56A 1ODMA 4CUGA 3ORJA 2JDUA 1NCQC 2HWD1 2P2KA 1WW6A 4AXOA 1GZCA 2DUOA 4OFGA 4YRDA 4QKBA 5JPMB 3O1MA 4KWKA 4WZCA 4QM9A 2Q1MA 1SMVA 2W52A 2WFF2 3KCXA 5FLJA 4CDUB 3IIIA 3OJBA 2HWF2 4YM1A 5A32B 1QWRA 1RUI2 1N3OA 2PHRA 2WWJA 3E1F1 1K42A 1RVF2 4MGIE 4BISA 1OXCA 2BPA2 2VXRA 4XXAA 2B42B 1BEV3 5FO7B 2R071 3NMBA 1AR91 2Q1ZB 2EIEA 2ZGTA 2MNGA 1UU4A 1YFUA 4XABA 4ATFA 3V0BB 5FR3A 2WNVA 3AP7A 3OPTA 5K0UA 1PM7A 2W08A 4I0BA 3WHUA 3ILFA 5F5QA 2BRTA 4Y24A 4D6SA 4NIHA 2HWE1 1PVC2 1VBB3 4G3YC 1KFUL 2CWSA 5GZDA 1V9U1 3VKFC 1H2MA 3VV1A 3NJYA 3I49A 1ZRCA 5FPUA 3W20A 1W06A 5B4NA 1SBDA 4OVEA 1PIV2 4WM7B 4CA9A 4PIYA 4AR2A 2WZEA 1XYNA 5J09A 1HQWA 2XHNA 2CAUA 2P6HA 2KD7A 5L19A 5FCCA 2WNUB 1YQ8A 5C4WB 1JBCA 3I4IA 3RI9A 5EYXA 2BJSA 3HBKA 5CB7A 3OY8A 1AYM2 4J6GA 3MBWA 1ZRDA 4I02A 3VKMA 1GOFA 2YC0A 5EXOA 1CIYA 3NNLA 5K7PA 1W6OB 3PIJA 2AEZA 1XPWA 1UMZA 5BNNB 4I3GA 1VMFA 1OLME 5FUIA 1O59A 2DCKA 1OD3A 3BN6A 4MGYE 4IGOA 4JRAA 4LT5A 2JKXA 3FMGA 4AI9A 1ZZ7A 2B8MA 1JXNA 1ND2A 2J42A 1GUIA 1O4ZA 4N9IA 4ZZ8A 4XETA 1N3PA 3PVBB 4A7YA 1RUD3 1RJ7A 2X8KA 3K3OA 4MLOA 5FK8A 4UBGA 2D3RA 3WUCA 2P3KA 4Z2AA 3VDBA 5FMOL 5C9AA 2VUAA 5SV8A 2W94A 4LPLA 1OMIA 1XQNA 2VR4A 1RYYA 1LGCA 1JZ7A 2PN5A 4D6RA 5ANNA 1K5MB 2C9KA 4IE0A 1RUC3 3VZJA 1PGL1 5FP3A 1TQ5A 1EPWA 3RZJA 4GD4A 2QQLA 2XGXA 3H42B 3M1HA 5EQUA 3UNPA 2BERA 1LHOA 2QQMA 2WZR1 1NE6A 3PVOA 5TSWA 4TSVA 5GZCA 4LQRA 4NRPA 3UGFA 1Z7S1 1HB4A 1HW5A 5H9RA 3B3QE 1PO21 1UQXA 3DKQA 1KGYA 5IFTA 2PHLA 4N7UA 4O9EA 1WW4A 1Q8QA 3WF2A 3O14A 1Y4WA 3LEGA 1MZFA 5FMBA 4WBBA 3AZZA 3BUCA 4UI9L 4BZ4A 4HETA 2DVDA 2XH6A 2VZQA 5CFCC 2B46X 1C28A 3B69A 4AF9A 3O1OA 4KBBA 1R082 2YC2A 3VHOA 1GFF2 2GNTA 4FCAA 2PLV2 4BLIA 4P9GA 5LATA 1VBA2 1ULDA 2VTXJ 2I07B 1ZX5A 4OI4A 2VE1A 1NLSA 3ZN5A 2CSGA 2CGOA 5DAWA 4FP2A 3VBUC 4UFIA 1CX4A 1H2NA 4HFSA 2D43A 1WA6X 5FYSA 3JBG3 3MW2A 4JGZC 4ZXEA 4L0PA 4K8RB 3J4UH 5FZMA 4MHUA 5FXZA 3S0MA 4HVOA 4AWDA 2IXKA 4HLTA 3THPA 3R6SA 2F4LA 3L9JT 2HWB2 5E8AA 4LBKA 1MS3A 5BPXA 2FDGA 2B9UA 2WNUC 3MLKA 5EP9A 2AYHA 2R061 1QH6A 1GOGA 3DECA 4QPWA 1HLCA 4Q0VA 4ATEA 3LQCA 5JXGA 2JDAA 3M3CA 2VM9A 3KVAA 2RS51 2VZ1A 4RQPA 4TTGA 3BTAA 1C8M1 3HT2A 1FNYA 3QCWA 4DRVA 4YG6A 3T0BA 4QMAA 3EHKA 3HQRA 4Z1VA 3NVCA 4OHWA 3VLBB 5LEJA 1ULFA 4PLNA 1QJZA 2DCTA 2XLGA 4AVSA 2A6XA 1RUG2 4KU8A 5C3QA 1AZDA 1LOAA 1QJY2 2DUQA 2XMLA 4H55A 5F6LB 1W3XA 4Y5SA 2XUMA 4P5HA 4E2QA 1KS5A 4PCRA 5JI7A 5I93A 5CFCA 1UOGA 3KGLA 1FI2A 3VZOA 5JZGB 3N7MA 4AFBA 3WP3A 1TMF1 1RUH1 2O1QA 1G86A 1R64A 1AR72 3ZIXA 4QPIB 1JI6A 3ILRA 1UOJA 1H2KA 3N9QA 4BXSV 4JKLA 2ADEA 2O8QA 5ABJA 1KS4A 3GZTB 5AFEA 5I0RA 3O7OA 3SITA 5FV3A 2FDFA 1P8JA 4CCKA 3VDDA 1YNAA 1MEC1 3OYWA 2WNUA 3TOJA 1V0AA 1XNKA 5KXDA 4CDUC 1O3TA 1C8NA 1H9WA 1ZBE2 3TEWA 3AP5A 4BLJA 4Y20B 4XTMA 2B5HA 2LROA 4UXAA 4DXRA 2PAEA 2ZKNA 3NNGA 4RFRB 4A4AA 1AYN2 4QHBA 3GGLA 3H8XA 2VNRA 3LE0A 1O3RA 5C4WA 3NWKA 3ZXFA 2E6VA 1DDLA 4K9SA 3KZ4C 2VW0A 5L9RA 2Z79A 1U5ZA 3QACA 4GH4C 4KNCA 2Q4SA 4I01A 4IV3C 4QX2A 1RB8G 2ZA9A 2C26A 1VRBA 2VH9A 3LOIA 1PK6A 2GNDA 2WZPP 3UT0A 4WZFA 3D0JA 2RG4A 3CO2A 4COYA 1VLNA 5GLWA 4P02B 5F2WA 2RS53 4NR1A 1X50A 1J1LA 5EJ3A 3CDZB 4WVZA 1HB1A 2EICA 1A8DA 2VZ3A 2GMEA 3KMHA 1YQ2A 2GH8A 1Q8OA 3GF6A 3SCFA 3DKWA 1EAH1 4XPVA 3MUY1 5IUQA 2LM3A 1UYYA 2GDFA 2XDVA 1QU0A 3AYDA 1VRH3 3HN1A 3MPBA 3POIA 4HVQA 5IK4A 2BFUS 5CFDA 4NPRA 1ENSA 1UY4A 4XFBA 4NMIA 3KQ4B 3IZOA 1V6OA 1RUE1 1H8TB 1STMA 2ZMLA 5T5JA 2R041 3A22A 4JHZA 1SPPA 3KT4A 1CVNA 1SFYA 2BYVE 3Q8AA 5FZGA 5A3TA 5JCTA 4GULA 4S2FA 2VCAA 3L2HA 2W46A 4CDWB 4CP9A 1DZQA 4IQPA 1XU2A 4ET7A 2BBAA 3MI8A 4D0QA 4KWJA 1X9PA 2E26A 1UYPA 4LXLA 1IGOA 2DF7A 3VBHC 1KITA 1SCSA 4XF1A 2FDHA 3AMHA 1B35B 3T1MA 1NCRC 3UKVA 4S2HA 5C3SA 3SEPA 4HT1T 2JG9A 5DXDA 4XFFA 1RUOA 4AI0A 2FDJA 2RJ2A 4IV1C 4Y20A 4C1WA 5K9YA 1DQ4A 1EY2A 3AZWA 1XXNA 3ETPA 4OHXA 1WZXA 2RS11 4IE5A 1K5MC 3OD0A 1POV1 4XF9A 3CNAA 1BBT1 2D3SA 1GANA 3M8LA 3RYRA 1FMD3 1IG0A 1UPSA 3M7AA 1JUIA 1DIWA 3ME2A 4M3CE 4LBOA 4DFSA 3D3AA 3PURA 4FPFA 3THTA 5KHIA 5T5PA 3UGHA 1H4HA 1ZYBA 4JQRA 5FJHA 5SV5A 2VMDA 2NPIA 2YFUA 1OPMA 4ISRA 3JB4C 2RDQA 1DYPA 3PTYA 1YUDA 1W39A 3H3UA 4CYDA 4XAAA 1DZTA 2QZ2A 1S0CA 5CKQA 3USUA 2C9AA 1OT5A 4DUWA 1WCUA 3GYDA 5L7OB 2RE9A 2JDYA 2VL4A 1LR5A 4DXZA 2YU1A 4QT6A 4BK4A 2WBKA 2GAUA 2D6KA 3PTRB 4MADA 1S0FA 4DO0A 1WCKA 2VMGA 4ZHNA 2OZ6A 1V70A 4JAAA 2IZWA 4Q4Y3 1IS4A 3AVSA 3ZX7A 1CESA 2ZBJA 4DY5A 3KGZA 4KWLA 3FJSA 1ENXA 1V00A 3ZLIA 2J1TA 3ZYGA 1V9U2 2VVEA 1VR3A 3B93A 4XMIA 2WABA 1W0NA 3DGTA 3Q8CA 3HNMA 5CU1A 3A4UA 2WT2A 1TME1 3A23A 4ZU5A 4YZ4A 1VBB1 2DFBA 3OCPA 5AC93 2ILMA 4NRQA 3HPNA 1ENQA 1CONA 3KS7A 3USSA 4AEDA 1NT0A 3N3HA 1FXZA 2OZJA 1LOGA 1GQHA 5A1AA 1N1VA 3TWIA 2WN2A 2Y6LA 2DVBA 5FZ8A 1BEV1 3CEWA 3VZLA 3WF3A 4WV8A 4IDZA 4JDOA 3WNMA 5JMCA 5JPNB 1GQPA 4P9IA 4Z92B 5GLZA 3U4SA 4CUAA 5C71A 2GU9A 3AYAA 3PU3A 3ZYBA 3RVHA 4QHZA 4A44A 2DURA 2HWC3 3ATGA 4CDQA 3VDDC 1IS5A 1E57A 3RGBA 1BVP1 1OQEA 1U5XA 2Y60A 4W50A 4N43C 2HWD2 1QXJA 3LPFA 2J1SA 3TYJA 1L7QA 1HKDA 3VD7A 4XFIA 4C1XA 4D69A 3HWJA 4YG3A 5CG8A 2WA4A 5DN2A 3BYWA 2QQUA 5JR2A 3OSDA 2ET1A 1F35A 4YM0A 5C3RA 3ZIWA 2OPKA 3W21A 2VQ0A 1ASJ2 2W91A 4NHXA 3NAPB 2I74A 4S2DA 1FV3A 2BNNA 3ZXEA 4XILA 1LU1A 3OBZA 4HKLA 1L7RA 4XVHA 1W03A 3RZHA 1D4M1 3DN7A 2AC1A 3P6BA 3VBSC 4XFAA 2EXHA 1CGPA 1VBC1 3GDBA 2IXCA 4L9BA 5C9AC 2OPWA 1J59A 1CWPA 4Y33A 3NKTA 1IPKA 3EBRA 2W47A 1Q8VA 1C8M3 4NIAA 1VIWB 3SH5A 4DS0A 5FRAA 2UWAA 4QXBA 1GU3A 1VB2A 2FCVA 4UW5A 3RNSA 3WF0A 4Q2FA 4Q1RA 1S0IA 2RVAA 2X5IB 4R9DA 1UXXX 2R073 4ITCA 3QOPA 4FPKA 3WG3A 4IEYA 2WJSA 3HD8B 2R0FA 3C7FA 2D40A 3WQBA 4FBFA 1HJFA 4L8QA 1LRHA 1LTEA 3I3MA 3OUJA 1OC1A 4AVVA 1PGW1 4CP0A 5GLTA 4FFIA 4LITA 2Z69A 2DVGA 3A0KA 4DEQA 3O1SA 2ADDA 4I09A 3B00A 2ARAA 2VNGA 2XL9A 3U78A 1LENA 5IHRA 2VPVA 1VBD2 2GP3A 3M70A 5FBJA 1YIPA 5GLVA 2H0BA 1JYXA 4NWVA 3ZFGC 3WDTA 2RM21 1FV2A 4RGAA 3LWCA 5DAVA 3SCHA 3U14A 3T4HB 2QNKA 1W6NB 1C5IA 2ARXA 1IHMA 1O5UA 3JCIA 4Q4Y2 3ZFFB 3AP9A 1VJ2A 4YGDA 5IVVA 4YW4A 4ZS2A 5L36A 2G4IA 2W87A 2FBEA 2DTWA 1RHI2
chains in the Genus database with same CATH topology
5IFPA 1UX7A 3WSOA 4DUVA 4OUEA 2BZDA 4OMCA 4A3ZA 3I3EA 1US3A 3VD5A 2WAAA 2VZVA 3WNLA 1US2A 2QQNA 2VMFA 2R7EB 3NJXA 1UMHA 2WQ8A 2W3JA 3GXUA 3A21A 4LKSA 3ABZA 4ZZ5A 3JXSA 4QDSA 1UMIA 2ZXQA 3J7HA 3LPGA 1JZ5A 3ACGA 3SKJE 1WKYA 3GM8A 3IIIA 5CZKA 3AC0A 5JXIA 1JYWA 2X05A 2CDOA 3E1F1 2E33A 3I2KA 4P08A 1K42A 3P1IA 5I0DA 5CYYA 3EYPA 1GNYA 4JKMA 2EIEA 1CZSA 2Y64A 5JXHA 1GOHA 3I3DA 4MO3M 2Y8KA 3VD9A 4YPJA 2VMCA 3VDAA 3HNBM 4P5YA 4BK5A 4AAXA 1UY2A 3DYMA 1H6XA 3K4ZA 3I2IA 5B4NA 4KI5M 1XNAA 2J22A 4TXWA 2VMEA 1JZ4A 2WZEA 3CQOA 3T2OA 2LS6A 2XHNA 2WAOA 2KD7A 2X10A 3IB3A 3BGAA 4OYUA 1NUKA 4CUCA 1O8PA 2W95A 2YB7A 3MBWA 1H6YA 4E8DA 1GOFA 1CIYA 1XC6A 3I2JA 3C7HA 1XPWA 2WO3A 3T09A 5FUIA 1O59A 2DCKA 3BN6A 1OD3A 2QQOA 2ORXA 2JKXA 4XURA 1UXZA 3A7QA 1D7PM 2J1RA 1GUIA 2L9LA 2ZEWA 4ZZ8A 2VQTA 3UETA 5G05L 4QDRA 3HJRA 4Z2AA 5JXJA 3VDBA 2W94A 1O8SA 4LPLA 1SDDB 4JKKA 2VR4A 1RYYA 1UYXA 4P00B 2QQJA 1JZ7A 2C9KA 3K46A 4W4ZA 2HYXA 2VZRA 2QQLA 3UNPA 5EJZB 4XUPA 2BERA 2QQMA 1NX9A 2Y6GA 2YG0A 2VZUA 3OGVA 4LQRA 2XONA 1UWWA 1T2XA 2YFZA 1KGYA 4HG6B 5IFTA 2VCBA 3WF2A 3LEGA 3FL7A 4UI9L 1GMMA 1SG3A 2VZQA 3NRUA 2YC2A 2RV9A 4XUQA 3U37A 3WNKA 2VC9A 4QDQA 2WUHA 3THDA 4ZXEA 3C8XA 4L0PA 3I97A 3T2QA 1JYVA 2Z4FA 1LNSA 1JZ3A 3T0AA 4QPWA 1GOGA 3DECA 4D8MA 3LQCA 5JXGA 2JDAA 1PMHX 2VM9A 4QX0A 5EJ1B 2VZ1A 4M4RA 4TTGA 5LA1A 3T0BA 4QB6A 5JUVA 2W9XA 2Y6KA 2LW8A 3EB7A 3WNPA 2CDPA 2DCJA 3WNNA 3ECQA 2W1QA 1F4HA 2VTFA 1R64A 2J7MA 2E32A 4QX3A 1JI6A 4BXSV 1JYNA 1WCQA 4JKLA 3PUHA 3MO4A 2HLEA 4CU8A 1P8JA 5B4XA 2ORZA 4A42A 1OH4A 4QB1A 3SEEA 3LEIA 4KWUA 4PQQA 2Y6HA 3LEKA 4OMDA 1K12A 3VDCA 4XUNA 2VCCA 4DXRA 3NNGA 3GGLA 4E8CA 4DXTA 3I2FA 3MV11 3LE0A 2B4KA 2VZTA 5DPNA 1UY0A 2BGOA 4QB2A 4QX2A 3WEZA 2C26A 3NJVA 5LA2A 1NKGA 3C7GA 5IYYA 2VO5A 4MGSA 3CIHA 4AG4A 2VZOA 4P02B 1W9SA 1K3IA 3CDZB 2VQUA 1OF4A 2EICA 2VZ3A 2VZSA 4W8JA 3OB8A 4DEVA 1YQ2A 3VD3A 3I3BA 1UY1A 2V4VA 2W1WA 3MUY1 1EUTA 2J1VA 1UYYA 4MGQA 3CZJA 5LCWL 1UZ0A 1UY4A 4CUBA 3VD4A 3OBAA 3A22A 4JHZA 2J1UA 1UYZA 3NQHA 3F2ZA 2VCAA 4JX0A 2W46A 4CU9A 4ZY9A 3C7OA 4ET7A 3ACHA 2BBAA 4D0QA 1SHWB 3MV01 3K4AA 2W92A 2E26A 1BHGA 3W5NA 4QX1A 2X09A 4GWIA 2WN3A 3CMGA 1JHJA 2WDBA 1PMJX 5JMOA 3SEPA 3WF1A 4DXSA 2ZEZA 3ZM8A 1CZVA 1DYOA 2W5FA 4A6OA 3OEAA 2RJ2A 2ZEXA 3ETPA 4KMQA 3C7EA 2ID4A 1KEXA 2B9VA 2J1EA 1TG7A 3OG2A 2XQXA 1JZ8A 4PT6A 3CKHA 4FI9A 2YC4A 3D3AA 2WYSA 5C70A 3UESA 1PX3A 1IQDC 2XOMA 3K75B 3K4DA 2J1AA 4PF1A 3FN9A 1NAEA 2VMDA 2VZPA 2YFUA 3DYPA 2WO1A 4BJ0A 4LHSA 1W9TA 4CVUA 3HN3A 1OT5A 4DUWA 1DLCA 2VL4A 2JD9A 2JE8A 4M4PA 4BK4A 2WBKA 1OF3A 4A4AA 4A41A 5C7GA 1W8NA 4UAPA 4MADA 4OZOA 2VOTA 3T08A 3ACFA 3OGRA 2J1TA 1J83A 2WABA 1W0NA 4MOAA 3HNMA 2PQSA 3A23A 4DUXA 2WO2A 2VJXA 1JZ6A 1W8OA 3HPNA 2WZ8A 2OKXA 2EIBA 2QQIA 1CZTA 4GWJA 5EIYB 5HPOA 1PX4A 1DP0A 2E31A 3IAQA 3WNOA 4GZ9A 3HNYM 5A1AA 2WN2A 2Y6LA 3WF3A 5G04L 3WNMA 1GQPA 1HN1A 4CUAA 5C71A 4A44A 5F7UA 4XUOA 3CZUA 3THCA 4W50A 5DMYA 5IJRA 3LPFA 3VD7A 2J1SA 4BDVB 1L7QA 4IUGA 3W5MA 5DN2A 3ACIA 3I2HA 5JR2A 4CU6A 2W91A 1K45A 1XNTA 2V72A 1JU3A 4RN5A 4XVHA 1ULOA 1L7RA 2BGPA 2C4XA 3P6BA 2W1UA 2EIDA 3I2GA 3PUIA 1MPXA 3GDBA 3FHQA 1I5PA 3OEBA 1EUUA 1CX1A 2Y6JA 2W47A 5LA0A 5J1XA 3K77A 3WF4A 3SKVA 1GU3A 3MUZ1 4UOJA 4RYDA 3FHAA 1TVGA 4ARXA 1W9WA 3WF0A 3IDAA 3T0DA 2RVAA 4QAWA 1UXXX 4ARYA 3IAPA 1JU4A 1UY3A 3C7FA 3WQBA 2QQKA 1F4AA 4XZUG 4XUTA 2ZEYA 3OGSA 2DDUA 4DEQA 1ULPA 3HEIA 5DQ0A 5IHRA 2W1SA 3DYOA 1JYXA 4A45A 4CU7A 1JZ2A 1J84A 2QBXA 1W99A 3HOBA 2V5DA 5HXMA 2W87A 3T2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IFP A;  1UX7 A;  3WSO A;  4DUV A;  4OUE A;  2BZD A;  4OMC A;  4A3Z A;  3I3E A;  1US3 A;  3VD5 A;  2WAA A;  2VZV A;  3WNL A;  1US2 A;  2QQN A;  2VMF A;  2R7E B;  3NJX A;  1UMH A;  2WQ8 A;  2W3J A;  3GXU A;  3A21 A;  4LKS A;  3ABZ A;  4ZZ5 A;  3JXS A;  4QDS A;  1UMI A;  2ZXQ A;  3J7H A;  3LPG A;  1JZ5 A;  3ACG A;  3SKJ E;  1WKY A;  3GM8 A;  3III A;  5CZK A;  3AC0 A;  5JXI A;  1JYW A;  2X05 A;  2CDO A;  3E1F 1;  2E33 A;  3I2K A;  4P08 A;  1K42 A;  3P1I A;  5I0D A;  5CYY A;  3EYP A;  1GNY A;  4JKM A;  2EIE A;  1CZS A;  2Y64 A;  5JXH A;  1GOH A;  3I3D A;  4MO3 M;  2Y8K A;  3VD9 A;  4YPJ A;  2VMC A;  3VDA A;  3HNB M;  4P5Y A;  4BK5 A;  4AAX A;  1UY2 A;  3DYM A;  1H6X A;  3K4Z A;  3I2I A;  5B4N A;  4KI5 M;  1XNA A;  2J22 A;  4TXW A;  2VME A;  1JZ4 A;  2WZE A;  3CQO A;  3T2O A;  2LS6 A;  2XHN A;  2WAO A;  2KD7 A;  2X10 A;  3IB3 A;  3BGA A;  4OYU A;  1NUK A;  4CUC A;  1O8P A;  2W95 A;  2YB7 A;  3MBW A;  1H6Y A;  4E8D A;  1GOF A;  1CIY A;  1XC6 A;  3I2J A;  3C7H A;  1XPW A;  2WO3 A;  3T09 A;  5FUI A;  1O59 A;  2DCK A;  3BN6 A;  1OD3 A;  2QQO A;  2ORX A;  2JKX A;  4XUR A;  1UXZ A;  3A7Q A;  1D7P M;  2J1R A;  1GUI A;  2L9L A;  2ZEW A;  4ZZ8 A;  2VQT A;  3UET A;  5G05 L;  4QDR A;  3HJR A;  4Z2A A;  5JXJ A;  3VDB A;  2W94 A;  1O8S A;  4LPL A;  1SDD B;  4JKK A;  2VR4 A;  1RYY A;  1UYX A;  4P00 B;  2QQJ A;  1JZ7 A;  2C9K A;  3K46 A;  4W4Z A;  2HYX A;  2VZR A;  2QQL A;  3UNP A;  5EJZ B;  4XUP A;  2BER A;  2QQM A;  1NX9 A;  2Y6G A;  2YG0 A;  2VZU A;  3OGV A;  4LQR A;  2XON A;  1UWW A;  1T2X A;  2YFZ A;  1KGY A;  4HG6 B;  5IFT A;  2VCB A;  3WF2 A;  3LEG A;  3FL7 A;  4UI9 L;  1GMM A;  1SG3 A;  2VZQ A;  3NRU A;  2YC2 A;  2RV9 A;  4XUQ A;  3U37 A;  3WNK A;  2VC9 A;  4QDQ A;  2WUH A;  3THD A;  4ZXE A;  3C8X A;  4L0P A;  3I97 A;  3T2Q A;  1JYV A;  2Z4F A;  1LNS A;  1JZ3 A;  3T0A A;  4QPW A;  1GOG A;  3DEC A;  4D8M A;  3LQC A;  5JXG A;  2JDA A;  1PMH X;  2VM9 A;  4QX0 A;  5EJ1 B;  2VZ1 A;  4M4R A;  4TTG A;  5LA1 A;  3T0B A;  4QB6 A;  5JUV A;  2W9X A;  2Y6K A;  2LW8 A;  3EB7 A;  3WNP A;  2CDP A;  2DCJ A;  3WNN A;  3ECQ A;  2W1Q A;  1F4H A;  2VTF A;  1R64 A;  2J7M A;  2E32 A;  4QX3 A;  1JI6 A;  4BXS V;  1JYN A;  1WCQ A;  4JKL A;  3PUH A;  3MO4 A;  2HLE A;  4CU8 A;  1P8J A;  5B4X A;  2ORZ A;  4A42 A;  1OH4 A;  4QB1 A;  3SEE A;  3LEI A;  4KWU A;  4PQQ A;  2Y6H A;  3LEK A;  4OMD A;  1K12 A;  3VDC A;  4XUN A;  2VCC A;  4DXR A;  3NNG A;  3GGL A;  4E8C A;  4DXT A;  3I2F A;  3MV1 1;  3LE0 A;  2B4K A;  2VZT A;  5DPN A;  1UY0 A;  2BGO A;  4QB2 A;  4QX2 A;  3WEZ A;  2C26 A;  3NJV A;  5LA2 A;  1NKG A;  3C7G A;  5IYY A;  2VO5 A;  4MGS A;  3CIH A;  4AG4 A;  2VZO A;  4P02 B;  1W9S A;  1K3I A;  3CDZ B;  2VQU A;  1OF4 A;  2EIC A;  2VZ3 A;  2VZS A;  4W8J A;  3OB8 A;  4DEV A;  1YQ2 A;  3VD3 A;  3I3B A;  1UY1 A;  2V4V A;  2W1W A;  3MUY 1;  1EUT A;  2J1V A;  1UYY A;  4MGQ A;  3CZJ A;  5LCW L;  1UZ0 A;  1UY4 A;  4CUB A;  3VD4 A;  3OBA A;  3A22 A;  4JHZ A;  2J1U A;  1UYZ A;  3NQH A;  3F2Z A;  2VCA A;  4JX0 A;  2W46 A;  4CU9 A;  4ZY9 A;  3C7O A;  4ET7 A;  3ACH A;  2BBA A;  4D0Q A;  1SHW B;  3MV0 1;  3K4A A;  2W92 A;  2E26 A;  1BHG A;  3W5N A;  4QX1 A;  2X09 A;  4GWI A;  2WN3 A;  3CMG A;  1JHJ A;  2WDB A;  1PMJ X;  5JMO A;  3SEP A;  3WF1 A;  4DXS A;  2ZEZ A;  3ZM8 A;  1CZV A;  1DYO A;  2W5F A;  4A6O A;  3OEA A;  2RJ2 A;  2ZEX A;  3ETP A;  4KMQ A;  3C7E A;  2ID4 A;  1KEX A;  2B9V A;  2J1E A;  1TG7 A;  3OG2 A;  2XQX A;  1JZ8 A;  4PT6 A;  3CKH A;  4FI9 A;  2YC4 A;  3D3A A;  2WYS A;  5C70 A;  3UES A;  1PX3 A;  1IQD C;  2XOM A;  3K75 B;  3K4D A;  2J1A A;  4PF1 A;  3FN9 A;  1NAE A;  2VMD A;  2VZP A;  2YFU A;  3DYP A;  2WO1 A;  4BJ0 A;  4LHS A;  1W9T A;  4CVU A;  3HN3 A;  1OT5 A;  4DUW A;  1DLC A;  2VL4 A;  2JD9 A;  2JE8 A;  4M4P A;  4BK4 A;  2WBK A;  1OF3 A;  4A4A A;  4A41 A;  5C7G A;  1W8N A;  4UAP A;  4MAD A;  4OZO A;  2VOT A;  3T08 A;  3ACF A;  3OGR A;  2J1T A;  1J83 A;  2WAB A;  1W0N A;  4MOA A;  3HNM A;  2PQS A;  3A23 A;  4DUX A;  2WO2 A;  2VJX A;  1JZ6 A;  1W8O A;  3HPN A;  2WZ8 A;  2OKX A;  2EIB A;  2QQI A;  1CZT A;  4GWJ A;  5EIY B;  5HPO A;  1PX4 A;  1DP0 A;  2E31 A;  3IAQ A;  3WNO A;  4GZ9 A;  3HNY M;  5A1A A;  2WN2 A;  2Y6L A;  3WF3 A;  5G04 L;  3WNM A;  1GQP A;  1HN1 A;  4CUA A;  5C71 A;  4A44 A;  5F7U A;  4XUO A;  3CZU A;  3THC A;  4W50 A;  5DMY A;  5IJR A;  3LPF A;  3VD7 A;  2J1S A;  4BDV B;  1L7Q A;  4IUG A;  3W5M A;  5DN2 A;  3ACI A;  3I2H A;  5JR2 A;  4CU6 A;  2W91 A;  1K45 A;  1XNT A;  2V72 A;  1JU3 A;  4RN5 A;  4XVH A;  1ULO A;  1L7R A;  2BGP A;  2C4X A;  3P6B A;  2W1U A;  2EID A;  3I2G A;  3PUI A;  1MPX A;  3GDB A;  3FHQ A;  1I5P A;  3OEB A;  1EUU A;  1CX1 A;  2Y6J A;  2W47 A;  5LA0 A;  5J1X A;  3K77 A;  3WF4 A;  3SKV A;  1GU3 A;  3MUZ 1;  4UOJ A;  4RYD A;  3FHA A;  1TVG A;  4ARX A;  1W9W A;  3WF0 A;  3IDA A;  3T0D A;  2RVA A;  4QAW A;  1UXX X;  4ARY A;  3IAP A;  1JU4 A;  1UY3 A;  3C7F A;  3WQB A;  2QQK A;  1F4A A;  4XZU G;  4XUT A;  2ZEY A;  3OGS A;  2DDU A;  4DEQ A;  1ULP A;  3HEI A;  5DQ0 A;  5IHR A;  2W1S A;  3DYO A;  1JYX A;  4A45 A;  4CU7 A;  1JZ2 A;  1J84 A;  2QBX A;  1W99 A;  3HOB A;  2V5D A;  5HXM A;  2W87 A;  3T2P A; 
#chains in the Genus database with same CATH topology
 4QKN A;  4Q8K A;  5IFP A;  4R4Z A;  4FT8 A;  2JIC A;  3JD7 1;  2HWE 3;  2YRO A;  4OUE A;  4PIX A;  5A3M A;  5LY2 A;  1ZBA 2;  3UL2 A;  2VZV A;  2XHK A;  1W8U A;  4UWD A;  2QQN A;  2VMF A;  5AC9 2;  4Y26 A;  2R7E B;  4X8P A;  4AK3 A;  1LOE A;  1A78 A;  1FPN 1;  1EV1 3;  2VUC A;  2XVL A;  4AED C;  1QQP 2;  1Y9Q A;  4LKS A;  4FOW A;  1OA4 A;  3IMN A;  3ROU A;  3O0W A;  4JC1 A;  1Q5O A;  4YZ3 A;  4C90 A;  4QDS A;  1X33 A;  1QNW A;  2ZXQ A;  3J7H A;  4HN1 A;  4YVW B;  4HK8 A;  2JG8 B;  2JEN A;  5DUX A;  3RPQ A;  1JZ5 A;  1FNZ A;  3K3N A;  3V64 A;  5K0U C;  1REE A;  2O0O A;  3ZPY A;  3ACG A;  1RXF A;  3M3Q A;  3S57 A;  1F9K A;  1JS9 A;  4IV3 A;  1T6B X;  3UJQ A;  1VBD 1;  3QD6 A;  5FZK A;  5CZK A;  5KC5 A;  1D2S A;  4YG0 A;  2WR9 A;  2AEN A;  2HBU A;  3IT8 A;  5JXI A;  2X05 A;  1B35 C;  4TYS A;  1RUE 3;  5FPZ A;  1MR5 A;  3VL8 A;  1DQ1 A;  3LIG A;  3I2K A;  2P3J A;  4P08 A;  1OOP B;  3V65 A;  1GWM A;  4LBQ A;  3RFR A;  1RHI 1;  1RUI 3;  1GNY A;  1CZS A;  2C24 A;  2Y64 A;  2PAK A;  1OOP A;  3FUO A;  2D6N A;  4MO3 M;  2Y8K A;  1QDC A;  4OZX A;  3TN9 2;  4IGQ A;  1OLM A;  2RMU 3;  4CRQ A;  1MVQ A;  1O3S A;  1SLI A;  5FYC A;  2RDN A;  4B7K A;  2WQZ C;  5FYZ A;  3HNB M;  2VW2 A;  3D0S A;  3POB A;  2P1B A;  5T5O A;  2JE7 A;  2JKB A;  2CGP A;  3KSC A;  4XF3 A;  1JOP A;  4IEO A;  4MET A;  3S7I A;  5I91 A;  3MIC A;  2WLP A;  3NAP A;  4JTO A;  3SQO A;  3CQO A;  1D0H A;  2UWC A;  1PIV 3;  5FYM A;  2DU0 A;  3BU7 A;  2LS6 A;  2R1D A;  2AH2 A;  3WG2 A;  2E51 A;  1DHK B;  1XOY A;  1S55 A;  1VBC 2;  2X10 A;  2ZHK A;  1UOB A;  1HJG A;  2GN3 A;  4EN7 B;  2W95 A;  5FAX A;  1YI7 A;  3JQX A;  4BM8 A;  1AR9 3;  5CAD A;  2VTX A;  2D3P A;  3LSD A;  5FZ9 A;  2RR1 1;  1POV 3;  1NQD A;  1XC6 A;  4B1L A;  4XC9 A;  5FO9 B;  3FX3 A;  2KR2 A;  1QXR A;  5L7O A;  3WDV A;  4Q8L A;  1AUY A;  3VHR A;  5T54 A;  1ZNP A;  3WP6 A;  5T52 A;  5E16 A;  2GN7 A;  4AFD A;  5DZG A;  1AR6 2;  1OA3 A;  2HWC 1;  2ZEW A;  1NA1 B;  2P5B A;  3EO6 A;  5CIR A;  3RS6 A;  4A7Z A;  4N7I A;  2ZKL A;  2E9Q A;  1Q56 A;  1CAU B;  1WMD A;  1TME 3;  3HJR A;  3NW4 A;  3ZSK A;  4QPI C;  2A75 A;  4PI2 A;  4XHX A;  1VPH A;  4XJW A;  5A6Z A;  4G4F A;  1SDD B;  3S7E A;  4LKF A;  2XJQ A;  1UYX A;  3GZU C;  4JDM A;  3ZSM A;  4XBL A;  3ZSL A;  4AEK A;  3HVD A;  1GYK A;  1EAH 3;  4HN0 A;  4B4Q A;  3H8R A;  4QPG A;  1HXS 2;  3BOD A;  2VNO A;  3WQ0 A;  2P3Y A;  2VZR A;  2WNE A;  3E6C C;  3GCX A;  5EJZ B;  4HSL A;  1IKQ A;  4UF0 A;  5BNP C;  3BTZ A;  4N53 A;  1LHW A;  1MEC 2;  2YG0 A;  3ENR A;  2VZU A;  3CJI C;  2VMI A;  5IVJ A;  3OGV A;  1JN2 P;  1RIN A;  2Q5T A;  3T1L A;  1T2X A;  3RZG A;  2YFZ A;  5FZH A;  4SLI A;  4RQP B;  1SBF A;  4HON A;  3TNQ A;  1OUR A;  1WBF A;  1KFX L;  1R09 3;  4KGQ A;  4HAN A;  2PQQ A;  3O1P A;  2RHP A;  2DV9 A;  3IDC B;  3MIE A;  3NRU A;  1GZW A;  1FAT A;  5DUW A;  4E4S A;  2ZGU A;  3TB0 A;  2HKX A;  2RS3 2;  1W0P A;  2GC1 A;  5FZA A;  4YGB A;  4ERO A;  1NE4 A;  3AZV A;  1R08 3;  4QX7 A;  1CJD A;  3WG1 A;  2AUY A;  2UWB A;  1LOF C;  1LOF A;  1VBA 3;  4UFK A;  5C4W C;  4LOT A;  5ISL A;  5BV6 A;  3G6J B;  3WNK A;  3DL3 A;  1CJP A;  1NOV A;  1W8W A;  2P4E A;  1AR8 1;  2VC9 A;  1HN0 A;  1DG6 A;  5FQ0 B;  3THD A;  4DMI A;  2UU8 A;  4NJ4 A;  5IK8 A;  2PFW A;  3RSJ A;  3C8X A;  3N9N A;  2JDH A;  3I97 A;  1FOD 3;  2WO7 A;  1TMF 3;  5C3O A;  2IXH A;  4AAP A;  3OUH A;  1JYV A;  1JTZ X;  3MLJ A;  1H1I A;  1SPP B;  5L7O C;  1BBT 3;  1AL0 G;  3RJ2 X;  3R0R A;  3BKZ A;  2CL2 A;  2G19 A;  4D8M A;  2QQP A;  2YPD A;  4OQ8 A;  4HKW A;  4QX0 A;  1UNB A;  1VBE 3;  5EJ1 B;  2YPJ A;  4Q0P A;  2HYK A;  1X9T A;  1LAJ A;  2NP0 A;  5A7P A;  2IFW A;  2ZAA A;  4GIQ A;  5F6K A;  3VBU A;  2W9X A;  2FDI A;  1GP6 A;  2XBO 3;  1QJU 3;  3HBZ A;  2LW8 A;  1V6L A;  1YC6 1;  5LBB A;  1HQL A;  3ZN6 B;  2X5I A;  3WNN A;  3WCR A;  3H1W A;  1F4H A;  2VBB A;  4GWM A;  2EXK A;  4YW2 A;  1QJY 3;  3NKG A;  1SZB A;  1Y9M A;  2ZX4 A;  4XTP A;  3ZSJ A;  4LBQ D;  3IN9 A;  4LLF A;  4J1W A;  2Q8D A;  1PO1 3;  2Z2S B;  4AI1 A;  4XDQ A;  4ZU7 A;  1RC6 A;  1BK0 A;  5KXB A;  4M00 A;  2QQV A;  4O65 A;  4YW1 A;  3AL6 A;  2ORZ A;  5FXV A;  1O3Q A;  1IOA A;  5DG2 A;  3J9S A;  1URX A;  2I45 A;  2YXS A;  4KWU A;  5BNP A;  4TWT A;  1VMH A;  2JWP A;  5FP9 A;  1CN1 A;  4FPJ A;  1SFP A;  1H9P A;  3LEK A;  4HMZ A;  1TNF A;  4Y22 B;  5F5I A;  1SCR A;  1D4M 2;  1K12 A;  5FZ3 A;  3TNP B;  3LB9 A;  4GXL A;  2BP6 A;  2R06 3;  1MQT A;  3I2F A;  3ZYH A;  4GB3 1;  3MV1 1;  5FY0 A;  4BQ5 A;  4LBJ A;  1AYN 3;  4NOT A;  1PVX A;  1Q8P A;  5FYU A;  2UYA A;  4RR3 B;  2BGO A;  3VB9 A;  4QB2 A;  3AKS A;  4CDX C;  2PTM A;  4QU2 A;  3WEZ A;  2XJU A;  5LA2 A;  2ZCW A;  4CE8 A;  1NKG A;  3C7G A;  5FDB A;  1EAH 2;  2FCU A;  4MGS A;  4XJ8 A;  4AFM A;  2P6C A;  2VZO A;  1LOC A;  2UYB A;  3DXU A;  2BOJ A;  2VQU A;  5J7M A;  2H0V A;  2VZS A;  3OB8 A;  2FQP A;  3ZDV A;  4DEV A;  3NL1 A;  2HH9 A;  3IMM A;  2N7G A;  1SLB A;  3KF5 A;  3MIG A;  4IV1 A;  2IVJ A;  5FLI A;  2J1V A;  1CQ9 A;  4MGQ A;  3CZJ A;  5FWE A;  4F7Z A;  1UZY A;  2OA2 A;  5HCF A;  4GMP 1;  1W9F A;  4LK7 A;  3AJY A;  3O1V A;  4DZG A;  2WFF 3;  3H8O A;  1N3Q A;  2YBP A;  2IXI A;  2QVS B;  4I0A A;  2OQ6 A;  1PZ8 A;  1CAX A;  4Q5O A;  2RS3 3;  4ZPI A;  3AL5 A;  2PHU A;  2D7F A;  3KV6 A;  3NQH A;  4IW3 A;  4Y1Y A;  3S30 A;  1ONA A;  4XOG A;  3F2Z A;  3LOB A;  3S5Q A;  3QH7 A;  2PHX A;  1H0B A;  4CU9 A;  1WCD J;  4JDN A;  4L11 A;  1W6P B;  4ZY9 A;  3O0V A;  4HBN A;  3AVR A;  4BMB A;  1GZT A;  3C7O A;  3KD4 A;  1CAV A;  2P34 A;  1UIJ A;  2WA3 A;  2XVK A;  1SHW B;  2A70 A;  4I0W B;  4P14 A;  1TE1 B;  2YY1 A;  2D44 A;  2JG8 C;  2DVF A;  2GAL A;  2WSU A;  3M4F A;  4QX1 A;  4KGG A;  4CDQ B;  3DXT A;  4IEP A;  2R49 A;  4CSW A;  5LY1 A;  1PHM A;  2WN3 A;  1BLZ A;  1RMU 2;  4R4X A;  2WDB A;  5FZI A;  1Q3E A;  1SLC A;  5JMO A;  3GNE A;  5T50 A;  2XXZ A;  4X6Q B;  1LGB A;  1WBL A;  3GJA A;  2ZEZ A;  2XKP A;  3ZM8 A;  3P3N A;  1DYO A;  4A6O A;  3AKQ A;  5F5A A;  1UZW A;  4AFC A;  1LOD A;  3AMQ A;  4LNV A;  1I5Z A;  2R0H A;  3E5X A;  1XB9 A;  1QOO A;  4HKO A;  3I54 A;  3R4D B;  4PBO A;  5A1L A;  4Q4Y 1;  3CJI B;  3WT3 A;  1F5F A;  4LA2 A;  4M0N A;  4WM7 A;  5L73 A;  4K40 A;  3J26 N;  1AYM 3;  1SDW A;  1HDK A;  2B9V A;  4RR3 C;  2ZMK A;  1NCQ A;  1NA1 C;  1JZ8 A;  3LAG A;  5C8C B;  4FI9 A;  4CDX A;  4CZS A;  2E63 A;  2WYS A;  4AED B;  4AVB A;  3I2O A;  3UES A;  1PX3 A;  1IQD C;  1IS3 A;  2XOM A;  4UT5 A;  3VBF C;  2A5Z A;  2J1A A;  3FLR A;  1S0E A;  3FN9 A;  1W8F A;  4E4Z A;  4OUM A;  2WT1 A;  2VZP A;  2XLA A;  2ARB A;  4GJZ A;  3TAY A;  3VKN A;  1R1A 2;  3JD7 2;  4BJ0 A;  1W9T A;  1CPN A;  3AMN A;  5JIU A;  4CVU A;  4QQP A;  1E5H A;  4MGK E;  4NO4 A;  1DLC A;  4NRM A;  4FXG B;  2JD9 A;  2JE8 A;  1AX1 A;  4M4P A;  2E7T A;  1ND2 B;  1OF3 A;  1QNY A;  1VAL A;  2FHR A;  2WKK A;  2YUE A;  3GHN A;  4A41 A;  4UAP A;  4OZO A;  1DGR A;  2E53 A;  1LHV A;  2VOT A;  2ZX2 A;  3WDY A;  3I2D A;  4XJZ A;  1MZ6 A;  4PIZ A;  1JYT A;  1FPN 3;  1ZRR A;  4ASM B;  1LJ7 A;  3WY6 A;  1J83 A;  2RM2 3;  3H7Y A;  1Z7S 3;  4Y22 A;  3D8C A;  3D4K A;  5FY1 A;  5GZF A;  5LBC A;  2E7Q A;  2EAA A;  3NO8 A;  4P9W A;  4FAG A;  1UU6 A;  1PGS A;  4FPG A;  4AVA A;  3DUI A;  3Q9O A;  4M3C F;  3POY A;  5FZ6 A;  3ZYI B;  4ASK A;  3JB8 A;  5FZB A;  2VJX A;  3TEZ A;  4MVT A;  3RQ0 A;  1W8O A;  3RZM A;  3KLS A;  3AZX A;  2MHF A;  3AX4 A;  4AE2 A;  2OKX A;  2EIB A;  4GWJ A;  5K8S A;  4ZXK A;  1QMJ A;  2DYC A;  4QWN A;  2CGN A;  4UFM A;  3OPZ A;  4GZ9 A;  3ZOI A;  4GB3 2;  4LO6 B;  1OA2 A;  2JDP A;  5JR7 B;  4B4R A;  3E6B A;  1JMU B;  2LUW A;  4COW A;  3LGR A;  4M0H A;  5C3P A;  1NXM A;  4XE9 A;  4CEY A;  2VBD A;  2VVD A;  2JEC A;  3RG0 A;  3B9I A;  3MIF A;  4H7L A;  1VP6 A;  2Z42 A;  3NV2 A;  5FZO B;  1H8V A;  5FYY A;  3JBG 2;  3JZV A;  2HWC 2;  4Y5T A;  1RUF 3;  5FK7 A;  3WDX A;  4HPK A;  3PME A;  4MXW B;  5HCB A;  5H9Q A;  2UY9 A;  3W5M A;  2VOK A;  4Z2W A;  3IIA A;  1JOB A;  2HWD 3;  2IXL A;  1NY7 1;  3I2H A;  1HV0 A;  2BOI A;  2HWB 3;  2LRP A;  4CU6 A;  2W39 A;  5FPX A;  4PQ9 A;  5FYT A;  2ZJC A;  3VBO B;  4H3W A;  4B7E A;  1OH3 A;  1POQ A;  1BEV 2;  2V72 A;  4PDW C;  3DF0 A;  1JU3 A;  5HV0 A;  3WCS A;  3CHX A;  1ASJ 3;  3WP5 A;  3SNM A;  2BGP A;  2EIG A;  3VBR A;  3VBF A;  3IKW A;  4UW3 A;  2Q8C A;  5JZG C;  1GWK A;  1WW5 A;  3PUI A;  1MPX A;  5HV4 A;  3FHQ A;  2KM2 A;  1I5P A;  1CAV B;  1PVC 3;  1VBB 2;  4EN9 B;  1UO9 A;  1RUG 3;  2VVF A;  2Y6J A;  4KU7 A;  1ST8 A;  1GZW B;  4LK6 A;  4Q26 A;  1ND2 C;  3SH3 A;  2OUJ A;  4CP1 A;  3K77 A;  1ZZ6 A;  1LOB A;  4UOJ A;  5E88 A;  5A80 A;  3DPR B;  3LA7 A;  3HAG A;  2EAL A;  1AHS A;  4MZU A;  4URA A;  1TVG A;  3ES1 A;  4HL0 A;  1W9W A;  4FPC A;  3IDA A;  1C1F A;  2OW4 A;  4LE4 A;  1RJ8 A;  4IET A;  4TN7 A;  5FMC A;  5HCH A;  1FX5 A;  5JOZ A;  4Y4R A;  1AYM 1;  4ARY A;  4ZU4 A;  1JU4 A;  4GMP 3;  1QJF A;  4AQ2 A;  4MH0 E;  4QX8 A;  2EA7 A;  1NXD 1;  1XSR A;  2R07 2;  4K6B A;  4UFH A;  4NAM A;  2QQK A;  3CLP A;  5C33 A;  1F31 A;  4NAO A;  4BXF A;  3GZA A;  3ZFG B;  4JGZ B;  4MSV A;  1JYI A;  3OGS A;  4JZR A;  4QXH A;  4NPM A;  1ULP A;  1S0G A;  2G1M A;  3HEI A;  3SIS A;  5DQ0 A;  4B8E A;  3DYO A;  1FYU A;  2ZGL A;  1VAV A;  5APA A;  4A45 A;  5FY9 A;  2I2S A;  4NHK A;  2CYF A;  4K21 A;  1DFQ A;  1J3R A;  1UF2 C;  4CDW A;  3BTY A;  2QBX A;  3ZXG A;  2BFU L;  3POJ A;  5FMO S;  1W99 A;  5JI9 A;  3VD9 A;  1GNZ A;  1E5S A;  2VU9 A;  1KDK A;  3U11 A;  1FPN 2;  4AI3 A;  4EWA A;  2OYZ A;  4B29 A;  1V6N A;  3EQE A;  5IVE A;  5M0T A;  3P5B A;  2VGD A;  4BIO A;  4EN8 B;  2XJV A;  4OMC A;  5F3E A;  3I3E A;  4XEZ A;  3VD5 A;  2WAA A;  3LDR A;  3VKO A;  1US2 A;  2WNO A;  3WNL A;  1B35 A;  2RS3 1;  4A2U A;  4XCA A;  5FKB A;  2R30 A;  3HR9 A;  5DAB A;  3N7J A;  3VBO C;  1ZBA 3;  4O61 A;  1YXW A;  2A3W A;  4Z07 A;  2JG9 B;  1XND A;  5A7Q A;  3HIF A;  2Q1F A;  4K20 A;  5FY8 A;  1C4R A;  2CV6 A;  5C9A B;  1QQP 3;  1UMI A;  2DTY A;  2JDN A;  4GB3 3;  4COU A;  2DWR A;  2JEM A;  3GBG A;  4KQ7 A;  4LIU A;  3I7D A;  1PK6 C;  1G8W A;  3MYX A;  4O9G A;  4D7Y A;  1KXG A;  5L9B A;  3SKJ E;  1K5M A;  5FO8 B;  5IK5 A;  2FZ2 A;  4LHL A;  1OOP C;  2ZGP A;  3GM8 A;  5DDJ 1;  2PLV 3;  4QQH A;  1J3P A;  1MQT B;  4K1Z A;  1QHD A;  5D21 A;  1YCI A;  2NMN A;  3U07 A;  1L3J A;  1HRI 1;  4ES9 A;  3AB0 A;  4FSJ A;  2E33 A;  2TUN A;  5F37 A;  3V0B A;  2R32 A;  3P1I A;  1KQR A;  1PNG A;  1RUE 2;  2XQR A;  3N7L A;  4XF0 A;  2PYT A;  5I0D A;  5J3U A;  1COV 1;  1BQP A;  3EYP A;  3V0A B;  4X6R B;  2HEV F;  3L2Y A;  1YYN A;  1FMD 1;  1I6X A;  5JXH A;  1FAY A;  1TZO A;  1W2O A;  2TNF A;  3I8T A;  3VBH A;  1KRI A;  1XU1 A;  3V0A A;  4XXP A;  1E5I A;  4MX3 A;  2VOX A;  5HI0 A;  3NAP C;  3WW4 A;  4YPJ A;  2F6B A;  4YGC A;  3ZKU A;  2XB6 C;  4JV4 A;  2RS1 3;  1QF3 A;  1UKR A;  2WZR 3;  1S2B A;  1W2U A;  3ZFG A;  4EWD A;  1YLL A;  4P5Y A;  1AX2 A;  4AAX A;  4CCN A;  5FPV A;  1UY2 A;  3K4Z A;  1H6X A;  4FFH A;  1GP4 A;  3I2I A;  3MEP A;  4KI5 M;  4XYX A;  1XNA A;  5KHG A;  5KXC A;  5DUV A;  1DZR A;  5JLV A;  2J22 A;  3LA3 A;  3MFA A;  3GAL A;  4H14 A;  1JZ4 A;  2H6B A;  2KA3 A;  2RR1 2;  1MS4 A;  3TN9 1;  1W8H A;  3OPW A;  3T2O A;  4WM7 C;  4HPK B;  2WAO A;  4MHR A;  3WD5 A;  3ZFF C;  1FMD 2;  2JDZ A;  3BGA A;  1DGR N;  2D5H A;  4XFC A;  1MZE A;  2Y26 A;  1NUK A;  2R04 3;  1O8P A;  3O1U A;  2WQ4 A;  3GZE A;  3BTX A;  2K46 A;  1QJX 3;  3ZYJ B;  2R1B A;  1HRI 2;  4I30 A;  4E8D A;  3APB A;  3OGG A;  3FBY A;  1CAW A;  5LK7 B;  3IDE A;  3I2J A;  3LFI A;  4QGL A;  3D82 A;  5EFU A;  2WO3 A;  3ZMO A;  1LB2 A;  4TLG A;  1G9F A;  2ZGQ A;  4YWA A;  2ORX A;  3OBR A;  1UZZ A;  3PU8 A;  1W6N A;  1UXZ A;  3A7Q A;  5D8A C;  2IUW A;  4FPO B;  4DNY A;  3MLL A;  1LED A;  4AZZ A;  2GH2 A;  2L9L A;  4FPY A;  2VQT A;  2WL1 A;  1OUX A;  1POV 0;  4UW4 A;  5C5U A;  5JXJ A;  3PJY A;  2WS9 1;  1W6M B;  2VD7 A;  1Y7B A;  2A73 B;  2QQW A;  2VCM A;  2Y0I A;  3WHT A;  1QJE A;  2IVI B;  3AKP A;  2V09 A;  3CF6 E;  4LEJ A;  5J96 B;  2GC3 A;  3K46 A;  5IAT A;  1YQ6 A;  2Y6F A;  4OUS A;  4CEW B;  4YNI A;  2RDR A;  3D5O A;  4OUL A;  3CL1 A;  1NCR B;  4XUP A;  4P9J A;  3B02 A;  4NII A;  4P9Y A;  4ZON A;  1UPI A;  4IE7 A;  2DBN A;  3WP4 A;  3N9L A;  3OYW B;  1YI9 A;  1UWW A;  2EAK A;  2XJS A;  2XON A;  1MEC 3;  1R1Z A;  5F39 A;  3FBM A;  5FP8 A;  4V2W A;  3FL7 A;  3RWN A;  3NJZ A;  3WQ7 A;  4YLZ A;  3MZH A;  1Q43 A;  2HWB 1;  5JIA A;  1GMM A;  3RWK X;  1G9B A;  2B7Y A;  1R09 2;  2EXI A;  4OQ9 A;  1PNF A;  4Q4V 3;  1Y3T A;  4NWW A;  2DU1 A;  4AQS A;  1QJY 1;  3ETQ A;  1UIK A;  3E6D A;  3BU0 A;  3POE A;  1ALY A;  1OKO A;  2XPJ A;  3I59 A;  5JSR A;  4XUQ A;  1APN A;  1SEF A;  1GR3 A;  4YM2 A;  5LK5 A;  3U37 A;  4AQT A;  1NZI A;  4E4D X;  2G9G A;  4QDQ A;  4GA9 A;  4YSF A;  3DEM A;  3QLQ A;  3BVC A;  3FZ3 A;  4IEW A;  2B39 A;  1DBN A;  3OF1 A;  3T2Q A;  3MFC A;  2ZHN A;  1DCS A;  2RJK A;  4M3C A;  1O4T A;  1VMJ A;  2Z4F A;  2OT7 A;  1BZW A;  4OI0 A;  4CDU A;  2GMM A;  3J7N A;  1HIX A;  1O91 A;  1W6O A;  3T0A A;  5BNN A;  2XKO A;  4TZD A;  1YO8 A;  3E5Q A;  1LEM A;  4IXL A;  4KL1 A;  4YW5 A;  2QDN A;  2B45 X;  2NLR A;  3MIH A;  2PHF A;  1PMH X;  1W6Q B;  1O4Y A;  4B4P A;  4M4R A;  5LA1 A;  2ES3 A;  5I0T A;  5GJ6 A;  1V6M A;  1GKB A;  2WZR 2;  3E97 A;  5JUV A;  3S5A A;  4CEY C;  4MG2 A;  3VZK A;  3QBQ A;  4AHX A;  4IER A;  2V73 A;  2LTN A;  3LSE A;  5F2S A;  1N1T A;  2XL7 A;  2NMO A;  5FZ7 A;  4QPG C;  4CEY B;  1VBA 1;  1GP5 A;  3EB7 A;  4UW6 A;  4Z8B A;  2CDP A;  4BME A;  2PLV 1;  4KG8 A;  2RR1 3;  1U0A A;  3ECQ A;  4QKD A;  5IVY A;  1QY4 A;  4BB3 A;  1W2N A;  1D4V B;  5F3G A;  4YW3 A;  3RJR A;  3NV1 A;  4YW7 A;  4F3J A;  3W58 A;  2VTF A;  4EV0 A;  4UBH A;  3ZVX A;  3T2T A;  5A7O A;  1OKQ A;  2MEV 3;  2ZS6 B;  1X8M A;  2J7M A;  5FYH A;  3LZZ A;  2XJP A;  5I8S A;  1PO2 2;  4IV1 B;  5FXW A;  1OI6 A;  1QJX 2;  1SFN A;  4H2A A;  3LEM A;  4CU8 A;  1JHN A;  1G6N A;  1DQ5 A;  5FZ1 A;  4A42 A;  2OX0 A;  4QB1 A;  2YGL A;  3SEE A;  3K51 A;  1RXG A;  1F2N A;  3LEI A;  4FOV A;  3GBF A;  1I3H A;  4PQQ A;  4XIO A;  5BNO B;  4NID A;  2Y6H A;  2YYO A;  1BVV A;  2CU5 A;  2V4A A;  4OMD A;  2K0G A;  4FPE A;  4XUN A;  5FZ4 A;  4BQ1 A;  5A3P A;  1M4W A;  1MS0 A;  2BU9 A;  4I3P A;  2FDK A;  3JUU A;  4CP2 A;  1OVP A;  5B2G B;  3RYP A;  2RMU 1;  4N53 B;  4E8C A;  2ET7 A;  3U1X A;  3URF A;  3LA2 A;  4GH4 B;  1IPJ A;  1LHN A;  2B4K A;  4LJH A;  4YM3 A;  1HQN A;  4Q0S A;  3FWE A;  3PDQ A;  1C57 A;  4AEM A;  3ACL A;  1XRU A;  4BYY A;  2ZZQ A;  4HK9 A;  3MW3 A;  3NJV A;  4ONU A;  1YFW A;  4FAH A;  4JTN A;  3SLI A;  1RIT A;  2C6S A;  4ASL A;  2NM1 A;  1GQG A;  3CIH A;  4AG4 A;  4AHW A;  3W9A A;  5IYY A;  1V9U 3;  4QGN A;  3SC7 X;  4COZ A;  4QKF A;  4CTE A;  1W6M A;  5CAZ A;  4OHY A;  1HB3 A;  5LRS A;  2QTW B;  2XWJ B;  3LDB A;  4W8J A;  3PNA A;  5FPB A;  4AHZ A;  2VUD A;  3VD3 A;  2K9Z A;  4D3W A;  3I3B A;  4FFG A;  1WA4 A;  1UCX A;  5KHH A;  3WV6 A;  4CCJ A;  4DIQ A;  1DQ6 A;  3LF7 A;  4Q4W 3;  1O5L A;  4XF4 A;  1NQJ A;  1H8T A;  4JGY C;  3KHC A;  1UZ0 A;  2JE9 A;  2Q30 A;  4FQZ A;  4W6W A;  5FZL A;  4IND A;  4DOU A;  2A71 A;  4CUB A;  4JCK A;  5EWS A;  3ZFE A;  3OBA A;  3MW4 A;  4EJR A;  2XJR A;  3ASI A;  1HRV 1;  5LZ6 A;  5LWB A;  4I2O A;  1QOS A;  2OQ7 A;  1RVF 1;  4MGZ E;  4Q4V 2;  1LES A;  3B01 A;  3NNM A;  4CDW C;  2PXJ A;  1GIC A;  2HWF 1;  1RTV A;  3VZM A;  3N36 A;  3ZKY A;  3VZN A;  2AR6 A;  3KV4 A;  4JX0 A;  1W05 A;  1ZM1 A;  4IEV A;  1QIQ A;  3H8U A;  4ISQ A;  4RHV 2;  1GBG A;  1E5R A;  1KD7 A;  2PHD A;  1UOF A;  1ZZC A;  2GZW A;  3N9P A;  2D6O X;  5EPA A;  3K4A A;  2W92 A;  4LR4 A;  3W5N A;  3AJZ A;  2X09 A;  4RGK A;  3R05 A;  5DZE A;  5IVC A;  3U0Z A;  4LUM A;  2VW1 A;  4MYE A;  2JB8 A;  1IS6 A;  1JHJ A;  2WS9 3;  5IW0 A;  2GP5 A;  1PMJ X;  3VDD B;  3WX5 A;  4BQW A;  4MXW A;  5JAX A;  3BB6 A;  4P9L A;  1BMV 2;  3WF1 A;  4BIF A;  4DXS A;  2Y34 A;  4E2G A;  1HXS 1;  4BQ3 A;  1C5H A;  2VXJ A;  1ZZB A;  3AYC A;  4YFZ A;  5KWR A;  5FY7 A;  1A8M A;  2JG9 C;  3OEA A;  1JOD A;  1SLA A;  3GJB A;  1ZZ8 A;  4BCU A;  2ZEX A;  2RJL A;  2ZZJ A;  1HX6 A;  3ZFE C;  1BXH A;  3SH4 A;  3KQR A;  1NY7 2;  5GLU A;  2GSY A;  4RL7 A;  2ZAC A;  3C7E A;  3KVB A;  4DRR A;  4OHV A;  2BNO A;  3SHR A;  4CCM A;  2HJI A;  3OY8 B;  4PF5 A;  3INA A;  1NYW A;  4YVW C;  2J1E A;  1TG7 A;  5LBF A;  3OG2 A;  2XQX A;  3MDP A;  4LE3 A;  3B5L B;  5A7N A;  2YC4 A;  3F95 A;  1VAK A;  5A6X A;  4ES8 A;  4N9H A;  1UKG A;  4EN0 A;  3O1T A;  4CXW A;  4FTE A;  2WII B;  4PF1 A;  1NAE A;  3SCG A;  1EV1 1;  2X5I C;  2WT0 A;  4RS5 C;  1W3V A;  2EVX A;  1ZRI A;  3AXD A;  4AGG A;  2JB4 A;  4BPZ A;  2ZX1 A;  2WNV B;  2FZ1 A;  1BYH A;  4JQT A;  3ZR5 A;  3HN3 A;  1R1A 3;  3JQW A;  1AL2 1;  1MQT C;  4Y1U A;  2HEY F;  1W8N A;  5EHD A;  1J1T A;  4BOW A;  1W8T A;  2XUE A;  1VAM A;  3TRS B;  5BNN C;  1DF0 A;  4QXC A;  3OGR A;  2AGS A;  1OQ1 A;  2YV8 A;  1YWK A;  3FFZ A;  3AP4 A;  3FC0 A;  4NPL A;  4D7S A;  1IG3 A;  4YZ1 A;  5F3C A;  2AEY A;  1RUC 2;  1LUL A;  1TNR A;  2IC1 A;  4MOA A;  1SBE A;  1XE7 A;  5T3N A;  4CP9 B;  3AXE A;  4DUX A;  3QH6 A;  1U5I A;  1F8V A;  3T4V A;  5IAV A;  1QXP A;  3TBD A;  4GH4 A;  1CZT A;  1QH7 A;  1W0O A;  2D97 A;  2QDR A;  5FXX A;  5EIY B;  1COV 2;  1J3Q A;  1OD5 A;  2PMW B;  3AMM A;  3IAQ A;  4PBP A;  3U75 A;  1GLH A;  3VBR C;  3HNY M;  3WDW A;  3KB5 A;  1IPS A;  1S1A A;  1YHF A;  3RMY A;  1ULG A;  3WOG A;  1A6C A;  4GWN A;  4LA3 A;  1ULC A;  1O7F A;  1EV1 2;  1RIR A;  1W6P A;  3OUI A;  4EWE A;  4NIG A;  5F3I A;  4XFH A;  5G04 L;  2GNB A;  1QEX A;  1UU5 A;  2C5D A;  1HN1 A;  3PUS A;  4Q4X 1;  2AAC A;  2ERF A;  4CPB D;  3N4M A;  4XBQ A;  2BEO A;  4R9B A;  5F7U A;  5KHJ A;  3PL0 A;  1UX6 A;  4N43 A;  2W2I A;  5IJR A;  4BDV B;  2XLF A;  5I8Y A;  4IUG A;  5K4L A;  1TMF 2;  1RUJ 1;  4GJY A;  4N43 B;  1V6K A;  2D98 A;  3ZFE B;  1JOJ A;  4OLL A;  4CEW A;  3VBS A;  4YFW A;  3VL9 A;  1L7L A;  2XWB B;  2YBS A;  3NNJ A;  4AI8 A;  2UUR A;  1ZBA 1;  4RS5 A;  1I1E A;  3SMH A;  4AEJ A;  1ULO A;  4DIN B;  2C4X A;  5ACA 2;  4FOQ A;  4IGP A;  1BMV 1;  4LO5 B;  4QGM A;  1K5J A;  1QJU 1;  4EYU A;  1QGL A;  4NHY A;  4BQY A;  2XJT A;  5FWJ A;  2XG3 A;  2WS9 2;  4RA0 A;  3NV3 A;  1HB2 A;  3ALQ A;  3ZXA C;  2A6Z A;  1NA1 A;  1CX1 A;  3EMR A;  2P17 A;  2FCT A;  4J1X A;  4RR3 A;  2OXB A;  3FFQ A;  4HSJ A;  2ARE A;  1ZRE A;  5LA0 A;  5FBZ A;  4A6S A;  1RUH 2;  4GAZ A;  2BWA A;  1UW8 A;  1S0D A;  5J1X A;  5J37 A;  3SKV A;  4EQV A;  4XMA A;  1U12 A;  4K8F A;  4RYD A;  4J25 A;  3FHA A;  3KHB A;  3PIG A;  4EZH A;  1PO1 2;  3T0D A;  5CKN A;  3M2M A;  4GAL A;  5J36 A;  1PGW 2;  1IZ3 A;  1SAC A;  4XDP A;  5GKA C;  4QAW A;  3BIE A;  2VY0 A;  3IAP A;  5C8W A;  4IEU A;  4HOO A;  3IM0 A;  1AR9 2;  3UGG A;  2YZ4 A;  2ZAB A;  2A7A A;  1ZRF A;  1AR7 3;  2XBO 1;  3N7K A;  3WW2 A;  4YZ5 A;  2GNM A;  1F4A A;  4XZU G;  5DZF A;  5A7S A;  4YAR A;  4DY3 A;  5FZ0 A;  4MXV A;  5KHK A;  3CU7 A;  1W2T A;  3KM5 A;  5DDJ 3;  5LRR A;  5J48 A;  1OHF A;  5KXE A;  2R06 2;  1AXK A;  1ZBE 3;  1WLW A;  4LO8 A;  3UYJ A;  1RUN A;  2W1S A;  5FTT C;  3U4X A;  2WFF 1;  3Q8E A;  2Q0A A;  2H6C A;  1CAW B;  1YFY A;  4LBM A;  4LHN A;  4Q4X 3;  5HXV A;  4AQ6 A;  4CU7 A;  3DPR C;  3ZXJ A;  3KV5 A;  2YGM A;  2WC2 A;  2A6W A;  3BCW A;  1DU3 D;  1AL2 2;  4Q0Q A;  3U10 A;  4WM8 B;  3USU B;  4C0B A;  2JIG A;  2V5D A;  1EP0 A;  1WLD A;  5FIX A;  1T6G C;  5T55 A;  2ZGN A;  1HXS 3;  3WSO A;  3ZFF A;  5IVF A;  4C8D A;  1UAI A;  2BZD A;  3IWZ A;  4A3Z A;  4R9C A;  2Y33 A;  2K2S A;  2QZ3 A;  4QHO A;  3AMP A;  3HQU A;  1GNH A;  3RDI A;  2WWU A;  4KH9 A;  1EPZ A;  3NJX A;  4CCD A;  3R4S A;  1ZVF A;  5HBA A;  1REF A;  2ZGM A;  2G9F A;  2AZ5 A;  3MF6 A;  1DGW A;  1COV 3;  3ABZ A;  4ZZ5 A;  2YBK A;  3JXS A;  4Y3O A;  4XAC A;  3LPG A;  1VRH 1;  3B7M A;  1VRH 2;  4DQA A;  1X7N A;  4CXY A;  4N90 A;  1RUF 1;  4B1M A;  1YQ5 A;  1XNB A;  4YW6 A;  1WKY A;  2VBP A;  3PUQ A;  3VBU B;  1PMI A;  3WW1 A;  1NCQ B;  5FPL A;  4AOC A;  3JU9 A;  4Q29 A;  1XSQ A;  3AC0 A;  2HBT A;  5F8P A;  1RVF 3;  1JYW A;  4CDX B;  5A3O A;  2CDO A;  2ZGK A;  4W6Y A;  3ZN6 A;  4WVV A;  4UF0 B;  1PZ9 A;  1YFX A;  2F17 A;  4GMP 0;  4YGE A;  4AVC A;  1ND3 A;  3GCW A;  3ES4 A;  3X29 B;  1X36 A;  1OQD A;  5CYY A;  3RI8 A;  4JKM A;  4MGT A;  3J8F 1;  2D6P A;  1N47 A;  1GOH A;  3RMX A;  1GV9 A;  5CFD C;  3I3D A;  3KCC A;  3H1Y A;  3O5S A;  1H8T C;  4JGY A;  4E2S A;  3BPS A;  2X29 A;  1D2Q A;  3AM2 A;  3RZZ A;  1HV1 A;  5CG9 A;  1WW7 A;  2CTV A;  3KF3 A;  1AJK A;  5FPA A;  5ABJ C;  4LLO A;  5LW9 A;  2A3Y A;  5C8C C;  1U5Y A;  2VMC A;  5A3N A;  3VDA A;  5ACA 3;  3H1M A;  1NLR A;  3Q8B A;  4BK5 A;  1BK1 A;  1RL3 A;  3VHN A;  4AGR A;  3DYM A;  1Q8S A;  2RDS A;  5J98 B;  1VBE 2;  2SLI A;  2OVU A;  3WDU A;  2ZX3 A;  4TXW A;  2DCZ A;  2VME A;  2VUJ A;  3FE5 A;  4UFL A;  1C1L A;  2PA7 A;  5F1R A;  4FPH A;  2D6M A;  5BUV A;  2NZ9 A;  1OVS A;  3AYE A;  2DFC A;  2PHW A;  1MS1 A;  3PLQ A;  2XBO 2;  3EXU A;  1QJU 2;  3IB3 A;  2DBI A;  1H2L A;  4OYU A;  3S6P A;  2PEL A;  1H1M A;  4IL7 A;  1VE0 A;  4GQ7 A;  3WG4 A;  4CUC A;  1GSL A;  4AL9 A;  3WVJ A;  2YB7 A;  5D8A B;  1H6Y A;  1LCL A;  3LFM A;  4UYB A;  4FO9 A;  5A3W A;  1JYC A;  3C7H A;  1XYP A;  2BUK A;  4NE9 A;  5T5L A;  3T09 A;  1HRI 3;  1WD3 A;  2QQO A;  5BNO C;  2QJV A;  4XUR A;  2LAL A;  3WZ1 A;  1RUD 2;  1D7P M;  1WGP A;  2J1R A;  4M01 A;  4W6X A;  4PHZ A;  5AFB A;  3WXP A;  5EYY A;  3UET A;  2EXJ A;  3Q8F A;  1CD3 G;  5G05 L;  4QDR A;  3A0N A;  5A70 A;  5E1R A;  1RED A;  1CPM A;  1AXZ A;  5JOY A;  3UKN A;  1MZ5 A;  4W65 A;  4S2G A;  3BOW A;  1O8S A;  4X8N A;  3OBT A;  3J8F 2;  4JKK A;  4E9K A;  1JW6 A;  4P00 B;  4Q4X 2;  2QQJ A;  4L97 A;  4P9X A;  3ZMN A;  2SBA A;  1MVE A;  2JXA A;  2WWS A;  3VN4 A;  1RHI 3;  1RUI 1;  5F9T A;  1RUG 1;  2JDM A;  2A6Y A;  4W4Z A;  3HMY A;  2HYX A;  3NST A;  4SBV A;  1YJK A;  2D5F A;  4BHP A;  3ITQ A;  5FZE A;  3ZO0 B;  2Q8E A;  2JIJ A;  4QPY A;  4BU2 A;  5KR7 A;  1NX9 A;  2BQP A;  2Y6G A;  1LKN A;  4RFT 0;  1WME A;  4QQ2 A;  2MPF A;  1KDM A;  4Q0U A;  4BQ2 A;  3OGJ A;  1S2K A;  3H50 A;  4H7M A;  4HG6 B;  5LEK A;  2VCB A;  1O6U A;  1SLL A;  4WM8 A;  4FQ4 A;  2ARC A;  4MUV A;  4OI2 A;  4FVV A;  1UN1 A;  1SG3 A;  4LBN A;  4COV A;  1Z0H A;  2A3X A;  2BDR A;  3VHP A;  1FT9 A;  4GKY A;  4Q4W 1;  3LCP A;  4PDW B;  5JOW A;  3T30 A;  3AFK A;  4XQD A;  2VOW A;  1WLC A;  4U36 A;  4C91 A;  3RZK A;  2TEP A;  2RV9 A;  5CFC B;  1GZ9 A;  1MS9 A;  1WMF A;  2CAV A;  4CEW C;  2VOV A;  1W90 A;  3UKT A;  3VBS B;  3B94 A;  5BXX A;  3RYK A;  5CFD B;  2WYF A;  2WUH A;  3ZXL A;  5A6Q A;  2CY6 A;  3VGI A;  5JDB A;  1F5J A;  4B3N A;  5JSO A;  4EE2 A;  1A3K A;  5DAP A;  2Q8O A;  1RUC 1;  2BWC A;  4YYO A;  3ZYF A;  1LNS A;  3POS A;  1JZ3 A;  2ETE A;  5D8A A;  4IE6 A;  5H9S A;  5BNO A;  3ILN A;  1Y9G A;  5GAL A;  4YVS C;  2F4P A;  2BBV A;  1W2A X;  1DQ0 A;  1V6I A;  4XIK A;  1N1S A;  5H9P A;  3P3P A;  4DPN A;  5FUN A;  4CDQ C;  3LDK A;  5HCA A;  3VBR B;  4WVM A;  1BCX A;  4QB6 A;  5FRE A;  4BE3 A;  4EN6 B;  4LHK A;  2HEW F;  3FHI B;  4XJU A;  5FYV A;  3OOX A;  1WUV A;  2BTV C;  3CJX A;  3C2U A;  4XJ9 A;  1VBC 3;  5A33 A;  2Y6K A;  2BVV A;  2ZGR A;  3BAL A;  1DGL A;  5E89 A;  3WNP A;  4QXK A;  1AYN 1;  3PHM A;  2DCJ A;  5AVP A;  2FMD A;  1ASJ 1;  1PO1 1;  4A3X A;  1YQC A;  4LMF A;  2W1Q A;  5A33 B;  3IBM A;  3CBN A;  5AVA A;  2WRA A;  1ZBE 1;  2NN8 A;  5CIS A;  5FKC A;  2ZGO A;  2O14 A;  4QQO A;  4V2V A;  3NV4 A;  4QX3 A;  3EJK A;  2E32 A;  3FLP A;  4AI2 A;  5F5C A;  1WCQ A;  2BGC A;  5GZG A;  1JYN A;  2BVB A;  2ATF A;  3DV8 A;  3PMS A;  2MEV 2;  3MO4 A;  3PUH A;  2HLE A;  4ZKT B;  5BNP B;  1RGS A;  1AR6 3;  1I9R A;  5B4X A;  2A1X A;  1PO2 3;  1OH4 A;  4QU1 A;  4N53 C;  4RGG A;  2DCY A;  5LAS A;  1ZA7 A;  2IFR A;  4Q27 A;  2W68 A;  5BNQ A;  5AC9 1;  5ACA 1;  3BPZ A;  3JD7 3;  2VCC A;  4R9A A;  3VDC A;  1YRZ A;  3MF9 A;  1XE8 A;  1TEI A;  2X53 S;  4JGZ A;  4Q4V 1;  5BY5 A;  4DXT A;  2YDE A;  3IPV A;  3ZXK A;  1PZ7 A;  1UL9 A;  2YMZ A;  5DPN A;  2VZT A;  1UY0 A;  4NRO A;  5A7W B;  2VNV A;  3J8F 3;  3LD8 A;  5I0S A;  1VB4 A;  4QM8 A;  2Y0O A;  2O8O A;  2RS5 2;  4MV2 A;  2CHH A;  1JUH A;  2VO5 A;  1AR8 3;  3O12 A;  4BA6 A;  5GM0 A;  5JVV A;  2RM2 2;  1VBE 1;  5FQ0 A;  1W9S A;  1K3I A;  4CCO A;  1S0J A;  1RUD 1;  2ZTN A;  1OF4 A;  5K0U B;  3ZDS A;  3FUQ A;  4V1P A;  1ZA4 A;  3KT1 A;  5ANQ A;  2ZMN A;  1XYO A;  2IXJ A;  1UY1 A;  2HWE 2;  2V4V A;  2W1W A;  3VBO A;  3ZPO A;  2BW8 A;  5FZD A;  4YVW A;  5ABJ B;  4Y1X A;  2WLQ A;  4Q1P A;  5FY4 A;  1EUT A;  4Y5Z 0;  5FMD A;  1CAU A;  4NHL A;  3H3Z A;  2WNV C;  5JSP A;  5LCW L;  4YZ2 A;  2BNM A;  4AW7 A;  1NG0 A;  1RUJ 3;  3H0O A;  3VD4 A;  1D0G A;  1OBN A;  4CPB A;  3O1R A;  4M3C B;  1IKP A;  4Y1V A;  1CR7 A;  2J1U A;  4YVS B;  1UYZ A;  3M3O A;  3KWV A;  5C6C A;  3ST7 A;  1CIW A;  1ODN A;  3IDB B;  3PVE A;  4L2N A;  1G9D A;  1NZC A;  2JX9 A;  1YJL A;  3BOP A;  4XQ4 A;  1XBF A;  2VMH A;  4Y1Z A;  5FZF A;  3AP6 A;  4URT A;  2QUO A;  4K7J A;  1G9C A;  4LUK A;  5FP7 A;  5FUP A;  1FOD 2;  2JD4 A;  2C1F A;  2UY8 A;  4E4H A;  1X82 A;  1RUF 2;  1AX0 A;  3ACH A;  3OD4 A;  4JVA A;  1PK6 B;  4RHV 3;  2MEV 1;  2QKD A;  3MV0 1;  3UJO A;  1BBT 2;  4EZ4 A;  2P3I A;  1BHG A;  2D6L X;  4BWO A;  3W59 A;  4GWI A;  3M3E A;  4HVR A;  2ZHL A;  3PVN A;  2RS1 2;  5EZW A;  1DGW X;  5FOJ B;  3CMG A;  4LOR A;  5CVR A;  1LHU A;  5LA9 A;  1ULE A;  3DCQ A;  3TN9 3;  3WUD A;  4BQX A;  3KT7 A;  1ND3 C;  4F83 A;  2RMU 2;  1S0B A;  4LBL A;  5DAX A;  5JWP A;  1CZV A;  4LKD A;  5CKM A;  2W5F A;  2TBV A;  2Y38 A;  4FPL A;  4PJY A;  3WW3 A;  5D2A A;  4AGV A;  4DB5 A;  5C5T A;  3POF A;  2OS2 A;  4LTA A;  4CXX A;  4KMQ A;  1EYB A;  4NVP A;  5I8T A;  3RZL A;  5LB6 A;  2ID4 A;  5DUU A;  3ZN4 A;  4IV3 B;  2NQY A;  1GWL A;  2YHJ A;  1KEX A;  1ENR A;  4RD7 A;  5F32 A;  2OII A;  1QJX 1;  4FTB A;  3D6E A;  1QKQ A;  5CEH A;  1QOT A;  4IE4 A;  2QE3 A;  1YIF A;  5GZE A;  2XR4 A;  1BJQ A;  4A7K A;  4NN0 A;  4PT6 A;  4RSU A;  3UV9 A;  3CKH A;  5A6Y A;  4WVM B;  2R16 A;  1NLQ A;  5C70 A;  5I0U A;  1ZZ9 A;  2ENR A;  4HXC A;  4LO7 A;  3K75 B;  3K4D A;  4KBZ A;  1W28 A;  5FFO C;  5C8C A;  4LBQ B;  3ZXD A;  1S4C A;  4FXK B;  1J58 A;  3DYP A;  3G7D A;  2WO1 A;  2E7A A;  4LHS A;  4JGY B;  4OCT A;  4XJA A;  3WR0 A;  1MAC A;  4CCC A;  4FTS A;  5CA6 A;  4LUL A;  3AK0 A;  3M3I A;  4NHM A;  1DQ2 A;  2CNA A;  2V5Y A;  3WLU A;  1H1A A;  5C7G A;  4LOS A;  4QQL A;  1ACC A;  5IK7 A;  1TME 2;  3N9O A;  4XW3 A;  1OFS A;  1M06 G;  5E6H A;  2GC0 A;  3DPR A;  1PIV 1;  1PM4 A;  3T08 A;  1R09 1;  3ACF A;  3TEY A;  4YVS A;  1S2E A;  2KXL A;  1FOD 1;  1LEC A;  3I3Q A;  4RHV 1;  3VKL A;  1AXY A;  1KJL A;  3H9A A;  5FLH A;  5BYN A;  2DVA A;  1PVC 1;  2VAU A;  2P37 A;  1LU2 A;  2W0X A;  3O0X A;  1WMX A;  2PQS A;  4UFJ A;  1W04 A;  5CNA A;  1G7Y A;  4R8H A;  3J7L A;  2WO2 A;  3VUO A;  1JZ6 A;  2CWM A;  4IEZ A;  1AR8 2;  1WD4 A;  3GBW A;  3ZYR A;  4E27 A;  2WZ8 A;  5FOB B;  5IAX A;  1HRV 2;  3WIN E;  2QQI A;  2VQA A;  1MS5 A;  4XZP A;  2QFE A;  4AYU A;  1DYK A;  1PX4 A;  5HPO A;  1DP0 A;  1W6Q A;  2E31 A;  1Y43 B;  3AFG A;  3WNO A;  4XDO A;  4D7T A;  2PAM A;  4XQW A;  4PDW A;  4JHT A;  1JH5 A;  1XE0 A;  1OSG A;  5IT6 A;  4XHB A;  3N35 A;  1RUJ 2;  1XJA A;  2JJ6 A;  2ZOE B;  4LIV A;  4N8M A;  2HWF 3;  3POW A;  4LKE A;  5FP4 A;  1UZV A;  3VBH B;  4XUO A;  3CZU A;  3GHM A;  3THC A;  5L9V A;  5DMY A;  5FZC A;  3NNF A;  4O7X A;  3WNX A;  1BKZ A;  4JRL A;  3PUA A;  1AR7 1;  1SQ4 A;  3CJI A;  3POG A;  1W8Z A;  4KG0 A;  4U2A A;  4WVW A;  3ACI A;  2WIN B;  2FD8 A;  1H30 A;  1QQP 1;  3MGU A;  3HT1 A;  1UD1 A;  2BV4 A;  5IWF A;  3ZYP A;  3T3Y A;  1AF9 A;  1RMU 3;  4L99 A;  1CAX B;  2NYY A;  1K45 A;  1XNT A;  4FP3 A;  5DG1 A;  4AVT A;  4RN5 A;  1B09 A;  1LGN A;  2WFP A;  4PLO A;  2R6Q A;  3BIW E;  5D1I A;  1G9A A;  2VG9 A;  2EID A;  2W1U A;  3LIH A;  1RMU 1;  4D94 A;  1OUS A;  3I2G A;  4FOY A;  1OPO A;  1C8M 2;  1IQA A;  4LO4 B;  4RQP C;  3K48 A;  3N9M A;  3VBF B;  3OEB A;  1EUU A;  1Z78 A;  3JBG 1;  3H7J A;  2OUH A;  5DAQ A;  3C3V A;  4OI1 A;  4FFF A;  1AR6 1;  3MPP G;  3ELN A;  2WSV A;  2ZAH A;  3MID A;  5FY5 A;  3R4U A;  5A32 A;  3WF4 A;  1OFN A;  2ZX0 A;  3MUZ 1;  5LBE A;  1MS8 A;  2XVG A;  1RUH 3;  4XBN A;  5ERL A;  4BQ4 A;  4ARX A;  2GMP A;  2IWG B;  3MIB A;  4K3U A;  2VEC A;  4IES A;  5A3L A;  1C3H A;  4CCL A;  2Z5W A;  2R04 2;  2G9Z A;  1NCR A;  1WWY A;  1OLR A;  3B9C A;  5FJK A;  1UY3 A;  5JZG A;  1XNC A;  2ZGS A;  3AZY A;  2QCS B;  4K1Y A;  5KC6 A;  3KV9 A;  2DUP A;  4QPI A;  4XAE A;  4XUT A;  2JG8 A;  4QX5 A;  3K2O A;  3RRD A;  4AHY A;  4IEX A;  1VBD 3;  2C0Z A;  2EF6 A;  1R08 1;  4RS5 B;  2DDU A;  2FMY A;  5FYB A;  3IPV B;  4PI0 A;  3MHZ A;  4Y4Y A;  4BH9 A;  2VUL A;  1F15 A;  3J7M A;  5EV7 A;  5DDJ 2;  4QD2 A;  5CBL A;  2ZHM A;  2YU2 A;  3H3L A;  5A7W A;  3UK9 A;  4PLM A;  1AVB A;  4WM8 C;  1D4M 3;  5IVB A;  1N1Y A;  1X8E A;  3E5U A;  3BI3 A;  3SXW A;  2GC2 A;  3KCY A;  1KJR A;  1JZ2 A;  4GKX A;  4C0H A;  4R52 A;  4D6Q A;  5A1F A;  3PJQ A;  1J84 A;  1Z7S 2;  2ZPX A;  4AFA A;  1ND3 B;  3ZSE A;  2JDK A;  2A6V A;  4OHZ A;  1A34 A;  3HQX A;  1V6J A;  5FZO A;  3HOB A;  5KBF A;  4Z82 A;  1SLT A;  4F8A A;  3AKT A;  2ZEY A;  3I59 B;  5HXM A;  1QDO A;  3T2P A;  4IEQ A;  1AL2 3;  4ORF A;  2PHT A;  3ZR6 A;  4CCE A;  1UX7 A;  4XCB A;  1OLQ A;  4DUV A;  1WCS A;  1W9Y A;  4NUB A;  1R1A 1;  1H4G A;  2D93 A;  5A3U A;  1US3 A;  4HZF A;  5FYI A;  1AJO A;  4L92 A;  4Q4W 2;  1PGL 2;  4ZS3 A;  3WQ1 A;  1YEW A;  4XFG A;  3OTF A;  1DLL A;  5JOX A;  1UMH A;  4G9S B;  3AKR A;  2WQ8 A;  1HRV 3;  2W3J A;  3A21 A;  3GXU A;  3ON7 A;  4QPG B;  4TLF A;  3LKJ A;  1WLT A;  3FLT A;  3TEX A;  3V56 A;  1ODM A;  4CUG A;  3ORJ A;  2JDU A;  1NCQ C;  2HWD 1;  2P2K A;  1WW6 A;  4AXO A;  1GZC A;  2DUO A;  4OFG A;  4YRD A;  4QKB A;  5JPM B;  3O1M A;  4KWK A;  4WZC A;  4QM9 A;  2Q1M A;  1SMV A;  2W52 A;  2WFF 2;  3KCX A;  5FLJ A;  4CDU B;  3III A;  3OJB A;  2HWF 2;  4YM1 A;  5A32 B;  1QWR A;  1RUI 2;  1N3O A;  2PHR A;  2WWJ A;  3E1F 1;  1K42 A;  1RVF 2;  4MGI E;  4BIS A;  1OXC A;  2BPA 2;  2VXR A;  4XXA A;  2B42 B;  1BEV 3;  5FO7 B;  2R07 1;  3NMB A;  1AR9 1;  2Q1Z B;  2EIE A;  2ZGT A;  2MNG A;  1UU4 A;  1YFU A;  4XAB A;  4ATF A;  3V0B B;  5FR3 A;  2WNV A;  3AP7 A;  3OPT A;  5K0U A;  1PM7 A;  2W08 A;  4I0B A;  3WHU A;  3ILF A;  5F5Q A;  2BRT A;  4Y24 A;  4D6S A;  4NIH A;  2HWE 1;  1PVC 2;  1VBB 3;  4G3Y C;  1KFU L;  2CWS A;  5GZD A;  1V9U 1;  3VKF C;  1H2M A;  3VV1 A;  3NJY A;  3I49 A;  1ZRC A;  5FPU A;  3W20 A;  1W06 A;  5B4N A;  1SBD A;  4OVE A;  1PIV 2;  4WM7 B;  4CA9 A;  4PIY A;  4AR2 A;  2WZE A;  1XYN A;  5J09 A;  1HQW A;  2XHN A;  2CAU A;  2P6H A;  2KD7 A;  5L19 A;  5FCC A;  2WNU B;  1YQ8 A;  5C4W B;  1JBC A;  3I4I A;  3RI9 A;  5EYX A;  2BJS A;  3HBK A;  5CB7 A;  3OY8 A;  1AYM 2;  4J6G A;  3MBW A;  1ZRD A;  4I02 A;  3VKM A;  1GOF A;  2YC0 A;  5EXO A;  1CIY A;  3NNL A;  5K7P A;  1W6O B;  3PIJ A;  2AEZ A;  1XPW A;  1UMZ A;  5BNN B;  4I3G A;  1VMF A;  1OLM E;  5FUI A;  1O59 A;  2DCK A;  1OD3 A;  3BN6 A;  4MGY E;  4IGO A;  4JRA A;  4LT5 A;  2JKX A;  3FMG A;  4AI9 A;  1ZZ7 A;  2B8M A;  1JXN A;  1ND2 A;  2J42 A;  1GUI A;  1O4Z A;  4N9I A;  4ZZ8 A;  4XET A;  1N3P A;  3PVB B;  4A7Y A;  1RUD 3;  1RJ7 A;  2X8K A;  3K3O A;  4MLO A;  5FK8 A;  4UBG A;  2D3R A;  3WUC A;  2P3K A;  4Z2A A;  3VDB A;  5FMO L;  5C9A A;  2VUA A;  5SV8 A;  2W94 A;  4LPL A;  1OMI A;  1XQN A;  2VR4 A;  1RYY A;  1LGC A;  1JZ7 A;  2PN5 A;  4D6R A;  5ANN A;  1K5M B;  2C9K A;  4IE0 A;  1RUC 3;  3VZJ A;  1PGL 1;  5FP3 A;  1TQ5 A;  1EPW A;  3RZJ A;  4GD4 A;  2QQL A;  2XGX A;  3H42 B;  3M1H A;  5EQU A;  3UNP A;  2BER A;  1LHO A;  2QQM A;  2WZR 1;  1NE6 A;  3PVO A;  5TSW A;  4TSV A;  5GZC A;  4LQR A;  4NRP A;  3UGF A;  1Z7S 1;  1HB4 A;  1HW5 A;  5H9R A;  3B3Q E;  1PO2 1;  1UQX A;  3DKQ A;  1KGY A;  5IFT A;  2PHL A;  4N7U A;  4O9E A;  1WW4 A;  1Q8Q A;  3WF2 A;  3O14 A;  1Y4W A;  3LEG A;  1MZF A;  5FMB A;  4WBB A;  3AZZ A;  3BUC A;  4UI9 L;  4BZ4 A;  4HET A;  2DVD A;  2XH6 A;  2VZQ A;  5CFC C;  2B46 X;  1C28 A;  3B69 A;  4AF9 A;  3O1O A;  4KBB A;  1R08 2;  2YC2 A;  3VHO A;  1GFF 2;  2GNT A;  4FCA A;  2PLV 2;  4BLI A;  4P9G A;  5LAT A;  1VBA 2;  1ULD A;  2VTX J;  2I07 B;  1ZX5 A;  4OI4 A;  2VE1 A;  1NLS A;  3ZN5 A;  2CSG A;  2CGO A;  5DAW A;  4FP2 A;  3VBU C;  4UFI A;  1CX4 A;  1H2N A;  4HFS A;  2D43 A;  1WA6 X;  5FYS A;  3JBG 3;  3MW2 A;  4JGZ C;  4ZXE A;  4L0P A;  4K8R B;  3J4U H;  5FZM A;  4MHU A;  5FXZ A;  3S0M A;  4HVO A;  4AWD A;  2IXK A;  4HLT A;  3THP A;  3R6S A;  2F4L A;  3L9J T;  2HWB 2;  5E8A A;  4LBK A;  1MS3 A;  5BPX A;  2FDG A;  2B9U A;  2WNU C;  3MLK A;  5EP9 A;  2AYH A;  2R06 1;  1QH6 A;  1GOG A;  3DEC A;  4QPW A;  1HLC A;  4Q0V A;  4ATE A;  3LQC A;  5JXG A;  2JDA A;  3M3C A;  2VM9 A;  3KVA A;  2RS5 1;  2VZ1 A;  4RQP A;  4TTG A;  3BTA A;  1C8M 1;  3HT2 A;  1FNY A;  3QCW A;  4DRV A;  4YG6 A;  3T0B A;  4QMA A;  3EHK A;  3HQR A;  4Z1V A;  3NVC A;  4OHW A;  3VLB B;  5LEJ A;  1ULF A;  4PLN A;  1QJZ A;  2DCT A;  2XLG A;  4AVS A;  2A6X A;  1RUG 2;  4KU8 A;  5C3Q A;  1AZD A;  1LOA A;  1QJY 2;  2DUQ A;  2XML A;  4H55 A;  5F6L B;  1W3X A;  4Y5S A;  2XUM A;  4P5H A;  4E2Q A;  1KS5 A;  4PCR A;  5JI7 A;  5I93 A;  5CFC A;  1UOG A;  3KGL A;  1FI2 A;  3VZO A;  5JZG B;  3N7M A;  4AFB A;  3WP3 A;  1TMF 1;  1RUH 1;  2O1Q A;  1G86 A;  1R64 A;  1AR7 2;  3ZIX A;  4QPI B;  1JI6 A;  3ILR A;  1UOJ A;  1H2K A;  3N9Q A;  4BXS V;  4JKL A;  2ADE A;  2O8Q A;  5ABJ A;  1KS4 A;  3GZT B;  5AFE A;  5I0R A;  3O7O A;  3SIT A;  5FV3 A;  2FDF A;  1P8J A;  4CCK A;  3VDD A;  1YNA A;  1MEC 1;  3OYW A;  2WNU A;  3TOJ A;  1V0A A;  1XNK A;  5KXD A;  4CDU C;  1O3T A;  1C8N A;  1H9W A;  1ZBE 2;  3TEW A;  3AP5 A;  4BLJ A;  4Y20 B;  4XTM A;  2B5H A;  2LRO A;  4UXA A;  4DXR A;  2PAE A;  2ZKN A;  3NNG A;  4RFR B;  4A4A A;  1AYN 2;  4QHB A;  3GGL A;  3H8X A;  2VNR A;  3LE0 A;  1O3R A;  5C4W A;  3NWK A;  3ZXF A;  2E6V A;  1DDL A;  4K9S A;  3KZ4 C;  2VW0 A;  5L9R A;  2Z79 A;  1U5Z A;  3QAC A;  4GH4 C;  4KNC A;  2Q4S A;  4I01 A;  4IV3 C;  4QX2 A;  1RB8 G;  2ZA9 A;  2C26 A;  1VRB A;  2VH9 A;  3LOI A;  1PK6 A;  2GND A;  2WZP P;  3UT0 A;  4WZF A;  3D0J A;  2RG4 A;  3CO2 A;  4COY A;  1VLN A;  5GLW A;  4P02 B;  5F2W A;  2RS5 3;  4NR1 A;  1X50 A;  1J1L A;  5EJ3 A;  3CDZ B;  4WVZ A;  1HB1 A;  2EIC A;  1A8D A;  2VZ3 A;  2GME A;  3KMH A;  1YQ2 A;  2GH8 A;  1Q8O A;  3GF6 A;  3SCF A;  3DKW A;  1EAH 1;  4XPV A;  3MUY 1;  5IUQ A;  2LM3 A;  1UYY A;  2GDF A;  2XDV A;  1QU0 A;  3AYD A;  1VRH 3;  3HN1 A;  3MPB A;  3POI A;  4HVQ A;  5IK4 A;  2BFU S;  5CFD A;  4NPR A;  1ENS A;  1UY4 A;  4XFB A;  4NMI A;  3KQ4 B;  3IZO A;  1V6O A;  1RUE 1;  1H8T B;  1STM A;  2ZML A;  5T5J A;  2R04 1;  3A22 A;  4JHZ A;  1SPP A;  3KT4 A;  1CVN A;  1SFY A;  2BYV E;  3Q8A A;  5FZG A;  5A3T A;  5JCT A;  4GUL A;  4S2F A;  2VCA A;  3L2H A;  2W46 A;  4CDW B;  4CP9 A;  1DZQ A;  4IQP A;  1XU2 A;  4ET7 A;  2BBA A;  3MI8 A;  4D0Q A;  4KWJ A;  1X9P A;  2E26 A;  1UYP A;  4LXL A;  1IGO A;  2DF7 A;  3VBH C;  1KIT A;  1SCS A;  4XF1 A;  2FDH A;  3AMH A;  1B35 B;  3T1M A;  1NCR C;  3UKV A;  4S2H A;  5C3S A;  3SEP A;  4HT1 T;  2JG9 A;  5DXD A;  4XFF A;  1RUO A;  4AI0 A;  2FDJ A;  2RJ2 A;  4IV1 C;  4Y20 A;  4C1W A;  5K9Y A;  1DQ4 A;  1EY2 A;  3AZW A;  1XXN A;  3ETP A;  4OHX A;  1WZX A;  2RS1 1;  4IE5 A;  1K5M C;  3OD0 A;  1POV 1;  4XF9 A;  3CNA A;  1BBT 1;  2D3S A;  1GAN A;  3M8L A;  3RYR A;  1FMD 3;  1IG0 A;  1UPS A;  3M7A A;  1JUI A;  1DIW A;  3ME2 A;  4M3C E;  4LBO A;  4DFS A;  3D3A A;  3PUR A;  4FPF A;  3THT A;  5KHI A;  5T5P A;  3UGH A;  1H4H A;  1ZYB A;  4JQR A;  5FJH A;  5SV5 A;  2VMD A;  2NPI A;  2YFU A;  1OPM A;  4ISR A;  3JB4 C;  2RDQ A;  1DYP A;  3PTY A;  1YUD A;  1W39 A;  3H3U A;  4CYD A;  4XAA A;  1DZT A;  2QZ2 A;  1S0C A;  5CKQ A;  3USU A;  2C9A A;  1OT5 A;  4DUW A;  1WCU A;  3GYD A;  5L7O B;  2RE9 A;  2JDY A;  2VL4 A;  1LR5 A;  4DXZ A;  2YU1 A;  4QT6 A;  4BK4 A;  2WBK A;  2GAU A;  2D6K A;  3PTR B;  4MAD A;  1S0F A;  4DO0 A;  1WCK A;  2VMG A;  4ZHN A;  2OZ6 A;  1V70 A;  4JAA A;  2IZW A;  4Q4Y 3;  1IS4 A;  3AVS A;  3ZX7 A;  1CES A;  2ZBJ A;  4DY5 A;  3KGZ A;  4KWL A;  3FJS A;  1ENX A;  1V00 A;  3ZLI A;  2J1T A;  3ZYG A;  1V9U 2;  2VVE A;  1VR3 A;  3B93 A;  4XMI A;  2WAB A;  1W0N A;  3DGT A;  3Q8C A;  3HNM A;  5CU1 A;  3A4U A;  2WT2 A;  1TME 1;  3A23 A;  4ZU5 A;  4YZ4 A;  1VBB 1;  2DFB A;  3OCP A;  5AC9 3;  2ILM A;  4NRQ A;  3HPN A;  1ENQ A;  1CON A;  3KS7 A;  3USS A;  4AED A;  1NT0 A;  3N3H A;  1FXZ A;  2OZJ A;  1LOG A;  1GQH A;  5A1A A;  1N1V A;  3TWI A;  2WN2 A;  2Y6L A;  2DVB A;  5FZ8 A;  1BEV 1;  3CEW A;  3VZL A;  3WF3 A;  4WV8 A;  4IDZ A;  4JDO A;  3WNM A;  5JMC A;  5JPN B;  1GQP A;  4P9I A;  4Z92 B;  5GLZ A;  3U4S A;  4CUA A;  5C71 A;  2GU9 A;  3AYA A;  3PU3 A;  3ZYB A;  3RVH A;  4QHZ A;  4A44 A;  2DUR A;  2HWC 3;  3ATG A;  4CDQ A;  3VDD C;  1IS5 A;  1E57 A;  3RGB A;  1BVP 1;  1OQE A;  1U5X A;  2Y60 A;  4W50 A;  4N43 C;  2HWD 2;  1QXJ A;  3LPF A;  2J1S A;  3TYJ A;  1L7Q A;  1HKD A;  3VD7 A;  4XFI A;  4C1X A;  4D69 A;  3HWJ A;  4YG3 A;  5CG8 A;  2WA4 A;  5DN2 A;  3BYW A;  2QQU A;  5JR2 A;  3OSD A;  2ET1 A;  1F35 A;  4YM0 A;  5C3R A;  3ZIW A;  2OPK A;  3W21 A;  2VQ0 A;  1ASJ 2;  2W91 A;  4NHX A;  3NAP B;  2I74 A;  4S2D A;  1FV3 A;  2BNN A;  3ZXE A;  4XIL A;  1LU1 A;  3OBZ A;  4HKL A;  1L7R A;  4XVH A;  1W03 A;  3RZH A;  1D4M 1;  3DN7 A;  2AC1 A;  3P6B A;  3VBS C;  4XFA A;  2EXH A;  1CGP A;  1VBC 1;  3GDB A;  2IXC A;  4L9B A;  5C9A C;  2OPW A;  1J59 A;  1CWP A;  4Y33 A;  3NKT A;  1IPK A;  3EBR A;  2W47 A;  1Q8V A;  1C8M 3;  4NIA A;  1VIW B;  3SH5 A;  4DS0 A;  5FRA A;  2UWA A;  4QXB A;  1GU3 A;  1VB2 A;  2FCV A;  4UW5 A;  3RNS A;  3WF0 A;  4Q2F A;  4Q1R A;  1S0I A;  2RVA A;  2X5I B;  4R9D A;  1UXX X;  2R07 3;  4ITC A;  3QOP A;  4FPK A;  3WG3 A;  4IEY A;  2WJS A;  3HD8 B;  2R0F A;  3C7F A;  2D40 A;  3WQB A;  4FBF A;  1HJF A;  4L8Q A;  1LRH A;  1LTE A;  3I3M A;  3OUJ A;  1OC1 A;  4AVV A;  1PGW 1;  4CP0 A;  5GLT A;  4FFI A;  4LIT A;  2Z69 A;  2DVG A;  3A0K A;  4DEQ A;  3O1S A;  2ADD A;  4I09 A;  3B00 A;  2ARA A;  2VNG A;  2XL9 A;  3U78 A;  1LEN A;  5IHR A;  2VPV A;  1VBD 2;  2GP3 A;  3M70 A;  5FBJ A;  1YIP A;  5GLV A;  2H0B A;  1JYX A;  4NWV A;  3ZFG C;  3WDT A;  2RM2 1;  1FV2 A;  4RGA A;  3LWC A;  5DAV A;  3SCH A;  3U14 A;  3T4H B;  2QNK A;  1W6N B;  1C5I A;  2ARX A;  1IHM A;  1O5U A;  3JCI A;  4Q4Y 2;  3ZFF B;  3AP9 A;  1VJ2 A;  4YGD A;  5IVV A;  4YW4 A;  4ZS2 A;  5L36 A;  2G4I A;  2W87 A;  2FBE A;  2DTW A;  1RHI 2; 
#chains in the Genus database with same CATH homology
 5IFP A;  1UX7 A;  3WSO A;  4DUV A;  4OUE A;  2BZD A;  4OMC A;  4A3Z A;  3I3E A;  1US3 A;  3VD5 A;  2WAA A;  2VZV A;  3WNL A;  1US2 A;  2QQN A;  2VMF A;  2R7E B;  3NJX A;  1UMH A;  2WQ8 A;  2W3J A;  3GXU A;  3A21 A;  4LKS A;  3ABZ A;  4ZZ5 A;  3JXS A;  4QDS A;  1UMI A;  2ZXQ A;  3J7H A;  3LPG A;  1JZ5 A;  3ACG A;  3SKJ E;  1WKY A;  3GM8 A;  3III A;  5CZK A;  3AC0 A;  5JXI A;  1JYW A;  2X05 A;  2CDO A;  3E1F 1;  2E33 A;  3I2K A;  4P08 A;  1K42 A;  3P1I A;  5I0D A;  5CYY A;  3EYP A;  1GNY A;  4JKM A;  2EIE A;  1CZS A;  2Y64 A;  5JXH A;  1GOH A;  3I3D A;  4MO3 M;  2Y8K A;  3VD9 A;  4YPJ A;  2VMC A;  3VDA A;  3HNB M;  4P5Y A;  4BK5 A;  4AAX A;  1UY2 A;  3DYM A;  1H6X A;  3K4Z A;  3I2I A;  5B4N A;  4KI5 M;  1XNA A;  2J22 A;  4TXW A;  2VME A;  1JZ4 A;  2WZE A;  3CQO A;  3T2O A;  2LS6 A;  2XHN A;  2WAO A;  2KD7 A;  2X10 A;  3IB3 A;  3BGA A;  4OYU A;  1NUK A;  4CUC A;  1O8P A;  2W95 A;  2YB7 A;  3MBW A;  1H6Y A;  4E8D A;  1GOF A;  1CIY A;  1XC6 A;  3I2J A;  3C7H A;  1XPW A;  2WO3 A;  3T09 A;  5FUI A;  1O59 A;  2DCK A;  3BN6 A;  1OD3 A;  2QQO A;  2ORX A;  2JKX A;  4XUR A;  1UXZ A;  3A7Q A;  1D7P M;  2J1R A;  1GUI A;  2L9L A;  2ZEW A;  4ZZ8 A;  2VQT A;  3UET A;  5G05 L;  4QDR A;  3HJR A;  4Z2A A;  5JXJ A;  3VDB A;  2W94 A;  1O8S A;  4LPL A;  1SDD B;  4JKK A;  2VR4 A;  1RYY A;  1UYX A;  4P00 B;  2QQJ A;  1JZ7 A;  2C9K A;  3K46 A;  4W4Z A;  2HYX A;  2VZR A;  2QQL A;  3UNP A;  5EJZ B;  4XUP A;  2BER A;  2QQM A;  1NX9 A;  2Y6G A;  2YG0 A;  2VZU A;  3OGV A;  4LQR A;  2XON A;  1UWW A;  1T2X A;  2YFZ A;  1KGY A;  4HG6 B;  5IFT A;  2VCB A;  3WF2 A;  3LEG A;  3FL7 A;  4UI9 L;  1GMM A;  1SG3 A;  2VZQ A;  3NRU A;  2YC2 A;  2RV9 A;  4XUQ A;  3U37 A;  3WNK A;  2VC9 A;  4QDQ A;  2WUH A;  3THD A;  4ZXE A;  3C8X A;  4L0P A;  3I97 A;  3T2Q A;  1JYV A;  2Z4F A;  1LNS A;  1JZ3 A;  3T0A A;  4QPW A;  1GOG A;  3DEC A;  4D8M A;  3LQC A;  5JXG A;  2JDA A;  1PMH X;  2VM9 A;  4QX0 A;  5EJ1 B;  2VZ1 A;  4M4R A;  4TTG A;  5LA1 A;  3T0B A;  4QB6 A;  5JUV A;  2W9X A;  2Y6K A;  2LW8 A;  3EB7 A;  3WNP A;  2CDP A;  2DCJ A;  3WNN A;  3ECQ A;  2W1Q A;  1F4H A;  2VTF A;  1R64 A;  2J7M A;  2E32 A;  4QX3 A;  1JI6 A;  4BXS V;  1JYN A;  1WCQ A;  4JKL A;  3PUH A;  3MO4 A;  2HLE A;  4CU8 A;  1P8J A;  5B4X A;  2ORZ A;  4A42 A;  1OH4 A;  4QB1 A;  3SEE A;  3LEI A;  4KWU A;  4PQQ A;  2Y6H A;  3LEK A;  4OMD A;  1K12 A;  3VDC A;  4XUN A;  2VCC A;  4DXR A;  3NNG A;  3GGL A;  4E8C A;  4DXT A;  3I2F A;  3MV1 1;  3LE0 A;  2B4K A;  2VZT A;  5DPN A;  1UY0 A;  2BGO A;  4QB2 A;  4QX2 A;  3WEZ A;  2C26 A;  3NJV A;  5LA2 A;  1NKG A;  3C7G A;  5IYY A;  2VO5 A;  4MGS A;  3CIH A;  4AG4 A;  2VZO A;  4P02 B;  1W9S A;  1K3I A;  3CDZ B;  2VQU A;  1OF4 A;  2EIC A;  2VZ3 A;  2VZS A;  4W8J A;  3OB8 A;  4DEV A;  1YQ2 A;  3VD3 A;  3I3B A;  1UY1 A;  2V4V A;  2W1W A;  3MUY 1;  1EUT A;  2J1V A;  1UYY A;  4MGQ A;  3CZJ A;  5LCW L;  1UZ0 A;  1UY4 A;  4CUB A;  3VD4 A;  3OBA A;  3A22 A;  4JHZ A;  2J1U A;  1UYZ A;  3NQH A;  3F2Z A;  2VCA A;  4JX0 A;  2W46 A;  4CU9 A;  4ZY9 A;  3C7O A;  4ET7 A;  3ACH A;  2BBA A;  4D0Q A;  1SHW B;  3MV0 1;  3K4A A;  2W92 A;  2E26 A;  1BHG A;  3W5N A;  4QX1 A;  2X09 A;  4GWI A;  2WN3 A;  3CMG A;  1JHJ A;  2WDB A;  1PMJ X;  5JMO A;  3SEP A;  3WF1 A;  4DXS A;  2ZEZ A;  3ZM8 A;  1CZV A;  1DYO A;  2W5F A;  4A6O A;  3OEA A;  2RJ2 A;  2ZEX A;  3ETP A;  4KMQ A;  3C7E A;  2ID4 A;  1KEX A;  2B9V A;  2J1E A;  1TG7 A;  3OG2 A;  2XQX A;  1JZ8 A;  4PT6 A;  3CKH A;  4FI9 A;  2YC4 A;  3D3A A;  2WYS A;  5C70 A;  3UES A;  1PX3 A;  1IQD C;  2XOM A;  3K75 B;  3K4D A;  2J1A A;  4PF1 A;  3FN9 A;  1NAE A;  2VMD A;  2VZP A;  2YFU A;  3DYP A;  2WO1 A;  4BJ0 A;  4LHS A;  1W9T A;  4CVU A;  3HN3 A;  1OT5 A;  4DUW A;  1DLC A;  2VL4 A;  2JD9 A;  2JE8 A;  4M4P A;  4BK4 A;  2WBK A;  1OF3 A;  4A4A A;  4A41 A;  5C7G A;  1W8N A;  4UAP A;  4MAD A;  4OZO A;  2VOT A;  3T08 A;  3ACF A;  3OGR A;  2J1T A;  1J83 A;  2WAB A;  1W0N A;  4MOA A;  3HNM A;  2PQS A;  3A23 A;  4DUX A;  2WO2 A;  2VJX A;  1JZ6 A;  1W8O A;  3HPN A;  2WZ8 A;  2OKX A;  2EIB A;  2QQI A;  1CZT A;  4GWJ A;  5EIY B;  5HPO A;  1PX4 A;  1DP0 A;  2E31 A;  3IAQ A;  3WNO A;  4GZ9 A;  3HNY M;  5A1A A;  2WN2 A;  2Y6L A;  3WF3 A;  5G04 L;  3WNM A;  1GQP A;  1HN1 A;  4CUA A;  5C71 A;  4A44 A;  5F7U A;  4XUO A;  3CZU A;  3THC A;  4W50 A;  5DMY A;  5IJR A;  3LPF A;  3VD7 A;  2J1S A;  4BDV B;  1L7Q A;  4IUG A;  3W5M A;  5DN2 A;  3ACI A;  3I2H A;  5JR2 A;  4CU6 A;  2W91 A;  1K45 A;  1XNT A;  2V72 A;  1JU3 A;  4RN5 A;  4XVH A;  1ULO A;  1L7R A;  2BGP A;  2C4X A;  3P6B A;  2W1U A;  2EID A;  3I2G A;  3PUI A;  1MPX A;  3GDB A;  3FHQ A;  1I5P A;  3OEB A;  1EUU A;  1CX1 A;  2Y6J A;  2W47 A;  5LA0 A;  5J1X A;  3K77 A;  3WF4 A;  3SKV A;  1GU3 A;  3MUZ 1;  4UOJ A;  4RYD A;  3FHA A;  1TVG A;  4ARX A;  1W9W A;  3WF0 A;  3IDA A;  3T0D A;  2RVA A;  4QAW A;  1UXX X;  4ARY A;  3IAP A;  1JU4 A;  1UY3 A;  3C7F A;  3WQB A;  2QQK A;  1F4A A;  4XZU G;  4XUT A;  2ZEY A;  3OGS A;  2DDU A;  4DEQ A;  1ULP A;  3HEI A;  5DQ0 A;  5IHR A;  2W1S A;  3DYO A;  1JYX A;  4A45 A;  4CU7 A;  1JZ2 A;  1J84 A;  2QBX A;  1W99 A;  3HOB A;  2V5D A;  5HXM A;  2W87 A;  3T2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...