4GAZA

Crystal structure of a jumonji domain-containing protein jmjd5
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
235
Chain Sequence
PDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 8
publication title Crystal Structure of a Jumonji Domain-containing Protein JMJD5
rcsb
source organism Homo sapiens
total genus 51
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4gazA00
3OPTA 4Y3OA 5A7NA 5FZ8A 2W2IA 5FZAA 4GD4A 5IVEA 5CEHA 5FZFA 3PUSA 4DO0A 5FJKA 5F2SA 3KV4A 5FYVA 4LITA 4CCMA 5IVJA 4EZHA 4QXHA 4CCKA 4IGPA 3KV9A 4V2VA 4QX8A 5FY9A 5FZ0A 5A3PA 2GP5A 5FJHA 4LIVA 5FXXA 5A7PA 3PU3A 3ZLIA 4E4HA 5F39A 5FZ9A 2Q8EA 5FZHA 3KV6A 5FWJA 4QXCA 5FP4A 4LXLA 5A3NA 2OS2A 4AAPA 5FP3A 4BXFA 3N9PA 2OQ7A 3RVHA 5F37A 3ZPOA 2OT7A 2XXZA 4D6RA 5FY7A 5LWBA 3KVBA 5A7OA 4CCJA 5FY0A 5F3GA 3KVAA 3AVSA 5FV3A 5A1FA 3AL6A 5KR7A 5A3WA 4HOOA 5FYTA 3PTRB 2YU2A 4IGOA 5FZ4A 3N9MA 3LDBA 2XMLA 5FPLA 4QU1A 5E6HA 5F3CA 3N9OA 4XDOA 3AL5A 5F2WA 5F5IA 5LY1A 4CSWA 2OX0A 5FYIA 5A7QA 3OPWA 4CCLA 5FZIA 3PU8A 4GJZA 5FP8A 4XDPA 5ANQA 5FY5A 2YBSA 4D6QA 4Y4RA 5FY4A 5FPUA 2PXJA 4HONA 5F3EA 5FXVA 1VRBA 2XUEA 2WWUA 4Y33A 4UF0B 5IVCA 3KV5A 5FZ3A 5A7SA 2VD7A 4UF0A 4QWNA 5FZEA 5IVFA 4CCOA 3K3OA 3U4SA 3PDQA 4AI9A 3NJYA 4V2WA 4NUBA 5FZOB 5FYMA 5FY1A 2YBPA 5FXWA 3DXUA 2OQ6A 2YPDA 4GAZA 5F3IA 5FZOA 2GP3A 3DXTA 5K4LA 5FZ7A 4ASKA 4CUGA 3K2OA 5F5CA 3LD8A 5FP7A 5FUPA 5FYZA 3PUAA 5FPVA 2Q8DA 5IVVA 4IGQA 5A7WB 2WWJA 4EYUA 5FWEA 5IW0A 4LIUA 2YBKA 3PUQA 4BISA 5FUNA 4URAA 5FZDA 5A1LA 4QXBA 5FYHA 2Q8CA 5FXZA 3N9QA 5F5AA 4CCNA 4DIQA 3N9NA 5FPBA 5FZ1A 5FYUA 3UYJA 5FZBA 5A80A 5F32A 3AVRA 2P5BA 5FZMA 5IWFA 5LW9A 5FP9A 5FPAA 5FZGA 3N9LA 3U78A 4C8DA 3PURA 5IVBA 5FYBA 5FZCA 4QX7A 5FZKA 3K3NA 4EZ4A 5ISLA 5FBJA 5FYYA 4BU2A 4D6SA 5FYCA 5FYSA 5A3TA 5FZLA 2XDVA 4TN7A 4GJYA 5IVYA 5LY2A 5FY8A 2YU1A 5A7WA 5FZ6A
chains in the Genus database with same CATH superfamily
1TG7A 1VBC2 1ZBA1 3J7MA 2WNVC 2ZMLA 1X36A 1W6NA 3KS7A 5IVEA 5JZGB 4KNCA 5BNNA 3RZHA 5GLUA 4P9GA 5JOXA 1NG0A 3AB0A 2WO7A 1VBD2 3P3PA 4LITA 4TXWA 4CXWA 3IZOA 3SMHA 4ES8A 2IXKA 3J26N 2WZ8A 3VBRC 1FPN1 4XFFA 1HB4A 4ISRA 1RUJ3 2D43A 1UYZA 4LBJA 3ATGA 5A3LA 3IIAA 5C3PA 1OVPA 3N3HA 4YSFA 1NA1B 1QF3A 3WX5A 3OEBA 4XQWA 2WNOA 2YROA 3MW2A 3POYA 2ZXQA 3ZPOA 1J58A 1RIRA 3O12A 5IAVA 3K48A 1GICA 4FTEA 1STMA 4HPKB 3AKQA 4Y4YA 5DN2A 3V56A 5BNOA 1HB3A 4QU2A 2BGCA 3RSJA 4KG8A 5J48A 1FYUA 2WR9A 2Y33A 3B69A 4QPGC 2JWPA 1G6NA 1CZTA 3WF2A 3OY8B 4JGYC 5IFPA 4XABA 1VBC3 4XFIA 4LBKA 1SBDA 1OF4A 4QPIC 5DMYA 3KHCA 4YARA 3M3IA 4YVSC 3U11A 3AYCA 4OHVA 3VD7A 1ULDA 2PXJA 2HWB1 4UW3A 3WG1A 1SLBA 3AJYA 3M3EA 1I5PA 1VBD3 3EHKA 5JDBA 1G8WA 3POJA 5C6CA 1D4M1 3IDAA 1BK0A 2FQPA 1NY71 4WM8A 1DQ1A 4YRDA 4LOTA 1UPSA 2C5DA 3FX3A 4AI9A 3MF9A 4CCEA 4MG2A 2VZTA 2WSVA 1X7NA 4ZY9A 1ZBA3 3C3VA 3I54A 2MPFA 3MIEA 4EWAA 4DMIA 5J7MA 1VB2A 4H7LA 3LIHA 3DXUA 2R072 2HWB2 2VECA 4FAHA 1ND3B 2Q1ZB 1OLQA 5K8SA 1XE0A 1YNAA 4XIOA 5A7WB 1D4M2 5FLHA 1FPN3 2XR4A 3RJRA 4XUOA 3MGUA 3ILRA 4BH9A 1NY72 4Q4Y1 1GFF2 4QX3A 1UOGA 4DY5A 1KQRA 3JD72 1V6LA 4HG6B 1J3QA 4ZZ5A 4NHXA 2A5ZA 2VQUA 4HVOA 2AZ5A 4MGTA 1IOAA 3AKPA 4IV3C 4LQRA 2YYOA 2BGOA 4AQ6A 3TNPB 2UY8A 1Y4WA 4F83A 4A7YA 2WZEA 1MQTC 4QB6A 3S7EA 3ILNA 2Q0AA 4IEVA 2QTWB 5K9YA 3V0AB 4Q0PA 3NV2A 1W39A 1W9YA 5FP9A 1CGPA 2PHDA 5A6YA 4Q4Y2 2GSYA 2JDAA 2YGMA 3BN6A 3ZDSA 3HD8B 4EN0A 3KSCA 2VVDA 3WV6A 1VB4A 4R4ZA 5EHDA 5FYCA 2WQZC 1JZ4A 4KWKA 5IVYA 5D8AB 3O0XA 5A3TA 5BNNC 5A7WA 3I2JA 1KFUL 1YQCA 4YG3A 1ASJ2 4NIIA 4IV1B 5FZ8A 3MV11 1W2AX 3O1PA 4AL9A 1QWRA 3VKOA 4YFWA 3CHXA 1PO11 3PUSA 4CUCA 4XCBA 2HWB3 5HV0A 2EF6A 4TYSA 1AVBA 2J1UA 4QXKA 5C9AA 1UX7A 4QXHA 4YZ2A 1D4M3 5C5TA 1HDKA 2JDKA 2PTMA 4BQ2A 3FJSA 5L7OC 2GP5A 1H2MA 3MLKA 3VHOA 1Y9MA 3WDWA 3KB5A 4BQWA 4QPWA 5FKCA 1AYN1 2OS2A 3D0SA 3IPVB 4O7XA 4AAPA 1JZ3A 1PO12 2JDYA 2W0XA 3NAPC 4LNVA 4CEWB 1CQ9A 4SBVA 1LGNA 3NQHA 4PF5A 1G9FA 5LZ6A 2ADDA 4QM8A 4LHNA 3RQ0A 1JOBA 1QU0A 3OSDA 4Y22A 4COWA 5M0TA 2A7AA 4XBLA 5T5PA 4L97A 4XAEA 3HN3A 1CAVB 4CP2A 5CADA 4IUGA 5FO7B 1WLWA 2ZX4A 1CZSA 1YFYA 1VALA 2BGPA 3E6DA 4ISQA 4ZZ8A 2DWRA 3FZ3A 2E63A 1K5MB 2IC1A 1ONAA 1SFNA 2AYHA 1ZZBA 2K9ZA 2VNOA 1GU3A 4I0BA 4P5HA 3RYRA 4FPKA 2EAAA 4DY3A 4CDQB 3ZSJA 5FP8A 3KCYA 3ZYIB 3MEPA 5JSRA 1UYXA 5LBEA 4H3WA 1RUH1 5FY4A 1W28A 2OUHA 4UW5A 4XBQA 1BKZA 1QEXA 3HNBM 3M7AA 3OBRA 3SH3A 4AR2A 4DFSA 1MS1A 2HBTA 4B4QA 4CP1A 1GOGA 2W68A 4N90A 3PL0A 3SKJE 5JSPA 3U4SA 3POSA 5JI7A 4MSVA 4LPLA 3D0JA 4XW3A 2BFUL 1UY4A 2XJUA 3VHPA 2J1EA 4NUBA 3M3QA 1JOPA 1HRV1 3GZAA 4IL7A 4O9GA 3VBUA 3AKTA 1RUH2 4WZFA 1V9U1 1XOYA 5CG8A 1CR7A 1AJOA 2GH8A 3FBMA 5CAZA 1O3SA 1GQGA 1K5MA 1ST8A 1Q8OA 1QJFA 1J3RA 1RJ7A 4FPJA 4K8FA 1HJGA 1KS4A 2WNUB 2VOVA 2ZCWA 4LO8A 4COUA 1M06G 2UU8A 1X9PA 2W94A 5BY5A 2DU0A 5LRRA 3MUY1 5DUVA 1RYYA 5A1LA 1SDWA 1S0CA 2AR6A 1B35B 2W1QA 1W06A 2IVIB 2W46A 1AYN3 1V6IA 4G4FA 2Y38A 4P9JA 2Y8KA 4QDQA 3Q8CA 4QXBA 4PDWA 3ZPYA 5EYXA 1HRV2 3GNEA 5DAVA 3ZXLA 2CL2A 1V9U2 1ULFA 4LBQB 4N53A 2P3YA 3MBWA 3LB9A 4PHZA 4JRAA 3MO4A 5FZ1A 5IATA 2BOIA 2P5BA 2XL7A 3IWZA 1K3IA 2R0FA 3QD6A 4HKLA 3USSA 1BVVA 4XJAA 1W6QA 4EN6B 1O6UA 1XPWA 1XSQA 3AYDA 1FAYA 1UF2C 3AC0A 1FT9A 2SBAA 5FQ0B 2H6BA 1D2SA 5HCHA 3K3NA 2BNNA 5LK7B 5FBJA 5E8AA 3AZWA 3HQXA 4Y20B 3TWIA 4GJYA 5LY2A 2XQXA 1IZ3A 1UMHA 3AXEA 5C9AC 1GP4A 3BU0A 3PMEA 3NVCA 2GN7A 5AFBA 2VO5A 2GNTA 1GQPA 3H9AA 1H8VA 1RUH3 4KI5M 3DPRA 3M1HA 3ZXKA 4XJWA 1A6CA 1LOBA 2V4AA 1QJU3 4RQPB 5FYVA 3EYPA 4H2AA 3H3LA 3R4DB 3C8XA 4CCKA 4AHWA 1UOFA 5EPAA 3INAA 4IEQA 1H4GA 2FCTA 1Q8VA 2IXJA 3FUOA 4LIVA 4FOWA 4KMQA 3R4UA 5HCFA 1S2EA 5A7PA 3WD5A 4E2GA 1NCRA 3ZVXA 4F8AA 3GCWA 4A44A 3ON7A 1HJFA 1EV11 1OQ1A 2R6QA 1HRV3 5FP3A 2BUKA 4QDSA 4BXFA 1GSLA 5C4WA 4RS5C 2OQ7A 4RGKA 4NIHA 1VBE1 2ENRA 2RDNA 1COV1 5A7OA 1CVNA 5FY0A 3KVAA 1OPOA 3WLUA 1IKPA 1QMJA 3AL6A 4JCKA 3B9CA 3ZM8A 2B9VA 2D3RA 1OXCA 3POWA 4CEYC 5C3OA 5CFDA 3GBFA 3LDBA 4Y26A 5E6HA 1V6JA 3VBSB 1O4TA 4BMBA 1EV12 1LOAA 3DEMA 4M3CE 4XURA 4S2GA 1LHUA 3U75A 2OX0A 1YHFA 3ZFEB 1RB8G 1GWLA 5SV5A 3T3YA 3BKZA 2VZRA 5FZIA 2Z79A 2WZR2 2XJTA 1COV2 2DVFA 3GZUC 1C57A 3UGGA 1UO9A 4DQAA 4CTEA 4YW4A 3OBTA 3THDA 2D6NA 5E1RA 2X09A 2WL1A 3WP6A 2ZMNA 2QJVA 3RWNA 4Y33A 2VAUA 4IERA 4AE2A 4LBMA 4B1MA 5CFCC 1IQAA 1GQHA 1KFXL 1PGW1 2VD7A 2GU9A 3V0BA 1NE6A 1AUYA 1AXKA 4S2DA 4CCOA 4HSJA 1O59A 1BZWA 1R64A 1US2A 2DVAA 4M3CA 4XC9A 1AL0G 4GH4A 3SEEA 4XDQA 4DXTA 4CDXA 4WVWA 3VBSA 1K45A 5F3IA 4RGAA 5FZOA 4AEKA 2XG3A 3WSOA 2GP3A 2JKBA 2QZ3A 2HEVF 3LEIA 2FDIA 2BQPA 5FP7A 4ASLA 4YLZA 1ND2C 1F4HA 3T4VA 3RZGA 5F8PA 1N1SA 3POBA 4PDWC 5IVVA 2HWF1 4JDNA 1PGW2 2QQVA 3RI8A 3LA3A 3OGGA 1DQ4A 4A4AA 5IW0A 4E4SA 4XOGA 1U12A 5FREA 2BV4A 1R091 1JODA 2Q1FA 3AK0A 4FPEA 4COZA 1LENA 1JHNA 4V1PA 1EV13 4C90A 2ZACA 1OA3A 3NO8A 2RDRA 1UQXA 2WINB 1U0AA 3CJIA 1RHI1 4D3WA 4LA3A 2W08A 3GM8A 1VBE3 3MLLA 4LULA 4NHMA 1COV3 2HWF2 3JZVA 4GMP1 4N9HA 4TLGA 1Q56A 2GMEA 3THCA 3HBKA 3O14A 5IVBA 1R092 1MS4A 1IGOA 4GWJA 2BYVE 2EXHA 2P37A 3C7OA 2N7GA 4BU2A 1W9WA 2F4PA 3HBZA 3WW4A 2QUOA 4HKOA 4META 4EE2A 5FRAA 4M0HA 2XVLA 4JTNA 1RHI2 1OA2A 5B2GB 1QXPA 4CDUB 1WLTA 1FI2A 1YIPA 2Y6FA 2ZEXA 3LPFA 4PF1A 4I02A 3ZFGB 2XGXA 3CJXA 1NCRC 4TZDA 3TAYA 3RS6A 4MHRA 1NXD1 4BPZA 2Y0OA 3T1LA 5FZ0A 2ZGOA 2JDHA 1F5FA 3ZLIA 2IFWA 4E4HA 4LUMA 3UL2A 3ZYRA 1RUF1 4PI2A 2W91A 1VLNA 3HEIA 3NJXA 1QH6A 3KV6A 1Q3EA 3NV4A 4LXLA 4XTMA 5HV4A 4CRQA 2I45A 2JKXA 3AKRA 3ZYFA 1BMV1 2FBEA 2ZAHA 3SH4A 4YM2A 2CGPA 1CESA 2RHPA 4IE4A 3S57A 2HWF3 4D6RA 4PLNA 4RFRB 2YG0A 1DBNA 3NKGA 1SEFA 4AFDA 2JE7A 4LK7A 3MICA 4YYOA 3I7DA 4IEYA 1R093 5FZ4A 1RUF2 4E9KA 5DUXA 2QFEA 1W8NA 3ELNA 3LKJA 2GAUA 4YZ4A 5F5IA 3SISA 2XPJA 1BMV2 4EWDA 4P9IA 3VBOA 2WRAA 1VBB1 4EN8B 1H9PA 2PQSA 3IMMA 1JZ6A 5FLJA 4UWDA 2PAEA 3PU8A 4FXGB 1ZZ8A 3I97A 3ZKYA 3H3ZA 4GMP3 2W95A 1U5IA 3UKNA 1FNZA 3AZXA 2C9AA 2JDUA 3SCGA 4A41A 1VRBA 2XUEA 3CO2A 1JHJA 1OC1A 3QH7A 5KHHA 4CA9A 3WCRA 3KV5A 4XUPA 3KT4A 4UF0A 4ONUA 1LULA 3BODA 3TBDA 2C1FA 1HX6A 2NLRA 2YFZA 2WS91 4Q26A 5T5JA 5BNPB 1F35A 2ZGSA 3E5QA 2VVFA 5K4LA 1XE8A 1QJEA 4PCRA 4AEJA 1FV2A 4RR3A 2FCVA 5JOYA 3O1TA 3D6EA 4HN1A 3AMHA 3A0KA 4EYUA 1SDDB 1GZWA 3OG2A 1RUOA 3LEGA 3SCFA 1VRH1 5H9QA 1OSGA 1RUF3 4HETA 2ERFA 2FDGA 2ZX3A 2WQ8A 3LA7A 2WS92 2VGDA 4FP2A 4QX1A 3CIHA 5CKQA 2LALA 3WQBA 4DIQA 1LR5A 1PX3A 2ZEYA 2BTVC 3W59A 5LK5A 4MXWB 3B7MA 4UFIA 5F7UA 1QXRA 3MFAA 5FZMA 1BQPA 5I0RA 1PGL1 3S5QA 2DTWA 1VRH2 5BNPA 5FZCA 1MVEA 3VB9A 4FOVA 4OUMA 5C3RA 2VOXA 4K6BA 4TN7A 3S0MA 1VBB3 2QDRA 4QX2A 3R0RA 3WOGA 4P9YA 4AWDA 2Y0IA 3VZKA 1UD1A 1W8WA 2JECA 5A7NA 4GWMA 3AP6A 4QGLA 3RWKX 1TZOA 3KHBA 1MS8A 1PGL2 5DAXA 3Q8EA 2O14A 4JGZC 1H2LA 1W9FA 3T09A 5CU1A 2GH2A 4QQHA 2MHFA 2WNVB 1N1YA 4RYDA 2YXSA 2YUEA 2Y6HA 4QX8A 5FMCA 1VP6A 5A6QA 3PU3A 1LGBA 4Z07A 5LEJA 1PM4A 5A70A 1JW6A 5C71A 2BPA2 2NYYA 3BPSA 2VUJA 4G3YC 2ZBJA 2P6HA 1W9SA 4Q8LA 3VBRB 2AUYA 4A6SA 5LA9A 3PMSA 4RHV3 2XLFA 2A6VA 3HT1A 3AYAA 4UXAA 1QY4A 3VZNA 5KC6A 4UBGA 1VR3A 2BVVA 2DF7A 1BEV1 3ZYJB 3RYPA 5JPMB 1MVQA 5LA1A 1MS9A 5A33B 2IXIA 4ZXEA 1RXFA 5FO8B 4DUVA 3VBOC 1POV0 3OOXA 2ZPXA 5FV3A 4OQ9A 1VRH3 1W9TA 1DGRN 4LK6A 3J7HA 2RJ2A 2IWGB 1VMHA 2XL9A 4XDOA 4M3CF 2PN5A 2JDMA 3WW3A 1RC6A 4Q4V1 3IIIA 3J8F3 3ORJA 3Q9OA 1NCQB 3L2HA 2F4LA 1XQNA 1GMMA 2A71A 3OPWA 1BEV2 4IEPA 5HCBA 4GJZA 3MUZ1 1OUSA 2XLGA 4EN9B 1RUG1 4Z82A 3GBWA 1MZEA 1EP0A 4Q0QA 5DZEA 5DPNA 2ZGRA 2RG4A 5HXMA 3PHMA 3IB3A 4KWJA 2LTNA 5C3SA 1HKDA 3KF5A 3NMBA 5LBCA 4QPIB 2DFCA 1N3QA 1X50A 3I4IA 4R9CA 2ZEZA 1YJLA 1PVC1 3I2FA 3TEXA 4K20A 1GWKA 3LPGA 1JBCA 5GLVA 2ZGQA 2UWBA 1WA4A 4RR3C 4LEJA 2DFBA 1QIQA 3VUOA 5K7PA 4YVWC 1AYM1 1ENXA 1RUG2 3ZSEA 4ZS2A 3E6BA 2AC1A 3ETQA 4YW5A 3P1IA 1X8MA 2TBVA 4XZPA 3WNLA 1R1A3 1XBFA 3ASIA 5J09A 4XFAA 2GC2A 4FSJA 3IMNA 4MLOA 2XVKA 3BIEA 1PVC2 2W1WA 5JAXA 1W8HA 3POIA 4YGCA 4GB31 4QPGA 4UFLA 1HRI2 3VDDC 4O65A 3OYWB 2ZGNA 1EPWA 1GWMA 4JGYA 1AR71 1H30A 5FXZA 1AYM2 1A8DA 5F6LB 3JU9A 2P34A 4DINB 4FOYA 4FFHA 1GR3A 4NN0A 4YVSA 4E27A 2VPVA 1OQDA 1BEV3 3DYMA 3B94A 1J1TA 5T50A 4XILA 5IWFA 4C1XA 1U5ZA 2V73A 1LU1A 4IV3B 4CP9B 1VIWB 3L2YA 3U78A 2IZWA 3JB4C 3K4AA 4GB32 3GALA 5KHJA 2Y6GA 3H8XA 1MQTB 3MW3A 1QNYA 2R043 3C2UA 4CDWA 4L8QA 2D44A 4PQ9A 1NQJA 4Q4V3 2JDPA 4Z92B 2OZ6A 5L73A 1WBFA 1K12A 4PIZA 1WCUA 5H9SA 2CU5A 4CCCA 2XH6A 1QDOA 1W6NB 2P3KA 1CJDA 1RMU1 2PQQA 2P4EA 3U37A 1LHVA 5BNNB 2FCUA 1L7QA 4S2FA 1RUG3 2QCSB 3NKTA 4GKYA 4XUNA 5D1IA 1CAXA 2PELA 3R6SA 3VDAA 5J1XA 1UWWA 1RUI1 5FJKA 4Y1YA 3RDIA 2X5IC 5FR3A 5IK8A 4P00B 2RV9A 2HKXA 4IEOA 5FY9A 3KF3A 3M8LA 5GZFA 1V00A 3ETPA 1BBT1 3CMGA 3ZSLA 2DVGA 2L9LA 1PO21 2O8QA 1UU6A 4MADA 4CE8A 2J1AA 1RMU2 2B45X 4MGYE 4NO4A 1AYM3 1TNFA 5JXIA 3AMMA 1REEA 1UXXX 4JHTA 5BYNA 1BXHA 1K42A 4KWLA 1RUI2 1OD3A 3IN9A 5A3OA 5F37A 2RMU1 4PIXA 1D2QA 5J98B 4FT8A 4YFZA 4XFGA 1Y9QA 4QKNA 4Y1UA 1GZ9A 4AI3A 3A23A 4L2NA 3IAQA 5BNOB 1BBT2 4GB33 1Z7S1 1UZVA 3LWCA 1PO22 1YXWA 3N9MA 3PVBB 1AR73 4D7SA 3AL5A 3J9SA 5I91A 3RZLA 4F3JA 1WMDA 4J1XA 4JDMA 3VLBB 3K4ZA 2QQUA 1LGCA 2PHUA 4HK8A 4HZFA 1Y3TA 2CAVA 2RMU2 1S0IA 2P3JA 1UMIA 3DCQA 3FBYA 1ENQA 4W8JA 2E26A 2JG8C 2PAKA 5L7OA 1DYPA 1IG3A 3J7NA 2IXLA 5I93A 1Z7S2 1GP6A 4HONA 3GDBA 1XU2A 2WWUA 1FNYA 2QQLA 1V6NA 1O5UA 4LO6B 4URTA 3MHZA 4WM8B 1DQ0A 1JS9A 4NRMA 3LDRA 1H9WA 3ZYHA 4QGNA 4IW3A 1DYOA 3NAPA 2FDFA 1XNCA 5HI0A 1RMU3 4ZXKA 5KHKA 2VBBA 2VZQA 1C5HA 2IXHA 4XPVA 4Y5Z0 4M0NA 2FZ1A 3I2GA 3K2OA 1ZX5A 2VBPA 3LD8A 1HXS1 3KQRA 5FYZA 5DZGA 3AX4A 4NOTA 3FHQA 3HN1A 4ORFA 1GNYA 1GNHA 4XMIA 1PZ8A 1BBT3 1OLME 4L11A 4Q4X2 1OFSA 1XNKA 4DS0A 2DDUA 2R071 3H7JA 2VNGA 1UKRA 4IQPA 1PO23 2DCKA 2RS31 3ZSMA 3I3EA 5JUVA 3D8CA 4JTOA 5FYHA 3LIGA 4QDRA 3ABZA 3RJ2X 5A32A 1ZNPA 4WM7A 2RMU3 3UYJA 4B29A 1HXS2 3WNMA 3JD71 3ITQA 5LA2A 4CDWC 3MF6A 1WMEA 5CZKA 2DUPA 1WD4A 1WCSA 3PURA 1Z7S3 1OOPC 2LRPA 2KR2A 2XJRA 2NPIA 2GNBA 2RS32 4COVA 5J96B 4FO9A 2OA2A 2B46X 2G9GA 2VMCA 1JTZX 1OLMA 3WUCA 5ANNA 4B7KA 1EUUA 4N9IA 4NIAA 5A6ZA 4Y1XA 1HV0A 1YRZA 1AHSA 1Z0HA 3EBRA 4XF1A 4ZHNA 3AMPA 2RR12 1ZBE1 3KCXA 3FN9A 1J84A 3MIGA 5FZAA 2ZGPA 3HIFA 4OI1A 4AFBA 5C9AB 4MGSA 1DLCA 2PHLA 4AI8A 4MZUA 1XYNA 4FAGA 5FMBA 1CAWA 4XBNA 1ASJ1 3I3QA 3KV9A 2FDHA 1WLCA 5FXXA 1CAUA 5FCCA 3WG4A 1VMJA 1W2UA 5KC5A 5FLIA 1YJKA 2ZEWA 1ZBE2 2WDBA 3QOPA 3CZJA 4QB1A 2XWBB 3WNNA 4BQ1A 1BLZA 1GOHA 1LOEA 2RS11 2VCAA 3JQWA 3OUIA 2X29A 3OBZA 4Y22B 1ZZ6A 1HXS3 5FK8A 4INDA 5IT6A 2VMFA 3PJYA 5DZFA 4ATEA 3T2PA 1XYOA 5F3GA 5KHGA 1DQ5A 4NVPA 2PHXA 5A3WA 1IS6A 1KGYA 2R073 3A0NA 2Q8OA 1F9KA 5FFOC 3WNPA 4EN7B 3BTZA 5FPLA 4JV4A 5F3CA 1ENSA 1W2OA 3MV01 5T55A 3ST7A 4CVUA 5FTTC 3I8TA 3HMYA 4N8MA 1QH7A 4LKSA 4OUEA 2E51A 1UY0A 2RS12 5GKAC 3UT0A 4CEYB 4CU7A 3RZMA 4NE9A 2ATFA 1LCLA 3JD73 3WDYA 1W90A 2W87A 2ZZQA 1FOD1 3FWEA 2YBSA 4XQDA 1ODNA 3T2TA 4QD2A 5GLTA 4OHZA 3ROUA 4Q2FA 3I2IA 4BQYA 1PK6A 4U36A 1RUE1 2VTFA 1UYPA 4QHOA 1JYNA 1C4RA 4QWNA 4XQ4A 2Z2SB 3THPA 3FHAA 4Q4Y3 1T6BX 2FHRA 2D6PA 4FP3A 4GKXA 4RD7A 4RS5A 4CUAA 1RUD1 5DAPA 1ZBE3 5GZDA 2BRTA 4FFGA 3VBUB 5JXGA 1RGSA 3ES4A 1FOD2 1EUTA 4GAZA 2YPDA 1AR61 2AEZA 1LESA 2CTVA 3H42B 1C8NA 1E5RA 2VULA 3B3QE 4A2UA 2D97A 2J22A 2IXCA 1ASJ3 4CEYA 4IGQA 1HQLA 1RUE2 5HXVA 4M4PA 2YV8A 3M3CA 3VKMA 4WM7C 3WNOA 4LHKA 2ZKNA 4PDWB 1JH5A 5E88A 4QMAA 1RUD2 1LECA 2VMHA 3J7LA 1OPMA 3B00A 2D7FA 4DRVA 3VBFA 5GZGA 4QKBA 2RS13 4N53B 1AR62 5LASA 2WAOA 1APNA 4XJ8A 1W6QB 1ULPA 1LEMA 2A6ZA 2VW2A 3N7MA 3A7QA 4X6QB 2QVSB 1LHNA 2D6KA 4AHZA 2F17A 5CFCA 2DV9A 1PO13 3GCXA 3E1F1 3TNQA 3UKTA 2VZ3A 5ISLA 2TNFA 4NWWA 5FYSA 4FPLA 4PJYA 5JVVA 3VN4A 3CEWA 1LKNA 4N7IA 3PIGA 4XEZA 3BB6A 3BVCA 2Z5WA 2Z69A 3OGJA 5A6XA 1I6XA 1ND2A 5JLVA 1QJY1 3DPRB 5HCAA 1PIV1 1H1IA 4QQPA 1W0PA 2YGLA 1LOFA 3BYWA 4UBHA 3GYDA 5IFTA 3I3BA 4MX3A 4UW4A 2RJLA 3AYEA 4FXKB 4MXVA 3CZUA 4FBFA 5IAXA 4V2VA 1RUE3 2G9ZA 1UIKA 3DGTA 2DBNA 1NCRB 4QQ2A 4ZS3A 1NUKA 1RUD3 4NPRA 4FI9A 1H1MA 5C4WB 1W2TA 2RJKA 1QJY2 3ZXDA 5DAQA 1PIV2 5F1RA 1AR63 1MZ6A 2UURA 1GV9A 1L7RA 1AJKA 1LU2A 2DU1A 2O0OA 2WLQA 4MV2A 4W6WA 4ZONA 2W92A 1GZTA 3AKSA 1UZ0A 3T08A 2WA3A 2EXIA 1S4CA 1GOFA 1WUVA 5CNAA 2VY0A 4I09A 5EJ1B 5CFDB 3SQOA 1F31A 3HVDA 2VCBA 1UZWA 5CBLA 2XLAA 1MEC2 1QNWA 2Q4SA 2OPKA 2XMLA 1C3HA 3H3UA 1KD7A 4J25A 4QU1A 1NOVA 2QQOA 4PBOA 4HK9A 1XB9A 2A1XA 2R30A 2XVGA 3NV3A 4P5YA 1SCRA 1NT0A 3RMXA 5FYIA 4UFJA 4U2AA 3H50A 2BOJA 4DNYA 2J1TA 4OCTA 1PK6C 2IFRA 4N7UA 4UFMA 4AVTA 1QJX1 2PHRA 3BTAA 4KGQA 1IS4A 1A78A 1W0OA 4RA0A 1V9U3 1P8JA 3V0BB 2WZR1 5JMCA 5E16A 1URXA 2ZX0A 3FLRA 3HOBA 3MI8A 1WZXA 2MEV1 4M3CB 4GH4B 3B01A 4JHZA 4CDXB 5JIAA 4XXAA 4V2WA 5FZOB 4RN5A 4Q1RA 1XNTA 3NNMA 1QJY3 1IS5A 1QJX2 1PIV3 1U5YA 1W8ZA 4XAAA 5FYMA 1SLAA 2JXAA 4Z2WA 2EAKA 1YO8A 2BEOA 5KHIA 4HVRA 3WR0A 1YCIA 4XHBA 5ABJA 3OPZA 3WZ1A 2NMNA 3UK9A 3VBFC 1WCDJ 3ECQA 1OUXA 2MEV2 4TSVA 4OI0A 2G19A 5GALA 4GA9A 2QDNA 4BISA 2W1SA 3ACIA 4SLIA 3ZYPA 4JVAA 1W04A 5EXOA 1FV3A 1O4YA 1S0FA 2JICA 3NWKA 2Q8CA 2X8KA 1DDLA 3CJIB 2VG9A 2YFUA 3OGRA 3ZYBA 2WO3A 4MGZE 2VVEA 2DYCA 2I07B 5C3QA 2BW8A 3JBG1 2JIJA 4QX5A 3CNAA 3H7YA 4QX0A 3VV1A 4OQ8A 3I3MA 4I3PA 1DGWX 1SACA 1LODA 2Q30A 1S0DA 5EIYB 4BB3A 4CPBA 2PLV1 3W21A 2VJXA 3WY6A 4A45A 4KG0A 2WJSA 2WLPA 2LW8A 2XDVA 5T54A 1LOFC 3PVEA 3N36A 4OVEA 3JBG2 4XHXA 2QQNA 3BOWA 2NQYA 3OPTA 1VBA1 2E9QA 2CHHA 3Q8FA 4IEZA 2ZHLA 4DB5A 5FO9B 4EWEA 1QJX3 5CEHA 3PTYA 2BERA 4MGQA 2ID4A 2HBUA 2PYTA 4PQQA 2PLV2 2DURA 4GZ9A 3P6BA 3NNLA 2WZR3 2GMPA 3POFA 2XB6C 4KWUA 5CVRA 3E97A 4JGZB 1XSRA 3BTXA 3QCWA 2MEV3 2ZGLA 2E33A 2FD8A 1KRIA 1VBA2 5FP4A 5K0UA 2ETEA 1W8UA 2A70A 2ES3A 4LA2A 3ZOIA 2W5FA 4NHYA 3BTYA 1BK1A 3N9PA 3C7EA 4JQRA 1O8PA 2VH9A 4UFHA 5F6KA 3H8RA 1MZFA 2OT7A 2Y6LA 4K40A 3POEA 1RINA 3KVBA 5G04L 4Z8BA 1AR81 3BPZA 5DUUA 1ACCA 4HFSA 3PTRB 4K21A 2ET1A 1ALYA 2Q1MA 1OQEA 1SQ4A 4MGIE 3T0BA 3VBOB 1LTEA 1W03A 4BDVB 3B9IA 3CLPA 1J3PA 2VBDA 3DN7A 3J4UH 4LHLA 3JBG3 5KXDA 1FXZA 3MDPA 3OUJA 1QOOA 4JGZA 1B35C 2JDZA 2D5FA 3AZVA 4XMAA 1TME2 1AR92 1OLRA 1PX4A 3GF6A 3NRUA 4LKEA 2DBIA 4XDPA 3MZHA 1E57A 2C26A 3OTFA 1AR82 5FAXA 1PMIA 3WF4A 5C7GA 2VXRA 2VMIA 3AP7A 4OZOA 2PLV3 4QB2A 4AGGA 3OD4A 4HL0A 2Y26A 1PMJX 4UF0B 1YQ6A 4XF4A 1OMIA 4FTSA 2ZGTA 4P9LA 4M00A 3D82A 1UKGA 1G9DA 5ABJC 5J37A 1VBA3 2EVXA 2I2SA 2XBO2 4N43A 5GLWA 1W05A 4ZU5A 3EXUA 3NNGA 4QKDA 5F5CA 1YC61 1RHI3 2WABA 4RR3B 2YPJA 3RYKA 4WBBA 5I0DA 3IT8A 1GZWB 3HPNA 4XZUG 3W9AA 3WHUA 3U1XA 2H6CA 1M4WA 5A1AA 2VE1A 2FMDA 4RQPC 3EQEA 2VQ0A 1S2BA 3O0VA 4I30A 1YFXA 3HNYM 4A7KA 2RM22 2SLIA 4AG4A 4YM3A 2J1RA 4CCNA 2WO2A 1OI6A 2WT1A 2XJSA 3WQ1A 4C0HA 3AZYA 4NHLA 1NZIA 2VCMA 4RL7A 2B7YA 3RPQA 1XRUA 3B5LB 5JCTA 1QOTA 4K3UA 3MYXA 1EYBA 3WP4A 3ZXAC 4AK3A 1SPPA 3WNXA 5FPAA 3ZXFA 2ADEA 1AR83 4PBPA 2GN3A 1ZYBA 2A73B 1GYKA 3WDUA 3FUQA 3OJBA 1JZ2A 1YIFA 1KS5A 1UY3A 2MNGA 2A3WA 1ULCA 1JUIA 2JX9A 2VMGA 2VW0A 3FMGA 5DDJ1 4YVWA 2ORXA 5FZ6A 3WF1A 4XJ9A 4JRLA 2D40A 2W2IA 2JEMA 1W6PA 1JYVA 2E32A 5CKMA 4C1WA 3ZDVA 3IAPA 5EFUA 4H14A 1B09A 5K0UC 3WQ7A 3E6CC 2C6SA 1DZQA 2K46A 3VDDA 3VL9A 2GC3A 5FJHA 1NLQA 2DUOA 4BOWA 5DDJ2 2HWC1 2PHFA 5F39A 3ZIWA 1F5JA 4NPLA 3B93A 1L3JA 4QXCA 4A3XA 2XQRA 5A3NA 3UJOA 4DXZA 3O7OA 2VTXJ 4AHXA 1PHMA 2HWE1 5F5QA 1FMD1 3CQOA 4AQSA 4OULA 2XKOA 4BIOA 4B1LA 4YGEA 4Q0UA 2LS6A 4P9XA 1H2KA 3LEKA 2HWC2 4BQ4A 3ILFA 5C8WA 4JC1A 2CWMA 1H0BA 4WVMA 4LUKA 1O3QA 3I3DA 3U4XA 1S0BA 4LTAA 1Q8QA 3DYPA 5DG2A 4FFFA 2GC0A 5F2WA 4CCDA 5LY1A 1H1AA 4LBOA 3N7JA 2HWE2 4Y24A 1FMD2 1OVSA 3U0ZA 1W99A 4AI1A 2GNDA 2PMWB 2X5IA 4AGRA 5LEKA 2WS93 5IHRA 3RZJA 1H6XA 1PNGA 3WDXA 2OZJA 4COYA 4I3GA 4KL1A 4N43C 2ZGKA 1C8M2 2ZX2A 4O9EA 3T1MA 2W39A 1Y7BA 2WUHA 5DABA 4AI0A 2WN2A 1ULEA 2JD4A 3RMYA 5DDJ3 3MPPG 3U07A 3BUCA 5CYYA 2OIIA 5BXXA 1XYPA 3T30A 2BBVA 1UPIA 5AC91 4YW1A 1YQ2A 3NJYA 2VOTA 3LOIA 5KBFA 5FXWA 4R52A 4QGMA 1ZRCA 3MIDA 4CDUC 5FDBA 2IUWA 5FPVA 3P5BA 3FC0A 4LE4A 2VW1A 2ZAAA 3ZFFC 4QPGB 3LCPA 3ZFGC 3AP4A 2HWC3 3LFMA 4LE3A 3PUQA 3HQRA 3FHIB 3LF7A 3O0WA 4JGYB 4AF9A 4URAA 3BCWA 4GWNA 5AC92 1E5IA 1R081 2P1BA 2ZTNA 3URFA 3VDBA 4Y5TA 4YVSB 1UNBA 1HQNA 4LBNA 2HWE3 2AEYA 2JG8A 2ILMA 3NV1A 5FPBA 2DCJA 4Q27A 5FUIA 2XUMA 3USUA 1HRI1 4CPBD 4TTGA 2QQPA 1YQ5A 2G9FA 1CX1A 4IE7A 2FDKA 4I0WB 3PIJA 4JQTA 3SEPA 4KH9A 4AVAA 3WINE 3D5OA 1OKOA 4NAMA 4AXOA 1H6YA 2VNRA 4KGGA 4HVQA 5HBAA 5L19A 4QPYA 3A22A 4CDWB 1R082 4XACA 5FYYA 3ZN6A 2E7AA 5ACA2 1GANA 2J1VA 1YFWA 5C8CA 2XHKA 3WDVA 2JD9A 2WFPA 1GNZA 3OEAA 1BYHA 1WCKA 1CAXB 4BYYA 1SFPA 1H8TC 5FZFA 1Q43A 3VHNA 3RZKA 2O1QA 2P3IA 4KQ7A 4DO0A 4GQ7A 4MYEA 5AVPA 3A21A 3EJKA 3D3AA 5LBFA 5TSWA 1F15A 5CB7A 3UJQA 5A3PA 1XE7A 4OMDA 3BI3A 1R1ZA 1YFUA 4JKKA 4XIKA 5KXBA 3EB7A 4OHYA 2GC1A 4E8DA 1OKQA 5AC93 5FWJA 1JI6A 4BIFA 2GZWA 4WV8A 2VC9A 2PA7A 2Z42A 3D4KA 3R05A 3W5NA 3CKHA 3S7IA 3NW4A 1IQDC 1PGSA 1X8EA 2C0ZA 2ZX1A 1OOPA 3OD0A 4BM8A 2XXZA 4Y1ZA 2HH9A 4ZU7A 3MLJA 3W5MA 4EJRA 1JZ8A 3TN91 3IM0A 1RUJ1 3SH5A 4MUVA 4HOOA 1MACA 5AVAA 4MGKE 5FYTA 1MS5A 4XYXA 1A3KA 3VD4A 1R083 2RS51 1NLSA 1Q5OA 4YZ3A 1A34A 2WA4A 1VAVA 4FPOB 4CSWA 5BV6A 4H7MA 1PVC3 5CA6A 2EXJA 3NJVA 1SBEA 2PFWA 2ARBA 3RG0A 1SLLA 1UZZA 1HRI3 1DP0A 1X33A 3KMHA 4CP0A 5L7OB 4RGGA 3TN92 1O5LA 1WD3A 4CU8A 1RUJ2 3R4SA 4MH0E 4D6QA 4D7TA 5FXVA 3WEZA 4JZRA 3OBAA 1RUC1 4HLTA 4FQZA 2RS52 4GULA 5LATA 2QE3A 2VQAA 1W6OA 3IBMA 4QKFA 3NAPB 2RDQA 4Q4W1 1G9BA 1VAMA 2BVBA 1VPHA 1GBGA 2AENA 3PDQA 2WBKA 3ACHA 1W6MA 1N1VA 1E5SA 3UV9A 3WG3A 5C5UA 3VD3A 5KWRA 2C4XA 2OXBA 3E5UA 2GDFA 5EP9A 5E89A 5IK5A 5AFEA 4W50A 3VKNA 1RUC2 1UX6A 2PHTA 3PUAA 3TYJA 1XNBA 4J1WA 4NMIA 4XUQA 3ZKUA 1SCSA 2YC2A 5A3MA 1XC6A 4Q4W2 5GJ6A 4FQ4A 2YB7A 5FUNA 4X8PA 3I59A 4XF9A 4QHBA 5FZDA 4B3NA 1JYTA 2NMOA 1D0HA 2DVBA 3EO6A 5A32B 2OVUA 1K5JA 1G9CA 4IEWA 4R8HA 4FVVA 2V4VA 4WM7B 2WSUA 4Y1VA 1UOBA 1SLCA 4Q4X1 3VBHA 2QKDA 5SV8A 1ZRDA 2EA7A 3ZMOA 3TN93 1DYKA 4LHSA 2W47A 2E7TA 1DQ2A 2BJSA 4ITCA 5FYBA 5C8CC 3S5AA 4AEDA 1RUI3 1ZBA2 4LORA 4LO7A 2RS53 1IPKA 4GIQA 4OYUA 3UNPA 1QQP1 3O1RA 4UAPA 2IVJA 4FFIA 5FY8A 5LRSA 1N1TA 4R9BA 4WVVA 3GBGA 4BMEA 5I0SA 2KM2A 1FPN2 1A8MA 1ULGA 5JIUA 4GD4A 5JXHA 3UESA 2ZKLA 1W3XA 1NCQC 1WKYA 1CAWB 2JG9C 2R7EB 4OI2A 1DGLA 5EQUA 3ZYGA 5JZGA 2R32A 4OUSA 1RUC3 4IE5A 5LCWL 1YWKA 1CAUB 1HB2A 1QQP2 1UL9A 2RR11 3DV8A 4HSLA 5JXJA 2R1BA 3PNAA 4Q4W3 4AHYA 5FZ9A 1LHWA 4XF0A 2V72A 5H9RA 4HKWA 3THTA 4YG6A 4KU7A 2YC4A 2WQ4A 3AFGA 3V64A 4AI2A 4QM9A 4LBLA 3GZTB 1NA1A 3UETA 3ME2A 3I49A 1NKGA 1S0GA 4BZ4A 1NLRA 5LWBA 3TEZA 2K0GA 2E53A 4F7ZA 2Q5TA 3GXUA 4HPKA 4QQOA 4D8MA 3OUHA 3ZR6A 4E4ZA 1Y43B 1QGLA 4JX0A 1ZZCA 3ZXJA 3SC7X 5LBBA 5I0UA 5JWPA 3AMQA 3N9OA 3POGA 4MO3M 1I1EA 3A4UA 4BQXA 1OF3A 4AEMA 3AP5A 1KXGA 5A3UA 1DU3D 1JZ7A 4Q4X3 1WMFA 1KJLA 1ZREA 3OY8A 2VL4A 5DAWA 5JOZA 2RE9A 5FY5A 2BZDA 3I2KA 2EIBA 3SNMA 2FDJA 4NJ4A 1PK6B 1O3TA 2B39A 5JOWA 1DZRA 1QQP3 3HWJA 4I0AA 1IPJA 4PI0A 5IVCA 1US3A 2NP0A 5HPOA 5DUWA 5FZ3A 2LM3A 4ASMB 3K46A 3MW4A 1WBLA 4GWIA 4RS5B 4YM1A 5L9BA 2V09A 1POV1 4WVZA 4GMP0 4BQ3A 4CU9A 2YDEA 2UY9A 2RS33 2YC0A 2A3YA 5LB6A 3ES1A 3F2ZA 2V5DA 1YEWA 4NHKA 3U14A 2YBPA 3PVNA 2OQ6A 4UI9L 3WVJA 1ZA4A 4IXLA 3TOJA 1TVGA 2RVAA 1ND3A 2Q8DA 4HT1T 1C28A 4BHPA 3LGRA 1I5ZA 2ARAA 2RR13 3WQ0A 2Y60A 1JYWA 3DL3A 3LAGA 2NM1A 2YY1A 3CBNA 4UYBA 3IDBB 2WT2A 1W8OA 5I0TA 3W58A 2YBKA 3VBHC 3M4FA 4DRRA 1PZ9A 4LKDA 4NWVA 3LDKA 4UOJA 3VGIA 5EV7A 1AL21 3ACFA 5EYYA 3CU7A 3VBFB 4M4RA 5GZCA 1H4HA 3JUUA 4S2HA 3T0AA 4XFBA 4OI4A 5EJZB 2AREA 2LUWA 4AEDC 5C33A 5BNQA 5FYUA 3W20A 5CG9A 3C7GA 2XONA 5F32A 4XFCA 3AVRA 5CFCB 2DUQA 2OPWA 3V0AA 1GUIA 2XKPA 2FZ2A 3WT3A 2A6WA 1OBNA 2VZVA 1OH3A 5CISA 4M01A 3KLSA 4QAWA 2ZZJA 1I9RA 5C70A 1AL22 4E2SA 2OYZA 4D6SA 2VZUA 2J7MA 2G4IA 4A3ZA 2H0VA 5BNOC 5JZGC 4UT5A 5D8AA 5DG1A 1UYYA 1J83A 5L36A 1ND2B 4Y3OA 1LNSA 4Q29A 2D3PA 4X6RB 4IV1A 4YG0A 2PHWA 2WWSA 3JQXA 1OA4A 3N7KA 4IDZA 1UIJA 3JXSA 1PNFA 4NROA 5F2SA 3VKLA 1C5IA 1AYN2 1OT5A 2DCTA 2CV6A 3T2QA 5IVJA 1J59A 1JYIA 1DF0A 1NQDA 5L9VA 2B42B 1CIYA 3HJRA 2XWJB 5JMOA 4AFCA 1NA1C 4W6XA 3KCCA 3UGFA 4AW7A 4P02B 4R9DA 3O1UA 1POV3 2WNEA 4YW7A 2Y64A 5DQ0A 1JZ5A 1AXZA 1F8VA 4WM8C 1RUNA 3IPVA 3Q8AA 1N47A 4ET7A 1QJU1 2VCCA 4D7YA 2A3XA 4CEWA 4IESA 4QQLA 5FY7A 3WCSA 4AVSA 1W2NA 4CCJA 3WXPA 2DTYA 5T5LA 1LEDA 3OGSA 1FOD3 1KDMA 2VZOA 3IDCB 1XXNA 3PUIA 1CZVA 2GMMA 3LSDA 1CAVA 1DHKB 3QACA 1IHMA 3BU7A 4IGOA 4QHZA 4CYDA 1AL23 3HR9A 4TWTA 3JCIA 4IE6A 1GZCA 4YGDA 4CU6A 1YYNA 4ES9A 4XUTA 5JR2A 3WDTA 1QJU2 5FOBB 2VUAA 2VZSA 1I3HA 1SLTA 1MEC1 2JJ6A 3VZOA 4CDQA 1SFYA 5EJ3A 4ARYA 1RXGA 3DECA 4Y4RA 5FPUA 1JU4A 4OHXA 3AMNA 3AXDA 5JR7B 4JAAA 2XHNA 5IK4A 3H0OA 4DUXA 2Y6JA 1DLLA 1O4ZA 4JDOA 4CZSA 4LMFA 1REFA 3B02A 1OHFA 1DGRA 2BU9A 1IKQA 1W3VA 4NPMA 2WZPP 1DGWA 5IYYA 4OFGA 3ZIXA 4DEVA 1ND3C 4FOQA 5IK7A 3QLQA 4EROA 1C1LA 3X29B 1UOJA 4AVCA 1D0GA 4XJZA 5IVFA 5DXDA 5ABJB 5FZ7A 3OCPA 4ASKA 4CUGA 4E2QA 1RL3A 3KD4A 5CKNA 4NR1A 4LLOA 1NX9A 2OKXA 4BE3A 2QQWA 3KGLA 1WW5A 2WWJA 2VNVA 5GLZA 5JSOA 2ZJCA 2WNUA 1MS0A 2NZ9A 1V6KA 2WFF1 3SCHA 3E5XA 1S2KA 1X82A 1B35A 4DOUA 3LZZA 2G1MA 2WAAA 3RRDA 1FX5A 4UW6A 1VJ2A 3GZEA 1WW7A 1OURA 3M70A 4AAXA 4BJ0A 2BWCA 2UYBA 2XJVA 4FPYA 5T52A 4LBQA 5T3NA 3VZMA 2CAUA 2QQIA 3VKFC 1OFNA 3M2MA 2GNMA 4C8DA 4Q0SA 5D8AC 5FKBA 2VR4A 4BK4A 5KXEA 3WHTA 1EY2A 2WFF2 3RGBA 4KBZA 4E8CA 5J36A 5FQ0A 2BDRA 2WKKA 2ZA9A 2DCYA 4IV1C 1LB2A 2HLEA 4Y20A 1TEIA 2VOWA 4MOAA 2CNAA 3H8OA 1G86A 1ULOA 4P14A 1WW4A 4YZ1A 3U10A 4NRPA 3KT1A 2WT0A 1MEC3 2VUCA 3KWVA 2ZGUA 5FMOS 1QOSA 1TNRA 1AX2A 3HT2A 3DF0A 1V6MA 1S1AA 4AYUA 1DZTA 2QBXA 2V5YA 3G7DA 2X53S 1VAKA 2VZ1A 1NAEA 2TEPA 3H1MA 5APAA 1HIXA 2HWD1 4RQPA 2JB4A 1XNDA 2UWAA 3WF0A 1JYXA 2D98A 5FK7A 1LOGA 3WF3A 4AOCA 4I2OA 1NYWA 1T6GC 1VBE2 3OF1A 4YW3A 4AFAA 1ZVFA 4LLFA 4CEWC 5K0UB 1PM7A 1Y9GA 1U5XA 4LO4B 3RZZA 3FLPA 1PMHX 3N35A 2BNMA 3LE0A 4CXXA 4Q1PA 2Y34A 4LJHA 1OD5A 2B5HA 1D4VB 1AXYA 2HWD2 5GM0A 1HQWA 3VBUC 4AQTA 3AJZA 2BBAA 2ARCA 3HQUA 1G7YA 3LFIA 1KDKA 1JOJA 5KR7A 1K5MC 3NL1A 4LOSA 2JE9A 2WFF3 4ZU4A 4DXRA 1JYCA 1V6OA 2B4KA 2WIIB 2F6BA 2HJIA 4K8RB 4CDQC 1YI7A 3IKWA 4Z2AA 2WC2A 1JMUB 5LA0A 4PIYA 1RTVA 3BGAA 2B9UA 1MPXA 2J42A 3ZFEA 1BVP1 2D6LX 1XU1A 3NNJA 3FE5A 4HN0A 1N3OA 1TE1B 3F95A 4N53C 2ET7A 3G6JB 5F3EA 1CWPA 5IJRA 4FCAA 1JN2P 2GALA 1TME1 1AR91 2H0BA 4XVHA 3V65A 3SXWA 2CYFA 3ZR5A 3WG2A 4B7EA 3DKWA 1UW8A 1HW5A 2ZHNA 3I2DA 4K1ZA 4N43B 5L9RA 4AVBA 3IDEA 4XTPA 2E31A 1SBFA 2CY6A 2ORZA 4QT6A 3KM5A 3EMRA 4L0PA 1RVF1 1SHWB 3T0DA 1KEXA 2WNUC 2VXJA 4LR4A 1CD3G 3UGHA 3RI9A 1W0NA 1UMZA 4OHWA 2YHJA 3WW1A 1O8SA 4GALA 2HWD3 5F9TA 5JPNB 1GLHA 2XBO1 4HMZA 1DCSA 3KQ4B 3DPRC 1WMXA 3LEMA 4D94A 3KZ4C 3ZN5A 4LIUA 4FTBA 3SLIA 4MVTA 1GP5A 3ZFFB 3AP9A 5FIXA 1RVF2 3N9QA 2QNKA 2VMEA 3I2HA 2CGOA 4CUBA 4K9SA 2VU9A 2AACA 2HEYF 4D0QA 5A80A 4B4RA 1SPPB 2NN8A 4XETA 3VZLA 2RM21 5C4WC 1ZRIA 3O1MA 5FZKA 3CF6E 1UY2A 5EWSA 4HBNA 4AVVA 2A6XA 4JKMA 4AZZA 4EQVA 3OB8A 5KXCA 4H55A 1XNAA 3MPBA 4YVWB 5FZLA 4YPJA 3VD9A 1F2NA 4D69A 1VE0A 2D6OX 2P2KA 3ENRA 1WGPA 5CFDC 2PAMA 1G9AA 5I8TA 3TEWA 1CONA 2KA3A 1W6PB 4ATFA 4DEQA 2R061 3K4DA 2KD7A 2ZHKA 4PLOA 3MIHA 1SZBA 4CDUA 1YUDA 4DPNA 4BQ5A 3ZFFA 5G05L 1O7FA 3ZFGA 1CPNA 3H1WA 3KV4A 1QHDA 3VDDB 4IEUA 4EZHA 3BALA 3C7FA 3O1VA 4IGPA 1H8TB 1TME3 1S55A 1AR93 4ZPIA 3GHNA 3SITA 4A7ZA 1CIWA 5T5OA 1WCQA 5ERLA 1WA6X 2CDPA 3GGLA 1QDCA 3ZX7A 2EICA 2VMDA 1DQ6A 1REDA 2R062 4B8EA 3ZO0B 1RITA 1RVF3 2DVDA 5FPZA 3H1YA 3DKQA 3GJBA 1TQ5A 5FOJB 4GH4C 4HANA 1D7PM 4AFMA 1EAH1 4CDXC 4ARXA 2XBO3 4Y5SA 2UWCA 3VBSC 2WO1A 4W4ZA 1IG0A 3AVSA 1VBB2 3CDZB 4YWAA 4WVMB 5IUQA 4DUWA 5A1FA 1UCXA 4FPGA 2OW4A 2P6CA 3ZFEC 1WLDA 4GXLA 5FPXA 1SG3A 3WUDA 3O1OA 4RHV1 1IS3A 2BNOA 1E5HA 2X05A 1H8TA 2X5IB 5A7QA 4L99A 1Z78A 1PZ7A 3K77A 3NNFA 1EAH2 3CL1A 5FMDA 2XJQA 1YQ8A 1GKBA 1JXNA 5ANQA 4C0BA 2RM23 3KT7A 2JE8A 3CJIC 1UZYA 1V0AA 2J1SA 2EIEA 3APBA 1YI9A 3TRSB 4RHV2 3J8F1 3OGVA 4UFKA 4BK5A 5A7SA 4IETA 1ZA7A 1J1LA 2C24A 4ZKTB 2E6VA 3K3OA 3ACGA 3P3NA 3ZXEA 1TMF1 4Q5OA 1UXZA 3UKVA 4XE9A 3ALQA 1C8M1 4I01A 2R063 3VZJA 1KJRA 3T2OA 3WP3A 3LA2A 1UAIA 1RJ8A 4BWOA 2QQMA 3S30A 1X9TA 4Z1VA 5JI9A 1Q8PA 4P9WA 4K7JA 4XJUA 5FMOL 3PJQA 1YLLA 3LOBA 1PVXA 4KU8A 2BWAA 3J8F2 4FPCA 5FWEA 3M3OA 5CIRA 2CGNA 4AGVA 1AZDA 1CN1A 3WNKA 2OUJA 3FLTA 1TMF2 1N3PA 1BCXA 1FATA 2ZOEB 1WW6A 4FPHA 2JG8B 4TLFA 2HYXA 3JB8A 1BHGA 4LBQD 4W6YA 1R1A1 2D93A 4LKFA 3RNSA 3USUB 5D2AA 5FZBA 4RFT0 1EAH3 2WYFA 2CSGA 4MXWA 1NZCA 4O61A 3I2OA 4MHUA 5LW9A 3O1SA 3WP5A 2EALA 3N9LA 1CJPA 3AM2A 2EXKA 2QZ2A 3FFZA 1VMFA 3ZN6B 3PVOA 1UN1A 1LOCA 2D5HA 4EZ4A 3WW2A 3ZSKA 3L9JT 5C8CB 5J3UA 3HAGA 3MIBA 4R4XA 1AF9A 2A75A 1R1A2 3NSTA 3TB0A 3LQCA 1CX4A 4BA6A 2D3SA 1V70A 1DG6A 1KITA 4WZCA 4BXSV 5ACA1 1O3RA 2Z4FA 2ZHMA 1DIWA 3DUIA 3H8UA 5GZEA 3FL7A 2KXLA 4CCMA 1FMD3 2R041 2VOKA 4G9SB 3VD5A 4A6OA 4XF3A 3GJAA 2WNVA 3PLQA 2ZMKA 4J6GA 2E7QA 4OLLA 3ZXGA 4NIDA 2TUNA 2JG9B 4K1YA 3VDCA 1UU4A 1HV1A 2Y6KA 2Q8EA 1WWYA 2CDOA 1TMF3 1ZZ7A 1POQA 2ZGMA 2B8MA 1QXJA 2I74A 2ZS6B 1BJQA 1C8M3 3FFQA 4L92A 5FZHA 1ZRFA 1XJAA 2O8OA 3VBRA 2VUDA 1LAJA 4A42A 2QQJA 2VTXA 1AX1A 1OOPB 2WYSA 3RVHA 1T2XA 2R042 2VM9A 4E4DX 2JENA 5B4XA 4LT5A 4Q4V2 4YW2A 4OMCA 4Q0VA 1H2NA 4FPFA 5A33A 3C7HA 2JDNA 2C9KA 4XXPA 4R9AA 4YNIA 2YU2A 3VHRA 1HN1A 3VL8A 1S0EA 2P17A 1CPMA 2R1DA 1W8TA 2A6YA 2CWSA 1C1FA 1SMVA 3N4MA 4RSUA 5I8SA 3QBQA 5FBZA 2EIDA 3SKVA 3TEYA 4PT6A 1IPSA 1MS3A 4BLJA 1NCQA 2JG9A 4X8NA 4BLIA 4CCLA 1EPZA 1SLIA 2X10A 3ZN4A 3QH6A 3PUHA 3ACLA 3HNMA 3S6PA 1MR5A 1QKQA 1JUHA 2HYKA 5EZWA 4NRQA 4YW6A 1LHOA 1W6OB 3AFKA 4DXSA 2YZ4A 2VQTA 4CXYA 4Q8KA 4QPIA 5BNPC 2QQKA 3MIFA 4XFHA 3DYOA 5FZEA 1DFQA 1W6MB 4C91A 1F4AA 1NE4A 2D6MA 5ACA3 2YMZA 1O91A 5FY1A 2W3JA 3BOPA 3LSEA 3DXTA 3MFCA 1LJ7A 2DCZA 3BIWE 1ODMA 4W65A 5FUPA 1AR72 2R49A 2W52A 1JU3A 2BP6A 2R16A 4OZXA 1NXMA 3Q8BA 4BCUA 4DZGA 3N7LA 4YGBA 3I59B 1OH4A 1ZZ9A 2AGSA 1LRHA 3KGZA 3RFRA 5BPXA 3NJZA 3ZMNA 2ZABA 4LO5B 5BUVA 2K2SA 1UY1A 2W1UA 4PLMA 3OYWA 5I8YA 5F5AA 4KBBA 3O5SA 1HLCA 1UU5A 1AX0A 4NAOA 4XCAA 5H9PA 3VBHB 3AZZA 3N9NA 1MZ5A 3K75B 3SHRA 2AH2A 2W9XA 2ARXA 1VBC1 2HEWF 1L7LA 4IE0A 3GHMA 2EIGA 4IEXA 4HXCA 1ZM1A 2LROA 2XOMA 4EV0A 5FZGA 1ZRRA 1S0JA 4AEDB 1ENRA 2R0HA 4IV3A 4P08A 4CP9A 2RDSA 4QX7A 1Q8SA 2WN3A 4YM0A 1VBD1 2JIGA 5B4NA 3T4HB 1HN0A 1W8FA 1HB1A 2XJPA 3K51A 1MQTA 2BFUS 2VZPA 4AQ2A 4JKLA 2FMYA 4YZ5A 4NIGA 2UYAA 2YU1A 4L9BA 4B4PA 2JB8A 5D21A 1QJZA
chains in the Genus database with same CATH topology
3OPTA 4Y3OA 5A7NA 5FZ8A 2W2IA 5FZAA 4GD4A 5IVEA 5CEHA 5FZFA 3PUSA 4DO0A 5FJKA 5F2SA 3KV4A 5FYVA 4LITA 4CCMA 5IVJA 4EZHA 4QXHA 4CCKA 4IGPA 3KV9A 4V2VA 4QX8A 5FY9A 5FZ0A 5A3PA 2GP5A 5FJHA 4LIVA 5FXXA 5A7PA 3PU3A 3ZLIA 4E4HA 5F39A 5FZ9A 2Q8EA 5FZHA 3KV6A 5FWJA 4QXCA 5FP4A 4LXLA 5A3NA 2OS2A 4AAPA 5FP3A 4BXFA 3N9PA 2OQ7A 3RVHA 5F37A 3ZPOA 2OT7A 2XXZA 4D6RA 5FY7A 5LWBA 3KVBA 5A7OA 4CCJA 5FY0A 5F3GA 3KVAA 3AVSA 5FV3A 5A1FA 3AL6A 5KR7A 5A3WA 4HOOA 5FYTA 3PTRB 2YU2A 4IGOA 5FZ4A 3N9MA 3LDBA 2XMLA 5FPLA 4QU1A 5E6HA 5F3CA 3N9OA 4XDOA 3AL5A 5F2WA 5F5IA 5LY1A 4CSWA 2OX0A 5FYIA 5A7QA 3OPWA 4CCLA 5FZIA 3PU8A 4GJZA 5FP8A 4XDPA 5ANQA 5FY5A 2YBSA 4D6QA 4Y4RA 5FY4A 5FPUA 2PXJA 4HONA 5F3EA 5FXVA 1VRBA 2XUEA 2WWUA 4Y33A 4UF0B 5IVCA 3KV5A 5FZ3A 5A7SA 2VD7A 4UF0A 4QWNA 5FZEA 5IVFA 4CCOA 3K3OA 3U4SA 3PDQA 4AI9A 3NJYA 4V2WA 4NUBA 5FZOB 5FYMA 5FY1A 2YBPA 5FXWA 3DXUA 2OQ6A 2YPDA 4GAZA 5F3IA 5FZOA 2GP3A 3DXTA 5K4LA 5FZ7A 4ASKA 4CUGA 3K2OA 5F5CA 3LD8A 5FP7A 5FUPA 5FYZA 3PUAA 5FPVA 2Q8DA 5IVVA 4IGQA 5A7WB 2WWJA 4EYUA 5FWEA 5IW0A 4LIUA 2YBKA 3PUQA 4BISA 5FUNA 4URAA 5FZDA 5A1LA 4QXBA 5FYHA 2Q8CA 5FXZA 3N9QA 5F5AA 4CCNA 4DIQA 3N9NA 5FPBA 5FZ1A 5FYUA 3UYJA 5FZBA 5A80A 5F32A 3AVRA 2P5BA 5FZMA 5IWFA 5LW9A 5FP9A 5FPAA 5FZGA 3N9LA 3U78A 4C8DA 3PURA 5IVBA 5FYBA 5FZCA 4QX7A 5FZKA 3K3NA 4EZ4A 5ISLA 5FBJA 5FYYA 4BU2A 4D6SA 5FYCA 5FYSA 5A3TA 5FZLA 2XDVA 4TN7A 4GJYA 5IVYA 5LY2A 5FY8A 2YU1A 5A7WA 5FZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPT A;  4Y3O A;  5A7N A;  5FZ8 A;  2W2I A;  5FZA A;  4GD4 A;  5IVE A;  5CEH A;  5FZF A;  3PUS A;  4DO0 A;  5FJK A;  5F2S A;  3KV4 A;  5FYV A;  4LIT A;  4CCM A;  5IVJ A;  4EZH A;  4QXH A;  4CCK A;  4IGP A;  3KV9 A;  4V2V A;  4QX8 A;  5FY9 A;  5FZ0 A;  5A3P A;  2GP5 A;  5FJH A;  4LIV A;  5FXX A;  5A7P A;  3PU3 A;  3ZLI A;  4E4H A;  5F39 A;  5FZ9 A;  2Q8E A;  5FZH A;  3KV6 A;  5FWJ A;  4QXC A;  5FP4 A;  4LXL A;  5A3N A;  2OS2 A;  4AAP A;  5FP3 A;  4BXF A;  3N9P A;  2OQ7 A;  3RVH A;  5F37 A;  3ZPO A;  2OT7 A;  2XXZ A;  4D6R A;  5FY7 A;  5LWB A;  3KVB A;  5A7O A;  4CCJ A;  5FY0 A;  5F3G A;  3KVA A;  3AVS A;  5FV3 A;  5A1F A;  3AL6 A;  5KR7 A;  5A3W A;  4HOO A;  5FYT A;  3PTR B;  2YU2 A;  4IGO A;  5FZ4 A;  3N9M A;  3LDB A;  2XML A;  5FPL A;  4QU1 A;  5E6H A;  5F3C A;  3N9O A;  4XDO A;  3AL5 A;  5F2W A;  5F5I A;  5LY1 A;  4CSW A;  2OX0 A;  5FYI A;  5A7Q A;  3OPW A;  4CCL A;  5FZI A;  3PU8 A;  4GJZ A;  5FP8 A;  4XDP A;  5ANQ A;  5FY5 A;  2YBS A;  4D6Q A;  4Y4R A;  5FY4 A;  5FPU A;  2PXJ A;  4HON A;  5F3E A;  5FXV A;  1VRB A;  2XUE A;  2WWU A;  4Y33 A;  4UF0 B;  5IVC A;  3KV5 A;  5FZ3 A;  5A7S A;  2VD7 A;  4UF0 A;  4QWN A;  5FZE A;  5IVF A;  4CCO A;  3K3O A;  3U4S A;  3PDQ A;  4AI9 A;  3NJY A;  4V2W A;  4NUB A;  5FZO B;  5FYM A;  5FY1 A;  2YBP A;  5FXW A;  3DXU A;  2OQ6 A;  2YPD A;  4GAZ A;  5F3I A;  5FZO A;  2GP3 A;  3DXT A;  5K4L A;  5FZ7 A;  4ASK A;  4CUG A;  3K2O A;  5F5C A;  3LD8 A;  5FP7 A;  5FUP A;  5FYZ A;  3PUA A;  5FPV A;  2Q8D A;  5IVV A;  4IGQ A;  5A7W B;  2WWJ A;  4EYU A;  5FWE A;  5IW0 A;  4LIU A;  2YBK A;  3PUQ A;  4BIS A;  5FUN A;  4URA A;  5FZD A;  5A1L A;  4QXB A;  5FYH A;  2Q8C A;  5FXZ A;  3N9Q A;  5F5A A;  4CCN A;  4DIQ A;  3N9N A;  5FPB A;  5FZ1 A;  5FYU A;  3UYJ A;  5FZB A;  5A80 A;  5F32 A;  3AVR A;  2P5B A;  5FZM A;  5IWF A;  5LW9 A;  5FP9 A;  5FPA A;  5FZG A;  3N9L A;  3U78 A;  4C8D A;  3PUR A;  5IVB A;  5FYB A;  5FZC A;  4QX7 A;  5FZK A;  3K3N A;  4EZ4 A;  5ISL A;  5FBJ A;  5FYY A;  4BU2 A;  4D6S A;  5FYC A;  5FYS A;  5A3T A;  5FZL A;  2XDV A;  4TN7 A;  4GJY A;  5IVY A;  5LY2 A;  5FY8 A;  2YU1 A;  5A7W A;  5FZ6 A; 
#chains in the Genus database with same CATH topology
 1TG7 A;  1VBC 2;  1ZBA 1;  3J7M A;  2WNV C;  2ZML A;  1X36 A;  1W6N A;  3KS7 A;  5IVE A;  5JZG B;  4KNC A;  5BNN A;  3RZH A;  5GLU A;  4P9G A;  5JOX A;  1NG0 A;  3AB0 A;  2WO7 A;  1VBD 2;  3P3P A;  4LIT A;  4TXW A;  4CXW A;  3IZO A;  3SMH A;  4ES8 A;  2IXK A;  3J26 N;  2WZ8 A;  3VBR C;  1FPN 1;  4XFF A;  1HB4 A;  4ISR A;  1RUJ 3;  2D43 A;  1UYZ A;  4LBJ A;  3ATG A;  5A3L A;  3IIA A;  5C3P A;  1OVP A;  3N3H A;  4YSF A;  1NA1 B;  1QF3 A;  3WX5 A;  3OEB A;  4XQW A;  2WNO A;  2YRO A;  3MW2 A;  3POY A;  2ZXQ A;  3ZPO A;  1J58 A;  1RIR A;  3O12 A;  5IAV A;  3K48 A;  1GIC A;  4FTE A;  1STM A;  4HPK B;  3AKQ A;  4Y4Y A;  5DN2 A;  3V56 A;  5BNO A;  1HB3 A;  4QU2 A;  2BGC A;  3RSJ A;  4KG8 A;  5J48 A;  1FYU A;  2WR9 A;  2Y33 A;  3B69 A;  4QPG C;  2JWP A;  1G6N A;  1CZT A;  3WF2 A;  3OY8 B;  4JGY C;  5IFP A;  4XAB A;  1VBC 3;  4XFI A;  4LBK A;  1SBD A;  1OF4 A;  4QPI C;  5DMY A;  3KHC A;  4YAR A;  3M3I A;  4YVS C;  3U11 A;  3AYC A;  4OHV A;  3VD7 A;  1ULD A;  2PXJ A;  2HWB 1;  4UW3 A;  3WG1 A;  1SLB A;  3AJY A;  3M3E A;  1I5P A;  1VBD 3;  3EHK A;  5JDB A;  1G8W A;  3POJ A;  5C6C A;  1D4M 1;  3IDA A;  1BK0 A;  2FQP A;  1NY7 1;  4WM8 A;  1DQ1 A;  4YRD A;  4LOT A;  1UPS A;  2C5D A;  3FX3 A;  4AI9 A;  3MF9 A;  4CCE A;  4MG2 A;  2VZT A;  2WSV A;  1X7N A;  4ZY9 A;  1ZBA 3;  3C3V A;  3I54 A;  2MPF A;  3MIE A;  4EWA A;  4DMI A;  5J7M A;  1VB2 A;  4H7L A;  3LIH A;  3DXU A;  2R07 2;  2HWB 2;  2VEC A;  4FAH A;  1ND3 B;  2Q1Z B;  1OLQ A;  5K8S A;  1XE0 A;  1YNA A;  4XIO A;  5A7W B;  1D4M 2;  5FLH A;  1FPN 3;  2XR4 A;  3RJR A;  4XUO A;  3MGU A;  3ILR A;  4BH9 A;  1NY7 2;  4Q4Y 1;  1GFF 2;  4QX3 A;  1UOG A;  4DY5 A;  1KQR A;  3JD7 2;  1V6L A;  4HG6 B;  1J3Q A;  4ZZ5 A;  4NHX A;  2A5Z A;  2VQU A;  4HVO A;  2AZ5 A;  4MGT A;  1IOA A;  3AKP A;  4IV3 C;  4LQR A;  2YYO A;  2BGO A;  4AQ6 A;  3TNP B;  2UY8 A;  1Y4W A;  4F83 A;  4A7Y A;  2WZE A;  1MQT C;  4QB6 A;  3S7E A;  3ILN A;  2Q0A A;  4IEV A;  2QTW B;  5K9Y A;  3V0A B;  4Q0P A;  3NV2 A;  1W39 A;  1W9Y A;  5FP9 A;  1CGP A;  2PHD A;  5A6Y A;  4Q4Y 2;  2GSY A;  2JDA A;  2YGM A;  3BN6 A;  3ZDS A;  3HD8 B;  4EN0 A;  3KSC A;  2VVD A;  3WV6 A;  1VB4 A;  4R4Z A;  5EHD A;  5FYC A;  2WQZ C;  1JZ4 A;  4KWK A;  5IVY A;  5D8A B;  3O0X A;  5A3T A;  5BNN C;  5A7W A;  3I2J A;  1KFU L;  1YQC A;  4YG3 A;  1ASJ 2;  4NII A;  4IV1 B;  5FZ8 A;  3MV1 1;  1W2A X;  3O1P A;  4AL9 A;  1QWR A;  3VKO A;  4YFW A;  3CHX A;  1PO1 1;  3PUS A;  4CUC A;  4XCB A;  2HWB 3;  5HV0 A;  2EF6 A;  4TYS A;  1AVB A;  2J1U A;  4QXK A;  5C9A A;  1UX7 A;  4QXH A;  4YZ2 A;  1D4M 3;  5C5T A;  1HDK A;  2JDK A;  2PTM A;  4BQ2 A;  3FJS A;  5L7O C;  2GP5 A;  1H2M A;  3MLK A;  3VHO A;  1Y9M A;  3WDW A;  3KB5 A;  4BQW A;  4QPW A;  5FKC A;  1AYN 1;  2OS2 A;  3D0S A;  3IPV B;  4O7X A;  4AAP A;  1JZ3 A;  1PO1 2;  2JDY A;  2W0X A;  3NAP C;  4LNV A;  4CEW B;  1CQ9 A;  4SBV A;  1LGN A;  3NQH A;  4PF5 A;  1G9F A;  5LZ6 A;  2ADD A;  4QM8 A;  4LHN A;  3RQ0 A;  1JOB A;  1QU0 A;  3OSD A;  4Y22 A;  4COW A;  5M0T A;  2A7A A;  4XBL A;  5T5P A;  4L97 A;  4XAE A;  3HN3 A;  1CAV B;  4CP2 A;  5CAD A;  4IUG A;  5FO7 B;  1WLW A;  2ZX4 A;  1CZS A;  1YFY A;  1VAL A;  2BGP A;  3E6D A;  4ISQ A;  4ZZ8 A;  2DWR A;  3FZ3 A;  2E63 A;  1K5M B;  2IC1 A;  1ONA A;  1SFN A;  2AYH A;  1ZZB A;  2K9Z A;  2VNO A;  1GU3 A;  4I0B A;  4P5H A;  3RYR A;  4FPK A;  2EAA A;  4DY3 A;  4CDQ B;  3ZSJ A;  5FP8 A;  3KCY A;  3ZYI B;  3MEP A;  5JSR A;  1UYX A;  5LBE A;  4H3W A;  1RUH 1;  5FY4 A;  1W28 A;  2OUH A;  4UW5 A;  4XBQ A;  1BKZ A;  1QEX A;  3HNB M;  3M7A A;  3OBR A;  3SH3 A;  4AR2 A;  4DFS A;  1MS1 A;  2HBT A;  4B4Q A;  4CP1 A;  1GOG A;  2W68 A;  4N90 A;  3PL0 A;  3SKJ E;  5JSP A;  3U4S A;  3POS A;  5JI7 A;  4MSV A;  4LPL A;  3D0J A;  4XW3 A;  2BFU L;  1UY4 A;  2XJU A;  3VHP A;  2J1E A;  4NUB A;  3M3Q A;  1JOP A;  1HRV 1;  3GZA A;  4IL7 A;  4O9G A;  3VBU A;  3AKT A;  1RUH 2;  4WZF A;  1V9U 1;  1XOY A;  5CG8 A;  1CR7 A;  1AJO A;  2GH8 A;  3FBM A;  5CAZ A;  1O3S A;  1GQG A;  1K5M A;  1ST8 A;  1Q8O A;  1QJF A;  1J3R A;  1RJ7 A;  4FPJ A;  4K8F A;  1HJG A;  1KS4 A;  2WNU B;  2VOV A;  2ZCW A;  4LO8 A;  4COU A;  1M06 G;  2UU8 A;  1X9P A;  2W94 A;  5BY5 A;  2DU0 A;  5LRR A;  3MUY 1;  5DUV A;  1RYY A;  5A1L A;  1SDW A;  1S0C A;  2AR6 A;  1B35 B;  2W1Q A;  1W06 A;  2IVI B;  2W46 A;  1AYN 3;  1V6I A;  4G4F A;  2Y38 A;  4P9J A;  2Y8K A;  4QDQ A;  3Q8C A;  4QXB A;  4PDW A;  3ZPY A;  5EYX A;  1HRV 2;  3GNE A;  5DAV A;  3ZXL A;  2CL2 A;  1V9U 2;  1ULF A;  4LBQ B;  4N53 A;  2P3Y A;  3MBW A;  3LB9 A;  4PHZ A;  4JRA A;  3MO4 A;  5FZ1 A;  5IAT A;  2BOI A;  2P5B A;  2XL7 A;  3IWZ A;  1K3I A;  2R0F A;  3QD6 A;  4HKL A;  3USS A;  1BVV A;  4XJA A;  1W6Q A;  4EN6 B;  1O6U A;  1XPW A;  1XSQ A;  3AYD A;  1FAY A;  1UF2 C;  3AC0 A;  1FT9 A;  2SBA A;  5FQ0 B;  2H6B A;  1D2S A;  5HCH A;  3K3N A;  2BNN A;  5LK7 B;  5FBJ A;  5E8A A;  3AZW A;  3HQX A;  4Y20 B;  3TWI A;  4GJY A;  5LY2 A;  2XQX A;  1IZ3 A;  1UMH A;  3AXE A;  5C9A C;  1GP4 A;  3BU0 A;  3PME A;  3NVC A;  2GN7 A;  5AFB A;  2VO5 A;  2GNT A;  1GQP A;  3H9A A;  1H8V A;  1RUH 3;  4KI5 M;  3DPR A;  3M1H A;  3ZXK A;  4XJW A;  1A6C A;  1LOB A;  2V4A A;  1QJU 3;  4RQP B;  5FYV A;  3EYP A;  4H2A A;  3H3L A;  3R4D B;  3C8X A;  4CCK A;  4AHW A;  1UOF A;  5EPA A;  3INA A;  4IEQ A;  1H4G A;  2FCT A;  1Q8V A;  2IXJ A;  3FUO A;  4LIV A;  4FOW A;  4KMQ A;  3R4U A;  5HCF A;  1S2E A;  5A7P A;  3WD5 A;  4E2G A;  1NCR A;  3ZVX A;  4F8A A;  3GCW A;  4A44 A;  3ON7 A;  1HJF A;  1EV1 1;  1OQ1 A;  2R6Q A;  1HRV 3;  5FP3 A;  2BUK A;  4QDS A;  4BXF A;  1GSL A;  5C4W A;  4RS5 C;  2OQ7 A;  4RGK A;  4NIH A;  1VBE 1;  2ENR A;  2RDN A;  1COV 1;  5A7O A;  1CVN A;  5FY0 A;  3KVA A;  1OPO A;  3WLU A;  1IKP A;  1QMJ A;  3AL6 A;  4JCK A;  3B9C A;  3ZM8 A;  2B9V A;  2D3R A;  1OXC A;  3POW A;  4CEY C;  5C3O A;  5CFD A;  3GBF A;  3LDB A;  4Y26 A;  5E6H A;  1V6J A;  3VBS B;  1O4T A;  4BMB A;  1EV1 2;  1LOA A;  3DEM A;  4M3C E;  4XUR A;  4S2G A;  1LHU A;  3U75 A;  2OX0 A;  1YHF A;  3ZFE B;  1RB8 G;  1GWL A;  5SV5 A;  3T3Y A;  3BKZ A;  2VZR A;  5FZI A;  2Z79 A;  2WZR 2;  2XJT A;  1COV 2;  2DVF A;  3GZU C;  1C57 A;  3UGG A;  1UO9 A;  4DQA A;  4CTE A;  4YW4 A;  3OBT A;  3THD A;  2D6N A;  5E1R A;  2X09 A;  2WL1 A;  3WP6 A;  2ZMN A;  2QJV A;  3RWN A;  4Y33 A;  2VAU A;  4IER A;  4AE2 A;  4LBM A;  4B1M A;  5CFC C;  1IQA A;  1GQH A;  1KFX L;  1PGW 1;  2VD7 A;  2GU9 A;  3V0B A;  1NE6 A;  1AUY A;  1AXK A;  4S2D A;  4CCO A;  4HSJ A;  1O59 A;  1BZW A;  1R64 A;  1US2 A;  2DVA A;  4M3C A;  4XC9 A;  1AL0 G;  4GH4 A;  3SEE A;  4XDQ A;  4DXT A;  4CDX A;  4WVW A;  3VBS A;  1K45 A;  5F3I A;  4RGA A;  5FZO A;  4AEK A;  2XG3 A;  3WSO A;  2GP3 A;  2JKB A;  2QZ3 A;  2HEV F;  3LEI A;  2FDI A;  2BQP A;  5FP7 A;  4ASL A;  4YLZ A;  1ND2 C;  1F4H A;  3T4V A;  3RZG A;  5F8P A;  1N1S A;  3POB A;  4PDW C;  5IVV A;  2HWF 1;  4JDN A;  1PGW 2;  2QQV A;  3RI8 A;  3LA3 A;  3OGG A;  1DQ4 A;  4A4A A;  5IW0 A;  4E4S A;  4XOG A;  1U12 A;  5FRE A;  2BV4 A;  1R09 1;  1JOD A;  2Q1F A;  3AK0 A;  4FPE A;  4COZ A;  1LEN A;  1JHN A;  4V1P A;  1EV1 3;  4C90 A;  2ZAC A;  1OA3 A;  3NO8 A;  2RDR A;  1UQX A;  2WIN B;  1U0A A;  3CJI A;  1RHI 1;  4D3W A;  4LA3 A;  2W08 A;  3GM8 A;  1VBE 3;  3MLL A;  4LUL A;  4NHM A;  1COV 3;  2HWF 2;  3JZV A;  4GMP 1;  4N9H A;  4TLG A;  1Q56 A;  2GME A;  3THC A;  3HBK A;  3O14 A;  5IVB A;  1R09 2;  1MS4 A;  1IGO A;  4GWJ A;  2BYV E;  2EXH A;  2P37 A;  3C7O A;  2N7G A;  4BU2 A;  1W9W A;  2F4P A;  3HBZ A;  3WW4 A;  2QUO A;  4HKO A;  4MET A;  4EE2 A;  5FRA A;  4M0H A;  2XVL A;  4JTN A;  1RHI 2;  1OA2 A;  5B2G B;  1QXP A;  4CDU B;  1WLT A;  1FI2 A;  1YIP A;  2Y6F A;  2ZEX A;  3LPF A;  4PF1 A;  4I02 A;  3ZFG B;  2XGX A;  3CJX A;  1NCR C;  4TZD A;  3TAY A;  3RS6 A;  4MHR A;  1NXD 1;  4BPZ A;  2Y0O A;  3T1L A;  5FZ0 A;  2ZGO A;  2JDH A;  1F5F A;  3ZLI A;  2IFW A;  4E4H A;  4LUM A;  3UL2 A;  3ZYR A;  1RUF 1;  4PI2 A;  2W91 A;  1VLN A;  3HEI A;  3NJX A;  1QH6 A;  3KV6 A;  1Q3E A;  3NV4 A;  4LXL A;  4XTM A;  5HV4 A;  4CRQ A;  2I45 A;  2JKX A;  3AKR A;  3ZYF A;  1BMV 1;  2FBE A;  2ZAH A;  3SH4 A;  4YM2 A;  2CGP A;  1CES A;  2RHP A;  4IE4 A;  3S57 A;  2HWF 3;  4D6R A;  4PLN A;  4RFR B;  2YG0 A;  1DBN A;  3NKG A;  1SEF A;  4AFD A;  2JE7 A;  4LK7 A;  3MIC A;  4YYO A;  3I7D A;  4IEY A;  1R09 3;  5FZ4 A;  1RUF 2;  4E9K A;  5DUX A;  2QFE A;  1W8N A;  3ELN A;  3LKJ A;  2GAU A;  4YZ4 A;  5F5I A;  3SIS A;  2XPJ A;  1BMV 2;  4EWD A;  4P9I A;  3VBO A;  2WRA A;  1VBB 1;  4EN8 B;  1H9P A;  2PQS A;  3IMM A;  1JZ6 A;  5FLJ A;  4UWD A;  2PAE A;  3PU8 A;  4FXG B;  1ZZ8 A;  3I97 A;  3ZKY A;  3H3Z A;  4GMP 3;  2W95 A;  1U5I A;  3UKN A;  1FNZ A;  3AZX A;  2C9A A;  2JDU A;  3SCG A;  4A41 A;  1VRB A;  2XUE A;  3CO2 A;  1JHJ A;  1OC1 A;  3QH7 A;  5KHH A;  4CA9 A;  3WCR A;  3KV5 A;  4XUP A;  3KT4 A;  4UF0 A;  4ONU A;  1LUL A;  3BOD A;  3TBD A;  2C1F A;  1HX6 A;  2NLR A;  2YFZ A;  2WS9 1;  4Q26 A;  5T5J A;  5BNP B;  1F35 A;  2ZGS A;  3E5Q A;  2VVF A;  5K4L A;  1XE8 A;  1QJE A;  4PCR A;  4AEJ A;  1FV2 A;  4RR3 A;  2FCV A;  5JOY A;  3O1T A;  3D6E A;  4HN1 A;  3AMH A;  3A0K A;  4EYU A;  1SDD B;  1GZW A;  3OG2 A;  1RUO A;  3LEG A;  3SCF A;  1VRH 1;  5H9Q A;  1OSG A;  1RUF 3;  4HET A;  2ERF A;  2FDG A;  2ZX3 A;  2WQ8 A;  3LA7 A;  2WS9 2;  2VGD A;  4FP2 A;  4QX1 A;  3CIH A;  5CKQ A;  2LAL A;  3WQB A;  4DIQ A;  1LR5 A;  1PX3 A;  2ZEY A;  2BTV C;  3W59 A;  5LK5 A;  4MXW B;  3B7M A;  4UFI A;  5F7U A;  1QXR A;  3MFA A;  5FZM A;  1BQP A;  5I0R A;  1PGL 1;  3S5Q A;  2DTW A;  1VRH 2;  5BNP A;  5FZC A;  1MVE A;  3VB9 A;  4FOV A;  4OUM A;  5C3R A;  2VOX A;  4K6B A;  4TN7 A;  3S0M A;  1VBB 3;  2QDR A;  4QX2 A;  3R0R A;  3WOG A;  4P9Y A;  4AWD A;  2Y0I A;  3VZK A;  1UD1 A;  1W8W A;  2JEC A;  5A7N A;  4GWM A;  3AP6 A;  4QGL A;  3RWK X;  1TZO A;  3KHB A;  1MS8 A;  1PGL 2;  5DAX A;  3Q8E A;  2O14 A;  4JGZ C;  1H2L A;  1W9F A;  3T09 A;  5CU1 A;  2GH2 A;  4QQH A;  2MHF A;  2WNV B;  1N1Y A;  4RYD A;  2YXS A;  2YUE A;  2Y6H A;  4QX8 A;  5FMC A;  1VP6 A;  5A6Q A;  3PU3 A;  1LGB A;  4Z07 A;  5LEJ A;  1PM4 A;  5A70 A;  1JW6 A;  5C71 A;  2BPA 2;  2NYY A;  3BPS A;  2VUJ A;  4G3Y C;  2ZBJ A;  2P6H A;  1W9S A;  4Q8L A;  3VBR B;  2AUY A;  4A6S A;  5LA9 A;  3PMS A;  4RHV 3;  2XLF A;  2A6V A;  3HT1 A;  3AYA A;  4UXA A;  1QY4 A;  3VZN A;  5KC6 A;  4UBG A;  1VR3 A;  2BVV A;  2DF7 A;  1BEV 1;  3ZYJ B;  3RYP A;  5JPM B;  1MVQ A;  5LA1 A;  1MS9 A;  5A33 B;  2IXI A;  4ZXE A;  1RXF A;  5FO8 B;  4DUV A;  3VBO C;  1POV 0;  3OOX A;  2ZPX A;  5FV3 A;  4OQ9 A;  1VRH 3;  1W9T A;  1DGR N;  4LK6 A;  3J7H A;  2RJ2 A;  2IWG B;  1VMH A;  2XL9 A;  4XDO A;  4M3C F;  2PN5 A;  2JDM A;  3WW3 A;  1RC6 A;  4Q4V 1;  3III A;  3J8F 3;  3ORJ A;  3Q9O A;  1NCQ B;  3L2H A;  2F4L A;  1XQN A;  1GMM A;  2A71 A;  3OPW A;  1BEV 2;  4IEP A;  5HCB A;  4GJZ A;  3MUZ 1;  1OUS A;  2XLG A;  4EN9 B;  1RUG 1;  4Z82 A;  3GBW A;  1MZE A;  1EP0 A;  4Q0Q A;  5DZE A;  5DPN A;  2ZGR A;  2RG4 A;  5HXM A;  3PHM A;  3IB3 A;  4KWJ A;  2LTN A;  5C3S A;  1HKD A;  3KF5 A;  3NMB A;  5LBC A;  4QPI B;  2DFC A;  1N3Q A;  1X50 A;  3I4I A;  4R9C A;  2ZEZ A;  1YJL A;  1PVC 1;  3I2F A;  3TEX A;  4K20 A;  1GWK A;  3LPG A;  1JBC A;  5GLV A;  2ZGQ A;  2UWB A;  1WA4 A;  4RR3 C;  4LEJ A;  2DFB A;  1QIQ A;  3VUO A;  5K7P A;  4YVW C;  1AYM 1;  1ENX A;  1RUG 2;  3ZSE A;  4ZS2 A;  3E6B A;  2AC1 A;  3ETQ A;  4YW5 A;  3P1I A;  1X8M A;  2TBV A;  4XZP A;  3WNL A;  1R1A 3;  1XBF A;  3ASI A;  5J09 A;  4XFA A;  2GC2 A;  4FSJ A;  3IMN A;  4MLO A;  2XVK A;  3BIE A;  1PVC 2;  2W1W A;  5JAX A;  1W8H A;  3POI A;  4YGC A;  4GB3 1;  4QPG A;  4UFL A;  1HRI 2;  3VDD C;  4O65 A;  3OYW B;  2ZGN A;  1EPW A;  1GWM A;  4JGY A;  1AR7 1;  1H30 A;  5FXZ A;  1AYM 2;  1A8D A;  5F6L B;  3JU9 A;  2P34 A;  4DIN B;  4FOY A;  4FFH A;  1GR3 A;  4NN0 A;  4YVS A;  4E27 A;  2VPV A;  1OQD A;  1BEV 3;  3DYM A;  3B94 A;  1J1T A;  5T50 A;  4XIL A;  5IWF A;  4C1X A;  1U5Z A;  2V73 A;  1LU1 A;  4IV3 B;  4CP9 B;  1VIW B;  3L2Y A;  3U78 A;  2IZW A;  3JB4 C;  3K4A A;  4GB3 2;  3GAL A;  5KHJ A;  2Y6G A;  3H8X A;  1MQT B;  3MW3 A;  1QNY A;  2R04 3;  3C2U A;  4CDW A;  4L8Q A;  2D44 A;  4PQ9 A;  1NQJ A;  4Q4V 3;  2JDP A;  4Z92 B;  2OZ6 A;  5L73 A;  1WBF A;  1K12 A;  4PIZ A;  1WCU A;  5H9S A;  2CU5 A;  4CCC A;  2XH6 A;  1QDO A;  1W6N B;  2P3K A;  1CJD A;  1RMU 1;  2PQQ A;  2P4E A;  3U37 A;  1LHV A;  5BNN B;  2FCU A;  1L7Q A;  4S2F A;  1RUG 3;  2QCS B;  3NKT A;  4GKY A;  4XUN A;  5D1I A;  1CAX A;  2PEL A;  3R6S A;  3VDA A;  5J1X A;  1UWW A;  1RUI 1;  5FJK A;  4Y1Y A;  3RDI A;  2X5I C;  5FR3 A;  5IK8 A;  4P00 B;  2RV9 A;  2HKX A;  4IEO A;  5FY9 A;  3KF3 A;  3M8L A;  5GZF A;  1V00 A;  3ETP A;  1BBT 1;  3CMG A;  3ZSL A;  2DVG A;  2L9L A;  1PO2 1;  2O8Q A;  1UU6 A;  4MAD A;  4CE8 A;  2J1A A;  1RMU 2;  2B45 X;  4MGY E;  4NO4 A;  1AYM 3;  1TNF A;  5JXI A;  3AMM A;  1REE A;  1UXX X;  4JHT A;  5BYN A;  1BXH A;  1K42 A;  4KWL A;  1RUI 2;  1OD3 A;  3IN9 A;  5A3O A;  5F37 A;  2RMU 1;  4PIX A;  1D2Q A;  5J98 B;  4FT8 A;  4YFZ A;  4XFG A;  1Y9Q A;  4QKN A;  4Y1U A;  1GZ9 A;  4AI3 A;  3A23 A;  4L2N A;  3IAQ A;  5BNO B;  1BBT 2;  4GB3 3;  1Z7S 1;  1UZV A;  3LWC A;  1PO2 2;  1YXW A;  3N9M A;  3PVB B;  1AR7 3;  4D7S A;  3AL5 A;  3J9S A;  5I91 A;  3RZL A;  4F3J A;  1WMD A;  4J1X A;  4JDM A;  3VLB B;  3K4Z A;  2QQU A;  1LGC A;  2PHU A;  4HK8 A;  4HZF A;  1Y3T A;  2CAV A;  2RMU 2;  1S0I A;  2P3J A;  1UMI A;  3DCQ A;  3FBY A;  1ENQ A;  4W8J A;  2E26 A;  2JG8 C;  2PAK A;  5L7O A;  1DYP A;  1IG3 A;  3J7N A;  2IXL A;  5I93 A;  1Z7S 2;  1GP6 A;  4HON A;  3GDB A;  1XU2 A;  2WWU A;  1FNY A;  2QQL A;  1V6N A;  1O5U A;  4LO6 B;  4URT A;  3MHZ A;  4WM8 B;  1DQ0 A;  1JS9 A;  4NRM A;  3LDR A;  1H9W A;  3ZYH A;  4QGN A;  4IW3 A;  1DYO A;  3NAP A;  2FDF A;  1XNC A;  5HI0 A;  1RMU 3;  4ZXK A;  5KHK A;  2VBB A;  2VZQ A;  1C5H A;  2IXH A;  4XPV A;  4Y5Z 0;  4M0N A;  2FZ1 A;  3I2G A;  3K2O A;  1ZX5 A;  2VBP A;  3LD8 A;  1HXS 1;  3KQR A;  5FYZ A;  5DZG A;  3AX4 A;  4NOT A;  3FHQ A;  3HN1 A;  4ORF A;  1GNY A;  1GNH A;  4XMI A;  1PZ8 A;  1BBT 3;  1OLM E;  4L11 A;  4Q4X 2;  1OFS A;  1XNK A;  4DS0 A;  2DDU A;  2R07 1;  3H7J A;  2VNG A;  1UKR A;  4IQP A;  1PO2 3;  2DCK A;  2RS3 1;  3ZSM A;  3I3E A;  5JUV A;  3D8C A;  4JTO A;  5FYH A;  3LIG A;  4QDR A;  3ABZ A;  3RJ2 X;  5A32 A;  1ZNP A;  4WM7 A;  2RMU 3;  3UYJ A;  4B29 A;  1HXS 2;  3WNM A;  3JD7 1;  3ITQ A;  5LA2 A;  4CDW C;  3MF6 A;  1WME A;  5CZK A;  2DUP A;  1WD4 A;  1WCS A;  3PUR A;  1Z7S 3;  1OOP C;  2LRP A;  2KR2 A;  2XJR A;  2NPI A;  2GNB A;  2RS3 2;  4COV A;  5J96 B;  4FO9 A;  2OA2 A;  2B46 X;  2G9G A;  2VMC A;  1JTZ X;  1OLM A;  3WUC A;  5ANN A;  4B7K A;  1EUU A;  4N9I A;  4NIA A;  5A6Z A;  4Y1X A;  1HV0 A;  1YRZ A;  1AHS A;  1Z0H A;  3EBR A;  4XF1 A;  4ZHN A;  3AMP A;  2RR1 2;  1ZBE 1;  3KCX A;  3FN9 A;  1J84 A;  3MIG A;  5FZA A;  2ZGP A;  3HIF A;  4OI1 A;  4AFB A;  5C9A B;  4MGS A;  1DLC A;  2PHL A;  4AI8 A;  4MZU A;  1XYN A;  4FAG A;  5FMB A;  1CAW A;  4XBN A;  1ASJ 1;  3I3Q A;  3KV9 A;  2FDH A;  1WLC A;  5FXX A;  1CAU A;  5FCC A;  3WG4 A;  1VMJ A;  1W2U A;  5KC5 A;  5FLI A;  1YJK A;  2ZEW A;  1ZBE 2;  2WDB A;  3QOP A;  3CZJ A;  4QB1 A;  2XWB B;  3WNN A;  4BQ1 A;  1BLZ A;  1GOH A;  1LOE A;  2RS1 1;  2VCA A;  3JQW A;  3OUI A;  2X29 A;  3OBZ A;  4Y22 B;  1ZZ6 A;  1HXS 3;  5FK8 A;  4IND A;  5IT6 A;  2VMF A;  3PJY A;  5DZF A;  4ATE A;  3T2P A;  1XYO A;  5F3G A;  5KHG A;  1DQ5 A;  4NVP A;  2PHX A;  5A3W A;  1IS6 A;  1KGY A;  2R07 3;  3A0N A;  2Q8O A;  1F9K A;  5FFO C;  3WNP A;  4EN7 B;  3BTZ A;  5FPL A;  4JV4 A;  5F3C A;  1ENS A;  1W2O A;  3MV0 1;  5T55 A;  3ST7 A;  4CVU A;  5FTT C;  3I8T A;  3HMY A;  4N8M A;  1QH7 A;  4LKS A;  4OUE A;  2E51 A;  1UY0 A;  2RS1 2;  5GKA C;  3UT0 A;  4CEY B;  4CU7 A;  3RZM A;  4NE9 A;  2ATF A;  1LCL A;  3JD7 3;  3WDY A;  1W90 A;  2W87 A;  2ZZQ A;  1FOD 1;  3FWE A;  2YBS A;  4XQD A;  1ODN A;  3T2T A;  4QD2 A;  5GLT A;  4OHZ A;  3ROU A;  4Q2F A;  3I2I A;  4BQY A;  1PK6 A;  4U36 A;  1RUE 1;  2VTF A;  1UYP A;  4QHO A;  1JYN A;  1C4R A;  4QWN A;  4XQ4 A;  2Z2S B;  3THP A;  3FHA A;  4Q4Y 3;  1T6B X;  2FHR A;  2D6P A;  4FP3 A;  4GKX A;  4RD7 A;  4RS5 A;  4CUA A;  1RUD 1;  5DAP A;  1ZBE 3;  5GZD A;  2BRT A;  4FFG A;  3VBU B;  5JXG A;  1RGS A;  3ES4 A;  1FOD 2;  1EUT A;  4GAZ A;  2YPD A;  1AR6 1;  2AEZ A;  1LES A;  2CTV A;  3H42 B;  1C8N A;  1E5R A;  2VUL A;  3B3Q E;  4A2U A;  2D97 A;  2J22 A;  2IXC A;  1ASJ 3;  4CEY A;  4IGQ A;  1HQL A;  1RUE 2;  5HXV A;  4M4P A;  2YV8 A;  3M3C A;  3VKM A;  4WM7 C;  3WNO A;  4LHK A;  2ZKN A;  4PDW B;  1JH5 A;  5E88 A;  4QMA A;  1RUD 2;  1LEC A;  2VMH A;  3J7L A;  1OPM A;  3B00 A;  2D7F A;  4DRV A;  3VBF A;  5GZG A;  4QKB A;  2RS1 3;  4N53 B;  1AR6 2;  5LAS A;  2WAO A;  1APN A;  4XJ8 A;  1W6Q B;  1ULP A;  1LEM A;  2A6Z A;  2VW2 A;  3N7M A;  3A7Q A;  4X6Q B;  2QVS B;  1LHN A;  2D6K A;  4AHZ A;  2F17 A;  5CFC A;  2DV9 A;  1PO1 3;  3GCX A;  3E1F 1;  3TNQ A;  3UKT A;  2VZ3 A;  5ISL A;  2TNF A;  4NWW A;  5FYS A;  4FPL A;  4PJY A;  5JVV A;  3VN4 A;  3CEW A;  1LKN A;  4N7I A;  3PIG A;  4XEZ A;  3BB6 A;  3BVC A;  2Z5W A;  2Z69 A;  3OGJ A;  5A6X A;  1I6X A;  1ND2 A;  5JLV A;  1QJY 1;  3DPR B;  5HCA A;  1PIV 1;  1H1I A;  4QQP A;  1W0P A;  2YGL A;  1LOF A;  3BYW A;  4UBH A;  3GYD A;  5IFT A;  3I3B A;  4MX3 A;  4UW4 A;  2RJL A;  3AYE A;  4FXK B;  4MXV A;  3CZU A;  4FBF A;  5IAX A;  4V2V A;  1RUE 3;  2G9Z A;  1UIK A;  3DGT A;  2DBN A;  1NCR B;  4QQ2 A;  4ZS3 A;  1NUK A;  1RUD 3;  4NPR A;  4FI9 A;  1H1M A;  5C4W B;  1W2T A;  2RJK A;  1QJY 2;  3ZXD A;  5DAQ A;  1PIV 2;  5F1R A;  1AR6 3;  1MZ6 A;  2UUR A;  1GV9 A;  1L7R A;  1AJK A;  1LU2 A;  2DU1 A;  2O0O A;  2WLQ A;  4MV2 A;  4W6W A;  4ZON A;  2W92 A;  1GZT A;  3AKS A;  1UZ0 A;  3T08 A;  2WA3 A;  2EXI A;  1S4C A;  1GOF A;  1WUV A;  5CNA A;  2VY0 A;  4I09 A;  5EJ1 B;  5CFD B;  3SQO A;  1F31 A;  3HVD A;  2VCB A;  1UZW A;  5CBL A;  2XLA A;  1MEC 2;  1QNW A;  2Q4S A;  2OPK A;  2XML A;  1C3H A;  3H3U A;  1KD7 A;  4J25 A;  4QU1 A;  1NOV A;  2QQO A;  4PBO A;  4HK9 A;  1XB9 A;  2A1X A;  2R30 A;  2XVG A;  3NV3 A;  4P5Y A;  1SCR A;  1NT0 A;  3RMX A;  5FYI A;  4UFJ A;  4U2A A;  3H50 A;  2BOJ A;  4DNY A;  2J1T A;  4OCT A;  1PK6 C;  2IFR A;  4N7U A;  4UFM A;  4AVT A;  1QJX 1;  2PHR A;  3BTA A;  4KGQ A;  1IS4 A;  1A78 A;  1W0O A;  4RA0 A;  1V9U 3;  1P8J A;  3V0B B;  2WZR 1;  5JMC A;  5E16 A;  1URX A;  2ZX0 A;  3FLR A;  3HOB A;  3MI8 A;  1WZX A;  2MEV 1;  4M3C B;  4GH4 B;  3B01 A;  4JHZ A;  4CDX B;  5JIA A;  4XXA A;  4V2W A;  5FZO B;  4RN5 A;  4Q1R A;  1XNT A;  3NNM A;  1QJY 3;  1IS5 A;  1QJX 2;  1PIV 3;  1U5Y A;  1W8Z A;  4XAA A;  5FYM A;  1SLA A;  2JXA A;  4Z2W A;  2EAK A;  1YO8 A;  2BEO A;  5KHI A;  4HVR A;  3WR0 A;  1YCI A;  4XHB A;  5ABJ A;  3OPZ A;  3WZ1 A;  2NMN A;  3UK9 A;  3VBF C;  1WCD J;  3ECQ A;  1OUX A;  2MEV 2;  4TSV A;  4OI0 A;  2G19 A;  5GAL A;  4GA9 A;  2QDN A;  4BIS A;  2W1S A;  3ACI A;  4SLI A;  3ZYP A;  4JVA A;  1W04 A;  5EXO A;  1FV3 A;  1O4Y A;  1S0F A;  2JIC A;  3NWK A;  2Q8C A;  2X8K A;  1DDL A;  3CJI B;  2VG9 A;  2YFU A;  3OGR A;  3ZYB A;  2WO3 A;  4MGZ E;  2VVE A;  2DYC A;  2I07 B;  5C3Q A;  2BW8 A;  3JBG 1;  2JIJ A;  4QX5 A;  3CNA A;  3H7Y A;  4QX0 A;  3VV1 A;  4OQ8 A;  3I3M A;  4I3P A;  1DGW X;  1SAC A;  1LOD A;  2Q30 A;  1S0D A;  5EIY B;  4BB3 A;  4CPB A;  2PLV 1;  3W21 A;  2VJX A;  3WY6 A;  4A45 A;  4KG0 A;  2WJS A;  2WLP A;  2LW8 A;  2XDV A;  5T54 A;  1LOF C;  3PVE A;  3N36 A;  4OVE A;  3JBG 2;  4XHX A;  2QQN A;  3BOW A;  2NQY A;  3OPT A;  1VBA 1;  2E9Q A;  2CHH A;  3Q8F A;  4IEZ A;  2ZHL A;  4DB5 A;  5FO9 B;  4EWE A;  1QJX 3;  5CEH A;  3PTY A;  2BER A;  4MGQ A;  2ID4 A;  2HBU A;  2PYT A;  4PQQ A;  2PLV 2;  2DUR A;  4GZ9 A;  3P6B A;  3NNL A;  2WZR 3;  2GMP A;  3POF A;  2XB6 C;  4KWU A;  5CVR A;  3E97 A;  4JGZ B;  1XSR A;  3BTX A;  3QCW A;  2MEV 3;  2ZGL A;  2E33 A;  2FD8 A;  1KRI A;  1VBA 2;  5FP4 A;  5K0U A;  2ETE A;  1W8U A;  2A70 A;  2ES3 A;  4LA2 A;  3ZOI A;  2W5F A;  4NHY A;  3BTY A;  1BK1 A;  3N9P A;  3C7E A;  4JQR A;  1O8P A;  2VH9 A;  4UFH A;  5F6K A;  3H8R A;  1MZF A;  2OT7 A;  2Y6L A;  4K40 A;  3POE A;  1RIN A;  3KVB A;  5G04 L;  4Z8B A;  1AR8 1;  3BPZ A;  5DUU A;  1ACC A;  4HFS A;  3PTR B;  4K21 A;  2ET1 A;  1ALY A;  2Q1M A;  1OQE A;  1SQ4 A;  4MGI E;  3T0B A;  3VBO B;  1LTE A;  1W03 A;  4BDV B;  3B9I A;  3CLP A;  1J3P A;  2VBD A;  3DN7 A;  3J4U H;  4LHL A;  3JBG 3;  5KXD A;  1FXZ A;  3MDP A;  3OUJ A;  1QOO A;  4JGZ A;  1B35 C;  2JDZ A;  2D5F A;  3AZV A;  4XMA A;  1TME 2;  1AR9 2;  1OLR A;  1PX4 A;  3GF6 A;  3NRU A;  4LKE A;  2DBI A;  4XDP A;  3MZH A;  1E57 A;  2C26 A;  3OTF A;  1AR8 2;  5FAX A;  1PMI A;  3WF4 A;  5C7G A;  2VXR A;  2VMI A;  3AP7 A;  4OZO A;  2PLV 3;  4QB2 A;  4AGG A;  3OD4 A;  4HL0 A;  2Y26 A;  1PMJ X;  4UF0 B;  1YQ6 A;  4XF4 A;  1OMI A;  4FTS A;  2ZGT A;  4P9L A;  4M00 A;  3D82 A;  1UKG A;  1G9D A;  5ABJ C;  5J37 A;  1VBA 3;  2EVX A;  2I2S A;  2XBO 2;  4N43 A;  5GLW A;  1W05 A;  4ZU5 A;  3EXU A;  3NNG A;  4QKD A;  5F5C A;  1YC6 1;  1RHI 3;  2WAB A;  4RR3 B;  2YPJ A;  3RYK A;  4WBB A;  5I0D A;  3IT8 A;  1GZW B;  3HPN A;  4XZU G;  3W9A A;  3WHU A;  3U1X A;  2H6C A;  1M4W A;  5A1A A;  2VE1 A;  2FMD A;  4RQP C;  3EQE A;  2VQ0 A;  1S2B A;  3O0V A;  4I30 A;  1YFX A;  3HNY M;  4A7K A;  2RM2 2;  2SLI A;  4AG4 A;  4YM3 A;  2J1R A;  4CCN A;  2WO2 A;  1OI6 A;  2WT1 A;  2XJS A;  3WQ1 A;  4C0H A;  3AZY A;  4NHL A;  1NZI A;  2VCM A;  4RL7 A;  2B7Y A;  3RPQ A;  1XRU A;  3B5L B;  5JCT A;  1QOT A;  4K3U A;  3MYX A;  1EYB A;  3WP4 A;  3ZXA C;  4AK3 A;  1SPP A;  3WNX A;  5FPA A;  3ZXF A;  2ADE A;  1AR8 3;  4PBP A;  2GN3 A;  1ZYB A;  2A73 B;  1GYK A;  3WDU A;  3FUQ A;  3OJB A;  1JZ2 A;  1YIF A;  1KS5 A;  1UY3 A;  2MNG A;  2A3W A;  1ULC A;  1JUI A;  2JX9 A;  2VMG A;  2VW0 A;  3FMG A;  5DDJ 1;  4YVW A;  2ORX A;  5FZ6 A;  3WF1 A;  4XJ9 A;  4JRL A;  2D40 A;  2W2I A;  2JEM A;  1W6P A;  1JYV A;  2E32 A;  5CKM A;  4C1W A;  3ZDV A;  3IAP A;  5EFU A;  4H14 A;  1B09 A;  5K0U C;  3WQ7 A;  3E6C C;  2C6S A;  1DZQ A;  2K46 A;  3VDD A;  3VL9 A;  2GC3 A;  5FJH A;  1NLQ A;  2DUO A;  4BOW A;  5DDJ 2;  2HWC 1;  2PHF A;  5F39 A;  3ZIW A;  1F5J A;  4NPL A;  3B93 A;  1L3J A;  4QXC A;  4A3X A;  2XQR A;  5A3N A;  3UJO A;  4DXZ A;  3O7O A;  2VTX J;  4AHX A;  1PHM A;  2HWE 1;  5F5Q A;  1FMD 1;  3CQO A;  4AQS A;  4OUL A;  2XKO A;  4BIO A;  4B1L A;  4YGE A;  4Q0U A;  2LS6 A;  4P9X A;  1H2K A;  3LEK A;  2HWC 2;  4BQ4 A;  3ILF A;  5C8W A;  4JC1 A;  2CWM A;  1H0B A;  4WVM A;  4LUK A;  1O3Q A;  3I3D A;  3U4X A;  1S0B A;  4LTA A;  1Q8Q A;  3DYP A;  5DG2 A;  4FFF A;  2GC0 A;  5F2W A;  4CCD A;  5LY1 A;  1H1A A;  4LBO A;  3N7J A;  2HWE 2;  4Y24 A;  1FMD 2;  1OVS A;  3U0Z A;  1W99 A;  4AI1 A;  2GND A;  2PMW B;  2X5I A;  4AGR A;  5LEK A;  2WS9 3;  5IHR A;  3RZJ A;  1H6X A;  1PNG A;  3WDX A;  2OZJ A;  4COY A;  4I3G A;  4KL1 A;  4N43 C;  2ZGK A;  1C8M 2;  2ZX2 A;  4O9E A;  3T1M A;  2W39 A;  1Y7B A;  2WUH A;  5DAB A;  4AI0 A;  2WN2 A;  1ULE A;  2JD4 A;  3RMY A;  5DDJ 3;  3MPP G;  3U07 A;  3BUC A;  5CYY A;  2OII A;  5BXX A;  1XYP A;  3T30 A;  2BBV A;  1UPI A;  5AC9 1;  4YW1 A;  1YQ2 A;  3NJY A;  2VOT A;  3LOI A;  5KBF A;  5FXW A;  4R52 A;  4QGM A;  1ZRC A;  3MID A;  4CDU C;  5FDB A;  2IUW A;  5FPV A;  3P5B A;  3FC0 A;  4LE4 A;  2VW1 A;  2ZAA A;  3ZFF C;  4QPG B;  3LCP A;  3ZFG C;  3AP4 A;  2HWC 3;  3LFM A;  4LE3 A;  3PUQ A;  3HQR A;  3FHI B;  3LF7 A;  3O0W A;  4JGY B;  4AF9 A;  4URA A;  3BCW A;  4GWN A;  5AC9 2;  1E5I A;  1R08 1;  2P1B A;  2ZTN A;  3URF A;  3VDB A;  4Y5T A;  4YVS B;  1UNB A;  1HQN A;  4LBN A;  2HWE 3;  2AEY A;  2JG8 A;  2ILM A;  3NV1 A;  5FPB A;  2DCJ A;  4Q27 A;  5FUI A;  2XUM A;  3USU A;  1HRI 1;  4CPB D;  4TTG A;  2QQP A;  1YQ5 A;  2G9F A;  1CX1 A;  4IE7 A;  2FDK A;  4I0W B;  3PIJ A;  4JQT A;  3SEP A;  4KH9 A;  4AVA A;  3WIN E;  3D5O A;  1OKO A;  4NAM A;  4AXO A;  1H6Y A;  2VNR A;  4KGG A;  4HVQ A;  5HBA A;  5L19 A;  4QPY A;  3A22 A;  4CDW B;  1R08 2;  4XAC A;  5FYY A;  3ZN6 A;  2E7A A;  5ACA 2;  1GAN A;  2J1V A;  1YFW A;  5C8C A;  2XHK A;  3WDV A;  2JD9 A;  2WFP A;  1GNZ A;  3OEA A;  1BYH A;  1WCK A;  1CAX B;  4BYY A;  1SFP A;  1H8T C;  5FZF A;  1Q43 A;  3VHN A;  3RZK A;  2O1Q A;  2P3I A;  4KQ7 A;  4DO0 A;  4GQ7 A;  4MYE A;  5AVP A;  3A21 A;  3EJK A;  3D3A A;  5LBF A;  5TSW A;  1F15 A;  5CB7 A;  3UJQ A;  5A3P A;  1XE7 A;  4OMD A;  3BI3 A;  1R1Z A;  1YFU A;  4JKK A;  4XIK A;  5KXB A;  3EB7 A;  4OHY A;  2GC1 A;  4E8D A;  1OKQ A;  5AC9 3;  5FWJ A;  1JI6 A;  4BIF A;  2GZW A;  4WV8 A;  2VC9 A;  2PA7 A;  2Z42 A;  3D4K A;  3R05 A;  3W5N A;  3CKH A;  3S7I A;  3NW4 A;  1IQD C;  1PGS A;  1X8E A;  2C0Z A;  2ZX1 A;  1OOP A;  3OD0 A;  4BM8 A;  2XXZ A;  4Y1Z A;  2HH9 A;  4ZU7 A;  3MLJ A;  3W5M A;  4EJR A;  1JZ8 A;  3TN9 1;  3IM0 A;  1RUJ 1;  3SH5 A;  4MUV A;  4HOO A;  1MAC A;  5AVA A;  4MGK E;  5FYT A;  1MS5 A;  4XYX A;  1A3K A;  3VD4 A;  1R08 3;  2RS5 1;  1NLS A;  1Q5O A;  4YZ3 A;  1A34 A;  2WA4 A;  1VAV A;  4FPO B;  4CSW A;  5BV6 A;  4H7M A;  1PVC 3;  5CA6 A;  2EXJ A;  3NJV A;  1SBE A;  2PFW A;  2ARB A;  3RG0 A;  1SLL A;  1UZZ A;  1HRI 3;  1DP0 A;  1X33 A;  3KMH A;  4CP0 A;  5L7O B;  4RGG A;  3TN9 2;  1O5L A;  1WD3 A;  4CU8 A;  1RUJ 2;  3R4S A;  4MH0 E;  4D6Q A;  4D7T A;  5FXV A;  3WEZ A;  4JZR A;  3OBA A;  1RUC 1;  4HLT A;  4FQZ A;  2RS5 2;  4GUL A;  5LAT A;  2QE3 A;  2VQA A;  1W6O A;  3IBM A;  4QKF A;  3NAP B;  2RDQ A;  4Q4W 1;  1G9B A;  1VAM A;  2BVB A;  1VPH A;  1GBG A;  2AEN A;  3PDQ A;  2WBK A;  3ACH A;  1W6M A;  1N1V A;  1E5S A;  3UV9 A;  3WG3 A;  5C5U A;  3VD3 A;  5KWR A;  2C4X A;  2OXB A;  3E5U A;  2GDF A;  5EP9 A;  5E89 A;  5IK5 A;  5AFE A;  4W50 A;  3VKN A;  1RUC 2;  1UX6 A;  2PHT A;  3PUA A;  3TYJ A;  1XNB A;  4J1W A;  4NMI A;  4XUQ A;  3ZKU A;  1SCS A;  2YC2 A;  5A3M A;  1XC6 A;  4Q4W 2;  5GJ6 A;  4FQ4 A;  2YB7 A;  5FUN A;  4X8P A;  3I59 A;  4XF9 A;  4QHB A;  5FZD A;  4B3N A;  1JYT A;  2NMO A;  1D0H A;  2DVB A;  3EO6 A;  5A32 B;  2OVU A;  1K5J A;  1G9C A;  4IEW A;  4R8H A;  4FVV A;  2V4V A;  4WM7 B;  2WSU A;  4Y1V A;  1UOB A;  1SLC A;  4Q4X 1;  3VBH A;  2QKD A;  5SV8 A;  1ZRD A;  2EA7 A;  3ZMO A;  3TN9 3;  1DYK A;  4LHS A;  2W47 A;  2E7T A;  1DQ2 A;  2BJS A;  4ITC A;  5FYB A;  5C8C C;  3S5A A;  4AED A;  1RUI 3;  1ZBA 2;  4LOR A;  4LO7 A;  2RS5 3;  1IPK A;  4GIQ A;  4OYU A;  3UNP A;  1QQP 1;  3O1R A;  4UAP A;  2IVJ A;  4FFI A;  5FY8 A;  5LRS A;  1N1T A;  4R9B A;  4WVV A;  3GBG A;  4BME A;  5I0S A;  2KM2 A;  1FPN 2;  1A8M A;  1ULG A;  5JIU A;  4GD4 A;  5JXH A;  3UES A;  2ZKL A;  1W3X A;  1NCQ C;  1WKY A;  1CAW B;  2JG9 C;  2R7E B;  4OI2 A;  1DGL A;  5EQU A;  3ZYG A;  5JZG A;  2R32 A;  4OUS A;  1RUC 3;  4IE5 A;  5LCW L;  1YWK A;  1CAU B;  1HB2 A;  1QQP 2;  1UL9 A;  2RR1 1;  3DV8 A;  4HSL A;  5JXJ A;  2R1B A;  3PNA A;  4Q4W 3;  4AHY A;  5FZ9 A;  1LHW A;  4XF0 A;  2V72 A;  5H9R A;  4HKW A;  3THT A;  4YG6 A;  4KU7 A;  2YC4 A;  2WQ4 A;  3AFG A;  3V64 A;  4AI2 A;  4QM9 A;  4LBL A;  3GZT B;  1NA1 A;  3UET A;  3ME2 A;  3I49 A;  1NKG A;  1S0G A;  4BZ4 A;  1NLR A;  5LWB A;  3TEZ A;  2K0G A;  2E53 A;  4F7Z A;  2Q5T A;  3GXU A;  4HPK A;  4QQO A;  4D8M A;  3OUH A;  3ZR6 A;  4E4Z A;  1Y43 B;  1QGL A;  4JX0 A;  1ZZC A;  3ZXJ A;  3SC7 X;  5LBB A;  5I0U A;  5JWP A;  3AMQ A;  3N9O A;  3POG A;  4MO3 M;  1I1E A;  3A4U A;  4BQX A;  1OF3 A;  4AEM A;  3AP5 A;  1KXG A;  5A3U A;  1DU3 D;  1JZ7 A;  4Q4X 3;  1WMF A;  1KJL A;  1ZRE A;  3OY8 A;  2VL4 A;  5DAW A;  5JOZ A;  2RE9 A;  5FY5 A;  2BZD A;  3I2K A;  2EIB A;  3SNM A;  2FDJ A;  4NJ4 A;  1PK6 B;  1O3T A;  2B39 A;  5JOW A;  1DZR A;  1QQP 3;  3HWJ A;  4I0A A;  1IPJ A;  4PI0 A;  5IVC A;  1US3 A;  2NP0 A;  5HPO A;  5DUW A;  5FZ3 A;  2LM3 A;  4ASM B;  3K46 A;  3MW4 A;  1WBL A;  4GWI A;  4RS5 B;  4YM1 A;  5L9B A;  2V09 A;  1POV 1;  4WVZ A;  4GMP 0;  4BQ3 A;  4CU9 A;  2YDE A;  2UY9 A;  2RS3 3;  2YC0 A;  2A3Y A;  5LB6 A;  3ES1 A;  3F2Z A;  2V5D A;  1YEW A;  4NHK A;  3U14 A;  2YBP A;  3PVN A;  2OQ6 A;  4UI9 L;  3WVJ A;  1ZA4 A;  4IXL A;  3TOJ A;  1TVG A;  2RVA A;  1ND3 A;  2Q8D A;  4HT1 T;  1C28 A;  4BHP A;  3LGR A;  1I5Z A;  2ARA A;  2RR1 3;  3WQ0 A;  2Y60 A;  1JYW A;  3DL3 A;  3LAG A;  2NM1 A;  2YY1 A;  3CBN A;  4UYB A;  3IDB B;  2WT2 A;  1W8O A;  5I0T A;  3W58 A;  2YBK A;  3VBH C;  3M4F A;  4DRR A;  1PZ9 A;  4LKD A;  4NWV A;  3LDK A;  4UOJ A;  3VGI A;  5EV7 A;  1AL2 1;  3ACF A;  5EYY A;  3CU7 A;  3VBF B;  4M4R A;  5GZC A;  1H4H A;  3JUU A;  4S2H A;  3T0A A;  4XFB A;  4OI4 A;  5EJZ B;  2ARE A;  2LUW A;  4AED C;  5C33 A;  5BNQ A;  5FYU A;  3W20 A;  5CG9 A;  3C7G A;  2XON A;  5F32 A;  4XFC A;  3AVR A;  5CFC B;  2DUQ A;  2OPW A;  3V0A A;  1GUI A;  2XKP A;  2FZ2 A;  3WT3 A;  2A6W A;  1OBN A;  2VZV A;  1OH3 A;  5CIS A;  4M01 A;  3KLS A;  4QAW A;  2ZZJ A;  1I9R A;  5C70 A;  1AL2 2;  4E2S A;  2OYZ A;  4D6S A;  2VZU A;  2J7M A;  2G4I A;  4A3Z A;  2H0V A;  5BNO C;  5JZG C;  4UT5 A;  5D8A A;  5DG1 A;  1UYY A;  1J83 A;  5L36 A;  1ND2 B;  4Y3O A;  1LNS A;  4Q29 A;  2D3P A;  4X6R B;  4IV1 A;  4YG0 A;  2PHW A;  2WWS A;  3JQX A;  1OA4 A;  3N7K A;  4IDZ A;  1UIJ A;  3JXS A;  1PNF A;  4NRO A;  5F2S A;  3VKL A;  1C5I A;  1AYN 2;  1OT5 A;  2DCT A;  2CV6 A;  3T2Q A;  5IVJ A;  1J59 A;  1JYI A;  1DF0 A;  1NQD A;  5L9V A;  2B42 B;  1CIY A;  3HJR A;  2XWJ B;  5JMO A;  4AFC A;  1NA1 C;  4W6X A;  3KCC A;  3UGF A;  4AW7 A;  4P02 B;  4R9D A;  3O1U A;  1POV 3;  2WNE A;  4YW7 A;  2Y64 A;  5DQ0 A;  1JZ5 A;  1AXZ A;  1F8V A;  4WM8 C;  1RUN A;  3IPV A;  3Q8A A;  1N47 A;  4ET7 A;  1QJU 1;  2VCC A;  4D7Y A;  2A3X A;  4CEW A;  4IES A;  4QQL A;  5FY7 A;  3WCS A;  4AVS A;  1W2N A;  4CCJ A;  3WXP A;  2DTY A;  5T5L A;  1LED A;  3OGS A;  1FOD 3;  1KDM A;  2VZO A;  3IDC B;  1XXN A;  3PUI A;  1CZV A;  2GMM A;  3LSD A;  1CAV A;  1DHK B;  3QAC A;  1IHM A;  3BU7 A;  4IGO A;  4QHZ A;  4CYD A;  1AL2 3;  3HR9 A;  4TWT A;  3JCI A;  4IE6 A;  1GZC A;  4YGD A;  4CU6 A;  1YYN A;  4ES9 A;  4XUT A;  5JR2 A;  3WDT A;  1QJU 2;  5FOB B;  2VUA A;  2VZS A;  1I3H A;  1SLT A;  1MEC 1;  2JJ6 A;  3VZO A;  4CDQ A;  1SFY A;  5EJ3 A;  4ARY A;  1RXG A;  3DEC A;  4Y4R A;  5FPU A;  1JU4 A;  4OHX A;  3AMN A;  3AXD A;  5JR7 B;  4JAA A;  2XHN A;  5IK4 A;  3H0O A;  4DUX A;  2Y6J A;  1DLL A;  1O4Z A;  4JDO A;  4CZS A;  4LMF A;  1REF A;  3B02 A;  1OHF A;  1DGR A;  2BU9 A;  1IKQ A;  1W3V A;  4NPM A;  2WZP P;  1DGW A;  5IYY A;  4OFG A;  3ZIX A;  4DEV A;  1ND3 C;  4FOQ A;  5IK7 A;  3QLQ A;  4ERO A;  1C1L A;  3X29 B;  1UOJ A;  4AVC A;  1D0G A;  4XJZ A;  5IVF A;  5DXD A;  5ABJ B;  5FZ7 A;  3OCP A;  4ASK A;  4CUG A;  4E2Q A;  1RL3 A;  3KD4 A;  5CKN A;  4NR1 A;  4LLO A;  1NX9 A;  2OKX A;  4BE3 A;  2QQW A;  3KGL A;  1WW5 A;  2WWJ A;  2VNV A;  5GLZ A;  5JSO A;  2ZJC A;  2WNU A;  1MS0 A;  2NZ9 A;  1V6K A;  2WFF 1;  3SCH A;  3E5X A;  1S2K A;  1X82 A;  1B35 A;  4DOU A;  3LZZ A;  2G1M A;  2WAA A;  3RRD A;  1FX5 A;  4UW6 A;  1VJ2 A;  3GZE A;  1WW7 A;  1OUR A;  3M70 A;  4AAX A;  4BJ0 A;  2BWC A;  2UYB A;  2XJV A;  4FPY A;  5T52 A;  4LBQ A;  5T3N A;  3VZM A;  2CAU A;  2QQI A;  3VKF C;  1OFN A;  3M2M A;  2GNM A;  4C8D A;  4Q0S A;  5D8A C;  5FKB A;  2VR4 A;  4BK4 A;  5KXE A;  3WHT A;  1EY2 A;  2WFF 2;  3RGB A;  4KBZ A;  4E8C A;  5J36 A;  5FQ0 A;  2BDR A;  2WKK A;  2ZA9 A;  2DCY A;  4IV1 C;  1LB2 A;  2HLE A;  4Y20 A;  1TEI A;  2VOW A;  4MOA A;  2CNA A;  3H8O A;  1G86 A;  1ULO A;  4P14 A;  1WW4 A;  4YZ1 A;  3U10 A;  4NRP A;  3KT1 A;  2WT0 A;  1MEC 3;  2VUC A;  3KWV A;  2ZGU A;  5FMO S;  1QOS A;  1TNR A;  1AX2 A;  3HT2 A;  3DF0 A;  1V6M A;  1S1A A;  4AYU A;  1DZT A;  2QBX A;  2V5Y A;  3G7D A;  2X53 S;  1VAK A;  2VZ1 A;  1NAE A;  2TEP A;  3H1M A;  5APA A;  1HIX A;  2HWD 1;  4RQP A;  2JB4 A;  1XND A;  2UWA A;  3WF0 A;  1JYX A;  2D98 A;  5FK7 A;  1LOG A;  3WF3 A;  4AOC A;  4I2O A;  1NYW A;  1T6G C;  1VBE 2;  3OF1 A;  4YW3 A;  4AFA A;  1ZVF A;  4LLF A;  4CEW C;  5K0U B;  1PM7 A;  1Y9G A;  1U5X A;  4LO4 B;  3RZZ A;  3FLP A;  1PMH X;  3N35 A;  2BNM A;  3LE0 A;  4CXX A;  4Q1P A;  2Y34 A;  4LJH A;  1OD5 A;  2B5H A;  1D4V B;  1AXY A;  2HWD 2;  5GM0 A;  1HQW A;  3VBU C;  4AQT A;  3AJZ A;  2BBA A;  2ARC A;  3HQU A;  1G7Y A;  3LFI A;  1KDK A;  1JOJ A;  5KR7 A;  1K5M C;  3NL1 A;  4LOS A;  2JE9 A;  2WFF 3;  4ZU4 A;  4DXR A;  1JYC A;  1V6O A;  2B4K A;  2WII B;  2F6B A;  2HJI A;  4K8R B;  4CDQ C;  1YI7 A;  3IKW A;  4Z2A A;  2WC2 A;  1JMU B;  5LA0 A;  4PIY A;  1RTV A;  3BGA A;  2B9U A;  1MPX A;  2J42 A;  3ZFE A;  1BVP 1;  2D6L X;  1XU1 A;  3NNJ A;  3FE5 A;  4HN0 A;  1N3O A;  1TE1 B;  3F95 A;  4N53 C;  2ET7 A;  3G6J B;  5F3E A;  1CWP A;  5IJR A;  4FCA A;  1JN2 P;  2GAL A;  1TME 1;  1AR9 1;  2H0B A;  4XVH A;  3V65 A;  3SXW A;  2CYF A;  3ZR5 A;  3WG2 A;  4B7E A;  3DKW A;  1UW8 A;  1HW5 A;  2ZHN A;  3I2D A;  4K1Z A;  4N43 B;  5L9R A;  4AVB A;  3IDE A;  4XTP A;  2E31 A;  1SBF A;  2CY6 A;  2ORZ A;  4QT6 A;  3KM5 A;  3EMR A;  4L0P A;  1RVF 1;  1SHW B;  3T0D A;  1KEX A;  2WNU C;  2VXJ A;  4LR4 A;  1CD3 G;  3UGH A;  3RI9 A;  1W0N A;  1UMZ A;  4OHW A;  2YHJ A;  3WW1 A;  1O8S A;  4GAL A;  2HWD 3;  5F9T A;  5JPN B;  1GLH A;  2XBO 1;  4HMZ A;  1DCS A;  3KQ4 B;  3DPR C;  1WMX A;  3LEM A;  4D94 A;  3KZ4 C;  3ZN5 A;  4LIU A;  4FTB A;  3SLI A;  4MVT A;  1GP5 A;  3ZFF B;  3AP9 A;  5FIX A;  1RVF 2;  3N9Q A;  2QNK A;  2VME A;  3I2H A;  2CGO A;  4CUB A;  4K9S A;  2VU9 A;  2AAC A;  2HEY F;  4D0Q A;  5A80 A;  4B4R A;  1SPP B;  2NN8 A;  4XET A;  3VZL A;  2RM2 1;  5C4W C;  1ZRI A;  3O1M A;  5FZK A;  3CF6 E;  1UY2 A;  5EWS A;  4HBN A;  4AVV A;  2A6X A;  4JKM A;  4AZZ A;  4EQV A;  3OB8 A;  5KXC A;  4H55 A;  1XNA A;  3MPB A;  4YVW B;  5FZL A;  4YPJ A;  3VD9 A;  1F2N A;  4D69 A;  1VE0 A;  2D6O X;  2P2K A;  3ENR A;  1WGP A;  5CFD C;  2PAM A;  1G9A A;  5I8T A;  3TEW A;  1CON A;  2KA3 A;  1W6P B;  4ATF A;  4DEQ A;  2R06 1;  3K4D A;  2KD7 A;  2ZHK A;  4PLO A;  3MIH A;  1SZB A;  4CDU A;  1YUD A;  4DPN A;  4BQ5 A;  3ZFF A;  5G05 L;  1O7F A;  3ZFG A;  1CPN A;  3H1W A;  3KV4 A;  1QHD A;  3VDD B;  4IEU A;  4EZH A;  3BAL A;  3C7F A;  3O1V A;  4IGP A;  1H8T B;  1TME 3;  1S55 A;  1AR9 3;  4ZPI A;  3GHN A;  3SIT A;  4A7Z A;  1CIW A;  5T5O A;  1WCQ A;  5ERL A;  1WA6 X;  2CDP A;  3GGL A;  1QDC A;  3ZX7 A;  2EIC A;  2VMD A;  1DQ6 A;  1RED A;  2R06 2;  4B8E A;  3ZO0 B;  1RIT A;  1RVF 3;  2DVD A;  5FPZ A;  3H1Y A;  3DKQ A;  3GJB A;  1TQ5 A;  5FOJ B;  4GH4 C;  4HAN A;  1D7P M;  4AFM A;  1EAH 1;  4CDX C;  4ARX A;  2XBO 3;  4Y5S A;  2UWC A;  3VBS C;  2WO1 A;  4W4Z A;  1IG0 A;  3AVS A;  1VBB 2;  3CDZ B;  4YWA A;  4WVM B;  5IUQ A;  4DUW A;  5A1F A;  1UCX A;  4FPG A;  2OW4 A;  2P6C A;  3ZFE C;  1WLD A;  4GXL A;  5FPX A;  1SG3 A;  3WUD A;  3O1O A;  4RHV 1;  1IS3 A;  2BNO A;  1E5H A;  2X05 A;  1H8T A;  2X5I B;  5A7Q A;  4L99 A;  1Z78 A;  1PZ7 A;  3K77 A;  3NNF A;  1EAH 2;  3CL1 A;  5FMD A;  2XJQ A;  1YQ8 A;  1GKB A;  1JXN A;  5ANQ A;  4C0B A;  2RM2 3;  3KT7 A;  2JE8 A;  3CJI C;  1UZY A;  1V0A A;  2J1S A;  2EIE A;  3APB A;  1YI9 A;  3TRS B;  4RHV 2;  3J8F 1;  3OGV A;  4UFK A;  4BK5 A;  5A7S A;  4IET A;  1ZA7 A;  1J1L A;  2C24 A;  4ZKT B;  2E6V A;  3K3O A;  3ACG A;  3P3N A;  3ZXE A;  1TMF 1;  4Q5O A;  1UXZ A;  3UKV A;  4XE9 A;  3ALQ A;  1C8M 1;  4I01 A;  2R06 3;  3VZJ A;  1KJR A;  3T2O A;  3WP3 A;  3LA2 A;  1UAI A;  1RJ8 A;  4BWO A;  2QQM A;  3S30 A;  1X9T A;  4Z1V A;  5JI9 A;  1Q8P A;  4P9W A;  4K7J A;  4XJU A;  5FMO L;  3PJQ A;  1YLL A;  3LOB A;  1PVX A;  4KU8 A;  2BWA A;  3J8F 2;  4FPC A;  5FWE A;  3M3O A;  5CIR A;  2CGN A;  4AGV A;  1AZD A;  1CN1 A;  3WNK A;  2OUJ A;  3FLT A;  1TMF 2;  1N3P A;  1BCX A;  1FAT A;  2ZOE B;  1WW6 A;  4FPH A;  2JG8 B;  4TLF A;  2HYX A;  3JB8 A;  1BHG A;  4LBQ D;  4W6Y A;  1R1A 1;  2D93 A;  4LKF A;  3RNS A;  3USU B;  5D2A A;  5FZB A;  4RFT 0;  1EAH 3;  2WYF A;  2CSG A;  4MXW A;  1NZC A;  4O61 A;  3I2O A;  4MHU A;  5LW9 A;  3O1S A;  3WP5 A;  2EAL A;  3N9L A;  1CJP A;  3AM2 A;  2EXK A;  2QZ2 A;  3FFZ A;  1VMF A;  3ZN6 B;  3PVO A;  1UN1 A;  1LOC A;  2D5H A;  4EZ4 A;  3WW2 A;  3ZSK A;  3L9J T;  5C8C B;  5J3U A;  3HAG A;  3MIB A;  4R4X A;  1AF9 A;  2A75 A;  1R1A 2;  3NST A;  3TB0 A;  3LQC A;  1CX4 A;  4BA6 A;  2D3S A;  1V70 A;  1DG6 A;  1KIT A;  4WZC A;  4BXS V;  5ACA 1;  1O3R A;  2Z4F A;  2ZHM A;  1DIW A;  3DUI A;  3H8U A;  5GZE A;  3FL7 A;  2KXL A;  4CCM A;  1FMD 3;  2R04 1;  2VOK A;  4G9S B;  3VD5 A;  4A6O A;  4XF3 A;  3GJA A;  2WNV A;  3PLQ A;  2ZMK A;  4J6G A;  2E7Q A;  4OLL A;  3ZXG A;  4NID A;  2TUN A;  2JG9 B;  4K1Y A;  3VDC A;  1UU4 A;  1HV1 A;  2Y6K A;  2Q8E A;  1WWY A;  2CDO A;  1TMF 3;  1ZZ7 A;  1POQ A;  2ZGM A;  2B8M A;  1QXJ A;  2I74 A;  2ZS6 B;  1BJQ A;  1C8M 3;  3FFQ A;  4L92 A;  5FZH A;  1ZRF A;  1XJA A;  2O8O A;  3VBR A;  2VUD A;  1LAJ A;  4A42 A;  2QQJ A;  2VTX A;  1AX1 A;  1OOP B;  2WYS A;  3RVH A;  1T2X A;  2R04 2;  2VM9 A;  4E4D X;  2JEN A;  5B4X A;  4LT5 A;  4Q4V 2;  4YW2 A;  4OMC A;  4Q0V A;  1H2N A;  4FPF A;  5A33 A;  3C7H A;  2JDN A;  2C9K A;  4XXP A;  4R9A A;  4YNI A;  2YU2 A;  3VHR A;  1HN1 A;  3VL8 A;  1S0E A;  2P17 A;  1CPM A;  2R1D A;  1W8T A;  2A6Y A;  2CWS A;  1C1F A;  1SMV A;  3N4M A;  4RSU A;  5I8S A;  3QBQ A;  5FBZ A;  2EID A;  3SKV A;  3TEY A;  4PT6 A;  1IPS A;  1MS3 A;  4BLJ A;  1NCQ A;  2JG9 A;  4X8N A;  4BLI A;  4CCL A;  1EPZ A;  1SLI A;  2X10 A;  3ZN4 A;  3QH6 A;  3PUH A;  3ACL A;  3HNM A;  3S6P A;  1MR5 A;  1QKQ A;  1JUH A;  2HYK A;  5EZW A;  4NRQ A;  4YW6 A;  1LHO A;  1W6O B;  3AFK A;  4DXS A;  2YZ4 A;  2VQT A;  4CXY A;  4Q8K A;  4QPI A;  5BNP C;  2QQK A;  3MIF A;  4XFH A;  3DYO A;  5FZE A;  1DFQ A;  1W6M B;  4C91 A;  1F4A A;  1NE4 A;  2D6M A;  5ACA 3;  2YMZ A;  1O91 A;  5FY1 A;  2W3J A;  3BOP A;  3LSE A;  3DXT A;  3MFC A;  1LJ7 A;  2DCZ A;  3BIW E;  1ODM A;  4W65 A;  5FUP A;  1AR7 2;  2R49 A;  2W52 A;  1JU3 A;  2BP6 A;  2R16 A;  4OZX A;  1NXM A;  3Q8B A;  4BCU A;  4DZG A;  3N7L A;  4YGB A;  3I59 B;  1OH4 A;  1ZZ9 A;  2AGS A;  1LRH A;  3KGZ A;  3RFR A;  5BPX A;  3NJZ A;  3ZMN A;  2ZAB A;  4LO5 B;  5BUV A;  2K2S A;  1UY1 A;  2W1U A;  4PLM A;  3OYW A;  5I8Y A;  5F5A A;  4KBB A;  3O5S A;  1HLC A;  1UU5 A;  1AX0 A;  4NAO A;  4XCA A;  5H9P A;  3VBH B;  3AZZ A;  3N9N A;  1MZ5 A;  3K75 B;  3SHR A;  2AH2 A;  2W9X A;  2ARX A;  1VBC 1;  2HEW F;  1L7L A;  4IE0 A;  3GHM A;  2EIG A;  4IEX A;  4HXC A;  1ZM1 A;  2LRO A;  2XOM A;  4EV0 A;  5FZG A;  1ZRR A;  1S0J A;  4AED B;  1ENR A;  2R0H A;  4IV3 A;  4P08 A;  4CP9 A;  2RDS A;  4QX7 A;  1Q8S A;  2WN3 A;  4YM0 A;  1VBD 1;  2JIG A;  5B4N A;  3T4H B;  1HN0 A;  1W8F A;  1HB1 A;  2XJP A;  3K51 A;  1MQT A;  2BFU S;  2VZP A;  4AQ2 A;  4JKL A;  2FMY A;  4YZ5 A;  4NIG A;  2UYA A;  2YU1 A;  4L9B A;  4B4P A;  2JB8 A;  5D21 A;  1QJZ A; 
#chains in the Genus database with same CATH homology
 3OPT A;  4Y3O A;  5A7N A;  5FZ8 A;  2W2I A;  5FZA A;  4GD4 A;  5IVE A;  5CEH A;  5FZF A;  3PUS A;  4DO0 A;  5FJK A;  5F2S A;  3KV4 A;  5FYV A;  4LIT A;  4CCM A;  5IVJ A;  4EZH A;  4QXH A;  4CCK A;  4IGP A;  3KV9 A;  4V2V A;  4QX8 A;  5FY9 A;  5FZ0 A;  5A3P A;  2GP5 A;  5FJH A;  4LIV A;  5FXX A;  5A7P A;  3PU3 A;  3ZLI A;  4E4H A;  5F39 A;  5FZ9 A;  2Q8E A;  5FZH A;  3KV6 A;  5FWJ A;  4QXC A;  5FP4 A;  4LXL A;  5A3N A;  2OS2 A;  4AAP A;  5FP3 A;  4BXF A;  3N9P A;  2OQ7 A;  3RVH A;  5F37 A;  3ZPO A;  2OT7 A;  2XXZ A;  4D6R A;  5FY7 A;  5LWB A;  3KVB A;  5A7O A;  4CCJ A;  5FY0 A;  5F3G A;  3KVA A;  3AVS A;  5FV3 A;  5A1F A;  3AL6 A;  5KR7 A;  5A3W A;  4HOO A;  5FYT A;  3PTR B;  2YU2 A;  4IGO A;  5FZ4 A;  3N9M A;  3LDB A;  2XML A;  5FPL A;  4QU1 A;  5E6H A;  5F3C A;  3N9O A;  4XDO A;  3AL5 A;  5F2W A;  5F5I A;  5LY1 A;  4CSW A;  2OX0 A;  5FYI A;  5A7Q A;  3OPW A;  4CCL A;  5FZI A;  3PU8 A;  4GJZ A;  5FP8 A;  4XDP A;  5ANQ A;  5FY5 A;  2YBS A;  4D6Q A;  4Y4R A;  5FY4 A;  5FPU A;  2PXJ A;  4HON A;  5F3E A;  5FXV A;  1VRB A;  2XUE A;  2WWU A;  4Y33 A;  4UF0 B;  5IVC A;  3KV5 A;  5FZ3 A;  5A7S A;  2VD7 A;  4UF0 A;  4QWN A;  5FZE A;  5IVF A;  4CCO A;  3K3O A;  3U4S A;  3PDQ A;  4AI9 A;  3NJY A;  4V2W A;  4NUB A;  5FZO B;  5FYM A;  5FY1 A;  2YBP A;  5FXW A;  3DXU A;  2OQ6 A;  2YPD A;  4GAZ A;  5F3I A;  5FZO A;  2GP3 A;  3DXT A;  5K4L A;  5FZ7 A;  4ASK A;  4CUG A;  3K2O A;  5F5C A;  3LD8 A;  5FP7 A;  5FUP A;  5FYZ A;  3PUA A;  5FPV A;  2Q8D A;  5IVV A;  4IGQ A;  5A7W B;  2WWJ A;  4EYU A;  5FWE A;  5IW0 A;  4LIU A;  2YBK A;  3PUQ A;  4BIS A;  5FUN A;  4URA A;  5FZD A;  5A1L A;  4QXB A;  5FYH A;  2Q8C A;  5FXZ A;  3N9Q A;  5F5A A;  4CCN A;  4DIQ A;  3N9N A;  5FPB A;  5FZ1 A;  5FYU A;  3UYJ A;  5FZB A;  5A80 A;  5F32 A;  3AVR A;  2P5B A;  5FZM A;  5IWF A;  5LW9 A;  5FP9 A;  5FPA A;  5FZG A;  3N9L A;  3U78 A;  4C8D A;  3PUR A;  5IVB A;  5FYB A;  5FZC A;  4QX7 A;  5FZK A;  3K3N A;  4EZ4 A;  5ISL A;  5FBJ A;  5FYY A;  4BU2 A;  4D6S A;  5FYC A;  5FYS A;  5A3T A;  5FZL A;  2XDV A;  4TN7 A;  4GJY A;  5IVY A;  5LY2 A;  5FY8 A;  2YU1 A;  5A7W A;  5FZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...