3IDEA

Structure of ipnv subviral particle
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
423
structure length
415
Chain Sequence
ATATYLKSIMLPETGPASIPDDITERHILKQETSSYNLEVSESGSGVLVCFPGAPGSRIGAHYRWNANQTGLEFDQWLETSQDLKKAFNYGRLISRKYDIQSSTNGTLNAATFEGSLSEVESLTYNSLMSLTTNPQDKVNNQLVTKGVTVLNLPTGFDKPYVRLEDETPQGLQSMNGAKMRCTAAIAPRRYEIDLPSQRLPPVPATGTLTTLYEGNADIVNSTTVTGDINFSLAEQPADETKFDFQLDFMGLDNDVPVVTVVSSVLATNDNYRGVSAKMTQSIPTENITKPITRVKLSYKINQQTAIGNVATLGTMGPASVSFSSGNGNVPGVLRPITLVAYEKMTPLSILTVAGVSNYELIPNPELLKNMVTRYGKYDPEGLNYAKMILSHREELDIRTVWRTEEYKERTRVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Capsid protein VP2
publication title Crystal structure of an aquabirnavirus particle: insights into antigenic diversity and virulence determinism
pubmed doi rcsb
source organism Infectious pancreatic necrosis virus -
total genus 98
structure length 415
sequence length 423
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ideA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3ideA02
1COV1 1PO12 3HAGA 1RHI3 4RHV3 4FTBA 3JD71 1CJDA 4N43B 1HRV2 3VDDC 1AYM2 5C8CC 2HWC3 2WLPA 5BNNC 3VBHB 1BMV2 1BBT1 1RHI2 4RHV2 5FMOS 4N53A 1AYN3 5D8AB 4NWVA 2XBO1 5C9AB 2HWC2 4CDXA 1EAH1 2RS13 4JGYB 4YVWC 1TMF1 5CFCC 3CJIC 2DF7A 5ACA1 1C8M3 1DDLA 1OPOA 5ABJC 5C4WC 1NCRC 1TME1 3VBFA 2WZR3 4CDQC 2GSYA 1PVC1 2HWE3 1OOPB 5A32A 1FPN1 4GH4B 1ZBE1 1HXS1 1RVF3 3ZFFA 1AR91 3DPRA 4CEWA 4RR3C 2RR11 1V9U1 3NAPA 1RUD1 2RS53 2WZR2 1RUC3 1HRI1 2HWE2 5FMOL 1H8TB 3ZFGC 1VBB2 4Y4YA 4IV3C 3VBSA 4RS5C 1QJY3 5C8CB 1VBC3 2RS52 5BNNB 1RUC2 2RS31 3ZFEA 1VBD3 4FTSA 1QJY2 4WM7B 1RUJ1 1VBC2 1ZBA3 2BBVA 4YVWB 2FZ2A 5CFCB 5A33B 1FMD1 1AR71 4N43C 5D8AA 1AR81 3ZXAC 2R073 1D4M1 5CFDA 5C9AA 3VBOB 5C4WB 5ABJB 1NCRB 3VBHC 4Q4X1 2RMU1 2PLV1 2WFF3 4CDQB 2Y26A 1R093 1QJX1 1MQTC 4Q4Y1 1R083 4GB31 1K5MB 3VBRA 1GFF2 1PIV3 4RR3B 1PO11 2HWB1 1VBE1 1QJU3 5K0UB 3ZFGB 2BFUS 4CDWA 4AEDC 5JZGC 4RS5B 1A6CA 1M06G 1RHI1 4FTEA 1OOPA 1QJU2 1AL23 2FZ1A 4LLFA 1VBA3 1Z7S3 1BEV3 1RUE1 4GH4C 4Q4V3 1RUH1 1RUG3 3VDDA 4Q4W2 2MEV3 5C8CA 4SBVA 1NOVA 5BNNA 1H8TC 1VBA2 1Z7S2 1VRH1 4Q4V2 2R061 1RUG2 2HWD1 2RM21 1ND3C 2HWF2 2ZAHA 1PGW2 1PGL1 1RMU3 3LOBA 3J8F3 2BFUL 1E57A 4YVWA 1MQTB 2VQ0A 2X5IC 5CFCA 3CJIA 4WM7C 5A33A 1RUI3 1B35C 3TN93 5BNPB 3J8F2 1AYN2 4RQPB 1EV13 1VBB1 1PO23 4AEDB 5C4WA 3JBG1 4Y5Z0 4BCUA 1AR61 1HQNA 2RS12 5JZGB 1RUI2 3TN92 3VBOC 1EV12 2QQPA 1PO22 4NWWA 2BPA2 1C8M2 1MEC3 1OHFA 1COV3 1RUF1 4CEYC 3JD73 3ZFGA 1K5MC 1VAKA 4IV3A 4RS5A 4CDXC 5K0UC 1BBT3 3JD72 4JGZC 1RVF2 2XBO3 1ND3B 1R1A1 1EAH3 1AUYA 1NY72 1BBT2 1FOD1 1TMF3 4PDWB 1IHMA 5AC93 5ACA3 2X5IB 3VBUC 1ASJ1 1EAH2 5GKAC 2IZWA 1B35B 1QQP1 4N43A 2WS93 1VBD2 1TMF2 1AL0G 4CEWC 1TME3 5AC92 3VBHA 2ZZQA 1PVC3 1C8NA 1X33A 4IV1C 1ZBA2 1FPN3 1ZBE3 1HXS3 1MQTA 2WS92 3VBSC 1AR93 2RR13 1V9U3 3JB4C 4YVSC 1RUD3 4JGYA 3S6PA 4GMP1 1HRI3 1POV1 4CEYB 4N53B 1FPN2 4WM8C 5L7OC 2R072 4AEDA 4Q4W1 2RR12 4CDXB 2WFF2 5BNPC 1HRI2 4CDUC 4RQPC 1R092 5BNOC 2RS33 1HRV1 1RUG1 1R082 1AYM1 2HWF1 1PGW1 4JGZB 4Z92B 1PIV2 1RUJ3 1BMV1 1NG0A 5DDJ3 4RHV1 4GH4A 2RS32 2HWC1 1CD3G 1F8VA 2R043 4QPIC 1FMD3 3VBUB 5DDJ2 1H8TA 5LK7B 1AL22 1AYN1 1AR83 1NCQC 1D4M3 3VBRC 1ND3A 3ZFFB 4CEWB 4Q4X3 2RMU3 2PLV3 4QPGC 2RS11 3M8LA 3NAPB 2R042 1F2NA 1FMD2 1BEV2 4IV1B 1QJX3 4Q4Y3 4GB33 2TBVA 1PO21 3VBSB 2MEV2 5J98B 4WM7A 1C8M1 4Q4X2 5J96B 4YVSB 2HWB3 1B35A 1VBE3 1ND2C 4PDWC 5L7OB 4Q4Y2 4WM8B 1NA1C 1POV0 1RMU2 2WZR1 2HWE1 2HWB2 1VBE2 4CDUB 5BNOB 1RVF1 3VBOA 5ABJA 1NCRA 1VB4A 3IDEA 2RS51 1NY71 1RUC1 4CDQA 2BUKA 1RUE3 4CEYA 1RUH3 1K5MA 5CFDB 1QJY1 1X36A 4RR3A 1VBC1 4QPIB 4N53C 1VRH3 2GH8A 5K0UA 1RUE2 1VBD1 1RUH2 2R063 2HWD3 2RM23 1NCQB 4JGZA 3VBRB 5AC91 1MEC2 1COV2 4QPGB 1VRH2 1ZBA1 2WS91 2R062 4CDWB 2HWD2 2RM22 1PGL2 1HX6A 3VBUA 1WCDJ 1ND2B 1VBB3 2R071 3FBMA 2XBO2 3VBFC 3JBG3 1NA1B 1AR63 2WFF1 4RFT0 1R091 4IV1A 1R081 3ZFFC 3DPRC 3VDDB 3NAPC 1QJZA 5ACA2 3JBG2 1PIV1 4YVSA 1AR62 1RUF3 1QJU1 2XPJA 5L7OA 4WM8A 1TME2 1PVC2 5DDJ1 5BNPA 1RUF2 5FOJB 3ZFEC 4CDUA 1AL21 4RQPA 5BNOA 2ZTNA 1SMVA 1ZBE2 1HXS2 1RB8G 1VB2A 1AR92 1R1A3 3CJIB 5JZGA 1V9U2 1RUD2 2R041 1VBA1 1Z7S1 1FOD3 1BEV1 4Q4V1 2MEV1 1R1A2 1ASJ3 4QPIA 1FOD2 1QQP3 5D8AC 5C9AC 5CFDC 1NCQA 1RMU1 4JGYC 1RUJ2 1ASJ2 1AR73 3VBFB 4QPGA 3J8F1 1QQP2 5A32B 3DPRB 4IV3B 1RUI1 1AR72 4GMP3 3TN91 1POV3 3JB8A 4CDWC 1ND2A 1AR82 4PDWA 1EV11 1D4M2 4Q4W3 2X5IA 1NA1A 4EJRA 2RMU2 2PLV2 1W39A 1PO13 1OOPC 1QJX2 1HRV3 3ZFEB 4GMP0 4GB32 1AYM3 2HWF3 4FSJA 2WWSA 1MEC1
chains in the Genus database with same CATH superfamily
1PO12 1W3XA 4HKOA 1XU1A 2CDOA 1TZOA 3JD71 4CA9A 4XDOA 3APBA 4N43B 1HRV2 2J1EA 1Q5OA 3VDDC 4CCOA 2SBAA 5C8CC 3V0AA 4YZ4A 1WMXA 4XFHA 5CG8A 3VBHB 3POFA 4B4RA 1JS9A 1BBT1 4N53A 5KHHA 2SLIA 4UYBA 5EWSA 1OURA 1YRZA 4YM2A 3H8XA 1ZVFA 3RQ0A 2K0GA 1N1SA 2XBO1 4M3CE 4NRMA 4OHWA 2H0BA 5FZKA 1LHVA 4GXLA 3JUUA 3ZOIA 4BK5A 4IERA 3CU7A 3AZYA 2CWMA 3RJ2X 5HCBA 1WKYA 1KFUL 3BB6A 3NQHA 4YVWC 1OUXA 4Q0UA 4BDVB 4NPMA 5CFCC 3CJIC 1LKNA 1F9KA 1RXFA 2PA7A 3EO6A 3M3QA 2V73A 2ZEYA 5SV8A 1W90A 2O8QA 1W03A 5ACA1 4OZOA 3KGLA 4AQTA 4LO5B 5FMBA 3SNMA 2CSGA 3N9QA 4QB6A 2Q1MA 2JECA 1CWPA 2FDGA 1TME1 2O1QA 3DEMA 1CX1A 4EE2A 3VBFA 4XMAA 1UX6A 3ZDSA 1OLQA 1FT9A 1PVC1 2P17A 2HWE3 3N36A 2BOIA 2D5HA 2A6YA 2FHRA 4GH4B 4NVPA 1ZBE1 4QXKA 4CUCA 4HMZA 1UOGA 5HCAA 4MGYE 4Y33A 1AR91 3ZFFA 3DPRA 3GZTB 4CEWA 4RR3C 4E9KA 5KC5A 1RUD1 3M7AA 2G9FA 4NAOA 4OMDA 4UAPA 5FYZA 1XSQA 1UY3A 1HV1A 2Q8OA 2HWE2 3U10A 1ULFA 1O4TA 2JXAA 3KSCA 1JU4A 2DCZA 2VNGA 4FPHA 2Q4SA 4LBNA 5T55A 1QJY3 1WZXA 2GNBA 2ZGLA 2ARBA 4XXAA 2Z69A 5C6CA 3AZXA 1AX1A 3SXWA 1QY4A 5A3LA 4OI2A 3OF1A 3WP4A 2OYZA 1PK6B 4A3XA 2NN8A 1DZTA 2WQ4A 4HK8A 2B5HA 2UWBA 5F1RA 1QJY2 1UX7A 4XYXA 3BIWE 4FPFA 3RZKA 3ZIXA 5A6QA 1FAYA 2HJIA 3JXSA 2Z42A 4BQ2A 3SCGA 2QQVA 2FZ2A 3T2OA 2R32A 4QPYA 4AI8A 2LRPA 1ACCA 2VMIA 4JKKA 4NMIA 3U11A 5KXCA 1YQCA 2AGSA 2H0VA 5FRAA 4AFBA 1X7NA 3PMSA 3WUCA 2QQJA 2A1XA 3ZSKA 5LB6A 4KWJA 2JIJA 1JU3A 4UFIA 1F5FA 4HSLA 1YFXA 5DG1A 1D4M1 5CFDA 5ABJB 4GJZA 4N7UA 1NCRB 1US2A 1PMIA 2QE3A 1SEFA 2EAAA 1OKOA 3KF3A 4CDQB 4E4HA 2A6ZA 3H8UA 5I91A 1MQTC 4HK9A 5M0TA 3AMMA 1WMEA 4O7XA 2ADDA 1UPSA 1PIV3 3CF6E 2YMZA 3VKOA 4KU7A 1DP0A 1QJU3 1YQ5A 4S2DA 3N9OA 2KA3A 3O1UA 5K0UB 1ZZ8A 3PVNA 2BFUS 3HVDA 3WHTA 3ZFGB 5EJZB 4AEDC 3O1PA 4BQXA 1OSGA 1F4HA 3MPBA 1LOAA 5JZGC 2WNUC 4RS5B 5FPBA 4XJUA 1K3IA 2WL1A 1QJU2 4AVTA 1LCLA 1AL23 2ZZJA 5JI9A 3AKRA 3POIA 3WQ7A 4AGRA 1WD4A 2YU2A 5IUQA 4ARXA 5IW0A 1XYPA 3WNPA 5CU1A 4LEJA 3VDBA 2VBPA 4NHKA 2DV9A 2WABA 1BEV3 5IVYA 3MIDA 4AHXA 4PLMA 4CYDA 2FBEA 4Q4W2 4YRDA 3KHCA 2NMNA 1UOBA 1PZ7A 2W0XA 1UF2C 1OC1A 1NOVA 4CUBA 1H8TC 3W21A 3OG2A 4DY5A 5LA9A 4OQ8A 4MHUA 3T09A 4X8NA 3I2FA 5H9PA 3CQOA 2HWD1 3O0XA 4TZDA 1H4HA 3AJZA 2ZMKA 1RMU3 5AFBA 4H14A 2VUAA 3ES1A 5BYNA 1O6UA 4LNVA 2XVKA 5FYHA 3EB7A 2Y8KA 1E57A 4N8MA 4H55A 3GGLA 1WW7A 5IVEA 1Q56A 1S2EA 4W4ZA 4UW5A 5JIUA 2WAAA 5HV0A 3VD9A 1LOFC 4M4PA 2IXIA 1B35C 5IVBA 3TN93 2BP6A 4XQWA 1S0IA 1AYN2 4LT5A 3ME2A 1EV13 1W6PB 2CNAA 1HB3A 1XPWA 5FZ7A 2ZHMA 2BJSA 1YFWA 3TRSB 4Y5Z0 4LO4B 3HPNA 4AVAA 2BGCA 3OPTA 3DV8A 3G7DA 3GZAA 3TN92 5T50A 1DZQA 3ZSEA 3WUDA 3I7DA 3J7NA 1EV12 4IE7A 2PHLA 2PMWB 2VZPA 1ZYBA 4D7SA 5E89A 5DUVA 2CV6A 1G86A 2YPDA 4EV0A 1L3JA 5J1XA 1MS4A 3ZFGA 2QNKA 1K5MC 1FV2A 4BU2A 3MEPA 3Q8AA 2WYSA 4PI2A 4AYUA 5KHIA 1EYBA 1GZTA 1ENSA 2ZJCA 4LIVA 4MADA 4RS5A 4D7TA 4MOAA 5FIXA 1UAIA 2WQZC 3VKLA 4CRQA 3OB8A 3RSJA 2ZPXA 3QH7A 3WNOA 5F2SA 1OVSA 2Y33A 1MPXA 4AEKA 2I45A 1ND3B 2CAVA 2DCJA 5GJ6A 1D2SA 5FP9A 5J09A 4LA3A 4UFJA 2LTNA 5KXBA 2D6LX 4YZ3A 1WBLA 3UNPA 1YIFA 1HW5A 1OPMA 1X50A 2OS2A 4MXVA 5AC93 1GQGA 2ZGPA 4Z2AA 2X5IB 1AF9A 4OHYA 1UZZA 4MSVA 5GKAC 3ZXKA 1QQP1 4Q27A 2QFEA 3OUJA 1UIJA 1OXCA 3N9NA 4CEWC 1UMHA 1BHGA 4Q29A 3ZYRA 5KR7A 1J1LA 2HEYF 2GZWA 5FREA 5AC92 4FAGA 4B7EA 4M3CB 4XTMA 4QQ2A 5JXGA 4D8MA 4ISRA 2E53A 1WCQA 5K8SA 4OLLA 1FPN3 4I02A 4CPBA 4Q1RA 1ZZBA 2XG3A 1HXS3 5FZ4A 5KHGA 4YZ2A 1RUNA 4MG2A 4M3CF 3JQWA 3S0MA 2VQTA 1V9U3 2A73B 4JGYA 4A44A 4GMP1 1XJAA 1HRI3 2BGOA 3NW4A 3WW3A 1MS5A 4OHZA 4CEYB 1FPN2 1E5IA 5SV5A 1W6PA 3R6SA 3P6BA 1S0CA 1LHUA 2P2KA 2W52A 5F3EA 4QHBA 5CISA 5BNPC 4WV8A 1HRI2 4RQPC 1CN1A 3GJAA 4X6QB 5E8AA 1HRV1 1YLLA 2HEWF 2ZHLA 3IB3A 2D3PA 3POBA 3PTYA 3LCPA 4P9IA 4QMAA 3ASIA 3SEEA 1UKRA 3D5OA 3B02A 3S7EA 2UWAA 4KI5M 5EQUA 2B9VA 2FMDA 3KVAA 2AH2A 3DUIA 3IM0A 4M0NA 3WSOA 3FZ3A 4BHPA 4PIZA 4D6SA 2BVBA 2OT7A 5GZCA 2YB7A 1I5PA 2VU9A 4N7IA 2N7GA 2R043 3LWCA 1FMD3 1EPZA 4MGKE 4QPIC 4ZONA 3VBUB 3ZIWA 1RIRA 3MLLA 2Q8DA 3GBFA 4PCRA 3MIEA 1UO9A 2BW8A 4B1LA 1IS5A 2Y6GA 1DQ4A 4DOUA 1ND3A 2K46A 2WUHA 4G4FA 3A22A 3VV1A 3AMPA 3IWZA 2DVFA 2R042 1FMD2 2Y6KA 1YUDA 4QXBA 1U12A 2VUCA 1DYPA 1H30A 1QNYA 5FYYA 2MEV2 5J98B 4YGEA 3VBSB 3N9LA 4WM7A 2FDKA 1IG3A 5J96B 5JWPA 4IETA 2WFPA 2BRTA 2HWB3 2VMHA 3RZLA 3OBAA 4AHWA 4COZA 4YZ5A 1UU5A 3NO8A 5L7OB 2BV4A 1WUVA 2W08A 3CL1A 2PFWA 4CCKA 1LTEA 3T1LA 2XHNA 4M3CA 4C1XA 5JXJA 2G9GA 1CAVA 2HWE1 2HWB2 2DTWA 2IWGB 2P6CA 3LPGA 4ZKTB 4HFSA 2HLEA 1I5ZA 5A3NA 5FCCA 3VZLA 1IQAA 3J7LA 3T2PA 3VBOA 4X6RB 1IPJA 1MACA 5BNQA 4IEQA 4WVVA 4EZ4A 2JG9C 5A70A 2VNOA 2JE9A 3NJVA 3MZHA 2BUKA 3LB9A 4CEYA 3SISA 3PNAA 2Y6FA 1JZ7A 4MVTA 2MNGA 3FMGA 1J58A 2K2SA 5I8SA 1LAJA 2IVJA 1MS0A 5T5PA 1QJY1 1X36A 2QJVA 4H7LA 4CCNA 2WBKA 4CXWA 3E6CC 2ES3A 3UL2A 2QQOA 4WZCA 2GH8A 4MGIE 2VH9A 2X53S 1V00A 1A78A 4XF9A 4ARYA 1IS6A 2DBNA 5I0RA 4F3JA 4R9CA 1BCXA 3VBRB 2VZ3A 4JTNA 5HPOA 3WF2A 1PX3A 3I4IA 4XF3A 4QPGB 2GAUA 5FO9B 2XJQA 1O4YA 4RGKA 3KV5A 3DXTA 1W0NA 3ZN4A 2WS91 4CDWB 1DQ5A 4ASKA 5JOWA 1IGOA 1PGL2 3OD4A 1V0AA 3VBUA 2XMLA 1VMFA 3CJXA 2FDHA 4LHLA 2JG8A 4K21A 2EF6A 3OD0A 3HIFA 1CPNA 4OMCA 1ND2B 2R0HA 2YBPA 1QNWA 4HONA 5DN2A 2XBO2 1QGLA 1LNSA 1T6BX 4LTAA 4XXPA 1MZ6A 4Y1ZA 2O8OA 2F6BA 1AR63 1SPPB 2VOTA 4MZUA 5DG2A 3WF0A 4BQYA 4XAAA 1K5JA 1X8MA 2OQ7A 4RFT0 5FZ8A 1FI2A 1HB4A 1SCRA 3FLPA 1OUSA 1N1YA 1WLDA 4XDPA 1PM4A 3SCFA 3IAQA 2R6QA 1PZ9A 4L11A 3VDDB 3NAPC 1QJZA 5ACA2 5FP4A 2VGDA 1PIV1 5FZOA 4COUA 1AR62 3KS7A 1RUF3 1QJU1 1DGWA 1KQRA 2XOMA 1LODA 3PVOA 4FOYA 4NIDA 1F31A 3LDBA 3O5SA 5L7OA 1YFUA 3HT1A 4CP9B 1TME2 2W95A 1XNBA 3C7EA 4IEUA 4KG0A 3B5LB 3LIGA 1PVC2 2RG4A 4QQHA 5DDJ1 1RUF2 1UU6A 4M00A 5FOJB 1AL21 3DYPA 2JDMA 3PLQA 2ZTNA 2EVXA 1ZBE2 3MW2A 4AOCA 1WLWA 2WA4A 4GALA 3ACLA 1Y7BA 4XEZA 1AR92 1OQEA 3BCWA 1R1A3 1W6QA 3CJIB 5GLVA 4BMEA 4AEJA 1RUD2 3ZYPA 3LAGA 3UKVA 4KWKA 4GKXA 4LHKA 1FOD3 1BEV1 1O5UA 2VTXJ 5E16A 3RYRA 3WDUA 5IAXA 4I09A 3QLQA 5JUVA 3RZJA 1W05A 4EN6B 3ZMNA 2VR4A 4OVEA 1H9WA 1MZFA 1KXGA 1R1A2 1ASJ3 2WNOA 4DO0A 3NRUA 4BK4A 4QWNA 1FOD2 5D8AC 3RWKX 3ETQA 1SDWA 3DXUA 3RDIA 5C9AC 1MR5A 5I8TA 4Q2FA 1LGCA 1U0AA 2QZ3A 3A0KA 4HXCA 2P1BA 1RMU1 1XNDA 4QX7A 2XONA 4JGYC 2VULA 5EXOA 1ASJ2 1PNFA 5DMYA 4QPGA 1DQ2A 1VMJA 2UWCA 4AGVA 1J3QA 3BOPA 1W2UA 4A7ZA 1BQPA 2VNVA 5FY9A 5FZ9A 1LHOA 5A32B 4QXCA 4EROA 2ZHKA 3POWA 3WG3A 4QQLA 2NMOA 4PF5A 3GXUA 1UW8A 4UI9L 2GALA 1S2KA 1ENQA 1BJQA 3TN91 1YQ2A 1RL3A 1GP4A 1WW5A 2D40A 2C9KA 4UFHA 3ZX7A 3ZXJA 5L36A 1GUIA 1ND2A 3M3IA 1EV11 3KLSA 3QD6A 3N7LA 1D4M2 1WBFA 3M3EA 3OEBA 5BXXA 5CKMA 2J1TA 4QPWA 3C3VA 4EJRA 3DCQA 4JHTA 1W39A 4UFKA 1IG0A 3PUIA 1FYUA 4B4QA 1YJKA 4FQ4A 4KWLA 3AL6A 3ZFEB 1NYWA 1WW6A 2IFWA 5IATA 1HJFA 3Q8FA 3LD8A 1DGWX 2F17A 4FSJA 2WWSA 3RNSA 4DXSA 1Y43B 4AW7A 2ZCWA 4FTBA 4LKEA 3RVHA 2E32A 3ZKYA 4XFIA 1D4VB 3ZSMA 1TVGA 2VG9A 2D44A 4UOJA 4AZZA 3ILRA 4L99A 1C57A 2HWC3 3ACFA 4QHZA 1XE0A 4NHXA 4COWA 4QU2A 4AVVA 1QKQA 5T5JA 1GZCA 4HSJA 1H0BA 3UJQA 4YW4A 2EXKA 2Y0OA 4FOVA 4QB1A 5CEHA 4NWVA 4ATEA 2CAUA 3DKWA 1BVP1 1K12A 1PVXA 2HWC2 2PHFA 4P5HA 4V2WA 4BQ1A 4DXZA 4CXYA 2RS13 3SH5A 4EWAA 3R4UA 1OA2A 4BISA 3WT3A 4PQ9A 2NYYA 4YZ1A 1W99A 4J25A 1H6XA 2YBKA 2PAEA 3LEMA 5ERLA 2XWJB 4YW6A 2WC2A 2KXLA 1ZREA 3FFQA 1HN1A 3AJYA 2NM1A 1C8M3 3N35A 4LJHA 2WNUB 1JYTA 1GKBA 1H2MA 2ZKNA 4I0AA 3WQ1A 1CESA 5GALA 1KFXL 2D6PA 2QZ2A 4NN0A 4D94A 2WQ8A 5JIAA 4CVUA 2R7EB 2XKOA 4ONUA 1Y4WA 4EQVA 1H9PA 2ZGNA 3K3NA 2R49A 1BLZA 4XURA 2YROA 2TUNA 3N3HA 3I2HA 1OOPB 5A32A 1FPN1 3K48A 2OW4A 5FUPA 1HXS1 1J3RA 3KQ4B 1RVF3 3ZLIA 5B2GB 3FHQA 4AK3A 1JXNA 2JICA 1V6JA 3LGRA 1V9U1 2QQLA 4ASLA 1S0BA 2WWUA 3M3OA 1RUC3 1HRI1 5A7PA 2Q5TA 3CIHA 1ST8A 2VAUA 1H8TB 5FMOL 3ZPOA 5FPAA 3ZXDA 5JLVA 4NR1A 3BYWA 4QXHA 1W3VA 3OY8B 3RZZA 3U37A 1S55A 3LKJA 1GU3A 1S2BA 2H6BA 3LEIA 4FFGA 4MXWB 3VUOA 3UYJA 1GBGA 1VBC3 4W6XA 5B4NA 1F35A 4NE9A 5IAVA 5BNNB 1RUC2 1W8UA 2E6VA 4L92A 2P6HA 5FY1A 4LO8A 4AAPA 5CADA 4PT6A 5JOXA 3ZFEA 1UYZA 5EHDA 4FTSA 1W9TA 3EXUA 4JDNA 4XQ4A 1UKGA 3D0SA 4MX3A 5EFUA 2VZQA 1C4RA 5LRRA 2LW8A 3KV9A 1LENA 1VBC2 3WP3A 4C8DA 5LY1A 2JG8C 3WCRA 3WLUA 1ZBA3 2V4AA 4OHXA 5LCWL 1US3A 1SLBA 2XL9A 2ZEZA 2JDPA 4EWDA 1YFYA 1YEWA 2JD4A 3AFKA 3DYOA 5CIRA 4OFGA 2VVDA 1W9FA 1D2QA 1KDMA 1S0DA 2G9ZA 4P9JA 1S0FA 3MW3A 1FMD1 4QGLA 4RSUA 4NRQA 3LIHA 4NIAA 3AZWA 3LA2A 2Q8EA 5L9RA 1NLQA 5C7GA 4WVMB 3UT0A 3ZXAC 2CY6A 4KMQA 2WNVA 5IJRA 5C4WB 4TN7A 3MFCA 4XW3A 3OSDA 2VOKA 3BOWA 2VZUA 2D5FA 2WFF3 4LHSA 5IK7A 5ISLA 4Z82A 1R093 1XBFA 2DTYA 4KL1A 2JDHA 2CL2A 3AZZA 2GDFA 3QACA 4NROA 5GZFA 1R083 3UGFA 1N3OA 5A6YA 1K5MB 2BTVC 4P9WA 3UGGA 1FXZA 3ILFA 3O7OA 4K40A 4XBNA 4Z07A 3K51A 4HKWA 5KHKA 2HWB1 3AMHA 3CO2A 2C9AA 1QF3A 1J59A 3P5BA 5A7WA 1C3HA 1QXJA 4E2SA 3BTAA 3LEKA 1G9CA 2WO7A 1A8DA 1DGLA 5GLZA 2HYKA 1OD5A 1A6CA 3PU3A 4JVAA 5DZFA 4BXSV 1W9WA 1SLIA 1OOPA 2WNEA 4HVQA 3OGRA 1K42A 2UURA 4AR2A 1W6MB 3PL0A 1KS4A 3DGTA 3ZYIB 3ZYFA 3M1HA 3QBQA 4UW6A 3THCA 2NLRA 3NNJA 4DUWA 2JB4A 4DXTA 3AK0A 4Z2WA 5K7PA 2LALA 2ZOEB 5IVCA 3FC0A 1GMMA 2I07B 2OZJA 1VBA3 3KCCA 1LGBA 3SC7X 3AYCA 3EHKA 4R9BA 2Q1ZB 1E5HA 1XC6A 2P3KA 3OY8A 5FUIA 2AACA 3LDRA 2C26A 3ES4A 4Q5OA 4PI0A 1M4WA 1YWKA 3GBWA 1JUIA 5BNNA 4ATFA 1KD7A 4Q1PA 1VBA2 1QU0A 4QKDA 2VVEA 3PUQA 3SEPA 4A7YA 4YWAA 2ZAHA 1GICA 1PGL1 2YBSA 4MGTA 2R16A 3UK9A 1GOHA 1OLME 2GH2A 2JDAA 5F6KA 1MZEA 4ES9A 3LOBA 3RI8A 1OKQA 1KS5A 1ULOA 2VL4A 4KNCA 4QKFA 1ZRIA 4XJ8A 1DU3D 1RC6A 3I3QA 5FZ0A 1J84A 4IESA 1F4AA 5BNPB 3U78A 1IOAA 4RQPB 5C4WA 1U5IA 2BWCA 2C0ZA 3J4UH 5FYCA 1AR61 4A6SA 4AEMA 3WZ1A 4CZSA 1PM7A 2XXZA 2D7FA 3ZN6A 1WD3A 3ECQA 2VXRA 2XWBB 5JSPA 3VHPA 3BU7A 4GULA 4KH9A 1CAXB 4NWWA 4Y22B 4PLOA 4RA0A 4LKFA 4K1ZA 2QKDA 1RUF1 1ZZ6A 5BY5A 1QJFA 1WA6X 1W2NA 3KV4A 1JZ6A 2UY8A 5C5TA 5G04L 3RI9A 1NE6A 1YI9A 5F8PA 2A3WA 5T5OA 4DB5A 2ZS6B 4E8CA 1FV3A 2VY0A 4I3PA 4XUQA 1H1AA 4IV3A 4PJYA 1ZRDA 5IYYA 1FNZA 1QEXA 3MIHA 5FPXA 2W91A 3H50A 5E6HA 4AL9A 1S0JA 5J37A 2E31A 3HBZA 2J1VA 3DECA 5FPLA 1UNBA 3OYWB 4JGZC 3D6EA 4OI1A 5JPMB 3P1IA 1R1A1 4CU8A 5LZ6A 1EAH3 2A75A 3K4AA 1QDOA 1AUYA 1VE0A 4P9LA 2VTFA 1FOD1 2DCTA 1AXKA 1TMF3 2VBDA 1IHMA 3SH4A 4EN0A 1QH6A 4IE5A 2AEYA 2X29A 5FZIA 2IXLA 1ASJ1 1QOTA 1EAH2 4FPYA 4IEXA 2AREA 5FXVA 4AVCA 3O0VA 2VMDA 4N43A 4R9AA 4BXFA 2ADEA 2WS93 1WMDA 1TMF2 2XH6A 1AL0G 1UY1A 5F39A 5FTTC 2I2SA 1GNZA 3VBHA 4BPZA 1W0PA 3GF6A 5D2AA 5FZDA 1JHJA 2XR4A 2GC3A 4CP2A 5C3SA 4JC1A 1OLRA 2D6OX 5F9TA 2WS92 2R0FA 1LR5A 4AHZA 1E5SA 1W2AX 3LE0A 3K2OA 4YVSC 5I0TA 3ZYJB 3PMEA 3WNXA 4XJWA 3N7MA 1O5LA 4WM8C 4GIQA 1PNGA 5T5LA 2XQRA 4C0BA 4ZZ8A 1L7LA 3GZUC 1GYKA 1U5YA 3E97A 2ZACA 3R05A 4AQ6A 3IIAA 4DQAA 2QCSB 4CDXB 1HN0A 1S0GA 4LO7A 5DQ0A 4CDUC 5BNOC 2RS33 4KWUA 1RUG1 1SBFA 2YZ4A 5FPZA 2JE7A 1RITA 3OUHA 4FPJA 5LBBA 5A3PA 5JVVA 4Y22A 4XF1A 2MHFA 4I2OA 3OJBA 4GA9A 4D0QA 1O59A 1PIV2 1RUJ3 2WO3A 3LA7A 5DDJ3 5FZCA 3UKTA 1UZYA 3ZN5A 2XQXA 4LUMA 2WINB 1LESA 1WGPA 2BBAA 4GH4A 4Y1VA 2C6SA 2A70A 2RS32 2VPVA 2WNVC 3G6JB 4DNYA 4BMBA 2HWC1 4NHMA 2QTWB 2QUOA 1UOJA 4LO6B 5LA2A 1SLLA 4FFHA 5DDJ2 2WT1A 1ODMA 1ZZ9A 2WSUA 3WD5A 3TEWA 5LK7B 4BQ3A 3FJSA 5A1LA 4ZHNA 1AL22 1JI6A 2ZEWA 1AR83 4LBOA 3V65A 4CCLA 1ZX5A 2J7MA 4IE4A 4N90A 1L7RA 2VE1A 3OOXA 4OI4A 5JXHA 4Q4X3 2RMU3 2PLV3 2RS11 3B7MA 3NAPB 5FJHA 1F2NA 2WO2A 1BEV2 5DZGA 4Y5TA 3N4MA 4IV1B 1NQJA 1QJX3 1PK6A 3AVRA 1XYNA 2TBVA 4GB33 4BH9A 3I3MA 1VALA 5JSOA 2WT0A 5IVJA 1C8M1 4Q4X2 1H1IA 5HV4A 3H42B 1D0HA 2E26A 2P4EA 2FDFA 5FY4A 2YU1A 2ZMNA 3WDXA 4IXLA 4PDWC 3AYAA 3PVEA 4Q0VA 2YGLA 5IK5A 3L2YA 1JHNA 4QKNA 4LBQD 2IXCA 1POV0 4XUTA 1RMU2 5FY8A 1QWRA 2B39A 5JSRA 4FOWA 1W8HA 2B9UA 5A3UA 1SG3A 2P5BA 2VW0A 1STMA 2XJPA 4C0HA 2JD9A 1GQPA 3A7QA 2TEPA 1BVVA 4HVOA 1RVF1 5ABJA 3RZHA 1NCRA 1UQXA 1IKPA 3H1WA 2OZ6A 3LZZA 4AWDA 3IZOA 1UPIA 3IDEA 3A4UA 5A6XA 2WSVA 3AKPA 1RUC1 5EJ3A 4CDQA 4IEOA 4C90A 1RUE3 4XC9A 3MI8A 1UWWA 1DG6A 2DFBA 1RUH3 2R1DA 3ENRA 3OPWA 4ITCA 4RYDA 4XILA 4EZHA 4YM1A 5F5QA 4YW2A 4JHZA 1VBC1 2DDUA 1XU2A 4ASMB 3KM5A 4N53C 1VRH3 4RN5A 5K0UA 4F8AA 1RUE2 1GSLA 4UF0B 2R063 1RUH2 4XUNA 2RM23 1NCQB 4TWTA 2GMMA 2YYOA 1LB2A 3KGZA 3NNLA 4QKBA 1VRH2 1ZBA1 2XJSA 3E6BA 3OBZA 4YFWA 1JYXA 2R062 3UV9A 4AF9A 2RM22 3O1MA 1REDA 3AKQA 1I9RA 1SHWB 1RTVA 2V72A 3HN1A 1MS1A 5CA6A 3I54A 4UFMA 3HD8B 3RJRA 3I49A 4YGDA 1XQNA 1WCDJ 3DF0A 3AXEA 1VBB3 4YPJA 3UESA 2RVAA 1HQWA 1W8FA 3FBMA 1R1ZA 2WLQA 3PUHA 3L2HA 2WAOA 2LS6A 3VBFC 1NA1B 2QDRA 4HT1T 2LROA 2WFF1 4OZXA 4R8HA 4B29A 3H3ZA 4QD2A 1QIQA 3H3LA 1R091 5L9VA 4IV1A 4XF0A 4BWOA 4XTPA 2QBXA 1H6YA 1R081 2X09A 3DPRC 3ZFFC 3VD4A 2VUJA 3VN4A 2NZ9A 5CB7A 1CX4A 1ODNA 2EIEA 1LOBA 5AVPA 5J36A 1W6NB 2XPJA 3USUB 2A3YA 3BTXA 5FY5A 5EJ1B 4QDSA 3WDVA 3SKJE 1HV0A 4W6WA 5CZKA 4ZY9A 1JW6A 1SMVA 1HXS2 1RXGA 2PHDA 1F5JA 3CZJA 3W20A 3ZDVA 2V4VA 5DUUA 3WVJA 3WV6A 1V9U2 4K8RB 5FY7A 1VBA1 5EYYA 3PIGA 3HEIA 4K20A 1H2LA 1T6GC 3ILNA 2FCVA 5FZ1A 5FXZA 4HLTA 2EIDA 2ZHNA 3EYPA 2VVFA 5EYXA 3ZSJA 2BERA 1C1FA 4LUKA 4ES8A 4D69A 1A3KA 5EZWA 3T1MA 2JDKA 4R52A 2ATFA 1GR3A 5JR2A 5CFDC 1NCQA 5A3MA 1NXD1 2ARCA 4XFAA 1VP6A 4OULA 4LBLA 5CVRA 5FXXA 3ACHA 2YGMA 3ALQA 3D4KA 4MLOA 4QDQA 1DIWA 1HKDA 4CUGA 3ABZA 2E33A 3N7JA 5IHRA 1CAUB 1X82A 3AP9A 4BQWA 2YDEA 1OH4A 4INDA 3WG4A 5LA0A 3V0BB 4O65A 5C3OA 3JB8A 3PJYA 4HVRA 2WR9A 4XBLA 3K46A 4COYA 1REEA 3WG1A 1MVEA 3E5XA 1UY2A 1X9PA 3V64A 4DRVA 2X5IA 3ZR5A 1NA1A 5GLTA 5FWJA 1SDDB 1TE1B 4META 3FBYA 1APNA 5IFPA 2A71A 4O9GA 3KT4A 2HWF3 3WP5A 2X10A 3O1TA 5F2WA 2VMFA 3MIGA 4BYYA 3HAGA 3FHIB 4RHV3 3ON7A 2A7AA 4MUVA 4H2AA 1CJDA 2VOWA 4JKLA 5C3QA 4L0PA 1ULPA 2IC1A 4QU1A 3USUA 1SFYA 4FPOB 5FLIA 1WW4A 2F4LA 3NVCA 3KV6A 5LBFA 2CGNA 4NJ4A 3D8CA 4AFAA 1ZNPA 4RHV2 5FMOS 5DXDA 2ZEXA 2EXIA 5T52A 5F6LB 3AVSA 1A34A 4CU6A 4YW5A 2GN7A 2Y0IA 4YW1A 1TG7A 1D0GA 1EAH1 4DMIA 1PX4A 2C1FA 1ENXA 1DGRA 4JZRA 1LJ7A 4Y4RA 1F15A 4LITA 2Y6LA 4NIGA 1TMF1 4AI9A 4E8DA 1GP5A 2YUEA 5C3PA 4TSVA 4JTOA 5GZEA 4NAMA 4EYUA 1S4CA 4L97A 1UIKA 5LRSA 4NHLA 3AKTA 4A42A 4XE9A 3OBTA 4E27A 1DDLA 1BK1A 3C7HA 1S1AA 4R4XA 4A6OA 1W06A 1CONA 3NV3A 4ZS3A 5ABJC 1NCRC 3GYDA 2OUHA 1DBNA 3LFMA 1C28A 4LBKA 1W9SA 4W6YA 3AYDA 5F5AA 4CDQC 4N9IA 3B00A 1OI6A 1WCSA 3I2KA 1CAUA 3LSEA 4G3YC 2WZ8A 2QQKA 5F3IA 1W8OA 4XFBA 1WLCA 5DAVA 3HNBM 5LATA 1N47A 1YJLA 2PN5A 5FFOC 2RS53 5FP3A 3AP6A 5HCFA 1KGYA 3ZFGC 3A21A 2XB6C 4OHVA 1LOGA 4CTEA 3VBSA 4XFGA 2GMEA 1Q8VA 4RS5C 2IUWA 1SFNA 4BM8A 3H1YA 1CVNA 5C8CB 2RS52 4YFZA 3FHAA 1IPKA 2RS31 1VBD3 2BYVE 4LK6A 4GWNA 1MVQA 1TEIA 4AI0A 5DAQA 4ZS2A 1LHWA 2BQPA 3OTFA 1W0OA 3KVBA 1RUJ1 2BEOA 3JQXA 4Y3OA 5FMCA 5FKBA 4JQRA 1G8WA 3IN9A 1Q8OA 5H9RA 2D97A 5LY2A 3VKMA 3MDPA 4YVWB 3U07A 2UYBA 3VZJA 3BTYA 4DS0A 5CFCB 1SLAA 1GOFA 3AMNA 4Q8KA 1AR71 2Q30A 3MIFA 4UBGA 1QXRA 2D6KA 4AG4A 1NXMA 4JKMA 4EN9B 1AR81 3ZO0B 5EP9A 2R073 1CIYA 4LBQB 2ZGRA 3K75B 2ZGQA 4HG6B 3TEXA 4E4SA 4EWEA 4Q4X1 2RMU1 2PLV1 1QXPA 1TNFA 5E88A 5JXIA 1W8NA 3MICA 4Q26A 1XRUA 4Z8BA 2CYFA 1QJX1 4QAWA 1OF3A 4H3WA 5JDBA 1J83A 1W8WA 2ENRA 3A23A 4GB31 3VBRA 4AQ2A 1GFF2 4JAAA 5EPAA 4YG6A 3E1F1 4RR3B 4LIUA 1LOCA 4KG8A 1RJ7A 5APAA 1OBNA 3L9JT 1ZRCA 4O9EA 2RDRA 4Y20B 1JZ8A 4NRPA 1ZZ7A 4CDWA 3HQRA 1JMUB 5B4XA 3HT2A 3IMMA 4FXKB 3RMYA 5ANQA 2WWJA 1KJLA 4AXOA 1Y3TA 2W87A 4IE6A 4D7YA 3PDQA 1RHI1 1Z0HA 4I30A 1H2NA 4YG0A 2CWSA 4K6BA 4RGAA 4FQZA 2KR2A 5FDBA 5F5IA 2RE9A 1N3PA 3CEWA 5C5UA 2OVUA 1SPPA 4Y5SA 4LLFA 4Y24A 3T0AA 4PBPA 1I6XA 1KITA 1RUE1 4Q0PA 4KGGA 1B09A 3RGBA 5A3WA 3T30A 1C5IA 2J1UA 1RUH1 1RUG3 4OYUA 3UJOA 3ZXEA 5FLJA 1HB2A 1X8EA 2HYXA 1Q8PA 2I74A 3VDDA 5KWRA 5JR7B 5C8CA 3IBMA 4NHYA 4SBVA 4B3NA 3AKSA 1UOFA 4LQRA 1V6MA 2VMCA 3T0DA 1VRH1 2JB8A 2YY1A 3O12A 2E51A 1RUG2 2R061 5FZEA 2RM21 1ND3C 2JEMA 4YYOA 4LKSA 4OUSA 4A45A 4CP9A 2AZ5A 4F7ZA 2ZBJA 1H8VA 3IPVB 4QX2A 3ELNA 4LXLA 4IE0A 3H3UA 3B69A 4FP2A 3WINE 2YV8A 4Y1XA 2VW2A 3MLKA 4YVWA 2NQYA 1MQTB 1ZZCA 1Q43A 2VQ0A 5BUVA 3CLPA 4IEVA 3U4SA 2VUDA 2X5IC 4JX0A 3CJIA 4WM7C 5CFCA 5IT6A 1OQ1A 1ZM1A 2HKXA 4K7JA 5CYYA 3LEGA 5LK5A 3KF5A 2DBIA 3HWJA 1VBB1 5FPUA 2W1WA 4FPEA 4AEDB 2BWAA 4YSFA 1PHMA 1DQ1A 2RV9A 3E5QA 2VZRA 4BCUA 2RS12 5FPVA 5JZGB 1OMIA 4XMIA 2GN3A 2RJKA 3VBOC 2VW1A 2WIIB 3CHXA 2QQPA 3J9SA 2QQIA 4LBJA 2BPA2 3WCSA 1C8M2 1MEC3 4K1YA 5FZFA 3FX3A 1COV3 4Q0QA 3THDA 4NIHA 4XDQA 4H7MA 4NUBA 4CEYC 3HJRA 1W28A 4E2GA 2VOXA 4URTA 1VAKA 4DFSA 4BQ5A 3C7GA 5FZAA 1EY2A 2WJSA 4S2GA 4ZXEA 1RVF2 4U36A 2W1SA 4C1WA 2ORXA 1GP6A 3I2GA 2ZX1A 2EXJA 1YYNA 4FCAA 1ZRFA 2HBUA 4CU9A 2D43A 2OA2A 4PDWB 3ZKUA 2AR6A 3NWKA 5A6ZA 4PF1A 2E7TA 3FL7A 3VBUC 2Y64A 4JCKA 4AI3A 4AVBA 3VD3A 2IZWA 2Z5WA 1B35B 4GZ9A 1Q8SA 2DU1A 3CZUA 1XNTA 1A8MA 4KBBA 1G9DA 1PGSA 5L9BA 1QH7A 3E6DA 5FP7A 3AFGA 2JKBA 3FLTA 1PMHX 3IPVA 3ZXLA 1RYYA 2W3JA 2ZZQA 3A0NA 2OKXA 4MGZE 5KHJA 4UXAA 3TNQA 3PHMA 3LSDA 1C8NA 1QJEA 1X33A 4HBNA 5E1RA 3VD7A 1ZBA2 1DQ6A 1EPWA 1AX2A 5FQ0B 2OX0A 1MQTA 4BQ4A 3K77A 3VBSC 1JH5A 4OCTA 1YI7A 1JYCA 1EP0A 2W1QA 3GHMA 4KGQA 5FBZA 3V0AB 2RR13 2XVGA 4ZU4A 4E4ZA 2O0OA 3H7JA 3RYPA 1JOJA 3BKZA 4AHYA 4XUOA 2PAKA 4N53B 5L7OC 4ZZ5A 2W92A 4WZFA 4HPKB 3MFAA 1RGSA 5D1IA 3W59A 4AEDA 1CAWB 5EV7A 2VZ1A 1IQDC 1AHSA 3NJZA 4ISQA 1DYOA 2RR12 2WNUA 4J1XA 2DVBA 2E63A 2JE8A 2WFF2 4L2NA 5C71A 3SMHA 3J7HA 4XOGA 1S0EA 3BUCA 1R092 2AEZA 4LULA 2PYTA 1H1MA 4RGGA 4V1PA 1IPSA 1R082 4ZU7A 2HWF1 2PHXA 1PGW1 4N9HA 4P9GA 2JDUA 2F4PA 1W9YA 1UYPA 3PVBB 1NG0A 3O1RA 4RHV1 4BE3A 5K9YA 4QGMA 5AVAA 5A7QA 5F7UA 3C2UA 4XHBA 1V6NA 1CD3G 1F8VA 5FZLA 4QT6A 3VHOA 2ETEA 1H8TA 4PIXA 4FBFA 3EBRA 2VECA 1C5HA 1REFA 3BVCA 3N7KA 1NQDA 4MXWA 5FZ6A 3VBRC 4XJ9A 4A4AA 4XFFA 3ZFFB 3OPZA 1JZ4A 4CEWB 4QPGC 1CR7A 3M8LA 1U5XA 4GQ7A 4LPLA 2EXHA 1K45A 2HH9A 2XUEA 5GLWA 4CCEA 3ETPA 3T08A 5HBAA 5FWEA 3BI3A 2BDRA 4AFMA 4FAHA 4Q4Y3 5I93A 1LOEA 3I2JA 3B9IA 1PO21 4O61A 3USSA 3KB5A 4A41A 1G9FA 2DYCA 4XETA 4Y26A 1CGPA 1HLCA 2VXJA 3DL3A 3TEZA 5FR3A 1E5RA 1LOFA 2XLAA 1B35A 1VBE3 1XB9A 4HOOA 3HNMA 5DAXA 1ND2C 3IT8A 4JV4A 1UU4A 1QOOA 2XJRA 3GDBA 4Q4Y2 1CJPA 1UMIA 3SCHA 4BIOA 3AB0A 5ANNA 2D93A 5FBJA 4DUVA 2GNDA 2J1SA 1VMHA 3IIIA 4S2HA 2P37A 1FATA 2UYAA 1G7YA 3RPQA 2W39A 1VBE2 5FO8B 3NV4A 1Q3EA 4WVMA 1EUTA 5FMDA 5FQ0A 1UY0A 2CTVA 4JDMA 2CGPA 1W2OA 2IXKA 4QHOA 3AMQA 3MGUA 2Y6JA 1O3SA 5FOBB 1V6OA 2RS51 1NY71 2P3YA 2VCCA 1DHKB 1CIWA 1NLRA 1G6NA 4IEWA 4MH0E 3FUOA 1K5MA 4HPKA 4WBBA 3SH3A 1CAWA 5CFDB 1DFQA 2VD7A 2VQAA 2YFUA 4XABA 3NKTA 3V56A 3R0RA 4QPIB 2RDSA 3BALA 3MYXA 4PQQA 4Q0SA 2XKPA 3BIEA 4DPNA 1HIXA 4BLJA 4AGGA 1UXXX 1VBD1 1X9TA 2B7YA 3IDBB 3JCIA 3ZYBA 4DINB 1IS4A 5F5CA 4CE8A 4YNIA 2VC9A 4KBZA 1TNRA 5FO7B 4FXGB 2VZSA 3GZEA 1UYYA 1W6MA 1XNAA 1AJOA 1R64A 1GNYA 3KZ4C 3WDYA 3CNAA 1NUKA 3HNYM 4HANA 4XAEA 4IGPA 4IEZA 2DU0A 4BOWA 1UZWA 2J22A 1V6IA 2R071 5IK4A 2JKXA 3ZYGA 4AI2A 3RMXA 1ULDA 1DQ0A 1LU1A 1Y9QA 1YHFA 3TWIA 4GJYA 2GC2A 3JBG3 5FZBA 1SCSA 3EMRA 2C5DA 1OFSA 1GOGA 2VNRA 2A3XA 1DZRA 3WF1A 2D3SA 1JTZX 3ITQA 4QX3A 3C7FA 2JENA 1G9AA 5I8YA 2R30A 2VCBA 5I0DA 4FFFA 5LEJA 3JBG2 5I0SA 2P34A 3ST7A 2JG9B 5J48A 3JZVA 1QMJA 1VRBA 2J1RA 2P3IA 2W1UA 1MS8A 1LULA 2CU5A 3TEYA 2OIIA 2GMPA 4LK7A 1YXWA 2HEVF 4XJZA 2PXJA 5CNAA 3VZNA 4BLIA 5A1FA 4LE4A 2Q0AA 1YNAA 5FZMA 5BNPA 3ZFEC 4RQPA 4P14A 3M3CA 5H9SA 3O0WA 5AFEA 1JZ5A 1RB8G 1YO8A 5A7OA 3B3QE 4M0HA 3B94A 4LOTA 2QVSB 3GALA 2WN2A 2H6CA 1DF0A 3U75A 4HN1A 2WO1A 2AENA 1C1LA 2JX9A 1L7QA 1XYOA 4CXXA 5FYBA 4AFDA 1CAXA 3WW4A 2JJ6A 5L73A 4QX0A 1NKGA 1IKQA 3KT7A 4SLIA 3MV01 4B8EA 1ULEA 4HN0A 5HXVA 5H9QA 4QPIA 4TXWA 2RDQA 1CQ9A 4AE2A 3ACGA 1LU2A 4XZPA 3THTA 2ET1A 1I3HA 2XDVA 1DLLA 3WR0A 2W5FA 4IGQA 2CHHA 2CGOA 4YW3A 1RUJ2 3AZVA 1AR73 2RJ2A 5KXDA 3GNEA 2FMYA 4PIYA 3T3YA 4YM3A 1O3RA 3B93A 5JCTA 4D3WA 3I3EA 3OYWA 4FI9A 2G4IA 2ZAAA 3QH6A 1EUUA 1G9BA 4CU7A 5GZDA 2EIGA 2PAMA 1AR72 1Y9GA 3NNMA 1POV3 4A7KA 3OGVA 1AR82 3MLJA 3OGJA 5DABA 1GWMA 5K4LA 4Q4W3 3F2ZA 4QX5A 1V6LA 3ZMOA 5F3CA 2RMU2 2PLV2 2BOJA 4K3UA 4P5YA 1OOPC 2VCMA 1QJX2 3HQUA 5FYUA 2BNNA 1VAMA 3MHZA 1ONAA 4GB32 1AYM3 2BNOA 4XVHA 5DZEA 3ZM8A 3B9CA 4QM9A 4IQPA 1MEC1 5BV6A 1COV1 2JG9A 2DUPA 1HB1A 1RHI3 2ZGMA 4FPCA 2FQPA 4FVVA 1JYIA 3WNKA 4GD4A 4RL7A 2JDZA 1AYM2 1W04A 5F32A 2WLPA 3LQCA 4QDRA 5BNNC 5LBCA 5LWBA 4FPGA 2GC0A 1BMV2 1RHI2 3S30A 5GZGA 1AYN3 5FZGA 5D8AB 3T2QA 4P9YA 5L19A 2GU9A 3BPZA 3IDAA 4HZFA 1ZA4A 3T2TA 5C9AB 2BVVA 3FFZA 1AXYA 2G1MA 4CDXA 1LHNA 2J42A 3VDAA 3H8OA 4JGYB 1VPHA 4D6RA 1AZDA 2ZGTA 4JRAA 4KQ7A 2WZPP 4B7KA 1FX5A 4UBHA 2V5DA 3F95A 3U0ZA 5CKNA 3H8RA 3ZR6A 3T4HB 3BU0A 2DF7A 2WZEA 2FD8A 5C33A 1SFPA 2RDNA 3WHUA 2QDNA 3AXDA 4ZPIA 2NP0A 3WEZA 2ZKLA 4XIOA 2W94A 1VAVA 2ZGOA 1OPOA 5C4WC 4ZU5A 5HI0A 4XUPA 4A3ZA 5F37A 5KBFA 4NO4A 4QGNA 2WZR3 4DEQA 2GSYA 2E7AA 5FV3A 5I0UA 2ORZA 3J26N 3VHNA 3VKNA 5JI7A 1UZVA 2PTMA 3POYA 3PUSA 5FK7A 3RYKA 3WNMA 4RFRB 5DUXA 3Q9OA 5F3GA 3H7YA 4P02B 4XJAA 4XHXA 4A2UA 4CUAA 2ARXA 3MV11 1XNKA 2RR11 3NAPA 5FZHA 4XCBA 2WZR2 2BGPA 2EIBA 3AYEA 4I01A 4XCAA 1ENRA 2Z4FA 5D21A 1AXZA 2ZMLA 3TAYA 3LDKA 3BGAA 1BK0A 1VBB2 3I2IA 4UT5A 4Y4YA 1KEXA 1OD3A 3RG0A 4IV3C 4M01A 3WOGA 3OEAA 1SLCA 1ZRRA 4QM8A 2XLFA 5DUWA 3H0OA 3THPA 1OA4A 2ZGSA 3AC0A 3CMGA 4DIQA 4UW4A 4FT8A 2DURA 1YC61 1DCSA 1YQ6A 3QOPA 5DAPA 3O1OA 2VMGA 3ORJA 4MV2A 1JYWA 1BZWA 1JOBA 1JOPA 4WM7B 3POEA 2XHKA 4E2QA 4COVA 1W8ZA 2BBVA 3AP4A 3FN9A 1DLCA 1O8PA 3NNGA 3WF4A 3ZPYA 1SBEA 3LPFA 5A33B 3MW4A 1GWLA 2P3JA 3MO4A 2JDYA 4QX1A 5DAWA 1LEMA 2PHWA 1CAVB 2X8KA 4N43C 4XBQA 2AUYA 3VKFC 4BB3A 1XNCA 1NX9A 4LHNA 5C8WA 5D8AA 1UL9A 2YC4A 3KD4A 3HN3A 4AFCA 3O14A 5C9AA 4LORA 3VBOB 5FKCA 2W68A 3VBHC 4E4DX 2ZABA 2DCYA 1GANA 1J3PA 3DYMA 4WVZA 2Y26A 1QHDA 5T3NA 4YGCA 4UF0A 2IVIB 2PHUA 5JPNB 2O14A 4Q4Y1 4AAXA 3AX4A 3WDTA 1KDKA 3U4XA 3Q8BA 3SKVA 4EN8B 1UZ0A 2ZX0A 3CDZB 4UW3A 1PO11 1J1TA 3I59B 1VBE1 2XJUA 1SZBA 1OT5A 4TTGA 1Z78A 4MO3M 5FP8A 3W58A 3X29B 3WNLA 1JN2P 5T54A 3IKWA 4I0BA 3GM8A 2Y34A 5LA1A 2VMEA 1M06G 3O1VA 4JQTA 5J7MA 4GWIA 4CCJA 4FTEA 4OUEA 1GWKA 4K9SA 4HKLA 2FZ1A 1VJ2A 1HJGA 4L9BA 4XFCA 5HXMA 4KU8A 1Y9MA 3HR9A 4FP3A 3IMNA 4YGBA 5C3RA 4J1WA 1Z7S3 3HBKA 2IFRA 4Z1VA 4GH4C 4Q4V3 1OLMA 2JG8B 3W9AA 1JYVA 1GQHA 1VLNA 2YPJA 2VJXA 2J1AA 2W2IA 2MEV3 1D7PM 2ZX4A 4CSWA 3O1SA 1W8TA 4IUGA 1XOYA 3RRDA 4QQOA 1KRIA 3KWVA 1Z7S2 1W6NA 4Q4V2 5DPNA 4NPRA 3WNNA 2JWPA 3I2DA 3KCXA 4LLOA 4MGSA 3S5QA 1OA3A 2HWF2 1PGW2 5CG9A 1WLTA 3PJQA 4X8PA 2EICA 5FZOB 3WF3A 1W2TA 2WKKA 2OUJA 3FE5A 3QCWA 1PK6C 2EALA 3J8F3 5FYSA 2BFUL 3H9AA 3MF6A 2JIGA 4P08A 2D3RA 5LBEA 5A33A 2XVLA 3SHRA 1VR3A 1GNHA 1O7FA 4CP1A 1RUI3 4NPLA 4WVWA 5CKQA 3UETA 1CZTA 2ZGKA 2IXHA 4W8JA 3J8F2 2D6NA 1PO23 3NNFA 1FNYA 3NJXA 1NT0A 2W46A 3JBG1 1GZ9A 1W6QB 3KCYA 1HQNA 2VTXA 1CZSA 2Q1FA 1GZWB 1RUI2 3ATGA 4PHZA 1JZ3A 1RJ8A 3I97A 4AI1A 3T0BA 2UY9A 3TNPB 1NZCA 5IVFA 3S5AA 4DEVA 2DVAA 4CP0A 3LFIA 4CCCA 5JMOA 1KJRA 1PO22 2CDPA 4G9SB 1XE8A 1WCUA 3BN6A 1POQA 5FJKA 3VHRA 1OHFA 1PZ8A 2G19A 1O91A 3C7OA 3PIJA 2W47A 3I59A 2D98A 3ZVXA 5A1AA 3GCXA 3RFRA 3JD73 1P8JA 5G05L 1ALYA 4BZ4A 3POJA 5KC6A 2MPFA 1RINA 1VIWB 2AC1A 2OQ6A 3OGSA 2UU8A 2B42B 4FOQA 4CDXC 2VO5A 4QX8A 3IAPA 2A5ZA 4V2VA 2OPKA 3V0BA 4IW3A 1BBT3 5K0UC 4Y1UA 1SQ4A 4FPKA 3JD72 4I0WB 5JAXA 4K8FA 3NV1A 2XBO3 4W50A 5A80A 3VGIA 5A3OA 2VQUA 3MPPG 2ZXQA 5GM0A 1NY72 3VZKA 1HQLA 1BBT2 1UMZA 2YC2A 2XGXA 3FUQA 1N3QA 3W5MA 3K3OA 1JODA 2QQMA 3JU9A 1AJKA 3UKNA 1WMFA 4LBMA 4XPVA 5ACA3 4FPLA 3KHBA 3Q8CA 2DVDA 2LM3A 3VZMA 1VBD2 3BPSA 1H2KA 3VDCA 4YARA 1IZ3A 5BPXA 1JBCA 1TME3 2GP3A 4JDOA 1JZ2A 1W6OB 1ZA7A 2VM9A 2A6VA 3B01A 4YM0A 1LGNA 3DN7A 2A6XA 1PVC3 1GLHA 2WDBA 3MF9A 4IV1C 1SLTA 2WN3A 3PTRB 2DFCA 1ZBE3 1CZVA 2GNTA 5A3TA 2YHJA 1AR93 1XE7A 2BU9A 1WCKA 3JB4C 4PLNA 4XZUG 1RUD3 3S6PA 1URXA 3KT1A 3VLBB 4R9DA 3GHNA 4LMFA 1POV1 5LW9A 4P00B 5FYTA 3SQOA 2R072 1GV9A 2XUMA 2OPWA 2YXSA 4GKYA 5FYMA 3RZGA 1YIPA 3MIBA 4Q4W1 4IDZA 3TYJA 2ID4A 3I2OA 3ACIA 1GZWA 1UN1A 3W5NA 2Y38A 1N1VA 1ULCA 3NMBA 4XACA 5FXWA 3TOJA 2PHRA 3UGHA 1AVBA 1AYM1 2HBTA 4IL7A 3VL9A 4Z92B 4JGZB 1XSRA 4HL0A 3SLIA 1WA4A 3ZXGA 1BMV1 3POGA 3KMHA 4YLZA 4ZXKA 3ROUA 3WQBA 1MS3A 4RD7A 5A7SA 4HETA 2XJTA 4JRLA 2PELA 4P9XA 1JYNA 4FFIA 3NL1A 2FDIA 3LF7A 3VZOA 4CCMA 1YCIA 3LA3A 2YG0A 2QQWA 4W65A 3I3DA 3WP6A 2DWRA 4LOSA 2EAKA 2K9ZA 2ILMA 1DGRN 3I3BA 4OI0A 1AYN1 1DYKA 1QOSA 1NCQC 2VZVA 4LA2A 3NSTA 1D4M3 3AP7A 2V5YA 2RJLA 4DUXA 2VOVA 4NOTA 5CBLA 3VB9A 1NE4A 2QQUA 1XXNA 3CKHA 4OQ9A 4I3GA 1O3QA 4LE3A 3BTZA 2FCTA 1UY4A 3K4DA 3M70A 3MUY1 2W9XA 1SACA 4UWDA 4YVSB 1IS3A 5HCHA 3D82A 1LEDA 4TLFA 1OVPA 4B4PA 1NZIA 2ZGUA 2E7QA 2XJVA 2YC0A 4WM8B 2X05A 3E5UA 1W6OA 1NA1C 1JUHA 4C91A 1HDKA 2WZR1 2B8MA 3OGGA 5JOYA 4XQDA 1T2XA 1V6KA 4CDUB 4LR4A 5BNOB 4LBQA 5JOZA 5IVVA 4MGQA 4BIFA 1VB4A 3K4ZA 4IGOA 2JDNA 5FAXA 2OXBA 4GWJA 3RS6A 3P3NA 4XIKA 3J7MA 3Q8EA 1UYXA 1NLSA 2VCAA 2FCUA 3NV2A 3U1XA 3ZXFA 3FLRA 5FY0A 1LRHA 2WNVB 3HQXA 3LOIA 5J3UA 3MBWA 1O4ZA 1O3TA 4YG3A 3TBDA 3N9PA 4RR3A 4AVSA 2E9QA 5FZ3A 4Y20A 1BKZA 4LKDA 3EJKA 2HWD3 1OH3A 4JGZA 5GLUA 4DXRA 5AC91 3NJYA 1MEC2 4FO9A 1AX0A 4NIIA 1COV2 1MS9A 4M4RA 3RWNA 3OUIA 4EN7B 1BXHA 4OUMA 5A7WB 4BA6A 2HWD2 4D6QA 3CBNA 2RHPA 1HX6A 1RUOA 3I8TA 2WRAA 1OQDA 4IEYA 3ZSLA 3M4FA 1WWYA 3PU8A 2Z2SB 1CPMA 3POSA 3T4VA 4QB2A 3SITA 2QQNA 5EIYB 3VD5A 4DY3A 4MYEA 1MZ5A 2DUQA 3WW1A 2Y6HA 5TSWA 4QQPA 3KQRA 5IFTA 1TQ5A 3AP5A 4ET7A 3S7IA 4Q8LA 2WYFA 3INAA 2DVGA 2VZTA 2D6MA 1NAEA 2XLGA 3EQEA 3WW2A 4CPBD 5CAZA 2LUWA 3IDCB 2FDJA 5LASA 4YVSA 4TLGA 3WXPA 2B46X 2Z79A 1OFNA 3URFA 1BYHA 3C8XA 4WM8A 3NKGA 4CCDA 1U5ZA 2EA7A 4S2FA 4AQSA 3OBRA 2B4KA 5C70A 2YFZA 2ZX3A 5FLHA 2IXJA 1N1TA 4Y1YA 4CDUA 5BNOA 2ERFA 2WT2A 3FWEA 4B1MA 3PURA 1VB2A 4BJ0A 5A7NA 2DUOA 1I1EA 3R4DB 2A6WA 4DZGA 5JZGA 4PBOA 3S57A 1SBDA 2C4XA 4TYSA 2R041 4MHRA 3U14A 1Z7S1 4Q4V1 4U2AA 5FUNA 1O8SA 4UFLA 4R4ZA 3OCPA 3BODA 3MUZ1 2MEV1 2PQQA 2R1BA 3GJBA 4ORFA 1YQ8A 3HMYA 3P3PA 3ZYHA 2PQSA 3WX5A 2V09A 4F83A 4GAZA 3R4SA 1QQP3 2ZA9A 2GP5A 5FK8A 4GWMA 4XF4A 5LEKA 3ZN6B 3GBGA 4DRRA 2WA3A 3N9MA 3HOBA 3WDWA 3WQ0A 2GC1A 2KD7A 2VZOA 3PUAA 2L9LA 2Y60A 1V70A 3GCWA 3VBFB 3WY6A 4URAA 2Q8CA 3AL5A 3D0JA 3J8F1 1QQP2 3VL8A 2BNMA 5IWFA 3H1MA 3DPRB 1LECA 2BZDA 2PHTA 4IV3B 1UD1A 3RZMA 1RUI1 3DKQA 2ET7A 1OF4A 3D3AA 4GMP3 3WG2A 2ARAA 3M2MA 4CDWC 4PDWA 2VBBA 4IEPA 4J6GA 1QDCA 1UXZA 1ULGA 2ZX2A 1PO13 5JMCA 2DCKA 1UCXA 2XL7A 4YW7A 1Q8QA 1HRV3 2B45X 2KM2A 4L8QA 5FYIA 5KXEA 4GMP0 2TNFA 5FYVA 3TB0A 3AM2A 1PMJX 1H4GA 5IK8A 2C24A 2AYHA 2GNMA 2NPIA
chains in the Genus database with same CATH topology
1PO12 4HKOA 1XU1A 3JD71 3APBA 4N43B 1HRV2 1Q5OA 3VDDC 2SBAA 5C8CC 3V0AA 4YZ4A 4XFHA 5CG8A 3VBHB 4B4RA 1BBT1 4N53A 5KHHA 2SLIA 5EWSA 1YRZA 1ZVFA 3RQ0A 2K0GA 1N1SA 2XBO1 4M3CE 4OHWA 2H0BA 1LHVA 4GXLA 3JUUA 4IERA 3CU7A 3AZYA 2CWMA 3RJ2X 5HCBA 1KFUL 3BB6A 4YVWC 4Q0UA 5CFCC 3CJIC 1LKNA 1F9KA 2PA7A 3EO6A 5SV8A 3M3QA 2V73A 5ACA1 2O8QA 3KGLA 4AQTA 4LO5B 3SNMA 2Q1MA 2JECA 1TME1 2O1QA 3VBFA 4XMAA 1UX6A 3ZDSA 1OLQA 1FT9A 1PVC1 2P17A 2HWE3 3N36A 2D5HA 2A6YA 2FHRA 4GH4B 4NVPA 1ZBE1 4QXKA 5HCAA 4HMZA 4MGYE 3ZFFA 1AR91 3DPRA 3GZTB 4CEWA 4RR3C 4E9KA 5KC5A 1RUD1 3M7AA 2G9FA 2Q8OA 3U10A 1HV1A 2HWE2 1ULFA 1O4TA 2JXAA 3KSCA 2DCZA 2VNGA 4FPHA 2Q4SA 4LBNA 5T55A 1QJY3 2ZGLA 2GNBA 2ARBA 4XXAA 2Z69A 3AZXA 1AX1A 3SXWA 1QY4A 5A3LA 4OI2A 3OF1A 3WP4A 2OYZA 1PK6B 4A3XA 2NN8A 1DZTA 2WQ4A 4HK8A 2B5HA 2UWBA 5F1RA 1QJY2 4XYXA 3BIWE 4FPFA 3ZIXA 1FAYA 2HJIA 2Z42A 3SCGA 2FZ2A 2R32A 4QPYA 4AI8A 3U11A 2VMIA 5KXCA 2AGSA 2H0VA 5FRAA 4AFBA 1X7NA 3PMSA 3WUCA 3ZSKA 4KWJA 1F5FA 4HSLA 1YFXA 5DG1A 1D4M1 5CFDA 5ABJB 4N7UA 1NCRB 1PMIA 2QE3A 1SEFA 2EAAA 4CDQB 2A6ZA 3H8UA 5I91A 1MQTC 4HK9A 3AMMA 1WMEA 1UPSA 1PIV3 3CF6E 2YMZA 3VKOA 4KU7A 1QJU3 4S2DA 2KA3A 5K0UB 1ZZ8A 3PVNA 2BFUS 3WHTA 3ZFGB 4AEDC 1OSGA 3MPBA 1LOAA 5JZGC 2WNUC 4RS5B 4XJUA 2WL1A 1QJU2 4AVTA 1LCLA 1AL23 2ZZJA 5JI9A 3AKRA 3WQ7A 4AGRA 1WD4A 5IUQA 1XYPA 5CU1A 4LEJA 4NHKA 2DV9A 1BEV3 3MIDA 4AHXA 4PLMA 4CYDA 2FBEA 4Q4W2 4YRDA 2NMNA 1PZ7A 2W0XA 1UF2C 4DY5A 1NOVA 1H8TC 4X8NA 5H9PA 2HWD1 3O0XA 4TZDA 1H4HA 3AJZA 2ZMKA 1RMU3 5AFBA 4H14A 2VUAA 3ES1A 5BYNA 4LNVA 2XVKA 1E57A 4H55A 1WW7A 1Q56A 4UW5A 5JIUA 1LOFC 2IXIA 1B35C 3TN93 4XQWA 1S0IA 1AYN2 4LT5A 3ME2A 1EV13 1W6PB 2CNAA 2ZHMA 1YFWA 3TRSB 4Y5Z0 4LO4B 4AVAA 2BGCA 3DV8A 3G7DA 3GZAA 3TN92 5T50A 1DZQA 3ZSEA 3WUDA 3I7DA 1EV12 2PHLA 1ZYBA 4D7SA 5E89A 5DUVA 2CV6A 1G86A 4EV0A 1L3JA 1MS4A 3ZFGA 2QNKA 1K5MC 1FV2A 3MEPA 4AYUA 5KHIA 1EYBA 1ENSA 2ZJCA 4RS5A 4D7TA 1UAIA 2WQZC 3VKLA 4CRQA 3RSJA 2ZPXA 3QH7A 4AEKA 2I45A 1ND3B 2CAVA 2DCJA 5GJ6A 1D2SA 5J09A 4LA3A 2LTNA 5KXBA 2D6LX 4YZ3A 1WBLA 1YIFA 1HW5A 1OPMA 1X50A 4MXVA 5AC93 1GQGA 2ZGPA 4OHYA 2X5IB 1AF9A 1UZZA 4MSVA 5GKAC 3ZXKA 1QQP1 4Q27A 2QFEA 1UIJA 4CEWC 4Q29A 3ZYRA 1J1LA 2HEYF 2GZWA 5FREA 5AC92 4FAGA 4B7EA 4M3CB 4XTMA 4QQ2A 4ISRA 2E53A 5K8SA 4OLLA 1FPN3 4I02A 4Q1RA 1ZZBA 2XG3A 1HXS3 5KHGA 1RUNA 4YZ2A 4M3CF 3JQWA 3S0MA 1V9U3 2A73B 4JGYA 4GMP1 1HRI3 3NW4A 3WW3A 1MS5A 4OHZA 4CEYB 1FPN2 5SV5A 1W6PA 3R6SA 1S0CA 1LHUA 2P2KA 2W52A 4QHBA 5BNPC 4WV8A 1HRI2 4RQPC 1CN1A 4X6QB 5E8AA 1HRV1 1YLLA 2HEWF 2ZHLA 2D3PA 3PTYA 3LCPA 4P9IA 4QMAA 3ASIA 1UKRA 3D5OA 3B02A 3S7EA 2UWAA 2FMDA 2AH2A 3DUIA 3IM0A 4M0NA 4BHPA 3FZ3A 4PIZA 2BVBA 5GZCA 2VU9A 4N7IA 2N7GA 2R043 3LWCA 1FMD3 1EPZA 4MGKE 4QPIC 3VBUB 3ZIWA 1RIRA 3MLLA 3GBFA 4PCRA 3MIEA 2BW8A 1IS5A 1DQ4A 4DOUA 1ND3A 4G4FA 3VV1A 3AMPA 3IWZA 2DVFA 2R042 1FMD2 1YUDA 1U12A 1DYPA 1H30A 1QNYA 3VBSB 2MEV2 5J98B 4YGEA 4WM7A 5J96B 5JWPA 4IETA 2WFPA 2HWB3 2VMHA 4AHWA 4COZA 4YZ5A 1UU5A 3NO8A 5L7OB 1WUVA 2W08A 3CL1A 2PFWA 1LTEA 3T1LA 4M3CA 4C1XA 2G9GA 1CAVA 2HWE1 2HWB2 2DTWA 2IWGB 4ZKTB 4HFSA 1I5ZA 5FCCA 3VZLA 1IQAA 3VBOA 4X6RB 1IPJA 1MACA 5BNQA 4IEQA 4WVVA 2JG9C 2VNOA 2JE9A 3MZHA 2BUKA 3LB9A 4CEYA 3SISA 3PNAA 4MVTA 2MNGA 3FMGA 1J58A 2K2SA 5I8SA 1MS0A 5T5PA 1QJY1 1X36A 2QJVA 4H7LA 3E6CC 2ES3A 3UL2A 4WZCA 2GH8A 4MGIE 2VH9A 2X53S 1V00A 1A78A 4XF9A 1IS6A 5I0RA 4F3JA 4R9CA 1BCXA 3VBRB 4JTNA 3I4IA 4XF3A 4QPGB 2GAUA 5FO9B 2XJQA 1O4YA 3ZN4A 2WS91 4CDWB 1DQ5A 5JOWA 1IGOA 1PGL2 3OD4A 3VBUA 3CJXA 4LHLA 2JG8A 4K21A 2EF6A 3OD0A 3HIFA 1CPNA 1ND2B 2R0HA 1QNWA 2XBO2 1QGLA 4XXPA 4LTAA 4Y1ZA 1MZ6A 2O8OA 2F6BA 1AR63 4MZUA 5DG2A 1X8MA 4RFT0 1FI2A 1SCRA 3FLPA 1N1YA 1WLDA 3SCFA 2R6QA 1PZ9A 4L11A 3VDDB 3NAPC 1QJZA 5ACA2 2VGDA 1PIV1 4COUA 1AR62 3KS7A 1RUF3 1QJU1 1DGWA 1KQRA 3PVOA 1LODA 4FOYA 1F31A 3O5SA 5L7OA 1YFUA 3HT1A 1TME2 1XNBA 4IEUA 4KG0A 3B5LB 1PVC2 4QQHA 5DDJ1 1RUF2 1UU6A 4M00A 5FOJB 1AL21 3PLQA 2ZTNA 2EVXA 1ZBE2 3MW2A 1WLWA 2WA4A 4GALA 3ACLA 1Y7BA 4XEZA 1AR92 1OQEA 3BCWA 1R1A3 1W6QA 3CJIB 5GLVA 4BMEA 4AEJA 1RUD2 3ZYPA 3LAGA 3UKVA 4KWKA 4GKXA 4LHKA 1FOD3 1BEV1 1O5UA 5E16A 3RYRA 3WDUA 2CGPA 4I09A 3QLQA 4EN6B 3ZMNA 4OVEA 1H9WA 1MZFA 1KXGA 1R1A2 1ASJ3 1FOD2 5D8AC 3ETQA 1SDWA 3RDIA 5C9AC 1MR5A 5I8TA 4Q2FA 1LGCA 1U0AA 2QZ3A 3A0KA 1RMU1 1XNDA 4JGYC 2VULA 5EXOA 1ASJ2 1PNFA 4QPGA 1DQ2A 2UWCA 4AGVA 1J3QA 3BOPA 1W2UA 4A7ZA 1BQPA 5A32B 4EROA 1LHOA 2ZHKA 3POWA 3WG3A 4QQLA 2NMOA 4PF5A 1UW8A 2GALA 1S2KA 1ENQA 1BJQA 3TN91 1RL3A 1WW5A 2D40A 3ZX7A 3ZXJA 5L36A 1ND2A 3M3IA 3QD6A 1EV11 3KLSA 3N7LA 1D4M2 1WBFA 3M3EA 5BXXA 3C3VA 4EJRA 1W39A 1FYUA 4B4QA 1YJKA 4FQ4A 4KWLA 3ZFEB 1NYWA 1WW6A 2IFWA 1DGWX 4FSJA 2WWSA 3RNSA 1Y43B 4AW7A 2ZCWA 4FTBA 4XFIA 1D4VB 3ZSMA 2VG9A 2D44A 3ILRA 4L99A 1C57A 2HWC3 4COWA 4QU2A 4AVVA 1QKQA 5T5JA 1GZCA 4HSJA 1H0BA 3UJQA 4YW4A 2EXKA 2Y0OA 4FOVA 4NWVA 4ATEA 2CAUA 3DKWA 1BVP1 2HWC2 1PVXA 2PHFA 4P5HA 4DXZA 4BQ1A 2RS13 3SH5A 4EWAA 3R4UA 1OA2A 3WT3A 4PQ9A 2NYYA 4YZ1A 2PAEA 2XWJB 2WC2A 2KXLA 1ZREA 3FFQA 3AJYA 2NM1A 1C8M3 3N35A 2WNUB 1GKBA 1H2MA 2ZKNA 4I0AA 3WQ1A 1CESA 5GALA 1KFXL 2D6PA 2QZ2A 4NN0A 4D94A 5JIAA 2XKOA 4ONUA 1H9PA 2ZGNA 2R49A 2YROA 2TUNA 3N3HA 1OOPB 5A32A 1FPN1 3K48A 2OW4A 1HXS1 1J3RA 1RVF3 5B2GB 4AK3A 1JXNA 2JICA 1V6JA 3LGRA 1V9U1 4ASLA 1S0BA 3M3OA 1RUC3 1HRI1 5LEKA 2Q5TA 5FMOL 5JLVA 1H8TB 3ZXDA 4NR1A 3RZZA 3OY8B 1S55A 3LKJA 1S2BA 3VUOA 2H6BA 4MXWB 1GBGA 1VBC3 4W6XA 5BNNB 1RUC2 2E6VA 4L92A 5CADA 4LO8A 5JOXA 3ZFEA 4FTSA 4JDNA 3EXUA 4XQ4A 1UKGA 3D0SA 4MX3A 5EFUA 3WP3A 1C4RA 5LRRA 1LENA 1VBC2 2JG8C 3WCRA 3WLUA 1ZBA3 4OHXA 1SLBA 2XL9A 4EWDA 1YFYA 2JD4A 3AFKA 5CIRA 4OFGA 2VVDA 4P9JA 1D2QA 1KDMA 1S0DA 4QGLA 1S0FA 3MW3A 1FMD1 4RSUA 3AZWA 3LA2A 4WVMB 3ZXAC 2CY6A 2WNVA 5C4WB 3MFCA 4XW3A 2VOKA 3BOWA 2D5FA 2WFF3 5IK7A 4Z82A 1R093 2DTYA 4KL1A 3AZZA 2CL2A 2GDFA 3QACA 5GZFA 1R083 1N3OA 1K5MB 2BTVC 4P9WA 1FXZA 3ILFA 3O7OA 4K40A 4XBNA 4Z07A 3K51A 4HKWA 5KHKA 2HWB1 3AMHA 3CO2A 2C9AA 1QF3A 1J59A 1C3HA 1QXJA 4E2SA 3BTAA 1G9CA 1A8DA 1DGLA 5GLZA 2HYKA 1OD5A 1A6CA 4JVAA 5DZFA 1SLIA 1OOPA 2WNEA 4HVQA 2UURA 1W6MB 3ZYIB 1KS4A 3DGTA 3M1HA 3QBQA 4UW6A 2NLRA 4Z2WA 5K7PA 3AK0A 2LALA 2ZOEB 3FC0A 2I07B 2OZJA 3KCCA 1VBA3 1LGBA 3AYCA 3EHKA 4R9BA 2Q1ZB 2P3KA 3OY8A 3ES4A 1M4WA 1YWKA 3GBWA 1JUIA 5BNNA 4ATFA 1KD7A 4Q1PA 1VBA2 1QU0A 2VVEA 4A7YA 2ZAHA 1GICA 1PGL1 2R16A 3UK9A 2GH2A 5F6KA 1MZEA 4ES9A 3LOBA 3RI8A 1OKQA 1KS5A 4KNCA 4XJ8A 1DU3D 1RC6A 4IESA 5BNPB 1IOAA 4RQPB 5C4WA 1U5IA 2BWCA 2C0ZA 3J4UH 1AR61 4AEMA 3WZ1A 4CZSA 1PM7A 2D7FA 3ZN6A 1WD3A 3ECQA 2VXRA 2XWBB 5JSPA 3VHPA 3BU7A 4GULA 4KH9A 1CAXB 4NWWA 4Y22B 4PLOA 4RA0A 4K1ZA 2QKDA 1RUF1 1ZZ6A 5BY5A 2UY8A 3RI9A 1NE6A 1YI9A 4DB5A 2A3WA 5T5OA 2ZS6B 1FV3A 2VY0A 4I3PA 1H1AA 4IV3A 4PJYA 1ZRDA 1FNZA 5FPXA 3MIHA 3H50A 1S0JA 5J37A 3HBZA 3OYWB 4JGZC 3D6EA 4OI1A 5JPMB 1R1A1 1EAH3 2A75A 1QDOA 1AUYA 4P9LA 1FOD1 2DCTA 1AXKA 1TMF3 1IHMA 3SH4A 4EN0A 1QH6A 2X29A 2IXLA 1ASJ1 1QOTA 1EAH2 4FPYA 4IEXA 2AREA 4AVCA 3O0VA 4N43A 4R9AA 2WS93 1WMDA 1TMF2 2XH6A 1AL0G 5FTTC 2I2SA 1GNZA 3VBHA 4BPZA 1W0PA 3GF6A 2GC3A 4CP2A 4JC1A 1OLRA 2D6OX 5F9TA 2WS92 2R0FA 1LR5A 4AHZA 4YVSC 5I0TA 3ZYJB 3PMEA 3WNXA 4XJWA 3N7MA 1O5LA 4WM8C 4GIQA 1PNGA 5T5LA 4C0BA 3GZUC 1GYKA 1U5YA 3E97A 2ZACA 3R05A 4AQ6A 3IIAA 4DQAA 2QCSB 4CDXB 1S0GA 4LO7A 4CDUC 5BNOC 2RS33 1RUG1 1SBFA 2YZ4A 5FPZA 2JE7A 1RITA 4FPJA 4I2OA 5JVVA 4Y22A 4XF1A 2MHFA 3OJBA 4GA9A 3LA7A 1PIV2 1RUJ3 5DDJ3 3UKTA 1UZYA 3ZN5A 4LUMA 2WINB 1LESA 1WGPA 4GH4A 4Y1VA 2A70A 2RS32 2VPVA 2WNVC 3G6JB 4DNYA 4BMBA 2HWC1 4NHMA 2QUOA 4LO6B 1SLLA 3WD5A 5DDJ2 2WT1A 1ZZ9A 2WSUA 5LK7B 3FJSA 1AL22 3V65A 1AR83 4LBOA 1ZX5A 4OI4A 4N90A 4Q4X3 2RMU3 2PLV3 2RS11 3B7MA 3NAPB 1F2NA 3N4MA 1BEV2 5DZGA 4IV1B 1NQJA 1QJX3 1PK6A 1XYNA 2TBVA 4GB33 4BH9A 1VALA 5JSOA 2WT0A 1C8M1 4Q4X2 1H1IA 1D0HA 2ZMNA 3WDXA 4IXLA 4PDWC 3AYAA 3PVEA 4Q0VA 2YGLA 5IK5A 3L2YA 1JHNA 4LBQD 2IXCA 1POV0 1RMU2 1QWRA 2B39A 5JSRA 4FOWA 2B9UA 2VW0A 2XJPA 4C0HA 2TEPA 1BVVA 4HVOA 1RVF1 5ABJA 1NCRA 1IKPA 3H1WA 2OZ6A 3LZZA 4AWDA 1UPIA 3IDEA 3A4UA 2WSVA 3AKPA 1RUC1 5EJ3A 4CDQA 4IEOA 4C90A 1RUE3 3MI8A 1DG6A 2DFBA 1RUH3 2R1DA 3ENRA 4ITCA 4XILA 4YM1A 5F5QA 4YW2A 1VBC1 1XU2A 4ASMB 3KM5A 4N53C 1VRH3 4F8AA 5K0UA 1RUE2 1GSLA 2R063 1RUH2 2RM23 1NCQB 4TWTA 2GMMA 2YYOA 1LB2A 3KGZA 1VRH2 1ZBA1 2XJSA 3E6BA 4YFWA 2R062 3UV9A 4AF9A 2RM22 1REDA 3AKQA 1I9RA 1RTVA 3HN1A 1MS1A 5CA6A 3I54A 3RJRA 3HD8B 4YGDA 1XQNA 1WCDJ 3DF0A 3AXEA 1VBB3 1HQWA 3FBMA 1R1ZA 2WLQA 3L2HA 3VBFC 1NA1B 2QDRA 4HT1T 4OZXA 2WFF1 4R8HA 4B29A 3H3ZA 4QD2A 1R091 4IV1A 4XF0A 4BWOA 4XTPA 1R081 3ZFFC 3DPRC 2VUJA 3VN4A 2NZ9A 5CB7A 1CX4A 1LOBA 5AVPA 5J36A 1W6NB 2XPJA 3USUB 2A3YA 3WDVA 1HV0A 4W6WA 1JW6A 1SMVA 1HXS2 2PHDA 1F5JA 5DUUA 3WV6A 3WVJA 1V9U2 1VBA1 5EYYA 4K20A 1H2LA 1T6GC 3ILNA 4HLTA 2ZHNA 2VVFA 5EYXA 3ZSJA 1C1FA 4LUKA 4ES8A 4D69A 1A3KA 5EZWA 3T1MA 4R52A 2ATFA 1GR3A 5CFDC 1NCQA 5A3MA 1NXD1 4XFAA 1VP6A 4OULA 4LBLA 5CVRA 3ALQA 2YGMA 3D4KA 4MLOA 1DIWA 1HKDA 3N7JA 1CAUB 1X82A 3AP9A 2YDEA 4INDA 3WG4A 3V0BB 3JB8A 3PJYA 4HVRA 4XBLA 4COYA 1REEA 3WG1A 1MVEA 3E5XA 3V64A 4DRVA 2X5IA 1NA1A 5GLTA 1TE1B 4META 3FBYA 1APNA 2A71A 4O9GA 3KT4A 2HWF3 3WP5A 3MIGA 4BYYA 3HAGA 3FHIB 4RHV3 2A7AA 4MUVA 1CJDA 2VOWA 2IC1A 3USUA 1SFYA 4FPOB 5FLIA 1WW4A 3NVCA 2CGNA 3D8CA 4AFAA 1ZNPA 4RHV2 5FMOS 5DXDA 2EXIA 5T52A 5F6LB 4YW5A 2GN7A 2Y0IA 4YW1A 1D0GA 1EAH1 4DMIA 2C1FA 1ENXA 1DGRA 1LJ7A 1TMF1 2YUEA 4TSVA 4JTOA 5GZEA 4L97A 1UIKA 5LRSA 4NHLA 3AKTA 4XE9A 3OBTA 4E27A 1DDLA 1BK1A 1S1AA 4R4XA 1CONA 3NV3A 5ABJC 1NCRC 3GYDA 2OUHA 1DBNA 1C28A 4LBKA 4W6YA 3AYDA 4CDQC 4N9IA 3B00A 1OI6A 1WCSA 1CAUA 3LSEA 4G3YC 4XFBA 1WLCA 1N47A 1YJLA 2PN5A 5FFOC 2RS53 3AP6A 5HCFA 3ZFGC 2XB6C 4OHVA 1LOGA 4CTEA 3VBSA 4XFGA 2GMEA 1Q8VA 4RS5C 1SFNA 4BM8A 3H1YA 1CVNA 5C8CB 2RS52 4YFZA 1IPKA 2RS31 1VBD3 2BYVE 4GWNA 1MVQA 1TEIA 4AI0A 5C6CA 1LHWA 2BQPA 3OTFA 1W0OA 1RUJ1 2BEOA 3JQXA 4JQRA 1G8WA 3IN9A 1Q8OA 5H9RA 2D97A 3VKMA 3MDPA 4YVWB 3U07A 2UYBA 3VZJA 4DS0A 5CFCB 1SLAA 3AMNA 4Q8KA 1AR71 2Q30A 3MIFA 4UBGA 1QXRA 2D6KA 4AG4A 1NXMA 4EN9B 1AR81 3ZO0B 2R073 4LBQB 2ZGRA 2ZGQA 4E4SA 4EWEA 4Q4X1 2RMU1 2PLV1 1QXPA 1TNFA 5E88A 3MICA 4Q26A 1XRUA 4Z8BA 2CYFA 1QJX1 4H3WA 5JDBA 4GB31 2ENRA 3VBRA 4AQ2A 1GFF2 4JAAA 4YG6A 4RR3B 1LOCA 4KG8A 1RJ7A 3L9JT 1ZRCA 4O9EA 4Y20B 1ZZ7A 4CDWA 3HT2A 4FXKB 3RMYA 1KJLA 4AXOA 1Y3TA 4D7YA 1RHI1