3IDEA

Structure of ipnv subviral particle
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
423
structure length
415
Chain Sequence
ATATYLKSIMLPETGPASIPDDITERHILKQETSSYNLEVSESGSGVLVCFPGAPGSRIGAHYRWNANQTGLEFDQWLETSQDLKKAFNYGRLISRKYDIQSSTNGTLNAATFEGSLSEVESLTYNSLMSLTTNPQDKVNNQLVTKGVTVLNLPTGFDKPYVRLEDETPQGLQSMNGAKMRCTAAIAPRRYEIDLPSQRLPPVPATGTLTTLYEGNADIVNSTTVTGDINFSLAEQPADETKFDFQLDFMGLDNDVPVVTVVSSVLATNDNYRGVSAKMTQSIPTENITKPITRVKLSYKINQQTAIGNVATLGTMGPASVSFSSGNGNVPGVLRPITLVAYEKMTPLSILTVAGVSNYELIPNPELLKNMVTRYGKYDPEGLNYAKMILSHREELDIRTVWRTEEYKERTRVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP2
publication title Crystal structure of an aquabirnavirus particle: insights into antigenic diversity and virulence determinism
pubmed doi rcsb
source organism Infectious pancreatic necrosis virus -
molecule tags Virus like particle
total genus 98
structure length 415
sequence length 423
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ideA01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 3ideA02
1B35B 1COV3 1C8M3 1NCRB 2WS93 2RS11 1OHFA 4IV3C 5C9AB 1ND2C 2RR13 1AR92 1OOPB 1VBD1 1ASJ1 1PVC1 2XBO3 4QPIC 1PGL2 1FPN3 1AR63 1BMV2 1D4M2 1ND2B 1AR72 1VB2A 5K0UA 1BEV2 1QJX3 5ACA1 1FOD3 1F2NA 1AL0G 1QJY3 5DDJ3 2R063 2R072 2MEV2 1ASJ2 1PVC2 2WZR3 3DPRA 5A32B 4PDWB 2BBVA 2VQ0A 3JBG1 5AC93 1M06G 3TN92 5GKAC 2GSYA 4Q4V1 1NCQA 1H8TC 2BFUL 1RUC2 3DPRC 4CEWA 1AYM2 1FPN1 4Y4YA 1H8TB 1R093 1Z7S1 1HRI3 1QJX1 1RUD3 2ZZQA 3VBHA 1POV1 4Q4V2 1W39A 4RR3B 3VBFA 1AUYA 5DDJ1 1R1A1 4CDUA 4RS5B 1V9U3 4QPGC 2WZR1 2GH8A 3JD72 4QPGB 1K5MA 5AC91 1VBA2 4Q4W1 1QQP3 4CDWC 1D4M3 5BNNC 1VBB1 5C8CB 1VRH3 1ZBA2 3ZXAC 3VBFC 1BEV3 5ABJB 4CDWB 2PLV3 1ND3C 5BNNB 4GB32 1RUG1 1HXS2 2RS13 2X5IC 5CFDA 3ZFFA 4RQPC 3VBOC 1ND3B 1NY71 2R073 1QJU2 1VBD3 2MEV3 1ASJ3 1K5MC 1PVC3 2R042 2X5IB 1FMD2 1HRI1 4RQPB 3VBOB 3VBUB 2HWE1 2RS52 1NCRA 1RVF1 2RS32 4GMP3 1BBT2 1RUE1 3TN93 4IV1C 1VBE1 1OOPA 3VBSA 1RUH2 1C8NA 3HAGA 4IV1B 5CFDC 1AR91 4Q4Y2 1NA1C 1PGL1 1BMV1 5JZGC 2ZTNA 3JBG3 1AR71 1RHI2 4JGYB 1NA1B 1PIV2 4AEDC 1NCRC 2XPJA 1BEV1 5JZGB 5FMOS 3JB8A 5A32A 4AEDB 4Q4V3 1OOPC 3VBSC 4PDWA 1HRV2 2R071 1AYN2 3VBSB 1VB4A 2MEV1 2ZAHA 4NWVA 2WFF2 3JD73 5L7OC 4RHV2 1Z7S3 4GMP1 3TN91 3VDDC 5L7OB 1POV3 5BNOB 1ZBA3 2RMU1 1POV0 1RUI2 2HWF2 3VDDB 1R1A3 4PDWC 3S6PA 4WM7B 1EAH2 1H8TA 1EV12 1RUC1 1AYM1 4RR3A 1PO12 4Q4W3 4JGZB 4RS5A 1HQNA 1PO22 1VBB3 5CFCB 2RMU2 2RS53 3J8F2 1F8VA 1TME2 4SBVA 5A33B 4QPGA 1SMVA 1RUG3 2WWSA 1VBC2 3JD71 1R082 2RM22 3CJIB 5C8CA 4YVSB 4Q4Y3 4RR3C 5ABJA 1VBA1 4CDWA 4WM8B 3VBRC 5BNNA 2HWE3 4RS5C 4FSJA 1MEC2 1RVF3 1PIV3 1ZBA1 1NG0A 1RUE3 1E57A 4GH4B 5J96B 3VBRB 1ND3A 4Q4X2 1VBE3 4RFT0 4GB31 1ZBE2 2X5IA 4RQPA 3VBUA 1HXS1 3VBOA 1RUF2 1AR82 4FTSA 1HRV3 1AR93 1QJU1 5C8CC 2R041 1FMD1 5ABJC 2FZ1A 1AR73 1QJZA 1COV2 2RS51 1C8M2 2RS31 2WS92 4IV1A 1BBT1 2RR12 3ZFGA 1RUH1 4YVWB 2XBO2 2QQPA 2HWF3 3VBUC 3ZFEC 1AR62 2BPA2 1EAH3 4CDQC 4JGYA 1NA1A 4Q4Y1 3ZFEB 5JZGA 1FOD2 1GFF2 4CDQB 4N53B 4AEDA 1RHI1 1RMU2 1PIV1 1QJY2 1RUJ2 4GMP0 2R062 2Y26A 5D8AB 2RMU3 3ZFGC 1RB8G 1HRV1 1AYN1 3ZFGB 4JGYC 1RUC3 1AYM3 2WFF1 1X36A 5L7OA 2RM23 5BNOA 1MQTA 1AL22 4RHV1 3VDDA 4WM7A 5BNPB 3NAPC 2HWC2 1RUI1 2HWF1 3NAPB 1EAH1 1EV11 1R092 4N43C 2HWB2 4JGZA 1RUD2 1RUF3 2HWD2 1AR83 3LOBA 5CFCA 4CDXB 2DF7A 1PO11 5BNOC 4N43B 4NWWA 1MQTC 1VBA3 5C4WB 5A33A 1PO21 4WM7C 1V9U2 1MQTB 3J8F1 1TME1 3FBMA 3CJIA 4LLFA 4GB33 4YVSA 1VBC1 1HXS3 4WM8A 4IV3B 1QQP2 4JGZC 5FMOL 1R081 2RM21 1QJU3 5CFCC 1VRH2 4GH4A 4QPIB 2R043 1FMD3 1CD3G 3VBRA 2BFUS 2TBVA 2PLV2 2RS33 1MEC1 1RMU3 2RS12 1BBT3 1RUJ3 1TMF1 3M8LA 4Q4X1 3CJIC 1VBD2 1RUH3 1ZBE1 4YVSC 1RUF1 4WM8C 1AR81 3JB4C 4EJRA 4GH4C 5K0UC 5ACA2 1RHI3 4YVWA 1COV1 1C8M1 5K0UB 1HX6A 1AL23 2WS91 1TMF2 2RR11 4BCUA 1NOVA 2XBO1 3ZFEA 2HWC3 4CDQA 1AR61 4N53A 2IZWA 3JBG2 1AYN3 3DPRB 5J98B 2HWB3 2WFF3 2HWD3 1FOD1 5D8AA 1RMU1 1WCDJ 4RHV3 4YVWC 1QJY1 1RUJ1 2R061 1NCQC 1PGW1 1RUI3 1FPN2 4CEWC 1EV13 4N53C 1NCQB 1Z7S2 1QJX2 4CEWB 5BNPA 1X33A 3IDEA 3VBHC 5D8AC 1PO13 1VAKA 1AL21 5DDJ2 1R1A2 3NAPA 3VBHB 1PO23 4CDUC 4CEYA 2WZR2 1PGW2 3VBFB 3J8F3 2HWC1 1IHMA 1TME3 4CDUB 4CDXA 5AC92 4N43A 1R091 1VBC3 5C4WA 1CJDA 2HWB1 4Q4W2 1RUD1 2HWD1 4FTBA 1R083 5BNPC 1VBB2 2WLPA 1OPOA 1B35A 1K5MB 2BUKA 4Y5Z0 5ACA3 5C9AA 1DDLA 1V9U1 1RUG2 1MEC3 4CEYC 4IV3A 1TMF3 4Q4X3 1NY72 1ND2A 3ZFFC 4CDXC 4CEYB 1ZBE3 4QPIA 5LK7B 4FTEA 1HRI2 4Z92B 5C4WC 2FZ2A 5CFDB 3ZFFB 1QQP1 2HWE2 1D4M1 1RVF2 1VRH1 5FOJB 1A6CA 1B35C 1RUE2 2PLV1 1VBE2 5C9AC
chains in the Genus database with same CATH superfamily
1COV3 1C8M3 5JPNB 3R4SA 3AM2A 2WS93 3NMBA 5FYYA 3POGA 3VZKA 2JG8B 5FY9A 5F3CA 1ND2C 5JCTA 1VBD1 2XLFA 3H3LA 2WQZC 3LFMA 2Y60A 4IETA 4UXAA 1J83A 2YC2A 1GR3A 1W8FA 3ECQA 4PHZA 5FZKA 1YFWA 2ZEXA 2VOVA 5IJRA 4B7EA 5EHDA 1BEV2 2VXJA 3J26N 5F3IA 3POFA 4XETA 3U4SA 4L99A 4QXKA 1AL0G 1LODA 1H8VA 2VZVA 3AKQA 1WMXA 3B93A 3GALA 3HBZA 4I01A 4AGGA 5J36A 3A4UA 3AX4A 1QJY3 4FT8A 4IEQA 4D7SA 4FVVA 1PVXA 2CY6A 2R072 2Z4FA 2JDNA 1OLQA 2AZ5A 2P2KA 2MEV2 3WLUA 3DPRA 4XYXA 5LWBA 3N35A 1FNZA 4PDWB 1KS5A 3GBFA 2PHTA 1DU3D 4XCAA 3P6BA 3ZPOA 2P3IA 3A0KA 4WBBA 1XJAA 3A21A 2OKXA 3WSOA 1VIWB 3PHMA 4CXWA 1LEDA 3QACA 1OQDA 3B5LB 3GZAA 4IEWA 3WDTA 2W87A 1LHOA 2X8KA 2Z2SB 1ULGA 3DGTA 4BIFA 5KHGA 1D4VB 4LK6A 3O1TA 5FMDA 1YQCA 4MGKE 4XW3A 1S0GA 2VH9A 1W6QB 1GNYA 1QF3A 3PIJA 3VL9A 5C3QA 3DPRC 3IN9A 4CEWA 5J3UA 3BU7A 4Y4YA 4LQRA 3ZXEA 5LRSA 1NXMA 5JI9A 1R093 5FZMA 2PTMA 4JQTA 4XDOA 2GZWA 5FZGA 3ZSJA 2PHDA 1RUD3 3ACLA 4PF5A 4A2UA 2BP6A 4XZPA 1PK6B 4XBLA 3KB5A 1XE7A 5HV4A 1O6UA 1AUYA 3N36A 4FXKB 1R1A1 2D6MA 4ZPIA 3U11A 4CDUA 2O8QA 2NM1A 4HETA 1JYIA 2BWAA 3LOIA 3IWZA 4GWMA 1Q56A 4AG4A 3JD72 1N47A 1FI2A 1WWYA 4HVRA 2CTVA 4NHMA 1CPMA 3EQEA 4XMIA 1DG6A 2XL7A 2ZMLA 4AI9A 4HKWA 1SHWB 3I3DA 3KCYA 4CDWC 2Q0AA 3PVOA 5LCWL 1D4M3 1Q8QA 1ST8A 5BNNC 2V5DA 4RN5A 4GKYA 5F9TA 1ZBA2 5FWJA 3N7MA 1KFXL 3N7LA 3T0BA 3OGRA 4AF9A 4YM1A 3HD8B 4BH9A 4LKEA 4YZ1A 3IB3A 3V0AA 4U2AA 4AAPA 1CAWA 4UFMA 4GB32 5CISA 4EE2A 1JODA 2WAAA 2H0BA 2XLAA 3B02A 3I4IA 1IGOA 4FPOB 1YLLA 2RS13 3K4AA 4JTOA 2VY0A 5GALA 4RQPC 3C8XA 3N9LA 3PUAA 1ND3B 1DLCA 1NY71 4P9WA 2N7GA 4FPEA 1SPPA 1X82A 1PVC3 4D7YA 1FMD2 2YU2A 3ZX7A 1ZNPA 1ZZBA 4ES8A 5E88A 4QPWA 1DYOA 2VOXA 1RVF1 3GDBA 4FXGB 2WZPP 2A6WA 4GMP3 4OUMA 1KXGA 2GMEA 1OF4A 2GALA 4Z82A 2D98A 2JG8A 3ATGA 3GHMA 4XVHA 3BTYA 3OGGA 3WOGA 1C8NA 3I2GA 1UY4A 3EB7A 1JZ6A 5A3LA 3AKPA 2R49A 5F8PA 3SCGA 2A6VA 1AR91 4DPNA 3W9AA 4Q4Y2 3QH7A 3WF2A 1L3JA 5IAVA 4FPLA 1BMV1 3ILFA 2GAUA 4L2NA 1AR71 1RHI2 4JGYB 1SBEA 2ETEA 1NA1B 1NX9A 2WUHA 2WZEA 2ZKLA 3I2JA 4UWDA 3OD0A 3U78A 4QXBA 1BK1A 5FZHA 1LHVA 2JG8C 4MGZE 1GP6A 5LK5A 4HPKB 4ZONA 4PDWA 2IFRA 3PURA 1XU1A 2ATFA 3WF4A 5H9PA 3WP4A 4DEVA 5BPXA 4BQ4A 3IPVB 1C57A 1AYN2 1ENRA 1VB4A 5CVRA 4NWVA 2IVJA 3FLTA 2AR6A 3QH6A 4XOGA 2WSVA 1ZZ7A 2TNFA 3ZN6B 5KXDA 4QU1A 5L7OC 1H2LA 3QD6A 4GMP1 3LZZA 2VD7A 4OVEA 3UETA 2KD7A 4W65A 3VDDC 3VKOA 3OTFA 1W6QA 2ZEZA 3NRUA 4CZSA 1ODNA 1Y9GA 2QDRA 5DPNA 1RUI2 5FZ3A 1VMFA 4PDWC 3B01A 1DZRA 1MS8A 3KV5A 1BKZA 3WP3A 2HBUA 2PHXA 2VUDA 3AZYA 3MF9A 3MDPA 4HSLA 2PAMA 1AYM1 1QWRA 3APBA 2XXZA 1D0GA 3R0RA 1PK6A 5IVFA 1XYOA 2XJUA 2IXLA 4LBJA 5JI7A 1UAIA 2CGNA 1Y3TA 4LOSA 2OPWA 5J7MA 4JGZB 1STMA 3Q8BA 4YZ3A 1HQNA 4COYA 5DMYA 5F7UA 4I0AA 3S57A 4JC1A 1ODMA 2RS53 1NKGA 4ISRA 3JUUA 3P3NA 2HEVF 1M4WA 4XF9A 5A3WA 1WD4A 4JKMA 1JYNA 1XPWA 4M0NA 1SCSA 3ES4A 3OBAA 2VAUA 2NPIA 3ACHA 5BV6A 3WQ0A 3T08A 2DVAA 3UK9A 2H6CA 2KM2A 4Q0VA 2RM22 3DV8A 4AHZA 3I7DA 2VCAA 3RJ2X 5FY0A 3MIHA 4XUTA 4YVSB 5FK7A 2GN7A 2WNEA 3B94A 4BQWA 1VBA1 2CWSA 1E5RA 4NMIA 4FSJA 4AVAA 1MEC2 2DURA 3KZ4C 5DUXA 1E57A 1O4TA 1UZWA 5CZKA 3WCRA 1ND3A 5ANNA 5IVEA 1CQ9A 1A8MA 1VBE3 2BGOA 5I0RA 4S2GA 2YPDA 1U5YA 4XCBA 1AR82 2B4KA 4AHXA 2D93A 1UD1A 3KCXA 3D82A 5SV5A 2VVEA 1QJU1 1REDA 4XQDA 2WBKA 3RI8A 3POIA 4GWIA 4AYUA 2R041 1HLCA 2VNVA 3AZZA 2CNAA 1Y7BA 2NP0A 2ZHLA 3T4VA 3JCIA 4DY3A 1HN0A 2RS51 4P9XA 2V4AA 4JRAA 5JR2A 5JSRA 3ZYHA 2W95A 1JU4A 3Q8AA 2AGSA 2RR12 3PMEA 1GANA 2RJLA 3DXTA 2ZGPA 1RUH1 1MVEA 3N9NA 2XBO2 4ZHNA 1OBNA 1Q8PA 3HWJA 3MBWA 2W91A 4IEUA 1H1MA 1YCIA 2Q1MA 3TOJA 4O9GA 3AZVA 3I97A 1NA1A 1V6LA 2WN2A 2WRAA 4JGYA 5BNQA 4EYUA 2PHRA 3JQWA 1QH6A 4WVWA 1P8JA 1W8TA 1FOD2 4CDQB 3C7GA 2VW1A 4FPFA 2QZ3A 5A6YA 5HCHA 2Z42A 4HPKA 5EYYA 3TB0A 3NNGA 3H1YA 2RDQA 1YHFA 2R062 5CG8A 3VHOA 2Y26A 5D8AB 3HT2A 4LTAA 1XNBA 5CA6A 3ZN6A 1G86A 4PIXA 3TEYA 1LOGA 3USUA 2QQIA 4JGYC 4XPVA 1OFSA 3WG1A 1CONA 1GV9A 4NO4A 1OQEA 5HCAA 3BODA 3OBRA 1G9FA 1AF9A 1W8UA 1Y4WA 1SG3A 5FUIA 3OB8A 2XOMA 3KF3A 3OGSA 5GLTA 4N9IA 1YI9A 2DYCA 2VW0A 3KV4A 4BPZA 4BQ5A 2ID4A 5F2WA 5FJHA 2R16A 4E4DX 5BYNA 1DZTA 3NAPC 1LULA 3LEGA 1W06A 1ALYA 1V6NA 5HXVA 2Y6JA 2VU9A 2DTWA 3H50A 4ASKA 3CLPA 3TEZA 4FFFA 2ENRA 1CN1A 1OVPA 2VGDA 2XKOA 1SDWA 3EBRA 4JGZA 4N43C 4LBKA 4O9EA 5IVVA 1MS4A 3LF7A 1DQ5A 3E6DA 1Z78A 3GYDA 1VJ2A 4XHBA 3AMNA 1NE6A 3CQOA 1YWKA 5C4WB 2YXSA 2W5FA 1DQ0A 2NZ9A 3GJAA 1PO21 3U0ZA 1V9U2 3CHXA 5JR7B 4ASLA 1JUIA 3LAGA 3I3MA 1RUOA 1XB9A 3ETQA 3J8F1 4EN9B 1W2OA 2Q4SA 5FOBB 2ORZA 1H9PA 5JVVA 3F2ZA 3I2DA 3OG2A 1N1SA 4YVSA 3LDKA 1XC6A 1HXS3 2LRPA 5DAWA 2VTFA 5J09A 4JGZC 1DYKA 3VGIA 1R081 4OUEA 4YM2A 4AI1A 2AREA 5A7OA 3UYJA 5EV7A 1X50A 2JDUA 2BFUS 1ZX5A 4LPLA 4TXWA 4ZU4A 3P1IA 1QHDA 2G1MA 1DQ4A 3BN6A 1XNTA 2RS33 1KEXA 1BBT3 2PYTA 4KH9A 2J1TA 4OULA 2A6XA 1UOGA 5F2SA 2L9LA 5F5AA 3PJQA 2WT0A 1DQ1A 1QOOA 1ZBE1 3LQCA 1ZA4A 2OXBA 4HSJA 4Z07A 4YVSC 2P5BA 4A4AA 5D2AA 1H1AA 5DUVA 3GBWA 3HMYA 1UQXA 4EJRA 3IBMA 2Y6GA 5CADA 2JEMA 4DZGA 2P3JA 2ZX1A 3EYPA 4ZZ5A 1CZSA 3BOPA 4YGEA 1X7NA 1GQGA 2B5HA 1F9KA 2MPFA 3QBQA 4KU8A 4LBQB 5F6KA 3EHKA 4K1ZA 4KG0A 4NHXA 3GXUA 2BNOA 2Q1FA 1OT5A 1UNBA 5T5JA 1MZ6A 4XZUG 3D3AA 4F83A 2C0ZA 4LE3A 3AYCA 2V72A 1J1LA 4RYDA 4GKXA 1WCKA 2VOKA 5AFEA 1K5JA 4V2WA 4E4SA 5IK8A 1LOAA 5EZWA 4CDQA 1AR61 2E31A 3WDWA 2IZWA 3IIIA 4CCDA 1KDKA 5LB6A 4QU2A 2HWB3 4BYYA 2WFF3 2HH9A 2HWD3 3BALA 4JV4A 3EXUA 1DIWA 2XJVA 5D8AA 4YW6A 4KU7A 1IQDC 5FPUA 5A7QA 3K75B 2KXLA 4A7KA 4RHV3 2EXKA 3UV9A 1Y9MA 5J48A 3GZUC 5FWEA 3HQRA 4FPJA 4QKFA 5T5PA 4XACA 1ZZ6A 5T55A 2UWCA 3USSA 2IWGB 3WP5A 1NCQC 5EFUA 4UFHA 1QEXA 3I2HA 2WDBA 1O91A 1EV13 1XYNA 1EY2A 4NIGA 3MYXA 1Z7S2 2JD4A 5T5OA 2XJPA 3E1F1 1X33A 4E8DA 2BV4A 4XJ8A 5D8AC 1PO13 3ZPYA 4Y1ZA 2XWBB 1UZYA 4UYBA 5DDJ2 3RSJA 5C7GA 1S2BA 4BDVB 1W8WA 3NL1A 4E4ZA 2P4EA 3O0VA 3FUQA 3LPGA 1Q8OA 3VBFB 3WQ1A 5I8SA 1WBFA 3MUY1 3BUCA 2VCBA 3FMGA 1UY3A 3LEIA 4PLNA 2Y8KA 3N9QA 2IFWA 1GWMA 1I6XA 4AFAA 1ZRRA 1VBC3 3IMMA 3KD4A 4URTA 5C4WA 2HWB1 2UYAA 4Q4W2 2HWD1 2V5YA 1JOBA 5FPVA 2ZX4A 1RGSA 1VBB2 1OPOA 3IKWA 3N7KA 1K5MB 3POJA 2BUKA 4FBFA 4XDQA 1LAJA 1JXNA 5IT6A 1QNYA 2VZ1A 2ZGSA 3J7LA 4AVCA 2BWCA 3LCPA 1DDLA 1MZFA 2G9GA 4UFJA 2VVDA 1NLSA 2VZQA 5T50A 3VDBA 1NLRA 2RG4A 1TMF3 4Q4X3 3WDXA 1VALA 4XUPA 2ADEA 3DXUA 4BM8A 3DYPA 4MUVA 4CEYB 1C1LA 2PHUA 2VOTA 2ZHNA 5EIYB 1XU2A 1HRI2 1Q8VA 1RITA 2NMNA 3PNAA 3TNQA 5C4WC 5CFDB 3ZFFB 1QQP1 4UW4A 4Q1PA 4YZ2A 3S7EA 4COZA 4H7MA 5FOJB 1A6CA 1W8HA 2JJ6A 4EROA 3ROUA 3WF0A 5CYYA 2KR2A 3PJYA 2XHNA 4AHWA 1FYUA 1W04A 2PLV1 2VBPA 1CWPA 3MLKA 1SLIA 3WNMA 2ILMA 3HQXA 1BVVA 1L7RA 4HZFA 2YC4A 5A7NA 1NCRB 1NT0A 3N3HA 4BIOA 5F32A 1OHFA 3TNPB 1UL9A 4JTNA 4AFCA 4I3PA 5C9AB 2D6PA 3HT1A 1U0AA 4LUMA 4X6QB 3S7IA 1LHWA 1DF0A 3H8XA 2FDGA 4XF1A 2A3YA 1FPN3 5DUWA 3V0BB 1ND2B 1DHKB 3T0DA 3GHNA 4BQ3A 3ZOIA 3TEXA 1H2MA 1QJX3 1JH5A 1PX3A 2GNTA 2QBXA 4QB6A 4ZXEA 3H42B 1D2QA 1S1AA 3V65A 3VKNA 4YW7A 5GZDA 4BU2A 2QQWA 4JAAA 4CA9A 2E26A 2CAVA 3OSDA 3BU0A 2UWAA 1VAMA 5A32B 2WZR3 4IEOA 4URAA 2YBKA 1J84A 2E9QA 4L9BA 4AFDA 2D97A 1L7LA 3AYEA 3TBDA 1LENA 1B09A 1NQJA 3WD5A 4M3CE 3JBG1 5FKBA 3RZHA 2BBVA 5AC93 1M06G 3KWVA 3OUIA 4LA3A 1Q43A 3LA7A 3K48A 3UGFA 5C3RA 1QJEA 1GLHA 4GJYA 1MS0A 2GSYA 5I0DA 1ZRFA 1V00A 4Q4V1 4K8FA 4AI8A 3OEAA 2VZOA 3SITA 4LR4A 1XBFA 3BTXA 1LU2A 1QXJA 4QAWA 4IQPA 1O3RA 1H8TC 1NAEA 1SLLA 5FV3A 3VV1A 5F5IA 1LTEA 1RUC2 3NJZA 2WLQA 2A75A 3PUQA 1FPN1 2ARAA 3AVSA 3M3QA 4XF3A 1HB2A 4C90A 2YHJA 2B45X 2BVVA 2QFEA 4E2GA 2VBBA 2ZHMA 4FQZA 2Q30A 1HIXA 4I2OA 1QJX1 2VMHA 1V0AA 1UIJA 4UFLA 4MLOA 1POV1 1UY2A 4Q4V2 2ARBA 4RR3B 3VBFA 2C9KA 4XAEA 5FUPA 4HKLA 2OZJA 2VG9A 2V09A 2X10A 1DGWX 4L11A 4RS5B 1LESA 1A78A 2O1QA 3AP5A 5IW0A 1OLMA 1PNGA 2WZR1 1W3VA 2GH8A 1J59A 1G8WA 4CXXA 4XAAA 5IWFA 3UKNA 2A5ZA 1JZ3A 1Y9QA 4L0PA 4E27A 1NLQA 1K5MA 5F1RA 5AC91 4LO8A 4WVMB 4QX2A 3EJKA 1GNHA 3OGJA 4XJWA 5CKQA 5F39A 3ZIWA 5I93A 5JSPA 4PLMA 3WZ1A 4GIQA 1VRH3 4FO9A 4JDNA 2XH6A 3VBFC 1BEV3 1C28A 1CR7A 3ZXAC 4XABA 1TZOA 2HKXA 1S0BA 4CDWB 5ABJB 2VUCA 4OHWA 5BNNB 3VHRA 1KRIA 4GZ9A 4N90A 2AUYA 4QKDA 4RGKA 1RUG1 4F8AA 2I07B 2X5IC 3MLJA 5CFDA 3ZFFA 3VBOC 4XFBA 1UKGA 2R073 1BLZA 4AI3A 4FCAA 1VBD3 4QWNA 3MUZ1 2MEV3 1K5MC 2D43A 3HBKA 1SBDA 3URFA 2P37A 2DCYA 4RQPB 1APNA 1RINA 2RJKA 2VCCA 1YQ5A 2OPKA 2SLIA 4XJUA 4MHUA 2HWE1 4P9IA 5E8AA 2D6KA 3U75A 2QUOA 4FOQA 3RI9A 1NCRA 4YFZA 1LKNA 1PZ8A 1RUE1 1LHNA 4LMFA 4D8MA 3ZIXA 3GF6A 3IIAA 3P3PA 1N1TA 3HIFA 3VBSA 3MW4A 1HV0A 1H30A 3V0BA 4KGQA 4NIIA 1OXCA 4XUOA 4BA6A 5CFDC 1XE0A 4FPCA 2EIDA 4XURA 3OPWA 3ENRA 2WO7A 2PXJA 3IMNA 2E7AA 4LJHA 3MV01 4QGNA 5I91A 2GNBA 5FYMA 5JZGC 2JG9C 1JI6A 3BTZA 2LROA 1AX1A 1NCRC 1WA4A 1BEV1 4BXSV 1YQ8A 2W68A 2OYZA 4LBLA 3JB8A 1BYHA 5LA2A 5A32A 4DB5A 3VBSC 3PL0A 2XG3A 3WQ7A 4BZ4A 2ET7A 2R071 4B1MA 4PIZA 4QX5A 2MEV1 3BIWE 4JRLA 5FZ1A 2WO1A 4ZXKA 3JD73 1NZIA 1G7YA 5F37A 4HANA 1WLTA 5FBJA 4LHSA 3VD4A 3O1UA 1JYWA 4NHLA 2ORXA 4QHZA 4EWAA 5L7OB 2JB4A 3FL7A 1DFQA 4M4RA 5BNOB 4P5HA 1ZBA3 5FY7A 5BXXA 3T2TA 3VZNA 3F95A 3AK0A 3VDDB 1R1A3 1EAH2 3HR9A 2BOJA 3ZR5A 4ASMB 2F17A 2PFWA 3FLRA 1LECA 3ILNA 4MXVA 4R4XA 4AVBA 4BHPA 1H0BA 4QQHA 5DZGA 4RR3A 3WF1A 3O1OA 1UPIA 5FZ4A 1I1EA 3DYMA 5F3GA 1JZ5A 4RS5A 3T09A 1UZZA 3WNXA 1MS3A 4O7XA 2QJVA 1RYYA 1TME2 3M4FA 5C71A 4SBVA 4ZS2A 4MSVA 3ZYBA 2IC1A 5CAZA 1C1FA 1SMVA 3I3BA 2VMDA 3I2OA 4QX3A 4WVMA 2J1RA 2WWSA 3B3QE 4DY5A 4AFBA 3PLQA 4NAOA 2BJSA 3ZMOA 5FZIA 4DUWA 3JD71 4Y3OA 2P6HA 2YDEA 2OUJA 4QXHA 2AACA 4M01A 4BLIA 3CEWA 4UFKA 4Q4Y3 1AX2A 2W1WA 4RR3C 5ABJA 5IVJA 4CDWA 4WM8B 1DQ6A 1GWKA 1OKOA 1UOBA 1AX0A 1VLNA 5BNNA 4RS5C 5EYXA 5IYYA 3H8UA 4QDSA 1RVF3 4XFGA 1WCSA 1ZBA1 4GH4B 5FYUA 5J96B 5I0TA 5FUNA 1UU4A 1T6BX 1VMHA 5FPLA 3ME2A 4RFT0 1JTZX 2MHFA 2DUQA 5LA0A 4MOAA 4GB31 1UW8A 1O3TA 2ZGNA 4EN8B 4RQPA 1RUF2 1FAYA 5IVCA 4HT1T 1AR93 4TWTA 3VDCA 2EXHA 1CIWA 3AFKA 4AVVA 2PHFA 1FMD1 3CZUA 3LIHA 5ABJC 2KA3A 1C3HA 2BGPA 3CJXA 3PIGA 1V6KA 2VCMA 1AR73 4B8EA 1QJZA 4HLTA 3RZJA 1COV2 1C8M2 1XSQA 4AW7A 4LBOA 2WS92 2FBEA 3SCHA 4DS0A 3VN4A 1PM7A 1RXFA 1S0FA 5FCCA 4C0HA 4W50A 5ANQA 4YVWB 3KHCA 4OZXA 4XTMA 3ZFEC 3I3EA 5HI0A 4MYEA 1QNWA 4JCKA 2VMEA 2WT1A 4AHYA 1JUHA 2CYFA 2EIBA 4Q4Y1 5CNAA 1CVNA 2VXRA 3IM0A 5IATA 1EPWA 2DU0A 1BK0A 4Y1YA 1W2TA 4W8JA 1GFF2 3AFGA 5FO8B 4N53B 1RHI1 3VD3A 4FFGA 2UY9A 1QJY2 5DZFA 1HDKA 4GMP0 3SLIA 1JHJA 1ZVFA 4K1YA 4Q8KA 4NRMA 1JOJA 4YW4A 5JIAA 4YZ5A 4NRPA 4OI1A 1OSGA 1RB8G 3AYDA 3BB6A 1W8ZA 3WDYA 4XUQA 2VNGA 4PIYA 5H9RA 3B9CA 4NIHA 1AYN1 2P34A 3I2IA 4KL1A 5FYHA 2RVAA 2VZTA 3EO6A 1AYM3 2C6SA 1UU5A 1X36A 3KGLA 1GZTA 5FYIA 3UGHA 5L7OA 2RM23 2RHPA 2WWJA 2BU9A 1I5ZA 4LO7A 5BNOA 1MQTA 3QCWA 1LOEA 1AL22 2ZCWA 3VDDA 2VO5A 1GWLA 1IOAA 1AJKA 5C5TA 5BNPB 3WUCA 1LOFA 2QVSB 1JW6A 4BMBA 4CU7A 1BQPA 4XXAA 5LZ6A 3ABZA 4COVA 4LORA 1RUI1 2WA3A 5FYCA 4RL7A 5A1LA 5KR7A 4XQWA 3NAPB 3O1MA 4YGCA 3N9OA 4QX8A 2QQVA 2W1UA 1R092 1YUDA 2PMWB 2VMIA 4QMAA 3HQUA 1UYPA 3NO8A 1RUD2 1GQHA 4CCNA 4L92A 1AR83 1BVP1 2RE9A 3LOBA 3WUDA 5FZDA 2XUMA 3USUB 1W6OA 2JE9A 2WN3A 1R64A 4Y33A 1IG0A 2VL4A 2FCUA 2IXIA 5BNOC 4N43B 4AR2A 1MQTC 1VBA3 1ZZ9A 4JDMA 3RWKX 2BVBA 3CDZB 4C0BA 5KBFA 3NW4A 2CL2A 3AKSA 5FAXA 2HYXA 1LOFC 2V73A 2VW2A 1IS6A 3DYOA 3PVNA 4FFIA 4QQPA 3AP4A 4D0QA 3FBMA 5H9SA 4PBOA 2YU1A 1I9RA 4IUGA 5DAQA 4FQ4A 5L73A 2VBDA 3C7FA 3O5SA 2R0HA 5LEJA 2LW8A 4WM8A 1NZCA 2PAEA 4D6RA 1WLDA 1XSRA 4Q27A 4ATFA 3MO4A 2RM21 3FUOA 2Y6HA 3FBYA 4PBPA 1OFNA 1QJU3 2WKKA 2XHKA 3LKJA 2NQYA 4GH4A 2R043 4QPIB 3AMPA 5I0UA 4TTGA 4Y5SA 1QMJA 1QGLA 1V6MA 1X9TA 2BNMA 3QOPA 1OUSA 3PMSA 3C7EA 1MEC1 4W6YA 3VDAA 4QGMA 2RS12 1H4HA 4WZFA 5FKCA 2QDNA 1W05A 1OD3A 1W2AX 2AENA 4UF0B 5H9QA 3VKFC 4CCOA 1RUH3 2GMPA 2D44A 3O1PA 1CAVB 1J1TA 1KJRA 3IDBB 4IW3A 4WM8C 1AR81 1REEA 3RYPA 2JE7A 2YPJA 1H6YA 5DQ0A 3VB9A 4GA9A 2BERA 2QQMA 4YSFA 5FYBA 4B1LA 5FXWA 4GH4C 5G05L 5K0UC 5ACA2 4D7TA 2WO3A 3NNFA 1FV2A 2YG0A 3AP9A 5FP4A 2VZUA 3CBNA 4I09A 5A3NA 4YVWA 1MACA 4LUKA 1UO9A 3AKRA 1HX6A 3POBA 3SHRA 2Y6FA 4CUCA 4X6RB 3FFZA 3RFRA 2E63A 3MIDA 4HKOA 2RR11 3SKVA 4SLIA 3U07A 4CCEA 1JN2P 3NJXA 1OKQA 2XBO1 4OQ8A 1NUKA 1SEFA 4ISQA 2WL1A 2R1BA 2ET1A 4N53A 1ZRCA 2OVUA 3H1WA 3LA3A 3JXSA 4JZRA 3ZMNA 2WFPA 3AJZA 2HEYF 2W46A 4K21A 5C3SA 3PDQA 3ZXGA 5GZCA 1WCQA 3E5QA 4AOCA 1FOD1 1XNDA 3CNAA 4Y1UA 3WW1A 3A23A 4YVWC 2ZEWA 5FZAA 2YC0A 4BISA 2QTWB 4IL7A 4J6GA 1BCXA 4LO5B 2Y33A 2R061 4XFIA 3B00A 4MGSA 4LE4A 4META 3IZOA 3LSEA 2CV6A 3J7NA 2NLRA 3HN3A 2JB8A 4PI2A 4KWUA 3RNSA 4CPBA 5I8YA 1DGWA 2W2IA 1K45A 1XRUA 4N53C 2DVGA 3OF1A 1NCQB 4R4ZA 1YXWA 2Y64A 4NHKA 2DV9A 3THTA 4E2QA 4COUA 5A6ZA 3WCSA 4K7JA 5BNPA 1N1VA 3MGUA 3VBHC 1PGSA 4UOJA 1VAKA 3K4ZA 3O1VA 2JDPA 1W03A 3NAPA 1PO23 2VZ3A 5AVAA 3TWIA 1W8OA 3MW3A 3O1RA 1YFUA 4O61A 3U1XA 5JIUA 4XFFA 3J8F3 3ELNA 4N9HA 3I2KA 4GALA 4YG0A 2VNRA 2ZPXA 3DEMA 2TUNA 4OI0A 4OI2A 3WW4A 4AQTA 4N43A 4OUSA 1OC1A 3OD4A 1CJDA 3RZMA 4FTBA 1R083 5BNPC 2W47A 4NR1A 1B35A 3AVRA 2R7EB 3KVAA 4GJZA 5JXHA 3U4XA 1ULDA 2ZGLA 4P9GA 2C9AA 4CRQA 4EWDA 5K8SA 5LY2A 3ITQA 5B2GB 2W94A 4MH0E 2ZGUA 1ULEA 1V9U1 2CU5A 3OUJA 3VZMA 3S5AA 4CSWA 4R8HA 4QD2A 5EXOA 1RJ8A 4EQVA 5EWSA 3H7YA 1W2NA 5EPAA 1ZBE3 4QPIA 5G04L 4ZY9A 3VL8A 4EV0A 5LK7B 4CP2A 1WW4A 2OIIA 5FPBA 4CPBD 4FPYA 2E51A 4QB1A 5DXDA 3KV6A 2ZGKA 1B35C 2VOWA 4LITA 2AH2A 2HYKA 2HEWF 3BYWA 4S2FA 3T1MA 2QCSB 3POEA 4UF0A 2CGPA 1VBE2 3M3OA 5IK5A 3D5OA 4AEJA 1SFYA 5IUQA 1CAVA 1UYXA 3VBRC 4UAPA 4DEQA 2BRTA 3O14A 4M4PA 3DN7A 4WV8A 1SLBA 5IFPA 3AC0A 5T3NA 1HQWA 1ASJ1 4QPIC 1PGL2 2E33A 1AR63 4JDOA 2AEZA 2OX0A 2D6OX 3HNYM 2D3SA 3ZLIA 3ZR6A 5J1XA 4ZU5A 5CG9A 4XJZA 3FX3A 1F31A 2C5DA 4Y20B 1F2NA 3SKJE 2AYHA 4QB2A 5GLVA 1QKQA 4XJAA 5KXBA 5LEKA 4GXLA 1DLLA 3A7QA 3WG2A 5DDJ3 5FDBA 1E5IA 2GC0A 4RGGA 2DCJA 3AL6A 1ASJ2 1MR5A 1PMIA 4LULA 2A3XA 5JSOA 3THCA 5J37A 4R9CA 3H1MA 3AMQA 4OLLA 4LO4B 3VZLA 2ZX0A 1WD3A 4YW1A 5FYZA 3KHBA 4BB3A 5FPAA 4MZUA 4Z2AA 3TN92 1BXHA 5JWPA 5GKAC 4DRRA 2EXJA 1W6MB 3D0JA 2DWRA 1JZ7A 1UMZA 1UCXA 2ZMKA 3RRDA 2UY8A 5T52A 3ZVXA 2VMCA 2ZZJA 1J3PA 1I3HA 1KQRA 2E32A 4G4FA 4P9LA 3SISA 4DXZA 3FFQA 3ZXDA 4Q5OA 4OHVA 2UYBA 4YPJA 2ZKNA 4YW3A 4ITCA 1NCQA 5GLWA 3OYWA 2ZS6B 2BFUL 2PAKA 3VUOA 4IE7A 4I3GA 4YFWA 2R0FA 1H8TB 3CIHA 3WW3A 3LWCA 1T2XA 1HRI3 1Z7S1 3GM8A 4P02B 2ZZQA 3KSCA 3CF6E 4XILA 1JS9A 2W9XA 1HB1A 3AB0A 3W5NA 5A3PA 5FQ0B 1GYKA 1IPJA 1ZZ8A 5DDJ1 1J58A 1PMJX 3WR0A 4I02A 4D3WA 1IKPA 3OCPA 4QPGC 4GWNA 3AMMA 4DXTA 2VTXJ 2WNOA 3POSA 3PU8A 5FK8A 5A6XA 4QGLA 2H6BA 1TNFA 3B9IA 3IAPA 2D6NA 2GC2A 2JDMA 1AVBA 3J4UH 5GLZA 4YZ4A 3SXWA 2GDFA 2OQ6A 4ES9A 4Q4W1 1XOYA 2XUEA 2XB6C 1QQP3 3ACGA 3MFCA 2GP5A 4OMCA 4YGBA 1CAUB 1GKBA 1VBB1 3MIEA 3PUHA 4B4QA 1T6GC 4BMEA 1URXA 3MIGA 1AHSA 3OBTA 3VHPA 3BCWA 5IFTA 2PLV3 1SBFA 2EVXA 5C70A 3RWNA 1SACA 1V70A 2IXKA 2JD9A 2WNVB 2P3YA 2YYOA 4CUBA 2W92A 4KG8A 1D7PM 1HXS2 3WXPA 3NV1A 5HPOA 4BLJA 1FX5A 3PUSA 1V6IA 3WDUA 3T2PA 1E5SA 2D3RA 3TYJA 2WQ4A 1KS4A 3QLQA 1LU1A 2ZAAA 4HG6B 3WDVA 4ZKTB 2X5IB 1HRI1 1X9PA 3VBOB 3VBUB 1IS4A 5KC5A 4M3CF 1CX4A 1GZ9A 5KXEA 2RS32 1DBNA 4J25A 1BBT2 1QU0A 3MHZA 3BI3A 2J1EA 4IV1C 2B9UA 3WG4A 1AXKA 5EP9A 1WMFA 3H8RA 4LKFA 4Y22B 3UJOA 3L2HA 2B8MA 1US3A 4O65A 4OHYA 1YQ6A 4AQ6A 5C33A 4K6BA 4K9SA 1LEMA 4D6SA 3HPNA 5APAA 4MXWA 1LGNA 1UMIA 2OA2A 2VECA 1L7QA 1FT9A 3AJYA 3KQRA 2PHLA 5ISLA 4Y20A 5FJKA 1YNAA 3ORJA 4CCCA 2ZTNA 3JBG3 5FLIA 5FTTC 1PIV2 3BOWA 4AEDC 2RDNA 1GU3A 2XPJA 3KS7A 2FDFA 4KMQA 5E6HA 1PZ7A 5JZGB 2JG9B 1QDOA 5FMOS 2GNMA 1ULCA 1CAXB 2LALA 3L2YA 2P17A 4Q4V3 3IDCB 4CYDA 4TZDA 2D40A 4PCRA 1Q8SA 4LO6B 4A6OA 1HRV2 2NYYA 4HVQA 3GZEA 1OA4A 2FCTA 4JX0A 3VBSB 2EIEA 4D6QA 1N3OA 5JMOA 2ZAHA 4KQ7A 2B39A 3T4HB 4YGDA 2FDKA 1W6MA 2WFF2 4FFHA 5FXVA 3KV9A 4BJ0A 3EMRA 4MGIE 2JDKA 2CSGA 4RHV2 3R4DB 4XQ4A 3SMHA 4Q2FA 3AZWA 1TEIA 2WQ8A 2ZHKA 1POV3 2JICA 3TRSB 4ARXA 2RMU1 3VZOA 1HW5A 1POV0 3NV2A 3BPSA 5FZ8A 2HWF2 5A3UA 4DUXA 3S6PA 1H8TA 1EV12 1VR3A 2FDHA 2WNUB 5JDBA 3K3NA 3H3ZA 1RUC1 4UBGA 2BW8A 3A0NA 1JYTA 3MICA 4DQAA 3KCCA 1PO12 1QXRA 1WBLA 1S0JA 4YG6A 3RVHA 3WF3A 3Q8CA 3UT0A 5FQ0A 1O5LA 2JIJA 5IK7A 4GWJA 1Q3EA 1TNRA 1UPSA 2ZABA 2J1VA 4CU8A 2GU9A 3AZXA 1YRZA 2YB7A 2RMU2 1TE1B 4NRQA 4XBNA 5DG2A 4MX3A 4YWAA 3SNMA 2Q8DA 3FHAA 3NVCA 3WNPA 3N4MA 2WSUA 1RUG3 2XDVA 3O1SA 1VBC2 2AEYA 1UXXX 4KWJA 5L19A 2WA4A 4N7IA 1AXZA 3M3IA 4LOTA 1OMIA 2VVFA 1CAUA 1W2UA 3CJIB 5ERLA 5JOZA 3KT1A 3WQBA 3J7HA 4EWEA 1PX4A 1REFA 5DUUA 5FXXA 3I59B 2VNOA 2XGXA 2EAKA 2HWE3 4UW6A 2Q8CA 1IZ3A 2WNVA 3V56A 1AZDA 3RPQA 4KWKA 4A44A 1KGYA 5FZ9A 1NG0A 4IE6A 1RUE3 3LA2A 3GNEA 2TEPA 3MF6A 4TLGA 1SZBA 1UF2C 4Q4X2 4LT5A 3LPFA 2JDHA 2J7MA 4JKKA 5LATA 1HN1A 3CO2A 2X5IA 3IDAA 5CU1A 3MW2A 3VBUA 3VBOA 1O7FA 2YFZA 4X8PA 1G6NA 2ZACA 2VTXA 1HB3A 1UXZA 5CKNA 2DCZA 3KMHA 1C5HA 1UZVA 3CMGA 4Y24A 3A22A 3H7JA 5CBLA 4Z8BA 5A7SA 4RGAA 4A6SA 1W6PB 1J3QA 2FZ1A 2PA7A 4Y22A 2WNVC 2JECA 4XMAA 2QE3A 3DUIA 3BTAA 5DABA 1GMMA 2PN5A 5FXZA 4UT5A 4BQ2A 4P14A 1UY1A 3VD5A 3ZFGA 1W0NA 3LE0A 1OH3A 2C1FA 2RDSA 3N9PA 1KFUL 2QQPA 4AXOA 1UX6A 4ZS3A 5LBEA 3VBUC 3ZXKA 1FXZA 1EAH3 3W5MA 3VKLA 1F4AA 5L36A 4FI9A 4HONA 1CPNA 3ZFEB 1F15A 5JZGA 1WMEA 2JG9A 4BE3A 2G4IA 4YW2A 4A3ZA 5KWRA 1CAXA 1DGRA 2LUWA 2XKPA 1ONAA 4OHZA 1RMU2 3NNLA 1Z0HA 3RG0A 1U5ZA 2G19A 4KI5M 3HNMA 5K4LA 4B3NA 4DXSA 1RUJ2 2VE1A 2VJXA 3G6JB 2NN8A 2OW4A 5A80A 1ZA7A 3O7OA 1JOPA 3I3QA 1PZ9A 3PVBB 4QM9A 2FDIA 2OQ7A 3NWKA 3ZFGC 4H7LA 4J1WA 1KJLA 3TAYA 2WIIB 1EUTA 4P00B 1VMJA 1VPHA 4MO3M 5DAXA 2VUJA 1SLCA 1QJFA 1JYXA 4OI4A 1O3QA 2YGLA 4CP9B 2F4LA 2BNNA 2WT2A 3KVBA 4A3XA 3PU3A 4LBMA 3E5UA 4C1WA 4KWLA 1VP6A 3RYRA 1QOSA 4CXYA 1WGPA 2OUHA 5BY5A 3LDRA 1GP4A 1K3IA 2WNUA 5E16A 2Y6LA 5E89A 1WW6A 4LHNA 2EICA 5BUVA 2HWC2 2WR9A 3SH5A 1CX1A 4JVAA 2VMFA 4LBNA 1YJLA 2CDPA 2YV8A 2ADDA 1EAH1 2QNKA 2QQOA 5GJ6A 3HVDA 4PLOA 1CJPA 4QHOA 2QKDA 3D4KA 4AI0A 3S30A 1BJQA 2D3PA 1RUF3 4QQ2A 4JQRA 5HCFA 1RXGA 2CAUA 2DCTA 4Q0PA 3MFAA 1MPXA 4JKLA 4CDXB 1XNCA 3LD8A 4NWWA 4AL9A 2K9ZA 4OMDA 4YW5A 1C4RA 1XNKA 3RMYA 2ZBJA 1UYZA 3HJRA 5FMBA 3R4UA 2WNUC 1MQTB 3LIGA 1S0IA 3AP7A 5SV8A 1LR5A 4RD7A 5A7PA 1JZ4A 1TME1 3T30A 4YG3A 2ES3A 2BZDA 3CJIA 2Z5WA 4IE0A 1V6JA 4GB33 1AJOA 3VLBB 3ZXLA 5FMCA 1W0PA 4R9DA 1LB2A 3I8TA 3I59A 2A6ZA 4H2AA 4IV3B 2C4XA 1U12A 5KHJA 1GQPA 2E53A 1VRH2 3WVJA 5JOXA 3GCWA 2A70A 1FMD3 3T0AA 4FOYA 4UBHA 1G9CA 4CU6A 2I74A 3U14A 4Z1VA 1W6OB 3GCXA 1K42A 1IQAA 4DFSA 3SQOA 4XF0A 4NPRA 3T3YA 3ZN5A 4NOTA 1W99A 4LKSA 3M8LA 1UOFA 3CJIC 1VBD2 1DZQA 1HJGA 3U10A 1W90A 3NNJA 4OHXA 4OYUA 2W39A 3W59A 1RUF1 2P3KA 2J1SA 1W6PA 1WLWA 2XJQA 1LOCA 3JB4C 1KITA 3ZN4A 3KQ4B 1WUVA 4IEVA 4NIAA 3C7OA 4QHBA 4LIUA 4L97A 4XIOA 5DAVA 2G9ZA 5FZLA 4LLOA 4N7UA 1RHI3 3DECA 1COV1 1V6OA 1C8M1 5K0UB 5A1FA 2EALA 1AL23 2WS91 1H2NA 4QM8A 4DIQA 4XC9A 4IE4A 2R30A 2YBPA 4BXFA 1NOVA 2VUAA 4HN1A 2LTNA 3ZFEA 4QKBA 4Y1XA 4KGGA 4HFSA 3OEBA 4HL0A 4LIVA 3RS6A 2YUEA 1AYN3 4GQ7A 4H55A 3GBGA 2FMYA 5CB7A 2IUWA 4BQ1A 4BWOA 4PT6A 3B69A 3C3VA 3UJQA 1A3KA 1WCDJ 2ZGMA 2JX9A 1YO8A 2XONA 4QQLA 4XBQA 4XFHA 1QJY1 3T1LA 4Q1RA 3UKTA 4M3CA 3WNNA 3WG3A 1CZTA 4K40A 2VMGA 1N1YA 5FZ0A 1RUI3 4HXCA 4CP9A 1SCRA 3E6BA 4UW5A 1EP0A 3FLPA 4ORFA 4CEWC 5L9RA 2ZEYA 5IVBA 1O59A 3D8CA 3ILRA 3AXDA 1I5PA 1O8SA 1PNFA 1YJKA 2GC1A 2ZX3A 4CCJA 3FN9A 5K7PA 1LRHA 5IHRA 4INDA 4DXRA 2W52A 5DAPA 2XL9A 1AL21 1R1A2 3MLLA 5JXJA 3W58A 3VBHB 3H8OA 4NPLA 4CDUC 3OBZA 3FJSA 1JYVA 4K8RB 1IHMA 3NSTA 2Z69A 4LXLA 4M00A 4CDXA 4AVSA 4X8NA 4ONUA 1R091 2DCKA 1HKDA 2XJTA 4TLFA 4IEXA 1RUD1 3VD7A 2DFCA 4LEJA 1ULFA 2XQRA 4A42A 4PQQA 5F5QA 3D0SA 2Y6KA 3CL1A 1JMUB 2F4PA 2JWPA 4NAMA 1DGRN 5ACA3 4UFIA 4R9BA 1UYYA 1IPSA 1YFXA 4NJ4A 5FPXA 2RV9A 5LW9A 1MEC3 3FZ3A 3GJBA 3ST7A 3WNOA 2GH2A 2W3JA 2FHRA 1LGCA 1QDCA 4CE8A 4IV3A 1SFNA 3THDA 3N9MA 3O0WA 1NY72 5EJZB 2DFBA 1ZRDA 5LA9A 1MZ5A 3S5QA 4CDXC 4R52A 2Y34A 1J3RA 4F7ZA 3SH4A 5FO9B 1SQ4A 3NQHA 1D4M1 1RVF2 2D7FA 1RL3A 3RZGA 5FR3A 1HQLA 1WZXA 4MG2A 4YM3A 4NROA 1EUUA 2K46A 1Y43B 4IGOA 3T2OA 3VD9A 2YMZA 3H3UA 1B35B 4BK5A 3SC7X 4Q0QA 5FP9A 3ZYIB 2A73B 1TQ5A 2RS11 3E6CC 1UWWA 4IV3C 2VPVA 5I8TA 1E5HA 2RR13 1AR92 5JXIA 1OOPB 2ZGQA 1PVC1 4XJ9A 2XBO3 5FYVA 2ARXA 1GZCA 1MS5A 1BMV2 2QQJA 2YFUA 1FV3A 1D4M2 3R05A 5JLVA 3ZYJB 1AR72 3M1HA 1VB2A 5K0UA 2B7YA 4RFRB 5FYTA 2YBSA 2QZ2A 5ACA1 1FOD3 5F5CA 2BGCA 2DUPA 2JXAA 2NMOA 3OY8B 3ETPA 4AZZA 1GZWB 1ZZCA 4LA2A 4N8MA 4IEYA 2R063 4OFGA 3UNPA 2G9FA 4G9SB 1XXNA 5IAXA 3RZKA 2F6BA 1PVC2 5TSWA 4AVTA 4XFCA 4XF4A 3SEEA 4XHXA 4BQYA 2XQXA 2B9VA 2JDYA 2VQ0A 5FZOB 1YQ2A 4NHYA 3KM5A 2ZGOA 3RJRA 2VM9A 5JAXA 3WNKA 4AEKA 5JXGA 4EN7B 4K3UA 1OA2A 1YI7A 5DZEA 2B42B 2BTVC 3ZKUA 3ZO0B 4FP3A 3WY6A 4U36A 4B4PA 4QDQA 4E8CA 1JHNA 4YM0A 1ENXA 1W9FA 2ZGRA 1AYM2 2SBAA 2DVFA 3MPPG 3WP6A 2WO2A 2Q1ZB 4D69A 1Q5OA 4IEZA 2ZOEB 2ZX2A 1PK6C 4YLZA 5KHKA 1XNAA 3ACIA 3INAA 1R1ZA 4I0WB 2Q8OA 3VBHA 2OS2A 4CU9A 1PM4A 5HV0A 1YEWA 4A41A 4JHZA 4BOWA 1W39A 4MVTA 4FAGA 2X05A 5LA1A 2O8OA 3K3OA 3M3CA 2DUOA 5E1RA 4LHKA 2WYSA 4IEPA 2MNGA 5LBFA 1V9U3 3K51A 1ACCA 2D6LX 2H0VA 3KT7A 1OH4A 3D6EA 4P5YA 4QX1A 5FZ6A 1C5IA 5FZBA 3LEMA 3LDBA 4WVVA 3OOXA 3PTYA 4QPGB 5C3OA 5KHIA 3OYWB 2JIGA 1OA3A 2DU1A 1VBA2 4S2DA 2I45A 3KLSA 1UKRA 1GOFA 1NXD1 3X29B 5C8CB 2ZA9A 3FE5A 3ES1A 2Q8EA 1OVSA 4D94A 2CHHA 2C26A 1XQNA 1OF3A 2PELA 1DQ2A 1GBGA 1ND3C 4M0HA 4FPKA 1ENSA 2QQKA 4HN0A 5A1AA 4G3YC 2A1XA 3G7DA 1NQDA 4XEZA 5T54A 4QKNA 4DMIA 2C24A 2K0GA 4IXLA 3W20A 1QJU2 3I54A 1ASJ3 4W6WA 4CCMA 2PQQA 2R042 4A7YA 3WINE 2YGMA 3NJVA 1PHMA 3AMHA 3IAQA 2RS52 4XFAA 3R6SA 2GP3A 4CP1A 2ZMNA 3TN93 2FMDA 5AFBA 5M0TA 3CKHA 1POQA 1VBE1 2OZ6A 3AL5A 1NYWA 1OOPA 2Z79A 3IPVA 1ULPA 2A3WA 1RUH2 1MVQA 2DVDA 2IXHA 3HAGA 3MIFA 3NNMA 3MV11 4F3JA 2X53S 4IV1B 1WKYA 2RJ2A 4E2SA 4MGTA 4MV2A 4J1XA 4AFMA 1NA1C 1IKQA 1BHGA 2BBAA 2HBTA 1LCLA 1H6XA 1PGL1 3I2FA 1O5UA 4FOWA 1GOGA 4PQ9A 4PF1A 3OPZA 5FZEA 3HNBM 3OY8A 4DINB 3LGRA 3NKTA 4Q29A 3SH3A 4Y4RA 2K2SA 1GZWA 3JZVA 4E9KA 1LJ7A 2UWBA 4CUAA 2XR4A 2ZJCA 2YROA 1RUNA 3ZM8A 5T5LA 4AEDB 1GUIA 1OOPC 1SDDB 2GMMA 2W08A 1UZ0A 1UOJA 2GC3A 4Q8LA 3GZTB 5GZGA 2FCVA 5FZOA 3DKWA 2P6CA 2JKXA 2HLEA 4AQSA 3C7HA 5LASA 5A7WB 4V1PA 4C1XA 3U37A 4DRVA 5D1IA 4ARYA 4MXWB 4A45A 4FOVA 1YIPA 4NVPA 3JQXA 1ULOA 1Z7S3 1U5XA 4GD4A 4HMZA 4HVOA 3DL3A 4TN7A 3TN91 4AAXA 4OQ9A 4FAHA 1EYBA 2WC2A 2VC9A 3PTRB 2LM3A 4FPHA 4IESA 1F5FA 4EZ4A 5HBAA 3MI8A 2QQLA 1NE4A 4WM7B 5L9VA 2BDRA 3ALQA 2GN3A 1VE0A 2VR4A 4GULA 3ASIA 3UL2A 2XVLA 4B4RA 3LFIA 4Q0SA 1KDMA 3ZSKA 4AGVA 4AWDA 2A71A 4WVZA 4XXPA 3BIEA 3NV3A 4DOUA 4IGPA 4AK3A 4YARA 1WA6X 1IPKA 1OLME 5EJ1B 3AKTA 3UESA 1ZREA 2PHWA 4Q4W3 2CGOA 4DUVA 1PO22 5JOWA 1VBB3 3K46A 2YY1A 1CESA 4CCLA 5CFCB 5LY1A 3J8F2 5IVYA 2Y0OA 4QXCA 5FLHA 4AGRA 5CEHA 5JOYA 1W28A 1F8VA 5FP7A 1G9DA 5A33B 4QPGA 5A3MA 3LEKA 5FY8A 5FREA 4XDPA 3MIBA 1W0OA 1O4ZA 4H3WA 4KBZA 1R082 5DG1A 5C6CA 1W9SA 5C8CA 2FD8A 1S0CA 3O12A 1BZWA 5L9BA 1S55A 4YRDA 2IVIB 1GP5A 2WABA 2XVGA 5LBBA 4DO0A 3WT3A 3I49A 1MZEA 3HOBA 1PIV3 5LBCA 2J1AA 3VBRB 4B29A 2DDUA 3PVEA 5FZCA 2IXJA 4IDZA 4ZU7A 3M2MA 3OPTA 4S2HA 3Q8EA 5LRRA 5IK4A 1ZBE2 3IT8A 1W6NB 1HXS1 1UY0A 2A7AA 4YNIA 4Z2WA 4FTSA 1YYNA 1F35A 1HRV3 2ERFA 4P9JA 1OLRA 5EQUA 4KNCA 3ZYRA 5C8CC 4LK7A 3M3EA 1W8NA 3NV4A 4JHTA 3C2UA 5GZEA 2B46X 3V64A 4WZCA 4RA0A 1FNYA 3RDIA 1MS1A 2JDAA 4PI0A 1JBCA 4E4HA 2RS31 2WINB 4IV1A 4ATEA 1BBT1 1S2KA 1XE8A 1H4GA 2EIGA 2J22A 5CIRA 2XJSA 5FLJA 1O4YA 2DVBA 2PQSA 2HWF3 5KXCA 1AR62 2BPA2 4CDQC 2A6YA 3AXEA 3ACFA 2V4VA 2VULA 4HOOA 5FP8A 4TYSA 3OJBA 1TVGA 2EA7A 3RQ0A 3KF5A 3ZDSA 4IERA 3ZSMA 4P9YA 1W9YA 4AEDA 4I30A 3VZJA 3K4DA 1PIV1 2WWUA 1XYPA 4AEMA 2BEOA 3K2OA 4UW3A 1K12A 3CU7A 4GAZA 5HXMA 3DKQA 4K20A 5F6LB 3ZSEA 3RZZA 2BYVE 2RMU3 1W9WA 5A7WA 4FP2A 3ZYFA 3B7MA 1HRV1 3KGZA 3WX5A 4V2VA 2ZGTA 3BPZA 3ZFGB 4Y1VA 1RUC3 2P1BA 4LHLA 2DBNA 2WFF1 1RIRA 5A3OA 1CGPA 2R32A 1S0DA 4KBBA 3M70A 1OI6A 3K77A 3POYA 3E97A 3OGVA 3ZSLA 5D21A 4RHV1 3FHIB 1IS5A 3AYAA 4NN0A 3BVCA 4WM7A 3CZJA 1UMHA 2J42A 1W9TA 1GICA 3UGGA 1HJFA 2JENA 3HEIA 2HWF1 4OCTA 4DNYA 1WLCA 5GZFA 4NE9A 5FPZA 1EV11 1DYPA 3ON7A 3J7MA 4IGQA 5FFOC 4YYOA 1DCSA 4HK8A 5FIXA 3WV6A 5A70A 2HWB2 2GNDA 1OQ1A 2HWD2 2X29A 4RSUA 1X8MA 1MS9A 3WHUA 5CFCA 4QT6A 1X8EA 2DF7A 1PO11 4R9AA 3ZXFA 3H9AA 3MEPA 5EJ3A 5A33A 4PJYA 1O3SA 4WM7C 5FY1A 1WW7A 4L8QA 1TG7A 5K9YA 1D2SA 4NUBA 4MHRA 1UIKA 3WW2A 4LLFA 3VHNA 3ZDVA 3FWEA 1H9WA 1A8DA 4HK9A 2E7TA 4MGYE 3KT4A 1VBC1 5GLUA 2DBIA 3ZYPA 5I0SA 2W1QA 3UKVA 1QQP2 5FMOL 2W0XA 1OPMA 4LBQA 1QXPA 4Q0UA 1HB4A 2WYFA 5FYSA 4AE2A 4Y26A 5CFCC 3TEWA 1SFPA 2D5FA 1CD3G 3VBRA 2JDZA 2TBVA 4C91A 2PLV2 4EN6B 3FC0A 1PMHX 3THPA 3PUIA 1GNZA 2Y38A 1RMU3 1W6NA 5F3EA 5KC6A 1VAVA 1O8PA 2VQUA 2EF6A 1OUXA 1RUJ3 1TMF1 1ZM1A 2WJSA 4Q4X1 4XTPA 3H0OA 5FY5A 4XUNA 4QDRA 4CP0A 3T2QA 1A34A 1YC61 1IG3A 1WCUA 1LOBA 5FZFA 4QQOA 5HCBA 3BKZA 5FBZA 1SLAA 5DN2A 2VZPA 1YFYA 1S4CA 1UU6A 1H2KA 4NPMA 1U5IA 2X09A 2O14A 2XJRA 2VZRA 4IE5A 4W6XA 4A7ZA 4TSVA 4OZOA 3DF0A 1TMF2 5C3PA 2UURA 5A6QA 4NIDA 3OUHA 3HN1A 1FATA 2BQPA 1HV1A 4BK4A 4BCUA 3JU9A 1F5JA 2CWMA 5FO7B 2HWC3 4MADA 4CUGA 2IXCA 1RJ7A 3Q9OA 4XIKA 3RGBA 4P08A 1D0HA 3JBG2 3WHTA 5B4NA 5JPMB 3RZLA 3DPRB 5J98B 4B7KA 1WW5A 2O0OA 2CDOA 3MPBA 5FZ7A 3M7AA 4UI9L 1SLTA 4LBQD 4Y5TA 1RMU1 3O0XA 2XWJB 4LKDA 3L9JT 1RUJ1 1F4HA 2I2SA 2LS6A 1IS3A 3N7JA 4QX0A 3SCFA 1KD7A 2RDRA 4W4ZA 1QOTA 2Q5TA 3RYKA 1G9BA 1PGW1 2QQNA 3Q8FA 4COWA 1OURA 2E6VA 5CKMA 2JE8A 3VKMA 1FPN2 1S2EA 1US2A 1N3QA 3S0MA 5A3TA 1LHUA 2XLGA 2R6QA 1LGBA 1AXYA 3E5XA 2EAAA 5C5UA 1QJX2 1CZVA 4CEWB 1JZ8A 5KHHA 2WAOA 3IDEA 3W21A 5C8WA 1QIQA 1RTVA 2HJIA 2BOIA 1CIYA 2FQPA 3LSDA 4ZZ8A 3DCQA 3ZKYA 1JZ2A 1GSLA 3ZYGA 2WZ8A 2OT7A 4QX7A 2QQUA 1N3PA 1VRBA 1S0EA 2WZR2 1PGW2 2ZXQA 4AI2A 4CEYA 5FY4A 1OD5A 3BGAA 4LNVA 2HWC1 4I0BA 1DP0A 1TME3 4CVUA 4EZHA 2EXIA 1ENQA 4XE9A 4M3CB 4CDUB 5JMCA 4EN0A 5AC92 2E7QA 3AP6A 5AVPA 1GOHA 1JU3A 2Y0IA 1EPZA 5FP3A 3LB9A 3J9SA 4AQ2A 1UN1A 2VZSA 4QPYA 2WLPA 1RC6A 3NKGA 3WEZA 5JUVA 4HBNA 4Y5Z0 1H1IA 2XVKA 2ARCA 4FPGA 4MGQA 4BQXA 5GM0A 5C9AA 1G9AA 1ZRIA 1W3XA 3SEPA 1RUG2 1DGLA 4H14A 2D5HA 4Q26A 2AC1A 4CEYC 3RMXA 3ZXJA 3POWA 2XMLA 3MZHA 2J1UA 4ET7A 1ND2A 2W1SA 3ZFFC 1QH7A 4C8DA 4CCKA 3V0AB 2JKBA 3NJYA 1ZYBA 1CAWB 2VQTA 4FTEA 4Z92B 2UU8A 2R1DA 2FZ2A 1LNSA 3WNLA 2HWE2 3GGLA 3P5BA 1QY4A 3FHQA 2YZ4A 1SPPB 2FDJA 1VRH1 1JYCA 1RUE2 2VQAA 1UX7A 2DTYA 5FRAA 5B4XA 4CTEA 1WMDA 5C9AC 1YIFA
chains in the Genus database with same CATH topology
1COV3 1C8M3 5JPNB 3R4SA 3AM2A 2WS93 3VZKA 2JG8B 1ND2C 5JCTA 1VBD1 2XLFA 2WQZC 4IETA 4UXAA 1GR3A 3ECQA 1YFWA 2VOVA 4B7EA 1BEV2 3J26N 4XETA 4L99A 4QXKA 1AL0G 1LODA 1H8VA 3AKQA 3B93A 3GALA 3HBZA 4I01A 4AGGA 5J36A 3A4UA 3AX4A 1QJY3 4FT8A 4IEQA 4D7SA 4FVVA 1PVXA 2CY6A 2R072 1OLQA 2AZ5A 2P2KA 2MEV2 3WLUA 3DPRA 4XYXA 3N35A 1FNZA 4PDWB 1KS5A 3GBFA 2PHTA 1DU3D 2P3IA 3A0KA 4WBBA 1VIWB 3PHMA 1LEDA 3QACA 1OQDA 3B5LB 3GZAA 4IEWA 3WDTA 2X8KA 1LHOA 2Z2SB 1ULGA 3DGTA 4BIFA 5KHGA 1D4VB 4MGKE 4XW3A 1S0GA 2VH9A 1W6QB 1QF3A 3VL9A 3DPRC 3IN9A 4CEWA 5J3UA 3BU7A 4Y4YA 3ZXEA 5LRSA 1NXMA 5JI9A 1R093 2PTMA 3ZSJA 2GZWA 4A2UA 2PHDA 1RUD3 3ACLA 4PF5A 4XZPA 1PK6B 4XBLA 3KB5A 1XE7A 3N36A 1AUYA 4FXKB 1R1A1 2D6MA 3U11A 4CDUA 2O8QA 2NM1A 4HETA 1JYIA 2BWAA 3LOIA 3IWZA 4GWMA 1Q56A 4AG4A 3JD72 1N47A 1FI2A 4HVRA 4NHMA 2CTVA 1CPMA 3EQEA 4XMIA 1DG6A 2XL7A 2ZMLA 4HKWA 3KCYA 4CDWC 2Q0AA 3PVOA 1D4M3 1Q8QA 5BNNC 4GKYA 5F9TA 1ZBA2 3N7MA 1KFXL 3N7LA 4AF9A 4YM1A 3HD8B 4BH9A 4YZ1A 3V0AA 4U2AA 1CAWA 4GB32 3B02A 3I4IA 2H0BA 2XLAA 1IGOA 4FPOB 1YLLA 2RS13 4JTOA 2VY0A 5GALA 4RQPC 1ND3B 1NY71 4P9WA 2N7GA 4FPEA 1X82A 1PVC3 4D7YA 1FMD2 3ZX7A 1ZNPA 1ZZBA 4ES8A 5E88A 2VOXA 1RVF1 4FXGB 2WZPP 2A6WA 4GMP3 4OUMA 1KXGA 2GMEA 2GALA 4Z82A 2D98A 2JG8A 3ATGA 3GHMA 3OGGA 3WOGA 1C8NA 5A3LA 3AKPA 2R49A 3SCGA 2A6VA 1AR91 4DPNA 3W9AA 4Q4Y2 3QH7A 1L3JA 4FPLA 1BMV1 3ILFA 2GAUA 4L2NA 1AR71 1RHI2 4JGYB 1SBEA 1NA1B 2ETEA 3RSJA 2ZKLA 4YSFA 3OD0A 1BK1A 1LHVA 2JG8C 4MGZE 5LK5A 4HPKB 4PDWA 2IFRA 1XU1A 2ATFA 5H9PA 5BPXA 3IPVB 1C57A 1AYN2 1ENRA 1VB4A 5CVRA 4NWVA 3FLTA 4XOGA 2AR6A 3QH6A 3ZN6B 2WSVA 1ZZ7A 2TNFA 5KXDA 5L7OC 1H2LA 3QD6A 4GMP1 3LZZA 4OVEA 4W65A 3VDDC 3VKOA 3OTFA 1W6QA 4CZSA 2QDRA 1RUI2 4PDWC 3B01A 1DZRA 1MS8A 1BKZA 3WP3A 2PHXA 3AZYA 3MF9A 3MDPA 4HSLA 2PAMA 1AYM1 1QWRA 3APBA 1D0GA 3R0RA 1PK6A 1XYOA 2XJUA 2IXLA 4LBJA 5JI7A 1UAIA 2CGNA 1Y3TA 5J7MA 4JGZB 4YZ3A 1HQNA 4COYA 4I0AA 4JC1A 2RS53 4ISRA 3JUUA 3P3NA 2HEVF 1M4WA 4XF9A 1WD4A 4M0NA 1SCSA 3ES4A 2NPIA 5BV6A 3WQ0A 2DVAA 3UK9A 2H6CA 2KM2A 4Q0VA 2RM22 3DV8A 4AHZA 3I7DA 3RJ2X 3MIHA 4YVSB 2GN7A 2WNEA 3B94A 1VBA1 2CWSA 4FSJA 4AVAA 1MEC2 2DURA 3KZ4C 5DUXA 1E57A 1O4TA 3WCRA 1ND3A 1CQ9A 1A8MA 1VBE3 5I0RA 4S2GA 1U5YA 1AR82 4AHXA 2D93A 1UD1A 3KCXA 3D82A 5SV5A 2VVEA 1QJU1 1REDA 4XQDA 3RI8A 4AYUA 2R041 1HLCA 3AZZA 2CNAA 1Y7BA 2NP0A 2ZHLA 3JCIA 4DY3A 2RS51 4P9XA 4JRAA 5JSRA 2AGSA 2RR12 3PMEA 1GANA 2RJLA 2ZGPA 1RUH1 1MVEA 2XBO2 1Q8PA 3HWJA 4IEUA 1H1MA 1YCIA 2Q1MA 3TOJA 4O9GA 3AZVA 4JGYA 1NA1A 1V6LA 5BNQA 2PHRA 3JQWA 1QH6A 4WVWA 1FOD2 4CDQB 2VW1A 4FPFA 2QZ3A 2Z42A 4HPKA 5EYYA 3TB0A 3H1YA 1YHFA 2R062 5CG8A 3VHOA 2Y26A 5D8AB 3HT2A 4LTAA 1XNBA 5CA6A 3ZN6A 1G86A 4PIXA 1LOGA 3USUA 4JGYC 4XPVA 1OFSA 3WG1A 1CONA 1GV9A 4NO4A 1OQEA 5HCAA 3BODA 3OBRA 1G9FA 1AF9A 5GLTA 4N9IA 1YI9A 2DYCA 2VW0A 4BPZA 2R16A 4E4DX 5BYNA 1DZTA 3NAPC 1LULA 5HXVA 1ALYA 1V6NA 2VU9A 2DTWA 3H50A 3CLPA 2ENRA 1CN1A 2VGDA 2XKOA 1SDWA 3EBRA 4JGZA 4N43C 4LBKA 4O9EA 1MS4A 1DQ5A 3E6DA 1Z78A 3GYDA 1VJ2A 4XHBA 3AMNA 1NE6A 1YWKA 5C4WB 2YXSA 1DQ0A 2NZ9A 1PO21 3U0ZA 1V9U2 5JR7B 1JUIA 3LAGA 1RUOA 3ETQA 3J8F1 4EN9B 5FOBB 2Q4SA 1H9PA 5JVVA 3I2DA 1N1SA 4YVSA 1HXS3 5J09A 4JGZC 1DYKA 3VGIA 1R081 4YM2A 4AI1A 2AREA 5EV7A 1X50A 2BFUS 1ZX5A 4ZU4A 1QHDA 1DQ4A 2RS33 1BBT3 2PYTA 4KH9A 4OULA 2A6XA 3PJQA 2WT0A 1DQ1A 1QOOA 1ZBE1 4Z07A 1ZA4A 4YVSC 4HSJA 1H1AA 5DUVA 3GBWA 3HMYA 4EJRA 3IBMA 5CADA 2JEMA 4DZGA 2P3JA 2ZX1A 3BOPA 4YGEA 1X7NA 1GQGA 2B5HA 1F9KA 2MPFA 3QBQA 4KU8A 4LBQB 5F6KA 3EHKA 4K1ZA 4KG0A 2BNOA 5T5JA 1MZ6A 4F83A 2C0ZA 4LE3A 3AYCA 1J1LA 4GKXA 1WCKA 2VOKA 5AFEA 4E4SA 5IK8A 1LOAA 5EZWA 4CDQA 1AR61 3WDWA 2IZWA 1KDKA 4QU2A 2HWB3 4BYYA 2WFF3 2HWD3 3BALA 4JV4A 3EXUA 1DIWA 2XJVA 5D8AA 4KU7A 2KXLA 4A7KA 4RHV3 2EXKA 3UV9A 5J48A 3GZUC 4FPJA 5T5PA 1ZZ6A 5T55A 2UWCA 3USSA 2IWGB 3WP5A 1NCQC 5EFUA 1O91A 1EV13 1XYNA 1EY2A 3MYXA 1Z7S2 2JD4A 5T5OA 2XJPA 1X33A 4XJ8A 5D8AC 1PO13 3ZPYA 4Y1ZA 2XWBB 1UZYA 5DDJ2 1S2BA 3NL1A 4E4ZA 3O0VA 3FUQA 1Q8OA 3VBFB 3WQ1A 5I8SA 1WBFA 3FMGA 4PLNA 2IFWA 1I6XA 4AFAA 1ZRRA 1VBC3 3KD4A 4URTA 5C4WA 2HWB1 2UYAA 4Q4W2 2HWD1 2V5YA 2ZX4A 1RGSA 1VBB2 1OPOA 3IKWA 3N7KA 1K5MB 2BUKA 4FBFA 4XDQA 1JXNA 5IT6A 1QNYA 2ZGSA 4AVCA 2BWCA 3LCPA 1DDLA 1MZFA 2G9GA 2VVDA 1NLSA 5T50A 1NLRA 1TMF3 4Q4X3 3WDXA 1VALA 4BM8A 4MUVA 4CEYB 1C1LA 2PHUA 2ZHNA 1XU2A 1HRI2 1Q8VA 1RITA 2NMNA 3PNAA 3TNQA 5C4WC 5CFDB 3ZFFB 1QQP1 4UW4A 4Q1PA 4YZ2A 3S7EA 4COZA 4H7MA 5FOJB 1A6CA 2JJ6A 4EROA 3ROUA 3PJYA 4AHWA 1FYUA 2PLV1 3MLKA 1SLIA 2ILMA 3HQXA 1BVVA 4HZFA 1NCRB 3N3HA 4BIOA 1OHFA 3TNPB 1UL9A 4JTNA 4AFCA 4I3PA 5C9AB 2D6PA 3HT1A 1U0AA 4LUMA 4X6QB 3S7IA 1LHWA 1DF0A 4XF1A 2A3YA 1FPN3 5DUWA 3V0BB 1ND2B 1DHKB 3GHNA 1H2MA 1QJX3 1JH5A 2GNTA 1D2QA 1S1AA 3V65A 3VKNA 5GZDA 4JAAA 2CAVA 2UWAA 1VAMA 5A32B 2WZR3 4IEOA 2E9QA 4L9BA 4AFDA 2D97A 3AYEA 3TBDA 1LENA 1B09A 1NQJA 3WD5A 4M3CE 3JBG1 2BBVA 5AC93 1M06G 4LA3A 1Q43A 3LA7A 3K48A 1GLHA 1MS0A 2GSYA 1ZRFA 1V00A 4Q4V1 4K8FA 4AI8A 3SITA 4LR4A 1LU2A 1QXJA 4IQPA 1O3RA 1H8TC 1SLLA 3VV1A 1LTEA 1RUC2 3NJZA 2WLQA 2A75A 1FPN1 4XF3A 3M3QA 4C90A 2YHJA 2B45X 2BVVA 2QFEA 4E2GA 2ZHMA 4FQZA 2Q30A 1HIXA 4I2OA 1QJX1 2VMHA 1UIJA 4MLOA 1POV1 4Q4V2 2ARBA 4RR3B 3VBFA 4HKLA 2OZJA 2VG9A 2V09A 4L11A 1DGWX 4RS5B 4DRVA 1LESA 1A78A 2O1QA 3AP5A 1PNGA 2WZR1 2GH8A 1J59A 1G8WA 3UKNA 2A5ZA 1Y9QA 4E27A 1K5MA 5F1RA 5AC91 4LO8A 4WVMB 4XJWA 3EJKA 1GNHA 3OGJA 5I93A 3ZIWA 5JSPA 4PLMA 3WZ1A 4GIQA 1VRH3 4FO9A 4JDNA 2XH6A 3VBFC 1BEV3 1C28A 1CR7A 3ZXAC 5ABJB 4CDWB 2HKXA 1S0BA 4OHWA 5BNNB 3VHRA 1KRIA 4N90A 2AUYA 1RUG1 4F8AA 2I07B 2X5IC 3MLJA 5CFDA 3ZFFA 3VBOC 4XFBA 1UKGA 2R073 4AI3A 4FCAA 1VBD3 2MEV3 1K5MC 2D43A 1SBDA 3URFA 2P37A 2DCYA 4RQPB 1APNA 1RINA 2RJKA 4XJUA 2OPKA 2SLIA 2HWE1 4P9IA 5E8AA 2D6KA 2QUOA 4FOQA 3RI9A 1NCRA 4YFZA 1LKNA 1PZ8A 1RUE1 1LHNA 3ZIXA 3GF6A 3IIAA 3P3PA 1N1TA 3HIFA 3VBSA 3MW4A 1HV0A 1H30A 3V0BA 4KGQA 4BA6A 5CFDC 4FPCA 3ENRA 3IMNA 2E7AA 4QGNA 5I91A 2GNBA 5JZGC 2JG9C 1AX1A 1NCRC 1WA4A 1BEV1 2OYZA 2W68A 4LBLA 3JB8A 1BYHA 5A32A 4DB5A 3VBSC 2XG3A 3WQ7A 4BZ4A 2ET7A 2R071 4PIZA 4QX5A 2MEV1 3BIWE 4JRLA 4ZXKA 3JD73 1G7YA 4HANA 1WLTA 4NHLA 4EWAA 5L7OB 1DFQA 5BNOB 4P5HA 1ZBA3 5BXXA 3T2TA 3VZNA 3AK0A 3VDDB 1R1A3 1EAH2 3HR9A 4ASMB 2PFWA 3FLRA 1LECA 3ILNA 4MXVA 4R4XA 4AVBA 4BHPA 1H0BA 4QQHA 5DZGA 4RR3A 1UPIA 1I1EA 4RS5A 1UZZA 3WNXA 1MS3A 2QJVA 1TME2 3M4FA 4SBVA 4MSVA 2IC1A 5CAZA 1C1FA 1SMVA 4WVMA 2WWSA 3B3QE 4DY5A 4AFBA 3PLQA 3ZMOA 3JD71 2YDEA 2OUJA 4M01A 4BLIA 3CEWA 4Q4Y3 1AX2A 4RR3C 5ABJA 4CDWA 4WM8B 1DQ6A 5BNNA 1AX0A 1VLNA 4RS5C 5EYXA 3H8UA 1RVF3 4XFGA 1WCSA 1ZBA1 4GH4B 5J96B 5I0TA 1UU4A 3ME2A 4RFT0 1JTZX 2MHFA 2DUQA 4GB31 1UW8A 1O3TA 2ZGNA 4EN8B 4RQPA 1RUF2 1FAYA 4HT1T 1AR93 4TWTA 2EXHA 1CIWA 3AFKA 4AVVA 2PHFA 1FMD1 5ABJC 2KA3A 1C3HA 3CJXA 1V6KA 1AR73 4B8EA 1QJZA 4HLTA 1COV2 1C8M2 4AW7A 4LBOA 2WS92 2FBEA 3SCHA 4DS0A 3VN4A 1PM7A 1S0FA 5FCCA 4C0HA 4YVWB 4OZXA 4XTMA 3ZFEC 5HI0A 4MYEA 1QNWA 4JCKA 2WT1A 4AHYA 1JUHA 2CYFA 4Q4Y1 5CNAA 1CVNA 2VXRA 3IM0A 1EPWA 2DU0A 4Y1YA 1GFF2 3AFGA 5FO8B 4N53B 1RHI1 2UY9A 1QJY2 5DZFA 1HDKA 4GMP0 3SLIA 1ZVFA 4K1YA 4Q8KA 1JOJA 4YW4A 5JIAA 4YZ5A 4OI1A 1OSGA 1RB8G 3AYDA 3BB6A 3WDYA 2VNGA 4PIYA 5H9RA 3B9CA 1AYN1 2P34A 4KL1A 3EO6A 1AYM3 1UU5A 1X36A 3KGLA 5L7OA 2RM23 2RHPA 5BNOA 1I5ZA 4LO7A 1MQTA 3QCWA 1LOEA 1AL22 2ZCWA 3VDDA 1IOAA 1AJKA 5BNPB 3WUCA 1LOFA 2QVSB 1JW6A 4BMBA 1BQPA 4XXAA 4COVA 1RUI1 2WA3A 4RL7A 4XQWA 3NAPB 4YGCA 1R092 1YUDA 2VMIA 4QMAA 3NO8A 1RUD2 1GQHA 4L92A 1AR83 1BVP1 2RE9A 3LOBA 3WUDA 2XUMA 3USUB 1W6OA 2JE9A 2IXIA 5BNOC 4N43B 1MQTC 1VBA3 1ZZ9A 4JDMA 2BVBA 4C0BA 5KBFA 3NW4A 2CL2A 3AKSA 5FAXA 1LOFC 2V73A 2VW2A 1IS6A 3PVNA 4QQPA 3AP4A 3FBMA 5H9SA 4PBOA 1I9RA 4FQ4A 5L73A 5LEJA 3O5SA 2R0HA 4WM8A 1NZCA 2PAEA 1WLDA 4ATFA 4Q27A 2RM21 3FUOA 3FBYA 4PBPA 1OFNA 1QJU3 2WKKA 2XHKA 3LKJA 2NQYA 4GH4A 2R043 4QPIB 3AMPA 5I0UA 1QMJA 1QGLA 1V6MA 2BNMA 3QOPA 3PMSA 4W6YA 1MEC1 4QGMA 2RS12 1H4HA 4WZFA 2QDNA 2AENA 5H9QA 3VKFC 1RUH3 2D44A 2GMPA 1CAVB 1J1TA 1KJRA 3IDBB 4WM8C 1AR81 1REEA 3RYPA 2JE7A 2YPJA 4GA9A 4GH4C 5K0UC 5ACA2 4D7TA 1FV2A 3AP9A 4I09A 4YVWA 1MACA 4LUKA 3SHRA 3AKRA 1HX6A 4X6RB 3FFZA 2E63A 3MIDA 4HKOA 2RR11 4SLIA 3U07A 1JN2P 1OKQA 2XBO1 4ISQA 1SEFA 2WL1A 2R1BA 2ET1A 4N53A 1ZRCA 2OVUA 3H1WA 3LA3A 3ZMNA 2WFPA 3AJZA 2HEYF 4K21A 3ZXGA 5GZCA 3E5QA 1FOD1 1XNDA 3CNAA 4Y1UA 3WW1A 4YVWC 2YC0A 4IL7A 4J6GA 1BCXA 4LO5B 2R061 4XFIA 3B00A 4LE4A 4META 3LSEA 2CV6A 2NLRA 3RNSA 5I8YA 1DGWA 1XRUA 4N53C 2DVGA 3OF1A 1NCQB 4R4ZA 1YXWA 4E2QA 4NHKA 2DV9A 3THTA 4COUA 3WCSA 4K7JA 5BNPA 1N1VA 3MGUA 3VBHC 1PGSA 1VAKA 3NAPA 1PO23 3TWIA 5AVAA 3MW3A 1YFUA 5JIUA 4XFFA 3J8F3 3ELNA 4N9HA 4GALA 4YG0A 2VNRA 2ZPXA 2TUNA 4OI0A 4OI2A 3WW4A 4AQTA 4N43A 4OUSA 3OD4A 1CJDA 4FTBA 1R083 5BNPC 4NR1A 1B35A 3U4XA 1ULDA 2ZGLA 4P9GA 2C9AA 4CRQA 4EWDA 5K8SA 5B2GB 4MH0E 2ZGUA 1ULEA 1V9U1 3VZMA 4R8HA 4QD2A 5EXOA 1RJ8A 5EWSA 3H7YA 1ZBE3 4QPIA 3VL8A 5LK7B 4EV0A 4CP2A 1WW4A 2OIIA 4FPYA 2E51A 5DXDA 2ZGKA 1B35C 2VOWA 2AH2A 2HYKA 2HEWF 4S2FA 3T1MA 2QCSB 2CGPA 1VBE2 3M3OA 5IK5A 3D5OA 4AEJA 1SFYA 5IUQA 1CAVA 3O14A 3DN7A 4WV8A 1SLBA 5T3NA 1HQWA 1ASJ1 4QPIC 1PGL2 4JDOA 1AR63 2D6OX 2D3SA 4ZU5A 5CG9A 4XJZA 3FX3A 1F31A 2C5DA 4Y20B 1F2NA 2AYHA 5GLVA 1QKQA 4XJAA 5KXBA 5LEKA 4GXLA 1DLLA 3WG2A 5DDJ3 5FDBA 2GC0A 4RGGA 2DCJA 1ASJ2 1MR5A 1PMIA 4LULA 2A3XA 5JSOA 5J37A 4R9CA 3H1MA 3AMQA 4OLLA 4LO4B 3VZLA 2ZX0A 1WD3A 4YW1A 4MZUA 3TN92 1BXHA 5JWPA 5GKAC 4DRRA 2EXJA 1W6MB 3D0JA 2DWRA 1UMZA 1UCXA 2ZMKA 3RRDA 2UY8A 5T52A 3ZVXA 2ZZJA 1J3PA 1I3HA 1KQRA 4G4FA 4P9LA 3SISA 4DXZA 3FFQA 3ZXDA 4OHVA 2UYBA 2ZKNA 4YW3A 4ITCA 1NCQA 5GLWA 3OYWA 2ZS6B 2BFUL 2PAKA 3VUOA 4I3GA 4YFWA 2R0FA 1H8TB 3WW3A 3LWCA 1Z7S1 1HRI3 2ZZQA 3KSCA 3CF6E 4XILA 3AB0A 5FQ0B 1GYKA 1IPJA 1ZZ8A 5DDJ1 1J58A 3WR0A 4I02A 4D3WA 1IKPA 3OCPA 4QPGC 4GWNA 3AMMA 3POSA 4QGLA 2H6BA 1TNFA 3B9IA 2D6NA 2GC2A 1AVBA 3J4UH 5GLZA 4YZ4A 3SXWA 2GDFA 4ES9A 4Q4W1 3MFCA 2XB6C 1QQP3 4YGBA 1CAUB 1GKBA 1VBB1 3MIEA 4B4QA 1T6GC 4BMEA 1URXA 3MIGA 1AHSA 3OBTA 3VHPA 3BCWA 2PLV3 1SBFA 2EVXA 3RWNA 1SACA 1V70A 2IXKA 2WNVB 2YYOA 3WXPA 4KG8A 1HXS2 3NV1A 4BLJA 1FX5A 1V6IA 3WDUA 2D3RA 3TYJA 2WQ4A 1KS4A 3QLQA 1LU1A 2ZAAA 3WDVA 4ZKTB 2X5IB 1HRI1 3VBUB 3VBOB 1IS4A 5KC5A 4M3CF 1CX4A 1GZ9A 5KXEA 2RS32 1DBNA 1BBT2 1QU0A 4IV1C 2B9UA 3WG4A 1AXKA 1WMFA 4Y22B 3UJOA 3L2HA 2B8MA 4OHYA 4AQ6A 5C33A 4K6BA 4K9SA