1WZXA

Crystal structure of family 30 carbohydrate binding module.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
RKLLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 35
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wzxA00
2Q1FA 2C24A 1V0AA 4LJHA 4CPBA 4LK6A 4LKFA 1GWMA 4LK7A 4YW7A 4BQ4A 2JWPA 4BQ5A 2LROA 1WZXA 1W9FA 3ORJA 5D21A 3ZYBA 1GWKA 3F95A 4CP9B 4CPBD 2O14A 2VXJA 2K46A 1W90A 1WMXA 1GWLA 1W8WA 1W8ZA 3UT0A 2KR2A 3ZYHA 4LKDA 1OH3A 1WCUA 1L7LA 1HN0A 4YW6A 1W8TA 4BQ3A 4YWAA 4BQ2A 4CP9A 3ZYFA 4A6SA 1UOJA 2LRPA 1OKOA 4LKEA 1W8UA 4AL9A 2WYFA
chains in the Genus database with same CATH superfamily
2XHKA 1C4RA 3GZAA 5DAXA 1CR7A 5JDBA 1YI9A 2VOTA 2HWB1 3K4ZA 1D0GA 2GZWA 4MYEA 4RQPA 5FLHA 1HDKA 4LIUA 4UW5A 3WD5A 1FI2A 4YGEA 3M70A 5A3WA 3QACA 4K9SA 1J3RA 2WQ4A 5LY2A 1JI6A 4J25A 3WW4A 1TME2 1SCRA 3U4XA 5DDJ3 4QQHA 1AX0A 5A3LA 4P9YA 2YGMA 3LFMA 4OI1A 2V5YA 3OGSA 3ZMNA 4M0NA 4CDUA 3WW3A 1MACA 5FCCA 2D44A 5FYVA 3IB3A 1AF9A 2GAUA 2KD7A 4LUKA 2CWMA 3WXPA 1OLME 4K1ZA 4M0HA 4P5YA 2VMFA 4XUPA 2QTWB 2O8QA 4YWAA 1X8EA 4QPGA 4QX3A 2HLEA 4KWLA 1LOAA 5LCWL 4CXYA 3DYMA 2WZEA 3ZFEA 3JCIA 3IAPA 1WUVA 1PVXA 2Z79A 4P08A 5D8AC 5C5UA 2BW8A 3S57A 2HWD1 3OOXA 2VVEA 3EB7A 3KB5A 4Q1RA 3ZFGB 1NXD1 2R042 3AVSA 3AMHA 3M3OA 2O0OA 4Q4W2 4OQ9A 4BLIA 1O4TA 2Q8CA 1RUE3 2P5BA 1MS4A 2VBDA 1TEIA 4Y24A 3A21A 2KXLA 1YQ5A 2BTVC 2OPKA 3BUCA 4DY3A 3A22A 1NCRA 3BALA 4COZA 1Y9GA 2GN7A 3OB8A 4YM2A 3LPGA 3LA3A 4YW4A 2A3WA 3DKWA 5FK8A 1ULDA 2JDKA 4BU2A 2WN2A 4CCOA 1YYNA 4BHPA 3S5QA 2OQ7A 4HKWA 1H2MA 1JBCA 2Q30A 3FHIB 1DLLA 3PUHA 4K8FA 4QGLA 1EYBA 2VUCA 3B3QE 4IW3A 4JGYB 4XYXA 2HEYF 4MADA 5FZEA 4X8NA 2VECA 4AFBA 4JGYC 4BCUA 3IDAA 4W6WA 2Q8OA 1GFF2 1Q56A 4FSJA 4XE9A 4XUNA 1NLSA 5BNNB 1S4CA 4M3CE 3R4DB 4XHXA 1HRI2 1J83A 4RGKA 1VBE1 2IXHA 4IEPA 1F8VA 1R093 4GH4B 2DUOA 1RUH3 2VZUA 2ZMKA 4IE0A 2VBPA 5DAWA 1N1VA 4YG3A 5F5IA 3MFAA 1AZDA 2BZDA 2W9XA 3GYDA 4QXCA 2BNOA 2BERA 5B2GB 2A70A 4ZHNA 3K2OA 2P37A 2ZGKA 1LRHA 1O4ZA 3I3DA 3FFQA 4OMCA 5DUWA 4EWEA 3D3AA 3AMQA 4YFZA 2FDGA 1YWKA 1XQNA 2VC9A 4PQ9A 4Y4RA 1OI6A 4RR3A 4X6QB 2QQLA 3VZJA 2BOJA 5LZ6A 4JKKA 4MX3A 4BYYA 1YFYA 1IS3A 4CEWB 4BQ4A 5JSRA 4PI2A 5DAVA 1NE4A 1RUF1 4CEWC 4QM8A 1HXS1 3O1UA 4OUEA 3LA2A 4AEDB 3RVHA 1HW5A 3I2IA 1QU0A 4HXCA 4NPMA 1OOPA 3WX5A 1QEXA 5F3CA 3ZSMA 1XYPA 1BEV3 4ZS3A 4KGGA 1Q8SA 1QF3A 3JBG2 3VBSB 4I3PA 2GMPA 2HWF3 2Q4SA 3N9OA 1F35A 3VBSC 1NKGA 1BBT2 2R30A 2JDMA 5L73A 4JHTA 4BM8A 4HVQA 4LXLA 5H9RA 1FOD2 5FJKA 5ISLA 5F1RA 3FBMA 1PGL2 2XLAA 1W6NA 3U0ZA 3ATGA 2PHLA 2D6NA 2ZKLA 3PUSA 4EQVA 4Q0PA 5GKAC 1DZQA 1VBA1 2JDAA 1N3PA 3OEAA 4MVTA 3WUDA 1MR5A 1W99A 1HJGA 2VQTA 1OQEA 4IQPA 1BMV2 5FMOS 2E7TA 1SMVA 1WMEA 4RS5B 3WEZA 2K46A 1UIKA 3MIEA 5GM0A 1R1A1 1WMXA 1NCQB 3AZVA 4OMDA 4Q1PA 3WW1A 4LE4A 1WKYA 1NCQC 2VCBA 4HVOA 5LK7B 3OG2A 4IESA 1UF2C 5LBEA 2OZ6A 4LKDA 4CEYB 3V0AA 4J1XA 5FLIA 5FZDA 4QX7A 1B35A 3NJXA 2VOXA 4CXXA 4LHLA 1ZYBA 1LOFC 2P6CA 4Q4V3 4OI0A 1VRH2 2WYFA 3GNEA 1H6YA 4WM8C 5L9RA 4EJRA 5FP7A 1ENXA 5T5LA 2P1BA 2VH9A 3RS6A 1IPKA 1LOCA 3PVNA 3USUB 4R9CA 5FYSA 5I8YA 5L36A 1RUJ1 2W52A 1FX5A 2VNOA 1H8TB 4FP3A 3J7LA 3VZMA 3WDTA 1TE1B 4JVAA 1QQP3 3KGLA 2PHUA 2E7AA 3C7EA 1NQJA 2X5IA 3RJRA 3M3CA 1V9U3 1QGLA 2VMGA 4FOQA 3AYCA 3K3OA 3VHPA 2BNNA 5J36A 1JODA 1MQTB 5CFDB 4XF3A 1R081 1MQTC 3WNNA 3LEGA 4DXTA 5L7OA 1RGSA 3ILNA 1LGCA 3BVCA 2XOMA 1QJU3 4LR4A 4QX5A 1W39A 1XYOA 4UOJA 3RWKX 4QPIA 1HN1A 1Y9QA 2PAEA 5JOXA 1OVSA 4JC1A 4KWJA 3VBFC 1RXFA 4NRQA 5DDJ2 3PVEA 4ORFA 1NYWA 1WD4A 5IVBA 3V0BA 2VU9A 4URAA 1LAJA 2ZKNA 2DV9A 4GMP0 3TRSB 5IFTA 3IKWA 2BQPA 3P3PA 4XFAA 5FZ0A 2VBBA 1GOGA 1U5IA 2VNRA 2R1BA 3ITQA 3LKJA 4YNIA 2Y64A 3HEIA 5C3OA 2FZ2A 1W90A 1NA1B 2X53S 4AGGA 1NA1C 1LECA 1OVPA 1W8ZA 1UXZA 2D6KA 4BK4A 2D98A 1W6MA 2PQQA 2V4AA 3SMHA 2QQUA 2YG0A 3P1IA 4JDNA 5JSOA 3OYWB 1VBB2 2QQJA 5FZCA 3N7LA 1UOJA 4CP9A 1ZA7A 1OC1A 4RYDA 3VDDC 1YJKA 1KFXL 1PGSA 2ORZA 3ENRA 1RUE2 3AJYA 4AF9A 2WZ8A 2QQWA 5KHJA 3VD9A 4CE8A 2BOIA 2RDSA 2J1VA 3V64A 5FWJA 3EHKA 1RMU1 2BGOA 1FMD1 4O65A 4PHZA 1UQXA 3AKQA 4WVMA 4YYOA 1GICA 4I09A 3MICA 1RYYA 3LE0A 5GZFA 4AVCA 5K4LA 3B02A 2PXJA 4AEKA 5FLJA 2WLPA 4D8MA 3E6BA 5FZOA 1OSGA 2FBEA 4Q4X3 4N90A 1LU1A 2P2KA 3AXEA 2AREA 2J42A 4HZFA 1AR73 3PL0A 1F5FA 1GNHA 4Y1XA 1ODMA 2B8MA 2R062 2GNTA 4XACA 1HRV1 3VB9A 4EROA 2XR4A 3R05A 4E8CA 1OLMA 4KU7A 1FNYA 2VVDA 2W68A 3IDBB 2QE3A 4HONA 3ZFFB 1OMIA 4FOWA 4FBFA 2IZWA 2J1EA 4QXKA 3C8XA 3TN92 3AP6A 3ZFFC 3WNXA 2Q1ZB 3KHCA 4JTNA 4TYSA 3W5NA 1REFA 1NUKA 3ZXJA 5J09A 3VBUB 4IV1B 3ZSKA 4YM1A 1ULGA 2WZR2 3VBUC 1CZSA 3POEA 4EN7B 3U07A 5EYYA 1NG0A 3ZFGA 5A1FA 3W9AA 1UZYA 4P9XA 4Q8LA 3SC7X 3CJIB 1W9WA 4CA9A 4QPWA 3BTZA 4FFHA 4OYUA 3KQRA 3S7EA 4FAHA 3HPNA 4XFCA 3ZKUA 5IAXA 1P8JA 4IEVA 4LUMA 3T3YA 4M4PA 4BH9A 1APNA 4L92A 4QQLA 3S5AA 2ZHKA 5DZGA 5F37A 1JZ4A 2QKDA 2A73B 3K48A 3SLIA 1BEV2 2E9QA 2AEZA 3PMEA 1N1TA 5CFCB 2V73A 4PT6A 4BA6A 3FE5A 1UN1A 5C3RA 5CFCC 3PHMA 1W28A 4GWMA 4LT5A 3OPTA 4P14A 4JGYA 4K40A 2RMU3 4PDWC 5A7PA 5C3PA 1VBD3 5I0SA 4O9EA 4KWKA 4M3CA 5FZ3A 1YQ2A 4NHYA 4NOTA 3MZHA 2CTVA 4QU1A 5FOBB 4CCKA 4XMAA 5JXJA 3TNPB 3RJ2X 2X29A 5FZ1A 1Y4WA 2ZGSA 5DUXA 2VAUA 3N7JA 3V56A 4V2WA 2HH9A 2XL9A 2DVFA 2YBPA 1HLCA 4Q8KA 2JICA 1YRZA 3ORJA 1Q8VA 2IFRA 2R6QA 3NQHA 2GP5A 1LHUA 1JYIA 3WDYA 1KFUL 3E97A 4DS0A 4Z1VA 1RITA 2UWBA 3MYXA 1CAUB 3NKGA 3T1LA 1ZRIA 4IL7A 4AQ6A 4AAPA 4ASKA 1PO13 1RINA 5LA1A 4FTSA 1AYM2 1IZ3A 1PGW2 4CEWA 2IUWA 3ES4A 1HKDA 2R1DA 3OEBA 4YGCA 1UY0A 1W8NA 3AYAA 1O6UA 4AEDA 4ZU5A 1X8MA 2HWB3 2PHTA 4FFFA 1QQP2 3VBSA 4FFGA 1ULFA 2XB6C 4EWAA 5EWSA 1V9U2 2ZX0A 3PU8A 4GXLA 3MIGA 1Z7S2 1J58A 4NO4A 1ZA4A 5DPNA 1JZ2A 3BU0A 4LORA 5FJHA 4IUGA 4NROA 1IHMA 3LF7A 3ZR6A 2JIJA 2EALA 1JXNA 3DYOA 3ZDSA 5CKNA 1CAXA 2F4PA 2WJSA 4CXWA 1C8M2 2W1QA 3D5OA 5IK7A 3M1HA 2YDEA 2AH2A 3VKFC 4BOWA 4ZU7A 1ZVFA 5FZHA 4N43B 4B7KA 5AC92 1KXGA 1BCXA 1WBLA 4N43C 3NMBA 2PHXA 1QIQA 4XXAA 4RS5A 1TMF2 3WHTA 1NCQA 1JYCA 2HWD3 5GLUA 4P9JA 1GZCA 3WP6A 2Y38A 4MGZE 5J48A 4RFT0 3U14A 5FYTA 1LOFA 3PJQA 5IVFA 2ZBJA 4Z2AA 4LO8A 3E1F1 4WM8A 3H7YA 1YNAA 5TSWA 4XQDA 1XNTA 4CSWA 3AKPA 3JU9A 2VXJA 5FZBA 1DQ6A 1VB2A 5BNNC 1NE6A 2D5FA 3V65A 1A6CA 1S0DA 5LWBA 5A1LA 4EN6B 4C8DA 2AR6A 2OPWA 3GXUA 4CP2A 4OHXA 4OZXA 1MS3A 4OVEA 2EXHA 2IXJA 2GH2A 3B5LB 4HLTA 4W6YA 4NPLA 3KCXA 1Q8QA 2MHFA 3OBTA 3UKVA 1QMJA 4FPFA 5FZ6A 3LQCA 4Z82A 1QJX2 5FK7A 5HCFA 2CAVA 2D43A 1MQTA 3SXWA 3GHNA 4NRMA 1WA6X 2VVFA 4YW7A 2HWE1 5IFPA 4KQ7A 4LBOA 1AR81 1WZXA 1C3HA 2ID4A 1W9FA 3FZ3A 4Q4X2 3K3NA 1M4WA 5J98B 3LA7A 1AR72 4FPKA 1VBE3 3HNBM 2Z2SB 4JDOA 3VBFA 4D3WA 3H1WA 4JAAA 3EMRA 1ZZ7A 2WFF1 3M3EA 4S2DA 4K6BA 4AK3A 1QJEA 1XYNA 3J8F1 4RQPB 1JOJA 2XLFA 4IE7A 3U75A 4E4ZA 1S2EA 2VZPA 3E5UA 4Y22A 3VGIA 3C3VA 2NZ9A 4XTPA 4UW3A 4DY5A 1X9TA 1CN1A 5A7NA 4MSVA 2ENRA 2CU5A 4A45A 1AR93 1OHFA 3GHMA 2CAUA 4MGYE 3T2QA 3ALQA 4NWVA 2IVJA 4IGQA 1NA1A 3AZYA 3ETPA 3TEXA 4QB2A 1SLTA 2BWCA 1ZREA 5JZGC 4DOUA 1AYN1 2QCSB 1AL21 1GV9A 3O1TA 3IPVA 4DQAA 1HXS3 2QJVA 1UOGA 1S1AA 4C0HA 3WDWA 3DF0A 1NX9A 3VDDA 4HKOA 1REEA 5BXXA 1J84A 3ZFEB 1RUOA 4CDQC 1DZRA 3M8LA 4Q0VA 2XVKA 1XOYA 2XQXA 2N7GA 4QX0A 1UO9A 1UX6A 5KXEA 2UWCA 4KGQA 2GNMA 4CCNA 1OKOA 5JCTA 3K46A 4QHBA 1XNBA 1HB4A 3VD3A 3N9LA 1VBA3 2ZMNA 2J1SA 3C7FA 3QCWA 5BV6A 3PURA 5ANNA 1YIPA 3ZDVA 1NCRB 2JE9A 3CZJA 4A7YA 2MEV2 2RMU2 1VBD2 1VPHA 1WCQA 3TOJA 4BE3A 5IK5A 3IAQA 2WS92 1R1A3 4P9WA 4SLIA 3N9QA 3I3MA 1W0NA 3ZFFA 5F7UA 3VKOA 5CBLA 5JWPA 3SCFA 2C4XA 4XFIA 2WBKA 2W46A 5FUNA 2ARBA 5CNAA 2DYCA 2OKXA 1KRIA 1QJY1 4G4FA 2JDNA 1NY72 4HN1A 3I3QA 2PFWA 4MXWA 3VBUA 4XETA 4PF1A 5FY8A 2JE7A 1DDLA 1F5JA 1X33A 1Z78A 2RJKA 1RUJ3 5JOWA 2C9AA 2W5FA 4UFIA 4MG2A 1YUDA 4RHV1 3P3NA 2C5DA 5A3UA 1PO12 1H9PA 3ZXAC 2XJSA 2VMCA 4CPBD 3SH4A 5C5TA 2H6BA 4LHNA 3W21A 1RUC2 4F3JA 2IVIB 1Q5OA 1IKQA 3LZZA 5FO7B 3RZKA 1SLCA 4XF9A 5IVJA 1R083 1CAVB 2HWB2 4YSFA 4I02A 3D82A 1DLCA 2FMYA 2RS11 4A6SA 2G9GA 5CFCA 1IKPA 2XJVA 1VMFA 2DBIA 2YFZA 4PDWA 2JD9A 1R1ZA 5FPBA 3U1XA 5FIXA 2XJQA 3MFCA 4HETA 5BY5A 5C71A 2OUHA 3PTRB 4FOVA 1E57A 2RR12 4AVSA 2JDZA 5EYXA 1O5LA 4Z2WA 3BB6A 5FBZA 2ZHNA 3FJSA 3NNMA 1PO21 2BU9A 4RN5A 1BXHA 4P9LA 4IEYA 4YGBA 3SH5A 1HV1A 4Z8BA 3BPZA 1W6NB 2JB4A 2J1RA 1EAH1 3ZIXA 5JXGA 4HFSA 3VZNA 1IPSA 1QH7A 4FOYA 2WO2A 2W92A 3MW3A 1WCDJ 3WF4A 4K3UA 4WV8A 4NIDA 1VBC2 1QJFA 3JZVA 1W2AX 2FMDA 4A3XA 3IIIA 5FY5A 3BCWA 1QWRA 2JDPA 2NM1A 3DL3A 5E8AA 1GOFA 4F8AA 1VIWB 1RMU3 1SLLA 1TQ5A 2E63A 1FMD3 1WMFA 2ZHMA 3JD71 4CUGA 3V0AB 2R7EB 5T5OA 4IXLA 3LPFA 1SLIA 2DWRA 1JU3A 3RI8A 5FZAA 3G6JB 2CGPA 3M7AA 3DEMA 3NAPC 1XRUA 1ZZ6A 3QOPA 4J6GA 1O3QA 1JHJA 3LD8A 4QX2A 2DURA 1JUHA 3BYWA 1OUSA 1IQAA 3ZMOA 2XJUA 5F3GA 3ZO0B 4CCCA 1HRV3 1NXMA 2LRPA 1TNFA 2RM21 1MEC1 4J1WA 1DHKB 2ARCA 4Y3OA 3D4KA 1VBE2 1TZOA 5ACA2 1WMDA 2G9FA 1Y3TA 5JPMB 2ZGMA 1RUI2 4N43A 2YPJA 2E33A 3JQWA 4U36A 4ET7A 5L7OB 4R52A 2GU9A 5FO8B 2O8OA 1JN2P 1AR92 5GJ6A 2HKXA 4IETA 3WLUA 3ZN6B 3LWCA 3V0BB 1T2XA 1ND3C 2V09A 3MW2A 1COV2 4CRQA 4D6RA 1LHOA 1BHGA 2RDRA 1KJLA 1MZ6A 2VM9A 4GB31 2KM2A 4IEZA 4B3NA 5F3EA 3T2PA 2FCVA 5HI0A 5EIYB 1K45A 1Q8PA 4H14A 1TVGA 5FPUA 4KG8A 3PNAA 3K77A 4ZS2A 4MGIE 1FYUA 2Y60A 1JU4A 3DKQA 1W6MB 4DRRA 5EQUA 5LA0A 1NLRA 2C6SA 4C1WA 4YZ4A 1GLHA 3WNKA 1Y9MA 3E6CC 1W05A 4NIGA 2IC1A 4LKSA 5FYHA 3T4VA 4L97A 3UETA 4K20A 4N7UA 4QDRA 1UU5A 1W2OA 5DUVA 4DFSA 2EIEA 5E89A 3EQEA 2J1UA 3HNYM 4FPJA 1O3SA 4FPHA 4AI9A 1WLWA 5GZDA 3RZGA 2WWJA 1VE0A 4EE2A 4FTBA 2VTXJ 2VPVA 3CL1A 4CDXC 1EUUA 5JMCA 1XJAA 1W0OA 4NIAA 3UGFA 4RFRB 2XJRA 1QXJA 5FZOB 4MV2A 4NIHA 2W94A 4BMBA 4G9SB 1JZ7A 2WT2A 3HN3A 3DCQA 3WF2A 4AFCA 2E53A 1UPIA 1XU2A 1NAEA 1RC6A 5EHDA 5JZGA 4XCBA 1LENA 1W8WA 5FYMA 1DYPA 3H50A 5C6CA 2HWC2 4QMAA 1EUTA 1SG3A 5CYYA 1EV11 1CGPA 3OY8A 1AJKA 5BNOB 1Q8OA 2VOVA 3KWVA 2DVAA 4QXBA 4YLZA 4OUSA 4ATEA 1BKZA 1K5MC 4CDQA 4D7TA 5BNOC 3T0AA 1XBFA 5CVRA 2HYKA 5D8AB 4CU7A 3MO4A 3ZN5A 3ZYGA 5IVEA 3ZVXA 2PAMA 2UYAA 3AL6A 1RTVA 3OUHA 1R082 2VZQA 4A44A 2BRTA 5JXHA 3FUQA 1XE7A 1PVC1 4JKLA 4UBGA 1RB8G 5FXVA 3T0DA 4L8QA 1ZZ8A 4S2FA 4L11A 2O1QA 5AVAA 2B42B 3O1RA 1DU3D 1BQPA 3NRUA 1PK6B 4TLFA 4WZFA 3RGBA 5ABJC 4YM3A 5LY1A 1IGOA 2VZRA 1PK6C 2A6XA 2OA2A 2ZABA 4E9KA 1I6XA 4FVVA 2I45A 3T08A 5D1IA 1OUXA 3QH6A 3WG3A 2H0BA 2YY1A 4LJHA 4CDWC 3AMPA 1SPPB 2GC3A 5LA2A 1W8OA 3HD8B 1ALYA 2W2IA 3NL1A 1X9PA 1NZCA 4N9IA 4XF4A 4M3CB 5JPNB 1L3JA 1DGLA 5HCHA 2DCJA 3AP7A 4AI8A 3HAGA 5FYYA 3F95A 4LHKA 4EN9B 3LDBA 5C8CC 1UMHA 3KLSA 1FNZA 3SNMA 1C1FA 2XGXA 3PVOA 1N1YA 3ZLIA 1U12A 2VO5A 3OTFA 5A3OA 1RVF1 2HJIA 3NV2A 2FDJA 2XH6A 3ACLA 1JH5A 4N53C 2EAKA 1I5ZA 1FMD2 3ELNA 4WM7C 1OF3A 4XFGA 5KXCA 2FDHA 1CONA 3ZXLA 1CAVA 2OQ6A 1N47A 2VL4A 2J1AA 1AR83 5LEKA 4BJ0A 4YW5A 3I2OA 2DU0A 2W1UA 3MGUA 1ZBA1 2Y6HA 4B29A 4Q0SA 5FV3A 2VR4A 2W1SA 2YPDA 4CCDA 4NHXA 4RL7A 4BQWA 2ZZQA 2DTYA 3EBRA 1U5ZA 3J8F3 2A6ZA 5FPZA 5DXDA 3ILFA 3GBWA 3MV11 3WY6A 3ME2A 1XE0A 2FCUA 5A3PA 1EPZA 3AP4A 5B4XA 1H1AA 2BDRA 4YVSB 2PN5A 3IZOA 2WN3A 1PMIA 3CJXA 4XZUG 3HNMA 1LGBA 5F5QA 4YVSC 4XAEA 1V6LA 3KZ4C 4BQYA 1DIWA 4AHYA 4AI2A 4YG6A 3EXUA 5IATA 2QQIA 4QQOA 1GOHA 2ZJCA 2EXJA 1AYN3 1AX1A 5FPAA 1AL23 1CAXB 4QQ2A 3X29B 4CUAA 1DYKA 1BLZA 2F6BA 1UXXX 4XABA 3HBKA 1UAIA 1YC61 2PHDA 2UWAA 2ZEYA 4I2OA 4COYA 5CU1A 5APAA 1GZ9A 4P9IA 2QDRA 3S6PA 3INAA 2DCKA 2XBO2 2ZX2A 2BGPA 4LNVA 2GC2A 4XJ9A 4DXRA 2SBAA 5A7OA 3O1PA 1ZBE2 1US2A 2D6PA 3O14A 4KBBA 5FWEA 2ZPXA 3NSTA 1W6QA 1JHNA 4P5HA 4RGGA 2A7AA 5A7SA 5IT6A 3WNLA 2D3PA 1K42A 4YVWB 1CZVA 4WM8B 1UY2A 2YC4A 4E2SA 4E4DX 4YVWC 2J7MA 3J7MA 1CJPA 3OCPA 4OHVA 4C91A 2GC1A 5KHHA 4YPJA 1SBEA 4Y1YA 3VBRC 4GWNA 3THDA 1ASJ1 1RHI1 2R0HA 5F2WA 4LIVA 4COUA 2VULA 4BMEA 1EY2A 3ABZA 3MIBA 3ACIA 4A3ZA 4LBQD 3WOGA 2OS2A 3NJYA 1FPN3 1GQPA 4A42A 1DF0A 4IE4A 4MGSA 1GP6A 1POV0 4AQSA 2D40A 2IXCA 4HG6B 2LM3A 2A71A 2R16A 2ZGRA 3A4UA 4JGZB 4Y1VA 1IOAA 1ZRRA 1XNDA 4JGZC 3UGHA 3FX3A 4CCLA 2XKOA 2FD8A 1E5HA 2VZTA 3AP9A 2C24A 1UOBA 3VBFB 3ZYIB 2VUDA 1H9WA 1L7RA 4R8HA 2D5HA 4YFWA 4NRPA 5FY7A 4AHXA 5BUVA 3H8XA 1LTEA 1G8WA 3ZN6A 4I01A 4AW7A 4RHV3 4UF0A 1J1LA 2VMHA 4Y22B 3WF0A 4YARA 2X10A 1XB9A 1UL9A 3GJBA 1A3KA 3ILRA 1POV1 4TN7A 2WL1A 1YEWA 5C70A 2CDPA 2FDKA 3MI8A 4K8RB 2NN8A 3AMMA 4Q4W1 4AXOA 3CU7A 2WAAA 1GQHA 2OXBA 1O3RA 1ULCA 2JD4A 1A8MA 2JEMA 2RS13 1CZTA 2JG9B 2UU8A 3WVJA 2GC0A 1RXGA 3IPVB 2JG9C 2MNGA 3HVDA 4PLOA 1YQCA 3VZLA 3VDDB 4EZHA 1DQ5A 5DN2A 4ZPIA 4YW1A 2A6YA 1OQDA 3DYPA 1ODNA 3UESA 1GP4A 2C26A 3VZKA 1DFQA 3DECA 2JDHA 2E26A 2CY6A 3GDBA 5FXWA 1PO23 4CDXA 4KH9A 5G05L 1QXRA 2A6WA 1EAH3 1H4GA 3VL9A 4DRVA 1MS5A 4JQRA 5HXVA 5J96B 4YZ3A 4R9AA 3ZN4A 3BI3A 4O61A 3KM5A 4BQ3A 3DXTA 4GWJA 5JOYA 3FFZA 1GZTA 5JIAA 3KVAA 3ECQA 4QAWA 5CEHA 5KHIA 3T2TA 2FZ1A 4XF0A 5G04L 4ES9A 2E51A 1QXPA 3MF6A 4Y5SA 4AAXA 3E5XA 5I91A 4UW6A 3H42B 3J4UH 5CADA 3JD73 3SEPA 2PHRA 2R071 1JYXA 5T52A 1XE8A 4GAZA 1MZ5A 1R092 1RUH2 5BNOA 5T55A 4XCAA 5GLVA 1HB3A 4MHUA 2D6OX 4MXWB 4CZSA 4XTMA 5D8AA 3WSOA 1SLAA 2ORXA 1WW5A 2YV8A 4CUBA 4XDPA 3AX4A 4B4QA 1WA4A 2GNDA 3UT0A 3ZXDA 4NWWA 2DUPA 5A7QA 4XOGA 2VZ3A 5DMYA 3AZZA 2RM23 4TSVA 1O5UA 4HOOA 1AR82 1MEC3 3JBG1 3HQRA 5AFEA 4IE6A 4CVUA 2YU1A 1BBT1 2GH8A 5T50A 5J3UA 4L99A 3I7DA 1E5SA 1OT5A 3JXSA 1CIWA 1FOD1 5ABJA 1CX4A 1V6MA 2DU1A 5F39A 4R4ZA 1QNYA 1PK6A 5FYZA 4QGNA 3J8F2 1PGL1 2VZ1A 5FPVA 5CZKA 2ZZJA 1UY4A 3Q8AA 4WVZA 3WCSA 4DMIA 2HWF2 4XDQA 3VBOC 3VLBB 2ZGPA 1UZVA 1SPPA 4PDWB 4Q2FA 3O12A 1BMV1 4A7KA 2ETEA 4GKXA 3OSDA 1FT9A 3GZTB 4XQWA 5C9AC 1AL22 3OGJA 2DF7A 3ZYFA 1ONAA 1AR63 2EF6A 3OD4A 5J1XA 5LRSA 1C8NA 4FI9A 3AXDA 5FZGA 2JB8A 5JLVA 1QDCA 3LOIA 2WT1A 4MGQA 1SFPA 1H2KA 4TWTA 4DIQA 3OGVA 1VRH1 2R0FA 2VW1A 1YLLA 2B9VA 4ZZ5A 5EJ1B 4WM7A 5FY0A 1YJLA 5F6LB 5C4WC 5DABA 2Y0IA 3U10A 1AUYA 1XU1A 2TNFA 5IWFA 5FOJB 4Q4V2 4R4XA 5JR2A 2JENA 4DEQA 4QWNA 2IWGB 3H1YA 3H3LA 3KF5A 5FXZA 2IXKA 2EICA 4XXPA 3WNOA 2CL2A 3DPRC 4UFMA 4L0PA 5CIRA 2HBUA 1L7LA 2WINB 5E6HA 3ZR5A 1CVNA 4ES8A 3BIWE 1SHWB 3CIHA 4PBOA 4QB1A 5HCBA 3VHOA 4DUXA 1DQ0A 1FPN2 1VMHA 3WG2A 1YQ6A 3AKTA 4CTEA 2ZX3A 3VD7A 3N36A 2OIIA 4UFLA 2XL7A 5IVCA 2NYYA 2LROA 4NN0A 3TNQA 1H6XA 3DUIA 5I8TA 4YVSA 4D94A 3U78A 1S0GA 3N7KA 3TBDA 5FFOC 1U0AA 4MGKE 2CV6A 2RHPA 3OBRA 1D7PM 1QJU2 3MLJA 1WLDA 2GN3A 1W6OA 2PTMA 3H3UA 3IN9A 2E7QA 1EV13 1G6NA 3NKTA 4UI9L 4OFGA 1LESA 1W9SA 3VDBA 1YFWA 2XUMA 3NVCA 5FYCA 4NAOA 1XSQA 1WCKA 4RHV2 1XXNA 1LCLA 5FRAA 2FQPA 3GALA 5IAVA 1A34A 3AKSA 5GALA 2RDQA 3CKHA 4N7IA 3UGGA 1AL0G 1W3XA 2GNBA 3MLKA 1H1MA 1VBB1 2ZAAA 1MS0A 1LHVA 3I2DA 1G86A 2EAAA 3L2YA 4M01A 2NP0A 3PIJA 3BTYA 5IVVA 1UZ0A 3O5SA 1AX2A 1CIYA 2VTFA 4XURA 4Q29A 4FPGA 4YVWA 1RUE1 3W58A 1AJOA 3J9SA 2RS12 1PVC3 2WABA 2YHJA 3AZXA 3LEIA 4OI4A 4S2HA 5I0RA 1W6PB 3KV4A 2J22A 3ASIA 2XDVA 3POFA 1OPOA 3UJOA 3UK9A 1W9TA 4E27A 2W08A 3GJAA 4LBLA 1HX6A 3BTXA 5FQ0A 4B4PA 1DG6A 1E5RA 4PI0A 3WHUA 3BPSA 3CO2A 3SQOA 2E32A 4GWIA 1QH6A 4FPLA 1LB2A 1S0BA 1W04A 3IDCB 5C3SA 2JIGA 2WO1A 4CPBA 5J37A 1PO22 1GWMA 3MIDA 1Q43A 1BVP1 2QZ3A 2R061 3E6DA 4UWDA 4JGZA 1KQRA 2RS51 4GALA 4GD4A 1JYVA 5FDBA 4DZGA 1DCSA 2XQRA 1JOBA 1BJQA 5CAZA 4QB6A 3NV3A 4CCEA 1VJ2A 4OCTA 3TN91 4E4HA 5K0UC 5IYYA 1RVF3 1RUG1 4HANA 5ERLA 2RVAA 2R32A 2AYHA 3APBA 5DZFA 4Y33A 5A33A 3GF6A 3WV6A 4XJAA 4DEVA 1N3OA 3HBZA 4DINB 3BOPA 2WZR1 3WQBA 3PVBB 1PMHX 1LEMA 4UXAA 2VCMA 1U5XA 2VG9A 3M4FA 3NNLA 5EV7A 5JZGB 2WKKA 2VOWA 5FMCA 5FPXA 4LO7A 3POWA 4W8JA 1X36A 3KHBA 1WLCA 2JG9A 2ZAHA 1RUF3 4N8MA 5FUPA 4B7EA 1ZBA3 5D21A 1BYHA 2WIIB 4IDZA 4XHBA 4Y1ZA 1T6BX 1Y7BA 3OY8B 2VCAA 3WNPA 2OZJA 1E5IA 2VNGA 3HIFA 1GZWB 3Q9OA 1WD3A 5EJZB 3VN4A 2RM22 1D4VB 4CDQB 5SV5A 1D0HA 2D3RA 3ZXGA 3ZYPA 1WCUA 2VZVA 2YU2A 3M2MA 4IEXA 4LO4B 4LOTA 5EXOA 3O1SA 4XJ8A 3VHNA 1ENSA 3FUOA 4CYDA 4D7YA 5HCAA 2PQSA 1WCSA 4N9HA 2BFUL 3DXUA 5CG9A 2ILMA 3RNSA 2WNEA 1KS4A 2OX0A 2RJLA 2VUAA 3CMGA 4A4AA 3S0MA 1UIJA 2YYOA 2WQZC 2B7YA 5EP9A 4D0QA 4X6RB 5T54A 2DDUA 1ULOA 2D93A 3UV9A 4BLJA 4UAPA 5A70A 4KNCA 1UY1A 2JECA 1AR62 1ENRA 2WNOA 2XXZA 1OPMA 2ZTNA 1O91A 3MUY1 1ULPA 1FXZA 4L2NA 5GLWA 5I0UA 1PNGA 4WZCA 4AL9A 3GZEA 3OPZA 2B46X 5KXBA 1AYM1 1PGW1 4QPYA 5GZEA 3QBQA 3R4SA 2Y6GA 1PIV1 4BQ1A 3LDKA 1OF4A 2AC1A 5F3IA 1ASJ3 1RHI3 4LK7A 4C90A 3CF6E 2Q8EA 2ZGLA 4HPKB 4PQQA 3WG1A 3WP4A 3DV8A 3GBGA 1QQP1 1W0PA 4NJ4A 5FZKA 2WAOA 2VMEA 2WRAA 2OT7A 1Z7S1 3VL8A 1UYPA 5F6KA 1O7FA 1NT0A 5FZFA 1OA3A 3SH3A 4CP0A 2PMWB 5DUUA 5C3QA 3B94A 4P02B 3AVRA 3I3BA 1RL3A 3VBOA 2Z4FA 3GM8A 5FY9A 1C8M1 1A78A 5C7GA 5L19A 4NHMA 4UBHA 2JG8C 5DAPA 3T09A 5AC91 5IHRA 5C9AA 3N35A 3WW2A 2BUKA 3NJZA 1MS8A 1TMF1 2PA7A 4TZDA 4LA2A 2Y33A 3AFGA 2Y6JA 5DQ0A 5LA9A 1POV3 4FFIA 3W20A 1VALA 1EV12 1TG7A 2WFPA 4Q26A 5JXIA 4AVTA 5FBJA 4L9BA 1VAKA 2G4IA 4QD2A 3TYJA 4FXGB 2W95A 4RR3C 2FDIA 3MBWA 4UFKA 1OFNA 1HQLA 4KG0A 1H1IA 2HWD2 5C4WA 3RYPA 4C1XA 3VKLA 4AFDA 1S2BA 4ZXEA 1O8PA 1JTZX 5H9QA 1OOPC 2VCCA 3ZX7A 4LKFA 4HT1T 2PLV1 4OZOA 3AC0A 1UYXA 4JCKA 4Q0QA 1H2LA 1LR5A 4ARXA 1VRBA 3DPRA 1I9RA 3MPBA 1FAYA 4LEJA 4W50A 1QJX1 5A6XA 2DCYA 1W6QB 4MUVA 3NAPB 4XDOA 1JUIA 4CCJA 1BZWA 4PLNA 4Q4X1 4GJYA 1F4HA 4QX8A 1STMA 2QQVA 1GQGA 1ULEA 4NHLA 4ASMB 3GCXA 1UWWA 2LTNA 4HMZA 3ON7A 1MVEA 4QKFA 2VQAA 5BPXA 1N1SA 3NW4A 5T5PA 5FP9A 1LEDA 2JKXA 2R073 4PF5A 4FAGA 3LIHA 1DGWA 3T2OA 4BQ5A 2GSYA 1PZ8A 4HK9A 1OFSA 1OXCA 5KWRA 1LOEA 4XIOA 4EYUA 4BWOA 2Q5TA 2YFUA 1XNCA 5LBFA 2QNKA 3QH7A 5FZIA 1PX4A 1ND3B 2ZGUA 1NZIA 4FQ4A 4H55A 5B4NA 2BFUS 2P3IA 4UF0B 5C8WA 1UX7A 1K5JA 2BGCA 1GR3A 3OBAA 3O1VA 1W3VA 3FWEA 2VMIA 3RDIA 1RUF2 1BBT3 1OD3A 1NOVA 1W6PA 1HXS2 2TUNA 3K4AA 3NNJA 2Y0OA 3QD6A 1FOD3 2PAKA 1DP0A 2SLIA 5DAQA 3AK0A 1QOOA 2HEVF 2GMMA 4TXWA 5FTTC 5C33A 5JOZA 3RZJA 1F4AA 2Q0AA 4BIOA 1ZRFA 2AACA 3WCRA 4QU2A 4Y5TA 4QPIC 1D2QA 5IK4A 2RG4A 2MEV1 3MV01 2ADDA 2RMU1 2ZEXA 4JRLA 1VBD1 3NV4A 1V00A 3IMNA 1ZZBA 2RE9A 3LSDA 4M4RA 3RG0A 2NLRA 3KF3A 4H7MA 3ZXEA 2WS91 3TEYA 1VBA2 1YFXA 3C2UA 3CQOA 3MF9A 1OA2A 5K0UA 4CDXB 1G9BA 4AFMA 2P34A 2W91A 4QX1A 4XQ4A 2WNUC 1DGRA 3FL7A 4E8DA 5A3MA 3HT2A 1VRH3 2ZA9A 3CBNA 4UT5A 1R1A2 1S2KA 3AL5A 3AYEA 5HV0A 4OLLA 3D6EA 1PX3A 3T4HB 1CPNA 3B01A 5LW9A 4IE5A 3EJKA 3D0SA 4LPLA 5F2SA 3ZM8A 4XIKA 4RD7A 1OD5A 5FMOL 1H0BA 4H2AA 1PO11 5FZ8A 1OKQA 3PIGA 4XBQA 2MPFA 3ACFA 4LE3A 1CJDA 1LHNA 3M3IA 4DPNA 1RUC1 4CU6A 3AYDA 4XUQA 1V6IA 2L9LA 1RUJ2 3ZOIA 5A7WB 3NJVA 1K5MB 2RV9A 1JS9A 1GZWA 3Q8CA 3VD5A 1JMUB 1PNFA 4IGOA 1O59A 4XPVA 3H0OA 3I4IA 3KCYA 3U4SA 3B9CA 3NNFA 1GP5A 4H3WA 2WO7A 2ZXQA 4ZONA 3WNMA 1RUD1 4GKYA 4HK8A 4JV4A 4SBVA 2RR11 4K7JA 4E2QA 2VMDA 4NR1A 2XHNA 5HBAA 4XILA 3SKVA 2CSGA 5ABJB 1KD7A 4A6OA 5HXMA 2YMZA 1UZWA 2V72A 1W8TA 3A0NA 4Y1UA 3O0XA 5F5CA 3KS7A 5JSPA 4KMQA 4V2VA 4YGDA 5CB7A 1F2NA 4KL1A 4HSLA 4LBQA 5BNPB 1WLTA 3QLQA 2W87A 3JB8A 4CDWB 5HV4A 2Q8DA 4Q4Y1 3T0BA 1VBB3 1H2NA 5BNPC 4C0BA 1VBC1 1O8SA 4TLGA 3RZZA 5FYUA 3ZFGC 5K9YA 4CU9A 1VR3A 3G7DA 1G9FA 4B1LA 5C8CB 3OUIA 1W2NA 1V70A 1UKRA 2YXSA 5FMDA 2QBXA 1DBNA 3WP3A 2DTWA 2D97A 1XNAA 4RSUA 3FN9A 3O0VA 3URFA 2WLQA 2YBSA 4MHRA 1KS5A 4HPKA 4Y4YA 4N53B 4YW2A 4ATFA 2GALA 4IEWA 2E6VA 4ZY9A 4I0AA 4BXSV 4K21A 4WM7B 4DXSA 1RMU2 1QOTA 3HJRA 1BVVA 1V0AA 2Q1MA 3VKMA 4BXFA 1D4M1 3VD4A 1HIXA 2ES3A 1V6KA 2BNMA 3GGLA 2C1FA 3VBHB 2BBVA 1DYOA 1ZZ9A 2R063 3VBHC 2RS53 2K2SA 2DVGA 2HWE3 1XSRA 4OHYA 3IBMA 3VZOA 4XUTA 1RJ7A 5JMOA 3KT4A 3VKNA 2AUYA 2BVVA 3J7HA 2AZ5A 5E88A 5GLZA 5L9BA 5ACA1 2W3JA 3TN93 3B69A 2VGDA 3ZPYA 4IEQA 1SBFA 2DFBA 2JG8A 2W39A 2WFF3 1RUI1 1RUG3 4GH4C 5EZWA 2UYBA 3U37A 1HRV2 2F4LA 3N4MA 5L9VA 4PCRA 1F15A 1O4YA 2YUEA 2ZEWA 4QKNA 4XW3A 3RFRA 5FZ9A 4BQ2A 2JXAA 2WZR3 2CWSA 4FPOB 2R072 4AG4A 1AR91 2YBKA 5GLTA 5JAXA 1UYZA 2A5ZA 2W47A 2Q1FA 3K4DA 4DB5A 4LBKA 1COV1 2B39A 3I59A 1L7QA 1AXZA 2C0ZA 2ARXA 1W8FA 3C7GA 1W6OB 2BEOA 1N3QA 3ACHA 3BKZA 3SCHA 4AQ2A 3AKRA 2VXRA 2WUHA 4ZZ8A 3WF1A 4AEDC 2VQ0A 4EN8B 4QKBA 1X82A 3O1MA 1UW8A 3UNPA 4QT6A 4XF1A 1XC6A 2VZSA 2I2SA 3WZ1A 2DVDA 1HN0A 1SZBA 2RS31 4P00B 3SCGA 1UZZA 1NQDA 3H3ZA 4YG0A 4DXZA 3KCCA 4MXVA 1SLBA 3I97A 4I0BA 3GCWA 3CHXA 3NAPA 3WUCA 4LK6A 4JZRA 2Y26A 2JKBA 2VE1A 2HEWF 3AM2A 3VBRB 4DUWA 2BBAA 5K8SA 3THCA 3ZSLA 4PIXA 2F17A 2P17A 4LULA 4B4RA 5KHGA 4HVRA 3FHAA 5BYNA 5FZ4A 5IVYA 1RIRA 2NMOA 1QY4A 4QGMA 5FQ0B 3USSA 4COVA 1YXWA 2XVGA 4BZ4A 1ST8A 4NAMA 4UFJA 4ARYA 1OURA 4Q0UA 4RS5C 3FLTA 3A0KA 3UKNA 4A41A 5JR7B 5JI7A 2XWBB 4FTEA 4CEYC 5H9SA 1TME1 1LHWA 2QQOA 5IW0A 3ZIWA 2ZGOA 1R64A 3ZSEA 5IJRA 2OVUA 1ZX5A 4DUVA 1QJY3 1AYM3 1V6NA 3AJZA 3AZWA 1G9DA 2HWC1 4LITA 1PIV3 2P3KA 1SDDB 3I2HA 4NPRA 2DVBA 1C5IA 4CP1A 5FKCA 1ND3A 1W2TA 1H8TC 5A33B 2YZ4A 1T6GC 1XPWA 4FT8A 4BIFA 5IK8A 4AVVA 3C7OA 5F5AA 3KMHA 2QQPA 1Z7S3 4AZZA 5JI9A 1UNBA 1GBGA 1H4HA 5BNQA 3PUIA 3TAYA 2R041 3N9PA 4V1PA 3ROUA 5CFDC 3LIGA 4B1MA 1RJ8A 1QDOA 4XFBA 1UD1A 2WA4A 2VQUA 3MHZA 1JW6A 4XEZA 4BK5A 5HPOA 3Q8FA 1C8M3 2D6LX 2CGNA 2RDNA 2WQ8A 3JQXA 1OH4A 3R6SA 3KV5A 4Y20A 3WDUA 4Z92B 2K9ZA 2X05A 5AC93 2X8KA 1PMJX 3OBZA 5GZGA 2BVBA 5FR3A 1JYTA 3PJYA 4UW4A 3BU7A 1TMF3 3S7IA 2OW4A 5FY1A 2ZCWA 2Y8KA 2CDOA 3TEWA 4JRAA 2WNUA 3D8CA 1UMIA 5KHKA 1MVQA 3KGZA 3KD4A 1DGRN 2I07B 2JJ6A 2PELA 3KVBA 4XVHA 1QJZA 4OHWA 3ZYHA 4U2AA 2EIDA 4ZKTB 3HR9A 4W4ZA 3FHQA 1HRI1 3GZUC 1PM4A 1ZRCA 2E31A 3O1OA 3POBA 2XONA 5LBCA 2VNVA 1PZ7A 2B4KA 2ATFA 2ZX1A 1A8DA 3L2HA 3O7OA 2QQMA 4GMP1 5JVVA 3UYJA 2PLV3 3M3QA 4LLFA 3RMYA 4AVAA 2D6MA 3B7MA 1KEXA 4W6XA 4IERA 2NPIA 1OQ1A 3R0RA 4M3CF 3EO6A 1KDKA 1QJX3 1I3HA 2VUJA 1SQ4A 5KXDA 5A7WA 1F9KA 1OLRA 1K5MA 3BN6A 3WF3A 4JX0A 4H7LA 4Q5OA 3FBYA 4XMIA 4FQZA 2EXIA 4RGAA 4EZ4A 4K1YA 4AHWA 2CHHA 3S30A 1Q3EA 4XC9A 4AGVA 1KGYA 3I2JA 2RS52 1NLQA 3VUOA 2HWE2 3RRDA 4IV3B 3RSJA 4Y26A 5KR7A 3HQUA 4IV3C 4LBJA 1LNSA 3ZPOA 4OQ8A 4BB3A 2WT0A 4LTAA 2WFF2 1RUG2 2W0XA 1UPSA 1ZRDA 4OHZA 1SFYA 5DG1A 2QQKA 5EFUA 2PHWA 1HB2A 1QHDA 2WO3A 1IS4A 2LS6A 3VBOB 3H8OA 3H1MA 3IWZA 1MPXA 5EJ3A 2V5DA 4IV1C 4ASLA 4CDWA 5BNPA 2XJPA 3TB0A 3ETQA 1B09A 1DGWX 2R49A 4NE9A 3IMMA 4FO9A 3H8RA 1AXYA 1CAWB 1ND2B 1IPJA 3SHRA 3VHRA 2YC0A 5C9AB 1JZ6A 1FATA 1IG0A 1ND2C 2B9UA 3CJIC 3HMYA 2GP3A 2XBO1 1AYN2 2XLGA 5A32B 3WG4A 4B8EA 5C8CA 2WWSA 4GB33 5LRRA 3LEKA 1ZBE1 4QM9A 2VW0A 1GU3A 3POGA 4HKLA 4W65A 5T5JA 5AFBA 4ONUA 1GYKA 2DCTA 3I2FA 1Y43B 1BK1A 1VAVA 4TTGA 5E1RA 4LO5B 2ZMLA 1YHFA 4AOCA 1K3IA 5A1AA 2FCTA 2VTXA 4N53A 4OI2A 4QHOA 2VD7A 4XJWA 4AGRA 1GWKA 5A6ZA 2QVSB 1GNYA 5C4WB 2H0VA 1LU2A 3PUAA 2MEV3 5F8PA 4AYUA 2WYSA 3ES1A 1WBFA 2XJTA 3VBHA 3ACGA 4M00A 3JUUA 1VLNA 4QKDA 4D6SA 3Q8BA 3HQXA 3LDRA 4QXHA 2QFEA 3I2KA 1UKGA 2WS93 4I0WB 1JZ3A 3IT8A 1GANA 4D7SA 5BNNA 3THPA 3DPRB 2GMEA 4HBNA 2ERFA 4MLOA 2A1XA 1WWYA 1PZ9A 4AVBA 4GH4A 4MGTA 4EV0A 4ISQA 3ZKYA 3N9MA 1CD3G 1U5YA 4AHZA 5FAXA 3BODA 1ZNPA 2IXIA 2JWPA 3P6BA 4LA3A 1D2SA 2RJ2A 3BIEA 1IG3A 1S0FA 3J7NA 3WINE 3W5MA 3POSA 1J59A 4JKMA 4G3YC 2ZACA 4XFFA 5I8SA 2VW2A 5DDJ1 1LOGA 5M0TA 1G9CA 2PHFA 1LOBA 1QJY2 1MZFA 2VY0A 1GMMA 4WBBA 3RPQA 1W03A 2ZX4A 2Y34A 3POIA 1PIV2 5ANQA 5IUQA 2X09A 4D69A 3TEZA 1RUC3 3K75B 4FP2A 3ZYJB 2AGSA 1J1TA 2P6HA 4YZ5A 4JHZA 4YW6A 5DG2A 2G9ZA 4D6QA 1J3QA 1C5HA 3FLRA 3WQ0A 1OBNA 1YO8A 3VV1A 5J7MA 2Z69A 3W59A 1CX1A 3AMNA 1POQA 3MIHA 4YRDA 1RUD3 5JIUA 1LODA 2YROA 3ZYRA 5A6QA 1GSLA 2RR13 3BTAA 3I49A 1MS9A 3HOBA 3VBRA 5FP8A 5SV8A 2A3XA 4XJZA 4GJZA 4OUMA 4ZU4A 2P3YA 4LO6B 2CGOA 2WSUA 1S55A 4FPCA 1GUIA 1AHSA 1S0JA 4E4SA 5LB6A 4Q4Y3 3J26N 3PLQA 3L9JT 4IEOA 5LATA 4CEYA 1VBC3 2NQYA 3FC0A 2P3JA 4F7ZA 1SDWA 3CEWA 1EAH2 1X50A 3WQ1A 4DO0A 5JUVA 2WA3A 3UL2A 3KT7A 4LMFA 3LB9A 3NNGA 3WR0A 4Y5Z0 3USUA 1S0CA 4YW3A 1UOFA 5EPAA 5K0UB 1R091 4YZ2A 1RUH1 3I3EA 3A7QA 1H8TA 3MEPA 4PIYA 5FZMA 2WWUA 2LUWA 2PLV2 2WR9A 2ADEA 3D0JA 3AB0A 1CPMA 4INDA 2A3YA 3ZXFA 3LAGA 1BK0A 1ENQA 1JOPA 5CA6A 3HT1A 3JD72 4AEMA 1D4M3 2CNAA 4GZ9A 2C9KA 4AI0A 5CFDA 2EXKA 3U11A 3NO8A 1JYWA 2BJSA 1OA4A 2Y6KA 2WNVB 5FYBA 3THTA 1K12A 4LOSA 1JZ8A 1LULA 1J3PA 1W2UA 2WNVC 5ACA3 3B00A 4KI5M 3GBFA 2H6CA 1M06G 2EA7A 5LK5A 1RUI3 2UY9A 3PU3A 5FUIA 3RZLA 4LBMA 3OJBA 3SEEA 1BEV1 3VDCA 4IGPA 2XPJA 4RQPC 1MEC2 3I54A 4R9BA 1F31A 2HWF1 1OH3A 1S0IA 2YC2A 3KSCA 4HL0A 2G1MA 3DN7A 4P9GA 5I0DA 1UYYA 3OGGA 4XFHA 4KU8A 4O9GA 3N3HA 1UU6A 1AXKA 4LKEA 1W8UA 4ITCA 2ET7A 4NIIA 2DBNA 5CKMA 3SKJE 2W1WA 2BPA2 4NVPA 1MS1A 4O7XA 1COV3 2XVLA 4GQ7A 4XZPA 1WGPA 3BOWA 4CDUB 5FP3A 4MO3M 4CDUC 3R4UA 1AVBA 3O0WA 3OYWA 3RYRA 3WP5A 4NHKA 2D3SA 4QPGB 3ZYBA 1X7NA 2O14A 4QPGC 1DQ1A 1KDMA 1LGNA 4OULA 4CU8A 3LGRA 4LBQB 3MPPG 3ZFEC 4E2GA 4GB32 5A80A 2JE8A 2VJXA 2ET1A 2IFWA 4AI1A 2BV4A 2RS33 3KV9A 3MUZ1 3OD0A 4YM0A 3N7MA 1OLQA 2XUEA 4LHSA 4Q4V1 1ACCA 3OGRA 4UFHA 2XWJB 3CDZB 2DCZA 3KT1A 2ZS6B 1SBDA 1NCRC 5FZ7A 4R9DA 4GIQA 5GZCA 1H30A 1CESA 1EP0A 1VAMA 1YFUA 1FPN1 2DUQA 3LCPA 4IV3A 4PBPA 2J1TA 3B9IA 5FZLA 1V9U1 1GWLA 3KQ4B 1ZM1A 2QZ2A 2QUOA 5FYIA 4AQTA 4WVWA 5DZEA 4GULA 1TME3 3EYPA 2JX9A 3LOBA 2I74A 3KV6A 4JDMA 2FHRA 3PTYA 3PMSA 1UMZA 4EN0A 2A6VA 2LW8A 1G9AA 2D7FA 4ZXKA 1WW6A 2ZGTA 2YB7A 3FMGA 2HWC3 2XKPA 1QJU1 4IV1A 5FKBA 1O3TA 4AFAA 3WT3A 4KWUA 5CKQA 1G7YA 2CYFA 2JG8B 2TEPA 1PM7A 3C7HA 1CQ9A 4I3GA 1DQ4A 4COWA 5FMBA 1CAWA 1ND2A 1HQWA 3OF1A 3CJIA 3ZSJA 1US3A 5A32A 2EIBA 2HYXA 3ST7A 4XJUA 3IM0A 4S2GA 3H8UA 3TWIA 3NV1A 4META 1KITA 5A6YA 2R043 1DQ2A 4Q4W3 5F9TA 2TBVA 4RR3B 4BISA 1REDA 4MZUA 4CUCA 4YZ1A 3I59B 3WQ7A 5LASA 2XMLA 5E16A 1VMJA 1FV3A 3CLPA 4QDSA 4QQPA 1TNRA 2Z42A 4A2UA 3WDXA 5KC6A 3UKTA 2WZPP 1V6JA 2AEYA 4ISRA 3ZXKA 5FY4A 2Y6LA 1OOPB 2EVXA 3LSEA 4LLOA 3MIFA 4QDQA 1RUD2 1JZ5A 2OUJA 1I5PA 1IS5A 1YIFA 4IEUA 1PVC2 3POYA 5KBFA 2P4EA 3RWNA 5FXXA 2B45X 1DZTA 2WDBA 5LEJA 4AE2A 4MOAA 4BDVB 1V6OA 1W06A 2PYTA 1XNKA 3Q8EA 1CWPA 1SEFA 3RMXA 4BPZA 3LFIA 4FPEA 3RYKA 3MDPA 2KR2A 4I30A 4FCAA 4XBLA 4Q4Y2 3JB4C 1GKBA 5FP4A 5I0TA 1AR71 1HRI3 3IDEA 5LBBA 2EIGA 1RUNA 1EPWA 1SACA 4XAAA 5KC5A 2ZOEB 2BP6A 4GMP3 1CAUA 2NMNA 3E5QA 1VP6A 3DGTA 3P5BA 2WC2A 4HN0A 2A75A 1YCIA 1W9YA 3RI9A 5FREA 3H7JA 1PHMA 1B35B 5FO9B 1UY3A 1QKQA 1RVF2 2B5HA 1B35C 1WW7A 2K0GA 5T3NA 4AR2A 2UURA 2XG3A 3CNAA 4XBNA 1YQ8A 3MLLA 3HWJA 2BYVE 3MW4A 4LQRA 2JDUA 2WSVA 4QHZA 3POJA 4Q27A 3RQ0A 3WDVA 3HN1A 1D4M2 2GDFA 5H9PA 2ZGNA 3RZMA 2VOKA 3AFKA 5FPLA 1LKNA 4AEJA 4URTA 1C57A 4WVVA 5AVPA 1ZZCA 3JBG3 2HBTA 2X5IB 3I2GA 3OPWA 5K7PA 1Z0HA 2X5IC 5A3NA 2DFCA 1ZBA2 1IQDC 1HQNA 3H9AA 2VZOA 2ARAA 2ZEZA 1VB4A 2BWAA 2KA3A 4MH0E 1SFNA 1C28A 2OYZA 1FV2A 1UU4A 3A23A 4JQTA 4RA0A 4EWDA 3BGAA 5L7OC 1LJ7A 3OUJA 4GA9A 3T1MA 3VDAA 5A3TA 1W8HA 1C1LA 3F2ZA 1HJFA 1QOSA 2JDYA 4FPYA 4QPIB 1URXA 3T30A 5CISA 1H8VA 2QQNA 1YI7A 4AI3A 4Y20B 3NWKA 5F32A 3I8TA 3LEMA 4NUBA 2XBO3 5CG8A 4LBNA 3UJQA 2AENA 2Z5WA 2ZGQA 1AR61 1IS6A 1KJRA 2YGLA 4A7ZA 1ZBE3 4F83A 3PUQA 4JTOA 4CCMA 3K51A 3B93A 2WNUB 3IIAA 4AWDA 1I1EA 1UCXA 1GNZA 3CZUA 4BQXA 2IXLA 3SISA 1HB1A 3AP5A 4PLMA 2QDNA 3FLPA 3RZHA 1NY71 1S0EA 2Y6FA 1MZEA 4XUOA 4Z07A 4CP9B 2FDFA 2RS32 1HV0A 4HSJA 4NMIA 2V4VA 1QNWA 4PIZA 5D2AA 3SITA 2LALA 1SCSA 2G19A 5I93A 4UYBA 1WW4A 4X8PA 4DNYA 2WNVA 3PDQA 4WVMB 2UY8A 2ZHLA 4PJYA 1ASJ2 1RHI2 1JYNA 3N9NA 4KBZA 4FXKB
chains in the Genus database with same CATH topology
2Q1FA 2C24A 1V0AA 4LJHA 4CPBA 4LK6A 4LKFA 1GWMA 4LK7A 4YW7A 4BQ4A 2JWPA 4BQ5A 2LROA 1WZXA 1W9FA 3ORJA 5D21A 3ZYBA 1GWKA 3F95A 4CP9B 4CPBD 2O14A 2VXJA 2K46A 1W90A 1WMXA 1GWLA 1W8WA 1W8ZA 3UT0A 2KR2A 3ZYHA 4LKDA 1OH3A 1WCUA 1L7LA 1HN0A 4YW6A 1W8TA 4BQ3A 4YWAA 4BQ2A 4CP9A 3ZYFA 4A6SA 1UOJA 2LRPA 1OKOA 4LKEA 1W8UA 4AL9A 2WYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1F A;  2C24 A;  1V0A A;  4LJH A;  4CPB A;  4LK6 A;  4LKF A;  1GWM A;  4LK7 A;  4YW7 A;  4BQ4 A;  2JWP A;  4BQ5 A;  2LRO A;  1WZX A;  1W9F A;  3ORJ A;  5D21 A;  3ZYB A;  1GWK A;  3F95 A;  4CP9 B;  4CPB D;  2O14 A;  2VXJ A;  2K46 A;  1W90 A;  1WMX A;  1GWL A;  1W8W A;  1W8Z A;  3UT0 A;  2KR2 A;  3ZYH A;  4LKD A;  1OH3 A;  1WCU A;  1L7L A;  1HN0 A;  4YW6 A;  1W8T A;  4BQ3 A;  4YWA A;  4BQ2 A;  4CP9 A;  3ZYF A;  4A6S A;  1UOJ A;  2LRP A;  1OKO A;  4LKE A;  1W8U A;  4AL9 A;  2WYF A; 
#chains in the Genus database with same CATH topology
 2XHK A;  1C4R A;  3GZA A;  5DAX A;  1CR7 A;  5JDB A;  1YI9 A;  2VOT A;  2HWB 1;  3K4Z A;  1D0G A;  2GZW A;  4MYE A;  4RQP A;  5FLH A;  1HDK A;  4LIU A;  4UW5 A;  3WD5 A;  1FI2 A;  4YGE A;  3M70 A;  5A3W A;  3QAC A;  4K9S A;  1J3R A;  2WQ4 A;  5LY2 A;  1JI6 A;  4J25 A;  3WW4 A;  1TME 2;  1SCR A;  3U4X A;  5DDJ 3;  4QQH A;  1AX0 A;  5A3L A;  4P9Y A;  2YGM A;  3LFM A;  4OI1 A;  2V5Y A;  3OGS A;  3ZMN A;  4M0N A;  4CDU A;  3WW3 A;  1MAC A;  5FCC A;  2D44 A;  5FYV A;  3IB3 A;  1AF9 A;  2GAU A;  2KD7 A;  4LUK A;  2CWM A;  3WXP A;  1OLM E;  4K1Z A;  4M0H A;  4P5Y A;  2VMF A;  4XUP A;  2QTW B;  2O8Q A;  4YWA A;  1X8E A;  4QPG A;  4QX3 A;  2HLE A;  4KWL A;  1LOA A;  5LCW L;  4CXY A;  3DYM A;  2WZE A;  3ZFE A;  3JCI A;  3IAP A;  1WUV A;  1PVX A;  2Z79 A;  4P08 A;  5D8A C;  5C5U A;  2BW8 A;  3S57 A;  2HWD 1;  3OOX A;  2VVE A;  3EB7 A;  3KB5 A;  4Q1R A;  3ZFG B;  1NXD 1;  2R04 2;  3AVS A;  3AMH A;  3M3O A;  2O0O A;  4Q4W 2;  4OQ9 A;  4BLI A;  1O4T A;  2Q8C A;  1RUE 3;  2P5B A;  1MS4 A;  2VBD A;  1TEI A;  4Y24 A;  3A21 A;  2KXL A;  1YQ5 A;  2BTV C;  2OPK A;  3BUC A;  4DY3 A;  3A22 A;  1NCR A;  3BAL A;  4COZ A;  1Y9G A;  2GN7 A;  3OB8 A;  4YM2 A;  3LPG A;  3LA3 A;  4YW4 A;  2A3W A;  3DKW A;  5FK8 A;  1ULD A;  2JDK A;  4BU2 A;  2WN2 A;  4CCO A;  1YYN A;  4BHP A;  3S5Q A;  2OQ7 A;  4HKW A;  1H2M A;  1JBC A;  2Q30 A;  3FHI B;  1DLL A;  3PUH A;  4K8F A;  4QGL A;  1EYB A;  2VUC A;  3B3Q E;  4IW3 A;  4JGY B;  4XYX A;  2HEY F;  4MAD A;  5FZE A;  4X8N A;  2VEC A;  4AFB A;  4JGY C;  4BCU A;  3IDA A;  4W6W A;  2Q8O A;  1GFF 2;  1Q56 A;  4FSJ A;  4XE9 A;  4XUN A;  1NLS A;  5BNN B;  1S4C A;  4M3C E;  3R4D B;  4XHX A;  1HRI 2;  1J83 A;  4RGK A;  1VBE 1;  2IXH A;  4IEP A;  1F8V A;  1R09 3;  4GH4 B;  2DUO A;  1RUH 3;  2VZU A;  2ZMK A;  4IE0 A;  2VBP A;  5DAW A;  1N1V A;  4YG3 A;  5F5I A;  3MFA A;  1AZD A;  2BZD A;  2W9X A;  3GYD A;  4QXC A;  2BNO A;  2BER A;  5B2G B;  2A70 A;  4ZHN A;  3K2O A;  2P37 A;  2ZGK A;  1LRH A;  1O4Z A;  3I3D A;  3FFQ A;  4OMC A;  5DUW A;  4EWE A;  3D3A A;  3AMQ A;  4YFZ A;  2FDG A;  1YWK A;  1XQN A;  2VC9 A;  4PQ9 A;  4Y4R A;  1OI6 A;  4RR3 A;  4X6Q B;  2QQL A;  3VZJ A;  2BOJ A;  5LZ6 A;  4JKK A;  4MX3 A;  4BYY A;  1YFY A;  1IS3 A;  4CEW B;  4BQ4 A;  5JSR A;  4PI2 A;  5DAV A;  1NE4 A;  1RUF 1;  4CEW C;  4QM8 A;  1HXS 1;  3O1U A;  4OUE A;  3LA2 A;  4AED B;  3RVH A;  1HW5 A;  3I2I A;  1QU0 A;  4HXC A;  4NPM A;  1OOP A;  3WX5 A;  1QEX A;  5F3C A;  3ZSM A;  1XYP A;  1BEV 3;  4ZS3 A;  4KGG A;  1Q8S A;  1QF3 A;  3JBG 2;  3VBS B;  4I3P A;  2GMP A;  2HWF 3;  2Q4S A;  3N9O A;  1F35 A;  3VBS C;  1NKG A;  1BBT 2;  2R30 A;  2JDM A;  5L73 A;  4JHT A;  4BM8 A;  4HVQ A;  4LXL A;  5H9R A;  1FOD 2;  5FJK A;  5ISL A;  5F1R A;  3FBM A;  1PGL 2;  2XLA A;  1W6N A;  3U0Z A;  3ATG A;  2PHL A;  2D6N A;  2ZKL A;  3PUS A;  4EQV A;  4Q0P A;  5GKA C;  1DZQ A;  1VBA 1;  2JDA A;  1N3P A;  3OEA A;  4MVT A;  3WUD A;  1MR5 A;  1W99 A;  1HJG A;  2VQT A;  1OQE A;  4IQP A;  1BMV 2;  5FMO S;  2E7T A;  1SMV A;  1WME A;  4RS5 B;  3WEZ A;  2K46 A;  1UIK A;  3MIE A;  5GM0 A;  1R1A 1;  1WMX A;  1NCQ B;  3AZV A;  4OMD A;  4Q1P A;  3WW1 A;  4LE4 A;  1WKY A;  1NCQ C;  2VCB A;  4HVO A;  5LK7 B;  3OG2 A;  4IES A;  1UF2 C;  5LBE A;  2OZ6 A;  4LKD A;  4CEY B;  3V0A A;  4J1X A;  5FLI A;  5FZD A;  4QX7 A;  1B35 A;  3NJX A;  2VOX A;  4CXX A;  4LHL A;  1ZYB A;  1LOF C;  2P6C A;  4Q4V 3;  4OI0 A;  1VRH 2;  2WYF A;  3GNE A;  1H6Y A;  4WM8 C;  5L9R A;  4EJR A;  5FP7 A;  1ENX A;  5T5L A;  2P1B A;  2VH9 A;  3RS6 A;  1IPK A;  1LOC A;  3PVN A;  3USU B;  4R9C A;  5FYS A;  5I8Y A;  5L36 A;  1RUJ 1;  2W52 A;  1FX5 A;  2VNO A;  1H8T B;  4FP3 A;  3J7L A;  3VZM A;  3WDT A;  1TE1 B;  4JVA A;  1QQP 3;  3KGL A;  2PHU A;  2E7A A;  3C7E A;  1NQJ A;  2X5I A;  3RJR A;  3M3C A;  1V9U 3;  1QGL A;  2VMG A;  4FOQ A;  3AYC A;  3K3O A;  3VHP A;  2BNN A;  5J36 A;  1JOD A;  1MQT B;  5CFD B;  4XF3 A;  1R08 1;  1MQT C;  3WNN A;  3LEG A;  4DXT A;  5L7O A;  1RGS A;  3ILN A;  1LGC A;  3BVC A;  2XOM A;  1QJU 3;  4LR4 A;  4QX5 A;  1W39 A;  1XYO A;  4UOJ A;  3RWK X;  4QPI A;  1HN1 A;  1Y9Q A;  2PAE A;  5JOX A;  1OVS A;  4JC1 A;  4KWJ A;  3VBF C;  1RXF A;  4NRQ A;  5DDJ 2;  3PVE A;  4ORF A;  1NYW A;  1WD4 A;  5IVB A;  3V0B A;  2VU9 A;  4URA A;  1LAJ A;  2ZKN A;  2DV9 A;  4GMP 0;  3TRS B;  5IFT A;  3IKW A;  2BQP A;  3P3P A;  4XFA A;  5FZ0 A;  2VBB A;  1GOG A;  1U5I A;  2VNR A;  2R1B A;  3ITQ A;  3LKJ A;  4YNI A;  2Y64 A;  3HEI A;  5C3O A;  2FZ2 A;  1W90 A;  1NA1 B;  2X53 S;  4AGG A;  1NA1 C;  1LEC A;  1OVP A;  1W8Z A;  1UXZ A;  2D6K A;  4BK4 A;  2D98 A;  1W6M A;  2PQQ A;  2V4A A;  3SMH A;  2QQU A;  2YG0 A;  3P1I A;  4JDN A;  5JSO A;  3OYW B;  1VBB 2;  2QQJ A;  5FZC A;  3N7L A;  1UOJ A;  4CP9 A;  1ZA7 A;  1OC1 A;  4RYD A;  3VDD C;  1YJK A;  1KFX L;  1PGS A;  2ORZ A;  3ENR A;  1RUE 2;  3AJY A;  4AF9 A;  2WZ8 A;  2QQW A;  5KHJ A;  3VD9 A;  4CE8 A;  2BOI A;  2RDS A;  2J1V A;  3V64 A;  5FWJ A;  3EHK A;  1RMU 1;  2BGO A;  1FMD 1;  4O65 A;  4PHZ A;  1UQX A;  3AKQ A;  4WVM A;  4YYO A;  1GIC A;  4I09 A;  3MIC A;  1RYY A;  3LE0 A;  5GZF A;  4AVC A;  5K4L A;  3B02 A;  2PXJ A;  4AEK A;  5FLJ A;  2WLP A;  4D8M A;  3E6B A;  5FZO A;  1OSG A;  2FBE A;  4Q4X 3;  4N90 A;  1LU1 A;  2P2K A;  3AXE A;  2ARE A;  2J42 A;  4HZF A;  1AR7 3;  3PL0 A;  1F5F A;  1GNH A;  4Y1X A;  1ODM A;  2B8M A;  2R06 2;  2GNT A;  4XAC A;  1HRV 1;  3VB9 A;  4ERO A;  2XR4 A;  3R05 A;  4E8C A;  1OLM A;  4KU7 A;  1FNY A;  2VVD A;  2W68 A;  3IDB B;  2QE3 A;  4HON A;  3ZFF B;  1OMI A;  4FOW A;  4FBF A;  2IZW A;  2J1E A;  4QXK A;  3C8X A;  3TN9 2;  3AP6 A;  3ZFF C;  3WNX A;  2Q1Z B;  3KHC A;  4JTN A;  4TYS A;  3W5N A;  1REF A;  1NUK A;  3ZXJ A;  5J09 A;  3VBU B;  4IV1 B;  3ZSK A;  4YM1 A;  1ULG A;  2WZR 2;  3VBU C;  1CZS A;  3POE A;  4EN7 B;  3U07 A;  5EYY A;  1NG0 A;  3ZFG A;  5A1F A;  3W9A A;  1UZY A;  4P9X A;  4Q8L A;  3SC7 X;  3CJI B;  1W9W A;  4CA9 A;  4QPW A;  3BTZ A;  4FFH A;  4OYU A;  3KQR A;  3S7E A;  4FAH A;  3HPN A;  4XFC A;  3ZKU A;  5IAX A;  1P8J A;  4IEV A;  4LUM A;  3T3Y A;  4M4P A;  4BH9 A;  1APN A;  4L92 A;  4QQL A;  3S5A A;  2ZHK A;  5DZG A;  5F37 A;  1JZ4 A;  2QKD A;  2A73 B;  3K48 A;  3SLI A;  1BEV 2;  2E9Q A;  2AEZ A;  3PME A;  1N1T A;  5CFC B;  2V73 A;  4PT6 A;  4BA6 A;  3FE5 A;  1UN1 A;  5C3R A;  5CFC C;  3PHM A;  1W28 A;  4GWM A;  4LT5 A;  3OPT A;  4P14 A;  4JGY A;  4K40 A;  2RMU 3;  4PDW C;  5A7P A;  5C3P A;  1VBD 3;  5I0S A;  4O9E A;  4KWK A;  4M3C A;  5FZ3 A;  1YQ2 A;  4NHY A;  4NOT A;  3MZH A;  2CTV A;  4QU1 A;  5FOB B;  4CCK A;  4XMA A;  5JXJ A;  3TNP B;  3RJ2 X;  2X29 A;  5FZ1 A;  1Y4W A;  2ZGS A;  5DUX A;  2VAU A;  3N7J A;  3V56 A;  4V2W A;  2HH9 A;  2XL9 A;  2DVF A;  2YBP A;  1HLC A;  4Q8K A;  2JIC A;  1YRZ A;  3ORJ A;  1Q8V A;  2IFR A;  2R6Q A;  3NQH A;  2GP5 A;  1LHU A;  1JYI A;  3WDY A;  1KFU L;  3E97 A;  4DS0 A;  4Z1V A;  1RIT A;  2UWB A;  3MYX A;  1CAU B;  3NKG A;  3T1L A;  1ZRI A;  4IL7 A;  4AQ6 A;  4AAP A;  4ASK A;  1PO1 3;  1RIN A;  5LA1 A;  4FTS A;  1AYM 2;  1IZ3 A;  1PGW 2;  4CEW A;  2IUW A;  3ES4 A;  1HKD A;  2R1D A;  3OEB A;  4YGC A;  1UY0 A;  1W8N A;  3AYA A;  1O6U A;  4AED A;  4ZU5 A;  1X8M A;  2HWB 3;  2PHT A;  4FFF A;  1QQP 2;  3VBS A;  4FFG A;  1ULF A;  2XB6 C;  4EWA A;  5EWS A;  1V9U 2;  2ZX0 A;  3PU8 A;  4GXL A;  3MIG A;  1Z7S 2;  1J58 A;  4NO4 A;  1ZA4 A;  5DPN A;  1JZ2 A;  3BU0 A;  4LOR A;  5FJH A;  4IUG A;  4NRO A;  1IHM A;  3LF7 A;  3ZR6 A;  2JIJ A;  2EAL A;  1JXN A;  3DYO A;  3ZDS A;  5CKN A;  1CAX A;  2F4P A;  2WJS A;  4CXW A;  1C8M 2;  2W1Q A;  3D5O A;  5IK7 A;  3M1H A;  2YDE A;  2AH2 A;  3VKF C;  4BOW A;  4ZU7 A;  1ZVF A;  5FZH A;  4N43 B;  4B7K A;  5AC9 2;  1KXG A;  1BCX A;  1WBL A;  4N43 C;  3NMB A;  2PHX A;  1QIQ A;  4XXA A;  4RS5 A;  1TMF 2;  3WHT A;  1NCQ A;  1JYC A;  2HWD 3;  5GLU A;  4P9J A;  1GZC A;  3WP6 A;  2Y38 A;  4MGZ E;  5J48 A;  4RFT 0;  3U14 A;  5FYT A;  1LOF A;  3PJQ A;  5IVF A;  2ZBJ A;  4Z2A A;  4LO8 A;  3E1F 1;  4WM8 A;  3H7Y A;  1YNA A;  5TSW A;  4XQD A;  1XNT A;  4CSW A;  3AKP A;  3JU9 A;  2VXJ A;  5FZB A;  1DQ6 A;  1VB2 A;  5BNN C;  1NE6 A;  2D5F A;  3V65 A;  1A6C A;  1S0D A;  5LWB A;  5A1L A;  4EN6 B;  4C8D A;  2AR6 A;  2OPW A;  3GXU A;  4CP2 A;  4OHX A;  4OZX A;  1MS3 A;  4OVE A;  2EXH A;  2IXJ A;  2GH2 A;  3B5L B;  4HLT A;  4W6Y A;  4NPL A;  3KCX A;  1Q8Q A;  2MHF A;  3OBT A;  3UKV A;  1QMJ A;  4FPF A;  5FZ6 A;  3LQC A;  4Z82 A;  1QJX 2;  5FK7 A;  5HCF A;  2CAV A;  2D43 A;  1MQT A;  3SXW A;  3GHN A;  4NRM A;  1WA6 X;  2VVF A;  4YW7 A;  2HWE 1;  5IFP A;  4KQ7 A;  4LBO A;  1AR8 1;  1WZX A;  1C3H A;  2ID4 A;  1W9F A;  3FZ3 A;  4Q4X 2;  3K3N A;  1M4W A;  5J98 B;  3LA7 A;  1AR7 2;  4FPK A;  1VBE 3;  3HNB M;  2Z2S B;  4JDO A;  3VBF A;  4D3W A;  3H1W A;  4JAA A;  3EMR A;  1ZZ7 A;  2WFF 1;  3M3E A;  4S2D A;  4K6B A;  4AK3 A;  1QJE A;  1XYN A;  3J8F 1;  4RQP B;  1JOJ A;  2XLF A;  4IE7 A;  3U75 A;  4E4Z A;  1S2E A;  2VZP A;  3E5U A;  4Y22 A;  3VGI A;  3C3V A;  2NZ9 A;  4XTP A;  4UW3 A;  4DY5 A;  1X9T A;  1CN1 A;  5A7N A;  4MSV A;  2ENR A;  2CU5 A;  4A45 A;  1AR9 3;  1OHF A;  3GHM A;  2CAU A;  4MGY E;  3T2Q A;  3ALQ A;  4NWV A;  2IVJ A;  4IGQ A;  1NA1 A;  3AZY A;  3ETP A;  3TEX A;  4QB2 A;  1SLT A;  2BWC A;  1ZRE A;  5JZG C;  4DOU A;  1AYN 1;  2QCS B;  1AL2 1;  1GV9 A;  3O1T A;  3IPV A;  4DQA A;  1HXS 3;  2QJV A;  1UOG A;  1S1A A;  4C0H A;  3WDW A;  3DF0 A;  1NX9 A;  3VDD A;  4HKO A;  1REE A;  5BXX A;  1J84 A;  3ZFE B;  1RUO A;  4CDQ C;  1DZR A;  3M8L A;  4Q0V A;  2XVK A;  1XOY A;  2XQX A;  2N7G A;  4QX0 A;  1UO9 A;  1UX6 A;  5KXE A;  2UWC A;  4KGQ A;  2GNM A;  4CCN A;  1OKO A;  5JCT A;  3K46 A;  4QHB A;  1XNB A;  1HB4 A;  3VD3 A;  3N9L A;  1VBA 3;  2ZMN A;  2J1S A;  3C7F A;  3QCW A;  5BV6 A;  3PUR A;  5ANN A;  1YIP A;  3ZDV A;  1NCR B;  2JE9 A;  3CZJ A;  4A7Y A;  2MEV 2;  2RMU 2;  1VBD 2;  1VPH A;  1WCQ A;  3TOJ A;  4BE3 A;  5IK5 A;  3IAQ A;  2WS9 2;  1R1A 3;  4P9W A;  4SLI A;  3N9Q A;  3I3M A;  1W0N A;  3ZFF A;  5F7U A;  3VKO A;  5CBL A;  5JWP A;  3SCF A;  2C4X A;  4XFI A;  2WBK A;  2W46 A;  5FUN A;  2ARB A;  5CNA A;  2DYC A;  2OKX A;  1KRI A;  1QJY 1;  4G4F A;  2JDN A;  1NY7 2;  4HN1 A;  3I3Q A;  2PFW A;  4MXW A;  3VBU A;  4XET A;  4PF1 A;  5FY8 A;  2JE7 A;  1DDL A;  1F5J A;  1X33 A;  1Z78 A;  2RJK A;  1RUJ 3;  5JOW A;  2C9A A;  2W5F A;  4UFI A;  4MG2 A;  1YUD A;  4RHV 1;  3P3N A;  2C5D A;  5A3U A;  1PO1 2;  1H9P A;  3ZXA C;  2XJS A;  2VMC A;  4CPB D;  3SH4 A;  5C5T A;  2H6B A;  4LHN A;  3W21 A;  1RUC 2;  4F3J A;  2IVI B;  1Q5O A;  1IKQ A;  3LZZ A;  5FO7 B;  3RZK A;  1SLC A;  4XF9 A;  5IVJ A;  1R08 3;  1CAV B;  2HWB 2;  4YSF A;  4I02 A;  3D82 A;  1DLC A;  2FMY A;  2RS1 1;  4A6S A;  2G9G A;  5CFC A;  1IKP A;  2XJV A;  1VMF A;  2DBI A;  2YFZ A;  4PDW A;  2JD9 A;  1R1Z A;  5FPB A;  3U1X A;  5FIX A;  2XJQ A;  3MFC A;  4HET A;  5BY5 A;  5C71 A;  2OUH A;  3PTR B;  4FOV A;  1E57 A;  2RR1 2;  4AVS A;  2JDZ A;  5EYX A;  1O5L A;  4Z2W A;  3BB6 A;  5FBZ A;  2ZHN A;  3FJS A;  3NNM A;  1PO2 1;  2BU9 A;  4RN5 A;  1BXH A;  4P9L A;  4IEY A;  4YGB A;  3SH5 A;  1HV1 A;  4Z8B A;  3BPZ A;  1W6N B;  2JB4 A;  2J1R A;  1EAH 1;  3ZIX A;  5JXG A;  4HFS A;  3VZN A;  1IPS A;  1QH7 A;  4FOY A;  2WO2 A;  2W92 A;  3MW3 A;  1WCD J;  3WF4 A;  4K3U A;  4WV8 A;  4NID A;  1VBC 2;  1QJF A;  3JZV A;  1W2A X;  2FMD A;  4A3X A;  3III A;  5FY5 A;  3BCW A;  1QWR A;  2JDP A;  2NM1 A;  3DL3 A;  5E8A A;  1GOF A;  4F8A A;  1VIW B;  1RMU 3;  1SLL A;  1TQ5 A;  2E63 A;  1FMD 3;  1WMF A;  2ZHM A;  3JD7 1;  4CUG A;  3V0A B;  2R7E B;  5T5O A;  4IXL A;  3LPF A;  1SLI A;  2DWR A;  1JU3 A;  3RI8 A;  5FZA A;  3G6J B;  2CGP A;  3M7A A;  3DEM A;  3NAP C;  1XRU A;  1ZZ6 A;  3QOP A;  4J6G A;  1O3Q A;  1JHJ A;  3LD8 A;  4QX2 A;  2DUR A;  1JUH A;  3BYW A;  1OUS A;  1IQA A;  3ZMO A;  2XJU A;  5F3G A;  3ZO0 B;  4CCC A;  1HRV 3;  1NXM A;  2LRP A;  1TNF A;  2RM2 1;  1MEC 1;  4J1W A;  1DHK B;  2ARC A;  4Y3O A;  3D4K A;  1VBE 2;  1TZO A;  5ACA 2;  1WMD A;  2G9F A;  1Y3T A;  5JPM B;  2ZGM A;  1RUI 2;  4N43 A;  2YPJ A;  2E33 A;  3JQW A;  4U36 A;  4ET7 A;  5L7O B;  4R52 A;  2GU9 A;  5FO8 B;  2O8O A;  1JN2 P;  1AR9 2;  5GJ6 A;  2HKX A;  4IET A;  3WLU A;  3ZN6 B;  3LWC A;  3V0B B;  1T2X A;  1ND3 C;  2V09 A;  3MW2 A;  1COV 2;  4CRQ A;  4D6R A;  1LHO A;  1BHG A;  2RDR A;  1KJL A;  1MZ6 A;  2VM9 A;  4GB3 1;  2KM2 A;  4IEZ A;  4B3N A;  5F3E A;  3T2P A;  2FCV A;  5HI0 A;  5EIY B;  1K45 A;  1Q8P A;  4H14 A;  1TVG A;  5FPU A;  4KG8 A;  3PNA A;  3K77 A;  4ZS2 A;  4MGI E;  1FYU A;  2Y60 A;  1JU4 A;  3DKQ A;  1W6M B;  4DRR A;  5EQU A;  5LA0 A;  1NLR A;  2C6S A;  4C1W A;  4YZ4 A;  1GLH A;  3WNK A;  1Y9M A;  3E6C C;  1W05 A;  4NIG A;  2IC1 A;  4LKS A;  5FYH A;  3T4V A;  4L97 A;  3UET A;  4K20 A;  4N7U A;  4QDR A;  1UU5 A;  1W2O A;  5DUV A;  4DFS A;  2EIE A;  5E89 A;  3EQE A;  2J1U A;  3HNY M;  4FPJ A;  1O3S A;  4FPH A;  4AI9 A;  1WLW A;  5GZD A;  3RZG A;  2WWJ A;  1VE0 A;  4EE2 A;  4FTB A;  2VTX J;  2VPV A;  3CL1 A;  4CDX C;  1EUU A;  5JMC A;  1XJA A;  1W0O A;  4NIA A;  3UGF A;  4RFR B;  2XJR A;  1QXJ A;  5FZO B;  4MV2 A;  4NIH A;  2W94 A;  4BMB A;  4G9S B;  1JZ7 A;  2WT2 A;  3HN3 A;  3DCQ A;  3WF2 A;  4AFC A;  2E53 A;  1UPI A;  1XU2 A;  1NAE A;  1RC6 A;  5EHD A;  5JZG A;  4XCB A;  1LEN A;  1W8W A;  5FYM A;  1DYP A;  3H50 A;  5C6C A;  2HWC 2;  4QMA A;  1EUT A;  1SG3 A;  5CYY A;  1EV1 1;  1CGP A;  3OY8 A;  1AJK A;  5BNO B;  1Q8O A;  2VOV A;  3KWV A;  2DVA A;  4QXB A;  4YLZ A;  4OUS A;  4ATE A;  1BKZ A;  1K5M C;  4CDQ A;  4D7T A;  5BNO C;  3T0A A;  1XBF A;  5CVR A;  2HYK A;  5D8A B;  4CU7 A;  3MO4 A;  3ZN5 A;  3ZYG A;  5IVE A;  3ZVX A;  2PAM A;  2UYA A;  3AL6 A;  1RTV A;  3OUH A;  1R08 2;  2VZQ A;  4A44 A;  2BRT A;  5JXH A;  3FUQ A;  1XE7 A;  1PVC 1;  4JKL A;  4UBG A;  1RB8 G;  5FXV A;  3T0D A;  4L8Q A;  1ZZ8 A;  4S2F A;  4L11 A;  2O1Q A;  5AVA A;  2B42 B;  3O1R A;  1DU3 D;  1BQP A;  3NRU A;  1PK6 B;  4TLF A;  4WZF A;  3RGB A;  5ABJ C;  4YM3 A;  5LY1 A;  1IGO A;  2VZR A;  1PK6 C;  2A6X A;  2OA2 A;  2ZAB A;  4E9K A;  1I6X A;  4FVV A;  2I45 A;  3T08 A;  5D1I A;  1OUX A;  3QH6 A;  3WG3 A;  2H0B A;  2YY1 A;  4LJH A;  4CDW C;  3AMP A;  1SPP B;  2GC3 A;  5LA2 A;  1W8O A;  3HD8 B;  1ALY A;  2W2I A;  3NL1 A;  1X9P A;  1NZC A;  4N9I A;  4XF4 A;  4M3C B;  5JPN B;  1L3J A;  1DGL A;  5HCH A;  2DCJ A;  3AP7 A;  4AI8 A;  3HAG A;  5FYY A;  3F95 A;  4LHK A;  4EN9 B;  3LDB A;  5C8C C;  1UMH A;  3KLS A;  1FNZ A;  3SNM A;  1C1F A;  2XGX A;  3PVO A;  1N1Y A;  3ZLI A;  1U12 A;  2VO5 A;  3OTF A;  5A3O A;  1RVF 1;  2HJI A;  3NV2 A;  2FDJ A;  2XH6 A;  3ACL A;  1JH5 A;  4N53 C;  2EAK A;  1I5Z A;  1FMD 2;  3ELN A;  4WM7 C;  1OF3 A;  4XFG A;  5KXC A;  2FDH A;  1CON A;  3ZXL A;  1CAV A;  2OQ6 A;  1N47 A;  2VL4 A;  2J1A A;  1AR8 3;  5LEK A;  4BJ0 A;  4YW5 A;  3I2O A;  2DU0 A;  2W1U A;  3MGU A;  1ZBA 1;  2Y6H A;  4B29 A;  4Q0S A;  5FV3 A;  2VR4 A;  2W1S A;  2YPD A;  4CCD A;  4NHX A;  4RL7 A;  4BQW A;  2ZZQ A;  2DTY A;  3EBR A;  1U5Z A;  3J8F 3;  2A6Z A;  5FPZ A;  5DXD A;  3ILF A;  3GBW A;  3MV1 1;  3WY6 A;  3ME2 A;  1XE0 A;  2FCU A;  5A3P A;  1EPZ A;  3AP4 A;  5B4X A;  1H1A A;  2BDR A;  4YVS B;  2PN5 A;  3IZO A;  2WN3 A;  1PMI A;  3CJX A;  4XZU G;  3HNM A;  1LGB A;  5F5Q A;  4YVS C;  4XAE A;  1V6L A;  3KZ4 C;  4BQY A;  1DIW A;  4AHY A;  4AI2 A;  4YG6 A;  3EXU A;  5IAT A;  2QQI A;  4QQO A;  1GOH A;  2ZJC A;  2EXJ A;  1AYN 3;  1AX1 A;  5FPA A;  1AL2 3;  1CAX B;  4QQ2 A;  3X29 B;  4CUA A;  1DYK A;  1BLZ A;  2F6B A;  1UXX X;  4XAB A;  3HBK A;  1UAI A;  1YC6 1;  2PHD A;  2UWA A;  2ZEY A;  4I2O A;  4COY A;  5CU1 A;  5APA A;  1GZ9 A;  4P9I A;  2QDR A;  3S6P A;  3INA A;  2DCK A;  2XBO 2;  2ZX2 A;  2BGP A;  4LNV A;  2GC2 A;  4XJ9 A;  4DXR A;  2SBA A;  5A7O A;  3O1P A;  1ZBE 2;  1US2 A;  2D6P A;  3O14 A;  4KBB A;  5FWE A;  2ZPX A;  3NST A;  1W6Q A;  1JHN A;  4P5H A;  4RGG A;  2A7A A;  5A7S A;  5IT6 A;  3WNL A;  2D3P A;  1K42 A;  4YVW B;  1CZV A;  4WM8 B;  1UY2 A;  2YC4 A;  4E2S A;  4E4D X;  4YVW C;  2J7M A;  3J7M A;  1CJP A;  3OCP A;  4OHV A;  4C91 A;  2GC1 A;  5KHH A;  4YPJ A;  1SBE A;  4Y1Y A;  3VBR C;  4GWN A;  3THD A;  1ASJ 1;  1RHI 1;  2R0H A;  5F2W A;  4LIV A;  4COU A;  2VUL A;  4BME A;  1EY2 A;  3ABZ A;  3MIB A;  3ACI A;  4A3Z A;  4LBQ D;  3WOG A;  2OS2 A;  3NJY A;  1FPN 3;  1GQP A;  4A42 A;  1DF0 A;  4IE4 A;  4MGS A;  1GP6 A;  1POV 0;  4AQS A;  2D40 A;  2IXC A;  4HG6 B;  2LM3 A;  2A71 A;  2R16 A;  2ZGR A;  3A4U A;  4JGZ B;  4Y1V A;  1IOA A;  1ZRR A;  1XND A;  4JGZ C;  3UGH A;  3FX3 A;  4CCL A;  2XKO A;  2FD8 A;  1E5H A;  2VZT A;  3AP9 A;  2C24 A;  1UOB A;  3VBF B;  3ZYI B;  2VUD A;  1H9W A;  1L7R A;  4R8H A;  2D5H A;  4YFW A;  4NRP A;  5FY7 A;  4AHX A;  5BUV A;  3H8X A;  1LTE A;  1G8W A;  3ZN6 A;  4I01 A;  4AW7 A;  4RHV 3;  4UF0 A;  1J1L A;  2VMH A;  4Y22 B;  3WF0 A;  4YAR A;  2X10 A;  1XB9 A;  1UL9 A;  3GJB A;  1A3K A;  3ILR A;  1POV 1;  4TN7 A;  2WL1 A;  1YEW A;  5C70 A;  2CDP A;  2FDK A;  3MI8 A;  4K8R B;  2NN8 A;  3AMM A;  4Q4W 1;  4AXO A;  3CU7 A;  2WAA A;  1GQH A;  2OXB A;  1O3R A;  1ULC A;  2JD4 A;  1A8M A;  2JEM A;  2RS1 3;  1CZT A;  2JG9 B;  2UU8 A;  3WVJ A;  2GC0 A;  1RXG A;  3IPV B;  2JG9 C;  2MNG A;  3HVD A;  4PLO A;  1YQC A;  3VZL A;  3VDD B;  4EZH A;  1DQ5 A;  5DN2 A;  4ZPI A;  4YW1 A;  2A6Y A;  1OQD A;  3DYP A;  1ODN A;  3UES A;  1GP4 A;  2C26 A;  3VZK A;  1DFQ A;  3DEC A;  2JDH A;  2E26 A;  2CY6 A;  3GDB A;  5FXW A;  1PO2 3;  4CDX A;  4KH9 A;  5G05 L;  1QXR A;  2A6W A;  1EAH 3;  1H4G A;  3VL9 A;  4DRV A;  1MS5 A;  4JQR A;  5HXV A;  5J96 B;  4YZ3 A;  4R9A A;  3ZN4 A;  3BI3 A;  4O61 A;  3KM5 A;  4BQ3 A;  3DXT A;  4GWJ A;  5JOY A;  3FFZ A;  1GZT A;  5JIA A;  3KVA A;  3ECQ A;  4QAW A;  5CEH A;  5KHI A;  3T2T A;  2FZ1 A;  4XF0 A;  5G04 L;  4ES9 A;  2E51 A;  1QXP A;  3MF6 A;  4Y5S A;  4AAX A;  3E5X A;  5I91 A;  4UW6 A;  3H42 B;  3J4U H;  5CAD A;  3JD7 3;  3SEP A;  2PHR A;  2R07 1;  1JYX A;  5T52 A;  1XE8 A;  4GAZ A;  1MZ5 A;  1R09 2;  1RUH 2;  5BNO A;  5T55 A;  4XCA A;  5GLV A;  1HB3 A;  4MHU A;  2D6O X;  4MXW B;  4CZS A;  4XTM A;  5D8A A;  3WSO A;  1SLA A;  2ORX A;  1WW5 A;  2YV8 A;  4CUB A;  4XDP A;  3AX4 A;  4B4Q A;  1WA4 A;  2GND A;  3UT0 A;  3ZXD A;  4NWW A;  2DUP A;  5A7Q A;  4XOG A;  2VZ3 A;  5DMY A;  3AZZ A;  2RM2 3;  4TSV A;  1O5U A;  4HOO A;  1AR8 2;  1MEC 3;  3JBG 1;  3HQR A;  5AFE A;  4IE6 A;  4CVU A;  2YU1 A;  1BBT 1;  2GH8 A;  5T50 A;  5J3U A;  4L99 A;  3I7D A;  1E5S A;  1OT5 A;  3JXS A;  1CIW A;  1FOD 1;  5ABJ A;  1CX4 A;  1V6M A;  2DU1 A;  5F39 A;  4R4Z A;  1QNY A;  1PK6 A;  5FYZ A;  4QGN A;  3J8F 2;  1PGL 1;  2VZ1 A;  5FPV A;  5CZK A;  2ZZJ A;  1UY4 A;  3Q8A A;  4WVZ A;  3WCS A;  4DMI A;  2HWF 2;  4XDQ A;  3VBO C;  3VLB B;  2ZGP A;  1UZV A;  1SPP A;  4PDW B;  4Q2F A;  3O12 A;  1BMV 1;  4A7K A;  2ETE A;  4GKX A;  3OSD A;  1FT9 A;  3GZT B;  4XQW A;  5C9A C;  1AL2 2;  3OGJ A;  2DF7 A;  3ZYF A;  1ONA A;  1AR6 3;  2EF6 A;  3OD4 A;  5J1X A;  5LRS A;  1C8N A;  4FI9 A;  3AXD A;  5FZG A;  2JB8 A;  5JLV A;  1QDC A;  3LOI A;  2WT1 A;  4MGQ A;  1SFP A;  1H2K A;  4TWT A;  4DIQ A;  3OGV A;  1VRH 1;  2R0F A;  2VW1 A;  1YLL A;  2B9V A;  4ZZ5 A;  5EJ1 B;  4WM7 A;  5FY0 A;  1YJL A;  5F6L B;  5C4W C;  5DAB A;  2Y0I A;  3U10 A;  1AUY A;  1XU1 A;  2TNF A;  5IWF A;  5FOJ B;  4Q4V 2;  4R4X A;  5JR2 A;  2JEN A;  4DEQ A;  4QWN A;  2IWG B;  3H1Y A;  3H3L A;  3KF5 A;  5FXZ A;  2IXK A;  2EIC A;  4XXP A;  3WNO A;  2CL2 A;  3DPR C;  4UFM A;  4L0P A;  5CIR A;  2HBU A;  1L7L A;  2WIN B;  5E6H A;  3ZR5 A;  1CVN A;  4ES8 A;  3BIW E;  1SHW B;  3CIH A;  4PBO A;  4QB1 A;  5HCB A;  3VHO A;  4DUX A;  1DQ0 A;  1FPN 2;  1VMH A;  3WG2 A;  1YQ6 A;  3AKT A;  4CTE A;  2ZX3 A;  3VD7 A;  3N36 A;  2OII A;  4UFL A;  2XL7 A;  5IVC A;  2NYY A;  2LRO A;  4NN0 A;  3TNQ A;  1H6X A;  3DUI A;  5I8T A;  4YVS A;  4D94 A;  3U78 A;  1S0G A;  3N7K A;  3TBD A;  5FFO C;  1U0A A;  4MGK E;  2CV6 A;  2RHP A;  3OBR A;  1D7P M;  1QJU 2;  3MLJ A;  1WLD A;  2GN3 A;  1W6O A;  2PTM A;  3H3U A;  3IN9 A;  2E7Q A;  1EV1 3;  1G6N A;  3NKT A;  4UI9 L;  4OFG A;  1LES A;  1W9S A;  3VDB A;  1YFW A;  2XUM A;  3NVC A;  5FYC A;  4NAO A;  1XSQ A;  1WCK A;  4RHV 2;  1XXN A;  1LCL A;  5FRA A;  2FQP A;  3GAL A;  5IAV A;  1A34 A;  3AKS A;  5GAL A;  2RDQ A;  3CKH A;  4N7I A;  3UGG A;  1AL0 G;  1W3X A;  2GNB A;  3MLK A;  1H1M A;  1VBB 1;  2ZAA A;  1MS0 A;  1LHV A;  3I2D A;  1G86 A;  2EAA A;  3L2Y A;  4M01 A;  2NP0 A;  3PIJ A;  3BTY A;  5IVV A;  1UZ0 A;  3O5S A;  1AX2 A;  1CIY A;  2VTF A;  4XUR A;  4Q29 A;  4FPG A;  4YVW A;  1RUE 1;  3W58 A;  1AJO A;  3J9S A;  2RS1 2;  1PVC 3;  2WAB A;  2YHJ A;  3AZX A;  3LEI A;  4OI4 A;  4S2H A;  5I0R A;  1W6P B;  3KV4 A;  2J22 A;  3ASI A;  2XDV A;  3POF A;  1OPO A;  3UJO A;  3UK9 A;  1W9T A;  4E27 A;  2W08 A;  3GJA A;  4LBL A;  1HX6 A;  3BTX A;  5FQ0 A;  4B4P A;  1DG6 A;  1E5R A;  4PI0 A;  3WHU A;  3BPS A;  3CO2 A;  3SQO A;  2E32 A;  4GWI A;  1QH6 A;  4FPL A;  1LB2 A;  1S0B A;  1W04 A;  3IDC B;  5C3S A;  2JIG A;  2WO1 A;  4CPB A;  5J37 A;  1PO2 2;  1GWM A;  3MID A;  1Q43 A;  1BVP 1;  2QZ3 A;  2R06 1;  3E6D A;  4UWD A;  4JGZ A;  1KQR A;  2RS5 1;  4GAL A;  4GD4 A;  1JYV A;  5FDB A;  4DZG A;  1DCS A;  2XQR A;  1JOB A;  1BJQ A;  5CAZ A;  4QB6 A;  3NV3 A;  4CCE A;  1VJ2 A;  4OCT A;  3TN9 1;  4E4H A;  5K0U C;  5IYY A;  1RVF 3;  1RUG 1;  4HAN A;  5ERL A;  2RVA A;  2R32 A;  2AYH A;  3APB A;  5DZF A;  4Y33 A;  5A33 A;  3GF6 A;  3WV6 A;  4XJA A;  4DEV A;  1N3O A;  3HBZ A;  4DIN B;  3BOP A;  2WZR 1;  3WQB A;  3PVB B;  1PMH X;  1LEM A;  4UXA A;  2VCM A;  1U5X A;  2VG9 A;  3M4F A;  3NNL A;  5EV7 A;  5JZG B;  2WKK A;  2VOW A;  5FMC A;  5FPX A;  4LO7 A;  3POW A;  4W8J A;  1X36 A;  3KHB A;  1WLC A;  2JG9 A;  2ZAH A;  1RUF 3;  4N8M A;  5FUP A;  4B7E A;  1ZBA 3;  5D21 A;  1BYH A;  2WII B;  4IDZ A;  4XHB A;  4Y1Z A;  1T6B X;  1Y7B A;  3OY8 B;  2VCA A;  3WNP A;  2OZJ A;  1E5I A;  2VNG A;  3HIF A;  1GZW B;  3Q9O A;  1WD3 A;  5EJZ B;  3VN4 A;  2RM2 2;  1D4V B;  4CDQ B;  5SV5 A;  1D0H A;  2D3R A;  3ZXG A;  3ZYP A;  1WCU A;  2VZV A;  2YU2 A;  3M2M A;  4IEX A;  4LO4 B;  4LOT A;  5EXO A;  3O1S A;  4XJ8 A;  3VHN A;  1ENS A;  3FUO A;  4CYD A;  4D7Y A;  5HCA A;  2PQS A;  1WCS A;  4N9H A;  2BFU L;  3DXU A;  5CG9 A;  2ILM A;  3RNS A;  2WNE A;  1KS4 A;  2OX0 A;  2RJL A;  2VUA A;  3CMG A;  4A4A A;  3S0M A;  1UIJ A;  2YYO A;  2WQZ C;  2B7Y A;  5EP9 A;  4D0Q A;  4X6R B;  5T54 A;  2DDU A;  1ULO A;  2D93 A;  3UV9 A;  4BLJ A;  4UAP A;  5A70 A;  4KNC A;  1UY1 A;  2JEC A;  1AR6 2;  1ENR A;  2WNO A;  2XXZ A;  1OPM A;  2ZTN A;  1O91 A;  3MUY 1;  1ULP A;  1FXZ A;  4L2N A;  5GLW A;  5I0U A;  1PNG A;  4WZC A;  4AL9 A;  3GZE A;  3OPZ A;  2B46 X;  5KXB A;  1AYM 1;  1PGW 1;  4QPY A;  5GZE A;  3QBQ A;  3R4S A;  2Y6G A;  1PIV 1;  4BQ1 A;  3LDK A;  1OF4 A;  2AC1 A;  5F3I A;  1ASJ 3;  1RHI 3;  4LK7 A;  4C90 A;  3CF6 E;  2Q8E A;  2ZGL A;  4HPK B;  4PQQ A;  3WG1 A;  3WP4 A;  3DV8 A;  3GBG A;  1QQP 1;  1W0P A;  4NJ4 A;  5FZK A;  2WAO A;  2VME A;  2WRA A;  2OT7 A;  1Z7S 1;  3VL8 A;  1UYP A;  5F6K A;  1O7F A;  1NT0 A;  5FZF A;  1OA3 A;  3SH3 A;  4CP0 A;  2PMW B;  5DUU A;  5C3Q A;  3B94 A;  4P02 B;  3AVR A;  3I3B A;  1RL3 A;  3VBO A;  2Z4F A;  3GM8 A;  5FY9 A;  1C8M 1;  1A78 A;  5C7G A;  5L19 A;  4NHM A;  4UBH A;  2JG8 C;  5DAP A;  3T09 A;  5AC9 1;  5IHR A;  5C9A A;  3N35 A;  3WW2 A;  2BUK A;  3NJZ A;  1MS8 A;  1TMF 1;  2PA7 A;  4TZD A;  4LA2 A;  2Y33 A;  3AFG A;  2Y6J A;  5DQ0 A;  5LA9 A;  1POV 3;  4FFI A;  3W20 A;  1VAL A;  1EV1 2;  1TG7 A;  2WFP A;  4Q26 A;  5JXI A;  4AVT A;  5FBJ A;  4L9B A;  1VAK A;  2G4I A;  4QD2 A;  3TYJ A;  4FXG B;  2W95 A;  4RR3 C;  2FDI A;  3MBW A;  4UFK A;  1OFN A;  1HQL A;  4KG0 A;  1H1I A;  2HWD 2;  5C4W A;  3RYP A;  4C1X A;  3VKL A;  4AFD A;  1S2B A;  4ZXE A;  1O8P A;  1JTZ X;  5H9Q A;  1OOP C;  2VCC A;  3ZX7 A;  4LKF A;  4HT1 T;  2PLV 1;  4OZO A;  3AC0 A;  1UYX A;  4JCK A;  4Q0Q A;  1H2L A;  1LR5 A;  4ARX A;  1VRB A;  3DPR A;  1I9R A;  3MPB A;  1FAY A;  4LEJ A;  4W50 A;  1QJX 1;  5A6X A;  2DCY A;  1W6Q B;  4MUV A;  3NAP B;  4XDO A;  1JUI A;  4CCJ A;  1BZW A;  4PLN A;  4Q4X 1;  4GJY A;  1F4H A;  4QX8 A;  1STM A;  2QQV A;  1GQG A;  1ULE A;  4NHL A;  4ASM B;  3GCX A;  1UWW A;  2LTN A;  4HMZ A;  3ON7 A;  1MVE A;  4QKF A;  2VQA A;  5BPX A;  1N1S A;  3NW4 A;  5T5P A;  5FP9 A;  1LED A;  2JKX A;  2R07 3;  4PF5 A;  4FAG A;  3LIH A;  1DGW A;  3T2O A;  4BQ5 A;  2GSY A;  1PZ8 A;  4HK9 A;  1OFS A;  1OXC A;  5KWR A;  1LOE A;  4XIO A;  4EYU A;  4BWO A;  2Q5T A;  2YFU A;  1XNC A;  5LBF A;  2QNK A;  3QH7 A;  5FZI A;  1PX4 A;  1ND3 B;  2ZGU A;  1NZI A;  4FQ4 A;  4H55 A;  5B4N A;  2BFU S;  2P3I A;  4UF0 B;  5C8W A;  1UX7 A;  1K5J A;  2BGC A;  1GR3 A;  3OBA A;  3O1V A;  1W3V A;  3FWE A;  2VMI A;  3RDI A;  1RUF 2;  1BBT 3;  1OD3 A;  1NOV A;  1W6P A;  1HXS 2;  2TUN A;  3K4A A;  3NNJ A;  2Y0O A;  3QD6 A;  1FOD 3;  2PAK A;  1DP0 A;  2SLI A;  5DAQ A;  3AK0 A;  1QOO A;  2HEV F;  2GMM A;  4TXW A;  5FTT C;  5C33 A;  5JOZ A;  3RZJ A;  1F4A A;  2Q0A A;  4BIO A;  1ZRF A;  2AAC A;  3WCR A;  4QU2 A;  4Y5T A;  4QPI C;  1D2Q A;  5IK4 A;  2RG4 A;  2MEV 1;  3MV0 1;  2ADD A;  2RMU 1;  2ZEX A;  4JRL A;  1VBD 1;  3NV4 A;  1V00 A;  3IMN A;  1ZZB A;  2RE9 A;  3LSD A;  4M4R A;  3RG0 A;  2NLR A;  3KF3 A;  4H7M A;  3ZXE A;  2WS9 1;  3TEY A;  1VBA 2;  1YFX A;  3C2U A;  3CQO A;  3MF9 A;  1OA2 A;  5K0U A;  4CDX B;  1G9B A;  4AFM A;  2P34 A;  2W91 A;  4QX1 A;  4XQ4 A;  2WNU C;  1DGR A;  3FL7 A;  4E8D A;  5A3M A;  3HT2 A;  1VRH 3;  2ZA9 A;  3CBN A;  4UT5 A;  1R1A 2;  1S2K A;  3AL5 A;  3AYE A;  5HV0 A;  4OLL A;  3D6E A;  1PX3 A;  3T4H B;  1CPN A;  3B01 A;  5LW9 A;  4IE5 A;  3EJK A;  3D0S A;  4LPL A;  5F2S A;  3ZM8 A;  4XIK A;  4RD7 A;  1OD5 A;  5FMO L;  1H0B A;  4H2A A;  1PO1 1;  5FZ8 A;  1OKQ A;  3PIG A;  4XBQ A;  2MPF A;  3ACF A;  4LE3 A;  1CJD A;  1LHN A;  3M3I A;  4DPN A;  1RUC 1;  4CU6 A;  3AYD A;  4XUQ A;  1V6I A;  2L9L A;  1RUJ 2;  3ZOI A;  5A7W B;  3NJV A;  1K5M B;  2RV9 A;  1JS9 A;  1GZW A;  3Q8C A;  3VD5 A;  1JMU B;  1PNF A;  4IGO A;  1O59 A;  4XPV A;  3H0O A;  3I4I A;  3KCY A;  3U4S A;  3B9C A;  3NNF A;  1GP5 A;  4H3W A;  2WO7 A;  2ZXQ A;  4ZON A;  3WNM A;  1RUD 1;  4GKY A;  4HK8 A;  4JV4 A;  4SBV A;  2RR1 1;  4K7J A;  4E2Q A;  2VMD A;  4NR1 A;  2XHN A;  5HBA A;  4XIL A;  3SKV A;  2CSG A;  5ABJ B;  1KD7 A;  4A6O A;  5HXM A;  2YMZ A;  1UZW A;  2V72 A;  1W8T A;  3A0N A;  4Y1U A;  3O0X A;  5F5C A;  3KS7 A;  5JSP A;  4KMQ A;  4V2V A;  4YGD A;  5CB7 A;  1F2N A;  4KL1 A;  4HSL A;  4LBQ A;  5BNP B;  1WLT A;  3QLQ A;  2W87 A;  3JB8 A;  4CDW B;  5HV4 A;  2Q8D A;  4Q4Y 1;  3T0B A;  1VBB 3;  1H2N A;  5BNP C;  4C0B A;  1VBC 1;  1O8S A;  4TLG A;  3RZZ A;  5FYU A;  3ZFG C;  5K9Y A;  4CU9 A;  1VR3 A;  3G7D A;  1G9F A;  4B1L A;  5C8C B;  3OUI A;  1W2N A;  1V70 A;  1UKR A;  2YXS A;  5FMD A;  2QBX A;  1DBN A;  3WP3 A;  2DTW A;  2D97 A;  1XNA A;  4RSU A;  3FN9 A;  3O0V A;  3URF A;  2WLQ A;  2YBS A;  4MHR A;  1KS5 A;  4HPK A;  4Y4Y A;  4N53 B;  4YW2 A;  4ATF A;  2GAL A;  4IEW A;  2E6V A;  4ZY9 A;  4I0A A;  4BXS V;  4K21 A;  4WM7 B;  4DXS A;  1RMU 2;  1QOT A;  3HJR A;  1BVV A;  1V0A A;  2Q1M A;  3VKM A;  4BXF A;  1D4M 1;  3VD4 A;  1HIX A;  2ES3 A;  1V6K A;  2BNM A;  3GGL A;  2C1F A;  3VBH B;  2BBV A;  1DYO A;  1ZZ9 A;  2R06 3;  3VBH C;  2RS5 3;  2K2S A;  2DVG A;  2HWE 3;  1XSR A;  4OHY A;  3IBM A;  3VZO A;  4XUT A;  1RJ7 A;  5JMO A;  3KT4 A;  3VKN A;  2AUY A;  2BVV A;  3J7H A;  2AZ5 A;  5E88 A;  5GLZ A;  5L9B A;  5ACA 1;  2W3J A;  3TN9 3;  3B69 A;  2VGD A;  3ZPY A;  4IEQ A;  1SBF A;  2DFB A;  2JG8 A;  2W39 A;  2WFF 3;  1RUI 1;  1RUG 3;  4GH4 C;  5EZW A;  2UYB A;  3U37 A;  1HRV 2;  2F4L A;  3N4M A;  5L9V A;  4PCR A;  1F15 A;  1O4Y A;  2YUE A;  2ZEW A;  4QKN A;  4XW3 A;  3RFR A;  5FZ9 A;  4BQ2 A;  2JXA A;  2WZR 3;  2CWS A;  4FPO B;  2R07 2;  4AG4 A;  1AR9 1;  2YBK A;  5GLT A;  5JAX A;  1UYZ A;  2A5Z A;  2W47 A;  2Q1F A;  3K4D A;  4DB5 A;  4LBK A;  1COV 1;  2B39 A;  3I59 A;  1L7Q A;  1AXZ A;  2C0Z A;  2ARX A;  1W8F A;  3C7G A;  1W6O B;  2BEO A;  1N3Q A;  3ACH A;  3BKZ A;  3SCH A;  4AQ2 A;  3AKR A;  2VXR A;  2WUH A;  4ZZ8 A;  3WF1 A;  4AED C;  2VQ0 A;  4EN8 B;  4QKB A;  1X82 A;  3O1M A;  1UW8 A;  3UNP A;  4QT6 A;  4XF1 A;  1XC6 A;  2VZS A;  2I2S A;  3WZ1 A;  2DVD A;  1HN0 A;  1SZB A;  2RS3 1;  4P00 B;  3SCG A;  1UZZ A;  1NQD A;  3H3Z A;  4YG0 A;  4DXZ A;  3KCC A;  4MXV A;  1SLB A;  3I97 A;  4I0B A;  3GCW A;  3CHX A;  3NAP A;  3WUC A;  4LK6 A;  4JZR A;  2Y26 A;  2JKB A;  2VE1 A;  2HEW F;  3AM2 A;  3VBR B;  4DUW A;  2BBA A;  5K8S A;  3THC A;  3ZSL A;  4PIX A;  2F17 A;  2P17 A;  4LUL A;  4B4R A;  5KHG A;  4HVR A;  3FHA A;  5BYN A;  5FZ4 A;  5IVY A;  1RIR A;  2NMO A;  1QY4 A;  4QGM A;  5FQ0 B;  3USS A;  4COV A;  1YXW A;  2XVG A;  4BZ4 A;  1ST8 A;  4NAM A;  4UFJ A;  4ARY A;  1OUR A;  4Q0U A;  4RS5 C;  3FLT A;  3A0K A;  3UKN A;  4A41 A;  5JR7 B;  5JI7 A;  2XWB B;  4FTE A;  4CEY C;  5H9S A;  1TME 1;  1LHW A;  2QQO A;  5IW0 A;  3ZIW A;  2ZGO A;  1R64 A;  3ZSE A;  5IJR A;  2OVU A;  1ZX5 A;  4DUV A;  1QJY 3;  1AYM 3;  1V6N A;  3AJZ A;  3AZW A;  1G9D A;  2HWC 1;  4LIT A;  1PIV 3;  2P3K A;  1SDD B;  3I2H A;  4NPR A;  2DVB A;  1C5I A;  4CP1 A;  5FKC A;  1ND3 A;  1W2T A;  1H8T C;  5A33 B;  2YZ4 A;  1T6G C;  1XPW A;  4FT8 A;  4BIF A;  5IK8 A;  4AVV A;  3C7O A;  5F5A A;  3KMH A;  2QQP A;  1Z7S 3;  4AZZ A;  5JI9 A;  1UNB A;  1GBG A;  1H4H A;  5BNQ A;  3PUI A;  3TAY A;  2R04 1;  3N9P A;  4V1P A;  3ROU A;  5CFD C;  3LIG A;  4B1M A;  1RJ8 A;  1QDO A;  4XFB A;  1UD1 A;  2WA4 A;  2VQU A;  3MHZ A;  1JW6 A;  4XEZ A;  4BK5 A;  5HPO A;  3Q8F A;  1C8M 3;  2D6L X;  2CGN A;  2RDN A;  2WQ8 A;  3JQX A;  1OH4 A;  3R6S A;  3KV5 A;  4Y20 A;  3WDU A;  4Z92 B;  2K9Z A;  2X05 A;  5AC9 3;  2X8K A;  1PMJ X;  3OBZ A;  5GZG A;  2BVB A;  5FR3 A;  1JYT A;  3PJY A;  4UW4 A;  3BU7 A;  1TMF 3;  3S7I A;  2OW4 A;  5FY1 A;  2ZCW A;  2Y8K A;  2CDO A;  3TEW A;  4JRA A;  2WNU A;  3D8C A;  1UMI A;  5KHK A;  1MVQ A;  3KGZ A;  3KD4 A;  1DGR N;  2I07 B;  2JJ6 A;  2PEL A;  3KVB A;  4XVH A;  1QJZ A;  4OHW A;  3ZYH A;  4U2A A;  2EID A;  4ZKT B;  3HR9 A;  4W4Z A;  3FHQ A;  1HRI 1;  3GZU C;  1PM4 A;  1ZRC A;  2E31 A;  3O1O A;  3POB A;  2XON A;  5LBC A;  2VNV A;  1PZ7 A;  2B4K A;  2ATF A;  2ZX1 A;  1A8D A;  3L2H A;  3O7O A;  2QQM A;  4GMP 1;  5JVV A;  3UYJ A;  2PLV 3;  3M3Q A;  4LLF A;  3RMY A;  4AVA A;  2D6M A;  3B7M A;  1KEX A;  4W6X A;  4IER A;  2NPI A;  1OQ1 A;  3R0R A;  4M3C F;  3EO6 A;  1KDK A;  1QJX 3;  1I3H A;  2VUJ A;  1SQ4 A;  5KXD A;  5A7W A;  1F9K A;  1OLR A;  1K5M A;  3BN6 A;  3WF3 A;  4JX0 A;  4H7L A;  4Q5O A;  3FBY A;  4XMI A;  4FQZ A;  2EXI A;  4RGA A;  4EZ4 A;  4K1Y A;  4AHW A;  2CHH A;  3S30 A;  1Q3E A;  4XC9 A;  4AGV A;  1KGY A;  3I2J A;  2RS5 2;  1NLQ A;  3VUO A;  2HWE 2;  3RRD A;  4IV3 B;  3RSJ A;  4Y26 A;  5KR7 A;  3HQU A;  4IV3 C;  4LBJ A;  1LNS A;  3ZPO A;  4OQ8 A;  4BB3 A;  2WT0 A;  4LTA A;  2WFF 2;  1RUG 2;  2W0X A;  1UPS A;  1ZRD A;  4OHZ A;  1SFY A;  5DG1 A;  2QQK A;  5EFU A;  2PHW A;  1HB2 A;  1QHD A;  2WO3 A;  1IS4 A;  2LS6 A;  3VBO B;  3H8O A;  3H1M A;  3IWZ A;  1MPX A;  5EJ3 A;  2V5D A;  4IV1 C;  4ASL A;  4CDW A;  5BNP A;  2XJP A;  3TB0 A;  3ETQ A;  1B09 A;  1DGW X;  2R49 A;  4NE9 A;  3IMM A;  4FO9 A;  3H8R A;  1AXY A;  1CAW B;  1ND2 B;  1IPJ A;  3SHR A;  3VHR A;  2YC0 A;  5C9A B;  1JZ6 A;  1FAT A;  1IG0 A;  1ND2 C;  2B9U A;  3CJI C;  3HMY A;  2GP3 A;  2XBO 1;  1AYN 2;  2XLG A;  5A32 B;  3WG4 A;  4B8E A;  5C8C A;  2WWS A;  4GB3 3;  5LRR A;  3LEK A;  1ZBE 1;  4QM9 A;  2VW0 A;  1GU3 A;  3POG A;  4HKL A;  4W65 A;  5T5J A;  5AFB A;  4ONU A;  1GYK A;  2DCT A;  3I2F A;  1Y43 B;  1BK1 A;  1VAV A;  4TTG A;  5E1R A;  4LO5 B;  2ZML A;  1YHF A;  4AOC A;  1K3I A;  5A1A A;  2FCT A;  2VTX A;  4N53 A;  4OI2 A;  4QHO A;  2VD7 A;  4XJW A;  4AGR A;  1GWK A;  5A6Z A;  2QVS B;  1GNY A;  5C4W B;  2H0V A;  1LU2 A;  3PUA A;  2MEV 3;  5F8P A;  4AYU A;  2WYS A;  3ES1 A;  1WBF A;  2XJT A;  3VBH A;  3ACG A;  4M00 A;  3JUU A;  1VLN A;  4QKD A;  4D6S A;  3Q8B A;  3HQX A;  3LDR A;  4QXH A;  2QFE A;  3I2K A;  1UKG A;  2WS9 3;  4I0W B;  1JZ3 A;  3IT8 A;  1GAN A;  4D7S A;  5BNN A;  3THP A;  3DPR B;  2GME A;  4HBN A;  2ERF A;  4MLO A;  2A1X A;  1WWY A;  1PZ9 A;  4AVB A;  4GH4 A;  4MGT A;  4EV0 A;  4ISQ A;  3ZKY A;  3N9M A;  1CD3 G;  1U5Y A;  4AHZ A;  5FAX A;  3BOD A;  1ZNP A;  2IXI A;  2JWP A;  3P6B A;  4LA3 A;  1D2S A;  2RJ2 A;  3BIE A;  1IG3 A;  1S0F A;  3J7N A;  3WIN E;  3W5M A;  3POS A;  1J59 A;  4JKM A;  4G3Y C;  2ZAC A;  4XFF A;  5I8S A;  2VW2 A;  5DDJ 1;  1LOG A;  5M0T A;  1G9C A;  2PHF A;  1LOB A;  1QJY 2;  1MZF A;  2VY0 A;  1GMM A;  4WBB A;  3RPQ A;  1W03 A;  2ZX4 A;  2Y34 A;  3POI A;  1PIV 2;  5ANQ A;  5IUQ A;  2X09 A;  4D69 A;  3TEZ A;  1RUC 3;  3K75 B;  4FP2 A;  3ZYJ B;  2AGS A;  1J1T A;  2P6H A;  4YZ5 A;  4JHZ A;  4YW6 A;  5DG2 A;  2G9Z A;  4D6Q A;  1J3Q A;  1C5H A;  3FLR A;  3WQ0 A;  1OBN A;  1YO8 A;  3VV1 A;  5J7M A;  2Z69 A;  3W59 A;  1CX1 A;  3AMN A;  1POQ A;  3MIH A;  4YRD A;  1RUD 3;  5JIU A;  1LOD A;  2YRO A;  3ZYR A;  5A6Q A;  1GSL A;  2RR1 3;  3BTA A;  3I49 A;  1MS9 A;  3HOB A;  3VBR A;  5FP8 A;  5SV8 A;  2A3X A;  4XJZ A;  4GJZ A;  4OUM A;  4ZU4 A;  2P3Y A;  4LO6 B;  2CGO A;  2WSU A;  1S55 A;  4FPC A;  1GUI A;  1AHS A;  1S0J A;  4E4S A;  5LB6 A;  4Q4Y 3;  3J26 N;  3PLQ A;  3L9J T;  4IEO A;  5LAT A;  4CEY A;  1VBC 3;  2NQY A;  3FC0 A;  2P3J A;  4F7Z A;  1SDW A;  3CEW A;  1EAH 2;  1X50 A;  3WQ1 A;  4DO0 A;  5JUV A;  2WA3 A;  3UL2 A;  3KT7 A;  4LMF A;  3LB9 A;  3NNG A;  3WR0 A;  4Y5Z 0;  3USU A;  1S0C A;  4YW3 A;  1UOF A;  5EPA A;  5K0U B;  1R09 1;  4YZ2 A;  1RUH 1;  3I3E A;  3A7Q A;  1H8T A;  3MEP A;  4PIY A;  5FZM A;  2WWU A;  2LUW A;  2PLV 2;  2WR9 A;  2ADE A;  3D0J A;  3AB0 A;  1CPM A;  4IND A;  2A3Y A;  3ZXF A;  3LAG A;  1BK0 A;  1ENQ A;  1JOP A;  5CA6 A;  3HT1 A;  3JD7 2;  4AEM A;  1D4M 3;  2CNA A;  4GZ9 A;  2C9K A;  4AI0 A;  5CFD A;  2EXK A;  3U11 A;  3NO8 A;  1JYW A;  2BJS A;  1OA4 A;  2Y6K A;  2WNV B;  5FYB A;  3THT A;  1K12 A;  4LOS A;  1JZ8 A;  1LUL A;  1J3P A;  1W2U A;  2WNV C;  5ACA 3;  3B00 A;  4KI5 M;  3GBF A;  2H6C A;  1M06 G;  2EA7 A;  5LK5 A;  1RUI 3;  2UY9 A;  3PU3 A;  5FUI A;  3RZL A;  4LBM A;  3OJB A;  3SEE A;  1BEV 1;  3VDC A;  4IGP A;  2XPJ A;  4RQP C;  1MEC 2;  3I54 A;  4R9B A;  1F31 A;  2HWF 1;  1OH3 A;  1S0I A;  2YC2 A;  3KSC A;  4HL0 A;  2G1M A;  3DN7 A;  4P9G A;  5I0D A;  1UYY A;  3OGG A;  4XFH A;  4KU8 A;  4O9G A;  3N3H A;  1UU6 A;  1AXK A;  4LKE A;  1W8U A;  4ITC A;  2ET7 A;  4NII A;  2DBN A;  5CKM A;  3SKJ E;  2W1W A;  2BPA 2;  4NVP A;  1MS1 A;  4O7X A;  1COV 3;  2XVL A;  4GQ7 A;  4XZP A;  1WGP A;  3BOW A;  4CDU B;  5FP3 A;  4MO3 M;  4CDU C;  3R4U A;  1AVB A;  3O0W A;  3OYW A;  3RYR A;  3WP5 A;  4NHK A;  2D3S A;  4QPG B;  3ZYB A;  1X7N A;  2O14 A;  4QPG C;  1DQ1 A;  1KDM A;  1LGN A;  4OUL A;  4CU8 A;  3LGR A;  4LBQ B;  3MPP G;  3ZFE C;  4E2G A;  4GB3 2;  5A80 A;  2JE8 A;  2VJX A;  2ET1 A;  2IFW A;  4AI1 A;  2BV4 A;  2RS3 3;  3KV9 A;  3MUZ 1;  3OD0 A;  4YM0 A;  3N7M A;  1OLQ A;  2XUE A;  4LHS A;  4Q4V 1;  1ACC A;  3OGR A;  4UFH A;  2XWJ B;  3CDZ B;  2DCZ A;  3KT1 A;  2ZS6 B;  1SBD A;  1NCR C;  5FZ7 A;  4R9D A;  4GIQ A;  5GZC A;  1H30 A;  1CES A;  1EP0 A;  1VAM A;  1YFU A;  1FPN 1;  2DUQ A;  3LCP A;  4IV3 A;  4PBP A;  2J1T A;  3B9I A;  5FZL A;  1V9U 1;  1GWL A;  3KQ4 B;  1ZM1 A;  2QZ2 A;  2QUO A;  5FYI A;  4AQT A;  4WVW A;  5DZE A;  4GUL A;  1TME 3;  3EYP A;  2JX9 A;  3LOB A;  2I74 A;  3KV6 A;  4JDM A;  2FHR A;  3PTY A;  3PMS A;  1UMZ A;  4EN0 A;  2A6V A;  2LW8 A;  1G9A A;  2D7F A;  4ZXK A;  1WW6 A;  2ZGT A;  2YB7 A;  3FMG A;  2HWC 3;  2XKP A;  1QJU 1;  4IV1 A;  5FKB A;  1O3T A;  4AFA A;  3WT3 A;  4KWU A;  5CKQ A;  1G7Y A;  2CYF A;  2JG8 B;  2TEP A;  1PM7 A;  3C7H A;  1CQ9 A;  4I3G A;  1DQ4 A;  4COW A;  5FMB A;  1CAW A;  1ND2 A;  1HQW A;  3OF1 A;  3CJI A;  3ZSJ A;  1US3 A;  5A32 A;  2EIB A;  2HYX A;  3ST7 A;  4XJU A;  3IM0 A;  4S2G A;  3H8U A;  3TWI A;  3NV1 A;  4MET A;  1KIT A;  5A6Y A;  2R04 3;  1DQ2 A;  4Q4W 3;  5F9T A;  2TBV A;  4RR3 B;  4BIS A;  1RED A;  4MZU A;  4CUC A;  4YZ1 A;  3I59 B;  3WQ7 A;  5LAS A;  2XML A;  5E16 A;  1VMJ A;  1FV3 A;  3CLP A;  4QDS A;  4QQP A;  1TNR A;  2Z42 A;  4A2U A;  3WDX A;  5KC6 A;  3UKT A;  2WZP P;  1V6J A;  2AEY A;  4ISR A;  3ZXK A;  5FY4 A;  2Y6L A;  1OOP B;  2EVX A;  3LSE A;  4LLO A;  3MIF A;  4QDQ A;  1RUD 2;  1JZ5 A;  2OUJ A;  1I5P A;  1IS5 A;  1YIF A;  4IEU A;  1PVC 2;  3POY A;  5KBF A;  2P4E A;  3RWN A;  5FXX A;  2B45 X;  1DZT A;  2WDB A;  5LEJ A;  4AE2 A;  4MOA A;  4BDV B;  1V6O A;  1W06 A;  2PYT A;  1XNK A;  3Q8E A;  1CWP A;  1SEF A;  3RMX A;  4BPZ A;  3LFI A;  4FPE A;  3RYK A;  3MDP A;  2KR2 A;  4I30 A;  4FCA A;  4XBL A;  4Q4Y 2;  3JB4 C;  1GKB A;  5FP4 A;  5I0T A;  1AR7 1;  1HRI 3;  3IDE A;  5LBB A;  2EIG A;  1RUN A;  1EPW A;  1SAC A;  4XAA A;  5KC5 A;  2ZOE B;  2BP6 A;  4GMP 3;  1CAU A;  2NMN A;  3E5Q A;  1VP6 A;  3DGT A;  3P5B A;  2WC2 A;  4HN0 A;  2A75 A;  1YCI A;  1W9Y A;  3RI9 A;  5FRE A;  3H7J A;  1PHM A;  1B35 B;  5FO9 B;  1UY3 A;  1QKQ A;  1RVF 2;  2B5H A;  1B35 C;  1WW7 A;  2K0G A;  5T3N A;  4AR2 A;  2UUR A;  2XG3 A;  3CNA A;  4XBN A;  1YQ8 A;  3MLL A;  3HWJ A;  2BYV E;  3MW4 A;  4LQR A;  2JDU A;  2WSV A;  4QHZ A;  3POJ A;  4Q27 A;  3RQ0 A;  3WDV A;  3HN1 A;  1D4M 2;  2GDF A;  5H9P A;  2ZGN A;  3RZM A;  2VOK A;  3AFK A;  5FPL A;  1LKN A;  4AEJ A;  4URT A;  1C57 A;  4WVV A;  5AVP A;  1ZZC A;  3JBG 3;  2HBT A;  2X5I B;  3I2G A;  3OPW A;  5K7P A;  1Z0H A;  2X5I C;  5A3N A;  2DFC A;  1ZBA 2;  1IQD C;  1HQN A;  3H9A A;  2VZO A;  2ARA A;  2ZEZ A;  1VB4 A;  2BWA A;  2KA3 A;  4MH0 E;  1SFN A;  1C28 A;  2OYZ A;  1FV2 A;  1UU4 A;  3A23 A;  4JQT A;  4RA0 A;  4EWD A;  3BGA A;  5L7O C;  1LJ7 A;  3OUJ A;  4GA9 A;  3T1M A;  3VDA A;  5A3T A;  1W8H A;  1C1L A;  3F2Z A;  1HJF A;  1QOS A;  2JDY A;  4FPY A;  4QPI B;  1URX A;  3T30 A;  5CIS A;  1H8V A;  2QQN A;  1YI7 A;  4AI3 A;  4Y20 B;  3NWK A;  5F32 A;  3I8T A;  3LEM A;  4NUB A;  2XBO 3;  5CG8 A;  4LBN A;  3UJQ A;  2AEN A;  2Z5W A;  2ZGQ A;  1AR6 1;  1IS6 A;  1KJR A;  2YGL A;  4A7Z A;  1ZBE 3;  4F83 A;  3PUQ A;  4JTO A;  4CCM A;  3K51 A;  3B93 A;  2WNU B;  3IIA A;  4AWD A;  1I1E A;  1UCX A;  1GNZ A;  3CZU A;  4BQX A;  2IXL A;  3SIS A;  1HB1 A;  3AP5 A;  4PLM A;  2QDN A;  3FLP A;  3RZH A;  1NY7 1;  1S0E A;  2Y6F A;  1MZE A;  4XUO A;  4Z07 A;  4CP9 B;  2FDF A;  2RS3 2;  1HV0 A;  4HSJ A;  4NMI A;  2V4V A;  1QNW A;  4PIZ A;  5D2A A;  3SIT A;  2LAL A;  1SCS A;  2G19 A;  5I93 A;  4UYB A;  1WW4 A;  4X8P A;  4DNY A;  2WNV A;  3PDQ A;  4WVM B;  2UY8 A;  2ZHL A;  4PJY A;  1ASJ 2;  1RHI 2;  1JYN A;  3N9N A;  4KBZ A;  4FXK B; 
#chains in the Genus database with same CATH homology
 2Q1F A;  2C24 A;  1V0A A;  4LJH A;  4CPB A;  4LK6 A;  4LKF A;  1GWM A;  4LK7 A;  4YW7 A;  4BQ4 A;  2JWP A;  4BQ5 A;  2LRO A;  1WZX A;  1W9F A;  3ORJ A;  5D21 A;  3ZYB A;  1GWK A;  3F95 A;  4CP9 B;  4CPB D;  2O14 A;  2VXJ A;  2K46 A;  1W90 A;  1WMX A;  1GWL A;  1W8W A;  1W8Z A;  3UT0 A;  2KR2 A;  3ZYH A;  4LKD A;  1OH3 A;  1WCU A;  1L7L A;  1HN0 A;  4YW6 A;  1W8T A;  4BQ3 A;  4YWA A;  4BQ2 A;  4CP9 A;  3ZYF A;  4A6S A;  1UOJ A;  2LRP A;  1OKO A;  4LKE A;  1W8U A;  4AL9 A;  2WYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...