1WZXA

Crystal structure of family 30 carbohydrate binding module.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
RKLLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 35
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wzxA00
1W8ZA 1W8UA 3ORJA 5D21A 3F95A 4CP9A 2O14A 1WZXA 1W9FA 4LJHA 4YWAA 3ZYHA 4CPBA 4CP9B 1L7LA 4CPBD 2Q1FA 4BQ3A 3ZYBA 1W8WA 4BQ5A 2LRPA 1HN0A 1OKOA 4BQ2A 1OH3A 1W90A 1V0AA 1GWMA 2KR2A 2LROA 4YW7A 1GWKA 1UOJA 4LKEA 4LKFA 1GWLA 4YW6A 4AL9A 4A6SA 1WMXA 2C24A 4LK7A 4LK6A 1W8TA 1WCUA 2VXJA 4BQ4A 3UT0A 2JWPA 3ZYFA 2K46A 4LKDA 2WYFA
chains in the Genus database with same CATH superfamily
3JD71 1PZ7A 3VBHA 3ZYJB 4S2GA 5FO9B 2P2KA 1IPJA 2W46A 2W91A 1OQDA 3HPNA 5KXCA 2ZCWA 4CU8A 1HB2A 5JZGB 2NPIA 4O65A 2V5YA 4SBVA 3DXTA 1LKNA 3BI3A 4IL7A 3AKQA 5ACA2 1W6PB 1S0EA 2WWUA 1S0FA 3N7JA 3AYCA 4N43B 1WA4A 4LBJA 2LM3A 1XC6A 1H6XA 1LAJA 4CEWA 1BEV1 2RMU2 5FZKA 1S2KA 5T52A 5IAXA 1K12A 2DFCA 3CL1A 4UFIA 5D2AA 2ZZJA 5IT6A 4YGDA 3CQOA 5CIRA 2PHTA 1H9PA 4NIGA 5FPBA 2D7FA 2VCCA 4LA3A 1SMVA 1BYHA 4LOSA 4QX2A 5EFUA 2WL1A 3RQ0A 4L0PA 3AL6A 2R073 4B29A 1NE4A 3V0BA 3I4IA 3B7MA 4DIQA 1H2KA 3USSA 1OH4A 2WC2A 3LA3A 4Y20A 2O14A 2OT7A 2JKBA 2O1QA 3KQ4B 1H8TC 3PUIA 1CX1A 5IVBA 5FP9A 4BIFA 3UNPA 4N90A 4YVSC 1ND3C 3HIFA 5LA9A 3NJYA 3MI8A 3VBFB 5CFCA 2F6BA 2A75A 1V00A 4YW2A 2Z69A 1QU0A 1AR91 2ZGQA 2HWC3 3MUY1 1FNYA 4Q4W1 5DG2A 1DQ2A 2I45A 2R1BA 3BPSA 2QQPA 3PTRB 1ND2B 1PNFA 1FV2A 5TSWA 2WZEA 2YY1A 2QQIA 3VD3A 5BY5A 4K8FA 1RHI3 5L9BA 1GICA 4QPGC 3M8LA 3FLPA 4I0AA 5SV5A 5IVVA 5J7MA 2Q1MA 4XBNA 5JPMB 1RUC2 2J1AA 4E4ZA 1RUOA 1ZM1A 1FAYA 1OA4A 3CJIB 3EB7A 1MZ5A 3KV6A 4HN0A 5H9RA 4EN7B 1XYOA 2IZWA 4QX5A 5C4WC 4IEXA 1VP6A 4NPRA 3ZXDA 1DFQA 3S5AA 4MGSA 2QZ3A 2D3RA 4YZ1A 4GKYA 4ONUA 2BVBA 1FPN3 1KDMA 3DGTA 4V2WA 5CYYA 2WS93 1JS9A 1GP6A 4LA2A 1VBB3 1W9SA 5J37A 1A78A 1U5XA 3VUOA 3SCGA 4CDXB 5A1AA 5DMYA 4ASLA 1DGWX 4IV1C 4ZXEA 4QHBA 2YC0A 2DFBA 4HT1T 3V0BB 1AUYA 2VMCA 1AYM3 5DUXA 1X36A 1RUH2 2QDRA 4OI1A 2HWF3 4Y20B 2MEV2 2ZGRA 5IYYA 1VRH2 1A6CA 3VD4A 1TEIA 4IEZA 2GC0A 3VZMA 5C6CA 4GB32 4RHV2 3GHMA 1KS4A 3NV2A 2PHLA 2HLEA 2WO3A 1QQP1 4QQ2A 1BMV2 1S0IA 1ULFA 5F8PA 1R1A2 2X5IB 5C7GA 3C7FA 5A1FA 1NZCA 1PMHX 3KWVA 3LEMA 4Q0SA 2RR13 3GCWA 3VD5A 1Y4WA 5CAZA 1GZWA 2V4AA 2HYKA 2HWE1 2IXKA 2VZSA 4AE2A 5BNNC 5F1RA 3I59A 2XPJA 4O7XA 1IG0A 2QTWB 2C6SA 2PLV3 5FY4A 4GWJA 5FUNA 1SLLA 2PFWA 1HXS3 3MDPA 4LOTA 2WNUC 4D7TA 1UIKA 3AZXA 2J1TA 4DFSA 2ZAHA 3BTXA 3PDQA 4Q29A 2BYVE 1DZTA 3WT3A 3HN3A 5FOJB 3BIWE 3FC0A 2GN7A 2VOKA 2MPFA 1EUUA 3G7DA 3OD0A 5FUPA 3AFKA 2F4LA 4PIXA 2RV9A 3GJAA 3NJXA 3VBUC 2WRAA 1I6XA 5IVCA 1XSRA 4RQPB 4K1YA 1CAVA 2YBSA 4GKXA 3KHBA 4WZFA 1WW5A 2VO5A 3M70A 2RM23 2XXZA 3WDVA 1WLWA 4PQQA 1EY2A 1A8DA 4EWEA 1ZRRA 5EZWA 4E4HA 4XZPA 1IG3A 1S0DA 3ON7A 4GIQA 4HMZA 1NCRA 2D98A 2E7QA 1GP4A 1ULEA 2XH6A 1GBGA 3D82A 4FOVA 4LUMA 4YFWA 5HXVA 3TEXA 3ZYGA 5HV4A 2AEZA 1A3KA 2DCJA 1Q3EA 4IE4A 4MLOA 1ALYA 1UOGA 3LPGA 2GP5A 2ARBA 2WZR3 4TTGA 3J7LA 1S0GA 1COV3 5BNPC 2FDHA 4Y5Z0 2WT2A 3MIBA 4UW6A 4AEDC 5IVJA 4P9YA 3FUOA 2DUPA 2ZJCA 5A7SA 4UFMA 2HBTA 5JMOA 3O1MA 1H8TA 2V73A 1LOEA 2V4VA 3KVAA 4FPKA 4Y4YA 3VHNA 3I3QA 3ST7A 3V56A 5GZDA 4C0HA 5L9VA 5LEKA 1PVC2 2ARXA 1YYNA 4ASMB 1O3SA 3KT4A 1MS1A 3I59B 1GZTA 1ZBA1 4LR4A 3LWCA 1FV3A 1PM7A 4WZCA 3I2KA 3WCRA 4IGQA 2QQNA 4J1WA 1US2A 3ZSLA 4XZUG 2SBAA 3ABZA 4AQSA 1RUJ2 4DINB 3JQWA 1TME3 4Q0VA 4L9BA 2YUEA 1CD3G 1EV13 4LEJA 2LROA 4XXAA 4BMBA 1OOPA 3AMMA 2VUAA 3JCIA 4LO8A 4W4ZA 4LKFA 1PIV3 4HN1A 5DDJ2 3W59A 5FKBA 4XJAA 2AUYA 2GNBA 4QPGA 4BMEA 1JBCA 1HRV2 3KT7A 3OCPA 4G4FA 5I8SA 4D0QA 4LLFA 5C3SA 3ZXKA 1ZVFA 2VBBA 2G4IA 1SCRA 2ZZQA 4Q4X2 3LSEA 2ILMA 1W9WA 5F3IA 5FZDA 3CIHA 3M3OA 5C5TA 5T5JA 2R32A 2RS51 1RUNA 5K0UA 4LIUA 3N4MA 2OPKA 1V6LA 4Q26A 3W21A 3C7HA 1NCRB 5A3OA 4D6QA 3FMGA 3ZMOA 4OHZA 5JWPA 2QE3A 3H1YA 1PGL1 2KR2A 2WAAA 2ZKNA 3TYJA 3RI9A 1H2LA 2E33A 3VGIA 3HBZA 1X8EA 5LZ6A 2ZGKA 3MW3A 2ZEWA 4EE2A 3VBSC 5HI0A 3KMHA 3ZXAC 1AR81 1RMU3 1XNCA 1YJKA 1C28A 1YCIA 3OYWA 1CR7A 2BOJA 3BVCA 2HWB1 3WNMA 4XHBA 4YM2A 3CMGA 3ALQA 4CRQA 2HWD2 5F5QA 4FPCA 1H9WA 2EAKA 2IVIB 2WNVC 3SH5A 4XURA 5A33A 3KHCA 1LOAA 5F6LB 1D0HA 3P3PA 1UMZA 3N9OA 2NYYA 4LPLA 1QXPA 4NN0A 1HN1A 4NUBA 2RDSA 1OOPB 4QXKA 4TWTA 3T2PA 1YFUA 2WNUA 3NKGA 1MACA 3I2FA 2WQ8A 5HCFA 5JVVA 4C0BA 2IVJA 4DRVA 2JG8B 4K8RB 1WMDA 2BOIA 3QH7A 2ZHNA 3ZFFC 3ETPA 1AXYA 4AWDA 4COUA 3O1TA 3B5LB 5GLUA 3DYPA 4KGGA 3WUDA 3S0MA 1EYBA 1VBA3 4J25A 4QXCA 2OW4A 3VBUA 2AYHA 3AC0A 1F35A 2SLIA 3CF6E 4QM9A 3T3YA 5K0UB 1IKQA 4HPKB 4CDUA 2ZS6B 5FYTA 4F3JA 3I49A 3M3IA 5FJKA 1LU2A 1ZA4A 1KJRA 4AQ2A 4ARYA 1PO12 2EIGA 4XUNA 2J1RA 1I5ZA 3GZTB 4Y1VA 3VN4A 5DAWA 1OC1A 3AKSA 4NHYA 4QD2A 1M4WA 1XNAA 2GU9A 5A3PA 1LGCA 2J7MA 3RWKX 3UETA 4Z2WA 4MSVA 3GZUC 2Y0IA 3MBWA 4CDWA 3RYKA 1MS5A 5BNPA 5LEJA 1CAXA 2GAUA 4LULA 4YGCA 2E63A 3OYWB 1SHWB 3LPFA 1W0PA 1ASJ1 2EIEA 4YW4A 5FFOC 1DDLA 4CCNA 3B93A 3IIAA 5FYZA 4DUXA 3QLQA 1AL23 4YLZA 3AX4A 1ULGA 3WXPA 1NLSA 5FLIA 4PCRA 4UYBA 5E6HA 2R16A 1NG0A 1RUG1 1ZBE3 1NA1C 2YV8A 4JGZC 1JZ6A 3FHAA 2Q8EA 3RSJA 4YM3A 5ISLA 4EJRA 4AFAA 2ZX4A 2VUJA 5A3WA 4AFMA 3I2GA 5J1XA 1ENQA 1VBE2 4XHXA 5CU1A 5FMOL 3ZIXA 1V9U3 3JBG2 4RL7A 4AGGA 1ZZ6A 4XVHA 1JYIA 3R4UA 1AZDA 1LULA 1GZ9A 4HK8A 4Q8KA 1N47A 1IS4A 1XSQA 1H4HA 2ZACA 2XVKA 4CDUB 1EUTA 2PMWB 4P02B 2Q8OA 3ZPYA 3ETQA 1AR73 1S55A 3PUAA 4QKNA 1HB4A 4MXVA 1UU6A 5FTTC 5IUQA 3U14A 1FOD3 3AXDA 1SBEA 4Q2FA 2KXLA 5DZEA 4EWAA 2VVDA 3M2MA 1HX6A 4NE9A 5K8SA 1OSGA 5FO7B 1JOJA 1WCKA 1VMJA 1YQ6A 1I1EA 1JYTA 1B35C 1O3RA 3BN6A 3LEKA 3J4UH 5FZCA 1NCQC 2WR9A 2YMZA 4HG6B 1TE1B 5A3NA 3O1OA 2P3KA 1W2OA 2HEYF 3HJRA 4S2HA 4U36A 4CDWB 4CSWA 1H30A 3VBRA 2VE1A 1CAXB 4Q4V2 4NIAA 2CGPA 3VZOA 1WKYA 2VM9A 3I2OA 4FPLA 3VBSA 4XTMA 2R071 1DZRA 1GV9A 2VC9A 1QJU3 3ZSEA 5A1LA 2H0BA 4FPHA 5AC93 1KD7A 2B9VA 2WABA 1BQPA 1OQ1A 2RDNA 5EP9A 3ASIA 2VBDA 1YWKA 3ZKYA 3ZSKA 2ZGUA 4YZ4A 4XC9A 1RXFA 2C5DA 3WW1A 2GH2A 5FY8A 3KB5A 4A6OA 1O3QA 2BW8A 2CWSA 2PQSA 5FZ9A 3TWIA 4AGVA 5FR3A 1G9DA 5KHKA 1SFNA 3LDBA 4XUPA 5AVAA 1F5FA 1JODA 2ZGOA 3NV1A 2XKOA 4JGYC 5JI7A 1RUF2 3CKHA 3WVJA 1GMMA 2TNFA 4RR3C 1G86A 2HWC1 2EAAA 1DGRA 4TN7A 2CU5A 1UKGA 2G9ZA 3KVBA 4YVWA 5T54A 1NUKA 5DUWA 4YZ5A 4H7LA 4PI0A 4AQTA 1MS3A 2XBO3 4QPIA 2EF6A 2DF7A 3AKPA 1K45A 4FPEA 2D3SA 1F2NA 4QDSA 2ETEA 1D4M3 1SDWA 2XJQA 5A7PA 1RHI1 3BALA 2E6VA 3U1XA 1NLRA 3VDDC 2D5HA 4NHMA 2AH2A 4LBMA 4DXSA 4B3NA 2WO2A 4ZKTB 5JMCA 5GZEA 2J22A 2NLRA 2PA7A 2XMLA 1O4TA 3GYDA 2PQQA 5C71A 1OURA 4P9IA 3O0VA 1WLDA 1OBNA 4RD7A 1FPN1 3GALA 4NJ4A 3IPVB 2WS91 2YBKA 2EALA 3ORJA 1L7RA 5F5CA 2PHRA 3ACFA 1JUHA 3J7NA 1KGYA 1VBB1 3BGAA 3PNAA 4OUMA 3ZXLA 2JIGA 4GAZA 3WDUA 3ZX7A 1O6UA 3OGSA 3I3EA 5EV7A 2JECA 1MS8A 1OLME 3K48A 1SEFA 4HETA 1AYM1 5DAPA 3B94A 3GBWA 1RUE3 4Q4Y2 4TLGA 2HWF1 2R062 3DKWA 4HONA 3BB6A 5E16A 1BBT3 3DCQA 1MQTA 3BOPA 4QB6A 5H9SA 5JZGC 4XUTA 2ZGSA 4ZU5A 3RVHA 3BKZA 4OHXA 4XACA 5IFPA 2BERA 1CN1A 1JUIA 3CDZB 2HEVF 3NRUA 2P17A 3BODA 5I0SA 4N43C 1DQ0A 2RR11 3WCSA 2BFUL 3M3QA 1S2EA 2RMU3 3O5SA 1XE8A 4YVWB 3ZYHA 3B9CA 4QB2A 2WINB 3NNLA 1Z7S2 4EROA 2PLV1 2RS33 5FLJA 4QPIB 2OS2A 5FP8A 1YI7A 2D6MA 4P5HA 5SV8A 3ZFEA 1HXS1 4CU9A 3FLRA 5IFTA 3GDBA 1HDKA 4CZSA 2WUHA 3GZEA 3WQ7A 3DKQA 2E31A 3WUCA 4Z2AA 1HRI2 2XJTA 5C9AA 3WG2A 5BNOA 4DXTA 2QQVA 5F7UA 1LGBA 2VNOA 2GH8A 5J09A 3AXEA 1W8OA 3FX3A 4QHZA 3U4SA 1YJLA 3I2JA 3POFA 4N53B 4CDQA 3VDCA 4AQ6A 5CBLA 3VBFC 5L7OA 1UZ0A 3MEPA 2BGPA 2FHRA 2RM21 1WCQA 2YFZA 4MV2A 3T4VA 4D69A 4QWNA 1B35A 2ZA9A 3FFZA 2VZOA 4UW5A 4OLLA 1WLTA 3J9SA 2VW1A 3WG3A 1ND2C 4E2GA 2A3WA 2WFF2 4E9KA 5F3EA 3TOJA 5FUIA 5JSPA 3VBOA 3AP6A 2B39A 4XF4A 1FXZA 4BQ1A 4XDPA 1C8M2 5FQ0A 2WZR1 1HB1A 1MQTB 1W6QA 4XFHA 1QXJA 5LBBA 4ZU7A 1AR62 3KF5A 1W8FA 2DTWA 1COV1 3K46A 3H8OA 1CVNA 3CJIC 2WKKA 3UJOA 3ZIWA 2D3PA 4XQWA 5IATA 1RUC3 2RJ2A 1MZFA 3FN9A 2BJSA 4YNIA 4Z1VA 4LXLA 5JOYA 1STMA 4QPWA 1U5YA 2IFRA 4FI9A 4C1XA 5FZAA 2BEOA 1W2UA 3I54A 4PJYA 4QU1A 1CAUB 4UBHA 2EVXA 4UFJA 1FI2A 4P14A 1S1AA 4CDXC 4DY3A 4LMFA 3WX5A 3ZFEB 3FBYA 1DYKA 1OLRA 1QDCA 3ILRA 3TN92 1K5MA 1TME1 3SHRA 5FYYA 4EWDA 1EV11 2E26A 1LU1A 2D93A 5JLVA 3OY8B 4XDQA 3RG0A 1AVBA 2EIBA 1WCUA 3PVBB 4OHVA 1PIV1 3ZSMA 4AHZA 4X8NA 2BTVC 5C9AB 3ZN6B 4P00B 3PLQA 5BNOB 3KS7A 2WYFA 4PLNA 2ZABA 2QQUA 1MR5A 2JDNA 5T50A 2C9AA 4CDQB 4GWIA 4WM8B 4GB33 5IVFA 4RHV3 3U11A 5A7QA 3WNPA 4YWAA 5L7OB 5C33A 2IXLA 2X5IC 4LQRA 1NXD1 4RGAA 1UF2C 4BDVB 1G9FA 4PHZA 4OQ9A 1LOBA 5FLHA 1VB2A 1R1A3 5DZGA 2ADDA 2VCMA 5G04L 1ST8A 2VCBA 5CKNA 2KD7A 2I07B 3T08A 3V65A 2ZGMA 5AVPA 5KHGA 4MGIE 3VBOB 4BB3A 1AR92 2GC2A 3RPQA 1SCSA 4Q4W2 1QJX3 5FQ0B 5FYVA 1OF4A 5FZBA 3S7EA 2J1UA 4GJYA 3UESA 4BQ4A 4HVQA 1YIPA 1HB3A 2Q1ZB 3SC7X 2W47A 1DQ4A 5DAVA 3ACLA 3KGLA 3THPA 2W94A 4XPVA 5LW9A 5JZGA 2DU0A 4AF9A 2VXRA 1RMU1 3OSDA 4CPBA 1Y43B 1HIXA 4CVUA 3WY6A 1W6PA 3C7GA 4RQPC 4S2DA 2H6CA 2X8KA 1VMFA 5T5OA 5A70A 5A7NA 1OMIA 3U10A 1ULCA 3UJQA 3ZM8A 1UCXA 2AR6A 2PHFA 3WINE 3WV6A 2OZJA 2X53S 2WSVA 4IETA 4RYDA 4DMIA 1AYN3 4CUCA 2R043 3T0DA 1WBFA 2ET1A 1GNHA 4LK6A 5G05L 5LK5A 3OBZA 2EXJA 5K4LA 3OEBA 2ZMKA 4G9SB 3IKWA 1W2TA 5ANNA 3ENRA 1E57A 5K9YA 3O1RA 1U5ZA 5FYHA 5A6YA 2WLPA 1GLHA 4ZU4A 2V5DA 1YQ5A 1W05A 1IS3A 2Y6GA 4LIVA 5FOBB 2QQOA 1ZREA 1F15A 3CZUA 3OGJA 2FCTA 1YUDA 1RGSA 1SLCA 2R0HA 1K3IA 1VBA1 4Y5SA 5JPNB 1Q56A 1X50A 3MZHA 5H9PA 2YGMA 4LO4B 4UBGA 4KWLA 2RVAA 4YM0A 1W2AX 1QQP2 4JDMA 3WOGA 4DRRA 5JUVA 3DL3A 3SNMA 1POV3 1QKQA 1F8VA 2W95A 3WNNA 1J3PA 1SLBA 4FVVA 2XDVA 3BTZA 3RZGA 5JAXA 1ND2A 2HWE2 1NAEA 1QHDA 4GD4A 2H6BA 3V0AA 1BLZA 3WEZA 1WW7A 4J1XA 3GM8A 4X6QB 4AVAA 3FHIB 1O3TA 1DLLA 2BV4A 3LCPA 2A5ZA 5C8CA 5DDJ3 2YG0A 1NXMA 1O4YA 1WCDJ 3MHZA 3POBA 1HRV3 3AVRA 3AMNA 2W39A 3CJIA 2ZX0A 1JU4A 3UGFA 3LEIA 1D7PM 5JXJA 1JZ7A 1IOAA 3ILNA 4V1PA 1EPZA 1AL21 4PIZA 1J3RA 4LBOA 4I02A 4QQLA 4YGBA 1KRIA 5DUUA 1NCRC 5IK7A 4WBBA 4CCDA 5D1IA 5FMDA 1URXA 1ZBE1 1N3QA 3I3DA 4MZUA 4CDXA 3PTYA 1HJFA 4R8HA 4ISQA 3SKJE 1IQDC 2ORZA 2WAOA 5GKAC 4FP2A 3NJVA 3OD4A 2Q8CA 5F3CA 4AFCA 4H14A 1LHNA 3RDIA 4P9GA 4CYDA 5EJ3A 2XGXA 2Y34A 1V9U1 3LA2A 2VMFA 4Y1ZA 2ID4A 4TYSA 3LIGA 4JRLA 4QAWA 1LRHA 1LCLA 3W9AA 1W06A 4QQOA 2GNTA 1OQEA 2NM1A 3A4UA 4GWMA 4UXAA 2RE9A 3M1HA 4OZXA 1SQ4A 2G1MA 3E97A 4LBKA 2X5IA 4XJWA 1VBC1 5FZ4A 3D6EA 3OB8A 5C3QA 5JOXA 1AR71 2C24A 1LHWA 1H2NA 5FYSA 1AX2A 1ZZCA 4K9SA 5FPXA 1DLCA 1FOD1 4KBZA 5IAVA 3SKVA 2F4PA 4BLJA 2XHKA 3H3ZA 2WLQA 1JHJA 3H1WA 2GC3A 2J1EA 4GULA 1W8UA 1XB9A 1ZBA2 4HZFA 1OOPC 4I01A 4BWOA 1QEXA 1UZVA 1WW6A 4JX0A 4YG0A 4E4DX 3T2QA 3V0AB 1AJOA 1WZXA 1XJAA 2LALA 1EPWA 2D6PA 3Q8BA 1POV0 4W8JA 5FY1A 4CEYB 4E2SA 5LA0A 5C8CB 3WDYA 1QJY3 2JG8C 4K21A 4MGKE 5HXMA 1SFPA 1W9YA 4ISRA 2DVGA 4BXSV 5KC6A 1GANA 4XILA 1X9PA 2F17A 1QJU1 1Y9QA 5AC91 3LAGA 5K0UC 4MH0E 3H1MA 4RQPA 2Y60A 3PIJA 5J98B 4KH9A 2YBPA 1W3VA 4Z8BA 4XBLA 3RZMA 4QKDA 3IDCB 2XWJB 1JMUB 4AHYA 5FXXA 2VOXA 2HJIA 2QJVA 2OKXA 3U75A 4CXYA 1J83A 2WIIB 4MXWB 3W20A 4QPYA 4UFLA 1JYVA 2P37A 2Q1FA 5FZHA 3FLTA 3ZYBA 3ILFA 2VZTA 2Y6FA 4OHWA 1PO23 2JG9A 1ZZ7A 1RITA 1VE0A 2XBO1 4YW6A 3RWNA 2AREA 3MICA 1T6GC 2DBNA 2GN3A 3THDA 2K2SA 3WF2A 1FMD2 2WQZC 1UYZA 3POGA 5EJZB 3ZYPA 1SBFA 2JE7A 3K75B 1AR82 3POIA 2DDUA 4Y22A 1QJZA 2VMDA 2ADEA 2R6QA 3LGRA 4W6WA 5CNAA 3WQ1A 1GSLA 2Q30A 2BBAA 1SG3A 2ZTNA 4B1LA 4D7SA 2HWB2 2W9XA 3AP5A 3BPZA 3GBGA 4YZ3A 2GNDA 2MNGA 4BQ5A 4BQ2A 2FCUA 3K3NA 1GWMA 2OUHA 3JB4C 3OEAA 4FFIA 1TMF3 4XUQA 3KD4A 1W2NA 1CZSA 1BJQA 5FV3A 4E8CA 3KLSA 3AMQA 1VBE3 4IERA 5I0DA 4XW3A 5EXOA 3JBG3 1ZA7A 1RUE1 4MHRA 1J1LA 4NIIA 4CDUC 4F7ZA 2YDEA 1JU3A 3OBRA 1BBT1 2A71A 3WD5A 5IK4A 3AP4A 3HOBA 1OFNA 4M4PA 2W2IA 2PHXA 4N9IA 2FBEA 1UX7A 1CAWB 4L2NA 4CP9B 3POEA 3LFIA 1H1MA 5E89A 1NY71 1ZRDA 1HN0A 3I7DA 5LY2A 2G19A 4YW1A 2JB4A 4ASKA 2JG9B 3DPRB 4OCTA 4AVCA 4CDWC 1QIQA 4GJZA 3C8XA 2RS31 4IV3B 3WP4A 1RL3A 2R1DA 1RUI1 2FMYA 2W5FA 3LB9A 4B8EA 3WP6A 4Q4V3 3VZKA 3OGRA 5IK8A 2K46A 2GMPA 4PDWB 5KHHA 4O9EA 1Q8PA 5LASA 4Y22B 1XU1A 4JQTA 4FFHA 4FPGA 5LA2A 5LRSA 1ASJ2 4MUVA 3AM2A 1JXNA 2VBPA 3J7HA 3VKMA 5FYBA 1XNDA 3RMXA 3KV9A 2BP6A 3AZWA 2JDPA 5F3GA 1YEWA 1QDOA 3PUSA 2VVFA 4UW3A 4UWDA 5DQ0A 4RFRB 2ZMLA 1Z78A 2D44A 4R4XA 5E1RA 5FZ7A 3K4DA 2OVUA 4Q8LA 5FYMA 2ARCA 5J3UA 4P5YA 3R6SA 5FYCA 1DGRN 1I3HA 3PMSA 4UT5A 2VECA 4UF0A 1AF9A 2JG8A 5J36A 2BUKA 1WLCA 1RIRA 3PUHA 5FYIA 5LA1A 2JWPA 5FPVA 1O5UA 5CZKA 5AFBA 4ZS3A 3HT2A 1RC6A 3D5OA 1XOYA 2EXIA 3RJRA 1IGOA 4HPKA 1OHFA 1OLQA 1T2XA 2D6NA 1DHKB 1ZRIA 3LE0A 4XQDA 1RUC1 1OI6A 5HCBA 1QXRA 2ZAAA 1PMJX 5EWSA 4JKMA 5F5IA 2VNGA 3WW4A 5C3OA 5CG8A 1GQGA 2QBXA 5FY7A 2H0VA 3W5NA 2QFEA 5C3RA 3VBRC 2JICA 5CISA 4HFSA 5IK5A 4QKFA 4NROA 2PAMA 1V70A 2WA4A 4U2AA 3SMHA 2DU1A 2QQMA 2Q8DA 4YW5A 1BXHA 3FUQA 1X8MA 1JHNA 1MEC1 1RVF3 2IXCA 3AP7A 4AEJA 1VAMA 3GNEA 5AFEA 2B7YA 1L7LA 2E32A 2R072 3HBKA 2XVLA 3I3BA 2YU2A 1L3JA 4RA0A 3TNPB 2RJKA 4GB31 1W0NA 1WBLA 4RHV1 4PBPA 1RXGA 2VMGA 2OYZA 3IT8A 2VG9A 1CPMA 2VQTA 1SBDA 2QCSB 2JE8A 3GJBA 1G9BA 1V6OA 1R1A1 2BDRA 4YZ2A 4RS5A 5JCTA 3HR9A 4M3CA 4RN5A 4D6SA 3ROUA 4XIKA 4DXRA 2PYTA 4YVWC 4AK3A 5F37A 4LUKA 2FDGA 5GLWA 4UF0B 2PHDA 2YU1A 5BV6A 2WJSA 2P1BA 3MLJA 4QPIC 2JX9A 4XBQA 1MZ6A 2D97A 3X29B 2UY9A 2HWC2 2WYSA 1JW6A 2CDPA 2EXKA 1QJX1 3MIGA 3WF3A 3T0AA 3E5UA 4CXWA 2DURA 4XFAA 1KQRA 5GZCA 2OPWA 4BK4A 4TLFA 4LBQD 2XOMA 3OUIA 4B4RA 4IE6A 1S0JA 2A3YA 4XQ4A 2JDYA 4MYEA 4HL0A 1R083 3Q8AA 4LHLA 3RGBA 2FZ2A 3TBDA 1OUSA 1RHI2 3OGGA 1HRI3 1UQXA 1WMEA 5BYNA 2CHHA 2YGLA 4N53C 1VPHA 5JI9A 4PF5A 3ZKUA 1EAH3 4K40A 5FZEA 2JJ6A 3WW2A 4BM8A 4EN0A 4P08A 4I0BA 3B02A 3OPZA 1REFA 2P4EA 2WBKA 4NPMA 4YRDA 4E27A 1WUVA 4AI1A 3BYWA 3BOWA 2DV9A 1AYN1 1FPN2 2UWAA 3IDBB 2R041 4SLIA 4OI4A 3HAGA 3THTA 4QKBA 3FHQA 3LDKA 2HYXA 3CU7A 4LJHA 1KFUL 2GC1A 3PVOA 4AOCA 4BQXA 3S6PA 1MQTC 4OI0A 3WNXA 1PM4A 1H1AA 2VNRA 4LITA 1ENSA 4NR1A 1AYM2 2Y33A 2NN8A 1AR63 3POWA 1IPKA 3TEZA 4BISA 1KFXL 1HQLA 5DN2A 4YSFA 4XMIA 2PN5A 1PX4A 2RS12 2VZ3A 3VB9A 1SLIA 1VBD3 1GNZA 1W03A 3HVDA 1C3HA 4RS5B 1W8TA 2ZMNA 3OG2A 4M3CB 4BQYA 1G7YA 2P5BA 2MHFA 2HKXA 3LFMA 1POV1 5F39A 4AI0A 3FL7A 3ZFEC 4D94A 2RR12 4EZ4A 1QJFA 3GF6A 3Q8CA 5GLTA 3ZDVA 3ZXJA 4M3CE 3RYPA 2EIDA 1NYWA 3WDXA 5M0TA 3JU9A 3TN93 5LRRA 1VAVA 2ORXA 4FOYA 3URFA 2PLV2 1PHMA 1WA6X 2W68A 4K1ZA 3UK9A 4MGYE 1G9CA 1HXS2 2XLAA 5C9AC 3MIEA 4HXCA 5BNOC 1Q5OA 3R4SA 4KU7A 5DDJ1 3KGZA 3NW4A 3U07A 1P8JA 1O91A 4CDQC 4WM8C 1HRV1 4QQHA 2C4XA 4BOWA 5A32A 5L7OC 1UW8A 3B69A 3BCWA 3PJYA 4FAHA 1HV0A 1DYPA 4QX3A 3O12A 3QH6A 2C0ZA 4NMIA 4ORFA 1R1ZA 1JZ3A 1W8NA 2IUWA 5FZGA 2CV6A 3H42B 1OLMA 3IPVA 2WFPA 4IW3A 4MGZE 4Y1XA 3KQRA 5EYXA 5I0UA 1UN1A 1SACA 3EMRA 2UYAA 5JXIA 5APAA 1O7FA 3SQOA 1WGPA 2R30A 3VBOC 3MW4A 5KBFA 2G9FA 4XFIA 3EJKA 4XJZA 4GH4A 4JKKA 4LTAA 4YM1A 3TB0A 4AVVA 4I3PA 3AVSA 4IEQA 4D3WA 4I2OA 2E9QA 1X82A 5D8AA 5BXXA 4AL9A 5L73A 3HEIA 5IVEA 2WZR2 1XU2A 3I8TA 3POSA 2IC1A 1GYKA 1COV2 1LENA 1UAIA 2VXJA 4HSJA 4IESA 3SXWA 3H0OA 2IFWA 1W6MB 1YLLA 1ENRA 1LOFA 2X09A 3AKTA 2OX0A 1YQ2A 2VNVA 5A7OA 1KJLA 2O8QA 2Y6KA 5JOZA 4R9AA 3VV1A 4OUEA 1K5MC 3IMNA 1SFYA 1KEXA 4H55A 2VJXA 1DGLA 4BHPA 3Q8EA 2UU8A 1APNA 1F31A 2VZRA 1ODNA 3WW3A 2HH9A 5KWRA 2GSYA 2VUDA 1QJY1 4NRQA 4QXHA 5FO8B 1NQJA 1EV12 3N7KA 1MVEA 5CEHA 4EYUA 1UIJA 3OGVA 3AJZA 1XE0A 1RUD3 3IAPA 5A32B 2VZUA 1PIV2 3DYMA 3THCA 5C5UA 5GLZA 1W04A 3H50A 1TNRA 4N53A 1SDDB 1PGW2 2EXHA 2NZ9A 3DECA 1QOOA 4I0WB 4A3ZA 2YYOA 2BZDA 1CIYA 3AL5A 4GH4B 2ZEXA 5FWEA 1F4AA 1BHGA 4NPLA 2QQKA 4XE9A 4B4QA 2C9KA 1R093 2X10A 1Q8SA 1ULDA 2AZ5A 3NMBA 3INAA 4XF0A 5D8AB 4A42A 2YROA 2DCTA 3AYEA 3OOXA 1PO21 1HLCA 4N7UA 4ZZ5A 3O0WA 3OUJA 4JAAA 4DO0A 5FZ8A 1QH7A 2IXHA 4QX0A 3ACHA 5KR7A 3T30A 4NOTA 3T2OA 3VD9A 1TG7A 3NWKA 5ACA3 3PUQA 1SPPA 5J96B 5FBZA 4Y24A 1IKPA 4KGQA 5EYYA 1PX3A 2UY8A 2XLFA 4YG6A 5LBCA 1RMU2 3N9MA 4Y26A 5HBAA 2ARAA 1K5JA 4AVSA 4EN6B 4AAXA 2ZGLA 2WWJA 3EBRA 1CAUA 3ZR5A 2XJSA 1FATA 2LW8A 3NO8A 4LT5A 1M06G 1NQDA 4R4ZA 2VUCA 2VW0A 3H8UA 1BZWA 1CZTA 4DPNA 5L36A 3OY8A 4IEOA 3DN7A 1HW5A 1U5IA 3DXUA 1TMF1 3IIIA 1Q43A 5DZFA 3AMHA 3ZN6A 4CP0A 3P3NA 3N7LA 3ZYFA 5CFDA 1OD5A 3O7OA 3JBG1 4LBNA 3NNMA 4QDQA 2Z4FA 2A3XA 5FXWA 1N1SA 4WM8A 2NP0A 4A2UA 3LOBA 1Q8VA 5F2SA 1OFSA 3UKNA 2XG3A 2GMEA 4N9HA 1G9AA 1UPIA 3ZFFB 3P6BA 1VBA2 3A23A 2BNNA 2C1FA 5EJ1B 4AW7A 4M01A 5FPZA 2ENRA 3TAYA 4COWA 3MLLA 3MGUA 4I09A 4MG2A 2CWMA 1O8SA 2C26A 4IEWA 1ZRCA 5LBEA 2D5FA 3AFGA 2RDQA 3J8F2 4FBFA 4MVTA 4CEYC 3VKFC 5C8CC 2UWBA 2XJPA 3N9NA 2B8MA 1W39A 5JR7B 1A8MA 5J48A 2UYBA 1DF0A 1UZYA 3JD72 2A1XA 3OTFA 1XPWA 4AR2A 2ZOEB 3ATGA 1SPPB 4Q4V1 2WNEA 1FNZA 4YFZA 4AI2A 2E7TA 1GR3A 2WDBA 1GQHA 2PAKA 4EN8B 1QY4A 2W52A 4OZOA 3T1MA 1SLAA 5HV0A 5KHJA 1V0AA 5A6ZA 5DG1A 3IAQA 4UFHA 4JRAA 2P3YA 5ANQA 1VMHA 2VOVA 2WSUA 1BEV2 3D0JA 3JZVA 1Z0HA 4FXKB 5FZ3A 3UYJA 4ZZ8A 5BNQA 1AL22 3AB0A 4KL1A 2BBVA 4BZ4A 3TEWA 3PL0A 4AHWA 2QQLA 3T0BA 1QNWA 2E7AA 1ZBE2 1BK0A 3HNBM 1RUH3 5C3PA 2DCYA 1QJEA 3A0NA 3VDAA 2MEV3 3V64A 1UU4A 2DBIA 5CFDB 1VRH3 1A34A 1J84A 4ES9A 1W99A 4HBNA 4XCBA 5JR2A 3OPWA 1DGWA 3U37A 5A3UA 1ZZBA 3BTAA 2XQRA 1V9U2 3GHNA 2ZGTA 2XWBB 1FMD3 2JIJA 1XNKA 4YW7A 1TZOA 4JC1A 5IJRA 5IVYA 3TEYA 4IEYA 3ELNA 1X33A 2CYFA 2O8OA 4A7KA 1VBC2 5CKQA 1UMIA 1UWWA 4HVOA 1AR72 1D4VB 4YG3A 3WHUA 2JENA 4DNYA 5EPAA 2P3IA 3NKTA 1FT9A 2FDIA 3ACIA 1LHOA 1MPXA 3C7OA 2XR4A 3M4FA 3F95A 2CGNA 4FPJA 4LKDA 4NHXA 3CLPA 4UI9L 4QDRA 3K51A 2W1WA 4CU6A 4MGQA 2FDKA 1D2SA 1CQ9A 4KU8A 5CA6A 4M0HA 1C4RA 2LRPA 1HQNA 4RGKA 5ABJB 1RVF1 1XYNA 3CHXA 3T2TA 3AYDA 3HD8B 4AI3A 4DXZA 1WMFA 1UY2A 5I8YA 2O0OA 2VTXA 5I8TA 4WVZA 3NAPB 3GXUA 5FWJA 4XJUA 5FK7A 3FWEA 5A6XA 3U4XA 1UYPA 4H2AA 1POQA 2WO7A 1OVPA 4GWNA 2AACA 2JG9C 3DPRC 4ATFA 3WDWA 4IV3C 5FXVA 2YPJA 1OVSA 3WF1A 1ONAA 3OJBA 4NAOA 2Y26A 2D40A 1XE7A 4QXBA 1OKOA 4FXGB 3HNYM 4NO4A 2VQ0A 4PDWC 1WCSA 1LEMA 5I0RA 3I2DA 4Q27A 3WSOA 1IS6A 3PVNA 1PVC3 1R081 3SCFA 4XMAA 5DAQA 2BPA2 4IE7A 1HRI1 4WVMA 3ZYRA 1E5RA 5L19A 3VZLA 4CCMA 2VQUA 1EAH1 3WG1A 2CGOA 1RUJ3 4L97A 1CJDA 4CUBA 3ZDSA 2CAVA 1LOGA 3ZFGA 4CEYA 4Q5OA 4KQ7A 4OULA 4W50A 2DCKA 4KI5M 2XUEA 3AK0A 5FPAA 3UGGA 2W1UA 3WF0A 4B7KA 4FTEA 5KXBA 4XFCA 1UOJA 5FZOB 4HKLA 2I74A 3OBTA 4JVAA 1L7QA 2JDAA 4L99A 2XQXA 4Q4X3 4E4SA 1QWRA 4FSJA 5FZ0A 1H2MA 4AGRA 2JB8A 4CUGA 1AR61 2A6ZA 2RHPA 1RUE2 4FTSA 2L9LA 3L9JT 2UURA 3MFAA 4K6BA 4FPOB 2AEYA 2RG4A 5FZIA 2X05A 5CG9A 1BBT2 4P9WA 5FY0A 1O4ZA 1VBD1 4N7IA 5F32A 3G6JB 3LQCA 4CCLA 4AG4A 3IM0A 3DV8A 4CCJA 3E6DA 3D3AA 3HMYA 4MXWA 1W9FA 5I0TA 1W6NB 4Y3OA 3R4DB 3WNLA 1NY72 1DQ6A 1Y9MA 3VKNA 2E51A 5FCCA 3M3EA 3S57A 4PT6A 3KSCA 3MPBA 2P6CA 3AZYA 1ODMA 1AXZA 2DCZA 2JXAA 2W87A 4OUSA 4R52A 3TN91 1CGPA 3D0SA 2RS32 3VHOA 4G3YC 4QU2A 4QM8A 3WQBA 4B1MA 5FMCA 3ZN4A 4I30A 1RUI2 4PLMA 1JH5A 2A6XA 3AJYA 4WVMB 2W1SA 3H8XA 1JOPA 3ITQA 5DUVA 2HWD3 4IEUA 4TXWA 4XF3A 3CZJA 3ZXEA 3HQUA 3C7EA 2WZ8A 3QCWA 4OFGA 1ACCA 2AENA 3K4AA 4QHOA 4EQVA 3ZFGB 3TRSB 3AKRA 3E5QA 2E53A 3MLKA 1YO8A 1US3A 3SISA 2CL2A 1OH3A 4Q0PA 1JTZX 4H7MA 1DG6A 1W6OA 5JSRA 2YXSA 4I3GA 4W65A 3VL9A 4DZGA 5A3LA 3WDTA 1BCXA 1CESA 3N3HA 4JKLA 1WMXA 5FPUA 4OHYA 2VMIA 5C70A 2XLGA 4LK7A 5DAXA 5F5AA 5GM0A 3ZN5A 4W6YA 3VLBB 5CVRA 1BVVA 1REEA 1WWYA 1G8WA 1YHFA 3H7YA 2UWCA 4OQ8A 3N9LA 4MOAA 3VBHB 1V6JA 4M0NA 2RS52 5LBFA 3E5XA 3PURA 1E5IA 4BA6A 2QQWA 1CAWA 1PO13 4CP9A 3N9QA 3HN1A 2BRTA 1DIWA 2TEPA 4GZ9A 3LEGA 2J42A 4KNCA 4GXLA 4BQ3A 1LB2A 2D6KA 4XAEA 1PGL2 3PVEA 1T6BX 3Q8FA 2VMEA 4XEZA 1X7NA 3AP9A 3DPRA 3N35A 3KCCA 3OF1A 4LKEA 4CEWB 1PK6A 3QACA 2OQ6A 2X29A 3QOPA 3CEWA 4IV3A 3SLIA 3NNFA 2JKXA 4FAGA 1D4M1 4AI8A 3WNKA 5DXDA 3ZPOA 2BWAA 4RSUA 5FAXA 2OIIA 4PDWA 3EYPA 4C1WA 4FTBA 4ZONA 2LS6A 4LO7A 3NJZA 1RUD1 4NHLA 4NRPA 5EQUA 1N1YA 1OF3A 5A6QA 1MEC2 4QX1A 1DP0A 4GQ7A 3B9IA 3NV4A 2RS13 4RS5C 1GZCA 3ZSJA 4Z92B 2R49A 2GALA 3MUZ1 4BU2A 3KV5A 2VTFA 1OKQA 1BKZA 2W92A 1W6OB 5CFCB 4MGTA 3RZKA 5FRAA 2VD7A 3K3OA 1R091 2VULA 1RJ8A 4HLTA 4BJ0A 2VTXJ 1V6MA 3UT0A 2FCVA 5FKCA 1Y3TA 5T55A 1QJX2 4IXLA 4WM7A 1UO9A 3H8RA 4A7ZA 2Q4SA 2JDKA 5IHRA 4FOWA 5LK7B 1UZWA 3OUHA 2BGCA 1NLQA 1UMHA 5ACA1 4Q0UA 4URTA 2ZX1A 1OT5A 2CY6A 4X6RB 1C1FA 4XDOA 2Y8KA 1VJ2A 2RMU1 1H0BA 1H8VA 1E5HA 1PK6B 5FZMA 2VZQA 3IBMA 1J1TA 4YYOA 4N8MA 3KT1A 4PIYA 5FMBA 1IS5A 1QNYA 2QVSB 4S2FA 1QH6A 2P6HA 1UOFA 4M00A 1AYN2 4LO6B 4DB5A 3BU0A 1YRZA 2R042 4L11A 3A21A 4DY5A 4ZPIA 3SH4A 4XETA 1NOVA 1C8NA 3MW2A 2DVDA 4LE3A 3VL8A 4F83A 1HJGA 3ZXFA 2D6OX 1V6NA 1OXCA 1CZVA 2PHWA 2QKDA 4Q0QA 2V72A 2A7AA 2OZ6A 2RDRA 2V09A 3GBFA 1GKBA 2W3JA 4FCAA 1QOSA 3LKJA 2FD8A 5FY5A 4ZY9A 3WNOA 3S5QA 3HQXA 3SEEA 3OPTA 1F9KA 1RUG2 3ECQA 1K42A 5KC5A 1RUF3 1MS4A 5IW0A 1N3PA 4EV0A 4GMP3 1HV1A 3P1IA 3WLUA 2VOWA 1AHSA 1MZEA 5GZGA 1GZWB 4MHUA 4YVSA 1ND3A 2DWRA 5JIUA 2GZWA 4LORA 4WV8A 4CU7A 1QMJA 4R9BA 4AI9A 5FY9A 5LATA 4ES8A 1ULOA 4K20A 1IPSA 3S7IA 5JDBA 2CSGA 4WM7B 3RJ2X 3ZO0B 1WD4A 3RS6A 4H3WA 3T1LA 4ET7A 1U12A 3VZJA 1XNBA 3HWJA 1C5HA 3PIGA 1YNAA 1S0CA 2ZHKA 4LBLA 1GNYA 5IWFA 3RRDA 3O1UA 5I93A 4HVRA 3MYXA 2VY0A 2YFUA 2Y38A 3AMPA 3T09A 2VQAA 5C4WA 3FJSA 1CAVB 3MIDA 3I97A 3LOIA 4QB1A 1LTEA 3MFCA 4GH4C 3ES4A 5GJ6A 1IZ3A 3WQ0A 1U0AA 4LO5B 3PMEA 3WZ1A 3IDEA 4UW4A 3VDBA 5GLVA 4ITCA 1ZZ9A 5D8AC 2YB7A 1RUH1 4Q4Y3 4CXXA 4YPJA 1JYCA 1ENXA 2R063 2MEV1 3BU7A 1YXWA 4IE5A 4CUAA 1VRH1 2JD9A 3LD8A 2JE9A 5FIXA 2R7EB 4XOGA 3WG4A 4IV1A 4OYUA 1YC61 3RFRA 5EHDA 5T5LA 2VH9A 1JZ8A 4LHSA 2IWGB 4DUVA 1KITA 3DUIA 1YI9A 1LOFC 2A6YA 5FPLA 2HBUA 1BMV1 2N7GA 1FMD1 4IUGA 5FJHA 3N36A 3W58A 4A7YA 2DTYA 1J3QA 4NIDA 1H8TB 1XQNA 3ME2A 1DBNA 1WW4A 4FFGA 1N3OA 2B42B 4YVSB 1HKDA 1ND3B 2RJLA 4FOQA 3VKLA 1N1TA 1UNBA 1Z7S3 2WN3A 5B4NA 3H3LA 2YZ4A 4TZDA 1MS9A 3MV01 3TNQA 1AXKA 3B00A 5BNNA 4QX8A 2QUOA 4XF9A 4GMP0 5DPNA 4L8QA 1UYYA 2OXBA 2K9ZA 2VZVA 3PU8A 4HKWA 4NVPA 4Y33A 2BGOA 4AYUA 3RZHA 1GWLA 1V6KA 2OUJA 1QJY2 2WWSA 5A3TA 3W5MA 1WD3A 1E5SA 4QPGB 4O61A 4FQ4A 1W28A 3RYRA 4KMQA 1LHVA 1QF3A 4B4PA 2QDNA 5C4WB 1UPSA 3NL1A 4F8AA 3WP3A 4R9DA 3P5BA 4UAPA 1LNSA 2WS92 5FYUA 3M3CA 1UXXX 4YARA 1DQ5A 2DUOA 1VBB2 1CIWA 4IGOA 2WFF3 1QGLA 2VCAA 4WVVA 3OBAA 3N9PA 4ARXA 1LEDA 5GZFA 3J8F3 1C8M3 3I2IA 3LA7A 2XKPA 4MX3A 4QGMA 4IV1B 3L2YA 1RINA 2HWF2 4JDOA 1S2BA 1UU5A 3EQEA 3E1F1 4KBBA 4URAA 2Q5TA 1MVQA 1UXZA 1PO22 3JD73 4RFT0 2KM2A 5B4XA 1BVP1 4Q1RA 2ES3A 4ZHNA 1N1VA 3SITA 4DS0A 3K2OA 4BK5A 1O59A 2YPDA 1BK1A 1UZZA 4LKSA 3I3MA 3UKTA 2J1SA 4NRMA 2XJUA 1W6MA 1PVC1 2NMNA 1X9TA 5E88A 1DYOA 5JIAA 1YFWA 4AEDA 1UY1A 4WVWA 4AVBA 2EA7A 2FDJA 2JEMA 2ZHMA 1BEV3 4META 5JOWA 3IZOA 1RUJ1 2VMHA 1F5JA 2YC2A 3R05A 1PNGA 5BNNB 5A33B 1D2QA 3EO6A 3CBNA 4XUOA 1J59A 5FZ6A 5HCAA 1GQPA 4COZA 1AX1A 2BNOA 2Y0OA 5CFDC 3RNSA 4IEPA 1ULPA 4FPFA 4MADA 2WNUB 1W8HA 1OUXA 3BIEA 2CAUA 3ZMNA 2B45X 4X8PA 1DQ1A 1AX0A 1TMF2 2ATFA 3UL2A 3ZOIA 4E8DA 5T3NA 1JYNA 3GCXA 2ZEZA 4BLIA 4A3XA 3DEMA 3RMYA 4AHXA 4Q4X1 5JXHA 1RJ7A 1RYYA 1W8ZA 1ZX5A 4D6RA 2ZHLA 2W1QA 3USUA 3SH3A 3VBUB 2G9GA 3POYA 2RM22 4AEKA 2OQ7A 2VW2A 5FK8A 2VL4A 4Z07A 1JYXA 1VB4A 1OD3A 4FFFA 3B3QE 1VBC3 4QQPA 1DU3D 1UY0A 1D0GA 1IQAA 3MIFA 1AR93 4HSLA 3H9AA 4Q4W3 1GUIA 2P34A 2AC1A 1UYXA 4EZHA 1ZRFA 2GDFA 1S0BA 4JCKA 4KWUA 1TNFA 3H7JA 3IN9A 2W08A 4MO3M 4NAMA 3VHPA 1KS5A 4IGPA 4CP1A 5ABJC 1I9RA 3AYAA 1GOHA 4NWVA 4C90A 5BNPB 1UY3A 4ZS2A 4CCEA 4AEDB 2QQJA 5FZFA 4GALA 4CP2A 3GZAA 2VOTA 5BPXA 2HWD1 3ACGA 4CA9A 2A6WA 4CPBD 3K77A 3NAPC 4KG8A 2TUNA 5GALA 1VR3A 1PZ9A 3A7QA 3NV3A 4DUWA 1H6YA 1V6IA 5JXGA 1Q8OA 1TME2 1YQ8A 3MV11 3UKVA 2VVEA 2WNVA 3N7MA 4LE4A 2BVVA 4LLOA 1AL0G 1UX6A 1VAKA 3KZ4C 4NWWA 2QZ2A 5HPOA 4AVTA 2LTNA 5F6KA 1OPMA 2PELA 1UD1A 4NHKA 4XFBA 4PLOA 3DYOA 4KG0A 4XTPA 2DVBA 2Z42A 1C57A 1VRBA 3C3VA 3USUB 4Z82A 1I5PA 3ZFFA 4COYA 3LIHA 3LDRA 3BTYA 1QQP3 5I91A 3SCHA 4TSVA 2GNMA 2AGSA 3APBA 5BUVA 2W0XA 2IXJA 4Y1YA 5FP7A 3KM5A 1PO11 4JTOA 5KHIA 2PHUA 4BH9A 1Y9GA 5CKMA 3VD7A 4YGEA 1KDKA 1G6NA 2HWE3 4ATEA 4AXOA 2BWCA 3E6CC 5LY1A 2Y64A 5A80A 2FMDA 3FBMA 3RZZA 1CJPA 2XB6C 2I2SA 1W0OA 2XONA 4QGNA 5L9RA 4DEVA 4FT8A 3QBQA 4XFGA 3MF6A 3KCXA 2BNMA 1KXGA 2YHJA 3AZVA 3U78A 2FZ1A 3A22A 3JB8A 3VBRB 2ERFA 1JZ4A 3Q9OA 3VBSB 4CE8A 2WT0A 4J6GA 3I2HA 2GP3A 2XUMA 2CNAA 2KA3A 4XIOA 1RVF2 3C2UA 2VU9A 4AZZA 1GP5A 2HEWF 4AFDA 3DF0A 3ZXGA 4A44A 2RS11 2JDMA 3HQRA 3NQHA 4XFFA 1UY4A 2ZX2A 4P9XA 4XJ9A 5LWBA 3LSDA 3O1SA 4C91A 2ZPXA 2WNVB 1ZNPA 1HQWA 3AZZA 1LESA 1DZQA 1NA1A 1VBE1 4BE3A 3MO4A 4JGZA 4KWJA 4IEVA 1B09A 1YFXA 2R0FA 3GGLA 3CJXA 4BYYA 1LR5A 4LBQA 4COVA 4C8DA 1XRUA 4IE0A 3NSTA 3O14A 1DCSA 1SLTA 1LOCA 2WNOA 3ES1A 4PQ9A 4AAPA 2BQPA 4XF1A 2Z2SB 1UL9A 3HNMA 4CCCA 1JOBA 5F2WA 3RI8A 1RUI3 1GU3A 5DABA 4P9LA 4QT6A 1RB8G 2CTVA 5FMOS 4HANA 5FBJA 1XBFA 4B7EA 5F9TA 1H4GA 4P9JA 1R082 4A4AA 3WP5A 5FZLA 5HCHA 4JV4A 1MS0A 1ZBA3 2D6LX 3ZFGC 2B9UA 1EAH2 2K0GA 2WT1A 3E6BA 1F4HA 4HK9A 4NIHA 1RTVA 4LHNA 1UOBA 4W6XA 1JN2P 1C1LA 3S30A 4LHKA 1R64A 4OI2A 1GOFA 2VPVA 1LJ7A 3VHRA 4FP3A 1QOTA 2XL7A 4YW3A 4XABA 5FP3A 1NCQA 3PJQA 1H1IA 1OPOA 3KV4A 2VZPA 2DVAA 4Y4RA 4D7YA 1SZBA 5ABJA 1W90A 1VALA 1C5IA 1GWKA 2WA3A 1XNTA 4LNVA 3VBHC 5A7WA 3VKOA 4OMDA 3L2HA 4PBOA 2FQPA 5T5PA 1O8PA 1GOGA 2RS53 3NAPA 3J7MA 4KWKA 3RZLA 4L92A 2ZKLA 1PVXA 5EIYB 1Y7BA 3HT1A 2P3JA 4FPYA 1NE6A 1VBD2 1RUF1 2DUQA 2Y6JA 3NVCA 5FDBA 5FP4A 2DVFA 4D8MA 4DQAA 4Y5TA 4GMP1 3JQXA 1NA1B 4CEWC 2ZGNA 4JGZB 2IXIA 3ZR6A 2PTMA 3PHMA 4CCOA 4CCKA 3FE5A 2ZX3A 3MIHA 4JDNA 4LBQB 4JGYA 3ZYIB 2Y6LA 4QMAA 1Q8QA 4BQWA 4RR3A 1JZ2A 2XHNA 1W3XA 1NT0A 2OA2A 2XL9A 3EXUA 1OA3A 4BPZA 1OA2A 2A70A 5LB6A 1AR83 1VIWB 4A6SA 2VZ1A 2XVGA 1XXNA 3FFQA 3WR0A 4JHTA 3POJA 5KXEA 3WHTA 4Q1PA 1MEC3 5A3MA 2HWB3 1J58A 3F2ZA 4PI2A 1FOD2 1YIFA 3KCYA 2WN2A 4XJ8A 2JDUA 3VDDA 1ZYBA 2ZBJA 3NNGA 4UFKA 4BXFA 3VZNA 1NKGA 3RZJA 2FDFA 3WF4A 1CPNA 1CX4A 2J1VA 2YC4A 2GMMA 2WQ4A 1FYUA 1PGW1 4GA9A 2BU9A 5CFCC 2Z5WA 3O1VA 1JZ5A 1FX5A 4Y1UA 3M7AA 3K4ZA 3A0KA 1B35B 1W8WA 1CWPA 1EP0A 5CADA 5FXZA 1NCQB 4BCUA 4FO9A 5FZOA 2B46X 4XYXA 4Q4Y1 1W9TA 4BIOA 4RGGA 2R061 2EICA 2WO1A 1LGNA 5A7WB 1QJU2 1PGSA 3ZVXA 3T4HB 5AC92 3NNJA 1W6QB 2VR4A 5CB7A 5B2GB 5H9QA 1NX9A 3KF3A 3LZZA 2NMOA 1YFYA 3CO2A 3QD6A 1REDA 3O0XA 1S4CA 3FZ3A 4JHZA 1GFF2 4AFBA 4DOUA 1XYPA 2JDZA 2VAUA 2Z79A 4A45A 2PXJA 2VGDA 3D4KA 1PK6C 4V2VA 1W6NA 1LECA 2PAEA 2TBVA 2LUWA 4CTEA 5C8WA 2A73B 3SEPA 1LHUA 1YQCA 3IMMA 4N43A 4XXPA 4M4RA 1Z7S1 3R0RA 3D8CA 4JGYB 1JYWA 3EHKA 4QX7A 2ZGPA 3LF7A 4ZXKA 4RR3B 5E8AA 3IDAA 5ERLA 5K7PA 2XBO2 5FZ1A 1K5MB 1AJKA 2D43A 1PZ8A 3J26N 4K7JA 2XJRA 3BUCA 3ZLIA 1D4M2 4JTNA 2BFUS 4PF1A 2A6VA 4HOOA 2JDHA 2QNKA 1ASJ3 4JQRA 4DEQA 4AEMA 4R9CA 4INDA 1IHMA 3MPPG 2B5HA 1NZIA 2ZEYA 3MF9A 2B4KA 3VDDB 1RUD2 5JSOA 4E2QA 5D21A 3IWZA 4OVEA 1UKRA 1LODA 5FREA 2ZXQA 4XAAA 1CONA 3B01A 4IQPA 1RUG3 3H3UA 4A41A 3U0ZA 5LCWL 5KXDA 3IB3A 2ET7A 4M3CF 4OMCA 2WZPP 1ZZ8A 4HKOA 1O5LA 2WFF1 4FQZA 3VBFA 3CNAA 2XJVA 3UGHA 2DYCA 2JD4A 3UV9A 3PU3A 1JI6A 4QGLA 4XCAA 4K3UA 4O9GA 4WM7C 2NQYA 2CDOA 3J8F1 4JZRA 1C8M1 2Y6HA 3JXSA 4UOJA 3O1PA 4IDZA 1R092 1TVGA 1VLNA 4EN9B 1TQ5A 1PMIA 3JUUA 2Q0AA
chains in the Genus database with same CATH topology
1W8ZA 1W8UA 3ORJA 5D21A 3F95A 4CP9A 2O14A 1WZXA 1W9FA 4LJHA 4YWAA 3ZYHA 4CPBA 4CP9B 1L7LA 4CPBD 2Q1FA 4BQ3A 3ZYBA 1W8WA 4BQ5A 2LRPA 1HN0A 1OKOA 4BQ2A 1OH3A 1W90A 1V0AA 1GWMA 2KR2A 2LROA 4YW7A 1GWKA 1UOJA 4LKEA 4LKFA 1GWLA 4YW6A 4AL9A 4A6SA 1WMXA 2C24A 4LK7A 4LK6A 1W8TA 1WCUA 2VXJA 4BQ4A 3UT0A 2JWPA 3ZYFA 2K46A 4LKDA 2WYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8Z A;  1W8U A;  3ORJ A;  5D21 A;  3F95 A;  4CP9 A;  2O14 A;  1WZX A;  1W9F A;  4LJH A;  4YWA A;  3ZYH A;  4CPB A;  4CP9 B;  1L7L A;  4CPB D;  2Q1F A;  4BQ3 A;  3ZYB A;  1W8W A;  4BQ5 A;  2LRP A;  1HN0 A;  1OKO A;  4BQ2 A;  1OH3 A;  1W90 A;  1V0A A;  1GWM A;  2KR2 A;  2LRO A;  4YW7 A;  1GWK A;  1UOJ A;  4LKE A;  4LKF A;  1GWL A;  4YW6 A;  4AL9 A;  4A6S A;  1WMX A;  2C24 A;  4LK7 A;  4LK6 A;  1W8T A;  1WCU A;  2VXJ A;  4BQ4 A;  3UT0 A;  2JWP A;  3ZYF A;  2K46 A;  4LKD A;  2WYF A; 
#chains in the Genus database with same CATH topology
 3JD7 1;  1PZ7 A;  3VBH A;  3ZYJ B;  4S2G A;  5FO9 B;  2P2K A;  1IPJ A;  2W46 A;  2W91 A;  1OQD A;  3HPN A;  5KXC A;  2ZCW A;  4CU8 A;  1HB2 A;  5JZG B;  2NPI A;  4O65 A;  2V5Y A;  4SBV A;  3DXT A;  1LKN A;  3BI3 A;  4IL7 A;  3AKQ A;  5ACA 2;  1W6P B;  1S0E A;  2WWU A;  1S0F A;  3N7J A;  3AYC A;  4N43 B;  1WA4 A;  4LBJ A;  2LM3 A;  1XC6 A;  1H6X A;  1LAJ A;  4CEW A;  1BEV 1;  2RMU 2;  5FZK A;  1S2K A;  5T52 A;  5IAX A;  1K12 A;  2DFC A;  3CL1 A;  4UFI A;  5D2A A;  2ZZJ A;  5IT6 A;  4YGD A;  3CQO A;  5CIR A;  2PHT A;  1H9P A;  4NIG A;  5FPB A;  2D7F A;  2VCC A;  4LA3 A;  1SMV A;  1BYH A;  4LOS A;  4QX2 A;  5EFU A;  2WL1 A;  3RQ0 A;  4L0P A;  3AL6 A;  2R07 3;  4B29 A;  1NE4 A;  3V0B A;  3I4I A;  3B7M A;  4DIQ A;  1H2K A;  3USS A;  1OH4 A;  2WC2 A;  3LA3 A;  4Y20 A;  2O14 A;  2OT7 A;  2JKB A;  2O1Q A;  3KQ4 B;  1H8T C;  3PUI A;  1CX1 A;  5IVB A;  5FP9 A;  4BIF A;  3UNP A;  4N90 A;  4YVS C;  1ND3 C;  3HIF A;  5LA9 A;  3NJY A;  3MI8 A;  3VBF B;  5CFC A;  2F6B A;  2A75 A;  1V00 A;  4YW2 A;  2Z69 A;  1QU0 A;  1AR9 1;  2ZGQ A;  2HWC 3;  3MUY 1;  1FNY A;  4Q4W 1;  5DG2 A;  1DQ2 A;  2I45 A;  2R1B A;  3BPS A;  2QQP A;  3PTR B;  1ND2 B;  1PNF A;  1FV2 A;  5TSW A;  2WZE A;  2YY1 A;  2QQI A;  3VD3 A;  5BY5 A;  4K8F A;  1RHI 3;  5L9B A;  1GIC A;  4QPG C;  3M8L A;  3FLP A;  4I0A A;  5SV5 A;  5IVV A;  5J7M A;  2Q1M A;  4XBN A;  5JPM B;  1RUC 2;  2J1A A;  4E4Z A;  1RUO A;  1ZM1 A;  1FAY A;  1OA4 A;  3CJI B;  3EB7 A;  1MZ5 A;  3KV6 A;  4HN0 A;  5H9R A;  4EN7 B;  1XYO A;  2IZW A;  4QX5 A;  5C4W C;  4IEX A;  1VP6 A;  4NPR A;  3ZXD A;  1DFQ A;  3S5A A;  4MGS A;  2QZ3 A;  2D3R A;  4YZ1 A;  4GKY A;  4ONU A;  2BVB A;  1FPN 3;  1KDM A;  3DGT A;  4V2W A;  5CYY A;  2WS9 3;  1JS9 A;  1GP6 A;  4LA2 A;  1VBB 3;  1W9S A;  5J37 A;  1A78 A;  1U5X A;  3VUO A;  3SCG A;  4CDX B;  5A1A A;  5DMY A;  4ASL A;  1DGW X;  4IV1 C;  4ZXE A;  4QHB A;  2YC0 A;  2DFB A;  4HT1 T;  3V0B B;  1AUY A;  2VMC A;  1AYM 3;  5DUX A;  1X36 A;  1RUH 2;  2QDR A;  4OI1 A;  2HWF 3;  4Y20 B;  2MEV 2;  2ZGR A;  5IYY A;  1VRH 2;  1A6C A;  3VD4 A;  1TEI A;  4IEZ A;  2GC0 A;  3VZM A;  5C6C A;  4GB3 2;  4RHV 2;  3GHM A;  1KS4 A;  3NV2 A;  2PHL A;  2HLE A;  2WO3 A;  1QQP 1;  4QQ2 A;  1BMV 2;  1S0I A;  1ULF A;  5F8P A;  1R1A 2;  2X5I B;  5C7G A;  3C7F A;  5A1F A;  1NZC A;  1PMH X;  3KWV A;  3LEM A;  4Q0S A;  2RR1 3;  3GCW A;  3VD5 A;  1Y4W A;  5CAZ A;  1GZW A;  2V4A A;  2HYK A;  2HWE 1;  2IXK A;  2VZS A;  4AE2 A;  5BNN C;  5F1R A;  3I59 A;  2XPJ A;  4O7X A;  1IG0 A;  2QTW B;  2C6S A;  2PLV 3;  5FY4 A;  4GWJ A;  5FUN A;  1SLL A;  2PFW A;  1HXS 3;  3MDP A;  4LOT A;  2WNU C;  4D7T A;  1UIK A;  3AZX A;  2J1T A;  4DFS A;  2ZAH A;  3BTX A;  3PDQ A;  4Q29 A;  2BYV E;  1DZT A;  3WT3 A;  3HN3 A;  5FOJ B;  3BIW E;  3FC0 A;  2GN7 A;  2VOK A;  2MPF A;  1EUU A;  3G7D A;  3OD0 A;  5FUP A;  3AFK A;  2F4L A;  4PIX A;  2RV9 A;  3GJA A;  3NJX A;  3VBU C;  2WRA A;  1I6X A;  5IVC A;  1XSR A;  4RQP B;  4K1Y A;  1CAV A;  2YBS A;  4GKX A;  3KHB A;  4WZF A;  1WW5 A;  2VO5 A;  3M70 A;  2RM2 3;  2XXZ A;  3WDV A;  1WLW A;  4PQQ A;  1EY2 A;  1A8D A;  4EWE A;  1ZRR A;  5EZW A;  4E4H A;  4XZP A;  1IG3 A;  1S0D A;  3ON7 A;  4GIQ A;  4HMZ A;  1NCR A;  2D98 A;  2E7Q A;  1GP4 A;  1ULE A;  2XH6 A;  1GBG A;  3D82 A;  4FOV A;  4LUM A;  4YFW A;  5HXV A;  3TEX A;  3ZYG A;  5HV4 A;  2AEZ A;  1A3K A;  2DCJ A;  1Q3E A;  4IE4 A;  4MLO A;  1ALY A;  1UOG A;  3LPG A;  2GP5 A;  2ARB A;  2WZR 3;  4TTG A;  3J7L A;  1S0G A;  1COV 3;  5BNP C;  2FDH A;  4Y5Z 0;  2WT2 A;  3MIB A;  4UW6 A;  4AED C;  5IVJ A;  4P9Y A;  3FUO A;  2DUP A;  2ZJC A;  5A7S A;  4UFM A;  2HBT A;  5JMO A;  3O1M A;  1H8T A;  2V73 A;  1LOE A;  2V4V A;  3KVA A;  4FPK A;  4Y4Y A;  3VHN A;  3I3Q A;  3ST7 A;  3V56 A;  5GZD A;  4C0H A;  5L9V A;  5LEK A;  1PVC 2;  2ARX A;  1YYN A;  4ASM B;  1O3S A;  3KT4 A;  1MS1 A;  3I59 B;  1GZT A;  1ZBA 1;  4LR4 A;  3LWC A;  1FV3 A;  1PM7 A;  4WZC A;  3I2K A;  3WCR A;  4IGQ A;  2QQN A;  4J1W A;  1US2 A;  3ZSL A;  4XZU G;  2SBA A;  3ABZ A;  4AQS A;  1RUJ 2;  4DIN B;  3JQW A;  1TME 3;  4Q0V A;  4L9B A;  2YUE A;  1CD3 G;  1EV1 3;  4LEJ A;  2LRO A;  4XXA A;  4BMB A;  1OOP A;  3AMM A;  2VUA A;  3JCI A;  4LO8 A;  4W4Z A;  4LKF A;  1PIV 3;  4HN1 A;  5DDJ 2;  3W59 A;  5FKB A;  4XJA A;  2AUY A;  2GNB A;  4QPG A;  4BME A;  1JBC A;  1HRV 2;  3KT7 A;  3OCP A;  4G4F A;  5I8S A;  4D0Q A;  4LLF A;  5C3S A;  3ZXK A;  1ZVF A;  2VBB A;  2G4I A;  1SCR A;  2ZZQ A;  4Q4X 2;  3LSE A;  2ILM A;  1W9W A;  5F3I A;  5FZD A;  3CIH A;  3M3O A;  5C5T A;  5T5J A;  2R32 A;  2RS5 1;  1RUN A;  5K0U A;  4LIU A;  3N4M A;  2OPK A;  1V6L A;  4Q26 A;  3W21 A;  3C7H A;  1NCR B;  5A3O A;  4D6Q A;  3FMG A;  3ZMO A;  4OHZ A;  5JWP A;  2QE3 A;  3H1Y A;  1PGL 1;  2KR2 A;  2WAA A;  2ZKN A;  3TYJ A;  3RI9 A;  1H2L A;  2E33 A;  3VGI A;  3HBZ A;  1X8E A;  5LZ6 A;  2ZGK A;  3MW3 A;  2ZEW A;  4EE2 A;  3VBS C;  5HI0 A;  3KMH A;  3ZXA C;  1AR8 1;  1RMU 3;  1XNC A;  1YJK A;  1C28 A;  1YCI A;  3OYW A;  1CR7 A;  2BOJ A;  3BVC A;  2HWB 1;  3WNM A;  4XHB A;  4YM2 A;  3CMG A;  3ALQ A;  4CRQ A;  2HWD 2;  5F5Q A;  4FPC A;  1H9W A;  2EAK A;  2IVI B;  2WNV C;  3SH5 A;  4XUR A;  5A33 A;  3KHC A;  1LOA A;  5F6L B;  1D0H A;  3P3P A;  1UMZ A;  3N9O A;  2NYY A;  4LPL A;  1QXP A;  4NN0 A;  1HN1 A;  4NUB A;  2RDS A;  1OOP B;  4QXK A;  4TWT A;  3T2P A;  1YFU A;  2WNU A;  3NKG A;  1MAC A;  3I2F A;  2WQ8 A;  5HCF A;  5JVV A;  4C0B A;  2IVJ A;  4DRV A;  2JG8 B;  4K8R B;  1WMD A;  2BOI A;  3QH7 A;  2ZHN A;  3ZFF C;  3ETP A;  1AXY A;  4AWD A;  4COU A;  3O1T A;  3B5L B;  5GLU A;  3DYP A;  4KGG A;  3WUD A;  3S0M A;  1EYB A;  1VBA 3;  4J25 A;  4QXC A;  2OW4 A;  3VBU A;  2AYH A;  3AC0 A;  1F35 A;  2SLI A;  3CF6 E;  4QM9 A;  3T3Y A;  5K0U B;  1IKQ A;  4HPK B;  4CDU A;  2ZS6 B;  5FYT A;  4F3J A;  3I49 A;  3M3I A;  5FJK A;  1LU2 A;  1ZA4 A;  1KJR A;  4AQ2 A;  4ARY A;  1PO1 2;  2EIG A;  4XUN A;  2J1R A;  1I5Z A;  3GZT B;  4Y1V A;  3VN4 A;  5DAW A;  1OC1 A;  3AKS A;  4NHY A;  4QD2 A;  1M4W A;  1XNA A;  2GU9 A;  5A3P A;  1LGC A;  2J7M A;  3RWK X;  3UET A;  4Z2W A;  4MSV A;  3GZU C;  2Y0I A;  3MBW A;  4CDW A;  3RYK A;  1MS5 A;  5BNP A;  5LEJ A;  1CAX A;  2GAU A;  4LUL A;  4YGC A;  2E63 A;  3OYW B;  1SHW B;  3LPF A;  1W0P A;  1ASJ 1;  2EIE A;  4YW4 A;  5FFO C;  1DDL A;  4CCN A;  3B93 A;  3IIA A;  5FYZ A;  4DUX A;  3QLQ A;  1AL2 3;  4YLZ A;  3AX4 A;  1ULG A;  3WXP A;  1NLS A;  5FLI A;  4PCR A;  4UYB A;  5E6H A;  2R16 A;  1NG0 A;  1RUG 1;  1ZBE 3;  1NA1 C;  2YV8 A;  4JGZ C;  1JZ6 A;  3FHA A;  2Q8E A;  3RSJ A;  4YM3 A;  5ISL A;  4EJR A;  4AFA A;  2ZX4 A;  2VUJ A;  5A3W A;  4AFM A;  3I2G A;  5J1X A;  1ENQ A;  1VBE 2;  4XHX A;  5CU1 A;  5FMO L;  3ZIX A;  1V9U 3;  3JBG 2;  4RL7 A;  4AGG A;  1ZZ6 A;  4XVH A;  1JYI A;  3R4U A;  1AZD A;  1LUL A;  1GZ9 A;  4HK8 A;  4Q8K A;  1N47 A;  1IS4 A;  1XSQ A;  1H4H A;  2ZAC A;  2XVK A;  4CDU B;  1EUT A;  2PMW B;  4P02 B;  2Q8O A;  3ZPY A;  3ETQ A;  1AR7 3;  1S55 A;  3PUA A;  4QKN A;  1HB4 A;  4MXV A;  1UU6 A;  5FTT C;  5IUQ A;  3U14 A;  1FOD 3;  3AXD A;  1SBE A;  4Q2F A;  2KXL A;  5DZE A;  4EWA A;  2VVD A;  3M2M A;  1HX6 A;  4NE9 A;  5K8S A;  1OSG A;  5FO7 B;  1JOJ A;  1WCK A;  1VMJ A;  1YQ6 A;  1I1E A;  1JYT A;  1B35 C;  1O3R A;  3BN6 A;  3LEK A;  3J4U H;  5FZC A;  1NCQ C;  2WR9 A;  2YMZ A;  4HG6 B;  1TE1 B;  5A3N A;  3O1O A;  2P3K A;  1W2O A;  2HEY F;  3HJR A;  4S2H A;  4U36 A;  4CDW B;  4CSW A;  1H30 A;  3VBR A;  2VE1 A;  1CAX B;  4Q4V 2;  4NIA A;  2CGP A;  3VZO A;  1WKY A;  2VM9 A;  3I2O A;  4FPL A;  3VBS A;  4XTM A;  2R07 1;  1DZR A;  1GV9 A;  2VC9 A;  1QJU 3;  3ZSE A;  5A1L A;  2H0B A;  4FPH A;  5AC9 3;  1KD7 A;  2B9V A;  2WAB A;  1BQP A;  1OQ1 A;  2RDN A;  5EP9 A;  3ASI A;  2VBD A;  1YWK A;  3ZKY A;  3ZSK A;  2ZGU A;  4YZ4 A;  4XC9 A;  1RXF A;  2C5D A;  3WW1 A;  2GH2 A;  5FY8 A;  3KB5 A;  4A6O A;  1O3Q A;  2BW8 A;  2CWS A;  2PQS A;  5FZ9 A;  3TWI A;  4AGV A;  5FR3 A;  1G9D A;  5KHK A;  1SFN A;  3LDB A;  4XUP A;  5AVA A;  1F5F A;  1JOD A;  2ZGO A;  3NV1 A;  2XKO A;  4JGY C;  5JI7 A;  1RUF 2;  3CKH A;  3WVJ A;  1GMM A;  2TNF A;  4RR3 C;  1G86 A;  2HWC 1;  2EAA A;  1DGR A;  4TN7 A;  2CU5 A;  1UKG A;  2G9Z A;  3KVB A;  4YVW A;  5T54 A;  1NUK A;  5DUW A;  4YZ5 A;  4H7L A;  4PI0 A;  4AQT A;  1MS3 A;  2XBO 3;  4QPI A;  2EF6 A;  2DF7 A;  3AKP A;  1K45 A;  4FPE A;  2D3S A;  1F2N A;  4QDS A;  2ETE A;  1D4M 3;  1SDW A;  2XJQ A;  5A7P A;  1RHI 1;  3BAL A;  2E6V A;  3U1X A;  1NLR A;  3VDD C;  2D5H A;  4NHM A;  2AH2 A;  4LBM A;  4DXS A;  4B3N A;  2WO2 A;  4ZKT B;  5JMC A;  5GZE A;  2J22 A;  2NLR A;  2PA7 A;  2XML A;  1O4T A;  3GYD A;  2PQQ A;  5C71 A;  1OUR A;  4P9I A;  3O0V A;  1WLD A;  1OBN A;  4RD7 A;  1FPN 1;  3GAL A;  4NJ4 A;  3IPV B;  2WS9 1;  2YBK A;  2EAL A;  3ORJ A;  1L7R A;  5F5C A;  2PHR A;  3ACF A;  1JUH A;  3J7N A;  1KGY A;  1VBB 1;  3BGA A;  3PNA A;  4OUM A;  3ZXL A;  2JIG A;  4GAZ A;  3WDU A;  3ZX7 A;  1O6U A;  3OGS A;  3I3E A;  5EV7 A;  2JEC A;  1MS8 A;  1OLM E;  3K48 A;  1SEF A;  4HET A;  1AYM 1;  5DAP A;  3B94 A;  3GBW A;  1RUE 3;  4Q4Y 2;  4TLG A;  2HWF 1;  2R06 2;  3DKW A;  4HON A;  3BB6 A;  5E16 A;  1BBT 3;  3DCQ A;  1MQT A;  3BOP A;  4QB6 A;  5H9S A;  5JZG C;  4XUT A;  2ZGS A;  4ZU5 A;  3RVH A;  3BKZ A;  4OHX A;  4XAC A;  5IFP A;  2BER A;  1CN1 A;  1JUI A;  3CDZ B;  2HEV F;  3NRU A;  2P17 A;  3BOD A;  5I0S A;  4N43 C;  1DQ0 A;  2RR1 1;  3WCS A;  2BFU L;  3M3Q A;  1S2E A;  2RMU 3;  3O5S A;  1XE8 A;  4YVW B;  3ZYH A;  3B9C A;  4QB2 A;  2WIN B;  3NNL A;  1Z7S 2;  4ERO A;  2PLV 1;  2RS3 3;  5FLJ A;  4QPI B;  2OS2 A;  5FP8 A;  1YI7 A;  2D6M A;  4P5H A;  5SV8 A;  3ZFE A;  1HXS 1;  4CU9 A;  3FLR A;  5IFT A;  3GDB A;  1HDK A;  4CZS A;  2WUH A;  3GZE A;  3WQ7 A;  3DKQ A;  2E31 A;  3WUC A;  4Z2A A;  1HRI 2;  2XJT A;  5C9A A;  3WG2 A;  5BNO A;  4DXT A;  2QQV A;  5F7U A;  1LGB A;  2VNO A;  2GH8 A;  5J09 A;  3AXE A;  1W8O A;  3FX3 A;  4QHZ A;  3U4S A;  1YJL A;  3I2J A;  3POF A;  4N53 B;  4CDQ A;  3VDC A;  4AQ6 A;  5CBL A;  3VBF C;  5L7O A;  1UZ0 A;  3MEP A;  2BGP A;  2FHR A;  2RM2 1;  1WCQ A;  2YFZ A;  4MV2 A;  3T4V A;  4D69 A;  4QWN A;  1B35 A;  2ZA9 A;  3FFZ A;  2VZO A;  4UW5 A;  4OLL A;  1WLT A;  3J9S A;  2VW1 A;  3WG3 A;  1ND2 C;  4E2G A;  2A3W A;  2WFF 2;  4E9K A;  5F3E A;  3TOJ A;  5FUI A;  5JSP A;  3VBO A;  3AP6 A;  2B39 A;  4XF4 A;  1FXZ A;  4BQ1 A;  4XDP A;  1C8M 2;  5FQ0 A;  2WZR 1;  1HB1 A;  1MQT B;  1W6Q A;  4XFH A;  1QXJ A;  5LBB A;  4ZU7 A;  1AR6 2;  3KF5 A;  1W8F A;  2DTW A;  1COV 1;  3K46 A;  3H8O A;  1CVN A;  3CJI C;  2WKK A;  3UJO A;  3ZIW A;  2D3P A;  4XQW A;  5IAT A;  1RUC 3;  2RJ2 A;  1MZF A;  3FN9 A;  2BJS A;  4YNI A;  4Z1V A;  4LXL A;  5JOY A;  1STM A;  4QPW A;  1U5Y A;  2IFR A;  4FI9 A;  4C1X A;  5FZA A;  2BEO A;  1W2U A;  3I54 A;  4PJY A;  4QU1 A;  1CAU B;  4UBH A;  2EVX A;  4UFJ A;  1FI2 A;  4P14 A;  1S1A A;  4CDX C;  4DY3 A;  4LMF A;  3WX5 A;  3ZFE B;  3FBY A;  1DYK A;  1OLR A;  1QDC A;  3ILR A;  3TN9 2;  1K5M A;  1TME 1;  3SHR A;  5FYY A;  4EWD A;  1EV1 1;  2E26 A;  1LU1 A;  2D93 A;  5JLV A;  3OY8 B;  4XDQ A;  3RG0 A;  1AVB A;  2EIB A;  1WCU A;  3PVB B;  4OHV A;  1PIV 1;  3ZSM A;  4AHZ A;  4X8N A;  2BTV C;  5C9A B;  3ZN6 B;  4P00 B;  3PLQ A;  5BNO B;  3KS7 A;  2WYF A;  4PLN A;  2ZAB A;  2QQU A;  1MR5 A;  2JDN A;  5T50 A;  2C9A A;  4CDQ B;  4GWI A;  4WM8 B;  4GB3 3;  5IVF A;  4RHV 3;  3U11 A;  5A7Q A;  3WNP A;  4YWA A;  5L7O B;  5C33 A;  2IXL A;  2X5I C;  4LQR A;  1NXD 1;  4RGA A;  1UF2 C;  4BDV B;  1G9F A;  4PHZ A;  4OQ9 A;  1LOB A;  5FLH A;  1VB2 A;  1R1A 3;  5DZG A;  2ADD A;  2VCM A;  5G04 L;  1ST8 A;  2VCB A;  5CKN A;  2KD7 A;  2I07 B;  3T08 A;  3V65 A;  2ZGM A;  5AVP A;  5KHG A;  4MGI E;  3VBO B;  4BB3 A;  1AR9 2;  2GC2 A;  3RPQ A;  1SCS A;  4Q4W 2;  1QJX 3;  5FQ0 B;  5FYV A;  1OF4 A;  5FZB A;  3S7E A;  2J1U A;  4GJY A;  3UES A;  4BQ4 A;  4HVQ A;  1YIP A;  1HB3 A;  2Q1Z B;  3SC7 X;  2W47 A;  1DQ4 A;  5DAV A;  3ACL A;  3KGL A;  3THP A;  2W94 A;  4XPV A;  5LW9 A;  5JZG A;  2DU0 A;  4AF9 A;  2VXR A;  1RMU 1;  3OSD A;  4CPB A;  1Y43 B;  1HIX A;  4CVU A;  3WY6 A;  1W6P A;  3C7G A;  4RQP C;  4S2D A;  2H6C A;  2X8K A;  1VMF A;  5T5O A;  5A70 A;  5A7N A;  1OMI A;  3U10 A;  1ULC A;  3UJQ A;  3ZM8 A;  1UCX A;  2AR6 A;  2PHF A;  3WIN E;  3WV6 A;  2OZJ A;  2X53 S;  2WSV A;  4IET A;  4RYD A;  4DMI A;  1AYN 3;  4CUC A;  2R04 3;  3T0D A;  1WBF A;  2ET1 A;  1GNH A;  4LK6 A;  5G05 L;  5LK5 A;  3OBZ A;  2EXJ A;  5K4L A;  3OEB A;  2ZMK A;  4G9S B;  3IKW A;  1W2T A;  5ANN A;  3ENR A;  1E57 A;  5K9Y A;  3O1R A;  1U5Z A;  5FYH A;  5A6Y A;  2WLP A;  1GLH A;  4ZU4 A;  2V5D A;  1YQ5 A;  1W05 A;  1IS3 A;  2Y6G A;  4LIV A;  5FOB B;  2QQO A;  1ZRE A;  1F15 A;  3CZU A;  3OGJ A;  2FCT A;  1YUD A;  1RGS A;  1SLC A;  2R0H A;  1K3I A;  1VBA 1;  4Y5S A;  5JPN B;  1Q56 A;  1X50 A;  3MZH A;  5H9P A;  2YGM A;  4LO4 B;  4UBG A;  4KWL A;  2RVA A;  4YM0 A;  1W2A X;  1QQP 2;  4JDM A;  3WOG A;  4DRR A;  5JUV A;  3DL3 A;  3SNM A;  1POV 3;  1QKQ A;  1F8V A;  2W95 A;  3WNN A;  1J3P A;  1SLB A;  4FVV A;  2XDV A;  3BTZ A;  3RZG A;  5JAX A;  1ND2 A;  2HWE 2;  1NAE A;  1QHD A;  4GD4 A;  2H6B A;  3V0A A;  1BLZ A;  3WEZ A;  1WW7 A;  4J1X A;  3GM8 A;  4X6Q B;  4AVA A;  3FHI B;  1O3T A;  1DLL A;  2BV4 A;  3LCP A;  2A5Z A;  5C8C A;  5DDJ 3;  2YG0 A;  1NXM A;  1O4Y A;  1WCD J;  3MHZ A;  3POB A;  1HRV 3;  3AVR A;  3AMN A;  2W39 A;  3CJI A;  2ZX0 A;  1JU4 A;  3UGF A;  3LEI A;  1D7P M;  5JXJ A;  1JZ7 A;  1IOA A;  3ILN A;  4V1P A;  1EPZ A;  1AL2 1;  4PIZ A;  1J3R A;  4LBO A;  4I02 A;  4QQL A;  4YGB A;  1KRI A;  5DUU A;  1NCR C;  5IK7 A;  4WBB A;  4CCD A;  5D1I A;  5FMD A;  1URX A;  1ZBE 1;  1N3Q A;  3I3D A;  4MZU A;  4CDX A;  3PTY A;  1HJF A;  4R8H A;  4ISQ A;  3SKJ E;  1IQD C;  2ORZ A;  2WAO A;  5GKA C;  4FP2 A;  3NJV A;  3OD4 A;  2Q8C A;  5F3C A;  4AFC A;  4H14 A;  1LHN A;  3RDI A;  4P9G A;  4CYD A;  5EJ3 A;  2XGX A;  2Y34 A;  1V9U 1;  3LA2 A;  2VMF A;  4Y1Z A;  2ID4 A;  4TYS A;  3LIG A;  4JRL A;  4QAW A;  1LRH A;  1LCL A;  3W9A A;  1W06 A;  4QQO A;  2GNT A;  1OQE A;  2NM1 A;  3A4U A;  4GWM A;  4UXA A;  2RE9 A;  3M1H A;  4OZX A;  1SQ4 A;  2G1M A;  3E97 A;  4LBK A;  2X5I A;  4XJW A;  1VBC 1;  5FZ4 A;  3D6E A;  3OB8 A;  5C3Q A;  5JOX A;  1AR7 1;  2C24 A;  1LHW A;  1H2N A;  5FYS A;  1AX2 A;  1ZZC A;  4K9S A;  5FPX A;  1DLC A;  1FOD 1;  4KBZ A;  5IAV A;  3SKV A;  2F4P A;  4BLJ A;  2XHK A;  3H3Z A;  2WLQ A;  1JHJ A;  3H1W A;  2GC3 A;  2J1E A;  4GUL A;  1W8U A;  1XB9 A;  1ZBA 2;  4HZF A;  1OOP C;  4I01 A;  4BWO A;  1QEX A;  1UZV A;  1WW6 A;  4JX0 A;  4YG0 A;  4E4D X;  3T2Q A;  3V0A B;  1AJO A;  1WZX A;  1XJA A;  2LAL A;  1EPW A;  2D6P A;  3Q8B A;  1POV 0;  4W8J A;  5FY1 A;  4CEY B;  4E2S A;  5LA0 A;  5C8C B;  3WDY A;  1QJY 3;  2JG8 C;  4K21 A;  4MGK E;  5HXM A;  1SFP A;  1W9Y A;  4ISR A;  2DVG A;  4BXS V;  5KC6 A;  1GAN A;  4XIL A;  1X9P A;  2F17 A;  1QJU 1;  1Y9Q A;  5AC9 1;  3LAG A;  5K0U C;  4MH0 E;  3H1M A;  4RQP A;  2Y60 A;  3PIJ A;  5J98 B;  4KH9 A;  2YBP A;  1W3V A;  4Z8B A;  4XBL A;  3RZM A;  4QKD A;  3IDC B;  2XWJ B;  1JMU B;  4AHY A;  5FXX A;  2VOX A;  2HJI A;  2QJV A;  2OKX A;  3U75 A;  4CXY A;  1J83 A;  2WII B;  4MXW B;  3W20 A;  4QPY A;  4UFL A;  1JYV A;  2P37 A;  2Q1F A;  5FZH A;  3FLT A;  3ZYB A;  3ILF A;  2VZT A;  2Y6F A;  4OHW A;  1PO2 3;  2JG9 A;  1ZZ7 A;  1RIT A;  1VE0 A;  2XBO 1;  4YW6 A;  3RWN A;  2ARE A;  3MIC A;  1T6G C;  2DBN A;  2GN3 A;  3THD A;  2K2S A;  3WF2 A;  1FMD 2;  2WQZ C;  1UYZ A;  3POG A;  5EJZ B;  3ZYP A;  1SBF A;  2JE7 A;  3K75 B;  1AR8 2;  3POI A;  2DDU A;  4Y22 A;  1QJZ A;  2VMD A;  2ADE A;  2R6Q A;  3LGR A;  4W6W A;  5CNA A;  3WQ1 A;  1GSL A;  2Q30 A;  2BBA A;  1SG3 A;  2ZTN A;  4B1L A;  4D7S A;  2HWB 2;  2W9X A;  3AP5 A;  3BPZ A;  3GBG A;  4YZ3 A;  2GND A;  2MNG A;  4BQ5 A;  4BQ2 A;  2FCU A;  3K3N A;  1GWM A;  2OUH A;  3JB4 C;  3OEA A;  4FFI A;  1TMF 3;  4XUQ A;  3KD4 A;  1W2N A;  1CZS A;  1BJQ A;  5FV3 A;  4E8C A;  3KLS A;  3AMQ A;  1VBE 3;  4IER A;  5I0D A;  4XW3 A;  5EXO A;  3JBG 3;  1ZA7 A;  1RUE 1;  4MHR A;  1J1L A;  4NII A;  4CDU C;  4F7Z A;  2YDE A;  1JU3 A;  3OBR A;  1BBT 1;  2A71 A;  3WD5 A;  5IK4 A;  3AP4 A;  3HOB A;  1OFN A;  4M4P A;  2W2I A;  2PHX A;  4N9I A;  2FBE A;  1UX7 A;  1CAW B;  4L2N A;  4CP9 B;  3POE A;  3LFI A;  1H1M A;  5E89 A;  1NY7 1;  1ZRD A;  1HN0 A;  3I7D A;  5LY2 A;  2G19 A;  4YW1 A;  2JB4 A;  4ASK A;  2JG9 B;  3DPR B;  4OCT A;  4AVC A;  4CDW C;  1QIQ A;  4GJZ A;  3C8X A;  2RS3 1;  4IV3 B;  3WP4 A;  1RL3 A;  2R1D A;  1RUI 1;  2FMY A;  2W5F A;  3LB9 A;  4B8E A;  3WP6 A;  4Q4V 3;  3VZK A;  3OGR A;  5IK8 A;  2K46 A;  2GMP A;  4PDW B;  5KHH A;  4O9E A;  1Q8P A;  5LAS A;  4Y22 B;  1XU1 A;  4JQT A;  4FFH A;  4FPG A;  5LA2 A;  5LRS A;  1ASJ 2;  4MUV A;  3AM2 A;  1JXN A;  2VBP A;  3J7H A;  3VKM A;  5FYB A;  1XND A;  3RMX A;  3KV9 A;  2BP6 A;  3AZW A;  2JDP A;  5F3G A;  1YEW A;  1QDO A;  3PUS A;  2VVF A;  4UW3 A;  4UWD A;  5DQ0 A;  4RFR B;  2ZML A;  1Z78 A;  2D44 A;  4R4X A;  5E1R A;  5FZ7 A;  3K4D A;  2OVU A;  4Q8L A;  5FYM A;  2ARC A;  5J3U A;  4P5Y A;  3R6S A;  5FYC A;  1DGR N;  1I3H A;  3PMS A;  4UT5 A;  2VEC A;  4UF0 A;  1AF9 A;  2JG8 A;  5J36 A;  2BUK A;  1WLC A;  1RIR A;  3PUH A;  5FYI A;  5LA1 A;  2JWP A;  5FPV A;  1O5U A;  5CZK A;  5AFB A;  4ZS3 A;  3HT2 A;  1RC6 A;  3D5O A;  1XOY A;  2EXI A;  3RJR A;  1IGO A;  4HPK A;  1OHF A;  1OLQ A;  1T2X A;  2D6N A;  1DHK B;  1ZRI A;  3LE0 A;  4XQD A;  1RUC 1;  1OI6 A;  5HCB A;  1QXR A;  2ZAA A;  1PMJ X;  5EWS A;  4JKM A;  5F5I A;  2VNG A;  3WW4 A;  5C3O A;  5CG8 A;  1GQG A;  2QBX A;  5FY7 A;  2H0V A;  3W5N A;  2QFE A;  5C3R A;  3VBR C;  2JIC A;  5CIS A;  4HFS A;  5IK5 A;  4QKF A;  4NRO A;  2PAM A;  1V70 A;  2WA4 A;  4U2A A;  3SMH A;  2DU1 A;  2QQM A;  2Q8D A;  4YW5 A;  1BXH A;  3FUQ A;  1X8M A;  1JHN A;  1MEC 1;  1RVF 3;  2IXC A;  3AP7 A;  4AEJ A;  1VAM A;  3GNE A;  5AFE A;  2B7Y A;  1L7L A;  2E32 A;  2R07 2;  3HBK A;  2XVL A;  3I3B A;  2YU2 A;  1L3J A;  4RA0 A;  3TNP B;  2RJK A;  4GB3 1;  1W0N A;  1WBL A;  4RHV 1;  4PBP A;  1RXG A;  2VMG A;  2OYZ A;  3IT8 A;  2VG9 A;  1CPM A;  2VQT A;  1SBD A;  2QCS B;  2JE8 A;  3GJB A;  1G9B A;  1V6O A;  1R1A 1;  2BDR A;  4YZ2 A;  4RS5 A;  5JCT A;  3HR9 A;  4M3C A;  4RN5 A;  4D6S A;  3ROU A;  4XIK A;  4DXR A;  2PYT A;  4YVW C;  4AK3 A;  5F37 A;  4LUK A;  2FDG A;  5GLW A;  4UF0 B;  2PHD A;  2YU1 A;  5BV6 A;  2WJS A;  2P1B A;  3MLJ A;  4QPI C;  2JX9 A;  4XBQ A;  1MZ6 A;  2D97 A;  3X29 B;  2UY9 A;  2HWC 2;  2WYS A;  1JW6 A;  2CDP A;  2EXK A;  1QJX 1;  3MIG A;  3WF3 A;  3T0A A;  3E5U A;  4CXW A;  2DUR A;  4XFA A;  1KQR A;  5GZC A;  2OPW A;  4BK4 A;  4TLF A;  4LBQ D;  2XOM A;  3OUI A;  4B4R A;  4IE6 A;  1S0J A;  2A3Y A;  4XQ4 A;  2JDY A;  4MYE A;  4HL0 A;  1R08 3;  3Q8A A;  4LHL A;  3RGB A;  2FZ2 A;  3TBD A;  1OUS A;  1RHI 2;  3OGG A;  1HRI 3;  1UQX A;  1WME A;  5BYN A;  2CHH A;  2YGL A;  4N53 C;  1VPH A;  5JI9 A;  4PF5 A;  3ZKU A;  1EAH 3;  4K40 A;  5FZE A;  2JJ6 A;  3WW2 A;  4BM8 A;  4EN0 A;  4P08 A;  4I0B A;  3B02 A;  3OPZ A;  1REF A;  2P4E A;  2WBK A;  4NPM A;  4YRD A;  4E27 A;  1WUV A;  4AI1 A;  3BYW A;  3BOW A;  2DV9 A;  1AYN 1;  1FPN 2;  2UWA A;  3IDB B;  2R04 1;  4SLI A;  4OI4 A;  3HAG A;  3THT A;  4QKB A;  3FHQ A;  3LDK A;  2HYX A;  3CU7 A;  4LJH A;  1KFU L;  2GC1 A;  3PVO A;  4AOC A;  4BQX A;  3S6P A;  1MQT C;  4OI0 A;  3WNX A;  1PM4 A;  1H1A A;  2VNR A;  4LIT A;  1ENS A;  4NR1 A;  1AYM 2;  2Y33 A;  2NN8 A;  1AR6 3;  3POW A;  1IPK A;  3TEZ A;  4BIS A;  1KFX L;  1HQL A;  5DN2 A;  4YSF A;  4XMI A;  2PN5 A;  1PX4 A;  2RS1 2;  2VZ3 A;  3VB9 A;  1SLI A;  1VBD 3;  1GNZ A;  1W03 A;  3HVD A;  1C3H A;  4RS5 B;  1W8T A;  2ZMN A;  3OG2 A;  4M3C B;  4BQY A;  1G7Y A;  2P5B A;  2MHF A;  2HKX A;  3LFM A;  1POV 1;  5F39 A;  4AI0 A;  3FL7 A;  3ZFE C;  4D94 A;  2RR1 2;  4EZ4 A;  1QJF A;  3GF6 A;  3Q8C A;  5GLT A;  3ZDV A;  3ZXJ A;  4M3C E;  3RYP A;  2EID A;  1NYW A;  3WDX A;  5M0T A;  3JU9 A;  3TN9 3;  5LRR A;  1VAV A;  2ORX A;  4FOY A;  3URF A;  2PLV 2;  1PHM A;  1WA6 X;  2W68 A;  4K1Z A;  3UK9 A;  4MGY E;  1G9C A;  1HXS 2;  2XLA A;  5C9A C;  3MIE A;  4HXC A;  5BNO C;  1Q5O A;  3R4S A;  4KU7 A;  5DDJ 1;  3KGZ A;  3NW4 A;  3U07 A;  1P8J A;  1O91 A;  4CDQ C;  4WM8 C;  1HRV 1;  4QQH A;  2C4X A;  4BOW A;  5A32 A;  5L7O C;  1UW8 A;  3B69 A;  3BCW A;  3PJY A;  4FAH A;  1HV0 A;  1DYP A;  4QX3 A;  3O12 A;  3QH6 A;  2C0Z A;  4NMI A;  4ORF A;  1R1Z A;  1JZ3 A;  1W8N A;  2IUW A;  5FZG A;  2CV6 A;  3H42 B;  1OLM A;  3IPV A;  2WFP A;  4IW3 A;  4MGZ E;  4Y1X A;  3KQR A;  5EYX A;  5I0U A;  1UN1 A;  1SAC A;  3EMR A;  2UYA A;  5JXI A;  5APA A;  1O7F A;  3SQO A;  1WGP A;  2R30 A;  3VBO C;  3MW4 A;  5KBF A;  2G9F A;  4XFI A;  3EJK A;  4XJZ A;  4GH4 A;  4JKK A;  4LTA A;  4YM1 A;  3TB0 A;  4AVV A;  4I3P A;  3AVS A;  4IEQ A;  4D3W A;  4I2O A;  2E9Q A;  1X82 A;  5D8A A;  5BXX A;  4AL9 A;  5L73 A;  3HEI A;  5IVE A;  2WZR 2;  1XU2 A;  3I8T A;  3POS A;  2IC1 A;  1GYK A;  1COV 2;  1LEN A;  1UAI A;  2VXJ A;  4HSJ A;  4IES A;  3SXW A;  3H0O A;  2IFW A;  1W6M B;  1YLL A;  1ENR A;  1LOF A;  2X09 A;  3AKT A;  2OX0 A;  1YQ2 A;  2VNV A;  5A7O A;  1KJL A;  2O8Q A;  2Y6K A;  5JOZ A;  4R9A A;  3VV1 A;  4OUE A;  1K5M C;  3IMN A;  1SFY A;  1KEX A;  4H55 A;  2VJX A;  1DGL A;  4BHP A;  3Q8E A;  2UU8 A;  1APN A;  1F31 A;  2VZR A;  1ODN A;  3WW3 A;  2HH9 A;  5KWR A;  2GSY A;  2VUD A;  1QJY 1;  4NRQ A;  4QXH A;  5FO8 B;  1NQJ A;  1EV1 2;  3N7K A;  1MVE A;  5CEH A;  4EYU A;  1UIJ A;  3OGV A;  3AJZ A;  1XE0 A;  1RUD 3;  3IAP A;  5A32 B;  2VZU A;  1PIV 2;  3DYM A;  3THC A;  5C5U A;  5GLZ A;  1W04 A;  3H50 A;  1TNR A;  4N53 A;  1SDD B;  1PGW 2;  2EXH A;  2NZ9 A;  3DEC A;  1QOO A;  4I0W B;  4A3Z A;  2YYO A;  2BZD A;  1CIY A;  3AL5 A;  4GH4 B;  2ZEX A;  5FWE A;  1F4A A;  1BHG A;  4NPL A;  2QQK A;  4XE9 A;  4B4Q A;  2C9K A;  1R09 3;  2X10 A;  1Q8S A;  1ULD A;  2AZ5 A;  3NMB A;  3INA A;  4XF0 A;  5D8A B;  4A42 A;  2YRO A;  2DCT A;  3AYE A;  3OOX A;  1PO2 1;  1HLC A;  4N7U A;  4ZZ5 A;  3O0W A;  3OUJ A;  4JAA A;  4DO0 A;  5FZ8 A;  1QH7 A;  2IXH A;  4QX0 A;  3ACH A;  5KR7 A;  3T30 A;  4NOT A;  3T2O A;  3VD9 A;  1TG7 A;  3NWK A;  5ACA 3;  3PUQ A;  1SPP A;  5J96 B;  5FBZ A;  4Y24 A;  1IKP A;  4KGQ A;  5EYY A;  1PX3 A;  2UY8 A;  2XLF A;  4YG6 A;  5LBC A;  1RMU 2;  3N9M A;  4Y26 A;  5HBA A;  2ARA A;  1K5J A;  4AVS A;  4EN6 B;  4AAX A;  2ZGL A;  2WWJ A;  3EBR A;  1CAU A;  3ZR5 A;  2XJS A;  1FAT A;  2LW8 A;  3NO8 A;  4LT5 A;  1M06 G;  1NQD A;  4R4Z A;  2VUC A;  2VW0 A;  3H8U A;  1BZW A;  1CZT A;  4DPN A;  5L36 A;  3OY8 A;  4IEO A;  3DN7 A;  1HW5 A;  1U5I A;  3DXU A;  1TMF 1;  3III A;  1Q43 A;  5DZF A;  3AMH A;  3ZN6 A;  4CP0 A;  3P3N A;  3N7L A;  3ZYF A;  5CFD A;  1OD5 A;  3O7O A;  3JBG 1;  4LBN A;  3NNM A;  4QDQ A;  2Z4F A;  2A3X A;  5FXW A;  1N1S A;  4WM8 A;  2NP0 A;  4A2U A;  3LOB A;  1Q8V A;  5F2S A;  1OFS A;  3UKN A;  2XG3 A;  2GME A;  4N9H A;  1G9A A;  1UPI A;  3ZFF B;  3P6B A;  1VBA 2;  3A23 A;  2BNN A;  2C1F A;  5EJ1 B;  4AW7 A;  4M01 A;  5FPZ A;  2ENR A;  3TAY A;  4COW A;  3MLL A;  3MGU A;  4I09 A;  4MG2 A;  2CWM A;  1O8S A;  2C26 A;  4IEW A;  1ZRC A;  5LBE A;  2D5F A;  3AFG A;  2RDQ A;  3J8F 2;  4FBF A;  4MVT A;  4CEY C;  3VKF C;  5C8C C;  2UWB A;  2XJP A;  3N9N A;  2B8M A;  1W39 A;  5JR7 B;  1A8M A;  5J48 A;  2UYB A;  1DF0 A;  1UZY A;  3JD7 2;  2A1X A;  3OTF A;  1XPW A;  4AR2 A;  2ZOE B;  3ATG A;  1SPP B;  4Q4V 1;  2WNE A;  1FNZ A;  4YFZ A;  4AI2 A;  2E7T A;  1GR3 A;  2WDB A;  1GQH A;  2PAK A;  4EN8 B;  1QY4 A;  2W52 A;  4OZO A;  3T1M A;  1SLA A;  5HV0 A;  5KHJ A;  1V0A A;  5A6Z A;  5DG1 A;  3IAQ A;  4UFH A;  4JRA A;  2P3Y A;  5ANQ A;  1VMH A;  2VOV A;  2WSU A;  1BEV 2;  3D0J A;  3JZV A;  1Z0H A;  4FXK B;  5FZ3 A;  3UYJ A;  4ZZ8 A;  5BNQ A;  1AL2 2;  3AB0 A;  4KL1 A;  2BBV A;  4BZ4 A;  3TEW A;  3PL0 A;  4AHW A;  2QQL A;  3T0B A;  1QNW A;  2E7A A;  1ZBE 2;  1BK0 A;  3HNB M;  1RUH 3;  5C3P A;  2DCY A;  1QJE A;  3A0N A;  3VDA A;  2MEV 3;  3V64 A;  1UU4 A;  2DBI A;  5CFD B;  1VRH 3;  1A34 A;  1J84 A;  4ES9 A;  1W99 A;  4HBN A;  4XCB A;  5JR2 A;  3OPW A;  1DGW A;  3U37 A;  5A3U A;  1ZZB A;  3BTA A;  2XQR A;  1V9U 2;  3GHN A;  2ZGT A;  2XWB B;  1FMD 3;  2JIJ A;  1XNK A;  4YW7 A;  1TZO A;  4JC1 A;  5IJR A;  5IVY A;  3TEY A;  4IEY A;  3ELN A;  1X33 A;  2CYF A;  2O8O A;  4A7K A;  1VBC 2;  5CKQ A;  1UMI A;  1UWW A;  4HVO A;  1AR7 2;  1D4V B;  4YG3 A;  3WHU A;  2JEN A;  4DNY A;  5EPA A;  2P3I A;  3NKT A;  1FT9 A;  2FDI A;  3ACI A;  1LHO A;  1MPX A;  3C7O A;  2XR4 A;  3M4F A;  3F95 A;  2CGN A;  4FPJ A;  4LKD A;  4NHX A;  3CLP A;  4UI9 L;  4QDR A;  3K51 A;  2W1W A;  4CU6 A;  4MGQ A;  2FDK A;  1D2S A;  1CQ9 A;  4KU8 A;  5CA6 A;  4M0H A;  1C4R A;  2LRP A;  1HQN A;  4RGK A;  5ABJ B;  1RVF 1;  1XYN A;  3CHX A;  3T2T A;  3AYD A;  3HD8 B;  4AI3 A;  4DXZ A;  1WMF A;  1UY2 A;  5I8Y A;  2O0O A;  2VTX A;  5I8T A;  4WVZ A;  3NAP B;  3GXU A;  5FWJ A;  4XJU A;  5FK7 A;  3FWE A;  5A6X A;  3U4X A;  1UYP A;  4H2A A;  1POQ A;  2WO7 A;  1OVP A;  4GWN A;  2AAC A;  2JG9 C;  3DPR C;  4ATF A;  3WDW A;  4IV3 C;  5FXV A;  2YPJ A;  1OVS A;  3WF1 A;  1ONA A;  3OJB A;  4NAO A;  2Y26 A;  2D40 A;  1XE7 A;  4QXB A;  1OKO A;  4FXG B;  3HNY M;  4NO4 A;  2VQ0 A;  4PDW C;  1WCS A;  1LEM A;  5I0R A;  3I2D A;  4Q27 A;  3WSO A;  1IS6 A;  3PVN A;  1PVC 3;  1R08 1;  3SCF A;  4XMA A;  5DAQ A;  2BPA 2;  4IE7 A;  1HRI 1;  4WVM A;  3ZYR A;  1E5R A;  5L19 A;  3VZL A;  4CCM A;  2VQU A;  1EAH 1;  3WG1 A;  2CGO A;  1RUJ 3;  4L97 A;  1CJD A;  4CUB A;  3ZDS A;  2CAV A;  1LOG A;  3ZFG A;  4CEY A;  4Q5O A;  4KQ7 A;  4OUL A;  4W50 A;  2DCK A;  4KI5 M;  2XUE A;  3AK0 A;  5FPA A;  3UGG A;  2W1U A;  3WF0 A;  4B7K A;  4FTE A;  5KXB A;  4XFC A;  1UOJ A;  5FZO B;  4HKL A;  2I74 A;  3OBT A;  4JVA A;  1L7Q A;  2JDA A;  4L99 A;  2XQX A;  4Q4X 3;  4E4S A;  1QWR A;  4FSJ A;  5FZ0 A;  1H2M A;  4AGR A;  2JB8 A;  4CUG A;  1AR6 1;  2A6Z A;  2RHP A;  1RUE 2;  4FTS A;  2L9L A;  3L9J T;  2UUR A;  3MFA A;  4K6B A;  4FPO B;  2AEY A;  2RG4 A;  5FZI A;  2X05 A;  5CG9 A;  1BBT 2;  4P9W A;  5FY0 A;  1O4Z A;  1VBD 1;  4N7I A;  5F32 A;  3G6J B;  3LQC A;  4CCL A;  4AG4 A;  3IM0 A;  3DV8 A;  4CCJ A;  3E6D A;  3D3A A;  3HMY A;  4MXW A;  1W9F A;  5I0T A;  1W6N B;  4Y3O A;  3R4D B;  3WNL A;  1NY7 2;  1DQ6 A;  1Y9M A;  3VKN A;  2E51 A;  5FCC A;  3M3E A;  3S57 A;  4PT6 A;  3KSC A;  3MPB A;  2P6C A;  3AZY A;  1ODM A;  1AXZ A;  2DCZ A;  2JXA A;  2W87 A;  4OUS A;  4R52 A;  3TN9 1;  1CGP A;  3D0S A;  2RS3 2;  3VHO A;  4G3Y C;  4QU2 A;  4QM8 A;  3WQB A;  4B1M A;  5FMC A;  3ZN4 A;  4I30 A;  1RUI 2;  4PLM A;  1JH5 A;  2A6X A;  3AJY A;  4WVM B;  2W1S A;  3H8X A;  1JOP A;  3ITQ A;  5DUV A;  2HWD 3;  4IEU A;  4TXW A;  4XF3 A;  3CZJ A;  3ZXE A;  3HQU A;  3C7E A;  2WZ8 A;  3QCW A;  4OFG A;  1ACC A;  2AEN A;  3K4A A;  4QHO A;  4EQV A;  3ZFG B;  3TRS B;  3AKR A;  3E5Q A;  2E53 A;  3MLK A;  1YO8 A;  1US3 A;  3SIS A;  2CL2 A;  1OH3 A;  4Q0P A;  1JTZ X;  4H7M A;  1DG6 A;  1W6O A;  5JSR A;  2YXS A;  4I3G A;  4W65 A;  3VL9 A;  4DZG A;  5A3L A;  3WDT A;  1BCX A;  1CES A;  3N3H A;  4JKL A;  1WMX A;  5FPU A;  4OHY A;  2VMI A;  5C70 A;  2XLG A;  4LK7 A;  5DAX A;  5F5A A;  5GM0 A;  3ZN5 A;  4W6Y A;  3VLB B;  5CVR A;  1BVV A;  1REE A;  1WWY A;  1G8W A;  1YHF A;  3H7Y A;  2UWC A;  4OQ8 A;  3N9L A;  4MOA A;  3VBH B;  1V6J A;  4M0N A;  2RS5 2;  5LBF A;  3E5X A;  3PUR A;  1E5I A;  4BA6 A;  2QQW A;  1CAW A;  1PO1 3;  4CP9 A;  3N9Q A;  3HN1 A;  2BRT A;  1DIW A;  2TEP A;  4GZ9 A;  3LEG A;  2J42 A;  4KNC A;  4GXL A;  4BQ3 A;  1LB2 A;  2D6K A;  4XAE A;  1PGL 2;  3PVE A;  1T6B X;  3Q8F A;  2VME A;  4XEZ A;  1X7N A;  3AP9 A;  3DPR A;  3N35 A;  3KCC A;  3OF1 A;  4LKE A;  4CEW B;  1PK6 A;  3QAC A;  2OQ6 A;  2X29 A;  3QOP A;  3CEW A;  4IV3 A;  3SLI A;  3NNF A;  2JKX A;  4FAG A;  1D4M 1;  4AI8 A;  3WNK A;  5DXD A;  3ZPO A;  2BWA A;  4RSU A;  5FAX A;  2OII A;  4PDW A;  3EYP A;  4C1W A;  4FTB A;  4ZON A;  2LS6 A;  4LO7 A;  3NJZ A;  1RUD 1;  4NHL A;  4NRP A;  5EQU A;  1N1Y A;  1OF3 A;  5A6Q A;  1MEC 2;  4QX1 A;  1DP0 A;  4GQ7 A;  3B9I A;  3NV4 A;  2RS1 3;  4RS5 C;  1GZC A;  3ZSJ A;  4Z92 B;  2R49 A;  2GAL A;  3MUZ 1;  4BU2 A;  3KV5 A;  2VTF A;  1OKQ A;  1BKZ A;  2W92 A;  1W6O B;  5CFC B;  4MGT A;  3RZK A;  5FRA A;  2VD7 A;  3K3O A;  1R09 1;  2VUL A;  1RJ8 A;  4HLT A;  4BJ0 A;  2VTX J;  1V6M A;  3UT0 A;  2FCV A;  5FKC A;  1Y3T A;  5T55 A;  1QJX 2;  4IXL A;  4WM7 A;  1UO9 A;  3H8R A;  4A7Z A;  2Q4S A;  2JDK A;  5IHR A;  4FOW A;  5LK7 B;  1UZW A;  3OUH A;  2BGC A;  1NLQ A;  1UMH A;  5ACA 1;  4Q0U A;  4URT A;  2ZX1 A;  1OT5 A;  2CY6 A;  4X6R B;  1C1F A;  4XDO A;  2Y8K A;  1VJ2 A;  2RMU 1;  1H0B A;  1H8V A;  1E5H A;  1PK6 B;  5FZM A;  2VZQ A;  3IBM A;  1J1T A;  4YYO A;  4N8M A;  3KT1 A;  4PIY A;  5FMB A;  1IS5 A;  1QNY A;  2QVS B;  4S2F A;  1QH6 A;  2P6H A;  1UOF A;  4M00 A;  1AYN 2;  4LO6 B;  4DB5 A;  3BU0 A;  1YRZ A;  2R04 2;  4L11 A;  3A21 A;  4DY5 A;  4ZPI A;  3SH4 A;  4XET A;  1NOV A;  1C8N A;  3MW2 A;  2DVD A;  4LE3 A;  3VL8 A;  4F83 A;  1HJG A;  3ZXF A;  2D6O X;  1V6N A;  1OXC A;  1CZV A;  2PHW A;  2QKD A;  4Q0Q A;  2V72 A;  2A7A A;  2OZ6 A;  2RDR A;  2V09 A;  3GBF A;  1GKB A;  2W3J A;  4FCA A;  1QOS A;  3LKJ A;  2FD8 A;  5FY5 A;  4ZY9 A;  3WNO A;  3S5Q A;  3HQX A;  3SEE A;  3OPT A;  1F9K A;  1RUG 2;  3ECQ A;  1K42 A;  5KC5 A;  1RUF 3;  1MS4 A;  5IW0 A;  1N3P A;  4EV0 A;  4GMP 3;  1HV1 A;  3P1I A;  3WLU A;  2VOW A;  1AHS A;  1MZE A;  5GZG A;  1GZW B;  4MHU A;  4YVS A;  1ND3 A;  2DWR A;  5JIU A;  2GZW A;  4LOR A;  4WV8 A;  4CU7 A;  1QMJ A;  4R9B A;  4AI9 A;  5FY9 A;  5LAT A;  4ES8 A;  1ULO A;  4K20 A;  1IPS A;  3S7I A;  5JDB A;  2CSG A;  4WM7 B;  3RJ2 X;  3ZO0 B;  1WD4 A;  3RS6 A;  4H3W A;  3T1L A;  4ET7 A;  1U12 A;  3VZJ A;  1XNB A;  3HWJ A;  1C5H A;  3PIG A;  1YNA A;  1S0C A;  2ZHK A;  4LBL A;  1GNY A;  5IWF A;  3RRD A;  3O1U A;  5I93 A;  4HVR A;  3MYX A;  2VY0 A;  2YFU A;  2Y38 A;  3AMP A;  3T09 A;  2VQA A;  5C4W A;  3FJS A;  1CAV B;  3MID A;  3I97 A;  3LOI A;  4QB1 A;  1LTE A;  3MFC A;  4GH4 C;  3ES4 A;  5GJ6 A;  1IZ3 A;  3WQ0 A;  1U0A A;  4LO5 B;  3PME A;  3WZ1 A;  3IDE A;  4UW4 A;  3VDB A;  5GLV A;  4ITC A;  1ZZ9 A;  5D8A C;  2YB7 A;  1RUH 1;  4Q4Y 3;  4CXX A;  4YPJ A;  1JYC A;  1ENX A;  2R06 3;  2MEV 1;  3BU7 A;  1YXW A;  4IE5 A;  4CUA A;  1VRH 1;  2JD9 A;  3LD8 A;  2JE9 A;  5FIX A;  2R7E B;  4XOG A;  3WG4 A;  4IV1 A;  4OYU A;  1YC6 1;  3RFR A;  5EHD A;  5T5L A;  2VH9 A;  1JZ8 A;  4LHS A;  2IWG B;  4DUV A;  1KIT A;  3DUI A;  1YI9 A;  1LOF C;  2A6Y A;  5FPL A;  2HBU A;  1BMV 1;  2N7G A;  1FMD 1;  4IUG A;  5FJH A;  3N36 A;  3W58 A;  4A7Y A;  2DTY A;  1J3Q A;  4NID A;  1H8T B;  1XQN A;  3ME2 A;  1DBN A;  1WW4 A;  4FFG A;  1N3O A;  2B42 B;  4YVS B;  1HKD A;  1ND3 B;  2RJL A;  4FOQ A;  3VKL A;  1N1T A;  1UNB A;  1Z7S 3;  2WN3 A;  5B4N A;  3H3L A;  2YZ4 A;  4TZD A;  1MS9 A;  3MV0 1;  3TNQ A;  1AXK A;  3B00 A;  5BNN A;  4QX8 A;  2QUO A;  4XF9 A;  4GMP 0;  5DPN A;  4L8Q A;  1UYY A;  2OXB A;  2K9Z A;  2VZV A;  3PU8 A;  4HKW A;  4NVP A;  4Y33 A;  2BGO A;  4AYU A;  3RZH A;  1GWL A;  1V6K A;  2OUJ A;  1QJY 2;  2WWS A;  5A3T A;  3W5M A;  1WD3 A;  1E5S A;  4QPG B;  4O61 A;  4FQ4 A;  1W28 A;  3RYR A;  4KMQ A;  1LHV A;  1QF3 A;  4B4P A;  2QDN A;  5C4W B;  1UPS A;  3NL1 A;  4F8A A;  3WP3 A;  4R9D A;  3P5B A;  4UAP A;  1LNS A;  2WS9 2;  5FYU A;  3M3C A;  1UXX X;  4YAR A;  1DQ5 A;  2DUO A;  1VBB 2;  1CIW A;  4IGO A;  2WFF 3;  1QGL A;  2VCA A;  4WVV A;  3OBA A;  3N9P A;  4ARX A;  1LED A;  5GZF A;  3J8F 3;  1C8M 3;  3I2I A;  3LA7 A;  2XKP A;  4MX3 A;  4QGM A;  4IV1 B;  3L2Y A;  1RIN A;  2HWF 2;  4JDO A;  1S2B A;  1UU5 A;  3EQE A;  3E1F 1;  4KBB A;  4URA A;  2Q5T A;  1MVQ A;  1UXZ A;  1PO2 2;  3JD7 3;  4RFT 0;  2KM2 A;  5B4X A;  1BVP 1;  4Q1R A;  2ES3 A;  4ZHN A;  1N1V A;  3SIT A;  4DS0 A;  3K2O A;  4BK5 A;  1O59 A;  2YPD A;  1BK1 A;  1UZZ A;  4LKS A;  3I3M A;  3UKT A;  2J1S A;  4NRM A;  2XJU A;  1W6M A;  1PVC 1;  2NMN A;  1X9T A;  5E88 A;  1DYO A;  5JIA A;  1YFW A;  4AED A;  1UY1 A;  4WVW A;  4AVB A;  2EA7 A;  2FDJ A;  2JEM A;  2ZHM A;  1BEV 3;  4MET A;  5JOW A;  3IZO A;  1RUJ 1;  2VMH A;  1F5J A;  2YC2 A;  3R05 A;  1PNG A;  5BNN B;  5A33 B;  1D2Q A;  3EO6 A;  3CBN A;  4XUO A;  1J59 A;  5FZ6 A;  5HCA A;  1GQP A;  4COZ A;  1AX1 A;  2BNO A;  2Y0O A;  5CFD C;  3RNS A;  4IEP A;  1ULP A;  4FPF A;  4MAD A;  2WNU B;  1W8H A;  1OUX A;  3BIE A;  2CAU A;  3ZMN A;  2B45 X;  4X8P A;  1DQ1 A;  1AX0 A;  1TMF 2;  2ATF A;  3UL2 A;  3ZOI A;  4E8D A;  5T3N A;  1JYN A;  3GCX A;  2ZEZ A;  4BLI A;  4A3X A;  3DEM A;  3RMY A;  4AHX A;  4Q4X 1;  5JXH A;  1RJ7 A;  1RYY A;  1W8Z A;  1ZX5 A;  4D6R A;  2ZHL A;  2W1Q A;  3USU A;  3SH3 A;  3VBU B;  2G9G A;  3POY A;  2RM2 2;  4AEK A;  2OQ7 A;  2VW2 A;  5FK8 A;  2VL4 A;  4Z07 A;  1JYX A;  1VB4 A;  1OD3 A;  4FFF A;  3B3Q E;  1VBC 3;  4QQP A;  1DU3 D;  1UY0 A;  1D0G A;  1IQA A;  3MIF A;  1AR9 3;  4HSL A;  3H9A A;  4Q4W 3;  1GUI A;  2P34 A;  2AC1 A;  1UYX A;  4EZH A;  1ZRF A;  2GDF A;  1S0B A;  4JCK A;  4KWU A;  1TNF A;  3H7J A;  3IN9 A;  2W08 A;  4MO3 M;  4NAM A;  3VHP A;  1KS5 A;  4IGP A;  4CP1 A;  5ABJ C;  1I9R A;  3AYA A;  1GOH A;  4NWV A;  4C90 A;  5BNP B;  1UY3 A;  4ZS2 A;  4CCE A;  4AED B;  2QQJ A;  5FZF A;  4GAL A;  4CP2 A;  3GZA A;  2VOT A;  5BPX A;  2HWD 1;  3ACG A;  4CA9 A;  2A6W A;  4CPB D;  3K77 A;  3NAP C;  4KG8 A;  2TUN A;  5GAL A;  1VR3 A;  1PZ9 A;  3A7Q A;  3NV3 A;  4DUW A;  1H6Y A;  1V6I A;  5JXG A;  1Q8O A;  1TME 2;  1YQ8 A;  3MV1 1;  3UKV A;  2VVE A;  2WNV A;  3N7M A;  4LE4 A;  2BVV A;  4LLO A;  1AL0 G;  1UX6 A;  1VAK A;  3KZ4 C;  4NWW A;  2QZ2 A;  5HPO A;  4AVT A;  2LTN A;  5F6K A;  1OPM A;  2PEL A;  1UD1 A;  4NHK A;  4XFB A;  4PLO A;  3DYO A;  4KG0 A;  4XTP A;  2DVB A;  2Z42 A;  1C57 A;  1VRB A;  3C3V A;  3USU B;  4Z82 A;  1I5P A;  3ZFF A;  4COY A;  3LIH A;  3LDR A;  3BTY A;  1QQP 3;  5I91 A;  3SCH A;  4TSV A;  2GNM A;  2AGS A;  3APB A;  5BUV A;  2W0X A;  2IXJ A;  4Y1Y A;  5FP7 A;  3KM5 A;  1PO1 1;  4JTO A;  5KHI A;  2PHU A;  4BH9 A;  1Y9G A;  5CKM A;  3VD7 A;  4YGE A;  1KDK A;  1G6N A;  2HWE 3;  4ATE A;  4AXO A;  2BWC A;  3E6C C;  5LY1 A;  2Y64 A;  5A80 A;  2FMD A;  3FBM A;  3RZZ A;  1CJP A;  2XB6 C;  2I2S A;  1W0O A;  2XON A;  4QGN A;  5L9R A;  4DEV A;  4FT8 A;  3QBQ A;  4XFG A;  3MF6 A;  3KCX A;  2BNM A;  1KXG A;  2YHJ A;  3AZV A;  3U78 A;  2FZ1 A;  3A22 A;  3JB8 A;  3VBR B;  2ERF A;  1JZ4 A;  3Q9O A;  3VBS B;  4CE8 A;  2WT0 A;  4J6G A;  3I2H A;  2GP3 A;  2XUM A;  2CNA A;  2KA3 A;  4XIO A;  1RVF 2;  3C2U A;  2VU9 A;  4AZZ A;  1GP5 A;  2HEW F;  4AFD A;  3DF0 A;  3ZXG A;  4A44 A;  2RS1 1;  2JDM A;  3HQR A;  3NQH A;  4XFF A;  1UY4 A;  2ZX2 A;  4P9X A;  4XJ9 A;  5LWB A;  3LSD A;  3O1S A;  4C91 A;  2ZPX A;  2WNV B;  1ZNP A;  1HQW A;  3AZZ A;  1LES A;  1DZQ A;  1NA1 A;  1VBE 1;  4BE3 A;  3MO4 A;  4JGZ A;  4KWJ A;  4IEV A;  1B09 A;  1YFX A;  2R0F A;  3GGL A;  3CJX A;  4BYY A;  1LR5 A;  4LBQ A;  4COV A;  4C8D A;  1XRU A;  4IE0 A;  3NST A;  3O14 A;  1DCS A;  1SLT A;  1LOC A;  2WNO A;  3ES1 A;  4PQ9 A;  4AAP A;  2BQP A;  4XF1 A;  2Z2S B;  1UL9 A;  3HNM A;  4CCC A;  1JOB A;  5F2W A;  3RI8 A;  1RUI 3;  1GU3 A;  5DAB A;  4P9L A;  4QT6 A;  1RB8 G;  2CTV A;  5FMO S;  4HAN A;  5FBJ A;  1XBF A;  4B7E A;  5F9T A;  1H4G A;  4P9J A;  1R08 2;  4A4A A;  3WP5 A;  5FZL A;  5HCH A;  4JV4 A;  1MS0 A;  1ZBA 3;  2D6L X;  3ZFG C;  2B9U A;  1EAH 2;  2K0G A;  2WT1 A;  3E6B A;  1F4H A;  4HK9 A;  4NIH A;  1RTV A;  4LHN A;  1UOB A;  4W6X A;  1JN2 P;  1C1L A;  3S30 A;  4LHK A;  1R64 A;  4OI2 A;  1GOF A;  2VPV A;  1LJ7 A;  3VHR A;  4FP3 A;  1QOT A;  2XL7 A;  4YW3 A;  4XAB A;  5FP3 A;  1NCQ A;  3PJQ A;  1H1I A;  1OPO A;  3KV4 A;  2VZP A;  2DVA A;  4Y4R A;  4D7Y A;  1SZB A;  5ABJ A;  1W90 A;  1VAL A;  1C5I A;  1GWK A;  2WA3 A;  1XNT A;  4LNV A;  3VBH C;  5A7W A;  3VKO A;  4OMD A;  3L2H A;  4PBO A;  2FQP A;  5T5P A;  1O8P A;  1GOG A;  2RS5 3;  3NAP A;  3J7M A;  4KWK A;  3RZL A;  4L92 A;  2ZKL A;  1PVX A;  5EIY B;  1Y7B A;  3HT1 A;  2P3J A;  4FPY A;  1NE6 A;  1VBD 2;  1RUF 1;  2DUQ A;  2Y6J A;  3NVC A;  5FDB A;  5FP4 A;  2DVF A;  4D8M A;  4DQA A;  4Y5T A;  4GMP 1;  3JQX A;  1NA1 B;  4CEW C;  2ZGN A;  4JGZ B;  2IXI A;  3ZR6 A;  2PTM A;  3PHM A;  4CCO A;  4CCK A;  3FE5 A;  2ZX3 A;  3MIH A;  4JDN A;  4LBQ B;  4JGY A;  3ZYI B;  2Y6L A;  4QMA A;  1Q8Q A;  4BQW A;  4RR3 A;  1JZ2 A;  2XHN A;  1W3X A;  1NT0 A;  2OA2 A;  2XL9 A;  3EXU A;  1OA3 A;  4BPZ A;  1OA2 A;  2A70 A;  5LB6 A;  1AR8 3;  1VIW B;  4A6S A;  2VZ1 A;  2XVG A;  1XXN A;  3FFQ A;  3WR0 A;  4JHT A;  3POJ A;  5KXE A;  3WHT A;  4Q1P A;  1MEC 3;  5A3M A;  2HWB 3;  1J58 A;  3F2Z A;  4PI2 A;  1FOD 2;  1YIF A;  3KCY A;  2WN2 A;  4XJ8 A;  2JDU A;  3VDD A;  1ZYB A;  2ZBJ A;  3NNG A;  4UFK A;  4BXF A;  3VZN A;  1NKG A;  3RZJ A;  2FDF A;  3WF4 A;  1CPN A;  1CX4 A;  2J1V A;  2YC4 A;  2GMM A;  2WQ4 A;  1FYU A;  1PGW 1;  4GA9 A;  2BU9 A;  5CFC C;  2Z5W A;  3O1V A;  1JZ5 A;  1FX5 A;  4Y1U A;  3M7A A;  3K4Z A;  3A0K A;  1B35 B;  1W8W A;  1CWP A;  1EP0 A;  5CAD A;  5FXZ A;  1NCQ B;  4BCU A;  4FO9 A;  5FZO A;  2B46 X;  4XYX A;  4Q4Y 1;  1W9T A;  4BIO A;  4RGG A;  2R06 1;  2EIC A;  2WO1 A;  1LGN A;  5A7W B;  1QJU 2;  1PGS A;  3ZVX A;  3T4H B;  5AC9 2;  3NNJ A;  1W6Q B;  2VR4 A;  5CB7 A;  5B2G B;  5H9Q A;  1NX9 A;  3KF3 A;  3LZZ A;  2NMO A;  1YFY A;  3CO2 A;  3QD6 A;  1RED A;  3O0X A;  1S4C A;  3FZ3 A;  4JHZ A;  1GFF 2;  4AFB A;  4DOU A;  1XYP A;  2JDZ A;  2VAU A;  2Z79 A;  4A45 A;  2PXJ A;  2VGD A;  3D4K A;  1PK6 C;  4V2V A;  1W6N A;  1LEC A;  2PAE A;  2TBV A;  2LUW A;  4CTE A;  5C8W A;  2A73 B;  3SEP A;  1LHU A;  1YQC A;  3IMM A;  4N43 A;  4XXP A;  4M4R A;  1Z7S 1;  3R0R A;  3D8C A;  4JGY B;  1JYW A;  3EHK A;  4QX7 A;  2ZGP A;  3LF7 A;  4ZXK A;  4RR3 B;  5E8A A;  3IDA A;  5ERL A;  5K7P A;  2XBO 2;  5FZ1 A;  1K5M B;  1AJK A;  2D43 A;  1PZ8 A;  3J26 N;  4K7J A;  2XJR A;  3BUC A;  3ZLI A;  1D4M 2;  4JTN A;  2BFU S;  4PF1 A;  2A6V A;  4HOO A;  2JDH A;  2QNK A;  1ASJ 3;  4JQR A;  4DEQ A;  4AEM A;  4R9C A;  4IND A;  1IHM A;  3MPP G;  2B5H A;  1NZI A;  2ZEY A;  3MF9 A;  2B4K A;  3VDD B;  1RUD 2;  5JSO A;  4E2Q A;  5D21 A;  3IWZ A;  4OVE A;  1UKR A;  1LOD A;  5FRE A;  2ZXQ A;  4XAA A;  1CON A;  3B01 A;  4IQP A;  1RUG 3;  3H3U A;  4A41 A;  3U0Z A;  5LCW L;  5KXD A;  3IB3 A;  2ET7 A;  4M3C F;  4OMC A;  2WZP P;  1ZZ8 A;  4HKO A;  1O5L A;  2WFF 1;  4FQZ A;  3VBF A;  3CNA A;  2XJV A;  3UGH A;  2DYC A;  2JD4 A;  3UV9 A;  3PU3 A;  1JI6 A;  4QGL A;  4XCA A;  4K3U A;  4O9G A;  4WM7 C;  2NQY A;  2CDO A;  3J8F 1;  4JZR A;  1C8M 1;  2Y6H A;  3JXS A;  4UOJ A;  3O1P A;  4IDZ A;  1R09 2;  1TVG A;  1VLN A;  4EN9 B;  1TQ5 A;  1PMI A;  3JUU A;  2Q0A A; 
#chains in the Genus database with same CATH homology
 1W8Z A;  1W8U A;  3ORJ A;  5D21 A;  3F95 A;  4CP9 A;  2O14 A;  1WZX A;  1W9F A;  4LJH A;  4YWA A;  3ZYH A;  4CPB A;  4CP9 B;  1L7L A;  4CPB D;  2Q1F A;  4BQ3 A;  3ZYB A;  1W8W A;  4BQ5 A;  2LRP A;  1HN0 A;  1OKO A;  4BQ2 A;  1OH3 A;  1W90 A;  1V0A A;  1GWM A;  2KR2 A;  2LRO A;  4YW7 A;  1GWK A;  1UOJ A;  4LKE A;  4LKF A;  1GWL A;  4YW6 A;  4AL9 A;  4A6S A;  1WMX A;  2C24 A;  4LK7 A;  4LK6 A;  1W8T A;  1WCU A;  2VXJ A;  4BQ4 A;  3UT0 A;  2JWP A;  3ZYF A;  2K46 A;  4LKD A;  2WYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...