1WZXA

Crystal structure of family 30 carbohydrate binding module.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
b'RKLLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 35
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wzxA00
3UT0A 1GWKA 3ORJA 1OKOA 1UOJA 2C24A 1GWLA 1W8UA 3F95A 3ZYHA 4BQ5A 1V0AA 4A6SA 4YW7A 2WYFA 2LRPA 4LKEA 4CP9A 4LKFA 2O14A 1WMXA 4BQ4A 4LK6A 2KR2A 4LKDA 1WZXA 1HN0A 4YWAA 4AL9A 1W8WA 4CP9B 2Q1FA 4LJHA 5D21A 1W9FA 1W8ZA 2VXJA 4CPBD 2LROA 1L7LA 3ZYFA 1WCUA 1GWMA 4BQ3A 4CPBA 1W90A 2K46A 1OH3A 4BQ2A 4LK7A 2JWPA 1W8TA 4YW6A 3ZYBA
chains in the Genus database with same CATH superfamily
3BU0A 1J84A 3AYEA 4QPIA 2D6KA 4GD4A 1O4ZA 2NZ9A 3VZJA 2VUAA 1J1TA 4HVRA 2ZMNA 4CEYB 2GP5A 4CP2A 5KC6A 4PQ9A 4QXBA 3I2OA 4B4PA 2GZWA 3B94A 4HVQA 3SH4A 1NXMA 1POV1 1Y9GA 2PHRA 3OB8A 4HKOA 1A34A 4LO4B 1UY1A 4XBNA 4LJHA 3OY8B 1W8ZA 4GKYA 5K0UC 1JOJA 1SFYA 5LA2A 3SCHA 3ZXFA 2WZR1 1QJFA 4GWMA 3NV4A 1WCKA 1AYN3 5E89A 1LRHA 2A3XA 2V73A 2WSUA 3POBA 5D8AB 4D6QA 4EWAA 3LOIA 3BGAA 5A6ZA 2YDEA 3I3DA 3NWKA 3NMBA 3ZOIA 3OD4A 4AQ2A 4CU7A 5EIYB 1EPWA 4ASLA 4AF9A 5E6HA 2WLQA 3RNSA 4DY3A 3O1PA 5G04L 1R091 5FMCA 4E27A 2QQKA 3ZM8A 3C7EA 1VB2A 1PX3A 4A6SA 4MX3A 1AF9A 1CQ9A 1RUJ3 4K1ZA 3R05A 4PT6A 5JPNB 3RJ2X 4OI4A 1QDCA 4MGYE 1X36A 3JB8A 2C0ZA 1YHFA 2GNMA 1OF3A 4BQ1A 1HV1A 4K8RB 5K9YA 1EAH1 1A8DA 2JE8A 1HXS2 2QQOA 4E2QA 2TUNA 3VZNA 1H9PA 2BJSA 4IGPA 4W65A 4LMFA 5T55A 3WNPA 4F83A 4XHXA 4HBNA 3KF5A 3ZDVA 2IXCA 3I2FA 1S2KA 2XL7A 5F32A 2HKXA 1RVF1 5FP9A 4FPLA 3WF4A 4YW6A 1CZVA 2JKBA 4OHXA 2ATFA 2ZX1A 1J3QA 4RHV1 4V1PA 2NPIA 4CRQA 3N7MA 3NSTA 4CEWA 1VBC1 4QX0A 1NCRA 2HYXA 1PK6A 5A33A 3LA3A 5JLVA 1QJU2 2RJKA 1BMV2 4IEXA 1HDKA 4CDWC 1GNZA 1O7FA 1QNYA 1RUC3 4AQTA 1KJRA 3HNMA 1HN1A 1QKQA 4ISQA 4PLNA 1PZ9A 2BP6A 4XETA 4Q4W3 5CFCC 1I9RA 2DVDA 4AG4A 2CGNA 3OBRA 1KITA 4JGZC 2WKKA 3J7NA 4LUKA 1UXXX 3POJA 4UF0B 3RMXA 4DO0A 3M3CA 4YZ2A 2VBPA 4N53A 2NQYA 2WT2A 3OCPA 2XLAA 3ETPA 4XTPA 3WXPA 5APAA 3THTA 2J42A 5JZGB 2I2SA 5IVBA 1VBE2 2G9ZA 3MUZ1 1SBFA 2UU8A 2VMDA 4HXCA 1IOAA 4EN6B 4LEJA 4GB32 2BGCA 1YJKA 2RS33 4KQ7A 1G86A 2GSYA 2VL4A 4P5HA 5BNOC 2R042 2FDHA 3ACLA 4YVSA 3WF0A 4Y5Z0 3VZOA 1UY2A 2BTVC 4D94A 3OOXA 1LEDA 2R30A 4Q1PA 1M06G 1AR83 4CXWA 1DYPA 5FCCA 5B4NA 1HRV2 4MV2A 2WC2A 4Q26A 2CL2A 4NIHA 4Z07A 3ZXDA 2R0HA 3AXDA 1VBB2 1FX5A 3UGHA 3CJIA 4HL0A 4BH9A 3HBKA 5KHIA 1DLLA 2YYOA 2EIDA 5I0RA 2JG9C 5FZBA 3MIFA 2D3RA 3T2TA 2OPKA 1KS4A 1UZZA 4XFGA 4OZXA 5F3CA 3PL0A 4XIKA 3MF9A 2D6MA 4XJWA 1UZYA 3HD8B 3KV6A 3T0BA 4Z2AA 2O8QA 4MVTA 2V5DA 5C8CC 5EWSA 4Q4X3 1US3A 4CCNA 1XRUA 5IAXA 1ZRFA 2E33A 2WS91 2VU9A 1RUG3 5CVRA 2EVXA 4YGCA 5DG1A 1XBFA 3I7DA 4Q4V1 5DUXA 5LATA 4FAHA 2P6CA 1AL22 2VOKA 4E2GA 4Y26A 1AVBA 2LW8A 5FUNA 2BFUS 4M3CF 2R6QA 4N43A 4XDQA 4NPMA 2D43A 1I3HA 3LKJA 4RN5A 1BZWA 4NRQA 1URXA 1O6UA 3WY6A 1SLLA 1ONAA 4IGOA 2ARCA 3J8F2 5F5AA 5G05L 1V0AA 2CGOA 1MS5A 2J1UA 1NG0A 1BK1A 3DXUA 3LFIA 1QY4A 3IDAA 4HONA 2YC2A 3ZXEA 4OUEA 1YXWA 2ZKLA 3VDAA 1QJU3 2ZX4A 1AR61 4BJ0A 4UBGA 2CYFA 4WBBA 5ACA3 2P34A 2WA4A 5FMOL 1QH7A 1W9FA 4GH4A 1RB8G 4EZHA 3T30A 4CPBA 2FCUA 2WNUC 2XBO1 3K75B 1FNYA 3LA2A 3LCPA 4NIDA 2CY6A 4IEOA 1JZ4A 3NNLA 1W3VA 1UXZA 5BXXA 3H0OA 4J25A 1ZBE2 4ATFA 1XQNA 4CU9A 5IFPA 2VZ3A 3AKTA 3ACFA 4WM8B 2PHUA 4MHUA 1ODNA 3MW4A 2ZAHA 4W8JA 5DAPA 3K3OA 5J98B 2AACA 4GB33 2GP3A 1X82A 5LBBA 4AVTA 4R4XA 4YZ4A 3AMHA 2P3IA 3ECQA 1U0AA 1S0GA 4FPGA 5C71A 1V9U2 3N9MA 1D0GA 1VIWB 4XUTA 4YYOA 2TNFA 4GWIA 3M70A 4LHSA 1NQDA 2YGMA 4NVPA 3KGLA 4XUNA 4H2AA 1HRV3 5IYYA 1RUD1 4LULA 4RL7A 3N9LA 2OQ6A 1H2MA 1HKDA 4CCMA 1UX7A 2ZGRA 5A32B 1B35A 1ZZBA 3GHNA 3S5AA 4CDQC 2YU1A 3WHUA 4QM9A 2GC1A 4G3YC 1Y9MA 3S30A 1XSQA 4RR3A 4QX2A 4BK4A 1TMF3 4LOTA 4D6SA 5AFBA 3THCA 4QHBA 1WLCA 3WHTA 5JDBA 2BPA2 2RM23 3B9IA 4GWJA 4LA3A 1YIPA 2B5HA 2KA3A 2WNVB 3MW3A 3NJYA 4GA9A 4JDNA 4QT6A 1JUIA 1JYXA 1RUI2 3O1MA 2IC1A 3IAPA 5ANQA 3BU7A 1V6KA 2DVAA 1TG7A 1WMEA 2XWJB 3KQ4B 2XJPA 3KZ4C 5SV8A 1XNBA 3NV3A 3Q8AA 3LF7A 4XFAA 3ROUA 4IE4A 5JPMB 4OQ9A 1DFQA 3GGLA 1EUUA 3FBYA 4IE0A 3VKOA 4CCJA 1H4HA 5FMDA 5A3TA 4B1LA 5HXVA 4D3WA 3WW2A 4Q4Y3 3J26N 3GBFA 4JTNA 2W1UA 4DUVA 2VULA 5JR7B 4XABA 2W47A 1OC1A 3J8F3 3KCCA 3VBHA 1FMD2 4S2FA 5FJKA 1QQP2 4Y3OA 4Z8BA 1RUF2 4UFLA 4CP1A 2K9ZA 1Z7S3 3LPGA 1X7NA 5FZOA 1LJ7A 5C7GA 5CA6A 1SLCA 4IE7A 2GC3A 1HRI1 1YYNA 4MH0E 1DGWX 1RUE2 5F2SA 1KJLA 2W95A 2K2SA 1S4CA 2QZ2A 2C4XA 1FV3A 3ZSEA 5J96B 4R9CA 1ZBE3 1SDWA 2DFBA 4IV3B 4B1MA 1OUXA 1SDDB 4R4ZA 1UO9A 1H2KA 5FK7A 4KU7A 2QZ3A 4UFIA 3KHCA 1NQJA 4LK6A 1XYNA 4N9HA 4COVA 5KBFA 2EF6A 2JECA 3POIA 5F7UA 3TN92 1W6QB 2E53A 3RZHA 4FXGB 3CZJA 1GMMA 4AI0A 1UCXA 2D3PA 1ND2A 2WZR2 3M3OA 1QMJA 4RD7A 1HW5A 2OVUA 2WFF1 1DQ4A 2XH6A 3VDDC 3PUQA 4C0HA 1W8NA 1NOVA 3WCRA 3RZJA 1O91A 1VMHA 3EHKA 3EMRA 1Q8SA 1W39A 4LITA 4V2VA 2QDNA 3VBOB 5FPXA 5FZ1A 3R0RA 1R092 5F37A 4XHBA 1QJEA 1K45A 3VBUA 2YPDA 2RG4A 5FP8A 3IBMA 1JZ5A 5FOJB 5A1LA 2PXJA 1FAYA 1GU3A 3QBQA 5BNPC 1RUI3 3AL5A 5LRRA 3I3BA 1PIV1 3UJOA 4ZZ8A 1ST8A 2W1SA 1MEC2 1XU1A 4IW3A 3BKZA 4A42A 2P6HA 1KD7A 2RDSA 2QQLA 5FXXA 3LEKA 4GZ9A 3BUCA 1RVF2 5A3MA 1LAJA 4CDUB 5FY1A 2DCJA 1XSRA 4B3NA 2VQTA 5EJ3A 4RHV2 4ZXKA 4MSVA 1TEIA 1C28A 1SBDA 1VBC2 2Q30A 1N3QA 2VTFA 2EAAA 3LAGA 2WYFA 2P37A 1D4VB 3O12A 4XJ8A 3GXUA 5FWEA 2PA7A 3BALA 3CDZB 5LW9A 2CDOA 1SACA 2VMIA 5ABJB 1YJLA 3M8LA 4LNVA 5CISA 2ZACA 5LA1A 3H8RA 5DUWA 3W5NA 3KQRA 2DBNA 3VDCA 1FPN1 2X5IC 1A6CA 4ZONA 1MVEA 2XHKA 4XFHA 2LS6A 1VR3A 2H6CA 1DZRA 5FXWA 1PO22 2D6NA 4FPJA 2XJQA 3RQ0A 4AFMA 4ZZ5A 4C0BA 1RUE3 1ZYBA 4E4DX 3ON7A 3T0DA 1F4HA 1SFPA 1TME3 4UW6A 3MICA 2ADDA 1LEMA 5GLUA 2DUPA 4BCUA 4FTBA 3I3MA 1YQ8A 1GYKA 4BLIA 2FZ2A 2WYSA 1AX0A 1RJ8A 3H42B 3N9PA 4NHXA 2E7AA 2JDAA 2YUEA 5C3PA 3J4UH 1F5JA 4D6RA 4AEDC 1HIXA 3T2QA 4TSVA 1RXFA 2YMZA 3E5QA 1UPSA 1POV3 1BJQA 3B93A 3EB7A 2VECA 4L0PA 2WQZC 2BV4A 2RS51 2WSVA 4QPGC 2XDVA 5C70A 5IVEA 2XG3A 1Q56A 4AFAA 2JG8C 1E5RA 2WZR3 1BXHA 3W58A 1GOGA 3ZFGA 3K4AA 1OOPA 2ZEYA 3WDWA 5FY9A 1H8TB 4DUXA 2VZPA 1GZWB 1KDKA 1LB2A 1W6NB 4JQTA 1ZZ7A 2ZGMA 4NROA 3ZN6A 5HCFA 4FCAA 3KLSA 5L7OC 1R093 1GSLA 3T0AA 5LRSA 2O14A 2WZ8A 4QDSA 4N7IA 1UMHA 1W9YA 2HWD1 4NHMA 4Y4RA 4CSWA 5IVCA 1AJKA 2WWSA 1REDA 1MACA 2CWMA 2VBDA 4DUWA 2ZX0A 4LKSA 2WS92 1LULA 3PHMA 3IZOA 2LROA 3VHNA 2PTMA 3ZYFA 5JIUA 2E63A 1CAVA 5FKBA 1EAH3 1Y7BA 1MR5A 4XPVA 3TNPB 5FZ3A 4UAPA 2QQPA 4MXWA 1S0EA 4FO9A 3I8TA 3ZFEA 4FPEA 4UI9L 5EYYA 3WR0A 1CIYA 3GDBA 1RVF3 5LBCA 1RJ7A 3ABZA 3AZXA 2IZWA 3FHAA 1APNA 4QX1A 3SH3A 4RHV3 4QPIB 2ETEA 2JJ6A 1CJPA 1VBC3 4I0BA 4A45A 4YM0A 2X05A 1SHWB 2R32A 1BVVA 1QIQA 1J1LA 1V6LA 2YFUA 4LBNA 2J1EA 5CZKA 3TYJA 3I49A 1CAXB 1S0JA 2W91A 2HLEA 1LR5A 3N7LA 4AFDA 4NOTA 1ZA7A 3R4DB 4D7YA 1C8M1 1L7RA 1J59A 3I2KA 2XBO2 5ABJC 2QQMA 3MLKA 1TNFA 3OGVA 2Q8EA 3WF2A 1JZ6A 2RDNA 5JOXA 3ZX7A 3A4UA 3LGRA 1D4M1 4LXLA 1HB3A 1PGL1 3VHRA 3N7JA 3VHPA 2XB6C 1POV0 2CNAA 4Q0VA 2ZGLA 2ZKNA 2P1BA 2ORXA 1WGPA 4BMEA 3WUDA 2PLV2 1O5UA 4AEMA 3P1IA 4BQ4A 2B42B 2C9KA 3OPZA 4GJZA 1FV2A 2RMU1 5LY2A 3RS6A 4W6WA 4K9SA 3I2DA 2F17A 2VQAA 1KFUL 3I2IA 3FX3A 3DPRC 3H3LA 2XQRA 5IK8A 4KL1A 5FY4A 1S0CA 5FPAA 4M3CA 2QQVA 1K3IA 3WQ7A 4NHYA 1W2AX 2UY9A 4YNIA 5DAVA 1DQ2A 5HV4A 3VKNA 5GLWA 1QOTA 3WG1A 3OGGA 2ZMKA 4YW4A 4JVAA 1W9SA 1LOEA 4M00A 2JB8A 1YQ6A 2ZCWA 3AZWA 5IVFA 3H8OA 3TNQA 3NJVA 3OBAA 4TN7A 5DDJ1 4CEWB 4CP9A 5LEKA 3AKQA 1NCRB 1CVNA 3JD72 1PK6B 1J58A 5ANNA 5KHJA 1DBNA 2DCKA 4QWNA 1HN0A 3F2ZA 1DGWA 2F4PA 3T08A 1HJGA 4P9LA 3WINE 5KXBA 1ENQA 5JMCA 2E7QA 1DLCA 1GFF2 4FFIA 5EV7A 4AXOA 4I0WB 5FBZA 2WS93 1V6MA 1OA4A 2WABA 1AYM2 4Q4V3 4HK8A 5IWFA 5L73A 4B29A 1OFSA 3H3UA 4IUGA 2HEVF 3ZYPA 1IHMA 2XJVA 4N53B 4XF9A 2EIGA 2FZ1A 3ATGA 3M3IA 3A21A 3E97A 3EYPA 3ORJA 4P08A 5A7WA 5T3NA 2QQWA 4XFCA 4DEVA 2GNDA 4Y24A 5CFDA 4DEQA 4C91A 1CJDA 1PNFA 4DZGA 5L9VA 5ISLA 1CAWA 1NZCA 4FOYA 1LGCA 3NAPA 2A71A 3O7OA 1N1VA 2XJRA 3FLTA 1GP5A 2ZEWA 2GAUA 4YVSB 5FLHA 3N9QA 3VBSA 4P9JA 5I0TA 5LK5A 3U4SA 4LOSA 3ACIA 5FQ0A 3SH5A 1BQPA 1WW5A 4SBVA 3PMSA 5HCHA 2OUJA 2XBO3 3ILNA 1K5JA 1ZRCA 3RG0A 1W8TA 4ZU4A 1ULEA 1VMJA 4A3XA 3CJIB 1DQ6A 2EXHA 3OGRA 5FZHA 3MIDA 3PUAA 2YY1A 1O59A 3V65A 1LECA 4DXZA 1QJX1 2DU1A 1NCQA 3B5LB 1H9WA 1OVPA 2BUKA 3QD6A 3ASIA 3LFMA 1O5LA 1UD1A 2PLV3 5FXZA 2H6BA 2XL9A 4AEKA 4FBFA 1T2XA 4AL9A 4B4QA 1GKBA 4MADA 1MS4A 1YCIA 3VD3A 1LGBA 4BXFA 4CDXC 4GXLA 2J1AA 1ASJ2 1UOGA 1NLQA 1OLMA 1I5PA 4OI2A 4Q2FA 5EJ1B 4QB1A 3NNGA 2XWBB 1IQAA 1RUD3 4RGKA 4RSUA 5KWRA 1RYYA 2WQ4A 2BWCA 5EHDA 4N43B 2PAEA 4S2DA 1SLAA 1NY71 1O8PA 2C6SA 4NHKA 3S7IA 3HR9A 4FPFA 2ZGUA 4XIOA 1OA3A 1S0BA 4G4FA 1GQGA 2PHWA 4HSJA 3D8CA 3R4SA 5EQUA 3GJAA 2XOMA 3CJXA 1WA4A 4E2SA 1W6OA 1K5MC 1YIFA 4JGYC 1VRH1 4BPZA 1QGLA 3CQOA 1FOD1 4UW5A 4OVEA 1XNDA 5K0UA 2OZ6A 1YC61 2ZGOA 1CZSA 4GH4B 4QHZA 1IS4A 3VBOC 2JD4A 1AZDA 3IB3A 4A41A 2DV9A 4QGLA 1BBT1 1JOBA 1DGRA 3OUIA 2VAUA 2VZSA 2LTNA 3I54A 4FOQA 4XQDA 4ONUA 4MOAA 1ZA4A 2C9AA 3OGJA 4Q0UA 2FDJA 3APBA 2P3JA 3MDPA 4TXWA 1JMUB 2ZGSA 4PQQA 4Y1UA 1OT5A 5TSWA 2OZJA 2Q8DA 3THPA 3J9SA 3KS7A 5JSOA 2WT0A 4WVVA 4ES8A 3PUSA 4CXYA 2Z5WA 2V4AA 1H1MA 2HBUA 4IETA 4IESA 2OQ7A 4GAZA 1EP0A 2JDHA 1F8VA 1VMFA 1FPN2 1D2SA 2VQ0A 2RJLA 3N4MA 1UY0A 3MFAA 1PZ7A 2B39A 4RS5C 3KD4A 3T2PA 1LHWA 2BGOA 1HRI3 3RSJA 3VD4A 4L2NA 5I8TA 5IK4A 4A7ZA 2E26A 3GHMA 4XF3A 3ACHA 2PELA 3AYCA 4DPNA 1N3OA 1ULOA 2G9FA 1B35B 4XFFA 3ZXGA 4E4HA 3NKTA 1EUTA 4IEWA 3POEA 4ASKA 3O1OA 1ENXA 4QXCA 3C7FA 1OKQA 1JN2P 1DYKA 1PM4A 1W05A 2RS32 4OULA 1MS3A 4QM8A 4RR3B 2Y64A 5GZDA 3GCXA 3IN9A 3ZXLA 3TOJA 1CAXA 4AI2A 1XOYA 2ZGTA 3WZ1A 5JI7A 3BOPA 2CSGA 1AR82 3D82A 2WNEA 3KGZA 1WWYA 5I8SA 3ZO0B 5CFCA 4FOWA 5JXJA 1O4YA 4H14A 3R6SA 5FO7B 4ZKTB 1BLZA 2Y6LA 2YPJA 1C1LA 1HLCA 5JXGA 2QQJA 1B09A 1ASJ3 1JU4A 1L7QA 2B9UA 5F39A 5FZCA 1O4TA 1HJFA 2JDNA 5A1AA 2WFF3 2QQIA 2VMGA 3RRDA 3DYOA 4QX5A 4YM1A 2A6YA 5CIRA 4CUAA 5C3RA 2VZQA 4EV0A 4FAGA 2YBPA 1VBA2 2I45A 1S55A 1XNAA 2J22A 2YC0A 3FN9A 4Q0QA 3T1MA 5DQ0A 3ZLIA 3P5BA 5BNOA 1AHSA 4Q4X2 1TE1B 2GNTA 5BNNA 2FBEA 2ZGQA 5FO8B 5F8PA 3O1SA 5DZEA 2HWD2 3VBHB 1RUG2 2JIJA 4Q8KA 1RL3A 1E5IA 1MS8A 1MQTC 2O8OA 2W1WA 3JCIA 1R64A 1H8TC 3MZHA 5FZOB 3LA7A 4YFZA 1AJOA 2XKPA 2X09A 1QXRA 4FQ4A 2BRTA 1X8MA 1FATA 1UOBA 2R072 4LLOA 4QD2A 4QKDA 3WNKA 2Z79A 5L19A 4E4ZA 4LUMA 1UQXA 4HKLA 3O1UA 5C3OA 3F95A 3WCSA 1J83A 1H0BA 1IG3A 2JDKA 3VZLA 4LT5A 5DPNA 1NZIA 2HEWF 4AHYA 3AL6A 4XUPA 5IVJA 2JKXA 2YGLA 4PLMA 5ACA2 5EFUA 5C8CA 4YWAA 4BYYA 1FT9A 1JI6A 3PTRB 1PZ8A 1NLSA 3MIHA 5I0UA 1RTVA 2FDIA 1JW6A 2ZGKA 2FMYA 2Y26A 4QXHA 2VC9A 2CGPA 5IJRA 4DRVA 1FPN3 2HEYF 3AP7A 1JYTA 4S2GA 5FPLA 4XF4A 5KHGA 3BPZA 1ND2B 3VL9A 4FT8A 1JYVA 2VOWA 1QJY1 4DIQA 3VHOA 2IFWA 1YI7A 2A3WA 3WP4A 2WZEA 3B3QE 2ZS6B 3AM2A 4XVHA 1R081 3MIBA 2AYHA 4ET7A 4XFIA 2W2IA 1UPIA 2WQ8A 4FPCA 5EJZB 3VKFC 3C3VA 1ZREA 1N3PA 4P5YA 3ELNA 4F8AA 3CU7A 3BOWA 5C9AC 1CESA 3VBUB 5C8WA 2W1QA 2XVLA 3H50A 4OHWA 4UOJA 3WQ1A 2EIBA 2J1VA 4BIFA 1GBGA 3JZVA 5AVAA 4LO6B 4WM7B 2WNUA 4G9SB 3WG2A 2IXLA 5FK8A 5FZLA 5BNQA 3GCWA 5FZIA 3WOGA 2QQNA 1IS5A 2VZUA 4RGAA 2P5BA 2DURA 4HPKA 1PHMA 1TMF2 2B7YA 2CAUA 4Z92B 4P00B 2W08A 4PF5A 4H3WA 4CP0A 5KXCA 2RM22 1VBA3 4O61A 5J37A 1WMXA 4DB5A 3O1RA 4Q29A 4FFHA 1XE7A 4Y1XA 4E4SA 1ULGA 1IKPA 4Y5SA 2VUCA 5A1FA 3POGA 4N9IA 2HWD3 1UYYA 1VB4A 2VZTA 3TWIA 1JZ3A 1TVGA 2VMHA 3VBRB 1SCRA 1YFUA 4I01A 1S0IA 3VN4A 1BEV1 3HWJA 1W9WA 4QQ2A 2GC2A 3VBFC 2BBAA 3LSDA 4CA9A 1WKYA 1CN1A 4K7JA 4CEWC 2ZMLA 2R073 1UN1A 5DMYA 4Q4Y2 1JHNA 5FP4A 2OT7A 3GZUC 3PVEA 2DTYA 2VCCA 5F3EA 3VZKA 2MHFA 2ZZQA 5EP9A 5T5PA 5E16A 2JDYA 3UKNA 1W2UA 3WNXA 5JWPA 1W8FA 4HANA 2LM3A 4L11A 3U07A 3ZYIB 1Z7S2 4AHXA 2ENRA 1MVQA 3M7AA 1V6OA 3V56A 1EY2A 3KMHA 3KCXA 3FE5A 1VRBA 2H0BA 3BCWA 3HN1A 2WUHA 4NIGA 5BY5A 4XACA 2A75A 1C8M3 1YO8A 2C5DA 2A6ZA 3W5MA 3ZYBA 3IIAA 3ZFGB 1RUH2 4NWWA 1IS6A 2XR4A 1OOPB 4OLLA 5FPZA 5LZ6A 4IEYA 1JZ7A 1EPZA 1D4M3 3C2UA 3RMYA 3FFQA 4XBQA 3HT2A 5FTTC 3ZN6B 4YVSC 2QCSB 2RR11 4QX7A 2A6VA 5FYHA 5FPUA 2UYBA 3E6DA 1RUNA 2AREA 1UNBA 5F5CA 5AC91 3HIFA 3Q8FA 3UKTA 2FDKA 4EQVA 3EJKA 1L7LA 4P9XA 2CV6A 2Q8CA 4BHPA 3NV1A 1OH3A 4EJRA 5FDBA 1CAVB 2LALA 4PIYA 4MXWB 5FPBA 5JOZA 3D4KA 4R9DA 2HWB2 1LNSA 3FUOA 3IMNA 2JX9A 3ZFEB 3RZMA 4PDWA 2NMNA 4RQPC 3ZYHA 1GOHA 1NA1B 1W0NA 1NY72 2MEV1 1GZCA 4PLOA 3ZYGA 1ZX5A 4MHRA 4EN9B 4N7UA 4F7ZA 1QJZA 2ZHMA 2F4LA 4QU1A 3ZFFA 3MPPG 3IT8A 5H9PA 4IV1C 5DABA 1SQ4A 1TQ5A 2GN7A 4UWDA 3V0AA 1FOD2 4R9AA 4I3PA 2IXIA 3HBZA 3AP6A 4N43C 4K1YA 1SLTA 2GN3A 1DDLA 4FP3A 4NRPA 3VDDA 4F3JA 3INAA 3MUY1 2GDFA 1BBT2 4P9GA 4AVCA 1LOBA 2W0XA 3HQUA 2VNRA 1UOJA 1IS3A 1IQDC 1AR92 1YNAA 1QF3A 5T5LA 4XCAA 1GV9A 4UFKA 4BWOA 5J7MA 1XE0A 1R1A1 5FYZA 3USUA 3C7HA 1PNGA 1H2NA 1YWKA 3E5XA 4B7KA 2B4KA 3PMEA 4JDOA 4JKKA 2UYAA 5DZGA 4YVWC 5FZDA 1ULFA 2QFEA 2Y38A 4K6BA 5BNPA 3BTXA 5L9BA 3QACA 5FYSA 2HWF1 1UZWA 1Z78A 2VR4A 2D40A 4QX8A 5A80A 3H8XA 4FPOB 1RIRA 5B4XA 1C3HA 4C90A 1S1AA 1KXGA 1LGNA 3MF6A 4SLIA 4KWJA 1JYNA 1XNTA 2ERFA 2PHXA 1TME2 2WO3A 1OLRA 3AKSA 2FD8A 2AEYA 2ZXQA 4M3CB 4HN1A 3T2OA 1ND3B 1BHGA 1G8WA 1PGW1 1RUH3 3SC7X 4W6XA 4HK9A 1LOAA 2BERA 2GMEA 4BLJA 2WAOA 1ZBA1 1IGOA 3AKRA 4TTGA 3MFCA 2IVIB 5FLIA 4PF1A 4OZOA 2XJTA 5JAXA 4CP9B 3USSA 2FMDA 5A3LA 1OBNA 4AGVA 2X29A 4LBQB 4IEVA 2Z42A 4CPBD 3UV9A 4RYDA 5FXVA 1P8JA 3KT1A 2VOVA 3MIEA 2X5IA 5J09A 3CO2A 2BZDA 3PJYA 1DGRN 2ES3A 2WR9A 3MBWA 1NXD1 3O5SA 3OEBA 5FRAA 4CEYC 3KV4A 2JICA 3MLLA 4AAPA 4COYA 1ZRRA 2VGDA 2HWB3 4HFSA 2BNNA 4YM2A 5T52A 3O0XA 1GLHA 5A7WB 1DZQA 4P14A 2P4EA 1DZTA 4QX3A 5M0TA 5H9QA 4YM3A 1LOCA 5CFDB 3H8UA 1BCXA 4AQ6A 2D6LX 4I02A 1CAWB 2A7AA 4AEDA 3VDBA 1CZTA 1UKRA 1AYN1 3PTYA 3NAPB 5DAXA 4BXSV 2YBSA 3MEPA 5D8AC 4WM7A 4QQPA 1EAH2 3I3EA 1VRH3 4QPGA 1FOD3 3PNAA 4QHOA 3VBSB 2JG8A 4LK7A 3CLPA 5FQ0B 4K8FA 4R9BA 1C1FA 4YW5A 2ARXA 2JDPA 1X8EA 3WW1A 5T54A 4MGZE 1BBT3 2BVBA 1RUJ1 3K2OA 1HQWA 1UYPA 4ITCA 1GZTA 1ULPA 1UWWA 4FFGA 1AR93 4NIAA 5L7OA 5GKAC 2WWJA 3S5QA 4CCEA 3CKHA 3NRUA 1YUDA 3UGFA 5LY1A 4DY5A 1NCQB 1HB1A 4IE6A 4BZ4A 2B8MA 4UW4A 1Z0HA 3SQOA 4KWUA 4WZCA 1W8HA 4ZPIA 2DVGA 3VBRA 2Y6KA 3AC0A 5C5UA 3M3QA 5LB6A 1W8OA 1W0OA 3FHIB 3T4HB 3TBDA 5C6CA 3FFZA 1QDOA 2MNGA 3HVDA 3ZPYA 4UYBA 4O7XA 3SEPA 3I59A 5A7QA 1V6JA 1ODMA 4ZXEA 2BNOA 1XNKA 4FI9A 3M2MA 4DS0A 2ET1A 5IT6A 1R082 1WW6A 3ILRA 2L9LA 3PVNA 3TRSB 3PURA 1VAVA 5FZ0A 1CPMA 3NV2A 1COV1 4FOVA 4QB2A 1RMU1 1A3KA 1VBD1 4OHVA 3ZKUA 3ACGA 5IFTA 5IW0A 2PAMA 3P6BA 1DQ0A 3AXEA 1OQEA 1W6OB 4R8HA 2A6WA 3H1MA 3L2YA 4A4AA 2J7MA 5FMOS 5K0UB 3SISA 3W21A 5JZGC 4LO7A 4BIOA 5FPVA 1DIWA 1VLNA 4QXKA 5DG2A 4LBMA 1X9PA 2RE9A 1OA2A 4MZUA 2DU0A 1YQCA 4AVBA 1DCSA 2AH2A 2V09A 3TAYA 1GP4A 1E57A 2A73B 1OH4A 3HNYM 5CG8A 1YI9A 4AEJA 1UIKA 4AVAA 1AXKA 1HV0A 2VBBA 2MPFA 1GR3A 3T09A 5FZ8A 5F9TA 3KV9A 1JU3A 2ZA9A 3JB4C 3LE0A 1K42A 1QWRA 1MS1A 4Q4V2 3DPRA 5LASA 4BQXA 4HVOA 3VKLA 1SLBA 1E5HA 2E51A 2D44A 2WRAA 4KGGA 1JYIA 2D5HA 2C1FA 2VO5A 5GZEA 3AK0A 3JBG1 3Q8EA 3LWCA 1W6MA 3H1YA 1YFYA 4H7LA 3S57A 1NA1A 3GJBA 1N1SA 3PLQA 3ZIXA 4EWDA 3ETQA 4XAAA 5J3UA 3OYWA 2PN5A 1NAEA 1QNWA 4LKEA 5FLJA 5A6YA 3O14A 3EO6A 4O65A 4XCBA 3AKPA 4XXPA 4K20A 3U37A 2PMWB 3LDBA 4BQYA 2A70A 5FP7A 1UIJA 5GM0A 1HXS1 1WBLA 2PFWA 2PQQA 1AR62 2OIIA 3P3PA 2IXKA 4YGDA 3ZKYA 4LA2A 4JQRA 1NT0A 2UURA 4XQWA 2GH2A 1WD4A 5CFCB 2JDMA 4META 3WP3A 1SCSA 4HG6B 3LZZA 2E32A 5F2WA 2JENA 4JGZB 4KGQA 3RWNA 1OLQA 5CNAA 1R1ZA 4CCCA 1REFA 2QNKA 3OTFA 5FREA 3FWEA 1H1AA 1QHDA 1QJY3 2JE9A 2W94A 5FZFA 2VOTA 3SITA 1FYUA 1QJU1 4CCLA 2PYTA 4LORA 1R083 4AW7A 1F9KA 5IHRA 2UWBA 1Y9QA 1UMZA 2VMFA 2ILMA 4RGGA 4UXAA 2I07B 4XXAA 5BNOB 3CZUA 3IDEA 2OA2A 2RV9A 4IQPA 3VB9A 1GUIA 5BNNB 4XJAA 5GLZA 4Y22A 4D69A 1AL0G 2XONA 5A3PA 3GBGA 2P3KA 4KWKA 4LTAA 2W5FA 5H9SA 4YZ3A 1RUD2 2W39A 1OXCA 2X8KA 1ND3A 1Y4WA 2WT1A 3MW2A 1VBE1 4INDA 4MUVA 4WM8C 1UU4A 4N90A 5FYIA 5T5JA 4YW1A 5C4WA 1BK0A 1OKOA 2GMMA 4DXTA 3OUHA 4GB31 2B46X 4OQ8A 2FCVA 2JG9B 2PQSA 1FXZA 4MGQA 3WQ0A 3WF1A 2MEV2 1H8VA 2R041 5LBFA 4OFGA 2CU5A 4QQLA 3CNAA 2VTXA 3DEMA 2OYZA 2KR2A 3IDBB 2AC1A 4LBQA 4P9IA 4QGNA 4BB3A 1J3RA 5DUUA 5HXMA 4XQ4A 5JOYA 2KXLA 4EZ4A 3AP4A 5DXDA 4L9BA 4LBOA 2XLGA 5C8CB 1OD5A 4CDXA 1GWMA 4RFT0 4AQSA 4AI3A 1VBB1 4WVZA 2CAVA 1QEXA 2IUWA 2JIGA 4IL7A 4QKFA 2JB4A 5D2AA 2WL1A 1BEV3 3E5UA 3LEGA 2P3YA 2VW2A 3ZN5A 4DINB 1W03A 4GMP1 3AP9A 4BOWA 1ZZ9A 2E9QA 2GMPA 1GNYA 3BN6A 1SFNA 2YXSA 2D93A 2WNVC 5A3NA 4DFSA 1OD3A 2W52A 3M4FA 2A5ZA 1GQHA 2RDRA 1SZBA 2XJSA 4IE5A 3AZYA 1RUOA 2VCMA 1ZZ8A 1UX6A 3OPTA 3AYDA 3WX5A 1K5MA 3HQXA 3P3NA 1AL21 1AR63 1Y43B 3L2HA 1TNRA 2D3SA 4XC9A 1U5YA 1X33A 3ZSMA 2K46A 2HWF2 4D8MA 3ZYJB 1T6BX 3DXTA 4FSJA 1HRI2 4FTEA 1S0DA 4LBKA 4NPLA 4Y1ZA 5EPAA 2WNUB 1N1YA 3B69A 1WCQA 2ZGPA 4M0NA 3ZVXA 3SKVA 3OF1A 4KU8A 1UMIA 3WUCA 1ZZCA 5A7PA 3M1HA 3K4ZA 2TBVA 1SMVA 3B00A 4NAMA 2BBVA 1ZBA2 4OMCA 4HPKB 2V5YA 5FY5A 4UBHA 4RA0A 2Q1MA 2RJ2A 4DQAA 5JI9A 3KVBA 4OMDA 1G9BA 1YRZA 5A7SA 2EICA 3N9NA 4CU6A 2Q1ZB 4O9EA 5AC93 2O1QA 4UT5A 5JSRA 3LSEA 2ET7A 1LHUA 5FZKA 2W68A 4RS5A 5LA9A 4BU2A 4J1WA 2WBKA 2WFF2 1ZBE1 1KS5A 4IV3C 1W28A 1STMA 1SLIA 2K0GA 3KHBA 2O0OA 5FR3A 2VCBA 3WG3A 3W9AA 1WCDJ 3BODA 1WW4A 2BOIA 2I74A 2YHJA 1U5XA 3MGUA 1LKNA 2ZABA 1LHOA 3POWA 2UY8A 4IEPA 3G7DA 3AJZA 3AFGA 1IPSA 2MEV3 1DP0A 1H30A 1V9U1 3KT7A 1F4AA 2V72A 4KI5M 3U10A 4LHLA 3DYMA 3HNBM 4M0HA 2BFUL 2GC0A 3ME2A 1KDMA 1NLRA 4ATEA 1PIV2 3H7YA 3BVCA 4CZSA 3BYWA 3IPVA 5EXOA 5FP3A 3UETA 2ID4A 3VD7A 2XHNA 3AFKA 3FUQA 3DYPA 4PI2A 2G4IA 1YFXA 3A0KA 1WLDA 1XE8A 5KHHA 3ZXAC 2PHLA 5CFDC 2FDFA 3K4DA 4I09A 4JKLA 4LBQD 2R49A 4URAA 3NAPC 1CPNA 3LD8A 3DGTA 1W9TA 4YZ1A 2YZ4A 3WW3A 2ZGNA 4Y20A 5FMBA 3UYJA 2ZEZA 1UKGA 1QOSA 2VPVA 3RI8A 3CHXA 4QMAA 3VBSC 1UZ0A 4A7YA 1W2OA 1F15A 4HOOA 3V0BA 2W9XA 5FZ7A 1MQTA 1YLLA 5FY0A 2YG0A 3J7MA 4CDUC 2VNVA 2ADEA 4HKWA 1KRIA 2Y34A 4KG8A 2HWF3 4J6GA 3U1XA 4ES9A 4CXXA 1JUHA 3MHZA 3AZZA 4HN0A 1U12A 1NCQC 3WP6A 1CWPA 3R4UA 1FMD1 4NWVA 4XMIA 4PDWB 1Q8PA 1QQP1 2DFCA 1CIWA 2YV8A 3OBTA 4LKFA 5HCBA 2RS11 1G9FA 3DUIA 1COV2 1ZBA3 1RUF1 2W92A 3POSA 4OI1A 4CDWA 3HEIA 4EROA 3S0MA 1SPPA 3BTAA 3ZFFB 2Y0IA 2FHRA 1HB4A 4QQHA 2BQPA 3JUUA 4XUQA 4HT1T 4QKNA 1D7PM 2BU9A 3DV8A 3ZSKA 2B9VA 4AOCA 2JEMA 1QU0A 1AR71 3OG2A 4JGZA 4L97A 2RS52 4NUBA 3V0AB 1QOOA 4XZUG 1PO11 5GZFA 3POFA 5JCTA 1LCLA 2JXAA 3TEZA 4AAXA 4E8DA 1DHKB 1W6PA 4HSLA 2VCAA 3VDDB 3FC0A 1WA6X 3U4XA 3U75A 4TZDA 3D6EA 4UFJA 4QAWA 4CTEA 3HPNA 2NYYA 4Y4YA 2J1RA 2ZBJA 4M3CE 4P02B 5F6LB 5CADA 4TWTA 2VXRA 2J1SA 5FZGA 1UYXA 3NNJA 3TN91 4JAAA 2D6OX 3PVOA 3USUB 5C9AA 1Q5OA 4URTA 4Y1YA 3WF3A 5A6QA 3A22A 5H9RA 3TB0A 2ZJCA 5HCAA 4PBPA 5GLVA 3KF3A 2ZHLA 5BNPB 1PIV3 3CEWA 4K21A 4KMQA 3DECA 3HAGA 4JKMA 4MLOA 4NO4A 2R7EB 1WLWA 5DN2A 5JUVA 1LOFC 5DUVA 1WLTA 2VTXJ 4ARXA 3JBG2 4XDPA 5LBEA 2JG9A 4ZY9A 3OJBA 4YARA 4FPYA 3TEXA 2PHDA 1JODA 2VNOA 4Z82A 3C7OA 5IUQA 3BIWE 3LIHA 4FP2A 5FYBA 2DCTA 5GJ6A 2HWE1 1WZXA 4AGGA 4JHZA 4LO5B 4KNCA 3W20A 2VUDA 3E6CC 1MEC1 2JDUA 3Q8BA 3AMQA 3GNEA 1OMIA 3PUIA 3X29B 5JXHA 3ALQA 2NMOA 4OHZA 2OS2A 2VZOA 5C3QA 1C8M2 3I97A 2X5IB 3VBFA 4NN0A 4ZHNA 2DVFA 4QPIC 5FJHA 3UT0A 4DRRA 5FZEA 1D4M2 3HOBA 1PGL2 2R16A 4BE3A 2W46A 2HWC1 1PGSA 4YRDA 1IKQA 3ITQA 2VMEA 2AGSA 4OUSA 3RDIA 3KWVA 2Q5TA 4E9KA 2YB7A 3AZVA 1COV3 3UESA 1CAUA 1RMU3 1VBD3 2QTWB 4XFBA 2RMU2 3A0NA 4AEDB 3PUHA 3U14A 2XMLA 4Z1VA 2AR6A 1ULCA 1PO21 1RITA 4O9GA 5F6KA 1G7YA 1GNHA 2D7FA 2RS53 4QPGB 1H2LA 2YFZA 4IEQA 3S6PA 3UKVA 3TEYA 4XF1A 3OD0A 1O8SA 5FZ4A 2JG8B 1LESA 1V6IA 3U78A 4AFBA 4EN8B 2WJSA 5FUIA 4NMIA 5BYNA 5HI0A 3JU9A 2DUQA 4BQ5A 5LCWL 1OLME 2WA3A 3WG4A 2HH9A 5FZMA 4X6QB 5BNNC 1AX2A 4YG0A 3LB9A 5DDJ2 4AHZA 2ZZJA 4IXLA 4DXRA 5L7OB 1JYWA 4ZU7A 2AENA 5FZAA 5B2GB 1LTEA 4CCOA 3H7JA 1JZ2A 4EWEA 4HETA 3GYDA 5FWJA 2NLRA 2VE1A 2WLPA 4U2AA 3D3AA 1OQDA 1G9DA 2VH9A 2E7TA 1UY4A 5EZWA 5LA0A 1KEXA 4QQOA 4PCRA 4XOGA 3JBG3 4CDQA 1NCRC 1DU3D 2OX0A 1MZFA 3I2GA 1PK6C 4M4RA 3I59B 4RQPA 4WVMA 4LR4A 4BISA 4BM8A 3N3HA 3FLRA 3VZMA 2QJVA 4AFCA 1AXZA 1PMHX 3AMPA 4ZS3A 1UY3A 1LHNA 4LE4A 5FV3A 4EN0A 3VGIA 2BDRA 1GZ9A 2UWAA 2WNOA 1Q8QA 1IZ3A 3IAQA 4IV1A 5J1XA 3SHRA 2D97A 2ZAAA 1HXS3 2XJUA 5DZFA 3K46A 3KT4A 4N53C 1LU1A 1W90A 4I3GA 3AJYA 4BQWA 3WDVA 2BW8A 3E1F1 3LPFA 2Y6HA 3KVAA 4LIUA 4QKBA 3C8XA 5LEJA 3ES1A 5HPOA 3BPSA 3E6BA 4COZA 3EQEA 5T50A 2C26A 3WDUA 1M4WA 3AVSA 3NL1A 4YPJA 1PMIA 1DQ5A 3WLUA 1US2A 3MLJA 5BPXA 2LUWA 4NR1A 3LIGA 4TYSA 4YW7A 2Y8KA 5FUPA 3T1LA 2Y6GA 2HYKA 1QJX2 3MV11 1H6YA 2QUOA 5IVVA 2WO1A 2PHTA 4D7SA 1RHI1 2OUHA 3KSCA 1C5HA 1HX6A 3SLIA 3IMMA 4YVWA 4XMAA 4NE9A 2RMU3 4XJUA 4TLGA 2ZOEB 5CU1A 2EXJA 2ZTNA 1FNZA 4KG0A 3RZZA 3LOBA 3GZAA 1PVC1 1UU6A 3CJIC 5DAQA 4BQ2A 2VUJA 5JR2A 3DPRB 3HJRA 1VAKA 1POQA 4OYUA 4XAEA 2HBTA 3O1TA 3N7KA 2VW0A 1VBE3 2DDUA 1W6MB 5L9RA 4Y33A 2PLV1 1XC6A 5IAVA 3L9JT 3PDQA 1H4GA 3OYWB 2R043 3D5OA 1UL9A 2AEZA 4JCKA 5DDJ3 4COUA 2Y0OA 4RFRB 1W2TA 2EA7A 4CUCA 1ZRIA 2G9GA 2UWCA 4GWNA 2VVEA 2EXKA 1DGLA 1KGYA 1VRH2 2Q8OA 4CUBA 5SV5A 4J1XA 1W0PA 2V4VA 1VBB3 1W04A 4CEYA 2ORZA 2Y60A 4HLTA 3SCGA 4N8MA 2QQUA 2R061 1BVP1 2EIEA 4GMP3 2GNBA 4JZRA 5FY8A 3PU3A 4H55A 1I5ZA 3NNMA 4XDOA 3RGBA 4C8DA 4YZ5A 1W3XA 4W6YA 3JD71 5A3UA 4GJYA 3UGGA 3VD5A 4FXKB 2HJIA 2OKXA 3OY8A 1WMFA 5FZ6A 1XYPA 2VVFA 5A6XA 4YFWA 2PAKA 4GH4C 1L3JA 1EV11 5K8SA 2CDPA 3MYXA 2CWSA 5D8AA 1AYM1 1UZVA 2H0VA 3A23A 4NPRA 3RWKX 2RVAA 3NVCA 3WQBA 1V6NA 1AL23 4FPHA 1H6XA 4NRMA 3K77A 5FOBB 3IIIA 3M3EA 4Y22B 1JBCA 4AHWA 1YQ5A 1XYOA 3K51A 3KM5A 5IATA 4CCKA 1HQLA 1I1EA 1RXGA 3WP5A 1ENSA 4MYEA 5HBAA 3B7MA 1DYOA 2QDRA 5F3GA 3GF6A 3NW4A 1N1TA 2D6PA 2WDBA 5C4WB 4XJ9A 2YBKA 5FYYA 3GM8A 4XYXA 3HQRA 3NQHA 4OCTA 2RS12 1QJX3 1NE6A 1Q3EA 1OPMA 1LODA 1ENRA 4ZS2A 3UK9A 2NP0A 3DF0A 2YU2A 1G6NA 3NKGA 5J48A 3NNFA 4U36A 3H3ZA 1ZVFA 4CU8A 1AR72 2BGPA 4AYUA 4AI1A 3HMYA 2DBIA 4ARYA 4C1XA 1PO12 4CDXB 1B35C 4XEZA 1UYZA 2DF7A 4JV4A 5A70A 4PDWC 1REEA 1O3SA 3T3YA 5DAWA 3WNMA 4RR3C 1OURA 2WAAA 2SBAA 1W8UA 4XILA 3DN7A 3D0JA 3J7HA 1NX9A 3A7QA 4FQZA 1XXNA 3ZFFC 4AGRA 3RZLA 3LDKA 2JD9A 1E5SA 3NO8A 3SEEA 3WSOA 2VZVA 4B4RA 2WFPA 4HMZA 1QH6A 3WNNA 3N36A 5KXDA 1S2EA 2Z4FA 3CF6E 4UF0A 1A78A 1VAMA 1V9U3 2ZEXA 1AUYA 3PIJA 3RPQA 5LK7B 1CX4A 1ASJ1 5A7OA 1V00A 5K7PA 1OSGA 4QB6A 1V70A 3SKJE 1EYBA 4DMIA 4GMP0 1K5MB 4JGYB 4MO3M 4JX0A 4BA6A 3UNPA 4IERA 5JZGA 3ZSLA 3IWZA 5E1RA 4I30A 2XXZA 1ZZ6A 4JRAA 4LHNA 4PIXA 4K3UA 1GWKA 1ACCA 4EN7B 1OI6A 1JOPA 3WDTA 4Q0PA 1WCSA 4PJYA 1W06A 2JDZA 4CCDA 1WBFA 4Q5OA 5FYTA 3VBHC 4QGMA 3I4IA 4NIIA 3SCFA 5FAXA 1YFWA 1VP6A 2OW4A 1OPOA 3WV6A 3ZSJA 2NN8A 3ENRA 3S7EA 4ISRA 3ST7A 2HWE2 4ASMB 4I2OA 1O3TA 1IPJA 4UFMA 2GH8A 2VNGA 4MGTA 4QDRA 3LDRA 1WCUA 5FFOC 2DYCA 4XJZA 2XGXA 5GZGA 4GKXA 1Q43A 3K3NA 5IK5A 3FZ3A 2EAKA 3ES4A 2Q0AA 4RS5B 3WNLA 4YGBA 1AXYA 1CR7A 1QJY2 2AZ5A 1G9AA 1Y3TA 1BYHA 2FCTA 2J1TA 4LPLA 2VZRA 3B9CA 5HV0A 2Q4SA 2WN2A 1RUC1 1I6XA 4YG3A 3AVRA 1O3RA 4LE3A 1FI2A 4GIQA 4CE8A 2WZPP 5CKNA 2IXJA 1FMD3 2HWC2 2R1BA 4Q4W1 3THDA 2DTWA 3WW4A 5KC5A 5FKCA 1QQP3 4M01A 1MPXA 2JE7A 5AVPA 5A7NA 2RDQA 2RS13 3LEMA 2VXJA 1RUF3 2D98A 5JOWA 1LENA 3MI8A 1LHVA 1ND2C 3BTYA 3CBNA 5F1RA 2BOJA 4JC1A 4JHTA 2VJXA 2BYVE 1MS0A 1AR73 1ALYA 2DWRA 2JWPA 4L99A 1OVSA 4Q8LA 2ARAA 3DKWA 5F5IA 5FO9B 1PO13 3IPVB 2ARBA 4XZPA 1UAIA 1VE0A 1PX4A 2G1MA 2VD7A 4IEZA 1LU2A 2C24A 3CL1A 5A3OA 1JS9A 2EALA 2RS31 1G9CA 3B01A 2QE3A 1D2QA 2WINB 3RYKA 3VBUC 2ZX2A 3FLPA 3QOPA 2ZX3A 3U0ZA 3PU8A 4LKDA 1AR81 1SBEA 1IG0A 5D21A 4WM7C 4Y20B 4AVVA 1PM7A 1OHFA 3TN93 3EXUA 2ZHKA 3QLQA 4W4ZA 1NE4A 1U5ZA 2DVBA 4GALA 3SXWA 3FHQA 3V0BB 3WDXA 1OQ1A 1MQTB 1BEV2 1C5IA 2QKDA 3CIHA 3KCYA 5F3IA 2QVSB 5ERLA 3N9OA 4MGSA 2EXIA 1ZNPA 4WM8A 3Q9OA 3RZKA 2GALA 2E6VA 1GWLA 1VBA1 1H1IA 4LBLA 5C3SA 3PVBB 5K4LA 4FVVA 4X8PA 2SLIA 4OHYA 2Y6JA 3VLBB 2LRPA 1A8MA 4Q4X1 1RGSA 5AFEA 1U5IA 5J36A 1Q8OA 1RINA 5CYYA 5T5OA 2KD7A 4D7TA 2NM1A 3ZMOA 4X6RB 3Q8CA 1RUG1 3QCWA 3RYPA 3IDCB 3JQXA 3VBRC 3W59A 2D5FA 4BMBA 4KH9A 2XQXA 5JSPA 1CD3G 2TEPA 4QDQA 1F31A 1QXJA 2CTVA 1WMDA 2HWE3 3POYA 3ZR6A 4CDWB 3BIEA 4L8QA 1SPPB 3U11A 5GZCA 3HN3A 3OPWA 5E8AA 1MEC3 5A32A 5JMOA 3FBMA 4LHKA 4E8CA 1X9TA 2R071 2R0FA 1DG6A 2Y6FA 2P2KA 3G6JB 2KM2A 2WWUA 4LIVA 5I0DA 3VKMA 1O3QA 4AVSA 1J3PA 4YLZA 2BVVA 3H9AA 4MG2A 5FIXA 2ZPXA 1F5FA 1UW8A 1C4RA 4A2UA 3FJSA 1Q8VA 1PMJX 1W6PB 3DKQA 1BMV1 2WNVA 5ACA1 2RHPA 5FYCA 4Q1RA 1KFXL 1XNCA 2XUMA 3QH7A 2HWC3 2RR12 5GLTA 2Y33A 3O1VA 2ZHNA 4QPYA 1JH5A 1RHI2 4XBLA 4COWA 4DNYA 1JHJA 5AC92 2XUEA 1NKGA 3HT1A 3I2HA 2X10A 4P9YA 5IVYA 3ZIWA 4JDMA 5C9AB 1JYCA 2P17A 3MPBA 3ZFGC 4PHZA 5CKMA 2WN3A 1OOPC 4C1WA 1PO23 1PVC2 3MV01 5E88A 2B45X 5CBLA 3JQWA 1JZ8A 4B7EA 1VPHA 4NJ4A 2XPJA 3BTZA 4QU2A 4S2HA 4EYUA 3ZPOA 4AR2A 4PBOA 2PHFA 3OEAA 4WZFA 5A3WA 5KXEA 4QPWA 3AP5A 4Y5TA 2CHHA 3RI9A 4YW3A 1W99A 1HB2A 4AI8A 1HRV1 3C7GA 3GALA 5BUVA 4A6OA 4ZU5A 5I91A 4A7KA 1JTZX 1OUSA 1UU5A 3ZFEC 2AUYA 1GANA 3LEIA 5GALA 2A3YA 1NA1C 5JIAA 1VALA 3GZTB 4IV3A 3VBFB 4MGKE 3ZXJA 1TMF1 2R062 4Q27A 3UJQA 2RM21 3BB6A 3WEZA 1TZOA 5CB7A 3MO4A 2BNMA 5CKQA 3J7LA 1CONA 5A33B 3NJZA 1R1A2 2XKOA 3VV1A 1W6QA 4M4PA 1OFNA 4Z2WA 1W8WA 2VVDA 2Q1FA 3IKWA 3OSDA 2FDGA 3I2JA 3O0VA 1UF2C 1EV12 2IFRA 5FBJA 3FMGA 4JGYA 4LBJA 1CAUB 2OPWA 2VY0A 3N35A 4OUMA 4XUOA 4AE2A 5FZ9A 4IGQA 4BQ3A 1CX1A 1XPWA 4IEUA 3ZYRA 3BI3A 2W3JA 2GU9A 1HQNA 3KB5A 1JXNA 3VBOA 4Q4Y1 4EE2A 4YW2A 3RYRA 3RZGA 3DL3A 4FTSA 4AZZA 3NJXA 2YC4A 3J8F1 4JTOA 1PGW2 3JXSA 4KWLA 4MXVA 2YROA 5KHKA 2DCZA 3AMNA 1WD3A 2A1XA 5FYVA 4Q0SA 1WW7A 1MS9A 1Z7S1 4GULA 3WVJA 4WV8A 4AI9A 3SMHA 3PIGA 2RR13 3TEWA 1RC6A 5D1IA 4P9WA 4JRLA 3EBRA 4XURA 1RHI3 3UL2A 4B8EA 2QBXA 4H7MA 3KV5A 4YGEA 3WNOA 4CDUA 2VG9A 2IWGB 5CEHA 1ND3C 1RUH1 1S0FA 2W87A 1SG3A 3VD9A 1PVC3 5C4WC 1GOFA 2Z69A 5FYUA 1DQ1A 4V2WA 3O0WA 4KBZA 4CYDA 1CGPA 3QH6A 3AX4A 1QXPA 1N47A 1W2NA 3FL7A 5EYXA 2A6XA 3D0SA 1ZRDA 2DCYA 3WD5A 4HZFA 2Z2SB 3WT3A 4CDQB 3H1WA 2VM9A 4WVWA 5F5QA 4WVMB 5ABJA 4RQPB 3OUJA 5KR7A 1GICA 3DCQA 3AB0A 1K12A 4XF0A 1SEFA 2VMCA 1MZEA 1T6GC 1AYN2 4AWDA 2WO7A 2XLFA 4IV1B 4XW3A 1IPKA 1MZ5A 2WO2A 4CUGA 3RFRA 1ULDA 3CMGA 3I3QA 3AYAA 4UFHA 3GZEA 2HWB1 2VOXA 4W50A 5FY7A 4DOUA 1NUKA 3OBZA 1F35A 4NHLA 4Y1VA 1D0HA 1XB9A 1RUJ2 1X50A 3V64A 2R063 4FPKA 2N7GA 4IDZA 1KQRA 2E31A 4K40A 4D0QA 4UW3A 5BV6A 5CAZA 4OI0A 4YG6A 2BWAA 2VZ1A 3OGSA 3JD73 4PI0A 4FFFA 1RUI1 4NAOA 1BKZA 1R1A3 5FYMA 3MIGA 4XE9A 4DXSA 3IM0A 3WDYA 4AK3A 3PJQA 1EV13 4A44A 2WIIB 3ILFA 4LQRA 3ZXKA 1ZM1A 4I0AA 3SNMA 1S2BA 1H8TA 1AYM3 4YVWB 2VQUA 3LQCA 4XTMA 1GP6A 1XU2A 1GZWA 4GQ7A 3RJRA 4CVUA 2IXHA 3K48A 1W6NA 2XVGA 1GQPA 1NYWA 3B02A 1LOFA 3URFA 5I8YA 1MZ6A 2R1DA 1AR91 2IVJA 1YQ2A 3ZDSA 4A3ZA 5JXIA 2X53S 2F6BA 4MGIE 5IK7A 4R52A 3AMMA 4LO8A 2G19A 4TLFA 4BK5A 5I93A 1RUC2 4BDVB 3VUOA 1LOGA 2BEOA 1VJ2A 1F2NA 1AX1A 3T4VA 5I0SA 1C57A 4Q4W2 1RMU2 1OF4A 1VBD2 2XVKA 4KBBA 4X8NA 5L36A 4PIZA 4LLFA 5JVVA 3ZMNA 4ORFA 4YSFA 1UOFA 2DUOA 3ZR5A 3RVHA 1PVXA 1RUE1 3ZN4A 1YEWA 1DF0A 5C33A 5CG9A 5LWBA 1XJAA 1TME1 1WUVA 2FQPA 1C8NA 2OXBA 2VW1A 4L92A 3VL8A 5C5TA 3GBWA
chains in the Genus database with same CATH topology
3UT0A 1GWKA 3ORJA 1OKOA 1UOJA 2C24A 1GWLA 1W8UA 3F95A 3ZYHA 4BQ5A 1V0AA 4A6SA 4YW7A 2WYFA 2LRPA 4LKEA 4CP9A 4LKFA 2O14A 1WMXA 4BQ4A 4LK6A 2KR2A 4LKDA 1WZXA 1HN0A 4YWAA 4AL9A 1W8WA 4CP9B 2Q1FA 4LJHA 5D21A 1W9FA 1W8ZA 2VXJA 4CPBD 2LROA 1L7LA 3ZYFA 1WCUA 1GWMA 4BQ3A 4CPBA 1W90A 2K46A 1OH3A 4BQ2A 4LK7A 2JWPA 1W8TA 4YW6A 3ZYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT0 A;  1GWK A;  3ORJ A;  1OKO A;  1UOJ A;  2C24 A;  1GWL A;  1W8U A;  3F95 A;  3ZYH A;  4BQ5 A;  1V0A A;  4A6S A;  4YW7 A;  2WYF A;  2LRP A;  4LKE A;  4CP9 A;  4LKF A;  2O14 A;  1WMX A;  4BQ4 A;  4LK6 A;  2KR2 A;  4LKD A;  1WZX A;  1HN0 A;  4YWA A;  4AL9 A;  1W8W A;  4CP9 B;  2Q1F A;  4LJH A;  5D21 A;  1W9F A;  1W8Z A;  2VXJ A;  4CPB D;  2LRO A;  1L7L A;  3ZYF A;  1WCU A;  1GWM A;  4BQ3 A;  4CPB A;  1W90 A;  2K46 A;  1OH3 A;  4BQ2 A;  4LK7 A;  2JWP A;  1W8T A;  4YW6 A;  3ZYB A; 
#chains in the Genus database with same CATH topology
 3BU0 A;  1J84 A;  3AYE A;  4QPI A;  2D6K A;  4GD4 A;  1O4Z A;  2NZ9 A;  3VZJ A;  2VUA A;  1J1T A;  4HVR A;  2ZMN A;  4CEY B;  2GP5 A;  4CP2 A;  5KC6 A;  4PQ9 A;  4QXB A;  3I2O A;  4B4P A;  2GZW A;  3B94 A;  4HVQ A;  3SH4 A;  1NXM A;  1POV 1;  1Y9G A;  2PHR A;  3OB8 A;  4HKO A;  1A34 A;  4LO4 B;  1UY1 A;  4XBN A;  4LJH A;  3OY8 B;  1W8Z A;  4GKY A;  5K0U C;  1JOJ A;  1SFY A;  5LA2 A;  3SCH A;  3ZXF A;  2WZR 1;  1QJF A;  4GWM A;  3NV4 A;  1WCK A;  1AYN 3;  5E89 A;  1LRH A;  2A3X A;  2V73 A;  2WSU A;  3POB A;  5D8A B;  4D6Q A;  4EWA A;  3LOI A;  3BGA A;  5A6Z A;  2YDE A;  3I3D A;  3NWK A;  3NMB A;  3ZOI A;  3OD4 A;  4AQ2 A;  4CU7 A;  5EIY B;  1EPW A;  4ASL A;  4AF9 A;  5E6H A;  2WLQ A;  3RNS A;  4DY3 A;  3O1P A;  5G04 L;  1R09 1;  5FMC A;  4E27 A;  2QQK A;  3ZM8 A;  3C7E A;  1VB2 A;  1PX3 A;  4A6S A;  4MX3 A;  1AF9 A;  1CQ9 A;  1RUJ 3;  4K1Z A;  3R05 A;  4PT6 A;  5JPN B;  3RJ2 X;  4OI4 A;  1QDC A;  4MGY E;  1X36 A;  3JB8 A;  2C0Z A;  1YHF A;  2GNM A;  1OF3 A;  4BQ1 A;  1HV1 A;  4K8R B;  5K9Y A;  1EAH 1;  1A8D A;  2JE8 A;  1HXS 2;  2QQO A;  4E2Q A;  2TUN A;  3VZN A;  1H9P A;  2BJS A;  4IGP A;  4W65 A;  4LMF A;  5T55 A;  3WNP A;  4F83 A;  4XHX A;  4HBN A;  3KF5 A;  3ZDV A;  2IXC A;  3I2F A;  1S2K A;  2XL7 A;  5F32 A;  2HKX A;  1RVF 1;  5FP9 A;  4FPL A;  3WF4 A;  4YW6 A;  1CZV A;  2JKB A;  4OHX A;  2ATF A;  2ZX1 A;  1J3Q A;  4RHV 1;  4V1P A;  2NPI A;  4CRQ A;  3N7M A;  3NST A;  4CEW A;  1VBC 1;  4QX0 A;  1NCR A;  2HYX A;  1PK6 A;  5A33 A;  3LA3 A;  5JLV A;  1QJU 2;  2RJK A;  1BMV 2;  4IEX A;  1HDK A;  4CDW C;  1GNZ A;  1O7F A;  1QNY A;  1RUC 3;  4AQT A;  1KJR A;  3HNM A;  1HN1 A;  1QKQ A;  4ISQ A;  4PLN A;  1PZ9 A;  2BP6 A;  4XET A;  4Q4W 3;  5CFC C;  1I9R A;  2DVD A;  4AG4 A;  2CGN A;  3OBR A;  1KIT A;  4JGZ C;  2WKK A;  3J7N A;  4LUK A;  1UXX X;  3POJ A;  4UF0 B;  3RMX A;  4DO0 A;  3M3C A;  4YZ2 A;  2VBP A;  4N53 A;  2NQY A;  2WT2 A;  3OCP A;  2XLA A;  3ETP A;  4XTP A;  3WXP A;  5APA A;  3THT A;  2J42 A;  5JZG B;  2I2S A;  5IVB A;  1VBE 2;  2G9Z A;  3MUZ 1;  1SBF A;  2UU8 A;  2VMD A;  4HXC A;  1IOA A;  4EN6 B;  4LEJ A;  4GB3 2;  2BGC A;  1YJK A;  2RS3 3;  4KQ7 A;  1G86 A;  2GSY A;  2VL4 A;  4P5H A;  5BNO C;  2R04 2;  2FDH A;  3ACL A;  4YVS A;  3WF0 A;  4Y5Z 0;  3VZO A;  1UY2 A;  2BTV C;  4D94 A;  3OOX A;  1LED A;  2R30 A;  4Q1P A;  1M06 G;  1AR8 3;  4CXW A;  1DYP A;  5FCC A;  5B4N A;  1HRV 2;  4MV2 A;  2WC2 A;  4Q26 A;  2CL2 A;  4NIH A;  4Z07 A;  3ZXD A;  2R0H A;  3AXD A;  1VBB 2;  1FX5 A;  3UGH A;  3CJI A;  4HL0 A;  4BH9 A;  3HBK A;  5KHI A;  1DLL A;  2YYO A;  2EID A;  5I0R A;  2JG9 C;  5FZB A;  3MIF A;  2D3R A;  3T2T A;  2OPK A;  1KS4 A;  1UZZ A;  4XFG A;  4OZX A;  5F3C A;  3PL0 A;  4XIK A;  3MF9 A;  2D6M A;  4XJW A;  1UZY A;  3HD8 B;  3KV6 A;  3T0B A;  4Z2A A;  2O8Q A;  4MVT A;  2V5D A;  5C8C C;  5EWS A;  4Q4X 3;  1US3 A;  4CCN A;  1XRU A;  5IAX A;  1ZRF A;  2E33 A;  2WS9 1;  2VU9 A;  1RUG 3;  5CVR A;  2EVX A;  4YGC A;  5DG1 A;  1XBF A;  3I7D A;  4Q4V 1;  5DUX A;  5LAT A;  4FAH A;  2P6C A;  1AL2 2;  2VOK A;  4E2G A;  4Y26 A;  1AVB A;  2LW8 A;  5FUN A;  2BFU S;  4M3C F;  2R6Q A;  4N43 A;  4XDQ A;  4NPM A;  2D43 A;  1I3H A;  3LKJ A;  4RN5 A;  1BZW A;  4NRQ A;  1URX A;  1O6U A;  3WY6 A;  1SLL A;  1ONA A;  4IGO A;  2ARC A;  3J8F 2;  5F5A A;  5G05 L;  1V0A A;  2CGO A;  1MS5 A;  2J1U A;  1NG0 A;  1BK1 A;  3DXU A;  3LFI A;  1QY4 A;  3IDA A;  4HON A;  2YC2 A;  3ZXE A;  4OUE A;  1YXW A;  2ZKL A;  3VDA A;  1QJU 3;  2ZX4 A;  1AR6 1;  4BJ0 A;  4UBG A;  2CYF A;  4WBB A;  5ACA 3;  2P34 A;  2WA4 A;  5FMO L;  1QH7 A;  1W9F A;  4GH4 A;  1RB8 G;  4EZH A;  3T30 A;  4CPB A;  2FCU A;  2WNU C;  2XBO 1;  3K75 B;  1FNY A;  3LA2 A;  3LCP A;  4NID A;  2CY6 A;  4IEO A;  1JZ4 A;  3NNL A;  1W3V A;  1UXZ A;  5BXX A;  3H0O A;  4J25 A;  1ZBE 2;  4ATF A;  1XQN A;  4CU9 A;  5IFP A;  2VZ3 A;  3AKT A;  3ACF A;  4WM8 B;  2PHU A;  4MHU A;  1ODN A;  3MW4 A;  2ZAH A;  4W8J A;  5DAP A;  3K3O A;  5J98 B;  2AAC A;  4GB3 3;  2GP3 A;  1X82 A;  5LBB A;  4AVT A;  4R4X A;  4YZ4 A;  3AMH A;  2P3I A;  3ECQ A;  1U0A A;  1S0G A;  4FPG A;  5C71 A;  1V9U 2;  3N9M A;  1D0G A;  1VIW B;  4XUT A;  4YYO A;  2TNF A;  4GWI A;  3M70 A;  4LHS A;  1NQD A;  2YGM A;  4NVP A;  3KGL A;  4XUN A;  4H2A A;  1HRV 3;  5IYY A;  1RUD 1;  4LUL A;  4RL7 A;  3N9L A;  2OQ6 A;  1H2M A;  1HKD A;  4CCM A;  1UX7 A;  2ZGR A;  5A32 B;  1B35 A;  1ZZB A;  3GHN A;  3S5A A;  4CDQ C;  2YU1 A;  3WHU A;  4QM9 A;  2GC1 A;  4G3Y C;  1Y9M A;  3S30 A;  1XSQ A;  4RR3 A;  4QX2 A;  4BK4 A;  1TMF 3;  4LOT A;  4D6S A;  5AFB A;  3THC A;  4QHB A;  1WLC A;  3WHT A;  5JDB A;  2BPA 2;  2RM2 3;  3B9I A;  4GWJ A;  4LA3 A;  1YIP A;  2B5H A;  2KA3 A;  2WNV B;  3MW3 A;  3NJY A;  4GA9 A;  4JDN A;  4QT6 A;  1JUI A;  1JYX A;  1RUI 2;  3O1M A;  2IC1 A;  3IAP A;  5ANQ A;  3BU7 A;  1V6K A;  2DVA A;  1TG7 A;  1WME A;  2XWJ B;  3KQ4 B;  2XJP A;  3KZ4 C;  5SV8 A;  1XNB A;  3NV3 A;  3Q8A A;  3LF7 A;  4XFA A;  3ROU A;  4IE4 A;  5JPM B;  4OQ9 A;  1DFQ A;  3GGL A;  1EUU A;  3FBY A;  4IE0 A;  3VKO A;  4CCJ A;  1H4H A;  5FMD A;  5A3T A;  4B1L A;  5HXV A;  4D3W A;  3WW2 A;  4Q4Y 3;  3J26 N;  3GBF A;  4JTN A;  2W1U A;  4DUV A;  2VUL A;  5JR7 B;  4XAB A;  2W47 A;  1OC1 A;  3J8F 3;  3KCC A;  3VBH A;  1FMD 2;  4S2F A;  5FJK A;  1QQP 2;  4Y3O A;  4Z8B A;  1RUF 2;  4UFL A;  4CP1 A;  2K9Z A;  1Z7S 3;  3LPG A;  1X7N A;  5FZO A;  1LJ7 A;  5C7G A;  5CA6 A;  1SLC A;  4IE7 A;  2GC3 A;  1HRI 1;  1YYN A;  4MH0 E;  1DGW X;  1RUE 2;  5F2S A;  1KJL A;  2W95 A;  2K2S A;  1S4C A;  2QZ2 A;  2C4X A;  1FV3 A;  3ZSE A;  5J96 B;  4R9C A;  1ZBE 3;  1SDW A;  2DFB A;  4IV3 B;  4B1M A;  1OUX A;  1SDD B;  4R4Z A;  1UO9 A;  1H2K A;  5FK7 A;  4KU7 A;  2QZ3 A;  4UFI A;  3KHC A;  1NQJ A;  4LK6 A;  1XYN A;  4N9H A;  4COV A;  5KBF A;  2EF6 A;  2JEC A;  3POI A;  5F7U A;  3TN9 2;  1W6Q B;  2E53 A;  3RZH A;  4FXG B;  3CZJ A;  1GMM A;  4AI0 A;  1UCX A;  2D3P A;  1ND2 A;  2WZR 2;  3M3O A;  1QMJ A;  4RD7 A;  1HW5 A;  2OVU A;  2WFF 1;  1DQ4 A;  2XH6 A;  3VDD C;  3PUQ A;  4C0H A;  1W8N A;  1NOV A;  3WCR A;  3RZJ A;  1O91 A;  1VMH A;  3EHK A;  3EMR A;  1Q8S A;  1W39 A;  4LIT A;  4V2V A;  2QDN A;  3VBO B;  5FPX A;  5FZ1 A;  3R0R A;  1R09 2;  5F37 A;  4XHB A;  1QJE A;  1K45 A;  3VBU A;  2YPD A;  2RG4 A;  5FP8 A;  3IBM A;  1JZ5 A;  5FOJ B;  5A1L A;  2PXJ A;  1FAY A;  1GU3 A;  3QBQ A;  5BNP C;  1RUI 3;  3AL5 A;  5LRR A;  3I3B A;  1PIV 1;  3UJO A;  4ZZ8 A;  1ST8 A;  2W1S A;  1MEC 2;  1XU1 A;  4IW3 A;  3BKZ A;  4A42 A;  2P6H A;  1KD7 A;  2RDS A;  2QQL A;  5FXX A;  3LEK A;  4GZ9 A;  3BUC A;  1RVF 2;  5A3M A;  1LAJ A;  4CDU B;  5FY1 A;  2DCJ A;  1XSR A;  4B3N A;  2VQT A;  5EJ3 A;  4RHV 2;  4ZXK A;  4MSV A;  1TEI A;  1C28 A;  1SBD A;  1VBC 2;  2Q30 A;  1N3Q A;  2VTF A;  2EAA A;  3LAG A;  2WYF A;  2P37 A;  1D4V B;  3O12 A;  4XJ8 A;  3GXU A;  5FWE A;  2PA7 A;  3BAL A;  3CDZ B;  5LW9 A;  2CDO A;  1SAC A;  2VMI A;  5ABJ B;  1YJL A;  3M8L A;  4LNV A;  5CIS A;  2ZAC A;  5LA1 A;  3H8R A;  5DUW A;  3W5N A;  3KQR A;  2DBN A;  3VDC A;  1FPN 1;  2X5I C;  1A6C A;  4ZON A;  1MVE A;  2XHK A;  4XFH A;  2LS6 A;  1VR3 A;  2H6C A;  1DZR A;  5FXW A;  1PO2 2;  2D6N A;  4FPJ A;  2XJQ A;  3RQ0 A;  4AFM A;  4ZZ5 A;  4C0B A;  1RUE 3;  1ZYB A;  4E4D X;  3ON7 A;  3T0D A;  1F4H A;  1SFP A;  1TME 3;  4UW6 A;  3MIC A;  2ADD A;  1LEM A;  5GLU A;  2DUP A;  4BCU A;  4FTB A;  3I3M A;  1YQ8 A;  1GYK A;  4BLI A;  2FZ2 A;  2WYS A;  1AX0 A;  1RJ8 A;  3H42 B;  3N9P A;  4NHX A;  2E7A A;  2JDA A;  2YUE A;  5C3P A;  3J4U H;  1F5J A;  4D6R A;  4AED C;  1HIX A;  3T2Q A;  4TSV A;  1RXF A;  2YMZ A;  3E5Q A;  1UPS A;  1POV 3;  1BJQ A;  3B93 A;  3EB7 A;  2VEC A;  4L0P A;  2WQZ C;  2BV4 A;  2RS5 1;  2WSV A;  4QPG C;  2XDV A;  5C70 A;  5IVE A;  2XG3 A;  1Q56 A;  4AFA A;  2JG8 C;  1E5R A;  2WZR 3;  1BXH A;  3W58 A;  1GOG A;  3ZFG A;  3K4A A;  1OOP A;  2ZEY A;  3WDW A;  5FY9 A;  1H8T B;  4DUX A;  2VZP A;  1GZW B;  1KDK A;  1LB2 A;  1W6N B;  4JQT A;  1ZZ7 A;  2ZGM A;  4NRO A;  3ZN6 A;  5HCF A;  4FCA A;  3KLS A;  5L7O C;  1R09 3;  1GSL A;  3T0A A;  5LRS A;  2O14 A;  2WZ8 A;  4QDS A;  4N7I A;  1UMH A;  1W9Y A;  2HWD 1;  4NHM A;  4Y4R A;  4CSW A;  5IVC A;  1AJK A;  2WWS A;  1RED A;  1MAC A;  2CWM A;  2VBD A;  4DUW A;  2ZX0 A;  4LKS A;  2WS9 2;  1LUL A;  3PHM A;  3IZO A;  2LRO A;  3VHN A;  2PTM A;  3ZYF A;  5JIU A;  2E63 A;  1CAV A;  5FKB A;  1EAH 3;  1Y7B A;  1MR5 A;  4XPV A;  3TNP B;  5FZ3 A;  4UAP A;  2QQP A;  4MXW A;  1S0E A;  4FO9 A;  3I8T A;  3ZFE A;  4FPE A;  4UI9 L;  5EYY A;  3WR0 A;  1CIY A;  3GDB A;  1RVF 3;  5LBC A;  1RJ7 A;  3ABZ A;  3AZX A;  2IZW A;  3FHA A;  1APN A;  4QX1 A;  3SH3 A;  4RHV 3;  4QPI B;  2ETE A;  2JJ6 A;  1CJP A;  1VBC 3;  4I0B A;  4A45 A;  4YM0 A;  2X05 A;  1SHW B;  2R32 A;  1BVV A;  1QIQ A;  1J1L A;  1V6L A;  2YFU A;  4LBN A;  2J1E A;  5CZK A;  3TYJ A;  3I49 A;  1CAX B;  1S0J A;  2W91 A;  2HLE A;  1LR5 A;  3N7L A;  4AFD A;  4NOT A;  1ZA7 A;  3R4D B;  4D7Y A;  1C8M 1;  1L7R A;  1J59 A;  3I2K A;  2XBO 2;  5ABJ C;  2QQM A;  3MLK A;  1TNF A;  3OGV A;  2Q8E A;  3WF2 A;  1JZ6 A;  2RDN A;  5JOX A;  3ZX7 A;  3A4U A;  3LGR A;  1D4M 1;  4LXL A;  1HB3 A;  1PGL 1;  3VHR A;  3N7J A;  3VHP A;  2XB6 C;  1POV 0;  2CNA A;  4Q0V A;  2ZGL A;  2ZKN A;  2P1B A;  2ORX A;  1WGP A;  4BME A;  3WUD A;  2PLV 2;  1O5U A;  4AEM A;  3P1I A;  4BQ4 A;  2B42 B;  2C9K A;  3OPZ A;  4GJZ A;  1FV2 A;  2RMU 1;  5LY2 A;  3RS6 A;  4W6W A;  4K9S A;  3I2D A;  2F17 A;  2VQA A;  1KFU L;  3I2I A;  3FX3 A;  3DPR C;  3H3L A;  2XQR A;  5IK8 A;  4KL1 A;  5FY4 A;  1S0C A;  5FPA A;  4M3C A;  2QQV A;  1K3I A;  3WQ7 A;  4NHY A;  1W2A X;  2UY9 A;  4YNI A;  5DAV A;  1DQ2 A;  5HV4 A;  3VKN A;  5GLW A;  1QOT A;  3WG1 A;  3OGG A;  2ZMK A;  4YW4 A;  4JVA A;  1W9S A;  1LOE A;  4M00 A;  2JB8 A;  1YQ6 A;  2ZCW A;  3AZW A;  5IVF A;  3H8O A;  3TNQ A;  3NJV A;  3OBA A;  4TN7 A;  5DDJ 1;  4CEW B;  4CP9 A;  5LEK A;  3AKQ A;  1NCR B;  1CVN A;  3JD7 2;  1PK6 B;  1J58 A;  5ANN A;  5KHJ A;  1DBN A;  2DCK A;  4QWN A;  1HN0 A;  3F2Z A;  1DGW A;  2F4P A;  3T08 A;  1HJG A;  4P9L A;  3WIN E;  5KXB A;  1ENQ A;  5JMC A;  2E7Q A;  1DLC A;  1GFF 2;  4FFI A;  5EV7 A;  4AXO A;  4I0W B;  5FBZ A;  2WS9 3;  1V6M A;  1OA4 A;  2WAB A;  1AYM 2;  4Q4V 3;  4HK8 A;  5IWF A;  5L73 A;  4B29 A;  1OFS A;  3H3U A;  4IUG A;  2HEV F;  3ZYP A;  1IHM A;  2XJV A;  4N53 B;  4XF9 A;  2EIG A;  2FZ1 A;  3ATG A;  3M3I A;  3A21 A;  3E97 A;  3EYP A;  3ORJ A;  4P08 A;  5A7W A;  5T3N A;  2QQW A;  4XFC A;  4DEV A;  2GND A;  4Y24 A;  5CFD A;  4DEQ A;  4C91 A;  1CJD A;  1PNF A;  4DZG A;  5L9V A;  5ISL A;  1CAW A;  1NZC A;  4FOY A;  1LGC A;  3NAP A;  2A71 A;  3O7O A;  1N1V A;  2XJR A;  3FLT A;  1GP5 A;  2ZEW A;  2GAU A;  4YVS B;  5FLH A;  3N9Q A;  3VBS A;  4P9J A;  5I0T A;  5LK5 A;  3U4S A;  4LOS A;  3ACI A;  5FQ0 A;  3SH5 A;  1BQP A;  1WW5 A;  4SBV A;  3PMS A;  5HCH A;  2OUJ A;  2XBO 3;  3ILN A;  1K5J A;  1ZRC A;  3RG0 A;  1W8T A;  4ZU4 A;  1ULE A;  1VMJ A;  4A3X A;  3CJI B;  1DQ6 A;  2EXH A;  3OGR A;  5FZH A;  3MID A;  3PUA A;  2YY1 A;  1O59 A;  3V65 A;  1LEC A;  4DXZ A;  1QJX 1;  2DU1 A;  1NCQ A;  3B5L B;  1H9W A;  1OVP A;  2BUK A;  3QD6 A;  3ASI A;  3LFM A;  1O5L A;  1UD1 A;  2PLV 3;  5FXZ A;  2H6B A;  2XL9 A;  4AEK A;  4FBF A;  1T2X A;  4AL9 A;  4B4Q A;  1GKB A;  4MAD A;  1MS4 A;  1YCI A;  3VD3 A;  1LGB A;  4BXF A;  4CDX C;  4GXL A;  2J1A A;  1ASJ 2;  1UOG A;  1NLQ A;  1OLM A;  1I5P A;  4OI2 A;  4Q2F A;  5EJ1 B;  4QB1 A;  3NNG A;  2XWB B;  1IQA A;  1RUD 3;  4RGK A;  4RSU A;  5KWR A;  1RYY A;  2WQ4 A;  2BWC A;  5EHD A;  4N43 B;  2PAE A;  4S2D A;  1SLA A;  1NY7 1;  1O8P A;  2C6S A;  4NHK A;  3S7I A;  3HR9 A;  4FPF A;  2ZGU A;  4XIO A;  1OA3 A;  1S0B A;  4G4F A;  1GQG A;  2PHW A;  4HSJ A;  3D8C A;  3R4S A;  5EQU A;  3GJA A;  2XOM A;  3CJX A;  1WA4 A;  4E2S A;  1W6O A;  1K5M C;  1YIF A;  4JGY C;  1VRH 1;  4BPZ A;  1QGL A;  3CQO A;  1FOD 1;  4UW5 A;  4OVE A;  1XND A;  5K0U A;  2OZ6 A;  1YC6 1;  2ZGO A;  1CZS A;  4GH4 B;  4QHZ A;  1IS4 A;  3VBO C;  2JD4 A;  1AZD A;  3IB3 A;  4A41 A;  2DV9 A;  4QGL A;  1BBT 1;  1JOB A;  1DGR A;  3OUI A;  2VAU A;  2VZS A;  2LTN A;  3I54 A;  4FOQ A;  4XQD A;  4ONU A;  4MOA A;  1ZA4 A;  2C9A A;  3OGJ A;  4Q0U A;  2FDJ A;  3APB A;  2P3J A;  3MDP A;  4TXW A;  1JMU B;  2ZGS A;  4PQQ A;  4Y1U A;  1OT5 A;  5TSW A;  2OZJ A;  2Q8D A;  3THP A;  3J9S A;  3KS7 A;  5JSO A;  2WT0 A;  4WVV A;  4ES8 A;  3PUS A;  4CXY A;  2Z5W A;  2V4A A;  1H1M A;  2HBU A;  4IET A;  4IES A;  2OQ7 A;  4GAZ A;  1EP0 A;  2JDH A;  1F8V A;  1VMF A;  1FPN 2;  1D2S A;  2VQ0 A;  2RJL A;  3N4M A;  1UY0 A;  3MFA A;  1PZ7 A;  2B39 A;  4RS5 C;  3KD4 A;  3T2P A;  1LHW A;  2BGO A;  1HRI 3;  3RSJ A;  3VD4 A;  4L2N A;  5I8T A;  5IK4 A;  4A7Z A;  2E26 A;  3GHM A;  4XF3 A;  3ACH A;  2PEL A;  3AYC A;  4DPN A;  1N3O A;  1ULO A;  2G9F A;  1B35 B;  4XFF A;  3ZXG A;  4E4H A;  3NKT A;  1EUT A;  4IEW A;  3POE A;  4ASK A;  3O1O A;  1ENX A;  4QXC A;  3C7F A;  1OKQ A;  1JN2 P;  1DYK A;  1PM4 A;  1W05 A;  2RS3 2;  4OUL A;  1MS3 A;  4QM8 A;  4RR3 B;  2Y64 A;  5GZD A;  3GCX A;  3IN9 A;  3ZXL A;  3TOJ A;  1CAX A;  4AI2 A;  1XOY A;  2ZGT A;  3WZ1 A;  5JI7 A;  3BOP A;  2CSG A;  1AR8 2;  3D82 A;  2WNE A;  3KGZ A;  1WWY A;  5I8S A;  3ZO0 B;  5CFC A;  4FOW A;  5JXJ A;  1O4Y A;  4H14 A;  3R6S A;  5FO7 B;  4ZKT B;  1BLZ A;  2Y6L A;  2YPJ A;  1C1L A;  1HLC A;  5JXG A;  2QQJ A;  1B09 A;  1ASJ 3;  1JU4 A;  1L7Q A;  2B9U A;  5F39 A;  5FZC A;  1O4T A;  1HJF A;  2JDN A;  5A1A A;  2WFF 3;  2QQI A;  2VMG A;  3RRD A;  3DYO A;  4QX5 A;  4YM1 A;  2A6Y A;  5CIR A;  4CUA A;  5C3R A;  2VZQ A;  4EV0 A;  4FAG A;  2YBP A;  1VBA 2;  2I45 A;  1S55 A;  1XNA A;  2J22 A;  2YC0 A;  3FN9 A;  4Q0Q A;  3T1M A;  5DQ0 A;  3ZLI A;  3P5B A;  5BNO A;  1AHS A;  4Q4X 2;  1TE1 B;  2GNT A;  5BNN A;  2FBE A;  2ZGQ A;  5FO8 B;  5F8P A;  3O1S A;  5DZE A;  2HWD 2;  3VBH B;  1RUG 2;  2JIJ A;  4Q8K A;  1RL3 A;  1E5I A;  1MS8 A;  1MQT C;  2O8O A;  2W1W A;  3JCI A;  1R64 A;  1H8T C;  3MZH A;  5FZO B;  3LA7 A;  4YFZ A;  1AJO A;  2XKP A;  2X09 A;  1QXR A;  4FQ4 A;  2BRT A;  1X8M A;  1FAT A;  1UOB A;  2R07 2;  4LLO A;  4QD2 A;  4QKD A;  3WNK A;  2Z79 A;  5L19 A;  4E4Z A;  4LUM A;  1UQX A;  4HKL A;  3O1U A;  5C3O A;  3F95 A;  3WCS A;  1J83 A;  1H0B A;  1IG3 A;  2JDK A;  3VZL A;  4LT5 A;  5DPN A;  1NZI A;  2HEW F;  4AHY A;  3AL6 A;  4XUP A;  5IVJ A;  2JKX A;  2YGL A;  4PLM A;  5ACA 2;  5EFU A;  5C8C A;  4YWA A;  4BYY A;  1FT9 A;  1JI6 A;  3PTR B;  1PZ8 A;  1NLS A;  3MIH A;  5I0U A;  1RTV A;  2FDI A;  1JW6 A;  2ZGK A;  2FMY A;  2Y26 A;  4QXH A;  2VC9 A;  2CGP A;  5IJR A;  4DRV A;  1FPN 3;  2HEY F;  3AP7 A;  1JYT A;  4S2G A;  5FPL A;  4XF4 A;  5KHG A;  3BPZ A;  1ND2 B;  3VL9 A;  4FT8 A;  1JYV A;  2VOW A;  1QJY 1;  4DIQ A;  3VHO A;  2IFW A;  1YI7 A;  2A3W A;  3WP4 A;  2WZE A;  3B3Q E;  2ZS6 B;  3AM2 A;  4XVH A;  1R08 1;  3MIB A;  2AYH A;  4ET7 A;  4XFI A;  2W2I A;  1UPI A;  2WQ8 A;  4FPC A;  5EJZ B;  3VKF C;  3C3V A;  1ZRE A;  1N3P A;  4P5Y A;  3ELN A;  4F8A A;  3CU7 A;  3BOW A;  5C9A C;  1CES A;  3VBU B;  5C8W A;  2W1Q A;  2XVL A;  3H50 A;  4OHW A;  4UOJ A;  3WQ1 A;  2EIB A;  2J1V A;  4BIF A;  1GBG A;  3JZV A;  5AVA A;  4LO6 B;  4WM7 B;  2WNU A;  4G9S B;  3WG2 A;  2IXL A;  5FK8 A;  5FZL A;  5BNQ A;  3GCW A;  5FZI A;  3WOG A;  2QQN A;  1IS5 A;  2VZU A;  4RGA A;  2P5B A;  2DUR A;  4HPK A;  1PHM A;  1TMF 2;  2B7Y A;  2CAU A;  4Z92 B;  4P00 B;  2W08 A;  4PF5 A;  4H3W A;  4CP0 A;  5KXC A;  2RM2 2;  1VBA 3;  4O61 A;  5J37 A;  1WMX A;  4DB5 A;  3O1R A;  4Q29 A;  4FFH A;  1XE7 A;  4Y1X A;  4E4S A;  1ULG A;  1IKP A;  4Y5S A;  2VUC A;  5A1F A;  3POG A;  4N9I A;  2HWD 3;  1UYY A;  1VB4 A;  2VZT A;  3TWI A;  1JZ3 A;  1TVG A;  2VMH A;  3VBR B;  1SCR A;  1YFU A;  4I01 A;  1S0I A;  3VN4 A;  1BEV 1;  3HWJ A;  1W9W A;  4QQ2 A;  2GC2 A;  3VBF C;  2BBA A;  3LSD A;  4CA9 A;  1WKY A;  1CN1 A;  4K7J A;  4CEW C;  2ZML A;  2R07 3;  1UN1 A;  5DMY A;  4Q4Y 2;  1JHN A;  5FP4 A;  2OT7 A;  3GZU C;  3PVE A;  2DTY A;  2VCC A;  5F3E A;  3VZK A;  2MHF A;  2ZZQ A;  5EP9 A;  5T5P A;  5E16 A;  2JDY A;  3UKN A;  1W2U A;  3WNX A;  5JWP A;  1W8F A;  4HAN A;  2LM3 A;  4L11 A;  3U07 A;  3ZYI B;  1Z7S 2;  4AHX A;  2ENR A;  1MVQ A;  3M7A A;  1V6O A;  3V56 A;  1EY2 A;  3KMH A;  3KCX A;  3FE5 A;  1VRB A;  2H0B A;  3BCW A;  3HN1 A;  2WUH A;  4NIG A;  5BY5 A;  4XAC A;  2A75 A;  1C8M 3;  1YO8 A;  2C5D A;  2A6Z A;  3W5M A;  3ZYB A;  3IIA A;  3ZFG B;  1RUH 2;  4NWW A;  1IS6 A;  2XR4 A;  1OOP B;  4OLL A;  5FPZ A;  5LZ6 A;  4IEY A;  1JZ7 A;  1EPZ A;  1D4M 3;  3C2U A;  3RMY A;  3FFQ A;  4XBQ A;  3HT2 A;  5FTT C;  3ZN6 B;  4YVS C;  2QCS B;  2RR1 1;  4QX7 A;  2A6V A;  5FYH A;  5FPU A;  2UYB A;  3E6D A;  1RUN A;  2ARE A;  1UNB A;  5F5C A;  5AC9 1;  3HIF A;  3Q8F A;  3UKT A;  2FDK A;  4EQV A;  3EJK A;  1L7L A;  4P9X A;  2CV6 A;  2Q8C A;  4BHP A;  3NV1 A;  1OH3 A;  4EJR A;  5FDB A;  1CAV B;  2LAL A;  4PIY A;  4MXW B;  5FPB A;  5JOZ A;  3D4K A;  4R9D A;  2HWB 2;  1LNS A;  3FUO A;  3IMN A;  2JX9 A;  3ZFE B;  3RZM A;  4PDW A;  2NMN A;  4RQP C;  3ZYH A;  1GOH A;  1NA1 B;  1W0N A;  1NY7 2;  2MEV 1;  1GZC A;  4PLO A;  3ZYG A;  1ZX5 A;  4MHR A;  4EN9 B;  4N7U A;  4F7Z A;  1QJZ A;  2ZHM A;  2F4L A;  4QU1 A;  3ZFF A;  3MPP G;  3IT8 A;  5H9P A;  4IV1 C;  5DAB A;  1SQ4 A;  1TQ5 A;  2GN7 A;  4UWD A;  3V0A A;  1FOD 2;  4R9A A;  4I3P A;  2IXI A;  3HBZ A;  3AP6 A;  4N43 C;  4K1Y A;  1SLT A;  2GN3 A;  1DDL A;  4FP3 A;  4NRP A;  3VDD A;  4F3J A;  3INA A;  3MUY 1;  2GDF A;  1BBT 2;  4P9G A;  4AVC A;  1LOB A;  2W0X A;  3HQU A;  2VNR A;  1UOJ A;  1IS3 A;  1IQD C;  1AR9 2;  1YNA A;  1QF3 A;  5T5L A;  4XCA A;  1GV9 A;  4UFK A;  4BWO A;  5J7M A;  1XE0 A;  1R1A 1;  5FYZ A;  3USU A;  3C7H A;  1PNG A;  1H2N A;  1YWK A;  3E5X A;  4B7K A;  2B4K A;  3PME A;  4JDO A;  4JKK A;  2UYA A;  5DZG A;  4YVW C;  5FZD A;  1ULF A;  2QFE A;  2Y38 A;  4K6B A;  5BNP A;  3BTX A;  5L9B A;  3QAC A;  5FYS A;  2HWF 1;  1UZW A;  1Z78 A;  2VR4 A;  2D40 A;  4QX8 A;  5A80 A;  3H8X A;  4FPO B;  1RIR A;  5B4X A;  1C3H A;  4C90 A;  1S1A A;  1KXG A;  1LGN A;  3MF6 A;  4SLI A;  4KWJ A;  1JYN A;  1XNT A;  2ERF A;  2PHX A;  1TME 2;  2WO3 A;  1OLR A;  3AKS A;  2FD8 A;  2AEY A;  2ZXQ A;  4M3C B;  4HN1 A;  3T2O A;  1ND3 B;  1BHG A;  1G8W A;  1PGW 1;  1RUH 3;  3SC7 X;  4W6X A;  4HK9 A;  1LOA A;  2BER A;  2GME A;  4BLJ A;  2WAO A;  1ZBA 1;  1IGO A;  3AKR A;  4TTG A;  3MFC A;  2IVI B;  5FLI A;  4PF1 A;  4OZO A;  2XJT A;  5JAX A;  4CP9 B;  3USS A;  2FMD A;  5A3L A;  1OBN A;  4AGV A;  2X29 A;  4LBQ B;  4IEV A;  2Z42 A;  4CPB D;  3UV9 A;  4RYD A;  5FXV A;  1P8J A;  3KT1 A;  2VOV A;  3MIE A;  2X5I A;  5J09 A;  3CO2 A;  2BZD A;  3PJY A;  1DGR N;  2ES3 A;  2WR9 A;  3MBW A;  1NXD 1;  3O5S A;  3OEB A;  5FRA A;  4CEY C;  3KV4 A;  2JIC A;  3MLL A;  4AAP A;  4COY A;  1ZRR A;  2VGD A;  2HWB 3;  4HFS A;  2BNN A;  4YM2 A;  5T52 A;  3O0X A;  1GLH A;  5A7W B;  1DZQ A;  4P14 A;  2P4E A;  1DZT A;  4QX3 A;  5M0T A;  5H9Q A;  4YM3 A;  1LOC A;  5CFD B;  3H8U A;  1BCX A;  4AQ6 A;  2D6L X;  4I02 A;  1CAW B;  2A7A A;  4AED A;  3VDB A;  1CZT A;  1UKR A;  1AYN 1;  3PTY A;  3NAP B;  5DAX A;  4BXS V;  2YBS A;  3MEP A;  5D8A C;  4WM7 A;  4QQP A;  1EAH 2;  3I3E A;  1VRH 3;  4QPG A;  1FOD 3;  3PNA A;  4QHO A;  3VBS B;  2JG8 A;  4LK7 A;  3CLP A;  5FQ0 B;  4K8F A;  4R9B A;  1C1F A;  4YW5 A;  2ARX A;  2JDP A;  1X8E A;  3WW1 A;  5T54 A;  4MGZ E;  1BBT 3;  2BVB A;  1RUJ 1;  3K2O A;  1HQW A;  1UYP A;  4ITC A;  1GZT A;  1ULP A;  1UWW A;  4FFG A;  1AR9 3;  4NIA A;  5L7O A;  5GKA C;  2WWJ A;  3S5Q A;  4CCE A;  3CKH A;  3NRU A;  1YUD A;  3UGF A;  5LY1 A;  4DY5 A;  1NCQ B;  1HB1 A;  4IE6 A;  4BZ4 A;  2B8M A;  4UW4 A;  1Z0H A;  3SQO A;  4KWU A;  4WZC A;  1W8H A;  4ZPI A;  2DVG A;  3VBR A;  2Y6K A;  3AC0 A;  5C5U A;  3M3Q A;  5LB6 A;  1W8O A;  1W0O A;  3FHI B;  3T4H B;  3TBD A;  5C6C A;  3FFZ A;  1QDO A;  2MNG A;  3HVD A;  3ZPY A;  4UYB A;  4O7X A;  3SEP A;  3I59 A;  5A7Q A;  1V6J A;  1ODM A;  4ZXE A;  2BNO A;  1XNK A;  4FI9 A;  3M2M A;  4DS0 A;  2ET1 A;  5IT6 A;  1R08 2;  1WW6 A;  3ILR A;  2L9L A;  3PVN A;  3TRS B;  3PUR A;  1VAV A;  5FZ0 A;  1CPM A;  3NV2 A;  1COV 1;  4FOV A;  4QB2 A;  1RMU 1;  1A3K A;  1VBD 1;  4OHV A;  3ZKU A;  3ACG A;  5IFT A;  5IW0 A;  2PAM A;  3P6B A;  1DQ0 A;  3AXE A;  1OQE A;  1W6O B;  4R8H A;  2A6W A;  3H1M A;  3L2Y A;  4A4A A;  2J7M A;  5FMO S;  5K0U B;  3SIS A;  3W21 A;  5JZG C;  4LO7 A;  4BIO A;  5FPV A;  1DIW A;  1VLN A;  4QXK A;  5DG2 A;  4LBM A;  1X9P A;  2RE9 A;  1OA2 A;  4MZU A;  2DU0 A;  1YQC A;  4AVB A;  1DCS A;  2AH2 A;  2V09 A;  3TAY A;  1GP4 A;  1E57 A;  2A73 B;  1OH4 A;  3HNY M;  5CG8 A;  1YI9 A;  4AEJ A;  1UIK A;  4AVA A;  1AXK A;  1HV0 A;  2VBB A;  2MPF A;  1GR3 A;  3T09 A;  5FZ8 A;  5F9T A;  3KV9 A;  1JU3 A;  2ZA9 A;  3JB4 C;  3LE0 A;  1K42 A;  1QWR A;  1MS1 A;  4Q4V 2;  3DPR A;  5LAS A;  4BQX A;  4HVO A;  3VKL A;  1SLB A;  1E5H A;  2E51 A;  2D44 A;  2WRA A;  4KGG A;  1JYI A;  2D5H A;  2C1F A;  2VO5 A;  5GZE A;  3AK0 A;  3JBG 1;  3Q8E A;  3LWC A;  1W6M A;  3H1Y A;  1YFY A;  4H7L A;  3S57 A;  1NA1 A;  3GJB A;  1N1S A;  3PLQ A;  3ZIX A;  4EWD A;  3ETQ A;  4XAA A;  5J3U A;  3OYW A;  2PN5 A;  1NAE A;  1QNW A;  4LKE A;  5FLJ A;  5A6Y A;  3O14 A;  3EO6 A;  4O65 A;  4XCB A;  3AKP A;  4XXP A;  4K20 A;  3U37 A;  2PMW B;  3LDB A;  4BQY A;  2A70 A;  5FP7 A;  1UIJ A;  5GM0 A;  1HXS 1;  1WBL A;  2PFW A;  2PQQ A;  1AR6 2;  2OII A;  3P3P A;  2IXK A;  4YGD A;  3ZKY A;  4LA2 A;  4JQR A;  1NT0 A;  2UUR A;  4XQW A;  2GH2 A;  1WD4 A;  5CFC B;  2JDM A;  4MET A;  3WP3 A;  1SCS A;  4HG6 B;  3LZZ A;  2E32 A;  5F2W A;  2JEN A;  4JGZ B;  4KGQ A;  3RWN A;  1OLQ A;  5CNA A;  1R1Z A;  4CCC A;  1REF A;  2QNK A;  3OTF A;  5FRE A;  3FWE A;  1H1A A;  1QHD A;  1QJY 3;  2JE9 A;  2W94 A;  5FZF A;  2VOT A;  3SIT A;  1FYU A;  1QJU 1;  4CCL A;  2PYT A;  4LOR A;  1R08 3;  4AW7 A;  1F9K A;  5IHR A;  2UWB A;  1Y9Q A;  1UMZ A;  2VMF A;  2ILM A;  4RGG A;  4UXA A;  2I07 B;  4XXA A;  5BNO B;  3CZU A;  3IDE A;  2OA2 A;  2RV9 A;  4IQP A;  3VB9 A;  1GUI A;  5BNN B;  4XJA A;  5GLZ A;  4Y22 A;  4D69 A;  1AL0 G;  2XON A;  5A3P A;  3GBG A;  2P3K A;  4KWK A;  4LTA A;  2W5F A;  5H9S A;  4YZ3 A;  1RUD 2;  2W39 A;  1OXC A;  2X8K A;  1ND3 A;  1Y4W A;  2WT1 A;  3MW2 A;  1VBE 1;  4IND A;  4MUV A;  4WM8 C;  1UU4 A;  4N90 A;  5FYI A;  5T5J A;  4YW1 A;  5C4W A;  1BK0 A;  1OKO A;  2GMM A;  4DXT A;  3OUH A;  4GB3 1;  2B46 X;  4OQ8 A;  2FCV A;  2JG9 B;  2PQS A;  1FXZ A;  4MGQ A;  3WQ0 A;  3WF1 A;  2MEV 2;  1H8V A;  2R04 1;  5LBF A;  4OFG A;  2CU5 A;  4QQL A;  3CNA A;  2VTX A;  3DEM A;  2OYZ A;  2KR2 A;  3IDB B;  2AC1 A;  4LBQ A;  4P9I A;  4QGN A;  4BB3 A;  1J3R A;  5DUU A;  5HXM A;  4XQ4 A;  5JOY A;  2KXL A;  4EZ4 A;  3AP4 A;  5DXD A;  4L9B A;  4LBO A;  2XLG A;  5C8C B;  1OD5 A;  4CDX A;  1GWM A;  4RFT 0;  4AQS A;  4AI3 A;  1VBB 1;  4WVZ A;  2CAV A;  1QEX A;  2IUW A;  2JIG A;  4IL7 A;  4QKF A;  2JB4 A;  5D2A A;  2WL1 A;  1BEV 3;  3E5U A;  3LEG A;  2P3Y A;  2VW2 A;  3ZN5 A;  4DIN B;  1W03 A;  4GMP 1;  3AP9 A;  4BOW A;  1ZZ9 A;  2E9Q A;  2GMP A;  1GNY A;  3BN6 A;  1SFN A;  2YXS A;  2D93 A;  2WNV C;  5A3N A;  4DFS A;  1OD3 A;  2W52 A;  3M4F A;  2A5Z A;  1GQH A;  2RDR A;  1SZB A;  2XJS A;  4IE5 A;  3AZY A;  1RUO A;  2VCM A;  1ZZ8 A;  1UX6 A;  3OPT A;  3AYD A;  3WX5 A;  1K5M A;  3HQX A;  3P3N A;  1AL2 1;  1AR6 3;  1Y43 B;  3L2H A;  1TNR A;  2D3S A;  4XC9 A;  1U5Y A;  1X33 A;  3ZSM A;  2K46 A;  2HWF 2;  4D8M A;  3ZYJ B;  1T6B X;  3DXT A;  4FSJ A;  1HRI 2;  4FTE A;  1S0D A;  4LBK A;  4NPL A;  4Y1Z A;  5EPA A;  2WNU B;  1N1Y A;  3B69 A;  1WCQ A;  2ZGP A;  4M0N A;  3ZVX A;  3SKV A;  3OF1 A;  4KU8 A;  1UMI A;  3WUC A;  1ZZC A;  5A7P A;  3M1H A;  3K4Z A;  2TBV A;  1SMV A;  3B00 A;  4NAM A;  2BBV A;  1ZBA 2;  4OMC A;  4HPK B;  2V5Y A;  5FY5 A;  4UBH A;  4RA0 A;  2Q1M A;  2RJ2 A;  4DQA A;  5JI9 A;  3KVB A;  4OMD A;  1G9B A;  1YRZ A;  5A7S A;  2EIC A;  3N9N A;  4CU6 A;  2Q1Z B;  4O9E A;  5AC9 3;  2O1Q A;  4UT5 A;  5JSR A;  3LSE A;  2ET7 A;  1LHU A;  5FZK A;  2W68 A;  4RS5 A;  5LA9 A;  4BU2 A;  4J1W A;  2WBK A;  2WFF 2;  1ZBE 1;  1KS5 A;  4IV3 C;  1W28 A;  1STM A;  1SLI A;  2K0G A;  3KHB A;  2O0O A;  5FR3 A;  2VCB A;  3WG3 A;  3W9A A;  1WCD J;  3BOD A;  1WW4 A;  2BOI A;  2I74 A;  2YHJ A;  1U5X A;  3MGU A;  1LKN A;  2ZAB A;  1LHO A;  3POW A;  2UY8 A;  4IEP A;  3G7D A;  3AJZ A;  3AFG A;  1IPS A;  2MEV 3;  1DP0 A;  1H30 A;  1V9U 1;  3KT7 A;  1F4A A;  2V72 A;  4KI5 M;  3U10 A;  4LHL A;  3DYM A;  3HNB M;  4M0H A;  2BFU L;  2GC0 A;  3ME2 A;  1KDM A;  1NLR A;  4ATE A;  1PIV 2;  3H7Y A;  3BVC A;  4CZS A;  3BYW A;  3IPV A;  5EXO A;  5FP3 A;  3UET A;  2ID4 A;  3VD7 A;  2XHN A;  3AFK A;  3FUQ A;  3DYP A;  4PI2 A;  2G4I A;  1YFX A;  3A0K A;  1WLD A;  1XE8 A;  5KHH A;  3ZXA C;  2PHL A;  5CFD C;  2FDF A;  3K4D A;  4I09 A;  4JKL A;  4LBQ D;  2R49 A;  4URA A;  3NAP C;  1CPN A;  3LD8 A;  3DGT A;  1W9T A;  4YZ1 A;  2YZ4 A;  3WW3 A;  2ZGN A;  4Y20 A;  5FMB A;  3UYJ A;  2ZEZ A;  1UKG A;  1QOS A;  2VPV A;  3RI8 A;  3CHX A;  4QMA A;  3VBS C;  1UZ0 A;  4A7Y A;  1W2O A;  1F15 A;  4HOO A;  3V0B A;  2W9X A;  5FZ7 A;  1MQT A;  1YLL A;  5FY0 A;  2YG0 A;  3J7M A;  4CDU C;  2VNV A;  2ADE A;  4HKW A;  1KRI A;  2Y34 A;  4KG8 A;  2HWF 3;  4J6G A;  3U1X A;  4ES9 A;  4CXX A;  1JUH A;  3MHZ A;  3AZZ A;  4HN0 A;  1U12 A;  1NCQ C;  3WP6 A;  1CWP A;  3R4U A;  1FMD 1;  4NWV A;  4XMI A;  4PDW B;  1Q8P A;  1QQP 1;  2DFC A;  1CIW A;  2YV8 A;  3OBT A;  4LKF A;  5HCB A;  2RS1 1;  1G9F A;  3DUI A;  1COV 2;  1ZBA 3;  1RUF 1;  2W92 A;  3POS A;  4OI1 A;  4CDW A;  3HEI A;  4ERO A;  3S0M A;  1SPP A;  3BTA A;  3ZFF B;  2Y0I A;  2FHR A;  1HB4 A;  4QQH A;  2BQP A;  3JUU A;  4XUQ A;  4HT1 T;  4QKN A;  1D7P M;  2BU9 A;  3DV8 A;  3ZSK A;  2B9V A;  4AOC A;  2JEM A;  1QU0 A;  1AR7 1;  3OG2 A;  4JGZ A;  4L97 A;  2RS5 2;  4NUB A;  3V0A B;  1QOO A;  4XZU G;  1PO1 1;  5GZF A;  3POF A;  5JCT A;  1LCL A;  2JXA A;  3TEZ A;  4AAX A;  4E8D A;  1DHK B;  1W6P A;  4HSL A;  2VCA A;  3VDD B;  3FC0 A;  1WA6 X;  3U4X A;  3U75 A;  4TZD A;  3D6E A;  4UFJ A;  4QAW A;  4CTE A;  3HPN A;  2NYY A;  4Y4Y A;  2J1R A;  2ZBJ A;  4M3C E;  4P02 B;  5F6L B;  5CAD A;  4TWT A;  2VXR A;  2J1S A;  5FZG A;  1UYX A;  3NNJ A;  3TN9 1;  4JAA A;  2D6O X;  3PVO A;  3USU B;  5C9A A;  1Q5O A;  4URT A;  4Y1Y A;  3WF3 A;  5A6Q A;  3A22 A;  5H9R A;  3TB0 A;  2ZJC A;  5HCA A;  4PBP A;  5GLV A;  3KF3 A;  2ZHL A;  5BNP B;  1PIV 3;  3CEW A;  4K21 A;  4KMQ A;  3DEC A;  3HAG A;  4JKM A;  4MLO A;  4NO4 A;  2R7E B;  1WLW A;  5DN2 A;  5JUV A;  1LOF C;  5DUV A;  1WLT A;  2VTX J;  4ARX A;  3JBG 2;  4XDP A;  5LBE A;  2JG9 A;  4ZY9 A;  3OJB A;  4YAR A;  4FPY A;  3TEX A;  2PHD A;  1JOD A;  2VNO A;  4Z82 A;  3C7O A;  5IUQ A;  3BIW E;  3LIH A;  4FP2 A;  5FYB A;  2DCT A;  5GJ6 A;  2HWE 1;  1WZX A;  4AGG A;  4JHZ A;  4LO5 B;  4KNC A;  3W20 A;  2VUD A;  3E6C C;  1MEC 1;  2JDU A;  3Q8B A;  3AMQ A;  3GNE A;  1OMI A;  3PUI A;  3X29 B;  5JXH A;  3ALQ A;  2NMO A;  4OHZ A;  2OS2 A;  2VZO A;  5C3Q A;  1C8M 2;  3I97 A;  2X5I B;  3VBF A;  4NN0 A;  4ZHN A;  2DVF A;  4QPI C;  5FJH A;  3UT0 A;  4DRR A;  5FZE A;  1D4M 2;  3HOB A;  1PGL 2;  2R16 A;  4BE3 A;  2W46 A;  2HWC 1;  1PGS A;  4YRD A;  1IKQ A;  3ITQ A;  2VME A;  2AGS A;  4OUS A;  3RDI A;  3KWV A;  2Q5T A;  4E9K A;  2YB7 A;  3AZV A;  1COV 3;  3UES A;  1CAU A;  1RMU 3;  1VBD 3;  2QTW B;  4XFB A;  2RMU 2;  3A0N A;  4AED B;  3PUH A;  3U14 A;  2XML A;  4Z1V A;  2AR6 A;  1ULC A;  1PO2 1;  1RIT A;  4O9G A;  5F6K A;  1G7Y A;  1GNH A;  2D7F A;  2RS5 3;  4QPG B;  1H2L A;  2YFZ A;  4IEQ A;  3S6P A;  3UKV A;  3TEY A;  4XF1 A;  3OD0 A;  1O8S A;  5FZ4 A;  2JG8 B;  1LES A;  1V6I A;  3U78 A;  4AFB A;  4EN8 B;  2WJS A;  5FUI A;  4NMI A;  5BYN A;  5HI0 A;  3JU9 A;  2DUQ A;  4BQ5 A;  5LCW L;  1OLM E;  2WA3 A;  3WG4 A;  2HH9 A;  5FZM A;  4X6Q B;  5BNN C;  1AX2 A;  4YG0 A;  3LB9 A;  5DDJ 2;  4AHZ A;  2ZZJ A;  4IXL A;  4DXR A;  5L7O B;  1JYW A;  4ZU7 A;  2AEN A;  5FZA A;  5B2G B;  1LTE A;  4CCO A;  3H7J A;  1JZ2 A;  4EWE A;  4HET A;  3GYD A;  5FWJ A;  2NLR A;  2VE1 A;  2WLP A;  4U2A A;  3D3A A;  1OQD A;  1G9D A;  2VH9 A;  2E7T A;  1UY4 A;  5EZW A;  5LA0 A;  1KEX A;  4QQO A;  4PCR A;  4XOG A;  3JBG 3;  4CDQ A;  1NCR C;  1DU3 D;  2OX0 A;  1MZF A;  3I2G A;  1PK6 C;  4M4R A;  3I59 B;  4RQP A;  4WVM A;  4LR4 A;  4BIS A;  4BM8 A;  3N3H A;  3FLR A;  3VZM A;  2QJV A;  4AFC A;  1AXZ A;  1PMH X;  3AMP A;  4ZS3 A;  1UY3 A;  1LHN A;  4LE4 A;  5FV3 A;  4EN0 A;  3VGI A;  2BDR A;  1GZ9 A;  2UWA A;  2WNO A;  1Q8Q A;  1IZ3 A;  3IAQ A;  4IV1 A;  5J1X A;  3SHR A;  2D97 A;  2ZAA A;  1HXS 3;  2XJU A;  5DZF A;  3K46 A;  3KT4 A;  4N53 C;  1LU1 A;  1W90 A;  4I3G A;  3AJY A;  4BQW A;  3WDV A;  2BW8 A;  3E1F 1;  3LPF A;  2Y6H A;  3KVA A;  4LIU A;  4QKB A;  3C8X A;  5LEJ A;  3ES1 A;  5HPO A;  3BPS A;  3E6B A;  4COZ A;  3EQE A;  5T50 A;  2C26 A;  3WDU A;  1M4W A;  3AVS A;  3NL1 A;  4YPJ A;  1PMI A;  1DQ5 A;  3WLU A;  1US2 A;  3MLJ A;  5BPX A;  2LUW A;  4NR1 A;  3LIG A;  4TYS A;  4YW7 A;  2Y8K A;  5FUP A;  3T1L A;  2Y6G A;  2HYK A;  1QJX 2;  3MV1 1;  1H6Y A;  2QUO A;  5IVV A;  2WO1 A;  2PHT A;  4D7S A;  1RHI 1;  2OUH A;  3KSC A;  1C5H A;  1HX6 A;  3SLI A;  3IMM A;  4YVW A;  4XMA A;  4NE9 A;  2RMU 3;  4XJU A;  4TLG A;  2ZOE B;  5CU1 A;  2EXJ A;  2ZTN A;  1FNZ A;  4KG0 A;  3RZZ A;  3LOB A;  3GZA A;  1PVC 1;  1UU6 A;  3CJI C;  5DAQ A;  4BQ2 A;  2VUJ A;  5JR2 A;  3DPR B;  3HJR A;  1VAK A;  1POQ A;  4OYU A;  4XAE A;  2HBT A;  3O1T A;  3N7K A;  2VW0 A;  1VBE 3;  2DDU A;  1W6M B;  5L9R A;  4Y33 A;  2PLV 1;  1XC6 A;  5IAV A;  3L9J T;  3PDQ A;  1H4G A;  3OYW B;  2R04 3;  3D5O A;  1UL9 A;  2AEZ A;  4JCK A;  5DDJ 3;  4COU A;  2Y0O A;  4RFR B;  1W2T A;  2EA7 A;  4CUC A;  1ZRI A;  2G9G A;  2UWC A;  4GWN A;  2VVE A;  2EXK A;  1DGL A;  1KGY A;  1VRH 2;  2Q8O A;  4CUB A;  5SV5 A;  4J1X A;  1W0P A;  2V4V A;  1VBB 3;  1W04 A;  4CEY A;  2ORZ A;  2Y60 A;  4HLT A;  3SCG A;  4N8M A;  2QQU A;  2R06 1;  1BVP 1;  2EIE A;  4GMP 3;  2GNB A;  4JZR A;  5FY8 A;  3PU3 A;  4H55 A;  1I5Z A;  3NNM A;  4XDO A;  3RGB A;  4C8D A;  4YZ5 A;  1W3X A;  4W6Y A;  3JD7 1;  5A3U A;  4GJY A;  3UGG A;  3VD5 A;  4FXK B;  2HJI A;  2OKX A;  3OY8 A;  1WMF A;  5FZ6 A;  1XYP A;  2VVF A;  5A6X A;  4YFW A;  2PAK A;  4GH4 C;  1L3J A;  1EV1 1;  5K8S A;  2CDP A;  3MYX A;  2CWS A;  5D8A A;  1AYM 1;  1UZV A;  2H0V A;  3A23 A;  4NPR A;  3RWK X;  2RVA A;  3NVC A;  3WQB A;  1V6N A;  1AL2 3;  4FPH A;  1H6X A;  4NRM A;  3K77 A;  5FOB B;  3III A;  3M3E A;  4Y22 B;  1JBC A;  4AHW A;  1YQ5 A;  1XYO A;  3K51 A;  3KM5 A;  5IAT A;  4CCK A;  1HQL A;  1I1E A;  1RXG A;  3WP5 A;  1ENS A;  4MYE A;  5HBA A;  3B7M A;  1DYO A;  2QDR A;  5F3G A;  3GF6 A;  3NW4 A;  1N1T A;  2D6P A;  2WDB A;  5C4W B;  4XJ9 A;  2YBK A;  5FYY A;  3GM8 A;  4XYX A;  3HQR A;  3NQH A;  4OCT A;  2RS1 2;  1QJX 3;  1NE6 A;  1Q3E A;  1OPM A;  1LOD A;  1ENR A;  4ZS2 A;  3UK9 A;  2NP0 A;  3DF0 A;  2YU2 A;  1G6N A;  3NKG A;  5J48 A;  3NNF A;  4U36 A;  3H3Z A;  1ZVF A;  4CU8 A;  1AR7 2;  2BGP A;  4AYU A;  4AI1 A;  3HMY A;  2DBI A;  4ARY A;  4C1X A;  1PO1 2;  4CDX B;  1B35 C;  4XEZ A;  1UYZ A;  2DF7 A;  4JV4 A;  5A70 A;  4PDW C;  1REE A;  1O3S A;  3T3Y A;  5DAW A;  3WNM A;  4RR3 C;  1OUR A;  2WAA A;  2SBA A;  1W8U A;  4XIL A;  3DN7 A;  3D0J A;  3J7H A;  1NX9 A;  3A7Q A;  4FQZ A;  1XXN A;  3ZFF C;  4AGR A;  3RZL A;  3LDK A;  2JD9 A;  1E5S A;  3NO8 A;  3SEE A;  3WSO A;  2VZV A;  4B4R A;  2WFP A;  4HMZ A;  1QH6 A;  3WNN A;  3N36 A;  5KXD A;  1S2E A;  2Z4F A;  3CF6 E;  4UF0 A;  1A78 A;  1VAM A;  1V9U 3;  2ZEX A;  1AUY A;  3PIJ A;  3RPQ A;  5LK7 B;  1CX4 A;  1ASJ 1;  5A7O A;  1V00 A;  5K7P A;  1OSG A;  4QB6 A;  1V70 A;  3SKJ E;  1EYB A;  4DMI A;  4GMP 0;  1K5M B;  4JGY B;  4MO3 M;  4JX0 A;  4BA6 A;  3UNP A;  4IER A;  5JZG A;  3ZSL A;  3IWZ A;  5E1R A;  4I30 A;  2XXZ A;  1ZZ6 A;  4JRA A;  4LHN A;  4PIX A;  4K3U A;  1GWK A;  1ACC A;  4EN7 B;  1OI6 A;  1JOP A;  3WDT A;  4Q0P A;  1WCS A;  4PJY A;  1W06 A;  2JDZ A;  4CCD A;  1WBF A;  4Q5O A;  5FYT A;  3VBH C;  4QGM A;  3I4I A;  4NII A;  3SCF A;  5FAX A;  1YFW A;  1VP6 A;  2OW4 A;  1OPO A;  3WV6 A;  3ZSJ A;  2NN8 A;  3ENR A;  3S7E A;  4ISR A;  3ST7 A;  2HWE 2;  4ASM B;  4I2O A;  1O3T A;  1IPJ A;  4UFM A;  2GH8 A;  2VNG A;  4MGT A;  4QDR A;  3LDR A;  1WCU A;  5FFO C;  2DYC A;  4XJZ A;  2XGX A;  5GZG A;  4GKX A;  1Q43 A;  3K3N A;  5IK5 A;  3FZ3 A;  2EAK A;  3ES4 A;  2Q0A A;  4RS5 B;  3WNL A;  4YGB A;  1AXY A;  1CR7 A;  1QJY 2;  2AZ5 A;  1G9A A;  1Y3T A;  1BYH A;  2FCT A;  2J1T A;  4LPL A;  2VZR A;  3B9C A;  5HV0 A;  2Q4S A;  2WN2 A;  1RUC 1;  1I6X A;  4YG3 A;  3AVR A;  1O3R A;  4LE3 A;  1FI2 A;  4GIQ A;  4CE8 A;  2WZP P;  5CKN A;  2IXJ A;  1FMD 3;  2HWC 2;  2R1B A;  4Q4W 1;  3THD A;  2DTW A;  3WW4 A;  5KC5 A;  5FKC A;  1QQP 3;  4M01 A;  1MPX A;  2JE7 A;  5AVP A;  5A7N A;  2RDQ A;  2RS1 3;  3LEM A;  2VXJ A;  1RUF 3;  2D98 A;  5JOW A;  1LEN A;  3MI8 A;  1LHV A;  1ND2 C;  3BTY A;  3CBN A;  5F1R A;  2BOJ A;  4JC1 A;  4JHT A;  2VJX A;  2BYV E;  1MS0 A;  1AR7 3;  1ALY A;  2DWR A;  2JWP A;  4L99 A;  1OVS A;  4Q8L A;  2ARA A;  3DKW A;  5F5I A;  5FO9 B;  1PO1 3;  3IPV B;  2ARB A;  4XZP A;  1UAI A;  1VE0 A;  1PX4 A;  2G1M A;  2VD7 A;  4IEZ A;  1LU2 A;  2C24 A;  3CL1 A;  5A3O A;  1JS9 A;  2EAL A;  2RS3 1;  1G9C A;  3B01 A;  2QE3 A;  1D2Q A;  2WIN B;  3RYK A;  3VBU C;  2ZX2 A;  3FLP A;  3QOP A;  2ZX3 A;  3U0Z A;  3PU8 A;  4LKD A;  1AR8 1;  1SBE A;  1IG0 A;  5D21 A;  4WM7 C;  4Y20 B;  4AVV A;  1PM7 A;  1OHF A;  3TN9 3;  3EXU A;  2ZHK A;  3QLQ A;  4W4Z A;  1NE4 A;  1U5Z A;  2DVB A;  4GAL A;  3SXW A;  3FHQ A;  3V0B B;  3WDX A;  1OQ1 A;  1MQT B;  1BEV 2;  1C5I A;  2QKD A;  3CIH A;  3KCY A;  5F3I A;  2QVS B;  5ERL A;  3N9O A;  4MGS A;  2EXI A;  1ZNP A;  4WM8 A;  3Q9O A;  3RZK A;  2GAL A;  2E6V A;  1GWL A;  1VBA 1;  1H1I A;  4LBL A;  5C3S A;  3PVB B;  5K4L A;  4FVV A;  4X8P A;  2SLI A;  4OHY A;  2Y6J A;  3VLB B;  2LRP A;  1A8M A;  4Q4X 1;  1RGS A;  5AFE A;  1U5I A;  5J36 A;  1Q8O A;  1RIN A;  5CYY A;  5T5O A;  2KD7 A;  4D7T A;  2NM1 A;  3ZMO A;  4X6R B;  3Q8C A;  1RUG 1;  3QCW A;  3RYP A;  3IDC B;  3JQX A;  3VBR C;  3W59 A;  2D5F A;  4BMB A;  4KH9 A;  2XQX A;  5JSP A;  1CD3 G;  2TEP A;  4QDQ A;  1F31 A;  1QXJ A;  2CTV A;  1WMD A;  2HWE 3;  3POY A;  3ZR6 A;  4CDW B;  3BIE A;  4L8Q A;  1SPP B;  3U11 A;  5GZC A;  3HN3 A;  3OPW A;  5E8A A;  1MEC 3;  5A32 A;  5JMO A;  3FBM A;  4LHK A;  4E8C A;  1X9T A;  2R07 1;  2R0F A;  1DG6 A;  2Y6F A;  2P2K A;  3G6J B;  2KM2 A;  2WWU A;  4LIV A;  5I0D A;  3VKM A;  1O3Q A;  4AVS A;  1J3P A;  4YLZ A;  2BVV A;  3H9A A;  4MG2 A;  5FIX A;  2ZPX A;  1F5F A;  1UW8 A;  1C4R A;  4A2U A;  3FJS A;  1Q8V A;  1PMJ X;  1W6P B;  3DKQ A;  1BMV 1;  2WNV A;  5ACA 1;  2RHP A;  5FYC A;  4Q1R A;  1KFX L;  1XNC A;  2XUM A;  3QH7 A;  2HWC 3;  2RR1 2;  5GLT A;  2Y33 A;  3O1V A;  2ZHN A;  4QPY A;  1JH5 A;  1RHI 2;  4XBL A;  4COW A;  4DNY A;  1JHJ A;  5AC9 2;  2XUE A;  1NKG A;  3HT1 A;  3I2H A;  2X10 A;  4P9Y A;  5IVY A;  3ZIW A;  4JDM A;  5C9A B;  1JYC A;  2P17 A;  3MPB A;  3ZFG C;  4PHZ A;  5CKM A;  2WN3 A;  1OOP C;  4C1W A;  1PO2 3;  1PVC 2;  3MV0 1;  5E88 A;  2B45 X;  5CBL A;  3JQW A;  1JZ8 A;  4B7E A;  1VPH A;  4NJ4 A;  2XPJ A;  3BTZ A;  4QU2 A;  4S2H A;  4EYU A;  3ZPO A;  4AR2 A;  4PBO A;  2PHF A;  3OEA A;  4WZF A;  5A3W A;  5KXE A;  4QPW A;  3AP5 A;  4Y5T A;  2CHH A;  3RI9 A;  4YW3 A;  1W99 A;  1HB2 A;  4AI8 A;  1HRV 1;  3C7G A;  3GAL A;  5BUV A;  4A6O A;  4ZU5 A;  5I91 A;  4A7K A;  1JTZ X;  1OUS A;  1UU5 A;  3ZFE C;  2AUY A;  1GAN A;  3LEI A;  5GAL A;  2A3Y A;  1NA1 C;  5JIA A;  1VAL A;  3GZT B;  4IV3 A;  3VBF B;  4MGK E;  3ZXJ A;  1TMF 1;  2R06 2;  4Q27 A;  3UJQ A;  2RM2 1;  3BB6 A;  3WEZ A;  1TZO A;  5CB7 A;  3MO4 A;  2BNM A;  5CKQ A;  3J7L A;  1CON A;  5A33 B;  3NJZ A;  1R1A 2;  2XKO A;  3VV1 A;  1W6Q A;  4M4P A;  1OFN A;  4Z2W A;  1W8W A;  2VVD A;  2Q1F A;  3IKW A;  3OSD A;  2FDG A;  3I2J A;  3O0V A;  1UF2 C;  1EV1 2;  2IFR A;  5FBJ A;  3FMG A;  4JGY A;  4LBJ A;  1CAU B;  2OPW A;  2VY0 A;  3N35 A;  4OUM A;  4XUO A;  4AE2 A;  5FZ9 A;  4IGQ A;  4BQ3 A;  1CX1 A;  1XPW A;  4IEU A;  3ZYR A;  3BI3 A;  2W3J A;  2GU9 A;  1HQN A;  3KB5 A;  1JXN A;  3VBO A;  4Q4Y 1;  4EE2 A;  4YW2 A;  3RYR A;  3RZG A;  3DL3 A;  4FTS A;  4AZZ A;  3NJX A;  2YC4 A;  3J8F 1;  4JTO A;  1PGW 2;  3JXS A;  4KWL A;  4MXV A;  2YRO A;  5KHK A;  2DCZ A;  3AMN A;  1WD3 A;  2A1X A;  5FYV A;  4Q0S A;  1WW7 A;  1MS9 A;  1Z7S 1;  4GUL A;  3WVJ A;  4WV8 A;  4AI9 A;  3SMH A;  3PIG A;  2RR1 3;  3TEW A;  1RC6 A;  5D1I A;  4P9W A;  4JRL A;  3EBR A;  4XUR A;  1RHI 3;  3UL2 A;  4B8E A;  2QBX A;  4H7M A;  3KV5 A;  4YGE A;  3WNO A;  4CDU A;  2VG9 A;  2IWG B;  5CEH A;  1ND3 C;  1RUH 1;  1S0F A;  2W87 A;  1SG3 A;  3VD9 A;  1PVC 3;  5C4W C;  1GOF A;  2Z69 A;  5FYU A;  1DQ1 A;  4V2W A;  3O0W A;  4KBZ A;  4CYD A;  1CGP A;  3QH6 A;  3AX4 A;  1QXP A;  1N47 A;  1W2N A;  3FL7 A;  5EYX A;  2A6X A;  3D0S A;  1ZRD A;  2DCY A;  3WD5 A;  4HZF A;  2Z2S B;  3WT3 A;  4CDQ B;  3H1W A;  2VM9 A;  4WVW A;  5F5Q A;  4WVM B;  5ABJ A;  4RQP B;  3OUJ A;  5KR7 A;  1GIC A;  3DCQ A;  3AB0 A;  1K12 A;  4XF0 A;  1SEF A;  2VMC A;  1MZE A;  1T6G C;  1AYN 2;  4AWD A;  2WO7 A;  2XLF A;  4IV1 B;  4XW3 A;  1IPK A;  1MZ5 A;  2WO2 A;  4CUG A;  3RFR A;  1ULD A;  3CMG A;  3I3Q A;  3AYA A;  4UFH A;  3GZE A;  2HWB 1;  2VOX A;  4W50 A;  5FY7 A;  4DOU A;  1NUK A;  3OBZ A;  1F35 A;  4NHL A;  4Y1V A;  1D0H A;  1XB9 A;  1RUJ 2;  1X50 A;  3V64 A;  2R06 3;  4FPK A;  2N7G A;  4IDZ A;  1KQR A;  2E31 A;  4K40 A;  4D0Q A;  4UW3 A;  5BV6 A;  5CAZ A;  4OI0 A;  4YG6 A;  2BWA A;  2VZ1 A;  3OGS A;  3JD7 3;  4PI0 A;  4FFF A;  1RUI 1;  4NAO A;  1BKZ A;  1R1A 3;  5FYM A;  3MIG A;  4XE9 A;  4DXS A;  3IM0 A;  3WDY A;  4AK3 A;  3PJQ A;  1EV1 3;  4A44 A;  2WII B;  3ILF A;  4LQR A;  3ZXK A;  1ZM1 A;  4I0A A;  3SNM A;  1S2B A;  1H8T A;  1AYM 3;  4YVW B;  2VQU A;  3LQC A;  4XTM A;  1GP6 A;  1XU2 A;  1GZW A;  4GQ7 A;  3RJR A;  4CVU A;  2IXH A;  3K48 A;  1W6N A;  2XVG A;  1GQP A;  1NYW A;  3B02 A;  1LOF A;  3URF A;  5I8Y A;  1MZ6 A;  2R1D A;  1AR9 1;  2IVJ A;  1YQ2 A;  3ZDS A;  4A3Z A;  5JXI A;  2X53 S;  2F6B A;  4MGI E;  5IK7 A;  4R52 A;  3AMM A;  4LO8 A;  2G19 A;  4TLF A;  4BK5 A;  5I93 A;  1RUC 2;  4BDV B;  3VUO A;  1LOG A;  2BEO A;  1VJ2 A;  1F2N A;  1AX1 A;  3T4V A;  5I0S A;  1C57 A;  4Q4W 2;  1RMU 2;  1OF4 A;  1VBD 2;  2XVK A;  4KBB A;  4X8N A;  5L36 A;  4PIZ A;  4LLF A;  5JVV A;  3ZMN A;  4ORF A;  4YSF A;  1UOF A;  2DUO A;  3ZR5 A;  3RVH A;  1PVX A;  1RUE 1;  3ZN4 A;  1YEW A;  1DF0 A;  5C33 A;  5CG9 A;  5LWB A;  1XJA A;  1TME 1;  1WUV A;  2FQP A;  1C8N A;  2OXB A;  2VW1 A;  4L92 A;  3VL8 A;  5C5T A;  3GBW A; 
#chains in the Genus database with same CATH homology
 3UT0 A;  1GWK A;  3ORJ A;  1OKO A;  1UOJ A;  2C24 A;  1GWL A;  1W8U A;  3F95 A;  3ZYH A;  4BQ5 A;  1V0A A;  4A6S A;  4YW7 A;  2WYF A;  2LRP A;  4LKE A;  4CP9 A;  4LKF A;  2O14 A;  1WMX A;  4BQ4 A;  4LK6 A;  2KR2 A;  4LKD A;  1WZX A;  1HN0 A;  4YWA A;  4AL9 A;  1W8W A;  4CP9 B;  2Q1F A;  4LJH A;  5D21 A;  1W9F A;  1W8Z A;  2VXJ A;  4CPB D;  2LRO A;  1L7L A;  3ZYF A;  1WCU A;  1GWM A;  4BQ3 A;  4CPB A;  1W90 A;  2K46 A;  1OH3 A;  4BQ2 A;  4LK7 A;  2JWP A;  1W8T A;  4YW6 A;  3ZYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...