1WZXA

Crystal structure of family 30 carbohydrate binding module.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
RKLLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords COG3291: FOG: PKD repeat
total genus 35
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wzxA00
2KR2A 4BQ4A 2JWPA 1GWLA 1W8TA 4YW6A 4AL9A 4CP9A 1WMXA 4YW7A 2LRPA 2LROA 3F95A 4A6SA 4LKDA 4LK6A 4LKFA 4LK7A 4CPBD 1W9FA 3ZYHA 3ZYFA 1L7LA 4BQ5A 3ZYBA 2Q1FA 1OH3A 1W8WA 1W90A 1W8UA 1W8ZA 1V0AA 1WZXA 4CPBA 3UT0A 3ORJA 2O14A 2K46A 5D21A 4CP9B 2VXJA 4LKEA 1GWMA 4LJHA 1WCUA 1OKOA 4BQ2A 1HN0A 1GWKA 2C24A 2WYFA 4BQ3A 4YWAA 1UOJA
chains in the Genus database with same CATH superfamily
2KR2A 3ST7A 1IKQA 2BDRA 4S2DA 5A7NA 1SBFA 2RR13 5H9QA 1J1LA 2QQOA 2DURA 1CIWA 1RUG2 1VB4A 1YUDA 5TSWA 1HV1A 3IB3A 4WVVA 4AHXA 4BE3A 3VHOA 1UNBA 3T0BA 2Y34A 1ODNA 2XJPA 3LA2A 1W8WA 4IE5A 1UXXX 4I3GA 4MX3A 3RG0A 3KHCA 4A3XA 4XDQA 3ZN6B 2VOWA 5SV8A 4IGQA 1ULPA 4N53B 2AEYA 2DBNA 2JDKA 2JDYA 4GH4B 4UFLA 3SH5A 1FOD2 4CDWA 4GJZA 3LDKA 3V64A 2D98A 3GYDA 1A78A 2PMWB 4KG0A 1FMD3 5EJ3A 1GOHA 1O4YA 5I8YA 1WD4A 2ZZQA 1RVF3 2WNVC 1RL3A 3GBGA 4RQPB 4E2QA 1JW6A 5HCHA 1BZWA 1XE7A 5HV0A 2J1UA 2DU0A 2UWBA 1NUKA 1AL21 1W6OA 1PK6B 1W3XA 3MIDA 5FYBA 4Q8LA 1C8NA 5D8AB 3VZMA 1XOYA 1EY2A 2FD8A 3FMGA 1Z7S3 5CEHA 2AGSA 1Z7S1 3OPTA 4J25A 4PBPA 4CTEA 4URTA 1RUC3 4L2NA 1VAVA 2SLIA 3NKGA 2YPJA 1W0PA 3BUCA 1RUI2 1B35A 1SFNA 4Y5SA 5GZDA 5LCWL 2HWC1 2WO3A 3RMXA 2BV4A 4QX1A 4JDNA 3FLRA 3I97A 2QQPA 4QX0A 3ZXFA 1W2UA 5IWFA 3AP6A 3OGJA 1OSGA 4L99A 2RJ2A 3DKQA 2P3IA 2LROA 1DQ2A 4QX3A 1NCQA 1ZZ6A 2JB8A 2ZGUA 2A1XA 3DYPA 2ZEZA 3I2KA 1R64A 1GSLA 4COVA 1S0CA 3DYMA 4DMIA 1V6OA 4GMP0 4MGKE 3PJYA 5KC6A 1YLLA 3FLPA 1ZYBA 4UFKA 2WN2A 1DLLA 3PDQA 4JAAA 1WW4A 5D2AA 3U1XA 1WBFA 3FC0A 4Q4V1 2OQ6A 1W6PA 1WCDJ 4W6WA 3UJQA 2CAUA 2ETEA 4DQAA 1WCKA 4EV0A 3ZYPA 1PO21 1XNAA 1IS6A 3OUJA 2GP3A 5FO7B 5FP4A 5H9PA 1HRI1 3VDDA 4YPJA 5IJRA 2Q8CA 2OQ7A 4LQRA 1O3TA 3ZFEB 5F5QA 3TWIA 1ZA7A 5BNPB 3ZDSA 1VBD2 1QNYA 4IXLA 1WLDA 3UL2A 4TYSA 1RIRA 3HNYM 1RJ7A 1COV3 2JG9C 4AEMA 3RQ0A 1SLLA 2XBO3 3VBSA 5FYHA 3VD5A 4AEDB 1DGWX 2P37A 2QKDA 2WINB 4PIZA 1UF2C 4RL7A 5C9AB 2XKPA 1E5IA 4EJRA 4UF0A 5H9SA 1VRH1 2C26A 2RM21 2C4XA 2ZOEB 3B7MA 3JBG1 2W9XA 3IZOA 4QXCA 1KS4A 1DQ1A 1O59A 3ABZA 3ILNA 3NNMA 4XXAA 4BH9A 1F4AA 5FZOB 3LEKA 4TLFA 4X8NA 5FZKA 3RJ2X 2BP6A 3B00A 2KA3A 4YW7A 4D7YA 1LRHA 2FQPA 3SQOA 2VNRA 3KM5A 1WW7A 2GNBA 4QAWA 1QKQA 4OCTA 1IS3A 1M4WA 1OUSA 2FCUA 4CZSA 1UY4A 5IVFA 2CDPA 3GHMA 1OD3A 1UN1A 2Z5WA 4OHWA 2A71A 4A41A 1LOFA 4MXWA 3T09A 3MLLA 4PDWC 2BYVE 2RM22 5FZCA 5HXMA 5IVEA 2Y6JA 1BCXA 2YROA 5I8TA 4ARYA 1EAH3 4JQTA 3DKWA 4Q4X2 4EYUA 3WG2A 1W28A 1PVC2 1AR92 2E51A 1LEDA 4XUPA 4AI2A 5FMOL 1JTZX 2W68A 4HKWA 4JGZC 3PMEA 4UF0B 4UW5A 3IAPA 5FXVA 3WUCA 4KG8A 2XXZA 1GFF2 3RZZA 4Z2AA 2PHRA 2VG9A 1QEXA 4YZ2A 5IVYA 5IFTA 1MS4A 1RMU2 3N9PA 2PTMA 3Q9OA 5LY2A 3ZYHA 4LULA 5HXVA 4F83A 1EPWA 1MZFA 2RS13 5A1LA 3JQWA 4YGEA 4ZS2A 1H4GA 3NW4A 5JOWA 3WP5A 4HBNA 5DDJ2 3G6JB 3RGBA 3S7EA 3BVCA 4QPWA 1JU4A 4HETA 4M3CF 2J42A 3T2QA 1C5IA 2GH2A 3GM8A 5JOYA 3UNPA 4JZRA 3T2TA 1MS8A 1X8EA 2A3WA 2DTWA 2X09A 3R4SA 2GN7A 3I4IA 3WW3A 3DYOA 4IV1C 4YZ3A 3O1PA 2ZPXA 1B09A 1WMXA 1OC1A 1PMHX 1VB2A 3H42B 4GKXA 4YM3A 2GP5A 4KNCA 4DPNA 3M3OA 2Y0IA 1DYOA 3KCYA 3H1YA 4QMAA 1ZZBA 1JN2P 5FP3A 3KT4A 4P5YA 1IPSA 5SV5A 1LGCA 2Y6HA 2Q1FA 3HVDA 4V2VA 2ZX3A 2DCZA 4C8DA 3DCQA 1V0AA 4MHUA 3U10A 4Y5Z0 2R072 4NIIA 3SCGA 1JI6A 1S0DA 3SKVA 1C8M3 2OVUA 1W04A 2H0VA 5A7PA 3HAGA 5A3PA 4NHXA 3PMSA 3WVJA 1DQ6A 5CFDC 4CCOA 1O8SA 1DGWA 1BEV2 5CYYA 4C1XA 4R8HA 1PNFA 5L73A 4IE0A 4CU8A 2V5YA 5AVAA 5JCTA 5JXHA 2YBSA 4AEDC 5F9TA 4FPFA 2JENA 3RZGA 4HT1T 3RRDA 3GF6A 2ZGKA 3AKTA 2PXJA 3ROUA 4DS0A 4FAGA 1BVP1 4DUXA 4IQPA 3ACFA 3O12A 2YB7A 1NE6A 4COZA 1OHFA 1NXD1 1PO11 2J1TA 2WT0A 1AR62 1VBD3 4DEQA 3RFRA 3ACHA 2YMZA 1BEV3 2O8OA 3SEEA 2WO2A 2WN3A 1D4M3 1AJOA 2CHHA 3FZ3A 1ND3B 1SHWB 2FMYA 2VQAA 2ZGLA 2GU9A 1KITA 1IGOA 3NO8A 1XYOA 1S1AA 5JOXA 2WA4A 5FYIA 2ZGOA 3FHAA 4Y1VA 2VMFA 4Q0VA 2HWC3 1Z78A 2ZXQA 2WZR1 3A23A 4NAMA 3BIWE 1GICA 2AC1A 1HXS2 1W8NA 1GMMA 3MV11 5A1AA 3FBYA 5IFPA 4PIYA 3MF6A 5DUWA 1R1ZA 2W39A 5FCCA 3DN7A 3RPQA 1RMU3 1AR61 4A2UA 1NA1B 3CLPA 3M1HA 5KXCA 1GOFA 1Q8PA 4P9GA 4HMZA 2TUNA 5IK5A 3WF2A 3OTFA 4TSVA 4OI1A 1S0GA 4MVTA 1BK1A 2JKBA 4LKEA 1XJAA 3SH4A 2XUEA 1Q8SA 3ZFGB 3OD4A 4CCLA 1CX1A 2FDHA 4QGLA 2D6LX 3B01A 2EIGA 3GJAA 4U2AA 3GZTB 5FBZA 2YUEA 4CU9A 4HK9A 4FVVA 5KBFA 5CNAA 4XQWA 1VALA 5J98B 2Y6LA 3PJQA 2BQPA 2VE1A 2YV8A 1YFYA 4DRVA 5JVVA 3ZXDA 2P5BA 4EROA 5FZEA 1QJU1 1AR73 4NIDA 3V0BA 5FLIA 1GP5A 4HANA 4I0AA 3A0KA 1REFA 5F3EA 2WNVA 1MQTA 4XF9A 4XUQA 2ZGSA 4RQPC 2WR9A 1NAEA 2XUMA 3I2JA 1ALYA 4DY3A 1LHNA 1HB3A 1CAVA 4RFRB 4QQLA 2HWD2 5C9AC 1H4HA 3ZVXA 2DCJA 4CDXB 2DCYA 3VBFB 4M01A 5FYTA 4K8FA 2YBKA 1XQNA 3DL3A 1NOVA 1A8DA 3ZR6A 4ATFA 5IAXA 5KWRA 1TME3 2C1FA 4B4PA 1TNFA 1WW5A 2B9UA 4WM8C 1RUJ1 1S55A 2E33A 3O1RA 1X7NA 1YJKA 2B39A 3I3MA 3ATGA 1GZWA 4FP3A 1DBNA 2UWAA 2ZJCA 3NV3A 4QM8A 1EUTA 2DFCA 1L3JA 5LRRA 2ZX2A 1AX1A 2A5ZA 3HPNA 2HWD3 3MZHA 4KU8A 2VBDA 1C1FA 2WQZC 1UD1A 2R073 2IXHA 4RR3B 4R9CA 3C2UA 5JZGB 3S0MA 3WEZA 2QZ2A 2BPA2 2BBVA 5LASA 4LOSA 4B1LA 4NUBA 4IETA 3OOXA 3KD4A 2W08A 4WV8A 4AFAA 5DXDA 1DU3D 4DRRA 5BNOC 2A6ZA 3N7LA 1VRH2 1FPN3 2QFEA 2VVEA 3D82A 3BB6A 1FNYA 4WVZA 1WUVA 3ASIA 3OF1A 5CKMA 4XCAA 4IE6A 4DXZA 3RVHA 3AMHA 1X50A 1ZZ8A 1VBA1 2WWUA 1ZM1A 1KJLA 1RHI1 2DF7A 1PO12 4IEUA 5LB6A 1G86A 1RHI3 4OZXA 4LHLA 5FKBA 5A6ZA 4D69A 5JR7B 2IVJA 2ZGTA 2VNGA 4G3YC 4QX5A 2D44A 2XBO1 1XE0A 4UW4A 4DNYA 1HIXA 4WBBA 4YW4A 4H3WA 4NOTA 3AP5A 3TN92 1UAIA 1W9TA 2IVIB 1OLME 2NZ9A 2VCBA 1RUI3 2PQSA 2QQMA 3IWZA 4XJ8A 3UKNA 5BNPC 3HQUA 5DUXA 2BNNA 1AHSA 2GC3A 2GMEA 2WRAA 2WNVB 2XVKA 4W65A 4UWDA 2ET7A 1YWKA 1DZQA 3LAGA 2VBPA 3PLQA 1J59A 4IERA 4K7JA 5IW0A 1EV13 2RHPA 2J1AA 3B9IA 3WDTA 5JSOA 1W0NA 4RS5A 4E8DA 3C3VA 2JDZA 1UCXA 1BVVA 3ON7A 1C5HA 2ZEYA 3TEZA 3O1OA 1STMA 1YQ6A 4N53C 2PHWA 4AQ6A 1N1YA 2ZZJA 1RUG1 3N9OA 4XAAA 3LZZA 3SH3A 3VLBB 4TZDA 4A3ZA 4JKKA 4PCRA 3J7HA 5F1RA 2RV9A 1H2KA 4N7UA 4XOGA 1YQ5A 1UY0A 4IEWA 5C71A 2RMU2 3IIIA 2CGOA 2J1RA 3ES4A 4IV1A 4GALA 3ZYFA 2O0OA 5AFBA 4XYXA 3LGRA 4QB1A 1MZEA 5HV4A 5DUVA 4Y22B 1D0HA 3MFCA 3MO4A 3VDDB 5J36A 3DV8A 4M3CE 4QGNA 1W6MB 3CJIC 5K4LA 4QX7A 3AXDA 4RGKA 1ASJ3 3LA3A 3SLIA 4JV4A 3WNOA 1I6XA 5IUQA 4HN0A 2CY6A 2VZQA 3VBUB 5CG9A 4NHYA 2H0BA 4MADA 1SLAA 2W91A 3GZAA 3PUSA 3FX3A 5ACA1 3VBRA 3KF3A 1U5XA 3WG3A 3AL5A 4AVAA 1OH4A 5ERLA 5FPUA 2FZ2A 5GM0A 2B46X 3LEIA 1W8HA 4I01A 4YGCA 1IHMA 4XJ9A 1YFXA 3W59A 5L7OB 5IK8A 4Y33A 4YYOA 4CP2A 5APAA 2X53S 3HMYA 5ANQA 1F15A 4P9IA 4AGVA 1FPN2 3I2GA 4AQTA 1EP0A 1JYTA 1PIV2 4KBBA 4GKYA 3H8UA 2AR6A 4QB2A 2D93A 4FFFA 4OVEA 4AI0A 1RC6A 4JVAA 2ENRA 3VD9A 5C70A 1ZRCA 4K1YA 3D0JA 1KGYA 1RTVA 4F8AA 1AR82 3V56A 4NO4A 2XB6C 1TQ5A 4FTBA 1OURA 1E57A 1LENA 1FAYA 3IMNA 5JPNB 1ZBE3 4Q4X3 2P17A 3KV4A 1OA3A 2NMOA 5L9VA 2E63A 2YC4A 1KXGA 2ZHLA 2ZS6B 4LUMA 5FPZA 3VD3A 1OQEA 5LZ6A 3JXSA 4XFFA 5FZDA 2WKKA 3PVNA 1OOPA 2XPJA 5JSRA 3ZXGA 4Q1RA 2B5HA 2R16A 3MUZ1 4FP2A 4SBVA 4XABA 2B9VA 4ZONA 1CGPA 1R081 2A6VA 2OZ6A 5K0UC 4QXBA 2WFF1 2Z4FA 3AZVA 5FPXA 1FMD2 2QJVA 4BK4A 3MEPA 4CDXA 3Q8AA 3N9LA 1OBNA 4QPYA 2F17A 5FZ3A 2IXIA 4LXLA 2OXBA 3W5NA 1LKNA 3GDBA 3O1UA 1AX2A 2CWSA 3LQCA 3RS6A 4HSLA 5B2GB 1LODA 3VD4A 2IFRA 3AKSA 3ZFFC 1NE4A 1XE8A 3ITQA 5F3GA 1Z0HA 4A7ZA 2VD7A 1WWYA 4NRQA 1S0IA 2A6YA 1K5MC 4GZ9A 4ZXKA 2B4KA 2BGPA 1KDMA 3GCXA 4P08A 3I59B 3TN93 4D7TA 1WA4A 1PGL1 4KH9A 5HCBA 1GQGA 2ZA9A 2VZ1A 3WQBA 4YSFA 3KVAA 4FFHA 3AZWA 4FFIA 4W6YA 5F6LB 4Y1ZA 2IXKA 2VZOA 1CR7A 3JB8A 4XEZA 1Y43B 5GZEA 1ENRA 2XHKA 4Y4YA 3THCA 5KHIA 3T1LA 2JG8A 2Y6GA 2W95A 3KGLA 3GALA 2GDFA 5AVPA 2Y33A 2BBAA 2IC1A 2CL2A 1O4ZA 1UYYA 2A6XA 2E9QA 1SBEA 2E7AA 2VMDA 1LHWA 1ND3C 1X33A 5DDJ1 1AXYA 2PHXA 2D7FA 3ZYIB 4QPGA 4UI9L 1GR3A 3U4SA 4AGRA 4CUBA 1OF3A 1REEA 3MF9A 3POBA 3USUA 1F5JA 2AUYA 2DU1A 2EAKA 3HEIA 1WW6A 2JG8C 4F7ZA 1OFNA 1WLCA 1IPJA 4QDQA 5A32A 1ENSA 1HRI3 4OLLA 2BOIA 5FZHA 4A4AA 1UZ0A 4E8CA 4NIAA 2TEPA 3IDEA 3OPZA 5LBFA 4CDUA 4XMIA 2D97A 1LJ7A 1V9U2 4FAHA 4NR1A 5FJKA 4A6SA 2F4PA 4MGYE 2BFUS 2VCCA 4IW3A 3ZSLA 1PO22 3H7JA 4EN8B 1AZDA 1YQ8A 1GZWB 4EN7B 1WLWA 1V6NA 2XJUA 4CCKA 1UO9A 1HB4A 3P6BA 1SPPA 1F35A 1COV2 2JX9A 4GWJA 4HFSA 3VBUA 3VKMA 4GH4A 1ND2B 1QJEA 1ZX5A 2UYBA 2VH9A 3JUUA 5FZMA 1RITA 4QQHA 2VOXA 3R0RA 5DAXA 3FBMA 3V0AA 1O3QA 3HBZA 1X36A 1JYWA 3N7KA 3KB5A 4LR4A 4PQQA 2YXSA 3OSDA 5GLVA 2VTXJ 4XTMA 3SHRA 2VQUA 3TB0A 4IEVA 1JOBA 4QKBA 3CZJA 1OD5A 1SLBA 3U14A 2UWCA 4D3WA 1J3PA 3S57A 2Z42A 3ZFGC 1JU3A 4B29A 2PLV3 5EJZB 5F39A 2E7QA 4CXYA 1IQAA 1PHMA 1OOPC 4FOVA 4UOJA 3KF5A 2WWJA 5BXXA 2W46A 3POWA 2R32A 3WQ0A 1YIPA 4BJ0A 3ELNA 5FKCA 1UOFA 1VBC2 2KM2A 3GNEA 1UU5A 4NWVA 2WUHA 2ZHKA 3O0VA 1KEXA 2RM23 5GJ6A 2DBIA 3WP3A 3KVBA 2RS31 4I30A 4JGYB 1IOAA 1QJU2 4QPIA 3E5XA 3H1WA 3B9CA 2A6WA 3I8TA 4YW6A 2NM1A 1S2EA 2QDRA 3LWCA 4JGZB 5IT6A 4OFGA 2JXAA 1Q8QA 3D6EA 4ZU4A 5L9BA 1UIKA 1ZVFA 2W92A 4JGZA 4P9YA 3RZHA 2VR4A 2OIIA 4YVWB 2ERFA 1GOGA 3EB7A 3O5SA 2G1MA 2PN5A 3O7OA 3SNMA 3ETPA 2DVDA 3VKNA 4PDWB 4N7IA 1GBGA 3CL1A 2WYSA 2JKXA 3VN4A 1CAVB 4Y1UA 2J1SA 2FMDA 3NJZA 1VP6A 4NHLA 5FP9A 1CJPA 3WNXA 1KRIA 1V00A 3NSTA 2WZEA 3SITA 3POYA 1L7RA 1JBCA 4META 1DLCA 1JMUB 4DIQA 2FCVA 2P1BA 4E2SA 4YVSC 1H8TC 4FPJA 2VMHA 3OY8B 1F8VA 4WM7A 1K5MA 2ZGRA 5FY1A 4AWDA 4NIGA 1NY72 5ABJA 1BMV1 3K4AA 4LO5B 1FOD3 1NCRB 2ZHMA 1PX3A 2JIJA 4FT8A 4Q4Y3 1ZBA1 1BXHA 1PVC3 3U07A 1XPWA 2A7AA 3A21A 3KHBA 2MHFA 1W6OB 3G7DA 4LORA 4BLIA 4JRAA 1JZ8A 3D5OA 3J8F3 4S2HA 5KHJA 4BQ1A 1O6UA 3IIAA 3DPRB 5FK7A 1OVSA 3TRSB 3L9JT 5FBJA 4NN0A 4UT5A 4P00B 3DPRA 3V0AB 3MIFA 4UFHA 2BVVA 2VXJA 3O1SA 2YY1A 3M3IA 2XJRA 4UBGA 1DFQA 1UQXA 2ZKNA 1ULEA 2C24A 4OUSA 1S2BA 1ULFA 4FPOB 3HJRA 3N36A 3M7AA 3NV2A 1R083 1RUH3 1UL9A 1ZBA2 5D8AC 2AZ5A 3BTZA 3GCWA 5GZFA 1SFYA 3F95A 1AR72 2C5DA 3LD8A 3OBZA 1BEV1 2BFUL 1J3RA 1W2OA 2VZVA 3E5UA 1CAWA 5FZOA 2HWC2 3ECQA 3CZUA 1QXJA 4R9DA 3ZYBA 5JIUA 2E31A 1MZ6A 4IEOA 2VTXA 1O7FA 5A32B 2VECA 2FCTA 4PBOA 2E26A 3KSCA 4DEVA 2NLRA 3AMMA 1RUF3 5K8SA 2GAUA 1S0EA 3AZXA 4C0BA 4FO9A 3K4DA 1H0BA 3MW2A 2JIGA 4M0HA 1AX0A 1RUG3 2FHRA 5JXJA 4WVWA 1GKBA 1QXPA 3KV5A 5DG1A 2ZEXA 3K2OA 4LLOA 4DY5A 5JMCA 2VUCA 5LW9A 1JH5A 5CG8A 3MBWA 1UWWA 1WCQA 4OHVA 4EWAA 2VNOA 3T30A 2VBBA 3VZKA 3IBMA 2RR11 2VM9A 3ZPOA 4MYEA 5FZ0A 2BNOA 4P9WA 4AF9A 5DZEA 2CV6A 1POQA 4B7EA 1WZXA 3BI3A 1VBA2 5GKAC 4L8QA 1PO23 1NCQB 2BGOA 5LA2A 3POFA 2R0HA 1NX9A 2VAUA 3WF0A 2E32A 2J1EA 5ACA3 3RZJA 1RYYA 4IV3C 5LA1A 1IS4A 2D6OX 4CEYB 5C8CA 4XTPA 2K0GA 4AXOA 1V6LA 1EPZA 2AACA 4QKFA 5KHKA 1T6GC 5JUVA 1G9DA 1SCSA 3UV9A 2XL9A 3IPVA 4QPIC 4Z8BA 4LK6A 2GMPA 1YHFA 3UKTA 3NNLA 2WZPP 2XDVA 4YFWA 1TVGA 4MOAA 5IK7A 4LE4A 1HB2A 3PUQA 4FCAA 2VVFA 1G8WA 1QH7A 4PHZA 4COWA 3SEPA 3THTA 3E1F1 3Q8CA 4CUAA 4AFBA 4G9SB 4Q5OA 3ES1A 1UY3A 3OYWA 4PF5A 3O14A 4AHWA 4PF1A 1OMIA 5CKQA 4AVSA 2RMU1 3PUIA 3P3PA 1QJZA 1ZBE1 3ZFFA 3X29B 2XBO2 4QQPA 1DGRN 3JB4C 4CDQC 5A3WA 4ISQA 4FPHA 4N9IA 4CDWB 1UX7A 2OT7A 1A6CA 2R30A 1JYCA 3T0AA 5LRSA 1W8OA 1GP6A 5J09A 3LSDA 5DZGA 4XFIA 4GXLA 1QJFA 1W05A 1YQ2A 1IQDC 1YQCA 2YYOA 2ZAAA 5FY7A 4WM7B 1MEC1 4Q4Y2 4CUCA 4CP9B 3TEYA 3QH7A 5AC91 4LO4B 3BTXA 2DV9A 2QQIA 4JC1A 2JDUA 4LO6B 1NQDA 3DPRC 2VY0A 5HPOA 2D43A 3RYRA 5J1XA 5K7PA 1YO8A 4QX2A 4X6QB 5EIYB 1UIJA 3AKPA 1G9CA 3J8F1 1J3QA 4XUOA 1XXNA 2PQQA 2PHFA 5JI9A 2RS11 3MICA 1PGSA 2OUJA 4LIVA 4CUGA 4CXXA 5DMYA 4FOYA 4M3CB 2C6SA 3BN6A 1DGRA 1JS9A 3ZSMA 1GYKA 1LEMA 4P5HA 1VBB2 5C4WC 4HVOA 1J58A 3D3AA 4WVMB 1XNTA 5ANNA 5JIAA 1AR81 4BXFA 2EALA 4Z92B 1LR5A 4HVRA 1PMIA 1WMFA 4QWNA 3T3YA 2CAVA 2QBXA 2WNEA 1EV12 5FPLA 4DINB 1XNDA 3MPPG 2C0ZA 2JDPA 3WY6A 5FJHA 3M70A 3LDRA 4HL0A 1IG3A 1RUD2 4DUWA 4BPZA 1JYVA 5CAZA 2OW4A 1H6YA 3V0BB 5F7UA 3SXWA 1P8JA 4IEZA 4ES9A 1FPN1 1QY4A 2XWBB 4J1XA 5A70A 5F3IA 3AYEA 3B94A 2YG0A 3H1MA 5FMDA 4MV2A 1Z7S2 2XMLA 1ULOA 2VZPA 2XR4A 4CDXC 1W06A 2X5IA 4FI9A 3ZSKA 3PHMA 3QLQA 4Q26A 3WUDA 3K3NA 1QQP2 2W52A 1HJFA 2VZTA 5A3LA 3E6DA 4YWAA 5I0SA 3EQEA 4O65A 4FOQA 3U11A 2WWSA 3AKQA 4ES8A 4NHMA 2HJIA 3GJBA 4UAPA 2A70A 5T5JA 3MI8A 1GP4A 4QXHA 2HWB2 2QE3A 4LHKA 2HH9A 2A3XA 5K0UA 2TBVA 4JX0A 2XQXA 5FIXA 2R1DA 5CBLA 4DOUA 2AYHA 4OI2A 1W8ZA 4OMDA 4R9AA 2DTYA 3AYAA 1VRBA 2RS33 5F32A 2BRTA 2GH8A 3W21A 2XGXA 4WZFA 3ZXKA 1RUH2 3K46A 1CPNA 2JDAA 3BIEA 3SISA 1ULCA 1NQJA 2JDMA 3WDUA 2CNAA 2N7GA 1S2KA 1H2LA 1RJ8A 1RUE2 1QOTA 1LESA 2R063 2ZX4A 4RYDA 3POGA 4Q0QA 1OKQA 3NNJA 5DQ0A 2LRPA 2VL4A 1CX4A 4NWWA 4ZZ8A 5FMCA 1QHDA 1UMIA 3KV9A 3IT8A 4KQ7A 1QGLA 1NLQA 2GC2A 3WT3A 4G4FA 1LHOA 1US2A 3WNLA 3M3CA 4DZGA 2B8MA 1PMJX 1GNYA 1H8VA 1SEFA 4JHTA 5LA9A 1WMEA 1NZCA 2VW0A 4YG6A 3H8OA 1DYKA 1LOEA 2QQNA 2VZ3A 3BKZA 3TBDA 1VE0A 1ZA4A 5T5PA 1PX4A 4DXSA 5A7WA 1ZREA 4IE4A 1AL0G 1I5PA 5IK4A 4PIXA 4BXSV 1XSQA 1RUJ2 2D5HA 2UU8A 1Y4WA 2DVAA 2OPWA 1W39A 3RZMA 1MS1A 3AJZA 2UURA 1TG7A 3J7MA 1ULGA 1ACCA 1QJY1 4XE9A 4GIQA 4BK5A 4L97A 4BB3A 4E2GA 2H6BA 2R1BA 5DZFA 1ASJ2 2J1VA 1VBA3 3AB0A 2VULA 3WCRA 3H8RA 3H50A 4I2OA 4LUKA 1ZRDA 3T0DA 1UZYA 5KXDA 4LE3A 2BGCA 3AP4A 2EVXA 3M3QA 4IESA 1POV3 2VUJA 1AVBA 2O14A 4QHBA 1DCSA 3I2HA 1US3A 4GB32 3Q8EA 4LBQB 3NV4A 3IMMA 2WFF3 3VKLA 1V6MA 5G05L 4F3JA 1F9KA 5JWPA 2LUWA 3L2HA 2XJSA 4KU7A 1NLRA 1TME1 3H3UA 2VW2A 1W2TA 1OXCA 5GLTA 5I8SA 3WINE 3MV01 1OA2A 1CAXA 2UYAA 1O4TA 3MIBA 4MGQA 4KWLA 1PZ7A 1RXFA 3CO2A 4XIOA 3I54A 3UGGA 3ZOIA 4O9GA 5CFDA 4H2AA 2EIDA 3WG1A 1PVXA 3AL6A 1RVF1 3VGIA 3OG2A 4ASKA 4IEYA 2VQTA 4AYUA 1AR83 3ORJA 1W6NA 4LITA 3VBSC 4IGOA 1WA6X 4YM1A 4CCEA 3TOJA 2IXJA 3Q8FA 3CDZB 1DZRA 2VXRA 4GWNA 1GZTA 3BOPA 4PLMA 1VIWB 4L0PA 1J84A 2P2KA 4FSJA 5FZ9A 1OPMA 3OY8A 1AUYA 2JDHA 4GWIA 5E1RA 1DZTA 1W8FA 3WSOA 2LW8A 4LIUA 2D3SA 4YZ4A 4BDVB 4CSWA 4HVQA 1N3PA 4ISRA 2I74A 2RDQA 4RGGA 5FUPA 2QQUA 5LY1A 5A6QA 4GB31 1JZ7A 3BOWA 3H3LA 2XLAA 1PGW2 3I7DA 3URFA 4BQ5A 2WJSA 2GALA 5FZIA 2FDIA 5DAVA 3WV6A 3H0OA 2CYFA 4XJAA 1GQPA 1BJQA 3HD8B 2X10A 2QVSB 4EWEA 3FL7A 2ARCA 5CADA 5F6KA 5ABJC 4CP0A 5FYYA 3KT7A 4FXKB 3TN91 2Q1ZB 1MVQA 4XXPA 5K9YA 4XILA 1MS3A 3U37A 3NL1A 4E4ZA 4Q2FA 3ENRA 5EHDA 1FI2A 4Q8KA 2IUWA 3WNNA 3JCIA 5C5UA 5HI0A 3W9AA 3ZPYA 1BK0A 4UFIA 2ZCWA 4QKDA 5FYMA 5FAXA 2QTWB 3B5LB 5IVJA 3P1IA 2GN3A 4EZHA 4DXRA 2EICA 4IL7A 1PIV1 1W90A 5IVCA 1A34A 1WGPA 3WW2A 2CSGA 3MW4A 3OEBA 2J7MA 4OULA 5A6XA 5BPXA 3GBWA 3ZMOA 4CRQA 2VOVA 3UKVA 2RDRA 1AYN2 5CIRA 2XKOA 3PURA 2Y6FA 4EZ4A 1RB8G 1OKOA 5FZGA 2R6QA 3PTYA 3LEMA 1CIYA 3E97A 3OGVA 5AFEA 2YDEA 3SCFA 4IGPA 2RS52 3ZFFB 1LULA 1NY71 1AR71 2PFWA 4JRLA 3FWEA 4FQZA 3ZYJB 4QD2A 4AG4A 1QJU3 2WNUB 1EAH1 1IS5A 5GALA 5KC5A 2PLV1 4Q0SA 3ZO0B 1OT5A 1RUE3 2E53A 1UMHA 3LOIA 4HKLA 2YGLA 4UXAA 1MQTC 2A3YA 3ZXJA 1HXS3 1QQP1 3J26N 1HJGA 2VO5A 3C7OA 3OPWA 4YVWA 1QQP3 3MFAA 2D3PA 1UW8A 1VBB1 3PIGA 2R041 3POIA 3R4UA 4H7LA 3LEGA 5FYSA 3ZIXA 4AFMA 5HCAA 3AP9A 4FPLA 1AXKA 3OUHA 5BNOA 3OD0A 1GWMA 3H7YA 2Q0AA 1TNRA 1WCUA 2Y0OA 3EYPA 4LJHA 3CIHA 2WABA 4AGGA 5C3RA 1LECA 4C91A 4XHBA 1C57A 1WCSA 3MDPA 1KDKA 2AEZA 3Q8BA 4LO7A 3VZOA 5FDBA 4NPMA 1RUD1 4WZCA 1TMF2 3D4KA 2D5FA 3NQHA 3CU7A 3VD7A 1WKYA 4X8PA 1V9U1 4BIOA 2WQ8A 3OBTA 1UPSA 1UY1A 4DB5A 5EV7A 3D8CA 3POSA 1F5FA 3IPVB 4QGMA 2EAAA 1C1LA 2YZ4A 3VBFC 2DCKA 4QU2A 4KGGA 2LTNA 2CGPA 1GZCA 1QH6A 2BVBA 2PAKA 4IDZA 4LBQD 5A3MA 5GLZA 1RUI1 5JPMB 1FNZA 4LPLA 4XJZA 5E88A 3BCWA 4JHZA 4NVPA 1ZRFA 2RJKA 1IZ3A 2R0FA 1ONAA 5FO8B 1KS5A 3U4XA 2ZX1A 1DDLA 2W0XA 1O5UA 3JD73 4BU2A 3IM0A 1GUIA 1QDOA 3WF4A 5I91A 1SMVA 1UKGA 2HWB1 3VKFC 3M4FA 4OHZA 1I9RA 3S30A 4CEWB 1CPMA 1Q56A 3O1VA 3NJXA 4NAOA 5FZ6A 2HYKA 2JECA 1R092 4OZOA 1NZIA 3U78A 1U5YA 3ZYRA 3JU9A 4HLTA 4YLZA 5EYYA 1SPPB 2DUOA 5FRAA 4CEYC 1XRUA 4CCDA 2NMNA 2ZMKA 5JDBA 3MLKA 5FO9B 5FWEA 2BOJA 1UKRA 1VBC1 2JJ6A 4PJYA 1NXMA 2YHJA 2QQKA 2WLPA 4I0WB 2P6HA 3JD72 1CWPA 2IXLA 2FDGA 4U36A 3ZFEC 2JE7A 4LA2A 2OUHA 4OYUA 1VLNA 3PU3A 1L7QA 4NRMA 5F2WA 5H9RA 4TN7A 3UETA 1AYN3 3AMQA 1GWKA 1W0OA 4JKMA 4ZY9A 5C3OA 1FXZA 2SBAA 3VKOA 1SDDB 2VZRA 2YU2A 3LE0A 5T52A 3LIHA 4QX8A 1OQDA 5E8AA 2ADDA 4AL9A 2WFPA 5E16A 3NKTA 4CVUA 4FBFA 4KWUA 1H1IA 4B3NA 3QBQA 3MIEA 1EUUA 1DGLA 1ZBA3 3VBOC 5HCFA 1PVC1 1QF3A 4IEPA 3THPA 1R1A2 3VBRC 4A44A 4JDMA 4UFJA 4YM2A 3ZXLA 2EXHA 4LKSA 4XFHA 4CDQA 3KQRA 1N3QA 4RS5C 3RI8A 3AVRA 1Q8VA 2ZBJA 3E5QA 3TAYA 3GGLA 5C3SA 2FBEA 3VHNA 2BJSA 3LIGA 4XBNA 1LTEA 3DUIA 3UJOA 4A7YA 3ZSJA 4QPIB 1QJX3 4NPRA 1XYNA 2F4LA 1Q43A 4D6QA 1RUF2 2OX0A 1JUIA 1GNZA 3DXTA 3KT1A 4DXTA 1J83A 2VVDA 1RMU1 3EHKA 1ZBE2 2RS12 2X29A 4HPKA 2G4IA 1D4M2 3VB9A 5IATA 3VBHB 2JE8A 4XQ4A 1R1A3 1C8M2 4LBMA 4AAPA 3K4ZA 4P9LA 2UY9A 3WP6A 3K48A 4O61A 1N1SA 1NG0A 2VMEA 4BQXA 5T5OA 2BWCA 2QNKA 3ACGA 1MS5A 2GMMA 2BERA 3MUY1 5BY5A 4LBQA 4XFAA 4FPGA 2P3KA 1K12A 1LOBA 1VAKA 2QQWA 4K9SA 4Q4X1 4RA0A 5FY5A 3WG4A 4BLJA 1C28A 2DFBA 3USUB 4RR3A 5JZGA 4CXWA 1YI9A 3VDCA 2ZACA 2Q5TA 2R061 5CFDB 4MZUA 2NYYA 4MO3M 5LATA 2WSUA 2ZEWA 5FY0A 1H30A 4RN5A 4AOCA 1U5IA 5DG2A 2VU9A 4ASLA 5FY9A 1CAUB 4M00A 1NLSA 3ZN4A 2ZABA 3NWKA 2HWE1 5C4WA 2KD7A 4K6BA 1PK6A 1ZZ9A 5A7QA 2O8QA 4A42A 4CCJA 1BMV2 2LS6A 4LBOA 3MGUA 3OB8A 2WS92 1OLRA 2GNDA 2KXLA 5EZWA 3RNSA 3RYPA 2GNMA 5FZ4A 4NROA 4I02A 5JOZA 2C9KA 5EWSA 2RMU3 2P3JA 2HWF1 5FQ0A 2K46A 5FFOC 1W6MA 3HOBA 2YU1A 2V4AA 2CU5A 1LCLA 4UYBA 2V5DA 4MSVA 2W87A 3I2IA 3MW3A 4NRPA 2NPIA 5DPNA 3TNQA 4AFCA 4JQRA 3T1MA 3ZSEA 2WO7A 5JR2A 4E4DX 4AVTA 3VBSB 4YZ1A 3OEAA 1VBE3 5EJ1B 4HONA 1K5JA 2V73A 5CVRA 3NJVA 4FPYA 4H7MA 2XL7A 2DDUA 3NRUA 5ACA2 5C3PA 3O1MA 1HLCA 3AMNA 1F31A 2WIIB 3CQOA 4O9EA 4OHYA 4I09A 1LB2A 1KD7A 3ZM8A 4B4RA 2AH2A 4XCBA 4NIHA 1MS0A 2MEV3 3B02A 2Y64A 2VMGA 4QQ2A 4B8EA 1W3VA 4TLGA 2Y26A 3NV1A 2DYCA 4RHV3 5ISLA 1Y9GA 3VBOA 2DUQA 4IE7A 1JYNA 3RWKX 2PLV2 1U12A 1JHJA 4N90A 4M4PA 1GQHA 4QHOA 4BMEA 2QZ3A 2YC2A 4WM7C 5J3UA 3IDBB 4AHYA 3KCXA 2XJTA 1OVPA 3RSJA 4EE2A 4BHPA 3PL0A 5FY8A 2D6NA 5LEJA 2EF6A 5CFCB 2NQYA 3N3HA 2R071 1CZTA 5DUUA 1AYN1 1UY2A 4FPKA 1RINA 3I3BA 3IDAA 3UYJA 4I0BA 4OUEA 5A80A 1DIWA 4XPVA 5FZFA 5FMOS 3K3OA 1UOGA 3PTRB 5IHRA 5JXIA 4RS5B 4QU1A 3W58A 5T3NA 4CP1A 4R9BA 1PO13 4AVVA 4R4XA 4C0HA 4LMFA 2VMCA 3RZLA 5JSPA 2W2IA 3TEXA 4GMP3 4KI5M 4XF1A 2ARAA 3DF0A 1W6QB 2W1QA 1G7YA 2BEOA 3ZLIA 2FDJA 1HQNA 1LU1A 1WD3A 4ZKTB 1CZVA 1HQLA 5E89A 4XFCA 4AI3A 3BU7A 5FXWA 5CA6A 4MUVA 1HB1A 4HN1A 3RJRA 4ARXA 3ZDVA 3GZUC 1O91A 2JE9A 2ILMA 4CDUB 1UYPA 4TXWA 3HN1A 3RMYA 1N3OA 2WT1A 1R091 1HRV3 4AEDA 2XHNA 4Y26A 3PVEA 1FT9A 1PZ9A 2WAOA 4IV3B 2ZAHA 4N43C 1T2XA 1FV2A 3J8F2 3O0XA 3PUHA 5FYCA 2OYZA 1YRZA 2EXKA 2ZGQA 2V4VA 4B4QA 3ILFA 5L19A 2VC9A 5CB7A 2WNUC 1POV0 4LBKA 5FOBB 1LNSA 2GC1A 3PUAA 3ZR5A 3VDDC 4NPLA 4A6OA 1S0JA 2ZMLA 1FV3A 2RVAA 1YEWA 3LDBA 1QOOA 5F5CA 3ZIWA 4XF0A 5FR3A 2HWE3 1XNCA 5KXEA 3S5AA 3VZLA 2XJVA 4HPKB 4BYYA 1V6JA 5M0TA 2BTVC 1H6XA 2JB4A 3OCPA 3KQ4B 4ASMB 1W8TA 1S0BA 3APBA 5I0TA 5T50A 3VHPA 2I07B 2NN8A 4ONUA 2RE9A 3NJYA 4LKDA 2OS2A 2WA3A 2PA7A 3RWNA 2R043 3TEWA 3LPFA 5FPAA 1W03A 1LHUA 1MZ5A 4FFGA 2X5IC 1VMHA 1BLZA 1VAMA 3IDCB 4AQSA 1YFUA 2XWJB 1QIQA 1GU3A 5A7SA 1H1MA 1V6KA 2XOMA 5I93A 4TTGA 1WLTA 3AMPA 3WW4A 5LK7B 2ARXA 2X5IB 1QXRA 1XYPA 1UOJA 3GBFA 2AREA 1ENQA 1RUJ3 2P4EA 5FYZA 2WT2A 4P9JA 1GWLA 3U75A 4Z1VA 2RJLA 1URXA 5L7OA 1U0AA 2BWAA 1VMJA 3KV6A 1POV1 2G19A 1BKZA 2V72A 5FZLA 1D2QA 1CZSA 2P3YA 4QT6A 1SLIA 1XNKA 3WDWA 1JHNA 3C7EA 1B35C 3O1TA 2XVGA 2W1WA 3T08A 2R7EB 2R49A 3GXUA 4N9HA 2JD9A 2BW8A 3T4VA 3AKRA 4JDOA 2PAEA 2Y38A 3BGAA 4XDOA 3S5QA 2J22A 4CEWC 5BNOB 2IWGB 1OF4A 2ZX0A 3BYWA 4BQ2A 1W6PB 3WQ1A 1Y9MA 3ACIA 2WS91 2ORZA 1UPIA 1QMJA 4XW3A 4DUVA 2X8KA 2WS93 5A1FA 5CKNA 2VZSA 5F2SA 5EFUA 5FZ8A 1EAH2 4W50A 4FTSA 2GNTA 3N35A 3J7LA 2FDFA 4RHV2 3VBUC 1Y9QA 3NAPC 1X9PA 3CJIA 4GJYA 2XLGA 3CMGA 3BTAA 4Y1YA 1VBE1 4EWDA 4MGIE 4CDUC 2F6BA 1KQRA 3WHTA 3WNKA 5J7MA 4ZHNA 3AFGA 2D6MA 3SKJE 5E6HA 1GANA 5T5LA 1WMDA 4R52A 5BNNB 2ID4A 1CVNA 1JXNA 4EN0A 3OGSA 4P9XA 2WNOA 3C7HA 5LA0A 1H2MA 2Y60A 2XVLA 4ZU7A 1A3KA 1AL22 2P6CA 2YPDA 4RHV1 4XMAA 1FATA 4RGAA 4L11A 2JD4A 2EXJA 1ASJ1 1VMFA 3H8XA 4UW3A 2GSYA 4LA3A 1SG3A 4GB33 2DVFA 2PYTA 2VNVA 1J1TA 4BCUA 2WZR3 4Q4V2 4YGDA 4QDRA 5FLJA 3FUQA 1JOPA 3I2OA 4XAEA 2IFWA 3WP4A 4KL1A 3ZYGA 5FPBA 4YM0A 4C1WA 1QDCA 2YBPA 1PGW1 3C7FA 4JTNA 2Z79A 5C6CA 3A7QA 2H6CA 2ZKLA 1I3HA 1VR3A 1DP0A 2VUAA 2WAAA 5FPVA 3ZMNA 3SMHA 4OUMA 4Q4W3 3AZYA 4INDA 1I1EA 5C4WB 1XNBA 1M06G 1OQ1A 3VL9A 3LFMA 4UBHA 4LHSA 4Y20A 4OMCA 3ZXEA 4GWMA 4UW6A 3KZ4C 2VTFA 4BQYA 3CNAA 2WZR2 4Q4V3 4AI8A 1OUXA 1VPHA 1AR91 1R082 2HWF3 3JZVA 1K5MB 2XONA 4LBNA 5B4XA 4AVCA 4Y5TA 5FK8A 3AZZA 1PIV3 5KHHA 1Q5OA 4MXWB 2XG3A 1QJY3 4XFBA 4NHKA 3N9MA 1RVF2 4CCCA 2VW1A 1UZVA 4FQ4A 2RDSA 4CEYA 4X6RB 4YW5A 4Q0UA 4XACA 4AZZA 3WDXA 4AW7A 2B45X 2R042 5DAQA 3O0WA 1G9BA 4BISA 4QM9A 1LHVA 3RI9A 3VDBA 2NP0A 5FP8A 1C3HA 3B3QE 4RSUA 1ND2A 5FZ1A 4XUNA 2RR12 4CPBD 4B1MA 4QXKA 1ULDA 2JG9B 5FV3A 2JG8B 1R093 5K0UB 1LOGA 5IVBA 2K2SA 1VRH3 4N43B 2VZUA 2HYXA 2O1QA 4CDWC 4GQ7A 5FXZA 4YZ5A 5DABA 4EQVA 1W8UA 1F2NA 1SZBA 1RHI2 3R6SA 4AEKA 5EXOA 1LOAA 3WLUA 1HV0A 4A7KA 1OLMA 1UU6A 1V9U3 4FOWA 4AEJA 1NT0A 3N7JA 3T4HB 1CJDA 4M4RA 1MPXA 2BNMA 4LLFA 1JZ5A 3M3EA 2YGMA 4XBLA 4A45A 4CU7A 5BNQA 4GH4C 2CDOA 3MHZA 1G9FA 4QDSA 3FLTA 1C8M1 5C3QA 4W6XA 3M2MA 4WVMA 2VOKA 4CP9A 5IVVA 3W20A 1QWRA 4ZU5A 3ILRA 3FHQA 4ZS3A 2YFUA 4XF3A 1AL23 2K9ZA 2OZJA 1W9SA 3HN3A 3LSEA 2QCSB 3PIJA 2HEYF 4MGZE 5FQ0B 3WQ7A 2MEV1 1PM4A 3EBRA 5FREA 1RUNA 4GD4A 1YYNA 1CD3G 5D8AA 3WF1A 2ZGNA 5B4NA 2JEMA 3AFKA 3AYCA 4AFDA 1OOPB 1YFWA 4XFGA 4QKNA 3A0NA 4PLNA 3EJKA 2JG9A 5EP9A 3WCSA 4BMBA 3M8LA 2VMIA 3MPBA 2I45A 3NVCA 1Y7BA 4HK8A 3OYWB 4ORFA 1AYM1 4J1WA 4RR3C 4JCKA 4YW1A 1RUC1 2DVBA 2EIEA 3TNPB 5JZGC 1QOSA 2WQ4A 1N1VA 3LOBA 1MACA 3ZX7A 1LGNA 2RG4A 1H2NA 2EA7A 4D6RA 1OFSA 2G9FA 3AP7A 3AM2A 2RS32 3QOPA 3VZJA 1O5LA 2Q4SA 4W8JA 1RUC2 1X9TA 2HKXA 4LK7A 2W3JA 1W9FA 3I3QA 4LBJA 1D4VB 1OI6A 4COYA 1CAWB 4KWKA 3VZNA 4LT5A 3W5MA 1UYZA 4P02B 5A3TA 2VCMA 1QNWA 1W2AX 5L9RA 4CCNA 1DG6A 1KJRA 3UGHA 3UESA 4QB6A 4R4ZA 3S6PA 2IZWA 1YXWA 3PVOA 1VJ2A 1LOFC 1HDKA 4M0NA 4O7XA 4NE9A 4JGYC 2PHLA 3ZFGA 5DN2A 2IXCA 2E7TA 5C7GA 1IG0A 1HQWA 1X82A 2JWPA 3I3EA 2XLFA 3POEA 1EV11 3VBOB 2WNUA 4UFMA 4AI9A 3VHRA 3GHNA 2A75A 1TE1B 1ZRIA 2D6KA 1RUOA 3WW1A 2ZGPA 2WZ8A 5FOJB 1SLCA 3JBG2 3WXPA 4Q4W2 4D0QA 4CDQB 5EYXA 3JQXA 1H1AA 5CZKA 5T55A 1NYWA 3GZEA 3ZKUA 4QPGB 4XIKA 5JI7A 1HRV1 3UGFA 2CWMA 3NAPB 1CAUA 4ZPIA 2Y8KA 1R1A1 4OI0A 2W1UA 3CJXA 1YCIA 4YW3A 4AVBA 5C8WA 1D2SA 4HOOA 4YW2A 1TEIA 3BPSA 5LBBA 1VBE2 3DEMA 3VL8A 3HQXA 1I5ZA 1VBB3 1YI7A 2ES3A 1W6NB 3H9AA 3INAA 4XF4A 5A33A 2PHUA 5A33B 1GV9A 4W4ZA 3JBG3 4XQDA 3CF6E 5IYYA 4LKFA 4CA9A 5A3OA 2OPKA 3IN9A 5A7OA 3HT1A 1T6BX 3ZKYA 4AQ2A 5FYVA 1L7LA 3PU8A 4GULA 2VCAA 1GLHA 3FN9A 4PLOA 4PT6A 5FYUA 4EN6B 1NCRC 3LPGA 4S2GA 4E27A 1HRV2 4FPCA 4ATEA 1RUD3 2I2SA 1DQ4A 5I0UA 2YC0A 5GZGA 4PQ9A 1G9AA 4YNIA 4YVSB 1H9PA 4LNVA 1N47A 4MH0E 4BWOA 1MR5A 4D94A 2DCTA 3OGGA 3E6CC 2HBUA 2YFZA 3DECA 1JUHA 5DAWA 4H14A 3WNPA 4M3CA 4HZFA 4IEQA 3WDVA 4DFSA 2P34A 3WNMA 3BALA 1EYBA 1NCQC 1W9WA 4K8RB 2B7YA 4D6SA 2HWD1 2BUKA 2HBTA 2Q1MA 3THDA 5F37A 4MLOA 3ZXAC 3EXUA 1QJX2 2DVGA 1JYXA 4FTEA 2GZWA 1W9YA 5CU1A 3KGZA 5LK5A 5A6YA 1OH3A 1GNHA 3KCCA 4YGBA 4Q0PA 4DO0A 4YFZA 5GZCA 5FMBA 2QUOA 1XBFA 1NKGA 1X8MA 2D6PA 4QQOA 5A3UA 1AR93 2Z2SB 4MG2A 4MGTA 4V1PA 1NA1A 4L92A 3CBNA 4Q4Y1 1LGBA 3HR9A 1DHKB 3WHUA 5ABJB 4K40A 4AHZA 2BZDA 4BIFA 1UOBA 2WDBA 4S2FA 3I3DA 1TZOA 3K75B 3HNBM 2C9AA 3J9SA 3VBRB 3FUOA 3MYXA 3QD6A 4Z07A 3LF7A 1G6NA 4HSJA 2X05A 5FTTC 3SC7X 1XB9A 1AYM2 5FUNA 4LEJA 3ZN5A 3C8XA 2AENA 1Q3EA 1SFPA 2B42B 4E4SA 3HNMA 5J37A 4HKOA 4E9KA 2ZHNA 4IEXA 4LBLA 4LTAA 1XU2A 3WOGA 1UYXA 4BA6A 1V6IA 3NNFA 4C90A 1V70A 1SDWA 4YG3A 2WO1A 2MEV2 3WD5A 3N9QA 2WC2A 3E6BA 3FFQA 3PVBB 1HX6A 1N1TA 4LHNA 5GLUA 2QDNA 1BBT1 2HEWF 2Q30A 3MIGA 4IV1B 3FHIB 2ADEA 4PI0A 3RZKA 5D1IA 5BNPA 5JAXA 4CCMA 3WF3A 1SACA 5C8CB 1ZNPA 1FMD1 3NNGA 1H9WA 4Q29A 4URAA 2L9LA 2FDKA 1BBT2 1MEC3 3B69A 3EMRA 3LFIA 1ND2C 1YIFA 4B7KA 4TWTA 1RXGA 2WBKA 3QACA 3WZ1A 3U0ZA 4LOTA 2Z69A 1A8MA 1ZZCA 1YNAA 2CGNA 4MGSA 4WM8B 1AR63 3V65A 1ZRRA 3ZFEA 3VBHA 1DF0A 3CHXA 3D0SA 3C7GA 2MPFA 3JD71 3OBAA 4YVSA 4AI1A 1O3RA 1JYIA 3KWVA 4XDPA 3MLJA 1BQPA 1XC6A 4MXVA 1XU1A 5D21A 3N9NA 4NMIA 1S0FA 1Q8OA 4CE8A 3KMHA 2WSVA 1JODA 1PNGA 3LCPA 1UXZA 4QPGC 3RYKA 2ZGMA 5F3CA 5BNNC 2G9GA 4XJWA 3VV1A 5KHGA 1K3IA 3ZN6A 1RUF1 1HKDA 1FYUA 2PAMA 3FJSA 3TYJA 1VBC3 2RDNA 2XH6A 3ME2A 4HG6B 4MHRA 5FLHA 3H3ZA 5A7WB 5BV6A 4XUTA 1SBDA 2XQRA 3N7MA 3AC0A 5KXBA 4RD7A 4K1ZA 1E5HA 1O3SA 2Q8OA 4GAZA 1MVEA 1F4HA 2ORXA 2Y6KA 4WM8A 4L9BA 5FY4A 4COUA 3RDIA 1Y3TA 2UY8A 1D0GA 3J4UH 3USSA 4CPBA 4N8MA 3ALQA 2WL1A 2W5FA 4XC9A 2PHTA 2VJXA 5JMOA 4OQ8A 3R05A 3FFZA 1SCRA 3K51A 5F5AA 4KMQA 3VDAA 3I49A 4LO8A 1CQ9A 5HBAA 2ATFA 4XVHA 3AXEA 2VOTA 2D3RA 4Q1PA 1H8TB 3NMBA 4NJ4A 2EIBA 1COV1 3UT0A 5I0DA 5BUVA 5C9AA 1K42A 1AJKA 1RGSA 5AC93 2BU9A 2HEVF 2WLQA 3IAQA 1PK6C 2G9ZA 1HN0A 4BQ3A 4XBQA 1CAXB 2QQJA 3A4UA 3HBKA 3KS7A 3L2YA 5FWJA 2W1SA 1O8PA 1SQ4A 2HWE2 4SLIA 1UZZA 2Q8EA 4BQ4A 1AXZA 1UX6A 3DGTA 4GA9A 4RFT0 1HXS1 1RUE1 3AK0A 3B93A 2TNFA 4OHXA 4Y4RA 4YVWC 4D8MA 3OBRA 3I2DA 4JGYA 4BQWA 4Q27A 3N4MA 2R062 4FXGB 4XJUA 3S7IA 3CEWA 2VPVA 3PNAA 1OA4A 4KGQA 4V2WA 5T54A 5AC92 4XZPA 3WDYA 4H55A 5J96B 1MQTB 1AYM3 1MS9A 2DUPA 3BODA 2ARBA 1KFXL 1JZ3A 4KBZA 2PELA 4ITCA 1JZ6A 4JTOA 4N43A 3VUOA 4PDWA 4K3UA 1OLQA 5JLVA 1LAJA 4I3PA 3LB9A 2JDNA 3OUIA 3VBFA 1JZ2A 1W99A 1TME2 2MNGA 1YC61 3FE5A 3HWJA 1HRI2 1SLTA 2OA2A 1H8TA 2RS51 4KWJA 4CYDA 1CN1A 2RS53 1DQ0A 3QH6A 5L7OC 3WR0A 1FOD1 3AVSA 2FZ1A 4J6GA 1W6QA 5CISA 2HWB3 5J48A 1DQ5A 1BBT3 1MEC2 1PM7A 4GMP1 3IKWA 5LBEA 3WX5A 5FXXA 1DYPA 4P14A 4YARA 4BZ4A 2GC0A 1NCRA 5G04L 5BNNA 2VQ0A 4QHZA 4AK3A 2PHDA 4EN9B 2QQLA 1JZ4A 1XSRA 4K21A 1QJX1 2E6VA 5GLWA 3AJYA 1ND3A 2WFF2 5IAVA 3CJIB 1HN1A 1FX5A 1TMF1 5LBCA 2CTVA 3T2OA 2W94A 1TMF3 1QJY2 4ZXEA 4BM8A 5C33A 1B35B 1RUH1 2LM3A 1ZZ7A 1UU4A 1PGL2 2DWRA 3K77A 3ETQA 4OI4A 3CKHA 3NAPA 1S4CA 1AF9A 5CFCA 4Y3OA 3POJA 3AX4A 4YG0A 4N53A 4Z2WA 1UZWA 1PZ8A 5JXGA 5FZAA 1U5ZA 1W2NA 1IKPA 3HT2A 3KLSA 4Y1XA 3BTYA 5FUIA 2WYFA 4JKLA 4D7SA 1C4RA 1UMZA 2ET1A 3AYDA 3OGRA 3EO6A 3A22A 5EQUA 4AAXA 5LWBA 1ENXA 4RQPA 2A73B 3HIFA 3OJBA 4Y20B 1E5RA 3MIHA 2ZMNA 4OQ9A 4K20A 3BU0A 4ET7A 5CFCC 1OPOA 4AR2A 4E4HA 3LKJA 1BYHA 5A3NA 4CEWA 3F2ZA 5FZ7A 3BPZA 4XZUG 3SCHA 5DAPA 4ZZ5A 2QQVA 1K45A 4HXCA 2ZTNA 3HQRA 4Y24A 5LEKA 4Q4W1 1VBD1 4IUGA 5DDJ3 4FPEA 4XURA 1KFUL 2W47A 1D4M1 1HW5A 3J7NA 3QCWA 5I0RA 2JICA 4IV3A 5F5IA 1LOCA 4AE2A 5BYNA 5KR7A 4XETA 1LU2A 1GZ9A 1NA1C 4CU6A 2VUDA 4BOWA 5C8CC 4YRDA 3I2FA 2HWF2 1YJLA 3UK9A 2OKXA 2VGDA 3ACLA 5L36A 1BHGA 1IPKA 4PI2A 1JOJA 2HLEA 4XHXA 3I59A 5EPAA 2LALA 2V09A 1D7PM 1WBLA 5C5TA 3DXUA 2D40A 2EXIA 3P3NA 3LA7A 1CESA 1ST8A 5F8PA 3VBHC 3P5BA 1APNA 1E5SA 4Y22A 5FP7A 1ODMA 3R4DB 4Z82A 2Q8DA 1CONA 1REDA 1QU0A 2XJQA 3T2PA 5FZBA
chains in the Genus database with same CATH topology
2KR2A 4BQ4A 2JWPA 1GWLA 1W8TA 4YW6A 4AL9A 4CP9A 1WMXA 4YW7A 2LRPA 2LROA 3F95A 4A6SA 4LKDA 4LK6A 4LKFA 4LK7A 4CPBD 1W9FA 3ZYHA 3ZYFA 1L7LA 4BQ5A 3ZYBA 2Q1FA 1OH3A 1W8WA 1W90A 1W8UA 1W8ZA 1V0AA 1WZXA 4CPBA 3UT0A 3ORJA 2O14A 2K46A 5D21A 4CP9B 2VXJA 4LKEA 1GWMA 4LJHA 1WCUA 1OKOA 4BQ2A 1HN0A 1GWKA 2C24A 2WYFA 4BQ3A 4YWAA 1UOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR2 A;  4BQ4 A;  2JWP A;  1GWL A;  1W8T A;  4YW6 A;  4AL9 A;  4CP9 A;  1WMX A;  4YW7 A;  2LRP A;  2LRO A;  3F95 A;  4A6S A;  4LKD A;  4LK6 A;  4LKF A;  4LK7 A;  4CPB D;  1W9F A;  3ZYH A;  3ZYF A;  1L7L A;  4BQ5 A;  3ZYB A;  2Q1F A;  1OH3 A;  1W8W A;  1W90 A;  1W8U A;  1W8Z A;  1V0A A;  1WZX A;  4CPB A;  3UT0 A;  3ORJ A;  2O14 A;  2K46 A;  5D21 A;  4CP9 B;  2VXJ A;  4LKE A;  1GWM A;  4LJH A;  1WCU A;  1OKO A;  4BQ2 A;  1HN0 A;  1GWK A;  2C24 A;  2WYF A;  4BQ3 A;  4YWA A;  1UOJ A; 
#chains in the Genus database with same CATH topology
 2KR2 A;  3ST7 A;  1IKQ A;  2BDR A;  4S2D A;  5A7N A;  1SBF A;  2RR1 3;  5H9Q A;  1J1L A;  2QQO A;  2DUR A;  1CIW A;  1RUG 2;  1VB4 A;  1YUD A;  5TSW A;  1HV1 A;  3IB3 A;  4WVV A;  4AHX A;  4BE3 A;  3VHO A;  1UNB A;  3T0B A;  2Y34 A;  1ODN A;  2XJP A;  3LA2 A;  1W8W A;  4IE5 A;  1UXX X;  4I3G A;  4MX3 A;  3RG0 A;  3KHC A;  4A3X A;  4XDQ A;  3ZN6 B;  2VOW A;  5SV8 A;  4IGQ A;  1ULP A;  4N53 B;  2AEY A;  2DBN A;  2JDK A;  2JDY A;  4GH4 B;  4UFL A;  3SH5 A;  1FOD 2;  4CDW A;  4GJZ A;  3LDK A;  3V64 A;  2D98 A;  3GYD A;  1A78 A;  2PMW B;  4KG0 A;  1FMD 3;  5EJ3 A;  1GOH A;  1O4Y A;  5I8Y A;  1WD4 A;  2ZZQ A;  1RVF 3;  2WNV C;  1RL3 A;  3GBG A;  4RQP B;  4E2Q A;  1JW6 A;  5HCH A;  1BZW A;  1XE7 A;  5HV0 A;  2J1U A;  2DU0 A;  2UWB A;  1NUK A;  1AL2 1;  1W6O A;  1PK6 B;  1W3X A;  3MID A;  5FYB A;  4Q8L A;  1C8N A;  5D8A B;  3VZM A;  1XOY A;  1EY2 A;  2FD8 A;  3FMG A;  1Z7S 3;  5CEH A;  2AGS A;  1Z7S 1;  3OPT A;  4J25 A;  4PBP A;  4CTE A;  4URT A;  1RUC 3;  4L2N A;  1VAV A;  2SLI A;  3NKG A;  2YPJ A;  1W0P A;  3BUC A;  1RUI 2;  1B35 A;  1SFN A;  4Y5S A;  5GZD A;  5LCW L;  2HWC 1;  2WO3 A;  3RMX A;  2BV4 A;  4QX1 A;  4JDN A;  3FLR A;  3I97 A;  2QQP A;  4QX0 A;  3ZXF A;  1W2U A;  5IWF A;  3AP6 A;  3OGJ A;  1OSG A;  4L99 A;  2RJ2 A;  3DKQ A;  2P3I A;  2LRO A;  1DQ2 A;  4QX3 A;  1NCQ A;  1ZZ6 A;  2JB8 A;  2ZGU A;  2A1X A;  3DYP A;  2ZEZ A;  3I2K A;  1R64 A;  1GSL A;  4COV A;  1S0C A;  3DYM A;  4DMI A;  1V6O A;  4GMP 0;  4MGK E;  3PJY A;  5KC6 A;  1YLL A;  3FLP A;  1ZYB A;  4UFK A;  2WN2 A;  1DLL A;  3PDQ A;  4JAA A;  1WW4 A;  5D2A A;  3U1X A;  1WBF A;  3FC0 A;  4Q4V 1;  2OQ6 A;  1W6P A;  1WCD J;  4W6W A;  3UJQ A;  2CAU A;  2ETE A;  4DQA A;  1WCK A;  4EV0 A;  3ZYP A;  1PO2 1;  1XNA A;  1IS6 A;  3OUJ A;  2GP3 A;  5FO7 B;  5FP4 A;  5H9P A;  1HRI 1;  3VDD A;  4YPJ A;  5IJR A;  2Q8C A;  2OQ7 A;  4LQR A;  1O3T A;  3ZFE B;  5F5Q A;  3TWI A;  1ZA7 A;  5BNP B;  3ZDS A;  1VBD 2;  1QNY A;  4IXL A;  1WLD A;  3UL2 A;  4TYS A;  1RIR A;  3HNY M;  1RJ7 A;  1COV 3;  2JG9 C;  4AEM A;  3RQ0 A;  1SLL A;  2XBO 3;  3VBS A;  5FYH A;  3VD5 A;  4AED B;  1DGW X;  2P37 A;  2QKD A;  2WIN B;  4PIZ A;  1UF2 C;  4RL7 A;  5C9A B;  2XKP A;  1E5I A;  4EJR A;  4UF0 A;  5H9S A;  1VRH 1;  2C26 A;  2RM2 1;  2C4X A;  2ZOE B;  3B7M A;  3JBG 1;  2W9X A;  3IZO A;  4QXC A;  1KS4 A;  1DQ1 A;  1O59 A;  3ABZ A;  3ILN A;  3NNM A;  4XXA A;  4BH9 A;  1F4A A;  5FZO B;  3LEK A;  4TLF A;  4X8N A;  5FZK A;  3RJ2 X;  2BP6 A;  3B00 A;  2KA3 A;  4YW7 A;  4D7Y A;  1LRH A;  2FQP A;  3SQO A;  2VNR A;  3KM5 A;  1WW7 A;  2GNB A;  4QAW A;  1QKQ A;  4OCT A;  1IS3 A;  1M4W A;  1OUS A;  2FCU A;  4CZS A;  1UY4 A;  5IVF A;  2CDP A;  3GHM A;  1OD3 A;  1UN1 A;  2Z5W A;  4OHW A;  2A71 A;  4A41 A;  1LOF A;  4MXW A;  3T09 A;  3MLL A;  4PDW C;  2BYV E;  2RM2 2;  5FZC A;  5HXM A;  5IVE A;  2Y6J A;  1BCX A;  2YRO A;  5I8T A;  4ARY A;  1EAH 3;  4JQT A;  3DKW A;  4Q4X 2;  4EYU A;  3WG2 A;  1W28 A;  1PVC 2;  1AR9 2;  2E51 A;  1LED A;  4XUP A;  4AI2 A;  5FMO L;  1JTZ X;  2W68 A;  4HKW A;  4JGZ C;  3PME A;  4UF0 B;  4UW5 A;  3IAP A;  5FXV A;  3WUC A;  4KG8 A;  2XXZ A;  1GFF 2;  3RZZ A;  4Z2A A;  2PHR A;  2VG9 A;  1QEX A;  4YZ2 A;  5IVY A;  5IFT A;  1MS4 A;  1RMU 2;  3N9P A;  2PTM A;  3Q9O A;  5LY2 A;  3ZYH A;  4LUL A;  5HXV A;  4F83 A;  1EPW A;  1MZF A;  2RS1 3;  5A1L A;  3JQW A;  4YGE A;  4ZS2 A;  1H4G A;  3NW4 A;  5JOW A;  3WP5 A;  4HBN A;  5DDJ 2;  3G6J B;  3RGB A;  3S7E A;  3BVC A;  4QPW A;  1JU4 A;  4HET A;  4M3C F;  2J42 A;  3T2Q A;  1C5I A;  2GH2 A;  3GM8 A;  5JOY A;  3UNP A;  4JZR A;  3T2T A;  1MS8 A;  1X8E A;  2A3W A;  2DTW A;  2X09 A;  3R4S A;  2GN7 A;  3I4I A;  3WW3 A;  3DYO A;  4IV1 C;  4YZ3 A;  3O1P A;  2ZPX A;  1B09 A;  1WMX A;  1OC1 A;  1PMH X;  1VB2 A;  3H42 B;  4GKX A;  4YM3 A;  2GP5 A;  4KNC A;  4DPN A;  3M3O A;  2Y0I A;  1DYO A;  3KCY A;  3H1Y A;  4QMA A;  1ZZB A;  1JN2 P;  5FP3 A;  3KT4 A;  4P5Y A;  1IPS A;  5SV5 A;  1LGC A;  2Y6H A;  2Q1F A;  3HVD A;  4V2V A;  2ZX3 A;  2DCZ A;  4C8D A;  3DCQ A;  1V0A A;  4MHU A;  3U10 A;  4Y5Z 0;  2R07 2;  4NII A;  3SCG A;  1JI6 A;  1S0D A;  3SKV A;  1C8M 3;  2OVU A;  1W04 A;  2H0V A;  5A7P A;  3HAG A;  5A3P A;  4NHX A;  3PMS A;  3WVJ A;  1DQ6 A;  5CFD C;  4CCO A;  1O8S A;  1DGW A;  1BEV 2;  5CYY A;  4C1X A;  4R8H A;  1PNF A;  5L73 A;  4IE0 A;  4CU8 A;  2V5Y A;  5AVA A;  5JCT A;  5JXH A;  2YBS A;  4AED C;  5F9T A;  4FPF A;  2JEN A;  3RZG A;  4HT1 T;  3RRD A;  3GF6 A;  2ZGK A;  3AKT A;  2PXJ A;  3ROU A;  4DS0 A;  4FAG A;  1BVP 1;  4DUX A;  4IQP A;  3ACF A;  3O12 A;  2YB7 A;  1NE6 A;  4COZ A;  1OHF A;  1NXD 1;  1PO1 1;  2J1T A;  2WT0 A;  1AR6 2;  1VBD 3;  4DEQ A;  3RFR A;  3ACH A;  2YMZ A;  1BEV 3;  2O8O A;  3SEE A;  2WO2 A;  2WN3 A;  1D4M 3;  1AJO A;  2CHH A;  3FZ3 A;  1ND3 B;  1SHW B;  2FMY A;  2VQA A;  2ZGL A;  2GU9 A;  1KIT A;  1IGO A;  3NO8 A;  1XYO A;  1S1A A;  5JOX A;  2WA4 A;  5FYI A;  2ZGO A;  3FHA A;  4Y1V A;  2VMF A;  4Q0V A;  2HWC 3;  1Z78 A;  2ZXQ A;  2WZR 1;  3A23 A;  4NAM A;  3BIW E;  1GIC A;  2AC1 A;  1HXS 2;  1W8N A;  1GMM A;  3MV1 1;  5A1A A;  3FBY A;  5IFP A;  4PIY A;  3MF6 A;  5DUW A;  1R1Z A;  2W39 A;  5FCC A;  3DN7 A;  3RPQ A;  1RMU 3;  1AR6 1;  4A2U A;  1NA1 B;  3CLP A;  3M1H A;  5KXC A;  1GOF A;  1Q8P A;  4P9G A;  4HMZ A;  2TUN A;  5IK5 A;  3WF2 A;  3OTF A;  4TSV A;  4OI1 A;  1S0G A;  4MVT A;  1BK1 A;  2JKB A;  4LKE A;  1XJA A;  3SH4 A;  2XUE A;  1Q8S A;  3ZFG B;  3OD4 A;  4CCL A;  1CX1 A;  2FDH A;  4QGL A;  2D6L X;  3B01 A;  2EIG A;  3GJA A;  4U2A A;  3GZT B;  5FBZ A;  2YUE A;  4CU9 A;  4HK9 A;  4FVV A;  5KBF A;  5CNA A;  4XQW A;  1VAL A;  5J98 B;  2Y6L A;  3PJQ A;  2BQP A;  2VE1 A;  2YV8 A;  1YFY A;  4DRV A;  5JVV A;  3ZXD A;  2P5B A;  4ERO A;  5FZE A;  1QJU 1;  1AR7 3;  4NID A;  3V0B A;  5FLI A;  1GP5 A;  4HAN A;  4I0A A;  3A0K A;  1REF A;  5F3E A;  2WNV A;  1MQT A;  4XF9 A;  4XUQ A;  2ZGS A;  4RQP C;  2WR9 A;  1NAE A;  2XUM A;  3I2J A;  1ALY A;  4DY3 A;  1LHN A;  1HB3 A;  1CAV A;  4RFR B;  4QQL A;  2HWD 2;  5C9A C;  1H4H A;  3ZVX A;  2DCJ A;  4CDX B;  2DCY A;  3VBF B;  4M01 A;  5FYT A;  4K8F A;  2YBK A;  1XQN A;  3DL3 A;  1NOV A;  1A8D A;  3ZR6 A;  4ATF A;  5IAX A;  5KWR A;  1TME 3;  2C1F A;  4B4P A;  1TNF A;  1WW5 A;  2B9U A;  4WM8 C;  1RUJ 1;  1S55 A;  2E33 A;  3O1R A;  1X7N A;  1YJK A;  2B39 A;  3I3M A;  3ATG A;  1GZW A;  4FP3 A;  1DBN A;  2UWA A;  2ZJC A;  3NV3 A;  4QM8 A;  1EUT A;  2DFC A;  1L3J A;  5LRR A;  2ZX2 A;  1AX1 A;  2A5Z A;  3HPN A;  2HWD 3;  3MZH A;  4KU8 A;  2VBD A;  1C1F A;  2WQZ C;  1UD1 A;  2R07 3;  2IXH A;  4RR3 B;  4R9C A;  3C2U A;  5JZG B;  3S0M A;  3WEZ A;  2QZ2 A;  2BPA 2;  2BBV A;  5LAS A;  4LOS A;  4B1L A;  4NUB A;  4IET A;  3OOX A;  3KD4 A;  2W08 A;  4WV8 A;  4AFA A;  5DXD A;  1DU3 D;  4DRR A;  5BNO C;  2A6Z A;  3N7L A;  1VRH 2;  1FPN 3;  2QFE A;  2VVE A;  3D82 A;  3BB6 A;  1FNY A;  4WVZ A;  1WUV A;  3ASI A;  3OF1 A;  5CKM A;  4XCA A;  4IE6 A;  4DXZ A;  3RVH A;  3AMH A;  1X50 A;  1ZZ8 A;  1VBA 1;  2WWU A;  1ZM1 A;  1KJL A;  1RHI 1;  2DF7 A;  1PO1 2;  4IEU A;  5LB6 A;  1G86 A;  1RHI 3;  4OZX A;  4LHL A;  5FKB A;  5A6Z A;  4D69 A;  5JR7 B;  2IVJ A;  2ZGT A;  2VNG A;  4G3Y C;  4QX5 A;  2D44 A;  2XBO 1;  1XE0 A;  4UW4 A;  4DNY A;  1HIX A;  4WBB A;  4YW4 A;  4H3W A;  4NOT A;  3AP5 A;  3TN9 2;  1UAI A;  1W9T A;  2IVI B;  1OLM E;  2NZ9 A;  2VCB A;  1RUI 3;  2PQS A;  2QQM A;  3IWZ A;  4XJ8 A;  3UKN A;  5BNP C;  3HQU A;  5DUX A;  2BNN A;  1AHS A;  2GC3 A;  2GME A;  2WRA A;  2WNV B;  2XVK A;  4W65 A;  4UWD A;  2ET7 A;  1YWK A;  1DZQ A;  3LAG A;  2VBP A;  3PLQ A;  1J59 A;  4IER A;  4K7J A;  5IW0 A;  1EV1 3;  2RHP A;  2J1A A;  3B9I A;  3WDT A;  5JSO A;  1W0N A;  4RS5 A;  4E8D A;  3C3V A;  2JDZ A;  1UCX A;  1BVV A;  3ON7 A;  1C5H A;  2ZEY A;  3TEZ A;  3O1O A;  1STM A;  1YQ6 A;  4N53 C;  2PHW A;  4AQ6 A;  1N1Y A;  2ZZJ A;  1RUG 1;  3N9O A;  4XAA A;  3LZZ A;  3SH3 A;  3VLB B;  4TZD A;  4A3Z A;  4JKK A;  4PCR A;  3J7H A;  5F1R A;  2RV9 A;  1H2K A;  4N7U A;  4XOG A;  1YQ5 A;  1UY0 A;  4IEW A;  5C71 A;  2RMU 2;  3III A;  2CGO A;  2J1R A;  3ES4 A;  4IV1 A;  4GAL A;  3ZYF A;  2O0O A;  5AFB A;  4XYX A;  3LGR A;  4QB1 A;  1MZE A;  5HV4 A;  5DUV A;  4Y22 B;  1D0H A;  3MFC A;  3MO4 A;  3VDD B;  5J36 A;  3DV8 A;  4M3C E;  4QGN A;  1W6M B;  3CJI C;  5K4L A;  4QX7 A;  3AXD A;  4RGK A;  1ASJ 3;  3LA3 A;  3SLI A;  4JV4 A;  3WNO A;  1I6X A;  5IUQ A;  4HN0 A;  2CY6 A;  2VZQ A;  3VBU B;  5CG9 A;  4NHY A;  2H0B A;  4MAD A;  1SLA A;  2W91 A;  3GZA A;  3PUS A;  3FX3 A;  5ACA 1;  3VBR A;  3KF3 A;  1U5X A;  3WG3 A;  3AL5 A;  4AVA A;  1OH4 A;  5ERL A;  5FPU A;  2FZ2 A;  5GM0 A;  2B46 X;  3LEI A;  1W8H A;  4I01 A;  4YGC A;  1IHM A;  4XJ9 A;  1YFX A;  3W59 A;  5L7O B;  5IK8 A;  4Y33 A;  4YYO A;  4CP2 A;  5APA A;  2X53 S;  3HMY A;  5ANQ A;  1F15 A;  4P9I A;  4AGV A;  1FPN 2;  3I2G A;  4AQT A;  1EP0 A;  1JYT A;  1PIV 2;  4KBB A;  4GKY A;  3H8U A;  2AR6 A;  4QB2 A;  2D93 A;  4FFF A;  4OVE A;  4AI0 A;  1RC6 A;  4JVA A;  2ENR A;  3VD9 A;  5C70 A;  1ZRC A;  4K1Y A;  3D0J A;  1KGY A;  1RTV A;  4F8A A;  1AR8 2;  3V56 A;  4NO4 A;  2XB6 C;  1TQ5 A;  4FTB A;  1OUR A;  1E57 A;  1LEN A;  1FAY A;  3IMN A;  5JPN B;  1ZBE 3;  4Q4X 3;  2P17 A;  3KV4 A;  1OA3 A;  2NMO A;  5L9V A;  2E63 A;  2YC4 A;  1KXG A;  2ZHL A;  2ZS6 B;  4LUM A;  5FPZ A;  3VD3 A;  1OQE A;  5LZ6 A;  3JXS A;  4XFF A;  5FZD A;  2WKK A;  3PVN A;  1OOP A;  2XPJ A;  5JSR A;  3ZXG A;  4Q1R A;  2B5H A;  2R16 A;  3MUZ 1;  4FP2 A;  4SBV A;  4XAB A;  2B9V A;  4ZON A;  1CGP A;  1R08 1;  2A6V A;  2OZ6 A;  5K0U C;  4QXB A;  2WFF 1;  2Z4F A;  3AZV A;  5FPX A;  1FMD 2;  2QJV A;  4BK4 A;  3MEP A;  4CDX A;  3Q8A A;  3N9L A;  1OBN A;  4QPY A;  2F17 A;  5FZ3 A;  2IXI A;  4LXL A;  2OXB A;  3W5N A;  1LKN A;  3GDB A;  3O1U A;  1AX2 A;  2CWS A;  3LQC A;  3RS6 A;  4HSL A;  5B2G B;  1LOD A;  3VD4 A;  2IFR A;  3AKS A;  3ZFF C;  1NE4 A;  1XE8 A;  3ITQ A;  5F3G A;  1Z0H A;  4A7Z A;  2VD7 A;  1WWY A;  4NRQ A;  1S0I A;  2A6Y A;  1K5M C;  4GZ9 A;  4ZXK A;  2B4K A;  2BGP A;  1KDM A;  3GCX A;  4P08 A;  3I59 B;  3TN9 3;  4D7T A;  1WA4 A;  1PGL 1;  4KH9 A;  5HCB A;  1GQG A;  2ZA9 A;  2VZ1 A;  3WQB A;  4YSF A;  3KVA A;  4FFH A;  3AZW A;  4FFI A;  4W6Y A;  5F6L B;  4Y1Z A;  2IXK A;  2VZO A;  1CR7 A;  3JB8 A;  4XEZ A;  1Y43 B;  5GZE A;  1ENR A;  2XHK A;  4Y4Y A;  3THC A;  5KHI A;  3T1L A;  2JG8 A;  2Y6G A;  2W95 A;  3KGL A;  3GAL A;  2GDF A;  5AVP A;  2Y33 A;  2BBA A;  2IC1 A;  2CL2 A;  1O4Z A;  1UYY A;  2A6X A;  2E9Q A;  1SBE A;  2E7A A;  2VMD A;  1LHW A;  1ND3 C;  1X33 A;  5DDJ 1;  1AXY A;  2PHX A;  2D7F A;  3ZYI B;  4QPG A;  4UI9 L;  1GR3 A;  3U4S A;  4AGR A;  4CUB A;  1OF3 A;  1REE A;  3MF9 A;  3POB A;  3USU A;  1F5J A;  2AUY A;  2DU1 A;  2EAK A;  3HEI A;  1WW6 A;  2JG8 C;  4F7Z A;  1OFN A;  1WLC A;  1IPJ A;  4QDQ A;  5A32 A;  1ENS A;  1HRI 3;  4OLL A;  2BOI A;  5FZH A;  4A4A A;  1UZ0 A;  4E8C A;  4NIA A;  2TEP A;  3IDE A;  3OPZ A;  5LBF A;  4CDU A;  4XMI A;  2D97 A;  1LJ7 A;  1V9U 2;  4FAH A;  4NR1 A;  5FJK A;  4A6S A;  2F4P A;  4MGY E;  2BFU S;  2VCC A;  4IW3 A;  3ZSL A;  1PO2 2;  3H7J A;  4EN8 B;  1AZD A;  1YQ8 A;  1GZW B;  4EN7 B;  1WLW A;  1V6N A;  2XJU A;  4CCK A;  1UO9 A;  1HB4 A;  3P6B A;  1SPP A;  1F35 A;  1COV 2;  2JX9 A;  4GWJ A;  4HFS A;  3VBU A;  3VKM A;  4GH4 A;  1ND2 B;  1QJE A;  1ZX5 A;  2UYB A;  2VH9 A;  3JUU A;  5FZM A;  1RIT A;  4QQH A;  2VOX A;  3R0R A;  5DAX A;  3FBM A;  3V0A A;  1O3Q A;  3HBZ A;  1X36 A;  1JYW A;  3N7K A;  3KB5 A;  4LR4 A;  4PQQ A;  2YXS A;  3OSD A;  5GLV A;  2VTX J;  4XTM A;  3SHR A;  2VQU A;  3TB0 A;  4IEV A;  1JOB A;  4QKB A;  3CZJ A;  1OD5 A;  1SLB A;  3U14 A;  2UWC A;  4D3W A;  1J3P A;  3S57 A;  2Z42 A;  3ZFG C;  1JU3 A;  4B29 A;  2PLV 3;  5EJZ B;  5F39 A;  2E7Q A;  4CXY A;  1IQA A;  1PHM A;  1OOP C;  4FOV A;  4UOJ A;  3KF5 A;  2WWJ A;  5BXX A;  2W46 A;  3POW A;  2R32 A;  3WQ0 A;  1YIP A;  4BJ0 A;  3ELN A;  5FKC A;  1UOF A;  1VBC 2;  2KM2 A;  3GNE A;  1UU5 A;  4NWV A;  2WUH A;  2ZHK A;  3O0V A;  1KEX A;  2RM2 3;  5GJ6 A;  2DBI A;  3WP3 A;  3KVB A;  2RS3 1;  4I30 A;  4JGY B;  1IOA A;  1QJU 2;  4QPI A;  3E5X A;  3H1W A;  3B9C A;  2A6W A;  3I8T A;  4YW6 A;  2NM1 A;  1S2E A;  2QDR A;  3LWC A;  4JGZ B;  5IT6 A;  4OFG A;  2JXA A;  1Q8Q A;  3D6E A;  4ZU4 A;  5L9B A;  1UIK A;  1ZVF A;  2W92 A;  4JGZ A;  4P9Y A;  3RZH A;  2VR4 A;  2OII A;  4YVW B;  2ERF A;  1GOG A;  3EB7 A;  3O5S A;  2G1M A;  2PN5 A;  3O7O A;  3SNM A;  3ETP A;  2DVD A;  3VKN A;  4PDW B;  4N7I A;  1GBG A;  3CL1 A;  2WYS A;  2JKX A;  3VN4 A;  1CAV B;  4Y1U A;  2J1S A;  2FMD A;  3NJZ A;  1VP6 A;  4NHL A;  5FP9 A;  1CJP A;  3WNX A;  1KRI A;  1V00 A;  3NST A;  2WZE A;  3SIT A;  3POY A;  1L7R A;  1JBC A;  4MET A;  1DLC A;  1JMU B;  4DIQ A;  2FCV A;  2P1B A;  4E2S A;  4YVS C;  1H8T C;  4FPJ A;  2VMH A;  3OY8 B;  1F8V A;  4WM7 A;  1K5M A;  2ZGR A;  5FY1 A;  4AWD A;  4NIG A;  1NY7 2;  5ABJ A;  1BMV 1;  3K4A A;  4LO5 B;  1FOD 3;  1NCR B;  2ZHM A;  1PX3 A;  2JIJ A;  4FT8 A;  4Q4Y 3;  1ZBA 1;  1BXH A;  1PVC 3;  3U07 A;  1XPW A;  2A7A A;  3A21 A;  3KHB A;  2MHF A;  1W6O B;  3G7D A;  4LOR A;  4BLI A;  4JRA A;  1JZ8 A;  3D5O A;  3J8F 3;  4S2H A;  5KHJ A;  4BQ1 A;  1O6U A;  3IIA A;  3DPR B;  5FK7 A;  1OVS A;  3TRS B;  3L9J T;  5FBJ A;  4NN0 A;  4UT5 A;  4P00 B;  3DPR A;  3V0A B;  3MIF A;  4UFH A;  2BVV A;  2VXJ A;  3O1S A;  2YY1 A;  3M3I A;  2XJR A;  4UBG A;  1DFQ A;  1UQX A;  2ZKN A;  1ULE A;  2C24 A;  4OUS A;  1S2B A;  1ULF A;  4FPO B;  3HJR A;  3N36 A;  3M7A A;  3NV2 A;  1R08 3;  1RUH 3;  1UL9 A;  1ZBA 2;  5D8A C;  2AZ5 A;  3BTZ A;  3GCW A;  5GZF A;  1SFY A;  3F95 A;  1AR7 2;  2C5D A;  3LD8 A;  3OBZ A;  1BEV 1;  2BFU L;  1J3R A;  1W2O A;  2VZV A;  3E5U A;  1CAW A;  5FZO A;  2HWC 2;  3ECQ A;  3CZU A;  1QXJ A;  4R9D A;  3ZYB A;  5JIU A;  2E31 A;  1MZ6 A;  4IEO A;  2VTX A;  1O7F A;  5A32 B;  2VEC A;  2FCT A;  4PBO A;  2E26 A;  3KSC A;  4DEV A;  2NLR A;  3AMM A;  1RUF 3;  5K8S A;  2GAU A;  1S0E A;  3AZX A;  4C0B A;  4FO9 A;  3K4D A;  1H0B A;  3MW2 A;  2JIG A;  4M0H A;  1AX0 A;  1RUG 3;  2FHR A;  5JXJ A;  4WVW A;  1GKB A;  1QXP A;  3KV5 A;  5DG1 A;  2ZEX A;  3K2O A;  4LLO A;  4DY5 A;  5JMC A;  2VUC A;  5LW9 A;  1JH5 A;  5CG8 A;  3MBW A;  1UWW A;  1WCQ A;  4OHV A;  4EWA A;  2VNO A;  3T30 A;  2VBB A;  3VZK A;  3IBM A;  2RR1 1;  2VM9 A;  3ZPO A;  4MYE A;  5FZ0 A;  2BNO A;  4P9W A;  4AF9 A;  5DZE A;  2CV6 A;  1POQ A;  4B7E A;  1WZX A;  3BI3 A;  1VBA 2;  5GKA C;  4L8Q A;  1PO2 3;  1NCQ B;  2BGO A;  5LA2 A;  3POF A;  2R0H A;  1NX9 A;  2VAU A;  3WF0 A;  2E32 A;  2J1E A;  5ACA 3;  3RZJ A;  1RYY A;  4IV3 C;  5LA1 A;  1IS4 A;  2D6O X;  4CEY B;  5C8C A;  4XTP A;  2K0G A;  4AXO A;  1V6L A;  1EPZ A;  2AAC A;  4QKF A;  5KHK A;  1T6G C;  5JUV A;  1G9D A;  1SCS A;  3UV9 A;  2XL9 A;  3IPV A;  4QPI C;  4Z8B A;  4LK6 A;  2GMP A;  1YHF A;  3UKT A;  3NNL A;  2WZP P;  2XDV A;  4YFW A;  1TVG A;  4MOA A;  5IK7 A;  4LE4 A;  1HB2 A;  3PUQ A;  4FCA A;  2VVF A;  1G8W A;  1QH7 A;  4PHZ A;  4COW A;  3SEP A;  3THT A;  3E1F 1;  3Q8C A;  4CUA A;  4AFB A;  4G9S B;  4Q5O A;  3ES1 A;  1UY3 A;  3OYW A;  4PF5 A;  3O14 A;  4AHW A;  4PF1 A;  1OMI A;  5CKQ A;  4AVS A;  2RMU 1;  3PUI A;  3P3P A;  1QJZ A;  1ZBE 1;  3ZFF A;  3X29 B;  2XBO 2;  4QQP A;  1DGR N;  3JB4 C;  4CDQ C;  5A3W A;  4ISQ A;  4FPH A;  4N9I A;  4CDW B;  1UX7 A;  2OT7 A;  1A6C A;  2R30 A;  1JYC A;  3T0A A;  5LRS A;  1W8O A;  1GP6 A;  5J09 A;  3LSD A;  5DZG A;  4XFI A;  4GXL A;  1QJF A;  1W05 A;  1YQ2 A;  1IQD C;  1YQC A;  2YYO A;  2ZAA A;  5FY7 A;  4WM7 B;  1MEC 1;  4Q4Y 2;  4CUC A;  4CP9 B;  3TEY A;  3QH7 A;  5AC9 1;  4LO4 B;  3BTX A;  2DV9 A;  2QQI A;  4JC1 A;  2JDU A;  4LO6 B;  1NQD A;  3DPR C;  2VY0 A;  5HPO A;  2D43 A;  3RYR A;  5J1X A;  5K7P A;  1YO8 A;  4QX2 A;  4X6Q B;  5EIY B;  1UIJ A;  3AKP A;  1G9C A;  3J8F 1;  1J3Q A;  4XUO A;  1XXN A;  2PQQ A;  2PHF A;  5JI9 A;  2RS1 1;  3MIC A;  1PGS A;  2OUJ A;  4LIV A;  4CUG A;  4CXX A;  5DMY A;  4FOY A;  4M3C B;  2C6S A;  3BN6 A;  1DGR A;  1JS9 A;  3ZSM A;  1GYK A;  1LEM A;  4P5H A;  1VBB 2;  5C4W C;  4HVO A;  1J58 A;  3D3A A;  4WVM B;  1XNT A;  5ANN A;  5JIA A;  1AR8 1;  4BXF A;  2EAL A;  4Z92 B;  1LR5 A;  4HVR A;  1PMI A;  1WMF A;  4QWN A;  3T3Y A;  2CAV A;  2QBX A;  2WNE A;  1EV1 2;  5FPL A;  4DIN B;  1XND A;  3MPP G;  2C0Z A;  2JDP A;  3WY6 A;  5FJH A;  3M70 A;  3LDR A;  4HL0 A;  1IG3 A;  1RUD 2;  4DUW A;  4BPZ A;  1JYV A;  5CAZ A;  2OW4 A;  1H6Y A;  3V0B B;  5F7U A;  3SXW A;  1P8J A;  4IEZ A;  4ES9 A;  1FPN 1;  1QY4 A;  2XWB B;  4J1X A;  5A70 A;  5F3I A;  3AYE A;  3B94 A;  2YG0 A;  3H1M A;  5FMD A;  4MV2 A;  1Z7S 2;  2XML A;  1ULO A;  2VZP A;  2XR4 A;  4CDX C;  1W06 A;  2X5I A;  4FI9 A;  3ZSK A;  3PHM A;  3QLQ A;  4Q26 A;  3WUD A;  3K3N A;  1QQP 2;  2W52 A;  1HJF A;  2VZT A;  5A3L A;  3E6D A;  4YWA A;  5I0S A;  3EQE A;  4O65 A;  4FOQ A;  3U11 A;  2WWS A;  3AKQ A;  4ES8 A;  4NHM A;  2HJI A;  3GJB A;  4UAP A;  2A70 A;  5T5J A;  3MI8 A;  1GP4 A;  4QXH A;  2HWB 2;  2QE3 A;  4LHK A;  2HH9 A;  2A3X A;  5K0U A;  2TBV A;  4JX0 A;  2XQX A;  5FIX A;  2R1D A;  5CBL A;  4DOU A;  2AYH A;  4OI2 A;  1W8Z A;  4OMD A;  4R9A A;  2DTY A;  3AYA A;  1VRB A;  2RS3 3;  5F32 A;  2BRT A;  2GH8 A;  3W21 A;  2XGX A;  4WZF A;  3ZXK A;  1RUH 2;  3K46 A;  1CPN A;  2JDA A;  3BIE A;  3SIS A;  1ULC A;  1NQJ A;  2JDM A;  3WDU A;  2CNA A;  2N7G A;  1S2K A;  1H2L A;  1RJ8 A;  1RUE 2;  1QOT A;  1LES A;  2R06 3;  2ZX4 A;  4RYD A;  3POG A;  4Q0Q A;  1OKQ A;  3NNJ A;  5DQ0 A;  2LRP A;  2VL4 A;  1CX4 A;  4NWW A;  4ZZ8 A;  5FMC A;  1QHD A;  1UMI A;  3KV9 A;  3IT8 A;  4KQ7 A;  1QGL A;  1NLQ A;  2GC2 A;  3WT3 A;  4G4F A;  1LHO A;  1US2 A;  3WNL A;  3M3C A;  4DZG A;  2B8M A;  1PMJ X;  1GNY A;  1H8V A;  1SEF A;  4JHT A;  5LA9 A;  1WME A;  1NZC A;  2VW0 A;  4YG6 A;  3H8O A;  1DYK A;  1LOE A;  2QQN A;  2VZ3 A;  3BKZ A;  3TBD A;  1VE0 A;  1ZA4 A;  5T5P A;  1PX4 A;  4DXS A;  5A7W A;  1ZRE A;  4IE4 A;  1AL0 G;  1I5P A;  5IK4 A;  4PIX A;  4BXS V;  1XSQ A;  1RUJ 2;  2D5H A;  2UU8 A;  1Y4W A;  2DVA A;  2OPW A;  1W39 A;  3RZM A;  1MS1 A;  3AJZ A;  2UUR A;  1TG7 A;  3J7M A;  1ULG A;  1ACC A;  1QJY 1;  4XE9 A;  4GIQ A;  4BK5 A;  4L97 A;  4BB3 A;  4E2G A;  2H6B A;  2R1B A;  5DZF A;  1ASJ 2;  2J1V A;  1VBA 3;  3AB0 A;  2VUL A;  3WCR A;  3H8R A;  3H50 A;  4I2O A;  4LUK A;  1ZRD A;  3T0D A;  1UZY A;  5KXD A;  4LE3 A;  2BGC A;  3AP4 A;  2EVX A;  3M3Q A;  4IES A;  1POV 3;  2VUJ A;  1AVB A;  2O14 A;  4QHB A;  1DCS A;  3I2H A;  1US3 A;  4GB3 2;  3Q8E A;  4LBQ B;  3NV4 A;  3IMM A;  2WFF 3;  3VKL A;  1V6M A;  5G05 L;  4F3J A;  1F9K A;  5JWP A;  2LUW A;  3L2H A;  2XJS A;  4KU7 A;  1NLR A;  1TME 1;  3H3U A;  2VW2 A;  1W2T A;  1OXC A;  5GLT A;  5I8S A;  3WIN E;  3MV0 1;  1OA2 A;  1CAX A;  2UYA A;  1O4T A;  3MIB A;  4MGQ A;  4KWL A;  1PZ7 A;  1RXF A;  3CO2 A;  4XIO A;  3I54 A;  3UGG A;  3ZOI A;  4O9G A;  5CFD A;  4H2A A;  2EID A;  3WG1 A;  1PVX A;  3AL6 A;  1RVF 1;  3VGI A;  3OG2 A;  4ASK A;  4IEY A;  2VQT A;  4AYU A;  1AR8 3;  3ORJ A;  1W6N A;  4LIT A;  3VBS C;  4IGO A;  1WA6 X;  4YM1 A;  4CCE A;  3TOJ A;  2IXJ A;  3Q8F A;  3CDZ B;  1DZR A;  2VXR A;  4GWN A;  1GZT A;  3BOP A;  4PLM A;  1VIW B;  4L0P A;  1J84 A;  2P2K A;  4FSJ A;  5FZ9 A;  1OPM A;  3OY8 A;  1AUY A;  2JDH A;  4GWI A;  5E1R A;  1DZT A;  1W8F A;  3WSO A;  2LW8 A;  4LIU A;  2D3S A;  4YZ4 A;  4BDV B;  4CSW A;  4HVQ A;  1N3P A;  4ISR A;  2I74 A;  2RDQ A;  4RGG A;  5FUP A;  2QQU A;  5LY1 A;  5A6Q A;  4GB3 1;  1JZ7 A;  3BOW A;  3H3L A;  2XLA A;  1PGW 2;  3I7D A;  3URF A;  4BQ5 A;  2WJS A;  2GAL A;  5FZI A;  2FDI A;  5DAV A;  3WV6 A;  3H0O A;  2CYF A;  4XJA A;  1GQP A;  1BJQ A;  3HD8 B;  2X10 A;  2QVS B;  4EWE A;  3FL7 A;  2ARC A;  5CAD A;  5F6K A;  5ABJ C;  4CP0 A;  5FYY A;  3KT7 A;  4FXK B;  3TN9 1;  2Q1Z B;  1MVQ A;  4XXP A;  5K9Y A;  4XIL A;  1MS3 A;  3U37 A;  3NL1 A;  4E4Z A;  4Q2F A;  3ENR A;  5EHD A;  1FI2 A;  4Q8K A;  2IUW A;  3WNN A;  3JCI A;  5C5U A;  5HI0 A;  3W9A A;  3ZPY A;  1BK0 A;  4UFI A;  2ZCW A;  4QKD A;  5FYM A;  5FAX A;  2QTW B;  3B5L B;  5IVJ A;  3P1I A;  2GN3 A;  4EZH A;  4DXR A;  2EIC A;  4IL7 A;  1PIV 1;  1W90 A;  5IVC A;  1A34 A;  1WGP A;  3WW2 A;  2CSG A;  3MW4 A;  3OEB A;  2J7M A;  4OUL A;  5A6X A;  5BPX A;  3GBW A;  3ZMO A;  4CRQ A;  2VOV A;  3UKV A;  2RDR A;  1AYN 2;  5CIR A;  2XKO A;  3PUR A;  2Y6F A;  4EZ4 A;  1RB8 G;  1OKO A;  5FZG A;  2R6Q A;  3PTY A;  3LEM A;  1CIY A;  3E97 A;  3OGV A;  5AFE A;  2YDE A;  3SCF A;  4IGP A;  2RS5 2;  3ZFF B;  1LUL A;  1NY7 1;  1AR7 1;  2PFW A;  4JRL A;  3FWE A;  4FQZ A;  3ZYJ B;  4QD2 A;  4AG4 A;  1QJU 3;  2WNU B;  1EAH 1;  1IS5 A;  5GAL A;  5KC5 A;  2PLV 1;  4Q0S A;  3ZO0 B;  1OT5 A;  1RUE 3;  2E53 A;  1UMH A;  3LOI A;  4HKL A;  2YGL A;  4UXA A;  1MQT C;  2A3Y A;  3ZXJ A;  1HXS 3;  1QQP 1;  3J26 N;  1HJG A;  2VO5 A;  3C7O A;  3OPW A;  4YVW A;  1QQP 3;  3MFA A;  2D3P A;  1UW8 A;  1VBB 1;  3PIG A;  2R04 1;  3POI A;  3R4U A;  4H7L A;  3LEG A;  5FYS A;  3ZIX A;  4AFM A;  5HCA A;  3AP9 A;  4FPL A;  1AXK A;  3OUH A;  5BNO A;  3OD0 A;  1GWM A;  3H7Y A;  2Q0A A;  1TNR A;  1WCU A;  2Y0O A;  3EYP A;  4LJH A;  3CIH A;  2WAB A;  4AGG A;  5C3R A;  1LEC A;  4C91 A;  4XHB A;  1C57 A;  1WCS A;  3MDP A;  1KDK A;  2AEZ A;  3Q8B A;  4LO7 A;  3VZO A;  5FDB A;  4NPM A;  1RUD 1;  4WZC A;  1TMF 2;  3D4K A;  2D5F A;  3NQH A;  3CU7 A;  3VD7 A;  1WKY A;  4X8P A;  1V9U 1;  4BIO A;  2WQ8 A;  3OBT A;  1UPS A;  1UY1 A;  4DB5 A;  5EV7 A;  3D8C A;  3POS A;  1F5F A;  3IPV B;  4QGM A;  2EAA A;  1C1L A;  2YZ4 A;  3VBF C;  2DCK A;  4QU2 A;  4KGG A;  2LTN A;  2CGP A;  1GZC A;  1QH6 A;  2BVB A;  2PAK A;  4IDZ A;  4LBQ D;  5A3M A;  5GLZ A;  1RUI 1;  5JPM B;  1FNZ A;  4LPL A;  4XJZ A;  5E88 A;  3BCW A;  4JHZ A;  4NVP A;  1ZRF A;  2RJK A;  1IZ3 A;  2R0F A;  1ONA A;  5FO8 B;  1KS5 A;  3U4X A;  2ZX1 A;  1DDL A;  2W0X A;  1O5U A;  3JD7 3;  4BU2 A;  3IM0 A;  1GUI A;  1QDO A;  3WF4 A;  5I91 A;  1SMV A;  1UKG A;  2HWB 1;  3VKF C;  3M4F A;  4OHZ A;  1I9R A;  3S30 A;  4CEW B;  1CPM A;  1Q56 A;  3O1V A;  3NJX A;  4NAO A;  5FZ6 A;  2HYK A;  2JEC A;  1R09 2;  4OZO A;  1NZI A;  3U78 A;  1U5Y A;  3ZYR A;  3JU9 A;  4HLT A;  4YLZ A;  5EYY A;  1SPP B;  2DUO A;  5FRA A;  4CEY C;  1XRU A;  4CCD A;  2NMN A;  2ZMK A;  5JDB A;  3MLK A;  5FO9 B;  5FWE A;  2BOJ A;  1UKR A;  1VBC 1;  2JJ6 A;  4PJY A;  1NXM A;  2YHJ A;  2QQK A;  2WLP A;  4I0W B;  2P6H A;  3JD7 2;  1CWP A;  2IXL A;  2FDG A;  4U36 A;  3ZFE C;  2JE7 A;  4LA2 A;  2OUH A;  4OYU A;  1VLN A;  3PU3 A;  1L7Q A;  4NRM A;  5F2W A;  5H9R A;  4TN7 A;  3UET A;  1AYN 3;  3AMQ A;  1GWK A;  1W0O A;  4JKM A;  4ZY9 A;  5C3O A;  1FXZ A;  2SBA A;  3VKO A;  1SDD B;  2VZR A;  2YU2 A;  3LE0 A;  5T52 A;  3LIH A;  4QX8 A;  1OQD A;  5E8A A;  2ADD A;  4AL9 A;  2WFP A;  5E16 A;  3NKT A;  4CVU A;  4FBF A;  4KWU A;  1H1I A;  4B3N A;  3QBQ A;  3MIE A;  1EUU A;  1DGL A;  1ZBA 3;  3VBO C;  5HCF A;  1PVC 1;  1QF3 A;  4IEP A;  3THP A;  1R1A 2;  3VBR C;  4A44 A;  4JDM A;  4UFJ A;  4YM2 A;  3ZXL A;  2EXH A;  4LKS A;  4XFH A;  4CDQ A;  3KQR A;  1N3Q A;  4RS5 C;  3RI8 A;  3AVR A;  1Q8V A;  2ZBJ A;  3E5Q A;  3TAY A;  3GGL A;  5C3S A;  2FBE A;  3VHN A;  2BJS A;  3LIG A;  4XBN A;  1LTE A;  3DUI A;  3UJO A;  4A7Y A;  3ZSJ A;  4QPI B;  1QJX 3;  4NPR A;  1XYN A;  2F4L A;  1Q43 A;  4D6Q A;  1RUF 2;  2OX0 A;  1JUI A;  1GNZ A;  3DXT A;  3KT1 A;  4DXT A;  1J83 A;  2VVD A;  1RMU 1;  3EHK A;  1ZBE 2;  2RS1 2;  2X29 A;  4HPK A;  2G4I A;  1D4M 2;  3VB9 A;  5IAT A;  3VBH B;  2JE8 A;  4XQ4 A;  1R1A 3;  1C8M 2;  4LBM A;  4AAP A;  3K4Z A;  4P9L A;  2UY9 A;  3WP6 A;  3K48 A;  4O61 A;  1N1S A;  1NG0 A;  2VME A;  4BQX A;  5T5O A;  2BWC A;  2QNK A;  3ACG A;  1MS5 A;  2GMM A;  2BER A;  3MUY 1;  5BY5 A;  4LBQ A;  4XFA A;  4FPG A;  2P3K A;  1K12 A;  1LOB A;  1VAK A;  2QQW A;  4K9S A;  4Q4X 1;  4RA0 A;  5FY5 A;  3WG4 A;  4BLJ A;  1C28 A;  2DFB A;  3USU B;  4RR3 A;  5JZG A;  4CXW A;  1YI9 A;  3VDC A;  2ZAC A;  2Q5T A;  2R06 1;  5CFD B;  4MZU A;  2NYY A;  4MO3 M;  5LAT A;  2WSU A;  2ZEW A;  5FY0 A;  1H30 A;  4RN5 A;  4AOC A;  1U5I A;  5DG2 A;  2VU9 A;  4ASL A;  5FY9 A;  1CAU B;  4M00 A;  1NLS A;  3ZN4 A;  2ZAB A;  3NWK A;  2HWE 1;  5C4W A;  2KD7 A;  4K6B A;  1PK6 A;  1ZZ9 A;  5A7Q A;  2O8Q A;  4A42 A;  4CCJ A;  1BMV 2;  2LS6 A;  4LBO A;  3MGU A;  3OB8 A;  2WS9 2;  1OLR A;  2GND A;  2KXL A;  5EZW A;  3RNS A;  3RYP A;  2GNM A;  5FZ4 A;  4NRO A;  4I02 A;  5JOZ A;  2C9K A;  5EWS A;  2RMU 3;  2P3J A;  2HWF 1;  5FQ0 A;  2K46 A;  5FFO C;  1W6M A;  3HOB A;  2YU1 A;  2V4A A;  2CU5 A;  1LCL A;  4UYB A;  2V5D A;  4MSV A;  2W87 A;  3I2I A;  3MW3 A;  4NRP A;  2NPI A;  5DPN A;  3TNQ A;  4AFC A;  4JQR A;  3T1M A;  3ZSE A;  2WO7 A;  5JR2 A;  4E4D X;  4AVT A;  3VBS B;  4YZ1 A;  3OEA A;  1VBE 3;  5EJ1 B;  4HON A;  1K5J A;  2V73 A;  5CVR A;  3NJV A;  4FPY A;  4H7M A;  2XL7 A;  2DDU A;  3NRU A;  5ACA 2;  5C3P A;  3O1M A;  1HLC A;  3AMN A;  1F31 A;  2WII B;  3CQO A;  4O9E A;  4OHY A;  4I09 A;  1LB2 A;  1KD7 A;  3ZM8 A;  4B4R A;  2AH2 A;  4XCB A;  4NIH A;  1MS0 A;  2MEV 3;  3B02 A;  2Y64 A;  2VMG A;  4QQ2 A;  4B8E A;  1W3V A;  4TLG A;  2Y26 A;  3NV1 A;  2DYC A;  4RHV 3;  5ISL A;  1Y9G A;  3VBO A;  2DUQ A;  4IE7 A;  1JYN A;  3RWK X;  2PLV 2;  1U12 A;  1JHJ A;  4N90 A;  4M4P A;  1GQH A;  4QHO A;  4BME A;  2QZ3 A;  2YC2 A;  4WM7 C;  5J3U A;  3IDB B;  4AHY A;  3KCX A;  2XJT A;  1OVP A;  3RSJ A;  4EE2 A;  4BHP A;  3PL0 A;  5FY8 A;  2D6N A;  5LEJ A;  2EF6 A;  5CFC B;  2NQY A;  3N3H A;  2R07 1;  1CZT A;  5DUU A;  1AYN 1;  1UY2 A;  4FPK A;  1RIN A;  3I3B A;  3IDA A;  3UYJ A;  4I0B A;  4OUE A;  5A80 A;  1DIW A;  4XPV A;  5FZF A;  5FMO S;  3K3O A;  1UOG A;  3PTR B;  5IHR A;  5JXI A;  4RS5 B;  4QU1 A;  3W58 A;  5T3N A;  4CP1 A;  4R9B A;  1PO1 3;  4AVV A;  4R4X A;  4C0H A;  4LMF A;  2VMC A;  3RZL A;  5JSP A;  2W2I A;  3TEX A;  4GMP 3;  4KI5 M;  4XF1 A;  2ARA A;  3DF0 A;  1W6Q B;  2W1Q A;  1G7Y A;  2BEO A;  3ZLI A;  2FDJ A;  1HQN A;  1LU1 A;  1WD3 A;  4ZKT B;  1CZV A;  1HQL A;  5E89 A;  4XFC A;  4AI3 A;  3BU7 A;  5FXW A;  5CA6 A;  4MUV A;  1HB1 A;  4HN1 A;  3RJR A;  4ARX A;  3ZDV A;  3GZU C;  1O91 A;  2JE9 A;  2ILM A;  4CDU B;  1UYP A;  4TXW A;  3HN1 A;  3RMY A;  1N3O A;  2WT1 A;  1R09 1;  1HRV 3;  4AED A;  2XHN A;  4Y26 A;  3PVE A;  1FT9 A;  1PZ9 A;  2WAO A;  4IV3 B;  2ZAH A;  4N43 C;  1T2X A;  1FV2 A;  3J8F 2;  3O0X A;  3PUH A;  5FYC A;  2OYZ A;  1YRZ A;  2EXK A;  2ZGQ A;  2V4V A;  4B4Q A;  3ILF A;  5L19 A;  2VC9 A;  5CB7 A;  2WNU C;  1POV 0;  4LBK A;  5FOB B;  1LNS A;  2GC1 A;  3PUA A;  3ZR5 A;  3VDD C;  4NPL A;  4A6O A;  1S0J A;  2ZML A;  1FV3 A;  2RVA A;  1YEW A;  3LDB A;  1QOO A;  5F5C A;  3ZIW A;  4XF0 A;  5FR3 A;  2HWE 3;  1XNC A;  5KXE A;  3S5A A;  3VZL A;  2XJV A;  4HPK B;  4BYY A;  1V6J A;  5M0T A;  2BTV C;  1H6X A;  2JB4 A;  3OCP A;  3KQ4 B;  4ASM B;  1W8T A;  1S0B A;  3APB A;  5I0T A;  5T50 A;  3VHP A;  2I07 B;  2NN8 A;  4ONU A;  2RE9 A;  3NJY A;  4LKD A;  2OS2 A;  2WA3 A;  2PA7 A;  3RWN A;  2R04 3;  3TEW A;  3LPF A;  5FPA A;  1W03 A;  1LHU A;  1MZ5 A;  4FFG A;  2X5I C;  1VMH A;  1BLZ A;  1VAM A;  3IDC B;  4AQS A;  1YFU A;  2XWJ B;  1QIQ A;  1GU3 A;  5A7S A;  1H1M A;  1V6K A;  2XOM A;  5I93 A;  4TTG A;  1WLT A;  3AMP A;  3WW4 A;  5LK7 B;  2ARX A;  2X5I B;  1QXR A;  1XYP A;  1UOJ A;  3GBF A;  2ARE A;  1ENQ A;  1RUJ 3;  2P4E A;  5FYZ A;  2WT2 A;  4P9J A;  1GWL A;  3U75 A;  4Z1V A;  2RJL A;  1URX A;  5L7O A;  1U0A A;  2BWA A;  1VMJ A;  3KV6 A;  1POV 1;  2G19 A;  1BKZ A;  2V72 A;  5FZL A;  1D2Q A;  1CZS A;  2P3Y A;  4QT6 A;  1SLI A;  1XNK A;  3WDW A;  1JHN A;  3C7E A;  1B35 C;  3O1T A;  2XVG A;  2W1W A;  3T08 A;  2R7E B;  2R49 A;  3GXU A;  4N9H A;  2JD9 A;  2BW8 A;  3T4V A;  3AKR A;  4JDO A;  2PAE A;  2Y38 A;  3BGA A;  4XDO A;  3S5Q A;  2J22 A;  4CEW C;  5BNO B;  2IWG B;  1OF4 A;  2ZX0 A;  3BYW A;  4BQ2 A;  1W6P B;  3WQ1 A;  1Y9M A;  3ACI A;  2WS9 1;  2ORZ A;  1UPI A;  1QMJ A;  4XW3 A;  4DUV A;  2X8K A;  2WS9 3;  5A1F A;  5CKN A;  2VZS A;  5F2S A;  5EFU A;  5FZ8 A;  1EAH 2;  4W50 A;  4FTS A;  2GNT A;  3N35 A;  3J7L A;  2FDF A;  4RHV 2;  3VBU C;  1Y9Q A;  3NAP C;  1X9P A;  3CJI A;  4GJY A;  2XLG A;  3CMG A;  3BTA A;  4Y1Y A;  1VBE 1;  4EWD A;  4MGI E;  4CDU C;  2F6B A;  1KQR A;  3WHT A;  3WNK A;  5J7M A;  4ZHN A;  3AFG A;  2D6M A;  3SKJ E;  5E6H A;  1GAN A;  5T5L A;  1WMD A;  4R52 A;  5BNN B;  2ID4 A;  1CVN A;  1JXN A;  4EN0 A;  3OGS A;  4P9X A;  2WNO A;  3C7H A;  5LA0 A;  1H2M A;  2Y60 A;  2XVL A;  4ZU7 A;  1A3K A;  1AL2 2;  2P6C A;  2YPD A;  4RHV 1;  4XMA A;  1FAT A;  4RGA A;  4L11 A;  2JD4 A;  2EXJ A;  1ASJ 1;  1VMF A;  3H8X A;  4UW3 A;  2GSY A;  4LA3 A;  1SG3 A;  4GB3 3;  2DVF A;  2PYT A;  2VNV A;  1J1T A;  4BCU A;  2WZR 3;  4Q4V 2;  4YGD A;  4QDR A;  5FLJ A;  3FUQ A;  1JOP A;  3I2O A;  4XAE A;  2IFW A;  3WP4 A;  4KL1 A;  3ZYG A;  5FPB A;  4YM0 A;  4C1W A;  1QDC A;  2YBP A;  1PGW 1;  3C7F A;  4JTN A;  2Z79 A;  5C6C A;  3A7Q A;  2H6C A;  2ZKL A;  1I3H A;  1VR3 A;  1DP0 A;  2VUA A;  2WAA A;  5FPV A;  3ZMN A;  3SMH A;  4OUM A;  4Q4W 3;  3AZY A;  4IND A;  1I1E A;  5C4W B;  1XNB A;  1M06 G;  1OQ1 A;  3VL9 A;  3LFM A;  4UBH A;  4LHS A;  4Y20 A;  4OMC A;  3ZXE A;  4GWM A;  4UW6 A;  3KZ4 C;  2VTF A;  4BQY A;  3CNA A;  2WZR 2;  4Q4V 3;  4AI8 A;  1OUX A;  1VPH A;  1AR9 1;  1R08 2;  2HWF 3;  3JZV A;  1K5M B;  2XON A;  4LBN A;  5B4X A;  4AVC A;  4Y5T A;  5FK8 A;  3AZZ A;  1PIV 3;  5KHH A;  1Q5O A;  4MXW B;  2XG3 A;  1QJY 3;  4XFB A;  4NHK A;  3N9M A;  1RVF 2;  4CCC A;  2VW1 A;  1UZV A;  4FQ4 A;  2RDS A;  4CEY A;  4X6R B;  4YW5 A;  4Q0U A;  4XAC A;  4AZZ A;  3WDX A;  4AW7 A;  2B45 X;  2R04 2;  5DAQ A;  3O0W A;  1G9B A;  4BIS A;  4QM9 A;  1LHV A;  3RI9 A;  3VDB A;  2NP0 A;  5FP8 A;  1C3H A;  3B3Q E;  4RSU A;  1ND2 A;  5FZ1 A;  4XUN A;  2RR1 2;  4CPB D;  4B1M A;  4QXK A;  1ULD A;  2JG9 B;  5FV3 A;  2JG8 B;  1R09 3;  5K0U B;  1LOG A;  5IVB A;  2K2S A;  1VRH 3;  4N43 B;  2VZU A;  2HYX A;  2O1Q A;  4CDW C;  4GQ7 A;  5FXZ A;  4YZ5 A;  5DAB A;  4EQV A;  1W8U A;  1F2N A;  1SZB A;  1RHI 2;  3R6S A;  4AEK A;  5EXO A;  1LOA A;  3WLU A;  1HV0 A;  4A7K A;  1OLM A;  1UU6 A;  1V9U 3;  4FOW A;  4AEJ A;  1NT0 A;  3N7J A;  3T4H B;  1CJD A;  4M4R A;  1MPX A;  2BNM A;  4LLF A;  1JZ5 A;  3M3E A;  2YGM A;  4XBL A;  4A45 A;  4CU7 A;  5BNQ A;  4GH4 C;  2CDO A;  3MHZ A;  1G9F A;  4QDS A;  3FLT A;  1C8M 1;  5C3Q A;  4W6X A;  3M2M A;  4WVM A;  2VOK A;  4CP9 A;  5IVV A;  3W20 A;  1QWR A;  4ZU5 A;  3ILR A;  3FHQ A;  4ZS3 A;  2YFU A;  4XF3 A;  1AL2 3;  2K9Z A;  2OZJ A;  1W9S A;  3HN3 A;  3LSE A;  2QCS B;  3PIJ A;  2HEY F;  4MGZ E;  5FQ0 B;  3WQ7 A;  2MEV 1;  1PM4 A;  3EBR A;  5FRE A;  1RUN A;  4GD4 A;  1YYN A;  1CD3 G;  5D8A A;  3WF1 A;  2ZGN A;  5B4N A;  2JEM A;  3AFK A;  3AYC A;  4AFD A;  1OOP B;  1YFW A;  4XFG A;  4QKN A;  3A0N A;  4PLN A;  3EJK A;  2JG9 A;  5EP9 A;  3WCS A;  4BMB A;  3M8L A;  2VMI A;  3MPB A;  2I45 A;  3NVC A;  1Y7B A;  4HK8 A;  3OYW B;  4ORF A;  1AYM 1;  4J1W A;  4RR3 C;  4JCK A;  4YW1 A;  1RUC 1;  2DVB A;  2EIE A;  3TNP B;  5JZG C;  1QOS A;  2WQ4 A;  1N1V A;  3LOB A;  1MAC A;  3ZX7 A;  1LGN A;  2RG4 A;  1H2N A;  2EA7 A;  4D6R A;  1OFS A;  2G9F A;  3AP7 A;  3AM2 A;  2RS3 2;  3QOP A;  3VZJ A;  1O5L A;  2Q4S A;  4W8J A;  1RUC 2;  1X9T A;  2HKX A;  4LK7 A;  2W3J A;  1W9F A;  3I3Q A;  4LBJ A;  1D4V B;  1OI6 A;  4COY A;  1CAW B;  4KWK A;  3VZN A;  4LT5 A;  3W5M A;  1UYZ A;  4P02 B;  5A3T A;  2VCM A;  1QNW A;  1W2A X;  5L9R A;  4CCN A;  1DG6 A;  1KJR A;  3UGH A;  3UES A;  4QB6 A;  4R4Z A;  3S6P A;  2IZW A;  1YXW A;  3PVO A;  1VJ2 A;  1LOF C;  1HDK A;  4M0N A;  4O7X A;  4NE9 A;  4JGY C;  2PHL A;  3ZFG A;  5DN2 A;  2IXC A;  2E7T A;  5C7G A;  1IG0 A;  1HQW A;  1X82 A;  2JWP A;  3I3E A;  2XLF A;  3POE A;  1EV1 1;  3VBO B;  2WNU A;  4UFM A;  4AI9 A;  3VHR A;  3GHN A;  2A75 A;  1TE1 B;  1ZRI A;  2D6K A;  1RUO A;  3WW1 A;  2ZGP A;  2WZ8 A;  5FOJ B;  1SLC A;  3JBG 2;  3WXP A;  4Q4W 2;  4D0Q A;  4CDQ B;  5EYX A;  3JQX A;  1H1A A;  5CZK A;  5T55 A;  1NYW A;  3GZE A;  3ZKU A;  4QPG B;  4XIK A;  5JI7 A;  1HRV 1;  3UGF A;  2CWM A;  3NAP B;  1CAU A;  4ZPI A;  2Y8K A;  1R1A 1;  4OI0 A;  2W1U A;  3CJX A;  1YCI A;  4YW3 A;  4AVB A;  5C8W A;  1D2S A;  4HOO A;  4YW2 A;  1TEI A;  3BPS A;  5LBB A;  1VBE 2;  3DEM A;  3VL8 A;  3HQX A;  1I5Z A;  1VBB 3;  1YI7 A;  2ES3 A;  1W6N B;  3H9A A;  3INA A;  4XF4 A;  5A33 A;  2PHU A;  5A33 B;  1GV9 A;  4W4Z A;  3JBG 3;  4XQD A;  3CF6 E;  5IYY A;  4LKF A;  4CA9 A;  5A3O A;  2OPK A;  3IN9 A;  5A7O A;  3HT1 A;  1T6B X;  3ZKY A;  4AQ2 A;  5FYV A;  1L7L A;  3PU8 A;  4GUL A;  2VCA A;  1GLH A;  3FN9 A;  4PLO A;  4PT6 A;  5FYU A;  4EN6 B;  1NCR C;  3LPG A;  4S2G A;  4E27 A;  1HRV 2;  4FPC A;  4ATE A;  1RUD 3;  2I2S A;  1DQ4 A;  5I0U A;  2YC0 A;  5GZG A;  4PQ9 A;  1G9A A;  4YNI A;  4YVS B;  1H9P A;  4LNV A;  1N47 A;  4MH0 E;  4BWO A;  1MR5 A;  4D94 A;  2DCT A;  3OGG A;  3E6C C;  2HBU A;  2YFZ A;  3DEC A;  1JUH A;  5DAW A;  4H14 A;  3WNP A;  4M3C A;  4HZF A;  4IEQ A;  3WDV A;  4DFS A;  2P34 A;  3WNM A;  3BAL A;  1EYB A;  1NCQ C;  1W9W A;  4K8R B;  2B7Y A;  4D6S A;  2HWD 1;  2BUK A;  2HBT A;  2Q1M A;  3THD A;  5F37 A;  4MLO A;  3ZXA C;  3EXU A;  1QJX 2;  2DVG A;  1JYX A;  4FTE A;  2GZW A;  1W9Y A;  5CU1 A;  3KGZ A;  5LK5 A;  5A6Y A;  1OH3 A;  1GNH A;  3KCC A;  4YGB A;  4Q0P A;  4DO0 A;  4YFZ A;  5GZC A;  5FMB A;  2QUO A;  1XBF A;  1NKG A;  1X8M A;  2D6P A;  4QQO A;  5A3U A;  1AR9 3;  2Z2S B;  4MG2 A;  4MGT A;  4V1P A;  1NA1 A;  4L92 A;  3CBN A;  4Q4Y 1;  1LGB A;  3HR9 A;  1DHK B;  3WHU A;  5ABJ B;  4K40 A;  4AHZ A;  2BZD A;  4BIF A;  1UOB A;  2WDB A;  4S2F A;  3I3D A;  1TZO A;  3K75 B;  3HNB M;  2C9A A;  3J9S A;  3VBR B;  3FUO A;  3MYX A;  3QD6 A;  4Z07 A;  3LF7 A;  1G6N A;  4HSJ A;  2X05 A;  5FTT C;  3SC7 X;  1XB9 A;  1AYM 2;  5FUN A;  4LEJ A;  3ZN5 A;  3C8X A;  2AEN A;  1Q3E A;  1SFP A;  2B42 B;  4E4S A;  3HNM A;  5J37 A;  4HKO A;  4E9K A;  2ZHN A;  4IEX A;  4LBL A;  4LTA A;  1XU2 A;  3WOG A;  1UYX A;  4BA6 A;  1V6I A;  3NNF A;  4C90 A;  1V70 A;  1SDW A;  4YG3 A;  2WO1 A;  2MEV 2;  3WD5 A;  3N9Q A;  2WC2 A;  3E6B A;  3FFQ A;  3PVB B;  1HX6 A;  1N1T A;  4LHN A;  5GLU A;  2QDN A;  1BBT 1;  2HEW F;  2Q30 A;  3MIG A;  4IV1 B;  3FHI B;  2ADE A;  4PI0 A;  3RZK A;  5D1I A;  5BNP A;  5JAX A;  4CCM A;  3WF3 A;  1SAC A;  5C8C B;  1ZNP A;  1FMD 1;  3NNG A;  1H9W A;  4Q29 A;  4URA A;  2L9L A;  2FDK A;  1BBT 2;  1MEC 3;  3B69 A;  3EMR A;  3LFI A;  1ND2 C;  1YIF A;  4B7K A;  4TWT A;  1RXG A;  2WBK A;  3QAC A;  3WZ1 A;  3U0Z A;  4LOT A;  2Z69 A;  1A8M A;  1ZZC A;  1YNA A;  2CGN A;  4MGS A;  4WM8 B;  1AR6 3;  3V65 A;  1ZRR A;  3ZFE A;  3VBH A;  1DF0 A;  3CHX A;  3D0S A;  3C7G A;  2MPF A;  3JD7 1;  3OBA A;  4YVS A;  4AI1 A;  1O3R A;  1JYI A;  3KWV A;  4XDP A;  3MLJ A;  1BQP A;  1XC6 A;  4MXV A;  1XU1 A;  5D21 A;  3N9N A;  4NMI A;  1S0F A;  1Q8O A;  4CE8 A;  3KMH A;  2WSV A;  1JOD A;  1PNG A;  3LCP A;  1UXZ A;  4QPG C;  3RYK A;  2ZGM A;  5F3C A;  5BNN C;  2G9G A;  4XJW A;  3VV1 A;  5KHG A;  1K3I A;  3ZN6 A;  1RUF 1;  1HKD A;  1FYU A;  2PAM A;  3FJS A;  3TYJ A;  1VBC 3;  2RDN A;  2XH6 A;  3ME2 A;  4HG6 B;  4MHR A;  5FLH A;  3H3Z A;  5A7W B;  5BV6 A;  4XUT A;  1SBD A;  2XQR A;  3N7M A;  3AC0 A;  5KXB A;  4RD7 A;  4K1Z A;  1E5H A;  1O3S A;  2Q8O A;  4GAZ A;  1MVE A;  1F4H A;  2ORX A;  2Y6K A;  4WM8 A;  4L9B A;  5FY4 A;  4COU A;  3RDI A;  1Y3T A;  2UY8 A;  1D0G A;  3J4U H;  3USS A;  4CPB A;  4N8M A;  3ALQ A;  2WL1 A;  2W5F A;  4XC9 A;  2PHT A;  2VJX A;  5JMO A;  4OQ8 A;  3R05 A;  3FFZ A;  1SCR A;  3K51 A;  5F5A A;  4KMQ A;  3VDA A;  3I49 A;  4LO8 A;  1CQ9 A;  5HBA A;  2ATF A;  4XVH A;  3AXE A;  2VOT A;  2D3R A;  4Q1P A;  1H8T B;  3NMB A;  4NJ4 A;  2EIB A;  1COV 1;  3UT0 A;  5I0D A;  5BUV A;  5C9A A;  1K42 A;  1AJK A;  1RGS A;  5AC9 3;  2BU9 A;  2HEV F;  2WLQ A;  3IAQ A;  1PK6 C;  2G9Z A;  1HN0 A;  4BQ3 A;  4XBQ A;  1CAX B;  2QQJ A;  3A4U A;  3HBK A;  3KS7 A;  3L2Y A;  5FWJ A;  2W1S A;  1O8P A;  1SQ4 A;  2HWE 2;  4SLI A;  1UZZ A;  2Q8E A;  4BQ4 A;  1AXZ A;  1UX6 A;  3DGT A;  4GA9 A;  4RFT 0;  1HXS 1;  1RUE 1;  3AK0 A;  3B93 A;  2TNF A;  4OHX A;  4Y4R A;  4YVW C;  4D8M A;  3OBR A;  3I2D A;  4JGY A;  4BQW A;  4Q27 A;  3N4M A;  2R06 2;  4FXG B;  4XJU A;  3S7I A;  3CEW A;  2VPV A;  3PNA A;  1OA4 A;  4KGQ A;  4V2W A;  5T54 A;  5AC9 2;  4XZP A;  3WDY A;  4H55 A;  5J96 B;  1MQT B;  1AYM 3;  1MS9 A;  2DUP A;  3BOD A;  2ARB A;  1KFX L;  1JZ3 A;  4KBZ A;  2PEL A;  4ITC A;  1JZ6 A;  4JTO A;  4N43 A;  3VUO A;  4PDW A;  4K3U A;  1OLQ A;  5JLV A;  1LAJ A;  4I3P A;  3LB9 A;  2JDN A;  3OUI A;  3VBF A;  1JZ2 A;  1W99 A;  1TME 2;  2MNG A;  1YC6 1;  3FE5 A;  3HWJ A;  1HRI 2;  1SLT A;  2OA2 A;  1H8T A;  2RS5 1;  4KWJ A;  4CYD A;  1CN1 A;  2RS5 3;  1DQ0 A;  3QH6 A;  5L7O C;  3WR0 A;  1FOD 1;  3AVS A;  2FZ1 A;  4J6G A;  1W6Q A;  5CIS A;  2HWB 3;  5J48 A;  1DQ5 A;  1BBT 3;  1MEC 2;  1PM7 A;  4GMP 1;  3IKW A;  5LBE A;  3WX5 A;  5FXX A;  1DYP A;  4P14 A;  4YAR A;  4BZ4 A;  2GC0 A;  1NCR A;  5G04 L;  5BNN A;  2VQ0 A;  4QHZ A;  4AK3 A;  2PHD A;  4EN9 B;  2QQL A;  1JZ4 A;  1XSR A;  4K21 A;  1QJX 1;  2E6V A;  5GLW A;  3AJY A;  1ND3 A;  2WFF 2;  5IAV A;  3CJI B;  1HN1 A;  1FX5 A;  1TMF 1;  5LBC A;  2CTV A;  3T2O A;  2W94 A;  1TMF 3;  1QJY 2;  4ZXE A;  4BM8 A;  5C33 A;  1B35 B;  1RUH 1;  2LM3 A;  1ZZ7 A;  1UU4 A;  1PGL 2;  2DWR A;  3K77 A;  3ETQ A;  4OI4 A;  3CKH A;  3NAP A;  1S4C A;  1AF9 A;  5CFC A;  4Y3O A;  3POJ A;  3AX4 A;  4YG0 A;  4N53 A;  4Z2W A;  1UZW A;  1PZ8 A;  5JXG A;  5FZA A;  1U5Z A;  1W2N A;  1IKP A;  3HT2 A;  3KLS A;  4Y1X A;  3BTY A;  5FUI A;  2WYF A;  4JKL A;  4D7S A;  1C4R A;  1UMZ A;  2ET1 A;  3AYD A;  3OGR A;  3EO6 A;  3A22 A;  5EQU A;  4AAX A;  5LWB A;  1ENX A;  4RQP A;  2A73 B;  3HIF A;  3OJB A;  4Y20 B;  1E5R A;  3MIH A;  2ZMN A;  4OQ9 A;  4K20 A;  3BU0 A;  4ET7 A;  5CFC C;  1OPO A;  4AR2 A;  4E4H A;  3LKJ A;  1BYH A;  5A3N A;  4CEW A;  3F2Z A;  5FZ7 A;  3BPZ A;  4XZU G;  3SCH A;  5DAP A;  4ZZ5 A;  2QQV A;  1K45 A;  4HXC A;  2ZTN A;  3HQR A;  4Y24 A;  5LEK A;  4Q4W 1;  1VBD 1;  4IUG A;  5DDJ 3;  4FPE A;  4XUR A;  1KFU L;  2W47 A;  1D4M 1;  1HW5 A;  3J7N A;  3QCW A;  5I0R A;  2JIC A;  4IV3 A;  5F5I A;  1LOC A;  4AE2 A;  5BYN A;  5KR7 A;  4XET A;  1LU2 A;  1GZ9 A;  1NA1 C;  4CU6 A;  2VUD A;  4BOW A;  5C8C C;  4YRD A;  3I2F A;  2HWF 2;  1YJL A;  3UK9 A;  2OKX A;  2VGD A;  3ACL A;  5L36 A;  1BHG A;  1IPK A;  4PI2 A;  1JOJ A;  2HLE A;  4XHX A;  3I59 A;  5EPA A;  2LAL A;  2V09 A;  1D7P M;  1WBL A;  5C5T A;  3DXU A;  2D40 A;  2EXI A;  3P3N A;  3LA7 A;  1CES A;  1ST8 A;  5F8P A;  3VBH C;  3P5B A;  1APN A;  1E5S A;  4Y22 A;  5FP7 A;  1ODM A;  3R4D B;  4Z82 A;  2Q8D A;  1CON A;  1RED A;  1QU0 A;  2XJQ A;  3T2P A;  5FZB A; 
#chains in the Genus database with same CATH homology
 2KR2 A;  4BQ4 A;  2JWP A;  1GWL A;  1W8T A;  4YW6 A;  4AL9 A;  4CP9 A;  1WMX A;  4YW7 A;  2LRP A;  2LRO A;  3F95 A;  4A6S A;  4LKD A;  4LK6 A;  4LKF A;  4LK7 A;  4CPB D;  1W9F A;  3ZYH A;  3ZYF A;  1L7L A;  4BQ5 A;  3ZYB A;  2Q1F A;  1OH3 A;  1W8W A;  1W90 A;  1W8U A;  1W8Z A;  1V0A A;  1WZX A;  4CPB A;  3UT0 A;  3ORJ A;  2O14 A;  2K46 A;  5D21 A;  4CP9 B;  2VXJ A;  4LKE A;  1GWM A;  4LJH A;  1WCU A;  1OKO A;  4BQ2 A;  1HN0 A;  1GWK A;  2C24 A;  2WYF A;  4BQ3 A;  4YWA A;  1UOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...