1WZXA

Crystal structure of family 30 carbohydrate binding module.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
RKLLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
total genus 35
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wzxA00
2K46A 2KR2A 3ORJA 2LRPA 4LK7A 2O14A 2WYFA 3UT0A 4CP9A 4LK6A 1OKOA 3ZYBA 4CPBA 4YWAA 2LROA 1V0AA 4YW7A 1L7LA 5D21A 1OH3A 1W90A 4BQ2A 4A6SA 4CP9B 1GWMA 3F95A 4BQ4A 1HN0A 1WCUA 2Q1FA 1GWKA 4BQ5A 2JWPA 4AL9A 1W9FA 1W8TA 4LJHA 3ZYFA 1GWLA 1W8ZA 1WZXA 1W8WA 1W8UA 4LKDA 1WMXA 4LKFA 4YW6A 3ZYHA 4LKEA 4CPBD 2VXJA 2C24A 1UOJA 4BQ3A
chains in the Genus database with same CATH superfamily
5JOXA 3ATGA 1W05A 4AE2A 4P9IA 2XH6A 4HN1A 4QGLA 3AK0A 5E16A 5EHDA 5AVPA 4AQSA 1KXGA 3GCWA 2B39A 3FUOA 1NOVA 4E4SA 2RS13 5IVVA 2ZGQA 1QJY2 2ZX2A 3R6SA 2RDQA 2SLIA 4FOWA 1HIXA 4AXOA 2NP0A 3Q8FA 4YM3A 1UZWA 1ZNPA 2QBXA 4Y4RA 5A7WB 1DG6A 4AGRA 1AR71 2HYKA 2LUWA 1HRV2 4PIZA 3VBHC 3FBYA 1OBNA 1W2OA 1AJOA 3WCRA 5CFCC 1AL22 3HEIA 2XQRA 2QQLA 4UWDA 2K46A 4WVVA 2ZKLA 5J1XA 4QX1A 1ZREA 4DPNA 4BU2A 3ZPYA 2DTYA 4ZY9A 4QX2A 1RUI1 3MIEA 3ES4A 3VD4A 1XOYA 5F37A 4M4PA 1RUH3 2VTFA 3E5UA 1PM4A 3D0JA 4G9SB 4BQYA 1X9PA 4L0PA 1JUHA 1YFWA 2A70A 4BQ5A 1GSLA 2HWB2 4BLIA 4FTEA 4B29A 1XSRA 5IVCA 1U5IA 4BIOA 4ES9A 5A6ZA 1JZ4A 3HT2A 2WNUA 4K6BA 4AVTA 1ZYBA 5IVJA 4XFAA 4P00B 3ENRA 4DZGA 3RI9A 1OQEA 2CSGA 2QQWA 2WS92 4O9GA 1UCXA 3WNOA 4BQWA 4UBGA 1IS4A 3LB9A 3QLQA 2VG9A 2VTXA 1WD3A 4AFAA 3HVDA 4YFZA 1XNTA 1W3XA 3D5OA 1RUD1 3NKGA 2JG8B 3ALQA 1JYCA 1QXRA 1RHI1 1RMU1 2PHWA 4E2GA 1EPWA 4LNVA 3POFA 5A3PA 2QQMA 4GMP0 4RR3B 4RGKA 4IE5A 3HQRA 4B7KA 1AYN1 2D6LX 5EV7A 4ONUA 1N1TA 1W8WA 4FFHA 4FOVA 4YGBA 1US3A 4JKKA 5LK7B 2WZEA 3H3LA 5LCWL 4AVBA 3SISA 3VBUA 1UIKA 2E7QA 2FDKA 1GZ9A 2PELA 2XONA 3LA2A 3OD4A 4QX0A 2HKXA 4QX5A 5KHIA 2WT2A 2R063 5HCFA 1RL3A 2BZDA 2FDGA 1JUIA 3UJQA 3AZWA 2DYCA 3C7OA 3LPGA 4AK3A 1RUC2 3QD6A 4NHYA 1VB4A 4QHZA 2IVJA 5HCBA 2QJVA 4PDWB 1QJFA 2OYZA 4OQ9A 4JGYA 2VUDA 4ISQA 1MPXA 1YXWA 3VKLA 3ZYJB 1AHSA 3BALA 3V0AB 4Z2WA 2ARAA 3VD9A 4R4XA 4DXTA 2G19A 1AXYA 2WO2A 2B8MA 4QM9A 1CGPA 2R6QA 2RR12 4JVAA 4P9XA 2LTNA 4XAEA 3I2JA 5A3TA 3NKTA 4DMIA 3JU9A 1D2QA 1PX4A 1VMJA 1VPHA 1ZBE1 2P1BA 5C33A 3OUIA 4XF3A 2DTWA 2UU8A 3H8XA 4KGGA 5FK7A 3I59B 2XJUA 2W95A 4IEXA 3J7LA 5LA9A 5FOBB 2G9ZA 4JGZC 1VRH1 1YEWA 4FCAA 1AYM2 1O3TA 3MIFA 1QKQA 4GXLA 5DABA 1DQ5A 2DCTA 2WIIB 4RFRB 2VUJA 3H7JA 3TN91 3WQ0A 2HEWF 4JRAA 5JZGC 3IIIA 5IFTA 3NNJA 4UXAA 5TSWA 3RWKX 1ULCA 1TNFA 3K75B 2VH9A 2D3RA 4XMAA 5FPXA 1Z7S3 3RZKA 1Y9QA 2E9QA 3U14A 2GAUA 4QKDA 3OSDA 4N43C 1NLSA 1OA3A 2W1UA 3T0AA 4DFSA 4GQ7A 3KT7A 2PHXA 3AMHA 3RNSA 3SCHA 5C4WC 3AYCA 1GU3A 3WT3A 4AEJA 3U1XA 1SDDB 4P08A 2RM23 4HG6B 4YZ1A 4M3CB 2DFCA 2R043 2J1TA 1AR91 1K3IA 4ZONA 2H0BA 5FMCA 1WMEA 5DUVA 2QQOA 1BLZA 4OZOA 2B46X 1YC61 1CVNA 3FX3A 5J98B 3KCYA 1Y43B 3NRUA 4FXGB 1FT9A 1R081 3WF1A 1WMDA 2QDRA 1FOD3 2R32A 2HWE1 1RUG3 2WZR3 3AFKA 3VDDB 5BNOB 2ZAAA 4CU8A 1NQJA 3I2OA 1AF9A 1W8UA 4TSVA 4Y5TA 3WINE 3MV11 4Q4Y3 3IIAA 1F35A 3FHQA 4N7UA 4Q4W1 5JPNB 5F1RA 1L7QA 4NROA 2VCBA 5EPAA 4HK8A 1CAVB 2VW1A 3DXUA 4TZDA 2UYAA 1E5SA 2GC1A 1OFNA 1LHVA 1YLLA 2L9LA 5ACA1 5K7PA 5KC5A 4I3PA 3POJA 4HKWA 1VE0A 4K8FA 2YROA 3CBNA 5DDJ1 3IDCB 2GH8A 5APAA 1RUF2 1TE1B 2V5DA 1LB2A 4X6RB 5GLTA 1AR62 2VNRA 4N53B 2Q30A 3POWA 4E4DX 1IS5A 5A6XA 4DOUA 2P37A 4RHV3 3WX5A 3ZKYA 4LOSA 1W8TA 4Q4V2 4AVCA 5KWRA 3LZZA 1DYPA 3BKZA 1GWLA 2AUYA 2IC1A 4OQ8A 1PGSA 1CONA 2CY6A 3EHKA 2YU2A 5IK7A 2QNKA 2Z4FA 3UGHA 4CVUA 4K21A 3Q9OA 4N9HA 2XLAA 3PIJA 4MO3M 2V4AA 4V2WA 5E6HA 4FQZA 4AAXA 1WBFA 4ARYA 1ZA7A 3T09A 4RQPA 4UF0B 1R1A3 4M01A 4Y22B 1MS9A 3WD5A 3KMHA 3LCPA 3IDBB 5FYHA 5FZOA 4CDXC 4GMP1 1HXS1 1GZWB 2RE9A 5BYNA 1W6QA 2Q8CA 3J8F2 4HLTA 1D4M1 4RGGA 5A7QA 1W2UA 4LBMA 1PHMA 2VM9A 1A8MA 3GXUA 4FOYA 2QQNA 3MF9A 1LEDA 1V9U3 1FPN1 4KWJA 5ANNA 1SFPA 3ZYFA 1YNAA 1W8ZA 2KD7A 2ES3A 5T5LA 3GHNA 3CL1A 3NV1A 1QNYA 3VUOA 3VZKA 1G86A 2YFUA 1OC1A 5E88A 2Y6LA 5K0UA 1OA4A 1LHWA 3SH3A 2GU9A 2VD7A 3AKRA 5F2WA 2JB8A 1XYNA 4JHZA 1LODA 4S2GA 4FOQA 1UY0A 1OQ1A 1BBT3 3DECA 4KWLA 5GLVA 3ZR6A 3N4MA 2ZZJA 3GZTB 2VVEA 1GBGA 4A6SA 1PVXA 5SV5A 5BNNC 4PQ9A 5FRAA 4B1MA 2ERFA 2O1QA 1GQHA 1YRZA 2WBKA 3VBSA 4A2UA 2HJIA 4Y20A 5A6YA 5JR2A 1CJDA 3HNMA 1QJU1 5B2GB 4KU7A 2DFBA 3VBFA 5FZFA 3ZLIA 5FYMA 4BCUA 4EJRA 1S0JA 3B7MA 1FMD1 1QJX3 3VBRB 1NCQA 1UZYA 1DLLA 4XBLA 1PNFA 3IMMA 4WVMB 4JDNA 1TMF2 2ORZA 2DVAA 3VHRA 1YFYA 1ASJ1 3ZYPA 2WN2A 2WFF3 2BWAA 5A33A 2R1BA 2FBEA 5L7OC 2X5IC 4Y4YA 1VJ2A 3LIGA 2X10A 1VB2A 4PJYA 3H8UA 2JDZA 1P8JA 1I9RA 1HRI1 3KGLA 2GMEA 4IGPA 4XJ8A 1SBEA 2VQTA 3CNAA 1UY1A 4I0AA 2AR6A 5LBBA 3VGIA 3ZXFA 4HVRA 1BMV1 4BIFA 5FQ0A 5FYIA 1OVPA 1LRHA 3P6BA 2G4IA 1YFUA 1LAJA 4X8NA 1XE7A 4LKEA 5BY5A 2WO7A 5C9AC 5CAZA 4OHWA 2ZABA 1TZOA 1Y9GA 5D8AC 1KDMA 3OGVA 1I6XA 3POBA 5I8TA 4W6WA 2YV8A 4XUPA 1OLMA 2WINB 4FP3A 5FY0A 4YPJA 4IV1C 3TNQA 1D2SA 5FP7A 2OQ6A 4OHVA 1UIJA 4XF1A 3FBMA 3IM0A 3U07A 4URAA 1WWYA 1DBNA 2JDNA 1TME3 3N9MA 5GLUA 5LK5A 2F6BA 1ZBA1 4AVVA 4IEQA 2RDNA 1US2A 1WCUA 1XXNA 1AR82 2HWD1 2ZX1A 1BVVA 3AM2A 4CP1A 4CZSA 2W46A 3O1OA 2PHRA 1AL21 4XFFA 5F6LB 2IFWA 3FE5A 2RJ2A 1WCSA 4HPKB 1DFQA 1QWRA 5H9QA 3RYPA 3UGGA 4PF1A 1VBA3 3RJRA 4DO0A 1V6NA 1WW5A 4Q27A 1PM7A 2XJSA 1PO23 2TEPA 4LK7A 1E5HA 5JCTA 3WQBA 1WCQA 2QTWB 3UESA 4IQPA 3DPRC 4B7EA 1PIV3 3KQ4B 2A73B 2JE8A 1MQTC 2BGCA 2ZEXA 1KJLA 1S0EA 1OF4A 3WHTA 4UFHA 1DQ0A 3S30A 4RS5B 3NNFA 3D3AA 4WM8B 1NLRA 2JDUA 4C0HA 2GNDA 2VBBA 3VZNA 5LA1A 1OLRA 2XKOA 2WS91 4UYBA 4W65A 5HCHA 3PJYA 3S5AA 4BHPA 3ZR5A 2RG4A 2WWSA 5FP8A 3TYJA 1NKGA 2F17A 4TYSA 3ZFFC 1AR72 2JG8A 2W68A 1Y9MA 1NXMA 2XVLA 1ULOA 2YG0A 3O14A 4RR3A 4NN0A 3LSEA 4KNCA 2DWRA 1U5XA 1V6JA 4LXLA 1G9DA 1Q56A 4LPLA 1BK1A 5LWBA 5EJZB 5GLWA 5HCAA 3ETPA 4CCNA 3T08A 3EXUA 4IEPA 4FFIA 2XDVA 2VCMA 3PMSA 2E32A 2CL2A 1W9FA 1YWKA 2Y38A 1XBFA 5FPAA 5I93A 1PMHX 3IDEA 5A7NA 3VHNA 1I5ZA 1DGWX 1QH6A 2DUQA 4QQPA 3URFA 1PO12 1IQDC 5FXVA 5I91A 3WNMA 3LEIA 4BH9A 1RUC1 1Q8SA 3FLPA 3NW4A 2LRPA 2JDKA 3TEXA 4GH4C 1RUNA 2RMU3 3PUSA 4XQWA 4NR1A 1POV1 4PDWA 1S4CA 5F6KA 2WWUA 3USUB 1F8VA 2ZEYA 3OJBA 3V56A 1UOBA 3WUDA 5I0DA 1J1TA 1L7LA 2YY1A 2ZGUA 2BW8A 4HL0A 5ABJC 3V0AA 1LGCA 1ND3B 4CCOA 1QOTA 2FDIA 1GWKA 2BVVA 4XVHA 2J1RA 1IPJA 4CSWA 4GIQA 3R0RA 4LO5B 2QZ2A 5CFDC 1QY4A 2HWF2 1RHI2 2WLQA 1RMU2 1SLLA 2CDOA 4M0NA 5A32B 2WYSA 2VMHA 3ZOIA 4P9LA 3ILRA 3S7EA 3I59A 3PUQA 2PLV3 3OBZA 4UT5A 3VN4A 4Z2AA 3UGFA 3ZSEA 4R9DA 4MGYE 5L9VA 3LGRA 4IGOA 1W9YA 4GWIA 2W1QA 2CYFA 4FPHA 1XYOA 1ZRCA 5DG1A 1APNA 4TWTA 4IEUA 3K2OA 2NN8A 3FL7A 4XUQA 3MW4A 4DB5A 2ZAHA 1W0PA 1JOPA 4XFCA 2DCYA 2MEV3 2NZ9A 1T2XA 3O1MA 1MEC3 4FAHA 4YGDA 4LQRA 1OMIA 3NWKA 3P5BA 2FZ1A 2VZSA 2JDMA 1UX6A 4M0HA 3TNPB 1RUOA 1PZ9A 2JKXA 3JQWA 4YGCA 4EN6B 1V6OA 4Q0UA 1W6OB 5DQ0A 3MIDA 3DN7A 4JV4A 4M3CA 2WQ4A 4OHXA 2ZGLA 2VZ3A 3AVSA 3WDWA 2Z5WA 3ORJA 4AYUA 2O14A 5FPUA 2D5HA 1CWPA 3ZN4A 2W91A 1CZVA 4XFIA 5FZ0A 3Q8AA 2Z42A 1JOJA 1VBC3 2G1MA 4OYUA 1H8VA 3LA7A 1B35B 1C1LA 1F15A 2GC2A 3KS7A 3ACHA 1NE4A 3VDDA 1POQA 4H2AA 3ZXKA 3R4SA 4HK9A 5BNOA 3KT4A 4EZ4A 3AP5A 2XJRA 3VZLA 3G6JB 1UWWA 2N7GA 2WNVC 2R0FA 3I7DA 3INAA 3WW3A 1VRH2 5J7MA 5FBZA 5I8SA 4A7YA 3PUIA 1BYHA 2VOXA 1CAVA 5A70A 5C6CA 1YYNA 1RXGA 4PLMA 3O1UA 5A1FA 5FYSA 3I3DA 3KHCA 1C5IA 5KXBA 1FYUA 1NA1C 3HNYM 1PVC3 2ADDA 3HN1A 3BPZA 3ZSKA 2JIGA 1KS5A 3N3HA 5DAWA 1FNYA 3WDUA 5JXGA 4R9AA 5IUQA 2BRTA 5C71A 1Y7BA 4N53A 3VBHB 4DQAA 5JAXA 4KG0A 4XILA 4WM7C 3OY8B 5CFCB 3BTXA 3W59A 3WF3A 4IUGA 3BI3A 1JBCA 3ELNA 2PHUA 2PAKA 3AZVA 1JZ6A 4CXYA 1AR92 3GZUC 3OOXA 2EAKA 2J1UA 2E31A 2GP3A 4Y1YA 3LKJA 5BUVA 2VZVA 3USSA 5C3OA 4GWMA 1JHJA 1VBE2 1R082 1OD5A 2VPVA 3WVJA 2PMWB 2BNNA 5KC6A 2VZ1A 4AEMA 3PUAA 2HWE2 5BNPC 4OI0A 1MVQA 4UF0A 5C5UA 4Y22A 2O8QA 4HZFA 5FYUA 2FMYA 2VULA 1GZWA 1X9TA 4J1WA 4Q4W2 3AMMA 5DZFA 3VZJA 4FTSA 5LA0A 3J8F1 4IGQA 5CZKA 1EUUA 4AGVA 3UK9A 1HB1A 1ZZ6A 5JIUA 2JD9A 3THDA 4BDVB 1UU5A 1YCIA 5IATA 3GBWA 3ZPOA 2GZWA 4Q4X3 4FBFA 2ZMNA 4E9KA 2CDPA 1KJRA 3E6BA 4FI9A 3GJBA 1UYZA 4QMAA 3N7JA 4NPMA 4AR2A 2UYBA 3CF6E 5FYZA 2J42A 1OVSA 5F7UA 2QQIA 3MO4A 4QXCA 2FCTA 1UF2C 3LWCA 1NUKA 4JRLA 5GJ6A 2AREA 2BOIA 3EQEA 3SXWA 2V5YA 2W3JA 4D6SA 3JCIA 5C70A 1HJGA 4ZPIA 3IAPA 4KL1A 4Q1RA 4H3WA 1NG0A 1GQGA 4FO9A 1W6PB 5KXDA 1XRUA 2EF6A 3U0ZA 4E2QA 4XFGA 1G6NA 4MX3A 3RRDA 1PK6A 1VAKA 1J84A 3MGUA 1QJEA 3KZ4C 1YJKA 3VBRA 3DV8A 4D7TA 1HXS2 4Q5OA 4BMBA 4LBQB 2V72A 1S0FA 3ZYHA 4A3XA 1VLNA 3ES1A 4Q0QA 5JSOA 4CDUC 2PHFA 5LRSA 1RIRA 5BV6A 2JG9A 2BWCA 1QQP2 4MGKE 1A6CA 3B02A 1FPN2 3CKHA 3KT1A 1EV13 5FZGA 4E8CA 4CCKA 3NJYA 5DN2A 1SCRA 1URXA 4QPIC 1W8HA 2R49A 3HJRA 2EIGA 2VMCA 5EFUA 5FY7A 1MS1A 3M4FA 3PVOA 3SCFA 4MOAA 4BK4A 1QNWA 4GD4A 1OD3A 4M4RA 4LHLA 1MVEA 4CDQB 1CX4A 1EAH3 1GYKA 3BOWA 1ACCA 1DGWA 1LKNA 3IMNA 1BJQA 2BYVE 2DURA 2JWPA 3SNMA 4LHSA 4COWA 3ZYGA 2RS53 4JGZB 4XHXA 4LKSA 4LOTA 4META 3AMNA 1ENSA 2VW2A 2ZA9A 2A6ZA 2VZQA 2ZGKA 1GLHA 1WCKA 2RJLA 4JQTA 4YZ2A 1JN2P 3C7GA 5C5TA 3MUZ1 1C57A 5JZGB 3WW1A 2B5HA 1F4AA 2NYYA 1MR5A 3OGJA 4HOOA 4NWWA 3VHPA 5AC93 5DMYA 1CIWA 5KXCA 4ISRA 1FV3A 5FZLA 1W6MB 1AR81 1ALYA 3GF6A 1OFSA 5L9RA 4N43B 3GZAA 3HIFA 1CJPA 4LO8A 5FWEA 1CIYA 3DYMA 1DDLA 3ZFGC 5C4WB 1XQNA 2BPA2 2R071 2XJTA 1QEXA 2IZWA 3P3PA 4R9BA 1IOAA 3FZ3A 3VBUC 3FN9A 4B8EA 1H0BA 3A7QA 1HRI2 3D6EA 4F7ZA 4CXWA 4F8AA 3I54A 2ZEZA 3OPWA 5IW0A 1PMIA 4YW2A 3ZVXA 1WUVA 5A7OA 1F9KA 2R1DA 2CWSA 2GP5A 4OI2A 4DEQA 1Q8PA 1DU3D 1ZZBA 2A6WA 2ZHNA 4YWAA 4RS5A 4XDQA 5FP9A 4L99A 1SDWA 4Y5Z0 5D21A 2WZ8A 5FO7B 5J3UA 4IV3C 4J25A 5C8WA 4Q8KA 5L73A 1OT5A 5I0SA 3VV1A 2XBO1 5LZ6A 3B01A 1JMUB 3HBZA 1IGOA 2XUEA 4KG8A 2XKPA 4XHBA 1ZBA2 2E7TA 3I2IA 5EYYA 5FYTA 2D5FA 5J37A 3MFCA 4DUXA 1QH7A 2P34A 3OYWA 2HWD2 3C7HA 5EJ3A 5FZMA 3FLTA 1RUI3 5SV8A 5FDBA 3H7YA 1K5MA 4CDWC 3I4IA 2E51A 3CQOA 3I3BA 4AFBA 2BNMA 2FCUA 2R7EB 1CAXA 2AH2A 2JXAA 3J9SA 3L2YA 4YZ4A 2D3PA 4GKXA 1TQ5A 3ACGA 3O5SA 4KGQA 1MS0A 4XJWA 4AEDA 4B3NA 4EV0A 3KF3A 5H9PA 1U5ZA 2BFUL 4A44A 4C1WA 4JDOA 1WGPA 2KA3A 1LU2A 5C8CC 4QM8A 1PO11 3K3OA 2RS11 1UU6A 1HJFA 4QPYA 1F2NA 2PTMA 4LKFA 2DCKA 4CDXB 3USUA 3P3NA 4YM0A 4D7YA 2QQUA 3ACIA 2BERA 4XUOA 3EO6A 2WR9A 5FXWA 5FFOC 1RUD3 4IERA 1JW6A 2W47A 3UKVA 3RZLA 3MLLA 1ND3A 4L11A 4Q26A 4UBHA 2JEMA 2HWC2 5F39A 4BLJA 4NRQA 4COVA 4PIXA 1AYN3 1ZZ8A 4JKLA 2WRAA 3E6DA 2HWF1 4OVEA 1SLBA 1O3RA 3LEMA 5A32A 2Q8EA 4C1XA 2CAUA 4HETA 4QKBA 3VHOA 3GYDA 1F5FA 4MSVA 5FREA 1VBB2 1BQPA 5FTTC 5FV3A 3WQ1A 4LHNA 1RVF3 1W39A 4V2VA 3O0WA 5BNNB 5LW9A 3ZN6B 1I1EA 1V70A 3UETA 1QHDA 2Y6JA 5CKMA 2BEOA 1V6IA 5FZBA 3W21A 1TVGA 3ZKUA 4NPRA 2D40A 1RUJ3 3M1HA 4ES8A 3O1VA 1N3OA 1O8SA 4HONA 2W5FA 2D6MA 3M2MA 2BQPA 3IWZA 1BEV3 3NNLA 3VDBA 3FFQA 1YUDA 2NMNA 3F95A 1S2KA 2ZS6B 1Q8QA 3GJAA 4LBNA 2PHDA 4YZ5A 4DY3A 4AI1A 3LQCA 1XU1A 5L7OB 1JU4A 2X5IB 2DVDA 3X29B 1D7PM 5FZ7A 5JXHA 3O1RA 2FZ2A 1IG3A 1MS5A 5FR3A 1ZBE3 5ISLA 2ZGPA 1K12A 5LBCA 3KM5A 2VOWA 2ILMA 3N7LA 4L9BA 4RGAA 4WZCA 1DQ4A 2QUOA 4CDQC 4COYA 5JMCA 1B35A 3LF7A 2W39A 2A3WA 1OOPC 1X8MA 2VU9A 1NZCA 1Q8OA 3I49A 1HB4A 3AKTA 2XLFA 4X6QB 1AZDA 5FPLA 3TN93 4DRRA 2I45A 1FV2A 1PNGA 5C9AB 5FYVA 5A3WA 3NSTA 5D8AB 4YVWC 3WR0A 3W5MA 2VZOA 1BHGA 4P9YA 4EROA 1HW5A 5JR7B 2C6SA 1RUE3 1D4VB 1UD1A 4I3GA 1LESA 2F4LA 1AX1A 2RS32 4IV1B 3T4VA 1R092 2BGPA 1CZTA 1MACA 4IDZA 3H9AA 5CG8A 3THTA 3SLIA 2XLGA 1HV0A 2P17A 1JODA 4CEWC 4C90A 3H1MA 2NPIA 3FWEA 1SLIA 3U4SA 3VBHA 4QX7A 1RTVA 2ATFA 4LE3A 3OY8A 3AL6A 4MXWB 4UFLA 4XJAA 1RINA 2AEYA 2XGXA 3AXDA 5LRRA 1PZ7A 5T52A 5CNAA 2BP6A 3I3MA 1LOEA 5FZAA 1T6GC 4N7IA 5JSPA 2DU1A 3I3QA 5EJ1B 3KSCA 4NE9A 2VW0A 1W90A 2YC2A 3BU0A 1UKRA 4DINB 1HN0A 3SMHA 4QPGC 1YIPA 3VBFC 4EN9B 5HBAA 1VBE1 3FHAA 4W4ZA 3D0SA 1H1AA 3DPRB 3MW2A 4Y33A 5IHRA 3N7KA 3JBG3 5CG9A 2OVUA 3MHZA 1MQTB 1HQWA 4YM2A 4BISA 2VBPA 4CEYC 3OGRA 4QB2A 5ACA3 4PBPA 1O4TA 1COV3 4EQVA 5DDJ3 5A3NA 2WSUA 2VBDA 3WP6A 2D44A 5EQUA 4XDOA 3U78A 4P5HA 4UFKA 5FLJA 2VAUA 3UYJA 3M3EA 4XETA 4AHYA 5D1IA 4ZU4A 1GR3A 1VIWB 1K5JA 2R041 3GALA 3MICA 3AXEA 1MZ5A 3ZFFB 3AKQA 2ARBA 3NV4A 3ZXLA 4NHMA 4TLGA 5EP9A 2PA7A 5FY9A 1DGRA 4PF5A 1ENQA 1EY2A 4K20A 1GZCA 3UL2A 4CUGA 2O8OA 4QKNA 2DDUA 4YLZA 3RPQA 1RUG1 2AENA 2CGOA 2WZR1 3PVEA 3SH4A 3ZDVA 4YG6A 1DHKB 3VBOC 3PTRB 2QQVA 2IUWA 2R16A 3AMPA 4Q4Y1 1HQNA 1HB2A 4XPVA 2WLPA 1ST8A 2E53A 4GB33 2VCCA 3MI8A 4NHXA 3W58A 3BIEA 3ECQA 3B00A 1D4M3 2HEYF 3I97A 3PVNA 4LTAA 5CU1A 1XNCA 3CDZB 1SBFA 3ITQA 3JQXA 3KV6A 2ZHKA 5FZKA 5IWFA 3WG3A 3ZDSA 3ZIXA 4TTGA 3O0XA 1PGL2 1QDCA 4GH4B 5IK8A 4I2OA 5HI0A 2EXIA 3M8LA 4BM8A 1LEMA 1QQP1 5F5IA 4CXXA 3IPVB 4MH0E 4ZU7A 4DNYA 4CE8A 4HN0A 4RHV1 4H7LA 3AYAA 4E27A 5ABJB 1KQRA 3ON7A 1HLCA 1W3VA 4AI8A 2UWAA 4NIAA 5FO8B 2DBIA 3SITA 4XAAA 5CFDB 2J7MA 5FZ1A 1NXD1 4OMDA 4COZA 4FAGA 1QIQA 3NNGA 4IEOA 1IQAA 4KBZA 2VOTA 2K0GA 3AP4A 3KWVA 1ULPA 4FT8A 3VDCA 5JWPA 1J59A 1H2NA 1QJU3 4PQQA 4NAOA 5DZGA 1X82A 5LBFA 2Q8DA 1N1SA 1R1A1 5T5PA 2FD8A 1XB9A 1FMD3 1N47A 2GN7A 3CHXA 1LHUA 2P4EA 1J3PA 2MPFA 3WF2A 2W2IA 5JZGA 2VCAA 4K9SA 4P5YA 1ASJ3 1C8M2 2VXRA 1GQPA 4AQTA 1S0DA 1S0CA 3T2TA 2D6NA 2BJSA 2VECA 3J7MA 4BE3A 1W6MA 3O1TA 3WXPA 2KR2A 4EE2A 3L2HA 4NRPA 5I0UA 4N43A 4YVSC 5IAVA 5LB6A 3T1MA 4CCMA 4D8MA 3UKTA 5KHKA 1JYWA 5BXXA 5FMOL 4NIHA 3ZM8A 4B4RA 1JYXA 4YGEA 2WZPP 3FFZA 1HV1A 3WQ7A 1O5LA 3MPPG 5FBJA 1O91A 2VVDA 3PL0A 3VD5A 1QJZA 2Q1ZB 3HWJA 3ILFA 2LS6A 4YFWA 2R30A 3AMQA 4QXBA 5A80A 3T1LA 4UW5A 1NY71 2F4PA 4YW6A 1XPWA 1UY4A 4FQ4A 5KXEA 1W9TA 1ENXA 1X33A 3J4UH 1UXXX 1QJY3 3T2PA 1REFA 1UOJA 2WNVB 3VKOA 4KMQA 2EIBA 2QDNA 1PX3A 2VE1A 3N9NA 4NUBA 4P9GA 3QACA 3V64A 3V65A 1ZRFA 4MLOA 1VAMA 2G9GA 4JTOA 2XXZA 2WT0A 1HRV3 2GDFA 4YM1A 2WFF1 2VOVA 1NA1B 3RGBA 4BYYA 2QQJA 1AL23 5EZWA 5T55A 4QU1A 5A7WA 3OBRA 3OBAA 5JIAA 5I0TA 5CEHA 3UKNA 4WVWA 1UX7A 5FPBA 4L97A 1MS3A 3ZXAC 3AKSA 5DUUA 4INDA 4BZ4A 3ZO0B 4WM7B 3CJIC 2YC4A 2VZTA 2BDRA 1Y3TA 5LBEA 2HBTA 2R072 5CADA 5JPMB 1A34A 2WA4A 5KHGA 3IN9A 5JI9A 4RD7A 2HWB3 3WEZA 1JYTA 4FPKA 4BXFA 2QE3A 3KVBA 1XE8A 2IXKA 3O0VA 2VUAA 3ZFEC 4QDRA 3SEEA 5BNPB 1AXZA 1LOCA 4IE7A 1X36A 4OI1A 3RWNA 1W9SA 4CDXA 2WS93 4AHWA 1SPPB 1TME1 4AL9A 4S2FA 1GP5A 1Q5OA 1PMJX 4NMIA 1DYKA 4ASLA 2X29A 5FZ8A 1UYYA 4E2SA 2ZOEB 2YYOA 3V0BB 2FHRA 1LHNA 2A6VA 2XBO2 3GHMA 5A3UA 1G9AA 3ZYIB 2Y33A 4FFFA 2C5DA 4QKFA 5F2SA 1JU3A 2HWC1 3G7DA 4YG0A 3U4XA 2AYHA 2JDYA 2ZGMA 1NQDA 5T50A 3CJXA 4J6GA 3R4DB 1ZZ7A 1XE0A 3ZYBA 2UY9A 4LIVA 5JXIA 1ONAA 5L9BA 1B09A 1VBD2 4AEDB 1OH3A 5KR7A 1XNDA 3AVRA 3GBGA 1VBB1 4CP9B 1LHOA 3BN6A 1PIV1 5HV4A 4PI2A 1F5JA 4PT6A 4YYOA 4UFIA 3IKWA 1KS4A 5FYYA 3KV4A 1O6UA 3ZN6A 4AFDA 2XL7A 2QCSB 3N9OA 1RUC3 2VZRA 3AX4A 4Q0SA 1KFUL 2X8KA 1POV3 2W94A 3PTYA 5FMBA 2WJSA 4FPLA 2IFRA 2RS12 3N7MA 1TEIA 3IBMA 3RS6A 3DUIA 3SKVA 4XMIA 4JDMA 4FPYA 3B9IA 1V00A 5LY2A 3RZJA 1W2NA 4G3YC 1O4YA 4EWAA 1JXNA 1LOGA 1O3QA 3I2HA 4CDUB 2RR13 3I2FA 4P9WA 3KB5A 4YW5A 5FZCA 5L7OA 2X5IA 2VOKA 3B69A 3W5NA 3POGA 4UOJA 2E63A 1WLDA 4KU8A 1CAUB 1FX5A 2GALA 4ASKA 4QPIB 3TWIA 5FK8A 3GM8A 3OBTA 4NRMA 1GICA 3H1YA 1UOGA 3BUCA 3T4HB 3EB7A 1WD4A 1AJKA 1LCLA 1XC6A 2GH2A 1AYM3 2J1SA 2J22A 2Y6FA 4M00A 2X05A 1OHFA 1RUH2 1UPIA 2EIEA 3NMBA 3NVCA 3D4KA 2IXCA 3R4UA 1UO9A 4Q8LA 3WNXA 5FZDA 5C9AA 3AB0A 3IDAA 3NAPC 3LE0A 5D8AA 3WG1A 5JMOA 1UMHA 1HB3A 1ZRIA 1LOFC 5IK5A 4GKYA 3QH7A 4MGIE 2JENA 4IV1A 1UNBA 2RS31 2D6PA 2A6XA 1ND2C 1M4WA 1R091 2BTVC 3RMYA 3AZYA 4ZS3A 5D2AA 2FDHA 5GZDA 3RG0A 2BOJA 3AL5A 5FXXA 3WOGA 5FY4A 4I30A 5IVBA 3HT1A 5J36A 2SBAA 4YW4A 5I0RA 1LJ7A 1CN1A 1FNZA 1S2EA 4MXWA 2VQ0A 4HKLA 1N3PA 2VXJA 3HOBA 3AP6A 4ITCA 4E4ZA 1MZFA 3ZFGB 2W92A 3RSJA 3MYXA 1I3HA 5DXDA 2QQPA 5EWSA 2P3IA 5IYYA 3VBUB 1F31A 5CKNA 3WG2A 4QHOA 1WLTA 5DAPA 1W99A 2NMOA 2WAOA 2Z79A 3DYPA 5FZ9A 5FWJA 2PLV1 2WSVA 3N35A 1NZIA 3TB0A 1PK6C 1CX1A 4K1YA 3DPRA 2OZ6A 4YARA 1H4GA 3HBKA 2AZ5A 2BGOA 3CIHA 3RQ0A 1W6NB 1MQTA 4AAPA 3KV5A 4HFSA 2Q1MA 1VP6A 2R062 2XVKA 4W6XA 1REDA 1H8TC 2ZMKA 5FKCA 2CWMA 2JG9C 5T5OA 3OG2A 3OEBA 1KD7A 1IHMA 1MEC1 5A7SA 4IV3B 2A71A 5FP4A 5FUNA 1RUF3 3WNPA 2OS2A 1AR63 3J7HA 5DUWA 1YHFA 4O7XA 4IEVA 3AZZA 3T3YA 3JB8A 4BQ3A 3JD73 2VTXJ 4ZKTB 4K8RB 3A0KA 3KCCA 2WYFA 3IB3A 2OUJA 2I2SA 2RDSA 3FLRA 1YI9A 1W9WA 4Q4V3 4RSUA 4YZ3A 3SH5A 1UMZA 3ZFFA 1XJAA 4AGGA 3LEGA 4R52A 2LM3A 2ZCWA 4D6RA 2Y0OA 4H55A 1ULEA 5G05L 3H0OA 4QB1A 1NCRC 2EAAA 4CDWB 4A4AA 4NOTA 1IKQA 4KBBA 2B4KA 4F83A 1ODMA 2DU0A 2Q5TA 3FMGA 4CU6A 2P6HA 2ADEA 5JVVA 3WP5A 5CISA 1CAWB 2Q0AA 2CGPA 1OLQA 4P02B 3GZEA 4LMFA 1UXZA 3VL9A 3IT8A 5JOZA 3J8F3 3A4UA 4BMEA 1DQ6A 5C8CB 4CCCA 1WMFA 3K46A 5FUIA 3UNPA 2XQXA 3DXTA 1XYPA 1PGL1 4GH4A 1X8EA 1W8NA 5KHJA 4COUA 1Z7S2 1OF3A 5HV0A 2AGSA 2I07B 2WABA 1SLCA 4B4QA 2OPKA 5ABJA 4AI3A 2PXJA 4W6YA 2ARCA 1XNBA 2XG3A 2RM22 5F5AA 4AI0A 4CCEA 2R042 1W2AX 2WNOA 4AI9A 4XC9A 2RVAA 5CFDA 2JJ6A 4XYXA 5C3QA 1QXPA 3RDIA 5HXMA 4QD2A 2CGNA 4HT1T 3NNMA 2ZXQA 4IW3A 1FAYA 1T6BX 1FOD2 1RUG2 2WZR2 1H9PA 4BJ0A 4BQXA 3GDBA 4E4HA 5FY8A 5F3CA 5T3NA 1DF0A 4IE4A 1Z78A 3M3OA 4Q4Y2 3GBFA 1O8PA 4XQ4A 1QMJA 2GC0A 1CR7A 2PAEA 3POSA 5H9RA 3NQHA 2YC0A 2Q1FA 4QQOA 1TMF3 2XJPA 5K4LA 4XFBA 3T0BA 1C8M1 1FATA 1Q8VA 3LDBA 1ENRA 3PDQA 4JKMA 4O65A 4X8PA 5FPVA 1HX6A 1SMVA 4QQLA 4LKDA 2Y6HA 3PMEA 4WVMA 1K5MC 4Y26A 3BOPA 3OEAA 4QWNA 4XCBA 2P3YA 4DUVA 4AHXA 3DKWA 2Y34A 3VD7A 1V6MA 4CPBA 4RHV2 2OIIA 2WC2A 4J1XA 5FMDA 4C91A 4BWOA 1KEXA 4BB3A 1EPZA 4UI9L 5IFPA 2PHTA 3MLJA 5KBFA 4C8DA 5JUVA 3W20A 2YMZA 3QH6A 2D6OX 1SLTA 2C9KA 1X7NA 2XWJB 1OOPB 5FZOB 1M06G 2W87A 2WNUC 4EN7B 1NE6A 1UAIA 2WNVA 2OA2A 1UYPA 2GNMA 4DXSA 1R1A2 5ERLA 4YVWB 3RZMA 2Q4SA 2I74A 3E1F1 4FPGA 4QGNA 2JE9A 4DY5A 2DF7A 2ET7A 2HEVF 2ZHMA 2WO1A 1AR83 4MHRA 1OLME 1ULGA 3MF6A 4ZXEA 3RMXA 1NA1A 3O1PA 3B3QE 3WCSA 3T0DA 3BTZA 2B7YA 1V9U2 4I0BA 4RA0A 1EV11 1WLWA 2WT1A 4CEWB 3THCA 2W0XA 2FMDA 4CTEA 4AEKA 3HPNA 3M70A 5T54A 3AC0A 3AFGA 3AYEA 5JSRA 1GOGA 1C3HA 3BIWE 4WM7A 2DUPA 3HNBM 5LASA 1UZ0A 4HPKA 4XZPA 4IEWA 4RYDA 1EAH1 3Q8BA 3R05A 3K48A 3I2GA 3LOIA 1VRBA 4GAZA 3ZSMA 5LEJA 2RHPA 3BVCA 1XNAA 1BBT2 5ANQA 5GZEA 1MZ6A 4QQHA 4D3WA 2RS51 4QPGB 5C3RA 3VBFB 2Y64A 3CZJA 4G4FA 5LY1A 4DEVA 3C7FA 3EBRA 4A7ZA 1NY72 5BNPA 1JHNA 5GZFA 4XF9A 2VMDA 1RJ8A 2LROA 2ZJCA 3M3IA 4B1LA 3DCQA 4CEYB 1O59A 1SPPA 1UKGA 2W52A 4WM8A 3CLPA 3VD3A 4JGYC 5AC91 1GUIA 2XOMA 2CNAA 1QJX2 2EXKA 5HXVA 1ZZCA 3V0BA 4ET7A 1HKDA 4Z07A 3MZHA 1AR73 1H1MA 2JICA 2UWBA 2ZPXA 2ZX4A 2WFF2 5E1RA 3LFIA 1PZ8A 3GGLA 5B4XA 5FZ6A 4PI0A 3ZMOA 5A3MA 2WL1A 3H50A 1ZZ9A 4FTBA 1VBD1 4XTPA 4CP9A 5GALA 5CFCA 3ETQA 3PU3A 1HN1A 2BV4A 3KVAA 2WDBA 1C4RA 4IL7A 4TLFA 1WW4A 1LNSA 2YDEA 3BU7A 4BQ1A 2PQQA 2YGMA 1OH4A 1PO13 4LBLA 2Y0IA 1VMHA 3VBOB 2ZHLA 3MV01 3H3ZA 1UYXA 4GULA 3RZZA 3RJ2X 1ZA4A 3APBA 3KCXA 4LIUA 4W8JA 3VKFC 4D7SA 4WBBA 4HVOA 4A7KA 4V1PA 5JOWA 5GKAC 3OPZA 2IXHA 1A8DA 1K45A 2VGDA 1TME2 1UZVA 1DCSA 4GZ9A 2WN3A 4Y5SA 5JOYA 2XJVA 2ZKNA 4NVPA 4CDUA 2YBPA 3J7NA 4AOCA 3PU8A 5JXJA 2HWF3 1RHI3 1CAUA 1RMU3 2E26A 2X09A 3ILNA 4U2AA 5FY1A 4C0BA 5IT6A 4QPIA 1YJLA 2ZMLA 1JYIA 4K1ZA 3A23A 1YQCA 1SG3A 4URTA 5F5QA 1BK0A 4A42A 1VBA2 2TBVA 3OUJA 2V4VA 1PO22 3PJQA 4XIKA 2ENRA 4LITA 1RUH1 4IEZA 3VZOA 4NAMA 1PIV2 4IXLA 3THPA 1FXZA 1PGW2 5JDBA 2IXJA 3FHIB 3WG4A 4CUBA 5EIYB 1LGBA 2BFUS 3DEMA 3MIGA 4XFHA 3POIA 1OQDA 3POEA 2FQPA 1DZRA 1QF3A 1R1ZA 2JX9A 1TNRA 2WAAA 2HLEA 3AZXA 2JE7A 3QOPA 4TXWA 3T2OA 4MHUA 4YW3A 3OB8A 3QBQA 1D0HA 3SKJE 5GZGA 4BQ4A 2ZGNA 3VZMA 4UAPA 3PNAA 2VR4A 2JDAA 4HSLA 4YVSB 3AP7A 4XDPA 2EXHA 3ZFGA 1W6OA 4DS0A 1J83A 1S0BA 2EXJA 2PAMA 3OGSA 1SFNA 3B9CA 4HKOA 4MZUA 4O9EA 3S7IA 2PHLA 2Z2SB 4M3CE 2KM2A 4ATFA 3B93A 3WZ1A 5M0TA 2HH9A 1JZ7A 4OCTA 1RVF1 3BYWA 1Y4WA 2A7AA 2NM1A 1VRH3 4RQPC 1GNZA 1V6KA 1W6NA 3VDAA 1EUTA 4GWJA 1W03A 3ACLA 3WHUA 5T5JA 2R061 1F4HA 4DXRA 2E6VA 1DZTA 1Q3EA 1UU4A 1RUJ1 3ZXEA 4N90A 4XBQA 2XPJA 4TN7A 5LATA 3VKMA 4MYEA 1MS8A 4I02A 1BEV1 4IV3A 4JHTA 2GNBA 3WNLA 4EWEA 4HVQA 1KRIA 3MUY1 2VMGA 2J1VA 5E8AA 4DIQA 1CQ9A 2RMU2 3K51A 3S0MA 1CPMA 2C0ZA 3AKPA 3T30A 3MDPA 3Q8CA 3NO8A 5DG2A 5K0UC 3K4DA 1ODNA 5BPXA 4MGSA 4DXZA 1UPSA 4CCDA 3ZSLA 1AR93 2YHJA 3PHMA 4BOWA 2OQ7A 3SQOA 4CDWA 2ZX3A 2IXIA 3CJIB 1VBE3 1R083 2OPWA 1UY3A 5FCCA 2BBVA 1W06A 2HYXA 2C1FA 5FO9B 1H1IA 2HWE3 3WW2A 1I5PA 1BKZA 1S1AA 2X53S 3VBSC 3WNKA 5CVRA 1CAWA 4NPLA 4QGMA 1JYVA 4UW4A 2PLV2 2WUHA 4Q4W3 4IE0A 1O7FA 4XOGA 1RXFA 2G9FA 3BB6A 4CA9A 2XB6C 3E5XA 1ZRDA 5C8CA 1WMXA 3E5QA 1NCQC 1RUE1 4FP2A 3WY6A 3ZFEB 1LTEA 1OSGA 4XCAA 4CPBD 2EIDA 5EYXA 2CU5A 3NV3A 2MEV2 3PIGA 2LALA 1NT0A 3UJOA 1MEC2 4ASMB 3WF0A 1OKOA 1SHWB 1Z7S1 4L2NA 5FZ4A 2FDFA 4OHYA 2VMIA 2E33A 1O5UA 1V0AA 5CIRA 4YW7A 1OURA 1SQ4A 2OXBA 3MIBA 4IE6A 1JZ2A 2A3XA 4LO7A 1N1YA 5A1AA 2D93A 2RV9A 4ZZ5A 1ULDA 2RM21 3OD0A 4GA9A 1VAVA 1W0OA 2VUCA 5C3SA 2ARXA 4U36A 3O12A 4KI5M 4JCKA 1VBC2 2H0VA 2WNEA 4OMCA 2CAVA 2JDPA 3ZMNA 1FOD1 2ET1A 4OLLA 3FJSA 4LE4A 3LSDA 3JBG1 4Y1XA 5IVEA 2XUMA 1W8FA 1LR5A 1JZ5A 2TUNA 4YSFA 2YGLA 1YQ5A 3PLQA 1W6PA 5DAXA 3UT0A 4BK5A 5L19A 4GMP3 3NJVA 4Q0PA 3AJYA 1COV1 1HXS3 3S57A 2ETEA 4JAAA 4JQRA 3MW3A 2GMPA 2O0OA 4OUEA 5K8SA 3TAYA 1QQP3 4XIOA 1QU0A 1FPN3 5FOJB 5FY5A 1PVC2 3JD72 4WV8A 3GCXA 4PCRA 1LGNA 1R64A 1LENA 2D98A 2OZJA 4LBQA 1HQLA 2PYTA 4NWVA 5DPNA 5AFBA 3KLSA 5GZCA 3NL1A 5IVFA 1OA2A 1H2KA 4KWUA 1AX0A 4RFT0 3ACFA 2PN5A 1GOHA 2ORXA 1YQ8A 3PURA 3C2UA 1KFXL 1E57A 2AACA 2OW4A 1QXJA 2ZGOA 5FPZA 5GM0A 3AYDA 2IWGB 4UFMA 3K4AA 1XU2A 3BCWA 1AXKA 4CDQA 1JZ8A 3KD4A 4QX3A 2JD4A 1OKQA 2LW8A 4Y1UA 2VNVA 1CPNA 2QVSB 3AJZA 1OOPA 2GN3A 1DZQA 4GB31 2YFZA 1WBLA 3ZN5A 2MNGA 1OPOA 2P5BA 3IAQA 3SEPA 3S5QA 4JGZA 5H9SA 5JLVA 3E6CC 4MGQA 3NAPB 2W1SA 4YVWA 5FAXA 2QZ3A 4FPFA 4OZXA 1S55A 2H6BA 2ZTNA 3TEWA 2WKKA 2H6CA 2JECA 2YPJA 3ROUA 1ND2B 1A78A 4P14A 1S0GA 3IZOA 1V9U1 1G9FA 2ZBJA 1LOBA 2JG8C 3VLBB 4Q4X2 3CEWA 4CEWA 4RR3C 4OHZA 4I09A 4UW3A 2Y6KA 2D6KA 4QDQA 4QAWA 4Z82A 4HSJA 1HRI3 5FIXA 2VZPA 1CD3G 1POV0 3HAGA 5FUPA 4GJYA 5C4WA 2VQAA 3ZXJA 4BQ2A 3ZIWA 2P3KA 4CP0A 1W04A 3I2KA 1QGLA 2WWJA 4AWDA 4JZRA 3A21A 4YRDA 1BVP1 1BBT1 1DIWA 3RYKA 3BTYA 4XXPA 2P6CA 4QB6A 4QPGA 4RN5A 2GC3A 1U5YA 2ZGRA 3TEYA 1WZXA 4XF4A 1PK6B 3MBWA 3E97A 4XQDA 4EZHA 4Z1VA 4M3CF 1H2LA 3TBDA 4PBOA 1X50A 3C3VA 3U10A 4AI2A 4Z92B 2DVBA 2UWCA 1NAEA 2BVBA 3O7OA 4AG4A 4ATEA 4CEYA 4PDWC 3FC0A 2D7FA 1YIFA 4AVAA 4HBNA 1K42A 2ZGSA 1H8TB 3HQUA 5C3PA 3OTFA 2JG9B 4BA6A 1QJX1 1ZBA3 4S2DA 4Y24A 1WLCA 3D82A 3SHRA 4CCJA 2UY8A 3JZVA 4XUTA 3TEZA 3U37A 4LBOA 4XACA 2EA7A 3LA3A 4LBKA 2HWD3 5A7PA 3U75A 3LDKA 2W08A 4R9CA 4FPJA 1EV12 2CHHA 5J96B 2Y8KA 4O61A 1GOFA 3U11A 1OI6A 3VL8A 4FPOB 3OF1A 2XWBB 3OUHA 3OCPA 4FXKB 5FMOS 5FJKA 3P1IA 3C8XA 2VMFA 4D6QA 3H3UA 3I8TA 1NCRB 1UZZA 1WCDJ 1EAH2 1LOAA 2NLRA 1GP4A 1ULFA 4ORFA 3Q8EA 2VC9A 4ZHNA 2B45X 1IS3A 3JB4C 4Q29A 3VBOA 1SFYA 1QJY1 3CZUA 4H14A 3DGTA 5IVYA 2RS52 3ZXDA 3M3CA 1DYOA 2BUKA 4XABA 4LT5A 4I0WB 1C5HA 3EJKA 4PIYA 2ZZQA 5F3IA 1JI6A 4FVVA 2V73A 5HPOA 1H9WA 1WA6X 5FJHA 1G8WA 2ID4A 3HD8B 2P2KA 1H30A 1J1LA 1HRV1 2WFPA 1IKPA 3HR9A 1WW7A 5FZEA 3BODA 5AC92 2HWC3 2B9VA 3HN3A 2B9UA 1KDKA 2Y26A 5A6QA 4LA2A 5FP3A 4EN0A 1NX9A 2OUHA 3F2ZA 4BXSV 2EVXA 5FLHA 3WP3A 3JXSA 1AVBA 1VBB3 2JDHA 5B4NA 2DUOA 3LPFA 1V6LA 3N9LA 3B94A 3VDDC 4ZZ8A 1VBA1 5BNOC 4NHLA 2HWB1 3K77A 5IK4A 1PO21 4FFGA 5DZEA 4EN8B 3N36A 4E8DA 4QU2A 4QXHA 3KF5A 3LDRA 3A22A 2VVFA 1NYWA 3WDTA 1SLAA 1DGLA 2XR4A 4CCLA 3NJXA 1Q43A 1PGW1 5BNNA 5F5CA 4XZUG 1D0GA 5A3OA 5DAVA 2HBUA 1L3JA 3KV9A 5FYCA 2GNTA 4FPEA 2C24A 2YB7A 3SCGA 1RYYA 5FYBA 3LD8A 2R0HA 4N53C 3POYA 1JH5A 2ZEWA 3OYWB 1LECA 4CRQA 3AP9A 1UL9A 2Y60A 1K5MB 4YVSA 1YI7A 3O1SA 2DVFA 1IZ3A 4IEYA 4NJ4A 1JS9A 4A41A 1XNKA 4LEJA 1CAXB 1SZBA 2W1WA 2TNFA 4LLOA 1RUI2 2Y6GA 4K3UA 4CU7A 1DGRN 3WDVA 4AQ6A 3SC7X 4ZS2A 5AVAA 4ARXA 1N1VA 5EXOA 1ZVFA 3ABZA 3PUHA 5F3EA 4Z8BA 4MV2A 4AFMA 4MADA 3LIHA 1VR3A 2D3SA 5A1LA 3WW4A 2WA3A 4LUKA 1IPSA 4R4ZA 1AL0G 3ZSJA 4ZXKA 3KHBA 4Q1PA 3EMRA 2ZX0A 2RS33 2WNUB 2VZUA 1R093 2PFWA 3BTAA 2OT7A 4UFJA 1OUXA 1VALA 5CYYA 2FCVA 4CU9A 2A6YA 2RMU1 3D8CA 4XW3A 1S2BA 3WF4A 4QHBA 3OPTA 3ST7A 2VQUA 2KXLA 3WUCA 5LEKA 2RR11 2ZACA 4PHZA 4Q0VA 1SBDA 1RUD2 3A0NA 4FPCA 4LJHA 4DUWA 5J48A 2BNOA 1EP0A 1U12A 4OULA 2EALA 1GFF2 1AYN2 4XF0A 2XJQA 3CJIA 3WLUA 2YUEA 1AYM1 4Y1VA 2B42B 1ZM1A 3T2QA 1WW6A 4KQ7A 1STMA 1GMMA 1C1FA 1UOFA 2MHFA 1RVF2 3M7AA 1KGYA 3DF0A 4LBQD 4YW1A 4Y1ZA 2JKBA 2AEZA 3JUUA 1RGSA 1FI2A 3MEPA 4KWKA 3RVHA 2EICA 3VBRC 4QDSA 1SEFA 3ZFEA 4MG2A 4A6OA 5F3GA 2IVIB 4EWDA 4SBVA 1RUJ2 2MEV1 4XJUA 5A3LA 4OUMA 4JGYB 1HDKA 1BEV2 2FDJA 2Q8OA 3MPBA 4XE9A 1GANA 5C7GA 2NQYA 1J58A 4NHKA 1J3RA 4QX8A 4AFCA 2QFEA 1G9CA 4OUSA 3J26N 3NJZA 1REEA 5CB7A 1SACA 3BPSA 1GNYA 4P9JA 3N9PA 1YFXA 1ZBE2 5DAQA 3C7EA 2D43A 5FZ3A 2GSYA 4A3ZA 2ZGTA 1N3QA 1VBC1 3H1WA 4UW6A 3MLKA 4L8QA 4PLOA 4W50A 1DLCA 2DCZA 5FLIA 1BXHA 1BZWA 1RC6A 1WKYA 2CTVA 4NIIA 2XHKA 4AQ2A 2XL9A 3CO2A 4LULA 2OKXA 3TN92 2BU9A 4DRVA 2A3YA 2VL4A 3HQXA 3WP4A 4AF9A 5K9YA 1RITA 2K2SA 4K7JA 4LR4A 2VJXA 4YG3A 3TRSB 2RJKA 5CA6A 1VMFA 3GNEA 5CBLA 4GJZA 1RUF1 4SLIA 1RUE2 4CP2A 3LOBA 1AR61 2XVGA 4NO4A 4D69A 1JYNA 1PVC1 3JD71 4LUMA 4GALA 4AVSA 2VO5A 2XMLA 4HXCA 2RDRA 1UW8A 4LHKA 1LULA 1KITA 2C4XA 2JB4A 4KH9A 4Q4V1 4QXKA 4IETA 3CMGA 3IPVA 1IG0A 2YBSA 4HANA 3LFMA 1NLQA 1DP0A 4LO6B 4AW7A 2Z69A 1G9BA 1W8OA 3RZGA 1CESA 3WDYA 4AZZA 1ZRRA 1MZEA 4YNIA 1C8NA 1YQ2A 3ZXGA 1G7YA 5KHHA 4JX0A 5FKBA 1W2TA 4CUCA 4LBJA 2YBKA 3VB9A 2DCJA 5F9TA 4RS5C 4JC1A 4N8MA 4WM8C 4NIGA 3ZYRA 2K9ZA 4H7MA 3K4ZA 3WNNA 2DV9A 4CUAA 1J3QA 3JBG2 2VMEA 2PQSA 2A1XA 2YXSA 3NAPA 2P3JA 1C8M3 4AHZA 4EYUA 1Z0HA 5I8YA 1UN1A 1JZ3A 3WV6A 4XBNA 5LA2A 2E7AA 1GWMA 1LOFA 3MIHA 5ACA2 4FSJA 1COV2 4QT6A 4XTMA 1DQ2A 5DUXA 3W9AA 4F3JA 3PVBB 5DDJ2 1ND2A 4LLFA 4L92A 1UQXA 5JI7A 4NIDA 2QKDA 4RL7A 2QQKA 4Y3OA 3QCWA 2C26A 2C9AA 4XJ9A 5BNQA 3I3EA 1O4ZA 3RI8A 4Q4X1 1YO8A 1IPKA 3I2DA 1QDOA 4BPZA 5L36A 1O3SA 4OI4A 1SCSA 4MGZE 4N9IA 4D94A 5IAXA 3LEKA 3VKNA 1A3KA 1L7RA 1C28A 3KQRA 4HMZA 4LORA 4XURA 5FXZA 2A75A 4XUNA 4AEDC 1H6YA 1DQ1A 3DL3A 4D0QA 1YQ6A 2CV6A 1H6XA 5CKQA 3M3QA 4K40A 4XJZA 3B5LB 3KGZA 1MS4A 2YZ4A 3EYPA 3ASIA 4RQPB 1TG7A 1U0AA 3N9QA 3H42B 4GB32 3FUQA 1W6QB 1QOSA 1D4M2 1TMF1 3WDXA 1H8TA 3HMYA 4MXVA 4MVTA 4ZU5A 1OXCA 2VY0A 1ND3C 5GLZA 3H8OA 1JTZX 2JIJA 2DVGA 1BCXA 2GMMA 3K3NA 4LA3A 3S6PA 1RB8G 4OFGA 4LK6A 4MGTA 1H2MA 1GP6A 1LU1A 2J1AA 2XHNA 3ME2A 1WA4A 3CU7A 4I01A 4QPWA 1GKBA 4WZFA 4S2HA 4Q2FA 4A45A 5K0UB 1W28A 1GZTA 1OPMA 2R073 1AX2A 3TOJA 1ZX5A 3DKQA 3MFAA 4QQ2A 3H8RA 2A5ZA 1IS6A 1H4HA 5IJRA 1OUSA 2DBNA 2D97A 1JOBA 3RYRA 1NCRA 3OGGA 1EYBA 3DYOA 4PLNA 2VNGA 2WO3A 2OX0A 2WQ8A 4IESA 1AUYA 5FZHA 4WVZA 5G04L 3VBSB 1QOOA 4Y20B 1QJU2 1XSQA 1E5IA 2IXLA 2J1EA 2W9XA 3RFRA 2YU1A 1FMD2 4XXAA 1S0IA 2AC1A 4JTNA 1E5RA 4GWNA 1NCQB 4B4PA 2V09A 3UV9A 3BGAA 3WSOA 2XBO3 2YPDA 3LAGA 5F32A 1ASJ2 5E89A 4R8HA 2WQZC 5FZIA 5A33B 1UMIA 1GV9A 5AFEA 1W0NA 3RZHA 4XEZA 1GNHA 2VNOA 3NV2A 3ZX7A 1RJ7A 2UURA 5F8PA 4CYDA 5J09A 4MUVA 1VBD3 1BMV2 1B35C 5FQ0B 1UY2A 4LO4B 1CZSA 2BBAA 3L9JT
chains in the Genus database with same CATH topology
2K46A 2KR2A 3ORJA 2LRPA 4LK7A 2O14A 2WYFA 3UT0A 4CP9A 4LK6A 1OKOA 3ZYBA 4CPBA 4YWAA 2LROA 1V0AA 4YW7A 1L7LA 5D21A 1OH3A 1W90A 4BQ2A 4A6SA 4CP9B 1GWMA 3F95A 4BQ4A 1HN0A 1WCUA 2Q1FA 1GWKA 4BQ5A 2JWPA 4AL9A 1W9FA 1W8TA 4LJHA 3ZYFA 1GWLA 1W8ZA 1WZXA 1W8WA 1W8UA 4LKDA 1WMXA 4LKFA 4YW6A 3ZYHA 4LKEA 4CPBD 2VXJA 2C24A 1UOJA 4BQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K46 A;  2KR2 A;  3ORJ A;  2LRP A;  4LK7 A;  2O14 A;  2WYF A;  3UT0 A;  4CP9 A;  4LK6 A;  1OKO A;  3ZYB A;  4CPB A;  4YWA A;  2LRO A;  1V0A A;  4YW7 A;  1L7L A;  5D21 A;  1OH3 A;  1W90 A;  4BQ2 A;  4A6S A;  4CP9 B;  1GWM A;  3F95 A;  4BQ4 A;  1HN0 A;  1WCU A;  2Q1F A;  1GWK A;  4BQ5 A;  2JWP A;  4AL9 A;  1W9F A;  1W8T A;  4LJH A;  3ZYF A;  1GWL A;  1W8Z A;  1WZX A;  1W8W A;  1W8U A;  4LKD A;  1WMX A;  4LKF A;  4YW6 A;  3ZYH A;  4LKE A;  4CPB D;  2VXJ A;  2C24 A;  1UOJ A;  4BQ3 A; 
#chains in the Genus database with same CATH topology
 5JOX A;  3ATG A;  1W05 A;  4AE2 A;  4P9I A;  2XH6 A;  4HN1 A;  4QGL A;  3AK0 A;  5E16 A;  5EHD A;  5AVP A;  4AQS A;  1KXG A;  3GCW A;  2B39 A;  3FUO A;  1NOV A;  4E4S A;  2RS1 3;  5IVV A;  2ZGQ A;  1QJY 2;  2ZX2 A;  3R6S A;  2RDQ A;  2SLI A;  4FOW A;  1HIX A;  4AXO A;  2NP0 A;  3Q8F A;  4YM3 A;  1UZW A;  1ZNP A;  2QBX A;  4Y4R A;  5A7W B;  1DG6 A;  4AGR A;  1AR7 1;  2HYK A;  2LUW A;  1HRV 2;  4PIZ A;  3VBH C;  3FBY A;  1OBN A;  1W2O A;  1AJO A;  3WCR A;  5CFC C;  1AL2 2;  3HEI A;  2XQR A;  2QQL A;  4UWD A;  2K46 A;  4WVV A;  2ZKL A;  5J1X A;  4QX1 A;  1ZRE A;  4DPN A;  4BU2 A;  3ZPY A;  2DTY A;  4ZY9 A;  4QX2 A;  1RUI 1;  3MIE A;  3ES4 A;  3VD4 A;  1XOY A;  5F37 A;  4M4P A;  1RUH 3;  2VTF A;  3E5U A;  1PM4 A;  3D0J A;  4G9S B;  4BQY A;  1X9P A;  4L0P A;  1JUH A;  1YFW A;  2A70 A;  4BQ5 A;  1GSL A;  2HWB 2;  4BLI A;  4FTE A;  4B29 A;  1XSR A;  5IVC A;  1U5I A;  4BIO A;  4ES9 A;  5A6Z A;  1JZ4 A;  3HT2 A;  2WNU A;  4K6B A;  4AVT A;  1ZYB A;  5IVJ A;  4XFA A;  4P00 B;  3ENR A;  4DZG A;  3RI9 A;  1OQE A;  2CSG A;  2QQW A;  2WS9 2;  4O9G A;  1UCX A;  3WNO A;  4BQW A;  4UBG A;  1IS4 A;  3LB9 A;  3QLQ A;  2VG9 A;  2VTX A;  1WD3 A;  4AFA A;  3HVD A;  4YFZ A;  1XNT A;  1W3X A;  3D5O A;  1RUD 1;  3NKG A;  2JG8 B;  3ALQ A;  1JYC A;  1QXR A;  1RHI 1;  1RMU 1;  2PHW A;  4E2G A;  1EPW A;  4LNV A;  3POF A;  5A3P A;  2QQM A;  4GMP 0;  4RR3 B;  4RGK A;  4IE5 A;  3HQR A;  4B7K A;  1AYN 1;  2D6L X;  5EV7 A;  4ONU A;  1N1T A;  1W8W A;  4FFH A;  4FOV A;  4YGB A;  1US3 A;  4JKK A;  5LK7 B;  2WZE A;  3H3L A;  5LCW L;  4AVB A;  3SIS A;  3VBU A;  1UIK A;  2E7Q A;  2FDK A;  1GZ9 A;  2PEL A;  2XON A;  3LA2 A;  3OD4 A;  4QX0 A;  2HKX A;  4QX5 A;  5KHI A;  2WT2 A;  2R06 3;  5HCF A;  1RL3 A;  2BZD A;  2FDG A;  1JUI A;  3UJQ A;  3AZW A;  2DYC A;  3C7O A;  3LPG A;  4AK3 A;  1RUC 2;  3QD6 A;  4NHY A;  1VB4 A;  4QHZ A;  2IVJ A;  5HCB A;  2QJV A;  4PDW B;  1QJF A;  2OYZ A;  4OQ9 A;  4JGY A;  2VUD A;  4ISQ A;  1MPX A;  1YXW A;  3VKL A;  3ZYJ B;  1AHS A;  3BAL A;  3V0A B;  4Z2W A;  2ARA A;  3VD9 A;  4R4X A;  4DXT A;  2G19 A;  1AXY A;  2WO2 A;  2B8M A;  4QM9 A;  1CGP A;  2R6Q A;  2RR1 2;  4JVA A;  4P9X A;  2LTN A;  4XAE A;  3I2J A;  5A3T A;  3NKT A;  4DMI A;  3JU9 A;  1D2Q A;  1PX4 A;  1VMJ A;  1VPH A;  1ZBE 1;  2P1B A;  5C33 A;  3OUI A;  4XF3 A;  2DTW A;  2UU8 A;  3H8X A;  4KGG A;  5FK7 A;  3I59 B;  2XJU A;  2W95 A;  4IEX A;  3J7L A;  5LA9 A;  5FOB B;  2G9Z A;  4JGZ C;  1VRH 1;  1YEW A;  4FCA A;  1AYM 2;  1O3T A;  3MIF A;  1QKQ A;  4GXL A;  5DAB A;  1DQ5 A;  2DCT A;  2WII B;  4RFR B;  2VUJ A;  3H7J A;  3TN9 1;  3WQ0 A;  2HEW F;  4JRA A;  5JZG C;  3III A;  5IFT A;  3NNJ A;  4UXA A;  5TSW A;  3RWK X;  1ULC A;  1TNF A;  3K75 B;  2VH9 A;  2D3R A;  4XMA A;  5FPX A;  1Z7S 3;  3RZK A;  1Y9Q A;  2E9Q A;  3U14 A;  2GAU A;  4QKD A;  3OSD A;  4N43 C;  1NLS A;  1OA3 A;  2W1U A;  3T0A A;  4DFS A;  4GQ7 A;  3KT7 A;  2PHX A;  3AMH A;  3RNS A;  3SCH A;  5C4W C;  3AYC A;  1GU3 A;  3WT3 A;  4AEJ A;  3U1X A;  1SDD B;  4P08 A;  2RM2 3;  4HG6 B;  4YZ1 A;  4M3C B;  2DFC A;  2R04 3;  2J1T A;  1AR9 1;  1K3I A;  4ZON A;  2H0B A;  5FMC A;  1WME A;  5DUV A;  2QQO A;  1BLZ A;  4OZO A;  2B46 X;  1YC6 1;  1CVN A;  3FX3 A;  5J98 B;  3KCY A;  1Y43 B;  3NRU A;  4FXG B;  1FT9 A;  1R08 1;  3WF1 A;  1WMD A;  2QDR A;  1FOD 3;  2R32 A;  2HWE 1;  1RUG 3;  2WZR 3;  3AFK A;  3VDD B;  5BNO B;  2ZAA A;  4CU8 A;  1NQJ A;  3I2O A;  1AF9 A;  1W8U A;  4TSV A;  4Y5T A;  3WIN E;  3MV1 1;  4Q4Y 3;  3IIA A;  1F35 A;  3FHQ A;  4N7U A;  4Q4W 1;  5JPN B;  5F1R A;  1L7Q A;  4NRO A;  2VCB A;  5EPA A;  4HK8 A;  1CAV B;  2VW1 A;  3DXU A;  4TZD A;  2UYA A;  1E5S A;  2GC1 A;  1OFN A;  1LHV A;  1YLL A;  2L9L A;  5ACA 1;  5K7P A;  5KC5 A;  4I3P A;  3POJ A;  4HKW A;  1VE0 A;  4K8F A;  2YRO A;  3CBN A;  5DDJ 1;  3IDC B;  2GH8 A;  5APA A;  1RUF 2;  1TE1 B;  2V5D A;  1LB2 A;  4X6R B;  5GLT A;  1AR6 2;  2VNR A;  4N53 B;  2Q30 A;  3POW A;  4E4D X;  1IS5 A;  5A6X A;  4DOU A;  2P37 A;  4RHV 3;  3WX5 A;  3ZKY A;  4LOS A;  1W8T A;  4Q4V 2;  4AVC A;  5KWR A;  3LZZ A;  1DYP A;  3BKZ A;  1GWL A;  2AUY A;  2IC1 A;  4OQ8 A;  1PGS A;  1CON A;  2CY6 A;  3EHK A;  2YU2 A;  5IK7 A;  2QNK A;  2Z4F A;  3UGH A;  4CVU A;  4K21 A;  3Q9O A;  4N9H A;  2XLA A;  3PIJ A;  4MO3 M;  2V4A A;  4V2W A;  5E6H A;  4FQZ A;  4AAX A;  1WBF A;  4ARY A;  1ZA7 A;  3T09 A;  4RQP A;  4UF0 B;  1R1A 3;  4M01 A;  4Y22 B;  1MS9 A;  3WD5 A;  3KMH A;  3LCP A;  3IDB B;  5FYH A;  5FZO A;  4CDX C;  4GMP 1;  1HXS 1;  1GZW B;  2RE9 A;  5BYN A;  1W6Q A;  2Q8C A;  3J8F 2;  4HLT A;  1D4M 1;  4RGG A;  5A7Q A;  1W2U A;  4LBM A;  1PHM A;  2VM9 A;  1A8M A;  3GXU A;  4FOY A;  2QQN A;  3MF9 A;  1LED A;  1V9U 3;  1FPN 1;  4KWJ A;  5ANN A;  1SFP A;  3ZYF A;  1YNA A;  1W8Z A;  2KD7 A;  2ES3 A;  5T5L A;  3GHN A;  3CL1 A;  3NV1 A;  1QNY A;  3VUO A;  3VZK A;  1G86 A;  2YFU A;  1OC1 A;  5E88 A;  2Y6L A;  5K0U A;  1OA4 A;  1LHW A;  3SH3 A;  2GU9 A;  2VD7 A;  3AKR A;  5F2W A;  2JB8 A;  1XYN A;  4JHZ A;  1LOD A;  4S2G A;  4FOQ A;  1UY0 A;  1OQ1 A;  1BBT 3;  3DEC A;  4KWL A;  5GLV A;  3ZR6 A;  3N4M A;  2ZZJ A;  3GZT B;  2VVE A;  1GBG A;  4A6S A;  1PVX A;  5SV5 A;  5BNN C;  4PQ9 A;  5FRA A;  4B1M A;  2ERF A;  2O1Q A;  1GQH A;  1YRZ A;  2WBK A;  3VBS A;  4A2U A;  2HJI A;  4Y20 A;  5A6Y A;  5JR2 A;  1CJD A;  3HNM A;  1QJU 1;  5B2G B;  4KU7 A;  2DFB A;  3VBF A;  5FZF A;  3ZLI A;  5FYM A;  4BCU A;  4EJR A;  1S0J A;  3B7M A;  1FMD 1;  1QJX 3;  3VBR B;  1NCQ A;  1UZY A;  1DLL A;  4XBL A;  1PNF A;  3IMM A;  4WVM B;  4JDN A;  1TMF 2;  2ORZ A;  2DVA A;  3VHR A;  1YFY A;  1ASJ 1;  3ZYP A;  2WN2 A;  2WFF 3;  2BWA A;  5A33 A;  2R1B A;  2FBE A;  5L7O C;  2X5I C;  4Y4Y A;  1VJ2 A;  3LIG A;  2X10 A;  1VB2 A;  4PJY A;  3H8U A;  2JDZ A;  1P8J A;  1I9R A;  1HRI 1;  3KGL A;  2GME A;  4IGP A;  4XJ8 A;  1SBE A;  2VQT A;  3CNA A;  1UY1 A;  4I0A A;  2AR6 A;  5LBB A;  3VGI A;  3ZXF A;  4HVR A;  1BMV 1;  4BIF A;  5FQ0 A;  5FYI A;  1OVP A;  1LRH A;  3P6B A;  2G4I A;  1YFU A;  1LAJ A;  4X8N A;  1XE7 A;  4LKE A;  5BY5 A;  2WO7 A;  5C9A C;  5CAZ A;  4OHW A;  2ZAB A;  1TZO A;  1Y9G A;  5D8A C;  1KDM A;  3OGV A;  1I6X A;  3POB A;  5I8T A;  4W6W A;  2YV8 A;  4XUP A;  1OLM A;  2WIN B;  4FP3 A;  5FY0 A;  4YPJ A;  4IV1 C;  3TNQ A;  1D2S A;  5FP7 A;  2OQ6 A;  4OHV A;  1UIJ A;  4XF1 A;  3FBM A;  3IM0 A;  3U07 A;  4URA A;  1WWY A;  1DBN A;  2JDN A;  1TME 3;  3N9M A;  5GLU A;  5LK5 A;  2F6B A;  1ZBA 1;  4AVV A;  4IEQ A;  2RDN A;  1US2 A;  1WCU A;  1XXN A;  1AR8 2;  2HWD 1;  2ZX1 A;  1BVV A;  3AM2 A;  4CP1 A;  4CZS A;  2W46 A;  3O1O A;  2PHR A;  1AL2 1;  4XFF A;  5F6L B;  2IFW A;  3FE5 A;  2RJ2 A;  1WCS A;  4HPK B;  1DFQ A;  1QWR A;  5H9Q A;  3RYP A;  3UGG A;  4PF1 A;  1VBA 3;  3RJR A;  4DO0 A;  1V6N A;  1WW5 A;  4Q27 A;  1PM7 A;  2XJS A;  1PO2 3;  2TEP A;  4LK7 A;  1E5H A;  5JCT A;  3WQB A;  1WCQ A;  2QTW B;  3UES A;  4IQP A;  3DPR C;  4B7E A;  1PIV 3;  3KQ4 B;  2A73 B;  2JE8 A;  1MQT C;  2BGC A;  2ZEX A;  1KJL A;  1S0E A;  1OF4 A;  3WHT A;  4UFH A;  1DQ0 A;  3S30 A;  4RS5 B;  3NNF A;  3D3A A;  4WM8 B;  1NLR A;  2JDU A;  4C0H A;  2GND A;  2VBB A;  3VZN A;  5LA1 A;  1OLR A;  2XKO A;  2WS9 1;  4UYB A;  4W65 A;  5HCH A;  3PJY A;  3S5A A;  4BHP A;  3ZR5 A;  2RG4 A;  2WWS A;  5FP8 A;  3TYJ A;  1NKG A;  2F17 A;  4TYS A;  3ZFF C;  1AR7 2;  2JG8 A;  2W68 A;  1Y9M A;  1NXM A;  2XVL A;  1ULO A;  2YG0 A;  3O14 A;  4RR3 A;  4NN0 A;  3LSE A;  4KNC A;  2DWR A;  1U5X A;  1V6J A;  4LXL A;  1G9D A;  1Q56 A;  4LPL A;  1BK1 A;  5LWB A;  5EJZ B;  5GLW A;  5HCA A;  3ETP A;  4CCN A;  3T08 A;  3EXU A;  4IEP A;  4FFI A;  2XDV A;  2VCM A;  3PMS A;  2E32 A;  2CL2 A;  1W9F A;  1YWK A;  2Y38 A;  1XBF A;  5FPA A;  5I93 A;  1PMH X;  3IDE A;  5A7N A;  3VHN A;  1I5Z A;  1DGW X;  1QH6 A;  2DUQ A;  4QQP A;  3URF A;  1PO1 2;  1IQD C;  5FXV A;  5I91 A;  3WNM A;  3LEI A;  4BH9 A;  1RUC 1;  1Q8S A;  3FLP A;  3NW4 A;  2LRP A;  2JDK A;  3TEX A;  4GH4 C;  1RUN A;  2RMU 3;  3PUS A;  4XQW A;  4NR1 A;  1POV 1;  4PDW A;  1S4C A;  5F6K A;  2WWU A;  3USU B;  1F8V A;  2ZEY A;  3OJB A;  3V56 A;  1UOB A;  3WUD A;  5I0D A;  1J1T A;  1L7L A;  2YY1 A;  2ZGU A;  2BW8 A;  4HL0 A;  5ABJ C;  3V0A A;  1LGC A;  1ND3 B;  4CCO A;  1QOT A;  2FDI A;  1GWK A;  2BVV A;  4XVH A;  2J1R A;  1IPJ A;  4CSW A;  4GIQ A;  3R0R A;  4LO5 B;  2QZ2 A;  5CFD C;  1QY4 A;  2HWF 2;  1RHI 2;  2WLQ A;  1RMU 2;  1SLL A;  2CDO A;  4M0N A;  5A32 B;  2WYS A;  2VMH A;  3ZOI A;  4P9L A;  3ILR A;  3S7E A;  3I59 A;  3PUQ A;  2PLV 3;  3OBZ A;  4UT5 A;  3VN4 A;  4Z2A A;  3UGF A;  3ZSE A;  4R9D A;  4MGY E;  5L9V A;  3LGR A;  4IGO A;  1W9Y A;  4GWI A;  2W1Q A;  2CYF A;  4FPH A;  1XYO A;  1ZRC A;  5DG1 A;  1APN A;  4TWT A;  4IEU A;  3K2O A;  2NN8 A;  3FL7 A;  4XUQ A;  3MW4 A;  4DB5 A;  2ZAH A;  1W0P A;  1JOP A;  4XFC A;  2DCY A;  2MEV 3;  2NZ9 A;  1T2X A;  3O1M A;  1MEC 3;  4FAH A;  4YGD A;  4LQR A;  1OMI A;  3NWK A;  3P5B A;  2FZ1 A;  2VZS A;  2JDM A;  1UX6 A;  4M0H A;  3TNP B;  1RUO A;  1PZ9 A;  2JKX A;  3JQW A;  4YGC A;  4EN6 B;  1V6O A;  4Q0U A;  1W6O B;  5DQ0 A;  3MID A;  3DN7 A;  4JV4 A;  4M3C A;  2WQ4 A;  4OHX A;  2ZGL A;  2VZ3 A;  3AVS A;  3WDW A;  2Z5W A;  3ORJ A;  4AYU A;  2O14 A;  5FPU A;  2D5H A;  1CWP A;  3ZN4 A;  2W91 A;  1CZV A;  4XFI A;  5FZ0 A;  3Q8A A;  2Z42 A;  1JOJ A;  1VBC 3;  2G1M A;  4OYU A;  1H8V A;  3LA7 A;  1B35 B;  1C1L A;  1F15 A;  2GC2 A;  3KS7 A;  3ACH A;  1NE4 A;  3VDD A;  1POQ A;  4H2A A;  3ZXK A;  3R4S A;  4HK9 A;  5BNO A;  3KT4 A;  4EZ4 A;  3AP5 A;  2XJR A;  3VZL A;  3G6J B;  1UWW A;  2N7G A;  2WNV C;  2R0F A;  3I7D A;  3INA A;  3WW3 A;  1VRH 2;  5J7M A;  5FBZ A;  5I8S A;  4A7Y A;  3PUI A;  1BYH A;  2VOX A;  1CAV A;  5A70 A;  5C6C A;  1YYN A;  1RXG A;  4PLM A;  3O1U A;  5A1F A;  5FYS A;  3I3D A;  3KHC A;  1C5I A;  5KXB A;  1FYU A;  1NA1 C;  3HNY M;  1PVC 3;  2ADD A;  3HN1 A;  3BPZ A;  3ZSK A;  2JIG A;  1KS5 A;  3N3H A;  5DAW A;  1FNY A;  3WDU A;  5JXG A;  4R9A A;  5IUQ A;  2BRT A;  5C71 A;  1Y7B A;  4N53 A;  3VBH B;  4DQA A;  5JAX A;  4KG0 A;  4XIL A;  4WM7 C;  3OY8 B;  5CFC B;  3BTX A;  3W59 A;  3WF3 A;  4IUG A;  3BI3 A;  1JBC A;  3ELN A;  2PHU A;  2PAK A;  3AZV A;  1JZ6 A;  4CXY A;  1AR9 2;  3GZU C;  3OOX A;  2EAK A;  2J1U A;  2E31 A;  2GP3 A;  4Y1Y A;  3LKJ A;  5BUV A;  2VZV A;  3USS A;  5C3O A;  4GWM A;  1JHJ A;  1VBE 2;  1R08 2;  1OD5 A;  2VPV A;  3WVJ A;  2PMW B;  2BNN A;  5KC6 A;  2VZ1 A;  4AEM A;  3PUA A;  2HWE 2;  5BNP C;  4OI0 A;  1MVQ A;  4UF0 A;  5C5U A;  4Y22 A;  2O8Q A;  4HZF A;  5FYU A;  2FMY A;  2VUL A;  1GZW A;  1X9T A;  4J1W A;  4Q4W 2;  3AMM A;  5DZF A;  3VZJ A;  4FTS A;  5LA0 A;  3J8F 1;  4IGQ A;  5CZK A;  1EUU A;  4AGV A;  3UK9 A;  1HB1 A;  1ZZ6 A;  5JIU A;  2JD9 A;  3THD A;  4BDV B;  1UU5 A;  1YCI A;  5IAT A;  3GBW A;  3ZPO A;  2GZW A;  4Q4X 3;  4FBF A;  2ZMN A;  4E9K A;  2CDP A;  1KJR A;  3E6B A;  4FI9 A;  3GJB A;  1UYZ A;  4QMA A;  3N7J A;  4NPM A;  4AR2 A;  2UYB A;  3CF6 E;  5FYZ A;  2J42 A;  1OVS A;  5F7U A;  2QQI A;  3MO4 A;  4QXC A;  2FCT A;  1UF2 C;  3LWC A;  1NUK A;  4JRL A;  5GJ6 A;  2ARE A;  2BOI A;  3EQE A;  3SXW A;  2V5Y A;  2W3J A;  4D6S A;  3JCI A;  5C70 A;  1HJG A;  4ZPI A;  3IAP A;  4KL1 A;  4Q1R A;  4H3W A;  1NG0 A;  1GQG A;  4FO9 A;  1W6P B;  5KXD A;  1XRU A;  2EF6 A;  3U0Z A;  4E2Q A;  4XFG A;  1G6N A;  4MX3 A;  3RRD A;  1PK6 A;  1VAK A;  1J84 A;  3MGU A;  1QJE A;  3KZ4 C;  1YJK A;  3VBR A;  3DV8 A;  4D7T A;  1HXS 2;  4Q5O A;  4BMB A;  4LBQ B;  2V72 A;  1S0F A;  3ZYH A;  4A3X A;  1VLN A;  3ES1 A;  4Q0Q A;  5JSO A;  4CDU C;  2PHF A;  5LRS A;  1RIR A;  5BV6 A;  2JG9 A;  2BWC A;  1QQP 2;  4MGK E;  1A6C A;  3B02 A;  1FPN 2;  3CKH A;  3KT1 A;  1EV1 3;  5FZG A;  4E8C A;  4CCK A;  3NJY A;  5DN2 A;  1SCR A;  1URX A;  4QPI C;  1W8H A;  2R49 A;  3HJR A;  2EIG A;  2VMC A;  5EFU A;  5FY7 A;  1MS1 A;  3M4F A;  3PVO A;  3SCF A;  4MOA A;  4BK4 A;  1QNW A;  4GD4 A;  1OD3 A;  4M4R A;  4LHL A;  1MVE A;  4CDQ B;  1CX4 A;  1EAH 3;  1GYK A;  3BOW A;  1ACC A;  1DGW A;  1LKN A;  3IMN A;  1BJQ A;  2BYV E;  2DUR A;  2JWP A;  3SNM A;  4LHS A;  4COW A;  3ZYG A;  2RS5 3;  4JGZ B;  4XHX A;  4LKS A;  4LOT A;  4MET A;  3AMN A;  1ENS A;  2VW2 A;  2ZA9 A;  2A6Z A;  2VZQ A;  2ZGK A;  1GLH A;  1WCK A;  2RJL A;  4JQT A;  4YZ2 A;  1JN2 P;  3C7G A;  5C5T A;  3MUZ 1;  1C57 A;  5JZG B;  3WW1 A;  2B5H A;  1F4A A;  2NYY A;  1MR5 A;  3OGJ A;  4HOO A;  4NWW A;  3VHP A;  5AC9 3;  5DMY A;  1CIW A;  5KXC A;  4ISR A;  1FV3 A;  5FZL A;  1W6M B;  1AR8 1;  1ALY A;  3GF6 A;  1OFS A;  5L9R A;  4N43 B;  3GZA A;  3HIF A;  1CJP A;  4LO8 A;  5FWE A;  1CIY A;  3DYM A;  1DDL A;  3ZFG C;  5C4W B;  1XQN A;  2BPA 2;  2R07 1;  2XJT A;  1QEX A;  2IZW A;  3P3P A;  4R9B A;  1IOA A;  3FZ3 A;  3VBU C;  3FN9 A;  4B8E A;  1H0B A;  3A7Q A;  1HRI 2;  3D6E A;  4F7Z A;  4CXW A;  4F8A A;  3I54 A;  2ZEZ A;  3OPW A;  5IW0 A;  1PMI A;  4YW2 A;  3ZVX A;  1WUV A;  5A7O A;  1F9K A;  2R1D A;  2CWS A;  2GP5 A;  4OI2 A;  4DEQ A;  1Q8P A;  1DU3 D;  1ZZB A;  2A6W A;  2ZHN A;  4YWA A;  4RS5 A;  4XDQ A;  5FP9 A;  4L99 A;  1SDW A;  4Y5Z 0;  5D21 A;  2WZ8 A;  5FO7 B;  5J3U A;  4IV3 C;  4J25 A;  5C8W A;  4Q8K A;  5L73 A;  1OT5 A;  5I0S A;  3VV1 A;  2XBO 1;  5LZ6 A;  3B01 A;  1JMU B;  3HBZ A;  1IGO A;  2XUE A;  4KG8 A;  2XKP A;  4XHB A;  1ZBA 2;  2E7T A;  3I2I A;  5EYY A;  5FYT A;  2D5F A;  5J37 A;  3MFC A;  4DUX A;  1QH7 A;  2P34 A;  3OYW A;  2HWD 2;  3C7H A;  5EJ3 A;  5FZM A;  3FLT A;  1RUI 3;  5SV8 A;  5FDB A;  3H7Y A;  1K5M A;  4CDW C;  3I4I A;  2E51 A;  3CQO A;  3I3B A;  4AFB A;  2BNM A;  2FCU A;  2R7E B;  1CAX A;  2AH2 A;  2JXA A;  3J9S A;  3L2Y A;  4YZ4 A;  2D3P A;  4GKX A;  1TQ5 A;  3ACG A;  3O5S A;  4KGQ A;  1MS0 A;  4XJW A;  4AED A;  4B3N A;  4EV0 A;  3KF3 A;  5H9P A;  1U5Z A;  2BFU L;  4A44 A;  4C1W A;  4JDO A;  1WGP A;  2KA3 A;  1LU2 A;  5C8C C;  4QM8 A;  1PO1 1;  3K3O A;  2RS1 1;  1UU6 A;  1HJF A;  4QPY A;  1F2N A;  2PTM A;  4LKF A;  2DCK A;  4CDX B;  3USU A;  3P3N A;  4YM0 A;  4D7Y A;  2QQU A;  3ACI A;  2BER A;  4XUO A;  3EO6 A;  2WR9 A;  5FXW A;  5FFO C;  1RUD 3;  4IER A;  1JW6 A;  2W47 A;  3UKV A;  3RZL A;  3MLL A;  1ND3 A;  4L11 A;  4Q26 A;  4UBH A;  2JEM A;  2HWC 2;  5F39 A;  4BLJ A;  4NRQ A;  4COV A;  4PIX A;  1AYN 3;  1ZZ8 A;  4JKL A;  2WRA A;  3E6D A;  2HWF 1;  4OVE A;  1SLB A;  1O3R A;  3LEM A;  5A32 A;  2Q8E A;  4C1X A;  2CAU A;  4HET A;  4QKB A;  3VHO A;  3GYD A;  1F5F A;  4MSV A;  5FRE A;  1VBB 2;  1BQP A;  5FTT C;  5FV3 A;  3WQ1 A;  4LHN A;  1RVF 3;  1W39 A;  4V2V A;  3O0W A;  5BNN B;  5LW9 A;  3ZN6 B;  1I1E A;  1V70 A;  3UET A;  1QHD A;  2Y6J A;  5CKM A;  2BEO A;  1V6I A;  5FZB A;  3W21 A;  1TVG A;  3ZKU A;  4NPR A;  2D40 A;  1RUJ 3;  3M1H A;  4ES8 A;  3O1V A;  1N3O A;  1O8S A;  4HON A;  2W5F A;  2D6M A;  3M2M A;  2BQP A;  3IWZ A;  1BEV 3;  3NNL A;  3VDB A;  3FFQ A;  1YUD A;  2NMN A;  3F95 A;  1S2K A;  2ZS6 B;  1Q8Q A;  3GJA A;  4LBN A;  2PHD A;  4YZ5 A;  4DY3 A;  4AI1 A;  3LQC A;  1XU1 A;  5L7O B;  1JU4 A;  2X5I B;  2DVD A;  3X29 B;  1D7P M;  5FZ7 A;  5JXH A;  3O1R A;  2FZ2 A;  1IG3 A;  1MS5 A;  5FR3 A;  1ZBE 3;  5ISL A;  2ZGP A;  1K12 A;  5LBC A;  3KM5 A;  2VOW A;  2ILM A;  3N7L A;  4L9B A;  4RGA A;  4WZC A;  1DQ4 A;  2QUO A;  4CDQ C;  4COY A;  5JMC A;  1B35 A;  3LF7 A;  2W39 A;  2A3W A;  1OOP C;  1X8M A;  2VU9 A;  1NZC A;  1Q8O A;  3I49 A;  1HB4 A;  3AKT A;  2XLF A;  4X6Q B;  1AZD A;  5FPL A;  3TN9 3;  4DRR A;  2I45 A;  1FV2 A;  1PNG A;  5C9A B;  5FYV A;  5A3W A;  3NST A;  5D8A B;  4YVW C;  3WR0 A;  3W5M A;  2VZO A;  1BHG A;  4P9Y A;  4ERO A;  1HW5 A;  5JR7 B;  2C6S A;  1RUE 3;  1D4V B;  1UD1 A;  4I3G A;  1LES A;  2F4L A;  1AX1 A;  2RS3 2;  4IV1 B;  3T4V A;  1R09 2;  2BGP A;  1CZT A;  1MAC A;  4IDZ A;  3H9A A;  5CG8 A;  3THT A;  3SLI A;  2XLG A;  1HV0 A;  2P17 A;  1JOD A;  4CEW C;  4C90 A;  3H1M A;  2NPI A;  3FWE A;  1SLI A;  3U4S A;  3VBH A;  4QX7 A;  1RTV A;  2ATF A;  4LE3 A;  3OY8 A;  3AL6 A;  4MXW B;  4UFL A;  4XJA A;  1RIN A;  2AEY A;  2XGX A;  3AXD A;  5LRR A;  1PZ7 A;  5T52 A;  5CNA A;  2BP6 A;  3I3M A;  1LOE A;  5FZA A;  1T6G C;  4N7I A;  5JSP A;  2DU1 A;  3I3Q A;  5EJ1 B;  3KSC A;  4NE9 A;  2VW0 A;  1W90 A;  2YC2 A;  3BU0 A;  1UKR A;  4DIN B;  1HN0 A;  3SMH A;  4QPG C;  1YIP A;  3VBF C;  4EN9 B;  5HBA A;  1VBE 1;  3FHA A;  4W4Z A;  3D0S A;  1H1A A;  3DPR B;  3MW2 A;  4Y33 A;  5IHR A;  3N7K A;  3JBG 3;  5CG9 A;  2OVU A;  3MHZ A;  1MQT B;  1HQW A;  4YM2 A;  4BIS A;  2VBP A;  4CEY C;  3OGR A;  4QB2 A;  5ACA 3;  4PBP A;  1O4T A;  1COV 3;  4EQV A;  5DDJ 3;  5A3N A;  2WSU A;  2VBD A;  3WP6 A;  2D44 A;  5EQU A;  4XDO A;  3U78 A;  4P5H A;  4UFK A;  5FLJ A;  2VAU A;  3UYJ A;  3M3E A;  4XET A;  4AHY A;  5D1I A;  4ZU4 A;  1GR3 A;  1VIW B;  1K5J A;  2R04 1;  3GAL A;  3MIC A;  3AXE A;  1MZ5 A;  3ZFF B;  3AKQ A;  2ARB A;  3NV4 A;  3ZXL A;  4NHM A;  4TLG A;  5EP9 A;  2PA7 A;  5FY9 A;  1DGR A;  4PF5 A;  1ENQ A;  1EY2 A;  4K20 A;  1GZC A;  3UL2 A;  4CUG A;  2O8O A;  4QKN A;  2DDU A;  4YLZ A;  3RPQ A;  1RUG 1;  2AEN A;  2CGO A;  2WZR 1;  3PVE A;  3SH4 A;  3ZDV A;  4YG6 A;  1DHK B;  3VBO C;  3PTR B;  2QQV A;  2IUW A;  2R16 A;  3AMP A;  4Q4Y 1;  1HQN A;  1HB2 A;  4XPV A;  2WLP A;  1ST8 A;  2E53 A;  4GB3 3;  2VCC A;  3MI8 A;  4NHX A;  3W58 A;  3BIE A;  3ECQ A;  3B00 A;  1D4M 3;  2HEY F;  3I97 A;  3PVN A;  4LTA A;  5CU1 A;  1XNC A;  3CDZ B;  1SBF A;  3ITQ A;  3JQX A;  3KV6 A;  2ZHK A;  5FZK A;  5IWF A;  3WG3 A;  3ZDS A;  3ZIX A;  4TTG A;  3O0X A;  1PGL 2;  1QDC A;  4GH4 B;  5IK8 A;  4I2O A;  5HI0 A;  2EXI A;  3M8L A;  4BM8 A;  1LEM A;  1QQP 1;  5F5I A;  4CXX A;  3IPV B;  4MH0 E;  4ZU7 A;  4DNY A;  4CE8 A;  4HN0 A;  4RHV 1;  4H7L A;  3AYA A;  4E27 A;  5ABJ B;  1KQR A;  3ON7 A;  1HLC A;  1W3V A;  4AI8 A;  2UWA A;  4NIA A;  5FO8 B;  2DBI A;  3SIT A;  4XAA A;  5CFD B;  2J7M A;  5FZ1 A;  1NXD 1;  4OMD A;  4COZ A;  4FAG A;  1QIQ A;  3NNG A;  4IEO A;  1IQA A;  4KBZ A;  2VOT A;  2K0G A;  3AP4 A;  3KWV A;  1ULP A;  4FT8 A;  3VDC A;  5JWP A;  1J59 A;  1H2N A;  1QJU 3;  4PQQ A;  4NAO A;  5DZG A;  1X82 A;  5LBF A;  2Q8D A;  1N1S A;  1R1A 1;  5T5P A;  2FD8 A;  1XB9 A;  1FMD 3;  1N47 A;  2GN7 A;  3CHX A;  1LHU A;  2P4E A;  1J3P A;  2MPF A;  3WF2 A;  2W2I A;  5JZG A;  2VCA A;  4K9S A;  4P5Y A;  1ASJ 3;  1C8M 2;  2VXR A;  1GQP A;  4AQT A;  1S0D A;  1S0C A;  3T2T A;  2D6N A;  2BJS A;  2VEC A;  3J7M A;  4BE3 A;  1W6M A;  3O1T A;  3WXP A;  2KR2 A;  4EE2 A;  3L2H A;  4NRP A;  5I0U A;  4N43 A;  4YVS C;  5IAV A;  5LB6 A;  3T1M A;  4CCM A;  4D8M A;  3UKT A;  5KHK A;  1JYW A;  5BXX A;  5FMO L;  4NIH A;  3ZM8 A;  4B4R A;  1JYX A;  4YGE A;  2WZP P;  3FFZ A;  1HV1 A;  3WQ7 A;  1O5L A;  3MPP G;  5FBJ A;  1O91 A;  2VVD A;  3PL0 A;  3VD5 A;  1QJZ A;  2Q1Z B;  3HWJ A;  3ILF A;  2LS6 A;  4YFW A;  2R30 A;  3AMQ A;  4QXB A;  5A80 A;  3T1L A;  4UW5 A;  1NY7 1;  2F4P A;  4YW6 A;  1XPW A;  1UY4 A;  4FQ4 A;  5KXE A;  1W9T A;  1ENX A;  1X33 A;  3J4U H;  1UXX X;  1QJY 3;  3T2P A;  1REF A;  1UOJ A;  2WNV B;  3VKO A;  4KMQ A;  2EIB A;  2QDN A;  1PX3 A;  2VE1 A;  3N9N A;  4NUB A;  4P9G A;  3QAC A;  3V64 A;  3V65 A;  1ZRF A;  4MLO A;  1VAM A;  2G9G A;  4JTO A;  2XXZ A;  2WT0 A;  1HRV 3;  2GDF A;  4YM1 A;  2WFF 1;  2VOV A;  1NA1 B;  3RGB A;  4BYY A;  2QQJ A;  1AL2 3;  5EZW A;  5T55 A;  4QU1 A;  5A7W A;  3OBR A;  3OBA A;  5JIA A;  5I0T A;  5CEH A;  3UKN A;  4WVW A;  1UX7 A;  5FPB A;  4L97 A;  1MS3 A;  3ZXA C;  3AKS A;  5DUU A;  4IND A;  4BZ4 A;  3ZO0 B;  4WM7 B;  3CJI C;  2YC4 A;  2VZT A;  2BDR A;  1Y3T A;  5LBE A;  2HBT A;  2R07 2;  5CAD A;  5JPM B;  1A34 A;  2WA4 A;  5KHG A;  3IN9 A;  5JI9 A;  4RD7 A;  2HWB 3;  3WEZ A;  1JYT A;  4FPK A;  4BXF A;  2QE3 A;  3KVB A;  1XE8 A;  2IXK A;  3O0V A;  2VUA A;  3ZFE C;  4QDR A;  3SEE A;  5BNP B;  1AXZ A;  1LOC A;  4IE7 A;  1X36 A;  4OI1 A;  3RWN A;  1W9S A;  4CDX A;  2WS9 3;  4AHW A;  1SPP B;  1TME 1;  4AL9 A;  4S2F A;  1GP5 A;  1Q5O A;  1PMJ X;  4NMI A;  1DYK A;  4ASL A;  2X29 A;  5FZ8 A;  1UYY A;  4E2S A;  2ZOE B;  2YYO A;  3V0B B;  2FHR A;  1LHN A;  2A6V A;  2XBO 2;  3GHM A;  5A3U A;  1G9A A;  3ZYI B;  2Y33 A;  4FFF A;  2C5D A;  4QKF A;  5F2S A;  1JU3 A;  2HWC 1;  3G7D A;  4YG0 A;  3U4X A;  2AYH A;  2JDY A;  2ZGM A;  1NQD A;  5T50 A;  3CJX A;  4J6G A;  3R4D B;  1ZZ7 A;  1XE0 A;  3ZYB A;  2UY9 A;  4LIV A;  5JXI A;  1ONA A;  5L9B A;  1B09 A;  1VBD 2;  4AED B;  1OH3 A;  5KR7 A;  1XND A;  3AVR A;  3GBG A;  1VBB 1;  4CP9 B;  1LHO A;  3BN6 A;  1PIV 1;  5HV4 A;  4PI2 A;  1F5J A;  4PT6 A;  4YYO A;  4UFI A;  3IKW A;  1KS4 A;  5FYY A;  3KV4 A;  1O6U A;  3ZN6 A;  4AFD A;  2XL7 A;  2QCS B;  3N9O A;  1RUC 3;  2VZR A;  3AX4 A;  4Q0S A;  1KFU L;  2X8K A;  1POV 3;  2W94 A;  3PTY A;  5FMB A;  2WJS A;  4FPL A;  2IFR A;  2RS1 2;  3N7M A;  1TEI A;  3IBM A;  3RS6 A;  3DUI A;  3SKV A;  4XMI A;  4JDM A;  4FPY A;  3B9I A;  1V00 A;  5LY2 A;  3RZJ A;  1W2N A;  4G3Y C;  1O4Y A;  4EWA A;  1JXN A;  1LOG A;  1O3Q A;  3I2H A;  4CDU B;  2RR1 3;  3I2F A;  4P9W A;  3KB5 A;  4YW5 A;  5FZC A;  5L7O A;  2X5I A;  2VOK A;  3B69 A;  3W5N A;  3POG A;  4UOJ A;  2E63 A;  1WLD A;  4KU8 A;  1CAU B;  1FX5 A;  2GAL A;  4ASK A;  4QPI B;  3TWI A;  5FK8 A;  3GM8 A;  3OBT A;  4NRM A;  1GIC A;  3H1Y A;  1UOG A;  3BUC A;  3T4H B;  3EB7 A;  1WD4 A;  1AJK A;  1LCL A;  1XC6 A;  2GH2 A;  1AYM 3;  2J1S A;  2J22 A;  2Y6F A;  4M00 A;  2X05 A;  1OHF A;  1RUH 2;  1UPI A;  2EIE A;  3NMB A;  3NVC A;  3D4K A;  2IXC A;  3R4U A;  1UO9 A;  4Q8L A;  3WNX A;  5FZD A;  5C9A A;  3AB0 A;  3IDA A;  3NAP C;  3LE0 A;  5D8A A;  3WG1 A;  5JMO A;  1UMH A;  1HB3 A;  1ZRI A;  1LOF C;  5IK5 A;  4GKY A;  3QH7 A;  4MGI E;  2JEN A;  4IV1 A;  1UNB A;  2RS3 1;  2D6P A;  2A6X A;  1ND2 C;  1M4W A;  1R09 1;  2BTV C;  3RMY A;  3AZY A;  4ZS3 A;  5D2A A;  2FDH A;  5GZD A;  3RG0 A;  2BOJ A;  3AL5 A;  5FXX A;  3WOG A;  5FY4 A;  4I30 A;  5IVB A;  3HT1 A;  5J36 A;  2SBA A;  4YW4 A;  5I0R A;  1LJ7 A;  1CN1 A;  1FNZ A;  1S2E A;  4MXW A;  2VQ0 A;  4HKL A;  1N3P A;  2VXJ A;  3HOB A;  3AP6 A;  4ITC A;  4E4Z A;  1MZF A;  3ZFG B;  2W92 A;  3RSJ A;  3MYX A;  1I3H A;  5DXD A;  2QQP A;  5EWS A;  2P3I A;  5IYY A;  3VBU B;  1F31 A;  5CKN A;  3WG2 A;  4QHO A;  1WLT A;  5DAP A;  1W99 A;  2NMO A;  2WAO A;  2Z79 A;  3DYP A;  5FZ9 A;  5FWJ A;  2PLV 1;  2WSV A;  3N35 A;  1NZI A;  3TB0 A;  1PK6 C;  1CX1 A;  4K1Y A;  3DPR A;  2OZ6 A;  4YAR A;  1H4G A;  3HBK A;  2AZ5 A;  2BGO A;  3CIH A;  3RQ0 A;  1W6N B;  1MQT A;  4AAP A;  3KV5 A;  4HFS A;  2Q1M A;  1VP6 A;  2R06 2;  2XVK A;  4W6X A;  1RED A;  1H8T C;  2ZMK A;  5FKC A;  2CWM A;  2JG9 C;  5T5O A;  3OG2 A;  3OEB A;  1KD7 A;  1IHM A;  1MEC 1;  5A7S A;  4IV3 B;  2A71 A;  5FP4 A;  5FUN A;  1RUF 3;  3WNP A;  2OS2 A;  1AR6 3;  3J7H A;  5DUW A;  1YHF A;  4O7X A;  4IEV A;  3AZZ A;  3T3Y A;  3JB8 A;  4BQ3 A;  3JD7 3;  2VTX J;  4ZKT B;  4K8R B;  3A0K A;  3KCC A;  2WYF A;  3IB3 A;  2OUJ A;  2I2S A;  2RDS A;  3FLR A;  1YI9 A;  1W9W A;  4Q4V 3;  4RSU A;  4YZ3 A;  3SH5 A;  1UMZ A;  3ZFF A;  1XJA A;  4AGG A;  3LEG A;  4R52 A;  2LM3 A;  2ZCW A;  4D6R A;  2Y0O A;  4H55 A;  1ULE A;  5G05 L;  3H0O A;  4QB1 A;  1NCR C;  2EAA A;  4CDW B;  4A4A A;  4NOT A;  1IKQ A;  4KBB A;  2B4K A;  4F83 A;  1ODM A;  2DU0 A;  2Q5T A;  3FMG A;  4CU6 A;  2P6H A;  2ADE A;  5JVV A;  3WP5 A;  5CIS A;  1CAW B;  2Q0A A;  2CGP A;  1OLQ A;  4P02 B;  3GZE A;  4LMF A;  1UXZ A;  3VL9 A;  3IT8 A;  5JOZ A;  3J8F 3;  3A4U A;  4BME A;  1DQ6 A;  5C8C B;  4CCC A;  1WMF A;  3K46 A;  5FUI A;  3UNP A;  2XQX A;  3DXT A;  1XYP A;  1PGL 1;  4GH4 A;  1X8E A;  1W8N A;  5KHJ A;  4COU A;  1Z7S 2;  1OF3 A;  5HV0 A;  2AGS A;  2I07 B;  2WAB A;  1SLC A;  4B4Q A;  2OPK A;  5ABJ A;  4AI3 A;  2PXJ A;  4W6Y A;  2ARC A;  1XNB A;  2XG3 A;  2RM2 2;  5F5A A;  4AI0 A;  4CCE A;  2R04 2;  1W2A X;  2WNO A;  4AI9 A;  4XC9 A;  2RVA A;  5CFD A;  2JJ6 A;  4XYX A;  5C3Q A;  1QXP A;  3RDI A;  5HXM A;  4QD2 A;  2CGN A;  4HT1 T;  3NNM A;  2ZXQ A;  4IW3 A;  1FAY A;  1T6B X;  1FOD 2;  1RUG 2;  2WZR 2;  1H9P A;  4BJ0 A;  4BQX A;  3GDB A;  4E4H A;  5FY8 A;  5F3C A;  5T3N A;  1DF0 A;  4IE4 A;  1Z78 A;  3M3O A;  4Q4Y 2;  3GBF A;  1O8P A;  4XQ4 A;  1QMJ A;  2GC0 A;  1CR7 A;  2PAE A;  3POS A;  5H9R A;  3NQH A;  2YC0 A;  2Q1F A;  4QQO A;  1TMF 3;  2XJP A;  5K4L A;  4XFB A;  3T0B A;  1C8M 1;  1FAT A;  1Q8V A;  3LDB A;  1ENR A;  3PDQ A;  4JKM A;  4O65 A;  4X8P A;  5FPV A;  1HX6 A;  1SMV A;  4QQL A;  4LKD A;  2Y6H A;  3PME A;  4WVM A;  1K5M C;  4Y26 A;  3BOP A;  3OEA A;  4QWN A;  4XCB A;  2P3Y A;  4DUV A;  4AHX A;  3DKW A;  2Y34 A;  3VD7 A;  1V6M A;  4CPB A;  4RHV 2;  2OII A;  2WC2 A;  4J1X A;  5FMD A;  4C91 A;  4BWO A;  1KEX A;  4BB3 A;  1EPZ A;  4UI9 L;  5IFP A;  2PHT A;  3MLJ A;  5KBF A;  4C8D A;  5JUV A;  3W20 A;  2YMZ A;  3QH6 A;  2D6O X;  1SLT A;  2C9K A;  1X7N A;  2XWJ B;  1OOP B;  5FZO B;  1M06 G;  2W87 A;  2WNU C;  4EN7 B;  1NE6 A;  1UAI A;  2WNV A;  2OA2 A;  1UYP A;  2GNM A;  4DXS A;  1R1A 2;  5ERL A;  4YVW B;  3RZM A;  2Q4S A;  2I74 A;  3E1F 1;  4FPG A;  4QGN A;  2JE9 A;  4DY5 A;  2DF7 A;  2ET7 A;  2HEV F;  2ZHM A;  2WO1 A;  1AR8 3;  4MHR A;  1OLM E;  1ULG A;  3MF6 A;  4ZXE A;  3RMX A;  1NA1 A;  3O1P A;  3B3Q E;  3WCS A;  3T0D A;  3BTZ A;  2B7Y A;  1V9U 2;  4I0B A;  4RA0 A;  1EV1 1;  1WLW A;  2WT1 A;  4CEW B;  3THC A;  2W0X A;  2FMD A;  4CTE A;  4AEK A;  3HPN A;  3M70 A;  5T54 A;  3AC0 A;  3AFG A;  3AYE A;  5JSR A;  1GOG A;  1C3H A;  3BIW E;  4WM7 A;  2DUP A;  3HNB M;  5LAS A;  1UZ0 A;  4HPK A;  4XZP A;  4IEW A;  4RYD A;  1EAH 1;  3Q8B A;  3R05 A;  3K48 A;  3I2G A;  3LOI A;  1VRB A;  4GAZ A;  3ZSM A;  5LEJ A;  2RHP A;  3BVC A;  1XNA A;  1BBT 2;  5ANQ A;  5GZE A;  1MZ6 A;  4QQH A;  4D3W A;  2RS5 1;  4QPG B;  5C3R A;  3VBF B;  2Y64 A;  3CZJ A;  4G4F A;  5LY1 A;  4DEV A;  3C7F A;  3EBR A;  4A7Z A;  1NY7 2;  5BNP A;  1JHN A;  5GZF A;  4XF9 A;  2VMD A;  1RJ8 A;  2LRO A;  2ZJC A;  3M3I A;  4B1L A;  3DCQ A;  4CEY B;  1O59 A;  1SPP A;  1UKG A;  2W52 A;  4WM8 A;  3CLP A;  3VD3 A;  4JGY C;  5AC9 1;  1GUI A;  2XOM A;  2CNA A;  1QJX 2;  2EXK A;  5HXV A;  1ZZC A;  3V0B A;  4ET7 A;  1HKD A;  4Z07 A;  3MZH A;  1AR7 3;  1H1M A;  2JIC A;  2UWB A;  2ZPX A;  2ZX4 A;  2WFF 2;  5E1R A;  3LFI A;  1PZ8 A;  3GGL A;  5B4X A;  5FZ6 A;  4PI0 A;  3ZMO A;  5A3M A;  2WL1 A;  3H50 A;  1ZZ9 A;  4FTB A;  1VBD 1;  4XTP A;  4CP9 A;  5GAL A;  5CFC A;  3ETQ A;  3PU3 A;  1HN1 A;  2BV4 A;  3KVA A;  2WDB A;  1C4R A;  4IL7 A;  4TLF A;  1WW4 A;  1LNS A;  2YDE A;  3BU7 A;  4BQ1 A;  2PQQ A;  2YGM A;  1OH4 A;  1PO1 3;  4LBL A;  2Y0I A;  1VMH A;  3VBO B;  2ZHL A;  3MV0 1;  3H3Z A;  1UYX A;  4GUL A;  3RZZ A;  3RJ2 X;  1ZA4 A;  3APB A;  3KCX A;  4LIU A;  4W8J A;  3VKF C;  4D7S A;  4WBB A;  4HVO A;  4A7K A;  4V1P A;  5JOW A;  5GKA C;  3OPZ A;  2IXH A;  1A8D A;  1K45 A;  2VGD A;  1TME 2;  1UZV A;  1DCS A;  4GZ9 A;  2WN3 A;  4Y5S A;  5JOY A;  2XJV A;  2ZKN A;  4NVP A;  4CDU A;  2YBP A;  3J7N A;  4AOC A;  3PU8 A;  5JXJ A;  2HWF 3;  1RHI 3;  1CAU A;  1RMU 3;  2E26 A;  2X09 A;  3ILN A;  4U2A A;  5FY1 A;  4C0B A;  5IT6 A;  4QPI A;  1YJL A;  2ZML A;  1JYI A;  4K1Z A;  3A23 A;  1YQC A;  1SG3 A;  4URT A;  5F5Q A;  1BK0 A;  4A42 A;  1VBA 2;  2TBV A;  3OUJ A;  2V4V A;  1PO2 2;  3PJQ A;  4XIK A;  2ENR A;  4LIT A;  1RUH 1;  4IEZ A;  3VZO A;  4NAM A;  1PIV 2;  4IXL A;  3THP A;  1FXZ A;  1PGW 2;  5JDB A;  2IXJ A;  3FHI B;  3WG4 A;  4CUB A;  5EIY B;  1LGB A;  2BFU S;  3DEM A;  3MIG A;  4XFH A;  3POI A;  1OQD A;  3POE A;  2FQP A;  1DZR A;  1QF3 A;  1R1Z A;  2JX9 A;  1TNR A;  2WAA A;  2HLE A;  3AZX A;  2JE7 A;  3QOP A;  4TXW A;  3T2O A;  4MHU A;  4YW3 A;  3OB8 A;  3QBQ A;  1D0H A;  3SKJ E;  5GZG A;  4BQ4 A;  2ZGN A;  3VZM A;  4UAP A;  3PNA A;  2VR4 A;  2JDA A;  4HSL A;  4YVS B;  3AP7 A;  4XDP A;  2EXH A;  3ZFG A;  1W6O A;  4DS0 A;  1J83 A;  1S0B A;  2EXJ A;  2PAM A;  3OGS A;  1SFN A;  3B9C A;  4HKO A;  4MZU A;  4O9E A;  3S7I A;  2PHL A;  2Z2S B;  4M3C E;  2KM2 A;  4ATF A;  3B93 A;  3WZ1 A;  5M0T A;  2HH9 A;  1JZ7 A;  4OCT A;  1RVF 1;  3BYW A;  1Y4W A;  2A7A A;  2NM1 A;  1VRH 3;  4RQP C;  1GNZ A;  1V6K A;  1W6N A;  3VDA A;  1EUT A;  4GWJ A;  1W03 A;  3ACL A;  3WHU A;  5T5J A;  2R06 1;  1F4H A;  4DXR A;  2E6V A;  1DZT A;  1Q3E A;  1UU4 A;  1RUJ 1;  3ZXE A;  4N90 A;  4XBQ A;  2XPJ A;  4TN7 A;  5LAT A;  3VKM A;  4MYE A;  1MS8 A;  4I02 A;  1BEV 1;  4IV3 A;  4JHT A;  2GNB A;  3WNL A;  4EWE A;  4HVQ A;  1KRI A;  3MUY 1;  2VMG A;  2J1V A;  5E8A A;  4DIQ A;  1CQ9 A;  2RMU 2;  3K51 A;  3S0M A;  1CPM A;  2C0Z A;  3AKP A;  3T30 A;  3MDP A;  3Q8C A;  3NO8 A;  5DG2 A;  5K0U C;  3K4D A;  1ODN A;  5BPX A;  4MGS A;  4DXZ A;  1UPS A;  4CCD A;  3ZSL A;  1AR9 3;  2YHJ A;  3PHM A;  4BOW A;  2OQ7 A;  3SQO A;  4CDW A;  2ZX3 A;  2IXI A;  3CJI B;  1VBE 3;  1R08 3;  2OPW A;  1UY3 A;  5FCC A;  2BBV A;  1W06 A;  2HYX A;  2C1F A;  5FO9 B;  1H1I A;  2HWE 3;  3WW2 A;  1I5P A;  1BKZ A;  1S1A A;  2X53 S;  3VBS C;  3WNK A;  5CVR A;  1CAW A;  4NPL A;  4QGM A;  1JYV A;  4UW4 A;  2PLV 2;  2WUH A;  4Q4W 3;  4IE0 A;  1O7F A;  4XOG A;  1RXF A;  2G9F A;  3BB6 A;  4CA9 A;  2XB6 C;  3E5X A;  1ZRD A;  5C8C A;  1WMX A;  3E5Q A;  1NCQ C;  1RUE 1;  4FP2 A;  3WY6 A;  3ZFE B;  1LTE A;  1OSG A;  4XCA A;  4CPB D;  2EID A;  5EYX A;  2CU5 A;  3NV3 A;  2MEV 2;  3PIG A;  2LAL A;  1NT0 A;  3UJO A;  1MEC 2;  4ASM B;  3WF0 A;  1OKO A;  1SHW B;  1Z7S 1;  4L2N A;  5FZ4 A;  2FDF A;  4OHY A;  2VMI A;  2E33 A;  1O5U A;  1V0A A;  5CIR A;  4YW7 A;  1OUR A;  1SQ4 A;  2OXB A;  3MIB A;  4IE6 A;  1JZ2 A;  2A3X A;  4LO7 A;  1N1Y A;  5A1A A;  2D93 A;  2RV9 A;  4ZZ5 A;  1ULD A;  2RM2 1;  3OD0 A;  4GA9 A;  1VAV A;  1W0O A;  2VUC A;  5C3S A;  2ARX A;  4U36 A;  3O12 A;  4KI5 M;  4JCK A;  1VBC 2;  2H0V A;  2WNE A;  4OMC A;  2CAV A;  2JDP A;  3ZMN A;  1FOD 1;  2ET1 A;  4OLL A;  3FJS A;  4LE4 A;  3LSD A;  3JBG 1;  4Y1X A;  5IVE A;  2XUM A;  1W8F A;  1LR5 A;  1JZ5 A;  2TUN A;  4YSF A;  2YGL A;  1YQ5 A;  3PLQ A;  1W6P A;  5DAX A;  3UT0 A;  4BK5 A;  5L19 A;  4GMP 3;  3NJV A;  4Q0P A;  3AJY A;  1COV 1;  1HXS 3;  3S57 A;  2ETE A;  4JAA A;  4JQR A;  3MW3 A;  2GMP A;  2O0O A;  4OUE A;  5K8S A;  3TAY A;  1QQP 3;  4XIO A;  1QU0 A;  1FPN 3;  5FOJ B;  5FY5 A;  1PVC 2;  3JD7 2;  4WV8 A;  3GCX A;  4PCR A;  1LGN A;  1R64 A;  1LEN A;  2D98 A;  2OZJ A;  4LBQ A;  1HQL A;  2PYT A;  4NWV A;  5DPN A;  5AFB A;  3KLS A;  5GZC A;  3NL1 A;  5IVF A;  1OA2 A;  1H2K A;  4KWU A;  1AX0 A;  4RFT 0;  3ACF A;  2PN5 A;  1GOH A;  2ORX A;  1YQ8 A;  3PUR A;  3C2U A;  1KFX L;  1E57 A;  2AAC A;  2OW4 A;  1QXJ A;  2ZGO A;  5FPZ A;  5GM0 A;  3AYD A;  2IWG B;  4UFM A;  3K4A A;  1XU2 A;  3BCW A;  1AXK A;  4CDQ A;  1JZ8 A;  3KD4 A;  4QX3 A;  2JD4 A;  1OKQ A;  2LW8 A;  4Y1U A;  2VNV A;  1CPN A;  2QVS B;  3AJZ A;  1OOP A;  2GN3 A;  1DZQ A;  4GB3 1;  2YFZ A;  1WBL A;  3ZN5 A;  2MNG A;  1OPO A;  2P5B A;  3IAQ A;  3SEP A;  3S5Q A;  4JGZ A;  5H9S A;  5JLV A;  3E6C C;  4MGQ A;  3NAP B;  2W1S A;  4YVW A;  5FAX A;  2QZ3 A;  4FPF A;  4OZX A;  1S55 A;  2H6B A;  2ZTN A;  3TEW A;  2WKK A;  2H6C A;  2JEC A;  2YPJ A;  3ROU A;  1ND2 B;  1A78 A;  4P14 A;  1S0G A;  3IZO A;  1V9U 1;  1G9F A;  2ZBJ A;  1LOB A;  2JG8 C;  3VLB B;  4Q4X 2;  3CEW A;  4CEW A;  4RR3 C;  4OHZ A;  4I09 A;  4UW3 A;  2Y6K A;  2D6K A;  4QDQ A;  4QAW A;  4Z82 A;  4HSJ A;  1HRI 3;  5FIX A;  2VZP A;  1CD3 G;  1POV 0;  3HAG A;  5FUP A;  4GJY A;  5C4W A;  2VQA A;  3ZXJ A;  4BQ2 A;  3ZIW A;  2P3K A;  4CP0 A;  1W04 A;  3I2K A;  1QGL A;  2WWJ A;  4AWD A;  4JZR A;  3A21 A;  4YRD A;  1BVP 1;  1BBT 1;  1DIW A;  3RYK A;  3BTY A;  4XXP A;  2P6C A;  4QB6 A;  4QPG A;  4RN5 A;  2GC3 A;  1U5Y A;  2ZGR A;  3TEY A;  1WZX A;  4XF4 A;  1PK6 B;  3MBW A;  3E97 A;  4XQD A;  4EZH A;  4Z1V A;  4M3C F;  1H2L A;  3TBD A;  4PBO A;  1X50 A;  3C3V A;  3U10 A;  4AI2 A;  4Z92 B;  2DVB A;  2UWC A;  1NAE A;  2BVB A;  3O7O A;  4AG4 A;  4ATE A;  4CEY A;  4PDW C;  3FC0 A;  2D7F A;  1YIF A;  4AVA A;  4HBN A;  1K42 A;  2ZGS A;  1H8T B;  3HQU A;  5C3P A;  3OTF A;  2JG9 B;  4BA6 A;  1QJX 1;  1ZBA 3;  4S2D A;  4Y24 A;  1WLC A;  3D82 A;  3SHR A;  4CCJ A;  2UY8 A;  3JZV A;  4XUT A;  3TEZ A;  3U37 A;  4LBO A;  4XAC A;  2EA7 A;  3LA3 A;  4LBK A;  2HWD 3;  5A7P A;  3U75 A;  3LDK A;  2W08 A;  4R9C A;  4FPJ A;  1EV1 2;  2CHH A;  5J96 B;  2Y8K A;  4O61 A;  1GOF A;  3U11 A;  1OI6 A;  3VL8 A;  4FPO B;  3OF1 A;  2XWB B;  3OUH A;  3OCP A;  4FXK B;  5FMO S;  5FJK A;  3P1I A;  3C8X A;  2VMF A;  4D6Q A;  3H3U A;  3I8T A;  1NCR B;  1UZZ A;  1WCD J;  1EAH 2;  1LOA A;  2NLR A;  1GP4 A;  1ULF A;  4ORF A;  3Q8E A;  2VC9 A;  4ZHN A;  2B45 X;  1IS3 A;  3JB4 C;  4Q29 A;  3VBO A;  1SFY A;  1QJY 1;  3CZU A;  4H14 A;  3DGT A;  5IVY A;  2RS5 2;  3ZXD A;  3M3C A;  1DYO A;  2BUK A;  4XAB A;  4LT5 A;  4I0W B;  1C5H A;  3EJK A;  4PIY A;  2ZZQ A;  5F3I A;  1JI6 A;  4FVV A;  2V73 A;  5HPO A;  1H9W A;  1WA6 X;  5FJH A;  1G8W A;  2ID4 A;  3HD8 B;  2P2K A;  1H30 A;  1J1L A;  1HRV 1;  2WFP A;  1IKP A;  3HR9 A;  1WW7 A;  5FZE A;  3BOD A;  5AC9 2;  2HWC 3;  2B9V A;  3HN3 A;  2B9U A;  1KDK A;  2Y26 A;  5A6Q A;  4LA2 A;  5FP3 A;  4EN0 A;  1NX9 A;  2OUH A;  3F2Z A;  4BXS V;  2EVX A;  5FLH A;  3WP3 A;  3JXS A;  1AVB A;  1VBB 3;  2JDH A;  5B4N A;  2DUO A;  3LPF A;  1V6L A;  3N9L A;  3B94 A;  3VDD C;  4ZZ8 A;  1VBA 1;  5BNO C;  4NHL A;  2HWB 1;  3K77 A;  5IK4 A;  1PO2 1;  4FFG A;  5DZE A;  4EN8 B;  3N36 A;  4E8D A;  4QU2 A;  4QXH A;  3KF5 A;  3LDR A;  3A22 A;  2VVF A;  1NYW A;  3WDT A;  1SLA A;  1DGL A;  2XR4 A;  4CCL A;  3NJX A;  1Q43 A;  1PGW 1;  5BNN A;  5F5C A;  4XZU G;  1D0G A;  5A3O A;  5DAV A;  2HBU A;  1L3J A;  3KV9 A;  5FYC A;  2GNT A;  4FPE A;  2C24 A;  2YB7 A;  3SCG A;  1RYY A;  5FYB A;  3LD8 A;  2R0H A;  4N53 C;  3POY A;  1JH5 A;  2ZEW A;  3OYW B;  1LEC A;  4CRQ A;  3AP9 A;  1UL9 A;  2Y60 A;  1K5M B;  4YVS A;  1YI7 A;  3O1S A;  2DVF A;  1IZ3 A;  4IEY A;  4NJ4 A;  1JS9 A;  4A41 A;  1XNK A;  4LEJ A;  1CAX B;  1SZB A;  2W1W A;  2TNF A;  4LLO A;  1RUI 2;  2Y6G A;  4K3U A;  4CU7 A;  1DGR N;  3WDV A;  4AQ6 A;  3SC7 X;  4ZS2 A;  5AVA A;  4ARX A;  1N1V A;  5EXO A;  1ZVF A;  3ABZ A;  3PUH A;  5F3E A;  4Z8B A;  4MV2 A;  4AFM A;  4MAD A;  3LIH A;  1VR3 A;  2D3S A;  5A1L A;  3WW4 A;  2WA3 A;  4LUK A;  1IPS A;  4R4Z A;  1AL0 G;  3ZSJ A;  4ZXK A;  3KHB A;  4Q1P A;  3EMR A;  2ZX0 A;  2RS3 3;  2WNU B;  2VZU A;  1R09 3;  2PFW A;  3BTA A;  2OT7 A;  4UFJ A;  1OUX A;  1VAL A;  5CYY A;  2FCV A;  4CU9 A;  2A6Y A;  2RMU 1;  3D8C A;  4XW3 A;  1S2B A;  3WF4 A;  4QHB A;  3OPT A;  3ST7 A;  2VQU A;  2KXL A;  3WUC A;  5LEK A;  2RR1 1;  2ZAC A;  4PHZ A;  4Q0V A;  1SBD A;  1RUD 2;  3A0N A;  4FPC A;  4LJH A;  4DUW A;  5J48 A;  2BNO A;  1EP0 A;  1U12 A;  4OUL A;  2EAL A;  1GFF 2;  1AYN 2;  4XF0 A;  2XJQ A;  3CJI A;  3WLU A;  2YUE A;  1AYM 1;  4Y1V A;  2B42 B;  1ZM1 A;  3T2Q A;  1WW6 A;  4KQ7 A;  1STM A;  1GMM A;  1C1F A;  1UOF A;  2MHF A;  1RVF 2;  3M7A A;  1KGY A;  3DF0 A;  4LBQ D;  4YW1 A;  4Y1Z A;  2JKB A;  2AEZ A;  3JUU A;  1RGS A;  1FI2 A;  3MEP A;  4KWK A;  3RVH A;  2EIC A;  3VBR C;  4QDS A;  1SEF A;  3ZFE A;  4MG2 A;  4A6O A;  5F3G A;  2IVI B;  4EWD A;  4SBV A;  1RUJ 2;  2MEV 1;  4XJU A;  5A3L A;  4OUM A;  4JGY B;  1HDK A;  1BEV 2;  2FDJ A;  2Q8O A;  3MPB A;  4XE9 A;  1GAN A;  5C7G A;  2NQY A;  1J58 A;  4NHK A;  1J3R A;  4QX8 A;  4AFC A;  2QFE A;  1G9C A;  4OUS A;  3J26 N;  3NJZ A;  1REE A;  5CB7 A;  1SAC A;  3BPS A;  1GNY A;  4P9J A;  3N9P A;  1YFX A;  1ZBE 2;  5DAQ A;  3C7E A;  2D43 A;  5FZ3 A;  2GSY A;  4A3Z A;  2ZGT A;  1N3Q A;  1VBC 1;  3H1W A;  4UW6 A;  3MLK A;  4L8Q A;  4PLO A;  4W50 A;  1DLC A;  2DCZ A;  5FLI A;  1BXH A;  1BZW A;  1RC6 A;  1WKY A;  2CTV A;  4NII A;  2XHK A;  4AQ2 A;  2XL9 A;  3CO2 A;  4LUL A;  2OKX A;  3TN9 2;  2BU9 A;  4DRV A;  2A3Y A;  2VL4 A;  3HQX A;  3WP4 A;  4AF9 A;  5K9Y A;  1RIT A;  2K2S A;  4K7J A;  4LR4 A;  2VJX A;  4YG3 A;  3TRS B;  2RJK A;  5CA6 A;  1VMF A;  3GNE A;  5CBL A;  4GJZ A;  1RUF 1;  4SLI A;  1RUE 2;  4CP2 A;  3LOB A;  1AR6 1;  2XVG A;  4NO4 A;  4D69 A;  1JYN A;  1PVC 1;  3JD7 1;  4LUM A;  4GAL A;  4AVS A;  2VO5 A;  2XML A;  4HXC A;  2RDR A;  1UW8 A;  4LHK A;  1LUL A;  1KIT A;  2C4X A;  2JB4 A;  4KH9 A;  4Q4V 1;  4QXK A;  4IET A;  3CMG A;  3IPV A;  1IG0 A;  2YBS A;  4HAN A;  3LFM A;  1NLQ A;  1DP0 A;  4LO6 B;  4AW7 A;  2Z69 A;  1G9B A;  1W8O A;  3RZG A;  1CES A;  3WDY A;  4AZZ A;  1ZRR A;  1MZE A;  4YNI A;  1C8N A;  1YQ2 A;  3ZXG A;  1G7Y A;  5KHH A;  4JX0 A;  5FKB A;  1W2T A;  4CUC A;  4LBJ A;  2YBK A;  3VB9 A;  2DCJ A;  5F9T A;  4RS5 C;  4JC1 A;  4N8M A;  4WM8 C;  4NIG A;  3ZYR A;  2K9Z A;  4H7M A;  3K4Z A;  3WNN A;  2DV9 A;  4CUA A;  1J3Q A;  3JBG 2;  2VME A;  2PQS A;  2A1X A;  2YXS A;  3NAP A;  2P3J A;  1C8M 3;  4AHZ A;  4EYU A;  1Z0H A;  5I8Y A;  1UN1 A;  1JZ3 A;  3WV6 A;  4XBN A;  5LA2 A;  2E7A A;  1GWM A;  1LOF A;  3MIH A;  5ACA 2;  4FSJ A;  1COV 2;  4QT6 A;  4XTM A;  1DQ2 A;  5DUX A;  3W9A A;  4F3J A;  3PVB B;  5DDJ 2;  1ND2 A;  4LLF A;  4L92 A;  1UQX A;  5JI7 A;  4NID A;  2QKD A;  4RL7 A;  2QQK A;  4Y3O A;  3QCW A;  2C26 A;  2C9A A;  4XJ9 A;  5BNQ A;  3I3E A;  1O4Z A;  3RI8 A;  4Q4X 1;  1YO8 A;  1IPK A;  3I2D A;  1QDO A;  4BPZ A;  5L36 A;  1O3S A;  4OI4 A;  1SCS A;  4MGZ E;  4N9I A;  4D94 A;  5IAX A;  3LEK A;  3VKN A;  1A3K A;  1L7R A;  1C28 A;  3KQR A;  4HMZ A;  4LOR A;  4XUR A;  5FXZ A;  2A75 A;  4XUN A;  4AED C;  1H6Y A;  1DQ1 A;  3DL3 A;  4D0Q A;  1YQ6 A;  2CV6 A;  1H6X A;  5CKQ A;  3M3Q A;  4K40 A;  4XJZ A;  3B5L B;  3KGZ A;  1MS4 A;  2YZ4 A;  3EYP A;  3ASI A;  4RQP B;  1TG7 A;  1U0A A;  3N9Q A;  3H42 B;  4GB3 2;  3FUQ A;  1W6Q B;  1QOS A;  1D4M 2;  1TMF 1;  3WDX A;  1H8T A;  3HMY A;  4MXV A;  4MVT A;  4ZU5 A;  1OXC A;  2VY0 A;  1ND3 C;  5GLZ A;  3H8O A;  1JTZ X;  2JIJ A;  2DVG A;  1BCX A;  2GMM A;  3K3N A;  4LA3 A;  3S6P A;  1RB8 G;  4OFG A;  4LK6 A;  4MGT A;  1H2M A;  1GP6 A;  1LU1 A;  2J1A A;  2XHN A;  3ME2 A;  1WA4 A;  3CU7 A;  4I01 A;  4QPW A;  1GKB A;  4WZF A;  4S2H A;  4Q2F A;  4A45 A;  5K0U B;  1W28 A;  1GZT A;  1OPM A;  2R07 3;  1AX2 A;  3TOJ A;  1ZX5 A;  3DKQ A;  3MFA A;  4QQ2 A;  3H8R A;  2A5Z A;  1IS6 A;  1H4H A;  5IJR A;  1OUS A;  2DBN A;  2D97 A;  1JOB A;  3RYR A;  1NCR A;  3OGG A;  1EYB A;  3DYO A;  4PLN A;  2VNG A;  2WO3 A;  2OX0 A;  2WQ8 A;  4IES A;  1AUY A;  5FZH A;  4WVZ A;  5G04 L;  3VBS B;  1QOO A;  4Y20 B;  1QJU 2;  1XSQ A;  1E5I A;  2IXL A;  2J1E A;  2W9X A;  3RFR A;  2YU1 A;  1FMD 2;  4XXA A;  1S0I A;  2AC1 A;  4JTN A;  1E5R A;  4GWN A;  1NCQ B;  4B4P A;  2V09 A;  3UV9 A;  3BGA A;  3WSO A;  2XBO 3;  2YPD A;  3LAG A;  5F32 A;  1ASJ 2;  5E89 A;  4R8H A;  2WQZ C;  5FZI A;  5A33 B;  1UMI A;  1GV9 A;  5AFE A;  1W0N A;  3RZH A;  4XEZ A;  1GNH A;  2VNO A;  3NV2 A;  3ZX7 A;  1RJ7 A;  2UUR A;  5F8P A;  4CYD A;  5J09 A;  4MUV A;  1VBD 3;  1BMV 2;  1B35 C;  5FQ0 B;  1UY2 A;  4LO4 B;  1CZS A;  2BBA A;  3L9J T; 
#chains in the Genus database with same CATH homology
 2K46 A;  2KR2 A;  3ORJ A;  2LRP A;  4LK7 A;  2O14 A;  2WYF A;  3UT0 A;  4CP9 A;  4LK6 A;  1OKO A;  3ZYB A;  4CPB A;  4YWA A;  2LRO A;  1V0A A;  4YW7 A;  1L7L A;  5D21 A;  1OH3 A;  1W90 A;  4BQ2 A;  4A6S A;  4CP9 B;  1GWM A;  3F95 A;  4BQ4 A;  1HN0 A;  1WCU A;  2Q1F A;  1GWK A;  4BQ5 A;  2JWP A;  4AL9 A;  1W9F A;  1W8T A;  4LJH A;  3ZYF A;  1GWL A;  1W8Z A;  1WZX A;  1W8W A;  1W8U A;  4LKD A;  1WMX A;  4LKF A;  4YW6 A;  3ZYH A;  4LKE A;  4CPB D;  2VXJ A;  2C24 A;  1UOJ A;  4BQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...