2YBPA

Jmjd2a complexed with r-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 106
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybpA01
2VD7A 5F39A 5FZCA 4XDOA 5FZ1A 5IVEA 4NUBA 5A7QA 3AVSA 5A3TA 3PU3A 5FY0A 3DXUA 5FWEA 2YBKA 4GAZA 4D6RA 5KR7A 4CCLA 4QXHA 5ISLA 3KV5A 2OX0A 3PDQA 5LY2A 4TN7A 4DO0A 4IGQA 5FPLA 5A7WB 4D6QA 4QU1A 4LXLA 4Y3OA 5FP3A 5FP4A 2OQ7A 4UF0A 4ASKA 2W2IA 2YBSA 4Y33A 4IGPA 5IW0A 5F3IA 5A7WA 5FZ8A 3N9MA 5IVFA 5IVJA 3K2OA 5FYTA 5FYMA 5FYUA 5FUPA 4V2WA 5F5AA 4CCMA 5FP7A 5F3GA 5F5IA 5FPVA 5F2SA 1VRBA 3ZLIA 5CEHA 3N9QA 5LW9A 5FZHA 4EYUA 5FJKA 5FZ6A 5A7SA 2XXZA 4QXBA 5E6HA 5FZ9A 2YU1A 3PUQA 5FYVA 4C8DA 5FXVA 4QXCA 5FPBA 5A3WA 4CCNA 5FYYA 5ANQA 3OPWA 4LIUA 5FY9A 5FZ0A 5FPAA 5FY1A 5FZLA 2WWUA 5FY7A 3LDBA 3U4SA 4IGOA 5LWBA 5FYZA 5IVBA 4CUGA 4HONA 4CCJA 5F3CA 5FXWA 5FZOB 2PXJA 2XUEA 5F5CA 5FJHA 4Y4RA 5FZEA 4D6SA 4DIQA 2YBPA 5FUNA 5A3NA 3NJYA 4GJYA 3AVRA 5A7NA 4CSWA 4BU2A 2OQ6A 2OS2A 3KV4A 5FY8A 5A7PA 4LITA 3ZPOA 5FZFA 4BISA 5IWFA 5A80A 5FXZA 5FP8A 4V2VA 3K3NA 3PUAA 4LIVA 5A1LA 3AL5A 3N9PA 5FZIA 4BXFA 3KVAA 5FZGA 3KVBA 4QX8A 4UF0B 5FPUA 5F32A 5FY4A 4AI9A 3PTRB 2WWJA 3DXTA 3PURA 5FYIA 5FYSA 5A7OA 3PU8A 4HOOA 5FYHA 5FYBA 3LD8A 5FZ7A 4AAPA 2YPDA 5FWJA 5FYCA 5LY1A 5F3EA 5K4LA 5FZAA 4GD4A 4URAA 3U78A 2GP5A 5FZDA 3RVHA 5FV3A 5A1FA 4EZHA 4CCKA 2OT7A 5FP9A 2YU2A 2Q8EA 4EZ4A 5FZ4A 2XMLA 4QX7A 4CCOA 3N9NA 3KV6A 5IVYA 2Q8CA 4GJZA 4XDPA 5FBJA 3N9OA 5FZ3A 2GP3A 5FZOA 2P5BA 5FZMA 5IVCA 5F2WA 5FXXA 2Q8DA 5FZKA 3K3OA 5FY5A 5FZBA 3PUSA 3UYJA 5IVVA 3AL6A 3N9LA 5A3PA 4E4HA 3OPTA 5F37A 4QWNA 2XDVA 3KV9A
chains in the Genus database with same CATH superfamily
5F6LB 5DDJ3 5FTTC 2X8KA 5GLZA 1OURA 1XU1A 4UW5A 2JB8A 3I2IA 1AXYA 3BI3A 3M3CA 1KJLA 1XRUA 2R071 5FY0A 2WNVC 1QHDA 4QKNA 1WCKA 5EQUA 2YBKA 1B35B 4YZ4A 5A3UA 4XZUG 3C2UA 4YVWC 1V9U1 4YYOA 1ULCA 4N53C 4Q27A 5JXHA 4KWLA 1FATA 4Y1VA 3ZMNA 4XILA 3W9AA 2XVKA 3WG2A 1W8TA 1RUD2 4LXLA 1UY0A 2E53A 4AK3A 3VD7A 4B3NA 3IZOA 4PCRA 5DZGA 4Q4Y1 4ZZ8A 2AEYA 2VOWA 3MDPA 4P9XA 3N9MA 4NO4A 1COV1 1SMVA 3M7AA 5KHGA 1W03A 4KBBA 1LGCA 2VW1A 3EJKA 1E57A 5FZHA 4GKYA 5JR2A 4RHV1 2FBEA 4QDSA 3JQWA 1N1YA 4XF3A 1CAXB 1J3QA 4O9GA 4B4RA 4Y22A 3WP3A 1VBE1 3H1MA 3OPWA 5BNPA 2HWE1 2E6VA 4Q2FA 4B29A 4EN0A 4Q1PA 4XF4A 4EE2A 3AM2A 1LOFC 1V9U3 1DYKA 1XOYA 2UY8A 3ZYRA 1K42A 1SDDB 3RZHA 3K77A 5JOZA 1UN1A 3OUHA 1KS5A 5FK8A 4A44A 1V9U2 3KT1A 3ZYFA 1Y9GA 4P5HA 1PK6A 2XR4A 2BOJA 2RS13 2ZX2A 4C1XA 2R072 1ZM1A 2VW0A 3AKTA 3H3UA 1BEV3 1UL9A 3MLLA 1O5LA 3NNJA 4LUKA 1XSQA 2WABA 3NNFA 2RS12 1LHWA 4JKKA 3ZX7A 1PVC3 2O14A 2WAOA 3TEXA 3MEPA 3WCSA 2J42A 3R4DB 2BQPA 3B00A 4R52A 2G9FA 2FCTA 3E5QA 3DKWA 3VLBB 4XFBA 4BHPA 1XE8A 3EMRA 4YW1A 5K8SA 2D6MA 2YXSA 5I8YA 1RUF3 5F32A 5DUXA 2WA3A 3H8XA 1XYOA 3OGRA 4AHWA 2R16A 1ULFA 1D4M2 4HOOA 4CYDA 1JYCA 3AXEA 3O0WA 3MPBA 5FZ7A 4JGZB 2P3KA 1JZ4A 1U5IA 1O4YA 1ALYA 1NCQB 4Y5SA 2L9LA 1IG0A 2A6XA 3KMHA 1S0BA 2XUMA 4ORFA 2IVJA 3SQOA 5ABJA 1RUOA 4GH4A 4IL7A 2ARBA 1DQ4A 2MPFA 4ARXA 1SLAA 5C4WC 5J37A 2D7FA 4OHYA 3VD3A 1GNYA 4N9HA 1E5IA 1EV13 1GWMA 2IZWA 2WA4A 2P3IA 3PVOA 4Q4V2 4AHYA 5LY1A 5FBJA 5T5JA 1WCUA 2ZEZA 4D8MA 2BV4A 2DUPA 1S0CA 4HVRA 1VALA 5ERLA 5F2WA 1RUE1 3QLQA 2A70A 4LHLA 5FBZA 5FZKA 5IYYA 2VNRA 3B02A 3WF0A 4CUAA 1JZ8A 3NQHA 1GOFA 3DF0A 1REEA 4LA2A 3LPGA 1YI9A 1QJX3 5APAA 1S0FA 3UKVA 3PJYA 5F39A 1ZNPA 2VNVA 4F7ZA 2IVIB 2MHFA 3H8OA 2LS6A 1W2NA 2RS32 4IV3B 4WM8A 2ZGRA 3ZYBA 1XNCA 1JUIA 4GMP1 1HB4A 3JZVA 2KD7A 4FTEA 5LCWL 2CGPA 4IV1A 2DYCA 1AJOA 1BKZA 3DPRA 3K4ZA 3MUZ1 3NSTA 4QQOA 1UY4A 2GNMA 4HSJA 5FMCA 1G9CA 3BKZA 1Y3TA 3WNPA 3AJYA 3M4FA 4UAPA 1CPNA 3SCFA 3UETA 3VBRA 5FP4A 3Q9OA 4XMIA 3OPZA 4RFRB 1AXKA 4M01A 3TN91 3FHIB 2IXIA 2KA3A 4P9IA 1W8FA 3K4DA 1W6OB 4NHXA 4Z07A 1OH3A 2JG9A 3VBFC 2RMU3 4YVSC 3WDUA 2JJ6A 1YNAA 2R1DA 3WDWA 4XQWA 2PN5A 1QOOA 1AVBA 3CLPA 5FO9B 2Y34A 1O91A 1RVF1 1BZWA 2HBTA 2HWB2 2JG8B 2J1UA 2SLIA 4QPWA 4XURA 3AKPA 3VDDB 5CADA 1KD7A 5JZGA 4G4FA 2ET7A 3OYWA 5JZGC 4C91A 2XG3A 4Q29A 1DG6A 2RV9A 3AYAA 2R1BA 3F2ZA 4I0WB 3DPRC 5D8AC 2YHJA 3O1SA 1QXRA 4N43A 2G1MA 5C71A 2R062 4HXCA 1YI7A 4J1XA 4FP3A 4QGNA 3OGJA 4DIQA 4P9GA 4PJYA 1FAYA 2AGSA 2JG9C 4WM8C 4YVSA 1AR82 2R063 1VRH2 2BWCA 5CZKA 1S4CA 3VBFA 4CUCA 4HK8A 2OQ6A 5FY8A 3TRSB 3FX3A 5EJZB 1MEC1 1MR5A 3V65A 4XXAA 1G7YA 2K46A 3RJ2X 2VL4A 3AP7A 4QM8A 2DURA 2ID4A 2WS91 3CHXA 4NHYA 4JGYB 2WZ8A 1CGPA 1VBC3 2J1AA 1C5IA 1RHI2 1DGWX 1VBA3 3E5XA 3KT7A 3WQ0A 4AQSA 2ZHNA 1PX3A 4XAAA 1S0EA 2A1XA 2ZX4A 3WNLA 4FVVA 4HKOA 3RMYA 2ZGUA 3HEIA 4HSLA 4QPYA 2ZA9A 1X9TA 2PQQA 4RFT0 5T54A 3SKVA 5F7UA 3BB6A 3H42B 1NX9A 4AW7A 4CXWA 1XYNA 1AX2A 4E27A 4XOGA 4HPKB 2H6BA 4GH4C 2PYTA 4AVCA 1OF4A 3TNPB 3D82A 1UO9A 3RPQA 4D0QA 4RYDA 2PHRA 1ASJ2 2XMLA 4GALA 1QXJA 2LRPA 3MUY1 4JC1A 4JVAA 5IVYA 2VBPA 3C7FA 1NA1A 3BVCA 4IE0A 4PLOA 1PO11 1FNZA 2B8MA 4XUTA 4LKEA 5I93A 3I2HA 5AFEA 1NLSA 3I3MA 1RUI1 3USSA 2JDAA 1BJQA 1W8WA 3OBAA 4R4ZA 4UI9L 5J98B 2ZJCA 2VMCA 3H8UA 4L8QA 5LK5A 5HV4A 2XPJA 3KD4A 1WCQA 5BNOA 3ZYPA 5F37A 2XJTA 3PVEA 5IVEA 5I0TA 4QX1A 4M3CB 3HMYA 2RS51 5BNNB 4ITCA 4N43B 3ITQA 1MEC3 5FZ1A 1RUH2 4INDA 3TNQA 1H4GA 1S0GA 2VUJA 5LBCA 1GP6A 3ECQA 4JGYA 1COV2 4DFSA 3JBG2 2WR9A 3MPPG 2EXKA 1SFPA 2CGOA 4Q4Y2 4L0PA 2PHTA 3IPVA 5JDBA 4Z2WA 1RUD1 4QKDA 5FPLA 1QH7A 4PT6A 5I91A 1OOPB 1YQ2A 3FBMA 3WNMA 1UZYA 2VULA 4YW4A 1PVC1 2ZAAA 1D0HA 5IVJA 3VGIA 5IVFA 4B7KA 1I3HA 5LASA 3AMPA 2CGNA 2LROA 2GMMA 4RA0A 5CEHA 1PK6C 1G86A 1QXPA 1U0AA 1UCXA 1RINA 3KGLA 3KF3A 3N36A 3P1IA 1QIQA 3T0DA 3PUQA 1SQ4A 4IEQA 2HWE3 3IB3A 2ZMLA 1JZ2A 2UYAA 1AF9A 2VTXA 2WO3A 1VMJA 4JX0A 1J3PA 3VHPA 1ZRIA 1O59A 4LBQD 4UFJA 4NRPA 5BNQA 2ZGPA 1TME2 3WR0A 3PLQA 2RR13 5KHHA 2B5HA 1PIV3 3V64A 1CAUA 3J7HA 2VVFA 4N53A 4GA9A 4LO4B 4YVWA 2NPIA 4BQYA 4GXLA 1W6QA 3I3DA 5K0UA 4BLIA 2Y6FA 2YG0A 4MGTA 3VBSB 4BU2A 4CP1A 4LBNA 1H4HA 5HBAA 4CEWA 2A6YA 5GLWA 1UKRA 4JDOA 3B9CA 1ULPA 3AKRA 1ENSA 4BPZA 3GBGA 1DU3D 1JYIA 4S2FA 5L73A 5LZ6A 1RJ8A 2NP0A 2CNAA 1C28A 5DDJ2 4QDQA 4OZXA 3MF9A 2XHKA 1CIYA 2J7MA 1F4AA 3KVAA 3I59B 4CVUA 3OSDA 4Y20A 1BMV2 2VZTA 3CZUA 4JQTA 2Y6LA 2WNVA 4LHKA 3NV4A 3S5AA 3M3EA 1ONAA 1CVNA 1TEIA 1S2KA 4IE4A 5CG8A 2ZHKA 2P3JA 1RUH1 4XJAA 4HBNA 5C8CC 2QQJA 1GUIA 4L9BA 1FX5A 2ZGOA 5D21A 5F3EA 1IS5A 1PGL1 4GD4A 3WOGA 2VNGA 3O1RA 2QTWB 2J22A 4ET7A 3WNOA 5T50A 2B46X 4LBKA 4AI0A 4EN6B 1UOGA 5EFUA 5IFPA 3HAGA 4FPGA 2VXJA 4C1WA 2VQAA 1UQXA 3AP5A 3G7DA 2YFUA 1W2UA 4JKLA 4K8FA 4RQPB 5A33A 5C8CB 1NUKA 4HMZA 4AVAA 1NA1B 3EHKA 1H9PA 1ZA7A 5LRSA 4R9AA 5FPZA 1BBT2 3CQOA 2JE9A 2WQ8A 3G6JB 4P02B 3HT1A 3WDTA 5A3PA 3OPTA 1YQ6A 1TMF3 4KNCA 1OSGA 2GAUA 2WBKA 4YVWB 3IDBB 1PK6B 2Z5WA 1OD3A 5DUVA 4AI2A 1ENQA 4ZXEA 5JIUA 1OLMA 2IC1A 3AZYA 2ARXA 1V6IA 3FMGA 3POYA 4GMP3 1KQRA 1XB9A 3AVSA 1ZBE1 2XJSA 3WINE 3DXUA 2DUOA 2EF6A 1W6MA 2FDGA 4UFLA 2WWSA 4GAZA 3VV1A 3NJZA 4D6RA 4XETA 1RHI1 1J59A 3I49A 1OQEA 4YNIA 1NZCA 3LSEA 4D3WA 4XUPA 4IEPA 5JXJA 2WFF2 4JCKA 1OLRA 4FXGB 5EP9A 5T52A 3LFIA 2HWC1 2HWD2 4MXWB 4Y3OA 5LB6A 4D6QA 1H2LA 3BODA 1GSLA 1NG0A 4G3YC 1APNA 2HYKA 2IXCA 1VB2A 4QPGC 2UWAA 2WO2A 4JRLA 3W59A 5FYMA 1WZXA 2LM3A 4CPBD 1ST8A 1N1VA 3LZZA 3D3AA 1VRBA 5FIXA 2EXJA 2CY6A 2IFWA 1GNHA 5FZ9A 1J1TA 1H1AA 2RM21 4JAAA 1MQTC 4XAEA 1YXWA 1ND3C 3CIHA 4MZUA 1IS3A 5GKAC 3NNGA 1LR5A 3VKNA 3Q8CA 4CCJA 3WY6A 1MS9A 2QVSB 3NKTA 4LNVA 3O1TA 1UKGA 3I2GA 2QUOA 3HQRA 4DY5A 3DEMA 3K51A 4LJHA 2ZOEB 1IQDC 4A7YA 1QQP3 1HRI1 3OF1A 4XHBA 1ZBE3 1VAMA 3I4IA 4A2UA 3FJSA 4CDUA 3O7OA 1LHVA 3T4VA 1N3OA 3ALQA 1OBNA 2OUHA 3K48A 1G9BA 3POJA 4RQPC 3NVCA 5FKBA 2QFEA 3HT2A 2WAAA 4H7LA 2RS33 1UYXA 2HBUA 1PHMA 3I54A 4HVOA 5H9SA 1UZVA 3UGHA 4XFFA 1GMMA 3EB7A 3PTRB 1W9WA 5LEJA 5F9TA 3VZMA 1ULEA 2AR6A 2QKDA 3IAPA 5A3LA 4YFWA 3ZN4A 5AC93 3X29B 5A70A 4YM1A 2GC1A 1H30A 2VMIA 4HFSA 4KQ7A 1JODA 4WVMA 1FV3A 3U78A 1WLWA 3NL1A 1W6PA 1POQA 2BNNA 4EZ4A 2YU2A 3E1F1 1QJU3 1WCSA 4EJRA 1DHKB 4DINB 3MIGA 4XQ4A 1ACCA 2YPJA 5E89A 3ON7A 2RMU2 4AI1A 5KWRA 1AYN2 4COWA 5F1RA 2WDBA 2XHNA 4Q1RA 2E7QA 2BBAA 1KFXL 4XDQA 4MV2A 2UWCA 1WWYA 4XUQA 4W6XA 3J8F2 5FAXA 4BK5A 3IT8A 4WM7B 1GZWA 1UW8A 2A6WA 3GF6A 3IN9A 5CU1A 4YWAA 3WEZA 3VBHB 5JSOA 5CNAA 4LULA 3UL2A 4HLTA 4ONUA 1AR93 1B09A 2BTVC 3VBHA 3C7EA 1PZ8A 1QOTA 1VBC1 2JDYA 4XW3A 3T3YA 1SLIA 1HKDA 1PVC2 1VRH3 4SBVA 1TG7A 3OD4A 3PJQA 2Q1ZB 1OI6A 2IXKA 2W94A 3I2DA 4HVQA 3KCYA 1ZVFA 1QJX1 3H1YA 3VBOC 1FV2A 2OQ7A 3B7MA 5C4WB 1GR3A 3C7OA 3JD72 5FZ8A 2JDHA 4Z1VA 1Y43B 1OMIA 2WSVA 1UMHA 3INAA 3ASIA 4P9LA 5G05L 3LSDA 2O0OA 3QACA 4AI8A 5C5UA 2BGCA 3OGVA 1DF0A 4ZU5A 1RYYA 2XL7A 1TVGA 2W46A 2GH8A 4NAMA 3ZLIA 1JYXA 1G6NA 1XQNA 2RVAA 3LF7A 4EYUA 1M06G 4FO9A 5HCBA 1PZ7A 2R041 3S7IA 3VL9A 2HEYF 1IPJA 1UPSA 1YFWA 1IHMA 1UX7A 2PMWB 2YU1A 3I8TA 5FMDA 4NWVA 4FPJA 4FPOB 5FYYA 5LA9A 2P4EA 3O0VA 1UMIA 4YZ1A 3I2FA 4WZFA 3A0NA 1ND3B 1MZ6A 2BGOA 4LBQA 4HONA 3VZJA 4META 1ZBA2 1POV0 4TLFA 4CUGA 5F5QA 3UKNA 4WVZA 3FLRA 4H3WA 3NKGA 5EJ1B 4BE3A 4FPEA 1EUTA 4AZZA 4HANA 4BB3A 4AI3A 2GALA 4LBLA 2FDHA 4QQLA 2RJKA 5BUVA 4N9IA 4FOWA 4CDWC 2I74A 3MW2A 2DFCA 5DZFA 5JMCA 1UOJA 1QJX2 1LOBA 3WX5A 1PO21 4YZ5A 3RZZA 1YLLA 1ND2B 5FZIA 5CAZA 3WP5A 1WW6A 5FZGA 4PLMA 4LTAA 3RFRA 3KS7A 5LA1A 2ZGNA 5KXCA 1COV3 2HEWF 1HRV2 1R081 1W8UA 3I59A 3PURA 4GZ9A 5IT6A 1NCQA 1RUI3 1MVQA 1YC61 1K5MB 1AL22 3ENRA 5D2AA 3VBHC 4GWJA 3LD8A 5IHRA 3I3EA 1LAJA 1DQ0A 4FTSA 2OVUA 3T4HB 1ZZ6A 1FMD2 1UU5A 2VCMA 4YPJA 4CCDA 5AC92 3J7NA 2D5HA 3POBA 5A3MA 5L9VA 2EA7A 2JIJA 5JZGB 2Q8EA 4W4ZA 3WQ1A 4E2QA 4ZKTB 1QEXA 4LO5B 4WVMB 4MH0E 2ZX0A 3FE5A 4LEJA 4CXXA 4DPNA 1OUSA 2DUQA 3VB9A 2VMHA 1E5RA 3AKSA 1EV11 4Q8KA 3ES4A 3UV9A 3CU7A 4FPCA 4RS5B 3CZJA 1ZRFA 4M3CE 4OUEA 2DVAA 5A32A 1PO22 2UU8A 4D7SA 2D5FA 4Q4W2 4QWNA 4LLOA 4A42A 5CFDC 2PAKA 4L11A 4YM0A 4ASMB 3RYRA 1Q8VA 4Q4X2 4FPFA 3OBZA 2WLQA 3LA2A 1PMHX 1H0BA 1OQDA 4K1ZA 4Y1XA 4YM2A 5A3OA 2O8QA 1PX4A 1R1A3 3ZXKA 3OUJA 4JKMA 1G8WA 5LA0A 2JDUA 3NMBA 3MO4A 4BYYA 3L2HA 3SHRA 3C3VA 4NPMA 1YIPA 3SH5A 1LHNA 5AFBA 1BVP1 1FYUA 3VKOA 4AFCA 4CCLA 4P00B 3UGFA 2R0FA 1QDCA 5H9QA 1S1AA 1HXS2 5B2GB 1AR73 1EAH1 2C1FA 4W50A 2BEOA 3JU9A 4UF0A 4GULA 4CDUC 2OZJA 1VBB2 4Y33A 5A7WA 2QJVA 3Q8AA 4ZXKA 2R042 4KU8A 2VZUA 4IQPA 5FP7A 4LO8A 4OQ8A 2ZZJA 5F3GA 3H50A 5DUWA 4LKSA 1ZRCA 1TQ5A 4DY3A 3OD0A 1SPPA 3AKQA 4MOAA 1W9FA 2QDRA 2DCYA 2QBXA 2ZABA 4QXCA 2A73B 2WNOA 3PVBB 1ND3A 5ANQA 1UPIA 2WZR3 3P3PA 2JD4A 3RI9A 2P17A 4GIQA 3RYKA 1AX0A 1MS4A 3KZ4C 4YGBA 2WT2A 2CL2A 4IGOA 4XUNA 1VBE3 5FYZA 2VO5A 4XXPA 1MZEA 3LEGA 1QMJA 1XNKA 2F17A 2JD9A 3IKWA 2LALA 2BUKA 5DN2A 3ABZA 3WDVA 5F6KA 5FZEA 1VBD2 1BLZA 5FMBA 4YG3A 5DUUA 1IQAA 3IDEA 1MS0A 5A7NA 2NN8A 3ZFGC 3EQEA 4HZFA 2VOKA 1UNBA 3AMQA 3ZFFA 5K0UB 4UBHA 2Z42A 4BLJA 4AEJA 1K3IA 2B9VA 4KWJA 4E2GA 5A80A 4DEQA 4CDWB 2C24A 1D4M1 3C8XA 3PUAA 4P08A 5C6CA 2FHRA 4XMAA 3A21A 4MGKE 2QQPA 2VW2A 4MADA 2R073 4UF0B 2YY1A 3VKLA 1K5MA 1UXZA 2AH2A 5FY4A 3ZFGB 1Z7S2 1VBA1 5T5PA 1UZ0A 4FAHA 2RMU1 4P5YA 2Q5TA 1K5JA 5GZGA 3UT0A 1VJ2A 3TEWA 1EP0A 1AR63 1DQ2A 4AWDA 1V6OA 2DBNA 2VBDA 4HL0A 4D7TA 4PIZA 2AYHA 1CONA 5I0UA 2X5IC 1J84A 4KGGA 5EYYA 2OT7A 4Q8LA 4CCKA 1OFNA 3AP6A 5HV0A 4QX7A 4LT5A 5TSWA 3LPFA 3N9NA 4QB2A 2Y33A 1J83A 1NXMA 2X29A 5EHDA 3HQXA 1RJ7A 2R32A 4NR1A 3ZFEB 4Q5OA 4QHZA 4CDQB 4Z8BA 5FZOA 4COUA 4N7IA 3GHMA 3RS6A 5FXXA 2SBAA 3KWVA 5FY5A 5IVVA 1QJY1 3ZXLA 1YEWA 2ZEXA 3VDCA 3H3LA 2B9UA 5D1IA 3KHCA 2ZTNA 1LJ7A 4GQ7A 3SMHA 1PGL2 2HWB3 2A71A 1RTVA 4QPIC 5EPAA 1O7FA 3NNLA 4XDOA 1V6MA 2WN2A 2D98A 3RQ0A 1WBLA 1GNZA 4FFGA 3N4MA 4XBNA 2VGDA 3HWJA 4PI2A 1JZ6A 1Q3EA 3HBZA 5BYNA 4W8JA 4ZS2A 4XHXA 3SCHA 1OKQA 3ST7A 3IM0A 5LY2A 4YG0A 4XF9A 3MIHA 2ADEA 5GM0A 4NIHA 3N35A 3AXDA 4E4ZA 4QU2A 1DP0A 2EAKA 1SZBA 2FDJA 5FK7A 4AGVA 5E8AA 2BPA2 1JH5A 2FQPA 3V0AA 4QX2A 5KXDA 4QDRA 2VMGA 5CYYA 1JYVA 1O3QA 2X05A 2Y26A 5K0UC 1NYWA 4QT6A 2E33A 3GM8A 2Q4SA 2R061 1H6XA 4EWDA 1C57A 3VBOB 2W52A 2XB6C 5E88A 3WP4A 3ZSEA 5A6XA 1M4WA 1Z78A 2XJQA 3E97A 2P1BA 3L2YA 4YGDA 1O8PA 2EIGA 1BBT1 2GZWA 2PHUA 3AYDA 4FQ4A 4KWUA 4UWDA 2WWUA 5FY1A 3DKQA 4FSJA 1K45A 3HD8B 4ZHNA 5LWBA 1SACA 4IE6A 1O3TA 3RJRA 4AF9A 2JEMA 4L2NA 2WJSA 3PVNA 5BXXA 1VE0A 5F5CA 1ASJ3 1WBFA 2D6PA 3K4AA 1CJDA 4A3XA 1GZWB 1JU4A 2DU0A 2E51A 4CU8A 1VPHA 1OLME 4WM7C 3MLJA 5FZFA 3ZSJA 1HV1A 2PLV1 3FHQA 1SBDA 4QPIA 3CKHA 4M3CF 1TMF2 4A45A 3B9IA 2WINB 4F83A 1EAH2 3ZFFB 2KXLA 3WNXA 1HXS1 4B8EA 4CP9A 1ODMA 2QQLA 4MLOA 5IAXA 2XQXA 1AZDA 3MV11 1JHJA 5J3UA 5JOWA 5JWPA 1UU6A 4RR3C 2BGPA 5FO7B 1BHGA 2YZ4A 5L7OC 2FZ2A 1PGW1 1SHWB 3KQRA 4JGYC 4YG6A 2ZKNA 2W95A 1L7RA 1OUXA 2QNKA 2RG4A 4UFMA 5FYHA 4B7EA 4IEVA 5JR7B 2AEZA 3CBNA 3VBRB 2WO7A 3LEMA 3WDYA 4RGKA 3QD6A 3KSCA 4Q26A 3RVHA 1BK0A 2G4IA 1XJAA 4NPLA 2ADDA 5BNOC 1BXHA 3MLKA 3O5SA 5FKCA 1NE4A 3VZLA 3FBYA 1W9SA 3NV2A 4GWMA 3ZFEA 2H6CA 4HPKA 1POV1 3KCCA 1MPXA 2PLV3 2AUYA 4GJZA 5CBLA 4AVSA 1Z7S1 3N9OA 1EYBA 1PGW2 1PVXA 1UOBA 2D3SA 2JDNA 1W3VA 2ZX3A 3OUIA 2VZ3A 1T6BX 2Q30A 5GALA 5FZBA 3PUSA 3UYJA 3GJBA 1ASJ1 4MHUA 2D6NA 2QQKA 1NY71 1A34A 1DQ5A 3T1LA 4E4HA 3IIAA 1JZ3A 4Y1UA 3P5BA 2GNDA 3ZSLA 2WYSA 1QDOA 5E1RA 1V6LA 3VL8A 2FDIA 1IZ3A 1R64A 1A78A 2YV8A 1XE0A 4FBFA 4AVTA 2O8OA 4HK9A 5FCCA 1VBD1 1HRV1 4MGZE 2GU9A 3KT4A 2VZRA 1ENXA 4CTEA 5JSPA 2WNVB 2ZAHA 1G9DA 2W92A 1POV3 2PHFA 4PIYA 1GP4A 1W3XA 4PQQA 5LRRA 3VDBA 4DEVA 1LEDA 4MGYE 4UBGA 2WS93 4UYBA 5D8AB 5T5LA 3POSA 3MHZA 3J9SA 1HN0A 3IBMA 4AQTA 1RMU3 2F6BA 5FYTA 1TNRA 1UU4A 5JCTA 4KBZA 4PBOA 4X8NA 4AGGA 2VCAA 5F2SA 4N43C 1FI2A 2G9GA 3EYPA 3PIGA 4DRRA 1ZREA 2EIDA 1AL23 3AZZA 5FJKA 5JPNB 2OPKA 4JZRA 2ZMKA 3HN1A 3OY8A 2A3YA 2XJRA 4LIUA 1U5YA 4JRAA 4RGAA 4LKFA 4BQWA 1HN1A 4Q0PA 3F95A 3WZ1A 5ANNA 4XCAA 3ES1A 1WA4A 4UFIA 2VG9A 1S2BA 3LEIA 4EN7B 1AYN3 3W5MA 1HV0A 4OVEA 1NCRA 3QH6A 5HI0A 1OA3A 1DLLA 1HW5A 1D2SA 1OA4A 1PNFA 1YRZA 4JDNA 4LBOA 3D0SA 5KBFA 4LPLA 4Q4X1 3J8F3 3T30A 3WW3A 3ZPOA 3TN92 4LITA 1EPWA 4AEDA 4XUOA 3S0MA 4PDWA 3CL1A 4BISA 1ZBA1 3ILFA 2XLAA 4Q0VA 1BBT3 3BUCA 3KM5A 5BY5A 4CP2A 1EAH3 1T6GC 3H7JA 4BXFA 4DUWA 2ZGSA 4CE8A 1CJPA 1QOSA 2W5FA 5DAVA 3POFA 2EXHA 3V0BA 1IS4A 1U12A 1W39A 3Q8FA 4R9DA 4NIGA 5CA6A 5C3RA 3AX4A 3ATGA 1OD5A 5FLJA 1QY4A 3SC7X 4DMIA 4LO6B 3V0BB 5C5TA 3CJIA 1CIWA 5FYCA 4MGSA 4A4AA 2W47A 2JB4A 1H1IA 1FXZA 3DCQA 4IEYA 2VXRA 2ZZQA 3VD5A 5AC91 1V70A 1VRH1 4EZHA 4LOSA 2BU9A 2D3PA 5ABJB 3FLPA 1HQNA 2YGLA 3A0KA 4I0BA 4JHTA 4QQPA 3BCWA 2BVBA 1NCQC 1L3JA 1VBA2 1R082 3C7HA 1KDKA 4NOTA 3USUB 1RL3A 2WLPA 1RUJ3 4M4PA 4XFIA 1AYM2 3SITA 4LKDA 3VHRA 3ZR5A 2R7EB 3AL6A 3USUA 3BALA 2HWB1 1PNGA 2ORXA 3TEZA 1QKQA 5ABJC 3WVJA 5J36A 1RUE3 2AC1A 1XC6A 2W1WA 3VBUC 3WHUA 4QHOA 5FZCA 2GH2A 3U14A 1CWPA 1ZBA3 4R9CA 2JIGA 3BOWA 4UW3A 5DZEA 1KGYA 1HJGA 3WSOA 3GGLA 2XBO3 1ND2C 3MFCA 3ZR6A 4U2AA 4CDUB 2R0HA 4YW5A 4NN0A 2XBO2 4QPIB 2BZDA 1A8MA 4WM8B 4CZSA 5CKNA 3LWCA 2P6HA 2K9ZA 4DO0A 4OI1A 2ZHLA 2C4XA 3VUOA 4J6GA 5DAQA 4BA6A 1UZZA 3AZXA 2WNUA 3ORJA 2YB7A 4A6SA 5FOBB 2WT0A 1WLTA 4Y20B 4FFFA 4MXVA 4YFZA 5JXIA 4K21A 1MZFA 3WG1A 4PIXA 4AYUA 4OMCA 1LRHA 4NROA 2BRTA 1UYZA 1FT9A 4Y5TA 1GV9A 4LHNA 1W2TA 1RUH3 1OC1A 1I5ZA 3N9QA 4QGLA 1ZZBA 2UURA 1GZTA 3SH4A 2WFF3 2WN3A 1ZA4A 1H8VA 1W90A 5IAVA 1H8TB 3B69A 4XVHA 1LOFA 1A3KA 2A3WA 1OT5A 3A22A 2HWC3 5L9RA 1F2NA 3VZKA 3RYPA 3VBOA 5A6ZA 1LU1A 1GQGA 1IPSA 4RS5C 1NQDA 4W6YA 1QJY3 1F31A 5IVBA 1GZCA 2B45X 1RXGA 2V09A 3HQUA 3MIDA 1C8M3 1WLCA 4LHSA 4Q4V1 5KHKA 3KLSA 3U0ZA 1T2XA 4LOTA 1MS1A 4ES8A 5K9YA 3AP4A 1TE1B 2XVLA 4Q0UA 4LBQB 5A3NA 5IK4A 2VR4A 4S2HA 1OHFA 1LGBA 3NAPC 4IW3A 4XF0A 4OI2A 1VMHA 2OA2A 1YFUA 2ARCA 1PO23 5FRAA 1UIJA 5J96B 4IV3C 2GC0A 4ZONA 4IEOA 4P9YA 1SFYA 1B35C 1YFXA 4RHV3 1KJRA 2C0ZA 1PMIA 3AL5A 1YHFA 3RDIA 1GICA 4EV0A 3GZAA 1AJKA 1R1A2 4E8DA 3BU0A 4LE4A 1W2OA 2Z2SB 1N1SA 1GOGA 1X8EA 1AYN1 1DGWA 1YQ8A 3E6BA 1C3HA 4DXTA 4UT5A 5FYBA 4OULA 1EUUA 3UESA 1W0OA 3RI8A 2VZPA 2JICA 2TNFA 3KCXA 3OGSA 5EZWA 3H8RA 3NAPB 1C4RA 1UXXX 2DTWA 2EIBA 4JDMA 2NLRA 4Z92B 4BQ1A 1ZYBA 2E32A 3GCXA 3R4UA 2ZGMA 5CISA 1JOPA 2FMDA 3FL7A 2RDNA 2ZACA 3VDDC 4BQXA 4XJ9A 3DL3A 3SKJE 1HQLA 2V73A 3OEAA 3ZSMA 4AL9A 4B4PA 1H8TA 2D40A 2DV9A 2QCSB 3N7LA 1K12A 1RMU1 1DZRA 1WKYA 3BPZA 4HKLA 4KI5M 3FZ3A 2ZEWA 4BMBA 1US2A 3OTFA 3ZDSA 5C9AA 3GALA 4LBJA 4XFCA 2WZR2 4DOUA 1QJU2 1H9WA 2B7YA 4ASKA 1LOEA 1W8HA 4URTA 4CCMA 4N7UA 1W04A 4PLNA 3DYMA 4PF1A 1O4TA 4K8RB 1RIRA 4OYUA 4XABA 4IE7A 2TBVA 1UY2A 2WQ4A 3ZVXA 1LECA 4IXLA 4Q0QA 3KF5A 1YUDA 1GQHA 1LTEA 4QKBA 1AUYA 5A7QA 5L36A 4FOYA 1XNTA 2R30A 2ERFA 4QPGB 3UNPA 5A6YA 2RDRA 2DCTA 3FFQA 3AK0A 2ZCWA 4GB33 1BCXA 2Z4FA 3D8CA 3KHBA 3WW2A 1C1FA 3R4SA 2J1EA 3FUOA 1W6MB 5L9BA 2X53S 3P6BA 2G9ZA 4V1PA 4JTNA 3V0AB 2E9QA 5F8PA 4O65A 5LK7B 4LK7A 1AR92 1DZQA 4DUXA 2CDOA 2DCJA 2W2IA 2EALA 3RZLA 2GMEA 1BYHA 4IEZA 1LB2A 3LGRA 1IKPA 4SLIA 5FYUA 2DCKA 2PHWA 1Q56A 3BYWA 4OMDA 1GYKA 2ZPXA 5BNPB 2W08A 3NV1A 4U36A 2QZ3A 4QXBA 2W68A 1EPZA 1XNBA 2WZR1 2D6OX 3RWKX 3O1MA 1SLTA 4WVWA 3FUQA 3ZN6B 1DGRN 4TZDA 2YGMA 4H7MA 3M1HA 2HWD1 2HWC2 5KHIA 2E63A 4C90A 2Q8OA 2ES3A 3CEWA 5C7GA 3ZKYA 1UWWA 4Q0SA 1IOAA 4CEYC 4XIKA 2E26A 2PLV2 3ZXGA 3I2OA 1WGPA 5I0RA 1CD3G 2N7GA 5DG2A 4AEDB 4OLLA 2YBPA 3MIEA 4GJYA 3VBUB 3U11A 2PAMA 1W0PA 5JI7A 3GYDA 3KV4A 2D6LX 3GBWA 1OFSA 3SXWA 4BJ0A 4CPBA 2RDQA 1LU2A 3I97A 3EXUA 4BXSV 1OVSA 4XBQA 3T2PA 5A1LA 1DZTA 2JDPA 2QQUA 2NYYA 3HNYM 4GMP0 3ACGA 3SEPA 1RVF3 2RHPA 3ETQA 4FAGA 2DVBA 4A6OA 2CWSA 4TSVA 3BTYA 2MEV3 2QQWA 3OBRA 2IXLA 4X8PA 2CYFA 4IETA 5GZCA 3S5QA 4MO3M 3ZO0B 2WWJA 2WYFA 3J7LA 4O61A 4UXAA 2JG9B 5FUIA 3ILRA 4A3ZA 5A7OA 5E16A 1GWLA 1V6KA 3FLTA 1DFQA 1C8NA 1QQP2 1ULDA 2X10A 3AB0A 4XF1A 3SLIA 3I7DA 1VB4A 2AREA 1JOBA 1X33A 5CIRA 1NOVA 2JE7A 2GP5A 1LOGA 3QBQA 5KXBA 1KXGA 4P9JA 1UF2C 1VBB1 1UYYA 2A75A 1HXS3 2VJXA 3LA3A 5KC5A 5SV5A 5A33B 5C8CA 4AOCA 2VZOA 4AAXA 1IPKA 1MS5A 2P3YA 1H8TC 3IMNA 2ZGQA 1RUI2 1L7QA 2P34A 3RZJA 2VOXA 1ZZ9A 2JX9A 4XYXA 2O1QA 3U10A 3U07A 3VKFC 4BQ4A 4LR4A 3J7MA 5DAPA 1WW5A 3O1UA 2ZEYA 4DXRA 4I0AA 1CR7A 3APBA 2XJPA 1CQ9A 3CMGA 2VPVA 4QX3A 2B42B 1CX4A 4IV3A 2R49A 3VHNA 2I2SA 4CEWC 4UW6A 3AJZA 2VTXJ 1J58A 1PZ9A 4XACA 1CESA 1HRI2 3HBKA 1Q8OA 5HCFA 4ZY9A 3T09A 4XPVA 1W06A 3WDXA 5A3TA 2A5ZA 2PA7A 3POWA 1LESA 3R0RA 4RN5A 2XLGA 4DRVA 1XNDA 2HYXA 3AFGA 3GZEA 4NRQA 2A3XA 1DQ6A 1UD1A 3LKJA 1XNAA 2BVVA 4GB32 1C8M1 1B35A 5FMOS 2JKBA 5A7WB 2W9XA 3DYOA 2Y6GA 3H9AA 4QU1A 4BWOA 4D94A 3NW4A 5C3OA 1I1EA 5FREA 4AFAA 5CVRA 1LEMA 3DYPA 3JUUA 3B94A 2ET1A 2HWF1 1H2KA 2VC9A 4XFHA 4IGPA 1QNWA 1FNYA 4K20A 2PHDA 3NAPA 4BQ3A 5GZFA 3K2OA 1CX1A 1YJKA 2QQVA 3LOIA 5L19A 1BEV2 4LBMA 1KDMA 5FMOL 3LDRA 4ES9A 4NHLA 2VZQA 1AR83 5T55A 2QQOA 3AC0A 2JENA 4YGEA 2OUJA 5FYVA 2VUCA 3AZWA 3L9JT 2Z69A 5C8WA 4CCNA 4RS5A 1AR71 5FZ0A 3AYEA 4C0BA 3HR9A 4N53B 2WNUC 5H9PA 3QOPA 1ZZCA 2EIEA 2X09A 3H0OA 3KGZA 3OEBA 3LIHA 3ZMOA 4AEMA 4EQVA 1X8MA 1D7PM 2VNOA 4ATFA 5SV8A 2YC4A 2GC3A 4D6SA 1CAUB 5AVAA 5JOXA 2VH9A 2W1SA 1QF3A 2IXHA 4OQ9A 2KM2A 3IAQA 3BTZA 1SFNA 4JV4A 2F4LA 3WUCA 2HWF2 2IXJA 1O3SA 3VBUA 4P14A 2OW4A 3SCGA 2JE8A 2LUWA 4E8CA 4LIVA 5GLVA 5IJRA 4ZU7A 1N3QA 3W5NA 1VBD3 4QX8A 3D4KA 3ZXAC 4XFGA 1JS9A 1ND2A 2J1TA 4CU6A 3IPVB 3DXTA 3WUDA 1YWKA 2RS31 1NA1C 2C5DA 1GBGA 5FQ0B 2B39A 4FT8A 4LA3A 1F5JA 1W0NA 5I0DA 1NE6A 3ZXFA 5FZAA 2TEPA 3ROUA 3C7GA 1DYPA 5IUQA 1OQ1A 2XVGA 1AR61 2Y0IA 3JD71 4MGIE 1KFUL 4AVBA 2Y8KA 5FP9A 3IDCB 1JYTA 5FZ4A 3TWIA 3CJIC 3ZIXA 5LATA 4D69A 1OF3A 3OYWB 1Z7S3 3JB4C 5G04L 5C3QA 4ISRA 1D4VB 1NLRA 2Y6JA 2LW8A 4XJ8A 4P9WA 4S2DA 2XBO1 2GP3A 3ZOIA 4EN8B 2P5BA 1ENRA 5IVCA 1W6QB 3AMHA 2BFUS 4S2GA 4EROA 4H2AA 5DDJ1 1X7NA 2ZGTA 3MF6A 3NJXA 1X36A 4IE5A 4DZGA 1U5ZA 1JOJA 1XYPA 5FFOC 1TZOA 4IDZA 3OCPA 2VQTA 1LGNA 3T2TA 1W2AX 4FFIA 3HOBA 1OVPA 4UW4A 2ZBJA 1Q8QA 5ACA3 2PQSA 3MICA 1DGLA 4BMEA 1J3RA 5GLTA 2QE3A 1JMUB 4ZZ5A 2YC2A 5D8AA 5LA2A 1F9KA 1UYPA 2ZGLA 1MQTB 5M0TA 2JWPA 1VMFA 4LORA 4BK4A 4NVPA 4E4DX 3FN9A 2EVXA 1LOAA 2VMEA 1CZSA 4PDWC 2XWBB 3GBFA 2WNEA 4AEDC 1F35A 1E5SA 1R092 3I3QA 2RE9A 1OOPA 5B4NA 3I2JA 4OHVA 1SPPB 2UY9A 3VN4A 4E9KA 5C3SA 2XH6A 4BH9A 4YW3A 1QJFA 1NCRC 5F5IA 4QD2A 4Y22B 1ODNA 2BNMA 4K1YA 3LE0A 1DCSA 1XBFA 3OG2A 2BNOA 1CZVA 2XXZA 3FHAA 5CB7A 3WLUA 5FXVA 3POIA 3W21A 2XJUA 2XJVA 3THTA 4OHWA 4OI0A 2AENA 3NNMA 3E5UA 1V6JA 2WSUA 4YZ3A 3VBRC 3B5LB 5BV6A 1GZ9A 3ZDVA 3WT3A 3BIEA 4XZPA 4K6BA 1VP6A 2W91A 3J4UH 4YVSB 2IFRA 3KQ4B 3PUHA 4IV1C 4XC9A 1ULOA 4XEZA 4Y1ZA 5FXWA 2XUEA 3JXSA 1GANA 1QJEA 1GFF2 1R083 3JBG1 4QAWA 2H0VA 4X6QB 3WF1A 4YW2A 1F8VA 4FTBA 1GLHA 1N1TA 1W8OA 3O1PA 3OGGA 5FOJB 3U4XA 2YDEA 2WIIB 2X5IB 1NCRB 3CJXA 2OS2A 2V4VA 4FQZA 4XCBA 5GZEA 4CXYA 1OLQA 5H9RA 1R1ZA 2PHXA 4AFDA 3D6EA 2D97A 3MIBA 2A7AA 3DPRB 4Q4W1 5FXZA 3K3NA 4NJ4A 5FDBA 5J48A 2W0XA 2PTMA 3N9PA 2VAUA 2DFBA 4HKWA 4UFHA 4NPRA 2RM23 2XONA 3ZYGA 1IG3A 1VBE2 2OZ6A 1WD3A 2RM22 5I0SA 3HNMA 4YW7A 3ZYIB 1EV12 4BOWA 2H0BA 2B4KA 2JDKA 2BW8A 2XLFA 2AACA 2AZ5A 2GNTA 4QB1A 3U75A 1WW7A 4COYA 4GWNA 2PHLA 4Y26A 1HB2A 3ZFEC 4AAPA 4H14A 2VVDA 1YCIA 2YROA 3ZYHA 5C4WA 4ASLA 1ULGA 1W8ZA 2D6KA 3URFA 5DPNA 4YARA 3RZGA 1CAXA 1LHUA 4TLGA 3HN3A 4BDVB 4Z2AA 3S57A 1L7LA 1WD4A 2HKXA 1WA6X 1YQ5A 2Y6KA 4TTGA 4XJZA 1VIWB 1PGSA 3O14A 4CDQA 4YM3A 5JPMB 4OFGA 1RITA 2ZMNA 3BGAA 1VAVA 3GJAA 5EXOA 2HH9A 3WHTA 1KRIA 1UMZA 4M4RA 1HRV3 2ARAA 3DV8A 4QX5A 2GDFA 2A6VA 3U1XA 1JW6A 3ZYJB 3N7JA 3LOBA 2DWRA 2WZEA 4KL1A 2ENRA 2GNBA 2VZ1A 2YYOA 4JHZA 4CP0A 2DVDA 3ETPA 3W58A 1XE7A 2RS53 4OI4A 3S30A 4G9SB 2XDVA 3B3QE 3IIIA 3KV9A 4OHZA 3WNKA 4MG2A 4KWKA 4WM7A 2QQIA 4PI0A 1J1LA 2WT1A 2CWMA 2GN3A 1WCDJ 1BEV1 1GP5A 3GXUA 4QM9A 5JUVA 1SCRA 3UK9A 3VBSA 2EAAA 2MNGA 3GHNA 4N8MA 5EYXA 5FWEA 5L7OA 4NIDA 2C26A 4RR3A 1R1A1 2WNUB 4KG0A 4TWTA 4QXKA 3ZN5A 5ISLA 1GWKA 4TN7A 5DMYA 5FLHA 4FFHA 4YLZA 3DN7A 5IFTA 5JAXA 5JIAA 4FPHA 3O1VA 1JUHA 2YC0A 3MYXA 4JGZA 5BNNC 1JYNA 5BNPC 4Y4YA 4KGQA 5FLIA 5IW0A 2NZ9A 1RVF2 2VMFA 4FPKA 4DQAA 4BQ2A 2XKPA 1S0IA 5T3NA 1DGRA 4BM8A 4I09A 1H2NA 4ZS3A 5ACA1 4NAOA 4AR2A 4F8AA 3M8LA 1UZWA 5FZ6A 5E6HA 4I2OA 1NQJA 2VCCA 5FPXA 4C8DA 3R05A 2KR2A 3D0JA 1JI6A 4FP2A 3RMXA 4AQ6A 3PHMA 2OXBA 4K40A 1BMV1 3A23A 4PHZA 4N90A 2Y6HA 2RJ2A 1RMU2 5CFCB 3U4SA 3FC0A 1CN1A 2EXIA 2FZ1A 2BERA 1V6NA 1JYWA 1Q43A 1REFA 1WW4A 3MV01 1O4ZA 3BOPA 1SLBA 4IESA 3VDAA 4B4QA 4E4SA 3M3OA 3CDZB 4I3GA 2FCVA 5GJ6A 3GZUC 1UY3A 1YFYA 2JDMA 1VBC2 4I30A 2WQZC 4UFKA 5C70A 4DUVA 3NJYA 4DB5A 2WL1A 1LODA 3Q8BA 4CSWA 2QDNA 1KEXA 1RC6A 5HPOA 2GMPA 5JSRA 3VHOA 1JN2P 1RUJ2 4Z82A 4JGZC 4A41A 5BNNA 2K2SA 1RUD3 2JDZA 3WCRA 1OA2A 1G9AA 3EO6A 4K7JA 1TME1 4QMAA 1LULA 1SBEA 4PDWB 3WG3A 1RUE2 3UKTA 5FPUA 1P8JA 3N7MA 5LBFA 1STMA 1VAKA 2FCUA 4AHZA 4AI9A 3VD4A 3VBSC 2WFPA 5DQ0A 4NIAA 1AL0G 2OIIA 5JXGA 3RNSA 1Y4WA 1RXFA 5FYSA 1WMFA 4YZ2A 5DABA 4GH4B 5CKMA 4QB6A 4GKXA 2YPDA 1YO8A 3BIWE 3S6PA 3AZVA 1F4HA 1NAEA 1RGSA 4K9SA 1JZ7A 4L97A 2CSGA 3I2KA 4URAA 2JG8C 2VQUA 2Y38A 3CF6E 4IEUA 4XJUA 5FZDA 3WF3A 4YSFA 5EJ3A 4ZU4A 4FCAA 2WUHA 3MW3A 2DU1A 4GWIA 3KV6A 3P3NA 1OPOA 4R9BA 1DQ1A 3ACFA 1RUC3 1SLCA 4XDPA 1HB3A 4RGGA 2ZKLA 3H7YA 3W20A 4QQ2A 3HIFA 1K5MC 5FZMA 4FOQA 3VKMA 4XBLA 4CDQC 1QH6A 3K3OA 4FXKB 1F5FA 1O5UA 1S0JA 2HWD3 1HDKA 3K46A 3N9LA 1HIXA 2X5IA 1NXD1 4FI9A 3MIFA 3N3HA 5DXDA 3WXPA 2RS52 2XKOA 2J1RA 4BIFA 4DNYA 1BVVA 1RUG2 2YMZA 2ZX1A 1TNFA 3ELNA 1Y9QA 4OCTA 2VOVA 4MUVA 1Z0HA 5EWSA 3RSJA 1RUG3 2IUWA 4NMIA 5GZDA 1MS8A 1QJY2 2DDUA 2CAVA 5IK8A 4Y1YA 4LLFA 2C9AA 3ACIA 3M3QA 1DBNA 3IWZA 3WV6A 1HJFA 1YIFA 2P37A 2GC2A 1D4M3 2OX0A 2HWF3 4FPYA 4EWAA 2HWE2 3Q8EA 3NWKA 1W6NB 3LA7A 5GLUA 5CFDB 3O12A 2YBSA 5LBBA 3ZFFC 1I5PA 3NRUA 3ZFGA 3V56A 5K7PA 4CDXA 4RHV2 5FUPA 3WNNA 4KG8A 4Q4V3 1PIV2 4BQ5A 4F3JA 3MI8A 3T0AA 4M0HA 2V4AA 4MYEA 5FO8B 3HVDA 3WQBA 5A3WA 1JXNA 1W6PB 3WF2A 4XJWA 5FZLA 5FPAA 3THPA 4AG4A 1BQPA 1O8SA 3B93A 3JQXA 1W9YA 4HN1A 4KU7A 5FY7A 3OY8B 5C3PA 2JECA 1SLLA 4ARYA 2OYZA 2OKXA 2HJIA 2BJSA 3JBG3 3T08A 5KHJA 4BIOA 1XU2A 1ZX5A 2VU9A 4HG6B 2G19A 2PXJA 4EN9B 1Q8SA 5FJHA 5JLVA 4COZA 3ZXJA 5HCAA 2J1SA 5FUNA 3B01A 3CNAA 1YYNA 1AR81 1H1MA 4RD7A 1OOPC 3WD5A 3POGA 4X6RB 4ATEA 2EICA 1OH4A 1RB8G 3VZOA 4IV1B 3LIGA 3PIJA 4OUSA 2GN7A 2D93A 5FP8A 1AL21 2DCZA 2XQRA 1C8M2 3LFMA 4MSVA 1GKBA 2DVFA 4H55A 3UJQA 4E2SA 3I3BA 1QWRA 4QGMA 1FOD3 5J1XA 1O3RA 1PM4A 1ZZ7A 4RR3B 4XQDA 1OKOA 2MEV1 2VUAA 1FOD2 4IEWA 3ACHA 1WLDA 3OBTA 4QQHA 1RUF1 5FYIA 1XSRA 3SH3A 5HXMA 3T0BA 3TOJA 4DS0A 5J7MA 1CAVB 2V72A 3JB8A 4AXOA 5CFDA 1D0GA 5K4LA 3FWEA 2A6ZA 4ISQA 2Q1MA 2RR12 2W1QA 4IEXA 1CPMA 3WP6A 4Q4X3 5IK7A 2E7AA 4D7YA 4XTMA 4LUMA 2Q8CA 4MGQA 4B1MA 4CRQA 3ME2A 2CTVA 2FMYA 5FR3A 1RUC2 1QGLA 2DBIA 1JU3A 1VR3A 2ATFA 2PAEA 5BNOB 1HX6A 2WRAA 2PELA 5I8TA 2RR11 5EV7A 3TBDA 4XIOA 2XL9A 4YRDA 3ZXEA 3AMMA 4LK6A 2I07B 2R043 2VZVA 4CDWA 4UOJA 2YFZA 3TEYA 3R6SA 3THCA 2E7TA 4NWWA 1RUF2 1RHI3 1PMJX 2P6CA 3FFZA 4CUBA 4RL7A 3PU3A 2PFWA 2VOTA 4XTPA 3PUIA 1NKGA 3LAGA 4OHXA 1V0AA 4O9EA 5CFCC 3BPSA 1FPN3 1GU3A 3PDQA 1AYM3 1LHOA 4IGQA 1Y7BA 3NO8A 3VZNA 4I01A 5I8SA 4TYSA 1I9RA 5B4XA 1TMF1 2D44A 4CCCA 1VLNA 3CJIB 5LBEA 1NT0A 2ZHMA 3TB0A 3LB9A 4AQ2A 4BCUA 2VBBA 1ZRDA 1MACA 1W8NA 5F3IA 4QKFA 1S55A 4FPLA 4Y24A 2Y64A 2YUEA 1AX1A 1FMD1 4MHRA 4V2WA 2ZGKA 1KS4A 2DVGA 4W65A 5F5AA 1YQCA 3DECA 3WW1A 2P2KA 1H2MA 3LDKA 2NMOA 2V5YA 2RJLA 3GDBA 3LQCA 3MW4A 4KH9A 4M0NA 4CDXB 5LW9A 2GSYA 2OPWA 1IKQA 1W05A 5KC6A 1R091 5FPBA 2UWBA 3RRDA 2XGXA 4HETA 5IATA 3AP9A 2D43A 5DG1A 1DYOA 1V00A 5FY9A 4OZOA 3DGTA 2CV6A 4COVA 5LEKA 5C9AB 2WS92 4NHKA 1Y9MA 3LDBA 1WMDA 4ZPIA 3DUIA 1LENA 3HPNA 3K75B 4CCEA 4YGCA 3WG4A 3ZPYA 3ILNA 3ZN6A 2WZPP 2XWJB 1MEC2 1IS6A 2ZXQA 4M3CA 5CFCA 3TAYA 3AFKA 5J09A 2JXAA 1LNSA 1N3PA 3D5OA 2J1VA 2NMNA 2XOMA 2RS11 3PTYA 4Q4Y3 1ZRRA 1AR62 1I6XA 4AE2A 1F15A 1FMD3 5IK5A 3MBWA 1HLCA 1OXCA 1MVEA 3OOXA 3ZIWA 4QX0A 1JHNA 1A6CA 2CDPA 3T1MA 4IUGA 3WF4A 3WW4A 4A7KA 4CEWB 4DXZA 4WV8A 3SISA 4HN0A 1EY2A 3J26N 3POEA 1UAIA 1JTZX 3EBRA 1PO13 2FD8A 2BOIA 2VY0A 3VD9A 4LMFA 1W9TA 2VVEA 3OJBA 1MS3A 5DAWA 1PO12 4J25A 2WC2A 4NRMA 1SDWA 1SEFA 4CU7A 4R4XA 1D2QA 2W87A 5T5OA 2FDKA 2Y60A 3HJRA 1PIV1 5HXVA 1RUG1 2DF7A 5FWJA 4OUMA 3TN93 4KMQA 2Z79A 4Q4W3 4L99A 4DXSA 4LE3A 2D3RA 4MVTA 1X82A 3IMMA 4RSUA 1R093 3BTAA 3PL0A 3U37A 4PBPA 3RZMA 2VQ0A 3LCPA 4HT1T 4CCOA 5HCHA 5JOYA 1X9PA 1CZTA 1AXZA 4B1LA 3NV3A 4Y5Z0 3M2MA 3PNAA 4C0HA 1FOD1 1KITA 4L92A 4WBBA 2VE1A 5FZ3A 3UJOA 1PM7A 3BN6A 2NM1A 3M3IA 2Q8DA 4TXWA 3N7KA 2QQNA 3WQ7A 3LEKA 5A1AA 1AR72 2TUNA 4RQPA 1SCSA 2WO1A 3IDAA 2C9KA 2CHHA 2ZS6B 4K3UA 3SEEA 4A7ZA 5C33A 5BPXA 1VBB3 1LCLA 2VD7A 1MZ5A 2VTFA 1JZ5A 3ZM8A 1HQWA 3AMNA 4AEKA 1HB1A 3S7EA 1Q8PA 3GNEA 4AHXA 4NUBA 3O1OA 3VBFB 3H1WA 1UY1A 1DDLA 2W3JA 3J8F1 1SG3A 3O0XA 1GQPA 4WVVA 2CAUA 2BDRA 2I45A 3A4UA 2C6SA 1NLQA 5KR7A 1H6YA 4J1WA 4IERA 1LOCA 2VMDA 3KV5A 4QXHA 2LTNA 3NJVA 1BK1A 3RGBA 1QJZA 1REDA 1FPN2 2BBVA 3ZXDA 3CO2A 2ORZA 1O6UA 2VECA 5FP3A 3ZKUA 1W28A 3A7QA 1HRI3 3OB8A 1MQTA 3T2QA 4LQRA 2VZSA 2Q0AA 2BWAA 1NZIA 1Q5OA 3TYJA 1WUVA 4CEYB 4NIIA 5FPVA 3M70A 1UIKA 5JI9A 2K0GA 3GZTB 5CKQA 3BTXA 4CEYA 3MFAA 5A7SA 4I02A 4CDXC 4NE9A 4LO7A 4JTOA 2RDSA 1QNYA 1N47A 2W1UA 1QU0A 5DAXA 3H3ZA 5CG9A 1NY72 3ZSKA 1CAWA 1OPMA 1SBFA 1S0DA 1DLCA 1A8DA 1UX6A 1U5XA 3GCWA 2IWGB 1LKNA 2QZ2A 4GB31 1URXA 4W6WA 3T2OA 5F3CA 1RUJ1 1ZZ8A 5FZOB 2W39A 2NQYA 2Y0OA 3RG0A 2VM9A 4QHBA 4Y4RA 5EIYB 2QQMA 3MGUA 1UOFA 3RZKA 4R8HA 3AVRA 1IGOA 2VUDA 4PF5A 4QPGA 5A7PA 4MX3A 5L7OB 4CP9B 4AGRA 5IWFA 1E5HA 3JD73 4NHMA 1RUNA 1AR91 1C1LA 4FOVA 4V2VA 3BU7A 4AFBA 4AFMA 1W6NA 3KVBA 5A6QA 3HNBM 2BP6A 1S2EA 1RUC1 1XPWA 3MZHA 1WMXA 4XE9A 3JCIA 3ACLA 2UYBA 3UGGA 3PU8A 1JBCA 5ACA2 2BFUL 4MXWA 1YJLA 1US3A 1G9FA 2WKKA 3RWNA 1X50A 5FQ0A 1WMEA 4M00A 2JKXA 2R6QA 2V5DA 3PMSA 1QJU1 1CAVA 2HLEA 5FV3A 2JG8A 2CU5A 1W6OA 1W99A 5A1FA 1TME3 1CAWB 2HEVF 3QH7A 2Q1FA 3KB5A 4JQRA 4BZ4A 5C9AC 1QQP1 1C5HA 4PQ9A 1AYM1 1DIWA 2ILMA 5JMOA 1FPN1 2WFF1 2FDFA 2DTYA 2ETEA 5AVPA 3THDA 2MEV2 1AHSA 1XXNA 3PMEA 4O7XA 3SNMA 3AYCA 3E6DA 3VDDA 5A32B 2BYVE 4EWEA 4I3PA 3E6CC 2E31A 4WZCA 3QCWA 4AVVA 2F4PA 1ZBE2 1GOHA 4YW6A 4CA9A 5KXEA 2VCBA 4XFAA 4CU9A 5JVVA
chains in the Genus database with same CATH topology
2VD7A 5F39A 5FZCA 4XDOA 5FZ1A 5IVEA 4NUBA 5A7QA 3AVSA 5A3TA 3PU3A 5FY0A 3DXUA 5FWEA 2YBKA 4GAZA 4D6RA 5KR7A 4CCLA 4QXHA 5ISLA 3KV5A 2OX0A 3PDQA 5LY2A 4TN7A 4DO0A 4IGQA 5FPLA 5A7WB 4D6QA 4QU1A 4LXLA 4Y3OA 5FP3A 5FP4A 2OQ7A 4UF0A 4ASKA 2W2IA 2YBSA 4Y33A 4IGPA 5IW0A 5F3IA 5A7WA 5FZ8A 3N9MA 5IVFA 5IVJA 3K2OA 5FYTA 5FYMA 5FYUA 5FUPA 4V2WA 5F5AA 4CCMA 5FP7A 5F3GA 5F5IA 5FPVA 5F2SA 1VRBA 3ZLIA 5CEHA 3N9QA 5LW9A 5FZHA 4EYUA 5FJKA 5FZ6A 5A7SA 2XXZA 4QXBA 5E6HA 5FZ9A 2YU1A 3PUQA 5FYVA 4C8DA 5FXVA 4QXCA 5FPBA 5A3WA 4CCNA 5FYYA 5ANQA 3OPWA 4LIUA 5FY9A 5FZ0A 5FPAA 5FY1A 5FZLA 2WWUA 5FY7A 3LDBA 3U4SA 4IGOA 5LWBA 5FYZA 5IVBA 4CUGA 4HONA 4CCJA 5F3CA 5FXWA 5FZOB 2PXJA 2XUEA 5F5CA 5FJHA 4Y4RA 5FZEA 4D6SA 4DIQA 2YBPA 5FUNA 5A3NA 3NJYA 4GJYA 3AVRA 5A7NA 4CSWA 4BU2A 2OQ6A 2OS2A 3KV4A 5FY8A 5A7PA 4LITA 3ZPOA 5FZFA 4BISA 5IWFA 5A80A 5FXZA 5FP8A 4V2VA 3K3NA 3PUAA 4LIVA 5A1LA 3AL5A 3N9PA 5FZIA 4BXFA 3KVAA 5FZGA 3KVBA 4QX8A 4UF0B 5FPUA 5F32A 5FY4A 4AI9A 3PTRB 2WWJA 3DXTA 3PURA 5FYIA 5FYSA 5A7OA 3PU8A 4HOOA 5FYHA 5FYBA 3LD8A 5FZ7A 4AAPA 2YPDA 5FWJA 5FYCA 5LY1A 5F3EA 5K4LA 5FZAA 4GD4A 4URAA 3U78A 2GP5A 5FZDA 3RVHA 5FV3A 5A1FA 4EZHA 4CCKA 2OT7A 5FP9A 2YU2A 2Q8EA 4EZ4A 5FZ4A 2XMLA 4QX7A 4CCOA 3N9NA 3KV6A 5IVYA 2Q8CA 4GJZA 4XDPA 5FBJA 3N9OA 5FZ3A 2GP3A 5FZOA 2P5BA 5FZMA 5IVCA 5F2WA 5FXXA 2Q8DA 5FZKA 3K3OA 5FY5A 5FZBA 3PUSA 3UYJA 5IVVA 3AL6A 3N9LA 5A3PA 4E4HA 3OPTA 5F37A 4QWNA 2XDVA 3KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD7 A;  5F39 A;  5FZC A;  4XDO A;  5FZ1 A;  5IVE A;  4NUB A;  5A7Q A;  3AVS A;  5A3T A;  3PU3 A;  5FY0 A;  3DXU A;  5FWE A;  2YBK A;  4GAZ A;  4D6R A;  5KR7 A;  4CCL A;  4QXH A;  5ISL A;  3KV5 A;  2OX0 A;  3PDQ A;  5LY2 A;  4TN7 A;  4DO0 A;  4IGQ A;  5FPL A;  5A7W B;  4D6Q A;  4QU1 A;  4LXL A;  4Y3O A;  5FP3 A;  5FP4 A;  2OQ7 A;  4UF0 A;  4ASK A;  2W2I A;  2YBS A;  4Y33 A;  4IGP A;  5IW0 A;  5F3I A;  5A7W A;  5FZ8 A;  3N9M A;  5IVF A;  5IVJ A;  3K2O A;  5FYT A;  5FYM A;  5FYU A;  5FUP A;  4V2W A;  5F5A A;  4CCM A;  5FP7 A;  5F3G A;  5F5I A;  5FPV A;  5F2S A;  1VRB A;  3ZLI A;  5CEH A;  3N9Q A;  5LW9 A;  5FZH A;  4EYU A;  5FJK A;  5FZ6 A;  5A7S A;  2XXZ A;  4QXB A;  5E6H A;  5FZ9 A;  2YU1 A;  3PUQ A;  5FYV A;  4C8D A;  5FXV A;  4QXC A;  5FPB A;  5A3W A;  4CCN A;  5FYY A;  5ANQ A;  3OPW A;  4LIU A;  5FY9 A;  5FZ0 A;  5FPA A;  5FY1 A;  5FZL A;  2WWU A;  5FY7 A;  3LDB A;  3U4S A;  4IGO A;  5LWB A;  5FYZ A;  5IVB A;  4CUG A;  4HON A;  4CCJ A;  5F3C A;  5FXW A;  5FZO B;  2PXJ A;  2XUE A;  5F5C A;  5FJH A;  4Y4R A;  5FZE A;  4D6S A;  4DIQ A;  2YBP A;  5FUN A;  5A3N A;  3NJY A;  4GJY A;  3AVR A;  5A7N A;  4CSW A;  4BU2 A;  2OQ6 A;  2OS2 A;  3KV4 A;  5FY8 A;  5A7P A;  4LIT A;  3ZPO A;  5FZF A;  4BIS A;  5IWF A;  5A80 A;  5FXZ A;  5FP8 A;  4V2V A;  3K3N A;  3PUA A;  4LIV A;  5A1L A;  3AL5 A;  3N9P A;  5FZI A;  4BXF A;  3KVA A;  5FZG A;  3KVB A;  4QX8 A;  4UF0 B;  5FPU A;  5F32 A;  5FY4 A;  4AI9 A;  3PTR B;  2WWJ A;  3DXT A;  3PUR A;  5FYI A;  5FYS A;  5A7O A;  3PU8 A;  4HOO A;  5FYH A;  5FYB A;  3LD8 A;  5FZ7 A;  4AAP A;  2YPD A;  5FWJ A;  5FYC A;  5LY1 A;  5F3E A;  5K4L A;  5FZA A;  4GD4 A;  4URA A;  3U78 A;  2GP5 A;  5FZD A;  3RVH A;  5FV3 A;  5A1F A;  4EZH A;  4CCK A;  2OT7 A;  5FP9 A;  2YU2 A;  2Q8E A;  4EZ4 A;  5FZ4 A;  2XML A;  4QX7 A;  4CCO A;  3N9N A;  3KV6 A;  5IVY A;  2Q8C A;  4GJZ A;  4XDP A;  5FBJ A;  3N9O A;  5FZ3 A;  2GP3 A;  5FZO A;  2P5B A;  5FZM A;  5IVC A;  5F2W A;  5FXX A;  2Q8D A;  5FZK A;  3K3O A;  5FY5 A;  5FZB A;  3PUS A;  3UYJ A;  5IVV A;  3AL6 A;  3N9L A;  5A3P A;  4E4H A;  3OPT A;  5F37 A;  4QWN A;  2XDV A;  3KV9 A; 
#chains in the Genus database with same CATH topology
 5F6L B;  5DDJ 3;  5FTT C;  2X8K A;  5GLZ A;  1OUR A;  1XU1 A;  4UW5 A;  2JB8 A;  3I2I A;  1AXY A;  3BI3 A;  3M3C A;  1KJL A;  1XRU A;  2R07 1;  5FY0 A;  2WNV C;  1QHD A;  4QKN A;  1WCK A;  5EQU A;  2YBK A;  1B35 B;  4YZ4 A;  5A3U A;  4XZU G;  3C2U A;  4YVW C;  1V9U 1;  4YYO A;  1ULC A;  4N53 C;  4Q27 A;  5JXH A;  4KWL A;  1FAT A;  4Y1V A;  3ZMN A;  4XIL A;  3W9A A;  2XVK A;  3WG2 A;  1W8T A;  1RUD 2;  4LXL A;  1UY0 A;  2E53 A;  4AK3 A;  3VD7 A;  4B3N A;  3IZO A;  4PCR A;  5DZG A;  4Q4Y 1;  4ZZ8 A;  2AEY A;  2VOW A;  3MDP A;  4P9X A;  3N9M A;  4NO4 A;  1COV 1;  1SMV A;  3M7A A;  5KHG A;  1W03 A;  4KBB A;  1LGC A;  2VW1 A;  3EJK A;  1E57 A;  5FZH A;  4GKY A;  5JR2 A;  4RHV 1;  2FBE A;  4QDS A;  3JQW A;  1N1Y A;  4XF3 A;  1CAX B;  1J3Q A;  4O9G A;  4B4R A;  4Y22 A;  3WP3 A;  1VBE 1;  3H1M A;  3OPW A;  5BNP A;  2HWE 1;  2E6V A;  4Q2F A;  4B29 A;  4EN0 A;  4Q1P A;  4XF4 A;  4EE2 A;  3AM2 A;  1LOF C;  1V9U 3;  1DYK A;  1XOY A;  2UY8 A;  3ZYR A;  1K42 A;  1SDD B;  3RZH A;  3K77 A;  5JOZ A;  1UN1 A;  3OUH A;  1KS5 A;  5FK8 A;  4A44 A;  1V9U 2;  3KT1 A;  3ZYF A;  1Y9G A;  4P5H A;  1PK6 A;  2XR4 A;  2BOJ A;  2RS1 3;  2ZX2 A;  4C1X A;  2R07 2;  1ZM1 A;  2VW0 A;  3AKT A;  3H3U A;  1BEV 3;  1UL9 A;  3MLL A;  1O5L A;  3NNJ A;  4LUK A;  1XSQ A;  2WAB A;  3NNF A;  2RS1 2;  1LHW A;  4JKK A;  3ZX7 A;  1PVC 3;  2O14 A;  2WAO A;  3TEX A;  3MEP A;  3WCS A;  2J42 A;  3R4D B;  2BQP A;  3B00 A;  4R52 A;  2G9F A;  2FCT A;  3E5Q A;  3DKW A;  3VLB B;  4XFB A;  4BHP A;  1XE8 A;  3EMR A;  4YW1 A;  5K8S A;  2D6M A;  2YXS A;  5I8Y A;  1RUF 3;  5F32 A;  5DUX A;  2WA3 A;  3H8X A;  1XYO A;  3OGR A;  4AHW A;  2R16 A;  1ULF A;  1D4M 2;  4HOO A;  4CYD A;  1JYC A;  3AXE A;  3O0W A;  3MPB A;  5FZ7 A;  4JGZ B;  2P3K A;  1JZ4 A;  1U5I A;  1O4Y A;  1ALY A;  1NCQ B;  4Y5S A;  2L9L A;  1IG0 A;  2A6X A;  3KMH A;  1S0B A;  2XUM A;  4ORF A;  2IVJ A;  3SQO A;  5ABJ A;  1RUO A;  4GH4 A;  4IL7 A;  2ARB A;  1DQ4 A;  2MPF A;  4ARX A;  1SLA A;  5C4W C;  5J37 A;  2D7F A;  4OHY A;  3VD3 A;  1GNY A;  4N9H A;  1E5I A;  1EV1 3;  1GWM A;  2IZW A;  2WA4 A;  2P3I A;  3PVO A;  4Q4V 2;  4AHY A;  5LY1 A;  5FBJ A;  5T5J A;  1WCU A;  2ZEZ A;  4D8M A;  2BV4 A;  2DUP A;  1S0C A;  4HVR A;  1VAL A;  5ERL A;  5F2W A;  1RUE 1;  3QLQ A;  2A70 A;  4LHL A;  5FBZ A;  5FZK A;  5IYY A;  2VNR A;  3B02 A;  3WF0 A;  4CUA A;  1JZ8 A;  3NQH A;  1GOF A;  3DF0 A;  1REE A;  4LA2 A;  3LPG A;  1YI9 A;  1QJX 3;  5APA A;  1S0F A;  3UKV A;  3PJY A;  5F39 A;  1ZNP A;  2VNV A;  4F7Z A;  2IVI B;  2MHF A;  3H8O A;  2LS6 A;  1W2N A;  2RS3 2;  4IV3 B;  4WM8 A;  2ZGR A;  3ZYB A;  1XNC A;  1JUI A;  4GMP 1;  1HB4 A;  3JZV A;  2KD7 A;  4FTE A;  5LCW L;  2CGP A;  4IV1 A;  2DYC A;  1AJO A;  1BKZ A;  3DPR A;  3K4Z A;  3MUZ 1;  3NST A;  4QQO A;  1UY4 A;  2GNM A;  4HSJ A;  5FMC A;  1G9C A;  3BKZ A;  1Y3T A;  3WNP A;  3AJY A;  3M4F A;  4UAP A;  1CPN A;  3SCF A;  3UET A;  3VBR A;  5FP4 A;  3Q9O A;  4XMI A;  3OPZ A;  4RFR B;  1AXK A;  4M01 A;  3TN9 1;  3FHI B;  2IXI A;  2KA3 A;  4P9I A;  1W8F A;  3K4D A;  1W6O B;  4NHX A;  4Z07 A;  1OH3 A;  2JG9 A;  3VBF C;  2RMU 3;  4YVS C;  3WDU A;  2JJ6 A;  1YNA A;  2R1D A;  3WDW A;  4XQW A;  2PN5 A;  1QOO A;  1AVB A;  3CLP A;  5FO9 B;  2Y34 A;  1O91 A;  1RVF 1;  1BZW A;  2HBT A;  2HWB 2;  2JG8 B;  2J1U A;  2SLI A;  4QPW A;  4XUR A;  3AKP A;  3VDD B;  5CAD A;  1KD7 A;  5JZG A;  4G4F A;  2ET7 A;  3OYW A;  5JZG C;  4C91 A;  2XG3 A;  4Q29 A;  1DG6 A;  2RV9 A;  3AYA A;  2R1B A;  3F2Z A;  4I0W B;  3DPR C;  5D8A C;  2YHJ A;  3O1S A;  1QXR A;  4N43 A;  2G1M A;  5C71 A;  2R06 2;  4HXC A;  1YI7 A;  4J1X A;  4FP3 A;  4QGN A;  3OGJ A;  4DIQ A;  4P9G A;  4PJY A;  1FAY A;  2AGS A;  2JG9 C;  4WM8 C;  4YVS A;  1AR8 2;  2R06 3;  1VRH 2;  2BWC A;  5CZK A;  1S4C A;  3VBF A;  4CUC A;  4HK8 A;  2OQ6 A;  5FY8 A;  3TRS B;  3FX3 A;  5EJZ B;  1MEC 1;  1MR5 A;  3V65 A;  4XXA A;  1G7Y A;  2K46 A;  3RJ2 X;  2VL4 A;  3AP7 A;  4QM8 A;  2DUR A;  2ID4 A;  2WS9 1;  3CHX A;  4NHY A;  4JGY B;  2WZ8 A;  1CGP A;  1VBC 3;  2J1A A;  1C5I A;  1RHI 2;  1DGW X;  1VBA 3;  3E5X A;  3KT7 A;  3WQ0 A;  4AQS A;  2ZHN A;  1PX3 A;  4XAA A;  1S0E A;  2A1X A;  2ZX4 A;  3WNL A;  4FVV A;  4HKO A;  3RMY A;  2ZGU A;  3HEI A;  4HSL A;  4QPY A;  2ZA9 A;  1X9T A;  2PQQ A;  4RFT 0;  5T54 A;  3SKV A;  5F7U A;  3BB6 A;  3H42 B;  1NX9 A;  4AW7 A;  4CXW A;  1XYN A;  1AX2 A;  4E27 A;  4XOG A;  4HPK B;  2H6B A;  4GH4 C;  2PYT A;  4AVC A;  1OF4 A;  3TNP B;  3D82 A;  1UO9 A;  3RPQ A;  4D0Q A;  4RYD A;  2PHR A;  1ASJ 2;  2XML A;  4GAL A;  1QXJ A;  2LRP A;  3MUY 1;  4JC1 A;  4JVA A;  5IVY A;  2VBP A;  3C7F A;  1NA1 A;  3BVC A;  4IE0 A;  4PLO A;  1PO1 1;  1FNZ A;  2B8M A;  4XUT A;  4LKE A;  5I93 A;  3I2H A;  5AFE A;  1NLS A;  3I3M A;  1RUI 1;  3USS A;  2JDA A;  1BJQ A;  1W8W A;  3OBA A;  4R4Z A;  4UI9 L;  5J98 B;  2ZJC A;  2VMC A;  3H8U A;  4L8Q A;  5LK5 A;  5HV4 A;  2XPJ A;  3KD4 A;  1WCQ A;  5BNO A;  3ZYP A;  5F37 A;  2XJT A;  3PVE A;  5IVE A;  5I0T A;  4QX1 A;  4M3C B;  3HMY A;  2RS5 1;  5BNN B;  4ITC A;  4N43 B;  3ITQ A;  1MEC 3;  5FZ1 A;  1RUH 2;  4IND A;  3TNQ A;  1H4G A;  1S0G A;  2VUJ A;  5LBC A;  1GP6 A;  3ECQ A;  4JGY A;  1COV 2;  4DFS A;  3JBG 2;  2WR9 A;  3MPP G;  2EXK A;  1SFP A;  2CGO A;  4Q4Y 2;  4L0P A;  2PHT A;  3IPV A;  5JDB A;  4Z2W A;  1RUD 1;  4QKD A;  5FPL A;  1QH7 A;  4PT6 A;  5I91 A;  1OOP B;  1YQ2 A;  3FBM A;  3WNM A;  1UZY A;  2VUL A;  4YW4 A;  1PVC 1;  2ZAA A;  1D0H A;  5IVJ A;  3VGI A;  5IVF A;  4B7K A;  1I3H A;  5LAS A;  3AMP A;  2CGN A;  2LRO A;  2GMM A;  4RA0 A;  5CEH A;  1PK6 C;  1G86 A;  1QXP A;  1U0A A;  1UCX A;  1RIN A;  3KGL A;  3KF3 A;  3N36 A;  3P1I A;  1QIQ A;  3T0D A;  3PUQ A;  1SQ4 A;  4IEQ A;  2HWE 3;  3IB3 A;  2ZML A;  1JZ2 A;  2UYA A;  1AF9 A;  2VTX A;  2WO3 A;  1VMJ A;  4JX0 A;  1J3P A;  3VHP A;  1ZRI A;  1O59 A;  4LBQ D;  4UFJ A;  4NRP A;  5BNQ A;  2ZGP A;  1TME 2;  3WR0 A;  3PLQ A;  2RR1 3;  5KHH A;  2B5H A;  1PIV 3;  3V64 A;  1CAU A;  3J7H A;  2VVF A;  4N53 A;  4GA9 A;  4LO4 B;  4YVW A;  2NPI A;  4BQY A;  4GXL A;  1W6Q A;  3I3D A;  5K0U A;  4BLI A;  2Y6F A;  2YG0 A;  4MGT A;  3VBS B;  4BU2 A;  4CP1 A;  4LBN A;  1H4H A;  5HBA A;  4CEW A;  2A6Y A;  5GLW A;  1UKR A;  4JDO A;  3B9C A;  1ULP A;  3AKR A;  1ENS A;  4BPZ A;  3GBG A;  1DU3 D;  1JYI A;  4S2F A;  5L73 A;  5LZ6 A;  1RJ8 A;  2NP0 A;  2CNA A;  1C28 A;  5DDJ 2;  4QDQ A;  4OZX A;  3MF9 A;  2XHK A;  1CIY A;  2J7M A;  1F4A A;  3KVA A;  3I59 B;  4CVU A;  3OSD A;  4Y20 A;  1BMV 2;  2VZT A;  3CZU A;  4JQT A;  2Y6L A;  2WNV A;  4LHK A;  3NV4 A;  3S5A A;  3M3E A;  1ONA A;  1CVN A;  1TEI A;  1S2K A;  4IE4 A;  5CG8 A;  2ZHK A;  2P3J A;  1RUH 1;  4XJA A;  4HBN A;  5C8C C;  2QQJ A;  1GUI A;  4L9B A;  1FX5 A;  2ZGO A;  5D21 A;  5F3E A;  1IS5 A;  1PGL 1;  4GD4 A;  3WOG A;  2VNG A;  3O1R A;  2QTW B;  2J22 A;  4ET7 A;  3WNO A;  5T50 A;  2B46 X;  4LBK A;  4AI0 A;  4EN6 B;  1UOG A;  5EFU A;  5IFP A;  3HAG A;  4FPG A;  2VXJ A;  4C1W A;  2VQA A;  1UQX A;  3AP5 A;  3G7D A;  2YFU A;  1W2U A;  4JKL A;  4K8F A;  4RQP B;  5A33 A;  5C8C B;  1NUK A;  4HMZ A;  4AVA A;  1NA1 B;  3EHK A;  1H9P A;  1ZA7 A;  5LRS A;  4R9A A;  5FPZ A;  1BBT 2;  3CQO A;  2JE9 A;  2WQ8 A;  3G6J B;  4P02 B;  3HT1 A;  3WDT A;  5A3P A;  3OPT A;  1YQ6 A;  1TMF 3;  4KNC A;  1OSG A;  2GAU A;  2WBK A;  4YVW B;  3IDB B;  1PK6 B;  2Z5W A;  1OD3 A;  5DUV A;  4AI2 A;  1ENQ A;  4ZXE A;  5JIU A;  1OLM A;  2IC1 A;  3AZY A;  2ARX A;  1V6I A;  3FMG A;  3POY A;  4GMP 3;  1KQR A;  1XB9 A;  3AVS A;  1ZBE 1;  2XJS A;  3WIN E;  3DXU A;  2DUO A;  2EF6 A;  1W6M A;  2FDG A;  4UFL A;  2WWS A;  4GAZ A;  3VV1 A;  3NJZ A;  4D6R A;  4XET A;  1RHI 1;  1J59 A;  3I49 A;  1OQE A;  4YNI A;  1NZC A;  3LSE A;  4D3W A;  4XUP A;  4IEP A;  5JXJ A;  2WFF 2;  4JCK A;  1OLR A;  4FXG B;  5EP9 A;  5T52 A;  3LFI A;  2HWC 1;  2HWD 2;  4MXW B;  4Y3O A;  5LB6 A;  4D6Q A;  1H2L A;  3BOD A;  1GSL A;  1NG0 A;  4G3Y C;  1APN A;  2HYK A;  2IXC A;  1VB2 A;  4QPG C;  2UWA A;  2WO2 A;  4JRL A;  3W59 A;  5FYM A;  1WZX A;  2LM3 A;  4CPB D;  1ST8 A;  1N1V A;  3LZZ A;  3D3A A;  1VRB A;  5FIX A;  2EXJ A;  2CY6 A;  2IFW A;  1GNH A;  5FZ9 A;  1J1T A;  1H1A A;  2RM2 1;  4JAA A;  1MQT C;  4XAE A;  1YXW A;  1ND3 C;  3CIH A;  4MZU A;  1IS3 A;  5GKA C;  3NNG A;  1LR5 A;  3VKN A;  3Q8C A;  4CCJ A;  3WY6 A;  1MS9 A;  2QVS B;  3NKT A;  4LNV A;  3O1T A;  1UKG A;  3I2G A;  2QUO A;  3HQR A;  4DY5 A;  3DEM A;  3K51 A;  4LJH A;  2ZOE B;  1IQD C;  4A7Y A;  1QQP 3;  1HRI 1;  3OF1 A;  4XHB A;  1ZBE 3;  1VAM A;  3I4I A;  4A2U A;  3FJS A;  4CDU A;  3O7O A;  1LHV A;  3T4V A;  1N3O A;  3ALQ A;  1OBN A;  2OUH A;  3K48 A;  1G9B A;  3POJ A;  4RQP C;  3NVC A;  5FKB A;  2QFE A;  3HT2 A;  2WAA A;  4H7L A;  2RS3 3;  1UYX A;  2HBU A;  1PHM A;  3I54 A;  4HVO A;  5H9S A;  1UZV A;  3UGH A;  4XFF A;  1GMM A;  3EB7 A;  3PTR B;  1W9W A;  5LEJ A;  5F9T A;  3VZM A;  1ULE A;  2AR6 A;  2QKD A;  3IAP A;  5A3L A;  4YFW A;  3ZN4 A;  5AC9 3;  3X29 B;  5A70 A;  4YM1 A;  2GC1 A;  1H30 A;  2VMI A;  4HFS A;  4KQ7 A;  1JOD A;  4WVM A;  1FV3 A;  3U78 A;  1WLW A;  3NL1 A;  1W6P A;  1POQ A;  2BNN A;  4EZ4 A;  2YU2 A;  3E1F 1;  1QJU 3;  1WCS A;  4EJR A;  1DHK B;  4DIN B;  3MIG A;  4XQ4 A;  1ACC A;  2YPJ A;  5E89 A;  3ON7 A;  2RMU 2;  4AI1 A;  5KWR A;  1AYN 2;  4COW A;  5F1R A;  2WDB A;  2XHN A;  4Q1R A;  2E7Q A;  2BBA A;  1KFX L;  4XDQ A;  4MV2 A;  2UWC A;  1WWY A;  4XUQ A;  4W6X A;  3J8F 2;  5FAX A;  4BK5 A;  3IT8 A;  4WM7 B;  1GZW A;  1UW8 A;  2A6W A;  3GF6 A;  3IN9 A;  5CU1 A;  4YWA A;  3WEZ A;  3VBH B;  5JSO A;  5CNA A;  4LUL A;  3UL2 A;  4HLT A;  4ONU A;  1AR9 3;  1B09 A;  2BTV C;  3VBH A;  3C7E A;  1PZ8 A;  1QOT A;  1VBC 1;  2JDY A;  4XW3 A;  3T3Y A;  1SLI A;  1HKD A;  1PVC 2;  1VRH 3;  4SBV A;  1TG7 A;  3OD4 A;  3PJQ A;  2Q1Z B;  1OI6 A;  2IXK A;  2W94 A;  3I2D A;  4HVQ A;  3KCY A;  1ZVF A;  1QJX 1;  3H1Y A;  3VBO C;  1FV2 A;  2OQ7 A;  3B7M A;  5C4W B;  1GR3 A;  3C7O A;  3JD7 2;  5FZ8 A;  2JDH A;  4Z1V A;  1Y43 B;  1OMI A;  2WSV A;  1UMH A;  3INA A;  3ASI A;  4P9L A;  5G05 L;  3LSD A;  2O0O A;  3QAC A;  4AI8 A;  5C5U A;  2BGC A;  3OGV A;  1DF0 A;  4ZU5 A;  1RYY A;  2XL7 A;  1TVG A;  2W46 A;  2GH8 A;  4NAM A;  3ZLI A;  1JYX A;  1G6N A;  1XQN A;  2RVA A;  3LF7 A;  4EYU A;  1M06 G;  4FO9 A;  5HCB A;  1PZ7 A;  2R04 1;  3S7I A;  3VL9 A;  2HEY F;  1IPJ A;  1UPS A;  1YFW A;  1IHM A;  1UX7 A;  2PMW B;  2YU1 A;  3I8T A;  5FMD A;  4NWV A;  4FPJ A;  4FPO B;  5FYY A;  5LA9 A;  2P4E A;  3O0V A;  1UMI A;  4YZ1 A;  3I2F A;  4WZF A;  3A0N A;  1ND3 B;  1MZ6 A;  2BGO A;  4LBQ A;  4HON A;  3VZJ A;  4MET A;  1ZBA 2;  1POV 0;  4TLF A;  4CUG A;  5F5Q A;  3UKN A;  4WVZ A;  3FLR A;  4H3W A;  3NKG A;  5EJ1 B;  4BE3 A;  4FPE A;  1EUT A;  4AZZ A;  4HAN A;  4BB3 A;  4AI3 A;  2GAL A;  4LBL A;  2FDH A;  4QQL A;  2RJK A;  5BUV A;  4N9I A;  4FOW A;  4CDW C;  2I74 A;  3MW2 A;  2DFC A;  5DZF A;  5JMC A;  1UOJ A;  1QJX 2;  1LOB A;  3WX5 A;  1PO2 1;  4YZ5 A;  3RZZ A;  1YLL A;  1ND2 B;  5FZI A;  5CAZ A;  3WP5 A;  1WW6 A;  5FZG A;  4PLM A;  4LTA A;  3RFR A;  3KS7 A;  5LA1 A;  2ZGN A;  5KXC A;  1COV 3;  2HEW F;  1HRV 2;  1R08 1;  1W8U A;  3I59 A;  3PUR A;  4GZ9 A;  5IT6 A;  1NCQ A;  1RUI 3;  1MVQ A;  1YC6 1;  1K5M B;  1AL2 2;  3ENR A;  5D2A A;  3VBH C;  4GWJ A;  3LD8 A;  5IHR A;  3I3E A;  1LAJ A;  1DQ0 A;  4FTS A;  2OVU A;  3T4H B;  1ZZ6 A;  1FMD 2;  1UU5 A;  2VCM A;  4YPJ A;  4CCD A;  5AC9 2;  3J7N A;  2D5H A;  3POB A;  5A3M A;  5L9V A;  2EA7 A;  2JIJ A;  5JZG B;  2Q8E A;  4W4Z A;  3WQ1 A;  4E2Q A;  4ZKT B;  1QEX A;  4LO5 B;  4WVM B;  4MH0 E;  2ZX0 A;  3FE5 A;  4LEJ A;  4CXX A;  4DPN A;  1OUS A;  2DUQ A;  3VB9 A;  2VMH A;  1E5R A;  3AKS A;  1EV1 1;  4Q8K A;  3ES4 A;  3UV9 A;  3CU7 A;  4FPC A;  4RS5 B;  3CZJ A;  1ZRF A;  4M3C E;  4OUE A;  2DVA A;  5A32 A;  1PO2 2;  2UU8 A;  4D7S A;  2D5F A;  4Q4W 2;  4QWN A;  4LLO A;  4A42 A;  5CFD C;  2PAK A;  4L11 A;  4YM0 A;  4ASM B;  3RYR A;  1Q8V A;  4Q4X 2;  4FPF A;  3OBZ A;  2WLQ A;  3LA2 A;  1PMH X;  1H0B A;  1OQD A;  4K1Z A;  4Y1X A;  4YM2 A;  5A3O A;  2O8Q A;  1PX4 A;  1R1A 3;  3ZXK A;  3OUJ A;  4JKM A;  1G8W A;  5LA0 A;  2JDU A;  3NMB A;  3MO4 A;  4BYY A;  3L2H A;  3SHR A;  3C3V A;  4NPM A;  1YIP A;  3SH5 A;  1LHN A;  5AFB A;  1BVP 1;  1FYU A;  3VKO A;  4AFC A;  4CCL A;  4P00 B;  3UGF A;  2R0F A;  1QDC A;  5H9Q A;  1S1A A;  1HXS 2;  5B2G B;  1AR7 3;  1EAH 1;  2C1F A;  4W50 A;  2BEO A;  3JU9 A;  4UF0 A;  4GUL A;  4CDU C;  2OZJ A;  1VBB 2;  4Y33 A;  5A7W A;  2QJV A;  3Q8A A;  4ZXK A;  2R04 2;  4KU8 A;  2VZU A;  4IQP A;  5FP7 A;  4LO8 A;  4OQ8 A;  2ZZJ A;  5F3G A;  3H50 A;  5DUW A;  4LKS A;  1ZRC A;  1TQ5 A;  4DY3 A;  3OD0 A;  1SPP A;  3AKQ A;  4MOA A;  1W9F A;  2QDR A;  2DCY A;  2QBX A;  2ZAB A;  4QXC A;  2A73 B;  2WNO A;  3PVB B;  1ND3 A;  5ANQ A;  1UPI A;  2WZR 3;  3P3P A;  2JD4 A;  3RI9 A;  2P17 A;  4GIQ A;  3RYK A;  1AX0 A;  1MS4 A;  3KZ4 C;  4YGB A;  2WT2 A;  2CL2 A;  4IGO A;  4XUN A;  1VBE 3;  5FYZ A;  2VO5 A;  4XXP A;  1MZE A;  3LEG A;  1QMJ A;  1XNK A;  2F17 A;  2JD9 A;  3IKW A;  2LAL A;  2BUK A;  5DN2 A;  3ABZ A;  3WDV A;  5F6K A;  5FZE A;  1VBD 2;  1BLZ A;  5FMB A;  4YG3 A;  5DUU A;  1IQA A;  3IDE A;  1MS0 A;  5A7N A;  2NN8 A;  3ZFG C;  3EQE A;  4HZF A;  2VOK A;  1UNB A;  3AMQ A;  3ZFF A;  5K0U B;  4UBH A;  2Z42 A;  4BLJ A;  4AEJ A;  1K3I A;  2B9V A;  4KWJ A;  4E2G A;  5A80 A;  4DEQ A;  4CDW B;  2C24 A;  1D4M 1;  3C8X A;  3PUA A;  4P08 A;  5C6C A;  2FHR A;  4XMA A;  3A21 A;  4MGK E;  2QQP A;  2VW2 A;  4MAD A;  2R07 3;  4UF0 B;  2YY1 A;  3VKL A;  1K5M A;  1UXZ A;  2AH2 A;  5FY4 A;  3ZFG B;  1Z7S 2;  1VBA 1;  5T5P A;  1UZ0 A;  4FAH A;  2RMU 1;  4P5Y A;  2Q5T A;  1K5J A;  5GZG A;  3UT0 A;  1VJ2 A;  3TEW A;  1EP0 A;  1AR6 3;  1DQ2 A;  4AWD A;  1V6O A;  2DBN A;  2VBD A;  4HL0 A;  4D7T A;  4PIZ A;  2AYH A;  1CON A;  5I0U A;  2X5I C;  1J84 A;  4KGG A;  5EYY A;  2OT7 A;  4Q8L A;  4CCK A;  1OFN A;  3AP6 A;  5HV0 A;  4QX7 A;  4LT5 A;  5TSW A;  3LPF A;  3N9N A;  4QB2 A;  2Y33 A;  1J83 A;  1NXM A;  2X29 A;  5EHD A;  3HQX A;  1RJ7 A;  2R32 A;  4NR1 A;  3ZFE B;  4Q5O A;  4QHZ A;  4CDQ B;  4Z8B A;  5FZO A;  4COU A;  4N7I A;  3GHM A;  3RS6 A;  5FXX A;  2SBA A;  3KWV A;  5FY5 A;  5IVV A;  1QJY 1;  3ZXL A;  1YEW A;  2ZEX A;  3VDC A;  3H3L A;  2B9U A;  5D1I A;  3KHC A;  2ZTN A;  1LJ7 A;  4GQ7 A;  3SMH A;  1PGL 2;  2HWB 3;  2A71 A;  1RTV A;  4QPI C;  5EPA A;  1O7F A;  3NNL A;  4XDO A;  1V6M A;  2WN2 A;  2D98 A;  3RQ0 A;  1WBL A;  1GNZ A;  4FFG A;  3N4M A;  4XBN A;  2VGD A;  3HWJ A;  4PI2 A;  1JZ6 A;  1Q3E A;  3HBZ A;  5BYN A;  4W8J A;  4ZS2 A;  4XHX A;  3SCH A;  1OKQ A;  3ST7 A;  3IM0 A;  5LY2 A;  4YG0 A;  4XF9 A;  3MIH A;  2ADE A;  5GM0 A;  4NIH A;  3N35 A;  3AXD A;  4E4Z A;  4QU2 A;  1DP0 A;  2EAK A;  1SZB A;  2FDJ A;  5FK7 A;  4AGV A;  5E8A A;  2BPA 2;  1JH5 A;  2FQP A;  3V0A A;  4QX2 A;  5KXD A;  4QDR A;  2VMG A;  5CYY A;  1JYV A;  1O3Q A;  2X05 A;  2Y26 A;  5K0U C;  1NYW A;  4QT6 A;  2E33 A;  3GM8 A;  2Q4S A;  2R06 1;  1H6X A;  4EWD A;  1C57 A;  3VBO B;  2W52 A;  2XB6 C;  5E88 A;  3WP4 A;  3ZSE A;  5A6X A;  1M4W A;  1Z78 A;  2XJQ A;  3E97 A;  2P1B A;  3L2Y A;  4YGD A;  1O8P A;  2EIG A;  1BBT 1;  2GZW A;  2PHU A;  3AYD A;  4FQ4 A;  4KWU A;  4UWD A;  2WWU A;  5FY1 A;  3DKQ A;  4FSJ A;  1K45 A;  3HD8 B;  4ZHN A;  5LWB A;  1SAC A;  4IE6 A;  1O3T A;  3RJR A;  4AF9 A;  2JEM A;  4L2N A;  2WJS A;  3PVN A;  5BXX A;  1VE0 A;  5F5C A;  1ASJ 3;  1WBF A;  2D6P A;  3K4A A;  1CJD A;  4A3X A;  1GZW B;  1JU4 A;  2DU0 A;  2E51 A;  4CU8 A;  1VPH A;  1OLM E;  4WM7 C;  3MLJ A;  5FZF A;  3ZSJ A;  1HV1 A;  2PLV 1;  3FHQ A;  1SBD A;  4QPI A;  3CKH A;  4M3C F;  1TMF 2;  4A45 A;  3B9I A;  2WIN B;  4F83 A;  1EAH 2;  3ZFF B;  2KXL A;  3WNX A;  1HXS 1;  4B8E A;  4CP9 A;  1ODM A;  2QQL A;  4MLO A;  5IAX A;  2XQX A;  1AZD A;  3MV1 1;  1JHJ A;  5J3U A;  5JOW A;  5JWP A;  1UU6 A;  4RR3 C;  2BGP A;  5FO7 B;  1BHG A;  2YZ4 A;  5L7O C;  2FZ2 A;  1PGW 1;  1SHW B;  3KQR A;  4JGY C;  4YG6 A;  2ZKN A;  2W95 A;  1L7R A;  1OUX A;  2QNK A;  2RG4 A;  4UFM A;  5FYH A;  4B7E A;  4IEV A;  5JR7 B;  2AEZ A;  3CBN A;  3VBR B;  2WO7 A;  3LEM A;  3WDY A;  4RGK A;  3QD6 A;  3KSC A;  4Q26 A;  3RVH A;  1BK0 A;  2G4I A;  1XJA A;  4NPL A;  2ADD A;  5BNO C;  1BXH A;  3MLK A;  3O5S A;  5FKC A;  1NE4 A;  3VZL A;  3FBY A;  1W9S A;  3NV2 A;  4GWM A;  3ZFE A;  2H6C A;  4HPK A;  1POV 1;  3KCC A;  1MPX A;  2PLV 3;  2AUY A;  4GJZ A;  5CBL A;  4AVS A;  1Z7S 1;  3N9O A;  1EYB A;  1PGW 2;  1PVX A;  1UOB A;  2D3S A;  2JDN A;  1W3V A;  2ZX3 A;  3OUI A;  2VZ3 A;  1T6B X;  2Q30 A;  5GAL A;  5FZB A;  3PUS A;  3UYJ A;  3GJB A;  1ASJ 1;  4MHU A;  2D6N A;  2QQK A;  1NY7 1;  1A34 A;  1DQ5 A;  3T1L A;  4E4H A;  3IIA A;  1JZ3 A;  4Y1U A;  3P5B A;  2GND A;  3ZSL A;  2WYS A;  1QDO A;  5E1R A;  1V6L A;  3VL8 A;  2FDI A;  1IZ3 A;  1R64 A;  1A78 A;  2YV8 A;  1XE0 A;  4FBF A;  4AVT A;  2O8O A;  4HK9 A;  5FCC A;  1VBD 1;  1HRV 1;  4MGZ E;  2GU9 A;  3KT4 A;  2VZR A;  1ENX A;  4CTE A;  5JSP A;  2WNV B;  2ZAH A;  1G9D A;  2W92 A;  1POV 3;  2PHF A;  4PIY A;  1GP4 A;  1W3X A;  4PQQ A;  5LRR A;  3VDB A;  4DEV A;  1LED A;  4MGY E;  4UBG A;  2WS9 3;  4UYB A;  5D8A B;  5T5L A;  3POS A;  3MHZ A;  3J9S A;  1HN0 A;  3IBM A;  4AQT A;  1RMU 3;  2F6B A;  5FYT A;  1TNR A;  1UU4 A;  5JCT A;  4KBZ A;  4PBO A;  4X8N A;  4AGG A;  2VCA A;  5F2S A;  4N43 C;  1FI2 A;  2G9G A;  3EYP A;  3PIG A;  4DRR A;  1ZRE A;  2EID A;  1AL2 3;  3AZZ A;  5FJK A;  5JPN B;  2OPK A;  4JZR A;  2ZMK A;  3HN1 A;  3OY8 A;  2A3Y A;  2XJR A;  4LIU A;  1U5Y A;  4JRA A;  4RGA A;  4LKF A;  4BQW A;  1HN1 A;  4Q0P A;  3F95 A;  3WZ1 A;  5ANN A;  4XCA A;  3ES1 A;  1WA4 A;  4UFI A;  2VG9 A;  1S2B A;  3LEI A;  4EN7 B;  1AYN 3;  3W5M A;  1HV0 A;  4OVE A;  1NCR A;  3QH6 A;  5HI0 A;  1OA3 A;  1DLL A;  1HW5 A;  1D2S A;  1OA4 A;  1PNF A;  1YRZ A;  4JDN A;  4LBO A;  3D0S A;  5KBF A;  4LPL A;  4Q4X 1;  3J8F 3;  3T30 A;  3WW3 A;  3ZPO A;  3TN9 2;  4LIT A;  1EPW A;  4AED A;  4XUO A;  3S0M A;  4PDW A;  3CL1 A;  4BIS A;  1ZBA 1;  3ILF A;  2XLA A;  4Q0V A;  1BBT 3;  3BUC A;  3KM5 A;  5BY5 A;  4CP2 A;  1EAH 3;  1T6G C;  3H7J A;  4BXF A;  4DUW A;  2ZGS A;  4CE8 A;  1CJP A;  1QOS A;  2W5F A;  5DAV A;  3POF A;  2EXH A;  3V0B A;  1IS4 A;  1U12 A;  1W39 A;  3Q8F A;  4R9D A;  4NIG A;  5CA6 A;  5C3R A;  3AX4 A;  3ATG A;  1OD5 A;  5FLJ A;  1QY4 A;  3SC7 X;  4DMI A;  4LO6 B;  3V0B B;  5C5T A;  3CJI A;  1CIW A;  5FYC A;  4MGS A;  4A4A A;  2W47 A;  2JB4 A;  1H1I A;  1FXZ A;  3DCQ A;  4IEY A;  2VXR A;  2ZZQ A;  3VD5 A;  5AC9 1;  1V70 A;  1VRH 1;  4EZH A;  4LOS A;  2BU9 A;  2D3P A;  5ABJ B;  3FLP A;  1HQN A;  2YGL A;  3A0K A;  4I0B A;  4JHT A;  4QQP A;  3BCW A;  2BVB A;  1NCQ C;  1L3J A;  1VBA 2;  1R08 2;  3C7H A;  1KDK A;  4NOT A;  3USU B;  1RL3 A;  2WLP A;  1RUJ 3;  4M4P A;  4XFI A;  1AYM 2;  3SIT A;  4LKD A;  3VHR A;  3ZR5 A;  2R7E B;  3AL6 A;  3USU A;  3BAL A;  2HWB 1;  1PNG A;  2ORX A;  3TEZ A;  1QKQ A;  5ABJ C;  3WVJ A;  5J36 A;  1RUE 3;  2AC1 A;  1XC6 A;  2W1W A;  3VBU C;  3WHU A;  4QHO A;  5FZC A;  2GH2 A;  3U14 A;  1CWP A;  1ZBA 3;  4R9C A;  2JIG A;  3BOW A;  4UW3 A;  5DZE A;  1KGY A;  1HJG A;  3WSO A;  3GGL A;  2XBO 3;  1ND2 C;  3MFC A;  3ZR6 A;  4U2A A;  4CDU B;  2R0H A;  4YW5 A;  4NN0 A;  2XBO 2;  4QPI B;  2BZD A;  1A8M A;  4WM8 B;  4CZS A;  5CKN A;  3LWC A;  2P6H A;  2K9Z A;  4DO0 A;  4OI1 A;  2ZHL A;  2C4X A;  3VUO A;  4J6G A;  5DAQ A;  4BA6 A;  1UZZ A;  3AZX A;  2WNU A;  3ORJ A;  2YB7 A;  4A6S A;  5FOB B;  2WT0 A;  1WLT A;  4Y20 B;  4FFF A;  4MXV A;  4YFZ A;  5JXI A;  4K21 A;  1MZF A;  3WG1 A;  4PIX A;  4AYU A;  4OMC A;  1LRH A;  4NRO A;  2BRT A;  1UYZ A;  1FT9 A;  4Y5T A;  1GV9 A;  4LHN A;  1W2T A;  1RUH 3;  1OC1 A;  1I5Z A;  3N9Q A;  4QGL A;  1ZZB A;  2UUR A;  1GZT A;  3SH4 A;  2WFF 3;  2WN3 A;  1ZA4 A;  1H8V A;  1W90 A;  5IAV A;  1H8T B;  3B69 A;  4XVH A;  1LOF A;  1A3K A;  2A3W A;  1OT5 A;  3A22 A;  2HWC 3;  5L9R A;  1F2N A;  3VZK A;  3RYP A;  3VBO A;  5A6Z A;  1LU1 A;  1GQG A;  1IPS A;  4RS5 C;  1NQD A;  4W6Y A;  1QJY 3;  1F31 A;  5IVB A;  1GZC A;  2B45 X;  1RXG A;  2V09 A;  3HQU A;  3MID A;  1C8M 3;  1WLC A;  4LHS A;  4Q4V 1;  5KHK A;  3KLS A;  3U0Z A;  1T2X A;  4LOT A;  1MS1 A;  4ES8 A;  5K9Y A;  3AP4 A;  1TE1 B;  2XVL A;  4Q0U A;  4LBQ B;  5A3N A;  5IK4 A;  2VR4 A;  4S2H A;  1OHF A;  1LGB A;  3NAP C;  4IW3 A;  4XF0 A;  4OI2 A;  1VMH A;  2OA2 A;  1YFU A;  2ARC A;  1PO2 3;  5FRA A;  1UIJ A;  5J96 B;  4IV3 C;  2GC0 A;  4ZON A;  4IEO A;  4P9Y A;  1SFY A;  1B35 C;  1YFX A;  4RHV 3;  1KJR A;  2C0Z A;  1PMI A;  3AL5 A;  1YHF A;  3RDI A;  1GIC A;  4EV0 A;  3GZA A;  1AJK A;  1R1A 2;  4E8D A;  3BU0 A;  4LE4 A;  1W2O A;  2Z2S B;  1N1S A;  1GOG A;  1X8E A;  1AYN 1;  1DGW A;  1YQ8 A;  3E6B A;  1C3H A;  4DXT A;  4UT5 A;  5FYB A;  4OUL A;  1EUU A;  3UES A;  1W0O A;  3RI8 A;  2VZP A;  2JIC A;  2TNF A;  3KCX A;  3OGS A;  5EZW A;  3H8R A;  3NAP B;  1C4R A;  1UXX X;  2DTW A;  2EIB A;  4JDM A;  2NLR A;  4Z92 B;  4BQ1 A;  1ZYB A;  2E32 A;  3GCX A;  3R4U A;  2ZGM A;  5CIS A;  1JOP A;  2FMD A;  3FL7 A;  2RDN A;  2ZAC A;  3VDD C;  4BQX A;  4XJ9 A;  3DL3 A;  3SKJ E;  1HQL A;  2V73 A;  3OEA A;  3ZSM A;  4AL9 A;  4B4P A;  1H8T A;  2D40 A;  2DV9 A;  2QCS B;  3N7L A;  1K12 A;  1RMU 1;  1DZR A;  1WKY A;  3BPZ A;  4HKL A;  4KI5 M;  3FZ3 A;  2ZEW A;  4BMB A;  1US2 A;  3OTF A;  3ZDS A;  5C9A A;  3GAL A;  4LBJ A;  4XFC A;  2WZR 2;  4DOU A;  1QJU 2;  1H9W A;  2B7Y A;  4ASK A;  1LOE A;  1W8H A;  4URT A;  4CCM A;  4N7U A;  1W04 A;  4PLN A;  3DYM A;  4PF1 A;  1O4T A;  4K8R B;  1RIR A;  4OYU A;  4XAB A;  4IE7 A;  2TBV A;  1UY2 A;  2WQ4 A;  3ZVX A;  1LEC A;  4IXL A;  4Q0Q A;  3KF5 A;  1YUD A;  1GQH A;  1LTE A;  4QKB A;  1AUY A;  5A7Q A;  5L36 A;  4FOY A;  1XNT A;  2R30 A;  2ERF A;  4QPG B;  3UNP A;  5A6Y A;  2RDR A;  2DCT A;  3FFQ A;  3AK0 A;  2ZCW A;  4GB3 3;  1BCX A;  2Z4F A;  3D8C A;  3KHB A;  3WW2 A;  1C1F A;  3R4S A;  2J1E A;  3FUO A;  1W6M B;  5L9B A;  2X53 S;  3P6B A;  2G9Z A;  4V1P A;  4JTN A;  3V0A B;  2E9Q A;  5F8P A;  4O65 A;  5LK7 B;  4LK7 A;  1AR9 2;  1DZQ A;  4DUX A;  2CDO A;  2DCJ A;  2W2I A;  2EAL A;  3RZL A;  2GME A;  1BYH A;  4IEZ A;  1LB2 A;  3LGR A;  1IKP A;  4SLI A;  5FYU A;  2DCK A;  2PHW A;  1Q56 A;  3BYW A;  4OMD A;  1GYK A;  2ZPX A;  5BNP B;  2W08 A;  3NV1 A;  4U36 A;  2QZ3 A;  4QXB A;  2W68 A;  1EPZ A;  1XNB A;  2WZR 1;  2D6O X;  3RWK X;  3O1M A;  1SLT A;  4WVW A;  3FUQ A;  3ZN6 B;  1DGR N;  4TZD A;  2YGM A;  4H7M A;  3M1H A;  2HWD 1;  2HWC 2;  5KHI A;  2E63 A;  4C90 A;  2Q8O A;  2ES3 A;  3CEW A;  5C7G A;  3ZKY A;  1UWW A;  4Q0S A;  1IOA A;  4CEY C;  4XIK A;  2E26 A;  2PLV 2;  3ZXG A;  3I2O A;  1WGP A;  5I0R A;  1CD3 G;  2N7G A;  5DG2 A;  4AED B;  4OLL A;  2YBP A;  3MIE A;  4GJY A;  3VBU B;  3U11 A;  2PAM A;  1W0P A;  5JI7 A;  3GYD A;  3KV4 A;  2D6L X;  3GBW A;  1OFS A;  3SXW A;  4BJ0 A;  4CPB A;  2RDQ A;  1LU2 A;  3I97 A;  3EXU A;  4BXS V;  1OVS A;  4XBQ A;  3T2P A;  5A1L A;  1DZT A;  2JDP A;  2QQU A;  2NYY A;  3HNY M;  4GMP 0;  3ACG A;  3SEP A;  1RVF 3;  2RHP A;  3ETQ A;  4FAG A;  2DVB A;  4A6O A;  2CWS A;  4TSV A;  3BTY A;  2MEV 3;  2QQW A;  3OBR A;  2IXL A;  4X8P A;  2CYF A;  4IET A;  5GZC A;  3S5Q A;  4MO3 M;  3ZO0 B;  2WWJ A;  2WYF A;  3J7L A;  4O61 A;  4UXA A;  2JG9 B;  5FUI A;  3ILR A;  4A3Z A;  5A7O A;  5E16 A;  1GWL A;  1V6K A;  3FLT A;  1DFQ A;  1C8N A;  1QQP 2;  1ULD A;  2X10 A;  3AB0 A;  4XF1 A;  3SLI A;  3I7D A;  1VB4 A;  2ARE A;  1JOB A;  1X33 A;  5CIR A;  1NOV A;  2JE7 A;  2GP5 A;  1LOG A;  3QBQ A;  5KXB A;  1KXG A;  4P9J A;  1UF2 C;  1VBB 1;  1UYY A;  2A75 A;  1HXS 3;  2VJX A;  3LA3 A;  5KC5 A;  5SV5 A;  5A33 B;  5C8C A;  4AOC A;  2VZO A;  4AAX A;  1IPK A;  1MS5 A;  2P3Y A;  1H8T C;  3IMN A;  2ZGQ A;  1RUI 2;  1L7Q A;  2P34 A;  3RZJ A;  2VOX A;  1ZZ9 A;  2JX9 A;  4XYX A;  2O1Q A;  3U10 A;  3U07 A;  3VKF C;  4BQ4 A;  4LR4 A;  3J7M A;  5DAP A;  1WW5 A;  3O1U A;  2ZEY A;  4DXR A;  4I0A A;  1CR7 A;  3APB A;  2XJP A;  1CQ9 A;  3CMG A;  2VPV A;  4QX3 A;  2B42 B;  1CX4 A;  4IV3 A;  2R49 A;  3VHN A;  2I2S A;  4CEW C;  4UW6 A;  3AJZ A;  2VTX J;  1J58 A;  1PZ9 A;  4XAC A;  1CES A;  1HRI 2;  3HBK A;  1Q8O A;  5HCF A;  4ZY9 A;  3T09 A;  4XPV A;  1W06 A;  3WDX A;  5A3T A;  2A5Z A;  2PA7 A;  3POW A;  1LES A;  3R0R A;  4RN5 A;  2XLG A;  4DRV A;  1XND A;  2HYX A;  3AFG A;  3GZE A;  4NRQ A;  2A3X A;  1DQ6 A;  1UD1 A;  3LKJ A;  1XNA A;  2BVV A;  4GB3 2;  1C8M 1;  1B35 A;  5FMO S;  2JKB A;  5A7W B;  2W9X A;  3DYO A;  2Y6G A;  3H9A A;  4QU1 A;  4BWO A;  4D94 A;  3NW4 A;  5C3O A;  1I1E A;  5FRE A;  4AFA A;  5CVR A;  1LEM A;  3DYP A;  3JUU A;  3B94 A;  2ET1 A;  2HWF 1;  1H2K A;  2VC9 A;  4XFH A;  4IGP A;  1QNW A;  1FNY A;  4K20 A;  2PHD A;  3NAP A;  4BQ3 A;  5GZF A;  3K2O A;  1CX1 A;  1YJK A;  2QQV A;  3LOI A;  5L19 A;  1BEV 2;  4LBM A;  1KDM A;  5FMO L;  3LDR A;  4ES9 A;  4NHL A;  2VZQ A;  1AR8 3;  5T55 A;  2QQO A;  3AC0 A;  2JEN A;  4YGE A;  2OUJ A;  5FYV A;  2VUC A;  3AZW A;  3L9J T;  2Z69 A;  5C8W A;  4CCN A;  4RS5 A;  1AR7 1;  5FZ0 A;  3AYE A;  4C0B A;  3HR9 A;  4N53 B;  2WNU C;  5H9P A;  3QOP A;  1ZZC A;  2EIE A;  2X09 A;  3H0O A;  3KGZ A;  3OEB A;  3LIH A;  3ZMO A;  4AEM A;  4EQV A;  1X8M A;  1D7P M;  2VNO A;  4ATF A;  5SV8 A;  2YC4 A;  2GC3 A;  4D6S A;  1CAU B;  5AVA A;  5JOX A;  2VH9 A;  2W1S A;  1QF3 A;  2IXH A;  4OQ9 A;  2KM2 A;  3IAQ A;  3BTZ A;  1SFN A;  4JV4 A;  2F4L A;  3WUC A;  2HWF 2;  2IXJ A;  1O3S A;  3VBU A;  4P14 A;  2OW4 A;  3SCG A;  2JE8 A;  2LUW A;  4E8C A;  4LIV A;  5GLV A;  5IJR A;  4ZU7 A;  1N3Q A;  3W5N A;  1VBD 3;  4QX8 A;  3D4K A;  3ZXA C;  4XFG A;  1JS9 A;  1ND2 A;  2J1T A;  4CU6 A;  3IPV B;  3DXT A;  3WUD A;  1YWK A;  2RS3 1;  1NA1 C;  2C5D A;  1GBG A;  5FQ0 B;  2B39 A;  4FT8 A;  4LA3 A;  1F5J A;  1W0N A;  5I0D A;  1NE6 A;  3ZXF A;  5FZA A;  2TEP A;  3ROU A;  3C7G A;  1DYP A;  5IUQ A;  1OQ1 A;  2XVG A;  1AR6 1;  2Y0I A;  3JD7 1;  4MGI E;  1KFU L;  4AVB A;  2Y8K A;  5FP9 A;  3IDC B;  1JYT A;  5FZ4 A;  3TWI A;  3CJI C;  3ZIX A;  5LAT A;  4D69 A;  1OF3 A;  3OYW B;  1Z7S 3;  3JB4 C;  5G04 L;  5C3Q A;  4ISR A;  1D4V B;  1NLR A;  2Y6J A;  2LW8 A;  4XJ8 A;  4P9W A;  4S2D A;  2XBO 1;  2GP3 A;  3ZOI A;  4EN8 B;  2P5B A;  1ENR A;  5IVC A;  1W6Q B;  3AMH A;  2BFU S;  4S2G A;  4ERO A;  4H2A A;  5DDJ 1;  1X7N A;  2ZGT A;  3MF6 A;  3NJX A;  1X36 A;  4IE5 A;  4DZG A;  1U5Z A;  1JOJ A;  1XYP A;  5FFO C;  1TZO A;  4IDZ A;  3OCP A;  2VQT A;  1LGN A;  3T2T A;  1W2A X;  4FFI A;  3HOB A;  1OVP A;  4UW4 A;  2ZBJ A;  1Q8Q A;  5ACA 3;  2PQS A;  3MIC A;  1DGL A;  4BME A;  1J3R A;  5GLT A;  2QE3 A;  1JMU B;  4ZZ5 A;  2YC2 A;  5D8A A;  5LA2 A;  1F9K A;  1UYP A;  2ZGL A;  1MQT B;  5M0T A;  2JWP A;  1VMF A;  4LOR A;  4BK4 A;  4NVP A;  4E4D X;  3FN9 A;  2EVX A;  1LOA A;  2VME A;  1CZS A;  4PDW C;  2XWB B;  3GBF A;  2WNE A;  4AED C;  1F35 A;  1E5S A;  1R09 2;  3I3Q A;  2RE9 A;  1OOP A;  5B4N A;  3I2J A;  4OHV A;  1SPP B;  2UY9 A;  3VN4 A;  4E9K A;  5C3S A;  2XH6 A;  4BH9 A;  4YW3 A;  1QJF A;  1NCR C;  5F5I A;  4QD2 A;  4Y22 B;  1ODN A;  2BNM A;  4K1Y A;  3LE0 A;  1DCS A;  1XBF A;  3OG2 A;  2BNO A;  1CZV A;  2XXZ A;  3FHA A;  5CB7 A;  3WLU A;  5FXV A;  3POI A;  3W21 A;  2XJU A;  2XJV A;  3THT A;  4OHW A;  4OI0 A;  2AEN A;  3NNM A;  3E5U A;  1V6J A;  2WSU A;  4YZ3 A;  3VBR C;  3B5L B;  5BV6 A;  1GZ9 A;  3ZDV A;  3WT3 A;  3BIE A;  4XZP A;  4K6B A;  1VP6 A;  2W91 A;  3J4U H;  4YVS B;  2IFR A;  3KQ4 B;  3PUH A;  4IV1 C;  4XC9 A;  1ULO A;  4XEZ A;  4Y1Z A;  5FXW A;  2XUE A;  3JXS A;  1GAN A;  1QJE A;  1GFF 2;  1R08 3;  3JBG 1;  4QAW A;  2H0V A;  4X6Q B;  3WF1 A;  4YW2 A;  1F8V A;  4FTB A;  1GLH A;  1N1T A;  1W8O A;  3O1P A;  3OGG A;  5FOJ B;  3U4X A;  2YDE A;  2WII B;  2X5I B;  1NCR B;  3CJX A;  2OS2 A;  2V4V A;  4FQZ A;  4XCB A;  5GZE A;  4CXY A;  1OLQ A;  5H9R A;  1R1Z A;  2PHX A;  4AFD A;  3D6E A;  2D97 A;  3MIB A;  2A7A A;  3DPR B;  4Q4W 1;  5FXZ A;  3K3N A;  4NJ4 A;  5FDB A;  5J48 A;  2W0X A;  2PTM A;  3N9P A;  2VAU A;  2DFB A;  4HKW A;  4UFH A;  4NPR A;  2RM2 3;  2XON A;  3ZYG A;  1IG3 A;  1VBE 2;  2OZ6 A;  1WD3 A;  2RM2 2;  5I0S A;  3HNM A;  4YW7 A;  3ZYI B;  1EV1 2;  4BOW A;  2H0B A;  2B4K A;  2JDK A;  2BW8 A;  2XLF A;  2AAC A;  2AZ5 A;  2GNT A;  4QB1 A;  3U75 A;  1WW7 A;  4COY A;  4GWN A;  2PHL A;  4Y26 A;  1HB2 A;  3ZFE C;  4AAP A;  4H14 A;  2VVD A;  1YCI A;  2YRO A;  3ZYH A;  5C4W A;  4ASL A;  1ULG A;  1W8Z A;  2D6K A;  3URF A;  5DPN A;  4YAR A;  3RZG A;  1CAX A;  1LHU A;  4TLG A;  3HN3 A;  4BDV B;  4Z2A A;  3S57 A;  1L7L A;  1WD4 A;  2HKX A;  1WA6 X;  1YQ5 A;  2Y6K A;  4TTG A;  4XJZ A;  1VIW B;  1PGS A;  3O14 A;  4CDQ A;  4YM3 A;  5JPM B;  4OFG A;  1RIT A;  2ZMN A;  3BGA A;  1VAV A;  3GJA A;  5EXO A;  2HH9 A;  3WHT A;  1KRI A;  1UMZ A;  4M4R A;  1HRV 3;  2ARA A;  3DV8 A;  4QX5 A;  2GDF A;  2A6V A;  3U1X A;  1JW6 A;  3ZYJ B;  3N7J A;  3LOB A;  2DWR A;  2WZE A;  4KL1 A;  2ENR A;  2GNB A;  2VZ1 A;  2YYO A;  4JHZ A;  4CP0 A;  2DVD A;  3ETP A;  3W58 A;  1XE7 A;  2RS5 3;  4OI4 A;  3S30 A;  4G9S B;  2XDV A;  3B3Q E;  3III A;  3KV9 A;  4OHZ A;  3WNK A;  4MG2 A;  4KWK A;  4WM7 A;  2QQI A;  4PI0 A;  1J1L A;  2WT1 A;  2CWM A;  2GN3 A;  1WCD J;  1BEV 1;  1GP5 A;  3GXU A;  4QM9 A;  5JUV A;  1SCR A;  3UK9 A;  3VBS A;  2EAA A;  2MNG A;  3GHN A;  4N8M A;  5EYX A;  5FWE A;  5L7O A;  4NID A;  2C26 A;  4RR3 A;  1R1A 1;  2WNU B;  4KG0 A;  4TWT A;  4QXK A;  3ZN5 A;  5ISL A;  1GWK A;  4TN7 A;  5DMY A;  5FLH A;  4FFH A;  4YLZ A;  3DN7 A;  5IFT A;  5JAX A;  5JIA A;  4FPH A;  3O1V A;  1JUH A;  2YC0 A;  3MYX A;  4JGZ A;  5BNN C;  1JYN A;  5BNP C;  4Y4Y A;  4KGQ A;  5FLI A;  5IW0 A;  2NZ9 A;  1RVF 2;  2VMF A;  4FPK A;  4DQA A;  4BQ2 A;  2XKP A;  1S0I A;  5T3N A;  1DGR A;  4BM8 A;  4I09 A;  1H2N A;  4ZS3 A;  5ACA 1;  4NAO A;  4AR2 A;  4F8A A;  3M8L A;  1UZW A;  5FZ6 A;  5E6H A;  4I2O A;  1NQJ A;  2VCC A;  5FPX A;  4C8D A;  3R05 A;  2KR2 A;  3D0J A;  1JI6 A;  4FP2 A;  3RMX A;  4AQ6 A;  3PHM A;  2OXB A;  4K40 A;  1BMV 1;  3A23 A;  4PHZ A;  4N90 A;  2Y6H A;  2RJ2 A;  1RMU 2;  5CFC B;  3U4S A;  3FC0 A;  1CN1 A;  2EXI A;  2FZ1 A;  2BER A;  1V6N A;  1JYW A;  1Q43 A;  1REF A;  1WW4 A;  3MV0 1;  1O4Z A;  3BOP A;  1SLB A;  4IES A;  3VDA A;  4B4Q A;  4E4S A;  3M3O A;  3CDZ B;  4I3G A;  2FCV A;  5GJ6 A;  3GZU C;  1UY3 A;  1YFY A;  2JDM A;  1VBC 2;  4I30 A;  2WQZ C;  4UFK A;  5C70 A;  4DUV A;  3NJY A;  4DB5 A;  2WL1 A;  1LOD A;  3Q8B A;  4CSW A;  2QDN A;  1KEX A;  1RC6 A;  5HPO A;  2GMP A;  5JSR A;  3VHO A;  1JN2 P;  1RUJ 2;  4Z82 A;  4JGZ C;  4A41 A;  5BNN A;  2K2S A;  1RUD 3;  2JDZ A;  3WCR A;  1OA2 A;  1G9A A;  3EO6 A;  4K7J A;  1TME 1;  4QMA A;  1LUL A;  1SBE A;  4PDW B;  3WG3 A;  1RUE 2;  3UKT A;  5FPU A;  1P8J A;  3N7M A;  5LBF A;  1STM A;  1VAK A;  2FCU A;  4AHZ A;  4AI9 A;  3VD4 A;  3VBS C;  2WFP A;  5DQ0 A;  4NIA A;  1AL0 G;  2OII A;  5JXG A;  3RNS A;  1Y4W A;  1RXF A;  5FYS A;  1WMF A;  4YZ2 A;  5DAB A;  4GH4 B;  5CKM A;  4QB6 A;  4GKX A;  2YPD A;  1YO8 A;  3BIW E;  3S6P A;  3AZV A;  1F4H A;  1NAE A;  1RGS A;  4K9S A;  1JZ7 A;  4L97 A;  2CSG A;  3I2K A;  4URA A;  2JG8 C;  2VQU A;  2Y38 A;  3CF6 E;  4IEU A;  4XJU A;  5FZD A;  3WF3 A;  4YSF A;  5EJ3 A;  4ZU4 A;  4FCA A;  2WUH A;  3MW3 A;  2DU1 A;  4GWI A;  3KV6 A;  3P3N A;  1OPO A;  4R9B A;  1DQ1 A;  3ACF A;  1RUC 3;  1SLC A;  4XDP A;  1HB3 A;  4RGG A;  2ZKL A;  3H7Y A;  3W20 A;  4QQ2 A;  3HIF A;  1K5M C;  5FZM A;  4FOQ A;  3VKM A;  4XBL A;  4CDQ C;  1QH6 A;  3K3O A;  4FXK B;  1F5F A;  1O5U A;  1S0J A;  2HWD 3;  1HDK A;  3K46 A;  3N9L A;  1HIX A;  2X5I A;  1NXD 1;  4FI9 A;  3MIF A;  3N3H A;  5DXD A;  3WXP A;  2RS5 2;  2XKO A;  2J1R A;  4BIF A;  4DNY A;  1BVV A;  1RUG 2;  2YMZ A;  2ZX1 A;  1TNF A;  3ELN A;  1Y9Q A;  4OCT A;  2VOV A;  4MUV A;  1Z0H A;  5EWS A;  3RSJ A;  1RUG 3;  2IUW A;  4NMI A;  5GZD A;  1MS8 A;  1QJY 2;  2DDU A;  2CAV A;  5IK8 A;  4Y1Y A;  4LLF A;  2C9A A;  3ACI A;  3M3Q A;  1DBN A;  3IWZ A;  3WV6 A;  1HJF A;  1YIF A;  2P37 A;  2GC2 A;  1D4M 3;  2OX0 A;  2HWF 3;  4FPY A;  4EWA A;  2HWE 2;  3Q8E A;  3NWK A;  1W6N B;  3LA7 A;  5GLU A;  5CFD B;  3O12 A;  2YBS A;  5LBB A;  3ZFF C;  1I5P A;  3NRU A;  3ZFG A;  3V56 A;  5K7P A;  4CDX A;  4RHV 2;  5FUP A;  3WNN A;  4KG8 A;  4Q4V 3;  1PIV 2;  4BQ5 A;  4F3J A;  3MI8 A;  3T0A A;  4M0H A;  2V4A A;  4MYE A;  5FO8 B;  3HVD A;  3WQB A;  5A3W A;  1JXN A;  1W6P B;  3WF2 A;  4XJW A;  5FZL A;  5FPA A;  3THP A;  4AG4 A;  1BQP A;  1O8S A;  3B93 A;  3JQX A;  1W9Y A;  4HN1 A;  4KU7 A;  5FY7 A;  3OY8 B;  5C3P A;  2JEC A;  1SLL A;  4ARY A;  2OYZ A;  2OKX A;  2HJI A;  2BJS A;  3JBG 3;  3T08 A;  5KHJ A;  4BIO A;  1XU2 A;  1ZX5 A;  2VU9 A;  4HG6 B;  2G19 A;  2PXJ A;  4EN9 B;  1Q8S A;  5FJH A;  5JLV A;  4COZ A;  3ZXJ A;  5HCA A;  2J1S A;  5FUN A;  3B01 A;  3CNA A;  1YYN A;  1AR8 1;  1H1M A;  4RD7 A;  1OOP C;  3WD5 A;  3POG A;  4X6R B;  4ATE A;  2EIC A;  1OH4 A;  1RB8 G;  3VZO A;  4IV1 B;  3LIG A;  3PIJ A;  4OUS A;  2GN7 A;  2D93 A;  5FP8 A;  1AL2 1;  2DCZ A;  2XQR A;  1C8M 2;  3LFM A;  4MSV A;  1GKB A;  2DVF A;  4H55 A;  3UJQ A;  4E2S A;  3I3B A;  1QWR A;  4QGM A;  1FOD 3;  5J1X A;  1O3R A;  1PM4 A;  1ZZ7 A;  4RR3 B;  4XQD A;  1OKO A;  2MEV 1;  2VUA A;  1FOD 2;  4IEW A;  3ACH A;  1WLD A;  3OBT A;  4QQH A;  1RUF 1;  5FYI A;  1XSR A;  3SH3 A;  5HXM A;  3T0B A;  3TOJ A;  4DS0 A;  5J7M A;  1CAV B;  2V72 A;  3JB8 A;  4AXO A;  5CFD A;  1D0G A;  5K4L A;  3FWE A;  2A6Z A;  4ISQ A;  2Q1M A;  2RR1 2;  2W1Q A;  4IEX A;  1CPM A;  3WP6 A;  4Q4X 3;  5IK7 A;  2E7A A;  4D7Y A;  4XTM A;  4LUM A;  2Q8C A;  4MGQ A;  4B1M A;  4CRQ A;  3ME2 A;  2CTV A;  2FMY A;  5FR3 A;  1RUC 2;  1QGL A;  2DBI A;  1JU3 A;  1VR3 A;  2ATF A;  2PAE A;  5BNO B;  1HX6 A;  2WRA A;  2PEL A;  5I8T A;  2RR1 1;  5EV7 A;  3TBD A;  4XIO A;  2XL9 A;  4YRD A;  3ZXE A;  3AMM A;  4LK6 A;  2I07 B;  2R04 3;  2VZV A;  4CDW A;  4UOJ A;  2YFZ A;  3TEY A;  3R6S A;  3THC A;  2E7T A;  4NWW A;  1RUF 2;  1RHI 3;  1PMJ X;  2P6C A;  3FFZ A;  4CUB A;  4RL7 A;  3PU3 A;  2PFW A;  2VOT A;  4XTP A;  3PUI A;  1NKG A;  3LAG A;  4OHX A;  1V0A A;  4O9E A;  5CFC C;  3BPS A;  1FPN 3;  1GU3 A;  3PDQ A;  1AYM 3;  1LHO A;  4IGQ A;  1Y7B A;  3NO8 A;  3VZN A;  4I01 A;  5I8S A;  4TYS A;  1I9R A;  5B4X A;  1TMF 1;  2D44 A;  4CCC A;  1VLN A;  3CJI B;  5LBE A;  1NT0 A;  2ZHM A;  3TB0 A;  3LB9 A;  4AQ2 A;  4BCU A;  2VBB A;  1ZRD A;  1MAC A;  1W8N A;  5F3I A;  4QKF A;  1S55 A;  4FPL A;  4Y24 A;  2Y64 A;  2YUE A;  1AX1 A;  1FMD 1;  4MHR A;  4V2W A;  2ZGK A;  1KS4 A;  2DVG A;  4W65 A;  5F5A A;  1YQC A;  3DEC A;  3WW1 A;  2P2K A;  1H2M A;  3LDK A;  2NMO A;  2V5Y A;  2RJL A;  3GDB A;  3LQC A;  3MW4 A;  4KH9 A;  4M0N A;  4CDX B;  5LW9 A;  2GSY A;  2OPW A;  1IKQ A;  1W05 A;  5KC6 A;  1R09 1;  5FPB A;  2UWB A;  3RRD A;  2XGX A;  4HET A;  5IAT A;  3AP9 A;  2D43 A;  5DG1 A;  1DYO A;  1V00 A;  5FY9 A;  4OZO A;  3DGT A;  2CV6 A;  4COV A;  5LEK A;  5C9A B;  2WS9 2;  4NHK A;  1Y9M A;  3LDB A;  1WMD A;  4ZPI A;  3DUI A;  1LEN A;  3HPN A;  3K75 B;  4CCE A;  4YGC A;  3WG4 A;  3ZPY A;  3ILN A;  3ZN6 A;  2WZP P;  2XWJ B;  1MEC 2;  1IS6 A;  2ZXQ A;  4M3C A;  5CFC A;  3TAY A;  3AFK A;  5J09 A;  2JXA A;  1LNS A;  1N3P A;  3D5O A;  2J1V A;  2NMN A;  2XOM A;  2RS1 1;  3PTY A;  4Q4Y 3;  1ZRR A;  1AR6 2;  1I6X A;  4AE2 A;  1F15 A;  1FMD 3;  5IK5 A;  3MBW A;  1HLC A;  1OXC A;  1MVE A;  3OOX A;  3ZIW A;  4QX0 A;  1JHN A;  1A6C A;  2CDP A;  3T1M A;  4IUG A;  3WF4 A;  3WW4 A;  4A7K A;  4CEW B;  4DXZ A;  4WV8 A;  3SIS A;  4HN0 A;  1EY2 A;  3J26 N;  3POE A;  1UAI A;  1JTZ X;  3EBR A;  1PO1 3;  2FD8 A;  2BOI A;  2VY0 A;  3VD9 A;  4LMF A;  1W9T A;  2VVE A;  3OJB A;  1MS3 A;  5DAW A;  1PO1 2;  4J25 A;  2WC2 A;  4NRM A;  1SDW A;  1SEF A;  4CU7 A;  4R4X A;  1D2Q A;  2W87 A;  5T5O A;  2FDK A;  2Y60 A;  3HJR A;  1PIV 1;  5HXV A;  1RUG 1;  2DF7 A;  5FWJ A;  4OUM A;  3TN9 3;  4KMQ A;  2Z79 A;  4Q4W 3;  4L99 A;  4DXS A;  4LE3 A;  2D3R A;  4MVT A;  1X82 A;  3IMM A;  4RSU A;  1R09 3;  3BTA A;  3PL0 A;  3U37 A;  4PBP A;  3RZM A;  2VQ0 A;  3LCP A;  4HT1 T;  4CCO A;  5HCH A;  5JOY A;  1X9P A;  1CZT A;  1AXZ A;  4B1L A;  3NV3 A;  4Y5Z 0;  3M2M A;  3PNA A;  4C0H A;  1FOD 1;  1KIT A;  4L92 A;  4WBB A;  2VE1 A;  5FZ3 A;  3UJO A;  1PM7 A;  3BN6 A;  2NM1 A;  3M3I A;  2Q8D A;  4TXW A;  3N7K A;  2QQN A;  3WQ7 A;  3LEK A;  5A1A A;  1AR7 2;  2TUN A;  4RQP A;  1SCS A;  2WO1 A;  3IDA A;  2C9K A;  2CHH A;  2ZS6 B;  4K3U A;  3SEE A;  4A7Z A;  5C33 A;  5BPX A;  1VBB 3;  1LCL A;  2VD7 A;  1MZ5 A;  2VTF A;  1JZ5 A;  3ZM8 A;  1HQW A;  3AMN A;  4AEK A;  1HB1 A;  3S7E A;  1Q8P A;  3GNE A;  4AHX A;  4NUB A;  3O1O A;  3VBF B;  3H1W A;  1UY1 A;  1DDL A;  2W3J A;  3J8F 1;  1SG3 A;  3O0X A;  1GQP A;  4WVV A;  2CAU A;  2BDR A;  2I45 A;  3A4U A;  2C6S A;  1NLQ A;  5KR7 A;  1H6Y A;  4J1W A;  4IER A;  1LOC A;  2VMD A;  3KV5 A;  4QXH A;  2LTN A;  3NJV A;  1BK1 A;  3RGB A;  1QJZ A;  1RED A;  1FPN 2;  2BBV A;  3ZXD A;  3CO2 A;  2ORZ A;  1O6U A;  2VEC A;  5FP3 A;  3ZKU A;  1W28 A;  3A7Q A;  1HRI 3;  3OB8 A;  1MQT A;  3T2Q A;  4LQR A;  2VZS A;  2Q0A A;  2BWA A;  1NZI A;  1Q5O A;  3TYJ A;  1WUV A;  4CEY B;  4NII A;  5FPV A;  3M70 A;  1UIK A;  5JI9 A;  2K0G A;  3GZT B;  5CKQ A;  3BTX A;  4CEY A;  3MFA A;  5A7S A;  4I02 A;  4CDX C;  4NE9 A;  4LO7 A;  4JTO A;  2RDS A;  1QNY A;  1N47 A;  2W1U A;  1QU0 A;  5DAX A;  3H3Z A;  5CG9 A;  1NY7 2;  3ZSK A;  1CAW A;  1OPM A;  1SBF A;  1S0D A;  1DLC A;  1A8D A;  1UX6 A;  1U5X A;  3GCW A;  2IWG B;  1LKN A;  2QZ2 A;  4GB3 1;  1URX A;  4W6W A;  3T2O A;  5F3C A;  1RUJ 1;  1ZZ8 A;  5FZO B;  2W39 A;  2NQY A;  2Y0O A;  3RG0 A;  2VM9 A;  4QHB A;  4Y4R A;  5EIY B;  2QQM A;  3MGU A;  1UOF A;  3RZK A;  4R8H A;  3AVR A;  1IGO A;  2VUD A;  4PF5 A;  4QPG A;  5A7P A;  4MX3 A;  5L7O B;  4CP9 B;  4AGR A;  5IWF A;  1E5H A;  3JD7 3;  4NHM A;  1RUN A;  1AR9 1;  1C1L A;  4FOV A;  4V2V A;  3BU7 A;  4AFB A;  4AFM A;  1W6N A;  3KVB A;  5A6Q A;  3HNB M;  2BP6 A;  1S2E A;  1RUC 1;  1XPW A;  3MZH A;  1WMX A;  4XE9 A;  3JCI A;  3ACL A;  2UYB A;  3UGG A;  3PU8 A;  1JBC A;  5ACA 2;  2BFU L;  4MXW A;  1YJL A;  1US3 A;  1G9F A;  2WKK A;  3RWN A;  1X50 A;  5FQ0 A;  1WME A;  4M00 A;  2JKX A;  2R6Q A;  2V5D A;  3PMS A;  1QJU 1;  1CAV A;  2HLE A;  5FV3 A;  2JG8 A;  2CU5 A;  1W6O A;  1W99 A;  5A1F A;  1TME 3;  1CAW B;  2HEV F;  3QH7 A;  2Q1F A;  3KB5 A;  4JQR A;  4BZ4 A;  5C9A C;  1QQP 1;  1C5H A;  4PQ9 A;  1AYM 1;  1DIW A;  2ILM A;  5JMO A;  1FPN 1;  2WFF 1;  2FDF A;  2DTY A;  2ETE A;  5AVP A;  3THD A;  2MEV 2;  1AHS A;  1XXN A;  3PME A;  4O7X A;  3SNM A;  3AYC A;  3E6D A;  3VDD A;  5A32 B;  2BYV E;  4EWE A;  4I3P A;  3E6C C;  2E31 A;  4WZC A;  3QCW A;  4AVV A;  2F4P A;  1ZBE 2;  1GOH A;  4YW6 A;  4CA9 A;  5KXE A;  2VCB A;  4XFA A;  4CU9 A;  5JVV A; 
#chains in the Genus database with same CATH homology
 2VD7 A;  5F39 A;  5FZC A;  4XDO A;  5FZ1 A;  5IVE A;  4NUB A;  5A7Q A;  3AVS A;  5A3T A;  3PU3 A;  5FY0 A;  3DXU A;  5FWE A;  2YBK A;  4GAZ A;  4D6R A;  5KR7 A;  4CCL A;  4QXH A;  5ISL A;  3KV5 A;  2OX0 A;  3PDQ A;  5LY2 A;  4TN7 A;  4DO0 A;  4IGQ A;  5FPL A;  5A7W B;  4D6Q A;  4QU1 A;  4LXL A;  4Y3O A;  5FP3 A;  5FP4 A;  2OQ7 A;  4UF0 A;  4ASK A;  2W2I A;  2YBS A;  4Y33 A;  4IGP A;  5IW0 A;  5F3I A;  5A7W A;  5FZ8 A;  3N9M A;  5IVF A;  5IVJ A;  3K2O A;  5FYT A;  5FYM A;  5FYU A;  5FUP A;  4V2W A;  5F5A A;  4CCM A;  5FP7 A;  5F3G A;  5F5I A;  5FPV A;  5F2S A;  1VRB A;  3ZLI A;  5CEH A;  3N9Q A;  5LW9 A;  5FZH A;  4EYU A;  5FJK A;  5FZ6 A;  5A7S A;  2XXZ A;  4QXB A;  5E6H A;  5FZ9 A;  2YU1 A;  3PUQ A;  5FYV A;  4C8D A;  5FXV A;  4QXC A;  5FPB A;  5A3W A;  4CCN A;  5FYY A;  5ANQ A;  3OPW A;  4LIU A;  5FY9 A;  5FZ0 A;  5FPA A;  5FY1 A;  5FZL A;  2WWU A;  5FY7 A;  3LDB A;  3U4S A;  4IGO A;  5LWB A;  5FYZ A;  5IVB A;  4CUG A;  4HON A;  4CCJ A;  5F3C A;  5FXW A;  5FZO B;  2PXJ A;  2XUE A;  5F5C A;  5FJH A;  4Y4R A;  5FZE A;  4D6S A;  4DIQ A;  2YBP A;  5FUN A;  5A3N A;  3NJY A;  4GJY A;  3AVR A;  5A7N A;  4CSW A;  4BU2 A;  2OQ6 A;  2OS2 A;  3KV4 A;  5FY8 A;  5A7P A;  4LIT A;  3ZPO A;  5FZF A;  4BIS A;  5IWF A;  5A80 A;  5FXZ A;  5FP8 A;  4V2V A;  3K3N A;  3PUA A;  4LIV A;  5A1L A;  3AL5 A;  3N9P A;  5FZI A;  4BXF A;  3KVA A;  5FZG A;  3KVB A;  4QX8 A;  4UF0 B;  5FPU A;  5F32 A;  5FY4 A;  4AI9 A;  3PTR B;  2WWJ A;  3DXT A;  3PUR A;  5FYI A;  5FYS A;  5A7O A;  3PU8 A;  4HOO A;  5FYH A;  5FYB A;  3LD8 A;  5FZ7 A;  4AAP A;  2YPD A;  5FWJ A;  5FYC A;  5LY1 A;  5F3E A;  5K4L A;  5FZA A;  4GD4 A;  4URA A;  3U78 A;  2GP5 A;  5FZD A;  3RVH A;  5FV3 A;  5A1F A;  4EZH A;  4CCK A;  2OT7 A;  5FP9 A;  2YU2 A;  2Q8E A;  4EZ4 A;  5FZ4 A;  2XML A;  4QX7 A;  4CCO A;  3N9N A;  3KV6 A;  5IVY A;  2Q8C A;  4GJZ A;  4XDP A;  5FBJ A;  3N9O A;  5FZ3 A;  2GP3 A;  5FZO A;  2P5B A;  5FZM A;  5IVC A;  5F2W A;  5FXX A;  2Q8D A;  5FZK A;  3K3O A;  5FY5 A;  5FZB A;  3PUS A;  3UYJ A;  5IVV A;  3AL6 A;  3N9L A;  5A3P A;  4E4H A;  3OPT A;  5F37 A;  4QWN A;  2XDV A;  3KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...