2YBPA

Jmjd2a complexed with r-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybpA01
4IGQA 5ANQA 5FZOB 4CCNA 2Q8DA 5FZ3A 4LIVA 5FP9A 5F5AA 3K3NA 4LITA 5FY1A 5A3WA 5F3CA 5LWBA 5FZ7A 4CSWA 5FY4A 4GD4A 4ASKA 4TN7A 5FPUA 5FUPA 4IGOA 3RVHA 5IVBA 5FWEA 5FYSA 4D6SA 4CCMA 5FY7A 4UF0B 2GP3A 5A7SA 4CCLA 5A3TA 3PDQA 5FYTA 3U4SA 5FYIA 5KR7A 2OQ7A 5FPLA 3KVAA 5FP7A 5F5CA 3AVSA 3KVBA 5A7WB 5A3PA 5FZKA 2PXJA 4QWNA 5A1FA 2XMLA 5IVCA 4BISA 3K3OA 5FZ4A 4XDPA 5IWFA 2GP5A 5A7PA 4Y3OA 5F3EA 5FZGA 2W2IA 4GJZA 2OQ6A 3KV6A 5IW0A 4CCJA 5FBJA 5FZCA 3ZPOA 5LY2A 3KV4A 5FZOA 5FYYA 5K4LA 5FZ9A 4QX8A 5FY0A 3N9QA 5FXWA 4DO0A 4BXFA 2OS2A 2VD7A 4Y33A 3DXTA 3UYJA 4NUBA 5FXZA 3PU3A 5A1LA 4AI9A 5IVVA 5F2SA 5F39A 4UF0A 3N9OA 4URAA 5IVFA 5LW9A 5F3IA 5F3GA 2YPDA 3OPTA 5FYHA 3AL6A 5FYVA 5A7WA 5FZEA 5ISLA 2WWUA 3PU8A 5A7QA 3KV5A 4QXBA 2P5BA 4BU2A 5F32A 5FZBA 4IGPA 3U78A 2YBKA 3PURA 5FPAA 2YU2A 3PUSA 5FPVA 5FY8A 4HONA 3PUQA 4HOOA 4CCOA 4CUGA 2OX0A 4LIUA 5FZLA 4QX7A 4V2WA 4CCKA 4QXHA 1VRBA 5FWJA 4EYUA 5F5IA 5FV3A 5FZFA 5FYBA 4GAZA 5FYUA 3PUAA 5FXVA 5A7OA 5IVJA 5FP3A 5F2WA 5FZDA 4XDOA 5FYMA 5FZMA 4Y4RA 5F37A 5FZIA 5FZ6A 5FUNA 5CEHA 4DIQA 4GJYA 3N9NA 3KV9A 3AL5A 5IVEA 4QXCA 3AVRA 2Q8EA 2YBPA 2WWJA 2Q8CA 4D6QA 2XXZA 5E6HA 5A7NA 3ZLIA 3DXUA 2YBSA 5FP4A 4EZ4A 3LDBA 5FP8A 5FPBA 4V2VA 5FYZA 5IVYA 3NJYA 5LY1A 5FYCA 2XDVA 2YU1A 3N9PA 3PTRB 3LD8A 5FJKA 4EZHA 2XUEA 4D6RA 4E4HA 4LXLA 5FZAA 2OT7A 4QU1A 4C8DA 5FXXA 5FZ8A 5FZ0A 3N9LA 3OPWA 5FJHA 4AAPA 5FY5A 5FY9A 5FZHA 3K2OA 5A80A 3N9MA 5A3NA 5FZ1A
chains in the Genus database with same CATH superfamily
1RUG3 4NN0A 1GR3A 1H2MA 2K46A 2PELA 4AE2A 4ET7A 3D4KA 4XURA 4CCCA 2Q8OA 1PZ7A 1AR93 1RUC2 4N90A 5F3CA 1LU2A 2RS53 1LESA 4CE8A 2F4PA 2PHTA 3JQXA 4FAGA 2WNVA 3AYCA 1DF0A 1YQ6A 3DL3A 5C8CB 2ETEA 2R32A 3GHNA 4B3NA 1QIQA 2XLAA 2YZ4A 4XQDA 4RL7A 2A7AA 1WLTA 4D6SA 4JZRA 4ZHNA 2V09A 2C5DA 1DYPA 4Q27A 3POFA 5A7SA 1OUXA 3ZYBA 5K0UC 2VY0A 3GF6A 4W6WA 1X7NA 1VJ2A 3U14A 4WVZA 1TNFA 4A6OA 3MIEA 3LOIA 3OG2A 3RJ2X 3ON7A 4L11A 4LO6B 4HG6B 3K3OA 4AVCA 1QJU2 4NE9A 4Y3OA 4BHPA 2W68A 1RXGA 3ZYFA 3WUCA 4AFCA 1UY3A 2PQQA 2WNVC 4QB2A 3N9QA 1NCQA 1RUD1 4DO0A 5K0UB 2VD7A 3VKNA 2DYCA 1IZ3A 4OCTA 1PK6B 1XU2A 1NYWA 1PGW2 2VMFA 2XLFA 3AMPA 3E1F1 2XBO2 4H55A 3VHPA 2FDHA 1UOJA 2YG0A 2XH6A 2EXHA 5FPZA 2OIIA 4IEPA 1DQ5A 1X9PA 4IV3C 3WDWA 4QQPA 4LJHA 4FFFA 3ZPYA 1XXNA 5A7WA 4S2FA 4CP1A 2WWUA 2VPVA 1WLDA 1ZZBA 4UFMA 4GB32 4W6XA 2EA7A 4Q4V2 4YG3A 4Q0QA 2OZJA 3PJQA 2CDPA 5BXXA 1NCQC 2OX0A 4F7ZA 1YI9A 3PTYA 2CHHA 3TRSB 4HMZA 1SBFA 3FHQA 1QOSA 2QQJA 3ELNA 2AUYA 4IV3B 1UWWA 5IVJA 1JYWA 3VDBA 2ARAA 2ZKLA 5DN2A 4CPBD 2J1UA 1JOBA 2JDMA 4H7MA 4I09A 4P08A 3WT3A 5I8SA 5F37A 2VMCA 3GCWA 2ZACA 1KXGA 4YM0A 3Q8BA 2A70A 1HN0A 3AZYA 4AFMA 4I3GA 3UESA 3AL5A 4QXCA 2QDNA 3D6EA 1RUE1 2Q8CA 4L92A 1X50A 2Q1FA 1ZRCA 1H9WA 5BNOC 4ZZ8A 4KL1A 5KXDA 1W8OA 2XONA 4OQ8A 1QY4A 4AFBA 2WDBA 2LROA 4P9GA 4EZ4A 3R05A 1WMEA 3MIDA 3IPVB 3VB9A 3CJXA 2E6VA 5C71A 4LK6A 2HWC2 4BIOA 3T08A 2VVEA 1IHMA 2Y6JA 1W0PA 4NHLA 4TZDA 1EUTA 2RHPA 1HRI3 5LASA 1Q8VA 1DQ1A 4AYUA 1NQDA 1ZZCA 5FZAA 1LENA 3I2KA 4P9XA 2UU8A 4LBQD 2H0VA 2F4LA 1NX9A 2ARCA 4EROA 5BNNB 4H14A 5FJHA 4DUVA 3IBMA 5CG9A 4XHBA 5BNOB 1W6PA 3HQXA 4EQVA 4XW3A 5GZGA 3K3NA 4CXWA 4YVSA 4TXWA 4HKLA 4CVUA 1D4M2 1XE8A 1HRV2 2E7AA 4JV4A 4TN7A 5E1RA 1JZ6A 4BPZA 3RVHA 3K46A 4CEWA 3WDVA 4Z92B 1VMJA 4AHYA 4MX3A 3PDQA 4HFSA 5FO7B 1ZREA 1NKGA 1LHVA 1JBCA 1AR62 2QQWA 1MS9A 2GH2A 2VU9A 3ORJA 2DDUA 4QDSA 1JYIA 1D0HA 2Y6FA 3WNOA 3ZXJA 4W50A 4XJZA 2PHDA 3APBA 5IK8A 4FP3A 2OVUA 4N7IA 3S6PA 4AQ2A 1UYZA 1DZRA 2A6VA 4UFKA 1KQRA 2I74A 1RMU1 1ASJ3 1DQ2A 2WBKA 3PLQA 4ES9A 3OY8B 2Z4FA 1AYN2 2V5YA 1DYOA 4TYSA 2JE8A 1GNYA 2F17A 5C3RA 2VBPA 1EAH2 1PHMA 2ZHNA 5FXZA 4XZPA 1Q56A 3MW3A 3PU3A 4MO3M 1GWLA 2RMU3 4P14A 5IJRA 1HKDA 4SBVA 1HQLA 5HV4A 2WAAA 5LW9A 1O8SA 2EIEA 4CUAA 1HLCA 3NV1A 5FYHA 4BM8A 4CDUB 3JUUA 1AR83 2HEVF 4UFIA 4BIFA 3OGRA 2VQAA 1UXXX 1QJX3 3TNPB 3WF0A 2VOVA 1DCSA 1JOPA 1GOGA 2YU2A 3PUSA 3ETQA 4NJ4A 4JDMA 3VDDC 3ZDVA 1RUH3 2WO2A 2BP6A 3RPQA 2DUQA 5KC6A 1VBE3 4RHV1 2WFF1 1VRH3 1OH3A 1NLRA 1ZX5A 5F5IA 3SMHA 3PUAA 1RHI2 4LKFA 4C90A 4LUKA 1WWYA 1RUF2 1JZ5A 2FCTA 4META 4PJYA 1VBD2 5LA1A 1ZRRA 2D97A 4I02A 3JQWA 3S0MA 3UJOA 3AP7A 3RGBA 4FPKA 4FQ4A 4DIQA 2BRTA 1FPN2 5F7UA 3VDDB 3WVJA 2VUJA 2ZHKA 3U07A 1P8JA 3OUJA 1RINA 3LEMA 5KC5A 5T5JA 4RR3A 1POV3 2QNKA 4XBQA 1MQTA 4AVAA 2QE3A 2VZSA 4PIYA 1QOOA 2YGMA 5IAVA 3VD5A 1COV3 5ACA3 4CP9B 4CXXA 2WS92 5A3OA 2IXHA 3P5BA 2JB8A 5DDJ3 3W20A 4XFFA 1JZ2A 1MR5A 4B7EA 4HKOA 3WCSA 1C8NA 4LLOA 2WAOA 2DCTA 1GKBA 2XUEA 4R52A 1VBC1 4AGVA 1V6NA 2AGSA 4CTEA 4DQAA 1A8MA 5FUIA 1US2A 5FXXA 2JDAA 1C5IA 2PAEA 3KM5A 1XNCA 4LEJA 4CUBA 2Y6LA 3TEWA 4TLGA 5IK5A 2D98A 1C1LA 5FZ1A 3CJIC 3Q8AA 3LF7A 4XMIA 4AEJA 3O1PA 3NKGA 3A23A 4RR3C 3LAGA 3OEBA 4FP2A 1CQ9A 3WNLA 1MQTC 2JG9C 3SH3A 4GKYA 4UFJA 5J7MA 4JTOA 1PMHX 5A33B 3ABZA 4BDVB 4IV1B 3WQ0A 2A6ZA 2VZ3A 4Z8BA 2JKXA 4BQ3A 5JIUA 1MS4A 2EAKA 5FYTA 2D3SA 4YVWC 5FYIA 2OQ7A 1QXJA 1S2KA 4GB33 4O9GA 4F8AA 2BTVC 1JN2P 1QNYA 2RDSA 2ZGRA 3CJIB 4QMAA 5EJ3A 1LAJA 2VZVA 2XMLA 1LGNA 2PHRA 3SH5A 4RR3B 4COYA 1H6YA 3H1WA 2RM21 5IVCA 3MIFA 2MPFA 3T0AA 2EF6A 3FHIB 1REFA 2JG9B 3L2HA 4NWVA 2E32A 1Y9MA 3H3ZA 3KV6A 3KB5A 3N35A 4AEKA 3OGVA 1FV2A 3I97A 1JHJA 4QX3A 5FMBA 5FYYA 3WF1A 3N3HA 2R042 2UY9A 1Q5OA 2R062 5DG2A 2PHWA 2W1SA 4QB6A 5GM0A 4YVWB 4UFHA 4NHKA 1UOGA 1UY0A 2BVBA 4E2GA 5L7OA 1SFNA 1GNHA 2GMMA 2HWF2 3ZMOA 3VD7A 1SCRA 2FDJA 3CZJA 3O1TA 2DVFA 2ES3A 3GYDA 2C1FA 3I4IA 2HLEA 4BXSV 1JH5A 3AL6A 2HWD1 2ZX0A 3T1MA 1F9KA 2R49A 4I01A 5HBAA 2WQ4A 2P1BA 2PHXA 3PU8A 3T09A 1PO12 4QPGA 3IMMA 3SEEA 2WRAA 3JBG1 3ZN4A 1NLQA 1RVF3 2BVVA 3ZYPA 2VZRA 2ZHMA 4CRQA 5KHGA 1WCDJ 1WKYA 2Y6GA 3ILRA 5L9RA 4EE2A 5I0DA 1HJFA 1LHUA 4Q2FA 1AYM2 3WP4A 4YFWA 3BKZA 1FOD2 4BQ5A 5L7OC 1W05A 2CL2A 3E5XA 3B94A 4CEYB 1OPOA 2V4AA 5FZDA 3EJKA 1REDA 4HVQA 3FWEA 1W9TA 3OBRA 4MSVA 4A42A 1D4M3 1DP0A 2P37A 2VUCA 3H7JA 4Y20B 3O1OA 4LKEA 5IVEA 1I1EA 5EP9A 3AVRA 1IQDC 2UWCA 2BBVA 1B09A 3CHXA 3MW2A 2VZQA 4FOYA 4FPOB 2VE1A 4ZS2A 3POSA 3VGIA 4W4ZA 1TQ5A 5A7NA 3BPSA 4LBQB 3LE0A 2DCZA 2YBSA 4P9LA 4YW1A 1Q8QA 4MGYE 1QH6A 5L7OB 1AR63 1CN1A 1WA4A 3VLBB 2YROA 2NN8A 2ZAHA 1OH4A 2DFBA 2VCAA 2QQOA 4L8QA 2JX9A 3NVCA 4DEVA 3MBWA 3SITA 4AVTA 4M0HA 3HR9A 3M3EA 3WQ7A 1UY2A 3GZEA 4FPLA 2VZ1A 1AYN3 4IERA 3IAPA 4ZXKA 3VL9A 1AZDA 3ALQA 2CYFA 4XAEA 1VP6A 1OBNA 1WMDA 2DFCA 1OLQA 5HCFA 1UYYA 4OUSA 1OA4A 3TN91 3WW3A 1VAKA 1EAH3 2VUDA 2PN5A 3OTFA 4SLIA 4V1PA 5AVPA 5FIXA 2V73A 4O65A 5FPXA 4JC1A 1WCUA 1WA6X 3CF6E 1OLMA 1E5HA 2B8MA 5FY4A 4GD4A 2R0FA 3AMNA 3RJRA 3O1MA 1XYNA 1RUJ2 4JRAA 4FTBA 4XQWA 4XILA 4JTNA 4AI3A 2D6NA 4CU8A 4ITCA 2XG3A 2AC1A 1AL22 1ZBE1 2RV9A 3L9JT 3RMXA 2B5HA 5AFBA 4WM8C 2UYBA 1GQPA 2DVDA 3K4ZA 1HQWA 2MNGA 4OI2A 3TEZA 3V64A 2Z42A 1UW8A 2QQPA 4QQHA 5IUQA 1RXFA 3V0AB 2ZGTA 3ETPA 4RD7A 3ACLA 3WNKA 2R1DA 3USUA 5F8PA 3B7MA 2CTVA 3MDPA 3ZPOA 1I6XA 3PVBB 1CESA 2HWB2 4FPGA 4I0WB 3LSEA 4WM7B 5FZ9A 5BY5A 2WO7A 1QJY1 2VW0A 5FK7A 1B35B 4K6BA 4UT5A 1F35A 5JXIA 1W6QA 4UFLA 3HT2A 1FATA 1S2BA 2QBXA 1BEV3 1AX0A 2RJ2A 1ZM1A 1K3IA 4YW7A 5J1XA 4WM8B 2AYHA 2AZ5A 3AK0A 1FPN3 3BU7A 4NPLA 4ES8A 4M3CB 3I2JA 4RYDA 1HXS2 5JAXA 1S2EA 1LGBA 4Q4X2 3ZR5A 3EXUA 3KCYA 1YQCA 1R081 2A1XA 3ACGA 2BW8A 3H50A 3OPTA 3VBUA 1TZOA 5EV7A 4WBBA 3W5NA 2P6HA 2QQVA 5CB7A 2GC1A 5DG1A 1I5ZA 2JDYA 1ULOA 1DYKA 1Y4WA 1LCLA 2WS93 3ZR6A 3VBFA 1BQPA 3LPGA 4KI5M 2D5HA 2PTMA 2W08A 1LB2A 3MGUA 3I59A 3VL8A 4CCOA 3NAPC 1C3HA 1ZBA1 1R1ZA 3GCXA 3QLQA 4QX7A 1OFSA 1TME1 1RJ8A 1C5HA 1N3OA 2GH8A 2R071 1GBGA 4RS5A 5AVAA 5FV3A 1FNZA 3CIHA 4K21A 1AR92 2RR12 4ARYA 1OD3A 2RS52 1WMXA 1MZ5A 4KG0A 4M4RA 5JMOA 2K2SA 3OB8A 4C0HA 2JG8B 3ZIXA 5FZIA 1HN1A 2ATFA 3JD71 1HB4A 3ZYGA 3VKLA 3HNMA 3L2YA 3VBFC 1GP6A 3NAPB 2DVAA 1W6QB 1UO9A 1XE7A 4MHUA 3WINE 1ZYBA 1SFYA 3HT1A 1YQ8A 3AX4A 5EZWA 3S7IA 3ZN6A 3S57A 3T0DA 3POWA 1CWPA 4YRDA 2NZ9A 3T30A 1OKOA 2Q1ZB 4CDQA 3W21A 4MHRA 1YUDA 3P1IA 5JOWA 2BBAA 3VHOA 2XDVA 1PM4A 3VN4A 1EPWA 4LXLA 3V56A 4XEZA 1PO22 4MZUA 4AL9A 1R091 3KLSA 5IYYA 4Q4Y2 2NYYA 3AJYA 4XMAA 5D8AB 2MEV2 3T3YA 1J84A 1QOTA 2R043 2Y64A 5DQ0A 3CNAA 1WMFA 2R063 2W46A 5GZCA 4E2SA 4FOVA 4D0QA 3W5MA 3MZHA 4IGQA 4RGKA 1NUKA 3I54A 4YGBA 5FZOB 3OGGA 1C8M3 2UURA 2IXLA 2QQNA 3FLTA 4IEOA 1Q8SA 1NA1C 4WVMB 2VVFA 5I91A 1FI2A 2HWF3 3BGAA 4P9WA 1STMA 3AP9A 4OFGA 1OSGA 3H8UA 4FCAA 4K20A 5L19A 4LMFA 1HW5A 5JIAA 4EN9B 1RTVA 1VLNA 1X8EA 3LSDA 4PIXA 2VECA 5BPXA 4FOWA 2H6CA 3DCQA 5LK7B 1JTZX 1RMU3 2AH2A 2KXLA 1V9U1 4MADA 4B1LA 3ATGA 1YJLA 4COVA 2DV9A 3JB8A 3WDYA 2D40A 1Y3TA 1NA1B 1JYCA 1O8PA 2BQPA 4UOJA 3TB0A 4A44A 1ST8A 1OLRA 2WZPP 5GJ6A 5F5QA 4HZFA 1UN1A 1LOAA 5FRAA 1QDOA 4YW6A 5FY0A 4UW5A 2FMDA 2NMOA 3I2GA 4A2UA 4CXYA 4BXFA 2GALA 1GOHA 3DEMA 5F1RA 2X29A 2TNFA 2VL4A 4HKWA 3IAQA 3UJQA 3CZUA 1Y43B 4MVTA 1VMHA 3AYEA 1VBA1 1WCSA 2IXJA 2LS6A 4AI1A 2JB4A 4UF0A 3IB3A 2KM2A 5DABA 2XJUA 1PM7A 1H1AA 4HPKB 4QX5A 2YPDA 5F3GA 5JXGA 1MACA 5JVVA 2VAUA 2AENA 3VZMA 1UMIA 5F6LB 5A7QA 1HRI2 4RHV3 2WZEA 3HBZA 4FPFA 5FKBA 3J9SA 4ZY9A 2LM3A 1WLCA 5GZFA 3WZ1A 3ZSLA 3U78A 4QX0A 2YBKA 3MIHA 1BBT2 3PUQA 3FBMA 3PVOA 3THTA 2FDGA 3OF1A 4CUGA 3RYKA 4YM3A 1NXD1 4QXHA 1W8HA 1XNBA 4XFHA 5JXHA 2SBAA 3WF3A 1JYNA 1CAVA 1O5LA 1OT5A 5EWSA 5FYUA 1CIWA 1NQJA 4P00B 4QAWA 1IGOA 4N43A 3USSA 3NL1A 1N1SA 5FK8A 4AHXA 1CZSA 3KGLA 4KH9A 4LA3A 4Q4V1 3EYPA 4QPWA 4RSUA 2Q8EA 5KHJA 1W39A 2IUWA 4D7YA 1GUIA 5CFDC 4HVRA 4OI4A 1A6CA 1VBC3 3TOJA 3LDBA 5BUVA 3OOXA 2JDHA 1I5PA 4OHWA 4BE3A 1LECA 1YIPA 1R1A1 1LOCA 5H9QA 4NRPA 4Y5TA 2WNUB 3AZVA 3AP5A 4E27A 1H0BA 4XF3A 3OEAA 1ASJ2 2BPA2 2PQSA 2IFWA 3OD4A 3NV4A 2WLPA 1YQ5A 4PDWA 3UT0A 4N43C 1W04A 3LEIA 2ZAAA 4NHMA 1IS4A 1RUNA 1UD1A 2RS12 2XKPA 3T2QA 5CFDB 4GMP3 3HNYM 2WYSA 3N9MA 4GZ9A 1W0OA 4V2WA 2JIJA 2RMU2 4NVPA 4Y1UA 5LBBA 3T2TA 1PVXA 4Y24A 1PIV1 1XBFA 4DXSA 1AHSA 3VZNA 1HXS3 3NMBA 4ASKA 2RS31 4FQZA 1AR82 5FUPA 4IGOA 2OKXA 1QJX2 1SLBA 1XSRA 1YO8A 4JQRA 1CD3G 4LBMA 2ZTNA 3MHZA 2ZX4A 3DYPA 5I0TA 2QQMA 1GOFA 5KR7A 1D2SA 4L0PA 1RUH2 4QB1A 3HIFA 1C4RA 3DKQA 4M0NA 5IATA 2PXJA 1VRH2 3QBQA 5AC91 3ITQA 3AM2A 1NY72 1UQXA 3LKJA 1HX6A 3AYAA 3OCPA 5A6XA 4AI2A 4GJZA 4TTGA 4JHTA 4YGDA 3UKTA 5FBJA 4AI0A 5E89A 4C91A 1YLLA 1UU5A 2RR13 2WNOA 4XBNA 4XETA 1FX5A 4XF0A 5C9AA 3U4XA 2VZOA 2JDZA 2OS2A 4EWAA 2FCUA 4Q0SA 2E9QA 5L9VA 2EIGA 4Y33A 4UI9L 1OOPA 4D94A 1DHKB 1ENXA 4I2OA 5FOJB 4MOAA 4M01A 5IVVA 1UPSA 2QZ2A 1T2XA 1MEC1 4RFRB 5FREA 1A78A 1O3TA 1QXPA 1KD7A 4UW4A 3KT7A 1OQEA 1COV2 5ACA2 3MIGA 5D1IA 3LFIA 1DQ4A 5CIRA 4DEQA 3HQRA 5DDJ2 4ZPIA 5FQ0A 5A6QA 3JCIA 5T5PA 5ISLA 1W6OB 4OI1A 4CDWA 2X05A 4BU2A 3FL7A 2ZX3A 1Z78A 4IGPA 3ST7A 1R64A 4HSLA 1IG0A 4KBZA 1AR71 3LQCA 4FXGB 3WHTA 1RC6A 1PO23 2WABA 1ZRFA 4QXKA 4Q4Y3 4EN8B 5BYNA 2IXIA 3ILNA 3Q8EA 2MEV3 3VKOA 2R1BA 1GQGA 1AX2A 5FZFA 2ORXA 2W1WA 4R9DA 4UW3A 5H9PA 2B42B 2QQIA 1EV11 2A3XA 2VM9A 4UYBA 5DAWA 4Q4W3 5DAVA 1YI7A 2ID4A 4ISRA 5E8AA 5FMCA 4FO9A 4UBHA 4DNYA 3BB6A 4E8CA 3A0KA 5HPOA 1VR3A 3N9NA 1GZCA 1VBB1 4AHZA 5J36A 1PX4A 1ENRA 1F5FA 2OUJA 3GJAA 2WWJA 1BVVA 1HB3A 2QQKA 2WNVB 4GALA 4Y1YA 5FOBB 1UU6A 3THPA 5E6HA 4E4ZA 4JGZA 4PBPA 5JZGA 1Z7S2 1YRZA 1GZWA 3H1MA 4YZ5A 1ENQA 4V2VA 1XYOA 1PVC2 3QH7A 4LO8A 3NJYA 4LBOA 2ZMLA 1FNYA 1SLTA 4Y1XA 3HMYA 4D8MA 1WW6A 1CJPA 3PJYA 3IN9A 4YWAA 5KXBA 3J8F2 3ZXGA 1RUF1 3TYJA 5ANNA 3TN93 1QDCA 1VBD1 4XJ8A 2UWAA 3THCA 1BK0A 3VBHA 3I3EA 3M4FA 2JDPA 2WJSA 2BWAA 3M8LA 5CAZA 1TE1B 1AUYA 3N9LA 3WY6A 1S1AA 4QT6A 4DRRA 3AMHA 2WT0A 3O14A 3K4AA 5JMCA 4XCBA 3WP5A 1LOFA 1CAWA 1IS5A 2QDRA 2JKBA 2WN3A 4RQPA 1YJKA 2A6YA 1NCQB 1IG3A 4LITA 3DPRA 1YIFA 1WBFA 4DXZA 1QMJA 5JI9A 1GWKA 3H9AA 5JZGC 4E4DX 2R6QA 3IDAA 2BDRA 4XUQA 2A6XA 1QKQA 1U5YA 4PHZA 3O0XA 4YARA 1REEA 5DMYA 1OMIA 4K40A 4YG0A 1ONAA 3O0VA 1RVF2 3MLJA 4JAAA 2GNTA 2HBUA 4P9IA 4KMQA 1H6XA 2CY6A 2O0OA 2VOTA 5GLUA 4N9IA 3KVBA 4XFBA 5A7WB 1PMIA 1BBT3 4LKDA 4YW4A 4M4PA 2Z5WA 1IPKA 3M3CA 1NZIA 1W2AX 3T0BA 3KCXA 2XGXA 5F3EA 2W2IA 2W87A 3G7DA 4OMDA 4BQ4A 1MZEA 3DPRC 3BYWA 3BODA 4L9BA 3WF2A 1EY2A 4LULA 3ZFEA 1T6GC 1APNA 3DF0A 4I30A 5FXWA 2WA4A 5IFTA 2OPWA 1G9CA 3DKWA 3AYDA 2XVLA 4QKNA 3K75B 5A1LA 2NP0A 5J09A 2GAUA 1QQP1 3P3NA 1J1TA 1EP0A 1LULA 2JENA 2WINB 3PMEA 4S2GA 4XF4A 3TAYA 1O5UA 1K5JA 1FYUA 2CSGA 2JICA 1CAWB 1W03A 2E7TA 4FPCA 4MG2A 3GZUC 2IC1A 2PLV1 5LA2A 5F9TA 3NNLA 2P34A 5I8TA 1F31A 3PUHA 4WVWA 1TME3 2R073 1RUI2 4N8MA 3AFKA 2XB6C 3POGA 4P9YA 2YB7A 4Y5SA 3W58A 4ZZ5A 1JUHA 2VUAA 4HONA 4ISQA 4JDOA 4YVSC 5JI7A 4CA9A 4MGZE 4Q0VA 4YGCA 2LUWA 1HQNA 3OYWA 4AI8A 3R6SA 1VIWB 4CEWC 2RS13 2XKOA 4AEDA 1U5ZA 1DLLA 3H3LA 3IDCB 3J7LA 2ZX2A 3PIJA 2VCMA 4IE5A 3LWCA 1W6PB 2O8OA 4PLNA 5T5OA 1H8TA 2J1TA 2WQZC 5CEHA 4JKKA 5ERLA 4GWMA 2YHJA 3KV9A 4K1YA 3FHAA 5FCCA 2I07B 5DXDA 4YVSB 4NPRA 5IHRA 5A3LA 4I3PA 2DCYA 3O7OA 4A45A 5C3PA 5JPNB 4CEWB 3BIWE 1S0DA 5FPBA 4Y1ZA 4NR1A 1RUD2 4PF1A 2WT2A 2W5FA 1SFPA 3MICA 5I0RA 3LEGA 3O5SA 4FBFA 4AEDC 1D4VB 2ENRA 4DY3A 1DZQA 3SXWA 4C1XA 1D0GA 1BCXA 1Y9QA 3ZOIA 4PI2A 4JQTA 1BEV2 5FY9A 3N7LA 1W6NA 3O1UA 1UZYA 2ZS6B 1SEFA 2B45X 4XACA 5EJ1B 4LHLA 1X36A 2WSUA 2WZR3 1JXNA 2Q8DA 4CU7A 3BIEA 1E5RA 1W2OA 3PNAA 5FP9A 3VUOA 2R7EB 3QOPA 5GLTA 3I8TA 4ZKTB 3HVDA 4ZONA 5EYYA 5FWEA 4MGQA 4MGSA 2D6KA 3C3VA 4DZGA 2G9ZA 2HYXA 2X5IA 5DPNA 3ZIWA 4AR2A 1GICA 3ZYHA 4X8NA 2DBIA 4JDNA 1LEMA 1CIYA 3LIHA 2ZBJA 4XPVA 2IWGB 5CBLA 2XOMA 1DDLA 1UYXA 3MF9A 4IEYA 3DN7A 4ZU7A 5IWFA 2WIIB 3ZYJB 1DGWA 1GANA 2AEYA 2ZJCA 3EHKA 1RUE2 1V70A 1ZNPA 1NAEA 2DVGA 4OMCA 4LBKA 4A4AA 1DQ0A 2QZ3A 5LY2A 1SCSA 4FOQA 3VD3A 5G04L 4HETA 2YC0A 4YM2A 2A73B 1O91A 3JB4C 3LGRA 4H7LA 5JCTA 2WN2A 5JSOA 1QNWA 3FBYA 2KD7A 1G6NA 4CCDA 1AL21 1UZVA 1W90A 3T2PA 2X5IC 2VZPA 4G4FA 5FMDA 1XQNA 2ZABA 2CV6A 1QJZA 1XNKA 4LHNA 1W6NB 4GIQA 4F83A 5B2GB 2CGPA 4XDQA 4NAMA 2O1QA 3UGFA 4LPLA 3AKQA 1W99A 3NV3A 4NIDA 3VKMA 5FO8B 1Z7S3 2CAVA 3LPFA 1ULFA 4DPNA 3EMRA 5JWPA 4Y4YA 1PVC3 1RL3A 1MQTB 2HWE3 1W9SA 3R4DB 2GC0A 1JU3A 2VTXJ 3HPNA 1M4WA 4NHYA 4W6YA 2P6CA 2A3YA 4GULA 3OBZA 1G9FA 1TMF1 3J8F3 5LK5A 4IE4A 4CPBA 1ODNA 3S30A 1KGYA 3JXSA 1IPJA 2RDNA 2ZMKA 3AXDA 3U10A 4UWDA 4EYUA 3WW2A 1C8M2 4XUOA 1KEXA 2GNDA 3QACA 4GQ7A 1W9YA 4KGGA 4R8HA 5H9RA 3HN1A 4CUCA 5FBZA 1VALA 5E16A 4AVBA 3BTXA 1NE6A 1K5MA 4AGGA 5AFEA 3HD8B 2P3YA 1IS6A 2UYAA 1R1A3 5JDBA 1URXA 3FE5A 4D69A 2FHRA 4HT1T 4BWOA 1LTEA 3GNEA 3E6BA 1RMU2 4N53A 5CYYA 5HCAA 2Y34A 5C70A 4ZU5A 4AVVA 1RUG1 3O1VA 3HOBA 4HK9A 1CAXA 1OQ1A 1W9FA 1W2UA 2NPIA 2QTWB 3H0OA 4PQ9A 3TWIA 3ZSEA 2WL1A 3KHBA 3Q8FA 2RS51 3OUHA 4ZS3A 3NNMA 1O4YA 1XYPA 1EPZA 1KJRA 1UF2C 4Q0PA 1W3VA 4RGAA 1H1MA 1QH7A 1D2QA 2ZA9A 1YHFA 3RZJA 4U36A 2GN3A 4BOWA 4AAPA 1K5MC 3MEPA 4KG8A 4AQTA 1UPIA 2HEYF 3VZJA 2RS33 2XL7A 2ZGOA 1RGSA 3H8XA 5FZMA 3WNMA 2Q30A 2VCCA 1OVSA 5LCWL 5ANQA 1G7YA 4D7TA 4QPGC 1VAVA 3POIA 4MLOA 5SV5A 4QU2A 3SLIA 4KBBA 2WFPA 4ASMB 1OA3A 4MXVA 5FPUA 5I0SA 2ARXA 1BXHA 5FMOL 4UAPA 4RHV2 5JR2A 2WFF2 1CAUA 3ZO0B 1BYHA 4JCKA 2Y0OA 3RNSA 1X82A 1CVNA 4NIHA 3GALA 5FPLA 1QXRA 1RUI3 5A1AA 1OHFA 2WKKA 2YDEA 5BNPA 5F5CA 3UKNA 3I2OA 2FDIA 5A1FA 3DECA 4QPGB 4YPJA 3J4UH 4CCEA 2ZEWA 2VQTA 2EVXA 3ZSMA 4XABA 1KFXL 2LRPA 1L3JA 2GC3A 4MV2A 5FZGA 5LZ6A 5EIYB 1GU3A 2UWBA 3DV8A 4F3JA 1MEC3 4QX8A 1W8TA 4G3YC 4P5YA 1VPHA 5C5UA 1WCQA 1MS5A 4AQ6A 1J3QA 1SLLA 3T2OA 1WGPA 5DZEA 1NXMA 5ABJA 3WDTA 3R4UA 3FUQA 4NWWA 5F6KA 3SCFA 1VBC2 3WNXA 3VBRA 2XJRA 4JKMA 4LBNA 5BNPC 1CJDA 2H6BA 2Q1MA 1S0IA 2PAMA 1V00A 1SQ4A 3GZTB 4HXCA 1ND2A 4FVVA 3F2ZA 4OUEA 4LBJA 2J7MA 1RUD3 4DINB 3N36A 1PGL1 2IVJA 3IIIA 1GSLA 1UMHA 3WNNA 1QHDA 5FPVA 1F5JA 1ZRIA 2V4VA 4XE9A 3RFRA 1EV13 3WD5A 1RIRA 3ZXLA 2GZWA 3I3QA 1GFF2 1BKZA 3CU7A 1UKGA 2B7YA 3IZOA 3ZYIB 1CPNA 1ACCA 2BUKA 3HAGA 3C7EA 4W8JA 5ABJC 1VBB3 2RVAA 5FXVA 4ZXEA 5DUVA 1FMD1 2VXRA 4QHOA 1XC6A 3M3QA 1MVQA 3ZXAC 4BQXA 1HRI1 2ORZA 4LE4A 5T52A 1UAIA 2V72A 4J6GA 1GZTA 5L36A 2XHKA 4XFIA 1NCRA 3AZWA 4Q1PA 2WLQA 5JOZA 3KSCA 1U5IA 1W8FA 4QPIA 5C3OA 3NRUA 4LR4A 1KS5A 2XXZA 4P9JA 4YYOA 1ULCA 2PYTA 4L2NA 5EPAA 2X10A 1QF3A 4B8EA 5ABJB 3T4HB 4LUMA 4NIAA 2JEMA 2VW1A 2Q0AA 1MZ6A 4H3WA 4XUTA 2ZEZA 1UMZA 2ARBA 3MI8A 1O6UA 4LORA 1LOBA 4FI9A 3WDUA 1H2LA 2G9FA 4A7ZA 5CISA 2VVDA 4CU6A 2DCKA 5K8SA 1C1FA 1RUE3 2HH9A 3ES1A 2W3JA 1ENSA 4ARXA 4DFSA 3FLRA 1G8WA 3RI9A 5E88A 4XJAA 3VBUC 1V6OA 2HWD2 3USUB 3E5QA 4YZ2A 5IT6A 3J7NA 2ADDA 2J1VA 2HEWF 3ACFA 3EB7A 3C7FA 1JYTA 4LIVA 3N7KA 4AWDA 3JBG2 4INDA 5F5AA 2KR2A 2VOXA 5C3QA 1UYPA 5FMOS 5FZ7A 1ZRDA 4XC9A 4NHXA 2VGDA 3RZKA 2ZEYA 2BNOA 3EBRA 1T6BX 4COWA 2A5ZA 4URTA 4YLZA 4YZ4A 4BQ2A 1ASJ1 1KDKA 1DQ6A 4RS5C 4Y22A 3WEZA 4CCMA 5JXJA 1YFYA 2JIGA 3GM8A 2K0GA 5FFOC 3WX5A 3UL2A 4XJ9A 3VBUB 2C24A 3B01A 3D0JA 4BMEA 1KFUL 1NZCA 4GWJA 2XJQA 2UY8A 3SC7X 4XXAA 4IW3A 3VBFB 3GZAA 4XJWA 3RG0A 3KQ4B 3I59B 5C5TA 1S0EA 2BEOA 5IW0A 3RS6A 4Z2AA 4FXKB 4Q4W2 2QQUA 2W91A 1O7FA 4HN1A 4A7KA 2A3WA 4JGYA 3W9AA 4RS5B 1QQP3 2NLRA 4E2QA 2ZCWA 3KF5A 2DUOA 5FDBA 3EQEA 4CDQC 2PLV3 4K8RB 5CFCA 1ND3A 4PLMA 3NNJA 5DUWA 3CQOA 4FFGA 4IESA 5GALA 2EAAA 4XF9A 3OGSA 4COUA 2BOIA 1VBE1 1L7RA 1OKQA 1V6IA 3WHUA 1XOYA 2NM1A 3ILFA 4S2HA 1Z0HA 2OUHA 4EWDA 5FZEA 1UZWA 4BH9A 2VBBA 1YFXA 4RN5A 4WZFA 1CONA 1OLME 3KV5A 3AKRA 3ZN6B 3U0ZA 3TN92 2B9UA 3R0RA 1RUC1 1UNBA 4YZ3A 2HBTA 2JE7A 5FY8A 5CG8A 4JGYC 1GP5A 4CDQB 2ZEXA 1SLIA 4FPJA 5A3NA 5FWJA 3E6CC 1POQA 3C7GA 3RSJA 2W1UA 1AXZA 5CFCC 2FZ2A 1BMV2 2Q5TA 3D0SA 3VZLA 2VNOA 3OBAA 4HSJA 3UGGA 3ZXDA 3C8XA 5GLWA 2QJVA 4AF9A 2OA2A 1KITA 3NSTA 3ZXKA 1O3SA 2YC4A 1SZBA 4J1XA 4DXRA 4K9SA 2BGOA 4KWUA 1ALYA 4PF5A 4XIOA 2FZ1A 4XXPA 3DUIA 4GJYA 3GHMA 2E51A 3GBGA 1MPXA 2VMIA 1QJU1 1W06A 1WLWA 4NROA 4QM8A 4N7UA 3B9CA 4XTPA 2WFF3 4KNCA 4QDQA 5C3SA 4QQOA 3MV11 4FPHA 4FTEA 2VH9A 2GSYA 1SLCA 2EXIA 1HB1A 4MGTA 1QJY2 3N7JA 4X8PA 3LDKA 3I49A 1PGW1 2Y0IA 1CX4A 1O4ZA 2XBO1 2Z2SB 4B29A 4EZHA 2Y26A 4IE7A 3OJBA 3ZYRA 1RITA 3B69A 3G6JB 4QKBA 2W52A 3POYA 2VULA 3QH6A 3K2OA 5A80A 4FTSA 4A41A 5I93A 4GB31 4IEVA 3IDEA 1DG6A 3E5UA 3JZVA 2A75A 3RQ0A 1JZ8A 3EO6A 2C6SA 2B46X 3U11A 2P3JA 3MUY1 5TSWA 1AJKA 2XR4A 2DU1A 5J98B 4YFZA 3WR0A 5BNQA 3UKVA 3U37A 1TME2 5KXEA 2P3IA 2R072 1O3RA 1V6KA 4UF0B 2VTXA 1IQAA 3K51A 2VXJA 4IXLA 1WD3A 5L9BA 3RZLA 5A3PA 1UOBA 4XOGA 3WDXA 4EWEA 5DAXA 2XJSA 4ZU4A 4TSVA 1IPSA 2EXKA 4QD2A 3GBWA 5KBFA 5A32A 2I2SA 4D3WA 4H2AA 3JD72 3RZMA 3BOPA 3AXEA 4FPYA 4U2AA 5T5LA 3V0BA 3ZKUA 2I45A 2PA7A 1ZVFA 5I8YA 3I2HA 5C8WA 2XQRA 2YUEA 1ULEA 1SBDA 2GNMA 2JDKA 2Y6HA 4MYEA 3VV1A 2HWC1 3I3DA 3LA3A 2P17A 1CAVB 5JOXA 1W0NA 1YEWA 3M3OA 2GU9A 3NJZA 4G9SB 5C8CA 2BV4A 2X09A 3A0NA 2YFZA 3N7MA 4QHZA 2RM23 4N43B 4RA0A 4URAA 5IVFA 2D6MA 4R9BA 3Q9OA 1R092 4R4XA 4EN6B 3MFAA 4PDWC 2VC9A 4LE3A 4O7XA 4BZ4A 1TMF3 4E4SA 3OD0A 2DCJA 1AX1A 3NO8A 3IWZA 2VNVA 4BQ1A 5HXVA 1PGSA 3FLPA 2BZDA 3K48A 2A6WA 2P5BA 3SNMA 3I2IA 5F32A 1US3A 2CWMA 3OGJA 3MLKA 3NW4A 3ZSKA 1NE4A 4BMBA 1D4M1 1PMJX 4OZXA 4HOOA 5KHHA 1CZTA 1HRV1 4IETA 1XJAA 1AF9A 2MHFA 3O1RA 3M3IA 3P3PA 4IE6A 4KWLA 4LTAA 5C8CC 1SACA 2WZR2 1ULGA 5K0UA 2HWD3 2PHLA 3WCRA 4COZA 4PDWB 5FYBA 5A3UA 1S0JA 2DTWA 2WC2A 2V5DA 3WW4A 1AR61 1PK6A 2VOWA 2EXJA 5FYMA 3JBG3 2Q4SA 3ES4A 4O61A 5FZ6A 5FUNA 1NOVA 3KD4A 2CNAA 2E33A 1SDDB 1LHWA 3RDIA 4LOSA 1YFUA 3ME2A 4W65A 4AFDA 3UETA 1XRUA 3BTZA 4Y5Z0 1CZVA 1AYN1 1QU0A 3KZ4C 5EQUA 5FKCA 1KJLA 5FP4A 3V65A 3TEXA 2ZGKA 5C9AC 1BHGA 1W8ZA 4IDZA 1EAH1 1HIXA 5IVYA 4XIKA 1PNGA 4J25A 1OOPC 3N4MA 2J1EA 3VHNA 3PTRB 1VB4A 3LFMA 4IEXA 4EN7B 5CA6A 3ASIA 1VBA2 1PK6C 3KHCA 2RE9A 2ZHLA 1W2NA 3DYOA 4IV3A 1YCIA 5FZ8A 2FDFA 3U1XA 1J59A 1NLSA 2D43A 2ZXQA 3FN9A 1Q43A 2OZ6A 3ROUA 5J3UA 5B4NA 1XSQA 4QGMA 1H2NA 2VQUA 4XVHA 4MXWA 1X9TA 4CDWC 5FZ3A 5C9AB 5A3WA 1H8VA 3A7QA 5A6ZA 3BTYA 1S0FA 4CSWA 5KHKA 1W9WA 3AZXA 1OOPB 3I2DA 2HJIA 5LBFA 1N1VA 1M06G 2JE9A 1G9AA 1QGLA 5FYSA 2HWE2 1AXYA 5EFUA 2BGPA 2IZWA 3IPVA 3OSDA 3HJRA 3NKTA 1RHI1 3X29B 4C1WA 3ZMNA 1DGLA 2JD9A 4QDRA 2XVGA 5FP7A 2C9KA 1ZZ9A 3AVSA 5FQ0B 3VD4A 1BEV1 5FZKA 3U75A 1LOGA 1HDKA 1UY1A 2YXSA 4QWNA 4CDWB 2NQYA 2AR6A 1FPN1 3D8CA 1H4GA 4Q8KA 5BNNA 4XDPA 1GMMA 3OPZA 5A7PA 3KT1A 5EYXA 5BNOA 4XYXA 5JLVA 2D3PA 2VMDA 5FZCA 1VMFA 5C6CA 4HLTA 4LO5B 2YC2A 1FXZA 3MPBA 5T54A 4JGZC 3FJSA 1GNZA 1ZBE3 2WS91 3LZZA 2BJSA 1XNDA 1DIWA 2CGNA 2QQLA 4NOTA 1R1A2 1O4TA 1YWKA 4WVVA 4MUVA 3HBKA 5JSPA 2H0BA 2IVIB 4IQPA 3Q8CA 5F2SA 5F39A 5C4WA 4ATFA 3LOBA 2ZGPA 2WZ8A 5F3IA 3BPZA 5T55A 2BNMA 3VBHC 4UXAA 3H1YA 2VNRA 4MXWB 4FPEA 2W94A 4DXTA 3O0WA 1E5IA 1QJY3 3B93A 2VBDA 3TBDA 5BNNC 2FDKA 1AL0G 4Z07A 4JGZB 1LOFC 2DVBA 5JZGB 4RQPC 1GZWB 4YGEA 2DTYA 5FPAA 3WOGA 4AEMA 3SHRA 1PIV2 3HWJA 1N1YA 1FMD3 5FAXA 3BALA 1DU3D 3RWKX 1RB8G 1A34A 2D6PA 1H30A 2RS32 3OY8A 4QQLA 1SDWA 1R083 4OLLA 1DFQA 5JUVA 4XZUG 2J1AA 3VBHB 3ACHA 2VO5A 3KS7A 1ZZ6A 4A3ZA 5C4WC 4OHYA 4DUWA 5DZFA 2AACA 4HL0A 4BLIA 4RQPB 1SBEA 1JS9A 2JXAA 4QKDA 5EXOA 3SKJE 3VKFC 3HNBM 5AC92 1ZBA3 3DPRB 4CDUA 4HANA 4XCAA 5K9YA 1F4AA 1LHNA 2ZMNA 2IXKA 1HV0A 4Q0UA 3J7HA 5HV0A 2ZOEB 4E8DA 1QJEA 1JYXA 4QHBA 2R041 1W2TA 3VD9A 2D5FA 3MO4A 3AKSA 2R061 3ZFEC 4E9KA 4PLOA 2ADEA 1Q3EA 3H42B 2D93A 3RMYA 4AOCA 3B3QE 4WZCA 4YW2A 4DMIA 1F15A 5C4WB 1C8M1 1N1TA 3NWKA 4GXLA 5LY1A 4BQWA 2YU1A 4I0AA 2HWF1 3IKWA 3JD73 2VR4A 3LD8A 1LKNA 2WO1A 3J26N 4QM9A 1RJ7A 3MLLA 1MEC2 4TWTA 4ASLA 3CKHA 3RZZA 2E26A 2C0ZA 5FZHA 4X6QB 5D21A 3NV2A 1PO11 1UL9A 2TUNA 5T50A 4QKFA 3POBA 4QX2A 3AP4A 4K1ZA 1JU4A 4CDUC 1OPMA 3ZFEB 2JDUA 1DGWX 1RYYA 3MF6A 3VDDA 2IXCA 4CYDA 1BK1A 3TEYA 2XUMA 5LWBA 5B4XA 3O12A 4CP2A 1AR72 1S0CA 2X8KA 5HCHA 5FLHA 3RZGA 1R093 5A3MA 4IEZA 4B4PA 1AYM1 3SISA 1FOD1 1YXWA 1GYKA 5T3NA 1WW5A 2VJXA 4CP9A 4GMP0 1UX7A 2ZKNA 1QEXA 1OURA 1U12A 1G9BA 3MV01 3KVAA 1J3RA 3VDCA 1EV12 1TNRA 3AKTA 1L7QA 1FT9A 1K45A 3SQOA 1H8TC 2GN7A 3WV6A 1CR7A 2D3RA 1JUIA 2YV8A 5DUUA 4DOUA 1VBB2 3VZKA 1HV1A 2VZTA 2WUHA 2BU9A 4GKXA 2K9ZA 4QPYA 4C0BA 4UBGA 3KV4A 3GDBA 4IUGA 3WSOA 3OYWB 3BVCA 3A22A 1N3QA 4OYUA 5LRRA 2XWJB 4AEDB 1LU1A 2NMNA 4NUBA 1V9U3 2XVKA 5A33A 2DF7A 4BB3A 1GP4A 2Y8KA 1JZ3A 1PZ9A 4LLFA 4KU8A 2XPJA 4Q29A 4IV1A 1MVEA 1H8TB 1PNFA 2D7FA 1OUSA 3WP6A 1QJFA 4L99A 1RUC3 1U5XA 4AK3A 2BWCA 1XPWA 2R0HA 4BK5A 4B1MA 2GC2A 4K8FA 4P02B 3CJIA 5JOYA 4OUMA 3VDAA 4DUXA 4LQRA 4QXBA 2DWRA 1UX6A 4JVAA 2JG9A 3PURA 2G19A 5CADA 4FFHA 1PZ8A 5CNAA 1JZ7A 1H2KA 1VBA3 5HXMA 1RUJ1 1J58A 1ODMA 3INAA 2J1SA 5GZEA 3KT4A 4AW7A 1LRHA 1U0AA 4BQYA 1E5SA 3UGHA 2VZUA 1QJU3 3HQUA 4YVWA 2EIDA 5A7OA 4IV1C 4BA6A 5DAPA 4AGRA 3UK9A 2L9LA 4XAAA 4YNIA 4FAHA 2XHNA 2B39A 1CPMA 3IMNA 5J37A 2YBPA 5JR7B 4M3CF 1SG3A 3RYPA 4B7KA 2HWB1 2XBO3 5CKQA 1UOFA 2EICA 4GMP1 3ZKYA 4S2DA 2EIBA 5DZGA 2HYKA 2X5IB 3DYMA 1MS1A 1I3HA 3ZN5A 5JSRA 1JYVA 2ILMA 4PT6A 1TEIA 5FJKA 1HXS1 2OXBA 1J1LA 4Q4X1 4EN0A 4LBLA 2D44A 4Q4V3 2WR9A 1QQP2 1CGPA 1GLHA 2WT1A 2Z69A 4C8DA 4EV0A 2F6BA 4CEYA 3BI3A 4R9CA 4HVOA 1YYNA 2PLV2 1JODA 3A4UA 1H9PA 2VCBA 4Y20A 4PIZA 4GA9A 4CCNA 2R30A 1OA2A 4AZZA 1WBLA 1G86A 1TVGA 2XJVA 5FY1A 3S5AA 3SEPA 2WO3A 1UXZA 1V0AA 3AKPA 3LA2A 1FAYA 4K7JA 2TBVA 4CDXA 5HI0A 3BTAA 3IM0A 4AQSA 5IVBA 4LBQA 2QKDA 3CBNA 1N3PA 2GMEA 2W47A 1MS3A 4X6RB 1OF3A 2QVSB 1AR91 2RR11 1UCXA 1XU1A 2RG4A 5A3TA 5C7GA 2Y33A 4CU9A 1S55A 2FBEA 4ORFA 2ZX1A 5CU1A 2VMEA 3H7YA 3M7AA 4Q5OA 4CEYC 1PIV3 2KA3A 4BJ0A 5IK7A 1HJGA 3GGLA 4Q26A 4LNVA 1QWRA 5FZ4A 2HWC3 4LKSA 5APAA 2X53S 2GP5A 3GXUA 5K7PA 4D7SA 4FFIA 1MZFA 3AZZA 1DGRN 1LODA 4LA2A 2DUPA 2JWPA 1XB9A 1JI6A 4XJUA 4YG6A 4N53C 3WQ1A 1JZ4A 3BU0A 4CDXC 5FLJA 3M2MA 5KWRA 1F4HA 5GLZA 3DXTA 3BCWA 1S4CA 2FMYA 4Y26A 4AI9A 5AC93 4OVEA 3S7EA 3ZDSA 1PO21 1YFWA 3CLPA 4XFAA 4QQ2A 4Q4Y1 1K5MB 3RRDA 5G05L 4NIIA 2MEV1 5CKMA 2GNBA 5FYVA 4UW6A 4AHWA 2VNGA 1HRV3 3IDBB 3AP6A 3CEWA 4RGGA 2OYZA 1NG0A 4AFAA 3UNPA 4Q4W1 4N53B 1G9DA 2QUOA 1LNSA 4CDXB 3WP3A 5J48A 3V0AA 1DZTA 1CAXB 3ZXEA 4L97A 1YNAA 4LIUA 4WM7A 3FX3A 5FZLA 2VMGA 4CCKA 4YZ1A 4PCRA 1DGRA 2OPKA 1B35A 3F95A 5IAXA 5GLVA 3K4DA 2ZZJA 3NNFA 3CDZB 4LO4B 3ZSJA 2E63A 3DGTA 5F2WA 4WM8A 4XDOA 2JECA 4LK7A 4AXOA 4M3CA 3LEKA 3WLUA 3LIGA 3WXPA 2DURA 1OQDA 4B4RA 1K42A 2ZGLA 4GH4A 1ZA4A 3J7MA 5FO9B 1AR73 5LA0A 1Y9GA 1ZZ7A 5EJZB 4BK4A 1WW7A 3IT8A 3KWVA 3MW4A 3POJA 4HN0A 2YY1A 4EJRA 1MS0A 1BLZA 3I3BA 2YGLA 3T1LA 2ZGQA 3MIBA 3DXUA 5C33A 1WCKA 3AFGA 1NT0A 1JW6A 2G1MA 2BYVE 2IFRA 1CAUB 2P4EA 3FMGA 4WM7C 3THDA 5LATA 4DRVA 3O1SA 1BMV1 5LEKA 4QX1A 2VMHA 4LHSA 1B35C 2R16A 3N9PA 5BNPB 5FR3A 1UY4A 2HKXA 2XLGA 3LDRA 3VBSA 4D6RA 5CKNA 1BZWA 4Z2WA 2SLIA 5CVRA 4XUNA 4QU1A 2YPJA 3BOWA 3GBFA 3HEIA 3VBRC 2RDQA 5BV6A 1EYBA 2WSVA 4GH4C 3WG1A 5FY5A 3C2UA 1ND2C 2JG8A 3ZFGA 2VW2A 3PL0A 3B9IA 2G4IA 2RM22 3D3AA 4MGKE 1N47A 2W0XA 3T4VA 1UIKA 3ZVXA 4XUPA 1BBT1 3PIGA 1OI6A 4JHZA 1RHI3 1IKPA 2LTNA 1GWMA 4NMIA 1C28A 1TMF2 3NAPA 1J3PA 3ZXFA 2FCVA 1RUF3 1VBD3 3BUCA 1UKRA 2D6OX 2ET1A 2VOKA 5D2AA 3ZFFA 5M0TA 1SHWB 3MYXA 5FY7A 3URFA 4OQ9A 2GMPA 2B9VA 2O8QA 3LA7A 3VBRB 4CCLA 2LW8A 1UZ0A 3VBSC 3VBOA 2W92A 2ERFA 4GH4B 3CO2A 4IEQA 1Y7BA 2AREA 4R4ZA 3E6DA 1ND2B 4LT5A 4KQ7A 1OC1A 1H4HA 2CU5A 1J83A 3I2FA 1DLCA 1LOEA 4YW3A 1POV0 4HBNA 1EUUA 2JG8C 3ZFGC 4BISA 3OUIA 3H3UA 4I0BA 5A6YA 4NPMA 4Y1VA 1GV9A 5D8AA 1O3QA 4BCUA 1NCRC 4GWIA 4MGIE 4XFCA 2PMWB 4PBOA 3LB9A 3WQBA 4QPIC 5SV8A 1FV3A 2JD4A 2D6LX 2ZGUA 5FZOA 5KHIA 3AMQA 1V6LA 2Z79A 2BFUL 2CDOA 4Q1RA 4WVMA 1W8NA 3AMMA 5DAQA 3VBSB 3ZFFC 3AB0A 1RUG2 3D5OA 5LA9A 1O59A 3PHMA 3SCGA 4JX0A 1CX1A 3H8RA 3VBOC 4LHKA 3N9OA 3FFZA 3QCWA 3ZFGB 3SKVA 3ZX7A 4BYYA 4CP0A 2XJTA 3FZ3A 2RS11 1NCRB 2VQ0A 4AVSA 3NJXA 4IL7A 4JRLA 4QPIB 2RMU1 5D8AC 3UV9A 1OXCA 4XBLA 2RJLA 2Y38A 4P5HA 4XHXA 1OD5A 1NA1A 3ZFFB 4A7YA 1AXKA 4K3UA 1MS8A 4AAXA 4DB5A 1AR81 2XJPA 2YMZA 3PVEA 3S5QA 3ACIA 4DS0A 3PVNA 1QJX1 3VBOB 2W1QA 3VZOA 4IE0A 4KWJA 3NQHA 2A71A 5EHDA 4AG4A 3WG3A 4N9HA 4GAZA 3CL1A 4IEUA 2VTFA 1RUH1 4FT8A 3FC0A 2BGCA 2XL9A 2ZGSA 2C9AA 4KU7A 1W8UA 1VRH1 1E57A 2BNNA 3ECQA 1JOJA 1SLAA 4WV8A 1UZZA 3SH4A 1NY71 1ULPA 4HPKA 4M00A 4D6QA 4ONUA 1H1IA 3I3MA 1W3XA 2G9GA 1Q8PA 2PAKA 2ZGMA 3PUIA 1S0BA 5FP8A 1KRIA 2PHUA 3NJVA 4XQ4A 4Y22B 3M70A 2WZR1 2E53A 1C57A 3I7DA 5IK4A 4Z1VA 5FYZA 3HN3A 3KCCA 2PFWA 3C7HA 4Z82A 3MUZ1 3GJBA 1POV1 2WWSA 4M3CE 2CAUA 4PI0A 3RYRA 3WG2A 3WUDA 1ND3C 1PO13 1SMVA 1ULDA 4E4HA 2O14A 4LO7A 5GZDA 2BOJA 3AJZA 5JPMB 2OT7A 2C26A 1COV1 1VB2A 1V6JA 2GDFA 1BJQA 1A8DA 1ZBE2 2LALA 5ACA1 3H8OA 5DDJ1 2YYOA 3RWNA 4A6SA 3OPWA 4ATEA 1XNTA 2RDRA 5CZKA 5FLIA 3B5LB 1AYM3 2J1RA 2WA3A 2XWBB 2P2KA 1FOD3 2EALA 4JGYB 1PGL2 3BN6A 1KDMA 3B02A 5FTTC 5LBEA 3WG4A 2JJ6A 3R4SA 5IFPA 3B00A 3OBTA 1W28A 1OVPA 3AC0A 2ZGNA 3QD6A 1ND3B 5CFCB 1YQ2A 5DUXA 1X33A 1F2NA 3PMSA 3WNPA 2GP3A 3M1HA 1WZXA 3U4SA 2WNUA 4JKLA 3LCPA 1JMUB 4R9AA 1FMD2 4OHZA 1VAMA 2BERA 2OW4A 4OULA 2JDNA 3TNQA 3A21A 1R082 3K77A 2C4XA 4QGLA 4OHXA 1LJ7A 1L7LA 2W39A 3KGZA 1IKQA 2FQPA 4GWNA 4YM1A 3ZM8A 4CCJA 2Y60A 2OQ6A 5CFDA 2BFUS 3WF4A 4NRMA 1A3KA 2TEPA 3P6BA 1Z7S1 4XTMA 5K4LA 1XNAA 1ZZ8A 3WW1A 2E31A 1LHOA 1GZ9A 1PVC1 2HWE1 1W6MA 4OZOA 1ZBA2 3UYJA 2ET7A 5A70A 4NIGA 4BLJA 3FUOA 4TLFA 1YC61 3J8F1 5L73A 1JHNA 5GKAC 2WNUC 3ENRA 3KMHA 3MPPG 3RI8A 3VHRA 3D82A 1RUOA 2QCSB 2QFEA 4OI0A 3E97A 5LEJA 4NO4A 4A3XA 1X8MA 1RUJ3 2ZZQA 5HCBA 5LBCA 2J42A 1I9RA 3KQRA 3JU9A 4LOTA 5FZBA 1W8WA 5I0UA 2B4KA 5H9SA 1SPPA 4KWKA 2WNEA 1VE0A 1AL23 1S0GA 2N7GA 5J96B 2DU0A 5LRSA 2DBNA 1IS3A 1WW4A 3NNGA 4YSFA 2XQXA 1VRBA 2J22A 3C7OA 3POEA 1TG7A 2FD8A 1WD4A 4CZSA 1RVF1 1K12A 1IOAA 1WUVA 1F8VA 2RJKA 2CGOA 3CMGA 2E7QA 4XFGA 5FP3A 1DBNA 1LEDA 3KF3A 2HWB3 4Y4RA 1ZA7A 2Y6KA 2W95A 3W59A 5LB6A 2YFUA 4RFT0 4PQQA 4KGQA 1Q8OA 4MH0E 4DY5A 4NAOA 1LGCA 1W6MB 3SCHA 1W6OA 4HK8A 1UU4A 4OHVA 3ZLIA 1BVP1 1KS4A 4Q4X3 4O9EA 3IIAA 4QGNA 2PHFA 1AVBA 1V6MA 4NRQA 1OF4A 2WYFA 4Q8LA 4YW5A 5KXCA 1LR5A 4XF1A 5FYCA 2WQ8A 3RZHA 1AJOA 1D7PM 4IEWA 2ZPXA 4FSJA 1OFNA 3FFQA 1UIJA 2W9XA 5A32B 1VBE2 1GQHA 5FZ0A 1HB2A 4B4QA 2P3KA 3MFCA 1PX3A 2CWSA 4J1WA 1XE0A 3V0BB 1V9U2 1SPPB 2VG9A 1RUI1 2AEZA
chains in the Genus database with same CATH topology
4IGQA 5ANQA 5FZOB 4CCNA 2Q8DA 5FZ3A 4LIVA 5FP9A 5F5AA 3K3NA 4LITA 5FY1A 5A3WA 5F3CA 5LWBA 5FZ7A 4CSWA 5FY4A 4GD4A 4ASKA 4TN7A 5FPUA 5FUPA 4IGOA 3RVHA 5IVBA 5FWEA 5FYSA 4D6SA 4CCMA 5FY7A 4UF0B 2GP3A 5A7SA 4CCLA 5A3TA 3PDQA 5FYTA 3U4SA 5FYIA 5KR7A 2OQ7A 5FPLA 3KVAA 5FP7A 5F5CA 3AVSA 3KVBA 5A7WB 5A3PA 5FZKA 2PXJA 4QWNA 5A1FA 2XMLA 5IVCA 4BISA 3K3OA 5FZ4A 4XDPA 5IWFA 2GP5A 5A7PA 4Y3OA 5F3EA 5FZGA 2W2IA 4GJZA 2OQ6A 3KV6A 5IW0A 4CCJA 5FBJA 5FZCA 3ZPOA 5LY2A 3KV4A 5FZOA 5FYYA 5K4LA 5FZ9A 4QX8A 5FY0A 3N9QA 5FXWA 4DO0A 4BXFA 2OS2A 2VD7A 4Y33A 3DXTA 3UYJA 4NUBA 5FXZA 3PU3A 5A1LA 4AI9A 5IVVA 5F2SA 5F39A 4UF0A 3N9OA 4URAA 5IVFA 5LW9A 5F3IA 5F3GA 2YPDA 3OPTA 5FYHA 3AL6A 5FYVA 5A7WA 5FZEA 5ISLA 2WWUA 3PU8A 5A7QA 3KV5A 4QXBA 2P5BA 4BU2A 5F32A 5FZBA 4IGPA 3U78A 2YBKA 3PURA 5FPAA 2YU2A 3PUSA 5FPVA 5FY8A 4HONA 3PUQA 4HOOA 4CCOA 4CUGA 2OX0A 4LIUA 5FZLA 4QX7A 4V2WA 4CCKA 4QXHA 1VRBA 5FWJA 4EYUA 5F5IA 5FV3A 5FZFA 5FYBA 4GAZA 5FYUA 3PUAA 5FXVA 5A7OA 5IVJA 5FP3A 5F2WA 5FZDA 4XDOA 5FYMA 5FZMA 4Y4RA 5F37A 5FZIA 5FZ6A 5FUNA 5CEHA 4DIQA 4GJYA 3N9NA 3KV9A 3AL5A 5IVEA 4QXCA 3AVRA 2Q8EA 2YBPA 2WWJA 2Q8CA 4D6QA 2XXZA 5E6HA 5A7NA 3ZLIA 3DXUA 2YBSA 5FP4A 4EZ4A 3LDBA 5FP8A 5FPBA 4V2VA 5FYZA 5IVYA 3NJYA 5LY1A 5FYCA 2XDVA 2YU1A 3N9PA 3PTRB 3LD8A 5FJKA 4EZHA 2XUEA 4D6RA 4E4HA 4LXLA 5FZAA 2OT7A 4QU1A 4C8DA 5FXXA 5FZ8A 5FZ0A 3N9LA 3OPWA 5FJHA 4AAPA 5FY5A 5FY9A 5FZHA 3K2OA 5A80A 3N9MA 5A3NA 5FZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGQ A;  5ANQ A;  5FZO B;  4CCN A;  2Q8D A;  5FZ3 A;  4LIV A;  5FP9 A;  5F5A A;  3K3N A;  4LIT A;  5FY1 A;  5A3W A;  5F3C A;  5LWB A;  5FZ7 A;  4CSW A;  5FY4 A;  4GD4 A;  4ASK A;  4TN7 A;  5FPU A;  5FUP A;  4IGO A;  3RVH A;  5IVB A;  5FWE A;  5FYS A;  4D6S A;  4CCM A;  5FY7 A;  4UF0 B;  2GP3 A;  5A7S A;  4CCL A;  5A3T A;  3PDQ A;  5FYT A;  3U4S A;  5FYI A;  5KR7 A;  2OQ7 A;  5FPL A;  3KVA A;  5FP7 A;  5F5C A;  3AVS A;  3KVB A;  5A7W B;  5A3P A;  5FZK A;  2PXJ A;  4QWN A;  5A1F A;  2XML A;  5IVC A;  4BIS A;  3K3O A;  5FZ4 A;  4XDP A;  5IWF A;  2GP5 A;  5A7P A;  4Y3O A;  5F3E A;  5FZG A;  2W2I A;  4GJZ A;  2OQ6 A;  3KV6 A;  5IW0 A;  4CCJ A;  5FBJ A;  5FZC A;  3ZPO A;  5LY2 A;  3KV4 A;  5FZO A;  5FYY A;  5K4L A;  5FZ9 A;  4QX8 A;  5FY0 A;  3N9Q A;  5FXW A;  4DO0 A;  4BXF A;  2OS2 A;  2VD7 A;  4Y33 A;  3DXT A;  3UYJ A;  4NUB A;  5FXZ A;  3PU3 A;  5A1L A;  4AI9 A;  5IVV A;  5F2S A;  5F39 A;  4UF0 A;  3N9O A;  4URA A;  5IVF A;  5LW9 A;  5F3I A;  5F3G A;  2YPD A;  3OPT A;  5FYH A;  3AL6 A;  5FYV A;  5A7W A;  5FZE A;  5ISL A;  2WWU A;  3PU8 A;  5A7Q A;  3KV5 A;  4QXB A;  2P5B A;  4BU2 A;  5F32 A;  5FZB A;  4IGP A;  3U78 A;  2YBK A;  3PUR A;  5FPA A;  2YU2 A;  3PUS A;  5FPV A;  5FY8 A;  4HON A;  3PUQ A;  4HOO A;  4CCO A;  4CUG A;  2OX0 A;  4LIU A;  5FZL A;  4QX7 A;  4V2W A;  4CCK A;  4QXH A;  1VRB A;  5FWJ A;  4EYU A;  5F5I A;  5FV3 A;  5FZF A;  5FYB A;  4GAZ A;  5FYU A;  3PUA A;  5FXV A;  5A7O A;  5IVJ A;  5FP3 A;  5F2W A;  5FZD A;  4XDO A;  5FYM A;  5FZM A;  4Y4R A;  5F37 A;  5FZI A;  5FZ6 A;  5FUN A;  5CEH A;  4DIQ A;  4GJY A;  3N9N A;  3KV9 A;  3AL5 A;  5IVE A;  4QXC A;  3AVR A;  2Q8E A;  2YBP A;  2WWJ A;  2Q8C A;  4D6Q A;  2XXZ A;  5E6H A;  5A7N A;  3ZLI A;  3DXU A;  2YBS A;  5FP4 A;  4EZ4 A;  3LDB A;  5FP8 A;  5FPB A;  4V2V A;  5FYZ A;  5IVY A;  3NJY A;  5LY1 A;  5FYC A;  2XDV A;  2YU1 A;  3N9P A;  3PTR B;  3LD8 A;  5FJK A;  4EZH A;  2XUE A;  4D6R A;  4E4H A;  4LXL A;  5FZA A;  2OT7 A;  4QU1 A;  4C8D A;  5FXX A;  5FZ8 A;  5FZ0 A;  3N9L A;  3OPW A;  5FJH A;  4AAP A;  5FY5 A;  5FY9 A;  5FZH A;  3K2O A;  5A80 A;  3N9M A;  5A3N A;  5FZ1 A; 
#chains in the Genus database with same CATH topology
 1RUG 3;  4NN0 A;  1GR3 A;  1H2M A;  2K46 A;  2PEL A;  4AE2 A;  4ET7 A;  3D4K A;  4XUR A;  4CCC A;  2Q8O A;  1PZ7 A;  1AR9 3;  1RUC 2;  4N90 A;  5F3C A;  1LU2 A;  2RS5 3;  1LES A;  4CE8 A;  2F4P A;  2PHT A;  3JQX A;  4FAG A;  2WNV A;  3AYC A;  1DF0 A;  1YQ6 A;  3DL3 A;  5C8C B;  2ETE A;  2R32 A;  3GHN A;  4B3N A;  1QIQ A;  2XLA A;  2YZ4 A;  4XQD A;  4RL7 A;  2A7A A;  1WLT A;  4D6S A;  4JZR A;  4ZHN A;  2V09 A;  2C5D A;  1DYP A;  4Q27 A;  3POF A;  5A7S A;  1OUX A;  3ZYB A;  5K0U C;  2VY0 A;  3GF6 A;  4W6W A;  1X7N A;  1VJ2 A;  3U14 A;  4WVZ A;  1TNF A;  4A6O A;  3MIE A;  3LOI A;  3OG2 A;  3RJ2 X;  3ON7 A;  4L11 A;  4LO6 B;  4HG6 B;  3K3O A;  4AVC A;  1QJU 2;  4NE9 A;  4Y3O A;  4BHP A;  2W68 A;  1RXG A;  3ZYF A;  3WUC A;  4AFC A;  1UY3 A;  2PQQ A;  2WNV C;  4QB2 A;  3N9Q A;  1NCQ A;  1RUD 1;  4DO0 A;  5K0U B;  2VD7 A;  3VKN A;  2DYC A;  1IZ3 A;  4OCT A;  1PK6 B;  1XU2 A;  1NYW A;  1PGW 2;  2VMF A;  2XLF A;  3AMP A;  3E1F 1;  2XBO 2;  4H55 A;  3VHP A;  2FDH A;  1UOJ A;  2YG0 A;  2XH6 A;  2EXH A;  5FPZ A;  2OII A;  4IEP A;  1DQ5 A;  1X9P A;  4IV3 C;  3WDW A;  4QQP A;  4LJH A;  4FFF A;  3ZPY A;  1XXN A;  5A7W A;  4S2F A;  4CP1 A;  2WWU A;  2VPV A;  1WLD A;  1ZZB A;  4UFM A;  4GB3 2;  4W6X A;  2EA7 A;  4Q4V 2;  4YG3 A;  4Q0Q A;  2OZJ A;  3PJQ A;  2CDP A;  5BXX A;  1NCQ C;  2OX0 A;  4F7Z A;  1YI9 A;  3PTY A;  2CHH A;  3TRS B;  4HMZ A;  1SBF A;  3FHQ A;  1QOS A;  2QQJ A;  3ELN A;  2AUY A;  4IV3 B;  1UWW A;  5IVJ A;  1JYW A;  3VDB A;  2ARA A;  2ZKL A;  5DN2 A;  4CPB D;  2J1U A;  1JOB A;  2JDM A;  4H7M A;  4I09 A;  4P08 A;  3WT3 A;  5I8S A;  5F37 A;  2VMC A;  3GCW A;  2ZAC A;  1KXG A;  4YM0 A;  3Q8B A;  2A70 A;  1HN0 A;  3AZY A;  4AFM A;  4I3G A;  3UES A;  3AL5 A;  4QXC A;  2QDN A;  3D6E A;  1RUE 1;  2Q8C A;  4L92 A;  1X50 A;  2Q1F A;  1ZRC A;  1H9W A;  5BNO C;  4ZZ8 A;  4KL1 A;  5KXD A;  1W8O A;  2XON A;  4OQ8 A;  1QY4 A;  4AFB A;  2WDB A;  2LRO A;  4P9G A;  4EZ4 A;  3R05 A;  1WME A;  3MID A;  3IPV B;  3VB9 A;  3CJX A;  2E6V A;  5C71 A;  4LK6 A;  2HWC 2;  4BIO A;  3T08 A;  2VVE A;  1IHM A;  2Y6J A;  1W0P A;  4NHL A;  4TZD A;  1EUT A;  2RHP A;  1HRI 3;  5LAS A;  1Q8V A;  1DQ1 A;  4AYU A;  1NQD A;  1ZZC A;  5FZA A;  1LEN A;  3I2K A;  4P9X A;  2UU8 A;  4LBQ D;  2H0V A;  2F4L A;  1NX9 A;  2ARC A;  4ERO A;  5BNN B;  4H14 A;  5FJH A;  4DUV A;  3IBM A;  5CG9 A;  4XHB A;  5BNO B;  1W6P A;  3HQX A;  4EQV A;  4XW3 A;  5GZG A;  3K3N A;  4CXW A;  4YVS A;  4TXW A;  4HKL A;  4CVU A;  1D4M 2;  1XE8 A;  1HRV 2;  2E7A A;  4JV4 A;  4TN7 A;  5E1R A;  1JZ6 A;  4BPZ A;  3RVH A;  3K46 A;  4CEW A;  3WDV A;  4Z92 B;  1VMJ A;  4AHY A;  4MX3 A;  3PDQ A;  4HFS A;  5FO7 B;  1ZRE A;  1NKG A;  1LHV A;  1JBC A;  1AR6 2;  2QQW A;  1MS9 A;  2GH2 A;  2VU9 A;  3ORJ A;  2DDU A;  4QDS A;  1JYI A;  1D0H A;  2Y6F A;  3WNO A;  3ZXJ A;  4W50 A;  4XJZ A;  2PHD A;  3APB A;  5IK8 A;  4FP3 A;  2OVU A;  4N7I A;  3S6P A;  4AQ2 A;  1UYZ A;  1DZR A;  2A6V A;  4UFK A;  1KQR A;  2I74 A;  1RMU 1;  1ASJ 3;  1DQ2 A;  2WBK A;  3PLQ A;  4ES9 A;  3OY8 B;  2Z4F A;  1AYN 2;  2V5Y A;  1DYO A;  4TYS A;  2JE8 A;  1GNY A;  2F17 A;  5C3R A;  2VBP A;  1EAH 2;  1PHM A;  2ZHN A;  5FXZ A;  4XZP A;  1Q56 A;  3MW3 A;  3PU3 A;  4MO3 M;  1GWL A;  2RMU 3;  4P14 A;  5IJR A;  1HKD A;  4SBV A;  1HQL A;  5HV4 A;  2WAA A;  5LW9 A;  1O8S A;  2EIE A;  4CUA A;  1HLC A;  3NV1 A;  5FYH A;  4BM8 A;  4CDU B;  3JUU A;  1AR8 3;  2HEV F;  4UFI A;  4BIF A;  3OGR A;  2VQA A;  1UXX X;  1QJX 3;  3TNP B;  3WF0 A;  2VOV A;  1DCS A;  1JOP A;  1GOG A;  2YU2 A;  3PUS A;  3ETQ A;  4NJ4 A;  4JDM A;  3VDD C;  3ZDV A;  1RUH 3;  2WO2 A;  2BP6 A;  3RPQ A;  2DUQ A;  5KC6 A;  1VBE 3;  4RHV 1;  2WFF 1;  1VRH 3;  1OH3 A;  1NLR A;  1ZX5 A;  5F5I A;  3SMH A;  3PUA A;  1RHI 2;  4LKF A;  4C90 A;  4LUK A;  1WWY A;  1RUF 2;  1JZ5 A;  2FCT A;  4MET A;  4PJY A;  1VBD 2;  5LA1 A;  1ZRR A;  2D97 A;  4I02 A;  3JQW A;  3S0M A;  3UJO A;  3AP7 A;  3RGB A;  4FPK A;  4FQ4 A;  4DIQ A;  2BRT A;  1FPN 2;  5F7U A;  3VDD B;  3WVJ A;  2VUJ A;  2ZHK A;  3U07 A;  1P8J A;  3OUJ A;  1RIN A;  3LEM A;  5KC5 A;  5T5J A;  4RR3 A;  1POV 3;  2QNK A;  4XBQ A;  1MQT A;  4AVA A;  2QE3 A;  2VZS A;  4PIY A;  1QOO A;  2YGM A;  5IAV A;  3VD5 A;  1COV 3;  5ACA 3;  4CP9 B;  4CXX A;  2WS9 2;  5A3O A;  2IXH A;  3P5B A;  2JB8 A;  5DDJ 3;  3W20 A;  4XFF A;  1JZ2 A;  1MR5 A;  4B7E A;  4HKO A;  3WCS A;  1C8N A;  4LLO A;  2WAO A;  2DCT A;  1GKB A;  2XUE A;  4R52 A;  1VBC 1;  4AGV A;  1V6N A;  2AGS A;  4CTE A;  4DQA A;  1A8M A;  5FUI A;  1US2 A;  5FXX A;  2JDA A;  1C5I A;  2PAE A;  3KM5 A;  1XNC A;  4LEJ A;  4CUB A;  2Y6L A;  3TEW A;  4TLG A;  5IK5 A;  2D98 A;  1C1L A;  5FZ1 A;  3CJI C;  3Q8A A;  3LF7 A;  4XMI A;  4AEJ A;  3O1P A;  3NKG A;  3A23 A;  4RR3 C;  3LAG A;  3OEB A;  4FP2 A;  1CQ9 A;  3WNL A;  1MQT C;  2JG9 C;  3SH3 A;  4GKY A;  4UFJ A;  5J7M A;  4JTO A;  1PMH X;  5A33 B;  3ABZ A;  4BDV B;  4IV1 B;  3WQ0 A;  2A6Z A;  2VZ3 A;  4Z8B A;  2JKX A;  4BQ3 A;  5JIU A;  1MS4 A;  2EAK A;  5FYT A;  2D3S A;  4YVW C;  5FYI A;  2OQ7 A;  1QXJ A;  1S2K A;  4GB3 3;  4O9G A;  4F8A A;  2BTV C;  1JN2 P;  1QNY A;  2RDS A;  2ZGR A;  3CJI B;  4QMA A;  5EJ3 A;  1LAJ A;  2VZV A;  2XML A;  1LGN A;  2PHR A;  3SH5 A;  4RR3 B;  4COY A;  1H6Y A;  3H1W A;  2RM2 1;  5IVC A;  3MIF A;  2MPF A;  3T0A A;  2EF6 A;  3FHI B;  1REF A;  2JG9 B;  3L2H A;  4NWV A;  2E32 A;  1Y9M A;  3H3Z A;  3KV6 A;  3KB5 A;  3N35 A;  4AEK A;  3OGV A;  1FV2 A;  3I97 A;  1JHJ A;  4QX3 A;  5FMB A;  5FYY A;  3WF1 A;  3N3H A;  2R04 2;  2UY9 A;  1Q5O A;  2R06 2;  5DG2 A;  2PHW A;  2W1S A;  4QB6 A;  5GM0 A;  4YVW B;  4UFH A;  4NHK A;  1UOG A;  1UY0 A;  2BVB A;  4E2G A;  5L7O A;  1SFN A;  1GNH A;  2GMM A;  2HWF 2;  3ZMO A;  3VD7 A;  1SCR A;  2FDJ A;  3CZJ A;  3O1T A;  2DVF A;  2ES3 A;  3GYD A;  2C1F A;  3I4I A;  2HLE A;  4BXS V;  1JH5 A;  3AL6 A;  2HWD 1;  2ZX0 A;  3T1M A;  1F9K A;  2R49 A;  4I01 A;  5HBA A;  2WQ4 A;  2P1B A;  2PHX A;  3PU8 A;  3T09 A;  1PO1 2;  4QPG A;  3IMM A;  3SEE A;  2WRA A;  3JBG 1;  3ZN4 A;  1NLQ A;  1RVF 3;  2BVV A;  3ZYP A;  2VZR A;  2ZHM A;  4CRQ A;  5KHG A;  1WCD J;  1WKY A;  2Y6G A;  3ILR A;  5L9R A;  4EE2 A;  5I0D A;  1HJF A;  1LHU A;  4Q2F A;  1AYM 2;  3WP4 A;  4YFW A;  3BKZ A;  1FOD 2;  4BQ5 A;  5L7O C;  1W05 A;  2CL2 A;  3E5X A;  3B94 A;  4CEY B;  1OPO A;  2V4A A;  5FZD A;  3EJK A;  1RED A;  4HVQ A;  3FWE A;  1W9T A;  3OBR A;  4MSV A;  4A42 A;  1D4M 3;  1DP0 A;  2P37 A;  2VUC A;  3H7J A;  4Y20 B;  3O1O A;  4LKE A;  5IVE A;  1I1E A;  5EP9 A;  3AVR A;  1IQD C;  2UWC A;  2BBV A;  1B09 A;  3CHX A;  3MW2 A;  2VZQ A;  4FOY A;  4FPO B;  2VE1 A;  4ZS2 A;  3POS A;  3VGI A;  4W4Z A;  1TQ5 A;  5A7N A;  3BPS A;  4LBQ B;  3LE0 A;  2DCZ A;  2YBS A;  4P9L A;  4YW1 A;  1Q8Q A;  4MGY E;  1QH6 A;  5L7O B;  1AR6 3;  1CN1 A;  1WA4 A;  3VLB B;  2YRO A;  2NN8 A;  2ZAH A;  1OH4 A;  2DFB A;  2VCA A;  2QQO A;  4L8Q A;  2JX9 A;  3NVC A;  4DEV A;  3MBW A;  3SIT A;  4AVT A;  4M0H A;  3HR9 A;  3M3E A;  3WQ7 A;  1UY2 A;  3GZE A;  4FPL A;  2VZ1 A;  1AYN 3;  4IER A;  3IAP A;  4ZXK A;  3VL9 A;  1AZD A;  3ALQ A;  2CYF A;  4XAE A;  1VP6 A;  1OBN A;  1WMD A;  2DFC A;  1OLQ A;  5HCF A;  1UYY A;  4OUS A;  1OA4 A;  3TN9 1;  3WW3 A;  1VAK A;  1EAH 3;  2VUD A;  2PN5 A;  3OTF A;  4SLI A;  4V1P A;  5AVP A;  5FIX A;  2V73 A;  4O65 A;  5FPX A;  4JC1 A;  1WCU A;  1WA6 X;  3CF6 E;  1OLM A;  1E5H A;  2B8M A;  5FY4 A;  4GD4 A;  2R0F A;  3AMN A;  3RJR A;  3O1M A;  1XYN A;  1RUJ 2;  4JRA A;  4FTB A;  4XQW A;  4XIL A;  4JTN A;  4AI3 A;  2D6N A;  4CU8 A;  4ITC A;  2XG3 A;  2AC1 A;  1AL2 2;  1ZBE 1;  2RV9 A;  3L9J T;  3RMX A;  2B5H A;  5AFB A;  4WM8 C;  2UYB A;  1GQP A;  2DVD A;  3K4Z A;  1HQW A;  2MNG A;  4OI2 A;  3TEZ A;  3V64 A;  2Z42 A;  1UW8 A;  2QQP A;  4QQH A;  5IUQ A;  1RXF A;  3V0A B;  2ZGT A;  3ETP A;  4RD7 A;  3ACL A;  3WNK A;  2R1D A;  3USU A;  5F8P A;  3B7M A;  2CTV A;  3MDP A;  3ZPO A;  1I6X A;  3PVB B;  1CES A;  2HWB 2;  4FPG A;  4I0W B;  3LSE A;  4WM7 B;  5FZ9 A;  5BY5 A;  2WO7 A;  1QJY 1;  2VW0 A;  5FK7 A;  1B35 B;  4K6B A;  4UT5 A;  1F35 A;  5JXI A;  1W6Q A;  4UFL A;  3HT2 A;  1FAT A;  1S2B A;  2QBX A;  1BEV 3;  1AX0 A;  2RJ2 A;  1ZM1 A;  1K3I A;  4YW7 A;  5J1X A;  4WM8 B;  2AYH A;  2AZ5 A;  3AK0 A;  1FPN 3;  3BU7 A;  4NPL A;  4ES8 A;  4M3C B;  3I2J A;  4RYD A;  1HXS 2;  5JAX A;  1S2E A;  1LGB A;  4Q4X 2;  3ZR5 A;  3EXU A;  3KCY A;  1YQC A;  1R08 1;  2A1X A;  3ACG A;  2BW8 A;  3H50 A;  3OPT A;  3VBU A;  1TZO A;  5EV7 A;  4WBB A;  3W5N A;  2P6H A;  2QQV A;  5CB7 A;  2GC1 A;  5DG1 A;  1I5Z A;  2JDY A;  1ULO A;  1DYK A;  1Y4W A;  1LCL A;  2WS9 3;  3ZR6 A;  3VBF A;  1BQP A;  3LPG A;  4KI5 M;  2D5H A;  2PTM A;  2W08 A;  1LB2 A;  3MGU A;  3I59 A;  3VL8 A;  4CCO A;  3NAP C;  1C3H A;  1ZBA 1;  1R1Z A;  3GCX A;  3QLQ A;  4QX7 A;  1OFS A;  1TME 1;  1RJ8 A;  1C5H A;  1N3O A;  2GH8 A;  2R07 1;  1GBG A;  4RS5 A;  5AVA A;  5FV3 A;  1FNZ A;  3CIH A;  4K21 A;  1AR9 2;  2RR1 2;  4ARY A;  1OD3 A;  2RS5 2;  1WMX A;  1MZ5 A;  4KG0 A;  4M4R A;  5JMO A;  2K2S A;  3OB8 A;  4C0H A;  2JG8 B;  3ZIX A;  5FZI A;  1HN1 A;  2ATF A;  3JD7 1;  1HB4 A;  3ZYG A;  3VKL A;  3HNM A;  3L2Y A;  3VBF C;  1GP6 A;  3NAP B;  2DVA A;  1W6Q B;  1UO9 A;  1XE7 A;  4MHU A;  3WIN E;  1ZYB A;  1SFY A;  3HT1 A;  1YQ8 A;  3AX4 A;  5EZW A;  3S7I A;  3ZN6 A;  3S57 A;  3T0D A;  3POW A;  1CWP A;  4YRD A;  2NZ9 A;  3T30 A;  1OKO A;  2Q1Z B;  4CDQ A;  3W21 A;  4MHR A;  1YUD A;  3P1I A;  5JOW A;  2BBA A;  3VHO A;  2XDV A;  1PM4 A;  3VN4 A;  1EPW A;  4LXL A;  3V56 A;  4XEZ A;  1PO2 2;  4MZU A;  4AL9 A;  1R09 1;  3KLS A;  5IYY A;  4Q4Y 2;  2NYY A;  3AJY A;  4XMA A;  5D8A B;  2MEV 2;  3T3Y A;  1J84 A;  1QOT A;  2R04 3;  2Y64 A;  5DQ0 A;  3CNA A;  1WMF A;  2R06 3;  2W46 A;  5GZC A;  4E2S A;  4FOV A;  4D0Q A;  3W5M A;  3MZH A;  4IGQ A;  4RGK A;  1NUK A;  3I54 A;  4YGB A;  5FZO B;  3OGG A;  1C8M 3;  2UUR A;  2IXL A;  2QQN A;  3FLT A;  4IEO A;  1Q8S A;  1NA1 C;  4WVM B;  2VVF A;  5I91 A;  1FI2 A;  2HWF 3;  3BGA A;  4P9W A;  1STM A;  3AP9 A;  4OFG A;  1OSG A;  3H8U A;  4FCA A;  4K20 A;  5L19 A;  4LMF A;  1HW5 A;  5JIA A;  4EN9 B;  1RTV A;  1VLN A;  1X8E A;  3LSD A;  4PIX A;  2VEC A;  5BPX A;  4FOW A;  2H6C A;  3DCQ A;  5LK7 B;  1JTZ X;  1RMU 3;  2AH2 A;  2KXL A;  1V9U 1;  4MAD A;  4B1L A;  3ATG A;  1YJL A;  4COV A;  2DV9 A;  3JB8 A;  3WDY A;  2D40 A;  1Y3T A;  1NA1 B;  1JYC A;  1O8P A;  2BQP A;  4UOJ A;  3TB0 A;  4A44 A;  1ST8 A;  1OLR A;  2WZP P;  5GJ6 A;  5F5Q A;  4HZF A;  1UN1 A;  1LOA A;  5FRA A;  1QDO A;  4YW6 A;  5FY0 A;  4UW5 A;  2FMD A;  2NMO A;  3I2G A;  4A2U A;  4CXY A;  4BXF A;  2GAL A;  1GOH A;  3DEM A;  5F1R A;  2X29 A;  2TNF A;  2VL4 A;  4HKW A;  3IAQ A;  3UJQ A;  3CZU A;  1Y43 B;  4MVT A;  1VMH A;  3AYE A;  1VBA 1;  1WCS A;  2IXJ A;  2LS6 A;  4AI1 A;  2JB4 A;  4UF0 A;  3IB3 A;  2KM2 A;  5DAB A;  2XJU A;  1PM7 A;  1H1A A;  4HPK B;  4QX5 A;  2YPD A;  5F3G A;  5JXG A;  1MAC A;  5JVV A;  2VAU A;  2AEN A;  3VZM A;  1UMI A;  5F6L B;  5A7Q A;  1HRI 2;  4RHV 3;  2WZE A;  3HBZ A;  4FPF A;  5FKB A;  3J9S A;  4ZY9 A;  2LM3 A;  1WLC A;  5GZF A;  3WZ1 A;  3ZSL A;  3U78 A;  4QX0 A;  2YBK A;  3MIH A;  1BBT 2;  3PUQ A;  3FBM A;  3PVO A;  3THT A;  2FDG A;  3OF1 A;  4CUG A;  3RYK A;  4YM3 A;  1NXD 1;  4QXH A;  1W8H A;  1XNB A;  4XFH A;  5JXH A;  2SBA A;  3WF3 A;  1JYN A;  1CAV A;  1O5L A;  1OT5 A;  5EWS A;  5FYU A;  1CIW A;  1NQJ A;  4P00 B;  4QAW A;  1IGO A;  4N43 A;  3USS A;  3NL1 A;  1N1S A;  5FK8 A;  4AHX A;  1CZS A;  3KGL A;  4KH9 A;  4LA3 A;  4Q4V 1;  3EYP A;  4QPW A;  4RSU A;  2Q8E A;  5KHJ A;  1W39 A;  2IUW A;  4D7Y A;  1GUI A;  5CFD C;  4HVR A;  4OI4 A;  1A6C A;  1VBC 3;  3TOJ A;  3LDB A;  5BUV A;  3OOX A;  2JDH A;  1I5P A;  4OHW A;  4BE3 A;  1LEC A;  1YIP A;  1R1A 1;  1LOC A;  5H9Q A;  4NRP A;  4Y5T A;  2WNU B;  3AZV A;  3AP5 A;  4E27 A;  1H0B A;  4XF3 A;  3OEA A;  1ASJ 2;  2BPA 2;  2PQS A;  2IFW A;  3OD4 A;  3NV4 A;  2WLP A;  1YQ5 A;  4PDW A;  3UT0 A;  4N43 C;  1W04 A;  3LEI A;  2ZAA A;  4NHM A;  1IS4 A;  1RUN A;  1UD1 A;  2RS1 2;  2XKP A;  3T2Q A;  5CFD B;  4GMP 3;  3HNY M;  2WYS A;  3N9M A;  4GZ9 A;  1W0O A;  4V2W A;  2JIJ A;  2RMU 2;  4NVP A;  4Y1U A;  5LBB A;  3T2T A;  1PVX A;  4Y24 A;  1PIV 1;  1XBF A;  4DXS A;  1AHS A;  3VZN A;  1HXS 3;  3NMB A;  4ASK A;  2RS3 1;  4FQZ A;  1AR8 2;  5FUP A;  4IGO A;  2OKX A;  1QJX 2;  1SLB A;  1XSR A;  1YO8 A;  4JQR A;  1CD3 G;  4LBM A;  2ZTN A;  3MHZ A;  2ZX4 A;  3DYP A;  5I0T A;  2QQM A;  1GOF A;  5KR7 A;  1D2S A;  4L0P A;  1RUH 2;  4QB1 A;  3HIF A;  1C4R A;  3DKQ A;  4M0N A;  5IAT A;  2PXJ A;  1VRH 2;  3QBQ A;  5AC9 1;  3ITQ A;  3AM2 A;  1NY7 2;  1UQX A;  3LKJ A;  1HX6 A;  3AYA A;  3OCP A;  5A6X A;  4AI2 A;  4GJZ A;  4TTG A;  4JHT A;  4YGD A;  3UKT A;  5FBJ A;  4AI0 A;  5E89 A;  4C91 A;  1YLL A;  1UU5 A;  2RR1 3;  2WNO A;  4XBN A;  4XET A;  1FX5 A;  4XF0 A;  5C9A A;  3U4X A;  2VZO A;  2JDZ A;  2OS2 A;  4EWA A;  2FCU A;  4Q0S A;  2E9Q A;  5L9V A;  2EIG A;  4Y33 A;  4UI9 L;  1OOP A;  4D94 A;  1DHK B;  1ENX A;  4I2O A;  5FOJ B;  4MOA A;  4M01 A;  5IVV A;  1UPS A;  2QZ2 A;  1T2X A;  1MEC 1;  4RFR B;  5FRE A;  1A78 A;  1O3T A;  1QXP A;  1KD7 A;  4UW4 A;  3KT7 A;  1OQE A;  1COV 2;  5ACA 2;  3MIG A;  5D1I A;  3LFI A;  1DQ4 A;  5CIR A;  4DEQ A;  3HQR A;  5DDJ 2;  4ZPI A;  5FQ0 A;  5A6Q A;  3JCI A;  5T5P A;  5ISL A;  1W6O B;  4OI1 A;  4CDW A;  2X05 A;  4BU2 A;  3FL7 A;  2ZX3 A;  1Z78 A;  4IGP A;  3ST7 A;  1R64 A;  4HSL A;  1IG0 A;  4KBZ A;  1AR7 1;  3LQC A;  4FXG B;  3WHT A;  1RC6 A;  1PO2 3;  2WAB A;  1ZRF A;  4QXK A;  4Q4Y 3;  4EN8 B;  5BYN A;  2IXI A;  3ILN A;  3Q8E A;  2MEV 3;  3VKO A;  2R1B A;  1GQG A;  1AX2 A;  5FZF A;  2ORX A;  2W1W A;  4R9D A;  4UW3 A;  5H9P A;  2B42 B;  2QQI A;  1EV1 1;  2A3X A;  2VM9 A;  4UYB A;  5DAW A;  4Q4W 3;  5DAV A;  1YI7 A;  2ID4 A;  4ISR A;  5E8A A;  5FMC A;  4FO9 A;  4UBH A;  4DNY A;  3BB6 A;  4E8C A;  3A0K A;  5HPO A;  1VR3 A;  3N9N A;  1GZC A;  1VBB 1;  4AHZ A;  5J36 A;  1PX4 A;  1ENR A;  1F5F A;  2OUJ A;  3GJA A;  2WWJ A;  1BVV A;  1HB3 A;  2QQK A;  2WNV B;  4GAL A;  4Y1Y A;  5FOB B;  1UU6 A;  3THP A;  5E6H A;  4E4Z A;  4JGZ A;  4PBP A;  5JZG A;  1Z7S 2;  1YRZ A;  1GZW A;  3H1M A;  4YZ5 A;  1ENQ A;  4V2V A;  1XYO A;  1PVC 2;  3QH7 A;  4LO8 A;  3NJY A;  4LBO A;  2ZML A;  1FNY A;  1SLT A;  4Y1X A;  3HMY A;  4D8M A;  1WW6 A;  1CJP A;  3PJY A;  3IN9 A;  4YWA A;  5KXB A;  3J8F 2;  3ZXG A;  1RUF 1;  3TYJ A;  5ANN A;  3TN9 3;  1QDC A;  1VBD 1;  4XJ8 A;  2UWA A;  3THC A;  1BK0 A;  3VBH A;  3I3E A;  3M4F A;  2JDP A;  2WJS A;  2BWA A;  3M8L A;  5CAZ A;  1TE1 B;  1AUY A;  3N9L A;  3WY6 A;  1S1A A;  4QT6 A;  4DRR A;  3AMH A;  2WT0 A;  3O14 A;  3K4A A;  5JMC A;  4XCB A;  3WP5 A;  1LOF A;  1CAW A;  1IS5 A;  2QDR A;  2JKB A;  2WN3 A;  4RQP A;  1YJK A;  2A6Y A;  1NCQ B;  1IG3 A;  4LIT A;  3DPR A;  1YIF A;  1WBF A;  4DXZ A;  1QMJ A;  5JI9 A;  1GWK A;  3H9A A;  5JZG C;  4E4D X;  2R6Q A;  3IDA A;  2BDR A;  4XUQ A;  2A6X A;  1QKQ A;  1U5Y A;  4PHZ A;  3O0X A;  4YAR A;  1REE A;  5DMY A;  1OMI A;  4K40 A;  4YG0 A;  1ONA A;  3O0V A;  1RVF 2;  3MLJ A;  4JAA A;  2GNT A;  2HBU A;  4P9I A;  4KMQ A;  1H6X A;  2CY6 A;  2O0O A;  2VOT A;  5GLU A;  4N9I A;  3KVB A;  4XFB A;  5A7W B;  1PMI A;  1BBT 3;  4LKD A;  4YW4 A;  4M4P A;  2Z5W A;  1IPK A;  3M3C A;  1NZI A;  1W2A X;  3T0B A;  3KCX A;  2XGX A;  5F3E A;  2W2I A;  2W87 A;  3G7D A;  4OMD A;  4BQ4 A;  1MZE A;  3DPR C;  3BYW A;  3BOD A;  4L9B A;  3WF2 A;  1EY2 A;  4LUL A;  3ZFE A;  1T6G C;  1APN A;  3DF0 A;  4I30 A;  5FXW A;  2WA4 A;  5IFT A;  2OPW A;  1G9C A;  3DKW A;  3AYD A;  2XVL A;  4QKN A;  3K75 B;  5A1L A;  2NP0 A;  5J09 A;  2GAU A;  1QQP 1;  3P3N A;  1J1T A;  1EP0 A;  1LUL A;  2JEN A;  2WIN B;  3PME A;  4S2G A;  4XF4 A;  3TAY A;  1O5U A;  1K5J A;  1FYU A;  2CSG A;  2JIC A;  1CAW B;  1W03 A;  2E7T A;  4FPC A;  4MG2 A;  3GZU C;  2IC1 A;  2PLV 1;  5LA2 A;  5F9T A;  3NNL A;  2P34 A;  5I8T A;  1F31 A;  3PUH A;  4WVW A;  1TME 3;  2R07 3;  1RUI 2;  4N8M A;  3AFK A;  2XB6 C;  3POG A;  4P9Y A;  2YB7 A;  4Y5S A;  3W58 A;  4ZZ5 A;  1JUH A;  2VUA A;  4HON A;  4ISQ A;  4JDO A;  4YVS C;  5JI7 A;  4CA9 A;  4MGZ E;  4Q0V A;  4YGC A;  2LUW A;  1HQN A;  3OYW A;  4AI8 A;  3R6S A;  1VIW B;  4CEW C;  2RS1 3;  2XKO A;  4AED A;  1U5Z A;  1DLL A;  3H3L A;  3IDC B;  3J7L A;  2ZX2 A;  3PIJ A;  2VCM A;  4IE5 A;  3LWC A;  1W6P B;  2O8O A;  4PLN A;  5T5O A;  1H8T A;  2J1T A;  2WQZ C;  5CEH A;  4JKK A;  5ERL A;  4GWM A;  2YHJ A;  3KV9 A;  4K1Y A;  3FHA A;  5FCC A;  2I07 B;  5DXD A;  4YVS B;  4NPR A;  5IHR A;  5A3L A;  4I3P A;  2DCY A;  3O7O A;  4A45 A;  5C3P A;  5JPN B;  4CEW B;  3BIW E;  1S0D A;  5FPB A;  4Y1Z A;  4NR1 A;  1RUD 2;  4PF1 A;  2WT2 A;  2W5F A;  1SFP A;  3MIC A;  5I0R A;  3LEG A;  3O5S A;  4FBF A;  4AED C;  1D4V B;  2ENR A;  4DY3 A;  1DZQ A;  3SXW A;  4C1X A;  1D0G A;  1BCX A;  1Y9Q A;  3ZOI A;  4PI2 A;  4JQT A;  1BEV 2;  5FY9 A;  3N7L A;  1W6N A;  3O1U A;  1UZY A;  2ZS6 B;  1SEF A;  2B45 X;  4XAC A;  5EJ1 B;  4LHL A;  1X36 A;  2WSU A;  2WZR 3;  1JXN A;  2Q8D A;  4CU7 A;  3BIE A;  1E5R A;  1W2O A;  3PNA A;  5FP9 A;  3VUO A;  2R7E B;  3QOP A;  5GLT A;  3I8T A;  4ZKT B;  3HVD A;  4ZON A;  5EYY A;  5FWE A;  4MGQ A;  4MGS A;  2D6K A;  3C3V A;  4DZG A;  2G9Z A;  2HYX A;  2X5I A;  5DPN A;  3ZIW A;  4AR2 A;  1GIC A;  3ZYH A;  4X8N A;  2DBI A;  4JDN A;  1LEM A;  1CIY A;  3LIH A;  2ZBJ A;  4XPV A;  2IWG B;  5CBL A;  2XOM A;  1DDL A;  1UYX A;  3MF9 A;  4IEY A;  3DN7 A;  4ZU7 A;  5IWF A;  2WII B;  3ZYJ B;  1DGW A;  1GAN A;  2AEY A;  2ZJC A;  3EHK A;  1RUE 2;  1V70 A;  1ZNP A;  1NAE A;  2DVG A;  4OMC A;  4LBK A;  4A4A A;  1DQ0 A;  2QZ3 A;  5LY2 A;  1SCS A;  4FOQ A;  3VD3 A;  5G04 L;  4HET A;  2YC0 A;  4YM2 A;  2A73 B;  1O91 A;  3JB4 C;  3LGR A;  4H7L A;  5JCT A;  2WN2 A;  5JSO A;  1QNW A;  3FBY A;  2KD7 A;  1G6N A;  4CCD A;  1AL2 1;  1UZV A;  1W90 A;  3T2P A;  2X5I C;  2VZP A;  4G4F A;  5FMD A;  1XQN A;  2ZAB A;  2CV6 A;  1QJZ A;  1XNK A;  4LHN A;  1W6N B;  4GIQ A;  4F83 A;  5B2G B;  2CGP A;  4XDQ A;  4NAM A;  2O1Q A;  3UGF A;  4LPL A;  3AKQ A;  1W99 A;  3NV3 A;  4NID A;  3VKM A;  5FO8 B;  1Z7S 3;  2CAV A;  3LPF A;  1ULF A;  4DPN A;  3EMR A;  5JWP A;  4Y4Y A;  1PVC 3;  1RL3 A;  1MQT B;  2HWE 3;  1W9S A;  3R4D B;  2GC0 A;  1JU3 A;  2VTX J;  3HPN A;  1M4W A;  4NHY A;  4W6Y A;  2P6C A;  2A3Y A;  4GUL A;  3OBZ A;  1G9F A;  1TMF 1;  3J8F 3;  5LK5 A;  4IE4 A;  4CPB A;  1ODN A;  3S30 A;  1KGY A;  3JXS A;  1IPJ A;  2RDN A;  2ZMK A;  3AXD A;  3U10 A;  4UWD A;  4EYU A;  3WW2 A;  1C8M 2;  4XUO A;  1KEX A;  2GND A;  3QAC A;  4GQ7 A;  1W9Y A;  4KGG A;  4R8H A;  5H9R A;  3HN1 A;  4CUC A;  5FBZ A;  1VAL A;  5E16 A;  4AVB A;  3BTX A;  1NE6 A;  1K5M A;  4AGG A;  5AFE A;  3HD8 B;  2P3Y A;  1IS6 A;  2UYA A;  1R1A 3;  5JDB A;  1URX A;  3FE5 A;  4D69 A;  2FHR A;  4HT1 T;  4BWO A;  1LTE A;  3GNE A;  3E6B A;  1RMU 2;  4N53 A;  5CYY A;  5HCA A;  2Y34 A;  5C70 A;  4ZU5 A;  4AVV A;  1RUG 1;  3O1V A;  3HOB A;  4HK9 A;  1CAX A;  1OQ1 A;  1W9F A;  1W2U A;  2NPI A;  2QTW B;  3H0O A;  4PQ9 A;  3TWI A;  3ZSE A;  2WL1 A;  3KHB A;  3Q8F A;  2RS5 1;  3OUH A;  4ZS3 A;  3NNM A;  1O4Y A;  1XYP A;  1EPZ A;  1KJR A;  1UF2 C;  4Q0P A;  1W3V A;  4RGA A;  1H1M A;  1QH7 A;  1D2Q A;  2ZA9 A;  1YHF A;  3RZJ A;  4U36 A;  2GN3 A;  4BOW A;  4AAP A;  1K5M C;  3MEP A;  4KG8 A;  4AQT A;  1UPI A;  2HEY F;  3VZJ A;  2RS3 3;  2XL7 A;  2ZGO A;  1RGS A;  3H8X A;  5FZM A;  3WNM A;  2Q30 A;  2VCC A;  1OVS A;  5LCW L;  5ANQ A;  1G7Y A;  4D7T A;  4QPG C;  1VAV A;  3POI A;  4MLO A;  5SV5 A;  4QU2 A;  3SLI A;  4KBB A;  2WFP A;  4ASM B;  1OA3 A;  4MXV A;  5FPU A;  5I0S A;  2ARX A;  1BXH A;  5FMO L;  4UAP A;  4RHV 2;  5JR2 A;  2WFF 2;  1CAU A;  3ZO0 B;  1BYH A;  4JCK A;  2Y0O A;  3RNS A;  1X82 A;  1CVN A;  4NIH A;  3GAL A;  5FPL A;  1QXR A;  1RUI 3;  5A1A A;  1OHF A;  2WKK A;  2YDE A;  5BNP A;  5F5C A;  3UKN A;  3I2O A;  2FDI A;  5A1F A;  3DEC A;  4QPG B;  4YPJ A;  3J4U H;  4CCE A;  2ZEW A;  2VQT A;  2EVX A;  3ZSM A;  4XAB A;  1KFX L;  2LRP A;  1L3J A;  2GC3 A;  4MV2 A;  5FZG A;  5LZ6 A;  5EIY B;  1GU3 A;  2UWB A;  3DV8 A;  4F3J A;  1MEC 3;  4QX8 A;  1W8T A;  4G3Y C;  4P5Y A;  1VPH A;  5C5U A;  1WCQ A;  1MS5 A;  4AQ6 A;  1J3Q A;  1SLL A;  3T2O A;  1WGP A;  5DZE A;  1NXM A;  5ABJ A;  3WDT A;  3R4U A;  3FUQ A;  4NWW A;  5F6K A;  3SCF A;  1VBC 2;  3WNX A;  3VBR A;  2XJR A;  4JKM A;  4LBN A;  5BNP C;  1CJD A;  2H6B A;  2Q1M A;  1S0I A;  2PAM A;  1V00 A;  1SQ4 A;  3GZT B;  4HXC A;  1ND2 A;  4FVV A;  3F2Z A;  4OUE A;  4LBJ A;  2J7M A;  1RUD 3;  4DIN B;  3N36 A;  1PGL 1;  2IVJ A;  3III A;  1GSL A;  1UMH A;  3WNN A;  1QHD A;  5FPV A;  1F5J A;  1ZRI A;  2V4V A;  4XE9 A;  3RFR A;  1EV1 3;  3WD5 A;  1RIR A;  3ZXL A;  2GZW A;  3I3Q A;  1GFF 2;  1BKZ A;  3CU7 A;  1UKG A;  2B7Y A;  3IZO A;  3ZYI B;  1CPN A;  1ACC A;  2BUK A;  3HAG A;  3C7E A;  4W8J A;  5ABJ C;  1VBB 3;  2RVA A;  5FXV A;  4ZXE A;  5DUV A;  1FMD 1;  2VXR A;  4QHO A;  1XC6 A;  3M3Q A;  1MVQ A;  3ZXA C;  4BQX A;  1HRI 1;  2ORZ A;  4LE4 A;  5T52 A;  1UAI A;  2V72 A;  4J6G A;  1GZT A;  5L36 A;  2XHK A;  4XFI A;  1NCR A;  3AZW A;  4Q1P A;  2WLQ A;  5JOZ A;  3KSC A;  1U5I A;  1W8F A;  4QPI A;  5C3O A;  3NRU A;  4LR4 A;  1KS5 A;  2XXZ A;  4P9J A;  4YYO A;  1ULC A;  2PYT A;  4L2N A;  5EPA A;  2X10 A;  1QF3 A;  4B8E A;  5ABJ B;  3T4H B;  4LUM A;  4NIA A;  2JEM A;  2VW1 A;  2Q0A A;  1MZ6 A;  4H3W A;  4XUT A;  2ZEZ A;  1UMZ A;  2ARB A;  3MI8 A;  1O6U A;  4LOR A;  1LOB A;  4FI9 A;  3WDU A;  1H2L A;  2G9F A;  4A7Z A;  5CIS A;  2VVD A;  4CU6 A;  2DCK A;  5K8S A;  1C1F A;  1RUE 3;  2HH9 A;  3ES1 A;  2W3J A;  1ENS A;  4ARX A;  4DFS A;  3FLR A;  1G8W A;  3RI9 A;  5E88 A;  4XJA A;  3VBU C;  1V6O A;  2HWD 2;  3USU B;  3E5Q A;  4YZ2 A;  5IT6 A;  3J7N A;  2ADD A;  2J1V A;  2HEW F;  3ACF A;  3EB7 A;  3C7F A;  1JYT A;  4LIV A;  3N7K A;  4AWD A;  3JBG 2;  4IND A;  5F5A A;  2KR2 A;  2VOX A;  5C3Q A;  1UYP A;  5FMO S;  5FZ7 A;  1ZRD A;  4XC9 A;  4NHX A;  2VGD A;  3RZK A;  2ZEY A;  2BNO A;  3EBR A;  1T6B X;  4COW A;  2A5Z A;  4URT A;  4YLZ A;  4YZ4 A;  4BQ2 A;  1ASJ 1;  1KDK A;  1DQ6 A;  4RS5 C;  4Y22 A;  3WEZ A;  4CCM A;  5JXJ A;  1YFY A;  2JIG A;  3GM8 A;  2K0G A;  5FFO C;  3WX5 A;  3UL2 A;  4XJ9 A;  3VBU B;  2C24 A;  3B01 A;  3D0J A;  4BME A;  1KFU L;  1NZC A;  4GWJ A;  2XJQ A;  2UY8 A;  3SC7 X;  4XXA A;  4IW3 A;  3VBF B;  3GZA A;  4XJW A;  3RG0 A;  3KQ4 B;  3I59 B;  5C5T A;  1S0E A;  2BEO A;  5IW0 A;  3RS6 A;  4Z2A A;  4FXK B;  4Q4W 2;  2QQU A;  2W91 A;  1O7F A;  4HN1 A;  4A7K A;  2A3W A;  4JGY A;  3W9A A;  4RS5 B;  1QQP 3;  2NLR A;  4E2Q A;  2ZCW A;  3KF5 A;  2DUO A;  5FDB A;  3EQE A;  4CDQ C;  2PLV 3;  4K8R B;  5CFC A;  1ND3 A;  4PLM A;  3NNJ A;  5DUW A;  3CQO A;  4FFG A;  4IES A;  5GAL A;  2EAA A;  4XF9 A;  3OGS A;  4COU A;  2BOI A;  1VBE 1;  1L7R A;  1OKQ A;  1V6I A;  3WHU A;  1XOY A;  2NM1 A;  3ILF A;  4S2H A;  1Z0H A;  2OUH A;  4EWD A;  5FZE A;  1UZW A;  4BH9 A;  2VBB A;  1YFX A;  4RN5 A;  4WZF A;  1CON A;  1OLM E;  3KV5 A;  3AKR A;  3ZN6 B;  3U0Z A;  3TN9 2;  2B9U A;  3R0R A;  1RUC 1;  1UNB A;  4YZ3 A;  2HBT A;  2JE7 A;  5FY8 A;  5CG8 A;  4JGY C;  1GP5 A;  4CDQ B;  2ZEX A;  1SLI A;  4FPJ A;  5A3N A;  5FWJ A;  3E6C C;  1POQ A;  3C7G A;  3RSJ A;  2W1U A;  1AXZ A;  5CFC C;  2FZ2 A;  1BMV 2;  2Q5T A;  3D0S A;  3VZL A;  2VNO A;  3OBA A;  4HSJ A;  3UGG A;  3ZXD A;  3C8X A;  5GLW A;  2QJV A;  4AF9 A;  2OA2 A;  1KIT A;  3NST A;  3ZXK A;  1O3S A;  2YC4 A;  1SZB A;  4J1X A;  4DXR A;  4K9S A;  2BGO A;  4KWU A;  1ALY A;  4PF5 A;  4XIO A;  2FZ1 A;  4XXP A;  3DUI A;  4GJY A;  3GHM A;  2E51 A;  3GBG A;  1MPX A;  2VMI A;  1QJU 1;  1W06 A;  1WLW A;  4NRO A;  4QM8 A;  4N7U A;  3B9C A;  4XTP A;  2WFF 3;  4KNC A;  4QDQ A;  5C3S A;  4QQO A;  3MV1 1;  4FPH A;  4FTE A;  2VH9 A;  2GSY A;  1SLC A;  2EXI A;  1HB1 A;  4MGT A;  1QJY 2;  3N7J A;  4X8P A;  3LDK A;  3I49 A;  1PGW 1;  2Y0I A;  1CX4 A;  1O4Z A;  2XBO 1;  2Z2S B;  4B29 A;  4EZH A;  2Y26 A;  4IE7 A;  3OJB A;  3ZYR A;  1RIT A;  3B69 A;  3G6J B;  4QKB A;  2W52 A;  3POY A;  2VUL A;  3QH6 A;  3K2O A;  5A80 A;  4FTS A;  4A41 A;  5I93 A;  4GB3 1;  4IEV A;  3IDE A;  1DG6 A;  3E5U A;  3JZV A;  2A75 A;  3RQ0 A;  1JZ8 A;  3EO6 A;  2C6S A;  2B46 X;  3U11 A;  2P3J A;  3MUY 1;  5TSW A;  1AJK A;  2XR4 A;  2DU1 A;  5J98 B;  4YFZ A;  3WR0 A;  5BNQ A;  3UKV A;  3U37 A;  1TME 2;  5KXE A;  2P3I A;  2R07 2;  1O3R A;  1V6K A;  4UF0 B;  2VTX A;  1IQA A;  3K51 A;  2VXJ A;  4IXL A;  1WD3 A;  5L9B A;  3RZL A;  5A3P A;  1UOB A;  4XOG A;  3WDX A;  4EWE A;  5DAX A;  2XJS A;  4ZU4 A;  4TSV A;  1IPS A;  2EXK A;  4QD2 A;  3GBW A;  5KBF A;  5A32 A;  2I2S A;  4D3W A;  4H2A A;  3JD7 2;  3RZM A;  3BOP A;  3AXE A;  4FPY A;  4U2A A;  5T5L A;  3V0B A;  3ZKU A;  2I45 A;  2PA7 A;  1ZVF A;  5I8Y A;  3I2H A;  5C8W A;  2XQR A;  2YUE A;  1ULE A;  1SBD A;  2GNM A;  2JDK A;  2Y6H A;  4MYE A;  3VV1 A;  2HWC 1;  3I3D A;  3LA3 A;  2P17 A;  1CAV B;  5JOX A;  1W0N A;  1YEW A;  3M3O A;  2GU9 A;  3NJZ A;  4G9S B;  5C8C A;  2BV4 A;  2X09 A;  3A0N A;  2YFZ A;  3N7M A;  4QHZ A;  2RM2 3;  4N43 B;  4RA0 A;  4URA A;  5IVF A;  2D6M A;  4R9B A;  3Q9O A;  1R09 2;  4R4X A;  4EN6 B;  3MFA A;  4PDW C;  2VC9 A;  4LE3 A;  4O7X A;  4BZ4 A;  1TMF 3;  4E4S A;  3OD0 A;  2DCJ A;  1AX1 A;  3NO8 A;  3IWZ A;  2VNV A;  4BQ1 A;  5HXV A;  1PGS A;  3FLP A;  2BZD A;  3K48 A;  2A6W A;  2P5B A;  3SNM A;  3I2I A;  5F32 A;  1US3 A;  2CWM A;  3OGJ A;  3MLK A;  3NW4 A;  3ZSK A;  1NE4 A;  4BMB A;  1D4M 1;  1PMJ X;  4OZX A;  4HOO A;  5KHH A;  1CZT A;  1HRV 1;  4IET A;  1XJA A;  1AF9 A;  2MHF A;  3O1R A;  3M3I A;  3P3P A;  4IE6 A;  4KWL A;  4LTA A;  5C8C C;  1SAC A;  2WZR 2;  1ULG A;  5K0U A;  2HWD 3;  2PHL A;  3WCR A;  4COZ A;  4PDW B;  5FYB A;  5A3U A;  1S0J A;  2DTW A;  2WC2 A;  2V5D A;  3WW4 A;  1AR6 1;  1PK6 A;  2VOW A;  2EXJ A;  5FYM A;  3JBG 3;  2Q4S A;  3ES4 A;  4O61 A;  5FZ6 A;  5FUN A;  1NOV A;  3KD4 A;  2CNA A;  2E33 A;  1SDD B;  1LHW A;  3RDI A;  4LOS A;  1YFU A;  3ME2 A;  4W65 A;  4AFD A;  3UET A;  1XRU A;  3BTZ A;  4Y5Z 0;  1CZV A;  1AYN 1;  1QU0 A;  3KZ4 C;  5EQU A;  5FKC A;  1KJL A;  5FP4 A;  3V65 A;  3TEX A;  2ZGK A;  5C9A C;  1BHG A;  1W8Z A;  4IDZ A;  1EAH 1;  1HIX A;  5IVY A;  4XIK A;  1PNG A;  4J25 A;  1OOP C;  3N4M A;  2J1E A;  3VHN A;  3PTR B;  1VB4 A;  3LFM A;  4IEX A;  4EN7 B;  5CA6 A;  3ASI A;  1VBA 2;  1PK6 C;  3KHC A;  2RE9 A;  2ZHL A;  1W2N A;  3DYO A;  4IV3 A;  1YCI A;  5FZ8 A;  2FDF A;  3U1X A;  1J59 A;  1NLS A;  2D43 A;  2ZXQ A;  3FN9 A;  1Q43 A;  2OZ6 A;  3ROU A;  5J3U A;  5B4N A;  1XSQ A;  4QGM A;  1H2N A;  2VQU A;  4XVH A;  4MXW A;  1X9T A;  4CDW C;  5FZ3 A;  5C9A B;  5A3W A;  1H8V A;  3A7Q A;  5A6Z A;  3BTY A;  1S0F A;  4CSW A;  5KHK A;  1W9W A;  3AZX A;  1OOP B;  3I2D A;  2HJI A;  5LBF A;  1N1V A;  1M06 G;  2JE9 A;  1G9A A;  1QGL A;  5FYS A;  2HWE 2;  1AXY A;  5EFU A;  2BGP A;  2IZW A;  3IPV A;  3OSD A;  3HJR A;  3NKT A;  1RHI 1;  3X29 B;  4C1W A;  3ZMN A;  1DGL A;  2JD9 A;  4QDR A;  2XVG A;  5FP7 A;  2C9K A;  1ZZ9 A;  3AVS A;  5FQ0 B;  3VD4 A;  1BEV 1;  5FZK A;  3U75 A;  1LOG A;  1HDK A;  1UY1 A;  2YXS A;  4QWN A;  4CDW B;  2NQY A;  2AR6 A;  1FPN 1;  3D8C A;  1H4G A;  4Q8K A;  5BNN A;  4XDP A;  1GMM A;  3OPZ A;  5A7P A;  3KT1 A;  5EYX A;  5BNO A;  4XYX A;  5JLV A;  2D3P A;  2VMD A;  5FZC A;  1VMF A;  5C6C A;  4HLT A;  4LO5 B;  2YC2 A;  1FXZ A;  3MPB A;  5T54 A;  4JGZ C;  3FJS A;  1GNZ A;  1ZBE 3;  2WS9 1;  3LZZ A;  2BJS A;  1XND A;  1DIW A;  2CGN A;  2QQL A;  4NOT A;  1R1A 2;  1O4T A;  1YWK A;  4WVV A;  4MUV A;  3HBK A;  5JSP A;  2H0B A;  2IVI B;  4IQP A;  3Q8C A;  5F2S A;  5F39 A;  5C4W A;  4ATF A;  3LOB A;  2ZGP A;  2WZ8 A;  5F3I A;  3BPZ A;  5T55 A;  2BNM A;  3VBH C;  4UXA A;  3H1Y A;  2VNR A;  4MXW B;  4FPE A;  2W94 A;  4DXT A;  3O0W A;  1E5I A;  1QJY 3;  3B93 A;  2VBD A;  3TBD A;  5BNN C;  2FDK A;  1AL0 G;  4Z07 A;  4JGZ B;  1LOF C;  2DVB A;  5JZG B;  4RQP C;  1GZW B;  4YGE A;  2DTY A;  5FPA A;  3WOG A;  4AEM A;  3SHR A;  1PIV 2;  3HWJ A;  1N1Y A;  1FMD 3;  5FAX A;  3BAL A;  1DU3 D;  3RWK X;  1RB8 G;  1A34 A;  2D6P A;  1H30 A;  2RS3 2;  3OY8 A;  4QQL A;  1SDW A;  1R08 3;  4OLL A;  1DFQ A;  5JUV A;  4XZU G;  2J1A A;  3VBH B;  3ACH A;  2VO5 A;  3KS7 A;  1ZZ6 A;  4A3Z A;  5C4W C;  4OHY A;  4DUW A;  5DZF A;  2AAC A;  4HL0 A;  4BLI A;  4RQP B;  1SBE A;  1JS9 A;  2JXA A;  4QKD A;  5EXO A;  3SKJ E;  3VKF C;  3HNB M;  5AC9 2;  1ZBA 3;  3DPR B;  4CDU A;  4HAN A;  4XCA A;  5K9Y A;  1F4A A;  1LHN A;  2ZMN A;  2IXK A;  1HV0 A;  4Q0U A;  3J7H A;  5HV0 A;  2ZOE B;  4E8D A;  1QJE A;  1JYX A;  4QHB A;  2R04 1;  1W2T A;  3VD9 A;  2D5F A;  3MO4 A;  3AKS A;  2R06 1;  3ZFE C;  4E9K A;  4PLO A;  2ADE A;  1Q3E A;  3H42 B;  2D93 A;  3RMY A;  4AOC A;  3B3Q E;  4WZC A;  4YW2 A;  4DMI A;  1F15 A;  5C4W B;  1C8M 1;  1N1T A;  3NWK A;  4GXL A;  5LY1 A;  4BQW A;  2YU1 A;  4I0A A;  2HWF 1;  3IKW A;  3JD7 3;  2VR4 A;  3LD8 A;  1LKN A;  2WO1 A;  3J26 N;  4QM9 A;  1RJ7 A;  3MLL A;  1MEC 2;  4TWT A;  4ASL A;  3CKH A;  3RZZ A;  2E26 A;  2C0Z A;  5FZH A;  4X6Q B;  5D21 A;  3NV2 A;  1PO1 1;  1UL9 A;  2TUN A;  5T50 A;  4QKF A;  3POB A;  4QX2 A;  3AP4 A;  4K1Z A;  1JU4 A;  4CDU C;  1OPM A;  3ZFE B;  2JDU A;  1DGW X;  1RYY A;  3MF6 A;  3VDD A;  2IXC A;  4CYD A;  1BK1 A;  3TEY A;  2XUM A;  5LWB A;  5B4X A;  3O12 A;  4CP2 A;  1AR7 2;  1S0C A;  2X8K A;  5HCH A;  5FLH A;  3RZG A;  1R09 3;  5A3M A;  4IEZ A;  4B4P A;  1AYM 1;  3SIS A;  1FOD 1;  1YXW A;  1GYK A;  5T3N A;  1WW5 A;  2VJX A;  4CP9 A;  4GMP 0;  1UX7 A;  2ZKN A;  1QEX A;  1OUR A;  1U12 A;  1G9B A;  3MV0 1;  3KVA A;  1J3R A;  3VDC A;  1EV1 2;  1TNR A;  3AKT A;  1L7Q A;  1FT9 A;  1K45 A;  3SQO A;  1H8T C;  2GN7 A;  3WV6 A;  1CR7 A;  2D3R A;  1JUI A;  2YV8 A;  5DUU A;  4DOU A;  1VBB 2;  3VZK A;  1HV1 A;  2VZT A;  2WUH A;  2BU9 A;  4GKX A;  2K9Z A;  4QPY A;  4C0B A;  4UBG A;  3KV4 A;  3GDB A;  4IUG A;  3WSO A;  3OYW B;  3BVC A;  3A22 A;  1N3Q A;  4OYU A;  5LRR A;  2XWJ B;  4AED B;  1LU1 A;  2NMN A;  4NUB A;  1V9U 3;  2XVK A;  5A33 A;  2DF7 A;  4BB3 A;  1GP4 A;  2Y8K A;  1JZ3 A;  1PZ9 A;  4LLF A;  4KU8 A;  2XPJ A;  4Q29 A;  4IV1 A;  1MVE A;  1H8T B;  1PNF A;  2D7F A;  1OUS A;  3WP6 A;  1QJF A;  4L99 A;  1RUC 3;  1U5X A;  4AK3 A;  2BWC A;  1XPW A;  2R0H A;  4BK5 A;  4B1M A;  2GC2 A;  4K8F A;  4P02 B;  3CJI A;  5JOY A;  4OUM A;  3VDA A;  4DUX A;  4LQR A;  4QXB A;  2DWR A;  1UX6 A;  4JVA A;  2JG9 A;  3PUR A;  2G19 A;  5CAD A;  4FFH A;  1PZ8 A;  5CNA A;  1JZ7 A;  1H2K A;  1VBA 3;  5HXM A;  1RUJ 1;  1J58 A;  1ODM A;  3INA A;  2J1S A;  5GZE A;  3KT4 A;  4AW7 A;  1LRH A;  1U0A A;  4BQY A;  1E5S A;  3UGH A;  2VZU A;  1QJU 3;  3HQU A;  4YVW A;  2EID A;  5A7O A;  4IV1 C;  4BA6 A;  5DAP A;  4AGR A;  3UK9 A;  2L9L A;  4XAA A;  4YNI A;  4FAH A;  2XHN A;  2B39 A;  1CPM A;  3IMN A;  5J37 A;  2YBP A;  5JR7 B;  4M3C F;  1SG3 A;  3RYP A;  4B7K A;  2HWB 1;  2XBO 3;  5CKQ A;  1UOF A;  2EIC A;  4GMP 1;  3ZKY A;  4S2D A;  2EIB A;  5DZG A;  2HYK A;  2X5I B;  3DYM A;  1MS1 A;  1I3H A;  3ZN5 A;  5JSR A;  1JYV A;  2ILM A;  4PT6 A;  1TEI A;  5FJK A;  1HXS 1;  2OXB A;  1J1L A;  4Q4X 1;  4EN0 A;  4LBL A;  2D44 A;  4Q4V 3;  2WR9 A;  1QQP 2;  1CGP A;  1GLH A;  2WT1 A;  2Z69 A;  4C8D A;  4EV0 A;  2F6B A;  4CEY A;  3BI3 A;  4R9C A;  4HVO A;  1YYN A;  2PLV 2;  1JOD A;  3A4U A;  1H9P A;  2VCB A;  4Y20 A;  4PIZ A;  4GA9 A;  4CCN A;  2R30 A;  1OA2 A;  4AZZ A;  1WBL A;  1G86 A;  1TVG A;  2XJV A;  5FY1 A;  3S5A A;  3SEP A;  2WO3 A;  1UXZ A;  1V0A A;  3AKP A;  3LA2 A;  1FAY A;  4K7J A;  2TBV A;  4CDX A;  5HI0 A;  3BTA A;  3IM0 A;  4AQS A;  5IVB A;  4LBQ A;  2QKD A;  3CBN A;  1N3P A;  2GME A;  2W47 A;  1MS3 A;  4X6R B;  1OF3 A;  2QVS B;  1AR9 1;  2RR1 1;  1UCX A;  1XU1 A;  2RG4 A;  5A3T A;  5C7G A;  2Y33 A;  4CU9 A;  1S55 A;  2FBE A;  4ORF A;  2ZX1 A;  5CU1 A;  2VME A;  3H7Y A;  3M7A A;  4Q5O A;  4CEY C;  1PIV 3;  2KA3 A;  4BJ0 A;  5IK7 A;  1HJG A;  3GGL A;  4Q26 A;  4LNV A;  1QWR A;  5FZ4 A;  2HWC 3;  4LKS A;  5APA A;  2X53 S;  2GP5 A;  3GXU A;  5K7P A;  4D7S A;  4FFI A;  1MZF A;  3AZZ A;  1DGR N;  1LOD A;  4LA2 A;  2DUP A;  2JWP A;  1XB9 A;  1JI6 A;  4XJU A;  4YG6 A;  4N53 C;  3WQ1 A;  1JZ4 A;  3BU0 A;  4CDX C;  5FLJ A;  3M2M A;  5KWR A;  1F4H A;  5GLZ A;  3DXT A;  3BCW A;  1S4C A;  2FMY A;  4Y26 A;  4AI9 A;  5AC9 3;  4OVE A;  3S7E A;  3ZDS A;  1PO2 1;  1YFW A;  3CLP A;  4XFA A;  4QQ2 A;  4Q4Y 1;  1K5M B;  3RRD A;  5G05 L;  4NII A;  2MEV 1;  5CKM A;  2GNB A;  5FYV A;  4UW6 A;  4AHW A;  2VNG A;  1HRV 3;  3IDB B;  3AP6 A;  3CEW A;  4RGG A;  2OYZ A;  1NG0 A;  4AFA A;  3UNP A;  4Q4W 1;  4N53 B;  1G9D A;  2QUO A;  1LNS A;  4CDX B;  3WP3 A;  5J48 A;  3V0A A;  1DZT A;  1CAX B;  3ZXE A;  4L97 A;  1YNA A;  4LIU A;  4WM7 A;  3FX3 A;  5FZL A;  2VMG A;  4CCK A;  4YZ1 A;  4PCR A;  1DGR A;  2OPK A;  1B35 A;  3F95 A;  5IAX A;  5GLV A;  3K4D A;  2ZZJ A;  3NNF A;  3CDZ B;  4LO4 B;  3ZSJ A;  2E63 A;  3DGT A;  5F2W A;  4WM8 A;  4XDO A;  2JEC A;  4LK7 A;  4AXO A;  4M3C A;  3LEK A;  3WLU A;  3LIG A;  3WXP A;  2DUR A;  1OQD A;  4B4R A;  1K42 A;  2ZGL A;  4GH4 A;  1ZA4 A;  3J7M A;  5FO9 B;  1AR7 3;  5LA0 A;  1Y9G A;  1ZZ7 A;  5EJZ B;  4BK4 A;  1WW7 A;  3IT8 A;  3KWV A;  3MW4 A;  3POJ A;  4HN0 A;  2YY1 A;  4EJR A;  1MS0 A;  1BLZ A;  3I3B A;  2YGL A;  3T1L A;  2ZGQ A;  3MIB A;  3DXU A;  5C33 A;  1WCK A;  3AFG A;  1NT0 A;  1JW6 A;  2G1M A;  2BYV E;  2IFR A;  1CAU B;  2P4E A;  3FMG A;  4WM7 C;  3THD A;  5LAT A;  4DRV A;  3O1S A;  1BMV 1;  5LEK A;  4QX1 A;  2VMH A;  4LHS A;  1B35 C;  2R16 A;  3N9P A;  5BNP B;  5FR3 A;  1UY4 A;  2HKX A;  2XLG A;  3LDR A;  3VBS A;  4D6R A;  5CKN A;  1BZW A;  4Z2W A;  2SLI A;  5CVR A;  4XUN A;  4QU1 A;  2YPJ A;  3BOW A;  3GBF A;  3HEI A;  3VBR C;  2RDQ A;  5BV6 A;  1EYB A;  2WSV A;  4GH4 C;  3WG1 A;  5FY5 A;  3C2U A;  1ND2 C;  2JG8 A;  3ZFG A;  2VW2 A;  3PL0 A;  3B9I A;  2G4I A;  2RM2 2;  3D3A A;  4MGK E;  1N47 A;  2W0X A;  3T4V A;  1UIK A;  3ZVX A;  4XUP A;  1BBT 1;  3PIG A;  1OI6 A;  4JHZ A;  1RHI 3;  1IKP A;  2LTN A;  1GWM A;  4NMI A;  1C28 A;  1TMF 2;  3NAP A;  1J3P A;  3ZXF A;  2FCV A;  1RUF 3;  1VBD 3;  3BUC A;  1UKR A;  2D6O X;  2ET1 A;  2VOK A;  5D2A A;  3ZFF A;  5M0T A;  1SHW B;  3MYX A;  5FY7 A;  3URF A;  4OQ9 A;  2GMP A;  2B9V A;  2O8Q A;  3LA7 A;  3VBR B;  4CCL A;  2LW8 A;  1UZ0 A;  3VBS C;  3VBO A;  2W92 A;  2ERF A;  4GH4 B;  3CO2 A;  4IEQ A;  1Y7B A;  2ARE A;  4R4Z A;  3E6D A;  1ND2 B;  4LT5 A;  4KQ7 A;  1OC1 A;  1H4H A;  2CU5 A;  1J83 A;  3I2F A;  1DLC A;  1LOE A;  4YW3 A;  1POV 0;  4HBN A;  1EUU A;  2JG8 C;  3ZFG C;  4BIS A;  3OUI A;  3H3U A;  4I0B A;  5A6Y A;  4NPM A;  4Y1V A;  1GV9 A;  5D8A A;  1O3Q A;  4BCU A;  1NCR C;  4GWI A;  4MGI E;  4XFC A;  2PMW B;  4PBO A;  3LB9 A;  3WQB A;  4QPI C;  5SV8 A;  1FV3 A;  2JD4 A;  2D6L X;  2ZGU A;  5FZO A;  5KHI A;  3AMQ A;  1V6L A;  2Z79 A;  2BFU L;  2CDO A;  4Q1R A;  4WVM A;  1W8N A;  3AMM A;  5DAQ A;  3VBS B;  3ZFF C;  3AB0 A;  1RUG 2;  3D5O A;  5LA9 A;  1O59 A;  3PHM A;  3SCG A;  4JX0 A;  1CX1 A;  3H8R A;  3VBO C;  4LHK A;  3N9O A;  3FFZ A;  3QCW A;  3ZFG B;  3SKV A;  3ZX7 A;  4BYY A;  4CP0 A;  2XJT A;  3FZ3 A;  2RS1 1;  1NCR B;  2VQ0 A;  4AVS A;  3NJX A;  4IL7 A;  4JRL A;  4QPI B;  2RMU 1;  5D8A C;  3UV9 A;  1OXC A;  4XBL A;  2RJL A;  2Y38 A;  4P5H A;  4XHX A;  1OD5 A;  1NA1 A;  3ZFF B;  4A7Y A;  1AXK A;  4K3U A;  1MS8 A;  4AAX A;  4DB5 A;  1AR8 1;  2XJP A;  2YMZ A;  3PVE A;  3S5Q A;  3ACI A;  4DS0 A;  3PVN A;  1QJX 1;  3VBO B;  2W1Q A;  3VZO A;  4IE0 A;  4KWJ A;  3NQH A;  2A71 A;  5EHD A;  4AG4 A;  3WG3 A;  4N9H A;  4GAZ A;  3CL1 A;  4IEU A;  2VTF A;  1RUH 1;  4FT8 A;  3FC0 A;  2BGC A;  2XL9 A;  2ZGS A;  2C9A A;  4KU7 A;  1W8U A;  1VRH 1;  1E57 A;  2BNN A;  3ECQ A;  1JOJ A;  1SLA A;  4WV8 A;  1UZZ A;  3SH4 A;  1NY7 1;  1ULP A;  4HPK A;  4M00 A;  4D6Q A;  4ONU A;  1H1I A;  3I3M A;  1W3X A;  2G9G A;  1Q8P A;  2PAK A;  2ZGM A;  3PUI A;  1S0B A;  5FP8 A;  1KRI A;  2PHU A;  3NJV A;  4XQ4 A;  4Y22 B;  3M70 A;  2WZR 1;  2E53 A;  1C57 A;  3I7D A;  5IK4 A;  4Z1V A;  5FYZ A;  3HN3 A;  3KCC A;  2PFW A;  3C7H A;  4Z82 A;  3MUZ 1;  3GJB A;  1POV 1;  2WWS A;  4M3C E;  2CAU A;  4PI0 A;  3RYR A;  3WG2 A;  3WUD A;  1ND3 C;  1PO1 3;  1SMV A;  1ULD A;  4E4H A;  2O14 A;  4LO7 A;  5GZD A;  2BOJ A;  3AJZ A;  5JPM B;  2OT7 A;  2C26 A;  1COV 1;  1VB2 A;  1V6J A;  2GDF A;  1BJQ A;  1A8D A;  1ZBE 2;  2LAL A;  5ACA 1;  3H8O A;  5DDJ 1;  2YYO A;  3RWN A;  4A6S A;  3OPW A;  4ATE A;  1XNT A;  2RDR A;  5CZK A;  5FLI A;  3B5L B;  1AYM 3;  2J1R A;  2WA3 A;  2XWB B;  2P2K A;  1FOD 3;  2EAL A;  4JGY B;  1PGL 2;  3BN6 A;  1KDM A;  3B02 A;  5FTT C;  5LBE A;  3WG4 A;  2JJ6 A;  3R4S A;  5IFP A;  3B00 A;  3OBT A;  1W28 A;  1OVP A;  3AC0 A;  2ZGN A;  3QD6 A;  1ND3 B;  5CFC B;  1YQ2 A;  5DUX A;  1X33 A;  1F2N A;  3PMS A;  3WNP A;  2GP3 A;  3M1H A;  1WZX A;  3U4S A;  2WNU A;  4JKL A;  3LCP A;  1JMU B;  4R9A A;  1FMD 2;  4OHZ A;  1VAM A;  2BER A;  2OW4 A;  4OUL A;  2JDN A;  3TNQ A;  3A21 A;  1R08 2;  3K77 A;  2C4X A;  4QGL A;  4OHX A;  1LJ7 A;  1L7L A;  2W39 A;  3KGZ A;  1IKQ A;  2FQP A;  4GWN A;  4YM1 A;  3ZM8 A;  4CCJ A;  2Y60 A;  2OQ6 A;  5CFD A;  2BFU S;  3WF4 A;  4NRM A;  1A3K A;  2TEP A;  3P6B A;  1Z7S 1;  4XTM A;  5K4L A;  1XNA A;  1ZZ8 A;  3WW1 A;  2E31 A;  1LHO A;  1GZ9 A;  1PVC 1;  2HWE 1;  1W6M A;  4OZO A;  1ZBA 2;  3UYJ A;  2ET7 A;  5A70 A;  4NIG A;  4BLJ A;  3FUO A;  4TLF A;  1YC6 1;  3J8F 1;  5L73 A;  1JHN A;  5GKA C;  2WNU C;  3ENR A;  3KMH A;  3MPP G;  3RI8 A;  3VHR A;  3D82 A;  1RUO A;  2QCS B;  2QFE A;  4OI0 A;  3E97 A;  5LEJ A;  4NO4 A;  4A3X A;  1X8M A;  1RUJ 3;  2ZZQ A;  5HCB A;  5LBC A;  2J42 A;  1I9R A;  3KQR A;  3JU9 A;  4LOT A;  5FZB A;  1W8W A;  5I0U A;  2B4K A;  5H9S A;  1SPP A;  4KWK A;  2WNE A;  1VE0 A;  1AL2 3;  1S0G A;  2N7G A;  5J96 B;  2DU0 A;  5LRS A;  2DBN A;  1IS3 A;  1WW4 A;  3NNG A;  4YSF A;  2XQX A;  1VRB A;  2J22 A;  3C7O A;  3POE A;  1TG7 A;  2FD8 A;  1WD4 A;  4CZS A;  1RVF 1;  1K12 A;  1IOA A;  1WUV A;  1F8V A;  2RJK A;  2CGO A;  3CMG A;  2E7Q A;  4XFG A;  5FP3 A;  1DBN A;  1LED A;  3KF3 A;  2HWB 3;  4Y4R A;  1ZA7 A;  2Y6K A;  2W95 A;  3W59 A;  5LB6 A;  2YFU A;  4RFT 0;  4PQQ A;  4KGQ A;  1Q8O A;  4MH0 E;  4DY5 A;  4NAO A;  1LGC A;  1W6M B;  3SCH A;  1W6O A;  4HK8 A;  1UU4 A;  4OHV A;  3ZLI A;  1BVP 1;  1KS4 A;  4Q4X 3;  4O9E A;  3IIA A;  4QGN A;  2PHF A;  1AVB A;  1V6M A;  4NRQ A;  1OF4 A;  2WYF A;  4Q8L A;  4YW5 A;  5KXC A;  1LR5 A;  4XF1 A;  5FYC A;  2WQ8 A;  3RZH A;  1AJO A;  1D7P M;  4IEW A;  2ZPX A;  4FSJ A;  1OFN A;  3FFQ A;  1UIJ A;  2W9X A;  5A32 B;  1VBE 2;  1GQH A;  5FZ0 A;  1HB2 A;  4B4Q A;  2P3K A;  3MFC A;  1PX3 A;  2CWS A;  4J1W A;  1XE0 A;  3V0B B;  1V9U 2;  1SPP B;  2VG9 A;  1RUI 1;  2AEZ A; 
#chains in the Genus database with same CATH homology
 4IGQ A;  5ANQ A;  5FZO B;  4CCN A;  2Q8D A;  5FZ3 A;  4LIV A;  5FP9 A;  5F5A A;  3K3N A;  4LIT A;  5FY1 A;  5A3W A;  5F3C A;  5LWB A;  5FZ7 A;  4CSW A;  5FY4 A;  4GD4 A;  4ASK A;  4TN7 A;  5FPU A;  5FUP A;  4IGO A;  3RVH A;  5IVB A;  5FWE A;  5FYS A;  4D6S A;  4CCM A;  5FY7 A;  4UF0 B;  2GP3 A;  5A7S A;  4CCL A;  5A3T A;  3PDQ A;  5FYT A;  3U4S A;  5FYI A;  5KR7 A;  2OQ7 A;  5FPL A;  3KVA A;  5FP7 A;  5F5C A;  3AVS A;  3KVB A;  5A7W B;  5A3P A;  5FZK A;  2PXJ A;  4QWN A;  5A1F A;  2XML A;  5IVC A;  4BIS A;  3K3O A;  5FZ4 A;  4XDP A;  5IWF A;  2GP5 A;  5A7P A;  4Y3O A;  5F3E A;  5FZG A;  2W2I A;  4GJZ A;  2OQ6 A;  3KV6 A;  5IW0 A;  4CCJ A;  5FBJ A;  5FZC A;  3ZPO A;  5LY2 A;  3KV4 A;  5FZO A;  5FYY A;  5K4L A;  5FZ9 A;  4QX8 A;  5FY0 A;  3N9Q A;  5FXW A;  4DO0 A;  4BXF A;  2OS2 A;  2VD7 A;  4Y33 A;  3DXT A;  3UYJ A;  4NUB A;  5FXZ A;  3PU3 A;  5A1L A;  4AI9 A;  5IVV A;  5F2S A;  5F39 A;  4UF0 A;  3N9O A;  4URA A;  5IVF A;  5LW9 A;  5F3I A;  5F3G A;  2YPD A;  3OPT A;  5FYH A;  3AL6 A;  5FYV A;  5A7W A;  5FZE A;  5ISL A;  2WWU A;  3PU8 A;  5A7Q A;  3KV5 A;  4QXB A;  2P5B A;  4BU2 A;  5F32 A;  5FZB A;  4IGP A;  3U78 A;  2YBK A;  3PUR A;  5FPA A;  2YU2 A;  3PUS A;  5FPV A;  5FY8 A;  4HON A;  3PUQ A;  4HOO A;  4CCO A;  4CUG A;  2OX0 A;  4LIU A;  5FZL A;  4QX7 A;  4V2W A;  4CCK A;  4QXH A;  1VRB A;  5FWJ A;  4EYU A;  5F5I A;  5FV3 A;  5FZF A;  5FYB A;  4GAZ A;  5FYU A;  3PUA A;  5FXV A;  5A7O A;  5IVJ A;  5FP3 A;  5F2W A;  5FZD A;  4XDO A;  5FYM A;  5FZM A;  4Y4R A;  5F37 A;  5FZI A;  5FZ6 A;  5FUN A;  5CEH A;  4DIQ A;  4GJY A;  3N9N A;  3KV9 A;  3AL5 A;  5IVE A;  4QXC A;  3AVR A;  2Q8E A;  2YBP A;  2WWJ A;  2Q8C A;  4D6Q A;  2XXZ A;  5E6H A;  5A7N A;  3ZLI A;  3DXU A;  2YBS A;  5FP4 A;  4EZ4 A;  3LDB A;  5FP8 A;  5FPB A;  4V2V A;  5FYZ A;  5IVY A;  3NJY A;  5LY1 A;  5FYC A;  2XDV A;  2YU1 A;  3N9P A;  3PTR B;  3LD8 A;  5FJK A;  4EZH A;  2XUE A;  4D6R A;  4E4H A;  4LXL A;  5FZA A;  2OT7 A;  4QU1 A;  4C8D A;  5FXX A;  5FZ8 A;  5FZ0 A;  3N9L A;  3OPW A;  5FJH A;  4AAP A;  5FY5 A;  5FY9 A;  5FZH A;  3K2O A;  5A80 A;  3N9M A;  5A3N A;  5FZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...