2YBPA

Jmjd2a complexed with r-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybpA01
4CUGA 4QXBA 5A7WB 5FZ6A 4DO0A 4EZ4A 5FZ8A 4QU1A 4EZHA 5A1LA 5F3CA 5LW9A 3OPTA 5FJKA 5FZDA 4V2WA 4IGQA 5FUNA 5FYBA 3U4SA 3PUQA 5FZ0A 5FZLA 3KV5A 3DXTA 3PURA 4QX7A 4D6QA 2Q8DA 4CSWA 2PXJA 2XDVA 4IGPA 5FXWA 5IVJA 5IVVA 5FYSA 3OPWA 5FYTA 2OT7A 3N9PA 3K3OA 5F37A 1VRBA 5A3TA 5FZ4A 5LY1A 5F2WA 4LIVA 3RVHA 5FY7A 5FZOA 4Y4RA 4UF0A 5FZCA 5A3PA 4V2VA 5FP7A 3NJYA 3K2OA 3N9LA 4GAZA 5F5CA 5FY4A 4HOOA 5FP3A 5FYCA 3LD8A 5FYHA 4URAA 3PU8A 3LDBA 5F2SA 4E4HA 5FWJA 3N9MA 5IVBA 5LWBA 4EYUA 5FZ9A 4LITA 5IVCA 4NUBA 3N9NA 5A7PA 4QXHA 5FPVA 5F5IA 2VD7A 3AVRA 4IGOA 3KVBA 3N9OA 5FYIA 5FZHA 3PU3A 3KV9A 5A7SA 3ZPOA 5A1FA 2YBSA 5IVEA 5F3GA 5FPLA 3K3NA 3N9QA 3KV6A 4CCLA 5ISLA 2YPDA 2XXZA 4AI9A 5A7NA 4XDPA 5F5AA 5FZKA 2GP5A 5FY1A 5A3WA 5IW0A 5FYYA 5FZBA 2OQ6A 4CCNA 4D6RA 5FUPA 5FZ1A 5CEHA 4Y3OA 5FZIA 2XUEA 5FY0A 5K4LA 4LXLA 2XMLA 4DIQA 5FXZA 2GP3A 5ANQA 3U78A 4BISA 5FPBA 4QX8A 5A7WA 4C8DA 5IVYA 3KVAA 4GJYA 5FP4A 4D6SA 5A3NA 5FJHA 3PTRB 3AVSA 5FZOB 2W2IA 4UF0B 4CCJA 5FBJA 5FP9A 2Q8EA 5FY9A 5F3EA 2YBPA 3PUSA 5FPUA 3KV4A 5FXVA 5FWEA 5IVFA 2WWUA 5E6HA 5F32A 4HONA 5FV3A 5F3IA 2OS2A 5FPAA 2WWJA 4QWNA 3ZLIA 5FZ3A 2P5BA 3AL5A 5F39A 2YBKA 4AAPA 4QXCA 5FY8A 5FZFA 5FZGA 2YU1A 4TN7A 5A7OA 2YU2A 5A80A 3DXUA 2Q8CA 5FXXA 5FP8A 4ASKA 5FZAA 5A7QA 4GJZA 4LIUA 5LY2A 4CCMA 5FYZA 4GD4A 4CCKA 4CCOA 5KR7A 5FYVA 3PUAA 2OQ7A 4BXFA 5IWFA 4BU2A 5FZEA 5FY5A 3UYJA 4XDOA 5FYUA 5FZMA 3PDQA 5FYMA 5FZ7A 4Y33A 2OX0A 3AL6A
chains in the Genus database with same CATH superfamily
1TME3 4RS5B 3RSJA 2V5YA 4BHPA 3JD73 4JZRA 3ILRA 1VBE1 4GMP3 1NUKA 2QQOA 5FZDA 3HIFA 4PLOA 3USUA 5FUNA 3B9IA 3JCIA 2R041 4DRRA 1YHFA 4TLGA 1O91A 1C1LA 2WFF2 1ODNA 3U4SA 3CL1A 1U5YA 4Q4Y1 4N7UA 5J36A 1VJ2A 3M3EA 3DPRC 2VZTA 4L2NA 3GXUA 5HPOA 1X8MA 4EN6B 4WVMB 5K8SA 3N7JA 2Y0OA 3OPWA 4S2HA 4NR1A 5CFDC 1PVXA 3WX5A 5JDBA 4IDZA 2AGSA 2R043 1G7YA 2AEYA 1NA1B 4LBNA 5FBZA 4UF0A 5D1IA 3WHUA 1NAEA 4XUTA 2HWB3 4Q4Y3 2QQNA 2V72A 2PHXA 3WD5A 3WG2A 2E53A 4YW5A 3O12A 1QHDA 3BKZA 1MQTA 5FMOL 3AXDA 1RUD1 1Q8QA 1UMZA 2NZ9A 1UD1A 2D6MA 3V64A 4OI2A 1WBLA 2JKBA 2VCBA 3J7MA 1AR91 2G4IA 5T55A 3TRSB 2W95A 1RUNA 3DCQA 4NHLA 1ZNPA 4EYUA 1JYXA 3RWKX 2KR2A 5BXXA 4C1XA 3KB5A 5FUIA 1NCQB 4XZPA 3T4VA 4CDUB 2D97A 1GQHA 4HKOA 3VLBB 5L36A 4LBLA 4CCLA 3I2JA 1ZBE2 3H8OA 3C2UA 4BQ1A 5KHIA 2PHUA 3GNEA 4ZZ8A 5A7NA 4UBHA 3C7GA 4E9KA 4IEYA 3HWJA 4QQPA 3RJRA 3MW3A 1FMD1 1X50A 3POSA 3LOBA 3CZJA 3VBFC 3PVNA 1SMVA 5JOYA 3RPQA 1AL22 1O8SA 2WL1A 4DIQA 1JN2P 1JZ2A 3WCSA 2Y6GA 3CLPA 3OGJA 2ARAA 1ZRDA 2P6HA 2HBTA 4JCKA 1TMF2 3AVSA 2RS32 4QKNA 5I0TA 2CY6A 4A44A 4M3CE 1AX2A 5HXVA 4S2GA 5JOZA 1V6LA 1E5SA 1Z0HA 1FMD3 2MEV3 1H4HA 4YZ3A 4LE4A 5A32A 1Q43A 3KV4A 4OQ9A 3WHTA 3KT1A 4I02A 4HKLA 3DN7A 1AUYA 1Q3EA 4WM7C 3S5AA 3PJQA 1V6JA 1NQDA 4RSUA 5K9YA 3VBRC 2YU1A 2ILMA 1EV13 1R1A2 4XQ4A 5A7OA 2UY9A 3ETQA 4UFHA 1XNAA 3CJIB 3M4FA 1C8NA 3MICA 4OI0A 1V6KA 2X05A 4L11A 2AYHA 4RQPA 1LHNA 4EN7B 2XUMA 2P3JA 4XFFA 1G86A 5E8AA 1LRHA 1SDDB 1PMJX 1C5HA 1SLTA 3O0XA 4RGGA 2A75A 1V6OA 5DDJ3 3ES4A 4LBMA 4M3CA 2WAOA 3LAGA 1B35B 2BERA 3AJZA 3PLQA 1ZRFA 3N4MA 1RHI1 3I2KA 3KCXA 4Y33A 5IFTA 3VBOB 4YG3A 1QQP2 3ACLA 3PVBB 5HCBA 1HDKA 3NNMA 4Z2AA 4OZXA 1NKGA 2FCTA 5A70A 5LBCA 1WLCA 1XRUA 3NVCA 4AEMA 2YB7A 4YM0A 5JOXA 2ET7A 3LB9A 4R9DA 1PNGA 4P9JA 1F5FA 3ABZA 5FZ0A 2BJSA 3KV5A 3VBSC 5HCAA 5GJ6A 2JG9B 3TAYA 5F6LB 3VBHC 1UXZA 4BJ0A 2A6ZA 1FOD1 1WLTA 4IE6A 2Q8DA 2OKXA 2X29A 4TWTA 1ULDA 3TB0A 2VZQA 1POV0 3D8CA 3DKWA 3IN9A 2C1FA 3PJYA 3TNPB 4LMFA 2VECA 3RVHA 3WXPA 3POYA 2VZ3A 4UFJA 3D6EA 2ZEZA 2YG0A 4UFKA 2XBO2 4Z8BA 1SPPA 1OOPA 3CIHA 1R083 1UCXA 2VMHA 2IXIA 1AR81 3MLKA 3POGA 5HCFA 1PIV2 3LD8A 4N43A 4U2AA 1YJLA 2ZGKA 3VGIA 3JXSA 1AX1A 2TEPA 1X9PA 2HKXA 3I54A 3CBNA 2ATFA 3JBG1 1BZWA 1KJLA 4BIOA 4XJAA 3AKQA 1PGW1 1H2KA 1OA4A 1UOBA 1CAUA 5A7PA 2WZPP 3ELNA 1CGPA 4FFGA 1W9SA 3LGRA 1CD3G 1N3PA 1MVQA 2TUNA 3K48A 5SV8A 3VD3A 4CU6A 3LE0A 1J1TA 2VPVA 1GQGA 3MGUA 1ND3A 2GC0A 5I0UA 4MSVA 1W0PA 5GZGA 3GALA 4PHZA 5H9PA 5FZ1A 4INDA 5FY0A 4GWJA 1ZM1A 3BTYA 1RC6A 4IESA 1IG0A 3HVDA 3C7HA 4QX8A 2OIIA 3MI8A 5HV4A 1BCXA 1PVC1 4GB32 1HN1A 1ZBA2 3DPRB 2BP6A 1UX7A 4KU8A 2BBAA 4MUVA 1ULEA 4Q27A 4HFSA 1RUH2 3RZKA 2E63A 2IFRA 4AI1A 4FXGB 1AR61 2BGCA 5F9TA 5CFDB 4NPRA 5FLIA 4AHWA 1LKNA 4JQRA 5DAXA 2A6XA 4HVRA 5FPAA 5LB6A 4AAXA 3ZFEA 3O1SA 3FLPA 5DAVA 2VUDA 4CU9A 1PVC3 1Y4WA 1HRV1 1OF3A 4CPBA 1SG3A 1JYCA 1RUJ2 4FQZA 3I97A 4QX2A 1LOCA 2WQ4A 4JTNA 4OHZA 4YSFA 4PCRA 3W5MA 1AR63 1FV3A 4GQ7A 4LORA 3INAA 1X7NA 4BM8A 4CCOA 3WEZA 1W8HA 3WNMA 3SHRA 4B29A 3FMGA 3LZZA 4HZFA 5FZMA 4AFBA 2B9VA 2Y8KA 3M1HA 5FZ7A 5CFCA 4ZU4A 5D21A 1RUE2 4LR4A 1OI6A 1DP0A 3NJVA 5FOJB 3S7EA 1JBCA 3LWCA 4QDSA 1IQDC 2EIDA 3UESA 3ZIXA 4LA3A 2D3SA 5FMOS 1BYHA 4ZONA 2O0OA 3FZ3A 3AP5A 1LOEA 4K21A 2QQIA 1UMIA 1XE0A 5FYBA 3VBFB 2XLFA 4XJUA 1RXFA 1RVF3 1H2LA 3WW4A 1PZ9A 5BNOC 1QJX1 1YQ5A 3RYKA 2XH6A 1UYYA 1QMJA 4NROA 2VZPA 1EYBA 2FDGA 1N3QA 5ACA1 2Y38A 1LCLA 4JGZA 3LA7A 1NYWA 4EN0A 4TTGA 5APAA 3RI9A 1V9U1 3ZFGB 2HWE1 1ZRRA 2VOVA 1NZIA 4AFCA 2DFCA 2WS92 5JXJA 4Y5TA 3K2OA 3WQ7A 3FN9A 4O61A 1QJX3 2R49A 3NKTA 5FY4A 4B3NA 4WM7B 5LRRA 5KWRA 2RR12 5EFUA 1VAKA 3HOBA 1NE6A 2QDRA 4GWMA 3VBRB 3N7LA 2WA4A 4I30A 5LWBA 3AMQA 1V9U3 1NOVA 3M2MA 4QHZA 2HWE3 3FHAA 1W8ZA 3HR9A 5EQUA 3WG4A 4RHV2 1CPNA 1RMU2 3BN6A 4LO6B 1J3RA 1LULA 3GHMA 2DBIA 4QM9A 1XU2A 1VBD3 4FSJA 3N9QA 4Q4V2 1Y9GA 4QGLA 1F4AA 2VU9A 2GH8A 3RZLA 1XQNA 3GJBA 1BLZA 1QJY2 3WF4A 1POQA 1CX1A 1UYPA 3W58A 1S4CA 5A6XA 1R093 1W2AX 3B94A 1HXS3 4FXKB 2E33A 1XOYA 1XSQA 1XBFA 2RM22 1HQNA 1VMJA 2XMLA 5LZ6A 5I0RA 2YC0A 1PX4A 4RS5A 2ZEYA 4X6RB 4Z1VA 3JUUA 4LK6A 1YQCA 3HQUA 3WW3A 1K12A 5A3NA 2GH2A 1RUF1 2QZ2A 2W2IA 1RJ7A 2KA3A 2ET1A 3ZXDA 5FO8B 3VBSB 1RB8G 1J1LA 3I49A 1LECA 3MIEA 4V1PA 2JENA 4N53C 4XUPA 2DURA 3VBHB 1Q8VA 5B4NA 2J42A 5FPUA 4YW1A 3ILFA 4L99A 1XC6A 4WVMA 2K2SA 1OD5A 4Y1ZA 5T52A 5DUXA 4LA2A 2GAUA 1QH6A 2OS2A 4PJYA 5KHJA 4FAHA 4META 4P08A 1RUF3 1AYM2 1ENXA 1KJRA 2ZX3A 2JDAA 3CU7A 3OEBA 1NA1A 3LF7A 1KS4A 1RIRA 2GDFA 1OPOA 1LU2A 1X33A 4K8FA 4NJ4A 5LBBA 2HWD1 1OFNA 1WCQA 4QKBA 5IUQA 1NE4A 5FP8A 4PDWA 4DOUA 2XB6C 5C3QA 1ODMA 2DTWA 2WNUC 2QQLA 4HKWA 1BBT1 5FYVA 1H8TC 1Q8SA 3AYEA 4B1LA 3CNAA 1RUG1 4OZOA 3MIHA 4YPJA 4IERA 3NMBA 4LT5A 3HN3A 1ULGA 2Z79A 1NCQA 1W3XA 1LOFC 2DUQA 4CDUA 4QXBA 5HCHA 1EUTA 2P6CA 1JYWA 1S0EA 5A7WB 2BWCA 2VW1A 5FZ8A 2PHDA 3T2TA 1YJKA 4A2UA 2MPFA 4EZ4A 1YWKA 4LK7A 4FI9A 3ZVXA 1AR73 4CYDA 5KXBA 3NQHA 1BBT3 2HYKA 4ISRA 5A6YA 3L9JT 1LEDA 3C7FA 4FPHA 1WCKA 4N8MA 1GZ9A 2QQKA 3KCCA 5T54A 4Q1PA 4CP1A 4JAAA 3AC0A 4FO9A 1K5JA 1HRI3 1GWLA 3BI3A 1YXWA 1EAH1 4JDMA 4M00A 1LGCA 4D6QA 1OT5A 5E1RA 3W59A 4OCTA 4AQ6A 1UY0A 2HWC2 1VRH1 3K3OA 3URFA 3JB4C 1PGSA 1E5HA 4DINB 3VDCA 1O59A 5J1XA 2V09A 3AMNA 4NPMA 4Q26A 1MZ5A 3D5OA 5IATA 3O1TA 2WNOA 1W05A 4AQTA 3NO8A 4HOOA 5FP3A 2C6SA 1MACA 4IE5A 4MGKE 3VKOA 4BMEA 4KWJA 4ZU5A 2GN3A 3SCGA 1VRH3 1HB4A 2PLV1 4AF9A 2VUCA 1UMHA 4FOWA 5G05L 5IVCA 2NLRA 3K46A 4QGMA 1YC61 4XYXA 5F5IA 4JQTA 3NAPA 4IGOA 5IK5A 5FZHA 3WDXA 3CEWA 1Q8OA 5FPLA 3K3NA 4ZS2A 4AL9A 4B7EA 4HN1A 4WV8A 1W9WA 4UWDA 2GZWA 4CEWC 4W6XA 2A7AA 2ZJCA 4I0WB 4M4RA 1URXA 2YFZA 4L92A 2OQ6A 2PTMA 2PLV3 1H2NA 1AVBA 3T2PA 4YW6A 5BNNC 4RQPB 1B35A 1HX6A 3ZKUA 2VO5A 1MS0A 4MGYE 1D2QA 1Z7S2 5ANQA 3VBOA 2QKDA 1PX3A 3B7MA 2BWAA 4HK9A 4XCAA 3I2DA 4M3CB 4H55A 2VQUA 4D6SA 5T5PA 1Z78A 3O1PA 4XZUG 1JU3A 5JIAA 3UKNA 2PAKA 2WO2A 5BNOB 3H1YA 1FV2A 2WR9A 2XJQA 4ZKTB 2AUYA 2CAUA 3LIGA 4C0HA 1DU3D 4Z2WA 4AWDA 1S0JA 3B5LB 3J8F1 1SBFA 2LRPA 2JG9A 1W8NA 2WSUA 4Z82A 5JPMB 3THPA 2XL9A 1MZEA 5F3IA 1ZZ9A 2VCAA 5J98B 5BV6A 2JE7A 4MHUA 4DB5A 2RDSA 5FMCA 3M3OA 3QLQA 2ID4A 4NRPA 1TNRA 4TN7A 2YZ4A 2DBNA 3ZDSA 1ZBE1 1LNSA 2FCUA 4UW5A 4FPKA 5HXMA 5DAQA 1W0OA 2W9XA 5FZAA 4DFSA 3U4XA 5L9VA 3GBGA 3J8F3 2PHLA 2DVGA 5IT6A 3C7OA 3OSDA 4CCKA 1C8M3 1KRIA 2XLGA 3PUAA 1F2NA 5AC92 3VDDA 4BU2A 1V70A 2W1WA 1SPPB 1QJZA 3UYJA 2WABA 5J37A 4Y5SA 4Y1YA 2Y33A 5I8YA 2HWF1 2Y34A 2ZAHA 2VC9A 4OMCA 5C71A 1YI9A 2BNMA 4W8JA 2RS31 3SH5A 4LUKA 1AXKA 4Q4W1 4XABA 4DMIA 4AEDC 3O1MA 4M0HA 4R9CA 5FTTC 5CU1A 1ULFA 1ULCA 3KZ4C 2WZR2 3MW2A 3C3VA 4XC9A 2P17A 1RYYA 4I3PA 3WQ0A 2DVFA 4HETA 3U14A 1NT0A 4Q0VA 4Y1UA 2HWF3 4E8DA 2Y6LA 1NZCA 2B46X 2C4XA 2CWMA 2HEYF 5FXWA 1BMV2 1GOGA 2RS33 2PHTA 2VH9A 1R1A1 1J83A 2OVUA 4Q4W3 4IE7A 4N53B 2DCJA 4WM8C 4XUNA 1RL3A 3LSDA 4DY3A 3DPRA 4XMAA 1AXZA 5CYYA 1WWYA 3N9LA 3HBZA 2XLAA 2VUJA 4Z92B 2LUWA 4MXWA 4QB2A 5FYHA 2ZTNA 2C9KA 5CFDA 3ZYRA 2WYFA 3SXWA 2UURA 1U5ZA 2BRTA 5L7OB 3B3QE 4ZHNA 4OUMA 2WNUB 1X9TA 1VIWB 5FYIA 5C4WC 4O7XA 5A1FA 5IVEA 1ENRA 1RTVA 2DVDA 4LULA 1H8TB 3KV6A 4D69A 4TYSA 2DU0A 3A7QA 3T0AA 3DYPA 5I91A 1XB9A 1ZVFA 5JXHA 4HLTA 4P9YA 2HLEA 2XVKA 3WUDA 3HPNA 4HT1T 4FOVA 3H50A 2WC2A 3LKJA 4N90A 3EYPA 4CCNA 3V56A 1CAWB 4OMDA 2CGPA 1Y3TA 2Y0IA 3OD0A 5K4LA 2P4EA 3ASIA 4BLIA 3U78A 2OW4A 4IL7A 2BFUL 4BISA 1OSGA 2IXCA 4KNCA 2P34A 4CUAA 5CKNA 4C8DA 1W9YA 3WW2A 2DUOA 4XF0A 3ZM8A 3AZYA 5CAZA 3NV3A 2JB4A 5LA2A 1J58A 1FXZA 5FQ0B 3VBFA 1PIV1 3LSEA 1G9CA 1IPKA 4JTOA 1UW8A 2VBPA 1S0DA 1WCSA 2UYAA 3D3AA 3IDBB 2VOWA 4BDVB 3SC7X 4I09A 2VNGA 4UFLA 3WDYA 4RGAA 1K45A 2IXHA 1JW6A 2VW0A 4NHKA 5IK7A 3CMGA 3UKVA 2GNTA 4YRDA 1YQ2A 1T2XA 5JZGC 3SNMA 5I8SA 2R062 1OA3A 1JZ3A 3ZXKA 5LEKA 5FKCA 4WM7A 3AXEA 5LY2A 1VBC3 3HQRA 2G19A 1S55A 2IC1A 1VBB2 1TZOA 4GA9A 2VNOA 4HVOA 3VBRA 4LUMA 3D0SA 4JHTA 4ARYA 4XAEA 1W0NA 5FK8A 4DY5A 1UKGA 3VD9A 5FOBB 3OUHA 3T0DA 1UY4A 3POWA 4XHBA 1PMIA 5T50A 4O9GA 4ITCA 2FBEA 3BPZA 1AXYA 1GP6A 2JD4A 4BZ4A 5DAWA 4N7IA 3UJQA 5EZWA 3VUOA 4XQDA 3VL8A 5BNNB 3ZXAC 1V00A 1Q5OA 3TYJA 3R4UA 1DCSA 1JOPA 1C5IA 3VD5A 4DXTA 3ECQA 2ZGQA 3NV1A 3PUQA 4BK5A 4CEYC 4AGRA 2CGNA 1SCSA 1IPJA 3LFIA 4MGSA 2GU9A 2DYCA 1VR3A 3TN92 1VLNA 1SDWA 2PXJA 2ZABA 4IGPA 1DQ6A 1UKRA 4KL1A 5DZGA 1RUJ1 3W5NA 1CJDA 2WT2A 2WA3A 1VRBA 1QNWA 4MVTA 5J3UA 3H8XA 1PO23 3MV01 1F35A 5FY7A 3VBSA 1GUIA 2ZGMA 1L3JA 4J1WA 3VZNA 2GNDA 3VBHA 1D4M2 3MIFA 3Q9OA 2ZGOA 2D44A 1MZFA 4YVSC 5KBFA 1OLME 2VR4A 2R16A 3WZ1A 4DXSA 5C3RA 1W06A 4UYBA 2YY1A 4YW4A 3LDBA 2EXHA 1CAVB 3MDPA 1RUJ3 3OEAA 3AKPA 4PI2A 4E4HA 4GWNA 3AZXA 4E27A 2XHKA 3AKTA 2MHFA 1HW5A 4NVPA 4LITA 1FT9A 4COUA 4N9HA 2BYVE 1AL0G 1WUVA 2ZZQA 4LNVA 5EJZB 1ND2C 4FAGA 1APNA 4IQPA 5A3PA 4MXVA 1RINA 4OQ8A 1DGRA 1VBE3 2I74A 1FNYA 2ZOEB 2Q1ZB 1O4ZA 4W4ZA 4COZA 3BGAA 2YPDA 1S2KA 5LBFA 3BIWE 4LO5B 3VZJA 3M3QA 1I1EA 4I2OA 3AMHA 2O14A 2W47A 5CZKA 4PDWB 3B9CA 4NWWA 2ZX0A 5K7PA 2XUEA 1JXNA 1IOAA 2A73B 4KQ7A 4QX3A 5FO9B 3ZSEA 1KGYA 1BEV2 1OURA 2O8OA 4X8NA 5A7WA 1F5JA 1NXMA 3GBFA 4NIGA 4BMBA 3G7DA 5T5OA 2WN2A 2JX9A 2WS91 4M0NA 4TLFA 4Y4YA 4LBQB 3SISA 2RS11 5FY9A 1GV9A 3BOWA 3GGLA 2YXSA 3UGFA 3THCA 1I5PA 3J7HA 4CP9B 2PAMA 4HXCA 1RUD3 3B93A 3OY8B 4OUEA 2VE1A 5I8TA 3D0JA 4XIOA 2I45A 1PM7A 1AR93 4WM8B 2D93A 4AGGA 2VXRA 1UY3A 4RHV1 1RMU1 1X82A 1W2NA 1XNCA 3E5QA 2ZACA 3I3BA 2VVEA 3BU7A 4PLMA 2RS13 3IIIA 1A8MA 3OD4A 3DXUA 5FXXA 2ETEA 3F95A 3SITA 1QJY1 5GLVA 3EJKA 1POV1 4FP2A 1D0HA 3V0AB 1MS1A 5JSOA 2NMOA 4LJHA 4OVEA 2ADDA 1X36A 5EPAA 5KHGA 1D4VB 1UZWA 1RMU3 4RYDA 4UT5A 2UU8A 4FPJA 2RVAA 5C4WB 5FYUA 2VZSA 4FPEA 4JDNA 4AEKA 2NQYA 3NNGA 2IUWA 1UY1A 3G6JB 3MFAA 3WNKA 3KGLA 4R9BA 3AX4A 1NLSA 2JDMA 2UY8A 1W28A 3AZWA 1XXNA 2K9ZA 3WF2A 4QT6A 4XW3A 5K0UC 1LHUA 3NAPB 1JZ7A 4CDXC 1GSLA 5F6KA 4ISQA 1OVPA 1CZSA 4ES9A 1NLQA 1G6NA 3PL0A 3B01A 2QQJA 3OYWB 3Q8FA 4XF3A 2RS52 3LEMA 1AYM1 1S2BA 2WN3A 1MR5A 2EA7A 4FOQA 4IEVA 1CN1A 5F37A 3UKTA 2CSGA 5FZ4A 3ZDVA 1QOSA 1H2MA 3NJXA 5A6QA 1REDA 3WF3A 4AHXA 4B8EA 5BNOA 3MUZ1 4G4FA 2FD8A 4IEPA 1UU6A 5GZCA 4GAZA 2P37A 3VHRA 4H14A 4BIFA 1ZZBA 2XKPA 3HEIA 5JAXA 1C4RA 1LB2A 2FDKA 3RQ0A 4CZSA 5BYNA 4AFDA 2W08A 2BFUS 2VCCA 3MYXA 1IHMA 1PZ8A 3IKWA 5T5JA 1PGL2 5A3UA 4ZZ5A 5L73A 2B9UA 1L7LA 4A3XA 2E7AA 5ABJC 1RHI3 1G9FA 2ZKNA 2XJTA 2JICA 2Y6KA 3NNJA 4NUBA 1QJU2 2ZEXA 2Z2SB 3R6SA 2R7EB 5C8CC 1JS9A 1N1VA 1AYN2 3LEIA 1UNBA 2B45X 5ISLA 4F3JA 3KT7A 2UYBA 2BV4A 4K8RB 2AZ5A 1ASJ2 1KFUL 4QB6A 3A4UA 3IWZA 2GSYA 1LAJA 1W2TA 1WLWA 1VPHA 4AHZA 3O1UA 3B00A 5FUPA 1IKQA 1OH4A 1PMHX 2Q4SA 5FZIA 1BXHA 4CXXA 2HWC1 2DU1A 5F8PA 4G9SB 1FOD3 2OXBA 5FPBA 3P1IA 5EV7A 4S2DA 2W87A 3VDDB 3WP4A 1MPXA 3SH3A 1JU4A 5FLHA 4CEYB 3I2IA 5JLVA 2WQZC 4KG0A 3ENRA 2JDPA 4MO3M 2VMGA 1YLLA 2YBPA 2DF7A 2VOXA 1AR83 1RGSA 2ZA9A 3E6BA 4YM1A 5D2AA 3I3MA 1O4TA 3ZYPA 1SLBA 4AK3A 5FCCA 2CDOA 2A6VA 5FV3A 2ZGLA 3OF1A 1Y9MA 2VZVA 3LOIA 2JXAA 3JBG3 3SMHA 3WT3A 3LPFA 1MEC2 4HL0A 4IE4A 4ASMB 1GWKA 2J22A 1COV1 4XFGA 2JDHA 1EY2A 4Q4X1 4N53A 3SKVA 1CIYA 4MV2A 4YVSB 2OA2A 1HN0A 1LHOA 3JQWA 3L2HA 1J84A 2WYSA 5FLJA 3EO6A 5FPZA 1TNFA 3ZSLA 5FPXA 1EP0A 1UIKA 4GH4C 3IDEA 2H6BA 3MW4A 4GD4A 3PIGA 4ZPIA 4AVVA 5KXCA 2ORXA 4OHWA 5L9BA 2ZGSA 3FL7A 5CG9A 5L7OA 4NN0A 1ND2B 4LO4B 2YMZA 1COV3 3WOGA 2NN8A 4Q4X3 4BOWA 4XDOA 1JODA 3PDQA 4LO8A 2OUHA 2D6OX 4I01A 4Q0UA 5FYMA 1BQPA 5HV0A 1CIWA 4MXWB 3H3LA 5F3EA 2WNUA 4WVZA 3LFMA 1SCRA 1XYNA 4QPGC 1V6NA 2WJSA 1E57A 1OC1A 2WFPA 1IG3A 1H8TA 2OZJA 3RZGA 2DV9A 5LASA 1UOFA 1IZ3A 4HPKB 3J7NA 2D6KA 2YROA 4XFCA 1MVEA 3CDZB 1XE8A 1LOFA 2YUEA 1CAWA 3T08A 2RJ2A 4C0BA 4Y1XA 1RUC1 2ZPXA 5FJHA 2RMU1 4QKFA 5IFPA 1XNTA 2PN5A 4BQ5A 5IHRA 1TME2 4HN0A 5BY5A 4EWEA 1HRV3 3JD72 4XJWA 3WDVA 4I0BA 2VGDA 4X8PA 4QQLA 3RZZA 4E2SA 5FQ0A 1TQ5A 3TEXA 1GANA 1ZA7A 2B7YA 1YUDA 5AC91 1RUC3 4R4ZA 4D3WA 2RMU3 1DF0A 4F8AA 4C90A 1PK6C 3TBDA 1W2UA 4AVBA 2YFUA 2HEVF 2WO7A 3RRDA 2VW2A 5CVRA 3FWEA 4DZGA 4Y24A 3OG2A 3MPPG 3QH6A 5D8AC 3I2HA 5FFOC 5JR2A 3FE5A 5C3PA 1XU1A 1GZTA 4SLIA 2D7FA 3R0RA 2P3IA 2R042 2Q1FA 3ZXGA 1W6PA 3FHQA 1M06G 2Q0AA 4FQ4A 4WZCA 4Q1RA 2HWB2 3WNOA 1N47A 4Q4Y2 4EN8B 4EWDA 4FCAA 2WZR1 4MX3A 3IZOA 5C6CA 4Q5OA 1BK0A 1H9PA 2ZBJA 1VAVA 2DTYA 2VUAA 4Y22B 5CEHA 4DUXA 1LGBA 4L8QA 2CWSA 1HB3A 4HBNA 1OQDA 2SLIA 5EWSA 2DFBA 2N7GA 2XQRA 2VNVA 4DUVA 1AJKA 5ACA3 4YGEA 3ORJA 4BQWA 4NAOA 1RUI1 2ES3A 2BGOA 2QBXA 4GJYA 4ZS3A 4CUCA 4XQWA 1R64A 3H0OA 3IMNA 5BPXA 4CDXB 5K0UB 2LS6A 5BNNA 1GKBA 4U36A 1MS3A 3ATGA 3HT2A 3WNXA 4JVAA 4XJ9A 4FPGA 3WP6A 4HVQA 4LBJA 3KHCA 4FP3A 2W52A 1KEXA 5JMCA 3UNPA 4KH9A 5LA9A 2V73A 2LM3A 3RI8A 1JYTA 4QPWA 2ZGTA 1LOBA 1UU5A 2HEWF 2TBVA 2PHWA 4QXKA 4BPZA 1UWWA 1LEMA 1RUI3 2JIGA 3AP7A 3O5SA 3WCRA 1UXXX 2BW8A 5BUVA 3KQ4B 2WNVC 5GKAC 5F39A 3P3NA 2CU5A 3IAQA 4PF5A 2LROA 2EVXA 4LPLA 4JHZA 3JB8A 4Y20B 1UIJA 5C7GA 4IV3C 1PNFA 1I6XA 5DUWA 5DABA 1A6CA 4YYOA 3ZO0B 1CZVA 2GC2A 3MV11 1FMD2 2ARXA 2MEV2 4LEJA 5J96B 1C28A 1CX4A 4Q29A 1CAVA 5C5TA 5ABJB 1OKQA 3LA3A 1YQ6A 3FLTA 4COVA 1KITA 5C8CB 1YQ8A 5A33A 3GDBA 4MZUA 3JZVA 5DZEA 3RMYA 4JV4A 4LKSA 3IMMA 4DO0A 1EV12 4CTEA 1QKQA 1YIPA 1MS4A 4EROA 3OPTA 4V2WA 2QE3A 1WMFA 3AB0A 2ZHNA 4PIYA 5KHKA 2XJPA 1J3PA 5L19A 4TSVA 3O1RA 4OFGA 4DPNA 1US3A 1DGWA 4QPIC 5IK4A 3FBMA 5DDJ2 2D6NA 3DXTA 3TEZA 2X5IC 3MIDA 1HB1A 4BH9A 1VBA1 5CKMA 5FYSA 4AEDA 1KS5A 2IFWA 3H7YA 4CDWC 3OBTA 2R061 5F2WA 4LIVA 4HSLA 2VVFA 5FREA 3ZR5A 4BQXA 4YZ1A 3V0BA 2XGXA 1EUUA 2B42B 4Y4RA 4LBQA 4CXYA 2HWD3 2R32A 3FUQA 5CG8A 1S1AA 2E6VA 4CP9A 3NW4A 3P3PA 4XPVA 3OY8A 3RYPA 1Y43B 1VBA3 4KGQA 3AMMA 3K4ZA 3PU8A 2XKOA 1QU0A 1OLQA 4KG8A 4CXWA 1KDKA 1RUG3 4WM8A 1UZZA 1QEXA 4RFT0 2A6WA 4UW3A 1FPN1 1DDLA 1CPMA 4XMIA 3U37A 4QXHA 2J1UA 4BE3A 1NCRC 4GH4B 4HSJA 1D0GA 4YGCA 5F3GA 1QNYA 3MLLA 4XDQA 3V0AA 3BU0A 1FAYA 2LW8A 5LA1A 1R082 4LHNA 2YC2A 1JYVA 2BPA2 2R071 3MO4A 4OI4A 5FYYA 4K20A 5JSPA 2I07B 1RITA 2WBKA 1FPN3 3PNAA 5C4WA 4L9BA 1SLCA 1ZZ7A 4FFHA 3ME2A 4QPGB 4W6WA 3W9AA 5BNPC 1EAH3 1VALA 1OPMA 3WUCA 1H0BA 3B02A 1H9WA 1ZZ6A 1YFXA 5IJRA 1WMXA 4D7YA 3U07A 4MOAA 3HT1A 2VTXA 2VVDA 4QX1A 3AP9A 2B4KA 2JDUA 2Y60A 1NY72 1JHNA 1W8FA 1ALYA 2E31A 2R073 2YHJA 4OLLA 3SKJE 3I2OA 3VKFC 4OHVA 1UPSA 3F2ZA 4P02B 4XVHA 2VMFA 1QXRA 1SFYA 3EBRA 2HJIA 5JVVA 2WFF1 4LE3A 3OYWA 2Q1MA 2CL2A 2ZKLA 4FT8A 4PI0A 2F4PA 5F32A 3T09A 5KC6A 3TEWA 4UFMA 5GLUA 3VKLA 3TOJA 5FZ3A 1J3QA 1SQ4A 5T5LA 5B4XA 5FZFA 1UPIA 4RR3C 4UW6A 5FZGA 5LATA 3PMEA 1WW5A 3OBRA 4YM3A 4LBKA 4QB1A 5DPNA 3WNLA 1PK6B 3NV2A 5DG2A 3MBWA 2WFF3 1WCDJ 4GJZA 1NLRA 1CQ9A 2JECA 3QD6A 5D8AB 1AJOA 2A70A 1UN1A 3HBKA 3LDKA 3NSTA 4QQOA 4NRMA 2WINB 5JZGA 5TSWA 1WD3A 3ZX7A 1BEV1 1WW4A 3X29B 3T1LA 5KHHA 1REEA 1PVC2 1S0IA 4E4SA 1GU3A 3T0BA 1F9KA 1VMHA 1ENQA 5FKBA 5A3OA 5C33A 2NP0A 4AW7A 5GLZA 2KD7A 1AR62 5IK8A 1OFSA 1STMA 3MHZA 3RMXA 2JDZA 1W6QB 1W6MB 2DDUA 2XVGA 4C1WA 4B7KA 3PURA 3EXUA 2XDVA 5GM0A 1FX5A 3DF0A 4YVWC 4A41A 5FYTA 3N9PA 4MGIE 1AL21 1H30A 4JKMA 1N1SA 4CEYA 3A0NA 1YFUA 1GOFA 1PHMA 3ZXLA 1ZRCA 2Q30A 1I5ZA 1ZBE3 2K0GA 1LENA 5ERLA 1ULPA 1TMF1 2RJKA 1UO9A 1UZYA 1WMDA 2D98A 5GALA 3VDAA 2QQWA 3WDTA 1RVF2 2W1QA 2WNVB 2ARBA 5J09A 1H8VA 5FRAA 2C24A 2WSVA 1XNBA 2ZGUA 4WVVA 5GZFA 2ARCA 4LHKA 1AL23 3D4KA 5J7MA 3CKHA 3AK0A 4OYUA 3WNNA 4FPYA 1IPSA 1VAMA 4IV3B 2GNMA 4YVSA 4YZ2A 3PU3A 1V6IA 2FCVA 1TMF3 1W9FA 2UWBA 3WW1A 4D7SA 1SBDA 3MUY1 3KQRA 1GZWB 2J1SA 5JPNB 1K5MC 4MGTA 4M4PA 5FZKA 5FY1A 4ATEA 5AFBA 1NG0A 1GMMA 1OQEA 1A8DA 3ZFFC 3K75B 3GZUC 1ND2A 5E16A 4XFIA 3LCPA 2F6BA 1ONAA 2XJUA 1IKPA 2AACA 3AYCA 1V9U2 1XJAA 3USSA 2HWE2 2G9GA 3IDCB 1WW6A 4IV1C 5JCTA 1JUHA 2RJLA 1R1A3 1N1YA 4QMAA 4R52A 1VBD2 2D43A 3PVEA 4QPIB 3BODA 4XILA 3T3YA 3UETA 1UOJA 4HPKA 1QQP1 2X5IB 3RGBA 5AVPA 2VTFA 2DCTA 1R1ZA 1LOAA 4XF9A 3ZOIA 3PUSA 2QVSB 4BK4A 5JWPA 4CDWB 1R092 1HXS2 4FVVA 1YI7A 2BGPA 2Y64A 2WWJA 5EYYA 3ZLIA 4NHXA 2P5BA 3ZSJA 1QJU1 3BTXA 4MG2A 2PHRA 2W91A 3E5UA 1QQP3 3A22A 3QACA 4NPLA 1AYN1 2FMDA 4LKDA 4CCCA 3IAPA 2WIIB 4DXZA 5A7QA 2WO1A 5J48A 5JOWA 1OUXA 2V5DA 1XNKA 1LU1A 4HMZA 4EWAA 2XBO1 1YYNA 5C9AC 2XOMA 3AYDA 4P5HA 3W21A 1QDOA 2EIGA 5IWFA 1QJEA 3WVJA 1NCRB 1SLAA 3TWIA 3AFKA 5E88A 2VY0A 4JGYC 4H7LA 2C0ZA 4DEVA 2VZ1A 3VD7A 1RUF2 2PQQA 3GCWA 1C57A 3HN1A 2E7QA 2H6CA 3CJIC 1S0CA 2PELA 1ACCA 2QNKA 4IGQA 4QX5A 5FAXA 3ROUA 2XBO3 4XUQA 1JOJA 5BNPB 2QQVA 3PUIA 4KI5M 2ENRA 1PIV3 1Y9QA 4COYA 1W6PB 4D94A 2VMCA 1SFPA 2JDNA 4URTA 4Y22A 1OD3A 4QHOA 3ZR6A 3I7DA 3THDA 3LPGA 2J1AA 1HQWA 4LKEA 3FHIB 1SZBA 3SEPA 3VHOA 5IVVA 3VZMA 5JIUA 1TVGA 2QZ3A 4BLJA 1OXCA 1KXGA 3FBYA 3J7LA 3JQXA 3MLJA 3P6BA 5K0UA 4AGVA 5FIXA 4AHYA 4A7ZA 4CDXA 1L7QA 2JDYA 2WWSA 2O8QA 4CE8A 4ET7A 1RUOA 1UU4A 1GNZA 1NQJA 3QH7A 1AR72 1XPWA 4AYUA 2ZS6B 1O5UA 4LO7A 4F83A 1BBT2 3JU9A 2VQAA 2A3YA 1IS6A 3RWNA 3C8XA 1CJPA 2V4VA 5JI7A 4GB31 1W6NB 4XFAA 1ZBA1 3KWVA 1L7RA 1HRI2 3OGVA 5L9RA 1RUH1 2EIEA 1GLHA 4RR3B 4M3CF 1GNYA 4AR2A 1GICA 1GZCA 2EIBA 2YDEA 2Z69A 5FZ9A 4CCDA 1U5IA 4IW3A 3KF3A 3IT8A 4XE9A 1G9DA 3KV9A 2HYXA 3WDWA 4Y20A 3V65A 3HD8B 4GB33 1TEIA 3IPVA 1YFYA 1W90A 1ZBA3 3MIBA 4EV0A 1WA6X 5AFEA 3DGTA 1RUH3 4BYYA 1RXGA 4CU7A 1S0GA 3N7MA 5ABJA 2X8KA 3D82A 5H9RA 4RFRB 4FPLA 5JMOA 2ZGRA 2AR6A 4G3YC 3GYDA 1U0AA 4PQ9A 5LRSA 3DECA 1VRH2 5C8CA 3VKMA 3LEKA 1X8EA 3KHBA 4LXLA 4QKDA 4BQ3A 2OPWA 4O9EA 5KXDA 2E32A 3O1VA 4K9SA 2FZ2A 3JD71 4HANA 5DG1A 5GLTA 3A21A 1UYZA 2VQTA 3CHXA 3I3EA 1W8OA 2IWGB 5A1AA 4NIHA 1C3HA 4J1XA 4OUSA 1RUE1 5FZOB 3U75A 3IBMA 5A33B 5JXIA 2WUHA 4CCJA 5M0TA 4AFMA 1DQ1A 3WP3A 5CBLA 2TNFA 1WBFA 1OVSA 4YNIA 1DQ4A 4YVWB 2K46A 2PLV2 2WWUA 3UGGA 4P9WA 2BVBA 3ZXFA 3BYWA 4HONA 2VXJA 4TXWA 4FTBA 3E97A 3SEEA 2F4LA 4Q8KA 3BTZA 3CF6E 3LQCA 1H6XA 2JKXA 3R05A 3GZTB 1RUE3 1HKDA 2RDRA 2XG3A 1DQ2A 1WD4A 4XJZA 2BU9A 2G9ZA 4GALA 4Q0QA 2HWB1 2X53S 1OLMA 4AOCA 4XUOA 4CA9A 4PIXA 1D2SA 2ZGPA 4AEDB 4ASKA 1CVNA 4D0QA 2JE9A 5GLWA 2GC1A 5LCWL 2UWCA 2XJSA 1ST8A 2E7TA 4LIUA 3WQBA 1XNDA 3V0BB 3VZLA 3VBUC 4GKXA 3NKGA 3MEPA 2RR11 5FY5A 3NNFA 4K1ZA 2VBBA 3ZSKA 5FMDA 2FHRA 4FTEA 1HB2A 3NV4A 3ALQA 1H4GA 2A3XA 2VBDA 2ZX2A 4GH4A 4KBBA 4CDQC 1K5MB 2YV8A 3AYAA 2RE9A 4EE2A 3TEYA 1F4HA 2D3RA 5FJKA 3NJZA 3VV1A 3I4IA 3ZFFB 2WS93 1HQLA 2R0HA 1OKOA 2A71A 2W94A 2ZMLA 3ZYJB 2BQPA 2AEZA 3J8F2 3DEMA 2GALA 2XL7A 3IB3A 4Q4V1 4E4ZA 1C8M2 2RR13 5C5UA 3UGHA 5FZLA 1YCIA 4QPGA 2IXJA 3RZJA 4IV1B 1VMFA 1FYUA 4AE2A 1DLCA 3OBAA 1CONA 4CSWA 2VG9A 2MNGA 4OHYA 4A42A 4HG6B 2G9FA 3CJXA 4SBVA 4GMP0 3T4HB 4AQSA 4AXOA 4RHV3 2RM21 4YM2A 1DHKB 5A3TA 1XYOA 3K77A 4CRQA 1GNHA 3DUIA 4OULA 2VMEA 4Q4V3 4K40A 3N35A 1GQPA 4V2VA 2W1SA 4AVTA 1FATA 4NHMA 1QF3A 2MEV1 3KS7A 3UL2A 2JG8C 1QJY3 2BOJA 5FYCA 1POV3 4P5YA 1O8PA 2DUPA 4AG4A 2W0XA 5IAVA 1W3VA 4IUGA 4URAA 1IS5A 1OHFA 1YO8A 2QUOA 4KWLA 4GZ9A 2ZMKA 2HWF2 5DUUA 5IVBA 2RM23 2BNOA 4OI1A 4A6OA 1JYNA 5EXOA 1K3IA 2FDIA 3AKRA 1EV11 1WA4A 3K4DA 1QOTA 1SLLA 4NWVA 4Q4W2 3ZFGC 3ZPOA 2BDRA 3KSCA 4YLZA 5C9AB 1PK6A 3H9AA 3I3QA 3H3ZA 3R4SA 5FMBA 4R4XA 5HBAA 4JC1A 4NRQA 1W8WA 4JRLA 1VB4A 2GP5A 3FFZA 3S5QA 2GMMA 4JGYB 4PF1A 5D8AA 5DDJ1 1DQ0A 1H1MA 2NYYA 2YPJA 2BVVA 4KWUA 4UOJA 3TNQA 1ZX5A 5LK7B 4EJRA 1DZRA 2CAVA 1HV0A 2IVJA 2QDNA 2LTNA 3VZOA 1AYM3 4B1MA 3WR0A 3AZVA 5JZGB 4MLOA 5DN2A 3RFRA 4J25A 1DG6A 1W6OB 3FUOA 3FLRA 3BOPA 3KGZA 2ZHKA 2VZOA 2PAEA 3IM0A 3PTRB 2BZDA 4LLFA 5DXDA 4BCUA 1YFWA 5FBJA 4EN9B 4XURA 5L7OC 4UBGA 1UY2A 3MIGA 4XBNA 1KD7A 1W6QA 1LJ7A 1W6MA 1OBNA 1G9AA 3J9SA 1QH7A 1BK1A 3NL1A 4K6BA 5H9SA 3WNPA 5KC5A 3M3IA 3I8TA 4BB3A 4ZXKA 2XQXA 1O3QA 1QIQA 3ST7A 1W8TA 3Q8BA 2GMPA 1SFNA 1IQAA 3AL5A 2B39A 3MF6A 1SLIA 1J59A 3PHMA 1BVP1 1JUIA 3WF0A 3T2OA 5EJ3A 2Q8CA 2VULA 2WQ8A 2DVBA 2QFEA 2RDNA 1R081 1REFA 3OGGA 3ZXEA 4CPBD 1W99A 2WNVA 5CIRA 2PHFA 4ZU7A 4D8MA 5KR7A 1JMUB 4QD2A 3BALA 3ZN5A 1NX9A 4BXFA 3Q8CA 2AENA 3AJYA 3VKNA 4YGBA 4ARXA 4CP0A 1JI6A 3M7AA 3P5BA 3WG3A 1F8VA 4ORFA 4LBOA 1WLDA 1VP6A 3BPSA 2WT1A 2OX0A 2HWC3 1YNAA 2VTXJ 4IV3A 4QM8A 4XEZA 4DXRA 2YGMA 2PQSA 4PLNA 3KCYA 5A1LA 5F3CA 1NY71 3O14A 1UYXA 3A23A 1EPWA 1GZWA 2Y26A 2FZ1A 2JEMA 4UFIA 1VBC2 4BQ4A 1W2OA 3VHPA 1YEWA 3U11A 1PO12 1H6YA 2EXKA 3POFA 5EYXA 4AEJA 4E4DX 1TE1B 2VM9A 2X09A 1JZ6A 3RG0A 1DZQA 1MQTC 1DYPA 1ZZ8A 5LY1A 1SEFA 3VN4A 1Z7S1 3BTAA 5A6ZA 4QPIA 1Q56A 5EHDA 3KM5A 2X5IA 1O3RA 5F5CA 4GWIA 5JSRA 3S30A 5C3SA 3K4AA 2X10A 4DQAA 1DIWA 4A7YA 4CDWA 3LIHA 3H1WA 4A7KA 5F2SA 4CVUA 1QGLA 1HV1A 1UX6A 2HH9A 2QQUA 3N9MA 2YC4A 4FPOB 1M4WA 2J1EA 4RGKA 5CB7A 3SCFA 3N36A 4CEWB 4I0AA 1Z7S3 3WF1A 3GF6A 3GJAA 1GBGA 4KMQA 2F17A 4RA0A 2DVAA 4S2FA 4ES8A 1PO22 4YW7A 3HJRA 2R0FA 3H8UA 3OGSA 5CA6A 3QCWA 4I3GA 3O1OA 2QQPA 3VBUB 1YIFA 3I59B 3QOPA 4P9IA 5JUVA 1Y7BA 1QJFA 1OMIA 2YYOA 4YG6A 1NXD1 5DZFA 4CP2A 4COWA 2P3KA 3LEGA 1AX0A 5FZBA 1K42A 1NCRA 1HJGA 1DGWX 2V4AA 4CDQB 4Y3OA 1N3OA 1YRZA 1ZRIA 3CQOA 1HIXA 2GP3A 3ZIWA 1P8JA 3MFCA 3ZMNA 1WCUA 2D5HA 5IVYA 5KXEA 1UQXA 2SBAA 4IEQA 1G8WA 4E2GA 1PZ7A 1VBE2 4MGQA 1DBNA 2JIJA 4BQ2A 3WP5A 5BNPA 1JTZX 1F15A 1RVF1 3GCXA 2CGOA 2FMYA 1JYIA 4P9LA 5FXVA 1G9BA 5AC93 2ZGNA 4XAAA 3SLIA 3KLSA 4RQPC 4OHXA 3WLUA 2BOIA 2E51A 2WDBA 1CAXB 1E5IA 4Q0SA 2CNAA 4LHSA 2CHHA 4XETA 1EPZA 3I2GA 3PUHA 2YBKA 4XTPA 4AAPA 3APBA 4IEOA 5FY8A 1JZ8A 4XFHA 3A0KA 5FDBA 2JG8B 3H42B 2JE8A 5DUVA 1BMV1 2ZZJA 2C9AA 4Q8LA 4XF4A 4GXLA 4XTMA 3OOXA 3T2QA 1W6NA 1WMEA 1CR7A 4XIKA 4LOSA 2G1MA 2WZR3 1MS8A 2D6LX 3AKSA 1JH5A 4JKKA 1RUD2 3O0WA 3PTYA 1T6GC 2OQ7A 2H0BA 4RR3A 3O7OA 3THTA 2AC1A 5FZEA 4Q0PA 1DGLA 2DCYA 2ZAAA 1I9RA 2ORZA 4NE9A 1AR92 2WNEA 4PIZA 4GULA 3GZEA 4CUGA 2JD9A 2PA7A 4A3ZA 3HMYA 1A34A 5LW9A 1VBD1 2RS12 3E6DA 4EZHA 3HNBM 2W1UA 3OCPA 3ZXJA 5LBEA 4LBQD 4HK8A 3RS6A 4P9GA 3AP4A 3OBZA 4JDOA 2ERFA 2A5ZA 2WZ8A 1FI2A 3BCWA 4YZ5A 1GFF2 2VL4A 2Q8OA 4PT6A 3POEA 1R091 5DAPA 1HXS1 5C70A 2WZEA 3FFQA 2W92A 3IPVB 5EP9A 2ADEA 1C1FA 4Q2FA 1US2A 3H3UA 3N7KA 4B4PA 4D7TA 4WBBA 1OOPC 3WSOA 5CISA 1UZ0A 3WQ1A 4NHYA 4N43C 4P14A 4QU2A 1S0FA 1O3SA 1U5XA 3J4UH 2GC3A 4W50A 5AVAA 1CZTA 2L9LA 2QCSB 5FZOA 5FZCA 4IE0A 3ZN4A 2ZXQA 1UOGA 5FP7A 4K1YA 4FBFA 3M8LA 4BA6A 2JWPA 3DYMA 3OUJA 4YVWA 2BUKA 4KGGA 1OQ1A 4WVWA 4W65A 1QOOA 2ZCWA 3ZYIB 5E89A 1GP4A 5CKQA 5ANNA 5LA0A 1A78A 3AMPA 3ZN6B 2XWBB 1DZTA 1S0BA 2ZHMA 1ND3C 5HI0A 1MS9A 4QQHA 2Y6JA 1SHWB 1FNZA 2VJXA 2ZMNA 2JJ6A 3EQEA 3N9NA 5FPVA 2AH2A 5FR3A 4PBOA 4CCEA 3E1F1 3RDIA 3N9OA 3E6CC 3HAGA 4AVSA 2YBSA 4NAMA 3VD4A 4LQRA 4QDRA 3USUB 4AI8A 1CESA 2IXLA 1VE0A 1HLCA 2XR4A 2XXZA 4B4QA 4NIAA 4YGDA 3PMSA 5F5AA 5G04L 3VDBA 5I93A 1KFXL 3KMHA 1T6BX 4P9XA 5SV5A 5T3NA 2A3WA 4FFIA 3K51A 4CUBA 1VBB1 3BUCA 1V0AA 2EAAA 4A45A 4AI3A 1ENSA 1RHI2 1CWPA 4LOTA 3GHNA 1K5MA 3KVAA 1JHJA 2RG4A 3IDAA 4K7JA 2R063 2XONA 1AR71 2IZWA 2GNBA 2OPKA 3ZFFA 3ZFEC 4UF0B 4YFWA 4EQVA 5FP9A 1XYPA 4XHXA 3ZMOA 2EXJA 2XVLA 3ON7A 5F5QA 3VL9A 4XF1A 1HRI1 3DV8A 4NMIA 4AVAA 1MQTB 1VBB3 2R6QA 3ACFA 1LODA 5FWEA 2CDPA 4IV1A 1W8UA 2Y6HA 1PM4A 3CZUA 2KM2A 2Z5WA 2BNNA 4YARA 2RDQA 4UI9L 1UZVA 5FK7A 5I0DA 1FOD2 4UW4A 3TN91 1TG7A 1VB2A 2YU2A 1GYKA 5A80A 4H3WA 3GM8A 4E8CA 5CFCC 3DYOA 3J26N 3S57A 2W68A 2VOTA 3HQXA 2BBVA 4XCBA 3U0ZA 3R4DB 2NMNA 2B5HA 2PFWA 1AR82 4IETA 1D4M1 2CTVA 4MHRA 4YW3A 5B2GB 3TN93 5EIYB 4QDQA 3S6PA 2XJRA 5LEJA 3JBG2 4JX0A 4DNYA 4YWAA 1E5RA 3UV9A 3UK9A 1PGW2 4XFBA 4Y26A 2BEOA 5FZ6A 4TZDA 3SH4A 3M3CA 4QU1A 2FDFA 2JDKA 3HNYM 5C9AA 2WLPA 3ITQA 4NIIA 1DFQA 4JGZC 1D4M3 4JGYA 4R8HA 3MPBA 4AI2A 2Q5TA 3I3DA 2XPJA 4AVCA 4XBQA 5A32B 1GR3A 2XJVA 2FDJA 1COV2 4QX7A 1W39A 1QXJA 3CJIA 4Q4X2 3ACGA 4ASLA 5IAXA 2VQ0A 4B4RA 5FO7B 2J1TA 2D3PA 2J1VA 2E9QA 1W6OA 1WW7A 4PQQA 1LHWA 1UL9A 2IXKA 4UXAA 2Y6FA 3W20A 4A6SA 1MZ6A 4AZZA 4Z07A 1RJ8A 3NJYA 4RL7A 3AZZA 3CO2A 3I2FA 5JXGA 1DGRN 1KDMA 1O5LA 1UAIA 2W46A 4L97A 1MS5A 2PMWB 1GP5A 3ZYGA 5F1RA 1LHVA 1BKZA 4YZ4A 1BVVA 4FPFA 4X6QB 4LLOA 3T1MA 3LDRA 1LESA 1BEV3 4L0PA 3UJOA 3ZYFA 3Q8EA 3DKQA 4IEUA 2VD7A 1ZZCA 2D5FA 1HRV2 3AM2A 4F7ZA 1HJFA 4H7MA 1AF9A 2HBUA 1OF4A 4FPCA 4RD7A 5A3LA 1WZXA 2XHNA 1WKYA 4KBZA 4C91A 2QJVA 3E5XA 4RS5C 3FC0A 1OUSA 3WDUA 1C8M1 2WO3A 3KF5A 4XDPA 3S7IA 2YGLA 5A3WA 2H0VA 1F31A 1RUC2 3VB9A 5IW0A 1SACA 2RMU2 3H1MA 3KT4A 4QQ2A 4D6RA 2ZEWA 3POIA 4DEQA 2E26A 1V6MA 1BHGA 4QAWA 5A3MA 5FXZA 1AHSA 2C26A 1H1IA 1OA2A 2VZRA 3POJA 2GMEA 1DYKA 2GN7A 4A4AA 2EAKA 2VMIA 1I3HA 3RYRA 3RJ2X 2A6YA 1LGNA 2P3YA 2UWAA 1DYOA 2NPIA 2P2KA 3MF9A 4QPYA 3EB7A 5JR7B 3ACIA 2W5FA 1ZA4A 2P1BA 4M01A 4XACA 2OYZA 2EF6A 5BNQA 1OLRA 1NA1C 1IS4A 1OOPB 1UF2C 2QTWB 4GKYA 4MH0E 2R1BA 4AFAA 3NNLA 5F7UA 4N43B 5IVFA 3MZHA 1ZREA 1DLLA 4PDWC 4ATFA 1QJX2 4K3UA 3PIJA 2XWJB 4BWOA 1A3KA 3VZKA 1DQ5A 1W03A 2Z42A 4N9IA 3GBWA 3OGRA 4AI0A 5ACA2 2RS51 2DCKA 4QHBA 1CAUB 2KXLA 5IYYA 2AREA 3C7EA 2LALA 2WLQA 3HNMA 4JKLA 4MGZE 4YG0A 4FTSA 3BB6A 3GZAA 4O65A 4H2AA 1NCQC 3U1XA 4CDUC 1H1AA 2R1DA 3FJSA 1ND3B 2WRAA 3OUIA 4BQYA 2EXIA 3OTFA 2VOKA 4WZFA 1W04A 2R30A 4CEWA 2RS53 1RUI2 2OZ6A 5JI9A 5DQ0A 3AL6A 4Y1VA 1PGL1 2D6PA 3EMRA 3Q8AA 1O3TA 2B8MA 3VBUA 3I59A 4NIDA 2QQMA 2VAUA 5GZDA 4XXAA 3ZSMA 4RN5A 3OPZA 5LK5A 1SBEA 4CDQA 1GOHA 4IEZA 1ASJ1 2VNRA 5GZEA 3AFGA 3N3HA 3ZPYA 1XE7A 5IVJA 3ZFEB 2OT7A 1LOGA 2BTVC 1QJU3 4MYEA 3U10A 2FQPA 4QX0A 4LHLA 1AZDA 1AYN3 2OUJA 3WV6A 4BXSV 1O4YA 2VCMA 3WINE 3SQOA 2D40A 4MADA 5EJ1B 3NAPC 1ASJ3 3RNSA 4NOTA 2RV9A 1GWMA 2I2SA 2VMDA 3B69A 1WGPA 2ZX1A 3POBA 4Y5Z0 3RZHA 3ZYHA 5FWJA 5I0SA 1O7FA 1CAXA 1QXPA 2EALA 4IXLA 3H7JA 3ES1A 2W39A 4ONUA 1JZ4A 2J1RA 4XXPA 4DS0A 5CFCB 1IS3A 4LTAA 2JG8A 3AVRA 3KVBA 2A1XA 4AQ2A 1B35C 1MEC1 1S2EA 5A7SA 3KD4A 2HWD2 2ZHLA 2ZX4A 4W6YA 3VBOC 2VZUA 4AI9A 1VBC1 3FX3A 3ACHA 2IVIB 1D7PM 1PO11 4UAPA 2FDHA 3WY6A 3QBQA 2CYFA 4IEXA 3OJBA 1QDCA 1B09A 1VBA2 4QGNA 3BIEA 4YW2A 3WG1A 4R9AA 2NM1A 2PYTA 1O6UA 3ZFGA 1RUG2 4GIQA 5C8WA 3LA2A 1MEC3 4FOYA 1QWRA 4JGZB 4IEWA 2W3JA 3ZYBA 2WAAA 1JZ5A 5FP4A 4ZXEA 2JG9C 2Z4FA 2EICA 4P00B 4XJ8A 4KWKA 2RHPA 1ZYBA 2C5DA 2JB8A 1PO13 4XBLA 4YFZA 2Q8EA 3O0VA 1N1TA 3PVOA 3AP6A 3T30A 3L2YA 4E2QA 5DMYA 2WKKA 2O1QA 4DUWA 4LKFA 3H8RA 2CV6A 1LR5A 5E6HA 1FPN2 5CNAA 3NWKA 4XOGA 2WT0A 2DCZA 1JOBA 1IGOA 1EAH2 4QWNA 5C3OA 2DWRA 1PO21 3SCHA 3ETPA 4QXCA 3ILNA 1U12A 1XSRA 3VDDC 2J7MA 3DL3A 3OB8A 4KU7A 4DRVA 1TME1 3S0MA 5CADA 4FFFA 3ZKYA 2R072 4NO4A 4GMP1 4CU8A 4CCMA 1W9TA 3NRUA 5FYZA 3VHNA 3EHKA 1BJQA 1KQRA 1QY4A 4ZY9A 4PBPA 1ULOA 1Q8PA 3IIAA 3M70A 4JRAA 3ZN6A 5H9QA 1LTEA 1OH3A 3BVCA 4J6GA 3UT0A 3RZMA
chains in the Genus database with same CATH topology
4CUGA 4QXBA 5A7WB 5FZ6A 4DO0A 4EZ4A 5FZ8A 4QU1A 4EZHA 5A1LA 5F3CA 5LW9A 3OPTA 5FJKA 5FZDA 4V2WA 4IGQA 5FUNA 5FYBA 3U4SA 3PUQA 5FZ0A 5FZLA 3KV5A 3DXTA 3PURA 4QX7A 4D6QA 2Q8DA 4CSWA 2PXJA 2XDVA 4IGPA 5FXWA 5IVJA 5IVVA 5FYSA 3OPWA 5FYTA 2OT7A 3N9PA 3K3OA 5F37A 1VRBA 5A3TA 5FZ4A 5LY1A 5F2WA 4LIVA 3RVHA 5FY7A 5FZOA 4Y4RA 4UF0A 5FZCA 5A3PA 4V2VA 5FP7A 3NJYA 3K2OA 3N9LA 4GAZA 5F5CA 5FY4A 4HOOA 5FP3A 5FYCA 3LD8A 5FYHA 4URAA 3PU8A 3LDBA 5F2SA 4E4HA 5FWJA 3N9MA 5IVBA 5LWBA 4EYUA 5FZ9A 4LITA 5IVCA 4NUBA 3N9NA 5A7PA 4QXHA 5FPVA 5F5IA 2VD7A 3AVRA 4IGOA 3KVBA 3N9OA 5FYIA 5FZHA 3PU3A 3KV9A 5A7SA 3ZPOA 5A1FA 2YBSA 5IVEA 5F3GA 5FPLA 3K3NA 3N9QA 3KV6A 4CCLA 5ISLA 2YPDA 2XXZA 4AI9A 5A7NA 4XDPA 5F5AA 5FZKA 2GP5A 5FY1A 5A3WA 5IW0A 5FYYA 5FZBA 2OQ6A 4CCNA 4D6RA 5FUPA 5FZ1A 5CEHA 4Y3OA 5FZIA 2XUEA 5FY0A 5K4LA 4LXLA 2XMLA 4DIQA 5FXZA 2GP3A 5ANQA 3U78A 4BISA 5FPBA 4QX8A 5A7WA 4C8DA 5IVYA 3KVAA 4GJYA 5FP4A 4D6SA 5A3NA 5FJHA 3PTRB 3AVSA 5FZOB 2W2IA 4UF0B 4CCJA 5FBJA 5FP9A 2Q8EA 5FY9A 5F3EA 2YBPA 3PUSA 5FPUA 3KV4A 5FXVA 5FWEA 5IVFA 2WWUA 5E6HA 5F32A 4HONA 5FV3A 5F3IA 2OS2A 5FPAA 2WWJA 4QWNA 3ZLIA 5FZ3A 2P5BA 3AL5A 5F39A 2YBKA 4AAPA 4QXCA 5FY8A 5FZFA 5FZGA 2YU1A 4TN7A 5A7OA 2YU2A 5A80A 3DXUA 2Q8CA 5FXXA 5FP8A 4ASKA 5FZAA 5A7QA 4GJZA 4LIUA 5LY2A 4CCMA 5FYZA 4GD4A 4CCKA 4CCOA 5KR7A 5FYVA 3PUAA 2OQ7A 4BXFA 5IWFA 4BU2A 5FZEA 5FY5A 3UYJA 4XDOA 5FYUA 5FZMA 3PDQA 5FYMA 5FZ7A 4Y33A 2OX0A 3AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUG A;  4QXB A;  5A7W B;  5FZ6 A;  4DO0 A;  4EZ4 A;  5FZ8 A;  4QU1 A;  4EZH A;  5A1L A;  5F3C A;  5LW9 A;  3OPT A;  5FJK A;  5FZD A;  4V2W A;  4IGQ A;  5FUN A;  5FYB A;  3U4S A;  3PUQ A;  5FZ0 A;  5FZL A;  3KV5 A;  3DXT A;  3PUR A;  4QX7 A;  4D6Q A;  2Q8D A;  4CSW A;  2PXJ A;  2XDV A;  4IGP A;  5FXW A;  5IVJ A;  5IVV A;  5FYS A;  3OPW A;  5FYT A;  2OT7 A;  3N9P A;  3K3O A;  5F37 A;  1VRB A;  5A3T A;  5FZ4 A;  5LY1 A;  5F2W A;  4LIV A;  3RVH A;  5FY7 A;  5FZO A;  4Y4R A;  4UF0 A;  5FZC A;  5A3P A;  4V2V A;  5FP7 A;  3NJY A;  3K2O A;  3N9L A;  4GAZ A;  5F5C A;  5FY4 A;  4HOO A;  5FP3 A;  5FYC A;  3LD8 A;  5FYH A;  4URA A;  3PU8 A;  3LDB A;  5F2S A;  4E4H A;  5FWJ A;  3N9M A;  5IVB A;  5LWB A;  4EYU A;  5FZ9 A;  4LIT A;  5IVC A;  4NUB A;  3N9N A;  5A7P A;  4QXH A;  5FPV A;  5F5I A;  2VD7 A;  3AVR A;  4IGO A;  3KVB A;  3N9O A;  5FYI A;  5FZH A;  3PU3 A;  3KV9 A;  5A7S A;  3ZPO A;  5A1F A;  2YBS A;  5IVE A;  5F3G A;  5FPL A;  3K3N A;  3N9Q A;  3KV6 A;  4CCL A;  5ISL A;  2YPD A;  2XXZ A;  4AI9 A;  5A7N A;  4XDP A;  5F5A A;  5FZK A;  2GP5 A;  5FY1 A;  5A3W A;  5IW0 A;  5FYY A;  5FZB A;  2OQ6 A;  4CCN A;  4D6R A;  5FUP A;  5FZ1 A;  5CEH A;  4Y3O A;  5FZI A;  2XUE A;  5FY0 A;  5K4L A;  4LXL A;  2XML A;  4DIQ A;  5FXZ A;  2GP3 A;  5ANQ A;  3U78 A;  4BIS A;  5FPB A;  4QX8 A;  5A7W A;  4C8D A;  5IVY A;  3KVA A;  4GJY A;  5FP4 A;  4D6S A;  5A3N A;  5FJH A;  3PTR B;  3AVS A;  5FZO B;  2W2I A;  4UF0 B;  4CCJ A;  5FBJ A;  5FP9 A;  2Q8E A;  5FY9 A;  5F3E A;  2YBP A;  3PUS A;  5FPU A;  3KV4 A;  5FXV A;  5FWE A;  5IVF A;  2WWU A;  5E6H A;  5F32 A;  4HON A;  5FV3 A;  5F3I A;  2OS2 A;  5FPA A;  2WWJ A;  4QWN A;  3ZLI A;  5FZ3 A;  2P5B A;  3AL5 A;  5F39 A;  2YBK A;  4AAP A;  4QXC A;  5FY8 A;  5FZF A;  5FZG A;  2YU1 A;  4TN7 A;  5A7O A;  2YU2 A;  5A80 A;  3DXU A;  2Q8C A;  5FXX A;  5FP8 A;  4ASK A;  5FZA A;  5A7Q A;  4GJZ A;  4LIU A;  5LY2 A;  4CCM A;  5FYZ A;  4GD4 A;  4CCK A;  4CCO A;  5KR7 A;  5FYV A;  3PUA A;  2OQ7 A;  4BXF A;  5IWF A;  4BU2 A;  5FZE A;  5FY5 A;  3UYJ A;  4XDO A;  5FYU A;  5FZM A;  3PDQ A;  5FYM A;  5FZ7 A;  4Y33 A;  2OX0 A;  3AL6 A; 
#chains in the Genus database with same CATH topology
 1TME 3;  4RS5 B;  3RSJ A;  2V5Y A;  4BHP A;  3JD7 3;  4JZR A;  3ILR A;  1VBE 1;  4GMP 3;  1NUK A;  2QQO A;  5FZD A;  3HIF A;  4PLO A;  3USU A;  5FUN A;  3B9I A;  3JCI A;  2R04 1;  4DRR A;  1YHF A;  4TLG A;  1O91 A;  1C1L A;  2WFF 2;  1ODN A;  3U4S A;  3CL1 A;  1U5Y A;  4Q4Y 1;  4N7U A;  5J36 A;  1VJ2 A;  3M3E A;  3DPR C;  2VZT A;  4L2N A;  3GXU A;  5HPO A;  1X8M A;  4EN6 B;  4WVM B;  5K8S A;  3N7J A;  2Y0O A;  3OPW A;  4S2H A;  4NR1 A;  5CFD C;  1PVX A;  3WX5 A;  5JDB A;  4IDZ A;  2AGS A;  2R04 3;  1G7Y A;  2AEY A;  1NA1 B;  4LBN A;  5FBZ A;  4UF0 A;  5D1I A;  3WHU A;  1NAE A;  4XUT A;  2HWB 3;  4Q4Y 3;  2QQN A;  2V72 A;  2PHX A;  3WD5 A;  3WG2 A;  2E53 A;  4YW5 A;  3O12 A;  1QHD A;  3BKZ A;  1MQT A;  5FMO L;  3AXD A;  1RUD 1;  1Q8Q A;  1UMZ A;  2NZ9 A;  1UD1 A;  2D6M A;  3V64 A;  4OI2 A;  1WBL A;  2JKB A;  2VCB A;  3J7M A;  1AR9 1;  2G4I A;  5T55 A;  3TRS B;  2W95 A;  1RUN A;  3DCQ A;  4NHL A;  1ZNP A;  4EYU A;  1JYX A;  3RWK X;  2KR2 A;  5BXX A;  4C1X A;  3KB5 A;  5FUI A;  1NCQ B;  4XZP A;  3T4V A;  4CDU B;  2D97 A;  1GQH A;  4HKO A;  3VLB B;  5L36 A;  4LBL A;  4CCL A;  3I2J A;  1ZBE 2;  3H8O A;  3C2U A;  4BQ1 A;  5KHI A;  2PHU A;  3GNE A;  4ZZ8 A;  5A7N A;  4UBH A;  3C7G A;  4E9K A;  4IEY A;  3HWJ A;  4QQP A;  3RJR A;  3MW3 A;  1FMD 1;  1X50 A;  3POS A;  3LOB A;  3CZJ A;  3VBF C;  3PVN A;  1SMV A;  5JOY A;  3RPQ A;  1AL2 2;  1O8S A;  2WL1 A;  4DIQ A;  1JN2 P;  1JZ2 A;  3WCS A;  2Y6G A;  3CLP A;  3OGJ A;  2ARA A;  1ZRD A;  2P6H A;  2HBT A;  4JCK A;  1TMF 2;  3AVS A;  2RS3 2;  4QKN A;  5I0T A;  2CY6 A;  4A44 A;  4M3C E;  1AX2 A;  5HXV A;  4S2G A;  5JOZ A;  1V6L A;  1E5S A;  1Z0H A;  1FMD 3;  2MEV 3;  1H4H A;  4YZ3 A;  4LE4 A;  5A32 A;  1Q43 A;  3KV4 A;  4OQ9 A;  3WHT A;  3KT1 A;  4I02 A;  4HKL A;  3DN7 A;  1AUY A;  1Q3E A;  4WM7 C;  3S5A A;  3PJQ A;  1V6J A;  1NQD A;  4RSU A;  5K9Y A;  3VBR C;  2YU1 A;  2ILM A;  1EV1 3;  1R1A 2;  4XQ4 A;  5A7O A;  2UY9 A;  3ETQ A;  4UFH A;  1XNA A;  3CJI B;  3M4F A;  1C8N A;  3MIC A;  4OI0 A;  1V6K A;  2X05 A;  4L11 A;  2AYH A;  4RQP A;  1LHN A;  4EN7 B;  2XUM A;  2P3J A;  4XFF A;  1G86 A;  5E8A A;  1LRH A;  1SDD B;  1PMJ X;  1C5H A;  1SLT A;  3O0X A;  4RGG A;  2A75 A;  1V6O A;  5DDJ 3;  3ES4 A;  4LBM A;  4M3C A;  2WAO A;  3LAG A;  1B35 B;  2BER A;  3AJZ A;  3PLQ A;  1ZRF A;  3N4M A;  1RHI 1;  3I2K A;  3KCX A;  4Y33 A;  5IFT A;  3VBO B;  4YG3 A;  1QQP 2;  3ACL A;  3PVB B;  5HCB A;  1HDK A;  3NNM A;  4Z2A A;  4OZX A;  1NKG A;  2FCT A;  5A70 A;  5LBC A;  1WLC A;  1XRU A;  3NVC A;  4AEM A;  2YB7 A;  4YM0 A;  5JOX A;  2ET7 A;  3LB9 A;  4R9D A;  1PNG A;  4P9J A;  1F5F A;  3ABZ A;  5FZ0 A;  2BJS A;  3KV5 A;  3VBS C;  5HCA A;  5GJ6 A;  2JG9 B;  3TAY A;  5F6L B;  3VBH C;  1UXZ A;  4BJ0 A;  2A6Z A;  1FOD 1;  1WLT A;  4IE6 A;  2Q8D A;  2OKX A;  2X29 A;  4TWT A;  1ULD A;  3TB0 A;  2VZQ A;  1POV 0;  3D8C A;  3DKW A;  3IN9 A;  2C1F A;  3PJY A;  3TNP B;  4LMF A;  2VEC A;  3RVH A;  3WXP A;  3POY A;  2VZ3 A;  4UFJ A;  3D6E A;  2ZEZ A;  2YG0 A;  4UFK A;  2XBO 2;  4Z8B A;  1SPP A;  1OOP A;  3CIH A;  1R08 3;  1UCX A;  2VMH A;  2IXI A;  1AR8 1;  3MLK A;  3POG A;  5HCF A;  1PIV 2;  3LD8 A;  4N43 A;  4U2A A;  1YJL A;  2ZGK A;  3VGI A;  3JXS A;  1AX1 A;  2TEP A;  1X9P A;  2HKX A;  3I54 A;  3CBN A;  2ATF A;  3JBG 1;  1BZW A;  1KJL A;  4BIO A;  4XJA A;  3AKQ A;  1PGW 1;  1H2K A;  1OA4 A;  1UOB A;  1CAU A;  5A7P A;  2WZP P;  3ELN A;  1CGP A;  4FFG A;  1W9S A;  3LGR A;  1CD3 G;  1N3P A;  1MVQ A;  2TUN A;  3K48 A;  5SV8 A;  3VD3 A;  4CU6 A;  3LE0 A;  1J1T A;  2VPV A;  1GQG A;  3MGU A;  1ND3 A;  2GC0 A;  5I0U A;  4MSV A;  1W0P A;  5GZG A;  3GAL A;  4PHZ A;  5H9P A;  5FZ1 A;  4IND A;  5FY0 A;  4GWJ A;  1ZM1 A;  3BTY A;  1RC6 A;  4IES A;  1IG0 A;  3HVD A;  3C7H A;  4QX8 A;  2OII A;  3MI8 A;  5HV4 A;  1BCX A;  1PVC 1;  4GB3 2;  1HN1 A;  1ZBA 2;  3DPR B;  2BP6 A;  1UX7 A;  4KU8 A;  2BBA A;  4MUV A;  1ULE A;  4Q27 A;  4HFS A;  1RUH 2;  3RZK A;  2E63 A;  2IFR A;  4AI1 A;  4FXG B;  1AR6 1;  2BGC A;  5F9T A;  5CFD B;  4NPR A;  5FLI A;  4AHW A;  1LKN A;  4JQR A;  5DAX A;  2A6X A;  4HVR A;  5FPA A;  5LB6 A;  4AAX A;  3ZFE A;  3O1S A;  3FLP A;  5DAV A;  2VUD A;  4CU9 A;  1PVC 3;  1Y4W A;  1HRV 1;  1OF3 A;  4CPB A;  1SG3 A;  1JYC A;  1RUJ 2;  4FQZ A;  3I97 A;  4QX2 A;  1LOC A;  2WQ4 A;  4JTN A;  4OHZ A;  4YSF A;  4PCR A;  3W5M A;  1AR6 3;  1FV3 A;  4GQ7 A;  4LOR A;  3INA A;  1X7N A;  4BM8 A;  4CCO A;  3WEZ A;  1W8H A;  3WNM A;  3SHR A;  4B29 A;  3FMG A;  3LZZ A;  4HZF A;  5FZM A;  4AFB A;  2B9V A;  2Y8K A;  3M1H A;  5FZ7 A;  5CFC A;  4ZU4 A;  5D21 A;  1RUE 2;  4LR4 A;  1OI6 A;  1DP0 A;  3NJV A;  5FOJ B;  3S7E A;  1JBC A;  3LWC A;  4QDS A;  1IQD C;  2EID A;  3UES A;  3ZIX A;  4LA3 A;  2D3S A;  5FMO S;  1BYH A;  4ZON A;  2O0O A;  3FZ3 A;  3AP5 A;  1LOE A;  4K21 A;  2QQI A;  1UMI A;  1XE0 A;  5FYB A;  3VBF B;  2XLF A;  4XJU A;  1RXF A;  1RVF 3;  1H2L A;  3WW4 A;  1PZ9 A;  5BNO C;  1QJX 1;  1YQ5 A;  3RYK A;  2XH6 A;  1UYY A;  1QMJ A;  4NRO A;  2VZP A;  1EYB A;  2FDG A;  1N3Q A;  5ACA 1;  2Y38 A;  1LCL A;  4JGZ A;  3LA7 A;  1NYW A;  4EN0 A;  4TTG A;  5APA A;  3RI9 A;  1V9U 1;  3ZFG B;  2HWE 1;  1ZRR A;  2VOV A;  1NZI A;  4AFC A;  2DFC A;  2WS9 2;  5JXJ A;  4Y5T A;  3K2O A;  3WQ7 A;  3FN9 A;  4O61 A;  1QJX 3;  2R49 A;  3NKT A;  5FY4 A;  4B3N A;  4WM7 B;  5LRR A;  5KWR A;  2RR1 2;  5EFU A;  1VAK A;  3HOB A;  1NE6 A;  2QDR A;  4GWM A;  3VBR B;  3N7L A;  2WA4 A;  4I30 A;  5LWB A;  3AMQ A;  1V9U 3;  1NOV A;  3M2M A;  4QHZ A;  2HWE 3;  3FHA A;  1W8Z A;  3HR9 A;  5EQU A;  3WG4 A;  4RHV 2;  1CPN A;  1RMU 2;  3BN6 A;  4LO6 B;  1J3R A;  1LUL A;  3GHM A;  2DBI A;  4QM9 A;  1XU2 A;  1VBD 3;  4FSJ A;  3N9Q A;  4Q4V 2;  1Y9G A;  4QGL A;  1F4A A;  2VU9 A;  2GH8 A;  3RZL A;  1XQN A;  3GJB A;  1BLZ A;  1QJY 2;  3WF4 A;  1POQ A;  1CX1 A;  1UYP A;  3W58 A;  1S4C A;  5A6X A;  1R09 3;  1W2A X;  3B94 A;  1HXS 3;  4FXK B;  2E33 A;  1XOY A;  1XSQ A;  1XBF A;  2RM2 2;  1HQN A;  1VMJ A;  2XML A;  5LZ6 A;  5I0R A;  2YC0 A;  1PX4 A;  4RS5 A;  2ZEY A;  4X6R B;  4Z1V A;  3JUU A;  4LK6 A;  1YQC A;  3HQU A;  3WW3 A;  1K12 A;  5A3N A;  2GH2 A;  1RUF 1;  2QZ2 A;  2W2I A;  1RJ7 A;  2KA3 A;  2ET1 A;  3ZXD A;  5FO8 B;  3VBS B;  1RB8 G;  1J1L A;  3I49 A;  1LEC A;  3MIE A;  4V1P A;  2JEN A;  4N53 C;  4XUP A;  2DUR A;  3VBH B;  1Q8V A;  5B4N A;  2J42 A;  5FPU A;  4YW1 A;  3ILF A;  4L99 A;  1XC6 A;  4WVM A;  2K2S A;  1OD5 A;  4Y1Z A;  5T52 A;  5DUX A;  4LA2 A;  2GAU A;  1QH6 A;  2OS2 A;  4PJY A;  5KHJ A;  4FAH A;  4MET A;  4P08 A;  1RUF 3;  1AYM 2;  1ENX A;  1KJR A;  2ZX3 A;  2JDA A;  3CU7 A;  3OEB A;  1NA1 A;  3LF7 A;  1KS4 A;  1RIR A;  2GDF A;  1OPO A;  1LU2 A;  1X33 A;  4K8F A;  4NJ4 A;  5LBB A;  2HWD 1;  1OFN A;  1WCQ A;  4QKB A;  5IUQ A;  1NE4 A;  5FP8 A;  4PDW A;  4DOU A;  2XB6 C;  5C3Q A;  1ODM A;  2DTW A;  2WNU C;  2QQL A;  4HKW A;  1BBT 1;  5FYV A;  1H8T C;  1Q8S A;  3AYE A;  4B1L A;  3CNA A;  1RUG 1;  4OZO A;  3MIH A;  4YPJ A;  4IER A;  3NMB A;  4LT5 A;  3HN3 A;  1ULG A;  2Z79 A;  1NCQ A;  1W3X A;  1LOF C;  2DUQ A;  4CDU A;  4QXB A;  5HCH A;  1EUT A;  2P6C A;  1JYW A;  1S0E A;  5A7W B;  2BWC A;  2VW1 A;  5FZ8 A;  2PHD A;  3T2T A;  1YJK A;  4A2U A;  2MPF A;  4EZ4 A;  1YWK A;  4LK7 A;  4FI9 A;  3ZVX A;  1AR7 3;  4CYD A;  5KXB A;  3NQH A;  1BBT 3;  2HYK A;  4ISR A;  5A6Y A;  3L9J T;  1LED A;  3C7F A;  4FPH A;  1WCK A;  4N8M A;  1GZ9 A;  2QQK A;  3KCC A;  5T54 A;  4Q1P A;  4CP1 A;  4JAA A;  3AC0 A;  4FO9 A;  1K5J A;  1HRI 3;  1GWL A;  3BI3 A;  1YXW A;  1EAH 1;  4JDM A;  4M00 A;  1LGC A;  4D6Q A;  1OT5 A;  5E1R A;  3W59 A;  4OCT A;  4AQ6 A;  1UY0 A;  2HWC 2;  1VRH 1;  3K3O A;  3URF A;  3JB4 C;  1PGS A;  1E5H A;  4DIN B;  3VDC A;  1O59 A;  5J1X A;  2V09 A;  3AMN A;  4NPM A;  4Q26 A;  1MZ5 A;  3D5O A;  5IAT A;  3O1T A;  2WNO A;  1W05 A;  4AQT A;  3NO8 A;  4HOO A;  5FP3 A;  2C6S A;  1MAC A;  4IE5 A;  4MGK E;  3VKO A;  4BME A;  4KWJ A;  4ZU5 A;  2GN3 A;  3SCG A;  1VRH 3;  1HB4 A;  2PLV 1;  4AF9 A;  2VUC A;  1UMH A;  4FOW A;  5G05 L;  5IVC A;  2NLR A;  3K46 A;  4QGM A;  1YC6 1;  4XYX A;  5F5I A;  4JQT A;  3NAP A;  4IGO A;  5IK5 A;  5FZH A;  3WDX A;  3CEW A;  1Q8O A;  5FPL A;  3K3N A;  4ZS2 A;  4AL9 A;  4B7E A;  4HN1 A;  4WV8 A;  1W9W A;  4UWD A;  2GZW A;  4CEW C;  4W6X A;  2A7A A;  2ZJC A;  4I0W B;  4M4R A;  1URX A;  2YFZ A;  4L92 A;  2OQ6 A;  2PTM A;  2PLV 3;  1H2N A;  1AVB A;  3T2P A;  4YW6 A;  5BNN C;  4RQP B;  1B35 A;  1HX6 A;  3ZKU A;  2VO5 A;  1MS0 A;  4MGY E;  1D2Q A;  1Z7S 2;  5ANQ A;  3VBO A;  2QKD A;  1PX3 A;  3B7M A;  2BWA A;  4HK9 A;  4XCA A;  3I2D A;  4M3C B;  4H55 A;  2VQU A;  4D6S A;  5T5P A;  1Z78 A;  3O1P A;  4XZU G;  1JU3 A;  5JIA A;  3UKN A;  2PAK A;  2WO2 A;  5BNO B;  3H1Y A;  1FV2 A;  2WR9 A;  2XJQ A;  4ZKT B;  2AUY A;  2CAU A;  3LIG A;  4C0H A;  1DU3 D;  4Z2W A;  4AWD A;  1S0J A;  3B5L B;  3J8F 1;  1SBF A;  2LRP A;  2JG9 A;  1W8N A;  2WSU A;  4Z82 A;  5JPM B;  3THP A;  2XL9 A;  1MZE A;  5F3I A;  1ZZ9 A;  2VCA A;  5J98 B;  5BV6 A;  2JE7 A;  4MHU A;  4DB5 A;  2RDS A;  5FMC A;  3M3O A;  3QLQ A;  2ID4 A;  4NRP A;  1TNR A;  4TN7 A;  2YZ4 A;  2DBN A;  3ZDS A;  1ZBE 1;  1LNS A;  2FCU A;  4UW5 A;  4FPK A;  5HXM A;  5DAQ A;  1W0O A;  2W9X A;  5FZA A;  4DFS A;  3U4X A;  5L9V A;  3GBG A;  3J8F 3;  2PHL A;  2DVG A;  5IT6 A;  3C7O A;  3OSD A;  4CCK A;  1C8M 3;  1KRI A;  2XLG A;  3PUA A;  1F2N A;  5AC9 2;  3VDD A;  4BU2 A;  1V70 A;  2W1W A;  1SPP B;  1QJZ A;  3UYJ A;  2WAB A;  5J37 A;  4Y5S A;  4Y1Y A;  2Y33 A;  5I8Y A;  2HWF 1;  2Y34 A;  2ZAH A;  2VC9 A;  4OMC A;  5C71 A;  1YI9 A;  2BNM A;  4W8J A;  2RS3 1;  3SH5 A;  4LUK A;  1AXK A;  4Q4W 1;  4XAB A;  4DMI A;  4AED C;  3O1M A;  4M0H A;  4R9C A;  5FTT C;  5CU1 A;  1ULF A;  1ULC A;  3KZ4 C;  2WZR 2;  3MW2 A;  3C3V A;  4XC9 A;  2P17 A;  1RYY A;  4I3P A;  3WQ0 A;  2DVF A;  4HET A;  3U14 A;  1NT0 A;  4Q0V A;  4Y1U A;  2HWF 3;  4E8D A;  2Y6L A;  1NZC A;  2B46 X;  2C4X A;  2CWM A;  2HEY F;  5FXW A;  1BMV 2;  1GOG A;  2RS3 3;  2PHT A;  2VH9 A;  1R1A 1;  1J83 A;  2OVU A;  4Q4W 3;  4IE7 A;  4N53 B;  2DCJ A;  4WM8 C;  4XUN A;  1RL3 A;  3LSD A;  4DY3 A;  3DPR A;  4XMA A;  1AXZ A;  5CYY A;  1WWY A;  3N9L A;  3HBZ A;  2XLA A;  2VUJ A;  4Z92 B;  2LUW A;  4MXW A;  4QB2 A;  5FYH A;  2ZTN A;  2C9K A;  5CFD A;  3ZYR A;  2WYF A;  3SXW A;  2UUR A;  1U5Z A;  2BRT A;  5L7O B;  3B3Q E;  4ZHN A;  4OUM A;  2WNU B;  1X9T A;  1VIW B;  5FYI A;  5C4W C;  4O7X A;  5A1F A;  5IVE A;  1ENR A;  1RTV A;  2DVD A;  4LUL A;  1H8T B;  3KV6 A;  4D69 A;  4TYS A;  2DU0 A;  3A7Q A;  3T0A A;  3DYP A;  5I91 A;  1XB9 A;  1ZVF A;  5JXH A;  4HLT A;  4P9Y A;  2HLE A;  2XVK A;  3WUD A;  3HPN A;  4HT1 T;  4FOV A;  3H50 A;  2WC2 A;  3LKJ A;  4N90 A;  3EYP A;  4CCN A;  3V56 A;  1CAW B;  4OMD A;  2CGP A;  1Y3T A;  2Y0I A;  3OD0 A;  5K4L A;  2P4E A;  3ASI A;  4BLI A;  3U78 A;  2OW4 A;  4IL7 A;  2BFU L;  4BIS A;  1OSG A;  2IXC A;  4KNC A;  2P34 A;  4CUA A;  5CKN A;  4C8D A;  1W9Y A;  3WW2 A;  2DUO A;  4XF0 A;  3ZM8 A;  3AZY A;  5CAZ A;  3NV3 A;  2JB4 A;  5LA2 A;  1J58 A;  1FXZ A;  5FQ0 B;  3VBF A;  1PIV 1;  3LSE A;  1G9C A;  1IPK A;  4JTO A;  1UW8 A;  2VBP A;  1S0D A;  1WCS A;  2UYA A;  3D3A A;  3IDB B;  2VOW A;  4BDV B;  3SC7 X;  4I09 A;  2VNG A;  4UFL A;  3WDY A;  4RGA A;  1K45 A;  2IXH A;  1JW6 A;  2VW0 A;  4NHK A;  5IK7 A;  3CMG A;  3UKV A;  2GNT A;  4YRD A;  1YQ2 A;  1T2X A;  5JZG C;  3SNM A;  5I8S A;  2R06 2;  1OA3 A;  1JZ3 A;  3ZXK A;  5LEK A;  5FKC A;  4WM7 A;  3AXE A;  5LY2 A;  1VBC 3;  3HQR A;  2G19 A;  1S55 A;  2IC1 A;  1VBB 2;  1TZO A;  4GA9 A;  2VNO A;  4HVO A;  3VBR A;  4LUM A;  3D0S A;  4JHT A;  4ARY A;  4XAE A;  1W0N A;  5FK8 A;  4DY5 A;  1UKG A;  3VD9 A;  5FOB B;  3OUH A;  3T0D A;  1UY4 A;  3POW A;  4XHB A;  1PMI A;  5T50 A;  4O9G A;  4ITC A;  2FBE A;  3BPZ A;  1AXY A;  1GP6 A;  2JD4 A;  4BZ4 A;  5DAW A;  4N7I A;  3UJQ A;  5EZW A;  3VUO A;  4XQD A;  3VL8 A;  5BNN B;  3ZXA C;  1V00 A;  1Q5O A;  3TYJ A;  3R4U A;  1DCS A;  1JOP A;  1C5I A;  3VD5 A;  4DXT A;  3ECQ A;  2ZGQ A;  3NV1 A;  3PUQ A;  4BK5 A;  4CEY C;  4AGR A;  2CGN A;  1SCS A;  1IPJ A;  3LFI A;  4MGS A;  2GU9 A;  2DYC A;  1VR3 A;  3TN9 2;  1VLN A;  1SDW A;  2PXJ A;  2ZAB A;  4IGP A;  1DQ6 A;  1UKR A;  4KL1 A;  5DZG A;  1RUJ 1;  3W5N A;  1CJD A;  2WT2 A;  2WA3 A;  1VRB A;  1QNW A;  4MVT A;  5J3U A;  3H8X A;  1PO2 3;  3MV0 1;  1F35 A;  5FY7 A;  3VBS A;  1GUI A;  2ZGM A;  1L3J A;  4J1W A;  3VZN A;  2GND A;  3VBH A;  1D4M 2;  3MIF A;  3Q9O A;  2ZGO A;  2D44 A;  1MZF A;  4YVS C;  5KBF A;  1OLM E;  2VR4 A;  2R16 A;  3WZ1 A;  4DXS A;  5C3R A;  1W06 A;  4UYB A;  2YY1 A;  4YW4 A;  3LDB A;  2EXH A;  1CAV B;  3MDP A;  1RUJ 3;  3OEA A;  3AKP A;  4PI2 A;  4E4H A;  4GWN A;  3AZX A;  4E27 A;  2XHK A;  3AKT A;  2MHF A;  1HW5 A;  4NVP A;  4LIT A;  1FT9 A;  4COU A;  4N9H A;  2BYV E;  1AL0 G;  1WUV A;  2ZZQ A;  4LNV A;  5EJZ B;  1ND2 C;  4FAG A;  1APN A;  4IQP A;  5A3P A;  4MXV A;  1RIN A;  4OQ8 A;  1DGR A;  1VBE 3;  2I74 A;  1FNY A;  2ZOE B;  2Q1Z B;  1O4Z A;  4W4Z A;  4COZ A;  3BGA A;  2YPD A;  1S2K A;  5LBF A;  3BIW E;  4LO5 B;  3VZJ A;  3M3Q A;  1I1E A;  4I2O A;  3AMH A;  2O14 A;  2W47 A;  5CZK A;  4PDW B;  3B9C A;  4NWW A;  2ZX0 A;  5K7P A;  2XUE A;  1JXN A;  1IOA A;  2A73 B;  4KQ7 A;  4QX3 A;  5FO9 B;  3ZSE A;  1KGY A;  1BEV 2;  1OUR A;  2O8O A;  4X8N A;  5A7W A;  1F5J A;  1NXM A;  3GBF A;  4NIG A;  4BMB A;  3G7D A;  5T5O A;  2WN2 A;  2JX9 A;  2WS9 1;  4M0N A;  4TLF A;  4Y4Y A;  4LBQ B;  3SIS A;  2RS1 1;  5FY9 A;  1GV9 A;  3BOW A;  3GGL A;  2YXS A;  3UGF A;  3THC A;  1I5P A;  3J7H A;  4CP9 B;  2PAM A;  4HXC A;  1RUD 3;  3B93 A;  3OY8 B;  4OUE A;  2VE1 A;  5I8T A;  3D0J A;  4XIO A;  2I45 A;  1PM7 A;  1AR9 3;  4WM8 B;  2D93 A;  4AGG A;  2VXR A;  1UY3 A;  4RHV 1;  1RMU 1;  1X82 A;  1W2N A;  1XNC A;  3E5Q A;  2ZAC A;  3I3B A;  2VVE A;  3BU7 A;  4PLM A;  2RS1 3;  3III A;  1A8M A;  3OD4 A;  3DXU A;  5FXX A;  2ETE A;  3F95 A;  3SIT A;  1QJY 1;  5GLV A;  3EJK A;  1POV 1;  4FP2 A;  1D0H A;  3V0A B;  1MS1 A;  5JSO A;  2NMO A;  4LJH A;  4OVE A;  2ADD A;  1X36 A;  5EPA A;  5KHG A;  1D4V B;  1UZW A;  1RMU 3;  4RYD A;  4UT5 A;  2UU8 A;  4FPJ A;  2RVA A;  5C4W B;  5FYU A;  2VZS A;  4FPE A;  4JDN A;  4AEK A;  2NQY A;  3NNG A;  2IUW A;  1UY1 A;  3G6J B;  3MFA A;  3WNK A;  3KGL A;  4R9B A;  3AX4 A;  1NLS A;  2JDM A;  2UY8 A;  1W28 A;  3AZW A;  1XXN A;  2K9Z A;  3WF2 A;  4QT6 A;  4XW3 A;  5K0U C;  1LHU A;  3NAP B;  1JZ7 A;  4CDX C;  1GSL A;  5F6K A;  4ISQ A;  1OVP A;  1CZS A;  4ES9 A;  1NLQ A;  1G6N A;  3PL0 A;  3B01 A;  2QQJ A;  3OYW B;  3Q8F A;  4XF3 A;  2RS5 2;  3LEM A;  1AYM 1;  1S2B A;  2WN3 A;  1MR5 A;  2EA7 A;  4FOQ A;  4IEV A;  1CN1 A;  5F37 A;  3UKT A;  2CSG A;  5FZ4 A;  3ZDV A;  1QOS A;  1H2M A;  3NJX A;  5A6Q A;  1RED A;  3WF3 A;  4AHX A;  4B8E A;  5BNO A;  3MUZ 1;  4G4F A;  2FD8 A;  4IEP A;  1UU6 A;  5GZC A;  4GAZ A;  2P37 A;  3VHR A;  4H14 A;  4BIF A;  1ZZB A;  2XKP A;  3HEI A;  5JAX A;  1C4R A;  1LB2 A;  2FDK A;  3RQ0 A;  4CZS A;  5BYN A;  4AFD A;  2W08 A;  2BFU S;  2VCC A;  3MYX A;  1IHM A;  1PZ8 A;  3IKW A;  5T5J A;  1PGL 2;  5A3U A;  4ZZ5 A;  5L73 A;  2B9U A;  1L7L A;  4A3X A;  2E7A A;  5ABJ C;  1RHI 3;  1G9F A;  2ZKN A;  2XJT A;  2JIC A;  2Y6K A;  3NNJ A;  4NUB A;  1QJU 2;  2ZEX A;  2Z2S B;  3R6S A;  2R7E B;  5C8C C;  1JS9 A;  1N1V A;  1AYN 2;  3LEI A;  1UNB A;  2B45 X;  5ISL A;  4F3J A;  3KT7 A;  2UYB A;  2BV4 A;  4K8R B;  2AZ5 A;  1ASJ 2;  1KFU L;  4QB6 A;  3A4U A;  3IWZ A;  2GSY A;  1LAJ A;  1W2T A;  1WLW A;  1VPH A;  4AHZ A;  3O1U A;  3B00 A;  5FUP A;  1IKQ A;  1OH4 A;  1PMH X;  2Q4S A;  5FZI A;  1BXH A;  4CXX A;  2HWC 1;  2DU1 A;  5F8P A;  4G9S B;  1FOD 3;  2OXB A;  5FPB A;  3P1I A;  5EV7 A;  4S2D A;  2W87 A;  3VDD B;  3WP4 A;  1MPX A;  3SH3 A;  1JU4 A;  5FLH A;  4CEY B;  3I2I A;  5JLV A;  2WQZ C;  4KG0 A;  3ENR A;  2JDP A;  4MO3 M;  2VMG A;  1YLL A;  2YBP A;  2DF7 A;  2VOX A;  1AR8 3;  1RGS A;  2ZA9 A;  3E6B A;  4YM1 A;  5D2A A;  3I3M A;  1O4T A;  3ZYP A;  1SLB A;  4AK3 A;  5FCC A;  2CDO A;  2A6V A;  5FV3 A;  2ZGL A;  3OF1 A;  1Y9M A;  2VZV A;  3LOI A;  2JXA A;  3JBG 3;  3SMH A;  3WT3 A;  3LPF A;  1MEC 2;  4HL0 A;  4IE4 A;  4ASM B;  1GWK A;  2J22 A;  1COV 1;  4XFG A;  2JDH A;  1EY2 A;  4Q4X 1;  4N53 A;  3SKV A;  1CIY A;  4MV2 A;  4YVS B;  2OA2 A;  1HN0 A;  1LHO A;  3JQW A;  3L2H A;  1J84 A;  2WYS A;  5FLJ A;  3EO6 A;  5FPZ A;  1TNF A;  3ZSL A;  5FPX A;  1EP0 A;  1UIK A;  4GH4 C;  3IDE A;  2H6B A;  3MW4 A;  4GD4 A;  3PIG A;  4ZPI A;  4AVV A;  5KXC A;  2ORX A;  4OHW A;  5L9B A;  2ZGS A;  3FL7 A;  5CG9 A;  5L7O A;  4NN0 A;  1ND2 B;  4LO4 B;  2YMZ A;  1COV 3;  3WOG A;  2NN8 A;  4Q4X 3;  4BOW A;  4XDO A;  1JOD A;  3PDQ A;  4LO8 A;  2OUH A;  2D6O X;  4I01 A;  4Q0U A;  5FYM A;  1BQP A;  5HV0 A;  1CIW A;  4MXW B;  3H3L A;  5F3E A;  2WNU A;  4WVZ A;  3LFM A;  1SCR A;  1XYN A;  4QPG C;  1V6N A;  2WJS A;  1E57 A;  1OC1 A;  2WFP A;  1IG3 A;  1H8T A;  2OZJ A;  3RZG A;  2DV9 A;  5LAS A;  1UOF A;  1IZ3 A;  4HPK B;  3J7N A;  2D6K A;  2YRO A;  4XFC A;  1MVE A;  3CDZ B;  1XE8 A;  1LOF A;  2YUE A;  1CAW A;  3T08 A;  2RJ2 A;  4C0B A;  4Y1X A;  1RUC 1;  2ZPX A;  5FJH A;  2RMU 1;  4QKF A;  5IFP A;  1XNT A;  2PN5 A;  4BQ5 A;  5IHR A;  1TME 2;  4HN0 A;  5BY5 A;  4EWE A;  1HRV 3;  3JD7 2;  4XJW A;  3WDV A;  4I0B A;  2VGD A;  4X8P A;  4QQL A;  3RZZ A;  4E2S A;  5FQ0 A;  1TQ5 A;  3TEX A;  1GAN A;  1ZA7 A;  2B7Y A;  1YUD A;  5AC9 1;  1RUC 3;  4R4Z A;  4D3W A;  2RMU 3;  1DF0 A;  4F8A A;  4C90 A;  1PK6 C;  3TBD A;  1W2U A;  4AVB A;  2YFU A;  2HEV F;  2WO7 A;  3RRD A;  2VW2 A;  5CVR A;  3FWE A;  4DZG A;  4Y24 A;  3OG2 A;  3MPP G;  3QH6 A;  5D8A C;  3I2H A;  5FFO C;  5JR2 A;  3FE5 A;  5C3P A;  1XU1 A;  1GZT A;  4SLI A;  2D7F A;  3R0R A;  2P3I A;  2R04 2;  2Q1F A;  3ZXG A;  1W6P A;  3FHQ A;  1M06 G;  2Q0A A;  4FQ4 A;  4WZC A;  4Q1R A;  2HWB 2;  3WNO A;  1N47 A;  4Q4Y 2;  4EN8 B;  4EWD A;  4FCA A;  2WZR 1;  4MX3 A;  3IZO A;  5C6C A;  4Q5O A;  1BK0 A;  1H9P A;  2ZBJ A;  1VAV A;  2DTY A;  2VUA A;  4Y22 B;  5CEH A;  4DUX A;  1LGB A;  4L8Q A;  2CWS A;  1HB3 A;  4HBN A;  1OQD A;  2SLI A;  5EWS A;  2DFB A;  2N7G A;  2XQR A;  2VNV A;  4DUV A;  1AJK A;  5ACA 3;  4YGE A;  3ORJ A;  4BQW A;  4NAO A;  1RUI 1;  2ES3 A;  2BGO A;  2QBX A;  4GJY A;  4ZS3 A;  4CUC A;  4XQW A;  1R64 A;  3H0O A;  3IMN A;  5BPX A;  4CDX B;  5K0U B;  2LS6 A;  5BNN A;  1GKB A;  4U36 A;  1MS3 A;  3ATG A;  3HT2 A;  3WNX A;  4JVA A;  4XJ9 A;  4FPG A;  3WP6 A;  4HVQ A;  4LBJ A;  3KHC A;  4FP3 A;  2W52 A;  1KEX A;  5JMC A;  3UNP A;  4KH9 A;  5LA9 A;  2V73 A;  2LM3 A;  3RI8 A;  1JYT A;  4QPW A;  2ZGT A;  1LOB A;  1UU5 A;  2HEW F;  2TBV A;  2PHW A;  4QXK A;  4BPZ A;  1UWW A;  1LEM A;  1RUI 3;  2JIG A;  3AP7 A;  3O5S A;  3WCR A;  1UXX X;  2BW8 A;  5BUV A;  3KQ4 B;  2WNV C;  5GKA C;  5F39 A;  3P3N A;  2CU5 A;  3IAQ A;  4PF5 A;  2LRO A;  2EVX A;  4LPL A;  4JHZ A;  3JB8 A;  4Y20 B;  1UIJ A;  5C7G A;  4IV3 C;  1PNF A;  1I6X A;  5DUW A;  5DAB A;  1A6C A;  4YYO A;  3ZO0 B;  1CZV A;  2GC2 A;  3MV1 1;  1FMD 2;  2ARX A;  2MEV 2;  4LEJ A;  5J96 B;  1C28 A;  1CX4 A;  4Q29 A;  1CAV A;  5C5T A;  5ABJ B;  1OKQ A;  3LA3 A;  1YQ6 A;  3FLT A;  4COV A;  1KIT A;  5C8C B;  1YQ8 A;  5A33 A;  3GDB A;  4MZU A;  3JZV A;  5DZE A;  3RMY A;  4JV4 A;  4LKS A;  3IMM A;  4DO0 A;  1EV1 2;  4CTE A;  1QKQ A;  1YIP A;  1MS4 A;  4ERO A;  3OPT A;  4V2W A;  2QE3 A;  1WMF A;  3AB0 A;  2ZHN A;  4PIY A;  5KHK A;  2XJP A;  1J3P A;  5L19 A;  4TSV A;  3O1R A;  4OFG A;  4DPN A;  1US3 A;  1DGW A;  4QPI C;  5IK4 A;  3FBM A;  5DDJ 2;  2D6N A;  3DXT A;  3TEZ A;  2X5I C;  3MID A;  1HB1 A;  4BH9 A;  1VBA 1;  5CKM A;  5FYS A;  4AED A;  1KS5 A;  2IFW A;  3H7Y A;  4CDW C;  3OBT A;  2R06 1;  5F2W A;  4LIV A;  4HSL A;  2VVF A;  5FRE A;  3ZR5 A;  4BQX A;  4YZ1 A;  3V0B A;  2XGX A;  1EUU A;  2B42 B;  4Y4R A;  4LBQ A;  4CXY A;  2HWD 3;  2R32 A;  3FUQ A;  5CG8 A;  1S1A A;  2E6V A;  4CP9 A;  3NW4 A;  3P3P A;  4XPV A;  3OY8 A;  3RYP A;  1Y43 B;  1VBA 3;  4KGQ A;  3AMM A;  3K4Z A;  3PU8 A;  2XKO A;  1QU0 A;  1OLQ A;  4KG8 A;  4CXW A;  1KDK A;  1RUG 3;  4WM8 A;  1UZZ A;  1QEX A;  4RFT 0;  2A6W A;  4UW3 A;  1FPN 1;  1DDL A;  1CPM A;  4XMI A;  3U37 A;  4QXH A;  2J1U A;  4BE3 A;  1NCR C;  4GH4 B;  4HSJ A;  1D0G A;  4YGC A;  5F3G A;  1QNY A;  3MLL A;  4XDQ A;  3V0A A;  3BU0 A;  1FAY A;  2LW8 A;  5LA1 A;  1R08 2;  4LHN A;  2YC2 A;  1JYV A;  2BPA 2;  2R07 1;  3MO4 A;  4OI4 A;  5FYY A;  4K20 A;  5JSP A;  2I07 B;  1RIT A;  2WBK A;  1FPN 3;  3PNA A;  5C4W A;  4L9B A;  1SLC A;  1ZZ7 A;  4FFH A;  3ME2 A;  4QPG B;  4W6W A;  3W9A A;  5BNP C;  1EAH 3;  1VAL A;  1OPM A;  3WUC A;  1H0B A;  3B02 A;  1H9W A;  1ZZ6 A;  1YFX A;  5IJR A;  1WMX A;  4D7Y A;  3U07 A;  4MOA A;  3HT1 A;  2VTX A;  2VVD A;  4QX1 A;  3AP9 A;  2B4K A;  2JDU A;  2Y60 A;  1NY7 2;  1JHN A;  1W8F A;  1ALY A;  2E31 A;  2R07 3;  2YHJ A;  4OLL A;  3SKJ E;  3I2O A;  3VKF C;  4OHV A;  1UPS A;  3F2Z A;  4P02 B;  4XVH A;  2VMF A;  1QXR A;  1SFY A;  3EBR A;  2HJI A;  5JVV A;  2WFF 1;  4LE3 A;  3OYW A;  2Q1M A;  2CL2 A;  2ZKL A;  4FT8 A;  4PI0 A;  2F4P A;  5F32 A;  3T09 A;  5KC6 A;  3TEW A;  4UFM A;  5GLU A;  3VKL A;  3TOJ A;  5FZ3 A;  1J3Q A;  1SQ4 A;  5T5L A;  5B4X A;  5FZF A;  1UPI A;  4RR3 C;  4UW6 A;  5FZG A;  5LAT A;  3PME A;  1WW5 A;  3OBR A;  4YM3 A;  4LBK A;  4QB1 A;  5DPN A;  3WNL A;  1PK6 B;  3NV2 A;  5DG2 A;  3MBW A;  2WFF 3;  1WCD J;  4GJZ A;  1NLR A;  1CQ9 A;  2JEC A;  3QD6 A;  5D8A B;  1AJO A;  2A70 A;  1UN1 A;  3HBK A;  3LDK A;  3NST A;  4QQO A;  4NRM A;  2WIN B;  5JZG A;  5TSW A;  1WD3 A;  3ZX7 A;  1BEV 1;  1WW4 A;  3X29 B;  3T1L A;  5KHH A;  1REE A;  1PVC 2;  1S0I A;  4E4S A;  1GU3 A;  3T0B A;  1F9K A;  1VMH A;  1ENQ A;  5FKB A;  5A3O A;  5C33 A;  2NP0 A;  4AW7 A;  5GLZ A;  2KD7 A;  1AR6 2;  5IK8 A;  1OFS A;  1STM A;  3MHZ A;  3RMX A;  2JDZ A;  1W6Q B;  1W6M B;  2DDU A;  2XVG A;  4C1W A;  4B7K A;  3PUR A;  3EXU A;  2XDV A;  5GM0 A;  1FX5 A;  3DF0 A;  4YVW C;  4A41 A;  5FYT A;  3N9P A;  4MGI E;  1AL2 1;  1H30 A;  4JKM A;  1N1S A;  4CEY A;  3A0N A;  1YFU A;  1GOF A;  1PHM A;  3ZXL A;  1ZRC A;  2Q30 A;  1I5Z A;  1ZBE 3;  2K0G A;  1LEN A;  5ERL A;  1ULP A;  1TMF 1;  2RJK A;  1UO9 A;  1UZY A;  1WMD A;  2D98 A;  5GAL A;  3VDA A;  2QQW A;  3WDT A;  1RVF 2;  2W1Q A;  2WNV B;  2ARB A;  5J09 A;  1H8V A;  5FRA A;  2C24 A;  2WSV A;  1XNB A;  2ZGU A;  4WVV A;  5GZF A;  2ARC A;  4LHK A;  1AL2 3;  3D4K A;  5J7M A;  3CKH A;  3AK0 A;  4OYU A;  3WNN A;  4FPY A;  1IPS A;  1VAM A;  4IV3 B;  2GNM A;  4YVS A;  4YZ2 A;  3PU3 A;  1V6I A;  2FCV A;  1TMF 3;  1W9F A;  2UWB A;  3WW1 A;  4D7S A;  1SBD A;  3MUY 1;  3KQR A;  1GZW B;  2J1S A;  5JPN B;  1K5M C;  4MGT A;  4M4P A;  5FZK A;  5FY1 A;  4ATE A;  5AFB A;  1NG0 A;  1GMM A;  1OQE A;  1A8D A;  3ZFF C;  3K75 B;  3GZU C;  1ND2 A;  5E16 A;  4XFI A;  3LCP A;  2F6B A;  1ONA A;  2XJU A;  1IKP A;  2AAC A;  3AYC A;  1V9U 2;  1XJA A;  3USS A;  2HWE 2;  2G9G A;  3IDC B;  1WW6 A;  4IV1 C;  5JCT A;  1JUH A;  2RJL A;  1R1A 3;  1N1Y A;  4QMA A;  4R52 A;  1VBD 2;  2D43 A;  3PVE A;  4QPI B;  3BOD A;  4XIL A;  3T3Y A;  3UET A;  1UOJ A;  4HPK A;  1QQP 1;  2X5I B;  3RGB A;  5AVP A;  2VTF A;  2DCT A;  1R1Z A;  1LOA A;  4XF9 A;  3ZOI A;  3PUS A;  2QVS B;  4BK4 A;  5JWP A;  4CDW B;  1R09 2;  1HXS 2;  4FVV A;  1YI7 A;  2BGP A;  2Y64 A;  2WWJ A;  5EYY A;  3ZLI A;  4NHX A;  2P5B A;  3ZSJ A;  1QJU 1;  3BTX A;  4MG2 A;  2PHR A;  2W91 A;  3E5U A;  1QQP 3;  3A22 A;  3QAC A;  4NPL A;  1AYN 1;  2FMD A;  4LKD A;  4CCC A;  3IAP A;  2WII B;  4DXZ A;  5A7Q A;  2WO1 A;  5J48 A;  5JOW A;  1OUX A;  2V5D A;  1XNK A;  1LU1 A;  4HMZ A;  4EWA A;  2XBO 1;  1YYN A;  5C9A C;  2XOM A;  3AYD A;  4P5H A;  3W21 A;  1QDO A;  2EIG A;  5IWF A;  1QJE A;  3WVJ A;  1NCR B;  1SLA A;  3TWI A;  3AFK A;  5E88 A;  2VY0 A;  4JGY C;  4H7L A;  2C0Z A;  4DEV A;  2VZ1 A;  3VD7 A;  1RUF 2;  2PQQ A;  3GCW A;  1C57 A;  3HN1 A;  2E7Q A;  2H6C A;  3CJI C;  1S0C A;  2PEL A;  1ACC A;  2QNK A;  4IGQ A;  4QX5 A;  5FAX A;  3ROU A;  2XBO 3;  4XUQ A;  1JOJ A;  5BNP B;  2QQV A;  3PUI A;  4KI5 M;  2ENR A;  1PIV 3;  1Y9Q A;  4COY A;  1W6P B;  4D94 A;  2VMC A;  1SFP A;  2JDN A;  4URT A;  4Y22 A;  1OD3 A;  4QHO A;  3ZR6 A;  3I7D A;  3THD A;  3LPG A;  2J1A A;  1HQW A;  4LKE A;  3FHI B;  1SZB A;  3SEP A;  3VHO A;  5IVV A;  3VZM A;  5JIU A;  1TVG A;  2QZ3 A;  4BLJ A;  1OXC A;  1KXG A;  3FBY A;  3J7L A;  3JQX A;  3MLJ A;  3P6B A;  5K0U A;  4AGV A;  5FIX A;  4AHY A;  4A7Z A;  4CDX A;  1L7Q A;  2JDY A;  2WWS A;  2O8Q A;  4CE8 A;  4ET7 A;  1RUO A;  1UU4 A;  1GNZ A;  1NQJ A;  3QH7 A;  1AR7 2;  1XPW A;  4AYU A;  2ZS6 B;  1O5U A;  4LO7 A;  4F83 A;  1BBT 2;  3JU9 A;  2VQA A;  2A3Y A;  1IS6 A;  3RWN A;  3C8X A;  1CJP A;  2V4V A;  5JI7 A;  4GB3 1;  1W6N B;  4XFA A;  1ZBA 1;  3KWV A;  1L7R A;  1HRI 2;  3OGV A;  5L9R A;  1RUH 1;  2EIE A;  1GLH A;  4RR3 B;  4M3C F;  1GNY A;  4AR2 A;  1GIC A;  1GZC A;  2EIB A;  2YDE A;  2Z69 A;  5FZ9 A;  4CCD A;  1U5I A;  4IW3 A;  3KF3 A;  3IT8 A;  4XE9 A;  1G9D A;  3KV9 A;  2HYX A;  3WDW A;  4Y20 A;  3V65 A;  3HD8 B;  4GB3 3;  1TEI A;  3IPV A;  1YFY A;  1W90 A;  1ZBA 3;  3MIB A;  4EV0 A;  1WA6 X;  5AFE A;  3DGT A;  1RUH 3;  4BYY A;  1RXG A;  4CU7 A;  1S0G A;  3N7M A;  5ABJ A;  2X8K A;  3D82 A;  5H9R A;  4RFR B;  4FPL A;  5JMO A;  2ZGR A;  2AR6 A;  4G3Y C;  3GYD A;  1U0A A;  4PQ9 A;  5LRS A;  3DEC A;  1VRH 2;  5C8C A;  3VKM A;  3LEK A;  1X8E A;  3KHB A;  4LXL A;  4QKD A;  4BQ3 A;  2OPW A;  4O9E A;  5KXD A;  2E32 A;  3O1V A;  4K9S A;  2FZ2 A;  3JD7 1;  4HAN A;  5DG1 A;  5GLT A;  3A21 A;  1UYZ A;  2VQT A;  3CHX A;  3I3E A;  1W8O A;  2IWG B;  5A1A A;  4NIH A;  1C3H A;  4J1X A;  4OUS A;  1RUE 1;  5FZO B;  3U75 A;  3IBM A;  5A33 B;  5JXI A;  2WUH A;  4CCJ A;  5M0T A;  4AFM A;  1DQ1 A;  3WP3 A;  5CBL A;  2TNF A;  1WBF A;  1OVS A;  4YNI A;  1DQ4 A;  4YVW B;  2K46 A;  2PLV 2;  2WWU A;  3UGG A;  4P9W A;  2BVB A;  3ZXF A;  3BYW A;  4HON A;  2VXJ A;  4TXW A;  4FTB A;  3E97 A;  3SEE A;  2F4L A;  4Q8K A;  3BTZ A;  3CF6 E;  3LQC A;  1H6X A;  2JKX A;  3R05 A;  3GZT B;  1RUE 3;  1HKD A;  2RDR A;  2XG3 A;  1DQ2 A;  1WD4 A;  4XJZ A;  2BU9 A;  2G9Z A;  4GAL A;  4Q0Q A;  2HWB 1;  2X53 S;  1OLM A;  4AOC A;  4XUO A;  4CA9 A;  4PIX A;  1D2S A;  2ZGP A;  4AED B;  4ASK A;  1CVN A;  4D0Q A;  2JE9 A;  5GLW A;  2GC1 A;  5LCW L;  2UWC A;  2XJS A;  1ST8 A;  2E7T A;  4LIU A;  3WQB A;  1XND A;  3V0B B;  3VZL A;  3VBU C;  4GKX A;  3NKG A;  3MEP A;  2RR1 1;  5FY5 A;  3NNF A;  4K1Z A;  2VBB A;  3ZSK A;  5FMD A;  2FHR A;  4FTE A;  1HB2 A;  3NV4 A;  3ALQ A;  1H4G A;  2A3X A;  2VBD A;  2ZX2 A;  4GH4 A;  4KBB A;  4CDQ C;  1K5M B;  2YV8 A;  3AYA A;  2RE9 A;  4EE2 A;  3TEY A;  1F4H A;  2D3R A;  5FJK A;  3NJZ A;  3VV1 A;  3I4I A;  3ZFF B;  2WS9 3;  1HQL A;  2R0H A;  1OKO A;  2A71 A;  2W94 A;  2ZML A;  3ZYJ B;  2BQP A;  2AEZ A;  3J8F 2;  3DEM A;  2GAL A;  2XL7 A;  3IB3 A;  4Q4V 1;  4E4Z A;  1C8M 2;  2RR1 3;  5C5U A;  3UGH A;  5FZL A;  1YCI A;  4QPG A;  2IXJ A;  3RZJ A;  4IV1 B;  1VMF A;  1FYU A;  4AE2 A;  1DLC A;  3OBA A;  1CON A;  4CSW A;  2VG9 A;  2MNG A;  4OHY A;  4A42 A;  4HG6 B;  2G9F A;  3CJX A;  4SBV A;  4GMP 0;  3T4H B;  4AQS A;  4AXO A;  4RHV 3;  2RM2 1;  4YM2 A;  1DHK B;  5A3T A;  1XYO A;  3K77 A;  4CRQ A;  1GNH A;  3DUI A;  4OUL A;  2VME A;  4Q4V 3;  4K40 A;  3N35 A;  1GQP A;  4V2V A;  2W1S A;  4AVT A;  1FAT A;  4NHM A;  1QF3 A;  2MEV 1;  3KS7 A;  3UL2 A;  2JG8 C;  1QJY 3;  2BOJ A;  5FYC A;  1POV 3;  4P5Y A;  1O8P A;  2DUP A;  4AG4 A;  2W0X A;  5IAV A;  1W3V A;  4IUG A;  4URA A;  1IS5 A;  1OHF A;  1YO8 A;  2QUO A;  4KWL A;  4GZ9 A;  2ZMK A;  2HWF 2;  5DUU A;  5IVB A;  2RM2 3;  2BNO A;  4OI1 A;  4A6O A;  1JYN A;  5EXO A;  1K3I A;  2FDI A;  3AKR A;  1EV1 1;  1WA4 A;  3K4D A;  1QOT A;  1SLL A;  4NWV A;  4Q4W 2;  3ZFG C;  3ZPO A;  2BDR A;  3KSC A;  4YLZ A;  5C9A B;  1PK6 A;  3H9A A;  3I3Q A;  3H3Z A;  3R4S A;  5FMB A;  4R4X A;  5HBA A;  4JC1 A;  4NRQ A;  1W8W A;  4JRL A;  1VB4 A;  2GP5 A;  3FFZ A;  3S5Q A;  2GMM A;  4JGY B;  4PF1 A;  5D8A A;  5DDJ 1;  1DQ0 A;  1H1M A;  2NYY A;  2YPJ A;  2BVV A;  4KWU A;  4UOJ A;  3TNQ A;  1ZX5 A;  5LK7 B;  4EJR A;  1DZR A;  2CAV A;  1HV0 A;  2IVJ A;  2QDN A;  2LTN A;  3VZO A;  1AYM 3;  4B1M A;  3WR0 A;  3AZV A;  5JZG B;  4MLO A;  5DN2 A;  3RFR A;  4J25 A;  1DG6 A;  1W6O B;  3FUO A;  3FLR A;  3BOP A;  3KGZ A;  2ZHK A;  2VZO A;  2PAE A;  3IM0 A;  3PTR B;  2BZD A;  4LLF A;  5DXD A;  4BCU A;  1YFW A;  5FBJ A;  4EN9 B;  4XUR A;  5L7O C;  4UBG A;  1UY2 A;  3MIG A;  4XBN A;  1KD7 A;  1W6Q A;  1LJ7 A;  1W6M A;  1OBN A;  1G9A A;  3J9S A;  1QH7 A;  1BK1 A;  3NL1 A;  4K6B A;  5H9S A;  3WNP A;  5KC5 A;  3M3I A;  3I8T A;  4BB3 A;  4ZXK A;  2XQX A;  1O3Q A;  1QIQ A;  3ST7 A;  1W8T A;  3Q8B A;  2GMP A;  1SFN A;  1IQA A;  3AL5 A;  2B39 A;  3MF6 A;  1SLI A;  1J59 A;  3PHM A;  1BVP 1;  1JUI A;  3WF0 A;  3T2O A;  5EJ3 A;  2Q8C A;  2VUL A;  2WQ8 A;  2DVB A;  2QFE A;  2RDN A;  1R08 1;  1REF A;  3OGG A;  3ZXE A;  4CPB D;  1W99 A;  2WNV A;  5CIR A;  2PHF A;  4ZU7 A;  4D8M A;  5KR7 A;  1JMU B;  4QD2 A;  3BAL A;  3ZN5 A;  1NX9 A;  4BXF A;  3Q8C A;  2AEN A;  3AJY A;  3VKN A;  4YGB A;  4ARX A;  4CP0 A;  1JI6 A;  3M7A A;  3P5B A;  3WG3 A;  1F8V A;  4ORF A;  4LBO A;  1WLD A;  1VP6 A;  3BPS A;  2WT1 A;  2OX0 A;  2HWC 3;  1YNA A;  2VTX J;  4IV3 A;  4QM8 A;  4XEZ A;  4DXR A;  2YGM A;  2PQS A;  4PLN A;  3KCY A;  5A1L A;  5F3C A;  1NY7 1;  3O14 A;  1UYX A;  3A23 A;  1EPW A;  1GZW A;  2Y26 A;  2FZ1 A;  2JEM A;  4UFI A;  1VBC 2;  4BQ4 A;  1W2O A;  3VHP A;  1YEW A;  3U11 A;  1PO1 2;  1H6Y A;  2EXK A;  3POF A;  5EYX A;  4AEJ A;  4E4D X;  1TE1 B;  2VM9 A;  2X09 A;  1JZ6 A;  3RG0 A;  1DZQ A;  1MQT C;  1DYP A;  1ZZ8 A;  5LY1 A;  1SEF A;  3VN4 A;  1Z7S 1;  3BTA A;  5A6Z A;  4QPI A;  1Q56 A;  5EHD A;  3KM5 A;  2X5I A;  1O3R A;  5F5C A;  4GWI A;  5JSR A;  3S30 A;  5C3S A;  3K4A A;  2X10 A;  4DQA A;  1DIW A;  4A7Y A;  4CDW A;  3LIH A;  3H1W A;  4A7K A;  5F2S A;  4CVU A;  1QGL A;  1HV1 A;  1UX6 A;  2HH9 A;  2QQU A;  3N9M A;  2YC4 A;  4FPO B;  1M4W A;  2J1E A;  4RGK A;  5CB7 A;  3SCF A;  3N36 A;  4CEW B;  4I0A A;  1Z7S 3;  3WF1 A;  3GF6 A;  3GJA A;  1GBG A;  4KMQ A;  2F17 A;  4RA0 A;  2DVA A;  4S2F A;  4ES8 A;  1PO2 2;  4YW7 A;  3HJR A;  2R0F A;  3H8U A;  3OGS A;  5CA6 A;  3QCW A;  4I3G A;  3O1O A;  2QQP A;  3VBU B;  1YIF A;  3I59 B;  3QOP A;  4P9I A;  5JUV A;  1Y7B A;  1QJF A;  1OMI A;  2YYO A;  4YG6 A;  1NXD 1;  5DZF A;  4CP2 A;  4COW A;  2P3K A;  3LEG A;  1AX0 A;  5FZB A;  1K42 A;  1NCR A;  1HJG A;  1DGW X;  2V4A A;  4CDQ B;  4Y3O A;  1N3O A;  1YRZ A;  1ZRI A;  3CQO A;  1HIX A;  2GP3 A;  3ZIW A;  1P8J A;  3MFC A;  3ZMN A;  1WCU A;  2D5H A;  5IVY A;  5KXE A;  1UQX A;  2SBA A;  4IEQ A;  1G8W A;  4E2G A;  1PZ7 A;  1VBE 2;  4MGQ A;  1DBN A;  2JIJ A;  4BQ2 A;  3WP5 A;  5BNP A;  1JTZ X;  1F15 A;  1RVF 1;  3GCX A;  2CGO A;  2FMY A;  1JYI A;  4P9L A;  5FXV A;  1G9B A;  5AC9 3;  2ZGN A;  4XAA A;  3SLI A;  3KLS A;  4RQP C;  4OHX A;  3WLU A;  2BOI A;  2E51 A;  2WDB A;  1CAX B;  1E5I A;  4Q0S A;  2CNA A;  4LHS A;  2CHH A;  4XET A;  1EPZ A;  3I2G A;  3PUH A;  2YBK A;  4XTP A;  4AAP A;  3APB A;  4IEO A;  5FY8 A;  1JZ8 A;  4XFH A;  3A0K A;  5FDB A;  2JG8 B;  3H42 B;  2JE8 A;  5DUV A;  1BMV 1;  2ZZJ A;  2C9A A;  4Q8L A;  4XF4 A;  4GXL A;  4XTM A;  3OOX A;  3T2Q A;  1W6N A;  1WME A;  1CR7 A;  4XIK A;  4LOS A;  2G1M A;  2WZR 3;  1MS8 A;  2D6L X;  3AKS A;  1JH5 A;  4JKK A;  1RUD 2;  3O0W A;  3PTY A;  1T6G C;  2OQ7 A;  2H0B A;  4RR3 A;  3O7O A;  3THT A;  2AC1 A;  5FZE A;  4Q0P A;  1DGL A;  2DCY A;  2ZAA A;  1I9R A;  2ORZ A;  4NE9 A;  1AR9 2;  2WNE A;  4PIZ A;  4GUL A;  3GZE A;  4CUG A;  2JD9 A;  2PA7 A;  4A3Z A;  3HMY A;  1A34 A;  5LW9 A;  1VBD 1;  2RS1 2;  3E6D A;  4EZH A;  3HNB M;  2W1U A;  3OCP A;  3ZXJ A;  5LBE A;  4LBQ D;  4HK8 A;  3RS6 A;  4P9G A;  3AP4 A;  3OBZ A;  4JDO A;  2ERF A;  2A5Z A;  2WZ8 A;  1FI2 A;  3BCW A;  4YZ5 A;  1GFF 2;  2VL4 A;  2Q8O A;  4PT6 A;  3POE A;  1R09 1;  5DAP A;  1HXS 1;  5C70 A;  2WZE A;  3FFQ A;  2W92 A;  3IPV B;  5EP9 A;  2ADE A;  1C1F A;  4Q2F A;  1US2 A;  3H3U A;  3N7K A;  4B4P A;  4D7T A;  4WBB A;  1OOP C;  3WSO A;  5CIS A;  1UZ0 A;  3WQ1 A;  4NHY A;  4N43 C;  4P14 A;  4QU2 A;  1S0F A;  1O3S A;  1U5X A;  3J4U H;  2GC3 A;  4W50 A;  5AVA A;  1CZT A;  2L9L A;  2QCS B;  5FZO A;  5FZC A;  4IE0 A;  3ZN4 A;  2ZXQ A;  1UOG A;  5FP7 A;  4K1Y A;  4FBF A;  3M8L A;  4BA6 A;  2JWP A;  3DYM A;  3OUJ A;  4YVW A;  2BUK A;  4KGG A;  1OQ1 A;  4WVW A;  4W65 A;  1QOO A;  2ZCW A;  3ZYI B;  5E89 A;  1GP4 A;  5CKQ A;  5ANN A;  5LA0 A;  1A78 A;  3AMP A;  3ZN6 B;  2XWB B;  1DZT A;  1S0B A;  2ZHM A;  1ND3 C;  5HI0 A;  1MS9 A;  4QQH A;  2Y6J A;  1SHW B;  1FNZ A;  2VJX A;  2ZMN A;  2JJ6 A;  3EQE A;  3N9N A;  5FPV A;  2AH2 A;  5FR3 A;  4PBO A;  4CCE A;  3E1F 1;  3RDI A;  3N9O A;  3E6C C;  3HAG A;  4AVS A;  2YBS A;  4NAM A;  3VD4 A;  4LQR A;  4QDR A;  3USU B;  4AI8 A;  1CES A;  2IXL A;  1VE0 A;  1HLC A;  2XR4 A;  2XXZ A;  4B4Q A;  4NIA A;  4YGD A;  3PMS A;  5F5A A;  5G04 L;  3VDB A;  5I93 A;  1KFX L;  3KMH A;  1T6B X;  4P9X A;  5SV5 A;  5T3N A;  2A3W A;  4FFI A;  3K51 A;  4CUB A;  1VBB 1;  3BUC A;  1V0A A;  2EAA A;  4A45 A;  4AI3 A;  1ENS A;  1RHI 2;  1CWP A;  4LOT A;  3GHN A;  1K5M A;  3KVA A;  1JHJ A;  2RG4 A;  3IDA A;  4K7J A;  2R06 3;  2XON A;  1AR7 1;  2IZW A;  2GNB A;  2OPK A;  3ZFF A;  3ZFE C;  4UF0 B;  4YFW A;  4EQV A;  5FP9 A;  1XYP A;  4XHX A;  3ZMO A;  2EXJ A;  2XVL A;  3ON7 A;  5F5Q A;  3VL9 A;  4XF1 A;  1HRI 1;  3DV8 A;  4NMI A;  4AVA A;  1MQT B;  1VBB 3;  2R6Q A;  3ACF A;  1LOD A;  5FWE A;  2CDP A;  4IV1 A;  1W8U A;  2Y6H A;  1PM4 A;  3CZU A;  2KM2 A;  2Z5W A;  2BNN A;  4YAR A;  2RDQ A;  4UI9 L;  1UZV A;  5FK7 A;  5I0D A;  1FOD 2;  4UW4 A;  3TN9 1;  1TG7 A;  1VB2 A;  2YU2 A;  1GYK A;  5A80 A;  4H3W A;  3GM8 A;  4E8C A;  5CFC C;  3DYO A;  3J26 N;  3S57 A;  2W68 A;  2VOT A;  3HQX A;  2BBV A;  4XCB A;  3U0Z A;  3R4D B;  2NMN A;  2B5H A;  2PFW A;  1AR8 2;  4IET A;  1D4M 1;  2CTV A;  4MHR A;  4YW3 A;  5B2G B;  3TN9 3;  5EIY B;  4QDQ A;  3S6P A;  2XJR A;  5LEJ A;  3JBG 2;  4JX0 A;  4DNY A;  4YWA A;  1E5R A;  3UV9 A;  3UK9 A;  1PGW 2;  4XFB A;  4Y26 A;  2BEO A;  5FZ6 A;  4TZD A;  3SH4 A;  3M3C A;  4QU1 A;  2FDF A;  2JDK A;  3HNY M;  5C9A A;  2WLP A;  3ITQ A;  4NII A;  1DFQ A;  4JGZ C;  1D4M 3;  4JGY A;  4R8H A;  3MPB A;  4AI2 A;  2Q5T A;  3I3D A;  2XPJ A;  4AVC A;  4XBQ A;  5A32 B;  1GR3 A;  2XJV A;  2FDJ A;  1COV 2;  4QX7 A;  1W39 A;  1QXJ A;  3CJI A;  4Q4X 2;  3ACG A;  4ASL A;  5IAX A;  2VQ0 A;  4B4R A;  5FO7 B;  2J1T A;  2D3P A;  2J1V A;  2E9Q A;  1W6O A;  1WW7 A;  4PQQ A;  1LHW A;  1UL9 A;  2IXK A;  4UXA A;  2Y6F A;  3W20 A;  4A6S A;  1MZ6 A;  4AZZ A;  4Z07 A;  1RJ8 A;  3NJY A;  4RL7 A;  3AZZ A;  3CO2 A;  3I2F A;  5JXG A;  1DGR N;  1KDM A;  1O5L A;  1UAI A;  2W46 A;  4L97 A;  1MS5 A;  2PMW B;  1GP5 A;  3ZYG A;  5F1R A;  1LHV A;  1BKZ A;  4YZ4 A;  1BVV A;  4FPF A;  4X6Q B;  4LLO A;  3T1M A;  3LDR A;  1LES A;  1BEV 3;  4L0P A;  3UJO A;  3ZYF A;  3Q8E A;  3DKQ A;  4IEU A;  2VD7 A;  1ZZC A;  2D5F A;  1HRV 2;  3AM2 A;  4F7Z A;  1HJF A;  4H7M A;  1AF9 A;  2HBU A;  1OF4 A;  4FPC A;  4RD7 A;  5A3L A;  1WZX A;  2XHN A;  1WKY A;  4KBZ A;  4C91 A;  2QJV A;  3E5X A;  4RS5 C;  3FC0 A;  1OUS A;  3WDU A;  1C8M 1;  2WO3 A;  3KF5 A;  4XDP A;  3S7I A;  2YGL A;  5A3W A;  2H0V A;  1F31 A;  1RUC 2;  3VB9 A;  5IW0 A;  1SAC A;  2RMU 2;  3H1M A;  3KT4 A;  4QQ2 A;  4D6R A;  2ZEW A;  3POI A;  4DEQ A;  2E26 A;  1V6M A;  1BHG A;  4QAW A;  5A3M A;  5FXZ A;  1AHS A;  2C26 A;  1H1I A;  1OA2 A;  2VZR A;  3POJ A;  2GME A;  1DYK A;  2GN7 A;  4A4A A;  2EAK A;  2VMI A;  1I3H A;  3RYR A;  3RJ2 X;  2A6Y A;  1LGN A;  2P3Y A;  2UWA A;  1DYO A;  2NPI A;  2P2K A;  3MF9 A;  4QPY A;  3EB7 A;  5JR7 B;  3ACI A;  2W5F A;  1ZA4 A;  2P1B A;  4M01 A;  4XAC A;  2OYZ A;  2EF6 A;  5BNQ A;  1OLR A;  1NA1 C;  1IS4 A;  1OOP B;  1UF2 C;  2QTW B;  4GKY A;  4MH0 E;  2R1B A;  4AFA A;  3NNL A;  5F7U A;  4N43 B;  5IVF A;  3MZH A;  1ZRE A;  1DLL A;  4PDW C;  4ATF A;  1QJX 2;  4K3U A;  3PIJ A;  2XWJ B;  4BWO A;  1A3K A;  3VZK A;  1DQ5 A;  1W03 A;  2Z42 A;  4N9I A;  3GBW A;  3OGR A;  4AI0 A;  5ACA 2;  2RS5 1;  2DCK A;  4QHB A;  1CAU B;  2KXL A;  5IYY A;  2ARE A;  3C7E A;  2LAL A;  2WLQ A;  3HNM A;  4JKL A;  4MGZ E;  4YG0 A;  4FTS A;  3BB6 A;  3GZA A;  4O65 A;  4H2A A;  1NCQ C;  3U1X A;  4CDU C;  1H1A A;  2R1D A;  3FJS A;  1ND3 B;  2WRA A;  3OUI A;  4BQY A;  2EXI A;  3OTF A;  2VOK A;  4WZF A;  1W04 A;  2R30 A;  4CEW A;  2RS5 3;  1RUI 2;  2OZ6 A;  5JI9 A;  5DQ0 A;  3AL6 A;  4Y1V A;  1PGL 1;  2D6P A;  3EMR A;  3Q8A A;  1O3T A;  2B8M A;  3VBU A;  3I59 A;  4NID A;  2QQM A;  2VAU A;  5GZD A;  4XXA A;  3ZSM A;  4RN5 A;  3OPZ A;  5LK5 A;  1SBE A;  4CDQ A;  1GOH A;  4IEZ A;  1ASJ 1;  2VNR A;  5GZE A;  3AFG A;  3N3H A;  3ZPY A;  1XE7 A;  5IVJ A;  3ZFE B;  2OT7 A;  1LOG A;  2BTV C;  1QJU 3;  4MYE A;  3U10 A;  2FQP A;  4QX0 A;  4LHL A;  1AZD A;  1AYN 3;  2OUJ A;  3WV6 A;  4BXS V;  1O4Y A;  2VCM A;  3WIN E;  3SQO A;  2D40 A;  4MAD A;  5EJ1 B;  3NAP C;  1ASJ 3;  3RNS A;  4NOT A;  2RV9 A;  1GWM A;  2I2S A;  2VMD A;  3B69 A;  1WGP A;  2ZX1 A;  3POB A;  4Y5Z 0;  3RZH A;  3ZYH A;  5FWJ A;  5I0S A;  1O7F A;  1CAX A;  1QXP A;  2EAL A;  4IXL A;  3H7J A;  3ES1 A;  2W39 A;  4ONU A;  1JZ4 A;  2J1R A;  4XXP A;  4DS0 A;  5CFC B;  1IS3 A;  4LTA A;  2JG8 A;  3AVR A;  3KVB A;  2A1X A;  4AQ2 A;  1B35 C;  1MEC 1;  1S2E A;  5A7S A;  3KD4 A;  2HWD 2;  2ZHL A;  2ZX4 A;  4W6Y A;  3VBO C;  2VZU A;  4AI9 A;  1VBC 1;  3FX3 A;  3ACH A;  2IVI B;  1D7P M;  1PO1 1;  4UAP A;  2FDH A;  3WY6 A;  3QBQ A;  2CYF A;  4IEX A;  3OJB A;  1QDC A;  1B09 A;  1VBA 2;  4QGN A;  3BIE A;  4YW2 A;  3WG1 A;  4R9A A;  2NM1 A;  2PYT A;  1O6U A;  3ZFG A;  1RUG 2;  4GIQ A;  5C8W A;  3LA2 A;  1MEC 3;  4FOY A;  1QWR A;  4JGZ B;  4IEW A;  2W3J A;  3ZYB A;  2WAA A;  1JZ5 A;  5FP4 A;  4ZXE A;  2JG9 C;  2Z4F A;  2EIC A;  4P00 B;  4XJ8 A;  4KWK A;  2RHP A;  1ZYB A;  2C5D A;  2JB8 A;  1PO1 3;  4XBL A;  4YFZ A;  2Q8E A;  3O0V A;  1N1T A;  3PVO A;  3AP6 A;  3T30 A;  3L2Y A;  4E2Q A;  5DMY A;  2WKK A;  2O1Q A;  4DUW A;  4LKF A;  3H8R A;  2CV6 A;  1LR5 A;  5E6H A;  1FPN 2;  5CNA A;  3NWK A;  4XOG A;  2WT0 A;  2DCZ A;  1JOB A;  1IGO A;  1EAH 2;  4QWN A;  5C3O A;  2DWR A;  1PO2 1;  3SCH A;  3ETP A;  4QXC A;  3ILN A;  1U12 A;  1XSR A;  3VDD C;  2J7M A;  3DL3 A;  3OB8 A;  4KU7 A;  4DRV A;  1TME 1;  3S0M A;  5CAD A;  4FFF A;  3ZKY A;  2R07 2;  4NO4 A;  4GMP 1;  4CU8 A;  4CCM A;  1W9T A;  3NRU A;  5FYZ A;  3VHN A;  3EHK A;  1BJQ A;  1KQR A;  1QY4 A;  4ZY9 A;  4PBP A;  1ULO A;  1Q8P A;  3IIA A;  3M70 A;  4JRA A;  3ZN6 A;  5H9Q A;  1LTE A;  1OH3 A;  3BVC A;  4J6G A;  3UT0 A;  3RZM A; 
#chains in the Genus database with same CATH homology
 4CUG A;  4QXB A;  5A7W B;  5FZ6 A;  4DO0 A;  4EZ4 A;  5FZ8 A;  4QU1 A;  4EZH A;  5A1L A;  5F3C A;  5LW9 A;  3OPT A;  5FJK A;  5FZD A;  4V2W A;  4IGQ A;  5FUN A;  5FYB A;  3U4S A;  3PUQ A;  5FZ0 A;  5FZL A;  3KV5 A;  3DXT A;  3PUR A;  4QX7 A;  4D6Q A;  2Q8D A;  4CSW A;  2PXJ A;  2XDV A;  4IGP A;  5FXW A;  5IVJ A;  5IVV A;  5FYS A;  3OPW A;  5FYT A;  2OT7 A;  3N9P A;  3K3O A;  5F37 A;  1VRB A;  5A3T A;  5FZ4 A;  5LY1 A;  5F2W A;  4LIV A;  3RVH A;  5FY7 A;  5FZO A;  4Y4R A;  4UF0 A;  5FZC A;  5A3P A;  4V2V A;  5FP7 A;  3NJY A;  3K2O A;  3N9L A;  4GAZ A;  5F5C A;  5FY4 A;  4HOO A;  5FP3 A;  5FYC A;  3LD8 A;  5FYH A;  4URA A;  3PU8 A;  3LDB A;  5F2S A;  4E4H A;  5FWJ A;  3N9M A;  5IVB A;  5LWB A;  4EYU A;  5FZ9 A;  4LIT A;  5IVC A;  4NUB A;  3N9N A;  5A7P A;  4QXH A;  5FPV A;  5F5I A;  2VD7 A;  3AVR A;  4IGO A;  3KVB A;  3N9O A;  5FYI A;  5FZH A;  3PU3 A;  3KV9 A;  5A7S A;  3ZPO A;  5A1F A;  2YBS A;  5IVE A;  5F3G A;  5FPL A;  3K3N A;  3N9Q A;  3KV6 A;  4CCL A;  5ISL A;  2YPD A;  2XXZ A;  4AI9 A;  5A7N A;  4XDP A;  5F5A A;  5FZK A;  2GP5 A;  5FY1 A;  5A3W A;  5IW0 A;  5FYY A;  5FZB A;  2OQ6 A;  4CCN A;  4D6R A;  5FUP A;  5FZ1 A;  5CEH A;  4Y3O A;  5FZI A;  2XUE A;  5FY0 A;  5K4L A;  4LXL A;  2XML A;  4DIQ A;  5FXZ A;  2GP3 A;  5ANQ A;  3U78 A;  4BIS A;  5FPB A;  4QX8 A;  5A7W A;  4C8D A;  5IVY A;  3KVA A;  4GJY A;  5FP4 A;  4D6S A;  5A3N A;  5FJH A;  3PTR B;  3AVS A;  5FZO B;  2W2I A;  4UF0 B;  4CCJ A;  5FBJ A;  5FP9 A;  2Q8E A;  5FY9 A;  5F3E A;  2YBP A;  3PUS A;  5FPU A;  3KV4 A;  5FXV A;  5FWE A;  5IVF A;  2WWU A;  5E6H A;  5F32 A;  4HON A;  5FV3 A;  5F3I A;  2OS2 A;  5FPA A;  2WWJ A;  4QWN A;  3ZLI A;  5FZ3 A;  2P5B A;  3AL5 A;  5F39 A;  2YBK A;  4AAP A;  4QXC A;  5FY8 A;  5FZF A;  5FZG A;  2YU1 A;  4TN7 A;  5A7O A;  2YU2 A;  5A80 A;  3DXU A;  2Q8C A;  5FXX A;  5FP8 A;  4ASK A;  5FZA A;  5A7Q A;  4GJZ A;  4LIU A;  5LY2 A;  4CCM A;  5FYZ A;  4GD4 A;  4CCK A;  4CCO A;  5KR7 A;  5FYV A;  3PUA A;  2OQ7 A;  4BXF A;  5IWF A;  4BU2 A;  5FZE A;  5FY5 A;  3UYJ A;  4XDO A;  5FYU A;  5FZM A;  3PDQ A;  5FYM A;  5FZ7 A;  4Y33 A;  2OX0 A;  3AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...