2YBPA

Jmjd2a complexed with r-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 106
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybpA01
3PU8A 4CCOA 5FYBA 5IW0A 5FZHA 5FY1A 4GJZA 4D6RA 3AVSA 5IVCA 3KV6A 5FYHA 5FP9A 5FPUA 4C8DA 2W2IA 2GP5A 5FY0A 2YBSA 5FBJA 5FUPA 4Y33A 5FYMA 3N9MA 4BISA 5FXWA 4AI9A 5IVVA 4XDOA 4LIUA 5FYYA 5FPAA 5FZMA 5K4LA 5FZOB 3PU3A 4IGQA 3RVHA 5FZ4A 4EZHA 5FPVA 5FP8A 4CCNA 4QX8A 5FV3A 5FZBA 4CCMA 2XDVA 4Y4RA 5F3GA 3KVAA 5FZDA 4CSWA 5KR7A 3KV5A 4Y3OA 4GD4A 3K3OA 4UF0B 4QXBA 5FZLA 5FYZA 5FZKA 3AL5A 3OPTA 5FZ7A 4E4HA 2WWJA 5LY1A 2YBKA 3KV9A 3N9LA 5FZ9A 4DIQA 5FZOA 3ZPOA 5FYIA 4TN7A 5A3NA 5F32A 2Q8EA 3KVBA 5FPBA 5A1LA 4QX7A 5FYSA 4GJYA 4V2WA 5FY9A 2OX0A 2Q8DA 3KV4A 3OPWA 5ISLA 3U78A 5CEHA 5FYTA 3PURA 2YPDA 4CCJA 3LDBA 5FYVA 4AAPA 5FZFA 2OT7A 4D6SA 5A7WA 4CCLA 5A7OA 4DO0A 4V2VA 3PUAA 2WWUA 5F39A 3PDQA 5A7PA 5FP7A 3N9QA 5F2WA 5FZAA 3LD8A 2Q8CA 4BU2A 5FXVA 5F37A 5A7QA 5F3CA 4D6QA 5LW9A 5FPLA 2VD7A 3N9NA 5FUNA 5A3WA 3AL6A 5A80A 3N9OA 2OQ6A 5FWJA 3N9PA 5FZ6A 4HOOA 4URAA 5FY4A 5FZEA 5LY2A 5FY8A 5FZ8A 3NJYA 5IVBA 5FZGA 5F5CA 3PUSA 5FY5A 5FP4A 2P5BA 2OS2A 2XUEA 1VRBA 4LIVA 5FP3A 5FWEA 2YBPA 5FZ0A 4EZ4A 4BXFA 3DXUA 4QXCA 5FZ1A 4HONA 3ZLIA 5IVEA 4GAZA 4QWNA 3PTRB 3U4SA 5F5IA 5FZCA 5A7SA 5F5AA 5IVYA 4CCKA 5E6HA 5A3TA 2YU2A 5ANQA 5A7WB 5FXZA 2GP3A 5A1FA 3AVRA 3PUQA 4IGOA 5IWFA 4LITA 4UF0A 4QXHA 4QU1A 5FXXA 5F3IA 2PXJA 3DXTA 4NUBA 5F3EA 2XXZA 4ASKA 3UYJA 3K3NA 5A7NA 5FZ3A 5FJHA 5FYCA 4LXLA 4XDPA 5F2SA 5FYUA 5FZIA 3K2OA 4EYUA 5FY7A 5FJKA 5IVJA 5A3PA 5IVFA 4IGPA 2OQ7A 2YU1A 2XMLA 4CUGA 5LWBA
chains in the Genus database with same CATH superfamily
3VBOA 2HEWF 3ZR5A 1TMF1 3DKWA 4COYA 4HG6B 2AEYA 4JGYA 4TLGA 5DDJ3 1PM7A 4BM8A 4E4ZA 4HK9A 1APNA 5FTTC 1AJKA 3RWNA 3RMYA 1RL3A 1JOJA 1BKZA 4N90A 4GWIA 4A6OA 3ZXLA 1C8M3 4LBLA 4QX1A 1DQ1A 5ABJC 3GZEA 2JDUA 2L9LA 2DTYA 3W21A 5DAPA 1YUDA 2OW4A 2GN7A 2VNGA 3HQXA 4FXKB 3WNNA 1G9AA 1MS1A 5BNPC 5FYYA 2UURA 1F31A 3CZUA 1GZWB 3FE5A 1SLBA 4CZSA 2DVGA 3ORJA 4XYXA 2KD7A 4RR3A 1PGL1 2NMNA 4ZKTB 5FZBA 1QGLA 3KS7A 5A6ZA 1WW4A 4E4DX 1RUD3 4Y1XA 3BPSA 1REFA 1BK0A 4LO7A 3KV5A 4HL0A 1UKGA 3USUB 2EIGA 4KBZA 2J7MA 4BXSV 5FZ7A 2WO1A 2GU9A 4XPVA 4FOWA 2YBKA 1ASJ1 2K9ZA 4TTGA 2O14A 2GNMA 4HXCA 4CEYB 3W5MA 1BEV2 1PO13 1WUVA 3MO4A 4TN7A 3ZXFA 3AM2A 5EV7A 3O1TA 3M3IA 3TRSB 1JODA 2D6NA 3AMPA 4QAWA 4RL7A 4MG2A 5JR7B 2HWC3 4Y20B 2Y33A 3ECQA 2ZGLA 1H2LA 3OGRA 3U78A 2HWE1 1OQDA 3D6EA 4NRMA 1RUE2 1UY1A 1ACCA 4XFBA 1DIWA 1OH4A 1ULCA 2FMDA 2VZQA 3WQ1A 2XG3A 5LEJA 2G4IA 3HN1A 5F39A 2WKKA 4LBOA 2CY6A 2ZGTA 4YRDA 3PVNA 1WLTA 4NPMA 3ZFFC 4CXWA 4IEZA 2ARXA 5J3UA 4R9AA 3VBRA 2QNKA 5KC5A 4I0AA 3J7LA 4XIKA 5LBBA 1W9SA 2QQOA 4NWWA 2BWCA 4N43A 3A4UA 2E26A 1T6BX 2LRPA 3PLQA 4JAAA 2X53S 1Y3TA 1B35A 3ZYJB 3CL1A 4YWAA 4IUGA 2J1UA 2W0XA 2P5BA 5FY5A 2HYXA 3RJ2X 3PVEA 4B29A 4NIAA 4BMEA 1AR93 5T52A 1W39A 1ZM1A 3DXUA 1W8HA 4JKKA 1ZZ9A 4BCUA 3KHBA 2JX9A 2F4PA 1GV9A 4ISRA 1X8EA 4L97A 5K0UB 1VBE1 2DUOA 2GP3A 5BPXA 2VNVA 4QGNA 3AKQA 1NXD1 1QQP1 2B9UA 1HXS3 1QJY1 4C1XA 4Q4W1 3ACFA 1LENA 4JGZA 2FDKA 5A3MA 2WINB 1RUJ2 3I4IA 4QDQA 4XCBA 5HCHA 4Y26A 1W9WA 3VKFC 4NROA 4LXLA 4ITCA 3V56A 4XDPA 2ERFA 2ZGRA 3E6DA 1JMUB 3OUIA 3SITA 2ZEXA 4IGPA 5EYYA 2HWC2 2E9QA 3FZ3A 4TWTA 4XC9A 4EV0A 2XBO3 1AR81 2VZSA 3URFA 3UESA 4M4PA 4AHYA 4I0WB 4B1LA 5DUUA 2Z4FA 1TZOA 3IAPA 3ZMOA 2JKXA 2VTXA 2XKPA 4NIHA 4M0NA 1HDKA 3VDCA 1UN1A 3AYEA 1FOD2 4S2DA 4X6QB 4AZZA 1V6OA 2A6VA 4DEQA 2G1MA 3ZKUA 2RS33 1GNYA 2R042 2BBAA 3M4FA 2W1SA 3E5UA 3SCHA 1G9FA 2DTWA 4AI9A 1HN1A 4JKLA 4Y4YA 1Y4WA 2O0OA 3IMNA 3T0AA 1LGNA 2XLAA 3HJRA 5G04L 4QD2A 1JBCA 1LRHA 3JCIA 5KXCA 1RB8G 5L9RA 3ZDSA 3VBFB 2P3YA 2XGXA 1WMXA 3GDBA 5HXVA 1W2OA 2JDHA 2D6KA 4N7IA 3S7EA 4X8NA 5FRAA 3TEZA 4AI1A 4RSUA 4XZPA 5HPOA 1CAXB 3OUJA 4PQ9A 1F2NA 4YM1A 2JE8A 4QXBA 3AMHA 4RHV3 5FZLA 1REDA 5C3SA 3ZMNA 1FAYA 1J84A 4BQ1A 2W68A 2OYZA 3E5XA 3MYXA 4QPGA 2PHDA 4CRQA 5JI7A 4NMIA 4UW3A 1UAIA 4M3CF 2VZ3A 3D5OA 4FPYA 2XQXA 1HXS2 4PDWB 4M3CE 1UX7A 3DN7A 2VXJA 3QD6A 1US3A 4GWJA 4Q4V1 4RHV1 1CPNA 4YW7A 1V6LA 1W8FA 3AZZA 4QM9A 1NT0A 1R092 4DB5A 1OLME 2GN3A 4BQYA 2VOVA 4IESA 4PIXA 4CCLA 2G9GA 4NHKA 4WM7B 5A3UA 3D0SA 4FPOB 3AKSA 2AZ5A 1E5RA 2GH8A 1AR72 1FNYA 2WN2A 4XMAA 5EIYB 4YZ1A 1FATA 2NP0A 2OZ6A 4LPLA 3WVJA 5CAZA 3IT8A 2YHJA 1KDMA 1UY0A 2QBXA 4DOUA 5A80A 4ZU7A 4OZOA 2D7FA 4HOOA 5FCCA 4LHKA 4LHLA 4O9GA 2W1WA 4QB2A 2V4AA 3JB8A 3AXEA 4UYBA 4YG3A 1W9FA 1VBD3 3JD73 5LBCA 1DHKB 3J8F3 3VZJA 2UY9A 4AQTA 3WNOA 3KF5A 1C8M2 1HB1A 2WWSA 3KZ4C 3OOXA 4Q27A 2YXSA 4G3YC 4Q2FA 1LHOA 4FTSA 3GZUC 5EFUA 4MZUA 3RZHA 1FOD1 1CIWA 3I2IA 4GH4A 1JN2P 1V6MA 3GBWA 4ONUA 1N3OA 4GAZA 4G4FA 3V65A 2W92A 4FOQA 5A7SA 1QDCA 1AXYA 3VKMA 3GCWA 4IEQA 3MPPG 3VDDC 2RS52 1WLDA 1AR91 4F3JA 1GP4A 2RHPA 4IERA 5EHDA 4QT6A 1TME1 1WD3A 3WR0A 1B35B 2PXJA 2VMGA 3GF6A 4I02A 5DABA 4NPRA 3SEPA 4Q1RA 4S2HA 3RPQA 1JOBA 1H1MA 1URXA 2B5HA 2BW8A 3JZVA 2XJVA 3T2PA 3U07A 2D93A 1CX1A 1U5ZA 2VNOA 5JXIA 4RA0A 5IVJA 5BNOB 5IVFA 1LB2A 2OQ7A 2XMLA 1QJY3 1H8TC 3EJKA 4E8CA 2RDRA 2DUQA 2JB4A 5D8AB 1LESA 3ZFEC 5IW0A 1SCSA 1Q8OA 4HPKB 2AACA 4XXAA 2YFUA 3LEKA 3VN4A 5FBJA 3B00A 4FBFA 4OHVA 1JXNA 4NAOA 2WNUB 4XHXA 4PHZA 1QY4A 2VBDA 3JUUA 1SBFA 4A3ZA 5IVVA 4OMCA 2GDFA 1S0BA 4QKFA 1CAWA 2JICA 4YGEA 1BBT2 4YZ3A 2ZGMA 3KGLA 4AOCA 2PAMA 1GZ9A 2BGOA 3THPA 1R64A 3JQXA 1OXCA 1X7NA 2PAEA 2R30A 4L2NA 1DU3D 3UJOA 3BUCA 3AZWA 1ZRCA 5JR2A 1BLZA 1FV3A 1NQDA 1W8TA 4XURA 3ZSJA 2A6XA 2ORXA 2XJQA 4LLOA 2JENA 5F3GA 3AP9A 4QQLA 2BU9A 5DZFA 2WQZC 4QPWA 4Q0UA 5L9BA 2ET1A 4ZZ8A 4K20A 4PJYA 1UZVA 4GIQA 5FZKA 5FYZA 3AL5A 1MQTB 1UZZA 3I8TA 3MIEA 4ZU5A 2WABA 2ZGQA 5AC92 2VM9A 5LY1A 1HB4A 4CEWA 2VW0A 2Y34A 4D3WA 3S57A 2VMHA 1COV3 2Q8EA 2EALA 1FX5A 1XC6A 2VQ0A 4ORFA 4GJYA 4KBBA 3B7MA 5T54A 4F7ZA 3OPWA 2W1UA 4XF3A 3MIGA 3U11A 1DQ5A 2GC1A 4GB32 4LBNA 4AYUA 4Z92B 1UKRA 2RS11 3O1OA 1IS3A 3AMQA 4RQPC 1RUJ3 1UW8A 1ND2A 3BU7A 1K42A 2W91A 2GNDA 4R4XA 3VBSB 1NKGA 3N4MA 2Q8CA 3L2YA 3ILNA 5C71A 3C8XA 5FXVA 1RC6A 3MLKA 2D3PA 1C3HA 4V1PA 4YARA 5JOWA 1W6NA 1WCUA 3Q8CA 4FQ4A 5FK7A 1NE6A 4QQHA 2XKOA 5A3WA 5GZEA 1PGW1 5T5JA 1GWLA 1F5FA 1LCLA 4JGZB 2X10A 1XSQA 5GLWA 5JIUA 1AYN3 4AWDA 2Y26A 2VL4A 1AJOA 3E97A 2GC0A 3JQWA 5FP4A 5J1XA 3J8F2 4BB3A 4YGCA 2CGPA 5GJ6A 4EZ4A 4CDXB 4IE0A 4QMAA 4OHWA 1OLMA 1RUE1 4COWA 4UFIA 1U0AA 1OF3A 1ZBE1 2ZTNA 3NQHA 1W99A 3DL3A 4Z82A 2Q8OA 5CA6A 5A3TA 5JZGA 1JZ7A 5E6HA 2RR13 2YGMA 4WBBA 5H9RA 3WY6A 4HK8A 3RGBA 5FQ0B 4XVHA 3VZMA 1PHMA 1YQ6A 4Q4X2 4YZ4A 2Z5WA 4LA2A 3AFKA 4QKDA 3BOPA 3O0VA 5JZGB 2IVJA 2VJXA 3I3DA 4LKSA 4YG0A 4KG0A 4CU6A 2GAUA 4BMBA 2VH9A 1JYIA 2QFEA 3VKNA 2P37A 2ZEWA 2ZJCA 3OGVA 4I09A 4FT8A 4XF1A 4GB33 2VZOA 3GZAA 4K40A 4OCTA 4KMQA 3ES1A 1UXZA 3CLPA 5GKAC 2D6PA 5C7GA 2CHHA 5ABJB 2YDEA 3HQUA 4H7MA 2BEOA 4Q1PA 3AP4A 3W58A 1XNTA 2EXJA 5EQUA 4IV1C 5CKQA 1Z78A 2GNBA 1EP0A 1JHJA 1HRV3 3WDTA 2UWBA 4Y22B 3W59A 5EJZB 2WZR2 5ABJA 1BVVA 1JI6A 1KITA 1YC61 2YZ4A 4XUQA 4ES9A 4FSJA 2PLV3 1F15A 2BTVC 4CUAA 2VE1A 4JGYC 1UNBA 1AYN2 1ZRRA 1F5JA 2P2KA 2RDNA 4DRRA 5FPVA 4N9HA 5LBEA 3RRDA 5L73A 1ASJ3 1LU2A 2ZABA 3CJIC 3ZM8A 5JPMB 1JUIA 5FZDA 5KR7A 5LA9A 5KHGA 1YXWA 4C91A 5I93A 4KU7A 2BOJA 3BGAA 4IEXA 2WLPA 1MQTA 4XFIA 1WMDA 2Q1MA 2WL1A 5FPXA 3KV9A 2WRAA 5SV5A 2V4VA 5K8SA 2FMYA 2WYFA 2XONA 4JDOA 4OI2A 3GHMA 1POV0 3T3YA 3NNJA 2KXLA 5ANNA 4L92A 3NNGA 4YW5A 3SQOA 5C8CC 5D8AC 3PURA 3EB7A 4I3GA 1NZCA 3ZN4A 4JC1A 5FZFA 3V64A 5AFEA 1Q8SA 1YQ8A 4V2VA 2BYVE 2D6LX 4BA6A 3A23A 3PDQA 4W6XA 3S7IA 1JYWA 5F2WA 3ACIA 1A3KA 1SG3A 4JHZA 4META 1JZ2A 4HKLA 1LULA 2WNUA 4LO8A 1Y7BA 2R16A 4GA9A 3W9AA 1V9U1 2V5YA 3ITQA 2CDPA 1OD3A 1RMU3 4I01A 1WMEA 1HB2A 5LY2A 4QPIB 3EHKA 1VP6A 4WVMA 5FMOL 2H6BA 2TUNA 2JKBA 2E7TA 3NV1A 1QOSA 2WDBA 3O0WA 1VE0A 3H8XA 3AB0A 3FUQA 2PLV2 1PZ8A 4IEOA 3GM8A 2B45X 3DEMA 2DURA 3AYAA 2B39A 2VZVA 2Z69A 1KDKA 5F6KA 3NV3A 1CZSA 3LWCA 2QQNA 5F5QA 4JX0A 3U4XA 3GBFA 4GMP3 2XR4A 2P3KA 4QHZA 1A6CA 5FXXA 1GZCA 1UOGA 1ENXA 1EYBA 2VZ1A 3LB9A 2VOTA 1SFYA 5DN2A 5JXHA 2VOWA 2RR11 1NY71 1U5XA 2A5ZA 2P1BA 1HN0A 3THCA 3UYJA 1E5IA 4AFBA 3P5BA 4CDUA 1QJEA 3QACA 1PIV1 2ZX3A 1H30A 1C8M1 4PBOA 2ZX2A 4E2SA 4XFGA 3CEWA 3KF3A 4QXKA 1J58A 1RUNA 3FFQA 1YHFA 5FZHA 4Y22A 3IDBB 2QQWA 2RM21 4GJZA 4C0BA 4PDWC 5FMDA 5IVCA 4CP9A 3M8LA 1J3QA 2NPIA 3MIHA 3VBRC 3WDUA 4IEVA 2G19A 2QQUA 1LOEA 4Y33A 3WG3A 5FQ0A 4OHXA 5KC6A 1PO21 1ENQA 4A45A 1BMV1 1RJ7A 2A6YA 2HWF1 4J25A 1OOPA 4XBQA 2ZOEB 4HKWA 4DZGA 3J26N 1XPWA 4RS5A 2VCCA 3PVBB 5FPAA 2IXHA 4NOTA 4RFT0 5A6QA 2E31A 2V09A 1Y43B 1CZTA 1UF2C 2XUMA 3AC0A 1UY2A 2EAAA 3ENRA 5IHRA 3ZFEA 1W0NA 5IK4A 2CDOA 4E2GA 3VHPA 4BIFA 1RUF2 3BB6A 3ON7A 1JTZX 3ZSMA 1KGYA 2G9ZA 3OY8B 3AZXA 4B4PA 4P5YA 1R1ZA 4B4QA 3WDVA 2R7EB 2XWJB 1XB9A 1ND3A 5EYXA 5JOZA 1A8MA 1NUKA 4MO3M 4A7KA 3JBG2 1CGPA 3N9LA 1UCXA 4HMZA 4B3NA 1D2QA 2P4EA 3VD5A 4AVCA 4ZS3A 5GM0A 1H4HA 2ZEYA 1AHSA 1VBB1 5FYSA 1RVF1 3RQ0A 3LA2A 3I2OA 1RYYA 1JS9A 5A7WA 3RZKA 4FPJA 1O7FA 5JUVA 1AYM1 1V6IA 2IVIB 2QZ2A 3B02A 2R0FA 2ZMLA 3OGJA 4LOSA 2GSYA 2K2SA 2MNGA 5CU1A 4XTMA 4ZXEA 4GWNA 1BQPA 5DG1A 3P3NA 2CTVA 4LE3A 2R041 2HWB1 3RZMA 1V70A 4D6QA 1RUOA 2P6CA 2W87A 4JKMA 5FPLA 1LOFC 3N7KA 2DU1A 4YW4A 1MEC2 5JOYA 2WNOA 2O8OA 2JDAA 3I7DA 1SFPA 4CDQB 3VUOA 3BIEA 2MHFA 1HKDA 2RE9A 4Y1VA 1HLCA 2PHTA 5IVBA 4HFSA 2R043 2ZGNA 3ZFGB 1ZA7A 5C4WC 4L9BA 4K6BA 2OIIA 1CN1A 5FWEA 1VBA2 2ZXQA 1K5MA 4WZFA 3RZJA 4JQRA 3MPBA 2C0ZA 1NOVA 3ZXAC 1U5YA 3MIDA 3S5QA 5CFCC 2VUCA 1RHI3 2YB7A 3WF2A 1D4M2 3DYMA 5BNNA 3O14A 1EV12 2HWD1 4I0BA 4QKBA 1GNHA 1Q5OA 3C3VA 3S0MA 2W08A 3TEXA 2J22A 1ZVFA 2RJKA 1C5HA 5LBFA 2RMU2 3T0BA 1DYPA 3A22A 5F3IA 5KHHA 4UW4A 3KB5A 1DZQA 2Q30A 5T5OA 2Y6HA 5FJHA 1F8VA 2BNMA 1GP6A 5FR3A 4D94A 1R091 2P3JA 3DF0A 1PMIA 3IMMA 5FLIA 3SHRA 2YC4A 3UKTA 1G9CA 1Q8QA 2VCMA 4XCAA 3VZNA 4UFLA 1POV3 2E6VA 2UWCA 2WA3A 5DAVA 3WF3A 3H1MA 4D6RA 5BNOC 4CCCA 1Z7S1 1GOHA 3ROUA 5FP9A 1QJU1 1X82A 1SACA 1R093 4CEYC 3HT1A 2JG9B 2JJ6A 3ZFFA 1AUYA 1IOAA 1AR83 1OA2A 1TMF3 1ONAA 2RDSA 1Z7S2 3AX4A 1IZ3A 4J1WA 1A78A 1VMJA 5FOBB 3LIGA 3OTFA 3VD7A 1OI6A 5LASA 4XILA 2WNEA 3N7JA 2Q0AA 1W2NA 5C3OA 2RV9A 2ADEA 3B9CA 5FP8A 3BOWA 4AGRA 3BPZA 5BNNB 4LA3A 5FFOC 5L9VA 1XOYA 3DGTA 3JD72 1ENRA 4FOYA 2JG9C 1ZREA 2W46A 1TG7A 2XVKA 3SH5A 5AVAA 1AXKA 5DQ0A 3EBRA 2YV8A 4L11A 4RS5C 3HN3A 3H3ZA 3LFMA 3U10A 3LSEA 5F1RA 1ZBA1 3I59B 2WWJA 5J37A 1QJZA 1O6UA 5E1RA 3ZN5A 1MS8A 3D3AA 1D4VB 1HV0A 1G9BA 1ZYBA 1CPMA 4FAGA 2B8MA 5A1LA 4M3CA 4UFJA 4V2WA 3LFIA 3C7OA 4GMP0 1W3VA 3J7NA 2C6SA 1P8JA 4AVTA 4Q4Y3 2WZ8A 4WVZA 1S2KA 1EY2A 3LDBA 2TBVA 1KQRA 2DWRA 3AK0A 3U0ZA 4GKXA 1EAH1 2GALA 4D6SA 1QH7A 5CVRA 1W6OA 5DZGA 4LKDA 1RIRA 2WWUA 2RMU1 3HPNA 1VBB3 3GXUA 3C7GA 5EPAA 3WOGA 1YI9A 3T1MA 2OUHA 4EN9B 3J4UH 5F37A 1VAVA 4OUSA 4N43C 2D3SA 5F3CA 3B9IA 3O1PA 1HQWA 4W6YA 3POWA 3OG2A 4EROA 1FPN2 2BRTA 1AYM3 4LHNA 1BBT1 1G86A 5GALA 5A1AA 1ZRIA 2VAUA 3SEEA 2D6OX 1AL21 4EWEA 5CZKA 3ME2A 5BNQA 1PZ7A 3NL1A 3L9JT 4PLNA 5I8SA 3OY8A 4M00A 2JIGA 1C4RA 1BBT3 3B93A 1PNFA 1IPKA 4IV3C 4QHBA 4ARXA 3POYA 2ET7A 3J7HA 2WNVC 4YW6A 3UGGA 5E8AA 3NVCA 3NV4A 1OC1A 2ZGKA 3J8F1 4CCKA 3KQRA 4KWJA 4PCRA 5ANQA 3UT0A 4LEJA 1LNSA 4P9XA 4N53A 3VBRB 1BXHA 4EJRA 4LMFA 1OF4A 5KXDA 3CJIB 4P9WA 1X8MA 3APBA 3IPVB 4XFAA 2D97A 2FCVA 1SHWB 3AYDA 4QQ2A 1D0GA 5LB6A 2Y60A 4M3CB 3I49A 4EWAA 4AI3A 4DUVA 1DCSA 4HVQA 4K3UA 1JH5A 1UXXX 2LALA 1V6JA 3OD0A 2FDJA 5HCAA 1YO8A 2JECA 4K9SA 2EXHA 2AYHA 3KCXA 3ZR6A 2PHRA 3GGLA 3JBG3 4XACA 2YU1A 3I54A 3AMMA 2QQLA 1MZ6A 5I0TA 1PNGA 5BYNA 2ZHLA 5I0SA 3UJQA 2LS6A 4FP2A 1BEV3 1PO12 1YRZA 2I2SA 1VALA 2RJ2A 3FC0A 3WP3A 1O4ZA 1W6MB 2XB6C 4JDNA 1WKYA 3BALA 5FUPA 1NLQA 4QU2A 1W03A 4Q4V2 3USUA 4YM2A 4NR1A 1LOBA 4MHUA 1K5MC 3R4SA 4JRLA 4D7TA 4Q4W2 1Z7S3 1RITA 4WM8A 1FPN3 1NQJA 5IFPA 2VMIA 4YW3A 4OMDA 5EZWA 3UK9A 4LE4A 3ZIXA 3VBUA 4YVWA 1I3HA 3HAGA 1ENSA 2RDQA 2A3WA 3IDAA 4IEPA 1Q56A 5FKCA 4AG4A 3PMSA 3T1LA 5JMCA 1I9RA 3N36A 2JE7A 3IDEA 3O0XA 5FZEA 4XQ4A 3UGHA 2X5IC 4UF0B 1VBA3 1K3IA 3USSA 1N1YA 1J3RA 1AL22 3KGZA 2RS13 3LPGA 2ES3A 5DUXA 4EQVA 1CJDA 2PHUA 2VQUA 4XW3A 5FZOA 4CPBA 3LIHA 5BY5A 3VBHB 3RWKX 3UKVA 4CP0A 2XPJA 3LEMA 4HSJA 5A70A 3M3QA 4MXVA 3KV4A 4XJZA 1VBA1 5CEHA 1X50A 1W6NB 4YG6A 4CCJA 4N53B 5C70A 5C3QA 4Q5OA 3LAGA 4Q4Y2 3DPRB 2DCJA 1CX4A 3AYCA 3BVCA 4LO6B 1LECA 3RI9A 1N1SA 1O3SA 4OULA 5A7PA 3L2HA 1OD5A 3O5SA 2IXKA 3N35A 1SQ4A 4PT6A 2VNRA 3LCPA 5A33A 5C4WB 1ZA4A 2Y6LA 2J1TA 3FN9A 1OKQA 2VD7A 1FMD1 1HV1A 2E7AA 4AI2A 3AJZA 4KWUA 4YW2A 2OQ6A 5FWJA 5IT6A 2DCTA 2A3XA 1QHDA 1LOAA 1WCQA 2K46A 2WAOA 4AQ6A 2ETEA 3KWVA 1S0JA 1SLTA 1TNRA 2ZZJA 3PVOA 2BVVA 4XBLA 3AJYA 2OS2A 3ZYRA 1VRBA 1JZ3A 5FKBA 3RNSA 1YFUA 1AR82 3ETPA 1S0GA 4QB6A 2WZR3 2RS32 2E63A 5FZ1A 4I3PA 3X29B 4AR2A 4CU8A 4K21A 4FPEA 3BCWA 3H1YA 4MOAA 3JD71 5JCTA 1JHNA 2VMEA 3QBQA 1H2MA 5A7WB 4NIIA 1SDDB 2HH9A 3MLLA 3MW3A 1UYPA 1OPMA 3ZYBA 3WNKA 1MS9A 1QEXA 4UAPA 4KI5M 4XJWA 1VBD2 4CE8A 1IHMA 5IWFA 3ZX7A 1MS5A 4DNYA 4QU1A 5I91A 1F4AA 3GHNA 4OI1A 4IW3A 5SV8A 1KEXA 1W3XA 3IKWA 1RUG1 3PIJA 1BVP1 4AI0A 3H7YA 3NW4A 3IIAA 2RG4A 5FJKA 2ZGSA 2R062 3NAPB 4Y24A 3HNBM 4CUGA 2HWF3 1WA6X 3IZOA 2WQ8A 2JXAA 4FFFA 1A34A 1HRV1 4HPKA 1JZ6A 5FDBA 5HCBA 5G05L 2FDFA 4AK3A 5JLVA 4CP2A 1LHUA 2NYYA 3AFGA 2R0HA 3OUHA 4MXWA 1N1VA 1DLCA 3ZFEB 3PJQA 4ES8A 5J96B 3SXWA 3N9MA 4CDWB 3IN9A 3SKVA 2FZ2A 2VOXA 3MHZA 3ZXKA 2HEYF 2VQTA 1GOFA 1OBNA 1L3JA 4HN0A 5FZMA 2B42B 3WQ7A 5CFCA 3PU3A 1R1A2 4D0QA 4HZFA 1VMFA 2BUKA 4Z1VA 4XUOA 5FAXA 2D43A 2C9KA 2R1DA 2WLQA 4UI9L 3A0KA 2SBAA 4YGDA 4CCMA 3KMHA 4GQ7A 5JSOA 5KWRA 4YFWA 4BQWA 4MUVA 3TNPB 3AP6A 2QQVA 2JDKA 1UYZA 2Z42A 4GH4B 4Y3OA 5L19A 4CXYA 3MZHA 2EVXA 2HWE3 2Q1ZB 3VBSC 4FPGA 1O4YA 3WW4A 2OZJA 2JG8A 2KM2A 1OVPA 3I2JA 4DIQA 3ZPOA 3LKJA 1QJU2 1ZZ6A 4A6SA 3S30A 4TSVA 4LUKA 4FVVA 4RR3B 4YPJA 1QF3A 3NKGA 1ULOA 5FYTA 2BFUL 4YVWB 4BQ3A 2YPDA 4D7SA 1O8PA 2ZS6B 3AXDA 3OBZA 2RS51 4K8FA 3KCYA 1DGWX 4GZ9A 3E5QA 5AC93 5C8CB 1ZX5A 5FP7A 3WF4A 1PGW2 1VAMA 4IEUA 1RUI1 1UZYA 3HR9A 1PGL2 4JHTA 3BYWA 4TXWA 4CDQC 1DZRA 5DAWA 2R071 3WP4A 2ZBJA 3DYPA 1RUJ1 5GZDA 3AL6A 3RSJA 1YQCA 5AC91 3WUCA 2YGLA 5FY4A 3ZYFA 1GQPA 2VTFA 2XLGA 2WS92 4LBMA 4QPGB 1TVGA 5BV6A 4XJ8A 5HBAA 1AX1A 4PI2A 4ZHNA 1WW7A 4AFDA 2XUEA 1GLHA 2DUPA 1IQDC 4S2FA 3VDBA 3GBGA 4BPZA 1R1A3 3ZXDA 4DMIA 1OUXA 3OEBA 1FV2A 1W2TA 2Q1FA 4ZXKA 3T2OA 5IVEA 2FDGA 4Q4W3 2LROA 1IGOA 1UZ0A 1NLRA 2GMMA 4XIOA 5D2AA 5J7MA 5IVYA 4BZ4A 5TSWA 2JG8B 4IE7A 1J83A 4QKNA 4PIZA 3WG2A 3I3QA 5DDJ2 5IK5A 2QQIA 3WHUA 2TNFA 2WT2A 3IWZA 4Q26A 4QXHA 1OFSA 3ZIWA 3ZO0B 5C5TA 3FMGA 4COZA 4NUBA 4CU9A 3VHOA 1IG3A 2GH2A 3O1UA 2PAKA 3ZYPA 1QJU3 3H8RA 3NAPA 3WF1A 3MV01 3SISA 3C7FA 1O3RA 2IUWA 1W90A 3HNYM 1PO23 2XVLA 2W9XA 1H4GA 2R063 5JIAA 1XNDA 3MF9A 2HWF2 5FYBA 4Q4X3 1H6YA 1COV2 4DY5A 1W6PA 1RUG3 3FLTA 2XWBB 1QH6A 1QJX1 3PNAA 1ZNPA 2GP5A 4E2QA 4FFGA 4KG8A 4MYEA 4BISA 4XUTA 4A42A 2VOKA 5FXWA 2RVAA 3GNEA 1YWKA 4LHSA 5GLVA 5CFDA 1I5PA 1TME2 1GSLA 2EAKA 2Y6JA 3TBDA 3WUDA 4A3XA 3RZZA 2ATFA 4Q29A 1HW5A 5K4LA 1XNCA 4UFKA 2JDPA 4OI4A 3C7HA 1NXMA 2NQYA 3I97A 4RN5A 5H9PA 5EJ3A 3WDXA 4DY3A 4DQAA 1PMJX 1I5ZA 2AR6A 3FJSA 2XJPA 4CCNA 4QX8A 1SPPA 3HOBA 3MIBA 3LQCA 3OBTA 1MZEA 4YLZA 5I0UA 2VW1A 5IFTA 1ND2B 1HRV2 2JDYA 4O7XA 4O9EA 1XBFA 1S1AA 4OUEA 3BIWE 1B09A 3GCXA 5K0UC 2WBKA 2HWC1 3BKZA 2X09A 3WW2A 1J1LA 4HVOA 5LCWL 4UWDA 4XDQA 5A33B 1UYXA 4P9GA 2JWPA 5EJ1B 5FZ9A 3TB0A 4TLFA 5T5PA 2XVGA 2UY8A 2C26A 1OA4A 4Q0PA 4XUPA 2VW2A 4RR3C 1UO9A 1EPWA 2HKXA 4XOGA 4AVBA 1K12A 1POQA 2ZA9A 5J48A 5FYVA 4BIOA 1RUH1 2ZKNA 4HBNA 4JDMA 2W39A 4UW6A 3WQ0A 3MUY1 5ACA1 3IBMA 5CG8A 1WA4A 3N9QA 4NHXA 3WP6A 5K9YA 2PHLA 1DF0A 1XQNA 2JG8C 4FI9A 1H9PA 3WQBA 5A7QA 5DPNA 2Z2SB 4AFMA 3I2DA 3WP5A 3PHMA 4HT1T 4PDWA 2D40A 2G9FA 1X9PA 3I2FA 3N9OA 2GZWA 3N9PA 4XE9A 4XQWA 3PL0A 4GKYA 1RHI1 5FZ8A 2D5FA 2AC1A 1K5JA 2QKDA 2RJLA 4LK7A 4W50A 1NLSA 4W8JA 5FZGA 5C9AC 3BU0A 2R073 4P5HA 4YGBA 1HRI1 1C28A 3HBZA 4CDUC 1LGCA 2E51A 3GZTB 4KH9A 4CYDA 2CV6A 3FWEA 1HXS1 2ARCA 5HI0A 1TEIA 3AZVA 1ODMA 2BNOA 4LBQD 4XF4A 5F5AA 4AVSA 1XJAA 2PHFA 2XBO2 3LGRA 4UBHA 4UFMA 4WVVA 2PTMA 3OPZA 5A1FA 3NJVA 4OLLA 4UXAA 1WMFA 5DZEA 4AF9A 2ZHNA 2GC2A 1JW6A 3E6CC 2FZ1A 1IQAA 1DQ0A 1CZVA 1NCRB 3PUHA 1UX6A 2XXZA 3N7LA 1YEWA 3IIIA 1BEV1 3K3NA 4JVAA 4YVWC 5AVPA 5B4XA 4A7YA 1DYKA 1HJGA 1MR5A 4P00B 4XJAA 1XE7A 3H42B 4FTEA 3FBMA 2CGOA 4MX3A 3RZLA 4NAMA 4ASLA 2Y64A 3H9AA 1L7QA 2ORZA 2VZRA 3ALQA 3ABZA 1U12A 2NN8A 3RVHA 3WW1A 4E4SA 1JYXA 4X8PA 1MS4A 3LE0A 4OHZA 4KL1A 5FY1A 3QH7A 3ACGA 1FI2A 2DYCA 4UBGA 2HLEA 3KV6A 5FPUA 3G6JB 2AGSA 3LA7A 1PVC3 4F83A 1JYNA 4J1XA 1ND3B 1A8DA 1QKQA 4A2UA 1RVF2 4D7YA 3OEAA 3NSTA 3I2HA 4M0HA 3VBFC 2DVAA 2A7AA 1DGLA 1W8OA 1ND3C 2JE9A 4MGKE 2Y6GA 1SLCA 2YUEA 5FZ4A 1GKBA 1W04A 2WR9A 3HMYA 4MADA 4K1ZA 3KLSA 3SCFA 2ARBA 2CNAA 4H14A 1VIWB 4S2GA 1I1EA 1UIJA 3KVAA 4MGYE 3TN93 4CSWA 2EA7A 4MVTA 4EE2A 2TEPA 2QQPA 3ZFFB 3PUIA 1UU5A 4DS0A 2DCZA 5BNPA 1DGRA 4IE4A 3POEA 4IV3A 1WLWA 2WNUC 3T2QA 3EYPA 2KR2A 3JB4C 1H8VA 4PLMA 1WW5A 4LKEA 1HRI2 3HVDA 4N53C 4QX7A 3VBOC 1J1TA 5FO7B 3HBKA 3UETA 2Q8DA 2WQ4A 4QGMA 1W8WA 4P9YA 5FMOS 4AQSA 5F7UA 4XJ9A 3OYWA 3UNPA 2LUWA 5FO9B 5L36A 2A73B 1NE4A 1UQXA 3KT1A 4XBNA 3ZFGA 4AHWA 1YNAA 2UYAA 3VHRA 4CDUB 4CVUA 4OHYA 2Z79A 4QB1A 2Y0IA 3HIFA 3PUAA 2O1QA 4IXLA 3H50A 4PQQA 3V0BB 3ZKYA 3T30A 4LOTA 5CFDC 4COVA 1ALYA 2X5IB 2HBTA 2VZTA 4KWKA 4CCDA 1NZIA 1ULDA 3ZSLA 4Q4Y1 4JGZC 2Y0OA 5KXBA 3CBNA 4BJ0A 2LTNA 1OHFA 1YLLA 2WJSA 3AP7A 1NY72 3D82A 4FQZA 1AR62 1EUUA 2V5DA 1W2UA 3VD3A 2C9AA 2P17A 4C90A 2YPJA 3PMEA 4Q8KA 3FLPA 1UWWA 2BGPA 4MHRA 1YI7A 2OXBA 4AVAA 1W2AX 4BXFA 3ASIA 4LBQB 4G9SB 2OKXA 1TME3 3QOPA 4HONA 2XL7A 3FLRA 3C2UA 4YM0A 1WCKA 3K4ZA 4WM8C 4AEMA 1F35A 2ZAAA 5F5IA 4QX0A 3RDIA 1H1AA 1MEC3 1NA1C 1OPOA 3SH4A 1KRIA 2QQKA 3U1XA 3TNQA 1UU4A 4PI0A 5GZFA 2CU5A 2PHWA 1IPSA 5F6LB 1BHGA 4IEWA 4OFGA 2JG9A 3RYRA 4FTBA 1OSGA 2BV4A 4KGQA 5T3NA 1RMU2 4XETA 2ID4A 2PMWB 2CWSA 2Y8KA 3UV9A 1XXNA 2J1SA 2WAAA 4AHXA 3KSCA 1Q8PA 3WLUA 4WM7C 3ES4A 2QQMA 2EIBA 4INDA 4MV2A 4EN0A 3WDYA 1CAUA 1W6QB 4Z2WA 3VBHC 2YBPA 2R32A 5H9SA 3E6BA 4IEYA 1GWKA 1UOBA 1QDOA 3V0BA 5DUVA 5FO8B 2V73A 2A1XA 2ZGOA 4Y5SA 4QM8A 1X33A 4I2OA 3D4KA 3SLIA 3FFZA 1CR7A 2BWAA 1N1TA 1C57A 2PLV1 2YBSA 5GLTA 3RFRA 2ZZQA 2QE3A 5LZ6A 5FMCA 1ULGA 1REEA 3K51A 3WNPA 4B7EA 3IDCB 4AW7A 1POV1 1PVXA 2A6WA 4OUMA 2UYBA 3NAPC 1CD3G 2F6BA 2GMPA 1QOTA 2A6ZA 4O61A 1UOFA 3H3UA 4JQTA 3I3BA 3WG4A 2RS31 3EQEA 5BNPB 2WYSA 1QOOA 1QXPA 1ZZCA 4F8AA 3RYPA 3IM0A 2FDHA 1CAVA 5A32A 1UL9A 3GALA 2XDVA 3H1WA 2PN5A 4MLOA 1PK6C 2JDNA 3T0DA 4XAEA 4QDRA 1KS4A 1WCDJ 2J1AA 5LRSA 3K3OA 1MS0A 2WUHA 2R072 2X05A 1JU4A 1HQLA 4TZDA 3W5NA 4Q0QA 4Y1UA 3WX5A 4Q0SA 2XOMA 1O5LA 1QJX2 3MLJA 4N8MA 4NO4A 1XYPA 2CWMA 1QXJA 2PHXA 3N3HA 4PIYA 1WLCA 3WINE 5C9AB 2OVUA 2C5DA 5IJRA 4K7JA 4JRAA 3J7MA 2BGCA 2VR4A 3K4AA 1XNBA 2IC1A 1FMD3 2OT7A 4R4ZA 4UFHA 1JYCA 2WT1A 3H8OA 1LHWA 1S0CA 4D8MA 2XHNA 1RMU1 4XF0A 3SC7X 4QPIC 1C8NA 1NX9A 3LA3A 4P9LA 4QPGC 4RGAA 1N3PA 4MGTA 2WFF1 4RGGA 4L99A 3N9NA 1EAH3 5FUNA 2VBPA 2DU0A 4LBKA 3PIGA 3C7EA 4SBVA 1VAKA 3KHCA 5CFDB 2W52A 3ATGA 2DV9A 1H8TA 1TNFA 2JDMA 3NV2A 5I8YA 5KHKA 1JZ4A 5K7PA 3V0AA 2WZEA 4K8RB 2XQRA 3THDA 3CNAA 1US2A 5GLZA 5HXMA 1IS4A 2BNNA 1ULFA 3VKOA 3ZLIA 2BP6A 5LA0A 2CGNA 4MGIE 2WA4A 3OSDA 3VBOB 1JYVA 2YU2A 3SCGA 3LOIA 2PELA 3U14A 4P02B 1KJLA 2BVBA 3CIHA 3H8UA 2EXIA 2IWGB 3PUQA 2X29A 1FOD3 2QDRA 3O1RA 1TE1B 5I0DA 1UMHA 1NCQA 1FYUA 2Q5TA 1BCXA 3B3QE 3ZXJA 1Q8VA 4FPCA 5HV4A 1RUI2 2PQQA 3SKJE 4D69A 3KT7A 3M3EA 1KFXL 4LTAA 4ASKA 2DCKA 4ZU4A 4GH4C 5D1IA 1O91A 4FXGB 2BERA 5F2SA 1QJX3 5A6XA 3O1MA 5IAXA 5FY7A 4WVWA 4YVSC 1XNKA 3NRUA 3OD4A 4GULA 4LKFA 4LULA 2RR12 1RUF1 3AP5A 4J6GA 3ZDVA 4XJUA 4P9IA 1GFF2 1YJLA 4CXXA 1NYWA 2FQPA 4CUBA 3O1SA 2P34A 4BK4A 1LEDA 1AXZA 2YMZA 1OKOA 2UU8A 2WFF2 4Y20A 1AZDA 1RUD2 1OQEA 4L8QA 2GMEA 3DCQA 1CESA 2JIJA 3LZZA 5FPZA 3WCRA 5BNNC 1YQ2A 2WS91 4YVSA 1RXGA 4CPBD 3WEZA 3T08A 1GANA 3CQOA 4IETA 2ARAA 5IATA 1BMV2 2VC9A 2QQJA 3ELNA 2HYKA 2AEZA 2E32A 3IPVA 3MFCA 4NPLA 2JD4A 3ZFGC 5C3RA 4Y1YA 1CONA 2VVDA 1NG0A 4JCKA 5CADA 1XNAA 2ZPXA 2CSGA 3A21A 3T09A 2WS93 1XRUA 1AR71 1M4WA 1D4M1 3JU9A 2WO7A 4CA9A 4ZY9A 1QNWA 1JZ8A 2JDZA 3DECA 4GD4A 5EP9A 3F2ZA 5E89A 2CL2A 1TMF2 1JZ5A 2BQPA 2JD9A 3A0NA 5FMBA 1X36A 5FOJB 5CG9A 1RUH3 3BTZA 1HJFA 1GQGA 1YCIA 1YQ5A 4OVEA 3R4UA 1XYOA 5ACA3 1E5HA 1H0BA 4H55A 4JZRA 1O4TA 3CF6E 1RUI3 1CVNA 4H2AA 1R083 5CYYA 3VKLA 3FBYA 2Q4SA 3I3MA 4OYUA 1DLLA 2YROA 3T4VA 2ZKLA 3PJYA 4XAAA 1FMD2 3B69A 5LA2A 2VVEA 4ATFA 1UY4A 4XQDA 3ZXGA 2R1BA 2E53A 1SLAA 1OOPB 3WF0A 2DBIA 5JWPA 3VZKA 1PO22 3BN6A 1W9TA 5DXDA 1T6GC 2RS53 4M4RA 5H9QA 4DEVA 5AFBA 2ZEZA 4AEDA 5CBLA 2IXJA 2C24A 2JEMA 1SBDA 5D8AA 1SZBA 2DCYA 1RGSA 4XEZA 3RJRA 1F4HA 1V00A 5DAXA 4U36A 1KD7A 3I59A 2WZPP 2SLIA 1CAUB 5FP3A 2KA3A 3V0AB 1QIQA 1DG6A 3ILRA 1D0HA 5C3PA 2PYTA 1SLIA 1S0FA 4CUCA 1Q43A 4LQRA 4QWNA 3PTRB 1UZWA 3U4SA 5FZCA 5C8CA 3ST7A 3LSDA 3I2GA 4FFHA 4AGGA 4XZUG 3HT2A 1MVEA 1SFNA 2IXIA 4NN0A 3ZSEA 4AEKA 3POIA 1JYTA 4LITA 1PIV3 3OGGA 4UT5A 2ZACA 1ZRDA 4IE5A 4JV4A 2VZPA 3LDRA 1G7YA 4Z07A 3VBSA 2WN3A 4KNCA 1T2XA 4NHLA 5DMYA 5I0RA 2WSVA 2WC2A 4B8EA 2JB8A 5IK7A 5F8PA 5FYUA 1PVC1 4FAHA 5FZIA 1Q3EA 3CJIA 4EYUA 3AZYA 2V72A 3E1F1 1IS6A 1E5SA 2WIIB 4R9DA 4U2AA 4XMIA 3FHAA 5C9AA 5LWBA 3GJBA 4CCOA 4NIGA 3T2TA 4WVMB 4IV1A 1OVSA 4W65A 3VBUC 1UMZA 3O12A 1ULPA 4RFRB 4ZPIA 4BLJA 3BI3A 2YFZA 2VGDA 3B5LB 1S0DA 4ASMB 2GNTA 2W2IA 1W8UA 5T5LA 3VZOA 1MZFA 2VUAA 1NCRC 3VL9A 5EWSA 3MI8A 4QDSA 4AE2A 4LT5A 4GB31 3KM5A 2VCAA 3TWIA 1XYNA 1OLQA 1GQHA 1TQ5A 4XDOA 2VECA 3VBHA 4LIUA 4BOWA 4YW1A 4AI8A 3TN91 3P3PA 3MIFA 4XTPA 4XABA 5FZOB 1NAEA 1WCSA 2FBEA 2VCBA 3DYOA 2I74A 1S4CA 4IGQA 1PK6A 4MGQA 3K4DA 2A75A 2FCUA 4FP3A 5JSRA 3RG0A 4QX5A 4XFCA 5IUQA 1CAWB 2GC3A 4Y4RA 3SH3A 2W5FA 1IKQA 1GWMA 4DFSA 4TYSA 2R49A 1NCQB 2O8QA 3F95A 2CAUA 5B4NA 2QCSB 2DVDA 4Q4V3 5A6YA 5FREA 5L7OC 1D2SA 2PQSA 5CKNA 3CMGA 1RUC1 2F17A 5CFCB 3NNLA 4ZZ5A 1AR73 2IFRA 4NHMA 3WW3A 2BJSA 3NNMA 3VDDB 5F32A 1LHNA 3KVBA 5A3NA 1RUH2 5GLUA 2ZGPA 3FHQA 3HQRA 3SMHA 2VTXJ 4CDXA 4QQOA 2XL9A 4NJ4A 1QMJA 4B7KA 1S2EA 3LEIA 5LK5A 1R082 3DV8A 3FHIB 3QLQA 1PO11 1GU3A 4FPHA 1H1IA 1DYOA 4NE9A 1V6NA 2VULA 4CCEA 1E57A 3LDKA 5FZAA 4EWDA 1L7LA 2W47A 1VBC1 1LJ7A 4XHBA 1AL23 3QCWA 5JVVA 4Q0VA 3DPRC 4Z2AA 3IB3A 4L0PA 5LATA 3FL7A 1WGPA 1W28A 2NLRA 5FZ6A 4URAA 2QZ3A 1VBC2 2ZHMA 1MACA 3NMBA 2J1EA 4NVPA 3I2KA 1NA1A 4LO5B 5F5CA 4B1MA 3LOBA 1ND2C 4IDZA 1SBEA 4RQPA 1VPHA 2A71A 1V9U3 4DUWA 3LPFA 3OB8A 4LR4A 4E8DA 1W6MA 3R6SA 4AVVA 5L7OB 4JTNA 5JOXA 5GZGA 3DPRA 4B4RA 2AH2A 2IXCA 3CU7A 4IL7A 3AVRA 4BH9A 2VPVA 3ZPYA 4AFAA 2ENRA 5BUVA 4HETA 1PK6B 3NO8A 2D44A 1CAXA 1S2BA 2XBO1 3DXTA 3DKQA 3K75B 1Y9QA 1BYHA 4RS5B 1EV11 2HWD2 2MEV3 2I07B 2E33A 5KXEA 1SMVA 1YYNA 2VMCA 3WXPA 5KBFA 3VV1A 3INAA 3NJXA 1GOGA 4Y1ZA 5HV0A 3RS6A 3K2OA 5I8TA 3N7MA 3NKTA 3OCPA 3ETQA 2C1FA 3HEIA 1XSRA 3T4HB 2LW8A 2NZ9A 1EV13 2MEV1 1ASJ2 4R9BA 5C8WA 4CEYA 1LAJA 5FYHA 1PMHX 4BLIA 3Q8FA 4BE3A 5F9TA 2F4LA 2C4XA 4XFFA 3VBUB 1ZZ7A 3VZLA 3Q8AA 2NM1A 3W20A 4CDWC 1AR61 4Q4X1 3TYJA 1FT9A 3VLBB 3WSOA 1UY3A 3A7QA 1OURA 1VMHA 3CO2A 5CISA 1JUHA 3BODA 1OUSA 5DAQA 1W8NA 4EZHA 4DRVA 1S0IA 1I6XA 1SCRA 2E7QA 4ISQA 4CP9B 1YFXA 1AR63 4EN7B 1ZBA3 4ET7A 3Q9OA 4Y5Z0 1W6OB 3U75A 1FNZA 3NWKA 1F9KA 3BTYA 4YM3A 1Y9GA 3KD4A 3MW2A 2OPKA 3CZJA 4AEDC 2DBNA 3WD5A 1DQ6A 4DXSA 1DGWA 4HKOA 2WNVB 2ZX4A 3I3EA 3H0OA 1NA1B 4NWVA 4XXPA 5FLJA 1OT5A 1O3TA 3M3OA 5K0UA 4WM8B 2VMDA 4LLFA 1RUD1 1G9DA 4E27A 1ZZBA 4YNIA 2D3RA 2HEVF 2IXLA 1ULEA 3VDDA 4A41A 1YJKA 1AYM2 1OH3A 2OUJA 2XLFA 1V6KA 2WNVA 2XJUA 3OJBA 4DXRA 2B9VA 5JPNB 1LKNA 3OYWB 4FOVA 1RUC3 4GWMA 3WT3A 4AAPA 4LJHA 1EUTA 3POFA 4A4AA 4YYOA 5A7OA 1LOFA 5T50A 4DO0A 4DXZA 1DGRN 1H2NA 2A3YA 4N43B 1W8ZA 3K48A 1AYN1 3R05A 1BK1A 1OOPC 1VBD1 3LF7A 4LBJA 4XFHA 5BXXA 1VB4A 4BU2A 3WG1A 2EICA 1ZRFA 2W94A 4BDVB 1IS5A 3S6PA 4OZXA 1GMMA 2AREA 5LA1A 3ZN6A 2WZR1 4PF1A 2H0VA 1LTEA 3TEYA 3QH6A 3H3LA 2ZMNA 2XJTA 3NJYA 3MV11 1VBC3 2YYOA 2HWB3 1YFWA 1OMIA 4EN6B 2J1VA 1QWRA 2DVBA 4LIVA 1G6NA 2QTWB 1UMIA 4HN1A 4K1YA 4RYDA 4EN8B 1W05A 1U5IA 3RYKA 3AKTA 3Q8BA 3OGSA 1KJRA 4MSVA 1O59A 5F3EA 4YZ2A 4AEJA 3FUOA 5FXZA 5DUWA 2ZMKA 2J1RA 5M0TA 2BBVA 1GBGA 3G7DA 4FPKA 3ZOIA 1MZ5A 4IGOA 5C6CA 4AQ2A 1QJFA 5DG2A 1SDWA 1QNYA 1VLNA 2ILMA 1MEC1 1GP5A 5LEKA 5APAA 5A7NA 1AX2A 2XHKA 4HVRA 4NHYA 3VDAA 3ZN6B 1MS3A 2MEV2 2HWD3 4ARYA 4CU7A 3VHNA 2VMFA 3TEWA 1LR5A 1LEMA 1WD4A 4DXTA 1LHVA 5BNOA 4HSLA 5A3PA 1QQP3 3CHXA 2IZWA 2VXRA 1UPIA 2DFBA 3M70A 4FO9A 2FDIA 5LK7B 5FLHA 2A70A 2VVFA 3R0RA 3WZ1A 5FK8A 1RUC2 1N3QA 1H2KA 3Q8EA 4IV1B 3ZYHA 1GUIA 2CAVA 4C8DA 1NCQC 1K5MB 1RTVA 2NMOA 2DDUA 2QDNA 3SNMA 4Q8LA 3JBG1 1VBE2 5FYMA 2N7GA 3UL2A 1D7PM 2EIEA 1HX6A 2YC0A 3D0JA 3P1IA 4BQ4A 5E16A 5A3LA 4QPYA 4QPIA 3VGIA 1W0PA 5C33A 1W9YA 1Y9MA 2BDRA 2HJIA 1XU2A 2R6QA 2W1QA 1HQNA 1Z0HA 4HANA 4LBQA 5J09A 4IQPA 4RD7A 2H6CA 4SLIA 3D8CA 4P9JA 4OI0A 1PVC2 5CNAA 4FCAA 1O5UA 2HWB2 1VRH3 4KWLA 5T55A 4FPFA 5FV3A 2H0BA 4UW5A 3UGFA 4MGSA 1ZBA2 3POBA 1V0AA 1PX4A 1KXGA 3B01A 3NNFA 4URTA 4X6RB 3HNMA 4RGKA 1FXZA 3RMXA 1PM4A 1GNZA 1V9U2 4KQ7A 5HCFA 4E4HA 3OPTA 4FFIA 3ZVXA 4BQ5A 3MBWA 1VRH1 2X5IA 3VB9A 2Y6KA 1YFYA 4LNVA 1H8TB 1W6PB 1G8WA 1UIKA 2DVFA 4YZ5A 2Y38A 1ST8A 5KHJA 1QJY2 1GZTA 2J42A 4NIDA 1DZTA 2ZX1A 1UYYA 3ACLA 1OQ1A 2X8KA 2OX0A 4W4ZA 4LO4B 5FY9A 4A7ZA 4BHPA 4CTEA 2OPWA 1GICA 2ZHKA 5B2GB 1HB3A 1ODNA 2ZCWA 3EXUA 3WNMA 3M1HA 3RI8A 4CP1A 1OFNA 3KQ4B 2BOIA 4FPLA 2ADDA 2LM3A 3THTA 5L7OA 4BYYA 4AAXA 2B7YA 1GYKA 2AUYA 1PX3A 3LD8A 2RS12 4AHZA 3WCSA 1YIFA 5LW9A 2ZGUA 5J98B 5CB7A 1WWYA 2VUDA 3B94A 2QJVA 4AXOA 1DDLA 3U37A 1QU0A 2RMU3 3RZGA 3ZYGA 1N47A 1ZBE3 2XH6A 1RXFA 3MEPA 2BPA2 4BQXA 3EO6A 4W6WA 4CEWB 1BJQA 1VB2A 2ZAHA 2WFF3 3OF1A 4COUA 3MGUA 1MVQA 1S55A 3HWJA 1VR3A 2QUOA 3DUIA 3TOJA 1UOJA 4GMP1 4I30A 3M3CA 1C1LA 1UU6A 1QXRA 3BTXA 4GALA 4MGZE 1NCRA 3OBAA 1MQTC 1L7RA 5JMOA 1DP0A 1W06A 1AVBA 1CIYA 2FCTA 1LGBA 3BTAA 3ILFA 4C0HA 3POGA 4KU8A 5GZCA 1RUE3 3ACHA 2ZX0A 3AKPA 1PGSA 1OLRA 4WZCA 2YY1A 3WV6A 4PLOA 1LODA 4CDQA 1AF9A 2AENA 3O7OA 5FZ3A 3MDPA 2DFCA 1VJ2A 4N7UA 4AEDB 5C5UA 4DUXA 2XJSA 4NRPA 1WBFA 4R52A 4H3WA 3CDZB 1C5IA 3WDWA 1J3PA 2YC2A 1JU3A 4YFZA 4P08A 3PU8A 5A3OA 3WNLA 5ACA2 3MW4A 1XE8A 4R9CA 4BQ2A 3AVSA 3K77A 1JOPA 4QX3A 4RQPB 1OA3A 4QQPA 5FBZA 5FY0A 3GJAA 1ZZ8A 2W95A 1DQ4A 1WW6A 2B46X 2D5HA 4MXWB 3M7AA 1RUF3 1AR92 4GXLA 1LU1A 2WT0A 1DFQA 3UKNA 1H6XA 3K46A 1RHI2 5JAXA 1DBNA 1XE0A 3M2MA 1WZXA 1D4M3 5IK8A 1UD1A 1CQ9A 2K0GA 2BFUS 5LRRA 4WV8A 4CEWC 4Z8BA 1RINA 1KFUL 2Y6FA 4PF5A 2HBUA 5IYYA 2I45A 4DPNA 5E88A 3VL8A 1YIPA 1B35C 1VRH2 2XJRA 4MH0E 1W0OA 5FUIA 2DF7A 1FPN1 3GYDA 2VUJA 3JXSA 3POJA 3MF6A 4CDWA 1IG0A 1S0EA 3O1VA 4BK5A 3CJXA 1RVF3 1AX0A 1MPXA 4LK6A 5JZGC 2EXKA 5CIRA 2BZDA 1O8SA 3PTYA 4N9IA 4A44A 2RM22 3NJZA 1LOCA 1M06G 3VD4A 4NRQA 5FYIA 5JSPA 4YVSB 5FPBA 3AKRA 4AFCA 2UWAA 4QGLA 2PA7A 3HD8B 5JXJA 4LUMA 3EMRA 4M01A 1PIV2 3WNXA 5ISLA 2VY0A 4HLTA 1SEFA 2YG0A 1CWPA 5ERLA 4QX2A 2MPFA 4H7LA 4IE6A 1GR3A 4LORA 1GZWA 4CDXC 3TAYA 3MFAA 3TN92 1COV1 1C1FA 1SLLA 3R4DB 4AGVA 1X9TA 2VO5A 3OBRA 5JI9A 4WM7A 5FIXA 1J59A 2HWE2 3AMNA 1CAVB 5A32B 1R081 3MICA 5IAVA 2CYFA 1UPSA 1H9WA 3LEGA 1QQP2 2D6MA 2VZUA 1BZWA 5EXOA 3ZYIB 4C1WA 4YSFA 3KCCA 1RJ8A 1HRI3 4KGGA 1XU1A 2FHRA 4O65A 2D98A 2B4KA 3ZXEA 3CKHA 2P3IA 3FX3A 2VQAA 5JDBA 5FY8A 2QVSB 2WO2A 3J9SA 1SPPB 1ZBE2 4ZS2A 5CKMA 3PUSA 3VD9A 1PZ9A 4IV3B 1VBE3 4Y5TA 4PBPA 2EIDA 4AL9A 2WO3A 1LOGA 4JTOA 2IFWA 4P14A 2EF6A 4RHV2 1KS5A 5FZ0A 1WBLA 4XF9A 4QXCA 4OQ9A 4QHOA 4DINB 3WHTA 2PFWA 2W3JA 5KHIA 5JXGA 1EAH2 1CJPA 3IAQA 1IKPA 5J36A 2FD8A 3VBFA 1EPZA 4XUNA 1O3QA 1K45A 4ATEA 2VU9A 3ZSKA 1RUG2 4R8HA 1R1A1 1W6QA 2WFPA 4BWOA 4UF0A 3S5AA 4ZONA 2VG9A 3KT4A 4E9KA 2WSUA 3H7JA 2R061 2OA2A 4OQ8A 1DQ2A 1VBB2 1AL0G 3POSA 4JGYB 1IPJA 5DDJ1 5D21A 2RM23 5FYCA 3P6BA 2P6HA 2VBBA 1STMA 1HIXA 4UOJA 3MUZ1 5C4WA
chains in the Genus database with same CATH topology
3PU8A 4CCOA 5FYBA 5IW0A 5FZHA 5FY1A 4GJZA 4D6RA 3AVSA 5IVCA 3KV6A 5FYHA 5FP9A 5FPUA 4C8DA 2W2IA 2GP5A 5FY0A 2YBSA 5FBJA 5FUPA 4Y33A 5FYMA 3N9MA 4BISA 5FXWA 4AI9A 5IVVA 4XDOA 4LIUA 5FYYA 5FPAA 5FZMA 5K4LA 5FZOB 3PU3A 4IGQA 3RVHA 5FZ4A 4EZHA 5FPVA 5FP8A 4CCNA 4QX8A 5FV3A 5FZBA 4CCMA 2XDVA 4Y4RA 5F3GA 3KVAA 5FZDA 4CSWA 5KR7A 3KV5A 4Y3OA 4GD4A 3K3OA 4UF0B 4QXBA 5FZLA 5FYZA 5FZKA 3AL5A 3OPTA 5FZ7A 4E4HA 2WWJA 5LY1A 2YBKA 3KV9A 3N9LA 5FZ9A 4DIQA 5FZOA 3ZPOA 5FYIA 4TN7A 5A3NA 5F32A 2Q8EA 3KVBA 5FPBA 5A1LA 4QX7A 5FYSA 4GJYA 4V2WA 5FY9A 2OX0A 2Q8DA 3KV4A 3OPWA 5ISLA 3U78A 5CEHA 5FYTA 3PURA 2YPDA 4CCJA 3LDBA 5FYVA 4AAPA 5FZFA 2OT7A 4D6SA 5A7WA 4CCLA 5A7OA 4DO0A 4V2VA 3PUAA 2WWUA 5F39A 3PDQA 5A7PA 5FP7A 3N9QA 5F2WA 5FZAA 3LD8A 2Q8CA 4BU2A 5FXVA 5F37A 5A7QA 5F3CA 4D6QA 5LW9A 5FPLA 2VD7A 3N9NA 5FUNA 5A3WA 3AL6A 5A80A 3N9OA 2OQ6A 5FWJA 3N9PA 5FZ6A 4HOOA 4URAA 5FY4A 5FZEA 5LY2A 5FY8A 5FZ8A 3NJYA 5IVBA 5FZGA 5F5CA 3PUSA 5FY5A 5FP4A 2P5BA 2OS2A 2XUEA 1VRBA 4LIVA 5FP3A 5FWEA 2YBPA 5FZ0A 4EZ4A 4BXFA 3DXUA 4QXCA 5FZ1A 4HONA 3ZLIA 5IVEA 4GAZA 4QWNA 3PTRB 3U4SA 5F5IA 5FZCA 5A7SA 5F5AA 5IVYA 4CCKA 5E6HA 5A3TA 2YU2A 5ANQA 5A7WB 5FXZA 2GP3A 5A1FA 3AVRA 3PUQA 4IGOA 5IWFA 4LITA 4UF0A 4QXHA 4QU1A 5FXXA 5F3IA 2PXJA 3DXTA 4NUBA 5F3EA 2XXZA 4ASKA 3UYJA 3K3NA 5A7NA 5FZ3A 5FJHA 5FYCA 4LXLA 4XDPA 5F2SA 5FYUA 5FZIA 3K2OA 4EYUA 5FY7A 5FJKA 5IVJA 5A3PA 5IVFA 4IGPA 2OQ7A 2YU1A 2XMLA 4CUGA 5LWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PU8 A;  4CCO A;  5FYB A;  5IW0 A;  5FZH A;  5FY1 A;  4GJZ A;  4D6R A;  3AVS A;  5IVC A;  3KV6 A;  5FYH A;  5FP9 A;  5FPU A;  4C8D A;  2W2I A;  2GP5 A;  5FY0 A;  2YBS A;  5FBJ A;  5FUP A;  4Y33 A;  5FYM A;  3N9M A;  4BIS A;  5FXW A;  4AI9 A;  5IVV A;  4XDO A;  4LIU A;  5FYY A;  5FPA A;  5FZM A;  5K4L A;  5FZO B;  3PU3 A;  4IGQ A;  3RVH A;  5FZ4 A;  4EZH A;  5FPV A;  5FP8 A;  4CCN A;  4QX8 A;  5FV3 A;  5FZB A;  4CCM A;  2XDV A;  4Y4R A;  5F3G A;  3KVA A;  5FZD A;  4CSW A;  5KR7 A;  3KV5 A;  4Y3O A;  4GD4 A;  3K3O A;  4UF0 B;  4QXB A;  5FZL A;  5FYZ A;  5FZK A;  3AL5 A;  3OPT A;  5FZ7 A;  4E4H A;  2WWJ A;  5LY1 A;  2YBK A;  3KV9 A;  3N9L A;  5FZ9 A;  4DIQ A;  5FZO A;  3ZPO A;  5FYI A;  4TN7 A;  5A3N A;  5F32 A;  2Q8E A;  3KVB A;  5FPB A;  5A1L A;  4QX7 A;  5FYS A;  4GJY A;  4V2W A;  5FY9 A;  2OX0 A;  2Q8D A;  3KV4 A;  3OPW A;  5ISL A;  3U78 A;  5CEH A;  5FYT A;  3PUR A;  2YPD A;  4CCJ A;  3LDB A;  5FYV A;  4AAP A;  5FZF A;  2OT7 A;  4D6S A;  5A7W A;  4CCL A;  5A7O A;  4DO0 A;  4V2V A;  3PUA A;  2WWU A;  5F39 A;  3PDQ A;  5A7P A;  5FP7 A;  3N9Q A;  5F2W A;  5FZA A;  3LD8 A;  2Q8C A;  4BU2 A;  5FXV A;  5F37 A;  5A7Q A;  5F3C A;  4D6Q A;  5LW9 A;  5FPL A;  2VD7 A;  3N9N A;  5FUN A;  5A3W A;  3AL6 A;  5A80 A;  3N9O A;  2OQ6 A;  5FWJ A;  3N9P A;  5FZ6 A;  4HOO A;  4URA A;  5FY4 A;  5FZE A;  5LY2 A;  5FY8 A;  5FZ8 A;  3NJY A;  5IVB A;  5FZG A;  5F5C A;  3PUS A;  5FY5 A;  5FP4 A;  2P5B A;  2OS2 A;  2XUE A;  1VRB A;  4LIV A;  5FP3 A;  5FWE A;  2YBP A;  5FZ0 A;  4EZ4 A;  4BXF A;  3DXU A;  4QXC A;  5FZ1 A;  4HON A;  3ZLI A;  5IVE A;  4GAZ A;  4QWN A;  3PTR B;  3U4S A;  5F5I A;  5FZC A;  5A7S A;  5F5A A;  5IVY A;  4CCK A;  5E6H A;  5A3T A;  2YU2 A;  5ANQ A;  5A7W B;  5FXZ A;  2GP3 A;  5A1F A;  3AVR A;  3PUQ A;  4IGO A;  5IWF A;  4LIT A;  4UF0 A;  4QXH A;  4QU1 A;  5FXX A;  5F3I A;  2PXJ A;  3DXT A;  4NUB A;  5F3E A;  2XXZ A;  4ASK A;  3UYJ A;  3K3N A;  5A7N A;  5FZ3 A;  5FJH A;  5FYC A;  4LXL A;  4XDP A;  5F2S A;  5FYU A;  5FZI A;  3K2O A;  4EYU A;  5FY7 A;  5FJK A;  5IVJ A;  5A3P A;  5IVF A;  4IGP A;  2OQ7 A;  2YU1 A;  2XML A;  4CUG A;  5LWB A; 
#chains in the Genus database with same CATH topology
 3VBO A;  2HEW F;  3ZR5 A;  1TMF 1;  3DKW A;  4COY A;  4HG6 B;  2AEY A;  4JGY A;  4TLG A;  5DDJ 3;  1PM7 A;  4BM8 A;  4E4Z A;  4HK9 A;  1APN A;  5FTT C;  1AJK A;  3RWN A;  3RMY A;  1RL3 A;  1JOJ A;  1BKZ A;  4N90 A;  4GWI A;  4A6O A;  3ZXL A;  1C8M 3;  4LBL A;  4QX1 A;  1DQ1 A;  5ABJ C;  3GZE A;  2JDU A;  2L9L A;  2DTY A;  3W21 A;  5DAP A;  1YUD A;  2OW4 A;  2GN7 A;  2VNG A;  3HQX A;  4FXK B;  3WNN A;  1G9A A;  1MS1 A;  5BNP C;  5FYY A;  2UUR A;  1F31 A;  3CZU A;  1GZW B;  3FE5 A;  1SLB A;  4CZS A;  2DVG A;  3ORJ A;  4XYX A;  2KD7 A;  4RR3 A;  1PGL 1;  2NMN A;  4ZKT B;  5FZB A;  1QGL A;  3KS7 A;  5A6Z A;  1WW4 A;  4E4D X;  1RUD 3;  4Y1X A;  3BPS A;  1REF A;  1BK0 A;  4LO7 A;  3KV5 A;  4HL0 A;  1UKG A;  3USU B;  2EIG A;  4KBZ A;  2J7M A;  4BXS V;  5FZ7 A;  2WO1 A;  2GU9 A;  4XPV A;  4FOW A;  2YBK A;  1ASJ 1;  2K9Z A;  4TTG A;  2O14 A;  2GNM A;  4HXC A;  4CEY B;  3W5M A;  1BEV 2;  1PO1 3;  1WUV A;  3MO4 A;  4TN7 A;  3ZXF A;  3AM2 A;  5EV7 A;  3O1T A;  3M3I A;  3TRS B;  1JOD A;  2D6N A;  3AMP A;  4QAW A;  4RL7 A;  4MG2 A;  5JR7 B;  2HWC 3;  4Y20 B;  2Y33 A;  3ECQ A;  2ZGL A;  1H2L A;  3OGR A;  3U78 A;  2HWE 1;  1OQD A;  3D6E A;  4NRM A;  1RUE 2;  1UY1 A;  1ACC A;  4XFB A;  1DIW A;  1OH4 A;  1ULC A;  2FMD A;  2VZQ A;  3WQ1 A;  2XG3 A;  5LEJ A;  2G4I A;  3HN1 A;  5F39 A;  2WKK A;  4LBO A;  2CY6 A;  2ZGT A;  4YRD A;  3PVN A;  1WLT A;  4NPM A;  3ZFF C;  4CXW A;  4IEZ A;  2ARX A;  5J3U A;  4R9A A;  3VBR A;  2QNK A;  5KC5 A;  4I0A A;  3J7L A;  4XIK A;  5LBB A;  1W9S A;  2QQO A;  4NWW A;  2BWC A;  4N43 A;  3A4U A;  2E26 A;  1T6B X;  2LRP A;  3PLQ A;  4JAA A;  2X53 S;  1Y3T A;  1B35 A;  3ZYJ B;  3CL1 A;  4YWA A;  4IUG A;  2J1U A;  2W0X A;  2P5B A;  5FY5 A;  2HYX A;  3RJ2 X;  3PVE A;  4B29 A;  4NIA A;  4BME A;  1AR9 3;  5T52 A;  1W39 A;  1ZM1 A;  3DXU A;  1W8H A;  4JKK A;  1ZZ9 A;  4BCU A;  3KHB A;  2JX9 A;  2F4P A;  1GV9 A;  4ISR A;  1X8E A;  4L97 A;  5K0U B;  1VBE 1;  2DUO A;  2GP3 A;  5BPX A;  2VNV A;  4QGN A;  3AKQ A;  1NXD 1;  1QQP 1;  2B9U A;  1HXS 3;  1QJY 1;  4C1X A;  4Q4W 1;  3ACF A;  1LEN A;  4JGZ A;  2FDK A;  5A3M A;  2WIN B;  1RUJ 2;  3I4I A;  4QDQ A;  4XCB A;  5HCH A;  4Y26 A;  1W9W A;  3VKF C;  4NRO A;  4LXL A;  4ITC A;  3V56 A;  4XDP A;  2ERF A;  2ZGR A;  3E6D A;  1JMU B;  3OUI A;  3SIT A;  2ZEX A;  4IGP A;  5EYY A;  2HWC 2;  2E9Q A;  3FZ3 A;  4TWT A;  4XC9 A;  4EV0 A;  2XBO 3;  1AR8 1;  2VZS A;  3URF A;  3UES A;  4M4P A;  4AHY A;  4I0W B;  4B1L A;  5DUU A;  2Z4F A;  1TZO A;  3IAP A;  3ZMO A;  2JKX A;  2VTX A;  2XKP A;  4NIH A;  4M0N A;  1HDK A;  3VDC A;  1UN1 A;  3AYE A;  1FOD 2;  4S2D A;  4X6Q B;  4AZZ A;  1V6O A;  2A6V A;  4DEQ A;  2G1M A;  3ZKU A;  2RS3 3;  1GNY A;  2R04 2;  2BBA A;  3M4F A;  2W1S A;  3E5U A;  3SCH A;  1G9F A;  2DTW A;  4AI9 A;  1HN1 A;  4JKL A;  4Y4Y A;  1Y4W A;  2O0O A;  3IMN A;  3T0A A;  1LGN A;  2XLA A;  3HJR A;  5G04 L;  4QD2 A;  1JBC A;  1LRH A;  3JCI A;  5KXC A;  1RB8 G;  5L9R A;  3ZDS A;  3VBF B;  2P3Y A;  2XGX A;  1WMX A;  3GDB A;  5HXV A;  1W2O A;  2JDH A;  2D6K A;  4N7I A;  3S7E A;  4X8N A;  5FRA A;  3TEZ A;  4AI1 A;  4RSU A;  4XZP A;  5HPO A;  1CAX B;  3OUJ A;  4PQ9 A;  1F2N A;  4YM1 A;  2JE8 A;  4QXB A;  3AMH A;  4RHV 3;  5FZL A;  1RED A;  5C3S A;  3ZMN A;  1FAY A;  1J84 A;  4BQ1 A;  2W68 A;  2OYZ A;  3E5X A;  3MYX A;  4QPG A;  2PHD A;  4CRQ A;  5JI7 A;  4NMI A;  4UW3 A;  1UAI A;  4M3C F;  2VZ3 A;  3D5O A;  4FPY A;  2XQX A;  1HXS 2;  4PDW B;  4M3C E;  1UX7 A;  3DN7 A;  2VXJ A;  3QD6 A;  1US3 A;  4GWJ A;  4Q4V 1;  4RHV 1;  1CPN A;  4YW7 A;  1V6L A;  1W8F A;  3AZZ A;  4QM9 A;  1NT0 A;  1R09 2;  4DB5 A;  1OLM E;  2GN3 A;  4BQY A;  2VOV A;  4IES A;  4PIX A;  4CCL A;  2G9G A;  4NHK A;  4WM7 B;  5A3U A;  3D0S A;  4FPO B;  3AKS A;  2AZ5 A;  1E5R A;  2GH8 A;  1AR7 2;  1FNY A;  2WN2 A;  4XMA A;  5EIY B;  4YZ1 A;  1FAT A;  2NP0 A;  2OZ6 A;  4LPL A;  3WVJ A;  5CAZ A;  3IT8 A;  2YHJ A;  1KDM A;  1UY0 A;  2QBX A;  4DOU A;  5A80 A;  4ZU7 A;  4OZO A;  2D7F A;  4HOO A;  5FCC A;  4LHK A;  4LHL A;  4O9G A;  2W1W A;  4QB2 A;  2V4A A;  3JB8 A;  3AXE A;  4UYB A;  4YG3 A;  1W9F A;  1VBD 3;  3JD7 3;  5LBC A;  1DHK B;  3J8F 3;  3VZJ A;  2UY9 A;  4AQT A;  3WNO A;  3KF5 A;  1C8M 2;  1HB1 A;  2WWS A;  3KZ4 C;  3OOX A;  4Q27 A;  2YXS A;  4G3Y C;  4Q2F A;  1LHO A;  4FTS A;  3GZU C;  5EFU A;  4MZU A;  3RZH A;  1FOD 1;  1CIW A;  3I2I A;  4GH4 A;  1JN2 P;  1V6M A;  3GBW A;  4ONU A;  1N3O A;  4GAZ A;  4G4F A;  3V65 A;  2W92 A;  4FOQ A;  5A7S A;  1QDC A;  1AXY A;  3VKM A;  3GCW A;  4IEQ A;  3MPP G;  3VDD C;  2RS5 2;  1WLD A;  1AR9 1;  4F3J A;  1GP4 A;  2RHP A;  4IER A;  5EHD A;  4QT6 A;  1TME 1;  1WD3 A;  3WR0 A;  1B35 B;  2PXJ A;  2VMG A;  3GF6 A;  4I02 A;  5DAB A;  4NPR A;  3SEP A;  4Q1R A;  4S2H A;  3RPQ A;  1JOB A;  1H1M A;  1URX A;  2B5H A;  2BW8 A;  3JZV A;  2XJV A;  3T2P A;  3U07 A;  2D93 A;  1CX1 A;  1U5Z A;  2VNO A;  5JXI A;  4RA0 A;  5IVJ A;  5BNO B;  5IVF A;  1LB2 A;  2OQ7 A;  2XML A;  1QJY 3;  1H8T C;  3EJK A;  4E8C A;  2RDR A;  2DUQ A;  2JB4 A;  5D8A B;  1LES A;  3ZFE C;  5IW0 A;  1SCS A;  1Q8O A;  4HPK B;  2AAC A;  4XXA A;  2YFU A;  3LEK A;  3VN4 A;  5FBJ A;  3B00 A;  4FBF A;  4OHV A;  1JXN A;  4NAO A;  2WNU B;  4XHX A;  4PHZ A;  1QY4 A;  2VBD A;  3JUU A;  1SBF A;  4A3Z A;  5IVV A;  4OMC A;  2GDF A;  1S0B A;  4QKF A;  1CAW A;  2JIC A;  4YGE A;  1BBT 2;  4YZ3 A;  2ZGM A;  3KGL A;  4AOC A;  2PAM A;  1GZ9 A;  2BGO A;  3THP A;  1R64 A;  3JQX A;  1OXC A;  1X7N A;  2PAE A;  2R30 A;  4L2N A;  1DU3 D;  3UJO A;  3BUC A;  3AZW A;  1ZRC A;  5JR2 A;  1BLZ A;  1FV3 A;  1NQD A;  1W8T A;  4XUR A;  3ZSJ A;  2A6X A;  2ORX A;  2XJQ A;  4LLO A;  2JEN A;  5F3G A;  3AP9 A;  4QQL A;  2BU9 A;  5DZF A;  2WQZ C;  4QPW A;  4Q0U A;  5L9B A;  2ET1 A;  4ZZ8 A;  4K20 A;  4PJY A;  1UZV A;  4GIQ A;  5FZK A;  5FYZ A;  3AL5 A;  1MQT B;  1UZZ A;  3I8T A;  3MIE A;  4ZU5 A;  2WAB A;  2ZGQ A;  5AC9 2;  2VM9 A;  5LY1 A;  1HB4 A;  4CEW A;  2VW0 A;  2Y34 A;  4D3W A;  3S57 A;  2VMH A;  1COV 3;  2Q8E A;  2EAL A;  1FX5 A;  1XC6 A;  2VQ0 A;  4ORF A;  4GJY A;  4KBB A;  3B7M A;  5T54 A;  4F7Z A;  3OPW A;  2W1U A;  4XF3 A;  3MIG A;  3U11 A;  1DQ5 A;  2GC1 A;  4GB3 2;  4LBN A;  4AYU A;  4Z92 B;  1UKR A;  2RS1 1;  3O1O A;  1IS3 A;  3AMQ A;  4RQP C;  1RUJ 3;  1UW8 A;  1ND2 A;  3BU7 A;  1K42 A;  2W91 A;  2GND A;  4R4X A;  3VBS B;  1NKG A;  3N4M A;  2Q8C A;  3L2Y A;  3ILN A;  5C71 A;  3C8X A;  5FXV A;  1RC6 A;  3MLK A;  2D3P A;  1C3H A;  4V1P A;  4YAR A;  5JOW A;  1W6N A;  1WCU A;  3Q8C A;  4FQ4 A;  5FK7 A;  1NE6 A;  4QQH A;  2XKO A;  5A3W A;  5GZE A;  1PGW 1;  5T5J A;  1GWL A;  1F5F A;  1LCL A;  4JGZ B;  2X10 A;  1XSQ A;  5GLW A;  5JIU A;  1AYN 3;  4AWD A;  2Y26 A;  2VL4 A;  1AJO A;  3E97 A;  2GC0 A;  3JQW A;  5FP4 A;  5J1X A;  3J8F 2;  4BB3 A;  4YGC A;  2CGP A;  5GJ6 A;  4EZ4 A;  4CDX B;  4IE0 A;  4QMA A;  4OHW A;  1OLM A;  1RUE 1;  4COW A;  4UFI A;  1U0A A;  1OF3 A;  1ZBE 1;  2ZTN A;  3NQH A;  1W99 A;  3DL3 A;  4Z82 A;  2Q8O A;  5CA6 A;  5A3T A;  5JZG A;  1JZ7 A;  5E6H A;  2RR1 3;  2YGM A;  4WBB A;  5H9R A;  3WY6 A;  4HK8 A;  3RGB A;  5FQ0 B;  4XVH A;  3VZM A;  1PHM A;  1YQ6 A;  4Q4X 2;  4YZ4 A;  2Z5W A;  4LA2 A;  3AFK A;  4QKD A;  3BOP A;  3O0V A;  5JZG B;  2IVJ A;  2VJX A;  3I3D A;  4LKS A;  4YG0 A;  4KG0 A;  4CU6 A;  2GAU A;  4BMB A;  2VH9 A;  1JYI A;  2QFE A;  3VKN A;  2P37 A;  2ZEW A;  2ZJC A;  3OGV A;  4I09 A;  4FT8 A;  4XF1 A;  4GB3 3;  2VZO A;  3GZA A;  4K40 A;  4OCT A;  4KMQ A;  3ES1 A;  1UXZ A;  3CLP A;  5GKA C;  2D6P A;  5C7G A;  2CHH A;  5ABJ B;  2YDE A;  3HQU A;  4H7M A;  2BEO A;  4Q1P A;  3AP4 A;  3W58 A;  1XNT A;  2EXJ A;  5EQU A;  4IV1 C;  5CKQ A;  1Z78 A;  2GNB A;  1EP0 A;  1JHJ A;  1HRV 3;  3WDT A;  2UWB A;  4Y22 B;  3W59 A;  5EJZ B;  2WZR 2;  5ABJ A;  1BVV A;  1JI6 A;  1KIT A;  1YC6 1;  2YZ4 A;  4XUQ A;  4ES9 A;  4FSJ A;  2PLV 3;  1F15 A;  2BTV C;  4CUA A;  2VE1 A;  4JGY C;  1UNB A;  1AYN 2;  1ZRR A;  1F5J A;  2P2K A;  2RDN A;  4DRR A;  5FPV A;  4N9H A;  5LBE A;  3RRD A;  5L73 A;  1ASJ 3;  1LU2 A;  2ZAB A;  3CJI C;  3ZM8 A;  5JPM B;  1JUI A;  5FZD A;  5KR7 A;  5LA9 A;  5KHG A;  1YXW A;  4C91 A;  5I93 A;  4KU7 A;  2BOJ A;  3BGA A;  4IEX A;  2WLP A;  1MQT A;  4XFI A;  1WMD A;  2Q1M A;  2WL1 A;  5FPX A;  3KV9 A;  2WRA A;  5SV5 A;  2V4V A;  5K8S A;  2FMY A;  2WYF A;  2XON A;  4JDO A;  4OI2 A;  3GHM A;  1POV 0;  3T3Y A;  3NNJ A;  2KXL A;  5ANN A;  4L92 A;  3NNG A;  4YW5 A;  3SQO A;  5C8C C;  5D8A C;  3PUR A;  3EB7 A;  4I3G A;  1NZC A;  3ZN4 A;  4JC1 A;  5FZF A;  3V64 A;  5AFE A;  1Q8S A;  1YQ8 A;  4V2V A;  2BYV E;  2D6L X;  4BA6 A;  3A23 A;  3PDQ A;  4W6X A;  3S7I A;  1JYW A;  5F2W A;  3ACI A;  1A3K A;  1SG3 A;  4JHZ A;  4MET A;  1JZ2 A;  4HKL A;  1LUL A;  2WNU A;  4LO8 A;  1Y7B A;  2R16 A;  4GA9 A;  3W9A A;  1V9U 1;  2V5Y A;  3ITQ A;  2CDP A;  1OD3 A;  1RMU 3;  4I01 A;  1WME A;  1HB2 A;  5LY2 A;  4QPI B;  3EHK A;  1VP6 A;  4WVM A;  5FMO L;  2H6B A;  2TUN A;  2JKB A;  2E7T A;  3NV1 A;  1QOS A;  2WDB A;  3O0W A;  1VE0 A;  3H8X A;  3AB0 A;  3FUQ A;  2PLV 2;  1PZ8 A;  4IEO A;  3GM8 A;  2B45 X;  3DEM A;  2DUR A;  3AYA A;  2B39 A;  2VZV A;  2Z69 A;  1KDK A;  5F6K A;  3NV3 A;  1CZS A;  3LWC A;  2QQN A;  5F5Q A;  4JX0 A;  3U4X A;  3GBF A;  4GMP 3;  2XR4 A;  2P3K A;  4QHZ A;  1A6C A;  5FXX A;  1GZC A;  1UOG A;  1ENX A;  1EYB A;  2VZ1 A;  3LB9 A;  2VOT A;  1SFY A;  5DN2 A;  5JXH A;  2VOW A;  2RR1 1;  1NY7 1;  1U5X A;  2A5Z A;  2P1B A;  1HN0 A;  3THC A;  3UYJ A;  1E5I A;  4AFB A;  3P5B A;  4CDU A;  1QJE A;  3QAC A;  1PIV 1;  2ZX3 A;  1H30 A;  1C8M 1;  4PBO A;  2ZX2 A;  4E2S A;  4XFG A;  3CEW A;  3KF3 A;  4QXK A;  1J58 A;  1RUN A;  3FFQ A;  1YHF A;  5FZH A;  4Y22 A;  3IDB B;  2QQW A;  2RM2 1;  4GJZ A;  4C0B A;  4PDW C;  5FMD A;  5IVC A;  4CP9 A;  3M8L A;  1J3Q A;  2NPI A;  3MIH A;  3VBR C;  3WDU A;  4IEV A;  2G19 A;  2QQU A;  1LOE A;  4Y33 A;  3WG3 A;  5FQ0 A;  4OHX A;  5KC6 A;  1PO2 1;  1ENQ A;  4A45 A;  1BMV 1;  1RJ7 A;  2A6Y A;  2HWF 1;  4J25 A;  1OOP A;  4XBQ A;  2ZOE B;  4HKW A;  4DZG A;  3J26 N;  1XPW A;  4RS5 A;  2VCC A;  3PVB B;  5FPA A;  2IXH A;  4NOT A;  4RFT 0;  5A6Q A;  2E31 A;  2V09 A;  1Y43 B;  1CZT A;  1UF2 C;  2XUM A;  3AC0 A;  1UY2 A;  2EAA A;  3ENR A;  5IHR A;  3ZFE A;  1W0N A;  5IK4 A;  2CDO A;  4E2G A;  3VHP A;  4BIF A;  1RUF 2;  3BB6 A;  3ON7 A;  1JTZ X;  3ZSM A;  1KGY A;  2G9Z A;  3OY8 B;  3AZX A;  4B4P A;  4P5Y A;  1R1Z A;  4B4Q A;  3WDV A;  2R7E B;  2XWJ B;  1XB9 A;  1ND3 A;  5EYX A;  5JOZ A;  1A8M A;  1NUK A;  4MO3 M;  4A7K A;  3JBG 2;  1CGP A;  3N9L A;  1UCX A;  4HMZ A;  4B3N A;  1D2Q A;  2P4E A;  3VD5 A;  4AVC A;  4ZS3 A;  5GM0 A;  1H4H A;  2ZEY A;  1AHS A;  1VBB 1;  5FYS A;  1RVF 1;  3RQ0 A;  3LA2 A;  3I2O A;  1RYY A;  1JS9 A;  5A7W A;  3RZK A;  4FPJ A;  1O7F A;  5JUV A;  1AYM 1;  1V6I A;  2IVI B;  2QZ2 A;  3B02 A;  2R0F A;  2ZML A;  3OGJ A;  4LOS A;  2GSY A;  2K2S A;  2MNG A;  5CU1 A;  4XTM A;  4ZXE A;  4GWN A;  1BQP A;  5DG1 A;  3P3N A;  2CTV A;  4LE3 A;  2R04 1;  2HWB 1;  3RZM A;  1V70 A;  4D6Q A;  1RUO A;  2P6C A;  2W87 A;  4JKM A;  5FPL A;  1LOF C;  3N7K A;  2DU1 A;  4YW4 A;  1MEC 2;  5JOY A;  2WNO A;  2O8O A;  2JDA A;  3I7D A;  1SFP A;  4CDQ B;  3VUO A;  3BIE A;  2MHF A;  1HKD A;  2RE9 A;  4Y1V A;  1HLC A;  2PHT A;  5IVB A;  4HFS A;  2R04 3;  2ZGN A;  3ZFG B;  1ZA7 A;  5C4W C;  4L9B A;  4K6B A;  2OII A;  1CN1 A;  5FWE A;  1VBA 2;  2ZXQ A;  1K5M A;  4WZF A;  3RZJ A;  4JQR A;  3MPB A;  2C0Z A;  1NOV A;  3ZXA C;  1U5Y A;  3MID A;  3S5Q A;  5CFC C;  2VUC A;  1RHI 3;  2YB7 A;  3WF2 A;  1D4M 2;  3DYM A;  5BNN A;  3O14 A;  1EV1 2;  2HWD 1;  4I0B A;  4QKB A;  1GNH A;  1Q5O A;  3C3V A;  3S0M A;  2W08 A;  3TEX A;  2J22 A;  1ZVF A;  2RJK A;  1C5H A;  5LBF A;  2RMU 2;  3T0B A;  1DYP A;  3A22 A;  5F3I A;  5KHH A;  4UW4 A;  3KB5 A;  1DZQ A;  2Q30 A;  5T5O A;  2Y6H A;  5FJH A;  1F8V A;  2BNM A;  1GP6 A;  5FR3 A;  4D94 A;  1R09 1;  2P3J A;  3DF0 A;  1PMI A;  3IMM A;  5FLI A;  3SHR A;  2YC4 A;  3UKT A;  1G9C A;  1Q8Q A;  2VCM A;  4XCA A;  3VZN A;  4UFL A;  1POV 3;  2E6V A;  2UWC A;  2WA3 A;  5DAV A;  3WF3 A;  3H1M A;  4D6R A;  5BNO C;  4CCC A;  1Z7S 1;  1GOH A;  3ROU A;  5FP9 A;  1QJU 1;  1X82 A;  1SAC A;  1R09 3;  4CEY C;  3HT1 A;  2JG9 B;  2JJ6 A;  3ZFF A;  1AUY A;  1IOA A;  1AR8 3;  1OA2 A;  1TMF 3;  1ONA A;  2RDS A;  1Z7S 2;  3AX4 A;  1IZ3 A;  4J1W A;  1A78 A;  1VMJ A;  5FOB B;  3LIG A;  3OTF A;  3VD7 A;  1OI6 A;  5LAS A;  4XIL A;  2WNE A;  3N7J A;  2Q0A A;  1W2N A;  5C3O A;  2RV9 A;  2ADE A;  3B9C A;  5FP8 A;  3BOW A;  4AGR A;  3BPZ A;  5BNN B;  4LA3 A;  5FFO C;  5L9V A;  1XOY A;  3DGT A;  3JD7 2;  1ENR A;  4FOY A;  2JG9 C;  1ZRE A;  2W46 A;  1TG7 A;  2XVK A;  3SH5 A;  5AVA A;  1AXK A;  5DQ0 A;  3EBR A;  2YV8 A;  4L11 A;  4RS5 C;  3HN3 A;  3H3Z A;  3LFM A;  3U10 A;  3LSE A;  5F1R A;  1ZBA 1;  3I59 B;  2WWJ A;  5J37 A;  1QJZ A;  1O6U A;  5E1R A;  3ZN5 A;  1MS8 A;  3D3A A;  1D4V B;  1HV0 A;  1G9B A;  1ZYB A;  1CPM A;  4FAG A;  2B8M A;  5A1L A;  4M3C A;  4UFJ A;  4V2W A;  3LFI A;  3C7O A;  4GMP 0;  1W3V A;  3J7N A;  2C6S A;  1P8J A;  4AVT A;  4Q4Y 3;  2WZ8 A;  4WVZ A;  1S2K A;  1EY2 A;  3LDB A;  2TBV A;  1KQR A;  2DWR A;  3AK0 A;  3U0Z A;  4GKX A;  1EAH 1;  2GAL A;  4D6S A;  1QH7 A;  5CVR A;  1W6O A;  5DZG A;  4LKD A;  1RIR A;  2WWU A;  2RMU 1;  3HPN A;  1VBB 3;  3GXU A;  3C7G A;  5EPA A;  3WOG A;  1YI9 A;  3T1M A;  2OUH A;  4EN9 B;  3J4U H;  5F37 A;  1VAV A;  4OUS A;  4N43 C;  2D3S A;  5F3C A;  3B9I A;  3O1P A;  1HQW A;  4W6Y A;  3POW A;  3OG2 A;  4ERO A;  1FPN 2;  2BRT A;  1AYM 3;  4LHN A;  1BBT 1;  1G86 A;  5GAL A;  5A1A A;  1ZRI A;  2VAU A;  3SEE A;  2D6O X;  1AL2 1;  4EWE A;  5CZK A;  3ME2 A;  5BNQ A;  1PZ7 A;  3NL1 A;  3L9J T;  4PLN A;  5I8S A;  3OY8 A;  4M00 A;  2JIG A;  1C4R A;  1BBT 3;  3B93 A;  1PNF A;  1IPK A;  4IV3 C;  4QHB A;  4ARX A;  3POY A;  2ET7 A;  3J7H A;  2WNV C;  4YW6 A;  3UGG A;  5E8A A;  3NVC A;  3NV4 A;  1OC1 A;  2ZGK A;  3J8F 1;  4CCK A;  3KQR A;  4KWJ A;  4PCR A;  5ANQ A;  3UT0 A;  4LEJ A;  1LNS A;  4P9X A;  4N53 A;  3VBR B;  1BXH A;  4EJR A;  4LMF A;  1OF4 A;  5KXD A;  3CJI B;  4P9W A;  1X8M A;  3APB A;  3IPV B;  4XFA A;  2D97 A;  2FCV A;  1SHW B;  3AYD A;  4QQ2 A;  1D0G A;  5LB6 A;  2Y60 A;  4M3C B;  3I49 A;  4EWA A;  4AI3 A;  4DUV A;  1DCS A;  4HVQ A;  4K3U A;  1JH5 A;  1UXX X;  2LAL A;  1V6J A;  3OD0 A;  2FDJ A;  5HCA A;  1YO8 A;  2JEC A;  4K9S A;  2EXH A;  2AYH A;  3KCX A;  3ZR6 A;  2PHR A;  3GGL A;  3JBG 3;  4XAC A;  2YU1 A;  3I54 A;  3AMM A;  2QQL A;  1MZ6 A;  5I0T A;  1PNG A;  5BYN A;  2ZHL A;  5I0S A;  3UJQ A;  2LS6 A;  4FP2 A;  1BEV 3;  1PO1 2;  1YRZ A;  2I2S A;  1VAL A;  2RJ2 A;  3FC0 A;  3WP3 A;  1O4Z A;  1W6M B;  2XB6 C;  4JDN A;  1WKY A;  3BAL A;  5FUP A;  1NLQ A;  4QU2 A;  1W03 A;  4Q4V 2;  3USU A;  4YM2 A;  4NR1 A;  1LOB A;  4MHU A;  1K5M C;  3R4S A;  4JRL A;  4D7T A;  4Q4W 2;  1Z7S 3;  1RIT A;  4WM8 A;  1FPN 3;  1NQJ A;  5IFP A;  2VMI A;  4YW3 A;  4OMD A;  5EZW A;  3UK9 A;  4LE4 A;  3ZIX A;  3VBU A;  4YVW A;  1I3H A;  3HAG A;  1ENS A;  2RDQ A;  2A3W A;  3IDA A;  4IEP A;  1Q56 A;  5FKC A;  4AG4 A;  3PMS A;  3T1L A;  5JMC A;  1I9R A;  3N36 A;  2JE7 A;  3IDE A;  3O0X A;  5FZE A;  4XQ4 A;  3UGH A;  2X5I C;  4UF0 B;  1VBA 3;  1K3I A;  3USS A;  1N1Y A;  1J3R A;  1AL2 2;  3KGZ A;  2RS1 3;  3LPG A;  2ES3 A;  5DUX A;  4EQV A;  1CJD A;  2PHU A;  2VQU A;  4XW3 A;  5FZO A;  4CPB A;  3LIH A;  5BY5 A;  3VBH B;  3RWK X;  3UKV A;  4CP0 A;  2XPJ A;  3LEM A;  4HSJ A;  5A70 A;  3M3Q A;  4MXV A;  3KV4 A;  4XJZ A;  1VBA 1;  5CEH A;  1X50 A;  1W6N B;  4YG6 A;  4CCJ A;  4N53 B;  5C70 A;  5C3Q A;  4Q5O A;  3LAG A;  4Q4Y 2;  3DPR B;  2DCJ A;  1CX4 A;  3AYC A;  3BVC A;  4LO6 B;  1LEC A;  3RI9 A;  1N1S A;  1O3S A;  4OUL A;  5A7P A;  3L2H A;  1OD5 A;  3O5S A;  2IXK A;  3N35 A;  1SQ4 A;  4PT6 A;  2VNR A;  3LCP A;  5A33 A;  5C4W B;  1ZA4 A;  2Y6L A;  2J1T A;  3FN9 A;  1OKQ A;  2VD7 A;  1FMD 1;  1HV1 A;  2E7A A;  4AI2 A;  3AJZ A;  4KWU A;  4YW2 A;  2OQ6 A;  5FWJ A;  5IT6 A;  2DCT A;  2A3X A;  1QHD A;  1LOA A;  1WCQ A;  2K46 A;  2WAO A;  4AQ6 A;  2ETE A;  3KWV A;  1S0J A;  1SLT A;  1TNR A;  2ZZJ A;  3PVO A;  2BVV A;  4XBL A;  3AJY A;  2OS2 A;  3ZYR A;  1VRB A;  1JZ3 A;  5FKB A;  3RNS A;  1YFU A;  1AR8 2;  3ETP A;  1S0G A;  4QB6 A;  2WZR 3;  2RS3 2;  2E63 A;  5FZ1 A;  4I3P A;  3X29 B;  4AR2 A;  4CU8 A;  4K21 A;  4FPE A;  3BCW A;  3H1Y A;  4MOA A;  3JD7 1;  5JCT A;  1JHN A;  2VME A;  3QBQ A;  1H2M A;  5A7W B;  4NII A;  1SDD B;  2HH9 A;  3MLL A;  3MW3 A;  1UYP A;  1OPM A;  3ZYB A;  3WNK A;  1MS9 A;  1QEX A;  4UAP A;  4KI5 M;  4XJW A;  1VBD 2;  4CE8 A;  1IHM A;  5IWF A;  3ZX7 A;  1MS5 A;  4DNY A;  4QU1 A;  5I91 A;  1F4A A;  3GHN A;  4OI1 A;  4IW3 A;  5SV8 A;  1KEX A;  1W3X A;  3IKW A;  1RUG 1;  3PIJ A;  1BVP 1;  4AI0 A;  3H7Y A;  3NW4 A;  3IIA A;  2RG4 A;  5FJK A;  2ZGS A;  2R06 2;  3NAP B;  4Y24 A;  3HNB M;  4CUG A;  2HWF 3;  1WA6 X;  3IZO A;  2WQ8 A;  2JXA A;  4FFF A;  1A34 A;  1HRV 1;  4HPK A;  1JZ6 A;  5FDB A;  5HCB A;  5G05 L;  2FDF A;  4AK3 A;  5JLV A;  4CP2 A;  1LHU A;  2NYY A;  3AFG A;  2R0H A;  3OUH A;  4MXW A;  1N1V A;  1DLC A;  3ZFE B;  3PJQ A;  4ES8 A;  5J96 B;  3SXW A;  3N9M A;  4CDW B;  3IN9 A;  3SKV A;  2FZ2 A;  2VOX A;  3MHZ A;  3ZXK A;  2HEY F;  2VQT A;  1GOF A;  1OBN A;  1L3J A;  4HN0 A;  5FZM A;  2B42 B;  3WQ7 A;  5CFC A;  3PU3 A;  1R1A 2;  4D0Q A;  4HZF A;  1VMF A;  2BUK A;  4Z1V A;  4XUO A;  5FAX A;  2D43 A;  2C9K A;  2R1D A;  2WLQ A;  4UI9 L;  3A0K A;  2SBA A;  4YGD A;  4CCM A;  3KMH A;  4GQ7 A;  5JSO A;  5KWR A;  4YFW A;  4BQW A;  4MUV A;  3TNP B;  3AP6 A;  2QQV A;  2JDK A;  1UYZ A;  2Z42 A;  4GH4 B;  4Y3O A;  5L19 A;  4CXY A;  3MZH A;  2EVX A;  2HWE 3;  2Q1Z B;  3VBS C;  4FPG A;  1O4Y A;  3WW4 A;  2OZJ A;  2JG8 A;  2KM2 A;  1OVP A;  3I2J A;  4DIQ A;  3ZPO A;  3LKJ A;  1QJU 2;  1ZZ6 A;  4A6S A;  3S30 A;  4TSV A;  4LUK A;  4FVV A;  4RR3 B;  4YPJ A;  1QF3 A;  3NKG A;  1ULO A;  5FYT A;  2BFU L;  4YVW B;  4BQ3 A;  2YPD A;  4D7S A;  1O8P A;  2ZS6 B;  3AXD A;  3OBZ A;  2RS5 1;  4K8F A;  3KCY A;  1DGW X;  4GZ9 A;  3E5Q A;  5AC9 3;  5C8C B;  1ZX5 A;  5FP7 A;  3WF4 A;  1PGW 2;  1VAM A;  4IEU A;  1RUI 1;  1UZY A;  3HR9 A;  1PGL 2;  4JHT A;  3BYW A;  4TXW A;  4CDQ C;  1DZR A;  5DAW A;  2R07 1;  3WP4 A;  2ZBJ A;  3DYP A;  1RUJ 1;  5GZD A;  3AL6 A;  3RSJ A;  1YQC A;  5AC9 1;  3WUC A;  2YGL A;  5FY4 A;  3ZYF A;  1GQP A;  2VTF A;  2XLG A;  2WS9 2;  4LBM A;  4QPG B;  1TVG A;  5BV6 A;  4XJ8 A;  5HBA A;  1AX1 A;  4PI2 A;  4ZHN A;  1WW7 A;  4AFD A;  2XUE A;  1GLH A;  2DUP A;  1IQD C;  4S2F A;  3VDB A;  3GBG A;  4BPZ A;  1R1A 3;  3ZXD A;  4DMI A;  1OUX A;  3OEB A;  1FV2 A;  1W2T A;  2Q1F A;  4ZXK A;  3T2O A;  5IVE A;  2FDG A;  4Q4W 3;  2LRO A;  1IGO A;  1UZ0 A;  1NLR A;  2GMM A;  4XIO A;  5D2A A;  5J7M A;  5IVY A;  4BZ4 A;  5TSW A;  2JG8 B;  4IE7 A;  1J83 A;  4QKN A;  4PIZ A;  3WG2 A;  3I3Q A;  5DDJ 2;  5IK5 A;  2QQI A;  3WHU A;  2TNF A;  2WT2 A;  3IWZ A;  4Q26 A;  4QXH A;  1OFS A;  3ZIW A;  3ZO0 B;  5C5T A;  3FMG A;  4COZ A;  4NUB A;  4CU9 A;  3VHO A;  1IG3 A;  2GH2 A;  3O1U A;  2PAK A;  3ZYP A;  1QJU 3;  3H8R A;  3NAP A;  3WF1 A;  3MV0 1;  3SIS A;  3C7F A;  1O3R A;  2IUW A;  1W90 A;  3HNY M;  1PO2 3;  2XVL A;  2W9X A;  1H4G A;  2R06 3;  5JIA A;  1XND A;  3MF9 A;  2HWF 2;  5FYB A;  4Q4X 3;  1H6Y A;  1COV 2;  4DY5 A;  1W6P A;  1RUG 3;  3FLT A;  2XWB B;  1QH6 A;  1QJX 1;  3PNA A;  1ZNP A;  2GP5 A;  4E2Q A;  4FFG A;  4KG8 A;  4MYE A;  4BIS A;  4XUT A;  4A42 A;  2VOK A;  5FXW A;  2RVA A;  3GNE A;  1YWK A;  4LHS A;  5GLV A;  5CFD A;  1I5P A;  1TME 2;  1GSL A;  2EAK A;  2Y6J A;  3TBD A;  3WUD A;  4A3X A;  3RZZ A;  2ATF A;  4Q29 A;  1HW5 A;  5K4L A;  1XNC A;  4UFK A;  2JDP A;  4OI4 A;  3C7H A;  1NXM A;  2NQY A;  3I97 A;  4RN5 A;  5H9P A;  5EJ3 A;  3WDX A;  4DY3 A;  4DQA A;  1PMJ X;  1I5Z A;  2AR6 A;  3FJS A;  2XJP A;  4CCN A;  4QX8 A;  1SPP A;  3HOB A;  3MIB A;  3LQC A;  3OBT A;  1MZE A;  4YLZ A;  5I0U A;  2VW1 A;  5IFT A;  1ND2 B;  1HRV 2;  2JDY A;  4O7X A;  4O9E A;  1XBF A;  1S1A A;  4OUE A;  3BIW E;  1B09 A;  3GCX A;  5K0U C;  2WBK A;  2HWC 1;  3BKZ A;  2X09 A;  3WW2 A;  1J1L A;  4HVO A;  5LCW L;  4UWD A;  4XDQ A;  5A33 B;  1UYX A;  4P9G A;  2JWP A;  5EJ1 B;  5FZ9 A;  3TB0 A;  4TLF A;  5T5P A;  2XVG A;  2UY8 A;  2C26 A;  1OA4 A;  4Q0P A;  4XUP A;  2VW2 A;  4RR3 C;  1UO9 A;  1EPW A;  2HKX A;  4XOG A;  4AVB A;  1K12 A;  1POQ A;  2ZA9 A;  5J48 A;  5FYV A;  4BIO A;  1RUH 1;  2ZKN A;  4HBN A;  4JDM A;  2W39 A;  4UW6 A;  3WQ0 A;  3MUY 1;  5ACA 1;  3IBM A;  5CG8 A;  1WA4 A;  3N9Q A;  4NHX A;  3WP6 A;  5K9Y A;  2PHL A;  1DF0 A;  1XQN A;  2JG8 C;  4FI9 A;  1H9P A;  3WQB A;  5A7Q A;  5DPN A;  2Z2S B;  4AFM A;  3I2D A;  3WP5 A;  3PHM A;  4HT1 T;  4PDW A;  2D40 A;  2G9F A;  1X9P A;  3I2F A;  3N9O A;  2GZW A;  3N9P A;  4XE9 A;  4XQW A;  3PL0 A;  4GKY A;  1RHI 1;  5FZ8 A;  2D5F A;  2AC1 A;  1K5J A;  2QKD A;  2RJL A;  4LK7 A;  4W50 A;  1NLS A;  4W8J A;  5FZG A;  5C9A C;  3BU0 A;  2R07 3;  4P5H A;  4YGB A;  1HRI 1;  1C28 A;  3HBZ A;  4CDU C;  1LGC A;  2E51 A;  3GZT B;  4KH9 A;  4CYD A;  2CV6 A;  3FWE A;  1HXS 1;  2ARC A;  5HI0 A;  1TEI A;  3AZV A;  1ODM A;  2BNO A;  4LBQ D;  4XF4 A;  5F5A A;  4AVS A;  1XJA A;  2PHF A;  2XBO 2;  3LGR A;  4UBH A;  4UFM A;  4WVV A;  2PTM A;  3OPZ A;  5A1F A;  3NJV A;  4OLL A;  4UXA A;  1WMF A;  5DZE A;  4AF9 A;  2ZHN A;  2GC2 A;  1JW6 A;  3E6C C;  2FZ1 A;  1IQA A;  1DQ0 A;  1CZV A;  1NCR B;  3PUH A;  1UX6 A;  2XXZ A;  3N7L A;  1YEW A;  3III A;  1BEV 1;  3K3N A;  4JVA A;  4YVW C;  5AVP A;  5B4X A;  4A7Y A;  1DYK A;  1HJG A;  1MR5 A;  4P00 B;  4XJA A;  1XE7 A;  3H42 B;  4FTE A;  3FBM A;  2CGO A;  4MX3 A;  3RZL A;  4NAM A;  4ASL A;  2Y64 A;  3H9A A;  1L7Q A;  2ORZ A;  2VZR A;  3ALQ A;  3ABZ A;  1U12 A;  2NN8 A;  3RVH A;  3WW1 A;  4E4S A;  1JYX A;  4X8P A;  1MS4 A;  3LE0 A;  4OHZ A;  4KL1 A;  5FY1 A;  3QH7 A;  3ACG A;  1FI2 A;  2DYC A;  4UBG A;  2HLE A;  3KV6 A;  5FPU A;  3G6J B;  2AGS A;  3LA7 A;  1PVC 3;  4F83 A;  1JYN A;  4J1X A;  1ND3 B;  1A8D A;  1QKQ A;  4A2U A;  1RVF 2;  4D7Y A;  3OEA A;  3NST A;  3I2H A;  4M0H A;  3VBF C;  2DVA A;  2A7A A;  1DGL A;  1W8O A;  1ND3 C;  2JE9 A;  4MGK E;  2Y6G A;  1SLC A;  2YUE A;  5FZ4 A;  1GKB A;  1W04 A;  2WR9 A;  3HMY A;  4MAD A;  4K1Z A;  3KLS A;  3SCF A;  2ARB A;  2CNA A;  4H14 A;  1VIW B;  4S2G A;  1I1E A;  1UIJ A;  3KVA A;  4MGY E;  3TN9 3;  4CSW A;  2EA7 A;  4MVT A;  4EE2 A;  2TEP A;  2QQP A;  3ZFF B;  3PUI A;  1UU5 A;  4DS0 A;  2DCZ A;  5BNP A;  1DGR A;  4IE4 A;  3POE A;  4IV3 A;  1WLW A;  2WNU C;  3T2Q A;  3EYP A;  2KR2 A;  3JB4 C;  1H8V A;  4PLM A;  1WW5 A;  4LKE A;  1HRI 2;  3HVD A;  4N53 C;  4QX7 A;  3VBO C;  1J1T A;  5FO7 B;  3HBK A;  3UET A;  2Q8D A;  2WQ4 A;  4QGM A;  1W8W A;  4P9Y A;  5FMO S;  4AQS A;  5F7U A;  4XJ9 A;  3OYW A;  3UNP A;  2LUW A;  5FO9 B;  5L36 A;  2A73 B;  1NE4 A;  1UQX A;  3KT1 A;  4XBN A;  3ZFG A;  4AHW A;  1YNA A;  2UYA A;  3VHR A;  4CDU B;  4CVU A;  4OHY A;  2Z79 A;  4QB1 A;  2Y0I A;  3HIF A;  3PUA A;  2O1Q A;  4IXL A;  3H50 A;  4PQQ A;  3V0B B;  3ZKY A;  3T30 A;  4LOT A;  5CFD C;  4COV A;  1ALY A;  2X5I B;  2HBT A;  2VZT A;  4KWK A;  4CCD A;  1NZI A;  1ULD A;  3ZSL A;  4Q4Y 1;  4JGZ C;  2Y0O A;  5KXB A;  3CBN A;  4BJ0 A;  2LTN A;  1OHF A;  1YLL A;  2WJS A;  3AP7 A;  1NY7 2;  3D82 A;  4FQZ A;  1AR6 2;  1EUU A;  2V5D A;  1W2U A;  3VD3 A;  2C9A A;  2P17 A;  4C90 A;  2YPJ A;  3PME A;  4Q8K A;  3FLP A;  1UWW A;  2BGP A;  4MHR A;  1YI7 A;  2OXB A;  4AVA A;  1W2A X;  4BXF A;  3ASI A;  4LBQ B;  4G9S B;  2OKX A;  1TME 3;  3QOP A;  4HON A;  2XL7 A;  3FLR A;  3C2U A;  4YM0 A;  1WCK A;  3K4Z A;  4WM8 C;  4AEM A;  1F35 A;  2ZAA A;  5F5I A;  4QX0 A;  3RDI A;  1H1A A;  1MEC 3;  1NA1 C;  1OPO A;  3SH4 A;  1KRI A;  2QQK A;  3U1X A;  3TNQ A;  1UU4 A;  4PI0 A;  5GZF A;  2CU5 A;  2PHW A;  1IPS A;  5F6L B;  1BHG A;  4IEW A;  4OFG A;  2JG9 A;  3RYR A;  4FTB A;  1OSG A;  2BV4 A;  4KGQ A;  5T3N A;  1RMU 2;  4XET A;  2ID4 A;  2PMW B;  2CWS A;  2Y8K A;  3UV9 A;  1XXN A;  2J1S A;  2WAA A;  4AHX A;  3KSC A;  1Q8P A;  3WLU A;  4WM7 C;  3ES4 A;  2QQM A;  2EIB A;  4IND A;  4MV2 A;  4EN0 A;  3WDY A;  1CAU A;  1W6Q B;  4Z2W A;  3VBH C;  2YBP A;  2R32 A;  5H9S A;  3E6B A;  4IEY A;  1GWK A;  1UOB A;  1QDO A;  3V0B A;  5DUV A;  5FO8 B;  2V73 A;  2A1X A;  2ZGO A;  4Y5S A;  4QM8 A;  1X33 A;  4I2O A;  3D4K A;  3SLI A;  3FFZ A;  1CR7 A;  2BWA A;  1N1T A;  1C57 A;  2PLV 1;  2YBS A;  5GLT A;  3RFR A;  2ZZQ A;  2QE3 A;  5LZ6 A;  5FMC A;  1ULG A;  1REE A;  3K51 A;  3WNP A;  4B7E A;  3IDC B;  4AW7 A;  1POV 1;  1PVX A;  2A6W A;  4OUM A;  2UYB A;  3NAP C;  1CD3 G;  2F6B A;  2GMP A;  1QOT A;  2A6Z A;  4O61 A;  1UOF A;  3H3U A;  4JQT A;  3I3B A;  3WG4 A;  2RS3 1;  3EQE A;  5BNP B;  2WYS A;  1QOO A;  1QXP A;  1ZZC A;  4F8A A;  3RYP A;  3IM0 A;  2FDH A;  1CAV A;  5A32 A;  1UL9 A;  3GAL A;  2XDV A;  3H1W A;  2PN5 A;  4MLO A;  1PK6 C;  2JDN A;  3T0D A;  4XAE A;  4QDR A;  1KS4 A;  1WCD J;  2J1A A;  5LRS A;  3K3O A;  1MS0 A;  2WUH A;  2R07 2;  2X05 A;  1JU4 A;  1HQL A;  4TZD A;  3W5N A;  4Q0Q A;  4Y1U A;  3WX5 A;  4Q0S A;  2XOM A;  1O5L A;  1QJX 2;  3MLJ A;  4N8M A;  4NO4 A;  1XYP A;  2CWM A;  1QXJ A;  2PHX A;  3N3H A;  4PIY A;  1WLC A;  3WIN E;  5C9A B;  2OVU A;  2C5D A;  5IJR A;  4K7J A;  4JRA A;  3J7M A;  2BGC A;  2VR4 A;  3K4A A;  1XNB A;  2IC1 A;  1FMD 3;  2OT7 A;  4R4Z A;  4UFH A;  1JYC A;  2WT1 A;  3H8O A;  1LHW A;  1S0C A;  4D8M A;  2XHN A;  1RMU 1;  4XF0 A;  3SC7 X;  4QPI C;  1C8N A;  1NX9 A;  3LA3 A;  4P9L A;  4QPG C;  4RGA A;  1N3P A;  4MGT A;  2WFF 1;  4RGG A;  4L99 A;  3N9N A;  1EAH 3;  5FUN A;  2VBP A;  2DU0 A;  4LBK A;  3PIG A;  3C7E A;  4SBV A;  1VAK A;  3KHC A;  5CFD B;  2W52 A;  3ATG A;  2DV9 A;  1H8T A;  1TNF A;  2JDM A;  3NV2 A;  5I8Y A;  5KHK A;  1JZ4 A;  5K7P A;  3V0A A;  2WZE A;  4K8R B;  2XQR A;  3THD A;  3CNA A;  1US2 A;  5GLZ A;  5HXM A;  1IS4 A;  2BNN A;  1ULF A;  3VKO A;  3ZLI A;  2BP6 A;  5LA0 A;  2CGN A;  4MGI E;  2WA4 A;  3OSD A;  3VBO B;  1JYV A;  2YU2 A;  3SCG A;  3LOI A;  2PEL A;  3U14 A;  4P02 B;  1KJL A;  2BVB A;  3CIH A;  3H8U A;  2EXI A;  2IWG B;  3PUQ A;  2X29 A;  1FOD 3;  2QDR A;  3O1R A;  1TE1 B;  5I0D A;  1UMH A;  1NCQ A;  1FYU A;  2Q5T A;  1BCX A;  3B3Q E;  3ZXJ A;  1Q8V A;  4FPC A;  5HV4 A;  1RUI 2;  2PQQ A;  3SKJ E;  4D69 A;  3KT7 A;  3M3E A;  1KFX L;  4LTA A;  4ASK A;  2DCK A;  4ZU4 A;  4GH4 C;  5D1I A;  1O91 A;  4FXG B;  2BER A;  5F2S A;  1QJX 3;  5A6X A;  3O1M A;  5IAX A;  5FY7 A;  4WVW A;  4YVS C;  1XNK A;  3NRU A;  3OD4 A;  4GUL A;  4LKF A;  4LUL A;  2RR1 2;  1RUF 1;  3AP5 A;  4J6G A;  3ZDV A;  4XJU A;  4P9I A;  1GFF 2;  1YJL A;  4CXX A;  1NYW A;  2FQP A;  4CUB A;  3O1S A;  2P34 A;  4BK4 A;  1LED A;  1AXZ A;  2YMZ A;  1OKO A;  2UU8 A;  2WFF 2;  4Y20 A;  1AZD A;  1RUD 2;  1OQE A;  4L8Q A;  2GME A;  3DCQ A;  1CES A;  2JIJ A;  3LZZ A;  5FPZ A;  3WCR A;  5BNN C;  1YQ2 A;  2WS9 1;  4YVS A;  1RXG A;  4CPB D;  3WEZ A;  3T08 A;  1GAN A;  3CQO A;  4IET A;  2ARA A;  5IAT A;  1BMV 2;  2VC9 A;  2QQJ A;  3ELN A;  2HYK A;  2AEZ A;  2E32 A;  3IPV A;  3MFC A;  4NPL A;  2JD4 A;  3ZFG C;  5C3R A;  4Y1Y A;  1CON A;  2VVD A;  1NG0 A;  4JCK A;  5CAD A;  1XNA A;  2ZPX A;  2CSG A;  3A21 A;  3T09 A;  2WS9 3;  1XRU A;  1AR7 1;  1M4W A;  1D4M 1;  3JU9 A;  2WO7 A;  4CA9 A;  4ZY9 A;  1QNW A;  1JZ8 A;  2JDZ A;  3DEC A;  4GD4 A;  5EP9 A;  3F2Z A;  5E89 A;  2CL2 A;  1TMF 2;  1JZ5 A;  2BQP A;  2JD9 A;  3A0N A;  5FMB A;  1X36 A;  5FOJ B;  5CG9 A;  1RUH 3;  3BTZ A;  1HJF A;  1GQG A;  1YCI A;  1YQ5 A;  4OVE A;  3R4U A;  1XYO A;  5ACA 3;  1E5H A;  1H0B A;  4H55 A;  4JZR A;  1O4T A;  3CF6 E;  1RUI 3;  1CVN A;  4H2A A;  1R08 3;  5CYY A;  3VKL A;  3FBY A;  2Q4S A;  3I3M A;  4OYU A;  1DLL A;  2YRO A;  3T4V A;  2ZKL A;  3PJY A;  4XAA A;  1FMD 2;  3B69 A;  5LA2 A;  2VVE A;  4ATF A;  1UY4 A;  4XQD A;  3ZXG A;  2R1B A;  2E53 A;  1SLA A;  1OOP B;  3WF0 A;  2DBI A;  5JWP A;  3VZK A;  1PO2 2;  3BN6 A;  1W9T A;  5DXD A;  1T6G C;  2RS5 3;  4M4R A;  5H9Q A;  4DEV A;  5AFB A;  2ZEZ A;  4AED A;  5CBL A;  2IXJ A;  2C24 A;  2JEM A;  1SBD A;  5D8A A;  1SZB A;  2DCY A;  1RGS A;  4XEZ A;  3RJR A;  1F4H A;  1V00 A;  5DAX A;  4U36 A;  1KD7 A;  3I59 A;  2WZP P;  2SLI A;  1CAU B;  5FP3 A;  2KA3 A;  3V0A B;  1QIQ A;  1DG6 A;  3ILR A;  1D0H A;  5C3P A;  2PYT A;  1SLI A;  1S0F A;  4CUC A;  1Q43 A;  4LQR A;  4QWN A;  3PTR B;  1UZW A;  3U4S A;  5FZC A;  5C8C A;  3ST7 A;  3LSD A;  3I2G A;  4FFH A;  4AGG A;  4XZU G;  3HT2 A;  1MVE A;  1SFN A;  2IXI A;  4NN0 A;  3ZSE A;  4AEK A;  3POI A;  1JYT A;  4LIT A;  1PIV 3;  3OGG A;  4UT5 A;  2ZAC A;  1ZRD A;  4IE5 A;  4JV4 A;  2VZP A;  3LDR A;  1G7Y A;  4Z07 A;  3VBS A;  2WN3 A;  4KNC A;  1T2X A;  4NHL A;  5DMY A;  5I0R A;  2WSV A;  2WC2 A;  4B8E A;  2JB8 A;  5IK7 A;  5F8P A;  5FYU A;  1PVC 1;  4FAH A;  5FZI A;  1Q3E A;  3CJI A;  4EYU A;  3AZY A;  2V72 A;  3E1F 1;  1IS6 A;  1E5S A;  2WII B;  4R9D A;  4U2A A;  4XMI A;  3FHA A;  5C9A A;  5LWB A;  3GJB A;  4CCO A;  4NIG A;  3T2T A;  4WVM B;  4IV1 A;  1OVS A;  4W65 A;  3VBU C;  1UMZ A;  3O12 A;  1ULP A;  4RFR B;  4ZPI A;  4BLJ A;  3BI3 A;  2YFZ A;  2VGD A;  3B5L B;  1S0D A;  4ASM B;  2GNT A;  2W2I A;  1W8U A;  5T5L A;  3VZO A;  1MZF A;  2VUA A;  1NCR C;  3VL9 A;  5EWS A;  3MI8 A;  4QDS A;  4AE2 A;  4LT5 A;  4GB3 1;  3KM5 A;  2VCA A;  3TWI A;  1XYN A;  1OLQ A;  1GQH A;  1TQ5 A;  4XDO A;  2VEC A;  3VBH A;  4LIU A;  4BOW A;  4YW1 A;  4AI8 A;  3TN9 1;  3P3P A;  3MIF A;  4XTP A;  4XAB A;  5FZO B;  1NAE A;  1WCS A;  2FBE A;  2VCB A;  3DYO A;  2I74 A;  1S4C A;  4IGQ A;  1PK6 A;  4MGQ A;  3K4D A;  2A75 A;  2FCU A;  4FP3 A;  5JSR A;  3RG0 A;  4QX5 A;  4XFC A;  5IUQ A;  1CAW B;  2GC3 A;  4Y4R A;  3SH3 A;  2W5F A;  1IKQ A;  1GWM A;  4DFS A;  4TYS A;  2R49 A;  1NCQ B;  2O8Q A;  3F95 A;  2CAU A;  5B4N A;  2QCS B;  2DVD A;  4Q4V 3;  5A6Y A;  5FRE A;  5L7O C;  1D2S A;  2PQS A;  5CKN A;  3CMG A;  1RUC 1;  2F17 A;  5CFC B;  3NNL A;  4ZZ5 A;  1AR7 3;  2IFR A;  4NHM A;  3WW3 A;  2BJS A;  3NNM A;  3VDD B;  5F32 A;  1LHN A;  3KVB A;  5A3N A;  1RUH 2;  5GLU A;  2ZGP A;  3FHQ A;  3HQR A;  3SMH A;  2VTX J;  4CDX A;  4QQO A;  2XL9 A;  4NJ4 A;  1QMJ A;  4B7K A;  1S2E A;  3LEI A;  5LK5 A;  1R08 2;  3DV8 A;  3FHI B;  3QLQ A;  1PO1 1;  1GU3 A;  4FPH A;  1H1I A;  1DYO A;  4NE9 A;  1V6N A;  2VUL A;  4CCE A;  1E57 A;  3LDK A;  5FZA A;  4EWD A;  1L7L A;  2W47 A;  1VBC 1;  1LJ7 A;  4XHB A;  1AL2 3;  3QCW A;  5JVV A;  4Q0V A;  3DPR C;  4Z2A A;  3IB3 A;  4L0P A;  5LAT A;  3FL7 A;  1WGP A;  1W28 A;  2NLR A;  5FZ6 A;  4URA A;  2QZ3 A;  1VBC 2;  2ZHM A;  1MAC A;  3NMB A;  2J1E A;  4NVP A;  3I2K A;  1NA1 A;  4LO5 B;  5F5C A;  4B1M A;  3LOB A;  1ND2 C;  4IDZ A;  1SBE A;  4RQP A;  1VPH A;  2A71 A;  1V9U 3;  4DUW A;  3LPF A;  3OB8 A;  4LR4 A;  4E8D A;  1W6M A;  3R6S A;  4AVV A;  5L7O B;  4JTN A;  5JOX A;  5GZG A;  3DPR A;  4B4R A;  2AH2 A;  2IXC A;  3CU7 A;  4IL7 A;  3AVR A;  4BH9 A;  2VPV A;  3ZPY A;  4AFA A;  2ENR A;  5BUV A;  4HET A;  1PK6 B;  3NO8 A;  2D44 A;  1CAX A;  1S2B A;  2XBO 1;  3DXT A;  3DKQ A;  3K75 B;  1Y9Q A;  1BYH A;  4RS5 B;  1EV1 1;  2HWD 2;  2MEV 3;  2I07 B;  2E33 A;  5KXE A;  1SMV A;  1YYN A;  2VMC A;  3WXP A;  5KBF A;  3VV1 A;  3INA A;  3NJX A;  1GOG A;  4Y1Z A;  5HV0 A;  3RS6 A;  3K2O A;  5I8T A;  3N7M A;  3NKT A;  3OCP A;  3ETQ A;  2C1F A;  3HEI A;  1XSR A;  3T4H B;  2LW8 A;  2NZ9 A;  1EV1 3;  2MEV 1;  1ASJ 2;  4R9B A;  5C8W A;  4CEY A;  1LAJ A;  5FYH A;  1PMH X;  4BLI A;  3Q8F A;  4BE3 A;  5F9T A;  2F4L A;  2C4X A;  4XFF A;  3VBU B;  1ZZ7 A;  3VZL A;  3Q8A A;  2NM1 A;  3W20 A;  4CDW C;  1AR6 1;  4Q4X 1;  3TYJ A;  1FT9 A;  3VLB B;  3WSO A;  1UY3 A;  3A7Q A;  1OUR A;  1VMH A;  3CO2 A;  5CIS A;  1JUH A;  3BOD A;  1OUS A;  5DAQ A;  1W8N A;  4EZH A;  4DRV A;  1S0I A;  1I6X A;  1SCR A;  2E7Q A;  4ISQ A;  4CP9 B;  1YFX A;  1AR6 3;  4EN7 B;  1ZBA 3;  4ET7 A;  3Q9O A;  4Y5Z 0;  1W6O B;  3U75 A;  1FNZ A;  3NWK A;  1F9K A;  3BTY A;  4YM3 A;  1Y9G A;  3KD4 A;  3MW2 A;  2OPK A;  3CZJ A;  4AED C;  2DBN A;  3WD5 A;  1DQ6 A;  4DXS A;  1DGW A;  4HKO A;  2WNV B;  2ZX4 A;  3I3E A;  3H0O A;  1NA1 B;  4NWV A;  4XXP A;  5FLJ A;  1OT5 A;  1O3T A;  3M3O A;  5K0U A;  4WM8 B;  2VMD A;  4LLF A;  1RUD 1;  1G9D A;  4E27 A;  1ZZB A;  4YNI A;  2D3R A;  2HEV F;  2IXL A;  1ULE A;  3VDD A;  4A41 A;  1YJK A;  1AYM 2;  1OH3 A;  2OUJ A;  2XLF A;  1V6K A;  2WNV A;  2XJU A;  3OJB A;  4DXR A;  2B9V A;  5JPN B;  1LKN A;  3OYW B;  4FOV A;  1RUC 3;  4GWM A;  3WT3 A;  4AAP A;  4LJH A;  1EUT A;  3POF A;  4A4A A;  4YYO A;  5A7O A;  1LOF A;  5T50 A;  4DO0 A;  4DXZ A;  1DGR N;  1H2N A;  2A3Y A;  4N43 B;  1W8Z A;  3K48 A;  1AYN 1;  3R05 A;  1BK1 A;  1OOP C;  1VBD 1;  3LF7 A;  4LBJ A;  4XFH A;  5BXX A;  1VB4 A;  4BU2 A;  3WG1 A;  2EIC A;  1ZRF A;  2W94 A;  4BDV B;  1IS5 A;  3S6P A;  4OZX A;  1GMM A;  2ARE A;  5LA1 A;  3ZN6 A;  2WZR 1;  4PF1 A;  2H0V A;  1LTE A;  3TEY A;  3QH6 A;  3H3L A;  2ZMN A;  2XJT A;  3NJY A;  3MV1 1;  1VBC 3;  2YYO A;  2HWB 3;  1YFW A;  1OMI A;  4EN6 B;  2J1V A;  1QWR A;  2DVB A;  4LIV A;  1G6N A;  2QTW B;  1UMI A;  4HN1 A;  4K1Y A;  4RYD A;  4EN8 B;  1W05 A;  1U5I A;  3RYK A;  3AKT A;  3Q8B A;  3OGS A;  1KJR A;  4MSV A;  1O59 A;  5F3E A;  4YZ2 A;  4AEJ A;  3FUO A;  5FXZ A;  5DUW A;  2ZMK A;  2J1R A;  5M0T A;  2BBV A;  1GBG A;  3G7D A;  4FPK A;  3ZOI A;  1MZ5 A;  4IGO A;  5C6C A;  4AQ2 A;  1QJF A;  5DG2 A;  1SDW A;  1QNY A;  1VLN A;  2ILM A;  1MEC 1;  1GP5 A;  5LEK A;  5APA A;  5A7N A;  1AX2 A;  2XHK A;  4HVR A;  4NHY A;  3VDA A;  3ZN6 B;  1MS3 A;  2MEV 2;  2HWD 3;  4ARY A;  4CU7 A;  3VHN A;  2VMF A;  3TEW A;  1LR5 A;  1LEM A;  1WD4 A;  4DXT A;  1LHV A;  5BNO A;  4HSL A;  5A3P A;  1QQP 3;  3CHX A;  2IZW A;  2VXR A;  1UPI A;  2DFB A;  3M70 A;  4FO9 A;  2FDI A;  5LK7 B;  5FLH A;  2A70 A;  2VVF A;  3R0R A;  3WZ1 A;  5FK8 A;  1RUC 2;  1N3Q A;  1H2K A;  3Q8E A;  4IV1 B;  3ZYH A;  1GUI A;  2CAV A;  4C8D A;  1NCQ C;  1K5M B;  1RTV A;  2NMO A;  2DDU A;  2QDN A;  3SNM A;  4Q8L A;  3JBG 1;  1VBE 2;  5FYM A;  2N7G A;  3UL2 A;  1D7P M;  2EIE A;  1HX6 A;  2YC0 A;  3D0J A;  3P1I A;  4BQ4 A;  5E16 A;  5A3L A;  4QPY A;  4QPI A;  3VGI A;  1W0P A;  5C33 A;  1W9Y A;  1Y9M A;  2BDR A;  2HJI A;  1XU2 A;  2R6Q A;  2W1Q A;  1HQN A;  1Z0H A;  4HAN A;  4LBQ A;  5J09 A;  4IQP A;  4RD7 A;  2H6C A;  4SLI A;  3D8C A;  4P9J A;  4OI0 A;  1PVC 2;  5CNA A;  4FCA A;  1O5U A;  2HWB 2;  1VRH 3;  4KWL A;  5T55 A;  4FPF A;  5FV3 A;  2H0B A;  4UW5 A;  3UGF A;  4MGS A;  1ZBA 2;  3POB A;  1V0A A;  1PX4 A;  1KXG A;  3B01 A;  3NNF A;  4URT A;  4X6R B;  3HNM A;  4RGK A;  1FXZ A;  3RMX A;  1PM4 A;  1GNZ A;  1V9U 2;  4KQ7 A;  5HCF A;  4E4H A;  3OPT A;  4FFI A;  3ZVX A;  4BQ5 A;  3MBW A;  1VRH 1;  2X5I A;  3VB9 A;  2Y6K A;  1YFY A;  4LNV A;  1H8T B;  1W6P B;  1G8W A;  1UIK A;  2DVF A;  4YZ5 A;  2Y38 A;  1ST8 A;  5KHJ A;  1QJY 2;  1GZT A;  2J42 A;  4NID A;  1DZT A;  2ZX1 A;  1UYY A;  3ACL A;  1OQ1 A;  2X8K A;  2OX0 A;  4W4Z A;  4LO4 B;  5FY9 A;  4A7Z A;  4BHP A;  4CTE A;  2OPW A;  1GIC A;  2ZHK A;  5B2G B;  1HB3 A;  1ODN A;  2ZCW A;  3EXU A;  3WNM A;  3M1H A;  3RI8 A;  4CP1 A;  1OFN A;  3KQ4 B;  2BOI A;  4FPL A;  2ADD A;  2LM3 A;  3THT A;  5L7O A;  4BYY A;  4AAX A;  2B7Y A;  1GYK A;  2AUY A;  1PX3 A;  3LD8 A;  2RS1 2;  4AHZ A;  3WCS A;  1YIF A;  5LW9 A;  2ZGU A;  5J98 B;  5CB7 A;  1WWY A;  2VUD A;  3B94 A;  2QJV A;  4AXO A;  1DDL A;  3U37 A;  1QU0 A;  2RMU 3;  3RZG A;  3ZYG A;  1N47 A;  1ZBE 3;  2XH6 A;  1RXF A;  3MEP A;  2BPA 2;  4BQX A;  3EO6 A;  4W6W A;  4CEW B;  1BJQ A;  1VB2 A;  2ZAH A;  2WFF 3;  3OF1 A;  4COU A;  3MGU A;  1MVQ A;  1S55 A;  3HWJ A;  1VR3 A;  2QUO A;  3DUI A;  3TOJ A;  1UOJ A;  4GMP 1;  4I30 A;  3M3C A;  1C1L A;  1UU6 A;  1QXR A;  3BTX A;  4GAL A;  4MGZ E;  1NCR A;  3OBA A;  1MQT C;  1L7R A;  5JMO A;  1DP0 A;  1W06 A;  1AVB A;  1CIY A;  2FCT A;  1LGB A;  3BTA A;  3ILF A;  4C0H A;  3POG A;  4KU8 A;  5GZC A;  1RUE 3;  3ACH A;  2ZX0 A;  3AKP A;  1PGS A;  1OLR A;  4WZC A;  2YY1 A;  3WV6 A;  4PLO A;  1LOD A;  4CDQ A;  1AF9 A;  2AEN A;  3O7O A;  5FZ3 A;  3MDP A;  2DFC A;  1VJ2 A;  4N7U A;  4AED B;  5C5U A;  4DUX A;  2XJS A;  4NRP A;  1WBF A;  4R52 A;  4H3W A;  3CDZ B;  1C5I A;  3WDW A;  1J3P A;  2YC2 A;  1JU3 A;  4YFZ A;  4P08 A;  3PU8 A;  5A3O A;  3WNL A;  5ACA 2;  3MW4 A;  1XE8 A;  4R9C A;  4BQ2 A;  3AVS A;  3K77 A;  1JOP A;  4QX3 A;  4RQP B;  1OA3 A;  4QQP A;  5FBZ A;  5FY0 A;  3GJA A;  1ZZ8 A;  2W95 A;  1DQ4 A;  1WW6 A;  2B46 X;  2D5H A;  4MXW B;  3M7A A;  1RUF 3;  1AR9 2;  4GXL A;  1LU1 A;  2WT0 A;  1DFQ A;  3UKN A;  1H6X A;  3K46 A;  1RHI 2;  5JAX A;  1DBN A;  1XE0 A;  3M2M A;  1WZX A;  1D4M 3;  5IK8 A;  1UD1 A;  1CQ9 A;  2K0G A;  2BFU S;  5LRR A;  4WV8 A;  4CEW C;  4Z8B A;  1RIN A;  1KFU L;  2Y6F A;  4PF5 A;  2HBU A;  5IYY A;  2I45 A;  4DPN A;  5E88 A;  3VL8 A;  1YIP A;  1B35 C;  1VRH 2;  2XJR A;  4MH0 E;  1W0O A;  5FUI A;  2DF7 A;  1FPN 1;  3GYD A;  2VUJ A;  3JXS A;  3POJ A;  3MF6 A;  4CDW A;  1IG0 A;  1S0E A;  3O1V A;  4BK5 A;  3CJX A;  1RVF 3;  1AX0 A;  1MPX A;  4LK6 A;  5JZG C;  2EXK A;  5CIR A;  2BZD A;  1O8S A;  3PTY A;  4N9I A;  4A44 A;  2RM2 2;  3NJZ A;  1LOC A;  1M06 G;  3VD4 A;  4NRQ A;  5FYI A;  5JSP A;  4YVS B;  5FPB A;  3AKR A;  4AFC A;  2UWA A;  4QGL A;  2PA7 A;  3HD8 B;  5JXJ A;  4LUM A;  3EMR A;  4M01 A;  1PIV 2;  3WNX A;  5ISL A;  2VY0 A;  4HLT A;  1SEF A;  2YG0 A;  1CWP A;  5ERL A;  4QX2 A;  2MPF A;  4H7L A;  4IE6 A;  1GR3 A;  4LOR A;  1GZW A;  4CDX C;  3TAY A;  3MFA A;  3TN9 2;  1COV 1;  1C1F A;  1SLL A;  3R4D B;  4AGV A;  1X9T A;  2VO5 A;  3OBR A;  5JI9 A;  4WM7 A;  5FIX A;  1J59 A;  2HWE 2;  3AMN A;  1CAV B;  5A32 B;  1R08 1;  3MIC A;  5IAV A;  2CYF A;  1UPS A;  1H9W A;  3LEG A;  1QQP 2;  2D6M A;  2VZU A;  1BZW A;  5EXO A;  3ZYI B;  4C1W A;  4YSF A;  3KCC A;  1RJ8 A;  1HRI 3;  4KGG A;  1XU1 A;  2FHR A;  4O65 A;  2D98 A;  2B4K A;  3ZXE A;  3CKH A;  2P3I A;  3FX3 A;  2VQA A;  5JDB A;  5FY8 A;  2QVS B;  2WO2 A;  3J9S A;  1SPP B;  1ZBE 2;  4ZS2 A;  5CKM A;  3PUS A;  3VD9 A;  1PZ9 A;  4IV3 B;  1VBE 3;  4Y5T A;  4PBP A;  2EID A;  4AL9 A;  2WO3 A;  1LOG A;  4JTO A;  2IFW A;  4P14 A;  2EF6 A;  4RHV 2;  1KS5 A;  5FZ0 A;  1WBL A;  4XF9 A;  4QXC A;  4OQ9 A;  4QHO A;  4DIN B;  3WHT A;  2PFW A;  2W3J A;  5KHI A;  5JXG A;  1EAH 2;  1CJP A;  3IAQ A;  1IKP A;  5J36 A;  2FD8 A;  3VBF A;  1EPZ A;  4XUN A;  1O3Q A;  1K45 A;  4ATE A;  2VU9 A;  3ZSK A;  1RUG 2;  4R8H A;  1R1A 1;  1W6Q A;  2WFP A;  4BWO A;  4UF0 A;  3S5A A;  4ZON A;  2VG9 A;  3KT4 A;  4E9K A;  2WSU A;  3H7J A;  2R06 1;  2OA2 A;  4OQ8 A;  1DQ2 A;  1VBB 2;  1AL0 G;  3POS A;  4JGY B;  1IPJ A;  5DDJ 1;  5D21 A;  2RM2 3;  5FYC A;  3P6B A;  2P6H A;  2VBB A;  1STM A;  1HIX A;  4UOJ A;  3MUZ 1;  5C4W A; 
#chains in the Genus database with same CATH homology
 3PU8 A;  4CCO A;  5FYB A;  5IW0 A;  5FZH A;  5FY1 A;  4GJZ A;  4D6R A;  3AVS A;  5IVC A;  3KV6 A;  5FYH A;  5FP9 A;  5FPU A;  4C8D A;  2W2I A;  2GP5 A;  5FY0 A;  2YBS A;  5FBJ A;  5FUP A;  4Y33 A;  5FYM A;  3N9M A;  4BIS A;  5FXW A;  4AI9 A;  5IVV A;  4XDO A;  4LIU A;  5FYY A;  5FPA A;  5FZM A;  5K4L A;  5FZO B;  3PU3 A;  4IGQ A;  3RVH A;  5FZ4 A;  4EZH A;  5FPV A;  5FP8 A;  4CCN A;  4QX8 A;  5FV3 A;  5FZB A;  4CCM A;  2XDV A;  4Y4R A;  5F3G A;  3KVA A;  5FZD A;  4CSW A;  5KR7 A;  3KV5 A;  4Y3O A;  4GD4 A;  3K3O A;  4UF0 B;  4QXB A;  5FZL A;  5FYZ A;  5FZK A;  3AL5 A;  3OPT A;  5FZ7 A;  4E4H A;  2WWJ A;  5LY1 A;  2YBK A;  3KV9 A;  3N9L A;  5FZ9 A;  4DIQ A;  5FZO A;  3ZPO A;  5FYI A;  4TN7 A;  5A3N A;  5F32 A;  2Q8E A;  3KVB A;  5FPB A;  5A1L A;  4QX7 A;  5FYS A;  4GJY A;  4V2W A;  5FY9 A;  2OX0 A;  2Q8D A;  3KV4 A;  3OPW A;  5ISL A;  3U78 A;  5CEH A;  5FYT A;  3PUR A;  2YPD A;  4CCJ A;  3LDB A;  5FYV A;  4AAP A;  5FZF A;  2OT7 A;  4D6S A;  5A7W A;  4CCL A;  5A7O A;  4DO0 A;  4V2V A;  3PUA A;  2WWU A;  5F39 A;  3PDQ A;  5A7P A;  5FP7 A;  3N9Q A;  5F2W A;  5FZA A;  3LD8 A;  2Q8C A;  4BU2 A;  5FXV A;  5F37 A;  5A7Q A;  5F3C A;  4D6Q A;  5LW9 A;  5FPL A;  2VD7 A;  3N9N A;  5FUN A;  5A3W A;  3AL6 A;  5A80 A;  3N9O A;  2OQ6 A;  5FWJ A;  3N9P A;  5FZ6 A;  4HOO A;  4URA A;  5FY4 A;  5FZE A;  5LY2 A;  5FY8 A;  5FZ8 A;  3NJY A;  5IVB A;  5FZG A;  5F5C A;  3PUS A;  5FY5 A;  5FP4 A;  2P5B A;  2OS2 A;  2XUE A;  1VRB A;  4LIV A;  5FP3 A;  5FWE A;  2YBP A;  5FZ0 A;  4EZ4 A;  4BXF A;  3DXU A;  4QXC A;  5FZ1 A;  4HON A;  3ZLI A;  5IVE A;  4GAZ A;  4QWN A;  3PTR B;  3U4S A;  5F5I A;  5FZC A;  5A7S A;  5F5A A;  5IVY A;  4CCK A;  5E6H A;  5A3T A;  2YU2 A;  5ANQ A;  5A7W B;  5FXZ A;  2GP3 A;  5A1F A;  3AVR A;  3PUQ A;  4IGO A;  5IWF A;  4LIT A;  4UF0 A;  4QXH A;  4QU1 A;  5FXX A;  5F3I A;  2PXJ A;  3DXT A;  4NUB A;  5F3E A;  2XXZ A;  4ASK A;  3UYJ A;  3K3N A;  5A7N A;  5FZ3 A;  5FJH A;  5FYC A;  4LXL A;  4XDP A;  5F2S A;  5FYU A;  5FZI A;  3K2O A;  4EYU A;  5FY7 A;  5FJK A;  5IVJ A;  5A3P A;  5IVF A;  4IGP A;  2OQ7 A;  2YU1 A;  2XML A;  4CUG A;  5LWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...