2YBPA

Jmjd2a complexed with r-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
b'TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybpA01
2VD7A 3K3OA 5FXVA 4GD4A 3OPWA 2OQ6A 5KR7A 5CEHA 5LY1A 5IVCA 5IVVA 4IGQA 5FXXA 4BISA 4AAPA 3N9LA 3PUSA 5ISLA 5FUNA 3NJYA 5F39A 5FYCA 4Y33A 4URAA 5FWEA 5FZ6A 5FZBA 5FZ0A 2YBSA 5FY0A 5FPBA 2YPDA 5FJKA 2WWUA 5FYYA 5FY1A 5FY8A 3PDQA 4LIUA 4CCLA 4EZHA 2GP5A 5A3WA 4BU2A 3AVRA 2WWJA 5F5CA 5A7PA 4NUBA 4CSWA 3PU8A 4GJYA 4XDOA 3KV5A 4UF0B 2XMLA 3N9NA 5F2SA 5FV3A 5A7WB 5F5AA 4CCOA 4QXCA 2YU2A 5FY7A 3N9MA 3PUAA 2OQ7A 5FZOA 5FZ1A 5FZLA 5A7OA 5FZ4A 2Q8EA 2YU1A 4CCNA 5IVYA 3KV4A 5FZ9A 5FXWA 3N9OA 3U4SA 5FYBA 5LW9A 4LIVA 4HOOA 5FYSA 5A3TA 5F3IA 4TN7A 4QU1A 5A3PA 2PXJA 5F3EA 4E4HA 4ASKA 4D6SA 3PURA 5FYVA 5F2WA 3PUQA 4Y4RA 4CUGA 5IVBA 2OS2A 4V2VA 4D6QA 5FZDA 5F32A 4CCMA 5FPUA 5FZHA 5FZEA 5FZGA 2YBKA 5FUPA 5K4LA 3RVHA 4QX7A 5FYUA 2XXZA 5F37A 2XUEA 3ZPOA 2YBPA 5A80A 5A7QA 5FP3A 3OPTA 2P5BA 4GJZA 5FYIA 5FZ3A 5FZIA 5FZOB 3K2OA 5FZCA 4CCJA 3AVSA 3DXUA 5ANQA 5IW0A 5A3NA 3LD8A 2W2IA 5FP8A 5IVJA 4QX8A 4QXBA 3DXTA 5FY9A 2XDVA 2Q8DA 3KVBA 5F3CA 4IGOA 5FBJA 5FWJA 3LDBA 3N9QA 5IVEA 5A1LA 4XDPA 5A7NA 5FYMA 5LY2A 3AL6A 4EYUA 5FYHA 4DO0A 5FZKA 4QXHA 3AL5A 3KVAA 2OT7A 3K3NA 4CCKA 1VRBA 5FP4A 3N9PA 4IGPA 4GAZA 3UYJA 5FZFA 3ZLIA 2OX0A 5IWFA 3PTRB 4DIQA 5FJHA 3PU3A 5FPAA 5F5IA 5FPLA 5FY5A 4V2WA 4QWNA 5IVFA 5FZAA 4Y3OA 5FY4A 5F3GA 5E6HA 5FYZA 4AI9A 4D6RA 4BXFA 3U78A 4C8DA 5LWBA 4HONA 2Q8CA 4LXLA 4EZ4A 5FZ8A 5FP9A 5FZMA 3KV6A 5FPVA 3KV9A 5FXZA 4UF0A 2GP3A 5A7WA 4LITA 5FP7A 5FZ7A 5FYTA 5A1FA 5A7SA
chains in the Genus database with same CATH superfamily
4YVWC 4Q4X3 4BPZA 3GJBA 3I8TA 3KQRA 3UKTA 3B9IA 1ODNA 4UXAA 2BZDA 2ZEXA 3PMSA 4HSLA 4A41A 3ETPA 2RR12 4S2DA 5JSRA 4CEWB 1M4WA 1V00A 1RUC2 2D40A 3HQRA 1S0IA 4Q1RA 4URAA 3IKWA 2D3SA 5DAXA 3WNNA 2JIGA 4A7ZA 1WCSA 1CR7A 3POEA 4YW5A 2ZZQA 3MBWA 2KD7A 2W1UA 3MYXA 2XWBB 5GZCA 3PVBB 3WD5A 4EROA 2HWC1 4CP1A 1OOPC 2GP5A 3AVRA 4FOWA 2A7AA 4RSUA 1X9PA 3UKNA 1S0JA 2R073 4XF0A 3RNSA 2HH9A 2A3XA 1ZBA1 3POJA 1ZA7A 4XHXA 4KWJA 1DBNA 1XJAA 3SKVA 1R1A2 3H0OA 3KM5A 5CFDA 4NRQA 5FZ4A 1JODA 4MUVA 5C4WC 4CTEA 1D2SA 1SZBA 2VE1A 4CCNA 3KT7A 2Q1FA 1C5HA 2RS32 3JBG1 3LDKA 4LR4A 1H4HA 1RYYA 3LQCA 5HCFA 1AR83 4ET7A 4FPCA 2Q5TA 4LKSA 3V65A 4ARYA 1RUD3 2HWD1 4AWDA 4RHV1 5DAPA 5F2WA 3H42B 3WHUA 4WM7A 2WS93 4FPKA 4UFKA 1PO13 2X5IB 3E5QA 1Z7S3 3H3UA 3ILNA 1PGSA 1HRI3 4JGZA 4NIAA 5HBAA 4L0PA 1CZSA 1KJRA 4OVEA 4BQYA 4FTBA 2NLRA 5FZGA 4JGYB 4GQ7A 4QPGB 5F37A 4QD2A 2YHJA 1PM7A 4E2QA 3K2OA 4MX3A 2VUCA 1ST8A 2OKXA 4BQ4A 1G7YA 2K9ZA 2KA3A 2RS11 1RUH2 2W2IA 4R4XA 4CUBA 2WYSA 4IEPA 5LA0A 2OZ6A 2XR4A 1RUE3 1XNCA 3ILRA 1G9FA 2ILMA 5L9BA 4L92A 4SBVA 4ZZ5A 3T2TA 1U5IA 1HXS1 5JR2A 2PA7A 1KGYA 4XF4A 3RFRA 1EV11 4UFHA 5JMCA 3ALQA 4JRLA 3H3ZA 2UY8A 3T2QA 2GNBA 4K9SA 3EJKA 2W95A 4CCKA 1GLHA 2VZVA 5J37A 2VNRA 4AI8A 2VXJA 3T2PA 3FJSA 1UO9A 1MQTB 2Q0AA 3THTA 4LQRA 2VOTA 4I09A 3E6DA 2HYKA 3WG4A 1IG0A 1F5JA 1WZXA 1XYNA 3J7LA 1PO22 3LCPA 4NIIA 1YNAA 4GH4B 1PHMA 5H9RA 4IV3B 2XKOA 5FO8B 4Y22A 2DWRA 5A3TA 1HDKA 3NWKA 4QPIA 4QKNA 2A70A 3TEYA 1N47A 4JDNA 3O14A 4LBJA 1AYM2 1UPSA 2RDRA 2ZGRA 3VDBA 5FXVA 3MIDA 4GD4A 3HQUA 4K3UA 1Y9MA 4CUCA 1SBDA 4HK8A 4X8PA 2B8MA 4OI4A 3N9LA 1SMVA 5HXMA 2CDOA 2ETEA 2BGPA 2BVVA 4OUEA 2LUWA 3AYAA 4Y33A 4C1WA 3GF6A 2IVIB 1DGWA 3O5SA 3ZYRA 1O8SA 1I1EA 4P9IA 3ACHA 3AKSA 1SLBA 3HVDA 4TLFA 5FZ0A 5JXHA 1PVC1 1MS0A 5FK8A 4FAGA 2Y6GA 2WT2A 4FTSA 5KHHA 1W8WA 3LEIA 3MPBA 3GZAA 4LIUA 1W8HA 4WVMB 4AZZA 4IL7A 1IPJA 4EN9B 1JYXA 1OLME 2ZMNA 4WV8A 3MEPA 5DPNA 3UNPA 3HIFA 3RWKX 1UXXX 1BLZA 2TNFA 4HZFA 4DFSA 5A6YA 1DG6A 3NKGA 4YZ4A 4UWDA 4TYSA 4COYA 1PIV2 1LECA 3NNGA 4WVWA 1JUIA 3BKZA 1QH7A 4I3PA 4QQPA 1AL22 1RVF3 3AP7A 2EXHA 4RFRB 1ZA4A 1J3QA 1JOPA 5DAWA 1TME1 3NV4A 2Q8EA 4Q4W3 4J25A 1PGL2 1OXCA 1R081 2EIGA 3ES1A 3GCXA 3CO2A 1NY72 4G3YC 3A4UA 1WUVA 4CEYC 1G86A 1PM4A 1N3QA 1FMD2 3O1SA 2ZX2A 1GQGA 3O1MA 3ZFEC 4FP2A 3U4XA 4D6QA 3POYA 1W2NA 2Z2SB 2ZGLA 1A3KA 3P5BA 3H9AA 3WF2A 5K0UB 2Y6FA 3UETA 3RVHA 4F83A 5FKBA 1S0CA 3JB8A 3W59A 3OTFA 1UXZA 1Y43B 1FPN1 4H14A 2R1DA 4Q0QA 4GMP1 5LZ6A 5FZIA 3W20A 3VL9A 4BQ5A 1ZBE2 2OVUA 3WUDA 4AFBA 4AEKA 2HEVF 1GP4A 1X82A 5HV4A 2EXJA 2VOVA 3E5UA 3GGLA 1OKOA 2XH6A 5ABJA 1UU4A 2D6NA 2W3JA 4ZZ8A 2J1AA 4RGGA 1JH5A 4HANA 3WDVA 4D7TA 5C6CA 3S5AA 5LEKA 4MGKE 3E5XA 1ND2C 4XTMA 1CX1A 1LAJA 2B39A 3OYWB 2BVBA 5T54A 5FZKA 3T09A 1FT9A 1DCSA 3DCQA 4S2FA 2PHUA 3MDPA 4W50A 3OEAA 3WP3A 4IV1C 1RJ8A 2P2KA 4S2GA 4XUNA 2PHDA 5KC5A 3WP4A 1POQA 1VBB1 2ARBA 3D4KA 3AM2A 4PBOA 4YZ3A 3OG2A 4DOUA 1QJU3 4YM3A 3WG1A 2R063 4DIQA 2ZACA 1O7FA 4WM8B 4CXWA 1AR92 5IATA 4NHXA 4S2HA 1A8DA 1SLIA 1VBA2 3E97A 2WINB 2CTVA 4IV3A 1IQAA 3L9JT 1S2BA 1VAKA 2VZOA 1QU0A 3B9CA 5AFBA 3VBHC 3T0DA 4PDWB 4IEWA 1AR71 1GUIA 3PHMA 1CD3G 3ZSEA 2GMMA 2ZGUA 1GWLA 3DYPA 5FRAA 4ZHNA 4ZONA 5IHRA 1MEC2 3CJXA 3KD4A 1NCRA 1JW6A 3OPZA 1COV3 1H2KA 1C1LA 1LOGA 2CYFA 2VVDA 2ARCA 3TB0A 5A33B 4XOGA 5L9RA 1VB4A 4Z07A 3IDEA 2WR9A 4Q0VA 4B7KA 5GLWA 2BNOA 5LB6A 1KS4A 1BBT1 4CP2A 2VMFA 1EP0A 3NRUA 3S7IA 3WF1A 4BLIA 1HB4A 3LFMA 2N7GA 2VCAA 4WVMA 2BU9A 4UI9L 4CCLA 2ZJCA 2AH2A 2QZ3A 5F1RA 1O3SA 2K2SA 2XJPA 1VLNA 2BP6A 2P1BA 5A3WA 3U07A 4E8DA 3JQXA 1Q8PA 4AEMA 4KNCA 4Z82A 2XMLA 4O61A 1EAH2 3B69A 1TE1B 3M4FA 3OOXA 1QNYA 2RM22 1ACCA 2RV9A 5FZOA 4KMQA 1RTVA 1Z0HA 3E1F1 4A45A 3HN1A 1OF3A 4XFGA 4F7ZA 2WFF1 3ZO0B 1H6YA 2CWSA 1D4M1 3USUB 1K5MB 3KV4A 3FZ3A 2V4VA 3OGGA 3CKHA 5H9SA 5FYBA 2DURA 3POWA 4AQTA 1UKRA 2PAKA 2PHXA 3GCWA 4O9EA 4NJ4A 1VBD3 3I59A 3ZOIA 3H8OA 1VR3A 2TBVA 4AI1A 3LAGA 5C8CA 1HRV1 2PXJA 4BLJA 4YYOA 5FYVA 1VAMA 3I3QA 2ZPXA 4R9DA 4YG3A 4AK3A 1Q56A 2EIDA 5EFUA 3PMEA 1CAXA 1W6QA 3CJIA 4E4ZA 2WT1A 4FSJA 3UJOA 4TTGA 5K0UA 1AXYA 3ITQA 1QKQA 2UYAA 3INAA 4PI0A 5K8SA 3VUOA 3AP9A 3HBZA 3AFKA 4NIDA 5CFCA 2P5BA 5FYIA 1R64A 2ZHKA 1BEV3 1LHOA 4Q4X1 1VALA 3BTZA 1FOD3 2PHWA 4B29A 4I0BA 4MV2A 3CBNA 3DXTA 1HB3A 1YQ8A 3POFA 5EJZB 3DV8A 4XCAA 4HT1T 3JBG2 4HL0A 4IEQA 1XSQA 5JOYA 3M2MA 1ZRDA 2E9QA 4Y1UA 1JHJA 1JBCA 5IVEA 3OYWA 4OFGA 5A1LA 1RUG3 5A6QA 3VBOC 2HWD2 1XE7A 2J7MA 2C5DA 1SLLA 4ISRA 4RHV2 3ZX7A 1YJKA 4YVSC 2E7TA 2I74A 3BALA 4OI0A 4FOYA 5DXDA 5CVRA 3RZMA 3KMHA 2XLAA 1OMIA 4DEVA 5GZGA 5HCAA 3J7MA 1ULGA 1BKZA 1AJOA 2YPJA 1PNFA 3A23A 1RUOA 3LSEA 2R071 2D6OX 2OX0A 1PMJX 1BK1A 1UZZA 3H7YA 1APNA 3PU3A 4DRVA 4WM8A 2DBIA 5GALA 5AC93 3ZXAC 4H55A 4W65A 2VUDA 4ATEA 1NLQA 3B7MA 5IVFA 4P9JA 1D2QA 2RS12 4D94A 4UBHA 3B01A 4BQ1A 5KHKA 4ISQA 3H8UA 5FZ8A 4UOJA 2XVGA 1AR81 1YFUA 1W8OA 1HXS2 3VBUB 4ZU7A 1EV12 5JZGB 2A3WA 2WS91 1ND3C 4Q5OA 2CNAA 3OPWA 3UGGA 1SCRA 5J09A 3CU7A 1A6CA 1MS1A 3VL8A 3TBDA 3WDYA 5JWPA 4HG6B 4I2OA 4XYXA 2VQ0A 4UAPA 1IGOA 1O59A 2A6YA 4XABA 5L73A 4HSJA 1US2A 3MIEA 3RG0A 5A3OA 1N3OA 1SFPA 4D69A 2VQUA 4INDA 2WLQA 4CU8A 5DDJ1 4MG2A 5GZEA 1VRH3 4NIGA 1TEIA 2JECA 2G1MA 3FBMA 4I02A 1J83A 3N7KA 3KGLA 3EBRA 4GJYA 2ZCWA 5FR3A 2D43A 4Y5SA 5A7WB 5GJ6A 1V70A 3MIFA 1POV1 3RGBA 3O0VA 3OD4A 3ZFGA 3BTAA 1R1A1 2ARXA 3FLRA 3WVJA 4QGMA 4LOTA 2GNTA 3A22A 3WHTA 2VC9A 4LO7A 2UURA 4LJHA 4XJUA 2ARAA 2VW2A 1CPNA 1DQ5A 1H1IA 1K5MA 2E33A 5FZ9A 4IE0A 4XAAA 5D2AA 2VZSA 4LIVA 4FPJA 2R0HA 1UYXA 4FOQA 2VW1A 3DKWA 5A32A 4QKBA 5BYNA 3SEEA 4FTEA 5CG8A 3OGJA 3RYRA 4NAOA 1PVC2 1FAYA 2X8KA 4D0QA 2RS53 4GALA 4HN1A 3TNPB 1GU3A 2AR6A 3AKRA 3ZFFA 1RXFA 2G9FA 2HKXA 3B02A 4O7XA 3VBRB 3ZXJA 1GQHA 3PNAA 2Y38A 3O7OA 4K21A 2YYOA 4QX7A 3UL2A 3I54A 4ZPIA 4L2NA 3DF0A 4IEVA 2DTWA 4RS5B 3IBMA 4ZS3A 5L7OB 1REFA 1TME2 3ATGA 5EQUA 1R082 4RA0A 3B5LB 2B5HA 3BIEA 3QH6A 4YG0A 2HEWF 3LIHA 3HQXA 3D0JA 1UIJA 3PL0A 2IFWA 2I07B 5A7NA 3IMMA 2DFBA 5C9AB 3ORJA 1GKBA 1YC61 5FTTC 1JOJA 1H8VA 3TAYA 3VKFC 2FDGA 1R092 1NA1B 2FHRA 4I0AA 2F17A 1AR61 4OI2A 5GLZA 1C3HA 3NSTA 3S30A 2D7FA 1KFXL 4IGPA 5JXGA 2QQUA 4URTA 3ZLIA 2JDPA 3ZXGA 3V0AA 3M3IA 1HB1A 4AEDC 4W8JA 3LF7A 4P00B 4M3CB 5F5IA 4UT5A 5FY5A 1HV1A 2I2SA 1RVF1 5E16A 1JYWA 5C3SA 4XZUG 2IXLA 2KXLA 2BNNA 1OQDA 3O0WA 4Q4V3 5IFTA 4RR3B 4NWWA 4N43A 3VN4A 3ACGA 1V6JA 4ZY9A 5D8AA 1WW6A 4O9GA 3T4HB 1MS4A 4CDUB 4B4PA 5E88A 5DZGA 1DQ6A 3VDDB 1F4HA 1LTEA 1QXRA 2E6VA 5E89A 3URFA 3ZKYA 3NNFA 3OCPA 2F4PA 2GC0A 4IESA 2A6XA 2GALA 4Y1YA 4ES9A 3OUHA 3FFZA 5FLJA 3QD6A 2W92A 3H8RA 4LHNA 1VBB2 3C7FA 4XJAA 3AX4A 1KQRA 4HKWA 4QHBA 2DUPA 2XL7A 2NZ9A 3QLQA 4NRMA 2EF6A 2YBSA 5I0UA 1ULFA 1OFNA 4LEJA 2OYZA 3T3YA 2WWUA 1RXGA 2VPVA 3WEZA 5IAXA 3U37A 2RDNA 2B7YA 4IUGA 5HI0A 4IW3A 5T5JA 2XQRA 1DGRA 1UX6A 3WR0A 4MXVA 4QQ2A 1AR72 4ARXA 4E2GA 2RMU3 3B3QE 3IM0A 4XUTA 5F2SA 1DHKB 2IVJA 5FQ0B 3MLJA 4QDRA 3WNLA 3MUZ1 5CADA 3PUAA 3MF6A 3MZHA 1XNTA 1YRZA 2ET7A 2WNOA 1J84A 2Y0IA 3RWNA 3A7QA 2RDQA 1LHVA 4YW2A 3PJYA 1GANA 3OF1A 4W6XA 5I0SA 1G8WA 3MV11 3H1MA 1O4YA 1RGSA 1QIQA 1YQ5A 4XFIA 1BBT2 2QQOA 4XC9A 3ZMOA 1IPKA 3MW3A 4AR2A 1DFQA 1H9WA 4XTPA 5FDBA 4XILA 1TMF3 3SISA 1HQNA 4CU7A 1IG3A 2VGDA 5CBLA 3MGUA 4Y1VA 1V0AA 4AVBA 5K4LA 4HN0A 2YBKA 5DQ0A 1K42A 2ZMLA 2AEYA 1UOJA 4XDQA 4JQRA 3UGFA 5EP9A 2W47A 2BGCA 3TWIA 4CCJA 5I0TA 1PK6A 5GLTA 4YZ1A 5CFDB 1COV1 2QUOA 1W8FA 1S0EA 4P08A 5GLUA 1DLCA 1OQEA 1RHI3 1TZOA 2WFF2 3AJZA 3BU7A 4M3CE 1UW8A 4K40A 1D4M2 4NR1A 4R9AA 3WOGA 1AYN3 4M4PA 2JD9A 4P9LA 2BPA2 4BQWA 2IZWA 2YY1A 1UMZA 2ZABA 3APBA 2VNOA 4YNIA 4KBZA 1OLQA 1HRV2 1JUHA 2QDRA 5C9AA 2ZAHA 4MGZE 2G4IA 4WM7B 2QQJA 5KBFA 4N53B 4PLMA 5JSPA 1UOFA 1E5RA 1UPIA 4BMEA 3WW3A 4YVWA 3J7NA 4JGZB 2ENRA 2BOIA 3NV1A 1C8M3 4QKFA 1QDOA 5IK8A 3MIHA 4NHMA 2IXHA 3I3DA 1X50A 3PTRB 4Q0UA 3K51A 4V2WA 4Q4X2 3RZZA 2JXAA 1WMXA 4MZUA 2WA4A 2ZEWA 4P14A 5FZAA 2B46X 3R4UA 4Y3OA 5IK4A 2JIJA 3I2IA 5JIAA 2Y6HA 4C8DA 1QY4A 4YW1A 1OOPA 3DL3A 4PCRA 5FXZA 1W8TA 3NMBA 4ITCA 2QQWA 4B1LA 4PHZA 1DZQA 2XQXA 4MH0E 4LA3A 3VDCA 4QQLA 5FBZA 5I0RA 3ACFA 2DCJA 1V6LA 2HWE1 1F15A 3ZSMA 5CKMA 3HPNA 3VBSC 5C4WA 1X8MA 2GN7A 2R072 5JI7A 4N90A 5BNNC 4GWMA 2JG8B 1GOGA 1V9U3 3SCHA 4W6YA 5A3NA 1BEV1 2XJRA 3WV6A 1HKDA 1FV3A 4FQZA 4H7LA 2MHFA 3WDWA 2WWJA 4JVAA 3AZWA 1DZTA 4QPIB 4FPHA 1VBC1 4K20A 1T2XA 3PU8A 4XBLA 2W91A 4RGKA 1AR82 4DUWA 2C1FA 1BK0A 1RUG1 2CL2A 2BERA 2RM21 1W6NA 2WS92 4Q8KA 3MHZA 1XSRA 4UBGA 2WA3A 3IN9A 3LA2A 4EE2A 2BYVE 2E31A 3HT1A 2QQNA 2WN2A 4HPKA 4IEXA 1DLLA 1R1ZA 3LA3A 2EXIA 4MSVA 5LK5A 1K12A 1QOOA 4AI0A 2PQQA 1RMU1 4C91A 5AC91 3LKJA 3N35A 3SH5A 2VZ3A 5C3RA 2R041 4Q4Y3 1XU2A 5KHJA 1ZVFA 3U10A 1LESA 3PUQA 1GV9A 5DDJ2 4JTNA 3R6SA 3O1VA 4FPFA 5FZDA 1YQCA 2YB7A 3IZOA 1LHWA 1V6OA 4KWUA 1IKQA 4XHBA 1OD3A 2XXZA 2SBAA 2XUEA 5GZDA 5A6XA 2IXIA 4LLFA 5T3NA 4A7KA 5LBFA 4X6QB 4CDXC 2AEZA 4K6BA 5IVJA 1YFXA 5ERLA 3G6JB 1YXWA 3I2JA 1UY0A 1ZRIA 4CDQB 4RR3C 4META 3BOPA 4EWEA 3T4VA 3I2OA 3KCYA 3KVBA 4QX5A 3BPSA 4MADA 4JQTA 5FBJA 4QGNA 2MEV3 4QPWA 2F4LA 4UW5A 1KDKA 4Y5Z0 4UFIA 3ZXDA 3LEKA 1NCQB 2V5DA 3LZZA 4P5HA 1LHUA 2A6WA 4UW4A 1AX2A 1OBNA 1SQ4A 1WLTA 4Y24A 5FYHA 4N53A 3T0AA 3AL5A 2B9UA 4RQPC 4Q1PA 3H7JA 3ENRA 4IQPA 1ASJ3 1VRH1 3DEMA 4EN7B 2ZAAA 3O1RA 4YGEA 3M7AA 3ILFA 3OGVA 1CAWA 4AQ2A 4GIQA 3K4ZA 1YQ6A 2PLV3 3IT8A 2W1WA 4IXLA 4LE3A 3CHXA 1T6GC 4AVTA 1EPZA 1MZEA 5CIRA 1UY3A 4QWNA 2B45X 2RE9A 2E26A 5JXIA 5FY4A 3FHQA 1YQ2A 5L36A 4A6OA 2NMNA 4X8NA 1W2UA 4OHZA 2A75A 4B4QA 5F8PA 2FDHA 4M3CF 2RR13 1BJQA 3J9SA 4KGQA 5L9VA 1W0NA 3AMMA 1J58A 2PMWB 4Y20A 3OUJA 1OHFA 1IS4A 3NVCA 4P9YA 5CYYA 5ANNA 4OQ9A 1N1YA 4J1XA 2VBPA 2OQ6A 1YHFA 1AR62 4EJRA 5C5TA 2R30A 4ZU4A 1VBE1 3J8F3 5FXXA 2GU9A 4BQ3A 2JG8A 1B35C 3OBRA 3Q8FA 4CDWC 1X7NA 1S2KA 1DGRN 5CZKA 3WZ1A 2BTVC 3GBGA 1LB2A 4E9KA 2YROA 1RVF2 4DY5A 5CG9A 5T52A 5KHIA 3FUQA 1GYKA 2GC3A 2GNDA 2VH9A 3I2DA 3WF3A 2HYXA 2LROA 1W3VA 3ZFEA 3NL1A 3ZR6A 5T5PA 3VV1A 4PQ9A 1CZVA 2DTYA 1S0DA 4BA6A 3ZN6A 1MZFA 3N9NA 5FCCA 2QJVA 1YUDA 4JAAA 1RJ7A 2E32A 2RS33 3LB9A 5CB7A 1O3TA 1PZ9A 5GKAC 1FXZA 1OH3A 3HMYA 1NCRB 4OMCA 5T55A 4OQ8A 3TOJA 2ZKLA 3EO6A 5FO7B 1TQ5A 2WO2A 1EY2A 1HQLA 1W0PA 4NHKA 5C7GA 3UK9A 4BHPA 5A3PA 5LK7B 4NAMA 4XQDA 1LOAA 2XLGA 1CGPA 2WLPA 1AUYA 1ND2A 3IIIA 1N1TA 4LPLA 2OPWA 3KT1A 1JZ2A 1RUF3 4PJYA 5F6LB 4A42A 2ZZJA 2VMIA 1CPMA 4H3WA 4CCMA 2Y0OA 3AZYA 1RUI3 4IV1A 5F6KA 2HJIA 1WKYA 2G9ZA 1Q43A 2ZXQA 4KWKA 1BCXA 4P9XA 4OI1A 1H8TB 1IQDC 2QQVA 4GJZA 5FZOB 3KS7A 3AVSA 3MLKA 1W3XA 4C1XA 2WO1A 1BHGA 1OT5A 4XFFA 3WDUA 4CDQA 2BBVA 1ZZ9A 4Z2WA 4GXLA 5TSWA 5FOBB 1DGLA 2Q8DA 1PZ7A 3PLQA 3VD3A 1BYHA 2WNVC 3I59B 3VBHA 5C8CB 1E5SA 5BNOC 1NCQA 2CHHA 3LDBA 4ATFA 1YWKA 4CU6A 4CVUA 1JMUB 4AHXA 1NLSA 1FI2A 1OA3A 4NE9A 2NN8A 1Q8VA 1R091 1ZZBA 1BQPA 2QNKA 3WDXA 3NKTA 1C57A 1CAXB 1W6QB 3AZZA 2JG9C 3CJIB 3U11A 3ETQA 5I8TA 2UY9A 3K4DA 4LHKA 2EIBA 3J7HA 1NQDA 3I2HA 3N9PA 2OW4A 5HPOA 1TNRA 1HQWA 4FXGB 4OUSA 1QJFA 2PHFA 5EV7A 5IWFA 5IT6A 2QBXA 1GMMA 1Q3EA 1KD7A 1QJX1 1GNZA 5DUUA 5FPLA 4ZXKA 2W08A 3CQOA 3VHRA 1COV2 1UNBA 3DKQA 2PTMA 3NV2A 2VZ1A 4LOSA 2WAOA 1S0GA 3BVCA 3WG2A 1CJPA 3VB9A 3MIBA 2KR2A 5FYZA 4BCUA 2WNUC 2VY0A 3I4IA 3LOIA 2WJSA 1J3PA 1ZZ6A 3BCWA 1FATA 4IEYA 4RFT0 2AGSA 3M3EA 1CAUB 5FPVA 3I2GA 1V6MA 1OKQA 1RL3A 2QQKA 3ASIA 2YXSA 1F31A 4PIZA 2HLEA 5A7SA 1HIXA 5A1FA 5JXJA 4HKOA 4QDSA 3WP6A 2LW8A 4KG8A 4KL1A 2QQPA 1MACA 4BISA 4CEWC 1O4TA 5ISLA 3DPRB 5F39A 2HWB1 3N4MA 1KJLA 1OPOA 1AZDA 1UMIA 2DVAA 5FWEA 4P9WA 4NOTA 4EQVA 2YC4A 1L7RA 1LEMA 1Z78A 1UCXA 1H0BA 3HNBM 5BNPB 4G4FA 1PIV3 3THCA 5AVPA 4FPEA 5LBEA 4W6WA 1OVPA 4MGQA 1AL23 5JZGC 2GH2A 4Q27A 4XUOA 1PGW1 3BOWA 3IAQA 3ZDVA 1LU2A 2EVXA 4H7MA 1DQ0A 3NV3A 1I3HA 3HNMA 5LRSA 1X36A 5T5LA 2ORXA 2WQ8A 2ZBJA 4MLOA 1W8UA 5A3LA 4KBBA 1WW5A 4ZKTB 2HWE2 4K7JA 2XJQA 1FMD3 3AYCA 1WWYA 1H2NA 4TLGA 3POIA 2A3YA 3FLPA 1E5IA 3MW2A 3PUIA 1H2LA 3PTYA 4Y1XA 1BEV2 2BDRA 2KM2A 1MS5A 3ZSJA 2NYYA 4NPRA 3ZM8A 3VBOA 1WLDA 2X5IC 5CKQA 4V2VA 4AVSA 1OA2A 5KXBA 1ZX5A 1VBC2 4GWNA 2P34A 1Y4WA 4JGYC 4QPGC 4CP0A 1AX1A 1H8TA 3ZFGB 1RUG2 2YBPA 2J22A 1RUNA 4UYBA 4XJZA 1FYUA 5FZ3A 2BW8A 3MFAA 2WZR1 2RHPA 1UF2C 3LD8A 2YDEA 4I01A 4FPLA 4K8RB 3D8CA 3C8XA 4IE5A 3BODA 1WD3A 4UF0A 5FMCA 5DUWA 2XVLA 5A32B 2GZWA 1V9U1 1XNDA 2W94A 1GQPA 5GLVA 2ZGPA 5FWJA 1RMU2 5AC92 2GAUA 4Q0PA 2JD4A 2R042 3ACIA 3AMPA 3T1MA 3P3PA 3SMHA 1HJGA 2CGNA 3D3AA 2OXBA 5ACA1 3KVAA 3LA7A 1ND3A 1XC6A 4OUMA 3ZFFB 3W58A 1AR93 3AMNA 3K3NA 3V0BA 4KGGA 4KWLA 1OLRA 3HD8B 4NHLA 4RD7A 3ZPYA 3RJ2X 1VBA3 4M4RA 1MQTC 5K7PA 4AOCA 3GXUA 2E63A 4JKLA 4YFZA 1LHNA 3EHKA 5CFCB 4QMAA 4JC1A 2WN3A 3RZLA 1A34A 4FOVA 2ADDA 4GH4C 5EJ3A 1KEXA 1U12A 1W6OA 2JDUA 4IV3C 3W9AA 1MEC3 5D21A 3ST7A 3DECA 1LOFC 4YM0A 1CAUA 3D6EA 4M0NA 4DB5A 2P3KA 2V72A 3P3NA 2W68A 3HOBA 2VNVA 5C70A 1VRH2 4QU2A 1SFYA 2DDUA 4XFHA 4XUPA 3DPRA 3PUSA 4OHVA 3LPFA 2EICA 5FUNA 3VKNA 4COWA 2WO7A 3EMRA 4IEZA 3V0AB 1QF3A 5FLHA 3P6BA 4MO3M 3GBWA 2YUEA 3THDA 1JYNA 2VMGA 3NNJA 3OGRA 5BNPA 2CAVA 2VMDA 2ZGOA 3BTXA 4EZHA 1ALYA 4N43B 4L11A 4CP9A 2J1SA 5D8AB 2WWSA 3D0SA 5BXXA 3A0KA 4A2UA 1CWPA 2MEV1 4A4AA 4WZFA 3KV5A 4XCBA 1RUD1 1JYIA 5DG1A 4FO9A 4NMIA 4N9HA 2Y33A 5DUXA 4NPMA 1PO11 2Q1ZB 4Z2AA 2K46A 1V6IA 1UWWA 1Z7S1 4NVPA 1HRI1 1NKGA 4DEQA 2QQIA 1JZ4A 1XNBA 2VCCA 4COVA 2PHTA 1YI9A 3OJBA 4JRAA 5IK5A 1VBE2 4OYUA 2G9GA 2Z69A 3KWVA 3N9OA 2HWC3 4CZSA 4NPLA 4YWAA 4P5YA 3FMGA 1QQP3 4RYDA 3UKVA 2AREA 4FFFA 3AC0A 5I8YA 2UWBA 1REEA 5DAVA 4LO6B 1CQ9A 3N7LA 4HKLA 2YC2A 4LO5B 4E4HA 1F9KA 1US3A 2GNMA 1F5FA 2GH8A 4QM9A 2VL4A 1ZBA3 3AFGA 4FI9A 3VDAA 3RZKA 4PLOA 1RUE1 3RJRA 4WVVA 5IVBA 2EAKA 1F4AA 2P3JA 3Q8AA 3ELNA 5F32A 5K0UC 1S55A 1DQ1A 1TG7A 1WBFA 5LATA 3WINE 1UAIA 4OZXA 2VOKA 4XURA 2B9VA 1SHWB 1LJ7A 2LALA 5JAXA 4XF9A 2VMHA 3JBG3 3B94A 4MOAA 3WXPA 2O0OA 3AP6A 1LRHA 1DZRA 1JTZX 2FMYA 3DXUA 3SC7X 2VUAA 3J26N 2VO5A 3J8F1 3W21A 4HFSA 4RHV3 2QDNA 2D97A 2XDVA 1L3JA 4IGOA 4XIKA 1ENXA 4IE4A 4L9BA 5GM0A 4CUAA 3KHCA 4BXSV 1D0HA 4ORFA 1AXKA 3L2HA 5E1RA 2L9LA 2H6CA 4JKMA 4LUMA 2ADEA 1G9AA 2A73B 1I5ZA 3FC0A 4Y5TA 1J3RA 4HK9A 4J6GA 5DZFA 1NE6A 1UIKA 1W90A 4ES8A 3Q8EA 2FZ2A 2Z79A 2RS13 1MPXA 2VUJA 2O8QA 2XJSA 3D5OA 3E6BA 4LUKA 5C8WA 4I30A 2GN3A 1VMHA 3I3BA 4WM8C 1HN0A 1W9TA 4R9BA 1PK6B 5JSOA 1YCIA 2JE7A 4C0BA 3ZXLA 1HXS3 4UW3A 5ABJB 3ZDSA 3ON7A 2E7QA 2GSYA 2FD8A 1YJLA 1J1LA 2JENA 4PDWC 5JI9A 3U78A 3BU0A 3OY8A 3NAPB 5KXEA 4MYEA 1GBGA 2XOMA 2ZMKA 4AFMA 3I49A 2J1TA 4TZDA 1GR3A 1ULOA 3G7DA 2AYHA 4PF5A 4QHZA 1RUF1 2VD7A 3MUY1 5BV6A 1UOGA 1G9CA 2P6CA 4YVWB 4H2AA 3ECQA 3AZXA 3LOBA 5IVCA 4YW7A 4E4DX 4AAPA 1QEXA 1WMEA 1XNAA 2VCBA 1JU4A 1QJX2 1SBFA 3JCIA 5FYYA 1WCDJ 4Q4W1 1LENA 5BNQA 4FT8A 4MGTA 3KLSA 1OOPB 4NUBA 1JI6A 3IPVB 2HWF3 1NAEA 3VLBB 3VHOA 2XUMA 3HT2A 2QFEA 3H8XA 5IAVA 4XXPA 2WNEA 3N9MA 3R4DB 3IWZA 1NE4A 1TMF2 5FFOC 3OGSA 1PMHX 3WW4A 4BDVB 1PVC3 3I3MA 1PX3A 5HCBA 1V6NA 4GB33 1ENSA 1UZVA 1K5MC 3VKLA 5JMOA 4M00A 1H2MA 2YU1A 2R6QA 5C4WB 3VBFA 5FXWA 2DVDA 3T30A 2HWB2 4NN0A 3M3OA 4BM8A 5LW9A 3W5NA 1AF9A 1B09A 4AFCA 4TN7A 2WBKA 2O14A 4BIFA 3ZIXA 4CA9A 2WDBA 1SDDB 3NJXA 2J1UA 4QXKA 2P3IA 3HNYM 4D8MA 4Y4RA 3C7HA 2OS2A 4LHLA 2NM1A 5FKCA 4QPYA 2XB6C 2JDHA 1AXZA 1UL9A 1PGW2 1VPHA 2DV9A 2VQTA 4XAEA 1W9SA 2R16A 5H9PA 5CAZA 1TME3 5FUPA 4AGRA 4CRQA 1R083 4X6RB 1C4RA 3FFQA 1VE0A 1W6NB 3K4AA 4PT6A 4D3WA 1QJZA 2VZRA 4EN6B 1HN1A 4HPKB 1LU1A 4Y4YA 1K5JA 4FQ4A 4KQ7A 5EJ1B 2YMZA 1AVBA 5LA9A 1QJU1 1XYPA 4LMFA 2IXJA 4QGLA 2R061 1C5IA 4V1PA 4B3NA 5KXCA 1UN1A 1UX7A 2G19A 2GC1A 4QQHA 2Z4FA 3S6PA 5JPNB 2Y34A 1X33A 1JN2P 2XKPA 4LO4B 2K0GA 3BI3A 3RDIA 4CCDA 3RSJA 1FPN3 2A5ZA 3KQ4B 1H1MA 4IE7A 4EN8B 4GMP3 4UFMA 2OT7A 5K9YA 4E2SA 4DXSA 4SLIA 5FP4A 1K45A 1XYOA 1SPPA 1RIRA 2W0XA 2BNMA 4AVVA 2DF7A 3VBSA 3F95A 5C71A 1VAVA 3K75B 1X8EA 2JWPA 4FFGA 4XZPA 2X09A 3JUUA 4Y1ZA 1A78A 3N7JA 4A3ZA 3WG3A 4LT5A 1QXPA 2A6VA 1XE0A 3ZN4A 2WZR2 4LE4A 5J96B 2UU8A 4IERA 2VBBA 1H30A 1O8PA 2VTXA 5F3GA 4AW7A 3RRDA 3C7GA 1RB8G 1WW7A 3NAPA 5DABA 1S2EA 1MS9A 1V9U2 2YC0A 4DZGA 3NJZA 3USSA 3A21A 2Y60A 3VBUC 3VZOA 3M70A 1IS5A 2QZ2A 2WYFA 3Q8BA 1XU1A 1ZRRA 4GWIA 2EIEA 4I3GA 4LITA 1DYPA 2FZ1A 2JDNA 3FX3A 1VJ2A 1DQ2A 3JQWA 1CN1A 5ACA2 4AVAA 5LY1A 4LHSA 4Y26A 2IFRA 1Y9GA 1CAWB 3RMXA 1TNFA 2DU1A 3NJYA 1YI7A 4DXRA 3ME2A 2PAEA 1RUJ3 2RJKA 4JV4A 3AB0A 4ASLA 5FY0A 3NO8A 4BQ2A 1AR73 3FL7A 3HJRA 4R52A 4FFHA 5FY8A 4LORA 2AUYA 4FAHA 3GJAA 3O1PA 1XOYA 2JX9A 2UWCA 3SH4A 2JDKA 4LKDA 5A7PA 3HR9A 1VBD1 3GHMA 5EHDA 5BPXA 3VD5A 1MS8A 3IPVA 4K1ZA 1SFNA 3RZGA 4GMP0 3AXDA 4AYUA 4CCOA 1ULPA 3FBYA 2XHKA 4LO8A 1OPMA 2IWGB 4Y20B 2YU2A 5LRRA 1ULEA 5LCWL 4TSVA 2DCTA 1DGWX 3KHBA 2XBO3 2VAUA 2A71A 1GP6A 4LBKA 4AEJA 4ASMB 2VM9A 4CDXA 2VNGA 4RGAA 1ZRCA 1FNYA 1QJY3 3JD73 3P1IA 4MXWA 4E27A 3WQ7A 4AFDA 4CEYB 5F3EA 1Q5OA 1FOD1 4ASKA 1CAVA 2RDSA 4COUA 1GWKA 5JOXA 1YEWA 5A6ZA 1Q8QA 3VBRC 3ZFEB 3S0MA 4RQPA 2BBAA 2LS6A 4XW3A 2WFF3 4R9CA 2MEV2 5FZEA 2XJVA 3ZN6B 4QDQA 1RUD2 2EXKA 3KF5A 4QX2A 2VZUA 5FYUA 4PF1A 4C90A 1XPWA 2FCTA 4RS5C 1NXMA 1PO12 1F35A 1LNSA 4B4RA 3PIGA 4EV0A 1Z7S2 3IAPA 2VXRA 1HRI2 2SLIA 2YGMA 3PIJA 4YRDA 4AFAA 5L7OC 1Y7BA 4AL9A 1H4GA 2W1SA 3O1UA 3KT4A 4KG0A 1OQ1A 4GULA 4B8EA 3K46A 3DYOA 2WSVA 3R4SA 5C9AC 1ND2B 1SLTA 4K8FA 2AZ5A 3MIGA 2VJXA 1NA1C 2QKDA 3MLLA 2D3PA 3OEBA 2PYTA 1RUE2 1ZZ8A 4L8QA 1KXGA 4YGBA 1VRBA 4IV1B 2VQAA 2R49A 3WLUA 3PJQA 4LK6A 1OC1A 1XE8A 3TN93 1N1VA 1OF4A 2J1EA 2MNGA 2C9KA 4AGVA 1B35A 4CDWA 4LBQB 3H1YA 4XUQA 1STMA 3C7OA 2JE8A 5JIUA 5C3OA 2VOXA 3J8F2 3T2OA 4LBQD 2EALA 3BIWE 4XVHA 1D4VB 1GICA 2GMPA 2J1VA 2JEMA 2V09A 4LULA 1G9BA 2FDFA 4BIOA 2CWMA 2Q8CA 2ET1A 1QQP1 1UZWA 5FMOL 1GZCA 1NZCA 3AKQA 5FZMA 3VBHB 5LBBA 3KV9A 4CDUC 3VDDC 5C3PA 1YIFA 3WW2A 1Y9QA 5FZ7A 5FYTA 1W0OA 2FCUA 1SLAA 5DG2A 3LGRA 5EZWA 3K3OA 4QHOA 3CDZB 3EYPA 5KR7A 2JDMA 1QHDA 2CY6A 1BMV1 3WY6A 4QB6A 1W8NA 4CXYA 5FOJB 3SQOA 5J3UA 1S1AA 3AYDA 1ENRA 1CONA 4YW3A 5FZBA 3SH3A 2CGOA 4ZS2A 3ES4A 1MZ5A 3ZMNA 3O1OA 2R0FA 5FY1A 1WMDA 3GHNA 3SXWA 3TRSB 1UD1A 2PQSA 1YIPA 2WAAA 1KITA 2NMOA 2P3YA 3WP5A 2W5FA 2UWAA 3QH7A 4BU2A 4CU9A 3C7EA 1BVVA 2ZA9A 3IDAA 3WNOA 1LEDA 1JHNA 2BUKA 3V56A 2VTFA 4QQOA 2RS51 1RUC3 2FDJA 5FV3A 3BUCA 5FY7A 4B7EA 5J48A 1NOVA 3SCGA 1RUF2 1U5ZA 2DYCA 4HMZA 2JDZA 2ZEYA 4LTAA 1U0AA 1RUI2 3RYPA 1VP6A 2C4XA 5DDJ3 3GM8A 1QMJA 4HOOA 3VZKA 1UY4A 3JU9A 4YFWA 4QU1A 3OUIA 1LCLA 2ATFA 2WNVA 4CEYA 1GZWA 5FAXA 1JYTA 2Y6JA 5BNOA 2Q30A 3AP5A 4Q4W2 4PBPA 4CUGA 1POV3 2H0BA 3QCWA 1R1A3 1W6MA 2NP0A 3AMHA 1MVQA 4AE2A 3VZMA 3O0XA 4M0HA 4JHTA 2XHNA 2JG9A 1S0BA 1DYKA 2JDYA 2W9XA 4BH9A 1PX4A 1UY1A 4AG4A 3TEXA 4WVZA 1IPSA 3GNEA 1JZ5A 1IS3A 4HVOA 5CFDC 4FP3A 5C3QA 5F7UA 1F8VA 3AP4A 1LOBA 4BJ0A 3GZUC 1E5HA 1QNWA 2W52A 2ZKNA 2EA7A 3B00A 4U2AA 1D7PM 2WNUA 1VMFA 3ZYJB 3CLPA 3PVOA 1YFYA 3N7MA 1UOBA 1JS9A 4MGIE 4XACA 3ZN5A 3T08A 3I97A 1SBEA 4WM7C 4XE9A 5FYMA 4Q4V1 4N53C 2ZX3A 1GZTA 4G9SB 1HB2A 3VBOB 1NT0A 2CV6A 1NUKA 4YVSB 4JGZC 4L99A 2A6ZA 3BPZA 5EIYB 3K77A 3F2ZA 4C0HA 1HX6A 1RUH3 2ZGMA 1SEFA 2HWF1 3ZYBA 1CZTA 2J42A 1JYCA 2OA2A 2Z42A 4CEWA 1X9TA 4XFBA 3WCSA 5A70A 1WLWA 3LE0A 4LBQA 5FPAA 5EXOA 3RYKA 4A7YA 2WO3A 1K3IA 2Y6KA 4GB31 2ES3A 3SHRA 5M0TA 3UV9A 1LKNA 5CA6A 2NPIA 2BFUL 3D82A 1OA4A 1QJU2 3LIGA 4AI9A 2R062 4QX1A 1POV0 1AR63 3DUIA 1CIWA 1W9YA 3JZVA 3VD4A 4BQXA 3S57A 3A0NA 4XJWA 1WGPA 2DVBA 5IFPA 2VVFA 1DYOA 3RI8A 5A3MA 3B93A 2RVAA 3HBKA 4XMAA 1ND3B 4YGCA 5F9TA 4A6SA 3V0BB 1OSGA 1JU3A 1PO23 2JJ6A 2WQZC 2B4KA 3CZUA 2RMU1 4IGQA 1W03A 3J4UH 2LRPA 3M3CA 5HXVA 1LOEA 5FUIA 5FYCA 3ZXKA 2JG8C 1CIYA 1Q8OA 2JKBA 1XNKA 3MV01 2CU5A 1J59A 3RZJA 1RC6A 4FPGA 3ZVXA 1OLMA 2P37A 2YPDA 1NZIA 3FHAA 1FV2A 4XEZA 4A3XA 1AYM3 1W6OB 2CSGA 4FFIA 2PFWA 2X5IA 4QPIC 3LDRA 3SCFA 1S4CA 2X53S 1G9DA 4NHYA 2PAMA 4XDOA 1GSLA 5EWSA 3SLIA 1JZ3A 4JGYA 4QPGA 4QXCA 1T6BX 3KB5A 1TMF1 4XFAA 1O4ZA 1GNYA 1GOFA 5FZLA 3OBZA 5JOWA 2R1BA 3R0RA 4NWVA 5DUVA 1N3PA 4QT6A 1UU6A 2C9AA 1ULDA 3M1HA 5JOZA 2HBTA 2ZX0A 4DY3A 2BJSA 4COZA 3FLTA 5KHGA 5F3IA 3AXEA 2Y6LA 2CAUA 3TEWA 3WF4A 4PQQA 3Q9OA 1RHI1 2FMDA 1UU5A 3PURA 2Y64A 2VU9A 2ZTNA 2Q8OA 1IHMA 1AYN1 3C3VA 4LBLA 4CP9B 4HVRA 1G6NA 1VBD2 1W2TA 2ZHLA 3CMGA 1OVSA 1YLLA 3R05A 2DVFA 4YW6A 1LR5A 1OURA 3E6CC 1ULCA 2VMEA 3OD0A 4DS0A 1MQTA 5A7QA 2WL1A 5FP3A 1WD4A 1JXNA 3H3LA 3UGHA 5FMBA 1JYVA 1C1FA 3I3EA 5ANQA 5DMYA 5I0DA 4Q0SA 5IW0A 3ZSKA 3POSA 1FX5A 1C8M1 1VIWB 4WBBA 3VZJA 4QX8A 4CDQC 2ZGQA 2YFUA 4GH4A 4Q29A 1ZYBA 1EPWA 3ZSLA 4Z1VA 4YZ5A 1NXD1 1RUJ1 1ZNPA 3I2FA 5G04L 2P6HA 3FHIB 4MGSA 4EN0A 5APAA 2WC2A 1LOFA 1NCQC 4OMDA 3N9QA 1ENQA 1CJDA 1SLCA 1FOD2 2OIIA 2ZGSA 3Q8CA 4QB1A 1L7LA 1VMJA 5FK7A 5SV8A 1U5XA 1W04A 3V64A 4TWTA 4YVSA 3KCCA 1HV0A 4XMIA 1ZBE3 3ZYGA 2EAAA 3IDCB 3IDBB 1KFUL 4XIOA 3OB8A 4YZ2A 4YGDA 2XGXA 4GWJA 5J98B 3ZYIB 3UYJA 4OLLA 2D5FA 1W8ZA 1O91A 4CYDA 4AEDB 1WCQA 3LFIA 4AQ6A 2XBO1 1OI6A 4D7YA 1JZ6A 1EUUA 2R32A 5EYXA 2XL9A 3AYEA 3M8LA 4AXOA 2ZHMA 4M01A 5E6HA 1BVP1 1O3QA 4MVTA 1QJY1 2AC1A 3VZLA 4HETA 3WQBA 3JD71 3ROUA 1W2OA 5L19A 1W2AX 4XJ9A 2GP3A 3PVNA 1ZZCA 2I45A 3IMNA 1LGNA 1W6PB 1WCUA 3FUOA 4CPBD 1W39A 3KCXA 3BGAA 2D5HA 4XBQA 1UMHA 4YARA 1W05A 2V73A 1AJKA 1UY2A 3BB6A 3DYMA 3ZYPA 3N3HA 3MPPG 2AACA 4FCAA 2BQPA 4QAWA 4R4ZA 1WLCA 1M06G 3M3QA 1W9WA 4DNYA 1KRIA 3MICA 4A44A 2DCZA 2HWC2 4LBNA 2Q1MA 3GDBA 3OY8B 1OD5A 4JZRA 1QQP2 1XQNA 2HWE3 2P4EA 3AKTA 4Q8LA 5I93A 4OZOA 4Q4Y1 5LASA 2B42B 1KS5A 2ID4A 2H0VA 1O3RA 3LWCA 1MZ6A 1NCRC 2OZJA 1EUTA 1XXNA 1ZBA2 3KGZA 3GYDA 5FLIA 5I8SA 1FNZA 2H6BA 2GC2A 2IUWA 2NQYA 4OULA 3RMYA 3N36A 5CKNA 2VZTA 4KU7A 3OBTA 4N7UA 3POBA 4E4SA 1QJEA 2BWAA 5IVYA 1BMV2 5JR7B 5H9QA 1O6UA 3TN91 3U4SA 2BGOA 2O1QA 5F5QA 1NLRA 1DP0A 2O8OA 1XRUA 4BOWA 4DINB 1VBC3 1UZYA 2ZS6B 4AQSA 4LLOA 1EAH3 4D6SA 3ZKUA 1PVXA 2RM23 4DXZA 5B2GB 1HLCA 4JDOA 2JB8A 2WABA 5KC6A 2D3RA 2W87A 4GZ9A 1N1SA 1W06A 4XQ4A 5FPUA 4BB3A 2D98A 5FPXA 5JCTA 2RS52 1H8TC 2VW0A 1PNGA 3IB3A 4J1WA 3ZPOA 2DBNA 2WRAA 2JICA 1BXHA 3OPTA 1ASJ1 1I5PA 1WA4A 4IE6A 1RMU3 4ZU5A 4RL7A 2D6LX 4DRRA 1MVEA 2R043 2DVGA 2LM3A 4OHWA 4PIYA 2PLV1 3LEGA 3VBFB 4LA2A 4DXTA 1UYZA 4AI2A 2QVSB 5F3CA 1JOBA 3CL1A 3O1TA 5C8CC 4PDWA 3NNLA 1LGCA 1Q8SA 5LEJA 2QCSB 2Y26A 3OSDA 5FPZA 2WZ8A 4TXWA 1NG0A 2C26A 4XDPA 4YG6A 3AL6A 4EYUA 4ONUA 4QXHA 2OUHA 4AHWA 1QWRA 3CJIC 4BK4A 2X29A 4N8MA 3VHPA 1LGBA 3T0BA 1LOCA 5B4NA 2XONA 4R8HA 2WUHA 1W9FA 2YZ4A 4GA9A 1GOHA 2RR11 4AGGA 3EQEA 2VCMA 5A33A 3WCRA 4CCEA 1D0GA 1RUC1 1YFWA 4W4ZA 5CFCC 1ZZ7A 3WQ0A 3TEZA 2XVKA 1OH4A 1ONAA 2D6MA 4AEDA 4DQAA 1ZRFA 1QOTA 1IKPA 1F2NA 1C8NA 4FVVA 3H1WA 4KH9A 4YM1A 2VZQA 3MFCA 2HWD3 3HWJA 1HJFA 5LBCA 2ERFA 3CZJA 5IUQA 5E8AA 4D6RA 5FMDA 5A3UA 2VBDA 4Q2FA 2DUQA 5SV5A 1CESA 1MR5A 3VGIA 2IXCA 2VECA 4XPVA 5FP9A 5HCHA 3LEMA 3CNAA 3U75A 3ZXFA 4CPBA 2F6BA 5GZFA 4Q4V2 4IETA 5LA2A 5LA1A 3CF6E 2OUJA 3OBAA 3HN3A 4FPYA 1W6PA 4CE8A 4LBMA 4OHYA 4IEOA 5IVVA 2FCVA 2VG9A 1SPPB 3DPRC 2WFPA 3UT0A 2HWF2 3USUA 3VBSB 1REDA 2RS31 2JB4A 1UYYA 2QQMA 5BNNB 3WX5A 5AFEA 1ZM1A 2VULA 5BNPC 4HLTA 3GBFA 1EV13 3S7EA 2ZX1A 3RPQA 4DUXA 3PDQA 4GB32 2W1QA 4XF3A 3X29B 5BUVA 5JDBA 2QTWB 5F5CA 2ZGTA 3H50A 3VZNA 1C28A 4CSWA 1VBE3 3FWEA 4UF0B 1W99A 3AZVA 4HBNA 4PLNA 1DIWA 4Q26A 1I6XA 4UFJA 4XXAA 5DZEA 5F5AA 2DUOA 1GNHA 3GZEA 5FIXA 3SNMA 2E51A 3WQ1A 3NW4A 2BRTA 1UQXA 1UYPA 2OQ7A 4XF1A 4LKFA 2W39A 4AAXA 3I2KA 4AHZA 1RUI1 2QQLA 1RUH1 2ZHNA 2RMU2 4L97A 5AVAA 4P02B 3BN6A 1AHSA 2X05A 2YG0A 4XETA 1YYNA 1JZ8A 2FBEA 5IJRA 2D6KA 3NNMA 4N7IA 4QB2A 1DF0A 1GFF2 5C33A 3C2UA 3WNPA 4YW4A 1RITA 3SITA 5T50A 2R7EB 1QOSA 3U1XA 1HW5A 2A1XA 3TNQA 3UJQA 3ZYHA 4QM8A 2DU0A 4RN5A 4BYYA 2W46A 4UW6A 3AMQA 4MHRA 4F3JA 3ZFGC 1W28A 4AI3A 5A1AA 1TVGA 2UYBA 2AENA 1WCKA 1MS3A 3O12A 4MHUA 4CCCA 2GMEA 1FPN2 1BZWA 2ZX4A 4PIXA 3POGA 2JKXA 1AL0G 1PO21 1DQ4A 3HEIA 4MGYE 5FP8A 2WQ4A 4CDXB 2CGPA 3L2YA 3WSOA 3I7DA 4I0WB 4AHYA 4AVCA 5FY9A 2QE3A 5IK7A 1ODMA 1NQJA 3SKJE 4MXWB 4YPJA 4YM2A 3VD7A 1LULA 3LSDA 4JDMA 1IZ3A 1CVNA 1SACA 4KI5M 2PN5A 1OFSA 3IIAA 1RHI2 1CAVB 2TUNA 2DCYA 1AYM1 4QKDA 5LY2A 3VBUA 3RZHA 4DO0A 5JZGA 1A8MA 2VOWA 1AYN2 3ZFFC 5HV0A 2WKKA 1J1TA 4RQPB 4BE3A 2RJLA 2BWCA 3ZR5A 4DMIA 1SDWA 4GAZA 1XB9A 5CNAA 2J1RA 4LKEA 1O5LA 5DAQA 3WF0A 3EB7A 4JCKA 4NROA 4KU8A 4OHXA 2E7AA 5C5UA 2Y8KA 4GKYA 1C8M2 1V6KA 3RS6A 3CIHA 4BMBA 1R093 2WZEA 3KZ4C 5T5OA 3S5QA 2DFCA 4BXFA 1NYWA 1RUJ2 2ZGNA 3EXUA 4LXLA 4EZ4A 1GZ9A 1UZ0A 4PI2A 2CDPA 5JLVA 1WMFA 5G05L 1KDMA 5FMOS 3WUCA 3UESA 5A7WA 3VD9A 5FP7A 1PIV1 1U5YA 2XPJA 1WBLA 3FN9A 2YGLA 3U0ZA 1AL21 1QJX3 1Y3TA 2DCKA 2D6PA 1WW4A 3DGTA 5CEHA 4K1YA 2RG4A 4IEUA 4LBOA 3TYJA 1PGL1 3FE5A 4YLZA 1NY71 3AKPA 3VHNA 5BNNA 5FZ6A 1B35B 4CDWB 3VKMA 5J36A 2YV8A 3WNXA 4XQWA 5FPBA 3HAGA 2XBO2 4N9IA 5FJKA 2VMCA 1IOAA 1WA6X 4FXKB 1FMD1 1PZ8A 2Z5WA 2ZEZA 2C6SA 3MW4A 4BWOA 4IDZA 4E8CA 1O5UA 4N43C 5KXDA 4ZXEA 4WZCA 5D8AC 1VB2A 4QX3A 4FBFA 1QJY2 3VBRA 4CXXA 4XJ8A 3AK0A 3ZXEA 3JD72 4AF9A 2ZGKA 1VBB3 2RJ2A 4F8AA 3WNMA 5I91A 2XJTA 1QDCA 3GZTB 3LPGA 2HWB3 3MI8A 3W5MA 2WT0A 4O65A 2JE9A 5D1IA 2XWJB 4RS5A 5FZ1A 1ZBE1 5A7OA 2V4AA 2Q4SA 2IXKA 4JTOA 5L7OA 2XG3A 4XFCA 5EPAA 3VBFC 4JKKA 4EWAA 2OPKA 1XBFA 1H6XA 1E57A 5FYSA 5JPMB 3SEPA 2VTXJ 4BK5A 3ZIWA 2E53A 3KF3A 4D7SA 2FDIA 1EYBA 4XBNA 4BZ4A 5JVVA 3AJYA 2FQPA 1URXA 1AX0A 3RQ0A 4JX0A 3VKOA 1QXJA 1NA1A 1RINA 2GDFA 4NIHA 1GP5A 3ACLA 3DN7A 5KWRA 5FZHA 3JB4C 4Q4Y2 3U14A 3JXSA 3BYWA 5A80A 4LNVA 2D44A 2HBUA 3CEWA 4M3CA 4UFLA 1BBT3 5FZCA 1ZREA 1AR91 1H1AA 2XJUA 1UKGA 4JHZA 4B1MA 3QACA 4OCTA 3K48A 4YSFA 3PUHA 5CISA 1QH6A 1VBA1 2FDKA 4QXBA 5CU1A 3WW1A 2C0ZA 4RR3A 3TN92 1OUXA 1CX4A 1DDLA 1NX9A 5J1XA 2D93A 2WNVB 4P9GA 1GZWB 2PELA 3THPA 4CDUA 4NO4A 4Z92B 5BNOB 1SG3A 1L7QA 1IS6A 1P8JA 1S0FA 2PHRA 3RI9A 1DU3D 3VDDA 1MEC1 4QX0A 5FO9B 1W6MB 2BEOA 1LODA 4GKXA 1H9PA 1I9RA 1QGLA 5FREA 2VR4A 5B4XA 2WZR3 2JG9B 2LTNA 3WDTA 1D4M3 3KSCA 5FZFA 2C24A 2HEYF 2TEPA 2ZOEB 1PMIA 3ZYFA 4HVQA 2PHLA 4U36A 2WSUA 5FJHA 5BY5A 2WIIB 1PK6C 1YO8A 5DN2A 1SCSA 3PVEA 3QOPA 4Z8BA 5JUVA 1ASJ2 3BTYA 2WZPP 1HRV3 3T1LA 5ABJC 5J7MA 3WNKA 1JZ7A 5IYYA 3MO4A 2V5YA 3GALA 2XLFA 2YFZA 2IC1A 2VZPA 2PLV2 3QBQA 3WT3A 2MPFA 2VVEA 4EWDA 5ACA3 5LWBA 2BV4A 2WNUB 3NAPC 2BFUS 3NQHA 4HONA 4Y22B 3NJVA 4NRPA 4DPNA 3KV6A 4HXCA 4LK7A 2JDAA 4FPOB 1EAH1 5EYYA 1OUSA 1GWMA 2BOJA 5FQ0A 3ABZA 2P17A 3MF9A 4DUVA 2ORZA 2X10A
chains in the Genus database with same CATH topology
2VD7A 3K3OA 5FXVA 4GD4A 3OPWA 2OQ6A 5KR7A 5CEHA 5LY1A 5IVCA 5IVVA 4IGQA 5FXXA 4BISA 4AAPA 3N9LA 3PUSA 5ISLA 5FUNA 3NJYA 5F39A 5FYCA 4Y33A 4URAA 5FWEA 5FZ6A 5FZBA 5FZ0A 2YBSA 5FY0A 5FPBA 2YPDA 5FJKA 2WWUA 5FYYA 5FY1A 5FY8A 3PDQA 4LIUA 4CCLA 4EZHA 2GP5A 5A3WA 4BU2A 3AVRA 2WWJA 5F5CA 5A7PA 4NUBA 4CSWA 3PU8A 4GJYA 4XDOA 3KV5A 4UF0B 2XMLA 3N9NA 5F2SA 5FV3A 5A7WB 5F5AA 4CCOA 4QXCA 2YU2A 5FY7A 3N9MA 3PUAA 2OQ7A 5FZOA 5FZ1A 5FZLA 5A7OA 5FZ4A 2Q8EA 2YU1A 4CCNA 5IVYA 3KV4A 5FZ9A 5FXWA 3N9OA 3U4SA 5FYBA 5LW9A 4LIVA 4HOOA 5FYSA 5A3TA 5F3IA 4TN7A 4QU1A 5A3PA 2PXJA 5F3EA 4E4HA 4ASKA 4D6SA 3PURA 5FYVA 5F2WA 3PUQA 4Y4RA 4CUGA 5IVBA 2OS2A 4V2VA 4D6QA 5FZDA 5F32A 4CCMA 5FPUA 5FZHA 5FZEA 5FZGA 2YBKA 5FUPA 5K4LA 3RVHA 4QX7A 5FYUA 2XXZA 5F37A 2XUEA 3ZPOA 2YBPA 5A80A 5A7QA 5FP3A 3OPTA 2P5BA 4GJZA 5FYIA 5FZ3A 5FZIA 5FZOB 3K2OA 5FZCA 4CCJA 3AVSA 3DXUA 5ANQA 5IW0A 5A3NA 3LD8A 2W2IA 5FP8A 5IVJA 4QX8A 4QXBA 3DXTA 5FY9A 2XDVA 2Q8DA 3KVBA 5F3CA 4IGOA 5FBJA 5FWJA 3LDBA 3N9QA 5IVEA 5A1LA 4XDPA 5A7NA 5FYMA 5LY2A 3AL6A 4EYUA 5FYHA 4DO0A 5FZKA 4QXHA 3AL5A 3KVAA 2OT7A 3K3NA 4CCKA 1VRBA 5FP4A 3N9PA 4IGPA 4GAZA 3UYJA 5FZFA 3ZLIA 2OX0A 5IWFA 3PTRB 4DIQA 5FJHA 3PU3A 5FPAA 5F5IA 5FPLA 5FY5A 4V2WA 4QWNA 5IVFA 5FZAA 4Y3OA 5FY4A 5F3GA 5E6HA 5FYZA 4AI9A 4D6RA 4BXFA 3U78A 4C8DA 5LWBA 4HONA 2Q8CA 4LXLA 4EZ4A 5FZ8A 5FP9A 5FZMA 3KV6A 5FPVA 3KV9A 5FXZA 4UF0A 2GP3A 5A7WA 4LITA 5FP7A 5FZ7A 5FYTA 5A1FA 5A7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD7 A;  3K3O A;  5FXV A;  4GD4 A;  3OPW A;  2OQ6 A;  5KR7 A;  5CEH A;  5LY1 A;  5IVC A;  5IVV A;  4IGQ A;  5FXX A;  4BIS A;  4AAP A;  3N9L A;  3PUS A;  5ISL A;  5FUN A;  3NJY A;  5F39 A;  5FYC A;  4Y33 A;  4URA A;  5FWE A;  5FZ6 A;  5FZB A;  5FZ0 A;  2YBS A;  5FY0 A;  5FPB A;  2YPD A;  5FJK A;  2WWU A;  5FYY A;  5FY1 A;  5FY8 A;  3PDQ A;  4LIU A;  4CCL A;  4EZH A;  2GP5 A;  5A3W A;  4BU2 A;  3AVR A;  2WWJ A;  5F5C A;  5A7P A;  4NUB A;  4CSW A;  3PU8 A;  4GJY A;  4XDO A;  3KV5 A;  4UF0 B;  2XML A;  3N9N A;  5F2S A;  5FV3 A;  5A7W B;  5F5A A;  4CCO A;  4QXC A;  2YU2 A;  5FY7 A;  3N9M A;  3PUA A;  2OQ7 A;  5FZO A;  5FZ1 A;  5FZL A;  5A7O A;  5FZ4 A;  2Q8E A;  2YU1 A;  4CCN A;  5IVY A;  3KV4 A;  5FZ9 A;  5FXW A;  3N9O A;  3U4S A;  5FYB A;  5LW9 A;  4LIV A;  4HOO A;  5FYS A;  5A3T A;  5F3I A;  4TN7 A;  4QU1 A;  5A3P A;  2PXJ A;  5F3E A;  4E4H A;  4ASK A;  4D6S A;  3PUR A;  5FYV A;  5F2W A;  3PUQ A;  4Y4R A;  4CUG A;  5IVB A;  2OS2 A;  4V2V A;  4D6Q A;  5FZD A;  5F32 A;  4CCM A;  5FPU A;  5FZH A;  5FZE A;  5FZG A;  2YBK A;  5FUP A;  5K4L A;  3RVH A;  4QX7 A;  5FYU A;  2XXZ A;  5F37 A;  2XUE A;  3ZPO A;  2YBP A;  5A80 A;  5A7Q A;  5FP3 A;  3OPT A;  2P5B A;  4GJZ A;  5FYI A;  5FZ3 A;  5FZI A;  5FZO B;  3K2O A;  5FZC A;  4CCJ A;  3AVS A;  3DXU A;  5ANQ A;  5IW0 A;  5A3N A;  3LD8 A;  2W2I A;  5FP8 A;  5IVJ A;  4QX8 A;  4QXB A;  3DXT A;  5FY9 A;  2XDV A;  2Q8D A;  3KVB A;  5F3C A;  4IGO A;  5FBJ A;  5FWJ A;  3LDB A;  3N9Q A;  5IVE A;  5A1L A;  4XDP A;  5A7N A;  5FYM A;  5LY2 A;  3AL6 A;  4EYU A;  5FYH A;  4DO0 A;  5FZK A;  4QXH A;  3AL5 A;  3KVA A;  2OT7 A;  3K3N A;  4CCK A;  1VRB A;  5FP4 A;  3N9P A;  4IGP A;  4GAZ A;  3UYJ A;  5FZF A;  3ZLI A;  2OX0 A;  5IWF A;  3PTR B;  4DIQ A;  5FJH A;  3PU3 A;  5FPA A;  5F5I A;  5FPL A;  5FY5 A;  4V2W A;  4QWN A;  5IVF A;  5FZA A;  4Y3O A;  5FY4 A;  5F3G A;  5E6H A;  5FYZ A;  4AI9 A;  4D6R A;  4BXF A;  3U78 A;  4C8D A;  5LWB A;  4HON A;  2Q8C A;  4LXL A;  4EZ4 A;  5FZ8 A;  5FP9 A;  5FZM A;  3KV6 A;  5FPV A;  3KV9 A;  5FXZ A;  4UF0 A;  2GP3 A;  5A7W A;  4LIT A;  5FP7 A;  5FZ7 A;  5FYT A;  5A1F A;  5A7S A; 
#chains in the Genus database with same CATH topology
 4YVW C;  4Q4X 3;  4BPZ A;  3GJB A;  3I8T A;  3KQR A;  3UKT A;  3B9I A;  1ODN A;  4UXA A;  2BZD A;  2ZEX A;  3PMS A;  4HSL A;  4A41 A;  3ETP A;  2RR1 2;  4S2D A;  5JSR A;  4CEW B;  1M4W A;  1V00 A;  1RUC 2;  2D40 A;  3HQR A;  1S0I A;  4Q1R A;  4URA A;  3IKW A;  2D3S A;  5DAX A;  3WNN A;  2JIG A;  4A7Z A;  1WCS A;  1CR7 A;  3POE A;  4YW5 A;  2ZZQ A;  3MBW A;  2KD7 A;  2W1U A;  3MYX A;  2XWB B;  5GZC A;  3PVB B;  3WD5 A;  4ERO A;  2HWC 1;  4CP1 A;  1OOP C;  2GP5 A;  3AVR A;  4FOW A;  2A7A A;  4RSU A;  1X9P A;  3UKN A;  1S0J A;  2R07 3;  4XF0 A;  3RNS A;  2HH9 A;  2A3X A;  1ZBA 1;  3POJ A;  1ZA7 A;  4XHX A;  4KWJ A;  1DBN A;  1XJA A;  3SKV A;  1R1A 2;  3H0O A;  3KM5 A;  5CFD A;  4NRQ A;  5FZ4 A;  1JOD A;  4MUV A;  5C4W C;  4CTE A;  1D2S A;  1SZB A;  2VE1 A;  4CCN A;  3KT7 A;  2Q1F A;  1C5H A;  2RS3 2;  3JBG 1;  3LDK A;  4LR4 A;  1H4H A;  1RYY A;  3LQC A;  5HCF A;  1AR8 3;  4ET7 A;  4FPC A;  2Q5T A;  4LKS A;  3V65 A;  4ARY A;  1RUD 3;  2HWD 1;  4AWD A;  4RHV 1;  5DAP A;  5F2W A;  3H42 B;  3WHU A;  4WM7 A;  2WS9 3;  4FPK A;  4UFK A;  1PO1 3;  2X5I B;  3E5Q A;  1Z7S 3;  3H3U A;  3ILN A;  1PGS A;  1HRI 3;  4JGZ A;  4NIA A;  5HBA A;  4L0P A;  1CZS A;  1KJR A;  4OVE A;  4BQY A;  4FTB A;  2NLR A;  5FZG A;  4JGY B;  4GQ7 A;  4QPG B;  5F37 A;  4QD2 A;  2YHJ A;  1PM7 A;  4E2Q A;  3K2O A;  4MX3 A;  2VUC A;  1ST8 A;  2OKX A;  4BQ4 A;  1G7Y A;  2K9Z A;  2KA3 A;  2RS1 1;  1RUH 2;  2W2I A;  4R4X A;  4CUB A;  2WYS A;  4IEP A;  5LA0 A;  2OZ6 A;  2XR4 A;  1RUE 3;  1XNC A;  3ILR A;  1G9F A;  2ILM A;  5L9B A;  4L92 A;  4SBV A;  4ZZ5 A;  3T2T A;  1U5I A;  1HXS 1;  5JR2 A;  2PA7 A;  1KGY A;  4XF4 A;  3RFR A;  1EV1 1;  4UFH A;  5JMC A;  3ALQ A;  4JRL A;  3H3Z A;  2UY8 A;  3T2Q A;  2GNB A;  4K9S A;  3EJK A;  2W95 A;  4CCK A;  1GLH A;  2VZV A;  5J37 A;  2VNR A;  4AI8 A;  2VXJ A;  3T2P A;  3FJS A;  1UO9 A;  1MQT B;  2Q0A A;  3THT A;  4LQR A;  2VOT A;  4I09 A;  3E6D A;  2HYK A;  3WG4 A;  1IG0 A;  1F5J A;  1WZX A;  1XYN A;  3J7L A;  1PO2 2;  3LCP A;  4NII A;  1YNA A;  4GH4 B;  1PHM A;  5H9R A;  4IV3 B;  2XKO A;  5FO8 B;  4Y22 A;  2DWR A;  5A3T A;  1HDK A;  3NWK A;  4QPI A;  4QKN A;  2A70 A;  3TEY A;  1N47 A;  4JDN A;  3O14 A;  4LBJ A;  1AYM 2;  1UPS A;  2RDR A;  2ZGR A;  3VDB A;  5FXV A;  3MID A;  4GD4 A;  3HQU A;  4K3U A;  1Y9M A;  4CUC A;  1SBD A;  4HK8 A;  4X8P A;  2B8M A;  4OI4 A;  3N9L A;  1SMV A;  5HXM A;  2CDO A;  2ETE A;  2BGP A;  2BVV A;  4OUE A;  2LUW A;  3AYA A;  4Y33 A;  4C1W A;  3GF6 A;  2IVI B;  1DGW A;  3O5S A;  3ZYR A;  1O8S A;  1I1E A;  4P9I A;  3ACH A;  3AKS A;  1SLB A;  3HVD A;  4TLF A;  5FZ0 A;  5JXH A;  1PVC 1;  1MS0 A;  5FK8 A;  4FAG A;  2Y6G A;  2WT2 A;  4FTS A;  5KHH A;  1W8W A;  3LEI A;  3MPB A;  3GZA A;  4LIU A;  1W8H A;  4WVM B;  4AZZ A;  4IL7 A;  1IPJ A;  4EN9 B;  1JYX A;  1OLM E;  2ZMN A;  4WV8 A;  3MEP A;  5DPN A;  3UNP A;  3HIF A;  3RWK X;  1UXX X;  1BLZ A;  2TNF A;  4HZF A;  4DFS A;  5A6Y A;  1DG6 A;  3NKG A;  4YZ4 A;  4UWD A;  4TYS A;  4COY A;  1PIV 2;  1LEC A;  3NNG A;  4WVW A;  1JUI A;  3BKZ A;  1QH7 A;  4I3P A;  4QQP A;  1AL2 2;  1RVF 3;  3AP7 A;  2EXH A;  4RFR B;  1ZA4 A;  1J3Q A;  1JOP A;  5DAW A;  1TME 1;  3NV4 A;  2Q8E A;  4Q4W 3;  4J25 A;  1PGL 2;  1OXC A;  1R08 1;  2EIG A;  3ES1 A;  3GCX A;  3CO2 A;  1NY7 2;  4G3Y C;  3A4U A;  1WUV A;  4CEY C;  1G86 A;  1PM4 A;  1N3Q A;  1FMD 2;  3O1S A;  2ZX2 A;  1GQG A;  3O1M A;  3ZFE C;  4FP2 A;  3U4X A;  4D6Q A;  3POY A;  1W2N A;  2Z2S B;  2ZGL A;  1A3K A;  3P5B A;  3H9A A;  3WF2 A;  5K0U B;  2Y6F A;  3UET A;  3RVH A;  4F83 A;  5FKB A;  1S0C A;  3JB8 A;  3W59 A;  3OTF A;  1UXZ A;  1Y43 B;  1FPN 1;  4H14 A;  2R1D A;  4Q0Q A;  4GMP 1;  5LZ6 A;  5FZI A;  3W20 A;  3VL9 A;  4BQ5 A;  1ZBE 2;  2OVU A;  3WUD A;  4AFB A;  4AEK A;  2HEV F;  1GP4 A;  1X82 A;  5HV4 A;  2EXJ A;  2VOV A;  3E5U A;  3GGL A;  1OKO A;  2XH6 A;  5ABJ A;  1UU4 A;  2D6N A;  2W3J A;  4ZZ8 A;  2J1A A;  4RGG A;  1JH5 A;  4HAN A;  3WDV A;  4D7T A;  5C6C A;  3S5A A;  5LEK A;  4MGK E;  3E5X A;  1ND2 C;  4XTM A;  1CX1 A;  1LAJ A;  2B39 A;  3OYW B;  2BVB A;  5T54 A;  5FZK A;  3T09 A;  1FT9 A;  1DCS A;  3DCQ A;  4S2F A;  2PHU A;  3MDP A;  4W50 A;  3OEA A;  3WP3 A;  4IV1 C;  1RJ8 A;  2P2K A;  4S2G A;  4XUN A;  2PHD A;  5KC5 A;  3WP4 A;  1POQ A;  1VBB 1;  2ARB A;  3D4K A;  3AM2 A;  4PBO A;  4YZ3 A;  3OG2 A;  4DOU A;  1QJU 3;  4YM3 A;  3WG1 A;  2R06 3;  4DIQ A;  2ZAC A;  1O7F A;  4WM8 B;  4CXW A;  1AR9 2;  5IAT A;  4NHX A;  4S2H A;  1A8D A;  1SLI A;  1VBA 2;  3E97 A;  2WIN B;  2CTV A;  4IV3 A;  1IQA A;  3L9J T;  1S2B A;  1VAK A;  2VZO A;  1QU0 A;  3B9C A;  5AFB A;  3VBH C;  3T0D A;  4PDW B;  4IEW A;  1AR7 1;  1GUI A;  3PHM A;  1CD3 G;  3ZSE A;  2GMM A;  2ZGU A;  1GWL A;  3DYP A;  5FRA A;  4ZHN A;  4ZON A;  5IHR A;  1MEC 2;  3CJX A;  3KD4 A;  1NCR A;  1JW6 A;  3OPZ A;  1COV 3;  1H2K A;  1C1L A;  1LOG A;  2CYF A;  2VVD A;  2ARC A;  3TB0 A;  5A33 B;  4XOG A;  5L9R A;  1VB4 A;  4Z07 A;  3IDE A;  2WR9 A;  4Q0V A;  4B7K A;  5GLW A;  2BNO A;  5LB6 A;  1KS4 A;  1BBT 1;  4CP2 A;  2VMF A;  1EP0 A;  3NRU A;  3S7I A;  3WF1 A;  4BLI A;  1HB4 A;  3LFM A;  2N7G A;  2VCA A;  4WVM A;  2BU9 A;  4UI9 L;  4CCL A;  2ZJC A;  2AH2 A;  2QZ3 A;  5F1R A;  1O3S A;  2K2S A;  2XJP A;  1VLN A;  2BP6 A;  2P1B A;  5A3W A;  3U07 A;  4E8D A;  3JQX A;  1Q8P A;  4AEM A;  4KNC A;  4Z82 A;  2XML A;  4O61 A;  1EAH 2;  3B69 A;  1TE1 B;  3M4F A;  3OOX A;  1QNY A;  2RM2 2;  1ACC A;  2RV9 A;  5FZO A;  4KMQ A;  1RTV A;  1Z0H A;  3E1F 1;  4A45 A;  3HN1 A;  1OF3 A;  4XFG A;  4F7Z A;  2WFF 1;  3ZO0 B;  1H6Y A;  2CWS A;  1D4M 1;  3USU B;  1K5M B;  3KV4 A;  3FZ3 A;  2V4V A;  3OGG A;  3CKH A;  5H9S A;  5FYB A;  2DUR A;  3POW A;  4AQT A;  1UKR A;  2PAK A;  2PHX A;  3GCW A;  4O9E A;  4NJ4 A;  1VBD 3;  3I59 A;  3ZOI A;  3H8O A;  1VR3 A;  2TBV A;  4AI1 A;  3LAG A;  5C8C A;  1HRV 1;  2PXJ A;  4BLJ A;  4YYO A;  5FYV A;  1VAM A;  3I3Q A;  2ZPX A;  4R9D A;  4YG3 A;  4AK3 A;  1Q56 A;  2EID A;  5EFU A;  3PME A;  1CAX A;  1W6Q A;  3CJI A;  4E4Z A;  2WT1 A;  4FSJ A;  3UJO A;  4TTG A;  5K0U A;  1AXY A;  3ITQ A;  1QKQ A;  2UYA A;  3INA A;  4PI0 A;  5K8S A;  3VUO A;  3AP9 A;  3HBZ A;  3AFK A;  4NID A;  5CFC A;  2P5B A;  5FYI A;  1R64 A;  2ZHK A;  1BEV 3;  1LHO A;  4Q4X 1;  1VAL A;  3BTZ A;  1FOD 3;  2PHW A;  4B29 A;  4I0B A;  4MV2 A;  3CBN A;  3DXT A;  1HB3 A;  1YQ8 A;  3POF A;  5EJZ B;  3DV8 A;  4XCA A;  4HT1 T;  3JBG 2;  4HL0 A;  4IEQ A;  1XSQ A;  5JOY A;  3M2M A;  1ZRD A;  2E9Q A;  4Y1U A;  1JHJ A;  1JBC A;  5IVE A;  3OYW A;  4OFG A;  5A1L A;  1RUG 3;  5A6Q A;  3VBO C;  2HWD 2;  1XE7 A;  2J7M A;  2C5D A;  1SLL A;  4ISR A;  4RHV 2;  3ZX7 A;  1YJK A;  4YVS C;  2E7T A;  2I74 A;  3BAL A;  4OI0 A;  4FOY A;  5DXD A;  5CVR A;  3RZM A;  3KMH A;  2XLA A;  1OMI A;  4DEV A;  5GZG A;  5HCA A;  3J7M A;  1ULG A;  1BKZ A;  1AJO A;  2YPJ A;  1PNF A;  3A23 A;  1RUO A;  3LSE A;  2R07 1;  2D6O X;  2OX0 A;  1PMJ X;  1BK1 A;  1UZZ A;  3H7Y A;  1APN A;  3PU3 A;  4DRV A;  4WM8 A;  2DBI A;  5GAL A;  5AC9 3;  3ZXA C;  4H55 A;  4W65 A;  2VUD A;  4ATE A;  1NLQ A;  3B7M A;  5IVF A;  4P9J A;  1D2Q A;  2RS1 2;  4D94 A;  4UBH A;  3B01 A;  4BQ1 A;  5KHK A;  4ISQ A;  3H8U A;  5FZ8 A;  4UOJ A;  2XVG A;  1AR8 1;  1YFU A;  1W8O A;  1HXS 2;  3VBU B;  4ZU7 A;  1EV1 2;  5JZG B;  2A3W A;  2WS9 1;  1ND3 C;  4Q5O A;  2CNA A;  3OPW A;  3UGG A;  1SCR A;  5J09 A;  3CU7 A;  1A6C A;  1MS1 A;  3VL8 A;  3TBD A;  3WDY A;  5JWP A;  4HG6 B;  4I2O A;  4XYX A;  2VQ0 A;  4UAP A;  1IGO A;  1O59 A;  2A6Y A;  4XAB A;  5L73 A;  4HSJ A;  1US2 A;  3MIE A;  3RG0 A;  5A3O A;  1N3O A;  1SFP A;  4D69 A;  2VQU A;  4IND A;  2WLQ A;  4CU8 A;  5DDJ 1;  4MG2 A;  5GZE A;  1VRH 3;  4NIG A;  1TEI A;  2JEC A;  2G1M A;  3FBM A;  4I02 A;  1J83 A;  3N7K A;  3KGL A;  3EBR A;  4GJY A;  2ZCW A;  5FR3 A;  2D43 A;  4Y5S A;  5A7W B;  5GJ6 A;  1V70 A;  3MIF A;  1POV 1;  3RGB A;  3O0V A;  3OD4 A;  3ZFG A;  3BTA A;  1R1A 1;  2ARX A;  3FLR A;  3WVJ A;  4QGM A;  4LOT A;  2GNT A;  3A22 A;  3WHT A;  2VC9 A;  4LO7 A;  2UUR A;  4LJH A;  4XJU A;  2ARA A;  2VW2 A;  1CPN A;  1DQ5 A;  1H1I A;  1K5M A;  2E33 A;  5FZ9 A;  4IE0 A;  4XAA A;  5D2A A;  2VZS A;  4LIV A;  4FPJ A;  2R0H A;  1UYX A;  4FOQ A;  2VW1 A;  3DKW A;  5A32 A;  4QKB A;  5BYN A;  3SEE A;  4FTE A;  5CG8 A;  3OGJ A;  3RYR A;  4NAO A;  1PVC 2;  1FAY A;  2X8K A;  4D0Q A;  2RS5 3;  4GAL A;  4HN1 A;  3TNP B;  1GU3 A;  2AR6 A;  3AKR A;  3ZFF A;  1RXF A;  2G9F A;  2HKX A;  3B02 A;  4O7X A;  3VBR B;  3ZXJ A;  1GQH A;  3PNA A;  2Y38 A;  3O7O A;  4K21 A;  2YYO A;  4QX7 A;  3UL2 A;  3I54 A;  4ZPI A;  4L2N A;  3DF0 A;  4IEV A;  2DTW A;  4RS5 B;  3IBM A;  4ZS3 A;  5L7O B;  1REF A;  1TME 2;  3ATG A;  5EQU A;  1R08 2;  4RA0 A;  3B5L B;  2B5H A;  3BIE A;  3QH6 A;  4YG0 A;  2HEW F;  3LIH A;  3HQX A;  3D0J A;  1UIJ A;  3PL0 A;  2IFW A;  2I07 B;  5A7N A;  3IMM A;  2DFB A;  5C9A B;  3ORJ A;  1GKB A;  1YC6 1;  5FTT C;  1JOJ A;  1H8V A;  3TAY A;  3VKF C;  2FDG A;  1R09 2;  1NA1 B;  2FHR A;  4I0A A;  2F17 A;  1AR6 1;  4OI2 A;  5GLZ A;  1C3H A;  3NST A;  3S30 A;  2D7F A;  1KFX L;  4IGP A;  5JXG A;  2QQU A;  4URT A;  3ZLI A;  2JDP A;  3ZXG A;  3V0A A;  3M3I A;  1HB1 A;  4AED C;  4W8J A;  3LF7 A;  4P00 B;  4M3C B;  5F5I A;  4UT5 A;  5FY5 A;  1HV1 A;  2I2S A;  1RVF 1;  5E16 A;  1JYW A;  5C3S A;  4XZU G;  2IXL A;  2KXL A;  2BNN A;  1OQD A;  3O0W A;  4Q4V 3;  5IFT A;  4RR3 B;  4NWW A;  4N43 A;  3VN4 A;  3ACG A;  1V6J A;  4ZY9 A;  5D8A A;  1WW6 A;  4O9G A;  3T4H B;  1MS4 A;  4CDU B;  4B4P A;  5E88 A;  5DZG A;  1DQ6 A;  3VDD B;  1F4H A;  1LTE A;  1QXR A;  2E6V A;  5E89 A;  3URF A;  3ZKY A;  3NNF A;  3OCP A;  2F4P A;  2GC0 A;  4IES A;  2A6X A;  2GAL A;  4Y1Y A;  4ES9 A;  3OUH A;  3FFZ A;  5FLJ A;  3QD6 A;  2W92 A;  3H8R A;  4LHN A;  1VBB 2;  3C7F A;  4XJA A;  3AX4 A;  1KQR A;  4HKW A;  4QHB A;  2DUP A;  2XL7 A;  2NZ9 A;  3QLQ A;  4NRM A;  2EF6 A;  2YBS A;  5I0U A;  1ULF A;  1OFN A;  4LEJ A;  2OYZ A;  3T3Y A;  2WWU A;  1RXG A;  2VPV A;  3WEZ A;  5IAX A;  3U37 A;  2RDN A;  2B7Y A;  4IUG A;  5HI0 A;  4IW3 A;  5T5J A;  2XQR A;  1DGR A;  1UX6 A;  3WR0 A;  4MXV A;  4QQ2 A;  1AR7 2;  4ARX A;  4E2G A;  2RMU 3;  3B3Q E;  3IM0 A;  4XUT A;  5F2S A;  1DHK B;  2IVJ A;  5FQ0 B;  3MLJ A;  4QDR A;  3WNL A;  3MUZ 1;  5CAD A;  3PUA A;  3MF6 A;  3MZH A;  1XNT A;  1YRZ A;  2ET7 A;  2WNO A;  1J84 A;  2Y0I A;  3RWN A;  3A7Q A;  2RDQ A;  1LHV A;  4YW2 A;  3PJY A;  1GAN A;  3OF1 A;  4W6X A;  5I0S A;  1G8W A;  3MV1 1;  3H1M A;  1O4Y A;  1RGS A;  1QIQ A;  1YQ5 A;  4XFI A;  1BBT 2;  2QQO A;  4XC9 A;  3ZMO A;  1IPK A;  3MW3 A;  4AR2 A;  1DFQ A;  1H9W A;  4XTP A;  5FDB A;  4XIL A;  1TMF 3;  3SIS A;  1HQN A;  4CU7 A;  1IG3 A;  2VGD A;  5CBL A;  3MGU A;  4Y1V A;  1V0A A;  4AVB A;  5K4L A;  4HN0 A;  2YBK A;  5DQ0 A;  1K42 A;  2ZML A;  2AEY A;  1UOJ A;  4XDQ A;  4JQR A;  3UGF A;  5EP9 A;  2W47 A;  2BGC A;  3TWI A;  4CCJ A;  5I0T A;  1PK6 A;  5GLT A;  4YZ1 A;  5CFD B;  1COV 1;  2QUO A;  1W8F A;  1S0E A;  4P08 A;  5GLU A;  1DLC A;  1OQE A;  1RHI 3;  1TZO A;  2WFF 2;  3AJZ A;  3BU7 A;  4M3C E;  1UW8 A;  4K40 A;  1D4M 2;  4NR1 A;  4R9A A;  3WOG A;  1AYN 3;  4M4P A;  2JD9 A;  4P9L A;  2BPA 2;  4BQW A;  2IZW A;  2YY1 A;  1UMZ A;  2ZAB A;  3APB A;  2VNO A;  4YNI A;  4KBZ A;  1OLQ A;  1HRV 2;  1JUH A;  2QDR A;  5C9A A;  2ZAH A;  4MGZ E;  2G4I A;  4WM7 B;  2QQJ A;  5KBF A;  4N53 B;  4PLM A;  5JSP A;  1UOF A;  1E5R A;  1UPI A;  4BME A;  3WW3 A;  4YVW A;  3J7N A;  4JGZ B;  2ENR A;  2BOI A;  3NV1 A;  1C8M 3;  4QKF A;  1QDO A;  5IK8 A;  3MIH A;  4NHM A;  2IXH A;  3I3D A;  1X50 A;  3PTR B;  4Q0U A;  3K51 A;  4V2W A;  4Q4X 2;  3RZZ A;  2JXA A;  1WMX A;  4MZU A;  2WA4 A;  2ZEW A;  4P14 A;  5FZA A;  2B46 X;  3R4U A;  4Y3O A;  5IK4 A;  2JIJ A;  3I2I A;  5JIA A;  2Y6H A;  4C8D A;  1QY4 A;  4YW1 A;  1OOP A;  3DL3 A;  4PCR A;  5FXZ A;  1W8T A;  3NMB A;  4ITC A;  2QQW A;  4B1L A;  4PHZ A;  1DZQ A;  2XQX A;  4MH0 E;  4LA3 A;  3VDC A;  4QQL A;  5FBZ A;  5I0R A;  3ACF A;  2DCJ A;  1V6L A;  2HWE 1;  1F15 A;  3ZSM A;  5CKM A;  3HPN A;  3VBS C;  5C4W A;  1X8M A;  2GN7 A;  2R07 2;  5JI7 A;  4N90 A;  5BNN C;  4GWM A;  2JG8 B;  1GOG A;  1V9U 3;  3SCH A;  4W6Y A;  5A3N A;  1BEV 1;  2XJR A;  3WV6 A;  1HKD A;  1FV3 A;  4FQZ A;  4H7L A;  2MHF A;  3WDW A;  2WWJ A;  4JVA A;  3AZW A;  1DZT A;  4QPI B;  4FPH A;  1VBC 1;  4K20 A;  1T2X A;  3PU8 A;  4XBL A;  2W91 A;  4RGK A;  1AR8 2;  4DUW A;  2C1F A;  1BK0 A;  1RUG 1;  2CL2 A;  2BER A;  2RM2 1;  1W6N A;  2WS9 2;  4Q8K A;  3MHZ A;  1XSR A;  4UBG A;  2WA3 A;  3IN9 A;  3LA2 A;  4EE2 A;  2BYV E;  2E31 A;  3HT1 A;  2QQN A;  2WN2 A;  4HPK A;  4IEX A;  1DLL A;  1R1Z A;  3LA3 A;  2EXI A;  4MSV A;  5LK5 A;  1K12 A;  1QOO A;  4AI0 A;  2PQQ A;  1RMU 1;  4C91 A;  5AC9 1;  3LKJ A;  3N35 A;  3SH5 A;  2VZ3 A;  5C3R A;  2R04 1;  4Q4Y 3;  1XU2 A;  5KHJ A;  1ZVF A;  3U10 A;  1LES A;  3PUQ A;  1GV9 A;  5DDJ 2;  4JTN A;  3R6S A;  3O1V A;  4FPF A;  5FZD A;  1YQC A;  2YB7 A;  3IZO A;  1LHW A;  1V6O A;  4KWU A;  1IKQ A;  4XHB A;  1OD3 A;  2XXZ A;  2SBA A;  2XUE A;  5GZD A;  5A6X A;  2IXI A;  4LLF A;  5T3N A;  4A7K A;  5LBF A;  4X6Q B;  4CDX C;  2AEZ A;  4K6B A;  5IVJ A;  1YFX A;  5ERL A;  3G6J B;  1YXW A;  3I2J A;  1UY0 A;  1ZRI A;  4CDQ B;  4RR3 C;  4MET A;  3BOP A;  4EWE A;  3T4V A;  3I2O A;  3KCY A;  3KVB A;  4QX5 A;  3BPS A;  4MAD A;  4JQT A;  5FBJ A;  4QGN A;  2MEV 3;  4QPW A;  2F4L A;  4UW5 A;  1KDK A;  4Y5Z 0;  4UFI A;  3ZXD A;  3LEK A;  1NCQ B;  2V5D A;  3LZZ A;  4P5H A;  1LHU A;  2A6W A;  4UW4 A;  1AX2 A;  1OBN A;  1SQ4 A;  1WLT A;  4Y24 A;  5FYH A;  4N53 A;  3T0A A;  3AL5 A;  2B9U A;  4RQP C;  4Q1P A;  3H7J A;  3ENR A;  4IQP A;  1ASJ 3;  1VRH 1;  3DEM A;  4EN7 B;  2ZAA A;  3O1R A;  4YGE A;  3M7A A;  3ILF A;  3OGV A;  1CAW A;  4AQ2 A;  4GIQ A;  3K4Z A;  1YQ6 A;  2PLV 3;  3IT8 A;  2W1W A;  4IXL A;  4LE3 A;  3CHX A;  1T6G C;  4AVT A;  1EPZ A;  1MZE A;  5CIR A;  1UY3 A;  4QWN A;  2B45 X;  2RE9 A;  2E26 A;  5JXI A;  5FY4 A;  3FHQ A;  1YQ2 A;  5L36 A;  4A6O A;  2NMN A;  4X8N A;  1W2U A;  4OHZ A;  2A75 A;  4B4Q A;  5F8P A;  2FDH A;  4M3C F;  2RR1 3;  1BJQ A;  3J9S A;  4KGQ A;  5L9V A;  1W0N A;  3AMM A;  1J58 A;  2PMW B;  4Y20 A;  3OUJ A;  1OHF A;  1IS4 A;  3NVC A;  4P9Y A;  5CYY A;  5ANN A;  4OQ9 A;  1N1Y A;  4J1X A;  2VBP A;  2OQ6 A;  1YHF A;  1AR6 2;  4EJR A;  5C5T A;  2R30 A;  4ZU4 A;  1VBE 1;  3J8F 3;  5FXX A;  2GU9 A;  4BQ3 A;  2JG8 A;  1B35 C;  3OBR A;  3Q8F A;  4CDW C;  1X7N A;  1S2K A;  1DGR N;  5CZK A;  3WZ1 A;  2BTV C;  3GBG A;  1LB2 A;  4E9K A;  2YRO A;  1RVF 2;  4DY5 A;  5CG9 A;  5T52 A;  5KHI A;  3FUQ A;  1GYK A;  2GC3 A;  2GND A;  2VH9 A;  3I2D A;  3WF3 A;  2HYX A;  2LRO A;  1W3V A;  3ZFE A;  3NL1 A;  3ZR6 A;  5T5P A;  3VV1 A;  4PQ9 A;  1CZV A;  2DTY A;  1S0D A;  4BA6 A;  3ZN6 A;  1MZF A;  3N9N A;  5FCC A;  2QJV A;  1YUD A;  4JAA A;  1RJ7 A;  2E32 A;  2RS3 3;  3LB9 A;  5CB7 A;  1O3T A;  1PZ9 A;  5GKA C;  1FXZ A;  1OH3 A;  3HMY A;  1NCR B;  4OMC A;  5T55 A;  4OQ8 A;  3TOJ A;  2ZKL A;  3EO6 A;  5FO7 B;  1TQ5 A;  2WO2 A;  1EY2 A;  1HQL A;  1W0P A;  4NHK A;  5C7G A;  3UK9 A;  4BHP A;  5A3P A;  5LK7 B;  4NAM A;  4XQD A;  1LOA A;  2XLG A;  1CGP A;  2WLP A;  1AUY A;  1ND2 A;  3III A;  1N1T A;  4LPL A;  2OPW A;  3KT1 A;  1JZ2 A;  1RUF 3;  4PJY A;  5F6L B;  4A42 A;  2ZZJ A;  2VMI A;  1CPM A;  4H3W A;  4CCM A;  2Y0O A;  3AZY A;  1RUI 3;  4IV1 A;  5F6K A;  2HJI A;  1WKY A;  2G9Z A;  1Q43 A;  2ZXQ A;  4KWK A;  1BCX A;  4P9X A;  4OI1 A;  1H8T B;  1IQD C;  2QQV A;  4GJZ A;  5FZO B;  3KS7 A;  3AVS A;  3MLK A;  1W3X A;  4C1X A;  2WO1 A;  1BHG A;  1OT5 A;  4XFF A;  3WDU A;  4CDQ A;  2BBV A;  1ZZ9 A;  4Z2W A;  4GXL A;  5TSW A;  5FOB B;  1DGL A;  2Q8D A;  1PZ7 A;  3PLQ A;  3VD3 A;  1BYH A;  2WNV C;  3I59 B;  3VBH A;  5C8C B;  1E5S A;  5BNO C;  1NCQ A;  2CHH A;  3LDB A;  4ATF A;  1YWK A;  4CU6 A;  4CVU A;  1JMU B;  4AHX A;  1NLS A;  1FI2 A;  1OA3 A;  4NE9 A;  2NN8 A;  1Q8V A;  1R09 1;  1ZZB A;  1BQP A;  2QNK A;  3WDX A;  3NKT A;  1C57 A;  1CAX B;  1W6Q B;  3AZZ A;  2JG9 C;  3CJI B;  3U11 A;  3ETQ A;  5I8T A;  2UY9 A;  3K4D A;  4LHK A;  2EIB A;  3J7H A;  1NQD A;  3I2H A;  3N9P A;  2OW4 A;  5HPO A;  1TNR A;  1HQW A;  4FXG B;  4OUS A;  1QJF A;  2PHF A;  5EV7 A;  5IWF A;  5IT6 A;  2QBX A;  1GMM A;  1Q3E A;  1KD7 A;  1QJX 1;  1GNZ A;  5DUU A;  5FPL A;  4ZXK A;  2W08 A;  3CQO A;  3VHR A;  1COV 2;  1UNB A;  3DKQ A;  2PTM A;  3NV2 A;  2VZ1 A;  4LOS A;  2WAO A;  1S0G A;  3BVC A;  3WG2 A;  1CJP A;  3VB9 A;  3MIB A;  2KR2 A;  5FYZ A;  4BCU A;  2WNU C;  2VY0 A;  3I4I A;  3LOI A;  2WJS A;  1J3P A;  1ZZ6 A;  3BCW A;  1FAT A;  4IEY A;  4RFT 0;  2AGS A;  3M3E A;  1CAU B;  5FPV A;  3I2G A;  1V6M A;  1OKQ A;  1RL3 A;  2QQK A;  3ASI A;  2YXS A;  1F31 A;  4PIZ A;  2HLE A;  5A7S A;  1HIX A;  5A1F A;  5JXJ A;  4HKO A;  4QDS A;  3WP6 A;  2LW8 A;  4KG8 A;  4KL1 A;  2QQP A;  1MAC A;  4BIS A;  4CEW C;  1O4T A;  5ISL A;  3DPR B;  5F39 A;  2HWB 1;  3N4M A;  1KJL A;  1OPO A;  1AZD A;  1UMI A;  2DVA A;  5FWE A;  4P9W A;  4NOT A;  4EQV A;  2YC4 A;  1L7R A;  1LEM A;  1Z78 A;  1UCX A;  1H0B A;  3HNB M;  5BNP B;  4G4F A;  1PIV 3;  3THC A;  5AVP A;  4FPE A;  5LBE A;  4W6W A;  1OVP A;  4MGQ A;  1AL2 3;  5JZG C;  2GH2 A;  4Q27 A;  4XUO A;  1PGW 1;  3BOW A;  3IAQ A;  3ZDV A;  1LU2 A;  2EVX A;  4H7M A;  1DQ0 A;  3NV3 A;  1I3H A;  3HNM A;  5LRS A;  1X36 A;  5T5L A;  2ORX A;  2WQ8 A;  2ZBJ A;  4MLO A;  1W8U A;  5A3L A;  4KBB A;  1WW5 A;  4ZKT B;  2HWE 2;  4K7J A;  2XJQ A;  1FMD 3;  3AYC A;  1WWY A;  1H2N A;  4TLG A;  3POI A;  2A3Y A;  3FLP A;  1E5I A;  3MW2 A;  3PUI A;  1H2L A;  3PTY A;  4Y1X A;  1BEV 2;  2BDR A;  2KM2 A;  1MS5 A;  3ZSJ A;  2NYY A;  4NPR A;  3ZM8 A;  3VBO A;  1WLD A;  2X5I C;  5CKQ A;  4V2V A;  4AVS A;  1OA2 A;  5KXB A;  1ZX5 A;  1VBC 2;  4GWN A;  2P34 A;  1Y4W A;  4JGY C;  4QPG C;  4CP0 A;  1AX1 A;  1H8T A;  3ZFG B;  1RUG 2;  2YBP A;  2J22 A;  1RUN A;  4UYB A;  4XJZ A;  1FYU A;  5FZ3 A;  2BW8 A;  3MFA A;  2WZR 1;  2RHP A;  1UF2 C;  3LD8 A;  2YDE A;  4I01 A;  4FPL A;  4K8R B;  3D8C A;  3C8X A;  4IE5 A;  3BOD A;  1WD3 A;  4UF0 A;  5FMC A;  5DUW A;  2XVL A;  5A32 B;  2GZW A;  1V9U 1;  1XND A;  2W94 A;  1GQP A;  5GLV A;  2ZGP A;  5FWJ A;  1RMU 2;  5AC9 2;  2GAU A;  4Q0P A;  2JD4 A;  2R04 2;  3ACI A;  3AMP A;  3T1M A;  3P3P A;  3SMH A;  1HJG A;  2CGN A;  3D3A A;  2OXB A;  5ACA 1;  3KVA A;  3LA7 A;  1ND3 A;  1XC6 A;  4OUM A;  3ZFF B;  3W58 A;  1AR9 3;  3AMN A;  3K3N A;  3V0B A;  4KGG A;  4KWL A;  1OLR A;  3HD8 B;  4NHL A;  4RD7 A;  3ZPY A;  3RJ2 X;  1VBA 3;  4M4R A;  1MQT C;  5K7P A;  4AOC A;  3GXU A;  2E63 A;  4JKL A;  4YFZ A;  1LHN A;  3EHK A;  5CFC B;  4QMA A;  4JC1 A;  2WN3 A;  3RZL A;  1A34 A;  4FOV A;  2ADD A;  4GH4 C;  5EJ3 A;  1KEX A;  1U12 A;  1W6O A;  2JDU A;  4IV3 C;  3W9A A;  1MEC 3;  5D21 A;  3ST7 A;  3DEC A;  1LOF C;  4YM0 A;  1CAU A;  3D6E A;  4M0N A;  4DB5 A;  2P3K A;  2V72 A;  3P3N A;  2W68 A;  3HOB A;  2VNV A;  5C70 A;  1VRH 2;  4QU2 A;  1SFY A;  2DDU A;  4XFH A;  4XUP A;  3DPR A;  3PUS A;  4OHV A;  3LPF A;  2EIC A;  5FUN A;  3VKN A;  4COW A;  2WO7 A;  3EMR A;  4IEZ A;  3V0A B;  1QF3 A;  5FLH A;  3P6B A;  4MO3 M;  3GBW A;  2YUE A;  3THD A;  1JYN A;  2VMG A;  3NNJ A;  3OGR A;  5BNP A;  2CAV A;  2VMD A;  2ZGO A;  3BTX A;  4EZH A;  1ALY A;  4N43 B;  4L11 A;  4CP9 A;  2J1S A;  5D8A B;  2WWS A;  3D0S A;  5BXX A;  3A0K A;  4A2U A;  1CWP A;  2MEV 1;  4A4A A;  4WZF A;  3KV5 A;  4XCB A;  1RUD 1;  1JYI A;  5DG1 A;  4FO9 A;  4NMI A;  4N9H A;  2Y33 A;  5DUX A;  4NPM A;  1PO1 1;  2Q1Z B;  4Z2A A;  2K46 A;  1V6I A;  1UWW A;  1Z7S 1;  4NVP A;  1HRI 1;  1NKG A;  4DEQ A;  2QQI A;  1JZ4 A;  1XNB A;  2VCC A;  4COV A;  2PHT A;  1YI9 A;  3OJB A;  4JRA A;  5IK5 A;  1VBE 2;  4OYU A;  2G9G A;  2Z69 A;  3KWV A;  3N9O A;  2HWC 3;  4CZS A;  4NPL A;  4YWA A;  4P5Y A;  3FMG A;  1QQP 3;  4RYD A;  3UKV A;  2ARE A;  4FFF A;  3AC0 A;  5I8Y A;  2UWB A;  1REE A;  5DAV A;  4LO6 B;  1CQ9 A;  3N7L A;  4HKL A;  2YC2 A;  4LO5 B;  4E4H A;  1F9K A;  1US3 A;  2GNM A;  1F5F A;  2GH8 A;  4QM9 A;  2VL4 A;  1ZBA 3;  3AFG A;  4FI9 A;  3VDA A;  3RZK A;  4PLO A;  1RUE 1;  3RJR A;  4WVV A;  5IVB A;  2EAK A;  1F4A A;  2P3J A;  3Q8A A;  3ELN A;  5F32 A;  5K0U C;  1S55 A;  1DQ1 A;  1TG7 A;  1WBF A;  5LAT A;  3WIN E;  1UAI A;  4OZX A;  2VOK A;  4XUR A;  2B9V A;  1SHW B;  1LJ7 A;  2LAL A;  5JAX A;  4XF9 A;  2VMH A;  3JBG 3;  3B94 A;  4MOA A;  3WXP A;  2O0O A;  3AP6 A;  1LRH A;  1DZR A;  1JTZ X;  2FMY A;  3DXU A;  3SC7 X;  2VUA A;  3J26 N;  2VO5 A;  3J8F 1;  3W21 A;  4HFS A;  4RHV 3;  2QDN A;  2D97 A;  2XDV A;  1L3J A;  4IGO A;  4XIK A;  1ENX A;  4IE4 A;  4L9B A;  5GM0 A;  4CUA A;  3KHC A;  4BXS V;  1D0H A;  4ORF A;  1AXK A;  3L2H A;  5E1R A;  2L9L A;  2H6C A;  4JKM A;  4LUM A;  2ADE A;  1G9A A;  2A73 B;  1I5Z A;  3FC0 A;  4Y5T A;  1J3R A;  4HK9 A;  4J6G A;  5DZF A;  1NE6 A;  1UIK A;  1W90 A;  4ES8 A;  3Q8E A;  2FZ2 A;  2Z79 A;  2RS1 3;  1MPX A;  2VUJ A;  2O8Q A;  2XJS A;  3D5O A;  3E6B A;  4LUK A;  5C8W A;  4I30 A;  2GN3 A;  1VMH A;  3I3B A;  4WM8 C;  1HN0 A;  1W9T A;  4R9B A;  1PK6 B;  5JSO A;  1YCI A;  2JE7 A;  4C0B A;  3ZXL A;  1HXS 3;  4UW3 A;  5ABJ B;  3ZDS A;  3ON7 A;  2E7Q A;  2GSY A;  2FD8 A;  1YJL A;  1J1L A;  2JEN A;  4PDW C;  5JI9 A;  3U78 A;  3BU0 A;  3OY8 A;  3NAP B;  5KXE A;  4MYE A;  1GBG A;  2XOM A;  2ZMK A;  4AFM A;  3I49 A;  2J1T A;  4TZD A;  1GR3 A;  1ULO A;  3G7D A;  2AYH A;  4PF5 A;  4QHZ A;  1RUF 1;  2VD7 A;  3MUY 1;  5BV6 A;  1UOG A;  1G9C A;  2P6C A;  4YVW B;  4H2A A;  3ECQ A;  3AZX A;  3LOB A;  5IVC A;  4YW7 A;  4E4D X;  4AAP A;  1QEX A;  1WME A;  1XNA A;  2VCB A;  1JU4 A;  1QJX 2;  1SBF A;  3JCI A;  5FYY A;  1WCD J;  4Q4W 1;  1LEN A;  5BNQ A;  4FT8 A;  4MGT A;  3KLS A;  1OOP B;  4NUB A;  1JI6 A;  3IPV B;  2HWF 3;  1NAE A;  3VLB B;  3VHO A;  2XUM A;  3HT2 A;  2QFE A;  3H8X A;  5IAV A;  4XXP A;  2WNE A;  3N9M A;  3R4D B;  3IWZ A;  1NE4 A;  1TMF 2;  5FFO C;  3OGS A;  1PMH X;  3WW4 A;  4BDV B;  1PVC 3;  3I3M A;  1PX3 A;  5HCB A;  1V6N A;  4GB3 3;  1ENS A;  1UZV A;  1K5M C;  3VKL A;  5JMO A;  4M00 A;  1H2M A;  2YU1 A;  2R6Q A;  5C4W B;  3VBF A;  5FXW A;  2DVD A;  3T30 A;  2HWB 2;  4NN0 A;  3M3O A;  4BM8 A;  5LW9 A;  3W5N A;  1AF9 A;  1B09 A;  4AFC A;  4TN7 A;  2WBK A;  2O14 A;  4BIF A;  3ZIX A;  4CA9 A;  2WDB A;  1SDD B;  3NJX A;  2J1U A;  4QXK A;  2P3I A;  3HNY M;  4D8M A;  4Y4R A;  3C7H A;  2OS2 A;  4LHL A;  2NM1 A;  5FKC A;  4QPY A;  2XB6 C;  2JDH A;  1AXZ A;  1UL9 A;  1PGW 2;  1VPH A;  2DV9 A;  2VQT A;  4XAE A;  1W9S A;  2R16 A;  5H9P A;  5CAZ A;  1TME 3;  5FUP A;  4AGR A;  4CRQ A;  1R08 3;  4X6R B;  1C4R A;  3FFQ A;  1VE0 A;  1W6N B;  3K4A A;  4PT6 A;  4D3W A;  1QJZ A;  2VZR A;  4EN6 B;  1HN1 A;  4HPK B;  1LU1 A;  4Y4Y A;  1K5J A;  4FQ4 A;  4KQ7 A;  5EJ1 B;  2YMZ A;  1AVB A;  5LA9 A;  1QJU 1;  1XYP A;  4LMF A;  2IXJ A;  4QGL A;  2R06 1;  1C5I A;  4V1P A;  4B3N A;  5KXC A;  1UN1 A;  1UX7 A;  2G19 A;  2GC1 A;  4QQH A;  2Z4F A;  3S6P A;  5JPN B;  2Y34 A;  1X33 A;  1JN2 P;  2XKP A;  4LO4 B;  2K0G A;  3BI3 A;  3RDI A;  4CCD A;  3RSJ A;  1FPN 3;  2A5Z A;  3KQ4 B;  1H1M A;  4IE7 A;  4EN8 B;  4GMP 3;  4UFM A;  2OT7 A;  5K9Y A;  4E2S A;  4DXS A;  4SLI A;  5FP4 A;  1K45 A;  1XYO A;  1SPP A;  1RIR A;  2W0X A;  2BNM A;  4AVV A;  2DF7 A;  3VBS A;  3F95 A;  5C71 A;  1VAV A;  3K75 B;  1X8E A;  2JWP A;  4FFG A;  4XZP A;  2X09 A;  3JUU A;  4Y1Z A;  1A78 A;  3N7J A;  4A3Z A;  3WG3 A;  4LT5 A;  1QXP A;  2A6V A;  1XE0 A;  3ZN4 A;  2WZR 2;  4LE4 A;  5J96 B;  2UU8 A;  4IER A;  2VBB A;  1H30 A;  1O8P A;  2VTX A;  5F3G A;  4AW7 A;  3RRD A;  3C7G A;  1RB8 G;  1WW7 A;  3NAP A;  5DAB A;  1S2E A;  1MS9 A;  1V9U 2;  2YC0 A;  4DZG A;  3NJZ A;  3USS A;  3A21 A;  2Y60 A;  3VBU C;  3VZO A;  3M70 A;  1IS5 A;  2QZ2 A;  2WYF A;  3Q8B A;  1XU1 A;  1ZRR A;  4GWI A;  2EIE A;  4I3G A;  4LIT A;  1DYP A;  2FZ1 A;  2JDN A;  3FX3 A;  1VJ2 A;  1DQ2 A;  3JQW A;  1CN1 A;  5ACA 2;  4AVA A;  5LY1 A;  4LHS A;  4Y26 A;  2IFR A;  1Y9G A;  1CAW B;  3RMX A;  1TNF A;  2DU1 A;  3NJY A;  1YI7 A;  4DXR A;  3ME2 A;  2PAE A;  1RUJ 3;  2RJK A;  4JV4 A;  3AB0 A;  4ASL A;  5FY0 A;  3NO8 A;  4BQ2 A;  1AR7 3;  3FL7 A;  3HJR A;  4R52 A;  4FFH A;  5FY8 A;  4LOR A;  2AUY A;  4FAH A;  3GJA A;  3O1P A;  1XOY A;  2JX9 A;  2UWC A;  3SH4 A;  2JDK A;  4LKD A;  5A7P A;  3HR9 A;  1VBD 1;  3GHM A;  5EHD A;  5BPX A;  3VD5 A;  1MS8 A;  3IPV A;  4K1Z A;  1SFN A;  3RZG A;  4GMP 0;  3AXD A;  4AYU A;  4CCO A;  1ULP A;  3FBY A;  2XHK A;  4LO8 A;  1OPM A;  2IWG B;  4Y20 B;  2YU2 A;  5LRR A;  1ULE A;  5LCW L;  4TSV A;  2DCT A;  1DGW X;  3KHB A;  2XBO 3;  2VAU A;  2A71 A;  1GP6 A;  4LBK A;  4AEJ A;  4ASM B;  2VM9 A;  4CDX A;  2VNG A;  4RGA A;  1ZRC A;  1FNY A;  1QJY 3;  3JD7 3;  3P1I A;  4MXW A;  4E27 A;  3WQ7 A;  4AFD A;  4CEY B;  5F3E A;  1Q5O A;  1FOD 1;  4ASK A;  1CAV A;  2RDS A;  4COU A;  1GWK A;  5JOX A;  1YEW A;  5A6Z A;  1Q8Q A;  3VBR C;  3ZFE B;  3S0M A;  4RQP A;  2BBA A;  2LS6 A;  4XW3 A;  2WFF 3;  4R9C A;  2MEV 2;  5FZE A;  2XJV A;  3ZN6 B;  4QDQ A;  1RUD 2;  2EXK A;  3KF5 A;  4QX2 A;  2VZU A;  5FYU A;  4PF1 A;  4C90 A;  1XPW A;  2FCT A;  4RS5 C;  1NXM A;  1PO1 2;  1F35 A;  1LNS A;  4B4R A;  3PIG A;  4EV0 A;  1Z7S 2;  3IAP A;  2VXR A;  1HRI 2;  2SLI A;  2YGM A;  3PIJ A;  4YRD A;  4AFA A;  5L7O C;  1Y7B A;  4AL9 A;  1H4G A;  2W1S A;  3O1U A;  3KT4 A;  4KG0 A;  1OQ1 A;  4GUL A;  4B8E A;  3K46 A;  3DYO A;  2WSV A;  3R4S A;  5C9A C;  1ND2 B;  1SLT A;  4K8F A;  2AZ5 A;  3MIG A;  2VJX A;  1NA1 C;  2QKD A;  3MLL A;  2D3P A;  3OEB A;  2PYT A;  1RUE 2;  1ZZ8 A;  4L8Q A;  1KXG A;  4YGB A;  1VRB A;  4IV1 B;  2VQA A;  2R49 A;  3WLU A;  3PJQ A;  4LK6 A;  1OC1 A;  1XE8 A;  3TN9 3;  1N1V A;  1OF4 A;  2J1E A;  2MNG A;  2C9K A;  4AGV A;  1B35 A;  4CDW A;  4LBQ B;  3H1Y A;  4XUQ A;  1STM A;  3C7O A;  2JE8 A;  5JIU A;  5C3O A;  2VOX A;  3J8F 2;  3T2O A;  4LBQ D;  2EAL A;  3BIW E;  4XVH A;  1D4V B;  1GIC A;  2GMP A;  2J1V A;  2JEM A;  2V09 A;  4LUL A;  1G9B A;  2FDF A;  4BIO A;  2CWM A;  2Q8C A;  2ET1 A;  1QQP 1;  1UZW A;  5FMO L;  1GZC A;  1NZC A;  3AKQ A;  5FZM A;  3VBH B;  5LBB A;  3KV9 A;  4CDU C;  3VDD C;  5C3P A;  1YIF A;  3WW2 A;  1Y9Q A;  5FZ7 A;  5FYT A;  1W0O A;  2FCU A;  1SLA A;  5DG2 A;  3LGR A;  5EZW A;  3K3O A;  4QHO A;  3CDZ B;  3EYP A;  5KR7 A;  2JDM A;  1QHD A;  2CY6 A;  1BMV 1;  3WY6 A;  4QB6 A;  1W8N A;  4CXY A;  5FOJ B;  3SQO A;  5J3U A;  1S1A A;  3AYD A;  1ENR A;  1CON A;  4YW3 A;  5FZB A;  3SH3 A;  2CGO A;  4ZS2 A;  3ES4 A;  1MZ5 A;  3ZMN A;  3O1O A;  2R0F A;  5FY1 A;  1WMD A;  3GHN A;  3SXW A;  3TRS B;  1UD1 A;  2PQS A;  1YIP A;  2WAA A;  1KIT A;  2NMO A;  2P3Y A;  3WP5 A;  2W5F A;  2UWA A;  3QH7 A;  4BU2 A;  4CU9 A;  3C7E A;  1BVV A;  2ZA9 A;  3IDA A;  3WNO A;  1LED A;  1JHN A;  2BUK A;  3V56 A;  2VTF A;  4QQO A;  2RS5 1;  1RUC 3;  2FDJ A;  5FV3 A;  3BUC A;  5FY7 A;  4B7E A;  5J48 A;  1NOV A;  3SCG A;  1RUF 2;  1U5Z A;  2DYC A;  4HMZ A;  2JDZ A;  2ZEY A;  4LTA A;  1U0A A;  1RUI 2;  3RYP A;  1VP6 A;  2C4X A;  5DDJ 3;  3GM8 A;  1QMJ A;  4HOO A;  3VZK A;  1UY4 A;  3JU9 A;  4YFW A;  4QU1 A;  3OUI A;  1LCL A;  2ATF A;  2WNV A;  4CEY A;  1GZW A;  5FAX A;  1JYT A;  2Y6J A;  5BNO A;  2Q30 A;  3AP5 A;  4Q4W 2;  4PBP A;  4CUG A;  1POV 3;  2H0B A;  3QCW A;  1R1A 3;  1W6M A;  2NP0 A;  3AMH A;  1MVQ A;  4AE2 A;  3VZM A;  3O0X A;  4M0H A;  4JHT A;  2XHN A;  2JG9 A;  1S0B A;  1DYK A;  2JDY A;  2W9X A;  4BH9 A;  1PX4 A;  1UY1 A;  4AG4 A;  3TEX A;  4WVZ A;  1IPS A;  3GNE A;  1JZ5 A;  1IS3 A;  4HVO A;  5CFD C;  4FP3 A;  5C3Q A;  5F7U A;  1F8V A;  3AP4 A;  1LOB A;  4BJ0 A;  3GZU C;  1E5H A;  1QNW A;  2W52 A;  2ZKN A;  2EA7 A;  3B00 A;  4U2A A;  1D7P M;  2WNU A;  1VMF A;  3ZYJ B;  3CLP A;  3PVO A;  1YFY A;  3N7M A;  1UOB A;  1JS9 A;  4MGI E;  4XAC A;  3ZN5 A;  3T08 A;  3I97 A;  1SBE A;  4WM7 C;  4XE9 A;  5FYM A;  4Q4V 1;  4N53 C;  2ZX3 A;  1GZT A;  4G9S B;  1HB2 A;  3VBO B;  1NT0 A;  2CV6 A;  1NUK A;  4YVS B;  4JGZ C;  4L99 A;  2A6Z A;  3BPZ A;  5EIY B;  3K77 A;  3F2Z A;  4C0H A;  1HX6 A;  1RUH 3;  2ZGM A;  1SEF A;  2HWF 1;  3ZYB A;  1CZT A;  2J42 A;  1JYC A;  2OA2 A;  2Z42 A;  4CEW A;  1X9T A;  4XFB A;  3WCS A;  5A70 A;  1WLW A;  3LE0 A;  4LBQ A;  5FPA A;  5EXO A;  3RYK A;  4A7Y A;  2WO3 A;  1K3I A;  2Y6K A;  4GB3 1;  2ES3 A;  3SHR A;  5M0T A;  3UV9 A;  1LKN A;  5CA6 A;  2NPI A;  2BFU L;  3D82 A;  1OA4 A;  1QJU 2;  3LIG A;  4AI9 A;  2R06 2;  4QX1 A;  1POV 0;  1AR6 3;  3DUI A;  1CIW A;  1W9Y A;  3JZV A;  3VD4 A;  4BQX A;  3S57 A;  3A0N A;  4XJW A;  1WGP A;  2DVB A;  5IFP A;  2VVF A;  1DYO A;  3RI8 A;  5A3M A;  3B93 A;  2RVA A;  3HBK A;  4XMA A;  1ND3 B;  4YGC A;  5F9T A;  4A6S A;  3V0B B;  1OSG A;  1JU3 A;  1PO2 3;  2JJ6 A;  2WQZ C;  2B4K A;  3CZU A;  2RMU 1;  4IGQ A;  1W03 A;  3J4U H;  2LRP A;  3M3C A;  5HXV A;  1LOE A;  5FUI A;  5FYC A;  3ZXK A;  2JG8 C;  1CIY A;  1Q8O A;  2JKB A;  1XNK A;  3MV0 1;  2CU5 A;  1J59 A;  3RZJ A;  1RC6 A;  4FPG A;  3ZVX A;  1OLM A;  2P37 A;  2YPD A;  1NZI A;  3FHA A;  1FV2 A;  4XEZ A;  4A3X A;  1AYM 3;  1W6O B;  2CSG A;  4FFI A;  2PFW A;  2X5I A;  4QPI C;  3LDR A;  3SCF A;  1S4C A;  2X53 S;  1G9D A;  4NHY A;  2PAM A;  4XDO A;  1GSL A;  5EWS A;  3SLI A;  1JZ3 A;  4JGY A;  4QPG A;  4QXC A;  1T6B X;  3KB5 A;  1TMF 1;  4XFA A;  1O4Z A;  1GNY A;  1GOF A;  5FZL A;  3OBZ A;  5JOW A;  2R1B A;  3R0R A;  4NWV A;  5DUV A;  1N3P A;  4QT6 A;  1UU6 A;  2C9A A;  1ULD A;  3M1H A;  5JOZ A;  2HBT A;  2ZX0 A;  4DY3 A;  2BJS A;  4COZ A;  3FLT A;  5KHG A;  5F3I A;  3AXE A;  2Y6L A;  2CAU A;  3TEW A;  3WF4 A;  4PQQ A;  3Q9O A;  1RHI 1;  2FMD A;  1UU5 A;  3PUR A;  2Y64 A;  2VU9 A;  2ZTN A;  2Q8O A;  1IHM A;  1AYN 1;  3C3V A;  4LBL A;  4CP9 B;  4HVR A;  1G6N A;  1VBD 2;  1W2T A;  2ZHL A;  3CMG A;  1OVS A;  1YLL A;  3R05 A;  2DVF A;  4YW6 A;  1LR5 A;  1OUR A;  3E6C C;  1ULC A;  2VME A;  3OD0 A;  4DS0 A;  1MQT A;  5A7Q A;  2WL1 A;  5FP3 A;  1WD4 A;  1JXN A;  3H3L A;  3UGH A;  5FMB A;  1JYV A;  1C1F A;  3I3E A;  5ANQ A;  5DMY A;  5I0D A;  4Q0S A;  5IW0 A;  3ZSK A;  3POS A;  1FX5 A;  1C8M 1;  1VIW B;  4WBB A;  3VZJ A;  4QX8 A;  4CDQ C;  2ZGQ A;  2YFU A;  4GH4 A;  4Q29 A;  1ZYB A;  1EPW A;  3ZSL A;  4Z1V A;  4YZ5 A;  1NXD 1;  1RUJ 1;  1ZNP A;  3I2F A;  5G04 L;  2P6H A;  3FHI B;  4MGS A;  4EN0 A;  5APA A;  2WC2 A;  1LOF A;  1NCQ C;  4OMD A;  3N9Q A;  1ENQ A;  1CJD A;  1SLC A;  1FOD 2;  2OII A;  2ZGS A;  3Q8C A;  4QB1 A;  1L7L A;  1VMJ A;  5FK7 A;  5SV8 A;  1U5X A;  1W04 A;  3V64 A;  4TWT A;  4YVS A;  3KCC A;  1HV0 A;  4XMI A;  1ZBE 3;  3ZYG A;  2EAA A;  3IDC B;  3IDB B;  1KFU L;  4XIO A;  3OB8 A;  4YZ2 A;  4YGD A;  2XGX A;  4GWJ A;  5J98 B;  3ZYI B;  3UYJ A;  4OLL A;  2D5F A;  1W8Z A;  1O91 A;  4CYD A;  4AED B;  1WCQ A;  3LFI A;  4AQ6 A;  2XBO 1;  1OI6 A;  4D7Y A;  1JZ6 A;  1EUU A;  2R32 A;  5EYX A;  2XL9 A;  3AYE A;  3M8L A;  4AXO A;  2ZHM A;  4M01 A;  5E6H A;  1BVP 1;  1O3Q A;  4MVT A;  1QJY 1;  2AC1 A;  3VZL A;  4HET A;  3WQB A;  3JD7 1;  3ROU A;  1W2O A;  5L19 A;  1W2A X;  4XJ9 A;  2GP3 A;  3PVN A;  1ZZC A;  2I45 A;  3IMN A;  1LGN A;  1W6P B;  1WCU A;  3FUO A;  4CPB D;  1W39 A;  3KCX A;  3BGA A;  2D5H A;  4XBQ A;  1UMH A;  4YAR A;  1W05 A;  2V73 A;  1AJK A;  1UY2 A;  3BB6 A;  3DYM A;  3ZYP A;  3N3H A;  3MPP G;  2AAC A;  4FCA A;  2BQP A;  4QAW A;  4R4Z A;  1WLC A;  1M06 G;  3M3Q A;  1W9W A;  4DNY A;  1KRI A;  3MIC A;  4A44 A;  2DCZ A;  2HWC 2;  4LBN A;  2Q1M A;  3GDB A;  3OY8 B;  1OD5 A;  4JZR A;  1QQP 2;  1XQN A;  2HWE 3;  2P4E A;  3AKT A;  4Q8L A;  5I93 A;  4OZO A;  4Q4Y 1;  5LAS A;  2B42 B;  1KS5 A;  2ID4 A;  2H0V A;  1O3R A;  3LWC A;  1MZ6 A;  1NCR C;  2OZJ A;  1EUT A;  1XXN A;  1ZBA 2;  3KGZ A;  3GYD A;  5FLI A;  5I8S A;  1FNZ A;  2H6B A;  2GC2 A;  2IUW A;  2NQY A;  4OUL A;  3RMY A;  3N36 A;  5CKN A;  2VZT A;  4KU7 A;  3OBT A;  4N7U A;  3POB A;  4E4S A;  1QJE A;  2BWA A;  5IVY A;  1BMV 2;  5JR7 B;  5H9Q A;  1O6U A;  3TN9 1;  3U4S A;  2BGO A;  2O1Q A;  5F5Q A;  1NLR A;  1DP0 A;  2O8O A;  1XRU A;  4BOW A;  4DIN B;  1VBC 3;  1UZY A;  2ZS6 B;  4AQS A;  4LLO A;  1EAH 3;  4D6S A;  3ZKU A;  1PVX A;  2RM2 3;  4DXZ A;  5B2G B;  1HLC A;  4JDO A;  2JB8 A;  2WAB A;  5KC6 A;  2D3R A;  2W87 A;  4GZ9 A;  1N1S A;  1W06 A;  4XQ4 A;  5FPU A;  4BB3 A;  2D98 A;  5FPX A;  5JCT A;  2RS5 2;  1H8T C;  2VW0 A;  1PNG A;  3IB3 A;  4J1W A;  3ZPO A;  2DBN A;  2WRA A;  2JIC A;  1BXH A;  3OPT A;  1ASJ 1;  1I5P A;  1WA4 A;  4IE6 A;  1RMU 3;  4ZU5 A;  4RL7 A;  2D6L X;  4DRR A;  1MVE A;  2R04 3;  2DVG A;  2LM3 A;  4OHW A;  4PIY A;  2PLV 1;  3LEG A;  3VBF B;  4LA2 A;  4DXT A;  1UYZ A;  4AI2 A;  2QVS B;  5F3C A;  1JOB A;  3CL1 A;  3O1T A;  5C8C C;  4PDW A;  3NNL A;  1LGC A;  1Q8S A;  5LEJ A;  2QCS B;  2Y26 A;  3OSD A;  5FPZ A;  2WZ8 A;  4TXW A;  1NG0 A;  2C26 A;  4XDP A;  4YG6 A;  3AL6 A;  4EYU A;  4ONU A;  4QXH A;  2OUH A;  4AHW A;  1QWR A;  3CJI C;  4BK4 A;  2X29 A;  4N8M A;  3VHP A;  1LGB A;  3T0B A;  1LOC A;  5B4N A;  2XON A;  4R8H A;  2WUH A;  1W9F A;  2YZ4 A;  4GA9 A;  1GOH A;  2RR1 1;  4AGG A;  3EQE A;  2VCM A;  5A33 A;  3WCR A;  4CCE A;  1D0G A;  1RUC 1;  1YFW A;  4W4Z A;  5CFC C;  1ZZ7 A;  3WQ0 A;  3TEZ A;  2XVK A;  1OH4 A;  1ONA A;  2D6M A;  4AED A;  4DQA A;  1ZRF A;  1QOT A;  1IKP A;  1F2N A;  1C8N A;  4FVV A;  3H1W A;  4KH9 A;  4YM1 A;  2VZQ A;  3MFC A;  2HWD 3;  3HWJ A;  1HJF A;  5LBC A;  2ERF A;  3CZJ A;  5IUQ A;  5E8A A;  4D6R A;  5FMD A;  5A3U A;  2VBD A;  4Q2F A;  2DUQ A;  5SV5 A;  1CES A;  1MR5 A;  3VGI A;  2IXC A;  2VEC A;  4XPV A;  5FP9 A;  5HCH A;  3LEM A;  3CNA A;  3U75 A;  3ZXF A;  4CPB A;  2F6B A;  5GZF A;  4Q4V 2;  4IET A;  5LA2 A;  5LA1 A;  3CF6 E;  2OUJ A;  3OBA A;  3HN3 A;  4FPY A;  1W6P A;  4CE8 A;  4LBM A;  4OHY A;  4IEO A;  5IVV A;  2FCV A;  2VG9 A;  1SPP B;  3DPR C;  2WFP A;  3UT0 A;  2HWF 2;  3USU A;  3VBS B;  1RED A;  2RS3 1;  2JB4 A;  1UYY A;  2QQM A;  5BNN B;  3WX5 A;  5AFE A;  1ZM1 A;  2VUL A;  5BNP C;  4HLT A;  3GBF A;  1EV1 3;  3S7E A;  2ZX1 A;  3RPQ A;  4DUX A;  3PDQ A;  4GB3 2;  2W1Q A;  4XF3 A;  3X29 B;  5BUV A;  5JDB A;  2QTW B;  5F5C A;  2ZGT A;  3H50 A;  3VZN A;  1C28 A;  4CSW A;  1VBE 3;  3FWE A;  4UF0 B;  1W99 A;  3AZV A;  4HBN A;  4PLN A;  1DIW A;  4Q26 A;  1I6X A;  4UFJ A;  4XXA A;  5DZE A;  5F5A A;  2DUO A;  1GNH A;  3GZE A;  5FIX A;  3SNM A;  2E51 A;  3WQ1 A;  3NW4 A;  2BRT A;  1UQX A;  1UYP A;  2OQ7 A;  4XF1 A;  4LKF A;  2W39 A;  4AAX A;  3I2K A;  4AHZ A;  1RUI 1;  2QQL A;  1RUH 1;  2ZHN A;  2RMU 2;  4L97 A;  5AVA A;  4P02 B;  3BN6 A;  1AHS A;  2X05 A;  2YG0 A;  4XET A;  1YYN A;  1JZ8 A;  2FBE A;  5IJR A;  2D6K A;  3NNM A;  4N7I A;  4QB2 A;  1DF0 A;  1GFF 2;  5C33 A;  3C2U A;  3WNP A;  4YW4 A;  1RIT A;  3SIT A;  5T50 A;  2R7E B;  1QOS A;  3U1X A;  1HW5 A;  2A1X A;  3TNQ A;  3UJQ A;  3ZYH A;  4QM8 A;  2DU0 A;  4RN5 A;  4BYY A;  2W46 A;  4UW6 A;  3AMQ A;  4MHR A;  4F3J A;  3ZFG C;  1W28 A;  4AI3 A;  5A1A A;  1TVG A;  2UYB A;  2AEN A;  1WCK A;  1MS3 A;  3O12 A;  4MHU A;  4CCC A;  2GME A;  1FPN 2;  1BZW A;  2ZX4 A;  4PIX A;  3POG A;  2JKX A;  1AL0 G;  1PO2 1;  1DQ4 A;  3HEI A;  4MGY E;  5FP8 A;  2WQ4 A;  4CDX B;  2CGP A;  3L2Y A;  3WSO A;  3I7D A;  4I0W B;  4AHY A;  4AVC A;  5FY9 A;  2QE3 A;  5IK7 A;  1ODM A;  1NQJ A;  3SKJ E;  4MXW B;  4YPJ A;  4YM2 A;  3VD7 A;  1LUL A;  3LSD A;  4JDM A;  1IZ3 A;  1CVN A;  1SAC A;  4KI5 M;  2PN5 A;  1OFS A;  3IIA A;  1RHI 2;  1CAV B;  2TUN A;  2DCY A;  1AYM 1;  4QKD A;  5LY2 A;  3VBU A;  3RZH A;  4DO0 A;  5JZG A;  1A8M A;  2VOW A;  1AYN 2;  3ZFF C;  5HV0 A;  2WKK A;  1J1T A;  4RQP B;  4BE3 A;  2RJL A;  2BWC A;  3ZR5 A;  4DMI A;  1SDW A;  4GAZ A;  1XB9 A;  5CNA A;  2J1R A;  4LKE A;  1O5L A;  5DAQ A;  3WF0 A;  3EB7 A;  4JCK A;  4NRO A;  4KU8 A;  4OHX A;  2E7A A;  5C5U A;  2Y8K A;  4GKY A;  1C8M 2;  1V6K A;  3RS6 A;  3CIH A;  4BMB A;  1R09 3;  2WZE A;  3KZ4 C;  5T5O A;  3S5Q A;  2DFC A;  4BXF A;  1NYW A;  1RUJ 2;  2ZGN A;  3EXU A;  4LXL A;  4EZ4 A;  1GZ9 A;  1UZ0 A;  4PI2 A;  2CDP A;  5JLV A;  1WMF A;  5G05 L;  1KDM A;  5FMO S;  3WUC A;  3UES A;  5A7W A;  3VD9 A;  5FP7 A;  1PIV 1;  1U5Y A;  2XPJ A;  1WBL A;  3FN9 A;  2YGL A;  3U0Z A;  1AL2 1;  1QJX 3;  1Y3T A;  2DCK A;  2D6P A;  1WW4 A;  3DGT A;  5CEH A;  4K1Y A;  2RG4 A;  4IEU A;  4LBO A;  3TYJ A;  1PGL 1;  3FE5 A;  4YLZ A;  1NY7 1;  3AKP A;  3VHN A;  5BNN A;  5FZ6 A;  1B35 B;  4CDW B;  3VKM A;  5J36 A;  2YV8 A;  3WNX A;  4XQW A;  5FPB A;  3HAG A;  2XBO 2;  4N9I A;  5FJK A;  2VMC A;  1IOA A;  1WA6 X;  4FXK B;  1FMD 1;  1PZ8 A;  2Z5W A;  2ZEZ A;  2C6S A;  3MW4 A;  4BWO A;  4IDZ A;  4E8C A;  1O5U A;  4N43 C;  5KXD A;  4ZXE A;  4WZC A;  5D8A C;  1VB2 A;  4QX3 A;  4FBF A;  1QJY 2;  3VBR A;  4CXX A;  4XJ8 A;  3AK0 A;  3ZXE A;  3JD7 2;  4AF9 A;  2ZGK A;  1VBB 3;  2RJ2 A;  4F8A A;  3WNM A;  5I91 A;  2XJT A;  1QDC A;  3GZT B;  3LPG A;  2HWB 3;  3MI8 A;  3W5M A;  2WT0 A;  4O65 A;  2JE9 A;  5D1I A;  2XWJ B;  4RS5 A;  5FZ1 A;  1ZBE 1;  5A7O A;  2V4A A;  2Q4S A;  2IXK A;  4JTO A;  5L7O A;  2XG3 A;  4XFC A;  5EPA A;  3VBF C;  4JKK A;  4EWA A;  2OPK A;  1XBF A;  1H6X A;  1E57 A;  5FYS A;  5JPM B;  3SEP A;  2VTX J;  4BK5 A;  3ZIW A;  2E53 A;  3KF3 A;  4D7S A;  2FDI A;  1EYB A;  4XBN A;  4BZ4 A;  5JVV A;  3AJY A;  2FQP A;  1URX A;  1AX0 A;  3RQ0 A;  4JX0 A;  3VKO A;  1QXJ A;  1NA1 A;  1RIN A;  2GDF A;  4NIH A;  1GP5 A;  3ACL A;  3DN7 A;  5KWR A;  5FZH A;  3JB4 C;  4Q4Y 2;  3U14 A;  3JXS A;  3BYW A;  5A80 A;  4LNV A;  2D44 A;  2HBU A;  3CEW A;  4M3C A;  4UFL A;  1BBT 3;  5FZC A;  1ZRE A;  1AR9 1;  1H1A A;  2XJU A;  1UKG A;  4JHZ A;  4B1M A;  3QAC A;  4OCT A;  3K48 A;  4YSF A;  3PUH A;  5CIS A;  1QH6 A;  1VBA 1;  2FDK A;  4QXB A;  5CU1 A;  3WW1 A;  2C0Z A;  4RR3 A;  3TN9 2;  1OUX A;  1CX4 A;  1DDL A;  1NX9 A;  5J1X A;  2D93 A;  2WNV B;  4P9G A;  1GZW B;  2PEL A;  3THP A;  4CDU A;  4NO4 A;  4Z92 B;  5BNO B;  1SG3 A;  1L7Q A;  1IS6 A;  1P8J A;  1S0F A;  2PHR A;  3RI9 A;  1DU3 D;  3VDD A;  1MEC 1;  4QX0 A;  5FO9 B;  1W6M B;  2BEO A;  1LOD A;  4GKX A;  1H9P A;  1I9R A;  1QGL A;  5FRE A;  2VR4 A;  5B4X A;  2WZR 3;  2JG9 B;  2LTN A;  3WDT A;  1D4M 3;  3KSC A;  5FZF A;  2C24 A;  2HEY F;  2TEP A;  2ZOE B;  1PMI A;  3ZYF A;  4HVQ A;  2PHL A;  4U36 A;  2WSU A;  5FJH A;  5BY5 A;  2WII B;  1PK6 C;  1YO8 A;  5DN2 A;  1SCS A;  3PVE A;  3QOP A;  4Z8B A;  5JUV A;  1ASJ 2;  3BTY A;  2WZP P;  1HRV 3;  3T1L A;  5ABJ C;  5J7M A;  3WNK A;  1JZ7 A;  5IYY A;  3MO4 A;  2V5Y A;  3GAL A;  2XLF A;  2YFZ A;  2IC1 A;  2VZP A;  2PLV 2;  3QBQ A;  3WT3 A;  2MPF A;  2VVE A;  4EWD A;  5ACA 3;  5LWB A;  2BV4 A;  2WNU B;  3NAP C;  2BFU S;  3NQH A;  4HON A;  4Y22 B;  3NJV A;  4NRP A;  4DPN A;  3KV6 A;  4HXC A;  4LK7 A;  2JDA A;  4FPO B;  1EAH 1;  5EYY A;  1OUS A;  1GWM A;  2BOJ A;  5FQ0 A;  3ABZ A;  2P17 A;  3MF9 A;  4DUV A;  2ORZ A;  2X10 A; 
#chains in the Genus database with same CATH homology
 2VD7 A;  3K3O A;  5FXV A;  4GD4 A;  3OPW A;  2OQ6 A;  5KR7 A;  5CEH A;  5LY1 A;  5IVC A;  5IVV A;  4IGQ A;  5FXX A;  4BIS A;  4AAP A;  3N9L A;  3PUS A;  5ISL A;  5FUN A;  3NJY A;  5F39 A;  5FYC A;  4Y33 A;  4URA A;  5FWE A;  5FZ6 A;  5FZB A;  5FZ0 A;  2YBS A;  5FY0 A;  5FPB A;  2YPD A;  5FJK A;  2WWU A;  5FYY A;  5FY1 A;  5FY8 A;  3PDQ A;  4LIU A;  4CCL A;  4EZH A;  2GP5 A;  5A3W A;  4BU2 A;  3AVR A;  2WWJ A;  5F5C A;  5A7P A;  4NUB A;  4CSW A;  3PU8 A;  4GJY A;  4XDO A;  3KV5 A;  4UF0 B;  2XML A;  3N9N A;  5F2S A;  5FV3 A;  5A7W B;  5F5A A;  4CCO A;  4QXC A;  2YU2 A;  5FY7 A;  3N9M A;  3PUA A;  2OQ7 A;  5FZO A;  5FZ1 A;  5FZL A;  5A7O A;  5FZ4 A;  2Q8E A;  2YU1 A;  4CCN A;  5IVY A;  3KV4 A;  5FZ9 A;  5FXW A;  3N9O A;  3U4S A;  5FYB A;  5LW9 A;  4LIV A;  4HOO A;  5FYS A;  5A3T A;  5F3I A;  4TN7 A;  4QU1 A;  5A3P A;  2PXJ A;  5F3E A;  4E4H A;  4ASK A;  4D6S A;  3PUR A;  5FYV A;  5F2W A;  3PUQ A;  4Y4R A;  4CUG A;  5IVB A;  2OS2 A;  4V2V A;  4D6Q A;  5FZD A;  5F32 A;  4CCM A;  5FPU A;  5FZH A;  5FZE A;  5FZG A;  2YBK A;  5FUP A;  5K4L A;  3RVH A;  4QX7 A;  5FYU A;  2XXZ A;  5F37 A;  2XUE A;  3ZPO A;  2YBP A;  5A80 A;  5A7Q A;  5FP3 A;  3OPT A;  2P5B A;  4GJZ A;  5FYI A;  5FZ3 A;  5FZI A;  5FZO B;  3K2O A;  5FZC A;  4CCJ A;  3AVS A;  3DXU A;  5ANQ A;  5IW0 A;  5A3N A;  3LD8 A;  2W2I A;  5FP8 A;  5IVJ A;  4QX8 A;  4QXB A;  3DXT A;  5FY9 A;  2XDV A;  2Q8D A;  3KVB A;  5F3C A;  4IGO A;  5FBJ A;  5FWJ A;  3LDB A;  3N9Q A;  5IVE A;  5A1L A;  4XDP A;  5A7N A;  5FYM A;  5LY2 A;  3AL6 A;  4EYU A;  5FYH A;  4DO0 A;  5FZK A;  4QXH A;  3AL5 A;  3KVA A;  2OT7 A;  3K3N A;  4CCK A;  1VRB A;  5FP4 A;  3N9P A;  4IGP A;  4GAZ A;  3UYJ A;  5FZF A;  3ZLI A;  2OX0 A;  5IWF A;  3PTR B;  4DIQ A;  5FJH A;  3PU3 A;  5FPA A;  5F5I A;  5FPL A;  5FY5 A;  4V2W A;  4QWN A;  5IVF A;  5FZA A;  4Y3O A;  5FY4 A;  5F3G A;  5E6H A;  5FYZ A;  4AI9 A;  4D6R A;  4BXF A;  3U78 A;  4C8D A;  5LWB A;  4HON A;  2Q8C A;  4LXL A;  4EZ4 A;  5FZ8 A;  5FP9 A;  5FZM A;  3KV6 A;  5FPV A;  3KV9 A;  5FXZ A;  4UF0 A;  2GP3 A;  5A7W A;  4LIT A;  5FP7 A;  5FZ7 A;  5FYT A;  5A1F A;  5A7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...