4HKLA

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
total genus 53
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hklA00
3VZLA 3VZOA 3VZKA 4HK9A 3VL9A 1OLQA 3B7MA 2JEMA 1IGOA 5K7PA 4XPVA 1HIXA 3WY6A 1QH6A 2B42B 2B45X 1UU6A 1HV0A 1TE1B 1AXKA 3RI8A 2VGDA 1UKRA 1REEA 3WR0A 2JENA 1OLRA 3RI9A 3WQ0A 1H0BA 2NQYA 3VZMA 1H1AA 1BK1A 1XXNA 2JICA 3VGIA 1PVXA 3WXPA 1XYOA 4NPRA 1M4WA 3ZSEA 3VHNA 3VHOA 2B46X 3MFCA 1C5HA 2DCKA 2BW8A 2QZ3A 2DCYA 3AKTA 3WP3A 2VUJA 1UU5A 3VZNA 1REFA 1XNKA 3AKRA 2NLRA 3WP5A 1OA2A 3M4FA 3AMHA 2D97A 4HKWA 3AKSA 1KS5A 2DFBA 3VLBB 1XYPA 4XQDA 4XQWA 3AMQA 2VULA 3MF6A 2C1FA 1YNAA 4S2GA 4XQ4A 4S2HA 3O7OA 4HKLA 1T6GC 4IXLA 4H7MA 3WP4A 3AMMA 1H8VA 1REDA 1OA3A 3MFAA 3VHPA 3WX5A 2Z79A 3MF9A 3VZJA 2F6BA 3AKPA 4HKOA 1XNBA 3B5LB 2DCJA 1BVVA 2BWAA 4S2DA 2D98A 1XYNA 1NLRA 1H4HA 5HXVA 4HK8A 5EJ3A 2DFCA 1HV1A 3VL8A 1F5JA 2QZ2A 1ENXA 4S2FA 1XNDA 2BWCA 3LGRA 3WQ1A 1W2UA 3WT3A 1KS4A 1OA4A 3HD8B 2BVVA 1C5IA 1XNCA 5K9YA 1H4GA 3WQ7A 2DCZA 3LB9A 3EXUA 1UU4A 1BCXA 1QH7A 3AMNA 2VG9A 3AMPA 3AKQA 3WP6A
chains in the Genus database with same CATH superfamily
3OBZA 3I3QA 4Y1UA 3VZOA 2VUDA 4DINB 4LBMA 4Z82A 5IK4A 1NG0A 1Y3TA 5ANNA 4QPGA 5I91A 1UOFA 3LEGA 3KWVA 3N9OA 2X10A 2Y26A 5HPOA 1WUVA 4FVVA 2QQKA 2JG8C 2A3YA 2VU9A 4AVCA 1LHUA 5CIRA 2A6WA 1OPMA 3ZYIB 4MUVA 2HYKA 5F3CA 5DAVA 1CGPA 1RUI3 4LMFA 2ILMA 1C8M3 3K4ZA 4AGVA 2DDUA 4DY3A 2XUMA 1SFNA 3ES1A 1VE0A 3U75A 2PLV3 5A6ZA 1ZRFA 5LBCA 5DQ0A 1LHNA 1QJY2 1ASJ1 1Q56A 4AI8A 1RHI1 2HWD3 4GWNA 2VNGA 1CQ9A 1A34A 3CNAA 4HN1A 3IMNA 1SBEA 2RVAA 4UFIA 1D4VB 5F3IA 2GDFA 2W92A 4GWIA 4P08A 2NN8A 2E63A 2JDKA 5KHKA 4EWAA 5JSRA 1HN1A 2E51A 5HCFA 3OUIA 1AF9A 2IXKA 3VBUA 2H0BA 2BP6A 3LPGA 3GHMA 1O8PA 2CHHA 1S2BA 4RHV1 3O5SA 2YBSA 2LUWA 3MW4A 4J25A 5ERLA 2PA7A 1WMEA 1NLQA 1YQ6A 2BGPA 1W8TA 3IPVA 4LOTA 5CNAA 2AR6A 2P2KA 4XC9A 5FY9A 3F95A 1SLCA 4Y5Z0 3T1LA 1TZOA 5CG9A 4AEDB 2HWB2 4ZKTB 3AMHA 3IN9A 4PLNA 4UWDA 5CYYA 2Y60A 3EBRA 2ADEA 2RR11 4AVAA 1KEXA 2D43A 2OPWA 5D2AA 5FOJB 5JOXA 3BI3A 2FDFA 2XBO2 3FL7A 4XCBA 2E31A 2ZAAA 1W9YA 3HT1A 3NRUA 1AJOA 3Q9OA 5FP4A 2ORZA 3LEMA 1S2KA 5IVCA 5T52A 3PMSA 4GALA 3N4MA 1D0GA 1UMZA 1LOCA 1W8OA 2PN5A 1CD3G 1VAVA 2Q1MA 5M0TA 3W58A 5LRRA 1ZM1A 3MDPA 4F3JA 1RUC2 1SQ4A 3AMMA 1YQ2A 1OA3A 2X09A 3CDZB 4Q4X3 1K45A 2JE7A 4JGZA 4MXWA 5FYMA 1D7PM 4R9CA 5A33A 4BXSV 3IDBB 4I3PA 1G9CA 3IM0A 3LQCA 3TN92 2GC2A 4LIUA 4CCLA 1RUOA 2VUCA 1JOPA 3IDAA 3VD4A 4UI9L 4CSWA 3OJBA 2HWC2 4Q1PA 3AJYA 3U1XA 1JS9A 4RQPB 3NL1A 1HRV3 3TBDA 1YIFA 3ILFA 2VZ3A 4FT8A 3GCWA 1PX3A 3RQ0A 3UNPA 4GZ9A 2HWE1 2EXJA 3CU7A 1QMJA 4AQ6A 5GZFA 3ZYHA 3WW1A 3POJA 3SCGA 3MUY1 2O1QA 2WZR2 3HT2A 2WYFA 1DYPA 4IE4A 4L8QA 2X5IC 3H8RA 2XB6C 3PJYA 2GP3A 4I0BA 4RFT0 2DUQA 3AMPA 4QHBA 3H3LA 1LKNA 2WWUA 1RUH2 3WNNA 1NA1C 2B8MA 3PNAA 2ET1A 3VBHB 5A6XA 2VCAA 4Q8KA 5HCHA 2VH9A 5F6LB 1COV1 1KFUL 3URFA 5JCTA 1J1LA 2ZHNA 3AFKA 4LUKA 3P5BA 3ILNA 2Y64A 3WG1A 1W9SA 3LCPA 3WY6A 4UBHA 1MEC2 4P9WA 4RL7A 4YSFA 4CE8A 2FDGA 1O4YA 1VBE2 2WC2A 5FY0A 3KB5A 3RZZA 4EWDA 1E5IA 1SHWB 2VO5A 1WGPA 4E8DA 1UKRA 4MGSA 5C9AA 4IEZA 1IPKA 2RMU3 2WNVC 1UIJA 5F3GA 3WQ0A 3VZMA 1PK6B 1C1FA 2LS6A 4LIVA 4X6QB 4E9KA 1UN1A 4HT1T 2WS92 3OBRA 4XBLA 1W3VA 4N53C 1S0GA 4M3CE 1AR92 5AVAA 1EV13 5J36A 3U11A 3E6CC 4FXKB 1H1IA 1QXPA 4B7EA 3MFCA 4DY5A 4G3YC 1AZDA 1R1ZA 2BW8A 2V5YA 1OH3A 4Q0VA 4QX3A 3UKVA 3I3BA 2CGPA 1VBA3 5SV5A 4NVPA 1ULCA 4GWJA 4NHXA 2WO3A 1ZX5A 3AM2A 2WT0A 2WNEA 2PQQA 1AX2A 2WLPA 4ISQA 1AR63 2JWPA 1RC6A 4YVSC 2OW4A 2FMYA 3WLUA 5IUQA 2FDIA 5T3NA 3ZFEC 2J1EA 2Z69A 5DG2A 3IBMA 4H2AA 3Q8EA 1OBNA 5FMOL 5EYXA 4FCAA 2VBBA 3HN1A 3MW2A 3KLSA 5J98B 4NPLA 2GNMA 1OXCA 4ZZ8A 4P5YA 4BJ0A 2DVDA 1UAIA 3UJOA 5GZDA 3S5AA 3LDKA 1RUD2 3CJIB 2DFBA 5KHJA 2VOTA 3HEIA 3WOGA 1I1EA 3WCSA 3ZKYA 4GJZA 1WMXA 3C7GA 3NAPA 3RWKX 1C4RA 2VR4A 1OF3A 2WFPA 2DBIA 2L9LA 1QDCA 4N43A 4NHYA 1DLCA 4S2HA 4Y24A 4AVSA 2QUOA 3O1VA 5AC91 2Y0OA 2V4VA 1ZBE3 3FFQA 2WQ4A 1GANA 1ND3A 2IXCA 4W6XA 1AR72 1V6NA 2C0ZA 3C2UA 3TNQA 2W91A 2Y6HA 1FYUA 2QTWB 1Q8VA 4PIYA 1C3HA 2RS51 2YBKA 5FPAA 1W6NA 3VBOA 2EIEA 3G6JB 2A3XA 2JDUA 1X33A 2D98A 3QH7A 1AR83 4NRQA 2WL1A 5JI7A 3MV01 1JZ2A 1QOOA 4A41A 3VDDC 5FZ8A 3PVOA 2VMCA 1YYNA 1APNA 1JYNA 2I07B 1ENXA 2ZPXA 4OHZA 4AHYA 1D2QA 1KS4A 3HPNA 5BNQA 2A73B 1PVC2 4KGGA 4FI9A 2QE3A 4M01A 5A7WA 3WHUA 1XNCA 3LFIA 2DCZA 4RR3C 1RUG2 3FLRA 4LKEA 2P17A 3H3ZA 5KC6A 2OQ7A 3OD0A 1JZ8A 1DHKB 1RVF3 3LFMA 3VDCA 1U0AA 1GZWB 1BLZA 3ZPOA 3BGAA 1IHMA 3E5UA 1JYTA 5T55A 1OLQA 1W6QB 4GQ7A 4R4XA 1W99A 1DGLA 1NE6A 1SCSA 3M3QA 2GC3A 1GU3A 3CZUA 1W2TA 1XNTA 5JR7B 1CJPA 3SXWA 1XB9A 3AZVA 3IT8A 2Z42A 3ACGA 5L7OC 4IEUA 3KV4A 2RS31 1OLRA 1GYKA 3ZYGA 2E32A 4OI2A 1I9RA 1PM4A 1RXFA 3WNOA 5BV6A 3I2HA 2X5IB 4QHZA 4YM2A 3NV3A 4BCUA 3M3IA 1YCIA 2PTMA 5CAZA 1YFYA 2GH8A 4HETA 2W1WA 1NA1B 4DEQA 2R1BA 1OOPB 1F31A 4RS5C 3ABZA 3LE0A 1ASJ3 4OHVA 1RHI3 4NROA 5DN2A 4B8EA 1Q8OA 4JDOA 5E16A 5FP3A 3BPSA 3I7DA 1W2AX 1JODA 5JXJA 3ZXEA 1W05A 3LOBA 4FPOB 4IV1A 3IAPA 2CNAA 1DLLA 1B35C 5D8AC 5ABJC 1O3RA 1D2SA 1O5LA 2XG3A 4AI9A 5F1RA 1WCKA 5KXCA 3O1TA 2UY8A 3U0ZA 2DVFA 1YEWA 3KD4A 5FMOS 4RHV3 3ZXFA 4OQ8A 1DCSA 2WNVB 5KHHA 4WVVA 2NMNA 5GLWA 4AQTA 4QU2A 3ZM8A 3B9CA 1PIV1 3LOIA 4MOAA 1W04A 4N53B 2RE9A 3O1OA 4XTPA 1SEFA 3KHBA 4UW5A 2LALA 2Q8CA 3ETPA 4AFMA 4XQWA 3WG3A 5C4WC 4GB31 2RR13 3LSDA 4Y5SA 4QX1A 4K6BA 5CB7A 4WM7A 2XHNA 3N36A 5BNOA 4XW3A 4HL0A 4XJ8A 3AX4A 1G9FA 1JU3A 2PHDA 4D7YA 2K46A 4YVSB 2ATFA 3VHPA 3BUCA 1NE4A 3ZFEB 3LWCA 5GZCA 1YLLA 1VR3A 1VAMA 1VJ2A 3AKPA 4Q4Y1 1MZEA 3INAA 5EFUA 2R061 1F9KA 4CEYC 4ZZ5A 4WVMB 2BV4A 4Z1VA 1QXJA 2DU0A 3CZJA 2PXJA 1XYNA 4LKFA 4XURA 5KXDA 2P37A 3ACIA 2ENRA 2XMLA 3DECA 4QD2A 4CDWC 4P5HA 3BTXA 3I97A 3VKOA 4JZRA 3I2DA 1RUE2 4XJZA 1HV1A 4YGDA 4EWEA 5FLJA 4RGKA 5ISLA 3RRDA 2AUYA 3NO8A 5L9BA 2QQIA 3UESA 2GNDA 3AFGA 5FY1A 5C33A 4CCNA 3NNLA 2OZ6A 4LE4A 2W1QA 4XFBA 5I0RA 3LF7A 1AXZA 5F8PA 4LHNA 3RFRA 1OD3A 5F9TA 2HWE3 2JE8A 4WVZA 2D40A 5DAPA 5D1IA 2A1XA 2ZAHA 3WP6A 3KMHA 3ATGA 2D6KA 4FPEA 1UXXX 4DQAA 1Z7S2 4MXVA 4NN0A 4EYUA 2WZ8A 5IK7A 1RMU1 1UPSA 4E4ZA 2CY6A 3W5MA 1QJY1 3KV5A 2J1UA 2Y0IA 5IFPA 4LXLA 2YG0A 1HIXA 2B42B 2VVEA 3VBFC 4Y22B 1COV3 4FOVA 3DN7A 5BXXA 2XL7A 1OPOA 2TUNA 3FHAA 1AXKA 4QXKA 4EZ4A 2W46A 4XJWA 3J7NA 5BPXA 4RR3B 3WVJA 2JDZA 4JGYC 3POEA 3SC7X 1VRH2 4OZXA 3U07A 5T5JA 1J84A 5CFDA 4QPIA 3AVSA 1BEV2 3SKJE 3ST7A 5T54A 2JICA 1K5MA 2RDRA 2C4XA 2VMFA 3CKHA 4LKSA 2HWF2 4L11A 2IXJA 3K48A 4AW7A 3RS6A 3C7EA 2HWB1 4BQ3A 3M3EA 2R30A 2DCKA 4YVWA 5FZOA 3T3YA 4AG4A 2XLGA 3WQBA 1LOGA 1UZZA 4JRLA 2JD4A 2Y33A 4C0BA 2X53S 2XBO1 1VPHA 2BOIA 2WIIB 3CEWA 2JB8A 5IYYA 2ADDA 5L7OB 4A3XA 3V0AB 1J59A 4C8DA 4BB3A 3GALA 4INDA 4NIIA 4K1ZA 3C7FA 4JQRA 4DUWA 3GGLA 5GLUA 4EV0A 3M4FA 4XFCA 4YRDA 3PIGA 5FKCA 5FZEA 4IE0A 5H9PA 4AAXA 4D7SA 1J58A 1Y7BA 1RUC1 3U4XA 5C7GA 1JOBA 4RS5B 1URXA 2YDEA 1TMF2 1VBD2 1CPMA 2JX9A 3AP7A 4QDQA 4AAPA 1IS5A 2VY0A 3TN91 2FMDA 4H55A 4A6OA 2D3PA 2CYFA 3APBA 4E4DX 2HWC1 3HBZA 4A2UA 2WFF2 5FYZA 4E2SA 1B35B 1FV3A 3FHQA 3JB8A 4EROA 3ZIWA 4NHLA 5T5LA 1UX7A 1YIPA 2W08A 4TLGA 4CEWA 5IK5A 1SLAA 1TNFA 5FUIA 1UMIA 4QX2A 4YZ5A 2D6NA 4TXWA 5HI0A 2W1SA 2FHRA 2JDAA 3J8F3 1GQGA 5AC93 4GJYA 1ZVFA 3DGTA 3V56A 1A78A 2VCCA 5G05L 1DDLA 1DGRA 2WZR1 2W95A 5JIUA 1H4HA 4COVA 3FLPA 2RS53 3W5NA 4AQ2A 2JDPA 1KFXL 2A6ZA 3DUIA 1RUH1 2CU5A 1AYN1 4DPNA 5C4WB 5J7MA 4BQWA 2VZ1A 5JZGA 5FY4A 4QM9A 2XJUA 4XF0A 2YROA 4QPGC 1CAWB 1T2XA 2Y34A 3POSA 1WBFA 2IXIA 5FDBA 2A6YA 3DPRB 3K51A 3J9SA 5F6KA 1GOGA 1MEC1 1CJDA 2Q30A 4YW1A 1SPPA 3ZKUA 3DYPA 4FPYA 5HXMA 5JMCA 1VBE1 3OYWA 2O14A 1LNSA 4IEQA 4LTAA 1QH7A 4Y20B 3UK9A 3AKQA 1DBNA 5FOBB 3VZLA 2YPDA 5JWPA 1SZBA 1V00A 3WDUA 2VNRA 4QGMA 5BUVA 4Y33A 3M70A 4KL1A 4EN6B 1KXGA 4CDWB 4KWKA 4XF3A 5C8CB 1KRIA 1CR7A 4Q4V2 3MIFA 3HNBM 1MS0A 1QH6A 4XJAA 1NCQA 1O5UA 1W6MB 2WS91 3CL1A 1SLLA 2A6XA 3JBG2 4PDWA 3VBSB 2XHKA 1MS1A 1AR91 5T5PA 1OD5A 3GBGA 2ORXA 3ME2A 4J6GA 4FTBA 3RMYA 3H1MA 4KWJA 1REEA 3WR0A 3GJBA 5I0DA 2D7FA 3M1HA 4JKKA 4CCKA 4CXXA 1IS3A 1H0BA 5CFCB 4B3NA 3VBUC 1MZ5A 4UFKA 3RPQA 1H9PA 3JUUA 4LBQD 3THPA 4GD4A 3N3HA 1JUHA 1U5ZA 2RS33 5FQ0B 1V6KA 1V9U3 1S0FA 4ZU5A 4ITCA 5AFBA 3S6PA 2QQVA 3ZN6B 2PAMA 2FBEA 3BOWA 2ZGUA 4LBQB 3VHOA 5LRSA 3ZMNA 1F5FA 1XSRA 4XVHA 1OH4A 1AL0G 3UL2A 4Q26A 2QZ3A 3ZYBA 5CKMA 5A7QA 4FP2A 1RUD1 2TBVA 4EN0A 3HR9A 4BWOA 5DDJ2 5EXOA 1QOSA 4XUPA 1WCSA 3SISA 3ZX7A 2WUHA 4BDVB 2Y8KA 4QB1A 1N3OA 1S0IA 1HX6A 4XFFA 1GZCA 2VZSA 2OUJA 5FREA 4BQXA 1G9BA 3WDXA 4H3WA 1X9PA 4OI1A 2HEVF 5FZKA 3LIGA 3LD8A 3O12A 2DBNA 4FTSA 3THTA 1ULFA 4JGZC 1PIV3 1H9WA 4XFIA 3ACFA 3ZYPA 1O3QA 3MLLA 4NR1A 2WR9A 1CAUA 3DKWA 4MVTA 4FPGA 4LULA 4WVWA 2HH9A 2BERA 1CIWA 4HN0A 2GC1A 4UOJA 1ZZCA 2VOKA 4GB33 4GMP1 3L2HA 3QLQA 2X8KA 4H7MA 4MLOA 1JZ6A 4P9LA 2SBAA 3MF9A 4BIOA 3HAGA 1PVC1 1QJZA 2OPKA 4P9XA 1ENSA 4LHLA 3DYMA 3USUA 3HNYM 3IB3A 5K8SA 1QDOA 1KDKA 1RUG1 1F4AA 2W94A 3E1F1 4PT6A 3ZOIA 4ZU7A 4MO3M 4Q4Y3 1KDMA 1JMUB 2R063 3NNMA 1B09A 1XC6A 2WN3A 4M3CF 2QJVA 3E97A 2GNTA 4S2FA 4COUA 1FV2A 3DYOA 1NQJA 3BN6A 3OY8B 3HD8B 3R4DB 2NM1A 1HJGA 4JKLA 1STMA 2UWCA 3OF1A 1MR5A 2QQLA 3O1UA 3PDQA 3EXUA 3FMGA 3B93A 1BCXA 3WF4A 2ES3A 4XABA 4XXPA 4IGQA 1H6YA 3KCCA 5LATA 2TEPA 5B4XA 2OT7A 3CHXA 1LODA 1XBFA 1H1MA 2EVXA 5C9AC 4JHZA 4MGTA 5I93A 4COZA 1NKGA 2VTFA 3FBYA 3PJQA 1X8EA 4IDZA 4CU8A 1H2KA 1GBGA 1DGWX 1EAH2 2B45X 3D0JA 4MYEA 3T4HB 3M3OA 4YW7A 1QJY3 4DUXA 5FZ3A 4YW4A 3I3MA 3OG2A 5ACA2 1V6MA 2UYAA 5JXGA 3WSOA 3H1YA 5DUVA 1ALYA 3NNFA 2ZKNA 3MO4A 4BMEA 3P3PA 5IWFA 2R042 1H2LA 4CP9A 5JSOA 5JOYA 3WNPA 3MICA 4P14A 1YFUA 2GNBA 4E4HA 1D4M2 4CDXA 4QPWA 3SMHA 1XYOA 3R05A 4KH9A 2ZJCA 4NPRA 1KJLA 3NJVA 1ULGA 2B46X 5H9SA 2C9KA 5EHDA 4FAGA 3TWIA 1A6CA 2QBXA 2ZGQA 1NOVA 1CX1A 1BKZA 4P9JA 5JXIA 3MW3A 3D4KA 2BQPA 3WP3A 2VJXA 4IEWA 3E6DA 2W52A 2UURA 4BPZA 3N35A 2O0OA 1UY2A 4YG3A 5CISA 2HWB3 1OKOA 1UWWA 3N7MA 3M2MA 1LGBA 3H7JA 3KM5A 3I59A 4AI2A 4CPBA 3NAPC 3ZXAC 1M06G 3QOPA 4E27A 5L19A 1W0PA 4CUAA 1DQ6A 2EA7A 1RMU2 2LW8A 4A4AA 4WM8A 3UT0A 3VBUB 2XBO3 4FP3A 4N43C 5GZEA 3W59A 5DZGA 3VDBA 3CO2A 1PO22 4FQZA 3UGHA 3AYAA 3BTAA 4IE5A 1ND3C 3ON7A 2VAUA 3RZKA 1RUC3 1CN1A 4LBKA 4OFGA 3H8XA 1YNAA 2XWJB 1UY0A 3VBOC 2P3YA 3FUOA 5FXVA 1C8NA 4AE2A 5JOWA 3NMBA 1SLIA 5FO7B 1S4CA 3N9MA 3TN93 1RUE1 3ZFGB 3O7OA 3WF2A 2A6VA 2KXLA 3RYKA 1OF4A 3A7QA 4K21A 4YGBA 4CDQA 2HWC3 3V0BA 3MFAA 5CG8A 4Z92B 5F32A 4YM1A 5FXWA 2VMGA 3AJZA 2PQSA 2GH2A 2R16A 2WNOA 3IIIA 1W3XA 4QQPA 1MS4A 1NLRA 5FZ6A 1ULOA 1BQPA 3Q8FA 4DZGA 2ZGTA 4IE6A 4JGZB 3R4UA 5A33B 1LJ7A 1D0HA 1WLDA 2YC4A 1Z7S1 2WZR3 2JG9A 3N7JA 4AGGA 2CTVA 4RGGA 4J1XA 3ZXDA 2WDBA 3ZXGA 1NCRB 1RUH3 2KD7A 1YJKA 2QNKA 3OPZA 1GP5A 5EV7A 4IUGA 5FYSA 2QQUA 1UD1A 1O59A 1UYXA 2RV9A 3B94A 4BIFA 2WT2A 5CFCA 3KQRA 3Q8AA 5F7UA 2HEYF 2VOXA 3VB9A 1U5XA 1FOD2 1E5HA 1MEC3 5JXHA 3MIHA 2XJQA 1RIRA 3WNXA 1VBE3 4NHKA 1VRH1 1X9TA 2BUKA 5FTTC 1K3IA 1W0NA 4DXZA 5FZCA 1YO8A 5FO8B 4CXYA 3OEBA 5LBFA 3HN3A 5BNPA 1BEV1 3ES4A 3ZYJB 4BLJA 5BNNB 2DUOA 4MHUA 3I4IA 5FRAA 5FY5A 1KQRA 3PVEA 3QACA 2HWF1 2D6MA 2VZOA 3SITA 1DGRN 4YM3A 2VMHA 4HG6B 2A70A 2WS93 4IETA 1PZ7A 2ZACA 3T4VA 1PMIA 5JIAA 1AR93 4DO0A 1LOBA 4L0PA 3UJQA 1U5IA 4IV1C 5JR2A 4QX7A 1SDDB 3WNKA 3NVCA 1MS3A 4XAEA 1AYN2 3WXPA 2RDNA 2P3JA 2ZMKA 5FK7A 4PHZA 1IG0A 1HRI1 2PHFA 4JRAA 3K77A 4LJHA 5FZFA 5I0UA 2GU9A 1S0JA 1RJ7A 2BJSA 1L3JA 3KCYA 1TMF1 1VBD1 3V65A 1YFXA 1LB2A 4PF1A 1UYYA 2I2SA 3BTYA 4AXOA 5A7OA 2EIBA 5FZLA 2V09A 3ZXJA 1LTEA 2JDMA 3NSTA 1O4TA 2K2SA 2BDRA 4R9BA 1RUD3 2YHJA 2ZCWA 2WFF1 2ZEWA 2Q1ZB 3WUCA 4YARA 4WM7C 4OVEA 3T1MA 3TNPB 4BMBA 1OUXA 5BNOC 2RS12 2ZX2A 2AH2A 1ZBA2 5FYTA 2A5ZA 4LA3A 4QU1A 3ITQA 1JOJA 2NPIA 1XYPA 1TEIA 1CAXA 1ZZBA 2O8OA 4I09A 3ZSLA 2YB7A 2JG8B 4FPLA 3MZHA 5J3UA 4QDRA 4S2GA 1UY1A 1AR73 5JSPA 1HQNA 3NNGA 4GH4A 4D0QA 3VBRA 4GMP0 1FMD2 2XUEA 3E5QA 3H8OA 4QPYA 3NAPB 3FWEA 4LLOA 4PLMA 1RXGA 4KG8A 2VZUA 3VZJA 5A3NA 5C6CA 2Y6LA 3KSCA 2VD7A 1LEMA 2VBPA 4N43B 4GMP3 4DRRA 5FZ4A 2BGCA 2BWAA 4UFMA 1N1YA 4BH9A 2AZ5A 4CVUA 2KA3A 3J7MA 4LR4A 3MPBA 1PVC3 1QQP2 4M3CB 2JDYA 4E2QA 5HV4A 2D6OX 1ND3B 1SBFA 2CV6A 1JYCA 3C7OA 4OLLA 1QEXA 1GZ9A 2D6PA 1J83A 1FPN2 1RUG3 1F5JA 1SBDA 4YW3A 2ID4A 1TNRA 1W2UA 3B9IA 1W6NB 4B1LA 4YGCA 1UMHA 4QB6A 1DQ4A 4XAAA 1CIYA 1WWYA 4P9IA 1DF0A 4Q4V1 5IT6A 1PMJX 1OQ1A 3ACHA 3MIDA 4XTMA 2DCTA 4NPMA 1RUJ2 3WQ7A 1UY3A 2NYYA 2R32A 3OGJA 4GXLA 5K0UA 3JBG1 1WMFA 1AX1A 3HWJA 5FXZA 2Q1FA 4PI2A 4D94A 5A7WB 2F17A 2ZX0A 4LNVA 3PVBB 3R6SA 3S5QA 4CU9A 4BQ4A 5FLIA 1VMHA 3P1IA 2GMEA 3RMXA 2N7GA 3E6BA 5CFDC 1RUNA 4QPIC 5FY7A 5I8SA 3I2KA 4BQ5A 1AVBA 1K5MC 4XF1A 4XJUA 1JHJA 2BGOA 1P8JA 4COWA 1VB4A 1RGSA 4R4ZA 3CJIA 2B39A 2VNOA 4L2NA 3C7HA 2VQ0A 4QGNA 5LA0A 1W9TA 2RJ2A 4YVWC 4FSJA 4SLIA 3T09A 1H1AA 2QDRA 2OKXA 1JW6A 3EHKA 4W6WA 5KR7A 5L36A 5DDJ1 4KBBA 4D6RA 1UZ0A 4TTGA 1QU0A 2WSUA 4QKBA 2X05A 3VKNA 5FMBA 4NAOA 3UV9A 1XE7A 1BMV2 4AL9A 1WKYA 1AJKA 2MHFA 3H42B 1US3A 1W8NA 2D6LX 3PLQA 4PBOA 4X8PA 2OYZA 3CIHA 4Q2FA 2HBTA 1WLWA 1MZ6A 2ZHLA 2P3IA 2ZEXA 3SEPA 4LUMA 4OZOA 3USSA 3QCWA 2VMEA 2VW2A 5FCCA 1W8UA 2ZX4A 4JX0A 5FZGA 3J7LA 2VMIA 3LA2A 5C3OA 2G9FA 1XSQA 4XACA 4CZSA 2I74A 1JZ4A 3T2OA 5LEJA 5FUPA 4LITA 5IAVA 1DQ0A 4V2WA 3T0AA 1J1TA 4XDOA 1POQA 2YC2A 2ZZJA 2ZGLA 5T50A 3LDRA 3DCQA 3OGGA 1PZ8A 2R0HA 3BCWA 4CEWC 1H2MA 2CAUA 2WRAA 4N7IA 3AZXA 3BIWE 1QY4A 1GZWA 1WD4A 2XQRA 2QQWA 4CCCA 2YU2A 2FDKA 4HKLA 5FUNA 1JUIA 4IL7A 1J3PA 2DUPA 2VPVA 4IESA 4JTNA 4NHMA 1W6PA 2F4LA 4NWVA 4Q4W2 4MHRA 4Q8LA 4PCRA 1GUIA 5JZGC 2DTYA 5F3EA 1XU2A 1RUE3 4ASLA 4IEYA 4WM7B 1SMVA 4FPCA 1GR3A 1DFQA 2R072 3Q8BA 5DUXA 5BNOB 2VZVA 4R9DA 4ATEA 3KGZA 3HIFA 4M0NA 1ZNPA 3MI8A 4LBJA 1ZRRA 5FPLA 3BPZA 3WZ1A 1PGL1 1DGWA 1WW7A 5EP9A 4DFSA 2WO7A 1W8FA 2D3SA 3VL8A 3H50A 2YYOA 2BWCA 4XMAA 3WT3A 4HPKB 3JD72 3K46A 2BVVA 1IOAA 1UOBA 3OBAA 1OHFA 1E5SA 1CZVA 2VVFA 5CKNA 3SNMA 1LRHA 1UIKA 4KBZA 1LENA 1Z7S3 1EAH1 5A6YA 1VAKA 2P5BA 1NCQC 2VUAA 1L7LA 5E6HA 2A3WA 5C3QA 3BU0A 4PDWC 5IVFA 1LGCA 2VZTA 1NAEA 4YFZA 4XF4A 5ACA1 1H8TA 4LO7A 3CBNA 4U2AA 4AQSA 1AHSA 2MEV1 3MEPA 3RWNA 1MACA 4IEPA 2JJ6A 2PHTA 2Q8DA 5F5QA 3MIBA 5KXEA 5IVYA 1BYHA 1W03A 3B7MA 2FZ2A 1MVQA 2R041 3AYEA 4QGLA 4EQVA 1Z78A 3RDIA 2GZWA 2BNOA 4O7XA 5CA6A 1UU6A 1D4M1 1VRH3 2ARBA 3N7KA 4MH0E 3TAYA 3JQWA 2UYBA 2H0VA 4XDQA 1W6OB 1RITA 4AEKA 1PNGA 4V1PA 3WDTA 1BEV3 1LHVA 4QDSA 2YY1A 1Q43A 1ND2A 2RHPA 3TEXA 2HWF3 1JYIA 4CDUA 3OGRA 1UZYA 1YQCA 2WWJA 2BBVA 1GWLA 4OULA 2OZJA 4NIDA 4K1YA 1PVXA 5AVPA 4XHXA 1QNYA 3VN4A 2ZZQA 2C5DA 1NT0A 4JCKA 5KC5A 1PM7A 2JD9A 2WJSA 4YZ3A 1TME2 3ZSEA 1ZA7A 1T6BX 4AI0A 1DQ2A 1RUF2 4X8NA 3VDDB 5CFDB 4AYUA 1OSGA 3MHZA 4NWWA 5GKAC 3ZSKA 1PO21 1QJX2 4WVMA 1HRI3 2VQUA 2E33A 2R7EB 1UX6A 2YC0A 3JQXA 4AOCA 4G4FA 3KQ4B 1EUTA 3VD3A 1CESA 4R52A 1TMF3 1VBD3 1MZFA 1UKGA 4YVWB 3D6EA 1F15A 4L92A 2ZGKA 5IVJA 1CVNA 3TB0A 4FBFA 1JZ7A 4DXSA 4XF9A 1XE8A 4LKDA 4PJYA 2WFF3 3AKSA 3TRSB 5E88A 5EJ1B 4BYYA 3ECQA 1JYWA 1FI2A 1PO12 2UU8A 1CAVA 4D8MA 5IK8A 1PMHX 1ST8A 3GYDA 3TEWA 5HV0A 1ACCA 5DG1A 2E7QA 3E5XA 4NO4A 2GMMA 1UQXA 1MS5A 3ZDSA 4PLOA 2VE1A 2YUEA 2WNUA 3JZVA 1AYM2 2DVGA 3GZEA 2P6HA 3U78A 2ZGSA 3WF3A 1OMIA 1LOFA 2FCVA 1NX9A 2YZ4A 3LPFA 4I01A 4QAWA 5FZBA 1HRI2 2WA4A 2DU1A 4Y22A 4Y4RA 3ZFFA 4HVQA 1LEDA 2AACA 2H6BA 4R8HA 4S2DA 2XWBB 4BZ4A 2G4IA 3IIAA 1UYPA 1FNZA 1JH5A 2AGSA 2VM9A 4HFSA 2XJTA 3VKMA 3BALA 5EJ3A 1EY2A 1DG6A 2EAAA 4HANA 3BOPA 1FOD1 2LRPA 3POIA 4HOOA 4XDPA 4ZY9A 2WZPP 1W9FA 1UF2C 1AUYA 4Y26A 4BQYA 3B69A 5C70A 5LW9A 3TEZA 5D8AB 2DF7A 5ABJB 1FXZA 5J1XA 2FCUA 5DPNA 4JAAA 4BA6A 1UL9A 1HDKA 1LGNA 5A32A 4DNYA 2BNMA 1S55A 3UGFA 5FZ7A 3TEYA 4ASMB 3AMNA 1RINA 4Q4V3 1J3RA 1G8WA 4D69A 1QJU2 2Q8EA 1I5PA 2WO2A 3VZKA 3JBG3 3WDYA 1ZREA 2X29A 2WLQA 2YPJA 3V0AA 1ENQA 1JZ3A 2FCTA 3I2OA 2VMDA 4K20A 3U37A 2PMWB 3KZ4C 4XPVA 2FDJA 1VBB2 1R082 5LEKA 1R1A2 1WZXA 3UYJA 4CDXC 4N9IA 4R9AA 2ZABA 1TE1B 5FY8A 5IAXA 4FTEA 3R0RA 2YMZA 2ZX3A 3RI9A 4C91A 5F5CA 3WHTA 2FQPA 2H6CA 2BZDA 5GALA 4EZHA 4EN9B 4PDWB 1X8MA 4OUEA 1Q8SA 5CKQA 1XXNA 2GP5A 4IQPA 1YI7A 1WBLA 2IC1A 2XQXA 2XLFA 4CEYB 4L9BA 2A75A 1JU4A 3AP9A 4PIXA 4NIAA 1M4WA 4CRQA 2VZRA 2VOVA 2YV8A 1KD7A 4WM8C 5DDJ3 3ZVXA 2ZHMA 4QX5A 2G9GA 2RS11 3LA7A 1IG3A 1WLCA 3AKTA 3GZUC 1ZBA1 1AX0A 2J1AA 5A6QA 1SLTA 2P4EA 5JLVA 4Y1YA 4YFWA 4N90A 2AEYA 4O9GA 2C26A 1W9WA 2VZQA 2WYSA 1REFA 3ENRA 3NV4A 3ZO0B 5ANQA 4OUSA 4CCDA 2JXAA 4IEVA 2EALA 3MLKA 4NAMA 4QQLA 4DEVA 2ZGNA 2W2IA 4OCTA 2GN7A 4IEXA 3THDA 3A4UA 1AXYA 3PURA 1FMD1 2J1SA 2XVGA 4GULA 2OUHA 3KCXA 4CDQC 3RZJA 4CTEA 4RSUA 4QQHA 5CVRA 1W90A 5LY1A 1VIWB 1YQ5A 2ZKLA 1BXHA 2HYXA 4Y20A 1YUDA 2JECA 4HSJA 1ULPA 3P3NA 4QWNA 3VBFB 3D3AA 4OQ9A 3RJ2X 1JXNA 1QQP1 1N47A 1A3KA 3A23A 3PL0A 4PF5A 5KHIA 1FPN1 4YW5A 3WP4A 2WKKA 1VBC2 5DZEA 5LZ6A 2AC1A 4JGYB 2JG9C 3B5LB 2DCJA 3VBSA 4IERA 2XH6A 5A3WA 4UFHA 2Y6GA 2W9XA 1RUJ1 3HOBA 4AFCA 2XJPA 1NZIA 1AL22 3AK0A 1PGSA 3PVNA 1C1LA 2XJVA 2NMOA 1H30A 4FFFA 4PQ9A 3FBMA 1DU3D 4KWLA 3SKVA 4BE3A 5FWJA 1HXS2 2QZ2A 3GZAA 1XNDA 2RMU1 3USUB 3KVAA 2QQJA 5LA2A 4UXAA 2D5FA 3ACLA 4YGEA 3S7EA 4IV3A 2AREA 1PX4A 3KF3A 5FXXA 5A3LA 1SDWA 5K9YA 2XPJA 5FZMA 3ZN6A 3LB9A 4LBQA 5BNPC 2FZ1A 3QBQA 4QMAA 4FFHA 1SCRA 4AEDC 2SLIA 4OHXA 4C1WA 5FP9A 4MG2A 3IWZA 3LAGA 5C3RA 1EAH3 4EE2A 2J22A 4BLIA 4KG0A 4HK9A 3VL9A 5IVEA 1MQTA 2CDPA 2RG4A 2XVLA 4YPJA 1DQ1A 3RG0A 3W21A 1W0OA 4ZXEA 5GLTA 5ACA3 4MSVA 1LHOA 1G9DA 1RB8G 1ZRIA 3K3NA 5FMCA 2ARCA 1S0EA 2ET7A 3A0NA 3PUQA 5DAWA 2XDVA 1ZRCA 3JCIA 2JIGA 1SG3A 2BBAA 3HJRA 3PTRB 2R043 1GQHA 4UBGA 2ETEA 4Q5OA 4FFGA 4YW2A 5DUWA 1BMV1 1V0AA 1GP4A 2XKOA 1LECA 4MV2A 1D4M3 5LY2A 3KF5A 1QKQA 1HKDA 1JHNA 1EYBA 2BVBA 4I0WB 3BVCA 5HBAA 1PGL2 4URTA 5I0TA 5FZ1A 3S30A 5FZHA 5IHRA 2CWMA 2XJRA 3AXDA 3O1PA 4B4PA 4LQRA 2WAOA 1WD3A 4JC1A 1PGW1 2WZEA 1SFPA 1W2OA 4FQ4A 2C24A 5H9RA 3LEKA 4W50A 4IGOA 2VL4A 2OVUA 1ZBE1 4LE3A 1RMU3 1UU5A 5L9VA 4UFJA 1MS9A 1W2NA 4QPGB 3IZOA 3KT7A 1O6UA 1XNKA 5F39A 2YGMA 1PO23 2UWBA 3AKRA 4ZS2A 5JUVA 1J3QA 3GBWA 4EJRA 2EAKA 2MEV2 2R0FA 2ZGOA 3PU3A 2D44A 2J1RA 4M00A 3FZ3A 3ZMOA 3ZN5A 1GICA 3T2TA 4FPKA 3AP5A 1QIQA 4XXAA 3PIJA 3ZDVA 4GH4C 3VBRC 3N9NA 4Q4W1 2ZBJA 3IAQA 4KGQA 1R092 1BBT2 3I59B 3QD6A 1UYZA 3VKLA 4AEMA 2CSGA 2JB4A 4Y1ZA 3UKNA 1H2NA 4WM8B 2R071 2VULA 2JKXA 4CCMA 1F8VA 5FP7A 1OVPA 1JBCA 1DIWA 4YZ1A 5FJHA 4RGAA 4NE9A 3B00A 4F83A 3OPTA 4NIGA 3IDCB 4D6QA 1QNWA 1HB3A 4LO4B 5IVBA 5IFTA 3WX5A 1GNYA 1GNZA 4TSVA 2Z79A 3AL6A 1Q5OA 4WBBA 1TG7A 1WCUA 3CQOA 3JD71 5FZ0A 2QQOA 2VVDA 4N8MA 3ZYRA 3WF1A 5L9RA 2Q4SA 3I2GA 4MADA 3RJRA 3WG4A 4AGRA 4LORA 4B7KA 4DRVA 4E2GA 3BIEA 2WQ8A 2V72A 1CPNA 3RZHA 2RM22 3H0OA 5EWSA 1FATA 4I0AA 4B1MA 4CDQB 3IPVB 5JI9A 1Y9GA 5K0UC 3V0BB 4UF0A 2DVBA 2TNFA 1O7FA 1YXWA 3GNEA 4Q0QA 3H9AA 1UY4A 5C5TA 4B4RA 5FPZA 1FOD3 3A22A 4ZS3A 3F2ZA 4ET7A 3AVRA 3J4UH 3POYA 2V4AA 4DXRA 4P00B 1OLMA 4RN5A 1RL3A 3FN9A 3LZZA 1HB1A 2RDQA 3NQHA 4BISA 3NKTA 4ORFA 4K8FA 1BVVA 2JG9B 3I2FA 3AYDA 3ZYFA 3RSJA 1EPZA 4O61A 1LU1A 3VDAA 3CJIC 1NY72 2VC9A 3WW4A 5JPNB 2P6CA 2W3JA 4FOQA 4PQQA 1LR5A 2ZMLA 4A3ZA 4MXWB 5FYHA 3OUHA 2WABA 1KJRA 2Q0AA 3OUJA 2LROA 3EQEA 3J7HA 5FYUA 4XILA 3TYJA 1L7QA 1TME1 3KT4A 2WSVA 4DMIA 5J48A 1RUF1 1AYN3 3LDBA 4FXGB 3S7IA 2ZA9A 4LO8A 5I8TA 1ZYBA 5IW0A 1TQ5A 3KGLA 5BNPB 1QJX1 4COYA 3VV1A 3QH6A 1RUI2 5DUUA 1W28A 2EIGA 2HKXA 1C8M2 3NV2A 4IGPA 2QFEA 4BK4A 4YG6A 1DZQA 3ZIXA 5DAXA 1YC61 4ZONA 3ZFGA 2VXJA 3ZSJA 1Y9QA 4D6SA 1V6JA 2PLV2 4KWUA 3POWA 4MGQA 4HZFA 3M7AA 4O9EA 1QXRA 5B4NA 1E57A 1C5HA 2HWD2 1XNAA 5LB6A 1I3HA 4AEDA 1CZSA 3VZNA 3ELNA 1IS4A 4BQ2A 1JYVA 5A1FA 2D5HA 1K12A 1PO11 5E8AA 3HBKA 2RS13 5IATA 1OFNA 3FX3A 1SACA 1DYKA 1U12A 1ZBA3 4FPJA 1K42A 4KU7A 3PUSA 1LULA 4OHWA 3DXUA 5LBBA 4MGZE 4MGIE 2R6QA 1AYM1 4O65A 1NCRA 3IKWA 5DABA 3AP4A 4YW6A 1G86A 1O3TA 2BTVC 3M3CA 4OHYA 1HW5A 5C9AB 4DXTA 4SBVA 3JU9A 4Y1VA 4A42A 5LK7B 1FMD3 3MF6A 3ZPYA 3I49A 4HSLA 1C28A 4OMDA 3AC0A 2HBUA 4XYXA 4KMQA 1PHMA 2V73A 3FLTA 4CUBA 1HJFA 4RQPA 1MVEA 1CAXB 5CADA 3RZMA 3O0XA 2JDHA 1ODNA 5BNNA 1QQP3 2GN3A 3ILRA 3LKJA 4HKOA 4XMIA 1GLHA 5KBFA 4META 4XBNA 4ISRA 3VHRA 1FPN3 1OOPC 4LO5B 4GH4B 1MPXA 5B2GB 4NIHA 3VBRB 3N9LA 1HQLA 3TOJA 4NUBA 4LO6B 4Q4X2 4CP2A 1PNFA 1E5RA 3P6BA 4J1WA 4UW4A 1ZZ9A 4XHBA 3CF6E 1QJU1 1RUJ3 3OTFA 4XFAA 1NLSA 4XIKA 1N1SA 5E1RA 3H3UA 1JI6A 3AZZA 1H8TC 3LGRA 4L97A 5IJRA 5FPXA 4TZDA 1TVGA 1X50A 2PHXA 4H7LA 4WZCA 5FV3A 1HRV2 4LBOA 3VBHA 1Q8PA 2HJIA 4ARXA 4MGYE 4ASKA 5LA9A 4D7TA 2YGLA 4DIQA 4YG0A 2BYVE 1Q8QA 2IWGB 3MIEA 4AVTA 1VBB1 1R081 1ZZ6A 5FZ9A 1R1A1 4JDMA 4ES9A 4KI5M 2VG9A 3V64A 2KR2A 4AHXA 4C0HA 2ZHKA 5E89A 4JKMA 1ND2C 5FZAA 3WNLA 2VNVA 3U4SA 3S57A 1K5JA 2YFZA 4AFBA 3X29B 4CDUC 4XIOA 5K0UB 4FOYA 5I0SA 5K7PA 4CYDA 2XKPA 1PK6A 2ARXA 3LA3A 3ORJA 4QKDA 4DS0A 5FZDA 1HV0A 3VBOB 1LAJA 1Y4WA 5FMDA 5CBLA 3RI8A 2ZTNA 2PYTA 3WDWA 2D93A 4JHTA 5EZWA 4IEOA 2WN2A 3A0KA 1DP0A 3HNMA 3HQRA 1OFSA 2EICA 2JG8A 5H9QA 5JAXA 4N7UA 4K8RB 4QQOA 2WA3A 3GF6A 3N9PA 5LASA 2JE9A 2RMU2 5LA1A 2W87A 1N1VA 1W39A 3GZTB 3PUAA 4FFIA 4CXWA 4FAHA 2NP0A 3AYCA 3HVDA 4XCAA 1H6XA 2WO1A 2QCSB 1G7YA 3PHMA 1OT5A 2QKDA 2BEOA 5JVVA 3ZSMA 2VUJA 1EV12 4YLZA 4Y4YA 1FX5A 1SFYA 4UW6A 4F7ZA 1YRZA 3J8F1 2RJKA 3N7LA 5J37A 2LTNA 1PZ9A 4M3CA 4YZ4A 2VTXJ 1WW4A 2CL2A 1HQWA 1GKBA 3OSDA 1VBA2 3T2QA 5HCAA 5CEHA 2R49A 2PHWA 2VCBA 1DYOA 1AR62 3KHCA 3NJXA 2A71A 2WNUC 4LPLA 1VBC1 3THCA 2GSYA 5L73A 5F2WA 1ONAA 2P34A 3O0WA 1KS5A 4NOTA 2B9VA 1LOFC 3RGBA 1WA6X 5EQUA 4W8JA 4XJ9A 2XJSA 3AMQA 3ZFFC 2BOJA 4Q4W3 3SLIA 1GFF2 3G7DA 3PMEA 3EB7A 2PHUA 4AFDA 1NQDA 1BHGA 1JTZX 4BHPA 1G6NA 1EP0A 4Q0UA 1WW5A 1AL21 1LCLA 4QX0A 3ZR6A 4AEJA 5A1AA 4LT5A 4DB5A 3OCPA 2WBKA 2R073 4DOUA 1X36A 4AZZA 2E7AA 1WCDJ 4KU8A 2IVIB 3T2PA 1HXS1 4ATFA 4HMZA 5JDBA 2ZMNA 3OD4A 4RA0A 3UKTA 4XZUG 4LHKA 2GAUA 4UW3A 3W9AA 1ZRDA 1PGW2 5A3TA 4IV1B 4XBQA 4WV8A 1Y43B 2IZWA 5FKBA 1ZBE2 2J7MA 1RTVA 2XL9A 3POBA 1NXD1 3JD73 4OUMA 4C1XA 2ZGMA 4MX3A 1W6PB 4KNCA 1UOJA 3ETQA 4ZU4A 4N9HA 3OGVA 2DFCA 5FP8A 4DUVA 3RZGA 4OYUA 4AHWA 2BPA2 4AK3A 1O91A 1AR82 4RD7A 5FFOC 3BU7A 5LBEA 4B4QA 2K0GA 4CUGA 1C5IA 4XFGA 3NKGA 2W68A 1V9U1 4BU2A 4CCOA 4A7KA 4F8AA 2YXSA 1W6QA 4OI4A 1UU4A 1POV1 1RJ8A 5FYIA 1LHWA 3M8LA 3NJYA 4P02B 2IVJA 5A3OA 4Y1XA 2K9ZA 2W0XA 1OQEA 2XXZA 2Y6FA 4M4PA 1FAYA 2JKBA 3FFZA 5CU1A 3PUHA 4QQ2A 1DZTA 2VQTA 5SV8A 3WD5A 5C71A 2IXLA 5LCWL 3FC0A 2IUWA 3POGA 4RFRB 3RZLA 2MNGA 1RVF2 3WF0A 2VXRA 4MZUA 1IZ3A 2X5IA 1XRUA 3MBWA 3FJSA 3WV6A 1H8TB 4Q0SA 5DMYA 3PUIA 2Z2SB 4W4ZA 3ROUA 2I45A 2ZX1A 1NA1A 4JDNA 4Q1RA 4BM8A 1OOPA 4HBNA 3GJAA 4MGKE 2PAKA 2W39A 2ZEZA 2DURA 1YI9A 2NQYA 1TME3 3FHIB 3BYWA 1UZWA 1RUF3 5JMOA 1N3QA 5F2SA 5A7SA 4YM0A 5APAA 2W1UA 1QJX3 2YFUA 3EO6A 3SCHA 1IKQA 1ND2B 1S0DA 1US2A 3B02A 4A6SA 4Z2AA 3BODA 1VB2A 4CDUB 4XETA 5HCBA 5LK5A 4V2VA 3D8CA 3CJXA 1GQPA 3BTZA 2WNVA 1VP6A 2QQPA 2OS2A 4A44A 4E4SA 4RYDA 3RVHA 1HB2A 4HXCA 1OURA 1R091 1IKPA 1ASJ2 1BBT1 1QGLA 1RHI2 1S0CA 3DPRC 5FIXA 3SEEA 5EPAA 3MIGA 3WW3A 4URAA 1JYXA 4N53A 4XZPA 3IMMA 4G9SB 2JIJA 1QWRA 1V6IA 3HQXA 1OKQA 3SH5A 2GALA 4AR2A 4ES8A 2C9AA 1CONA 4FPFA 1PO13 2P1BA 1BVP1 4XEZA 1GNHA 4Y5TA 4HPKA 2Y6KA 1QF3A 4UT5A 3JXSA 2D97A 2LM3A 2ZXQA 1W8ZA 4HKWA 4YNIA 3SHRA 4RHV2 2AEZA 5C8CC 4AF9A 2Q8OA 4YVSA 3WEZA 1G9AA 4E8CA 2R1DA 4KQ7A 1AYM3 1NZCA 3VBSC 3W20A 3ZFEA 4AVVA 4UFLA 5A7PA 4QPIB 3AXEA 4XQ4A 1IPSA 3MLJA 3OPWA 5FBZA 5LWBA 1CWPA 2RM21 3DL3A 5I8YA 1K5MB 5GLZA 3ZXKA 3ZR5A 4LOSA 3NNJA 1F4HA 2W5FA 5BYNA 3H8UA 5FYVA 4XUQA 5FR3A 1H8VA 1REDA 2RR12 3T0BA 1CAVB 3GHNA 3VKFC 3WUDA 5CFCC 5KHGA 1KITA 1N3PA 2F6BA 3AZWA 3JB4C 5T5OA 3VUOA 1LOAA 5FZOB 4Y3OA 4AWDA 4BOWA 5F37A 2EXHA 1HB4A 1UXZA 1W6OA 2YU1A 3WG2A 4IV3C 5F5IA 3DXTA 4Z8BA 2MPFA 2E9QA 2WNUB 3EYPA 3NWKA 1LESA 4GAZA 5HXVA 2FDHA 4U36A 1OI6A 1VRBA 1GMMA 2B5HA 2PELA 2XONA 1R64A 2IFRA 5GLVA 2WQZC 2OIIA 3ZFFB 2IXHA 2HLEA 2V5DA 2VECA 4IE7A 3U14A 5C5UA 3WQ1A 3S0MA 1BK0A 1WW6A 2PHRA 1NY71 3B01A 5F5AA 3T0DA 2G1MA 1FT9A 3AB0A 1VMJA 1QJU3 1F35A 1OVSA 3NJZA 2YBPA 1MQTC 1Y9MA 3D82A 4XUOA 5FYCA 4YYOA 3MPPG 1SLBA 1YJLA 3U10A 4XUNA 5AFEA 1DQ5A 1XPWA 5C3PA 3VDDA 1GOFA 5A3MA 3D5OA 1GP6A 3OGSA 5FPVA 4NRPA 3LEIA 2ZGRA 4K7JA 4QKNA 4HONA 2P3KA 5DAQA 1VBB3 1R083 2Q5TA 3IDEA 1R1A3 1GWKA 1HN0A 1O8SA 2CGOA 2ARAA 2HWE2 5GM0A 1F2NA 5A32B 1NYWA 1NUKA 2Z4FA 4LHSA 1RUI1 1GSLA 4RR3A 4CEWB 1IGOA 4ONUA 1X82A 1C8M1 2BNNA 2WWSA 1V70A 5FYYA 1YHFA 2WT1A 3ZLIA 2B7YA 2B9UA 5FBJA 3O1MA 3KVBA 5A7NA 1IS6A 2PLV1 2XLAA 1S1AA 4W65A 3K3OA 2VGDA 3SQOA 2VZPA 4A45A 2BFUL 2HWD1 5J96B 3MYXA 5GZGA 1VLNA 1GZTA 4Q29A 1COV2 3D0SA 3GM8A 3KV6A 3L9JT 3DKQA 4I3GA 5JZGB 1BK1A 3KS7A 3RYRA 5JOZA 4CCJA 1QOTA 4YWAA 4I02A 1IQAA 2OQ6A 2VTXA 3BKZA 3H1WA 2UWAA 2E53A 5L7OA 2XVKA 5FJKA 3VHNA 4W6YA 4LBLA 1SPPB 4P9GA 2NZ9A 3O0VA 4FO9A 3OYWB 1XQNA 4XOGA 5A3UA 2DCYA 4UAPA 4JVAA 4H14A 4LK6A 4ZHNA 2DWRA 1N1TA 3I8TA 4XUTA 3KT1A 4M4RA 4CP0A 1VMFA 4RS5A 2XGXA 1A8DA 5FWEA 2NLRA 3PU8A 1QHDA 4ZXKA 3WP5A 1KGYA 1OUSA 2ZOEB 4Z07A 5FZIA 3ZN4A 1NCQB 2ZGPA 3NV1A 1C57A 3I2IA 3PTYA 2CAVA 2GC0A 3GDBA 4WZFA 4LA2A 3POFA 2C6SA 4TWTA 3WDVA 1B35A 5D8AA 5ABJA 4JV4A 2UY9A 3T08A 3RYPA 4GWMA 3VLBB 1OQDA 2WINB 4AI3A 3EJKA 1YFWA 4OMCA 1S0BA 1VBC3 4UYBA 2C1FA 3SH4A 4HVOA 1W8HA 5DXDA 5A80A 4BXFA 4Q4X1 2QQMA 3KV9A 3MGUA 3WW2A 3O1RA 1MS8A 5A1LA 1T6GC 4IXLA 4EN8B 5KXBA 4CP1A 2QDNA 4QT6A 4OI0A 1AL23 1LU2A 5C4WA 1XNBA 1HRV1 2G9ZA 2ZEYA 3O1SA 2A7AA 1JZ5A 4CU7A 1RYYA 1HXS3 2J42A 3B3QE 3OBTA 4HVRA 2PHLA 1UPIA 1CAWA 3CLPA 1ULDA 4L99A 3DPRA 1NXMA 2CWSA 3GCXA 4QKFA 2AYHA 2BU9A 3J8F2 2W47A 4FPHA 2RDSA 2QVSB 3FUQA 4I30A 1UZVA 2PFWA 3VD5A 5AC92 3UETA 3C3VA 2EXIA 3GBFA 4GKXA 1HLCA 1O4ZA 3K4DA 1GV9A 4XE9A 1OA4A 2ZS6B 4CEYA 1ZA4A 2VQAA 3I3DA 1Z0HA 2HEWF 1ZZ7A 4HLTA 2RS52 4CUCA 2J1VA 4P9YA 4QX8A 2J1TA 1QJFA 2G19A 4CDWA 5J09A 4JTOA 5C8CA 3O14A 1POV0 1BJQA 1UW8A 2XOMA 1GOHA 2O8QA 3SH3A 1CAUB 1O3SA 1W6MA 4EN7B 5FAXA 5FK8A 2GMPA 4AI1A 3ZXLA 1CZTA 3ASIA 4IV3B 3WCRA 1POV3 4Z2WA 3N9QA 5GJ6A 2EIDA 1A8MA 4YZ2A 5BY5A 2VW1A 4IW3A 2E26A 2JEMA 3H7YA 3AP6A 4K3UA 3LIHA 1XU1A 3K4AA 4XFHA 5FYBA 4Q27A 4TLFA 2VOWA 4Q0PA 4AVBA 4ARYA 2QQNA 3DF0A 4X6RB 4C90A 2Y38A 3FE5A 1WA4A 3ZFGC 5FQ0A 2BFUS 4PBPA 4A7ZA 4AFAA 1UCXA 4TN7A 4PI0A 2JDNA 4NRMA 2JENA 1LOEA 1MQTB 4JQTA 3UGGA 3AL5A 1W06A 1W8WA 1ULEA 5KWRA 2E7TA 1EV11 1OC1A 4QXBA 3EMRA 3A21A 3VBFA 1XJAA 3VGIA 3R4SA 5EYYA 3HMYA 2EXKA 4GIQA 2ERFA 1AR71 1WLTA 3NW4A 2VW0A 1VBA1 2OXBA 4LBNA 1FNYA 4LK7A 2D3RA 5FO9B 4FOWA 4JGYA 2F4PA 1AR61 2RS32 3OEAA 1V9U2 1QJEA 2MEV3 1ENRA 2DYCA 3DEMA 1U5YA 1NCRC 3OB8A 4NJ4A 1ZZ8A 2Y6JA 1L7RA 5DZFA 1DZRA 3RNSA 1XOYA 4LLFA 3K2OA 4NMIA 1R093 3SCFA 3OOXA 1BBT3 1VALA 1V6OA 3MV11 1OA2A 5TSWA 4BK5A 3LSEA 5EJZB 4M0HA 1I5ZA 1UNBA 1YQ8A 4CU6A 5C3SA 1WCQA 2DV9A 3DV8A 4RQPC 2BRTA 3I2JA 5BNNC 4XQDA 4BQ1A 3VD9A 4QXCA 3BB6A 5A70A 5FLHA 1JN2P 5FPBA 1V6LA 1UO9A 2KM2A 4CP9B 4I2OA 2CGNA 5K4LA 2CDOA 2DVAA 4CDXB 5C8WA 4AHZA 1PIV2 4D3WA 1CX4A 2WAAA 3I54A 1YWKA 3MUZ1 4QHOA 5A3PA 4LEJA 1AR81 2RM23 2XR4A 4PIZA 1X7NA 1BZWA 2VBDA 5IVVA 4CPBD 3CMGA 3C8XA 3OY8A 2DTWA 2OX0A 4GB32 2Z5WA 3Q8CA 4QM8A 4ZPIA 2RJLA 4QB2A 3ALQA 3T30A 3VBHC 2FD8A 2AENA 2B4KA 1I6XA 4K9SA 5D21A 1OLME 4HK8A 4CCEA 2E6VA 2OA2A 2VCMA 5FPUA 2IFWA 3J26N 1EUUA 5G04L 1XE0A 3K75B 3L2YA 3WINE 1IQDC 3GXUA 4CA9A 3VD7A 4Q4Y2 1UOGA 4K40A 5EIYB 1WMDA 2R062 4GKYA 5JPMB 3HQUA 1RVF1 1H4GA 3I3EA 4B29A 4UF0B 2EF6A 1ODMA 1IPJA 4A7YA 1GWMA 1Q3EA 5CZKA 1PK6C 1EPWA 4GA9A 4QXHA 4TYSA 3AZYA 2PAEA 1S2EA 3WNMA
chains in the Genus database with same CATH topology
4Y1UA 3VZOA 4DINB 4LBMA 4Z82A 5IK4A 1NG0A 1Y3TA 4QPGA 5I91A 2Y26A 1WUVA 4FVVA 2JG8C 2A3YA 2VU9A 4AVCA 1LHUA 5CIRA 2A6WA 1OPMA 3ZYIB 4MUVA 2HYKA 1CGPA 1RUI3 2ILMA 1C8M3 4AGVA 4DY3A 2XUMA 1SFNA 3ES1A 2PLV3 1ZRFA 4AI8A 1LHNA 1QJY2 1ASJ1 1Q56A 1RHI1 2HWD3 4GWNA 2VNGA 1CQ9A 3CNAA 4HN1A 3IMNA 1SBEA 1D4VB 2GDFA 2NN8A 2E63A 5KHKA 4EWAA 5JSRA 2E51A 5HCFA 1AF9A 2IXKA 3VBUA 2H0BA 3GHMA 4RHV1 1S2BA 3O5SA 3MW4A 2LUWA 2PA7A 1WMEA 3IPVA 5CNAA 2AR6A 2P2KA 3T1LA 1SLCA 4Y5Z0 5CG9A 4AEDB 2HWB2 4ZKTB 3AMHA 3IN9A 4PLNA 3EBRA 4AVAA 2RR11 5FOJB 2D43A 5JOXA 2XBO2 2ZAAA 3HT1A 3Q9OA 1AJOA 1S2KA 5T52A 3PMSA 4GALA 3N4MA 1D0GA 1UMZA 1LOCA 2PN5A 1CD3G 1VAVA 2Q1MA 3W58A 5LRRA 1ZM1A 3MDPA 4F3JA 1RUC2 1SQ4A 3AMMA 1OA3A 4Q4X3 2JE7A 4MXWA 4JGZA 4R9CA 5A33A 3IDBB 4I3PA 1G9CA 3IM0A 3TN92 2GC2A 1RUOA 3OJBA 2HWC2 4Q1PA 3AJYA 4RQPB 3NL1A 1HRV3 3TBDA 1YIFA 3ILFA 4FT8A 3RQ0A 2HWE1 2EXJA 3CU7A 1QMJA 4AQ6A 5GZFA 3WW1A 3SCGA 2O1QA 2WZR2 3HT2A 4L8QA 1DYPA 2X5IC 2XB6C 3PJYA 4I0BA 4RFT0 2DUQA 3AMPA 4QHBA 1LKNA 1RUH2 1NA1C 2B8MA 3PNAA 2ET1A 3VBHB 4Q8KA 2VH9A 5F6LB 1COV1 1KFUL 3URFA 5JCTA 1J1LA 2ZHNA 3AFKA 4LUKA 3ILNA 3WG1A 3LCPA 3WY6A 4UBHA 1MEC2 4P9WA 4RL7A 4YSFA 1O4YA 1VBE2 2WC2A 3KB5A 3RZZA 4EWDA 1WGPA 1UKRA 5C9AA 4IEZA 1IPKA 2RMU3 2WNVC 1UIJA 3WQ0A 3VZMA 1PK6B 1C1FA 4E9KA 4X6QB 1UN1A 4HT1T 2WS92 3OBRA 4XBLA 4N53C 1S0GA 4M3CE 1AR92 5AVAA 1EV13 5J36A 3U11A 3E6CC 4FXKB 1H1IA 1QXPA 4B7EA 3MFCA 4DY5A 4G3YC 1AZDA 1R1ZA 2BW8A 2V5YA 4Q0VA 3UKVA 2CGPA 1VBA3 5SV5A 4NVPA 1ULCA 1ZX5A 3AM2A 2WT0A 2WNEA 2PQQA 1AX2A 2WLPA 4ISQA 1AR63 1RC6A 4YVSC 2OW4A 2FMYA 3WLUA 5IUQA 5T3NA 3ZFEC 2Z69A 5DG2A 3IBMA 5FMOL 5EYXA 4FCAA 3KLSA 3HN1A 3MW2A 5J98B 2GNMA 2DVDA 1UAIA 3UJOA 5GZDA 1RUD2 3CJIB 2DFBA 5KHJA 1I1EA 3WOGA 3WCSA 3NAPA 1C4RA 2WFPA 1QDCA 4N43A 4S2HA 4Y24A 4AVSA 2QUOA 5AC91 2Y0OA 1ZBE3 3FFQA 2WQ4A 1GANA 1ND3A 2IXCA 4W6XA 1AR72 1V6NA 2C0ZA 3C2UA 3TNQA 1FYUA 1Q8VA 4PIYA 1C3HA 2RS51 1W6NA 3VBOA 3G6JB 2A3XA 3QH7A 1X33A 2D98A 1AR83 2WL1A 5JI7A 1QOOA 3VDDC 3PVOA 1YYNA 1APNA 2I07B 1ENXA 2ZPXA 4OHZA 4AHYA 1D2QA 1KS4A 5BNQA 2A73B 1PVC2 4KGGA 4M01A 2QE3A 3WHUA 1XNCA 2DCZA 4RR3C 1RUG2 3FLRA 2P17A 3H3ZA 5KC6A 3OD0A 1DHKB 1RVF3 1U0AA 1GZWB 1IHMA 3E5UA 5T55A 1OLQA 1W6QB 4GQ7A 4R4XA 1DGLA 1NE6A 1SCSA 3M3QA 2GC3A 5JR7B 1CJPA 3SXWA 3AZVA 3IT8A 2Z42A 5L7OC 4IEUA 2RS31 1OLRA 1GYKA 3ZYGA 4OI2A 1I9RA 5BV6A 2X5IB 4YM2A 3NV3A 4BCUA 3M3IA 1YCIA 2PTMA 5CAZA 1YFYA 2GH8A 4HETA 1NA1B 2R1BA 1OOPB 1F31A 4RS5C 1ASJ3 4OHVA 1RHI3 4B8EA 1Q8OA 4JDOA 5E16A 3I7DA 3ZXEA 3LOBA 4FPOB 4IV1A 2CNAA 1DLLA 1B35C 5D8AC 5ABJC 1O3RA 1D2SA 1O5LA 2XG3A 5F1RA 1WCKA 5KXCA 2UY8A 3U0ZA 2DVFA 3KD4A 5FMOS 4RHV3 3ZXFA 2WNVB 5KHHA 4WVVA 2NMNA 5GLWA 4AQTA 4QU2A 3B9CA 1PIV1 3LOIA 4N53B 2RE9A 4XTPA 1SEFA 4UW5A 2LALA 4AFMA 4XQWA 3WG3A 5C4WC 4GB31 2RR13 3LSDA 4K6BA 5CB7A 4WM7A 3N36A 5BNOA 4XW3A 4HL0A 4XJ8A 3AX4A 1G9FA 2PHDA 4D7YA 4YVSB 2ATFA 3VHPA 1NE4A 3ZFEB 3LWCA 5GZCA 1YLLA 1VR3A 1VAMA 1VJ2A 3AKPA 4Q4Y1 1MZEA 3INAA 5EFUA 2R061 1F9KA 4CEYC 4WVMB 4Z1VA 1QXJA 2DU0A 5KXDA 1XYNA 2P37A 2ENRA 4QD2A 4CDWC 4P5HA 3VKOA 3I2DA 1RUE2 4XJZA 1HV1A 4YGDA 4EWEA 5FLJA 3RRDA 2AUYA 3NO8A 2GNDA 3AFGA 5C33A 2OZ6A 4LE4A 4XFBA 5I0RA 1AXZA 4LHNA 5F9TA 2HWE3 4WVZA 2D40A 5D1IA 2ZAHA 3WP6A 3KMHA 3ATGA 2D6KA 4FPEA 4DQAA 1Z7S2 4MXVA 4NN0A 5IK7A 1RMU1 1UPSA 4E4ZA 2CY6A 1QJY1 2Y0IA 1HIXA 2B42B 2VVEA 3VBFC 4Y22B 1COV3 4FOVA 3DN7A 5BXXA 2XL7A 1OPOA 2TUNA 4QXKA 1AXKA 4XJWA 5BPXA 4RR3B 3WVJA 2JDZA 4JGYC 1VRH2 4OZXA 3U07A 5T5JA 5CFDA 4QPIA 1BEV2 3ST7A 5T54A 2JICA 1K5MA 2HWF2 4L11A 2IXJA 3K48A 4AW7A 3RS6A 2HWB1 3M3EA 2R30A 2DCKA 4YVWA 4AG4A 2XLGA 1LOGA 1UZZA 4JRLA 2JD4A 4C0BA 2X53S 2XBO1 2WIIB 3CEWA 5L7OB 1J59A 3V0AB 4A3XA 3GALA 4INDA 4K1ZA 4JQRA 5GLUA 4EV0A 3M4FA 4XFCA 4YRDA 5H9PA 4D7SA 1J58A 1Y7BA 1RUC1 3U4XA 4RS5B 1URXA 2YDEA 1TMF2 1VBD2 1CPMA 2JX9A 3AP7A 1IS5A 2VY0A 3TN91 2FMDA 4H55A 2D3PA 2CYFA 3APBA 4E4DX 2HWC1 3HBZA 4A2UA 2WFF2 4E2SA 1B35B 1FV3A 3JB8A 4EROA 3ZIWA 4NHLA 5T5LA 1YIPA 2W08A 4CEWA 5IK5A 1SLAA 1TNFA 4YZ5A 2D6NA 5HI0A 2FHRA 3J8F3 1GQGA 5AC93 1ZVFA 3DGTA 3V56A 1A78A 1DDLA 1DGRA 2WZR1 5JIUA 1H4HA 4COVA 3FLPA 2RS53 4AQ2A 1KFXL 2A6ZA 3DUIA 1RUH1 1AYN1 4DPNA 5C4WB 5J7MA 5JZGA 4QM9A 2XJUA 4XF0A 2YROA 4QPGC 1CAWB 3POSA 1WBFA 2IXIA 5FDBA 2A6YA 3DPRB 3K51A 3J9SA 5F6KA 2Q30A 1CJDA 1MEC1 4YW1A 4FPYA 5JMCA 1VBE1 3OYWA 4IEQA 4LTAA 3UK9A 1QH7A 4Y20B 3AKQA 1DBNA 5FOBB 3VZLA 5JWPA 1V00A 3WDUA 2VNRA 4QGMA 5BUVA 3M70A 4KL1A 4EN6B 1KXGA 4CDWB 4KWKA 4XF3A 5C8CB 1KRIA 1CR7A 4Q4V2 3MIFA 1MS0A 1QH6A 4XJAA 1NCQA 1O5UA 1W6MB 2WS91 3CL1A 1SLLA 2A6XA 3JBG2 4PDWA 3VBSB 2XHKA 1MS1A 1AR91 5T5PA 1OD5A 3GBGA 3ME2A 4J6GA 4FTBA 3RMYA 3H1MA 4KWJA 1REEA 3WR0A 2D7FA 3M1HA 1IS3A 1H0BA 5CFCB 4B3NA 3VBUC 1MZ5A 3RPQA 1H9PA 3JUUA 4LBQD 3THPA 3N3HA 1JUHA 1U5ZA 2RS33 5FQ0B 1V6KA 1V9U3 1S0FA 4ZU5A 4ITCA 5AFBA 3S6PA 3ZN6B 2PAMA 2FBEA 3BOWA 2ZGUA 4LBQB 3VHOA 5LRSA 3ZMNA 1F5FA 3UL2A 1AL0G 4Q26A 2QZ3A 4FP2A 1RUD1 2TBVA 4EN0A 3HR9A 4BWOA 5DDJ2 5EXOA 1QOSA 1WCSA 3SISA 3ZX7A 1N3OA 1S0IA 1HX6A 4XFFA 1GZCA 5FREA 2OUJA 1G9BA 3WDXA 4H3WA 4OI1A 2HEVF 3O12A 4FTSA 3THTA 1ULFA 4JGZC 1PIV3 1H9WA 4XFIA 3ZYPA 1O3QA 3MLLA 4NR1A 1CAUA 3DKWA 4MVTA 4FPGA 4LULA 4WVWA 1CIWA 4HN0A 2GC1A 1ZZCA 2VOKA 4GB33 4GMP1 3L2HA 3QLQA 2X8KA 4H7MA 4MLOA 4P9LA 2SBAA 3MF9A 4BIOA 3HAGA 1PVC1 1QJZA 2OPKA 4P9XA 1ENSA 4LHLA 3USUA 5K8SA 1QDOA 1KDKA 1RUG1 4ZU7A 4Q4Y3 1KDMA 2R063 1B09A 4M3CF 2QJVA 3E97A 2GNTA 4S2FA 4COUA 1FV2A 3OY8B 1NQJA 3HD8B 3R4DB 2NM1A 2UWCA 3OF1A 1MR5A 3EXUA 3FMGA 3B93A 1BCXA 2ES3A 4XXPA 3KCCA 2TEPA 1LODA 2EVXA 1H1MA 5C9AC 5I93A 4COZA 3FBYA 3PJQA 1X8EA 1H2KA 1GBGA 1DGWX 1EAH2 2B45X 3D0JA 4MYEA 3M3OA 1QJY3 4YW4A 5ACA2 1V6MA 2UYAA 3H1YA 5DUVA 1ALYA 4BMEA 2ZKNA 3P3PA 2R042 1H2LA 5JOYA 5JSOA 3MICA 4P14A 1YFUA 2GNBA 1D4M2 4CDXA 3SMHA 1XYOA 3R05A 4KH9A 2ZJCA 4NPRA 1KJLA 5H9SA 1ULGA 2B46X 4FAGA 3TWIA 1A6CA 2ZGQA 1NOVA 1BKZA 4P9JA 3MW3A 3D4KA 2BQPA 3WP3A 4IEWA 3E6DA 2W52A 2UURA 4BPZA 3N35A 2O0OA 4YG3A 2HWB3 3N7MA 3M2MA 1LGBA 3H7JA 3KM5A 3I59A 4AI2A 3NAPC 3ZXAC 1M06G 3QOPA 4E27A 5L19A 1W0PA 1DQ6A 2EA7A 1RMU2 4WM8A 3VBUB 2XBO3 4FP3A 4N43C 5GZEA 3W59A 5DZGA 3CO2A 1PO22 4FQZA 3AYAA 3BTAA 1ND3C 1RUC3 1CN1A 4LBKA 4OFGA 1YNAA 2XWJB 3VBOC 3FUOA 1C8NA 4AE2A 5JOWA 1SLIA 5FO7B 3TN93 3ZFGB 1RUE1 3O7OA 2A6VA 2KXLA 3RYKA 4K21A 5CG8A 4YGBA 4CDQA 3V0BA 2HWC3 3MFAA 4Z92B 4YM1A 2VMGA 3AJZA 2GH2A 2R16A 4QQPA 1MS4A 1NLRA 1BQPA 4DZGA 2ZGTA 4JGZB 3R4UA 5A33B 1LJ7A 1D0HA 1WLDA 1Z7S1 2WZR3 2JG9A 3N7JA 4AGGA 2CTVA 4RGGA 4J1XA 3ZXDA 3ZXGA 1NCRB 1RUH3 1YJKA 2QNKA 3OPZA 5EV7A 1UD1A 4BIFA 3B94A 2WT2A 3KQRA 2HEYF 2VOXA 1U5XA 1FOD2 1MEC3 3MIHA 2XJQA 1RIRA 3WNXA 1VBE3 4NHKA 1VRH1 2BUKA 5FTTC 4DXZA 5FO8B 1YO8A 5BNPA 1BEV1 3ES4A 3ZYJB 4BLJA 5BNNB 2DUOA 3I4IA 5FRAA 1KQRA 3PVEA 3QACA 2HWF1 2D6MA 3SITA 1DGRN 4YM3A 2VMHA 2A70A 2WS93 4IETA 1PZ7A 2ZACA 1PMIA 5JIAA 1AR93 1LOBA 3UJQA 1U5IA 4IV1C 3NVCA 1MS3A 1AYN2 3WXPA 2P3JA 2ZMKA 1HRI1 2PHFA 4JRAA 5I0UA 2GU9A 1S0JA 1RJ7A 1L3JA 3KCYA 1TMF1 1VBD1 3V65A 1YFXA 1LB2A 2I2SA 4AXOA 2V09A 3ZXJA 1LTEA 3NSTA 1O4TA 2K2SA 4R9BA 1RUD3 2YHJA 2ZCWA 2WFF1 3WUCA 2Q1ZB 4YARA 4WM7C 4OVEA 3T1MA 3TNPB 4BMBA 5BNOC 2RS12 2ZX2A 2AH2A 1ZBA2 2A5ZA 4LA3A 1JOJA 2NPIA 1XYPA 1TEIA 1CAXA 1ZZBA 2O8OA 4I09A 3ZSLA 2JG8B 4FPLA 3MZHA 4S2GA 1AR73 5JSPA 1HQNA 4GH4A 3VBRA 4GMP0 1FMD2 3E5QA 4QPYA 3NAPB 3FWEA 4LLOA 4PLMA 5C6CA 4KG8A 3VZJA 3KSCA 1LEMA 4N43B 4GMP3 4DRRA 2BGCA 2BWAA 1N1YA 4BH9A 2AZ5A 2KA3A 4LR4A 3MPBA 1PVC3 1QQP2 4M3CB 4E2QA 2D6OX 1ND3B 1SBFA 2CV6A 1JYCA 4OLLA 1GZ9A 2D6PA 1FPN2 1RUG3 1F5JA 1SBDA 4YW3A 1TNRA 1W2UA 3B9IA 1W6NB 4YGCA 1DQ4A 4P9IA 5IT6A 4Q4V1 1DF0A 4XTMA 1OQ1A 3MIDA 3WQ7A 2DCTA 1RUJ2 2NYYA 2R32A 3OGJA 4GXLA 5K0UA 3JBG1 1WMFA 1AX1A 3HWJA 4D94A 2ZX0A 4LNVA 3PVBB 3R6SA 5FLIA 2GMEA 3RMXA 2N7GA 3E6BA 5CFDC 1RUNA 4QPIC 5I8SA 1AVBA 1K5MC 4XF1A 4XJUA 4COWA 1VB4A 1RGSA 4R4ZA 3CJIA 2B39A 2VNOA 4L2NA 4QGNA 2VQ0A 4YVWC 4FSJA 4SLIA 1H1AA 2QDRA 1JW6A 3EHKA 4W6WA 5L36A 5DDJ1 4KBBA 1QU0A 2WSUA 3VKNA 3UV9A 1XE7A 1BMV2 1AJKA 2MHFA 3PLQA 4X8PA 2OYZA 2D6LX 4PBOA 4Q2FA 1WLWA 1MZ6A 2ZHLA 2P3IA 3USSA 4LUMA 3QCWA 2VW2A 5FCCA 2ZX4A 2VMIA 3LA2A 2G9FA 4CZSA 2I74A 5LEJA 1DQ0A 1J1TA 2ZZJA 5T50A 2ZGLA 3OGGA 1PZ8A 2R0HA 3BCWA 4CEWC 1H2MA 2CAUA 4N7IA 3AZXA 3BIWE 1QY4A 1GZWA 1WD4A 4HKLA 1JUIA 4IL7A 1J3PA 2DUPA 2VPVA 4IESA 4JTNA 4NHMA 1W6PA 4NWVA 4Q4W2 4Q8LA 4PCRA 5JZGC 2DTYA 4ASLA 1XU2A 1RUE3 4IEYA 4WM7B 1SMVA 4FPCA 1GR3A 1DFQA 2R072 5DUXA 5BNOB 4R9DA 4ATEA 3KGZA 3HIFA 4M0NA 1ZNPA 3MI8A 4LBJA 1ZRRA 3BPZA 3WZ1A 1PGL1 1DGWA 1WW7A 4DFSA 2D3SA 3VL8A 3H50A 2YYOA 2BWCA 4XMAA 3WT3A 4HPKB 3JD72 1IOAA 2BVVA 1OHFA 2VVFA 3SNMA 1LRHA 1UIKA 1LENA 1Z7S3 1EAH1 1VAKA 1NCQC 2VUAA 2A3WA 4PDWC 1LGCA 4YFZA 4XF4A 5ACA1 1H8TA 4LO7A 4U2AA 4AQSA 1AHSA 2MEV1 3MEPA 3RWNA 1MACA 4IEPA 2JJ6A 2PHTA 5F5QA 3MIBA 5KXEA 1BYHA 3B7MA 2FZ2A 1MVQA 2R041 3AYEA 4QGLA 1Z78A 3RDIA 2GZWA 2BNOA 5CA6A 1UU6A 1D4M1 1VRH3 2ARBA 3N7KA 4MH0E 3TAYA 3JQWA 2UYBA 2H0VA 4XDQA 1W6OB 1RITA 4AEKA 1PNGA 4V1PA 3WDTA 1BEV3 1LHVA 2YY1A 1Q43A 1ND2A 2RHPA 2HWF3 1JYIA 4CDUA 1UZYA 2BBVA 4OULA 2OZJA 4K1YA 1PVXA 5AVPA 4XHXA 1QNYA 3VN4A 2ZZQA 2C5DA 4JCKA 5KC5A 1PM7A 2WJSA 4YZ3A 1TME2 3ZSEA 4AI0A 1DQ2A 1RUF2 4X8NA 3VDDB 5CFDB 4AYUA 1OSGA 3ZSKA 4NWWA 5GKAC 1PO21 1QJX2 4WVMA 1HRI3 1UX6A 2YC0A 3JQXA 4G4FA 1CESA 4R52A 1TMF3 1VBD3 1MZFA 1UKGA 4YVWB 3D6EA 4L92A 2ZGKA 1CVNA 3TB0A 4FBFA 4XF9A 1XE8A 4PJYA 2WFF3 3AKSA 3TRSB 5E88A 4BYYA 3ECQA 1FI2A 1PO12 2UU8A 1CAVA 5IK8A 3GYDA 5DG1A 2E7QA 3E5XA 4NO4A 2GMMA 1MS5A 3ZDSA 4PLOA 2YUEA 2WNUA 3JZVA 1AYM2 2DVGA 2ZGSA 1OMIA 1LOFA 4I01A 2YZ4A 1HRI2 2WA4A 2DU1A 4Y22A 3ZFFA 4HVQA 1LEDA 2H6BA 4R8HA 4S2DA 2XWBB 4BZ4A 2G4IA 3IIAA 1FNZA 1JH5A 2AGSA 4HFSA 2XJTA 3VKMA 3BALA 5EJ3A 1EY2A 1DG6A 2EAAA 4HANA 3BOPA 1FOD1 2WZPP 1UF2C 1AUYA 4Y26A 3B69A 5D8AB 2DF7A 5ABJB 1FXZA 4BA6A 4JAAA 1UL9A 1HDKA 1LGNA 5A32A 4DNYA 2BNMA 1S55A 4ASMB 3AMNA 1RINA 4Q4V3 1J3RA 1G8WA 4D69A 1QJU2 3VZKA 3JBG3 3WDYA 1ZREA 2X29A 2WLQA 2YPJA 3V0AA 1ENQA 4K20A 4XPVA 3KZ4C 1VBB2 1R082 5LEKA 1R1A2 4CDXC 4N9IA 4R9AA 2ZABA 1TE1B 4FTEA 3R0RA 2YMZA 2ZX3A 3RI9A 4C91A 3WHTA 2FQPA 2H6CA 5GALA 4EN9B 4PDWB 1X8MA 1Q8SA 1XXNA 4IQPA 1YI7A 1WBLA 2IC1A 4CEYB 2XLFA 4L9BA 2A75A 3AP9A 4PIXA 1M4WA 4CRQA 2VOVA 2YV8A 1KD7A 4WM8C 5DDJ3 3ZVXA 2ZHMA 4QX5A 2G9GA 2RS11 3LA7A 1WLCA 3AKTA 3GZUC 1ZBA1 1AX0A 1SLTA 5JLVA 4Y1YA 4YFWA 4N90A 4O9GA 3NV4A 3ZO0B 1REFA 3ENRA 4OUSA 2JXAA 4IEVA 2EALA 3MLKA 4QQLA 2ZGNA 2GN7A 4IEXA 3A4UA 1AXYA 1FMD1 2XVGA 4GULA 2OUHA 3KCXA 4CDQC 4CTEA 4RSUA 4QQHA 5CVRA 1VIWB 2ZKLA 1BXHA 4Y20A 1YUDA 2JECA 4HSJA 3P3NA 3VBFB 3RJ2X 1JXNA 1QQP1 1N47A 1A3KA 4PF5A 5KHIA 1FPN1 4YW5A 3WP4A 2WKKA 1VBC2 5DZEA 4JGYB 2JG9C 3B5LB 2DCJA 3VBSA 4IERA 2XH6A 1RUJ1 4AFCA 2XJPA 3AK0A 1AL22 1PGSA 3PVNA 1C1LA 2XJVA 2NMOA 1H30A 4PQ9A 3FBMA 1DU3D 4KWLA 4BE3A 1HXS2 2QZ2A 3GZAA 1XNDA 2RMU1 3USUB 4UXAA 2D5FA 3ACLA 4YGEA 3S7EA 4IV3A 2AREA 5K9YA 5A3LA 1SDWA 2XPJA 3ZN6A 3LB9A 4LBQA 5BNPC 2FZ1A 3QBQA 4QMAA 4AEDC 1SCRA 2SLIA 4OHXA 4C1WA 3IWZA 3LAGA 1EAH3 4BLIA 4KG0A 4HK9A 3VL9A 1MQTA 2XVLA 5ACA3 1DQ1A 3RG0A 1W0OA 5GLTA 1G9DA 4MSVA 1LHOA 1RB8G 1S0EA 2ET7A 3A0NA 1ZRCA 3JCIA 2R043 1GQHA 4UBGA 2ETEA 4YW2A 5DUWA 1BMV1 2XKOA 1LECA 4MV2A 1D4M3 1QKQA 1HKDA 1JHNA 1EYBA 2BVBA 4I0WB 5HBAA 1PGL2 4URTA 5I0TA 3S30A 2CWMA 2XJRA 3AXDA 4B4PA 1WD3A 4JC1A 1PGW1 4FQ4A 5H9RA 2OVUA 1ZBE1 4LE3A 1RMU3 1UU5A 1MS9A 4QPGB 3KT7A 1XNKA 2YGMA 1PO23 2UWBA 3AKRA 1J3QA 3GBWA 4EJRA 2EAKA 2MEV2 2R0FA 2ZGOA 3ZMOA 2D44A 5J3UA 4M00A 3FZ3A 3ZN5A 1GICA 3T2TA 4FPKA 3AP5A 4XXAA 4GH4C 3VBRC 4Q4W1 2ZBJA 4KGQA 1R092 1BBT2 3I59B 3QD6A 3VKLA 4AEMA 4Y1ZA 3UKNA 1H2NA 4WM8B 2R071 2VULA 1F8VA 1JBCA 1DIWA 4YZ1A 4F83A 4RGAA 3B00A 3IDCB 1QNWA 4LO4B 3WX5A 1GNZA 4TSVA 2Z79A 1Q5OA 4WBBA 3JD71 2VVDA 3ZYRA 4AGRA 2Q4SA 4E2GA 3RJRA 3WG4A 4B7KA 4DRVA 1CPNA 2RM22 3H0OA 5EWSA 1FATA 4I0AA 4CDQB 5JI9A 3IPVB 5K0UC 3V0BB 2TNFA 2DVBA 1O7FA 1YXWA 3GNEA 4Q0QA 3H9AA 4B4RA 5FPZA 1FOD3 3J4UH 3POYA 1RL3A 3LZZA 3NKTA 4ORFA 4K8FA 1BVVA 2JG9B 3AYDA 3RSJA 1EPZA 1LU1A 3CJIC 1NY72 3WW4A 5JPNB 4FOQA 1LR5A 2ZMLA 4MXWB 1KJRA 2Q0AA 3EQEA 4XILA 3TYJA 1TME1 3KT4A 2WSVA 4DMIA 5J48A 1RUF1 1AYN3 4FXGB 3S7IA 2ZA9A 4LO8A 5I8TA 1ZYBA 5BNPB 1TQ5A 3KGLA 1QJX1 4COYA 3VV1A 3QH6A 1RUI2 5DUUA 2EIGA 2HKXA 1C8M2 3NV2A 2QFEA 4YG6A 1DZQA 3ZIXA 3ZFGA 3ZSJA 1Y9QA 1V6JA 2PLV2 3POWA 4HZFA 3M7AA 4O9EA 1QXRA 1E57A 1C5HA 2HWD2 1I3HA 4AEDA 3VZNA 3ELNA 1IS4A 2D5HA 1PO11 5E8AA 2RS13 1OFNA 3FX3A 1SACA 1DYKA 1U12A 1ZBA3 4FPJA 4KU7A 1LULA 4OHWA 4MGZE 4MGIE 2R6QA 1AYM1 1NCRA 3IKWA 3AP4A 1G86A 1O3TA 2BTVC 3M3CA 4OHYA 1HW5A 5C9AB 4SBVA 3JU9A 4Y1VA 5LK7B 1FMD3 3MF6A 3ZPYA 4HSLA 1C28A 4XYXA 1PHMA 2V73A 3FLTA 4RQPA 1MVEA 1CAXB 5CADA 3O0XA 5BNNA 1QQP3 2GN3A 3ILRA 3LKJA 4HKOA 4XMIA 1GLHA 5KBFA 4META 4XBNA 4ISRA 3VHRA 1FPN3 1OOPC 4LO5B 4GH4B 5B2GB 3VBRB 4CP2A 1HQLA 3TOJA 4LO6B 4Q4X2 1PNFA 4J1WA 4UW4A 1ZZ9A 4XHBA <