4HKLA

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 53
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hklA00
3MF9A 4XPVA 3WP6A 1AXKA 2JENA 1QH6A 3HD8B 3WP4A 2NLRA 1TE1B 1XNDA 3VHNA 1UKRA 3WXPA 1H8VA 2BWCA 4NPRA 2BW8A 4S2HA 1HV1A 1REFA 1XYNA 4S2GA 3AKSA 2DFCA 2B45X 2VG9A 1BK1A 2BVVA 2DFBA 3MFCA 2VUJA 3WP3A 4HK8A 3VHOA 5EJ3A 1ENXA 3WT3A 3VZOA 2D98A 3AMNA 3VZMA 1C5IA 3B7MA 3AKQA 5K7PA 1XYOA 1C5HA 1OA4A 3LB9A 3RI8A 1H1AA 3AKRA 1F5JA 3VL8A 1H4HA 3AMQA 2JICA 2B42B 4HKLA 1M4WA 2VGDA 3WY6A 1NLRA 1H0BA 1T6GC 2QZ3A 1XXNA 1REDA 2Z79A 3MF6A 4IXLA 1OA3A 3VZKA 2VULA 1BCXA 2D97A 2QZ2A 2DCKA 3M4FA 3WQ7A 1OLRA 1OA2A 3VHPA 1UU5A 1XNKA 2F6BA 4HK9A 1KS4A 2C1FA 4HKOA 3MFAA 3AMHA 1HIXA 3WR0A 3B5LB 5HXVA 2NQYA 1OLQA 3O7OA 1YNAA 1KS5A 3AKTA 3AMMA 3AMPA 3WX5A 1REEA 1IGOA 3RI9A 3ZSEA 3EXUA 4XQDA 4S2FA 2BWAA 1HV0A 3VZLA 1H4GA 2DCZA 3VLBB 3VZNA 4S2DA 4H7MA 1QH7A 3WQ1A 1XNCA 3VZJA 4XQWA 3WQ0A 1XNBA 1UU4A 1UU6A 4XQ4A 3VGIA 1PVXA 2B46X 3VL9A 2DCYA 1XYPA 3AKPA 3WP5A 2DCJA 3LGRA 1W2UA 4HKWA 5K9YA 2JEMA 1BVVA
chains in the Genus database with same CATH superfamily
1NQDA 1YFYA 4WVVA 1QH6A 1LRHA 4Y1VA 4SBVA 1YCIA 1GYKA 2OPWA 1E5HA 3ITQA 5FZ7A 1UO9A 1KXGA 2BJSA 1BBT2 4JVAA 4NPMA 1U5IA 4HVQA 1PK6A 2D6MA 1C4RA 2VQUA 4BJ0A 3PURA 4P5YA 3KV4A 5E1RA 2B39A 4Y1YA 2JDAA 2FCTA 2J22A 3KCXA 3POBA 4LHSA 1G9CA 5FZ6A 3ZXGA 1FOD1 5EFUA 4Z2WA 4Z2AA 1E5IA 5L7OC 4AF9A 1XPWA 5FYVA 4DXRA 2W2IA 5A7WA 2VZQA 4JQRA 1OQDA 1TMF1 1YRZA 4GWMA 5A1LA 5HPOA 2EXIA 4Z8BA 3GALA 1N1SA 2HWB2 4NHKA 4AAPA 4AI1A 3JXSA 1KGYA 5A3PA 4PIYA 4QKNA 1LHWA 4XJWA 1R1A1 3MDPA 3TAYA 2W08A 4MGYE 1UY1A 3S7IA 3RI8A 1CESA 2OZ6A 2DU1A 3DF0A 2JICA 3H50A 3D3AA 1EPWA 1XU1A 1WLCA 5J48A 2UWAA 1T6GC 4A6SA 5KXEA 1LCLA 2BFUL 2PYTA 4IV3C 3C7FA 3ABZA 5FPXA 3CJIB 1FNZA 5F2WA 2CSGA 2J1EA 1XSQA 3OGJA 2DDUA 1OLRA 4HL0A 4BQWA 1A6CA 4Q4W2 2RDSA 2AREA 3IN9A 1ZBE1 3VHPA 4AEDA 3GDBA 4YYOA 3RGBA 1NA1C 4PJYA 4R52A 5FOJB 1W8FA 2QBXA 4LEJA 2XVKA 5DQ0A 3VBUB 2GP3A 2VZ3A 4HLTA 2D5FA 4UYBA 5BNNB 3WDUA 2YC4A 4BQ5A 4FPOB 1OQ1A 3I49A 3AMMA 4KG8A 4XFAA 1VALA 2WFF1 4K40A 4ZPIA 4F7ZA 5LBEA 2ETEA 3VV1A 1JYTA 2QUOA 4XUTA 4D7YA 3ZYGA 2IXCA 1F5FA 4RQPA 4FFIA 1Z7S3 5C3SA 5FZOB 1SBDA 3KVAA 3N9NA 1B35C 4QM8A 4QWNA 1UWWA 1VBB1 2MEV3 2W5FA 3SQOA 1AVBA 1NAEA 1RUG2 3TNQA 4Z1VA 1CGPA 3SITA 1HQLA 5F5IA 4XQWA 1IPKA 3HBZA 3OEBA 4AQSA 2YDEA 3UKNA 3BPZA 2HEVF 2PLV2 1MR5A 3S5QA 4L92A 1UZWA 1W6PA 4OMCA 1ZNPA 3ZFGA 4XJZA 5FZIA 1ZRCA 4RS5C 4RFRB 2R061 1DQ4A 2ENRA 2YY1A 2JWPA 2FDFA 1FV3A 2TBVA 4XFIA 4JKLA 2TNFA 2VZRA 3WF0A 4FAGA 4EE2A 2PQQA 4Q0PA 2ZABA 2DUQA 1Z78A 2IXKA 4XMAA 4COWA 1ZX5A 2WNUC 4ZZ5A 5HXMA 4MADA 3THCA 1OLME 1WW7A 1AXKA 3WP6A 1LB2A 1US3A 2WZ8A 1AL0G 2WZR3 3PUQA 3ZXKA 2A3YA 3DYOA 2P6HA 2RS31 4Y26A 1RUE3 1O3RA 2QQNA 4LKDA 1OD5A 3V0AA 1TMF3 1VAKA 3HQRA 2X5IB 4QPIB 3OB8A 4YGDA 5HCFA 4R8HA 1S0EA 2ZHLA 2X09A 5FYBA 4AK3A 4CXWA 5JR2A 1HV1A 1REFA 2ZMKA 5FOBB 1HXS2 2VZOA 4LO8A 3B9IA 2WBKA 4EQVA 4R9AA 2HBUA 3I7DA 4XHXA 2RDNA 2HKXA 4GULA 2ID4A 4D69A 5C4WC 1VB2A 1KITA 2IC1A 2VG9A 2EXJA 1UN1A 4FP2A 1KJRA 5ANNA 4A3ZA 5C71A 4WM7C 3SCGA 4XCAA 5IVCA 4GMP1 1LECA 2V5DA 1S55A 1JHNA 3PJYA 4L11A 3TEWA 1APNA 1DFQA 5I8YA 3KD4A 4X8NA 5DABA 1H2MA 1JTZX 1RHI1 1F2NA 5FPVA 3OUIA 1J3QA 4J6GA 4NHXA 1R082 2YBPA 4PIZA 4BMEA 3PU3A 1IS6A 4X8PA 1ND2B 5FYIA 4XIOA 2UY9A 1DBNA 5KHGA 3PNAA 3VD7A 5A32A 5C9AA 4CCLA 4MV2A 5FXWA 1U5ZA 1XXNA 3EYPA 1SG3A 3I8TA 4IEPA 3V65A 2V09A 2Y6HA 5C5TA 4BOWA 1ENQA 2DCKA 3MIGA 4IV3A 4YPJA 1DGRA 1AR81 2OZJA 4HFSA 4LIVA 3IDCB 5T5OA 1ASJ1 3WF1A 5CB7A 2XPJA 2WFF3 2W1SA 3PMEA 4XXPA 5KHJA 1M06G 2YMZA 3UETA 4FFHA 2IXIA 1RUJ3 2QQMA 3A0KA 3LOIA 5AFEA 5LK7B 1PNGA 1UYZA 4H3WA 1Q3EA 3O5SA 4YVWB 4Q4X3 3CJXA 5JDBA 4DIQA 2JG9A 5LA0A 4QGLA 4MLOA 5FZFA 3WNNA 1RUNA 2LM3A 1HJGA 5CZKA 5A6ZA 4YLZA 2HWC3 2AACA 2E6VA 2XVGA 2JG9B 5DPNA 1S0DA 5GALA 4PLMA 2QNKA 5F3GA 5FUNA 5KHHA 2YU1A 1Q8QA 3EXUA 4CDQA 1S2BA 3U11A 4EROA 1OPOA 1PO21 1QDOA 3NV1A 4HOOA 2JDNA 3P5BA 5FMDA 3RYKA 1GKBA 3AB0A 5FAXA 1WLWA 4DRVA 4QM9A 1SMVA 3NAPC 4IGOA 3L2YA 1GOFA 4WVMA 1OH4A 4Y22B 4YG3A 3ASIA 2QQUA 4F3JA 1GMMA 2WT0A 3BN6A 4LULA 1DF0A 2JDPA 3MV01 1F35A 3GCXA 4RD7A 5IT6A 2A3WA 2QDNA 2GMEA 2ZHKA 1C1LA 2R071 2B46X 3DYPA 2K2SA 1GZWB 2XHKA 4QPGB 4E8CA 2DCJA 4YVWA 5T5JA 3VUOA 2WINB 1UPIA 2BERA 4CCNA 5IW0A 4LBOA 5FZGA 1SACA 5DDJ1 3H7JA 3WZ1A 3LDBA 1EP0A 1S1AA 2EF6A 4LLOA 1C28A 4CXXA 1OH3A 3PDQA 5IHRA 4GB33 4CDUB 1W8ZA 1JN2P 1H8VA 1BK0A 2VOKA 3AFGA 3TYJA 2HWE1 1ACCA 4Y5TA 4Y5Z0 3U10A 2AZ5A 3CJIA 5L9RA 3GBGA 5DZFA 5LY2A 5JXIA 4YZ5A 1ULGA 4BLIA 1H30A 1ZA7A 4YG0A 3SKVA 4GQ7A 1X36A 5BXXA 4FFGA 3FBYA 5KC6A 4WZFA 2A73B 2R30A 1PVC2 2ZMNA 3PTYA 4OZXA 4Q4Y1 2YBKA 3I2DA 1FYUA 4XACA 4J1XA 3CNAA 5HCHA 3MLLA 4RA0A 4WM8B 4R9BA 1S4CA 4QD2A 3T4VA 2QE3A 4RR3C 4CDWC 3AFKA 2JDMA 4CU6A 2WNVA 2ZGMA 3MGUA 3EO6A 1PZ8A 2DTYA 5FK8A 4CDQC 1V6JA 3NNGA 3QH7A 5I0UA 1WA4A 3W21A 1CN1A 2VCMA 3K77A 5IFPA 1ASJ3 4TTGA 4W6YA 2W94A 1LEMA 1NXMA 1PIV2 3VL8A 1HDKA 3ZFFB 1H9PA 2XL7A 4AHWA 2XBO1 3S30A 5FWEA 2WZEA 3KGLA 1N1TA 4MO3M 1ENSA 1MQTA 2GDFA 4META 4NHYA 1R64A 1HN1A 2QZ3A 3DL3A 1REDA 5FYZA 3FLTA 1RVF1 5DAVA 5ACA1 3N36A 1AX1A 4QX3A 5FR3A 1GUIA 4GD4A 1MZFA 4N7IA 2HWC1 3MUZ1 1X9TA 4JRLA 4CCMA 2HBTA 1AR61 1GLHA 2BGCA 3ZM8A 2VH9A 1XU2A 3J8F2 3N9LA 4YVSB 4YGCA 4QGNA 4QPIC 2A1XA 3WDWA 4HANA 1NY71 3WNMA 2VNGA 1DZQA 2I2SA 3HNBM 1KJLA 1W8TA 4YZ2A 2LROA 3GXUA 4FTSA 5HXVA 5JCTA 2Q30A 5A3NA 3CMGA 4A45A 3MHZA 3WNOA 2Q1MA 1L3JA 3K3NA 1YWKA 5LASA 4GJZA 2HYKA 3B00A 3VN4A 1IGOA 2TUNA 4QU1A 4HVOA 4CP9A 2P3KA 3W9AA 2K46A 1HRV2 4N90A 5JR7B 1W90A 5FXVA 2PA7A 3K2OA 1JZ5A 5I0SA 1QJX3 1EV13 1O4TA 3PVBB 3OBAA 4CRQA 1SPPA 2SBAA 2VUDA 3U1XA 3JB8A 3SLIA 2RM23 2VAUA 3MO4A 4LNVA 4CU8A 1OKOA 2JDKA 1R092 4IESA 2ZEZA 3JQWA 5F39A 3OY8B 1POQA 1DIWA 4OLLA 1OT5A 4A2UA 2HWD3 4PDWC 5C8CA 5JMCA 5A3WA 2JDUA 2F17A 2RS32 4CU7A 3KLSA 2Y6FA 4MHRA 4UW5A 1YJLA 1D7PM 4R4ZA 4MGSA 2W1UA 4FVVA 2HEWF 3NVCA 3WEZA 3HR9A 1UYXA 4BQYA 3LWCA 3B94A 2VW2A 1CVNA 2WQ8A 3CIHA 1PVC1 2XGXA 3USUA 1F4HA 3K51A 1RIRA 2R062 2XG3A 1VBD1 3HMYA 2DVDA 2YV8A 2JIJA 1WWYA 3Q8CA 4G3YC 2GN7A 4MZUA 5BPXA 3WP4A 3E5UA 1ZRIA 4XUOA 3WHUA 2ARXA 3P3PA 2VOVA 3SCFA 1SEFA 4E4HA 5KR7A 1EUTA 4ASKA 5A33B 2ORZA 2F4PA 4RSUA 3O0WA 5C3QA 3CQOA 4S2HA 3MIDA 1WCKA 2VVDA 4GWNA 2D3PA 3NKTA 3G6JB 4XYXA 2PMWB 3LIHA 4S2GA 5DDJ2 5FZDA 1S0IA 1ZVFA 2BRTA 2WO2A 1XSRA 1PX4A 4PLNA 4AHXA 5J7MA 4D3WA 3KCCA 3J8F1 3J7LA 4QQPA 1UZZA 4JX0A 1AR62 1HRI3 1G8WA 2QQLA 3I2JA 3SXWA 3VD4A 1FV2A 1D4M3 1ZYBA 2BVBA 1GOGA 4PBPA 4NMIA 5FKCA 1QF3A 1W2NA 3T2PA 4YFZA 5CADA 5I0DA 1QY4A 1RVF3 1SPPB 4LO7A 1KDMA 5FCCA 3POYA 3ZXDA 5ABJC 3B93A 4YM1A 4QQHA 5LZ6A 1JU3A 2Q4SA 1YHFA 4PQ9A 1RJ7A 1AZDA 3AKQA 4PLOA 1AR63 2OQ6A 2VCCA 4ES9A 2VECA 1EPZA 3GYDA 3AXDA 5D8AB 4IGPA 5F32A 2CTVA 4D6SA 3KVBA 1O5LA 1IHMA 3AL5A 3BODA 1QXRA 4DB5A 1WLDA 1UYPA 3K3OA 1QJZA 4Q27A 1I3HA 1E5RA 3WG4A 1NZCA 5LBFA 2YZ4A 1O7FA 5IWFA 1JZ7A 2EAKA 3KQRA 1R1A3 4XDOA 2Q1FA 3SEPA 4BQ1A 3O1PA 2VJXA 3ZIWA 1YI7A 3BB6A 3D4KA 2NYYA 4OZOA 5FPAA 4MXWA 1XNTA 4RQPB 4AQTA 1N3PA 4P08A 1RUI1 2WS92 1ZBA1 1EV11 1OC1A 2ZEWA 4W6XA 3K48A 4CEYA 4CEWA 2XJVA 3AM2A 2BBAA 4MXVA 3WV6A 4DO0A 4EJRA 2OT7A 4WVZA 1WMEA 3IT8A 5C3RA 1KS5A 1DYPA 1K3IA 3ZSEA 2R32A 4FPJA 5FY5A 4M4PA 2WN2A 3ELNA 2GNMA 4GJYA 4EWEA 1UXXX 2VMFA 1W28A 1H6XA 5IVEA 4Q4W3 1CZVA 2FDJA 1BEV2 3OF1A 4Q0VA 5FLJA 3POGA 1PVC3 4H2AA 4IEUA 4S2DA 1AYN3 2A70A 3VBRB 3LQCA 3KHCA 3J4UH 4UBGA 5FKBA 3RMYA 1BEV1 3WNLA 2YC0A 4BPZA 3KV6A 1UXZA 1COV1 2RS11 2RG4A 1UD1A 2ZZQA 4I3GA 5FFOC 2IWGB 4CYDA 3ZO0B 3WP5A 1XYPA 3AKPA 1O8PA 5H9SA 5IVYA 4XURA 4MG2A 2ZJCA 1ZZ6A 5CVRA 5FBJA 2PAKA 4MGQA 4E4ZA 3WCSA 2ZX1A 3V0AB 1QJY1 3Q8AA 4LLFA 1JU4A 2O14A 1NE4A 1GWKA 2YFZA 3AL6A 1OMIA 4M0HA 2EIEA 3E6CC 2F4LA 4WV8A 1C8M1 1HX6A 2GC2A 5FZLA 1W6MA 4IE0A 3AYAA 2NMOA 4ISRA 1F31A 1K45A 4XJ8A 2PLV3 3ZSMA 4IV1A 4XDPA 5IAVA 2RV9A 4V2WA 2W9XA 5FYYA 1OOPB 3AJZA 2E51A 4YW6A 2B45X 3I2KA 1PK6B 5A7QA 5EP9A 3MPPG 4ASLA 4BISA 3FUOA 1YQ2A 4EN6B 1OPMA 3ZIXA 2DFBA 3L2HA 4LITA 5T52A 4EWAA 3WP3A 1SDDB 3H1MA 3ZYJB 3VHOA 3PIJA 3BCWA 4C90A 1VR3A 2G19A 5GZEA 2AEYA 4AI3A 3VZMA 1C5IA 3UKVA 3USUB 3ZYRA 2EICA 5D8AC 1HRV3 3LPFA 4FQ4A 4QKFA 2PTMA 1C5HA 5GJ6A 2WUHA 3LB9A 4UFHA 4D94A 5IYYA 5JXGA 5LW9A 3S5AA 4Q1RA 2DVGA 2OW4A 1NLQA 3PUSA 2YBSA 1E5SA 1NXD1 3LF7A 5A32B 1ZBA3 3VB9A 2ZKNA 4C1WA 1NLRA 4CDXC 1RMU2 5EZWA 1ODNA 4W4ZA 1AR92 3VBSB 4OMDA 4JC1A 1X50A 4FPEA 1WKYA 1LHNA 1G9FA 3PU8A 4ZS2A 1N1VA 3C2UA 4K8RB 1ZRDA 3M4FA 3E97A 4Y20B 5A3LA 1YLLA 1QOOA 5T54A 3WNXA 1AUYA 2XL9A 3QH6A 1Q8SA 4COZA 4UWDA 4Y20A 4C8DA 2JECA 2MPFA 4N43B 4CCOA 3IAPA 1WCSA 4MOAA 1WCQA 3OG2A 4QPGA 2VL4A 2WS91 3WW2A 2VCBA 1OLQA 3NNFA 3GHNA 3HOBA 4LKSA 4E2SA 4QMAA 1AR83 1I6XA 3KV5A 1UAIA 4YSFA 4OHYA 5FYUA 1JZ3A 1QDCA 3MIBA 3MICA 2C5DA 2G9GA 2X8KA 2O8QA 1TQ5A 4QX8A 4CE8A 2D3RA 2WR9A 1MZ6A 1RUJ1 2Y6JA 5FMOL 2LW8A 5F9TA 4FPFA 1T6BX 3ACHA 1X8EA 4XE9A 1KEXA 2R7EB 4B1MA 3VZLA 4ES8A 4M3CE 3WDXA 1DZTA 4QX2A 1RXGA 3UK9A 1AYM2 2VD7A 1BXHA 4TN7A 5JSRA 1CAXB 3WF2A 4FOQA 4NWWA 1WMDA 1QU0A 2Y8KA 3N7MA 2E9QA 2PHRA 5L7OB 3GGLA 1ND3A 1QQP3 2HWB1 4LO5B 4P5HA 1AX2A 2GAUA 1W6PB 1ULEA 2GALA 2ILMA 3AZXA 4GH4C 3RWKX 3VGIA 4NN0A 5D8AA 4OYUA 1UY2A 5FZ0A 4QB1A 3VL9A 2OUHA 3LEIA 2E7AA 1QNWA 3THPA 1RMU1 2H6CA 3OD0A 2NZ9A 4XPVA 2RVAA 3HD8B 4GWIA 5FBZA 1R081 1LJ7A 4AWDA 5FZOA 1HQWA 5CU1A 1CQ9A 2VZTA 2EXKA 4WM8A 3H1WA 5F8PA 4A6OA 3POFA 3BGAA 5A7NA 2WZR1 4MSVA 5IFTA 1OOPC 1W6QA 4HN1A 3CF6E 1LOBA 2RS33 3FHIB 3LDKA 3OUJA 3VBOB 5GLUA 1F15A 3J7MA 4EYUA 2UYAA 2A71A 3GHMA 2DFCA 2H6BA 3FUQA 3C7OA 4UF0A 4CEWC 2ZGUA 4UXAA 5J98B 4C0HA 3VBRA 3T0BA 2NN8A 3ES1A 4GMP0 3K4DA 2GC1A 4KNCA 3IMMA 4LE3A 1LR5A 1BVP1 1HB4A 3FHAA 2CNAA 3WT3A 1EYBA 3VZOA 2RMU3 4IE7A 5IJRA 3T0AA 4DUWA 4CUAA 1NX9A 5A1AA 2B4KA 2Z5WA 3LEGA 2KM2A 1FPN1 1QHDA 3AP6A 1C1FA 2VW1A 3AVSA 2GN3A 4KWKA 4RYDA 1V0AA 3B9CA 3SH3A 5JMOA 2DU0A 3FFZA 3T4HB 1NG0A 2A3XA 4I0BA 4GKXA 5C9AB 2GU9A 2VGDA 3H42B 1ZZ8A 3Q8EA 1K5MB 1QJU2 4IUGA 1S2EA 5BNOA 5TSWA 5C70A 5EQUA 4HXCA 4LA2A 2YU2A 2ZAAA 1RUC1 2VQTA 5C8WA 1W8UA 4V2VA 4K1ZA 3N4MA 3I2GA 5FJHA 2H0BA 4DXZA 1W9SA 1W2OA 1OURA 4CSWA 2YXSA 1UQXA 1O3SA 1OQEA 4N9HA 4OFGA 4BCUA 3KT7A 4XF4A 5A6QA 4COVA 3IAQA 5A7WB 4CDQB 1VBB2 3OD4A 2QQOA 4CU9A 3JU9A 4CP9B 4RR3B 4IEYA 3URFA 4CDWB 1NY72 5KC5A 3T2TA 1NZIA 4WM8C 3OTFA 3KB5A 5FYCA 4N53A 3AC0A 4IV1B 1ALYA 1YEWA 2FDHA 4OHVA 2XH6A 1K5MC 3H1YA 1VP6A 1G9BA 2CL2A 5B4XA 4XW3A 1PMJX 5EYYA 4NPLA 1W6MB 1YQ6A 2B5HA 4LMFA 3ROUA 2Y0IA 3A21A 4Q8KA 5EJZB 1ZZCA 3VBUC 5ACA2 3JBG2 3RSJA 1FMD1 2BWAA 4N7UA 3TEXA 4JCKA 2YC2A 1JYIA 1RUOA 1RMU3 1SCSA 1WBLA 3C7GA 1FXZA 4Y1ZA 2ZAHA 3CHXA 1CAUB 2P3IA 3KMHA 4ZY9A 4DEVA 3AYEA 4LBMA 1OSGA 4Z92B 5FXXA 5I8SA 2VMDA 4NR1A 5IUQA 3HNMA 5BNQA 1W2AX 4K21A 2VZSA 3OSDA 4X6QB 1LKNA 1SBEA 3LOBA 1MS5A 1SZBA 3H9AA 2JEMA 4NAMA 2GNDA 3RVHA 1I5PA 4ZU7A 3AP4A 1OFSA 2GC0A 3KQ4B 1VAMA 3I3EA 2D6KA 3WXPA 2LUWA 5F5AA 1XNAA 1VE0A 1OXCA 1MS0A 2A75A 5EHDA 2QJVA 5FPZA 2EA7A 1ASJ2 4LBNA 1UMZA 3WCRA 3OCPA 4GB31 3ILRA 4NRPA 4M00A 4CVUA 4MHUA 1VBD3 3NJVA 4AOCA 4I0AA 5DN2A 4CUGA 2G9FA 5JLVA 4ITCA 2BBVA 2VTXA 3AYDA 4OUSA 4HSJA 2R041 1VPHA 1XC6A 2VMEA 4K7JA 1SLTA 5FY7A 1XE0A 4TZDA 3NJZA 4AVTA 1ZREA 3FZ3A 4LBLA 4MGIE 1VMHA 4GIQA 5FZ3A 4BU2A 4C0BA 1YIPA 3KCYA 1LOFC 3R05A 5F5QA 5AC93 4BIOA 1NYWA 4LQRA 4Q8LA 4QGMA 1XYOA 2W3JA 4GZ9A 4IEVA 2R1DA 1LU1A 1U5YA 1IS3A 2VMGA 5JI9A 2WA4A 3TB0A 1U0AA 5FP7A 5LATA 3SEEA 3LA2A 1MQTC 3ZFEB 3KM5A 3WY6A 4Q29A 1NCRC 2VVEA 3PUIA 5FZBA 2RDRA 4YW5A 1S0JA 1A34A 3WW4A 4TXWA 1H1MA 1POV3 2XUMA 2XBO3 4GH4A 2QZ2A 1XOYA 4QDQA 3OJBA 3E5QA 4YVSA 1MS9A 1GR3A 1PZ7A 2BNNA 3LPGA 3LA7A 1J3RA 3POJA 4XFBA 4B7EA 2WYSA 3ZYFA 4AEMA 5A3MA 2WSUA 1V6MA 4AYUA 3WG1A 3PVOA 4R9CA 2IZWA 5FRAA 5J09A 5JSPA 5FYSA 2LTNA 3AJYA 2JE8A 4FP3A 3THTA 1LEDA 1R1A2 2XLFA 4A7ZA 4F8AA 3KT4A 4DEQA 3O1MA 1US2A 1DHKB 2XWJB 4UOJA 1HB2A 4AI2A 5I93A 4TLGA 5JPNB 1W6OA 4LOTA 5F6KA 1W9FA 5GLZA 3LKJA 1PM7A 4YZ4A 2MNGA 2XQXA 2WO7A 1RXFA 3NRUA 1F9KA 1KFUL 4HETA 3O1SA 2PAEA 3TRSB 5KXBA 4AEDB 3D8CA 3M3OA 2CWMA 2Y34A 1H4GA 1WCDJ 5BNPA 3FHQA 1UW8A 1VBE2 4XFHA 1QH7A 2HYXA 5H9QA 2CAUA 2RS53 4KG0A 1CIYA 4IEWA 5JOZA 2RM21 1GWMA 5JXHA 3I3MA 4E4DX 1ULOA 3HN3A 1B09A 2AEZA 1BBT1 3A23A 3NW4A 2YG0A 1PVXA 3BOWA 4XF0A 4Q0QA 1NA1B 2HWC2 3TBDA 2BOIA 2HWD1 3ZN6B 1UZYA 2BV4A 4DOUA 5BNNA 4XJAA 2B8MA 1DQ6A 3CLPA 3IB3A 1JZ6A 1OHFA 3ETQA 4XXAA 4XBQA 2YUEA 1BVVA 4BDVB 1PHMA 5FP8A 2C26A 5GZFA 1BEV3 1BZWA 3GM8A 2OXBA 1X9PA 3GNEA 1V6OA 4PF1A 5IAXA 4QPWA 4XEZA 1T2XA 3NL1A 1ULPA 3C3VA 1WLTA 2BWCA 4ZONA 4QHBA 3DXTA 3ZXLA 1YJKA 1L7QA 1ZBE2 4Y4RA 3VDAA 3RZKA 2WWJA 3U75A 2B9UA 2CGPA 4K3UA 5ERLA 4AEDC 2A6VA 5KWRA 4Q26A 2P3YA 2QFEA 4NHMA 1SLAA 1UIKA 3OYWB 1Q8VA 4JGZA 2X05A 2FMDA 1HW5A 1GZTA 2BYVE 3SNMA 3VBRC 3NWKA 2ARAA 3PUAA 2X5IA 1H2LA 4UFKA 5FP3A 3SISA 1GQPA 4NVPA 1PNFA 3LSDA 5F3EA 5BYNA 1HN0A 3FLRA 1POV1 1XRUA 3BOPA 3J8F3 1LU2A 4W6WA 2PLV1 4XETA 3UGFA 3U4SA 5IVVA 4DZGA 5LCWL 3JQXA 1VMJA 2R49A 4XJ9A 1OA4A 3RPQA 2X53S 2AGSA 4PI0A 3AKRA 5G04L 3N7KA 1IG3A 3IIIA 3AMQA 2AH2A 1M4WA 4QX5A 1N3QA 5J36A 3VD5A 1O5UA 4CCCA 5EYXA 5BNOC 3D0SA 2D40A 3JCIA 2G9ZA 1PMHX 1W8NA 1QNYA 2P2KA 1Q43A 3MF6A 3O0VA 2RJKA 4AXOA 4AW7A 3E1F1 4PDWB 1YYNA 3KS7A 3BU7A 2R1BA 1UOGA 1Z7S2 2P4EA 2WWUA 1PK6C 4IERA 2KD7A 4AFDA 5JAXA 1MPXA 3PL0A 1WGPA 2XUEA 2CHHA 3UESA 5I0RA 3H8OA 4HMZA 3LDRA 3MIHA 1HIXA 4CCJA 5CFDC 1JI6A 1I1EA 3ZSLA 5E89A 3WSOA 2JG8A 1C3HA 1RUH3 5K0UA 3LE0A 2B9VA 3P6BA 5CNAA 3W20A 3AMPA 3WX5A 3ZSKA 1NT0A 3E5XA 5I91A 3QOPA 3WD5A 1GFF2 2ZX2A 3IM0A 1W9TA 5A3OA 1BBT3 3VBUA 2D6NA 2ZMLA 2W87A 4NUBA 2WC2A 2BNMA 1RTVA 2VR4A 2ZX4A 3KGZA 2Y6GA 4D8MA 1KFXL 1YI9A 3DN7A 1RUF2 2Q8DA 3D82A 1YQ5A 3VLBB 4YM2A 1D0HA 4L8QA 3RFRA 3VDDA 4CA9A 3ZXAC 4O65A 4PDWA 3WQ1A 2ZZJA 3HT1A 1JYNA 2JDHA 1MZEA 1H8TB 4RGGA 4DNYA 3VZJA 2DUPA 3LD8A 4NIGA 3WQ0A 3CEWA 4G4FA 2VUAA 3WDYA 3JD72 1NLSA 3ZMOA 3VKMA 3HT2A 4LBKA 2FQPA 1W99A 3RRDA 4XILA 2FHRA 1QJY2 2IXJA 4JGYB 3JUUA 1TMF2 3WOGA 3TEYA 1LOCA 1ENRA 2RS13 5HCAA 5K9YA 3O1VA 4Y1UA 2C0ZA 3V0BB 4RFT0 4CDXA 1QOTA 2DURA 5LEJA 1Y9QA 5EXOA 2NLRA 2P6CA 1V00A 3VHNA 1QQP1 2HWB3 1EAH1 3RDIA 4QU2A 3H8RA 1COV2 4ZZ8A 4FTEA 1FAYA 1PGL1 1WCUA 1QJY3 3UT0A 1QKQA 1GNYA 4A7YA 3IKWA 4XZUG 1DYKA 3R4UA 1POV0 4RN5A 2JD9A 5E8AA 2XLGA 4N8MA 2JIGA 1UOJA 3ES4A 2HEYF 1VBC2 3I2HA 1OOPA 3AYCA 1J83A 4IEZA 1YFXA 2MHFA 4RQPC 2OKXA 2G1MA 4C1XA 4HG6B 5B4NA 3AZWA 3CBNA 2JG9C 1OVSA 4ATEA 4XTPA 1L7RA 1CAUA 1RJ8A 4HBNA 4NRQA 4OI2A 5JOWA 3N7JA 4FPLA 4FOYA 4H7LA 2K0GA 4W65A 5SV5A 3WINE 4B4RA 3ZYBA 4JGYC 2JD4A 2FZ2A 3DUIA 4IE4A 4AGVA 1WD3A 2BQPA 4MX3A 2ES3A 1F8VA 2VC9A 1URXA 3HN1A 1LULA 4UFMA 1YUDA 2WJSA 1WW5A 3NSTA 1O4ZA 2VBDA 1ODMA 5GKAC 1JUIA 2ZGKA 2XJTA 4Y5SA 3UGHA 5GLWA 2VNRA 3W5MA 4M4RA 1C8NA 5T5PA 1RUJ2 2Y60A 1LAJA 2MEV2 1IS5A 2RR12 3RNSA 1SQ4A 3W58A 5BY5A 1ZBE3 4IEQA 4OUEA 5D1IA 2W95A 3HEIA 4QT6A 4D6RA 1RGSA 4P9WA 4YVSC 5C7GA 1B35B 3O12A 3DV8A 5M0TA 1W3XA 2WDBA 3J9SA 4H55A 1OA2A 1W06A 3DCQA 2PXJA 3WNPA 4COYA 1GNZA 4BQ4A 3AP5A 5A7PA 1AYM3 4DINB 3FFQA 5I8TA 1JZ2A 3ZVXA 1MEC2 1D2SA 4IE5A 3LCPA 1LHUA 4Q0UA 5K8SA 4CUBA 1Y3TA 3PJQA 3FE5A 1Y7BA 4FT8A 2CGNA 3TN92 1W8WA 3ACGA 4GXLA 1YNAA 2WA3A 2WZR2 3KF5A 3EJKA 5CIRA 4DMIA 2UURA 5B2GB 3APBA 1Z7S1 2EIDA 1REEA 1W6QB 2BDRA 4HVRA 3VD3A 5FMOS 4FPKA 1VRBA 1GU3A 2LALA 2UWCA 4O61A 1VBB3 4ZU5A 1IOAA 4BXFA 2Q1ZB 1W9WA 4QAWA 4S2FA 5KBFA 1TME3 3GBWA 1SLIA 3UL2A 5BUVA 1PM4A 2UU8A 1O3QA 2FDIA 1DGWX 2JDYA 5LRSA 4PT6A 4YW7A 2X5IC 3G7DA 1H1IA 1W03A 3ZKYA 5KXDA 2DWRA 2EIBA 3GCWA 3QLQA 4CXYA 3ZN4A 3MZHA 4AL9A 3ALQA 2W47A 3H0OA 2V4VA 4UF0B 1UU6A 5C8CC 3AK0A 2P3JA 1QEXA 1CPNA 3IIAA 4Q4V1 2OYZA 5IVFA 4IEOA 4H14A 2QDRA 4QPIA 5GLVA 1O6UA 4COUA 2G4IA 2GNBA 1DGRN 4DY5A 5D2AA 3S57A 5JIAA 4EWDA 2IXLA 4UAPA 3LAGA 3FL7A 3WG3A 4CDXB 5A6XA 5FWJA 2ADEA 4P9GA 2DTWA 2PQSA 2ZX3A 3ACFA 4LO6B 4RHV2 5FDBA 5F7UA 1R083 4OUMA 1Y9MA 2HLEA 2R6QA 3B69A 4YW3A 3VBHC 5FZ4A 3ZYIB 2A6ZA 4I02A 2W92A 4N53B 3W5NA 5HBAA 3NMBA 4FTBA 2WN3A 4HSLA 4IQPA 4DFSA 4ISQA 4K1YA 4Y24A 1FMD2 2XKPA 5L7OA 4M0NA 4CUCA 1S0CA 1DQ5A 3BVCA 5DG2A 3ZKUA 3I2OA 1SFNA 3E6BA 2AENA 1FOD2 3M8LA 2I74A 4LOSA 1NCQC 4QKDA 2XJSA 2D44A 4AQ6A 5A3UA 1XQNA 1ND3C 3AP7A 3F95A 3ZMNA 4PCRA 2JKBA 4GMP3 4NIHA 4XTMA 1JODA 2WO3A 3B7MA 3OEAA 1H9WA 4Y33A 3I4IA 3M3EA 5FZKA 1H1AA 4OHXA 3ST7A 3FC0A 4CCEA 2B42B 4A42A 3M1HA 2NM1A 2W39A 1H0BA 1LHOA 2CGOA 2P1BA 4Y3OA 4P02B 5FO7B 5A1FA 4L2NA 3SC7X 1MZ5A 5DUVA 4RGKA 2E33A 4XFGA 1N3OA 2ET7A 2V73A 3HQXA 4XUPA 3ZYPA 4AG4A 5AC91 1VRH1 5EPAA 2Y6KA 1CZTA 3ZN5A 4CP1A 5F1RA 2FD8A 1GBGA 1RUC3 2F6BA 2AC1A 4MVTA 5ISLA 2Q8EA 2WRAA 3T2QA 2GH2A 2IFRA 2C1FA 3NKGA 2JG8C 2N7GA 1W6OB 5K0UC 1Q5OA 4AGGA 1AXYA 2PHTA 4XOGA 5FQ0B 2XMLA 5CKQA 1MS8A 5DAXA 1NKGA 3SH5A 4QB6A 3KHBA 5ABJB 4INDA 4Q4X1 4E4SA 4RR3A 4CDWA 3I97A 1O4YA 4ARXA 4XUNA 3LIGA 4Y4YA 2ZGRA 1JOBA 4XFCA 3SH4A 4BIFA 2QCSB 2W46A 2KR2A 4XQDA 3NNJA 5FY9A 1L7LA 5AVAA 2ADDA 4Q4Y2 4E2QA 3SKJE 2BNOA 3AZZA 1Q56A 1ZA4A 5DUXA 5FY0A 5F37A 3LFMA 3LSEA 1K12A 1RINA 5DAPA 3MYXA 5BNPC 3VKLA 2WO1A 3O1RA 2AR6A 3N9PA 5GLTA 4JGYA 4URTA 2VNVA 4TSVA 3VBOC 5L9VA 2VE1A 5J3UA 4KU7A 2Y33A 4B7KA 2CWSA 4DPNA 3WDVA 2CDOA 4OHZA 2VPVA 1SLCA 1ZRRA 3POWA 4FQZA 3MLKA 1A3KA 1RUD2 1J84A 2CAVA 2ERFA 3I59A 4NIDA 1VBE3 3IDEA 3U78A 4LXLA 4MH0E 4BM8A 1GP5A 4FPYA 5FIXA 3V56A 1V9U1 2R16A 1RUD1 5DXDA 1NCRA 1XE8A 2RS51 4D7TA 4EZ4A 2O8OA 2XXZA 5JPMB 1TE1B 1XNDA 2QQVA 4HPKA 5L9BA 2FDKA 1H2NA 4IV3B 4NPRA 2ZOEB 2CV6A 4V1PA 5CISA 4KQ7A 1ZZBA 3N9MA 1ZM1A 2EAAA 4CPBD 2CDPA 1K5MA 2WFPA 1GP6A 1NA1A 4BK5A 5KHIA 2XHNA 2PHLA 2QQJA 3FJSA 1CPMA 4J1WA 2VBPA 4BQXA 1XB9A 2D6LX 2GP5A 3B01A 4QQ2A 4QXBA 4LPLA 5FUPA 1WMFA 5KXCA 1ST8A 4XC9A 3MUY1 1J1LA 5FY1A 2BVVA 2VCAA 3OY8A 3O1UA 2OPKA 1OVPA 4DRRA 3VHRA 4B4QA 2D6OX 2WLQA 4JTOA 4MXWB 3TN93 3V64A 3AXEA 1UY3A 1VBA2 1FPN2 3OGSA 4AR2A 3WHTA 3AMNA 2XONA 1H6YA 2KA3A 4LUKA 1GQHA 1Q8OA 1QJFA 4JAAA 4Q0SA 3RYRA 2DF7A 4MGZE 5ACA3 1F4AA 3CU7A 1RYYA 3ZFGB 3NV2A 2PFWA 3ATGA 4K8FA 2Q8CA 3OGGA 1YQCA 4LBJA 3A22A 4IXLA 4CEWB 1JYXA 4LT5A 3T3YA 1OA3A 1VAVA 1DGWA 3BTYA 2VULA 4AVSA 2YPJA 5FPLA 4JKMA 1QJX2 3BTZA 4E27A 5LEKA 4Q5OA 4ONUA 1AR91 2BPA2 4AI9A 1UCXA 4XUQA 5F5CA 2X29A 3MLJA 2GMMA 4D6QA 3EQEA 4LUMA 4PI2A 1UKGA 2WQZC 3WF3A 3ZXFA 2A6XA 2YYOA 4N53C 1O59A 1ZZ7A 2C6SA 4J25A 1QJX1 3RZZA 4P14A 2RE9A 3AVRA 1XBFA 4I01A 5EIYB 4DQAA 4I09A 5JZGA 2QQWA 3FWEA 5T55A 4HT1T 4ARYA 4KBBA 2XJQA 3VBHB 3U14A 1BQPA 4NIIA 4ZS3A 2ZGPA 4OQ9A 5C33A 2FDGA 1PIV1 3V0BA 4AFMA 3LA3A 2ZKLA 5SV8A 3VBSC 3WUCA 1P8JA 1W6NB 4IE6A 4E9KA 1CWPA 3RG0A 4P9YA 4E8DA 1OF3A 4CDUA 4XAEA 1GZ9A 4R9DA 4MUVA 1TG7A 5DAWA 5GM0A 5A80A 4CCKA 1UMHA 4BYYA 3ECQA 5A33A 1LOEA 3ETPA 2J1TA 3K75B 1ND2C 1OD3A 3MF9A 3UJQA 3JD73 4ASMB 5FTTC 4LTAA 2YGMA 4TYSA 4LK7A 1NCRB 1A8MA 2IFWA 4N43C 1ULCA 4A3XA 2X10A 3VBFA 3R4DB 2WSVA 4FFFA 4SLIA 4XF3A 2RS12 4NIAA 4YG6A 3T2OA 2DV9A 5A70A 4XBLA 2W91A 2SLIA 3MIFA 4L99A 1DGLA 4QXCA 1PO12 1W0NA 2VU9A 1D2QA 5G05L 5C3PA 1G9AA 3KZ4C 2PN5A 4NROA 1JBCA 1UPSA 1C57A 3H8XA 2VNOA 1EAH3 3MW3A 1DYOA 3SCHA 2PHXA 4EZHA 3WF4A 1FNYA 3IBMA 1LOAA 4QPYA 3TOJA 5JXJA 1YC61 3EBRA 3MEPA 2WAAA 4GB32 4LHNA 4B1LA 3ON7A 2D98A 3MI8A 4QKBA 4CTEA 3BTXA 1ULFA 4GH4B 3J7HA 4OI0A 2CY6A 2V72A 4B8EA 4RHV3 2JB4A 1JMUB 1MEC1 2W52A 4A41A 4CPBA 1BMV2 4P9LA 1OUSA 4ZXEA 3VDDC 5A3TA 3RZGA 2EIGA 4YZ1A 2NP0A 4XF1A 4YARA 1OBNA 2XWBB 1W2TA 2E7TA 1V6KA 2XLAA 2ZGTA 3GZEA 1YFWA 2QQIA 4LBQA 1VIWB 2WT2A 3D0JA 2ZHNA 3FX3A 4Q4X2 2BFUS 4XFFA 5DZEA 3Q8FA 1LESA 2Y38A 2UY8A 2WYFA 4R4XA 4YM0A 2RDQA 4LHKA 4QXHA 4QX1A 4W50A 1A8DA 4YW4A 1JW6A 3OGVA 5FLHA 4CDUC 3C7EA 3PTRB 2ZEXA 1AL23 1W8HA 2D7FA 4LIUA 5LBBA 5IK4A 1BJQA 1HB3A 1FT9A 1R091 3N9QA 4I3PA 3UV9A 3MFAA 4OQ8A 3WR0A 2FCUA 1KRIA 1PIV3 5FV3A 4Y1XA 1WD4A 1N1YA 1JUHA 3O7OA 3U0ZA 1QXJA 1LGNA 5LBCA 4P9JA 1CAVB 1CZSA 1JOJA 2RR13 3ACLA 1LENA 4FXGB 4QB2A 3WW3A 3LFIA 2C9AA 2BOJA 3IMNA 1UY4A 3R0RA 1ZZ9A 3RI9A 3ME2A 2VBBA 3DECA 2YB7A 3ZR5A 1AYN1 4IW3A 1S0GA 2VZ1A 4YRDA 3RZLA 2VZUA 1OFNA 4I30A 1HV0A 4RGAA 5FZ1A 3S6PA 3ZR6A 4JKKA 1J59A 2J1UA 1VBC1 5ANQA 1COV3 3OBZA 1DQ0A 4IGQA 4H7MA 1CJPA 1PO11 2Z4FA 5JZGB 1WW4A 1XNCA 1PZ9A 4PF5A 1O3TA 3VBSA 4U36A 2O1QA 2WNVC 1PGL2 3FBMA 1XNBA 4AEJA 4BK4A 1HXS3 5LK5A 1LHVA 2BTVC 1UZVA 4F83A 5BNNC 2E7QA 2FCVA 2VTXJ 1TME1 5IVBA 3HIFA 3OGRA 3WVJA 3OPZA 5CFCB 3ZFGC 2K9ZA 3ZXJA 2PAMA 4AFAA 2VO5A 2E26A 3WNKA 2WABA 2WLPA 5J96B 4XIKA 4CZSA 4D0QA 1LNSA 1C8M3 3BI3A 1LTEA 4KH9A 4ATFA 1NCQB 2I07B 4FPHA 3VDCA 4FSJA 1X82A 1CAWB 2OVUA 1UYYA 2WNUA 2JDZA 4QDSA 1ZBA2 5FP4A 5CFDA 1QJEA 4QQLA 5L36A 4KI5M 3BU0A 1KD7A 1MVQA 1NE6A 2BW8A 3T08A 4OHWA 1RUG3 1PMIA 3D5OA 4XBNA 5FXZA 2V5YA 3I2FA 2HH9A 3L9JT 4Q4V3 2ZGQA 5LB6A 3WW1A 1C8M2 2DBIA 3M2MA 3OYWA 4JGZB 2A7AA 2XDVA 2PHUA 4AHYA 3J7NA 4KWLA 4AVCA 5JIUA 3JZVA 5FQ0A 3AKSA 4N9IA 2VOXA 1SDWA 4O9EA 4CEYC 3BUCA 5T50A 1UZ0A 4Q4V2 3GBFA 4IL7A 3KT1A 1JYWA 2ARBA 2XVLA 1W8OA 2ATFA 3T09A 1HRV1 4HK8A 5FJKA 5CFDB 4NJ4A 5EJ3A 4QDRA 3P1IA 4JHTA 3O14A 4BXSV 4IEXA 1HQNA 1UOFA 2XQRA 4KWUA 2QQKA 4UT5A 1J1TA 1V70A 2CYFA 1F5JA 2OS2A 2C9KA 2Y0OA 5LRRA 2YGLA 3ZN6A 2XR4A 2LRPA 5H9PA 2D6PA 5JI7A 5IATA 1ND2A 2L9LA 1G9DA 1IKQA 3PHMA 4C91A 1RUE2 5FP9A 4LK6A 4OULA 3N7LA 5CG9A 3N3HA 1JZ8A 4N43A 5CKMA 4RL7A 2Z42A 2OA2A 4JV4A 4OI4A 2HJIA 2W1QA 1RVF2 3INAA 5DZGA 1JHJA 2Y26A 4I2OA 2B7YA 3F2ZA 4FAHA 3HQUA 1HB1A 4DXTA 4HK9A 5I0TA 5GZGA 1KS4A 3A7QA 4TWTA 4BA6A 5FLIA 2H0VA 5HI0A 2XB6C 1W04A 2J1VA 1EV12 3I59B 3K4AA 3TEZA 1AYM1 5FY8A 2YFUA 3H7YA 4WM7B 5E88A 5FMCA 4A4AA 1VRH3 3H3LA 2P37A 1QWRA 1QGLA 1VBA1 4G9SB 2WKKA 5CYYA 2WS93 3U4XA 2P5BA 4IV1C 2AYHA 2MEV1 2D93A 5FYMA 4O7XA 4DUVA 1AR73 1LOFA 2HWF3 3ZOIA 2D43A 5C4WA 3S7EA 2FZ1A 1ZRFA 2DVBA 2WWSA 3C8XA 2DCZA 1TNFA 3VZNA 1GANA 2EXHA 3GZTB 5JWPA 2GC3A 1G7YA 5FYTA 1BMV1 3POSA 5LA9A 1O91A 3RZHA 3D6EA 5FZCA 3VKNA 1JYVA 2R063 5FY4A 1DQ1A 1D0GA 1PX3A 1AF9A 3DKQA 3HPNA 4YW2A 3I3BA 5ABJA 4XQ4A 5JVVA 4FBFA 5CFCC 4AEKA 2LS6A 3CO2A 4RS5A 5FO8B 1RUG1 4ET7A 2BGPA 2NPIA 5AVPA 5CA6A 3O1TA 4LORA 1GV9A 4FO9A 3WQBA 1WW6A 3VD9A 3KSCA 2VM9A 1IS4A 2RS52 3LGRA 1CX4A 2Z2SB 3K46A 4WVMB 4Y22A 1V6NA 2WZPP 4P9XA 1MS1A 1RUE1 3PIGA 1H8TC 1QIQA 2XJUA 3MBWA 3X29B 1FOD3 3NO8A 2JENA 4P00B 3MIEA 5E6HA 4AHZA 1GZCA 1UKRA 2DVAA 5DUUA 3EHKA 3PMSA 4JDOA 5FYHA 2BGOA 4M01A 3DPRA 3JB4C 1LGCA 3NV4A 3PLQA 5JOXA 2PHWA 3DKWA 4XHBA 2V4AA 2ZCWA 1VBE1 1QQP2 1DP0A 3CJIC 4BH9A 4X6RB 1Y43B 5FMBA 3IPVA 5FZ9A 3THDA 1TVGA 1DG6A 2JX9A 3CZUA 5JUVA 2VZVA 4EN8B 1RUD3 2XKOA 3NQHA 1GQGA 1JH5A 4K9SA 2QQPA 1MVEA 1AL22 1DLLA 2YPDA 3WG2A 3AP9A 4KGGA 2XBO2 3OUHA 1MS4A 5T3NA 4ZXKA 1RHI3 4HPKB 2VUJA 2ZBJA 4LKFA 4FPGA 1W0PA 4XJUA 2E32A 1ENXA 5FZMA 2P34A 5E16A 4K6BA 4B29A 4YZ3A 5C3OA 1UF2C 2YROA 4MGKE 4UW4A 3RZJA 1IQDC 5HV0A 4Q1PA 1VLNA 4OCTA 2J1SA 1BKZA 3LEMA 4L97A 4B4PA 4PQQA 1W9YA 3MV11 4Q2FA 1H4HA 1QXPA 2RMU1 4UFIA 2UWBA 4LE4A 2WL1A 1FPN3 3E6DA 3B02A 1STMA 4NE9A 2ZGSA 5IK8A 1Y4WA 4KGQA 1S0BA 1SLBA 4L0PA 1W05A 1J58A 4GKYA 1GP4A 3ZYHA 1TME2 1UIJA 2E63A 2E53A 2VXRA 3GZAA 4NWVA 3RJRA 2KXLA 3QACA 4AE2A 1VBA3 1W3VA 3PVEA 2PHDA 4AI0A 2QTWB 4BE3A 2ZGLA 3NJXA 5APAA 4AVBA 4AVVA 3CZJA 1X33A 3VBHA 1KDKA 3M3QA 5D21A 3KV9A 1AR71 2HWF1 1QOSA 3ACIA 3ZLIA 5C5UA 3ZDVA 4AAXA 4K20A 3B5LB 4P9IA 4URAA 1AX0A 4QQOA 1AJOA 3PVNA 4OI1A 5CAZA 2XOMA 5FZAA 3ZSJA 3VDBA 3IPVB 4FOWA 1W0OA 3O0XA 3T0DA 1AYN2 3BIEA 4CCDA 1AR93 5LWBA 3H3UA 2R072 1YIFA 3ZFFC 1UNBA 2GSYA 2ET1A 1IPJA 4JGZC 2EVXA 3NJYA 4NRMA 2JE9A 3BTAA 2XJRA 3NAPA 1RC6A 1IKPA 3RJ2X 2VOTA 3TWIA 4BZ4A 5C4WB 4DUXA 1SCRA 3KWVA 1BLZA 4XABA 4UI9L 3ZPOA 2R073 4MGTA 1YFUA 4LBQD 1FMD3 3A0NA 4XMIA 4AI8A 3NNMA 1S0FA 1YXWA 1RUI2 4LR4A 5BNOB 1ULDA 2Y64A 1TZOA 3GZUC 3LZZA 1OKQA 2NMNA 1GOHA 5A6YA 2BP6A 2BU9A 2R0FA 1CR7A 2ZGOA 4KMQA 5DDJ3 3UJOA 2PELA 5J1XA 4WZCA 2DCYA 3FN9A 1NUKA 2GH8A 5DAQA 3PUHA 1DLCA 1SFPA 3DGTA 3S0MA 3T1LA 1D4M2 5CBLA 2HWE3 4YWAA 1GICA 1UOBA 3ENRA 2WNVB 2ZXQA 4QHOA 3Q8BA 4Z07A 2IVJA 4E2GA 4QHZA 2VMCA 1V9U3 2FMYA 1BHGA 3N35A 1UX6A 3IWZA 4LA3A 1WZXA 2D5HA 1DDLA 1CIWA 2Q8OA 3ZX7A 1MS3A 1IZ3A 2HWE2 3KF3A 4CP0A 1VJ2A 5C6CA 4QXKA 2VMIA 3WDTA 2R043 3ZDSA 1XE7A 3I54A 3UNPA 2JG8B 3EMRA 5K0UB 3JBG1 4D7SA 4JTNA 5J37A 4XF9A 3BIWE 4ORFA 3NV3A 5FUIA 4EV0A 4WVWA 2ZX0A 5LY1A 2VVFA 2HWD2 1BK1A 3M70A 2J7MA 4NOTA 3VDDB 3RYPA 4AGRA 2Q5TA 2ARCA 3OBTA 1UL9A 1EUUA 1KQRA 3QCWA 2WFF2 3U07A 5FZHA 1SLLA 5A7SA 1AJKA 4CP2A 3POEA 2DUOA 4NAOA 4ZU4A 4ZKTB 2VW0A 4JRAA 2BZDA 3TN91 3H3ZA 1EAH2 1IG0A 3ZPYA 3T30A 5K7PA 2E31A 4AZZA 3BKZA 1QMJA 2VY0A 2A5ZA 2HWF2 1AR72 1V6LA 3DXUA 4JZRA 1K42A 4HKLA 2TEPA 4HN0A 1VMFA 4HZFA 4KL1A 3HNYM 3J26N 1VBD2 4KU8A 1ND3B 5F2SA 1UX7A 2Z79A 3DEMA 1PO22 5GZDA 2ZHMA 2IUWA 3VZKA 1RB8G 2C24A 4AQ2A 2D97A 1QJU1 1CAXA 4UBHA 5LA2A 4ZHNA 3ILNA 2WAOA 1SBFA 2ZEYA 3MW2A 4RHV1 3NAPB 4I0WB 1CAWA 4KWJA 1CJDA 4YFWA 4KBZA 3RWNA 1UU5A 3VKFC 2RMU2 1XNKA 4BB3A 1S2KA 3M7AA 4FPCA 2JKXA 4PIXA 1PO23 4QPGC 1A78A 1RUF1 1HRI2 3P3NA 3AMHA 5T5LA 2IXHA 3IDBB 3NNLA 2VTFA 4AFCA 3OOXA 2NQYA 4BMBA 5A7OA 1U5XA 1MQTB 2DYCA 1PGSA 3CL1A 3ZFEC 4A7KA 5CG8A 1SFYA 3UYJA 2WNOA 2ORXA 2W0XA 4LHLA 1CD3G 2PHFA 3AKTA 4BLJA 2O0OA 2DBNA 5JZGC 3OBRA 2VZPA 2CU5A 1NOVA 5AC92 2P17A 4GAZA 3R4SA 1V6IA 4PBOA 1JZ4A 4BWOA 5CKNA 5FK7A 1AL21 5H9RA 3HWJA 3VBFB 5IK5A 1Y9GA 1JXNA 1ONAA 5BV6A 4DXSA 3USSA 3WUDA 1DU3D 1LODA 4LO4B 1B35A 4WBBA 1J3PA 5IK7A 3SHRA 3AX4A 4LJHA 3OPTA 4OVEA 2VQAA 1Q8PA 2BUKA 3I3QA 4O9GA 5CFCA 4XCBA 1OUXA 3QBQA 4UW6A 2GMPA 3O1OA 1RHI2 1UU4A 2JXAA 3C7HA 4YM3A 1Z0HA 1K5JA 3TNPB 4GALA 3RZMA 3RMXA 2I45A 1IQAA 3AZVA 4L9BA 1XJAA 1HJFA 5L19A 4CEYB 4JDMA 2WIIB 4NHLA 3OPWA 5FREA 1H8TA 1W2UA 4HKWA 5EWSA 5BNPB 2WNEA 3JBG3 4Q4Y3 1LGBA 3BYWA 3IDAA 4FCAA 5F3CA 1SHWB 1FI2A 2JB8A 2EALA 3VBFC 5EV7A 3DPRC 2UYBA 5F3IA 1HXS1 1E57A 3FLPA 1EY2A 3JD71 1TEIA 1X8MA 3UKTA 5KHKA 1WBFA 1UMIA 5F6LB 4XAAA 2OX0A 4Z82A 1UY0A 3WLUA 1GZWA 2C4XA 3HJRA 1XYNA 4M3CB 1PGW2 3CKHA 2ZACA 1HRI1 2YHJA 1GNHA 1D4M1 2J1AA 1HLCA 3EB7A 3M3IA 3M3CA 4UFJA 2RJ2A 4QX0A 2A6YA 1JOPA 2ZA9A 2OIIA 3MFCA 1GSLA 2W68A 2ZGNA 1CX1A 1X7NA 2J42A 2Y6LA 4GWJA 4IETA 5FO9B 1NCQA 1H2KA 5HCBA 1W39A 3HAGA 5IVJA 1GWLA 1QJU3 1HKDA 2J1RA 4XVHA 4LBQB 3CDZB 1OLMA 5K4LA 4BHPA 3MPBA 1O8SA 1CONA 5DMYA 1N47A 2D3SA 4W8JA 2JE7A 4A44A 4B3NA 4RS5B 2VMHA 4U2AA 4GA9A 1RUF3 5JSOA 2FBEA 1AHSA 1TNRA 1V9U2 1MEC3 2ZS6B 5JOYA 3ILFA 5C9AC 4MYEA 1BCXA 5DG1A 4EN9B 3BALA 2IVIB 1RUI3 3MW4A 2Z69A 3HBKA 3H8UA 4YW1A 3WQ7A 4LKEA 4XDQA 4JDNA 3W59A 1D4VB 1FX5A 2BEOA 2R042 3ORJA 2WNUB 3SMHA 5AFBA 2RM22 1FATA 4JQTA 3A4UA 3RQ0A 3FMGA 3ZXEA 4QX7A 5FZEA 4DY3A 1OI6A 4HKOA 4UW3A 4XZPA 2WT1A 4FI9A 1DCSA 4PHZA 1BYHA 1DZRA 3T1MA 3R6SA 4BQ3A 2VQ0A 2VXJA 2WQ4A 2QKDA 2ZTNA 4HONA 1CAVA 1AXZA 1JS9A 4WM7A 4EN0A 5L73A 1RL3A 4YGBA 3IZOA 1R093 3I3DA 4M3CA 3ZFEA 2OUJA 4BQ2A 4NO4A 3ZFFA 4Q4W1 1RUC2 5FZ8A 2AUYA 3I2IA 4YNIA 4YGEA 1WA6X 2JJ6A 2QVSB 1W6NA 3QD6A 1RUH1 4EN7B 3U37A 3GF6A 4IDZA 2A6WA 3HVDA 2DVFA 2RR11 2VUCA 1R1ZA 3GJBA 4M3CF 2GZWA 3VKOA 2ZPXA 4FXKB 5CEHA 1I5ZA 3DYMA 4UFLA 4DS0A 5EJ1B 5GZCA 1MACA 1OF4A 2RHPA 2VOWA 3B3QE 3LEKA 1RITA 5DUWA 1PGW1 2GNTA 1I9RA 1NQJA 2DCTA 1WMXA 4JHZA 5FPBA 2OQ7A 1DQ2A 4AFBA 1VBC3 5HV4A 2Q0AA 3GJAA 1G6NA 1RUH2 1PO13 3N9OA 2XJPA 3POIA 3VBOA 3UGGA 1U12A 3AZYA 1IPSA 1VRH2 1AR82 1YO8A 4TLFA 1JYCA 2W1WA 4AVAA 3BPSA 1YQ8A 4FOVA 1WUVA 5C8CB 5FPUA 1VB4A 1LOGA 3Q9OA 1G86A 3DPRB 2RJLA 3K4ZA 4YVWC 5LA1A 2R0HA 3RS6A
chains in the Genus database with same CATH topology
1NQDA 1YFYA 4WVVA 1QH6A 1LRHA 4Y1VA 4SBVA 1YCIA 1GYKA 1KXGA 1BBT2 4JVAA 1U5IA 4HVQA 1PK6A 2D6MA 1C4RA 5E1RA 2B39A 4Y1YA 3KCXA 1G9CA 3ZXGA 1FOD1 5EFUA 4Z2WA 5L7OC 4AF9A 4JQRA 1OQDA 1TMF1 1YRZA 4GWMA 2EXIA 4Z8BA 3GALA 1N1SA 2HWB2 4NHKA 4AI1A 4PIYA 4XJWA 1LHWA 1R1A1 3MDPA 3TAYA 2W08A 4MGYE 3S7IA 3RI8A 1CESA 2OZ6A 2DU1A 3DF0A 2JICA 3H50A 1EPWA 1XU1A 1WLCA 5J48A 2UWAA 1T6GC 5KXEA 1LCLA 2BFUL 2PYTA 4IV3C 5FPXA 3CJIB 1FNZA 3OGJA 1OLRA 4HL0A 1A6CA 4Q4W2 2AREA 3IN9A 1ZBE1 3VHPA 4AEDA 4YYOA 1NA1C 4PJYA 4R52A 5FOJB 4LEJA 2XVKA 3VBUB 4HLTA 5BNNB 2D5FA 3WDUA 4FPOB 1OQ1A 3AMMA 4KG8A 4XFAA 1VALA 2WFF1 4K40A 4F7ZA 2ETEA 3VV1A 2QUOA 4D7YA 3ZYGA 2IXCA 1F5FA 4RQPA 1Z7S3 1SBDA 1B35C 4QM8A 1VBB1 2MEV3 1AVBA 1RUG2 3TNQA 1CGPA 4Z1VA 3SITA 1HQLA 4XQWA 1IPKA 3HBZA 4AQSA 2YDEA 3UKNA 3BPZA 2HEVF 2PLV2 1MR5A 4L92A 1W6PA 1ZNPA 3ZFGA 4XJZA 1ZRCA 4RS5C 2R061 1DQ4A 2ENRA 2YY1A 1FV3A 2TBVA 4XFIA 4FAGA 2TNFA 2PQQA 4Q0PA 2ZABA 2DUQA 1Z78A 2IXKA 4XMAA 4COWA 1ZX5A 2WNUC 1WW7A 3WP6A 1AXKA 1LB2A 2WZR3 1AL0G 3ZXKA 2A3YA 2RS31 4Y26A 1RUE3 1O3RA 3V0AA 1OD5A 1TMF3 1VAKA 4QPIB 2X5IB 5HCFA 4YGDA 4R8HA 1S0EA 2ZHLA 4AK3A 1HV1A 1REFA 2ZMKA 5FOBB 1HXS2 4LO8A 3B9IA 4R9AA 3I7DA 4XHXA 4GULA 2HKXA 4D69A 5C4WC 1VB2A 1KITA 2IC1A 2VG9A 2EXJA 1UN1A 4FP2A 1KJRA 4WM7C 3SCGA 4GMP1 1LECA 1S55A 1JHNA 3PJYA 4L11A 1APNA 1DFQA 5I8YA 3KD4A 4X8NA 1H2MA 1JTZX 1RHI1 1F2NA 1J3QA 4J6GA 1R082 4PIZA 4BMEA 1IS6A 4X8PA 1ND2B 4XIOA 2UY9A 1DBNA 5KHGA 3PNAA 5A32A 5C9AA 4MV2A 1U5ZA 1XXNA 3I8TA 4IEPA 3V65A 2V09A 4BOWA 1ENQA 2DCKA 3MIGA 4IV3A 1DGRA 1AR81 2OZJA 4HFSA 3IDCB 5T5OA 1ASJ1 2XPJA 5CB7A 2WFF3 3PMEA 4XXPA 5KHJA 1M06G 2YMZA 2IXIA 1RUJ3 3A0KA 3LOIA 5AFEA 5LK7B 1PNGA 4H3WA 1Q3EA 3O5SA 4YVWB 4Q4X3 3CJXA 5JDBA 2JG9A 4QGLA 4MLOA 1RUNA 2LM3A 4YLZA 2HWC3 2E6VA 2XVGA 5GALA 2JG9B 1S0DA 4PLMA 2QNKA 5KHHA 1Q8QA 3EXUA 4CDQA 1S2BA 3U11A 4EROA 1OPOA 1PO21 1QDOA 3NV1A 3RYKA 1GKBA 3AB0A 5FAXA 1WLWA 4QM9A 1SMVA 3NAPC 3L2YA 4WVMA 4Y22B 4YG3A 3ASIA 4F3JA 2WT0A 4LULA 1DF0A 4RD7A 5IT6A 2A3WA 2QDNA 2GMEA 2ZHKA 1C1LA 2R071 2B46X 2K2SA 1GZWB 2XHKA 4QPGB 2DCJA 4YVWA 5T5JA 3VUOA 2WINB 1UPIA 4LBOA 1SACA 5DDJ1 3H7JA 3WZ1A 1EP0A 1S1AA 2EF6A 4LLOA 1C28A 4GB33 4CDUB 1JN2P 1H8VA 2VOKA 3AFGA 3TYJA 2HWE1 4Y5Z0 3U10A 2AZ5A 3CJIA 3GBGA 5DZFA 4YZ5A 1ULGA 4BLIA 1H30A 4YG0A 4GQ7A 1X36A 5BXXA 3FBYA 5KC6A 4WZFA 2A73B 2R30A 1PVC2 2ZMNA 3PTYA 4OZXA 4Q4Y1 3I2DA 1FYUA 4J1XA 3CNAA 3MLLA 4RA0A 4WM8B 4R9BA 4QD2A 2QE3A 4RR3C 4CDWC 3AFKA 2WNVA 2ZGMA 3MGUA 3EO6A 1PZ8A 2DTYA 4CDQC 1V6JA 3QH7A 5I0UA 1WA4A 1CN1A 1ASJ3 4W6YA 1LEMA 1NXMA 1PIV2 3VL8A 1HDKA 3ZFFB 1H9PA 2XL7A 4AHWA 2XBO1 3S30A 3KGLA 1N1TA 1ENSA 1MQTA 2GDFA 4META 2QZ3A 3DL3A 1REDA 3FLTA 1RVF1 5ACA1 3N36A 1AX1A 1MZFA 4N7IA 2HWC1 4JRLA 1AR61 1GLHA 2BGCA 2VH9A 1XU2A 3J8F2 4YVSB 4QGNA 4QPIC 3WDWA 4HANA 1NY71 2VNGA 1DZQA 2I2SA 1KJLA 4YZ2A 4FTSA 5HXVA 5JCTA 2Q30A 2Q1MA 1L3JA 1YWKA 2HYKA 3B00A 3VN4A 1IGOA 2TUNA 4HVOA 2P3KA 3W9AA 1HRV2 4N90A 5JR7B 2PA7A 5I0SA 1QJX3 1EV13 1O4TA 3PVBB 4CRQA 2SBAA 3JB8A 3SLIA 2RM23 4LNVA 1R092 4IESA 3JQWA 3OY8B 1DIWA 4OLLA 4A2UA 2HWD3 4PDWC 5C8CA 5JMCA 2RS32 3KLSA 4UW5A 1YJLA 4R4ZA 4FVVA 2HEWF 3NVCA 3HR9A 3LWCA 3B94A 2VW2A 1CVNA 1PVC1 2XGXA 3USUA 3K51A 1RIRA 2R062 2XG3A 1VBD1 3HMYA 2DVDA 2YV8A 4G3YC 4YGCA 4MZUA 2GN7A 5BPXA 3WP4A 3E5UA 3WHUA 2ARXA 3P3PA 2VOVA 3SCFA 1SEFA 5A33B 2F4PA 4RSUA 3O0WA 4S2HA 3MIDA 1WCKA 2VVDA 4GWNA 2D3PA 3NKTA 3G6JB 4XYXA 4S2GA 5DDJ2 1S0IA 1ZVFA 5J7MA 4PLNA 4AHXA 4D3WA 3KCCA 3J8F1 4QQPA 1UZZA 1AR62 1HRI3 1G8WA 1FV2A 1D4M3 1ZYBA 2BVBA 4PBPA 4YFZA 4ZKTB 1QF3A 5CADA 1QY4A 1RVF3 4LO7A 1KDMA 5FCCA 3POYA 3ZXDA 5ABJC 3B93A 4YM1A 4QQHA 2Q4SA 1YHFA 4PQ9A 1RJ7A 1AZDA 3AKQA 4PLOA 1AR63 4ES9A 2VECA 1EPZA 3GYDA 3AXDA 5D8AB 2CTVA 1O5LA 1IHMA 3BODA 1QXRA 4DB5A 1WLDA 4Q27A 1QJZA 1I3HA 3WG4A 1NZCA 2YZ4A 1O7FA 2EAKA 3KQRA 1R1A3 4BQ1A 3ZIWA 1YI7A 3BB6A 3D4KA 2NYYA 4MXWA 4RQPB 4AQTA 1N3PA 1RUI1 2WS92 1ZBA1 1EV11 4W6XA 3K48A 4CEYA 4CEWA 2XJVA 3AM2A 4MXVA 3WV6A 4EJRA 4WVZA 1WMEA 3IT8A 1KS5A 1DYPA 3ZSEA 2R32A 4FPJA 3ELNA 2GNMA 4EWEA 4Q4W3 1BEV2 3OF1A 4Q0VA 5FLJA 1PVC3 4IEUA 4S2DA 1AYN3 2A70A 3VBRB 3J4UH 4UBGA 3RMYA 1BEV1 2YC0A 4BPZA 2RS11 1COV1 1UD1A 2ZZQA 4I3GA 5FFOC 2IWGB 4CYDA 3ZO0B 3WP5A 1XYPA 3AKPA 5H9SA 2ZJCA 1ZZ6A 5CVRA 4E4ZA 2PAKA 3V0AB 2ZX1A 1QJY1 4LLFA 1NE4A 1OMIA 4M0HA 3E6CC 4WV8A 1C8M1 1HX6A 2GC2A 1W6MA 3AYAA 2NMOA 4ISRA 1F31A 4XJ8A 2PLV3 3ZSMA 4IV1A 1OOPB 3AJZA 2E51A 2B45X 1PK6B 3MPPG 4ASLA 3FUOA 4EN6B 1OPMA 3ZIXA 2DFBA 3L2HA 5T52A 4EWAA 3WP3A 3H1MA 3ZYJB 3VHOA 3BCWA 4C90A 1VR3A 5GZEA 4AI3A 3VZMA 1C5IA 3UKVA 3USUB 3ZYRA 5D8AC 1HRV3 4FQ4A 2PTMA 1C5HA 5GJ6A 4D94A 3LB9A 4Q1RA 2DVGA 2OW4A 5A32B 1NXD1 1ZBA3 2ZKNA 4C1WA 1NLRA 4CDXC 1RMU2 5EZWA 3VBSB 1AR92 4JC1A 1X50A 4FPEA 1LHNA 1G9FA 1N1VA 3C2UA 1ZRDA 3M4FA 3E97A 4Y20B 5A3LA 1YLLA 1QOOA 5T54A 3WNXA 1AUYA 2XL9A 3QH6A 1Q8SA 4COZA 4Y20A 2JECA 2MPFA 4N43B 1WCSA 4QPGA 2WS91 3WW2A 1OLQA 3GHNA 4E2SA 4QMAA 1AR83 1I6XA 1UAIA 4YSFA 4OHYA 1QDCA 3MIBA 3MICA 2C5DA 2G9GA 2X8KA 2O8QA 1TQ5A 2D3RA 1MZ6A 1RUJ1 5FMOL 5F9TA 4FPFA 1X8EA 4XE9A 3VZLA 4ES8A 4M3CE 3WDXA 1DZTA 3UK9A 1AYM2 1BXHA 5JSRA 1CAXB 4FOQA 4NWWA 1WMDA 1QU0A 3N7MA 2E9QA 2PHRA 5L7OB 1ND3A 1QQP3 2HWB1 4LO5B 4P5HA 1AX2A 2GAUA 1W6PB 1ULEA 2GALA 2ILMA 3AZXA 4GH4C 3VGIA 4NN0A 5D8AA 3VL9A 2OUHA 2E7AA 1QNWA 3THPA 1RMU1 2H6CA 3OD0A 2NZ9A 4XPVA 3HD8B 5FBZA 1R081 1LJ7A 4AWDA 1HQWA 5CU1A 1CQ9A 2EXKA 4WM8A 3H1WA 2WZR1 4MSVA 1OOPC 1W6QA 4HN1A 3CF6E 1LOBA 2RS33 3FHIB 3VBOB 5GLUA 2UYAA 2A71A 3GHMA 2DFCA 2H6BA 3FUQA 4CEWC 2ZGUA 4UXAA 5J98B 4C0HA 3VBRA 2NN8A 3ES1A 4GMP0 4KNCA 2GC1A 4LE3A 1LR5A 1BVP1 3WT3A 2CNAA 1EYBA 3VZOA 2RMU3 2Z5WA 2KM2A 1FPN1 1QHDA 3AP6A 1C1FA 2VW1A 2GN3A 4KWKA 3SH3A 3B9CA 2DU0A 3FFZA 1NG0A 2A3XA 4I0BA 4GKXA 5C9AB 2GU9A 2VGDA 1ZZ8A 1K5MB 1QJU2 5BNOA 5TSWA 4LA2A 2ZAAA 1RUC1 5C8WA 4K1ZA 3N4MA 2H0BA 4DXZA 1O3SA 2YXSA 1OQEA 4N9HA 4OFGA 4BCUA 3KT7A 4XF4A 4COVA 4CDQB 1VBB2 3OD4A 3JU9A 4RR3B 4IEYA 3URFA 4CDWB 1NY72 5KC5A 3T2TA 4WM8C 3OTFA 3KB5A 4N53A 4IV1B 1ALYA 4OHVA 2XH6A 1K5MC 3H1YA 1VP6A 1G9BA 2CL2A 4XW3A 5EYYA 1W6MB 2B5HA 3ROUA 2Y0IA 4Q8KA 1ZZCA 3VBUC 5ACA2 3JBG2 3RSJA 1FMD1 2BWAA 4N7UA 4JCKA 1JYIA 1RUOA 1RMU3 1SCSA 1WBLA 1FXZA 4Y1ZA 2ZAHA 3KMHA 1CAUB 2P3IA 3AYEA 4LBMA 1OSGA 4Z92B 5I8SA 4NR1A 5IUQA 5BNQA 4K21A 4X6QB 1LKNA 1SBEA 3LOBA 1MS5A 3H9AA 2JEMA 2GNDA 4ZU7A 3AP4A 1OFSA 2GC0A 1VAMA 2D6KA 3WXPA 2LUWA 1MS0A 2A75A 2QJVA 5FPZA 2EA7A 1ASJ2 4LBNA 1UMZA 3WCRA 3OCPA 4GB31 3ILRA 4M00A 1VBD3 4I0AA 2G9FA 5JLVA 4ITCA 2BBVA 3AYDA 4OUSA 4HSJA 2R041 4K7JA 1SLTA 4TZDA 3NJZA 4AVTA 1ZREA 3FZ3A 4LBLA 4MGIE 4GIQA 4C0BA 1YIPA 3KCYA 1LOFC 3R05A 5F5QA 5AC93 4BIOA 1NYWA 4QGMA 4Q8LA 1XYOA 4IEVA 2R1DA 1LU1A 1U5YA 1IS3A 2VMGA 5JI9A 2WA4A 3TB0A 1U0AA 3LA2A 1MQTC 3ZFEB 3KM5A 3WY6A 4Q29A 1NCRC 2VVEA 4YW5A 1S0JA 3WW4A 1H1MA 1POV3 2XUMA 2XBO3 4GH4A 2QZ2A 3OJBA 3E5QA 4YVSA 1MS9A 1GR3A 1PZ7A 2BNNA 3LA7A 1J3RA 4XFBA 4B7EA 4AEMA 5A3MA 2WSUA 1V6MA 4AYUA 3WG1A 3PVOA 4R9CA 2IZWA 5FRAA 5J09A 5JSPA 2LTNA 3AJYA 4FP3A 3THTA 1LEDA 1R1A2 2XLFA 4A7ZA 4F8AA 3KT4A 1DHKB 2XWJB 4AI2A 5JPNB 5I93A 1W6OA 5F6KA 5GLZA 3LKJA 1PM7A 4YZ4A 2MNGA 1F9KA 1KFUL 4HETA 2PAEA 3TRSB 5KXBA 4AEDB 3D8CA 3M3OA 2CWMA 1H4GA 1WCDJ 5BNPA 1UW8A 1VBE2 4XFHA 1QH7A 5H9QA 2CAUA 2RS53 4KG0A 4IEWA 5JOZA 2RM21 4E4DX 1B09A 1BBT1 3NW4A 1PVXA 3BOWA 4XF0A 4Q0QA 1NA1B 2HWC2 3TBDA 2HWD1 3ZN6B 4DOUA 1UZYA 5BNNA 4XJAA 2B8MA 1DQ6A 3CLPA 1OHFA 3ETQA 4XXAA 4XBQA 2YUEA 1BVVA 1PHMA 5GZFA 1BEV3 1BZWA 3GNEA 1V6OA 4XEZA 3NL1A 3C3VA 1WLTA 2BWCA 4QHBA 3ZXLA 1YJKA 1ZBE2 2B9UA 2CGPA 4K3UA 4AEDC 2A6VA 5KWRA 4Q26A 2QFEA 4NHMA 1SLAA 1UIKA 3OYWB 1Q8VA 4JGZA 2FMDA 1HW5A 2BYVE 3SNMA 3VBRC 3NWKA 2X5IA 1H2LA 3SISA 4NVPA 1PNFA 3LSDA 5BYNA 3FLRA 1POV1 1XRUA 3BOPA 3J8F3 1LU2A 4W6WA 2PLV1 4XETA 4DZGA 3JQXA 2R49A 4XJ9A 1OA4A 3RPQA 2X53S 2AGSA 3AKRA 3N7KA 3AMQA 2AH2A 1M4WA 4QX5A 1N3QA 5J36A 1O5UA 5BNOC 5EYXA 3D0SA 2D40A 3JCIA 3MF6A 4AXOA 1QNYA 2P2KA 1Q43A 3O0VA 4AW7A 2RJKA 4PDWB 1YYNA 3KS7A 3BU7A 2R1BA 1Z7S2 1PK6C 4IERA 4AFDA 5JAXA 1WGPA 5I0RA 4HMZA 3MIHA 1HIXA 5CFDC 1I1EA 3ZSLA 5E89A 2JG8A 1C3HA 1RUH3 5K0UA 5CNAA 3AMPA 3WX5A 3ZSKA 3E5XA 5I91A 3QOPA 3WD5A 1GFF2 2ZX2A 3IM0A 3VBUA 1BBT3 2D6NA 2ZMLA 2WC2A 2BNMA 1RTVA 2ZX4A 3KGZA 1KFXL 1YI9A 3DN7A 1RUF2 3D82A 3VLBB 4YM2A 1D0HA 4L8QA 3VDDA 3ZXAC 4PDWA 3WQ1A 2ZZJA 3HT1A 4RGGA 1MZEA 1H8TB 4DNYA 3VZJA 2DUPA 3WQ0A 3CEWA 4G4FA 2VUAA 3WDYA 3JD72 1NLSA 3ZMOA 3VKMA 3HT2A 4LBKA 2FQPA 3RRDA 4XILA 2FHRA 1QJY2 2IXJA 4JGYB 3JUUA 1TMF2 3WOGA 1LOCA 1ENRA 2RS13 5HCAA 5K9YA 4Y1UA 2C0ZA 3V0BB 4RFT0 4CDXA 1QOTA 2DURA 5LEJA 1Y9QA 5EXOA 2NLRA 1V00A 3VHNA 1QQP1 2HWB3 1EAH1 3RDIA 4QU2A 1COV2 4FTEA 1FAYA 1PGL1 1QJY3 1QKQA 4A7YA 3IKWA 1DYKA 3R4UA 1POV0 5E8AA 2XLGA 3ES4A 2HEYF 1VBC2 1OOPA 3AYCA 4IEZA 1YFXA 2MHFA 4RQPC 4C1XA 3AZWA 2JG9C 4ATEA 4XTPA 1CAUA 1RJ8A 4HBNA 5JOWA 4OI2A 3N7JA 4FPLA 4FOYA 4H7LA 2K0GA 4W65A 5SV5A 3WINE 4B4RA 4JGYC 2JD4A 2FZ2A 3DUIA 4AGVA 1WD3A 2BQPA 4MX3A 2ES3A 1F8VA 1URXA 3HN1A 1LULA 1YUDA 2WJSA 1WW5A 3NSTA 1O4ZA 5GKAC 1JUIA 2ZGKA 2XJTA 5GLWA 2VNRA 1C8NA 5T5PA 1RUJ2 2MEV2 1IS5A 2RR12 3RNSA 1SQ4A 3W58A 5BY5A 1ZBE3 4IEQA 5D1IA 4QT6A 1RGSA 4P9WA 4YVSC 1B35B 3O12A 3DV8A 3J9SA 4H55A 1OA2A 4COYA 1GNZA 3AP5A 1AYM3 4DINB 3FFQA 5I8TA 3ZVXA 1MEC2 1D2SA 3LCPA 1LHUA 4Q0UA 5K8SA 1Y3TA 3PJQA 3FE5A 1Y7BA 4FT8A 2CGNA 3TN92 4DMIA 4GXLA 1YNAA 2WA3A 2WZR2 5CIRA 3EJKA 2UURA 5B2GB 3APBA 1Z7S1 4HVRA 1REEA 1W6QB 5FMOS 4FPKA 2LALA 2UWCA 1VBB3 4ZU5A 1IOAA 2Q1ZB 4S2FA 5KBFA 1TME3 3GBWA 1SLIA 3UL2A 5BUVA 2UU8A 1O3QA 1DGWX 5LRSA 2X5IC 3G7DA 1H1IA 5KXDA 2DWRA 3QLQA 3ZN4A 3MZHA 3ALQA 3H0OA 1UU6A 5C8CC 3AK0A 2P3JA 1CPNA 3IIAA 4Q4V1 2OYZA 4IEOA 4H14A 2QDRA 4QPIA 5GLVA 4COUA 2G4IA 2GNBA 1DGRN 4DY5A 5JIAA 4EWDA 2IXLA 3WG3A 3LAGA 4CDXB 4P9GA 2DTWA 2ZX3A 4LO6B 4RHV2 5FDBA 1R083 4OUMA 3B69A 2R6QA 4YW3A 3VBHC 3ZYIB 2A6ZA 4I02A 4N53B 5HBAA 4FTBA 4HSLA 4IQPA 4DFSA 4ISQA 4K1YA 4Y24A 1FMD2 2XKPA 5L7OA 4M0NA 1S0CA 1DQ5A 5DG2A 1SFNA 3E6BA 2AENA 1FOD2 3M8LA 2I74A 1NCQC 2XJSA 2D44A 4AQ6A 1XQNA 1ND3C 3AP7A 3ZMNA 4PCRA 2JKBA 4GMP3 4XTMA 3B7MA 1H9WA 3I4IA 3M3EA 1H1AA 4OHXA 3ST7A 3FC0A 2B42B 3M1HA 2NM1A 2W39A 1H0BA 1LHOA 2CGOA 5FO7B 4L2NA 1MZ5A 5DUVA 4XFGA 1N3OA 2ET7A 2V73A 3HQXA 3ZYPA 4AG4A 5AC91 1VRH1 3ZN5A 4CP1A 5F1RA 1GBGA 1RUC3 2F6BA 4MVTA 2GH2A 2IFRA 2C1FA 3NKGA 2JG8C 2N7GA 1W6OB 5K0UC 1Q5OA 4AGGA 1AXYA 2PHTA 4XOGA 5FQ0B 3SH5A 1MS8A 5ABJB 4INDA 4Q4X1 4E4SA 4RR3A 4CDWA 1O4YA 3SH4A 4Y4YA 2ZGRA 4XFCA 4BIFA 2QCSB 4XQDA 5AVAA 4Q4Y2 4E2QA 2BNOA 3AZZA 1Q56A 1ZA4A 5DUXA 3LSEA 1RINA 3MYXA 5BNPC 3VKLA 2AR6A 5GLTA 4JGYA 4URTA 4TSVA 3VBOC 5J3UA 4KU7A 4DPNA 4B7KA 2CWSA 3WDVA 4OHZA 2VPVA 1SLCA 1ZRRA 3POWA 4FQZA 3MLKA 1A3KA 1RUD2 2CAVA 2ERFA 3I59A 1VBE3 3IDEA 4MH0E 4BM8A 3V56A 4FPYA 1V9U1 2R16A 1RUD1 5DXDA 1NCRA 1XE8A 2RS51 4D7TA 2O8OA 5JPMB 1TE1B 1XNDA 4HPKA 1H2NA 4IV3B 4NPRA 2ZOEB 2CV6A 4V1PA 4KQ7A 1ZZBA 1ZM1A 2EAAA 2WFPA 1K5MA 1NA1A 5KHIA 2PHLA 3FJSA 1CPMA 4J1WA 3B01A 2D6LX 4QQ2A 1WMFA 5KXCA 1J1LA 2BVVA 3OY8A 2OPKA 4DRRA 3VHRA 4B4QA 2D6OX 2WLQA 4JTOA 4MXWB 3TN93 3V64A 3AXEA 1VBA2 1FPN2 3WHTA 3AMNA 2KA3A 4LUKA 1GQHA 1Q8OA 4JAAA 4Q0SA 3RYRA 2DF7A 4MGZE 5ACA3 3CU7A 3ZFGB 3NV2A 2PFWA 3ATGA 4K8FA 3OGGA 4LBJA 4IXLA 4CEWB 4LT5A 1OA3A 1VAVA 1DGWA 2VULA 4AVSA 2YPJA 1QJX2 4E27A 5LEKA 4ONUA 1AR91 2BPA2 1UCXA 2X29A 3MLJA 2GMMA 3EQEA 4LUMA 1UKGA 2WQZC 3ZXFA 2A6XA 2YYOA 4N53C 1ZZ7A 1QJX1 3RZZA 4P14A 2RE9A 4I01A 4DQAA 4I09A 5JZGA 3FWEA 5T55A 4HT1T 4KBBA 2XJQA 3VBHB 1BQPA 2ZGPA 5C33A 1PIV1 3V0BA 4AFMA 3LA3A 2ZKLA 5SV8A 3VBSC 3WUCA 1W6NB 4E9KA 3RG0A 4P9YA 1GZ9A 4R9DA 4MUVA 5GM0A 4BYYA 3ECQA 5A33A 1LOEA 1ND2C 3MF9A 3UJQA 3JD73 4ASMB 5FTTC 4LTAA 2YGMA 4TYSA 1NCRB 1A8MA 2IFWA 4N43C 1ULCA 4A3XA 3VBFA 3R4DB 2WSVA 4SLIA 4XF3A 2RS12 4YG6A 2DV9A 4XBLA 2SLIA 3MIFA 4L99A 1DGLA 1PO12 2VU9A 1D2QA 1G9AA 3KZ4C 2PN5A 1JBCA 1UPSA 1C57A 2VNOA 1EAH3 3MW3A 3SCHA 2PHXA 1FNYA 3IBMA 1LOAA 4QPYA 3TOJA 3EBRA 3MEPA 4LHNA 4GB32 2D98A 3MI8A 4CTEA 1ULFA 4GH4B 4OI0A 2CY6A 4B8EA 4RHV3 1MEC1 2W52A 1BMV2 4P9LA 3VDDC 2EIGA 4YZ1A 2NP0A 4XF1A 4YARA 2XWBB 2E7TA 1V6KA 2XLAA 2ZGTA 1YFWA 4LBQA 4XFFA 1VIWB 2WT2A 3D0JA 2ZHNA 3FX3A 4Q4X2 2BFUS 5DZEA 1LESA 2Y38A 2UY8A 4R4XA 4YM0A 4LHKA 4CDUC 1A8DA 4YW4A 1JW6A 5FLHA 1AL23 2D7FA 5IK4A 1BJQA 1FT9A 1R091 4I3PA 3UV9A 3MFAA 3WR0A 1KRIA 1PIV3 4Y1XA 1WD4A 1N1YA 1JUHA 3O7OA 3U0ZA 1QXJA 1LGNA 4P9JA 1CAVB 1JOJA 2RR13 3ACLA 1LENA 4FXGB 3WW3A 3R0RA 2C9AA 3IMNA 3RI9A 1ZZ9A 3ME2A 1AYN1 1S0GA 4YRDA 1OFNA 4I30A 1HV0A 4RGAA 3S6PA 1J59A 1VBC1 1COV3 1DQ0A 4H7MA 1CJPA 1PO11 5JZGB 1WW4A 1XNCA 1PZ9A 4PF5A 1O3TA 3VBSA 4U36A 2O1QA 2WNVC 1PGL2 3FBMA 1XNBA 4AEJA 1HXS3 5LK5A 1LHVA 2BTVC 4F83A 5BNNC 2E7QA 1TME1 3HIFA 3WVJA 3OPZA 5CFCB 3ZFGC 2K9ZA 3ZXJA 2PAMA 4AFAA 5J96B 2WLPA 4XIKA 4CZSA 1C8M3 1LTEA 4KH9A 4ATFA 1NCQB 2I07B 4FPHA 4FSJA 1X82A 1CAWB 2OVUA 3WCSA 2WNUA 2JDZA 5CFDA 1ZBA2 4QQLA 5L36A 1KD7A 1MVQA 1NE6A