4HKLA

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 53
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hklA00
2B46X 1UU4A 4HK9A 2B45X 3EXUA 1T6GC 3VZOA 2C1FA 4HK8A 4S2FA 3WP5A 2DCYA 4XQDA 2BWAA 4NPRA 3WY6A 1BCXA 3VGIA 1UU6A 2VULA 3VHNA 1QH6A 3M4FA 4H7MA 4XPVA 3MFCA 3VZMA 2F6BA 4S2DA 2QZ3A 2D97A 5K9YA 1PVXA 1REDA 3VHPA 2JEMA 2BVVA 3MF6A 3VZKA 1HV0A 1KS4A 3VL9A 1C5HA 3O7OA 1ENXA 3WQ7A 1H0BA 2NQYA 3VZJA 1YNAA 1M4WA 2DCJA 1XNKA 1OA2A 2JICA 1XNBA 3RI8A 3ZSEA 3MF9A 1OLQA 3AKRA 1REEA 3LGRA 3RI9A 1HV1A 1TE1B 2DFCA 3WP6A 3AMPA 4HKWA 1F5JA 1BK1A 4S2GA 1QH7A 1C5IA 4XQWA 2QZ2A 3WQ1A 2NLRA 3LB9A 3VLBB 1HIXA 1OA3A 1OA4A 2D98A 1XNDA 1H4GA 2Z79A 1OLRA 3B5LB 1XNCA 3VZNA 2DCZA 4S2HA 1AXKA 3WP4A 4IXLA 1XYOA 3AMNA 2BW8A 3VL8A 2BWCA 4XQ4A 3WT3A 1XYNA 4HKOA 1KS5A 2JENA 3WQ0A 5K7PA 1UKRA 1NLRA 3AKTA 1IGOA 1H8VA 1H1AA 3WX5A 3VHOA 3AKSA 1REFA 5EJ3A 2VGDA 1XYPA 1BVVA 2DCKA 2DFBA 1W2UA 5HXVA 1H4HA 3HD8B 3AKPA 3B7MA 3WP3A 1UU5A 3AMQA 1XXNA 2VG9A 3MFAA 4HKLA 3WR0A 3AKQA 3AMMA 3VZLA 3WXPA 2B42B 3AMHA 2VUJA
chains in the Genus database with same CATH superfamily
1W8UA 1VE0A 1TMF1 1RUD3 1RUG1 1T6GC 2XJUA 3LA7A 2RS13 1S0GA 1J1TA 4N53A 3P1IA 2WWUA 3VBFA 1PNFA 4YM2A 1Y43B 4L8QA 3C7EA 4ZONA 3O14A 4IE6A 2WFF2 5LW9A 2PELA 3ZMOA 3M3CA 3ACIA 4XABA 5GZCA 3U0ZA 1SBFA 1FX5A 1S0DA 2AC1A 2FCVA 2VXJA 2Q8DA 4Q0VA 1PVC3 4KMQA 5AFEA 4Y26A 2PLV1 5ACA3 3T1LA 2JE8A 1HRI3 1R083 5AC92 1QGLA 3ECQA 1ND2C 3ZYBA 1U5IA 1U5XA 1YI9A 3WSOA 5FYCA 4MG2A 2CWMA 4ET7A 4IL7A 5FZEA 4XIKA 4GJYA 3FLTA 2XHKA 4KQ7A 4COUA 1PMHX 4P5YA 4LHKA 3KV6A 4NHYA 1ULPA 1JHNA 3WF2A 4Q4X2 3T2TA 4C0BA 4OHWA 1LULA 1XOYA 1XSQA 1RXGA 3AKRA 3BYWA 1REEA 5LASA 3OB8A 4GH4A 2ZX4A 3MW4A 1NCRA 3SLIA 5FYZA 4YRDA 3ZFGA 3AFKA 2CHHA 4IW3A 1ENQA 4GAZA 5LA1A 1W99A 2R043 2JIGA 5BNQA 3BI3A 4HETA 2AACA 5FP4A 5EFUA 1S0EA 1NXMA 2GN7A 1VBB3 3ASIA 2HEYF 4DINB 4JTOA 2A70A 4A44A 2P2KA 5FY9A 1KQRA 3WG2A 5EYYA 2XLAA 1NCQB 2WWJA 1HIXA 1OH4A 1V9U2 3IBMA 1VBC3 5DABA 5G04L 3S0MA 1AUYA 3MPPG 4ZXKA 4AVAA 5T54A 4IV1C 4UW3A 2RS33 2Z79A 5FZCA 4XZUG 2OYZA 3ZKYA 4N8MA 2R30A 4XFGA 2PQSA 1B35C 3DECA 2OPKA 1WLWA 4S2HA 2JG8B 3MDPA 4L11A 5GM0A 1V6OA 1RUJ1 4A3ZA 5IHRA 4QHOA 4WM8C 4FPFA 4AYUA 1ZYBA 1XYNA 2ETEA 3D5OA 5FY8A 1QY4A 1RHI1 2SLIA 1W8ZA 1BXHA 3PNAA 1VRBA 5JCTA 4OZOA 3GHMA 2X5IA 1UQXA 3AKSA 3GDBA 1UX6A 4QXKA 2A3YA 5KBFA 4R52A 3GZAA 3MIHA 2EAKA 2QNKA 4I0AA 2OKXA 4CP2A 5IK8A 2AENA 3VBRA 2I45A 2WO2A 2ZEWA 2RM21 3ZXEA 1PO12 1ZZ8A 4FSJA 4NRMA 2E32A 2ARBA 5A1LA 2WT2A 1Q8PA 1ZZBA 3A4UA 3B9CA 3ZYRA 1FT9A 1CONA 1NZCA 4ORFA 3AMMA 1X36A 3DEMA 4BQWA 1G7YA 3RS6A 1ZRFA 2VPVA 4NIDA 2VMDA 2YC2A 2VTXJ 4PBOA 4GB33 3KCXA 4XUNA 3EXUA 4Y3OA 4JZRA 4I02A 2XVGA 1OI6A 2D6PA 5I0TA 3USUB 4PT6A 1JYVA 4R9CA 4UYBA 1F8VA 4YVWB 1OD5A 1F15A 3DYPA 2VD7A 3N7KA 1AL21 1CX4A 4FOYA 1AR63 5FZAA 5CKMA 1FMD2 4D94A 3HR9A 3POGA 3H3UA 2IXKA 5CU1A 1VBD2 1OOPC 4D7YA 3PVNA 3OYWA 5F37A 1QJU1 2VZOA 4URAA 3LZZA 3NKGA 5DAWA 3KT4A 2ES3A 4RQPA 1HV0A 5C4WB 1ACCA 1QEXA 1GP4A 2D7FA 5KHGA 2WFPA 5ABJA 5APAA 4CCOA 4V2VA 3E6BA 4HLTA 5H9SA 3OGVA 1HRV1 2FMYA 3M3OA 1G9AA 1LEDA 2QDRA 1MQTB 3FWEA 4BQ5A 4XILA 5BNPB 1W3VA 2DCJA 4DXZA 1LOEA 3T0DA 2CL2A 3VBSB 5FPBA 3VN4A 5C8CC 5CVRA 3T4HB 1PGW1 4NAMA 3ZFFC 1D7PM 5D1IA 4CEYB 2A73B 2Z69A 4XEZA 1GOFA 5DAQA 1YO8A 1NQDA 2ZCWA 1UMIA 4LO4B 2RS51 4LE4A 4XDOA 1W6NB 3A0NA 4UFJA 3VBUB 2VOWA 5HCFA 4FFHA 5D21A 4HZFA 2JE7A 2BYVE 2ZHKA 3ZPOA 2VZPA 1PGL1 1VP6A 2R6QA 2YROA 5FY1A 4CXXA 1XJAA 1W2AX 1AR72 2A6VA 1ND2A 3IKWA 1QHDA 2XQXA 4QX0A 5IK4A 3VBOC 3KVBA 4FAHA 1D0HA 4DUWA 3KHBA 4ZS2A 4ASLA 4BCUA 4MUVA 2WJSA 4M3CA 2G9FA 4OI4A 3VKMA 3WG1A 1XE7A 2A1XA 4LXLA 1CQ9A 2VW1A 5FCCA 2HBTA 5FMOS 5EPAA 1RXFA 1MS0A 3KVAA 5GLUA 2DBIA 5KHJA 2BVBA 2NPIA 4OUSA 3AP9A 2OQ7A 3H8RA 3AJYA 3ZN5A 5FV3A 4PIXA 3ZFEC 1DHKB 2LROA 2OVUA 5H9QA 2RDSA 4QDRA 2WS92 5FP8A 1UOFA 1NLRA 3LIGA 1UZ0A 5E6HA 3HVDA 1EV13 1DQ4A 4WVZA 4WVVA 1KDKA 1VALA 1W2OA 2WABA 1OD3A 1WKYA 1VBE1 2W52A 3ZPYA 1XYPA 1DYPA 4Y5Z0 4LOSA 4IV1A 1O5UA 4CCDA 4KI5M 4RHV1 3WP3A 1B35A 2ARCA 3AC0A 1CJPA 5BNNB 2WSVA 4YVSB 5KHIA 1CVNA 2EIBA 3FC0A 3H8UA 2WNUB 1N3OA 3C7OA 4LA3A 1ZRIA 3H7JA 4QX5A 2HWE1 4KBZA 3M3QA 3WVJA 4WM8A 3ZDVA 1F4HA 1RVF1 3FFZA 2DYCA 2JDKA 3LDKA 5CG8A 1DQ1A 3LEMA 1RUD1 3AMHA 3BB6A 4CE8A 3O5SA 2VMCA 2XBO3 5JOYA 3NVCA 1MZEA 4YW2A 2EIEA 3NAPB 4XDQA 1G9BA 5DUWA 2VZSA 4TLFA 1VRH3 2GNTA 1RUH2 2DDUA 3E97A 4JTNA 4N9IA 3OUJA 4YW1A 1RUI1 1QH6A 2BGOA 2JDHA 3TBDA 2L9LA 3PTYA 4H7MA 3WNNA 3GJBA 4E2QA 4LBLA 5FZ6A 2W2IA 1PVC1 4LULA 3NJYA 2QZ3A 3WW1A 4BQYA 1CAVA 3O12A 2W1UA 5TSWA 3CZUA 3AYCA 1R081 4QXCA 2QQOA 3RJ2X 4BQ2A 3HN3A 4R9AA 1K3IA 4OHZA 3WQBA 1H0BA 3R05A 1Q8SA 1WMDA 2YG0A 4DUXA 3ZXJA 1R091 2JDZA 4QX2A 1YQ6A 1CD3G 2B9VA 4L2NA 2ZGSA 3RZKA 2KXLA 1LCLA 3R0RA 1ZBA2 3IT8A 4ONUA 1X9PA 4XYXA 5CNAA 1S0BA 1K5MB 1R1ZA 5A32B 2HWC2 4IV3C 5FZIA 2YB7A 3RFRA 3BVCA 3TN92 3TRSB 1UF2C 4Q4V3 2ZX3A 5T52A 3AZWA 2YPDA 3LGRA 3N7JA 3J26N 3IDBB 3OCPA 5GZDA 2DFCA 4EZ4A 4AVVA 1OOPA 4AXOA 2R041 3K3OA 1PM7A 1U5YA 2K9ZA 3M1HA 3U14A 5LCWL 4S2GA 1JYIA 4KBBA 2JX9A 1ODMA 2RR12 2Y6HA 1CAWB 2XWJB 1W6MB 2PHXA 4LQRA 4QPIC 4P14A 5FQ0B 2EXIA 1E5IA 1QOSA 1RUE2 2VZRA 3AB0A 1RITA 2E63A 1VBC1 2DBNA 2DWRA 1V6LA 4A6OA 2BOJA 3OGGA 2LS6A 2W5FA 2IFRA 2C4XA 2UWBA 5G05L 4AVTA 3HWJA 3M3EA 5FZ7A 1G86A 3HBZA 5JVVA 2PQQA 4W50A 3ZYJB 5FPUA 3JUUA 3ACLA 4P9YA 2BZDA 3UT0A 1AR81 5FJHA 1HB4A 3H1MA 1FV2A 3VZNA 3LOIA 5JIUA 1JU4A 3UETA 1AVBA 5C8CA 1DZQA 1C28A 2OZ6A 3ZFFA 3D82A 1E5HA 1Z7S2 2C5DA 2LW8A 3KSCA 4N43B 2W0XA 2BWCA 2W1WA 1PIV2 2Y38A 4COYA 1DU3D 3P6BA 2R063 2DV9A 4X8NA 5IAVA 5AC91 1GR3A 4K20A 4P9IA 4NVPA 1XRUA 5DZEA 4AFCA 1OC1A 2DURA 4INDA 1ZNPA 3O0WA 3U11A 3ZX7A 3B9IA 4QX8A 2ZGMA 2P3KA 2ARXA 4Y4YA 3LOBA 1W6QB 3WX5A 4UXAA 1TMF2 1OKQA 1RUG2 3VBOA 4JGYC 4XOGA 5AVPA 1QWRA 5J96B 1O3SA 4CCCA 4H7LA 4ZU5A 5HXVA 3JCIA 3MIEA 3DPRB 1HW5A 3GALA 3U75A 1JUIA 3USUA 5DQ0A 4Z1VA 4OHVA 1X8MA 2CAUA 2EVXA 3WHTA 2JDMA 1AXZA 2YU2A 1OF4A 1W6PA 3WG4A 4CDXA 5DAVA 1Q3EA 2WNVB 2WSUA 1ODNA 5EXOA 5FDBA 2PLV2 2NP0A 5JR2A 4M3CE 3ZFEA 4I0BA 3FLPA 2QFEA 4K8FA 3URFA 3PIGA 5DXDA 1HQNA 3BOWA 1DQ0A 5A3PA 1AYM1 1OMIA 3H3ZA 2R16A 3AK0A 3JU9A 4K21A 4K6BA 4XQDA 3POIA 1UXZA 5IK7A 1OVPA 1L7LA 4CDWC 3OBZA 3FJSA 3HMYA 3O1TA 1M06G 3VHNA 3ZYHA 1AL0G 4XACA 3AP5A 5D8AC 4LBKA 3WG3A 4P5HA 3VD5A 1SLLA 1DLCA 1JH5A 1REDA 2QQNA 4D7SA 1YEWA 3WOGA 4HPKA 4ASMB 1QNWA 1KS4A 2ZAAA 3V0BA 3LIHA 5LBBA 2W08A 3K75B 4FP2A 3N9OA 5CBLA 4GD4A 4QU2A 5DUVA 3ZIWA 4QHBA 3CNAA 1H2KA 1G6NA 1UZVA 2GMEA 2ZZQA 4YM1A 4GXLA 4QKFA 4LK6A 1STMA 3I3EA 1R64A 4QM9A 5SV5A 4EQVA 5A70A 1PO11 5C9AC 4JGZC 2HWF3 3OD4A 3MEPA 3WHUA 4K9SA 4QX3A 4ATFA 4LKSA 3NJVA 5CFDC 1HV1A 1I9RA 3VKOA 3LFIA 5FP7A 2D93A 2EIGA 4CDXB 4F83A 1RC6A 3I2KA 4Q0QA 1G8WA 1JU3A 1RUJ2 1BKZA 1QJFA 5EV7A 2HWB3 3ZXLA 1YI7A 3KV5A 4B29A 1G9CA 4D3WA 4Z2WA 3GBGA 2P4EA 5FRAA 1SFNA 4N53B 2AGSA 3VBFB 4Q4W3 2ZGOA 3A22A 1RHI2 4NN0A 5GZFA 4COZA 3W5NA 3IDAA 2IVIB 5IK5A 1OPOA 5BV6A 1OA4A 5GALA 2PAMA 4Q0SA 2YBPA 2BFUL 2JKXA 5LBEA 4FPHA 3EBRA 3O1OA 2FDHA 2C24A 1WW7A 1HQWA 1GFF2 5T5OA 4A42A 1X33A 4Y24A 3O1VA 3I2FA 1YFUA 2DCZA 1D4M3 3QLQA 2ET7A 2XUMA 4KG0A 1KGYA 3WP4A 1V6IA 1W8FA 2RM22 4IV3A 4I30A 1RUOA 1ZBE2 2AH2A 3OBRA 4F7ZA 2BW8A 3J9SA 2Y0IA 5KR7A 2ZHMA 4R8HA 5AVAA 5JOWA 1QJY3 2ZMLA 4XIOA 1BVP1 1BLZA 4COWA 5J7MA 3AX4A 2NZ9A 2WLQA 4P00B 1J84A 1NUKA 4WZFA 4AFDA 5BNNA 1IPJA 3WNOA 3W58A 1EV11 5FAXA 2VR4A 3I97A 4QPIA 5I8SA 1GANA 3SXWA 2HEWF 4XE9A 1IHMA 3N36A 1KITA 3D3AA 3POSA 4GH4B 1NCRB 2CU5A 2HWD3 1UN1A 4JKMA 4NR1A 3EO6A 2P34A 3ZFGB 3RWNA 4LBOA 4IEPA 5T5JA 4EN6B 4U2AA 3RQ0A 4SLIA 4AHXA 3IZOA 3LF7A 3ZXDA 3EB7A 3PLQA 5CA6A 1RGSA 2JDNA 5A7WA 1O8PA 4G4FA 1IPSA 1QJU2 2YC4A 5A7NA 4CP1A 5FK7A 2EA7A 4E8CA 5FJKA 2XBO1 2F4LA 3DL3A 4Q0PA 2VUJA 1YXWA 1CN1A 4I0WB 2VQAA 4PQQA 3ZDSA 1UU4A 4Q1RA 2WO1A 1UY0A 2EICA 2WLPA 3NJXA 3ZVXA 4XAAA 1HRV2 5JLVA 5L9RA 2PTMA 4CA9A 1IS4A 1WA4A 2VOTA 3PMSA 4JCKA 4AR2A 4DEVA 1VRH1 1O4ZA 2XKPA 2FCUA 4JGYA 2C6SA 2VMIA 4NIGA 1IS3A 1UYPA 4N90A 2J1SA 2N7GA 2QTWB 4ASKA 2CNAA 5L7OC 3POYA 3OUIA 4XJAA 2GP5A 2Q5TA 2RS52 3AL6A 3HQXA 3P3NA 5A32A 1Y3TA 1ENXA 2X5IB 1F4AA 1JS9A 1K5JA 2XKOA 5IW0A 2DTWA 2V5YA 2D3RA 1F5FA 3HAGA 3S5QA 1PGL2 5F5CA 1UOJA 3VBRB 5FY5A 4AVSA 4O61A 3MIDA 5FPXA 1O6UA 1GOGA 1V6NA 4EROA 5KXBA 1WLCA 1EUTA 1NG0A 1D0GA 2D5HA 1KFUL 2VQ0A 2R1BA 4MHRA 2VO5A 4AL9A 3CHXA 1MS4A 3H50A 5B2GB 1MS8A 3U1XA 4CDWA 4OUEA 3OD0A 4G3YC 4XTMA 3ILRA 5FXXA 2WZR3 2IXJA 3I2OA 4CTEA 5D8AA 4JKKA 1BQPA 4YM0A 4K40A 4XAEA 1VB2A 1UYZA 1GZ9A 5LA9A 2BBAA 3UL2A 5IVEA 1G9FA 1F5JA 4QQOA 3AYDA 2ARAA 1F35A 2G19A 4CU8A 3G7DA 1W2TA 2P1BA 1U0AA 4ZY9A 1A78A 3J7HA 1NKGA 4XBNA 1VAVA 1PZ9A 1YCIA 5SV8A 4CU6A 5C9AB 2LALA 1ZRDA 2GZWA 1XNDA 3AZYA 2PYTA 1C8M1 4FFIA 3Q8CA 1XSRA 3O1PA 3OYWB 1CR7A 3N35A 3I2IA 4XW3A 4C91A 1VBE2 4CCEA 2P3YA 4RQPB 4RFT0 4L99A 3JBG3 1UMZA 4ITCA 3PJYA 4RHV2 5C9AA 3ROUA 4JGZA 5ABJB 5H9RA 1QXJA 1XYOA 2GC2A 2KA3A 3EHKA 1C3HA 4A7YA 3MUZ1 5CFDA 3RMXA 3U07A 2V09A 4D6SA 3WQ0A 1KS5A 3M2MA 2HKXA 4UOJA 2HWE2 3DF0A 3N3HA 1CIYA 5GLTA 3AVSA 1RVF2 1GQPA 1S55A 4A3XA 5A80A 4BJ0A 3QBQA 1RUD2 4EWAA 2ZAHA 2K2SA 4QKNA 1ZBA1 4QX1A 2XQRA 5DUXA 3VDDC 1WWYA 4NHLA 3MHZA 1BVVA 2HBUA 1IOAA 3ZM8A 1NLQA 2HWC1 2Z42A 1QOOA 4EWDA 1Y9GA 3OPWA 1ULDA 1RUI2 1WCKA 4AAXA 2FDGA 1XQNA 3N9LA 4M4RA 4RFRB 1PVC2 1SDDB 2NYYA 5HPOA 1ND2B 1H9WA 3CKHA 3ZXKA 2BUKA 4GIQA 2PHDA 2XVKA 4NAOA 5ISLA 5FZGA 5FYTA 1HRI2 2VZUA 1R082 4B7EA 1QXRA 3JB4C 4M3CB 1UPSA 2ZHLA 1F2NA 2ADEA 4FQZA 5KC6A 1CAXA 4XFIA 2VBDA 4HK9A 1SBEA 3LPFA 5CKQA 3UKVA 4LR4A 1W3XA 4PF1A 3JQXA 5FZOA 5FY0A 2HJIA 1O3RA 1R092 2ZX2A 4WM7C 4LO8A 1ZVFA 4BA6A 4X6QB 3ZO0B 3NMBA 2DUOA 5FP9A 4QWNA 4WVWA 3TNQA 3ZR5A 1W8HA 4CCLA 4Q27A 2PAKA 4XPVA 5CEHA 3D8CA 2J1RA 4QPWA 2E7QA 2FBEA 3NNMA 1JYTA 2PXJA 4YGBA 1MZ6A 3N4MA 4DO0A 2K46A 3GF6A 1ZZ7A 2WA3A 3NNFA 3BU0A 4URTA 1HB1A 2R042 4CP9A 1C1FA 2W68A 3S7EA 5EQUA 3O0XA 4LBQA 5A7SA 2AEYA 4FPGA 3LDBA 4IV1B 4IEZA 4JC1A 2W95A 1M4WA 3ELNA 1VBC2 4LEJA 1B35B 1KJLA 3IIAA 4BISA 4B1MA 1QJX1 1RJ7A 2P37A 1UCXA 2BU9A 5FXZA 2A3XA 4E2GA 5HV0A 1WZXA 1SBDA 1VMHA 2CGNA 2R071 1VR3A 3AL5A 1O3QA 1AR82 1ONAA 4LHNA 1IPKA 3I2DA 4WM8B 5JDBA 5FUNA 5M0TA 5FXWA 5BNOC 1LHWA 2ZABA 1US2A 4MSVA 1EYBA 5FP3A 1IS6A 3OPZA 3NW4A 4Q1PA 2WA4A 1QH7A 4GMP1 4CDUC 4LO6B 1DGLA 1BMV1 1URXA 1JMUB 5LBFA 5LBCA 1NYWA 1SHWB 1CZSA 2A75A 1H8TC 1OVSA 4HONA 1FI2A 2X29A 1DZTA 5FZLA 2TUNA 5EYXA 1I5ZA 3B5LB 1JOBA 1D4M1 1CAVB 2YZ4A 3A7QA 4FPKA 5A7QA 3UKTA 2XH6A 1AXKA 5BYNA 1W6OA 4Z92B 2WNEA 3AJZA 2W39A 4UFIA 4YFZA 4L97A 1QJY1 2QQLA 1XPWA 4AEKA 5E88A 1SCSA 3WT3A 4WVMA 2V73A 5K7PA 2JENA 3UGFA 4BHPA 4I01A 5E89A 2YV8A 2OZJA 3BODA 3J7MA 4GWIA 4MGIE 4O7XA 3IAQA 2Q1FA 3ACGA 1W90A 1GU3A 2ZPXA 2W92A 4GMP0 4QPYA 3SC7X 3WDXA 4BDVB 2V72A 1AYM2 1V6KA 2GMMA 2WWSA 2ZGTA 4XFBA 1KEXA 1YJKA 2VECA 4JRAA 3NL1A 1OOPB 4YZ1A 1V6MA 4FOVA 2D6NA 3U78A 3AP4A 3K2OA 3Q8BA 2G9GA 2F17A 5DZGA 4QGLA 2JD9A 5JOZA 1PMJX 1C4RA 4E4HA 1SLBA 1QDOA 4PI2A 2JXAA 2XUEA 1AYN3 3CJXA 4PLOA 1YQ2A 2VOXA 1YUDA 3DV8A 4ZU7A 2B8MA 2IC1A 5IWFA 4RSUA 2QJVA 1AX0A 2XDVA 3OBTA 2VZ3A 5C3PA 3GCXA 1D2SA 5C8CB 3MUY1 3ZFFB 3JQWA 2R0FA 5E1RA 1VB4A 3VGIA 3VDDA 1UU6A 3R4DB 2WFF3 4KWLA 4BIOA 1RUC3 4DB5A 3FHQA 3IM0A 3TEZA 4XBQA 5A6XA 4XHBA 3VZMA 1ZBE1 3Q8EA 5CG9A 1TG7A 2VOKA 1J59A 1SEFA 1AR93 1QOTA 4LE3A 2YFZA 4B3NA 2WAOA 2FDJA 3I3QA 1CAUA 3GZTB 3H9AA 4FO9A 3T2QA 2VQTA 1ZZCA 3VBOB 1O91A 3V64A 5IYYA 2ET1A 4Z07A 2G1MA 3AP6A 3ZYGA 5C3OA 4P9LA 2HEVF 2VBPA 3POWA 2D3SA 1SLIA 4HOOA 3WLUA 2UY8A 4WM7A 3UV9A 1SFPA 4Q4X3 5LATA 1BHGA 3ZSLA 4AQ2A 2KR2A 4FXGB 1LHUA 1DQ2A 1W6PB 2WZR1 3OG2A 5L9BA 3OTFA 2VMHA 1SPPA 2YMZA 4IEOA 2SBAA 3RI9A 3VKFC 3HT1A 1X9TA 3ZFEB 2LRPA 2PA7A 1BBT3 3H0OA 4N9HA 4YNIA 2KD7A 2D6OX 2ZMNA 4MXWA 2BERA 5FBJA 5I0UA 5GLZA 2ADDA 1OXCA 3UNPA 2X53S 1V9U3 2RDQA 2FDFA 1EV12 2P3IA 1I5PA 3AVRA 5ANNA 4IESA 5C5UA 1OUXA 3T2PA 5A1FA 1H4GA 1MS9A 2FDKA 4XCAA 4GWJA 4QQLA 1POV1 3RNSA 3SH5A 3JBG1 2WR9A 4KL1A 2ZHNA 4HPKB 2UWCA 3V0BB 4AG4A 3K4ZA 5K0UC 3D6EA 1FOD3 4YW6A 1S4CA 2WBKA 3JD73 4IE4A 4R9DA 4LO5B 4XFFA 2A5ZA 3SH4A 5CISA 4HN0A 1JZ2A 2WUHA 4MH0E 2BV4A 1EAH3 3KS7A 2MEV3 3KT7A 3UK9A 1H8VA 4CDUA 2XBO2 4OMDA 3CIHA 2H6BA 1H8TA 1HKDA 4QQPA 3OGSA 1IQDC 2NMOA 3RZJA 1Y9QA 1ZZ9A 1JYXA 3T2OA 3T3YA 1VRH2 2B4KA 1W2UA 3SQOA 2BGPA 3E6DA 3ZIXA 2QBXA 4XJWA 4F3JA 4XC9A 1CZVA 1POV0 3FE5A 4BMBA 5C6CA 4IEVA 1PGSA 2VOVA 2XJRA 3WDVA 3MFAA 3WINE 1XU1A 4AEJA 1LENA 2VTXA 2XB6C 2WC2A 4Q4Y3 5FWEA 4B8EA 4P08A 5IVBA 3U4SA 3ZYIB 4MGSA 3E6CC 1LHNA 3CJIC 4ARYA 1GZWA 2ZTNA 1QJZA 2OPWA 2YGLA 1YQ8A 2A6WA 4IV3B 2QQIA 4Y1ZA 3DKQA 4DRRA 3PU3A 1RJ8A 4XXAA 4AI0A 1JHJA 3WNKA 1F9KA 1LGBA 2XL7A 4CEWC 2TBVA 4OLLA 4DY5A 4LNVA 1DIWA 5FZ4A 4Y5SA 4DXTA 3ZSMA 2JJ6A 2F6BA 3VD4A 4Y1XA 3E5UA 4JDOA 2DU1A 1WD3A 5K9YA 2Y6LA 2BVVA 3OPTA 2D6KA 4HANA 4IE5A 4QPIB 3ZMNA 2VTFA 4AGRA 5JSRA 3NNJA 2WN3A 2ID4A 1IZ3A 3O7OA 3WQ7A 4CP0A 5GLVA 3B00A 4CCNA 1BBT1 1DBNA 1LESA 1OBNA 2DU0A 3ZKUA 2GC3A 4TN7A 4AW7A 1NE4A 5FPVA 2BNMA 5FYHA 5EIYB 4HL0A 2RS11 1OFNA 3G6JB 4BU2A 1SQ4A 4MGZE 4XF9A 4DQAA 1FPN3 5FZ1A 3LA2A 5K8SA 3E1F1 4NO4A 1C8M2 5A7WB 5DUUA 2CWSA 1OLQA 4I3GA 1H6YA 2H0BA 1DDLA 4UT5A 1WBFA 2Q8OA 2RV9A 5H9PA 4G9SB 1N3PA 1UX7A 3LSEA 4K1ZA 3VKLA 2DCTA 5FZ9A 2WQZC 3PVBB 4HKWA 1LGNA 3WNLA 4GJZA 3POEA 1XE8A 5ACA1 2JG9C 2ILMA 2KM2A 1HRI1 2R062 2GSYA 2RE9A 2WINB 1O4YA 3ATGA 4OZXA 4E8DA 1A8DA 4XJZA 1AJKA 1AR73 2VZQA 1V00A 3K4DA 2UU8A 3AP7A 4FVVA 3K46A 1H1IA 1GWLA 4JGYB 5IVVA 3VDBA 2XWBB 1WMEA 4IEXA 1KXGA 2ZXQA 1Q8OA 3A21A 4RGGA 1CZTA 4DMIA 3BTXA 5LY1A 1OUSA 2GNBA 4NWWA 4BLJA 1WW4A 4IEWA 4MGQA 4DS0A 2QQWA 4JDNA 3T09A 1RB8G 2XLGA 5LEJA 3BCWA 1XU2A 1N1TA 2R1DA 4PIZA 2CTVA 1QKQA 1VBB1 4I3PA 4XUPA 3WUCA 1LOAA 1YFWA 2XL9A 1XBFA 3TOJA 5A3NA 3TEYA 4NIAA 1B09A 5J36A 5A3MA 1ALYA 2XJSA 4CDWB 4FI9A 2WRAA 1JXNA 2RS31 5EJ3A 4EN9B 2FQPA 1PNGA 4WV8A 3BPZA 5BXXA 5D8AB 3JB8A 5FO8B 1WD4A 3NWKA 3AKPA 3ABZA 1BYHA 5EZWA 4YPJA 5A7OA 4MYEA 3J4UH 2QQMA 3CQOA 1XXNA 2RMU3 3MLJA 2Y60A 5FZDA 2OX0A 4YVSC 4GKYA 3OF1A 4E27A 3B93A 1AYN1 1RUF3 1LNSA 1W9FA 2GMPA 2VVEA 1D2QA 3PUQA 5T5PA 1YHFA 2DVAA 4NJ4A 4YGEA 3RWKX 1DYOA 3GHNA 3SMHA 5F2SA 4TLGA 3VZOA 4CSWA 4SBVA 5J98B 2W1SA 2BWAA 5DDJ3 3WY6A 4JGZB 4K8RB 4O9GA 1VJ2A 1IG0A 2QQJA 4R4ZA 2VNVA 1DF0A 5EP9A 1QJX2 4IE7A 5F3GA 2X05A 5CFDB 3VKNA 3MBWA 2XONA 1TNRA 4AEDC 2R072 5KHHA 1GZTA 1ZRCA 1AR91 1UO9A 1UIKA 4GQ7A 2Y8KA 4OUMA 2D3PA 5F8PA 1DGRA 2GAUA 3MF6A 4HSJA 5F9TA 4KWKA 3VZKA 4A41A 3VD9A 2HLEA 3HPNA 4B1LA 1C5HA 4LLOA 2PFWA 4XTPA 3P3PA 2YYOA 4AQTA 2XGXA 4FAGA 3PIJA 5DN2A 3SHRA 2H0VA 2A71A 2XMLA 4GB31 2YDEA 4MZUA 5FIXA 4OQ8A 2P6CA 1N47A 4R4XA 3W21A 1BMV2 1X7NA 1GP5A 2LM3A 3AXEA 4O9EA 3L9JT 2PHRA 3CJIA 1GWMA 2QUOA 2AZ5A 2VL4A 3BPSA 1AR61 3AYEA 1LOCA 3N9NA 4CXYA 1CX1A 4PLNA 2UURA 4P9XA 1D4M2 1LHOA 3NV3A 1FXZA 4CEWA 4RR3C 3ON7A 4IEYA 1S0FA 5HCHA 1ASJ3 2ZGNA 2UY9A 1CAXB 1QJY2 2RR13 1WLTA 5FZOB 1H2NA 5E8AA 1A3KA 5ERLA 3WF0A 2VUAA 5C33A 1JZ7A 4UFKA 1C5IA 1MS1A 4CCKA 3LKJA 2VZTA 3VLBB 3IWZA 4Y4RA 4Z82A 1JZ5A 2R49A 2CV6A 4V1PA 1C57A 1QQP3 2VCBA 3HNYM 3VDCA 1LB2A 1WCSA 4OI0A 3N7MA 3UJQA 3TEXA 3ES1A 3KQ4B 3OY8A 1OLRA 1HN0A 4WBBA 2HWD2 4XZPA 1D4VB 2EIDA 1KDMA 1Q56A 1UOGA 2YGMA 4Y5TA 2XJPA 1FOD1 1GP6A 1Z7S3 2X10A 3EJKA 4CP9B 4XVHA 4IXLA 5JXIA 3JD71 2WZPP 4QDQA 3WCRA 1BJQA 5LWBA 4X6RB 1W39A 4LBQB 3TYJA 2WQ4A 2VU9A 4DRVA 1JZ8A 3V65A 5T3NA 2ZGRA 4HMZA 4AQ6A 1GQGA 5JXGA 4XFHA 2JG9A 1EAH1 3H1WA 4Y20A 3U10A 4W4ZA 2MEV1 4CDQC 1H9PA 3ENRA 4V2WA 5J09A 3KB5A 1IGOA 1UYYA 2BNOA 1EPZA 1HXS3 1PK6C 1ZRRA 5FOJB 2YHJA 3WZ1A 5DG2A 1REFA 4LIUA 5FMOL 1ZA4A 2Z4FA 5L73A 2A6XA 3LD8A 4AAPA 4DXRA 3BALA 3HQRA 2FZ2A 4AGGA 4I09A 1DCSA 1FV3A 4IERA 3WD5A 4PBPA 1H30A 4HVRA 1OLMA 3K51A 2W47A 5I93A 1GBGA 2VG9A 5DAPA 5FZ8A 1PHMA 1SFYA 2PLV3 2VCMA 4HKLA 2JE9A 2WT0A 4Q4Y1 5LEKA 2QQUA 4M3CF 4UWDA 4W6WA 3J7NA 4CUBA 5GZGA 1W9TA 4Q0UA 2ZGUA 1CIWA 2OQ6A 4QX7A 3PUSA 4BZ4A 1PO23 1VAKA 4YGCA 3PJQA 1AHSA 1VMFA 3U37A 1JOPA 1TEIA 1YYNA 5F5AA 2XJVA 1W6OB 3HQUA 2D6LX 2PHFA 1JI6A 4IGOA 1RIRA 2Y6KA 4QD2A 1W05A 3H7YA 2CDOA 3OEBA 5FZ3A 2VJXA 4WVMB 2DUQA 1S0IA 2WZR2 4COVA 4H55A 1YIPA 1TZOA 2XJQA 4NHXA 3L2HA 4NUBA 4XUQA 3O1RA 4JHTA 4RS5C 4LORA 4OFGA 1LODA 2O0OA 2WL1A 4PQ9A 4TZDA 3BTZA 1ZA7A 2NQYA 4LJHA 5JUVA 2BEOA 4UF0A 3WDWA 2ZJCA 1FPN1 2FMDA 4NE9A 5JWPA 5CKNA 1RYYA 2JICA 4GWMA 5JSOA 4KU7A 4BQXA 5FZMA 1YC61 2J1UA 2R7EB 4MO3M 3Q8FA 5F7UA 1COV3 3JBG2 3HOBA 4GZ9A 4OVEA 1S2KA 3F2ZA 5JR7B 1E57A 4AEDA 2UYBA 4LTAA 2Z5WA 1UY1A 4PDWC 4D8MA 4KWUA 1X50A 4YG0A 3O1MA 1C8NA 4AFBA 2O14A 5KWRA 3O0VA 3LEGA 4OMCA 5DAXA 1TME3 1PMIA 2RG4A 1CPMA 3AZZA 4NOTA 3GXUA 4BM8A 1PX4A 1VMJA 2VW2A 1UXXX 3M8LA 5ANQA 1VAMA 3VDDB 2BBVA 1J58A 2D98A 3WV6A 2E7AA 4JRLA 4XCBA 2ZX0A 3AM2A 1DP0A 4H2AA 2BNNA 2WIIB 4JHZA 3ZSKA 4Y33A 4AHWA 4LBQD 4Q4V1 3FHIB 2WKKA 2OS2A 1CAUB 1CGPA 1UW8A 4TYSA 5DMYA 3BUCA 5FMDA 4Q2FA 4RR3A 4OCTA 3VL8A 4XQ4A 2PHLA 4CUCA 4EZHA 4HKOA 3S5AA 4C90A 2Q8CA 3RZMA 2VNGA 3B94A 1DQ6A 4H14A 5CB7A 3KCYA 3LA3A 5FO9B 2ZEZA 4ATEA 2B7YA 1A34A 4WM7B 3M7AA 1RMU3 2YBKA 4AGVA 2RJ2A 4K3UA 4GALA 3DN7A 3T08A 5A6YA 3IDCB 5IFTA 2GN3A 2ZGLA 5FMCA 2J42A 1SPPB 1SDWA 4BWOA 1T2XA 4LK7A 1W04A 4NPLA 4XFCA 1AL23 1HQLA 2D40A 1W03A 4GH4C 4BOWA 1GQHA 4BXSV 5JSPA 5J37A 2VMGA 1UU5A 1S1AA 2RMU1 2Y6GA 4JAAA 1UKGA 4MXWB 2ZKLA 2QQKA 3ZOIA 2XLFA 2ERFA 1T6BX 1RUF1 4P9WA 2WAAA 4BB3A 2R061 3APBA 4YSFA 3MZHA 5A33A 3ILFA 3HEIA 1U5ZA 5FLIA 3MLKA 2ZBJA 1IS5A 5FR3A 4ZKTB 2VBBA 4CDQA 1BBT2 2R32A 1HRV3 5JI9A 4OI1A 2WZEA 4QDSA 5DDJ1 1BEV3 2W3JA 3NV4A 2RS12 1UZWA 3P5BA 5T5LA 4M0HA 4NPRA 4ZZ8A 1J83A 1UYXA 4LLFA 2PHTA 1K12A 4OHXA 4UBGA 1SLCA 3IMMA 5BNOB 1WW5A 3FN9A 1ND3C 3VBHC 3DUIA 3D0SA 4LKEA 3I8TA 4BH9A 1UD1A 5FZHA 4DY3A 1R1A3 4CDUB 1J3PA 1ZM1A 1TNFA 1FATA 1ULGA 1SCRA 1O4TA 3CL1A 2GP3A 3PU8A 2DVGA 3RGBA 1YLLA 4M4PA 5ACA2 1H8TB 3BN6A 3RZZA 3T0AA 1YFYA 1WMXA 2W94A 3RRDA 4AZZA 1LECA 1W8OA 2DVBA 3KGLA 3VZJA 1YNAA 2VNOA 4QMAA 2BRTA 2GC1A 4YM3A 1XNKA 3IPVA 4HVQA 1OA2A 2VCCA 1PZ7A 1OLME 1JN2P 2IFWA 2ZGQA 3MF9A 4JVAA 4M01A 4AVBA 3WUDA 1E5SA 1QF3A 4META 5CFCC 1L7QA 1UL9A 1HDKA 1ASJ1 3MICA 1L3JA 4QPGC 1V0AA 4YW4A 1HB2A 3MV11 2JDYA 5KC5A 1OFSA 5FY7A 4CVUA 1UZZA 4LUMA 1PX3A 1VBA3 1GZWB 3HJRA 3RDIA 1LKNA 4U36A 3LPGA 4RS5A 3GCWA 1VBB2 4JV4A 5A3OA 5I0DA 2XPJA 3WCSA 2FD8A 1QQP1 4YARA 2C26A 2FCTA 2W46A 3NO8A 5HXMA 1A6CA 1S2BA 3RG0A 2JECA 5A3TA 4ZU4A 2A6YA 2GH2A 1MEC3 3LEIA 3U4XA 2H6CA 1UZYA 2RS32 4K7JA 1AJOA 3FMGA 1JYWA 2E9QA 2W1QA 4QKBA 2K0GA 2HWF1 4GA9A 2IXHA 4XFAA 4QGNA 4LKFA 3ETQA 1DLLA 1FYUA 4ZXEA 2NMNA 3GNEA 3WNXA 5L36A 3JXSA 3AMNA 4HSLA 4AWDA 1I3HA 2HWB1 4EE2A 1KFXL 1YQCA 2HWE3 1LU2A 5L7OA 5FO7B 1UKRA 2MHFA 4PDWA 4UI9L 3H8XA 1AYN2 3PVOA 4Q4W1 1NE6A 5F39A 1HXS1 2ZS6B 4W8JA 4XF3A 3DKWA 1Q5OA 1WMFA 2WYFA 2F4PA 4FQ4A 2I2SA 4QT6A 2ZGKA 5FKCA 2W87A 1EUUA 4HFSA 4XJ9A 2EF6A 4KNCA 2B9UA 2LTNA 1GZCA 4M0NA 5CADA 2VMFA 3MIBA 3WW3A 3EMRA 1RUC2 1RUI3 3BGAA 2EAAA 1PZ8A 3AMQA 1JW6A 1MS5A 2JDPA 4BIFA 3T30A 3LCPA 1JUHA 2WNOA 1SMVA 3GJAA 1AR92 3K77A 4XDPA 2C0ZA 2Y6JA 3VV1A 4YW7A 3NV2A 4CUAA 5EWSA 5FZKA 4X8PA 3K48A 5F6LB 3N9PA 1HLCA 4XF1A 4NIIA 1PO21 4KGGA 2WO7A 3LFMA 3J8F3 4E4ZA 4D69A 5JZGC 2B45X 2VCAA 3KQRA 1R093 2PAEA 4GB32 1NXD1 4RGAA 3H8OA 2C1FA 4QU1A 4S2FA 3CO2A 3KMHA 4Y22A 4ES8A 1Y4WA 4YG3A 2HWD1 4AHYA 1OURA 1BCXA 3RZHA 1GUIA 3KF5A 5IVFA 2ZEYA 1XNTA 1YJLA 5JXJA 4RN5A 1AR62 2Z2SB 3M4FA 3SKJE 4QKDA 4W6YA 5FFOC 3WNMA 1GKBA 4LIVA 4QGMA 4PJYA 2EXKA 1NA1C 2ENRA 4XF4A 3LWCA 4CCMA 3BIWE 2GNMA 3GBWA 4BQ1A 3UESA 2BP6A 2Y33A 1Q8VA 3C2UA 2BTVC 3HN1A 1NAEA 4UW5A 4DOUA 3FX3A 2PN5A 5K4LA 2CY6A 3ZN6A 1ULEA 3I59A 1UY2A 1DG6A 1S2EA 1V6JA 5K0UB 5FUIA 1COV1 3D0JA 2OW4A 2UYAA 4AOCA 1AR83 2IXIA 3SNMA 3W59A 4YZ5A 4YLZA 2IWGB 3TNPB 4A7KA 1N1SA 3NKTA 1EP0A 2ZEXA 1GNHA 1FOD2 3M70A 5KXDA 1TE1B 2JKBA 1ND3A 2VC9A 1EPWA 1W0PA 1GSLA 3JD72 4Y1UA 2Q8EA 3VBHA 5J1XA 4NROA 4MHUA 5HBAA 1PM4A 1AX2A 1TME1 1X8EA 4UFMA 3SITA 5AC93 4M00A 2NN8A 4QB6A 1EAH2 2MEV2 5FMBA 1IG3A 1WGPA 5FUPA 4DZGA 1LU1A 4FPLA 1NY71 2ORXA 4FFFA 1LOGA 3GZEA 3W9AA 1G9DA 3I2JA 4J1WA 1ZX5A 3N9QA 3MLLA 3WEZA 2Y64A 4D0QA 2CSGA 2JIJA 3ES4A 4TXWA 2VNRA 2Y0OA 1JYCA 2VVDA 3SISA 1I1EA 4D7TA 1RINA 5CZKA 4HG6B 2ORZA 3NNGA 4P02B 4LMFA 5CFCA 1MACA 4UW6A 2JDUA 4QPGA 1QNYA 1L7RA 4NHKA 3CZJA 4LBMA 3MPBA 1MPXA 4QM8A 1RMU1 4Q4Y2 3I2HA 3CJIB 4JKLA 1ENRA 3QACA 4ZS3A 5HCBA 3VHRA 1O7FA 4YYOA 1UMHA 2Q0AA 3FUOA 3OEAA 5A3WA 3MI8A 5I8YA 1AYM3 1CPNA 3B01A 3VHOA 2VE1A 2G9ZA 3OJBA 3WDYA 1NCQC 4CEWB 2BPA2 2CGPA 1X82A 4E2SA 4NPMA 3IDEA 5C3SA 2WYSA 3B7MA 4B4QA 5FTTC 5C5TA 3R4UA 1DFQA 3K4AA 3OGRA 2VQUA 5JPNB 1OPMA 4FPJA 4DFSA 2JG8C 4RD7A 2ZMKA 2E26A 5BUVA 5F3EA 5C3RA 3ALQA 3S57A 5BNOA 4IDZA 1LTEA 2E51A 3AKQA 1JZ6A 3VZLA 1KRIA 5IVJA 3T4VA 3AZVA 4FT8A 2Y26A 5F5QA 3CDZB 3C3VA 3OY8B 1Y9MA 4ZPIA 3SH3A 4I2OA 2B46X 4L9BA 4QQHA 1FNYA 3SCHA 1BEV1 5JOXA 1P8JA 2IVJA 3B69A 3FFQA 4LUKA 5FZ0A 1OQDA 4MOAA 4XF0A 5FYUA 3PDQA 4PIYA 5HV4A 2EXHA 2E6VA 1FPN2 2XJTA 3ORJA 4RGKA 1S0JA 3I3MA 1DQ5A 2VULA 2IZWA 5LA0A 3PMEA 3IIIA 1PO13 1UPIA 4KG8A 4AI9A 3I3DA 1XNAA 3KZ4C 4AQSA 2FDIA 1LJ7A 1WBLA 2JG9B 4Y20B 2PHWA 1R1A1 2WQ8A 3Q9OA 4H3WA 5I0SA 1PVXA 3PURA 4EN7B 2MNGA 2AEZA 5C7GA 2Q4SA 4BK5A 2RVAA 4YW5A 4A2UA 1LRHA 2G4IA 1RL3A 3K3NA 5C8WA 2FHRA 3ZSJA 3V0AA 2VMEA 1J1LA 4IUGA 3ZR6A 5F3CA 4E9KA 3LEKA 4BQ4A 4O65A 4Q5OA 5JZGA 3JZVA 1J3RA 4Z2AA 3Q8AA 1XNBA 3RI8A 5L19A 3OOXA 1YQ5A 4JDMA 2XXZA 1FMD3 4YVWC 1LOFC 5JMCA 4QAWA 1W9WA 2BFUS 1VBD3 2A3WA 4CPBD 4Q4V2 3W20A 4TWTA 5LB6A 2DF7A 4FPEA 3WP6A 2RDNA 4BMEA 4AF9A 3LSDA 1VBA1 2OUHA 3SEPA 1HJFA 1NA1A 3W5MA 4PI0A 3POBA 2J22A 3FZ3A 1KJRA 5C4WC 4NMIA 2DVFA 3HNBM 4FCAA 4PLMA 4F8AA 2Y6FA 2V4VA 5IJRA 1OT5A 5GJ6A 4TSVA 1H6XA 1ST8A 1GNZA 4L0PA 1MEC1 2JWPA 1OH3A 4XUTA 4PF5A 5FPAA 1W8WA 4YG6A 5IT6A 1MQTC 2ATFA 5BNPC 1IQAA 3CLPA 1MS3A 4DNYA 1MVEA 1YFXA 5T55A 4Y1VA 1W06A 1BZWA 3I7DA 4AI3A 5B4NA 4LPLA 4PHZA 3M3IA 4AE2A 3VBSC 5F2WA 5JXHA 2BJSA 1UOBA 4XBLA 4J1XA 2RMU2 2TNFA 3CMGA 4CEYC 4OI2A 5FPLA 2E33A 1OQEA 1LGCA 5LK7B 2P3JA 4LO7A 4UF0B 4C0HA 5FREA 1RUF2 4GKXA 1SZBA 4N7IA 1WA6X 3MIGA 4FXKB 3USSA 3VBUC 2P6HA 1S0CA 2WN2A 4CCJA 4BXFA 2XOMA 1H1MA 3FLRA 2ZA9A 4NRQA 5IATA 1CJDA 3KWVA 5HCAA 1Q43A 3MYXA 1ULFA 4NIHA 5DDJ2 3FBMA 1NOVA 3WW4A 4EV0A 4AEDB 1HX6A 4HT1T 1DGWA 5EHDA 3RZLA 1SACA 4QXBA 1F31A 1UY3A 3KF3A 2J1VA 3RYKA 3THDA 5GZEA 1H2LA 3HBKA 1NT0A 2ZKNA 3IN9A 2J1TA 3IAPA 4A45A 2P17A 2JB8A 2TEPA 3RYRA 3FL7A 2O1QA 3WXPA 2WS93 3J8F1 2YXSA 1OF3A 1FNZA 4BYYA 1N1YA 5I8TA 4XXPA 1GNYA 2VVFA 5L9VA 2QE3A 3OGJA 1ZZ6A 1HN1A 1NX9A 2DCYA 4IGPA 2PMWB 3FUQA 1TVGA 4W65A 1YRZA 4FPYA 5FYBA 4OQ9A 1NCQA 1XB9A 4LBNA 4RR3B 2ZACA 3PHMA 4XMIA 4XUOA 1W2NA 3MFCA 1GWKA 4CZSA 1Z0HA 2V5DA 3H42B 1ASJ2 2YY1A 3ME2A 5K0UA 4ISQA 2JEMA 4CYDA 3DYMA 5BNNC 2JG8A 4AHZA 4BK4A 1DGWX 2GDFA 2WNUC 3LE0A 4XJ8A 2Q30A 4AFAA 3UYJA 3S6PA 4BLIA 2CDPA 5FWJA 2YPJA 1RUNA 2ZZJA 2VY0A 2YFUA 5I91A 2WO3A 5FLHA 4CPBA 5CAZA 1OSGA 3ACFA 1QQP2 1GMMA 4EYUA 1SLAA 1C8M3 1DZRA 2IXLA 3E5QA 4UAPA 1RUH3 2WFF1 4ZHNA 3BKZA 1RUC1 3NAPC 1GICA 3SCGA 3BOPA 4EWEA 5A33B 2HWF2 1ENSA 1I6XA 2GNDA 2I07B 1JOJA 1W0OA 3A0KA 1YIFA 3QOPA 4AI2A 4OYUA 1MR5A 4CDQB 2ZX1A 4LHLA 4Q8LA 4DXSA 2HWB2 2FZ1A 4AK3A 2YU1A 4FTSA 3MIFA 3KD4A 1CESA 1AX1A 1PK6B 4BPZA 5EJ1B 2EXJA 3MW3A 1GOHA 2E7TA 2XVLA 3ZXFA 4Q4W2 4FTEA 3ACHA 3RJRA 1HXS2 3PUHA 4XETA 2R0HA 4RL7A 3POFA 5IVYA 3WW2A 4JQTA 1ZBA3 4HBNA 4UW4A 1J3QA 4Q4X1 1NZIA 1O59A 2VW0A 3FHAA 2AUYA 4DIQA 2HWC3 2OT7A 3TN93 2CYFA 2QCSB 4AI1A 4YVWA 1K5MC 1LOFA 4CU9A 4YW3A 2AR6A 1WUVA 1O5LA 2E31A 3NNLA 4LBJA 4JQRA 4XHXA 5BPXA 4BE3A 3WF3A 3WF1A 3DXUA 4HXCA 4NRPA 3V56A 3NSTA 1U12A 1N1VA 3IPVB 4YZ4A 1RUE3 2D43A 1V9U1 2QKDA 4YZ2A 3POJA 5C4WA 4DUVA 1PO22 2OUJA 2D6MA 3S7IA 1DGRN 3N9MA 3PTRB 3H3LA 4EN0A 2QVSB 2P5BA 3PVEA 1WCDJ 4QB1A 1MQTA 5BNPA 1XE0A 3HD8B 3ZXGA 1QIQA 5C3QA 3R4SA 1VPHA 1GV9A 1EY2A 3QCWA 3VBSA 4RS5B 5KHKA 3VDAA 3PL0A 1PIV3 4FFGA 5DG1A 4C1XA 4CEYA 4J6GA 3WF4A 5IVCA 4AEMA 1K42A 2OXBA 5F3IA 1UWWA 3THTA 4N43C 4ISRA 3DGTA 3BIEA 3DCQA 2B42B 1W6NA 3AYAA 3ILNA 4P9GA 5FYMA 5JAXA 3SEEA 3VBUA 1LOBA 3ZYPA 1UIJA 5FLJA 1TMF3 1RUG3 2V4AA 4UBHA 1QJX3 3I3BA 2JD4A 1JZ4A 3VB9A 1AF9A 1LEMA 2B5HA 4QXHA 3ST7A 4FPCA 1O3TA 1OKOA 2R073 2RDRA 1COV2 4B4RA 5L7OB 4AI8A 3TB0A 4LT5A 3QD6A 4PDWB 3CU7A 4S2DA 5IUQA 3T1MA 2D97A 3DPRC 3TWIA 3CF6E 3BU7A 4HVOA 4KGQA 4PCRA 2D5FA 2X8KA 1C1LA 5B4XA 2BDRA 1ULOA 3UJOA 3VD7A 4GMP3 1W9YA 1WCQA 1TME2 1Q8QA 2WNVC 5BY5A 4Y1YA 4ARXA 2BQPA 2I74A 5FY4A 1LHVA 3EQEA 1QDCA 2XHNA 4IETA 4BQ3A 3UGHA 4XMAA 3GM8A 1NY72 1LR5A 1FMD1 1QJEA 1VIWB 4B7KA 4A4AA 3ZSEA 4R9BA 1SLTA 2B39A 3NRUA 4Q26A 1VBD1 4MGYE 3KHCA 5LY2A 1SG3A 4LA2A 1V70A 4A6SA 2DTYA 4MV2A 1W8TA 1MZ5A 1K45A 1TQ5A 2GALA 1JODA 3B3QE 3KM5A 3ZYFA 1AXYA 1E5RA 2C9AA 3PUIA 4ZZ5A 4YVSA 4NHMA 5FK8A 4Y22B 2WNUA 2QZ2A 4FOQA 2MPFA 4XQWA 3WQ1A 1RMU2 3LB9A 3E5XA 2IUWA 4RA0A 1HB3A 1OA3A 4GULA 3INAA 2OIIA 2VZ1A 4HN1A 3F95A 5FZFA 3HNMA 5KXCA 4UFHA 2PHUA 4XJUA 1UY4A 4YWAA 1XC6A 4TTGA 3A23A 1POQA 3OUHA 1W9SA 1AL22 3RZGA 1ZREA 4CXWA 5CYYA 1HJGA 3NAPA 2Q1MA 4FTBA 2J7MA 4MXVA 1LAJA 4UFLA 3C7GA 3RYPA 1YWKA 1RUJ3 1Z78A 3VUOA 1KD7A 5C70A 5A7PA 4CDXC 1AR71 2WDBA 4N7UA 2Q1ZB 3NV1A 1UAIA 4FPOB 4GWNA 1NQJA 3I59B 3ZN6B 1RHI3 2ZOEB 3B02A 1AZDA 1VLNA 5I0RA 3HIFA 5IFPA 5EJZB 5LK5A 4N53C 4IQPA 1JBCA 2HYKA 4QHZA 3VBFC 4FP3A 3O1UA 3BTAA 1BEV2 2VM9A 2VGDA 3OBAA 2QQVA 1N3QA 4EJRA 2WT1A 1ND3B 2E53A 2DCKA 3VBHB 4MGTA 2GU9A 1H4HA 4E4SA 5FKBA 1PGW2 4AFMA 4OHYA 4YZ3A 4OULA 2RM23 1A8MA 4IEQA 3THCA 1ZBE3 3WNPA 4C8DA 2UWAA 4KWJA 3ZXAC 1K5MA 3QH7A 5JI7A 1R1A2 5GLWA 3RSJA 5F6KA 3S30A 4Z8BA 1H2MA 3MV01 2DVDA 2AREA 2OA2A 2WS91 3WR0A 5HI0A 5E16A 2XG3A 1QU0A 4MGKE 4B4PA 2VZVA 3H1YA 2A6ZA 3BTYA 4E4DX 1CWPA 1OHFA 1QXPA 5FYIA 4HK8A 3SCFA 1CAWA 4JX0A 4CRQA 1W6MA 3WP5A 4FBFA 1ULCA 5FQ0A 2JDAA 3OSDA 2W91A 3ETPA 4KH9A 5DPNA 5DZFA 5A3LA 2BGCA 5CFCB 2HH9A 2X09A 3GGLA 3MGUA 4QPGB 5FYYA 5F32A 1NCRC 1MVQA 3ZFGC 4FOWA 3TAYA 4LHSA 3WDUA 5C71A 4DPNA 3C7FA 3CBNA 1UNBA 3IB3A 2J1AA 3VHPA 1QJU3 2CAVA 2D44A 4L92A 5FPZA 2CGOA 3VL9A 3ZLIA 5LZ6A 1VBA2 2XR4A 3IMNA 3RMYA 2IXCA 4MX3A 3R6SA 3RPQA 4IGQA 5CIRA 4A7ZA 1JYNA 2GH8A 4N43A 1W28A 5LRSA 1FAYA 4QQ2A 2VAUA 2YUEA 2YBSA 3NQHA 3VD3A 2QQPA 2RJLA 3KV4A 3L2YA 4EN8B 2GC0A 1RUH1 3NJZA 2EALA 1PK6A 1JTZX 1MEC2 2YC0A 1POV3 2VH9A 3LAGA 3X29B 4Q8KA 1W6QA 2BOIA 3I49A 1US3A 3DXTA 2VUCA 5F5IA 3TEWA 4AVCA 3GYDA 5GKAC 3AXDA 4CU7A 2ZGPA 4IEUA 1W0NA 1WCUA 3AMPA 3DYOA 4YFWA 3WDTA 3KV9A 2RS53 3DPRA 4LOTA 1BK1A 3GBFA 4P9JA 5J48A 5FOBB 5JMOA 5A1AA 2HYXA 3MW2A 2NLRA 3KGZA 5A3UA 2X5IC 3ITQA 2LUWA 2QDNA 4MVTA 2WNVA 5JIAA 4RYDA 5FYSA 3RVHA 4IE0A 3UGGA 3VBRC 2WZ8A 3I54A 3J7LA 5IAXA 5J3UA 1O8SA 3TN91 1QMJA 3AFGA 3UKNA 4C1WA 1DYKA 1XNCA 2RJKA 1RTVA 3C7HA 3EYPA 1W8NA 1IKPA 1APNA 5FYVA 1NLSA 3PUAA 3KCCA 5AFBA 1WLDA 4QB2A 3THPA 4W6XA 3I4IA 2W9XA 3V0AB 5F1RA 2RR11 2NM1A 5LA2A 3LDRA 1MZFA 4KU8A 4LKDA 5FXVA 4ES9A 5JZGB 1RUE1 2RHPA 2J1EA 4K1YA 2VXRA 2DUPA 5A6ZA 3AKTA 3C8XA 3J8F2 1H1AA 2O8QA 3GZUC 3SKVA 3KLSA 3D4KA 1GLHA 3I2GA 3O1SA 2JB4A 2O8OA 4MADA 4MLOA 5FBZA 4DEQA 2Y34A 3HT2A 5D2AA 4WZCA 3ZN4A 3LQCA 5JPMB 1VBE3 2DFBA 4NWVA 3CEWA 4XURA 4D6RA 5KXEA 1Z7S1 2C9KA 4RHV3 1NA1B 3AZXA 5FZBA 3KT1A 5T50A 4RQPC 4J25A 1PIV1 1BK0A 3N7LA 2A7AA 2AYHA 3QH6A 3T0BA 3FBYA 5ABJC 1OQ1A 5A6QA 4LITA 4CUGA 4YGDA 1IKQA 1Y7BA 3MO4A 1JZ3A 1WW6A 4Q29A 2VUDA 4D6QA 1RVF3 5LRRA 1GYKA
chains in the Genus database with same CATH topology
1TMF1 1RUD3 1RUG1 1T6GC 2XJUA 3LA7A 2RS13 1S0GA 1J1TA 4N53A 3VBFA 1PNFA 4YM2A 1Y43B 4L8QA 3O14A 2WFF2 2PELA 3ZMOA 3M3CA 3U0ZA 5GZCA 1SBFA 1FX5A 1S0DA 4Q0VA 1PVC3 5AFEA 4Y26A 2PLV1 5ACA3 3T1LA 1HRI3 1R083 5AC92 1QGLA 3ECQA 1ND2C 1U5IA 1U5XA 1YI9A 2CWMA 4IL7A 4XIKA 3FLTA 2XHKA 4KQ7A 4COUA 4LHKA 1JHNA 4Q4X2 3T2TA 4C0BA 4OHWA 1LULA 3AKRA 3SLIA 1REEA 4GH4A 2ZX4A 3MW4A 1NCRA 4YRDA 3ZFGA 3AFKA 1ENQA 2R043 5BNQA 4HETA 5EFUA 1S0EA 1NXMA 2GN7A 1VBB3 3ASIA 2HEYF 4DINB 4JTOA 2A70A 2P2KA 1KQRA 3WG2A 5EYYA 2XLAA 1NCQB 1HIXA 1V9U2 3IBMA 1VBC3 3S0MA 1AUYA 3MPPG 4ZXKA 4AVAA 5T54A 4IV1C 4UW3A 2RS33 2Z79A 2OYZA 2R30A 4XFGA 1B35C 2OPKA 1WLWA 4S2HA 2JG8B 3MDPA 4L11A 5GM0A 1V6OA 1RUJ1 4WM8C 4FPFA 4AYUA 1ZYBA 1XYNA 2ETEA 3D5OA 1QY4A 1RHI1 2SLIA 3PNAA 1BXHA 5JCTA 3GHMA 2X5IA 3AKSA 1UX6A 4QXKA 2A3YA 5KBFA 4R52A 3GZAA 3MIHA 2EAKA 2QNKA 4I0AA 5IK8A 4CP2A 2AENA 3VBRA 2I45A 2RM21 3ZXEA 1PO12 1ZZ8A 4FSJA 2ARBA 2WT2A 1Q8PA 1ZZBA 3A4UA 3B9CA 3ZYRA 1FT9A 1CONA 1NZCA 4ORFA 3AMMA 1X36A 1G7YA 3RS6A 1ZRFA 2VPVA 4PBOA 4GB33 3KCXA 3EXUA 4I02A 2XVGA 1OI6A 2D6PA 5I0TA 3USUB 4R9CA 1F8VA 4YVWB 1OD5A 3N7KA 1AL21 1CX4A 4FOYA 1AR63 1FMD2 4D94A 3HR9A 3H3UA 2IXKA 5CU1A 1VBD2 1OOPC 4D7YA 3PVNA 3OYWA 1QJU1 3LZZA 3NKGA 3KT4A 2ES3A 4RQPA 1HV0A 5C4WB 2D7FA 5KHGA 2WFPA 5ABJA 3E6BA 4HLTA 5H9SA 1HRV1 2FMYA 3M3OA 1G9AA 1LEDA 2QDRA 1MQTB 3FWEA 4XILA 5BNPB 2DCJA 4DXZA 1LOEA 2CL2A 3VBSB 3VN4A 5C8CC 5CVRA 1PGW1 3ZFFC 5D1IA 4CEYB 2A73B 2Z69A 4XEZA 1YO8A 1NQDA 2ZCWA 4LO4B 2RS51 4LE4A 1W6NB 3A0NA 3VBUB 2VOWA 5HCFA 4HZFA 2JE7A 2BYVE 2ZHKA 1PGL1 1VP6A 2R6QA 2YROA 1AR72 2A6VA 1ND2A 3IKWA 1QHDA 5IK4A 3VBOC 4FAHA 1D0HA 4ASLA 4BCUA 4MUVA 2WJSA 4M3CA 2G9FA 4OI4A 3VKMA 3WG1A 1XE7A 1CQ9A 2VW1A 5FCCA 5FMOS 1MS0A 5GLUA 5KHJA 2BVBA 2NPIA 4OUSA 3AP9A 3AJYA 3ZN5A 4PIXA 3ZFEC 1DHKB 5H9QA 2OVUA 2WS92 1NLRA 1EV13 1DQ4A 4WVZA 4WVVA 1KDKA 1VALA 1VBE1 2W52A 3ZPYA 1XYPA 1DYPA 4Y5Z0 4IV1A 1O5UA 4RHV1 3WP3A 1B35A 1CJPA 5BNNB 2WSVA 4YVSB 5KHIA 1CVNA 3FC0A 3H8UA 2WNUB 1N3OA 4LA3A 3H7JA 4QX5A 2HWE1 3M3QA 3WVJA 4WM8A 3FFZA 1RVF1 2DYCA 5CG8A 1DQ1A 1RUD1 3AMHA 3BB6A 3O5SA 2XBO3 5JOYA 3NVCA 1MZEA 4YW2A 3NAPB 4XDQA 1G9BA 5DUWA 4TLFA 1VRH3 2GNTA 1RUH2 3E97A 4JTNA 4YW1A 4N9IA 1RUI1 1QH6A 3TBDA 3PTYA 4H7MA 4E2QA 4LBLA 1PVC1 4LULA 3WW1A 2QZ3A 1CAVA 3O12A 5TSWA 3AYCA 1R081 3RJ2X 4R9AA 4OHZA 1H0BA 3R05A 1Q8SA 1WMDA 3ZXJA 1R091 2JDZA 1CD3G 4L2NA 2ZGSA 2KXLA 1LCLA 3R0RA 1ZBA2 3IT8A 4ONUA 4XYXA 5CNAA 1S0BA 1K5MB 1R1ZA 5A32B 2HWC2 4IV3C 3TN92 3TRSB 1UF2C 4Q4V3 2ZX3A 5T52A 3AZWA 3LGRA 3N7JA 3J26N 3IDBB 3OCPA 5GZDA 2DFCA 4AVVA 1OOPA 4AXOA 2R041 1PM7A 1U5YA 2K9ZA 3M1HA 4S2GA 1JYIA 4KBBA 2JX9A 2RR12 1CAWB 2XWJB 1W6MB 2PHXA 4QPIC 4P14A 5FQ0B 2EXIA 1RUE2 1QOSA 3AB0A 1RITA 2E63A 1VBC1 2DWRA 1V6LA 3OGGA 4AVTA 2IFRA 2UWBA 4EJRA 3HWJA 3M3EA 3ZYJB 1G86A 3HBZA 2PQQA 3JUUA 3ACLA 4P9YA 1AR81 3H1MA 1FV2A 3VZNA 3LOIA 5JIUA 5C8CA 1AVBA 1DZQA 1C28A 2OZ6A 3ZFFA 3D82A 1Z7S2 2C5DA 3KSCA 4N43B 2W0XA 2BWCA 4COYA 1PIV2 2Y38A 1DU3D 2R063 2DV9A 4X8NA 5AC91 1GR3A 4K20A 4P9IA 4NVPA 1XRUA 5DZEA 4AFCA 2DURA 4INDA 1ZNPA 3O0WA 3U11A 3ZX7A 3B9IA 2ZGMA 2P3KA 2ARXA 4Y4YA 3LOBA 1W6QB 3WX5A 4UXAA 1TMF2 1OKQA 1RUG2 3VBOA 4JGYC 4XOGA 5AVPA 1QWRA 5J96B 1O3SA 4H7LA 4ZU5A 5HXVA 3JCIA 3MIEA 3DPRB 1HW5A 3GALA 3USUA 1JUIA 4Z1VA 4OHVA 1X8MA 2CAUA 2EVXA 3WHTA 1AXZA 4CDXA 1W6PA 3WG4A 1Q3EA 2WNVB 2WSUA 5EXOA 5FDBA 2PLV2 2NP0A 4M3CE 3ZFEA 4I0BA 3FLPA 2QFEA 4K8FA 3URFA 5DXDA 1HQNA 3BOWA 1DQ0A 1AYM1 1OMIA 3H3ZA 2R16A 3AK0A 3JU9A 4K21A 4K6BA 4XQDA 5IK7A 4CDWC 3FJSA 3HMYA 1M06G 3VHNA 1AL0G 3AP5A 5D8AC 4LBKA 3WG3A 4P5HA 1SLLA 1JH5A 1REDA 4D7SA 3WOGA 4HPKA 4ASMB 1QNWA 1KS4A 2ZAAA 3V0BA 2W08A 4FP2A 5CBLA 4QU2A 5DUVA 3ZIWA 4QHBA 3CNAA 1H2KA 1G6NA 2GMEA 2ZZQA 4YM1A 4GXLA 4QM9A 5SV5A 1PO11 5C9AC 4JGZC 2HWF3 3OD4A 3MEPA 3WHUA 4K9SA 4ATFA 5CFDC 1HV1A 1I9RA 3VKOA 4F83A 2D93A 2EIGA 4CDXB 5LK7B 1RC6A 4Q0QA 1G8WA 1RUJ2 1BKZA 5EV7A 2HWB3 3ZXLA 1YI7A 4B29A 1G9CA 4D3WA 4Z2WA 3GBGA 5FRAA 1SFNA 4N53B 2AGSA 3VBFB 4Q4W3 2ZGOA 4NN0A 1RHI2 5GZFA 4COZA 5IK5A 1OPOA 5BV6A 1OA4A 5GALA 2PAMA 4Q0SA 2BFUL 4FPHA 3EBRA 1WW7A 1GFF2 1HQWA 5T5OA 1X33A 4Y24A 1YFUA 2DCZA 1D4M3 3QLQA 2ET7A 2XUMA 4KG0A 3WP4A 1V6IA 2RM22 4IV3A 4I30A 1RUOA 1ZBE2 2AH2A 3OBRA 4F7ZA 2BW8A 3J9SA 2Y0IA 2ZHMA 4R8HA 5AVAA 5JOWA 1QJY3 2ZMLA 4XIOA 1BVP1 4COWA 5J7MA 3AX4A 2NZ9A 2WLQA 4WZFA 4AFDA 5BNNA 1IPJA 3W58A 1EV11 5FAXA 4QPIA 5I8SA 1GANA 3SXWA 2HEWF 4XE9A 1IHMA 3N36A 1KITA 3POSA 4GH4B 1NCRB 2HWD3 1UN1A 4NR1A 3EO6A 2P34A 3ZFGB 3RWNA 4LBOA 4IEPA 5T5JA 4EN6B 4U2AA 3RQ0A 4SLIA 4AHXA 3ZXDA 3PLQA 5CA6A 1RGSA 4G4FA 1QJU2 4CP1A 2EA7A 2XBO1 3DL3A 4Q0PA 2VUJA 1YXWA 1CN1A 4I0WB 2VQAA 3ZDSA 1UU4A 4Q1RA 3ZVXA 2WLPA 5JLVA 1HRV2 2PTMA 1IS4A 1WA4A 3PMSA 4JCKA 1VRH1 1O4ZA 2XKPA 4JGYA 2VMIA 1IS3A 4N90A 2N7GA 2CNAA 5L7OC 3POYA 4XJAA 2Q5TA 2RS52 5A32A 3HQXA 3P3NA 1Y3TA 1ENXA 2X5IB 2XKOA 2DTWA 2V5YA 2D3RA 1F5FA 3HAGA 1PGL2 4AVSA 3VBRB 3MIDA 5FPXA 1V6NA 4EROA 5KXBA 1WLCA 1NG0A 1D0GA 2D5HA 1KFUL 2VQ0A 2R1BA 1MS4A 3H50A 5B2GB 1MS8A 4CDWA 3OD0A 4G3YC 4XTMA 3ILRA 2WZR3 2IXJA 4CTEA 5D8AA 4YM0A 1BQPA 4K40A 1VB2A 1GZ9A 3UL2A 1G9FA 1F5JA 4QQOA 3AYDA 3G7DA 1U0AA 1A78A 4XBNA 1VAVA 1PZ9A 1YCIA 5SV8A 2LALA 1ZRDA 2GZWA 1XNDA 3AZYA 2PYTA 1C8M1 3OYWB 1CR7A 3N35A 4XW3A 4C91A 1VBE2 4RQPB 4RFT0 4L99A 3JBG3 1UMZA 4ITCA 3PJYA 4RHV2 5C9AA 3ROUA 4JGZA 5ABJB 5H9RA 1QXJA 1XYOA 2GC2A 2KA3A 3EHKA 1C3HA 4A7YA 5CFDA 3RMXA 3U07A 2V09A 3WQ0A 1KS5A 3M2MA 2HKXA 2HWE2 3DF0A 3N3HA 5GLTA 4A3XA 1RVF2 1S55A 3QBQA 1RUD2 4EWAA 2ZAHA 2K2SA 1ZBA1 3VDDC 5DUXA 4NHLA 1BVVA 1IOAA 2HWC1 2Z42A 1QOOA 4EWDA 1ULDA 1RUI2 1WCKA 1XQNA 1PVC2 2NYYA 1ND2B 1H9WA 3ZXKA 2BUKA 4GIQA 2PHDA 2XVKA 1HRI2 1R082 4B7EA 1QXRA 3JB4C 4M3CB 1UPSA 2ZHLA 1F2NA 4FQZA 5KC6A 1CAXA 4XFIA 4HK9A 1SBEA 3UKVA 1O3RA 4LR4A 3JQXA 2HJIA 1R092 2ZX2A 4WM7C 4LO8A 1ZVFA 4BA6A 4X6QB 3ZO0B 2DUOA 4WVWA 3TNQA 4Q27A 2PAKA 4XPVA 3D8CA 2E7QA 2FBEA 4YGBA 1MZ6A 3N4MA 3GF6A 1ZZ7A 2WA3A 4URTA 2R042 1C1FA 2W68A 3S7EA 3O0XA 4LBQA 4FPGA 4IV1B 4IEZA 4JC1A 1M4WA 3ELNA 1VBC2 4LEJA 1B35B 1KJLA 3IIAA 1QJX1 1RJ7A 2P37A 1UCXA 4E2GA 2A3XA 1SBDA 2CGNA 2R071 1VR3A 1O3QA 1AR82 1ONAA 4LHNA 1IPKA 3I2DA 4WM8B 5JDBA 5BNOC 1LHWA 2ZABA 4MSVA 1EYBA 1IS6A 3OPZA 3NW4A 4Q1PA 2WA4A 1QH7A 4GMP1 4CDUC 4LO6B 1DGLA 1BMV1 1URXA 1NYWA 2A75A 1H8TC 1FI2A 2X29A 1DZTA 2TUNA 5EYXA 1I5ZA 3B5LB 1D4M1 1CAVB 2YZ4A 4FPKA 3UKTA 2XH6A 1AXKA 5BYNA 1W6OA 4Z92B 2WNEA 3AJZA 2W39A 4YFZA 4L97A 1QJY1 4AEKA 5E88A 1SCSA 3WT3A 4WVMA 2V73A 5K7PA 2JENA 4BHPA 4I01A 5E89A 2YV8A 2OZJA 3BODA 4MGIE 2ZPXA 4GMP0 4QPYA 3WDXA 2WWSA 1AYM2 1V6KA 2GMMA 2ZGTA 4XFBA 2VECA 1YJKA 4JRAA 3NL1A 1OOPB 4YZ1A 1V6MA 4FOVA 2D6NA 3AP4A 2G9GA 5DZGA 4QGLA 5JOZA 1C4RA 1SLBA 1QDOA 2JXAA 3CJXA 1AYN3 4PLOA 2VOXA 1YUDA 3DV8A 4ZU7A 2B8MA 2IC1A 4RSUA 2QJVA 1AX0A 3OBTA 1D2SA 5C8CB 3ZFFB 3JQWA 2R0FA 5E1RA 1VB4A 3VGIA 3VDDA 1UU6A 3R4DB 2WFF3 4KWLA 4BIOA 1RUC3 4DB5A 3IM0A 4XBQA 4XHBA 3VZMA 1ZBE1 5CG9A 2VOKA 1J59A 1SEFA 1AR93 1QOTA 4LE3A 4B3NA 1CAUA 3GZTB 3H9AA 4FO9A 1ZZCA 3VBOB 1O91A 3V64A 2ET1A 4Z07A 3ZYGA 3AP6A 4P9LA 2HEVF 3POWA 2D3SA 1SLIA 3WLUA 2UY8A 4WM7A 3UV9A 4Q4X3 3ZSLA 4AQ2A 4FXGB 1LHUA 1DQ2A 1W6PB 2WZR1 3OTFA 2VMHA 2YMZA 4IEOA 2SBAA 3RI9A 3VKFC 3HT1A 3ZFEB 2PA7A 1BBT3 3H0OA 4N9HA 4YNIA 2D6OX 2ZMNA 4MXWA 5I0UA 5GLZA 2X53S 1V9U3 1EV12 2P3IA 4IESA 1H4GA 1MS9A 3RNSA 3SH5A 4QQLA 1POV1 3JBG1 4KL1A 2ZHNA 4HPKB 2UWCA 3V0BB 4AG4A 5K0UC 3D6EA 1FOD3 3JD73 4R9DA 4LO5B 4XFFA 2A5ZA 3SH4A 4HN0A 4MH0E 1EAH3 3KS7A 2MEV3 3KT7A 3UK9A 1H8VA 4CDUA 2XBO2 2H6BA 1H8TA 1HKDA 4QQPA 2NMOA 1Y9QA 1ZZ9A 1VRH2 1W2UA 3E6DA 3ZIXA 4XJWA 4F3JA 1POV0 3FE5A 4BMBA 5C6CA 4IEVA 1PGSA 2VOVA 2XJRA 3WDVA 3MFAA 3WINE 1XU1A 4AEJA 1LENA 2XB6C 2WC2A 4Q4Y3 4B8EA 3ZYIB 3E6CC 1LHNA 3CJIC 1GZWA 2ZTNA 1QJZA 2YGLA 4IV3B 2A6WA 4Y1ZA 4DRRA 4AI0A 1RJ8A 4XXAA 1F9KA 1LGBA 2XL7A 4CEWC 2TBVA 4OLLA 4DY5A 4LNVA 1DIWA 3ZSMA 2JJ6A 2F6BA 4Y1XA 3E5UA 4JDOA 2DU1A 1WD3A 5K9YA 2BVVA 4HANA 2D6KA 3ZMNA 4QPIB 5JSRA 4AGRA 3O7OA 4CP0A 1IZ3A 3WQ7A 5GLVA 3B00A 1BBT1 1DBNA 1LESA 4AW7A 2DU0A 2GC3A 1NE4A 2BNMA 4HL0A 2RS11 1OFNA 3G6JB 1SQ4A 4MGZE 4XF9A 4DQAA 1FPN3 5K8SA 3LA2A 4NO4A 1C8M2 5DUUA 2CWSA 1OLQA 4I3GA 2H0BA 1DDLA 1WBFA 2Q8OA 5H9PA 4G9SB 1N3PA 3LSEA 4K1ZA 3VKLA 2DCTA 2WQZC 3PVBB 4HKWA 1LGNA 1XE8A 5ACA1 2JG9C 2ILMA 2KM2A 1HRI1 2R062 2GSYA 2RE9A 2WINB 1O4YA 3ATGA 4OZXA 1A8DA 4XJZA 1AJKA 1AR73 1V00A 2UU8A 3AP7A 4FVVA 1H1IA 4JGYB 2XWBB 1WMEA 4IEXA 1KXGA 4DMIA 1Q8OA 4RGGA 2GNBA 4NWWA 4BLJA 1WW4A 4IEWA 4DS0A 4JDNA 1RB8G 2XLGA 5LEJA 3BCWA 1XU2A 1N1TA 2R1DA 4PIZA 2CTVA 1QKQA 1VBB1 4I3PA 3WUCA 1LOAA 1YFWA 2XL9A 3TOJA 1B09A 5J36A 5A3MA 1ALYA 2XJSA 4CDWB 1JXNA 2RS31 5EJ3A 4EN9B 2FQPA 1PNGA 4WV8A 3BPZA 5BXXA 5D8AB 3JB8A 5FO8B 1WD4A 3NWKA 3AKPA 1BYHA 5EZWA 4MYEA 3J4UH 1XXNA 2RMU3 3MLJA 4YVSC 4GKYA 3OF1A 4E27A 3B93A 1AYN1 1RUF3 2GMPA 2VVEA 1D2QA 5T5PA 1YHFA 2DVAA 4YGEA 3SMHA 3GHNA 3VZOA 4SBVA 5J98B 2BWAA 5DDJ3 3WY6A 4JGZB 5C9AB 4O9GA 1VJ2A 4R4ZA 5JVVA 1DF0A 1QJX2 5CFDB 3VKNA 4AEDC 1TNRA 2R072 5KHHA 1ZRCA 1AR91 1UIKA 4GQ7A 4OUMA 2D3PA 1DGRA 2GAUA 3MF6A 4HSJA 5F9TA 4KWKA 3VZKA 1C5HA 4LLOA 2PFWA 4XTPA 3P3PA 2YYOA 4AQTA 2XGXA 4FAGA 3SHRA 2H0VA 2A71A 4GB31 2YDEA 4MZUA 1N47A 4R4XA 1BMV2 1X7NA 2LM3A 3AXEA 4O9EA 3L9JT 2PHRA 3CJIA 2QUOA 2AZ5A 1AR61 3AYEA 1LOCA 4PLNA 2UURA 4P9XA 1D4M2 1LHOA 3NV3A 1FXZA 4CEWA 4RR3C 4IEYA 1S0FA 1ASJ3 2ZGNA 2UY9A 1CAXB 1QJY2 2RR13 1WLTA 1H2NA 5E8AA 1A3KA 5C33A 2VUAA 1C5IA 1MS1A 3LKJA 3VLBB 3IWZA 4Z82A 2R49A 2CV6A 4V1PA 1C57A 1QQP3 1LB2A 1WCSA 4OI0A 3N7MA 3UJQA 3ES1A 3OY8A 1OLRA 4XZPA 4WBBA 2HWD2 1D4VB 1KDMA 1Q56A 2YGMA 2XJPA 1FOD1 1Z7S3 3EJKA 4IXLA 3JD71 2WZPP 3WCRA 1BJQA 4X6RB 1W39A 4LBQB 3TYJA 2WQ4A 2VU9A 4DRVA 3V65A 5T3NA 2ZGRA 4HMZA 4AQ6A 1GQGA 4XFHA 2JG9A 1EAH1 3H1WA 4Y20A 3U10A 2MEV1 4CDQC 1H9PA 3ENRA 5J09A 3KB5A 1IGOA 2BNOA 1HXS3 1EPZA 1PK6C 1ZRRA 5FOJB 2YHJA 3WZ1A 5DG2A 1REFA 5FMOL 1ZA4A 5L73A 2A6XA 3BALA 2FZ2A 4AGGA 4I09A 1FV3A 4IERA 3WD5A 4PBPA 1H30A 4HVRA 5I93A 3K51A 1GBGA 2VG9A 1PHMA 1SFYA 2PLV3 4HKLA 2JE9A 2WT0A 4Q4Y1 5LEKA 4M3CF 4W6WA 5GZGA 4Q0UA 2ZGUA 1CIWA 4BZ4A 1PO23 1VAKA 4YGCA 3PJQA 1AHSA 1TEIA 1YYNA 2XJVA 1W6OB 2D6LX 2PHFA 1RIRA 4QD2A 3H7YA 4WVMB 2DUQA 1S0IA 2WZR2 4COVA 4H55A 1YIPA 2XJQA 3L2HA 4RS5C 4OFGA 1LODA 2O0OA 2WL1A 4PQ9A 4TZDA 2NQYA 2BEOA 3WDWA 2ZJCA 1FPN1 2FMDA 5JWPA 2JICA 4GWMA 5JSOA 4KU7A 1COV3 3JBG2 4OVEA 1S2KA 5JR7B 1E57A 4AEDA 2UYBA 4LTAA 2Z5WA 4PDWC 1X50A 4YG0A 1C8NA 4AFBA 5KWRA 3O0VA 1TME3 1PMIA 3AZZA 1CPMA 4NOTA 4BM8A 3VDDB 2VW2A 2BBVA 3M8LA 1VAMA 1J58A 2D98A 3WV6A 2E7AA 4JRLA 2ZX0A 3AM2A 2BNNA 2WIIB 3ZSKA 4AHWA 4LBQD 4Q4V1 3FHIB 2WKKA 1CAUB 1CGPA 1UW8A 4TYSA 4Q2FA 4RR3A 3VL8A 4XQ4A 2PHLA 4HKOA 4C90A 2VNGA 3B94A 1DQ6A 4H14A 5CB7A 3KCYA 3LA3A 5FO9B 4ATEA 2B7YA 4WM7B 3M7AA 1RMU3 4AGVA 4K3UA 4GALA 3DN7A 3IDCB 2GN3A 2ZGLA 4BWOA 1SDWA 4XFCA 1AL23 1HQLA 2D40A 4GH4C 5JSPA 4BOWA 1GQHA 5J37A 2VMGA 1UU5A 1S1AA 2RMU1 4JAAA 1UKGA 4MXWB 2ZKLA 2XLFA 2ERFA 4YSFA 1RUF1 4P9WA 2R061 3APBA 3MZHA 5A33A 3ILFA 1U5ZA 5FLIA 3MLKA 2ZBJA 1IS5A 4ZKTB 5JI9A 4CDQA 1BBT2 2R32A 1HRV3 4OI1A 5DDJ1 1BEV3 3NV4A 2RS12 5T5LA 4M0HA 4NPRA 4LLFA 2PHTA 4OHXA 4UBGA 1SLCA 5BNOB 1WW5A 1ND3C 3VBHC 3DUIA 3D0SA 3I8TA 4BH9A 1UD1A 4DY3A 1R1A3 4CDUB 1J3PA 1ZM1A 1TNFA 1FATA 1ULGA 1SCRA 1O4TA 3CL1A 2DVGA 1YLLA 5ACA2 1H8TB 3RZZA 1YFYA 3RRDA 1LECA 2DVBA 3KGLA 3VZJA 1YNAA 2VNOA 4QMAA 2GC1A 4YM3A 1XNKA 3IPVA 4HVQA 1OA2A 1PZ7A 1JN2P 2IFWA 2ZGQA 3MF9A 4JVAA 4M01A 4AVBA 3WUDA 1QF3A 4META 5CFCC 1UL9A 1HDKA 1ASJ1 3MICA 1L3JA 4QPGC 4YW4A 5KC5A 1OFSA 1UZZA 4LUMA 1VBA3 1GZWB 3RDIA 1LKNA 4U36A 4RS5A 1VBB2 4JV4A 2XPJA 3WCSA 1QQP1 4YARA 3NO8A 1A6CA 1S2BA 3RG0A 2JECA 4ZU4A 2A6YA 2GH2A 1MEC3 3U4XA 2H6CA 1UZYA 2RS32 4K7JA 1AJOA 3FMGA 2E9QA 2K0GA 2HWF1 4GA9A 2IXHA 4XFAA 4QGNA 3ETQA 1DLLA 1FYUA 3WNXA 2NMNA 3GNEA 5L36A 3AMNA 4HSLA 4AWDA 1I3HA 2HWB1 1KFXL 2HWE3 1LU2A 5L7OA 5FO7B 1UKRA 2MHFA 4PDWA 1AYN2 3PVOA 4Q4W1 1NE6A 1HXS1 2ZS6B 4XF3A 3DKWA 1Q5OA 1WMFA 2F4PA 4FQ4A 2I2SA 4QT6A 2ZGKA 4HFSA 4XJ9A 2EF6A 4KNCA 2B9UA 2LTNA 1GZCA 4M0NA 5CADA 3MIBA 3WW3A 1RUC2 1RUI3 2EAAA 1PZ8A 3AMQA 1JW6A 1MS5A 4BIFA 3LCPA 1JUHA 1SMVA 1AR92 2C0ZA 3VV1A 3NV2A 5EWSA 4X8PA 3K48A 5F6LB 1HLCA 4XF1A 1PO21 4KGGA 4E4ZA 3J8F3 4D69A 5JZGC 2B45X 3KQRA 1R093 2PAEA 4GB32 1NXD1 4RGAA 2C1FA 4S2FA 3CO2A 3KMHA 4Y22A 4ES8A 4YG3A 2HWD1 4AHYA 1BCXA 1YJLA 1AR62 2Z2SB 3M4FA 4W6YA 5FFOC 1GKBA 4QGMA 4PJYA 2EXKA 1NA1C 2ENRA 4XF4A 3LWCA 3BIWE 2GNMA 3GBWA 4BQ1A 1Q8VA 3C2UA 2BTVC 3HN1A 4UW5A 4DOUA 3FX3A 2PN5A 2CY6A 3ZN6A 1ULEA 3I59A 1DG6A 1V6JA 5K0UB 1COV1 3D0JA 2OW4A 2UYAA 1AR83 2IXIA 3SNMA 3W59A 4YZ5A 4YLZA 2IWGB 3TNPB 4A7KA 1N1SA 3NKTA 1EP0A 1GNHA 1FOD2 3M70A 5KXDA 1TE1B 2JKBA 1ND3A 3VBHA 1EPWA 1W0PA 1GSLA 3JD72 4Y1UA 5HBAA 1AX2A 1TME1 1X8EA 3SITA 5AC93 4M00A 2NN8A 1EAH2 2MEV2 1WGPA 4DZGA 1LU1A 4FPLA 1NY71 1LOGA 3W9AA 1G9DA 4J1WA 1ZX5A 3MLLA 3ES4A 2VNRA 2Y0OA 1JYCA 2VVDA 3SISA<