5DUVA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'NPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duvA00
4LBJA 2D6OX 1AXYA 1Q8OA 4YM2A 3D5OA 4YW2A 5JMCA 4M00A 4M3CB 5FRAA 1R1ZA 4XJ9A 1YO8A 3ASIA 1LECA 4JC1A 3WHUA 3V0AB 2DVGA 4LBQD 1W6PB 3OY8B 1ULDA 2H0BA 1SFYA 4XIOA 3FUOA 2DUQA 1GV9A 1CJPA 5DZEA 1YRZA 2A5ZA 1O4ZA 1LOFC 2VXRA 1GKBA 1QU0A 2GN3A 1WW5A 3FFZA 4Y1VA 3IPVA 4YGDA 1I3HA 2YROA 4W65A 2D3PA 4K1YA 1YXWA 4BLIA 2EIGA 1HQWA 4YW5A 1LU2A 1BQPA 3ZSKA 1QOTA 3SLIA 1WCSA 5F5QA 4M3CE 2VW0A 3ZYRA 3GALA 2DU0A 4F83A 1G9CA 1SBFA 2B7YA 2DTYA 4HANA 2CYFA 2XG3A 2DVFA 3N7JA 2ARXA 1FNZA 2FMDA 2E51A 4P9YA 1JYIA 2UU8A 5GALA 5HCAA 4YW3A 3IPVB 5GJ6A 1W6QB 1MS0A 1SCRA 3D6EA 1DYPA 3IMNA 3POSA 1Z78A 2ZGPA 5DZFA 4ASMB 2WT2A 1GSLA 4XJ8A 4Y1UA 3UK9A 1I1EA 5JVVA 2A6YA 4K20A 4GA9A 4YGCA 2ZGOA 4NOTA 5GLTA 3V65A 3OBTA 2AGSA 3WNXA 2BQPA 4XJZA 5T55A 1YYNA 4LBQB 3T1MA 4PBPA 5EWSA 2PHRA 1N3OA 3JUUA 4R9AA 3VKOA 4AVTA 2ES3A 2NYYA 2NZ9A 4XHBA 4FP2A 2CWSA 3W59A 2ZKNA 2ZGQA 4XHXA 3N7KA 4XXPA 1CVNA 4CZSA 3KQRA 1V6JA 3ZXKA 4YFWA 1QDOA 1MVQA 1KJRA 1QF3A 3V64A 3RSJA 3POWA 2P37A 1LHNA 2EXIA 3ENRA 2E6VA 4UW3A 2JE9A 1SLBA 2P34A 4DPNA 5GZEA 4OZXA 2AH2A 2WSUA 4R9DA 3WCSA 1LJ7A 2CY6A 4MYEA 3WG2A 4Y1ZA 2ZGKA 3ATGA 3USUA 4GKXA 2R1DA 1WD3A 3OGGA 4Y24A 3WLUA 4XILA 4ISQA 1F5FA 4H55A 2CL2A 4YW4A 1IS5A 1SLAA 1VAVA 1BYHA 4NO4A 3ZSLA 3ILRA 1IS3A 2AUYA 2GDFA 4M3CA 5KXDA 5JOYA 2A3YA 3VKMA 3B3QE 3AZVA 4LBKA 1MS4A 2ZHMA 3D4KA 1G86A 1MZ5A 4AGGA 4ATEA 2WT1A 1LOFA 1W6MA 3V0BB 1IS6A 2GMEA 5IT6A 4ZKTB 4RL7A 3OJBA 2D44A 3MW2A 2JE7A 1B09A 3UL2A 2DTWA 3MEPA 4FPFA 4BOWA 2DV9A 4JCKA 2VUAA 4R9BA 2AR6A 4TYSA 1ULCA 5DUUA 3TB0A 4BMBA 1ENSA 1FATA 5H9PA 3PVOA 1Z0HA 5IK5A 4WVWA 1CONA 3IKWA 3SH5A 2E7QA 3U4XA 3ZPYA 4IQPA 1D0HA 4GXLA 3AYDA 4Y1YA 3N3HA 3O0XA 1BJQA 1W6OB 2ZGLA 1UKGA 4LBNA 2AYHA 2D43A 2NN8A 3HMYA 3AZYA 2ZGSA 3OYWB 3LSEA 1AJOA 2W08A 1Q8SA 1ZM1A 1SLLA 3QLQA 1F31A 1ENQA 2GNTA 3AP7A 4GWNA 2A6XA 2ZGUA 2WLQA 1DGLA 5T54A 1FV3A 1H30A 1WBFA 5JOWA 1MZ6A 1W6OA 3ILFA 4R9CA 2VU9A 2WJSA 3PVNA 4LBLA 4FPGA 3O12A 4Q27A 3WOGA 1V6OA 4D69A 1Q8VA 1WUVA 1QNYA 3O0WA 3BODA 4XYXA 1ULGA 1X50A 2ARBA 3FLTA 3RMYA 2VH9A 1UPSA 3MPPG 2KM2A 2RHPA 3AP6A 2OW4A 2ERFA 3OBRA 4K21A 2PELA 1AX2A 1QKQA 2YMZA 3VKFC 5H9SA 1DIWA 4FOYA 1DLLA 2UWAA 3WG1A 1S1AA 1G8WA 1GNZA 1S0DA 2D3SA 3AP4A 4XBLA 3T1LA 1VAMA 2ZZJA 4AYUA 4DRVA 1WLWA 4FVVA 2UWBA 4XBQA 3WG3A 1A8DA 4Q8KA 1LOBA 2ZGTA 4PCRA 2ZGNA 3M3CA 2EXJA 4SLIA 2JD4A 1CPNA 5CNAA 4XZPA 3RMXA 1DQ1A 4YZ1A 4BLJA 4TZDA 1WLCA 3AYCA 5SV8A 3T2TA 5F9TA 5GLVA 1C4RA 5GLUA 1A3KA 2YXSA 1SLIA 2ZHNA 1W0OA 4M01A 1QDCA 4BQ1A 4M3CF 2WT0A 2WNEA 1Q8PA 4Q26A 2GMPA 3WDXA 5L73A 3ZSMA 4YM1A 1DQ4A 4PQ9A 4PBOA 3ZYPA 1CQ9A 3IN9A 4Y22B 1LENA 1VIWB 1DBNA 4DFSA 2VW1A 2GNMA 1BXHA 3AZZA 4WVVA 1DQ6A 2PHUA 4XDQA 5T5OA 5JLVA 2VW2A 1S0IA 1S0GA 4YGBA 3UJOA 4DS0A 4YG3A 1SCSA 4YGEA 2V5YA 1LGNA 3B00A 3DGTA 1W6NB 4UW6A 1Y7BA 2EXHA 3O0VA 2W52A 3R05A 4UW5A 1W6PA 3ILNA 3OY8A 4FPKA 3H0OA 1ULEA 1RINA 3N7LA 2G4IA 4ISRA 3WDWA 1LHUA 3DUIA 1AVBA 1V6LA 1LHVA 2ZGMA 1HDKA 4XBNA 4Q2FA 1XQNA 3WDYA 2DUOA 4YZ2A 1JOJA 1QMJA 2GNBA 3TAYA 3WDVA 1H9PA 3LSDA 2P3JA 1WBLA 4U36A 4Q8LA 4JRAA 4AVSA 3RRDA 5CBLA 2DURA 1MR5A 3VV1A 3RG0A 2OUJA 4Y20B 3FLPA 1G9BA 5GZCA 2HYKA 3BIWE 4GALA 4XJAA 2JDZA 1WD4A 3AXEA 1QNWA 3SNMA 3AZWA 2UURA 2D6LX 2EXKA 3AJYA 3ZSJA 1CN1A 1HKDA 1WW7A 2XB6C 5EXOA 2YZ4A 5DXDA 1DFQA 1LGBA 1LTEA 2C9AA 2DYCA 2R0HA 3UJQA 1J1TA 1YI7A 3WHTA 3AK0A 1LOEA 1AZDA 2FHRA 2Q5TA 3N36A 3N35A 3NWKA 2D6MA 4XTPA 1YIFA 1MS3A 3NV3A 1H9WA 1SBDA 3MW3A 4Z8BA 1UN1A 3FLRA 4CRQA 3N7MA 4FOQA 2ENRA 4CTEA 1V6MA 1BZWA 1KITA 3ZXFA 1MS8A 4FQZA 1KJLA 1N1TA 3VKNA 4P14A 2R0FA 1G7YA 2PHWA 4FPOB 2YY1A 3AYEA 4FPYA 1G9FA 2DWRA 3FBYA 4ZXKA 5HCFA 1LGCA 2E53A 5CAZA 3VUOA 5AVAA 2GMMA 2VY0A 5GLZA 1LCLA 2OVUA 1C1LA 1FNYA 2PHXA 2SLIA 3R4SA 3INAA 3KM5A 1LOAA 1LEDA 1ZA4A 1GNHA 2V73A 1GBGA 3JU9A 1Q8QA 2GN7A 3M2MA 5DG2A 4YW1A 3WV6A 1DHKB 3A0KA 1PZ8A 2JJ6A 1PZ9A 1CESA 2NP0A 2NMNA 2D6NA 2DU1A 3WG4A 5IUQA 1DQ2A 3B69A 4XOGA 2EALA 2TEPA 5DUVA 1JYCA 3AFKA 3AX4A 1DQ5A 4FPCA 5KXEA 4XJUA 2NMOA 1GZCA 2A71A 4P9WA 5BYNA 3AJZA 4ITCA 5E88A 3V0AA 2D6PA 4XIKA 4FQ4A 3I4IA 4YZ5A 3GNEA 1F9KA 2ZHKA 5DUXA 1LHOA 2A3XA 5IK4A 1N1VA 2CTVA 1JN2P 5E8AA 1GANA 1LEMA 3O5SA 3Q9OA 5CA6A 3AP9A 1S0EA 1FAYA 1FYUA 1VLNA 5JOZA 1G9AA 1JW6A 2A6WA 1AX0A 3LCPA 3NV2A 4UW4A 4HL0A 1S0FA 2LTNA 1V6NA 2JECA 4ATFA 1MACA 2A6VA 4DQAA 1MS1A 2R16A 1W0PA 1S0CA 4RA0A 1DZQA 1LOGA 1ONAA 1ULFA 2PHFA 1IOAA 3L2YA 4BPZA 2OUHA 3IM0A 3FUQA 2WQZC 1KRIA 4LBQA 1C1FA 2PHTA 3QCWA 1FV2A 4GKYA 4Y1XA 3ZXEA 4AWDA 2NM1A 1W6QA 3RQ0A 2ZBJA 4FOWA 2ZAAA 5GZGA 3POYA 2P3IA 1KQRA 4Q1RA 5IK7A 3WDTA 3BOPA 2GALA 2WSVA 1ENRA 1BKZA 4Y20A 2A7AA 2E7TA 1GYKA 3PMEA 4XTMA 1JBCA 1GZWA 1TEIA 5EYXA 1CIWA 1KDMA 1N1SA 1N1YA 3M3OA 3SH3A 1MVEA 4YM3A 5DG1A 1GZ9A 4AGVA 1OKQA 4L8QA 3OYWA 4WZFA 1PZ7A 3WVJA 1AF9A 2I2SA 3ZVXA 1JUIA 4XXAA 3MW4A 2Z42A 4FPEA 5T5PA 4AVVA 1GLHA 2AREA 2DVDA 4YLZA 3BTAA 4C1XA 1AJKA 4Y22A 4Q1PA 4FP3A 5HCBA 5KXBA 5GZDA 1AX1A 1V6IA 2A3WA 3NV1A 4YG6A 1DYKA 1UMZA 1UZZA 1G9DA 3APBA 3A4UA 4YZ3A 3ZXJA 3AYAA 3A0NA 1CPMA 1GZWB 3WUCA 1RIRA 1SLCA 1QGLA 1Q56A 2ZMLA 2D6KA 1DQ0A 4FOVA 3SISA 2JKBA 1HLCA 2W68A 5LK5A 2DUPA 1S0JA 5T5LA 3C2UA 3ZXLA 4PF5A 4DRRA 2YV8A 1A78A 2P2KA 5T50A 1W6MB 1V6KA 4XMAA 1KDKA 1O4YA 2ZACA 3AXDA 3PVEA 3R4UA 2W39A 3CNAA 4Y26A 3RS6A 5IK8A 2A75A 4U2AA 4LBMA 1QOSA 2ZA9A 2D3RA 2A70A 3WZ1A 4AGRA 2R1BA 2CNAA 2AENA 5EYYA 3WUDA 1UZYA 1WW4A 1N3QA 4WV8A 1EPWA 4FPJA 2ZMKA 1IS4A 4KBBA 1W6NA 5GZFA 2ZHLA 1N47A 3B01A 4YM0A 3AZXA 5T52A 1V00A 2EF6A 1D2SA 3M1HA 3USUB 1MS5A 1WLDA 1S0BA 3HN1A 1QOOA 3B9CA 4GWMA 1AXKA 1FX5A 1OQ1A 1RITA 5T5JA 2SBAA 2ZMNA 4YZ4A 1IKPA 4FPLA 3V0BA 3SH4A 4BMEA 4XJWA 2UWCA 5GM0A 1SBEA 2CWMA 1MS9A 1NLSA 1LESA 1LODA 5JOXA 1VALA 5CB7A 4K1ZA 2WKKA 4C1WA 5DZGA 3NV4A 3OPZA 4YG0A 1LOCA 2DVAA 4YFZA 1WW6A 2GNDA 1UAIA 1AXZA 1N3PA 2R49A 3VKLA 2LALA 2C5DA 5FREA 5DUWA 1U0AA 3PJQA 4P9XA 1OFSA 3AP5A 2EAKA 1SACA 5GLWA 2D7FA 1NXD1 3WCRA 1LULA 1UX6A 1HQLA 1JXNA 3I8TA 4BM8A 1URXA 4LBOA 3SITA 1GICA 1JHNA 5JDBA 1LHWA 3M3QA 5KXCA 1SLTA 3M3EA 3W58A 5E89A 2ZABA 4FPHA 5H9RA 2P3KA 1C57A 1IKQA 3HR9A 4XE9A 1LU1A 1CR7A 1UL9A 2A6ZA 1APNA 4XMIA 4I30A 3WDUA 2DVBA 2ZGRA 5H9QA
chains in the Genus database with same CATH superfamily
2JDAA 3KF3A 3MDPA 3NKGA 4Q4V2 5JMCA 4M00A 5DMYA 2JEMA 1KS4A 3I2FA 4RGKA 1QXJA 5FRAA 1R1ZA 4BIFA 3DV8A 3KHCA 1RUD1 1LECA 2KXLA 5A80A 3O7OA 2D5HA 3OY8B 1TVGA 4NHXA 3A23A 1VJ2A 1H2MA 4W6YA 2P6CA 4B4QA 1O4ZA 3FFZA 3CZJA 1GKBA 1S2KA 2VTFA 1HB3A 1ZBE1 1T2XA 1NE4A 2WFF3 2YUEA 4EN6B 4W65A 1PGL1 3MLJA 4K1YA 4PHZA 1YUDA 3VBRA 2P6HA 1HQWA 4CU9A 1YQ8A 4YW5A 1W8HA 2D40A 2PYTA 4A42A 1BEV2 3I3DA 1NYWA 3VD9A 3EMRA 5LA2A 4AFDA 5J09A 5F5QA 2VW0A 1SBFA 3QH6A 4O9GA 2VQUA 4URTA 2HWF2 4BXFA 4GB33 2XG3A 4P9YA 5LRSA 2FMDA 1QJY1 4AQTA 4UFMA 1VBE1 5GJ6A 4JDOA 3D6EA 2P17A 4IV1C 1NLQA 1J84A 4ZU7A 4DUXA 3POIA 2XL9A 2WT2A 1GSLA 4B29A 1YLLA 4Y1UA 5JIUA 1XE0A 4QHOA 1RUC1 3IDCB 4GA9A 3LDBA 1RUF2 4DB5A 1OA4A 5GLTA 2BBAA 3V65A 2E7AA 3W9AA 1PM7A 5D8AC 4XJZA 2RS32 5LBEA 5T55A 5K7PA 5L7OA 1V9U2 2JKXA 5EWSA 5J98B 1N3OA 2L9LA 3VBHA 2ES3A 4XHBA 3GBWA 4FP2A 2GSYA 5EP9A 4CDUC 2ZKNA 5FYMA 2VMEA 1D7PM 2VXJA 3THDA 2C6SA 4XFFA 2BYVE 3LEMA 3N7KA 2DBIA 4IV1B 2R072 5CFCC 1ZZ8A 2V4VA 3KQRA 1K12A 1V6JA 4RYDA 4D7SA 1H1IA 1E5RA 2BGOA 2YGMA 2O1QA 4UT5A 2JICA 2JE9A 5I91A 1AHSA 4DPNA 2JENA 2QCSB 3OUIA 4OZXA 2WSUA 1ULPA 4C0HA 1XNCA 2CY6A 3TN92 2EVXA 3OB8A 2WYSA 5F3CA 3I3MA 2HLEA 4NR1A 3T3YA 1WD3A 3OGGA 4HXCA 4ZU4A 4FT8A 1AR82 3BYWA 4CXXA 4H55A 4YW4A 1SLAA 1SMVA 1DGRN 2CAVA 2HBUA 5DAWA 4NO4A 1VBC1 4K8RB 5FOBB 3S6PA 4N43C 4IEWA 1LB2A 5KHGA 2AUYA 3VLBB 3WNPA 3B3QE 3H8OA 3WQBA 4Q0VA 2UYBA 2VBPA 1FPN3 4COVA 5IVYA 1YQ2A 4TLGA 4RSUA 3IDBB 4S2GA 3V0BB 1WKYA 3TOJA 1OQDA 4ZKTB 3U14A 3KLSA 4RL7A 3GF6A 4KG8A 1K5MC 1IG3A 3MW2A 1W03A 4CP2A 5LCWL 3WSOA 2BUKA 1VBB3 4FPFA 1UMIA 1PIV3 5FK7A 4BOWA 4QPIC 4P5YA 2DV9A 1BLZA 4JCKA 3TB0A 4OUMA 1ULCA 4L11A 2JWPA 1ENSA 2P3YA 1NQJA 3NRUA 1BBT2 1Z0HA 2R32A 2VQTA 4JKMA 3KV9A 4IQPA 2VZTA 3DKQA 3VL8A 1COV1 3O0XA 3VBUA 5AC91 4R52A 4Z82A 2ZGLA 2XKPA 3W5MA 4G4FA 4LBNA 2AYHA 3HMYA 2Y0IA 4DXRA 3VZMA 4CDUB 1NZIA 1X8EA 4N43A 4DUWA 4RFT0 2W08A 5F8PA 3RDIA 1JYVA 3B93A 1GMMA 2OXBA 2YBSA 4YVSA 2GNTA 4GWNA 3ZN6B 2ZGUA 1DGLA 2V5DA 4HG6B 1JZ5A 3HNBM 4IEYA 4IE5A 3F2ZA 3ILFA 1AYN3 1Q3EA 2WJSA 2IVIB 5CEHA 2HWD3 4FPGA 4OULA 4I3GA 3O12A 4V1PA 3WT3A 4D69A 1X7NA 3U4SA 1XNBA 3U75A 3O0WA 5I93A 2HWE3 1K3IA 1ULGA 5FPVA 3ZFGB 3FLTA 3X29B 1NA1C 3MPPG 2F17A 5BXXA 2RHPA 4QKDA 4MGYE 2OW4A 4M4PA 3OBRA 5FKCA 3LD8A 1QJU2 2YMZA 5FZ9A 1VR3A 2XMLA 5CADA 4AQSA 4NRMA 3ZO0B 2JDPA 5D2AA 5H9SA 5J3UA 5FYBA 4LKEA 4B7KA 3WG1A 1S1AA 1R093 1S0DA 3FN9A 1O8SA 2VCBA 1UD1A 4EWAA 3M3IA 1H4HA 1AR93 2G9ZA 1UY0A 3BTYA 1TNRA 3WG3A 5AC93 2JB8A 2ZGNA 3M3CA 2JD4A 1UNBA 4XZPA 1O6UA 1DQ1A 4TZDA 5F9TA 3LGRA 3PNAA 1AYN2 1CAVB 1R1A2 1D4M3 1KXGA 1SLIA 4QAWA 4WM8A 3WNOA 4CU7A 3VDBA 2VUJA 2Y34A 1F5JA 1RUE2 4Y4YA 1XNDA 4PJYA 3GXUA 1SEFA 3AKPA 1MQTA 4W8JA 1RXFA 1YNAA 3WDXA 4AR2A 4IE0A 1RUI3 1T6BX 4DO0A 3ECQA 3ZSMA 4OYUA 4PBOA 1JZ2A 2FBEA 3ZYPA 1W99A 1UIJA 2VZ1A 1LENA 1IG0A 1VIWB 3DL3A 3DPRB 1SG3A 1DBNA 5I0UA 1F2NA 4D94A 3I2DA 5C3OA 3U0ZA 4ASLA 2GNMA 4Y4RA 3ELNA 3ZYBA 4B1LA 1OOPC 2PHUA 4XDQA 1WMFA 2XJTA 5JXGA 2VW2A 1S0IA 3VBOA 2XJSA 4P9JA 4DS0A 2VOTA 1SCSA 3K4ZA 3HPNA 2ILMA 4XC9A 2B46X 3DXUA 3RI8A 3TN93 3ZOIA 4N53C 4OVEA 4XUTA 1Y7BA 2EXHA 2IC1A 1CX4A 3HOBA 3ZFFB 3H8UA 2PAKA 2ARCA 4JGZB 4UW5A 2ORZA 1ZBE3 4W6WA 5LATA 4C90A 1COV2 5FZBA 3N7LA 1RINA 2W3JA 4LKDA 4ISRA 4XCAA 1CGPA 1LHUA 2I07B 3WP6A 4LHLA 1MEC3 4AEDC 3DUIA 1Y9QA 1C8M3 1WMEA 1MZFA 2ZGMA 4Q4X3 4B4PA 3MGUA 2J1UA 1XB9A 3CJIB 3WDYA 2DUOA 3IDEA 4EN9B 1RC6A 2ZOEB 5LB6A 1HV1A 1JU4A 1QMJA 1AYM3 1UY4A 3T2OA 4AAXA 3WDVA 4Q4W2 2VC9A 1MQTB 4NAOA 2P3JA 4WZCA 4RQPB 5KBFA 1BVVA 1WCKA 2VBDA 3RRDA 2DURA 1MR5A 4XFIA 5J96B 4L97A 1JZ7A 2B45X 2W92A 3FLPA 5JZGC 5CVRA 1PO21 1GWLA 1RYYA 1UOJA 5GZCA 2HYKA 3SCFA 5APAA 5IVFA 1AR73 4XFCA 1ZYBA 3AZWA 3SNMA 4CCDA 1YQ5A 2D6LX 4LQRA 5A3LA 2XB6C 3BTXA 4WM7C 3JD73 3I3QA 5CG9A 1ZBE2 2R30A 4A6SA 4JTOA 4MX3A 4AEJA 2C9AA 3MO4A 1RMU2 2NQYA 4QQPA 1YI7A 3EXUA 1AZDA 4FI9A 1XSQA 3N36A 4N9IA 3N35A 1CAWB 2JIJA 2D6MA 2JB4A 2VMHA 1YIFA 1FOD1 4XTPA 1H9WA 5BNOA 4LR4A 5KC6A 1AL23 2VMGA 3FLRA 3NJZA 1RUJ1 1O3QA 3BGAA 2AEZA 2DDUA 2OA2A 3KT7A 3WEZA 4M4RA 2JG9B 1HRI2 4ZU5A 1VPHA 4GH4A 1GQHA 1XE8A 1N1TA 5F32A 3VKNA 5J7MA 3GHMA 1LKNA 4ZXKA 3LZZA 3FBYA 5IVVA 2OZJA 2ZJCA 3WX5A 3VZKA 1YFYA 2VY0A 2YBPA 4MV2A 5GLZA 3EHKA 1C1LA 3PTRB 1ODNA 3ZFEC 2W9XA 3IIAA 3INAA 3VZLA 4QX7A 2PN5A 2RDSA 3ZXGA 1L7QA 3E5QA 3DXTA 3JU9A 1Q8QA 3NL1A 4YW1A 1JUHA 1GQGA 2HWD1 3C3VA 2NP0A 2JJ6A 4CE8A 1CESA 4F3JA 2VUDA 5K8SA 1HW5A 5FYVA 2VZRA 2WFPA 3LOBA 2JG9C 2TBVA 3B69A 2JXAA 3AFKA 1IPKA 2R041 4RR3C 1OVSA 1OSGA 2YFUA 1GZCA 4IGPA 1NOVA 1HRV2 1U5ZA 1H8TC 2D6PA 2WUHA 5DUXA 1KEXA 2ZHKA 4RGAA 1R092 2A3XA 1AR63 3IBMA 1N1VA 2CTVA 1RUH3 5C8CC 1S0EA 1FYUA 2W1SA 1NZCA 1V6NA 2LTNA 1MACA 2MEV3 1MS1A 4JDMA 1STMA 3HIFA 4E2GA 2VOXA 4JGYA 2WO3A 2PHFA 1IOAA 2OUHA 3FUQA 1O7FA 2JD9A 4LBQA 2JDMA 5FPZA 3ZXEA 3MZHA 4AWDA 2NM1A 1W6QA 4MGSA 4HN0A 2BFUS 3RWKX 2J1AA 3OBAA 2ZAAA 4PIYA 5GZGA 3POYA 2X10A 3HT1A 5HPOA 4NRQA 5IK7A 4Q0SA 2K9ZA 4V2WA 2WSVA 1ENRA 2RMU3 5LRRA 3UKTA 2RJLA 3VBFA 2Y0OA 4CEWC 2WYFA 5JPNB 1AR72 3CKHA 1VBC3 4FFFA 3B9IA 2OPWA 4IUGA 2YGLA 5FZGA 1RUOA 2P4EA 1DLCA 3AVRA 5FLHA 4FTBA 2XUMA 1T6GC 3JB4C 4FPEA 5T5PA 1ZZBA 2AREA 4C1XA 3KMHA 5AFBA 4Q1PA 5IATA 1U12A 4QPYA 5C3QA 1VBA2 1V6IA 1PMIA 4LA2A 1DYKA 3LF7A 4QPIB 3VBSA 2R042 4KWJA 3S5AA 4YZ3A 5HXMA 1GU3A 1H0BA 3AYAA 3EYPA 1QGLA 1PK6C 2W94A 1Q56A 1XNKA 2Y6JA 3ACGA 2YYOA 2IWGB 4MXWB 1HLCA 4RGGA 3PUIA 1VMJA 4UWDA 1QJY2 3ZXLA 2HYXA 2QQNA 1GNYA 4AHWA 2QDRA 2P2KA 1W6MB 4KGQA 2ZACA 3PVEA 2W39A 3CNAA 3E5UA 3R0RA 4AXOA 1QOSA 1NCRB 2D3RA 2A70A 3IAPA 4ZS2A 3ZM8A 1O4TA 3H8RA 3DYMA 2CNAA 2AENA 3EB7A 3IAQA 1PK6B 1UZYA 2IXCA 3ORJA 5BNNC 4WV8A 4NIIA 1EPWA 5M0TA 4Z07A 3U11A 3EQEA 3W5NA 4FPJA 3UGFA 3N4MA 2VZPA 3BTZA 1IS4A 3ZFFA 4CP0A 2UY9A 2W1UA 1R082 5FO9B 4PF1A 5FLJA 5T52A 3VBOC 5JI9A 1V00A 5FWJA 2HWC2 1W2OA 4K6BA 5C5TA 3HN1A 2ZZQA 1HRV3 4UF0A 3CDZB 4BQWA 1IKPA 3V0BA 1NX9A 5FUNA 1MEC1 3VBRB 1RHI2 5A3PA 3I2IA 1E5HA 5FQ0A 1KFUL 1SBEA 1MS9A 4AFBA 1LESA 2JDUA 1ZRFA 2EICA 1VALA 4FCAA 5CB7A 5L19A 3NW4A 2WKKA 2WZEA 1VAKA 4O61A 5DZGA 3NV4A 2RVAA 2XL7A 3OPZA 4XQWA 4AZZA 3KT1A 2PLV3 4JAAA 2VMCA 1LOCA 2BP6A 2DVAA 4XZUG 1XC6A 1WW6A 4OI2A 4QPGB 4XF1A 5IYYA 3I3EA 2Q8EA 5C9AA 1AXZA 3ETPA 3VKLA 2IFRA 2C5DA 5C4WB 2CGNA 4B1MA 3J8F1 1FOD3 1U0AA 2WZR1 1AR81 4QM8A 4WM8B 4BJ0A 5FK8A 1NXD1 1PIV2 4LUKA 2X05A 1HQLA 1GOFA 1RXGA 4ES8A 4FXGB 2O14A 4LBOA 1JHNA 2Y6KA 4COWA 2W1WA 5EQUA 1JZ6A 2JG9A 2CHHA 1HQNA 3M3EA 3W58A 3MUZ1 2ZABA 3MIEA 2BWAA 4FXKB 5DDJ1 5EJ1B 5H9RA 5FYYA 1PM4A 5LA1A 1ZNPA 1C57A 3B02A 5IFPA 3FJSA 3TBDA 1LU1A 1CR7A 2A6ZA 3GDBA 4XMIA 3WDUA 2Y6GA 2DVBA 3VHPA 1CAWA 1LAJA 4BCUA 3KQ4B 3POGA 2HH9A 1SQ4A 2XLAA 3CZUA 3D5OA 4C8DA 1O3RA 2XR4A 4QXCA 5FTTC 1VBA3 2C1FA 4XJ9A 5F3GA 2RV9A 2UYAA 1DYOA 3ASIA 5FMBA 5HV0A 3WHUA 4LBQD 5FZMA 4F8AA 4KL1A 3NJVA 1FPN2 2A73B 3UESA 4AI9A 5I0DA 1LOFC 1NG0A 4RHV2 4KQ7A 2FQPA 1QWRA 1I3HA 2D3PA 3IWZA 1TMF2 4AEMA 1REFA 1XRUA 4HZFA 5A6ZA 3HQXA 3ZYFA 1W8TA 5A7WA 1PNGA 3FFQA 4AFAA 3ZSKA 1CAXB 2B8MA 1QOTA 2OKXA 3URFA 4R4ZA 2RS51 4BISA 1TG7A 1WCSA 4IETA 4ZONA 1RUJ2 4F83A 4NIHA 3GALA 1AR92 1MEC2 4MLOA 5DPNA 1POV1 4I09A 3WF1A 1R083 2RDNA 5HCAA 2IVJA 1W6QB 4P5HA 1JYWA 2HWC1 1SCRA 4S2HA 3WF0A 2HEYF 3POSA 1W9YA 2ZGPA 4BQ4A 1R091 1ZREA 4FO9A 2WNUA 4FSJA 1XBFA 5JVVA 2A6YA 2CSGA 3M7AA 3MV01 4HETA 2E32A 3JQWA 4Q4Y1 3E1F1 4NOTA 4A45A 1LRHA 1L7RA 1EP0A 2BQPA 2ZKLA 3RWNA 1XYPA 1U5XA 4LBQB 4PBPA 2VUCA 3PJYA 2FD8A 1R081 2NYYA 5JSOA 3LWCA 3O14A 1DDLA 2ZGQA 3MI8A 4XHXA 1OFNA 2ZAHA 1CVNA 1ODMA 2N7GA 5FPLA 5F6KA 1QJFA 1QDOA 2E9QA 3QBQA 4N7IA 2GZWA 4PLNA 4XW3A 1GWKA 1LHNA 2YHJA 1FMD1 1OF3A 2E6VA 2R7EB 3BPZA 4UW3A 3U78A 4NVPA 1OMIA 1S4CA 4IV1A 3KS7A 2W5FA 4Y1ZA 4K9SA 4IE7A 3USUA 1ND2B 2ETEA 2XWJB 5LA9A 5FZ4A 3PU8A 3GJAA 2D98A 4XILA 4X6QB 1M06G 3BVCA 4G3YC 1R1A3 1VBA1 3OOXA 2VOWA 3ZSLA 4IEUA 3GHNA 4JDNA 2X09A 5CFDA 4M3CA 3E97A 2GU9A 4CCNA 3JXSA 4AGGA 2W2IA 3U07A 2RG4A 5KHHA 1H2KA 4GMP0 1IS6A 1UOBA 4HFSA 3K48A 1H1AA 1ND2C 2GMEA 3RZHA 5DDJ3 3H3ZA 2JE7A 2GP5A 4H7LA 4LEJA 2WO1A 3OPWA 5JWPA 1ZVFA 3MEPA 3T0BA 1S2BA 2G9GA 4QHBA 5AVPA 5FYUA 1NUKA 2VUAA 4TYSA 5DN2A 5L9VA 2BWCA 3LFIA 4HK8A 5CFDB 5H9PA 4RFRB 4Q4W1 1AYN1 3SH5A 3KV4A 1EUTA 4CDXA 5ACA1 3ZPOA 1BJQA 3WQ0A 4CEYC 4RQPC 3SC7X 1UKGA 1RUC3 4Q0QA 2D43A 2BTVC 3AZYA 1W9FA 3OYWB 2PA7A 1Q43A 3I54A 5C3RA 1ZM1A 1QJX2 1UY1A 4K8FA 1DU3D 4AI1A 4PIXA 5J1XA 1ENQA 2Q1ZB 3AP7A 4Q4X2 5ISLA 1COV3 4ZY9A 5T54A 4AK3A 4CP9B 4OHXA 1K45A 1MZ6A 2WAAA 2JDHA 2ZS6B 1PVXA 4IXLA 2WR9A 2YC0A 4LBLA 1NLRA 4GAZA 2BNNA 2RS52 3UETA 4COUA 3WOGA 1W2UA 2FCUA 5FY5A 1Q8VA 3N9LA 3C7FA 3P3PA 1QNYA 4MGIE 3BODA 3HT2A 1X50A 3RMYA 1UY2A 4CEWA 2ZX3A 3PLQA 4HT1T 5DQ0A 1HXS1 3TNQA 1PNFA 3FZ3A 1PX4A 4HVRA 2ERFA 1U5YA 2F6BA 3GYDA 2D5FA 5JXHA 2Y26A 3ZMOA 1UX7A 3SEPA 3VKFC 2VGDA 1DIWA 2VTXJ 5FY1A 1J3QA 2B9VA 1GNZA 2D3SA 3AP4A 3T1LA 4RR3B 3RPQA 4QXKA 1OT5A 1VAMA 4AYUA 3LQCA 4DRVA 3LAGA 3CIHA 4FVVA 4XBQA 4XDPA 4Q8KA 1LOBA 4PCRA 4QDRA 3Q8AA 3MPBA 4EV0A 2EXJA 4SLIA 5F7UA 1CPNA 1OKOA 5CNAA 3VBSC 5IVCA 4YZ1A 3RMXA 1GR3A 1EUUA 1YCIA 4IW3A 2OQ6A 1A3KA 5JI7A 2YXSA 3SKJE 3WF2A 1BBT1 4UFKA 2DCKA 3PMSA 4MZUA 4WVMB 4AQ2A 2FDHA 1RL3A 4LK7A 2WT0A 3AFGA 3ZDSA 3BI3A 4P00B 2BW8A 4QDSA 4NIAA 1J83A 1NQDA 4P9GA 1VBB2 4Q26A 5L73A 1HRI1 1UMHA 3J7HA 3BKZA 2WA4A 1GZTA 3I59B 3THPA 1ALYA 4MVTA 4AOCA 2X29A 5T3NA 3DYPA 1OPMA 3AZZA 1B35B 1W04A 3T0AA 1OURA 4WBBA 3V56A 2BEOA 5JLVA 1BMV2 2OPKA 3MLLA 3UJOA 4YGEA 4GQ7A 2XQXA 5FCCA 2Y33A 4KGGA 2WQ8A 4S2FA 4Q4V1 2BZDA 3OY8A 4FPKA 2VCAA 3WW4A 5A3TA 4ORFA 3CEWA 3WDWA 2P1BA 5BNPA 4Q29A 4NJ4A 3EO6A 4YNIA 1UOGA 1JU3A 1UCXA 2XHKA 1IQAA 5C8WA 1AVBA 3FE5A 1LHVA 1RUG2 4GB31 4XBNA 2RS11 1OLMA 3ES1A 3S5QA 4YZ2A 3TAYA 1H9PA 4D6SA 2QFEA 1JYXA 2G1MA 1WBLA 4LJHA 3N9NA 4ONUA 1GOGA 4A41A 1W8OA 2DCZA 5FYTA 2VULA 5CBLA 3RG0A 2OUJA 4PI0A 4ZZ8A 5LBCA 5FMDA 4HONA 1ND2A 2ZEZA 2WFF1 5F39A 5FIXA 1AL21 3BIWE 1J58A 3AXEA 3KCYA 2R6QA 2VZSA 1YQ6A 2RR13 1CN1A 1C3HA 1HKDA 2VCMA 2XWBB 3DN7A 3AMPA 1AYM1 2YPDA 3I2OA 4RHV1 3OG2A 2JIGA 1LGBA 1DZTA 4GWJA 3BU0A 1Y4WA 1D2QA 2PTMA 2JE8A 4YW6A 3KCCA 3OGSA 3R4DB 1NT0A 5LASA 1LOEA 4LIVA 5BNPB 2O8OA 4QX0A 2Q5TA 4Q4Y2 3C8XA 1U5IA 1MS3A 1RUF1 5FYZA 5FPAA 1SBDA 3PUSA 1NCQA 5EJ3A 2QZ3A 4Z8BA 1UN1A 2LM3A 1QIQA 1ZBA1 1BHGA 4FOQA 4QU2A 4QX1A 1JODA 2GH8A 4BE3A 1MS8A 1EV12 1YFXA 1KJLA 2XDVA 4GMP1 2R0FA 3R6SA 1OUSA 4J1XA 3PIGA 2XJRA 1GP6A 3NVCA 4NMIA 5HCFA 1ZBA3 4YVWB 4DZGA 5AVAA 1CWPA 2GMMA 4KBZA 4E2QA 5K9YA 4K40A 3AM2A 5FY0A 5JR7B 2F4PA 5FZDA 2PHXA 4N9HA 4YSFA 2WABA 2XJPA 3NNFA 2XXZA 1LEDA 2V73A 3MIGA 4KH9A 3HNMA 1QJU1 1PZ8A 2NMNA 3CLPA 2PFWA 4OLLA 5IUQA 1YHFA 2RR11 4BZ4A 2BDRA 2RM22 1X9TA 4XOGA 3SQOA 3G7DA 5L36A 3OGRA 2Q8CA 1RVF1 3VBFC 1YEWA 4FPCA 1D4M1 5KXEA 4XJUA 4Q4V3 4P9WA 4D7TA 5BYNA 1BBT3 1ZZ6A 3AJZA 4ITCA 5L9RA 4LOTA 5FO8B 3V0AA 3CU7A 3I4IA 4A2UA 4XAAA 4EN8B 4EROA 5TSWA 5IK4A 1ASJ1 1GANA 3O5SA 5LY1A 2Q1FA 1X82A 3ZMNA 2WNUC 4DEQA 1G9AA 1P8JA 3LCPA 4BIOA 4HL0A 2JECA 3P5BA 1I5PA 3CQOA 4RN5A 4W50A 2VZ3A 2JG8B 3MLKA 1H2NA 1NXMA 1S0CA 4YVSC 5LW9A 3RZKA 2JG8C 1DZQA 3L2YA 3MF6A 2VM9A 4NWWA 4RA0A 1K42A 4OI1A 2WQZC 3B7MA 5IHRA 3QCWA 4GKYA 2XH6A 1NKGA 4FFIA 1PGW1 3I2KA 3LEIA 3MIDA 5CG8A 4L2NA 2EIDA 4AI0A 1A34A 4NAMA 5A1FA 5BNQA 2P3IA 2HKXA 5IW0A 3SKVA 3WDTA 2WFF2 3BOPA 3OD4A 5EJZB 3AVSA 3ME2A 3ABZA 1YIPA 2A7AA 4Y20A 1R1A1 2XQRA 1CAXA 4P08A 3OTFA 1JBCA 2J7MA 3RFRA 2Z4FA 5HV4A 1VBE2 1KDMA 1POV0 5FBJA 3OBZA 1RUD2 4YM3A 5A3MA 1OKQA 5A3UA 1AF9A 2G19A 1JUIA 2VTXA 3C7GA 3BUCA 3DYOA 5F5AA 1ULOA 3W20A 1G9CA 5FBZA 1AJKA 4RS5B 2AZ5A 4FP3A 3ZFGA 1RUG3 3ZKUA 4AI2A 3M8LA 2E33A 2A3WA 3NV1A 1XJAA 4I0BA 4IEQA 3A4UA 1DCSA 4LXLA 4CYDA 3CBNA 1HB2A 1CAUA 1CPMA 1GZWB 1RIRA 1SLCA 2BRTA 4YARA 2ZMLA 2OT7A 3FL7A 2DFCA 1DQ0A 1REEA 2VVFA 3MIFA 4XUQA 3J26N 3OEAA 3SISA 2W68A 5LK5A 4AL9A 3H7JA 2R071 2E31A 4DRRA 4PF5A 5A7SA 4AFCA 4PDWB 2NLRA 2YV8A 5T50A 1V6KA 4XMAA 3AXDA 5F5IA 5I0TA 2Q8DA 4EWEA 4CDWC 4MGTA 4LBMA 3MFCA 1QH7A 4CP1A 4AGRA 1CZSA 3K51A 3ZXDA 2FDGA 4AG4A 5L9BA 1JOPA 1IPSA 4JKKA 1UZWA 2X8KA 4PLMA 1N3QA 2FDKA 5FY4A 5HXVA 1BMV1 1TMF1 2VMFA 2O0OA 2BOIA 1I5ZA 2VNRA 2W46A 5FFOC 4E4DX 5JPMB 4QQHA 1RUJ3 2BFUL 4X6RB 1J3RA 3ZFGC 1W6NA 2DCYA 3LIGA 5GZFA 1N47A 3B01A 1ZZCA 2HBTA 5DAXA 3M1HA 3USUB 1W90A 1MS5A 1WLDA 3B94A 4COYA 4IE6A 1AXKA 1FX5A 1RITA 4DIQA 5C4WC 4UBGA 4YZ4A 2YU1A 4BMEA 3AMQA 5FZHA 2UWCA 5FJHA 5CFCB 5F2SA 4IERA 4ZXEA 1LODA 1O3TA 4D8MA 4F7ZA 3H3LA 2ET1A 2XONA 5JAXA 1UXZA 1ZA7A 2UY8A 3FMGA 1MZEA 3LEGA 4OI0A 2YU2A 5IWFA 3DEMA 1RUNA 1ZX5A 2TUNA 2VZUA 4LE3A 3WXPA 4BH9A 4YFZA 1XPWA 5FP4A 1OLQA 4CCLA 5A3NA 2R49A 4LO5B 2WN3A 4E4SA 3KCXA 4Y5SA 4A6OA 3TEWA 4XQ4A 3WW3A 3WCRA 2D7FA 4LE4A 1GOHA 1W8NA 3KWVA 5CFCA 5ANQA 5A7NA 3I8TA 4BM8A 2RM23 5K0UC 1ZRCA 3ZYIB 1W28A 5JDBA 2VJXA 1O5LA 2C9KA 3CJIC 5F5CA 5E89A 4N8MA 5DAPA 1WMDA 3I49A 1ZRRA 2WRAA 5IFTA 1RUG1 1IKQA 2PAMA 3HR9A 4IV3B 5D21A 5FOJB 2YG0A 4I30A 4XFAA 1YI9A 4QMAA 3MV11 4PLOA 5H9QA 4CEYB 2WDBA 2ZCWA 4LBJA 2JDNA 1Q8OA 2H6CA 4IEZA 1W8ZA 5A7OA 1XXNA 1LNSA 1NCRA 1UIKA 2VOVA 3PL0A 5FY7A 4QGMA 4AEDA 1UU6A 3VDDC 3VZNA 4XETA 4BQ5A 1YO8A 2BNMA 3WNNA 3S7EA 2RS53 4JC1A 4KWUA 1W6PB 4XIOA 1ULDA 2H0BA 1SFYA 3FUOA 1HIXA 2DUQA 2E26A 4KU7A 4Y5Z0 1CJPA 1L3JA 1RVF2 3NQHA 1YRZA 3ITQA 3A7QA 5DZEA 2A5ZA 2XJVA 2XVGA 4Y1VA 5C3SA 3GZUC 4YGDA 1YQCA 3ZDVA 2YROA 2IFWA 5FXWA 4CUCA 2Z2SB 2Q30A 4BLIA 2EIGA 2IXIA 3MF9A 1BQPA 3BPSA 4TN7A 4XF3A 1OF4A 1RUD3 3ZYJB 5A70A 1JYTA 1AL0G 3SLIA 4MGQA 2ID4A 5IAVA 3ZYRA 5JXIA 2DU0A 3F95A 1OD5A 1RGSA 4AVBA 2FCTA 2DVFA 2ARXA 1FNZA 4HKWA 4JQTA 1JYIA 3ES4A 2UU8A 4Q0PA 1X8MA 1EV11 4YW3A 5FP7A 4LHSA 5HBAA 1W8UA 4QDQA 4AEDB 1DYPA 3IMNA 1EYBA 1Z78A 2BU9A 3HD8B 3ZR6A 1O3SA 1HXS2 1H8TA 3O1SA 1ZRDA 4XJ8A 3UK9A 5C33A 4XUNA 3LB9A 3UV9A 3NNLA 2J42A 4YGCA 2LRPA 4BXSV 2AGSA 3WNXA 3WQ1A 1YYNA 2ATFA 2OIIA 4TTGA 5ACA2 2PHRA 2W47A 3JUUA 4R9AA 3VKOA 1XOYA 4E8DA 5A33B 1QJY3 1C8NA 2CWSA 1DGWX 2VNVA 4JZRA 2LROA 3VHOA 5HCHA 4OUEA 5FKBA 1US3A 3T30A 4JX0A 2VZOA 1CZVA 2IXKA 3GCXA 4LITA 3ZXKA 4OI4A 3EJKA 1DF0A 1SPPB 5ABJC 1QF3A 3V64A 4AAPA 3RVHA 4NPLA 3U10A 3VD7A 1SZBA 2OX0A 3ENRA 3OGVA 4QU1A 1SLBA 1OUXA 2Z69A 4R9DA 1O5UA 3WCSA 1YC61 3ZR5A 4MYEA 1VBC2 4DXTA 3AKTA 1W8FA 4H7MA 4XQDA 4DY5A 2R1DA 1BCXA 4OMCA 5FZOA 2B4KA 3ZFEB 4LO7A 2HJIA 5C8CA 1Y3TA 2JDKA 2EA7A 3WLUA 2Z79A 3DPRC 2R063 3L9JT 1XYNA 4H2AA 1VRBA 1GP5A 4MG2A 2DBNA 1BYHA 1F35A 1H1MA 1VP6A 3VDDB 4GJZA 4XDOA 3DCQA 3ILRA 2DFBA 1IS3A 1VE0A 1VRH3 5KXDA 4HKLA 2A3YA 1QQP2 1QHDA 3OPTA 4QGNA 4EE2A 4D3WA 5JOYA 4JKLA 3WF4A 3AZVA 4LBKA 3ZLIA 2ZHMA 1W8WA 3D4KA 3TNPB 1MZ5A 2QQPA 5F3EA 4ATEA 4J6GA 5F3IA 5L7OC 3RGBA 1ND3B 2JG8A 1LOFA 2BERA 1WLTA 2WA3A 4QWNA 4BK4A 3ST7A 5IT6A 5JZGA 5FUPA 4L9BA 1NA1B 5I0SA 1B09A 2BGCA 2DTWA 3LA3A 1OC1A 3SMHA 1K5MA 4R9BA 5DUUA 5G05L 1YWKA 4BMBA 4XF9A 1J59A 1FATA 4WM7B 5EPAA 4QPIA 3I2HA 2E63A 1CONA 5LBFA 1PVC2 5LA0A 3VD5A 4LK6A 1AR83 1CZTA 3AYDA 2V4AA 3C7OA 3N3HA 4GXLA 4L0PA 3T2QA 2ARAA 4MOAA 1W6OB 4LLFA 4E4HA 3H50A 1D0GA 3NJXA 4UYBA 1W9TA 3WQ7A 3LSEA 3NAPB 4RQPA 5JXJA 3GJBA 4EQVA 5AC92 4PIZA 3ZN4A 3ZIXA 1SLLA 2ZEWA 4L92A 2A6XA 1Z7S3 4BYYA 4OHZA 1FV3A 4XAEA 3K75B 4Q4W3 3RZMA 5JOWA 3J7NA 2VU9A 3A22A 3PVNA 1RUF3 4NWVA 4P02B 2V09A 4Q27A 4QB6A 1PO11 1Q5OA 1V6OA 4FFHA 4Q4X1 5F6LB 4AF9A 2XLFA 1JHJA 3OD0A 3LE0A 2ARBA 2FMYA 4ZHNA 5A6YA 2VH9A 1K5MB 2J1VA 3NAPC 3VBHB 2PHLA 1TME3 2ZX2A 5C9AC 3C7HA 1KFXL 1OXCA 3AP6A 4MXVA 2GC2A 4XURA 3USSA 3VBRC 2PELA 3TEYA 1QKQA 1QQP1 5EZWA 2XGXA 1KD7A 2ORXA 1F4HA 5CISA 5IAXA 3GGLA 3PTYA 3SXWA 5C5UA 1G8WA 1L7LA 3W21A 3GZTB 3BU7A 5K0UA 1JI6A 3WY6A 4ZS3A 2QQMA 2FDFA 3MFAA 1WLWA 2UWBA 1A8DA 1E5SA 5JCTA 2ZGTA 3ZSEA 3S7IA 4EJRA 2RS13 4ZZ5A 3GCWA 3PIJA 4MADA 1HRV1 3SCGA 4M0HA 4MHUA 4BLJA 3AYCA 4K3UA 4CDWB 5F2WA 2WL1A 3PHMA 4XCBA 2W0XA 3OGJA 5GLUA 1HRI3 3WNMA 2ZHNA 2RMU1 5KHKA 4XFBA 5J48A 3K3NA 1DP0A 4OZOA 4XUPA 2GH2A 1TE1B 4LUMA 4DXZA 4M01A 3VGIA 1V9U3 4CDQA 4M3CF 4B8EA 1EAH3 4UAPA 4Z92B 2X53S 1GP4A 4NHYA 3VDDA 4R8HA 1JZ3A 1RTVA 2GMPA 4CDXB 1ND3C 4YM1A 1EV13 3HQRA 4Y22B 3UKNA 1ND3A 4ASKA 1PHMA 2ZX4A 5FXVA 4BQ2A 1HB4A 4DFSA 5IVEA 1CAVA 4WVVA 1DQ6A 1VBD1 5T5OA 2BPA2 4CCKA 2C0ZA 4OQ9A 1W3XA 1TMF3 1S0GA 4JVAA 4YGBA 2D97A 2RDQA 4YG3A 2Y8KA 5D8AB 5FJKA 4YPJA 1X9PA 3O1RA 4CDXC 4NE9A 2OYZA 3RJ2X 4UW6A 3ZIWA 3QOPA 4YVWC 2PAEA 3O0VA 2W52A 2BVBA 3R05A 2CU5A 3ILNA 4HOOA 1AUYA 2VD7A 4WM8C 1OVPA 3H1WA 2VQ0A 1HX6A 3VHRA 3RZJA 2J1SA 2IXHA 1FXZA 2XBO1 1V6LA 4N43B 3J7LA 4Q2FA 1XQNA 1PGSA 1NCQC 5IJRA 1W9SA 2QBXA 2FDJA 1GUIA 1YFUA 1JOJA 4HPKA 2GNBA 2OS2A 2HWB1 3U1XA 2R062 3JD71 4YVSB 2IXJA 1Y9MA 2W95A 2Y6HA 1PO22 4JGYC 5FY9A 3I97A 4HBNA 2PQQA 2CDOA 3UYJA 4AEKA 4JRAA 4AVSA 2QQIA 1RUI1 2WIIB 4Y33A 3LPGA 2VECA 3O1UA 2RMU2 5JSRA 1F15A 3KD4A 1SPPA 2PQSA 1WD4A 4LPLA 1O59A 5FZEA 4EN0A 2UURA 4YYOA 3KVBA 3AJYA 2QQLA 3ZSJA 4IL7A 1VRH1 1QJZA 4WVMA 5DXDA 5A32A 2WNOA 4BA6A 1LTEA 4X8NA 4M0NA 5HI0A 1UYZA 2WZR2 4TXWA 3BN6A 3ROUA 2R0HA 1V70A 3UGGA 4JGZC 2QNKA 5EIYB 1EY2A 2XPJA 3WINE 3NWKA 3IDAA 2EIEA 5C3PA 3LIHA 2VOKA 1X33A 3N9OA 1SHWB 4CRQA 3N7MA 5FYIA 1HJGA 3MBWA 3MIBA 5IVBA 2ENRA 3HVDA 3O1TA 4CTEA 3THTA 2FZ2A 1KITA 3POEA 1AR62 1ENXA 2J22A 5FMOL 4IGOA 4FQZA 4HPKB 3S57A 1G7YA 4CUAA 2PHWA 4FPOB 3AYEA 5FZAA 3H9AA 1RUE3 3IZOA 2DWRA 1TME1 4CCMA 3VUOA 3MYXA 2ZX0A 2HWE2 4INDA 1G6NA 3WW1A 1EAH2 1XE7A 1LCLA 2OVUA 2ZEXA 4NN0A 2LS6A 3H3UA 5J37A 1EPZA 2SLIA 2B5HA 2VAUA 4P9IA 3ETQA 1XSRA 1LOAA 1ZA4A 3J9SA 3I3BA 2GN7A 1GQPA 3D0JA 1OPOA 5A32B 2C4XA 2DU1A 5FP9A 1QJEA 3WG4A 3RNSA 4UBHA 1Y9GA 2QQKA 2EALA 3I2GA 3HEIA 1J1LA 1WGPA 4TSVA 3OF1A 4MO3M 1DQ5A 3M4FA 2NMOA 2A71A 3PURA 1QJU3 1PGL2 1OI6A 4A44A 5E88A 1HJFA 5FMOS 4FQ4A 2RM21 2ZXQA 4WVZA 4ARYA 4BQXA 1F9KA 1LHOA 3UNPA 1JN2P 4HMZA 3AP9A 3OEBA 4XEZA 1FAYA 1OA3A 1VLNA 2LUWA 4OCTA 1QJX1 3RJRA 4AFMA 3NV2A 4BQYA 1RJ8A 2XUEA 4UW4A 1IHMA 1S0FA 4ATFA 2QUOA 2C26A 3I2JA 5F37A 3H7YA 2R16A 4URAA 1LOGA 1UQXA 1ULFA 2IXLA 4QQ2A 2RJ2A 4OHWA 1C1FA 2PHTA 1QY4A 1FV2A 2RJKA 1KRIA 4IV3C 4NHLA 3MHZA 5LK7B 2ADEA 2VL4A 2YC2A 1BK1A 1TZOA 3CL1A 4DY3A 1KQRA 4Q1RA 4KNCA 4XABA 3WD5A 2AACA 2RR12 3L2HA 4QX2A 2BVVA 1NA1A 3PMEA 2RS31 3AKRA 4OQ8A 3HAGA 5FR3A 1TQ5A 1CIWA 1N1YA 3SH3A 3M3OA 3ZFFC 1MVEA 2XBO3 4LHNA 3RYRA 2R061 3ALQA 1W05A 1GZ9A 2ZEYA 3C7EA 3JD72 3AL6A 3OYWA 5DG1A 3T09A 4WZFA 1PZ7A 1QH6A 3WVJA 3T2PA 1AR91 3TEXA 3ZVXA 1JS9A 3ACHA 3JBG2 4JHTA 2V72A 2OZ6A 2I74A 4AVVA 3VZJA 4FBFA 2DVDA 4YLZA 5FMCA 5SV5A 1W9WA 4Y22A 5KXBA 1RB8G 5HCBA 1UU4A 2K46A 5GZDA 1AX1A 1OOPB 3J4UH 5A3WA 3MUY1 4YG6A 1UMZA 1UZZA 5C71A 1G9DA 4NUBA 3WUCA 1UO9A 3N9QA 2D6KA 2QTWB 3VBUB 4FOVA 2JKBA 2BOJA 4DINB 2DUPA 1S0JA 3C2UA 3T08A 4GH4B 1MPXA 3J8F3 1A78A 1YJKA 3NAPA 4I02A 2FZ1A 3BCWA 4Y5TA 1KDKA 3GBFA 1XNAA 4Y26A 4S2DA 3T4HB 3THCA 4QT6A 2ZA9A 1RVF3 1CJDA 5EYYA 1WZXA 3WUDA 4BWOA 5KC5A 3GZAA 5C70A 3K4AA 3N9MA 3ZXAC 2ZMKA 5BNNA 4PI2A 1DGWA 2WINB 1UF2C 4A4AA 1WCUA 1OD3A 3LKJA 3B5LB 2J1EA 3WP5A 4LMFA 4CUGA 3QACA 1D2SA 2Y38A 1QOOA 1FT9A 4OMDA 5FZOB 1OQ1A 5T5JA 1QXRA 2WZR3 3VBSB 1YJLA 3SH4A 4HVQA 4XJWA 5GM0A 3ZYGA 3E6DA 1W0NA 1DGRA 3TYJA 3O1MA 1UYPA 1NLSA 2CWMA 5FZ1A 2YB7A 5JOXA 3ZKYA 4QB1A 5J36A 1JMUB 2RDRA 4K1ZA 2KA3A 4NHKA 1QQP3 1C28A 4TLFA 3J8F2 1BVP1 2NPIA 4YG0A 1WA6X 2HWB2 2CGPA 4CDQC 4DUVA 1UAIA 4GIQA 3TRSB 4CDQB 1K5JA 1VB2A 2QJVA 5FREA 4W6XA 5DUWA 5A3OA 5FPUA 2VVEA 3OUHA 3WNKA 1JZ4A 3PJQA 4P9XA 3RYKA 5C6CA 2Y60A 3AP5A 2EIBA 5F1RA 2EAKA 1SACA 1B35C 5GLWA 4LHKA 4E27A 1IGOA 2R073 1UX6A 1JOBA 3IB3A 1JXNA 2ZPXA 3A21A 1VBD3 5B4NA 1URXA 3K2OA 5BNNB 3SITA 1GICA 2K2SA 5JSPA 3DF0A 2VZQA 5A6QA 4R4XA 1RUC2 1ASJ3 4UFLA 4BDVB 3PUAA 4N53B 3HJRA 3JZVA 2XLGA 3QH7A 3RZZA 4FPHA 5ERLA 5L7OB 2VMDA 3NNMA 4QB2A 2WWUA 4RR3A 1XYOA 3VBOB 5BV6A 1V0AA 2XBO2 5CZKA 1UL9A 3NNJA 4ES9A 2ZGRA 1KGYA 2WNVC 4CU6A 2GAUA 4LKSA 2D6OX 4JGZA 5I8SA 3KV5A 1AXYA 4YM2A 2B9UA 4YW2A 4L99A 1D4VB 2VNGA 1NY71 4M3CB 2DF7A 3DECA 2BGPA 1OLME 3CJXA 4QM9A 4AW7A 2HWD2 1H8VA 2Q1MA 3V0AB 2DVGA 1PVC1 1W2AX 3POBA 4C0BA 1GV9A 4HLTA 4GH4C 4MXWA 4QGLA 4KWLA 4YWAA 3K46A 3ZFEA 2FDIA 2VXRA 1QU0A 1VRH2 1VMHA 1F4AA 1WW5A 2GN3A 3H8XA 3IPVA 5FZ8A 2J1RA 1SFPA 4A3ZA 1US2A 2VMIA 5ABJA 2BNOA 1YXWA 3WP4A 3K4DA 3CF6E 4UFJA 1LU2A 4HKOA 1JH5A 4HN1A 3KHBA 4M3CE 1WMXA 2PXJA 2B7YA 2DTYA 2YFZA 4HANA 2CYFA 5BNOC 3N7JA 1M4WA 1C8M2 2E51A 2WWSA 1VB4A 5GALA 5JZGB 1HN1A 3IPVB 1MS0A 2P5BA 2XJUA 1RMU1 5FDBA 4GZ9A 2MHFA 4LKFA 2C24A 2R043 4LO6B 5DZFA 5A33A 4ASMB 3AKSA 2QQVA 4CEWB 2PLV1 4C91A 3I7DA 5FQ0B 4K20A 5CIRA 3NJYA 5A7QA 3VB9A 1I1EA 4YRDA 4ZPIA 4UF0B 2ZGOA 3OBTA 5FZCA 2MEV1 2VVDA 3NKTA 1YFWA 3T1MA 5D8AA 4AVTA 1H8TB 2NZ9A 2HEWF 5BNOB 3KV6A 4AHXA 3W59A 5CKMA 3Q8FA 3VBHC 5C9AB 1DG6A 1PO13 1WA4A 1RHI1 4XXPA 2DCTA 3PVBB 4CZSA 4LULA 3PU3A 4YFWA 1MVQA 1KJRA 4QQLA 1UPIA 3TWIA 3RSJA 3POWA 2P37A 4D0QA 4AE2A 5C8CB 3BIEA 3SHRA 2Q4SA 5FO7B 2EXIA 4IEOA 5LEJA 2P34A 5GZEA 5LZ6A 2AH2A 4PDWA 4QPGC 1LJ7A 1OQEA 1H2LA 4MGZE 3UKVA 1AL22 3WG2A 4PDWC 5IVJA 4CPBA 2YBKA 2ZGKA 3ATGA 4GKXA 4PQQA 5FYHA 2RS12 4Y24A 1RHI3 3H1MA 5FWEA 1RUH1 1BEV1 3H42B 2CV6A 4ISQA 1F5FA 2WNUB 1NCRC 2CL2A 5A7PA 1IS5A 1VAVA 2QQOA 1CIYA 2AEYA 5LWBA 2G9FA 2VE1A 5FXXA 1PK6A 4Z2WA 5I8TA 1JZ8A 2GDFA 5FPBA 5FZ7A 3VKMA 3VDCA 1MS4A 1G86A 2J1TA 2WT1A 3RZGA 1FOD2 4UFIA 4Z1VA 1FI2A 3I59A 1W6MA 5KHJA 3K3OA 3IMMA 4E4ZA 2VNOA 5ANNA 3HNYM 2XJQA 1HB1A 3OJBA 2D44A 2PLV2 2BV4A 1VBD2 1E5IA 3UL2A 2LW8A 4E2SA 3H1YA 3VL9A 3CMGA 4P9LA 5KWRA 1ZZ9A 2AR6A 4GB32 4JHZA 4CCCA 1PMJX 3AL5A 3PVOA 4QX5A 5IK5A 4WVWA 3IKWA 3KF5A 4I0WB 2E7QA 1UXXX 3ZPYA 3U4XA 2WC2A 1WCDJ 3ZYHA 1D0HA 2HWF3 5JMOA 1Z7S1 4Q0UA 4Y1YA 1AR71 2H0VA 3O1VA 3KVAA 3ACLA 2CAUA 3K77A 2NN8A 5C4WA 4LTAA 2ZGSA 1W39A 2ET7A 4CU8A 2WS92 2I45A 3VN4A 1HXS3 1AJOA 2GC3A 3CHXA 1Q8SA 3KB5A 4RS5C 2MEV2 2VPVA 5JIAA 4CXWA 4NROA 3QLQA 4E9KA 1F31A 4RD7A 3UGHA 1OBNA 3UT0A 3P3NA 2WLQA 4I01A 5E16A 4IDZA 1H30A 1R64A 1ST8A 1WBFA 2QZ2A 4COZA 1W6OA 4QPWA 4R9CA 1AYM2 2RS33 4IV3A 4QKBA 4B3NA 4EN7B 1RJ7A 5FP8A 2WWJA 3POJA 5KHIA 2WO2A 4QXBA 1LR5A 4UI9L 5FYCA 3E5XA 1WUVA 3P1IA 3FHIB 3RYPA 2EAAA 2ZTNA 4XYXA 1E57A 2QQJA 4GD4A 2W1QA 4N90A 3T0DA 2CDPA 4XACA 1UPSA 3AMMA 1OH3A 2KM2A 3VHNA 5GKAC 1PO23 4JRLA 4B4RA 4QXHA 3WP3A 3AMNA 2W91A 4K21A 3WF3A 2BJSA 4N7UA 1AX2A 1O8PA 1NCQB 1XU1A 3G6JB 5FY8A 4FOYA 1DLLA 2UWAA 4I0AA 3HQUA 4LLOA 5D1IA 1F8VA 3POFA 4XBLA 5AFEA 3ACFA 2ZZJA 4AHZA 3VZOA 2HWE1 5ACA3 1JYNA 5DAQA 3OUJA 3ZN5A 4QHZA 5FUIA 3J7MA 4MH0E 4XF0A 1HV0A 1WLCA 5SV8A 3T2TA 5GLVA 1C4RA 3PUQA 4LO4B 5FZLA 3O1OA 2QQUA 1W0OA 1FMD2 1NY72 2XVLA 5EHDA 5FYSA 4XFGA 2AC1A 1QDCA 1W2NA 2VCCA 3DKWA 2OQ7A 4QQOA 3VBFB 3ZX7A 1H4GA 4BQ1A 1BK0A 1SDDB 2WNEA 3TN91 1Q8PA 4ARXA 3MIHA 4A7KA 4CDWA 3SEEA 5I8YA 2X5IC 1NE6A 3FWEA 4OHYA 1DQ4A 2IUWA 4PQ9A 4YW7A 1CQ9A 3IN9A 3VDAA 4QKFA 3FHQA 1A6CA 3N9PA 2WQ4A 4NPRA 4CDUA 5JR2A 3FC0A 2VW1A 2WAOA 1PVC3 4LOSA 1OA2A 1BXHA 1OLRA 4BB3A 4JV4A 1UKRA 2TNFA 5LBBA 3NNGA 4CVUA 1PO12 4A3XA 4LORA 4A7YA 2V5YA 1W3VA 1LGNA 4O9EA 3B00A 3DGTA 1W6NB 4IGQA 4HSJA 3LOIA 2WZ8A 3LDRA 5FPXA 1ZRIA 4D7YA 1W6PA 3JBG3 4N53A 5BNPC 4QD2A 3H0OA 4D6QA 1Z7S2 1ULEA 4DEVA 2G4IA 4UXAA 1PX3A 4CCEA 1FMD3 3KZ4C 3E6CC 1SFNA 2XHNA 2B39A 3AKQA 3SCHA 2Y6LA 1QEXA 2WS93 1HDKA 4MHRA 2WN2A 4MGKE 1QJX3 3LPFA 5C7GA 4IEXA 5BPXA 2ADDA 3LSDA 4H3WA 1VBB1 2WZPP 1MQTC 4U36A 4Q8LA 4AI3A 4CPBD 1JTZX 3LA2A 3D82A 3VV1A 1VMFA 3FBMA 4Y20B 4G9SB 4K7JA 1UY3A 1G9BA 4I3PA 4NHMA 5FXZA 4CP9A 2GC1A 3RI9A 4GALA 2H6BA 4FFGA 2Y6FA 2JDZA 4H14A 1B35A 4V2VA 2HWF1 4XJAA 4EWDA 1QNWA 2Y64A 4QX8A 3LDKA 1I6XA 5FP3A 2EXKA 2QE3A 1WW7A 1GFF2 2O8QA 5EXOA 2YZ4A 5DDJ2 3Q8BA 1DFQA 4QKNA 5A7WB 4NIDA 1UW8A 1Y43B 5FAXA 2DYCA 2Q8OA 3JB8A 1J1TA 4XFHA 4YVWA 3AK0A 1POV3 3KT4A 3LFMA 3KGLA 3UJQA 3WHTA 1D4M2 2FHRA 1TNFA 4BHPA 5G04L 4CEYA 5BY5A 4EYUA 3NV3A 4UFHA 1IQDC 3MW3A 1RUE1 3NMBA 3WW2A 1I9RA 1EAH1 1V6MA 3JBG1 1BZWA 4O7XA 4KMQA 2YPJA 3ZXFA 5CFDC 2VQAA 1XNTA 5B4XA 4I2OA 4P14A 3M70A 2VR4A 2YY1A 3PUHA 4FPYA 4AQ6A 4AVAA 1G9FA 2HWB3 4FTEA 5CAZA 1LGCA 2E53A 2VZVA 4BQ3A 5A6XA 1RUI2 4BK5A 2X5IB 3D8CA 3GZEA 4Q5OA 2KD7A 1XU2A 1FNYA 2QQWA 1CD3G 4D6RA 3R4SA 4J1WA 4KWKA 1IZ3A 2K0GA 3KM5A 3M2MA 5DG2A 5FLIA 1GNHA 3WV6A 1GBGA 3ZN6A 1OOPA 4XPVA 1DHKB 3A0KA 4JTNA 2BBVA 1PZ9A 2D6NA 1PIV1 2VO5A 3E6BA 1C5IA 1S2EA 1DQ2A 1O91A 3CJIA 4XVHA 1FPN1 4Q4Y3 2TEPA 1H6YA 1QXPA 1JYCA 1X36A 2QVSB 3FX3A 3AX4A 5DUVA 5EFUA 4HSLA 4EZHA 5B2GB 4NPMA 3WNLA 3AMHA 4XIKA 1VBE3 3EBRA 2XOMA 2HWC3 2WLPA 3GNEA 4LIUA 5FZ0A 4CCJA 4OHVA 4YZ5A 5E8AA 2WO7A 3ACIA 4GWIA 1LEMA 4CA9A 3BOWA 3Q9OA 3GM8A 5CA6A 5FZFA 2FCVA 5E1RA 1ZZ7A 4EZ4A 3ON7A 5JOZA 5E6HA 1JW6A 2A6WA 4LO8A 1AX0A 4HVOA 1PGW2 4OFGA 5FV3A 2JX9A 2A6VA 4DQAA 3HN3A 3RZLA 1W0PA 5K4LA 3WR0A 1ONAA 2WBKA 4BPZA 2D93A 3IM0A 3IIIA 1ACCA 1POQA 4JQRA 4KI5M 4E8CA 4CXYA 4Y1XA 4GJYA 3CO2A 4LNVA 4Z2AA 3RQ0A 3QD6A 5BUVA 2ZBJA 4TWTA 4FOWA 1OH4A 4IESA 4CCOA 2GALA 1BKZA 2E7TA 4NIGA 1GYKA 4XF4A 2XVKA 4XTMA 1TME2 1CAUB 1GZWA 1TEIA 5EYXA 3HBZA 3VBUC 3NO8A 1N1SA 4SBVA 1BEV3 1OHFA 3T4VA 2WS91 5FZ6A 3MICA 4QPGA 3NSTA 4L8QA 4UOJA 4AGVA 5KR7A 2I2SA 3DPRA 3AB0A 1S55A 5FZIA 4KU8A 3Q8EA 3MW4A 2Z42A 4XXAA 1ASJ2 3VD3A 1GLHA 3KSCA 4CUBA 4DOUA 2PHDA 3BTAA 4O65A 3KGZA 4DMIA 3BB6A 1IPJA 2GC0A 2MPFA 4GMP3 1UZVA 3APBA 5LY2A 2QDNA 3ZXJA 3A0NA 3D0SA 4FAHA 5I0RA 4MUVA 3O1PA 2VBBA 2Z5WA 1HN0A 5CU1A 3OSDA 1REDA 5T5LA 3OCPA 1C8M1 1DZRA 5EV7A 1UYYA 5FZ3A 4W4ZA 1KS5A 2WNVB 1O4YA 5IK8A 2KR2A 3RS6A 3R4UA 4RHV3 3FHAA 1PMHX 2A75A 4U2AA 2X5IA 4OUSA 5A1LA 4GULA 3WZ1A 4AI8A 2R1BA 4CSWA 3U37A 1UOFA 5K0UB 1WW4A 3LA7A 1SDWA 4LA3A 3Q8CA 4WM7A 1C5HA 1UWWA 2YDEA 3LEKA 1W2TA 2DCJA 2Q0AA 4AHYA 1RUH2 4JGYB 4AVCA 4KBBA 2CGOA 2ZHLA 4RS5A 4YM0A 3AZXA 4LT5A 2EF6A 2XKOA 2WNVA 3IT8A 4DNYA 1S0BA 5LEKA 3B9CA 4GWMA 3S0MA 3JCIA 2SBAA 2ZMNA 3HWJA 4FPLA 4META 1A8MA 5ABJB 2QKDA 1UU5A 4B7EA 5JUVA 3AC0A 1GWMA 3P6BA 4A7ZA 5CKQA 1NAEA 4PT6A 1ZBA2 4C1WA 5CKNA 1V9U1 1W06A 4IEVA 3JQXA 2GNDA 4X8PA 4IE4A 2PMWB 3PDQA 1N3PA 5FZKA 2LALA 4FAGA 2A1XA 2JDYA 4FTSA 3HBKA 1CX1A 4IEPA 1OFSA 4DXSA 1UZ0A 5A1AA 2HEVF 4MSVA 3S30A 1WWYA 2B42B 1LULA 3TEZA 2W87A 4QX3A 1H6XA 2F4LA 2YC4A 4HK9A 5DABA 2MNGA 2IZWA 1J3PA 1LHWA 2GP3A 3M3QA 4Y3OA 5CYYA 2ZX1A 4XUOA 5KXCA 1AR61 1SLTA 3D3AA 3VD4A 2RE9A 4J25A 4KG0A 4NRPA 4BU2A 2P3KA 5DAVA 4XE9A 1UYXA 4ET7A 1APNA 3BALA 3GBGA 1WCQA 2VG9A 1RMU3
chains in the Genus database with same CATH topology
3MDPA 3NKGA 4Q4V2 5JMCA 4M00A 2JEMA 1KS4A 1QXJA 5FRAA 1R1ZA 4BIFA 3DV8A 1RUD1 1LECA 2KXLA 3O7OA 2D5HA 3OY8B 1VJ2A 1H2MA 4W6YA 4B4QA 1O4ZA 3FFZA 1GKBA 1S2KA 1ZBE1 1NE4A 2WFF3 2YUEA 4EN6B 4W65A 1PGL1 3MLJA 4K1YA 1YUDA 3VBRA 1HQWA 4YW5A 2D40A 2PYTA 1BEV2 1NYWA 4AFDA 5J09A 5F5QA 2VW0A 1SBFA 3QH6A 4O9GA 4URTA 2HWF2 4GB33 2XG3A 4P9YA 5LRSA 2FMDA 1QJY1 4AQTA 1VBE1 5GJ6A 4JDOA 3D6EA 2P17A 4IV1C 4ZU7A 2XL9A 2WT2A 1GSLA 4B29A 1YLLA 4Y1UA 5JIUA 1RUC1 3IDCB 4GA9A 1RUF2 4DB5A 1OA4A 5GLTA 3V65A 3W9AA 2E7AA 1PM7A 5D8AC 4XJZA 2RS32 5T55A 5K7PA 5L7OA 1V9U2 5EWSA 5J98B 1N3OA 3VBHA 2ES3A 4XHBA 3GBWA 4FP2A 2GSYA 4CDUC 2ZKNA 4XFFA 2BYVE 3N7KA 4IV1B 5CFCC 2R072 1ZZ8A 3KQRA 1V6JA 4D7SA 1H1IA 2YGMA 2O1QA 2JICA 2JE9A 5I91A 1AHSA 4DPNA 2JENA 2QCSB 4OZXA 2WSUA 4C0HA 1XNCA 2CY6A 3TN92 2EVXA 4NR1A 1WD3A 3OGGA 4ZU4A 4FT8A 1AR82 4H55A 4YW4A 1SLAA 1SMVA 1DGRN 2CAVA 4NO4A 1VBC1 5FOBB 3S6PA 4N43C 4IEWA 1LB2A 5KHGA 2AUYA 3VLBB 3B3QE 4Q0VA 2UYBA 1FPN3 4COVA 4RSUA 3IDBB 4S2GA 3V0BB 3TOJA 1OQDA 4ZKTB 3KLSA 4RL7A 3GF6A 4KG8A 1K5MC 3MW2A 4CP2A 2BUKA 1VBB3 4FPFA 1PIV3 4BOWA 4QPIC 2DV9A 4JCKA 3TB0A 4OUMA 1ULCA 4L11A 1ENSA 1NQJA 1BBT2 1Z0HA 2R32A 4IQPA 3VL8A 1COV1 3O0XA 3VBUA 5AC91 4R52A 4Z82A 2ZGLA 2XKPA 4G4FA 4LBNA 2AYHA 3HMYA 2Y0IA 3VZMA 4CDUB 1X8EA 4N43A 4RFT0 2W08A 3RDIA 3B93A 4YVSA 2GNTA 4GWNA 3ZN6B 2ZGUA 1DGLA 4IEYA 3ILFA 1AYN3 1Q3EA 2WJSA 2HWD3 4FPGA 4OULA 4I3GA 3O12A 4V1PA 3WT3A 4D69A 1X7NA 1XNBA 3O0WA 5I93A 2HWE3 1ULGA 3ZFGB 3FLTA 3X29B 1NA1C 3MPPG 5BXXA 2RHPA 4MGYE 2OW4A 3OBRA 1QJU2 2YMZA 5CADA 1VR3A 4AQSA 3ZO0B 5H9SA 5J3UA 4B7KA 3WG1A 1S1AA 1R093 1S0DA 4EWAA 1UD1A 3M3IA 1H4HA 1AR93 1TNRA 3WG3A 5AC93 2ZGNA 3M3CA 2JD4A 4XZPA 4TZDA 1DQ1A 5F9TA 3LGRA 3PNAA 1AYN2 1CAVB 1R1A2 1D4M3 1KXGA 1SLIA 4WM8A 2VUJA 1F5JA 1RUE2 4Y4YA 1XNDA 4PJYA 1SEFA 3AKPA 1MQTA 1YNAA 3WDXA 1RUI3 3ECQA 3ZSMA 4PBOA 2FBEA 3ZYPA 1UIJA 3DL3A 1LENA 1VIWB 3DPRB 4D94A 1DBNA 5I0UA 1F2NA 3I2DA 3U0ZA 4ASLA 2GNMA 3ELNA 1OOPC 2PHUA 4XDQA 1WMFA 2XJTA 2VW2A 1S0IA 3VBOA 2XJSA 4P9JA 4DS0A 1SCSA 3TN93 2ILMA 3RI8A 2B46X 4N53C 4OVEA 1Y7BA 2EXHA 2IC1A 1CX4A 3ZFFB 3H8UA 2PAKA 4JGZB 4UW5A 4C90A 1ZBE3 4W6WA 1COV2 3N7LA 1RINA 4ISRA 1CGPA 1LHUA 2I07B 3WP6A 4LHLA 1MEC3 4AEDC 3DUIA 1Y9QA 1C8M3 1WMEA 1MZFA 2ZGMA 4Q4X3 4B4PA 3MGUA 3CJIB 3WDYA 2DUOA 3IDEA 4EN9B 1RC6A 2ZOEB 1HV1A 1QMJA 1AYM3 3WDVA 4Q4W2 1MQTB 2P3JA 4WZCA 4RQPB 5KBFA 1BVVA 1WCKA 3RRDA 2DURA 1MR5A 4XFIA 5J96B 4L97A 2B45X 3FLPA 5JZGC 5CVRA 1PO21 5GZCA 2HYKA 3SCFA 1AR73 4XFCA 1ZYBA 3AZWA 3SNMA 2D6LX 5A3LA 2XB6C 4WM7C 3JD73 5CG9A 1ZBE2 2R30A 4AEJA 4JTOA 4MX3A 2C9AA 1RMU2 2NQYA 4QQPA 1YI7A 3EXUA 1AZDA 3N36A 4N9IA 3N35A 1CAWB 2D6MA 2VMHA 1YIFA 1FOD1 4XTPA 1H9WA 5BNOA 4LR4A 5KC6A 1AL23 2VMGA 3FLRA 3NJZA 1RUJ1 1O3QA 2OA2A 3KT7A 2JG9B 1HRI2 4ZU5A 4GH4A 1GQHA 1XE8A 1N1TA 3VKNA 5J7MA 3GHMA 1LKNA 4ZXKA 3LZZA 3FBYA 2OZJA 2ZJCA 3WX5A 3VZKA 1YFYA 2VY0A 4MV2A 5GLZA 3EHKA 1C1LA 3ZFEC 3IIAA 3INAA 3VZLA 3ZXGA 2PN5A 3E5QA 3JU9A 1Q8QA 3NL1A 4YW1A 1JUHA 1GQGA 2HWD1 3C3VA 2NP0A 2JJ6A 4F3JA 1CESA 5K8SA 1HW5A 2WFPA 3LOBA 2JG9C 2TBVA 3B69A 2JXAA 3AFKA 1IPKA 2R041 4RR3C 1OSGA 1GZCA 1NOVA 1HRV2 1U5ZA 1H8TC 2D6PA 5DUXA 2ZHKA 4RGAA 1R092 2A3XA 1AR63 3IBMA 1N1VA 2CTVA 1RUH3 5C8CC 1S0EA 1FYUA 1NZCA 1V6NA 2LTNA 1MACA 2MEV3 1MS1A 4JDMA 3HIFA 4E2GA 2VOXA 4JGYA 2PHFA 1IOAA 2OUHA 3FUQA 1O7FA 4LBQA 5FPZA 3MZHA 3ZXEA 4AWDA 2NM1A 1W6QA 4HN0A 2BFUS 2ZAAA 4PIYA 5GZGA 3POYA 3HT1A 5IK7A 4Q0SA 2K9ZA 2WSVA 1ENRA 2RMU3 5LRRA 3UKTA 2RJLA 3VBFA 2Y0OA 4CEWC 5JPNB 1AR72 1VBC3 3B9IA 2YGLA 1RUOA 5FLHA 4FTBA 2XUMA 1T6GC 3JB4C 4FPEA 5T5PA 1ZZBA 2AREA 4C1XA 3KMHA 5AFBA 4Q1PA 1U12A 4QPYA 1VBA2 1V6IA 1PMIA 4LA2A 1DYKA 4QPIB 3VBSA 2R042 4KWJA 4YZ3A 3AYAA 1H0BA 1QGLA 1PK6C 1Q56A 1XNKA 2YYOA 2IWGB 4MXWB 1HLCA 4RGGA 1QJY2 3ZXLA 4AHWA 2QDRA 2P2KA 1W6MB 4KGQA 2ZACA 3PVEA 2W39A 3CNAA 3E5UA 3R0RA 4AXOA 1QOSA 1NCRB 2D3RA 2A70A 1O4TA 2CNAA 2AENA 1PK6B 1UZYA 2IXCA 5BNNC 4WV8A 1EPWA 4Z07A 3U11A 3EQEA 3N4MA 4FPJA 1IS4A 3ZFFA 4CP0A 2UY9A 1R082 5FO9B 5FLJA 5T52A 3VBOC 5JI9A 1V00A 2HWC2 4K6BA 3HN1A 2ZZQA 1HRV3 1IKPA 3V0BA 3VBRB 1MEC1 5FQ0A 1RHI2 1KFUL 1SBEA 1MS9A 4AFBA 1LESA 1ZRFA 1VALA 4FCAA 5CB7A 5L19A 3NW4A 2WKKA 1VAKA 5DZGA 3NV4A 2XL7A 3OPZA 4XQWA 3KT1A 2PLV3 4JAAA 1LOCA 2DVAA 4QPGB 1WW6A 4OI2A 4XF1A 5C9AA 1AXZA 3VKLA 2IFRA 2C5DA 5C4WB 2CGNA 3J8F1 1FOD3 1U0AA 2WZR1 1AR81 4QM8A 4WM8B 1NXD1 1PIV2 4LUKA 1HQLA 4ES8A 4FXGB 4LBOA 1JHNA 4COWA 2JG9A 1HQNA 3M3EA 3W58A 2ZABA 3MIEA 2BWAA 4FXKB 5DDJ1 5H9RA 1ZNPA 1C57A 3B02A 3FJSA 3TBDA 1LU1A 1CR7A 2A6ZA 4XMIA 3WDUA 2DVBA 3VHPA 1CAWA 4BCUA 2XLAA 1SQ4A 3D5OA 1O3RA 5FTTC 1VBA3 2C1FA 4XJ9A 2UYAA 3ASIA 3WHUA 4LBQD 4F8AA 4KL1A 1FPN2 2A73B 1LOFC 1NG0A 4RHV2 4KQ7A 2FQPA 1QWRA 1I3HA 2D3PA 3IWZA 1TMF2 4AEMA 1REFA 1XRUA 4HZFA 3HQXA 1PNGA 3FFQA 4AFAA 3ZSKA 1CAXB 2B8MA 1QOTA 3URFA 4R4ZA 2RS51 1WCSA 4IETA 1RUJ2 4F83A 3GALA 1AR92 1MEC2 4MLOA 1POV1 4I09A 1R083 5HCAA 1W6QB 4P5HA 2HWC1 1SCRA 4S2HA 2HEYF 3POSA 2ZGPA 1ZREA 1R091 4FO9A 2WNUA 4FSJA 5JVVA 2A6YA 3M7AA 4Q4Y1 4HETA 3JQWA 4NOTA 1LRHA 1EP0A 2BQPA 2ZKLA 3RWNA 1XYPA 1U5XA 4LBQB 4PBPA 3PJYA 1R081 2NYYA 3LWCA 3O14A 1DDLA 2ZGQA 3MI8A 4XHXA 1OFNA 2ZAHA 1CVNA 2N7GA 5F6KA 1QDOA 2E9QA 3QBQA 4N7IA 2GZWA 4PLNA 4XW3A 1LHNA 2YHJA 1FMD1 2E6VA 3BPZA 4UW3A 4NVPA 1OMIA 4IV1A 3KS7A 4Y1ZA 4K9SA 3USUA 1ND2B 2ETEA 2XWJB 2D98A 4XILA 4X6QB 1M06G 4G3YC 1R1A3 1VBA1 2VOWA 3ZSLA 4IEUA 3GHNA 4JDNA 5CFDA 4M3CA 3E97A 2GU9A 4AGGA 3U07A 5KHHA 1H2KA 4GMP0 1IS6A 4HFSA 3K48A 1H1AA 1ND2C 2GMEA 5DDJ3 3H3ZA 2JE7A 4H7LA 4LEJA 5JWPA 1ZVFA 3MEPA 1S2BA 2G9GA 4QHBA 5AVPA 2VUAA 4TYSA 2BWCA 4HK8A 5CFDB 5H9PA 4Q4W1 1AYN1 3SH5A 4CDXA 5ACA1 1BJQA 3WQ0A 4CEYC 4RQPC 1UKGA 1RUC3 4Q0QA 2D43A 2BTVC 3AZYA 3OYWB 2PA7A 1Q43A 3I54A 1ZM1A 1QJX2 4K8FA 1DU3D 4AI1A 4PIXA 1ENQA 2Q1ZB 3AP7A 4Q4X2 1COV3 5T54A 4AK3A 4OHXA 2ZS6B 1MZ6A 4IXLA 4LLFA 1PVXA 4FBFA 2YC0A 4LBLA 1NLRA 2BNNA 2RS52 4COUA 3WOGA 1W2UA 1Q8VA 3P3PA 1QNYA 4MGIE 3BODA 3HT2A 1X50A 3RMYA 4CEWA 2ZX3A 3PLQA 4HT1T 1HXS1 3TNQA 1PNFA 3FZ3A 4HVRA 2ERFA 1U5YA 2F6BA 3GYDA 2D5FA 2Y26A 3ZMOA 3VKFC 2VGDA 1DIWA 1J3QA 1GNZA 2D3SA 3AP4A 3T1LA 4RR3B 3RPQA 4QXKA 1VAMA 4AYUA 4DRVA 3LAGA 4FVVA 4XBQA 4Q8KA 1LOBA 4PCRA 4EV0A 3MPBA 2EXJA 4SLIA 1CPNA 5CNAA 3VBSC 4YZ1A 3RMXA 1GR3A 1YCIA 5JI7A 1A3KA 2YXSA 1BBT1 4WVMB 2DCKA 3PMSA 4MZUA 4AQ2A 1RL3A 2WT0A 3AFGA 3ZDSA 2BW8A 1NQDA 4P9GA 1VBB2 4Q26A 5L73A 1HRI1 2WA4A 3I59B 3THPA 1ALYA 4MVTA 2X29A 5T3NA 1OPMA 3AZZA 1B35B 4WBBA 3V56A 2BEOA 5JLVA 1BMV2 2OPKA 3MLLA 3UJOA 4YGEA 4GQ7A 5FCCA 4KGGA 4S2FA 4Q4V1 3OY8A 4FPKA 3WW4A 4ORFA 3CEWA 3WDWA 5BNPA 4Q29A 3EO6A 4YNIA 1UCXA 2XHKA 1IQAA 5C8WA 1AVBA 3FE5A 1LHVA 1RUG2 4GB31 4XBNA 2RS11 3ES1A 4YZ2A 3TAYA 1H9PA 2QFEA 1WBLA 4ONUA 2DCZA 2VULA 5CBLA 3RG0A 2OUJA 1ND2A 2WFF1 1AL21 3BIWE 1J58A 3AXEA 3KCYA 2R6QA 2RR13 1HKDA 1CN1A 1C3HA 2XWBB 3DN7A 3AMPA 1AYM1 4RHV1 1LGBA 1DZTA 2PTMA 1D2QA 3KCCA 3R4DB 1LOEA 5BNPB 2O8OA 2Q5TA 4Q4Y2 1U5IA 1MS3A 1RUF1 1SBDA 1NCQA 5EJ3A 2QZ3A 4Z8BA 1UN1A 2LM3A 1ZBA1 4FOQA 4QU2A 2GH8A 4BE3A 1MS8A 1EV12 1YFXA 1KJLA 4GMP1 2R0FA 3R6SA 4J1XA 2XJRA 3NVCA 5HCFA 1ZBA3 4YVWB 4DZGA 5AVAA 2GMMA 5K9YA 4K40A 3AM2A 5JR7B 2F4PA 2PHXA 4N9HA 4YSFA 2XJPA 1LEDA 2V73A 3MIGA 4KH9A 1QJU1 1PZ8A 2NMNA 3CLPA 2PFWA 4OLLA 5IUQA 1YHFA 2RR11 4BZ4A 2RM22 4XOGA 5L36A 3G7DA 1RVF1 3VBFC 4FPCA 1D4M1 5KXEA 4XJUA 4Q4V3 4P9WA 4D7TA 5BYNA 1BBT3 1ZZ6A 3AJZA 4ITCA 5FO8B 3V0AA 3CU7A 3I4IA 4A2UA 4EN8B 4EROA 5TSWA 5IK4A 1ASJ1 1GANA 3O5SA 1X82A 3ZMNA 2WNUC 1G9AA 3LCPA 4BIOA 4HL0A 2JECA 2JG8B 3MLKA 1H2NA 1NXMA 1S0CA 4YVSC 2JG8C 1DZQA 3L2YA 3MF6A 4NWWA 4RA0A 4OI1A 2WQZC 3B7MA 3QCWA 4GKYA 2XH6A 1PGW1 3MIDA 5CG8A 4L2NA 4AI0A 5BNQA 2P3IA 2HKXA 3WDTA