5DUVA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
NPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duvA00
1W6OB 1G9BA 1AX1A 3ILFA 1Q8SA 5E8AA 2AREA 5DXDA 2NN8A 1TEIA 1IS5A 4K20A 1ENSA 2WT0A 3JU9A 4FPCA 4CRQA 3PMEA 5DZGA 1HKDA 3PVEA 1FNZA 2ZZJA 1GZWA 1HLCA 2JJ6A 5L73A 1DIWA 1N1TA 4C1WA 1IS4A 3U4XA 2UWBA 1VALA 2D44A 2PHTA 4ASMB 3AJYA 5GZCA 1DQ5A 1SCRA 2JKBA 4Q8KA 3AZZA 1UZZA 3IPVA 5T5PA 2EIGA 2EALA 1WD3A 5GLWA 1LHUA 2YROA 1FAYA 2A71A 4Q27A 4YLZA 1DHKB 1QNYA 3WCSA 3TAYA 4AGVA 4DFSA 2GMMA 2VY0A 2WQZC 4GKXA 1SLBA 3NV1A 4Y24A 5F5QA 4CZSA 5CAZA 1DQ2A 1Q8QA 3AYEA 3N36A 5SV8A 3ZXFA 4M01A 2AYHA 3ZXEA 4YM3A 1A8DA 2EF6A 1D2SA 1FV3A 4Q2FA 2PHFA 5DUWA 1WLDA 4Y1UA 2A7AA 4PF5A 2A75A 4GWMA 1BKZA 1OFSA 1DQ4A 4YW2A 2NYYA 1PZ9A 2ZGOA 2YMZA 1SCSA 1IS3A 4FP2A 1MR5A 3VKLA 3V64A 3VKNA 2TEPA 2ZMLA 1CQ9A 4AYUA 4BLIA 2WSUA 1JW6A 2NMNA 5JLVA 1KDMA 3WG3A 2A3XA 1MS9A 1W6NA 4XE9A 2W39A 3N3HA 1G86A 5FREA 4FPJA 5T52A 2ENRA 1R1ZA 3FLTA 1WW7A 1YO8A 3RQ0A 4Z8BA 1GBGA 3A0KA 3FLPA 3AP7A 4YZ2A 4AVVA 3OGGA 5E89A 4XYXA 3VKMA 2AUYA 2VH9A 1UPSA 1FYUA 1MACA 1CPNA 4FOWA 3AZWA 4Q8LA 1GZWB 1G9CA 3SISA 1LENA 1KJLA 1APNA 2OUJA 4P9YA 1B09A 4M3CB 1QDOA 1NLSA 2GMEA 1MS5A 2AR6A 3POYA 4LBQD 2ZA9A 4GKYA 4K21A 5DG1A 2PHRA 3AJZA 4FP3A 1QGLA 3MPPG 1H9PA 5DG2A 4IQPA 3APBA 3SH5A 1CVNA 3I4IA 3WUCA 4Y1VA 2ZKNA 4UW3A 5HCFA 1Q8PA 3AK0A 3FUQA 2P3JA 4D69A 3V0BB 4FPEA 4YGBA 5IK4A 2ZBJA 4WV8A 4BPZA 3M2MA 1AXZA 2GNMA 1LOFC 4Q1RA 1GYKA 1C4RA 3WDYA 5H9PA 2A70A 2A6YA 2H0BA 5JOZA 3T1LA 1BQPA 2ZHLA 1OQ1A 2DVAA 4LBJA 3GALA 4YM0A 3I8TA 4YZ1A 4DS0A 3BTAA 1V6JA 3FLRA 3LSDA 1LHWA 1LULA 1AXKA 2C5DA 4WVWA 1YIFA 5IK8A 2GNBA 1LGNA 3VKFC 1LOEA 1YRZA 2ZMNA 2GNDA 4YFZA 1HQWA 3O12A 4OZXA 3W59A 1LOGA 4R9BA 3V0AB 3B9CA 3ZYPA 4HANA 4TZDA 3SNMA 5GZGA 1KJRA 1BYHA 5CNAA 3WUDA 1V6KA 4XBQA 1GZ9A 1LHNA 2RHPA 2CYFA 3O5SA 5FRAA 2ARXA 3USUB 4ATFA 4JCKA 4YG6A 3R4SA 1N1YA 1DQ6A 4GXLA 2DTYA 1ZA4A 2CL2A 4F83A 1LOFA 3B69A 4YW1A 3OBTA 4KBBA 4U2AA 1LODA 3FUOA 4FPGA 3ZSJA 1G9AA 3O0XA 1IS6A 4XJZA 1AF9A 1ZM1A 1S0IA 3INAA 4R9DA 4LBQA 1WW6A 3ZXLA 1JBCA 2D6KA 4RA0A 1AVBA 4YFWA 4L8QA 4XJ8A 1QOOA 1W6MA 3WDUA 4XJWA 4Y1XA 4YZ5A 1CPMA 1ENQA 1LESA 1VAVA 4NO4A 1S0EA 4Y22B 3ZPYA 4ATEA 5KXEA 1LOCA 2ES3A 1DLLA 1HDKA 2UURA 3HN1A 5HCBA 4BOWA 5EXOA 2WKKA 3KM5A 3OYWB 2OVUA 2ZHKA 1QNWA 3POWA 4AVTA 4ISQA 4K1ZA 1G7YA 5GM0A 5T54A 3LCPA 2BQPA 1JN2P 1N3QA 2DVDA 1MVQA 3AP9A 1V6LA 1SLAA 1YYNA 5DUUA 1GV9A 2D6NA 4DQAA 4XXPA 2ZGLA 2GMPA 1WBFA 4Y1YA 1MZ6A 2R0HA 4XXAA 3T2TA 3WLUA 3IM0A 3O0WA 2XG3A 2DTWA 2JE7A 1CONA 1QMJA 3AP6A 5GZEA 3ZXKA 2WLQA 3UL2A 3SH3A 3ZXJA 4TYSA 4PQ9A 1LGCA 3AZYA 3SLIA 1AX2A 2VW1A 2DYCA 4Y26A 1V6IA 1PZ7A 3M3OA 2E51A 4WVVA 5DZEA 3OY8B 2E7QA 2R49A 3A0NA 2ZGPA 3FFZA 4FOQA 1S0JA 5GZDA 3D6EA 3RMYA 1G8WA 3WV6A 5JOWA 2A6VA 4AVSA 2D3RA 1WLWA 1Q8OA 4LBQB 3IKWA 1GZCA 4XDQA 5DZFA 2WT1A 2A5ZA 2ZMKA 2ARBA 1SBDA 5KXDA 2B7YA 5HCAA 2NM1A 1N47A 1S1AA 2OW4A 3OPZA 1Y7BA 1C1LA 1JYIA 1WLCA 4MYEA 4P9WA 3VUOA 1S0FA 2ZABA 4SLIA 1GNZA 1ULDA 2ZGKA 1DYKA 2D6LX 1UZYA 1WW4A 1BJQA 1CJPA 2AH2A 3H0OA 3WG4A 4ZKTB 5JOYA 1AJKA 3JUUA 2R1BA 4JRAA 2ZGUA 3IPVB 2AGSA 1W6QA 2WNEA 4FPOB 5T50A 2UU8A 4LBKA 1DQ0A 3MEPA 3WOGA 3OBRA 1JYCA 4XBNA 5KXCA 3ILRA 4PBPA 5IK5A 1Z78A 3AYCA 2D6PA 1V6NA 5T5OA 1AX0A 1DYPA 1SLLA 4XHBA 1ENRA 2PHUA 1LEDA 3ATGA 1UMZA 2NP0A 1V00A 2A6ZA 2PHXA 3PVOA 2P3KA 4FVVA 1SACA 2VW0A 5DUXA 2EXHA 1MS8A 2Z42A 3AX4A 3MW2A 1BXHA 2ZGSA 4XJAA 2D3PA 2DU0A 1S0GA 5H9SA 1PZ8A 2E6VA 5EYXA 4U36A 5EWSA 4Y20A 1W6PA 4JC1A 2JD4A 4M00A 3BIWE 5H9QA 5GLTA 4ZXKA 4XBLA 3AP5A 3W58A 3DUIA 1W6OA 4GA9A 3HR9A 5IK7A 2VUAA 1W6NB 3M3EA 1H9WA 1MS3A 4BMEA 1SFYA 2R16A 1S0DA 4PCRA 3RSJA 2JECA 2DU1A 2YXSA 1Z0HA 3L2YA 1QOTA 2ZGTA 1CN1A 2VW2A 5JDBA 4XOGA 2D43A 3NWKA 2WSVA 3AFKA 1GSLA 2C9AA 2HYKA 1KDKA 2ZGMA 4LBLA 1N1SA 3VKOA 2A6XA 2DUPA 4XMIA 3UK9A 3WG2A 1UKGA 4AWDA 2WJSA 2WT2A 2D6OX 3B01A 2UWAA 3SH4A 3WNXA 5JVVA 1CIWA 4UW5A 4FOVA 3UJOA 3N7MA 3AYDA 1KQRA 1LCLA 2V73A 1QOSA 3N7KA 1W0OA 3R4UA 1URXA 4HL0A 2LTNA 3WVJA 4XZPA 4Y1ZA 1JUIA 1VLNA 3D5OA 3N35A 4YZ4A 4BM8A 2YY1A 3GNEA 4K1YA 4XJ9A 1MZ5A 1LOAA 1FV2A 3T1MA 3KQRA 1U0AA 5JOXA 4H55A 1DQ1A 4XIOA 1IKQA 4LBOA 4YG3A 1EPWA 4Q1PA 5T5LA 4FPLA 4M3CF 3WHTA 1GLHA 5GLUA 2Q5TA 3VV1A 1W6PB 1XQNA 1LOBA 1MS1A 1UL9A 2EAKA 2LALA 3NV2A 1QF3A 5LK5A 1MS0A 3AZVA 4R9CA 3TB0A 2AENA 1CESA 4ITCA 2D7FA 3D4KA 2D3SA 2OUHA 1WBLA 2PELA 3AXEA 1C1FA 1A3KA 1QU0A 2I2SA 2JDZA 2A3YA 3B3QE 1GNHA 1RITA 4LBMA 1JXNA 1WUVA 4FQ4A 4XIKA 4AGRA 4C1XA 1LGBA 1ONAA 3CNAA 2EXIA 3IN9A 3POSA 4YW3A 2YZ4A 3DGTA 3ZSLA 3BOPA 3C2UA 4M3CA 4YM1A 3BODA 4FPYA 3QCWA 4FQZA 1VIWB 5AVAA 3WG1A 4R9AA 2GNTA 1BZWA 2SBAA 3RS6A 3NV4A 4YGEA 1F5FA 4YGDA 3HMYA 4LBNA 4GALA 1WCSA 1UN1A 2DVBA 3ZYRA 1ULCA 1O4ZA 5H9RA 1CR7A 2W52A 4W65A 1VAMA 3WHUA 3V0BA 1W6MB 1D0HA 1QDCA 1V6OA 2P37A 4ISRA 3B00A 4XHXA 1RIRA 5F9TA 2DUOA 4UW6A 3OJBA 2VU9A 3NV3A 1DZQA 1F9KA 2NMOA 1FNYA 4BMBA 3WDWA 2GN3A 4P9XA 5IUQA 1GANA 4M3CE 2ZGRA 1Q8VA 2E7TA 1AJOA 4CTEA 1S0CA 3PVNA 2D6MA 1H30A 3ENRA 2UWCA 1C57A 1X50A 1N3PA 4FPHA 3RMXA 1HQLA 5BYNA 2VXRA 5CA6A 1DGLA 2DV9A 1F31A 4PBOA 4UW4A 4YW4A 3UJQA 3RRDA 1N1VA 1Q56A 2ZGQA 5T5JA 5GJ6A 3MW3A 3V0AA 3ILNA 3R05A 2CTVA 2FHRA 3A4UA 4XTPA 1DBNA 1JOJA 1N3OA 2A6WA 3ZSKA 3SITA 1MVEA 2R0FA 2CWSA 4FPKA 1KRIA 2CY6A 4BQ1A 1W0PA 4DRRA 4YZ3A 3USUA 1YI7A 3QLQA 4P14A 3Q9OA 1UX6A 1OKQA 5GLZA 4YG0A 5CBLA 4DPNA 4WZFA 3N7JA 4I30A 3WDXA 1G9DA 2DVFA 4XTMA 5KXBA 2ERFA 1I1EA 3ZSMA 4NOTA 1MS4A 3IMNA 3LSEA 3ZVXA 1DFQA 1LJ7A 5GZFA 1O4YA 2CWMA 4GWNA 3WDVA 5JMCA 3ASIA 1FATA 1LEMA 1LTEA 1I3HA 1SLIA 1YXWA 2W68A 2GDFA 3M1HA 4Y22A 5E88A 2SLIA 3WZ1A 2JE9A 2KM2A 3O0VA 2ZGNA 2EXJA 2V5YA 1A78A 2YV8A 1LU1A 2ZAAA 2DURA 3OYWA 1AXYA 1UAIA 2ZHNA 3M3QA 1S0BA 2FMDA 2P2KA 3RG0A 1LECA 1ULGA 3AXDA 3WCRA 2CNAA 1LU2A 1V6MA 1W6QB 3AYAA 5DUVA 5T55A 2GALA 3V65A 3N7LA 1QKQA 1IOAA 1FX5A 1G9FA 4FOYA 1SLCA 5IT6A 5GALA 2PHWA 2EXKA 1ULEA 1SBFA 1WW5A 1WD4A 2ZACA 1J1TA 1KITA 3AP4A 3PJQA 4YM2A 2XB6C 4FPFA 1JHNA 2W08A 3M3CA 4Q26A 5GLVA 4YGCA 4BLJA 2DUQA 3MW4A 4DRVA 2GN7A 1SBEA 4XMAA 4YW5A 1LHOA 1RINA 1GKBA 1LHVA 1ULFA 2ZHMA 1GICA 2G4IA 3AZXA 4XILA 5CB7A 3WDTA 4XJUA 2P34A 1SLTA 4Y20B 1NXD1 4RL7A 2DVGA 2E53A 3OY8A 2NZ9A 2R1DA 2DWRA 1IKPA 5EYYA 1AZDA 2P3IA 4AGGA 2A3WA 3FBYA
chains in the Genus database with same CATH superfamily
3HN3A 5IAXA 1ZZ6A 4IV1C 3T0DA 5G04L 1ULPA 2QQUA 2E33A 2VZUA 3J7NA 1ENSA 2WT0A 4FPCA 3M3IA 3P5BA 3H1MA 5DZGA 4B1MA 2CAVA 2XLFA 1XE0A 4IEWA 3MPBA 3TEYA 4NIDA 4IE6A 1ND3B 1N1TA 5F32A 4YW6A 4CEWA 2P1BA 2R041 3NNLA 2UWBA 4IE4A 1VALA 2PHTA 4LK7A 1DQ5A 4D0QA 3J7MA 1UZZA 1VRH2 3IPVA 3I3DA 4HLTA 1OA2A 1AR82 3GZAA 4KWLA 4OMCA 4PJYA 2YROA 3SEPA 3WUDA 4YLZA 3WCSA 4BQ2A 4GMP3 1W06A 4DFSA 3PMSA 1J3QA 4GKXA 4Y24A 2X05A 4QPWA 1NQJA 4WM8A 5F5QA 1DQ2A 4CDUB 3N36A 2HWF3 5FYTA 4M01A 1A8DA 1X8MA 4Q4V2 5DUWA 1WLDA 5BNOA 2H0VA 3GBWA 2WIIB 2V5DA 3OPTA 3RZKA 1JH5A 5A7NA 4IV1A 1OFSA 4XFFA 1VRH1 2G9ZA 4I0AA 2YMZA 2YDEA 1QJU3 1SCSA 4FP2A 5FK8A 3TWIA 1AR81 1TZOA 1VMHA 2VOXA 2X5IB 3RYKA 3V64A 2TEPA 1UIJA 2ID4A 2BNNA 1LNSA 1STMA 2PN5A 4Q0UA 2A3XA 1UY1A 3LA7A 4Q4V1 4XQ4A 2WS92 1GWLA 2Y60A 5CIRA 5T52A 2YFZA 4OHZA 2ARCA 4E2GA 1R1ZA 4Z8BA 4TLGA 5FZ4A 1GBGA 3A0KA 5LA9A 4YZ2A 4YVWC 4XYXA 1V9U3 2AUYA 2RM22 1O4TA 1UPSA 2ADDA 4OMDA 5FMOS 5FZHA 1CPNA 4Q8LA 2O8QA 2KXLA 4AFDA 4EWEA 3SISA 1LENA 3K4AA 1GZTA 2XVLA 4XF3A 3RWKX 2OUJA 4P9YA 4A4AA 1O3SA 1QDOA 4XW3A 4L2NA 4D3WA 3HPNA 1QJY3 1SZBA 4LBQD 3TN93 3JD72 2WS91 4FP3A 4GJZA 1ZZBA 1QGLA 2K46A 3MPPG 3ZYIB 3N9LA 1M4WA 5FWJA 1OPMA 3SH5A 4OI0A 1CVNA 3I4IA 4RS5A 3ZDSA 4MXVA 2WYSA 3O1TA 2JG9C 1UU6A 2BBAA 1Q8PA 2XQXA 2Z69A 3E5XA 4LIVA 4FPEA 3U4SA 1UY3A 1OUXA 5FPZA 2VOVA 3M2MA 1VBB3 4JTNA 4XABA 4COUA 2HKXA 4Q1RA 2F6BA 2CDPA 2PAMA 1VBE2 5H9PA 2E32A 3JD71 3WQ7A 5FK7A 3KHBA 5FZMA 2JDKA 5JOZA 4CXWA 1BQPA 1RUD1 2Y6HA 2ZHLA 4LO7A 1REEA 5FZDA 4LBJA 4WZCA 1H0BA 3F95A 5FZEA 1ASJ3 3PLQA 4YM0A 4AVCA 2Q8OA 4DS0A 2XWJB 4KNCA 2D98A 2C5DA 4J1WA 2YGMA 4LJHA 4RQPB 2VZOA 1GOFA 4BDVB 5G05L 2GNBA 1LGNA 3VKFC 1I9RA 4NVPA 1JU3A 1VAKA 1DG6A 1COV2 4YFZA 3LEIA 1VBE1 2QJVA 4O61A 5KC6A 4NR1A 4R9BA 2WRAA 4AOCA 4CSWA 2QDRA 1XSQA 1EV12 3RI9A 1IQDC 5FP4A 4ES8A 3CZJA 1WGPA 2J7MA 1OC1A 4KG0A 4B4PA 1GZ9A 5FZ8A 2OPKA 1HQNA 3NW4A 3O5SA 5HV0A 2ARXA 2A73B 4ATFA 5DAVA 1N1YA 3K2OA 2CL2A 4L99A 2B45X 3RDIA 3D0JA 4KBBA 5FYIA 3ZXAC 2EAAA 1COV1 1J3PA 2WO7A 2QQJA 3O0XA 5FP7A 1IS6A 1G9AA 4XJZA 1S0IA 3AL5A 3INAA 4R9DA 3ZXLA 2JWPA 1JBCA 4NJ4A 5IVJA 2D6KA 4A6OA 3S57A 2QZ2A 5DAQA 1W6MA 3K48A 1HB1A 1SG3A 3QH7A 4L9BA 3WDUA 4DEQA 5CFDB 4Y1XA 1ENQA 5EP9A 3ZPYA 5BNPA 1H4HA 4ATEA 4YARA 2MPFA 3D8CA 4JGZB 1O8PA 4UFJA 4AE2A 3WW3A 1HDKA 5HCBA 4BE3A 5HXMA 4DXRA 3D82A 3VBHB 3KM5A 3POWA 2ZHKA 5F5IA 4AF9A 1S2BA 1XC6A 2QBXA 3P3NA 4HOOA 5FTTC 2DCJA 3H50A 5GM0A 3I3BA 4YPJA 3VGIA 1JN2P 4MUVA 1F4HA 3MUZ1 3AFGA 5F6LB 3J7LA 3NNMA 3WQBA 3GCXA 4CU6A 4BIFA 4BZ4A 1MVQA 3AP9A 4NHYA 1W3XA 2XONA 4PIYA 3VBFB 1GWKA 2D6NA 4ZY9A 4DQAA 2JDAA 2GMPA 2HWF1 2WQ4A 3PUHA 4Z82A 2VMHA 5LZ6A 3A7QA 1ZRDA 4EYUA 4CDQB 2QNKA 3C7HA 3O0WA 3AMMA 1J59A 5L7OB 3MLKA 1D0GA 2YPJA 1QMJA 3AP6A 3FMGA 3ZXKA 4LHLA 3WEZA 1US3A 4NHMA 4BK4A 1H1MA 3VB9A 1UIKA 4CU8A 3D0SA 4PQ9A 5FUNA 3AZYA 4QQPA 3SLIA 1H8TB 4KU7A 1E57A 2VZVA 4DUWA 4N43B 1PZ7A 2VMEA 2ZJCA 1R1A3 4WVVA 2E7QA 5APAA 3FFZA 3WV6A 5JOWA 1NCQC 5C3RA 4GH4B 4XUPA 5C5TA 4AVSA 3BPSA 2WZR3 2V72A 1BMV2 3CHXA 3LGRA 1Q3EA 1GZCA 4RHV3 4S2DA 4A7YA 1UXXX 2WT1A 1LB2A 4Y4RA 2ARBA 2CDOA 1OHFA 5J3UA 1Z7S3 4Q0QA 1N47A 5EFUA 3OPZA 2VD7A 2IXCA 3I2IA 1JU4A 5C9AC 2R073 1JYIA 2XJPA 3IMMA 2CHHA 3POBA 1V9U1 1WLCA 4P9WA 1H8VA 3FFQA 2ZABA 1GNZA 3WD5A 5FDBA 4UFLA 3ZPOA 1NCRC 4QPIC 1WW4A 1JMUB 1AR92 3WG4A 1VBB2 4XFCA 4K7JA 2PXJA 2XJRA 3FX3A 3JUUA 4JRAA 1K45A 5LA1A 2ZGUA 3OGJA 2L9LA 4UXAA 1BMV1 4H7LA 1BCXA 3ACIA 5T50A 5DN2A 3AB0A 3TNQA 5CEHA 2J1VA 4Q4X3 4R4ZA 3I49A 1OH4A 2D97A 5IK5A 2VQTA 2D6PA 5J09A 1HXS3 1AX0A 1ASJ2 3UGHA 2BYVE 2ZTNA 3THCA 1UMZA 4Y5TA 4E9KA 2Q30A 2NP0A 1CD3G 1NCQA 1PMIA 4QX1A 4EE2A 3I59A 1VBB1 3AX4A 2Q8CA 2ZGSA 4XQWA 3ZFEB 3I3QA 2GZWA 2DCZA 1S0GA 2Q1ZB 3PJYA 5EPAA 5C9AA 3P6BA 1WMEA 2JD4A 5FP8A 5H9QA 3N9OA 2JD9A 4XBLA 1OVPA 4AHWA 3T0BA 4LEJA 1ASJ1 5C7GA 5FZGA 2BFUS 3H8UA 4J1XA 2RDSA 2VZ1A 4SBVA 3U75A 2CV6A 1W6NB 1NCRA 3KQ4B 1H9WA 3M3EA 1MS3A 4QPIA 1ZNPA 5CKQA 4DOUA 2H6BA 3OGSA 1UMHA 1GOHA 3KT4A 1R082 1S0DA 2HWB3 3LOIA 4WVMA 5FUIA 3R6SA 2DU1A 1O3QA 1Z0HA 2QKDA 3K77A 5I93A 3O1MA 3DPRB 3OF1A 2VVDA 3RZJA 1RUI3 2D43A 1X33A 2XUEA 2WSVA 1AR73 5JIUA 1RC6A 1GSLA 2RS52 2Y0OA 3CMGA 2ZGMA 1KDKA 2PHLA 1FOD3 3WG2A 2DUPA 1PK6C 2W1QA 1QQP3 2D6OX 4LA2A 4N8MA 1OXCA 3VDDB 3ZMOA 5FY9A 3B01A 3KGZA 4BXFA 4MG2A 3SH4A 4KWUA 5GKAC 1OPOA 4JQTA 4FOVA 1K5MC 5IWFA 3ZYHA 4XC9A 4HFSA 3R4UA 3WVJA 4BB3A 4HL0A 2XLGA 4EN7B 4ARXA 2QCSB 3HD8B 1AUYA 4A42A 4BK5A 5FFOC 5HV4A 3ZX7A 1MZ5A 1FV2A 3OD4A 1GP4A 4AAPA 3KQRA 4OHWA 5JOXA 1DQ1A 1IHMA 4YG3A 1I5PA 5F8PA 5FPXA 5J96B 2ZEYA 3B94A 4KG8A 1W6PB 4E4SA 2ZX1A 1XQNA 1YI9A 1UL9A 1WCKA 2LALA 5LRRA 4BQWA 4MV2A 4CCOA 5FYVA 1RJ8A 4R9CA 3THPA 3TB0A 1PK6A 1CESA 3BALA 4HPKB 3T08A 3GZTB 4I09A 3CZUA 1A3KA 4MXWB 2A3YA 3VBRC 4AXOA 3S30A 4LBMA 4AI3A 1JXNA 2ET1A 2WZR2 4C1XA 4RHV2 4BQ4A 1K5MA 2VUJA 4YW3A 3T0AA 3B7MA 1JYXA 4LKEA 2HWD3 4UFMA 5JI9A 3C2UA 4M3CA 4D7YA 1DCSA 2FDFA 2IFWA 2R072 3O1SA 2R7EB 1VIWB 5J7MA 1TMF3 2SBAA 1QJEA 2JDPA 3NV4A 5FXVA 1F5FA 5F2WA 4LT5A 1R1A1 4YGDA 2JDNA 5C6CA 3M8LA 1HN0A 4PLOA 4XCAA 2WZR1 2ORZA 3EB7A 5H9RA 5ISLA 4RHV1 2VOKA 1MQTC 3FHAA 4AW7A 4QHOA 4Q4X2 1ZVFA 1RUJ2 4XHXA 3GJAA 5FZ3A 4UW6A 3HEIA 3OJBA 4R52A 3TBDA 2VU9A 4IGPA 4JDMA 4HVQA 5BNNB 3O1OA 2R071 3WF3A 4Q4W3 3CJXA 4QX3A 3WW2A 4BQ3A 3K75B 4BMBA 2JE8A 4H2AA 1Q5OA 4KQ7A 1JOPA 5IFPA 5FMDA 1AJOA 1BVVA 1Y3TA 2FQPA 5JPNB 5BNQA 1F35A 1UD1A 3ENRA 5FZ6A 4FPHA 5EIYB 4G4FA 1ND2B 2Q8EA 1HQLA 4Q4X1 3KD4A 3W9AA 1YIPA 1TE1B 4YW4A 2V4VA 3I2HA 3UJQA 1HXS1 1PVC3 3POEA 3V0AA 3R05A 3LEKA 1H1IA 4OULA 4PLMA 1QH7A 1DBNA 1BEV3 1JOJA 5F39A 1VJ2A 4FPKA 4XFHA 5JMOA 1UXZA 2HWB2 4BIOA 4NIGA 4ARYA 5K8SA 5FY4A 1MQTA 3WQ0A 1RUI2 2ZX0A 3H1WA 5FZCA 3ZYGA 2RDNA 1AR72 2EVXA 2G19A 2FDJA 4JDOA 5FPAA 4CP9A 4NRMA 1UO9A 2LS6A 4FTSA 3ZOIA 1FOD2 3WNLA 1SPPB 4YG0A 4DPNA 4HBNA 3N7JA 2W1UA 1UNBA 2DVFA 2JIGA 2PQSA 5CU1A 4LQRA 4NOTA 2P6HA 3IMNA 2HWB1 1KD7A 1DFQA 3B02A 3BB6A 4B4RA 1DLCA 5GZFA 4BJ0A 4GZ9A 5JMCA 3MLLA 3WZ1A 1JYVA 1OSGA 2VAUA 1RUI1 2SLIA 1AR71 1XE7A 2KM2A 3NNFA 1H6YA 4QT6A 2VOTA 1NLRA 3T30A 1C28A 4OFGA 5A6ZA 4QB1A 1FOD1 2ZX4A 3SXWA 2ET7A 3M3QA 3JBG3 1S0BA 5FZOB 2P2KA 2FDKA 1LECA 2QQKA 4N53B 1QQP1 3UKTA 1U5XA 1PMJX 3WCRA 4MH0E 3AYAA 1ZZ7A 4QAWA 3AMQA 2GALA 1HB3A 3MIFA 1UOJA 3N7LA 3LIHA 5CVRA 5A3NA 3ZO0B 5M0TA 4L97A 4G3YC 2BZDA 5GALA 5A1AA 2EXKA 5FR3A 4K40A 1CX1A 3IIAA 3HJRA 3VZLA 1WLTA 3ZYFA 1NLQA 4CEYB 1HRV2 4IEPA 3BCWA 3ZMNA 4YM2A 1PIV3 4Q26A 4QQ2A 3MFAA 3OB8A 1F8VA 4YGCA 1W03A 4IEYA 1AR62 3ZXDA 3MW4A 3KF3A 2GN7A 1ZA7A 4DNYA 1SBEA 4XMAA 4IGQA 4R8HA 4JQRA 5CB7A 4XJUA 4HVRA 5A32A 5A6YA 1XXNA 4Y20B 4RL7A 2E53A 2ZEXA 5IVEA 4ONUA 2R1DA 2DWRA 4CCJA 1PM4A 1QY4A 3Q8CA 1RTVA 4IV3B 4NAOA 4NMIA 4PIZA 1HRV1 5K0UC 2VNOA 4Y5SA 1W2OA 4CYDA 3H8XA 5E8AA 4XPVA 1AR61 4OCTA 1OLMA 2AREA 2MEV3 4AEDA 1A6CA 2NN8A 3MIBA 1TEIA 1IS5A 4K20A 4L11A 4RR3C 4EN8B 2XJQA 4JHZA 1ST8A 2Z2SB 1HKDA 3PVEA 5EQUA 1OKOA 4XFAA 3VLBB 1FPN2 2ZZJA 3ACFA 1HLCA 2JJ6A 3JB4C 2WN2A 1DIWA 2VTFA 2HWD1 1O8SA 2D44A 3AJYA 4XUQA 2JKBA 4Q8KA 2ETEA 2EIGA 4Q4W2 3VHNA 4NWVA 2XJVA 4E2QA 5FQ0A 1PX4A 2J22A 1LHUA 4UAPA 2WDBA 3FL7A 3MDPA 3IDEA 4Q27A 4C90A 2VECA 2WNUB 4OHXA 3ZFGB 1A8MA 4XAAA 2RJ2A 4QQHA 5L19A 1Q8QA 1W2TA 5E1RA 4EROA 5C4WB 3ELNA 1FPN1 4ZS3A 1D2SA 5FYHA 4JHTA 4E4HA 1S55A 2Y26A 2BTVC 4PF5A 5FAXA 1OA3A 4GWMA 2Y0IA 2E7AA 3DKWA 4ZU4A 3ZN6B 2XR4A 1DQ4A 5A1FA 2VC9A 1FI2A 2NYYA 1PZ9A 2ZGOA 4Q4W1 4HKOA 4XUOA 1IG0A 1IS3A 5CISA 1ALYA 1MR5A 5LATA 4HSJA 4RR3A 2Y6LA 3VKNA 4IE7A 3PVBB 5AC93 4OQ8A 5DAXA 3E97A 3VBUC 1GFF2 4NIIA 5JLVA 1KDMA 1O3TA 2RDRA 2BNOA 4XE9A 2W39A 1WWYA 1CAWA 2XJSA 3AVSA 2E9QA 5AVPA 4FPJA 3BYWA 1W9TA 2ENRA 3FLTA 3RQ0A 1WW7A 3Q8BA 4I0WB 4OUEA 4XVHA 5IJRA 1JZ2A 3A23A 2JG8C 4OI2A 3VKMA 4F7ZA 1PVC1 4QDRA 3J4UH 1FYUA 1BEV1 1JODA 2R32A 5A7QA 1B09A 2AR6A 1K3IA 3GM8A 1YWKA 3NAPA 5DG1A 3EHKA 2PHRA 3AJZA 4LOSA 5IYYA 5HCHA 2RMU3 5F7UA 1H9PA 3LDRA 1XNCA 3APBA 3DKQA 3JQXA 3JXSA 3BU0A 4C91A 3JBG2 5BV6A 3AKRA 4Y1VA 1PNFA 5FCCA 3CU7A 2I74A 1NX9A 5HCFA 2R30A 1NUKA 1AYN3 2B9VA 2IUWA 2P3JA 2Y6KA 3AK0A 3C7FA 4GQ7A 4KGGA 4YGBA 3ZIWA 5BNOB 4BPZA 1HB4A 1AXZA 2PHDA 2GNMA 1LOFC 1C4RA 4QPGB 1O5UA 3MO4A 4ZPIA 2FDHA 3RJRA 1C8M3 3KB5A 3ZSEA 4CA9A 2B39A 3T1LA 1KS5A 4QXHA 3AMNA 1L7QA 1EP0A 2DVAA 4HMZA 4Y3OA 2RVAA 2HWE3 2VMIA 3GALA 3JBG1 1NXMA 4PLNA 2WNVC 3WW4A 3T2OA 2WZ8A 3HBZA 3FLRA 3LSDA 1AXKA 1LULA 3VN4A 2YU1A 1FMD3 3I2FA 4QGLA 5A3TA 2R6QA 3RNSA 2FCTA 3NNJA 4M0HA 2BGCA 3OUHA 3L2HA 2ZMNA 1HQWA 2XVKA 3K3NA 3B9CA 4HANA 3ZFFB 1PIV1 3SNMA 4E4ZA 3S5AA 2VMFA 3E5UA 2WR9A 1PO23 2WUHA 1V6KA 4XBQA 4CCEA 3BTZA 1JYNA 2RHPA 4IESA 2DTYA 4E8DA 3BTYA 1LOFA 3B69A 3U11A 3OBTA 2WZPP 3H8RA 1DZRA 5JSRA 2R042 3FUOA 2MHFA 4UT5A 4W6YA 3PUAA 2WWJA 1AF9A 1V0AA 1ZM1A 1PVXA 3HBKA 3KSCA 3PUIA 4I01A 3E6CC 1W04A 3NSTA 1QOOA 3KGLA 2YG0A 2D40A 4XJWA 1CAXA 2WNVA 2MEV1 2EIBA 4MSVA 1CPMA 1LESA 1XNAA 4NO4A 1GP6A 4Y22B 3HAGA 4AI1A 5KHKA 2X10A 2BVBA 3WNPA 4C0HA 5A70A 2ADEA 2ES3A 2PMWB 3HN1A 1DU3D 1QXJA 5EXOA 4YVWB 5JSPA 1OH3A 4Q0VA 2XVGA 4CXXA 2YBPA 4DUVA 2R063 4LHNA 2JICA 3PIJA 4BXSV 1NOVA 1PNGA 4BQYA 3BGAA 3CJIB 3O1PA 2DVDA 5AC92 3VHPA 3OD0A 4YWAA 1GV9A 5JSOA 4XXPA 1WBFA 3LB9A 1XNDA 1YJLA 3RI8A 4XXAA 1LRHA 2O0OA 1GMMA 5C8WA 2XG3A 1HRI3 5F2SA 2JE7A 2RR12 1CONA 2VXJA 5GZEA 3ZR5A 2JG9B 3UV9A 1J58A 2W91A 5ABJC 3RJ2X 5A33A 3SH3A 4RS5C 4KL1A 4TYSA 1LGCA 4I2OA 2JKXA 4FO9A 4IUGA 1AX2A 4AG4A 5AC91 2W3JA 1XBFA 3M3OA 3OY8B 3USSA 5J1XA 5JXIA 5GZDA 4LMFA 5CFCB 1KFUL 1Q8OA 1WLWA 5CKMA 5C8CA 3I7DA 2A5ZA 1UPIA 1SBDA 2B7YA 1YCIA 2RR11 4B29A 1SDWA 5C3PA 1H2NA 3IBMA 3UKNA 1C1LA 3OUIA 3WX5A 4MYEA 5BY5A 1YQ8A 1J3RA 1ULDA 2ZGKA 3IDBB 1AYN2 1GQHA 2VBPA 2D6LX 5A3LA 1XYOA 5F37A 1RXFA 2CGPA 4CEYA 1Y43B 5I0UA 5JXHA 3H0OA 1XPWA 1V70A 4QM8A 1OF3A 4A3ZA 4NRQA 1MZEA 4A45A 4XDOA 3IDAA 3I2OA 4RSUA 4NIAA 2RMU1 3MEPA 4MGIE 3MV01 4FXGB 3DF0A 4XBNA 1RUD2 3TYJA 3WOGA 5ABJA 5KXCA 3T4HB 1GOGA 1OFNA 1V6NA 3ITQA 1SLLA 1CJDA 2A1XA 1ENRA 4AVBA 4DEVA 2PHUA 5A7WA 1AYN1 1V00A 2P3KA 1SACA 2DDUA 2VW0A 2D5FA 3HOBA 4N9HA 2E63A 2FMYA 3MBWA 1BXHA 1WCDJ 4XETA 3KLSA 3H7JA 1ZRFA 3WP4A 1PZ8A 2E6VA 5ACA3 4CDUC 2BOIA 4U36A 4G9SB 2XDVA 4HN0A 4DMIA 4AK3A 1PO22 2F4LA 2HWE1 2JIJA 2QDNA 3AP5A 1QJZA 3FHQA 4D94A 2IC1A 1VBD3 3J8F3 1EAH3 4YYOA 5IK7A 3MIDA 5BNPC 1FMD1 3VHOA 2R16A 3TNPB 2JECA 2X5IC 2YXSA 3CKHA 5F3EA 5LBEA 1H1AA 3VL8A 4BYYA 1CN1A 2X8KA 4XOGA 1CAUB 1RHI3 4AQSA 3AVRA 2C9AA 4QD2A 3PU3A 4Z2WA 4Y33A 2VQUA 4LBLA 2YHJA 2PFWA 1PO21 3GF6A 3RFRA 4ZZ5A 1UKGA 3POGA 2IZWA 2IFRA 4FTEA 2VGDA 2VZRA 4MHUA 2YU2A 2JX9A 3WNXA 4LKDA 5JVVA 1XU1A 1Y4WA 2WWSA 4UI9L 2WFF3 4AHYA 4IGOA 4S2HA 1JI6A 4LR4A 4A2UA 3W5MA 1W9WA 4LE4A 3AYDA 3PURA 4HKWA 1LKNA 1YFYA 3N7KA 4OQ9A 3THDA 1PHMA 5DDJ3 2WNOA 4XZPA 1OQDA 1VLNA 3EYPA 5FV3A 4YZ4A 1HX6A 4BM8A 3GNEA 4K1YA 1NA1B 2ATFA 2J1EA 1J83A 2BGOA 3I59B 4LITA 4EZHA 2X09A 1U0AA 4AZZA 2B5HA 3CDZB 2HWF2 4H55A 4K8RB 1IKQA 2ZEZA 4XIOA 4QKBA 2HH9A 2X5IA 4FPLA 4NPMA 1GLHA 2GSYA 3HNYM 5DMYA 3BKZA 5C9AB 2EAKA 1HN1A 4DXTA 1O6UA 3ES1A 4HKLA 1QF3A 1QWRA 3VZOA 4H3WA 2R061 5LK5A 1OLQA 4AR2A 1VR3A 1QJU2 4LHKA 4XACA 3OCPA 5I0RA 3T4VA 1KS4A 4GMP1 1XYPA 1F5JA 2BP6A 2DFCA 3AXEA 4FCAA 4MGYE 4PF1A 2I2SA 3U0ZA 4K3UA 3B3QE 1GNHA 1RITA 2GH8A 4MGQA 5IAVA 2G9FA 4XIKA 4COYA 4Q4Y3 3EBRA 3POSA 3H3LA 2YZ4A 5FZ0A 3DGTA 1HRI1 4RQPC 3ZSLA 3PUQA 2DCYA 5IATA 1V9U2 1QJU1 4FBFA 3WG1A 1RUF3 2GNTA 1D2QA 2I45A 4NHXA 3SHRA 2WAOA 2AC1A 3HMYA 1HW5A 4AQ2A 2GH2A 4GALA 3VBOB 1VB4A 3PNAA 1NE4A 4RGGA 1OLRA 1QJY2 4NE9A 3TN92 1GNYA 2I07B 3ES4A 1VAMA 2GAUA 5EJ3A 1D0HA 5I91A 1QDCA 1RIRA 5JZGB 3T09A 4CPBD 3KHCA 3LA2A 1U5ZA 4GMP0 3CEWA 4P9XA 2W1WA 3AKTA 3LKJA 3N9MA 4UWDA 4M3CE 5IUQA 4B7KA 1Q8VA 2OZ6A 4WVZA 1QJY1 4PT6A 4QB2A 3TN91 3PVNA 3EJKA 2D6MA 1H30A 1C57A 1X50A 4RQPA 4PDWB 5C5UA 4MZUA 5IVFA 5CA6A 1DGLA 4JGZC 1UY0A 1F31A 2RJLA 3HWJA 4LO8A 4PBOA 4UW4A 1OVSA 2F4PA 1Q56A 3P3PA 4GB33 3RRDA 4P5HA 1W8UA 4XUTA 3MICA 5C3QA 1VBD2 1O3RA 1EAH2 2FHRA 3A4UA 3ORJA 3ZSKA 4BWOA 2A6WA 2NPIA 1NKGA 1K5MB 3A21A 3Q8EA 5B4XA 2CWSA 1YNAA 1BK0A 2P5BA 2QQVA 2IVIB 3POIA 5JXGA 2ZX2A 4BHPA 4EN9B 3VBFC 3KMHA 1B35B 3ZR6A 3KS7A 1RHI2 3QLQA 4I3PA 2W94A 5ANQA 1OKQA 4DZGA 2UYBA 4ASKA 3MHZA 5CBLA 4CDQC 3KV4A 1EY2A 4I30A 3WDXA 1UQXA 2Q8DA 1QHDA 1VBD1 1EAH1 2LRPA 2OXBA 3J8F1 4PIXA 4XTMA 5KXBA 3ZSMA 4UBGA 2XJTA 4HG6B 1XNTA 4XFIA 1UCXA 3ZVXA 1H8TC 1LJ7A 2WFF2 1O4YA 3F2ZA 4GWNA 4N43C 1UZ0A 1W8FA 3ASIA 1LEMA 2VZPA 1SLIA 5D21A 1UOFA 3WDVA 2JDYA 3GCWA 4BA6A 1RHI1 4WM7B 4JGZA 4GH4C 3O0VA 2JXAA 1TQ5A 3VBHA 2YV8A 3RYPA 3ZKYA 2WO2A 3VBRB 2ARAA 2Y6FA 2FMDA 3RG0A 2KA3A 2HEWF 2Y6JA 1UW8A 1V6MA 1W6QB 1S2KA 3LZZA 1VE0A 5HBAA 3V65A 4CDWC 4D7TA 3D3AA 4ET7A 5IFTA 1G9FA 4FOYA 3VBFA 1SLCA 2WFF1 4CXYA 1WMFA 2PHWA 3LFIA 1KEXA 4AEJA 4N90A 3JB8A 2ZPXA 3W5NA 1R093 1REFA 2QTWB 4CDQA 1JHNA 2RV9A 1DP0A 3PU8A 4B7EA 4DRVA 1KFXL 4K6BA 1O91A 1OOPB 1ULFA 1RINA 1GKBA 2ZHMA 2FD8A 1H8TA 3NJVA 4XILA 2J1AA 1ZBE3 4N43A 1NXD1 1IGOA 4TXWA 4A3XA 4LULA 1TG7A 3MF9A 5EYYA 1IKPA 1SQ4A 5FLJA 4ZS2A 3ZKUA 1UU5A 1J84A 4GH4A 3E6BA 3P1IA 3FBYA 1W6OB 2JDUA 2XHNA 1T2XA 5B4NA 3VDCA 4N7IA 1W28A 4QHBA 1G9BA 1AX1A 2G9GA 1NYWA 1Q8SA 2HBUA 2VPVA 1R1A2 2PA7A 4INDA 1X8EA 2CSGA 5DXDA 4F3JA 2Q1FA 4QWNA 5JUVA 1FNZA 4CDWA 5I0TA 4Q4Y1 1QJX3 1GZWA 4OLLA 2P4EA 4UBHA 5L73A 3FZ3A 4M0NA 1Z7S2 1IS4A 3RZMA 4ASMB 5GZCA 2C1FA 1SCRA 4XDPA 1RUF1 3DPRC 2EALA 1WD3A 1Y9QA 5FZAA 1FAYA 1JZ7A 1DHKB 1QNYA 4QX7A 4JV4A 3GJBA 4IEOA 2WQZC 2VY0A 5FY8A 4CZSA 1SLBA 5D8AB 1YUDA 5FPBA 1JZ3A 4MGKE 5SV8A 2FCUA 2TBVA 2AYHA 5FY1A 3ZXEA 2Y64A 4Q2FA 1J1LA 3MI8A 2PHFA 3BTXA 1OLME 3JZVA 3IAPA 5FXZA 3VDDC 1RUNA 1Z7S1 5J48A 1HXS2 3ZFEA 5LWBA 4CUBA 4JGYB 2EIEA 3BOWA 4OI1A 3SEEA 5FY5A 3VKLA 4X6RB 1CQ9A 4LLFA 5A32B 4AYUA 4BLIA 2WSUA 1CAVB 1JW6A 5DPNA 3LAGA 4MHRA 4H7MA 3U14A 4UF0B 3WG3A 2XOMA 1YQ6A 3AL6A 1LR5A 1MS9A 1W6NA 3L9JT 3ST7A 1G86A 2VO5A 5FREA 4XZUG 1ZX5A 1YO8A 4MGZE 3H42B 3VBSC 1FXZA 3AP7A 3SKVA 2QQOA 1NT0A 1QXPA 3DPRA 5E89A 4AVVA 3MZHA 3HQUA 5L9BA 3W21A 4LA3A 4FOWA 3AZWA 1AL0G 1G9CA 1ZRIA 3M70A 3FC0A 1XRUA 3MIGA 1KJLA 1APNA 4LUKA 3TEZA 3U78A 3NL1A 2GMEA 3VDDA 3C7GA 4K21A 3GXUA 1IQAA 2IVJA 4HVOA 2K9ZA 2GC0A 4NPLA 5DG2A 4IQPA 3ZN4A 5FY7A 3IZOA 4DINB 2W95A 3ETPA 3WUCA 4IW3A 3ABZA 1F15A 1QQP2 2W87A 2J42A 4UW3A 4QXBA 3FUQA 3V0BB 5IK4A 5K0UB 4CCCA 3MIHA 3ETQA 1BVP1 4TTGA 3OUJA 1JYTA 1GYKA 3WDYA 5ANNA 4CP2A 4Z07A 5IVVA 2A70A 2A6YA 1YQCA 2H0BA 5L9VA 1HV0A 4XFGA 4XF0A 3VBSA 3GYDA 1POQA 5KC5A 1PGL1 3DECA 1OQ1A 5BPXA 4OUMA 4AEDC 3WSOA 1HIXA 3I8TA 4ES9A 2Q1MA 1QH6A 4KGQA 5BNNC 1RUE3 2VUCA 1V6JA 3ACLA 4O9GA 4EQVA 1U12A 3MGUA 4HPKA 3KVAA 5IK8A 2Z4FA 4COZA 3PUSA 4LO4B 4LOTA 5FZ1A 1YRZA 3VDAA 1F2NA 2GNDA 4GIQA 4MXWA 3ZN5A 4XAEA 4OZXA 4XURA 3W59A 5C3OA 3FHIB 5JIAA 1TME3 4LK6A 2P3YA 2QQPA 1L3JA 3ZYPA 1R091 5LY1A 4QGMA 5DAWA 1BYHA 4CUCA 1TVGA 1VBC3 2QZ3A 3U07A 1LHNA 3K4DA 2CYFA 3LF7A 5FPVA 5HPOA 3USUB 2Z5WA 4JCKA 5KHJA 3R4SA 2W1SA 1KXGA 1JTZX 1W8TA 4GXLA 5ERLA 5FYBA 1ZBE1 3PTYA 4YW1A 2FZ1A 1XB9A 1LODA 4FPGA 2HWD2 1HB2A 3SC7X 3TRSB 4QHZA 3VD5A 4LBQA 2GC3A 4A7ZA 5CKNA 5K9YA 1TMF2 1AVBA 4LXLA 4XJ8A 3VBUB 5FZ7A 4BQ5A 1SDDB 1RJ7A 2W5FA 3KV5A 3QACA 2RS13 5BNNA 1VAVA 1U5YA 5FZ9A 3VZKA 1OMIA 1CX4A 1XOYA 2OZJA 1BK1A 2YBKA 1W9FA 1QJX1 1DLLA 4P08A 2UURA 4BOWA 5E6HA 1R64A 1JZ8A 3OYWB 2JG8B 1QNWA 3Q8FA 4ISQA 4K1ZA 4B3NA 1G7YA 2TNFA 3NJXA 3SCHA 5T54A 3LCPA 2ZCWA 4LLOA 4YVSB 4HSLA 1N3QA 1TMF1 2BWAA 5LY2A 1DDLA 2VZQA 5DAPA 1ND2A 3UNPA 1GQPA 1VMJA 2AZ5A 3WF2A 1VBA3 4C8DA 3RZHA 1SLAA 1YYNA 5DUUA 2QQMA 4D8MA 4AL9A 4CCDA 4TWTA 1DF0A 2R0HA 3LEMA 4HONA 1X7NA 3T2TA 3IM0A 4QU1A 2HEVF 4N53C 2PYTA 3LPFA 5FLIA 3NAPC 2VJXA 3KV6A 3LQCA 4IETA 2HWC3 4XEZA 4META 4EJRA 4IEXA 4A44A 1Y9GA 3BVCA 2XHKA 3UL2A 3ZXJA 1PVC2 4AI9A 4JKKA 3OPWA 1ZBA3 5KWRA 1BEV2 2BU9A 3G6JB 2DYCA 4BCUA 1V6IA 2YC4A 1SPPA 1WCQA 2R49A 4FOQA 2ZGPA 3RMYA 3D6EA 1W8OA 1RGSA 4D7SA 5F3CA 5CG9A 3KCYA 4AAXA 4XDQA 5DZFA 2ZMKA 5FWEA 5F3GA 3MIEA 1CAXB 4PQQA 2WNVB 2XH6A 4FXKB 4S2FA 1S1AA 4HETA 5A80A 4MLOA 2BEOA 4AQ6A 1VRH3 4AFAA 4IV3C 4AI2A 1S0FA 2BWCA 4CEWB 2AH2A 4ZKTB 2JB8A 1AJKA 1RMU3 1GUIA 1Y9MA 4W4ZA 4N53A 2R1BA 2OIIA 3IPVB 5FPLA 4FPOB 2UU8A 4Q0PA 3RWNA 3OBRA 1JYCA 1XJAA 2GP3A 3ILRA 1Z78A 3J7HA 4FFFA 2C24A 4XHBA 1DYPA 4WM8B 5AFBA 3KV9A 3WR0A 1W8NA 3ATGA 1RUE2 3MF6A 3WNNA 1E5SA 4PI0A 4JTOA 2A6ZA 2BRTA 2PHXA 2VR4A 3BPZA 3PVOA 4FVVA 4CDXC 5LA0A 4QQLA 4CCNA 2VCCA 1QJFA 2VVEA 2WC2A 2WO1A 1PGSA 2EXHA 3HQXA 4P00B 4QKNA 4XF4A 4XJAA 5DUXA 4IV1B 3I3EA 2WNUC 3ZFGC 1TME2 1PO13 5EYXA 5F3IA 5J98B 4DXZA 5FO9B 1PIV2 2ZKLA 1PGW2 2VE1A 4Y20A 4M00A 5D1IA 1O59A 3M7AA 3BIWE 5GLTA 2VTXA 1AHSA 3LWCA 4I02A 4QM9A 1VBC2 4IV3A 5KHGA 3DUIA 4QQOA 2BDRA 2RM23 4GA9A 1RUE1 3HR9A 2WWUA 3HQRA 3NNGA 1S2EA 5LBFA 1WKYA 1REDA 4MOAA 5L9RA 1SFYA 5FKBA 3L2YA 3T2PA 2ZGTA 3C8XA 2WQ8A 5J36A 3DEMA 1TME1 3LEGA 3NWKA 4FAGA 5FJKA 3VD9A 3AFKA 1D4M3 1GR3A 1PGW1 5FOBB 4D6SA 1N1SA 2MEV2 1X9TA 2A6XA 1U5IA 3UK9A 1VBC1 3BUCA 2RS12 1BBT3 3UGGA 1WA4A 2WT2A 3IWZA 4CDXA 5CG8A 5A7SA 3BIEA 2VCMA 5ABJB 5A3PA 3UJOA 3GBFA 3N7MA 2VUDA 2WNUA 3E5QA 3ZFGA 3AMPA 4RS5B 4AFMA 5KHIA 5LEKA 1LCLA 1MPXA 1QOSA 2V73A 1W0OA 2YUEA 3GGLA 4JVAA 4Y1ZA 5EHDA 3N35A 1Q43A 2YY1A 4GWJA 5FZKA 1VBA2 5F1RA 2RS11 3ZN6A 5EV7A 2RG4A 3T1MA 2GC1A 2ZXQA 3CQOA 2LM3A 4LBOA 4IE5A 1EPWA 4Q1PA 2Q4SA 2RDQA 5A6XA 5JXJA 2GC2A 4Z92B 5C8CC 5GLUA 3VV1A 4J25A 4FTBA 3NV2A 3X29B 5FXXA 4M4PA 2J1TA 4IERA 3ZLIA 3DYPA 5FMBA 1QXRA 5FO8B 3AZVA 4QPGC 1EV13 1ZBA2 4ITCA 4P9JA 4P02B 2H6CA 2D7FA 3D4KA 1VBA1 3DYOA 4XF1A 2PELA 1WBLA 3PDQA 2CU5A 1QU0A 4CEYC 4ZU7A 1YEWA 1JUHA 1WUVA 2W46A 1LGBA 3CNAA 5JAXA 2YC0A 4A7KA 2PQQA 3T3YA 2VNGA 5A6QA 5KBFA 4JKMA 1H2KA 2HWC1 5FZIA 2LW8A 4LIUA 1KGYA 1W99A 4YM1A 4HK9A 4IDZA 1MZFA 3QCWA 1HJFA 1NAEA 3AKSA 5BXXA 4A6SA 1ZBA1 4O9EA 3DV8A 4QU2A 1ZZCA 4YGEA 3ZFFC 4Q0SA 1RUH3 3VZNA 4Q29A 1POV3 1T6BX 1UN1A 2X29A 1RMU2 4DO0A 2QQNA 4LNVA 1ULCA 1O4ZA 4CU9A 4W65A 3WHUA 1W6MB 2RMU2 2WA4A 2P37A 3B00A 5F9TA 2EIDA 4RGKA 4IEVA 3EMRA 1DZQA 4B1LA 4QPGA 5BNPB 1WMXA 2NMOA 3H1YA 4NPRA 4QX8A 2F17A 1FNYA 3WDWA 1H4GA 2YGLA 2ZGRA 2E7TA 2VQAA 1RMU1 1S0CA 5A1LA 2BUKA 4LUMA 1C8M2 4QX0A 4H14A 4RFT0 5FY0A 4BH9A 5LW9A 1PO12 1GU3A 5F6KA 1RB8G 1K42A 3H3ZA 2VXRA 5BYNA 2IXIA 2G1MA 1ND3C 1ZZ9A 1N1VA 2HWE2 3E6DA 5T5JA 3DYMA 3QBQA 2W92A 5GJ6A 4NHKA 4EWDA 2OX0A 3ILNA 2CTVA 4XTPA 5FLHA 5HXVA 3SMHA 3ZFFA 1FMD2 1JZ4A 3NO8A 1MVEA 4W6WA 1X82A 2K2SA 1PMHX 2IXJA 2HBTA 2XMLA 5FBZA 5FYSA 3CJIC 4NHLA 5JR7B 4BQ1A 4JRLA 4V1PA 1C8M1 4YZ3A 3URFA 1OA4A 1W2AX 1PO11 5KHHA 1D4M2 3Q9OA 3KF5A 5FIXA 5GLZA 2PLV3 1I6XA 2OKXA 1XNKA 4DY5A 2AEZA 2BBVA 4XFBA 5B2GB 3WNOA 1BBT2 4GWIA 3HNMA 3MV11 3RZZA 2RM21 2PAEA 3N4MA 1DGWX 2VBBA 3J26N 4FFIA 1MS4A 1ZREA 3WP6A 3AC0A 2B8MA 1AR93 1BHGA 1NZCA 2CWMA 3WW1A 3HIFA 2Y8KA 3LDKA 4V2WA 4WV8A 4Y22A 1LTEA 1I3HA 1PX3A 1YXWA 2W68A 2GDFA 3N9NA 5E88A 5FO7B 2HYXA 2QVSB 2JE9A 2W0XA 5FXWA 3T2QA 4BISA 1UOBA 3QH6A 2RJKA 1D4M1 1C5IA 1ND3A 2EXJA 2V5YA 2TUNA 3N9QA 4E8CA 2DURA 4YVWA 1AXYA 4IE0A 3OEAA 3ROUA 1DGWA 1UU4A 1BBT1 3LOBA 3AXDA 3AKQA 4IEUA 2C4XA 3VZMA 1LU2A 3ZIXA 1ZYBA 2DBIA 1W3VA 2Z79A 3CJIA 4W8JA 3O1VA 1IOAA 5L36A 3WF4A 5LBBA 2OPWA 2BV4A 1W9SA 1WW5A 2AACA 3NKTA 4CP0A 3RZGA 2J1UA 2R062 2ZACA 1X9PA 3CO2A 1UYZA 1DYOA 1WCUA 3LIGA 4KI5M 3PJQA 2D93A 4KU8A 4FPFA 1GWMA 1RVF3 4IEZA 3DXUA 1NCQB 2AEYA 4P5YA 2DUQA 5GLVA 3WNKA 4V2VA 2JG9A 5LRSA 2DFBA 4YW5A 4OZOA 3W20A 2RE9A 1W39A 2XGXA 4B4QA 4COVA 4GJYA 1GICA 2G4IA 2KD7A 1EUTA 2VMGA 5FZBA 3WF0A 2VNVA 4JDNA 4Z2AA 1R083 2JDMA 1HRI2 3OY8A 5FBJA 2NZ9A 2XL7A 3S7EA 2WYFA 5CFCA 4NAMA 4UFKA 3LDBA 4AGGA 5LK7B 5FYUA 1RL3A 4AFCA 2O1QA 3UETA 5A3UA 1OF4A 1NCRB 1UF2C 2RS53 4J6GA 2XBO3 4QPIB 1YJKA 1EV11 3EXUA 3ILFA 1YFXA 2Y6GA 4JX0A 3GHNA 4QXCA 4WVMB 5IW0A 5FOJB 5IHRA 1OD3A 1RUH2 1ZZ8A 3JU9A 4CRQA 3IT8A 1IPJA 3MYXA 4EZ4A 3S5QA 3PMEA 2VBDA 1NG0A 1NZIA 1RUG3 3ZDVA 3QD6A 1M06G 5BUVA 1SEFA 1W0NA 2WL1A 3KCXA 1O7FA 2W2IA 4FFGA 5KR7A 3SCFA 4C1WA 1UWWA 2Q0AA 4ORFA 3RZLA 3U4XA 2W47A 1ODMA 3H3UA 4W50A 2XQRA 3AZZA 2OQ7A 1GQGA 4KWJA 5T5PA 4AHZA 1JYWA 1E5HA 4XCBA 5GLWA 4NIHA 2A71A 4AGVA 2WABA 3TAYA 3DXTA 4LKFA 1DGRN 1RUH1 2GMMA 4CCLA 3NV1A 1POV1 2DCKA 4DB5A 5CAZA 2C26A 3AYEA 1NQDA 1W90A 2C9KA 4N7UA 3ZXFA 4YM3A 4Y4YA 2EF6A 3JQWA 1FV3A 1H2MA 3ZXGA 2WAAA 4OUSA 3KVBA 4Y1UA 4COWA 1RUOA 3VD3A 2A7AA 3E1F1 5LASA 5FP9A 2A75A 3FBMA 4KBZA 1BKZA 4YW2A 4GAZA 4B8EA 4YRDA 5FYZA 2NQYA 5EJZB 2ZS6B 1A34A 1UZWA 2ZMLA 2V09A 2ZZQA 2XWBB 5C70A 4LTAA 2NMNA 5CFDC 2UYAA 4KWKA 1NA1C 3NJZA 2CAUA 4X8NA 5C3SA 3VDBA 4IL7A 4YW7A 3N3HA 5ACA2 1ULOA 3CL1A 1PK6B 2CGNA 3NVCA 3C3VA 3LD8A 2PLV2 2WZEA 1VRBA 3C7EA 5FZLA 4F8AA 1NY72 4FAHA 1XYNA 3FLPA 2Y34A 3NQHA 3VBHC 3OGGA 4AI0A 2ORXA 2HJIA 2FZ2A 3J8F2 1CAUA 2VH9A 4CDWB 5LEJA 1MACA 2ILMA 4JAAA 4PHZA 1GZWB 1CIYA 3ON7A 4NRPA 4KMQA 2IXLA 1POV0 3IAQA 3K46A 4PI2A 2VL4A 1VMFA 3CIHA 4M3CB 2VNRA 1NLSA 2VCBA 2BPA2 1MS5A 3POYA 5ACA1 2ZA9A 4GKYA 3TEXA 3WINE 4AQTA 3B5LB 1UYPA 1UMIA 3AM2A 4LKSA 3S6PA 1RUJ3 2PLV1 1NY71 5L7OC 1ODNA 2ZKNA 3CF6E 5JCTA 3UGFA 4CE8A 3ZYBA 1TNFA 2OS2A 5CFDA 3O14A 1OURA 4CUAA 2ZBJA 4LORA 4MADA 1NA1A 3LFMA 2BVVA 4RFRB 4QB6A 1AR91 4UFIA 5FMOL 4E2SA 2WFPA 3CBNA 1YLLA 1O5LA 2XKPA 5DDJ2 5FKCA 3VBOC 3GDBA 4BU2A 4E4DX 4OVEA 2YYOA 1RVF2 2GP5A 3EO6A 5LBCA 2IWGB 5K7PA 5JR2A 3H7YA 1YC61 3OOXA 1CWPA 4EV0A 5FJHA 4XUNA 5FMCA 4YZ1A 3BTAA 1OQEA 5JZGC 1LHWA 1TNRA 4WVWA 1MEC3 1SFNA 1YIFA 3NJYA 4QMAA 4AEMA 4AEKA 5T3NA 2DF7A 1LOEA 3SKJE 1PM7A 3I2KA 3WNMA 4AHXA 3O12A 4P9LA 1LOGA 5DDJ1 3V0AB 2WINB 2YC2A 4TZDA 2XBO2 5GZGA 1RVF1 5L7OA 1KJRA 2OT7A 3FJSA 5CNAA 4MGTA 4PDWC 5FRAA 1RUC3 1MQTB 1HJGA 5FP3A 1RUG2 4OI4A 4YG6A 4Q4Y2 4CP9B 1DQ6A 4QKDA 1ZA4A 4O65A 4F83A 2RS33 1R081 4U2AA 1D4VB 4RGAA 2XPJA 3ZSJA 3VBOA 3U10A 2MNGA 5CYYA 4TSVA 1WW6A 2V4AA 3J9SA 1RUF2 1W05A 3K4ZA 2RS51 4RA0A 4YFWA 2XBO1 4L8QA 3ZFEC 1B35C 1YHFA 1QEXA 4I0BA 3GZEA 3UT0A 4YZ5A 5JZGA 3PL0A 4LPLA 4L0PA 4FT8A 1S0EA 3OEBA 1W9YA 4K9SA 1RUG1 4UOJA 5KXEA 1LOCA 5EJ1B 4ASLA 4DIQA 2WKKA 3VBSB 1RYYA 5CZKA 4AVAA 1UZVA 2OVUA 4AVTA 4CCKA 5I0DA 1UX7A 4GULA 1HRV3 2BQPA 4JZRA 2XKOA 3I2GA 4PDWA 5FYCA 3MUY1 1WA6X 4WM7C 1AR63 2WA3A 1V6LA 1K5JA 5HI0A 2DCTA 2ZGLA 4Y1YA 2PTMA 2O8OA 1MZ6A 1WZXA 2X53S 3WLUA 1IPKA 5A3MA 1W8WA 2C0ZA 4LE3A 2DBNA 5LA2A 4LO6B 2DTWA 3RVHA 4GB32 2WLQA 1FT9A 3EQEA 2J1SA 1B35A 4ZONA 1W2UA 2VW1A 4Y26A 2N7GA 5DZEA 2E51A 4X8PA 3A0NA 2IXKA 1S0JA 2LUWA 1G8WA 3O7OA 3RYRA 4CCMA 2A6VA 4NN0A 4XF9A 2D3RA 3DCQA 4LBQB 5A7OA 3IKWA 1FPN3 3TOJA 1OOPC 2J1RA 4LO5B 3R0RA 4BQXA 1NE6A 4DXSA 5KXDA 4AEDB 5HCAA 2NM1A 2B9UA 4GB31 2OW4A 3UKVA 1Y7BA 1E5IA 4MVTA 3KT7A 3VUOA 4WM7A 4SLIA 4MO3M 1DYKA 2QFEA 1UYYA 4OYUA 2XLAA 5J37A 1UZYA 3ECQA 4FFHA 4WBBA 5F5CA 3VBRA 3WP3A 1BJQA 1CJPA 1JHJA 4YSFA 1EPZA 4FSJA 5JOYA 3THTA 1IZ3A 2C6SA 2AGSA 1W6QA 2WNEA 3RPQA 5FQ0B 1H2LA 4LBKA 5JI7A 3BI3A 1DQ0A 2P17A 1F4AA 2OYZA 1RUJ1 1PGL2 4PBPA 2P6CA 3AYCA 3UYJA 5T5OA 1W8ZA 3ZM8A 1SFPA 1LEDA 3DL3A 3UESA 4ZHNA 3AMHA 4MX3A 1MEC2 2JDHA 5E16A 3VL9A 4LHSA 2Z42A 1MS8A 3MW2A 1S4CA 3M4FA 5AFEA 1YFWA 2B46X 2D3PA 2DU0A 1OOPA 2EA7A 2UY8A 2WN3A 5H9SA 1VP6A 2FCVA 4NROA 5D8AC 3HNBM 1R092 1CGPA 2BOJA 4MGSA 4RR3B 1YQ2A 2QQWA 2GU9A 5EWSA 2E26A 4JKLA 1W6PA 4JC1A 5A3WA 3ZYJB 2HLEA 4YNIA 4ZXKA 3W58A 4N9IA 3DN7A 2QUOA 2VOWA 2W9XA 2UY9A 1JOBA 1W6OA 1RUC2 4M4RA 1OUSA 1XNBA 2VUAA 3OGVA 1CAWB 1JS9A 3IB3A 3ME2A 4JGYC 4BMEA 1ZBE2 1MEC1 2LROA 3NMBA 5IVYA 5CADA 4CDUA 2RS32 4PCRA 3RSJA 3WF1A 3I3MA 1QOTA 4P9IA 4EN0A 2VW2A 2YBSA 4W6XA 2VQ0A 1DZTA 5JDBA 3R4DB 4RN5A 5A3OA 2HYKA 3OBAA 2KR2A 3WP5A 3KWVA 3VKOA 4Y5Z0 1W8HA 4XMIA 5FZFA 1ND2C 2JENA 2Y33A 3NRUA 2OA2A 4IEQA 4AWDA 2WJSA 1AYM3 1RUC1 4D6RA 1YFUA 5LB6A 3NAPB 2UWAA 1OBNA 1QJX2 4QGNA 3U1XA 5I0SA 1CIWA 4UW5A 2RS31 3WQ1A 2BFUL 1OT5A 1UY2A 2CGOA 3ALQA 5D8AA 4DUXA 2YPDA 1KQRA 1SMVA 2BW8A 2EICA 1URXA 3GBGA 2LTNA 3O1UA 1AL23 2Y38A 3LA3A 1JUIA 2BNMA 3D5OA 3KT1A 1OI6A 1DGRA 1QIQA 4XJ9A 1UY4A 5SV5A 4AI8A 3TEWA 1LOAA 1US2A 1P8JA 3G7DA 3POFA 4AFBA 3MFCA 4JGYA 3K51A 5I8TA 4NUBA 3K3OA 4HZFA 1G6NA 4L92A 4OHVA 4ZXEA 4IXLA 5T5LA 3WXPA 4M3CF 4UFHA 3OSDA 3WHTA 3KZ4C 4D69A 2Q5TA 1CAVA 3I2JA 1UYXA 1LOBA 1MS1A 1YQ5A 4UF0A 3GHMA 2QQLA 2XJUA 4QX2A 3SCGA 1MS0A 3HVDA 2WBKA 2AENA 3S0MA 5DQ0A 5FYYA 2D3SA 2OUHA 1C5HA 1C1FA 2BJSA 4HXCA 4D6QA 2JDZA 2VVFA 5FUPA 4UYBA 4FQ4A 2VULA 4QDSA 4OHYA 1X36A 4AGRA 3IDCB 1ONAA 2K0GA 2YFUA 2EXIA 3IN9A 2WLPA 1C8NA 2R043 2VZTA 3O1RA 3HT1A 3BOPA 2NLRA 3BU7A 5A7PA 3ACGA 4FI9A 3B93A 3BODA 4FPYA 5AVAA 4FQZA 4CDXB 1XE8A 4P9GA 4R9AA 4E27A 1BZWA 5CFCC 5FYMA 5EZWA 3RS6A 4CU7A 3MLJA 1JZ5A 4QPYA 1D7PM 4LBNA 1SHWB 4O7XA 2OQ6A 4HN1A 1WCSA 3RGBA 2DVBA 3ZYRA 3PIGA 1I5ZA 4I3GA 3BN6A 1CR7A 2W52A 3LPGA 2XXZA 3N9PA 3V56A 3V0BA 3I2DA 5K0UA 1V6OA 4ISRA 2JEMA 2DUOA 2ZX3A 3SQOA 3A22A 4R4XA 3NV3A 4EN6B 2VMDA 1W2NA 3AKPA 3Q8AA 1F9KA 2VM9A 4X6QB 2ZEWA 1AR83 3U37A 1ZRRA 2VTXJ 2GN3A 1GANA 5FZOA 3OGRA 4S2GA 1XSRA 1L7LA 1JZ6A 5TSWA 4QXKA 4CTEA 2FDIA 1E5RA 5LCWL 1CZTA 4Q4V3 2UWCA 4C0BA 1N3PA 1EUUA 1T6GC 3FE5A 3RMXA 3VD4A 2DV9A 2RR13 1ACCA 3WT3A 2ZGQA 1ZRCA 1VPHA 3MW3A 1XU2A 4HT1T 4A41A 1N3OA 1GP5A 1H6XA 4YVSC 3SITA 5C33A 1OD5A 2R0FA 1IPSA 2FDGA 1KRIA 5D2AA 2CY6A 3PTRB 1W0PA 4DRRA 5A33B 1UKRA 3USUA 4QDQA 1YI7A 5K4LA 3KCCA 3CLPA 1LAJA 2WS93 2XL9A 4P14A 1CZVA 2HEYF 3JCIA 5C4WC 1UX6A 2B4KA 2BGPA 3HT2A 2VZSA 4WZFA 4K8FA 3QOPA 5IVBA 1G9DA 1AYM2 4RD7A 2IXHA 5C8CB 2ERFA 1I1EA 2QQIA 2VMCA 2VZ3A 3VBUA 4Q5OA 3LSEA 4URAA 3WY6A 2WO3A 5FPUA 2O14A 3I54A 4ZU5A 1FATA 3M1HA 4TN7A 3JD73 1WMDA 2PAKA 5DABA 4CUGA 5JPMB 1AL22 3S7IA 3OG2A 2ZGNA 1HV1A 1A78A 1LU1A 1L7RA 1C3HA 1RUD3 2JG8A 1ENXA 1UAIA 2ZAAA 3GZUC 3I97A 3OYWA 2ZHNA 3VZJA 4Z1VA 4CPBA 1RXGA 4NWWA 5IVCA 2YB7A 2VG9A 1ULGA 1AYM1 1CZSA 1K12A 3FN9A 4XQDA 2CNAA 4QKFA 4YVSA 5DUVA 4CP1A 4ZZ8A 1UOGA 4EWAA 3OBZA 5I8SA 3C7OA 5T55A 1QKQA 1FX5A 2ZOEB 3PHMA 2ZAHA 5IT6A 1EYBA 1ULEA 1SBFA 1VBE3 1WD4A 4CEWC 2BERA 1J1TA 1KITA 2E31A 3AP4A 4RYDA 5C4WA 5A7WB 3H9AA 1AL21 2FBEA 2XB6C 3FWEA 2W08A 4TLFA 3M3CA 2VCAA 4GD4A 3VD7A 5JWPA 3IIIA 4BLJA 1BLZA 4URTA 5F5AA 3OTFA 3ACHA 3LE0A 1LHOA 5C71A 4KH9A 1LHVA 2D5HA 4QX5A 3AZXA 4WM8C 4DY3A 3POJA 3WDTA 3H8OA 2P34A 5I8YA 1SLTA 3B9IA 3NKGA 3VHRA 2DVGA 2XUMA 2HWC2 2JB4A 4CVUA 1COV3 2B42B 1AZDA 1IG3A 2P3IA 1VB2A 2QE3A 5BNOC 4HK8A 2A3WA
chains in the Genus database with same CATH topology
1ZZ6A 4IV1C 1ENSA 2WT0A 4FPCA 3M3IA 5DZGA 3H1MA 2CAVA 2XLFA 4IEWA 3MPBA 1ND3B 1N1TA 4CEWA 2R041 2UWBA 1VALA 2PHTA 1DQ5A 1UZZA 1VRH2 3IPVA 4HLTA 1OA2A 1AR82 3GZAA 4KWLA 4PJYA 3WUDA 2YROA 4YLZA 3WCSA 4GMP3 4DFSA 3PMSA 1J3QA 4GKXA 4Y24A 5F5QA 1NQJA 4WM8A 4CDUB 1DQ2A 3N36A 2HWF3 4M01A 1A8DA 1X8MA 4Q4V2 5DUWA 1WLDA 5BNOA 2H0VA 3GBWA 2WIIB 1JH5A 4IV1A 1OFSA 4XFFA 1VRH1 4I0AA 2YMZA 2YDEA 1QJU3 1SCSA 4FP2A 3TWIA 1AR81 3RYKA 2VOXA 2X5IB 3V64A 2TEPA 1UIJA 2BNNA 2PN5A 4Q0UA 2A3XA 3LA7A 4Q4V1 4XQ4A 2WS92 5CIRA 5T52A 4OHZA 4E2GA 1R1ZA 4Z8BA 1GBGA 3A0KA 4YZ2A 4YVWC 4XYXA 1V9U3 2AUYA 2RM22 1O4TA 1UPSA 5FMOS 1CPNA 4Q8LA 2O8QA 2KXLA 4AFDA 4EWEA 3SISA 1LENA 2XVLA 4XF3A 2OUJA 4P9YA 1O3SA 1QDOA 4XW3A 4L2NA 4D3WA 1QJY3 4LBQD 3TN93 3JD72 2WS91 4FP3A 1ZZBA 1QGLA 3ZYIB 3MPPG 1M4WA 1OPMA 3SH5A 4OI0A 1CVNA 3I4IA 4RS5A 3ZDSA 4MXVA 2JG9C 1UU6A 1Q8PA 2Z69A 3E5XA 4FPEA 5FPZA 2VOVA 3M2MA 1VBB3 4JTNA 2HKXA 4Q1RA 2F6BA 2PAMA 1VBE2 5H9PA 3JD71 3WQ7A 5JOZA 1BQPA 1RUD1 2ZHLA 4LO7A 1REEA 4LBJA 4WZCA 1H0BA 1ASJ3 3PLQA 4YM0A 4AVCA 2Q8OA 4DS0A 2XWJB 4KNCA 2D98A 2C5DA 4J1WA 2YGMA 4RQPB 2GNBA 1LGNA 3VKFC 1I9RA 4NVPA 1VAKA 1DG6A 1COV2 4YFZA 1VBE1 2QJVA 5KC6A 4NR1A 4R9BA 2QDRA 1EV12 3RI9A 4ES8A 1WGPA 4KG0A 4B4PA 1GZ9A 2OPKA 1HQNA 3NW4A 3O5SA 2ARXA 2A73B 4ATFA 1N1YA 2CL2A 4L99A 2B45X 3RDIA 3D0JA 4KBBA 3ZXAC 2EAAA 1COV1 1J3PA 1G9AA 3O0XA 1IS6A 4XJZA 1S0IA 3INAA 4R9DA 3ZXLA 1JBCA 2D6KA 2QZ2A 1W6MA 3K48A 3QH7A 4L9BA 3WDUA 5CFDB 4Y1XA 1ENQA 3ZPYA 5BNPA 1H4HA 4ATEA 4YARA 2MPFA 3D8CA 4JGZB 4AE2A 3WW3A 1HDKA 5HCBA 4BE3A 3D82A 3VBHB 3KM5A 3POWA 2ZHKA 4AF9A 1S2BA 3P3NA 5FTTC 2DCJA 3H50A 5GM0A 3VGIA 1JN2P 4MUVA 5F6LB 3AFGA 4BIFA 4BZ4A 1MVQA 3AP9A 4PIYA 3VBFB 2D6NA 4DQAA 2GMPA 2WQ4A 2HWF1 4Z82A 2VMHA 1ZRDA 4CDQB 2QNKA 3O0WA 3AMMA 1J59A 5L7OB 3MLKA 1D0GA 2YPJA 1QMJA 3AP6A 3FMGA 3ZXKA 4LHLA 4NHMA 1H1MA 1UIKA 3D0SA 4PQ9A 3AZYA 4QQPA 3SLIA 1H8TB 4KU7A 1E57A 4N43B 1PZ7A 4WVVA 2ZJCA 1R1A3 2E7QA 3FFZA 3WV6A 5JOWA 1NCQC 4GH4B 4AVSA 2WZR3 1BMV2 3LGRA 4RHV3 1Q3EA 1GZCA 4S2DA 1LB2A 4A7YA 2WT1A 2ARBA 5J3UA 1OHFA 1Z7S3 4Q0QA 1N47A 5EFUA 3OPZA 2IXCA 1JYIA 5C9AC 2R073 2XJPA 1V9U1 1WLCA 4P9WA 1H8VA 3FFQA 2ZABA 1GNZA 3WD5A 5FDBA 1NCRC 4QPIC 1WW4A 1AR92 3WG4A 1VBB2 4XFCA 4K7JA 2XJRA 3FX3A 3JUUA 4JRAA 2ZGUA 3OGJA 4UXAA 1BMV1 4H7LA 1BCXA 5T50A 3TNQA 3AB0A 4Q4X3 4R4ZA 2D97A 5IK5A 2D6PA 5J09A 1HXS3 1AX0A 1ASJ2 2BYVE 2ZTNA 1UMZA 4E9KA 2Q30A 2NP0A 1CD3G 1NCQA 1PMIA 3I59A 1VBB1 3AX4A 2ZGSA 4XQWA 3ZFEB 2GZWA 2DCZA 1S0GA 2Q1ZB 3PJYA 5C9AA 1WMEA 2JD4A 5H9QA 4AHWA 4XBLA 4LEJA 1ASJ1 2BFUS 3H8UA 4J1XA 4SBVA 2CV6A 1W6NB 1NCRA 3M3EA 1H9WA 4QPIA 1MS3A 1ZNPA 4DOUA 2H6BA 3KT4A 4WVMA 1R082 1S0DA 2HWB3 3LOIA 3R6SA 1O3QA 2DU1A 1Z0HA 2QKDA 5I93A 3DPRB 3OF1A 2VVDA 1RUI3 2D43A 1X33A 5JIUA 2WSVA 1AR73 1RC6A 1GSLA 2RS52 2Y0OA 2ZGMA 1KDKA 2PHLA 1FOD3 3WG2A 2DUPA 1PK6C 1QQP3 2D6OX 4LA2A 3ZMOA 3VDDB 3B01A 3KGZA 3SH4A 5GKAC 1OPOA 4FOVA 1K5MC 4HFSA 3R4UA 3WVJA 4HL0A 2XLGA 4EN7B 2QCSB 3HD8B 1AUYA 5FFOC 3ZX7A 1MZ5A 1FV2A 3OD4A 3KQRA 4OHWA 5JOXA 1DQ1A 1IHMA 4YG3A 5J96B 5FPXA 3B94A 4KG8A 1W6PB 4E4SA 2ZX1A 1XQNA 1YI9A 1UL9A 1WCKA 2LALA 5LRRA 4MV2A 1RJ8A 4R9CA 3THPA 3TB0A 1PK6A 1CESA 3BALA 4HPKB 3GZTB 4I09A 1A3KA 4MXWB 2A3YA 3VBRC 4AXOA 3S30A 4LBMA 4AI3A 1JXNA 2ET1A 2WZR2 4C1XA 4RHV2 1K5MA 2VUJA 4YW3A 3B7MA 2HWD3 5JI9A 3C2UA 4M3CA 4D7YA 2IFWA 2R072 1VIWB 5J7MA 1TMF3 2SBAA 3NV4A 4LT5A 1F5FA 1R1A1 4YGDA 5C6CA 3M8LA 4PLOA 2WZR1 5H9RA 4RHV1 2VOKA 1MQTC 4AW7A 4Q4X2 1ZVFA 1RUJ2 4XHXA 4UW6A 3OJBA 4R52A 3TBDA 2VU9A 5BNNB 4JDMA 2R071 4Q4W3 3CJXA 3WW2A 4BMBA 1Q5OA 4KQ7A 1AJOA 1BVVA 1Y3TA 2FQPA 5JPNB 5BNQA 1UD1A 3ENRA 4FPHA 4G4FA 1ND2B 1HQLA 4Q4X1 3KD4A 3W9AA 1YIPA 1TE1B 4YW4A 3UJQA 1HXS1 1PVC3 3V0AA 3R05A 1H1IA 4OULA 4PLMA 1DBNA 1JOJA 1BEV3 1QH7A 1VJ2A 4FPKA 4XFHA 2HWB2 4BIOA 5K8SA 1MQTA 3WQ0A 1RUI2 2ZX0A 3H1WA 3ZYGA 4AQTA 4JDOA 1AR72 2EVXA 4FTSA 1FOD2 4YG0A 4DPNA 4HBNA 3N7JA 2DVFA 5CU1A 4NOTA 3IMNA 2HWB1 1KD7A 1DFQA 3B02A 3BB6A 4B4RA 5GZFA 5JMCA 3MLLA 3WZ1A 1OSGA 1RUI1 2SLIA 1AR71 1XE7A 2KM2A 4QT6A 1NLRA 1C28A 4OFGA 1FOD1 2ZX4A 3SXWA 2ET7A 3M3QA 3JBG3 1S0BA 2P2KA 1LECA 4N53B 1QQP1 3UKTA 1U5XA 3WCRA 4MH0E 3AYAA 1ZZ7A 3AMQA 2GALA 3MIFA 3N7LA 5CVRA 3ZO0B 4L97A 4G3YC 5GALA 2EXKA 4K40A 3IIAA 3VZLA 1WLTA 1HRV2 4IEPA 3BCWA 3ZMNA 4YM2A 1PIV3 4Q26A 4QQ2A 3MFAA 1F8VA 4YGCA 4IEYA 1AR62 3ZXDA 3MW4A 2GN7A 4DNYA 1SBEA 4XMAA 4R8HA 4JQRA 5CB7A 4XJUA 4HVRA 5A32A 1XXNA 4Y20B 4RL7A 2E53A 4ONUA 2R1DA 2DWRA 5K0UC 1QY4A 4IV3B 1RTVA 4PIZA 1HRV1 2VNOA 4CYDA 5E8AA 4XPVA 1AR61 4AEDA 2AREA 2MEV3 4Z2WA 1A6CA 2NN8A 3MIBA 1TEIA 1IS5A 4K20A 4L11A 4RR3C 4EN8B 2XJQA 2Z2SB 1HKDA 3PVEA 4XFAA 3VLBB 1FPN2 2ZZJA 1HLCA 2JJ6A 3JB4C 1DIWA 2HWD1 2D44A 3AJYA 2JKBA 4Q8KA 2ETEA 2EIGA 4Q4W2 3VHNA 4NWVA 2XJVA 4E2QA 5FQ0A 1LHUA 4Q27A 3MDPA 3IDEA 4C90A 2VECA 2WNUB 4OHXA 3ZFGB 1A8MA 5L19A 4QQHA 1Q8QA 5E1RA 4EROA 5C4WB 3ELNA 1FPN1 1D2SA 1S55A 2Y26A 2BTVC 4PF5A 5FAXA 1OA3A 4GWMA 2Y0IA 2E7AA 3DKWA 4ZU4A 3ZN6B 1DQ4A 1FI2A 2NYYA 1PZ9A 2ZGOA 4Q4W1 4HKOA 1IS3A 1ALYA 1MR5A 4HSJA 4RR3A 3VKNA 3PVBB 5AC93 3E97A 3VBUC 1GFF2 5JLVA 1KDMA 1O3TA 2BNOA 4XE9A 2W39A 1CAWA 2XJSA 2E9QA 5AVPA 4FPJA 2ENRA 3FLTA 3RQ0A 1WW7A 4I0WB 2JG8C 4OI2A 3VKMA 4F7ZA 1PVC1 3J4UH 1FYUA 1BEV1 2R32A 1B09A 2AR6A 1YWKA 3NAPA 5DG1A 3EHKA 2PHRA 3AJZA 2RMU3 1H9PA 1XNCA 3APBA 3JQXA 4C91A 3JBG2 5BV6A 3AKRA 4Y1VA 1PNFA 5FCCA 3CU7A 2I74A 5HCFA 2R30A 3AK0A 1AYN3 4GQ7A 2P3JA 4KGGA 4D69A 4YGBA 3ZIWA 5BNOB 4BPZA 1AXZA 2PHDA 2GNMA 1LOFC 1C4RA 4QPGB 1O5UA 3RJRA 1C8M3 3KB5A 3ZSEA 2B39A 3T1LA 1KS5A 3AMNA 1EP0A 2DVAA 4HMZA 3GALA 2HWE3 2VMIA 3JBG1 1NXMA 4PLNA 2WNVC 3WW4A 3HBZA 3FLRA 3LSDA 1AXKA 1LULA 3VN4A 1FMD3 4QGLA 2R6QA 3RNSA 4M0HA 2BGCA 3L2HA 2ZMNA 1HQWA 2XVKA 3B9CA 4HANA 3ZFFB 1PIV1 3SNMA 4E4ZA 3E5UA 1PO23 1V6KA 4XBQA 2RHPA 4IESA 2DTYA 1LOFA 3B69A 3U11A 3OBTA 2WZPP 1DZRA 5JSRA 2R042 3FUOA 2MHFA 4W6YA 1AF9A 1ZM1A 3KSCA 1PVXA 3E6CC 4I01A 3NSTA 1QOOA 3KGLA 4XJWA 2D40A 1CAXA 2WNVA 2MEV1 4MSVA 1CPMA 1LESA 4NO4A 4Y22B 3HAGA 4AI1A 5KHKA 2BVBA 4C0HA 2ES3A 3HN1A 1DU3D 1QXJA 5EXOA 4YVWB 5JSPA 4Q0VA 2XVGA 2R063 4LHNA 2JICA 1NOVA 1PNGA 3CJIB 2DVDA 5AC92 3VHPA 3OD0A 1GV9A 5JSOA 4XXPA 1WBFA 3LB9A 1XNDA 1YJLA 3RI8A 4XXAA 1LRHA 2O0OA 5C8WA 2XG3A 1HRI3 2JE7A 2RR12 1CONA 5GZEA 2JG9B 3UV9A 1J58A 5ABJC 3RJ2X 5A33A 3SH3A 4RS5C 4KL1A 4TYSA 1LGCA 4I2OA 4FO9A 1AX2A 4AG4A 5AC91 3M3OA 3OY8B 3USSA 5GZDA 5CFCB 1KFUL 1Q8OA 1WLWA 5C8CA 3I7DA 2A5ZA 1UPIA 1SBDA 2B7YA 1YCIA 2RR11 4B29A 1SDWA 1H2NA 3IBMA 3UKNA 1C1LA 3WX5A 4MYEA 5BY5A 1J3RA 1ULDA 2ZGKA 3IDBB 1AYN2 1GQHA 5A3LA 2D6LX 2CGPA 1XYOA 4CEYA 1Y43B 5I0UA 3H0OA 1V70A 4QM8A 1MZEA 4RSUA 2RMU1 3MEPA 4MGIE 3TYJA 4FXGB 3DF0A 4XBNA 1RUD2 3WOGA 5ABJA 5KXCA 1OFNA 1V6NA 1SLLA 1CJDA 1ENRA 4AVBA 2PHUA 1AYN1 1V00A 2P3KA 1SACA 2VW0A 2D5FA 4N9HA 2E63A 2FMYA 1BXHA 1WCDJ 4XETA 3KLSA 3H7JA 1ZRFA 3WP4A 1PZ8A 2E6VA 5ACA3 4CDUC 4U36A 4G9SB 4DMIA 4HN0A 4AK3A 1PO22 2QDNA 2HWE1 3AP5A 1QJZA 4D94A 2IC1A 1VBD3 3J8F3 1EAH3 4YYOA 5IK7A 3MIDA 5BNPC 1FMD1 3VHOA 2R16A 3TNPB 2JECA 2X5IC 2YXSA 1H1AA 3VL8A 4BYYA 1CN1A 2X8KA 4XOGA 1CAUB 1RHI3 4AQSA 2C9AA 4QD2A 4LBLA 2YHJA 2PFWA 1PO21 3GF6A 1UKGA 2IZWA 2IFRA 4FTEA 2VGDA 3WNXA 2JX9A 5JVVA 1XU1A 2WWSA 2WFF3 4AHYA 4S2HA 4LR4A 4A2UA 4LE4A 4CDUA 3AYDA 4HKWA 1LKNA 1YFYA 3N7KA 1PHMA 5DDJ3 4XZPA 1OQDA 1VLNA 4YZ4A 1HX6A 4BM8A 3GNEA 4K1YA 1NA1B 2ATFA 3I59B 1U0AA 2B5HA 4H55A 2HWF2 4XIOA 1IKQA 2X5IA 4FPLA 1GLHA 2GSYA 5C9AB 2EAKA 3ES1A 4HKLA 1QF3A 1QWRA 3VZOA 4H3WA 2R061 5LK5A 1OLQA 1VR3A 1QJU2 4LHKA 3OCPA 5I0RA 1KS4A 4GMP1 1XYPA 1F5JA 3AXEA 2DFCA 3U0ZA 4FCAA 4MGYE 2I2SA 4K3UA 3B3QE 1GNHA 1RITA 2GH8A 2G9FA 4XIKA 4COYA 4Q4Y3 3EBRA 3POSA 2YZ4A 3DGTA 1HRI1 4RQPC