5DUVA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
NPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duvA00
4DPNA 4ISRA 1FV2A 1LHNA 3R4SA 1WBFA 1ULGA 4LBJA 4YM1A 1B09A 1W6QB 4YW3A 3N35A 2CWSA 3OPZA 2P3KA 3T1LA 1VAMA 1UL9A 5JOYA 4FPJA 3AZZA 5JVVA 1LGCA 2DTWA 1R1ZA 4YM0A 4ITCA 4GWMA 3O5SA 2CNAA 4XMAA 4M3CF 3HR9A 3AJZA 3M3OA 4Y20A 1G9FA 1YIFA 2ZGUA 1GLHA 2GN3A 1LODA 3GNEA 2D6PA 5T5LA 3WG4A 3LCPA 3WUDA 4PF5A 1CPNA 5AVAA 5GZCA 1MS8A 2PELA 3KM5A 4FPLA 2GMPA 4TZDA 1JXNA 2DV9A 1G8WA 1UZYA 2PHWA 4XJWA 4XXAA 2AREA 2A75A 2EF6A 4BMEA 1BJQA 2B7YA 2AYHA 1QGLA 5DUXA 1HLCA 2D44A 3LSDA 4UW6A 1LEMA 2PHRA 2W08A 2R49A 4FPOB 1FNZA 1N1TA 2ZGQA 4LBLA 4L8QA 3SITA 2ZA9A 3H0OA 1WLDA 1C57A 5F9TA 4R9CA 4XXPA 1V6OA 1S1AA 2C9AA 1SLAA 1WW5A 1YI7A 1MR5A 2ZGLA 1MVEA 1W6OB 2GALA 1N3QA 3AP5A 1UX6A 2JJ6A 3ZXFA 4WZFA 4BOWA 2RHPA 1WD4A 3RRDA 1S0DA 2A6WA 3ZXLA 2XB6C 2AH2A 1ULDA 3ZYPA 3R4UA 5L73A 3OYWA 5GM0A 4ATEA 1LHWA 2D6KA 3DGTA 2D7FA 3AP4A 4XBLA 2YV8A 4XMIA 4YG0A 3TB0A 3WDVA 2JECA 4K1YA 3AJYA 3OBRA 2P3IA 1JBCA 4Q8LA 3FBYA 1IS4A 4YGDA 1QDCA 4Y1ZA 2DUQA 4U2AA 1Q56A 1W0OA 2E7QA 3N7JA 4FPEA 3RSJA 5EYYA 4Q8KA 3M1HA 2I2SA 4YW2A 4P9WA 3RMXA 4BM8A 3RS6A 3WG1A 3ATGA 4Q1RA 1ZM1A 2D3RA 4YGBA 4XILA 1IOAA 2OUHA 4KBBA 2GNDA 2SBAA 3JUUA 1G86A 4Y1VA 1W6NB 1C4RA 1QOTA 1QOSA 1FV3A 1LCLA 5GZGA 5JOZA 4AWDA 1QKQA 3LSEA 1KDMA 3NV2A 1GANA 2EXHA 4R9BA 4HANA 1ENQA 1V6IA 5T52A 3RMYA 1LGNA 2PHXA 1DFQA 4C1XA 3IKWA 1ULCA 1UMZA 2AENA 1G9CA 3VKOA 1LHVA 1XQNA 2NMNA 3OY8A 4LBQB 5HCFA 2A3YA 2D6MA 2UU8A 4YZ3A 2GN7A 3I8TA 2A70A 3NV1A 4K1ZA 2E51A 1N47A 1AVBA 1LU1A 4SLIA 1Q8VA 1SLTA 5H9SA 5HCAA 2WT0A 3O12A 5FREA 1V00A 5JLVA 1FATA 4M01A 5IK8A 2DTYA 4BMBA 4BPZA 1S0IA 1LOEA 1RINA 1RIRA 4GWNA 5DUUA 2NP0A 1A78A 3N7MA 4FPGA 2TEPA 2A6XA 3BODA 4H55A 5IK4A 3O0XA 1F5FA 4GXLA 2NZ9A 5CNAA 1C1FA 1F31A 1GBGA 1WW6A 2D3SA 2VXRA 2WSVA 2ZMNA 1MS9A 3HN1A 4FPCA 4XDQA 4XJ9A 4YG3A 3UL2A 5BYNA 4Q27A 4XBQA 1GZWB 2OW4A 2AR6A 3ASIA 2ZZJA 3QLQA 5DZGA 1MS0A 4M3CE 3JU9A 5GLTA 1QNYA 1AXKA 4YW4A 2E53A 3WDYA 5IT6A 5HCBA 2AGSA 5T5PA 1LECA 1VLNA 5E89A 1IS5A 1AX1A 3BTAA 1N3PA 1Q8PA 1KJRA 2EIGA 1DQ4A 1V6LA 3ILRA 3D5OA 1OKQA 3CNAA 1RITA 1ZA4A 3ENRA 3WCRA 1LOGA 1IKPA 3WG2A 5GJ6A 2YMZA 4Q1PA 2DUOA 5DG1A 2VW2A 1N1SA 2DVBA 1V6KA 1AJKA 1EPWA 4XIKA 1GV9A 2DVDA 2WT2A 2A5ZA 2NM1A 2UURA 2ZMKA 3WV6A 3ZXKA 4U36A 1SLLA 4TYSA 1LESA 1WW7A 1W6OA 3INAA 4JRAA 2W39A 2VY0A 3PVOA 4P9XA 4P9YA 1HQWA 3ZSMA 4FPHA 4K21A 3DUIA 2G4IA 4YW5A 3V0BA 3N3HA 3SH4A 1Z0HA 5GALA 2AUYA 3FUOA 1X50A 4UW4A 1GZCA 1JW6A 1HQLA 1LULA 1WLCA 1N1VA 1GKBA 4LBMA 1G7YA 4F83A 1WUVA 1HKDA 3FLPA 4YM2A 2ARBA 1YXWA 4OZXA 4ASMB 4BLIA 2DU1A 2A3XA 1AX0A 1AXZA 1W6PB 1FX5A 4YLZA 4LBQD 2A71A 3WHTA 3A0NA 3IMNA 1DQ2A 3WDWA 1LOAA 1N1YA 2D6OX 2ZKNA 4YG6A 4YM3A 1OFSA 2VU9A 3AZWA 4YGCA 3OJBA 1GICA 4IQPA 3V0BB 4ZKTB 1G9AA 1S0FA 1IS6A 1UKGA 1LOBA 5T55A 4XE9A 2A6ZA 2DVFA 3ZPYA 2EXJA 1BXHA 1IKQA 4XOGA 3SNMA 4CTEA 2W52A 1S0EA 3WUCA 1DQ1A 2BQPA 2CWMA 2PHUA 4LBKA 2GDFA 1W6NA 4PBOA 3IM0A 2YY1A 1MZ5A 2DU0A 5T5JA 1UAIA 1NLSA 3TAYA 2SLIA 2Z42A 2VUAA 1YRZA 2PHFA 3AYEA 3D4KA 1I3HA 1QMJA 3MW3A 3SH3A 3PMEA 1H9PA 1LEDA 3AXDA 4XTPA 3L2YA 1MS4A 4WV8A 3T2TA 4AVSA 1DQ5A 2ZBJA 3N7LA 1QOOA 2ZMLA 5T5OA 1O4ZA 3AYCA 3WDTA 2V5YA 1V6JA 2ES3A 1LHOA 4FP3A 4LBQA 3WZ1A 4AVVA 1MS5A 2W68A 4MYEA 2A3WA 2YROA 3B00A 4M3CB 3R05A 1PZ9A 1C1LA 1JN2P 1PZ8A 2ZGNA 4RA0A 5GLWA 5DG2A 2ZABA 2XG3A 4FVVA 4NO4A 3ZXEA 4XHXA 1D2SA 1U0AA 1DQ0A 3A4UA 1WLWA 4M00A 2CYFA 2DURA 1I1EA 3AP7A 2A7AA 2ZGTA 5DZEA 3W58A 4FPFA 2VW0A 3OBTA 2EALA 5DUWA 4DS0A 1AXYA 1H30A 4UW5A 2WKKA 1N3OA 2WLQA 3M2MA 3ZYRA 1GZWA 2E6VA 3O0WA 2R0HA 1W6MB 3PVNA 3SLIA 3PVEA 4XJAA 3BIWE 2GMMA 1GZ9A 1KQRA 4JC1A 4R9DA 3W59A 5DUVA 3ZXJA 1AX2A 5F5QA 5T50A 4LBNA 4DFSA 2EXIA 5KXBA 1SBFA 3AXEA 2JDZA 1J1TA 3KQRA 4ZXKA 1SLBA 4C1WA 3AZXA 2A6VA 4YGEA 1DIWA 3IN9A 5H9PA 1KITA 2P2KA 4FOYA 3ZSKA 2DUPA 1LOFC 2FHRA 3B01A 1SCSA 2VW1A 2ZHNA 2ZHLA 3OGGA 2ERFA 1QDOA 4XZPA 1A8DA 4R9AA 1G9DA 1DZQA 1KRIA 1WW4A 2NMOA 2ZAAA 2WNEA 3POSA 4FPYA 4W65A 3B69A 1AF9A 3AP6A 1W0PA 3POYA 3VKNA 1VIWB 4ATFA 1WBLA 1WD3A 3SISA 4DQAA 4LBOA 3V0AB 1LU2A 2LTNA 5JOXA 3BOPA 1NXD1 4Y1XA 3AZVA 5GLVA 2CY6A 1MACA 1JYIA 1ONAA 2EXKA 4XYXA 5EWSA 2D3PA 5E8AA 3USUB 1CPMA 2WQZC 1CVNA 5SV8A 3WLUA 3GALA 4Y1UA 5KXDA 1LENA 3Q9OA 3VKMA 1JUIA 1SLIA 3IPVB 4P14A 2DVAA 1W6PA 2JKBA 4HL0A 1CR7A 3FUQA 4Y22B 2ZGMA 2JD4A 2UWCA 1MVQA 1GNZA 3NWKA 2D43A 3APBA 1TEIA 1SBEA 2NYYA 1ULEA 1MZ6A 1QF3A 3AYAA 3MPPG 3M3CA 1DLLA 2P3JA 5H9QA 1DYPA 2ARXA 5CBLA 3ILNA 1V6NA 2ZACA 3B3QE 2ZGOA 1OQ1A 1UZZA 1S0CA 2PHTA 1LJ7A 1CIWA 2OUJA 1A3KA 1CQ9A 5GZEA 4AGGA 1DGLA 2ZHMA 5IK5A 3O0VA 1Q8SA 1GSLA 5KXEA 1GYKA 3AYDA 4GALA 3ILFA 4FQZA 4K20A 4AGVA 4CZSA 2A6YA 3AX4A 3QCWA 3RQ0A 1HDKA 1LGBA 1WCSA 2H0BA 1LOCA 4FOQA 2R0FA 4Y24A 3FLRA 2UWBA 1KDKA 1JYCA 4JCKA 4RL7A 2ENRA 4WVWA 2DWRA 2FMDA 3AK0A 2ZGPA 4DRRA 3NV4A 4FOWA 1MS3A 3UJQA 1QU0A 4Y20B 4M3CA 1VALA 2GNBA 2GNMA 3AFKA 1LHUA 2ZGSA 1ULFA 3FLTA 4XJ8A 5DXDA 1UPSA 4YZ2A 4BQ1A 3V64A 3ZSJA 1D0HA 3MEPA 1ENSA 4UW3A 4XIOA 1IS3A 3HMYA 1V6MA 2R1BA 1BQPA 1BYHA 5CB7A 3C2UA 3WHUA 1S0GA 1S0JA 2D6NA 1DBNA 4Y1YA 4ISQA 1CN1A 1G9BA 1H9WA 3WDXA 5H9RA 3SH5A 1DQ6A 4DRVA 4AGRA 4D69A 3MW4A 1Y7BA 2R16A 2V73A 1BKZA 2ZHKA 2E7TA 2VH9A 1SCRA 2DVGA 4FP2A 3WVJA 4Q2FA 1GNHA 1Q8QA 1JHNA 1VAVA 4FPKA 4FOVA 4YZ4A 1W6MA 3T1MA 4YW1A 1PZ7A 2ZGRA 5JDBA 3N36A 2GNTA 2UWAA 3D6EA 1BZWA 5IUQA 2LALA 1ENRA 4AYUA 3FFZA 2CL2A 1CJPA 2ZGKA 5GZDA 5LK5A 3VKLA 5DZFA 3U4XA 1CESA 3M3QA 1UN1A 1YO8A 4FQ4A 4CRQA 2KM2A 3OYWB 1APNA 2CTVA 1SBDA 1DYKA 4XJUA 3I4IA 3A0KA 4WVVA 1JOJA 3B9CA 4Y26A 5JMCA 2Q5TA 2P37A 4NOTA 2DYCA 3MW2A 4XJZA 3UJOA 1AJOA 3AP9A 3WG3A 1SACA 3WNXA 3VV1A 4BLJA 5CA6A 1SFYA 1AZDA 3N7KA 2HYKA 5GLZA 3ZVXA 4Q26A 1QNWA 5EYXA 2NN8A 2R1DA 3V0AA 5KXCA 3PJQA 1O4YA 1LTEA 2JE7A 4XBNA 1S0BA 3AZYA 3NV3A 2WSUA 2C5DA 4PBPA 5FRAA 4YFZA 3USUA 1URXA 3ZSLA 4YZ5A 4GA9A 4PQ9A 5GLUA 2P34A 5GZFA 1FYUA 4GKXA 1KJLA 1FAYA 3WOGA 3VUOA 2OVUA 5CAZA 3UK9A 1SLCA 1DHKB 3IPVA 4YZ1A 5E88A 1FNYA 1W6QA 2JE9A 4GKYA 5EXOA 5T54A 3RG0A 4Z8BA 4Y22A 3WDUA 3M3EA 4XTMA 4XHBA 3OY8B 2WJSA 3VKFC 5JOWA 3WCSA 5IK7A 3POWA 4AVTA 1F9KA 2EAKA 2WT1A 1CONA 1Z78A 2GMEA 2YZ4A 4I30A 4YFWA 3V65A 1Q8OA 2D6LX 1LOFA 1MS1A 1YYNA 4PCRA 2YXSA
chains in the Genus database with same CATH superfamily
1J59A 4HMZA 2ZEYA 1UY1A 3I2FA 3BKZA 1AR92 4ISRA 1R082 4LBJA 5DAQA 2JIGA 2ZTNA 4QM8A 1GOFA 1W6QB 4R8HA 3WP3A 3ZYGA 1AR81 5C3RA 4O61A 4CUAA 4AEKA 2P3KA 1UYPA 1UL9A 1WA6X 1UOBA 4Q4Y2 5CFDB 2DTWA 1ZZ7A 4AI8A 1OVPA 2OA2A 2X8KA 2XWJB 3I2DA 3O5SA 4ITCA 4XCBA 5A3OA 3VD3A 5FY4A 4QDQA 2PA7A 2C6SA 2MEV2 3L2HA 4AI0A 3H9AA 4OUEA 1H2MA 1DGRA 5I0UA 1GLHA 2R061 4GH4B 3WUDA 2ET1A 4RQPB 1YFXA 4I0BA 3S30A 1V9U3 3E5XA 3BPSA 1OQDA 4I0AA 3WQ1A 4N43B 1JXNA 4E4HA 4XFHA 3BYWA 1RUI2 4LXLA 2FDHA 5FY9A 1OF3A 4QWNA 4UBGA 5LASA 4XFIA 1C8NA 2PAKA 4COVA 1AR63 1UW8A 2XPJA 4BQYA 4FCAA 1HLCA 5FYBA 1GFF2 3HT2A 4CDUB 5C3SA 3LEKA 3OPWA 2IC1A 1N1TA 1XSRA 4L8QA 2ZA9A 1VBB3 3NSTA 4PIXA 4GB32 5F1RA 3T30A 5F9TA 3MF9A 1D0GA 4XXPA 3J8F2 1EPZA 1BVP1 1SLAA 1WW5A 2QQPA 2ZGLA 1RC6A 1KEXA 4LUMA 4D8MA 1MVEA 4ZZ5A 1UIJA 2VMEA 3I59A 4JTOA 4TXWA 4EYUA 3VBUB 5C9AC 1UX6A 2JJ6A 4M0HA 2ZXQA 1FOD2 5FY8A 1ND3A 3TN93 1UY0A 2HWB1 3KD4A 1S0DA 1REFA 3K4AA 4QPIC 2JB4A 1QQP2 2AH2A 1G6NA 3Q8CA 3SCFA 3JXSA 3I2HA 3WW2A 1QJX2 2WAOA 4YG0A 5LA2A 3TB0A 1US2A 2JDYA 4K1YA 2ETEA 1KD7A 3OBRA 1W9WA 4LK7A 1PGW1 3FBYA 2VCBA 1IS4A 2RM23 3LDRA 1NX9A 1QDCA 2DUQA 4CSWA 2DCYA 1MQTC 4BQXA 1CAVB 1QY4A 2ZEWA 3KS7A 4RS5B 1S4CA 3M1HA 4MHRA 5FAXA 4YW2A 5FWEA 5DAPA 4AEDB 4CA9A 1RUJ1 4IEPA 3RS6A 3UKVA 2VUCA 4IV3A 4M0NA 1ZRCA 1ZM1A 3N9OA 1KXGA 1NA1B 2D3RA 2VCMA 3Q8FA 4AHXA 4J1XA 2OUHA 2PTMA 2SBAA 1VBD1 1QOTA 1XXNA 3NNFA 2VZOA 1LCLA 3WNPA 4RR3A 4AFAA 4P5HA 5EPAA 5JOZA 1KDMA 3PUHA 3WXPA 1ENQA 5F3IA 1JODA 1ND2B 3RZMA 2PHXA 4OHVA 3ZN5A 3OUJA 3TWIA 2E32A 4INDA 1POQA 1ZBA2 2XJSA 4C1XA 1ULCA 2TNFA 1HN0A 3JCIA 4HETA 5FZBA 4NE9A 2Q8CA 3VKOA 1XQNA 2NMNA 1C5IA 1YQ6A 1AL0G 2WNUA 5K0UB 4IEZA 2GN7A 4K1ZA 3J4UH 4ES9A 4EZHA 1N47A 5EP9A 4K6BA 1OVSA 1Q8VA 1CD3G 1TG7A 5H9SA 4DUVA 3S5QA 4LPLA 5L9BA 3EMRA 5M0TA 1YQ5A 4RGGA 2HWF1 1O3SA 5IAVA 1X8EA 1RIRA 4GWNA 2ORZA 1PNGA 1L3JA 4FPGA 1EAH2 1VMJA 3ZPOA 5A1FA 1W3XA 3RZKA 1XRUA 5C4WA 3UKTA 3D0SA 2IWGB 3LF7A 3BTZA 3KGLA 2ZMNA 1L7LA 2R073 1QJY3 3HN1A 4YG3A 3UL2A 1RUG1 4Q27A 4OI0A 4QQHA 3ZFFA 2AR6A 2RDQA 4ASKA 3I3MA 4V2WA 2LW8A 3ZKUA 2O0OA 1CJDA 2RMU2 3ZN6A 1CAUB 4AI2A 4EQVA 3WDYA 5IT6A 2JEMA 2D93A 1DGWA 1IS5A 3KCYA 2UY8A 1QJEA 1Q8PA 2IXCA 1RMU2 2JXAA 2PHDA 4YYOA 4TLGA 3K2OA 1OKQA 4BH9A 3AMNA 4AK3A 3CJIB 3ENRA 3FWEA 5AC92 2LUWA 2QZ3A 4GULA 4JGYA 1BVVA 1H1AA 5F8PA 4Q1PA 1VBE3 2VR4A 2VW2A 2Y6HA 5T3NA 4AF9A 4AFMA 1EPWA 4AFBA 1AR93 3D8CA 4XF4A 5LY2A 1R083 2Z4FA 4CXWA 1L7RA 1NQDA 2NM1A 2WIIB 2ZMKA 3ACGA 3PTRB 1O3RA 1V9U1 3ZXKA 3RJRA 4E4SA 1LESA 3QD6A 5A3NA 1DGRN 1TNRA 2JDPA 4EJRA 1PGL1 3MIDA 1W6OA 4JRAA 2R6QA 1MZFA 2W39A 4QPWA 3UYJA 2XWBB 1AR61 3CBNA 4NJ4A 2BOJA 4P9YA 4K21A 2MEV3 3N9MA 4LO7A 2FMYA 4LITA 2G4IA 2BBVA 1DLCA 4OCTA 3N3HA 1OFNA 3V0BA 1YIPA 2JD9A 4FFGA 1VBB1 4UW4A 1GZCA 1JW6A 4O9GA 4EN8B 1HQLA 1LULA 1DF0A 3MIFA 4LBMA 5EJ1B 5FOBB 3M4FA 5C8CB 1OA3A 3RI9A 2ARBA 4BLIA 4ASMB 4HSJA 4G9SB 4OYUA 2H6CA 2W1UA 4JHZA 4AAXA 4XAAA 3WHTA 3TN91 1UY3A 3WDWA 3K77A 1N1YA 4QDRA 3E6DA 4YM3A 1CZVA 1NCRC 1NZCA 1YFYA 3B9IA 4M4RA 4IQPA 1HB1A 3LQCA 5CU1A 5FBJA 3IT8A 5IHRA 4GB33 2IFWA 4ZKTB 1IPJA 1IS6A 1YFWA 2WNVC 2XL7A 2Q8EA 2VGDA 4ZU7A 1RB8G 1S0EA 3WVJA 4LBKA 4QXCA 1JZ7A 2YY1A 5T5JA 4O7XA 5BNPC 4EN7B 2RM21 4LKSA 4HPKA 1FOD3 2QCSB 2GAUA 3W5MA 3D4KA 5EQUA 1I3HA 1QMJA 3AXDA 5BNOA 3L2YA 3E6CC 2ZBJA 3N7LA 3SEEA 4B3NA 1J3RA 5BUVA 1ASJ1 2HWD2 4R52A 2F6BA 4CE8A 3WEZA 5LRSA 2ES3A 4CCEA 3HQUA 1QJX3 4TSVA 5FZGA 1OA2A 4AW7A 2A3WA 3WNKA 5F5AA 2P1BA 4YPJA 1C1LA 3MFAA 3DECA 2ZGNA 5GLWA 1H1IA 2ADDA 1JOPA 4Q4X2 1PM4A 2VCAA 2MHFA 4CU8A 1DQ0A 1VPHA 3DKQA 3A4UA 2BFUL 4KQ7A 4XUTA 5JI9A 5FMCA 2CYFA 4JQRA 4FTBA 2DURA 2VM9A 3U75A 2RJLA 3NAPA 2ZGTA 2W2IA 2AACA 4QHZA 3W58A 4XQDA 3PUIA 2EALA 3ZLIA 4AL9A 3RZGA 4DS0A 5FPUA 1NG0A 3RZLA 1H1MA 4FO9A 1OT5A 2F4LA 3USSA 3POFA 1N3OA 4QPIB 2WLQA 3M2MA 3S57A 5FV3A 1O91A 2HYXA 3UNPA 3ZYJB 2E9QA 1K5MC 1QXRA 3SLIA 3PVEA 4XJAA 2EIBA 2WZPP 3BIWE 5C71A 3AC0A 1KQRA 3KT1A 2B8MA 3AVRA 3HEIA 3W59A 3ZXJA 1AX2A 4DINB 1F4HA 2Y26A 4LR4A 4ZY9A 5KXBA 2RS52 4LKEA 5A3TA 3MLKA 1SLBA 4I3GA 5ISLA 2DBIA 2WN3A 3BN6A 1UXXX 5F39A 5H9PA 3OB8A 4FOYA 2DUPA 1QJY1 2PAMA 3QOPA 3OGGA 3JD72 3HAGA 1QDOA 2AEYA 4XZPA 1J58A 4UI9L 2AEZA 4CDXC 4BQ2A 1KRIA 2NMOA 2ZAAA 2WNEA 1OBNA 2HWC2 2I74A 1SPPB 1W8TA 2X29A 4OHZA 3VKNA 4ATFA 2GC0A 1WBLA 3H3LA 4QB1A 1LU2A 1PMHX 1NXD1 1XBFA 2VBDA 2ARCA 1UWWA 2CY6A 2OPKA 3DF0A 4PI0A 4KG8A 4AG4A 4XCAA 4ZPIA 1PK6C 2QJVA 5A6ZA 3KHBA 1RJ7A 5E8AA 4IGOA 1AR82 2JDUA 1VBE1 2G9FA 2RMU3 3CL1A 5FYMA 1AR91 2XONA 3CKHA 2WQZC 1R081 4UXAA 3TEXA 2RS13 1YHFA 3I2JA 3LA3A 4CP0A 5SV8A 2TBVA 1ENXA 1UOJA 4Y1UA 1LENA 3K75B 3Q9OA 3VKMA 3WW3A 3IPVB 3RPQA 2JKBA 2VZRA 1W8NA 3FUQA 4NMIA 4G4FA 5I8YA 1XE8A 2VPVA 2UYAA 2MEV1 3APBA 1ULEA 1MZ6A 2XDVA 4IW3A 4LULA 1W9YA 4N7UA 4WM8B 3VHPA 1PNFA 4LHKA 1D7PM 1U12A 5H9QA 1DYPA 1OQEA 4I3PA 3ILNA 1V6NA 2ZACA 5F2WA 4D6QA 3FN9A 3VDDA 1OQ1A 1SFPA 3UGGA 3SCGA 1CIWA 2OZJA 2OUJA 4QKFA 1H2KA 1GUIA 1CQ9A 3I3DA 2BGPA 2VMDA 1VBC2 1H6XA 1Q8SA 3ACLA 3BCWA 3A21A 2ZPXA 3Q8AA 1GYKA 5KXEA 1JZ6A 2JDHA 3AVSA 2WS93 3C7OA 3TYJA 4CU6A 2A6YA 1FPN2 3IZOA 2WLPA 5BNNA 4ORFA 1HDKA 3MFCA 5TSWA 1W99A 3PU3A 4FOQA 2R0FA 3FLRA 1OC1A 4LQRA 3NL1A 4RL7A 4KGGA 4WVWA 4HBNA 2FMDA 3HJRA 4LIVA 4F8AA 4K3UA 4NWVA 4X8NA 3VZNA 5LA1A 4GAZA 1NT0A 1VALA 3AFKA 3FLTA 1ULFA 2YC2A 3HNMA 5FDBA 1FOD1 3B02A 4YZ2A 4AHWA 5C3PA 5EV7A 3ZSJA 3PDQA 4EWDA 3MEPA 1IS3A 2RE9A 1PGW2 3HT1A 5CG8A 5FP4A 4EN6B 4UAPA 1Q3EA 3WHUA 1S0JA 5JPMB 1DBNA 2OX0A 4DIQA 4JTNA 1CAXB 1QJX1 4JGZC 3U78A 4XAEA 3H50A 3ETQA 2BERA 3I3QA 1RUJ2 4EN0A 1NCQC 5FKCA 1NAEA 1SCRA 1EV12 4JQTA 4RYDA 4RHV3 4YZ4A 3VBHC 1VAVA 4IGQA 2Y60A 1B35C 1W6MA 3WY6A 3GHNA 3H7JA 2GP3A 3BTXA 3OTFA 1VBD2 2WINB 2G1MA 4WM7A 2BTVC 2PLV2 3S7IA 2O1QA 4NIIA 5I0DA 4AYUA 1ENRA 1OPOA 4FBFA 1HRV3 1SDWA 4JV4A 2VNOA 1DZRA 4XDOA 4NHYA 2ATFA 1YO8A 4W6WA 1NCRB 1PIV1 1HB4A 5FFOC 3OYWB 4ZXEA 1SBDA 4Y5TA 3POBA 4QU1A 1LNSA 2WNVB 4XJUA 3VGIA 4MG2A 3ZMOA 1DDLA 2VMGA 3VHNA 2XLAA 4E2SA 4HK9A 5JMCA 4I01A 5D2AA 2DYCA 3UJOA 5HCAA 3WNXA 1AJOA 3AP9A 1WCUA 5EHDA 3WF1A 5CFCA 4NHKA 3N9LA 1SFYA 5J98B 5GLZA 2HYKA 1JYNA 2A73B 2XBO3 4QHBA 1YWKA 3VZKA 2NN8A 4W6XA 3U0ZA 2EIEA 5A1LA 3V0AA 1XNDA 5C5UA 4LOSA 3URFA 1S0BA 2HWF2 3GJBA 2ZEZA 3GDBA 3N9PA 2C5DA 3CEWA 3W20A 1BK1A 5FRAA 4YFZA 5IVFA 5FP3A 4YVWA 4YZ5A 4PQ9A 5GLUA 4RQPC 2X10A 3BALA 5A32B 2P17A 1D4VB 3T09A 2MNGA 4AQ6A 2RS53 3VBFC 1IPSA 4MGIE 4NN0A 5CKQA 4Z92B 1REDA 3RYKA 1W6QA 2JE9A 3LZZA 3VBSA 3WDUA 1EUTA 4COYA 5B4NA 3JD73 5FUIA 2HBUA 5D8AA 3TEYA 2RMU1 3POWA 1PMJX 5A3WA 4AVTA 2EAKA 5I91A 2RS11 1Z78A 2YZ4A 2HWC3 1PX3A 2HLEA 4H14A 2Y0OA 3HVDA 1YYNA 5FY7A 4ZZ8A 2Q4SA 2VZSA 3ETPA 3LD8A 2Z5WA 1OD5A 4D7TA 4GWJA 3RZZA 1STMA 1ULGA 5C3QA 1K5MB 5I93A 4PLNA 4GJZA 3POJA 5FPXA 4N43A 3KT7A 1V9U2 1VAMA 3ZXAC 4FAGA 4UF0B 5FZ4A 1LGCA 4W8JA 1EYBA 4GWMA 1K5JA 2CNAA 4CDUA 3I2GA 4XMAA 1W9TA 4MADA 3ZMNA 2OQ7A 2R042 4M3CF 4CP9A 5IW0A 4Y20A 2ZGUA 1YIFA 3T2QA 4MVTA 1DP0A 2GN3A 1LODA 1C3HA 3OCPA 4XPVA 3LCPA 4PF5A 1O59A 5FJHA 3AB0A 5AVAA 3NNMA 4IEOA 1MS8A 4GMP0 1NZIA 2GMPA 2WS91 3BGAA 4AEDC 3N4MA 3VBUA 2DV9A 2J1SA 1G8WA 2PHWA 4L99A 4BMEA 3UKNA 2A75A 2LS6A 3CO2A 1BJQA 4XUQA 1NA1C 1QGLA 1FXZA 2D44A 3LSDA 4QB6A 2QFEA 1NYWA 3TN92 2BBAA 2W08A 1PK6B 2R49A 3QH6A 4FPOB 4HN0A 1S2EA 1VBC3 3G6JB 3H0OA 1F15A 5DABA 1C57A 4C0HA 1OXCA 4R9CA 4MXWA 1V6OA 1S1AA 2C9AA 3ZSEA 2BPA2 3LB9A 1YI7A 2HEYF 5F6LB 1FPN3 3MBWA 4YVSC 4ASLA 3Q8EA 3E97A 4PLMA 3LWCA 1N3QA 3AP5A 3ZXFA 4CDQC 2CAUA 4BOWA 1CAVA 5A7QA 4A3XA 2RHPA 1RUD3 2VULA 4RS5A 4COWA 5K0UC 3P1IA 5FXWA 3RRDA 1OUXA 2FZ1A 2R30A 1BEV2 1EUUA 2VTFA 2VQTA 3ZXLA 5A33B 2XB6C 1HXS2 2EICA 5FTTC 2BVVA 3VL9A 1ULPA 1KFXL 3OGJA 3BB6A 4LHLA 1ASJ2 1LHWA 1R092 2D6KA 3DGTA 4RHV1 1O4TA 3AP4A 4WBBA 4OI1A 4Q0UA 3WDVA 2C26A 1YC61 2JECA 3WNMA 3AJYA 1JBCA 4Q8LA 4YGDA 5JZGC 2Q0AA 2BWCA 3ZFEA 4W4ZA 1O3TA 4P08A 4OHYA 1W0OA 5JUVA 5JSRA 1O7FA 2E7QA 3N7JA 3NNJA 1HRV1 4B1MA 1RHI3 5EYYA 3WR0A 2I2SA 1NE6A 3DCQA 1RUOA 3ZYIB 4P9WA 4BM8A 4EWEA 3ATGA 3KSCA 1EV13 4J1WA 2XJUA 2YC4A 3PNAA 4NUBA 4YGBA 2OT7A 4XILA 3ES4A 2Q8DA 2XUEA 1SZBA 2GU9A 1W6NB 1C4RA 2PAEA 4KWKA 1FV3A 4PDWA 5GZGA 5FP7A 1QKQA 2PLV3 5L36A 1GANA 4R9BA 3WP4A 4PLOA 4HANA 5AFEA 2XBO1 4FTSA 2ZKLA 3RMYA 1LGNA 4CEYC 1HX6A 4MGTA 1DFQA 3WF2A 3ZR5A 2XL9A 2VBPA 3IKWA 3PVBB 3Q8BA 2JE8A 1LHVA 4Z82A 3DPRB 3NVCA 3OY8A 1RUC1 4V2VA 3V56A 1UU6A 2A70A 2E26A 1CX1A 2Y6LA 4XQWA 3O1OA 4JGZB 4CEWC 4SLIA 1SLTA 5JIAA 3UT0A 4AZZA 1NCQB 1CAUA 2FD8A 3SEPA 2RS51 1V00A 3T2PA 1PHMA 3VBHB 5E6HA 1B35B 4QQOA 5B4XA 3IIIA 5IK8A 2FDGA 3LDKA 1E5RA 5DUUA 1T2XA 1A78A 1OH3A 3KT4A 4PIYA 3UGFA 1OURA 3BODA 4H55A 3JD71 3WNOA 1H8TB 1IQAA 4GXLA 1XNAA 5CNAA 1C1FA 1POV0 1JYTA 3VBOC 1OD3A 2W92A 4JKLA 2VXRA 1WZXA 4XDQA 2HWC1 3JBG1 1GZWB 5DZGA 3HBZA 3KF3A 4B29A 3RZHA 1RGSA 4M3CE 1RXGA 2D97A 5JMOA 1AXKA 2K46A 1VBE2 4Q4W2 4YW4A 4AFCA 2AGSA 1VLNA 1H2LA 2G9ZA 1QXPA 1AX1A 3PIJA 4CPBA 4MGSA 4LO6B 4UFLA 2IXHA 1V6LA 3D5OA 1JYVA 4BWOA 2DFCA 5KC6A 1GQGA 1LOGA 3WF4A 2KXLA 3GZTB 1REEA 3J7MA 4XIKA 4DO0A 1OOPA 1NE4A 2DVDA 3K46A 2UURA 2XUMA 1OLQA 2B46X 3WV6A 3P5BA 1SLLA 2WZ8A 3NRUA 1UQXA 2NQYA 4FSJA 3GXUA 3VBFB 1NUKA 2VOKA 2AC1A 2C24A 2YHJA 2W1SA 3PVOA 1HQWA 1ZZ9A 2R043 3U37A 2AUYA 5JWPA 1VBC1 1CWPA 4ZONA 4BIOA 4NHLA 1WLCA 4F83A 5JXJA 1BHGA 1WUVA 2F17A 1WMDA 1HQNA 1YXWA 1FPN1 4OZXA 5JIUA 3VN4A 1AX0A 2BP6A 4JDOA 1W6PB 1FX5A 1UYYA 4HK8A 4YLZA 5FYVA 1C28A 1RUD1 3TRSB 1LOAA 1ZZ8A 2D6OX 3QH7A 4YG6A 4BQ4A 1SFNA 4WVMB 4YGCA 2VU9A 3AZWA 5FO9B 3PUAA 3KV5A 5ABJB 4OMCA 1UU5A 1G9AA 4OLLA 1LOBA 4IEXA 5T55A 4Y33A 4XE9A 3VZMA 3EO6A 2DVFA 2JG8B 4TLFA 3ZPYA 3H7YA 1IKQA 4QPGC 4XOGA 5D21A 5FZ1A 4CTEA 2W52A 5AFBA 2PHUA 3VZJA 2QUOA 2C4XA 1W2OA 4D94A 2QQNA 4W50A 4MV2A 1YQ8A 1SMVA 1YRZA 4IE0A 3SH3A 3PMEA 1H9PA 2DCKA 1BEV3 1RHI1 4B4RA 1ULOA 5T5OA 1HXS3 3ACHA 1O4ZA 2J22A 5C9AA 1CGPA 2V4AA 2V5YA 3FC0A 3K4DA 3MIEA 1ASJ3 1EV11 1R093 3NKGA 4FP3A 1OLME 3F95A 4IV1A 4LBQA 5FXVA 4DXRA 1MS5A 2W68A 4P00B 5CVRA 5HV4A 5LA0A 3B00A 4M3CB 5FZCA 4QPIA 2YB7A 1W9FA 1PZ9A 2PLV1 2JIJA 3HPNA 3TEWA 5CEHA 1PIV2 2YBKA 4XVHA 4QX1A 5JAXA 2VVFA 5F5IA 4AVCA 2JG9A 4NO4A 4E2GA 4XHXA 1D2SA 5FO7B 1U0AA 1XOYA 4AI3A 5K7PA 4W6YA 4IE5A 3CHXA 3NJVA 4YVSB 4AHZA 4BQ5A 4BXSV 4M00A 4Z1VA 3M8LA 3RZJA 1RUF1 4CDQB 3VD9A 1MQTA 2YU2A 3VDCA 4A6SA 4A4AA 2XMLA 5IJRA 4FPFA 1JMUB 3OBTA 3RYRA 5FKBA 1AXYA 1WCDJ 1H30A 2Q1MA 4XQ4A 3RVHA 4AOCA 1CZSA 4FAHA 1H2NA 1VMHA 3ZYRA 2E6VA 2ADEA 3W21A 3RNSA 4QHOA 5JR7B 3VZOA 2JKXA 3T4VA 1YUDA 2FCVA 2YYOA 1GZ9A 4JC1A 4HLTA 5DUVA 1GNYA 2RG4A 4WM8C 5JZGB 2VC9A 3AXEA 1IG3A 1UF2C 4OVEA 5A3PA 1E5SA 1TNFA 3AZXA 3MF6A 5IFTA 4L92A 3ZFFC 1JH5A 1R64A 3B01A 1Z7S3 1XU2A 4QGMA 3MLLA 2ERFA 3HWJA 4D6SA 5FYHA 1G9DA 2BU9A 3EJKA 2VNRA 3POSA 4FPYA 5A80A 2YG0A 2V09A 2RS12 2XH6A 3AP6A 5A7OA 4B8EA 1WD3A 2GC1A 3SISA 4LBOA 1PO23 2WA4A 3C8XA 5JOXA 2GP5A 4CEYB 1HJFA 2RJ2A 5FQ0B 4JGYC 4MH0E 4RN5A 5K8SA 4X6QB 2CGNA 4UBHA 1W04A 3IDCB 1QJFA 2D3PA 3MI8A 4H2AA 4Q5OA 4E8DA 2FDFA 1XU1A 3USUB 3POEA 2JICA 4NVPA 4Q4W3 4XC9A 4LMFA 1JS9A 3KV6A 4H7LA 2BUKA 3H3ZA 4BK4A 4CEWB 4QKNA 4YARA 2I45A 5KXDA 4XW3A 1RVF2 3I2OA 5I0RA 2OZ6A 3FL7A 2XXZA 4AEJA 1CR7A 3ZR6A 4BYYA 5LBFA 4JHTA 2X09A 4DEQA 2XVKA 4A7KA 1GNZA 2R041 1SBEA 4JRLA 2NYYA 2E31A 3FZ3A 1QF3A 1TMF3 2WS92 5HXVA 4GIQA 3EXUA 1DLLA 2P3JA 2BOIA 5CBLA 4QQLA 3THDA 4TTGA 4LA3A 3AKTA 3VBOB 1UZZA 5IYYA 4N53C 5BY5A 5GZEA 1TME2 1BBT1 4KBZA 2ZHMA 3GCXA 3O0VA 1GSLA 5DMYA 1O8SA 3ILFA 4FQZA 4FTEA 1DYOA 4BCUA 3QCWA 1GOGA 1LGBA 1WCSA 3B93A 3I2IA 4Z07A 1OA4A 1UO9A 1TQ5A 1XB9A 2A1XA 2WFF3 5DQ0A 2ENRA 1CAXA 3CIHA 2DWRA 4P9JA 3AL5A 2XR4A 1UMHA 3NV4A 4DUXA 5LEJA 4KU7A 3N9NA 1QU0A 5FOJB 4XJ8A 3VHRA 2QQOA 5DXDA 1UPSA 2H6BA 1UIKA 3SQOA 4RHV2 1D0HA 1BEV1 1ZRFA 4F7ZA 3VBRA 3CQOA 1GWKA 1V6MA 1HXS1 2R1BA 4Q4V1 5CB7A 5F3CA 4WZCA 1M06G 1R091 1S0GA 2D6NA 4Y1YA 5LA9A 4J6GA 1CN1A 1H9WA 3WDXA 5H9RA 3E1F1 4DOUA 1HRV2 3SH5A 1DQ6A 2GZWA 5LZ6A 1ZZ6A 4HZFA 4XDPA 2HWE3 5CZKA 4ET7A 2E7TA 2VH9A 2WNVA 3OF1A 2HKXA 4CDWA 3GGLA 1Q8QA 1JHNA 1C5HA 4FPKA 4JVAA 4L2NA 4LJHA 5CKNA 2ZGRA 4XUNA 4EROA 1IGOA 3KB5A 3I59B 3CLPA 3NMBA 4GJYA 2FDIA 5BNPA 4Y5SA 1O3QA 4KWUA 2C9KA 4SBVA 1BZWA 3KWVA 4B7KA 4D0QA 5ACA3 4DZGA 5HCHA 2XBO2 2VZVA 2Y6GA 4HVQA 5E16A 1I6XA 1UN1A 4DNYA 3VHOA 3MGUA 4CRQA 4ZU4A 2HBTA 1PIV3 2X5IA 3AM2A 2VUDA 5F32A 2W5FA 1SDDB 1ZRRA 1RUC2 4XUPA 1W8UA 1ODMA 5FZ9A 2Q5TA 4QPGB 2VZUA 1XYOA 5JXIA 3VV1A 2I07B 2ZS6B 1AZDA 3N7KA 3ZVXA 2YC0A 2W3JA 3MIGA 1X36A 2R1DA 4IL7A 1GWMA 3HNYM 2OPWA 3WP5A 1O4YA 5FXZA 2B4KA 4O9EA 5L7OC 1GP4A 1Z7S1 4N8MA 1OPMA 5CISA 1AR73 4CCLA 3HOBA 1URXA 1Y43B 1Q43A 3PU8A 1C8M3 2ID4A 2PQQA 1FAYA 4GKXA 3WOGA 2J1EA 4A3ZA 5CAZA 3D3AA 3JBG2 1HJGA 4IEYA 3U10A 2QQUA 4OHWA 1PO21 3K3NA 5FYSA 4LO4B 1FNYA 2HH9A 4GKYA 2J1RA 5FZOA 1TVGA 3KGZA 4Y22A 3M3EA 4XHBA 2AZ5A 4UF0A 2WNUB 3AKSA 3AMQA 4KWJA 1VMFA 4CCCA 4LOTA 1F9KA 4Q4W1 3ZM8A 2FZ2A 2WT1A 1CONA 2WZR3 2GMEA 4XETA 4YFWA 3KMHA 2D6LX 2Z2SB 3I54A 1MS1A 1P8JA 1VRH2 3KV9A 3J26N 4AE2A 1W03A 3SHRA 2RR13 3FBMA 3H42B 4CDXA 4K7JA 1DZTA 4NPMA 5F3GA 1WLTA 5IWFA 1OUSA 3E5UA 3WNNA 2CWSA 3ZKYA 3PUQA 4QX2A 1W8FA 4QX5A 3AL6A 5C4WB 1TMF1 5JVVA 4K9SA 1UNBA 2Y0IA 2B39A 3H8RA 1PMIA 5LBEA 1JOBA 1E5IA 4A7YA 5BNQA 2DBNA 2DCZA 1RUE3 3J7NA 4K8FA 3ZFFB 5C7GA 4MGZE 3ZXDA 5CADA 5J96B 1RVF3 1Y4WA 5C6CA 3ZN6B 3ACFA 5DDJ2 4KU8A 2FDKA 3WG4A 1CPNA 5BNNC 1X9PA 2W0XA 3D0JA 2PELA 3ZN4A 4FPLA 5FIXA 3BI3A 1UZYA 3HQXA 3LIGA 4MSVA 4UFKA 4MX3A 2EF6A 2BEOA 4PT6A 3S6PA 3NNLA 5IVVA 2B7YA 1S55A 2WFF1 4QDSA 4UW6A 1RUD2 4JGYB 1F5JA 2PHRA 1HW5A 1FNZA 1US3A 3ZYFA 1TME3 2W95A 4LBLA 3U1XA 2BRTA 3O1MA 1ACCA 4LLFA 2QQLA 3MIBA 4NWWA 5FMOS 2IXIA 2IXJA 2DDUA 1MR5A 1VB2A 4UFIA 3U07A 3IB3A 1JZ3A 1W6OB 1W8HA 5KHHA 2GALA 5FLHA 1DCSA 2OQ6A 4LHSA 1O5LA 4QMAA 3DPRC 4C8DA 2CDOA 3GM8A 4QX7A 3HQRA 2A6WA 5L9RA 1RHI2 1AL23 1UX7A 3RI8A 2CDPA 1ULDA 2HWE1 3ZYPA 2CU5A 3MLJA 3R4UA 3TEZA 5L73A 4ATEA 1UZWA 1RUH2 5IVCA 2BDRA 2JWPA 4XBLA 3UETA 4XMIA 4HKLA 2G9GA 2GH2A 4D7SA 1IG0A 4P9GA 1X8MA 4N53B 4NAOA 4YW7A 2VCCA 3U14A 1PO12 3MHZA 4HKOA 2B45X 4Y1ZA 3ZIWA 2XJRA 4U2AA 5ACA1 3M7AA 2IUWA 3MICA 1H8TC 2VJXA 3ORJA 4FPEA 4KWLA 3RSJA 4Q8KA 1W9SA 3N9QA 3RMXA 3TBDA 2IVJA 4DY3A 1RJ8A 1KS5A 4Q1RA 3HBKA 2G19A 4A44A 4AVBA 2GSYA 5DAXA 5BV6A 1GP5A 1RUF2 4KBBA 2O14A 3JUUA 4JGZA 2ET7A 4BK5A 1PX4A 5FLIA 4YW6A 2RJKA 5JSOA 3LEGA 2UY9A 5T52A 4IE7A 1B35A 3GCWA 4MUVA 2QQJA 2HEVF 2P5BA 3TNQA 2WQ8A 4EZ4A 1XNBA 1UMZA 2AENA 3EBRA 4K8RB 1IPKA 2B42B 1QH6A 4OUSA 4QGNA 1G9CA 4DUWA 4YVWC 1AR71 2A3YA 2VG9A 4Q0PA 1ZBE2 1RUC3 5HCFA 2D6MA 4NHMA 1UYZA 2PXJA 3I8TA 4OUMA 1A34A 2BNOA 4HKWA 1AVBA 1LKNA 3RFRA 1LU1A 4AQTA 4CPBD 4YRDA 1C8M1 3KCXA 3H8OA 2WUHA 5F6KA 5JR2A 2VOWA 1CAWB 4D6RA 5LCWL 1I9RA 2MPFA 4M01A 4I09A 2DTYA 4BMBA 4BPZA 5JI7A 2BGOA 1S0IA 4QXHA 2O8QA 2NP0A 2W87A 5A6YA 2A6XA 3C3VA 1PM7A 4UYBA 4E27A 3NAPB 1F5FA 1TZOA 4URTA 2K2SA 5CFDA 3NJZA 1LR5A 1JYWA 1WW6A 1GBGA 4CXXA 4UFHA 2WSVA 2QQMA 2WZR1 3K3OA 3QACA 5A1AA 4AI1A 3WNLA 4URAA 4XBQA 2OW4A 3ASIA 1W06A 3H1WA 1UPIA 3QLQA 3JBG3 1MS0A 3GZUC 3I7DA 1QNYA 1J84A 2E53A 2RR11 4NAMA 4GH4A 5HCBA 4QXBA 4RQPA 5T5PA 1LECA 1U5IA 2XLFA 1ZZBA 2XJPA 3E5QA 1N3PA 4UOJA 1DQ4A 2TUNA 3VBFA 5ABJC 1HN1A 1YFUA 3KLSA 2JDMA 1RITA 4R4XA 2KR2A 1ZA4A 3WCRA 2JG8C 3GJAA 1KGYA 1VBA3 1QJU2 2QTWB 3DXTA 2F4PA 5GJ6A 5LRRA 1RUE1 4WVZA 3AMHA 5L7OB 1QIQA 1VRH3 3PIGA 4EV0A 1N1SA 1RVF1 1V6KA 1UY4A 4BZ4A 1GV9A 4DXZA 2BZDA 2A5ZA 2QQIA 2J7MA 4XFAA 2YBPA 1UXZA 1HRI3 4H3WA 4QX8A 4U36A 4TYSA 1WW7A 4XZUG 3TNPB 3WQBA 2E33A 3INAA 4L97A 5EZWA 3PLQA 1BBT2 2Y8KA 4QKDA 1YJKA 3ZSMA 4FPHA 4WVMA 2N7GA 4XF0A 3DUIA 4IEUA 4YW5A 3SH4A 1JTZX 1TME1 2WQ4A 4OZOA 1X50A 5DDJ3 1XNTA 1WMEA 4GMP3 5FZEA 1N1VA 4RGAA 2QQKA 4S2HA 5CG9A 2D5HA 3BTYA 1YQCA 1AXZA 1AHSA 2Y64A 5EJZB 2HEWF 4LBQD 2VVDA 2RS33 3PHMA 5FPZA 2RDNA 3IMNA 2OS2A 1TE1B 4B1LA 5C3OA 4AEDA 4XF3A 2WR9A 3OJBA 1NOVA 1AL21 2D98A 2ZAHA 3THCA 5FMBA 5KC5A 4S2FA 1UKGA 3ABZA 4TN7A 3UGHA 4Q4V2 2WWJA 4OQ8A 1NA1A 2EXJA 3PTYA 5LBCA 1JI6A 3WUCA 2BQPA 4PBOA 2GDFA 4Q0QA 3O7OA 3WSOA 3ZFEC 1MZ5A 2DU0A 3ECQA 4A7ZA 5J7MA 2SLIA 2YFUA 3A7QA 1ZX5A 1I5PA 3GZAA 3PJYA 1RL3A 4RD7A 5FK7A 3ZIXA 5EIYB 2PHFA 2Z69A 2XVLA 3AYEA 3T3YA 1OLRA 4DEVA 1ND2A 2E63A 4XTPA 2VVEA 3RWNA 5BNNB 2GH8A 1MS4A 5A7WB 1V70A 4WV8A 3T2TA 4LHNA 1HV0A 1W2NA 2ZMLA 4FFFA 4HSLA 1MZEA 3WDTA 4FFHA 1D4M3 4CDQA 1V6JA 4FXKB 1COV3 2PMWB 1XYPA 1YLLA 1RUH3 1LHOA 3SKJE 3SKVA 3WZ1A 5K0UA 4PDWC 4AVVA 1YQ2A 4MYEA 2YROA 2XJTA 3GF6A 3ZFGC 1PO13 1PGSA 3POIA 3R05A 4OI4A 5B2GB 1JN2P 2XKPA 4HT1T 3CDZB 5IVYA 5DG2A 2ZABA 3JQWA 1U5XA 2XG3A 3UESA 4QM9A 5A3LA 4I2OA 1ZRDA 3ZXEA 5BPXA 5HV0A 4OQ9A 1BCXA 2QZ2A 1WLWA 4CP2A 2XHNA 1NXMA 1ZVFA 1CZTA 1GP6A 5FYTA 3AP7A 1I1EA 1RUF3 2A7AA 1RXFA 3WF0A 2Y6KA 5DN2A 2VOVA 2EIDA 2VAUA 4D7YA 3WP6A 4UW5A 4EE2A 2WKKA 1RUNA 3DN7A 5LW9A 3O1TA 3R0RA 3KVBA 3O0WA 3T0DA 1Z7S2 1W6MB 2VZ1A 1IHMA 4P5YA 3PVNA 3LIHA 5FZFA 2V72A 2PYTA 4OHXA 1NQJA 4LLOA 3DYMA 3I2KA 3OUHA 5T50A 3VD4A 4DFSA 1CIYA 4META 5LATA 1ZBE3 3KQRA 2JDZA 4NPLA 2RDRA 4ZXKA 4CEYA 2J1TA 3AMPA 5KHKA 1XJAA 1YNAA 1QHDA 1PO22 4A42A 3IN9A 3CJIA 1KITA 2P6HA 3H1YA 4LEJA 1LOFC 1OKOA 2FHRA 2VMHA 3NKTA 4QU2A 4CXYA 5JSPA 3JZVA 1S2BA 2ZHLA 2QKDA 2WL1A 2W47A 2Y33A 4OULA 3OEAA 4KG0A 4PJYA 1A8DA 4R9AA 2DFBA 5F37A 1DZQA 4XFGA 2Z79A 1NY72 1WW4A 2WAAA 3G7DA 2P3YA 5FP8A 5L9VA 4W65A 3B69A 1W0PA 4CVUA 3POYA 1WWYA 1VIWB 4OFGA 1POV3 4DQAA 2BFUS 5KHIA 3OG2A 3V0AB 4LE3A 2LTNA 3OD0A 3BOPA 4JX0A 2ZJCA 3AZVA 2IVIB 5FPBA 1JYIA 1JZ5A 5LB6A 2WNOA 1VBA1 2VECA 1OOPC 1RTVA 1OLMA 3FFQA 5FPLA 4AAPA 1VRH1 4YVWB 5G04L 3KHCA 1TMF2 3VBOA 3JQXA 3GBGA 5I8SA 4A41A 1HRI1 2W94A 4PHZA 5C8CA 3WLUA 5FMOL 3VL8A 3GALA 2ZX1A 1ZYBA 1JUIA 1JZ8A 4P14A 4QKBA 4HL0A 4HVOA 2XHKA 5FBZA 4CU7A 5J3UA 2VE1A 3VBSB 4ARYA 2ZGMA 1A8MA 2JD4A 1QJU3 1MVQA 2QE3A 4CCJA 3NWKA 2D43A 2IFRA 3MPPG 5D8AB 4AI9A 3M3CA 5DDJ1 3B94A 3HNBM 4JAAA 4GMP1 3S5AA 1VB4A 2WFF2 1S0CA 2VMIA 3M3IA 2WYFA 1A3KA 4TWTA 1JYXA 4IDZA 4AGGA 3AMMA 1AYM2 1DGLA 1D2QA 5ANQA 3TOJA 1BBT3 1HIXA 1ND3C 2RS31 2JENA 2X05A 2JX9A 5CYYA 1HB3A 3KF5A 3RQ0A 5C33A 2H0BA 1LOCA 4H7MA 1W3VA 4Y24A 5DPNA 4HVRA 1QWRA 1JYCA 3NJYA 4JCKA 5FZ8A 2YBSA 1YI9A 2R7EB 3AK0A 2ZGPA 4DRRA 4CP9B 1OI6A 2K9ZA 1MS3A 3UJQA 4Y20B 2GNBA 1FMD2 2WDBA 5E1RA 1LHUA 2FQPA 1JZ2A 1FI2A 2ZCWA 2HWE2 5JPNB 4UT5A 2PFWA 4PI2A 4UW3A 4XIOA 3HMYA 1X82A 5LWBA 1XE0A 4IV3C 5EFUA 1WMXA 4IV1C 2ORXA 3LA7A 4S2DA 1D4M1 4Q4V3 5EJ3A 3WW1A 1COV1 5FXXA 3VB9A 3MPBA 1RUH1 1W90A 1W05A 1GZTA 5ACA2 2BJSA 4Z2WA 3BU7A 1LB2A 4Y4RA 4DRVA 3ES1A 4RR3C 5A7PA 4ZU5A 1F35A 1PO11 2R16A 4UWDA 2JG9C 4Q2FA 4MXWB 4QQPA 3T1MA 1VP6A 4QPGA 3N36A 2PHLA 2Y34A 4QAWA 2LRPA 3AKPA 3LPFA 5D1IA 4DB5A 4G3YC 1T6GC 2WNUC 1CJPA 2ZGKA 3DV8A 3FFZA 4LO5B 1NLRA 5LK5A 2WO3A 4CUCA 5FK8A 4CCMA 3U4XA 1CESA 2J42A 3M3QA 3DYOA 4QB2A 4FQ4A 4AQ2A 2KM2A 1APNA 3I3BA 2LROA 4E8CA 1DYKA 4COUA 2YU1A 3O1UA 4KGQA 4WVVA 1AR72 1JOJA 1U5YA 4HFSA 4Y26A 5FUNA 4NOTA 2WA3A 2RVAA 3MW2A 4XJZA 3WG3A 4BLJA 1BK0A 1XE7A 2O8OA 1SPPA 2BNNA 3ZFEB 1PVC3 1C8M2 2DF7A 4Q26A 1QNWA 5EYXA 5FMDA 5C4WC 5JCTA 5KHGA 1PVXA 1ZBE1 2CGOA 3CF6E 1QEXA 1Y9QA 3IDAA 3NO8A 3PJQA 4E4ZA 5KXCA 2JE7A 4XBNA 3AZYA 1W8WA 3EQEA 3FE5A 4P9IA 2YUEA 2ZX4A 4PBPA 4KI5M 4PIZA 3A22A 3VZLA 4GA9A 2V4VA 4PDWB 2E7AA 3IDBB 2XLGA 3IIAA 2P34A 4IEVA 4LA2A 1FYUA 4O65A 5GZFA 2ZX2A 1J83A 3ZFGB 2WZR2 4L0PA 5FY0A 1POV1 2BGCA 2VZQA 4MGKE 3IPVA 2Y38A 3LKJA 4YZ1A 1YJLA 5EXOA 2VZ3A 2WWUA 4UFJA 3RG0A 4Z8BA 2RR12 3LGRA 2VL4A 3RDIA 5HXMA 1ST8A 3OY8B 2BYVE 3P3NA 4WM8A 1VE0A 2J1VA 1AYN1 3HIFA 3CZUA 3V65A 3O14A 4M4PA 1Q8OA 1SHWB 3MIHA 4AXOA 1HV1A 2GNDA 4Y3OA 1ZNPA 4N9HA 1RUE2 2W91A 2YXSA 3ST7A 4DPNA 1FV2A 1LHNA 3R4SA 1WBFA 4DMIA 5HPOA 2OYZA 2XJVA 3OOXA 1B09A 2Q30A 4YM1A 1A6CA 3N35A 4YW3A 1QJU1 3OEBA 4XACA 3LDBA 3WX5A 3OPZA 3T1LA 5JOYA 3K48A 3AZZA 4FPJA 5FZLA 5APAA 1VAKA 1WCKA 5FY1A 3WQ7A 1R1ZA 4YM0A 4AR2A 5J36A 4FT8A 1LRHA 3AKQA 1E5HA 3U4SA 4FFIA 2VMFA 3HR9A 5CIRA 3AJZA 3KVAA 2JB8A 3M3OA 4A6OA 1G9FA 5FZHA 3GNEA 1U5ZA 2D6PA 5T5LA 3AKRA 5I0SA 4NROA 5FZMA 4IE6A 5GZCA 3KM5A 4TZDA 5FZIA 4NR1A 4Q4Y3 4XXAA 4XJWA 3RWKX 2AREA 3KV4A 4NIHA 1H4HA 1OSGA 3LE0A 3U11A 2AYHA 4N9IA 1GQHA 1R1A2 5DUXA 2VZTA 2BVBA 3ELNA 3I3EA 3T0AA 1LEMA 2XJQA 1Y9GA 5A6XA 2ZGQA 3SITA 2QNKA 1OOPB 1AYM3 1H8VA 1AL22 1WLDA 3ITQA 3LFIA 4BDVB 2WABA 1W0NA 4QX3A 1F2NA 1SG3A 3VBRC 1XYNA 5BNOC 3BVCA 3HN3A 4N53A 1OHFA 1RUI3 3OD4A 2DCTA 2B5HA 4I02A 5J1XA 1BMV1 4WZFA 5FCCA 2XQXA 4Y4YA 5FYIA 3I49A 1WD4A 4Y5Z0 3W5NA 4CCNA 3OGVA 3JB4C 3ZYHA 4BIFA 3S0MA 1FMD3 4MHUA 4CDWC 1VRBA 3DKWA 1NCRA 4N7IA 3J8F3 5LEKA 3OYWA 5GM0A 5FZ3A 2KD7A 2D7FA 2BWAA 5K9YA 2YV8A 4P9LA 4NIDA 2VOTA 3FMGA 1DGWX 2P3IA 4K40A 4CU9A 3KQ4B 2VXJA 3GBWA 1UMIA 1Q56A 2YFZA 3NAPC 2EA7A 3T2OA 1ND3B 3BOWA 1QQP3 5LBBA 1X9TA 4AEMA 1QH7A 2X5IC 3WG1A 3MO4A 5SV5A 3WD5A 3FJSA 3VLBB 4KL1A 3ZDVA 1IOAA 2VZPA 4IXLA 2VQUA 1G86A 2R32A 4Y1VA 4X8PA 1H4GA 1QOSA 3LEMA 4AWDA 5FZ6A 3M70A 3LSEA 3NV2A 2EXHA 3DYPA 1CAWA 5A32A 4XF9A 1PVC1 1V6IA 3NNGA 3FHAA 2ZEXA 3ON7A 1NKGA 3T4HB 5FLJA 5C5TA 1WKYA 2JDAA 2FBEA 3SCHA 4HXCA 3E6BA 3ME2A 4QGLA 3ZDSA 4QT6A 4C91A 4DXTA 5C9AB 5LY1A 5FPVA 2YDEA 4IV3B 4ZS3A 4GD4A 3T08A 4CCKA 4CYDA 4LBQB 4IV1B 2W1WA 4C0BA 2UU8A 4OI2A 4YZ3A 3NV1A 4CCOA 1MEC2 2E51A 3NQHA 3I97A 4FI9A 3CZJA 4XURA 3THPA 4RR3B 1X7NA 2WT0A 3O12A 4RFT0 4LNVA 5FREA 1LAJA 5JLVA 2JG9B 4IGPA 1FATA 1ZBA3 4V1PA 4HOOA 3ALQA 1WA4A 1K5MA 1LOEA 1RINA 4BB3A 3GHMA 3OGRA 3N7MA 4JZRA 2TEPA 1O6UA 3B5LB 5IK4A 5DAVA 1MQTB 3O0XA 5FUPA 4LT5A 2NZ9A 4BA6A 1X33A 2QDNA 4X6RB 3C7HA 1NY71 5CKMA 1F31A 2D3SA 2R071 1ZZCA 4FPCA 3ZXGA 4E9KA 1MS9A 4XJ9A 5JDBA 3ZOIA 1UD1A 1YCIA 2GC3A 3EHKA 5BYNA 5L7OA 1W28A 3VDBA 3H8XA 2ZZJA 5A70A 1VBA2 1H6YA 1UKRA 2J1AA 5HI0A 3JU9A 3FHIB 3PL0A 5GLTA 3WF3A 3F2ZA 3ZO0B 4MLOA 1EAH3 5E89A 4IUGA 5J37A 1QXJA 3BTAA 1HRI2 2EIGA 1KJRA 2VO5A 1KS4A 4NIGA 1GQPA 3ILRA 4PF1A 3CNAA 2B9UA 3VDDC 3RJ2X 5FZKA 1IKPA 3WG2A 1J3PA 2YMZA 2VQ0A 4ARXA 5A3MA 2DUOA 5DG1A 1PK6A 2DVBA 1OMIA 1AJKA 2Q1ZB 4B7EA 1Y3TA 2WT2A 4XFBA 4MXVA 4BQWA 4Z2AA 4BQ3A 1RMU3 3LEIA 5FYCA 5J48A 2WFPA 2NLRA 4Q4Y1 1GU3A 4IESA 4YSFA 4PQQA 4QQ2A 2IXLA 2VY0A 2R062 1IZ3A 5AC93 2WBKA 4P9XA 3O1PA 1UOFA 2RS32 4MOAA 4LO8A 3CJXA 1ALYA 3K4ZA 1Z0HA 5A33A 5GALA 3FUOA 1AYM1 4IEWA 3CMGA 1JU3A 5LK7B 3OBZA 5KHJA 1GKBA 1MPXA 1F8VA 1G7YA 3UV9A 1HKDA 3FLPA 4FXGB 5FO8B 4YM2A 3CU7A 2C1FA 1RUI1 2DU1A 1M4WA 2A3XA 2OIIA 3MDPA 5I8TA 1IQDC 5G05L 4RFRB 5F5CA 2A71A 3T0BA 3BPZA 1R1A3 3A0NA 4LE4A 3ACIA 1DQ2A 1GR3A 2ZKNA 3J7LA 4NHXA 4OMDA 5A7WA 3LAGA 1NLQA 1OFSA 2FCTA 1GICA 4GB31 5KBFA 3V0BB 1FMD1 3WT3A 5FJKA 1S0FA 4LORA 3J8F1 3SC7X 2A6ZA 1BXHA 1D4M2 2HWB2 5A6QA 3DXUA 1COV2 2JDNA 3B7MA 3SNMA 3PURA 2J1UA 1DQ1A 2WRAA 2CWMA 3RGBA 1W6NA 3IM0A 2Y6FA 4WM7C 1K42A 1UAIA 1NLSA 2ARAA 1XNKA 3OUIA 3MUZ1 3TAYA 1J3QA 2YPDA 2VUAA 2Z42A 5IVBA 4R4ZA 4L9BA 3MW3A 1K45A 2PN5A 1LEDA 3OPTA 1QQP1 4AVSA 4ES8A 1DQ5A 2VUJA 1QOOA 3AYCA 5FYUA 5ERLA 1E57A 3DPRA 1UCXA 4QD2A 1JHJA 4AFDA 3IMMA 2ZOEB 4GZ9A 4D3WA 4CCDA 2D5FA 4E2QA 5CFCC 4XEZA 2LM3A 4HONA 4KMQA 2VD7A 4LKFA 1PZ8A 4RA0A 4HPKB 2BV4A 2ILMA 3VD7A 4BHPA 1NCQA 5BXXA 4Q0VA 2CV6A 3MYXA 4FVVA 1UYXA 4MZUA 3VBHA 5AVPA 5FZ0A 3VDAA 4CUBA 3VBRB 5BNOB 2YPJA 3O1SA 2HWD3 4YNIA 4L11A 1JU4A 3LA2A 4J25A 3SMHA 3FX3A 2W46A 4NRQA 5JXGA 4GQ7A 1H8TA 4IEQA 5DZEA 4LTAA 5FR3A 2VW0A 5FYYA 5DUWA 4BXFA 2L9LA 1VR3A 2XQRA 4B4PA 4NRMA 2NPIA 2QBXA 4I0WB 1GZWA 4CDWB 4XFCA 4Q4X3 2YGLA 2R0HA 4P02B 2ZZQA 1GMMA 4KNCA 1ZBA1 2GMMA 2ZX0A 3VBSC 2EVXA 2WZEA 2D40A 4R9DA 5BNPB 3IBMA 5F5QA 4LBNA 5CFDC 2EXIA 5D8AC 1SBFA 1J1TA 4C1WA 4YGEA 1MEC3 2GC2A 2A6VA 5ANNA 1DIWA 4DY5A 2WO1A 3IAQA 2P2KA 3LPGA 3ZSKA 1CX4A 2JDKA 1SCSA 2VW1A 3J9SA 2ZHNA 3DL3A 2X5IB 2WWSA 5L19A 4Q29A 2WO7A 4GH4C 4QX0A 3EYPA 2EAAA 1AYN2 2VTXA 5GKAC 4XABA 1EAH1 4AQSA 1AF9A 1RUG2 3PUSA 4N43C 1W39A 3WINE 1O5UA 4IE4A 4HN1A 2OKXA 4Y1XA 3BIEA 2PQSA 4CDUC 5GLVA 3WW4A 1MACA 4Q0SA 1ONAA 2K0GA 2EXKA 4IERA 1KFUL 4MGYE 4XYXA 3OGSA 4YWAA 5EWSA 1SEFA 2X53S 4NIAA 3AFGA 3O1VA 1UZVA 3QBQA 1CPMA 5FP9A 1CVNA 4XUOA 3IWZA 2B9VA 1RMU1 3JB8A 4BISA 3VBUC 1YEWA 1K12A 1SLIA 2P4EA 2DVAA 1EP0A 1W6PA 5C70A 3IDEA 5FZOB 4Y22B 5AC91 5A7NA 1Q5OA 2UWCA 5K4LA 4LK6A 1AR83 3ZYBA 3W9AA 1TEIA 2XOMA 1PGL2 3AYAA 4MO3M 2IZWA 3HD8B 5HBAA 5JXHA 2ARXA 5ABJA 1XC6A 4A2UA 1I5ZA 2Q8OA 5KR7A 1AR62 1FT9A 5FYZA 3B3QE 2JG8A 2ZGOA 2PHTA 3J7HA 4LIUA 4ZHNA 3BUCA 1Y9MA 1LJ7A 2YGMA 2QVSB 2VMCA 3C7GA 4KH9A 5IVEA 3MZHA 2KA3A 2BW8A 2FDJA 3NJXA 4NPRA 1VBB2 4CDXB 2R063 2BNMA 5IK5A 3THTA 3A23A 2P6CA 4RS5C 1W2UA 2W9XA 3AYDA 1R1A1 2ZX3A 1SQ4A 4GALA 4BJ0A 4K20A 4AGVA 4CZSA 3R6SA 1WGPA 3AX4A 3SXWA 1QJZA 4ZS2A 3OBAA 4C90A 5C8WA 3BU0A 1EY2A 3S7EA 1DU3D 2CAVA 1KDKA 1F4AA 2UWBA 3NW4A 4XFFA 1BMV2 4COZA 5A3UA 4B4QA 1XSQA 5F2SA 3VD5A 3MV01 3VDDB 4FOWA 2CSGA 4EN9B 4M3CA 2GNMA 2ZGSA 1ND2C 4F3JA 2DCJA 2H0VA 1XPWA 1UY2A 4GWIA 1ZREA 2UYBA 4BQ1A 3V64A 5FZ7A 3P6BA 4LKDA 1K3IA 1ENSA 5FZAA 4JKKA 2XGXA 4UFMA 1L7QA 3MV11 1BQPA 1BYHA 4CP1A 2RM22 4JDMA 4YVSA 3PMSA 2VNGA 3C2UA 3R4DB 2RDSA 3ROUA 3OSDA 2HWB3 3GBFA 3D82A 4ISQA 4A45A 1G9BA 4MGQA 4AGRA 4D69A 3MW4A 1Y7BA 2V73A 5I0TA 1BKZA 2ZHKA 2VNVA 2DVGA 4FP2A 5IATA 1GNHA 1UOGA 1GOHA 1ZA7A 4FOVA 3GYDA 1ODNA 4BU2A 4YW1A 4DXSA 2OXBA 1PZ7A 1OH4A 1S2KA 2GNTA 3H1MA 2UWAA 4QXKA 2HWD1 3D6EA 5FPAA 4JKMA 5IUQA 5IAXA 2LALA 2XKOA 2CGPA 4E4DX 2CL2A 1WCQA 2FCUA 5JZGA 1W2AX 1PVC2 5GZDA 3VKLA 2HJIA 5DZFA 3KZ4C 1W8ZA 5DAWA 3KCCA 1RUJ3 2WO2A 1T6BX 3H8UA 3LOIA 2VBBA 4N90A 2Y6JA 4HG6B 3L9JT 4JDNA 2CTVA 2C0ZA 3POGA 1O8PA 4Q4X1 5FWJA 3I4IA 3X29B 3A0KA 1VBD3 1JZ4A 3B9CA 3FHQA 2P37A 2QDRA 3DEMA 4AHYA 3O1RA 4RGKA 3WQ0A 3ZFGA 2RV9A 1WMFA 5CA6A 1SACA 1H0BA 5F3EA 4WM7B 2V5DA 4NRPA 2Q1FA 1W8OA 3CJIC 1LTEA 1MEC1 1W2TA 5FQ0A 3NV3A 4RSUA 2QQVA 2WSUA 1JUHA 2WN2A 3ZX7A 3MUY1 2QQWA 5FZDA 1AUYA 3P3PA 3USUA 5IFPA 1RYYA 3ZSLA 3LOBA 1HB2A 3K51A 1BLZA 2W1QA 2WC2A 3IAPA 4LUKA 1KJLA 1QJY2 2IXKA 2R072 4EWAA 2VQAA 2WYSA 5CFCB 3VUOA 1GWLA 2OVUA 2CHHA 4CEWA 5KWRA 3UK9A 1SLCA 1ZRIA 3LFMA 4ONUA 1DHKB 5F7UA 5IVJA 3C7FA 1V0AA 2HWF3 5E88A 4XF1A 5T54A 3EB7A 3GZEA 3H3UA 2VOXA 4S2GA 4XTMA 5A7SA 4BE3A 4IETA 2WJSA 3VKFC 4CUGA 5JOWA 3WCSA 1DG6A 1OF4A 5J09A 5IK7A 1UZ0A 1VJ2A 2VTXJ 1AYN3 1XNCA 4I30A 5C8CC 5FY5A 2XVGA 3RYPA 1RUG3 1J1LA 1LOFA 1UU4A 3C7EA 4PCRA 4AVAA 4QPYA
chains in the Genus database with same CATH topology
1J59A 4HMZA 1AR92 4ISRA 1R082 4LBJA 2ZTNA 4QM8A 1W6QB 4R8HA 3WP3A 3ZYGA 1AR81 4AEKA 2P3KA 1UL9A 4Q4Y2 5CFDB 2DTWA 1ZZ7A 4AI8A 3I2DA 2OA2A 2X8KA 2XWJB 4ITCA 3O5SA 2PA7A 2MEV2 3L2HA 4AI0A 3H9AA 1H2MA 1DGRA 5I0UA 1GLHA 2R061 4GH4B 3WUDA 2ET1A 4RQPB 1YFXA 4I0BA 3S30A 1V9U3 3E5XA 1OQDA 4I0AA 3WQ1A 4N43B 1JXNA 4XFHA 1RUI2 4UBGA 2XPJA 4COVA 4XFIA 1C8NA 2PAKA 1AR63 1UW8A 4FCAA 1HLCA 4CDUB 1GFF2 3HT2A 2IC1A 1N1TA 4L8QA 2ZA9A 1VBB3 3NSTA 4PIXA 4GB32 5F1RA 5F9TA 3MF9A 1D0GA 4XXPA 3J8F2 1EPZA 1BVP1 1SLAA 1WW5A 2ZGLA 1RC6A 4LUMA 1MVEA 1UIJA 3I59A 4JTOA 5C9AC 3VBUB 1UX6A 2JJ6A 4M0HA 1FOD2 1ND3A 3TN93 2HWB1 3KD4A 1S0DA 1REFA 4QPIC 1QQP2 2AH2A 1G6NA 3SCFA 3WW2A 1QJX2 4YG0A 3TB0A 4K1YA 2ETEA 1KD7A 3OBRA 1PGW1 3FBYA 1IS4A 2RM23 1QDCA 2DUQA 2DCYA 1MQTC 1CAVB 1QY4A 3KS7A 4RS5B 5FAXA 3M1HA 4AEDB 4YW2A 1RUJ1 4IEPA 3RS6A 3UKVA 4IV3A 4M0NA 1ZRCA 1ZM1A 1KXGA 1NA1B 2D3RA 4AHXA 4J1XA 2OUHA 2PTMA 2SBAA 1VBD1 1QOTA 1XXNA 4AFAA 5JOZA 1LCLA 4RR3A 4P5HA 1KDMA 3WXPA 1ENQA 1ND2B 2PHXA 4OHVA 3ZN5A 3TWIA 4INDA 1ZBA2 2XJSA 4C1XA 1ULCA 2TNFA 3JCIA 4HETA 3VKOA 1XQNA 2NMNA 1C5IA 1AL0G 2WNUA 5K0UB 4IEZA 2GN7A 4K1ZA 3J4UH 4ES9A 1N47A 4K6BA 1Q8VA 1CD3G 5H9SA 4RGGA 2HWF1 1O3SA 1X8EA 1RIRA 4GWNA 1PNGA 1L3JA 4FPGA 1EAH2 1XRUA 5C4WA 3UKTA 3D0SA 2IWGB 3KGLA 2ZMNA 3HN1A 2R073 1QJY3 4YG3A 3UL2A 4OI0A 1RUG1 4Q27A 4QQHA 3ZFFA 2AR6A 2O0OA 1CJDA 2RMU2 3ZN6A 1CAUB 4AI2A 3WDYA 5IT6A 2JEMA 2D93A 1DGWA 1IS5A 3KCYA 2UY8A 1Q8PA 2IXCA 1RMU2 2JXAA 2PHDA 4YYOA 4BH9A 1OKQA 3AMNA 4AK3A 3CJIB 3ENRA 3FWEA 5AC92 2LUWA 2QZ3A 4GULA 4JGYA 1BVVA 1H1AA 4AF9A 4Q1PA 1VBE3 4AFMA 2VW2A 4AFBA 5T3NA 1EPWA 1AR93 3D8CA 4XF4A 1R083 1NQDA 2NM1A 2WIIB 2ZMKA 1O3RA 1V9U1 3ZXKA 3RJRA 4E4SA 1LESA 3QD6A 1PGL1 1DGRN 1TNRA 4EJRA 3MIDA 1W6OA 4JRAA 2R6QA 1MZFA 2W39A 2XWBB 1AR61 4P9YA 4K21A 2MEV3 4LO7A 2FMYA 2G4IA 2BBVA 3V0BA 3N3HA 1OFNA 1YIPA 1VBB1 4UW4A 1GZCA 1JW6A 4O9GA 4EN8B 1HQLA 1LULA 1DF0A 3MIFA 4LBMA 5FOBB 3M4FA 5C8CB 1OA3A 3RI9A 2ARBA 4BLIA 4ASMB 4HSJA 4G9SB 2H6CA 3WHTA 3TN91 3WDWA 1N1YA 3E6DA 4YM3A 1NCRC 1NZCA 1YFYA 5CU1A 3B9IA 4IQPA 3IT8A 4GB33 2IFWA 4ZKTB 1IPJA 1IS6A 1YFWA 2WNVC 2XL7A 2VGDA 4ZU7A 1RB8G 1S0EA 3WVJA 4LBKA 2YY1A 5T5JA 5BNPC 4EN7B 2RM21 4HPKA 1FOD3 2QCSB 2GAUA 3D4KA 1I3HA 1QMJA 3AXDA 5BNOA 3L2YA 3E6CC 2ZBJA 3N7LA 4B3NA 1J3RA 5BUVA 1ASJ1 2HWD2 4R52A 2F6BA 5LRSA 2ES3A 1QJX3 4TSVA 1OA2A 4AW7A 2A3WA 1C1LA 3MFAA 2ZGNA 5GLWA 1H1IA 4Q4X2 2MHFA 1DQ0A 4KQ7A 3A4UA 2BFUL 5JI9A 2CYFA 4JQRA 4FTBA 2DURA 2RJLA 3NAPA 2ZGTA 3W58A 4XQDA 2EALA 4DS0A 1NG0A 1H1MA 4FO9A 3USSA 1N3OA 4QPIB 2WLQA 3M2MA 1O91A 3ZYJB 2E9QA 1K5MC 1QXRA 3SLIA 3PVEA 4XJAA 2WZPP 3BIWE 1KQRA 3KT1A 2B8MA 3W59A 3ZXJA 1AX2A 4DINB 2Y26A 4LR4A 5KXBA 2RS52 3MLKA 1SLBA 4I3GA 5H9PA 4FOYA 2DUPA 1QJY1 2PAMA 3QOPA 3OGGA 3JD72 3HAGA 1QDOA 4XZPA 1J58A 4CDXC 1KRIA 2NMOA 2ZAAA 2WNEA 2HWC2 2I74A 2X29A 4OHZA 3VKNA 4ATFA 2GC0A 1WBLA 1LU2A 1NXD1 2OPKA 2CY6A 4AG4A 3DF0A 4KG8A 1PK6C 2QJVA 1RJ7A 5E8AA 1AR82 3CL1A 1VBE1 2G9FA 2RMU3 1AR91 2WQZC 1R081 4UXAA 2RS13 1YHFA 3LA3A 4CP0A 5SV8A 2TBVA 1ENXA 4Y1UA 1LENA 3Q9OA 3VKMA 3WW3A 3IPVB 3RPQA 2JKBA 3FUQA 4G4FA 5I8YA 2VPVA 1XE8A 2UYAA 2MEV1 3APBA 1ULEA 1MZ6A 4LULA 4WM8B 3VHPA 4N7UA 1PNFA 4LHKA 1U12A 5H9QA 1DYPA 1OQEA 4I3PA 3ILNA 1V6NA 2ZACA 3VDDA 1OQ1A 3SCGA 1CIWA 2OZJA 2OUJA 1H2KA 1CQ9A 1VBC2 1Q8SA 3ACLA 3BCWA 2ZPXA 5KXEA 1GYKA 2WS93 3TYJA 2A6YA 1FPN2 5BNNA 2WLPA 4ORFA 1HDKA 3MFCA 5TSWA 4FOQA 2R0FA 3FLRA 3NL1A 4RL7A 4KGGA 4WVWA 4HBNA 2FMDA 4F8AA 4K3UA 4NWVA 4X8NA 3VZNA 1VALA 3AFKA 3FLTA 1ULFA 5FDBA 1FOD1 3B02A 4YZ2A 4AHWA 5EV7A 3ZSJA 4EWDA 3MEPA 1IS3A 2RE9A 1PGW2 3HT1A 5CG8A 4EN6B 1Q3EA 3WHUA 1S0JA 5JPMB 1DBNA 4JTNA 1CAXB 1QJX1 4JGZC 3H50A 3ETQA 1RUJ2 4EN0A 1NCQC 1SCRA 1EV12 4RHV3 4YZ4A 3VBHC 1VAVA 1B35C 1W6MA 3WY6A 3GHNA 3H7JA 3OTFA 1VBD2 2WINB 4WM7A 2BTVC 2PLV2 3S7IA 2O1QA 4AYUA 1ENRA 1OPOA 4FBFA 1HRV3 1SDWA 4JV4A 2VNOA 1DZRA 2ATFA 1YO8A 4W6WA 1NCRB 1PIV1 5FFOC 3OYWB 1SBDA 3VGIA 4XJUA 2WNVB 3ZMOA 1DDLA 2VMGA 3VHNA 2XLAA 4E2SA 4HK9A 5JMCA 4I01A 2DYCA 3UJOA 5HCAA 3WNXA 1AJOA 3AP9A 5CFCA 4NHKA 1SFYA 5J98B 5GLZA 2HYKA 2A73B 2XBO3 4QHBA 1YWKA 3VZKA 2NN8A 4W6XA 3U0ZA 3V0AA 1XNDA 3URFA 1S0BA 2HWF2 2C5DA 3CEWA 1BK1A 5FRAA 4YFZA 4YVWA 4YZ5A 4PQ9A 5GLUA 4RQPC 3BALA 5A32B 2P17A 1D4VB 2MNGA 4AQ6A 2RS53 3VBFC 4MGIE 4NN0A 4Z92B 1REDA 3RYKA 1W6QA 2JE9A 3LZZA 3VBSA 3WDUA 4COYA 3JD73 5D8AA 2RMU1 3POWA 4AVTA 2EAKA 5I91A 2RS11 1Z78A 2YZ4A 2HWC3 4H14A 2Y0OA 1YYNA 2Q4SA 2Z5WA 1OD5A 4D7TA 3RZZA 1ULGA 1K5MB 5I93A 4PLNA 5FPXA 4N43A 3KT7A 1V9U2 1VAMA 3ZXAC 4FAGA 1LGCA 1EYBA 4GWMA 2CNAA 4CDUA 4XMAA 3ZMNA 2R042 4M3CF 4Y20A 2ZGUA 1YIFA 4MVTA 2GN3A 3OCPA 1LODA 1C3HA 4XPVA 3LCPA 4PF5A 3AB0A 5AVAA 4IEOA 1MS8A 4GMP0 2GMPA 2WS91 4AEDC 3N4MA 3VBUA 2DV9A 2PHWA 1G8WA 4L99A 4BMEA 3UKNA 2A75A 3CO2A 1BJQA 1NA1C 1QGLA 1FXZA 2D44A 3LSDA 2QFEA 1NYWA 3TN92 2W08A 4HN0A 1PK6B 2R49A 3QH6A 4FPOB 1VBC3 3G6JB 3H0OA 1C57A 4C0HA 4R9CA 4MXWA 1V6OA 1S1AA 2C9AA 3ZSEA 2BPA2 3LB9A 1YI7A 2HEYF 5F6LB 1FPN3 4YVSC 4ASLA 3E97A 4PLMA 3LWCA 1N3QA 3AP5A 3ZXFA 4CDQC 2CAUA 4BOWA 1CAVA 4A3XA 2RHPA 1RUD3 2VULA 4RS5A 4COWA 5K0UC 3RRDA 2FZ1A 2R30A 1BEV2 3ZXLA 5A33B 2XB6C 1HXS2 5FTTC 2BVVA 3VL9A 1KFXL 3OGJA 3BB6A 4LHLA 1ASJ2 1LHWA 1R092 2D6KA 3DGTA 4RHV1 1O4TA 3AP4A 4WBBA 4OI1A 4Q0UA 3WDVA 2JECA 3AJYA 1JBCA 4Q8LA 4YGDA 5JZGC 2Q0AA 2BWCA 3ZFEA 1O3TA 4OHYA 1W0OA 5JSRA 1O7FA 2E7QA 3N7JA 1HRV1 1RHI3 5EYYA 3WR0A 2I2SA 1NE6A 1RUOA 3ZYIB 4P9WA 4BM8A 4EWEA 3ATGA 3KSCA 1EV13 4J1WA 2XJUA 3PNAA 4YGBA 4XILA 3ES4A 2GU9A 1W6NB 1C4RA 2PAEA 4KWKA 1FV3A 4PDWA 5GZGA 1QKQA 2PLV3 5L36A 1GANA 4R9BA 3WP4A 4PLOA 4HANA 5AFEA 2XBO1 4FTSA 2ZKLA 3RMYA 1LGNA 4CEYC 1HX6A 1DFQA 2XL9A 3IKWA 3PVBB 1LHVA 4Z82A 3DPRB 3NVCA 3OY8A 1RUC1 3V56A 1UU6A 2A70A 4XQWA 4JGZB 4CEWC 4SLIA 1SLTA 5JIAA 1NCQB 1CAUA 2RS51 1V00A 1PHMA 3VBHB 5IK8A 1B35B 4QQOA 5DUUA 3KT4A 1A78A 4PIYA 3BODA 4H55A 3JD71 1H8TB 1IQAA 4GXLA 5CNAA 1C1FA 1POV0 3VBOC 2VXRA 4XDQA 2HWC1 3JBG1 1GZWB 5DZGA 3HBZA 4B29A 1RGSA 4M3CE 2D97A 1AXKA 4Q4W2 1VBE2 4YW4A 4AFCA 2AGSA 1VLNA 1H2LA 1QXPA 1AX1A 4LO6B 2IXHA 1V6LA 3D5OA 4BWOA 2DFCA 5KC6A 1GQGA 1LOGA 2KXLA 3GZTB 1REEA 4XIKA 1OOPA 1NE4A 2DVDA 2UURA 2XUMA 1OLQA 2B46X 3WV6A 1SLLA 2NQYA 4FSJA 3VBFB 2VOKA 3PVOA 2YHJA 1HQWA 1ZZ9A 2R043 2AUYA 5JWPA 1VBC1 4BIOA 4NHLA 1WLCA 4F83A 1WUVA 1WMDA 1HQNA 1YXWA 1FPN1 4OZXA 5JIUA 3VN4A 1AX0A 4JDOA 1W6PB 1FX5A 4HK8A 4YLZA 1C28A 1RUD1 3TRSB 1LOAA 1ZZ8A 2D6OX 3QH7A 4YG6A 1SFNA 4WVMB 4YGCA 2VU9A 3AZWA 5FO9B 5ABJB 1UU5A 1G9AA 4OLLA 1LOBA 4IEXA 5T55A 3VZMA 4XE9A 3EO6A 2DVFA 2JG8B 4TLFA 3ZPYA 3H7YA 1IKQA 4QPGC 4XOGA 4CTEA 2W52A 5AFBA 2PHUA 3VZJA 2QUOA 4D94A 4MV2A 1SMVA 1YRZA 3SH3A 3PMEA 1H9PA 2DCKA 1BEV3 1RHI1 4B4RA 5T5OA 1HXS3 1O4ZA 5C9AA 1CGPA 3MIEA 2V5YA 3FC0A 3NKGA 1ASJ3 1EV11 1R093 4FP3A 4LBQA 4IV1A 1MS5A 2W68A 5CVRA 3B00A 4M3CB 4QPIA 1PZ9A 2PLV1 1PIV2 5JAXA 2VVFA 4AVCA 4E2GA 2JG9A 4NO4A 4XHXA 1D2SA 5FO7B 1U0AA 4AI3A 5K7PA 4W6YA 4YVSB 4Z1VA 4AHZA 4M00A 3M8LA 1RUF1 4CDQB 1MQTA 4FPFA 3OBTA 3RYRA 1AXYA 1WCDJ 1H30A 2Q1MA 4XQ4A 4FAHA 1H2NA 3ZYRA 2E6VA 3RNSA 5JR7B 3VZOA 1YUDA 2YYOA 1GZ9A 4JC1A 4HLTA 5DUVA 4WM8C 5JZGB 3AXEA 1UF2C 4OVEA 1TNFA 3AZXA 3MF6A 4L92A 3ZFFC 1JH5A 3B01A 1Z7S3 1XU2A 4QGMA 3MLLA 2ERFA 3HWJA 1G9DA 3EJKA 2VNRA 3POSA 4FPYA 2V09A 2RS12 2XH6A 3AP6A 4B8EA 1WD3A 2GC1A 3SISA 4LBOA 1PO23 2WA4A 5JOXA 4CEYB 5FQ0B 4JGYC 4MH0E 5K8SA 4X6QB 2CGNA 4UBHA 3IDCB 2D3PA 3MI8A 1XU1A 3USUB 2JICA 4NVPA 4Q4W3 4H7LA 2BUKA 3H3ZA 4CEWB 4YARA 2I45A 5KXDA 4XW3A 1RVF2 5I0RA 2OZ6A 4AEJA 1CR7A 4BYYA 2XVKA 4A7KA 1GNZA 2R041 1SBEA 4JRLA 2NYYA 3FZ3A 5HXVA 1QF3A 1TMF3 2WS92 4GIQA 3EXUA 1DLLA 2P3JA 5CBLA 4QQLA 4LA3A 3AKTA 3VBOB 1UZZA 4N53C 5BY5A 5GZEA