1XNTA

Nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
151
structure length
151
Chain Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (DNA-REPAIR PROTEIN XRCC1)
publication title Solution structure of the single-strand break repair protein XRCC1 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xntA00
2L9LA 5LCWL 2J1TA 3A21A 4DXSA 2VOTA 1US3A 1W9SA 1UMHA 1YQ2A 3THDA 4ZXEA 4P5YA 1XC6A 3I2GA 3SKVA 1UY0A 4DEQA 1W99A 4QB1A 5JXHA 2QQIA 1TG7A 4JKMA 1JYNA 3FHAA 3C7FA 2J1UA 1JZ8A 1H6XA 2QQKA 3LEIA 1PX4A 4KMQA 4MGSA 4ARXA 2ID4A 3UNPA 2E33A 2W94A 3EYPA 3OBAA 1W0NA 3IIIA 3K75B 4A44A 1R64A 1HN1A 2J1EA 2W91A 2W47A 4CUCA 2J1VA 3I3DA 3T2QA 1O59A 1SDDB 3VD5A 2VMDA 2ZEZA 2ZEXA 4A41A 4DXRA 3WNLA 4CU9A 4QB2A 4W50A 1WKYA 5LA2A 2QBXA 1ULPA 3CZUA 5EJ1B 4XURA 3SEEA 5JUVA 4JHZA 1OH4A 2OKXA 1UWWA 4ZZ5A 5C71A 3I2KA 5HPOA 3K4AA 1UXXX 3DYPA 3WNPA 5IYYA 1UX7A 2PQSA 3JXSA 3PUHA 1UYYA 3VD3A 1W8NA 3OEBA 2W92A 4QDRA 2JKXA 1SG3A 1KEXA 3D3AA 4TXWA 4UI9L 2E26A 2B4KA 2VMCA 2Y6LA 1W8OA 3SEPA 1NKGA 5LA1A 3P6BA 4LQRA 1K42A 4JKLA 3VD7A 2J1RA 3GXUA 1XPWA 2QQOA 3LQCA 2X05A 2HLEA 3I2HA 3BGAA 2VM9A 1O8SA 4A45A 1GOHA 3BN6A 4CU7A 2LW8A 4M4RA 2LS6A 1W9TA 3WNKA 2WZEA 3IB3A 1UY1A 3HNMA 3LE0A 3ZM8A 1XNTA 5IJRA 3OEAA 4YPJA 4HG6B 4QPWA 1O8PA 1JI6A 1GOGA 1CZTA 4BXSV 2YC2A 3VDCA 3WF1A 5A1AA 5B4XA 4A42A 2XHNA 1LNSA 1JU4A 2J1AA 4KI5M 3OGRA 4XUQA 2KD7A 5DN2A 1GOFA 5DPNA 2WAAA 3C7OA 1JZ6A 2V5DA 1PX3A 2W1QA 3WQBA 2VZ1A 4AG4A 2EIDA 2WN3A 5JXGA 3I2JA 5CZKA 2WO3A 1EUTA 4ET7A 4DXTA 4E8DA 3OB8A 2RV9A 4IUGA 2BERA 4XVHA 1UYZA 2C4XA 4DEVA 3C7EA 2ORXA 3MUZ1 2QQJA 3ACIA 3PUIA 1J83A 2DCKA 2QQLA 4LPLA 2C9KA 4TTGA 4XUTA 4KWUA 3CMGA 4QX1A 3VDAA 2VZPA 3FHQA 2VC9A 5IHRA 3A7QA 3EB7A 2VJXA 2Y6HA 3CKHA 5I0DA 4MOAA 2VMEA 2W3JA 4D8MA 4PF1A 2RVAA 2HYXA 2E32A 2VQUA 3ACFA 2WN2A 2WUHA 3WEZA 3DYMA 2V4VA 3LEGA 2Y64A 5B4NA 4P00B 4BDVB 1KGYA 4CU8A 2WAOA 4P08A 5F7UA 2VZQA 2VL4A 5DMYA 3VD9A 1DYOA 4BK5A 3T0DA 2YC4A 1OT5A 3ABZA 1D7PM 1T2XA 5JXIA 3I2FA 1UXZA 3K77A 2EICA 1MPXA 2WABA 1OD3A 4FI9A 4XZUG 5EJZB 1JU3A 3T0AA 2EIBA 2Y8KA 3THCA 2VZRA 2J1SA 2W87A 1EUUA 2W95A 4RN5A 1NX9A 3MV01 4OUEA 3LEKA 4CU6A 1JHJA 3P1IA 4LKSA 1IQDC 5G04L 4GWJA 3CZJA 4QDQA 5IFTA 1NUKA 5C7GA 3CDZB 3NJXA 2W1SA 1DLCA 4QX3A 3MBWA 4BJ0A 2ZXQA 4DUXA 2ORZA 3NNGA 5JR2A 2VR4A 2DDUA 2VZOA 2VCAA 3NJVA 1UY3A 3OGVA 3OG2A 2WBKA 1GNYA 2X10A 3T2PA 3IAQA 2E31A 3OGSA 1RYYA 4P02B 3J7HA 2VZSA 2EIEA 3E1F1 4D0QA 1BHGA 2J22A 3WF2A 3WF3A 2QQMA 4AAXA 1JYVA 3T0BA 4MADA 1JYWA 2YG0A 2C26A 1W9WA 3K4DA 4CUAA 1GMMA 2ZEWA 2B9VA 4MGQA 3IAPA 4RYDA 4ZY9A 3HEIA 2VQTA 1UY2A 1L7QA 3NQHA 5IFPA 3ETPA 3C7HA 3I3BA 5JMOA 1J84A 3UETA 4PT6A 3T09A 3MO4A 1JZ3A 1L7RA 3I2IA 2QQNA 4A4AA 2VZ3A 2JE8A 2YFUA 3DYOA 4ZZ8A 2JDAA 4XUOA 3FL7A 2YB7A 2Y6GA 3I3EA 1TVGA 2WYSA 2VMFA 2J7MA 4UOJA 4QX2A 3C7GA 5C70A 1GQPA 1JZ5A 3LPGA 5JXJA 3HNYM 2W1WA 3MUY1 1UZ0A 4CUBA 1P8JA 5DQ0A 3T2OA 1US2A 1GUIA 4LHSA 4UAPA 2WDBA 1JYXA 2W9XA 2YFZA 4CVUA 1UY4A 3ACHA 3K46A 1ULOA 1PMJX 3W5NA 3AC0A 3DECA 2CDOA 3GM8A 3UESA 4L0PA 5J1XA 3W5MA 3FN9A 1XNAA 4QX0A 3WNNA 3HN3A 2ZEYA 2VTFA 1CIYA 4GWIA 1K12A 4QAWA 2WO1A 3A23A 4A3ZA 4DUVA 1I5PA 4OZOA 2V72A 4M4PA 3ECQA 2VCBA 2VCCA 4E8CA 4OMDA 1K3IA 2VZUA 1GU3A 2Y6KA 3WSOA 5LA0A 4JX0A 1F4HA 3MV11 3A22A 2W5FA 1SHWB 1CX1A 3LPFA 2X09A 5HXMA 2VO5A 2BGPA 3F2ZA 3HOBA 2W46A 4DUWA 3CQOA 2WQ8A 4BK4A 4W4ZA 3I97A 4A6OA 1UYXA 2R7EB 2XOMA 3WF0A 4GZ9A 1OF4A 3IDAA 4OMCA 2BBAA 3NRUA 3U37A 1K45A 4Z2AA 1H6YA 5CYYA 1JZ7A 1CZVA 2VZTA 1PMHX 5G05L 2WO2A 3C8XA 3WF4A 1JZ2A 3WNMA 2Z4FA 4W8JA 3VD4A 2Y6JA 2VZVA 3GDBA 2BGOA 1NAEA 5FUIA 2W1UA 2WZ8A 3T08A 4XUPA 4QB6A 3HJRA 1CZSA 4OYUA 4MO3M 1F4AA 1OF3A 4XUNA 2CDPA 3HPNA 3HNBM 1DP0A 3CIHA 2XQXA 3ACGA 4ARYA 3VDBA 3SKJE 3GGLA 3WNOA 4QDSA 2JD9A 1JZ4A 2BZDA 4PQQA 2DCJA 1WCQA 4JKKA 5EIYB 2XONA 3K4ZA 2RJ2A 1UMIA
chains in the Genus database with same CATH superfamily
2D6OX 2J1TA 3TB0A 5C8CB 3KZ4C 1R091 1W9SA 1LCLA 4BH9A 3PMSA 1CJPA 3ZN4A 1H2LA 2B46X 1R092 4ONUA 3DV8A 2LRPA 2VECA 1ULDA 3MFAA 4DY5A 1X9PA 4AQ6A 2OYZA 5IVBA 2WKKA 5DZFA 4Q0VA 3SKVA 3VBRC 4AEJA 4NRMA 5CBLA 3BTAA 1O3SA 4ORFA 1W99A 1E57A 4FFGA 4QB1A 2IFWA 4YW1A 4FFIA 1YIPA 3AP9A 1DGRA 4JKMA 4E9KA 1JYNA 5FPUA 5BXXA 2EAAA 1E5HA 1PO21 3MW3A 5C4WA 2WC2A 2D5HA 1PO22 2CL2A 3KF5A 1QJEA 2E6VA 1OUSA 3MICA 4XCAA 1MACA 2FZ1A 4LBLA 1S4CA 1YNAA 1OUXA 3GALA 3MLJA 2W94A 2A73B 3ES1A 4LIVA 1UCXA 2UY9A 2VW2A 5EYXA 2QNKA 3ZIXA 1GLHA 3IIIA 3ZMNA 4CEWB 3J8F3 2GNTA 3HMYA 2A1XA 3JB4C 1UIKA 4A44A 1R64A 1S1AA 2RS13 5FZ4A 1C5HA 3ZR5A 4CDWB 4CUCA 2XBO1 4C0BA 2J1VA 4K8RB 1WCDJ 4UF0A 4IGQA 2VOXA 4YVSB 4NMIA 3U1XA 2ZEXA 4YW7A 1DHKB 2ZGSA 4CU9A 4HETA 1CN1A 2ZBJA 4IGPA 3BU7A 4QB2A 5FZDA 3ZYRA 3EMRA 3VDDA 3CZUA 5EJ1B 3NSTA 5CFCC 5JZGB 5FKBA 1DF0A 3U75A 3VZNA 4EWEA 2F4LA 5LA9A 5T5JA 5HPOA 5HI0A 1UXXX 2CSGA 2FDJA 2XVKA 3DYPA 1UX7A 5L9RA 4AHXA 5ABJB 1GP5A 5KC5A 3U10A 2WL1A 2WNVB 3A4UA 4JGZA 4CDUC 1UZVA 2OT7A 1W8NA 3BVCA 1DQ2A 3OEBA 5CIRA 4R9BA 1YXWA 3EXUA 4XILA 4CRQA 1FV2A 1POV0 5CG8A 4FTEA 4A2UA 1U12A 3VBUC 2Q8DA 1QOOA 4OLLA 3B93A 1VRH3 3SCGA 4D6SA 1MR5A 1UMZA 3PU3A 3SEPA 5A3PA 5T3NA 3FWEA 1V6OA 4HONA 2QDRA 4LQRA 1AZDA 3ZYHA 2X53S 2A6XA 4CP2A 1K5MA 3O1RA 1BK0A 1VPHA 4N53A 2HLEA 1YC61 3NAPA 2FDHA 3Q8CA 3ZDSA 1PK6C 3PVNA 4ISQA 1IQAA 1GR3A 1WW4A 1YJKA 5K4LA 5JIUA 3LWCA 4AVBA 3BN6A 1SDWA 1JBCA 5JOZA 3R6SA 4CEYB 2OZ6A 1NCRC 1WBFA 5FYYA 3FJSA 1GSLA 2WZEA 4AE2A 3LSEA 1SPPB 3LE0A 5HCAA 3FC0A 3M3CA 5FMCA 1IS4A 3ZM8A 1ZRIA 3TOJA 2E53A 4HKWA 4W65A 2HEYF 2BUKA 5IJRA 2QQUA 4FP2A 3OUHA 4HG6B 4QPWA 4AQTA 2TBVA 3I59B 1O8PA 5AFEA 1OVPA 5FYMA 5IAVA 5FJKA 2CAUA 4MH0E 4BXSV 1Y9QA 2D6NA 1RUF2 1OURA 1KDMA 5ANNA 1XE0A 2YC2A 3HD8B 4HANA 3JD71 1STMA 3RYKA 4DINB 1DGLA 1Q43A 3JD72 2HKXA 3CJIA 4CXXA 4JHTA 5A3NA 2ZGQA 4QXCA 3KV6A 4TN7A 3APBA 2E7TA 3QLQA 2QQVA 5FZ3A 3W58A 3NNLA 4TZDA 1RUC1 5C3OA 4TYSA 1LNSA 1JU4A 4XBNA 3UKTA 1VBB3 2XPJA 2J1AA 4KI5M 2V5YA 2ZMKA 1DQ6A 4Q29A 2PHDA 4A6SA 1W0OA 4RD7A 2SLIA 4CDQB 5ACA3 4PDWC 3NMBA 5BPXA 3RZJA 1ACCA 3HQUA 1AYN1 5A3OA 4DB5A 2YHJA 1LHWA 1X8MA 3O1TA 2JDYA 4Y1YA 4Q8KA 1AYN2 2BU9A 1D4M2 2ZAAA 5FPBA 3ZXDA 3JBG3 4P14A 1ND2A 1UO9A 5I8SA 2W1QA 1JYTA 4JZRA 4LR4A 4K7JA 5HCFA 4Q4V3 4AG4A 1LJ7A 3U4XA 3M8LA 2WN3A 4NJ4A 2QDNA 1SBDA 4UF0B 1H30A 4QQ2A 3VGIA 2ET1A 2VQAA 4DXTA 4E8DA 2VMGA 4YZ2A 4AW7A 3OB8A 1AR73 4BQWA 3EJKA 2A3YA 3D8CA 1XRUA 1WW7A 3N9PA 3VDDB 5JAXA 4QGMA 2C24A 4N43C 2A6YA 4XVHA 5C6CA 4FPGA 1LHNA 2P5BA 4GULA 4DEVA 3C7EA 1REDA 2RR11 1DFQA 1S2KA 3MUZ1 3RNSA 2HBTA 5KBFA 3IM0A 1J83A 3V56A 2QZ2A 1NG0A 3F95A 1POV3 2DCKA 2E9QA 2C9KA 1Y4WA 2QQLA 4B4PA 5CADA 2Z69A 4META 4XUTA 4YZ3A 5BNPC 4XMAA 1ST8A 1PO11 5FYUA 2BQPA 2O8QA 3RQ0A 1LHOA 3H3UA 4KWUA 4QX1A 4XHXA 4ATEA 3OD4A 5FYIA 1DQ4A 1WD3A 3FHQA 2VC9A 5IHRA 5JCTA 3UV9A 1WGPA 3ZO0B 2O1QA 3CKHA 3ZYGA 4OHWA 3J7MA 4LMFA 2W3JA 1MS5A 3K48A 5FY0A 3HR9A 2R32A 5LY2A 3K3NA 5J36A 2WN2A 2WUHA 1NOVA 5IVEA 1K5MB 5C8CC 3DYMA 3HBKA 3MIBA 2DUOA 4R4XA 4N53B 2JKBA 2PQQA 3ROUA 1RUI1 3NAPB 1BXHA 3ZN6B 4RR3B 3ZFEA 1PM4A 2Y64A 4UW4A 3TWIA 1RUI2 3WOGA 1CAWA 5BNNB 2GNDA 1SFNA 4QQPA 1KGYA 4KBZA 1S0JA 2WR9A 3N7MA 3VD9A 2AEZA 1TMF3 2MHFA 2PHTA 1YO8A 4NIIA 3WG3A 4AEKA 1Z7S2 5FLJA 2C9AA 1D7PM 4L97A 4AVTA 2RM21 3WDTA 2PA7A 1HXS2 1OLQA 1G6NA 2RM22 2VY0A 2GC1A 3IZOA 1LOFA 3E5UA 3N9MA 5DAXA 1W0PA 4FI9A 4HL0A 5EJZB 1PZ7A 5FZ6A 1JU3A 4WM8B 1ZX5A 2WNUA 4PIXA 3ZXGA 4ISRA 4XOGA 4KNCA 3LSDA 3TEXA 2BNNA 4XPVA 2A6WA 4P9GA 3PU8A 4YGBA 5FV3A 2W87A 4ASLA 3LOIA 2ARXA 2PHRA 3CJIB 3VBOB 5KHIA 3TEWA 2W52A 4IEWA 4CEWC 4XJWA 4N9IA 3AP5A 3ZR6A 4CTEA 2WS93 3AYCA 3ZYFA 4CDWC 2UWCA 2XGXA 2ZX3A 2XJSA 3E5XA 4OUEA 4TLGA 1BBT3 4EQVA 5I0RA 5CG9A 1VBC3 2HWF3 1JHJA 3P1IA 2R16A 4LKSA 3THCA 1W39A 3CZJA 2G19A 3ILFA 5IFTA 3IIAA 4J6GA 2FCUA 4XQDA 2GC0A 1SLAA 3GCWA 4LKEA 4UT5A 1JTZX 3NJXA 4RHV2 3VBSA 1UOFA 4AFBA 5CAZA 1OPOA 5JZGC 2OQ7A 2VOKA 1IG3A 1SMVA 2RMU3 2WWSA 1EP0A 1ND2B 3MBWA 1RUJ3 5FTTC 3NNGA 5F2SA 1BKZA 2VR4A 3GNEA 5FZ7A 1OA2A 5ABJC 4NPMA 2WNVC 4OQ8A 1YI7A 1RUG1 3NJVA 3DF0A 2VUDA 4QD2A 1B35C 4FPJA 5LRSA 1RUG2 1NQJA 2PLV1 2VH9A 3MEPA 3OG2A 2I45A 3IAQA 1XSRA 2OW4A 2E31A 2PLV2 1CJDA 1RYYA 1VAKA 1ZBA1 3M3EA 1A34A 4P02B 1COV1 4R9AA 1ZBA2 2EIEA 3VB9A 4D0QA 1COV2 3PJQA 1BHGA 1NA1C 4Q0SA 2R6QA 4COUA 4FSJA 1GNHA 1JYVA 2C5DA 3DKQA 2RS51 2OX0A 4MADA 5A7SA 1PGW1 2YG0A 4LO6B 5LBBA 4AGRA 3TAYA 1JYWA 3B02A 1O4ZA 2Z2SB 3WR0A 1O4YA 3K4DA 4CUAA 4LITA 5KR7A 1GMMA 3V64A 3LKJA 3M7AA 2E51A 1VBA3 2RS33 3GBGA 4BIFA 4CZSA 4ZY9A 2IXKA 3HEIA 3J7LA 4C0HA 1UY2A 1QDOA 4NHKA 2ADDA 3I3BA 4U36A 3WXPA 3I3MA 3UETA 1HDKA 5JPNB 1PVXA 2DCTA 3PJYA 1D4M3 3BI3A 5A32A 2G9ZA 1JZ3A 1B09A 1RUNA 5I8YA 1ULCA 2QQNA 3EO6A 1R081 4YSFA 1EV11 2DU0A 1XYPA 3VKMA 4RGKA 2RE9A 2GDFA 4XE9A 1R082 4QX8A 1EV12 3S7EA 4XUOA 4BQ1A 3H8OA 1S2BA 4WVMA 3SMHA 1ZZ6A 1UU4A 2I74A 2FDGA 1OMIA 2J7MA 4UOJA 3UK9A 4XTPA 1V9U3 4W6XA 5EYYA 5FZ0A 5A3UA 5JXJA 1QIQA 2DF7A 4AQ2A 2F17A 5JOXA 1PGSA 2YYOA 4IL7A 1LU2A 5FXVA 2IXJA 5CFCA 4MHUA 3T2OA 1OKQA 5FYVA 2OPWA 4J1XA 4UAPA 2W9XA 1WLDA 2Q5TA 3DXUA 1VRBA 4EZHA 1UY4A 2WNUB 4ZU5A 4YARA 4CDQC 1MVQA 3DECA 3IDBB 3MPPG 5A3WA 3WDXA 4AI1A 3GM8A 5EFUA 4CDUA 5J1XA 1R1A3 4XHBA 4IE0A 4HK9A 1XNAA 1CIWA 4YW3A 4B1MA 3GBWA 2YMZA 2Y26A 4XBLA 1LOAA 3VBUA 1O4TA 1V6NA 4W6YA 5FZGA 4CCMA 3B9CA 3DKWA 3J4UH 4B1LA 2XJPA 4GB33 5A6QA 2Q4SA 2ZEYA 1HQWA 2VTFA 5FZHA 3CNAA 4A3ZA 2GP3A 4ZHNA 5L19A 2VCBA 1APNA 4Q27A 2WO7A 4Y5Z0 4XMIA 1ZBE3 4E8CA 4OMDA 3VBSB 3VDDC 2A6VA 2Y6KA 1BMV1 2RDQA 1LENA 2VVDA 3B3QE 4MUVA 2YBPA 2HWC1 4HVQA 1G9BA 1E5RA 2AYHA 2HWC2 4EN8B 1CX1A 3LPFA 2X09A 5F6KA 3SCHA 2BGPA 3HBZA 2D3PA 3HOBA 3AKTA 3ZVXA 4XF4A 3B00A 4D7TA 2P3IA 1GYKA 5IUQA 3RG0A 1VP6A 3O1SA 4A6OA 4MZUA 5CKNA 1PMIA 4GZ9A 1RUH1 3AKSA 1VBE3 1OF4A 2A3XA 2R041 4N9HA 3P3PA 1RUH2 3U37A 2ZPXA 1L7LA 1K45A 4X8PA 4Z2AA 2R042 4JDMA 3O12A 4HT1T 2JG9C 1AX1A 5CYYA 5GZCA 2TEPA 1F35A 4BA6A 1IS5A 5G05L 2WO2A 1K5MC 1SLLA 5A80A 1KFXL 4YM2A 4Z92B 1V6JA 4N53C 1UL9A 2Z4FA 1JMUB 5FOJB 4RR3C 3IDEA 1GQGA 1W06A 5BNNC 2HWB3 2CGOA 2WINB 1ENSA 4ZKTB 1H4HA 5LB6A 2VZVA 5FYHA 5IATA 1XBFA 4P9IA 2BGOA 3I54A 4HMZA 2IWGB 4XFAA 3WDVA 4CCOA 4M3CF 5I0UA 3WZ1A 1BEV3 4XXPA 2VUJA 2EXHA 3O1VA 4XUPA 4QB6A 1IKQA 4L92A 1KRIA 1CZSA 5C5TA 2RHPA 1IPKA 2WWUA 5EP9A 1UQXA 3ELNA 4OYUA 3BB6A 1X7NA 2NYYA 1OF3A 2AH2A 1DZRA 4G9SB 4R9CA 2OUJA 4F3JA 3HPNA 4WM8C 1PIV2 3P5BA 3M3IA 3POFA 1HW5A 1ENQA 3CIHA 4XJ9A 1HRI3 3POGA 5FZIA 5FZ8A 1JODA 4LBNA 4WVMB 3NNFA 1URXA 4BIOA 3SKJE 3NNMA 3WNOA 2Q30A 1UIJA 4QDSA 3A0NA 1LAJA 2W2IA 4YW2A 3UGHA 2BZDA 3VBOC 1WCQA 2YPJA 4Q0UA 4DRVA 5EIYB 5LEKA 3K4ZA 5CFCB 3CU7A 3Q8EA 4GMP1 1X33A 5JR7B 5I93A 1MZ5A 1L3JA 4DXSA 5FDBA 2VW0A 2VOTA 3SXWA 5HBAA 4UW6A 4I02A 1LESA 3LFMA 3THDA 1WMEA 4ZXEA 3S5QA 1XC6A 3IMMA 2XWBB 3JZVA 4P9WA 1MZFA 4BQ3A 2OS2A 4AGGA 3AKQA 2Q1ZB 3SLIA 1HKDA 5F39A 2VNVA 5JVVA 2GN3A 2ILMA 2A7AA 2X5IA 2WLPA 2SBAA 4MLOA 1ND2C 3CHXA 2QUOA 2UYAA 4FOWA 3N9NA 2ZKLA 3FHAA 3OPWA 4PLNA 4HBNA 3TYJA 2HH9A 3RMXA 4ZONA 4FP3A 1MS1A 2XUMA 4OZXA 4Q4W1 4CCDA 4AHWA 5C8CA 3LEIA 5FPXA 1JZ8A 4DQAA 1YWKA 4Q4W2 1MZEA 3I2DA 5FKCA 4KMQA 1QJU1 1E5SA 4MGSA 4M0HA 4O7XA 5C3QA 1QJU2 2E33A 3EYPA 3HIFA 3OBAA 1ZYBA 4HSLA 1W0NA 1I6XA 3WT3A 4MSVA 2R071 3NL1A 5FZ9A 1OOPA 1LODA 5FMOL 4D69A 1GP4A 2J1EA 4RFRB 4C1WA 2R072 4Y1VA 2BGCA 2LUWA 3B7MA 5FFOC 3OJBA 3Q8FA 2ZA9A 1OA3A 4ZS3A 1S2EA 3SITA 4LTAA 3VD5A 2VMDA 3KHCA 3LDRA 3VV1A 1AR63 3JB8A 4DXRA 3WNLA 2BW8A 2ZAHA 5GM0A 3ZSMA 1Y9GA 1GFF2 5LA2A 5T52A 4HZFA 3RGBA 4LBJA 1V70A 3ES4A 4XURA 3SEEA 4BE3A 5AC91 5FZOA 5JUVA 1OH4A 2JE9A 4IETA 4IV1A 5LZ6A 2ZGMA 5AC92 5LK5A 3WP5A 1W03A 4ZZ5A 1LOEA 5C71A 3BU0A 2OZJA 1RIRA 2E63A 3MF6A 1C8NA 3ZSKA 4YG0A 3PHMA 1QF3A 3JXSA 1ZZ7A 1UYYA 4L11A 4CCJA 3VD3A 4NIDA 3BCWA 4CDWA 5LATA 1HV1A 4MGYE 4QDRA 3FHIB 3KCYA 4MXWA 1SG3A 4BWOA 5FPZA 2WA3A 1RUOA 2PTMA 4TXWA 2JDMA 1DYKA 2E26A 2KM2A 4UI9L 1RITA 1ENXA 4I3GA 5FWEA 1NKGA 1YFUA 3WHUA 4A7KA 3LB9A 3AP6A 1EAH1 3P6BA 1QWRA 3VD7A 5FYBA 2B7YA 4HFSA 4AI3A 1H0BA 3USUA 3VL8A 4BB3A 3ST7A 5JZGA 1AR91 1G8WA 1QJY3 2QQOA 5FZMA 3DEMA 3LQCA 2X05A 3RYRA 3BTXA 1AR92 4EN9B 3WG1A 1WCKA 4DIQA 1MQTC 2XQRA 4O9EA 3DXTA 4O9GA 2WNUC 4XDOA 1A78A 3BGAA 2P37A 3OTFA 1OC1A 2CWSA 4CU7A 2IXIA 1B35A 4M4RA 2LS6A 1W9TA 4IESA 3AL5A 2K46A 3KLSA 2E7QA 2CV6A 3T4HB 3ZIWA 2BYVE 2QCSB 1ALYA 2XLAA 3N9QA 4FFFA 1XJAA 1QJFA 1XNTA 1CAXA 2YPDA 2B45X 2XL9A 5CKQA 1ZNPA 4NN0A 3W9AA 2EXJA 1HQNA 2ZTNA 1W8ZA 1YIFA 4H14A 5EV7A 3OEAA 3SHRA 3NJZA 5A1LA 1YI9A 3OGGA 1NA1A 1K5JA 1XNKA 2ARBA 3KF3A 5SV8A 5A3MA 2AACA 1GOGA 5JDBA 2O0OA 4FXKB 2D44A 5FZKA 5FP9A 3WF1A 3WUDA 2IUWA 1RUE1 3I2OA 2VVFA 3HT1A 3Q8AA 4GIQA 3VBSC 4BMEA 4COYA 5A1AA 1MEC3 4PLOA 1RUE2 5DUVA 2ZOEB 3B5LB 5BNOA 5FO8B 1PGL2 1D4VB 2QQWA 2BNOA 2X5IB 3BTZA 3R05A 2ERFA 1S0CA 2XHNA 4I2OA 2PELA 5A33A 4EZ4A 1HQLA 5FY1A 3ZYIB 2NN8A 2D43A 1Q8OA 1YUDA 3POEA 3OGRA 1GANA 2ZHNA 4XUQA 5A7NA 2VG9A 4YG3A 2P3JA 5D8AA 2YUEA 2Q1FA 4Y4YA 3V65A 5F5CA 3TN93 1DQ0A 4GQ7A 2R0FA 3C7OA 2BJSA 1DG6A 3I59A 3UGFA 1PM7A 1DLLA 2ZGOA 4YVWA 1AL23 2BOJA 3RI8A 3WDUA 5C9AC 2V5DA 3KSCA 1SBFA 4K1YA 1PX3A 3VHOA 3HWJA 1OOPB 3WQBA 1H1IA 4XFHA 1FPN1 1VBD1 3J9SA 3ATGA 1ENRA 5FO7B 4YRDA 4BQXA 1FPN2 1PHMA 1C1LA 1VBD2 2BP6A 2GAUA 2HWE1 2OUHA 3H9AA 1W8HA 5CZKA 4FVVA 3NV3A 3BYWA 1FXZA 1VB4A 2HWE2 4LUKA 4GXLA 2JB8A 3AP7A 1AR71 4XABA 1Q5OA 1N47A 1AVBA 4XF1A 4QPIB 4Y1ZA 2NZ9A 5LBEA 3UYJA 1DGWX 4CDQA 5FUNA 1W6MA 4CUGA 2BERA 5J48A 2K9ZA 3JUUA 4Y3OA 5FZOB 1UNBA 1ASJ3 1UYZA 4IV1B 4KGQA 3DUIA 4NAOA 4BQ5A 2C4XA 2ORXA 2XVLA 4XF0A 5HV4A 3N9OA 4FPKA 4WM7C 4TWTA 3UKNA 1QKQA 3AVSA 5FZFA 2CGNA 2TUNA 4LPLA 1SFPA 1ZZBA 2E7AA 2WT1A 3POBA 3Q9OA 5FZBA 2JDHA 3KV9A 4NIAA 2ZX4A 2ADEA 1AHSA 2NLRA 4MXWB 5GLZA 1WLCA 4BXFA 4OI0A 2XBO2 3A7QA 2PHWA 2P3YA 1QEXA 1XSQA 2Y6HA 3H8RA 5FXWA 3BODA 2VMEA 2W08A 5LW9A 3O5SA 1NLQA 4B8EA 3VKLA 1ODNA 2ZHMA 2VQUA 3JU9A 3KQ4B 5JIAA 3USUB 4DY3A 5HV0A 2OA2A 1NZIA 4NIGA 4QQHA 1A8DA 1XOYA 3SH3A 3VHNA 1M06G 4XXAA 1CD3G 5FYTA 2FCVA 2CAVA 1QQP3 1KJRA 2R063 3LEGA 1RUD3 2JIGA 5B4NA 5F8PA 3LFIA 3FUQA 4GJZA 1TE1B 4P00B 4PF5A 4ZXKA 4MYEA 3E5QA 4XIOA 4B7EA 1SZBA 2VZQA 2VL4A 1KD7A 1TMF1 4BK5A 3T0DA 2A75A 4GJYA 1B35B 4ZS2A 1W05A 3ABZA 3M3QA 1TNFA 1I3HA 2XVGA 4HN0A 3K77A 2ZMNA 2H0BA 2ZGRA 1CAXB 2MEV1 4I01A 1OD3A 1YQ5A 3GHMA 2ZGPA 3L9JT 4OUMA 4CPBA 1BK1A 2MEV2 4HVOA 2JG9A 3N7LA 4CDXA 1OLME 4NHYA 3K51A 4Q4X1 1NA1B 1QY4A 2DFBA 3T0AA 4KWKA 2NMOA 4UFLA 2PHLA 2Y8KA 4MX3A 5FY5A 4DXZA 5FP4A 3ZN6A 1VAVA 1YJLA 2PAKA 1W2OA 2VD7A 2VCMA 1XU2A 1QXPA 2VZRA 3NV2A 4IEUA 3FLTA 4MV2A 4RR3A 3WX5A 5IVFA 1EUUA 4QQOA 5BNOB 3I4IA 3ORJA 2VE1A 3AX4A 4AHZA 3O1PA 3VZKA 1H2MA 4RN5A 1FYUA 2JE7A 3FLRA 5DXDA 1NQDA 5A33B 5DDJ3 5CFDA 2YY1A 1MZ6A 2A5ZA 4GAZA 4AZZA 4GWJA 5D8AB 4URAA 2HEVF 4AFAA 2GC2A 1LOBA 5CVRA 5L73A 4JC1A 3N35A 4GWMA 5H9SA 3GZEA 4G3YC 4WM8A 4B29A 4BQYA 4X8NA 3MHZA 4YVWB 2DU1A 3U07A 1DLCA 2WFF3 2WIIB 2A6ZA 2Y0OA 3RZZA 3VBFA 3WLUA 3POIA 5C8WA 4S2FA 3PMEA 1O5LA 1X82A 4YYOA 1S0FA 3VBOA 2XONA 3D0JA 4NUBA 4NIHA 1AYM1 1FNZA 4J1WA 1TME3 2EAKA 3E6BA 3NNJA 1AYM2 2VCAA 1QDCA 1UPSA 1RUC2 5FY9A 4R4ZA 1XE7A 3OGVA 5LWBA 1GNYA 3BPSA 3T2PA 2AENA 5IVVA 2F6BA 4CCEA 1OVSA 3EHKA 5B2GB 1C28A 1YRZA 2D6PA 4IW3A 1W6MB 3GJBA 5CA6A 1OBNA 3UT0A 2BEOA 2VZSA 3UJQA 3I49A 3POSA 3E1F1 4JQTA 3T1MA 1JOJA 4V2WA 3PTRB 1AXZA 4AAXA 3RPQA 3ZYJB 1KJLA 4SBVA 4E2SA 3KCXA 5IK7A 1W9WA 1QOTA 2WZR3 3MFCA 1H1AA 3INAA 4SLIA 1IOAA 2OIIA 4MGQA 4RYDA 4BCUA 1DZTA 2XKPA 3FZ3A 2VQTA 1BCXA 1YEWA 4QMAA 1D2QA 1L7QA 1CVNA 1OQEA 3ETPA 5H9PA 1J84A 1Q56A 1R093 1RC6A 2VNGA 3T09A 2BDRA 2QTWB 4OHXA 1UU6A 4RGGA 4EJRA 1Z0HA 4J25A 3TEYA 3BKZA 1MS4A 4A4AA 2VZ3A 4Z8BA 4QM9A 3SQOA 1YFYA 1WMDA 3DYOA 3PL0A 1R1ZA 3FL7A 2BNMA 2R49A 1WW5A 2RR12 3ASIA 3HVDA 4LBQB 4BLIA 1GWKA 4DNYA 1D2SA 2Y38A 2WYSA 2VMFA 5A3LA 3BIWE 5KXCA 3KB5A 1KS5A 5C70A 4RS5A 1JZ5A 3N7KA 1PO12 3HNYM 1GWLA 3CJXA 1PO23 2X5IC 2JX9A 4L2NA 5KWRA 4XQWA 1O3QA 1HIXA 4CUBA 1P8JA 1US2A 4XYXA 4DPNA 3OPZA 1UW8A 1SFYA 5KXDA 2WDBA 3WW2A 3L2HA 4TSVA 2JG9B 4MGIE 4CDXB 3JQXA 5FLHA 2VMHA 4EV0A 4FTSA 2DVFA 2CHHA 2ETEA 4L0PA 2XH6A 5FWJA 3LA2A 5LRRA 3W5MA 2FDKA 3FUOA 3FN9A 1FV3A 1LU1A 2ES3A 4IEPA 1UX6A 1EPZA 2XBO3 2UWBA 4YW5A 1F8VA 1AXYA 3GBFA 4RGAA 3L2YA 5F3EA 4RL7A 4Z07A 3KM5A 5HCHA 1OOPC 1V0AA 5FP8A 5IT6A 3I3QA 3RJRA 5CFDB 1ZREA 1CIYA 1ZZ9A 2FD8A 2JDKA 3NVCA 1K12A 2WO1A 5FZLA 3QH6A 3H3LA 2JG8C 1I5PA 2XUEA 3AK0A 4DUVA 4M4PA 1AJOA 5GZDA 3U78A 5F9TA 2WJSA 1MQTA 5J3UA 1CPNA 1JH5A 2GH2A 3AXEA 2VOVA 3FFQA 3H3ZA 1K3IA 2VZUA 4QPIC 4XW3A 1RMU1 5F3GA 4Y22A 4UFJA 3VBFB 4JX0A 1GZ9A 4IV1C 1RMU2 1F4HA 4H2AA 4EN0A 3QH7A 4K9SA 3A22A 1ND3B 2W5FA 4JRLA 3OOXA 3O0WA 2JICA 5EXOA 3ZPYA 4D6QA 5HXMA 4N7UA 4Q8LA 3F2ZA 4C1XA 1ZRRA 4XDQA 3KMHA 5DAPA 4KG0A 5T5PA 5J37A 4BZ4A 3PIJA 2R7EB 1HLCA 2XOMA 1W6PA 2KR2A 3WF0A 1Y3TA 3O0VA 3IDAA 5C3PA 5T5LA 2BBAA 1UKRA 5F3CA 1NZCA 4YZ1A 4KQ7A 1H6YA 3KVBA 5DG1A 2NMNA 5CISA 4P9XA 3ZPOA 1F15A 1JZ7A 2VQ0A 2VULA 1PMHX 3VZOA 5F3IA 1HRV1 4S2GA 4LNVA 3NW4A 1J3RA 5CNAA 2W0XA 3S57A 1HRV2 3MIEA 5H9QA 1X8EA 3KCCA 1RHI1 1ZZCA 4INDA 3URFA 5FXZA 4BISA 4YM3A 4JTOA 1S0GA 1RHI2 4UFMA 3LA3A 5FPVA 4WV8A 2A71A 1XNDA 2AZ5A 3ZXLA 3VD4A 2RDNA 5FBZA 4BM8A 1HB2A 2R30A 2W1UA 2NP0A 1QMJA 2ZACA 1XQNA 4MVTA 5FZEA 1O6UA 3HJRA 4E4DX 5C9AA 3TBDA 1RUF3 2PXJA 3AMNA 5FREA 2A3WA 4IEXA 3D82A 2CDPA 3ZOIA 2XHKA 2R1BA 3JD73 1UOBA 4NHMA 5JOWA 1PVC1 1UYPA 2PAEA 4S2HA 3ACGA 1WW6A 2TNFA 1H4GA 2ZZJA 4ARYA 1PVC2 2VUAA 4AI8A 4LUMA 2RS52 3GGLA 1W6NB 1PGW2 4IQPA 1CX4A 3DPRA 3DGTA 3OGJA 3NJYA 4RS5B 4PQQA 1DDLA 2Z79A 5BNOC 1LECA 2B39A 1ZZ8A 1D0GA 1UMIA 3ZKUA 4BQ2A 5I0SA 2L9LA 2OPKA 2D6KA 1Q3EA 2ZGKA 3RI9A 5LCWL 3FLPA 3PUQA 5J98B 3KV5A 3POYA 1GZTA 4HLTA 1US3A 4EE2A 1UMHA 1AYN3 1YQ2A 1YHFA 2C6SA 4WM7A 1CPMA 5D8AC 5EQUA 4BOWA 5IAXA 3X29B 2YGLA 4P5YA 4NWWA 4QQLA 4YW6A 5A7PA 4LA3A 4N90A 3I2GA 4FPEA 3DL3A 4PIZA 5LY1A 1UY0A 3S5AA 2ARAA 4CSWA 3PUSA 2DFCA 4LHKA 4YVWC 1ZA4A 5GLUA 3USSA 3T2TA 3WD5A 3LGRA 4LT5A 1FMD1 1TG7A 5ANQA 4JDOA 3KT1A 3M4FA 2OVUA 1FMD2 2DTYA 4LORA 5T54A 1EYBA 1OH3A 4CYDA 3WUCA 3C7FA 4QKNA 2J1UA 2ATFA 1H6XA 2VBBA 1LB2A 2G9GA 4UXAA 5A6XA 2DUPA 1MQTB 2BFUL 5A7OA 3ZXKA 1S0EA 2RR13 5AFBA 4I0WB 4NPRA 1J1LA 4UFIA 1VMJA 1LOGA 2PFWA 2EIGA 5GALA 4Y22B 5JSPA 2JDZA 2P4EA 5DUUA 5GZFA 2DCZA 1PO13 3B01A 2Z5WA 3MIGA 5FK7A 1CGPA 1G9AA 3PUAA 5GZEA 3T2QA 4QHOA 1SDDB 3MYXA 1AR61 2ZEZA 4A41A 3RJ2X 1PNGA 4ASMB 1WZXA 2XJTA 3LZZA 3WNXA 1OXCA 1TZOA 1W6PB 4K21A 4NROA 2EXKA 1GWMA 4QU1A 1U5YA 1IPJA 4COWA 1UWWA 1DYPA 5F6LB 3I2KA 2H6BA 1RUI3 2D93A 3K4AA 1G9CA 2DURA 2VMIA 4NWVA 4YNIA 5A1FA 5IYYA 3VKOA 1GV9A 3MGUA 1BMV2 1Z7S3 1UN1A 2VXJA 3ZFGB 2GN7A 2W92A 1AXKA 1H8TA 1HXS3 1UZYA 1VR3A 2JKXA 1KEXA 3AYEA 2Y60A 1OFNA 2DBNA 2RM23 2YU1A 3D3AA 3KS7A 1Y7BA 2HWD1 4JRAA 4LHLA 4CXWA 4IXLA 1ZRDA 2B4KA 1WWYA 2VMCA 2AGSA 2HWD2 2Y6LA 1UKGA 5FQ0B 3VZMA 3W59A 4COZA 5C33A 5GLWA 1V6KA 1AUYA 1QJZA 5LA1A 4XFBA 4JKLA 5FAXA 5FIXA 4CCLA 3THPA 1DU3D 5EJ3A 3WVJA 2UY8A 3GZUC 1C8M1 5C9AB 1QJX1 3LIGA 4XDPA 5EHDA 5F32A 1C8M2 2YGMA 1QJX2 3ZSEA 2JD4A 4Q4Y1 5H9RA 4F8AA 3ZXFA 4CDXC 1YLLA 4Q4Y2 5KHKA 2ENRA 3OCPA 3LA7A 1O8SA 2O14A 1ULEA 2Y0IA 4F83A 1LGNA 3WNKA 3DPRB 1UY1A 2JDNA 1UZWA 3W20A 4IE5A 2WZPP 1HB4A 2CWMA 4Z1VA 3WCSA 3QACA 2JECA 4YPJA 1EPWA 4RHV3 5FY7A 1J58A 1AR81 3WQ1A 1VMHA 1HJFA 3GF6A 5CFDC 2DCYA 4M01A 1W2TA 3PIGA 4XJ8A 1AR82 4WM7B 1ZRCA 4UW3A 2PHUA 1CZTA 3ZXEA 1H9WA 3K3OA 3VDCA 4L9BA 1FT9A 3ZKYA 2UWAA 4EROA 5AVAA 5JMCA 3AMQA 3D5OA 2F4PA 1FOD1 3VBFC 4CCCA 1GICA 4NHLA 4YGCA 1FOD2 1RUG3 4E2GA 1RVF1 1GZCA 1ND3C 1E5IA 5E6HA 2PLV3 3WV6A 1RVF2 4HXCA 4CA9A 1FNYA 3V0AB 2ZZQA 2KD7A 2G1MA 3HQXA 1UAIA 4WVZA 1DQ1A 1GOFA 1ZBA3 2WAAA 4QPGC 5D1IA 5F2WA 3LF7A 5FMOS 2MNGA 5BY5A 1COV3 4QKBA 4XFIA 4CP1A 3ZSLA 1IPSA 1VJ2A 4IDZA 4PJYA 3NKGA 3POWA 1ODMA 3JQWA 2W68A 5T5OA 3H0OA 1SQ4A 4FPFA 2EIDA 3AXDA 1W8FA 5FP3A 5K8SA 4JV4A 1LHVA 2WO3A 1EUTA 2RDRA 4ET7A 4Q5OA 3O1UA 3RFRA 4O65A 4WBBA 4M3CE 4NOTA 3RZGA 4IUGA 1BJQA 3ZYPA 4FBFA 4Q1RA 3WINE 2AEYA 4KH9A 5A70A 1R083 5AVPA 1EV13 5K0UC 4AVAA 4R52A 2QQJA 5DAQA 2FHRA 2EF6A 3PUIA 5K7PA 1YQCA 2GC3A 3J8F1 4TTGA 4XTMA 3AZZA 5JLVA 3J8F2 2RS11 1WA6X 3M70A 1YQ8A 3SNMA 1WCSA 1H8TB 3CMGA 2RS12 2VZPA 5FYSA 3VDAA 2P17A 4XETA 1RJ8A 1N1SA 3W21A 1NE4A 2JG8A 3EB7A 1N1VA 2D3RA 2VJXA 2R0HA 3B9IA 2ZABA 3WP6A 4QM8A 4YZ5A 5GZGA 4MOAA 5I0DA 4CXYA 4RS5C 2BBVA 4D8MA 4A7YA 5DUXA 2RVAA 4QPIA 4FO9A 2E32A 4LK7A 4PI0A 4UWDA 3ACFA 1VAMA 3IWZA 4FQZA 4GMP0 3T1LA 4FTBA 3PNAA 2ZMLA 2YXSA 4B4RA 1JYCA 1SBEA 2ZS6B 2V4VA 1QH7A 5GKAC 4KL1A 4BDVB 4CU8A 1IG0A 5F7UA 4A3XA 3EQEA 2LROA 4UYBA 1OT5A 1OQ1A 4MGTA 4I0BA 2D98A 5JXIA 3I2FA 4HPKA 3BOWA 4HKLA 4GH4B 3ETQA 5JSOA 4OVEA 2EICA 1VRH1 2WABA 4QHBA 4WVWA 5L36A 5FXXA 1NLSA 1XU1A 4XZUG 1VRH2 2ZGUA 5IVJA 2ET7A 2GALA 4EWDA 4LBKA 1D0HA 1EAH2 2KA3A 4DFSA 2P1BA 4LLOA 4IE4A 2WA4A 2IZWA 5FK8A 2AR6A 5FZ1A 4BYYA 1HV0A 2HWC3 4Y24A 4AYUA 5DAVA 5KHJA 1F9KA 2PN5A 4EYUA 1CQ9A 3MIFA 2W95A 4QKDA 5F5AA 4LEJA 2UURA 4LE4A 3BPZA 3LD8A 1LEDA 4CCNA 3ILRA 1QHDA 1ULGA 4FOVA 3MV01 5BV6A 1W8UA 4LE3A 1OA4A 3LEKA 4Y20A 2ZCWA 5G04L 1IQDC 1RUH3 2PHXA 2FBEA 4YLZA 2R043 1LGCA 2IXLA 1NUKA 2ZJCA 4P9LA 3QCWA 1RXFA 1YFXA 5C7GA 4N7IA 3H42B 4FT8A 1UOGA 2GNBA 5DZGA 5HCBA 5IK5A 5E16A 3RZLA 4WZFA 2W1SA 5ISLA 1AX0A 2WSVA 5FP7A 3BTYA 4QX3A 1RGSA 2Q0AA 3OUIA 5APAA 1SCRA 2ORZA 2BWCA 4DUXA 3AJZA 5JR2A 4NPLA 3LAGA 2JB4A 4BU2A 3ZN5A 4DRRA 1O3TA 1GP6A 1RTVA 1VE0A 2GZWA 3SH4A 2X29A 1N3OA 4R8HA 5TSWA 3WHTA 4N8MA 3ZFGC 1VBB1 1CESA 2D3SA 1DBNA 1UY3A 1NE6A 4LO8A 1VBB2 2WBKA 3U0ZA 4PCRA 5K9YA 1W3XA 3N4MA 1F5JA 5ACA1 3OBRA 4QXKA 1H2KA 1LTEA 1PIV3 2WYFA 3J7HA 3MPBA 4BMBA 5ACA2 2JXAA 4R9DA 2J22A 4Y1XA 2IXCA 3WF3A 2QQMA 4E4SA 3JBG1 3AZVA 3AMMA 4CP9A 3JBG2 2QQPA 2B8MA 3PTYA 4Q4V1 2EVXA 5IK4A 4Q4V2 1XB9A 3ACLA 3HT2A 3IAPA 3T0BA 4HKOA 2GH8A 2JG8B 2JDPA 4XACA 4B3NA 4OI2A 1W3VA 2XJRA 3CF6E 4GMP3 3DPRC 2OQ6A 5JMOA 1BVVA 1QNWA 2A70A 5DG2A 3ZFFA 5JI9A 1GKBA 2VXRA 1LEMA 1AR72 1S0BA 1S55A 4IV3C 1L7RA 5SV5A 3I2IA 4I3PA 2BVVA 2JE8A 3LEMA 2P3KA 4V2VA 3RVHA 1H8VA 2VUCA 4ZZ8A 5GLVA 4I09A 2YROA 4K20A 4I30A 1MS3A 3GJAA 3C2UA 3MW4A 2Y6GA 1POV1 4QWNA 1U0AA 1TVGA 1OLMA 1T6BX 4KBBA 4Y4RA 1T6GC 3C7GA 4AAPA 1NXD1 1N1TA 3BALA 5FPLA 5A3TA 1AF9A 1JOPA 5FLIA 2VGDA 2YBSA 1OD5A 4DO0A 3TRSB 4HPKB 5CU1A 5L7OA 4Q4W3 3CL1A 5DQ0A 4XFCA 3UGGA 3LDKA 4LHSA 5CB7A 1JYXA 2YFZA 1QJU3 4S2DA 3KT4A 1AL0G 3KGZA 5FUIA 1WCUA 3ENRA 3H50A 5GLTA 2K0GA 2VU9A 1ULOA 1NLRA 3OBZA 3AC0A 2R073 3ZSJA 3VKFC 2VBPA 4LBQA 5C3RA 4ES8A 4ATFA 2IFRA 2C1FA 2OXBA 1CONA 4D7SA 4Y5TA 3MLKA 4XEZA 3AMHA 4QX0A 4NRQA 1JS9A 4HSJA 3WNNA 4HOOA 4AFMA 1TMF2 2GNMA 3HN3A 2HEWF 1EY2A 1I9RA 3N7JA 4GWIA 4Y20B 1M4WA 4QAWA 4YWAA 5I8TA 1QGLA 1VMFA 4AOCA 2V72A 5AC93 3ECQA 1W6QA 3QOPA 1IS3A 1ULFA 2O8OA 1QH6A 4HN1A 1O7FA 1U5ZA 2P2KA 2VCCA 3TNQA 2NM1A 3ALQA 4Q4X2 5D21A 5I91A 1WA4A 1CAVB 4IERA 2IVIB 2Y33A 4DS0A 2B42B 4XZPA 4BHPA 3VLBB 4QXBA 2VO5A 2I2SA 1GZWA 3EBRA 4DUWA 1LR5A 3H8XA 1I5ZA 4BK4A 2WS91 2NQYA 3ON7A 5F5QA 4W4ZA 4COVA 1UYXA 5DZEA 1H8TC 1BBT1 2WS92 2YBKA 3E97A 1EAH3 1VBC1 2HWF1 4RFT0 4V1PA 5EPAA 1BBT2 2D97A 4LOTA 4OMCA 1VBC2 2HWF2 3S0MA 1OKOA 1AR93 3NRUA 3G7DA 1QNYA 2VNRA 1Q8VA 4CP0A 1A8MA 3HN1A 3S30A 5A7WA 3RSJA 2VZTA 3H1WA 1JXNA 3C8XA 1IGOA 1J3QA 1UU5A 2RMU1 2XR4A 4AI2A 3E6CC 1RUJ1 1JZ2A 4CP9B 1ND3A 2RMU2 2VBDA 3RZHA 1RUJ2 3FE5A 5M0TA 4XJZA 5FYCA 4AEDA 2WRAA 1BZWA 3C3VA 4AI9A 5DUWA 3OY8B 3OUJA 4K3UA 2IC1A 4AVCA 1NAEA 2D7FA 1FI2A 3H8UA 4GA9A 4KWLA 4PLMA 1YYNA 4QPGA 1J3PA 3AYAA 3O0XA 3KD4A 2CYFA 3T08A 3UL2A 2MPFA 4GH4C 3ZFFB 3OPTA 2LM3A 4XC9A 1RUF1 4UW5A 4RQPC 1I1EA 1MS9A 4MO3M 4KU7A 4YGEA 2ZX1A 4XUNA 3VL9A 4GWNA 5E1RA 1RUE3 1NCQA 2CTVA 4LBMA 4URTA 3GZAA 4F7ZA 1DP0A 3H7JA 4AHYA 1JYIA 2XQXA 4LA2A 3WY6A 3PVOA 3S6PA 1HJGA 1MVEA 2PAMA 3T3YA 4NHXA 3ITQA 5CKMA 3IKWA 3T30A 4IEZA 1BVP1 2JD9A 4DZGA 3SC7X 1WBLA 3OYWA 2DYCA 2I07B 1KFUL 2QJVA 1VBA1 2RG4A 2RS31 4QX5A 4NRPA 4XAEA 5HXVA 3MLLA 4AWDA 2RJ2A 1VBA2 1IS6A 2RS32 4XIKA 5C4WB 5L7OB 2K2SA 5JI7A 1HB1A 2BPA2 4Y26A 3A21A 5FRAA 3R0RA 2Y34A 5K0UA 1D4M1 1NXMA 4NVPA 2ZHLA 2B5HA 1RINA 3VBHA 4AVSA 4Z2WA 4AVVA 1H2NA 2V09A 4QPYA 4ZU4A 4RSUA 5JSRA 3GZTB 3UJOA 4W6WA 4DEQA 5E8AA 1FPN3 1VBD3 2AUYA 4YZ4A 4WZCA 3WW1A 1VIWB 5JXHA 2HWE3 5FUPA 4IGOA 1W6NA 1JN2P 5EWSA 2QQIA 4AF9A 1N3PA 1V9U1 3H1MA 2DVBA 5LBCA 2WQZC 1V9U2 2HYKA 1TEIA 3VN4A 2P6CA 2PHFA 2QQKA 1PX4A 1SCSA 3SISA 1W6QB 4QGNA 5FCCA 1BQPA 4Q0QA 2ID4A 4ARXA 3UNPA 4GD4A 5E88A 3S7IA 1TQ5A 1OPMA 5J7MA 1CAUA 1H1MA 4XFFA 1YCIA 3ME2A 2IVJA 5FY8A 3K75B 4JDNA 1R1A1 1HN1A 2W91A 5T55A 2W47A 1J1TA 4JGZB 4JGYA 1R1A2 3AM2A 2GSYA 2QVSB 3I3DA 1C57A 3RS6A 1OSGA 3KVAA 4LOSA 5GJ6A 1GZWB 5JPMB 1VLNA 1O59A 4DOUA 4YFZA 2WNOA 4GB31 2V4AA 1W04A 2ZGTA 3AMPA 4NO4A 2Z42A 4GB32 4TLFA 4W50A 1WKYA 3R4UA 4HK8A 4K1ZA 5L9VA 4KU8A 1O91A 4MG2A 2QBXA 1ULPA 4K8FA 1S0IA 2FCTA 3PDQA 4WVVA 2N7GA 4JHZA 2EALA 2OKXA 4D7YA 2VNOA 2VAUA 2XG3A 4MGKE 5IK8A 2IXHA 1DZQA 4PHZA 1ZBE1 3D6EA 5KHHA 5A7WB 2HBUA 2XJUA 3AZWA 4LULA 4B4QA 3NO8A 1ZBE2 3WNPA 2GU9A 2PQSA 2EA7A 1DGRN 2JIJA 3Q8BA 1BLZA 3PUHA 3P3NA 4LKFA 1Z7S1 4X6RB 5EZWA 2QKDA 3HAGA 5LBFA 3ZXJA 4EWAA 1HXS1 3IDCB 1WUVA 1OI6A 4AEDB 3IT8A 1Y9MA 2WNEA 1BYHA 2MEV3 1G9DA 1ZM1A 1W8OA 4QPGB 4YGDA 3M3OA 1K42A 2JDUA 4CCKA 1QOSA 1VBE1 2J1RA 4OHZA 4Q4X3 1REEA 3GXUA 4OHVA 1WLWA 1VBE2 1XPWA 3BUCA 2XDVA 4FQ4A 3I2HA 1OQDA 1WLTA 1YQ6A 1NCQB 1SLTA 2VM9A 1W2UA 1XNCA 4PBOA 4A45A 4ASKA 3U11A 1VALA 1GOHA 2C0ZA 2LW8A 5F37A 1GBGA 3ZFGA 2HJIA 2YV8A 4Y33A 1VB2A 3O1OA 1DGWA 1V00A 2HWB1 3IB3A 3HNMA 3OF1A 1Y43B 3OYWB 1NYWA 2HWB2 4YFWA 3RWNA 5FQ0A 1XNBA 4YVSC 3NKTA 3N3HA 5FR3A 5I0TA 3I8TA 4FPYA 1BEV1 2UU8A 4RHV1 4AQSA 1F31A 3AL6A 3R4DB 5K0UB 4Y5SA 1BEV2 4FXGB 4GKXA 4QX7A 1JI6A 3VBHB 5D2AA 3AYDA 1Q8QA 3SH5A 4XCBA 4OULA 3M1HA 1XXNA 1C3HA 4ZU7A 4P9YA 2BOIA 1UF2C 2DVDA 1HRI1 1JUIA 4FCAA 4YM1A 5B4XA 4MHRA 3SCFA 4A42A 1AYM3 4XQ4A 3AP4A 1HRI2 2XJVA 1V6IA 1RUC3 2Y6FA 4BQ4A 4LIUA 2BFUS 3RZKA 2B9UA 5A6YA 4IV3A 5KXBA 2DVGA 5DN2A 5ERLA 3ZDVA 1FAYA 4U2AA 2V73A 5DPNA 2WWJA 2P6HA 5BNNA 2FMYA 1JZ6A 3PVEA 3VBRA 4E4HA 5LEJA 4K40A 2JWPA 5C5UA 2ZGLA 5FYZA 4FAHA 1V6MA 4YW4A 1RXGA 1CAUB 4BLJA 2ARCA 4PBPA 1SACA 4PI2A 2NPIA 1W90A 2VZ1A 4LHNA 4JGYB 3NV1A 2X8KA 2YZ4A 3U14A 3DN7A 4K6BA 5JXGA 4JQRA 3VZLA 3I2JA 4LO5B 4H7MA 4Q0PA 4CEYC 4YG6A 4GKYA 1WD4A 1XYOA 1LULA 4FOQA 3V0AA 2CGPA 1WMXA 1G9FA 3AZYA 3LDBA 1X50A 4IEOA 2RV9A 4JVAA 1N3QA 4QT6A 4QXHA 3FX3A 4C91A 4ITCA 1SLCA 1GNZA 1FX5A 3KQRA 3ZFFC 1WMFA 2AC1A 4PIYA 2XMLA 3OSDA 4FPLA 1A6CA 1PNFA 3ZLIA 4XJUA 3ACIA 1W2NA 2JEMA 3IN9A 5FJHA 4P5HA 3ZFEB 1CAWB 5F1RA 5C3SA 3U4SA 3VKNA 4Y1UA 5FMDA 4H55A 5F5IA 3ILNA 3HQRA 1KXGA 1NY71 4D3WA 4P9JA 1F2NA 2CY6A 1NY72 4C90A 3E6DA 3RZMA 4L8QA 1AR62 2CU5A 4PF1A 2Q8EA 3MIHA 4KGGA 2HYXA 2ZGNA 4XFGA 2ZKNA 2QFEA 3VZJA 4E27A 3WEZA 5C4WC 3V0BA 5L7OC 4AGVA 1POQA 1W2AX 3R4SA 4NR1A 3BOPA 4RA0A 3AJYA 1G7YA 3WW3A 4A7ZA 1ZA7A 3ZYBA 3VHPA 1W9YA 4XF9A 1LHUA 3NWKA 3RMYA 1REFA 2WAOA 3IPVA 1U5IA 3MF9A 4P08A 5DAWA 3WCRA 4FAGA 5DMYA 3BIEA 1DYOA 2XLFA 2Q8OA 4AFCA 2YC4A 1AX2A 1T2XA 3D0SA 2WLQA 1UXZA 5L9BA 1IZ3A 4JTNA 4AEMA 1MPXA 4AK3A 1HB3A 3AFKA 4I0AA 3WG2A 2WT2A 2JENA 1PK6A 3AZXA 1LOCA 4IE6A 3VUOA 1QJY1 2EIBA 1ONAA 1RMU3 1V6LA 3JCIA 1XE8A 3CEWA 1QJY2 1SLIA 2R1DA 3D4KA 3MI8A 3OD0A 1NCRA 3RRDA 5FBJA 5A6ZA 1F5FA 2RDSA 2J1SA 3ZXAC 5FY4A 3O14A 3LOBA 3RWKX 2JJ6A 1ZVFA 4G4FA 5E89A 4JGZC 1NX9A 1DCSA 1JW6A 1XYNA 2FMDA 3CO2A 3FBYA 4OFGA 4GH4A 1JOBA 2D6LX 4LLFA 1MS8A 4CU6A 5J09A 4KG8A 4M00A 4IV3B 1KS4A 2PYTA 4QDQA 4RQPA 2PMWB 4Z82A 4UBGA 3I7DA 3O7OA 3WQ7A 4OHYA 4FOYA 3AVRA 3CDZB 3VBRB 1ZRFA 2XL7A 2RJLA 3AFGA 4UFHA 1HRV3 1FATA 2DV9A 5CEHA 2G4IA 4Q1PA 4UBHA 3TEZA 3GHNA 3G6JB 3GCXA 4M3CA 3THTA 4BJ0A 3N9LA 2ZXQA 1RHI3 3NAPC 2Q8CA 4E4ZA 2DDUA 1MEC1 3FMGA 1UOJA 4AR2A 1DIWA 1MEC2 4D94A 2VZOA 4LO4B 3WQ0A 1LGBA 4FFHA 4EN7B 2DVAA 3KWVA 4NAMA 4PDWA 4QU2A 1AJKA 3RDIA 4AEDC 2Q1MA 2X10A 2WSUA 4JCKA 5A32B 3OGSA 3TN91 1KDKA 3DCQA 4AI0A 4H3WA 2VOWA 4FPCA 1PIV1 2BVBA 3WP4A 3MIDA 3TN92 1AL21 4XJAA 2FDIA 3WP3A 3WF2A 1PVC3 3ZMOA 1AL22 5LASA 2RS53 4XF3A 1OHFA 1SLBA 1YFWA 4OQ9A 4PQ9A 2KXLA 2C26A 2XLGA 1RL3A 1IKPA 1NCQC 2CNAA 4QKFA 2ZEWA 3IBMA 3KV4A 2B9VA 2EXIA 2XJQA 3CJIC 3H1YA 4AFDA 1W6OA 4N43A 2LTNA 3NQHA 3WW4A 1X9TA 5IFPA 2VW1A 1TNRA 3C7HA 3PURA 4AL9A 4PT6A 3MO4A 2FZ2A 4IE7A 3LIHA 3POJA 3V0BB 1HX6A 3AKPA 3GYDA 5FPAA 1ASJ1 1JHNA 5BNPA 1W28A 2YFUA 3VHRA 1C4RA 4CDUB 5BUVA 1PZ8A 1ASJ2 2JDAA 3NV4A 4C8DA 5IWFA 3VBHC 5JWPA 2YB7A 4XAAA 1HN0A 4FPHA 5T50A 1Q8SA 3I3EA 1Q8PA 2XB6C 3IPVB 3VBUB 4EN6B 1C1FA 1PZ9A 4B7KA 3KGLA 4QX2A 1FMD3 1GQPA 2BTVC 3LPGA 3M2MA 1IHMA 1LKNA 3B69A 4D6RA 2W1WA 3MUY1 1UZ0A 2FQPA 2XKOA 3TNPB 1CWPA 1GUIA 2ZX0A 5FMBA 1O3RA 4IEYA 1W8TA 4HVRA 5FZAA 1KQRA 1MS0A 5DABA 1GQHA 1OLRA 4Q26A 4YM0A 4CVUA 4LBOA 1PK6B 1O5UA 3ACHA 3CBNA 3H7YA 2W39A 3K46A 3FBMA 5FOBB 1PMJX 4OUSA 5IW0A 3W5NA 5KXEA 2VTXJ 1UD1A 2CDOA 4LBQD 4OI1A 1UPIA 5LK7B 2WQ4A 3FFZA 3J7NA 3MDPA 4LK6A 3UESA 4E2QA 1QQP1 1NCRB 2R061 1RUD1 1QQP2 4MGZE 2R062 1A3KA 2RJKA 1RUD2 5IVCA 2GMEA 2D5FA 2GMMA 1RJ7A 4OI4A 2VPVA 4JGYC 3PLQA 4UFKA 4CPBD 2FDFA 4O61A 3LCPA 1LRHA 1Z78A 1CR7A 3A23A 4ES9A 5JOYA 3O1MA 1W8WA 4OZOA 4RQPB 4CE8A 2D6MA 4QHZA 5FZCA 2WT0A 5J96B 3N36A 2DBIA 4IEVA 1KITA 3PVBB 1GU3A 1PGL1 4CEWA 3T4VA 3WSOA 5LA0A 4M3CB 3MV11 3A0KA 4NE9A 1SHWB 1UZZA 3ZFEC 1S0DA 5BNQA 4H7LA 2W46A 3QD6A 2GP5A 2HWD3 4YVSA 3CQOA 2QE3A 3OBTA 3QBQA 2WQ8A 3K2OA 5IVYA 1QU0A 2GMPA 2G9FA 2DUQA 3I97A 4M0NA 4PDWB 5DDJ1 3KT7A 1RB8G 4X6QB 2P34A 5DDJ2 2LALA 3B94A 2DWRA 1H9PA 1C8M3 3ZX7A 2ZHKA 1QJX3 4IEQA 2YDEA 2VTXA 1LOFC 1G86A 2BWAA 3AKRA 3WDWA 2J42A 4Q4Y3 1CZVA 4LXLA 2WFF1 3WF4A 1QXJA 2VVEA 1CAVA 1OFSA 4LKDA 3UKVA 5ABJA 2WNVA 3MZHA 5FO9B 1N1YA 2WFF2 4JAAA 5A7QA 3WNMA 5BYNA 3CLPA 1C5IA 4FPOB 3WDYA 4W8JA 1TME1 2Y6JA 5KC6A 4KWJA 4ZPIA 1DQ5A 2YC0A 3GDBA 1TME2 1W6OB 4MXVA 2AREA 4L99A 2DTWA 4N43B 2BRTA 2XXZA 2WZ8A 2D40A 1AR83 3KHBA 4LO7A 1X36A 2YU2A 1W9FA 3MW2A 3J26N 4DMIA 2H0VA 4LJHA 1F4AA 4XBQA 4Q2FA 5BNPB 2ZX2A 4QGLA 2QZ3A 3HNBM 2BV4A 1QXRA 3IMNA 3VDBA 3WG4A 1FOD3 4CEYA 4AXOA 1JUHA 2WFPA 2WZR1 1SEFA 2H6CA 2UYBA 2XWJB 4BPZA 1RVF3 5KHGA 1J59A 1SPPA 1JZ4A 2WZR2 2DCJA 3AB0A 3OY8A 3RYPA 4JKKA 1NT0A 1U5XA 4OCTA 4GALA
chains in the Genus database with same CATH topology
2L9LA 5LCWL 2J1TA 3A21A 4DXSA 2VOTA 1US3A 1W9SA 1UMHA 1YQ2A 3THDA 4ZXEA 4P5YA 1XC6A 3I2GA 3SKVA 1UY0A 4DEQA 1W99A 4QB1A 5JXHA 2QQIA 1TG7A 4JKMA 1JYNA 3FHAA 3C7FA 2J1UA 1JZ8A 1H6XA 2QQKA 3LEIA 1PX4A 4KMQA 4MGSA 4ARXA 2ID4A 3UNPA 2E33A 2W94A 3EYPA 3OBAA 1W0NA 3IIIA 3K75B 4A44A 1R64A 1HN1A 2J1EA 2W91A 2W47A 4CUCA 2J1VA 3I3DA 3T2QA 1O59A 1SDDB 3VD5A 2VMDA 2ZEZA 2ZEXA 4A41A 4DXRA 3WNLA 4CU9A 4QB2A 4W50A 1WKYA 5LA2A 2QBXA 1ULPA 3CZUA 5EJ1B 4XURA 3SEEA 5JUVA 4JHZA 1OH4A 2OKXA 1UWWA 4ZZ5A 5C71A 3I2KA 5HPOA 3K4AA 1UXXX 3DYPA 3WNPA 5IYYA 1UX7A 2PQSA 3JXSA 3PUHA 1UYYA 3VD3A 1W8NA 3OEBA 2W92A 4QDRA 2JKXA 1SG3A 1KEXA 3D3AA 4TXWA 4UI9L 2E26A 2B4KA 2VMCA 2Y6LA 1W8OA 3SEPA 1NKGA 5LA1A 3P6BA 4LQRA 1K42A 4JKLA 3VD7A 2J1RA 3GXUA 1XPWA 2QQOA 3LQCA 2X05A 2HLEA 3I2HA 3BGAA 2VM9A 1O8SA 4A45A 1GOHA 3BN6A 4CU7A 2LW8A 4M4RA 2LS6A 1W9TA 3WNKA 2WZEA 3IB3A 1UY1A 3HNMA 3LE0A 3ZM8A 1XNTA 5IJRA 3OEAA 4YPJA 4HG6B 4QPWA 1O8PA 1JI6A 1GOGA 1CZTA 4BXSV 2YC2A 3VDCA 3WF1A 5A1AA 5B4XA 4A42A 2XHNA 1LNSA 1JU4A 2J1AA 4KI5M 3OGRA 4XUQA 2KD7A 5DN2A 1GOFA 5DPNA 2WAAA 3C7OA 1JZ6A 2V5DA 1PX3A 2W1QA 3WQBA 2VZ1A 4AG4A 2EIDA 2WN3A 5JXGA 3I2JA 5CZKA 2WO3A 1EUTA 4ET7A 4DXTA 4E8DA 3OB8A 2RV9A 4IUGA 2BERA 4XVHA 1UYZA 2C4XA 4DEVA 3C7EA 2ORXA 3MUZ1 2QQJA 3ACIA 3PUIA 1J83A 2DCKA 2QQLA 4LPLA 2C9KA 4TTGA 4XUTA 4KWUA 3CMGA 4QX1A 3VDAA 2VZPA 3FHQA 2VC9A 5IHRA 3A7QA 3EB7A 2VJXA 2Y6HA 3CKHA 5I0DA 4MOAA 2VMEA 2W3JA 4D8MA 4PF1A 2RVAA 2HYXA 2E32A 2VQUA 3ACFA 2WN2A 2WUHA 3WEZA 3DYMA 2V4VA 3LEGA 2Y64A 5B4NA 4P00B 4BDVB 1KGYA 4CU8A 2WAOA 4P08A 5F7UA 2VZQA 2VL4A 5DMYA 3VD9A 1DYOA 4BK5A 3T0DA 2YC4A 1OT5A 3ABZA 1D7PM 1T2XA 5JXIA 3I2FA 1UXZA 3K77A 2EICA 1MPXA 2WABA 1OD3A 4FI9A 4XZUG 5EJZB 1JU3A 3T0AA 2EIBA 2Y8KA 3THCA 2VZRA 2J1SA 2W87A 1EUUA 2W95A 4RN5A 1NX9A 3MV01 4OUEA 3LEKA 4CU6A 1JHJA 3P1IA 4LKSA 1IQDC 5G04L 4GWJA 3CZJA 4QDQA 5IFTA 1NUKA 5C7GA 3CDZB 3NJXA 2W1SA 1DLCA 4QX3A 3MBWA 4BJ0A 2ZXQA 4DUXA 2ORZA 3NNGA 5JR2A 2VR4A 2DDUA 2VZOA 2VCAA 3NJVA 1UY3A 3OGVA 3OG2A 2WBKA 1GNYA 2X10A 3T2PA 3IAQA 2E31A 3OGSA 1RYYA 4P02B 3J7HA 2VZSA 2EIEA 3E1F1 4D0QA 1BHGA 2J22A 3WF2A 3WF3A 2QQMA 4AAXA 1JYVA 3T0BA 4MADA 1JYWA 2YG0A 2C26A 1W9WA 3K4DA 4CUAA 1GMMA 2ZEWA 2B9VA 4MGQA 3IAPA 4RYDA 4ZY9A 3HEIA 2VQTA 1UY2A 1L7QA 3NQHA 5IFPA 3ETPA 3C7HA 3I3BA 5JMOA 1J84A 3UETA 4PT6A 3T09A 3MO4A 1JZ3A 1L7RA 3I2IA 2QQNA 4A4AA 2VZ3A 2JE8A 2YFUA 3DYOA 4ZZ8A 2JDAA 4XUOA 3FL7A 2YB7A 2Y6GA 3I3EA 1TVGA 2WYSA 2VMFA 2J7MA 4UOJA 4QX2A 3C7GA 5C70A 1GQPA 1JZ5A 3LPGA 5JXJA 3HNYM 2W1WA 3MUY1 1UZ0A 4CUBA 1P8JA 5DQ0A 3T2OA 1US2A 1GUIA 4LHSA 4UAPA 2WDBA 1JYXA 2W9XA 2YFZA 4CVUA 1UY4A 3ACHA 3K46A 1ULOA 1PMJX 3W5NA 3AC0A 3DECA 2CDOA 3GM8A 3UESA 4L0PA 5J1XA 3W5MA 3FN9A 1XNAA 4QX0A 3WNNA 3HN3A 2ZEYA 2VTFA 1CIYA 4GWIA 1K12A 4QAWA 2WO1A 3A23A 4A3ZA 4DUVA 1I5PA 4OZOA 2V72A 4M4PA 3ECQA 2VCBA 2VCCA 4E8CA 4OMDA 1K3IA 2VZUA 1GU3A 2Y6KA 3WSOA 5LA0A 4JX0A 1F4HA 3MV11 3A22A 2W5FA 1SHWB 1CX1A 3LPFA 2X09A 5HXMA 2VO5A 2BGPA 3F2ZA 3HOBA 2W46A 4DUWA 3CQOA 2WQ8A 4BK4A 4W4ZA 3I97A 4A6OA 1UYXA 2R7EB 2XOMA 3WF0A 4GZ9A 1OF4A 3IDAA 4OMCA 2BBAA 3NRUA 3U37A 1K45A 4Z2AA 1H6YA 5CYYA 1JZ7A 1CZVA 2VZTA 1PMHX 5G05L 2WO2A 3C8XA 3WF4A 1JZ2A 3WNMA 2Z4FA 4W8JA 3VD4A 2Y6JA 2VZVA 3GDBA 2BGOA 1NAEA 5FUIA 2W1UA 2WZ8A 3T08A 4XUPA 4QB6A 3HJRA 1CZSA 4OYUA 4MO3M 1F4AA 1OF3A 4XUNA 2CDPA 3HPNA 3HNBM 1DP0A 3CIHA 2XQXA 3ACGA 4ARYA 3VDBA 3SKJE 3GGLA 3WNOA 4QDSA 2JD9A 1JZ4A 2BZDA 4PQQA 2DCJA 1WCQA 4JKKA 5EIYB 2XONA 3K4ZA 2RJ2A 1UMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9L A;  5LCW L;  2J1T A;  3A21 A;  4DXS A;  2VOT A;  1US3 A;  1W9S A;  1UMH A;  1YQ2 A;  3THD A;  4ZXE A;  4P5Y A;  1XC6 A;  3I2G A;  3SKV A;  1UY0 A;  4DEQ A;  1W99 A;  4QB1 A;  5JXH A;  2QQI A;  1TG7 A;  4JKM A;  1JYN A;  3FHA A;  3C7F A;  2J1U A;  1JZ8 A;  1H6X A;  2QQK A;  3LEI A;  1PX4 A;  4KMQ A;  4MGS A;  4ARX A;  2ID4 A;  3UNP A;  2E33 A;  2W94 A;  3EYP A;  3OBA A;  1W0N A;  3III A;  3K75 B;  4A44 A;  1R64 A;  1HN1 A;  2J1E A;  2W91 A;  2W47 A;  4CUC A;  2J1V A;  3I3D A;  3T2Q A;  1O59 A;  1SDD B;  3VD5 A;  2VMD A;  2ZEZ A;  2ZEX A;  4A41 A;  4DXR A;  3WNL A;  4CU9 A;  4QB2 A;  4W50 A;  1WKY A;  5LA2 A;  2QBX A;  1ULP A;  3CZU A;  5EJ1 B;  4XUR A;  3SEE A;  5JUV A;  4JHZ A;  1OH4 A;  2OKX A;  1UWW A;  4ZZ5 A;  5C71 A;  3I2K A;  5HPO A;  3K4A A;  1UXX X;  3DYP A;  3WNP A;  5IYY A;  1UX7 A;  2PQS A;  3JXS A;  3PUH A;  1UYY A;  3VD3 A;  1W8N A;  3OEB A;  2W92 A;  4QDR A;  2JKX A;  1SG3 A;  1KEX A;  3D3A A;  4TXW A;  4UI9 L;  2E26 A;  2B4K A;  2VMC A;  2Y6L A;  1W8O A;  3SEP A;  1NKG A;  5LA1 A;  3P6B A;  4LQR A;  1K42 A;  4JKL A;  3VD7 A;  2J1R A;  3GXU A;  1XPW A;  2QQO A;  3LQC A;  2X05 A;  2HLE A;  3I2H A;  3BGA A;  2VM9 A;  1O8S A;  4A45 A;  1GOH A;  3BN6 A;  4CU7 A;  2LW8 A;  4M4R A;  2LS6 A;  1W9T A;  3WNK A;  2WZE A;  3IB3 A;  1UY1 A;  3HNM A;  3LE0 A;  3ZM8 A;  1XNT A;  5IJR A;  3OEA A;  4YPJ A;  4HG6 B;  4QPW A;  1O8P A;  1JI6 A;  1GOG A;  1CZT A;  4BXS V;  2YC2 A;  3VDC A;  3WF1 A;  5A1A A;  5B4X A;  4A42 A;  2XHN A;  1LNS A;  1JU4 A;  2J1A A;  4KI5 M;  3OGR A;  4XUQ A;  2KD7 A;  5DN2 A;  1GOF A;  5DPN A;  2WAA A;  3C7O A;  1JZ6 A;  2V5D A;  1PX3 A;  2W1Q A;  3WQB A;  2VZ1 A;  4AG4 A;  2EID A;  2WN3 A;  5JXG A;  3I2J A;  5CZK A;  2WO3 A;  1EUT A;  4ET7 A;  4DXT A;  4E8D A;  3OB8 A;  2RV9 A;  4IUG A;  2BER A;  4XVH A;  1UYZ A;  2C4X A;  4DEV A;  3C7E A;  2ORX A;  3MUZ 1;  2QQJ A;  3ACI A;  3PUI A;  1J83 A;  2DCK A;  2QQL A;  4LPL A;  2C9K A;  4TTG A;  4XUT A;  4KWU A;  3CMG A;  4QX1 A;  3VDA A;  2VZP A;  3FHQ A;  2VC9 A;  5IHR A;  3A7Q A;  3EB7 A;  2VJX A;  2Y6H A;  3CKH A;  5I0D A;  4MOA A;  2VME A;  2W3J A;  4D8M A;  4PF1 A;  2RVA A;  2HYX A;  2E32 A;  2VQU A;  3ACF A;  2WN2 A;  2WUH A;  3WEZ A;  3DYM A;  2V4V A;  3LEG A;  2Y64 A;  5B4N A;  4P00 B;  4BDV B;  1KGY A;  4CU8 A;  2WAO A;  4P08 A;  5F7U A;  2VZQ A;  2VL4 A;  5DMY A;  3VD9 A;  1DYO A;  4BK5 A;  3T0D A;  2YC4 A;  1OT5 A;  3ABZ A;  1D7P M;  1T2X A;  5JXI A;  3I2F A;  1UXZ A;  3K77 A;  2EIC A;  1MPX A;  2WAB A;  1OD3 A;  4FI9 A;  4XZU G;  5EJZ B;  1JU3 A;  3T0A A;  2EIB A;  2Y8K A;  3THC A;  2VZR A;  2J1S A;  2W87 A;  1EUU A;  2W95 A;  4RN5 A;  1NX9 A;  3MV0 1;  4OUE A;  3LEK A;  4CU6 A;  1JHJ A;  3P1I A;  4LKS A;  1IQD C;  5G04 L;  4GWJ A;  3CZJ A;  4QDQ A;  5IFT A;  1NUK A;  5C7G A;  3CDZ B;  3NJX A;  2W1S A;  1DLC A;  4QX3 A;  3MBW A;  4BJ0 A;  2ZXQ A;  4DUX A;  2ORZ A;  3NNG A;  5JR2 A;  2VR4 A;  2DDU A;  2VZO A;  2VCA A;  3NJV A;  1UY3 A;  3OGV A;  3OG2 A;  2WBK A;  1GNY A;  2X10 A;  3T2P A;  3IAQ A;  2E31 A;  3OGS A;  1RYY A;  4P02 B;  3J7H A;  2VZS A;  2EIE A;  3E1F 1;  4D0Q A;  1BHG A;  2J22 A;  3WF2 A;  3WF3 A;  2QQM A;  4AAX A;  1JYV A;  3T0B A;  4MAD A;  1JYW A;  2YG0 A;  2C26 A;  1W9W A;  3K4D A;  4CUA A;  1GMM A;  2ZEW A;  2B9V A;  4MGQ A;  3IAP A;  4RYD A;  4ZY9 A;  3HEI A;  2VQT A;  1UY2 A;  1L7Q A;  3NQH A;  5IFP A;  3ETP A;  3C7H A;  3I3B A;  5JMO A;  1J84 A;  3UET A;  4PT6 A;  3T09 A;  3MO4 A;  1JZ3 A;  1L7R A;  3I2I A;  2QQN A;  4A4A A;  2VZ3 A;  2JE8 A;  2YFU A;  3DYO A;  4ZZ8 A;  2JDA A;  4XUO A;  3FL7 A;  2YB7 A;  2Y6G A;  3I3E A;  1TVG A;  2WYS A;  2VMF A;  2J7M A;  4UOJ A;  4QX2 A;  3C7G A;  5C70 A;  1GQP A;  1JZ5 A;  3LPG A;  5JXJ A;  3HNY M;  2W1W A;  3MUY 1;  1UZ0 A;  4CUB A;  1P8J A;  5DQ0 A;  3T2O A;  1US2 A;  1GUI A;  4LHS A;  4UAP A;  2WDB A;  1JYX A;  2W9X A;  2YFZ A;  4CVU A;  1UY4 A;  3ACH A;  3K46 A;  1ULO A;  1PMJ X;  3W5N A;  3AC0 A;  3DEC A;  2CDO A;  3GM8 A;  3UES A;  4L0P A;  5J1X A;  3W5M A;  3FN9 A;  1XNA A;  4QX0 A;  3WNN A;  3HN3 A;  2ZEY A;  2VTF A;  1CIY A;  4GWI A;  1K12 A;  4QAW A;  2WO1 A;  3A23 A;  4A3Z A;  4DUV A;  1I5P A;  4OZO A;  2V72 A;  4M4P A;  3ECQ A;  2VCB A;  2VCC A;  4E8C A;  4OMD A;  1K3I A;  2VZU A;  1GU3 A;  2Y6K A;  3WSO A;  5LA0 A;  4JX0 A;  1F4H A;  3MV1 1;  3A22 A;  2W5F A;  1SHW B;  1CX1 A;  3LPF A;  2X09 A;  5HXM A;  2VO5 A;  2BGP A;  3F2Z A;  3HOB A;  2W46 A;  4DUW A;  3CQO A;  2WQ8 A;  4BK4 A;  4W4Z A;  3I97 A;  4A6O A;  1UYX A;  2R7E B;  2XOM A;  3WF0 A;  4GZ9 A;  1OF4 A;  3IDA A;  4OMC A;  2BBA A;  3NRU A;  3U37 A;  1K45 A;  4Z2A A;  1H6Y A;  5CYY A;  1JZ7 A;  1CZV A;  2VZT A;  1PMH X;  5G05 L;  2WO2 A;  3C8X A;  3WF4 A;  1JZ2 A;  3WNM A;  2Z4F A;  4W8J A;  3VD4 A;  2Y6J A;  2VZV A;  3GDB A;  2BGO A;  1NAE A;  5FUI A;  2W1U A;  2WZ8 A;  3T08 A;  4XUP A;  4QB6 A;  3HJR A;  1CZS A;  4OYU A;  4MO3 M;  1F4A A;  1OF3 A;  4XUN A;  2CDP A;  3HPN A;  3HNB M;  1DP0 A;  3CIH A;  2XQX A;  3ACG A;  4ARY A;  3VDB A;  3SKJ E;  3GGL A;  3WNO A;  4QDS A;  2JD9 A;  1JZ4 A;  2BZD A;  4PQQ A;  2DCJ A;  1WCQ A;  4JKK A;  5EIY B;  2XON A;  3K4Z A;  2RJ2 A;  1UMI A; 
#chains in the Genus database with same CATH topology
 2D6O X;  2J1T A;  3TB0 A;  5C8C B;  3KZ4 C;  1R09 1;  1W9S A;  1LCL A;  4BH9 A;  3PMS A;  1CJP A;  3ZN4 A;  1H2L A;  2B46 X;  1R09 2;  4ONU A;  3DV8 A;  2LRP A;  2VEC A;  1ULD A;  3MFA A;  4DY5 A;  1X9P A;  4AQ6 A;  2OYZ A;  5IVB A;  2WKK A;  5DZF A;  4Q0V A;  3SKV A;  3VBR C;  4AEJ A;  4NRM A;  5CBL A;  3BTA A;  1O3S A;  4ORF A;  1W99 A;  1E57 A;  4FFG A;  4QB1 A;  2IFW A;  4YW1 A;  4FFI A;  1YIP A;  3AP9 A;  1DGR A;  4JKM A;  4E9K A;  1JYN A;  5FPU A;  5BXX A;  2EAA A;  1E5H A;  1PO2 1;  3MW3 A;  5C4W A;  2WC2 A;  2D5H A;  1PO2 2;  2CL2 A;  3KF5 A;  1QJE A;  2E6V A;  1OUS A;  3MIC A;  4XCA A;  1MAC A;  2FZ1 A;  4LBL A;  1S4C A;  1YNA A;  1OUX A;  3GAL A;  3MLJ A;  2W94 A;  2A73 B;  3ES1 A;  4LIV A;  1UCX A;  2UY9 A;  2VW2 A;  5EYX A;  2QNK A;  3ZIX A;  1GLH A;  3III A;  3ZMN A;  4CEW B;  3J8F 3;  2GNT A;  3HMY A;  2A1X A;  3JB4 C;  1UIK A;  4A44 A;  1R64 A;  1S1A A;  2RS1 3;  5FZ4 A;  1C5H A;  3ZR5 A;  4CDW B;  4CUC A;  2XBO 1;  4C0B A;  2J1V A;  4K8R B;  1WCD J;  4UF0 A;  4IGQ A;  2VOX A;  4YVS B;  4NMI A;  3U1X A;  2ZEX A;  4YW7 A;  1DHK B;  2ZGS A;  4CU9 A;  4HET A;  1CN1 A;  2ZBJ A;  4IGP A;  3BU7 A;  4QB2 A;  5FZD A;  3ZYR A;  3EMR A;  3VDD A;  3CZU A;  5EJ1 B;  3NST A;  5CFC C;  5JZG B;  5FKB A;  1DF0 A;  3U75 A;  3VZN A;  4EWE A;  2F4L A;  5LA9 A;  5T5J A;  5HPO A;  5HI0 A;  1UXX X;  2CSG A;  2FDJ A;  2XVK A;  3DYP A;  1UX7 A;  5L9R A;  4AHX A;  5ABJ B;  1GP5 A;  5KC5 A;  3U10 A;  2WL1 A;  2WNV B;  3A4U A;  4JGZ A;  4CDU C;  1UZV A;  2OT7 A;  1W8N A;  3BVC A;  1DQ2 A;  3OEB A;  5CIR A;  4R9B A;  1YXW A;  3EXU A;  4XIL A;  4CRQ A;  1FV2 A;  1POV 0;  5CG8 A;  4FTE A;  4A2U A;  1U12 A;  3VBU C;  2Q8D A;  1QOO A;  4OLL A;  3B93 A;  1VRH 3;  3SCG A;  4D6S A;  1MR5 A;  1UMZ A;  3PU3 A;  3SEP A;  5A3P A;  5T3N A;  3FWE A;  1V6O A;  4HON A;  2QDR A;  4LQR A;  1AZD A;  3ZYH A;  2X53 S;  2A6X A;  4CP2 A;  1K5M A;  3O1R A;  1BK0 A;  1VPH A;  4N53 A;  2HLE A;  1YC6 1;  3NAP A;  2FDH A;  3Q8C A;  3ZDS A;  1PK6 C;  3PVN A;  4ISQ A;  1IQA A;  1GR3 A;  1WW4 A;  1YJK A;  5K4L A;  5JIU A;  3LWC A;  4AVB A;  3BN6 A;  1SDW A;  1JBC A;  5JOZ A;  3R6S A;  4CEY B;  2OZ6 A;  1NCR C;  1WBF A;  5FYY A;  3FJS A;  1GSL A;  2WZE A;  4AE2 A;  3LSE A;  1SPP B;  3LE0 A;  5HCA A;  3FC0 A;  3M3C A;  5FMC A;  1IS4 A;  3ZM8 A;  1ZRI A;  3TOJ A;  2E53 A;  4HKW A;  4W65 A;  2HEY F;  2BUK A;  5IJR A;  2QQU A;  4FP2 A;  3OUH A;  4HG6 B;  4QPW A;  4AQT A;  2TBV A;  3I59 B;  1O8P A;  5AFE A;  1OVP A;  5FYM A;  5IAV A;  5FJK A;  2CAU A;  4MH0 E;  4BXS V;  1Y9Q A;  2D6N A;  1RUF 2;  1OUR A;  1KDM A;  5ANN A;  1XE0 A;  2YC2 A;  3HD8 B;  4HAN A;  3JD7 1;  1STM A;  3RYK A;  4DIN B;  1DGL A;  1Q43 A;  3JD7 2;  2HKX A;  3CJI A;  4CXX A;  4JHT A;  5A3N A;  2ZGQ A;  4QXC A;  3KV6 A;  4TN7 A;  3APB A;  2E7T A;  3QLQ A;  2QQV A;  5FZ3 A;  3W58 A;  3NNL A;  4TZD A;  1RUC 1;  5C3O A;  4TYS A;  1LNS A;  1JU4 A;  4XBN A;  3UKT A;  1VBB 3;  2XPJ A;  2J1A A;  4KI5 M;  2V5Y A;  2ZMK A;  1DQ6 A;  4Q29 A;  2PHD A;  4A6S A;  1W0O A;  4RD7 A;  2SLI A;  4CDQ B;  5ACA 3;  4PDW C;  3NMB A;  5BPX A;  3RZJ A;  1ACC A;  3HQU A;  1AYN 1;  5A3O A;  4DB5 A;  2YHJ A;  1LHW A;  1X8M A;  3O1T A;  2JDY A;  4Y1Y A;  4Q8K A;  1AYN 2;  2BU9 A;  1D4M 2;  2ZAA A;  5FPB A;  3ZXD A;  3JBG 3;  4P14 A;  1ND2 A;  1UO9 A;  5I8S A;  2W1Q A;  1JYT A;  4JZR A;  4LR4 A;  4K7J A;  5HCF A;  4Q4V 3;  4AG4 A;  1LJ7 A;  3U4X A;  3M8L A;  2WN3 A;  4NJ4 A;  2QDN A;  1SBD A;  4UF0 B;  1H30 A;  4QQ2 A;  3VGI A;  2ET1 A;  2VQA A;  4DXT A;  4E8D A;  2VMG A;  4YZ2 A;  4AW7 A;  3OB8 A;  1AR7 3;  4BQW A;  3EJK A;  2A3Y A;  3D8C A;  1XRU A;  1WW7 A;  3N9P A;  3VDD B;  5JAX A;  4QGM A;  2C24 A;  4N43 C;  2A6Y A;  4XVH A;  5C6C A;  4FPG A;  1LHN A;  2P5B A;  4GUL A;  4DEV A;  3C7E A;  1RED A;  2RR1 1;  1DFQ A;  1S2K A;  3MUZ 1;  3RNS A;  2HBT A;  5KBF A;  3IM0 A;  1J83 A;  3V56 A;  2QZ2 A;  1NG0 A;  3F95 A;  1POV 3;  2DCK A;  2E9Q A;  2C9K A;  1Y4W A;  2QQL A;  4B4P A;  5CAD A;  2Z69 A;  4MET A;  4XUT A;  4YZ3 A;  5BNP C;  4XMA A;  1ST8 A;  1PO1 1;  5FYU A;  2BQP A;  2O8Q A;  3RQ0 A;  1LHO A;  3H3U A;  4KWU A;  4QX1 A;  4XHX A;  4ATE A;  3OD4 A;  5FYI A;  1DQ4 A;  1WD3 A;  3FHQ A;  2VC9 A;  5IHR A;  5JCT A;  3UV9 A;  1WGP A;  3ZO0 B;  2O1Q A;  3CKH A;  3ZYG A;  4OHW A;  3J7M A;  4LMF A;  2W3J A;  1MS5 A;  3K48 A;  5FY0 A;  3HR9 A;  2R32 A;  5LY2 A;  3K3N A;  5J36 A;  2WN2 A;  2WUH A;  1NOV A;  5IVE A;  1K5M B;  5C8C C;  3DYM A;  3HBK A;  3MIB A;  2DUO A;  4R4X A;  4N53 B;  2JKB A;  2PQQ A;  3ROU A;  1RUI 1;  3NAP B;  1BXH A;  3ZN6 B;  4RR3 B;  3ZFE A;  1PM4 A;  2Y64 A;  4UW4 A;  3TWI A;  1RUI 2;  3WOG A;  1CAW A;  5BNN B;  2GND A;  1SFN A;  4QQP A;  1KGY A;  4KBZ A;  1S0J A;  2WR9 A;  3N7M A;  3VD9 A;  2AEZ A;  1TMF 3;  2MHF A;  2PHT A;  1YO8 A;  4NII A;  3WG3 A;  4AEK A;  1Z7S 2;  5FLJ A;  2C9A A;  1D7P M;  4L97 A;  4AVT A;  2RM2 1;  3WDT A;  2PA7 A;  1HXS 2;  1OLQ A;  1G6N A;  2RM2 2;  2VY0 A;  2GC1 A;  3IZO A;  1LOF A;  3E5U A;  3N9M A;  5DAX A;  1W0P A;  4FI9 A;  4HL0 A;  5EJZ B;  1PZ7 A;  5FZ6 A;  1JU3 A;  4WM8 B;  1ZX5 A;  2WNU A;  4PIX A;  3ZXG A;  4ISR A;  4XOG A;  4KNC A;  3LSD A;  3TEX A;  2BNN A;  4XPV A;  2A6W A;  4P9G A;  3PU8 A;  4YGB A;  5FV3 A;  2W87 A;  4ASL A;  3LOI A;  2ARX A;  2PHR A;  3CJI B;  3VBO B;  5KHI A;  3TEW A;  2W52 A;  4IEW A;  4CEW C;  4XJW A;  4N9I A;  3AP5 A;  3ZR6 A;  4CTE A;  2WS9 3;  3AYC A;  3ZYF A;  4CDW C;  2UWC A;  2XGX A;  2ZX3 A;  2XJS A;  3E5X A;  4OUE A;  4TLG A;  1BBT 3;  4EQV A;  5I0R A;  5CG9 A;  1VBC 3;  2HWF 3;  1JHJ A;  3P1I A;  2R16 A;  4LKS A;  3THC A;  1W39 A;  3CZJ A;  2G19 A;  3ILF A;  5IFT A;  3IIA A;  4J6G A;  2FCU A;  4XQD A;  2GC0 A;  1SLA A;  3GCW A;  4LKE A;  4UT5 A;  1JTZ X;  3NJX A;  4RHV 2;  3VBS A;  1UOF A;  4AFB A;  5CAZ A;  1OPO A;  5JZG C;  2OQ7 A;  2VOK A;  1IG3 A;  1SMV A;  2RMU 3;  2WWS A;  1EP0 A;  1ND2 B;  3MBW A;  1RUJ 3;  5FTT C;  3NNG A;  5F2S A;  1BKZ A;  2VR4 A;  3GNE A;  5FZ7 A;  1OA2 A;  5ABJ C;  4NPM A;  2WNV C;  4OQ8 A;  1YI7 A;  1RUG 1;  3NJV A;  3DF0 A;  2VUD A;  4QD2 A;  1B35 C;  4FPJ A;  5LRS A;  1RUG 2;  1NQJ A;  2PLV 1;  2VH9 A;  3MEP A;  3OG2 A;  2I45 A;  3IAQ A;  1XSR A;  2OW4 A;  2E31 A;  2PLV 2;  1CJD A;  1RYY A;  1VAK A;  1ZBA 1;  3M3E A;  1A34 A;  4P02 B;  1COV 1;  4R9A A;  1ZBA 2;  2EIE A;  3VB9 A;  4D0Q A;  1COV 2;  3PJQ A;  1BHG A;  1NA1 C;  4Q0S A;  2R6Q A;  4COU A;  4FSJ A;  1GNH A;  1JYV A;  2C5D A;  3DKQ A;  2RS5 1;  2OX0 A;  4MAD A;  5A7S A;  1PGW 1;  2YG0 A;  4LO6 B;  5LBB A;  4AGR A;  3TAY A;  1JYW A;  3B02 A;  1O4Z A;  2Z2S B;  3WR0 A;  1O4Y A;  3K4D A;  4CUA A;  4LIT A;  5KR7 A;  1GMM A;  3V64 A;  3LKJ A;  3M7A A;  2E51 A;  1VBA 3;  2RS3 3;  3GBG A;  4BIF A;  4CZS A;  4ZY9 A;  2IXK A;  3HEI A;  3J7L A;  4C0H A;  1UY2 A;  1QDO A;  4NHK A;  2ADD A;  3I3B A;  4U36 A;  3WXP A;  3I3M A;  3UET A;  1HDK A;  5JPN B;  1PVX A;  2DCT A;  3PJY A;  1D4M 3;  3BI3 A;  5A32 A;  2G9Z A;  1JZ3 A;  1B09 A;  1RUN A;  5I8Y A;  1ULC A;  2QQN A;  3EO6 A;  1R08 1;  4YSF A;  1EV1 1;  2DU0 A;  1XYP A;  3VKM A;  4RGK A;  2RE9 A;  2GDF A;  4XE9 A;  1R08 2;  4QX8 A;  1EV1 2;  3S7E A;  4XUO A;  4BQ1 A;  3H8O A;  1S2B A;  4WVM A;  3SMH A;  1ZZ6 A;  1UU4 A;  2I74 A;  2FDG A;  1OMI A;  2J7M A;  4UOJ A;  3UK9 A;  4XTP A;  1V9U 3;  4W6X A;  5EYY A;  5FZ0 A;  5A3U A;  5JXJ A;  1QIQ A;  2DF7 A;  4AQ2 A;  2F17 A;  5JOX A;  1PGS A;  2YYO A;  4IL7 A;  1LU2 A;  5FXV A;  2IXJ A;  5CFC A;  4MHU A;  3T2O A;  1OKQ A;  5FYV A;  2OPW A;  4J1X A;  4UAP A;  2W9X A;  1WLD A;  2Q5T A;  3DXU A;  1VRB A;  4EZH A;  1UY4 A;  2WNU B;  4ZU5 A;  4YAR A;  4CDQ C;  1MVQ A;  3DEC A;  3IDB B;  3MPP G;  5A3W A;  3WDX A;  4AI1 A;  3GM8 A;  5EFU A;  4CDU A;  5J1X A;  1R1A 3;  4XHB A;  4IE0 A;  4HK9 A;  1XNA A;  1CIW A;  4YW3 A;  4B1M A;  3GBW A;  2YMZ A;  2Y26 A;  4XBL A;  1LOA A;  3VBU A;  1O4T A;  1V6N A;  4W6Y A;  5FZG A;  4CCM A;  3B9C A;  3DKW A;  3J4U H;  4B1L A;  2XJP A;  4GB3 3;  5A6Q A;  2Q4S A;  2ZEY A;  1HQW A;  2VTF A;  5FZH A;  3CNA A;  4A3Z A;  2GP3 A;  4ZHN A;  5L19 A;  2VCB A;  1APN A;  4Q27 A;  2WO7 A;  4Y5Z 0;  4XMI A;  1ZBE 3;  4E8C A;  4OMD A;  3VBS B;  3VDD C;  2A6V A;  2Y6K A;  1BMV 1;  2RDQ A;  1LEN A;  2VVD A;  3B3Q E;  4MUV A;  2YBP A;  2HWC 1;  4HVQ A;  1G9B A;  1E5R A;  2AYH A;  2HWC 2;  4EN8 B;  1CX1 A;  3LPF A;  2X09 A;  5F6K A;  3SCH A;  2BGP A;  3HBZ A;  2D3P A;  3HOB A;  3AKT A;  3ZVX A;  4XF4 A;  3B00 A;  4D7T A;  2P3I A;  1GYK A;  5IUQ A;  3RG0 A;  1VP6 A;  3O1S A;  4A6O A;  4MZU A;  5CKN A;  1PMI A;  4GZ9 A;  1RUH 1;  3AKS A;  1VBE 3;  1OF4 A;  2A3X A;  2R04 1;  4N9H A;  3P3P A;  1RUH 2;  3U37 A;  2ZPX A;  1L7L A;  1K45 A;  4X8P A;  4Z2A A;  2R04 2;  4JDM A;  3O12 A;  4HT1 T;  2JG9 C;  1AX1 A;  5CYY A;  5GZC A;  2TEP A;  1F35 A;  4BA6 A;  1IS5 A;  5G05 L;  2WO2 A;  1K5M C;  1SLL A;  5A80 A;  1KFX L;  4YM2 A;  4Z92 B;  1V6J A;  4N53 C;  1UL9 A;  2Z4F A;  1JMU B;  5FOJ B;  4RR3 C;  3IDE A;  1GQG A;  1W06 A;  5BNN C;  2HWB 3;  2CGO A;  2WIN B;  1ENS A;  4ZKT B;  1H4H A;  5LB6 A;  2VZV A;  5FYH A;  5IAT A;  1XBF A;  4P9I A;  2BGO A;  3I54 A;  4HMZ A;  2IWG B;  4XFA A;  3WDV A;  4CCO A;  4M3C F;  5I0U A;  3WZ1 A;  1BEV 3;  4XXP A;  2VUJ A;  2EXH A;  3O1V A;  4XUP A;  4QB6 A;  1IKQ A;  4L92 A;  1KRI A;  1CZS A;  5C5T A;  2RHP A;  1IPK A;  2WWU A;  5EP9 A;  1UQX A;  3ELN A;  4OYU A;  3BB6 A;  1X7N A;  2NYY A;  1OF3 A;  2AH2 A;  1DZR A;  4G9S B;  4R9C A;  2OUJ A;  4F3J A;  3HPN A;  4WM8 C;  1PIV 2;  3P5B A;  3M3I A;  3POF A;  1HW5 A;  1ENQ A;  3CIH A;  4XJ9 A;  1HRI 3;  3POG A;  5FZI A;  5FZ8 A;  1JOD A;  4LBN A;  4WVM B;  3NNF A;  1URX A;  4BIO A;  3SKJ E;  3NNM A;  3WNO A;  2Q30 A;  1UIJ A;  4QDS A;  3A0N A;  1LAJ A;  2W2I A;  4YW2 A;  3UGH A;  2BZD A;  3VBO C;  1WCQ A;  2YPJ A;  4Q0U A;  4DRV A;  5EIY B;  5LEK A;  3K4Z A;  5CFC B;  3CU7 A;  3Q8E A;  4GMP 1;  1X33 A;  5JR7 B;  5I93 A;  1MZ5 A;  1L3J A;  4DXS A;  5FDB A;  2VW0 A;  2VOT A;  3SXW A;  5HBA A;  4UW6 A;  4I02 A;  1LES A;  3LFM A;  3THD A;  1WME A;  4ZXE A;  3S5Q A;  1XC6 A;  3IMM A;  2XWB B;  3JZV A;  4P9W A;  1MZF A;  4BQ3 A;  2OS2 A;  4AGG A;  3AKQ A;  2Q1Z B;  3SLI A;  1HKD A;  5F39 A;  2VNV A;  5JVV A;  2GN3 A;  2ILM A;  2A7A A;  2X5I A;  2WLP A;  2SBA A;  4MLO A;  1ND2 C;  3CHX A;  2QUO A;  2UYA A;  4FOW A;  3N9N A;  2ZKL A;  3FHA A;  3OPW A;  4PLN A;  4HBN A;  3TYJ A;  2HH9 A;  3RMX A;  4ZON A;  4FP3 A;  1MS1 A;  2XUM A;  4OZX A;  4Q4W 1;  4CCD A;  4AHW A;  5C8C A;  3LEI A;  5FPX A;  1JZ8 A;  4DQA A;  1YWK A;  4Q4W 2;  1MZE A;  3I2D A;  5FKC A;  4KMQ A;  1QJU 1;  1E5S A;  4MGS A;  4M0H A;  4O7X A;  5C3Q A;  1QJU 2;  2E33 A;  3EYP A;  3HIF A;  3OBA A;  1ZYB A;  4HSL A;  1W0N A;  1I6X A;  3WT3 A;  4MSV A;  2R07 1;  3NL1 A;  5FZ9 A;  1OOP A;  1LOD A;  5FMO L;  4D69 A;  1GP4 A;  2J1E A;  4RFR B;  4C1W A;  2R07 2;  4Y1V A;  2BGC A;  2LUW A;  3B7M A;  5FFO C;  3OJB A;  3Q8F A;  2ZA9 A;  1OA3 A;  4ZS3 A;  1S2E A;  3SIT A;  4LTA A;  3VD5 A;  2VMD A;  3KHC A;  3LDR A;  3VV1 A;  1AR6 3;  3JB8 A;  4DXR A;  3WNL A;  2BW8 A;  2ZAH A;  5GM0 A;  3ZSM A;  1Y9G A;  1GFF 2;  5LA2 A;  5T52 A;  4HZF A;  3RGB A;  4LBJ A;  1V70 A;  3ES4 A;  4XUR A;  3SEE A;  4BE3 A;  5AC9 1;  5FZO A;  5JUV A;  1OH4 A;  2JE9 A;  4IET A;  4IV1 A;  5LZ6 A;  2ZGM A;  5AC9 2;  5LK5 A;  3WP5 A;  1W03 A;  4ZZ5 A;  1LOE A;  5C71 A;  3BU0 A;  2OZJ A;  1RIR A;  2E63 A;  3MF6 A;  1C8N A;  3ZSK A;  4YG0 A;  3PHM A;  1QF3 A;  3JXS A;  1ZZ7 A;  1UYY A;  4L11 A;  4CCJ A;  3VD3 A;  4NID A;  3BCW A;  4CDW A;  5LAT A;  1HV1 A;  4MGY E;  4QDR A;  3FHI B;  3KCY A;  4MXW A;  1SG3 A;  4BWO A;  5FPZ A;  2WA3 A;  1RUO A;  2PTM A;  4TXW A;  2JDM A;  1DYK A;  2E26 A;  2KM2 A;  4UI9 L;  1RIT A;  1ENX A;  4I3G A;  5FWE A;  1NKG A;  1YFU A;  3WHU A;  4A7K A;  3LB9 A;  3AP6 A;  1EAH 1;  3P6B A;  1QWR A;  3VD7 A;  5FYB A;  2B7Y A;  4HFS A;  4AI3 A;  1H0B A;  3USU A;  3VL8 A;  4BB3 A;  3ST7 A;  5JZG A;  1AR9 1;  1G8W A;  1QJY 3;  2QQO A;  5FZM A;  3DEM A;  3LQC A;  2X05 A;  3RYR A;  3BTX A;  1AR9 2;  4EN9 B;  3WG1 A;  1WCK A;  4DIQ A;  1MQT C;  2XQR A;  4O9E A;  3DXT A;  4O9G A;  2WNU C;  4XDO A;  1A78 A;  3BGA A;  2P37 A;  3OTF A;  1OC1 A;  2CWS A;  4CU7 A;  2IXI A;  1B35 A;  4M4R A;  2LS6 A;  1W9T A;  4IES A;  3AL5 A;  2K46 A;  3KLS A;  2E7Q A;  2CV6 A;  3T4H B;  3ZIW A;  2BYV E;  2QCS B;  1ALY A;  2XLA A;  3N9Q A;  4FFF A;  1XJA A;  1QJF A;  1XNT A;  1CAX A;  2YPD A;  2B45 X;  2XL9 A;  5CKQ A;  1ZNP A;  4NN0 A;  3W9A A;  2EXJ A;  1HQN A;  2ZTN A;  1W8Z A;  1YIF A;  4H14 A;  5EV7 A;  3OEA A;  3SHR A;  3NJZ A;  5A1L A;  1YI9 A;  3OGG A;  1NA1 A;  1K5J A;  1XNK A;  2ARB A;  3KF3 A;  5SV8 A;  5A3M A;  2AAC A;  1GOG A;  5JDB A;  2O0O A;  4FXK B;  2D44 A;  5FZK A;  5FP9 A;  3WF1 A;  3WUD A;  2IUW A;  1RUE 1;  3I2O A;  2VVF A;  3HT1 A;  3Q8A A;  4GIQ A;  3VBS C;  4BME A;  4COY A;  5A1A A;  1MEC 3;  4PLO A;  1RUE 2;  5DUV A;  2ZOE B;  3B5L B;  5BNO A;  5FO8 B;  1PGL 2;  1D4V B;  2QQW A;  2BNO A;  2X5I B;  3BTZ A;  3R05 A;  2ERF A;  1S0C A;  2XHN A;  4I2O A;  2PEL A;  5A33 A;  4EZ4 A;  1HQL A;  5FY1 A;  3ZYI B;  2NN8 A;  2D43 A;  1Q8O A;  1YUD A;  3POE A;  3OGR A;  1GAN A;  2ZHN A;  4XUQ A;  5A7N A;  2VG9 A;  4YG3 A;  2P3J A;  5D8A A;  2YUE A;  2Q1F A;  4Y4Y A;  3V65 A;  5F5C A;  3TN9 3;  1DQ0 A;  4GQ7 A;  2R0F A;  3C7O A;  2BJS A;  1DG6 A;  3I59 A;  3UGF A;  1PM7 A;  1DLL A;  2ZGO A;  4YVW A;  1AL2 3;  2BOJ A;  3RI8 A;  3WDU A;  5C9A C;  2V5D A;  3KSC A;  1SBF A;  4K1Y A;  1PX3 A;  3VHO A;  3HWJ A;  1OOP B;  3WQB A;  1H1I A;  4XFH A;  1FPN 1;  1VBD 1;  3J9S A;  3ATG A;  1ENR A;  5FO7 B;  4YRD A;  4BQX A;  1FPN 2;  1PHM A;  1C1L A;  1VBD 2;  2BP6 A;  2GAU A;  2HWE 1;  2OUH A;  3H9A A;  1W8H A;  5CZK A;  4FVV A;  3NV3 A;  3BYW A;  1FXZ A;  1VB4 A;  2HWE 2;  4LUK A;  4GXL A;  2JB8 A;  3AP7 A;  1AR7 1;  4XAB A;  1Q5O A;  1N47 A;  1AVB A;  4XF1 A;  4QPI B;  4Y1Z A;  2NZ9 A;  5LBE A;  3UYJ A;  1DGW X;  4CDQ A;  5FUN A;  1W6M A;  4CUG A;  2BER A;  5J48 A;  2K9Z A;  3JUU A;  4Y3O A;  5FZO B;  1UNB A;  1ASJ 3;  1UYZ A;  4IV1 B;  4KGQ A;  3DUI A;  4NAO A;  4BQ5 A;  2C4X A;  2ORX A;  2XVL A;  4XF0 A;  5HV4 A;  3N9O A;  4FPK A;  4WM7 C;  4TWT A;  3UKN A;  1QKQ A;  3AVS A;  5FZF A;  2CGN A;  2TUN A;  4LPL A;  1SFP A;  1ZZB A;  2E7A A;  2WT1 A;  3POB A;  3Q9O A;  5FZB A;  2JDH A;  3KV9 A;  4NIA A;  2ZX4 A;  2ADE A;  1AHS A;  2NLR A;  4MXW B;  5GLZ A;  1WLC A;  4BXF A;  4OI0 A;  2XBO 2;  3A7Q A;  2PHW A;  2P3Y A;  1QEX A;  1XSQ A;  2Y6H A;  3H8R A;  5FXW A;  3BOD A;  2VME A;  2W08 A;  5LW9 A;  3O5S A;  1NLQ A;  4B8E A;  3VKL A;  1ODN A;  2ZHM A;  2VQU A;  3JU9 A;  3KQ4 B;  5JIA A;  3USU B;  4DY3 A;  5HV0 A;  2OA2 A;  1NZI A;  4NIG A;  4QQH A;  1A8D A;  1XOY A;  3SH3 A;  3VHN A;  1M06 G;  4XXA A;  1CD3 G;  5FYT A;  2FCV A;  2CAV A;  1QQP 3;  1KJR A;  2R06 3;  3LEG A;  1RUD 3;  2JIG A;  5B4N A;  5F8P A;  3LFI A;  3FUQ A;  4GJZ A;  1TE1 B;  4P00 B;  4PF5 A;  4ZXK A;  4MYE A;  3E5Q A;  4XIO A;  4B7E A;  1SZB A;  2VZQ A;  2VL4 A;  1KD7 A;  1TMF 1;  4BK5 A;  3T0D A;  2A75 A;  4GJY A;  1B35 B;  4ZS2 A;  1W05 A;  3ABZ A;  3M3Q A;  1TNF A;  1I3H A;  2XVG A;  4HN0 A;  3K77 A;  2ZMN A;  2H0B A;  2ZGR A;  1CAX B;  2MEV 1;  4I01 A;  1OD3 A;  1YQ5 A;  3GHM A;  2ZGP A;  3L9J T;  4OUM A;  4CPB A;  1BK1 A;  2MEV 2;  4HVO A;  2JG9 A;  3N7L A;  4CDX A;  1OLM E;  4NHY A;  3K51 A;  4Q4X 1;  1NA1 B;  1QY4 A;  2DFB A;  3T0A A;  4KWK A;  2NMO A;  4UFL A;  2PHL A;  2Y8K A;  4MX3 A;  5FY5 A;  4DXZ A;  5FP4 A;  3ZN6 A;  1VAV A;  1YJL A;  2PAK A;  1W2O A;  2VD7 A;  2VCM A;  1XU2 A;  1QXP A;  2VZR A;  3NV2 A;  4IEU A;  3FLT A;  4MV2 A;  4RR3 A;  3WX5 A;  5IVF A;  1EUU A;  4QQO A;  5BNO B;  3I4I A;  3ORJ A;  2VE1 A;  3AX4 A;  4AHZ A;  3O1P A;  3VZK A;  1H2M A;  4RN5 A;  1FYU A;  2JE7 A;  3FLR A;  5DXD A;  1NQD A;  5A33 B;  5DDJ 3;  5CFD A;  2YY1 A;  1MZ6 A;  2A5Z A;  4GAZ A;  4AZZ A;  4GWJ A;  5D8A B;  4URA A;  2HEV F;  4AFA A;  2GC2 A;  1LOB A;  5CVR A;  5L73 A;  4JC1 A;  3N35 A;  4GWM A;  5H9S A;  3GZE A;  4G3Y C;  4WM8 A;  4B29 A;  4BQY A;  4X8N A;  3MHZ A;  4YVW B;  2DU1 A;  3U07 A;  1DLC A;  2WFF 3;  2WII B;  2A6Z A;  2Y0O A;  3RZZ A;  3VBF A;  3WLU A;  3POI A;  5C8W A;  4S2F A;  3PME A;  1O5L A;  1X82 A;  4YYO A;  1S0F A;  3VBO A;  2XON A;  3D0J A;  4NUB A;  4NIH A;  1AYM 1;  1FNZ A;  4J1W A;  1TME 3;  2EAK A;  3E6B A;  3NNJ A;  1AYM 2;  2VCA A;  1QDC A;  1UPS A;  1RUC 2;  5FY9 A;  4R4Z A;  1XE7 A;  3OGV A;  5LWB A;  1GNY A;  3BPS A;  3T2P A;  2AEN A;  5IVV A;  2F6B A;  4CCE A;  1OVS A;  3EHK A;  5B2G B;  1C28 A;  1YRZ A;  2D6P A;  4IW3 A;  1W6M B;  3GJB A;  5CA6 A;  1OBN A;  3UT0 A;  2BEO A;  2VZS A;  3UJQ A;  3I49 A;  3POS A;  3E1F 1;  4JQT A;  3T1M A;  1JOJ A;  4V2W A;  3PTR B;  1AXZ A;  4AAX A;  3RPQ A;  3ZYJ B;  1KJL A;  4SBV A;  4E2S A;  3KCX A;  5IK7 A;  1W9W A;  1QOT A;  2WZR 3;  3MFC A;  1H1A A;  3INA A;  4SLI A;  1IOA A;  2OII A;  4MGQ A;  4RYD A;  4BCU A;  1DZT A;  2XKP A;  3FZ3 A;  2VQT A;  1BCX A;  1YEW A;  4QMA A;  1D2Q A;  1L7Q A;  1CVN A;  1OQE A;  3ETP A;  5H9P A;  1J84 A;  1Q56 A;  1R09 3;  1RC6 A;  2VNG A;  3T09 A;  2BDR A;  2QTW B;  4OHX A;  1UU6 A;  4RGG A;  4EJR A;  1Z0H A;  4J25 A;  3TEY A;  3BKZ A;  1MS4 A;  4A4A A;  2VZ3 A;  4Z8B A;  4QM9 A;  3SQO A;  1YFY A;  1WMD A;  3DYO A;  3PL0 A;  1R1Z A;  3FL7 A;  2BNM A;  2R49 A;  1WW5 A;  2RR1 2;  3ASI A;  3HVD A;  4LBQ B;  4BLI A;  1GWK A;  4DNY A;  1D2S A;  2Y38 A;  2WYS A;  2VMF A;  5A3L A;  3BIW E;  5KXC A;  3KB5 A;  1KS5 A;  5C70 A;  4RS5 A;  1JZ5 A;  3N7K A;  1PO1 2;  3HNY M;  1GWL A;  3CJX A;  1PO2 3;  2X5I C;  2JX9 A;  4L2N A;  5KWR A;  4XQW A;  1O3Q A;  1HIX A;  4CUB A;  1P8J A;  1US2 A;  4XYX A;  4DPN A;  3OPZ A;  1UW8 A;  1SFY A;  5KXD A;  2WDB A;  3WW2 A;  3L2H A;  4TSV A;  2JG9 B;  4MGI E;  4CDX B;  3JQX A;  5FLH A;  2VMH A;  4EV0 A;  4FTS A;  2DVF A;  2CHH A;  2ETE A;  4L0P A;  2XH6 A;  5FWJ A;  3LA2 A;  5LRR A;  3W5M A;  2FDK A;  3FUO A;  3FN9 A;  1FV3 A;  1LU1 A;  2ES3 A;  4IEP A;  1UX6 A;  1EPZ A;  2XBO 3;  2UWB A;  4YW5 A;  1F8V A;  1AXY A;  3GBF A;  4RGA A;  3L2Y A;  5F3E A;  4RL7 A;  4Z07 A;  3KM5 A;  5HCH A;  1OOP C;  1V0A A;  5FP8 A;  5IT6 A;  3I3Q A;  3RJR A;  5CFD B;  1ZRE A;  1CIY A;  1ZZ9 A;  2FD8 A;  2JDK A;  3NVC A;  1K12 A;  2WO1 A;  5FZL A;  3QH6 A;  3H3L A;  2JG8 C;  1I5P A;  2XUE A;  3AK0 A;  4DUV A;  4M4P A;  1AJO A;  5GZD A;  3U78 A;  5F9T A;  2WJS A;  1MQT A;  5J3U A;  1CPN A;  1JH5 A;  2GH2 A;  3AXE A;  2VOV A;  3FFQ A;  3H3Z A;  1K3I A;  2VZU A;  4QPI C;  4XW3 A;  1RMU 1;  5F3G A;  4Y22 A;  4UFJ A;  3VBF B;  4JX0 A;  1GZ9 A;  4IV1 C;  1RMU 2;  1F4H A;  4H2A A;  4EN0 A;  3QH7 A;  4K9S A;  3A22 A;  1ND3 B;  2W5F A;  4JRL A;  3OOX A;  3O0W A;  2JIC A;  5EXO A;  3ZPY A;  4D6Q A;  5HXM A;  4N7U A;  4Q8L A;  3F2Z A;  4C1X A;  1ZRR A;  4XDQ A;  3KMH A;  5DAP A;  4KG0 A;  5T5P A;  5J37 A;  4BZ4 A;  3PIJ A;  2R7E B;  1HLC A;  2XOM A;  1W6P A;  2KR2 A;  3WF0 A;  1Y3T A;  3O0V A;  3IDA A;  5C3P A;  5T5L A;  2BBA A;  1UKR A;  5F3C A;  1NZC A;  4YZ1 A;  4KQ7 A;  1H6Y A;  3KVB A;  5DG1 A;  2NMN A;  5CIS A;  4P9X A;  3ZPO A;  1F15 A;  1JZ7 A;  2VQ0 A;  2VUL A;  1PMH X;  3VZO A;  5F3I A;  1HRV 1;  4S2G A;  4LNV A;  3NW4 A;  1J3R A;  5CNA A;  2W0X A;  3S57 A;  1HRV 2;  3MIE A;  5H9Q A;  1X8E A;  3KCC A;  1RHI 1;  1ZZC A;  4IND A;  3URF A;  5FXZ A;  4BIS A;  4YM3 A;  4JTO A;  1S0G A;  1RHI 2;  4UFM A;  3LA3 A;  5FPV A;  4WV8 A;  2A71 A;  1XND A;  2AZ5 A;  3ZXL A;  3VD4 A;  2RDN A;  5FBZ A;  4BM8 A;  1HB2 A;  2R30 A;  2W1U A;  2NP0 A;  1QMJ A;  2ZAC A;  1XQN A;  4MVT A;  5FZE A;  1O6U A;  3HJR A;  4E4D X;  5C9A A;  3TBD A;  1RUF 3;  2PXJ A;  3AMN A;  5FRE A;  2A3W A;  4IEX A;  3D82 A;  2CDP A;  3ZOI A;  2XHK A;  2R1B A;  3JD7 3;  1UOB A;  4NHM A;  5JOW A;  1PVC 1;  1UYP A;  2PAE A;  4S2H A;  3ACG A;  1WW6 A;  2TNF A;  1H4G A;  2ZZJ A;  4ARY A;  1PVC 2;  2VUA A;  4AI8 A;  4LUM A;  2RS5 2;  3GGL A;  1W6N B;  1PGW 2;  4IQP A;  1CX4 A;  3DPR A;  3DGT A;  3OGJ A;  3NJY A;  4RS5 B;  4PQQ A;  1DDL A;  2Z79 A;  5BNO C;  1LEC A;  2B39 A;  1ZZ8 A;  1D0G A;  1UMI A;  3ZKU A;  4BQ2 A;  5I0S A;  2L9L A;  2OPK A;  2D6K A;  1Q3E A;  2ZGK A;  3RI9 A;  5LCW L;  3FLP A;  3PUQ A;  5J98 B;  3KV5 A;  3POY A;  1GZT A;  4HLT A;  1US3 A;  4EE2 A;  1UMH A;  1AYN 3;  1YQ2 A;  1YHF A;  2C6S A;  4WM7 A;  1CPM A;  5D8A C;  5EQU A;  4BOW A;  5IAX A;  3X29 B;  2YGL A;  4P5Y A;  4NWW A;  4QQL A;  4YW6 A;  5A7P A;  4LA3 A;  4N90 A;  3I2G A;  4FPE A;  3DL3 A;  4PIZ A;  5LY1 A;  1UY0 A;  3S5A A;  2ARA A;  4CSW A;  3PUS A;  2DFC A;  4LHK A;  4YVW C;  1ZA4 A;  5GLU A;  3USS A;  3T2T A;  3WD5 A;  3LGR A;  4LT5 A;  1FMD 1;  1TG7 A;  5ANQ A;  4JDO A;  3KT1 A;  3M4F A;  2OVU A;  1FMD 2;  2DTY A;  4LOR A;  5T54 A;  1EYB A;  1OH3 A;  4CYD A;  3WUC A;  3C7F A;  4QKN A;  2J1U A;  2ATF A;  1H6X A;  2VBB A;  1LB2 A;  2G9G A;  4UXA A;  5A6X A;  2DUP A;  1MQT B;  2BFU L;  5A7O A;  3ZXK A;  1S0E A;  2RR1 3;  5AFB A;  4I0W B;  4NPR A;  1J1L A;  4UFI A;  1VMJ A;  1LOG A;  2PFW A;  2EIG A;  5GAL A;  4Y22 B;  5JSP A;  2JDZ A;  2P4E A;  5DUU A;  5GZF A;  2DCZ A;  1PO1 3;  3B01 A;  2Z5W A;  3MIG A;  5FK7 A;  1CGP A;  1G9A A;  3PUA A;  5GZE A;  3T2Q A;  4QHO A;  1SDD B;  3MYX A;  1AR6 1;  2ZEZ A;  4A41 A;  3RJ2 X;  1PNG A;  4ASM B;  1WZX A;  2XJT A;  3LZZ A;  3WNX A;  1OXC A;  1TZO A;  1W6P B;  4K21 A;  4NRO A;  2EXK A;  1GWM A;  4QU1 A;  1U5Y A;  1IPJ A;  4COW A;  1UWW A;  1DYP A;  5F6L B;  3I2K A;  2H6B A;  1RUI 3;  2D93 A;  3K4A A;  1G9C A;  2DUR A;  2VMI A;  4NWV A;  4YNI A;  5A1F A;  5IYY A;  3VKO A;  1GV9 A;  3MGU A;  1BMV 2;  1Z7S 3;  1UN1 A;  2VXJ A;  3ZFG B;  2GN7 A;  2W92 A;  1AXK A;  1H8T A;  1HXS 3;  1UZY A;  1VR3 A;  2JKX A;  1KEX A;  3AYE A;  2Y60 A;  1OFN A;  2DBN A;  2RM2 3;  2YU1 A;  3D3A A;  3KS7 A;  1Y7B A;  2HWD 1;  4JRA A;  4LHL A;  4CXW A;  4IXL A;  1ZRD A;  2B4K A;  1WWY A;  2VMC A;  2AGS A;  2HWD 2;  2Y6L A;  1UKG A;  5FQ0 B;  3VZM A;  3W59 A;  4COZ A;  5C33 A;  5GLW A;  1V6K A;  1AUY A;  1QJZ A;  5LA1 A;  4XFB A;  4JKL A;  5FAX A;  5FIX A;  4CCL A;  3THP A;  1DU3 D;  5EJ3 A;  3WVJ A;  2UY8 A;  3GZU C;  1C8M 1;  5C9A B;  1QJX 1;  3LIG A;  4XDP A;  5EHD A;  5F32 A;  1C8M 2;  2YGM A;  1QJX 2;  3ZSE A;  2JD4 A;  4Q4Y 1;  5H9R A;  4F8A A;  3ZXF A;  4CDX C;  1YLL A;  4Q4Y 2;  5KHK A;  2ENR A;  3OCP A;  3LA7 A;  1O8S A;  2O14 A;  1ULE A;  2Y0I A;  4F83 A;  1LGN A;  3WNK A;  3DPR B;  1UY1 A;  2JDN A;  1UZW A;  3W20 A;  4IE5 A;  2WZP P;  1HB4 A;  2CWM A;  4Z1V A;  3WCS A;  3QAC A;  2JEC A;  4YPJ A;  1EPW A;  4RHV 3;  5FY7 A;  1J58 A;  1AR8 1;  3WQ1 A;  1VMH A;  1HJF A;  3GF6 A;  5CFD C;  2DCY A;  4M01 A;  1W2T A;  3PIG A;  4XJ8 A;  1AR8 2;  4WM7 B;  1ZRC A;  4UW3 A;  2PHU A;  1CZT A;  3ZXE A;  1H9W A;  3K3O A;  3VDC A;  4L9B A;  1FT9 A;  3ZKY A;  2UWA A;  4ERO A;  5AVA A;  5JMC A;  3AMQ A;  3D5O A;  2F4P A;  1FOD 1;  3VBF C;  4CCC A;  1GIC A;  4NHL A;  4YGC A;  1FOD 2;  1RUG 3;  4E2G A;  1RVF 1;  1GZC A;  1ND3 C;  1E5I A;  5E6H A;  2PLV 3;  3WV6 A;  1RVF 2;  4HXC A;  4CA9 A;  1FNY A;  3V0A B;  2ZZQ A;  2KD7 A;  2G1M A;  3HQX A;  1UAI A;  4WVZ A;  1DQ1 A;  1GOF A;  1ZBA 3;  2WAA A;  4QPG C;  5D1I A;  5F2W A;  3LF7 A;  5FMO S;  2MNG A;  5BY5 A;  1COV 3;  4QKB A;  4XFI A;  4CP1 A;  3ZSL A;  1IPS A;  1VJ2 A;  4IDZ A;  4PJY A;  3NKG A;  3POW A;  1ODM A;  3JQW A;  2W68 A;  5T5O A;  3H0O A;  1SQ4 A;  4FPF A;  2EID A;  3AXD A;  1W8F A;  5FP3 A;  5K8S A;  4JV4 A;  1LHV A;  2WO3 A;  1EUT A;  2RDR A;  4ET7 A;  4Q5O A;  3O1U A;  3RFR A;  4O65 A;  4WBB A;  4M3C E;  4NOT A;  3RZG A;  4IUG A;  1BJQ A;  3ZYP A;  4FBF A;  4Q1R A;  3WIN E;  2AEY A;  4KH9 A;  5A70 A;  1R08 3;  5AVP A;  1EV1 3;  5K0U C;  4AVA A;  4R52 A;  2QQJ A;  5DAQ A;  2FHR A;  2EF6 A;  3PUI A;  5K7P A;  1YQC A;  2GC3 A;  3J8F 1;  4TTG A;  4XTM A;  3AZZ A;  5JLV A;  3J8F 2;  2RS1 1;  1WA6 X;  3M70 A;  1YQ8 A;  3SNM A;  1WCS A;  1H8T B;  3CMG A;  2RS1 2;  2VZP A;  5FYS A;  3VDA A;  2P17 A;  4XET A;  1RJ8 A;  1N1S A;  3W21 A;  1NE4 A;  2JG8 A;  3EB7 A;  1N1V A;  2D3R A;  2VJX A;  2R0H A;  3B9I A;  2ZAB A;  3WP6 A;  4QM8 A;  4YZ5 A;  5GZG A;  4MOA A;  5I0D A;  4CXY A;  4RS5 C;  2BBV A;  4D8M A;  4A7Y A;  5DUX A;  2RVA A;  4QPI A;  4FO9 A;  2E32 A;  4LK7 A;  4PI0 A;  4UWD A;  3ACF A;  1VAM A;  3IWZ A;  4FQZ A;  4GMP 0;  3T1L A;  4FTB A;  3PNA A;  2ZML A;  2YXS A;  4B4R A;  1JYC A;  1SBE A;  2ZS6 B;  2V4V A;  1QH7 A;  5GKA C;  4KL1 A;  4BDV B;  4CU8 A;  1IG0 A;  5F7U A;  4A3X A;  3EQE A;  2LRO A;  4UYB A;  1OT5 A;  1OQ1 A;  4MGT A;  4I0B A;  2D98 A;  5JXI A;  3I2F A;  4HPK A;  3BOW A;  4HKL A;  4GH4 B;  3ETQ A;  5JSO A;  4OVE A;  2EIC A;  1VRH 1;  2WAB A;  4QHB A;  4WVW A;  5L36 A;  5FXX A;  1NLS A;  1XU1 A;  4XZU G;  1VRH 2;  2ZGU A;  5IVJ A;  2ET7 A;  2GAL A;  4EWD A;  4LBK A;  1D0H A;  1EAH 2;  2KA3 A;  4DFS A;  2P1B A;  4LLO A;  4IE4 A;  2WA4 A;  2IZW A;  5FK8 A;  2AR6 A;  5FZ1 A;  4BYY A;  1HV0 A;  2HWC 3;  4Y24 A;  4AYU A;  5DAV A;  5KHJ A;  1F9K A;  2PN5 A;  4EYU A;  1CQ9 A;  3MIF A;  2W95 A;  4QKD A;  5F5A A;  4LEJ A;  2UUR A;  4LE4 A;  3BPZ A;  3LD8 A;  1LED A;  4CCN A;  3ILR A;  1QHD A;  1ULG A;  4FOV A;  3MV0 1;  5BV6 A;  1W8U A;  4LE3 A;  1OA4 A;  3LEK A;  4Y20 A;  2ZCW A;  5G04 L;  1IQD C;  1RUH 3;  2PHX A;  2FBE A;  4YLZ A;  2R04 3;  1LGC A;  2IXL A;  1NUK A;  2ZJC A;  4P9L A;  3QCW A;  1RXF A;  1YFX A;  5C7G A;  4N7I A;  3H42 B;  4FT8 A;  1UOG A;  2GNB A;  5DZG A;  5HCB A;  5IK5 A;  5E16 A;  3RZL A;  4WZF A;  2W1S A;  5ISL A;  1AX0 A;  2WSV A;  5FP7 A;  3BTY A;  4QX3 A;  1RGS A;  2Q0A A;  3OUI A;  5APA A;  1SCR A;  2ORZ A;  2BWC A;  4DUX A;  3AJZ A;  5JR2 A;  4NPL A;  3LAG A;  2JB4 A;  4BU2 A;  3ZN5 A;  4DRR A;  1O3T A;  1GP6 A;  1RTV A;  1VE0 A;  2GZW A;  3SH4 A;  2X29 A;  1N3O A;  4R8H A;  5TSW A;  3WHT A;  4N8M A;  3ZFG C;  1VBB 1;  1CES A;  2D3S A;  1DBN A;  1UY3 A;  1NE6 A;  4LO8 A;  1VBB 2;  2WBK A;  3U0Z A;  4PCR A;  5K9Y A;  1W3X A;  3N4M A;  1F5J A;  5ACA 1;  3OBR A;  4QXK A;  1H2K A;  1LTE A;  1PIV 3;  2WYF A;  3J7H A;  3MPB A;  4BMB A;  5ACA 2;  2JXA A;  4R9D A;  2J22 A;  4Y1X A;  2IXC A;  3WF3 A;  2QQM A;  4E4S A;  3JBG 1;  3AZV A;  3AMM A;  4CP9 A;  3JBG 2;  2QQP A;  2B8M A;  3PTY A;  4Q4V 1;  2EVX A;  5IK4 A;  4Q4V 2;  1XB9 A;  3ACL A;  3HT2 A;  3IAP A;  3T0B A;  4HKO A;  2GH8 A;  2JG8 B;  2JDP A;  4XAC A;  4B3N A;  4OI2 A;  1W3V A;  2XJR A;  3CF6 E;  4GMP 3;  3DPR C;  2OQ6 A;  5JMO A;  1BVV A;  1QNW A;  2A70 A;  5DG2 A;  3ZFF A;  5JI9 A;  1GKB A;  2VXR A;  1LEM A;  1AR7 2;  1S0B A;  1S55 A;  4IV3 C;  1L7R A;  5SV5 A;  3I2I A;  4I3P A;  2BVV A;  2JE8 A;  3LEM A;  2P3K A;  4V2V A;  3RVH A;  1H8V A;  2VUC A;  4ZZ8 A;  5GLV A;  4I09 A;  2YRO A;  4K20 A;  4I30 A;  1MS3 A;  3GJA A;  3C2U A;  3MW4 A;  2Y6G A;  1POV 1;  4QWN A;  1U0A A;  1TVG A;  1OLM A;  1T6B X;  4KBB A;  4Y4R A;  1T6G C;  3C7G A;  4AAP A;  1NXD 1;  1N1T A;  3BAL A;  5FPL A;  5A3T A;  1AF9 A;  1JOP A;  5FLI A;  2VGD A;  2YBS A;  1OD5 A;  4DO0 A;  3TRS B;  4HPK B;  5CU1 A;  5L7O A;  4Q4W 3;  3CL1 A;  5DQ0 A;  4XFC A;  3UGG A;  3LDK A;  4LHS A;  5CB7 A;  1JYX A;  2YFZ A;  1QJU 3;  4S2D A;  3KT4 A;  1AL0 G;  3KGZ A;  5FUI A;  1WCU A;  3ENR A;  3H50 A;  5GLT A;  2K0G A;  2VU9 A;  1ULO A;  1NLR A;  3OBZ A;  3AC0 A;  2R07 3;  3ZSJ A;  3VKF C;  2VBP A;  4LBQ A;  5C3R A;  4ES8 A;  4ATF A;  2IFR A;  2C1F A;  2OXB A;  1CON A;  4D7S A;  4Y5T A;  3MLK A;  4XEZ A;  3AMH A;  4QX0 A;  4NRQ A;  1JS9 A;  4HSJ A;  3WNN A;  4HOO A;  4AFM A;  1TMF 2;  2GNM A;  3HN3 A;  2HEW F;  1EY2 A;  1I9R A;  3N7J A;  4GWI A;  4Y20 B;  1M4W A;  4QAW A;  4YWA A;  5I8T A;  1QGL A;  1VMF A;  4AOC A;  2V72 A;  5AC9 3;  3ECQ A;  1W6Q A;  3QOP A;  1IS3 A;  1ULF A;  2O8O A;  1QH6 A;  4HN1 A;  1O7F A;  1U5Z A;  2P2K A;  2VCC A;  3TNQ A;  2NM1 A;  3ALQ A;  4Q4X 2;  5D21 A;  5I91 A;  1WA4 A;  1CAV B;  4IER A;  2IVI B;  2Y33 A;  4DS0 A;  2B42 B;  4XZP A;  4BHP A;  3VLB B;  4QXB A;  2VO5 A;  2I2S A;  1GZW A;  3EBR A;  4DUW A;  1LR5 A;  3H8X A;  1I5Z A;  4BK4 A;  2WS9 1;  2NQY A;  3ON7 A;  5F5Q A;  4W4Z A;  4COV A;  1UYX A;  5DZE A;  1H8T C;  1BBT 1;  2WS9 2;  2YBK A;  3E97 A;  1EAH 3;  1VBC 1;  2HWF 1;  4RFT 0;  4V1P A;  5EPA A;  1BBT 2;  2D97 A;  4LOT A;  4OMC A;  1VBC 2;  2HWF 2;  3S0M A;  1OKO A;  1AR9 3;  3NRU A;  3G7D A;  1QNY A;  2VNR A;  1Q8V A;  4CP0 A;  1A8M A;  3HN1 A;  3S30 A;  5A7W A;  3RSJ A;  2VZT A;  3H1W A;  1JXN A;  3C8X A;  1IGO A;  1J3Q A;  1UU5 A;  2RMU 1;  2XR4 A;  4AI2 A;  3E6C C;  1RUJ 1;  1JZ2 A;  4CP9 B;  1ND3 A;  2RMU 2;  2VBD A;  3RZH A;  1RUJ 2;  3FE5 A;  5M0T A;  4XJZ A;  5FYC A;  4AED A;  2WRA A;  1BZW A;  3C3V A;  4AI9 A;  5DUW A;  3OY8 B;  3OUJ A;  4K3U A;  2IC1 A;  4AVC A;  1NAE A;  2D7F A;  1FI2 A;  3H8U A;  4GA9 A;  4KWL A;  4PLM A;  1YYN A;  4QPG A;  1J3P A;  3AYA A;  3O0X A;  3KD4 A;  2CYF A;  3T08 A;  3UL2 A;  2MPF A;  4GH4 C;  3ZFF B;  3OPT A;  2LM3 A;  4XC9 A;  1RUF 1;  4UW5 A;  4RQP C;  1I1E A;  1MS9 A;  4MO3 M;  4KU7 A;  4YGE A;  2ZX1 A;  4XUN A;  3VL9 A;  4GWN A;  5E1R A;  1RUE 3;  1NCQ A;  2CTV A;  4LBM A;  4URT A;  3GZA A;  4F7Z A;  1DP0 A;  3H7J A;  4AHY A;  1JYI A;  2XQX A;  4LA2 A;  3WY6 A;  3PVO A;  3S6P A;  1HJG A;  1MVE A;  2PAM A;  3T3Y A;  4NHX A;  3ITQ A;  5CKM A;  3IKW A;  3T30 A;  4IEZ A;  1BVP 1;  2JD9 A;  4DZG A;  3SC7 X;  1WBL A;  3OYW A;  2DYC A;  2I07 B;  1KFU L;  2QJV A;  1VBA 1;  2RG4 A;  2RS3 1;  4QX5 A;  4NRP A;  4XAE A;  5HXV A;  3MLL A;  4AWD A;  2RJ2 A;  1VBA 2;  1IS6 A;  2RS3 2;  4XIK A;  5C4W B;  5L7O B;  2K2S A;  5JI7 A;  1HB1 A;  2BPA 2;  4Y26 A;  3A21 A;  5FRA A;  3R0R A;  2Y34 A;  5K0U A;  1D4M 1;  1NXM A;  4NVP A;  2ZHL A;  2B5H A;  1RIN A;  3VBH A;  4AVS A;  4Z2W A;  4AVV A;  1H2N A;  2V09 A;  4QPY A;  4ZU4 A;  4RSU A;  5JSR A;  3GZT B;  3UJO A;  4W6W A;  4DEQ A;  5E8A A;  1FPN 3;  1VBD 3;  2AUY A;  4YZ4 A;  4WZC A;  3WW1 A;  1VIW B;  5JXH A;  2HWE 3;  5FUP A;  4IGO A;  1W6N A;  1JN2 P;  5EWS A;  2QQI A;  4AF9 A;  1N3P A;  1V9U 1;  3H1M A;  2DVB A;  5LBC A;  2WQZ C;  1V9U 2;  2HYK A;  1TEI A;  3VN4 A;  2P6C A;  2PHF A;  2QQK A;  1PX4 A;  1SCS A;  3SIS A;  1W6Q B;  4QGN A;  5FCC A;  1BQP A;  4Q0Q A;  2ID4 A;  4ARX A;  3UNP A;  4GD4 A;  5E88 A;  3S7I A;  1TQ5 A;  1OPM A;  5J7M A;  1CAU A;  1H1M A;  4XFF A;  1YCI A;  3ME2 A;  2IVJ A;  5FY8 A;  3K75 B;  4JDN A;  1R1A 1;  1HN1 A;  2W91 A;  5T55 A;  2W47 A;  1J1T A;  4JGZ B;  4JGY A;  1R1A 2;  3AM2 A;  2GSY A;  2QVS B;  3I3D A;  1C57 A;  3RS6 A;  1OSG A;  3KVA A;  4LOS A;  5GJ6 A;  1GZW B;  5JPM B;  1VLN A;  1O59 A;  4DOU A;  4YFZ A;  2WNO A;  4GB3 1;  2V4A A;  1W04 A;  2ZGT A;  3AMP A;  4NO4 A;  2Z42 A;  4GB3 2;  4TLF A;  4W50 A;  1WKY A;  3R4U A;  4HK8 A;  4K1Z A;  5L9V A;  4KU8 A;  1O91 A;  4MG2 A;  2QBX A;  1ULP A;  4K8F A;  1S0I A;  2FCT A;  3PDQ A;  4WVV A;  2N7G A;  4JHZ A;  2EAL A;  2OKX A;  4D7Y A;  2VNO A;  2VAU A;  2XG3 A;  4MGK E;  5IK8 A;  2IXH A;  1DZQ A;  4PHZ A;  1ZBE 1;  3D6E A;  5KHH A;  5A7W B;  2HBU A;  2XJU A;  3AZW A;  4LUL A;  4B4Q A;  3NO8 A;  1ZBE 2;  3WNP A;  2GU9 A;  2PQS A;  2EA7 A;  1DGR N;  2JIJ A;  3Q8B A;  1BLZ A;  3PUH A;  3P3N A;  4LKF A;  1Z7S 1;  4X6R B;  5EZW A;  2QKD A;  3HAG A;  5LBF A;  3ZXJ A;  4EWA A;  1HXS 1;  3IDC B;  1WUV A;  1OI6 A;  4AED B;  3IT8 A;  1Y9M A;  2WNE A;  1BYH A;  2MEV 3;  1G9D A;  1ZM1 A;  1W8O A;  4QPG B;  4YGD A;  3M3O A;  1K42 A;  2JDU A;  4CCK A;  1QOS A;  1VBE 1;  2J1R A;  4OHZ A;  4Q4X 3;  1REE A;  3GXU A;  4OHV A;  1WLW A;  1VBE 2;  1XPW A;  3BUC A;  2XDV A;  4FQ4 A;  3I2H A;  1OQD A;  1WLT A;  1YQ6 A;  1NCQ B;  1SLT A;  2VM9 A;  1W2U A;  1XNC A;  4PBO A;  4A45 A;  4ASK A;  3U11 A;  1VAL A;  1GOH A;  2C0Z A;  2LW8 A;  5F37 A;  1GBG A;  3ZFG A;  2HJI A;  2YV8 A;  4Y33 A;  1VB2 A;  3O1O A;  1DGW A;  1V00 A;  2HWB 1;  3IB3 A;  3HNM A;  3OF1 A;  1Y43 B;  3OYW B;  1NYW A;  2HWB 2;  4YFW A;  3RWN A;  5FQ0 A;  1XNB A;  4YVS C;  3NKT A;  3N3H A;  5FR3 A;  5I0T A;  3I8T A;  4FPY A;  1BEV 1;  2UU8 A;  4RHV 1;  4AQS A;  1F31 A;  3AL6 A;  3R4D B;  5K0U B;  4Y5S A;  1BEV 2;  4FXG B;  4GKX A;  4QX7 A;  1JI6 A;  3VBH B;  5D2A A;  3AYD A;  1Q8Q A;  3SH5 A;  4XCB A;  4OUL A;  3M1H A;  1XXN A;  1C3H A;  4ZU7 A;  4P9Y A;  2BOI A;  1UF2 C;  2DVD A;  1HRI 1;  1JUI A;  4FCA A;  4YM1 A;  5B4X A;  4MHR A;  3SCF A;  4A42 A;  1AYM 3;  4XQ4 A;  3AP4 A;  1HRI 2;  2XJV A;  1V6I A;  1RUC 3;  2Y6F A;  4BQ4 A;  4LIU A;  2BFU S;  3RZK A;  2B9U A;  5A6Y A;  4IV3 A;  5KXB A;  2DVG A;  5DN2 A;  5ERL A;  3ZDV A;  1FAY A;  4U2A A;  2V73 A;  5DPN A;  2WWJ A;  2P6H A;  5BNN A;  2FMY A;  1JZ6 A;  3PVE A;  3VBR A;  4E4H A;  5LEJ A;  4K40 A;  2JWP A;  5C5U A;  2ZGL A;  5FYZ A;  4FAH A;  1V6M A;  4YW4 A;  1RXG A;  1CAU B;  4BLJ A;  2ARC A;  4PBP A;  1SAC A;  4PI2 A;  2NPI A;  1W90 A;  2VZ1 A;  4LHN A;  4JGY B;  3NV1 A;  2X8K A;  2YZ4 A;  3U14 A;  3DN7 A;  4K6B A;  5JXG A;  4JQR A;  3VZL A;  3I2J A;  4LO5 B;  4H7M A;  4Q0P A;  4CEY C;  4YG6 A;  4GKY A;  1WD4 A;  1XYO A;  1LUL A;  4FOQ A;  3V0A A;  2CGP A;  1WMX A;  1G9F A;  3AZY A;  3LDB A;  1X50 A;  4IEO A;  2RV9 A;  4JVA A;  1N3Q A;  4QT6 A;  4QXH A;  3FX3 A;  4C91 A;  4ITC A;  1SLC A;  1GNZ A;  1FX5 A;  3KQR A;  3ZFF C;  1WMF A;  2AC1 A;  4PIY A;  2XML A;  3OSD A;  4FPL A;  1A6C A;  1PNF A;  3ZLI A;  4XJU A;  3ACI A;  1W2N A;  2JEM A;  3IN9 A;  5FJH A;  4P5H A;  3ZFE B;  1CAW B;  5F1R A;  5C3S A;  3U4S A;  3VKN A;  4Y1U A;  5FMD A;  4H55 A;  5F5I A;  3ILN A;  3HQR A;  1KXG A;  1NY7 1;  4D3W A;  4P9J A;  1F2N A;  2CY6 A;  1NY7 2;  4C90 A;  3E6D A;  3RZM A;  4L8Q A;  1AR6 2;  2CU5 A;  4PF1 A;  2Q8E A;  3MIH A;  4KGG A;  2HYX A;  2ZGN A;  4XFG A;  2ZKN A;  2QFE A;  3VZJ A;  4E27 A;  3WEZ A;  5C4W C;  3V0B A;  5L7O C;  4AGV A;  1POQ A;  1W2A X;  3R4S A;  4NR1 A;  3BOP A;  4RA0 A;  3AJY A;  1G7Y A;  3WW3 A;  4A7Z A;  1ZA7 A;  3ZYB A;  3VHP A;  1W9Y A;  4XF9 A;  1LHU A;  3NWK A;  3RMY A;  1REF A;  2WAO A;  3IPV A;  1U5I A;  3MF9 A;  4P08 A;  5DAW A;  3WCR A;  4FAG A;  5DMY A;  3BIE A;  1DYO A;  2XLF A;  2Q8O A;  4AFC A;  2YC4 A;  1AX2 A;  1T2X A;  3D0S A;  2WLQ A;  1UXZ A;  5L9B A;  1IZ3 A;  4JTN A;  4AEM A;  1MPX A;  4AK3 A;  1HB3 A;  3AFK A;  4I0A A;  3WG2 A;  2WT2 A;  2JEN A;  1PK6 A;  3AZX A;  1LOC A;  4IE6 A;  3VUO A;  1QJY 1;  2EIB A;  1ONA A;  1RMU 3;  1V6L A;  3JCI A;  1XE8 A;  3CEW A;  1QJY 2;  1SLI A;  2R1D A;  3D4K A;  3MI8 A;  3OD0 A;  1NCR A;  3RRD A;  5FBJ A;  5A6Z A;  1F5F A;  2RDS A;  2J1S A;  3ZXA C;  5FY4 A;  3O14 A;  3LOB A;  3RWK X;  2JJ6 A;  1ZVF A;  4G4F A;  5E89 A;  4JGZ C;  1NX9 A;  1DCS A;  1JW6 A;  1XYN A;  2FMD A;  3CO2 A;  3FBY A;  4OFG A;  4GH4 A;  1JOB A;  2D6L X;  4LLF A;  1MS8 A;  4CU6 A;  5J09 A;  4KG8 A;  4M00 A;  4IV3 B;  1KS4 A;  2PYT A;  4QDQ A;  4RQP A;  2PMW B;  4Z82 A;  4UBG A;  3I7D A;  3O7O A;  3WQ7 A;  4OHY A;  4FOY A;  3AVR A;  3CDZ B;  3VBR B;  1ZRF A;  2XL7 A;  2RJL A;  3AFG A;  4UFH A;  1HRV 3;  1FAT A;  2DV9 A;  5CEH A;  2G4I A;  4Q1P A;  4UBH A;  3TEZ A;  3GHN A;  3G6J B;  3GCX A;  4M3C A;  3THT A;  4BJ0 A;  3N9L A;  2ZXQ A;  1RHI 3;  3NAP C;  2Q8C A;  4E4Z A;  2DDU A;  1MEC 1;  3FMG A;  1UOJ A;  4AR2 A;  1DIW A;  1MEC 2;  4D94 A;  2VZO A;  4LO4 B;  3WQ0 A;  1LGB A;  4FFH A;  4EN7 B;  2DVA A;  3KWV A;  4NAM A;  4PDW A;  4QU2 A;  1AJK A;  3RDI A;  4AED C;  2Q1M A;  2X10 A;  2WSU A;  4JCK A;  5A32 B;  3OGS A;  3TN9 1;  1KDK A;  3DCQ A;  4AI0 A;  4H3W A;  2VOW A;  4FPC A;  1PIV 1;  2BVB A;  3WP4 A;  3MID A;  3TN9 2;  1AL2 1;  4XJA A;  2FDI A;  3WP3 A;  3WF2 A;  1PVC 3;  3ZMO A;  1AL2 2;  5LAS A;  2RS5 3;  4XF3 A;  1OHF A;  1SLB A;  1YFW A;  4OQ9 A;  4PQ9 A;  2KXL A;  2C26 A;  2XLG A;  1RL3 A;  1IKP A;  1NCQ C;  2CNA A;  4QKF A;  2ZEW A;  3IBM A;  3KV4 A;  2B9V A;  2EXI A;  2XJQ A;  3CJI C;  3H1Y A;  4AFD A;  1W6O A;  4N43 A;  2LTN A;  3NQH A;  3WW4 A;  1X9T A;  5IFP A;  2VW1 A;  1TNR A;  3C7H A;  3PUR A;  4AL9 A;  4PT6 A;  3MO4 A;  2FZ2 A;  4IE7 A;  3LIH A;  3POJ A;  3V0B B;  1HX6 A;  3AKP A;  3GYD A;  5FPA A;  1ASJ 1;  1JHN A;  5BNP A;  1W28 A;  2YFU A;  3VHR A;  1C4R A;  4CDU B;  5BUV A;  1PZ8 A;  1ASJ 2;  2JDA A;  3NV4 A;  4C8D A;  5IWF A;  3VBH C;  5JWP A;  2YB7 A;  4XAA A;  1HN0 A;  4FPH A;  5T50 A;  1Q8S A;  3I3E A;  1Q8P A;  2XB6 C;  3IPV B;  3VBU B;  4EN6 B;  1C1F A;  1PZ9 A;  4B7K A;  3KGL A;  4QX2 A;  1FMD 3;  1GQP A;  2BTV C;  3LPG A;  3M2M A;  1IHM A;  1LKN A;  3B69 A;  4D6R A;  2W1W A;  3MUY 1;  1UZ0 A;  2FQP A;  2XKO A;  3TNP B;  1CWP A;  1GUI A;  2ZX0 A;  5FMB A;  1O3R A;  4IEY A;  1W8T A;  4HVR A;  5FZA A;  1KQR A;  1MS0 A;  5DAB A;  1GQH A;  1OLR A;  4Q26 A;  4YM0 A;  4CVU A;  4LBO A;  1PK6 B;  1O5U A;  3ACH A;  3CBN A;  3H7Y A;  2W39 A;  3K46 A;  3FBM A;  5FOB B;  1PMJ X;  4OUS A;  5IW0 A;  3W5N A;  5KXE A;  2VTX J;  1UD1 A;  2CDO A;  4LBQ D;  4OI1 A;  1UPI A;  5LK7 B;  2WQ4 A;  3FFZ A;  3J7N A;  3MDP A;  4LK6 A;  3UES A;  4E2Q A;  1QQP 1;  1NCR B;  2R06 1;  1RUD 1;  1QQP 2;  4MGZ E;  2R06 2;  1A3K A;  2RJK A;  1RUD 2;  5IVC A;  2GME A;  2D5F A;  2GMM A;  1RJ7 A;  4OI4 A;  2VPV A;  4JGY C;  3PLQ A;  4UFK A;  4CPB D;  2FDF A;  4O61 A;  3LCP A;  1LRH A;  1Z78 A;  1CR7 A;  3A23 A;  4ES9 A;  5JOY A;  3O1M A;  1W8W A;  4OZO A;  4RQP B;  4CE8 A;  2D6M A;  4QHZ A;  5FZC A;  2WT0 A;  5J96 B;  3N36 A;  2DBI A;  4IEV A;  1KIT A;  3PVB B;  1GU3 A;  1PGL 1;  4CEW A;  3T4V A;  3WSO A;  5LA0 A;  4M3C B;  3MV1 1;  3A0K A;  4NE9 A;  1SHW B;  1UZZ A;  3ZFE C;  1S0D A;  5BNQ A;  4H7L A;  2W46 A;  3QD6 A;  2GP5 A;  2HWD 3;  4YVS A;  3CQO A;  2QE3 A;  3OBT A;  3QBQ A;  2WQ8 A;  3K2O A;  5IVY A;  1QU0 A;  2GMP A;  2G9F A;  2DUQ A;  3I97 A;  4M0N A;  4PDW B;  5DDJ 1;  3KT7 A;  1RB8 G;  4X6Q B;  2P34 A;  5DDJ 2;  2LAL A;  3B94 A;  2DWR A;  1H9P A;  1C8M 3;  3ZX7 A;  2ZHK A;  1QJX 3;  4IEQ A;  2YDE A;  2VTX A;  1LOF C;  1G86 A;  2BWA A;  3AKR A;  3WDW A;  2J42 A;  4Q4Y 3;  1CZV A;  4LXL A;  2WFF 1;  3WF4 A;  1QXJ A;  2VVE A;  1CAV A;  1OFS A;  4LKD A;  3UKV A;  5ABJ A;  2WNV A;  3MZH A;  5FO9 B;  1N1Y A;  2WFF 2;  4JAA A;  5A7Q A;  3WNM A;  5BYN A;  3CLP A;  1C5I A;  4FPO B;  3WDY A;  4W8J A;  1TME 1;  2Y6J A;  5KC6 A;  4KWJ A;  4ZPI A;  1DQ5 A;  2YC0 A;  3GDB A;  1TME 2;  1W6O B;  4MXV A;  2ARE A;  4L99 A;  2DTW A;  4N43 B;  2BRT A;  2XXZ A;  2WZ8 A;  2D40 A;  1AR8 3;  3KHB A;  4LO7 A;  1X36 A;  2YU2 A;  1W9F A;  3MW2 A;  3J26 N;  4DMI A;  2H0V A;  4LJH A;  1F4A A;  4XBQ A;  4Q2F A;  5BNP B;  2ZX2 A;  4QGL A;  2QZ3 A;  3HNB M;  2BV4 A;  1QXR A;  3IMN A;  3VDB A;  3WG4 A;  1FOD 3;  4CEY A;  4AXO A;  1JUH A;  2WFP A;  2WZR 1;  1SEF A;  2H6C A;  2UYB A;  2XWJ B;  4BPZ A;  1RVF 3;  5KHG A;  1J59 A;  1SPP A;  1JZ4 A;  2WZR 2;  2DCJ A;  3AB0 A;  3OY8 A;  3RYP A;  4JKK A;  1NT0 A;  1U5X A;  4OCT A;  4GAL A; 
#chains in the Genus database with same CATH homology
 2L9L A;  5LCW L;  2J1T A;  3A21 A;  4DXS A;  2VOT A;  1US3 A;  1W9S A;  1UMH A;  1YQ2 A;  3THD A;  4ZXE A;  4P5Y A;  1XC6 A;  3I2G A;  3SKV A;  1UY0 A;  4DEQ A;  1W99 A;  4QB1 A;  5JXH A;  2QQI A;  1TG7 A;  4JKM A;  1JYN A;  3FHA A;  3C7F A;  2J1U A;  1JZ8 A;  1H6X A;  2QQK A;  3LEI A;  1PX4 A;  4KMQ A;  4MGS A;  4ARX A;  2ID4 A;  3UNP A;  2E33 A;  2W94 A;  3EYP A;  3OBA A;  1W0N A;  3III A;  3K75 B;  4A44 A;  1R64 A;  1HN1 A;  2J1E A;  2W91 A;  2W47 A;  4CUC A;  2J1V A;  3I3D A;  3T2Q A;  1O59 A;  1SDD B;  3VD5 A;  2VMD A;  2ZEZ A;  2ZEX A;  4A41 A;  4DXR A;  3WNL A;  4CU9 A;  4QB2 A;  4W50 A;  1WKY A;  5LA2 A;  2QBX A;  1ULP A;  3CZU A;  5EJ1 B;  4XUR A;  3SEE A;  5JUV A;  4JHZ A;  1OH4 A;  2OKX A;  1UWW A;  4ZZ5 A;  5C71 A;  3I2K A;  5HPO A;  3K4A A;  1UXX X;  3DYP A;  3WNP A;  5IYY A;  1UX7 A;  2PQS A;  3JXS A;  3PUH A;  1UYY A;  3VD3 A;  1W8N A;  3OEB A;  2W92 A;  4QDR A;  2JKX A;  1SG3 A;  1KEX A;  3D3A A;  4TXW A;  4UI9 L;  2E26 A;  2B4K A;  2VMC A;  2Y6L A;  1W8O A;  3SEP A;  1NKG A;  5LA1 A;  3P6B A;  4LQR A;  1K42 A;  4JKL A;  3VD7 A;  2J1R A;  3GXU A;  1XPW A;  2QQO A;  3LQC A;  2X05 A;  2HLE A;  3I2H A;  3BGA A;  2VM9 A;  1O8S A;  4A45 A;  1GOH A;  3BN6 A;  4CU7 A;  2LW8 A;  4M4R A;  2LS6 A;  1W9T A;  3WNK A;  2WZE A;  3IB3 A;  1UY1 A;  3HNM A;  3LE0 A;  3ZM8 A;  1XNT A;  5IJR A;  3OEA A;  4YPJ A;  4HG6 B;  4QPW A;  1O8P A;  1JI6 A;  1GOG A;  1CZT A;  4BXS V;  2YC2 A;  3VDC A;  3WF1 A;  5A1A A;  5B4X A;  4A42 A;  2XHN A;  1LNS A;  1JU4 A;  2J1A A;  4KI5 M;  3OGR A;  4XUQ A;  2KD7 A;  5DN2 A;  1GOF A;  5DPN A;  2WAA A;  3C7O A;  1JZ6 A;  2V5D A;  1PX3 A;  2W1Q A;  3WQB A;  2VZ1 A;  4AG4 A;  2EID A;  2WN3 A;  5JXG A;  3I2J A;  5CZK A;  2WO3 A;  1EUT A;  4ET7 A;  4DXT A;  4E8D A;  3OB8 A;  2RV9 A;  4IUG A;  2BER A;  4XVH A;  1UYZ A;  2C4X A;  4DEV A;  3C7E A;  2ORX A;  3MUZ 1;  2QQJ A;  3ACI A;  3PUI A;  1J83 A;  2DCK A;  2QQL A;  4LPL A;  2C9K A;  4TTG A;  4XUT A;  4KWU A;  3CMG A;  4QX1 A;  3VDA A;  2VZP A;  3FHQ A;  2VC9 A;  5IHR A;  3A7Q A;  3EB7 A;  2VJX A;  2Y6H A;  3CKH A;  5I0D A;  4MOA A;  2VME A;  2W3J A;  4D8M A;  4PF1 A;  2RVA A;  2HYX A;  2E32 A;  2VQU A;  3ACF A;  2WN2 A;  2WUH A;  3WEZ A;  3DYM A;  2V4V A;  3LEG A;  2Y64 A;  5B4N A;  4P00 B;  4BDV B;  1KGY A;  4CU8 A;  2WAO A;  4P08 A;  5F7U A;  2VZQ A;  2VL4 A;  5DMY A;  3VD9 A;  1DYO A;  4BK5 A;  3T0D A;  2YC4 A;  1OT5 A;  3ABZ A;  1D7P M;  1T2X A;  5JXI A;  3I2F A;  1UXZ A;  3K77 A;  2EIC A;  1MPX A;  2WAB A;  1OD3 A;  4FI9 A;  4XZU G;  5EJZ B;  1JU3 A;  3T0A A;  2EIB A;  2Y8K A;  3THC A;  2VZR A;  2J1S A;  2W87 A;  1EUU A;  2W95 A;  4RN5 A;  1NX9 A;  3MV0 1;  4OUE A;  3LEK A;  4CU6 A;  1JHJ A;  3P1I A;  4LKS A;  1IQD C;  5G04 L;  4GWJ A;  3CZJ A;  4QDQ A;  5IFT A;  1NUK A;  5C7G A;  3CDZ B;  3NJX A;  2W1S A;  1DLC A;  4QX3 A;  3MBW A;  4BJ0 A;  2ZXQ A;  4DUX A;  2ORZ A;  3NNG A;  5JR2 A;  2VR4 A;  2DDU A;  2VZO A;  2VCA A;  3NJV A;  1UY3 A;  3OGV A;  3OG2 A;  2WBK A;  1GNY A;  2X10 A;  3T2P A;  3IAQ A;  2E31 A;  3OGS A;  1RYY A;  4P02 B;  3J7H A;  2VZS A;  2EIE A;  3E1F 1;  4D0Q A;  1BHG A;  2J22 A;  3WF2 A;  3WF3 A;  2QQM A;  4AAX A;  1JYV A;  3T0B A;  4MAD A;  1JYW A;  2YG0 A;  2C26 A;  1W9W A;  3K4D A;  4CUA A;  1GMM A;  2ZEW A;  2B9V A;  4MGQ A;  3IAP A;  4RYD A;  4ZY9 A;  3HEI A;  2VQT A;  1UY2 A;  1L7Q A;  3NQH A;  5IFP A;  3ETP A;  3C7H A;  3I3B A;  5JMO A;  1J84 A;  3UET A;  4PT6 A;  3T09 A;  3MO4 A;  1JZ3 A;  1L7R A;  3I2I A;  2QQN A;  4A4A A;  2VZ3 A;  2JE8 A;  2YFU A;  3DYO A;  4ZZ8 A;  2JDA A;  4XUO A;  3FL7 A;  2YB7 A;  2Y6G A;  3I3E A;  1TVG A;  2WYS A;  2VMF A;  2J7M A;  4UOJ A;  4QX2 A;  3C7G A;  5C70 A;  1GQP A;  1JZ5 A;  3LPG A;  5JXJ A;  3HNY M;  2W1W A;  3MUY 1;  1UZ0 A;  4CUB A;  1P8J A;  5DQ0 A;  3T2O A;  1US2 A;  1GUI A;  4LHS A;  4UAP A;  2WDB A;  1JYX A;  2W9X A;  2YFZ A;  4CVU A;  1UY4 A;  3ACH A;  3K46 A;  1ULO A;  1PMJ X;  3W5N A;  3AC0 A;  3DEC A;  2CDO A;  3GM8 A;  3UES A;  4L0P A;  5J1X A;  3W5M A;  3FN9 A;  1XNA A;  4QX0 A;  3WNN A;  3HN3 A;  2ZEY A;  2VTF A;  1CIY A;  4GWI A;  1K12 A;  4QAW A;  2WO1 A;  3A23 A;  4A3Z A;  4DUV A;  1I5P A;  4OZO A;  2V72 A;  4M4P A;  3ECQ A;  2VCB A;  2VCC A;  4E8C A;  4OMD A;  1K3I A;  2VZU A;  1GU3 A;  2Y6K A;  3WSO A;  5LA0 A;  4JX0 A;  1F4H A;  3MV1 1;  3A22 A;  2W5F A;  1SHW B;  1CX1 A;  3LPF A;  2X09 A;  5HXM A;  2VO5 A;  2BGP A;  3F2Z A;  3HOB A;  2W46 A;  4DUW A;  3CQO A;  2WQ8 A;  4BK4 A;  4W4Z A;  3I97 A;  4A6O A;  1UYX A;  2R7E B;  2XOM A;  3WF0 A;  4GZ9 A;  1OF4 A;  3IDA A;  4OMC A;  2BBA A;  3NRU A;  3U37 A;  1K45 A;  4Z2A A;  1H6Y A;  5CYY A;  1JZ7 A;  1CZV A;  2VZT A;  1PMH X;  5G05 L;  2WO2 A;  3C8X A;  3WF4 A;  1JZ2 A;  3WNM A;  2Z4F A;  4W8J A;  3VD4 A;  2Y6J A;  2VZV A;  3GDB A;  2BGO A;  1NAE A;  5FUI A;  2W1U A;  2WZ8 A;  3T08 A;  4XUP A;  4QB6 A;  3HJR A;  1CZS A;  4OYU A;  4MO3 M;  1F4A A;  1OF3 A;  4XUN A;  2CDP A;  3HPN A;  3HNB M;  1DP0 A;  3CIH A;  2XQX A;  3ACG A;  4ARY A;  3VDB A;  3SKJ E;  3GGL A;  3WNO A;  4QDS A;  2JD9 A;  1JZ4 A;  2BZD A;  4PQQ A;  2DCJ A;  1WCQ A;  4JKK A;  5EIY B;  2XON A;  3K4Z A;  2RJ2 A;  1UMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...