1M06G

Structural studies of bacteriophage alpha3 assembly, x-ray crystallography
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid Protein
publication title Structural Studies of Bacteriophage alpha3 Assembly
pubmed doi rcsb
source organism Enterobacteria phage alpha3
molecule tags Virus/dna
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1m06G00
4YVWA 1AR92 1VBD1 2X5IB 1VBE3 1MEC3 4CEWB 3DPRB 1ZBE1 4PDWB 5AC92 2HWF1 4RFT0 5BNNB 1PGW2 1AR81 2ZZQA 4IV1B 1RB8G 1EAH1 1SMVA 3S6PA 1AUYA 4WM8B 4CDWA 1QQP3 1RUF1 1BBT2 1RUG2 4RHV2 1R083 1FPN2 1H8TB 4Y5Z0 1QJZA 4Q4W2 3ZFGB 1AR91 1AR62 2RS32 4YVSC 1FOD3 1NA1C 5AC91 1ND3B 3VBSC 1IHMA 3JBG2 4CDUB 2WZR3 1PGW1 5BNOA 2FZ1A 4FTSA 1VBC2 4QPGB 4GMP3 1NCQB 4RS5C 3VBUA 3NAPB 1VRH3 1HRI2 1BBT1 1RUG1 5CFCC 1NA1A 1RUH3 4RHV1 1PGL2 1FPN1 4RQPC 1MQTA 4GH4C 4Q4W1 3ZFEB 1AR61 3JD73 2RS31 2WFF2 4FTBA 2HWB2 5A33B 3HAGA 1OOPB 1PO23 3JBG1 1COV3 2XPJA 3VBHB 4RS5A 1DDLA 4BCUA 1VBC1 5A32A 1BEV2 1ND2B 3VBSB 2MEV2 3VBOC 2Y26A 5J96B 4RQPA 2RM22 4RR3B 4Q4X3 5CFDB 1HRI1 3TN92 4CDXC 2WLPA 2RR12 2XBO3 1PGL1 2HWD2 2RS52 5K0UB 1R093 5BNPA 3VBFC 2R043 2WFF1 5GKAC 5ABJB 5L7OA 3ZFFB 5ACA3 1RUI3 1K5MC 2HWB1 1PVC2 1VBA3 4WM7A 4CEYA 4EJRA 1PO13 2ZTNA 2PLV3 2TBVA 4IV3B 1NY72 1RUC3 1Z7S2 2HWE2 1ZBA3 4QPIC 1FMD3 1BEV1 4CDXA 1AL22 2MEV1 5JZGB 1B35B 2RM21 1HRV2 1W39A 1AYM2 4Q4V3 4Q4Y3 4N53A 2DF7A 2IZWA 3TN91 2RR11 2ZAHA 4YVWC 2HWD1 2RS51 3CJIB 1TME2 3VBRC 3VBOB 1K5MA 2RMU3 1ZBE3 2BUKA 1F2NA 4JGZA 2HWF3 4QPIA 1PVC1 4GB33 1AR83 2BPA2 1E57A 1NY71 1Z7S1 2HWE1 4JGYC 5C9AB 1AL21 4CDWC 1HRV1 1RUF3 1AYM1 3VBRA 5D8AB 4CEWA 3DPRA 1AR93 1TME1 1NG0A 5AC93 5C8CB 1RVF3 4JGYA 4SBVA 1MEC2 4YVWB 1RUJ2 4IV1A 1ASJ2 5BNOC 4CDQB 1HXS3 2GSYA 1C8M2 3VBUC 3M8LA 2R072 2BFUL 2R062 1MQTC 4Q4W3 1QQP2 4FTEA 1AR63 1ND3A 1TMF2 1R082 1RUE2 4LLFA 3VDDA 1V9U3 5DDJ2 1MEC1 1OPOA 3JBG3 1RUJ1 1ASJ1 1PIV2 4QPGA 1HX6A 2VQ0A 3ZXAC 3J8F2 1NCQA 1VBC3 1VBB2 3NAPA 2WZR2 2RS12 1C8M1 1D4M2 4N43C 2R071 2BFUS 1AR72 2R061 5BNPC 1QQP1 5C4WC 1TMF1 1R081 1RUE1 5A33A 4YVSB 1OOPA 5L7OC 1NA1B 3VBHA 4WM7C 1C8NA 3JD72 5DDJ1 4CEYC 1PIV1 1ND2A 3J8F1 4N43A 4RR3A 1PO22 1BEV3 1VBB1 1COV2 2MEV3 2WZR1 2RS11 2RM23 1D4M1 1QJX2 4RS5B 1NCRC 4N53C 5C4WA 3TN93 1EV12 2RR13 2HWD3 1AR71 2RS53 5CFCB 4RQPB 4GH4B 2XBO2 4JGZC 4IV3A 3LOBA 1AL0G 1PVC3 3JD71 2R042 1RHI2 5BNPB 4Z92B 1HQNA 4FSJA 1Z7S3 5ACA2 5JZGA 1NCRA 1RMU3 1B35A 1PO21 1AL23 1COV1 4AEDC 1QJU2 4CEYB 1VBD3 1HRV3 1QJX1 2HWC2 1AYM3 1GFF2 2X5IC 1X36A 1EV11 1AYN2 4CDXB 1RUD2 3DPRC 4PDWC 4CEWC 1TME3 4Q4V2 4Q4Y2 1VAKA 1QJY2 2XBO1 2BBVA 3VBFB 5BNNC 1EAH3 2RMU2 4IV1C 2R041 1RHI1 4AEDA 1K5MB 5C9AA 1M06G 2WS92 5ACA1 4WM8C 2X5IA 4GB32 2PLV1 4QPIB 1QJU1 4PDWA 1NOVA 1H8TC 1R1A2 1ZBA1 2HWC1 5D8AA 3ZFGC 4Y4YA 1AYN1 5BNNA 1RUD1 1ND3C 1VBE2 4Q4V1 4Q4Y1 5C8CA 3VDDC 1QJY1 3VBRB 4CDUC 1A6CA 4WM8A 2RMU1 1RUJ3 1ASJ3 4CDQA 4QPGC 1RVF2 1NCQC 2WS91 1H8TA 1BBT3 1RUG3 3NAPC 3ZFGA 4RHV3 4JGYB 1FPN3 4GB31 1C8M3 3JB8A 1R1A1 2RS33 2R073 1HXS2 1CD3G 4CDWB 3ZFEC 1POV1 2R063 3IDEA 4CDUA 1VBE1 1FOD2 1TMF3 3JB4C 1RUE3 1OOPC 3VBHC 1VB2A 5DDJ3 2QQPA 1F8VA 1WCDJ 1ND2C 1PIV3 1RVF1 1V9U2 3J8F3 5LK7B 3VDDB 4RR3C 5BNOB 1HRI3 1VBB3 5CFDC 3ZFEA 2RS13 1D4M3 1VRH2 4NWWA 3VBUB 5K0UC 1RUH2 1BMV2 2WFF3 1HXS1 4NWVA 1AR73 2HWB3 1MQTB 4YVSA 5ABJC 1FOD1 3ZFFC 1POV0 3VBSA 4IV3C 5CFDA 5JZGC 1V9U1 1B35C 5FOJB 4GMP1 5K0UA 5A32B 4Q4X2 1QJX3 1VRH1 3CJIC 5ABJA 5CFCA 1RUH1 3ZFFA 1BMV1 5FMOL 4N43B 1EV13 4GH4A 1R092 3FBMA 5C4WB 2HWE3 1OHFA 1RUI2 1VBA2 1PO12 2PLV2 5L7OB 1RHI3 1RUC2 4WM7B 5C9AC 1ZBA2 1FMD2 1CJDA 3CJIA 3VBOA 1QJU3 4Q4X1 2WWSA 2HWC3 1RMU2 4GMP0 5D8AC 5FMOS 2GH8A 1VB4A 2FZ2A 1NCRB 4N53B 1VBD2 1AYN3 1RUD3 1R091 5C8CC 1ZBE2 3VBFA 1QJY3 2HWF2 1RUI1 1VBA1 4JGZB 1PO11 1X33A 4CDQC 1AR82 1RUC1 1EAH2 2WS93 1FMD1 1RUF2 5J98B 1R1A3 1RMU1 4AEDB 1POV3
chains in the Genus database with same CATH superfamily
5A3TA 2OIIA 2ZGLA 2QQMA 1C1FA 4Y1YA 3SEPA 2CDPA 1MEC3 4PDWB 4FFHA 2G1MA 2Q1ZB 5FYUA 4NPLA 2YB7A 2XVKA 4XIKA 1BK1A 1HV1A 4PJYA 2W87A 2X05A 4Z82A 1FNYA 2DTWA 1YI7A 1ULOA 2HBTA 3D5OA 3M3IA 1UMHA 3C8XA 1RB8G 3PURA 3URFA 5FY5A 5A1FA 1JXNA 1UZZA 2JKBA 5FCCA 3ZDVA 1JYXA 1AZDA 4OLLA 5C8WA 5LBEA 5HCBA 1RYYA 5BYNA 1XU2A 2ZKNA 1FPN2 1VRBA 2QQWA 1HLCA 2A6WA 1QJZA 2WNEA 4Q4W2 4C1XA 4N9HA 4JKKA 3ZX7A 2Y6LA 3AZVA 1GQGA 4YVSC 5IVYA 4XJUA 3POEA 4DS0A 5FZOB 3VBSC 3MDPA 5FZ3A 4B4RA 3M4FA 1DGWA 4J6GA 2ZHKA 1W06A 2BRTA 3OUJA 2WNOA 1MACA 3J7HA 4CDUB 1YQ8A 1HQLA 2YC4A 2ID4A 1OSGA 2WSUA 2FZ1A 4FTSA 4YNIA 1S2BA 2X29A 4J1XA 1XE8A 4KWUA 2O8QA 1FT9A 4K1YA 5TSWA 1GR3A 3VBUA 5C3QA 3NAPB 3U4XA 1SPPA 4F3JA 4DMIA 1PHMA 4CUGA 1NA1A 2W68A 3W21A 2DDUA 1PGL2 3KHBA 5EZWA 4YW3A 4NHXA 2XVGA 3T0AA 1UZWA 3PU8A 5KHIA 2IXKA 3ZFEB 1OBNA 2BTVC 4LBQD 2BBAA 3BALA 4FTBA 1POQA 2G4IA 1N3OA 2VW1A 1JZ6A 4XZPA 1W9FA 3LEGA 1OOPB 3JBG1 5JAXA 3VBHB 4CU9A 1STMA 3OEAA 4BCUA 4C90A 3S57A 5T5PA 4F7ZA 4QB6A 1W6PB 3AP7A 1BEV2 1ND2B 2CHHA 3U11A 3VBOC 1K42A 4Z2AA 1XYOA 3RVHA 4RQPA 4UOJA 4RR3B 3K4ZA 1PMIA 2D6PA 1ODMA 4CDXC 4NAMA 3C7OA 4BHPA 1O6UA 3LD8A 1NKGA 2HWD2 5K0UB 5A1AA 1JW6A 2J1VA 2PHFA 1OXCA 2WO7A 3FN9A 5BNPA 1JYNA 2C9KA 2D6NA 2WUHA 1CAUB 5FZ7A 2WFF1 4BQ2A 2ZX4A 5FMDA 1CPNA 3NL1A 5GKAC 3IMNA 4YW2A 4PT6A 2JDMA 4QX3A 1K5MC 3M3OA 4EJRA 4JDNA 2ZTNA 3HNBM 1W2TA 4BQ3A 4M4RA 4MOAA 1O3SA 4E4ZA 5FOBB 1CQ9A 5I0UA 3MF6A 2EXJA 4K21A 3S7IA 5CVRA 2WYFA 4DRVA 2MEV1 2Q1MA 2XDVA 3FJSA 1ZRCA 1B35B 4AQTA 2RM21 1SDWA 3UESA 3ZYFA 5FZIA 3EB7A 1WMXA 4IL7A 5ERLA 2XOMA 2WQ4A 5AVAA 5FPVA 1OA4A 3H9AA 2ZX3A 2K46A 5HXVA 2RS51 1H9WA 3I2FA 3TBDA 2R32A 3O0XA 5JOZA 4CA9A 4YM2A 1CAWA 3B9IA 1W8WA 4W4ZA 2Z2SB 5CB7A 2X10A 3LB9A 4FQZA 1PVC1 2YBPA 2Q8DA 1E5RA 4A6OA 1AR83 2Y33A 1TNRA 3OBZA 2ZX0A 4AFAA 4GWJA 3PTRB 3ZYHA 4A42A 1ZA7A 2Y0IA 1JODA 3WQ1A 1AL21 4ZU7A 1JZ3A 4FXKB 5F5AA 4CDWC 1L7LA 1RUF3 1AYM1 2CGOA 3OGRA 3VBRA 5IVVA 1VMJA 2WA3A 4W50A 5L9RA 3AYEA 3O0WA 4MGSA 2PTMA 3C7HA 4AL9A 3ZLIA 4GJZA 1V00A 1NLQA 3H42B 2W52A 3MICA 2IVIB 2ZEXA 4F83A 1JOPA 2YG0A 4Y1XA 4QX8A 3AMMA 1HN0A 5C8CB 1GOGA 5DG1A 1LECA 4JGYA 4AW7A 2QBXA 4R9AA 2D6KA 1NLSA 3P5BA 2JJ6A 3I4IA 1SLCA 4MSVA 1DQ5A 3JUUA 3R4UA 1MR5A 1H1MA 2D93A 5EQUA 4LBJA 4I01A 5I0SA 2RDNA 1OC1A 2CWMA 4ES9A 4CCLA 2BNOA 1YRZA 4AOCA 4HVQA 2XVLA 2ZAAA 2OZ6A 3GZUC 3MPPG 2BP6A 1U12A 2R062 1MQTC 1L7QA 4Q4W3 2OX0A 4OI4A 4FTEA 4UW3A 4UT5A 5FMCA 2ZGRA 2XLGA 2PAMA 3PMSA 4AZZA 4CRQA 4JKLA 1PVXA 2GC2A 5LA0A 3DUIA 1MEC1 2J7MA 2PHUA 1RUJ1 3ZSJA 1UY0A 1VP6A 3CF6E 2L9LA 1PK6C 3ZXAC 2WT2A 3J8F2 4AVBA 1NCQA 5IVFA 3W5MA 2VL4A 3SHRA 2QZ2A 4RFRB 3OUIA 1BHGA 4LE4A 1QNYA 5FZAA 4XUPA 1C8M1 1D4M2 1TVGA 5D2AA 4AQSA 1QJFA 2D40A 2DWRA 3V64A 4EWDA 1H1AA 2QJVA 4AHYA 4OVEA 3I7DA 4A4AA 1AR72 4E4SA 5IK8A 2XXZA 2OW4A 3RNSA 4A41A 3GJAA 4R4XA 1SPPB 5LBFA 2ERFA 5C3RA 3OGGA 3PDQA 1NA1B 2W08A 3LEIA 2B9VA 4JRLA 2YMZA 4PLOA 3LFIA 2ZMKA 4I30A 1PIV1 2ZHNA 2VNVA 3NW4A 4XBQA 4XFFA 5FY4A 4KWKA 3KT7A 5GZDA 3SEEA 1BEV3 1VBB1 4TN7A 5FZ0A 4A3XA 2FDKA 2JG9C 3DYPA 3VKOA 1ST8A 1N3PA 4Z8BA 2KR2A 2VZ3A 3K51A 4N53C 4XDOA 2VE1A 5C4WA 3E5QA 2W1QA 2UU8A 1BZWA 3G7DA 3KT1A 1EV12 3MUY1 5DZEA 2HWD3 2XJRA 3SH3A 4D6QA 5BY5A 1NQJA 5C7GA 5CFCB 5JR2A 1G9AA 2I45A 1CX1A 1MS4A 4RQPB 4XF3A 4NVPA 1OQEA 4S2GA 1D7PM 4YW7A 1QEXA 2DCJA 3RI8A 4IV3A 4PI0A 4JVAA 4P00B 3ENRA 4QB2A 1GOFA 3KLSA 3U10A 3D0JA 3KM5A 4COVA 5C5UA 2PQQA 5BNPB 3TEWA 1HQNA 4L92A 1WMDA 2Z5WA 5JZGA 1UKGA 1JYCA 3OBTA 2YHJA 3PVOA 1DQ1A 4L2NA 3HN1A 5FZ4A 1TE1B 2GAUA 4NR1A 5HI0A 1H9PA 3SMHA 1GOHA 2WBKA 1QJU2 1GBGA 3OYWA 4A45A 5B2GB 3L2HA 1QJX1 1LTEA 1HDKA 1WW7A 1GFF2 3O1PA 1DF0A 4S2HA 2OPKA 5FYBA 4IXLA 1OI6A 4I0AA 4OUEA 3NSTA 3OD0A 1AYN2 2F6BA 1LESA 4UAPA 1WGPA 2PHTA 2ZZJA 3IDAA 4Q4V2 4QAWA 3I49A 1NXD1 2CNAA 4QPWA 5JSPA 4CCDA 1JUIA 4KG0A 3WG3A 3CMGA 3ZMOA 2BYVE 3A7QA 5BNNC 1W6NB 5JPNB 4YFWA 3POIA 2RMU2 2OT7A 2JKXA 2A6YA 4IV1C 4JHZA 5FJKA 4MGIE 1XNAA 1RHI1 2B9UA 4FPKA 3UKVA 1M06G 4CPBD 4C0HA 2XKPA 3GDBA 4UBHA 2LALA 4WM8C 1TZOA 1YEWA 2PFWA 2X5IA 4TLFA 4XCAA 4XVHA 4FPOB 3WQ7A 5CG9A 2VMDA 3TNQA 1NOVA 1H8TC 2HWC1 3I2IA 3OBAA 5FWEA 3ZFGC 3I2DA 4OMDA 1LEMA 5A1LA 5CAZA 3L9JT 1YFYA 1AX2A 2DUOA 2VOXA 1G9FA 2ZGNA 3MIEA 1ND3C 1VBE2 3A0NA 4UF0A 4B4PA 5T5JA 3T1LA 1JZ7A 3T09A 3WP3A 1TQ5A 3RG0A 3VBRB 5T55A 3SQOA 3WDTA 4MX3A 5GLZA 1A6CA 2VUAA 1SACA 3AMQA 3HT1A 4IE5A 4RGKA 2VBDA 3AB0A 2WNVA 4JDOA 4QPGC 3INAA 3LA3A 2WS91 3WW2A 1RUG3 4RHV3 4LLOA 4JGYB 5SV5A 1YQ2A 2DYCA 1S0GA 4QGNA 4QQ2A 5FY9A 4AVTA 2VVEA 1JOBA 3DXTA 3ST7A 1HXS2 1CD3G 1OH4A 1UXXX 3N9PA 4J1WA 1XNCA 1IGOA 1XNTA 5A7SA 3WUDA 4CUCA 5CISA 3B7MA 2R063 3H1WA 1LRHA 4KH9A 5I8SA 3MLLA 4UFKA 3R6SA 1G9CA 4QB1A 3NVCA 3I59B 3AMNA 4LKFA 1IG0A 4LOSA 5L73A 5E88A 2W0XA 1HW5A 3B01A 5J36A 1WCSA 3PU3A 3WP4A 5FZFA 4JCKA 2J22A 5J09A 3ZN6B 4ZKTB 3AP4A 3J8F3 1F5JA 2IUWA 3HN3A 3FFZA 1PM4A 2VR4A 4K3UA 4H2AA 1D4M3 3N35A 2JE8A 5FP8A 3WY6A 5IVBA 1SHWB 4OI0A 3AXEA 4XQ4A 2GC0A 3JXSA 1I5ZA 1BMV2 4NWVA 2WO3A 2A71A 4GKXA 1AR73 5FQ0A 3AJYA 4IEQA 2HWB3 1YFUA 4YRDA 2YV8A 4YVSA 2X53S 3ZFFC 2J1EA 5IJRA 5KHGA 3D0SA 3VBSA 2EIDA 3CNAA 2D43A 4CEYA 3FLPA 4GIQA 4CZSA 4F8AA 2R1BA 4GULA 2IXLA 1CVNA 2DTYA 4XJ8A 4AGRA 4X6QB 4GWIA 3RZLA 1W6MA 3WG4A 5DAXA 1OLQA 2I2SA 2PYTA 1GP4A 1ZZBA 5FOJB 1NZIA 4GMP1 1LJ7A 5SV8A 5A32B 5FXWA 5DUWA 3HPNA 1Y9MA 1VRH1 5FLIA 5F5QA 3I3EA 2Y6FA 3QCWA 4JQRA 5ANNA 1RUH1 5E89A 1AJKA 1HKDA 5G05L 1EV13 2DBNA 4YW1A 3CJXA 2VC9A 2E63A 2V5DA 5FO7B 5FKCA 5F7UA 1W03A 4FPJA 5C3PA 4WBBA 2HWE3 2JICA 1YQ6A 3WD5A 5C4WB 4NHMA 1RUI2 1DGRA 2GZWA 2QE3A 2W39A 2YZ4A 2AEZA 4JX0A 3I2OA 4IESA 5L7OB 3POBA 3CIHA 5C9AC 4WM7B 2W3JA 5FUIA 3T2OA 4K40A 2J1AA 5D21A 5LASA 1V70A 4QQPA 1OLRA 2EA7A 3OPZA 4DB5A 3WNXA 1V6OA 1KDKA 3O5SA 3VBOA 1KITA 1A34A 4HZFA 4QPYA 1F35A 2OQ6A 1QJU3 3E6DA 3QACA 4GMP0 4MGKE 5D8AC 2VMFA 2E32A 5FMOS 1CWPA 4NIHA 2BGOA 2EIBA 3HBKA 1X9PA 3BGAA 1VBD2 1AYN3 4LMFA 3AP5A 2AEYA 1YXWA 3OYWB 4W6WA 1ZBE2 4ATEA 4BISA 1TNFA 2GP3A 3EQEA 1Q8VA 2ZJCA 2HWF2 2QQOA 4FPGA 3USUA 3VDAA 2GDFA 1V6NA 3ME2A 5KXEA 3AVSA 5CA6A 2E31A 4N8MA 1O8SA 1LENA 1RUC1 1AVBA 3SKVA 4QQHA 1O4YA 3RZGA 1BYHA 4CE8A 1FMD1 3DECA 2V5YA 5K7PA 1XPWA 3O1OA 2NLRA 4D7YA 1CX4A 4Q0SA 3AFKA 5IATA 2E9QA 2JDNA 3HJRA 3QH7A 4L0PA 4D0QA 1DZQA 4HANA 4KBZA 1CZSA 4LBLA 2KA3A 4ET7A 3BKZA 2WNUC 2X5IB 3MIDA 4FFIA 1VBE3 1J83A 2CSGA 2XLFA 4PHZA 5A7WB 4CEWB 3DPRB 3DKQA 5AC92 2NMNA 2QQLA 2EAKA 2P3IA 4FPHA 4INDA 1A78A 1ZYBA 2HH9A 3ITQA 5FK7A 2ILMA 4K6BA 2XHKA 4RFT0 4XETA 1H8VA 4IEOA 3VZJA 4UF0B 1W3XA 1XBFA 2V73A 2J1SA 3V56A 2QDRA 3AKSA 3SLIA 4BOWA 3GNEA 1MS8A 1GP6A 3LA7A 1FV2A 3K3OA 3WUCA 5ISLA 1W2UA 3CO2A 5JOYA 4CDWA 3JCIA 1BBT2 2Y6JA 1YJLA 2YBKA 2ADEA 2V4AA 2IXIA 2ZMNA 3CQOA 4WVMB 1AR91 3T3YA 4CCNA 4BA6A 3GALA 1BVP1 2RS32 4PBOA 3AP6A 5A6QA 1AR62 5CG8A 1F4AA 4HKOA 5EHDA 1A8DA 4O9EA 2VW2A 3LPGA 4L97A 3VL8A 2QQIA 4UI9L 1S0IA 2P6HA 2WZR3 1VMFA 1PGW1 4FO9A 5EFUA 1OT5A 3UL2A 1O59A 1RGSA 2VD7A 3IPVA 1ENSA 3WOGA 1DQ2A 1UY4A 3HWJA 4XF0A 4Y24A 4RS5C 4AVAA 2ADDA 2A5ZA 3N9QA 2H6BA 1URXA 4FPFA 2KXLA 4ZY9A 1XB9A 1QKQA 1HRI2 1RUG1 4RHV1 4TZDA 4EROA 1MQTA 4GH4C 4GA9A 4RN5A 2XJVA 3FMGA 1W9YA 1IKPA 1LOFA 2V09A 3JD73 3ACFA 2CTVA 2EICA 2AUYA 2PHLA 1H2MA 1ZRRA 3NNMA 2Q5TA 3WW1A 3WW4A 5A33B 1PO23 3TRSB 1COV3 2D44A 2QQUA 2XPJA 3A22A 3GZAA 1W3VA 1C5HA 2YPDA 3B9CA 4AGGA 4LITA 4M3CF 1PK6A 4CXXA 1PX4A 1B09A 3DKWA 3J7MA 1UPSA 1VBC1 1DZTA 4KWLA 3ZYBA 3E6CC 1H2LA 2FQPA 3VBSB 1RJ8A 1UZ0A 2Z42A 3U1XA 4XF4A 4IEXA 1X8MA 3VHNA 1G9BA 1W6MB 5FLHA 2WYSA 2O14A 1HV0A 2BWAA 4HOOA 3TN92 5B4NA 3I2JA 2RR12 1MPXA 5GM0A 1C57A 4P5HA 2JDHA 3LGRA 5A3NA 3DF0A 1XYPA 3N9MA 4EYUA 3VBFC 2FDJA 3ELNA 2P3KA 2R043 1OFSA 4UFMA 1ULCA 5IT6A 4BZ4A 3WNOA 3SITA 1O7FA 4YWAA 2YFUA 2Y60A 3WX5A 1RUI3 2R30A 5ACA3 2HWB1 3U0ZA 1V6MA 4COUA 1KJLA 4B1LA 2JWPA 3MBWA 2ZXQA 4LK6A 5K8SA 1Z7S2 1CJPA 2GNDA 4LBMA 4GALA 2CDOA 5GZGA 1JUHA 1ODNA 2E7AA 2VCMA 4MXWA 2ZGQA 3CZJA 4UFJA 3Q8FA 4OUMA 1JU4A 2JG9A 3SCFA 4Q1RA 5KC6A 1UL9A 1HRV2 2E53A 4IDZA 3KZ4C 4NIIA 4EN0A 4N53A 2IZWA 4NRQA 4UW5A 3O1UA 3ZSKA 4YVWC 1O91A 4E4HA 3S30A 1TME2 3O12A 3VBOB 5F1RA 5LY1A 1RTVA 1JTZX 4LO8A 1NQDA 4BIFA 4V2VA 4MH0E 1ZBE3 2GNMA 3N7KA 3WNLA 1JMUB 1Y4WA 1F2NA 4TTGA 1W9SA 5IUQA 2HWF3 1O3QA 3D3AA 4QPIA 3V0AB 1FI2A 1X50A 3DEMA 4R4ZA 1NY71 2HWE1 1CONA 2VQAA 1H2KA 1ZA4A 2VXRA 4DNYA 4GWNA 4OULA 4XUQA 3OOXA 4NJ4A 4OUSA 2Q8OA 3USUB 2P3YA 4O7XA 4BQWA 3PMEA 1GNYA 1QJEA 3ACGA 1OD5A 2B39A 1REDA 1H6XA 3OBRA 4AFBA 5H9RA 2ZBJA 2OZJA 2ZABA 3RYRA 1NG0A 4WVWA 1JYTA 5LA2A 3NV4A 5C3OA 2ZPXA 1LR5A 5AC93 3LSEA 4YW5A 1JZ4A 1K45A 1AXKA 1F4HA 5IVEA 1J58A 2XLAA 4IV1A 4MUVA 4AI8A 2XGXA 5F6LB 2ARXA 2WKKA 3T2TA 5BNOC 4CXYA 4CDQB 2XJQA 3TNPB 1ZX5A 3N36A 4IEVA 3OY8A 2YDEA 4CCMA 4CUBA 1X8EA 2D97A 2PHDA 4AAPA 4COZA 4LA3A 1JYVA 2BFUL 1V6JA 1QQP2 4LPLA 3K4AA 4I09A 1AR63 1ND3A 1TMF2 3EO6A 4M3CB 4NHYA 4QD2A 1R082 5T54A 2VJXA 4AQ6A 1JBCA 3AK0A 3KQ4B 4LLFA 3BCWA 3ZPYA 4COYA 4DO0A 5DZFA 4D3WA 2HBUA 4B8EA 3SKJE 1BJQA 1V9U3 5DDJ2 2QDNA 5K9YA 2DURA 2DVBA 1N1VA 5KWRA 2JDPA 1ASJ1 4KNCA 1SLBA 2P17A 4QPGA 1HX6A 4QX0A 2DVDA 5GLWA 4NIAA 4BQ4A 2VQ0A 3VZMA 1IS3A 1FXZA 1XOYA 2J42A 2VULA 3AFGA 1FYUA 4AEMA 1DGWX 2YPJA 3E6BA 2PHWA 1JYIA 4DXSA 2RS12 1GKBA 1K3IA 4RYDA 4URAA 2VZUA 4N43C 3ZO0B 5KXDA 2VTFA 3BTXA 3AM2A 2R071 5LRRA 1UIJA 2XH6A 2Z79A 1YHFA 2QVSB 5EYYA 2P3JA 2R7EB 2WT0A 3LFMA 1DBNA 2C5DA 4X6RB 3PHMA 3K3NA 2RHPA 1QF3A 4PIYA 2VNRA 1RUE1 1O3TA 2FDHA 2AYHA 2BNMA 2FMYA 4LTAA 3LA2A 4CEYC 1VPHA 5H9SA 4ASKA 1CESA 4CVUA 1QDOA 5FZCA 4QU1A 5APAA 3MEPA 4PIXA 1W2AX 4XFHA 1IS5A 3T4VA 4FBFA 2PMWB 3QH6A 1C28A 2LUWA 4XF9A 4AR2A 3GM8A 3H8RA 2B45X 2WZR1 3HOBA 4AWDA 4GKYA 2UWBA 4LJHA 4M00A 3H8UA 3FC0A 2OYZA 5C71A 1KXGA 5JR7B 3KVAA 3BODA 2UWAA 4Y4RA 3TN93 5EPAA 2RR13 1GWLA 4XZUG 5F5CA 3BOPA 4R9BA 3ORJA 1ZVFA 2EALA 3J4UH 2XBO2 4O61A 2YUEA 4JGZC 3ZVXA 1LGNA 4QX1A 1S55A 4E8DA 5FZMA 1BQPA 4X8PA 5GZFA 3JD71 2XWBB 3TEYA 1IKQA 3EBRA 2VZOA 1LODA 2XUEA 5IWFA 4Z92B 1Z7S3 4XABA 2P6CA 1NCRA 2E26A 1JZ8A 4HT1T 2WT1A 1PO21 1COV1 3U07A 2ZGTA 5FUPA 3NKTA 4AEDC 1IQDC 4Q1PA 1HRV3 5C3SA 3PNAA 3NNJA 1I6XA 1SZBA 1YLLA 2JE9A 4YGDA 2NMOA 2O0OA 4M01A 2A1XA 2IXJA 1NT0A 1RUD2 1RJ7A 1VJ2A 3D8CA 4LORA 1TME3 4MXWB 4PDWC 4Q4Y2 4Y1UA 3VZLA 3TEXA 2V4VA 1UOBA 1EPWA 1VAKA 4NUBA 4Y3OA 1QJY2 2BGCA 2XQXA 4RSUA 5EIYB 4ARYA 5JXIA 1EAH3 3J7LA 5CIRA 2R041 3KMHA 4P9JA 3ABZA 4DXTA 5C9AA 5CKQA 2E51A 3ZXGA 3HIFA 5ACA1 5FZLA 2UURA 4Z07A 1N1YA 5IW0A 5I0DA 1H30A 1GLHA 1LOEA 1LHVA 4GB32 3CKHA 4XJAA 1QOOA 4QPIB 2VZTA 1XQNA 3AZWA 4BWOA 3KV9A 3LDKA 1R1A2 3AC0A 4YW6A 3ATGA 3MW3A 5D8AA 5EXOA 3ZSEA 1GV9A 3A4UA 4B3NA 3KSCA 2WLQA 3Q8BA 4BLJA 3ZR6A 3ACLA 3IBMA 2BQPA 2GN7A 1S4CA 2RVAA 1PMJX 4LO7A 4Y4YA 1OF3A 4BQXA 4E2QA 2XL7A 4MADA 3VDDC 5BXXA 1R1ZA 1CPMA 2ZHMA 2VBBA 1H0BA 2XJPA 4XTMA 3K46A 4CDUC 2VNGA 5IK5A 3POGA 1C1LA 1G6NA 5FBJA 2ZGOA 4YZ1A 1OVPA 3D82A 3LDBA 4IGPA 1KEXA 1RVF2 3DYOA 3BVCA 4XMIA 2VOWA 4JAAA 3USSA 5FYTA 1NE6A 5LBCA 4HXCA 3NAPC 2F4LA 1FPN3 3GHNA 5F9TA 1UWWA 2D6OX 4HVRA 3J26N 1ZZ9A 1FV3A 5FYIA 4IE4A 2YGLA 3HEIA 1KFXL 1ZNPA 3IDCB 1QIQA 1L7RA 4IERA 4OHXA 3N7MA 5F3EA 3RRDA 3ZFEC 1CAXA 2BNNA 3DGTA 3WNNA 1PMHX 2ZCWA 3WNPA 4Y20A 2WNUA 1IG3A 3AJZA 1J59A 1QOSA 5T5LA 1FOD2 1TMF3 3OY8B 4UWDA 4OHWA 1SDDB 3KV4A 3JB4C 2YYOA 3NNFA 1OOPC 5B4XA 1V0AA 5JOWA 3GCWA 3VBHC 5BUVA 1W0OA 4DXRA 5DDJ3 2QQPA 1YI9A 4WZFA 2WAAA 1ND2C 1Y43B 1Q56A 1UZYA 4LBQA 2UYAA 5EWSA 5KHHA 1UOJA 4FOWA 2YC0A 4RR3C 2YU1A 1J3QA 1D2SA 4KQ7A 4MGZE 5I8YA 3VKMA 4HK9A 2N7GA 2RS13 1CIYA 1QXRA 4C91A 2Y6HA 2R16A 4NWWA 2ZEZA 4YW4A 3VBUB 5K0UC 5JOXA 3FUOA 5JXGA 1D0HA 4YM0A 1JN2P 4PQ9A 4R9DA 4GJYA 4XPVA 2WABA 5FZ9A 1NUKA 2QCSB 4OCTA 4AI2A 3WF2A 2CGPA 1UU5A 4NRPA 1BK0A 2HYXA 2PA7A 4AAXA 3OD4A 3NWKA 2AREA 4UBGA 4LHLA 5FV3A 3H8XA 1K5JA 4YZ4A 4BH9A 4CCEA 2FDGA 4OQ9A 4LO6B 5CFDA 1HJFA 2JDAA 3NMBA 3RFRA 4HPKA 2HKXA 1QXJA 3LIGA 4D69A 2HLEA 4I0WB 3H1MA 1V9U1 1B35C 3DCQA 4FOVA 4QQLA 2NP0A 2FD8A 3VD9A 4LIVA 3Q9OA 3A21A 5EJ1B 1O4TA 1PX3A 4FFGA 4Q4X2 4AF9A 5HBAA 1GSLA 4AE2A 1FATA 1UAIA 5FJHA 1HB2A 2I07B 3N7LA 5ABJA 2AH2A 2Y34A 4KU7A 2D5HA 2WINB 1US2A 4Y1ZA 2VBPA 4ZHNA 4GH4A 1R092 1G7YA 4B1MA 1SBFA 3MF9A 3KWVA 3OGSA 2VMCA 5FXZA 3RGBA 4BPZA 5FYHA 2G9ZA 2GALA 5FP7A 2AGSA 4FAHA 1PM7A 3ZN5A 1Y7BA 5DZGA 4DY5A 1LHUA 2XUMA 4AYUA 1VBA2 1PO12 2PLV2 2VZRA 4FPLA 1YC61 2XQRA 1BXHA 1RL3A 1W0NA 1CAVA 5DAPA 1H2NA 1W6QA 1ZBA2 2A6XA 2ZGSA 1MZEA 1CJDA 3CJIA 2BDRA 1WUVA 4A7YA 2VU9A 3VUOA 1JHJA 4XILA 5JMOA 4LA2A 1SBDA 1DQ4A 5I8TA 1RMU2 2GH8A 3OF1A 4EN7B 5EJ3A 5AFBA 4ZPIA 2OQ7A 1NCRB 3W20A 1UN1A 1RUD3 2VGDA 5C8CC 1KRIA 4KU8A 5FY1A 1OLME 3VBFA 1QJY3 5K4LA 2HEYF 1CAWB 5IAXA 1HB4A 2VECA 2Q8CA 1WW4A 2VOTA 2G9GA 1JZ2A 2W1SA 4NAOA 3TEZA 5L9BA 5JDBA 1SG3A 2WQ8A 1DQ6A 1SLAA 3POJA 1WKYA 5GJ6A 1Q43A 2FMDA 2I74A 3RMYA 4D94A 2A70A 4FPYA 3POSA 1O3RA 2W46A 3N3HA 3VKLA 4AGVA 2MPFA 3AL5A 1R1A3 5FLJA 2F17A 4S2FA 4BJ0A 1POV3 4YVWA 3I3MA 3TOJA 1NLRA 1ZZ8A 2W2IA 3GBFA 3Q8CA 3CLPA 3WDYA 1VIWB 5HCAA 3KV5A 1C4RA 2WWJA 2CL2A 2VMGA 3BN6A 2A73B 3M70A 4YPJA 2JDYA 1ENQA 4DIQA 1XNKA 1AR81 2QKDA 2ZZQA 3ALQA 5GZCA 4OHYA 4NO4A 2VVFA 5F5IA 1MVEA 3TWIA 5EV7A 1EAH1 3WXPA 1RITA 4AK3A 1Q5OA 2DCZA 2TUNA 4GQ7A 2YXSA 1APNA 5FZKA 3S6PA 4BQ1A 4EZ4A 1N1SA 3WP6A 5GLTA 5JUVA 4LEJA 4XFGA 4JTNA 2DVFA 1RUF1 2RE9A 1S0JA 2YROA 2QQVA 3I97A 2OUHA 4Y5Z0 1YIFA 4AHZA 5DN2A 3CBNA 3GHMA 3Q8AA 3VDCA 3AKTA 4XIOA 2D7FA 2VO5A 1ENRA 2ET7A 1FOD3 1NA1C 2RJ2A 1UIKA 2UWCA 2BZDA 5F3IA 1YO8A 5FIXA 2OKXA 4NN0A 1UO9A 4DINB 3RMXA 2PHXA 2BJSA 1H4GA 2NQYA 2VVDA 2G9FA 4LO4B 3JBG2 2QZ3A 2ZGMA 2WNUB 4GZ9A 1ENXA 3LKJA 5BNOA 3T08A 4QXKA 5FFOC 3THPA 1W05A 5A6YA 3RJRA 3NNLA 1H6YA 4FFFA 3WW3A 1NCQB 2PXJA 3SNMA 3AKPA 1Y3TA 4OHZA 1VAMA 1LEDA 3KV6A 3F2ZA 4U2AA 4LBQB 4P9XA 2D6LX 5CFCC 3H1YA 3IT8A 3C3VA 1FPN1 3HQXA 4RQPC 1PNGA 4QHOA 2XG3A 5AFEA 1O4ZA 1UOFA 1X82A 2XJUA 3BOWA 4Q4W1 4QHBA 5FREA 1YQ5A 2WFF2 2WSVA 3HQRA 3UETA 2ZEYA 1IOAA 2HJIA 3APBA 4QGMA 1UY2A 1YCIA 2C6SA 1GZTA 1Q3EA 3RZHA 1LOGA 3N4MA 2VUJA 1AHSA 4NIGA 4XXAA 5FAXA 3WCSA 5KXCA 3NRUA 3NO8A 4TXWA 4XC9A 4KBBA 1MZ6A 3R4DB 4NROA 2P4EA 2VOVA 2B8MA 5A7OA 2DUQA 5LK5A 3TB0A 3DYMA 1T6GC 1IZ3A 2MEV2 1IPJA 3AMPA 3N7JA 2SBAA 1BVVA 2Y26A 3C2UA 4LBNA 2DV9A 1DHKB 2RM22 4GAZA 1VR3A 3T1MA 3VZOA 4Q4X3 5CFDB 3OG2A 3BI3A 2EXKA 3CHXA 4QGLA 5A3OA 3K4DA 3KT4A 3MO4A 2VUCA 1SLLA 3S7EA 2RS52 3WF3A 4CU6A 1PGL1 2IWGB 1MZFA 1R093 4EE2A 3CU7A 3HMYA 5AVPA 4PIZA 1OA3A 5E6HA 1MS3A 4EZHA 1WWYA 2ZOEB 2BVBA 1W8TA 2ZEWA 1V6KA 3P1IA 4KGQA 3KB5A 4I02A 4LO5B 3ZPOA 3GBWA 2H0BA 3G6JB 3HQUA 5A6ZA 1PVC2 1VBA3 1LKNA 1Q8QA 2HEWF 3R4SA 1PO13 4FVVA 2PLV3 4IGOA 4IV3B 2VY0A 1UYXA 4JHTA 4LR4A 1RUNA 4Q8KA 3WDUA 4CYDA 4E2SA 1ZBA3 4QKFA 2XMLA 1BEV1 4UFLA 1AL22 2GMEA 4CDXA 5A3PA 5JZGB 2DCKA 1RIRA 4YZ3A 3AKQA 1AYM2 1EUUA 4Q4V3 5FPXA 4CP9A 2DF7A 3LE0A 4CPBA 1OUSA 1W6QB 2FBEA 1QH7A 1TG7A 3KCXA 3FLTA 4O65A 5G04L 2EXHA 2HWD1 3CJIB 5LRSA 3PUIA 3VBRC 4ZXKA 5DUVA 1K5MA 5FZ6A 2RMU3 2W1WA 3EJKA 3S0MA 3VKFC 4H7LA 2BUKA 2EVXA 2ENRA 4JGZA 5A3WA 3ZYJB 4K1ZA 2BOIA 1LGBA 4ISQA 5HV4A 2FCTA 4FT8A 4LIUA 1E57A 4CU8A 1JHNA 4JGYC 1SCSA 3NJYA 3AXDA 5DXDA 4OYUA 4XJ9A 5I0RA 3I2GA 5FYMA 2RV9A 4YG0A 4BLIA 3DV8A 3J7NA 2D98A 3H7YA 3I2HA 5I91A 3IN9A 1JYWA 5FYYA 3AX4A 4QU2A 4OZOA 1GZWA 1YFWA 3GBGA 2QQJA 5FYSA 3MW4A 1IS6A 3PUAA 2EF6A 2VPVA 4ASLA 3L2YA 3RS6A 4MGYE 4Y26A 5J3UA 4ARXA 3N9NA 4SBVA 4XQWA 4BXFA 1MEC2 2LTNA 3GJBA 4UXAA 1RUJ2 4YVWB 4DQAA 2ZGPA 2ZHLA 3ZMNA 2W95A 4ITCA 1GQPA 3H8OA 4ZZ5A 3W5NA 2Q4SA 4AVVA 1J1LA 2WNVB 5FUNA 1HXS3 2GSYA 1OF4A 2VOKA 3WHTA 1C8M2 2GMMA 3EXUA 3M8LA 3PJYA 1H4HA 4XUOA 5JXHA 2VTXJ 3O1TA 1S0CA 1IS4A 2DBIA 1S2EA 4AVSA 3AP9A 5JI9A 1JH5A 3LEMA 1CGPA 2IXCA 2ZMLA 1E5IA 2AR6A 4COWA 3H7JA 3OEBA 1T2XA 4A3ZA 2WJSA 1WW6A 5FZOA 4QKNA 5DAVA 3AMHA 3MPBA 1UMIA 3DL3A 3BTAA 1UYZA 3VDDA 5LCWL 3W9AA 1DG6A 4JKMA 1KD7A 3AVRA 3OPTA 4LHKA 5FPBA 1V6LA 4HN1A 1OPOA 2RJLA 3JBG3 2YFZA 3EMRA 1PIV2 2YU2A 2FCVA 3SCGA 5LA9A 3HNYM 4IEPA 1J3RA 4LUKA 3KGLA 1BLZA 1VBB2 3KHCA 2R6QA 3NAPA 3UKNA 5I93A 1DYKA 3B94A 1N1TA 2O8OA 1R64A 4Y5TA 2QQKA 3P6BA 2PQSA 4ZU5A 3MLJA 3PL0A 3PUHA 3AYDA 2FCUA 2GP5A 2R061 3JQXA 3PLQA 5F37A 2ZX2A 3ZXJA 5C4WC 1ALYA 1DYPA 1LCLA 2WWUA 5FQ0B 1W28A 3HT2A 5JI7A 3WF4A 4CP1A 3HVDA 1OOPA 4YVSB 3RI9A 5L7OC 5FP9A 3VBHA 2C24A 3B00A 4PBPA 4WM7C 1LHOA 1Q8OA 4LBOA 1S0BA 5LA1A 1W6PA 2A3WA 1ND2A 2QFEA 2BGPA 2RDRA 3J8F1 4YLZA 1PZ7A 4RR3A 3SC7X 3BB6A 3RPQA 1W8FA 1WLWA 2MEV3 1NE4A 1GZ9A 3O1VA 1WW5A 2R49A 1GANA 1D4M1 1QJX2 2RM23 2BW8A 4N9IA 4BK5A 3T30A 3C7FA 2Y6KA 3H50A 2ZGKA 4MYEA 4Q5OA 5CNAA 4XMAA 2RS53 1AR71 4B7KA 5E1RA 3LWCA 2BVVA 3U14A 5ABJB 2VMHA 3MLKA 4TWTA 4XDPA 2ES3A 3UK9A 3NJXA 2B7YA 2JB4A 4KI5M 4KWJA 2QNKA 1OKQA 1AL0G 1PVC3 4D8MA 5C5TA 1RHI2 4MVTA 4DZGA 1KFUL 2LRPA 2EAAA 2BOJA 4QHZA 4LT5A 3O7OA 1B35A 1GNHA 5LEJA 1WBFA 1DLCA 4BB3A 1AL23 5T3NA 1QOTA 2PELA 1WCUA 4CEYB 3ILRA 5GZEA 1VBD3 1P8JA 3GCXA 2HWC2 1AYM3 2OA2A 1S1AA 4MHUA 4NMIA 1S2KA 1D4VB 2X5IC 4LULA 3E97A 5EP9A 5F8PA 5KHJA 1EV11 5FZ1A 4CDXB 3DPRC 4CEWC 2ZKLA 3UT0A 5H9QA 2CGNA 4P9GA 5HPOA 4Q26A 3RZMA 4JTOA 5LY2A 3VZNA 1SLTA 2CWSA 4N7IA 5GLUA 3H3UA 4ASMB 4CP9B 3NJVA 4LK7A 2ORXA 3T2QA 1WA6X 5IFTA 1A3KA 4BMEA 2WAOA 4XOGA 5F6KA 4LNVA 1FNZA 4EN9B 1K5MB 2OS2A 2YY1A 2XHNA 3UNPA 1W9TA 2WS92 2AENA 1GP5A 4PF1A 2PLV1 4KGGA 2GN3A 2E7QA 1QJU1 1UYPA 1W90A 2IXHA 1LNSA 4IEZA 3EYPA 4MLOA 1ZBA1 4P9WA 3MV01 3T2PA 4LBKA 4DOUA 4I0BA 5IFPA 3FL7A 3UGGA 2DFBA 1AYN1 5BNNA 2HYKA 4Q4V1 1F15A 4Y5SA 3TAYA 5C8CA 4H3WA 5FY0A 4R8HA 2RJKA 2YBSA 4A2UA 2JB8A 2Z69A 5F3CA 3ASIA 5L9VA 1GZWB 5J37A 2VCAA 1XSQA 1LU1A 1RUJ3 1UX7A 2RMU1 4WM8A 4ZU4A 1UNBA 2E33A 1H8TA 4IE0A 1SEFA 4EWAA 1BBT3 4XYXA 4EV0A 3ZFGA 4AI0A 5JSRA 3T0DA 3IMMA 4XAEA 1RXFA 5BV6A 1C8M3 1UD1A 3FHQA 3KD4A 4UW4A 5A7PA 3RSJA 4P9IA 2WZEA 4B29A 2A75A 5JXJA 2RS33 2UY9A 3BPZA 3JZVA 3NJZA 5DUXA 3VHRA 3ZYIB 5FP4A 4CDWB 4FP3A 4LE3A 4SLIA 3ZR5A 4XCBA 4YFZA 4HETA 3IDEA 1UY3A 5HCHA 1DZRA 3PJQA 2JG8C 4HFSA 1VBE1 3UJOA 3PTYA 1HB1A 2GMPA 3PUQA 4ZS3A 4CCKA 2C4XA 2XB6C 3M3CA 1LB2A 1XNDA 3K77A 4EWEA 1E5SA 3A23A 3MIGA 1CR7A 5FPUA 1Q8PA 5DQ0A 3VN4A 3RYKA 5CEHA 1UKRA 4FCAA 3OJBA 3O0VA 1YQCA 2B42B 1WCDJ 4LUMA 4QDQA 1AX0A 4G4FA 1PIV3 3W58A 2LROA 5EYXA 1O8PA 3V65A 5LK7B 3ZXKA 3VDDB 5FO9B 5KR7A 3ECQA 1HRI3 2WZ8A 1VBB3 1YYNA 4K7JA 3IPVB 3K48A 2G19A 3B69A 5C70A 3U75A 3GF6A 4ES8A 2W1UA 1VRH2 4AEKA 2JDKA 2JXAA 5FXVA 4JV4A 2ZA9A 1RUH2 3VLBB 2NZ9A 1HXS1 3I3QA 5KBFA 3BTYA 1DYOA 1LOBA 1ULEA 4XW3A 1QGLA 1MQTB 4NRMA 4JZRA 3FBYA 4QX7A 5FXXA 1HB3A 1RINA 1OVSA 5IVCA 4BQYA 2IC1A 4BK4A 2K0GA 3NV3A 2DVAA 2XR4A 4QX5A 3GYDA 4URTA 1OLMA 4BU2A 3O1RA 2FDFA 1YJKA 4FPCA 4FXGB 2C26A 2OXBA 3BPSA 1PK6B 4M3CE 2Q8EA 1W04A 2LM3A 2P5BA 2P1BA 2Z4FA 3I3BA 4QWNA 1JZ5A 3E5UA 3KQRA 1VAVA 1QJX3 2KD7A 3OCPA 3ROUA 2A7AA 1Z78A 4ORFA 1REEA 5CFCA 3ZFFA 1BMV1 5FMOL 2R0HA 1J84A 3PVNA 5FP3A 4N7UA 2B4KA 2LS6A 4EQVA 1X9TA 3TYJA 2WIIB 3FBMA 4G3YC 1G9DA 1DDLA 3ZXEA 1O5UA 2W94A 3HD8B 2NPIA 3FFQA 4QDSA 2PAEA 3T0BA 1FAYA 1NAEA 3LQCA 4B7EA 5LEKA 1KS5A 1RHI3 1RUC2 2VCCA 5DG2A 4UYBA 3BUCA 3VB9A 5KC5A 2JIGA 1FMD2 4AXOA 3B5LB 1W8OA 2AZ5A 4MHRA 1GYKA 2Q0AA 2WWSA 2HWC3 4CCJA 5IK7A 2JG9B 2CAUA 3CEWA 1QXPA 4BMBA 3ZYPA 1EPZA 3NNGA 5DAQA 3PVEA 4N53B 1SFNA 5FWJA 1I5PA 2ZX1A 3IZOA 3QOPA 5T50A 5FK8A 5CKMA 5FMBA 5EJZB 4D7SA 5J1XA 3IKWA 1W6NA 4QM8A 2W47A 4AI3A 4CTEA 5CBLA 3FE5A 1GUIA 1Q8SA 4AG4A 1RUI1 1HN1A 4YYOA 1ULPA 1QDCA 4XBLA 3ZIWA 4XE9A 4YM1A 4CDQC 3SXWA 4U36A 4D7TA 2DFCA 3HNMA 4GXLA 3ILFA 4MV2A 2WS93 5FO8B 1XJAA 4JRAA 1YIPA 4XURA 1F31A 4V1PA 4E9KA 2GNBA 3MW2A 3RZJA 4FAGA 4C1WA 5J98B 4GWMA 2DCTA 3ZKYA 2VQUA 3LF7A 4HSLA 3VD5A 3JU9A 2GU9A 2AC1A 2W92A 3C7GA 1UF2C 1J3PA 1AR92 2D6MA 1VBD1 3AZZA 3SH5A 4A7KA 1RXGA 2E6VA 2D5FA 2DU1A 2X09A 2D3RA 1DP0A 1ZBE1 2NYYA 2W9XA 4AI9A 3ZKUA 2Q30A 1LGCA 2VM9A 2HWF1 4Y1VA 3UGHA 4EN8B 4E4DX 5LZ6A 4V2WA 4M0NA 5BNNB 2IFWA 1PGW2 4WVZA 5HCFA 3V0BA 1LHNA 3WDVA 4IV1B 1XU1A 4OFGA 1O5LA 2WA4A 5A6XA 4QXCA 5FZ8A 4AEJA 1SMVA 1AUYA 1MS1A 3PUSA 5JIUA 4ISRA 3B93A 4WM8B 1DLLA 1QQP3 2WDBA 3U37A 1V6IA 4XQDA 1NZCA 1RUG2 2WN3A 2A3YA 4RHV2 1R083 1XE0A 3BYWA 4XHBA 3ZDSA 1U5XA 1AX1A 1H8TB 2WC2A 3WG2A 4B4QA 4Q2FA 5J48A 4MGTA 4WV8A 3ZFGB 3I59A 3VDBA 5IYYA 3ES1A 4YG3A 3AL6A 2EXIA 3VD4A 3POFA 3KS7A 3GGLA 2P2KA 5AC91 1ND3B 1UU4A 1YUDA 4N90A 3B3QE 3WF1A 2WO2A 4L8QA 1IHMA 4D6RA 4AFCA 1LOFC 5HXMA 3ZN6A 3VHPA 5LW9A 3FX3A 4LXLA 3B02A 1VBC2 5M0TA 3SH4A 3MUZ1 4QPGB 1L3JA 1OFNA 1REFA 4GMP3 5F39A 1WLDA 1ZRIA 4Y22A 1LHWA 1T6BX 2A6VA 1LOCA 4IQPA 1VRH3 1W2NA 5FZEA 3ZXDA 4XUNA 3Q8EA 1OURA 1BBT1 3IAPA 3UYJA 2K2SA 3LEKA 1RUH3 2VZSA 1US3A 5IVJA 1AR61 4OZXA 5D1IA 2RS31 3AYCA 1NXMA 4L9BA 1WMFA 4R9CA 1DGRN 4QXHA 5CU1A 4E8CA 3MIBA 2HWB2 2JEMA 4Q0VA 3HAGA 3P3NA 1NYWA 1KJRA 2ATFA 4P5YA 1JU3A 1ZRFA 4RS5A 2VG9A 3FUQA 3MGUA 4H55A 4ZXEA 2JE7A 3MHZA 1ZZ6A 2GC3A 2ORZA 3ACHA 3PIGA 4Q0QA 5E16A 4AHXA 4D6SA 2XJTA 5A32A 3P3PA 2Y6GA 4QDRA 4I3GA 4YZ2A 4YGCA 4HVOA 4A44A 5J96B 5DUUA 2GH2A 4XTPA 2JDUA 4X8NA 4XFBA 1HRI1 5A70A 2WLPA 1XSRA 1YFXA 3RZZA 5CYYA 3KGZA 2XBO3 5JPMB 3VZKA 4LOTA 4CP2A 4M0HA 3IAQA 2ZACA 3OTFA 4TSVA 4FQ4A 3IWZA 4IW3A 4R52A 1J1TA 5L7OA 4FOQA 5I0TA 3ZFFB 4PCRA 3NV2A 4WM7A 2DUPA 1CZTA 4H14A 2TBVA 3WNKA 1OQ1A 2JD9A 1NY72 1RUC3 2HWE2 3K75B 4L99A 4XHXA 4QPIC 1FMD3 3F95A 1G86A 1SFPA 3RDIA 3MFAA 5A3LA 5LWBA 1X7NA 4P14A 4W8JA 4BE3A 4K20A 4XBNA 4CCOA 3GZEA 1W39A 4LKEA 4Q4Y3 1UZVA 3D4KA 3TN91 3PVBB 2JIJA 1Y9QA 3ZSLA 2RR11 2ZAHA 5IAVA 2WR9A 4NHLA 5IK4A 2VZVA 2UY8A 1ULGA 2ET1A 2NM1A 3O1MA 1K12A 2TNFA 2WN2A 4S2DA 4DY3A 2E7TA 2J1RA 3A0KA 4NPRA 2UYBA 4GB33 4HBNA 2BPA2 5FDBA 1Z7S1 4NE9A 2W91A 3GXUA 5C9AB 3I2KA 4LQRA 1QH6A 3E1F1 1LU2A 4NOTA 4AQ2A 4P9LA 5A7QA 4CSWA 2RDSA 1Y9GA 1HRV1 3WDXA 2CAVA 3JQWA 4G9SB 1I3HA 4MGQA 5D8AB 2TEPA 5A7WA 4CEWA 3DPRA 1AR93 1TME1 3LPFA 3RJ2X 3ZYRA 5F2SA 2BU9A 4HKWA 5IHRA 4K9SA 1RVF3 5T5OA 2YGMA 1W8ZA 5JMCA 3NQHA 5CADA 3LSDA 1ASJ2 3THCA 3WSOA 1IQAA 1KQRA 1SCRA 4ZS2A 2O1QA 4RGGA 3WV6A 1C3HA 2GC1A 4BXSV 3ZIXA 1KS4A 4XF1A 2ZS6B 5T52A 3VL9A 3IIAA 4NPMA 1DIWA 3VBUC 4IEYA 2CYFA 2VNOA 3OGJA 4PF5A 2DCYA 3V0BB 1CIWA 2R072 1QMJA 3BU7A 4JDMA 3FLRA 4FPEA 1CN1A 4WVMA 2B46X 2BWCA 2DVGA 2BERA 4PQQA 2MHFA 3FHIB 1H1IA 1MS9A 1ZZCA 5FY8A 1U0AA 1CAXB 1ULFA 3M3QA 4Y20B 1DGLA 1RUE2 2LW8A 4A7ZA 1XXNA 5FZBA 4BQ5A 4FI9A 5L19A 3AZYA 4XUTA 1GNZA 3ETPA 1OH3A 5FKBA 2H0VA 1VBC3 4MG2A 3THDA 3C7EA 4QT6A 3I3DA 2WZR2 1RC6A 2Y38A 1DCSA 1KDMA 3BIWE 4LKSA 4XFIA 3WVJA 3AZXA 3DN7A 2XKOA 4AHWA 4CP0A 3LAGA 3POWA 2BFUS 5JLVA 1VALA 1D2QA 3KF3A 4JC1A 3NKGA 1W8NA 5H9PA 3MIFA 5BNPC 1QQP1 1DQ0A 2JG8A 3ACIA 4Y22B 3WG1A 1TMF1 2OVUA 3UV9A 4AI1A 5L36A 1R081 1OUXA 5CZKA 5A33A 1FX5A 2HEVF 1E5HA 1JOJA 3WQ0A 4I3PA 4CU7A 2RG4A 2CY6A 1W6OA 1C8NA 3JD72 3EHKA 5DDJ1 3T4HB 3MFCA 3BU0A 5FYVA 4YGEA 1UOGA 1PZ9A 1UPIA 4HSJA 3KVBA 2C9AA 3OGVA 3H0OA 5C6CA 4P9YA 4N43A 1I1EA 1N3QA 3GZTB 3FHAA 4QM9A 3WLUA 1PO22 4HPKB 3DXUA 1COV2 1OMIA 4Q0UA 1OA2A 3VV1A 4DUVA 3X29B 3AKRA 2RS11 1F9KA 5FYCA 2PHRA 3QLQA 3I54A 4RS5B 3WQBA 1NCRC 1SQ4A 2OPWA 2PAKA 2FDIA 4FOYA 4K8FA 3KF5A 4IE6A 4RA0A 2BV4A 4MXVA 4IEWA 2WZPP 3VD3A 3CL1A 4XACA 5HV0A 2ARCA 1UXZA 1VMHA 1WLTA 4IGQA 4DPNA 5LB6A 4GD4A 3QD6A 2A3XA 2R1DA 3N9LA 4KL1A 4GH4B 1GQHA 4AVCA 1MS5A 1ACCA 4PI2A 4J25A 5FYZA 4P08A 1UYYA 1Z0HA 4OI2A 1WCKA 2QUOA 1N47A 1U5ZA 5E8AA 3LOBA 1MS0A 2R042 3ZYGA 1PNFA 1W9WA 2VMEA 4FSJA 2WO1A 2VAUA 3VHOA 5ACA2 3ZOIA 3LCPA 5JCTA 4ATFA 1RMU3 4HN0A 4Q27A 1AXYA 1CAVB 4IUGA 3UGFA 3D6EA 2RDQA 1AJOA 1IPSA 4IEUA 4ONUA 1HIXA 2CV6A 3U4SA 2R0FA 1UX6A 1WZXA 1XE7A 2D3SA 3ZXLA 3RWKX 3POYA 1VE0A 3IIIA 4OMCA 1MZ5A 4XDQA 4XJWA 1X36A 2P34A 4Q0PA 4XJZA 1G8WA 4YGBA 1EUTA 1EYBA 1QHDA 4Q29A 2IFRA 4L11A 1U5IA 4XAAA 3ILNA 3O1SA 2XONA 3RYPA 4XXPA 1SLIA 1XC6A 2XBO1 1DU3D 1VLNA 2C1FA 4ZONA 5DPNA 4DEQA 3VBFB 3V0AA 2BBVA 1S0FA 3BTZA 4RD7A 4IE7A 2WL1A 1XNBA 3MYXA 1BKZA 2D3PA 2PN5A 3O14A 4BM8A 3ZSMA 4AEDA 1GMMA 2VZQA 3CDZB 4Y33A 5A3MA 2JENA 2ZGUA 2JD4A 1QY4A 5DAWA 4OI1A 4QKBA 3K2OA 4PDWA 5FY7A 4AFMA 3M2MA 3WINE 3SCHA 2Q1FA 3UJQA 4DUWA 1ZZ7A 4NIDA 3VKNA 1RUD1 4W65A 1EY2A 2QTWB 4Q4Y1 3OSDA 5GLVA 5C33A 1QJY1 1XYNA 2SLIA 3UKTA 5DMYA 3SISA 2BEOA 1WBLA 1ASJ3 4HG6B 4CDQA 4RGAA 3R0RA 4C8DA 5FPAA 1JS9A 1C5IA 1W0PA 1NCQC 3HR9A 5BNQA 5FPZA 3KCYA 4UFHA 2WFPA 2EIGA 2NN8A 4GB31 5F3GA 5F32A 1YNAA 4M4PA 5F2WA 2XL9A 1DFQA 1UQXA 4YARA 4YSFA 3JB8A 3R05A 1R1A1 2R073 3ES4A 3IM0A 4PLNA 5ANQA 4DEVA 2QQNA 2EIEA 1POV1 1ZRDA 4CXWA 4M3CA 1UMZA 1HQWA 3E5XA 4HLTA 2YC2A 5DABA 4CDUA 1CZVA 1S0EA 5JWPA 4NHKA 1WLCA 1NX9A 2VH9A 2JX9A 1HJGA 2AACA 1RUE3 3QBQA 2C0ZA 5JIAA 1A8MA 3H3LA 1D0GA 4TLGA 1VB2A 4QQOA 4DXZA 4BIOA 1F8VA 2VMIA 3MV11 5LBBA 2J1TA 5A80A 2Y0OA 4PLMA 1JI6A 1UCXA 3M3EA 4OQ8A 2W5FA 3THTA 1RVF1 3FZ3A 3IDBB 2WRAA 1V9U2 1UY1A 2FHRA 5BNOB 2VXJA 5CFDC 3ZFEA 4DUXA 4LKDA 3LDRA 4K8RB 4XFCA 4IETA 3RWNA 1PGSA 1GZCA 1GWKA 1UW8A 2VTXA 2ARBA 1OPMA 2WFF3 3J9SA 3LOIA 4H7MA 5FZHA 2IVJA 2MNGA 2H6CA 1AF9A 1IPKA 1W8UA 4HKLA 4Q8LA 1ZM1A 2F4PA 1RUOA 3BIEA 3I8TA 5ABJC 1FOD1 2VQTA 1POV0 4W6YA 4BDVB 2XWJB 4P02B 2V72A 1QWRA 1GICA 4IV3C 4UFIA 5JVVA 1SBEA 4QX2A 3WEZA 1WD4A 2XJSA 1KGYA 5FZDA 3ZN4A 1W99A 5CKNA 3PIJA 2VCBA 3WNMA 1ZREA 1UU6A 2JG8B 3AYAA 3N9OA 3VGIA 4OHVA 5JZGC 2ETEA 4QKDA 4TYSA 4KG8A 1GU3A 5K0UA 4META 4CUAA 3OB8A 1LOAA 1W6OB 1U5YA 3WR0A 4BYYA 1CAUA 4QXBA 4WZCA 1WA4A 4HL0A 3LZZA 5KXBA 1BCXA 3CJIC 3WHUA 1TEIA 1XRUA 3VD7A 4N43B 3ETQA 3ZM8A 1PZ8A 1S0DA 3OUHA 4DFSA 4HMZA 5J7MA 1AXZA 3M7AA 3OPWA 4YG6A 2WQZC 5FBZA 1F5FA 2CU5A 2Y64A 1OHFA 3MI8A 4XEZA 4XFAA 4LHSA 4Z1VA 2VUDA 1WCQA 4ZZ8A 2JDZA 3LIHA 2VW0A 2J1UA 4MO3M 3WZ1A 5FPLA 4E27A 3W59A 3NV1A 4EN6B 4FP2A 3RZKA 1EP0A 4CCCA 1W8HA 1I9RA 2KM2A 3FWEA 5LATA 2VZ1A 3CZUA 1OKOA 1ONAA 3S5QA 4Q4X1 4HONA 4I2OA 2JECA 1SFYA 1W2OA 2OUJA 1VB4A 4UW6A 4W6XA 2B5HA 5FZGA 5BPXA 5KHKA 2FZ2A 1QNWA 5A7NA 1M4WA 4WVVA 1R091 3U78A 5A3UA 3MIHA 4A6SA 5FR3A 3M1HA 4YM3A 4HK8A 2ARAA 3WDWA 4Z2WA 5FTTC 4C0BA 4MZUA 3KCCA 5GALA 3WF0A 4E2GA 1ULDA 4KMQA 1OD3A 1GWMA 1VBA1 4JGZB 2DU0A 1PO11 1X33A 4RL7A 2WNVC 1AR82 4JQTA 5FRAA 5JSOA 4QMAA 3MZHA 3RQ0A 1WD3A 1EAH2 2P37A 2Y8KA 4YZ5A 2VZPA 1LAJA 1YWKA 4DRRA 2X8KA 1QU0A 3H3ZA 1WMEA 2A6ZA 2GNTA 3WT3A 1LULA 3IB3A 2K9ZA 1RUF2 3WCRA 1MVQA 3HBZA 4AEDB 1RMU1 3ZXFA 1OQDA 3WP5A 4AFDA 3S5AA 4LHNA 3ON7A 4O9GA
chains in the Genus database with same CATH topology
2OIIA 2ZGLA 1C1FA 4Y1YA 1MEC3 4PDWB 2Q1ZB 2XVKA 4XIKA 1BK1A 1HV1A 4PJYA 4Z82A 1FNYA 2DTWA 1YI7A 3D5OA 3M3IA 1RB8G 3URFA 1JXNA 1UZZA 2JKBA 5FCCA 1AZDA 4OLLA 5C8WA 5HCBA 5BYNA 1XU2A 2ZKNA 1FPN2 1HLCA 2A6WA 1QJZA 2WNEA 4Q4W2 4C1XA 4N9HA 3ZX7A 3AZVA 4YVSC 1GQGA 4XJUA 4DS0A 3VBSC 3MDPA 4B4RA 3M4FA 1DGWA 4J6GA 2ZHKA 1MACA 4CDUB 1HQLA 1OSGA 2WSUA 2FZ1A 4FTSA 4YNIA 1S2BA 2X29A 4J1XA 1XE8A 2O8QA 1FT9A 4K1YA 5TSWA 1GR3A 3VBUA 3NAPB 3U4XA 4F3JA 4DMIA 1PHMA 1NA1A 2W68A 1PGL2 5EZWA 4YW3A 2XVGA 5KHIA 2IXKA 3ZFEB 2BTVC 4LBQD 3BALA 4FTBA 2G4IA 1N3OA 2VW1A 4XZPA 1OOPB 3JBG1 5JAXA 3VBHB 4BCUA 4C90A 5T5PA 4F7ZA 1W6PB 3AP7A 1BEV2 1ND2B 3U11A 3VBOC 1XYOA 4RQPA 4RR3B 1PMIA 2D6PA 4CDXC 4BHPA 2HWD2 5K0UB 1JW6A 2PHFA 5BNPA 2D6NA 1CAUB 2WFF1 2ZX4A 1CPNA 3NL1A 5GKAC 3IMNA 4YW2A 1K5MC 3M3OA 4EJRA 4JDNA 2ZTNA 1O3SA 4E4ZA 5FOBB 1CQ9A 5I0UA 3MF6A 2EXJA 4K21A 3S7IA 5CVRA 4DRVA 2MEV1 2Q1MA 3FJSA 1ZRCA 1B35B 4AQTA 2RM21 1SDWA 4IL7A 2WQ4A 5AVAA 1OA4A 3H9AA 2ZX3A 5HXVA 2RS51 1H9WA 3TBDA 2R32A 3O0XA 5JOZA 4YM2A 1CAWA 3B9IA 2Z2SB 5CB7A 4FQZA 3LB9A 1PVC1 1AR83 1TNRA 2ZX0A 4AFAA 2Y0IA 3WQ1A 1AL21 4ZU7A 4FXKB 4CDWC 1RUF3 1AYM1 2CGOA 3VBRA 2WA3A 3AYEA 3O0WA 2PTMA 1V00A 2W52A 3MICA 4Y1XA 3AMMA 5C8CB 5DG1A 1LECA 4JGYA 4AW7A 4R9AA 2D6KA 1NLSA 2JJ6A 3I4IA 1SLCA 4MSVA 1DQ5A 3JUUA 3R4UA 1MR5A 1H1MA 2D93A 4LBJA 4I01A 2CWMA 4ES9A 2BNOA 1YRZA 4HVQA 2XVLA 2ZAAA 2OZ6A 3GZUC 3MPPG 1U12A 2R062 1MQTC 4Q4W3 4OI4A 4FTEA 4UW3A 2ZGRA 2XLGA 2PAMA 3PMSA 4CRQA 1PVXA 2GC2A 3DUIA 1MEC1 2PHUA 1RUJ1 3ZSJA 1VP6A 3CF6E 4AVBA 1PK6C 3ZXAC 2WT2A 3J8F2 1NCQA 3SHRA 2QZ2A 4LE4A 1QNYA 1C8M1 1D4M2 4AQSA 2D40A 2DWRA 3V64A 4EWDA 1H1AA 2QJVA 4AHYA 4OVEA 3I7DA 1AR72 4E4SA 5IK8A 2OW4A 3RNSA 4R4XA 2ERFA 3OGGA 1NA1B 2W08A 4JRLA 2YMZA 4PLOA 2ZMKA 4I30A 1PIV1 2ZHNA 3NW4A 4XBQA 4XFFA 4KWKA 3KT7A 5GZDA 1BEV3 1VBB1 4A3XA 2JG9C 3VKOA 1N3PA 4Z8BA 3K51A 4N53C 5C4WA 3E5QA 2UU8A 1BZWA 3G7DA 3KT1A 1EV12 5DZEA 3SH3A 2HWD3 2XJRA 4D3WA 5BY5A 5CFCB 1NQJA 2I45A 1MS4A 4RQPB 4XF3A 4NVPA 1OQEA 4S2GA 2DCJA 3RI8A 4IV3A 4JVAA 3ENRA 3U10A 3KLSA 3D0JA 3KM5A 4COVA 2PQQA 5BNPB 1HQNA 4L92A 1WMDA 2Z5WA 5JZGA 1UKGA 1JYCA 3OBTA 2YHJA 3PVOA 1DQ1A 4L2NA 3HN1A 1TE1B 2GAUA 4NR1A 5HI0A 1H9PA 3SMHA 1QJU2 1GBGA 3OYWA 5B2GB 3L2HA 1QJX1 1LTEA 1HDKA 1WW7A 1GFF2 1DF0A 4S2HA 2OPKA 4IXLA 1OI6A 4I0AA 3NSTA 3OD0A 1AYN2 2F6BA 1LESA 1WGPA 2PHTA 2ZZJA 4Q4V2 1NXD1 2CNAA 5JSPA 1JUIA 4KG0A 3WG3A 5BNNC 3ZMOA 2BYVE 5JPNB 1W6NB 4YFWA 2RMU2 4IV1C 2A6YA 4MGIE 1RHI1 2B9UA 4FPKA 3UKVA 1M06G 4C0HA 2XKPA 4UBHA 2LALA 4WM8C 2X5IA 2PFWA 4TLFA 4FPOB 3WQ7A 5CG9A 3TNQA 1NOVA 1H8TC 2HWC1 3ZFGC 3I2DA 1LEMA 5CAZA 3L9JT 1YFYA 1AX2A 2DUOA 2VOXA 1G9FA 2ZGNA 3MIEA 1ND3C 1VBE2 3A0NA 4B4PA 5T5JA 3T1LA 3WP3A 1TQ5A 3RG0A 3VBRB 5T55A 3WDTA 4MX3A 5GLZA 1A6CA 2VUAA 1SACA 3AMQA 3HT1A 3AB0A 2WNVA 4JDOA 4QPGC 3INAA 3LA3A 2WS91 3WW2A 1RUG3 4RHV3 4LLOA 4JGYB 5SV5A 2DYCA 1S0GA 4QGNA 4QQ2A 4AVTA 2VVEA 3ST7A 1HXS2 1CD3G 4J1WA 3WUDA 1G9AA 1XNCA 1IGOA 3B7MA 2R063 3H1WA 1LRHA 4KH9A 5I8SA 3MLLA 3R6SA 1G9CA 3NVCA 3I59B 3AMNA 5L73A 5E88A 2W0XA 1HW5A 3B01A 5J36A 1WCSA 3WP4A 4JCKA 5J09A 3ZN6B 4ZKTB 3AP4A 3J8F3 1F5JA 3FFZA 4K3UA 1D4M3 3N35A 3WY6A 4OI0A 3AXEA 4XQ4A 2GC0A 1BMV2 1I5ZA 4NWVA 2A71A 4GKXA 1AR73 5FQ0A 3AJYA 4IEQA 2HWB3 1YFUA 4YRDA 2YV8A 4YVSA 2X53S 3ZFFC 5KHGA 3D0SA 3VBSA 3CNAA 2D43A 3FLPA 4GIQA 4CZSA 4F8AA 2R1BA 4GULA 2IXLA 1CVNA 2DTYA 4XJ8A 4AGRA 4X6QB 1W6MA 3WG4A 1OLQA 2I2SA 2PYTA 1ZZBA 5FOJB 4GMP1 1LJ7A 5SV8A 5A32B 5DUWA 1VRH1 5FLIA 5F5QA 3QCWA 4JQRA 1RUH1 5E89A 1AJKA 1HKDA 1EV13 4YW1A 3CJXA 2E63A 5FO7B 4FPJA 4WBBA 2HWE3 2JICA 3WD5A 5C4WB 4NHMA 1RUI2 1DGRA 2GZWA 2QE3A 2W39A 2YZ4A 4IESA 5L7OB 5C9AC 4WM7B 4K40A 1V70A 4QQPA 1OLRA 2EA7A 3OPZA 4DB5A 3WNXA 1V6OA 1KDKA 3O5SA 3VBOA 1KITA 4HZFA 4QPYA 1QJU3 3E6DA 3QACA 4GMP0 4MGKE 5D8AC 5FMOS 1VBD2 1AYN3 3AP5A 1YXWA 3OYWB 4W6WA 1ZBE2 4ATEA 1TNFA 3EQEA 1Q8VA 2ZJCA 2HWF2 4FPGA 3USUA 5KXEA 2GDFA 1V6NA 3ME2A 5CA6A 1LENA 1RUC1 1AVBA 4QQHA 1O4YA 1BYHA 1FMD1 5K7PA 2V5YA 2NLRA 4D7YA 1CX4A 4Q0SA 3AFKA 2E9QA 3QH7A 1DZQA 4HANA 4LBLA 2KA3A 2WNUC 2X5IB 3MIDA 1VBE3 2XLFA 4CEWB 3DPRB 5AC92 2NMNA 2EAKA 2P3IA 4FPHA 4INDA 1A78A 1ZYBA 2ILMA 4K6BA 2XHKA 4RFT0 4XETA 1H8VA 4IEOA 3VZJA 2V73A 3V56A 2QDRA 3AKSA 3SLIA 4BOWA 3GNEA 1MS8A 3LA7A 3WUCA 1FV2A 1W2UA 3CO2A 5JOYA 4CDWA 3JCIA 1BBT2 1YJLA 2IXIA 2ZMNA 4WVMB 1AR91 1AR62 4BA6A 3GALA 1BVP1 2RS32 4PBOA 3AP6A 5CG8A 4HKOA 1A8DA 4O9EA 2VW2A 4L97A 3VL8A 1S0IA 2WZR3 5EFUA 4FO9A 1PGW1 3UL2A 1RGSA 3IPVA 1ENSA 3WOGA 1DQ2A 3HWJA 4XF0A 4Y24A 4RS5C 4AVAA 2A5ZA 2H6BA 1URXA 4FPFA 2KXLA 1QKQA 1HRI2 1RUG1 4RHV1 4TZDA 4EROA 1MQTA 4GH4C 4GA9A 2XJVA 3FMGA 1IKPA 1LOFA 2V09A 3JD73 2CTVA 2AUYA 2PHLA 1H2MA 1ZRRA 2Q5TA 3WW1A 3WW4A 5A33B 1PO23 3TRSB 1COV3 2D44A 2XPJA 3GZAA 3B9CA 1C5HA 1DDLA 4AGGA 4M3CF 1PK6A 3DKWA 1B09A 4KWLA 1UPSA 1VBC1 1DZTA 3E6CC 1H2LA 2FQPA 3VBSB 1RJ8A 2Z42A 4XF4A 4IEXA 1X8MA 3VHNA 1G9BA 1W6MB 5FLHA 3TN92 1HV0A 2BWAA 2RR12 5GM0A 1C57A 4P5HA 3LGRA 3DF0A 1XYPA 3VBFC 3ELNA 2P3KA 2R043 1OFSA 1ULCA 5IT6A 4BZ4A 3SITA 1O7FA 3WX5A 5ACA3 1RUI3 2R30A 2HWB1 3U0ZA 1V6MA 4COUA 1KJLA 5K8SA 1Z7S2 1CJPA 2GNDA 4LBMA 4GALA 5GZGA 1JUHA 2E7AA 4MXWA 2ZGQA 4OUMA 2JG9A 3SCFA 4Q1RA 5KC6A 1UL9A 1HRV2 2E53A 3KZ4C 4EN0A 4N53A 2IZWA 4UW5A 3ZSKA 4YVWC 1O91A 3S30A 1TME2 3O12A 3VBOB 5F1RA 1RTVA 1JTZX 4LO8A 1NQDA 4BIFA 4MH0E 1ZBE3 2GNMA 3N7KA 1F2NA 5IUQA 2HWF3 1O3QA 4QPIA 3V0AB 1FI2A 1X50A 4R4ZA 1NY71 2HWE1 1CONA 2VQAA 1H2KA 1ZA4A 2VXRA 4DNYA 4GWNA 4OULA 3USUB 4OUSA 2Q8OA 3PMEA 1OD5A 2B39A 1REDA 3OBRA 4AFBA 5H9RA 2ZBJA 2OZJA 2ZABA 3RYRA 1NG0A 4WVWA 3NV4A 2ZPXA 1LR5A 5AC93 3LSEA 4YW5A 1AXKA 1J58A 2XLAA 4IV1A 4MUVA 4AI8A 2XGXA 5F6LB 2ARXA 2WKKA 3T2TA 5BNOC 4CDQB 2XJQA 3TNPB 1ZX5A 3N36A 4IEVA 3OY8A 2YDEA 1X8EA 2D97A 2PHDA 4COZA 4LA3A 2BFUL 1V6JA 1QQP2 4I09A 3VZKA 1AR63 1ND3A 1TMF2 3EO6A 4M3CB 4QD2A 5T54A 1R082 4AQ6A 1JBCA 3AK0A 4LLFA 3ZPYA 3BCWA 4COYA 5DZFA 4B8EA 1BJQA 1V9U3 5DDJ2 2QDNA 5K9YA 2DURA 2DVBA 1N1VA 5KWRA 1ASJ1 4KNCA 1SLBA 2P17A 4QPGA 1HX6A 5GLWA 2DVDA 2VQ0A 3VZMA 1IS3A 1FXZA 2VULA 3AFGA 4AEMA 1FYUA 1JYIA 1DGWX 2YPJA 3E6BA 2PHWA 2RS12 1GKBA 4N43C 3ZO0B 5KXDA 3AM2A 2R071 5LRRA 1UIJA 2XH6A 2Z79A 1YHFA 2QVSB 5EYYA 2P3JA 2WT0A 1DBNA 2C5DA 4X6RB 3PHMA 2RHPA 1QF3A 4PIYA 2VNRA 1RUE1 1O3TA 2AYHA 2BNMA 2FMYA 4LTAA 3LA2A 4CEYC 5H9SA 1CESA 1QDOA 3MEPA 4PIXA 4XFHA 1IS5A 4FBFA 3QH6A 1C28A 2LUWA 4XF9A 2B45X 2WZR1 4AWDA 4GKYA 2UWBA 4M00A 3H8UA 3FC0A 2OYZA 1KXGA 5JR7B 3BODA 2UWAA 3TN93 2RR13 3BOPA 4R9BA 1ZVFA 2EALA 3J4UH 2XBO2 2YUEA 4JGZC 3ZVXA 1LGNA 1S55A 1BQPA 4X8PA 5GZFA 3JD71 2XWBB 1IKQA 3EBRA 4Z92B 1LODA 1Z7S3 1NCRA 4HT1T 2WT1A 1PO21 1COV1 3U07A 2ZGTA 4AEDC 3NKTA 4Q1PA 1HRV3 3PNAA 1I6XA 1YLLA 2JE9A 4YGDA 2NMOA 2O0OA 4M01A 2IXJA 1RUD2 1RJ7A 1VJ2A 3D8CA 4MXWB 1TME3 4PDWC 4Q4Y2 4Y1UA 3VZLA 1EPWA 1VAKA 1QJY2 2BGCA 4RSUA 1EAH3 5CIRA 2R041 3KMHA 4P9JA 5C9AA 2E51A 3ZXGA 3HIFA 5ACA1 2UURA 4Z07A 1N1YA 1H30A 1GLHA 1LOEA 1LHVA 4GB32 4XJAA 1QOOA 4QPIB 1XQNA 3AZWA 4BWOA 1R1A2 3ZSEA 5F9TA 3ATGA 3MW3A 5D8AA 5EXOA 1GV9A 3A4UA 4B3NA 3KSCA 2WLQA 4BLJA 3ACLA 3IBMA 2BQPA 2GN7A 4Y4YA 4LO7A 4E2QA 2XL7A 3VDDC 5BXXA 1R1ZA 1CPMA 2ZHMA 2XJPA 1H0BA 4XTMA 4CDUC 2VNGA 5IK5A 1C1LA 1G6NA 2ZGOA 4YZ1A 3D82A 1RVF2 4XMIA 2VOWA 4JAAA 3USSA 1NE6A 3NAPC 1FPN3 3GHNA 2D6OX 4HVRA 3J26N 1ZZ9A 1FV3A 2YGLA 1KFXL 1ZNPA 3IDCB 4IERA 4OHXA 3RRDA 3ZFEC 3N7MA 1CAXA 2BNNA 3DGTA 2ZCWA 4Y20A 2WNUA 3AJZA 1J59A 1QOSA 5T5LA 1FOD2 1TMF3 3OY8B 4OHWA 3JB4C 2YYOA 1OOPC 5JOWA 3VBHC 5BUVA 1W0OA 5DDJ3 2QQPA 1YI9A 4WZFA 1ND2C 1Y43B 1Q56A 1UZYA 4LBQA 2UYAA 5EWSA 5KHHA 4FOWA 2YC0A 4RR3C 1J3QA 1D2SA 4KQ7A 4MGZE 5I8YA 3VKMA 4HK9A 2N7GA 2RS13 4C91A 1QXRA 2R16A 4NWWA 4YW4A 3VBUB 5K0UC 5JOXA 3FUOA 1D0HA 4YM0A 1JN2P 4PQ9A 4R9DA 4XPVA 2QCSB 4AI2A 2CGPA 1UU5A 2PA7A 3OD4A 3NWKA 2AREA 4UBGA 4LHLA 4YZ4A 4BH9A 4LO6B 5CFDA 4HPKA 2HKXA 1QXJA 4D69A 4I0WB 3H1MA 1V9U1 1B35C 4QQLA 4FOVA 2NP0A 3Q9OA 4AF9A 1O4TA 4Q4X2 5HBAA 1GSLA 4AE2A 1FATA 1UAIA 3N7LA 2I07B 5ABJA 2AH2A 4KU7A 2D5HA 2WINB 4Y1ZA 4GH4A 1R092 1G7YA 1SBFA 3MF9A 4FAHA 4BPZA 2GALA 2AGSA 1PM7A 3ZN5A 1Y7BA 5DZGA 4DY5A 1LHUA 2XUMA 4AYUA 1VBA2 1PO12 2PLV2 4FPLA 1BXHA 1RL3A 1CAVA 1H2NA 1W6QA 1ZBA2 2A6XA 2ZGSA 1MZEA 1CJDA 3CJIA 1WUVA 4A7YA 2VU9A 3VUOA 4XILA 4LA2A 1SBDA 1DQ4A 5I8TA 1RMU2 2GH8A 3OF1A 4EN7B 5EJ3A 5AFBA 1NCRB 1UN1A 1RUD3 2VGDA 5C8CC 1KRIA 4KU8A 3VBFA 1QJY3 2HEYF 1CAWB 2VECA 1WW4A 2G9GA 5JDBA 1DQ6A 1SLAA 5GJ6A 1Q43A 2FMDA 2I74A 3RMYA 4D94A 2A70A 4FPYA 3POSA 1O3RA 3N3HA 4AGVA 3VKLA 2MPFA 1R1A3 5FLJA 4S2FA 1POV3 4YVWA 3TOJA 1NLRA 1ZZ8A 3GBFA 3CLPA 3WDYA 1VIWB 5HCAA 1C4RA 2CL2A 2VMGA 2A73B 3M70A 1ENQA 4OHYA 1XNKA 1AR81 2QKDA 2ZZQA 3ALQA 5GZCA 4NO4A 2VVFA 1MVEA 3TWIA 5EV7A 1EAH1 3WXPA 1RITA 4AK3A 1Q5OA 2DCZA 2TUNA 4GQ7A 2YXSA 1APNA 3S6PA 4BQ1A 1N1SA 3WP6A 5GLTA 4LEJA 4XFGA 4JTNA 2DVFA 1RUF1 2RE9A 1S0JA 2YROA 2OUHA 4Y5Z0 1YIFA 4AHZA 3GHMA 3AKTA 4XIOA 2D7FA 1ENRA 2ET7A 1FOD3 1NA1C 1UIKA 2UWCA 1YO8A 4NN0A 4DINB 3RMXA 2PHXA 2NQYA 1H4GA 2VVDA 2G9FA 4LO4B 3JBG2 2QZ3A 2ZGMA 2WNUB 1ENXA 3LKJA 5BNOA 4QXKA 5FFOC 3THPA 3RJRA 3WW3A 1NCQB 3SNMA 3AKPA 1Y3TA 4OHZA 1VAMA 1LEDA 4U2AA 4LBQB 4P9XA 2D6LX 5CFCC 3H1YA 3IT8A 3C3VA 1FPN1 3HQXA 4RQPC 1PNGA 2XG3A 5AFEA 1O4ZA 2XJUA 1X82A 3BOWA 4Q4W1 4QHBA 5FREA 2WFF2 2WSVA 1IOAA 2HJIA 3APBA 4QGMA 1YCIA 1Q3EA 1LOGA 3N4MA 2VUJA 1AHSA 4XXAA 5FAXA 3WCSA 5KXCA 3NO8A 4KBBA 1MZ6A 3R4DB 2VOVA 2B8MA 2DUQA 5LK5A 3TB0A 1T6GC 1IZ3A 2MEV2 1IPJA 3AMPA 3N7JA 2SBAA 1BVVA 2Y26A 3C2UA 4LBNA 2DV9A 1DHKB 2RM22 1VR3A 3T1MA 3VZOA 4Q4X3 5CFDB 2EXKA 4QGLA 3KT4A 3S7EA 1PGL1 1SLLA 2RS52 2IWGB 1MZFA 1R093 3CU7A 3HMYA 5AVPA 4PIZA 1OA3A 1MS3A 2ZOEB 2BVBA 4LO5B 1V6KA 4KGQA 5ABJB 3KB5A 4I02A 5KHKA 3GBWA 2H0BA 3G6JB 1PVC2 1VBA3 1LKNA 1Q8QA 2HEWF 3R4SA 1PO13 4FVVA 2PLV3 4IV3B 4CEYA 2VY0A 4LR4A 1RUNA 4Q8KA 3WDUA 4CYDA 4E2SA 1ZBA3 1BEV1 4CDXA 1AL22 2GMEA 5JZGB 2DCKA 1RIRA 4YZ3A 3AKQA 1AYM2 4Q4V3 5FPXA 2DF7A 5I0SA 3KCXA 1W6QB 2FBEA 1QH7A 3FLTA 2EXHA 2HWD1 3CJIB 5LRSA 3VBRC 4ZXKA 5DUVA 1K5MA 2RMU3 3EJKA 3S0MA 3VKFC 4H7LA 2BUKA 2EVXA 2ENRA 4JGZA 3ZYJB 4K1ZA 1LGBA 4ISQA 4FT8A 1E57A 1JHNA 4JGYC 1SCSA 3AXDA 5DXDA 4XJ9A 5I0RA 4YG0A 4BLIA 3DV8A 2D98A 3H7YA 5I91A 3IN9A 3AX4A 4QU2A 1GZWA 1YFWA 3GBGA 3MW4A 1IS6A 2EF6A 2VPVA 4ASLA 3L2YA 3RS6A 4MGYE 4Y26A 5J3UA 4SBVA 4XQWA 1MEC2 2LTNA 4UXAA 4YVWB 1RUJ2 4DQAA 2ZGPA 2ZHLA 3ZMNA 4ITCA 2Q4SA 4AVVA 1J1LA