1M06G

Structural studies of bacteriophage alpha3 assembly, x-ray crystallography
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/dna
molecule keywords Capsid Protein
publication title Structural Studies of Bacteriophage alpha3 Assembly
pubmed doi rcsb
source organism Enterobacteria phage alpha3
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1m06G00
1ZBE2 1AR73 5D8AC 1FMD3 5A32B 2RS33 3JB8A 1AYN2 1NOVA 1EV11 1AR81 5AC91 4YVSC 1AR63 1HXS2 2GH8A 1BEV3 4JGYA 2HWE3 3J8F1 2RR12 3DPRB 4EJRA 4PDWC 2RS52 5BNPB 1EAH2 1ND2A 4CDQB 1OOPB 4CDXA 1VAKA 1FOD3 1NCRA 1ZBA2 1ND3A 2RMU2 4RHV1 4QPIB 5DDJ3 5ABJC 1R081 1VBB1 4FTSA 4NWWA 1MEC2 1QJU1 2X5IA 4Y4YA 1RUI2 4JGYB 1R091 1AR92 2HWB3 2HWD1 2BPA2 1ND2B 1BBT1 1AL21 1RUC2 1RB8G 4CDXB 3NAPA 1NCRB 1VBE1 2RM23 5BNOA 4RQPA 1ND3B 1RMU2 2RS13 3JB4C 3ZFFA 2R062 5ACA1 3JD71 1FPN3 1RUG3 2XBO1 2HWF1 1QJX2 2GSYA 1NA1A 1B35C 1TME2 3FBMA 1RHI2 2X5IB 5CFCC 1HRI2 2PLV1 4GMP0 3S6PA 4GMP1 1R1A2 1RUE2 1SMVA 3VBFC 3VBSC 1AR83 4CEWA 1PO21 1VBD1 1BMV2 1Z7S2 4CDUC 1DDLA 2HWC2 1NY72 2X5IC 3HAGA 1RUH2 3NAPB 5BNOB 1RUD2 4RQPB 1COV2 3TN91 4Q4X1 2VQ0A 1F2NA 4Q4W1 3ZFFB 1QJY1 4SBVA 1ASJ2 1PIV3 4YVSA 1QQP2 1VRH1 4PDWA 1R083 1AR72 4Q4Y3 1FMD2 1NA1B 1AYM2 2MEV3 2RS32 1VBC3 1AYN1 2R041 5BNNC 4CEWB 1QJU3 5ABJA 1NG0A 1NA1C 1AR62 3ZFEA 1BEV2 2HWE2 1R093 5JZGC 4CEWC 1AL0G 1FOD2 1ZBA1 2RMU1 4BCUA 5DDJ2 4YVSB 1AYM3 4GB33 1H8TA 4PDWB 3ZXAC 1TMF3 3JD73 3LOBA 1MEC1 5ABJB 1RUI1 1VBA3 4N43C 3ZFEB 4FTBA 1M06G 1AR91 2HWB2 1VBD3 1RUJ3 2WFF1 1B35A 1D4M3 2RM22 3ZFEC 1RVF3 1OHFA 5CFCA 2RS12 3VBFA 3VBSA 4Q4W3 1H8TB 4CDUA 1FPN2 1RUG2 1K5MC 1HRV1 1QJX1 2WS93 1H8TC 1HRI1 4N53C 2R071 1F8VA 1RUE1 1PO11 1AR82 1BMV1 1AUYA 2Y26A 4Z92B 4Q4V1 1B35B 1V9U1 1A6CA 2WZR1 3VBHC 3JBG3 1RUD1 5CFCB 4IV3C 5BNNA 4FSJA 3VBFB 3VBSB 4GH4C 1X33A 1MQTC 1PIV2 4CDUB 2FZ2A 2ZTNA 4NWVA 1PGL1 2FZ1A 1R082 5JZGA 4FTEA 1EV13 4Q4Y2 2BUKA 1PGW1 1PVC1 2MEV2 3VBOA 1VBC2 1C8NA 5AC93 2ZAHA 4WM8C 3CJIC 3J8F3 1QJU2 1AR61 1C8M1 1BEV1 1RUF1 2HWE1 5C4WC 1R092 2BBVA 5BNNB 4RHV3 2WFF3 2BFUS 5CFDC 1ZBE1 1VBB3 4RS5A 4GB32 3M8LA 4N43A 5JZGB 1TMF2 5J98B 4CDWA 3JD72 5FOJB 5FMOS 3VBOB 2WLPA 1HXS1 1HRV3 5C9AC 2RR11 2RS51 1VBA2 1EAH1 2HWD3 2R073 3IDEA 3VBOC 1BBT3 1PO13 1AL23 3VDDC 1K5MA 2HWB1 1VBE3 1VBD2 1RUJ2 1HX6A 4Q4V3 1D4M2 2RM21 1RVF2 1HQNA 1V9U3 2WZR3 4N53A 4RS5B 5ACA3 2IZWA 2RS11 2XBO3 4N43B 4Q4W2 2HWF3 2TBVA 3ZFGC 5J96B 1FPN1 1RUG1 1POV0 1IHMA 4CDWB 5C8CA 1POV1 4RS5C 5GKAC 2PLV3 5K0UC 3VBHA 2WS92 4GMP3 4IV3A 1PO23 3VBUC 1PVC3 4GH4A 2BFUL 4AEDC 4CDWC 2R042 1MQTA 1RUC1 1K5MB 1RMU1 1C8M3 3TN93 1RUF3 4Q4X3 1VB4A 2QQPA 2R061 5FMOL 1CD3G 1QJY3 3JBG2 4N53B 4WM8A 1VRH3 3CJIA 1ZBE3 1PIV1 1TME1 3DPRC 1RHI1 5C8CB 1X36A 5A33A 5BNPC 2ZZQA 4JGZA 5C4WA 2XPJA 1AYN3 2R043 1EV12 1OOPC 1R1A1 4Q4Y1 4CDQC 3VBHB 2MEV1 4IV3B 1VBC1 1Z7S1 4YVWA 2HWC1 4GH4B 5C8CC 5AC92 1NY71 4QPIC 5CFDA 1HXS3 1MQTB 3VBRA 1RUH1 3J8F2 2RR13 2RS53 1CJDA 1COV1 1EAH3 4WM7A 1ZBA3 5L7OA 1ASJ1 2RMU3 1QQP1 4RHV2 2WFF2 5C9AA 4WM8B 5LK7B 3CJIB 4IV1A 1AR71 1VBB2 4JGYC 1FMD1 1AYM1 1VB2A 2RS31 4GB31 1NCQA 4CEYA 5A33B 4JGZB 3VDDA 5C4WB 1ND2C 1TMF1 4Y5Z0 1MEC3 4CDXC 1NCRC 1POV3 1WCDJ 4YVWB 1ND3C 1RUI3 1HRV2 4RR3A 5CFDB 3VBRB 4JGZC 1AR93 1QJZA 1VBA1 2HWD2 2R072 3ZFGA 4WM7B 4LLFA 4YVWC 1FOD1 1BBT2 1PO12 1AL22 1RUC3 4QPGA 1VBE2 5L7OB 3VBRC 1RUJ1 5DDJ1 1RMU3 5D8AA 5K0UA 5C9AB 4Q4V2 1D4M1 4IV1B 1RVF1 3VBUA 2R063 4WM7C 1V9U2 1GFF2 2WZR2 4AEDA 5ACA2 2XBO2 5L7OC 1OPOA 1NCQB 4CEYB 2HWF2 3VDDB 1QJX3 5A32A 4IV1C 1TME3 3NAPC 1RHI3 5BNOC 4RFT0 4RQPC 1HRI3 1PGL2 2PLV2 4RR3B 2WS91 1R1A3 1NCQC 1RUE3 4CEYC 1PGW2 3ZFFC 1PO22 1PVC2 1Z7S3 2HWC3 1W39A 3ZFGB 1E57A 3DPRA 1RUH3 4QPGB 4RR3C 5BNPA 1RUD3 1COV3 1C8M2 1OOPA 1RUF2 4Q4X2 5D8AB 3TN92 4CDQA 5K0UB 1QJY2 3VBUB 3JBG1 4AEDB 4QPIA 1ASJ3 4QPGC 1QQP3 1VRH2 2WWSA 2DF7A
chains in the Genus database with same CATH superfamily
1LULA 4IERA 3OSDA 4ITCA 1W6MA 5JOYA 3D8CA 3WW4A 2XOMA 2D93A 4KWKA 1DG6A 3MFCA 4QM8A 3S5AA 5AFBA 3MIBA 1AYN2 1V6NA 1W8NA 3TWIA 4LJHA 3JUUA 2GMEA 4QM9A 1LHOA 2ADDA 2JG8C 1AR81 3D0JA 2F6BA 3ZSJA 5C8WA 3SNMA 1G7YA 2QE3A 2VGDA 1AR63 3PJQA 1HXS2 4Q26A 5FZBA 4JGYA 2HWE3 3M3EA 3AP4A 1YQ8A 4PDWC 3OOXA 2ZGPA 4IEYA 1FT9A 3OD0A 5BNPB 2JDMA 5IVCA 1EAH2 1XYPA 3TEXA 3QCWA 3MBWA 4CDQB 4YG3A 4LKDA 1FOD3 1ZBA2 5GALA 3J7MA 2XLFA 5B4NA 2YBSA 4Y22B 1CAVA 4JTNA 2A73B 2VCAA 5I0RA 1OF3A 1GICA 3H42B 4P9GA 1W6MB 1XNTA 3LA3A 4G3YC 2AC1A 4XHXA 1FYUA 5IVEA 4XURA 4XDQA 5LATA 4QGLA 1UX6A 2OA2A 3KM5A 1KJRA 4AXOA 2AUYA 2XJQA 4C90A 5JPNB 2FQPA 5FQ0A 4Z8BA 2X5IA 5LK5A 5T54A 2XONA 3I2KA 3U10A 5C70A 1GYKA 1SPPA 3PVNA 2CNAA 1XQNA 2R1BA 1YQ6A 1MZ5A 4JGYB 3RMYA 1R091 4XILA 4QDQA 4QAWA 1TZOA 1BCXA 1PM4A 3KV6A 1DCSA 2NQYA 3BCWA 4HVOA 3S30A 4DO0A 5F3CA 4KU7A 1RB8G 2GNMA 4UT5A 3Q8BA 4DNYA 3SKJE 3NAPA 1KGYA 5GM0A 1VBE1 4A6SA 4D7YA 5FPUA 2RM23 2OZ6A 1W9TA 3U75A 2R30A 2A6XA 4XXAA 4N7IA 2LRPA 2GMPA 5FZCA 1CAVB 2OXBA 3O0XA 3JB4C 5LWBA 4YM3A 4K3UA 2ZOEB 2LALA 5JXHA 3AKRA 5CG9A 2VZPA 3JD71 1K42A 3HQUA 2D7FA 5FMBA 2XWBB 4DOUA 3VL8A 2HWF1 4JRAA 4E2GA 4YZ3A 2GSYA 3SLIA 1B35C 5FQ0B 2BGCA 2BEOA 3FBMA 1ZZ8A 2X5IB 4UFMA 4X6QB 1SPPB 4GMP0 3GM8A 1ZZ6A 4WZFA 3A0KA 4LBQA 2YY1A 4CEWA 1PO21 2EIGA 2ZGUA 3PMSA 4KL1A 2QQWA 3RG0A 4Q0VA 5J1XA 4L11A 2WT1A 3PUHA 2VVEA 1NY72 5EJ1B 1ZNPA 3SQOA 4BQ1A 5AVPA 5IVJA 1SBFA 2VE1A 1VR3A 2P17A 3NAPB 5FY1A 3J26N 1K3IA 5CIRA 3TOJA 5C3QA 4OI0A 1RUD2 1XNKA 3T0AA 1CONA 2W46A 4TXWA 3D0SA 4DB5A 1MS5A 1N1YA 1TG7A 2QTWB 3I7DA 3T2TA 5FZ6A 4YVSA 1H0BA 1UMZA 4D94A 3I49A 1YIPA 3E5QA 4LBMA 1V6KA 1R083 1X9PA 2ATFA 5F3IA 2ADEA 2VZUA 3MV01 4Q4Y3 4ARXA 3RDIA 5JUVA 4YLZA 3H8RA 2MEV3 4GZ9A 4AFMA 3KS7A 1VBC3 4P9IA 4ISQA 4YG6A 5LY1A 4LITA 1LOFA 2OVUA 1W9YA 1WLDA 3F2ZA 1QXJA 1S1AA 4CEWB 2AENA 3VD9A 1NA1C 1AR62 1JBCA 3NNGA 1CESA 4K1YA 4W65A 3VZJA 2HWE2 4YW2A 3FX3A 3R4SA 1OA2A 3MLKA 4JAAA 4B4RA 2P34A 4PBOA 3WQ1A 1WMEA 3CZUA 2A6ZA 4AQTA 1FX5A 1UOJA 4QD2A 1GP4A 2GAUA 4OZOA 1FOD2 2VMDA 3AZYA 3U11A 5IAXA 4EN9B 3LEKA 1BK1A 1W2AX 3M1HA 4AAXA 1V6MA 3DEMA 3M3OA 4XVHA 4YVSB 4BCUA 1DYKA 2WWJA 3NW4A 5DUUA 3KHCA 1D2SA 4XUOA 1H8TA 1K45A 3ZXAC 4OYUA 3AVRA 2YC4A 1ZZ9A 2WO7A 5FPZA 3LOBA 3E5XA 1LTEA 3D3AA 1V70A 2C26A 1JN2P 3CU7A 1TNRA 3OGGA 3VGIA 3KZ4C 1YNAA 2ZGTA 3HVDA 3LPFA 4XQWA 4XCAA 2B9VA 4ASMB 3H8UA 3OUHA 4XTPA 1I6XA 1OF4A 1OLMA 3D4KA 5DG1A 4CP1A 5F37A 2FDKA 1BYHA 1JOBA 1OD5A 2W1UA 4XFHA 4ZXEA 5LBCA 5CKNA 2JKXA 4J25A 1HB2A 3N7JA 3RWKX 1JHJA 4FT8A 2BBAA 1UIJA 3AX4A 1REDA 2RM22 1WW7A 4XDOA 1B09A 1UAIA 3ZYFA 4CP9A 5CFCA 1YJKA 1BVP1 4W8JA 4NROA 3VBFA 5FJHA 3VBSA 4FOQA 4HK9A 3GJAA 3E6CC 1H8TB 2VW1A 2D6LX 1QDOA 2G19A 1DF0A 2J1EA 1TE1B 2RJKA 3BODA 4DY3A 1JXNA 2AZ5A 5B2GB 1REEA 1S2EA 1SZBA 2P3KA 2W5FA 4N9IA 1ACCA 4XF3A 3WHTA 2ZHNA 1HRV1 4XFAA 3RI8A 5I0SA 1GBGA 3A21A 1WCUA 3I2DA 4Y1UA 2VU9A 3VZOA 4L92A 4J1WA 2JX9A 3SCFA 3HEIA 1N3PA 5LY2A 1F8VA 3X29B 1RUE1 2CU5A 1PO11 1OC1A 2WKKA 3KT4A 4LR4A 1BMV1 1A3KA 2ILMA 2YB7A 3UGFA 1SHWB 1UYPA 3R0RA 4MGKE 5FPBA 5JIUA 3WQ7A 2ES3A 1Y7BA 2C9KA 4WVVA 4CCDA 3IAQA 3O12A 3EO6A 3PVEA 1V9U1 4Q0SA 5F6KA 4L0PA 2XWJB 4CP9B 4E8CA 2D97A 5CFCB 1C28A 3ZXGA 3PIGA 1IOAA 3UYJA 2W91A 3VBFB 3WG2A 2WNEA 3I2IA 3VBSB 5IK5A 1X33A 3WF2A 3DKQA 2DDUA 4AVCA 2H6BA 4WV8A 3H3ZA 4NN0A 2ZTNA 1U5IA 5JVVA 2YG0A 4NWVA 3ITQA 1R082 2W2IA 4DRRA 4Z1VA 1HW5A 4Q4Y2 5JZGA 5FZ9A 4FTEA 5JOXA 4QKNA 2GZWA 2PHXA 2E33A 2MEV2 5FMCA 4ZZ5A 5FIXA 5DZFA 1VBC2 2QQIA 4NPMA 4QXKA 5LBFA 1NE6A 4KGGA 2VW2A 3E97A 3RMXA 5A3PA 4YM2A 5LA1A 1H4HA 4RSUA 5ERLA 4RFRB 2NN8A 3SCHA 2DUQA 2IXHA 1LAJA 2XJTA 1OVPA 1BEV1 2BWCA 3N7MA 1BKZA 4LQRA 4MADA 3OBAA 4BQ5A 3W59A 4A7KA 1GOFA 2JB4A 2RVAA 5L36A 3TN92 3MI8A 2WFF3 3OUIA 2ZMLA 4XBLA 1D0GA 3POGA 4RS5A 2VBBA 3RI9A 2WNOA 4MVTA 4DXSA 1VMFA 4JKMA 2GC3A 3NV2A 4W6XA 5JZGB 2WN2A 5J98B 4AVSA 3MZHA 2WT0A 4CCNA 1FNZA 5IK8A 2EXIA 2XGXA 4HSJA 5CVRA 2ZX0A 1WMFA 1ULOA 2NLRA 2LROA 1HXS1 1F4AA 1URXA 3IBMA 2FHRA 1CPMA 3O0WA 3QOPA 3MGUA 3SXWA 1UXXX 1A78A 2I07B 3BI3A 1OKQA 1EAH1 2V5YA 3DECA 1S0CA 1ULEA 4YW3A 1CX4A 4U36A 4OMCA 3VDDC 3MFAA 1K5MA 1GQHA 1KS5A 1AVBA 1SBEA 2HWB1 1VBE3 4GIQA 4CRQA 1GZWA 5EJ3A 4AEMA 3KCXA 2BJSA 3BOWA 1W8ZA 3VZLA 4PF1A 3E6BA 3GBWA 4N53A 4RS5B 4ASLA 4UYBA 1VP6A 2RS11 4B4QA 4BA6A 1O91A 1YWKA 1W28A 4K8FA 2NMOA 3B01A 1T2XA 2EIDA 2HWF3 1W6OA 4LKEA 2TBVA 4OFGA 4QKFA 5F5CA 1LHUA 1IHMA 3THPA 1LOEA 4XFCA 1UD1A 4IXLA 1MZEA 3K46A 4AQ2A 2FDIA 2W94A 5GKAC 4XJAA 5E16A 1S0GA 2A5ZA 1JZ4A 5FREA 5FYHA 2N7GA 2WQ8A 2ET7A 2YU1A 3DGTA 4LO6B 1PO23 1OD3A 1PVC3 1UY1A 2P1BA 3VBUC 4AEDC 2CGPA 4PQ9A 2R042 2P4EA 4IGOA 3USUA 3U4SA 1N1VA 2E26A 1JZ3A 3OB8A 3T2QA 1K5MB 1G9FA 1YLLA 1GZWB 2ZGNA 4AQ6A 2IFRA 3SH3A 5JCTA 1PK6C 4UFJA 2Q30A 4IUGA 2VXJA 2KXLA 2YC0A 2ZPXA 4MGSA 4QHOA 1N3QA 2ZGMA 2ZX3A 3BOPA 4N53B 4OHZA 1W90A 4WM8A 4LLOA 3CJIA 3ZDSA 3RS6A 5CKMA 1W6OB 3NNMA 1ZBE3 4OCTA 5IT6A 1PIV1 2XR4A 3UGHA 3A22A 3KT7A 3R6SA 2HH9A 5A3WA 2ZZQA 3VV1A 4Q1PA 3WF3A 5C4WA 4BMEA 2XPJA 4BMBA 2B7YA 3AXEA 3VKMA 5LEJA 1RUNA 1GKBA 2HEVF 2HKXA 3HWJA 4DPNA 2ZMKA 2R1DA 5DXDA 1NY71 1H6YA 2W95A 4AEKA 3USUB 1GZTA 2KD7A 2JICA 3GNEA 4CU9A 1UO9A 1ZA4A 4XZPA 5HPOA 4AZZA 4Q5OA 4F83A 3NKGA 2PTMA 3CMGA 2WNUA 4P08A 4WM7A 1RTVA 2Q8CA 3WNMA 1C1FA 1OKOA 3NVCA 1GLHA 4CA9A 1YUDA 4QB1A 2JDYA 5FY5A 3TEZA 5FYTA 2WFF2 1JYCA 5H9SA 5C9AA 4UW5A 3WG1A 4WM8B 5LK7B 4FAHA 1L7LA 3CJIB 1UWWA 4M0NA 4PIYA 5DAVA 3ZKYA 2VJXA 1ZREA 2BU9A 3T08A 2CL2A 3AJZA 1DHKB 5A6ZA 4PIXA 1NLRA 4IQPA 3QBQA 5C4WB 1MVEA 1ND2C 3IMNA 1E5HA 4CDXC 1W8FA 2I45A 1NCRC 2ZBJA 3C3VA 4IEZA 3V0BA 5FZ7A 1HN0A 4BQYA 5FZLA 3ZN4A 4K7JA 5T3NA 2WNUB 4WM7B 1FOD1 2QVSB 1FXZA 4QPGA 2BDRA 4Y33A 1VBE2 5HXMA 2DCKA 1Q8SA 4GWJA 3ZLIA 1C1LA 2VOWA 4Y1VA 1QY4A 2GC2A 1RMU3 5K0UA 4WVWA 5C9AB 1O3QA 1GP6A 2W0XA 5CEHA 1D4M1 3LE0A 1RVF1 2WJSA 2JB8A 4AHXA 2R063 3I2OA 4OULA 5FKCA 1QOOA 3ILRA 4DUXA 2JG8A 5L7OC 4S2FA 2HWF2 1W9WA 1GMMA 2HJIA 2VMEA 2XHNA 4P9XA 2PQQA 3KV4A 3GHNA 4KWUA 1LOAA 1TME3 4HKWA 5KC5A 1Q8VA 2R6QA 4EN7B 4UBHA 4XFBA 1PGL2 1W04A 5E89A 2MHFA 3V0BB 1RUE3 4XEZA 4BLJA 3ZFFC 1PO22 2HEYF 1PVC2 1J84A 3AL6A 4QB2A 5EV7A 3VZKA 2E53A 2PHTA 5H9QA 3MLJA 3ZPYA 4UFIA 4HFSA 4X8PA 1RUH3 2QQOA 4QPGB 4XDPA 4RR3C 3UKVA 1JZ5A 1XYNA 1QJEA 2VTFA 3U1XA 2PAMA 2QQMA 3T2OA 4TTGA 1COV3 4FFHA 5K0UB 4LEJA 5GLZA 1W05A 3GXUA 1K5JA 3O14A 4NIHA 1KRIA 1UMIA 3IDBB 2BVBA 1DGRA 2A6WA 1W6PA 4XPVA 3O7OA 4QPIA 1ASJ3 2DVBA 2JG8B 4A7ZA 5F2SA 2D6OX 3WW3A 1ZBE2 5D8AC 1AX1A 1WW6A 3KVBA 3NMBA 5J09A 2V09A 1YCIA 5BY5A 4AL9A 4ATFA 4ZKTB 3PU3A 2O1QA 4TWTA 4LE3A 5T55A 1XC6A 1MPXA 4Q1RA 4BXSV 4GKXA 4OUSA 2CWMA 3DYPA 2VZRA 2QQLA 2DFBA 3AKTA 4BOWA 1BEV3 1W03A 4W6YA 5FZGA 5FP4A 3J8F1 2IUWA 4CUGA 3CL1A 1J83A 2YFZA 3LDRA 1Q8QA 1W06A 2EAKA 1ST8A 3FLTA 1PNFA 1PX4A 4LO7A 4OQ9A 4PLNA 1F31A 1VAKA 2JD9A 2O14A 4I30A 1N3OA 4NVPA 3U07A 1ZVFA 4R9CA 1W6PB 3NJVA 1UY0A 1ND3A 3HMYA 3MV11 4HXCA 2WABA 5DUXA 4QPIB 4BQ3A 5DDJ3 1GU3A 1WKYA 2PHDA 4E27A 4AEJA 1LKNA 1HB4A 4HETA 4B29A 5FBJA 1GR3A 1R081 1VBB1 2V4AA 4GKYA 3I8TA 3MW2A 4HL0A 4FPYA 4ES8A 1JYIA 4BZ4A 3RZKA 3WW2A 4I3PA 1I9RA 4IE6A 4FTSA 4FFFA 1O4YA 2PHRA 2VC9A 3C7OA 4R9DA 5C6CA 4NR1A 1DQ4A 2ZGLA 3S5QA 3K3NA 3ZPOA 3E1F1 3VDCA 2ZCWA 4XQ4A 4ZZ8A 1XPWA 3FN9A 1JYWA 2GALA 3OJBA 5FYVA 1W8WA 2XKOA 5DUWA 5C3OA 2HWB3 2VNOA 4HVRA 2VECA 4LBOA 3GALA 2W08A 1BBT1 4NHLA 1AL21 3VD5A 5LRRA 4AVAA 5CAZA 5EZWA 4XABA 4CU8A 2WYFA 1ND3B 4RQPA 1RMU2 3AB0A 2RS13 3ES4A 2Z79A 2XJPA 2E51A 4KH9A 3T30A 3ZR6A 4AGRA 3WG4A 4EN6B 2R062 4L8QA 1RXFA 5ACA1 2FDFA 5HXVA 1E5SA 3ACFA 4GAZA 1WCKA 3POWA 1HB3A 3VDBA 1Q5OA 1TNFA 1NA1A 2BOIA 4O61A 3AFGA 1TME2 3POSA 5KHIA 5FZ3A 2W3JA 1CX1A 2WSVA 3ZX7A 1J3QA 3ZXJA 3SHRA 1KXGA 4GMP1 1GOHA 1RUE2 3EMRA 1OLRA 5FOBB 1H9PA 4IE4A 3FZ3A 4PLOA 3POJA 1BMV2 2VZTA 2JIGA 3SEPA 4EYUA 2XQRA 1RUH2 5FZ1A 2FBEA 5CISA 3RZZA 4KU8A 2JENA 3ZDVA 4HMZA 5F9TA 4NUBA 4AW7A 2UY8A 4RQPB 1COV2 4Y1XA 2PA7A 3ORJA 3TN91 4QQLA 1CIWA 1OUXA 3VKOA 5LZ6A 4H55A 3PL0A 4P5HA 2FDGA 1E5IA 1KDMA 4SBVA 1F15A 1ASJ2 1PIV3 1UPIA 3IT8A 4EZ4A 2QKDA 5FYSA 3OPWA 4W4ZA 3ZYBA 2QQKA 1O6UA 3JXSA 4YW6A 3ZXFA 3A7QA 5IK4A 3S0MA 4NIGA 4Z2WA 3NO8A 2XB6C 5SV8A 4MHUA 1NA1B 1LRHA 1AYM2 3LFMA 5K0UC 2PQSA 1JODA 3QH7A 2R041 5BNNC 3SISA 3AZVA 3IDAA 4QWNA 4DMIA 4Q8KA 2VQUA 1X8MA 2DUPA 4A6OA 5IJRA 2EXKA 1V6LA 5LA0A 1QJU3 2VVFA 3KCYA 5ABJA 4A44A 4XQDA 2J7MA 4QX0A 1P8JA 1BEV2 3FHQA 4YGBA 5IAVA 2QZ3A 3GDBA 4MZUA 1I1EA 2I2SA 3BTXA 3O1PA 3AZZA 3F95A 4RGKA 4D69A 3DN7A 5IVFA 1LR5A 1DBNA 2Z69A 4E4SA 1S0EA 1IPKA 4ZONA 5DDJ2 2IC1A 2Y8KA 3KVAA 2WQ4A 5JOZA 2AR6A 1MS9A 4NMIA 5FUIA 3LIGA 2W87A 4I01A 4P02B 2BOJA 4TSVA 2W68A 2ZX2A 3ZSMA 1RJ7A 3WDXA 1H2MA 4FP3A 1E5RA 2D40A 1MEC1 1H30A 4XACA 4DQAA 4KWJA 5JR2A 2VOXA 2GH2A 2IXJA 5ABJB 4EZHA 2JE8A 4QHZA 4N43C 2JDZA 2JE9A 1GSLA 1AR91 2HWB2 3WCRA 4A3ZA 4FFGA 4JRLA 4H3WA 1LGCA 2A3YA 3IIAA 2WFF1 2X10A 4JCKA 5A6YA 5FZMA 4HKOA 1UNBA 3USSA 3H9AA 5K9YA 2WQZC 2ZHLA 2ZGSA 3UKNA 3O1OA 4M3CF 4XIKA 1D4M3 2G9FA 3HQRA 3T0BA 1RVF3 3ZFEC 4FPHA 4RGAA 2RS12 5E6HA 4CUCA 1O3RA 1S0IA 1H6XA 1NQJA 1D2QA 4Q4W3 3I3QA 1VLNA 3GCWA 4CDUA 1LU2A 4HG6B 2YUEA 4HBNA 4NHMA 4CXWA 3D82A 1XSRA 3H50A 2WN3A 3WNOA 1QJX1 3ZO0B 1W2TA 2K0GA 4MG2A 4XFFA 4S2DA 1LHWA 1HQWA 1WWYA 1C5HA 3BTAA 1SCSA 1IS6A 2R0HA 2VO5A 4SLIA 5FXXA 5KHHA 3VKLA 2BWAA 1O3SA 3ASIA 4XTMA 4BQ4A 1K12A 5EYYA 4B1LA 5T5OA 1QOSA 1YYNA 3HN3A 3NNLA 4O9GA 4V2WA 1DP0A 2WR9A 4JQRA 1JU3A 3A0NA 4UFLA 3AJYA 1YIFA 4NO4A 4QX3A 3V56A 3VBHC 4H2AA 4PQQA 3OY8A 2Y64A 2Z5WA 3ELNA 4FSJA 2CY6A 2G1MA 3ZVXA 4P9WA 4XJWA 4GH4C 4IEOA 3PUSA 1U0AA 2A7AA 1WMDA 2JJ6A 1HJGA 2WO1A 1MQTC 1PM7A 2JDHA 2X8KA 3WP6A 4XUNA 1PIV2 4M4PA 3LD8A 4AK3A 1MR5A 4I09A 4CDUB 2FZ2A 5L73A 2PHWA 4BPZA 3R4DB 1PGL1 2FZ1A 4JTOA 2GN7A 3LA7A 1I3HA 1Y43B 3ACIA 1L7RA 3P3PA 1PVC1 3ZM8A 3ZMOA 3L2YA 1Y9QA 1YJLA 3SITA 3ZR5A 1MS4A 1PHMA 2QZ2A 2UU8A 3AKPA 4XJ9A 2YC2A 2ZZJA 2UY9A 2XDVA 2I74A 4HZFA 3N9LA 3T1LA 1S0FA 3J8F3 1QJU2 1W0PA 1XSQA 1ZA7A 3LEIA 3PHMA 2WZEA 5JMCA 3JCIA 4R4ZA 3J7LA 3RJ2X 3PTRB 2VZSA 4YW7A 1WD4A 1RITA 4TN7A 4LK6A 2QQJA 5IUQA 3J9SA 4AHWA 3GZTB 2BBVA 4NIAA 4LBJA 2YFUA 4AFAA 2KA3A 3OY8B 1DGRN 1DQ1A 3WDVA 1LEDA 2VUJA 2IXLA 3BGAA 5CFDC 5D2AA 1ZBE1 2UWAA 1VBB3 2F17A 3H7YA 3T09A 2D3SA 4DS0A 2VMHA 1XBFA 2VTXJ 3HOBA 3ZXLA 5CG8A 2PHUA 1NXD1 1RINA 2QNKA 2C6SA 1N1TA 4LBQB 1CAXA 1XE0A 5EFUA 5FOJB 4BJ0A 2YV8A 4DRVA 4YW1A 1H1AA 5EIYB 3U14A 5JXIA 4IEWA 3IMMA 2NM1A 1BK0A 4NHYA 4D0QA 4MGIE 5JR7B 3RYRA 2ZMNA 4R9AA 2DCJA 3IDEA 5EPAA 2DFCA 3VBOC 5GLTA 1BBT3 1AL23 2B39A 5A7QA 1RJ8A 4YNIA 3MPBA 3AZXA 1Z78A 3C7EA 3HNYM 4YM1A 2W9XA 1D4M2 1DLLA 2QDRA 1RVF2 3ZXDA 3RZJA 2WZR3 5ACA3 3W5MA 1XU1A 4MUVA 4FVVA 2BNOA 1ZZ7A 1V0AA 3BPZA 4Q4W2 2Q1FA 2VCMA 3RJRA 1OH4A 2WO2A 3H3LA 3ZFGC 4MXVA 2E6VA 1FPN1 1RUG1 1CAXB 3UL2A 4NE9A 3K77A 2AACA 4HPKA 2XLGA 3D5OA 1UOBA 4FPEA 1SDDB 1T6GC 2ZGQA 3IB3A 4GMP3 2OPKA 2CDPA 4IV3A 5IVVA 3AMQA 3OYWA 1ALYA 1CPNA 1PMJX 2JXAA 5HCAA 2W1SA 1LEMA 3LB9A 1OPMA 3ZYGA 1OLME 2G4IA 1MZFA 4LKSA 2J22A 3O1TA 1LHNA 4JDOA 2AGSA 1UPSA 3SH4A 2ORXA 1RMU1 4HANA 3WG3A 1BXHA 1C8M3 3TN93 2NZ9A 3CF6E 3IKWA 4XJZA 2R061 4M3CA 4QX5A 1CD3G 1ODMA 3IIIA 2K46A 1U5ZA 4L97A 1OA4A 2EXJA 2BVVA 1FI2A 2WBKA 1I5ZA 2NP0A 2BNMA 3W20A 2ZX4A 3CO2A 2J1RA 3FE5A 2Q4SA 3FHIB 2ZACA 1TME1 1DQ2A 5CNAA 1X36A 3ZSKA 1NXMA 2CHHA 4RGGA 4RL7A 3WDWA 4HPKB 5BNPC 4M01A 2R043 3C7FA 3GGLA 3ZYIB 1VAMA 5FCCA 5FYZA 4CDQC 2D3RA 3I3EA 5FY8A 4IV3B 5IK7A 1G9BA 1XNCA 1LENA 3AZWA 3OYWB 1DZRA 3MIHA 4S2HA 2DCTA 3IN9A 4PF5A 3P5BA 1O5LA 4FO9A 5LA2A 3OBRA 4F8AA 1RUH1 4QDSA 2VOTA 4ZS3A 3J8F2 1H9WA 2RS53 4CCLA 1DIWA 1COV1 5FZEA 4L99A 2LUWA 3WNKA 3KWVA 4KBZA 1YRZA 3K51A 2EVXA 4Q27A 4FXKB 2JWPA 2VAUA 5FPLA 5L7OA 4M3CB 1KFXL 2GNBA 5T5JA 1S0BA 3WF4A 1ASJ1 3WVJA 1UL9A 1JZ7A 3RZHA 1W6QA 5IWFA 3SCGA 1H2KA 3MIDA 5C33A 1DQ0A 1WMXA 3H8OA 1VBB2 1W6NA 4LO5B 4JGYC 3POYA 4LORA 5EYXA 4Z2AA 1AYM1 5JXJA 4GB31 3NJZA 3P6BA 3CNAA 4MYEA 1C4RA 3JZVA 5GZCA 5BXXA 2BERA 1TMF1 4AFDA 1GV9A 3B94A 3BIWE 4FP2A 4Y5Z0 5E8AA 1MEC3 1VRBA 2R7EB 4ZY9A 1KEXA 1WCDJ 5FK8A 1ZRCA 2Y0OA 1I5PA 4RR3A 3T0DA 1UYZA 3DYMA 4TYSA 4IEVA 1HKDA 1WUVA 1CIYA 4RA0A 1AR93 1VBA1 5G04L 5A1LA 4YVWC 1BBT2 4RD7A 1AL22 4CVUA 1JYXA 1NKGA 4COWA 2D44A 2GMMA 3VBRC 4YM0A 5L7OB 5APAA 1RUJ1 1UMHA 4UF0A 4YGDA 5DDJ1 2UWBA 1W6QB 5D8AA 1XE7A 3FLPA 2RJLA 1KJLA 3B5LB 1OI6A 4LO4B 1W6NB 2WZR2 1IPSA 1DGLA 3U78A 5ACA2 3KQ4B 1LNSA 1UN1A 2ZHMA 1DGWX 3DV8A 2G9GA 1D0HA 4IESA 3T4HB 2ID4A 1NZCA 5A6XA 1O8SA 2PAKA 1QJX3 3LFIA 4LHSA 5DUVA 5F39A 3UESA 5BYNA 5TSWA 2J42A 5A32A 4IV1C 2DVAA 3NAPC 5HV4A 1RHI3 5DMYA 2D43A 4RFT0 5DZGA 4RR3B 1ZZCA 2WS91 5K4LA 1R1A3 1DZTA 3B02A 3WDUA 1PGW2 1JHNA 3OBTA 2QFEA 3NNFA 3ZYRA 1LGBA 2CSGA 2ZKNA 5KC6A 3K4ZA 3AC0A 1W39A 4FPFA 2ZJCA 3QH6A 1JU4A 3K2OA 4CU6A 2R49A 3TEWA 2O8QA 3DPRA 1CZSA 3V65A 4NPRA 4UF0B 1QEXA 2CAVA 1C8M2 1OOPA 1BQPA 2DBNA 4LPLA 2GN3A 5D8AB 1PVXA 2X29A 4ET7A 3DXUA 5IATA 3WX5A 2A3WA 1SLAA 5CKQA 3SH5A 4AI3A 2ZEXA 2Y6GA 3N9QA 5BV6A 5I91A 1HIXA 3N9NA 2DF7A 4ZU7A 2ZHKA 1OT5A 3RVHA 5IVYA 1JYVA 1FMD3 2UURA 5A32B 3J7HA 3ALQA 1ULFA 2RS33 2ZA9A 4KQ7A 3I59A 3JB8A 4OI2A 4QKBA 3AVSA 4NJ4A 1FNYA 1FV3A 1PNGA 4B4PA 1YQCA 1RL3A 2KR2A 1EPWA 4QXBA 1KQRA 2JDAA 4QT6A 2A75A 1WA6X 5E88A 1SBDA 1W8OA 3ILFA 4TLGA 4YVSC 1FATA 2H6CA 3M70A 2YZ4A 2FDJA 3KB5A 4HT1T 3DPRB 4EJRA 3J4UH 3FHAA 2RS52 4NRMA 1WA4A 3ZXKA 1AX0A 4CP2A 4D7TA 1OOPB 4AI2A 1NAEA 2YMZA 3CDZB 2Y38A 5KBFA 1LOFC 1S55A 4BB3A 3VL9A 2BRTA 2GNTA 3RSJA 1VE0A 4RHV1 2FCVA 4AFCA 1MS3A 2BYVE 5L19A 3POIA 4JDNA 3TEYA 3EQEA 2JG9A 5L9RA 3N3HA 1GNYA 1O4TA 1YQ5A 3AP6A 3I59B 4NPLA 2DWRA 2F4PA 2QQUA 3FUOA 1MEC2 2BW8A 1OBNA 3ZIXA 1QJU1 2E31A 3LWCA 4Y4YA 5A3LA 3GZAA 2D6MA 4Y5TA 4YPJA 3AYEA 3ACHA 1QH7A 1XU2A 2X05A 1M4WA 4IEUA 5LBEA 5C3SA 3OG2A 3H0OA 1ZRRA 4UXAA 5HCFA 3WR0A 1YFXA 5FYUA 1JUIA 1AR92 2HWD1 4CP0A 1G9DA 1RXGA 1UZZA 2WSUA 1PMIA 2WFPA 3UT0A 4IDZA 3SC7X 3WCSA 2E63A 4OHXA 5BNOA 2ZEZA 3AP7A 4FOYA 4FOWA 4XFIA 2OUJA 1ODNA 1JMUB 4GULA 3BYWA 3MEPA 2CV6A 1J59A 3AMHA 4HSLA 5FZDA 2P5BA 1BHGA 1FPN3 1RUG3 1R1ZA 2JG9B 2XBO1 5D1IA 2EA7A 1Y3TA 2G9ZA 4ARYA 1O59A 4BIFA 4E4HA 4EN8B 4PBPA 1EUUA 1QJX2 4ISRA 1MS8A 5CBLA 2JD4A 2E7QA 5F5AA 3ACGA 4FPLA 4IE5A 1RHI2 1SG3A 4BDVB 4PHZA 4NHXA 4O9EA 2B42B 5CFCC 2VNVA 2O8OA 5GZEA 5I8SA 1LCLA 3VBFC 1R1A2 4LBLA 3VBSC 1HV0A 2Z2SB 4XMIA 3VHPA 2MNGA 4IL7A 4QX7A 5FY0A 4B1MA 1DDLA 5FXVA 4LK7A 1UCXA 3ECQA 3KT1A 3L2HA 3MO4A 2DV9A 4AGGA 2R0FA 4O65A 5FBZA 2ZGKA 4QGMA 3RPQA 5BNOB 1UU6A 1JW6A 3KCCA 4MO3M 2OIIA 4Q4X1 2VQ0A 2PFWA 1F2NA 2JDNA 4OUEA 4Q4W1 4LT5A 1QJY1 1V6OA 2ET1A 3NNJA 4X6RB 4JKLA 3MF6A 4LBNA 4AI1A 3ME2A 4AG4A 3BUCA 3KSCA 1VRH1 3V0AA 3K4DA 4PDWA 5T50A 1F35A 1PZ9A 4XUTA 4ZXKA 1ENSA 4B3NA 2DCYA 4O7XA 1FMD2 4D6RA 3Q8EA 4BE3A 2R16A 2RS32 1QWRA 4YW4A 4JX0A 5CYYA 5A70A 1OQEA 2VMGA 4C1XA 3APBA 1VJ2A 3IZOA 4HKLA 5FZ0A 4C0BA 1NG0A 2CWSA 4CE8A 3MUZ1 5A3TA 2JKBA 2BTVC 2QBXA 1SDWA 1DU3D 1YC61 4IEPA 4YGCA 3LDBA 5T5LA 3ZFEA 1RC6A 2CYFA 3BN6A 3QLQA 4ORFA 2GC0A 4ES9A 5JZGC 1APNA 2W47A 5FYBA 1TQ5A 4OVEA 4LO8A 3TBDA 4K40A 4H14A 3IWZA 5DZEA 2BQPA 1AL0G 2HEWF 2WYSA 5GZFA 1KS4A 2JDPA 3GBGA 3HNMA 3PTYA 3RWNA 1PMHX 2RMU1 2PYTA 4URAA 1W3VA 1W3XA 3FWEA 5F32A 1AYM3 4GB33 4OMDA 3HQXA 4FXGB 3V0AB 3RRDA 1O5UA 4K6BA 4PDWB 4YG0A 3Q9OA 3AYCA 1C57A 1TMF3 2P2KA 2YPJA 2DCZA 3CKHA 1ZRIA 2VOVA 1AXKA 3HBZA 1YEWA 5IYYA 5JWPA 4COYA 3LEGA 5FO9B 1V6JA 2WL1A 1RUI1 3RFRA 1QU0A 2VPVA 1VBA3 4PIZA 4IW3A 1QMJA 2J1VA 4NHKA 5C3PA 3ZFEB 3BIEA 4FTBA 5KHJA 2B4KA 2OW4A 2YGMA 4ZU5A 1MACA 2DYCA 2VTXA 2UYBA 1VBD3 2VNRA 1ULCA 4FBFA 2JDKA 4XETA 4E4DX 1H2NA 1RUJ3 4Y26A 2VG9A 1B35A 2EALA 1J58A 4P9JA 2UWCA 1QDCA 4QQ2A 4A7YA 5KXEA 1W2UA 2TNFA 4LMFA 1IS3A 3B7MA 1Q8PA 4GQ7A 1SLBA 4HOOA 4JDMA 1DYPA 3OGVA 1LB2A 1OMIA 2X53S 5FY4A 2XJSA 3EXUA 3LIHA 2YDEA 4NIIA 5DAPA 2MPFA 1FPN2 1RUG2 3UV9A 4WBBA 1YQ2A 1K5MC 2PMWB 3W58A 4B7EA 4MH0E 5IHRA 5SV5A 4IGPA 2LW8A 4M4RA 1WD3A 3OEBA 2WS93 3TB0A 1KFUL 5EHDA 4WVZA 4OHWA 2ZABA 3WF0A 1HRI1 4N53C 4XUPA 4XJ8A 5JSRA 1HJFA 2Q8EA 2RG4A 2YROA 2ETEA 2B8MA 3NV4A 1HDKA 5JSPA 4BLIA 4DXRA 4E2SA 1LECA 3NV1A 3U0ZA 4UI9L 1A8DA 2D98A 2E9QA 1B35B 5GZDA 1UZVA 2ZGOA 3R4UA 2WZR1 1IKQA 5F6LB 3POEA 5FZ8A 2VCBA 3PURA 2ZXQA 5CU1A 4YRDA 2XL9A 1H1IA 4I0BA 2OPWA 1OQDA 3B00A 1JUHA 1NX9A 5DAXA 5E1RA 3OGRA 5B4XA 5JXGA 2OQ6A 4CTEA 2RDQA 1WCQA 2NPIA 4PI0A 1PGW1 4CZSA 1UY3A 1JI6A 3VBOA 2JDUA 4F7ZA 3ZXEA 4LKFA 1YFWA 4IEXA 5FZAA 4DZGA 1UXZA 4WM8C 2AEYA 2ZGRA 3WUDA 3CJIC 5F3GA 5LASA 3I3DA 1CVNA 1CR7A 4DY5A 1F5FA 1C8M1 4AE2A 5H9RA 1TEIA 4M00A 1VPHA 4I02A 4K8RB 4QQHA 5C4WC 4KWLA 2QCSB 1IKPA 4Q29A 4XMAA 4A4AA 1F9KA 2RDSA 3ST7A 1SEFA 3AK0A 4Q8LA 4RHV3 3K3OA 1PZ7A 4LUKA 5CZKA 4MOAA 4M0HA 4XE9A 5FY9A 2BFUS 4MGTA 1ZRFA 4UBGA 3PIJA 4P9LA 3QACA 4C1WA 5DPNA 4KBBA 3AMNA 4GB32 2ARBA 4KGQA 4HN0A 3W9AA 1DQ6A 1CZVA 1J3PA 1GUIA 4XXPA 2WNUC 2WWUA 3J7NA 3BB6A 1TMF2 3VD7A 4DEQA 2EF6A 4JV4A 5FYMA 2W52A 2VR4A 5FMOS 3VBOB 2DU1A 2JEMA 2VW0A 1RUOA 1MZ6A 2QDNA 2WLPA 3ETQA 3GJBA 4IEQA 4XHBA 3UGGA 5C9AC 1VALA 2D5FA 4YFWA 3N7KA 1Y9GA 2RS51 5BNQA 2DURA 4B7KA 3BTZA 1VBA2 3RYPA 2HWD3 1QXPA 2R073 3LF7A 5A1FA 1SCRA 4QX2A 5FZHA 5JIAA 4R52A 2PXJA 2EICA 4Z82A 3TYJA 1VBD2 3M7AA 5J3UA 3BU7A 1RUJ2 2VCCA 3BVCA 3WUCA 1QOTA 2WDBA 3DCQA 4C91A 5FTTC 5A3NA 1ENRA 5EQUA 1G8WA 4Q4V3 4F3JA 1CAWA 4CU7A 2QJVA 1HQNA 2TEPA 5FWEA 1SLCA 4E8DA 2IZWA 3WV6A 3WSOA 2XBO3 1GWMA 4QPWA 3E6DA 2FMYA 2ZEWA 4YW5A 1J1TA 3P3NA 1POV0 3ROUA 2XKPA 1QKQA 3ZYPA 1ULDA 4HK8A 3OTFA 4XUQA 3AMMA 1W8UA 2QUOA 3G7DA 2WS92 3M3IA 1NQDA 5J7MA 1IG3A 3HNBM 4RN5A 2ARXA 1AF9A 3WW1A 4YYOA 4CDWC 1ZYBA 4AI9A 1W9FA 1MS0A 1NLQA 1NUKA 5A1AA 4PLMA 5CADA 5FK7A 1RGSA 5F5IA 2OT7A 1VAVA 1W8TA 1T6BX 1JYNA 1RUF3 4Q4X3 1VB4A 3VHRA 4DUWA 4I0WB 1CAWB 2O0OA 1QJY3 4YZ1A 2XH6A 2PN5A 1VMHA 3AP5A 2Y6LA 3ATGA 2SLIA 3ZSLA 1DYOA 2NYYA 2Y6FA 1US3A 4FCAA 1VRH3 3GHMA 4A3XA 5KHGA 1BJQA 1GQGA 3M3QA 1RHI1 3KD4A 4FI9A 1H2LA 4AQSA 4C8DA 5A3UA 3O5SA 4XF4A 2CAUA 1R1A1 1WLTA 4LULA 4CXYA 3ZN6A 1LESA 3LPGA 1OFSA 3I4IA 1XJAA 2D6NA 2AH2A 1AXZA 1YHFA 4YVWA 3ZKUA 4MX3A 2VUDA 2A1XA 5C8CC 4QPIC 5KHKA 1G9CA 2VD7A 2XVLA 3VBRA 4QU1A 4Y4RA 4CCOA 4YGEA 1A34A 2W1WA 2RR13 3FC0A 4LHNA 3C7HA 3ON7A 3PVOA 3CZJA 1CJDA 5DAQA 3WZ1A 4Y5SA 1IS5A 4OHYA 4LBKA 2PAEA 1OH3A 3OUJA 3TNQA 4LA2A 4W50A 2DTWA 4BYYA 3GF6A 1UZ0A 3NL1A 3BTYA 1SFYA 2RMU3 2QQVA 3B93A 4RHV2 2WINB 1QNWA 2P3YA 4D8MA 2XUEA 3MIEA 2XLAA 4IV1A 1TVGA 3OGJA 3N9OA 4GD4A 5A6QA 3OGSA 1FMD1 3NV3A 2WNVC 2XVGA 3WHUA 1VB2A 4DUVA 2RS31 4BQ2A 2XJVA 3VDDA 3K4AA 2LS6A 3I2JA 4FPOB 3ABZA 3D6EA 3MHZA 3PMEA 3ZN6B 2EAAA 2FD8A 1KDKA 4P9YA 1POV3 3SEEA 4YVWB 1F4HA 5J48A 1ND3C 4DIQA 4S2GA 1RUI3 1JOPA 4FPKA 3N9MA 4LA3A 5FXZA 4XW3A 2WLQA 4JGZC 1X7NA 3VBRB 2YGLA 4KI5M 4CSWA 1OXCA 2HWD2 3HT2A 2R072 1GZCA 3WNNA 1Z0HA 4XCBA 3MPPG 5FP9A 3VHNA 1A8MA 3KGZA 1RUC3 3HD8B 3K48A 4DXTA 1JYTA 4DINB 4R8HA 3Q8CA 1J1LA 5FDBA 2Q1MA 3DUIA 4QB6A 1OFNA 1W9SA 2P6CA 3KV5A 1AXYA 3CIHA 1UU4A 3N9PA 3PU8A 4EE2A 4Q4V2 5C7GA 4IV1B 1IQDC 4K20A 3VBUA 5GZGA 4MGQA 1W0NA 4P00B 5IVBA 1GFF2 1X82A 2ZAAA 2ZEYA 4NRQA 2CTVA 3HJRA 4AEDA 3VUOA 2C9AA 2HBTA 2XBO2 5FWJA 5CA6A 3I3MA 4V1PA 2C24A 1LOGA 3VDDB 4EV0A 1Q8OA 2P37A 4Y1ZA 5LW9A 3DXTA 5DG2A 4LUMA 2RHPA 3LEMA 3RNSA 1PK6A 2DVDA 1GWLA 2WC2A 4RQPC 2DVFA 1HRI3 1CWPA 1HV1A 4CPBD 2BGOA 1NCQC 4CEYC 3MIGA 4META 3UETA 1HLCA 1Z7S3 4GALA 3O1MA 4MXWA 2HWC3 4C0HA 4PI2A 2H0VA 2VULA 2W1QA 3PUQA 3ZYHA 3SKVA 1E57A 5KXDA 5A7PA 1FAYA 2BV4A 2WT2A 3POBA 2BNNA 3CJXA 3VN4A 1R64A 2RJ2A 3T2PA 4GA9A 4FQZA 1RUF2 4Q4X2 3THTA 4BIOA 5K7PA 1Y9MA 5GLWA 1QJY2 3VBUB 3JBG1 3FMGA 1C5IA 2WIIB 4AEDB 3MIFA 5D21A 5JPMB 4LIVA 1QQP3 5FYIA 4QKDA 1S0JA 1VRH2 2WWSA 4EN0A 2RV9A 1GOGA 2VQAA 1G6NA 2FMDA 4LE4A 1AR73 3O1SA 3KQRA 2VZQA 3N36A 1AJKA 1WCSA 2D5HA 2K2SA 2WO3A 3M3CA 4N8MA 3EB7A 4AR2A 1EYBA 2DU0A 1LU1A 4N9HA 1JOJA 1PK6B 4XFGA 1NOVA 1EV11 5JLVA 2CGOA 4XIOA 1RYYA 2ARAA 2C5DA 4JKKA 3ZMNA 1CGPA 5KXBA 4K1ZA 4Y3OA 2YPDA 1YFYA 2VNGA 4JVAA 5AC91 2VM9A 4MXWB 2GH8A 2TUNA 1QHDA 1ENXA 3GZUC 2RR12 3LSDA 2V72A 1ULPA 3BALA 2GP5A 5FAXA 4EWDA 2DTYA 5EJZB 1ND2A 3ZYJB 3MF9A 4NOTA 4Y24A 5HI0A 1L7QA 4CDXA 4COUA 1NCRA 5F1RA 4AHYA 4EWAA 4M3CE 4A41A 2RMU2 2F4LA 4CUAA 5KR7A 1UOGA 3LOIA 5G05L 2YHJA 3FL7A 4XBQA 5ABJC 2RDNA 1U5XA 5FZ4A 4TLFA 1GWKA 5HCHA 1YFUA 3MYXA 5EP9A 1LGNA 1VIWB 2VY0A 1AZDA 4P5YA 3DF0A 4URTA 2CDOA 2P3IA 1UX7A 4UOJA 4NWWA 2EXHA 3WQ0A 1GQPA 5GJ6A 1RUI2 3VD4A 5GLUA 2Q8OA 3RYKA 4HONA 3VKFC 3RZGA 1UOFA 4AI8A 2XMLA 3GCXA 2NMNA 2BPA2 4LXLA 1ND2B 2ZX1A 4XF9A 3Q8AA 4MSVA 4LHLA 2Q8DA 1RUC2 5FMDA 4CDXB 4I0AA 1NCRB 2E7TA 2VZVA 2YYOA 3Q8FA 3T3YA 2OS2A 3C8XA 5L9VA 1BZWA 4Q0UA 3VZMA 1DZQA 1W2NA 3ZFFA 1XYOA 1IZ3A 1SFNA 3IDCB 4BU2A 4AHZA 2B45X 3VHOA 2A70A 3WQBA 2A6YA 3DL3A 2HYXA 4QGNA 3RGBA 3WY6A 3LGRA 5A7NA 1X9TA 1SLLA 2AEZA 3I2GA 4EROA 1JZ8A 4JZRA 4XOGA 1O3TA 4HVQA 4Q0QA 4KNCA 4NIDA 2JECA 3HIFA 3TAYA 3WNLA 3ZN5A 3B69A 2IVJA 4K9SA 2C4XA 2J1TA 2XXZA 1HRI2 5FZKA 2PLV1 4R9BA 3A23A 5T5PA 3WT3A 3S6PA 2UYAA 1SMVA 2VBPA 3DYOA 5J37A 2E32A 1AR83 3KLSA 1Q56A 1J3RA 1VBD1 5FYYA 1NT0A 1Z7S2 2HLEA 4CDUC 2BZDA 2HWC2 4V2VA 4WZCA 2X5IC 4RYDA 5GLVA 3U37A 5T52A 3HAGA 2Q0AA 3JQWA 5FZOA 4LOTA 4D6QA 4UW6A 1X50A 4MV2A 4OI4A 2HBUA 1GANA 1QNYA 4Y1YA 3LAGA 4H7MA 1XXNA 4CCCA 5I8TA 3ZFFB 4A42A 1CAUA 5IFPA 4QPYA 3DKWA 2VL4A 4JC1A 1MS1A 1QQP2 1EY2A 3FFQA 1VMJA 5LB6A 2GP3A 2YXSA 5FR3A 2EIBA 2RDRA 1AR72 2J1SA 2WRAA 2A6VA 4OUMA 3H8XA 3WEZA 1ONAA 5ISLA 2D6KA 4PT6A 3LZZA 4YZ5A 2WAOA 1AYN1 1NZIA 3ETPA 4LTAA 2WA4A 1UKRA 4UW4A 1C3HA 2ZS6B 4CUBA 1US2A 1U12A 3U4XA 4PJYA 4CXXA 5FZIA 1XNAA 2V5DA 1OA3A 3HBKA 1OVSA 1UQXA 1UKGA 2SBAA 5JSOA 2Y60A 1LJ7A 3OEAA 4MLOA 5FZOB 1R093 3I2HA 1S2BA 3LSEA 3UNPA 2FDHA 3IPVA 2A3XA 2VQTA 1LHVA 4QXCA 3BKZA 4CEWC 5HV0A 2QQNA 3FUQA 3MW3A 4ASKA 1CZTA 1XOYA 3WXPA 1ZBA1 2W39A 1CAUB 1PZ8A 3LCPA 4AOCA 3WNXA 4AVTA 4NAMA 3W21A 1UZWA 1WBFA 4ZPIA 4ATEA 1WLCA 2Y34A 1IG0A 1AX2A 1UYYA 2B5HA 1XB9A 3VZNA 3JD73 5FRAA 5FLIA 5C71A 4QX1A 1ZRDA 3MUY1 2AREA 4OQ8A 5C5TA 1F5JA 5L9BA 1QH6A 3VDAA 4YSFA 3O1UA 5J36A 4QQOA 5C3RA 3INAA 3RZMA 3OCPA 1UYXA 4LHKA 3I2FA 5A3OA 3G6JB 3T4VA 1M06G 4A2UA 2KM2A 5AVAA 4H7LA 5FXWA 3IPVB 4BH9A 1WW5A 5FO8B 3FFZA 2J1UA 2EIEA 3N4MA 1HQLA 4NAOA 2K9ZA 2IVIB 2B9UA 1NLSA 3URFA 1KD7A 2P3JA 1OHFA 3AL5A 2DVGA 4GJYA 4EQVA 1YO8A 4UAPA 4KMQA 5BUVA 4XJUA 4EWEA 1JZ6A 3KF3A 3H1YA 3PJYA 3PLQA 4UW3A 1SACA 3WD5A 2HYKA 1LOBA 2ZKLA 4QX8A 2OZJA 1W8HA 3CQOA 4IE7A 4CYDA 1GNHA 2BGPA 2YBKA 3AYAA 3ENRA 5BPXA 4UFKA 3WP5A 3FJSA 3JU9A 3GZEA 2IFWA 3PUIA 4INDA 2Y6JA 1H8TC 3MLLA 4HLTA 3CBNA 3OPZA 1CJPA 4UFHA 2Y33A 3H7JA 5FLJA 4PCRA 4JHZA 5EXOA 2R071 4I3GA 2B46X 5LCWL 4BHPA 1AR82 5FP3A 4JHTA 2WUHA 4L9BA 4QHBA 1AUYA 2FCTA 4Q2FA 2Y26A 5H9PA 1D7PM 2PHLA 2JIJA 4L2NA 4Z92B 1UZYA 4XYXA 1WZXA 5A7OA 4BISA 1UW8A 4Q4V1 3O1VA 4QXHA 4R4XA 1X8EA 5DABA 3FBYA 5FPAA 2OUHA 3I97A 3KV9A 4JQTA 1A6CA 3HPNA 1ZX5A 3NRUA 3ZSEA 3JBG3 1RUD1 4COZA 4IV3C 5BNNA 1EUTA 3R05A 4LBQD 2IXKA 4MGYE 4N7UA 1N1SA 4D3WA 3AKQA 5EWSA 3S57A 3K75B 4GXLA 5I0TA 1AHSA 4OI1A 1OURA 5K8SA 3UKTA 3NJXA 4NRPA 4P14A 3NJYA 3AP9A 2VBDA 4OZXA 1Y4WA 3POFA 1EP0A 1RIRA 3O0VA 1EV13 3CHXA 2BUKA 2VMFA 3EJKA 1Q43A 1UY4A 4MGZE 4AWDA 3UJOA 2AYHA 3VLBB 4G9SB 1C8NA 4AVVA 4BWOA 1Q3EA 1QGLA 5AC93 2ZAHA 4D7SA 2VZOA 2IXIA 5A7WA 3UJQA 1NYWA 3AKSA 3KGLA 4ZHNA 3FLRA 4YZ2A 5IFTA 2WAAA 2WA3A 4Z07A 3B9IA 5HCBA 4AVBA 1AR61 2R32A 2VMCA 1RUF1 1UIKA 3I3BA 2HWE1 5DQ0A 5A3MA 2PELA 2H0BA 1H8VA 2W92A 1R092 4TZDA 1DQ5A 1N47A 1S2KA 3H1WA 3ZIWA 4CCEA 3E5UA 4WVMA 1BLZA 5BNNB 5KWRA 1QF3A 4B8EA 1OQ1A 2GC1A 4N90A 5F2WA 3LA2A 4LOSA 2XL7A 2VH9A 5JI9A 4AYUA 1XRUA 3M8LA 4N43A 5FV3A 2JE7A 3C7GA 5A7SA 2VUCA 4CDWA 1XE8A 3JD72 2VVDA 4BQXA 2P6HA 2VZ1A 4Y20A 5JOWA 2VXRA 3OBZA 2Y0IA 4XF0A 1HRV3 3HR9A 3WINE 1H4GA 2C1FA 4W6WA 5A7WB 5FYCA 2RR11 3NWKA 3ES1A 4U2AA 1W99A 5ANQA 4LNVA 5FZFA 2V4VA 4A45A 3VKNA 2OX0A 3C2UA 4LIUA 4DXZA 5ANNA 2C0ZA 3PNAA 1PO13 5DAWA 3EHKA 5LEKA 4GWNA 4AFBA 5IW0A 4J1XA 3HT1A 4D6SA 2ENRA 3M2MA 5FKBA 5F5QA 4OLLA 1IQAA 2L9LA 4WVMB 5FO7B 2J1AA 1HX6A 2XJRA 3WLUA 4E2QA 2PHFA 2VMIA 3V64A 2RM21 4BXFA 3OPTA 4CPBA 1V9U3 4E9KA 2XUMA 1G9AA 4AI0A 1WLWA 5A80A 4I2OA 4N43B 2FCUA 4YWAA 1PGSA 1SLTA 1REFA 2V73A 2A71A 5J96B 3VD3A 1OUSA 3ACLA 4CDWB 5C8CA 4DEVA 1POV1 1POQA 4XBNA 3AXDA 5FLHA 4RS5C 4BK5A 3BPSA 3NKTA 4Y20B 5JI7A 1ZZBA 2PLV3 2XG3A 3VBHA 4ONUA 1DGWA 1SLIA 2VUAA 2XVKA 3WOGA 4GH4A 2BFUL 4QQPA 1MQTA 2ERFA 1RUC1 2Y6KA 3W5NA 2LTNA 4XAAA 4KG0A 5DN2A 3MICA 1KITA 3TNPB 2ARCA 2Y6HA 4FPGA 4AGVA 4YARA 1CN1A 2IWGB 4KG8A 4COVA 2WNVA 2QQPA 1ULGA 5JDBA 2CGNA 5FMOL 1QXRA 1SFPA 1GP5A 3JBG2 4UWDA 1QJFA 1XNDA 3KF5A 2WZPP 3CEWA 5FP8A 1STMA 3IM0A 1ZM1A 5LBBA 4YFZA 1WGPA 1HB1A 3DPRC 5C8CB 5A33A 2OKXA 4FQ4A 1IPJA 4JGZA 1AYN3 3GBFA 1EV12 1OOPC 4Q4Y1 2OQ7A 3VBHB 3WDYA 5I8YA 3B3QE 3O1RA 2MEV1 3LQCA 1YXWA 1AJOA 3B9CA 1VBC1 5C5UA 4XAEA 1Z7S1 2VZ3A 4QDRA 4QMAA 5I0UA 1D4VB 2HWC1 3CLPA 4GH4B 3UK9A 5AC92 1SQ4A 2D3PA 2XQXA 5CFDA 3WP3A 1DLCA 1HXS3 1MQTB 1OSGA 2ORZA 2RE9A 3KMHA 3T1MA 3WNPA 4IE0A 5AFEA 3H1MA 3GYDA 1EAH3 1ENQA 1EPZA 2WNVB 3LKJA 4CCJA 4BK4A 1ZBA3 4QU2A 3EBRA 4FAGA 1QQP1 3LDKA 4YZ4A 1JS9A 3BU0A 1NE4A 3AFKA 1AR71 1S0DA 1FV2A 4GWMA 1OLQA 2E7AA 3H3UA 3MW4A 3VB9A 5M0TA 1NCQA 4CEYA 5A33B 4JGZB 3THCA 4XC9A 1V00A 3N7LA 3ILNA 5FPXA 4E4ZA 4AAPA 3KHBA 1YI9A 2YU2A 4ZS2A 1LODA 3JQXA 4FFIA 3SMHA 2YBPA 5FPVA 4CCKA 1HRV2 3AM2A 5FY7A 4AF9A 5CFDB 5LA9A 1O7FA 1MVQA 5F8PA 1O4ZA 1QJZA 1UU5A 4CCMA 3OD4A 3TRSB 2Q1ZB 2JG9C 1IGOA 4J6GA 2DBIA 3ZFGA 4LLFA 1PO12 1WW4A 3EYPA 1WBLA 5JAXA 4IGQA 3PDQA 4X8NA 2LM3A 4BQWA 3M4FA 3RZLA 1IS4A 2XHKA 2WZ8A 3N35A 4OHVA 3L9JT 3RQ0A 1BVVA 3AMPA 3I54A 2D6PA 3IAPA 5CB7A 3S7IA 3WF1A 5LRSA 1XNBA 2Q5TA 1GZ9A 3PUAA 4GWIA 4WM7C 1V9U2 3WDTA 4K21A 2Z4FA 4MHRA 4XZUG 2GDFA 1W0OA 3HN1A 1OPOA 5FP7A 5F3EA 1G86A 1NCQB 2X09A 1HN1A 3MDPA 4GJZA 4XF1A 1JH5A 2GU9A 4BM8A 4CEYB 5KXCA 2GNDA 1UY2A 1L3JA 1V6IA 2OYZA 1DFQA 3ZOIA 3THDA 4G4FA 5FFOC 3NQHA 5BNOC 5F7UA 3PVBB 2DUOA 2PLV2 4FOVA 1QIQA 3P1IA 3A4UA 3AYDA 2VOKA 3S7EA 1H1MA 1YI7A 1JTZX 3QD6A 5FJKA 1LOCA 5FUNA 3WP4A 3ZFGB 4IETA 2Z42A 1U5YA 4DFSA 5BNPA 2XJUA 4ZU4A 1RUD3 1CQ9A 1UF2C 1W2OA 2BP6A 2IXCA 4CDQA 5I93A 5JMOA 1GNZA 3NSTA 3OF1A 5HBAA 1PX3A 4FPCA 4QPGC 4Y22A 1JZ2A 4HN1A 1S4CA 4Q0PA 5FUPA 1O8PA 4FPJA 5I0DA
chains in the Genus database with same CATH topology
1LULA 4IERA 4ITCA 1W6MA 3D8CA 3WW4A 2D93A 4KWKA 1DG6A 3MFCA 4QM8A 5AFBA 3MIBA 1AYN2 1V6NA 3TWIA 4QM9A 3JUUA 2GMEA 1LHOA 2JG8C 3D0JA 1AR81 2F6BA 5C8WA 3SNMA 1G7YA 2QE3A 2VGDA 1AR63 3PJQA 1HXS2 4Q26A 4JGYA 2HWE3 3M3EA 3AP4A 4PDWC 2ZGPA 4IEYA 1FT9A 3OD0A 5BNPB 1EAH2 1XYPA 3QCWA 4CDQB 4YG3A 1FOD3 1ZBA2 5GALA 2XLFA 4Y22B 1CAVA 4JTNA 2A73B 5I0RA 1GICA 4P9GA 1W6MB 3LA3A 4G3YC 4XHXA 1FYUA 4XDQA 4QGLA 1UX6A 2OA2A 3KM5A 1KJRA 4AXOA 2AUYA 2XJQA 4C90A 5JPNB 2FQPA 5FQ0A 4Z8BA 2X5IA 5LK5A 5T54A 3U10A 1GYKA 3PVNA 2CNAA 1XQNA 2R1BA 4JGYB 1MZ5A 3RMYA 1R091 4XILA 1BCXA 4HVOA 2NQYA 3BCWA 3S30A 4KU7A 1RB8G 2GNMA 4DNYA 3NAPA 5GM0A 4D7YA 1VBE1 2RM23 2OZ6A 2R30A 2A6XA 4XXAA 4N7IA 2GMPA 1CAVB 3O0XA 3JB4C 4YM3A 4K3UA 2ZOEB 2LALA 3AKRA 5CG9A 3JD71 2D7FA 2XWBB 4DOUA 3VL8A 2HWF1 4JRAA 4E2GA 4YZ3A 2GSYA 3SLIA 1B35C 5FQ0B 2BGCA 2BEOA 3FBMA 1ZZ8A 2X5IB 4X6QB 4GMP0 1ZZ6A 4WZFA 3A0KA 4LBQA 2YY1A 4CEWA 1PO21 2EIGA 2ZGUA 3PMSA 4KL1A 3RG0A 4Q0VA 4L11A 2WT1A 2VVEA 1NY72 1ZNPA 4BQ1A 5AVPA 1SBFA 1VR3A 2P17A 3NAPB 3J26N 5CIRA 4OI0A 3TOJA 1RUD2 1XNKA 1CONA 3D0SA 4DB5A 1MS5A 1N1YA 3I7DA 3T2TA 4YVSA 1H0BA 1UMZA 4D94A 1YIPA 3E5QA 4LBMA 1V6KA 1R083 2ATFA 4Q4Y3 3RDIA 4YLZA 2MEV3 4AFMA 3KS7A 1VBC3 4P9IA 4ISQA 4YG6A 1LOFA 2OVUA 1WLDA 1QXJA 1S1AA 4CEWB 2AENA 1NA1C 1AR62 1JBCA 4K1YA 1CESA 4W65A 3VZJA 2HWE2 4YW2A 3FX3A 3R4SA 1OA2A 3MLKA 4JAAA 4B4RA 2P34A 4PBOA 3WQ1A 1WMEA 2A6ZA 4AQTA 1FX5A 4QD2A 2GAUA 1FOD2 3AZYA 3U11A 4EN9B 3M1HA 1BK1A 4BCUA 1V6MA 3M3OA 4YVSB 1DYKA 5DUUA 3NW4A 1D2SA 1H8TA 3ZXAC 1ZZ9A 5FPZA 3LOBA 3E5XA 1LTEA 1V70A 1JN2P 3CU7A 1TNRA 3OGGA 3VGIA 3KZ4C 1YNAA 2ZGTA 4XQWA 4ASMB 3H8UA 4XTPA 1I6XA 3D4KA 4CP1A 5DG1A 1BYHA 1OD5A 4XFHA 3N7JA 4FT8A 1UIJA 3AX4A 1REDA 2RM22 1WW7A 1B09A 1UAIA 5CFCA 1YJKA 1BVP1 3VBFA 3VBSA 4FOQA 4HK9A 3E6CC 1H8TB 2VW1A 2RJKA 2D6LX 1QDOA 1DF0A 3BODA 1TE1B 4DY3A 1JXNA 2AZ5A 5B2GB 1REEA 4N9IA 2P3KA 4XF3A 3WHTA 2ZHNA 1HRV1 4XFAA 3RI8A 5I0SA 1GBGA 3I2DA 4Y1UA 2VU9A 3VZOA 4L92A 4J1WA 2JX9A 3SCFA 1N3PA 1F8VA 3X29B 1RUE1 1PO11 4LR4A 2WKKA 3KT4A 1BMV1 1A3KA 2ILMA 3R0RA 4MGKE 3WQ7A 1Y7BA 2ES3A 4WVVA 3O12A 3EO6A 3PVEA 1V9U1 4Q0SA 5F6KA 2XWJB 2D97A 5CFCB 1C28A 3ZXGA 3WG2A 1IOAA 3VBFB 2WNEA 3VBSB 5IK5A 1X33A 4AVCA 2H6BA 4WV8A 3H3ZA 4NN0A 2ZTNA 1U5IA 5JVVA 4NWVA 4DRRA 1R082 5JZGA 4FTEA 4Z1VA 1HW5A 4Q4Y2 5JOXA 2GZWA 2PHXA 2MEV2 5DZFA 1VBC2 4QXKA 1NE6A 4KGGA 2VW2A 3E97A 3RMXA 4YM2A 1H4HA 4RSUA 2NN8A 3SCHA 2DUQA 2IXHA 2XJTA 2BWCA 1BEV1 3N7MA 1BKZA 3W59A 4A7KA 5L36A 3MI8A 2WFF3 2ZMLA 4XBLA 1D0GA 4RS5A 3RI9A 4MVTA 2GC3A 3NV2A 4W6XA 5JZGB 5J98B 4AVSA 3MZHA 2WT0A 1FNZA 5IK8A 2EXIA 2XGXA 4HSJA 5CVRA 2ZX0A 1WMFA 2NLRA 1HXS1 1URXA 3IBMA 2FHRA 1CPMA 3O0WA 3QOPA 3MGUA 3SXWA 2I07B 1A78A 1OKQA 1EAH1 2V5YA 1S0CA 1ULEA 4YW3A 1CX4A 4U36A 3VDDC 3MFAA 1K5MA 1GQHA 1KS5A 1AVBA 1SBEA 2HWB1 1VBE3 4GIQA 4CRQA 1GZWA 5EJ3A 4AEMA 3KCXA 3BOWA 3VZLA 3E6BA 3GBWA 4N53A 4RS5B 4ASLA 1VP6A 2RS11 4B4QA 4BA6A 1O91A 1YWKA 4K8FA 2NMOA 3B01A 2HWF3 4OFGA 1W6OA 2TBVA 1LHUA 1IHMA 3THPA 1LOEA 4XFCA 1UD1A 4IXLA 1MZEA 4AQ2A 5GKAC 4XJAA 5E16A 1S0GA 2A5ZA 5FREA 2N7GA 3DGTA 2ET7A 4LO6B 1PO23 3VBUC 1PVC3 4AEDC 2CGPA 4PQ9A 2R042 3USUA 1N1VA 1K5MB 1G9FA 1YLLA 1GZWB 2ZGNA 4AQ6A 2IFRA 3SH3A 5JCTA 1PK6C 2Q30A 2ZPXA 2KXLA 2YC0A 1N3QA 2ZGMA 2ZX3A 3BOPA 4N53B 4OHZA 4WM8A 4LLOA 3CJIA 3ZDSA 3RS6A 1W6OB 1ZBE3 5IT6A 1PIV1 3KT7A 3R6SA 2ZZQA 3VV1A 4Q1PA 4BMEA 5C4WA 2XPJA 4BMBA 2B7YA 3AXEA 3VKMA 5LEJA 1RUNA 1GKBA 2HEVF 2HKXA 3HWJA 2ZMKA 2R1DA 5DXDA 1NY71 4AEKA 3USUB 2JICA 3GNEA 1ZA4A 4XZPA 4F83A 3NKGA 2PTMA 2WNUA 4WM7A 1RTVA 1C1FA 3NVCA 1GLHA 1YUDA 2WFF2 1JYCA 5H9SA 5C9AA 4UW5A 3WG1A 4WM8B 5LK7B 4FAHA 3CJIB 4M0NA 4PIYA 1ZREA 2CL2A 3AJZA 1DHKB 4PIXA 1NLRA 4IQPA 3QBQA 5C4WB 1MVEA 1ND2C 3IMNA 4CDXC 2I45A 1NCRC 2ZBJA 3C3VA 4IEZA 3V0BA 3ZN4A 4K7JA 5T3NA 2WNUB 4WM7B 1FOD1 2QVSB 1FXZA 4QPGA 1VBE2 2DCKA 1Q8SA 1C1LA 2VOWA 4Y1VA 1QY4A 2GC2A 1RMU3 5K0UA 4WVWA 5C9AB 1O3QA 2W0XA 1D4M1 1RVF1 2WJSA 4AHXA 2R063 4OULA 1QOOA 3ILRA 2JG8A 5L7OC 4S2FA 2HWF2 2HJIA 4P9XA 2PQQA 3GHNA 1LOAA 1TME3 4HKWA 5KC5A 1Q8VA 2R6QA 4EN7B 4UBHA 4XFBA 1PGL2 5E89A 2MHFA 3V0BB 1RUE3 4XEZA 4BLJA 3ZFFC 1PO22 2HEYF 1PVC2 5EV7A 3VZKA 2E53A 2PHTA 5H9QA 3MLJA 3ZPYA 4HFSA 4X8PA 1RUH3 4QPGB 3UKVA 4RR3C 1XYNA 2PAMA 1COV3 5K0UB 4LEJA 5GLZA 3O14A 3IDBB 2BVBA 1DGRA 2A6WA 1W6PA 4XPVA 3O7OA 4QPIA 1ASJ3 2DVBA 2JG8B 4A7ZA 2D6OX 3WW3A 1ZBE2 5D8AC 1AX1A 1WW6A 5J09A 2V09A 1YCIA 5BY5A 4ATFA 4ZKTB 2O1QA 4TWTA 4LE3A 5T55A 4Q1RA 4GKXA 4OUSA 2CWMA 2DFBA 3AKTA 4BOWA 1BEV3 4W6YA 3J8F1 3CL1A 1Q8QA 2EAKA 3FLTA 1PNFA 4LO7A 4PLNA 1F31A 1VAKA 4I30A 1N3OA 4NVPA 3U07A 1ZVFA 4R9CA 1W6PB 5DUXA 1ND3A 3HMYA 4E27A 4QPIB 5JAXA 5DDJ3 2PHDA 4AEJA 1LKNA 4HETA 4B29A 1GR3A 1R081 1VBB1 4GKYA 3I8TA 3MW2A 4HL0A 4FPYA 4ES8A 1JYIA 4BZ4A 3WW2A 4I3PA 1I9RA 4FTSA 1O4YA 2PHRA 4R9DA 5C6CA 4NR1A 1DQ4A 2ZGLA 2ZCWA 4XQ4A 2GALA 3OJBA 2XKOA 5DUWA 2HWB3 2VNOA 4HVRA 2VECA 4LBOA 3GALA 2W08A 1BBT1 4NHLA 1AL21 5LRRA 4AVAA 5CAZA 5EZWA 4RQPA 1ND3B 1RMU2 3AB0A 2RS13 3ES4A 2Z79A 2XJPA 2E51A 4KH9A 4AGRA 4EN6B 3WG4A 2R062 4L8QA 5ACA1 5HXVA 1WCKA 3POWA 1Q5OA 1TNFA 1NA1A 3AFGA 1TME2 3POSA 5KHIA 2WSVA 3ZX7A 1J3QA 3ZXJA 3SHRA 1KXGA 4GMP1 1RUE2 1OLRA 5FOBB 1H9PA 3FZ3A 4PLOA 1BMV2 1RUH2 2FBEA 3RZZA 4KU8A 2JENA 5F9TA 4HMZA 4AW7A 2UY8A 4RQPB 1COV2 4Y1XA 2PA7A 3TN91 4QQLA 1CIWA 3VKOA 4H55A 4P5HA 1KDMA 4SBVA 1ASJ2 1PIV3 1UPIA 3IT8A 2QKDA 3ZXFA 5IK4A 3S0MA 4Z2WA 3NO8A 2XB6C 5SV8A 1NA1B 1LRHA 1AYM2 3QH7A 2R041 5BNNC 3SISA 3AZVA 4DMIA 4Q8KA 1X8MA 2DUPA 2EXKA 1V6LA 1QJU3 2VVFA 3KCYA 5ABJA 4XQDA 1BEV2 4YGBA 2QZ3A 4MZUA 1I1EA 2I2SA 3AZZA 4D69A 3DN7A 1LR5A 1DBNA 2Z69A 4E4SA 1S0EA 1IPKA 5DDJ2 2IC1A 2WQ4A 5JOZA 2AR6A 1MS9A 4I01A 4TSVA 2W68A 2ZX2A 3ZSMA 1RJ7A 3WDXA 1H2MA 4FP3A 2D40A 1MEC1 1H30A 4DQAA 4KWJA 2VOXA 2GH2A 2IXJA 5ABJB 4N43C 2JDZA 2JE9A 1GSLA 1AR91 2HWB2 3WCRA 4JRLA 4H3WA 1LGCA 2A3YA 3IIAA 2WFF1 4JCKA 4HKOA 3USSA 3H9AA 5K9YA 2WQZC 2ZHLA 2ZGSA 3UKNA 4M3CF 4XIKA 1D4M3 2G9FA 3ZFEC 1RVF3 4FPHA 4RGAA 2RS12 1O3RA 1S0IA 1NQJA 1D2QA 4Q4W3 1VLNA 4CDUA 1LU2A 4NHMA 2YUEA 4HBNA 3D82A 3H50A 1QJX1 3ZO0B 2K0GA 4XFFA 4S2DA 1LHWA 1HQWA 1C5HA 3BTAA 1SCSA 1IS6A 2R0HA 3VKLA 4SLIA 5KHHA 2BWAA 1O3SA 3ASIA 4XTMA 5EYYA 5T5OA 1QOSA 1YYNA 4O9GA 4JQRA 3A0NA 3AJYA 1YIFA 4NO4A 3V56A 3VBHC 3OY8A 3ELNA 2Z5WA 4FSJA 2CY6A 3ZVXA 4P9WA 4XJWA 4GH4C 4IEOA 1U0AA 2A7AA 1WMDA 2JJ6A 2X8KA 3WP6A 1MQTC 1PM7A 1PIV2 4CDUB 4AK3A 1MR5A 4I09A 2FZ2A 5L73A 2PHWA 4BPZA 3R4DB 1PGL1 2FZ1A 4JTOA 2GN7A 3LA7A 1I3HA 1Y43B 3P3PA 1PVC1 3ZMOA 3L2YA 1Y9QA 1YJLA 3SITA 1MS4A 1PHMA 2QZ2A 2UU8A 3AKPA 4XJ9A 2ZZJA 2UY9A 2I74A 4HZFA 3T1LA 5JIUA 1S0FA 3J8F3 1QJU2 1W0PA 3PHMA 5JMCA 3JCIA 4R4ZA 3RJ2X 1WD4A 1RITA 5IUQA 3J9SA 4AHWA 3GZTB 2BBVA 4LBJA 4AFAA 2KA3A 3OY8B 1DGRN 1DQ1A 3WDVA 1LEDA 2VUJA 2IXLA 5CFDC 1ZBE1 2UWAA 1VBB3 3H7YA 2D3SA 4DS0A 2VMHA 3ZXLA 5CG8A 2PHUA 1NXD1 1RINA 2QNKA 1N1TA 4LBQB 1CAXA 5EFUA 5FOJB 2YV8A 4DRVA 4YW1A 1H1AA 4IEWA 2NM1A 4MGIE 5JR7B 3RYRA 2ZMNA 4R9AA 2DCJA 3IDEA 2DFCA 3VBOC 5GLTA 1BBT3 1AL23 2B39A 1RJ8A 4YNIA 3MPBA 3AZXA 1Z78A 4YM1A 1D4M2 1DLLA 2QDRA 1RVF2 3ZXDA 2WZR3 5ACA3 1XU1A 4MUVA 4FVVA 2BNOA 1ZZ7A 3BPZA 4Q4W2 3RJRA 3ZFGC 4MXVA 2E6VA 1FPN1 1RUG1 1CAXB 3UL2A 4HPKA 2XLGA 3D5OA 4FPEA 1T6GC 2ZGQA 4GMP3 2OPKA 4IV3A 3AMQA 3OYWA 1ALYA 1CPNA 2JXAA 5HCAA 1LEMA 3LB9A 1OPMA 3ZYGA 2G4IA 1MZFA 1LHNA 4JDOA 2AGSA 1UPSA 3SH4A 1RMU1 4HANA 3WG3A 1BXHA 1C8M3 3TN93 2NZ9A 3CF6E 3IKWA 4XJZA 2R061 4M3CA 4QX5A 1CD3G 1U5ZA 4L97A 1OA4A 2EXJA 2BVVA 1FI2A 1I5ZA 2NP0A 2BNMA 2ZX4A 3CO2A 3FE5A 2Q4SA 3FHIB 2ZACA 1TME1 1DQ2A 5CNAA 1X36A 3ZSKA 1NXMA 4RGGA 4RL7A 3WDWA 5BNPC 4HPKB 4M01A 2R043 3ZYIB 4CDQC 1VAMA 5FCCA 2D3RA 4IV3B 5IK7A 1G9BA 1XNCA 1LENA 3AZWA 3OYWB 1DZRA 3MIHA 4S2HA 2DCTA 3IN9A 4PF5A 1O5LA 4FO9A 4F8AA 3OBRA 1RUH1 3J8F2 1H9WA 2RS53 1DIWA 1COV1 4L99A 2LUWA 1YRZA 3K51A 2EVXA 4Q27A 4FXKB 5L7OA 4M3CB 1KFXL 2GNBA 5T5JA 1S0BA 3WVJA 1ASJ1 1KRIA 1UL9A 1W6QA 3SCGA 1H2KA 3MIDA 5C33A 1DQ0A 1VBB2 1W6NA 4LO5B 4JGYC 3POYA 5EYXA 1AYM1 4GB31 3NJZA 3CNAA 4MYEA 1C4RA 3JZVA 5GZCA 5BXXA 1TMF1 4AFDA 1GV9A 3B94A 3BIWE 4FP2A 4Y5Z0 5E8AA 1MEC3 1WCDJ 1ZRCA 2Y0OA 4RR3A 4TYSA 4IEVA 1HKDA 1WUVA 4RA0A 1AR93 1VBA1 4YVWC 1BBT2 4RD7A 1AL22 4COWA 2D44A 2GMMA 3VBRC 4YM0A 5L7OB 1RUJ1 4YGDA 5DDJ1 2UWBA 1W6QB 5D8AA 1XE7A 3FLPA 2RJLA 1KJLA 3B5LB 1OI6A 4LO4B 1W6NB 2WZR2 1DGLA 5ACA2 1UN1A 2ZHMA 3DV8A 1DGWX 2G9GA 1D0HA 4IESA 1NZCA 2PAKA 1QJX3 5DUVA 5BYNA 5TSWA 5A32A 4IV1C 2DVAA 3NAPC 1RHI3 2D43A 4RFT0 5DZGA 4RR3B 1ZZCA 2WS91 1R1A3 1DZTA 3B02A 3WDUA 1PGW2 1JHNA 3OBTA 2QFEA 3ZYRA 1LGBA 2ZKNA 5KC6A 1W39A 4FPFA 2ZJCA 3QH6A 2R49A 2O8QA 3DPRA 3V65A 4NPRA 1C8M2 1OOPA 1BQPA 2CAVA 5D8AB 3TN92 2GN3A 1PVXA 2X29A 3WX5A 2A3WA 1SLAA 4AI3A 3SH5A 5BV6A 5I91A 1HIXA 2DF7A 4ZU7A 2ZHKA 1FMD3 2UURA 5A32B 3ALQA 1ULFA 2RS33 2ZA9A 4KQ7A 3I59A 3JB8A 4OI2A 1FNYA 1FV3A 1PNGA 4B4PA 1RL3A 1EPWA 1KQRA 4QT6A 2A75A 5E88A 1SBDA 3ILFA 4YVSC 1FATA 2H6CA 3M70A 2YZ4A 3KB5A 4HT1T 3DPRB 4EJRA 3J4UH 2RS52 1WA4A 3ZXKA 1AX0A 4CP2A 4D7TA 1OOPB 4AI2A 2YMZA 2Y38A 5KBFA 1LOFC 1S55A 3VL9A 2GNTA 3RSJA 4RHV1 4AFCA 1MS3A 2BYVE 5L19A 4JDNA 3EQEA 2JG9A 3N3HA 1O4TA 3AP6A 3I59B 2DWRA 2F4PA 3FUOA 1MEC2 2BW8A 3ZIXA 1QJU1 3LWCA 4Y4YA 5A3LA 3GZAA 2D6MA 3AYEA 1QH7A 1XU2A 1M4WA 4IEUA 3H0OA 1ZRRA 4UXAA 5HCFA 3WR0A 1YFXA 1JUIA 1AR92 2HWD1 4CP0A 1G9DA 1UZZA 2WSUA 1PMIA 2WFPA 3WCSA 2E63A 4OHXA 5BNOA 3AP7A 4FOYA 4FOWA 4XFIA 2OUJA 4GULA 3MEPA 2CV6A 1J59A 3AMHA 4HSLA 1FPN3 1RUG3 1R1ZA 2JG9B 2XBO1 5D1IA 2EA7A 1Y3TA 4BIFA 4EN8B 4PBPA 1QJX2 4ISRA 1MS8A 5CBLA 2JD4A 2E7QA 4FPLA 1RHI2 4O9EA 2B42B 5CFCC 2O8OA 5GZEA 5I8SA 1LCLA 3VBFC 1R1A2 4LBLA 3VBSC 1HV0A 2Z2SB 4XMIA 3VHPA 2MNGA 4IL7A 1DDLA 1UCXA 3ECQA 3KT1A 3L2HA 2DV9A 4AGGA 2R0FA 5FBZA 2ZGKA 4QGMA 3RPQA 5BNOB 1UU6A 1JW6A 3KCCA 2OIIA 4Q4X1 2VQ0A 2PFWA 1F2NA 4LT5A 4Q4W1 1QJY1 1V6OA 2ET1A 4X6RB 3MF6A 4LBNA 4AI1A 3ME2A 4AG4A 3KSCA 1VRH1 3V0AA 4PDWA 5T50A 1PZ9A 4ZXKA 1ENSA 4B3NA 2DCYA 1FMD2 4BE3A 2R16A 2RS32 1QWRA 4YW4A 1OQEA 2VMGA 4C1XA 3APBA 1VJ2A 4HKLA 4C0BA 1NG0A 2CWSA 2JKBA 2BTVC 3ZSJA 1SDWA 1DU3D 4YGCA 4IEPA 5T5LA 3ZFEA 1RC6A 2CYFA 3QLQA 4ORFA 4ES9A 2GC0A 5JZGC 1APNA 3TBDA 1TQ5A 4OVEA 4LO8A 4K40A 4H14A 3IWZA 5DZEA 2BQPA 1AL0G 2HEWF 5GZFA 1KS4A 3GBGA 3PTYA 3RWNA 2RMU1 2PYTA 3FWEA 1AYM3 4GB33 3HQXA 4FXGB 3V0AB 3RRDA 1O5UA 4K6BA 4PDWB 4YG0A 3Q9OA 3AYCA 1C57A 1TMF3 2P2KA 2YPJA 2DCZA 2VOVA 1AXKA 3HBZA