1M06G

Structural studies of bacteriophage alpha3 assembly, x-ray crystallography
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid Protein
publication title Structural Studies of Bacteriophage alpha3 Assembly
pubmed doi rcsb
source organism Enterobacteria phage alpha3
molecule tags Virus/dna
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1m06G00
1HXS2 3JD73 1R092 1RUE3 5A33B 1POV3 4Q4Y1 2RMU2 1TME1 1CD3G 1PO22 1COV2 1NA1C 3CJIB 4SBVA 2ZZQA 1BEV2 5CFDC 4QPIC 5JZGC 1FPN2 1RUH1 5A32B 2R042 1QJX3 1NA1A 1RUI2 1RUG1 1GFF2 1RMU3 2RS52 4CDXC 5CFDA 4QPIA 5JZGA 4FTSA 1RUJ3 1FMD3 4N53C 1ZBE3 4Y5Z0 1VBD1 1RHI2 2HWE1 1AYN1 4CDXA 4WM7C 1A6CA 5DDJ1 5K0UC 1OPOA 1OOPC 4N53A 1PVC1 4GB31 3DPRB 1HRI3 5AC91 3ZXAC 4PDWC 4Q4V2 4WM7A 5K0UA 4RS5B 1OOPA 3JD71 2X5IB 1RUE1 5C8CC 1POV1 4PDWA 1ASJ3 2HWD2 1D4M3 2BFUS 5BNNB 1RUC2 5C8CA 1TMF3 3JBG3 5C8CB 1RVF3 4JGYB 1ND3B 1AYM3 2MEV2 2PLV1 3J8F2 1MQTC 1CJDA 2XBO2 4RFT0 1QJX1 1RMU1 1V9U1 1RUJ1 1VRH2 1FMD1 1MQTA 1ZBE1 1AR93 2WS92 4RR3C 4CDWC 5BNPA 1RUF2 1PIV3 5BNPB 5C9AB 1DDLA 1PGL2 4RR3A 1HRI1 3JB4C 1MEC3 4Q4X3 4CDWA 4YVWC 5LK7B 4RR3B 3LOBA 4YVWA 1ASJ1 1D4M1 1VBB3 1ND2C 1PO13 2RR12 3ZFEC 3TN92 1TMF1 2QQPA 2RS33 2WZR2 1RVF1 1AYM1 1BBT2 1ND2A 3ZFEA 1H8TB 4WM8C 1HX6A 1AR91 4RHV3 1PIV1 5D8AC 4WM8A 1QQP2 4CDQC 5BNOC 4Q4X1 1MEC1 5D8AA 4RQPC 1RUG3 2WFF3 4GH4C 3NAPC 4CDQA 2HWF2 5BNOA 2RM23 4YVSC 4CEWC 1VBB1 4RQPA 1AR72 1PO11 3NAPA 4GH4A 3ZFGB 4GH4B 4YVSA 4CEWA 1FOD2 2ZTNA 3S6PA 1POV0 5J98B 3CJIC 5A33A 2TBVA 1W39A 3VBSB 3CJIA 4CDUB 2GH8A 4RHV1 1EAH2 1C8M3 5A32A 2PLV3 1RB8G 2WFF1 2HWB2 3VBRB 1NG0A 1NY72 1V9U3 2RM21 3DPRC 1AUYA 2VQ0A 1NCRB 4RS5C 5CFCB 3JBG2 2X5IC 4IV1B 3DPRA 1ZBA3 4N43B 1AR82 1R083 4RS5A 5BNNC 1IHMA 2X5IA 1R1A3 5FMOL 1HRV2 3VBOB 1QJY2 4JGYC 1ND3C 5BNNA 1QJU2 1HXS3 5ACA2 1R093 4JGYA 1ND3A 1MEC2 1AR61 1C8M1 1VBC2 1PO23 1COV3 2R071 1PGW2 2RS12 5BNPC 1BEV3 5C9AC 2HWC2 1HQNA 1FPN3 2R043 1RUI3 1Z7S1 5C4WB 2RS53 5C9AA 5ABJB 1EV13 2RS32 1ZBA1 1B35B 1RHI3 1BMV1 2R062 1R081 3FBMA 1R1A1 1VBE1 4Q4Y2 1TME2 1NCQB 3ZFFB 4Q4V3 4JGZB 4RHV2 1HXS1 4GMP3 1R091 5GKAC 1K5MB 1H8TC 1AL23 2HWD3 1RUH2 1RUC3 1SMVA 4IV3B 1PO21 3VDDB 1COV1 1RUG2 1H8TA 1M06G 1BEV1 3J8F3 2MEV3 4QPGA 1FPN1 1VBD2 4BCUA 2R041 1WCDJ 2HWE2 1AYN2 4QPGB 1RUI1 5DDJ2 2RS51 1EV11 1PVC2 4GB32 5AC92 2BFUL 2WS93 1RHI1 1OHFA 3JD72 3VBUB 1RUE2 3ZFGC 2XPJA 3VBFB 4Q4V1 4GMP1 3ZFGA 1F8VA 1C8M2 1AL21 4FTEA 2HWD1 2PLV2 3VBSC 1RUC1 1QJX2 2RR13 4CDUC 1RMU2 5FMOS 3TN93 1V9U2 1RUJ2 2WZR3 3VBSA 1FMD2 4NWWA 3J8F1 1BBT3 1ZBE2 2MEV1 4EJRA 2XBO1 1F2NA 5L7OB 2FZ2A 4CDUA 3VBHC 4CEYB 1VRH1 3VBRC 1HRI2 1AL0G 2WS91 1AR63 3VBHA 2BBVA 1QQP3 1NCRC 2R073 1VBA3 5CFCC 5J96B 3VBHB 3M8LA 4Q4W3 3VBRA 4FSJA 4IV1C 1PGL1 2DF7A 1ASJ2 4N43C 4AEDB 1D4M2 1NCRA 1Z7S3 5CFCA 1TMF2 4IV1A 2HWF3 4N43A 1RVF2 3VBOC 1AYM2 1AR73 1RUD3 2RR11 3TN91 3VBOA 1VBE3 2WZR1 1FOD3 1BBT1 4LLFA 1AR92 1NA1B 1PIV2 1NOVA 1EV12 2GSYA 5CFDB 4QPIB 5JZGB 1X33A 2RMU3 4Q4X2 4CDXB 5C4WC 1QQP1 1VBA1 5ABJC 1EAH3 4N53B 4Q4W1 1B35C 2WWSA 5C4WA 1VBB2 4WM7B 5K0UB 1OOPB 1PO12 5ABJA 1AL22 2HWB3 2HWF1 1B35A 4PDWB 1NCQC 3ZFFC 4JGZC 2BPA2 1AR71 1RUD1 1K5MC 1NCQA 1VB4A 1FOD1 3ZFFA 1AR83 4GMP0 4JGZA 1X36A 4IV3C 3VDDC 1K5MA 1HRV3 1QJY3 2Y26A 4Y4YA 1MQTB 2RMU1 1QJU3 4IV3A 3VDDA 5ACA3 4QPGC 2WFF2 1EAH1 1E57A 2RM22 1VBC3 4CDWB 3HAGA 2XBO3 2FZ1A 2RS13 3VBUC 2HWB1 2HWC3 1VB2A 1NY71 1VRH3 4YVWB 2ZAHA 3VBFC 1RUF3 3IDEA 3VBUA 3JBG1 2R063 1AR81 3VBFA 1ND2B 1QJZA 5FOJB 3ZFEB 4NWVA 1C8NA 1HRV1 4Q4Y3 1TME3 1QJY1 1AR62 2BUKA 1QJU1 2WLPA 5ACA1 2R072 5L7OC 1VBA2 4WM8B 4Q4W2 4CEYC 1RUH3 1VBC1 5L7OA 3JB8A 1Z7S2 5D8AB 1PGW1 2RS11 4CEYA 1VAKA 2HWC1 4CDQB 1ZBA2 5BNOB 1VBD3 1BMV2 2HWE3 1AYN3 4AEDC 1RUD2 1R082 4FTBA 5DDJ3 4RQPB 1RUF1 1R1A2 3NAPB 2RS31 1VBE2 1PVC3 4GB33 5AC93 2IZWA 4Z92B 4YVSB 4AEDA 4CEWB 2R061
chains in the Genus database with same CATH superfamily
5IK8A 4I3GA 5KXBA 2FCTA 1LGNA 1POV3 1V6IA 4IEWA 4BMEA 3RWNA 1ODMA 1UYYA 2AEYA 1XC6A 1W0NA 1H2KA 1YFYA 5FFOC 1ZRRA 1CD3G 4L97A 1W8TA 3K4ZA 2BWCA 2G19A 4UFLA 1QNYA 3B93A 1FT9A 1YQ6A 4SBVA 2EVXA 3BCWA 3D8CA 2ZZQA 1BEV2 3MW3A 4XFAA 1YCIA 2R1DA 1PHMA 3L2YA 4BHPA 4UFMA 4OQ9A 4B4RA 1JU4A 3FLRA 2TEPA 1V6JA 1ZRDA 3J7HA 1NA1A 3RZHA 2PXJA 2X09A 3PHMA 3POIA 4QB2A 1ZREA 2JWPA 1BHGA 4MXWB 5CFDA 1AHSA 4ZZ8A 2IFRA 1FMD3 3J7MA 4N53C 1ZBE3 3FWEA 4YWAA 2WSUA 4YW5A 3AKTA 1EP0A 4LO6B 1O5LA 1YFWA 2GU9A 1OLRA 2L9LA 4QGLA 1OPOA 1OOPC 4FPLA 1W06A 2JG8C 1S0BA 1US2A 3DPRB 1NLQA 4YNIA 4IUGA 1BQPA 1WCSA 1WCQA 2ZMKA 3I3DA 2BNOA 4WM7A 2WA4A 1AF9A 2AUYA 3J26N 4CDUB 4CCKA 2P37A 4KNCA 3PDQA 4COUA 3CIHA 1Z0HA 2BFUS 2WKKA 5BNNB 1RUC2 2VCBA 3IPVA 5FXXA 3E6CC 1SBEA 1CZVA 4YM0A 3AKSA 1TMF3 3ZDVA 3V0BB 2BGOA 3K3OA 2MEV2 2VW0A 3GALA 4P02B 4GXLA 1Q8PA 2XBO2 4RFT0 2YFZA 3AMQA 3SH3A 4Q0SA 3NL1A 4G4FA 2QQNA 5T54A 4LPLA 5JIUA 1EYBA 1RMU1 3AKQA 3OB8A 1RUJ1 2J1UA 1MQTA 4YM1A 2WS92 4CDWC 4DUWA 4Q0VA 2VZTA 4KWUA 2YV8A 3B9IA 2VTXJ 4QT6A 5BNPB 1ALYA 3OUJA 4G3YC 2Y6KA 3VKOA 5A3PA 4FOVA 1HQWA 2W3JA 2PHWA 1IQDC 4P9LA 4RR3A 3WEZA 1LHOA 4A3ZA 4YVWC 5CB7A 1MACA 1VAMA 3U37A 5G05L 1CX4A 4JHZA 4UYBA 4P9JA 1BLZA 3O1SA 2BNMA 3Q8CA 1YFXA 4F8AA 1Q43A 4YG6A 2JXAA 4A7YA 1IG3A 4LK7A 3A21A 3AKPA 1LGCA 5FZ7A 4GWMA 1DZRA 3O5SA 1PO13 4Q2FA 4TSVA 4QM9A 1O5UA 3TN92 1SZBA 4ATFA 1ZZ9A 1PMHX 3P5BA 2RS33 1DU3D 1J84A 1E5RA 1RVF1 2X10A 1AYM1 4EN6B 1LAJA 1UMZA 2EAKA 4AEJA 2X8KA 3ZSJA 2VL4A 4BPZA 1IQAA 2Z69A 5E6HA 4FXGB 2DU0A 3R4SA 4D8MA 4YW4A 5KC6A 2XL7A 3ZSEA 1AR91 2ETEA 1GZWA 4LITA 1W2AX 3MIGA 5EYYA 5D8AC 5CADA 4WM8A 2BRTA 2AREA 4NJ4A 5EWSA 3POEA 3ZR5A 2ATFA 1PMJX 2GNTA 4XJWA 3RVHA 5A3UA 3SCGA 2LRPA 3VD4A 4Q4X1 1MEC1 4YGEA 1VMJA 4QX2A 2SLIA 2IVIB 3WINE 1DFQA 2WFF3 2E31A 4J1XA 3NAPC 4QM8A 1SFPA 3S7EA 5IWFA 2E6VA 4QGMA 2X53S 4YVSC 3SITA 2B9UA 2XL9A 5DUVA 3AX4A 3KQRA 2VY0A 3FC0A 3RZMA 5FY0A 3JUUA 4NIDA 5IVYA 4GH4A 3ZFGB 4RA0A 2ARAA 5H9RA 3TBDA 4A45A 2Y33A 4CEWA 1H4GA 2ZTNA 3B02A 4W8JA 3S6PA 1OVSA 3DCQA 4ATEA 2P34A 1POV0 3RYRA 3VN4A 5I8YA 4R4XA 1W03A 5A33A 2C4XA 2P5BA 3M7AA 2OT7A 2BQPA 1W6MA 2WIIB 4DEVA 1GWMA 4IEUA 3DECA 1S2KA 4NHLA 2QZ2A 3CJIA 4A44A 4RHV1 1HW5A 4FPJA 1CZSA 3PVOA 2ZHMA 2XLAA 1EAH2 2JB8A 3AMHA 3Q8BA 4L92A 1SBFA 2ZJCA 2O1QA 5A7QA 4OHXA 4XBLA 1G7YA 3MLJA 4P9GA 4Y1YA 4XBNA 4KG8A 1J58A 2PA7A 4QX7A 4IDZA 2VMEA 2ZX4A 3HQUA 2P3YA 1UY1A 1YC61 4FOQA 2BP6A 3RSJA 2RM21 3DPRC 4KWKA 1JN2P 2CY6A 1AUYA 3WW3A 3GDBA 2WUHA 1YIFA 2VXRA 1XU2A 3JBG2 4FQZA 2Y0IA 4PQQA 3RYPA 2D6MA 2PHXA 4KI5M 3T1MA 4AFCA 5LA0A 3ZYGA 4N43B 5HXVA 2VMFA 2WC2A 2CAVA 4YW3A 1R083 5BNNC 1QJFA 1CAUA 4YLZA 2X5IA 2C9KA 2UWAA 4JVAA 1VALA 2YGMA 4UFJA 4E2SA 3DGTA 2VMGA 3EMRA 4BQXA 2VO5A 2A5ZA 2DU1A 2ZGPA 4XVHA 1JYXA 5IAVA 4TXWA 2XHNA 5ACA2 1ENQA 3BGAA 2PQSA 3POFA 2FDJA 3RZLA 4XUNA 5FPLA 4D7TA 3OPZA 1ND3A 4AVTA 2WO2A 4YW7A 5FO8B 4TTGA 3J7LA 1GLHA 5FZ9A 3CDZB 4QQOA 3WR0A 2RG4A 5BNPC 1X8MA 1BEV3 2W5FA 4AAPA 4XBQA 4FTBA 2HWC2 1D2QA 1HQNA 2WYSA 3CNAA 3GCWA 1I6XA 2QNKA 4FOYA 1QMJA 5JOWA 4Y26A 1CGPA 1YXWA 4B7KA 3ILFA 2Q8OA 5C9AA 3PL0A 4CPBA 4B29A 3OTFA 5K9YA 4IEQA 3LSDA 3DYPA 4AHXA 2F4LA 3MICA 1ODNA 4FOWA 5EFUA 2GAUA 3SH5A 2ARBA 1IG0A 1R1A1 1GYKA 4Q0UA 1WLTA 1LOGA 4Q4Y2 1NCQB 2GC2A 4DO0A 2NLRA 2P17A 3KZ4C 4N7IA 1QJEA 1R091 5AC92 1GSLA 4I01A 5GKAC 2E63A 1K5MB 3MGUA 5LA1A 1OSGA 1O3TA 4KWLA 1UCXA 4XURA 4QB1A 1ULDA 2YUEA 4F7ZA 1UOJA 4FPOB 1RUH2 3I3MA 4P9WA 3KV9A 1RUC3 1EPWA 4IV3B 1PO21 2KR2A 3VD9A 1MZFA 1RUG2 4QPWA 1WBFA 2D98A 3NWKA 3U4XA 1JBCA 3BOWA 4MSVA 3KF3A 4CRQA 1NAEA 2I45A 4B4PA 4NRQA 2JB4A 2MEV3 5HCHA 2RDSA 1HB3A 1VBD2 3U78A 4JTOA 5FZ6A 1D0GA 2HWE2 1AYN2 4YW2A 1RIRA 3I2KA 2YMZA 3RZZA 2GMMA 3HBKA 4K21A 5F9TA 5H9SA 3UKVA 4O7XA 3FHQA 1SDDB 1S0GA 2BFUL 4CPBD 2WS93 2W91A 2J22A 2HBTA 4K40A 3ZKYA 4R9BA 3N7MA 4M4RA 5FZ1A 3M1HA 5GZCA 1RUE2 3MF9A 3ZFGC 2VNOA 3AC0A 5C33A 1ZRFA 1GZCA 4IGPA 2W2IA 4UF0A 4DXSA 5CA6A 1DLCA 4OMCA 4OHVA 5IFTA 4Q4V1 3UKNA 4E2GA 4YFZA 4M00A 4GMP1 1CAVA 3VDAA 3GNEA 4IE4A 2WZPP 1C8M2 1AL21 4QQPA 2EIDA 2XQXA 4FTEA 4KU8A 5JPNB 2G9GA 1JXNA 4X6RB 3W5MA 3WG2A 5CISA 3LE0A 3UETA 3EHKA 5FMOS 3TN93 2LALA 3IDCB 4JDNA 1Q8VA 2A6YA 2XJUA 3NVCA 4XHXA 1BJQA 2VZPA 4CDUA 2JDZA 3UNPA 3KF5A 4LOSA 3VZJA 4OI4A 4NMIA 3POJA 5DZFA 5CAZA 2WJSA 2HBUA 5GLTA 5H9PA 1E5HA 4XF0A 4XMAA 4E4HA 2O0OA 1C1LA 4BIOA 5TSWA 1S0DA 4W50A 3E5QA 5JOYA 2BBVA 3AP6A 4XAAA 3DF0A 3HJRA 3LA7A 3VBHB 1OF4A 5LW9A 1ASJ2 4N43C 3IMNA 2B8MA 4Y22A 1H9WA 5LBBA 3WP4A 4AEDB 4E4DX 2VE1A 1GU3A 2ILMA 4QQ2A 4AI2A 1JH5A 1KS4A 3J4UH 2VBPA 5FZOB 4EWDA 1SHWB 1JZ4A 1NUKA 3VDCA 2V09A 2ZGOA 1JI6A 1ZYBA 3SXWA 1WLDA 2A71A 3FLTA 2RDNA 4GWNA 5FPUA 3WDUA 2YPDA 2DCKA 1APNA 1CJPA 3O1VA 2W9XA 4EN0A 4K7JA 4OHYA 2RE9A 2ET1A 3HT1A 3NW4A 1OLMA 2EALA 5A3OA 2DVAA 2A3XA 4JHTA 1NA1B 2IXKA 1PIV2 4BIFA 1NOVA 2A6VA 1F31A 4FPEA 4PLNA 1ZA4A 5LBCA 4LKFA 3R6SA 4AAXA 5CFDB 1NXD1 2J1VA 1GNHA 4QKBA 3VHPA 5LZ6A 3ZM8A 1DYPA 3AMPA 5LBFA 2XJRA 1LCLA 2RMU3 4XFFA 2CGOA 2DYCA 5A7PA 2CYFA 4D94A 5GLVA 2ZEXA 4E4ZA 5FR3A 5IVEA 4A3XA 3T2OA 5C5TA 1XYOA 2R49A 1EAH3 2GP3A 5HCAA 4I30A 1UZVA 3SMHA 2ZA9A 3SQOA 2ZMLA 5C4WA 1US3A 2ZACA 3B00A 4WM7B 5CG8A 4JTNA 2XOMA 5HXMA 3U4SA 4D7YA 2B39A 1B35A 1PGSA 1NCQC 2E32A 5FY1A 3INAA 3SCFA 3OEAA 4Z2WA 1W6NA 1Y9GA 3S30A 4XMIA 1AR71 4NAOA 2OW4A 3ZPYA 1ENXA 4B7EA 2JD4A 1FNYA 2OX0A 2ZX3A 1K5MC 4FPHA 4Q8KA 1J1TA 5EIYB 3S5AA 5LB6A 1FOD1 1B09A 2D93A 3MPPG 5BUVA 1X36A 4LHLA 2AACA 3MIHA 4HKOA 4IV3C 4AE2A 4OLLA 4XQDA 3PU8A 2D5HA 1PX4A 2J7MA 2AR6A 4CXXA 1MQTB 2JG9A 4Q27A 3WDXA 2Z5WA 3TWIA 4OMDA 3VDDA 5ACA3 3MV11 5GALA 2YZ4A 3NSTA 4CSWA 2A7AA 3IDBB 4LO8A 4EV0A 1W2TA 2QQUA 4TWTA 4AGVA 3CJXA 3W58A 4JKLA 2VECA 2YBPA 3KGZA 5E16A 1OUXA 1EY2A 3WCRA 3RDIA 1V6KA 3I7DA 1C1FA 4BISA 2VJXA 5A7OA 5F3GA 2HWB1 5IJRA 2HWC3 3CF6E 2WQ4A 1NY71 1RITA 3T2TA 3M3EA 2GALA 4LBNA 2J1SA 2ZAHA 1S2EA 2PN5A 5DAQA 3WNKA 4OI1A 3O0XA 4IEZA 1NXMA 5FY8A 4XZPA 4O9EA 2A6XA 1UZYA 3NV1A 4XFHA 4MV2A 2PHLA 3VBFA 2JIJA 2WA3A 3WQBA 1O6UA 1OI6A 1XOYA 4JC1A 1DGRA 2FBEA 2Y64A 4NWVA 4D7SA 2JDKA 4Q4Y3 2ZZJA 4BK4A 3QD6A 4P5HA 3BN6A 4META 1UY3A 2DWRA 2QDRA 1GZWB 2B4KA 2J1EA 1OH4A 1SLAA 3N9LA 4ZONA 1ZNPA 2LS6A 4Q4W2 4WM8B 5FYSA 3ZXEA 5IK5A 2OS2A 4HKWA 5A7SA 1G9CA 3IKWA 2Z4FA 1RUH3 3ME2A 2OZJA 1VBC1 2VQTA 1HN0A 4GIQA 5L7OA 2VXJA 3BB6A 3LAGA 3S0MA 1ULEA 4BLIA 2IC1A 1PGW1 1JOJA 1D4VB 1DLLA 1N3OA 1VAKA 4YRDA 5BY5A 4D6QA 4C90A 1ZBA2 1VBD3 1LENA 2XONA 5A3NA 3APBA 2HWE3 1AYN3 2IXLA 1RUD2 4AEDC 1BMV2 3CO2A 4ONUA 5IVBA 3IN9A 4DB5A 2VZQA 1JS9A 3LSEA 1REEA 4Y1UA 3BI3A 1LOFA 5EJZB 2P3JA 3I2DA 5HCFA 1TEIA 1WMEA 1V6OA 2OPWA 4CEWB 3ZPOA 1UX7A 4BQ4A 1HXS2 4I3PA 3WDYA 4YZ3A 3FBYA 5I0RA 4IETA 1RUE3 3I2IA 5A33B 5GZDA 1F9KA 3WP5A 3NO8A 1W6MB 1TME1 4PJYA 1UIJA 4FPCA 4R52A 3CQOA 1YO8A 4DRRA 1COV2 2Y60A 4QKDA 1NA1C 3CJIB 3K75B 5FZGA 4AFAA 2HEYF 1I1EA 1DCSA 5CFDC 3MPBA 3WW2A 4QQHA 1GR3A 2C0ZA 2VUAA 3VDBA 3DN7A 1VE0A 2R042 2P3IA 3MW4A 1QHDA 1RUI2 2DVBA 4FQ4A 5C3OA 5CKMA 2RS52 1XNDA 2Y8KA 4XUTA 3LF7A 3O14A 5A1LA 3OGVA 2JE7A 1WBLA 2KA3A 4WVWA 5JZGA 5IVCA 4HK8A 3U11A 3ZYBA 2K0GA 1W2OA 4CDXA 5T5JA 1L7QA 1A6CA 4WM7C 4LMFA 4ORFA 2C1FA 4DY3A 5JXIA 1WWYA 2MNGA 3NNJA 1KGYA 1PVC1 4QXHA 4AG4A 3AVRA 3PVBB 1H6YA 5K0UA 5CEHA 1TQ5A 2OVUA 5FP4A 2R7EB 1CAUB 4UFIA 2X5IB 5KXDA 1POV1 1Y9QA 2C5DA 4GQ7A 3GJAA 2ZHNA 5JR7B 2D7FA 1ASJ3 3A23A 3LIHA 4QGNA 2W08A 4DUXA 4BMBA 4IW3A 3M70A 1WW7A 5C8CA 3AYCA 2RHPA 1WW4A 1F4AA 1GMMA 2WNEA 1O4ZA 1XYPA 1ND3B 3J8F2 2PLV1 2ES3A 4ASMB 1MQTC 3BIWE 4CZSA 1ZZCA 3H1WA 1WCKA 5J36A 1LNSA 5BNQA 1L7RA 3N9QA 3PUQA 1DP0A 3USSA 1CAWA 1MR5A 1VRH2 4HMZA 1FMD1 2VR4A 4RL7A 1ZBE1 4DMIA 5JXJA 3ZXDA 4RR3C 2A75A 3FX3A 3ZO0B 1RUF2 4XILA 2ZGQA 1PIV3 3P6BA 3RZGA 1V70A 2D3PA 3T4HB 5C9AB 2DUQA 3CZJA 4HBNA 4AVBA 1GBGA 1CAXA 1MZ6A 4J6GA 3ENRA 4NHKA 2YB7A 4CP9A 4LKDA 1WGPA 2A70A 4WVZA 3CHXA 2QFEA 3LOBA 1HJFA 2JX9A 3K77A 4M3CF 4AZZA 1TZOA 1XRUA 4CCLA 1J59A 3VKFC 1SQ4A 5ERLA 1J3QA 4BZ4A 3C7HA 4AEKA 4PHZA 4CCEA 1TMF1 2X29A 4CE8A 5C3QA 2QQPA 1WLWA 2WZR2 3QOPA 1OVPA 3G7DA 4A4AA 2UWBA 5JXHA 1QOSA 1SFNA 2RDQA 5FTTC 3RGBA 4WM8C 1S1AA 4XXPA 4BOWA 3HN1A 2VBDA 4QQLA 5LATA 3LOIA 4B8EA 1H1AA 4TZDA 1BVP1 3ZDSA 5F37A 2ZHLA 2FDHA 5JOZA 4YW1A 4AI3A 5J37A 4HOOA 4Q5OA 3PUSA 1R1ZA 2D43A 1MS0A 4NPMA 4HN1A 1PX3A 5F39A 3GZTB 1S55A 3NJVA 4EYUA 2KD7A 4L99A 4YZ2A 3QH6A 1UKRA 3OBRA 1UO9A 3N9PA 3C7OA 4GH4C 2J1TA 2XGXA 2AEZA 1H0BA 2LUWA 4UF0B 2VVEA 4CEWC 5A7WA 2VAUA 3WT3A 1C5HA 3ZN6A 4RQPA 1AXZA 1UF2C 1WA6X 4JQRA 1PO11 3UYJA 4B1LA 1UX6A 5FYHA 3WG3A 1CAVB 4NPRA 4EZHA 2BOJA 3W5NA 3MLKA 4FVVA 1ZRIA 1HB2A 2E9QA 2WFPA 3V64A 4UI9L 3OBZA 5LRSA 1VP6A 2PHDA 4XHBA 1JUHA 4OQ8A 1RUOA 2Q4SA 5FXVA 4AXOA 1UU4A 2FMYA 4DRVA 3CJIC 5T55A 1T6GC 1WMXA 3R05A 2QBXA 1ZVFA 3HOBA 3ZMNA 5KXCA 3GBFA 5FP8A 4N7UA 2W46A 3LEMA 3O7OA 1FXZA 1PVXA 4UBHA 3DKQA 1U5YA 3O0WA 3AB0A 1W0PA 2GH8A 3OG2A 5FPAA 2BBAA 2WT0A 4JDOA 2A1XA 4AQSA 1K45A 3LEKA 2JE8A 1AX0A 1CONA 1W9WA 1PM7A 2PLV3 2GC0A 1GWKA 4WVMA 5CZKA 2ZKLA 3ZIWA 1VPHA 5JUVA 1QIQA 4PLMA 2WFF1 2B9VA 4YGCA 1H8VA 1NG0A 2AC1A 2HLEA 1W8FA 1YQ8A 1MVQA 4Y22B 1H30A 4XCBA 2EIBA 1YI9A 2FMDA 2N7GA 2VQ0A 3USUA 1G86A 4QDRA 4K3UA 4ZY9A 2X5IC 1RXGA 4PBOA 3VD5A 2UU8A 4AQ6A 3O1TA 1OUSA 1ZBA3 3H3UA 5F3CA 1MZEA 2NMOA 4JRLA 1AR82 4HL0A 2EIGA 1GP4A 3IBMA 1JYWA 1J3PA 3LFIA 1HRV2 1RINA 3CLPA 5G04L 4CCNA 3FJSA 1ND3C 4A7KA 2VM9A 4CUBA 4IE5A 5F32A 2B5HA 1HXS3 1BKZA 2GDFA 4Y3OA 2QTWB 2R1BA 3D0JA 1E5SA 2JDMA 4AVVA 3UKTA 1ZZ8A 3OGGA 4HKLA 3WCSA 5C8WA 4JGYA 4MADA 4NOTA 3VLBB 1MEC2 3PTRB 1AR61 3IZOA 1NX9A 1WMFA 1COV3 5FRAA 2ZX0A 5LY1A 2WLQA 3MW2A 1LHWA 1W04A 3I59A 1JHNA 2TNFA 2VZRA 5C9AC 1U12A 1LEMA 2Y34A 4BQ5A 4EE2A 1LOEA 2VQUA 4AHWA 4LT5A 1ULFA 4XDQA 4DXZA 2R043 4EWAA 1RUI3 3I2JA 5C4WB 2RS53 1K12A 4CCMA 5FYBA 4KGGA 1EV13 3DV8A 3KV4A 4MGIE 1W3XA 3O1PA 2JDYA 5A3TA 5DAXA 3WX5A 3D4KA 1B35B 4Y4RA 3DYOA 2R062 1UZWA 5FQ0B 5JI7A 1R081 1W6NB 3S7IA 1W05A 5KBFA 1SLCA 4NIIA 2NP0A 1RJ8A 1ENRA 2XJSA 4XJUA 2QCSB 1VBE1 3E6BA 3AZVA 2JE9A 5F3EA 2EF6A 2O8OA 5ANQA 4NROA 4G9SB 4DXRA 5J7MA 3A22A 4RHV2 1BK1A 2I07B 4QWNA 4ZXEA 2VZVA 3ZLIA 4MGQA 3ZSLA 4C0BA 2YBKA 5LEJA 5FJKA 4XPVA 2JG9B 2ZAAA 4LBLA 4BXFA 5D21A 3K48A 1PMIA 2QDNA 2WR9A 5FK8A 4YYOA 3VDDB 4BA6A 1H8TA 4NN0A 1MS5A 1BEV1 4LIVA 4OHWA 1GOFA 1X7NA 4OVEA 5C6CA 3J8F3 5FBZA 1AXYA 4XF4A 1WCDJ 1OXCA 1Q56A 2Z2SB 3ACIA 4QPGB 5DDJ2 5FLHA 1W2NA 5LA9A 5KHJA 4CP2A 1VLNA 2DCYA 2WWJA 2RVAA 3B01A 1OA2A 4GB32 2OA2A 2JICA 3WNLA 3FMGA 1GV9A 1N1TA 2WL1A 1OHFA 2UWCA 1W8UA 3ALQA 3RPQA 5CBLA 3WP3A 3JD72 4AI8A 5IK4A 2ZX1A 4LR4A 3PTYA 5LA2A 1OQEA 3ABZA 5GJ6A 4X8PA 1LHVA 1WMDA 3KHBA 4A41A 1HB1A 2VUJA 2XHKA 2W92A 4GKYA 3VBFB 2VMIA 3LDBA 1JOPA 2LW8A 1OBNA 4EN7B 2Q8CA 5FAXA 2OPKA 2W52A 3FL7A 4JV4A 3OD0A 3GHMA 2ZCWA 2EXKA 5HCBA 3E6DA 4DEQA 1JYCA 1RUC1 2DV9A 1QJX2 3HQRA 5FUPA 5FYVA 5A6ZA 1F15A 2YGLA 4CDUC 3LB9A 1JTZX 3WDVA 1V9U2 2WZR3 4NWWA 2MEV1 3AJZA 3DYMA 4NO4A 3I3BA 2XBO1 5I0SA 5IK7A 3BTXA 3WNPA 2QQMA 3VD3A 5L7OB 1AZDA 3RFRA 3AYEA 1PZ7A 3UK9A 2RDRA 4MGYE 1RL3A 4LNVA 5DUXA 2ZGTA 2YU2A 2VOXA 5F6LB 4K1YA 1HRI2 2KXLA 2WS91 1AR63 2VOKA 3I49A 4LBJA 1A78A 1A34A 1VBA3 5J96B 3NJXA 1Y9MA 4KG0A 4RGGA 4XTPA 2PAMA 3GBGA 2CWMA 4GKXA 3NV4A 4CU9A 1D4M2 3Q8AA 4NUBA 4LJHA 3H9AA 3ZXKA 1H6XA 3KVAA 5GLUA 5CFCA 1JYVA 2R0HA 4Y1VA 4AVCA 3BPZA 2VMDA 4XXAA 2XKOA 2VPVA 1UY0A 1IS5A 2EICA 2ZXQA 3M3QA 4I0AA 4QX3A 3U1XA 2PMWB 4FT8A 2EXIA 3WF0A 5C3PA 4E2QA 1SPPA 1CPMA 4B3NA 2GNMA 1TVGA 1HQLA 1NZCA 1VR3A 2DUPA 2XDVA 3TN91 3HEIA 4NIGA 4QXBA 1W9YA 1VBE3 3ZXFA 5J09A 4PCRA 5DABA 3WW1A 4LLFA 4HANA 3TAYA 2OZ6A 2LM3A 2DUOA 3ZN5A 4CXWA 5B4NA 2VZUA 2GSYA 4LO7A 1S0IA 4Y20A 5JZGB 2XWJB 2BOIA 1CR7A 2WN2A 5GZGA 2WAAA 1E5IA 1UOGA 1XNCA 3EJKA 2V73A 5LCWL 4CDXB 5C4WC 2CTVA 2WT2A 4R9CA 4YZ5A 4URTA 2JDAA 2OQ7A 5FIXA 3JZVA 4JX0A 3VB9A 1JZ2A 4KWJA 1B35C 5F3IA 3HQXA 3LIGA 5FZ4A 1GQHA 4A6OA 1VBB2 5K0UB 3O1OA 4A7ZA 1AL22 2Z42A 2K2SA 3AP9A 4L11A 4MGKE 1GZTA 2WNVA 3CMGA 1K42A 2EAAA 4TLGA 2IXHA 2BPA2 2HJIA 5E8AA 4Q1PA 1XQNA 2Y6FA 4BQWA 5FWJA 3BTZA 1O4YA 4WZCA 5F2WA 5IVJA 2DVDA 2GMEA 4NR1A 1VB4A 4CP1A 3JU9A 5FPBA 3NNFA 1AR83 4JGZA 2JG9C 2WZ8A 3LDKA 2VUCA 2ZKNA 1HIXA 2P4EA 1IS3A 1W6OA 3DXTA 3CBNA 5DG2A 5FZEA 3VDDC 2OXBA 1HRV3 4HG6B 4OUSA 3OYWB 4GJZA 1CAWB 2Y26A 4H7LA 4L8QA 4QDSA 4Y4YA 3VZMA 2W1QA 3ZVXA 2RMU1 2VU9A 1F4HA 4ZZ5A 5A1FA 2CL2A 2Q8DA 3WNMA 1WKYA 4QPGC 3SLIA 1UQXA 1N1VA 1EAH1 3WLUA 5IATA 1CAXB 2C6SA 4GAZA 3HAGA 1AJKA 2CV6A 3THPA 2XBO3 3VZKA 1OFSA 2FZ1A 1UN1A 1D7PM 3GJBA 3I2HA 3OCPA 4CP9B 4P14A 3ILNA 1QDOA 3S57A 5AFEA 4FFFA 3VUOA 4QKFA 2W87A 2BW8A 3BODA 3VBFC 3NJYA 2XH6A 3KCXA 5FWEA 5FZDA 2BVVA 3IDEA 3VHNA 3JBG1 3RI9A 2YY1A 2X05A 1UL9A 3PJYA 5ISLA 2OUHA 2VTXA 3AL6A 1PNGA 2R063 4COWA 5JMCA 1H9PA 1QJZA 3FZ3A 1G9FA 1PZ8A 4HVRA 5F2SA 1C8NA 4HSLA 2Q1MA 3F2ZA 4L0PA 2SBAA 5DQ0A 3RJ2X 4BLJA 2OYZA 5A6QA 2WO1A 5EYXA 5KHIA 4Y1ZA 4E8CA 4PIZA 3TNPB 2WLPA 4WZFA 4XUOA 2CSGA 5FOBB 5ACA1 2R072 5L7OC 4S2GA 2GH2A 4S2DA 2LTNA 4P9YA 1KFUL 1KXGA 3LCPA 3D3AA 4Q0QA 4BYYA 1Z7S2 2WRAA 4CXYA 1CX1A 4ISRA 1EUUA 1LGBA 1YUDA 1LECA 2HWC1 3HNMA 1LOFC 1JHJA 1IPSA 5T5OA 2OKXA 3MI8A 3FLPA 4N90A 4OUMA 3EB7A 5A7WB 3HPNA 3ZSKA 2E26A 4GULA 4RQPB 5DDJ3 4AF9A 4EZ4A 5JDBA 3H8OA 3OGJA 3D82A 4GB33 5AC93 2IZWA 5KHKA 1W8HA 4UW3A 2XVGA 1YNAA 4FPGA 3P3NA 4XJ9A 1YIPA 4XDPA 3JD73 5A3WA 1ZM1A 4Q4Y1 3WD5A 2FHRA 2RJ2A 4QX8A 3HNYM 3KT1A 4X8NA 1GQGA 3TB0A 3SEEA 4NHMA 3TNQA 1JZ8A 1UY4A 3H50A 3O12A 1QGLA 5KXEA 1FV3A 3GM8A 3J7NA 3PVEA 4M3CA 2QZ3A 5JZGC 3AL5A 3Q8EA 4E9KA 1FPN2 1RUH1 4XF3A 4N9HA 1QJX3 2E7TA 3BVCA 4WVMB 5EJ3A 1RUG1 1GFF2 3N7KA 2OUJA 2P6CA 4CDXC 1ST8A 4A2UA 3FUQA 2G9FA 4QPIA 3N3HA 1LODA 5FK7A 3D0SA 1A8MA 4CU6A 5JXGA 4FTSA 3FFQA 1DGWA 2WQ8A 1G6NA 1VBD1 1RHI2 2D6OX 2Y38A 5F5IA 5JWPA 2HWE1 1AYN1 1EPZA 4MVTA 1OMIA 4NIHA 5K0UC 3USUB 1STMA 5F6KA 1SLTA 1HRI3 1VJ2A 2EIEA 4HVOA 3AZWA 5K8SA 4KMQA 3WUCA 1O3RA 3U14A 3THTA 2HEVF 5FMBA 2DFCA 3N36A 3OY8A 3KLSA 4MXVA 5FY7A 3T0AA 1H1IA 1RUE1 5C8CC 2XXZA 5A6YA 4XQ4A 4ES9A 3RZJA 4XIOA 4PDWA 4AEMA 2HWD2 4LK6A 1TNRA 1D4M3 4O9GA 1UAIA 4XACA 3KT4A 4KL1A 5L9BA 3T0BA 2ORXA 3IPVB 2XB6C 4IE7A 3ST7A 2Q1FA 3JBG3 4D6SA 5CKNA 4JGYB 4V2WA 4LHNA 1GNYA 2I74A 1FNZA 1CJDA 1ZZ6A 1KQRA 3IB3A 5HI0A 3NKTA 1QXPA 5FYYA 1H4HA 2BGPA 2IXJA 3GXUA 2GZWA 5FO9B 1UXXX 2AYHA 4IEXA 3B9CA 3ETQA 2D3RA 3D6EA 3T1LA 1D2SA 4N8MA 5BNPA 3ZSMA 1SCSA 1RTVA 2GNBA 2ENRA 1QOTA 5LRRA 2VCCA 5KR7A 3KD4A 2BNNA 1IKPA 3MDPA 3MHZA 4XIKA 5FZFA 3ZXJA 4CTEA 5I91A 1R64A 1PGL2 1G8WA 3HN3A 4RR3B 2PQQA 4HLTA 3VKNA 1KD7A 4CVUA 4OULA 3ZYHA 3WHUA 4AWDA 4M0HA 1Q3EA 1OLQA 3ZYPA 1ASJ1 4QHZA 2HH9A 2R16A 1VBB3 2Y6HA 3J9SA 4H14A 5KHGA 4ZU4A 2RR12 4LUMA 3WNOA 4OFGA 3AMMA 5FREA 4AYUA 3MFAA 1JOBA 1GWLA 2WABA 5FYZA 4AVAA 1H2NA 1XNKA 2VUDA 4MHUA 1BBT2 1W6PA 4JAAA 4BU2A 4LBQA 1LU2A 1ND2A 3ZFEA 2CGNA 2C24A 1REDA 4QKNA 1H8TB 4UXAA 3C2UA 1UZ0A 3B7MA 4AW7A 2JECA 3IM0A 2UURA 1AX1A 1OLME 3AK0A 5FMCA 5GZFA 1W8WA 5H9QA 3CZUA 1YEWA 4HK9A 3WQ0A 1PIV1 4LHKA 1QQP2 4JKKA 1W99A 2VW2A 1GANA 3OJBA 3ZX7A 3UGGA 1BCXA 1I9RA 4MX3A 1WW6A 2QQOA 3ITQA 3ZXGA 1SCRA 2BDRA 1OQ1A 4A42A 3BYWA 4RQPC 1RUG3 1XNBA 2VZOA 2CDPA 3O1MA 1MS4A 2ORZA 4PF5A 5T52A 4AHYA 4CDQA 2HWF2 2D6NA 5BNOA 1LEDA 2GC1A 1W9SA 2YHJA 3R4DB 4X6QB 5DZEA 4M01A 4OHZA 3BUCA 4FFIA 4MZUA 2E33A 4XW3A 4LQRA 1W8ZA 4GH4B 4HPKA 5HV4A 1FX5A 3LDRA 3ILRA 5FZBA 5A80A 2XR4A 3IDAA 5J98B 3AVSA 2H6BA 3LWCA 2P3KA 2QVSB 5F5QA 1W39A 3AZYA 4P9IA 5FPVA 2G1MA 1PK6A 2GC3A 5BPXA 2ZPXA 3OUHA 1REFA 2XLFA 4ZKTB 3T2PA 5FUNA 3GYDA 4NRPA 5T50A 4CU8A 4Z07A 1C8M3 5EPAA 3FHAA 4Z1VA 5A32A 1J83A 3HIFA 1HJGA 1I5ZA 3QLQA 4K9SA 2XWBB 3W59A 3ZOIA 1TE1B 1QDCA 5I8TA 4JCKA 1GZ9A 2D3SA 2Y6GA 4CUGA 2VBBA 4LLOA 2E7QA 3HD8B 4BQ2A 4NHYA 2EXHA 3H0OA 4IQPA 5IHRA 3UV9A 1XU1A 4HT1T 3L9JT 5CFCB 1LB2A 3WQ7A 2FCVA 4S2HA 2G4IA 3KB5A 2MHFA 2Q8EA 4EROA 1V6MA 4OZXA 2A6ZA 3AJYA 3ZYRA 4RS5A 3NMBA 3OBAA 1SPPB 1IHMA 2AGSA 5FMOL 2B7YA 5JMOA 1TNFA 4LTAA 1QJY2 1XSQA 4JGYC 5CNAA 3SHRA 4MG2A 2WZEA 5FZ3A 1UWWA 5C7GA 1HN1A 1QJU2 1AX2A 1QXRA 3K3NA 3MIEA 4XF9A 1UXZA 2R32A 5FZKA 1RXFA 2Q1ZB 3H3ZA 3R4UA 3POSA 2JDPA 5ANNA 5FPXA 2QE3A 4Y20B 1OURA 1UYPA 1V6LA 1X50A 3QACA 2PFWA 4K8RB 1QWRA 1RGSA 5JR2A 2Y0OA 2W0XA 5EXOA 2PTMA 3MUZ1 1HLCA 2RS12 2PHUA 4AOCA 2C9AA 2KM2A 5FY5A 4LO4B 4I0BA 4PF1A 3BALA 1FPN3 3T2QA 1W8OA 1JZ3A 4KBBA 4XE9A 1LOBA 2VOWA 2DCJA 1W2UA 5C3RA 3C8XA 1UZZA 1UY2A 2RS32 4C1WA 3RZKA 1QH7A 3AP4A 5E89A 2PAEA 1MPXA 1ZBA1 5JOXA 2IUWA 4COZA 1RHI3 3TOJA 1BMV1 2A3YA 1URXA 2WNVB 1JODA 4GZ9A 4F83A 3PU3A 1DGWX 2DTYA 3ZKUA 5FYTA 2V5DA 4IESA 3FE5A 3TEXA 1H2LA 3D5OA 3VKLA 1GNZA 1W3VA 2GN7A 2PAKA 4XUQA 4JGZB 5FP9A 1HXS1 3AP7A 1QEXA 1W6OB 3KVBA 4PI2A 2VQAA 1H8TC 2VH9A 4Z82A 2HWD3 2IXCA 3PMSA 3BKZA 4FPFA 4AL9A 1SMVA 4XAEA 1DQ4A 1COV1 1K3IA 4HONA 2BV4A 1WD4A 1T6BX 4LE3A 2ZBJA 1IGOA 4PIXA 3IAQA 2PELA 1N47A 5A70A 2D5FA 2R041 3K4AA 3AMNA 3RMYA 4DS0A 5FKCA 4ZHNA 1RUI1 3E5XA 2RS51 4TYSA 3V0AB 1EV11 3QBQA 4HETA 4YG0A 2MPFA 3W21A 2W94A 4MGZE 4URAA 1YI7A 4LKSA 1CPNA 1YQ5A 3BTAA 3EO6A 1UPIA 5J48A 4H7MA 4UFKA 3BTYA 2DCZA 3H8RA 3PURA 2NPIA 1JYNA 4C91A 4K8FA 1W9TA 1W8NA 3TRSB 4FPKA 2UYBA 1O3SA 1MZ5A 3OOXA 5EV7A 1DF0A 5LASA 3U07A 4D3WA 5JPMB 2XPJA 1GQPA 1ZZBA 5T5PA 4FBFA 3RMXA 1F8VA 2JDNA 4FP3A 4XCAA 4PBPA 3MBWA 1GKBA 1L7LA 3F95A 2FQPA 1OA3A 3LGRA 3V56A 2ZEZA 2D6PA 2IFWA 2RR13 1ULCA 2WNUA 1RMU2 2W95A 3H7YA 4DIQA 5KWRA 4QHBA 1RUJ2 4J25A 5DXDA 3SCHA 3VBSA 3J8F1 1BBT3 5GLZA 1UMIA 4U2AA 2VD7A 1M4WA 1H1MA 4DINB 2FZ2A 4NVPA 1SACA 5IFPA 3EXUA 4KQ7A 4ARXA 3B94A 2WINB 3GHNA 1VRH1 1V00A 2E7AA 2W68A 2JENA 2ZGUA 3M3IA 4R9AA 3RI8A 3WHTA 1JZ7A 5F7UA 1N3PA 4MYEA 3VBHA 3SKVA 1QQP3 3C7EA 5FZCA 2CGPA 2K46A 4Y24A 3SNMA 4C1XA 5CFCC 1RUNA 1Y3TA 4Q4W3 3VBRA 1NT0A 2ADDA 2CDOA 2ZGMA 2IXIA 5FP3A 1I5PA 1ULGA 2Y6LA 3WG1A 3ZYFA 1NE4A 1VMFA 5FZOA 3WF3A 1NCRA 4OI0A 1LESA 1CVNA 1AJOA 3UL2A 3I2GA 4IV1A 1DQ6A 1XSRA 2HWF3 1RVF2 1AYM2 4YM2A 1Y7BA 3ZN4A 4AFBA 1LOAA 5FYIA 4FFGA 1W28A 1FATA 1YHFA 2YU1A 2JJ6A 1OPMA 3OPTA 1FYUA 1RUD3 3I54A 3ZYIB 4H3WA 3EBRA 4P00B 3NQHA 4M3CB 4JKMA 3VBOA 3VL9A 2WZR1 1KITA 2YFUA 3E97A 2QQLA 1AR92 5JSRA 1ULPA 2YDEA 3Q8FA 1VMHA 4D6RA 3IIIA 1GUIA 4DQAA 5JAXA 3AXEA 4QPIB 5F5AA 3IIAA 4S2FA 3H8UA 1HKDA 4Q4X2 3WUDA 4Y5SA 3T30A 4DOUA 2R30A 4XYXA 5FMDA 3MIDA 1QOOA 3WP6A 1XNAA 4LEJA 4DZGA 2ZX2A 3R0RA 2QQIA 1VBA1 2VCAA 3AM2A 1S0JA 1DG6A 2NMNA 4LUKA 2VNGA 3WY6A 3WQ1A 1H2MA 1MS1A 4QDQA 2FDKA 1HV1A 2WNVC 1GP6A 4QX1A 1LKNA 3URFA 4AVSA 3OY8B 5ABJA 2D44A 2B42B 4E27A 2ET7A 3H3LA 3ES4A 3MLLA 4PDWB 1X8EA 1NLSA 4JGZC 1FAYA 3ACHA 1BZWA 1O8SA 4XJAA 3U75A 3OGRA 5DZGA 4FO9A 4FP2A 4V1PA 3AFGA 4Q0PA 3WF2A 5JI9A 1LJ7A 4Q1RA 2WYFA 4XJ8A 3VHRA 3ZFFA 2D6LX 1SFYA 2YYOA 4DUVA 1ONAA 3LQCA 3BIEA 2IVJA 5DN2A 5K7PA 2ZEYA 2FDFA 1YRZA 4R4ZA 2NN8A 2VNRA 2R0FA 4OUEA 5FZHA 2V4VA 3VZLA 1F5FA 4MH0E 1XNTA 1QJY3 4LBMA 3PUHA 1NYWA 5FZIA 1GOHA 2QJVA 1QJU3 4PIYA 3LA3A 3I8TA 4IEYA 4KGQA 4P9XA 1ZX5A 1U5IA 2VTFA 4O65A 5BV6A 5KHHA 3UT0A 4FFHA 5FZAA 3U0ZA 4FAHA 4ITCA 2JKBA 4FCAA 3ZMOA 3MUY1 1E57A 2RM22 4AHZA 5APAA 4XQWA 1JZ5A 1CN1A 2RS13 3C7GA 1W6QA 2FCUA 1VB2A 4COYA 4RGAA 4UFHA 1VRH3 2VMCA 5A1AA 2CAUA 1BVVA 4Q29A 4CUAA 1XXNA 2XG3A 1RUF3 1WLCA 3JXSA 3AYDA 4PLOA 3VBUA 4ES8A 5CYYA 2WWUA 1KEXA 3ACFA 2DBNA 4K6BA 3GZUC 5DMYA 4ASLA 1W6PB 1AR81 2W1WA 1ND2B 4GD4A 4LBQB 1DYKA 4DY5A 4Q26A 4QHOA 3ZFEB 4IE6A 3ECQA 4QXKA 2W1UA 1UOBA 4LO5B 1HRV1 1CZTA 3MZHA 4JQTA 4W6XA 1IS6A 1U5ZA 2VVDA 3RS6A 3WNNA 4AR2A 1XJAA 1OA4A 4Q8LA 1IPJA 5C3SA 1ACCA 3VD7A 1Y43B 4YW6A 1DQ5A 1IKQA 2WN3A 4SLIA 4XTMA 3JB8A 1ENSA 4CEYA 3RYKA 2VZ1A 2IWGB 3IT8A 4CDQB 3A4UA 5BNOB 3N9NA 4YARA 3HT2A 5FZ8A 3V65A 2C26A 1VIWB 4AI1A 1IS4A 4LA2A 4OCTA 1R1A2 5T5LA 1YJLA 2BWAA 1RJ7A 3DEMA 4HPKB 5HV0A 3U10A 1NKGA 2O14A 1SLLA 2R061 3SISA 2HYXA 4PQ9A 1R092 3UJQA 3WNXA 1VAVA 1XB9A 3A7QA 2RMU2 1F35A 3O1RA 5L19A 1Q8SA 2XVLA 4UWDA 3FUOA 1UOFA 2BVBA 2Q5TA 5FYCA 1PK6B 1PO22 1Q8QA 4K1ZA 4L2NA 4PI0A 4BQ3A 2J1AA 4QD2A 5FLIA 5SV8A 3LPFA 5FDBA 4QPIC 2UY9A 2DCTA 5A6XA 1D0HA 5A32B 2OQ6A 1G9AA 1NZIA 3ACGA 2JIGA 3I3EA 1TG7A 5EZWA 3WV6A 1S0FA 3KHCA 1RMU3 4UW5A 5AFBA 4Z2AA 1RUJ3 3ACLA 3WF4A 4BE3A 4MOAA 4Y5Z0 2XQRA 5BYNA 1JU3A 1KDKA 3FN9A 5DDJ1 2LROA 3LD8A 2PYTA 4NRMA 3RNSA 3RRDA 4LE4A 4N53A 5LY2A 5BXXA 3I2OA 2YC2A 4LORA 3IWZA 4GB31 5AC91 3HWJA 1LULA 3PLQA 2EA7A 4PDWC 4YGBA 3ZXAC 1O8PA 1YYNA 4Q4V2 5LBEA 4RS5B 1OOPA 1SEFA 4EN9B 3JD71 1UU5A 2DBIA 2JG8A 2VULA 3MYXA 4NAMA 1GICA 5JIAA 3RG0A 5L73A 4DPNA 1X9PA 3S5QA 1C28A 1XE7A 3T09A 3VL8A 4LULA 4Y33A 3MIFA 2ZS6B 2JD9A 5FBJA 1DQ2A 3ES1A 5KC5A 3M2MA 1OKQA 1RVF3 5C8CB 4YPJA 1AYM3 4CYDA 1N1YA 3GF6A 2CWSA 5AVPA 1QJX1 3QH7A 1MS9A 5B2GB 2QQVA 2XUMA 4MLOA 4FPYA 1CESA 2UYAA 1W0OA 1V9U1 2RJLA 4BK5A 2W1SA 1K5JA 2VW1A 2ZOEB 3WF1A 1AR93 3K51A 2D6KA 4M4PA 3I2FA 4WV8A 3L2HA 3POBA 1DDLA 3KSCA 1ULOA 2XJTA 1HRI1 3JB4C 1MEC3 1V6NA 4LBOA 4Q4X3 4CDWA 1HV0A 4W4ZA 5LK7B 2W47A 3OUIA 4GALA 4ET7A 1QXJA 4IE0A 4YGDA 5DPNA 3RWKX 2XUEA 1GOGA 1UNBA 3POGA 2QQWA 4YVWA 4TLFA 2ZGKA 5IW0A 3EQEA 4Y5TA 4RFRB 1D4M1 4ISQA 5DG1A 4AFDA 3KCCA 1ND2C 4NIAA 1MVEA 1OH3A 2H6CA 2PHFA 3ZFEC 3T3YA 3TEYA 4L9BA 2AZ5A 3FHIB 3C3VA 3KMHA 3SC7X 4XF1A 4IL7A 2XLGA 5CIRA 4XOGA 2XKPA 3TEWA 3GZAA 5GZEA 1Q5OA 3KV5A 4XZUG 2VG9A 5B4XA 1NE6A 1UIKA 1KDMA 2BGCA 1O59A 1MS3A 5FY9A 3ZXLA 1X9TA 1UU6A 4K20A 3KCYA 1HX6A 3OSDA 4UBGA 5DAWA 5LWBA 3BU0A 1HB4A 1NQDA 4LBKA 2VOTA 2J42A 2VZ3A 4HFSA 3THCA 3M3OA 1O4TA 4RHV3 4QAWA 3TEZA 3HMYA 2O8QA 4CDQC 3W20A 4I0WB 5BNOC 3OGSA 5D8AA 1QF3A 4BJ0A 2JDHA 5CU1A 2K9ZA 2YROA 2VMHA 3OBTA 3GGLA 2VOVA 2RM23 2NYYA 3NNGA 3GCXA 3O1UA 5GLWA 1OQDA 1VBB1 1PM4A 1AR72 2GP5A 3AFKA 1OKOA 2WO3A 3NAPA 4MUVA 5IUQA 3RQ0A 3ZN6B 5IT6A 3G6JB 3HNBM 2BTVC 4YVSA 1X82A 4ARYA 1DIWA 3WVJA 1FOD2 5JSOA 1KJLA 2QKDA 3N35A 4LA3A 1PK6C 4RD7A 2G9ZA 2WNUB 3OPWA 3UGFA 4FI9A 5CG9A 4GWIA 4CCCA 5L9VA 2TBVA 3VBSB 3M3CA 2V5YA 5DAPA 1IZ3A 1XE0A 2ADEA 5EJ1B 4N9IA 4AGRA 4JRAA 1NQJA 4M0NA 1JYIA 3WDTA 1F5JA 3WW4A 1DQ0A 4GA9A 1RB8G 4UT5A 3JCIA 3SKJE 4XDOA 3CL1A 4MXWA 3AZXA 3LKJA 3LZZA 2HWB2 5JSPA 3LFMA 3VBRB 3WOGA 3O0VA 1NY72 1V9U3 2WT1A 1RC6A 3NRUA 5A7NA 1XYNA 3HVDA 2ID4A 4XJZA 4UAPA 5F5CA 1O3QA 3C7FA 4O61A 1NCRB 1UMHA 1YQ2A 2R6QA 4RS5C 4QB6A 4P5YA 5FPZA 3B3QE 1UYZA 2WQZC 4IV1B 3ZR6A 3DPRA 4BH9A 5JCTA 4BDVB 5DAVA 1Q8OA 1ZZ7A 4RGKA 3T4VA 2DTWA 3HBZA 3VZNA 5JVVA 1R1A3 4BXSV 5FJHA 1VRBA 3OF1A 3VBOB 4CUCA 1ZA7A 3MFCA 3KGLA 5BNNA 3ROUA 2P6HA 4JZRA 1XE8A 1R093 3WSOA 1KFXL 3UJOA 3V0BA 3MF6A 1NLRA 3EYPA 1JMUB 3N7LA 3E1F1 2ZGSA 1C8M1 2CNAA 1VBC2 3CU7A 2ZMNA 3A0KA 1LTEA 5E1RA 1PO23 3ELNA 3FFZA 3UESA 4EQVA 1BYHA 2R071 4RYDA 1PGW2 3B5LB 4I09A 4ZPIA 4ZU5A 1DZQA 3UGHA 2OIIA 3VZOA 4AI0A 2TUNA 2DVFA 4IERA 2QQKA 3I59B 1Y4WA 3ON7A 1S4CA 1YQCA 3T08A 1Z7S1 3GBWA 3K2OA 4W6YA 4IEOA 5ABJB 3KV6A 4YFWA 5FV3A 3N9MA 5FLJA 5FQ0A 2ZHKA 1UD1A 3LPGA 1DQ1A 3NV3A 4IGQA 4V2VA 5IVFA 4IXLA 2BEOA 3FBMA 2XJVA 4INDA 4ZS2A 4KU7A 1WUVA 5CKQA 3WZ1A 4ZU7A 5M0TA 5JLVA 1TME2 2WO7A 1WD3A 3NV2A 1OF3A 4H2AA 5FP7A 3ZFFB 3ZIXA 1U0AA 1S0EA 4MO3M 4Q4V3 2YPJA 5FZLA 4GMP3 4CCJA 3JQWA 1DYOA 1AL23 1LOCA 4NHXA 4YSFA 1PZ9A 3I4IA 3KT7A 1LRHA 2A3WA 4DFSA 4QPYA 1KS5A 2YG0A 5FYUA 4QU2A 4NE9A 4YG3A 4NPLA 2ARXA 1M06G 3DKWA 5EHDA 1O91A 4B1MA 1LHNA 1I3HA 4M3CE 5FCCA 2ZABA 4U36A 1CIYA 2ZGLA 1DGRN 3I3QA 1FPN1 2XMLA 1XBFA 3MV01 4QPGA 4BCUA 5L36A 2P2KA 1S2BA 3VV1A 1P8JA 4AQTA 1O7FA 2VZSA 4MGTA 2VGDA 4B4QA 1W6QB 4GWJA 3IAPA 4CCDA 1PVC2 2YC4A 2FDGA 1YFUA 1N3QA 1PNFA 1RHI1 3IMMA 3MEPA 4CU7A 2W39A 2YBSA 4HN0A 4XABA 5J3UA 5DUUA 1L3JA 2CHHA 3CKHA 4ZS3A 5SV5A 3VBUB 3K46A 5A3MA 4XFGA 1BK0A 1DHKB 1QKQA 5FY4A 1A8DA 3BU7A 3MIBA 1WZXA 2E53A 3JQXA 4J1WA 5FUIA 2JDUA 3ETPA 4XFCA 3VHOA 2GMPA 2Q0AA 3ZFGA 3DL3A 2WNUC 3BPSA 3GZEA 2VVFA 3E5UA 1G9BA 2WNOA 1ZRCA 2HWD1 2PLV2 2A73B 1W9FA 4W6WA 3VBSC 3NNMA 4AI9A 3H8XA 5I0TA 4D69A 5FKBA 2P1BA 3I97A 4ASKA 1C5IA 3P1IA 4LBQD 2UY8A 4LXLA 2WAOA 3WXPA 4Z8BA 2FDIA 2HEWF 1FMD2 4EJRA 1ZBE2 4Y1XA 5EQUA 5D1IA 5GM0A 4RSUA 4WBBA 2BJSA 3ZYJB 1F2NA 1DZTA 1YWKA 2YXSA 5LK5A 3X29B 3BOPA 3B69A 3VBHC 1POQA 4CEYB 3AP5A 3POYA 1LU1A 2B46X 3VBRC 2XJQA 1XPWA 1OFNA 3M4FA 4OYUA 1AL0G 2D97A 5I93A 2BZDA 1WW5A 1C4RA 4E8DA 4QX5A 2GNDA 5C70A 3PVNA 1U5XA 1NCRC 2R073 4HSJA 4COVA 2BYVE 4XC9A 3M8LA 2ERFA 4C8DA 4FSJA 4IV1C 4AFMA 2H0BA 1PGL1 2DF7A 2NM1A 1JYTA 1T2XA 4FAGA 1DBNA 3Q9OA 1Z7S3 5FYMA 4JDMA 3V0AA 5FXWA 2HKXA 3KWVA 1TMF2 4EN8B 2HYKA 1WCUA 2D40A 4N43A 3VBOC 1SDWA 1V0AA 3N7JA 3SEPA 5C71A 4OI2A 2NZ9A 4BM8A 2BU9A 5D2AA 1AR73 1OD3A 3KQ4B 1A3KA 5I0DA 2RR11 1UYXA 1OC1A 5I8SA 3VKMA 2AENA 1SBDA 5C5UA 1AXKA 1FOD3 1BBT1 2F6BA 3ORJA 2Q30A 3PNAA 3T0DA 1SLBA 4QMAA 1EV12 3H42B 4IGOA 4LOTA 1RYYA 4DNYA 1QNWA 3H1YA 1X33A 1GP5A 2QUOA 1FV2A 3LA2A 4ZXKA 1LHUA 4H55A 2WDBA 4BWOA 5HPOA 4QXCA 3H7JA 2YC0A 3MO4A 1QQP1 4HVQA 4GJYA 2DURA 5ABJC 4N53B 2A6WA 4Q4W1 4CP0A 4W65A 2WWSA 4XEZA 1YLLA 2GN3A 3NJZA 5E88A 1OOPB 1PO12 5J1XA 2WSVA 1C57A 1UKGA 2HWB3 2JG8B 3N9OA 3PIJA 1CIWA 5K4LA 3ATGA 2HWF1 2BERA 2ZEWA 1G9DA 1KJRA 1UW8A 4D0QA 4XFIA 1W90A 3ZFFC 2VNVA 2ZGNA 1RUD1 4E4SA 4UW4A 4AQ2A 4BQ1A 1NCQA 2PHRA 5FZ0A 4IEPA 4GMP0 2NQYA 2RV9A 5IYYA 2FD8A 3OD4A 4FXKB 2ZGRA 4OZOA 4PT6A 3OYWA 3POWA 1K5MA 4C0HA 4LHSA 2DFBA 3PUAA 2DVGA 2XJPA 1JUIA 2WBKA 3RJRA 4I02A 1MS8A 1SLIA 1UPSA 4IV3A 3OEBA 4I2OA 1DGLA 5IAXA 2PHTA 4QX0A 4R8HA 3PMEA 4TN7A 4XFBA 1AVBA 2WFF2 2CU5A 3W9AA 3WDWA 2F17A 2V4AA 1SG3A 5L9RA 3ASIA 3LEIA 3VGIA 1VBC3 4CDWB 2F4PA 4UOJA 5FXZA 4RN5A 3SH4A 3AXDA 1BXHA 4CA9A 3PUIA 1CQ9A 3VBUC 2AH2A 5FZMA 3AZZA 3TYJA 3AKRA 4YVWB 3DUIA 2ARCA 1OT5A 1WA4A 1KRIA 1QH6A 4BB3A 1JZ6A 4DXTA 2Y6JA 5CVRA 4XETA 2VCMA 4AK3A 3N4MA 1FI2A 2RJKA 1J3RA 1OD5A 2VC9A 5DUWA 1JW6A 4HXCA 3HR9A 3A0NA 3K4DA 4P08A 4CCOA 4F3JA 2Z79A 5FOJB 3NNLA 4QU1A 5FO7B 5IVVA 3CEWA 2JEMA 1TME3 3PIGA 4MHRA 1QJY1 4HZFA 1AR62 2BUKA 5F8PA 2DDUA 1QJU1 1QU0A 1LR5A 5AVAA 4EWEA 3QCWA 1VBA2 5LEKA 1QY4A 3H1MA 3P3PA 1J1LA 4R9DA 5A3LA 4WVVA 5I0UA 2B45X 2H0VA 4LIUA 4CEYC 3LEGA 3WG4A 2EXJA 3KM5A 1YJKA 1EUTA 1Z78A 2XVKA 1IPKA 3KS7A 5D8AB 5EP9A 2V72A 1HDKA 4AGGA 2RS11 4MGSA 1C3HA 2J1RA 3NKGA 2E51A 1IOAA 4KH9A 4YZ1A 1CWPA 1R082 3THDA 4KBZA 2JKXA 4UW6A 1RUF1 3AYAA 3DXUA 3PJQA 3NAPB 4A6SA 2RS31 1VBE2 5F1RA 4IEVA 1PVC3 4YZ4A 5T3NA 4BQYA 4YM3A 4YVSB 4Z92B 1S0CA 2QQJA 4XUPA 5HBAA 4AEDA 1N1SA 2I2SA 4LKEA
chains in the Genus database with same CATH topology
5IK8A 4I3GA 5KXBA 1LGNA 1POV3 1V6IA 4IEWA 4BMEA 3RWNA 1H2KA 1YFYA 5FFOC 1ZRRA 1CD3G 4L97A 2BWCA 1QNYA 3B93A 1FT9A 4SBVA 2EVXA 3BCWA 3D8CA 2ZZQA 1BEV2 3MW3A 4XFAA 1YCIA 2R1DA 1PHMA 3L2YA 4BHPA 4B4RA 3FLRA 2TEPA 1V6JA 1ZRDA 1NA1A 3PHMA 1ZREA 4MXWB 5CFDA 1AHSA 2IFRA 1FMD3 4N53C 1ZBE3 3FWEA 2WSUA 4YW5A 3AKTA 1EP0A 4LO6B 1O5LA 1YFWA 2GU9A 1OLRA 4QGLA 1OPOA 1OOPC 4FPLA 2JG8C 1S0BA 3DPRB 4YNIA 1BQPA 1WCSA 2ZMKA 2BNOA 4WM7A 2WA4A 1AF9A 2AUYA 3J26N 2P37A 4KNCA 4COUA 1Z0HA 2BFUS 2WKKA 5BNNB 1RUC2 3IPVA 3E6CC 1SBEA 4YM0A 3AKSA 1TMF3 3V0BB 2MEV2 2VW0A 3GALA 4GXLA 1Q8PA 2XBO2 4RFT0 3AMQA 3SH3A 4Q0SA 3NL1A 4G4FA 5T54A 5JIUA 1EYBA 1RMU1 3AKQA 1RUJ1 1MQTA 4YM1A 2WS92 4CDWC 4Q0VA 2YV8A 3B9IA 4QT6A 5BNPB 1ALYA 4G3YC 3VKOA 4FOVA 1HQWA 2PHWA 4P9LA 4RR3A 1LHOA 4YVWC 5CB7A 1MACA 1VAMA 1CX4A 4P9JA 2BNMA 1YFXA 4F8AA 1Q43A 4YG6A 2JXAA 4A7YA 3AKPA 1LGCA 4GWMA 1DZRA 3O5SA 1PO13 4Q2FA 4TSVA 4QM9A 1O5UA 3TN92 4ATFA 1ZZ9A 2RS33 1DU3D 1RVF1 4EN6B 1AYM1 1UMZA 2EAKA 4AEJA 2X8KA 3ZSJA 4BPZA 1IQAA 2Z69A 4FXGB 2DU0A 3R4SA 4YW4A 5KC6A 2XL7A 3ZSEA 1AR91 2ETEA 1GZWA 5EYYA 3MIGA 5D8AC 5CADA 4WM8A 2AREA 5EWSA 2ATFA 2GNTA 4XJWA 3SCGA 4Q4X1 1MEC1 4YGEA 2SLIA 3WINE 1DFQA 2WFF3 4J1XA 3NAPC 4QM8A 3S7EA 2E6VA 4QGMA 2X53S 4YVSC 3SITA 2B9UA 2XL9A 5DUVA 3AX4A 3KQRA 2VY0A 3FC0A 3JUUA 4GH4A 3ZFGB 4RA0A 5H9RA 3TBDA 4CEWA 1H4GA 2ZTNA 3B02A 3S6PA 4ATEA 2P34A 1POV0 3RYRA 3VN4A 5I8YA 4R4XA 5A33A 3M7AA 2BQPA 1W6MA 2WIIB 4IEUA 1S2KA 4NHLA 2QZ2A 3CJIA 4RHV1 1HW5A 4FPJA 3PVOA 2ZHMA 2XLAA 1EAH2 3AMHA 4L92A 1SBFA 2ZJCA 2O1QA 4OHXA 4XBLA 1G7YA 3MLJA 4P9GA 4Y1YA 4XBNA 4KG8A 1J58A 2PA7A 2ZX4A 4FOQA 3RSJA 2RM21 3DPRC 4KWKA 1JN2P 2CY6A 1AUYA 3WW3A 1YIFA 2VXRA 1XU2A 3JBG2 4FQZA 2Y0IA 3RYPA 4AFCA 2D6MA 2PHXA 3V0AB 3T1MA 3ZYGA 4N43B 5HXVA 2WC2A 2CAVA 4YW3A 1R083 5BNNC 1CAUA 4YLZA 2X5IA 4E2SA 2UWAA 4JVAA 1VALA 2YGMA 3DGTA 2VMGA 2A5ZA 2DU1A 2ZGPA 5ACA2 1ENQA 4D7TA 3OPZA 1ND3A 4AVTA 5FO8B 1GLHA 4QQOA 3WR0A 5BNPC 1X8MA 1BEV3 4XBQA 2HWC2 1D2QA 1HQNA 3CNAA 4FOYA 1I6XA 2QNKA 1QMJA 5JOWA 4Y26A 1CGPA 1YXWA 4B7KA 3ILFA 2Q8OA 5C9AA 4B29A 3OTFA 5K9YA 4IEQA 3LSDA 4AHXA 3MICA 4FOWA 5EFUA 2GAUA 3SH5A 2ARBA 1R1A1 1GYKA 4Q0UA 1WLTA 1LOGA 4Q4Y2 1NCQB 2GC2A 2NLRA 2P17A 3KZ4C 4N7IA 1R091 1GSLA 4I01A 5GKAC 2E63A 1K5MB 3MGUA 1OSGA 1O3TA 4KWLA 1UCXA 4F7ZA 1ULDA 2YUEA 4FPOB 1RUH2 4P9WA 1RUC3 1EPWA 4IV3B 1PO21 1MZFA 1RUG2 1WBFA 2D98A 3NWKA 3U4XA 1JBCA 3BOWA 4MSVA 4CRQA 2I45A 4B4PA 2MEV3 1VBD2 4JTOA 1D0GA 2HWE2 1AYN2 4YW2A 1RIRA 5F9TA 2YMZA 3RZZA 2GMMA 4K21A 5H9SA 3UKVA 1S0GA 2BFUL 2WS93 4K40A 4R9BA 3N7MA 3M1HA 5GZCA 1RUE2 3MF9A 3ZFGC 2VNOA 5C33A 1ZRFA 1GZCA 5CA6A 4OHVA 4Q4V1 3UKNA 4E2GA 4YFZA 4M00A 4GMP1 1CAVA 3GNEA 2WZPP 1C8M2 1AL21 4QQPA 4FTEA 4KU8A 5JPNB 2G9GA 1JXNA 4X6RB 3WG2A 3EHKA 5FMOS 3TN93 2LALA 3IDCB 4JDNA 1Q8VA 2A6YA 2XJUA 3NVCA 4XHXA 1BJQA 4CDUA 2JDZA 3VZJA 4OI4A 5DZFA 5CAZA 2WJSA 5GLTA 5H9PA 4XF0A 4XMAA 2O0OA 1C1LA 4BIOA 5TSWA 1S0DA 5JOYA 3E5QA 2BBVA 3AP6A 3DF0A 3LA7A 3VBHB 1ASJ2 4N43C 3IMNA 2B8MA 4Y22A 1H9WA 3WP4A 4AEDB 4E4DX 2ILMA 4QQ2A 1JH5A 1KS4A 3J4UH 4EWDA 2V09A 2ZGOA 1ZYBA 3SXWA 1WLDA 2A71A 3FLTA 4GWNA 3WDUA 2DCKA 1APNA 1CJPA 4EN0A 4K7JA 4OHYA 2RE9A 2ET1A 3HT1A 3NW4A 2EALA 2DVAA 2A3XA 1NA1B 2IXKA 1PIV2 4BIFA 1NOVA 2A6VA 1F31A 4FPEA 4PLNA 1ZA4A 3R6SA 5CFDB 1NXD1 1GNHA 3VHPA 1DYPA 3AMPA 2XJRA 1LCLA 2RMU3 4XFFA 2CGOA 2DYCA 2CYFA 4D94A 5GLVA 4E4ZA 4A3XA 1XYOA 2R49A 1EAH3 5HCAA 4I30A 3SMHA 2ZA9A 2ZMLA 5C4WA 2ZACA 3B00A 4WM7B 5CG8A 4JTNA 4D7YA 2B39A 1B35A 1PGSA 1NCQC 3INAA 3SCFA 4Z2WA 1W6NA 3S30A 4XMIA 1AR71 2OW4A 3ZPYA 1ENXA 4B7EA 2JD4A 1FNYA 2ZX3A 1K5MC 4FPHA 4Q8KA 1J1TA 1FOD1 1B09A 2D93A 3MPPG 5BUVA 1X36A 4LHLA 3MIHA 4HKOA 4IV3C 4AE2A 4OLLA 4XQDA 2D5HA 2AR6A 1MQTB 2JG9A 4Q27A 3WDXA 2Z5WA 3TWIA 3VDDA 5ACA3 5GALA 2YZ4A 3NSTA 2A7AA 3IDBB 4LO8A 4EV0A 4TWTA 4AGVA 3CJXA 3W58A 2VECA 3KGZA 5E16A 1EY2A 3WCRA 3RDIA 1V6KA 3I7DA 1C1FA 2HWB1 2HWC3 3CF6E 2WQ4A 1NY71 1RITA 3T2TA 3M3EA 2GALA 4LBNA 2ZAHA 2PN5A 4OI1A 3O0XA 4IEZA 1NXMA 4XZPA 4O9EA 2A6XA 1UZYA 3NV1A 4XFHA 4MV2A 2PHLA 3VBFA 2WA3A 1OI6A 4JC1A 1DGRA 2FBEA 4NWVA 4D7SA 4Q4Y3 2ZZJA 3QD6A 4P5HA 4META 2DWRA 2QDRA 1GZWB 1SLAA 1ZNPA 4WM8B 4Q4W2 3ZXEA 5IK5A 4HKWA 1G9CA 3IKWA 1RUH3 3ME2A 2OZJA 1VBC1 4GIQA 5L7OA 3LAGA 3BB6A 3S0MA 1ULEA 4BLIA 2IC1A 1PGW1 1JOJA 1D4VB 1DLLA 1N3OA 1VAKA 4YRDA 5BY5A 4C90A 1ZBA2 1VBD3 1LENA 3APBA 2HWE3 1AYN3 2IXLA 1RUD2 4AEDC 1BMV2 3CO2A 4ONUA 3IN9A 4DB5A 3LSEA 1REEA 4Y1UA 1LOFA 2P3JA 3I2DA 5HCFA 1TEIA 1WMEA 1V6OA 4CEWB 1HXS2 4I3PA 3WDYA 4YZ3A 3FBYA 5I0RA 4IETA 1RUE3 5A33B 5GZDA 1F9KA 3WP5A 3NO8A 1W6MB 1TME1 4PJYA 1UIJA 4FPCA 4R52A 1YO8A 4DRRA 1COV2 4AFAA 1NA1C 3CJIB 2HEYF 1I1EA 5CFDC 3MPBA 3WW2A 4QQHA 1GR3A 2C0ZA 2VUAA 3DN7A 2R042 2P3IA 3MW4A 1QHDA 1RUI2 2DVBA 4FQ4A 2RS52 1XNDA 3O14A 2JE7A 1WBLA 2KA3A 4WVWA 5JZGA 4HK8A 3U11A 2K0GA 4CDXA 5T5JA 4WM7C 1A6CA 4ORFA 2C1FA 4DY3A 2MNGA 1PVC1 4AG4A 3PVBB 5K0UA 1TQ5A 2OVUA 1CAUB 2X5IB 5KXDA 1POV1 1Y9QA 2C5DA 4GQ7A 2ZHNA 5JR7B 2D7FA 1ASJ3 4QGNA 2W08A 4BMBA 3M70A 1WW7A 5C8CA 3AYCA 2RHPA 1WW4A 2WNEA 1O4ZA 1XYPA 1ND3B 3J8F2 2PLV1 2ES3A 4ASMB 1MQTC 3BIWE 4CZSA 1ZZCA 3H1WA 1WCKA 5J36A 5BNQA 3USSA 1CAWA 1MR5A 1VRH2 4HMZA 1FMD1 4DMIA 4RL7A 1ZBE1 3ZXDA 4RR3C 2A75A 3FX3A 3ZO0B 1RUF2 4XILA 2ZGQA 1PIV3 1V70A 2D3PA 5C9AB 2DUQA 4HBNA 4AVBA 1GBGA 1CAXA 1MZ6A 4J6GA 3ENRA 4NHKA 1WGPA 2A70A 4WVZA 2QFEA 3LOBA 2JX9A 4M3CF 1XRUA 1J59A 3VKFC 1SQ4A 1J3QA 4BZ4A 4AEKA 1TMF1 2X29A 2QQPA 1WLWA 2WZR2 3QOPA 3G7DA 2UWBA 1QOSA 1SFNA 5FTTC 4WM8C 1S1AA 4XXPA 4BOWA 3HN1A 4QQLA 3LOIA 4B8EA 1H1AA 4TZDA 1BVP1 3ZDSA 2ZHLA 5JOZA 4YW1A 4AI3A 5J37A 1R1ZA 2D43A 1MS0A 4HN1A 3GZTB 1S55A 4L99A 4YZ2A 3QH6A 1UKRA 3OBRA 4GH4C 2XGXA 1H0BA 2LUWA 2VVEA 4CEWC 3WT3A 1C5HA 3ZN6A 4RQPA 1AXZA 1UF2C 4JQRA 1PO11 1UX6A 3WG3A 1CAVB 4NPRA 3MLKA 4FVVA 2E9QA 2WFPA 3V64A 5LRSA 1VP6A 2PHDA 4XHBA 1JUHA 1RUOA 2Q4SA 4AXOA 1UU4A 2FMYA 4DRVA 3CJIC 5T55A 1T6GC 3R05A 1ZVFA 3ZMNA 5KXCA 3GBFA 4N7UA 3O7OA 1FXZA 1PVXA 4UBHA 1U5YA 3O0WA 3AB0A 1W0PA 2GH8A 4CDUB 2WT0A 4JDOA 4AQSA 1AX0A 1CONA 1PM7A 2PLV3 2GC0A 4WVMA 2ZKLA 3ZIWA 4PLMA 2WFF1 4YGCA 1H8VA 1NG0A 1MVQA 4Y22B 1H30A 1YI9A 2FMDA 2N7GA 2VQ0A 3USUA 1G86A 4K3UA 2X5IC 4PBOA 2UU8A 4AQ6A 1ZBA3 3H3UA 1MZEA 2NMOA 4JRLA 1AR82 4HL0A 2EIGA 3IBMA 1J3PA 1HRV2 1RINA 3CLPA 3FJSA 1ND3C 4A7KA 2B5HA 1HXS3 1BKZA 2GDFA 2R1BA 3D0JA 4AVVA 3UKTA 1ZZ8A 3OGGA 4HKLA 3WCSA 5C8WA 4JGYA 4NOTA 3VLBB 1MEC2 1AR61 1WMFA 1COV3 5FRAA 2ZX0A 2WLQA 3MW2A 1LHWA 3I59A 1JHNA 2TNFA 5C9AC 1U12A 1LEMA 4LT5A 1LOEA 4AHWA 1ULFA 4XDQA 4DXZA 2R043 4EWAA 1RUI3 5C4WB 2RS53 4KGGA 1EV13 3DV8A 4MGIE 3WX5A 3D4KA 1B35B 2R062 5FQ0B 5JI7A 1R081 1W6NB 3S7IA 5KBFA 1SLCA 2NP0A 1RJ8A 1ENRA 2XJSA 4XJUA 2QCSB 1VBE1 3E6BA 3AZVA 2JE9A 2EF6A 2O8OA 4G9SB 5J7MA 4RHV2 1BK1A 2I07B 4C0BA 3ZSLA 5LEJA 4XPVA 2JG9B 2ZAAA 4LBLA 3K48A 1PMIA 2QDNA 4YYOA 3VDDB 4BA6A 1H8TA 4NN0A 1MS5A 1BEV1 4OHWA 5C6CA 1X7NA 4OVEA 3J8F3 5FBZA 1AXYA 4XF4A 1WCDJ 2Z2SB 1Q56A 4QPGB 5DDJ2 5FLHA 5KHJA 4CP2A 1VLNA 2DCYA 4GB32 5AC92 3B01A 1OA2A 2OA2A 2JICA 3FMGA 1GV9A 1N1TA 2WL1A 1OHFA 2UWCA 5CBLA 3ALQA 3RPQA 3WP3A 3JD72 4AI8A 5IK4A 2ZX1A 4LR4A 3PTYA 1OQEA 5GJ6A 4X8PA 1LHVA 1WMDA 3VBFB 2VUJA 2XHKA 4GKYA 2VMIA 4EN7B 5FAXA 2OPKA 2W52A 4JV4A 3OD0A 3GHMA 2ZCWA 2EXKA 5HCBA 3E6DA 1JYCA 1RUC1 2DV9A 1QJX2 2YGLA 4CDUC 3LB9A 1JTZX 3WDVA 1V9U2 2WZR3 4NWWA 2MEV1 3AJZA 4NO4A 2XBO1 5IK7A 5L7OB 1AZDA 3AYEA 1PZ7A 3UK9A 4MGYE 1RL3A 4LNVA 5DUXA 2ZGTA 2VOXA 5F6LB 4K1YA 1HRI2 2KXLA 2WS91 1AR63 2VOKA 4LBJA 1A78A 1VBA3 5J96B 4KG0A 4RGGA 4XTPA 2PAMA 3GBGA 2CWMA 4GKXA 3NV4A 1D4M2 3H9AA 3ZXKA 5GLUA 5CFCA 2R0HA 4Y1VA 4AVCA 3BPZA 4XXAA 2XKOA 2VPVA 1IS5A 3M3QA 4I0AA 4FT8A 2EXIA 4E2QA 1CPMA 4B3NA 2GNMA 1HQLA 1NZCA 1VR3A 2DUPA 3TN91 1VBE3 3ZXFA 5J09A 4PCRA 3WW1A 4LLFA 4HANA 3TAYA 2OZ6A 2LM3A 2DUOA 3ZN5A 2GSYA 4LO7A 1S0IA 4Y20A 5JZGB 2XWJB 1CR7A 5GZGA 1XNCA 3EJKA 2V73A 4CDXB 5C4WC 2CTVA 2WT2A 4R9CA 4YZ5A 4URTA 3JZVA 4KWJA 1B35C 3HQXA 1GQHA 1VBB2 5K0UB 4A7ZA 1AL22 2Z42A 2K2SA 3AP9A 4L11A 4MGKE 2WNVA 2EAAA 2IXHA 2BPA2 2HJIA 5E8AA 4Q1PA 1XQNA 1O4YA 4WZCA 2DVDA 2GMEA 4NR1A 1VB4A 4CP1A 3JU9A 1AR83 4JGZA 2JG9C 2ZKNA 1HIXA 5DG2A 1IS3A 1W6OA 3VDDC 1HRV3 4OUSA 3OYWB 1CAWB 2Y26A 4H7LA 4L8QA 4Y4YA 3VZMA 5I8TA 3ZVXA 2RMU1 2VU9A 2CL2A 4QPGC 3SLIA 1N1VA 1EAH1 3WLUA 1CAXB 3HAGA 1AJKA 2CV6A 3THPA 2XBO3 3VZKA 1OFSA 2FZ1A 1UN1A 3OCPA 4P14A 3ILNA 1QDOA 5AFEA 3VUOA 2BW8A 3BODA 3VBFC 2XH6A 3KCXA 3VHNA 2BVVA 3IDEA 3JBG1 3RI9A 2YY1A 1UL9A 3PJYA 2OUHA 1PNGA 2R063 4COWA 5JMCA 1H9PA 1QJZA 3FZ3A 1G9FA 1PZ8A 4HVRA 1C8NA 4HSLA 2Q1MA 3RJ2X 4BLJA 2SBAA 5I0SA 2OYZA 5EYXA 5KHIA 4Y1ZA 4PIZA 3TNPB 2WLPA 4WZFA 5FOBB 5ACA1 2R072 5L7OC 4S2GA 2GH2A 4S2DA 2LTNA 4P9YA 1KFUL 1KXGA 3LCPA 4Q0QA 4BYYA 1Z7S2 4ISRA 1LGBA 1YUDA 1LECA 2HWC1 1LOFC 5T5OA 3MI8A 3FLPA 4N90A 4OUMA 3ZSKA 4AF9A 5JDBA 4FTBA 5DDJ3 4GULA 4RQPB 3OGJA 3D82A 4GB33 5AC93 2IZWA 5KHKA 4UW3A 2XVGA 1YNAA 4FPGA 3P3NA 4XJ9A 1YIPA 3JD73 1ZM1A 4Q4Y1 3WD5A 2FHRA 3KT1A 4X8NA 1GQGA 3TB0A 4NHMA 3TNQA 3H50A 3O12A 1QGLA 5KXEA 1FV3A 4M3CA 3PVEA 2QZ3A 5JZGC 4E9KA 1FPN2 1RUH1 4XF3A 4N9HA 1QJX3 2E7TA 4WVMB 5EJ3A 1RUG1 1GFF2 3N7KA 2OUJA 4CDXC 4A2UA 3FUQA 2G9FA 4QPIA 3N3HA 1LODA 4FTSA 3D0SA 1A8MA 3FFQA 1DGWA 1G6NA 1VBD1 1RHI2 2D6OX 2Y38A 5JWPA 2HWE1 1AYN1 1EPZA 4MVTA 1OMIA 5K0UC 3USUB 5F6KA 1SLTA 1HRI3 1VJ2A 4HVOA 5K8SA 3AZWA 3WUCA 1O3RA 3THTA 2HEVF 2DFCA 3N36A 3OY8A 3KLSA 4MXVA 1H1IA 1RUE1 5C8CC 4XQ4A 4ES9A 4XIOA 4PDWA 4AEMA 2HWD2 1TNRA 1D4M3 4O9GA 1UAIA 3KT4A 4KL1A 3IPVB 2XB6C 3ST7A 3JBG3 4JGYB 4LHNA 2I74A 1FNZA 1CJDA 1ZZ6A 1KQRA 5HI0A 3NKTA 1QXPA 1H4HA 2IXJA 2GZWA 5FO9B 2AYHA 4IEXA 3B9CA 3ETQA 2D3RA 3D6EA 3T1LA 1D2SA 5BNPA 3ZSMA 1SCSA 1RTVA 2GNBA 2ENRA 1QOTA 5LRRA 3KD4A 2BNNA 1IKPA 3MDPA 4XIKA 3ZXJA 4CTEA 5I91A 1PGL2 1G8WA 4RR3B 2PQQA 4HLTA 3VKNA 1KD7A 4OULA 4AWDA 3WHUA 4M0HA 1Q3EA 1OLQA 3ZYPA 1ASJ1 2R16A 1VBB3 3J9SA 5KHGA 4H14A 4ZU4A 2RR12 4LUMA 4OFGA 3AMMA 5FREA 4AYUA 3MFAA 4AVAA 1H2NA 1XNKA 1BBT2 1W6PA 4JAAA 4LBQA 1LU2A 1ND2A 3ZFEA 2CGNA 1REDA 1H8TB 4UXAA 3C2UA 3B7MA 4AW7A 2JECA 3IM0A 2UURA 1AX1A 3AK0A 5GZFA 5H9QA 3WQ0A 4HK9A 1PIV1 4LHKA 1QQP2 2VW2A 1GANA 3OJBA 3ZX7A 1BCXA 1I9RA 4MX3A 1WW6A 3ZXGA 1SCRA 1OQ1A 4RQPC 1RUG3 1XNBA 1MS4A 4AHYA 4PF5A 5T52A 4CDQA 2HWF2 2D6NA 5BNOA 1LEDA 2GC1A 2YHJA 3R4DB 4X6QB 5DZEA 4M01A 4OHZA 4MZUA 4XW3A 4GH4B 4HPKA 1FX5A 3ILRA 5J98B 2H6BA 3LWCA 2P3KA 2QVSB 5F5QA