3OJBA

Crystal structure of c-terminal domain of human galectin-8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'MPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Crystal structure of C-terminal carbohydrate recognition domain of human galectin-8
rcsb
total genus 30
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ojbA00
2W68A 2DTYA 2NZ9A 4UW4A 5E89A 5GZEA 5H9QA 2CWSA 1QDOA 2DVDA 5EXOA 3MW3A 3AP4A 2LTNA 2D44A 1IOAA 1MVEA 2A6VA 2FMDA 2HYKA 1DQ0A 1AJKA 5KXBA 2A3WA 1G9DA 3WG1A 3RRDA 1AXYA 1FNZA 3HN1A 4H55A 2E53A 4FQZA 1IKQA 3N7MA 3ZXFA 4BMEA 3WG4A 1V6MA 1YRZA 4FOVA 4YW1A 3WDUA 4F83A 4XXPA 3NV4A 2D6PA 4YW2A 1MZ6A 1GZCA 1QNYA 4Q8KA 1N1TA 3W59A 1AXZA 4Q1PA 1KDKA 1Z78A 2PHUA 4XIOA 5FREA 2ZMLA 1DLLA 1DQ1A 3M3QA 4XTPA 4Q27A 4FOWA 2JE9A 3OJBA 1W6QB 5DZEA 1IS4A 3PVEA 4U36A 4YW3A 3VUOA 1V00A 4Y1VA 4XYXA 4M00A 2E7TA 4XMAA 4PBPA 1GANA 3OY8A 3WLUA 5F5QA 2D3RA 2ZHNA 2OUJA 3JUUA 2PHFA 2R16A 1KJRA 1LHVA 2GMMA 2Z42A 3I8TA 2G4IA 3POYA 4LBQD 4UW5A 5DUXA 3V0AB 1JBCA 2P3IA 3WVJA 3LCPA 2DURA 4C1WA 3AYAA 4MYEA 3SISA 2ZGRA 3BOPA 4FOQA 1BKZA 4XJ9A 1N1SA 2CTVA 3MW4A 4XJWA 3L2YA 5DG2A 1W0PA 4Y24A 4P9YA 1GNZA 1V6KA 2ENRA 4YZ3A 1O4YA 2DVBA 1PZ7A 1H9PA 4FOYA 1V6JA 1LHNA 2AH2A 4M3CF 5CA6A 2OW4A 5CB7A 3D4KA 5AVAA 3IM0A 1R1ZA 3ILNA 1SLCA 4TZDA 4YGDA 2A6XA 1GSLA 1N47A 2YMZA 3SH4A 2XG3A 4CTEA 4FPHA 3WG3A 1KQRA 3OGGA 4PCRA 4RA0A 3U4XA 1D2SA 2OVUA 1GV9A 2DU0A 1SLBA 2A3XA 2D3SA 1HKDA 4PBOA 1DBNA 3IKWA 5H9PA 4XJAA 4XXAA 4YFZA 5IT6A 4JC1A 1GICA 4YGEA 1WW4A 1PZ9A 4K1ZA 3INAA 3WDWA 1LEMA 3POWA 2SBAA 2DUOA 1HLCA 5CAZA 3AFKA 2KM2A 4AVSA 4BM8A 1QOTA 1WBLA 3OBTA 1MS1A 2EXKA 2B7YA 2V5YA 1VIWB 2JJ6A 1JHNA 1JUIA 1MS3A 2DVFA 1AX1A 2JECA 3ZYRA 4FPYA 2E51A 2SLIA 1QNWA 3CNAA 3N36A 4Y20B 1UN1A 3UL2A 3V0AA 2VW0A 1A78A 2UURA 5FRAA 2GNDA 4ISRA 4UW3A 2ZHMA 3ZVXA 3VKLA 3TAYA 1MACA 2DVGA 1N3PA 1N3OA 5GZCA 4I30A 2AENA 5IUQA 1IS3A 3OY8B 5JOYA 4M3CA 2A7AA 2D7FA 4Y1ZA 1SLIA 1W6NB 1WW5A 4FPEA 1I1EA 1FX5A 1F9KA 1G7YA 1JXNA 2NM1A 3A0NA 5DZGA 5HCBA 1HQLA 4Y26A 4GXLA 1WBFA 3T1LA 3O0WA 1SLTA 4OZXA 2JDZA 4K20A 3RG0A 5DUUA 3TB0A 1FAYA 1MS0A 2P3JA 3AP9A 3V64A 1UZYA 3PJQA 1Q8QA 2E6VA 3VV1A 1MR5A 1KJLA 1D0HA 1UZZA 3O0VA 3RMXA 4C1XA 1YO8A 3POSA 2D6KA 3AYEA 1OQ1A 2ZMKA 4ITCA 3A4UA 5HCAA 3WNXA 2AYHA 1AVBA 1S0JA 2P2KA 4M01A 1G8WA 1W6OA 4SLIA 3WG2A 1Y7BA 1W6MB 2P37A 2ZGPA 3SNMA 2D43A 2ZABA 2R49A 1WLWA 3SLIA 3USUA 4R9CA 4AGVA 3APBA 4LBOA 5GLZA 2I2SA 3QCWA 3ZYPA 5IK7A 1UPSA 4D69A 2WLQA 1X50A 4TYSA 3M3OA 3T2TA 5T5JA 2DV9A 1FV3A 2EALA 3MEPA 2PHRA 2YROA 2CNAA 2NMOA 2EAKA 3B01A 3AX4A 3OYWB 4Y1XA 3QLQA 1LU1A 1HDKA 4XJZA 2EXHA 1F5FA 4AVVA 1G9AA 3O0XA 4ATFA 1LTEA 1AZDA 3FBYA 1V6IA 4LBJA 3B3QE 5JLVA 4FPFA 2ZGKA 1JN2P 1GYKA 4HL0A 3N7LA 1URXA 4ZXKA 2WSUA 5T5PA 2ZGLA 1FYUA 2AUYA 3B69A 1LOBA 3WDVA 1WD4A 1CPMA 1MZ5A 1N1YA 1MS4A 1DZQA 5GLUA 2PELA 2W08A 5DG1A 1XQNA 2DUQA 4Y22A 1LHWA 3B00A 4FPKA 1ULGA 4RL7A 2LALA 4XHXA 1DQ2A 1W6PA 1G9FA 2DWRA 2CWMA 2W52A 1LCLA 2JKBA 2YY1A 3FLRA 4GKYA 4WVWA 2D3PA 2YXSA 5IK8A 4Y22B 2VU9A 1LGNA 4GA9A 4LBMA 3FUQA 2C5DA 3IMNA 3MPPG 1VAVA 1DIWA 1LOFC 4R9BA 2D6OX 2DU1A 2FHRA 1F31A 4FPJA 2A6ZA 3W58A 2WSVA 3AXEA 1A8DA 2R0FA 1CN1A 4YW4A 3AZVA 4JCKA 2NN8A 1BJQA 1NXD1 1QKQA 2WJSA 1S0GA 2WKKA 4XBNA 3ENRA 1BXHA 2UU8A 4GWMA 4LBQA 5EYXA 4LBQB 2DUPA 3A0KA 4L8QA 4YM0A 2D6MA 1Q8PA 1QOOA 1YI7A 3KQRA 2CL2A 2V73A 1ULDA 2VH9A 2ZACA 3IPVB 1ENQA 4XIKA 1LGBA 5CBLA 1SLAA 2AGSA 3OBRA 1SBDA 4XDQA 1DYPA 4WVVA 4R9DA 2VXRA 4P9WA 3HMYA 5GZDA 1WUVA 4YG0A 3ILFA 1SFYA 4ASMB 4XJ8A 1W6OB 2DYCA 2ZGUA 2P34A 1EPWA 1LOCA 3FLPA 3R05A 5EYYA 5JDBA 1SBEA 1S0EA 3AZYA 4AGGA 1C1FA 2E7QA 2CYFA 2ZHLA 1DHKB 1OKQA 4PQ9A 5E88A 3V65A 1O4ZA 5DUVA 4BQ1A 3WDTA 3LSDA 4AYUA 1I3HA 2GN7A 4FPLA 1AJOA 2NMNA 4YM1A 5IK5A 4GKXA 1CR7A 1VLNA 4WZFA 1GZ9A 1J1TA 2ZBJA 3D6EA 4P14A 1N1VA 1Q8SA 5GLTA 4BLJA 3O5SA 4DFSA 4R9AA 1ULEA 2EXIA 2PHWA 4Y1UA 4XBLA 2D6LX 1TEIA 2ARBA 5JOXA 3NV1A 4M3CE 1CIWA 1MVQA 1W0OA 5H9RA 2DTWA 1UAIA 2P3KA 1H30A 3BODA 4Q2FA 4Q26A 5CNAA 3WCRA 2ZGSA 3IPVA 3N7KA 1ONAA 4BMBA 1DQ5A 3ZSJA 2AR6A 2D6NA 3NWKA 4NOTA 1AF9A 4Y1YA 2ZGTA 2ZGNA 1SBFA 3GALA 3N35A 3B9CA 1B09A 4IQPA 4XZPA 3M3EA 1U0AA 2WT0A 4W65A 4PF5A 5GM0A 5L73A 2WT1A 3N3HA 1LOEA 3ZSLA 4DRVA 3ZXKA 2GALA 1W6QA 3VKOA 1RINA 4FPCA 3DUIA 4DQAA 4YG6A 1LEDA 2ZA9A 2W39A 2WNEA 2XB6C 1ENRA 2RHPA 1QDCA 1BZWA 2GMPA 5T55A 1WLCA 3N7JA 1LOFA 2PHXA 1H9WA 3R4SA 1QF3A 4YGBA 1DQ6A 1ZM1A 1KDMA 2VW2A 4AGRA 1GBGA 1ULCA 2EIGA 3LSEA 2NP0A 4XBQA 1V6NA 2GN3A 1Q8VA 2ERFA 1C57A 5F9TA 1DGLA 4LBKA 1IS5A 3PVOA 1W6PB 2A6YA 4XE9A 1W6MA 4YW5A 1CONA 4FP2A 2YZ4A 3RS6A 1JOJA 2A3YA 5T5OA 2A5ZA 3JU9A 4ISQA 5GLVA 5T50A 3VKFC 4M3CB 3C2UA 1LU2A 1N3QA 5DUWA 3WUDA 3UK9A 5JOZA 1BYHA 4YM3A 5KXEA 3AJZA 2VUAA 4BOWA 1UX6A 1ZA4A 3WDYA 3AZXA 2ZZJA 4XTMA 5BYNA 1QGLA 2A70A 2JE7A 2R1DA 2WT2A 1LULA 1YYNA 4GWNA 4UW6A 1LOAA 2PHTA 1JYIA 2ZKNA 3O12A 1UKGA 1WW7A 2DVAA 3T1MA 5KXDA 3FUOA 1C4RA 1FATA 2UWBA 2NYYA 3OYWA 1VALA 3ZSKA 4AVTA 2AREA 1S0BA 5EWSA 1ULFA 4YM2A 4U2AA 2ARXA 4XILA 3WOGA 1GZWB 5H9SA 1GNHA 2A71A 2GNMA 5GLWA 3ZXEA 3AZWA 1MS8A 4DS0A 3UJOA 1A3KA 3WCSA 1LHUA 1V6LA 5IK4A 4ATEA 5JMCA 1QMJA 5GZFA 1LGCA 4XOGA 5LK5A 1SCRA 4DRRA 1PZ8A 1MS9A 1QOSA 2Q5TA 1AXKA 4HANA 1G86A 3I4IA 1DYKA 3VKMA 1MS5A 4LBLA 4Z8BA 3NV3A 1HQWA 4JRAA 5E8AA 1WLDA 2GDFA 1LHOA 3AP6A 5KXCA 4FPOB 1S0FA 4FVVA 2R0HA 3WV6A 1DFQA 4FQ4A 5T54A 1FNYA 1LESA 2WQZC 1SLLA 4YZ1A 3BIWE 3SITA 3AJYA 4DPNA 2EXJA 5HCFA 3KM5A 1CVNA 5GALA 1WD3A 3RSJA 3V0BB 1VAMA 1Q56A 1S0DA 1IS6A 4FP3A 3AZZA 3AYCA 3PVNA 1CPNA 2ES3A 1YXWA 3AK0A 1CESA 1YIFA 1SCSA 4AWDA 1BQPA 3FFZA 3PMEA 1S0IA 4Q1RA 2VW1A 1W6NA 4ZKTB 1NLSA 1G9BA 4XJUA 5SV8A 1V6OA 4BLIA 4Q8LA 5T52A 3ILRA 3RQ0A 2ZHKA 4P9XA 1QU0A 1S0CA 3UJQA 4CZSA 1ENSA 3Q9OA 3WHUA 3FLTA 2ZGOA 2OUHA 1Q8OA 4Y20A 5GJ6A 3WUCA 3AXDA 3V0BA 3MW2A 4YZ2A 2H0BA 5DXDA 3NV2A 1S1AA 4YLZA 1GZWA 3R4UA 4YFWA 4XMIA 1CQ9A 1LENA 2C9AA 3ZXLA 4K21A 3M1HA 4CRQA 1C1LA 3WDXA 3BTAA 2ZGQA 3M2MA 2VY0A 3IN9A 1LJ7A 1OFSA 1JYCA 1KITA 1Z0HA 3USUB 2ZGMA 3ZSMA 3M3CA 4BPZA 2TEPA 2BQPA 2JD4A 3WZ1A 4YG3A 1LOGA 3ATGA 2R1BA 4XHBA 3SH5A 1LODA 5JVVA 1FV2A 1AX2A 3ZPYA 4NO4A 2ZAAA 1UMZA 3ASIA 2EF6A 1GKBA 2A75A 1JW6A 3AYDA 2GMEA 4KBBA 1KRIA 4LBNA 3AP5A 1WW6A 1DQ4A 2GNTA 1RITA 3GNEA 1G9CA 1GLHA 1IKPA 2GNBA 2CY6A 4YZ5A 1CJPA 5T5LA 4YZ4A 5GZGA 3D5OA 3VKNA 1UL9A 4FPGA 5DZFA 5JOWA 4K1YA 3RMYA 3DGTA 3H0OA 1APNA 1LECA 1WCSA 3AP7A 3ZXJA 1RIRA 4GALA 2UWCA 3SH3A 2A6WA 2UWAA 2ZMNA 3WHTA 1SACA 1AX0A 4YGCA 3OPZA 4WV8A 2YV8A 3HR9A
chains in the Genus database with same CATH superfamily
1VBC2 2NZ9A 1S4CA 3RWNA 3M3IA 5EXOA 3KV4A 1OPOA 3MW3A 1XYPA 1AHSA 1IG3A 1MVEA 1SHWB 1VBC1 2W2IA 3BB6A 2CAUA 2RS32 1RMU2 1QJZA 2W9XA 2YG0A 3PLQA 5FY9A 3RRDA 4H55A 4OI0A 1H6XA 1V70A 2VR4A 4FQZA 3N7MA 4NHXA 1NY72 4BMEA 3OG2A 2D93A 5FKBA 4ZS2A 1O5LA 3CBNA 1VBC3 1COV2 4WM8A 4QX2A 4Q1PA 3ZN6B 3MIDA 3RZJA 1FPN1 4MGZE 5FREA 4DUWA 5F6LB 4N7IA 4RHV1 1ND3C 3M3QA 4Q0VA 4O61A 4Q27A 4FOWA 5FYZA 5ABJB 1X9PA 4COZA 3MV01 1BBT2 2OZ6A 3PVEA 4FO9A 4HVOA 2WO2A 3GZUC 1BVP1 4LA2A 4R4ZA 4Y1VA 4M00A 3A21A 4LO4B 3ZFEA 2R32A 1QQP3 3ZN4A 2ZKLA 3VZKA 5I0DA 1GU3A 1UIKA 1Y4WA 4YVSB 5FP9A 1Y9MA 2VGDA 2G4IA 3ZR6A 1AR81 1DYOA 2BU9A 1NUKA 2P3IA 1ZRIA 4BQ2A 1JZ6A 4URTA 4Q0PA 1YFWA 1W9FA 3O1UA 2Y6HA 5FYYA 5FJKA 4KGQA 2ZGRA 1POV0 1DG6A 3BOPA 4FOQA 4IGPA 5FY8A 4XAEA 4XJWA 2R072 1OI6A 3L2YA 3MYXA 4IERA 4QB6A 5DG2A 1OD3A 4Y24A 3THTA 5FY7A 3UGHA 1DCSA 4G4FA 2ENRA 1GP5A 1VRBA 1XE0A 4ZXEA 4CU7A 1O4YA 2DVBA 2CSGA 2Y6GA 1SPPB 4FOYA 3RNSA 3MIHA 4COVA 1ZRFA 4UWDA 4UFLA 1LHNA 5E1RA 3W9AA 4AFDA 5CB7A 1NZCA 1R1ZA 3K3NA 2JDPA 2ZX4A 1GSLA 1N47A 1UYZA 5FPLA 3BUCA 2AZ5A 3WNOA 2XG3A 1W2UA 1W9SA 2BDRA 2Y6FA 5A7QA 4Q4W3 4LLOA 2AEZA 4CTEA 3VZOA 5A3LA 3OGGA 4RA0A 1JU3A 1UY0A 4YARA 1ND3A 1OUXA 2RM23 1SLBA 4ORFA 3IAPA 4A45A 1DZRA 1NCRC 3RJRA 4RQPB 3LF7A 4NR1A 1QJU2 1OPMA 3I59B 4XXAA 4JGZC 4A3ZA 4YFZA 1GICA 4Y33A 3O1TA 4LKDA 2K46A 3BCWA 3DKQA 4K1ZA 4CUCA 5FBZA 2B9UA 2LROA 2C4XA 4KBZA 3AL6A 1QOTA 2XHNA 3OBTA 4GJYA 3VL8A 4CDWB 1MS1A 2DCYA 2UY9A 1VIWB 4LORA 1PO23 2EIEA 1AX1A 2JECA 4LA3A 3ZYRA 5A3TA 1XB9A 2LS6A 4KU7A 3UL2A 3ZFGC 3V0AA 3POFA 5FRAA 5FYCA 3HQXA 3OEAA 4UW3A 2QQMA 3VKLA 1YIPA 1PGL2 1REDA 3DCQA 4AQ6A 1ZZ6A 2X5IC 4AFAA 4Y1ZA 1XYOA 4HKLA 3I3BA 1W6NB 4FPEA 4QGNA 5FYUA 3WW4A 1I1EA 1W3VA 2QBXA 1G7YA 1ZRRA 1P8JA 2VZ1A 1NAEA 5HV0A 2YBSA 1SG3A 4Y26A 2JG8A 2Y0IA 1AR83 2X5IB 4EYUA 1XBFA 3MIGA 5DAVA 5FZ4A 3T1LA 1RUF2 2WZR1 1SLTA 3JD73 4J1XA 3LA3A 3E6CC 3BTYA 4K40A 5FZ1A 3GDBA 1FAYA 1O3RA 1O6UA 1EAH1 4AEJA 2VOTA 1UZWA 3K4DA 3V64A 1UZYA 5JZGA 2E6VA 2W46A 5A6YA 4C1XA 3O0VA 4QXKA 5D1IA 3VBUC 3POSA 2D6KA 2BWAA 1OQ1A 1UD1A 2ZMKA 1W03A 3AL5A 2WIIB 4ITCA 1AVBA 4INDA 1U5YA 5LA2A 1W6OA 2CGPA 2PLV2 2D43A 2ZABA 1QHDA 2XKPA 2Y33A 1RYYA 3RJ2X 1F15A 4CDUB 3LZZA 4O9GA 4A7YA 4IXLA 2W87A 4D3WA 2XPJA 5DAXA 2R6QA 3WEZA 2DBNA 2O14A 2DV9A 5DABA 1FV3A 1HRV2 5JXHA 2HWF1 1NQDA 1JYXA 2NMOA 2A1XA 5CG9A 1J3RA 5FP7A 5FCCA 3JB8A 1G9AA 2EXHA 1UX7A 3ZO0B 5HBAA 3LD8A 3O0XA 2J7MA 1I5PA 4W4ZA 5JLVA 4JRLA 1GYKA 2W92A 3IAQA 4HL0A 2O8QA 2WSUA 5T5PA 4OVEA 4ARYA 4D8MA 3ZYHA 3ZN5A 2RS33 3OPWA 1CPMA 2YHJA 4D6QA 5C9AB 1WMXA 5C8CA 2GAUA 5JZGB 2BW8A 4FFGA 1AR91 2UYBA 4JGZB 3CJIB 3J8F2 5CU1A 4XDOA 2PELA 2W08A 3VBOB 3ZSEA 4OHYA 4JDMA 2HWD3 1LHWA 2QCSB 4FPKA 2WNVB 1CAWB 1CJDA 1R083 2HWE1 3PU8A 2W52A 2RS53 4DEVA 2VUDA 4Y22B 2VU9A 5CISA 5DN2A 3JBG3 2QNKA 1TNRA 4P9JA 4PIZA 4HETA 1DIWA 1H4HA 4OLLA 4AEMA 1H8VA 3I2OA 2FHRA 4FPJA 5B4NA 3W58A 4CCOA 2R7EB 1Z7S3 3KT4A 2XVKA 2Y26A 5DAQA 1BJQA 1DF0A 2P5BA 4PI2A 1S0GA 2WKKA 2VMHA 3ENRA 4FSJA 2UU8A 4GWMA 2ETEA 4KG8A 2HEWF 4NPMA 4L8QA 3GZAA 2XLFA 3JBG2 4LE3A 4W50A 4BIFA 1ULDA 5K0UB 2ZACA 4PDWB 1C8NA 1OBNA 3SCGA 2NLRA 2WC2A 3HIFA 1PVC2 3I54A 4IGOA 1BEV3 3OPTA 2JDYA 3VHNA 4UXAA 1JODA 1OF4A 2WZ8A 4UFMA 1DYPA 1ZZ7A 2Z4FA 4N43B 4EN0A 1IGOA 5A7OA 2XUEA 3LDBA 4P9WA 3VHRA 2VZPA 5CFDA 4YG0A 1XNAA 5SV5A 4AI9A 5FYBA 2ZGUA 2P34A 3IBMA 2E7AA 3FLPA 3DL3A 4L99A 5FO8B 2XBO3 2VMDA 2E9QA 1D4M1 2HWD1 4Y5Z0 2ZHLA 4PQ9A 4LK7A 4DXRA 3V65A 2PA7A 2J1SA 2W95A 4JX0A 1PHMA 2WO3A 4XUPA 1VLNA 1GZ9A 1J1TA 4P14A 5GLTA 4BLJA 1C5IA 4A41A 1ULEA 2EXIA 5C3QA 3RZMA 1YQ6A 4RFT0 4ZZ8A 2VNRA 4AFBA 1W0OA 2BGPA 2BERA 4LO8A 3P1IA 3VD5A 3I2JA 2WNVA 2P3KA 1E5HA 1RUC3 3EJKA 4Q26A 5CNAA 2FCUA 3EQEA 4TLFA 2J1UA 2BOIA 3WQBA 4DUVA 2AR6A 4H3WA 1AF9A 4Y1YA 3LPFA 2IXCA 3ZIXA 4E8DA 3N35A 4LXLA 3C7GA 1FT9A 2WT0A 4PF5A 5FBJA 4Q4V1 4UFKA 2W3JA 1ZZBA 5GM0A 2WT1A 2FCTA 3BN6A 3N3HA 4NN0A 4NROA 1A6CA 4V2WA 2V5DA 4Y5TA 1W6QA 2VULA 4A3XA 1JZ8A 5G04L 1OLME 2GZWA 3VKOA 1H8TA 4FPCA 3THCA 4GH4A 3DUIA 3O1RA 4YG6A 1LEDA 2C0ZA 3LEGA 4RS5B 2VE1A 3GJAA 5FUIA 4FTSA 2RHPA 1H2MA 2R061 4AR2A 1YQCA 2RE9A 4QKNA 1XNKA 1VAKA 2V4VA 1GZTA 2VL4A 1ODNA 1H9WA 3K2OA 3KCCA 4IEPA 4UAPA 4YGBA 1ZM1A 1KDMA 1POV1 5F3CA 1UKRA 3LSEA 2Y64A 4NE9A 2QZ3A 3KV9A 2VNVA 1Q8VA 4ET7A 1HXS2 5IFPA 1C57A 2VAUA 1DGLA 1OHFA 1IS5A 3NW4A 1W6PB 5F3EA 5C8CC 1UY4A 1CZTA 1W6MA 5LZ6A 3ZFEC 4BK4A 4WVMB 2PAEA 4OQ9A 2IFWA 3JU9A 5FUNA 5GLVA 5T5OA 2WINB 4PDWA 4M3CB 3VKFC 5BNOC 2QDNA 2PQSA 4AF9A 4YM3A 1J83A 5IVEA 2F6BA 4AEDB 5KXEA 3I3QA 5CEHA 3DECA 1UX6A 4P9IA 1ZA4A 4GJZA 4XTMA 5BYNA 4OI4A 1QGLA 2WL1A 5FAXA 2R1DA 5FXVA 4ZHNA 1ENXA 1LULA 3ACIA 4HLTA 1YNAA 4IE6A 1YYNA 4UW6A 2OYZA 4E27A 3MICA 4E4HA 2GSYA 2D98A 2PHTA 3ZKUA 4CP0A 2E33A 1UKGA 5KXDA 3DKWA 1RUE3 1AR63 4S2DA 4CDUC 2UWBA 3CHXA 2AREA 4BJ0A 2F4LA 1F35A 5DQ0A 4IW3A 3DPRB 3ZYJB 2A71A 2B4KA 2DBIA 4WZCA 3BPZA 2ZS6B 4Q4Y1 1QJX2 5FZBA 2FCVA 2JENA 1JZ3A 1W39A 2XJRA 5J96B 5KHIA 5JMCA 1QMJA 3EMRA 3TWIA 3GM8A 1ZZ9A 1E5RA 4KWKA 5D8AC 2RM21 2OPWA 4KWJA 1LB2A 1HB4A 2BYVE 1WA6X 1ZBE1 4JDNA 2QDRA 1MS9A 3J7MA 1PM4A 4K8FA 1G86A 1R091 1DYKA 3VKMA 1MS5A 3K48A 4LBLA 2XJPA 4XW3A 5A3OA 3Q8EA 4XACA 2RJLA 5EFUA 5E8AA 1WLDA 3AP6A 3BU0A 4FPOB 3Q8CA 4FVVA 2XBO2 3ZX7A 4FQ4A 1LESA 4IV1C 1SFNA 2WQZC 1RVF2 4DPNA 1XPWA 2EXJA 4DZGA 2W1WA 3ECQA 3KM5A 4HXCA 4PQQA 5GALA 3KLSA 1NQJA 4HSJA 4COUA 3THPA 4AE2A 1O91A 1KFXL 3RYPA 2ES3A 1ZX5A 1CESA 4KQ7A 1US2A 3FFZA 3LFIA 3PMEA 1S0IA 4QHOA 2VW1A 1VBB2 3KZ4C 3JBG1 3AMMA 1XNCA 2QQLA 2Y8KA 2V4AA 5A33A 3PJYA 2TNFA 4OFGA 4CCMA 2PHLA 5DAPA 1QU0A 4XFAA 1W0NA 2ATFA 1RUI1 2X8KA 1FMD3 2ZEXA 1X33A 1UOGA 2I74A 4LO6B 1OLRA 3FJSA 1GFF2 4Y20A 3VGIA 1SQ4A 4RGAA 4KWLA 2VBPA 5GJ6A 2BVBA 1QXRA 3DN7A 4L92A 3OTFA 1UPIA 4YZ2A 5IVBA 4JKKA 1NZIA 3IDBB 5DXDA 4Q4V2 4CCKA 3NL1A 4M0HA 1GZWA 4GAZA 1IHMA 4UFHA 4AI0A 3Q8FA 1LENA 2B9VA 2WRAA 2XQXA 1ULPA 3M1HA 2Q1FA 1C1LA 3IT8A 3BTAA 5CKNA 4YVSA 4QGLA 2ORZA 1PMHX 4LTAA 5FR3A 3B02A 1LJ7A 2VQAA 3ZYBA 3MUZ1 3MZHA 1BMV2 1KITA 3LAGA 1DU3D 2ZGMA 2ADEA 2TBVA 3ZKYA 3ZSMA 3M3CA 4CPBA 1NCRA 2BQPA 3VBUA 3WZ1A 5C70A 4KL1A 3ATGA 2QZ2A 5LY2A 2BV4A 2PFWA 4UBGA 1RHI3 2OQ6A 1OQEA 3T30A 4BU2A 4MOAA 2MNGA 5F8PA 2E32A 2VZTA 2IVIB 4MXWA 3UETA 1TMF1 4CP9A 3I7DA 2W1QA 3KGZA 4ASKA 4CXWA 4OHWA 3T2QA 3VBSA 1JUHA 4IEOA 1STMA 4HZFA 1G9CA 1GLHA 3ACGA 3HVDA 2HBUA 4CE8A 3TOJA 1W06A 4R8HA 1VR3A 3OUHA 4H7MA 2N7GA 3VKNA 5JOWA 3LEIA 1OD5A 4I0AA 5LBBA 2MEV3 3H0OA 3AP7A 2XR4A 3ZXJA 2XJQA 2B45X 2WNUB 3DEMA 4ZY9A 5EP9A 2QQJA 2UWCA 3EBRA 2A6WA 5C9AC 1EV12 3WHTA 1AX0A 4RQPA 4A6OA 2YV8A 4WM7A 5IATA 3HR9A 5J36A 2DTYA 4BIOA 1NCQC 4YVWC 3A23A 1O3TA 1QDOA 1UWWA 1OURA 3AP4A 2X09A 2D44A 2FMDA 2HYKA 5EZWA 2VVDA 1OQDA 5FZ3A 3HN1A 1ND2C 1IKQA 1YLLA 3ZXFA 2C1FA 3WG4A 4KWUA 1W8UA 1YRZA 2FZ1A 5E16A 2BFUL 1OVPA 3WDUA 5KC5A 4QT6A 2D6PA 2XL7A 4EE2A 1YCIA 1XRUA 1HRI1 2WABA 1AXZA 1OVSA 2PHUA 4XIOA 1E5SA 2RM22 2YBPA 4QD2A 1DQ1A 2VCCA 3ZYFA 2VNGA 1K5MA 2JE9A 3GJBA 4ZS3A 3KT7A 4WBBA 1W9TA 3OJBA 5DZEA 5FZ9A 2WS92 1ND3B 3P5BA 4PLNA 2QQKA 4CCLA 1K5MC 2J1TA 2XDVA 4YW7A 3TEYA 5C8CB 1RL3A 1MQTA 3AKPA 2D3RA 2LRPA 2OUJA 1X36A 5BNOB 5A80A 4BDVB 3WQ0A 2Z42A 4Q29A 1HX6A 3U10A 2XLGA 3S57A 3KMHA 2D5FA 2C24A 4XQWA 4C1WA 3AYAA 5FOJB 4NHLA 4MYEA 3V56A 3SISA 3SCFA 3UKVA 3VHPA 3ZM8A 3R4DB 4XJ9A 1ZYBA 1OLMA 2CTVA 5BNNC 3OGJA 1RUC2 3CU7A 1NX9A 4P9YA 3VBHC 3UV9A 4EWEA 4HVQA 5IJRA 4YZ3A 2HWC2 4QX0A 4AAPA 2ADDA 1XE8A 3H42B 1V6JA 5C9AA 1VBA3 4M3CF 4JTOA 4X6RB 4MG2A 2VCMA 3D4KA 1H4GA 2BUKA 5AVAA 3IM0A 3AVSA 2G9GA 3ILNA 3LGRA 1SLCA 4YGDA 2ZX3A 2VZSA 2YMZA 2VQTA 3VBRB 2QKDA 4CYDA 2VOVA 2XWBB 3KSCA 1KQRA 3GF6A 5FZCA 2IVJA 2R062 1GV9A 2DU0A 4IEQA 1J84A 1HKDA 1BCXA 1W2TA 2DFBA 3PVBB 4XJAA 5IT6A 5JXJA 1GUIA 3NNLA 1I9RA 1B35B 1WW4A 2G9FA 3H9AA 3SMHA 1QWRA 3LEMA 1KD7A 1PZ9A 1VRH2 2QJVA 1J1LA 3WDWA 3POWA 4DO0A 5FZEA 1JMUB 2VO5A 3QD6A 2XBO1 5FYIA 2FD8A 1QQP2 3SQOA 1TNFA 1MS3A 2JDNA 3NO8A 1R092 2HKXA 4C91A 4DNYA 3JZVA 3N36A 2JB4A 2DF7A 5A32A 3IWZA 2VW0A 4N53B 1X82A 4ISRA 1YFUA 2ZHMA 2R30A 3O7OA 5EJ1B 5C6CA 3A7QA 2DVGA 5TSWA 1K42A 3OBZA 5GZCA 2ZX2A 1PM7A 1TMF3 2AENA 4BYYA 5I8TA 2ORXA 3KQ4B 5I8YA 1PGW1 2D7FA 3MO4A 3VLBB 4UBHA 1F9KA 1K5JA 4CEWC 2DFCA 2NM1A 4IV1A 4QX3A 3BIEA 1PGL1 1VBE2 4GXLA 1WBFA 4DB5A 3O0WA 2P6HA 4OZXA 3ZXDA 2XXZA 5DUUA 1UYPA 5FP8A 2PQQA 1H6YA 1R64A 2ZAHA 4BZ4A 3GBWA 1MR5A 4Z92B 5DPNA 1UZZA 2HJIA 3MFCA 1RUE2 1QJU3 5KR7A 1VBD3 3H3ZA 3A4UA 5HCAA 4MXVA 2ZTNA 3TNQA 2AYHA 3MIFA 4L9BA 5FV3A 5FTTC 1W2NA 1IZ3A 3K51A 4HG6B 1Y7BA 1CWPA 2ZGPA 4JHZA 1NE6A 4DXZA 3PTYA 4EWDA 1WLWA 2JWPA 3SLIA 4R9CA 5C4WB 3UKTA 4AGVA 5BNNB 4E4SA 4LBOA 4Y5SA 1NA1A 3ZYPA 3NKGA 3QCWA 2WLQA 3NNMA 4COWA 5T5JA 5FMCA 4RSUA 3MUY1 4PJYA 3S30A 3N9OA 3H7JA 4JHTA 3U0ZA 2CNAA 3WINE 2EAKA 1MZFA 3B01A 3TYJA 4IE7A 4P9GA 4BQWA 4GD4A 1LU1A 1O3SA 5K9YA 2IXKA 1AZDA 1CAVB 1V6IA 1AR93 3FBYA 1VBA2 4QX7A 5F7UA 1CZVA 2VTXA 3LDRA 2GP3A 4NVPA 1URXA 4OZOA 4QM8A 3B69A 3OEBA 4QMAA 4ZU5A 4MV2A 5IVCA 1J3PA 4RGKA 1NCQB 1YJLA 3NJZA 1WKYA 5LCWL 2WR9A 3H50A 3VBUB 1RJ7A 1YWKA 5DG1A 3RGBA 3ME2A 1XQNA 2J1EA 2XOMA 3OUJA 4MGIE 1KS4A 2YPJA 5FPAA 1W6PA 1LCLA 2JKBA 1PGSA 4GKYA 4QX8A 4IGQA 1JYNA 4FXGB 2YXSA 4QQHA 4XFIA 1U12A 4GA9A 1RGSA 3LQCA 2C5DA 4MO3M 5KHKA 5FZ6A 5FZDA 5CG8A 4GH4B 1LOFC 1SMVA 2DU1A 2WS93 1BK0A 5L9RA 1A8DA 1UQXA 2XL9A 2YGLA 5IVVA 3WQ1A 2YGMA 2NQYA 2HWF2 1FPN2 1NCRB 1ZA7A 2RMU3 3CO2A 3I2DA 4ONUA 1COV1 3HEIA 2BRTA 5EYXA 3AMPA 2YBKA 3VL9A 3DYOA 3N9LA 1UU6A 1O59A 1Q8PA 2ZZQA 1W8TA 5LA0A 2JG8C 2WA3A 2VH9A 2X10A 2BBAA 3BYWA 1EAH3 1ENQA 3ZIWA 2VPVA 1LGBA 1T6GC 4MSVA 4BQXA 3H8XA 3VDCA 1ZBA3 4QX5A 5FY1A 1YQ2A 3OBRA 1S2BA 3OBAA 1SBDA 4NWWA 5FLHA 4XDQA 3T2OA 1B35A 2JDHA 5FYSA 1O3QA 4R9DA 2VNOA 5FJHA 2VXRA 2VD7A 3HMYA 1M4WA 1WA4A 2C9KA 4QHBA 3ZXGA 5K4LA 3LOBA 3ILFA 2E26A 1PIV2 3ZPOA 1LAJA 3R05A 5JDBA 1T6BX 1EPWA 3I97A 3J7NA 1SBEA 1ULOA 4AGGA 3NMBA 3RZKA 1C1FA 4O65A 3VBHB 1UMHA 3PNAA 1OKQA 3HNMA 4TWTA 5HXVA 1RUD1 5DUVA 3W5MA 3LSDA 4AYUA 1I3HA 3LFMA 4FFFA 5JR7B 4OHZA 4ES8A 2Q8CA 2NMNA 1CR7A 3AB0A 4RD7A 2ZBJA 3D6EA 4WZFA 3JQXA 2RR11 2VVEA 3DXTA 3POGA 3BVCA 4Y1UA 4XBLA 4CXXA 1TEIA 4N43A 2VMIA 4OUEA 4B4PA 3JD71 3OD4A 5K7PA 3X29B 4B3NA 2HWE2 2WLPA 4LE4A 3J7HA 3WCRA 1YQ8A 3L2HA 1UOBA 1DQ5A 3ZSJA 2FDKA 5FFOC 3WNLA 1NCQA 5BNNA 2XONA 4CDWC 3UYJA 4A7KA 4HFSA 4AHZA 3RZHA 2XWJB 5K0UA 3KB5A 1SZBA 2IZWA 3B9CA 4IQPA 3VB9A 5CFCC 4CDXA 1K3IA 1OA4A 1U0AA 4KG0A 2XVLA 3C3VA 2V09A 3FHAA 2W47A 1U5IA 4AI8A 4WM7B 2W39A 3THDA 3ORJA 3H1MA 1QDCA 2JDMA 1BZWA 3LOIA 3VDDB 1WLCA 3GXUA 2Z79A 4NHKA 4SBVA 1OF3A 3N7JA 3R4SA 2PHXA 3ZLIA 3FMGA 5C5UA 1DQ6A 2JICA 2Y0OA 4AGRA 2NP0A 2OPKA 4XBQA 2ERFA 3PUQA 1COV3 4TSVA 4XFFA 2A73B 1DZTA 4LBKA 4XEZA 5F9TA 5FPXA 3DF0A 3TEWA 1HRV3 1OMIA 1RUG1 2RMU2 2ZXQA 1OC1A 1W9YA 1XSRA 3FHIB 5D8AB 1NG0A 4PLOA 2YZ4A 2WFF2 1JOJA 2ILMA 2Q30A 2A5ZA 3LB9A 3U78A 5L9VA 3ELNA 4Q4W1 1EP0A 1H8TB 5DUWA 3URFA 3UK9A 4BA6A 1MZEA 4BOWA 4TXWA 1YFYA 1XOYA 1YEWA 3VZMA 3RFRA 3M70A 4E9KA 2HWB1 3WNNA 4LIVA 4LKFA 5A1AA 1JTZX 4KGGA 5C3SA 5F32A 4GWNA 4IV3B 4MLOA 1TQ5A 1JYIA 1GQPA 1YJKA 3G6JB 2EIDA 2VCAA 2WFF3 2LW8A 3T1MA 2DVAA 3FC0A 3GZEA 5CKQA 3FUOA 1C4RA 4QHZA 3VD4A 2AC1A 5C4WC 1L3JA 4AVAA 1QJX3 4KU8A 3TBDA 3GBGA 1S0BA 4B4QA 2R073 4IV3C 4U2AA 3T0DA 3WW3A 1WMEA 4GULA 3P6BA 3POIA 1GZWB 2WYFA 5J98B 5KHGA 3ZN6A 2GNMA 4B7KA 3CMGA 5GLWA 1VB2A 3LPGA 3ZXEA 4IE5A 4NMIA 1AR72 4GMP3 4LUKA 4P5HA 2BVVA 3UJOA 1HQNA 1ASJ3 1C5HA 1V6LA 2O0OA 5LBEA 4RR3C 4CDQC 2QUOA 2P6CA 4ATEA 4B1LA 1C3HA 1JHJA 4RHV2 1IG0A 4ASLA 5JI9A 1LGCA 1HB2A 1PZ8A 4K7JA 3D0SA 1QOSA 1PX3A 2PXJA 1W8OA 3OD0A 4Z8BA 4NRQA 1CGPA 4LMFA 3NV3A 1C28A 1HQWA 5IWFA 1UF2C 2RJ2A 1S0FA 3DYMA 5DDJ2 2WBKA 3Q8AA 4WM8B 2W1UA 1UZVA 3AJYA 3POBA 1PO11 5FZ7A 4FAGA 5HCFA 5C3PA 3M4FA 3WT3A 1PO21 4OUSA 3MPBA 4AW7A 1QJY1 3TEZA 2X5IA 1IQDC 2VZOA 4FP3A 4H14A 4KNCA 1NOVA 3AZZA 2B39A 3TEXA 1CPNA 1XYNA 1YXWA 3PIJA 5C71A 5FO9B 1H0BA 5FZGA 1L7LA 1BQPA 5I93A 2HWF3 3N9QA 2VXJA 3D8CA 2XMLA 2ID4A 1AYM1 4AQTA 2OXBA 3F2ZA 1WCUA 3GCXA 4IEWA 2L9LA 3UGGA 4RHV3 4BLIA 3ILRA 4UFIA 4L97A 4P9XA 2QQOA 2FDHA 1LNSA 3KV5A 2GH2A 1S0CA 2FZ2A 1L7RA 3JQWA 2ZX1A 2MEV2 1ENSA 3Q9OA 3WHUA 4NIGA 2ZGOA 3N9MA 3NNJA 2FMYA 4AEKA 1Q8OA 2OT7A 2Q0AA 5FIXA 5FQ0B 3S0MA 1AYN3 3E5XA 1OXCA 4G9SB 3DYPA 2AACA 3WUCA 1VBD2 2JG8B 3MW2A 4QKBA 2KR2A 1OT5A 2H0BA 2W91A 4S2GA 2BWCA 4YLZA 3AKRA 1JYTA 3RDIA 1GP6A 4P00B 5LRSA 3GCWA 1PNFA 1JOPA 5CYYA 4Z2AA 3ZXLA 3T3YA 4CRQA 3WDXA 5ACA1 3TN92 2GU9A 4CEYC 1AR82 2K0GA 1CAXA 5FWJA 3IN9A 4IV1B 1W8WA 3MV11 1OFSA 3H8RA 1Z0HA 4H2AA 5CKMA 5FY4A 5ACA2 4H7LA 4JGYA 5HPOA 2Q1ZB 2TEPA 1TME1 3K4AA 3OF1A 2JD4A 4MHRA 4XHBA 2R1BA 3WW2A 3ON7A 3SH5A 1D7PM 3CIHA 3QACA 4IL7A 4N9IA 5ANQA 1FV2A 3VHOA 3O1OA 2ZAAA 3BKZA 1GKBA 1TE1B 1JW6A 3AYDA 1JYVA 3WF3A 3H8OA 3RYKA 3HOBA 5CADA 3MBWA 3WF0A 4M4RA 1WW6A 4JDOA 1DQ4A 1SPPA 3GNEA 4AHWA 2GNBA 1IKPA 2MEV1 4RFRB 4XF1A 3U14A 3PUHA 4EV0A 3E1F1 1REEA 3H7YA 5JSOA 4O9EA 5ABJC 1ZRCA 2IXHA 4S2HA 4P08A 1BEV2 1UL9A 2X29A 4FPGA 2EVXA 2RV9A 4K1YA 3DGTA 3RMYA 1UOJA 4I02A 2G1MA 1VBE3 4GALA 4BHPA 1A8MA 1NY71 3SHRA 4URAA 2ZMNA 3W21A 2JG9A 2OQ7A 3CJXA 3OPZA 1VB4A 2RS31 4YGCA 4E8CA 4JZRA 4NUBA 5L7OA 2G19A 2W68A 5E89A 5H9QA 1X8EA 2J42A 4BXFA 4QPGA 1PO22 4JKMA 3HNYM 2LTNA 1PO12 3NAPB 2RS13 2YC4A 5KXBA 1DQ0A 1AJKA 4QDRA 2A3WA 5LB6A 1G9DA 3WG1A 3POEA 5LY1A 1NKGA 1RXGA 5F2WA 3OGRA 1V6MA 1GWLA 1CD3G 4FOVA 1QJEA 4YW1A 3NJYA 4XXPA 3NV4A 4YW2A 3VBFB 1GZCA 1QNYA 4GMP0 4Q8KA 1N1TA 4LKEA 3W59A 5A1LA 3RZGA 1KDKA 4XC9A 1Z78A 4CA9A 1UYXA 2ZMLA 5FPUA 1LKNA 3P3PA 3T08A 5A70A 4B8EA 2YFZA 2JKXA 3ES4A 2HBTA 4QPIA 2WNOA 1VRH3 1W6QB 4MHUA 4BQ3A 4YW3A 3J26N 3VUOA 4LQRA 3VBRC 4EN7B 3ITQA 5JOZA 2WQ4A 1V00A 3B7MA 3DXUA 3PIGA 3RYRA 3TRSB 2E7TA 4EQVA 5A3WA 4CDXC 3AVRA 4RQPC 1UYYA 3WLUA 5LWBA 5F5QA 1JH5A 1VPHA 3JUUA 3CZUA 4Z1VA 4QB2A 1VE0A 2PHFA 5C3OA 1ZBA1 3AKTA 4LBQD 1KJRA 4META 3POYA 4QQ2A 5DUXA 3V0AB 5L7OB 2RS51 1IQAA 3ABZA 4UOJA 3TN91 3LCPA 5ANNA 1GOGA 1FOD1 1SDDB 1QQP1 2DURA 5KC6A 4GWJA 5FDBA 3AM2A 4Z07A 2JIGA 2VC9A 3O1MA 4M4PA 3MW4A 3CZJA 4CEYB 3CEWA 1H2KA 1W0PA 4Q4W2 4XVHA 1VBD1 1V6KA 3K77A 1R1A1 3KD4A 4BK5A 4B29A 1PZ7A 1EUUA 1H9PA 4HK9A 2ZEZA 2GC0A 3KGLA 2AH2A 5IHRA 2CGOA 4PI0A 1MQTB 3GYDA 3D82A 4IDZA 5FLIA 4AAXA 4JVAA 2BGOA 2F17A 2GP5A 2FDFA 1WMFA 5BNQA 4HOOA 4FPHA 1AYM2 1XE7A 5CZKA 2DCZA 2EAAA 4P5YA 5C3RA 1POQA 4CEWB 1AYN1 1MQTC 3QBQA 5LEKA 1D2SA 2OVUA 2ARCA 1K5MB 4QXHA 2A3XA 2D3SA 4E4DX 1I6XA 2VMGA 1DBNA 3ZFFA 4DXSA 5H9PA 3QOPA 5FOBB 5A3NA 4JC1A 4YGEA 5FK7A 3KF3A 4MGKE 3RVHA 5AC92 2DUOA 1HLCA 1GOFA 2AEYA 3E97A 2ET1A 2KM2A 5FZMA 5CFCB 4BM8A 4DY3A 5DDJ1 1WBLA 3I2GA 4WVZA 1PNGA 2EXKA 1QY4A 2B7YA 3E5UA 4DIQA 4N7UA 4CEWA 3W5NA 1JHNA 4WM8C 4FPYA 2E51A 3U1XA 2SLIA 3KT1A 3CNAA 4K8RB 1UN1A 1NXMA 4E2QA 4QWNA 2WWJA 1UXXX 4WM7C 5FY0A 4AVBA 1OKOA 4DY5A 1VBE1 3ZVXA 1D0GA 3TAYA 2CAVA 1RUH2 1N3PA 1RUF3 1AYM3 3IDCB 3JD72 4AEDA 4I30A 5A7WA 4OYUA 2QQPA 1IS3A 5FZOB 1HJGA 1FXZA 3ZYIB 4M3CA 3MDPA 2A7AA 3MF6A 4N53A 4DMIA 3WNPA 1AR71 4LEJA 1H1IA 1SLIA 4AHYA 4JAAA 1FX5A 4FBFA 5IYYA 3NNFA 1OH3A 5DZGA 2WNUC 3USSA 5APAA 5FO7B 5HCBA 1HQLA 3HNBM 3I2FA 3LIGA 4C0BA 5AFBA 2Y38A 1UZ0A 1GQGA 3B9IA 1XU2A 3PDQA 4I0WB 1AL21 4PLMA 4NIAA 2FQPA 3NNGA 2JDZA 1C8M2 4K20A 1GQHA 4QGMA 1KS5A 5E6HA 5L9BA 3RG0A 4LLFA 3AP9A 2P3JA 2W1SA 3C7FA 4Q4X1 1NA1C 2R063 2B46X 2G9ZA 5IW0A 4CCJA 2PAKA 1TME3 1KJLA 3PL0A 4I01A 1YO8A 4J6GA 4CUAA 3MIBA 4QQPA 5JSRA 1CX4A 3FWEA 1S0JA 1VRH1 3OSDA 3OB8A 5JWPA 4I2OA 2BBVA 1G8WA 4SLIA 1FMD2 1W6MB 2WFF1 5FZ0A 2HEYF 3O1VA 4QPIB 2QTWB 1RUG2 3BI3A 2R49A 5B2GB 1HV0A 1KXGA 4HMZA 4A2UA 5BUVA 5GLZA 2DCJA 1UPSA 4XETA 5A7NA 1JYWA 1X50A 4XQ4A 4ZU4A 3VN4A 2O8OA 1AR62 3VD7A 4EZ4A 2GH8A 2EALA 2Q8OA 2XQRA 4BWOA 3MEPA 2HH9A 1Q5OA 2PHRA 2YROA 2VCBA 2XJSA 4W6YA 5D2AA 4IV3A 3N4MA 2BJSA 3KWVA 3QLQA 4XJZA 3WX5A 5M0TA 1Y43B 5FKCA 3SC7X 4ATFA 1LTEA 2VQ0A 3CF6E 1TMF2 3B3QE 4CU6A 3ZFGA 5IAVA 2HWB3 1JN2P 2HLEA 2I07B 4QPGB 4ZXKA 4BE3A 1MEC1 4K3UA 1FI2A 2I45A 1FYUA 2AUYA 3ST7A 4N8MA 2Z69A 5L19A 4LHSA 1LOBA 4QKFA 2CGNA 5EQUA 3H3LA 4I0BA 1HB3A 2JDUA 5EHDA 2VZVA 3W20A 3BTXA 1DZQA 5GLUA 3VZNA 4D94A 5FLJA 1WZXA 4A7ZA 1RJ8A 1WCDJ 1EY2A 5KBFA 3HWJA 1X9TA 1ND2B 4XHXA 1DQ2A 3T0BA 1G9FA 3BTZA 5J3UA 2FBEA 2VMCA 2YY1A 3FLRA 1GP4A 5EV7A 1V9U3 5C8WA 2D3PA 5JPMB 1WCQA 1EYBA 2QQVA 3FUQA 2YC2A 3RWKX 1TZOA 1VAVA 2RR12 1I5ZA 2VECA 3MPPG 1VBA1 4FXKB 4IUGA 3BPSA 4K9SA 2D6OX 4NAMA 1F31A 1RUH3 2A6ZA 4IEYA 3MFAA 4L11A 2WSVA 3AXEA 2VQUA 4O7XA 2DCKA 4LT5A 3R6SA 1KGYA 4PIXA 4C0HA 1F4HA 1NXD1 1QKQA 2WJSA 4AZZA 4GH4C 1QH6A 4LBQA 1X8MA 1HRI2 2Y6JA 4LBQB 2DUPA 1OSGA 4D6SA 3EXUA 5LBFA 4CDXB 3ZMNA 3EHKA 1QOOA 2E31A 1YI7A 1Z7S1 3KQRA 4QU2A 1VBB1 1PIV1 4FCAA 4L2NA 1RUNA 2E63A 2RS11 4GIQA 3RI8A 4CUBA 5F37A 1HN1A 1OOPB 4WVMA 5BNPC 5CBLA 1NE4A 1SFPA 2AGSA 2BNOA 2WDBA 1NA1B 1PIV3 4X6QB 3ZFFB 5BNPB 5FQ0A 4LO5B 2DDUA 3VDBA 1WUVA 1DGWX 5DAWA 3WF2A 1SFYA 1V9U1 1DLCA 4ASMB 1WMDA 5EYYA 1J3QA 3BOWA 1US3A 3U37A 1WWYA 3UT0A 4CU9A 3VBOA 3AZYA 4LPLA 4HK8A 4C90A 5C33A 1DHKB 4QPIC 3IDEA 2VG9A 4P02B 3AFGA 4BQ1A 5LASA 3LE0A 2D97A 4CCCA 2GN7A 2QQWA 4FPLA 5F5CA 4A42A 2PLV3 5CFDC 5IVJA 2PTMA 4GKXA 5IK5A 2HWC3 4XUQA 1OLQA 5A32B 4AQSA 4DFSA 1N1VA 1Q8SA 4IEZA 1MPXA 2BNMA 3O5SA 4NPLA 3SKVA 4R9AA 5F6KA 3T0AA 4D6RA 4FTEA 1W9WA 1VMFA 3RZLA 1GOHA 3I2IA 2MHFA 1RUJ1 1AR73 4HN1A 2DTWA 4HN0A 5FZ8A 1UAIA 1ND2A 3BODA 1UO9A 3EYPA 2JD9A 5HXMA 4MZUA 1W8FA 3Q8BA 2BNNA 2ZGSA 4QX1A 3IPVA 4AL9A 1IPSA 1CAUA 5FYHA 1BMV1 2Z2SB 1DGRA 2QQUA 4QPGC 3LDKA 4BMBA 1ZVFA 3VZJA 4BQ4A 4XURA 4B1MA 2YB7A 4E2SA 3NWKA 4NOTA 4YW6A 2OX0A 2ZGTA 1S2EA 2ZGNA 1SBFA 3KVBA 1PVXA 1RUI3 3GALA 3U07A 2JG9C 4D7YA 1B09A 1EUTA 4GZ9A 3M3EA 2P1BA 4W65A 3ZSLA 1LOEA 4DRVA 1VBB3 3PTRB 1XJAA 2GALA 1HXS3 2BTVC 2PMWB 3I2KA 3WNMA 2VTFA 3KCXA 2ZA9A 1FPN3 2WNEA 1ENRA 5K8SA 2NPIA 5T55A 1RUI2 4XF0A 1HXS1 1R082 1ZBE3 1CAUB 4MGYE 4A6SA 1LOFA 4AFMA 1QF3A 3VD9A 4UFJA 3T09A 3VBFA 1ULCA 2VBBA 2VJXA 1V6NA 2GN3A 3HAGA 3IIAA 3FZ3A 3KS7A 4XUTA 5JMOA 5FPZA 2VUJA 3PVOA 2IXJA 4Z82A 5A6ZA 2A6YA 4XE9A 2VOKA 2IC1A 4FP2A 1PO13 3E6DA 5F3IA 4YW5A 3RS6A 2HWC1 4ISQA 2X05A 3WY6A 3VBOC 2WWUA 1NT0A 2ZX0A 2FDIA 2JB8A 3HJRA 1F4AA 1ZZCA 2IXIA 2J1VA 2X53S 1RUG3 5FPVA 1RVF1 2TUNA 1W90A 3HQUA 4PIYA 3WDYA 1RUE1 1CAVA 1JI6A 5JAXA 2B8MA 2JE7A 4LNVA 4Y4YA 1QJFA 2WT2A 5LA9A 2VZRA 3IB3A 1UU5A 2Q4SA 4RR3A 4CDQA 4XF4A 1LOAA 4C8DA 3OUIA 2CDOA 4NIDA 5A7SA 4XFBA 1WW7A 1QH7A 1OUSA 5FZLA 1QEXA 4XF9A 3TN93 1REFA 3J4UH 2NYYA 3OYWA 4AVTA 1ASJ1 5IVFA 5EWSA 1KEXA 2ARXA 3WOGA 3WQ7A 1OOPA 4NRPA 4RS5C 1GNHA 1VMHA 2WS91 4B4RA 2HEVF 3A22A 2RG4A 1MS8A 2WZEA 1PGW2 3AZWA 4M0NA 4DS0A 1A3KA 3TNPB 3WCSA 1ZZ8A 3ZYGA 4Z2WA 2PYTA 1YFXA 2PAMA 5IK4A 3CKHA 1K12A 4F8AA 3NVCA 5HV4A 5JIUA 2BP6A 4L0PA 3VBSC 4TTGA 4XOGA 5LK5A 1XXNA 4XAAA 2QQNA 2Q5TA 1AXKA 4HANA 5F3GA 3I4IA 4DUXA 1G6NA 4IEXA 4HONA 1V9U2 4JRAA 3IMMA 2GDFA 1LHOA 5T3NA 5KXCA 1XU1A 3WV6A 1TG7A 1DFQA 4EZHA 4LR4A 3ZOIA 4YZ1A 3SITA 2VM9A 3K3OA 4CXYA 3VBFC 4GQ7A 4Q4X3 3V0BB 1VAMA 3WP5A 4LUMA 3PVNA 3WD5A 4NIHA 3AK0A 3N9PA 3WP3A 1PVC1 1SCSA 4D0QA 2RS12 3HN3A 1NLSA 1Z7S2 4FT8A 1Y9GA 3M7AA 4XJUA 5SV8A 4FTBA 3M8LA 2VTXJ 3U75A 2ZJCA 4XDPA 4YVWA 5T52A 1NLRA 4NRMA 3RQ0A 4EWAA 4GB32 1W28A 3I3EA 3IZOA 4V2VA 5EJ3A 2CDPA 2RDNA 1ZREA 2J22A 4AOCA 3WR0A 2WAOA 1MEC3 4PF1A 3UJQA 1OA2A 2WNUA 2B42B 5FZAA 4Q5OA 3FLTA 5FZFA 4JV4A 3NQHA 4K6BA 2VBDA 1K45A 4EJRA 2YFUA 5FZHA 2W0XA 1RUC1 3NV2A 3R4UA 4YFWA 5EJZB 1J59A 1D4M3 4XMIA 2C9AA 4CDUA 4TN7A 4I3GA 4YSFA 4LIUA 1LRHA 3M2MA 2VY0A 3OGVA 4Q0QA 1QXJA 1JYCA 3K4ZA 3J8F1 3FX3A 4P9LA 3ZFFC 3CLPA 1XC6A 4MX3A 5FMDA 1Q3EA 2WN3A 1RUJ2 2W5FA 4OI2A 5JI7A 2QQIA 1AX2A 2EA7A 2IWGB 3FN9A 3K75B 1UMZA 3ASIA 2JIJA 4BISA 2GMEA 2WN2A 4OUMA 1Q43A 4KBBA 3AP5A 3CDZB 4XUOA 5D8AA 5I0UA 4UF0B 4XF3A 3I3MA 5F2SA 3PUAA 2W94A 4IE4A 4BXSV 5CFDB 3SEPA 5I8SA 5T5LA 4GB31 1D4M2 1QXPA 3AMNA 3UGFA 5J1XA 3EB7A 2VOWA 4XCBA 5IVYA 1WCKA 5DZFA 3WW1A 5LW9A 5KHJA 1APNA 1D4VB 4AEDC 3D3AA 4FAHA 2YC0A 4EN6B 5JXGA 1SDWA 3AMHA 3LA2A 4LHLA 4WV8A 1KRIA 2VUCA 1GNYA 4EN9B 5FZKA 4UW4A 5GZEA 5A1FA 5FZOA 1W2OA 5CVRA 3WSOA 2CWSA 2DVDA 1NLQA 4PDWC 3FBMA 5FK8A 5BNOA 1IOAA 2JG9B 1HB1A 2A6VA 1PK6B 3KF5A 4OULA 1CX1A 1AXYA 1FNZA 1EV11 2E53A 2WNVC 3RPQA 3WF1A 4ARXA 3HT2A 5L36A 5AC93 3WP4A 3IDAA 4CDWA 4YYOA 3KVAA 4F83A 4Q4X2 3DPRC 1MZ6A 1BLZA 1PX4A 3DPRA 1RUF1 3FFQA 4NPRA 2H6CA 3ZDVA 2RDSA 5KWRA 5C7GA 1DLLA 2HWE3 4OHVA 4XTPA 5LK7B 2Y34A 1RUOA 3O1SA 2XUMA 2WO1A 2RJKA 2VZQA 3CL1A 4LHNA 3I59A 4ZONA 1IS4A 4LHKA 4U36A 3OOXA 5J48A 4Y4RA 4NAOA 4QAWA 1DGWA 4XMAA 4XYXA 4PBPA 4YVSC 3RZZA 5F39A 4R52A 1GANA 3OY8A 4XFCA 4AG4A 5LATA 2WZPP 1ASJ2 3NRUA 2ZHNA 5ISLA 5LEJA 3WNKA 1CAXB 2ZPXA 2R16A 1LHVA 1Y9QA 2GMMA 2OS2A 2RDQA 1W8NA 3I8TA 4UW5A 3VBHA 1JBCA 3N9NA 2Q8DA 3WVJA 2GC3A 4LO7A 1AR92 1BHGA 1DP0A 1H1MA 5FP4A 1R1A3 1D2QA 5BXXA 3NAPC 4MGQA 4Q0SA 1X7NA 2C6SA 1BKZA 1N1SA 4QB1A 5FYTA 2Y60A 1CAWA 2P17A 1YI9A 3ES1A 3SCHA 1GNZA 2LUWA 4W6XA 1RMU3 3UESA 3RI9A 4IESA 5CIRA 4AI3A 5CA6A 4W6WA 2YDEA 2OW4A 4QXCA 4EROA 4AI1A 4DEQA 2WZR3 4JGYC 4YWAA 5BY5A 1HRV1 4JTNA 2A6XA 4TZDA 3ZFEB 5FMOL 2HYXA 1UW8A 2BGCA 5IFTA 3VDAA 2UYAA 5JXIA 3WG3A 1R081 4FFHA 1QJY3 4PCRA 3U4XA 3FHQA 5JR2A 3JB4C 1Y3TA 3KV6A 4PBOA 5J09A 4XCAA 1XNDA 3IKWA 1HRI3 2PLV1 3KCYA 1R1A2 1FMD1 5HI0A 2UY8A 5J37A 5A3MA 1W3XA 3T4HB 3INAA 4R4XA 1LEMA 4BH9A 2SBAA 5CAZA 3AFKA 5F5IA 2RDRA 1PVC3 2WWSA 3FL7A 4AVSA 5L7OC 1UOFA 4OCTA 2OA2A 2YU2A 2V5YA 2JJ6A 1H8TC 2DVFA 1JUIA 1EAH2 4GB33 5J7MA 1QNWA 5DMYA 4Y20B 1ZBE2 1A78A 2UURA 2GNDA 1JU4A 1UU4A 4UI9L 1XSQA 3NAPA 1MACA 1RXFA 1IPKA 1N3OA 5BPXA 4DOUA 5IUQA 3JXSA 5AVPA 3OY8B 5JOYA 1W8HA 5FPBA 1QJX1 4Q4Y2 1WW5A 4IEUA 4MADA 2Y6LA 4AXOA 1BBT1 5HCHA 1R093 2P3YA 3IIIA 1PMIA 3FE5A 1JXNA 3A0NA 2RR13 1O8SA 1XNBA 4JQTA 4XQDA 3J8F3 2ZEWA 3ZFGB 1DGRN 1W05A 4QPWA 5FYVA 5B4XA 4QPYA 4BB3A 5FMOS 2HWD2 3C7OA 3C8XA 4NHMA 3TB0A 3O1PA 4EN8B 1MS0A 3K46A 3LIHA 3AMQA 4YRDA 2VOXA 3G7DA 5JUVA 3PJQA 1Q8QA 3S7EA 3VV1A 3RMXA 1D0HA 2WO7A 4IETA 4HPKB 3AYEA 2PN5A 4HT1T 4HKOA 3WNXA 2WUHA 2XJUA 2P2KA 4TLGA 3J9SA 2H6BA 3NJVA 3PHMA 4HVRA 4M01A 5LBCA 4N53C 3WG2A 2P37A 2XKOA 4YNIA 3SNMA 2ZOEB 5I0SA 5FXZA 3GBFA 1H2LA 1CZSA 3EO6A 2KXLA 2EICA 3USUA 3APBA 4OMDA 4ES9A 5LA1A 2I2SA 5KHHA 5IK7A 4D69A 4I09A 4TYSA 3T2TA 3M3OA 4XFGA 4D7TA 2BPA2 4F7ZA 3MLKA 2WA4A 4MGTA 4GMP1 4ZPIA 4CSWA 3BU7A 3H8UA 3AX4A 3OYWB 2D5HA 4Y1XA 3SEEA 1HDKA 1F5FA 4AVVA 1U5ZA 2BEOA 5BV6A 4UF0A 2QFEA 4LBJA 4FPFA 2ZGKA 5ACA3 1T2XA 3N7LA 2O1QA 4MXWB 2VVFA 2EIBA 2R071 1BBT3 1JZ5A 2ZGLA 3MF9A 2ZCWA 1DDLA 5FXWA 3WDVA 4BQYA 1WD4A 2JDKA 1MZ5A 1N1YA 5FWEA 1MS4A 4DXTA 3C7EA 3OCPA 4N43C 2JX9A 1YUDA 1RHI1 2DUQA 2P4EA 1CIYA 5GKAC 2OKXA 3WF4A 4Y22A 3B00A 4IE0A 4RL7A 1ULGA 5FP3A 4IEVA 2LALA 4HBNA 1W04A 2DWRA 4CCEA 5JSPA 2CWMA 5IAXA 4WVWA 3PUSA 2K2SA 1VMJA 5IK8A 3S6PA 1LGNA 1MEC2 4E4ZA 4LBMA 2CU5A 3B93A 3MLLA 3IMNA 2VMEA 4CP9B 1H1AA 3WXPA 1RUD3 4JGZA 4R9BA 5I0TA 2PHDA 1VP6A 2R0FA 2YU1A 1CN1A 4YW4A 1RTVA 5K0UC 3AZVA 3KHBA 4JCKA 2NN8A 4XBNA 4AI2A 4N90A 1BXHA 2OZJA 3BALA 2H0VA 4XZUG 2ARAA 4HSLA 2BFUS 1B35C 1VJ2A 3A0KA 3POJA 1AR61 4YM0A 2D6MA 4LOTA 4AFCA 4CP2A 4YVWB 5G05L 1BVVA 2CL2A 2V73A 2B5HA 4QQLA 5EPAA 3IPVB 4LULA 3VZLA 1JZ4A 4XIKA 4NIIA 5ERLA 4ZU7A 1RC6A 1SLAA 4NJ4A 3CQOA 4OQ8A 1JOBA 4UYBA 3BGAA 1W8ZA 4WVVA 1UCXA 4FFIA 3R0RA 1OOPC 4RS5A 2IFRA 3S5QA 3HD8B 5GZDA 3MI8A 4XJ8A 3B5LB 1W6OB 2DYCA 3VDDA 1LOCA 3H1WA 4E2GA 4BQ5A 2Q1MA 5DDJ3 3DV8A 3U4SA 3H1YA 1S0EA 4OMCA 1NYWA 3ZDSA 2E7QA 2CYFA 4A44A 1AL22 3D0JA 4J1WA 3U11A 5E88A 1UMIA 3VDDC 1O4ZA 1YC61 3WDTA 1HIXA 3S5AA 1KFUL 1AJOA 1ACCA 4YM1A 3NKTA 3SH4A 4XABA 2QVSB 2J1AA 1QIQA 4JGYB 3GZTB 3KHCA 2GC2A 1GMMA 1JS9A 2PHWA 3H3UA 3MLJA 2D6LX 2Z5WA 2ARBA 3VD3A 1A34A 3I3DA 5JOXA 2XHKA 3NV1A 1CIWA 1MVQA 1U5XA 1GWKA 4M3CE 1RUH1 5H9RA 5BNPA 3LWCA 3MIEA 1TME2 1H30A 4Q2FA 4XUNA 4LITA 3ACFA 4JKLA 4COYA 3HBKA 2XJTA 3N7KA 1ODMA 2FDJA 3PU3A 4Q4V3 1ONAA 2KD7A 4N9HA 4B7EA 2JDAA 5EIYB 2D6NA 3S7IA 4DINB 2Y6KA 1ST8A 1PMJX 2VZUA 2Q8EA 3MHZA 2J1RA 4XZPA 2XJVA 2XLAA 2KA3A 3QH7A 5AC91 4Q4Y3 5L73A 3ZXKA 3MGUA 3GHNA 1HV1A 1SEFA 1LR5A 1RINA 4MH0E 4QKDA 4RGGA 4AVCA 4DQAA 2FDGA 3QH6A 1AL0G 2RMU1 2V72A 2XB6C 3PUIA 5CFCA 1S2KA 2GMPA 2XVGA 2IUWA 2WAAA 5FXXA 5A6QA 5A3PA 3UNPA 1EPZA 1AUYA 4RYDA 1ZRDA 3WP6A 1HJFA 2VW2A 1GBGA 2EIGA 4QM9A 1EV13 2MPFA 2VMFA 1JZ2A 1J58A 2F4PA 4RR3B 4CDQB 4J25A 2RVAA 5FYMA 1BK1A 4QDSA 1RB8G 3VBSB 4Y3OA 1CONA 2A3YA 5A6XA 2WYSA 2BZDA 5T50A 1QJY2 1UY3A 4CPBD 1YQ5A 1LU2A 1N3QA 3C2UA 3WUDA 4QQOA 1BYHA 3GGLA 3E6BA 3AJZA 2VUAA 4A4AA 1GR3A 3AZXA 2ZZJA 2A70A 2OIIA 2YUEA 4X8PA 1H2NA 4ZZ5A 5C5TA 4LJHA 1ALYA 1FOD2 4RN5A 4OI1A 4UT5A 4YPJA 4W8JA 5JIAA 2ZKNA 1W2AX 3O12A 5F1RA 1C8M1 4G3YC 1ZBA2 4CEYA 2WZR2 3J7LA 5D21A 2R043 1FATA 3AC0A 3ZSKA 1VALA 1L7QA 3E5QA 1ULFA 4YM2A 1UNBA 4XILA 1TVGA 5H9SA 1C8M3 4MGSA 3SKJE 2JEMA 2JXAA 2CHHA 2WFPA 4V1PA 1FOD3 3LKJA 5I91A 1O7FA 3PURA 1LHUA 3HPNA 1YHFA 1UY2A 4NWVA 4CP1A 3B94A 4AK3A 1F2NA 5GZFA 3LA7A 5F5AA 4LKSA 1SCRA 4DRRA 3VBRA 4JQRA 2YPDA 5ABJA 1IPJA 4KMQA 3HT1A 3ETQA 2ZEYA 3ACHA 2R0HA 1GWMA 1JZ7A 2HWB2 5T54A 1WGPA 1FNYA 1OFNA 1RMU1 2QE3A 1SLLA 1WLTA 3BIWE 5JZGC 1CVNA 1WD3A 2JE8A 3RSJA 4CCDA 2IXLA 1O4TA 1Q56A 1IS6A 1S0DA 2XH6A 3GHMA 1QJU1 3AYCA 3T2PA 3I49A 1RVF3 5FMBA 3ZR5A 4KI5M 1YIFA 4AWDA 5I0RA 4X8NA 1F5JA 1POV3 1AYN2 2BOJA 4Q1RA 3PMSA 3ZMOA 4AHXA 1W6NA 4F3JA 4ZKTB 2WQ8A 3P3NA 3ROUA 1G9BA 4KH9A 4PT6A 1V6OA 3ALQA 3UKNA 5A33B 1BEV1 5A3UA 4PHZA 4Q8LA 1OA3A 3NSTA 5A7WB 5LRRA 2ZHKA 2R041 4MUVA 4CZSA 4CVUA 4CCNA 1M06G 1E57A 2OUHA 3OGSA 5FY5A 1O5UA 3NJXA 4D7SA 3V0BA 3AXDA 2YYOA 1UIJA 4HKWA 5FZIA 1S1AA 4LK6A 2GC1A 4MVTA 3ACLA 4QU1A 3HQRA 1CQ9A 2CV6A 2DCTA 3ETPA 4K21A 5C4WA 1UXZA 5JPNB 3L9JT 2ZGQA 3HBZA 4QDQA 2RS52 1AL23 3T4VA 1ZNPA 4XFHA 1E5IA 5JCTA 1V0AA 1RHI2 3USUB 4I3PA 2LM3A 4QXBA 4XPVA 4BPZA 1PK6C 4CU8A 3ZXAC 4YG3A 1LOGA 1PK6A 1F8VA 3SXWA 1LODA 4HPKA 3JCIA 4S2FA 5JVVA 4LOSA 3ZPYA 1OH4A 4NO4A 4Q0UA 3I2HA 2EF6A 2A75A 4FI9A 1RUJ3 4LBNA 4GWIA 5AFEA 4NHYA 2GNTA 1RITA 5FUPA 3F95A 2CY6A 4YZ5A 2ET7A 2R042 2VZ3A 1CJPA 1RUD2 1XNTA 2D40A 5A7PA 1HW5A 4YZ4A 5GZGA 3D5OA 4CUGA 3AKSA 1S55A 3O14A 2K9ZA 1LECA 1WCSA 3LEKA 1RIRA 3CJIA 4BCUA 1UY1A 3SH3A 2UWAA 4OHXA 1HN0A 1SACA 1W99A 3AKQA 1O8PA 4AQ2A 3C7HA 3CJIC 2XGXA 2C26A
chains in the Genus database with same CATH topology
1VBC2 2NZ9A 3RWNA 3M3IA 5EXOA 1OPOA 3MW3A 1XYPA 1AHSA 1MVEA 1VBC1 3BB6A 2CAUA 2RS32 1RMU2 1QJZA 3PLQA 3RRDA 4OI0A 4H55A 1V70A 4FQZA 3N7MA 1NY72 4BMEA 2D93A 1O5LA 1VBC3 1COV2 4WM8A 4Q1PA 3ZN6B 3MIDA 1FPN1 4MGZE 5FREA 5F6LB 4N7IA 4RHV1 1ND3C 3M3QA 4Q0VA 4Q27A 4FOWA 5ABJB 4COZA 1BBT2 2OZ6A 3PVEA 4FO9A 4HVOA 3GZUC 1BVP1 4LA2A 4R4ZA 4Y1VA 4M00A 4LO4B 3ZFEA 2R32A 1QQP3 3ZN4A 2ZKLA 3VZKA 1UIKA 4YVSB 2VGDA 2G4IA 1AR81 2P3IA 4URTA 4Q0PA 1YFWA 4KGQA 2ZGRA 1POV0 1DG6A 3BOPA 4FOQA 4XJWA 2R072 1OI6A 3L2YA 3MYXA 4IERA 5DG2A 3THTA 4Y24A 4G4FA 2ENRA 1O4YA 2DVBA 4COVA 4FOYA 3RNSA 3MIHA 1ZRFA 1LHNA 5E1RA 3W9AA 4AFDA 5CB7A 1NZCA 1R1ZA 2ZX4A 1GSLA 1N47A 2AZ5A 2XG3A 1W2UA 4CTEA 4Q4W3 4LLOA 3VZOA 5A3LA 3OGGA 4RA0A 4YARA 2RM23 1ND3A 1SLBA 4ORFA 1DZRA 1NCRC 3RJRA 4RQPB 4XXAA 4NR1A 1QJU2 1OPMA 3I59B 4YFZA 4JGZC 1GICA 3BCWA 4K1ZA 5FBZA 2B9UA 1QOTA 3OBTA 3VL8A 4CDWB 1MS1A 2DCYA 2UY9A 1VIWB 1PO23 1AX1A 2JECA 4LA3A 3ZYRA 4KU7A 3UL2A 3ZFGC 3V0AA 5FRAA 3HQXA 4UW3A 3VKLA 1YIPA 1PGL2 1REDA 4AQ6A 1ZZ6A 2X5IC 4AFAA 4Y1ZA 1XYOA 4HKLA 3WW4A 1W6NB 4FPEA 4QGNA 1I1EA 1G7YA 1ZRRA 4Y26A 2JG8A 2Y0IA 1AR83 2X5IB 3MIGA 3T1LA 1RUF2 2WZR1 1SLTA 3JD73 4J1XA 3LA3A 3E6CC 4K40A 1FAYA 1O3RA 1EAH1 4AEJA 3V64A 1UZYA 5JZGA 2E6VA 4C1XA 3O0VA 4QXKA 5D1IA 3VBUC 3POSA 2D6KA 2BWAA 1OQ1A 1UD1A 2ZMKA 4ITCA 2WIIB 1AVBA 4INDA 1U5YA 1W6OA 2CGPA 2PLV2 2D43A 2ZABA 1QHDA 2XKPA 3RJ2X 4CDUB 3LZZA 4O9GA 4A7YA 4IXLA 4D3WA 2XPJA 2R6QA 2DV9A 1FV3A 1HRV2 2HWF1 1NQDA 2NMOA 5CG9A 1J3RA 5FCCA 3JB8A 1G9AA 2EXHA 5HBAA 3ZO0B 3O0XA 5JLVA 4JRLA 1GYKA 4HL0A 2O8QA 2WSUA 5T5PA 4OVEA 3ZN5A 2RS33 1CPMA 2YHJA 5C9AB 5C8CA 2GAUA 5JZGB 2BW8A 4FTSA 1AR91 2UYBA 4JGZB 3CJIB 3J8F2 5CU1A 2PELA 2W08A 3VBOB 3ZSEA 4OHYA 4JDMA 2HWD3 1LHWA 2QCSB 4FPKA 2WNVB 1CAWB 1CJDA 1R083 2HWE1 2W52A 2RS53 4Y22B 2VU9A 3JBG3 2QNKA 1TNRA 4P9JA 4PIZA 4HETA 1DIWA 1H4HA 4OLLA 4AEMA 1H8VA 2FHRA 4FPJA 3W58A 1Z7S3 3KT4A 2XVKA 2Y26A 1BJQA 1DF0A 1S0GA 2WKKA 2VMHA 3ENRA 4FSJA 2UU8A 4GWMA 2ETEA 4KG8A 2HEWF 4L8QA 3GZAA 2XLFA 3JBG2 4LE3A 4BIFA 1ULDA 5K0UB 2ZACA 4PDWB 1C8NA 3SCGA 2NLRA 2WC2A 3HIFA 1PVC2 3I54A 1BEV3 3VHNA 4UXAA 1DYPA 1ZZ7A 4N43B 4EN0A 1IGOA 4P9WA 3VHRA 5CFDA 4YG0A 5SV5A 2ZGUA 2P34A 3IBMA 2E7AA 3FLPA 3DL3A 4L99A 5FO8B 2XBO3 2E9QA 1D4M1 2HWD1 4Y5Z0 2ZHLA 4PQ9A 3V65A 2PA7A 1PHMA 1VLNA 1GZ9A 1J1TA 4P14A 5GLTA 4BLJA 1C5IA 1ULEA 2EXIA 4RFT0 2VNRA 4AFBA 1W0OA 4LO8A 2WNVA 2P3KA 1RUC3 3EJKA 4Q26A 5CNAA 3EQEA 4TLFA 2AR6A 4H3WA 1AF9A 4Y1YA 2IXCA 3ZIXA 3N35A 1FT9A 2WT0A 4PF5A 5GM0A 4Q4V1 3ZFGB 1ZZBA 5JI9A 2WT1A 3N3HA 4NN0A 1A6CA 4A3XA 1W6QA 2VULA 2GZWA 3VKOA 1H8TA 4FPCA 4GH4A 3DUIA 4YG6A 1LEDA 2C0ZA 4RS5B 2RHPA 1H2MA 2R061 2RE9A 1XNKA 1VAKA 3KCCA 4IEPA 1H9WA 4YGBA 1ZM1A 1KDMA 1POV1 1UKRA 3LSEA 2QZ3A 1Q8VA 1HXS2 1C57A 1DGLA 1OHFA 1IS5A 3NW4A 1W6PB 5C8CC 1W6MA 3ZFEC 4WVMB 2PAEA 2IFWA 3JU9A 5GLVA 5T5OA 3VKFC 2WINB 4PDWA 4M3CB 5BNOC 2QDNA 4AF9A 4YM3A 2F6BA 4AEDB 5KXEA 1UX6A 4P9IA 1ZA4A 4XTMA 5BYNA 4OI4A 1QGLA 2WL1A 5FAXA 2R1DA 1ENXA 1LULA 4HLTA 2OYZA 1YNAA 1YYNA 4UW6A 4E27A 3MICA 2GSYA 2D98A 2PHTA 4CP0A 1UKGA 5KXDA 3DKWA 1RUE3 1AR63 4S2DA 4CDUC 2UWBA 2AREA 3DPRB 3ZYJB 2A71A 4WZCA 3BPZA 2ZS6B 4Q4Y1 1QJX2 2JENA 1W39A 2XJRA 5J96B 5KHIA 5JMCA 1QMJA 3TWIA 5D8AC 1ZZ9A 4KWKA 2RM21 4KWJA 1LB2A 2BYVE 1ZBE1 4JDNA 2QDRA 1MS9A 4K8FA 1G86A 1R091 1DYKA 3VKMA 1MS5A 3K48A 4LBLA 2XJPA 4XW3A 2RJLA 5EFUA 5E8AA 1WLDA 3AP6A 4FPOB 4FVVA 2XBO2 3ZX7A 4FQ4A 1LESA 4IV1C 1SFNA 2WQZC 1RVF2 4DPNA 2EXJA 4DZGA 3ECQA 3KM5A 5GALA 3KLSA 1NQJA 4HSJA 4COUA 3THPA 4AE2A 1O91A 1KFXL 3RYPA 2ES3A 1ZX5A 1CESA 4KQ7A 3FFZA 3PMEA 1S0IA 2VW1A 1VBB2 3KZ4C 3JBG1 3AMMA 1XNCA 5A33A 3PJYA 2TNFA 4OFGA 2PHLA 1QU0A 4XFAA 2X8KA 2ATFA 1RUI1 1FMD3 1X33A 2I74A 4LO6B 1OLRA 3FJSA 1GFF2 4Y20A 3VGIA 1SQ4A 4RGAA 4KWLA 5GJ6A 2BVBA 1QXRA 3DN7A 4L92A 3OTFA 1UPIA 4YZ2A 3IDBB 5DXDA 4Q4V2 3NL1A 4M0HA 1GZWA 4AI0A 1IHMA 1LENA 3M1HA 1C1LA 3IT8A 3BTAA 4YVSA 4QGLA 4LTAA 3B02A 1LJ7A 2VQAA 3MZHA 1BMV2 1KITA 3LAGA 1DU3D 2ZGMA 3ZSMA 2TBVA 3M3CA 1NCRA 2BQPA 3VBUA 3WZ1A 4KL1A 3ATGA 2QZ2A 2PFWA 4UBGA 1RHI3 1OQEA 2MNGA 4MXWA 1TMF1 3I7DA 3KGZA 4OHWA 3VBSA 1JUHA 4IEOA 4HZFA 1G9CA 1GLHA 3TOJA 4R8HA 1VR3A 4H7MA 2N7GA 3VKNA 5JOWA 4I0AA 1OD5A 2MEV3 3H0OA 3AP7A 3ZXJA 2XJQA 2B45X 2WNUB 2UWCA 3EBRA 2A6WA 5C9AC 1EV12 3WHTA 1AX0A 4RQPA 2YV8A 4WM7A 3HR9A 5J36A 2DTYA 4BIOA 1NCQC 4YVWC 1O3TA 1QDOA 3AP4A 2D44A 2FMDA 2HYKA 5EZWA 2VVDA 1OQDA 3HN1A 1ND2C 1IKQA 1YLLA 3ZXFA 2C1FA 3WG4A 1YRZA 2FZ1A 5E16A 5KC5A 2BFUL 3WDUA 4QT6A 2D6PA 2XL7A 1YCIA 1XRUA 1HRI1 1AXZA 2PHUA 4XIOA 2RM22 4QD2A 1DQ1A 2VNGA 1K5MA 2JE9A 3KT7A 4WBBA 3OJBA 5DZEA 2WS92 1ND3B 4PLNA 1K5MC 5C8CB 1RL3A 1MQTA 3AKPA 2D3RA 2OUJA 1X36A 5BNOB 3WQ0A 2Z42A 4Q29A 1HX6A 3U10A 2XLGA 3KMHA 2D5FA 4XQWA 4C1WA 3AYAA 5FOJB 4NHLA 4MYEA 3V56A 3SISA 3SCFA 3UKVA 3VHPA 3R4DB 4XJ9A 1ZYBA 2CTVA 5BNNC 3OGJA 1RUC2 3CU7A 4P9YA 3VBHC 3UV9A 4EWEA 4HVQA 4YZ3A 2HWC2 1XE8A 1V6JA 5C9AA 1VBA3 4M3CF 4JTOA 4X6RB 3D4KA 1H4GA 2BUKA 5AVAA 3IM0A 2G9GA 3ILNA 3LGRA 1SLCA 4YGDA 2ZX3A 2YMZA 3VBRB 2QKDA 4CYDA 2VOVA 2XWBB 3KSCA 1KQRA 3GF6A 2R062 1GV9A 2DU0A 4IEQA 1HKDA 1BCXA 2DFBA 3PVBB 4XJAA 5IT6A 1I9RA 1B35B 1WW4A 2G9FA 3H9AA 3SMHA 1QWRA 1KD7A 1PZ9A 1VRH2 2QJVA 1J1LA 3WDWA 3POWA 3QD6A 2XBO1 1QQP2 1TNFA 1MS3A 3NO8A 1R092 2HKXA 4C91A 4DNYA 3JZVA 3N36A 2DF7A 5A32A 3IWZA 2VW0A 4N53B 1X82A 4ISRA 1YFUA 2ZHMA 2R30A 3O7OA 5C6CA 2DVGA 5TSWA 5GZCA 2ZX2A 1PM7A 1TMF3 2AENA 4BYYA 5I8TA 5I8YA 1PGW1 2D7FA 3VLBB 4UBHA 1F9KA 4CEWC 2DFCA 2NM1A 4IV1A 1PGL1 1VBE2 4GXLA 1WBFA 4DB5A 3O0WA 4OZXA 3ZXDA 5DUUA 2PQQA 2ZAHA 4BZ4A 3GBWA 1MR5A 4Z92B 1UZZA 2HJIA 3MFCA 1RUE2 1QJU3 1VBD3 3H3ZA 3A4UA 5HCAA 4MXVA 2ZTNA 3TNQA 2AYHA 3MIFA 4L9BA 5FTTC 1IZ3A 3K51A 1Y7BA 2ZGPA 1NE6A 4DXZA 3PTYA 4EWDA 1WLWA 3SLIA 4R9CA 5C4WB 3UKTA 4AGVA 5BNNB 4E4SA 4LBOA 1NA1A 3ZYPA 3NKGA 3QCWA 2WLQA 4COWA 5T5JA 4RSUA 4PJYA 3S30A 3H7JA 3U0ZA 2CNAA 3WINE 2EAKA 1MZFA 3B01A 3TYJA 4P9GA 1LU1A 1O3SA 5K9YA 2IXKA 1AZDA 1CAVB 1V6IA 1AR93 3FBYA 1VBA2 4NVPA 1URXA 4QM8A 3B69A 4QMAA 4ZU5A 4MV2A 1J3PA 1NCQB 1YJLA 3NJZA 3H50A 3VBUB 1RJ7A 1YWKA 5DG1A 3ME2A 1XQNA 4MGIE 1KS4A 2YPJA 1W6PA 1LCLA 2JKBA 1PGSA 4GKYA 4FXGB 2YXSA 4QQHA 4XFIA 1U12A 4GA9A 1RGSA 2C5DA 5KHKA 5CG8A 4GH4B 1LOFC 1SMVA 2DU1A 2WS93 1A8DA 2XL9A 2YGLA 3WQ1A 2YGMA 2NQYA 1NCRB 1FPN2 2HWF2 2RMU3 3CO2A 3I2DA 4ONUA 5EYXA 1COV1 4AVCA 3AMPA 3VL9A 1UU6A 2ZZQA 1Q8PA 2JG8C 2WA3A 2VH9A 1EAH3 1ENQA 3ZIWA 2VPVA 1LGBA 1T6GC 4MSVA 1ZBA3 4QX5A 3OBRA 1S2BA 1SBDA 4NWWA 5FLHA 4XDQA 1O3QA 1B35A 4R9DA 2VNOA 2VXRA 3HMYA 1M4WA 1WA4A 4QHBA 3ZXGA 3LOBA 3ILFA 1PIV2 3R05A 5JDBA 1EPWA 1SBEA 4AGGA 1C1FA 3VBHB 3PNAA 1OKQA 4TWTA 5HXVA 1RUD1 5DUVA 3LSDA 4AYUA 1I3HA 5JR7B 4ES8A 4OHZA 2NMNA 1CR7A 3AB0A 4RD7A 2ZBJA 3D6EA 4WZFA 3JQXA 2RR11 2VVEA 4Y1UA 4XBLA 1TEIA 4N43A 2VMIA 4B4PA 3JD71 3OD4A 5K7PA 3X29B 4B3NA 2HWE2 2WLPA 4LE4A 3WCRA 3L2HA 1DQ5A 3ZSJA 5FFOC 1NCQA 5BNNA 4CDWC 4A7KA 4HFSA 4AHZA 2XWJB 5K0UA 3KB5A 2IZWA 5CFCC 3B9CA 4IQPA 4CDXA 1U0AA 1OA4A 4KG0A 2XVLA 3C3VA 2V09A 1U5IA 4AI8A 4WM7B 2W39A 3H1MA 1QDCA 1BZWA 3LOIA 3VDDB 1WLCA 2Z79A 4NHKA 4SBVA 3N7JA 3R4SA 2PHXA 3FMGA 1DQ6A 2JICA 2Y0OA 4AGRA 2NP0A 2OPKA 4XBQA 2ERFA 4TSVA 1COV3 4XFFA 5F9TA 2A73B 1DZTA 4LBKA 4XEZA 5FPXA 3DF0A 1HRV3 1OMIA 1RUG1 2RMU2 3FHIB 5D8AB 1NG0A 4PLOA 2YZ4A 2WFF2 1JOJA 2ILMA 2Q30A 2A5ZA 3LB9A 3ELNA 4Q4W1 1EP0A 1H8TB 5DUWA 3URFA 3UK9A 4BA6A 1MZEA 4BOWA 1YFYA 3VZMA 4E9KA 3M70A 2HWB1 1JTZX 4KGGA 4GWNA 4IV3B 4MLOA 1TQ5A 1JYIA 1YJKA 3G6JB 2WFF3 3T1MA 2DVAA 3FC0A 3FUOA 1C4RA 5C4WC 1L3JA 4AVAA 1QJX3 4KU8A 3TBDA 3GBGA 1S0BA 4B4QA 2R073 4IV3C 4U2AA 3WW3A 1WMEA 4GULA 5KHGA 1GZWB 5J98B 3ZN6A 2GNMA 4B7KA 5GLWA 1VB2A 3ZXEA 1AR72 4GMP3 4LUKA 4P5HA 2BVVA 3UJOA 1HQNA 1ASJ3 1C5HA 1V6LA 2O0OA 4RR3C