3VZJA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) e172h mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATHGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 44
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzjA00
2F6BA 1KS4A 1XYPA 3MFCA 1UU5A 2VUJA 1F5JA 3WR0A 3WT3A 3MFAA 4S2HA 1QH7A 2D97A 3AKPA 1YNAA 2VG9A 1AXKA 1OA4A 2B45X 4S2FA 3M4FA 3VZNA 5EJ3A 3LGRA 1XNBA 2B42B 3AKTA 3WQ7A 1H4HA 1OA3A 1XYOA 1UU6A 3WX5A 1W2UA 1C5HA 2DCKA 2NQYA 3AMHA 3AMQA 1XNKA 2DFCA 4XQDA 1T6GC 3VZJA 3WP5A 1REDA 4HKWA 2DCYA 5K9YA 2B46X 2VULA 1NLRA 3VL9A 4S2DA 4XQ4A 2QZ2A 3VZMA 3WP6A 2C1FA 2BVVA 1OLRA 2DCJA 3VZLA 1XXNA 2NLRA 3AMPA 4HKOA 2JENA 1REFA 3VZOA 2BWAA 3EXUA 3VHNA 1H8VA 1H1AA 4NPRA 1C5IA 5HXVA 1XNDA 2DCZA 2BW8A 1UKRA 3WQ0A 2VGDA 3WP3A 2DFBA 3WP4A 1PVXA 3RI9A 3AKRA 1BK1A 3WY6A 3AKQA 4HK8A 5K7PA 3WXPA 3LB9A 3RI8A 3VHOA 3HD8B 1QH6A 3B5LB 1XYNA 1M4WA 3AMMA 4HKLA 3O7OA 1OLQA 4H7MA 2BWCA 1IGOA 1KS5A 1REEA 4S2GA 4XQWA 3MF6A 1BCXA 1TE1B 1XNCA 3ZSEA 3AMNA 1H0BA 1HV1A 4IXLA 1H4GA 3MF9A 2JICA 3VZKA 2Z79A 3WQ1A 1BVVA 1ENXA 4HK9A 3VL8A 1OA2A 3B7MA 1HV0A 2JEMA 1HIXA 3AKSA 3VGIA 1UU4A 2D98A 2QZ3A 3VHPA 4XPVA 3VLBB
chains in the Genus database with same CATH superfamily
4XEZA 3GGLA 4XJ8A 5FK7A 1QQP1 5FZDA 3TAYA 2UYBA 1DGWX 2ZMNA 2HWC2 4MGSA 4ZXEA 4CCKA 2C5DA 3AZWA 3H50A 4XJZA 4EJRA 4EV0A 4XIKA 2QVSB 2OUJA 2ZEZA 5J3UA 2QBXA 3M7AA 3LEKA 3KQ4B 1WCKA 3T09A 2CL2A 1OBNA 5AFBA 3OPWA 4HN0A 3D4KA 1O3QA 1BMV2 2ZKNA 5F8PA 5GLUA 1EAH2 4XABA 4RHV2 1TEIA 3I2OA 2ID4A 1PK6A 4ZXKA 4Q4Y1 5T5JA 1QNWA 3NW4A 2P6HA 4OUMA 4XZUG 1SBFA 1X36A 4YG3A 2Y34A 4MXVA 4QGLA 5CFCC 2FQPA 1O8SA 2VMFA 2LRPA 4FXGB 2ZGRA 3NQHA 1Y43B 1V6JA 3O5SA 4YW5A 5EIYB 3F2ZA 1PNGA 4Y22B 4O9GA 3AB0A 1UOBA 4OULA 3WNLA 4FCAA 5JSPA 2Y0OA 1GMMA 1VB2A 3K4ZA 5T52A 4UFMA 2OKXA 3KSCA 1FMD2 1MZEA 1G86A 2OPWA 4P9GA 1C1LA 4CZSA 5A6QA 4IERA 2TBVA 1ZRFA 1URXA 2ZX3A 3TN92 5LY1A 2ZHMA 3O0XA 2B4KA 1P8JA 1HLCA 5FMBA 3KV5A 1V6NA 3AXEA 1WZXA 4CCCA 1W9YA 4BM8A 1Q3EA 1W2TA 4KU7A 1RINA 5FXWA 3S5AA 2WAAA 2Q8DA 1NYWA 3FBMA 1J1LA 3V64A 5FBJA 4Q4V3 1VBD3 3FLPA 4QGNA 4AQTA 4LLFA 4A6SA 1JZ6A 4B4PA 1D0HA 3RZGA 2VZQA 3MEPA 5DUVA 1MQTA 4PBPA 1VLNA 4PI2A 3HD8B 3ILNA 2HWF1 5J37A 1WA4A 3CHXA 5DAWA 3FWEA 4R9DA 3DKQA 5BNPB 1LAJA 4QKNA 2VW0A 1GP6A 1HRV3 1S0EA 3KV9A 4QPGB 3TEYA 3NMBA 3H8XA 2LM3A 1RJ7A 1CVNA 3NRUA 4DXSA 2FDKA 3P5BA 4BXFA 4Q8KA 3GCXA 1UYPA 1RUI3 4W8JA 3N9QA 2CWSA 3WINE 1DQ2A 3DXUA 5T5OA 3WLUA 4FVVA 4QU2A 1BEV3 1Y9QA 4Y1VA 1TNRA 4URAA 3RZKA 5L7OC 2KA3A 3EBRA 2ZMKA 3M3CA 1L7QA 2VQAA 4JCKA 4MUVA 2DVFA 4Q4V1 1X50A 1VBD1 2PQSA 4GJYA 2Z79A 3PU3A 5FZOB 1NOVA 3SH4A 5HPOA 2UU8A 1HV0A 2JEMA 5FZ0A 3ZMOA 3E5QA 5F1RA 2YFZA 3UKTA 4OHZA 2WFF3 1PO13 1RUE3 3KHCA 4JGYA 4X8PA 1RMU1 2BTVC 3ILFA 4WVMB 1D7PM 1HRV1 3MPPG 1H2MA 1UZWA 3PDQA 5G04L 3OEBA 3GHNA 4I3GA 2OA2A 2ZJCA 3DGTA 4ZS3A 2A3WA 3CJIA 1RUI1 4XBNA 2NMOA 2R073 2H0VA 4UBGA 4D6RA 2XJUA 2UYAA 1PK6B 1SDWA 1YNAA 3UGGA 1JBCA 4QQPA 5I0RA 2VECA 1CN1A 1BEV1 4KWJA 5EHDA 1FOD3 3MHZA 5FJHA 1ZVFA 3AP4A 3OPTA 4XUOA 4AHXA 4YZ4A 4CE8A 1X33A 2G9GA 1HRI1 1VAKA 4NWWA 5F5AA 5J98B 1X82A 3IAPA 1C8M2 2O8QA 4B1MA 1JUIA 1W8HA 3DN7A 2BOJA 1PIV3 2WFF1 3QACA 4HVRA 2VZSA 1PO11 1HQNA 1REDA 2XXZA 2B39A 1OLMA 3OD4A 3S57A 5BNOC 3J7MA 2RS33 1X9TA 2VULA 4AEDC 1WD4A 4CRQA 1U12A 3BTZA 1PMJX 2R16A 3JCIA 3A0KA 4BQWA 4AQSA 4BE3A 3SLIA 5KC6A 2N7GA 4QX8A 2VQ0A 3CBNA 4J6GA 4L99A 1VBC2 4MHUA 1O91A 1QIQA 1T2XA 1WD3A 2FHRA 3NV3A 4K1ZA 1WMDA 4N7IA 4M3CE 4Y1UA 4AFDA 5IK7A 3ES4A 3EXUA 1IKQA 2KD7A 1ZBA3 3DL3A 1FOD1 2UY8A 3BVCA 4YSFA 2YBKA 4C91A 5T50A 2ZGNA 1I6XA 4L8QA 3ZYHA 2AR6A 1XE7A 1RUD3 3N7LA 4KBBA 1F15A 1GU3A 1MQTB 1JZ2A 2VZOA 3RGBA 4MSVA 5DQ0A 5KHGA 2JDAA 3ZMNA 3RG0A 4CSWA 1L7LA 3MZHA 1PIV1 3M3QA 3WY6A 3U11A 4GB33 2W1WA 4OZXA 2FCTA 4PI0A 4LA3A 3D82A 1OFSA 3WW4A 5J96B 5JXHA 1I9RA 3O1MA 1Q56A 1UZYA 2RS31 5ACA2 2J7MA 1PO22 5EXOA 1K42A 1O59A 1YCIA 3BOPA 4PJYA 1LU2A 3DPRC 2IFWA 3HQRA 2WLPA 1UO9A 1M4WA 3BTXA 5FYSA 1PVC2 5CAZA 2GNBA 3K3NA 4HT1T 4COWA 2WIIB 1W03A 3V0AA 2D5FA 2UY9A 2NP0A 2E7QA 4RGAA 5GLVA 3ZX7A 1RUJ3 4P9WA 1ZZ8A 4CCOA 1V6MA 3MF6A 3FHQA 3N9MA 2EXIA 2WN2A 4HFSA 1W6QA 3RQ0A 3ZR6A 5HV0A 1LR5A 4ZPIA 3BYWA 2P37A 4KL1A 1LEDA 1RXFA 1EV12 3AMNA 1H0BA 1UMZA 1Y9GA 1DQ0A 4A7KA 1DGRN 1NXMA 2VL4A 2XVLA 1H4GA 4K40A 4PT6A 4JGYB 3H8UA 4AVTA 5HCHA 2AEZA 5JMCA 1AL22 2VXJA 5FZKA 1JW6A 3GCWA 4GB31 1WW5A 1YIPA 4BWOA 3RMYA 3SC7X 1I1EA 1QJX2 4B8EA 3CJIB 5JAXA 1FI2A 2EIBA 4OMCA 2D7FA 2DURA 2XJQA 3ZSJA 3PHMA 1LU1A 4NN0A 4XPVA 4YVSC 5L9BA 5A3WA 1QDOA 2W5FA 3VBOA 4BQXA 1ONAA 3RJRA 4PF5A 1NA1A 2XL7A 2VAUA 1QXJA 4QM9A 5FP9A 2B8MA 4IGQA 4CDUB 1OA4A 2HYKA 2VTFA 5JMOA 1UOFA 4Z82A 1VMHA 4YG6A 3LGRA 5IWFA 3WHUA 2ZOEB 1MS3A 4CXXA 2A75A 1JZ5A 4JGZA 2B5HA 1LHUA 1VBA3 3ME2A 1CIWA 2WT1A 5C3PA 3BGAA 3LCPA 1C5HA 2GU9A 2DCKA 2GNTA 4COYA 1YI7A 1RUC2 2YV8A 1AX1A 3AFKA 4TLFA 2ZGPA 2QKDA 2X53S 2P6CA 2P1BA 4JRLA 4PIXA 5FZLA 4XXPA 4HKWA 3EYPA 3QH6A 5I0UA 1RUH3 5LK5A 4C1XA 1MR5A 1FATA 4QPWA 5K4LA 5F5QA 3DCQA 2CNAA 3LWCA 1NY71 4SLIA 3PU8A 3T2QA 2RVAA 4CP1A 4GKXA 2RR12 3K46A 3GF6A 4LIUA 1POV3 3VZMA 4AGGA 1DP0A 1R1ZA 2WT0A 5C33A 3A22A 3AMPA 1RITA 4B3NA 5LRSA 1GWLA 1ULOA 1VMJA 1REFA 2OQ7A 2XUMA 3E6DA 1RHI2 2BGCA 3IT8A 3TNPB 5E8AA 1NCRA 4YM1A 3W58A 4IGOA 2VVEA 1EYBA 5JXGA 1CX1A 2ZKLA 1C4RA 1VBA1 3PVNA 4IE6A 4NE9A 2WNVC 1WW7A 4G9SB 3LOIA 1A6CA 4FPKA 1QOOA 5CYYA 3MV11 5FMOS 5FOJB 4IV1C 1SBDA 4YW7A 4QHZA 4I2OA 3V0AB 1HB4A 4YW2A 2ZGLA 1J3RA 3KD4A 1RUH1 5FV3A 3N3HA 1JMUB 2WNEA 4P02B 2ET1A 3JBG3 1MS0A 1K5JA 2XQRA 4QKBA 4URTA 3B5LB 1LULA 1W6QB 1XYNA 1YC61 3AMMA 2VCAA 5LWBA 4AEKA 1POV1 3LEMA 4YFZA 2ZGTA 4E4HA 1IPKA 2PLV3 4QQOA 4CCDA 4M01A 4KU8A 1KDKA 5CZKA 2FDIA 1REEA 4GAZA 4S2GA 3VBSC 3PL0A 1S2BA 1SFNA 3C7EA 4JRAA 2MPFA 1JZ3A 4OHVA 4QPYA 1FMD3 1OPMA 4Q4Y2 2WNUA 3H1MA 1W2OA 3VBUC 4AI0A 3LE0A 2WWSA 1HQLA 4RQPC 5FDBA 1GQPA 5CEHA 5FLIA 3WDYA 3IIIA 1H2KA 1C8NA 4A44A 3VDAA 4CDXA 2HKXA 2BV4A 3VZKA 3VBOB 3B94A 3JD73 4YZ5A 1SEFA 4AVCA 2VMEA 1S2KA 3T1MA 3VL8A 1QEXA 4LBKA 5C5TA 1UY1A 3LDRA 3LIHA 1NA1B 1HIXA 2OPKA 4E8CA 4E2SA 5IVCA 3JBG1 5FMOL 3J8F2 4QX5A 2VW1A 3FBYA 2OYZA 2R1DA 1ZA4A 1GZTA 1AR93 3LKJA 4LBLA 5GLZA 4AQ6A 2PLV1 2FZ2A 2WR9A 2XPJA 4XJAA 4JGZB 4Q0UA 1D0GA 3WT3A 3C7OA 2BQPA 1H6YA 4FQZA 2B7YA 1FMD1 2XMLA 4HSLA 4QD2A 4AGRA 2Y60A 3PIGA 3DV8A 3Q8EA 5A3TA 2XJVA 5JIUA 3VBFA 4YW4A 3ZYJB 3AYEA 4MGTA 4FP3A 1CPNA 2LALA 4ZONA 2QE3A 4YPJA 3WDWA 2GP3A 3OGJA 2BFUS 4KNCA 4LBOA 4Y4YA 5C4WA 2VZVA 3WNNA 3AMHA 4QWNA 3NKGA 2DUPA 3RRDA 4ASMB 4CYDA 1LRHA 1QOSA 3FLTA 2NZ9A 3IDEA 1ULFA 1AR91 3NAPC 4LOSA 1AR83 1ZM1A 4E4ZA 4FO9A 3VKFC 4F3JA 2XWJB 5L73A 3ZYGA 3MLKA 4B7EA 1NCRB 5CIRA 4JV4A 3VBHA 2Q1FA 4XQ4A 1JYXA 2QQOA 5CVRA 1ZRDA 5BNQA 3H7JA 4PIYA 3P3NA 3OUIA 2RM22 2ARCA 5FQ0A 2W2IA 4BK5A 1K5MA 3KT7A 4OUSA 4Q4V2 5F39A 1KITA 1VBD2 4ZU4A 5KC5A 1ND3C 3OUHA 4GD4A 3ACGA 4GIQA 1JOBA 2JXAA 4LO7A 4OYUA 1J84A 2BW8A 4M00A 1QHDA 1VMFA 4GJZA 4COVA 3FN9A 3WP3A 3WP4A 2WO3A 3MDPA 2Q8EA 4D8MA 3P6BA 2XHNA 4GWIA 1BK1A 1HRV2 2VQTA 4META 3ZXJA 2UWCA 3ZYRA 5FYZA 4GWMA 4BQ5A 4ITCA 2RJKA 2KR2A 5CU1A 4YVWA 3PUSA 4FOYA 2I2SA 1AR81 1RUI2 1PMHX 4IV3A 2WQ4A 3URFA 2KM2A 1BLZA 4IEWA 4BU2A 2WNUB 3BCWA 1A78A 1OC1A 3AXDA 1KJRA 2W94A 5FPVA 1BEV2 2GC0A 4NHMA 3T2PA 1LEMA 1DYOA 1QDCA 4DOUA 4DRVA 3MPBA 3FZ3A 3CEWA 1AHSA 1NAEA 1R093 1ZRRA 1X8MA 2WYFA 2XGXA 4A4AA 4CDXB 4NIHA 4FTSA 5JOZA 2RDQA 3VDBA 5LBEA 1E57A 1UZVA 2LTNA 2VOVA 1W39A 1CPMA 2YXSA 4P08A 4R8HA 4K9SA 4CPBD 5I8YA 3MV01 5I0SA 2WFF2 2E31A 4Q26A 1PO12 3E97A 1RUE2 5T5PA 3T08A 3C7FA 4JKMA 3SH3A 4LBQA 1GNHA 1O3TA 1OKOA 2ZPXA 4QXBA 2ZMLA 4RYDA 2HWE3 1IS3A 3FHIB 2D6KA 5JDBA 2MHFA 1Q5OA 4MADA 1LODA 5ABJA 3CZUA 4HXCA 4LQRA 1W3VA 2R072 3PMEA 2ZGKA 2W9XA 4LHKA 2V5DA 2PMWB 1IQAA 3EO6A 3MW2A 4OI1A 2VNOA 2TNFA 1POV0 2VZ1A 3IWZA 1FV2A 2WWJA 1FOD2 3S6PA 1DFQA 4IDZA 3VBFB 4DXTA 5A32A 5KXCA 4PDWA 5BV6A 5FYYA 2XVKA 3MFCA 4INDA 4Y3OA 3IAQA 1R091 2YU2A 3ITQA 5FZ1A 1XJAA 1MVEA 4BDVB 1PVC3 2D97A 1UCXA 1VE0A 4I0WB 2DWRA 4KH9A 5FY8A 2QQNA 2W47A 5C4WB 2NMNA 4D6SA 1RTVA 4D7SA 1PIV2 1F9KA 4BQ2A 4IEPA 1UX6A 5A6ZA 3UJQA 2RS32 5F9TA 2HWE1 3I2KA 3WG3A 1TNFA 1HQWA 3FE5A 2VTXJ 3RMXA 1EV13 4NO4A 4P9LA 1QWRA 2D6LX 2R32A 3VBHB 2ZEXA 3WVJA 3ZO0B 2RS12 3AZVA 3LF7A 1S0CA 4KI5M 1HKDA 5GZEA 1QNYA 3N9NA 2AENA 5LK7B 5FQ0B 1W6OA 5K0UC 3WOGA 1ZBA2 1K5MB 5B2GB 1E5RA 4P9IA 1B35A 1QY4A 1UKGA 5B4XA 4AF9A 1RUD2 4K7JA 3O1OA 1VBB3 4XMAA 3D5OA 2YC2A 1PVC1 1QXRA 4WVVA 4A6OA 1JZ7A 3NL1A 4G4FA 2JENA 1LTEA 4MLOA 3T3YA 1ZA7A 2I74A 5A7OA 4ASLA 1H8VA 5E89A 1H1AA 1O3SA 4GB32 1N1TA 1VAVA 4NR1A 5HXVA 4GA9A 3UGHA 4YVWB 1PGW1 4EN9B 5IATA 1N1SA 4IV3B 1SLLA 4MX3A 1FNYA 2QTWB 4WBBA 1EV11 3FC0A 1UNBA 3MBWA 5D1IA 5IW0A 3WF2A 2JDPA 1CZTA 3OBAA 4XDOA 1H9PA 4JQTA 1UYYA 2VM9A 1MS1A 2XUEA 5FPBA 1H2NA 4D6QA 4JKLA 4NHKA 4N43A 2BYVE 1RUJ2 3HWJA 2UWAA 3MLLA 1W05A 2GMPA 2PXJA 4Y5Z0 4BHPA 2W39A 4FI9A 3O1UA 2ERFA 1JYVA 2W1UA 3WCRA 4DO0A 4O9EA 4Q0VA 3VDDC 2BNOA 1G8WA 4O7XA 3VBRC 2BERA 2Y6KA 1KS5A 1Q8OA 2QQIA 4A41A 4AK3A 5FKBA 4LBQB 5D8AA 1F2NA 2G9FA 3B01A 3NKTA 3O0WA 1TME3 4FPLA 4ZU7A 2CAUA 5FZIA 1DG6A 4NUBA 3TNQA 1XNCA 4WM8A 5ABJB 1GR3A 4JC1A 4QXKA 2WL1A 5A7NA 1SPPA 1DIWA 2X5IB 4LE3A 2MNGA 2OQ6A 1PM4A 2VMCA 5CFDC 4M3CA 1I3HA 1NX9A 2CWMA 4NMIA 1NY72 4IEVA 3TBDA 3U07A 5A32B 4P9XA 1BZWA 4XFCA 5F32A 4PDWB 5D21A 1WLTA 5HXMA 3GBGA 1RUC1 2AC1A 4N8MA 3GXUA 4XBLA 1YFWA 2D6MA 2QZ3A 4P14A 1A8DA 5E16A 3B3QE 2F6BA 4OI0A 3MI8A 3AP7A 2GAUA 3UL2A 3KV4A 3C7GA 5A33B 1XYPA 5JPNB 1VBA2 1IPSA 3WUDA 3U0ZA 2WO1A 3B69A 4E27A 4AI3A 2GNDA 3KCYA 4LORA 3QBQA 1IS4A 1SCSA 4XURA 5CFCA 4BYYA 1YQ8A 4D69A 2W68A 3NNMA 4MGYE 3HOBA 1VBE3 3ZFGA 4RSUA 1RUH2 3FHAA 1DQ5A 3WQ7A 3EHKA 4UBHA 1XYOA 2ZHNA 1W6OB 4WVZA 3BI3A 1E5HA 2GN3A 4QB1A 2BEOA 1B35B 3L2YA 1XE0A 2PQQA 3ZPOA 4EN8B 5HI0A 2G9ZA 4G3YC 3BKZA 1PMIA 2ZGQA 3FUQA 4R9CA 1BHGA 1KFXL 1JI6A 4XUTA 3RZHA 3SCHA 4MVTA 5K9YA 4IEQA 3ROUA 4JHZA 2FBEA 1JOJA 4ZS2A 5KHKA 4Q2FA 1UYXA 4WVWA 1CGPA 2Y6LA 1SMVA 3KM5A 4YG0A 2VUAA 2ZX2A 3J8F3 4YW1A 3T2OA 4C8DA 2C9AA 3GZUC 3UV9A 2WS92 1MZ5A 5IHRA 4EWEA 2A6VA 3AYCA 2BZDA 2ZAHA 4Q29A 2ZEYA 1LECA 2LS6A 3ZR5A 2EXJA 2FCUA 4UI9L 5DZFA 4IE5A 4L2NA 5KHIA 2V72A 5EV7A 1VBE1 2PFWA 1HN0A 3VD4A 3ZYIB 3RYRA 4D7YA 3T0BA 3KVAA 2OZ6A 4N43B 3WF3A 4MOAA 3JBG2 1VAMA 4EWAA 1OVPA 3SQOA 1CQ9A 3U75A 3I8TA 1RUNA 2RHPA 1CAVA 2PYTA 1ODMA 1SZBA 2VNVA 2PLV2 2YPDA 3CDZB 5JIAA 3VHRA 3RWNA 1GICA 2YMZA 1RIRA 3GJBA 3QCWA 4CEYC 5D8AB 1W8UA 4BA6A 5A3MA 5ANNA 3J8F1 3G7DA 2AYHA 5FP7A 4HKLA 5L7OA 2CAVA 1V6LA 2ZACA 1XC6A 4M3CF 3E6BA 4RS5C 4AWDA 2HEYF 4WM8B 4OMDA 4QPGC 2O14A 3AK0A 5SV5A 5E1RA 3U1XA 4ATFA 4R52A 1JYWA 1SPPB 1S0IA 1NKGA 2VJXA 3JD72 1BCXA 4M3CB 1WW4A 2P5BA 3LA2A 1EUTA 3AC0A 1OQEA 4Y1YA 2RM23 1YXWA 1Z0HA 4OCTA 5APAA 3MW3A 3H3UA 1BK0A 2XJPA 3TWIA 1AR92 4KGQA 4KG8A 2JKXA 4H7LA 1QMJA 2Q4SA 4W4ZA 2YHJA 1QF3A 4LTAA 1VALA 2A5ZA 1H30A 1POQA 3E1F1 1GOHA 2NN8A 4ONUA 2JG9C 1FNZA 5JR7B 4IUGA 3VGIA 1NG0A 4FFHA 3HPNA 1NE6A 4JTNA 2ILMA 3BIEA 5C3RA 1DU3D 1PHMA 3T2TA 5CFCB 2VUCA 5A7WA 2DF7A 3R4DB 3ZFGB 5FYMA 1APNA 4UF0A 4FPFA 1F5JA 1HX6A 2Z69A 2W92A 2ARBA 5M0TA 5JXJA 1PK6C 1ZBE3 3POIA 3B9IA 2RM21 1C57A 1DZTA 4TZDA 5BNOA 4NIGA 2A3XA 3OF1A 5T3NA 3CL1A 1G9FA 1XE8A 1H8TA 4AEDA 5FYCA 4C90A 1TMF2 4FFGA 1AR82 3ZXFA 2VZUA 1I5PA 2GN7A 2JD9A 3JUUA 4KG0A 1W2UA 3POEA 2WJSA 4KBZA 3HT1A 4R4ZA 3ZPYA 4AOCA 4CU7A 5KR7A 5JWPA 1YHFA 1WKYA 1XNKA 2YFUA 1WCUA 3I3EA 4DRRA 5FUIA 4ES8A 3AZYA 3PUIA 1UD1A 3ATGA 1DYPA 4OZOA 2VXRA 2DV9A 2Q8CA 4CCNA 5IAVA 1GWMA 2V4AA 3PURA 2EIEA 1C3HA 1AVBA 1UOGA 4FOVA 3BU0A 1UWWA 1SLTA 2QZ2A 3GZAA 1HB1A 3NO8A 5AVPA 4PIZA 3H3ZA 3WDXA 2HWD3 4I01A 2NLRA 3FMGA 3OJBA 1RGSA 1ZBE1 2A6YA 4Q5OA 1BBT3 4GKYA 3WF4A 1CAVB 4XDQA 5FZEA 2ZABA 4LIVA 4PLMA 3ZSMA 1C5IA 1UIJA 3B9CA 3PVBB 3MUY1 1XNDA 4DUXA 3DPRA 4CTEA 4K1YA 2ZGOA 4LO5B 4XF9A 4DS0A 1UF2C 1RUE1 1UY3A 4YARA 5I91A 1S0FA 3ALQA 3WNOA 5L7OB 4KWKA 4YGEA 1QJFA 3W20A 3NJYA 4UFLA 4XFIA 1V9U3 5FPZA 3WXPA 2NM1A 3WNXA 2JE8A 1R092 4DPNA 3BIWE 5FYBA 5JOXA 4IEZA 3WD5A 4AVBA 3BUCA 2A6XA 1DGRA 1W06A 1IZ3A 2R071 4AAPA 2RS13 4Y26A 1D4M3 2QQMA 4MGZE 2WZPP 4HVQA 4GXLA 2D44A 1OPOA 2HWD1 5BPXA 4DZGA 1LESA 4DNYA 1KGYA 4DUVA 3PNAA 2I07B 4L0PA 5FO8B 3ZYPA 1IG0A 1IS5A 2GC1A 4WM7A 1BBT1 5C9AC 5CBLA 1HDKA 2HWE2 4XC9A 1JYIA 4X6RB 5FZAA 2LW8A 2WN3A 3THTA 1YQ5A 1F4HA 5EJ1B 2VPVA 5C6CA 1XQNA 3CKHA 3PUAA 4R9AA 1FX5A 2JWPA 1RYYA 1MS4A 4Q4W3 5FO9B 2BGPA 3TEZA 4XMIA 1Q8QA 4IXLA 3KQRA 2E33A 5FPXA 2ZZJA 4XETA 4YFWA 4JGYC 4OI4A 1NZIA 5GZFA 2K9ZA 1O5LA 4GMP3 4NHXA 4XF1A 4UFIA 2ZX0A 5A7WB 1IS6A 1GFF2 1V9U1 3NWKA 3D6EA 2RDSA 4UF0B 3ZM8A 5A1AA 5FKCA 3UJOA 4OFGA 1YUDA 4R9BA 2ADEA 2RS11 4L11A 1D4M1 2QFEA 4RFRB 2O8OA 4TWTA 4EN0A 2DTWA 3SITA 4GALA 3I2JA 5IT6A 2R043 2CV6A 2J42A 2WNOA 1ZBA1 5AVAA 2C0ZA 3RPQA 4RD7A 5BNOB 1H8TB 1PGW2 3APBA 2VR4A 2Y26A 1AL0G 3T4VA 2WSUA 1RUD1 1GQGA 2YBPA 3KGZA 3MFAA 1N3PA 3N35A 3MLJA 3Q8FA 4LBJA 2NPIA 1OQDA 5FTTC 4CDWA 4CDUC 5EPAA 4FAHA 2H0BA 1HJGA 2FDHA 5FREA 1UN1A 2ARXA 2W52A 4N53C 4AHWA 4Q4W1 3VKLA 5JI9A 4TTGA 4K3UA 4PLOA 1LGBA 2GC3A 2QDRA 1CJDA 1H1MA 1O6UA 4WZFA 1IHMA 1NZCA 1W0OA 2YC0A 4JKKA 2D3SA 1K12A 4KGGA 3KGLA 4GMP1 2CHHA 4IQPA 3D0JA 3I4IA 4ORFA 3VKNA 1W04A 3JQWA 3ZSLA 2NQYA 4WZCA 1VBB2 2XOMA 3O1PA 2PELA 2P17A 1UIKA 3GDBA 2BVBA 3Q8AA 1CWPA 4XOGA 1RJ8A 3AP5A 3ZYFA 2P34A 1WWYA 1DBNA 1RUJ1 1UY2A 4A3ZA 1NLRA 4XF3A 2WNVA 4Y1XA 4TN7A 1MZFA 3T0AA 1RXGA 4Q4X3 2E7TA 4EQVA 3DPRB 3SISA 3H3LA 2XBO3 4UXAA 2YBSA 3AJZA 3NVCA 2D6OX 4AI1A 5F7UA 4XFBA 4XUPA 2XL9A 4JX0A 4RN5A 3WW3A 4YW3A 3OPZA 2CU5A 3UKNA 2VCCA 2ARAA 3S5QA 5IFTA 4BB3A 3OD0A 2DCZA 5A3NA 1KEXA 3C8XA 2EVXA 3LOBA 4QX3A 1RUF3 4Q1RA 2VGDA 3SEPA 4BMBA 1DDLA 1PVXA 1UZZA 2X09A 1B09A 5FCCA 1F5FA 4ZU5A 3TEXA 4ZY9A 5L36A 1S4CA 1DQ1A 3H1YA 4W6YA 5A70A 2Q1ZB 1RVF3 4W65A 4WM7B 2SBAA 4AI9A 5H9PA 3VBUA 2WA3A 2WZ8A 1TME2 3CLPA 3NV2A 5C3OA 1QXPA 4FPCA 4PLNA 1W28A 4CPBA 1H9WA 2ORZA 1Y3TA 2PHDA 5F6KA 3LFMA 4Q4X1 5FXZA 5IFPA 1N3QA 4RR3A 5FUNA 5IJRA 3ZFEC 2XBO1 5IK5A 4LT5A 2V09A 2DCTA 1ZNPA 3I3MA 2YG0A 4QU1A 4IESA 1JHNA 1OOPA 3X29B 3ZSKA 4B1LA 4CU6A 5FZ9A 2JD4A 5IK8A 2XQXA 2PHTA 3ZIXA 2WS93 3LSEA 2D6PA 4FPJA 2WFPA 1TE1B 2YU1A 1FV3A 5FZ7A 4P00B 4AFBA 1NQDA 1RUF1 3H1WA 3K51A 4LLOA 4KMQA 5JLVA 3N9OA 1DQ4A 3ACLA 4FPOB 4O61A 3CIHA 2IZWA 1YFUA 1QKQA 4P9JA 5GALA 1W9TA 2OT7A 4DB5A 4LE4A 2OS2A 5DABA 1C1FA 4TLGA 2QUOA 4ATEA 3H8OA 1RVF1 3V0BA 1NA1C 1CZVA 3WG2A 1OHFA 2DU0A 4D3WA 4P5YA 4AHZA 1CAUA 4A3XA 2FDGA 1DF0A 3AYAA 5CKMA 3VD5A 4CDWB 2Y8KA 3RZMA 1U0AA 3E5UA 3KF3A 1VBE2 2Y6JA 2WQ8A 4X8NA 2TEPA 4CU8A 1CZSA 2E51A 2XKOA 4QX0A 4YZ2A 1J3PA 2WLQA 3WQBA 1CAXA 2O1QA 4XAEA 2VMDA 2WS91 4P9YA 1A3KA 5FY4A 3LEIA 3LA7A 3ZDSA 1FPN3 4XCAA 1HW5A 5LB6A 2NYYA 3D3AA 2VD7A 4FP2A 2XH6A 4AAXA 1MS5A 3NAPA 2D3PA 1ND2C 1PX3A 2WABA 5F5IA 1FXZA 3MICA 1NLSA 2J1EA 4DEVA 4QQLA 2A3YA 2IUWA 3ETPA 4FFFA 1GOGA 2A6WA 2WNVB 3WG4A 5CKNA 3RNSA 2DFCA 4FT8A 4BZ4A 3SXWA 1NXD1 2JB4A 2BBVA 1ND3A 3LEGA 2R6QA 1IPJA 4JDOA 5IYYA 2VUDA 4QHBA 2DDUA 2AEYA 2QQVA 2VNGA 2XVGA 2C6SA 3I2FA 4XDPA 2RJ2A 1OFNA 2ETEA 4HONA 2BBAA 1LOFC 3EQEA 4Z07A 1JTZX 1F31A 3AVRA 3RS6A 3ZXAC 4W6WA 2JIGA 4UYBA 2E32A 1FPN1 2VTXA 3PVEA 3GNEA 3HEIA 3I2IA 5DZEA 3ELNA 3VHNA 3H0OA 2JDKA 4FPHA 1WGPA 3IDCB 3JD71 3AX4A 4NJ4A 4DINB 5FZMA 5LEKA 1LHOA 2QDNA 3A4UA 3GBWA 1W8TA 1AJOA 2HBUA 2EALA 4GMP0 4HL0A 2A7AA 3NNLA 3VBUB 5FP3A 4DY5A 2EICA 3LIGA 4PCRA 5A1LA 5IK4A 4TXWA 4PHZA 1TMF3 4TYSA 2RG4A 1O4ZA 4RR3B 4CP0A 4JVAA 3CMGA 3U4XA 2XWBB 1OOPB 1LOCA 1EPWA 3SCFA 4A42A 2OIIA 5FZHA 3RSJA 1QH6A 3KT4A 3R4SA 3VD3A 5EYYA 5IAXA 5IVBA 1SCRA 1EP0A 2JDUA 3DYMA 1R64A 2WNUC 3RYKA 3PTYA 4XBQA 3K77A 1COV3 4LKSA 4BOWA 5FYIA 5ANQA 4OVEA 4QPIC 3J9SA 1PM7A 2F17A 3AP9A 4CDXC 3DYOA 1PNFA 4ISRA 3S30A 5C8CC 2QNKA 2CGPA 1BXHA 1MVQA 3OGRA 4XHBA 1SLIA 3V0BB 5I8TA 1G9AA 1HV1A 2PA7A 3F95A 3KV6A 5FLJA 4XFHA 3WZ1A 3B00A 4XUNA 4B7KA 4ZZ5A 4BQ4A 1D2SA 1TMF1 5BNNC 3EJKA 1GZ9A 1GZWA 4MYEA 1W6NA 1OUXA 2AH2A 5IUQA 4OHYA 1S0JA 1CAXB 2WT2A 2Y64A 4XW3A 5DDJ3 3ETQA 3Q8BA 2DVBA 1ZBE2 1G6NA 2WBKA 3MIFA 3K2OA 3ZXLA 3LDKA 4NIIA 1COV1 4BMEA 4DEQA 5LBFA 1XNTA 1NCQC 4E8DA 3NAPB 4NPLA 4XTPA 4GULA 2V73A 1ZZCA 1NUKA 3KS7A 3U37A 1MZ6A 5F3IA 4Q8LA 1GNZA 3I2GA 4IEYA 4AHYA 3IDBB 1MEC3 2B45X 3FFZA 3QLQA 4LEJA 2W91A 2WINB 5EZWA 4YYOA 5FY5A 3PUQA 2PAKA 4YLZA 1W3XA 2W1QA 2PAMA 3MIEA 5GM0A 1OA3A 2YC4A 3KF5A 2E63A 4NPMA 2QQUA 1ND3B 2RDNA 3M70A 3D8CA 3WDTA 2AREA 4D7TA 3ACFA 1X8EA 2ATFA 4IGPA 2WSVA 5FLHA 5FXVA 3ZN5A 2OVUA 1JHJA 4DXRA 4LXLA 3POBA 4JTOA 3VBHC 3UETA 3POWA 2HWD2 5DDJ1 1G7YA 3PIJA 4YM3A 3A7QA 1BBT2 1JZ8A 2VNRA 1FT9A 1X9PA 3GBFA 4K6BA 5IVEA 3TB0A 4EROA 4ET7A 3A0NA 3P1IA 3WP6A 4BCUA 4FPEA 1ZZ6A 2GMEA 2BP6A 4QKFA 5BXXA 4OUEA 4YZ3A 1MEC1 4LHSA 3A21A 4CCMA 4Z2WA 4BISA 3W5MA 4GZ9A 5DMYA 3ABZA 2Z42A 1PZ9A 4L9BA 1ACCA 1KJLA 1Q8VA 1V9U2 1W6PA 5FZGA 4AVVA 2V4VA 4YVWC 1CAWA 1BJQA 4LKEA 4DMIA 4AVAA 1IQDC 5D2AA 2P4EA 2ADDA 3WQ0A 5LW9A 2CGNA 3MIBA 3VDDA 4FAGA 1R083 3VBRA 2X29A 1D4M2 4MGKE 3I7DA 4AXOA 4J1XA 4XF4A 2EA7A 4GH4A 5C70A 3WW1A 1CJPA 4EZ4A 2A1XA 4NIAA 3GYDA 2IFRA 1OUSA 3IZOA 2H6BA 5A7QA 5L9RA 1CESA 2FMDA 4LO8A 2HH9A 4LNVA 3VHOA 1KFUL 3ILRA 2QQWA 3I97A 3THCA 2QQKA 3WF0A 2VZ3A 4HN1A 4CDQC 4HBNA 4QQ2A 5A3UA 2O0OA 2VW2A 4U36A 5F2WA 4XILA 3AP6A 4XXAA 2WZR3 2DVDA 4Q4W2 5FPAA 1CX4A 4H7MA 4JHTA 2P3JA 2WZEA 1UAIA 5CFDA 1XRUA 5GJ6A 1ULGA 1OD5A 4FXKB 5H9QA 2RS53 1A34A 3WEZA 2DTYA 5DAVA 3UESA 1OKQA 4LHLA 1GZWB 3ZFFC 4F83A 3NNJA 1W6NB 3NNFA 5F3EA 5FMCA 5ABJC 2PHLA 1R081 2R7EB 2VOWA 5FZ4A 5T54A 3MF9A 2X5IC 2RMU3 2JICA 3OUJA 1ZREA 2R042 4YM2A 2JG8C 5JI7A 4I0AA 3WQ1A 2X10A 1BVVA 1HXS3 1SLBA 5C5UA 2GDFA 4PDWC 1UXZA 1XPWA 4MHRA 4YGBA 2D40A 3WSOA 4BQ1A 4NHYA 4P5HA 1VBB1 2VMIA 4LBNA 5F2SA 1TQ5A 1J83A 5FPUA 1QJU3 4XFAA 2WZR1 2WRAA 4I30A 1SQ4A 2D93A 4KWUA 1LNSA 1K45A 5AC92 1W9WA 4BLJA 1QGLA 3N7MA 2FMYA 2A6ZA 1CD3G 4XAAA 2RS51 3R6SA 4AR2A 4JDMA 2VG9A 4W6XA 1W9SA 2HJIA 1DHKB 3LFIA 4JQRA 4CP9A 1D2QA 1O7FA 4YW6A 1VJ2A 1W6MA 2B42B 1Y7BA 1RUOA 1H4HA 5J09A 2RMU1 4RFT0 5DZGA 4B4RA 1OSGA 1SFPA 5LA0A 3WX5A 2ZX4A 5F6LB 3FL7A 3WNKA 1J3QA 4BXSV 1HXS1 2XJTA 1VPHA 3IN9A 1B35C 1VP6A 1OD3A 2GH8A 2CY6A 2EXKA 4Q4X2 4BQ3A 3OG2A 5SV8A 5JZGC 2XBO2 1T6GC 3PJYA 1GSLA 5JSRA 4AFAA 3WNMA 3M2MA 2VE1A 1QJU1 4COUA 1QJZA 1V00A 1ZX5A 4AGVA 1TG7A 1I5ZA 1ODNA 1TME1 1UOJA 2ZCWA 4UW5A 2B9VA 5A7PA 3ASIA 4S2DA 1W6PB 3MYXA 4ARXA 2DCJA 1OLRA 1CAWB 1RUF2 3A23A 2BNNA 3ACIA 2IC1A 5HCFA 5FWEA 2ZX1A 3VDDB 4PQQA 1VR3A 5CA6A 3VBRB 1O5UA 1NE4A 2K0GA 2VC9A 4GH4B 1FYUA 4LJHA 4CEYA 5JOWA 1RVF2 3I3DA 3IB3A 4LA2A 5A7SA 1JUHA 3VV1A 1XNAA 1OVSA 4RS5A 3AFGA 3RI9A 3AKRA 5HCBA 3OY8A 3MIDA 1J1TA 3DYPA 2Y0IA 2PHRA 4CCLA 2CSGA 1SBEA 5FY0A 5T55A 1EY2A 3OYWA 4AI8A 1VIWB 2VO5A 3MW4A 3K75B 5EFUA 3W59A 1Z7S3 3HIFA 4Q27A 3H42B 3K48A 5FZFA 3THPA 4QX1A 3CJXA 4NHLA 3SEEA 4AEJA 4WM8C 4XYXA 4BIOA 2YY1A 1W8WA 1N47A 1OH4A 1GWKA 1Q8SA 2DYCA 3AL5A 1J59A 3WDUA 5H9SA 4Y24A 5FZOA 2WO7A 1OMIA 4FSJA 4OLLA 4BK4A 2JG9A 3BPSA 3ORJA 1JU3A 3DXTA 3FFQA 5TSWA 3ZKYA 1S1AA 2YZ4A 5FK8A 1W8FA 4CA9A 2Y6HA 4EN6B 2QQPA 4DIQA 2VVDA 2Y38A 2L9LA 5FMDA 4PQ9A 2VCBA 1ENXA 4UW3A 4HK9A 3OSDA 2HEVF 3OEAA 4I0BA 5JPMB 1AZDA 1W0NA 4RGGA 3ZLIA 2FDFA 2JB8A 2PHWA 2C4XA 1Z7S1 1FPN2 1DYKA 1WLWA 3OBRA 3BU7A 5HBAA 3VHPA 4C0HA 4CP9B 1JYTA 4YGDA 2VBBA 2R49A 4AYUA 3POSA 1W6MB 3W9AA 2BOIA 4MV2A 3ZFGC 1WUVA 4A45A 3VN4A 4C0BA 4LHNA 5FRAA 2HWF3 4QB2A 3GALA 3BALA 4NVPA 5B4NA 3ZVXA 3OOXA 4UAPA 2JDYA 2H6CA 3FX3A 4JDNA 4XZPA 2IXCA 2VZRA 5AFEA 1XNBA 2R063 2A71A 3JXSA 3AKTA 5I0TA 4GWNA 1O4TA 1OI6A 3M3IA 5KHJA 3LSDA 5J1XA 1DGLA 2W1SA 2DUQA 2EXHA 1YRZA 3SH5A 4Z92B 2PHFA 1E5IA 1J58A 1WLDA 1UMIA 1JODA 3BB6A 4K20A 2UWBA 2GSYA 3TYJA 2QQLA 4L92A 4Y5TA 4OQ8A 1Y4WA 2K46A 1LENA 1VRH2 3I49A 5FPLA 4NIDA 1GZCA 1XBFA 3D0SA 3MIHA 4XJWA 4V1PA 1NQJA 5LA9A 3VL9A 5JOYA 1PX4A 2DVAA 2JDMA 3OBTA 4CEYB 2ZEWA 3MIGA 4QHOA 4PBOA 2BVVA 2ZHKA 3HNYM 3O14A 2MEV3 3VD7A 1RMU3 3C7HA 1AR63 4RS5B 4XF0A 2BWAA 2TUNA 2D5HA 3OY8B 4UFJA 4NRQA 1O4YA 2R061 2CGOA 5JVVA 3S7IA 4YZ1A 3RWKX 1JS9A 3PMSA 1E5SA 5CG9A 1BKZA 4XJ9A 4IEUA 4XJUA 3OYWB 5EP9A 3Q8CA 3KT1A 1PGL1 2DFBA 5AC93 1HJFA 1RUG2 5IVJA 3E6CC 1ZZ7A 1LOGA 2AACA 2HBTA 4F8AA 1COV2 5LASA 3ZXDA 2QCSB 5C9AA 3N9LA 3VD9A 1WMFA 3GM8A 2X8KA 5K7PA 2CDOA 3W5NA 3POFA 1HRI3 3LAGA 1O8PA 4QDRA 4XFGA 3DECA 3C2UA 2P3IA 2F4PA 1XB9A 4N9HA 4UW6A 4C1WA 3I2HA 3DKWA 2WDBA 1OH3A 2JG9B 4TSVA 4A7ZA 4X6QB 1KXGA 1HB3A 2MEV1 2YDEA 4QB6A 4IETA 2ZAAA 1YYNA 3OTFA 3K4DA 4LKDA 1AR61 3CU7A 4ARYA 4H3WA 4LOTA 3I3BA 3R0RA 3HJRA 4Q0QA 1MQTC 3T4HB 1NT0A 4NAMA 2G4IA 3UKVA 5F5CA 2YPJA 5FYTA 4FOWA 3JU9A 3TRSB 2CYFA 4IE4A 4UFKA 3ZSEA 5DDJ2 2VMGA 3J7HA 3KZ4C 2B9UA 3LDBA 4H14A 2BGOA 5IVVA 1YFYA 1XU1A 5KBFA 2VOTA 1YQCA 2E9QA 3LPGA 3CZJA 3O12A 3POYA 5FYVA 1V6OA 3OCPA 4BLIA 1ULDA 1VB4A 3WP5A 3B02A 1RC6A 2OXBA 3JB4C 3LD8A 4QX2A 4DY3A 4IEXA 4BIFA 3KCXA 4AEDB 5GLWA 3KHBA 4CDUA 4XE9A 4HANA 3WF1A 1HB2A 2ES3A 4N53A 1MEC2 4OQ9A 5DUXA 4KWLA 5DAPA 5FUPA 4YM0A 3K4AA 1AR73 3HMYA 3ZN6A 3VLBB 3KWVA 1LGCA 4SBVA 4OHXA 3VKOA 1R1A3 4Z1VA 1KQRA 2GALA 3IM0A 5ERLA 4CCJA 1KS4A 4COZA 5I93A 2ZGSA 1H8TC 1KD7A 1X7NA 3H7YA 4XVHA 4BJ0A 4RL7A 5CADA 2OW4A 2X05A 3OBZA 1ENSA 4YVSA 1WW6A 3EMRA 3M4FA 1GUIA 4CVUA 5JXIA 4IE7A 4XUQA 5FZ6A 4EE2A 4HG6B 3UGFA 3QH7A 3UNPA 3N7KA 1QJY3 3KVBA 2P2KA 5EWSA 1YEWA 4Z2AA 4HPKA 2JDNA 2V5YA 4EYUA 3U14A 2HYXA 4ZZ8A 2XG3A 3CJIC 4NRPA 5DAQA 2Y6GA 2W0XA 1ASJ3 4ASKA 3L2HA 2ZZQA 3AMQA 1UX7A 3U78A 1RL3A 3U10A 5DUWA 5C3QA 3PVOA 4B29A 4O65A 4V2VA 5FYUA 2P3KA 2Q30A 1AR71 1PZ8A 3RVHA 5LRRA 3CQOA 1W99A 2VZPA 3ES1A 3HT2A 5BY5A 1N1VA 5LZ6A 1R1A1 4HZFA 1WBFA 1D4VB 4HOOA 1YJLA 1XXNA 5EYXA 1WCQA 1R082 5H9RA 1AYM3 4HETA 3CF6E 1SLCA 2GNMA 3I54A 4A7YA 1NLQA 3DEMA 4FBFA 1AJKA 1BYHA 1CONA 5I0DA 5C9AB 5A80A 1QJY1 3C3VA 3LZZA 2JE7A 2J1VA 3NJZA 4LKFA 3SKVA 1UPSA 1LHWA 5DPNA 3HNBM 2FDJA 2W08A 1F4AA 4W50A 1YI9A 1UXXX 1SACA 1ASJ1 1GANA 1ALYA 1UQXA 3FUOA 5FZ3A 3ZFEA 4B4QA 2LUWA 1GP5A 2GMMA 2WZR2 1AYN3 5A6YA 5FXXA 5GKAC 4MH0E 3AKQA 2R041 2VQUA 4HK8A 1GQHA 4FPGA 5GZGA 1OF3A 4E2GA 3SMHA 2DBIA 2SLIA 4DFSA 4D94A 4WM7C 4CXYA 2ZXQA 2RS52 3NJVA 1WBLA 4FTEA 1KRIA 3T30A 4XACA 2VBPA 1JH5A 3AZZA 3IMMA 4IV1A 3AJYA 1ENRA 3O1SA 1IGOA 1FAYA 4XFFA 1AYM1 1U5IA 2RMU2 4K8RB 4L97A 4XQWA 1S0BA 1ST8A 3LPFA 5AC91 2W87A 1ZRIA 2IXIA 4CU9A 1HXS2 1IOAA 5FZCA 1JYNA 1IG3A 1YWKA 1W90A 1SFYA 3VBSA 3PTRB 1H6XA 4N53B 1QJU2 2C24A 4LBMA 2DVGA 4LK7A 1AYN1 2FCVA 3VZJA 3ZN6B 2I45A 2XB6C 2IVIB 3V65A 4HMZA 4RQPA 1LOAA 2IXHA 3MUZ1 2VH9A 4AFCA 1F35A 3RJ2X 1EUUA 1UU4A 4AG4A 2AGSA 2JKBA 2ZHLA 5GLTA 2QJVA 4YVSB 4CDWC 5J7MA 1ND2A 3JZVA 2RJLA 2R1BA 1LHVA 2OX0A 3V56A 3ZOIA 2AUYA 2ZGUA 4CUBA 1UU5A 2VUJA 2HWB3 3IKWA 1DLCA 3POGA 4S2HA 3ZXEA 1QH7A 4HPKB 3AKPA 3HR9A 1YIFA 4S2FA 4A2UA 5KXEA 2J1AA 3VZNA 2PTMA 2C9KA 4H55A 5FFOC 5EJ3A 5KXBA 5FP4A 4I02A 1DCSA 3J4UH 1JN2P 5I8SA 3VBOC 4MO3M 4BQYA 1US3A 2HWC3 1Q43A 3NV4A 3CNAA 4IEOA 2IXKA 3ZYBA 5FWJA 1LOFA 2PHUA 1S55A 2XLGA 4MXWA 4N7UA 3IMNA 1U5YA 2ET7A 1LHNA 1SDDB 1G9CA 1CR7A 3ZIWA 3O1TA 1JOPA 2DCYA 4Z8BA 4LK6A 4QAWA 1EAH3 4RHV3 3TOJA 1UY4A 2JIJA 2XLAA 2IVJA 4JAAA 1QQP2 2VCMA 2W46A 4JGZC 3WHTA 4F7ZA 2YUEA 2ENRA 2BRTA 5LATA 2HWB1 5FYHA 2DU1A 4J1WA 3WV6A 4AE2A 5A6XA 4MG2A 1US2A 4AW7A 4Q0PA 5A3LA 2XDVA 4LR4A 3ZFEB 2GP5A 4EN7B 1H2LA 1LCLA 1LOBA 2ZA9A 4RGKA 5LBCA 5L19A 5JR2A 3ZKUA 1AX0A 1KDMA 3H9AA 3KMHA 2HWC1 1RB8G 1XSQA 5EJZB 4LUMA 1UKRA 2E6VA 4E4DX 1O3RA 2HEWF 4FPYA 1Z7S2 5KHHA 2Q0AA 3PUHA 5L9VA 3TN93 3HQXA 3SHRA 3UT0A 1W0PA 4Y5SA 1GP4A 3WUCA 3HN1A 4IV1B 5ISLA 4QPIA 3WNPA 4MGQA 1JZ4A 4RR3C 1W2NA 2J22A 4JZRA 1BMV1 1NCRC 3LB9A 4EWDA 1EAH1 4GWJA 3WDVA 4RHV1 2GH2A 1ULEA 4FTBA 3HN3A 5C8CA 1OOPC 4J25A 5FBZA 4XHXA 3T1LA 1ZRCA 2JECA 2XLFA 4LMFA 3VB9A 5F3CA 1VRH3 2WC2A 1OLQA 2OUHA 5FY1A 1ULPA 3UK9A 5LBBA 3VBSB 3USUA 5LA2A 2D43A 5BNNA 4HVOA 2J1UA 3IIAA 3ZN4A 2K2SA 2YB7A 3AZXA 4M0NA 3WG1A 5GZCA 4RQPB 3L9JT 3SCGA 1OLME 1Z78A 1YO8A 3IPVA 4N90A 3NJXA 5F37A 3TN91 3PLQA 1NCQA 2YYOA 1G9BA 2RDRA 4CCEA 4CEWA 3ON7A 1ND2B 2BNMA 3BPZA 1DZQA 4ES9A 3O1VA 2OZJA 2WQZC 1ZYBA 3B7MA 5FO7B 4CUCA 1LJ7A 1JXNA 3R05A 1RUG3 1Q8PA 1OF4A 1QJEA 1S0GA 2HWF2 3JB8A 1SG3A 3THDA 2Y33A 2EIDA 2D98A 1TVGA 3M3OA 1A8MA 1QU0A 3BN6A 1VRH1 4AZZA 3HNMA 1W8OA 2R062 3MO4A 3KLSA 1N1YA 2HLEA 4M4RA 3BODA 3WR0A 3RDIA 4MZUA 3J7NA 4UT5A 2R0FA 1AXKA 5DG2A 4CUGA 4E4SA 3HBZA 1CAUB 5FY9A 4FOQA 1YQ2A 2XHKA 4MXWB 5C7GA 4UOJA 2WA4A 3GZTB 3ZXGA 5FOBB 1UMHA 1V70A 3ZXKA 4LULA 5BUVA 5LA1A 3H8RA 1UU6A 3RZJA 2QQJA 3HVDA 4FQ4A 3INAA 1SHWB 3USSA 4QGMA 4NOTA 3AM2A 3HAGA 2Q8OA 4ZKTB 2VY0A 1RUG1 4YNIA 2VU9A 3NNGA 2MEV2 4I09A 1ULCA 4XQDA 1GNYA 1LGNA 3LA3A 1RMU2 4QKDA 3AVSA 1AR62 4I3PA 3RYPA 3VBFC 1G9DA 2JE9A 2BFUL 2RV9A 5E88A 1GOFA 3S7EA 2IWGB 3EB7A 3I59A 2WUHA 2ZTNA 1C8M3 2Y6FA 3GZEA 2C1FA 3VZLA 2G1MA 5C4WC 4QMAA 2PAEA 3SKJE 5K0UA 3DUIA 3ZDVA 5J36A 1U5XA 3J26N 3GHMA 3I3QA 1VRBA 4ZHNA 1DQ6A 1CIYA 3QD6A 3FJSA 4QPIB 2UURA 4NPRA 4U2AA 4WV8A 5LCWL 3S0MA 3KCCA 1IKPA 2KXLA 4CDQA 1HN1A 3AYDA 1HRI2 3CO2A 4NAOA 2BU9A 3N36A 1UL9A 2G19A 3O0VA 4E9KA 3BTYA 3I2DA 4CEWC 3AL6A 5CB7A 5C8CB 5KWRA 1JYCA 2GC2A 3N7JA 4CP2A 1VBC3 1WLCA 2JDZA 1AF9A 2J1TA 4D0QA 2ZS6B 4GQ7A 2YGMA 4BPZA 4AL9A 1S0DA 4Q0SA 1K5MC 2Q5TA 3BOWA 1JU4A 2D3RA 2EF6A 4EZHA 1PZ7A 2CDPA 3RI8A 4IW3A 3USUB 5BNNB 2R0HA 1Y9MA 4IL7A 4M0HA 3RFRA 3DF0A 5DXDA 3U4SA 2E7AA 3ZFFA 3M3EA 5C3SA 1V6IA 4YGCA 5A1FA 5FAXA 1C8M1 2XKPA 5FIXA 4UFHA 3O7OA 3JQXA 4Y4RA 2X5IA 4DQAA 1PGL2 2PN5A 2BWCA 3IPVB 2JX9A 3J7LA 1BQPA 1AXZA 4QDQA 4KQ7A 2JG8A 4BH9A 3WCSA 4XIOA 5ACA3 1NCQB 1PO23 2VBDA 3WW2A 5DG1A 5A3PA 5GZDA 4CEWB 2GZWA 2Z2SB 4IV3C 5JUVA 5FZ8A 1UZ0A 2FZ1A 2ZGMA 1STMA 3HQUA 4XCBA 4LPLA 1T6BX 2JDHA 1VBC1 2YGLA 1W8ZA 2D6NA 1AR72 1WCSA 1YJKA 4M4PA 1LKNA 5A33A 5K8SA 1R1A2 1GYKA 5E6HA 1OA2A 4YWAA 3VKMA 4NWVA 2XJSA 1L3JA 2WKKA 3IDAA 3ST7A 5JCTA 2YROA 1UPIA 3N9PA 2IXLA 4K21A 4QXCA 3OGSA 1K3IA 3Q9OA 1AXYA 1AUYA 1N3OA 2A70A 1YLLA 1OURA 2P3YA 5FR3A 1MS9A 4H2AA 5A3OA 3MGUA 1AL23 4E2QA 1UW8A 1M06G 1QJY2 1PGSA 3G6JB 5ACA1 1DGWA 1QJX3 1V6KA 1PO21 2J1RA 4Y20A 5IVFA 1WCDJ 3OGVA 2RE9A 3FLRA 1ASJ2 5JZGA 2EAKA 4WVMA 5EQUA 3TEWA 5DN2A 3IBMA 1C28A 2WAOA 4UWDA 1YQ6A 2EIGA 4QX7A 5G05L 1AX2A 3HBKA 2F4LA 1WMEA 5LY2A 2WWUA 3R4UA 1ENQA 4HSJA 2IXJA 4K8FA 4XTMA 1XSRA 3I59B 1XOYA 4Y33A 5FY7A 3T0DA 4Q1PA 5FJKA 1AYM2 4UW4A 2Q1MA 5K0UB 4NRMA 2XJRA 2B46X 1MACA 3VUOA 1AL21 2BUKA 4LO6B 4QXHA 5F3GA 4ISQA 1W8NA 4QDSA 4CDQB 5J48A 1QJX1 4PF1A 1RUC3 1BVP1 1SLAA 3SNMA 1GKBA 4AEMA 1OQ1A 1W9FA 3M1HA 3M8LA 5CNAA 4AFMA 3W21A 4HKOA 1GLHA 1UY0A 3UYJA 2BPA2 2XONA 5CISA 3VZOA 1MS8A 1AYN2 3BTAA 2VVFA 4LUKA 4Y22A 2XR4A 1XU2A 3B93A 4AVSA 2AZ5A 4GH4C 2WYSA 5JSOA 1WA6X 1GBGA 2RR13 1H1IA 2BDRA 3LQCA 2E26A 5HCAA 4NROA 3ZFFB 3OGGA 5BYNA 2DUOA 2W3JA 4R4XA 3N4MA 5CG8A 3OB8A 5DUUA 4DXZA 4QM8A 1RHI3 1UYZA 1EPZA 4RA0A 1GV9A 5LEJA 3NSTA 5BNPC 2JJ6A 2E53A 1YFXA 4LO4B 2JG8B 2CTVA 2VMHA 2J1SA 1OT5A 2VOXA 1U5ZA 1DLLA 4MGIE 1ZZBA 1W2AX 1LB2A 4DUWA 5FZBA 2PHXA 3P3PA 3RZZA 5HV4A 5C71A 2VOKA 4QQHA 2Z4FA 5C8WA 1QQP3 2FD8A 5T5LA 4CXWA 4Y1ZA 4N43C 2W95A 2DBNA 1DZRA 1OXCA 2WO2A 3ACHA 4HLTA 2A73B 5BNPA 3RZLA 2RR11 3GJAA 4FFIA 1QOTA 4QPGA 2Z5WA 4V2WA 4OI2A 3K3OA 4N9IA 5IVYA 4CUAA 3E5XA 3PJQA 1ZZ9A 4LITA 4AI2A 3VDCA 5DAXA 3ECQA 3ENRA 4QT6A 5CFDB 1RHI1 4AQ2A 3NV1A 5KXDA 3QOPA 3POJA 1LOEA 2ORXA 5D8AC 4Q4Y3 2BJSA 1MPXA 1TZOA 2R30A 4IE0A 2LROA 2HWB2 3AKSA 3KB5A 2ZBJA 4OHWA 4Y20B 4YRDA 5FP8A 1V0AA 1WMXA 4LBQD 1L7RA 3O1RA 2VZTA 2C26A 5CKQA 2EAAA 5JZGB 1F8VA 1S2EA
chains in the Genus database with same CATH topology
4XEZA 4XJ8A 1QQP1 3TAYA 2UYBA 1DGWX 2ZMNA 2HWC2 4EV0A 2C5DA 3AZWA 3H50A 4XJZA 4EJRA 4XIKA 2QVSB 2OUJA 5J3UA 3M7AA 1WCKA 2CL2A 5AFBA 4HN0A 3D4KA 1BMV2 2ZKNA 5GLUA 1EAH2 4RHV2 1TEIA 1PK6A 4ZXKA 4Q4Y1 5T5JA 1QNWA 3NW4A 4OUMA 1SBFA 1X36A 4YG3A 4MXVA 4QGLA 5CFCC 2FQPA 4FXGB 2ZGRA 1Y43B 1V6JA 3O5SA 4YW5A 1PNGA 4Y22B 4O9GA 3AB0A 4OULA 4FCAA 5JSPA 2Y0OA 1VB2A 5T52A 4CZSA 3KSCA 1FMD2 1MZEA 1G86A 4P9GA 1C1LA 1ZRFA 4IERA 2TBVA 1URXA 2ZX3A 3TN92 2ZHMA 3O0XA 1HLCA 1V6NA 3AXEA 4BM8A 1Q3EA 4KU7A 1RINA 1NYWA 3FBMA 1J1LA 3V64A 4Q4V3 1VBD3 3FLPA 4QGNA 4AQTA 4LLFA 4B4PA 1D0HA 3MEPA 5DUVA 1MQTA 4PBPA 1VLNA 3HD8B 3ILNA 2HWF1 5J37A 1WA4A 3FWEA 4R9DA 5BNPB 2VW0A 1HRV3 1S0EA 4QPGB 2LM3A 1RJ7A 1CVNA 4Q8KA 1RUI3 2CWSA 3WINE 1DQ2A 5T5OA 3WLUA 4FVVA 4QU2A 1BEV3 1Y9QA 4Y1VA 1TNRA 5L7OC 2KA3A 3EBRA 2ZMKA 3M3CA 2VQAA 4JCKA 4MUVA 2DVFA 4Q4V1 1X50A 1VBD1 2Z79A 1NOVA 3SH4A 2UU8A 1HV0A 2JEMA 3ZMOA 3E5QA 5F1RA 3UKTA 4OHZA 2WFF3 1PO13 1RUE3 4JGYA 4X8PA 1RMU1 2BTVC 3ILFA 1HRV1 3MPPG 1H2MA 3GHNA 4I3GA 2OA2A 2ZJCA 3DGTA 2A3WA 3CJIA 1RUI1 4XBNA 2NMOA 2R073 2H0VA 4UBGA 2XJUA 2UYAA 1PK6B 1SDWA 1YNAA 1JBCA 4QQPA 5I0RA 2VECA 1CN1A 1BEV1 4KWJA 1FOD3 1ZVFA 3AP4A 4AHXA 4YZ4A 1X33A 2G9GA 1HRI1 1VAKA 4NWWA 5J98B 1X82A 1C8M2 2O8QA 1JUIA 3DN7A 1PIV3 2WFF1 3QACA 4HVRA 1PO11 1HQNA 1REDA 3OD4A 2B39A 5BNOC 2RS33 2VULA 4AEDC 1WD4A 4CRQA 1U12A 2R16A 3JCIA 3A0KA 4AQSA 4BE3A 3SLIA 5KC6A 2N7GA 2VQ0A 4J6GA 4L99A 1VBC2 1O91A 1WD3A 3NV3A 1PGL1 2FHRA 4K1ZA 5IK7A 1WMDA 4N7IA 4M3CE 4Y1UA 4AFDA 3ES4A 3EXUA 1IKQA 1ZBA3 3DL3A 1FOD1 2UY8A 4YSFA 4C91A 5T50A 2ZGNA 1I6XA 4L8QA 2AR6A 1XE7A 1RUD3 3N7LA 4KBBA 1MQTB 4MSVA 5KHGA 3ZMNA 3RG0A 3MZHA 1PIV1 3M3QA 3WY6A 3U11A 4GB33 4OZXA 4LA3A 3D82A 1OFSA 3WW4A 5J96B 1I9RA 1Q56A 1UZYA 2RS31 5ACA2 1PO22 5EXOA 1YCIA 3BOPA 4PJYA 1LU2A 3DPRC 2IFWA 2WLPA 1M4WA 1PVC2 5CAZA 2GNBA 4HT1T 4COWA 2WIIB 3V0AA 2D5FA 2UY9A 2NP0A 2E7QA 4RGAA 5GLVA 3ZX7A 1RUJ3 4P9WA 1ZZ8A 1V6MA 3MF6A 2EXIA 4HFSA 3RQ0A 1W6QA 1LR5A 2P37A 4KL1A 1LEDA 1EV12 3AMNA 1H0BA 1UMZA 4A7KA 1DQ0A 1DGRN 1NXMA 2XVLA 1H4GA 4K40A 4JGYB 3H8UA 4AVTA 5JMCA 1AL22 1JW6A 4GB31 1WW5A 1YIPA 4BWOA 3RMYA 1I1EA 1QJX2 4B8EA 3CJIB 5JAXA 1FI2A 2D7FA 2DURA 2XJQA 3ZSJA 3PHMA 1LU1A 4NN0A 4XPVA 4YVSC 3VBOA 1QDOA 1ONAA 3RJRA 4PF5A 1NA1A 2XL7A 1QXJA 4QM9A 2B8MA 4CDUB 1OA4A 2HYKA 4Z82A 4YG6A 3LGRA 3WHUA 2ZOEB 1MS3A 2A75A 4JGZA 2B5HA 1LHUA 1VBA3 3ME2A 1CIWA 2WT1A 3LCPA 1C5HA 2GU9A 2DCKA 2GNTA 4COYA 1YI7A 1RUC2 2YV8A 1AX1A 3AFKA 4TLFA 2ZGPA 2QKDA 2X53S 4JRLA 4PIXA 3VZJA 3WP5A 5I0UA 4XXPA 4HKWA 4BLIA 3QH6A 4C1XA 1RUH3 5LK5A 1MR5A 1FATA 5F5QA 2CNAA 3LWCA 1NY71 4SLIA 4CP1A 4GKXA 2RR12 3GF6A 1POV3 3VZMA 4AGGA 1R1ZA 2WT0A 5C33A 3AMPA 4B3NA 1RITA 5LRSA 1REFA 2XUMA 3E6DA 1RHI2 2BGCA 3IT8A 3TNPB 5E8AA 1NCRA 4YM1A 3W58A 2VVEA 1EYBA 2ZKLA 1C4RA 1VBA1 3PVNA 2WNVC 1WW7A 4G9SB 3LOIA 1A6CA 4FPKA 1QOOA 5FMOS 5FOJB 4IV1C 1SBDA 4I2OA 3V0AB 4YW2A 2ZGLA 1J3RA 3KD4A 1RUH1 3N3HA 2WNEA 2ET1A 3JBG3 1MS0A 4URTA 3B5LB 1LULA 1W6QB 1XYNA 3AMMA 4AEKA 1POV1 4YFZA 2ZGTA 1IPKA 2PLV3 4QQOA 4M01A 4KU8A 1KDKA 1REEA 4S2GA 3VBSC 1S2BA 1SFNA 4JRAA 2MPFA 4OHVA 4QPYA 1FMD3 1OPMA 4Q4Y2 2WNUA 3H1MA 3VBUC 4AI0A 2WWSA 1HQLA 4RQPC 5FDBA 5FLIA 3WDYA 1H2KA 1C8NA 4CDXA 2HKXA 3VZKA 3VBOB 3B94A 3JD73 4YZ5A 1SEFA 4AVCA 1S2KA 3T1MA 3VL8A 4LBKA 1NA1B 1HIXA 2OPKA 4E2SA 3JBG1 5FMOL 3J8F2 4QX5A 2VW1A 3FBYA 2OYZA 2R1DA 1ZA4A 1AR93 3LKJA 4LBLA 5GLZA 4AQ6A 2PLV1 2FZ2A 2XPJA 4XJAA 4JGZB 4Q0UA 1D0GA 3WT3A 2BQPA 4FQZA 2B7YA 1FMD1 4HSLA 4AGRA 4QD2A 3DV8A 2XJVA 5JIUA 3VBFA 4YW4A 3ZYJB 3AYEA 4FP3A 1CPNA 2LALA 2QE3A 3WDWA 3OGJA 2BFUS 4KNCA 4LBOA 4Y4YA 5C4WA 3AMHA 3NKGA 2DUPA 3RRDA 4ASMB 4CYDA 1LRHA 1QOSA 3FLTA 2NZ9A 3IDEA 1ULFA 1AR91 3NAPC 1AR83 1ZM1A 4E4ZA 4FO9A 3VKFC 4F3JA 2XWJB 5L73A 3ZYGA 3MLKA 4B7EA 1NCRB 5CIRA 4JV4A 3VBHA 4XQ4A 5CVRA 1ZRDA 5BNQA 3H7JA 4PIYA 3P3NA 5FQ0A 2RM22 1K5MA 3KT7A 4OUSA 4Q4V2 1KITA 1VBD2 4ZU4A 5KC5A 1ND3C 4GIQA 2JXAA 4LO7A 2BW8A 4M00A 1QHDA 4COVA 3WP3A 3WP4A 3MDPA 1BK1A 1HRV2 4META 3ZXJA 2UWCA 3ZYRA 4GWMA 4ITCA 2RJKA 4YVWA 5CU1A 4FOYA 2I2SA 1AR81 1RUI2 4IV3A 2WQ4A 3URFA 2KM2A 4IEWA 2WNUB 3BCWA 1A78A 3AXDA 1KJRA 1BEV2 2GC0A 4NHMA 1LEMA 1QDCA 4DOUA 4DRVA 3MPBA 3FZ3A 3CEWA 1AHSA 4FTSA 1R093 1ZRRA 1X8MA 2XGXA 4CDXB 5JOZA 1E57A 2LTNA 2VOVA 4R8HA 1W39A 1CPMA 2YXSA 4CEWC 5I8YA 4K9SA 5I0SA 2WFF2 4Q26A 1PO12 3E97A 1RUE2 5T5PA 3SH3A 4LBQA 1GNHA 1O3TA 2ZPXA 2ZMLA 2HWE3 1IS3A 3FHIB 2D6KA 5JDBA 2MHFA 1Q5OA 1LODA 5ABJA 2R072 3PMEA 2ZGKA 4LHKA 1IQAA 3EO6A 3MW2A 4OI1A 2VNOA 2TNFA 1POV0 3IWZA 1FV2A 1FOD2 3S6PA 1DFQA 5KXCA 3VBFB 5A32A 4PDWA 5BV6A 2XVKA 3MFCA 4INDA 1R091 1MVEA 1PVC3 2D97A 1UCXA 4I0WB 2DWRA 4KH9A 5C4WB 2NMNA 1RTVA 1PIV2 1F9KA 4IEPA 1UX6A 3UJQA 2RS32 5F9TA 2HWE1 3WG3A 1TNFA 1HQWA 3FE5A 3RMXA 1EV13 4NO4A 4P9LA 1QWRA 2D6LX 2R32A 3VBHB 3WVJA 3ZO0B 2RS12 3AZVA 1S0CA 1HKDA 5GZEA 1QNYA 2AENA 5LK7B 5FQ0B 1W6OA 5K0UC 3WOGA 1ZBA2 1K5MB 5B2GB 4P9IA 1B35A 1QY4A 1UKGA 4AF9A 1RUD2 4K7JA 1VBB3 4XMAA 3D5OA 1PVC1 1QXRA 4WVVA 3NL1A 4G4FA 2JENA 1LTEA 4MLOA 4ASLA 2I74A 1H8VA 5E89A 1H1AA 1O3SA 4GB32 1N1TA 1VAVA 4NR1A 5HXVA 4GA9A 4YVWB 1PGW1 4EN9B 1N1SA 4IV3B 1SLLA 4MX3A 1FNYA 4WBBA 1EV11 3FC0A 5D1IA 1H9PA 1MS1A 1H2NA 4NHKA 4N43A 2BYVE 1RUJ2 3HWJA 2UWAA 3MLLA 2GMPA 4Y5Z0 4BHPA 1O3QA 2W39A 2ERFA 3WCRA 4O9EA 4Q0VA 3VDDC 2BNOA 1G8WA 3VBRC 1KS5A 1Q8OA 4AK3A 4LBQB 5D8AA 1F2NA 2G9FA 3B01A 3NKTA 3O0WA 1TME3 4FPLA 4ZU7A 2CAUA 1DG6A 3TNQA 1XNCA 4WM8A 5ABJB 1GR3A 4JC1A 4QXKA 2WL1A 2X5IB 1DIWA 4LE3A 2MNGA 5CFDC 4M3CA 1I3HA 2CWMA 3U07A 1NY72 4IEVA 3TBDA 5A32B 4P9XA 1BZWA 4XFCA 4PDWB 1WLTA 3GBGA 1RUC1 4XBLA 1YFWA 2D6MA 2QZ3A 4P14A 1A8DA 5E16A 3B3QE 2F6BA 4OI0A 3MI8A 3AP7A 2GAUA 3UL2A 5A33B 1XYPA 5JPNB 1VBA2 3U0ZA 3WUDA 3B69A 4E27A 4AI3A 2GNDA 3KCYA 3QBQA 1IS4A 1SCSA 5CFCA 4BYYA 4D69A 2W68A 4MGYE 1VBE3 3ZFGA 4RSUA 1RUH2 3WQ7A 1DQ5A 3EHKA 4UBHA 1XYOA 2ZHNA 1W6OB 4WVZA 2GN3A 2BEOA 1B35B 3L2YA 2PQQA 5HI0A 4EN8B 4G3YC 1PMIA 2ZGQA 3FUQA 4R9CA 1KFXL 3SCHA 4MVTA 5K9YA 4IEQA 3ROUA 2FBEA 1JOJA 5KHKA 1CGPA 4Q2FA 4WVWA 1SMVA 3KM5A 4YG0A 2VUAA 2ZX2A 3J8F3 4YW1A 2C9AA 3GZUC 3UV9A 2WS92 1MZ5A 4EWEA 2A6VA 3AYCA 2ZAHA 4Q29A 1LECA 2EXJA 5DZFA 4L2NA 5KHIA 5EV7A 1VBE1 2PFWA 3ZYIB 3RYRA 4D7YA 4N43B 2OZ6A 3JBG2 1VAMA 4EWAA 1CQ9A 3I8TA 1RUNA 2RHPA 1CAVA 2PYTA 5JIAA 2PLV2 3VHRA 3RWNA 1GICA 2YMZA 1RIRA 3QCWA 4CEYC 5D8AB 5A3MA 3J8F1 3G7DA 2AYHA 4HKLA 5L7OA 2CAVA 1V6LA 2ZACA 4RS5C 4M3CF 3E6BA 4AWDA 5BNPC 2HEYF 4WM8B 5SV5A 4QPGC 3AK0A 4ATFA 5E1RA 4R52A 1S0IA 3JD72 1BCXA 4M3CB 1WW4A 3LA2A 1OQEA 4Y1YA 2RM23 1YXWA 1Z0HA 3MW3A 3H3UA 2XJPA 3TWIA 1AR92 4KGQA 4KG8A 4H7LA 1QMJA 2Q4SA 2YHJA 1QF3A 4LTAA 1VALA 2A5ZA 1H30A 2NN8A 4ONUA 2JG9C 1FNZA 5JR7B 3VGIA 1NG0A 4JTNA 1NE6A 2ILMA 1DU3D 1PHMA 3T2TA 5CFCB 2DF7A 3R4DB 3ZFGB 1APNA 4FPFA 1F5JA 1HX6A 2Z69A 2ARBA 1PK6C 1ZBE3 3B9IA 2RM21 1C57A 1DZTA 4TZDA 5BNOA 2A3XA 3OF1A 5T3NA 3CL1A 1G9FA 1XE8A 1H8TA 4AEDA 4C90A 1TMF2 1AR82 3ZXFA 2GN7A 3JUUA 4KG0A 1W2UA 2WJSA 3ZPYA 3HT1A 4R4ZA 5JWPA 1YHFA 1XNKA 4DRRA 4ES8A 3AZYA 1UD1A 3ATGA 1DYPA 2VXRA 2DV9A 1C3HA 1AVBA 4FOVA 1SLTA 2QZ2A 3GZAA 3NO8A 5AVPA 4PIZA 3H3ZA 3WDXA 2HWD3 4I01A 2NLRA 3FMGA 3OJBA 1RGSA 1ZBE1 2A6YA 1BBT3 4GKYA 1CAVB 4XDQA 2ZABA 3ZSMA 4PLMA 1C5IA 1UIJA 3B9CA 3PVBB 1XNDA 3DPRA 4CTEA 4K1YA 2ZGOA 4LO5B 4XF9A 4DS0A 1UF2C 1RUE1 4YARA 5I91A 1S0FA 3ALQA 5L7OB 4KWKA 4YGEA 4XFIA 1V9U3 5FPZA 3WXPA 2NM1A 3WNXA 1R092 4DPNA 3BIWE 5JOXA 4IEZA 3WD5A 4AVBA 2A6XA 1DGRA 1IZ3A 2R071 2RS13 4Y26A 1D4M3 4MGZE 2WZPP 4HVQA 4GXLA 2D44A 1OPOA 2HWD1 5BPXA 4DZGA 1LESA 4DNYA 3PNAA 2I07B 5FO8B 3ZYPA 1IS5A 2GC1A 4WM7A 1BBT1 5C9AC 5CBLA 1HDKA 2HWE2 1JYIA 4X6RB 3THTA 2VPVA 5C6CA 1XQNA 4R9AA 1FX5A 1MS4A 4Q4W3 5FO9B 4XMIA 1Q8QA 4IXLA 3KQRA 5FPXA 2ZZJA 4XETA 4YFWA 4JGYC 4OI4A 5GZFA 2K9ZA 1O5LA 4GMP3 4XF1A 2ZX0A 1IS6A 1GFF2 1V9U1 3NWKA 3D6EA 3UJOA 4OFGA 1YUDA 4R9BA 2RS11 4L11A 1D4M1 2QFEA 2O8OA 4TWTA 4EN0A 2DTWA 3SITA 4GALA 5IT6A 2R043 2CV6A 5AVAA 1ZBA1 2C0ZA 3RPQA 4RD7A 5BNOB 1H8TB 1PGW2 3APBA 4AEDB 2Y26A 1AL0G 2WSUA 1RUD1 1GQGA 3N35A 3KGZA 3MFAA 1N3PA 4LBJA 3MLJA 2NPIA 1OQDA 5FTTC 4CDWA 4CDUC 4FAHA 2H0BA 5FREA 1UN1A 2ARXA 2W52A 4N53C 4AHWA 4Q4W1 3VKLA 5JI9A 4K3UA 4PLOA 1LGBA 2QDRA 2GC3A 1CJDA 1H1MA 4WZFA 5AC93 1IHMA 1NZCA 1W0OA 2YC0A 2D3SA 4KGGA 3KGLA 4GMP1 4IQPA 3D0JA 3I4IA 4ORFA 3VKNA 3JQWA 3ZSLA 2NQYA 4WZCA 1VBB2 2PELA 2P17A 1UIKA 2BVBA 4XOGA 1RJ8A 3AP5A 2P34A 1DBNA 1RUJ1 1NLRA 4XF3A 2WNVA 4Y1XA 1MZFA 4Q4X3 2E7TA 3DPRB 3SISA 2XBO3 4UXAA 3AJZA 3NVCA 2D6OX 4AI1A 4XFBA 2XL9A 3WW3A 4YW3A 3OPZA 3UKNA 3OD0A 2DCZA 2EVXA 3LOBA 1RUF3 4Q1RA 2VGDA 4BMBA 1DDLA 1PVXA 1UZZA 1B09A 5FCCA 1F5FA 4ZU5A 5L36A 1DQ1A 3H1YA 4W6YA 2Q1ZB 1RVF3 4W65A 4WM7B 2SBAA 5H9PA 3VBUA 2WA3A 1TME2 3CLPA 3NV2A 1QXPA 4FPCA 4PLNA 1H9WA 1Y3TA 2PHDA 5F6KA 4Q4X1 1N3QA 4RR3A 4LT5A 3ZFEC 2XBO1 5IK5A 2V09A 2DCTA 1ZNPA 4IESA 1JHNA 1OOPA 3X29B 3ZSKA 2JD4A 5IK8A 2PHTA 3ZIXA 2WS93 3LSEA 2D6PA 4FPJA 2WFPA 1TE1B 1FV3A 4AFBA 1NQDA 1RUF1 3H1WA 3K51A 4LLOA 5JLVA 1DQ4A 3ACLA 4FPOB 2IZWA 1YFUA 1QKQA 4P9JA 5GALA 4DB5A 4LE4A 1C1FA 2QUOA 4ATEA 1RVF1 3V0BA 1NA1C 3WG2A 4D3WA 1OHFA 2DU0A 4AHZA 1CAUA 4A3XA 1DF0A 3AYAA 4CDWB 1U0AA 3E5UA 1VBE2 4X8NA 2TEPA 2E51A 2XKOA 4YZ2A 1J3PA 2WLQA 1CAXA 2O1QA 2WS91 4P9YA 1A3KA 3ZDSA 3LA7A 1FPN3 1HW5A 2NYYA 4FP2A 2XH6A 1MS5A 3NAPA 2D3PA 1ND2C 1FXZA 3MICA 1NLSA 4QQLA 2A3YA 2A6WA 2WNVB 3WG4A 3RNSA 2DFCA 4FT8A 4BZ4A 3SXWA 1NXD1 2BBVA 1ND3A 4JDOA 2R6QA 1IPJA 4QHBA 2VNGA 2XVGA 1OFNA 2ETEA 1LOFC 3EQEA 4Z07A 1JTZX 1F31A 3RS6A 3ZXAC 4W6WA 1FPN1 3PVEA 3GNEA 5DZEA 3ELNA 3VHNA 3H0OA 4FPHA 1WGPA 3IDCB 3JD71 3AX4A 4DINB 5LEKA 1LHOA 2QDNA 3A4UA 3GBWA 1AJOA 2EALA 4GMP0 4HL0A 2A7AA 3VBUB 4DY5A 5IK4A 4PCRA 1TMF3 4TYSA 1O4ZA 4RR3B 4CP0A 4JVAA 3U4XA 2XWBB 1OOPB 1LOCA 1EPWA 3SCFA 2OIIA 3RSJA 1QH6A 3KT4A 3R4SA 5EYYA 1SCRA 1EP0A 2WNUC 3RYKA 3PTYA 4XBQA 1COV3 4BOWA 4OVEA 4QPIC 3J9SA 1PM7A 3AP9A 4CDXC 1PNFA 4ISRA 3S30A 5C8CC 2QNKA 2CGPA 1BXHA 1MVQA 4XHBA 1SLIA 3V0BB 5I8TA 1G9AA 1HV1A 2PA7A 5FLJA 4XFHA 3WZ1A 3B00A 4B7KA 1D2SA 1TMF1 5BNNC 3EJKA 1GZ9A 1GZWA 4MYEA 1W6NA 2AH2A 5IUQA 4OHYA 1S0JA 1CAXB 2WT2A 4XW3A 5DDJ3 3ETQA 2DVBA 1ZBE2 1G6NA 3MIFA 3ZXLA 1COV1 4BMEA 1NCQC 3NAPB 4XTPA 4GULA 2V73A 1ZZCA 3KS7A 1MZ6A 4Q8LA 1GNZA 4IEYA 4AHYA 3IDBB 1MEC3 2B45X 3FFZA 3QLQA 4LEJA 2WINB 5EZWA 4YYOA 2PAKA 4YLZA 2PAMA 3MIEA 5GM0A 1OA3A 2E63A 1ND3B 3M70A 3D8CA 3WDTA 2AREA 4D7TA 1X8EA 2ATFA 5FLHA 2WSVA 3ZN5A 2OVUA 4JTOA 3VBHC 3POWA 2HWD2 5DDJ1 1G7YA 4YM3A 1BBT2 2VNRA 1FT9A 3GBFA 4K6BA 3TB0A 4EROA 3A0NA 3WP6A 4BCUA 4FPEA 1ZZ6A 2GMEA 5BXXA 4YZ3A 1MEC1 4Z2WA 2Z42A 1PZ9A 4L9BA 1KJLA 1Q8VA 1V9U2 1W6PA 4BA6A 4D7SA 4AVVA 4YVWC 1CAWA 1BJQA 4DMIA 4AVAA 3WQ0A 2CGNA 3MIBA 3VDDA 4FAGA 1R083 3VBRA 2X29A 1D4M2 4MGKE 3I7DA 4AXOA 4J1XA 4XF4A 2EA7A 4GH4A 3WW1A 1CJPA 3GYDA 2IFRA 2H6BA 1CESA 2FMDA 4LO8A 4LNVA 3VHOA 1KFUL 3ILRA 5J48A 4HN1A 4CDQC 4HBNA 4QQ2A 2O0OA 2VW2A 4U36A 4XILA 3AP6A 4XXAA 2WZR3 2DVDA 4Q4W2 1CX4A 4H7MA 2P3JA 1UAIA 5CFDA 1XRUA 5GJ6A 1ULGA 1OD5A 4FXKB 5H9QA 2RS53 2DTYA 1OKQA 4LHLA 1GZWB 3ZFFC 4F83A 1W6NB 5ABJC 2PHLA 1R081 5T54A 2VOWA 3MF9A 2X5IC 2RMU3 2JICA 1ZREA 2R042 4YM2A 2JG8C 5JI7A 4I0AA 3WQ1A 1BVVA 1HXS3 1SLBA 2GDFA 4PDWC 4YGBA 2D40A 4BQ1A 4P5HA 1VBB1 2VMIA 4LBNA 1TQ5A 1QJU3 4XFAA 2WZR1 4I30A 1SQ4A 2D93A 5AC92 4BLJA 1QGLA 3N7MA 2FMYA 2A6ZA 1CD3G 2RS51 3R6SA 4JDMA 2VG9A 4W6XA 2HJIA 1DHKB 4JQRA 1D2QA 1O7FA 1VJ2A 1W6MA 2B42B 1Y7BA 1RUOA 1H4HA 5J09A 2RMU1 4RFT0 5DZGA 4B4RA 1OSGA 3WX5A 2ZX4A 5F6LB 1J3QA 1HXS1 2XJTA 3IN9A 1B35C 1VP6A 2CY6A 2EXKA 2GH8A 4Q4X2 5SV8A 5JZGC 2XBO2 1T6GC 3PJYA 1GSLA 5JSRA 4AFAA 3M2MA 1QJU1 4COUA 1QJZA 1V00A 1ZX5A 4AGVA 1I5ZA 1TME1 2ZCWA 4UW5A 3ASIA 4S2DA 1W6PB 3MYXA 2DCJA 1OLRA 1CAWB 1RUF2 2BNNA 2IC1A 5HCFA 3VDDB 2ZX1A 1VR3A 5CA6A 3VBRB 1O5UA 1NE4A 2K0GA 4GH4B 1FYUA 4CEYA 5JOWA 1RVF2 4LA2A 1JUHA 3VV1A 4RS5A 3AFGA 3RI9A 3AKRA 5HCBA 3OY8A 3MIDA 1J1TA 2Y0IA 2PHRA 1SBEA 5T55A 1EY2A 3OYWA 4AI8A 1VIWB 3MW4A 5EFUA 3W59A 1Z7S3 3HIFA 4Q27A 3K48A 3THPA 3CJXA 4NHLA 4AEJA 4WM8C 4XYXA 4BIOA 2YY1A 1N47A 1Q8SA 2DYCA 1J59A 3WDUA 5H9SA 4Y24A 1OMIA 4FSJA 4OLLA 2JG9A 3FFQA 5TSWA 1S1AA 2YZ4A 4EN6B 2QQPA 2VVDA 2Y38A 4PQ9A 1ENXA 4UW3A 4HK9A 2HEVF 4I0BA 5JPMB 1AZDA 4RGGA 2PHWA 1Z7S1 1FPN2 1DYKA 1WLWA 3OBRA 3BU7A 5HBAA 3VHPA 4C0HA 4YGDA 2R49A 4AYUA 3POSA 1W6MB 3W9AA 4MV2A 3ZFGC 1WUVA 3VN4A 4C0BA 4LHNA 5FRAA 2HWF3 3GALA 3BALA 4NVPA 3ZVXA 4XZPA 2H6CA 3FX3A 4JDNA 5AFEA 2IXCA 1XNBA 2R063 2A71A 3AKTA 5I0TA 4GWNA 1O4TA 1OI6A 3M3IA 5KHJA 3LSDA 1DGLA 2DUQA 2EXHA 1YRZA 3SH5A 4Z92B 2PHFA 1J58A 1WLDA 3BB6A 4K20A 2UWBA 2GSYA 3TYJA 4L92A 1LENA 1VRH2 1GZCA 3D0SA 3MIHA 4XJWA 4V1PA 1NQJA 3VL9A 5JOYA 2DVAA 3OBTA 4CEYB 3MIGA 4PBOA 2BVVA 2ZHKA 3O14A 2MEV3 1RMU3 1AR63 4RS5B 4XF0A 2BWAA 2TUNA 2D5HA 3OY8B 1O4YA 2R061 2CGOA 5JVVA 3S7IA 4YZ1A 3PMSA 5CG9A 1BKZA 4XJ9A 4IEUA 4XJUA 3OYWB 3KT1A 2DFBA 1RUG2 3E6CC 1ZZ7A 1LOGA 4F8AA 1COV2 3ZXDA 2QCSB