3VZJA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) e172h mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATHGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 44
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzjA00
2DCKA 3VZOA 3VZJA 1H4GA 1W2UA 2NQYA 4XPVA 1REDA 1ENXA 2DCJA 2DCYA 4H7MA 2Z79A 4HKLA 2C1FA 2BWCA 1C5IA 1XNKA 4NPRA 1XXNA 4HKWA 3WX5A 1QH6A 1XNDA 1XNBA 3RI9A 3WQ7A 4XQWA 3M4FA 3O7OA 5EJ3A 3WQ1A 3AMHA 1BK1A 2VULA 3VLBB 3WP5A 3WP4A 1HIXA 3AMPA 3MF6A 1BVVA 2B45X 2BVVA 1XYPA 1XYNA 4XQ4A 1BCXA 1NLRA 3AKQA 1C5HA 3B7MA 3RI8A 3WY6A 2JEMA 1REEA 4S2GA 1HV0A 1UU5A 1REFA 1OA2A 2D97A 3VL9A 3WP6A 2DCZA 3AKPA 1OA3A 3LB9A 3VZNA 3VZMA 3WQ0A 3VHNA 2D98A 1OA4A 5HXVA 2B46X 1TE1B 3WT3A 3WXPA 2JENA 1H1AA 2JICA 2BWAA 1IGOA 1H4HA 1T6GC 2QZ3A 3HD8B 1H0BA 2BW8A 2VUJA 4XQDA 3ZSEA 1HV1A 5K9YA 3AMQA 3AKSA 1M4WA 1KS4A 3AKTA 1UKRA 2B42B 3EXUA 3MFCA 1PVXA 3VHPA 1H8VA 3B5LB 4HK9A 1QH7A 3VHOA 1F5JA 1OLQA 2DFCA 3AMMA 4S2HA 1UU6A 3WR0A 1YNAA 3AMNA 1XNCA 3MF9A 3LGRA 2QZ2A 4IXLA 4HKOA 3VZKA 3VZLA 2DFBA 1KS5A 3WP3A 3MFAA 1XYOA 4S2FA 2VG9A 4S2DA 2NLRA 2VGDA 3VL8A 3AKRA 4HK8A 1UU4A 2F6BA 5K7PA 1AXKA 1OLRA 3VGIA
chains in the Genus database with same CATH superfamily
1PK6A 2JDUA 2HWC1 5A7PA 4JKKA 1GNYA 1W39A 3LEGA 4KH9A 4XPVA 5JOZA 2WN3A 4OHZA 1AYM1 1ENXA 3JXSA 1RUD3 4P9GA 3CIHA 3N9MA 4Y1UA 5JI7A 3A0KA 3KMHA 1VAMA 1W0PA 4GQ7A 2Q1ZB 4QU2A 2YY1A 2JDZA 1H8TC 2W1UA 3K3NA 5T5JA 4B4PA 3DXTA 3POSA 4CDXB 4ZKTB 1S0CA 3I2KA 1GQGA 5F3CA 4DEVA 1AR82 5FZIA 2VTXA 4C90A 5BUVA 3PJYA 3LPGA 1RUE1 2DBIA 2KM2A 3CO2A 1BYHA 2JWPA 2VZUA 3T0AA 3I2DA 3PURA 1PZ7A 4QX8A 2WKKA 3FWEA 2WJSA 4CUGA 1LGCA 4DY5A 4TWTA 5F2SA 4GWMA 4OUMA 4Q8KA 1XNTA 3HQRA 4LBLA 1RUD1 3T3YA 3VD4A 2B45X 2R063 1XE0A 3OGJA 1N1VA 1ZZ8A 2Z42A 2JG9A 4XQ4A 2RMU3 5FYIA 2FDKA 4QM9A 4FPKA 1MR5A 4Q0SA 1QXRA 3WY6A 4A2UA 3O14A 1LHVA 4PBPA 2UURA 1S0IA 1STMA 5F5IA 2H0VA 4AFDA 3QOPA 1RYYA 2QQKA 5FLHA 5A3PA 5HPOA 2WA3A 1QJU2 3B93A 4HMZA 4NVPA 2VBBA 4PF5A 2YC2A 4HVRA 2XDVA 3KQ4B 3WCRA 5K0UC 1W90A 4WVWA 1QOTA 1U5IA 4IV3C 3FBYA 5CFDB 2XH6A 2QQIA 1DIWA 3CLPA 1TE1B 3MIHA 1AL23 4JTOA 5A6YA 2J42A 3PTRB 2VXRA 2YFUA 5CG8A 1H9PA 4XJAA 4Y1VA 2R061 2BWAA 1GZ9A 1A78A 5L36A 4BQXA 4R8HA 4K40A 4CCNA 4YG0A 1PM4A 2RMU1 2V5DA 3B00A 3E5UA 2WNVB 3J7LA 3DUIA 4XEZA 3BN6A 2YHJA 3TEYA 5GKAC 4D8MA 2WNEA 3VBSA 5L7OC 4ZS3A 4XFGA 4QB2A 3RZHA 2CGPA 1LHNA 3HNYM 5DDJ3 1HKDA 4AQ2A 3LDBA 1AL0G 3B5LB 3VHPA 4BE3A 2XPJA 4Y22B 2XKPA 3VDCA 1ND2B 4JX0A 5D8AC 4FQ4A 1OLQA 3WZ1A 5I8TA 1SACA 3MDPA 1AL21 4GMP3 4IEZA 5ABJC 1UY0A 1LCLA 1QWRA 4XTMA 1RUE2 5FO8B 3VKFC 3WNNA 4WVZA 4R4ZA 2R49A 3DV8A 1PIV2 1DGLA 5FYHA 1YFUA 4HKOA 4N53A 5JXIA 1URXA 2BRTA 4BDVB 3DYOA 5IAVA 3SNMA 3SC7X 4CU6A 2PFWA 1RUD2 4PBOA 1ZZ7A 4CCCA 5JR7B 2LRPA 1HQWA 2AR6A 5DDJ1 4FVVA 4QX5A 5FPAA 3BTYA 2W1SA 2YBSA 4HK8A 2C9AA 1R1A2 2VAUA 3SKJE 3CZUA 4FFIA 5J37A 5EYXA 4DMIA 2Z2SB 4IE5A 3IIIA 5FBJA 4GMP1 1HJGA 4ARYA 2ZX2A 1BZWA 2WZR3 3AYDA 4CXWA 1IG3A 4HANA 4XUPA 3CU7A 3NAPB 2ZX1A 4JTNA 1LOFC 2IWGB 2DCJA 3RRDA 3U4XA 1VB2A 4XF0A 3OBRA 3HT1A 4LBQB 4LNVA 3G6JB 2VZ1A 4PDWC 1RB8G 1RUI3 4JGZB 4Y33A 1XRUA 3OPWA 5CAZA 3DN7A 4UW6A 3LKJA 1XSRA 4NUBA 1F2NA 1Y4WA 2WT1A 1N3PA 4KU7A 4JQTA 5A70A 5IVFA 1FNZA 4MYEA 5EJ3A 1W6QB 2UY8A 2XOMA 3JCIA 5EQUA 1D4M3 5T52A 1US3A 4RR3C 4Y24A 1WGPA 3HJRA 3SLIA 1GR3A 4HPKA 4B4RA 4YW5A 1LOBA 5C3RA 1W6PA 3MBWA 3I59A 2R7EB 2WZR1 1LHWA 2HWF1 3WF2A 3V0BA 2OVUA 1A34A 5E88A 4D94A 2D6MA 1DF0A 4XMIA 1DHKB 3WLUA 4A7YA 1AX2A 1MS5A 5I8YA 4NWVA 5F3GA 4CE8A 1CJDA 1VB4A 1RUI1 1W6NA 2RDRA 2WZEA 4J6GA 2VW0A 4KNCA 5FP8A 2VH9A 3RYKA 4ASMB 4A3XA 4LBOA 4NRMA 5FMOL 1JUIA 5FKCA 5C5TA 1WLDA 4TYSA 3WDTA 1RTVA 2B7YA 2GZWA 3OJBA 5C8CC 1D4M1 1GZWA 3FLPA 2AREA 3K75B 3IBMA 3DPRC 2HBTA 1UY3A 4OULA 3AJYA 3FC0A 3ZDSA 2X8KA 5FY1A 3BU0A 3L9JT 1S0BA 4FQZA 5DDJ2 5H9PA 1HB2A 3N4MA 1LU1A 4WM8C 1Y3TA 1GYKA 3ITQA 2GC1A 2EXHA 4K6BA 4YRDA 3RQ0A 4RQPC 2Y0IA 4BQ2A 3KQRA 1YFWA 1WWYA 3RYPA 4CDUA 2H6CA 2WN2A 1COV3 1W6OA 5FP9A 2WC2A 1UZVA 4IEVA 1OOPB 3ZN6B 4NWWA 3WF1A 4CVUA 4LXLA 5BNPB 1UNBA 1VE0A 1QEXA 4Y1XA 4EN6B 4I02A 4XOGA 5EHDA 4CDQB 4EJRA 3MPBA 1V0AA 4EN9B 2YGMA 3RZJA 2AZ5A 3TEZA 1SHWB 1HQNA 3FZ3A 4LBNA 4W50A 4C1WA 1F5JA 1ULDA 2F17A 4ISQA 1OF3A 2A71A 2PAMA 2PTMA 3ME2A 2XR4A 4B4QA 4YW2A 3POWA 4EZHA 4C91A 2QZ2A 2TNFA 4QU1A 1CAUB 5L9RA 3UNPA 1COV1 1LNSA 1NXMA 4UF0A 2YYOA 2QNKA 4WBBA 3NV1A 4X8NA 1H2KA 4AE2A 5IK8A 1X33A 3TWIA 2BDRA 3OTFA 1JZ6A 2FMDA 2EVXA 3H7JA 1XYOA 5JZGC 1ENRA 4RHV2 1NE4A 5GZDA 1IKPA 4BQ1A 4OHXA 4FP3A 4GD4A 4ZU5A 2QQUA 1UOGA 3AKRA 1S2EA 2A7AA 1NLQA 3ETQA 4Y26A 5BNNC 1N1SA 2GU9A 5K7PA 5FY9A 4XJ9A 4CDWB 2YMZA 4HBNA 1H2NA 1M06G 1Y9MA 4QKFA 4YVWB 3KS7A 2VTFA 4RGKA 3VZJA 1WW6A 3AXEA 3X29B 5EV7A 1F5FA 3NQHA 3ES4A 5FMDA 1UYZA 2C1FA 3IDAA 4P9WA 5FXVA 1MEC3 2D44A 4BHPA 3LEMA 3BI3A 5FYVA 1YQ6A 5EZWA 5BNOA 3MW2A 5A1AA 2PMWB 2R32A 4CDXC 3IPVB 1L7QA 1XNBA 1QKQA 3AP7A 1JXNA 5FZOB 3I3MA 3QCWA 3W58A 2E53A 4DY3A 4G3YC 2VBPA 4AZZA 2QDNA 4UT5A 1BK1A 2ZX3A 4QHBA 3W9AA 1WCDJ 2AACA 3J7MA 1E5IA 2P5BA 2XWJB 4NAOA 2BNMA 5LASA 2YG0A 4AVBA 5BNQA 1SLCA 4NHKA 4YW3A 2JDHA 1OLMA 3AVSA 4LOTA 2BVVA 3C7HA 1QDOA 1MEC1 4MGKE 1NA1A 2PYTA 3U11A 4R9BA 3VBFA 4LO4B 5JSRA 1NLRA 4TZDA 1NZCA 1OQEA 5FOJB 3E6CC 4MO3M 2XJQA 1OQDA 1J3PA 4IGPA 5FP4A 3ELNA 5C4WA 1COV2 2W94A 5FFOC 3T09A 4AI9A 2PXJA 1JHJA 4XDPA 3CQOA 3WNLA 4FOWA 1E5HA 3HN1A 4UAPA 5B4XA 4Y4RA 1JYXA 3KV6A 1OA3A 1J3QA 1IS3A 1L7LA 1W2NA 2JIJA 3IZOA 1VPHA 4M4RA 3VDDC 5IYYA 2D98A 2QFEA 3VKOA 2VQUA 1B35A 2FCTA 2W08A 4H14A 1VBB3 5FQ0B 2Z5WA 2WNUB 1XPWA 1ENQA 5E6HA 4LORA 2Y38A 4GB32 4Q0VA 1ULGA 1ST8A 3MUZ1 3WEZA 2WNVC 3ZSMA 5LBCA 2G4IA 4AFMA 4ZONA 3LEIA 3AFGA 3T4VA 1LGNA 2EXKA 2Y6FA 4Z07A 3NJXA 4LO8A 1I6XA 2AEZA 5DMYA 3ZYJB 4YG3A 4K1YA 3SEPA 5A3LA 4TTGA 3ZLIA 2HEYF 2SBAA 2R042 3ZO0B 4I2OA 3H8RA 2WT2A 4UW4A 4B1LA 1XE8A 1XU2A 3AMMA 1PM7A 3B02A 1CZSA 1VBB1 2XLFA 3N9OA 3PJQA 4AF9A 5T50A 4BXSV 1IG0A 1BXHA 5FCCA 3MF9A 4QM8A 2C24A 1QXJA 2DTYA 5FLJA 4DO0A 2OUHA 2B5HA 1MPXA 2VCCA 3MLLA 1PZ8A 1LKNA 2XBO3 1FOD3 1JU4A 3WINE 1PMHX 5BV6A 2ZAAA 3OGSA 1UO9A 1BQPA 1DCSA 1YI9A 1P8JA 4E8CA 3W20A 5CNAA 1DZTA 2JG9B 2VBDA 1MEC2 1VR3A 2OIIA 2VG9A 4ES9A 3NNMA 1QJEA 5FZ4A 4QHOA 1H2LA 2RV9A 1DU3D 1LJ7A 1NCQA 2A3XA 4QX2A 3J7HA 4QX0A 2D6KA 1FXZA 1MZEA 1NCRA 3VGIA 4D3WA 4Q0QA 5JR2A 2O14A 2XMLA 3NNJA 5C9AC 3VD5A 4AHXA 2E31A 4AWDA 2WFF3 1UZYA 1QJY3 1W9TA 1QY4A 1YIFA 4NIDA 2XBO1 1FOD1 5A3WA 1ALYA 4K7JA 3VD7A 1E5RA 1XNKA 4R52A 4NPRA 5GZGA 4MV2A 4JGZC 5KHHA 2ZPXA 2IXLA 1C1LA 1QOSA 4OQ9A 2ZEYA 2ARCA 2ZA9A 1WMXA 3BB6A 3M2MA 5HCAA 4LA3A 5GLVA 3MYXA 5L73A 3HOBA 4D6RA 3VBSB 4E27A 3KT7A 2CDOA 1WMDA 2ZGKA 2CWSA 4CCJA 5FZLA 3LIHA 2W39A 1W9FA 1AJOA 2XVKA 5FK7A 5LBEA 4AVSA 2DVGA 2WFF1 1SMVA 2XVGA 1AYN2 2VZSA 4MGSA 1HB3A 1QJY1 4CP9A 1BJQA 1W03A 2ZGQA 2OQ7A 3AZYA 5HCFA 2WYFA 3WNOA 4AVVA 4F3JA 4YWAA 3I2JA 1U5ZA 4QWNA 3SKVA 3D0SA 4JHTA 1Y43B 1DGWA 3ZXDA 1O8SA 1SLAA 3ZFGB 3GHNA 4YVSA 4E9KA 5C3OA 2JG8A 2BBVA 3RI8A 3DF0A 4EN7B 4N53B 3RWKX 5I0RA 2VMGA 4Y22A 1JZ7A 1PNFA 3TNPB 1O3QA 4HSLA 2FDIA 3AKPA 5C70A 5GLUA 2Q8EA 1CWPA 2PAEA 1VBE3 4IL7A 3ZFEA 1JUHA 3DKQA 3GXUA 4HN1A 2BQPA 4KG8A 2FDHA 4WM7B 2VOWA 4N90A 4YZ2A 3O1MA 1OUXA 1I5PA 2XJPA 2BGPA 3NNFA 4GWIA 3ZXJA 2JENA 3LA3A 5F7UA 1HQLA 4GAZA 1NYWA 1Q8SA 3ORJA 3UYJA 4FPGA 4YYOA 2X29A 4H3WA 3AMQA 4ORFA 1UOBA 1W04A 2FCVA 1BEV2 1M4WA 3AKSA 4LIUA 4Q0UA 5JVVA 3R4DB 3H9AA 1ULPA 5IVJA 3OF1A 2XBO2 2E33A 3KGLA 4PI0A 1A8MA 1OI6A 5LA2A 3TN92 1VMJA 1OF4A 5CISA 1W05A 1VBE1 3KD4A 4Q29A 3T08A 2ATFA 5FXZA 5LBFA 2BOIA 2B9UA 2RG4A 2J1RA 2RDNA 1L3JA 2BV4A 1PVC3 1KGYA 2GP5A 1RC6A 2QVSB 1UL9A 1XNCA 4HPKB 1LOCA 4LBQA 4B7EA 4ATEA 2BNNA 1ZBE3 4WVMA 4NIHA 3I59B 2W46A 1JYWA 2W0XA 3VZKA 2X09A 1CPMA 1U0AA 2J1VA 1QJY2 3WP3A 3KM5A 3VBOC 2C5DA 3TB0A 3WNKA 4S2FA 1Y7BA 5H9QA 1W6NB 5AC92 3KT1A 3AYAA 3NJVA 4Y1YA 1RJ8A 2A6VA 5H9RA 4IEOA 4AEJA 1RL3A 4BQ3A 5FPXA 4W6XA 1QQP2 2P37A 4YSFA 3J9SA 1V6OA 4NE9A 3IM0A 1WCKA 1PVC1 4YVWC 3H8OA 1YCIA 1GZWB 4XUOA 5ACA3 2DCKA 4CPBD 5JXJA 3FJSA 1H4GA 1YQCA 1HRI3 2DUQA 4A6SA 4A7KA 1EYBA 1ZBE1 3OD0A 5EYYA 1WLCA 1Q5OA 1RITA 3K48A 1NXD1 1RUG3 2Y6KA 3AM2A 1BBT3 2ZGUA 4AL9A 2HLEA 4HKWA 1VP6A 3USUB 5F3EA 4QGNA 4CDUB 5JWPA 4QQLA 4XCAA 1W6OB 2OXBA 5FYZA 3TNQA 2ZHLA 3KV4A 5I0UA 4B8EA 4LMFA 2AH2A 4ITCA 2ENRA 2D3SA 1XJAA 3LDKA 4MGZE 1KD7A 5J1XA 3PU3A 5FAXA 3AMHA 4YG6A 1E57A 3HEIA 3GGLA 3KVAA 2D43A 4XJ8A 5ACA1 2OZJA 1HRI1 4CCLA 3N9NA 5I8SA 4GWNA 5FYBA 3WP4A 1VBE2 2E9QA 1JW6A 3JU9A 4W6YA 3R4UA 3RJ2X 3LAGA 1RUG1 1UXZA 2PA7A 1BBT1 1ZBA3 3RJRA 2HWD3 4CEWC 1LR5A 3VD3A 4CDQA 4QXHA 3WHUA 3ACHA 4CCMA 5A3OA 5J3UA 3GBGA 4RD7A 3IKWA 3UESA 1K5MA 4WZFA 4H7LA 1LHOA 1APNA 4AI1A 3CNAA 3ZX7A 2DCZA 2GN7A 3BTAA 3LB9A 3OEAA 2VUAA 4IEUA 4Y20A 5FZ9A 1U5YA 3RZKA 4LQRA 3W5NA 3DXUA 3CJXA 3A7QA 2Y60A 5HCBA 4HFSA 1NOVA 4IESA 3D5OA 3NJYA 2ZEWA 1QJFA 3QACA 1PK6C 1GU3A 2B4KA 5F9TA 5KC6A 2VNOA 4EN0A 1ZBA1 2XVLA 2HWD1 1PVC2 1XOYA 4PQQA 3WDWA 1G9DA 2VVEA 4O9GA 5ANQA 2UYAA 1D2QA 1GQPA 1YQ2A 3A21A 4NPLA 4PIYA 1LAJA 3TYJA 4KWKA 2CYFA 1EUTA 4PIZA 5BNOB 1W3XA 3FE5A 3NRUA 3HQXA 4LO7A 4CDWA 5DAPA 4E4HA 3C7FA 1JN2P 4MGIE 2ZJCA 1PGW1 2DFCA 1DYPA 2XLGA 2OKXA 4BQ5A 5GLTA 1GOFA 3VV1A 3KCYA 4YGBA 5F6KA 3WR0A 4AEDC 4DXZA 1YNAA 1JZ3A 3WF3A 3B69A 3JQWA 4AOCA 2C4XA 1N3OA 1WZXA 5EIYB 1GOHA 5DAXA 4CXYA 3MGUA 4FAGA 4BZ4A 2FZ2A 1SBFA 2Q4SA 1JYNA 2GC3A 1GZCA 1HRI2 1LESA 1W8HA 4LE4A 3E6BA 4QGLA 1HN0A 1NT0A 2UU8A 2BBAA 1NA1B 2JG9C 3H7YA 1QJU3 4M3CB 3VBFB 3POYA 5J36A 3VBUB 1RUG2 5FBZA 2J1AA 4HETA 5T3NA 4TXWA 2CHHA 4I0BA 4D6QA 2FZ1A 4YARA 1Q8OA 1S0DA 4YW6A 4CUAA 3ZKYA 5C4WB 2DVBA 3LFMA 2ZX0A 3CF6E 1YWKA 3M1HA 4NMIA 1GANA 4XBNA 3UKVA 4BMBA 1G9BA 1WCSA 3ENRA 4WVVA 2NQYA 4XVHA 5FPUA 1MACA 2VCBA 2JX9A 5DPNA 5H9SA 5FDBA 1B35B 2E7AA 1T6BX 3KLSA 5DZFA 1S0FA 2IUWA 2RS53 2VCMA 4BH9A 5M0TA 5FZ1A 1KEXA 2V72A 1PZ9A 4QX7A 1DP0A 5JI9A 3R0RA 1QJU1 1RGSA 5DUXA 5LRRA 1S1AA 2ZACA 4MXVA 4BQWA 5FTTC 1XNDA 1ZBA2 3HWJA 2GMPA 2HWD2 1EY2A 2UWBA 4AVTA 2LTNA 3HAGA 2FDJA 3NKGA 3WQ1A 5F1RA 4OMCA 1CJPA 2WNUA 2A73B 3MIBA 1BLZA 1PIV3 2PN5A 1ZZ9A 2ZHNA 1LOAA 4FSJA 4Y5Z0 3KF5A 1TZOA 4JDNA 4LTAA 3AMPA 4C0BA 2IXHA 3IWZA 5FRAA 3ZFFC 1PGW2 2RS51 4PLOA 4CU8A 5J09A 1D0HA 4W6WA 2W1QA 4NIIA 3T2OA 4IGOA 4BLJA 4NAMA 2JE7A 2OUJA 3N36A 5SV8A 4N53C 5DAVA 4BMEA 5CFCA 4DQAA 2CL2A 4UW3A 1W8NA 1UKGA 2XG3A 4ZXEA 4DNYA 5FXWA 1OUSA 1R1A3 2PAKA 3RNSA 4JRLA 3I3BA 4LE3A 4BJ0A 5KXCA 3OGRA 3I49A 3A4UA 5LBBA 5L9VA 3RDIA 4AEMA 1I9RA 4XF9A 1SLTA 1U5XA 2D97A 5B2GB 5LCWL 1SLBA 1ULOA 4ZPIA 5IK5A 3DKWA 5KBFA 1UX7A 3WG3A 4V1PA 2VQ0A 1PIV1 1YXWA 1T2XA 4Q5OA 3RGBA 1N1YA 3S7IA 1WA4A 1NCQB 4GMP0 3RSJA 1H1AA 5C6CA 4A3ZA 1H4HA 1NCRB 5E1RA 4OVEA 3QBQA 4MSVA 4YM0A 1GWMA 4CXXA 1RXFA 1RVF2 2QE3A 3OYWB 3P3PA 4A45A 5K9YA 1QMJA 4B1MA 3J26N 4QD2A 1WW5A 4XIOA 1O5LA 1I1EA 1R1A1 4B7KA 1UX6A 1F15A 4LK6A 3TOJA 4ZU7A 2IZWA 1PVXA 4MHRA 1V6IA 4LBJA 1O4YA 1QH7A 1DLLA 3ZXAC 3OBTA 3TRSB 3VN4A 3DGTA 4NHLA 4YM3A 1QXPA 4SBVA 4EWAA 4QXKA 3PDQA 2XLAA 4CCKA 1Y9GA 1OLME 4IW3A 4N43A 2B9VA 1YYNA 4Z8BA 2VW2A 1IPSA 4LUMA 4M3CE 2NM1A 4PT6A 5FY0A 4IE7A 1KJRA 4CP9B 5GLZA 3ZSJA 1CESA 2VW1A 3ILNA 1AXYA 2Y6LA 3E97A 2VECA 2VNRA 3VBHC 1ZRRA 4BIOA 3LCPA 3S57A 5CZKA 2EAKA 2RS52 3POBA 4YVSB 1BK0A 5A7OA 2JG8B 2K0GA 2ZGLA 4GULA 4OHWA 4S2DA 2IVIB 1H6XA 2FBEA 2WLQA 3SCFA 5DG1A 1H30A 2A6XA 3NNGA 4JDMA 1VBA2 2Y26A 3NWKA 2WWJA 3ZIWA 2VVDA 1UYXA 1FATA 2F4LA 2Q8OA 3ZFEB 4BM8A 4L0PA 5GZFA 2BGOA 1ODMA 1TMF2 1K12A 1W2TA 1WLWA 1HDKA 4PHZA 3V65A 3ZFGA 4BK5A 5FYCA 4GWJA 5JDBA 1W0OA 2E63A 2O1QA 2ZGMA 3RZZA 4W65A 2D3PA 2OT7A 2MPFA 2WAOA 1FPN3 3SH4A 1OC1A 3PVBB 3I97A 3U10A 5FMOS 5JXHA 1NLSA 1OQ1A 3AC0A 4LKDA 1YO8A 3Q8FA 4XQWA 1GWKA 2BNOA 5K4LA 1VLNA 2UWAA 2JDKA 5FZ8A 5IFTA 2ZHKA 4WM7A 2GNMA 5EFUA 2R1BA 3M3QA 3NO8A 4Q8LA 3DEMA 4K21A 2VNVA 3OY8A 3H1YA 2WQ8A 3WP5A 3BKZA 2VD7A 5LY2A 2YXSA 1HIXA 2SLIA 3OG2A 4LHSA 3O12A 3VB9A 1CAWB 2VZ3A 4PF1A 2D6NA 4RHV3 3T2QA 1FPN1 2YC0A 1VRH2 3KHBA 1NAEA 1D4VB 4YZ3A 3OUHA 2ZX4A 2C6SA 4WVMB 3E1F1 4HONA 4ES8A 5ISLA 4DINB 4PQ9A 2W68A 3UK9A 3MW4A 3NV3A 4ET7A 5DUUA 4D6SA 3CJIA 1C8M2 1R64A 3VL9A 2B8MA 3VZNA 3WQ0A 4M01A 1D2SA 1MS0A 1KFXL 1SQ4A 1MS3A 3ZYGA 1A8DA 1MS9A 1NUKA 1ZVFA 2RM22 2IVJA 3AYEA 2EXJA 1C4RA 4IEWA 3ZR6A 5FZ6A 5IK4A 3HBZA 3VHRA 5GLWA 4LHLA 1H1MA 1T6GC 2GMEA 4LKSA 3O0VA 4RHV1 3KV5A 4QPIC 4XQDA 1X9PA 2ARBA 2P3YA 1DZQA 1RUOA 2R0HA 2WINB 4ZZ8A 2PQQA 3J8F2 5FP3A 3BCWA 2XB6C 1G9CA 1EP0A 2ZZQA 1RUF3 4XABA 1C57A 4UFHA 5KHGA 3QH6A 1H8VA 2A1XA 4XMAA 3VHOA 4IEPA 3I3EA 3GALA 1NG0A 3I2HA 3POIA 4XJWA 5FY8A 3MZHA 1OPOA 2VZQA 2JECA 1GBGA 1UY2A 2R6QA 3AZWA 1XSQA 3BIEA 2PHDA 4LKFA 2A5ZA 1POV3 3GZTB 4LA2A 1ASJ2 4KWUA 3USUA 5L7OA 2C26A 3JBG3 4RSUA 1NA1C 4IE0A 2QJVA 4AFBA 4CUBA 3GYDA 1PGL1 4KBBA 1RUF1 2MEV3 4QKDA 1UOFA 1W8FA 1QGLA 5FIXA 1FPN2 2A3YA 2DVDA 2RHPA 1K5MB 1LEMA 1UU4A 3VKLA 5ABJA 2QCSB 5GZEA 3ZYRA 4NR1A 5DZGA 2CSGA 4UFKA 4LO5B 1S0EA 4GB33 5IW0A 4CP1A 5HBAA 3Q8AA 4CRQA 2GALA 5JIAA 1O4ZA 4Y20B 4CU7A 2W87A 3WNPA 1ZRCA 4XHBA 1POV1 4C8DA 4IDZA 1OMIA 3KHCA 1V6LA 1PO23 3ILRA 2Z79A 3O0WA 3JBG1 5CEHA 2YBKA 2JXAA 2ZGNA 4E2GA 1JH5A 2WYSA 4CUCA 1FV2A 1E5SA 4LHKA 3SH5A 1MQTB 4F8AA 2BPA2 1UW8A 2R043 2W47A 4PLMA 2MEV1 4MH0E 2Y64A 1TNFA 4H2AA 1YHFA 2G19A 4QAWA 5T5PA 4AQ6A 3ROUA 3N7JA 5FZBA 4P9IA 4MZUA 2HWE2 1NKGA 1TME3 3H8UA 4GB31 5F5CA 2GNDA 2AYHA 4JQRA 2VXJA 4COVA 1EAH3 1IS5A 2PHWA 1PO21 3ALQA 2QKDA 3VKNA 1LHUA 2JDYA 2ZGOA 4QKBA 1XYNA 2QTWB 2Q8CA 5T55A 2E6VA 4W8JA 4XW3A 2X5IB 3K4DA 3W21A 3A0NA 3ON7A 1Z7S2 2R041 4KG0A 2VMCA 4LBMA 2KXLA 1JYVA 4BOWA 3R6SA 5IWFA 5FV3A 2AEYA 4RR3A 1WCQA 4OI0A 1UZ0A 3BODA 2HJIA 3N7LA 1TME1 1F4AA 2WNOA 1S55A 1SZBA 2DDUA 4BQ4A 2Y6JA 5FOBB 3T1LA 1PGL2 2DVFA 1RUF2 1RUH2 4IUGA 4RGAA 5I93A 1EAH1 1NCQC 4GXLA 1ZZCA 3U4SA 2W91A 3WXPA 2FDFA 5FUIA 3CMGA 4KGQA 1C1FA 5C5UA 1XNAA 3MW3A 1O6UA 3ZOIA 4KWJA 4M3CA 1JZ8A 1UOJA 2RJKA 4GALA 4LK7A 4UXAA 4GJYA 3HMYA 3VBUA 4DB5A 4IV1B 3A23A 3AK0A 1KS4A 2GSYA 2LM3A 3BIWE 1DQ5A 3AKTA 5DUWA 5C8CA 3LQCA 4AI2A 1AZDA 3K2OA 3LZZA 3JBG2 3GCXA 4R9AA 4MG2A 4ATFA 3VDBA 3HPNA 2JD4A 1LB2A 1N47A 3WDYA 3HR9A 1UN1A 2PLV2 3RMXA 5FPZA 3JZVA 1AYN3 1YIPA 3AZZA 4LJHA 2MEV2 5CFDC 2WSVA 5IVCA 1CIWA 1CQ9A 4ASKA 4OYUA 1UMHA 2DURA 3BPSA 4XF3A 4LHNA 3B94A 1HXS3 4P9LA 4Z82A 3VZLA 1UYPA 1CZTA 3WSOA 5A3UA 1SLIA 2PELA 3N7KA 4BPZA 4QXCA 3INAA 5A1LA 4M3CF 1PO22 3NV4A 1GNHA 2JG8C 5HI0A 4CSWA 2HWB2 3OOXA 4JC1A 5JLVA 5CFCB 1DGRN 4D7SA 1N3QA 2B39A 5DZEA 4E8DA 1AYN1 1ND2C 4EN8B 5FPLA 4BU2A 2O8OA 4PCRA 5L19A 3ZFEC 4CP2A 1FMD3 5KC5A 2YV8A 4FPJA 5AVPA 2PHFA 5F6LB 1TME2 3T0DA 5JPMB 3LA2A 3I4IA 1HXS1 1BEV3 2D5HA 1FYUA 4PJYA 4HZFA 4QT6A 5D2AA 4AHWA 3PMSA 5I0DA 1EAH2 2W95A 4OCTA 1XXNA 3TN93 1SCRA 4COUA 1JYCA 3WW3A 3WNXA 2WRAA 4PIXA 1WW7A 3VD9A 1QHDA 4GA9A 2E26A 1LULA 1JOBA 4NJ4A 3WV6A 1ULFA 1ZYBA 2WA4A 2OW4A 5JMCA 2BJSA 3UGHA 3FUOA 1FMD1 4X6RB 4BCUA 1OD5A 2GC0A 1UQXA 2J7MA 2EAAA 2FQPA 4XF4A 3RZGA 3NAPC 1LECA 1V6MA 2H6BA 1BEV1 1LOGA 3OYWA 5D1IA 5F5AA 3BTXA 5JSOA 1JTZX 2O0OA 5JOYA 4QPYA 3GBWA 2WZ8A 4AFAA 4N43B 4Q2FA 3DL3A 2AENA 2D6OX 5FJKA 2RS12 3R05A 3TN91 3BVCA 4XFHA 5AC93 4UI9L 5DN2A 3AYCA 2EIEA 2ERFA 1CGPA 2P34A 5LWBA 5JOXA 1HN1A 4UW5A 4CYDA 1QQP3 2DUPA 4XTPA 3IAPA 2EIDA 2ZGTA 4UFMA 3SCHA 2BTVC 2VQAA 2ADDA 1J59A 1XB9A 4W4ZA 3N9LA 4DPNA 1HW5A 3GM8A 5AVAA 1W9WA 1PO12 3VDAA 5JUVA 1PNGA 2ZEXA 1Q8QA 5FUPA 2WUHA 2NMOA 1ZRFA 3LEKA 2BUKA 1W9YA 2BW8A 3ZXFA 5AC91 5TSWA 4GIQA 4XCBA 1NX9A 3FL7A 1FT9A 3PL0A 2VL4A 4P9JA 1QQP1 1HXS2 2JB4A 4UBHA 1UY1A 2B42B 3PUIA 3I3QA 2JE9A 2BGCA 4DXRA 4A44A 1MZFA 2Q5TA 4J1XA 2EA7A 3VBRA 4FXGB 1DGRA 2CY6A 3ZM8A 5JCTA 5DABA 3WQBA 1AX0A 2ZHMA 5FMBA 5A1FA 4Q0PA 5SV5A 4R9CA 5CKMA 4DOUA 4YW1A 2PHTA 3IDCB 1L7RA 3P6BA 4O61A 4YW7A 3UKTA 4FPHA 4IXLA 3U1XA 1JZ4A 4CCOA 3OY8B 3T2PA 3WD5A 3MPPG 1HB1A 1MVEA 3IN9A 1FMD2 4I3PA 2C0ZA 2OA2A 1OOPC 1ND3A 3LWCA 4ONUA 4Q1RA 1H8TB 1Z0HA 1WLTA 4FOVA 1GP4A 3H1WA 4Q26A 5A33A 5C7GA 4CDQC 5KHJA 2G9GA 3RG0A 1OBNA 3MIEA 4MGTA 3D0JA 5AFEA 4Q1PA 3OPZA 5KXBA 2EF6A 1AJKA 2VUCA 1RUJ3 4HN0A 1JODA 1OXCA 5J7MA 3ZKUA 2JDNA 2R072 3CJIB 1ZRIA 4L97A 4OI1A 2XUEA 1OVSA 4AHZA 1W2UA 1CAWA 4I30A 1V00A 1UZZA 1VBD3 3AP4A 5BXXA 3PIGA 4EV0A 2VO5A 2KD7A 2JKBA 3AL5A 5LB6A 4BWOA 1X36A 3NVCA 1R092 1YLLA 4P08A 2XJTA 3O1RA 3IT8A 4XDOA 4NHYA 4NO4A 1HLCA 5FZ0A 3RYRA 1I3HA 2WS93 3ECQA 3S30A 3V56A 5IVVA 5JPNB 1F8VA 2DWRA 3M4FA 3MLKA 1WD3A 5I0SA 2Q1MA 1RUJ1 4QGMA 1G9AA 1UMIA 2VQTA 3MI8A 4IV3B 4K8RB 4CDWC 2ORXA 3URFA 2P17A 1SFNA 2YFZA 1BKZA 4B3NA 5I91A 2KA3A 3OGGA 1BVVA 1C28A 1UZWA 4AW7A 2LROA 1VALA 2PHRA 1DQ2A 4XC9A 3USSA 1CONA 1H2MA 3FMGA 2KR2A 1SDDB 5A6ZA 2D40A 3CEWA 4IETA 4BIFA 1R082 2JEMA 2Y8KA 1IQAA 1FI2A 1W2AX 1X82A 4O65A 1AR92 4QQ2A 2W52A 2WS91 4OI2A 4WV8A 5LA9A 4DIQA 4LKEA 3POJA 5LA0A 4EROA 4HL0A 2XWBB 4D0QA 2DF7A 4LLFA 2OYZA 3UJQA 1W28A 5D8AB 2VVFA 3KCCA 4YW4A 1JS9A 1QJZA 2DTWA 3ZXGA 3BPZA 4YNIA 5A3MA 5ABJB 4V2VA 4BYYA 3UETA 2JJ6A 1J84A 5IK7A 1J58A 1MZ6A 2JICA 2WQ4A 4FO9A 1IGOA 4J25A 1WMEA 3ACGA 1RJ7A 1OH3A 3GNEA 3GZAA 3KZ4C 2E7QA 4D7YA 5A7WA 3T30A 3M7AA 4JZRA 2ZKNA 5FY5A 3LOIA 5HV4A 2ZBJA 4YFWA 1C3HA 1VJ2A 1V6KA 3WUDA 5T54A 2C9KA 3IDBB 3PU8A 2W1WA 2ARAA 2ETEA 3WVJA 3AP5A 3ZMNA 3O1VA 5LZ6A 3EXUA 3FHIB 1PGSA 4RFT0 2WBKA 4UFLA 1DDLA 3PVEA 4QQPA 5FP7A 3ST7A 2R16A 1WCUA 4OUSA 2VM9A 4GH4A 1K42A 4UWDA 2PHUA 1AX1A 5G05L 5I0TA 2WNUC 3AXDA 2WIIB 3H8XA 3AMNA 5GALA 2VNGA 3EBRA 4AVAA 3WDUA 2E32A 1RUJ2 1W0NA 3VKMA 4ISRA 2I45A 1MQTA 2JDMA 3DYPA 3OUJA 4QX3A 1F31A 1VBD2 3WDVA 3FLRA 3RS6A 2A75A 3C3VA 2VOTA 3HQUA 4EYUA 2BOJA 5CFCC 4AAPA 5L9BA 2UWCA 3M70A 3RPQA 3WUCA 3FUQA 4RR3B 2DV9A 2WS92 4RA0A 4CEYA 1JZ2A 1TQ5A 2IC1A 1KRIA 2VMHA 1V9U3 4RN5A 3D6EA 1RVF3 2VMEA 4KU8A 2H0BA 2HEVF 3MV11 2X5IA 4RYDA 5FR3A 5C71A 4FFFA 3O1OA 3THPA 2LW8A 4COWA 1EV13 3I2OA 4HOOA 4Z1VA 1FV3A 5EJ1B 4P02B 5B4NA 1G7YA 3H3UA 5BNPC 1F4HA 1O3RA 3WX5A 2BZDA 3HN3A 3RI9A 4AYUA 4X8PA 5T5LA 3THDA 4AGGA 4CA9A 2EIGA 5C8CB 1AR72 3ETPA 1DGWX 5EPAA 4DXSA 3POEA 1MZ5A 2LALA 3ACIA 2VOVA 3AVRA 1UWWA 3KGZA 5E8AA 2VZTA 2HH9A 1QU0A 3HNBM 4SLIA 1POQA 1Q8VA 2OPWA 1V9U1 5FZ7A 1BHGA 1RVF1 1S0GA 2YROA 3APBA 1RUC3 2HYKA 4Q4X3 1EV11 1ULEA 2ZTNA 3NV2A 4IV1A 3ZSLA 3ZYBA 1GQHA 3HBKA 3ZYHA 3ZYPA 5EWSA 3HNMA 4GZ9A 3AX4A 4BA6A 2WSUA 1ACCA 2YC4A 4XILA 3M3EA 5KXDA 3N35A 3BOWA 5LATA 5A3NA 1QOOA 3VBSC 1VBA3 2JDAA 4H55A 3UGGA 3HVDA 4TSVA 4FOQA 1SBEA 2VCAA 1ZREA 1LENA 1NZIA 5DAQA 5LK5A 3THTA 1TMF3 4A7ZA 4ZZ5A 2TUNA 4FPOB 4LIVA 1UYYA 4E2SA 1QNWA 1RUC1 1SDWA 1NQJA 4FT8A 4EZ4A 4CEWA 4BLIA 4Q4X1 1IHMA 2CGOA 4QQOA 2DYCA 3CBNA 2DU0A 1H0BA 5A32A 2TEPA 1IPJA 3ZFGC 5IFPA 4YZ4A 4IE4A 4RFRB 3WHTA 4DUXA 4NOTA 3WF4A 2P4EA 3CZJA 2IFRA 4HVOA 2EXIA 2G9FA 1VBA1 4Y5SA 1WUVA 4EWDA 5DG2A 2NZ9A 4MOAA 1YJLA 4JDOA 1YJKA 1D7PM 5BNNB 4Y5TA 5IVEA 1TMF1 2ZMKA 1UU6A 4S2HA 4WM7C 5IAXA 4JCKA 3MV01 3RVHA 5JSPA 2MNGA 2Q30A 2ZCWA 4N7IA 4A42A 4Y1ZA 1VRH3 2QQNA 2MHFA 1Q8PA 2PQSA 2OPKA 4XYXA 5CU1A 4HLTA 3JQXA 1SBDA 1K5JA 4RS5A 3SEEA 5FZCA 3ZN4A 1UY4A 4BISA 4L9BA 5FYYA 1V9U2 1AR62 1SFPA 4FTEA 3N9QA 3NW4A 1YQ8A 2YU1A 2DVAA 3MFAA 1C8M3 4L11A 1J1LA 4LITA 3IDEA 5F3IA 1EV12 2VUDA 2X10A 2CAVA 1OHFA 2QQWA 2QQLA 2VOKA 4NHXA 5FYSA 2VGDA 3WG1A 2RM23 3B9IA 2FD8A 4XZPA 5C3PA 4AEDA 2DBNA 2R1DA 3CJIC 5KWRA 2IXJA 2ZXQA 4AGRA 1IZ3A 1O91A 4AG4A 3PUSA 3MICA 3C7EA 1W8UA 1V6NA 4F83A 1HRV2 2RR12 1VRH1 2BERA 5LA1A 3AFKA 4XUNA 2ZKLA 2WT0A 1ZX5A 4JGYA 4MX3A 1RUNA 4YPJA 5F2WA 3O1PA 2GDFA 2XJRA 3J8F3 4BB3A 1ODNA 3KVBA 4XFAA 5IHRA 1W06A 4DRRA 1AXZA 1RUC2 1CN1A 1DQ6A 1C8M1 4Y4YA 4QX1A 3W59A 4Q4X2 1J3RA 1ZA7A 4TN7A 1QH6A 2R30A 3M3CA 3WQ7A 2J1TA 1LEDA 2P6CA 4QQHA 5FZ3A 2RM21 2CTVA 5FZFA 3IAQA 4XETA 4UBGA 1NY71 3VDDB 3IMMA 3GHMA 1SCSA 2R0FA 2VULA 4V2WA 3VBRB 1IOAA 2FCUA 1ASJ3 1SPPA 1PX4A 1UD1A 5E16A 2V09A 3J7NA 4MVTA 3MF6A 1KITA 4PI2A 2TBVA 1XYPA 1O7FA 3J8F1 1ZRDA 3EJKA 2HWC2 3U14A 1CX1A 2Y33A 3LSDA 1GKBA 4FTSA 4FPLA 5D21A 3BTZA 5C8WA 4BQYA 1AYM2 4OUEA 4CDUC 2Y34A 2WQZC 5LRSA 4QDQA 4QPGA 5FO9B 3O1SA 3FHAA 4XURA 4NIGA 1ND3B 1X7NA 4RGGA 5JXGA 1TNRA 5FWJA 5BYNA 2EALA 3KB5A 2AC1A 5F32A 3D82A 4QDRA 5A33B 2PHXA 4NN0A 3VHNA 1W6MA 1OA4A 1OKQA 1ASJ1 1UCXA 3ZFFA 1DG6A 1QF3A 3WT3A 2J1UA 4FPYA 3BOPA 1KXGA 2CWMA 2VC9A 2XGXA 1W99A 3B01A 1GFF2 3HD8B 3LDRA 4LBQD 2NP0A 1POV0 1H8TA 1JOJA 2ILMA 4BK4A 3GF6A 3RMYA 3UT0A 1TEIA 4GKXA 4KWLA 2VZVA 2HWE3 2A3WA 1MS4A 1YI7A 3IIAA 4COYA 4OZXA 4MXWA 3H50A 5CADA 3O0XA 3M3IA 5L7OB 3I7DA 5FY4A 3F95A 4Q27A 3D3AA 2E7TA 4GJZA 2ZS6B 3OBZA 1GOGA 2P2KA 5J98B 5FJHA 2HWF3 1UPIA 4I01A 1PHMA 1FNYA 5FZMA 4URAA 5C9AB 1NY72 2ES3A 2VU9A 2CDPA 4TLFA 3LGRA 1CR7A 1Z7S3 1K45A 1VBC3 4JVAA 3SQOA 3BYWA 2XXZA 1RXGA 2DFBA 3C2UA 3U0ZA 4FPFA 4LEJA 4OI4A 3ASIA 3L2YA 2R062 3MHZA 4JRAA 1DQ0A 2VMDA 2HWE1 1RHI3 3B3QE 5FYTA 2RMU2 2VR4A 3I2IA 5BNOC 3Q8BA 2NLRA 5K0UA 3J4UH 1RUH3 4Z92B 4MUVA 4IV3A 3EHKA 1AVBA 3PMEA 4HSJA 2CV6A 3FFQA 3LF7A 1JZ5A 4NPMA 2VZPA 3THCA 4O7XA 1DYOA 3WNMA 1GMMA 2HKXA 3DECA 4FXKB 3BU7A 1Z7S1 1VBC1 3GBFA 5FY7A 1CAXA 4K9SA 5CKNA 4HKLA 4CZSA 2LUWA 1AL22 3JB4C 4LR4A 4META 3VBHA 4P5YA 4AAXA 2D6PA 3JB8A 4KI5M 3H3ZA 4XBLA 4CCDA 3EQEA 5LEJA 1DFQA 1RHI1 1OH4A 3O5SA 4URTA 5A7WB 3VBFC 1UF2C 2PLV3 5FPBA 3T2TA 3VBUC 1X9TA 1EPWA 5A7NA 1GP5A 4KBZA 3C8XA 1RUH1 3PUHA 5D8AA 3KT4A 2OX0A 3E5XA 3ZMOA 5JIUA 3O7OA 4R4XA 1O4TA 5C4WC 4DRVA 4PLNA 3O1UA 2G1MA 4NHMA 4J1WA 4CPBA 2D93A 3FHQA 3WCSA 2HBUA 3SCGA 3MIGA 1KQRA 3PIJA 1LODA 2JIGA 5F37A 1O3TA 4GH4B 3S5AA 4DUWA 2QQVA 2RDQA 3POGA 4XE9A 2V4VA 4XFCA 5F8PA 1B35C 1GNZA 3OSDA 4FPEA 5E89A 4ZS2A 1LRHA 3K77A 3TEWA 1BCXA 1CVNA 3OB8A 2HWB3 1NE6A 3KSCA 3T1MA 3MO4A 1BMV1 1MS1A 2PLV1 1REEA 3MIDA 3D8CA 3PUQA 2IFWA 1JI6A 4Z2AA 1UU5A 4C0HA 1S2BA 4P9XA 4FPCA 2J22A 1H1IA 1DYKA 1ZZBA 5CA6A 3UV9A 1GLHA 3H3LA 3WW4A 4AEKA 4EQVA 3V0AA 1UAIA 1Z78A 3TEXA 1LOFA 1VAKA 1WBFA 1ZNPA 2Q1FA 3NKTA 3T4HB 2K9ZA 5FLIA 4P9YA 3P5BA 4FAHA 1C8NA 4CEYB 4A4AA 4PDWA 2CU5A 5IUQA 1FAYA 1W8WA 2WZR2 2HWF2 2HWB1 5GM0A 1F9KA 3FBMA 4XUTA 1JU3A 4QB6A 3LSEA 3VBOB 4L2NA 1VBC2 4MGQA 5FREA 4XFBA 2QDRA 3I8TA 1RUI2 2BYVE 3BGAA 3QLQA 5HV0A 2QBXA 2UYBA 4EWEA 2QQMA 4QMAA 4MHUA 2Z4FA 2Y0OA 4HK9A 5FPVA 1XE7A 5G04L 3S0MA 1RHI2 1YQ5A 3GJBA 1PMJX 4XZUG 4FTBA 5FZEA 3QH7A 4JKLA 1D4M2 1VRBA 4Y3OA 4LOSA 1YEWA 4QB1A 4QPIA 4YGEA 5IATA 2RS13 1NCRC 1GWLA 4A6OA 3A22A 3MLJA 4HT1T 1W3VA 1CZVA 5DAWA 5FK8A 4JHZA 1ZZ6A 1UMZA 1DLCA 5CIRA 5BPXA 4DFSA 1CAVA 2CNAA 3EB7A 5CBLA 3K4AA 2YB7A 1RINA 3DPRA 4LLOA 1PO13 1VIWB 4LULA 1BMV2 3AB0A 5FZDA 2P3KA 5CG9A 3GZUC 4WM8A 5EP9A 3S6PA 3ZPYA 3SISA 2NN8A 4KL1A 4OLLA 4RQPA 5FZKA 3VZOA 2RS11 1ZM1A 4P00B 3SHRA 4WZCA 2RJ2A 4QHZA 3LA7A 3ZYFA 1CPNA 1SLLA 3G7DA 3NL1A 4FFHA 4H7MA 4I0AA 5FXXA 4DEQA 5EXOA 4HXCA 5CKQA 4YM2A 2QQOA 3LPFA 2VPVA 3AZVA 3AZXA 4KGGA 3RWNA 2ZGRA 4FCAA 4CEWB 3JD73 5FKBA 3K51A 2F4PA 1EPZA 2JB8A 1KJLA 5F5QA 5A32B 5FZAA 4YVSC 5FUNA 1U12A 4AK3A 2BEOA 1PO11 3N3HA 1UIJA 3PVNA 5GZCA 1VMFA 3PVOA 2K46A 2XJVA 3U07A 4E4SA 3VBRC 1XU1A 1YUDA 2K2SA 4N8MA 2WR9A 2YDEA 1QNYA 1Q3EA 4XJZA 1FX5A 3VLBB 2DU1A 1CD3G 3KWVA 3EO6A 2YUEA 2WWUA 3ZR5A 4IQPA 4CP0A 4Q4Y3 3TBDA 1PK6B 4OHYA 5FYUA 5K8SA 1JOPA 2ID4A 1F35A 1O8PA 3B7MA 3I2FA 3JD71 4L99A 1JHNA 3GZEA 4AQTA 5CB7A 5JZGA 4N9HA 2GH8A 2ZMLA 4RS5B 4YZ5A 4QXBA 5KHKA 1K3IA 2XJUA 1ND3C 2V73A 2XHNA 2YGLA 4S2GA 4BXFA 1IQDC 4CU9A 3AL6A 4XDQA 5LW9A 1ULCA 5BNNA 1REFA 2R073 4K8FA 2ORZA 2GN3A 3VZMA 5JOWA 3V64A 3DYMA 2W2IA 2ZOEB 1S0JA 3K3OA 3P1IA 3MIFA 5HXVA 5J96B 2I2SA 3ZXLA 2ADEA 4Q4Y1 3WDXA 4AEDB 5LK7B 2WAAA 1R093 3RFRA 2JE8A 2Z69A 2FHRA 2QZ3A 3U37A 3FN9A 2YU2A 3WG4A 2XUMA 5FWEA 2VUJA 3ES1A 4YLZA 2GAUA 5APAA 4ZXKA 2AGSA 4CDXA 3R4SA 4JGYB 1SFYA 2ZGPA 2VMFA 2XQXA 3Q8EA 2XL9A 4CCEA 2WO3A 1H6YA 1UKRA 3SH3A 5KHIA 2EIBA 2IXKA 3S5QA 3AP9A 3GJAA 2R071 4M00A 2UY9A 4CTEA 2RS33 1OD3A 4COZA 1OURA 4AVCA 1LGBA 3ATGA 3FLTA 2CGNA 2VOXA 5C33A 4U2AA 1XQNA 3HT2A 4M0HA 1YFXA 1O5UA 1HJFA 2WLPA 5LEKA 2YPDA 3HIFA 3DCQA 1R091 3N9PA 2V4AA 2Y6HA 4I3GA 3F2ZA 1SPPB 4AI3A 3BUCA 1R083 1WA6X 3N7MA 1AR93 3WG2A 2YZ4A 5C3QA 2L9LA 1KS5A 3RZMA 2JD9A 2XL7A 3ZXEA 1X8EA 4FOYA 4OZOA 3WOGA 3SXWA 4X6QB 2RS31 3VDDA 3ZXKA 2J1EA 4A41A 4YZ1A 3VL8A 3JD72 5CFDA 4AI0A 2FMYA 4MGYE 4QDSA 3OBAA 4QPGB 5LY1A 4XJUA 1W2OA 4Q4V3 1I5ZA 1MS8A 2E51A 4FP2A 3ABZA 1AXKA 2W5FA 3BALA 2AUYA 2P6HA 5FZHA 1A6CA 1W6MB 2VE1A 1TVGA 2WNVA 1G9FA 2V5YA 4IE6A 2WDBA 3AJZA 1R081 4E4DX 2DCYA 2WWSA 3PLQA 1IS4A 3ZFFB 1AR91 1OVPA 1VBB2 2RE9A 3CKHA 3FX3A 1C5IA 4FBFA 4Z2WA 3LD8A 3MEPA 1W8TA 2VY0A 2ZABA 3ILFA 4Q4Y2 2GMMA 1QJX3 3KF3A 5A80A 3POFA 4G4FA 2NPIA 1ND2A 3LE0A 3SMHA 5GJ6A 1JYTA 1R1ZA 5AFBA 3M8LA 4Q4V1 2Q8DA 1K5MC 4ZY9A 4DZGA 2WL1A 4B29A 4YM1A 1CIYA 3H0OA 4MXWB 3H1MA 1XC6A 3EMRA 2D6LX 1J83A 1US2A 2P1BA 2QUOA 3C7GA 1YFYA 4XAEA 1UPSA 1VAVA 4C1XA 4GH4C 3VUOA 1KDKA 4LUKA 4R9DA 1MVQA 5DXDA 1OFSA 5JAXA 1N1TA 1RMU3 1C5HA 4XXAA 1QJX1 4MLOA 1X50A 3O1TA 5IVBA 1MQTC 4HVQA 1EUUA 4P5HA 4DUVA 4IEYA 1FOD2 3TAYA 1LOEA 1G86A 3I3DA 3U75A 4D7TA 3S7EA 5A7QA 5HCHA 3IB3A 3PNAA 3ZN5A 1S4CA 5HXMA 4FI9A 5EJZB 5C9AA 3L2HA 5K0UB 3RZLA 3NAPA 4AI8A 2RS32 5ANNA 3NNLA 3PHMA 4NRQA 4QPWA 2ZGSA 1UXXX 4CEYC 4N9IA 1AF9A 1VBD1 1W6PB 2CAUA 1S2KA 5A6XA 3V0BB 2JDPA 4JGZA 3U78A 1WD4A 2Q0AA 3E6DA 1RMU1 1TG7A 2ET7A 4JV4A 4AGVA 1GP6A 4AHYA 2YPJA 2X5IC 2WFF2 5FZGA 4LBKA 2XHKA 1XBFA 3OD4A 2ARXA 1CAXB 4ARXA 4JAAA 1G6NA 1AR73 1X8MA 4NROA 1QDCA 5IJRA 3ZVXA 3VBHB 1W6QA 3OPTA 1Q43A 1J1TA 2A70A 2I74A 2XONA 2GNBA 2IXIA 4LPLA 4U36A 5T5OA 5A3TA 3MFCA 2WABA 2DUOA 4XIKA 2RVAA 2BFUS 5DUVA 2ZZJA 1QIQA 2D5FA 3ACFA 3LIGA 1SG3A 2LS6A 5C3SA 1V70A 4Q4V2 1W8ZA 1VMHA 2GP3A 1D0GA 4XFIA 1W8OA 1LTEA 4AFCA 2ZAHA 1GZTA 5DQ0A 4HG6B 4M4PA 1GSLA 1AR71 1A3KA 4IV1C 4M0NA 4Q4W3 1OT5A 1B09A 3LFIA 4LT5A 1G8WA 4P14A 1YRZA 2ET1A 1CX4A 2WO2A 3UJOA 3ZPOA 3FFZA 1QJX2 4XUQA 2A6YA 4INDA 4IERA 2BP6A 4JKMA 5FMCA 2XQRA 1HB4A 1OLRA 4OQ8A 3W5MA 5KXEA 1WMFA 2Y6GA 3OUIA 4AQSA 2EICA 4N7UA 1UIKA 4UFJA 3V0AB 3ZN6A 1REDA 2IXCA 1OOPA 1OFNA 4XFFA 3WW2A 5BNPA 2WFPA 1DBNA 1H9WA 2BWCA 3MUY1 4K3UA 3WW1A 4ASLA 2W92A 2NMNA 2ZEZA 4Q4W1 5BY5A 4XHXA 4UF0B 4PDWB 3OGVA 4ZHNA 5CVRA 4AR2A 1WW4A 4O9EA 4YGCA 4LO6B 1O3SA 5J48A 1DQ4A 1RMU2 2JKXA 2G9ZA 3OCPA 2VZRA 3K4ZA 3PTYA 4FFGA 5A6QA 1JBCA 3P3NA 3SITA 1DZRA 4XAAA 2GC2A 3UKNA 2OS2A 1AUYA 2O8QA 2GH2A 3ACLA 3E5QA 4KQ7A 2X05A 3ZDVA 3CDZB 2VMIA 3Q9OA 3H42B 4XF1A 2BFUL 1CAUA 2WZPP 1HX6A 4IGQA 5ERLA 1IKQA 1AR63 1Q56A 2QQPA 4UOJA 2BU9A 3I54A 2I07B 5JMOA 3CHXA 4OFGA 1O59A 2VTXJ 1PMIA 4YGDA 1GICA 2NYYA 2D3RA 4E2QA 4QPIB 3VBOA 1Y9QA 3AKQA 1AR83 3Q8CA 2WO7A 4RL7A 4XXPA 3EYPA 4RS5C 1ZBE2 4MADA 3LOBA 4QKNA 2FDGA 1OPMA 1HV0A 3OEBA 4XBQA 4ZU4A 4IEXA 5FO7B 1WKYA 1OKOA 1OA2A 2RJLA 5FYMA 4DS0A 5IT6A 3CL1A 3WP6A 4YVWA 1HRV3 1CAVB 2RR13 1JMUB 3GCWA 4OHVA 3IMNA 4UYBA 4NIAA 2XJSA 4D69A 3DPRB 4IEQA 5F39A 1KDMA 1KFUL 2B46X 3NMBA 2WO1A 1AR61 4YFZA 3D4KA 1PX3A 4NRPA 5A7SA 4WM8B 1AHSA 2W3JA 1ENSA 4K1ZA 5ACA2 4K20A 4N43C 4RQPB 1OSGA 1AR81 3IPVA 3PUAA 4JGYC 4TLGA 1HV1A 3ZSEA 2QQJA 4I09A 5FZOA 5IVYA 1ZA4A 2OZ6A 4EE2A 2X53S 1LU2A 2P3JA 1BBT2 3B9CA 4AXOA 5CYYA 2YBPA 3UL2A 4Q4W2 1HRV1 2RR11 1YC61 2D7FA 2XKOA 3ZIXA 2OQ6A 4DXTA 3UGFA 1WBLA 2A6ZA 2VJXA 4UFIA 1NQDA 3NJZA 1JYIA 1ONAA 2BVBA 1BVP1 3KV9A 2HWC3 2VZOA 5KR7A 1GUIA 3C7OA 2GNTA 4GKYA 4F7ZA 2PHLA 1AYM3 1GV9A 4XACA 3I2GA 2W9XA 1W9SA 1DQ1A 4KMQA 3WF0A 4E4ZA 2ZMNA 2RDSA 3QD6A 2DCTA 1RIRA 3ZYIB 3T0BA 2HEWF 4G9SB 2P3IA 3M3OA 3JUUA 5JZGB 2HYXA 4OMDA 3NSTA 4QPGC 2N7GA 3ZSKA 4I0WB 2J1SA 1RUE3 3AP6A 3GDBA 1IS6A 1V6JA 3K46A 4L92A 2F6BA 5FQ0A 3KCXA 4L8QA 1IPKA 2A6WA 1SEFA
chains in the Genus database with same CATH topology
1PK6A 2HWC1 1W39A 4KH9A 4XPVA 5JOZA 4OHZA 1AYM1 1ENXA 1RUD3 4P9GA 4Y1UA 5JI7A 3A0KA 3KMHA 1VAMA 1W0PA 4GQ7A 2Q1ZB 4QU2A 2YY1A 2JDZA 1H8TC 5T5JA 4B4PA 3POSA 4ZKTB 4CDXB 1S0CA 1GQGA 1AR82 4C90A 5BUVA 3PJYA 1RUE1 2KM2A 3CO2A 1BYHA 3I2DA 1PZ7A 2WKKA 3FWEA 2WJSA 1LGCA 4DY5A 4TWTA 4GWMA 4OUMA 4Q8KA 4LBLA 1RUD1 2B45X 2R063 3OGJA 1N1VA 1ZZ8A 2Z42A 2JG9A 4XQ4A 2RMU3 4QM9A 4FPKA 1MR5A 4Q0SA 1QXRA 3WY6A 4A2UA 3O14A 1LHVA 4PBPA 2UURA 1S0IA 4AFDA 2H0VA 3QOPA 5FLHA 2WA3A 1QJU2 3B93A 4HMZA 4NVPA 4PF5A 3WCRA 4HVRA 5K0UC 4WVWA 1QOTA 1U5IA 4IV3C 3FBYA 5CFDB 2XH6A 1DIWA 3CLPA 1TE1B 3MIHA 1AL23 4JTOA 2VXRA 5CG8A 1H9PA 4XJAA 4Y1VA 2R061 2BWAA 1GZ9A 1A78A 5L36A 4R8HA 4K40A 4YG0A 2RMU1 3B00A 3E5UA 2WNVB 3DUIA 4XEZA 2YHJA 5GKAC 2WNEA 3VBSA 5L7OC 4XFGA 2CGPA 1LHNA 5DDJ3 1HKDA 4AQ2A 3VHPA 1AL0G 3B5LB 2XPJA 4Y22B 2XKPA 1ND2B 5D8AC 4FQ4A 1OLQA 3WZ1A 5I8TA 1SACA 3MDPA 1AL21 4GMP3 4IEZA 5ABJC 1LCLA 1QWRA 4XTMA 1RUE2 5FO8B 3VKFC 4WVZA 4R4ZA 2R49A 3DV8A 1PIV2 1DGLA 1YFUA 4HKOA 4N53A 1URXA 3SNMA 2PFWA 1RUD2 4PBOA 1ZZ7A 5JR7B 1HQWA 2AR6A 5DDJ1 4FVVA 4QX5A 4HK8A 2C9AA 1R1A2 5J37A 5EYXA 4DMIA 2Z2SB 4GMP1 2ZX2A 1BZWA 2WZR3 3AYDA 4HANA 3CU7A 3NAPB 2ZX1A 4JTNA 1LOFC 2IWGB 2DCJA 3RRDA 3U4XA 1VB2A 4XF0A 3OBRA 3HT1A 4LBQB 4LNVA 3G6JB 4PDWC 1RB8G 1RUI3 4JGZB 1XRUA 5CAZA 3DN7A 4UW6A 3LKJA 1F2NA 2WT1A 4KU7A 1N3PA 1FNZA 4MYEA 5EJ3A 1W6QB 2UY8A 3JCIA 5T52A 1D4M3 4RR3C 4Y24A 1WGPA 3SLIA 1GR3A 4HPKA 4B4RA 4YW5A 1LOBA 1W6PA 3I59A 3V0BA 2WZR1 1LHWA 2HWF1 2OVUA 5E88A 4D94A 2D6MA 1DF0A 4XMIA 1DHKB 3WLUA 4A7YA 1AX2A 1MS5A 5I8YA 4NWVA 1CJDA 1VB4A 1RUI1 1W6NA 4J6GA 4KNCA 2WZPP 2VW0A 4ASMB 2VH9A 3RYKA 4A3XA 4LBOA 5FMOL 1JUIA 1WLDA 4TYSA 3WDTA 1RTVA 2B7YA 2GZWA 3OJBA 5C8CC 1D4M1 1GZWA 3FLPA 2AREA 3IBMA 3DPRC 4OULA 3ZDSA 3AJYA 3FC0A 2X8KA 3L9JT 1S0BA 4FQZA 5DDJ2 5H9PA 1LU1A 4WM8C 1Y3TA 1GYKA 4YRDA 2GC1A 2EXHA 4K6BA 3RQ0A 4RQPC 2Y0IA 3KQRA 1YFWA 3RYPA 4CDUA 2H6CA 1COV3 1W6OA 3ZN6B 2WC2A 4IEVA 1OOPB 5BNPB 4Y1XA 4EN6B 4I02A 4XOGA 4CDQB 4EN9B 4EJRA 3MPBA 2YGMA 2AZ5A 1HQNA 3FZ3A 4LBNA 4C1WA 1F5JA 1ULDA 4ISQA 2A71A 2PAMA 2PTMA 3ME2A 4B4QA 4YW2A 3POWA 4C91A 2QZ2A 2TNFA 1CAUB 1COV1 1NXMA 2YYOA 2QNKA 4WBBA 3NV1A 4X8NA 1H2KA 4AE2A 5IK8A 1X33A 3TWIA 3OTFA 2FMDA 2EVXA 3H7JA 1XYOA 5JZGC 1ENRA 4RHV2 1NE4A 5GZDA 1IKPA 4BQ1A 4OHXA 4FP3A 4ZU5A 3AKRA 2A7AA 3ETQA 4Y26A 5BNNC 1N1SA 2GU9A 5K7PA 4XJ9A 4CDWB 2YMZA 4HBNA 1H2NA 1M06G 4YVWB 3KS7A 3VZJA 1WW6A 3AXEA 3X29B 5EV7A 1F5FA 3ES4A 4BHPA 2C1FA 4P9WA 1MEC3 2D44A 5EZWA 5BNOA 3MW2A 2R32A 4CDXC 3IPVB 1XNBA 1QKQA 3AP7A 1JXNA 3QCWA 3W58A 2E53A 4DY3A 4G3YC 2QDNA 1BK1A 2ZX3A 4QHBA 3W9AA 1WCDJ 2XWJB 2BNMA 4AVBA 5BNQA 1SLCA 4NHKA 4YW3A 2BVVA 1QDOA 1MEC1 4MGKE 1NA1A 2PYTA 3U11A 4R9BA 3VBFA 4LO4B 5JSRA 1NLRA 4TZDA 1NZCA 1OQEA 5FOJB 3E6CC 2XJQA 1OQDA 1J3PA 5C4WA 3ELNA 1COV2 5FFOC 4FOWA 3HN1A 1OA3A 1J3QA 1IS3A 3VDDC 2D98A 2QFEA 3VKOA 1B35A 2W08A 4H14A 1VBB3 5FQ0B 2Z5WA 2WNUB 1ENQA 2Y38A 4GB32 4Q0VA 1ULGA 2WNVC 3ZSMA 2G4IA 4AFMA 3AFGA 1LGNA 2EXKA 4Z07A 4LO8A 1I6XA 3ZYJB 4YG3A 4K1YA 5A3LA 2HEYF 2SBAA 2R042 3ZO0B 4I2OA 2WT2A 4UW4A 1XE8A 1XU2A 3AMMA 1PM7A 3B02A 1VBB1 4AF9A 2XLFA 3PJQA 5T50A 1BXHA 5FCCA 3MF9A 4QM8A 1QXJA 2DTYA 5FLJA 2OUHA 2B5HA 3MLLA 1PZ8A 1LKNA 2XBO3 1FOD3 3WINE 5BV6A 2ZAAA 1BQPA 1YI9A 5CNAA 1DZTA 2JG9B 1MEC2 1VR3A 2OIIA 2VG9A 4ES9A 1H2LA 1DU3D 1LJ7A 1NCQA 2A3XA 2D6KA 1FXZA 1MZEA 1NCRA 3VGIA 4D3WA 4Q0QA 5C9AC 4AHXA 4AWDA 2WFF3 1UZYA 1QJY3 1YIFA 1QY4A 2XBO1 1FOD1 1ALYA 4K7JA 1XNKA 4R52A 4NPRA 5GZGA 4MV2A 4JGZC 5KHHA 2ZPXA 2IXLA 1C1LA 1QOSA 2ZA9A 3BB6A 3M2MA 5HCAA 4LA3A 5GLVA 3MYXA 5L73A 4E27A 3VBSB 3KT7A 1WMDA 2ZGKA 2CWSA 2W39A 1AJOA 2XVKA 4AVSA 2DVGA 2WFF1 1SMVA 2XVGA 1AYN2 1QJY1 1BJQA 2ZGQA 3AZYA 5HCFA 4AVVA 4F3JA 1U5ZA 3ZXDA 3D0SA 1Y43B 1DGWA 4E9KA 1SLAA 3ZFGB 3GHNA 4YVSA 2JG8A 2BBVA 3RI8A 3DF0A 4EN7B 4N53B 5I0RA 2VMGA 4Y22A 1O3QA 1PNFA 3TNPB 4HSLA 3AKPA 5GLUA 2PAEA 1VBE3 4IL7A 3ZFEA 1JUHA 4HN1A 2BQPA 4KG8A 4WM7B 2VOWA 4N90A 4YZ2A 2XJPA 3ZXJA 2JENA 3LA3A 1HQLA 1NYWA 1Q8SA 4FPGA 4YYOA 2X29A 4H3WA 3AMQA 4ORFA 5BNPC 3AKSA 1BEV2 1M4WA 5JVVA 4Q0UA 3R4DB 3H9AA 3OF1A 2XBO2 3KGLA 1A8MA 1OI6A 3TN92 1VBE1 3KD4A 4Q29A 2ATFA 2B9UA 1L3JA 1PVC3 1RC6A 2QVSB 1UL9A 1XNCA 4HPKB 1LOCA 4LBQA 4B7EA 4ATEA 2BNNA 1ZBE3 4WVMA 3I59B 2W0XA 3VZKA 1CPMA 1U0AA 1QJY2 3WP3A 3KM5A 3VBOC 2C5DA 3TB0A 4S2FA 1Y7BA 5H9QA 1W6NB 5AC92 3KT1A 3AYAA 4Y1YA 1RJ8A 2A6VA 5H9RA 4IEOA 4AEJA 1RL3A 5FPXA 4W6XA 1QQP2 2P37A 4YSFA 3J9SA 1V6OA 3IM0A 1WCKA 1PVC1 4YVWC 1YCIA 1GZWB 5ACA3 2DCKA 3FJSA 1H4GA 1HRI3 2DUQA 4A7KA 1EYBA 1ZBE1 3OD0A 5EYYA 1WLCA 1Q5OA 1RITA 3K48A 1NXD1 1RUG3 3AM2A 1BBT3 2ZGUA 4HKWA 1VP6A 3USUB 5JWPA 4QGNA 4CDUB 4QQLA 1W6OB 3TNQA 2ZHLA 5I0UA 4B8EA 2AH2A 4ITCA 2ENRA 2D3SA 4MGZE 1KD7A 5FAXA 3AMHA 4YG6A 1E57A 2D43A 4XJ8A 5ACA1 2OZJA 1HRI1 5I8SA 3WP4A 4GWNA 1VBE2 2E9QA 1JW6A 3JU9A 4W6YA 3R4UA 3RJ2X 3LAGA 1RUG1 2PA7A 1BBT1 1ZBA3 3RJRA 2HWD3 4CEWC 1LR5A 4CDQA 3WHUA 5J3UA 3GBGA 4RD7A 3IKWA 1K5MA 4WZFA 4H7LA 1LHOA 1APNA 4AI1A 3CNAA 3ZX7A 2DCZA 2GN7A 3BTAA 3LB9A 4IEUA 2VUAA 4Y20A 1U5YA 3CJXA 5HCBA 4HFSA 1NOVA 4IESA 3D5OA 3QACA 1PK6C 5F9TA 5KC6A 2VNOA 4EN0A 1ZBA1 2XVLA 2HWD1 1PVC2 1G9DA 3WDWA 2VVEA 4O9GA 2UYAA 1D2QA 4PIYA 3TYJA 4KWKA 2CYFA 4PIZA 5BNOB 3FE5A 3HQXA 4LO7A 4CDWA 1JN2P 4MGIE 2ZJCA 1PGW1 2DFCA 1DYPA 2XLGA 5GLTA 3VV1A 3KCYA 4YGBA 5F6KA 3WR0A 4AEDC 4DXZA 1YNAA 3B69A 3JQWA 1N3OA 3MGUA 4FAGA 4BZ4A 2FZ2A 1SBFA 2Q4SA 2GC3A 1GZCA 1HRI2 1LESA 4LE4A 3E6BA 4QGLA 4M3CB 3H7YA 2UU8A 2JG9C 1NA1B 5J36A 1QJU3 3VBFB 3POYA 3VBUB 1RUG2 5FBZA 4HETA 5T3NA 4I0BA 2FZ1A 4YARA 1Q8OA 1S0DA 5C4WB 2DVBA 2ZX0A 3CF6E 1YWKA 3M1HA 1GANA 4XBNA 3UKVA 4BMBA 1G9BA 1WCSA 3ENRA 4WVVA 2NQYA 1MACA 5H9SA 2JX9A 5FDBA 1B35B 2E7AA 3KLSA 5DZFA 1S0FA 2RS53 4BH9A 1PZ9A 5JI9A 3R0RA 1QJU1 1RGSA 5DUXA 5LRRA 1S1AA 2ZACA 4MXVA 5FTTC 1XNDA 1ZBA2 3HWJA 2GMPA 2HWD2 1EY2A 2UWBA 4AVTA 2LTNA 3HAGA 3NKGA 5F1RA 3WQ1A 1CJPA 2WNUA 2A73B 3MIBA 2PN5A 1PIV3 2ZHNA 1ZZ9A 1LOAA 4FSJA 4Y5Z0 4JDNA 4LTAA 3AMPA 4C0BA 2IXHA 3IWZA 5FRAA 3ZFFC 1PGW2 2RS51 4PLOA 5J09A 1D0HA 4W6WA 4BLJA 2JE7A 2OUJA 3N36A 5SV8A 4N53C 4BMEA 5CFCA 4DQAA 2CL2A 4UW3A 2XG3A 1UKGA 4DNYA 1R1A3 2PAKA 3RNSA 4JRLA 4LE3A 5KXCA 3A4UA 3RDIA 4AEMA 1I9RA 4XF9A 1SLTA 1U5XA 2D97A 5B2GB 1SLBA 5IK5A 3DKWA 5KBFA 3WG3A 4V1PA 2VQ0A 1PIV1 1YXWA 1N1YA 3S7IA 1WA4A 1NCQB 4GMP0 3RSJA 1H1AA 5C6CA 1H4HA 1NCRB 5E1RA 4OVEA 3QBQA 4MSVA 4YM0A 1RVF2 2QE3A 3OYWB 3P3PA 5K9YA 1QMJA 3J26N 4QD2A 1WW5A 4XIOA 1O5LA 1I1EA 1R1A1 4B7KA 1UX6A 3TOJA 4ZU7A 2IZWA 1PVXA 1V6IA 4LBJA 1O4YA 1QH7A 1DLLA 3ZXAC 3OBTA 3TRSB 3VN4A 3DGTA 4NHLA 4YM3A 1QXPA 4SBVA 4EWAA 4QXKA 2XLAA 4N43A 1YYNA 4Z8BA 2VW2A 4LUMA 4M3CE 2NM1A 1KJRA 5GLZA 3ZSJA 1CESA 2VW1A 3ILNA 1AXYA 3E97A 2VECA 2VNRA 3VBHC 1ZRRA 4BIOA 3LCPA 2EAKA 2RS52 4YVSB 2JG8B 2K0GA 2ZGLA 4GULA 4OHWA 4S2DA 3SCFA 2FBEA 2WLQA 5DG1A 1H30A 2A6XA 4JDMA 1VBA2 2Y26A 3NWKA 3ZIWA 2VVDA 1FATA 2Q8OA 3ZFEB 4BM8A 5GZFA 1TMF2 1WLWA 1HDKA 3ZFGA 3V65A 5JDBA 1W0OA 2E63A 2O1QA 2ZGMA 3RZZA 4W65A 2D3PA 2MPFA 1FPN3 3SH4A 3PVBB 3U10A 5FMOS 1NLSA 1OQ1A 1YO8A 4XQWA 2BNOA 1VLNA 2UWAA 2ZHKA 4WM7A 2GNMA 5EFUA 2R1BA 3M3QA 3NO8A 4Q8LA 4K21A 3OY8A 3WP5A 3H1YA 2YXSA 1HIXA 2SLIA 3O12A 1CAWB 2D6NA 4RHV3 1FPN1 2YC0A 1VRH2 1D4VB 4YZ3A 4WVMB 2ZX4A 4ES8A 4DINB 4PQ9A 2W68A 3UK9A 3MW4A 3NV3A 5DUUA 3CJIA 1C8M2 3VL9A 2B8MA 3VZNA 3WQ0A 4M01A 1D2SA 1MS0A 1KFXL 1SQ4A 1MS3A 3ZYGA 1A8DA 1MS9A 4NWWA 1ZVFA 2RM22 3AYEA 3WHTA 2EXJA 1C4RA 4IEWA 5IK4A 3HBZA 3VHRA 5GLWA 4LHLA 1H1MA 1T6GC 2GMEA 3O0VA 4RHV1 4QPIC 4XQDA 2ARBA 1DZQA 1RUOA 2R0HA 2WINB 2PQQA 3J8F2 3BCWA 2XB6C 1G9CA 1EP0A 2ZZQA 1RUF3 1C57A 5KHGA 3QH6A 1H8VA 4XMAA 3VHOA 4IEPA 3GALA 1NG0A 4XJWA 3MZHA 1OPOA 2JECA 1GBGA 2R6QA 3AZWA 2PHDA 2A5ZA 1POV3 3GZTB 4LA2A 1ASJ2 3USUA 5L7OA 3JBG3 4RSUA 1NA1C 2QJVA 4AFBA 3GYDA 1PGL1 4KBBA 1RUF1 2MEV3 1QGLA 1FPN2 2A3YA 2DVDA 2RHPA 1K5MB 1LEMA 1UU4A 3VKLA 5ABJA 2QCSB 5GZEA 3ZYRA 4NR1A 5DZGA 5HBAA 4CP1A 4LO5B 1S0EA 4GB33 4CRQA 2GALA 5JIAA 1O4ZA 4Y20B 1ZRCA 4XHBA 1POV1 1OMIA 1V6LA 1PO23 3ILRA 2Z79A 3O0WA 3JBG1 2JXAA 2ZGNA 4E2GA 1JH5A 1FV2A 4LHKA 3SH5A 1MQTB 4F8AA 2BPA2 1UW8A 2R043 4PLMA 2MEV1 4MH0E 1TNFA 1YHFA 5T5PA 4AQ6A 3ROUA 3N7JA 4P9IA 4MZUA 2HWE2 1TME3 3H8UA 4GB31 2GNDA 2AYHA 4JQRA 4COVA 1EAH3 1IS5A 2PHWA 1PO21 3ALQA 2QKDA 3VKNA 1LHUA 2ZGOA 1XYNA 5T55A 2E6VA 4XW3A 2X5IB 3A0NA 1Z7S2 2R041 4KG0A 4LBMA 2KXLA 4BOWA 3R6SA 4RR3A 4OI0A 3BODA 2HJIA 3N7LA 1TME1 1S55A 5FOBB 3T1LA 1PGL2 2DVFA 1RUF2 1RUH2 4RGAA 5I93A 1EAH1 1NCQC 4GXLA 1ZZCA 3WXPA 4KGQA 1C1FA 3MW3A 4KWJA 4M3CA 2RJKA 4GALA 4UXAA 3HMYA 3VBUA 4DB5A 4IV1B 3AK0A 3BIWE 1KS4A 2GSYA 2LM3A 5DUWA 1DQ5A 3AKTA 5C8CA 4AI2A 1AZDA 3LZZA 3JBG2 4R9AA 4ATFA 1LB2A 2JD4A 1N47A 3WDYA 3HR9A 1UN1A 2PLV2 3RMXA 5FPZA 3JZVA 1AYN3 1YIPA 3AZZA 2MEV2 5CFDC 2WSVA 1CIWA 1CQ9A 4XF3A 2DURA 4LHNA 3B94A 1HXS3 4P9LA 4Z82A 3VZLA 1SLIA 2PELA 3N7KA 4BPZA 3INAA 4M3CF 1PO22 3NV4A 1GNHA 2JG8C 5HI0A 2HWB2 4JC1A 5JLVA 5CFCB 1DGRN 4D7SA 1N3QA 2B39A 5DZEA 1AYN1 1ND2C 4EN8B 2O8OA 4PCRA 5L19A 3ZFEC 4CP2A 1FMD3 5KC5A 2YV8A 4FPJA 5AVPA 2PHFA 5F6LB 1TME2 5JPMB 3LA2A 3I4IA 1HXS1 1BEV3 2D5HA 1FYUA 4PJYA 4HZFA 4QT6A 4AHWA 3PMSA 1EAH2 1XXNA 3TN93 1SCRA 4COUA 1JYCA 3WW3A 3WNXA 4PIXA 1WW7A 1QHDA 4GA9A 1LULA 3WV6A 1ULFA 1ZYBA 2WA4A 2OW4A 5JMCA 3FUOA 1FMD1 4X6RB 4BCUA 1OD5A 2GC0A 2EAAA 2FQPA 4XF4A 3NAPC 1LECA 1V6MA 2H6BA 1BEV1 1LOGA 3OYWA 5D1IA 5JSOA 1JTZX 2O0OA 5JOYA 4QPYA 3GBWA 4AFAA 4N43B 4Q2FA 3DL3A 2AENA 2D6OX 2RS12 3R05A 3TN91 4XFHA 5AC93 3AYCA 2ERFA 1CGPA 2P34A 5JOXA 4UW5A 4CYDA 1QQP3 2DUPA 4XTPA 2ZGTA 3SCHA 2BTVC 2VQAA 1J59A 4DPNA 1HW5A 5AVAA 1PO12 1PNGA 1Q8QA 2NMOA 1ZRFA 2BUKA 2BW8A 3ZXFA 5AC91 5TSWA 4GIQA 1FT9A 4P9JA 1QQP1 1HXS2 4UBHA 2B42B 2JE9A 2BGCA 1MZFA 2Q5TA 4J1XA 2EA7A 3VBRA 4FXGB 1DGRA 2CY6A 5JCTA 1AX0A 2ZHMA 4Q0PA 5SV5A 4R9CA 4DOUA 4YW1A 2PHTA 3IDCB 3UKTA 4FPHA 4IXLA 3OY8B 3WD5A 3MPPG 1MVEA 3IN9A 1FMD2 4I3PA 2C0ZA 2OA2A 1OOPC 1ND3A 3LWCA 4ONUA 4Q1RA 1H8TB 1Z0HA 1WLTA 4FOVA 3H1WA 5A33A 4Q26A 4CDQC 5KHJA 2G9GA 3RG0A 3MIEA 3D0JA 5AFEA 4Q1PA 3OPZA 5KXBA 2EF6A 1AJKA 4HN0A 1RUJ3 5J7MA 2R072 3CJIB 4L97A 4OI1A 4AHZA 1W2UA 1CAWA 4I30A 1V00A 1UZZA 1VBD3 3AP4A 5BXXA 4EV0A 2JKBA 4BWOA 1X36A 3NVCA 1R092 1YLLA 2XJTA 3IT8A 3RYRA 4NO4A 1HLCA 1I3HA 2WS93 3ECQA 3S30A 3V56A 5JPNB 1F8VA 2DWRA 3M4FA 3MLKA 1WD3A 5I0SA 2Q1MA 1RUJ1 4QGMA 1G9AA 3MI8A 4IV3B 4CDWC 3URFA 2P17A 1SFNA 1BKZA 4B3NA 5I91A 2KA3A 3OGGA 1BVVA 1C28A 4AW7A 1VALA 2PHRA 1DQ2A 3USSA 1CONA 1H2MA 3FMGA 2D40A 3CEWA 4IETA 4BIFA 1R082 2JEMA 5GZCA 1IQAA 1FI2A 1X82A 5L7OB 4WV8A 1AR92 4QQ2A 2W52A 2WS91 4OI2A 4EROA 4HL0A 2XWBB 2DF7A 4LLFA 2OYZA 3UJQA 5D8AB 2VVFA 3KCCA 4YW4A 1QJZA 2DTWA 3ZXGA 3BPZA 4YNIA 5A3MA 5ABJB 4BYYA 2JJ6A 5IK7A 1J58A 1MZ6A 2JICA 2WQ4A 4FO9A 1IGOA 1WMEA 4D7YA 1RJ7A 3GNEA 3GZAA 3KZ4C 2E7QA 3M7AA 2ZKNA 3LOIA 2ZBJA 4YFWA 1C3HA 1VJ2A 1V6KA 3WUDA 5T54A 3IDBB 3WVJA 2ETEA 3AP5A 3ZMNA 3EXUA 3FHIB 1PGSA 4RFT0 1DDLA 3PVEA 4QQPA 3ST7A 2R16A 4OUSA 4GH4A 2PHUA 1AX1A 5I0TA 2WNUC 3AXDA 2WIIB 3AMNA 5GALA 2VNGA 3EBRA 4AVAA 3WDUA 1RUJ2 3VKMA 4ISRA 2I45A 1MQTA 1F31A 1VBD2 3WDVA 3FLRA 3RS6A 2A75A 3C3VA 5CFCC 2UWCA 3M70A 3RPQA 3WUCA 3FUQA 4RR3B 2DV9A 2WS92 4RA0A 4CEYA 1TQ5A 2IC1A 1KRIA 2VMHA 1V9U3 3D6EA 1RVF3 4KU8A 2H0BA 2HEVF 2X5IA 3THPA 4COWA 1EV13 4Z1VA 1FV3A 1G7YA 3H3UA 1O3RA 3WX5A 4AYUA 3RI9A 4X8PA 5T5LA 4AGGA 2EIGA 5C8CB 1AR72 1DGWX 1MZ5A 2LALA 2VOVA 3KGZA 5E8AA 4SLIA 1QU0A 1Q8VA 1V9U1 2YROA 1RVF1 1S0GA 3APBA 1RUC3 2HYKA 4Q4X3 1EV11 1ULEA 2ZTNA 3NV2A 4IV1A 3ZSLA 1GQHA 3ZYPA 5EWSA 3AX4A 4BA6A 2WSUA 4XILA 3M3EA 5KXDA 3N35A 3BOWA 1QOOA 3VBSC 1VBA3 4H55A 4TSVA 4FOQA 1SBEA 1ZREA 1LENA 5LK5A 3THTA 1TMF3 4A7ZA 2TUNA 4FPOB 4E2SA 1QNWA 1RUC1 1SDWA 1NQJA 4FT8A 4CEWA 4BLIA 4Q4X1 1IHMA 2CGOA 4QQOA 2DYCA 2DU0A 1H0BA 5A32A 2TEPA 1IPJA 3ZFGC 4YZ4A 4NOTA 2IFRA 4HVOA 2EXIA 2G9FA 1VBA1 1WUVA 4EWDA 5DG2A 2NZ9A 1YJLA 4JDOA 1YJKA 5BNNB 1TMF1 2ZMKA 1UU6A 4S2HA 4WM7C 4JCKA 5JSPA 2MNGA 2Q30A 2ZCWA 4N7IA 4Y1ZA 1VRH3 2MHFA 1Q8PA 2OPKA 4XYXA 5CU1A 4HLTA 3JQXA 1SBDA 4RS5A 3ZN4A 1AR62 3N4MA 4L9BA 1V9U2 4FTEA 3NW4A 2DVAA 3MFAA 1C8M3 4L11A 1J1LA 3IDEA 1EV12 2CAVA 1OHFA 2VOKA 2VGDA 3WG1A 2RM23 3B9IA 4XZPA 4AEDA 2R1DA 3CJIC 5KWRA 2IXJA 4AGRA 1IZ3A 1O91A 4AG4A 3MICA 1V6NA 4F83A 1HRV2 2RR12 1VRH1 3AFKA 2ZKLA 2WT0A 1ZX5A 4JGYA 4MX3A 1RUNA 2GDFA 2XJRA 3J8F3 4XFAA 4DRRA 1AXZA 1RUC2 1CN1A 1DQ6A 1C8M1 4Y4YA 3W59A 4Q4X2 1J3RA 1QH6A 2R30A 3M3CA 3WQ7A 4QQHA 1LEDA 2RM21 2CTVA 4XETA 4UBGA 1NY71 3VDDB 3GHMA 1SCSA 2R0FA 2VULA 3VBRB 1IOAA 1ASJ3 1UD1A 5E16A 2V09A 4MVTA 3MF6A 1KITA 2TBVA 1XYPA 1O7FA 3J8F1 1ZRDA 3EJKA 2HWC2 3LSDA 1GKBA 4FTSA 4FPLA 5C8WA 1AYM2 4CDUC 2WQZC 5LRSA 4QPGA 5FO9B 1ND3B 1X7NA 4RGGA 1TNRA 5BYNA 2EALA 3KB5A 3D82A 5A33B 2PHXA 4NN0A 3VHNA 1W6MA 1OA4A 1OKQA 1ASJ1 1UCXA 3ZFFA 1DG6A 1QF3A 3WT3A 4FPYA 3BOPA 1KXGA 2CWMA 2XGXA 3HD8B 3B01A 1GFF2 4LBQD 2NP0A 1POV0 1H8TA 1JOJA 2ILMA 3GF6A 3RMYA 1TEIA