3VZJA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) e172h mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATHGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
source organism Bacillus circulans
total genus 44
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzjA00
2BVVA 3EXUA 4HK9A 2DCJA 1UU6A 3WQ7A 3AKRA 1XXNA 1HIXA 1HV0A 3WY6A 1BK1A 2QZ3A 2Z79A 1OA3A 3WP4A 3ZSEA 2QZ2A 3VZLA 4H7MA 4HKOA 1ENXA 1KS5A 2B42B 2BWCA 1BVVA 4NPRA 3VZJA 2JENA 1REFA 1XNDA 5K7PA 1OA2A 3AMNA 3WXPA 1IGOA 5K9YA 4XQDA 1OLRA 3MFCA 3WQ1A 2D97A 4HK8A 4HKLA 1UU4A 1H0BA 1HV1A 2JICA 1BCXA 1F5JA 1M4WA 1H1AA 2VGDA 1H4HA 4HKWA 2JEMA 3VZNA 1OLQA 3VL9A 3O7OA 1T6GC 3B7MA 1H8VA 2DCZA 2VG9A 2VULA 3VHNA 1XYPA 1PVXA 1XNCA 3AMPA 3AKSA 3VGIA 3AMHA 1OA4A 4S2GA 3LGRA 3VHOA 3WP5A 1NLRA 4S2DA 1UU5A 3B5LB 2DFBA 2C1FA 2B45X 3LB9A 1TE1B 1KS4A 3VLBB 2DCYA 3M4FA 1C5HA 2D98A 3HD8B 5HXVA 3AMQA 1UKRA 1YNAA 3MF6A 4S2FA 1XNBA 4S2HA 1QH7A 3AKTA 3AKQA 3AMMA 3VL8A 3VZKA 3VZOA 1XYOA 3WX5A 3RI9A 3WT3A 3WR0A 5EJ3A 1C5IA 2BWAA 1W2UA 1XYNA 1XNKA 3MFAA 3AKPA 3WP3A 4IXLA 2F6BA 3WP6A 2DFCA 2NQYA 1REDA 3MF9A 3VHPA 1QH6A 3VZMA 1REEA 1H4GA 3WQ0A 1AXKA 2B46X 4XQWA 4XQ4A 2BW8A 3RI8A 4XPVA 2DCKA 2NLRA 2VUJA
chains in the Genus database with same CATH superfamily
3CZJA 2GH2A 1LOFA 4FXKB 4W6WA 3Q9OA 2WZPP 4CDUA 5KHHA 1UY1A 3L2HA 2NPIA 1JZ6A 2XUEA 2QUOA 3KMHA 3LIGA 1JOJA 1XXNA 5T5LA 2WO7A 3C8XA 4NOTA 4FFIA 3B3QE 1E57A 2ZZJA 3CO2A 2QZ3A 4HZFA 4N9IA 5B4XA 2OYZA 3I59B 4DXRA 3I2KA 4LUMA 1RUJ3 4QHBA 1WA6X 4XTPA 4XJAA 5F2SA 3VBFC 2CGPA 2ZA9A 3B9CA 3IB3A 2PMWB 1ACCA 5A80A 4QX2A 3KV4A 3MGUA 1N3QA 4GB33 1HXS3 2R043 3H9AA 2HWB3 3AYDA 3MYXA 3PNAA 5FPXA 4AEJA 5LATA 3H7YA 3WCSA 2R061 2VXRA 3CHXA 1OLRA 1UZVA 3PL0A 2HYXA 4JDMA 4L99A 1Y9MA 4R52A 3SEEA 1O59A 2QE3A 4LO5B 4PF5A 4AHZA 5BNPB 1DGRN 4QKDA 2EAAA 4XUNA 5EV7A 3KGLA 2JDUA 3EO6A 2CWSA 3AFKA 1VBC3 5K0UB 1SPPB 4CZSA 4COVA 1NA1C 4CE8A 1AYN3 2ZEYA 4MGQA 3UESA 3IZOA 2VULA 5FZBA 3TWIA 2J42A 5JI9A 1S55A 4JTNA 2DUOA 3ZFGA 2WBKA 4MOAA 1RUOA 2CAUA 2VM9A 3JB4C 5CU1A 2D6PA 1C1LA 1CJPA 2PHWA 2QQPA 3LDRA 3DUIA 3N9QA 4ZU5A 3P5BA 2VZSA 3GM8A 1W0NA 2QFEA 1DP0A 4WVMA 1WW6A 4AEDA 4AL9A 1GNYA 2VTXJ 4XUQA 2PQSA 2DCYA 4Q8KA 2OVUA 2Y38A 5JCTA 5GM0A 3N9PA 1S0JA 1RYYA 2VVEA 4FT8A 4J1XA 5A7WA 3K3OA 4AI9A 3WF0A 4BB3A 1YNAA 4LORA 3MF6A 4A3ZA 1ST8A 4ET7A 2UWBA 4L0PA 4R9DA 4PT6A 5A7NA 4QDQA 3VBOC 3MI8A 1HB3A 3VZKA 1S0DA 2FZ1A 2VZPA 3OCPA 3WX5A 1WD4A 1JYVA 1OT5A 5LEJA 4IV3B 1QJY3 1SBDA 4BXFA 4B1MA 1ULDA 4KQ7A 3SQOA 4B4RA 3NV2A 4AOCA 5L36A 5BYNA 1HB2A 5DABA 1W04A 2JDMA 3LE0A 4LHNA 4QAWA 2QKDA 1LOBA 4CDWC 5TSWA 4OZXA 2WZR3 5IVBA 3H1MA 1LHNA 1YO8A 3U14A 1NAEA 4YG6A 3U07A 2GMMA 3T0BA 4ONUA 4CEWA 4CP1A 2RMU2 4CP2A 3OGVA 4IE4A 1H9PA 3AJYA 4LHLA 4OHWA 5CADA 1GP4A 4QX5A 4XQ4A 5A3WA 2FDFA 3MW2A 3H42B 1FYUA 2EIBA 3UETA 3AB0A 1ODMA 2VNVA 3L2YA 4A6SA 3AYCA 1AR81 3JD71 2WS91 5LW9A 3KM5A 1Q8QA 1SLTA 3H8XA 2FCUA 2F4LA 4AFMA 1KGYA 1ZRIA 2Y6GA 4Y5SA 4OI0A 4LK7A 1QEXA 3TNPB 1RUF2 2ZGTA 5IVCA 1J58A 4MGIE 1BBT3 1ENXA 2D6MA 2VUDA 1V9U3 3NSTA 4CCCA 4RGKA 3CMGA 1VAVA 1NQJA 5EJZB 3BU0A 4CEYA 5L9BA 1R1A2 5F6LB 3IDBB 4HETA 4Q26A 2UU8A 4R4XA 5IVYA 2VVFA 4A2UA 2GN3A 4HANA 4AHWA 2W92A 5IFPA 5LBCA 4NPMA 5G05L 2R1BA 5K9YA 5CFCC 2SBAA 1YJKA 3OY8A 5A1FA 1YFUA 1N47A 4B4PA 4D69A 5FOJB 2VVDA 2DDUA 1WMXA 3OB8A 4XHBA 3UT0A 5ACA2 5HV4A 4JRLA 4W65A 1F15A 3SCHA 4XZUG 4QPGA 1W2OA 3VZNA 1OMIA 2PYTA 4I30A 2IC1A 4QWNA 2ERFA 3KF3A 4G9SB 4M4RA 4SLIA 3WZ1A 2Z69A 3D5OA 3WNXA 4EWEA 5FY7A 1B35C 4PLMA 1O3TA 1CIYA 1UMZA 4RGAA 5FLJA 5T3NA 1CIWA 2YBKA 1OOPB 2HWC2 4NN0A 1GWLA 2JKBA 5SV5A 1UXXX 4UBGA 5KR7A 5GJ6A 2CV6A 1R093 3OPZA 4RR3C 2BOJA 1TEIA 1JODA 2WO3A 4W6YA 4CU8A 4FOYA 3M70A 5L9RA 3VDDA 2PN5A 5SV8A 1LGBA 3I49A 2UYAA 3FHIB 1JYNA 1F4AA 3B69A 1U0AA 5BNNA 1HLCA 1LECA 4CUGA 1RL3A 1URXA 3BKZA 4XFIA 3USSA 2D6NA 2A1XA 2O8QA 2YXSA 1ZBA3 2YUEA 3PVBB 1NLSA 3UNPA 1IQDC 4XBLA 2XG3A 4E9KA 2ZEXA 2WNUC 3NNMA 5JVVA 5FZFA 1W3VA 1YFWA 5D1IA 3VBUA 1ZA7A 2CSGA 1OD3A 2FMYA 2FQPA 1W9WA 3N9MA 3NW4A 2J1EA 4BQXA 4DO0A 3VD3A 1JZ8A 3VN4A 3WSOA 2W9XA 2K9ZA 4A7YA 2D43A 5AC91 2WN2A 1RMU2 1TMF2 2HWC1 2R16A 3FWEA 3N7KA 3H50A 4JHTA 4UWDA 5DAXA 5EFUA 3SH4A 1U5XA 4O65A 3J7LA 4RA0A 2YGLA 3LOBA 1MPXA 1JZ3A 4GMP0 5FYIA 1PZ8A 3M3IA 5FKBA 1HJFA 4XVHA 1ZBE1 1N1TA 3PUAA 1S2KA 5IK7A 5DDJ1 1D4M1 2ARXA 3H1YA 3P6BA 4JX0A 1QJFA 5CEHA 1GUIA 3R4DB 2LS6A 3ZXKA 4H2AA 1ULFA 3EYPA 3LWCA 5F5CA 3VD5A 1RUI2 1UY2A 4BLIA 5FK7A 1F5FA 2A75A 5D8AB 5LZ6A 2RR13 3UL2A 4ZKTB 4NVPA 1BVP1 1NA1A 3S7IA 3ZPYA 4DUXA 4TLGA 4EN8B 3HT1A 3MIGA 5I8TA 5FYYA 4EN9B 4NE9A 4YVSC 1TMF1 3EXUA 2DV9A 2XJQA 1GWMA 4L92A 1QQP2 4MVTA 2O14A 4TLFA 1EV13 1PK6C 3WDUA 2YFZA 1TNRA 1IS3A 4Q0SA 4W4ZA 5C33A 5F9TA 4GWMA 4HG6B 2VC9A 4IE7A 2CYFA 1JS9A 2JG8B 2ZX3A 3NL1A 1NCRC 3R4UA 3WDXA 5DMYA 2JDKA 2ZX2A 1FPN2 1PHMA 2QQWA 3TEXA 3KV9A 2WN3A 4K6BA 1GQHA 5L7OB 4LA2A 4B7EA 3ES4A 3THPA 3ILNA 3JQWA 1O8SA 4LE4A 5A6QA 4FPKA 2QQUA 1L7QA 4IGQA 1RUE2 1XNDA 4UFIA 3BYWA 5EZWA 1O3SA 1SLAA 2QDRA 4IEXA 1OA2A 4KWJA 2XJPA 3LEIA 3VBOA 4YM2A 4JGZC 5FY8A 1SLBA 4J1WA 1E5IA 1C8M2 2ZGSA 1SACA 5JOXA 4BQYA 1JYWA 4WZCA 2EA7A 1I5PA 4DY3A 5C4WC 3DXUA 1PX4A 2XDVA 3E5UA 4Y3OA 3ME2A 2FDGA 2Q8CA 2O0OA 2VCMA 4IEYA 1SFNA 3I2DA 2JEMA 4JDOA 4B29A 2X10A 3APBA 1WMDA 1GZ9A 4KGGA 3WG2A 3ACIA 5LBEA 1POV0 3VHNA 3U11A 1HQWA 1JW6A 5JMCA 4OULA 2BV4A 2V09A 2RJLA 5FZOA 4YARA 4TXWA 3WW2A 1AL22 1VRH2 1RUE1 1LU2A 1UOGA 3H0OA 3T2OA 3VHOA 3HOBA 4CDUC 1JHNA 1CZSA 3N9NA 5FZ6A 1W9YA 4XJ9A 1GLHA 5K8SA 5C9AA 4CDQC 5CAZA 2ZEZA 4U2AA 3B5LB 4XACA 1W6QA 1OQDA 4IE6A 1J3PA 4K21A 2A71A 3CJIB 4PLNA 3ZYIB 3CQOA 4CUCA 1DQ6A 5GKAC 5HXVA 1UKRA 1WLCA 4XILA 4C8DA 3J9SA 5GZFA 3UGFA 4DEQA 1JZ2A 2IVIB 3VDAA 2R063 4AFBA 3UKTA 1QH7A 4EJRA 5I0SA 2XJVA 1MVEA 3W20A 4AI1A 2E32A 2Y0OA 3T1MA 3BI3A 3OPTA 1D0HA 3ZSLA 1VRH1 2R042 4EYUA 1J3QA 3QH7A 1QY4A 1BKZA 3FE5A 3OBRA 4W8JA 5K4LA 5I91A 4AI2A 3WW3A 1VBB1 1UYZA 4IV1C 1S0IA 2W1WA 1COV1 2ZX4A 3B94A 4LBOA 3IDEA 3VBSC 1REDA 4P08A 1V6OA 4CDXC 3R6SA 1KDKA 2PHUA 2CGNA 2YPJA 3DF0A 1EPWA 4QX3A 5FXVA 4JAAA 2OXBA 1IS4A 3K48A 1FXZA 2VQTA 1GOFA 5E88A 2ZXQA 3S0MA 4ES9A 2KXLA 5F5IA 1X8MA 1RUH2 3GHMA 2OPKA 5H9SA 5FYMA 3AXEA 1ULOA 4UYBA 1UPIA 3HBZA 1JOBA 3R05A 1UU6A 2VAUA 5L73A 1K5MA 3BGAA 4RR3A 3PTRB 2Q30A 2ARBA 5ABJC 1DGWA 1EYBA 1NQDA 2E6VA 2HWF1 4QGLA 1Q3EA 1LNSA 1RGSA 5A33B 1PO22 4DINB 1QOOA 1W6OA 1X33A 5GLUA 3HN3A 4TSVA 2RM22 4AQ6A 4ARXA 5FO8B 3RZGA 1US3A 2RE9A 4GH4A 1QJZA 1Z7S1 4AVAA 1VBA2 3HQXA 4OMDA 2BBAA 2W08A 1Y9QA 1ZRRA 3ETPA 1RTVA 3KWVA 1QXPA 1WBLA 2WIIB 1IG0A 1HB4A 1IOAA 3SH3A 2QQVA 1MS3A 3LQCA 2DUPA 1DCSA 5KC5A 2ZS6B 3O1TA 1XQNA 3P3PA 1YCIA 4YZ5A 1JMUB 1RIRA 1QKQA 4E4DX 1RUH1 4QQHA 5LBFA 5KHGA 3HAGA 3THTA 3KSCA 2HJIA 1RVF1 1RHI1 3V0AA 3VBHC 4P02B 5LEKA 3CZUA 3CLPA 1DQ4A 1XRUA 3LA2A 3BN6A 3PU3A 3SXWA 2PELA 3KCCA 1PO21 2Y8KA 5JPMB 3NJYA 3AZVA 3LEKA 1GYKA 1W8OA 1UY3A 2WZR2 1LOAA 1VBA1 3K46A 1AR83 3JD73 3AKSA 3FL7A 2A7AA 2P6CA 1LESA 4V1PA 2P4EA 4NMIA 1W39A 3S57A 1DIWA 5I8YA 2ET1A 4YG0A 2BTVC 3JB8A 2AYHA 2K2SA 3J7HA 5E1RA 5AVAA 2B45X 3LB9A 1JUHA 3ZSMA 1J59A 2E31A 3ZYHA 4QKBA 2BJSA 2DU0A 2PLV2 3D4KA 3NVCA 2RMU3 4LIUA 2X09A 5IK8A 1MVQA 1CONA 1OVPA 1NCRA 3JUUA 4S2FA 4UXAA 3VBRC 4AZZA 4MHRA 3ZFGB 4CP9A 1PGSA 1XNBA 2R0HA 2VBBA 2RDSA 1LGNA 1VB4A 1AR71 4LE3A 4XAAA 1QF3A 1MZEA 3RI9A 4WVMB 5EJ3A 2GP5A 4OHZA 4GJZA 1E5RA 3GBWA 4CU9A 3WG4A 2ZGNA 4PDWA 2GALA 1PO12 5C3SA 1AJOA 4B3NA 3NQHA 5A7WB 5F3CA 2JIGA 1IPSA 1N1YA 2JG9C 4MLOA 2QQKA 4N8MA 3ZXAC 2P17A 4KWUA 5FUPA 1A6CA 2BNOA 1X8EA 4MV2A 3TN91 4SBVA 4XABA 1X36A 4RS5A 5AFEA 4O61A 4OI2A 1H4GA 3BCWA 3WQ0A 1AXKA 1CN1A 1UKGA 4GA9A 3RYRA 2BGOA 5GZDA 5JSOA 3LDBA 3OGSA 1TG7A 1BZWA 3BOWA 3BVCA 3GHNA 2BEOA 1IG3A 1ND3A 1VRBA 3KT4A 4CU6A 1O4TA 1R092 1PO11 4P9IA 4XDOA 1POV1 5C8WA 5FLHA 4E2GA 4CEWB 1WLDA 1Z78A 2QDNA 3MICA 4DUWA 4FBFA 2XPJA 1ULPA 1DFQA 1BLZA 2LROA 1H2KA 1WCKA 3C7EA 4N43A 5AC93 1KS5A 1LENA 5LA1A 3SNMA 1DQ0A 2HWC3 1JI6A 4TWTA 2A6VA 3LCPA 1JZ7A 5HPOA 2QNKA 4AVTA 3JCIA 1S1AA 3ZPOA 4LOSA 1ZBE3 5JOZA 2BFUL 2P37A 3D3AA 2BDRA 4ZPIA 1NY71 3K4AA 3TEYA 3OBZA 3IWZA 1XPWA 1UZWA 1AVBA 2VL4A 3AZXA 1Y7BA 4W6XA 4FPFA 4RGGA 1HW5A 1ZZBA 3HMYA 1LRHA 1SLLA 3SCFA 1H4HA 5HV0A 1OLQA 1YYNA 4CEYB 1UMIA 3WHTA 5J36A 4QDSA 2Y6FA 5E16A 4N90A 4EE2A 5BY5A 1GICA 1RMU3 1TMF3 3K77A 4E4HA 2W52A 5CKNA 1QXJA 3OY8B 5JLVA 1I6XA 1XE8A 3J8F2 4WM7A 5FZAA 4I3PA 1F35A 1PMIA 5CISA 5JSRA 4S2GA 1I1EA 3VD7A 4Y4YA 3ZN6A 4Z2WA 2PXJA 1WGPA 2YHJA 4ISRA 4QPGB 1PNFA 1EY2A 4N53A 2FDJA 4D0QA 3ZYJB 4LOTA 2J22A 3FX3A 1Q8VA 3PTYA 5FBJA 3M4FA 1EV12 2EXKA 4KG0A 4GIQA 1FAYA 3PDQA 4JTOA 2WA3A 3ST7A 5ABJA 1G8WA 2W46A 2WFF2 5CKMA 4NRMA 1K5JA 2WWUA 4DS0A 4Q27A 2RVAA 2FMDA 5FZEA 3U37A 1UZ0A 1S0EA 4M0HA 2ZBJA 3I8TA 4CCOA 1OLMA 3VDDB 4DQAA 1DLLA 1SZBA 2GMPA 1QQP3 4LPLA 4F7ZA 3CF6E 5A32A 2P6HA 2W91A 3J8F1 1UN1A 4BISA 2XQRA 5BNNB 4OUEA 4D7YA 2RJ2A 1MZ6A 3K4DA 1Q56A 4ZY9A 4H55A 3GXUA 3HWJA 1SQ4A 4COWA 2DYCA 3IPVA 4P9LA 2VNGA 5HBAA 5JPNB 1M06G 3V64A 4RQPC 2JD4A 2WYFA 4Z07A 5JXIA 1ZNPA 4FPHA 3W21A 3T4HB 5E8AA 4P14A 5LK7B 2AENA 2XLFA 3POYA 4ZZ8A 1RUE3 3OG2A 2FHRA 4CU7A 5G04L 1MQTC 5IFTA 4XQWA 2VOVA 4XE9A 1C8M3 1LOGA 1YQ8A 4XPVA 5FP7A 2DCKA 4WM8C 3THDA 4P9GA 3GALA 5I0UA 5KXDA 4HMZA 3ACGA 3ZYPA 4BQ1A 2XR4A 2BVBA 4E2SA 2W5FA 5FCCA 1RB8G 1W06A 4PI2A 1NUKA 2D40A 5GZGA 4UFHA 1Q8SA 3CKHA 5LK5A 3WP4A 1UCXA 4AAPA 4H7MA 1NA1B 4YZ2A 4LKEA 4BIFA 3SITA 1CJDA 1BVVA 1GV9A 2DF7A 3DGTA 4DMIA 1VRH3 5JXGA 3ELNA 4WVZA 3QLQA 4GAZA 5FZ8A 2OKXA 2GNDA 2FDHA 3NV4A 1IGOA 5LY2A 4DY5A 4XXAA 3LEMA 4KL1A 3WQ1A 3CBNA 4LXLA 4D7SA 2D97A 3C7GA 3QH6A 4XOGA 5DAPA 4D6RA 2CAVA 1J1TA 4FXGB 3HIFA 2R071 4LBKA 2A3XA 1LAJA 2EAKA 4EROA 1ZX5A 4OI4A 1KXGA 5DAQA 4IEUA 3ZFFC 4XFCA 4BMEA 3HT2A 3H7JA 3U10A 1DYKA 5FXZA 2C5DA 2JG9A 5FY9A 2OS2A 1H8VA 3BODA 3NNGA 2ENRA 3IT8A 1IKQA 5FYVA 2DBIA 5LRSA 3VBOB 1OVSA 3WG1A 1NLQA 4NIAA 1LKNA 2K0GA 1CX4A 1RXFA 5EXOA 2ZX0A 4CA9A 1MZFA 4EWDA 2XGXA 3PUIA 2ARAA 3HVDA 1JXNA 1XSRA 2WNVC 1C3HA 4AE2A 3INAA 3VDBA 1FATA 1PVC1 3KCXA 2HEVF 3RVHA 4D6SA 4M01A 2FDKA 4AQTA 2J1UA 1Z7S3 1FOD2 1QNYA 4JQRA 4DOUA 3I4IA 1AXZA 1HRV1 1XU2A 1AJKA 4X6QB 2JDZA 1UIKA 3AMQA 5FZOB 3BPZA 4H7LA 4LMFA 3N4MA 3IN9A 4XBNA 3MZHA 2D7FA 1QGLA 2BFUS 3B9IA 3KB5A 4QU2A 3AKQA 3ZXFA 1RUH3 2LM3A 3AK0A 3K4ZA 3AZYA 4LO7A 5FPUA 1RVF3 1RHI3 5FO7B 5C9AB 5IVEA 1C5IA 1K12A 2BWAA 2P1BA 2X29A 5FXXA 1W6QB 4YW7A 2ILMA 5FPVA 3LSDA 4QD2A 2NYYA 1XYNA 4A3XA 1XNKA 1AYM2 5A3LA 1PO23 2ZPXA 4M4PA 2V4VA 2RM23 4HVQA 3W5NA 4WZFA 3SC7X 1FOD1 1VBA3 2MEV2 3FHAA 3MF9A 3DPRC 1SLCA 4LLOA 1W6MA 3JBG2 4LHSA 4QPWA 4QPIA 1QH6A 4XJZA 4X8NA 2WSVA 2I2SA 4GWIA 1IS5A 5FZKA 4A7ZA 5CFDC 4Q4X2 1AL0G 2GDFA 5FYBA 2QQJA 4FAGA 5BNOC 2VZTA 4C90A 3LKJA 3TEZA 4URAA 2HEYF 2ZGLA 2G4IA 1ZZ7A 3SEPA 2Y33A 1L3JA 1G9AA 3WCRA 3EJKA 4WVVA 1AR82 3JD72 4NHYA 2WS92 3D0SA 5C6CA 3WHUA 3AP6A 1QU0A 3MEPA 2YZ4A 1NXD1 3V0BA 3HQUA 4NHXA 3QACA 4PJYA 2VNOA 1AYM1 5EHDA 1XSQA 1KD7A 4GKYA 4PHZA 3KLSA 1F4HA 4HKOA 1AR73 1W6PA 4YM1A 2VCCA 2MEV1 2B39A 4G4FA 3JBG1 2WRAA 3B00A 1KITA 3BB6A 3E5QA 1XBFA 1LEDA 4Q4X1 1K3IA 4XW3A 1PIV1 1CAXA 3H3LA 4JRAA 1K5MB 4MGSA 4LKDA 1JBCA 4R9CA 4RR3B 5FY0A 4ZU7A 2BZDA 1AX2A 1VB2A 3C7FA 3KHBA 3ZO0B 3R4SA 4QXCA 5BNPC 2P34A 1MZ5A 1W6OB 2XONA 4M0NA 5CIRA 2PLV3 4KU8A 5FLIA 1W8UA 2Q1MA 1DBNA 1SDWA 3MIDA 4E8DA 4GH4B 5K0UC 1N1SA 1H1AA 2GC2A 2XL7A 1LULA 4UI9L 2X5IA 3N7LA 4XDPA 3RYKA 4P00B 1U5IA 3UJQA 2VG9A 3ZXEA 2JECA 3GF6A 4BJ0A 2VCAA 3AP9A 2C6SA 1CVNA 1NCQA 1TME1 2D6OX 1PO13 3AVRA 4GJYA 1POV3 3GZUC 2YGMA 3MIFA 5FY4A 3ZFEC 4MGZE 3V0AB 4ZHNA 5CB7A 4EZ4A 1QJU2 2DVAA 4RFT0 2HWD1 2JDPA 2Q8OA 5JR7B 2QQIA 5JZGA 3AYAA 4Y24A 4PBOA 3ZDSA 3E1F1 4HSJA 4Y5Z0 1Q8OA 1IZ3A 5ISLA 2YBPA 1BMV1 3OPWA 4Q29A 3PVOA 4LKFA 3H3ZA 5FYUA 1W8FA 4YVWA 4YRDA 1C5HA 1V6MA 3HD8B 1HQNA 1NG0A 3MO4A 2JJ6A 3S30A 1LHWA 3NNLA 3FLPA 1FT9A 4EZHA 3RMYA 4UFKA 4M3CE 3S6PA 4B1LA 5A7QA 5AC92 4XFGA 2GC3A 5I93A 2ZJCA 4IV3C 5DUVA 4LT5A 3WR0A 2B9VA 4BQ5A 4GKXA 5FAXA 1S0GA 4KH9A 4XUOA 3SH5A 1ZRCA 1YLLA 2ZOEB 4AHXA 1N3PA 1AF9A 1QJU1 1ZBE2 2WLPA 3GZAA 2P5BA 1D4M2 4QXBA 1D2SA 3MFAA 2WWJA 5DDJ2 3RJ2X 4AQSA 5EWSA 4GWJA 4BDVB 3ZMNA 4K8FA 4CP9B 2KA3A 3OGGA 1DGRA 4LR4A 2BQPA 1HRI2 4FFGA 4HBNA 1K45A 3EB7A 2XVLA 3OBAA 3O0XA 3MIHA 4K20A 1AR92 2Y26A 4XC9A 3VHPA 1LCLA 4EQVA 1MS8A 2E7TA 3RSJA 1DQ1A 1W3XA 4A42A 2E51A 3EHKA 3ZFFA 2Y6JA 3K75B 1Y9GA 2OUJA 3ZSKA 4G3YC 2VZRA 2GZWA 4UW3A 4PDWB 3OD0A 2DURA 3NAPC 3VBFA 2IXLA 4CP0A 4BCUA 4B4QA 2OW4A 4EN7B 4CXWA 4JKLA 5A6YA 1H6XA 1K42A 1W9FA 3IDAA 4ATFA 1YIPA 2ORXA 2ZACA 2WNVA 4K1YA 4XFAA 4NRPA 3EMRA 1QWRA 4N7UA 3ZDVA 3DCQA 3GZTB 3DYOA 4UBHA 3WY6A 4QKFA 4RS5B 4EN0A 3HQRA 3RS6A 4LITA 3OD4A 3TNQA 1UYPA 3I2IA 4M3CF 1HRI1 4J25A 4E4ZA 1W28A 3FBMA 3FHQA 3WF1A 2B42B 3A0NA 1AR91 3NV3A 3I97A 5BPXA 1AXYA 3J8F3 5IW0A 2JENA 2E7AA 2GMEA 1TQ5A 5E6HA 1ND3B 2R7EB 1W8TA 1DHKB 2BBVA 2FZ2A 4XQDA 4ZU4A 2BGPA 3J26N 2A6WA 1QXRA 3AC0A 4OUMA 2MNGA 4YFWA 1BHGA 3DYMA 1PGW2 4MHUA 5IVVA 4R4ZA 4N43B 2K46A 1NT0A 2V5YA 4FPLA 4PIYA 2WFF3 3CU7A 4DIQA 3PVNA 1O5UA 4ARYA 3NKGA 5FP8A 3TB0A 1CPNA 2VZ1A 1VE0A 3I2HA 1W6NA 4BPZA 1X9PA 4COYA 1ENSA 1V6NA 3MUY1 1UF2C 4OVEA 1XNCA 3AMPA 1H2NA 1LGCA 1OOPC 1R1ZA 4FSJA 4MSVA 4Q0QA 2GSYA 1YJLA 3A23A 5F5QA 5CFDA 3X29B 3Q8BA 2GAUA 1BEV2 5BNOA 4MYEA 4M3CA 4S2DA 4XZPA 3RPQA 4IERA 5FPLA 5LASA 1YFYA 2ZGKA 4Y5TA 1XNAA 3O5SA 5LBBA 1TE1B 4CCEA 1PGW1 1CZTA 2WC2A 2EIEA 2VQUA 1ULEA 4YWAA 3G6JB 5JMOA 4XMAA 2B4KA 5DZGA 5LA2A 2IXHA 4NHLA 2RS51 1A8DA 2WR9A 3HEIA 3NRUA 4WM7B 5A7OA 1N3OA 2E9QA 4PBPA 4CDWA 2Y0IA 1GFF2 1RUD1 2VOXA 1ASJ1 1GR3A 3OJBA 5IT6A 3ZYGA 3S7EA 3F2ZA 1DYOA 2WINB 3PLQA 2XVKA 4N53B 4DNYA 2XBO1 3ZMOA 4HLTA 5C3RA 1DF0A 1BEV1 5B4NA 1RITA 3T0AA 2H0VA 3ON7A 3POBA 1I9RA 5ABJB 1VBB2 4Z1VA 5T5PA 1S0FA 3C7HA 2LALA 3O12A 1ENRA 4LULA 1COV2 4H3WA 2WQ4A 2SLIA 2DTWA 3RRDA 2GC0A 2ZHNA 4C91A 2E33A 1W8NA 4F83A 2OX0A 1CAVA 1S4CA 3WF4A 5T50A 2Q4SA 4QHZA 3VZMA 3OTFA 1O6UA 1FV3A 5D8AC 1W9SA 2VZUA 3WUCA 5A32B 1AX1A 2ZAAA 2ZGRA 3S5QA 2GH8A 5DN2A 2BVVA 2W68A 2QJVA 2YYOA 3K3NA 2BNNA 3IPVB 3L9JT 4XF4A 3VBUC 3I2GA 1JOPA 1WCSA 2BUKA 1HQLA 2UYBA 1NE4A 3NNFA 3RQ0A 3ZFEA 5FFOC 1RINA 2HWF2 2JG8C 2VW1A 3A22A 4IW3A 4CXYA 5CFCA 4FTBA 4BK4A 3WINE 2VUAA 2NMOA 1O4ZA 2C9AA 3A21A 4IE0A 5ANNA 4GULA 2ZCWA 1WD3A 1G7YA 4QQLA 1Z7S2 1RUC2 4AGVA 3QBQA 3DKQA 4F8AA 3CDZB 3CNAA 3U4SA 5L7OC 4IGPA 4UW5A 1AZDA 4RSUA 2RDRA 5CKQA 4NAOA 5A1AA 4IL7A 4LK6A 5FDBA 3IIIA 1PZ9A 1H8TB 1B35A 1C4RA 4K8RB 5D21A 3WD5A 4IV3A 2JDYA 1GBGA 1FOD3 1RVF2 1UNBA 1CZVA 1RHI2 1OKQA 3GJBA 3MPBA 5DG1A 5FREA 3SKJE 2VBDA 4CXXA 2RS32 3A4UA 4A7KA 1DDLA 1UZZA 4TN7A 2BGCA 5DAVA 4MXWB 1WMFA 3KCYA 1NZIA 5JOWA 3WNLA 4QHOA 4HPKA 4MXVA 3NNJA 4LO4B 4UOJA 2EALA 3LEGA 1RUC1 4HONA 4OI1A 4LJHA 1AUYA 1RUJ1 5CYYA 3VKFC 2WNUA 4LBMA 3HNBM 1H6YA 3FBYA 4YW3A 4FCAA 1OA4A 3GYDA 1AYM3 1HXS1 2Y60A 4RN5A 3I2FA 2WQ8A 2HWB1 2OA2A 4A41A 4XTMA 3RG0A 3NAPA 4D94A 2X53S 4HN1A 4QQ2A 1W0OA 4YZ3A 5IVJA 5JDBA 1HN1A 4AR2A 2Y64A 2MEV3 2WNOA 4QB2A 3ZXLA 4C1XA 3CJIC 5J3UA 2RS31 2ZGPA 3JBG3 3M1HA 4IEZA 1J1LA 3VLBB 5T55A 5GZCA 4A4AA 1UY0A 4DFSA 5T52A 2H0BA 3D0JA 3LAGA 4Q4X3 2VCBA 5KXBA 1VBC1 5JWPA 2HKXA 5GZEA 2ZMLA 4YG3A 3RMXA 3UGHA 1H2LA 5EP9A 4CCKA 1AR72 1D0GA 1AYN1 2D5HA 4GMP1 4LBJA 1ND2C 1ONAA 1XYOA 1CR7A 1YHFA 2WS93 3LPGA 4QX0A 3VZOA 2DCTA 4MGKE 5DUWA 3BALA 4BZ4A 3UKNA 1ENQA 1OBNA 4Y1ZA 3O1PA 3A0KA 3LDKA 5FUIA 2UWCA 1H30A 3BIWE 4YVSA 2RV9A 3K51A 1MEC2 2VMFA 1BQPA 2WL1A 5C8CA 5LCWL 1PK6A 2VUCA 2DFCA 5A3TA 3USUA 2LTNA 1VJ2A 3TN92 3ZM8A 4YGCA 1SDDB 4NUBA 2MPFA 3ILFA 4UFMA 3UV9A 1ZREA 3M3EA 5FZCA 4FFFA 2DWRA 3ATGA 1PM7A 4IEQA 1ZZ8A 1O3RA 3POGA 4AF9A 2PAMA 2VZVA 3OEBA 3E6BA 3TYJA 1HJGA 4BYYA 4FPJA 4KWLA 1TVGA 5JXJA 5H9RA 1OOPA 4P9YA 4AEDB 2FD8A 4AXOA 5KBFA 2JDAA 1QJY1 2AEZA 5C71A 3RZJA 1RUNA 2JDHA 4CTEA 4JGZA 1E5HA 1F9KA 1HV0A 1W6MB 4HFSA 2A6XA 4KNCA 4QPIB 5L9VA 1ULCA 4AVCA 2Z79A 2BOIA 3WDTA 4L2NA 1MEC1 3UK9A 3ZSEA 4D7TA 5CG9A 1VAMA 2GC1A 5FXWA 1C1FA 3VZLA 5FZHA 5C4WA 2LUWA 5F6KA 1MS5A 1FNZA 3GBGA 1HN0A 2ETEA 1UX7A 1XNTA 4P9WA 4U36A 4W50A 2BWCA 5CNAA 4ASLA 1ZM1A 4BHPA 2X8KA 3O0WA 4NPRA 3H8UA 1LOFC 3AP4A 2Y6HA 4Q0PA 5DXDA 1HB1A 1V6LA 5DAWA 5FKCA 5CVRA 3T3YA 2A3YA 1XOYA 1QJU3 2D6LX 3EBRA 5JI7A 5IYYA 5K7PA 3V0BB 1RUG2 2O8OA 3CEWA 3PURA 1R081 1Y4WA 4PIXA 5F8PA 1LOEA 1NY72 4YGDA 5FYSA 2PAKA 5FZ4A 1ULGA 1OHFA 3MIBA 4HK8A 3HNYM 4QM8A 5FBZA 2W95A 4PQQA 1KFUL 1UU4A 5F37A 1H0BA 5FYHA 2AH2A 1W6PB 2JIJA 1DQ5A 2VPVA 1OXCA 2JX9A 2V4AA 2VR4A 2VZOA 1UOBA 1M4WA 1C8NA 2VXJA 2VGDA 2XUMA 3PU8A 3S5AA 3M3OA 1G6NA 4CDQA 1OQ1A 4CCMA 4E4SA 4CCDA 3V56A 2BP6A 1CAXB 2DUQA 1O8PA 1XYPA 3ACHA 2JE8A 4K40A 3QCWA 4YZ1A 2C26A 3OYWA 1RJ7A 5D8AA 5FZGA 1JH5A 2A6ZA 3WNOA 1LU1A 2VJXA 1DZRA 3LGRA 1RUG1 5A3OA 5DDJ3 1D4M3 4BMBA 4I0BA 4Q4Y2 4NHMA 3EQEA 2QBXA 2UURA 5EPAA 3M8LA 4I09A 5FJKA 1HRI3 2E26A 2OQ6A 3AYEA 2X5IB 2C1FA 2ZGOA 3IM0A 1OPMA 3OGJA 4Y1XA 4Y4RA 2ZHKA 2BERA 1CGPA 1AR93 1QDCA 4QPYA 2D98A 4XMIA 1E5SA 4EV0A 4FAHA 4FTSA 3W5MA 5CZKA 3AP5A 3HPNA 3KV5A 2PHRA 1NCQB 2WDBA 5FJHA 2F4PA 5JUVA 4IV1A 2VH9A 3D6EA 3BPSA 1X50A 3VBSA 3T2TA 5A3UA 2WKKA 2GN7A 4CDXA 3DKWA 4WBBA 3SMHA 3VL8A 3BTXA 4ZONA 1WMEA 5FMCA 5FIXA 1H1MA 2X05A 5JZGB 4XJWA 3IKWA 1GQGA 3RGBA 4BOWA 2EIDA 3K2OA 1WW7A 4N7IA 3AL5A 2EXHA 2HEWF 2ZGMA 3N7JA 3POEA 4XETA 4XYXA 4QQOA 3VD4A 3ETQA 4YVWB 4JVAA 5FV3A 4ATEA 4KMQA 2CU5A 1WLWA 4Q4Y1 4Y1VA 1UOJA 4IGOA 4NIIA 3PUHA 2GU9A 3BOPA 4LBQA 4QT6A 4META 3O1UA 2YC4A 2YU2A 1GP5A 2JXAA 3ACFA 1KRIA 2OZJA 2QCSB 4XFBA 3RWNA 2UY9A 3ZR6A 1EAH2 2FCTA 2TBVA 4NR1A 4CCJA 2VMIA 2JE9A 2TUNA 4NO4A 4YYOA 2B46X 2VY0A 4V2WA 2W94A 2WNEA 5T54A 5I0RA 2WT1A 1W8HA 2XHKA 4UW4A 5EYYA 2VUJA 4E8CA 1POQA 2D5FA 4ZXEA 4JGYC 4UFLA 3DECA 2OQ7A 3PVEA 3LPFA 4Q4V2 1VBD2 3JZVA 1QHDA 1WBFA 3WF3A 1HIXA 4CUAA 2I74A 4CEWC 4C1WA 4L97A 1OA3A 3MLJA 1F2NA 1FI2A 3U4XA 3KVAA 3VBHA 3O1VA 2PHTA 1STMA 2XWBB 1PMJX 5FYZA 3VBFB 2XH6A 1CAUA 3B02A 5FMBA 5FZ3A 1LEMA 1EAH1 2VOWA 1ALYA 3LF7A 1MS9A 1BEV3 4BXSV 2QQNA 1H9WA 2ZZQA 4Q0VA 1KJRA 2C24A 2RJKA 4OHXA 1ND2A 4FFHA 2Z2SB 2VOTA 2VNRA 5F3GA 1GANA 2PQQA 2RDNA 4HKLA 3BTZA 4I02A 5FMOL 4Q4V1 2QQLA 1VBD1 2R072 1LJ7A 1J3RA 4D8MA 4K7JA 2R6QA 2JWPA 4QQPA 3Q8CA 4AVBA 3FC0A 3LZZA 1QJX2 3ORJA 4LA3A 3N3HA 3B7MA 1SEFA 2QVSB 2PHXA 2XMLA 1V6KA 3RFRA 1OPOA 1W0PA 4EWAA 4UF0A 3V65A 1ZRFA 2H6BA 3VBRA 4DRVA 2AZ5A 2AC1A 3VGIA 2KM2A 2B8MA 4FOVA 4LHKA 4COZA 4I3GA 5JAXA 3IAPA 2IXCA 5FWEA 4DB5A 2Q1FA 1PVC2 1VBB3 1XE7A 1A8MA 4QPGC 1COV3 2WYSA 4LBQD 3OF1A 2YC0A 4IQPA 3TOJA 4Z92B 2NP0A 1W6NB 4XHXA 2VQAA 4XFHA 3T2PA 1G9CA 1HRV2 4Y20A 3ZOIA 4COUA 3F95A 4FOQA 2YG0A 1NOVA 1CPMA 4MZUA 2ZMKA 3WEZA 1QJX1 4XIKA 3KHCA 3LIHA 3WOGA 2AGSA 1GZWA 5CFDB 2JDNA 2WT2A 4NJ4A 3E5XA 2VMEA 3AMMA 3KVBA 4FPOB 1OFNA 3D8CA 4QB6A 2VW0A 3N9OA 4M3CB 3PJYA 4QXKA 3VDDC 2ES3A 5LY1A 2G9GA 2DVGA 3WT3A 2VE1A 1DGLA 5IK4A 5FZIA 3U0ZA 3I2JA 4XBQA 5DQ0A 3ROUA 3WQBA 2VQ0A 3N9LA 5BNNC 4XEZA 2HWF3 4X8PA 1I5ZA 4XF0A 5LA9A 1ZA4A 4GQ7A 2Q0AA 3RWKX 1EUTA 3WP3A 3I3BA 5A3NA 3W59A 5C5UA 1RUC3 1YEWA 3LOIA 4XXPA 5ERLA 1LHVA 2P3JA 2ADEA 2IUWA 4KI5M 2NQYA 4KGQA 3UKVA 2QQMA 3T1LA 4CDWB 1UYYA 4Q1RA 1NYWA 1WA4A 3GCXA 1LB2A 2KD7A 1QNWA 2EXIA 3H8RA 1REEA 3FUQA 4RD7A 2WAAA 2YU1A 5FY1A 2JB8A 2P2KA 4ORFA 5F3IA 5FUNA 2YBSA 2XJSA 1YIFA 4TYSA 2ZHMA 1LHOA 3T4VA 2I45A 2WQZC 2YC2A 2PFWA 1UYXA 3KQ4B 3KZ4C 3MV01 1SMVA 4FO9A 4AHYA 1WW5A 3C2UA 1W9TA 2W3JA 5FPAA 2RS33 4OYUA 3ZXJA 1AR62 4AYUA 4HT1T 1X7NA 3AM2A 4LNVA 3ECQA 1OI6A 1PX3A 4QX1A 3PUSA 2J1AA 2LW8A 1CAVB 2IXJA 2D44A 1H2MA 1ODNA 4Q0UA 2OUHA 3IMNA 4A45A 2BYVE 4EN6B 1OKOA 4GMP3 3HNMA 3WNNA 1JZ4A 3ENRA 3VKOA 1MS0A 4UFJA 4A6OA 4YM3A 1N1VA 2NN8A 4NWWA 2WWSA 3LA7A 4CCLA 1D2QA 1UY4A 3BU7A 4YNIA 5GALA 1PIV2 1LHUA 2VMDA 2RDQA 4GD4A 4QXHA 1V6IA 2NM1A 3ZFEB 1BYHA 1YI9A 1APNA 4Q4W2 3HBKA 4JDNA 2BPA2 5LWBA 4P9JA 4YW4A 5CFCB 4Y22A 4OHVA 1C57A 1AR61 1WKYA 1Q5OA 3M3CA 4DRRA 4JC1A 1DG6A 2ZGUA 4LO8A 1QOSA 5BNOB 4BH9A 5E89A 4OHYA 4HKWA 4MUVA 2D93A 4YW2A 5FYCA 2L9LA 1T6GC 2RG4A 3T08A 4XF1A 1NXMA 4AVSA 5JSPA 1SBFA 1ZVFA 1B35B 1W03A 4QX7A 4FPEA 1J84A 1TME2 4XJUA 3UYJA 5DZFA 5F39A 3VD9A 1T6BX 4RHV2 2YROA 1YWKA 5J37A 2HWD2 4A44A 4Q4W1 3FJSA 1UU5A 2KR2A 1MEC3 1W99A 3ZYRA 3IMMA 1YQ2A 1BMV2 4JGYA 4OQ9A 2TNFA 4HPKB 4JZRA 1WCQA 3T0DA 3FLTA 3TN93 1KS4A 4L9BA 1LTEA 2JB4A 2R0FA 2ORZA 3DXTA 3KV6A 4P9XA 2GP3A 3SISA 1SHWB 2WNUB 4XAEA 4FP3A 4BQ4A 5GLVA 1DZTA 4RQPA 4AFDA 2C4XA 1R083 1YQ5A 3FFZA 4NWVA 3SCGA 5FP4A 4IETA 3AKTA 3GBFA 4BQ3A 1FV2A 2XJRA 3MDPA 4OLLA 2VO5A 5FQ0A 4QU1A 3NAPB 1FMD2 4ZXKA 5FP9A 5C9AC 1MQTA 5FMOS 2FCVA 4PCRA 4RHV1 1Z0HA 4I0WB 4XUTA 4D3WA 1PZ7A 1SBEA 4WM8A 2ARCA 4CCNA 4XF9A 5F2WA 3POIA 4IXLA 4JKMA 1YUDA 4XDQA 1UD1A 1W2TA 4KWKA 4AFCA 4OMCA 4AFAA 1IS6A 2N7GA 1L7LA 4O7XA 4I2OA 4NAMA 1YRZA 3GJAA 1RXGA 3NJXA 3ZN5A 1KEXA 2H6CA 3FUOA 5JR2A 4NPLA 2D3RA 1VR3A 2ZABA 4QX8A 1NKGA 1IKPA 1OH3A 2GNMA 2RMU1 1RUG3 2YV8A 2BW8A 1S2BA 2P3IA 3NKTA 3O1RA 1W90A 3AX4A 1DYPA 3B01A 4UT5A 5HCAA 3OSDA 1FMD1 3PUQA 1UPSA 1AX0A 3H1WA 4YVSB 4DXTA 2DCJA 5C8CB 1V6JA 3WQ7A 4YGEA 1GZTA 1PK6B 2WO2A 3AKRA 4XFFA 3PJQA 5A7PA 3USUB 5KWRA 2R32A 4PF1A 4HOOA 1VMFA 1BK1A 1NCRB 3C7OA 3M7AA 1VMHA 3TRSB 1UO9A 2E63A 2GNBA 3O1MA 2FBEA 5FZMA 1RUF1 5A6XA 2J7MA 3GDBA 1JN2P 1YFXA 1PMHX 2Y34A 2R49A 3J4UH 4ISQA 5C7GA 2WSUA 4KBBA 1WCUA 1RC6A 2XJUA 5F5AA 4CUBA 4K9SA 1R1A1 1REFA 2D6KA 1O4YA 1O91A 4LQRA 1K5MC 1X9TA 1QMJA 4Q4Y3 4NRQA 4BLJA 4JGZB 2PTMA 4BQ2A 2XJTA 1GOHA 3VKMA 1O7FA 2ADDA 2J1SA 4HSLA 5DG2A 2J1TA 1CAWA 1HDKA 2OIIA 1FNYA 2VZQA 3IBMA 1HV1A 5C4WB 3ZN4A 2DBNA 2XXZA 3AFGA 1DGWX 2W2IA 4GH4C 5ACA1 5J1XA 3ZX7A 5LB6A 2A70A 1NX9A 2DVBA 5FK8A 3N35A 3WDWA 4FQ4A 1T2XA 3GNEA 4PQ9A 3VB9A 1UOFA 2D3SA 4LKSA 2IVJA 4DPNA 5FTTC 4OUSA 5FZDA 2VU9A 2XKOA 2ZHLA 1OF3A 5T5JA 2OZ6A 1PNGA 4RYDA 4KG8A 3PMSA 3CIHA 1KJLA 2QQOA 3UGGA 1IPJA 3IIAA 5FPZA 4CDUB 4B7KA 3HJRA 3OUJA 3PHMA 1VBE2 2HWE2 2NZ9A 4I0AA 3AXDA 4XJ8A 5GLTA 5HCFA 4CDQB 4K3UA 3MBWA 1OSGA 5JIAA 1U12A 2CDOA 2XHNA 3HN1A 2ZEWA 3SHRA 3ITQA 1EAH3 2XL9A 4J6GA 2DVFA 2NMNA 2HH9A 2CDPA 4NHKA 5I0DA 2RS52 4YGBA 1UZYA 3OYWB 4QGMA 4IESA 4Y1UA 4IEVA 4MX3A 4Y26A 2PHFA 5FYTA 1RUD2 4NIGA 1ASJ2 4Q5OA 1YXWA 3DPRA 4P5HA 3WNPA 4F3JA 2VOKA 4C0BA 1A3KA 1GP6A 1S2EA 4Q4V3 1RMU1 2XBO2 1MR5A 1VBD3 3VBUB 5J7MA 3C3VA 3I3QA 3THCA 4BQWA 4LEJA 4AGGA 5C3QA 5JOYA 1CQ9A 4L11A 1DLCA 2ET7A 5FP3A 1VBE1 2HWE1 2IWGB 1PGL2 3I3EA 4GWNA 4IV1B 5FMDA 4FTEA 3VBSB 4RFRB 5KC6A 4NIHA 4Q1PA 4CDXB 2IXIA 3NMBA 2G19A 2CGOA 1RUI1 3I59A 2WA4A 2WAOA 4QM9A 2XQXA 4PDWC 2W39A 4UW6A 4FPYA 2Q1ZB 5FRAA 3WUDA 3ZN6B 1UL9A 5F1RA 5CBLA 2AEYA 3WP6A 2XLGA 3I3MA 1D4VB 4JQTA 4KBZA 2Q8EA 4LBQB 3WV6A 4AGRA 3AZZA 4CVUA 2RS12 2R073 1GU3A 4R9BA 1QQP1 1DZQA 2PHLA 4BIOA 2A3WA 1OUSA 3I54A 1JYXA 1QJX3 1LR5A 1V0AA 2CHHA 4RS5C 3ZYFA 5BNPA 1PGL1 2MHFA 4Z82A 3VDCA 1FPN1 3MLLA 5BUVA 2IZWA 2VD7A 1OFSA 5IAVA 5K0UA 4WV8A 2W0XA 2XLAA 3LSEA 1SPPA 5FZLA 4WVWA 2Z4FA 4DXZA 2A5ZA 1IQAA 1ND3C 3DEMA 2G1MA 1PVC3 1UIJA 1UWWA 2A6YA 4BK5A 2W1UA 5A6ZA 3ZXDA 3ACLA 4FP2A 3VHRA 1SG3A 3P1IA 1C8M1 3LFIA 4BA6A 5IAXA 4O9EA 2ATFA 4Q2FA 3IDCB 3POJA 1HRV3 2RS11 2VMGA 5C5TA 1F8VA 4N43C 3E6CC 3VBHB 1V70A 4FOWA 5H9PA 3MW4A 5J98B 5FWJA 1QJEA 4AG4A 1CAUB 3OUHA 5FZ1A 3O7OA 1SFYA 5LRRA 3N7MA 5APAA 2YPDA 2Q5TA 3Q8AA 1NZCA 1RUJ2 1OF4A 1UAIA 5AVPA 1JU4A 4BM8A 3WDVA 4URTA 2DTYA 3WF2A 1PVXA 5FZ7A 1ND2B 1OQEA 2HYKA 5GLWA 1JYTA 3ZSJA 1IHMA 4JKKA 1AL21 4BU2A 4GB32 4E27A 1HXS2 3NJVA 2HWB2 1KDMA 1NLRA 3MLKA 5L19A 3H8OA 3HR9A 1GWKA 3RZMA 1UMHA 3PIJA 4QGNA 4N9HA 3O1OA 5LA0A 3CJXA 4LBLA 3TEWA 1A78A 2CY6A 4UAPA 2CNAA 2Z42A 4YW1A 4UF0B 5A3PA 1DU3D 3GZEA 5IWFA 4AWDA 1NE6A 1CESA 1UX6A 1VBC2 2Q8DA 3VBRB 1Q8PA 4WM7C 5A1LA 5KXCA 4S2HA 5AFBA 3UJOA 1AYN2 4XF3A 3KD4A 4YW6A 2HBUA 3RNSA 3ZIXA 4LTAA 5DZEA 1U5YA 4OQ8A 1FX5A 1AR63 4D6QA 2WO1A 3WW4A 4TTGA 4N53C 2UY8A 2A73B 2VECA 4FQZA 5DUXA 1UXZA 4GB31 2R041 3Q8FA 2E7QA 5EQUA 3W9AA 3NV1A 4Y20B 3T30A 4BE3A 3KT1A 4AAXA 2ID4A 1OUXA 3MPPG 4XCAA 1GNHA 4FI9A 3J7MA 3M2MA 2JG9B 2WUHA 4YSFA 1V00A 1VAKA 2F6BA 5C3OA 4YM0A 1GZWB 2EVXA 5IJRA 3RYPA 3WW1A 3ZKUA 4R8HA 4DXSA 5JIUA 3KF5A 2XOMA 3NO8A 1SCRA 1EP0A 3NJZA 4LLFA 1PIV3 4MGYE 3ZXGA 4YZ4A 2XVGA 4Q4W3 3RI8A 4ASMB 2JE7A 2AREA 4LO6B 5FZ9A 4K1ZA 1VIWB 2NLRA 5IHRA 2QTWB 4GXLA 4MH0E 3AJZA 1JYCA 4NIDA 2WFPA 1QJY2 4MG2A 5BNQA 2OT7A 5J09A 2ZKNA 1I3HA 1MS1A 1S0BA 3GGLA 5KHIA 1HKDA 1OD5A 3ZVXA 2BRTA 3IAQA 3KS7A 4JV4A 2VBPA 3OUIA 2QZ2A 5D2AA 3ZKYA 4AI8A 2J1VA 3I2OA 2RM21 4LIVA 2WLQA 1HX6A 2C0ZA 3P3NA 2AACA 2RHPA 1TME3 1S0CA 5F3EA 4YPJA 3VZJA 5J96B 1MACA 2HBTA 4RHV3 2WZEA 2E53A 4AQ2A 1GKBA 2WT0A 2ZKLA 2HWD3 2WJSA 1XE0A 3U1XA 1R082 5H9QA 3WXPA 1H8TC 3AMNA 4DUVA 2JD9A 4IDZA 1O3QA 1KQRA 2P3KA 1G9FA 1QIQA 2W1QA 2WZ8A 5EIYB 2YMZA 3POFA 1WZXA 1UW8A 1VALA 5T5OA 2J1RA 3BTAA 4E2QA 3ZLIA 1BCXA 2FDIA 1F5JA 3URFA 3VUOA 4MO3M 4QB1A 4H14A 1SFPA 3KT7A 5C70A 2ZX1A 2DCZA 5FOBB 2AR6A 4HVOA 1OURA 1EPZA 1BBT2 1FMD3 3H3UA 5HI0A 1V9U2 2B9UA 2WZR1 3BUCA 2YDEA 2DU1A 1D7PM 2YY1A 4Y22B 4QMAA 5HXMA 1XU1A 3AMHA 3DL3A 4ES8A 3WP5A 4IEOA 3ILRA 4TZDA 1W2NA 1JTZX 3PIGA 4OFGA 4OCTA 1JHJA 4PIZA 1RUF3 3LA3A 4AI0A 1YQ6A 1VMJA 2DFBA 2IXKA 3OGRA 1CWPA 4HXCA 2C9KA 1IPKA 1GMMA 3FZ3A 1OH4A 2G9FA 1C28A 1WW4A 4L8QA 1OLME 1G86A 3A7QA 2PLV1 3GCWA 2BNMA 1R1A3 3RJRA 2IFWA 1MS4A 1U5ZA 2D3PA 3N36A 3VV1A 5IK5A 4GZ9A 3B93A 3ZYBA 1J83A 1GQPA 5IATA 1BXHA 4NROA 4V2VA 4XCBA 2EXJA 3WG3A 3LD8A 2VZ3A 2V72A 4CYDA 4ZZ5A 1BBT1 4AVVA 5FR3A 4AW7A 1V9U1 4I01A 1B09A 2VW2A 4QDRA 5FY5A 3PMEA 5A70A 5C8CC 4JGYB 1XC6A 3AVSA 5ACA3 4IUGA 2OPWA 4JHZA 1PM4A 4CPBA 1W05A 4M00A 5DUUA 1A34A 5A3MA 3NWKA 3CL1A 5FPBA 3MIEA 3AKPA 2Y6KA 1P8JA 2AUYA 5C3PA 3QD6A 4O9GA 4RQPB 4HL0A 3WNMA 5IUQA 4Y33A 5IVFA 1Y43B 4PLOA 1VP6A 4DEVA 2JG8A 3U78A 3OBTA 3JXSA 5FQ0B 5I0TA 5GLZA 3ZFGC 1ZBA2 5DPNA 3WNKA 3ES1A 1OC1A 2W1SA 3RZHA 2V5DA 1LOCA 1SCSA 2ZAHA 1MQTB 2VTFA 1G9BA 3RZZA 1YI7A 5L7OA 1ZYBA 1R64A 2Z5WA 2V73A 3KQRA 1KFXL 4WM8B 3O0VA 4XURA 3RDIA 4AEDC 2ZTNA 3TAYA 4ASKA 3DYPA 1CD3G 3WVJA 1W8WA 4HK9A 3ABZA 1W2AX 4BWOA 4AEKA 5B2GB 1GNZA 2LRPA 2VMHA 3Q8EA 2WABA 1JZ5A 1R091 3QOPA 4QPIC 1Q43A 5BV6A 3I7DA 2CWMA 3RZLA 1CX1A 3U75A 3ASIA 3ZR5A 3O1SA 4LUKA 1O5LA 5ANQA 1SLIA 4IEPA 1LODA 2W47A 3BIEA 4Z8BA 1GSLA 3O14A 3T2QA 2XKPA 1YC61 4AEMA 5KHKA 4AK3A 2W87A 1ZZ6A 2YB7A 5FO9B 1ZBA1 3I3DA 1EUUA 3VKNA 1JYIA 3G7DA 2IFRA 2VTXA 2I07B 3AP7A 3FLRA 2RR12 3T09A 1BJQA 4XIOA 1VBE3 2G9ZA 2HWE3 3ALQA 1F31A 3MFCA 3WLUA 5KXEA 4KU7A 3SKVA 5KHJA 1TNFA 4MGTA 2HLEA 1YQCA 2Y6LA 3AZWA 4YLZA 3OEAA 4CSWA 1Y3TA 5A7SA 5F7UA 2JICA 4MADA 1DQ2A 1RUI3 2RS53 4Y1YA 3AL6A 1AHSA 3J7NA 2R30A 1W8ZA 3JU9A 1RJ8A 2P3YA 3KGZA 3VL9A 3ZFFB 3DV8A 2PHDA 3FN9A 1RUD3 5EJ1B 1ASJ3 3E97A 3SLIA 3CJIA 3MHZA 3OOXA 1XJAA 1ZZ9A 2GNTA 2XB6C 4R9AA 3M3QA 4P5YA 2XBO3 2JKXA 2R1DA 1CAWB 1L7RA 4YW5A 1UQXA 2UWAA 2RR11 1VPHA 2EICA 2WNVB 5FZ0A 2BU9A 4CPBD 1ZRDA 1BK0A 4DZGA 4B8EA 5JXHA 4YFZA 5BXXA 1FPN3 1TZOA 2CL2A 3R0RA 2B7YA 1QDOA 4ZS3A 2X5IC 2EIGA 3JQXA 4FVVA 2XWJB 1WCDJ 3E6DA 4XUPA 1GZCA 4INDA 3MUZ1 1EV11 3FFQA 4HVRA 2VMCA 2ZMNA 1H1IA 4CEYC 1NCQC 5I8SA 3FMGA 2WFF1 1ZZCA 4Q8LA 4QKNA 3POWA 2PAEA 3LFMA 2EF6A 1XB9A 5M0TA 4FPGA 4C0HA 4GALA 2TEPA 5JZGC 3ZIWA 5EYXA 2RS13 1US2A 2PA7A 1WUVA 3D82A 3TBDA 2B5HA 2DVDA 5F32A 3VKLA 1W2UA 1X82A 4YVWC 4LBNA 1H8TA 4AI3A 5HCHA 4X6RB 3BTYA 4RL7A 1G9DA 3DN7A 2CTVA 2YFUA 4IEWA 3POSA 5J48A 4CRQA 4JCKA 5CA6A 4ITCA 4OZOA 1QOTA 1WWYA 2F17A 3MW3A 4MXWA 3DPRB 1WLTA 1JU3A 4IE5A 4Z2AA 2ZGQA 4FPCA 1AL23 4PI0A 4HN0A 5A33A 3W58A 1JUIA 2O1QA 3WDYA 1VLNA 4ZS2A 1GOGA 5HCBA 2R062 3RZKA 5CG8A 3MV11
chains in the Genus database with same CATH topology
2GH2A 1LOFA 4FXKB 4W6WA 3Q9OA 2WZPP 5KHHA 3L2HA 2NPIA 3KMHA 2QUOA 1JOJA 1XXNA 5T5LA 4NOTA 3B3QE 1E57A 2ZZJA 3CO2A 2QZ3A 4HZFA 4N9IA 2OYZA 3I59B 4LUMA 1RUJ3 4QHBA 4XTPA 4XJAA 3VBFC 2CGPA 2ZA9A 3B9CA 3MGUA 1N3QA 4GB33 1HXS3 2R043 3H9AA 2HWB3 3AYDA 3MYXA 3PNAA 5FPXA 4AEJA 3H7YA 3WCSA 2R061 2VXRA 4L99A 1OLRA 4JDMA 4R52A 2QE3A 4LO5B 4PF5A 4AHZA 5BNPB 1DGRN 2EAAA 5EV7A 3KGLA 3EO6A 2CWSA 3AFKA 1VBC3 5K0UB 4CZSA 4COVA 1NA1C 1AYN3 3TWIA 2VULA 5JI9A 1S55A 4JTNA 2DUOA 3ZFGA 1RUOA 2CAUA 5CU1A 3JB4C 2D6PA 1C1LA 1CJPA 2PHWA 2QQPA 3DUIA 4ZU5A 2QFEA 4WVMA 4AEDA 1WW6A 2DCYA 4Q8KA 2OVUA 2Y38A 5JCTA 5GM0A 4Z92B 1S0JA 2VVEA 4FT8A 4J1XA 1YNAA 3MF6A 2UWBA 4R9DA 3VBOC 3MI8A 3VZKA 1S0DA 2FZ1A 3WX5A 3OCPA 5LEJA 1WD4A 4IV3B 1QJY3 1SBDA 1ULDA 4KQ7A 4B4RA 3NV2A 5L36A 5BYNA 4LHNA 2QKDA 1LOBA 4CDWC 5TSWA 4OZXA 2WZR3 3H1MA 1LHNA 1YO8A 4YG6A 3U07A 2GMMA 4CEWA 4ONUA 4CP1A 2RMU2 4CP2A 1H9PA 3AJYA 4LHLA 4OHWA 5CADA 4XQ4A 4QX5A 3MW2A 1FYUA 3AB0A 3L2YA 3AYCA 1AR81 3JD71 2WS91 3KM5A 1Q8QA 1SLTA 4AFMA 4OI0A 3TNPB 1RUF2 2ZGTA 1J58A 4MGIE 1BBT3 1ENXA 2D6MA 1V9U3 3NSTA 1VAVA 1NQJA 4CEYA 1R1A2 5F6LB 3IDBB 4HETA 4Q26A 2UU8A 4R4XA 2VVFA 4A2UA 2GN3A 4HANA 4AHWA 2R1BA 5K9YA 5CFCC 2SBAA 1YJKA 3OY8A 1YFUA 1N47A 4B4PA 4D69A 5FOJB 2VVDA 4XHBA 5ACA2 4JRLA 4W65A 3SCHA 4QPGA 3VZNA 1OMIA 2PYTA 4I30A 2IC1A 4SLIA 2ERFA 4G9SB 3WZ1A 2Z69A 3D5OA 3WNXA 4EWEA 1B35C 4PLMA 1O3TA 5FLJA 1UMZA 4RGAA 5T3NA 1CIWA 1KRIA 1OOPB 2HWC2 4NN0A 2JKBA 5SV5A 4UBGA 5GJ6A 2CV6A 1R093 3OPZA 4RR3C 1TEIA 4W6YA 4FOYA 3M70A 3VDDA 2PN5A 5SV8A 1LGBA 2UYAA 3FHIB 3B69A 1U0AA 5BNNA 1HLCA 1LECA 1RL3A 1URXA 4XFIA 3USSA 2D6NA 2O8QA 2YXSA 1ZBA3 2YUEA 3PVBB 1NLSA 4XBLA 2XG3A 4E9KA 2WNUC 5JVVA 1YFWA 5D1IA 3NW4A 2FMYA 2FQPA 3VN4A 2K9ZA 4A7YA 2D43A 5AC91 1RMU2 1TMF2 2HWC1 2R16A 3FWEA 3N7KA 3H50A 5EFUA 3SH4A 1U5XA 4RA0A 2YGLA 3LOBA 4GMP0 1PZ8A 3M3IA 1ZBE1 1N1TA 1S2KA 5IK7A 5DDJ1 1D4M1 2ARXA 3H1YA 3R4DB 3ZXKA 1ULFA 3LWCA 1RUI2 4BLIA 1F5FA 2A75A 5D8AB 2RR13 3UL2A 4ZKTB 4NVPA 1BVP1 1NA1A 3S7IA 3ZPYA 3HT1A 3MIGA 5I8TA 4EN9B 4YVSC 1TMF1 3EXUA 2DV9A 2XJQA 4L92A 4MVTA 1QQP2 4TLFA 5C8CC 1EV13 1PK6C 3WDUA 5F9TA 1TNRA 1IS3A 4Q0SA 5C33A 4GWMA 2CYFA 2JG8B 2ZX3A 3NL1A 1NCRC 3R4UA 3WDXA 2ZX2A 1FPN2 1PHMA 4K6BA 1GQHA 5L7OB 4LA2A 4B7EA 3ES4A 3THPA 3ILNA 3JQWA 4LE4A 4FPKA 1O3SA 1RUE2 1XNDA 5EZWA 1SLAA 2QDRA 4IEXA 1OA2A 4KWJA 2XJPA 3VBOA 4YM2A 4JGZC 1SLBA 4J1WA 1C8M2 2ZGSA 1SACA 5JOXA 4WZCA 2EA7A 4DY3A 5C4WC 3E5UA 3ME2A 2O0OA 4IEYA 4JDOA 1SFNA 3I2DA 2JEMA 4B29A 3APBA 1WMDA 1GZ9A 4KGGA 3WG2A 1POV0 3VHNA 3U11A 1HQWA 1JW6A 5JMCA 4OULA 2V09A 2RJLA 4YARA 3WW2A 1AL22 1VRH2 1RUE1 1LU2A 3H0OA 3VHOA 4CDUC 1JHNA 4XJ9A 1GLHA 5K8SA 5C9AA 4CDQC 5CAZA 4U2AA 3B5LB 1W6QA 1OQDA 1J3PA 4K21A 2A71A 3CJIB 4PLNA 3ZYIB 1DQ6A 5GKAC 5HXVA 1UKRA 1WLCA 4XILA 3J9SA 5GZFA 2R063 4AFBA 3UKTA 1QH7A 4EJRA 5I0SA 2XJVA 1MVEA 4AI1A 2Y0OA 3T1MA 1D0HA 3ZSLA 1VRH1 2R042 1J3QA 3QH7A 1QY4A 1BKZA 3FE5A 3OBRA 5I91A 4AI2A 1VBB1 4IV1C 1S0IA 1COV1 2ZX4A 3B94A 4LBOA 3IDEA 3VBSC 1REDA 1V6OA 4CDXC 3R6SA 1KDKA 2PHUA 2YPJA 2CGNA 3DF0A 1EPWA 4JAAA 1IS4A 3K48A 1FXZA 5E88A 3S0MA 4ES9A 2KXLA 1X8MA 1RUH2 3GHMA 2OPKA 5H9SA 3AXEA 1UPIA 3HBZA 3R05A 1UU6A 5L73A 1K5MA 4RR3A 2Q30A 2ARBA 5ABJC 1DGWA 1EYBA 1NQDA 2E6VA 2HWF1 4QGLA 1Q3EA 1RGSA 5A33B 1PO22 4DINB 1QOOA 1W6OA 1X33A 5GLUA 5AFBA 4TSVA 2RM22 4AQ6A 5FO8B 2RE9A 4GH4A 1QJZA 1Z7S1 4AVAA 1VBA2 3HQXA 2W08A 1Y9QA 1ZRRA 1RTVA 1QXPA 1WBLA 2WIIB 1IOAA 3SH3A 1MS3A 2DUPA 5KC5A 2ZS6B 1XQNA 3P3PA 1YCIA 4YZ5A 1RIRA 1QKQA 4E4DX 1RUH1 4QQHA 5KHGA 3HAGA 3KSCA 2HJIA 1RVF1 1RHI1 3V0AA 3VBHC 5LEKA 3CLPA 1DQ4A 1XRUA 3LA2A 3SXWA 2PELA 3KCCA 1PO21 5JPMB 3AZVA 1GYKA 2WZR2 1LOAA 1VBA1 1AR83 3JD73 3AKSA 2A7AA 1LESA 4V1PA 1W39A 1DIWA 5I8YA 2ET1A 4YG0A 2BTVC 3JB8A 2AYHA 2K2SA 5E1RA 5AVAA 2B45X 3LB9A 1JUHA 3ZSMA 1J59A 2DU0A 2PLV2 3D4KA 3NVCA 2RMU3 5IK8A 1MVQA 1CONA 3JUUA 1NCRA 4S2FA 4UXAA 3VBRC 3ZFGB 1PGSA 1XNBA 2R0HA 1LGNA 1VB4A 1AR71 4LE3A 1QF3A 1MZEA 3RI9A 4WVMB 5EJ3A 4OHZA 3GBWA 3WG4A 2ZGNA 4PDWA 2GALA 1PO12 1AJOA 4B3NA 1N1YA 2JG9C 4MLOA 3ZXAC 2P17A 1A6CA 2BNOA 1X8EA 4MV2A 3TN91 4SBVA 1X36A 4RS5A 5AFEA 4OI2A 1H4GA 3BCWA 3WQ0A 1AXKA 1CN1A 1UKGA 4GA9A 3RYRA 5GZDA 5JSOA 1BZWA 3BOWA 3GHNA 2BEOA 1ND3A 3KT4A 1O4TA 1R092 1PO11 4P9IA 1POV1 5C8WA 5FLHA 4E2GA 4CEWB 1WLDA 1Z78A 2QDNA 3MICA 4FBFA 2XPJA 1DFQA 1H2KA 1WCKA 4N43A 5AC93 1KS5A 1LENA 3SNMA 1DQ0A 2HWC3 4TWTA 2A6VA 3LCPA 2QNKA 4AVTA 3JCIA 1S1AA 1ZBE3 5JOZA 2BFUL 2P37A 1NY71 3IWZA 1AVBA 3AZXA 4W6XA 1Y7BA 4FPFA 4RGGA 1HW5A 1ZZBA 3HMYA 1LRHA 1SLLA 3SCFA 1H4HA 1OLQA 1YYNA 4CEYB 3WHTA 5J36A 5E16A 4N90A 5BY5A 1GICA 1RMU3 1TMF3 2W52A 1QXJA 3OY8B 5JLVA 1I6XA 1XE8A 3J8F2 4WM7A 4I3PA 1PMIA 5JSRA 4S2GA 1I1EA 4Y4YA 3ZN6A 4Z2WA 1WGPA 2YHJA 4ISRA 4QPGB 1PNFA 1EY2A 4N53A 3ZYJB 3FX3A 1Q8VA 3PTYA 3M4FA 1EV12 2EXKA 4KG0A 4GIQA 1FAYA 4JTOA 2WA3A 3ST7A 5ABJA 1G8WA 2WFF2 4DS0A 4Q27A 2FMDA 1S0EA 4M0HA 2ZBJA 3I8TA 3VDDB 4DQAA 1DLLA 2GMPA 1QQP3 4F7ZA 3CF6E 5A32A 3J8F1 1UN1A 5BNNB 4D7YA 1MZ6A 1Q56A 4H55A 3HWJA 4COWA 1SQ4A 2DYCA 3IPVA 4P9LA 2VNGA 5HBAA 5JPNB 1M06G 3V64A 4RQPC 2JD4A 4Z07A 1ZNPA 4FPHA 5E8AA 4P14A 5LK7B 2AENA 2XLFA 3POYA 1RUE3 2FHRA 1MQTC 4XQWA 2VOVA 4XE9A 1C8M3 1LOGA 4XPVA 2DCKA 4WM8C 4P9GA 3GALA 5I0UA 5KXDA 4HMZA 3ZYPA 4BQ1A 2BVBA 4E2SA 5FCCA 1RB8G 2D40A 5GZGA 1Q8SA 5LK5A 3WP4A 1UCXA 4H7MA 1NA1B 4YZ2A 4BIFA 3SITA 1CJDA 1BVVA 1GV9A 2DF7A 3DGTA 4DMIA 1VRH3 3ELNA 4WVZA 3QLQA 2GNDA 3NV4A 1IGOA 4DY5A 4XXAA 4KL1A 3WQ1A 4D7SA 2D97A 3QH6A 4XOGA 2CAVA 1J1TA 4FXGB 3HIFA 2R071 4LBKA 2A3XA 2EAKA 4EROA 1ZX5A 4OI4A 1KXGA 4BMEA 4IEUA 3ZFFC 4XFCA 3HT2A 3H7JA 3U10A 1DYKA 2C5DA 2JG9A 1H8VA 3BODA 2ENRA 3IT8A 1IKQA 5LRSA 3VBOB 3WG1A 1LKNA 2K0GA 1CX4A 5EXOA 2ZX0A 1MZFA 4EWDA 2XGXA 1JXNA 2WNVC 1C3HA 4AE2A 3INAA 1FATA 1PVC1 3KCXA 2HEVF 4M01A 4AQTA 1Z7S3 1FOD2 1QNYA 4JQRA 4DOUA 3I4IA 1AXZA 1HRV1 1XU2A 1AJKA 4X6QB 2JDZA 1UIKA 3AMQA 3BPZA 4H7LA 3N4MA 3IN9A 4XBNA 3MZHA 2D7FA 1QGLA 2BFUS 3B9IA 3KB5A 4QU2A 3AKQA 3ZXFA 1RUH3 2LM3A 3AK0A 3AZYA 4LO7A 1RVF3 1RHI3 5FO7B 5C9AB 1C5IA 2BWAA 2X29A 1W6QB 2ILMA 3LSDA 4QD2A 2NYYA 1XYNA 4A3XA 1XNKA 1AYM2 5A3LA 1PO23 2ZPXA 2RM23 4HVQA 4WZFA 1FOD1 1VBA3 2MEV2 3MF9A 3DPRC 1SLCA 4LLOA 1W6MA 3JBG2 4QPIA 1QH6A 4XJZA 4X8NA 2WSVA 2I2SA 4A7ZA 1IS5A 5CFDC 4Q4X2 1AL0G 2GDFA 4FAGA 5BNOC 4C90A 3LKJA 2HEYF 2ZGLA 2G4IA 1ZZ7A 1L3JA 1G9AA 3WCRA 3EJKA 4WVVA 1AR82 3JD72 2WS92 3D0SA 5C6CA 3WHUA 3AP6A 1QU0A 3MEPA 2YZ4A 1NXD1 3V0BA 3QACA 4PJYA 2VNOA 1AYM1 1KD7A 4GKYA 3KLSA 4HKOA 1AR73 1W6PA 4YM1A 2MEV1 2B39A 4G4FA 3JBG1 3B00A 1KITA 3BB6A 3E5QA 1LEDA 4Q4X1 4XW3A 1PIV1 1CAXA 4JRAA 1K5MB 1JBCA 4R9CA 4RR3B 4ZU7A 1AX2A 1VB2A 3ZO0B 3R4SA 5BNPC 2P34A 1MZ5A 1W6OB 4M0NA 5CIRA 2PLV3 4KU8A 5FLIA 2Q1MA 1DBNA 1SDWA 3MIDA 4GH4B 5K0UC 1N1SA 1H1AA 2GC2A 2XL7A 1LULA 2X5IA 3N7LA 3RYKA 1U5IA 3UJQA 2VG9A 3ZXEA 2JECA 3GF6A 3AP9A 1CVNA 1NCQA 1TME1 2D6OX 1PO13 3ZFEC 1POV3 3GZUC 2YGMA 3MIFA 4MGZE 3V0AB 5CB7A 1QJU2 2DVAA 4RFT0 2HWD1 2Q8OA 5JR7B 5JZGA 3AYAA 4Y24A 4PBOA 3ZDSA 4HSJA 4Y5Z0 1Q8OA 1IZ3A 1BMV1 4Q29A 3PVOA 3H3ZA 4YVWA 4YRDA 1C5HA 1V6MA 3HD8B 1HQNA 1NG0A 2JJ6A 3S30A 1LHWA 3FLPA 1FT9A 3RMYA 4M3CE 3S6PA 5AC92 4XFGA 2GC3A 5I93A 2ZJCA 4IV3C 5DUVA 4LT5A 3WR0A 4GKXA 5FAXA 1S0GA 4KH9A 3SH5A 1ZRCA 1YLLA 2ZOEB 4AHXA 1N3PA 1AF9A 1QJU1 1ZBE2 2WLPA 3GZAA 5DDJ2 1D4M2 3RJ2X 1D2SA 3MFAA 4AQSA 5EWSA 3ZMNA 4K8FA 2KA3A 3OGGA 1DGRA 4LR4A 2BQPA 1HRI2 4HBNA 2XVLA 4K20A 3O0XA 3MIHA 3VHPA 2Y26A 1AR92 1LCLA 1MS8A 2E7TA 3RSJA 1DQ1A 2E51A 3EHKA 3ZFFA 2OUJA 3ZSKA 4G3YC 2GZWA 4UW3A 4PDWB 3OD0A 2DURA 3NAPC 3VBFA 2IXLA 4CP0A 4BCUA 4B4QA 2OW4A 4EN7B 4ATFA 1YIPA 2ZACA 2WNVA 4K1YA 4XFAA 1QWRA 4N7UA 3GZTB 4UBHA 3WY6A 4RS5B 4EN0A 3RS6A 3OD4A 3TNQA 4M3CF 1HRI1 4E4ZA 3FBMA 2B42B 3A0NA 1AR91 3NV3A 5BPXA 1AXYA 3J8F3 2JENA 2E7AA 2GMEA 1TQ5A 1ND3B 1DHKB 2BBVA 2FZ2A 4XQDA 4ZU4A 3J26N 2A6WA 1QXRA 4OUMA 2MNGA 4YFWA 1PGW2 4R4ZA 4N43B 2V5YA 4FPLA 4PIYA 2WFF3 3CU7A 3PVNA 1O5UA 3NKGA 3TB0A 1CPNA 1W6NA 4BPZA 4COYA 1ENSA 1V6NA 1UF2C 4OVEA 1XNCA 3AMPA 1H2NA 1LGCA 1OOPC 1R1ZA 4FSJA 4MSVA 4Q0QA 2GSYA 1YJLA 5F5QA 5CFDA 3X29B 5BNOA 2GAUA 1BEV2 4MYEA 4M3CA 4S2DA 4XZPA 3RPQA 4IERA 1YFYA 2ZGKA 3O5SA 1TE1B 1PGW1 2WC2A 1ULEA 3G6JB 4XMAA 5DZGA 2IXHA 4NHLA 2RS51 1A8DA 4WM7B 1N3OA 2E9QA 4PBPA 4CDWA 2Y0IA 1GFF2 1RUD1 2VOXA 1ASJ1 1GR3A 3OJBA 5IT6A 3ZYGA 3S7EA 3PLQA 2WINB 2XVKA 4N53B 4DNYA 2XBO1 3ZMOA 4HLTA 1DF0A 1BEV1 1RITA 2H0VA 1I9RA 5ABJB 1VBB2 4Z1VA 5T5PA 1S0FA 2LALA 3O12A 1ENRA 4LULA 1COV2 4H3WA 2WQ4A 2SLIA 2DTWA 3RRDA 2GC0A 2ZHNA 4C91A 4F83A 1CAVA 5T50A 2Q4SA 3VZMA 3OTFA 1FV3A 5D8AC 3WUCA 5A32B 1AX1A 2ZAAA 2ZGRA 2GH8A 2BVVA 2W68A 2QJVA 2YYOA 3L9JT 2BNNA 3IPVB 4XF4A 3VBUC 1WCSA 2BUKA 3ZFEA 1HQLA 2UYBA 1NE4A 3RQ0A 5FFOC 1RINA 2HWF2 2JG8C 2VW1A 5CFCA 4FTBA 3WINE 2VUAA 2NMOA 1O4ZA 2C9AA 4GULA 2ZCWA 1WD3A 1G7YA 4QQLA 1Z7S2 1RUC2 4AGVA 3QBQA 4F8AA 5L7OC 3CNAA 4UW5A 1AZDA 4RSUA 4IL7A 5FDBA 1PZ9A 1H8TB 1B35A 1C4RA 3WD5A 4IV3A 1GBGA 1FOD3 1RVF2 5DG1A 1RHI2 3MPBA 1OKQA 3U0ZA 5FREA 1DDLA 2RS32 3A4UA 4A7KA 1UZZA 2BGCA 4MXWB 1WMFA 3KCYA 5JOWA 4HPKA 4MXVA 4LO4B 2EALA 1RUC1 4OI1A 1AUYA 1RUJ1 3VKFC 2WNUA 4LBMA 3FBYA 4YW3A 4FCAA 1OA4A 3GYDA 1AYM3 1HXS1 2HWB1 2OA2A 4XTMA 3RG0A 3NAPA 4D94A 2X53S 4HN1A 4QQ2A 1W0OA 4YZ3A 5JDBA 2MEV3 4C1XA 3ZXLA 5J3UA 3CJIC 2RS31 2ZGPA 3JBG3 3M1HA 4IEZA 1J1LA 3VLBB 5T55A 5GZCA 4DFSA 5T52A 2H0BA 3D0JA 3LAGA 4Q4X3 5KXBA 1VBC1 5JWPA 2HKXA 5GZEA 2ZMLA 4YG3A 3RMXA 1H2LA 1AR72 1D0GA 1AYN1 2D5HA 4GMP1 4LBJA 1ND2C 1ONAA 1XYOA 1CR7A 1YHFA 2WS93 3VZOA 2DCTA 4MGKE 5DUWA 3BALA 4BZ4A 3UKNA 1ENQA 4Y1ZA 3A0KA 2UWCA 1H30A 3BIWE 4YVSA 3K51A 1MEC2 2WL1A 1BQPA 5C8CA 1PK6A 2DFCA 3USUA 2LTNA 1VJ2A 3TN92 4YGCA 2MPFA 3ILFA 3UV9A 1ZREA 3M3EA 2DWRA 3ATGA 1PM7A 4IEQA 1ZZ8A 1O3RA 4AF9A 2PAMA 3E6BA 3TYJA 4BYYA 4FPJA 4KWLA 5H9RA 1OOPA 4P9YA 4AEDB 4AXOA 5KBFA 1QJY1 1RUNA 4CTEA 4JGZA 1F9KA 1HV0A 1W6MB 4HFSA 2A6XA 4KNCA 4QPIB 1ULCA 4AVCA 2Z79A 3WDTA 4L2NA 1MEC1 3UK9A 3ZSEA 4D7TA 5CG9A 1VAMA 2GC1A 1C1FA 3VZLA 5C4WA 2LUWA 5F6KA 1MS5A 1FNZA 3GBGA 2ETEA 4P9WA 4U36A 5CNAA 4ASLA 2BWCA 4BHPA 1ZM1A 2X8KA 3O0WA 4NPRA 3H8UA 1LOFC 3AP4A 3THTA 4Q0PA 5DXDA 1V6LA 3WW3A 5CVRA 2A3YA 3EBRA 1QJU3 2D6LX 5JI7A 5K7PA 3V0BB 1RUG2 2O8OA 3CEWA 4PIXA 1R081 4EN8B 1LOEA 1NY72 4YGDA 2PAKA 1ULGA 1OHFA 3MIBA 4HK8A 4QM8A 5FBZA 1KFUL 1UU4A 1H0BA 2AH2A 1W6PB 4QMAA 1DQ5A 2VPVA 2JX9A 4CDUA 2XUMA 1M4WA 1C8NA 2VGDA 3M3OA 1G6NA 4CDQA 1OQ1A 4E4SA 3V56A 1CAXB 2DUQA 1XYPA 4K40A 3QCWA 4YZ1A 3OYWA 1RJ7A 5D8AA 1JH5A 2A6ZA 1LU1A 1DZRA 3LGRA 1RUG1 5DDJ3 1D4M3 4BMBA 4I0BA 4Q4Y2 4NHMA 3EQEA 2UURA 3M8LA 4I09A 1HRI3 3AYEA 3OGJA 3IM0A 2X5IB 2C1FA 2ZGOA 4Y1XA 1OPMA 3VBUA 4C0HA 1CGPA 2ZHKA 1AR93 1QDCA 4QPYA 2D98A 4XMIA 4EV0A 4FAHA 4FTSA 3AP5A 2PHRA 1NCQB 2F4PA 4IV1A 2VH9A 3D6EA 1X50A 3VBSA 3T2TA 2WKKA 2GN7A 4CDXA 3DKWA 4WBBA 3SMHA 3VL8A 1WMEA 1H1MA 5JZGB 4XJWA 3IKWA 1GQGA 4BOWA 1WW7A 4N7IA 2EXHA 2HEWF 2ZGMA 3N7JA 4XETA 4XYXA 4QQOA 3ETQA 4YVWB 4JVAA 4ATEA 1WLWA 4Q4Y1 4Y1VA 2GU9A 3BOPA 4LBQA 4QT6A 4META 2JXAA 2OZJA 2QCSB 4XFBA 3RWNA 2UY9A 1EAH2 2TBVA 4NR1A 2VMIA 2JE9A 2TUNA 4NO4A 4YYOA 2B46X 2VY0A 2WNEA 5T54A 5I0RA 2WT1A 2XHKA 4UW4A 5EYYA 2VUJA 2D5FA 4JGYC 3PVEA 4Q4V2 1VBD2 3JZVA 1QHDA 1WBFA 1HIXA 2I74A 4CEWC 4C1WA 4L97A 1OA3A 3MLJA 1F2NA 1FI2A 3U4XA 3VBHA 2PHTA 2XWBB 3VBFB 2XH6A 1CAUA 3B02A 1LEMA 1EAH1 2VOWA 1ALYA 1MS9A 1BEV3 1H9WA 2ZZQA 4Q0VA 1KJRA 2RJKA 4OHXA 1ND2A 2Z2SB 2VNRA 1GANA 2PQQA 4HKLA 4I02A 5FMOL 4Q4V1 1VBD1 2R072 1LJ7A 1J3RA 4K7JA 2R6QA 4QQPA 4AVBA 3FC0A 3LZZA 1QJX2 4LA3A 3N3HA 3B7MA 1SEFA 2QVSB 2PHXA 1V6KA 1OPOA 1W0PA 4EWAA 3V65A 1ZRFA 2H6BA 3VBRA 4DRVA 2AZ5A 3VGIA 2KM2A 2B8MA 4FOVA 4LHKA 4COZA 4I3GA 5JAXA 2IXCA 4DB5A 1PVC2 1VBB3 1XE7A 1A8MA 4QPGC 1COV3 4LBQD 3OF1A 2YC0A 4IQPA 3TOJA 2NP0A 1W6NB 4XHXA 2VQAA 4XFHA 1G9CA 1HRV2 4Y20A 4COUA 4FOQA 1NOVA 1CPMA 4MZUA 2ZMKA 1QJX1 4XIKA 3WOGA 2AGSA 1GZWA 5CFDB 2WT2A 5JOYA 3E5XA 3AMMA 4FPOB 5BNOB 1OFNA 3D8CA 2VW0A 4QXKA 4M3CB 3PJYA 3VDDC 2ES3A 2G9GA 2DVGA 3WT3A 1DGLA 5IK4A 4XBQA 3ROUA 5BNNC 2VQ0A 4XEZA 2HWF3 4X8PA 1I5ZA 4XF0A 1ZA4A 4GQ7A 2Q0AA 3WP3A 3W59A 1RUC3 4XXPA 3LOIA 1LHVA 2P3JA 2NQYA 4KGQA 3UKVA 3T1LA 4CDWB 4Q1RA 1NYWA 1WA4A 1LB2A 1QNWA 2EXIA 1REEA 3FUQA 4RD7A 2P2KA 4ORFA 2XJSA 1YIFA 4TYSA 2ZHMA 1LHOA 2I45A 2WQZC 2PFWA 3KZ4C 1SMVA 4FO9A 4AHYA 1WW5A 3C2UA 2RS33 3ZXJA 1AR62 4AYUA 4HT1T 1X7NA 3AM2A 4LNVA 3ECQA 1OI6A 1CAVB 2IXJA 2D44A 1H2MA 4Q0UA 2OUHA 3IMNA 2BYVE 4EN6B 4GMP3 3ENRA 3VKOA 1MS0A 4YM3A 1N1VA 2NN8A 4NWWA 2WWSA 3LA7A 1D2QA 3BU7A 4YNIA 5GALA 1PIV2 1LHUA 1V6IA 2NM1A 3ZFEB 1BYHA 1YI9A 1APNA 4Q4W2 4JDNA 2BPA2 4P9JA 4YW4A 5CFCB 4Y22A 4OHVA 1C57A 1AR61 1Q5OA 3M3CA 4DRRA 4JC1A 1DG6A 2ZGUA 4LO8A 1QOSA 4BH9A 5E89A 4OHYA 4HKWA 4MUVA 2D93A 4YW2A 1T6GC 4XF1A 1NXMA 4AVSA 5JSPA 1SBFA 1ZVFA 1B35B 4FPEA 1TME2 4XJUA 5DZFA 4RHV2 2YROA 1YWKA 5J37A 2HWD2 4Q4W1 3FJSA 1UU5A 1MEC3 3ZYRA 1BMV2 4JGYA 2TNFA 4HPKB 3FLTA 3TN93