5L73A

Mam domain of human neuropilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
QDEFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-1
publication title Crystal Structure of the Neuropilin-1 MAM Domain: Completing the Neuropilin-1 Ectodomain Picture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l73A00
3FLTA 1YYNA 2YY1A 3N36A 2ZGLA 3ZYRA 2W39A 1LOFC 1CN1A 1LOFA 4GALA 1VLNA 3AZYA 4WVVA 4XXPA 1GBGA 3ZXEA 5T52A 5JMCA 3NV1A 1DQ4A 4XJAA 2NP0A 1S0BA 4DS0A 5DZFA 2JDZA 1FYUA 1QGLA 2GNDA 2NZ9A 2WQZC 1MVEA 1GANA 2DV9A 3ZSJA 5E89A 2JJ6A 2ZGQA 1KITA 1BJQA 1ENRA 1G9BA 4CTEA 1MACA 1W6OB 2ZHKA 5DZGA 5E88A 1Q8OA 4Q8LA 2YMZA 2GMEA 1W6PA 1CR7A 1W6QA 1HKDA 2A6WA 3NWKA 4NO4A 5EYXA 3B3QE 1AXZA 3T2TA 1AF9A 2HYKA 4GXLA 5IK4A 1UN1A 1YI7A 1DQ5A 1UX6A 2A3WA 5DG1A 4R9BA 2NMNA 4YZ4A 4ZXKA 2CWMA 1S0GA 2CWSA 1KDKA 3D6EA 3OY8B 3V0AA 3WG2A 4DQAA 1G9DA 4ISQA 2PHUA 1V6IA 4FPCA 4XXAA 2ZAAA 1D2SA 1CVNA 1WW7A 4XMIA 1MZ5A 3POSA 5GZGA 1SBEA 1C1FA 4M3CB 4YZ5A 4TZDA 3OBRA 3D4KA 1G9FA 2ZHNA 5KXDA 2A5ZA 1AJOA 2BQPA 3KM5A 1QOSA 1S0DA 4FPHA 4D69A 2A6XA 3PJQA 4L8QA 4AVVA 3VKNA 3AZVA 1KRIA 1GV9A 1HDKA 4XIOA 1DQ1A 2ZGUA 3MEPA 3OYWB 1PZ8A 2EXKA 2G4IA 4Y1ZA 3L2YA 4YM2A 3SITA 5KXCA 2WNEA 4YW1A 1A3KA 1DBNA 2EXJA 1BKZA 2D3SA 3LSDA 5GJ6A 1H9PA 1LHUA 4YZ3A 2JD4A 3SH5A 2XG3A 5CA6A 1S0JA 2ZBJA 1ULDA 2ES3A 4AGVA 1FAYA 2D7FA 2R49A 2P34A 1LOEA 4UW5A 3N35A 3ILNA 5GZCA 4XZPA 1N1YA 1CONA 1MS1A 2ZZJA 4FPLA 4P9WA 3VKLA 5IK8A 2A6ZA 1A8DA 2DURA 1ZA4A 2CNAA 2GALA 2D3PA 4Z8BA 1AX0A 1GZCA 1N3PA 4PBPA 3T1LA 2A6YA 2ZGRA 1JHNA 4Q27A 5H9QA 4XJ8A 3AP4A 3I8TA 4XJWA 5GZFA 2V5YA 4DPNA 3QLQA 3ZYPA 4M01A 2WSUA 3APBA 3QCWA 1A78A 1AJKA 5T5PA 2ZA9A 4BLJA 4W65A 1QDCA 1JW6A 4PQ9A 2D6MA 1SCRA 1GLHA 1I3HA 2A6VA 2R1BA 3N7LA 1QOTA 1W6NB 3WDVA 2W08A 4H55A 2R0HA 3VV1A 3WDTA 2DTYA 4Q1PA 4Y20A 4Y1XA 2E53A 3WZ1A 4Y1VA 4YFZA 4YZ2A 1S1AA 2DUPA 2ERFA 1N1VA 1JYCA 3AP6A 1LECA 2LTNA 1N1TA 1ULCA 1ULGA 2AENA 2FMDA 1YIFA 2R0FA 3JUUA 4FPJA 1F5FA 1AVBA 2CY6A 5GLZA 1MS3A 5T50A 1AXYA 1YXWA 5LK5A 1MZ6A 1WW4A 4ISRA 1WLCA 3BODA 1KJRA 4U36A 1LU2A 4XBQA 4XE9A 1G7YA 2OUJA 5JOXA 1LENA 1R1ZA 4DRRA 5T5LA 1V6MA 1AZDA 1AXKA 1GZ9A 4YM1A 1LEMA 2JECA 3Q9OA 3V65A 4WZFA 4WVWA 4YGEA 4C1XA 3ZXFA 3VKOA 1GYKA 3O5SA 3WDWA 1NXD1 4PBOA 3M3QA 5F9TA 1CPNA 2AUYA 3WDUA 2E7QA 2SBAA 3M2MA 2P3IA 3UJOA 1X50A 5JOWA 2EAKA 3A4UA 3SISA 1BXHA 2NMOA 5EYYA 3VUOA 4YZ1A 2JE7A 3AZWA 3IM0A 1JN2P 2D3RA 2YXSA 5GLVA 2VXRA 4Q2FA 1LGNA 4BMEA 1S0EA 1HQLA 1DGLA 4R9CA 1W6PB 3T1MA 4R9AA 2D6OX 3AP7A 2DWRA 3C2UA 1QKQA 1QDOA 4FQZA 4KBBA 4XJZA 1KJLA 2A3YA 4M00A 1FV2A 2PHFA 5IK7A 2FHRA 2ENRA 1DQ0A 3AX4A 1LGCA 2W52A 2YROA 3WVJA 1Q8QA 5DUUA 2ARBA 1SBDA 5JOYA 2ZMNA 4YW5A 5F5QA 2C5DA 3SLIA 3GNEA 3IMNA 1RITA 3UJQA 1XQNA 2NYYA 3AJYA 4ATFA 4BOWA 1YRZA 4YG3A 1FNZA 5GLUA 1H30A 3UL2A 3RQ0A 3FBYA 4GKXA 1SLCA 1LEDA 4GA9A 4RA0A 4Y1YA 1O4ZA 5CAZA 4YGDA 1G8WA 3N7KA 4LBLA 1SACA 2P37A 3PVEA 4YM0A 1UKGA 2DVGA 1LJ7A 1AX2A 1JUIA 1C57A 2D6PA 1I1EA 3O12A 4PF5A 1GZWA 4CRQA 1W6MA 5BYNA 2ARXA 1IS5A 3IPVA 1LOGA 1ZM1A 2LALA 2B7YA 1IS4A 4FPOB 2DVBA 1BYHA 4Q1RA 3U4XA 2JE9A 2WLQA 2PHXA 3AXDA 1DFQA 1IKQA 1QOOA 3DUIA 5T5OA 1SLLA 5DUWA 3MW4A 3WG4A 2ZKNA 5IT6A 4YGCA 4FPEA 3WHTA 4XBLA 3AYCA 3R4UA 1LTEA 1LULA 5T55A 1YO8A 1OKQA 4TYSA 3V64A 2GMPA 1WUVA 1LCLA 2GN7A 2OVUA 1Z0HA 3RSJA 1DIWA 4BLIA 3RRDA 3INAA 1LHWA 4XBNA 4GWNA 2UU8A 3IKWA 2VY0A 3NV3A 1Q8SA 3ILFA 5GZEA 2GMMA 3AZZA 2GNBA 1SBFA 1V6LA 4MYEA 3VKMA 2A3XA 2H0BA 2VW2A 1DLLA 1Z78A 3ATGA 2TEPA 3N3HA 4YLZA 4YW3A 1RIRA 1W0OA 3PVOA 1N47A 3V0BB 1Q8VA 4Y22A 4RL7A 4LBKA 5IK5A 3ILRA 3ENRA 1IS3A 3FUOA 2ZABA 5H9SA 3ZXKA 4BPZA 1CESA 3IN9A 2A71A 3RS6A 1QNWA 3WDXA 3O0XA 4YG0A 4LBQB 4XHXA 3BTAA 4UW6A 4XHBA 3WCSA 1WBFA 4F83A 1ULEA 1MR5A 1LGBA 3UK9A 1MS5A 1QU0A 1SFYA 4FOVA 1DYKA 4U2AA 3O0VA 2V73A 1O4YA 4XILA 4Y20B 3AYAA 1UZYA 2DVDA 2PHRA 4K20A 2DTWA 2AGSA 1V6NA 3TB0A 1N1SA 2E51A 4LBQD 1GSLA 3AK0A 1DYPA 1UZZA 1OQ1A 2C9AA 1D0HA 4HANA 1TEIA 2XB6C 2SLIA 4SLIA 2P3KA 2VW0A 3FLRA 3MW3A 5DUVA 1JBCA 1GKBA 2UWAA 1DQ6A 1VALA 2R16A 4YG6A 3ZXJA 2WSVA 3KQRA 3ZVXA 4P9XA 2EF6A 5KXBA 2ZHMA 1LHNA 2E7TA 2VU9A 4K1YA 4FOYA 1MS0A 4XTMA 3USUA 2GN3A 5DUXA 3ASIA 3SNMA 4AVTA 4GWMA 2WT1A 4GKYA 3WUCA 4AWDA 1ONAA 3B9CA 4K21A 1LOCA 2ZGKA 1S0IA 1MS9A 1WLDA 1KQRA 4ZKTB 1UAIA 2EXHA 2WT2A 4LBJA 3ZPYA 2UWCA 3DGTA 5HCBA 1QNYA 1WD3A 2ZGTA 3ZSKA 4P14A 1F31A 1BQPA 2WJSA 2P2KA 5GLWA 1LU1A 2E6VA 3WHUA 3A0KA 1W6QB 2I2SA 3WV6A 3I4IA 3NV4A 3BOPA 4XJ9A 5CBLA 1CJPA 3B00A 1MS4A 1W0PA 1WW6A 1SLTA 3FUQA 4PCRA 4CZSA 2GNMA 1LOAA 1IOAA 5HCFA 4XOGA 3V0AB 3RMYA 3WLUA 5HCAA 2EALA 3WOGA 2WKKA 1LHOA 5H9PA 3FLPA 5GLTA 5EWSA 1LOBA 2ZMLA 4OZXA 4XMAA 1VAVA 2WT0A 4ITCA 2D44A 1DHKB 4R9DA 3HN1A 3POWA 4YW4A 2UURA 1GNHA 5FREA 3LCPA 2DUQA 3B01A 2KM2A 4BMBA 4XDQA 2DVAA 1JXNA 4XIKA 3D5OA 5L73A 1W6OA 2YZ4A 4XTPA 1GZWB 4JCKA 1W6MB 1F9KA 2CL2A 3PVNA 2VUAA 3IPVB 3MPPG 1WBLA 1WCSA 1HQWA 1CIWA 1FNYA 1SLIA 2Q5TA 2D6NA 5GZDA 1PZ7A 4C1WA 1WW5A 1IKPA 3RMXA 5FRAA 1Q56A 3N7MA 4FQ4A 3W58A 1MVQA 4FP3A 1CQ9A 5DZEA 2VW1A 4M3CE 1DQ2A 2A70A 3A0NA 1KDMA 1PZ9A 1EPWA 5H9RA 3OY8A 5JOZA 2AYHA 3ZXLA 2D43A 2NN8A 2DVFA 1VAMA 1JYIA 1IS6A 2A7AA 3WG1A 4M3CA 2ZGOA 1N3OA 1G9CA 2Z42A 5GALA 5EXOA 1NLSA 1S0FA 4UW3A 1BZWA 4UW4A 3JU9A 1LHVA 1Y7BA 4NOTA 1V6KA 2JKBA 4FPFA 2CYFA 3GALA 2OW4A 2ZGNA 3OYWA 4HL0A 2PHTA 1B09A 2DUOA 4JRAA 3HR9A 4LBOA 4Y22B 4BQ1A 3HMYA 3WCRA 1FV3A 1LESA 1FX5A 1URXA 3AFKA 3OJBA 5E8AA 2GDFA 1V6JA 2UWBA 4WV8A 2DYCA 2NM1A 1HLCA 4M3CF 4DRVA 4P9YA 5JVVA 2CTVA 3CNAA 1SCSA 5AVAA 3B69A 3M3CA 3RG0A 4Q26A 1UMZA 4FVVA 2ZMKA 1Q8PA 4Y1UA 5SV8A 2ZHLA 2D6KA 2GNTA 3AYEA 1S0CA 2PHWA 2R1DA 2ZACA 2ZGMA 3R4SA 5DXDA 3WUDA 2DU1A 2VH9A 1FATA 1RINA 1SLAA 1J1TA 1JOJA 2DU0A 2A75A 2RHPA 3LSEA 4FPKA 3WDYA 4AGGA 2ZGPA 1UPSA 4AGRA 3AJZA 1ENQA 1ULFA 1G86A 1OFSA 4ASMB 3POYA 1H9WA 2AREA 1GNZA 1APNA 2AR6A 4Q8KA 3V0BA 1V00A 4ATEA 4YFWA 4DFSA 5DG2A 3H0OA 3ZSMA 1G9AA 3AYDA 1ENSA 3M3OA 5KXEA 2P3JA 4YW2A 5CB7A 1AX1A 4YGBA 4IQPA 3N7JA 3OPZA 4FOWA 3M1HA 1N3QA 3O0WA 4LBQA 2EXIA 1VIWB 5GM0A 3SH4A 3SH3A 3AXEA 3USUB 3AP5A 4I30A 3NV2A 3PMEA 1UL9A 4LBMA 5JDBA 2D6LX 2YV8A 1C1LA 1W6NA 3OGGA 3R05A 3VKFC 3WNXA 3MW2A 2ZGSA 2W68A 2AH2A 1LODA 4Y26A 2PELA 1U0AA 3BIWE 5IUQA 2OUHA 3AP9A 3WG3A 4FPGA 3FFZA 1MS8A 4BM8A 1DZQA 5T5JA 4XYXA 4FP2A 1WD4A 5JLVA 1QF3A 3AZXA 4YM3A 3OBTA 4XJUA 4JC1A 4FOQA 3ZSLA 1QMJA 4AYUA 4AVSA 3M3EA 3TAYA 1V6OA 1CPMA 4K1ZA 4FPYA 1C4RA 2EIGA 4Y24A 1GICA 5T54A 1SLBA 1WLWA 4LBNA 5CNAA 3W59A
chains in the Genus database with same CATH superfamily
3N36A 2YC2A 3ZPOA 1LOFC 5FPLA 5L19A 3FN9A 1PK6B 4GH4B 2BGCA 5K0UA 1WA4A 1WMFA 4WM7A 5T52A 4YYOA 5CISA 1AL22 3WP6A 2ATFA 1IZ3A 4ZONA 2XJRA 1UMHA 5I0SA 1QGLA 1EAH2 2WQZC 5C4WC 1MVEA 1JZ2A 2Z69A 5LB6A 4O9EA 2DV9A 4EN0A 3HWJA 3W20A 3MIGA 4P02B 1GP6A 3WW4A 1H1IA 2UYAA 5DZGA 1Q8OA 1YCIA 1VMJA 2VQTA 3AVRA 1VBE1 3IB3A 1W6QA 1RUF1 3RFRA 4UBHA 4NO4A 5EYXA 2VNRA 1BBT3 1VRH3 3W21A 3V56A 5C9AC 3PVBB 2OXBA 3EQEA 3S7EA 5IK4A 1SPPA 1UN1A 2X5IC 2A3WA 1W0NA 1EUTA 1YUDA 4YZ4A 3RJRA 3VBUA 1S0GA 2XJUA 5A3LA 1C8M3 4K8RB 4AL9A 4FPCA 3K3OA 4UFJA 1WW7A 3ZR5A 5CG8A 1PNFA 2ORZA 3BCWA 3J8F2 3WNNA 5A7QA 5GZGA 3BI3A 5CVRA 4TZDA 3OBRA 4MADA 1G9FA 2X10A 4GJYA 3CZUA 4FPHA 5F39A 1S0DA 3S7IA 1W2AX 4RQPA 3TN92 3VKNA 1HDKA 4XIOA 4XQWA 1IG3A 4URAA 3KWVA 2W5FA 5C8CB 3OYWB 2WDBA 2G4IA 1AR83 3L2YA 5CFDB 3FX3A 4H3WA 4EWEA 4N8MA 2OYZA 1DBNA 1PO22 1YQ6A 3KV5A 5GJ6A 4QKDA 3EBRA 4QMAA 4EE2A 2QJVA 1JU3A 1SHWB 4YZ3A 4TTGA 1S4CA 1IGOA 2YC0A 3J7MA 1POV3 3NMBA 4UWDA 5CA6A 1WWYA 4LOTA 5F7UA 3UKTA 3NL1A 1FAYA 2BWCA 3ZOIA 3S6PA 1LR5A 3AMMA 4UW5A 3N35A 4DIQA 2VMEA 4AEDA 4DUXA 4YARA 5FZ8A 4XZPA 1N1YA 4XFGA 1O59A 2WUHA 1O3QA 1NA1B 2PYTA 3I97A 4NWWA 4E4ZA 2R062 2DCZA 4NPRA 4RFT0 2D3PA 4Z8BA 4PBPA 3T1LA 4CP9A 2PLV1 1JHNA 1AHSA 2VC9A 1QJX3 4XURA 1W05A 5A6YA 3Q8EA 2GP3A 4A7YA 4XJWA 2W9XA 2V5YA 5EPAA 3I3MA 4CE8A 1QH6A 4NAOA 3K51A 2EA7A 3ZDVA 1QXJA 3ACFA 2WWSA 2QKDA 1XPWA 3J8F3 1RUG2 3APBA 4FTEA 1AJKA 3MIBA 3S5QA 1DGWX 4UF0A 4ET7A 4EWDA 1JW6A 2VCCA 2D6MA 4PQ9A 4FAHA 4PF1A 1I3HA 4CCMA 1QXRA 4JQRA 2VCMA 2DF7A 4MGSA 4OQ9A 3BOWA 1SZBA 2IXKA 3WDVA 4H55A 1IPSA 4QKFA 5F5IA 5FMBA 3WDTA 4NIDA 1QJY2 4Y20A 4YVWB 1EY2A 3O1OA 5E16A 3MFAA 4RD7A 4QXCA 4Y1VA 3UGFA 2CDOA 5J7MA 4YFZA 4YW6A 4YZ2A 1XRUA 1S1AA 2ERFA 2OT7A 4ZU5A 4JVAA 5FYZA 3T4HB 5FXWA 3BU7A 3VD5A 2AENA 2FMDA 5L9RA 1MQTB 5FR3A 2YC4A 4FPJA 3MDPA 2WNUC 4XZUG 3H7JA 1AVBA 2CY6A 5T50A 4DEQA 1ZZ8A 1AXYA 4K6BA 4GULA 2VZSA 4N7UA 1RVF3 1WW4A 4OUSA 2RVAA 3VBRC 1KJRA 3IAQA 5ACA1 1OH3A 5JXGA 1PMIA 2IXHA 4DRRA 5T5LA 3BTYA 1AZDA 2QQKA 1DYOA 3Q9OA 2WAOA 2R063 1XXNA 4WZFA 5FWEA 1J58A 5FYIA 4OI1A 5JXJA 1RHI2 3VKOA 1GYKA 3O5SA 3RZGA 1NXD1 2Q8DA 2AUYA 5DPNA 1H2KA 2E7QA 2SBAA 1GUIA 4I0WB 4QXHA 3UJOA 5AC91 5C4WB 2EAKA 2RS31 2YB7A 4RN5A 4DXZA 1BXHA 4YSFA 1PM7A 5EYYA 4B4QA 3AZWA 3IM0A 5AVPA 1CAWB 2D3RA 2WLPA 3PDQA 1XNTA 2VXRA 2FCTA 5JZGA 2R043 4LKEA 4R9CA 2FCVA 1YI9A 2XBO2 3AP7A 3C2UA 3DYPA 1QKQA 1QDOA 2XXZA 4CXXA 2PHFA 3SCFA 2ENRA 4QX8A 1DGRA 5C9AB 1QJY3 3WVJA 5J1XA 3D3AA 2ARBA 3S5AA 2X5IB 5J3UA 4XCAA 4YW5A 5F5QA 4CU8A 4HG6B 4NRMA 1NXMA 5JPMB 3UJQA 4ATFA 3JBG2 2XJVA 1YRZA 2N7GA 3IIIA 5IFTA 2O8OA 2X53S 1FPN3 5I91A 3U37A 1H2MA 5I0UA 1L3JA 1QJU3 4GA9A 4RA0A 1RUJ1 2RJLA 4L9BA 3T0DA 2ARAA 4PI2A 2HWF3 2R6QA 3HVDA 4LBLA 4QD2A 4IE4A 3PVEA 4PDWA 3AKPA 4COZA 4PI0A 1AX2A 1JUIA 3OUJA 1GZWA 5IVFA 1W6MA 5FZ1A 2HWE1 1RHI3 2X29A 3IPVA 2D93A 3OTFA 4CCDA 3S0MA 1RMU1 1HB4A 2PMWB 4D8MA 2DVBA 3FHAA 1OKOA 1UU5A 2VZ3A 3AXDA 2PAKA 2R073 1IKQA 1NLRA 1QOOA 1W99A 3CLPA 1RUI3 4IL7A 5IVBA 3D8CA 4KGQA 5IT6A 5HI0A 4YGCA 3WHTA 3AYCA 1LTEA 3GZTB 5T55A 1RUH1 5FZ6A 5CADA 1OKQA 4TYSA 2XBO3 4R52A 1LCLA 2GN7A 4BQWA 1Z0HA 3PLQA 1DIWA 3LD8A 3RRDA 2VMIA 3INAA 3GBFA 3VBHC 4HONA 1JZ6A 1K5JA 3ACGA 5F3GA 4LA3A 5FY1A 4RS5A 5GZEA 3CL1A 3WF2A 4XFCA 1CAUA 4IGOA 1PGSA 4MYEA 1XU1A 1Z78A 4QXBA 2TEPA 3N3HA 1HN1A 5L36A 4GMP3 4CDUC 2W2IA 3MUY1 2XR4A 2Y34A 3B93A 4Q4W1 3BTXA 4Y22A 4RL7A 4ZZ5A 2VMFA 1R093 2Q1FA 1AUYA 1ZX5A 1AYN3 1HV1A 3IN9A 4LLFA 1Y9MA 1VBC3 4YG0A 1NLQA 3I3DA 1NYWA 4XHBA 4F83A 5C5UA 1MS5A 1SFYA 2ORXA 4UFLA 4ARXA 1ZBE1 2V73A 1KS5A 4XILA 4EYUA 3AYAA 5FXZA 3HQRA 5F1RA 2X8KA 1D7PM 1LKNA 2ZX3A 3A21A 2AGSA 1V6NA 2DCJA 1S55A 4NIIA 4OUEA 3TB0A 3RPQA 2JDUA 1Y4WA 4JHZA 4MGYE 2RDSA 2ZX1A 3WR0A 3ZO0B 3T3YA 3VN4A 5CFCC 3K75B 3NVCA 1OQ1A 4AEJA 4X8NA 1TG7A 1UPIA 4BU2A 4CEYC 1RUC3 1PX3A 1VPHA 1OPMA 2XB6C 5CYYA 1YNAA 4LE4A 1OI6A 1JBCA 4NIHA 2ZZQA 4AAXA 4Q0PA 3DCQA 3VBRB 5C3RA 5KBFA 4YG6A 5B2GB 1D4M1 3QH7A 2WC2A 2YU1A 3ZVXA 3OF1A 4TWTA 4P9XA 1CWPA 1DCSA 2VJXA 3WEZA 1FMD3 2E7TA 3NAPA 4B4PA 1HRI2 1WZXA 3NNFA 1ODNA 4HT1T 4K1YA 2QDNA 4AVTA 3ASIA 5A3OA 2VVEA 3SNMA 4K21A 1F8VA 1K12A 4O7XA 2HEWF 2YFZA 3KHBA 2G9ZA 4LHKA 1S0IA 1ZVFA 1E5HA 1CZVA 3H7YA 5HCBA 2VULA 1I5ZA 5FUPA 1E5RA 1MQTA 3DKQA 5DAQA 3S57A 2MNGA 2P2KA 4CCOA 3BPSA 5FJKA 3WHUA 5FLHA 3R6SA 2VR4A 4K40A 1PVC1 2I2SA 1QQP2 1VBE3 3OEAA 2J1EA 2XJTA 4HVOA 3RZZA 1W9TA 3WV6A 3TNPB 1RUF3 2VXJA 3KZ4C 1SLTA 2ID4A 3N9PA 1OF4A 1LOAA 2XJSA 5FZDA 1IOAA 5HCFA 2IFRA 2VCAA 2EALA 4BZ4A 3ACLA 4WVZA 2VGDA 5H9PA 2WFF1 1HB3A 4OZXA 5GKAC 2WT0A 5FZGA 5IATA 3RI8A 3DEMA 1XYNA 3POWA 2J42A 4QPWA 1HRV1 3JCIA 4NPLA 2BU9A 3HN3A 3LCPA 1MZFA 2JG8C 1UYXA 2WIIB 4XDQA 1NY72 3D5OA 2H6CA 5L73A 5JIUA 5FP7A 3PVNA 2CL2A 3MPPG 3GDBA 1WBLA 4GJZA 4IE5A 3VHOA 1SLIA 1UZWA 5GZDA 2D6NA 5FY4A 2Q30A 1ND3C 1ZZCA 1BVP1 4E9KA 4BXFA 2OPWA 5DAWA 2XONA 2GH8A 3ZFFA 2RDRA 3BYWA 2VW1A 3MI8A 4M3CE 3DN7A 2O14A 3HPNA 1PX4A 1NCRC 1E57A 4XETA 5LA2A 4Z1VA 4P00B 1EPWA 5H9RA 3OY8A 2FDFA 3ZDSA 5JOZA 3SKVA 4IDZA 4G4FA 2BYVE 2XH6A 1C8NA 1WCUA 3E1F1 2DVFA 4TXWA 3IWZA 3VBHB 4RHV1 1ZRIA 2G1MA 2BNMA 3PU8A 3RZMA 1TVGA 2ZGOA 3H1MA 4FCAA 4KQ7A 1NLSA 4UW3A 4URTA 1BZWA 5LY2A 5KR7A 2W1SA 1COV1 1LHVA 4KH9A 1O3SA 4GD4A 2FDGA 4NOTA 2FMYA 2JKBA 3BVCA 2ZGNA 2PHTA 1TNRA 5JPNB 4IERA 2PLV3 1ST8A 4X6QB 2EIDA 2BWAA 1WCQA 4GIQA 4CCCA 2QQUA 1PO12 1URXA 5LRRA 2GDFA 4CDQA 4DRVA 3M4FA 2DYCA 2NM1A 4WV8A 1LAJA 4P9YA 4IGPA 2TUNA 2CTVA 5D8AB 4XF9A 4RGAA 2EIEA 1B35C 2HKXA 5FPBA 3F2ZA 2J1VA 2QQVA 1TE1B 2C0ZA 4FVVA 1ZBA1 2RG4A 3UV9A 4AQTA 3AYEA 1AR91 2PHWA 4Q4Y1 5DXDA 3VDDA 4LIVA 5G05L 3SMHA 1EP0A 4B3NA 3CF6E 1TMF2 1J1TA 1JOJA 2DU0A 2A75A 4BIFA 4FPKA 3FFQA 2OA2A 5HXMA 2PXJA 1UPSA 5CFCB 2VZTA 3I2HA 1J59A 1ENQA 3PMSA 4CEYB 4P9JA 4A6SA 1ODMA 2ADDA 4Q29A 2Y8KA 3CU7A 4DFSA 3GGLA 3H0OA 5C70A 2WQ4A 3M3OA 3ITQA 5IJRA 1H4HA 2QDRA 3AKTA 4PT6A 4DY5A 5I0DA 1H2NA 4FSJA 2XOMA 3N7JA 5FZ9A 3WT3A 5FMCA 1N3QA 2VMHA 3O0WA 2EXIA 3SH4A 2P1BA 3ZKYA 3URFA 1J84A 3J7HA 4KWKA 2WZ8A 2VNOA 4LBMA 2E9QA 4BA6A 2YV8A 4IE7A 4OULA 2WZPP 3VKFC 1OURA 3PTRB 4UAPA 1YQ5A 4COYA 4HLTA 2O1QA 2W0XA 3ACIA 2HH9A 3LWCA 4A42A 2UY8A 2B8MA 2Y64A 1DZQA 5T5JA 2E26A 1XJAA 4CDXC 4FP2A 1FXZA 1PO13 3AZXA 5AC93 1J3RA 3T2QA 3WINE 1O3RA 1H0BA 1QMJA 2LRPA 3THDA 2RS33 5K8SA 3M3EA 1YQ8A 3TAYA 1V6OA 2VOKA 2YU2A 1OD3A 2XVLA 1DU3D 1C4RA 4FPYA 3O1VA 1RJ8A 3RZLA 4E8DA 1J3PA 1YQ2A 1SLBA 4LBNA 4CP0A 3A23A 5KHJA 5F2WA 2G9GA 5IVVA 2QVSB 3RZJA 3ZYRA 2ZGLA 5JWPA 2GC0A 1CN1A 1HV0A 4MGZE 4WVVA 3H8UA 2DFBA 5ISLA 1GBGA 3GCWA 5HCHA 1H8VA 3NV1A 4MXWA 2NP0A 3OUIA 3T08A 1OH4A 3W5NA 2WZR1 3GHMA 1GANA 2RR12 2JG8B 2JJ6A 4MZUA 1ENRA 1S2EA 5A3NA 3GXUA 3I2IA 2ZHKA 3DYOA 2KA3A 3IDEA 1ND2C 4Q8LA 1KFXL 2GMEA 4DUVA 1W2TA 4H7LA 3FJSA 3TEZA 1CR7A 2VZPA 1FOD2 1XNBA 4QKBA 1HKDA 4AI9A 4CUCA 2XJPA 3NWKA 3K2OA 1ND3B 3VBFC 1GNYA 4EZ4A 2FBEA 5ANQA 2HWE3 1AF9A 1ZRFA 4YRDA 1R1A1 1RMU3 4XQ4A 3U10A 4Z2WA 4ZXKA 4R9BA 1NCRB 2NMNA 3ES1A 4MGTA 4AQ2A 1K5MC 1HJGA 1KDKA 2BJSA 2CWSA 3D6EA 5LWBA 3WG2A 1G9DA 4JTOA 2PHUA 1V6IA 3WNPA 4UT5A 2RS52 1W2UA 2YGMA 4P5HA 1ASJ1 1CVNA 4XMIA 5F3EA 1MZ5A 1FT9A 5CG9A 1C1FA 2D40A 3AVSA 4M3CB 5LBFA 1RUH3 3ZYFA 3D4KA 5BPXA 4CU7A 3NNJA 2A5ZA 2BQPA 5FKBA 1M06G 2A6XA 4L8QA 5E6HA 1GV9A 3WW3A 4CUBA 1OA2A 1GQHA 1DQ1A 1VB4A 1KGYA 2ZGUA 3EYPA 3N9LA 4R8HA 2EXKA 4YM2A 3PUQA 3SITA 4AAPA 1PGW2 4S2GA 4ZU4A 1CX4A 5FAXA 1BKZA 1DZTA 3LSDA 5F32A 1H9PA 4EN8B 3WNLA 5JR2A 3SH5A 2JD4A 4GWIA 4XF0A 2RM21 4Q4W3 5LA0A 4Y5SA 2VCBA 1V0AA 2ES3A 3AMQA 4RGGA 1JUHA 4RFRB 1B35B 5A1LA 2RMU2 4PLNA 1VAKA 3MF6A 3KT1A 1LOEA 4XUQA 5LEJA 3OBAA 1BEV1 2YUEA 3ILNA 4GB31 1VP6A 4XVHA 3SHRA 5I0TA 4J1XA 4CDWC 1W8ZA 1PHMA 2ZZJA 2VVFA 1S2BA 3O1RA 2A6ZA 4OMCA 1OA4A 4KWLA 1ZBE3 2DURA 3USSA 2IUWA 2A6YA 3I2FA 1DP0A 3ZYBA 5H9QA 4XJ8A 5FPAA 3I8TA 3ACHA 4JDOA 2P3YA 4MOAA 4FFHA 5GZFA 1POQA 4DPNA 5LZ6A 1OLMA 4OYUA 4BDVB 2VNVA 3AMNA 3H3LA 3ZYPA 2CDPA 5FZOB 3BN6A 2WSUA 4A3ZA 1A78A 4OVEA 1XE0A 1ENXA 2V5DA 5T5PA 2F4PA 3WQ1A 3MHZA 3O1SA 4W65A 4JAAA 1GR3A 1QIQA 3LOIA 1GLHA 1D4M3 2A6VA 4RR3A 5A6XA 1W6NB 3IAPA 4UFHA 3C7EA 2W08A 2WO7A 2R0HA 2YGLA 5A32B 1VMFA 4Q1PA 1ALYA 4Y1XA 3BIEA 4GAZA 4AI3A 5BNOA 1OC1A 5KHHA 1BBT2 3WZ1A 2G9FA 2IC1A 4CDXB 2BBVA 2DUPA 4CEYA 1PGL2 1JYCA 4QXKA 2LTNA 4MVTA 2XKOA 5IVEA 1BHGA 1C8M2 4CCEA 1OFNA 4F8AA 4HVQA 2RMU3 1F5FA 3E6CC 5EP9A 5GLZA 4UOJA 5LK5A 1V9U1 3DV8A 4BIOA 2VMGA 4ISRA 4D7TA 4U36A 2WWUA 4XBQA 4XE9A 5JOXA 1G7YA 3NRUA 5DABA 5IW0A 5FO9B 3JQXA 4QM9A 4QPIA 1PVC3 4TLFA 1UY3A 3UETA 2BUKA 4HMZA 5C71A 4WVWA 3C8XA 4C1XA 3E5XA 4NMIA 3I2KA 1OOPA 5LEKA 1AR82 2K0GA 2HWC1 3H9AA 4PBOA 1UF2C 4DOUA 3M2MA 5I8TA 3IMMA 1D0GA 1CAXB 1WMEA 1YFUA 5JOWA 1AR61 4QM8A 2B46X 4Q5OA 5K7PA 1R082 2WFF3 2NMOA 3A4UA 1AR71 3G6JB 5CIRA 3SISA 5ANNA 5DAXA 2BERA 2A73B 4E2GA 5FP4A 2BW8A 1Z7S1 1GFF2 4QPGC 5FZ4A 4QDRA 2YBSA 1YLLA 1W6PB 3UKNA 1XYPA 3DPRA 2OKXA 4FQZA 2WAAA 1YHFA 3HT1A 1NKGA 4KBBA 1KJLA 5A7WA 3ZYJB 3GJBA 5A33B 3VBFB 2FHRA 4G9SB 4WM8C 5IK7A 5A3UA 2OZJA 4CCJA 1C5HA 4JGYC 5C8CC 5DUUA 1SEFA 5EIYB 1W2OA 3Q8FA 5JOYA 5D2AA 1K5MB 2VNGA 2WNVC 3SLIA 3GNEA 2B39A 3T4VA 1QJX2 3AJYA 2LW8A 4IEXA 1H30A 3JD71 4CP2A 2QQWA 3UL2A 5ABJC 5JSOA 3RQ0A 3FBYA 1IPKA 2VAUA 4IV1C 2RJKA 4Z92B 2LM3A 4Y1YA 2JG8A 3RI9A 4HBNA 5IYYA 1DG6A 2P37A 4IEUA 4Y33A 2E63A 4I3GA 4ARYA 4M0HA 4YM0A 4OHZA 2DVGA 1LJ7A 4RHV3 2EICA 2JE8A 3ABZA 4QB1A 3MO4A 2D6PA 1US2A 4CRQA 4PF5A 1I1EA 5BYNA 3CJIB 3CIHA 1ND3A 2DBNA 1COV3 4A7ZA 1IS4A 1BYHA 4Q1RA 3U4XA 5EQUA 3I3BA 4RYDA 2W87A 2Q8CA 4PIXA 1DFQA 1WMXA 1E5SA 3POBA 3HJRA 4AQ6A 1STMA 1R083 5T5OA 1SLLA 3MW4A 3WG4A 4FPEA 3GZUC 4XBLA 3R4UA 3JXSA 1YO8A 3CEWA 2Q8OA 2IXLA 4IXLA 2LUWA 3RWKX 3LGRA 4CDWB 1NT0A 3RVHA 5LA9A 3I49A 3KT7A 4BLIA 1RVF2 1TZOA 1ZBA3 2CAUA 1LHWA 3S30A 5LBEA 5IAVA 2UU8A 5JXIA 4Q4Y3 2VY0A 4K3UA 3NV3A 2QQIA 5J09A 1VJ2A 3ILFA 4E4SA 1SG3A 2DBIA 1NQDA 3U0ZA 3VKMA 5F5AA 1DLLA 3ATGA 4FFFA 4YW3A 1RUE1 5FZHA 1BK1A 4Q4X1 4QWNA 2VPVA 4EN6B 5IK5A 2VZQA 3ILRA 4Q0UA 3ENRA 4AR2A 1W28A 2WRAA 1IS3A 5F6LB 2ZABA 2F4LA 4WVMB 1US3A 4H2AA 1YEWA 4IEWA 1DZRA 1RUD1 2VOXA 3KF3A 3U14A 4L2NA 3H8RA 1QHDA 4MHUA 2YBKA 3WDXA 3O0XA 1Y9QA 2R042 4IE0A 1XNKA 1JI6A 2YYOA 3WCSA 1X9TA 1LGBA 3ZIXA 3MIHA 3P3PA 1NCQC 1DYKA 4OMDA 4U2AA 2XDVA 2V09A 4W6WA 3D82A 4P9LA 1QJEA 3I2JA 2P6CA 3ROUA 3AMHA 1JMUB 3IDAA 4LOSA 4IEYA 4LKFA 1CJDA 1N1SA 4NHYA 1D4VB 1UNBA 4IV3C 2Y0IA 2MEV2 3VZNA 5IWFA 3KF5A 2XGXA 4SLIA 1T2XA 2P3KA 3FLRA 3WP3A 3OPTA 4O9GA 1FPN2 1AYM1 4YVSC 5B4NA 2UWAA 5CKNA 1QJU2 5DDJ1 1YWKA 5FZOA 1VRBA 4LK6A 2HWF2 5D1IA 2FDHA 1TME1 4OI0A 2WS92 4DY3A 2WSVA 3KQRA 3VHNA 4X8PA 3POEA 5KXBA 1JYTA 5JIAA 4FOYA 3E5QA 3USUA 2GN3A 1ZZ7A 5LATA 3WUCA 3ZIWA 4E4HA 1RB8G 4TSVA 1ONAA 4Q4V1 3ECQA 3MLKA 1H2LA 3ZSEA 1OXCA 4ORFA 2BFUS 2ZGKA 3AKQA 3CBNA 3B9IA 4CDXA 4JHTA 2E32A 1GWLA 3AC0A 1UAIA 4AFCA 2EXHA 2HWB1 4LBJA 3ZFGC 3DGTA 3NJXA 2R072 1H4GA 2K2SA 5FY8A 1RUI2 2WZR3 4QPGB 1F4HA 3ZXGA 4ZS3A 4L11A 2E6VA 1XBFA 3ZXAC 1RYYA 4WM8B 4XABA 3I4IA 4JGYB 5FZLA 4DUWA 4LK7A 2XL9A 5CBLA 4XJ9A 5D8AA 2VE1A 3U75A 1CJPA 4BE3A 4JGZC 4J6GA 4PCRA 1HB1A 1WW6A 2WNVB 2GNMA 3ETQA 1PK6A 2VBBA 4Q0SA 4GH4A 1EV11 3BB6A 2MEV3 1R1A3 5L9BA 3RMYA 2W3JA 3WLUA 3WQ0A 5HCAA 1O4TA 1QH7A 1W9SA 5ABJB 4BQXA 4IV1B 1NZCA 3FLPA 4QX5A 1CAXA 1LOBA 1MEC1 2ZMLA 4JZRA 4BQ2A 4ITCA 1YJKA 1J1LA 3HOBA 2UURA 4YW4A 3K77A 1R092 1SFNA 1ASJ3 1GNHA 4IEOA 5FREA 3PUAA 2ZPXA 1AYN2 3KLSA 4ES9A 2WS93 4CEWC 3O1MA 2RS11 1VBC2 4XTPA 4JCKA 5FQ0B 1W8TA 4K9SA 3FE5A 5FV3A 3VDBA 4W6YA 1WCSA 3VBFA 5IVJA 1JZ8A 1CIWA 1FNYA 4LO4B 4NROA 1IQAA 1Q5OA 4C1WA 5FBJA 3RMXA 4CVUA 3VBUC 5JMOA 3HQXA 2ADEA 3TEXA 4FP3A 2AACA 5FWJA 5FCCA 5KHIA 1J3QA 3A0NA 3H3UA 1VB2A 1VBD1 2B9VA 5FJHA 5FPZA 4OI2A 3SQOA 4AI1A 3BUCA 3FMGA 2D43A 2RM23 1RUC2 4IESA 3ZN4A 3MBWA 3IIAA 2V4VA 3E6DA 3SCGA 3LFIA 1JYIA 1BEV3 2A7AA 3BTZA 2QZ2A 3LEMA 4GB33 2BZDA 2JDHA 5GALA 1S0FA 4KG8A 4N9IA 2B42B 2VVDA 1BMV2 3FL7A 2I74A 1FMD2 3MLLA 1TNFA 3CJIA 2CYFA 1FI2A 5C8CA 2YPJA 3OYWA 5CFDA 4LHSA 4AHWA 3PHMA 3THCA 2PHDA 1UCXA 4GQ7A 1RTVA 1FV3A 2MHFA 1W9YA 2O0OA 4N43C 3THTA 3ZN6B 2UWBA 4COUA 3LF7A 1F5JA 5KC6A 5A3MA 4HOOA 1SCSA 2WZEA 1Q43A 2PQQA 5DN2A 2DCTA 4Q26A 5A3PA 1OLRA 4Y1UA 5SV8A 1NCQB 2ZHLA 4CDWA 1PM4A 2D6KA 2GNTA 1S0CA 3WUDA 4DEVA 1VBE2 1X82A 1FATA 1SLAA 1NA1A 3J7LA 4NHMA 1HQNA 1W9FA 3K3NA 1RUF2 3KV9A 4XDOA 2ZGPA 1VBB1 4IV3B 4AGRA 3D0SA 4LIUA 1G86A 3UGHA 4ASMB 2BV4A 4LORA 3NO8A 4CYDA 3H8OA 2R30A 1H6XA 4PHZA 1DLCA 3WF4A 2AR6A 4Q8KA 2HWD1 4I2OA 4ATEA 3Q8AA 5JI9A 4UI9L 3ZSMA 1G9AA 2WNUB 3AYDA 5LBBA 1ENSA 5BNNC 5KXEA 5CB7A 4WVMA 4B29A 1C3HA 2P6HA 4YGBA 1UD1A 2H6BA 3O1UA 1UMIA 5FO8B 3OPZA 4BQ5A 1GP5A 1HXS1 3M1HA 5GM0A 4QDQA 5EZWA 2ZEZA 5FDBA 3SH3A 2OQ7A 4D0QA 5FP3A 2WNOA 1K42A 3NV2A 3PMEA 4HSJA 4NIAA 4XAEA 4ASLA 1C1LA 2IWGB 3OGGA 3R05A 3OB8A 2VUCA 4Y4YA 2ZGSA 2W68A 3M70A 4YVWA 2RS51 5IUQA 2OUHA 3AP9A 4Q0VA 4FPGA 3WG3A 3ZFGB 2HWC3 4N7IA 4AF9A 4COWA 2JXAA 3UYJA 1QF3A 1SMVA 4YM3A 2W91A 1JH5A 2OX0A 4FXKB 4FOQA 3DXUA 1AR63 3POJA 4HN0A 1UWWA 4QB6A 1H6YA 3I2OA 4P08A 1AR73 2Y33A 1CPMA 1NOVA 3IDBB 4QQOA 2WN3A 4R4XA 4QHZA 2IXJA 3VBSC 4AEMA 4AW7A 4OHYA 2WA3A 3AMPA 1WLWA 3SEEA 4XDPA 3TNQA 1RL3A 1PIV1 3VL9A 3FLTA 1YYNA 5F6KA 3LDRA 2W39A 1NQJA 1I6XA 1LOFA 4GALA 4IUGA 2FDIA 1VLNA 2H0VA 2VQAA 3AZYA 4FXGB 3RNSA 5K0UC 1UW8A 1R64A 4WM7C 5FMOS 5JMCA 4XJAA 1DQ4A 2QFEA 4DNYA 4RSUA 4JKMA 4DS0A 3ZYIB 3TBDA 3MPBA 1VBA1 2J1AA 2PLV2 1LB2A 2JIJA 2JDZA 5FZ3A 4AI8A 1UYPA 3P1IA 5C4WA 5FXVA 3JD73 2VG9A 5E89A 2OZ6A 2JB4A 2ZGQA 1KITA 4QPGA 4CEWB 2XLGA 3JB8A 1W6OB 1CAWA 4CTEA 3FBMA 3LA3A 4QDSA 5A7OA 4NVPA 4KMQA 5C6CA 5KHGA 2Y6GA 1YFWA 2Q8EA 1JYNA 1QXPA 3VBUB 4HPKB 3PU3A 5C9AA 3ON7A 1XB9A 5FXXA 1YI7A 1DQ5A 2X5IA 3RYRA 1NX9A 2CWMA 4LULA 3N9QA 4ISQA 3ZN5A 3I59B 4XXAA 4IV1A 2ZAAA 4LO6B 1OSGA 2OPKA 1ZREA 2VD7A 4HK8A 1HJFA 2YBPA 4V2VA 5FZFA 4D6SA 3POSA 3DL3A 2GU9A 5FYVA 1XU2A 5LBCA 2ZHNA 5F5CA 2ZJCA 4OUMA 1AJOA 3KM5A 3BKZA 1QOSA 3KGZA 2BRTA 5FPVA 1A8MA 3PJQA 1VRH1 4RQPC 1KRIA 2GAUA 5ACA2 4BHPA 5LASA 1JZ3A 1PZ8A 4Y1ZA 3U07A 1UOBA 2WNEA 3I2DA 1ULPA 4FO9A 4CDUB 4ZY9A 1VR3A 1OA3A 4XCBA 2D3SA 5FY9A 1KD7A 2HEVF 4N43B 4FTSA 1LHUA 1W8HA 4INDA 4META 2XG3A 2WL1A 3WNMA 4Q4X3 2BGOA 2ZBJA 5AC92 5A1FA 1ULDA 4LHNA 5G04L 3MZHA 2RS32 3LAGA 4XUTA 4AEDC 2YPDA 2VQ0A 5JI7A 2BNOA 4HSLA 3WQ7A 1W2NA 1CONA 4FPLA 4I3PA 1U5ZA 3VKLA 4MXVA 3J4UH 3ZR6A 1ZA4A 1AL21 1GOFA 2BNNA 4B1LA 3CDZB 4I09A 2FZ2A 1AX0A 1GZCA 3HT2A 2ZGRA 3H8XA 1EAH1 1YC61 3AP4A 2C24A 5I0RA 4B8EA 1P8JA 3KHCA 4NN0A 5FFOC 3U78A 4D7SA 5BNNB 2E7AA 2RE9A 3ZN6A 4H14A 4M01A 3HNYM 3BPZA 3QCWA 3ES4A 1RXGA 1AYM3 4LO5B 5DDJ3 5FZMA 2ZA9A 1ZRCA 3WF3A 3CQOA 1QDCA 1E5IA 1RUJ2 1SCRA 1L7LA 3AL5A 2R1BA 3N7LA 1TME3 1K3IA 1NCQA 1RC6A 3X29B 5ACA3 3B02A 3VV1A 4DXSA 2DTYA 2ZX0A 4QX7A 2KR2A 5A1AA 2ZX4A 2HWE2 4Q4V3 4ZU7A 1O5UA 1I5PA 1N1VA 1RMU2 3C7OA 3AP6A 4QQ2A 1Y3TA 2ET1A 1REEA 1JZ7A 1LECA 1WA6X 3E97A 1N1TA 2JX9A 2X09A 4D6RA 5FK7A 2HYXA 2HEYF 1PNGA 1ULGA 3J8F1 4E2QA 4ZXEA 4LE3A 1UY0A 5FYBA 3U4SA 2R0FA 3VBSB 2WNUA 3HQUA 2E31A 3G7DA 5FYMA 4W50A 1KXGA 3KVAA 1WLCA 2V72A 3TN91 3VBRA 1RUH2 1D2QA 1VE0A 1ZNPA 1LENA 1R1ZA 2ET7A 4XFFA 3CMGA 4L0PA 1UIKA 1AXKA 3J7NA 1GZ9A 4UFIA 5K0UB 1PO21 4YGEA 4BQ3A 4WM7B 3B94A 3TEWA 3LE0A 4LR4A 1T6GC 2C4XA 3WF0A 5F9TA 4BXSV 4EROA 1X50A 3ZFEC 3U11A 5IHRA 2VUDA 2G19A 3LQCA 4LUMA 3VUOA 1MEC3 1POV0 4IEVA 4V2WA 4YZ1A 2JE7A 4Q4W2 3MICA 3ZYGA 3OUHA 4Q2FA 4Z82A 4BMEA 1S0EA 1HQLA 1DGLA 1RUJ3 3IDCB 3T1MA 2D6OX 2DWRA 2DCYA 3MIFA 3OOXA 4XJZA 1X8MA 4FI9A 1NZIA 1FV2A 2R061 2RS13 1DQ0A 1OLQA 5FYHA 1GOHA 2W52A 1BVVA 3NJVA 2BBAA 4NHXA 1Q8QA 4JV4A 5KWRA 1ZBE2 1SBDA 2P4EA 2ZAHA 2ZMNA 3MIDA 1RJ7A 1JU4A 3FHIB 5BXXA 4XF3A 3IMNA 1RITA 4GZ9A 1XQNA 4AI0A 3GHNA 4YG3A 2J7MA 1REDA 1X7NA 2R32A 1RUG1 1XNCA 4LPLA 1VBD3 4KI5M 1SLCA 3ALQA 3NKTA 1O4ZA 2XMLA 4BK5A 3LDKA 5CAZA 2J1RA 1GQGA 3N7KA 5JSRA 4UBGA 1XE8A 4CEWA 3VD9A 4PDWC 5D21A 3EXUA 3JQWA 1W9WA 4KG0A 4RQPB 5C3OA 1QJY1 1D4M2 3K4DA 5IVCA 1CGPA 3O12A 3AKRA 1XSRA 4NWVA 5A7NA 2ARXA 1UZVA 3POIA 2B7YA 4NAMA 2XUEA 2CHHA 4FPOB 4HPKA 4LO7A 5IVYA 3RJ2X 2JDKA 2DFCA 2JE9A 2WLQA 5A70A 5C7GA 2PHXA 4HK9A 5EFUA 5EJ3A 3HNBM 3DUIA 4PIZA 1UU4A 4JQTA 1JYXA 3H3ZA 3I59A 4PQQA 3DKWA 3LPFA 3P6BA 1PMHX 1LULA 4AEDB 1CZSA 1L7QA 2ZTNA 2VM9A 5FLJA 3ZX7A 2ZX2A 2OVUA 2PTMA 4C90A 3RSJA 2JG9C 2BPA2 2W1QA 3VBHA 4LJHA 1RHI1 3IKWA 2F6BA 4QX2A 4RS5C 1PVC2 2BOJA 4CP9B 1RGSA 2RDQA 3AZZA 4CU9A 4XW3A 1UY2A 2A3XA 2H0BA 5JXHA 3D0JA 2JIGA 1VBB3 1W0OA 3L9JT 4CDUA 3PVOA 4ZS2A 4YPJA 3IZOA 1N47A 1JYWA 2C26A 4UYBA 1Q8VA 4CP1A 1JOBA 3LFMA 4AOCA 3TWIA 2HWD3 1OUXA 2VTFA 2VO5A 3ZXKA 2XBO1 2WFF2 4PJYA 4MO3M 4BPZA 1RUOA 1CESA 3RS6A 2A71A 4A2UA 1QNWA 2VMDA 2PAEA 1HRV2 3EB7A 3ZYHA 4LBQB 5K9YA 3BTAA 4OFGA 1WBFA 5FZBA 1ULEA 1MR5A 1HXS3 2W1WA 4AHXA 4NIGA 1QU0A 5EJZB 4FOVA 4Y20B 3O0VA 2Y6HA 2HJIA 2ZEXA 1CX1A 3KMHA 4CCKA 1UZYA 2DVDA 4K20A 2DTWA 5FP9A 3NNLA 3ZLIA 3JBG1 3EHKA 4IW3A 3RGBA 3PL0A 2E51A 2P17A 1YFXA 1GSLA 2BTVC 2Y6JA 4J25A 1DYPA 1F4AA 3J26N 5CFCA 1BLZA 1UZZA 5C3QA 4HETA 1TEIA 4Q0QA 2WO2A 1XNAA 3RWNA 2SLIA 3C7HA 5DUVA 3PURA 5BNNA 2GZWA 3OCPA 3MF9A 3RDIA 2IFWA 2KXLA 1OPOA 3ZMNA 2R16A 1VALA 3VB9A 3ZXJA 1OUSA 2QQJA 1OT5A 3T0AA 1H1AA 3W5MA 4Y5TA 4B7KA 4KGGA 2EF6A 4WZCA 2ZHMA 1LHNA 3NAPC 2VU9A 4RHV2 4W8JA 3VDCA 3C7FA 4XTMA 1MS0A 2XL7A 5DUXA 4GWMA 2WT1A 1O8PA 3P5BA 5E1RA 3NJYA 3AFGA 1ZZ6A 4AWDA 4V1PA 1COV2 5FZCA 5FY0A 2Y6LA 1GMMA 3ZFEB 1MS9A 3RZHA 1KQRA 3CO2A 3ZPYA 2WT2A 5FKCA 2UWCA 4C0BA 2TNFA 1QNYA 4JDNA 2ZGTA 2VOTA 4P14A 4EQVA 2WJSA 1UYZA 2BEOA 4P5YA 1HRV3 2VQUA 3LEGA 4O61A 4HZFA 2DCKA 1ND2B 3WNKA 1CAVB 3NV4A 3WP5A 1ZBA2 3WXPA 2C1FA 5A7SA 1SQ4A 4XQDA 2P5BA 1AR92 4Q4Y2 1MS4A 3FUQA 5EHDA 5FUIA 3BALA 1UU6A 5A80A 2W46A 3V0AB 4GMP0 4TLGA 3WOGA 1OQEA 4L99A 3JZVA 1O3TA 3ZKUA 4M0NA 5EWSA 5FTTC 5GLTA 1VAVA 2D44A 1DHKB 1BCXA 3KCXA 3KV6A 1XNDA 2B9UA 4MV2A 4PDWB 3B01A 1RUNA 3LA2A 2O8QA 3GCXA 4LA2A 4AEKA 4XIKA 5LA1A 5F37A 3K4AA 3TEYA 3HBZA 1GZWB 1W6MB 2F17A 3VHPA 2VUAA 3IPVB 1GP4A 2B45X 2QTWB 4MG2A 1Q3EA 3OD4A 3OG2A 5CKMA 1PZ7A 3WY6A 5C8WA 1IKPA 5FK8A 3MV11 1JOPA 3MUZ1 3W58A 3N7MA 4FQ4A 1UIJA 3RYPA 3ZFFC 3NNMA 5AFBA 2VL4A 5T3NA 1DQ2A 1EYBA 2A70A 2BDRA 3T2PA 1NCRA 4G3YC 5HPOA 2FD8A 1KDMA 1PZ9A 2JDNA 4IEZA 2AYHA 1BK0A 3ETPA 5FYTA 1UY4A 2NN8A 3VZJA 3TYJA 3T09A 2JG9B 4OI4A 4DO0A 1HRI1 4M3CA 5LRSA 3ME2A 4RS5B 1G9CA 2Z42A 3PUSA 4OHXA 1CAUB 1W04A 3DYMA 1HIXA 5EXOA 1UY1A 2X05A 2ZKLA 4XUPA 2HLEA 1AR93 4CXYA 3LB9A 1QY4A 2OS2A 4FPFA 1AL23 2WINB 1OD5A 3GALA 1O7FA 5C3PA 4EWAA 2DUOA 2OQ6A 4MSVA 4D94A 3HR9A 2Q4SA 4LBOA 4OCTA 4Y22B 1EAH3 1RXFA 2CSGA 2PFWA 3WW2A 2QE3A 3HMYA 2XWJB 3OJBA 5E8AA 2JD9A 4CDQC 1V6JA 4A41A 1HLCA 4M3CF 5JVVA 2WZR2 2V4AA 4OZOA 1QQP1 2IVIB 1B35A 3KD4A 3N9MA 3M3CA 3N9OA 3RG0A 1REFA 1UMZA 2ZMKA 1WMDA 2CU5A 4MGIE 3L2HA 2ZACA 2ZGMA 3THPA 3VDDC 2WA4A 2HBTA 3M7AA 4E4DX 3POFA 1QJFA 4UXAA 2Q1ZB 4DB5A 3PIJA 4AGGA 3LSEA 4H7MA 1UOJA 1CZTA 4IGQA 3AJZA 3C3VA 1ULFA 1OFSA 2YG0A 4P9GA 4A4AA 5FZ0A 4AG4A 5JCTA 1H9WA 2E33A 3J9SA 5LY1A 2CV6A 1R1A2 2AREA 2BFUL 4LUKA 4BQ4A 1QWRA 4EJRA 4YFWA 5DG2A 1NY71 3ORJA 4HKLA 5I8SA 5J36A 2P3JA 4YW2A 1AX1A 1ASJ2 3R4DB 4FOWA 4QX1A 5FZIA 3NAPB 4LBQA 1VIWB 3TN93 1TQ5A 1F15A 2JENA 3AP5A 4I30A 4C8DA 2ZEYA 2D6LX 4MX3A 1W6NA 1ULOA 1UYYA 4LKSA 4TN7A 1PO23 3FHQA 2WO1A 1IPJA 4Y26A 2ZXQA 1KEXA 5A32A 2PELA 1U0AA 2Y26A 2BOIA 3BIWE 4LKDA 1HB2A 4O65A 2GP5A 2WWJA 3JB4C 4IEPA 3FFZA 1MS8A 4NUBA 4BM8A 1W8WA 2ETEA 2VZRA 2Z79A 4XYXA 2W47A 5JLVA 3OBTA 4LO8A 4QKNA 4XJUA 3OD0A 4XC9A 3WW1A 3ZSLA 2QZ3A 3A22A 3I3EA 3H50A 2VBDA 4QGLA 2RM22 4K1ZA 2TBVA 1JYVA 1ZA7A 4QQLA 2WYFA 1GICA 5JAXA 2XWBB 4EN7B 3HAGA 3MV01 5CNAA 3LKJA 1BEV2 2XPJA 4GB32 4KNCA 1X8EA 5BY5A 2JKXA 2YY1A 3QD6A 4J1WA 4XFAA 5A3WA 3DF0A 3OGVA 5A7PA 3FWEA 1GOGA 3WF1A 2K46A 4XXPA 3ZXEA 2BP6A 1YJLA 4UFMA 2Y60A 3CZJA 4XPVA 3VZMA 1PO11 5FBZA 2R7EB 3VZLA 1S0BA 2LROA 3ZFEA 5DZFA 2GC2A 4HKOA 1FYUA 2GNDA 1I9RA 1QEXA 2NZ9A 1XE7A 1RUG3 1CD3G 3HNMA 2J22A 3VBOC 3ZSJA 5BUVA 4AXOA 4CCNA 1BJQA 4Y4RA 1G9BA 1MACA 5FUNA 5FZEA 4CCLA 1U12A 4QB2A 5E88A 4PLMA 2FDJA 1ND2A 2YMZA 5FLIA 1TMF1 1W6PA 3GZEA 3M8LA 4K8FA 4Z2AA 4ZZ8A 5C33A 1CAVA 2A6WA 1ZZ9A 2BVVA 5A33A 5BNQA 3N4MA 3LDBA 2ZCWA 3B3QE 1AXZA 3M3IA 2FQPA 5CU1A 3T2TA 3TOJA 5IAXA 5LCWL 3B5LB 3I3QA 3H1WA 1YIPA 4MHRA 3ZFFB 5FPXA 2HYKA 3Q8CA 3LA7A 4GXLA 4QAWA 4NR1A 1UX6A 5DG1A 4BB3A 4CPBA 2A1XA 5IFPA 1X9PA 4FFIA 2AEYA 1K5MA 3OY8B 5M0TA 3V0AA 4DQAA 4X6RB 1X36A 1UX7A 5F2SA 4HVRA 1D2SA 4JX0A 3CJXA 2YDEA 1IHMA 1SBEA 2VMCA 5CEHA 4YZ5A 4GWJA 2VZ1A 5KXDA 3O14A 4A44A 4D69A 3VD7A 3QACA 3GZAA 1S2KA 1V9U2 3PTYA 4AVVA 5L7OC 2KD7A 4QX0A 2ZOEB 3AZVA 4HXCA 2GH2A 2VZUA 3KCYA 4KWJA 3MEPA 3MIEA 4IEQA 4LTAA 5KXCA 4Y5Z0 2QNKA 1VMHA 4LEJA 4FTBA 4NHLA 4YW1A 4SBVA 1A3KA 2EXJA 2WFPA 3ZXDA 1U5XA 2I07B 2IXIA 2PHLA 2XLFA 1JZ5A 4CDQB 2HWC2 1S0JA 4AGVA 4HFSA 3PNAA 5JUVA 2D7FA 5FY5A 1AR62 2R49A 1W03A 2L9LA 2P34A 4KWUA 1AR72 5EJ1B 2RJ2A 5GZCA 4N53C 2JG9A 3VDDB 4I0BA 5F3IA 1Z7S2 1MS1A 4P9WA 1NUKA 1OLME 1W3XA 2MPFA 5IK8A 3HIFA 1F2NA 5SV5A 1A8DA 4MH0E 2CNAA 2GALA 2LS6A 3HBKA 3OGJA 1O6UA 2QCSB 3KT4A 1N3PA 3KCCA 1O5LA 4Q27A 3JBG3 4AFDA 4AFMA 4HKWA 2RR11 3LPGA 3MGUA 1W8OA 1UXXX 1ZRDA 3QLQA 4YVSB 1W8NA 2PQSA 2B5HA 2D5FA 1O8SA 4I02A 5FZAA 1OVPA 3JD72 4C0HA 5BNPC 5C5TA 4JRLA 4BLJA 1FOD1 5B4XA 1WKYA 4AZZA 1V9U3 3DXTA 1QOTA 4RR3C 2Y6FA 5HBAA 2NPIA 3RYKA 1DGRN 2ILMA 2WYSA 4AI2A 1UKRA 1IQDC 2W1UA 3EJKA 5BNOC 3UKVA 4OQ8A 2E53A 3OGSA 1M4WA 3ZMOA 2RDNA 4F3JA 4Y3OA 1X33A 1SDWA 4CUAA 3F95A 4HN1A 3QOPA 5FMOL 1ULCA 1H8TC 2VZOA 3GBWA 1YIFA 2UYBA 3JUUA 1MS3A 2CAVA 1YXWA 4EZHA 1MZ6A 2AEZA 3GF6A 3BODA 5BV6A 1Z7S3 3PJYA 1LU2A 5LW9A 2DDUA 2WABA 2OUJA 5FZKA 4QPIC 1PGW1 1V6MA 4AHZA 4JGZB 4EV0A 4YM1A 3V65A 1LEMA 2JECA 3VLBB 4B7EA 4XF4A 2JDYA 3ZXFA 4M4PA 1OOPC 4MXWB 3WDWA 4EN9B 2AC1A 4QU2A 4CXWA 3M3QA 4K7JA 1CPNA 3WDUA 4AQSA 2JDAA 2NQYA 2P3IA 3KVBA 5K4LA 1JODA 1PVXA 1SDDB 2IXCA 5J98B 3VBOB 1RUE2 2RMU1 5JR7B 1WCDJ 2VTXA 1IG0A 3VGIA 3O1TA 4Q4X2 1JN2P 2YXSA 5GLVA 2QBXA 2D97A 4LNVA 1LGNA 2XKPA 3WD5A 2CGPA 4R9AA 4BQYA 3DPRC 3HEIA 5A6QA 4F7ZA 1RUD2 4BCUA 2A3YA 4M00A 2JICA 5HXVA 2W94A 4S2HA 4WM8A 3AX4A 1YFYA 3HD8B 1LGCA 3OSDA 1UOFA 4PIYA 4YWAA 4CUGA 2YROA 4JGYA 1A6CA 1EUUA 3K46A 3KGLA 3OBZA 2JWPA 4XFHA 3T2OA 3Q8BA 5KC5A 2C5DA 4FFGA 2WNVA 2J1UA 3AL6A 4KBZA 4COVA 2NYYA 1Y9GA 4BOWA 1FNZA 2I45A 2J1TA 5FZ7A 4NE9A 1XOYA 5GLUA 1OQDA 4M4RA 2QQMA 5ABJA 4GKXA 3LIHA 1LEDA 4I0AA 3WQBA 2FZ1A 2JB8A 3WP4A 1G6NA 3WNOA 3IT8A 1YQCA 4YGDA 1G8WA 1SACA 2FCUA 1AYM2 2Z4FA 5L7OB 5DDJ2 4ES8A 1UKGA 2WBKA 3R0RA 1HRI3 2XQRA 1H1MA 4BISA 2W95A 1C57A 4W4ZA 1TME2 1BBT1 2D98A 5FQ0A 2BVBA 3UNPA 1IS5A 1F35A 1LOGA 1ZM1A 2LALA 5FYSA 5JSPA 1PGL1 1OBNA 4KU8A 4OHWA 3OEBA 1KS4A 5KHKA 2WQ8A 1XYOA 2WN2A 1C8M1 4S2FA 4FAGA 2Q1MA 4Q4V2 1O91A 3ST7A 1RUE3 2XJQA 3O7OA 1OVSA 5DUWA 2ZKNA 5FYCA 5FYYA 1XSQA 2HWB2 2JDMA 2VOVA 1ZZBA 4N53B 3OPWA 2Y6KA 2GMPA 4JTNA 1W3VA 1WUVA 3V64A 1QQP3 1RUD3 3NJZA 4XF1A 1GWMA 1ZYBA 2GC1A 1L7RA 2J1SA 2PN5A 2D5HA 4XBNA 4GWNA 1NG0A 1Q8SA 1AR81 4DINB 2GMMA 3UGGA 5DAPA 2GNBA 1SBFA 1V6LA 3QH6A 4N90A 4BYYA 2VECA 2VW2A 4YLZA 3K48A 1RIRA 3SEPA 1R081 3V0BB 1POV1 3CHXA 1EV12 4QT6A 1W8UA 4LBKA 3T0BA 5BNPB 4YNIA 3MYXA 5LK7B 4ZHNA 3FUOA 5H9SA 5CZKA 3VD4A 4OHVA 1MEC2 3POGA 4NRQA 1LNSA 2YFUA 4QPYA 4ASKA 1Y43B 4XHXA 4RR3B 4UW6A 4LLOA 1GU3A 3UK9A 3KS7A 5I93A 1MZEA 1O4YA 2AZ5A 3I7DA 3EMRA 2RS12 3GYDA 5TSWA 4A6OA 4BJ0A 5BNOB 2PHRA 1JHJA 3ELNA 1QJX1 2C6SA 5A6ZA 4S2DA 4LBQD 3AK0A 2K9ZA 4IV3A 3ZM8A 1QJZA 1H8TB 2C9AA 1D0HA 4HANA 5J37A 2W92A 2BGPA 4QHOA 2HWB3 2VW0A 3MW3A 1GKBA 1VBD2 4YVSA 2QQPA 1DQ6A 2GC3A 1SFPA 3VDAA 5L9VA 4QPIB 2ZEWA 5HV4A 5AFEA 5C3SA 4QU1A 4BK4A 2Q0AA 1A34A 1OOPB 1ZRRA 4FBFA 1C5IA 1PMJX 1UOGA 2EIBA 4GKYA 4AFBA 1K45A 3B9CA 1LOCA 5FMDA 1WLDA 2Y38A 1EPZA 3CKHA 5DQ0A 2EAAA 4ZKTB 3GM8A 4XFBA 1EV13 3ZFGA 1MPXA 1WD3A 4ZPIA 2QQOA 3ZSKA 3T30A 4DXTA 1F31A 1BQPA 3TRSB 2CGNA 2XVGA 2IZWA 4AK3A 2VUJA 4C91A 3UESA 4AHYA 4D7YA 3E5UA 1RVF1 3DPRB 4D6QA 4E27A 5GLWA 5JZGC 5F8PA 1LU1A 5A7WB 3AKSA 1U5IA 4MUVA 5DAVA 3A0KA 1W6QB 4IETA 4JKLA 4XEZA 5A3TA 1TMF3 3BOPA 5D8AC 2UY9A 3SC7X 3O1PA 4BH9A 3B00A 4JGZA 5FY7A 2XHNA 1JZ4A 1W0PA 4CZSA 1SPPB 3RZKA 5HV0A 4LITA 1PK6C 4GH4C 4XOGA 5J48A 4E8CA 2XHKA 3FC0A 3PIGA 4A3XA 3DECA 1VBB2 3P3NA 2WKKA 1LHOA 3PUHA 3VD3A 3VZOA 5I8YA 2ZS6B 3NSTA 4XMAA 3IBMA 4KL1A 4R9DA 3VBOA 3WSOA 3HN1A 4E2SA 4B4RA 1OHFA 1W39A 4LXLA 4B1MA 2R041 2HWD2 4RGKA 2DUQA 1T6BX 4CPBD 4MGQA 2KM2A 4BMBA 4YW7A 4LT5A 2DVAA 1JXNA 5FOBB 1W6OA 2YZ4A 3NQHA 4QHBA 1ACCA 1F9KA 4BWOA 1HXS2 1AL0G 1UQXA 1HQWA 2Q5TA 3LEKA 1GWKA 1WW5A 4NRPA 1DDLA 4WBBA 2MEV1 5CKQA 5FRAA 1Q56A 1MVQA 2ARCA 1CQ9A 5DZEA 2XLAA 3QBQA 2FDKA 5DMYA 3SXWA 1FPN1 3LOBA 3W9AA 4XACA 1QJU1 3GJAA 1HW5A 3B7MA 3ZXLA 4CA9A 1UO9A 1WCKA 2HWF1 2NLRA 4XUNA 1HX6A 5EV7A 2WS91 2XQXA 4OLLA 4AVBA 3K4ZA 4NPMA 4D3WA 1VAMA 2OIIA 1IS6A 1NE6A 2RV9A 2WO3A 4QX3A 3WG1A 1GZTA 4CU6A 2Y0OA 1V70A 3GBGA 4LHLA 5L7OA 1N3OA 5APAA 1XC6A 3AB0A 4UFKA 2Z2SB 4UW4A 1WLTA 3JU9A 1J83A 1DGWA 5ERLA 4DZGA 1UXZA 5FO7B 1Y7BA 1PIV2 3H42B 3FZ3A 3CJIC 1V6KA 3C7GA 3I2GA 3KB5A 4ONUA 4QGMA 4QQHA 2PAMA 3SCHA 2OW4A 2CGOA 1LRHA 2VBPA 4HL0A 5CFDC 1B09A 5FOJB 1W06A 2R071 3MLJA 3EO6A 4JRAA 1RUI1 2C9KA 2GSYA 1C28A 3OGRA 4BQ1A 2RR13 3WCRA 1GQPA 1LESA 4R4ZA 1FX5A 3AFKA 4N43A 4DXRA 3NKGA 2QQNA 1VBA2 3BGAA 4UF0B 3CNAA 3LEIA 4XAAA 4A7KA 3N9NA 2VZVA 3B69A 3MFCA 5AVAA 1W8FA 4N53A 4PLOA 3PUIA 1Q8PA 3I54A 1FOD3 4XFIA 2YHJA 3R4SA 1JS9A 2R1DA 3AM2A 3LZZA 2DU1A 4AVAA 2VH9A 4MGKE 1NA1C 1RINA 1NAEA 2RHPA 3WDYA 3E6BA 1JTZX 4GMP1 1OMIA 3VHRA 1W90A 3WX5A 3POYA 1KFUL 4A45A 3H1YA 2RS53 4LMFA 1UZ0A 1GNZA 4KU7A 1APNA 1R091 4QQPA 3V0BA 4JKKA 1V00A 2VOWA 4L97A 5BNPA 1AYN1 1NE4A 2EVXA 4XUOA 3VL8A 1HN0A 2WR9A 3LIGA 4AFAA 1WGPA 2QUOA 2QQLA 1VBC1 4IQPA 3U1XA 4AE2A 4NJ4A 5FYUA 3BU0A 4AVCA 2XVKA 2VTXJ 3AXEA 3USUB 1DF0A 4NHKA 1UL9A 2Z5WA 5JDBA 1PIV3 3KV4A 3WNXA 1VRH2 3MW2A 2JDPA 4IE6A 1OF3A 1LODA 2AH2A 3NW4A 4LQRA 2JEMA 4YVWC 1U5YA 4N9HA 4DMIA 3SKJE 4Z07A 2IVJA 5F3CA 5FIXA 3VZKA 1RUC1 4CSWA 1WD4A 4FT8A 4MLOA 1H8TA 3KSCA 2HBUA 3KQ4B 4JC1A 1CIYA 1VBA3 4JDMA 4AYUA 4AVSA 5FP8A 4QGNA 4W6XA 3NNGA 5JZGB 1MQTC 4I01A 3A7QA 4P9IA 5FPUA 2EIGA 4Y24A 2PA7A 3VBSA 5T54A 2XUMA 5J96B 1BMV1 3UT0A 2B4KA 4L92A 1FMD1 3W59A
chains in the Genus database with same CATH topology
3N36A 1LOFC 5L19A 1PK6B 4GH4B 2BGCA 5K0UA 1WA4A 1WMFA 4WM7A 5T52A 4YYOA 1AL22 3WP6A 2ATFA 1IZ3A 2XJRA 5I0SA 1QGLA 1EAH2 2WQZC 5C4WC 1MVEA 2Z69A 4O9EA 2DV9A 4EN0A 3HWJA 3MIGA 3WW4A 1H1IA 2UYAA 5DZGA 1Q8OA 1YCIA 1VBE1 1W6QA 1RUF1 4UBHA 4NO4A 5EYXA 2VNRA 1BBT3 1VRH3 5C9AC 3V56A 3PVBB 3EQEA 3S7EA 5IK4A 1UN1A 2X5IC 2A3WA 1YUDA 4YZ4A 3RJRA 1S0GA 2XJUA 5A3LA 1C8M3 4FPCA 1WW7A 5CG8A 1PNFA 3BCWA 3J8F2 5GZGA 5CVRA 4TZDA 3OBRA 1G9FA 4FPHA 1S0DA 3S7IA 3VKNA 4RQPA 3TN92 1HDKA 4XIOA 4XQWA 5C8CB 3OYWB 2G4IA 1AR83 3L2YA 5CFDB 3FX3A 4H3WA 4EWEA 2OYZA 1DBNA 1PO22 5GJ6A 4QMAA 3EBRA 2QJVA 4YZ3A 1IGOA 2YC0A 1POV3 5CA6A 3UKTA 3NL1A 1FAYA 2BWCA 3S6PA 1LR5A 3AMMA 4UW5A 3N35A 4AEDA 4YARA 4XZPA 1N1YA 4XFGA 1O3QA 1NA1B 2PYTA 4NWWA 4E4ZA 2R062 2DCZA 4NPRA 4RFT0 2D3PA 4Z8BA 4PBPA 3T1LA 2PLV1 1JHNA 1AHSA 1QJX3 4A7YA 4XJWA 2V5YA 1QH6A 3K51A 2EA7A 1QXJA 2WWSA 2QKDA 3J8F3 1RUG2 3APBA 4FTEA 1AJKA 3MIBA 1DGWX 4EWDA 1JW6A 4PQ9A 2D6MA 4FAHA 1I3HA 1QXRA 4JQRA 2DF7A 3BOWA 2IXKA 3WDVA 4H55A 3WDTA 1QJY2 4Y20A 4YVWB 1EY2A 5E16A 3MFAA 4RD7A 4Y1VA 5J7MA 4YFZA 4YZ2A 1XRUA 1S1AA 2ERFA 4ZU5A 4JVAA 3BU7A 2AENA 2FMDA 1MQTB 4FPJA 3MDPA 2WNUC 3H7JA 1AVBA 2CY6A 5T50A 1ZZ8A 1AXYA 4K6BA 4GULA 4N7UA 1RVF3 1WW4A 4OUSA 3VBRC 1KJRA 5ACA1 1PMIA 2IXHA 4DRRA 5T5LA 1AZDA 3Q9OA 2R063 1XXNA 4WZFA 4OI1A 1J58A 1RHI2 3VKOA 1GYKA 3O5SA 1NXD1 2AUYA 1H2KA 2E7QA 2SBAA 4I0WB 3UJOA 5AC91 5C4WB 2EAKA 2RS31 4DXZA 4YSFA 1BXHA 1PM7A 5EYYA 4B4QA 3AZWA 3IM0A 5AVPA 1CAWB 2D3RA 2WLPA 2VXRA 5JZGA 2R043 4R9CA 1YI9A 2XBO2 3AP7A 3C2UA 1QKQA 1QDOA 2PHFA 3SCFA 2ENRA 1DGRA 5C9AB 1QJY3 3WVJA 2ARBA 2X5IB 5J3UA 4YW5A 5F5QA 1NXMA 5JPMB 3UJQA 4ATFA 3JBG2 2XJVA 1YRZA 2N7GA 2O8OA 2X53S 1FPN3 5I91A 1H2MA 5I0UA 1L3JA 1QJU3 4GA9A 4RA0A 1RUJ1 2RJLA 4L9BA 2HWF3 2R6QA 4LBLA 4QD2A 3PVEA 4PDWA 3AKPA 4COZA 1AX2A 1JUIA 1GZWA 1W6MA 1RHI3 2HWE1 2X29A 3IPVA 2D93A 3OTFA 3S0MA 1RMU1 2DVBA 1UU5A 3AXDA 2PAKA 2R073 1IKQA 1NLRA 1QOOA 4IL7A 3CLPA 1RUI3 3D8CA 4KGQA 5IT6A 5HI0A 4YGCA 3WHTA 3AYCA 1LTEA 3GZTB 5T55A 1RUH1 5CADA 1OKQA 4TYSA 2XBO3 4R52A 1LCLA 2GN7A 1Z0HA 3PLQA 1DIWA 3RRDA 2VMIA 3INAA 3GBFA 3VBHC 4LA3A 4RS5A 5GZEA 3CL1A 4XFCA 1CAUA 1PGSA 4MYEA 1XU1A 1Z78A 2TEPA 3N3HA 5L36A 4GMP3 4CDUC 3B93A 4Q4W1 4Y22A 4RL7A 1R093 1AUYA 1ZX5A 1AYN3 1HV1A 3IN9A 4LLFA 1VBC3 4YG0A 1NYWA 4XHBA 4F83A 1MS5A 1SFYA 1ZBE1 2V73A 1KS5A 4XILA 3AYAA 5F1RA 2X8KA 1LKNA 2ZX3A 2AGSA 1V6NA 2DCJA 1S55A 3TB0A 3RPQA 3WR0A 4MGYE 3ZO0B 2ZX1A 5CFCC 3VN4A 3NVCA 4CEYC 1OQ1A 4AEJA 4X8NA 1UPIA 1RUC3 2XB6C 1OPMA 1YNAA 4LE4A 1OI6A 1JBCA 2ZZQA 4Q0PA 3VBRB 5KBFA 4YG6A 5B2GB 1D4M1 3QH7A 2WC2A 3ZVXA 3OF1A 4TWTA 4P9XA 1FMD3 2E7TA 3NAPA 4B4PA 1HRI2 4K1YA 4HT1T 2QDNA 4AVTA 3ASIA 3SNMA 2VVEA 4K21A 1F8VA 2HEWF 4LHKA 1S0IA 1ZVFA 3H7YA 5HCBA 2VULA 1I5ZA 1MQTA 2MNGA 2P2KA 3WHUA 5FLHA 3R6SA 4K40A 1PVC1 2I2SA 1QQP2 1VBE3 4HVOA 3RZZA 2XJTA 3WV6A 3TNPB 1RUF3 3KZ4C 1SLTA 1LOAA 2XJSA 1IOAA 5HCFA 2IFRA 2EALA 4BZ4A 3ACLA 4WVZA 2VGDA 5H9PA 2WFF1 5GKAC 4OZXA 2WT0A 3RI8A 3POWA 1XYNA 1HRV1 3JCIA 3LCPA 1MZFA 2JG8C 2WIIB 4XDQA 1NY72 3D5OA 2H6CA 5L73A 5JIUA 3PVNA 2CL2A 3MPPG 1WBLA 3VHOA 1SLIA 5GZDA 2D6NA 2Q30A 1ND3C 1ZZCA 1BVP1 4E9KA 2GH8A 3ZFFA 2VW1A 3MI8A 4M3CE 3DN7A 4XETA 1NCRC 1E57A 4Z1VA 5H9RA 1EPWA 3OY8A 3ZDSA 5JOZA 4G4FA 2BYVE 2XH6A 1C8NA 2DVFA 3IWZA 3VBHB 4RHV1 2BNMA 2ZGOA 3H1MA 4FCAA 4KQ7A 1NLSA 4UW3A 4URTA 1BZWA 1COV1 1LHVA 4KH9A 1O3SA 4NOTA 2FMYA 2JKBA 2ZGNA 2PHTA 1TNRA 5JPNB 4IERA 2PLV3 4X6QB 2BWAA 4GIQA 1PO12 1URXA 5LRRA 2GDFA 4CDQA 4DRVA 3M4FA 2DYCA 2NM1A 4WV8A 4P9YA 2TUNA 2CTVA 4XF9A 4RGAA 1B35C 2HKXA 1TE1B 2C0ZA 4FVVA 1ZBA1 3UV9A 4AQTA 3AYEA 1AR91 2PHWA 4Q4Y1 5DXDA 3VDDA 3SMHA 1EP0A 4B3NA 3CF6E 1TMF2 1J1TA 1JOJA 2DU0A 2A75A 4BIFA 4FPKA 3FFQA 2OA2A 5CFCB 1UPSA 1J59A 1ENQA 3PMSA 4CEYB 4P9JA 4Q29A 3CU7A 4DFSA 3H0OA 2WQ4A 3M3OA 1H4HA 2QDRA 3AKTA 4DY5A 4FSJA 1H2NA 3N7JA 3WT3A 1N3QA 2VMHA 3O0WA 2EXIA 3SH4A 3URFA 4KWKA 2VNOA 4LBMA 2E9QA 4BA6A 2YV8A 4OULA 2WZPP 3VKFC 4COYA 4HLTA 2O1QA 2W0XA 3LWCA 2UY8A 2B8MA 1DZQA 5T5JA 4CDXC 4FP2A 1FXZA 1PO13 3AZXA 5AC93 1J3RA 3WINE 1O3RA 1H0BA 1QMJA 2RS33 5K8SA 3M3EA 3TAYA 1V6OA 2VOKA 2XVLA 4FPYA 1DU3D 1C4RA 1RJ8A 1J3PA 1SLBA 4LBNA 4CP0A 5KHJA 2G9GA 2QVSB 3ZYRA 2ZGLA 5JWPA 2GC0A 1CN1A 1HV0A 4MGZE 4WVVA 3H8UA 2DFBA 1GBGA 1H8VA 3NV1A 4MXWA 2NP0A 2WZR1 3GHMA 1GANA 2RR12 2JG8B 2JJ6A 4MZUA 1ENRA 2ZHKA 2KA3A 3IDEA 1ND2C 4Q8LA 1KFXL 2GMEA 4H7LA 3FJSA 1CR7A 1FOD2 1XNBA 1HKDA 2XJPA 3NWKA 1ND3B 3VBFC 2FBEA 2HWE3 1AF9A 1ZRFA 4YRDA 1R1A1 1RMU3 4XQ4A 3U10A 4Z2WA 4ZXKA 4R9BA 1NCRB 2NMNA 3ES1A 4AQ2A 1K5MC 2CWSA 1KDKA 3D6EA 3WG2A 1G9DA 4JTOA 2PHUA 1V6IA 2RS52 1W2UA 2YGMA 4P5HA 1ASJ1 1CVNA 4XMIA 1MZ5A 1FT9A 5CG9A 1C1FA 2D40A 4M3CB 1RUH3 3D4KA 5BPXA 2A5ZA 2BQPA 1M06G 2A6XA 4L8QA 1GV9A 3WW3A 1OA2A 1GQHA 1DQ1A 1VB4A 2ZGUA 4R8HA 3SITA 2EXKA 4YM2A 1PGW2 4S2GA 4ZU4A 1CX4A 5FAXA 1BKZA 1DZTA 3LSDA 1H9PA 4EN8B 3SH5A 2JD4A 4XF0A 2RM21 4Q4W3 3AMQA 2ES3A 4RGGA 1JUHA 1B35B 2RMU2 4PLNA 1VAKA 3MF6A 3KT1A 1LOEA 5LEJA 1BEV1 2YUEA 3ILNA 4GB31 1VP6A 3SHRA 5I0TA 4J1XA 4CDWC 1PHMA 2ZZJA 2VVFA 1S2BA 2A6ZA 1OA4A 4KWLA 1ZBE3 2DURA 3USSA 2A6YA 5H9QA 4XJ8A 3I8TA 4JDOA 5GZFA 4DPNA 3AMNA 3ZYPA 2WSUA 1A78A 4OVEA 1ENXA 5T5PA 2F4PA 3WQ1A 4W65A 4JAAA 1GR3A 3LOIA 1GLHA 1D4M3 2A6VA 4RR3A 1W6NB 2W08A 2R0HA 2YGLA 5A32B 4Q1PA 1ALYA 4Y1XA 4AI3A 5BNOA 5KHHA 1BBT2 3WZ1A 2G9FA 2IC1A 4CDXB 2BBVA 2DUPA 4CEYA 1PGL2 1JYCA 4QXKA 2LTNA 4MVTA 2XKOA 1C8M2 1OFNA 4F8AA 4HVQA 2RMU3 1F5FA 3E6CC 5GLZA 5LK5A 1V9U1 3DV8A 4BIOA 2VMGA 4ISRA 4D7TA 4U36A 4XBQA 4XE9A 5JOXA 1G7YA 5FO9B 3JQXA 4QM9A 4QPIA 1PVC3 4TLFA 2BUKA 4HMZA 4WVWA 4C1XA 3E5XA 1OOPA 5LEKA 1AR82 2K0GA 2HWC1 3H9AA 4PBOA 1UF2C 4DOUA 3M2MA 5I8TA 1D0GA 1CAXB 1WMEA 1YFUA 5JOWA 1AR61 4QM8A 2B46X 5K7PA 1R082 2WFF3 2NMOA 3A4UA 1AR71 3G6JB 5CIRA 3SISA 2A73B 4E2GA 2BW8A 1Z7S1 1GFF2 4QPGC 1YLLA 1W6PB 3UKNA 1XYPA 3DPRA 4DB5A 4FQZA 4KBBA 1YHFA 3HT1A 3ZYJB 5A33B 1KJLA 5IK7A 3VBFB 2FHRA 4G9SB 4WM8C 2OZJA 1C5HA 4JGYC 5DUUA 1SEFA 5JOYA 1K5MB 2VNGA 2WNVC 3SLIA 3GNEA 2B39A 1QJX2 3AJYA 4IEXA 1H30A 3JD71 4CP2A 3UL2A 5ABJC 5JSOA 3RQ0A 3FBYA 1IPKA 4IV1C 2RJKA 4Z92B 2LM3A 4Y1YA 2JG8A 3RI9A 4HBNA 1DG6A 2P37A 4IEUA 2E63A 4I3GA 4M0HA 4YM0A 4OHZA 2DVGA 1LJ7A 4RHV3 2D6PA 1I1EA 4CRQA 4PF5A 5BYNA 3CJIB 1ND3A 4A7ZA 1COV3 1IS4A 1BYHA 4Q1RA 3U4XA 4PIXA 1DFQA 4AQ6A 1R083 5T5OA 1SLLA 3MW4A 3WG4A 4FPEA 3GZUC 4XBLA 3R4UA 1YO8A 3CEWA 2Q8OA 2IXLA 4IXLA 2LUWA 3LGRA 4CDWB 3KT7A 4BLIA 1RVF2 1ZBA3 2CAUA 1LHWA 3S30A 2UU8A 4Q4Y3 2VY0A 4K3UA 3NV3A 5J09A 1VJ2A 3ILFA 4E4SA 1NQDA 3U0ZA 3VKMA 1DLLA 3ATGA 4YW3A 1RUE1 1BK1A 4Q4X1 2VPVA 4EN6B 5IK5A 3ILRA 4Q0UA 3ENRA 1IS3A 5F6LB 2ZABA 4WVMB 4IEWA 1DZRA 1RUD1 2VOXA 4L2NA 1QHDA 3WDXA 3O0XA 1Y9QA 2R042 3WCSA 1XNKA 2YYOA 1LGBA 3ZIXA 3MIHA 3P3PA 1NCQC 1DYKA 4U2AA 2V09A 4W6WA 3D82A 4P9LA 3ROUA 3AMHA 4IEYA 1CJDA 1N1SA 1D4VB 4IV3C 2Y0IA 2MEV2 3VZNA 2XGXA 4SLIA 2P3KA 3FLRA 3WP3A 4O9GA 1FPN2 1AYM1 4YVSC 2UWAA 1QJU2 5DDJ1 1YWKA 2HWF2 5D1IA 1TME1 4OI0A 2WS92 4DY3A 2WSVA 3KQRA 3VHNA 4X8PA 5KXBA 5JIAA 4FOYA 3E5QA 3USUA 2GN3A 1ZZ7A 3ZIWA 3WUCA 1RB8G 4TSVA 1ONAA 4Q4V1 3ECQA 3MLKA 1H2LA 3ZSEA 4ORFA 2BFUS 2ZGKA 3AKQA 3B9IA 4CDXA 4AFCA 1UAIA 2EXHA 2HWB1 4LBJA 3ZFGC 3DGTA 2R072 1H4GA 2K2SA 1RUI2 2WZR3 4QPGB 3ZXGA 4L11A 2E6VA 3ZXAC 4WM8B 3I4IA 4JGYB 2XL9A 5CBLA 4XJ9A 5D8AA 1CJPA 4BE3A 4JGZC 4J6GA 4PCRA 1WW6A 2WNVB 2GNMA 3ETQA 1PK6A 4Q0SA 4GH4A 1EV11 3BB6A 2MEV3 1R1A3 3RMYA 3WLUA 5HCAA 3WQ0A 1O4TA 1QH7A 5ABJB 4IV1B 1NZCA 3FLPA 4QX5A 1CAXA 1LOBA 1MEC1 2ZMLA 4ITCA 1YJKA 1J1LA 4YW4A 2UURA 1R092 1SFNA 1ASJ3 1GNHA 4IEOA 5FREA 2ZPXA 1AYN2 3KLSA 4ES9A 2WS93 4CEWC 2RS11 1VBC2 4XTPA 4JCKA 5FQ0B 4K9SA 3FE5A 4W6YA 1WCSA 3VBFA 1CIWA 1FNYA 4LO4B 4C1WA 1IQAA 1Q5OA 3RMXA 3VBUC 3HQXA 4FP3A 5FCCA 5KHIA 1J3QA 3A0NA 3H3UA 1VB2A 1VBD1