5L73A

Mam domain of human neuropilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
QDEFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Neuropilin-1 MAM Domain: Completing the Neuropilin-1 Ectodomain Picture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-1
total genus 34
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l73A00
1S0JA 2P3IA 2JD4A 2ZGNA 4BPZA 3WDUA 4WVVA 2DU1A 4JCKA 4F83A 1MS0A 2FHRA 1LCLA 2OVUA 1MZ5A 5DUVA 3WUCA 1LHOA 2R49A 3BODA 4PF5A 3T1MA 1SLAA 5GALA 3WHUA 4Y24A 5GJ6A 2ZA9A 1LULA 3L2YA 2WT2A 3UK9A 1JYCA 5GLZA 3WOGA 3AZZA 4PBOA 1RIRA 1LHUA 2DTWA 1PZ8A 1RITA 4K21A 4YG3A 4M3CA 1QKQA 1MS8A 2ZAAA 1LTEA 3WCRA 4Q2FA 3SLIA 1AF9A 1DFQA 2ZGRA 3R05A 4JRAA 1MS4A 5HCFA 1WW4A 1MZ6A 1HKDA 1JHNA 5GLWA 2EXKA 2ZHKA 3AXDA 2PHUA 3ZXJA 1OKQA 3R4UA 1H30A 2YZ4A 2E7TA 4LBMA 4ATFA 2XG3A 4M3CB 2GNBA 1F5FA 2DYCA 2NYYA 2W52A 1QNYA 4BLIA 4OZXA 1GICA 1ULFA 2DUQA 2VW2A 2ZGOA 3LSDA 1ULEA 1VAVA 2D43A 4XMAA 3W58A 1DIWA 4Y22A 1WD3A 4FPCA 1SBDA 1FAYA 4CZSA 5DXDA 3VKOA 1G9DA 2GMEA 1W6QB 4XZPA 5T50A 4FPYA 3WVJA 3ZVXA 1JN2P 1N47A 1LJ7A 3M1HA 4BMEA 1LGNA 1AXZA 5EYXA 4XIKA 4XTPA 1TEIA 4BQ1A 1WW7A 4GA9A 4YG6A 5JVVA 5DUWA 3IPVB 4FPOB 4UW4A 1QU0A 2W08A 2JE9A 1SBFA 1W6MA 3RMXA 3IKWA 4HANA 5CBLA 1ZA4A 2YV8A 3PVOA 1QF3A 4M00A 4BM8A 1X50A 3SH3A 1DZQA 4FPEA 1OQ1A 3AZXA 4FOWA 2ZGQA 1AX2A 1C1FA 4XDQA 3VV1A 1LOGA 1UX6A 5H9RA 1LODA 4YGEA 5T55A 5T5LA 1ENQA 1AXYA 1MS5A 4Q27A 4XXAA 2DUOA 1DQ0A 2VH9A 1LEMA 2ZGMA 3ZYPA 4Q8LA 4BMBA 2GNTA 3WDTA 2PHWA 5JLVA 4AGVA 5T5JA 3BTAA 4H55A 1GANA 3R4SA 1BXHA 1QOOA 2DWRA 1APNA 2W39A 1VIWB 1DQ1A 2YY1A 3AZVA 3FBYA 4FP3A 4FOYA 4YGDA 5T52A 3WLUA 5JOZA 2WSUA 2V5YA 5E88A 3A0KA 2VW0A 3RG0A 2A6WA 1JW6A 2ZMNA 5H9QA 2DVGA 5T5OA 2EXIA 1KRIA 3C2UA 4Y1YA 5CNAA 2P37A 1I1EA 4LBKA 2WQZC 2NM1A 3SH4A 3IMNA 1DLLA 4PQ9A 4UW5A 5H9SA 3FLTA 4XIOA 1ULDA 4XJAA 2DURA 5GZEA 1B09A 4FQZA 1NLSA 4M01A 2GALA 1G9BA 1IOAA 1LGCA 3AJYA 4Y22B 1BQPA 1WW6A 3NV2A 3OY8B 1CPMA 1SACA 1CR7A 1W6QA 1QDOA 2PELA 5DG2A 3AP7A 1GBGA 1LU2A 4RA0A 2P2KA 1FYUA 3FUQA 4WZFA 5F5QA 1MVEA 4R9CA 1LENA 1GZWA 1S0EA 2CYFA 1G8WA 2CWMA 3MW4A 3PVEA 1DQ6A 5JOWA 1LOCA 3VKMA 4GWNA 4LBOA 5DUXA 2VUAA 4YW5A 2PHXA 1JUIA 2WKKA 1D0HA 4JC1A 5JDBA 1OFSA 2CTVA 1CPNA 3OBTA 3PMEA 4U2AA 4Y1ZA 1N1TA 5SV8A 1IS5A 5GM0A 3WG4A 1UKGA 2NN8A 2ZGUA 2ZMLA 1GLHA 5KXCA 1W6OA 4C1XA 3JU9A 4PBPA 2CNAA 1H9WA 2YROA 4D69A 1SFYA 3USUA 1N1SA 1FATA 1FNYA 1MS1A 1S0IA 1F9KA 3B00A 2VU9A 1W0PA 1KDKA 2AREA 3POYA 2JE7A 3WUDA 1Z0HA 2ES3A 3WDXA 1ULCA 4FPHA 3SNMA 4Z8BA 1V00A 4NO4A 2A75A 2VW1A 4FVVA 4P14A 3M3EA 4XTMA 2ZGKA 1GSLA 4LBQA 3VKFC 1UMZA 1URXA 1WD4A 2A70A 1SLCA 4M3CF 3RS6A 1XQNA 5GLTA 4GWMA 5CAZA 3N36A 3AXEA 2A6ZA 5KXDA 5F9TA 2EXHA 5FREA 2UWCA 1BJQA 2DVBA 4LBQB 1WLDA 2R1DA 2WT0A 3B01A 1S0BA 3AP6A 1LU1A 4XJ9A 1AJOA 4LBJA 1LESA 1LHWA 1GKBA 1HQWA 1C4RA 1SLIA 2JECA 2ZMKA 3AZWA 3IN9A 3LCPA 2PHRA 4U36A 3B9CA 3VKNA 4C1WA 5T54A 4YZ5A 5EXOA 1LOFC 1W6NA 1YO8A 3MW2A 4HL0A 3WZ1A 2E7QA 4R9AA 1JOJA 3POSA 4GKXA 2A6YA 4ASMB 1LOFA 4DRVA 3KM5A 3M3OA 2AYHA 1GNHA 1UPSA 1G9AA 3ATGA 1S0DA 3B69A 2EXJA 2ZGLA 1IKQA 1KJLA 4K1ZA 1IS4A 1YIFA 4Y20B 4YM2A 4AVSA 1GZWB 3AYCA 1LHNA 2GDFA 3OBRA 4LBLA 3NV1A 3CNAA 5BYNA 3ZYRA 1W6PB 1JYIA 1DQ5A 3OYWA 4YW4A 2ARBA 4XOGA 1H9PA 2D3RA 3WCSA 3BOPA 4AWDA 2PHTA 4XJWA 1W0OA 1RINA 5HCAA 5GZGA 1DYKA 4XBLA 2KM2A 5CB7A 1C1LA 1UZYA 5GZCA 4WVWA 4YFWA 4ATEA 1FV2A 3UJOA 3WDWA 4CRQA 4Q8KA 2CL2A 2D6MA 4ISQA 3ILRA 3Q9OA 1AXKA 5JOYA 2E53A 2A3YA 4AGGA 3OGGA 3T2TA 2YXSA 4TZDA 1VALA 3HN1A 1N3QA 1SBEA 3WG1A 1G7YA 2I2SA 4K1YA 1CN1A 4NOTA 3WG2A 5IK4A 1ONAA 1FV3A 4AGRA 2E51A 2DV9A 1S0GA 3ASIA 3O0XA 2D6KA 3ZXKA 4YFZA 1A8DA 2R0HA 5IK5A 1KQRA 1LHVA 1LOBA 3ZXFA 2SBAA 2WT1A 1CVNA 4W65A 3BIWE 3ZSJA 1GV9A 2EIGA 1DQ2A 2B7YA 2RHPA 3ZSKA 2ZACA 3HR9A 3SITA 1MACA 3O12A 4XXPA 2VXRA 3RQ0A 5EYYA 1UL9A 1W6NB 4XILA 2ENRA 1FNZA 3QCWA 1Q56A 1WW5A 4AYUA 1S1AA 2D3PA 4DRRA 3MPPG 5GZFA 3ILFA 4FOQA 1LOAA 4XJZA 2ZHMA 4XYXA 3A4UA 2JJ6A 3V0BB 1Q8PA 3MEPA 4FPFA 4GKYA 4GXLA 1HDKA 2WLQA 3V0AB 1ENSA 1GNZA 1N3OA 1W6PA 3AK0A 1CQ9A 1SLTA 3FLPA 3FFZA 2AR6A 2CY6A 3ZPYA 2UURA 4XHBA 1WLCA 5DG1A 1IS3A 4FPGA 1DYPA 2YMZA 2DVFA 2C5DA 2E6VA 1KITA 4YGCA 5GLUA 3O0WA 3FUOA 1Q8SA 4DFSA 2GNMA 1G86A 2EF6A 2ZBJA 3ZXEA 1AVBA 3RSJA 4ITCA 3AFKA 3WV6A 2WJSA 2V73A 2PHFA 3ILNA 1U0AA 2D6OX 3UJQA 5JMCA 4LBNA 4CTEA 2R0FA 2C9AA 4XJ8A 4K20A 1AJKA 2D6LX 2D6PA 1QNWA 1Z78A 4ZKTB 1WUVA 3JUUA 3USUB 3NWKA 2ZKNA 4XHXA 1LGBA 2FMDA 1V6LA 5E8AA 5JOXA 3HMYA 2Z42A 1Q8VA 3SISA 4IQPA 4XMIA 2TEPA 1FX5A 4SLIA 1DGLA 1QOTA 2A6VA 2HYKA 4XE9A 2ZABA 3VKLA 1A78A 4ISRA 1DQ4A 3I8TA 1QDCA 1I3HA 4XBNA 4YZ3A 4YZ1A 3V64A 3FLRA 1BYHA 2OUHA 2NMNA 4Y1XA 3AP4A 5DZGA 5L73A 4FPJA 4YLZA 1SLBA 1VLNA 2XB6C 1S0CA 4P9WA 4UW6A 2R16A 4P9YA 3WDYA 3TAYA 1SLLA 1MR5A 4GALA 2DU0A 3IM0A 1SCRA 2NMOA 1BZWA 5T5PA 3OY8A 3O5SA 2BQPA 3AX4A 4YZ2A 2ERFA 1O4ZA 1V6NA 2SLIA 4YW2A 4Y1UA 3WDVA 1UAIA 2D44A 2NP0A 1NXD1 1YXWA 5HCBA 1F31A 2G4IA 3INAA 2D3SA 2ZGSA 4Y1VA 2WSVA 3W59A 5GZDA 5IK7A 4ZXKA 2A6XA 4AVTA 1ENRA 1GYKA 4YM3A 3RRDA 4FP2A 5DZFA 5FRAA 5GLVA 5KXEA 1AX1A 1SCSA 2D7FA 1V6IA 1KJRA 3AYAA 1PZ9A 3NV3A 4FPKA 4YW3A 1UZZA 2DUPA 2EALA 4XBQA 5EWSA 1Q8QA 5KXBA 2OW4A 4Q1PA 4WV8A 4BLJA 3PVNA 1V6OA 1CJPA 1GZ9A 1QGLA 4L8QA 4MYEA 2Q5TA 2DVDA 2AENA 1QMJA 3D4KA 2P34A 4P9XA 5LK5A 4Q26A 4M3CE 3N7KA 5DUUA 1WBLA 3SH5A 1N1YA 5IT6A 1D2SA 3LSEA 1VAMA 2A71A 3V65A 3N7JA 2AUYA 2UWAA 4I30A 2ZGPA 4Q1RA 3APBA 2LALA 1ZM1A 1LOEA 1UN1A 1HLCA 1WBFA 3N35A 1V6JA 5AVAA 1S0FA 1KDMA 1CONA 2P3KA 3V0BA 2JKBA 2LTNA 1A3KA 4LBQD 4YGBA 3ZSMA 2AH2A 1W6OB 4R9DA 4FPLA 3OPZA 4AVVA 1DHKB 2CWSA 1ULGA 3AYDA 5CA6A 3AP9A 5E89A 3B3QE 4PCRA 1G9CA 2A5ZA 2ZHLA 3OJBA 2R1BA 1BKZA 4Y26A 4YW1A 4DPNA 1V6MA 3N7LA 1YI7A 2VY0A 1DBNA 2ZHNA 2A7AA 1CESA 3DUIA 3H0OA 1LEDA 3WHTA 1N3PA 5H9PA 1YRZA 4R9BA 3DGTA 3MW3A 4FOVA 3D6EA 1MS3A 2UU8A 3AP5A 3AYEA 3I4IA 4XJUA 3N3HA 3ZSLA 3O0VA 3VUOA 3KQRA 3M3CA 2DTYA 2WNEA 1V6KA 2NZ9A 4TYSA 5DZEA 3M3QA 3T1LA 5IK8A 4Y20A 2OUJA 3TB0A 1C57A 1AZDA 1O4YA 1HQLA 1PZ7A 3AJZA 3U4XA 3WG3A 3RMYA 3UL2A 3OYWB 2GMPA 4YM0A 4YZ4A 1Y7BA 3AZYA 4YM1A 1Q8OA 4UW3A 2A3WA 2ZGTA 1R1ZA 2GNDA 3V0AA 3GALA 4BOWA 3GNEA 1EPWA 2ZZJA 4KBBA 2JDZA 2AGSA 4RL7A 3N7MA 5IUQA 1N1VA 2W68A 3ZXLA 3QLQA 1QOSA 2UWBA 3M2MA 2DVAA 1IS6A 2EAKA 1JBCA 3PJQA 1LECA 1WCSA 3NV4A 1G9FA 1JXNA 1MVQA 2GN7A 3WNXA 1J1TA 1WLWA 2GMMA 2P3JA 4YG0A 1MS9A 4FQ4A 2D6NA 3ENRA 3IPVA 1CIWA 2A3XA 3A0NA 1W6MB 1GZCA 2H0BA 1AX0A 4DQAA 4DS0A 1IKPA 3D5OA 3POWA 2ARXA 1YYNA 2GN3A
chains in the Genus database with same CATH superfamily
1RUD2 1NY72 4WM8B 3PIGA 4WVVA 3TNQA 3IIIA 2DU1A 4QX0A 4XCAA 2YU1A 1V0AA 4AFDA 5C4WA 5IFPA 4AI9A 1LCLA 2W1QA 4N43C 2VMIA 1MZ5A 2JD9A 4QM9A 4J1XA 4TSVA 2HWD1 5DUVA 3T4VA 3WP3A 3WP5A 1FMD3 3LB9A 1Z7S2 4R4XA 1SLAA 2QE3A 2OX0A 3BVCA 2D5HA 3L2YA 2WT2A 2XQXA 5CFCB 1IGOA 4PDWB 1RUF3 5KHHA 1C28A 4K21A 1JOPA 2R072 1RUC2 3H1YA 1A6CA 3H3ZA 5FY5A 5C8CB 5FP4A 3N9MA 1LTEA 5EHDA 3PIJA 1PMHX 1SG3A 3SLIA 1YHFA 1AF9A 4BK5A 1RUE2 3S6PA 5HCFA 3NAPA 3SC7X 1JHNA 1ZZ9A 1POV1 4L99A 2HYXA 1OKQA 2XBO1 4OHYA 1EYBA 3NRUA 1YJLA 2Z4FA 2DYCA 2W52A 4M3CB 1F35A 3VDDA 5DAQA 1GICA 3VZKA 3LIHA 5FKBA 2E33A 4AHYA 4XMAA 3KMHA 4FPCA 2KA3A 2HEWF 4OZOA 4RD7A 3UKNA 4Y5SA 3ETPA 2BNNA 1P8JA 4FO9A 4LHKA 3WVJA 4ET7A 4OHXA 4Q4W2 1LJ7A 4V1PA 1QJY1 1QJX3 2QVSB 5DABA 3SCGA 3BTZA 3T4HB 4YG6A 3WR0A 5JVVA 3ZSEA 3HD8B 5BNOC 4GIQA 1CIYA 3K4AA 3IPVB 1QU0A 2W08A 4IV1B 4DUVA 4TTGA 2Q8CA 1ODNA 5KHGA 4MGTA 1F8VA 5JWPA 5A7SA 1ZA4A 4NAMA 3PUHA 2ZEXA 4BM8A 1YIPA 3W5NA 1DZQA 4FPEA 4O7XA 4CCNA 4XDQA 2QQUA 1OA2A 5AFBA 2VQUA 5D8AB 2VZ1A 1AR93 1OVPA 3WF1A 5H9RA 1GU3A 3DYMA 4GWJA 4O9EA 3ZMNA 2W91A 4YGEA 4AEMA 1YFWA 1W2OA 1Y9MA 4GB33 4PT6A 3VLBB 4UF0A 1ZREA 2W3JA 1SPPA 2DFBA 3BKZA 3CLPA 3JXSA 2Y38A 3NJXA 3ZXAC 4XXAA 3WQ1A 2ZGMA 4R8HA 2PAKA 2WA4A 4RGKA 1K5MA 4AGVA 5T5JA 4CPBD 2DWRA 4WM8C 1DQ1A 3AZVA 3CIHA 3IT8A 4FOYA 4KQ7A 1YC61 4YGDA 5D2AA 4BZ4A 2ZCWA 4JHZA 3ZM8A 4YNIA 5F5CA 2ZEWA 2ZMNA 5IVCA 4Q4X3 4U2AA 5H9QA 2CAUA 2EICA 5T5OA 1KRIA 5CNAA 3Q8AA 5JZGC 2WFF2 5K0UC 1C3HA 2YB7A 5FYSA 5C4WC 3FHAA 4RFRB 5KC6A 1TE1B 2WWJA 5GZEA 4QPYA 4AEDB 1NQJA 4M01A 4ARYA 2WFF3 1IOAA 1LGCA 5KWRA 3MIGA 4Y22B 3ACIA 4INDA 1MEC3 1WW6A 1CWPA 4CCJA 1X9PA 5A3WA 3D0JA 3EB7A 2PHDA 3MLKA 5C71A 3VL9A 5I93A 1ULPA 1LAJA 1XC6A 2P2KA 2P5BA 3NL1A 5F5QA 4WZFA 1UD1A 4IEZA 1MVEA 2VCMA 5J96B 1RHI2 1LENA 4P5HA 1RUF1 4CU9A 4L2NA 1ZZ6A 3ZN6A 3PVEA 3MW4A 2YU2A 1DZRA 5JOWA 1LOCA 2J1TA 2VUAA 1CAUA 1HW5A 3RPQA 4XFCA 2WKKA 1HRV2 4JC1A 5JDBA 2CTVA 3CL1A 3WG4A 5HCHA 1ZBA1 2XLAA 2ZGUA 4LPLA 4DO0A 2ARCA 3ROUA 1H9WA 2RS32 5I0UA 1MS1A 3B00A 3KT1A 1H0BA 3AC0A 4BQ2A 1KDKA 4XABA 3POYA 2JE7A 4CEYA 2P6CA 1JU3A 3WUDA 3JD71 5FTTC 5HBAA 3M3IA 4K6BA 4LK7A 1ZZ8A 4FPHA 1YWKA 2J7MA 4IE5A 2ZX1A 4QB2A 2VO5A 4BU2A 1XXNA 2RVAA 4XEZA 4AVCA 4P14A 3M3EA 4XTMA 2ZGKA 4O61A 2GAUA 2HWB3 4X6RB 3BOWA 1HXS1 3LA3A 1AL22 3GYDA 2A70A 4M3CF 3SXWA 1XNDA 4D6SA 3GBGA 3RS6A 3AB0A 2KXLA 3H8OA 4H3WA 1RUG2 3N36A 1ZRDA 3WF2A 1BJQA 1O5UA 2DVBA 4LIVA 2HEVF 4PIZA 1Z7S3 3FN9A 4LBQB 1JZ6A 1WLDA 1C8M3 3PUAA 1UU5A 4JGZA 1O59A 4XJ9A 1AJOA 3LOIA 5HPOA 1LESA 1SLIA 1VRBA 3CJIA 3U0ZA 2JECA 4FT8A 3IN9A 2VCAA 2PHRA 1BEV2 4YZ5A 1O3SA 2V5DA 1COV2 5FYHA 5T54A 1XE7A 1MZEA 3E6BA 1W6NA 3VBRB 1YO8A 3KF3A 3O1OA 1UZVA 2E7QA 2WS92 3CZUA 4CU6A 4DRVA 4JTNA 4RQPB 3KCCA 1O4TA 1GR3A 2P4EA 4RGAA 1UPSA 3KD4A 1G9AA 2IXCA 2EXJA 1FXZA 1UY3A 2F6BA 3SEPA 3HVDA 3RI9A 1GZWB 2RV9A 1OMIA 1RVF3 5DPNA 3ZLIA 4AVSA 4RS5C 4GMP0 4CDWC 2XL9A 3J7LA 3OBRA 4GAZA 4QU2A 2IVJA 1W6PB 4RS5B 2BP6A 3ZYRA 4GQ7A 5C6CA 1JYIA 4BQ4A 2WS91 3BOPA 1AR72 2JKXA 4ZZ5A 2VGDA 3U10A 5HCAA 4Q4W3 1VE0A 2MEV1 1W8ZA 5GZGA 3GZAA 2JDKA 4NVPA 1H4HA 5EPAA 5CB7A 1C1LA 5GZCA 5C4WB 1SMVA 1FV2A 3UJOA 3TN92 2EIBA 2D6MA 1O3QA 1AXKA 5I8SA 5G05L 5JOYA 2ZZQA 2E53A 2IZWA 5IJRA 4AGGA 4AFBA 1VBA1 1MZFA 5FPAA 3CDZB 3K51A 3IMMA 4AHZA 3U75A 2QCSB 4NOTA 4LHNA 2VZPA 2ZS6B 4EN9B 1GWMA 2JWPA 4MOAA 4KI5M 1PGL2 1YNAA 1JOBA 4COYA 5K0UB 4YVSA 2R0HA 1RGSA 4BK4A 4NN0A 3ZXFA 4AAXA 3BN6A 2WZR1 3HT2A 1JH5A 3BIWE 3ZSKA 1K45A 2RHPA 4NHLA 3RZHA 4M4RA 3HR9A 3SITA 4AI3A 2BPA2 3UESA 3I3DA 4XXPA 4CYDA 2Q1MA 2VXRA 3QBQA 5EYYA 2DDUA 1D0GA 4JGYA 4XPVA 2F17A 3NQHA 5EZWA 5M0TA 4XFIA 4QPIA 4WM7A 3K4DA 2F4PA 3MPPG 4A6SA 5GZFA 2JDPA 4FOQA 4HK9A 4XJZA 4WM7C 4P9LA 4ASLA 3A4UA 4AFMA 4GKYA 5LCWL 3V0AB 1HRI2 1KEXA 3KV5A 1RUH2 4CDUA 2VMHA 3DV8A 4MGYE 3AK0A 4HN1A 2WZPP 1CQ9A 1SLTA 3FFZA 4B1MA 1WA4A 2HWB2 4CSWA 1HXS2 4MVTA 3ZPYA 5HV0A 2QDRA 4Z2AA 2JICA 1IS3A 1I6XA 5CG8A 5GLUA 1OA4A 2I07B 4YYOA 2XL7A 1Q8SA 3SMHA 4DFSA 4YARA 5IVVA 2EF6A 3MFCA 1Q3EA 1W9FA 1AUYA 1W0NA 2EIDA 5L9VA 2WJSA 3ILNA 2VNVA 3D3AA 3UJQA 4LBNA 4IESA 4IEPA 3WF3A 4CTEA 5FP7A 4UFHA 1VPHA 4D94A 3NJYA 2D6LX 3VL8A 1QNWA 5IW0A 4FBFA 2PFWA 4XAAA 1WUVA 3JUUA 5FPUA 1O7FA 3H8UA 1YI9A 5F5IA 1VBD3 4QB6A 3SISA 4IQPA 1PK6C 4G3YC 5D8AC 2A6VA 4PIYA 5K9YA 1F2NA 4O65A 4IEOA 3WINE 1A78A 2E7AA 3HIFA 1QDCA 2C6SA 2XONA 3JCIA 4XBNA 4YZ3A 5IVEA 2VTFA 1BYHA 1NA1C 2VZVA 5BNNA 4N90A 5DZGA 1RUE3 5L73A 4DXTA 1VLNA 1DU3D 4AW7A 2Q1ZB 2RM22 2R16A 4AQSA 2RE9A 4B1LA 5KHIA 1XNCA 4NWWA 4AEDA 1SLLA 4EWEA 4Y33A 3RZLA 2NMOA 5BV6A 3OY8A 4MADA 4E4ZA 2ERFA 2XGXA 2Y6JA 2SLIA 3MIDA 4QQLA 1GMMA 5SV5A 2RDQA 4NHKA 4IDZA 3DF0A 4MHRA 2WINB 4E4DX 1ND3C 5A7OA 4LULA 5GZDA 1ND3B 1NYWA 3M8LA 2QQMA 3UKTA 4AVTA 4J1WA 4Z1VA 1ENRA 4Q0SA 4XACA 2DBIA 1UXXX 2YDEA 1CAUB 5GLVA 4CP9B 2OT7A 1Y43B 4FPKA 4CU7A 4LA3A 1VRH2 3JBG2 1V9U3 4JQTA 4JGZC 1IQDC 1IPSA 1WCQA 2WBKA 4WV8A 3VHRA 1V6OA 5F1RA 3RZKA 1OT5A 1U5IA 4AI1A 2Q5TA 1RJ7A 3TRSB 1OLME 3OGVA 2P6HA 1CAWA 3OD0A 4P9XA 4OI1A 1XYNA 4NIDA 1AR83 1B35C 3N7KA 1WBLA 4PLOA 4PF1A 2VQTA 1D2SA 2HWE1 1UMIA 4BXSV 5FYZA 2AUYA 2UWAA 3OCPA 2KD7A 4B7EA 1R091 1DZTA 3RI8A 1HLCA 4QX5A 5IVJA 5AVAA 1S0FA 4AF9A 5IFTA 1KDMA 3ELNA 1CONA 3V0BA 3U14A 5BNPB 2JB4A 2OPWA 1JYNA 1DYOA 4WBBA 3ZYFA 5FO8B 2AH2A 2XKOA 4N53A 1VR3A 4FPLA 3BI3A 3OPZA 3WNNA 3TOJA 4RN5A 1ULGA 3L2HA 3ZKUA 5BPXA 5E89A 2E31A 5JXIA 1S2EA 4D7TA 4CXYA 1G9CA 2B39A 3OJBA 4CUCA 2HWF1 1V6MA 1G6NA 2J42A 3H0OA 2BGCA 2ZHNA 1VB4A 2PLV3 3I2FA 4JKMA 1JYVA 1POQA 4UT5A 5DAWA 4XF0A 3WHTA 5C3PA 1UPIA 4LLFA 4EN8B 3QOPA 1KS5A 4LUMA 5CFCA 4Q5OA 2UU8A 3K75B 4XJUA 4A42A 5FOBB 2XLGA 3O0VA 5J36A 4ZU7A 3LA2A 3M3CA 1CX4A 2HWE3 2WNEA 5LA0A 3FHQA 3ME2A 1FOD1 5DZEA 3T1LA 2ZEZA 2VL4A 4Y20A 3WW4A 5C3RA 3DXUA 1ASJ1 2JG9A 4DXSA 2V4AA 5FZDA 3AJZA 2VBDA 2BVVA 3WQ0A 2JG9C 4K3UA 2GZWA 1NLRA 5JXGA 1Y7BA 3AZYA 1M06G 4HBNA 5D21A 1Q8OA 1VJ2A 2FDIA 3BU0A 3C7FA 1OPMA 2HWD2 4KBBA 1PGL1 1YUDA 3ZXLA 4LTAA 3EHKA 3B5LB 1FPN3 2UWBA 2IXHA 4QXCA 2YC0A 4N7UA 3MV11 3W9AA 4AEJA 3ZFFA 2YGLA 5A32B 4DZGA 1JXNA 1MVQA 2GN7A 3I59B 4HVOA 1WLWA 2LROA 1KD7A 2GMMA 4XCBA 5FMBA 4HLTA 2BBVA 4YG0A 1MS9A 4XW3A 5FZBA 3VB9A 5FZ0A 4FQ4A 1WMXA 5AC92 5F37A 3ZFEB 2QDNA 4R52A 2WRAA 2A3XA 5LASA 3BPSA 2AZ5A 3IDAA 1AX0A 4IEXA 1ASJ3 1UY4A 4MXWB 2KR2A 2X05A 4QHOA 4DQAA 4DXZA 5FWJA 2WA3A 3KSCA 1EAH3 1AL23 1AYN3 3VZLA 4CCMA 2OS2A 2DCYA 5E1RA 3WNKA 3ZYJB 2ZX3A 3JD73 1S0JA 5LEJA 2QQIA 5FQ0A 3LPFA 1RC6A 1U5XA 4QKBA 4F83A 1GOHA 1JYTA 1NCQA 1EAH2 5HV4A 3LOBA 4B4RA 5FDBA 4GWIA 3LGRA 3RFRA 2Z5WA 3IIAA 4XF3A 2YBSA 4PF5A 4LMFA 2BUKA 2W92A 1VRH3 4BCUA 1OOPA 2ZA9A 1LULA 1UOGA 4UFKA 1YCIA 4WVMB 4FTSA 4GJZA 1LHUA 3ZYHA 1PZ8A 1GWKA 4M3CA 3GBWA 2NQYA 1MS8A 4JDNA 1ZRFA 1PK6B 1TZOA 1DFQA 1XNBA 2W47A 2W9XA 2RS31 3KB5A 3KCYA 4RYDA 4W4ZA 1MZ6A 1FOD2 5FY7A 5I91A 4PDWA 5C9AC 4I09A 5A7QA 4RQPC 3AXDA 2JDNA 2WNOA 3ZXJA 5JI7A 4PDWC 3FHIB 2GNBA 1W9TA 4BLIA 5C8CA 4OZXA 4LO5B 2VW2A 1QJU3 3LSDA 4QQ2A 5LATA 1ULEA 1EV11 4FFFA 2JG8A 4ES9A 4KWJA 1DIWA 1MPXA 4Y22A 1QHDA 4Y4RA 4CZSA 5ABJA 2VOKA 2VM9A 3ZPOA 1RUNA 5A80A 2MNGA 2Z2SB 3I3EA 3P3PA 4RSUA 4XZPA 2FD8A 1W8HA 5T50A 4CCOA 5HI0A 3ZVXA 1JN2P 1RUJ3 3LFMA 1GNYA 4HPKA 4BMEA 5BUVA 2YFUA 4HETA 3ZXGA 4XIKA 3MZHA 1OH4A 3ZKYA 1R093 1WW7A 3R6SA 3ZFEC 1C8M1 1POV3 3ZR5A 2JE9A 1SBFA 1W6MA 4S2GA 1QJX2 1W9WA 2R6QA 3RMXA 2RR12 4XQ4A 1F15A 2BU9A 1PNFA 1VBD1 1QF3A 1GP4A 5L9RA 1X50A 3TEWA 5KHJA 4QGMA 2ZGQA 2GP5A 1C1FA 3OPTA 4CUGA 5A3UA 3TEYA 1F5JA 1NQDA 4NPRA 3I2JA 3LDBA 4AQ2A 2Y33A 1GQHA 3WT3A 2N7GA 1ENQA 2I74A 4FXGB 3DYPA 1ST8A 1AXYA 3PU3A 4HK8A 1O8SA 3LD8A 1C5HA 1YEWA 5FXXA 1U5ZA 5LZ6A 3K4ZA 2VUJA 3ZYPA 1W03A 3IAPA 4Q29A 4BMBA 1OPOA 2RMU1 3WDTA 2UY9A 1PIV3 4FFHA 1SFNA 3J4UH 1GANA 4Q4Y1 3OSDA 1BXHA 3ALQA 4JKLA 1VIWB 3FBYA 2FBEA 1BVVA 1R1A3 2WSUA 2JX9A 5E88A 5FZKA 1ZBA3 2A6WA 2WWUA 2EXIA 1TME1 3I3QA 5FLJA 1I1EA 1EPZA 3MO4A 2NM1A 2VD7A 3HT1A 3E6DA 2Y6FA 4PQ9A 4UW5A 4WM7B 3FLTA 3HQXA 1PGW2 4XIOA 3TEZA 1TME2 5LBCA 3J9SA 2DCTA 1UU6A 2RG4A 1BQPA 3NV2A 5ISLA 3H42B 4KH9A 1SACA 2QZ3A 2HWC3 3IDBB 1QDOA 3K48A 3KVBA 3TEXA 5ACA2 1JZ8A 1JI6A 1GBGA 1XBFA 4RA0A 3WW1A 2CGPA 5CADA 1HRI1 1H6XA 1VP6A 2QFEA 3MF6A 4UXAA 4JX0A 3PHMA 5LB6A 4XDPA 2QQKA 1AHSA 1GZWA 2E9QA 5CFDB 2XJTA 2CWMA 4A7YA 5FO9B 4CEWB 4TXWA 4MUVA 4KMQA 3LPGA 2XH6A 4UOJA 2PHXA 3CU7A 4ASKA 1QH7A 1OFSA 4QKFA 1IS5A 5GM0A 1UKRA 1UKGA 3K2OA 2ZMLA 3JU9A 4PBPA 5C70A 4IEVA 4EV0A 1OLQA 2GC3A 2XPJA 4D69A 5DAPA 1VBD2 1N1SA 4QX1A 3RWKX 1UMHA 1PVC1 1F9KA 1IPJA 1NOVA 5FJHA 1W0PA 4A7ZA 2K0GA 1QJY3 2ATFA 4BIFA 1Z0HA 2XKPA 3A23A 3WDXA 1NKGA 1ULCA 4DY5A 3ZIXA 2NLRA 2TBVA 4Z8BA 3FL7A 2B46X 2A75A 2VW1A 1RUI2 3AMMA 2BGOA 3RNSA 4WM8A 2R061 2QQPA 3E5UA 4MGIE 2VNOA 1ZBE2 5A3LA 3J8F2 3VHOA 1URXA 2IXJA 4NIHA 1H8VA 4NRQA 1RVF2 5F32A 2WN2A 4FFGA 4FI9A 4GWMA 2JDUA 4TLFA 5GLTA 1UYZA 5K0UA 3JQXA 4MGSA 3WY6A 5KXDA 4IL7A 1NE6A 2C26A 3FE5A 1OD3A 4QX3A 3UYJA 4META 2UYBA 2R1DA 2WT0A 4JHTA 4QX2A 1PMIA 3WSOA 2ADEA 3KT4A 4OHVA 3MIBA 1LHWA 1OD5A 1C4RA 2WQ8A 3N9QA 3LCPA 4L11A 4C1WA 3K3OA 4MXVA 5EXOA 2JXAA 3MW2A 4HL0A 4JGYB 4AVBA 4R9AA 3IB3A 4FSJA 4I0WB 2A6YA 3M7AA 1FOD3 2AYHA 4JGZB 1GNHA 3C8XA 3OUIA 5DN2A 5FKCA 2ZGLA 2W94A 2Y0OA 2YBKA 4YM2A 2ZX0A 4F3JA 1RHI3 4HMZA 1LR5A 3NV1A 3CNAA 4EN0A 1DQ5A 3OYWA 4YW4A 3LDRA 4QWNA 5JXJA 2YPDA 1UY0A 1L7RA 1H9PA 2D3RA 3WCSA 1K12A 2WAAA 2PHTA 4E8DA 1W0OA 4OFGA 1RINA 3O1UA 4XFBA 4AK3A 2B5HA 4H2AA 1H2KA 1TMF1 4WVWA 4YFWA 4E2GA 2X53S 2WNUC 4QHBA 3ZN4A 4F8AA 1L7QA 2HWD3 2WNUB 1R082 1W2TA 5FZ9A 1VBE3 2VZOA 3KV9A 5ANQA 3RZZA 4Z07A 1OOPB 2Y6GA 1SDWA 1RVF1 5JMOA 4AFCA 4P02B 1N3QA 1AL21 1G7YA 2I2SA 1CN1A 1CZVA 2BNOA 1VMHA 2WO3A 1ONAA 4AXOA 4QPGA 5L7OA 5LA9A 2HWC2 5ACA3 4DUXA 2BRTA 1WA6X 4ZONA 3O1MA 5BNPC 2E51A 2DV9A 1RUI1 1S0GA 3LKJA 3THCA 1PNGA 4QGLA 3WNOA 3ABZA 3S5QA 2BZDA 1BVP1 5C33A 1RUG3 1XB9A 2BFUL 3ZFGC 3ZSJA 1ZX5A 2B7YA 2J1UA 3MIFA 4LE4A 2ZACA 3ES4A 1CGPA 1JZ7A 3ZFGA 3TWIA 1MACA 3QH7A 1COV1 1US2A 4YVWB 4LE3A 1NAEA 3ZX7A 4HKWA 3VBRA 4UBGA 4X8PA 2Q8OA 1RMU3 3KS7A 4J6GA 3SKVA 4KBZA 4CDQB 1S1AA 4QB1A 4XFHA 1EUTA 3THDA 1W8OA 1LOAA 4XYXA 1XYOA 4XQWA 2JJ6A 3R4DB 1Q8PA 3V0BB 4FPFA 2OKXA 2H6BA 2WLQA 3JBG1 1W8TA 3ZO0B 4P00B 3LFIA 1N3OA 3AL5A 4BWOA 2HWF2 2VZ3A 4QPIB 2RJKA 1ZBE1 3KF5A 1BHGA 4K40A 4R4ZA 3CQOA 1QIQA 3UV9A 4OUMA 5KR7A 5JXHA 3H1WA 1UNBA 4KWKA 3ZXEA 4ITCA 3AFKA 3WV6A 5KHKA 3GHMA 4MGKE 3VBFA 2PHFA 1OA3A 1CAWB 1MEC1 2D6OX 2RMU3 2X10A 2JDAA 3VBHB 2R0FA 4LO4B 2B45X 3CBNA 5JCTA 1AJKA 2D6PA 1Z78A 1S2BA 3T2QA 1H4GA 3ORJA 4HVQA 4ZKTB 1PM4A 1RB8G 1LGBA 2Z42A 1Q8VA 2DCKA 2FZ1A 1NCQB 2G1MA 4Q4V3 4XMIA 4CEYB 3HNBM 1W2NA 2TEPA 2W87A 4SLIA 4N9HA 3H8RA 4ES8A 2HKXA 2HYKA 2RS51 1REFA 4XE9A 5BY5A 2ZABA 3L9JT 4QDRA 5IHRA 4ARXA 4ISRA 3I8TA 2FDFA 3V64A 4QAWA 4WVMA 2OUHA 4Y1XA 1GFF2 4YLZA 4XAEA 2XB6C 5EIYB 1W8NA 1S0CA 1NXMA 3I3BA 1YJKA 4UF0B 5EJ1B 5FJKA 3RGBA 3M4FA 1DP0A 2ZEYA 1LNSA 1OFNA 1RYYA 1SCRA 1BZWA 1NZIA 4GB31 5T5PA 4N43B 3WF4A 2IXIA 1DGWA 3O5SA 3AX4A 1NZCA 1AR91 2ZOEB 4GH4A 3ITQA 2PTMA 3ES1A 4YW2A 5FPBA 4C91A 2D44A 4J25A 4HZFA 5HCBA 3GGLA 3T2PA 3CZJA 2D3SA 5L19A 3I97A 2WSVA 5EQUA 5CKMA 5IK7A 3VDCA 1ZNPA 3B9IA 4LNVA 5CVRA 1GYKA 3ETQA 5FRAA 2MHFA 1POV0 2VBPA 3EJKA 1RUH3 1EY2A 3VD5A 3NV3A 2BW8A 4IEWA 4RGGA 2RS33 4XBQA 2K2SA 2VUDA 2OW4A 2WZR3 1W2UA 2ORZA 3FJSA 4A6OA 4BLJA 5JSRA 2IFRA 1XSQA 1GZ9A 3GDBA 5FPLA 3E1F1 3H8XA 3LAGA 3GZEA 3JB4C 3HWJA 1QXPA 2J1RA 3NW4A 1QMJA 1RL3A 1OC1A 4PI0A 4M3CE 1A34A 5DUUA 1QQP3 4YSFA 3SH5A 2VECA 5IT6A 1EP0A 4LT5A 4QGNA 3AKTA 4I30A 5C5TA 1VBA3 5ERLA 4HOOA 2BTVC 3VDBA 2BWAA 4PIXA 1WBFA 4D6RA 1KFXL 1HB1A 3HNYM 1QJX1 3DCQA 5EJ3A 5KBFA 2XOMA 3AKSA 4LBQD 4BQWA 3GHNA 5I8TA 3MF9A 4XZUG 1ZZBA 1XU2A 1JODA 5FYCA 4FFIA 2W95A 4Q4W1 2A5ZA 2ZHLA 4DPNA 1X8EA 4Y26A 5E16A 4AI8A 1YI7A 2VY0A 1DBNA 1J3RA 2J1AA 1CESA 1YFYA 2PN5A 4I01A 4MG2A 5L9BA 3EMRA 5FZOA 5LEKA 4R9BA 1E5IA 2BBAA 3MW3A 4FOVA 5FXZA 2BDRA 4BXFA 4C0BA 4COZA 1MS3A 4RHV2 1OSGA 5FZHA 3I4IA 3AMPA 2O8QA 3N3HA 4XUQA 4EROA 3ZSLA 2XXZA 3CKHA 4CCKA 2C9KA 3I2KA 3E97A 3KQRA 1SDDB 4DUWA 3AM2A 2DTYA 4IUGA 3CEWA 4RR3C 2NZ9A 3NNLA 4JZRA 5IK8A 3DN7A 1CD3G 1ND3A 3RVHA 5I8YA 1D4M1 1C57A 1O4YA 1D4M3 5LBFA 3U4XA 3KHCA 3PTYA 2D93A 3T0AA 3WG3A 3W5MA 3UL2A 2XDVA 3OYWB 1YQCA 3ACLA 2GMPA 3PNAA 5A3PA 5DMYA 3OGJA 5CZKA 1RUD3 4YZ4A 1DDLA 4CEWC 4LO6B 3Q8CA 3HQUA 3N9LA 1R1ZA 3V0AA 4P08A 5ABJB 3U07A 2ZXQA 1EPWA 2ZZJA 1VBE1 4LHLA 2AGSA 5FZ7A 3N7MA 4CEWA 3VBRC 2W68A 4QT6A 5ANNA 3QLQA 1FI2A 2X5IC 5I0DA 3M2MA 2DVAA 1LECA 1WCSA 1T6BX 1ZRCA 3VZNA 1XU1A 4KGQA 3WNXA 1B35A 1DG6A 1Q5OA 3GF6A 1VMFA 2P3JA 4TN7A 5JIAA 4I3PA 3GJAA 4RS5A 1DLCA 4KU8A 1W6MB 2H0BA 2HJIA 2HH9A 4NRMA 5A6QA 1SQ4A 3F95A 3UGGA 1M4WA 2QBXA 2WAOA 4OHWA 3D5OA 3POWA 4N53B 4NMIA 5J98B 3OOXA 4QKNA 1PO12 3S57A 3KWVA 3SCHA 1BMV2 4BPZA 1TG7A 3SQOA 5F2WA 4JCKA 1OF3A 3NKTA 3IDEA 1PVXA 3CMGA 2A73B 4HG6B 3ECQA 5F39A 4S2FA 1REEA 2B42B 2BFUS 1BLZA 2FDGA 1LHOA 4IE6A 3KQ4B 1W9SA 2R49A 2E63A 3BODA 4QQPA 1T6GC 2RJ2A 3WHUA 4COUA 5C8WA 2CV6A 1LKNA 1NA1B 4OYUA 5GLZA 2CU5A 1VB2A 1RIRA 3AZZA 3WOGA 5JSPA 3QACA 2DTWA 4A41A 1QKQA 4NHMA 3OB8A 2ZAAA 2XMLA 2IC1A 3WCRA 1HRI3 4Q2FA 2WLPA 3V56A 4YVSB 1MS4A 2HWE2 4NHYA 2JG9B 3ACHA 3WW3A 4YVSC 4OI0A 5B4NA 1OLRA 1TNRA 5LBEA 2BV4A 2PHUA 4D0QA 4ATFA 2YZ4A 1WLTA 2E7TA 4IXLA 4KNCA 2GC2A 3Q8BA 1HB3A 4LBMA 5FPZA 1F5FA 2QUOA 2NYYA 4A3XA 1QNYA 4EQVA 4F7ZA 1ULFA 2DUQA 1H2NA 3W58A 1RUG1 2R063 4AQTA 1AR73 1WD3A 1SBDA 2PMWB 4I2OA 1FMD2 2XLFA 3DYOA 3VKOA 2GMEA 2XVKA 4JGYC 2ZPXA 5A3OA 4D7SA 1YLLA 2G9ZA 1ZYBA 4XC9A 5ACA1 1N47A 4XUTA 3M1HA 5FR3A 1OKOA 4OLLA 1LGNA 5EYXA 1XPWA 4I3GA 2C4XA 2JG8B 4PQQA 4XTPA 1TEIA 3U37A 3VHNA 4BQ1A 3QH6A 1R083 5T3NA 5LBBA 5DUWA 4UW4A 2Y60A 4FPOB 4XFFA 2RS53 4NAOA 4N53C 4EZHA 1JZ5A 4QDQA 2JDMA 1CAXA 3PVOA 4JRLA 4CCDA 4MGQA 2DCJA 3UKVA 3SH3A 4E8CA 3IZOA 1ND2A 2OXBA 3NNJA 4CXXA 1AX2A 4QQHA 3VV1A 2W5FA 2RR13 4V2VA 1WZXA 1ND2C 1UX6A 5I0SA 2D98A 1LODA 3C7HA 4Z2WA 1JUHA 1J1LA 2VOVA 1NCQC 5C5UA 4NJ4A 4Q27A 4OQ9A 2VH9A 3RZMA 1LB2A 1A8MA 1XSRA 4Q8LA 2GNTA 3EXUA 4TWTA 4DB5A 2PHWA 4LIUA 2QQNA 2QQLA 2YYOA 3AMQA 3EQEA 1DGRN 1PGSA 1QOOA 1APNA 2YY1A 5JOZA 2LRPA 5IAXA 4NROA 1FPN2 3NVCA 3J7NA 1QXJA 3EYPA 3PUIA 5C3OA 1GQGA 1US3A 4NUBA 4COWA 2DVGA 1UIJA 1OI6A 3C2UA 3DPRB 4Y1YA 2YGMA 1DGRA 5F3IA 1MQTB 4HN0A 3SH4A 3VN4A 4CDQA 4ZZ8A 5H9SA 2JG8C 1LRHA 4QM8A 4RR3B 1B09A 1S4CA 1NLSA 5FLHA 3PU8A 4CXWA 3HQRA 3I54A 2GALA 2V09A 4OVEA 2XHKA 1OQDA 4AEDC 1R64A 3E5XA 3H7JA 1YQ6A 2PAMA 3OY8B 4HSLA 4URAA 1FPN1 1CPMA 4XFAA 3HJRA 5CYYA 1W6QA 2RJLA 1WCDJ 1UYYA 3E6CC 3OGRA 2VMDA 5DG2A 1KS4A 2ZX4A 3AP7A 3GBFA 2B9UA 4NE9A 2RMU2 3AKPA 4V2WA 1FYUA 1CAVB 3LEKA 5CG9A 4LKEA 4ORFA 1S55A 4K9SA 1S0EA 1ZBE3 2R043 1G8WA 4LJHA 5JAXA 3VKMA 4CDWB 3MUY1 5FZAA 3DXTA 5DAVA 4AL9A 1ACCA 4GD4A 4YW5A 3VBOB 1JUIA 2WNVC 4NR1A 1ZVFA 1YQ2A 2WFPA 2FZ2A 5A32A 2NN8A 4PJYA 3I59A 3POEA 4Q0QA 5FCCA 2VVEA 3X29B 2YROA 2X29A 3H3UA 5CFDA 1SFYA 3UT0A 1FATA 1S0IA 4CU8A 2WZ8A 2VU9A 1MEC2 3N9PA 3VHPA 2O8OA 2VJXA 2WZR2 3VBSA 3ZMOA 4I02A 1K42A 1VBB2 2VC9A 3SNMA 1W8UA 3VBSC 1AYM3 1V00A 1OOPC 5DDJ1 4IE7A 3U1XA 1QJY2 1XYPA 5FQ0B 2VNGA 5FP3A 5FYMA 5IVYA 1XRUA 1ULOA 3J26N 1WD4A 1SLCA 4OUEA 2K46A 1RUI3 2H0VA 2QQVA 1UW8A 5CAZA 3AXEA 5F9TA 5IATA 1E5RA 2GP3A 5FREA 4MHUA 5A7NA 3I2HA 2G9GA 4XETA 4Y5TA 1PVC3 3B01A 3TN91 5CEHA 4AE2A 3AP6A 4W6YA 1HN0A 4BQ5A 5A7PA 1E5HA 4IERA 4LBJA 5TSWA 1RUOA 2ZMKA 4U36A 4DNYA 1TVGA 1V9U2 4XQDA 1AR71 2R073 1JOJA 2WR9A 1O6UA 3POSA 3IDCB 2JIGA 3K3NA 2R071 4GKXA 2OQ7A 3POFA 1R1A1 3LIGA 2FQPA 5CU1A 5DAXA 3OBAA 3ATGA 1S0DA 3B69A 4CUBA 2VZQA 4A2UA 1UOFA 4IV3C 3RYPA 3HNMA 1IS4A 1YIFA 2VOWA 3OGSA 2J1EA 2PQQA 4XURA 4Y20B 1LHNA 5B4XA 3VZOA 4E2QA 5FZ6A 3S0MA 2GDFA 4I0AA 4MZUA 1W9YA 5BNOA 5CKQA 1EAH1 1GOFA 2ARBA 4M4PA 1OUSA 4XUPA 2B4KA 1HRV3 4LKSA 3AVRA 4LORA 4AWDA 1O5LA 1TMF3 1D4M2 1HN1A 2CAVA 2DF7A 1S2KA 4XBLA 1X8MA 1OLMA 4YPJA 1XE0A 1KGYA 3VD3A 4JVAA 3GCXA 4ATEA 4CRQA 3WDWA 4BIOA 2CL2A 1TMF2 4ISQA 3VBHA 3ZFFB 2LW8A 1O3RA 3ILRA 3Q9OA 2PAEA 3O7OA 2O1QA 2VQAA 2AEZA 2W46A 4Y3OA 3MLJA 4XUOA 3VBHC 3OGGA 4G9SB 3ZDSA 3T2TA 2YXSA 3PURA 3KV4A 4BQXA 1VALA 3HN1A 2XJQA 2XHNA 4Q4Y3 4TZDA 1RUC3 5JIUA 1NT0A 3LWCA 1BK0A 4K1YA 4HFSA 3WG2A 4JDMA 3WQBA 1GP6A 2L9LA 5FO7B 4AGRA 2VUCA 1DCSA 4AQ6A 4DY3A 1L7LA 1VMJA 1Y4WA 3DEMA 5LRRA 3ASIA 3O0XA 4RHV3 1K5JA 3PVBB 4XF1A 5FZCA 4B3NA 5IK5A 4LITA 1LHVA 1LOBA 1AYN2 3J7HA 1HV1A 3A7QA 3RZGA 4E4HA 2Y0IA 5JZGA 3UETA 3JZVA 4LO8A 1J84A 1QJU1 4IV3B 4CP0A 4MSVA 1GV9A 2EIGA 1IG3A 1NCRB 5BXXA 2Y26A 4N7IA 1PO13 4B4PA 1V9U1 4HONA 1RMU1 1W39A 2GU9A 2VVDA 2XJPA 3LDKA 1UL9A 2WO2A 4XILA 5FY9A 2EAAA 1W8FA 2ENRA 4GZ9A 3S30A 3QCWA 2IXLA 1BEV3 1WW5A 4GH4B 3VGIA 4AYUA 3C3VA 4AFAA 3CF6E 3A21A 4MX3A 2BERA 4UYBA 2UY8A 2XJSA 4E4SA 4EJRA 1H8TC 1HX6A 1VBB3 2J22A 3MEPA 2WNVB 2RS13 2Q1FA 3BU7A 1HDKA 4QDSA 5JSOA 2FDHA 1FT9A 1GNZA 1SEFA 1W2AX 3D82A 2YC2A 3NJVA 2ZTNA 4FXKB 3JQWA 3J8F1 2RS11 3DPRC 1OH3A 2CY6A 5FFOC 4X6QB 2EVXA 1WLCA 5DG1A 2B9VA 1CAXB 1DYPA 2Q8EA 5IYYA 2VOTA 2ET7A 4FTBA 1G86A 2ZBJA 3JB8A 3CHXA 1AVBA 3RSJA 3H50A 3JD72 1JZ3A 3VD7A 1U0AA 3KT7A 3ZFFC 5F8PA 1UY1A 4ZY9A 5FZEA 2IWGB 2Y6KA 4UFMA 4B8EA 5A6XA 1SPPB 2Q30A 4K20A 4XFGA 3SEEA 3ZXDA 1W04A 2PLV1 4AAPA 5T52A 3BTYA 2P1BA 3VDAA 2QQOA 4EWDA 1K5MC 3USUB 3MICA 2ZKNA 3NWKA 3U11A 4BE3A 5E8AA 2VG9A 5JOXA 4Q4X2 3VBFB 2ORXA 1J59A 4QXKA 2V72A 2XUMA 1QOTA 4QPGB 5L7OB 4MO3M 1ODMA 3VBOC 1CJDA 3VKLA 2LM3A 1IZ3A 2P3YA 3H9AA 1RHI1 2WUHA 2JB8A 1H1MA 2WO7A 5JUVA 4Q4V2 3I49A 3BIEA 3AP4A 1J58A 2BWCA 3BB6A 4FPJA 4JV4A 4ZS3A 1ZA7A 4YVWC 1AL0G 4LA2A 3I3MA 3WNMA 5FMCA 2DU0A 4YVWA 3IM0A 5FZOB 3B94A 3BALA 4W6XA 5FZIA 3WP6A 2D5FA 2OZJA 3MBWA 3N9NA 5FYTA 2CDOA 2VMGA 4P9JA 4YW6A 1VAKA 1O4ZA 1V6NA 3I2DA 4A44A 5IWFA 2Y8KA 3VBUC 1UAIA 5KXCA 2NP0A 1NXD1 1YXWA 5I0TA 3ZIWA 2XWJB 4N9IA 1UZWA 2ZGSA 5K4LA 3KGLA 4GMP1 1WWYA 5C9AA 5G04L 4YM3A 3NAPC 3O1PA 5FK7A 3UNPA 3GM8A 5KXEA 2D7FA 1V6IA 2ETEA 5A7WB 3W20A 3AYAA 1PZ9A 3TNPB 2DUPA 2EALA 1HB4A 1EUUA 1WCUA 5EWSA 3VDDC 4AHWA 5KXBA 3S5AA 2E32A 1BK1A 1H2LA 3S7IA 5EFUA 3VBFC 2JDYA 3IAQA 2YG0A 1CJPA 4LKFA 5FY1A 1QGLA 2RS52 2X5IB 2DVDA 3LEMA 5A3TA 2P34A 1Q43A 3ON7A 2C24A 2ARAA 5F7UA 3ZN5A 5LWBA 1N1YA 2Y64A 3HBKA 1B35B 1HQNA 3LSEA 1VAMA 1GQPA 2A71A 2TNFA 1ALYA 1PIV1 3CJXA 3N7JA 3PDQA 1ND2B 4QU1A 5FZGA 4CDXA 4CP2A 4DMIA 3T0DA 2LALA 1ZM1A 1LOEA 2BEOA 3R0RA 3LQCA 1UN1A 4FTEA 1RUC1 2Y6LA 4W8JA 4UBHA 5FZ8A 1UCXA 3W21A 2P3KA 2WYSA 4QPGC 5L7OC 3QD6A 4IEYA 2JKBA 1L3JA 3ZSMA 4R9DA 1W6OB 5IAVA 1DHKB 2TUNA 2VZTA 2QQJA 3AYDA 5FUPA 3VBUB 2PQSA 4JAAA 5FYUA 4NWVA 4MV2A 2BVBA 2R1BA 4YW1A 4OMCA 5FP9A 4HSJA 3CJIC 5DDJ3 1D2QA 2CSGA 2YUEA 4YW7A 2OYZA 2W2IA 2VBBA 3CJIB 1D4VB 1NY71 2DFCA 5IVBA 4GH4C 1EV12 1YRZA 4AOCA 3DGTA 4N43A 4QXBA 2QNKA 3MGUA 3OUJA 4IEUA 3D6EA 1UWWA 1VBC2 3AYEA 4MH0E 1W3XA 1UXZA 5J09A 2OA2A 1RUJ1 3MFAA 1IQAA 5A33B 4OHZA 3ZFGB 5K8SA 3M3QA 4AVAA 2XWBB 2BOJA 4M0NA 3TB0A 4B4QA 1PZ7A 2MPFA 4CDUC 1YQ5A 2PHLA 1PO22 4IEQA 3RMYA 1JHJA 2J1VA 3RZJA 1QJU2 3AVSA 1SZBA 4H14A 5L36A 4NRPA 1CAVA 2GH2A 2A3WA 1NCRC 2PA7A 2ZGTA 3GCWA 3KLSA 5FYVA 4NIIA 3TN93 5IUQA 1HJGA 1OQEA 1RXFA 2DCZA 2JDZA 4RL7A 3USSA 1N1VA 4FCAA 3IBMA 1QOSA 4Q0PA 3MPBA 5FY0A 2Z69A 1JBCA 4BYYA 3NV4A 1JZ2A 2YPJA 4ZPIA 2XVLA 1PO11 1J1TA 4HXCA 1F4AA 2D6NA 2Y6HA 3ENRA 4E9KA 3IPVA 3UGFA 3BTXA 3SKJE 1GZCA 5FBJA 2LUWA 1O8PA 4XF4A 2WC2A 3G7DA 4RHV1 5FAXA 5J37A 3LA7A 2ZKLA 5AC91 2ARXA 1YYNA 3T30A 2GN3A 4ZS2A 2P3IA 4LHSA 2JD4A 3RJ2X 2ZGNA 4H7MA 1WKYA 3WDUA 1NG0A 3S7EA 4DINB 4FAGA 1MS0A 2FHRA 2VCCA 4A3ZA 4DEQA 5LY1A 2VOXA 2OVUA 3WUCA 3WEZA 3ZYGA 2WNUA 2ZAHA 1BCXA 4S2HA 3T1MA 5GALA 4Y24A 1Y9QA 5GJ6A 2Q0AA 5F3GA 3UK9A 1JYCA 1VBB1 1WMFA 5FPVA 4PBOA 5B2GB 4PLMA 4BQ3A 1XNKA 1RITA 5EV7A 1C8NA 3OEBA 4YG3A 2QTWB 3T2OA 3WNPA 2VR4A 3K77A 1I9RA 1R092 2HBUA 1WCKA 3FX3A 4LXLA 3P6BA 3R05A 2ZGRA 4JRAA 3ACFA 2VULA 1WW4A 5HXVA 4QHZA 1HKDA 2OZ6A 4Z92B 4CDUB 4XF9A 4GMP3 4D6QA 5GLWA 2EXKA 2ZHKA 4L92A 3ACGA 1RXGA 3R4UA 1H30A 1XNAA 2XG3A 4WVZA 1JYWA 4CCEA 3LEGA 5CFDC 2G19A 3O1TA 2WABA 4BHPA 1W8WA 2ZGOA 1VAVA 2D43A 3CO2A 3MYXA 2FCVA 3KCXA 4HT1T 1VRH1 1FAYA 3O14A 5DXDA 4DXRA 1G9DA 3O1RA 2BJSA 1W6QB 1AYM1 4FPYA 3RYKA 3B02A 4JTOA 3ST7A 3NSTA 3SCFA 1GWLA 3WX5A 3U78A 4CUAA 2R062 1AXZA 4P9IA 5DDJ2 5A3NA 2YHJA 4QKDA 4BDVB 4GA9A 1H1IA 2VTXJ 4CDWA 5D8AA 4XDOA 4NIAA 1F4HA 2VNRA 1NLQA 4PI2A 3IKWA 4HANA 4G4FA 5CBLA 2JENA 2WFF1 4URTA 2LS6A 3ZYBA 2HWF3 2Z79A 2YV8A 1GP5A 4M00A 4MGZE 4GB32 1OQ1A 3AZXA 4FOWA 4CVUA 3N4MA 1IG0A 1UX7A 3HEIA 4Y5Z0 1LOGA 2IUWA 1K5MB 4CEYC 2C1FA 3LE0A 4IV1A 4D8MA 1W90A 1HRV1 5T55A 2ADDA 3D8CA 5T5LA 3WW2A 3OEAA 4XVHA 1MS5A 5FY8A 1O91A 2DUOA 1DQ0A 1LEMA 4Y4YA 2XVGA 5LW9A 5CFCC 5JLVA 1QJZA 3BTAA 4H55A 5IVFA 4HKLA 2D40A 3R4SA 2W39A 1BBT2 1X82A 3HOBA 2WL1A 4FP3A 3WLUA 5JPMB 1CX1A 5J48A 2V5YA 3G6JB 3GZUC 3A0KA 5FLIA 2VW0A 1GZTA 1H2MA 1TNFA 3RG0A 1JW6A 5FYYA 5DQ0A 3T09A 2P37A 1WMDA 4LBKA 1EV13 2RR11 1CZTA 2WQZC 3POJA 3I7DA 4OMDA 3IMNA 3JBG3 1DLLA 3PL0A 4L0PA 1X7NA 4P9GA 5A7WA 1AR92 1U12A 1ULDA 3MHZA 2DURA 4LQRA 4FQZA 4XJAA 5C3SA 2I45A 2RDRA 4H7LA 4JQRA 4C8DA 4CPBA 1G9BA 2WS93 3WF0A 3AJYA 3IWZA 4AR2A 4E27A 4ZXEA 1YFUA 3A22A 2X5IA 1CR7A 5A6YA 3PTRB 3OBZA 2PELA 1MQTA 1REDA 3HN3A 2NPIA 4BISA 5GKAC 3VD4A 3AKQA 4QPIC 1LU2A 3MLLA 4L97A 1MQTC 1JTZX 3T3YA 3URFA 3NMBA 3FUQA 5FUIA 1TQ5A 4DOUA 1UYPA 4R9CA 1W28A 2BOIA 2CDPA 5FXVA 2CYFA 1QEXA 1H8TB 1DQ6A 4GWNA 4LBOA 5DUXA 4D7YA 4HVRA 2ILMA 3PJYA 1D0HA 1OURA 2VAUA 2Q4SA 2XBO2 1CPNA 1QY4A 3OBTA 3PMEA 4ONUA 1N1TA 3KHBA 3P5BA 2WQ4A 4IE4A 4PHZA 4Y1ZA 5SV8A 3KZ4C 1GLHA 3DL3A 5JR7B 1W6OA 4C1XA 3RYRA 2CNAA 1RUE1 2P17A 2PLV2 1XJAA 3USUA 4BQYA 5CISA 1FNYA 4DIQA 3D0SA 2AREA 3TBDA 4AI0A 2E26A 1AR81 2ES3A 4IGOA 1OF4A 1HB2A 4UWDA 2CHHA 3OF1A 3ZYIB 4CCCA 3HBZA 4NO4A 4FVVA 4ZU5A 4A4AA 1GSLA 4LBQA 2VTXA 2HWB1 5FY4A 2GH8A 1UMZA 4UAPA 1AYM2 4C0HA 1XQNA 1VBA2 3POGA 2A6ZA 2EXHA 1NE4A 2UWCA 3DPRA 4LKDA 2JDHA 3J7MA 1NA1A 4E2SA 3BCWA 4LOTA 5BNNC 1HJFA 5JZGB 4RQPA 1S0BA 1LU1A 1OHFA 2CGOA 4SBVA 2YBPA 1UZ0A 5FWEA 1GKBA 1HQWA 3VKFC 3VKNA 3AZWA 1RMU2 3B9CA 4W6WA 2GC0A 1LOFC 5CKNA 1RTVA 3NJZA 3WZ1A 4ASMB 1LOFA 4LUKA 2BNMA 4GJYA 3KM5A 1Y3TA 3LEIA 1OBNA 2R041 3M3OA 4BH9A 1OUXA 5FZMA 3VDDB 1VBE2 1AR63 3MI8A 1IKQA 4QMAA 5FZ3A 1KJLA 2WWSA 4YRDA 4K1ZA 2G9FA 2WN3A 3MDPA 4IE0A 1W3VA 2WNVA 3AYCA 5KC5A 3O1SA 3POIA 5D1IA 3ZFEA 4LBLA 2RDNA 3WQ7A 5BYNA 3DKQA 3VBOA 1H6YA 2R042 4DEVA 1UY2A 4XOGA 4QQOA 1HV0A 5EP9A 4BJ0A 5A6ZA 5FUNA 1BMV1 1RUD1 2C0ZA 3DECA 5LA1A 4XJWA 4D3WA 1OVSA 4KG8A 2BYVE 4ZHNA 1PO23 4Q4X1 2JEMA 1DYKA 2KM2A 1RJ8A 3FC0A 2MEV3 3GZTB 1E57A 3AFGA 4QD2A 1UZYA 5BNOB 3VZMA 1PX3A 3PLQA 4Q8KA 2IVIB 5HXMA 3FMGA 3PMSA 3VBSB 3RJRA 2FMYA 5A1AA 5F6KA 3MIHA 1W99A 1I5PA 3LZZA 2XJVA 3AMHA 3MUZ1 5K7PA 2MEV2 2A3YA 4W50A 1ZRIA 3GXUA 4LK6A 1IPKA 3VBUA 5C3QA 2VPVA 1JYXA 1SBEA 1OXCA 4ZU4A 3WG1A 5AC93 2VCBA 5IK4A 3VZJA 4GULA 1FV3A 4EWAA 5J7MA 3J8F3 5BNQA 4MLOA 1K3IA 5FP8A 2DBNA 4LLOA 2GC1A 4JKKA 2WDBA 1VBC3 4KL1A 2JIJA 2D6KA 2W1UA 2HEYF 1A8DA 3Q8EA 1XOYA 1KQRA 5FYIA 3ZXKA 4YFZA 3FWEA 3LF7A 2SBAA 3P1IA 2R7EB 2WT1A 1CVNA 3EBRA 1JMUB 5FMOL 1YFXA 3Q8FA 4W65A 5C8CC 2VMFA 1PO21 1DQ2A 4NHXA 2R30A 3OG2A 2XJRA 5A1FA 4P5YA 1PX4A 2OQ6A 2XBO3 2ZJCA 3O12A 4NPLA 1PHMA 1PIV2 1BEV1 3C7OA 3NNFA 3P3NA 3RQ0A 4EYUA 1W6NB 2YFZA 5A3MA 1FNZA 1XNTA 1RUJ2 2VE1A 1Q56A 3U4SA 2D3PA 1KXGA 2CGNA 4IV3A 4DRRA 4OQ8A 3I2IA 3ILFA 3C7EA 4RR3A 4EN7B 2ZHMA 3NKGA 1HXS3 1AR61 3MIEA 1QQP1 2D97A 5F5AA 1NX9A 4GXLA 2X09A 3OTFA 4KU7A 2ET1A 3NAPB 2AACA 1SFPA 1DF0A 1ENSA 2O0OA 2PYTA 2XQRA 3H7YA 3H3LA 2XR4A 1J83A 1W05A 3ZR6A 1W6PA 2OPKA 1PM7A 3BGAA 4CP9A 3FLPA 2AR6A 4AG4A 4CE8A 2UURA 4XHBA 3B93A 5CIRA 4Q0UA 3THPA 4FPGA 2GSYA 1X36A 2DVFA 2C5DA 2E6VA 1KITA 2YMZA 4XUNA 4YGCA 3O0WA 3FUOA 3ZN6B 3H1MA 2GNMA 1ZRRA 4LR4A 3ZOIA 2QZ2A 3RWNA 3V65A 1AR82 4AI2A 2V73A 3K46A 1V70A 5FBZA 5JMCA 1J3QA 2FDKA 1PVC2 2C9AA 2VXJA 4XJ8A 2Q8DA 1H1AA 5F3CA 5JI9A 1QJFA 5AFEA 2AC1A 2H6CA 4YWAA 2UYAA 1QWRA 4Z82A 5FV3A 5FZLA 4XHXA 1ZBA2 2W1WA 2FMDA 1V6LA 3AMNA 2IFWA 3HMYA 5J1XA 4Q4Y2 5A1LA 1FX5A 3C7GA 1DGLA 1GOGA 2XJUA 2VZSA 3WXPA 4CA9A 4NIGA 2RM23 4K7JA 4YZ1A 1DQ4A 1RUF2 4PLNA 1I3HA 3GJBA 2FCTA 3FLRA 1GUIA 5FK8A 3DKWA 2NMNA 1KFUL 4LEJA 5FXWA 4AZZA 3T0BA 1SLBA 3OD4A 5F6LB 4BA6A 4P9WA 1QH6A 4UW6A 4AHXA 1NCRA 4P9YA 3WDYA 3TAYA 1QJEA 1MR5A 4GALA 1JS9A 4KWUA 4AEKA 2FCUA 5LA2A 4FAHA 4IGPA 2A1XA 5BNNB 3O1VA 1ZZ7A 2BQPA 3T08A 3UGHA 2B8MA 1PGW1 3AL6A 5EJZB 4YZ2A 3OUHA 5A70A 3I2GA 4Y1UA 3MV01 3WDVA 1WGPA 4EZ4A 3EO6A 1C8M2 1F31A 2G4IA 4UI9L 2WZEA 3INAA 2F4LA 4Y1VA 3W59A 1J3PA 5LRSA 5FOJB 4ZXKA 4UFIA 1UO9A 2A6XA 2EIEA 3HPNA 4COVA 5FZ1A 1WMEA 1H8TA 1XE8A 3NNMA 3OPWA 1BBT3 2WYFA 4FP2A 2BGPA 5DZFA 3B7MA 3RRDA 3N9OA 3SHRA 2RM21 1AX1A 1BBT1 1HIXA 1SCSA 4BB3A 4L9BA 1KJRA 1O3TA 4YW3A 1UZZA 1COV3 4LOSA 4Q4V1 5FMOS 1Q8QA 5I0RA 1D7PM 1W06A 4Q1PA 4S2DA 1PMJX 2PXJA 4K8FA 4IETA 2RDSA 3PVNA 2R32A 3WP4A 4CDXB 1AR62 5FIXA 4N8MA 4L8QA 3KV6A 4MYEA 2AENA 2W1SA 3D4KA 4KG0A 2VMCA 5LK5A 4A7KA 1UF2C 1QXRA 4Q26A 4K8RB 2VMEA 4OCTA 1DGWX 5E6HA 3NNGA 5C7GA 3FBMA 1UIKA 3KGZA 5FZFA 4QPWA 5J3UA 1CZSA 2ZGPA 2QJVA 4Q1RA 3APBA 3AKRA 1YQ8A 3BUCA 4B7KA 3N35A 1V6JA 4QX8A 1UYXA 2WIIB 4WZCA 1UU4A 4MXWA 3THTA 2Y34A 4YGBA 2LTNA 1A3KA 2ZX2A 3NO8A 1AYN1 1X9TA 4QX7A 4AVVA 4KGGA 2CWSA 1UQXA 2HBTA 2V4VA 5F2SA 1UOJA 2VVFA 4JDOA 5APAA 4QXHA 5CA6A 3AP9A 1NUKA 3B3QE 4KWLA 4PCRA 2X8KA 4OUSA 2RS12 1BKZA 4O9GA 5FMDA 4EN6B 5LK7B 3N7LA 2ID4A 1U5YA 2A7AA 3DUIA 1FMD1 1RUH1 3E5QA 1LEDA 2VZRA 2IXKA 3BPZA 1N3PA 1QQP2 5H9PA 1R081 3AP5A 4CP1A 1IHMA 2HLEA 2XUEA 3VUOA 2W0XA 4HKOA 4I0BA 4M0HA 3FFQA 1X33A 4OULA 4A45A 1V6KA 4TYSA 2J1SA 1PK6A 5FZ4A 2OUJA 2QKDA 3FZ3A 5C9AB 1AZDA 1HQLA 2VQ0A 3VD9A 2K9ZA 4CDQC 3BYWA 5AVPA 3WNLA 1STMA 1E5SA 5JPNB 4YM0A 4OI4A 2VZUA 5F3EA 5A33A 2O14A 3RDIA 4RFT0 2EA7A 4UFLA 4YM1A 3KVAA 4UW3A 3HAGA 1Z7S1 4IV1C 4LO7A 4TLGA 5ABJC 2OIIA 4IGQA 2GNDA 4C90A 3GALA 1ZZCA 4BOWA 3GNEA 3PUQA 3POBA 2HWC1 1R1A2 5FYBA 3TYJA 1IS6A 2EAKA 2WO1A 2YC4A 3PJQA 3PUSA 4HPKB 1JU4A 1I5ZA 1G9FA 1SHWB 3ZDVA 4OI2A 1ASJ2 4B29A 1JZ4A 1ENXA 4NPMA 4CCLA 4CDXC 2AEYA 3F2ZA 1Y9GA 4X8NA 3I2OA 2QQWA 5FPXA 2JE8A 1CIWA 3A0NA 1TME3 2FDJA 4Q0VA 1T2XA 1C5IA 4IW3A 5BNPA 3M70A 4DS0A 1VBC1 4UFJA 1IKPA 5LY2A 5JR2A 1UOBA 3WD5A 4EE2A
chains in the Genus database with same CATH topology
1RUD2 1NY72 4WM8B 4WVVA 3TNQA 2DU1A 4AFDA 5C4WA 1LCLA 4N43C 4QM9A 2VMIA 1MZ5A 4TSVA 5DUVA 4J1XA 3WP5A 2HWD1 5C4WC 3WP3A 1FMD3 3LB9A 1Z7S2 4R4XA 1SLAA 2QE3A 2D5HA 3L2YA 2WT2A 5CFCB 1IGOA 4PDWB 1RUF3 5KHHA 1C28A 4K21A 2R072 1RUC2 3H1YA 1A6CA 3H3ZA 5C8CB 1LTEA 3SLIA 1YHFA 1AF9A 1RUE2 3S6PA 5HCFA 3NAPA 1JHNA 1ZZ9A 1POV1 4L99A 1OKQA 2XBO1 4OHYA 1EYBA 1YJLA 4M3CB 2DYCA 2W52A 3VDDA 1GICA 3VZKA 4AHYA 4XMAA 3KMHA 4FPCA 2KA3A 2HEWF 4RD7A 3UKNA 2BNNA 4FO9A 4LHKA 3WVJA 4OHXA 4Q4W2 1LJ7A 4V1PA 1QJY1 1QJX3 2QVSB 3SCGA 4YG6A 3WR0A 5JVVA 3ZSEA 3HD8B 5BNOC 4GIQA 3IPVB 1QU0A 2W08A 4IV1B 5KHGA 1F8VA 5JWPA 1ZA4A 4BM8A 1YIPA 1DZQA 4FPEA 4XDQA 1OA2A 5AFBA 5D8AB 1AR93 3ZMNA 5H9RA 4O9EA 4YGEA 4AEMA 1YFWA 4GB33 3VLBB 1ZREA 2DFBA 3CLPA 2Y38A 3ZXAC 4XXAA 3WQ1A 2ZGMA 4R8HA 2PAKA 2WA4A 1K5MA 4AGVA 5T5JA 2DWRA 4WM8C 1DQ1A 3AZVA 4FOYA 3IT8A 4KQ7A 5T52A 4YGDA 4BZ4A 2ZCWA 4YNIA 2ZMNA 4Q4X3 5H9QA 2CAUA 5T5OA 1KRIA 5CNAA 5JZGC 2WFF2 5K0UC 1C3HA 1TE1B 5GZEA 4QPYA 4AEDB 1NQJA 4M01A 2WFF3 1IOAA 1LGCA 5KWRA 3MIGA 4Y22B 4INDA 1MEC3 1WW6A 3D0JA 2PHDA 3MLKA 5I93A 3VL9A 3NL1A 2P2KA 5F5QA 4WZFA 1UD1A 4IEZA 1MVEA 1RHI2 1LENA 4P5HA 1RUF1 4L2NA 1ZZ6A 3ZN6A 3PVEA 3MW4A 1DZRA 5JOWA 1LOCA 2VUAA 1CAUA 1HW5A 3RPQA 4XFCA 2WKKA 1HRV2 4JC1A 5JDBA 2CTVA 3CL1A 3WG4A 1ZBA1 2XLAA 2ZGUA 3ROUA 1H9WA 2RS32 5I0UA 1MS1A 3B00A 3KT1A 1H0BA 1KDKA 3POYA 2JE7A 4CEYA 3WUDA 5HBAA 3JD71 5FTTC 3M3IA 4K6BA 1ZZ8A 4FPHA 1YWKA 2ZX1A 1XXNA 4XEZA 4AVCA 4P14A 3M3EA 4XTMA 2ZGKA 4X6RB 2GAUA 2HWB3 3BOWA 1HXS1 3LA3A 1AL22 3GYDA 2A70A 4M3CF 3SXWA 1XNDA 3GBGA 3RS6A 3AB0A 2KXLA 4H3WA 1RUG2 3N36A 1ZRDA 1BJQA 1O5UA 2DVBA 4PIZA 2HEVF 1Z7S3 4LBQB 1WLDA 1C8M3 1UU5A 4JGZA 4XJ9A 1AJOA 3LOIA 1LESA 1SLIA 3CJIA 3U0ZA 2JECA 4FT8A 3IN9A 2PHRA 1BEV2 4YZ5A 1O3SA 5T54A 1COV2 3VBRB 1XE7A 1MZEA 3E6BA 1W6NA 1YO8A 2WS92 2E7QA 4DRVA 4JTNA 4RQPB 3KCCA 1O4TA 1GR3A 4RGAA 1UPSA 3KD4A 1G9AA 2IXCA 2EXJA 1FXZA 2F6BA 3RI9A 1GZWB 4AVSA 1OMIA 1RVF3 4CDWC 4RS5C 4GMP0 2XL9A 3OBRA 4QU2A 4RS5B 1W6PB 3ZYRA 1JYIA 4GQ7A 5C6CA 2WS91 3BOPA 1AR72 2VGDA 3U10A 5HCAA 4Q4W3 2MEV1 5GZGA 3GZAA 4NVPA 1H4HA 5CB7A 1C1LA 5GZCA 5C4WB 1SMVA 1FV2A 3UJOA 3TN92 2D6MA 1O3QA 1AXKA 5I8SA 5JOYA 2ZZQA 2E53A 2IZWA 4AGGA 4AFBA 1VBA1 1MZFA 3K51A 4AHZA 2QCSB 4NOTA 4LHNA 2ZS6B 4EN9B 1PGL2 1YNAA 4COYA 5K0UB 4YVSA 2R0HA 1RGSA 4NN0A 3ZXFA 2WZR1 3HT2A 1JH5A 3BIWE 3ZSKA 2RHPA 4NHLA 3HR9A 3SITA 4AI3A 2BPA2 4XXPA 4CYDA 2VXRA 2Q1MA 3QBQA 5EYYA 1D0GA 4JGYA 4XPVA 5EZWA 4XFIA 4QPIA 4WM7A 2F4PA 3MPPG 5GZFA 4FOQA 4HK9A 4XJZA 4WM7C 4P9LA 4ASLA 3A4UA 4AFMA 4GKYA 3V0AB 1HRI2 4CDUA 1RUH2 2VMHA 3DV8A 4MGYE 3AK0A 4HN1A 2WZPP 1CQ9A 1SLTA 3FFZA 1WA4A 2HWB2 1HXS2 4MVTA 3ZPYA 2QDRA 1IS3A 1I6XA 2JICA 5CG8A 5GLUA 1OA4A 2I07B 4YYOA 2XL7A 1Q8SA 4YARA 4DFSA 2EF6A 3MFCA 1Q3EA 1AUYA 2WJSA 3ILNA 3UJQA 4LBNA 4IESA 4IEPA 4CTEA 4D94A 2D6LX 3VL8A 1QNWA 4FBFA 2PFWA 1WUVA 3JUUA 1O7FA 3H8UA 1YI9A 1VBD3 3SISA 4IQPA 1PK6C 4G3YC 5D8AC 2A6VA 4PIYA 5K9YA 1F2NA 4IEOA 3WINE 1A78A 2E7AA 3HIFA 1QDCA 3JCIA 4XBNA 4YZ3A 1BYHA 1NA1C 5BNNA 4N90A 5DZGA 1RUE3 5L73A 1VLNA 1DU3D 4AW7A 2Q1ZB 2RM22 2R16A 4AQSA 2RE9A 5KHIA 1XNCA 4NWWA 4AEDA 1SLLA 4EWEA 2NMOA 5BV6A 3OY8A 4E4ZA 2ERFA 2XGXA 2SLIA 3MIDA 4QQLA 5SV5A 4NHKA 3DF0A 2WINB 4E4DX 1ND3C 4LULA 5GZDA 1ND3B 1NYWA 3M8LA 3UKTA 4AVTA 4Z1VA 4J1WA 1ENRA 4Q0SA 2YDEA 1CAUB 5GLVA 1Y43B 4FPKA 4LA3A 1VRH2 3JBG2 1V9U3 4JGZC 4WV8A 3VHRA 1V6OA 5F1RA 1U5IA 4AI1A 2Q5TA 1RJ7A 3TRSB 3OD0A 1CAWA 4P9XA 4OI1A 1XYNA 1AR83 1B35C 3N7KA 1WBLA 4PLOA 1D2SA 2HWE1 2AUYA 2UWAA 3OCPA 4B7EA 1R091 1DZTA 3RI8A 1HLCA 4QX5A 5AVAA 1S0FA 4AF9A 1KDMA 3ELNA 1CONA 3V0BA 5BNPB 4WBBA 5FO8B 2AH2A 2XKOA 4N53A 1VR3A 4FPLA 3OPZA 3TOJA 1ULGA 3L2HA 5BPXA 5E89A 4D7TA 1G9CA 2B39A 3OJBA 2HWF1 1V6MA 1G6NA 3H0OA 2ZHNA 2BGCA 1VB4A 2PLV3 4XF0A 3WHTA 1UPIA 4LLFA 4EN8B 3QOPA 1KS5A 4LUMA 5CFCA 4XJUA 2UU8A 5FOBB 2XLGA 3O0VA 5J36A 4ZU7A 3LA2A 3M3CA 1CX4A 2HWE3 2WNEA 3ME2A 1FOD1 5DZEA 3T1LA 4Y20A 3WW4A 1ASJ1 2JG9A 3AJZA 2BVVA 3WQ0A 2JG9C 4K3UA 2GZWA 1NLRA 1Y7BA 3AZYA 1M06G 4HBNA 1Q8OA 1VJ2A 1OPMA 2HWD2 4KBBA 1PGL1 1YUDA 3ZXLA 4LTAA 3EHKA 3B5LB 1FPN3 2UWBA 2IXHA 2YC0A 4N7UA 3W9AA 4AEJA 3ZFFA 2YGLA 5A32B 4DZGA 1JXNA 1MVQA 2GN7A 3I59B 4HVOA 1WLWA 1KD7A 2GMMA 2BBVA 4HLTA 4YG0A 1MS9A 4XW3A 5AC92 4FQ4A 3ZFEB 2QDNA 4R52A 2A3XA 2AZ5A 1AX0A 4IEXA 1ASJ3 4MXWB 4DQAA 4DXZA 2WA3A 3KSCA 1EAH3 1AL23 1AYN3 3VZLA 2DCYA 5E1RA 3ZYJB 2ZX3A 3JD73 1S0JA 5LEJA 5FQ0A 4F83A 1RC6A 1U5XA 1NCQA 1EAH2 3LOBA 4B4RA 5FDBA 3LGRA 2Z5WA 3IIAA 4XF3A 4PF5A 2BUKA 1VRH3 4BCUA 1OOPA 2ZA9A 1LULA 4WVMB 4FTSA 1YCIA 1LHUA 1PZ8A 4M3CA 3GBWA 2NQYA 1MS8A 4JDNA 1ZRFA 1PK6B 1DFQA 1XNBA 3KB5A 3KCYA 2RS31 4WVZA 1MZ6A 1FOD2 5I91A 4PDWA 5C9AC 4I09A 4RQPC 3AXDA 3ZXJA 5JI7A 4PDWC 3FHIB 2GNBA 4BLIA 5C8CA 4OZXA 4LO5B 2VW2A 1QJU3 3LSDA 4QQ2A 1ULEA 1EV11 2JG8A 4ES9A 4KWJA 1DIWA 4Y22A 1QHDA 4CZSA 5ABJA 1RUNA 2VOKA 2MNGA 2Z2SB 3P3PA 4XZPA 4RSUA 5T50A 5HI0A 3ZVXA 1JN2P 1RUJ3 4HPKA 4BMEA 5BUVA 4HETA 3ZXGA 4XIKA 3MZHA 1R093 1WW7A 3R6SA 3ZFEC 1C8M1 1POV3 2JE9A 1SBFA 1W6MA 4S2GA 1QJX2 2R6QA 3RMXA 2RR12 4XQ4A 1PNFA 1VBD1 1QF3A 1X50A 5KHJA 4QGMA 2ZGQA 1C1FA 1F5JA 1NQDA 4NPRA 4AQ2A 1GQHA 3WT3A 2N7GA 1ENQA 2I74A 4FXGB 1AXYA 4HK8A 1C5HA 1U5ZA 2VUJA 3ZYPA 4Q29A 4BMBA 1OPOA 2RMU1 3WDTA 2UY9A 1PIV3 1SFNA 3J4UH 1GANA 4Q4Y1 1BXHA 3ALQA 1VIWB 3FBYA 2FBEA 1BVVA 1R1A3 2WSUA 2JX9A 5E88A 1ZBA3 2A6WA 2EXIA 1TME1 5FLJA 1I1EA 1EPZA 2NM1A 3HT1A 3E6DA 4PQ9A 4UW5A 4WM7B 3FLTA 3HQXA 1PGW2 4XIOA 1TME2 3J9SA 2DCTA 1UU6A 1BQPA 3NV2A 4KH9A 1SACA 2QZ3A 2HWC3 3IDBB 1QDOA 3K48A 5ACA2 1GBGA 4RA0A 3WW1A 2CGPA 5CADA 1HRI1 1VP6A 2QFEA 3MF6A 4UXAA 3PHMA 1AHSA 1GZWA 2E9QA 5CFDB 2XJTA 2CWMA 4A7YA 5FO9B 4CEWB 4MUVA 2XH6A 2PHXA 3CU7A 1QH7A 1OFSA 1IS5A 5GM0A 1UKRA 1UKGA 2ZMLA 3JU9A 4PBPA 4IEVA 4EV0A 1OLQA 2GC3A 2XPJA 4D69A 1VBD2 1N1SA 1PVC1 1F9KA 1IPJA 1NOVA 1W0PA 4A7ZA 2K0GA 1QJY3 2ATFA 4BIFA 1Z0HA 2XKPA 3WDXA 4DY5A 1ULCA 3ZIXA 2NLRA 2TBVA 4Z8BA 2B46X 2A75A 2VW1A 1RUI2 3AMMA 3RNSA 4WM8A 2R061 2QQPA 3E5UA 4MGIE 2VNOA 1ZBE2 5A3LA 3J8F2 3VHOA 1URXA 2IXJA 1H8VA 1RVF2 5GLTA 4GWMA 4TLFA 5K0UA 3WY6A 3JQXA 5KXDA 4IL7A 1NE6A 3FE5A 4META 2UYBA 2R1DA 2WT0A 1PMIA 3KT4A 4OHVA 3MIBA 1LHWA 1OD5A 1C4RA 4L11A 3LCPA 4C1WA 4MXVA 5EXOA 2JXAA 3MW2A 4HL0A 4JGYB 4AVBA 4R9AA 4FSJA 4I0WB 2A6YA 3M7AA 1FOD3 2AYHA 4JGZB 1GNHA 2ZGLA 2Y0OA 4YM2A 2ZX0A 4F3JA 1RHI3 4HMZA 1LR5A 3NV1A 3CNAA 4EN0A 1DQ5A 3OYWA 4YW4A 1H9PA 2D3RA 3WCSA 2PHTA 1W0OA 4OFGA 1RINA 4XFBA 4AK3A 2B5HA 1H2KA 1TMF1 4WVWA 4YFWA 2X53S 2WNUC 4QHBA 3ZN4A 4F8AA 2HWD3 2WNUB 1R082 1VBE3 3RZZA 4Z07A 1OOPB 1SDWA 1RVF1 4AFCA 1N3QA 1AL21 1G7YA 2I2SA 1CN1A 2BNOA 1ONAA 4AXOA 4QPGA 5L7OA 2HWC2 5ACA3 5BNPC 2E51A 2DV9A 1RUI1 1S0GA 3LKJA 1PNGA 4QGLA 1BVP1 5C33A 1RUG3 2BFUL 3ZFGC 3ZSJA 1ZX5A 2B7YA 4LE4A 3MIFA 2ZACA 3ES4A 1CGPA 3ZFGA 3TWIA 1MACA 3QH7A 1COV1 4YVWB 3ZX7A 4LE3A 4HKWA 3VBRA 4UBGA 4X8PA 2Q8OA 1RMU3 3KS7A 4J6GA 4CDQB 1S1AA 4XFHA 1LOAA 4XYXA 1XYOA 4XQWA 2JJ6A 3R4DB 1Q8PA 3V0BB 4FPFA 2H6BA 2WLQA 3JBG1 3ZO0B 1N3OA 4BWOA 2HWF2 4QPIB 2RJKA 1ZBE1 4K40A 4R4ZA 3UV9A 4OUMA 3H1WA 4KWKA 3ZXEA 4ITCA 3AFKA 3WV6A 5KHKA 3GHMA 4MGKE 3VBFA 2PHFA 1OA3A 1CAWB 1MEC1 2D6OX 2RMU3 3VBHB 2R0FA 4LO4B 2B45X 5JCTA 1AJKA 2D6PA 1Z78A 1S2BA 1H4GA 4HVQA 4ZKTB 1RB8G 1LGBA 2Z42A 1Q8VA 2DCKA 2FZ1A 1NCQB 4CEYB 4Q4V3 4XMIA 2TEPA 4SLIA 4N9HA 4ES8A 2HKXA 2HYKA 2RS51 1REFA 4XE9A 5BY5A 2ZABA 3L9JT 4ISRA 3I8TA 3V64A 4WVMA 2OUHA 4Y1XA 1GFF2 4YLZA 2XB6C 1S0CA 1NXMA 1YJKA 3M4FA 1OFNA 1SCRA 4GB31 1BZWA 5T5PA 4N43B 2IXIA 1DGWA 3O5SA 3AX4A 1NZCA 1AR91 2ZOEB 4GH4A 2PTMA 3ES1A 4YW2A 4C91A 2D44A 4HZFA 5HCBA 2D3SA 5L19A 2WSVA 5IK7A 1ZNPA 3B9IA 4LNVA 5CVRA 1GYKA 3ETQA 5FRAA 2MHFA 1POV0 3EJKA 1RUH3 1EY2A 3NV3A 2BW8A 4IEWA 4RGGA 2RS33 4XBQA 2K2SA 2OW4A 2WZR3 1W2UA 3FJSA 4BLJA 5JSRA 2IFRA