5L73A

Mam domain of human neuropilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
b'QDEFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-1
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal Structure of the Neuropilin-1 MAM Domain: Completing the Neuropilin-1 Ectodomain Picture.
pubmed doi rcsb
total genus 34
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l73A00
4YG3A 4XYXA 1I1EA 1FV3A 3T1MA 3WOGA 1SLIA 4YM0A 3AP5A 1AXZA 3BIWE 4Q26A 1IS3A 1UL9A 3ASIA 1MS1A 2CWMA 2GNDA 2ERFA 1UKGA 1LGBA 3RG0A 4GALA 4NO4A 2EAKA 3AZVA 1N1VA 2A75A 3AP7A 3POSA 4Y1YA 4M3CA 1SACA 2CTVA 4Y22B 1GNZA 2LTNA 2ZHKA 2ZMLA 2GMMA 1GZCA 1LOFA 1ENSA 5CBLA 1F9KA 2DV9A 4FPGA 4R9BA 2W68A 1AJKA 1OKQA 3RRDA 1S0IA 3AYAA 2NYYA 3SLIA 2YY1A 1W6NB 3VKOA 2AENA 5T5LA 1UPSA 2PELA 4XJWA 3VKLA 3VV1A 1GZWB 4PF5A 4XHXA 2DVAA 2A6YA 1SFYA 3WDVA 2VU9A 4K1YA 4H55A 1W6NA 2LALA 1JHNA 2P3IA 4GKYA 3ZXKA 4YM1A 1LESA 5AVAA 3ZXFA 3JU9A 2D6NA 3FFZA 1WLWA 3T2TA 3WDUA 3BODA 5IK8A 4C1WA 2D6MA 1LOFC 1LEDA 3TB0A 3ZSMA 1VIWB 4ISRA 3SISA 4AGRA 3AFKA 3DUIA 1QMJA 2A5ZA 2ZABA 1WLCA 3KM5A 4YW3A 1DQ5A 1Y7BA 2DU0A 2DYCA 1LGCA 3WG4A 5HCAA 3FUQA 2W52A 1WUVA 1SBFA 2GALA 2ENRA 5H9PA 5JMCA 4XDQA 1S0CA 1A8DA 2ZACA 4NOTA 2JKBA 3WG2A 1DGLA 5DUXA 2A3XA 1UX6A 3OBTA 1H9WA 2WSUA 1D2SA 4DS0A 4ZKTB 3WG3A 3LSEA 1JYIA 3IMNA 5EYXA 1S0JA 4M3CB 1N3PA 1G8WA 1Z0HA 3ILRA 3SH3A 3O0XA 1YXWA 3D5OA 4XJUA 1AXKA 1GSLA 4AVVA 1LTEA 2ZGMA 2GN7A 3MEPA 4XTPA 4XOGA 2C9AA 5T50A 1S0EA 2ZKNA 1KQRA 5KXDA 2GMPA 1LHUA 4YG0A 5GALA 5JOXA 3GNEA 3NV2A 3AZWA 3I8TA 3ZXEA 2VUAA 1QNYA 2A3WA 1BQPA 3SITA 2GNTA 1SBEA 2DUPA 1LOCA 2ZZJA 1DYKA 2NZ9A 4XJAA 1YIFA 2ZMNA 1JXNA 4K1ZA 4XMAA 1Q8QA 3VKMA 3C2UA 4LBQA 1PZ8A 2DURA 2ZHLA 5GZGA 1QDOA 1WBLA 3IKWA 4R9AA 1SLLA 1IKPA 4XJ9A 3ILNA 2ZMKA 1AZDA 1O4YA 1BKZA 1W6MB 1N47A 2ZGSA 4L8QA 1G9FA 4PQ9A 5CB7A 1W6OB 4P9XA 1MS5A 5JOZA 1SLBA 3OY8A 5GLZA 2EIGA 2D44A 3VUOA 2GDFA 3N3HA 4UW3A 1AX1A 4FPKA 4XBQA 5GLWA 3TAYA 1FX5A 1S1AA 1ONAA 3LSDA 3WG1A 2JJ6A 4UW4A 3V0BB 1UZYA 3GALA 3MW3A 3ILFA 2ZHMA 1X50A 2D6KA 2XG3A 1RINA 4AVTA 2OW4A 1YO8A 5EWSA 1DQ4A 3N7JA 3ZVXA 3AXEA 1N1SA 3OBRA 4CTEA 4Y1ZA 3B69A 1MVEA 2NN8A 5GLVA 2DVGA 4IQPA 4FPJA 3OJBA 3ZSJA 3V0BA 1ENRA 2UURA 3ZPYA 2CNAA 1VAMA 4GKXA 4D69A 4Y1XA 1WW4A 2WSVA 4LBOA 1D0HA 3RMXA 1CONA 1LU2A 1AF9A 3POYA 1AX0A 1URXA 1WLDA 1MACA 2G4IA 1CN1A 3IPVB 3UK9A 2YXSA 4ATFA 1S0FA 2P37A 2OUHA 4U36A 2R1BA 1GKBA 1LENA 3ZSKA 2JD4A 2WLQA 1JUIA 4LBJA 4LBQB 4XIOA 1G9AA 2D6PA 3AYDA 1BZWA 4WV8A 2B7YA 3WDXA 1W6PA 2DTWA 2A71A 3BOPA 4TYSA 1LEMA 3V0AB 2SBAA 1LGNA 1JN2P 1U0AA 4FP3A 4R9DA 5L73A 1H30A 1LJ7A 2E53A 3WNXA 1SCSA 4F83A 4XXAA 3L2YA 2AREA 1A78A 1C57A 1DQ1A 1ZA4A 3M3EA 1MS8A 4M3CE 4XXPA 3HR9A 3NV4A 1FAYA 2CL2A 2JDZA 1Q8VA 1Q8SA 4RA0A 1DQ0A 1ZM1A 1QOSA 2A70A 2SLIA 4WZFA 3WHTA 1CVNA 5EXOA 4FPYA 3CNAA 2A6XA 4XHBA 5F5QA 3VKFC 1Q56A 1LODA 1DQ6A 1V00A 1DHKB 4AGGA 2AYHA 1WD4A 1Z78A 2D3PA 2XB6C 1R1ZA 3UL2A 1KRIA 2R16A 1LOBA 3JUUA 4XZPA 1ULDA 2P3KA 3KQRA 2PHRA 1YRZA 2YV8A 3W59A 2YZ4A 1DYPA 4TZDA 3N35A 3IPVA 1SLTA 5DUVA 2NMNA 4Y20B 2C5DA 3ZSLA 1BYHA 1EPWA 5HCBA 1MVQA 1WW7A 1V6LA 2ZBJA 5CA6A 4FOVA 4UW5A 4XBLA 1TEIA 1F31A 1QOOA 2UWAA 3N7LA 4LBKA 1W6QA 3AJZA 3A4UA 4AGVA 4LBMA 2D43A 1Q8PA 5DUUA 3W58A 4PBPA 1HQLA 4GWNA 3WUDA 2R0FA 4XE9A 4M01A 4DRRA 4PBOA 4GWMA 4K21A 4FQZA 1MZ6A 1JBCA 4HL0A 5T5OA 4DQAA 5KXBA 2KM2A 4FOQA 2A3YA 1SBDA 2E7QA 5GJ6A 1G86A 2ZGRA 3O0WA 3PVNA 3U4XA 2DUOA 1NLSA 3B00A 4XMIA 4Y1VA 4FP2A 1RITA 3OPZA 4YFZA 3WHUA 2E51A 2VXRA 2WT0A 4BLIA 2YMZA 4ITCA 4Q27A 5JVVA 1IKQA 1GZ9A 5JOYA 1G9BA 3N36A 1WCSA 1SLAA 5JLVA 3A0NA 1WW6A 5HCFA 3R4SA 1C4RA 5GLTA 4RL7A 1G9DA 2V73A 1B09A 2JE9A 1QU0A 4AWDA 1KJRA 2PHTA 1LOEA 3UJQA 4CRQA 5F9TA 1LHWA 2JECA 2VW2A 3FLTA 1GANA 2Z42A 5E88A 2EXHA 3ATGA 1HQWA 4Q8LA 1O4ZA 2A7AA 5H9SA 3I4IA 1GZWA 4YGCA 4YZ5A 4W65A 4BOWA 2YROA 3HMYA 4YZ3A 2AH2A 3LCPA 2P3JA 1LOAA 5IK4A 1LOGA 1FNZA 5GZFA 2DVFA 1S0BA 2ZGQA 2ZGPA 5KXEA 3PVEA 5GM0A 5DZGA 5LK5A 2ZGKA 3ZYPA 5DZEA 5IK5A 3WUCA 3OYWA 1UZZA 1APNA 2VW1A 5SV8A 2FMDA 4FQ4A 5T52A 2V5YA 1KDMA 3RSJA 4FPHA 4Q1RA 1YYNA 3INAA 3QLQA 1BXHA 2DU1A 2PHWA 1DFQA 1UN1A 1QNWA 3A0KA 2NP0A 1S0DA 1QF3A 1W0PA 3FUOA 2ZHNA 3BTAA 3AZXA 3AXDA 3AYCA 3MW2A 5DUWA 5DXDA 5FREA 2WQZC 3QCWA 4YZ4A 1MS3A 1G7YA 4XTMA 5GZCA 3WDWA 1QOTA 1WD3A 4XJZA 1FNYA 1CQ9A 2ZA9A 5CNAA 1V6JA 5GLUA 4FPEA 4YLZA 1V6MA 3AP6A 4Q2FA 1SCRA 3MW4A 1CR7A 1HLCA 4YM3A 4M00A 1IS5A 3IN9A 1GV9A 5DG2A 1UMZA 4OZXA 3FBYA 2DVDA 1CPMA 4KBBA 4XILA 1ULCA 1W6MA 1W6QB 3AK0A 5IK7A 5E8AA 1QDCA 2WNEA 5T5JA 4M3CF 1VLNA 4Y1UA 3T1LA 1OQ1A 1MS4A 1FV2A 2GNBA 3OGGA 1KITA 4P9WA 1PZ7A 1LECA 2CY6A 4Y20A 3D6EA 4YW2A 3B3QE 2W39A 3AJYA 4XIKA 4BMBA 2AUYA 4JCKA 4XBNA 3V65A 3WCSA 4YM2A 2NM1A 5GZDA 1V6OA 2EXJA 5GZEA 3NWKA 1DZQA 3ZYRA 1ULEA 1IS6A 4LBLA 2H0BA 1V6IA 5H9RA 1IOAA 3SH4A 2D3RA 1DQ2A 1VALA 5T55A 4Z8BA 2ZGTA 5T54A 3WDTA 3WZ1A 4AYUA 1PZ9A 2GN3A 4YW5A 4ZXKA 2E7TA 3D4KA 3O12A 5KXCA 2ARXA 1CPNA 1AJOA 3FLPA 3IM0A 2WT2A 1FATA 4YG6A 3HN1A 2OVUA 1QGLA 1HKDA 1IS4A 3O0VA 4XJ8A 3MPPG 4C1XA 2BQPA 4AVSA 1WBFA 2DWRA 3PVOA 4JRAA 3RS6A 1N1TA 4GXLA 2ZGNA 1ENQA 2GNMA 1YI7A 2A6WA 3B9CA 1NXD1 2ZAAA 5JDBA 2WJSA 4Q1PA 4YGBA 1I3HA 1G9CA 3V0AA 1GBGA 2VH9A 3OYWB 1KDKA 4BMEA 1LHNA 3APBA 3AZZA 1F5FA 2R1DA 1LULA 3M3CA 4FVVA 1LHOA 2D3SA 3FLRA 3M2MA 4I30A 1JOJA 5H9QA 2DTYA 1J1TA 4BM8A 1GNHA 3WVJA 2VW0A 2I2SA 1N1YA 4K20A 1LU1A 3SNMA 4LBQD 5BYNA 1H9PA 1Q8OA 4YZ1A 3V64A 3ZXJA 1QKQA 2D6OX 1OFSA 2AR6A 5EYYA 3AP9A 1CIWA 1VAVA 2EALA 2R49A 4FPFA 2ZGOA 4R9CA 2W08A 2ZGLA 4ATEA 4FOWA 2HYKA 3AX4A 3WLUA 4BQ1A 5DZFA 3M3QA 4P14A 1FYUA 2E6VA 2P34A 3AZYA 4YGDA 4Q8KA 3O5SA 4JC1A 1LCLA 1C1LA 5E89A 2EXKA 2FHRA 4HANA 3SH5A 3NV1A 1XQNA 2OUJA 4SLIA 1ULFA 4YFWA 1UAIA 4CZSA 1SLCA 3VKNA 2D6LX 2P2KA 4BLJA 1JYCA 4MYEA 3RQ0A 2UU8A 5FRAA 4ASMB 4YZ2A 2ARBA 3WCRA 2UWBA 1AVBA 3WV6A 2VY0A 2WT1A 1JW6A 2GMEA 2PHXA 4YW4A 3M3OA 3NV3A 4FPOB 1MZ5A 4UW6A 5IT6A 4WVWA 4BPZA 1MS0A 2NMOA 2AGSA 4U2AA 1RIRA 5CAZA 1BJQA 4DPNA 1HDKA 1MS9A 3PJQA 3UJOA 3B01A 3RMYA 2CWSA 1V6KA 2A6ZA 4YGEA 1CESA 2JE7A 3ZXLA 2DVBA 2DUQA 3AP4A 1W6PB 2PHUA 5DG1A 3Q9OA 3H0OA 4WVVA 2CYFA 3R05A 2ES3A 4Y22A 2A6VA 1W0OA 3WDYA 1A3KA 2PHFA 4DFSA 1N3QA 5JOWA 1CJPA 1LHVA 1V6NA 2D7FA 2UWCA 3DGTA 1KJLA 3M1HA 5T5PA 4DRVA 2EF6A 4Y24A 2RHPA 3POWA 1N3OA 4Y26A 1W6OA 3PMEA 1DBNA 3OY8B 3R4UA 1MR5A 1DIWA 3N7MA 2WKKA 2Q5TA 2EXIA 3N7KA 1AXYA 2TEPA 4FPLA 2ZGUA 4FOYA 4ISQA 1AX2A 4P9YA 1GYKA 3AYEA 2R0HA 5IUQA 1C1FA 3USUB 4FPCA 3ENRA 4PCRA 4YW1A 1ULGA 1GLHA 3USUA 4GA9A 1GICA 4LBNA 1S0GA 1DLLA 1WW5A
chains in the Genus database with same CATH superfamily
1PX4A 2BEOA 4AQSA 4XYXA 3JXSA 4IL7A 3ST7A 3WOGA 1SLIA 4YM0A 2GC0A 4Q26A 1FT9A 5FZ4A 3WW2A 5FWJA 4DNYA 1CX4A 1MS1A 4AI1A 4IXLA 1RUF1 3VD5A 1UKGA 2RS51 4GJZA 1Z7S2 4GALA 4UFIA 4O61A 3RDIA 4P9GA 2HWC2 2IXJA 1N1VA 3VBFB 3A7QA 2YC2A 5FXXA 4AEDB 4X6QB 1LOFA 1RUG3 1UX7A 3LD8A 3VHNA 5AC91 4MXWA 1NXMA 1MQTB 1PM7A 1HN1A 3JBG3 4A4AA 4CU6A 1WWYA 1COV2 3VDCA 3MUY1 2DV9A 4MGKE 5AVPA 5DAVA 5J98B 4D7YA 2WNVC 4XABA 1H6XA 3VZOA 1OSGA 2W68A 1ZA7A 5DAPA 5EIYB 4NRMA 5CFDA 3RRDA 2ET1A 3J7LA 1XPWA 1S0IA 1RVF3 2VXJA 1AL21 2CAVA 1U5ZA 1RUD3 3AYAA 4YSFA 2NYYA 1W6NB 4EE2A 4XJWA 3WQ7A 1FXZA 3VV1A 3KHCA 4PF5A 2RS33 3QOPA 1VRH1 1SFYA 2EICA 4UI9L 3T4VA 2G9FA 4RS5C 4H55A 4M0NA 1JHNA 1RUJ2 2P3IA 2Q1FA 4A2UA 4B4QA 5CFCA 5FP3A 4YM1A 1JU4A 3JU9A 2D6NA 3MV11 3WDUA 3T2TA 3PU8A 4IEXA 5IK8A 5FAXA 3ON7A 1VIWB 4ISRA 3GF6A 2JG8A 3WF2A 1W8UA 5FY8A 2ZABA 4QPGC 4PDWA 1XJAA 4YW3A 1KS5A 2RS13 1RMU2 2ORZA 1UZWA 5HCAA 5J3UA 1NCRA 2CDPA 5JMCA 2ENRA 3F2ZA 1L7QA 2XVLA 2BFUL 2ZACA 4XDQA 2JKBA 4XUTA 3FN9A 3HIFA 2DCYA 4FO9A 4QPWA 3OBTA 4IEWA 1H9WA 2MPFA 2WSUA 1F5JA 4ZKTB 2ATFA 3VL9A 2W3JA 2EIDA 1E57A 2WO7A 1TG7A 2OA2A 4JGYA 4LO8A 5JXHA 1G8WA 3MF6A 2BFUS 3R0RA 5FYUA 3ZFEB 2RE9A 1GSLA 4Q0QA 2BWCA 3J8F2 3MEPA 1PIV3 2GN7A 3GCWA 4XTPA 4Z92B 1JOPA 4BIFA 3ITQA 3RJRA 4UBGA 4XQ4A 3E1F1 5DN2A 1GQGA 2GMPA 2PAEA 1RUD1 4AFAA 2J1VA 4UFLA 2ZXQA 4ZXEA 5IVVA 5FJKA 4CCJA 1CAXB 3I2FA 3AZWA 5FYZA 1OPOA 3ZXEA 2VUAA 2OQ6A 3HVDA 1F15A 4W50A 1VB4A 2GNTA 3W9AA 4CEYC 4NPRA 1DYKA 4RQPB 2X5IA 3E5QA 5F39A 1K45A 1PZ8A 2VZPA 1GP5A 3J9SA 3IKWA 3DYMA 1SLLA 3QD6A 5CKNA 5CU1A 1IKPA 3ILNA 1K42A 1AZDA 1O4YA 1QIQA 1N47A 5JPMB 1DZRA 1ZZ8A 3H3ZA 3SKJE 3BKZA 1OOPB 1DGRN 2EIGA 2XJPA 3TOJA 3O1MA 1R1A3 5A3PA 3N3HA 1AX1A 3H8UA 4CP9B 3ZFFB 5BNOA 4QB6A 4LKDA 5BNOC 3PUIA 3LSDA 3WG1A 3V0BB 4KWJA 3GALA 1EYBA 3ILFA 1OFNA 4NN0A 4HN1A 4CEWC 4JHTA 4CP2A 5JR2A 2YFZA 5C33A 4GWIA 5GLVA 3K4ZA 1KFUL 5DABA 3FL7A 2PLV2 4MV2A 4W8JA 4B8EA 4NHLA 2BVBA 4LTAA 2GC3A 4QGLA 2D5FA 3ZSJA 5EV7A 3V0BA 3J8F1 3ZPYA 2C24A 5FFOC 1WW4A 4EN0A 3RMXA 1CONA 1LU2A 3T2QA 3KV4A 1BK1A 3POYA 4CPBA 3BOWA 2VNOA 1VBC2 2GP3A 3UK9A 4I09A 2QBXA 2YXSA 3LEGA 2QDRA 2P37A 5C5UA 1PX3A 4LHLA 2OUHA 4OHVA 4U36A 1YI9A 3KGLA 4LBJA 1D0GA 1AR91 1SPPB 1NUKA 2NQYA 1AHSA 3HD8B 3NVCA 3GJBA 5FY9A 3JBG2 2XBO2 1J84A 2ZKLA 4P9IA 2A73B 2BNNA 1DGRA 4TYSA 4XFHA 3VBFC 2SBAA 1LGNA 2PAMA 1U0AA 1JI6A 5FYVA 5F6LB 2J7MA 1H30A 4N9HA 4NROA 4XACA 1XNTA 1JTZX 3KVAA 4XXAA 1T6BX 2J1RA 4MO3M 1C57A 2QZ3A 5I93A 2FBEA 4OI0A 3KCXA 5JZGB 3IDCB 2B9VA 5CKQA 2JDZA 1RTVA 5KHHA 5FYMA 4RA0A 4QX7A 4BZ4A 5FZ9A 2WS93 3AM2A 5IJRA 3P3PA 4NVPA 3WHTA 3B94A 1VPHA 3CNAA 4FPYA 1MEC2 2A6XA 2FCTA 5HV4A 4XHBA 4BQYA 5F5QA 3ZXGA 3VKFC 1J83A 3B93A 4GULA 1D7PM 1R1ZA 1JODA 3JUUA 4XZPA 4AF9A 4HSJA 3O1PA 5CG9A 2QQOA 3LA7A 4HVRA 5JXIA 4K7JA 1JZ7A 3E6CC 2YV8A 1EP0A 5FYBA 2LUWA 2RV9A 2W91A 1VRH2 2HWF3 4PF1A 4AK3A 3VBOB 2P4EA 3CHXA 1REEA 2WNUC 4UW5A 5B4NA 4EV0A 2UWAA 2YDEA 4NIIA 4XFAA 5T3NA 3A4UA 4LBMA 5DUUA 4QDSA 1WMXA 1Z7S1 4OLLA 3URFA 3AMQA 1O4TA 4GQ7A 1CJDA 3UNPA 3AFGA 3IDAA 5A33B 4K21A 4DQAA 3I2IA 1MZ6A 2E32A 4LHNA 3KSCA 2J1SA 2P1BA 3O14A 3GDBA 4P02B 5FYCA 4YARA 1H8VA 1TNRA 1OF4A 2E7QA 5GJ6A 1G86A 2ZGRA 3O0WA 1AR92 1POV0 3PVNA 3ZFFC 2OPKA 4XMIA 5FZFA 3U78A 1RITA 5ACA3 5FUIA 2E51A 2VXRA 3K77A 1ZZ6A 4MGSA 3DN7A 2OIIA 2YMZA 4OUSA 4ZS3A 4AFBA 4BISA 2WR9A 4CEWA 5JOYA 1YCIA 1WMDA 3NAPB 1P8JA 4XAAA 5A1LA 5FO9B 1VBD2 2WA4A 1XC6A 3R4SA 2BGCA 4PI0A 2WABA 3I59B 4UAPA 4I0AA 5IVYA 2JE9A 1O8PA 2HWB3 3A23A 2QQNA 3LF7A 1IG3A 1POV1 1MZFA 4AFCA 5F9TA 2VUJA 2JECA 2W87A 2VW2A 4LXLA 3FLTA 5LRSA 2Z42A 1DDLA 2X8KA 5E88A 1J3PA 2R073 2XQRA 4IEZA 5K0UB 2ZS6B 3H9AA 4RR3B 4KH9A 1AR72 1AR62 2AH2A 3AVSA 1PO21 2XXZA 1LOAA 2KA3A 2XBO3 4P5YA 4JRLA 5BNPB 5C3RA 2DVFA 1R082 2P17A 2RS11 4IEQA 2PXJA 2ARCA 2HWD1 1Y4WA 2JDNA 2X05A 2G9ZA 1VBA2 1UZZA 2OS2A 3CZJA 5SV8A 5IVBA 1UF2C 1VBC3 2LRPA 4WM7A 2VG9A 3RSJA 1YYNA 4OZOA 1BXHA 2QQIA 1MQTA 1NX9A 3A0KA 1COV3 5G04L 5FXWA 1LNSA 1H8TB 1AYN2 3BTAA 4Q4W1 3MW2A 4QQHA 4CE8A 5DUWA 5DXDA 4OQ8A 3DPRA 1D4M1 3QCWA 5F3IA 4YZ4A 4MGZE 3DXUA 3K75B 4LEJA 3NJVA 4COZA 3WDWA 1UU6A 1L7RA 1NG0A 1RMU1 2N7GA 1VMHA 4BA6A 1XE0A 2PYTA 3HNYM 4FPEA 4RS5B 4XF1A 4YLZA 1UQXA 4Q2FA 5FPLA 1CR7A 1ZBA1 2YBKA 1S4CA 3ZKYA 2VCCA 1W2UA 3K3NA 5FZ3A 3WD5A 5JUVA 2JB4A 1GV9A 1FMD2 5DG2A 3ACFA 3FBYA 3MUZ1 4E4ZA 1CPMA 2ETEA 1ULCA 2BVVA 5LA9A 2BERA 4CXYA 2WNEA 1W04A 2XDVA 4Y1UA 3WF4A 1ENXA 1MS4A 3OGGA 3IWZA 4FFFA 4X8NA 4CCMA 4Y20A 1IPSA 1UIJA 3D6EA 4Q0UA 5KHJA 2W39A 3MFCA 5JI7A 5BNQA 4BMBA 1OH3A 3ZMNA 3V65A 3WCSA 1R1A1 4YM2A 2WNUA 1H4GA 2IFWA 4UF0B 5GZDA 2WLPA 3NWKA 1PVXA 1V6IA 4XFGA 3AMMA 2RMU2 3J26N 5H9RA 5LBFA 3WF1A 1UY0A 5T55A 1VALA 1YWKA 4H2AA 4XVHA 3LDRA 3POJA 1BLZA 4JDOA 3VBSA 3VB9A 3CIHA 2XKOA 3DKWA 4L0PA 4WVZA 3ZR5A 5C9AB 1CPNA 5FQ0B 1QJY3 1V0AA 3FLPA 2XUMA 3UGFA 3KCYA 5KHGA 5FYHA 2RMU1 2LM3A 5JPNB 3ZO0B 1QGLA 2VMIA 1IS4A 3J8F3 4IEOA 3O0VA 4FFGA 5F8PA 4C1XA 5CG8A 4BDVB 2BQPA 2W92A 4CCEA 2QQKA 4AVSA 1TME3 2DWRA 3MPBA 1AL22 1N1TA 4DOUA 4Q4V2 5SV5A 1ENQA 3H42B 3JB8A 5F2WA 3WNOA 3LKJA 3B9CA 2R072 4N90A 5L7OC 2MEV1 1HJGA 4CDXA 4Q1PA 1KDKA 4OUMA 4C90A 1JZ2A 1F5FA 3T2PA 3M3CA 3FLRA 3M2MA 1H0BA 2XJRA 1D2QA 1JOJA 4I30A 2VZ3A 1S2BA 4GIQA 1GNHA 3C7EA 3T0DA 5FY0A 1SMVA 2JDKA 3O1OA 4H3WA 1BBT1 4QX8A 2ZPXA 2QQPA 3RNSA 3M3IA 3J7HA 4KNCA 2VCAA 3OUIA 1WA4A 1RUE2 3E5UA 3K48A 2D6OX 4L9BA 3UT0A 5EYYA 2VBDA 4A42A 1CIWA 4FPFA 2X29A 2ZX4A 1HIXA 4Q4Y2 3CDZB 5IVCA 3WLUA 2DCJA 4A44A 1FYUA 3RWKX 3AZYA 4EQVA 3O5SA 1AYN1 5E89A 2EXKA 4OUEA 5FOBB 4HANA 1ASJ3 4I0WB 4BWOA 3T2OA 5LASA 4Q4X2 1UAIA 2W9XA 3ZX7A 3VKNA 3NW4A 1O59A 2P2KA 1JYCA 2RG4A 3ORJA 2UU8A 5HCHA 3R6SA 1TME1 4HFSA 3BYWA 2VY0A 2WT1A 5BUVA 2PHXA 1T2XA 3AKQA 4XCAA 4FPOB 1PGL2 3ZSEA 3KV9A 2Z4FA 5C8WA 4UW6A 1ND3A 1AR61 5HI0A 4JQTA 1PK6C 1GR3A 4L97A 1JZ3A 1RIRA 3ZOIA 1NCQA 1Z7S3 2W47A 3LEIA 4A3ZA 2HEYF 3NSTA 4I0BA 5FYYA 1ZRIA 3B01A 2CWSA 4YYOA 3UJOA 3KT4A 2R062 3P1IA 2ILMA 4YGEA 3PIJA 2QQMA 4KG8A 1BK0A 3HJRA 2E26A 2AZ5A 2MNGA 3GGLA 3KHBA 4HOOA 4HT1T 4RGAA 5DG1A 5M0TA 1NT0A 3H0OA 2XJUA 1A6CA 2CYFA 4FXKB 4LUKA 2ES3A 4RSUA 4WVVA 4Y3OA 3WDYA 2DFCA 2MHFA 2PHFA 1WMEA 2HWE3 2QQVA 2PFWA 4DFSA 4E2QA 1LHVA 1XYPA 3M1HA 2IXHA 4JZRA 5T5PA 3VBUC 1NE4A 2EF6A 2FCUA 1XSQA 2GSYA 5C9AC 2ADEA 4A6OA 2VR4A 4MG2A 4DY3A 3Q8EA 1JMUB 1TVGA 2FMYA 4CDWA 4OYUA 3N7KA 1AXYA 2TEPA 4FPLA 4FOYA 4XW3A 2Q1MA 2X10A 4OVEA 4QHBA 2FDJA 2WZ8A 2TBVA 4GD4A 5CKMA 1QXRA 2BDRA 3USUB 3UESA 1QQP2 2R042 1RUI1 4QKBA 1FPN3 4YW1A 4BIOA 5C71A 1GLHA 4QDRA 3HWJA 4PDWC 1PO11 1DLLA 1Y7BA 3ZFGA 3B5LB 1W3VA 5LZ6A 5FP9A 1QH6A 4AHZA 1Q43A 3SQOA 4JQRA 3BCWA 5A7PA 5LRRA 3AP5A 2VZOA 3RYKA 4DEQA 2J1UA 3ROUA 3ASIA 4EJRA 3KF3A 2HWB2 1O3QA 2PTMA 1ZZBA 4NO4A 1M4WA 2EAKA 1IGOA 2RJ2A 2YHJA 4TLFA 2W2IA 5HV0A 3AP7A 3POSA 4CUAA 1JYNA 2YC4A 2CTVA 4HBNA 1GNZA 3UETA 3OGJA 4LE3A 3I59A 4ZPIA 2ZMLA 2GMMA 1GZCA 4NIAA 2WO2A 1W9WA 4RFT0 1DGWX 1C28A 1RUI2 1WCQA 1XRUA 1OVSA 3ACHA 4N43B 1F9KA 2WAAA 2QZ2A 3DECA 1ND2A 1NOVA 5JSRA 4XC9A 2CDOA 2YU2A 5CADA 4GMP1 4GAZA 3S30A 5ABJB 4IE0A 1NY72 3ME2A 2AEYA 1EUTA 2VPVA 3KD4A 4LKEA 3SLIA 4EZHA 1RUNA 3KV5A 1Q5OA 5T5LA 3CO2A 1UPSA 5FUNA 4ES9A 1B35B 2XONA 2QUOA 1GZWB 3PUSA 5JWPA 3I2KA 4XHXA 1V70A 2DVAA 3IBMA 4JGYC 5FXVA 2JDAA 3W20A 4YVWA 3I3DA 1NCRB 5F32A 4MZUA 2P5BA 1RJ8A 1PNFA 1RUC3 1TZOA 1W6NA 2LALA 2WYFA 2XL7A 3H8RA 2BNMA 2D97A 3H50A 3MDPA 3WXPA 4NAOA 3ZXFA 1O6UA 4RFRB 3FFZA 4DMIA 4Z1VA 3T0BA 2G19A 4C1WA 5J37A 2D6MA 3EQEA 2JWPA 5DAQA 5D8AC 3SISA 2CV6A 3AFKA 3DUIA 1O3RA 1QMJA 2WL1A 5DAWA 1W06A 3KM5A 3NAPC 2DU0A 3ZDSA 2BRTA 1WUVA 1KGYA 2GALA 5CFCC 2W1WA 5H9PA 4CDWB 1A8DA 4NOTA 2O1QA 4V2VA 3FHIB 3NNGA 3VUOA 2A3XA 1UX6A 5FZOB 2DBIA 3WG3A 3LSEA 4S2DA 1NQDA 2UYAA 5EYXA 1S0JA 4RYDA 1ACCA 4M3CB 5BV6A 1UNBA 4HG6B 4SBVA 5FZ6A 4AI2A 2QDNA 3O0XA 3SH3A 1POQA 2CGNA 4CUGA 4P9JA 4JDMA 3MZHA 2ZGMA 2WZR1 5A33A 5JAXA 1PVC3 3VDDC 2C9AA 4H14A 4OI4A 2ZKNA 1KQRA 1RUJ3 3GJAA 1ZRDA 4MUVA 1LHUA 5GALA 5JOXA 1F4HA 3NRUA 1QY4A 2RJKA 1CD3G 1JZ5A 1PM4A 1UW8A 4BQ5A 4WVMB 1BQPA 2IVJA 3SITA 2K46A 1ULOA 2O0OA 3HPNA 4CP1A 4KMQA 2DUPA 2PQSA 3OPWA 2NZ9A 1J1LA 1S55A 4XCBA 1NCQB 2VMHA 5FZ7A 1JXNA 4DIQA 5ACA1 1Q8QA 1DG6A 2AACA 3CQOA 3I3QA 2V72A 3THTA 4AW7A 1WBLA 2EVXA 4H7LA 4NWWA 4QX3A 2RDNA 2ZMKA 3OTFA 1BKZA 4Q0VA 4MGYE 4AHYA 1W6OB 3VBRB 4P9XA 1SLBA 3OY8A 1IPKA 2ZAHA 5FDBA 3POGA 3TAYA 5FY5A 5IVEA 4JX0A 5TSWA 4IETA 2HEWF 1QJX3 2JJ6A 2YG0A 4IE6A 1UZYA 2VVDA 3AC0A 3WY6A 3BIEA 1X50A 3ETQA 2OKXA 2D6KA 1NCRC 2XG3A 1RYYA 1RINA 2R071 4XF0A 1VE0A 3NL1A 4FAGA 2OT7A 4QPIC 1OD5A 2H6BA 3N7JA 4QPGA 1N1SA 3ZVXA 4NPMA 2NN8A 5C3QA 1LB2A 2DVGA 4AZZA 1FMD3 2WZR3 3S7IA 2WN3A 3OJBA 5A7QA 2CNAA 1VAMA 4GKXA 1RUJ1 3W5MA 4FFHA 2WA3A 1AX0A 4N8MA 2G4IA 3WW4A 1QH7A 2WO1A 4IV3B 2R063 1CN1A 4CDUC 3ZMOA 2P6CA 4ATFA 2JX9A 3C7GA 4XFFA 1COV1 1JUIA 4JGYB 4XIOA 2WINB 2XOMA 1EV13 1UYXA 5FZKA 2L9LA 3AYDA 1BZWA 1ZRRA 4Q4W3 4WV8A 5A3OA 4UBHA 3WDXA 5CFDB 5K9YA 1IPJA 3BOPA 2VCMA 1PMIA 1Y9MA 5FZBA 2JB8A 2VMEA 4E4DX 4FP3A 4UT5A 4WM8C 5CFDC 2YPDA 3OF1A 1ODNA 4Y4YA 5CYYA 5L73A 5FY4A 2HWC1 1GUIA 3RPQA 4XPVA 2WWUA 2UY8A 4KWUA 1SCSA 3JQXA 3WNXA 4F83A 5F6KA 1R083 5F37A 2XHKA 1TE1B 2VMDA 1ZA4A 2JE8A 3ZM8A 4CVUA 4XXPA 1MS8A 3U75A 3ZYBA 4B3NA 3T08A 1FAYA 4D6SA 1UYYA 1ZM1A 1QOSA 2SLIA 4R8HA 3H1YA 4KWKA 2RS52 1VBB3 3PDQA 2WN2A 4XF3A 3RZJA 1DQ6A 1DHKB 1WD4A 2D3PA 2QJVA 2XB6C 4PT6A 4B7EA 1KRIA 2O8QA 3VD4A 1ZBA3 5GLWA 3USSA 1ODMA 3THDA 4D8MA 4JGZA 2EIEA 3MF9A 1UY1A 5IATA 2PHRA 4XF9A 2YZ4A 1DYPA 3POFA 2QCSB 5JZGC 3WP4A 3WEZA 1SLTA 3JZVA 4ASLA 1OC1A 2DCKA 1RUG1 1UY2A 3GZTB 3RZHA 3UV9A 1EPWA 5HCBA 3LWCA 1MVQA 4XETA 1FOD3 4AR2A 3KB5A 1QJY1 5CVRA 3N4MA 4FOVA 1HXS1 5C4WB 4LBKA 3HQUA 3AJZA 2WNVB 3NQHA 4LIUA 1W9YA 1HQLA 4GWNA 3SXWA 3HEIA 5FMOL 3ZYJB 4PBOA 1TME2 3A22A 3LA2A 5T5OA 5A6ZA 4E2SA 3ZFEA 4Z82A 2RR12 3OUHA 4DO0A 5IFPA 1SDWA 1SBDA 3WNNA 2VVFA 4IV3A 3U4XA 4RGKA 2DUOA 1NLSA 3AKTA 3AMPA 4FP2A 3OPZA 4Q0PA 4AVBA 2VQUA 3FHAA 3VDDB 2RVAA 4ITCA 4Q27A 5JVVA 5FK7A 2DCZA 3N36A 2Q8EA 1WCSA 5JXGA 1AYM2 5HCFA 1BEV1 2VTFA 2XPJA 4RQPA 5C70A 5GLTA 1US3A 3ZFGC 1G9DA 2ET7A 5FO7B 1QU0A 4KQ7A 2R6QA 3TEWA 1H6YA 5DMYA 3GBFA 1UZ0A 2JG9C 1OXCA 4LE4A 1LHWA 5G05L 2VCBA 1X7NA 4Q8LA 1O4ZA 4CDQA 4YGCA 4W65A 1PGSA 3C8XA 4BOWA 5J96B 1R091 1HV0A 3LCPA 4JVAA 1R64A 1U5IA 4LITA 2MEV2 3MLLA 5IK4A 3FX3A 4HMZA 5KXEA 1W8OA 3PVEA 5I0UA 2Y0IA 2YBSA 3OB8A 2XUEA 5DZGA 4BXSV 2ZGKA 4QQOA 3VHOA 5ABJA 2X53S 4MHRA 3OYWA 2VW1A 2F17A 3WUCA 4ZZ5A 2BV4A 1US2A 5T52A 4W6YA 2V5YA 1KDMA 1NA1C 3THPA 4C0BA 3PUAA 3INAA 1WCUA 2DU1A 2PHWA 2BOJA 4L11A 3VDDA 2NP0A 3H8OA 3HT2A 1KXGA 4XFIA 5LA1A 3FUOA 2ZHNA 2WO3A 3AZXA 4I02A 2YGMA 2VGDA 2VZTA 5FKCA 1OLME 2WQZC 1C8M3 1G7YA 2Z2SB 4XTMA 2IXIA 4XJZA 1OT5A 3VBRC 1JYVA 2J42A 2YC0A 1H2MA 3LPFA 4XDPA 5CNAA 1QJU2 2YGLA 1V6JA 3MICA 3PL0A 5GLUA 4L92A 3GBWA 3QH7A 4CCKA 3AP6A 1HN0A 5FMCA 3ZN6B 1K5MC 1HLCA 3DPRB 3C3VA 1PIV1 2YYOA 3MBWA 3ACLA 3IN9A 1NZIA 3SEPA 2XL9A 4FTBA 1UMZA 4OZXA 2CGOA 4KBBA 3HQXA 1ZYBA 1C3HA 2TNFA 1LR5A 2C0ZA 3AK0A 4XILA 5E8AA 3KZ4C 4NWVA 4N53B 3U14A 4CCNA 3IAQA 1PVC2 1FV2A 2GNBA 4LULA 1YJLA 1KITA 4R52A 3H8XA 1PZ7A 1LECA 3KVBA 2V4AA 3G7DA 4M4RA 1H2NA 3B02A 3EHKA 3ETPA 4JCKA 1YQ2A 3KGZA 2NM1A 3QH6A 3PTYA 4QQ2A 5C5TA 1V6OA 2VTXJ 5FLIA 3OGRA 4ASKA 3P3NA 3ZYRA 1VBD3 2H0BA 4JGZB 2J22A 3CU7A 3H3UA 3M8LA 4RD7A 4K3UA 4NE9A 4Z8BA 5T54A 3WDTA 4AYUA 2BNOA 3VD7A 4NHYA 4DZGA 2ORXA 1SZBA 4Y33A 1YC61 2E7TA 4OMDA 1GP6A 4ZXKA 1UOJA 3SKVA 5KXCA 2ARXA 5DQ0A 1AJOA 1PO13 1AR93 2Y0OA 2WT2A 5I0DA 3HN1A 2OVUA 2IC1A 4W6XA 2JG9A 4MGQA 4XJ8A 4R4XA 4E27A 1IQDC 2CGPA 4W4ZA 4NAMA 1HB4A 1X9TA 5A7WB 4YRDA 1RVF2 4I3PA 3CEWA 4WZCA 2R30A 5A7SA 3PVOA 3RS6A 4M0HA 3BB6A 4HLTA 4RQPC 1QJFA 3JD71 4GXLA 1GNYA 3FC0A 4QAWA 4ZHNA 4PDWB 1NXD1 4FSJA 5FUPA 1PO22 2F4LA 1W2AX 2I45A 1GBGA 2Z5WA 3CLPA 4Q4W2 3MLJA 3OYWB 5BXXA 1CZVA 3APBA 2Y34A 2R1DA 4BB3A 1XBFA 4BYYA 1WGPA 2WS91 2DTYA 1J1TA 2HWF2 5H9QA 2LW8A 3BALA 2VW0A 2I2SA 4WM8A 5EZWA 1HRV3 2OX0A 5FMOS 4ZY9A 1UY3A 2HH9A 5L19A 2VZUA 5JIAA 5FK8A 1H9PA 4V1PA 1RHI3 2VUDA 4CP9A 4YZ1A 5BNOB 4QU1A 2RS12 3MI8A 3HOBA 4UXAA 4LO5B 4LT5A 5A6XA 3ZXJA 1O3TA 1GQPA 1QKQA 4YNIA 1WCKA 3N9QA 1OFSA 4UFJA 2AR6A 5BNNB 3I54A 1CAWA 1VAVA 2JDUA 2PA7A 4R9CA 1MEC3 4HKLA 4CP0A 2BGPA 3AX4A 3HT1A 3I49A 4EYUA 5A32B 1UOFA 1VBE2 2XMLA 2Y6JA 2P34A 2E6VA 4QQPA 1TMF2 2QQWA 4Q8KA 4JC1A 4Z2WA 1VJ2A 2VQTA 2Q8DA 1VAKA 2FHRA 1OURA 5IHRA 3NV1A 1XQNA 2OUJA 4N7IA 1RUC1 4G4FA 5CEHA 1SLCA 2F4PA 3NMBA 2D6LX 1KS4A 4MYEA 4IE5A 5KC6A 1CAWB 2ARBA 2RJLA 4B29A 2FDFA 5HPOA 5F5CA 4I2OA 4QM9A 5L36A 2H0VA 2HBTA 4AQ2A 1JUHA 3AMHA 1NY71 4YW4A 1HV1A 1J59A 3TN93 4HPKB 1W3XA 4YVSB 1FPN2 3WNPA 1GP4A 1UIKA 3KT7A 3ZLIA 4WVWA 1VMJA 1MS0A 4R4ZA 4KGGA 4AG4A 4U2AA 3MFAA 5CAZA 1HDKA 1MS9A 1MZEA 2AEZA 3LEMA 1HRV1 3NKTA 2A6ZA 3JB4C 3UGHA 1CESA 3AMNA 2DVBA 2JG8C 2JD9A 2XH6A 5FY7A 4AI9A 1MQTC 2HWE2 1FOD2 1SDDB 4A41A 5FZ8A 4Z2AA 4COWA 5FPBA 4HONA 5IW0A 2VZSA 2JG9B 4CCCA 2XJVA 1N3QA 3I7DA 4QMAA 1V6NA 2D7FA 4DRVA 3RZLA 4DUWA 4Y4RA 1YEWA 1QWRA 1EUUA 2RHPA 3ZYFA 4Y26A 3U10A 1NQJA 3N7MA 1DIWA 5KWRA 3OBAA 3D0JA 3H7JA 4IEYA 4LIVA 1HB2A 1KEXA 2VC9A 1YFYA 4JKLA 3AYEA 2R0HA 5D2AA 2WYSA 4FPCA 1OD3A 3WQ0A 2VAUA 4BQ2A 3MYXA 3X29B 4PCRA 3EBRA 2XJSA 4GA9A 3PUHA 4CUCA 3NAPA 4LBNA 1QJX1 1WW5A 3I3MA 3RJ2X 4YG3A 4ZS2A 1I1EA 5D21A 4LHKA 2PQQA 2JEMA 3T1MA 2ZEYA 4M4PA 2VUCA 3OGVA 2HYXA 5A7WA 1SFNA 1IS3A 4OCTA 3HNBM 3LOBA 1NZCA 3BN6A 1K5MB 1OF3A 2CWMA 2ERFA 3RG0A 2JKXA 2J1TA 1W05A 1VRH3 3K2OA 2IFRA 3SEEA 3T3YA 1CAVA 4DXSA 2XBO1 4AQTA 4Y1YA 2E63A 4OFGA 4J25A 4M3CA 4NHXA 1SACA 4Y22B 2ZTNA 3I3EA 2LTNA 1NE6A 2R061 3THCA 1YFUA 4D7SA 2VL4A 2PMWB 1JHJA 1AR83 3IIIA 4I3GA 4GWJA 1HRI2 4CSWA 3RGBA 4A7YA 4QWNA 4FPGA 5A3LA 5LATA 1AJKA 1OKQA 4LK6A 3OGSA 5ERLA 2VM9A 1A34A 1SQ4A 4K8FA 2IWGB 2PLV1 2WFF1 2ZX3A 3BU0A 4PIXA 3PTRB 3BTYA 2G1MA 2BP6A 2YY1A 4LLOA 4GH4A 5JCTA 1RUF3 2PELA 2GH2A 4LO4B 4Q29A 1A8MA 2EAAA 5K0UA 1VBE1 2XLFA 2XJQA 4OI2A 2A6YA 5EP9A 2Z79A 1BVVA 3WDVA 4YVSC 3LZZA 4QDQA 3W21A 4K1YA 2WNVA 5AFBA 3ZXDA 3ZXKA 3N9PA 2RDQA 1W0NA 2Y60A 4FFIA 2VD7A 4WM8B 5AVAA 2W1QA 3VHPA 2IVIB 3VBOC 1WLWA 4OQ9A 3ZIXA 1VBB1 3ES1A 5L9BA 1LOFC 1LEDA 1RUD2 2H6CA 5FZDA 3TB0A 1OA4A 5A3MA 3WQ1A 4AEKA 1IQAA 5D8AA 1SG3A 1W99A 1ZX5A 2A5ZA 3BPZA 1X8MA 1ZREA 1UXXX 2GU9A 2W94A 1LGCA 3WG4A 2BPA2 4J6GA 1Y43B 4ZZ8A 5C8CA 4QX0A 5E6HA 3D0SA 1IHMA 2VOKA 1S0CA 5FXZA 3WG2A 1DGLA 3GHMA 5DUXA 4AI8A 5FZLA 4DS0A 3POIA 4YVWC 4MOAA 5APAA 1W39A 3K4AA 1I9RA 1N3PA 2D98A 5C6CA 4N9IA 4COYA 1YXWA 1OOPC 4LORA 2B4KA 4AVVA 1KD7A 4XOGA 1W2NA 1YQ8A 5CISA 4MXVA 3DYOA 5FZOA 4H7MA 2GC2A 1UPIA 1S0EA 1XNCA 2W1UA 2WFF3 5T50A 4AOCA 4EN7B 1MPXA 1W03A 5KXDA 2ADDA 5J09A 5FPAA 3GNEA 3NV2A 4HN0A 4GJYA 4MXWB 5DDJ2 2VJXA 4KI5M 2XQXA 3LGRA 3LPGA 4NPLA 5A7OA 4CUBA 4P5HA 4XFBA 3A21A 1SBEA 1LOCA 1ASJ1 2ZZJA 1X8EA 3PVBB 4DXRA 4XJAA 4XMAA 2VZQA 1RC6A 1PVC1 3NNJA 4LPLA 4OI1A 2YPJA 1CAVB 3L2HA 3TYJA 2VO5A 4LBQA 2NPIA 1V9U3 1QXJA 1QDOA 2IXLA 2ZHLA 4R9AA 2RDSA 4XJ9A 4HVQA 5KHIA 1W6MB 5CB7A 4PQ9A 1BBT3 1G9FA 1RUH2 2Y6GA 1OLMA 5JOZA 3BTZA 5IVJA 4L2NA 4CU7A 4CCOA 1ZZ7A 1PMJX 2GDFA 2DCTA 3FJSA 4FPKA 2JDYA 1ND3C 1WMFA 4HKOA 3U37A 4GH4B 4EN8B 4UW4A 2GH8A 3E6BA 4LHSA 2HEVF 3MW3A 5C3OA 2ZHMA 2Q8CA 1PIV2 1XU2A 3GZEA 4XQWA 1YO8A 1DQ4A 2VOTA 1GOFA 3AXEA 4RHV3 4CTEA 4P00B 5KC5A 4Y1ZA 1LRHA 3Q8AA 1BEV3 4AL9A 1U5YA 1XE7A 4FPJA 4CDXB 2X5IC 3NJZA 4MGIE 2Q8OA 4IEVA 4CPBD 1X36A 1YQCA 5F5IA 4Y1XA 1RUF2 2BBAA 1R092 1D0HA 4LBOA 5FYIA 3O7OA 4D69A 2V4VA 4MH0E 1QXPA 1NLRA 1WLDA 3FFQA 4XUPA 4Z07A 3GZUC 3T30A 3UKNA 2E9QA 2VULA 2K0GA 1OBNA 4AAXA 3OSDA 3OEAA 1VP6A 1G6NA 4QB1A 4LO7A 1EAH2 2R1BA 3C7OA 1GKBA 3ZSKA 2JD4A 2WLQA 4LBQB 1G9AA 3GM8A 4XDOA 1K12A 2D6PA 1EAH3 1GFF2 4EZ4A 4J1WA 3VZNA 1W6PA 4B1MA 5A3NA 2DTWA 2A71A 2RM21 4DUXA 1IZ3A 4OHYA 4ARYA 3ACIA 5HBAA 2QNKA 5C8CB 3NNMA 5IVFA 5C3SA 2UYBA 2B45X 1LJ7A 1UU4A 2D40A 1H2LA 5A3TA 5A1AA 2E53A 2XWJB 3SCHA 3S6PA 2AREA 1BEV2 1ZRCA 2FD8A 4FAHA 1EV11 1AR71 3UKVA 1NA1B 3M3EA 1C5HA 3NV4A 3MO4A 1W8NA 5F3GA 2QQJA 5LBCA 2Y38A 2WAOA 1QHDA 2O8OA 4JV4A 5EJZB 1CVNA 3K46A 5EXOA 4TTGA 2BUKA 1VBA1 4DXTA 2YU1A 4BJ0A 4CA9A 2AYHA 4MLOA 2W1SA 3UL2A 2IXCA 2R16A 4BQ4A 3HBKA 3O1TA 4XURA 5IYYA 1YIPA 1ULDA 3RZGA 1RUH3 1VBD1 3WP5A 4EROA 3KQRA 2J1EA 3QBQA 1YRZA 4NMIA 3W59A 4TZDA 1U5XA 3N35A 2FZ1A 3IPVA 3TWIA 5A1FA 5DUVA 1RL3A 2C5DA 2A1XA 4P08A 5DDJ3 3KWVA 4K8RB 2ZBJA 2I74A 5CA6A 4QU2A 4N53A 4YW6A 4XBLA 5BY5A 1EAH1 2WFF2 3N7LA 3BTXA 5FIXA 2RM23 2D43A 3W58A 1O91A 4LLFA 4F3JA 4MX3A 3WUDA 2ZCWA 4MADA 2VZ1A 4XE9A 4M01A 4DRRA 2C6SA 4GWMA 1JBCA 2E33A 2FDHA 1BVP1 2VVEA 4ORFA 4QKNA 2Y64A 3MGUA 5FWEA 3AL6A 4Y1VA 3B00A 3Q8BA 1F8VA 2JIGA 3ELNA 4QKFA 4RGGA 3WHUA 5LA0A 1EY2A 1DLCA 4F8AA 3BGAA 1YLLA 2BWAA 1VBA3 2D5HA 5FYSA 1G9BA 1REFA 5L7OA 1SLAA 4NHMA 3U4SA 4JTNA 5JLVA 1WW6A 5LEKA 3WP6A 1OHFA 3JD73 1UOBA 1X82A 5FP7A 1B09A 2FCVA 2PHTA 3T4HB 3P6BA 1LOEA 5C7GA 5K4LA 1MEC1 5FZGA 4RR3A 3MIEA 1GANA 2JENA 3PU3A 3J7NA 2J1AA 1HQWA 1XXNA 1YHFA 5H9SA 1OMIA 3I4IA 4UWDA 1B35C 3AKRA 3PNAA 3U07A 2YROA 3HMYA 1RHI1 2VQAA 3AVRA 1FNZA 2VMFA 2P3YA 1H1MA 5IWFA 1S0BA 2OPWA 5AFEA 1BMV2 2ZGPA 5IAVA 1CGPA 2GP5A 5GM0A 1ZBE3 5ANNA 3ZYPA 5DZEA 4LNVA 4INDA 1APNA 3CJIB 3DXTA 2FMDA 2DDUA 4MSVA 1R1A2 1VMFA 3JBG1 1HX6A 3OCPA 1H2KA 4OULA 4CEWB 3S57A 3VD3A 1UN1A 2FQPA 1HRI3 1S0DA 1QF3A 5LW9A 1W0PA 4QKDA 5KHKA 2B8MA 3AXDA 3AYCA 3AL5A 3U1XA 3VBHB 5JZGA 5FREA 5IFTA 1OQDA 3OUJA 3SCGA 5GZCA 4IEUA 1QOTA 1WD3A 3DV8A 3LDBA 1FNYA 3PLQA 4RHV2 1CQ9A 4QQLA 1CX1A 2ZA9A 1UWWA 1JYXA 4DEVA 5FR3A 4YWAA 2RS31 2WRAA 1V6MA 5BPXA 1LKNA 4JDNA 4YM3A 4M00A 1J3QA 3H3LA 1CAUB 1CZTA 3KT1A 1RUC2 1IS5A 5E1RA 3S5AA 4AFDA 2V5DA 3WSOA 2DVDA 1W6MA 3T09A 3MIFA 1C8M1 4HKWA 4M3CF 1VLNA 3T1LA 1U12A 1OQ1A 5F3EA 1VBC1 2CHHA 3ZXAC 2ZJCA 3LOIA 2WNUB 1JH5A 2CY6A 3VBOA 4YW2A 3B3QE 1NKGA 2JDHA 1PGW1 5A32A 5K7PA 1HB1A 4WVMA 2EXJA 5GZEA 1DZQA 5FCCA 1ULEA 1IS6A 2C26A 3MIBA 1UO9A 2JDPA 4LBLA 1IOAA 4COVA 2RDRA 3SH4A 5K0UC 2WFPA 4LKSA 5A80A 3W5NA 3HAGA 2WZR2 2BJSA 1E5RA 1PZ9A 3DYPA 4URAA 3ES4A 4YW5A 3D4KA 3O12A 3HQRA 2VTXA 3KV6A 1ULPA 3IM0A 4IGQA 3U11A 2WQ8A 4YG6A 4BQWA 4COUA 2BTVC 4FT8A 1HKDA 2XLGA 1I5ZA 2IXKA 2VOXA 5EPAA 1DU3D 4CCDA 3DCQA 2G9GA 1JOBA 4RN5A 3BUCA 2B5HA 5CZKA 4AEMA 1GWMA 1L3JA 2GAUA 4IE7A 2GNMA 4UFHA 4AI3A 2W0XA 1YI7A 2A6WA 2RS32 1AYN3 1DP0A 2WJSA 2ZAAA 4IDZA 3VLBB 1G9CA 1K5JA 2VH9A 1SHWB 4QGMA 3TEZA 4BMEA 1W8FA 1LHOA 3S5QA 1XB9A 4CYDA 1QQP3 2R043 3HBZA 1C8M2 1OUSA 3SCFA 4HK8A 3WVJA 3S0MA 3JD72 2KXLA 2WC2A 4K20A 3MIDA 4IGPA 4N7UA 3EJKA 3SNMA 4HPKA 3DKQA 5BYNA 4QXBA 4DINB 4UYBA 1W8HA 3WF0A 3V64A 1RUOA 2RMU3 1KFXL 4HETA 3B7MA 4PIYA 1AR73 3P5BA 2PLV3 4O9EA 3IB3A 5B4XA 2TUNA 4LK7A 2CAUA 2GC1A 4JKKA 4WM7B 4FOWA 1ST8A 4QPGB 5DZFA 2Y26A 4P14A 2HWC3 2MEV3 1C1LA 1J58A 4WM7C 1GMMA 3SH5A 4LA3A 3LFIA 4SLIA 4YFWA 2WUHA 3CZUA 3E5XA 4BLJA 5LWBA 3RQ0A 5FRAA 2Q4SA 4V2WA 2HKXA 1VR3A 3VBHC 3WCRA 1GWKA 2VOWA 1QJU1 1AVBA 3WV6A 5LEJA 2HWE1 1UCXA 4NIGA 2Y33A 3M3OA 3FHQA 1B35A 1MZ5A 4QGNA 2QE3A 1WKYA 4C0HA 3ZYHA 4BPZA 1K5MA 1AYM3 5ISLA 1ZRFA 1BJQA 3N9NA 4TN7A 4CXWA 5IAXA 3RYPA 4YPJA 1V6KA 4QPYA 1O3SA 4ZU7A 2QTWB 4KG0A 1F4AA 3CF6E 1W90A 5FZMA 5F2SA 3E97A 3ZXLA 3ZFGB 1CAXA 1OA2A 1OQEA 5A3UA 3DEMA 4OMCA 3O1UA 1OH4A 1H1IA 1I5PA 5JI9A 4LA2A 1W6PB 2NLRA 2PHUA 3CBNA 4Q4X3 4QT6A 1CAUA 2FDGA 4S2HA 3R05A 1H1AA 4Y22A 1WLTA 2A6VA 1W0OA 5FZCA 2HJIA 2B39A 4EWAA 3MIGA 5BNPA 5JOWA 2UWCA 2VMGA 4KBZA 2C9KA 4AHWA 3N9MA 3ZIWA 5C9AA 3OD0A 5FLHA 3RWNA 3POWA 1N3OA 4D0QA 1W9SA 4LOSA 4QX1A 1W9TA 2Q30A 1DCSA 1XNAA 4IERA 3IIAA 4UFMA 4YVWB 1OOPA 5JR7B 5L9RA 3SMHA 2X09A 5DPNA 3WNLA 2FDKA 2WKKA 3VN4A 4AXOA 2Q5TA 5I91A 3OBZA 1XNBA 3N9LA 4Q0SA 4QPIB 2XR4A 1RXGA 1AX2A 2ID4A 2IUWA 2Q1ZB 2ZX1A 4P9YA 4QX5A 1GYKA 1XNKA 5LBBA 4JTOA 1BHGA 3LEKA 4CDQC 5JMOA 2JG8B 3I2JA 3MHZA 1UU5A 1UYZA 3TRSB 3ZN4A 2WBKA 3USUA 2QKDA 4AEJA 4D3WA 5I0SA 4FTSA 1S0GA 4Y5SA 3ZYIB 2OZJA 1NAEA 3HNMA 4A3XA 3PIGA 1AUYA 2OYZA 1PNGA 1FV3A 1XYNA 1GZTA 3KCCA 4LMFA 1AXZA 3BIWE 4Q4V3 3MIHA 1UL9A 5C3PA 4UOJA 4FCAA 4IV1A 1Y9GA 2GNDA 3UGGA 1LGBA 5HXVA 4IV1C 3RI9A 4RS5A 1ND3B 3GZAA 4LJHA 1RB8G 2ZOEB 3AZVA 2A75A 2XKPA 4YVSA 3K4DA 2XJTA 4Q4X1 5LY2A 4AI0A 4BQXA 3ZKUA 1XE8A 1JZ4A 2ZHKA 1Q3EA 3LQCA 4B4RA 2ZX2A 3PJYA 3VZKA 3Q8FA 2HWF1 1ENSA 5FZ1A 5CBLA 1PGL1 5KBFA 4BCUA 1BCXA 2HBUA 3NKGA 3IDEA 1EV12 2I07B 2B42B 2BW8A 3H1WA 4R9BA 1GOGA 5FBJA 4XEZA 4MVTA 4ARXA 4LO6B 4EWDA 2PN5A 3UKTA 1STMA 3VBFA 1HXS2 5J36A 2XHNA 3WW1A 2XVKA 2QFEA 3VKOA 2WDBA 2AENA 3SC7X 5CFCB 3LDKA 4A7KA 3VKLA 1JZ8A 2OXBA 2RM22 2WWJA 5FZAA 3VBSB 1YQ5A 3LIHA 4NRQA 4BU2A 4K40A 2VU9A 5HXMA 1XU1A 4GKYA 1OLQA 3DF0A 4NIDA 5C8CC 1LESA 1WCDJ 2JXAA 4Q4V1 3BODA 5FJHA 2IZWA 3D3AA 1YNAA 4DUVA 3ZSMA 4PLNA 2WQ4A 5FV3A 3BU7A 4AQ6A 3H7YA 4AGRA 5A6QA 2WZEA 4E8DA 5I8YA 3CKHA 1O8SA 1WLCA 4N43A 5FTTC 1RUH1 1DQ5A 2DYCA 3O1RA 1I6XA 2LS6A 2ZEZA 1NCQC 2W52A 3FUQA 1SBFA 3UYJA 5JSPA 5FMDA 1UY4A 3D82A 4B1LA 3TBDA 3VBRA 1JYIA 1D2SA 3J4UH 3IMNA 3C7HA 4PI2A 1SPPA 2B46X 3ALQA 1YFXA 1Z0HA 3ILRA 4HSLA 3T0AA 3D5OA 4XJUA 1AXKA 5FQ0A 1LTEA 2RR13 5J7MA 4ES8A 3ECQA 2R7EB 3VBHA 3RI8A 4CDQB 4QHZA 2W5FA 5FLJA 5LY1A 4IESA 3GHNA 4L99A 4Y5Z0 4J1XA 4YG0A 2Y6KA 1OLRA 5FPZA 4D94A 5LK7B 3I8TA 1XSRA 3PURA 1QNYA 4GMP0 2A3WA 4URTA 1HB3A 3WR0A 3I2OA 4QXCA 1W2OA 1Y9QA 4CDWC 5GKAC 4PLMA 1YIFA 2ZMNA 4K1ZA 4XFCA 1OI6A 5I0TA 3VKMA 4CXXA 3C2UA 5GZGA 3RZMA 2DURA 4AFMA 5FPUA 2VBBA 4QPIA 3RFRA 4K6BA 3ABZA 2ZGSA 4GB31 5FMBA 4AAPA 1E5IA 4L8QA 4CDUB 4D6RA 3NO8A 2RS53 4HZFA 1MS5A 4ZU5A 4E2GA 4PHZA 4META 5GLZA 2D44A 2Z69A 4UW3A 4YW7A 4XBQA 1ZVFA 3MLKA 1RXFA 3EMRA 1FX5A 1S1AA 3IT8A 5ACA2 1ONAA 4C91A 1H4HA 3C7FA 3JQWA 2OQ7A 3I2HA 5LCWL 1V9U1 1W9FA 4AVTA 1QJU3 2OW4A 4BH9A 5FY1A 5EWSA 3OBRA 3VZLA 4XUQA 5FBZA 3VZMA 1ND2B 3B69A 4AHXA 1MVEA 4IQPA 2JIJA 4E4HA 2RR11 4HXCA 1PK6A 1ENRA 2UURA 3WINE 1M06G 4S2GA 2ZZQA 3U0ZA 2WSVA 1AF9A 1URXA 1MACA 4O7XA 3VDAA 3ZR6A 3IPVB 1AL0G 1DZTA 3LA3A 3WT3A 4DB5A 5I8SA 2WWSA 1S0FA 3TN91 2KD7A 4E4SA 1LENA 1FI2A 3D8CA 3FBMA 1HRI1 1HQNA 1F35A 1CIYA 2B7YA 3FWEA 4HVOA 4BXFA 5BNNC 5KR7A 4AE2A 1QEXA 4LUMA 3I97A 4TLGA 1LEMA 3RVHA 3V0AB 3NNLA 1JN2P 2JDMA 3DL3A 4GB33 4GZ9A 4R9DA 2D93A 5J1XA 1ZBE2 1ZZ9A 1S2EA 3L2YA 1UMIA 4NR1A 4XZUG 1A78A 4JGZC 1NYWA 4PQQA 1DQ1A 3ZYGA 4A7ZA 4CCLA 5FO8B 1HXS3 4N43C 4M3CE 3HR9A 2CL2A 4ET7A 4QXHA 1Q8VA 1Q8SA 1DQ0A 1IG0A 1DF0A 2A70A 2WIIB 4WZFA 4Y5TA 5F7UA 1TNFA 2O14A 3L9JT 3EYPA 1RJ7A 4MGTA 1QJX2 1Q56A 2YBPA 1LODA 2QQLA 1V00A 3AB0A 4QHOA 3ZPOA 4AGGA 1Z78A 3VD9A 1LAJA 2XVGA 1JU3A 1W8WA 1LOBA 1YQ6A 2E7AA 4XUOA 3AKPA 3ZN6A 2P3KA 3EO6A 3O1VA 2VECA 1UXZA 4QB2A 5F1RA 2EA7A 1CZSA 3DPRC 3OEBA 2YB7A 1VB2A 2NMNA 4Y20B 2CU5A 2VMCA 2ARAA 3ZSLA 5K8SA 1BYHA 5L9VA 1EPZA 2BZDA 1WW7A 1UYPA 1H8TA 5A3WA 1V6LA 3KMHA 1OVPA 5BNNA 1YJKA 1TEIA 1F31A 1QOOA 2K9ZA 3TEXA 1XYOA 1W6QA 1BMV1 1ND2C 5FYTA 4AGVA 2WNOA 1Q8PA 4PBPA 3KS7A 4AEDA 1F2NA 2R0FA 1SFPA 4XF4A 3VBSC 1E5SA 2OZ6A 5EQUA 4E9KA 4FQZA 4HL0A 5KXBA 2E31A 1CWPA 3TNPB 1VBE3 1GOHA 1QJEA 2A3YA 2KM2A 4FOQA 1HJFA 1C5IA 3H1MA 3V56A 3I2DA 4EWEA 1C8NA 4YFZA 2QVSB 2WT0A 3M70A 3WW3A 4BLIA 1QQP1 2R041 1IKQA 1OUXA 1PHMA 4LOTA 5F5AA 1GZ9A 1HW5A 4C8DA 5FPXA 2PHLA 3A0NA 1FOD1 5FPVA 5EFUA 2HLEA 5CIRA 1HRV2 1FPN1 1C4RA 1OKOA 3IZOA 4X6RB 4RL7A 4IEPA 2V73A 2VE1A 4XQDA 4AWDA 3IAPA 1KJRA 4W6WA 1UKRA 3Q8CA 4NIHA 2W95A 2CSGA 4KU8A 3POBA 3UJQA 4CRQA 1X9PA 2HWD3 3N9OA 4UFKA 1UMHA 3ZFFA 2PHDA 3CMGA 1NLQA 4ZU4A 2F6BA 5ABJC 3LFMA 2EXHA 3ATGA 3QACA 2A7AA 3WNKA 2VOVA 1GZWA 4YZ5A 5A6YA 4YZ3A 2P3JA 4JHZA 4FXGB 1LOGA 5GZFA 4CU8A 1PMHX 4JKMA 1SEFA 2ZGQA 3OOXA 4G3YC 2P6HA 5FKBA 4LQRA 5LK5A 3WQBA 2BBVA 3KLSA 5FP8A 3VBUA 4BK4A 5B2GB 5BNPC 5IK5A 1D4VB 3E6DA 4N53C 4IUGA 4KGQA 4FQ4A 3GXUA 1RUI3 4FPHA 4Q1RA 2VQ0A 3QLQA 5C4WA 1DFQA 1QNWA 1GU3A 3PMSA 4GMP3 5D8AB 1TMF1 4IGOA 3CJIA 2WS92 3CJXA 1ZNPA 4HK9A 3MV01 3OG2A 1MS3A 1ZBE1 3VBUB 4ZONA 4TXWA 4I01A 4EN6B 5AC93 4NHKA 4RR3C 5JSOA 1ALYA 2YFUA 1R093 4BE3A 1SCRA 3MW4A 4E8CA 5FOJB 4BHPA 1O5UA 3ZN5A 5J48A 5A7NA 3WF3A 4IW3A 4KL1A 4NJ4A 1XNDA 1RVF1 1AL23 3CJIC 1W6QB 3KQ4B 5IK7A 2WZPP 1QDCA 2JICA 1T6GC 5T5JA 3M7AA 2VNRA 2DFBA 4CEYA 4P9WA 5C4WC 3RZKA 5D1IA 4S2FA 1OPMA 1NA1A 2X5IB 3AJYA 4XIKA 2AUYA 4XBNA 2FZ2A 4AVCA 2EIBA 4KWLA 3TNQA 4EN9B 3R4DB 2YUEA 1QJZA 4O9GA 1PGW2 2QQUA 3POEA 3RZZA 1WZXA 3EB7A 2D3RA 3NNFA 1DQ2A 4D7TA 5I8TA 3TEYA 1BBT2 1UD1A 2ZGTA 3I3BA 3WZ1A 2BGOA 1Y3TA 2VZVA 4DXZA 2GN3A 1V9U2 3K3OA 3NJYA 1FATA 3IMMA 3FE5A 3M4FA 5DAXA 1TMF3 3O1SA 3CL1A 2K2SA 2DBNA 3MPPG 1RUE1 2XWBB 1WBFA 4P9LA 4OHWA 2UY9A 3EXUA 4GB32 4JRAA 4RHV1 4OHZA 4Q5OA 2ZGNA 3IDBB 2AC1A 4PIZA 5JDBA 3OPTA 4KU7A 3V0AA 1RHI2 1I3HA 4NUBA 4YGBA 1W2TA 2VBPA 4QXKA 4CDXC 4WBBA 1LHNA 3AZZA 3LE0A 1LULA 4QM8A 5LA2A 4FVVA 2D3SA 4B7KA 4BM8A 1O5LA 1OA3A 1N1YA 5E16A 3HN3A 4NRPA 1LU1A 1X33A 5LB6A 2ZX0A 4LBQD 4D6QA 1UZVA 3ZFEC 1Q8OA 4PJYA 1PO23 3ACGA 5FZHA 4GH4C 4B4PA 3F95A 5FP4A 3BI3A 4FTEA 1GQHA 2HWB1 2BU9A 4LR4A 5FZEA 4A6SA 4AEDC 1S2KA 1ZZCA 3AP9A 3PUQA 1DYOA 1POV3 1ASJ2 2EALA 1PK6B 2R49A 2ZGOA 4ATEA 2W08A 2ZGLA 5LBEA 3VHRA 4BQ1A 2HYKA 4X8PA 2Y6FA 3M3QA 4UF0A 3VGIA 1H8TC 2VZRA 3G6JB 4QX2A 4YGDA 3VDBA 5DDJ1 1LCLA 2FDIA 1XOYA 3PHMA 3GCXA 1PO12 2Y6HA 3GBGA 3LB9A 5FZIA 1AR63 1FMD1 1JYWA 3SHRA 1ULFA 4CEYB 3KF5A 1K3IA 2VNGA 4CZSA 4ASMB 1RUE3 4DY5A 4YZ2A 3WNMA 4Q4Y3 2UWBA 1L7LA 5F3CA 1RMU3 1JW6A 2GMEA 3NV3A 3WP3A 1JS9A 3B9IA 5AC92 2C4XA 1D4M2 3VL8A 1VRBA 4XUNA 5IT6A 3J7MA 3AKSA 3GYDA 5EJ3A 3LAGA 4ONUA 5ANQA 2NMOA 2AGSA 4XAEA 1O7FA 5I0RA 4CU9A 4A45A 4DPNA 1D4M3 3JCIA 1ZBA2 3PJQA 3RMYA 1AR82 2Y6LA 2W46A 2ZEXA 3FMGA 2JE7A 4O65A 5JIUA 4IE4A 2BOIA 4AVAA 1VBB2 2DUQA 2Q0AA 3AP4A 1R081 3OD4A 2V09A 1YFWA 3BVCA 3Q9OA 4TSVA 1GWLA 1AYM1 3NJXA 1W8ZA 1W28A 3I2GA 2Y8KA 4K9SA 1JZ6A 1A3KA 1DGWA 1J3RA 2C1FA 3BPSA 2LROA 1JYTA 1CJPA 1REDA 1TQ5A 3DGTA 1KJLA 2XGXA 4IV3C 4PLOA 3RYRA 5A70A 4TWTA 5EJ1B 4IV1B 4BK5A 2BYVE 4Y24A 3WX5A 4JAAA 2VNVA 1QJY2 2KR2A 4FBFA 1W6OA 2HWD2 3PMEA 3S7EA 5FZ0A 1DBNA 1W8TA 3OY8B 1MR5A 3R4UA 3TN92 4CDUA 3LIGA 1RUG2 4LKFA 2EXIA 3ZDVA 2DF7A 2GZWA 2ZGUA 4Q4Y1 4ISQA 1WA6X 2PAKA 4BQ3A 1E5HA 2XLAA 5IUQA 3FZ3A 1C1FA 4G9SB 4FI9A 2ZEWA 2R32A 5EHDA 3VZJA 3ENRA 1AR81 1YUDA 2B9UA 4MHUA 1ULGA 4F7ZA 5JXJA 1UOGA 3K51A 4QD2A 1GICA 5L7OB 1RGSA 4OHXA
chains in the Genus database with same CATH topology
2BEOA 4AQSA 4XYXA 4IL7A 3ST7A 3WOGA 1SLIA 4YM0A 2GC0A 4Q26A 1FT9A 3WW2A 4DNYA 1CX4A 1MS1A 4AI1A 4IXLA 1RUF1 1UKGA 2RS51 1Z7S2 4GALA 3RDIA 4P9GA 2HWC2 2IXJA 1N1VA 3VBFB 4AEDB 4X6QB 1LOFA 1RUG3 3VHNA 5AC91 4MXWA 1NXMA 1MQTB 1PM7A 3JBG3 1COV2 2DV9A 4MGKE 5AVPA 5J98B 4D7YA 2WNVC 3VZOA 1OSGA 2W68A 5CFDA 3RRDA 2ET1A 1S0IA 1RVF3 1AL21 2CAVA 1U5ZA 1RUD3 3AYAA 4YSFA 2NYYA 1W6NB 4XJWA 3WQ7A 1FXZA 3VV1A 4PF5A 2RS33 3QOPA 1VRH1 1SFYA 2G9FA 4RS5C 4H55A 4M0NA 1JHNA 1RUJ2 2P3IA 4A2UA 4B4QA 5CFCA 4YM1A 3JU9A 2D6NA 3WDUA 3T2TA 4IEXA 5IK8A 5FAXA 1VIWB 4ISRA 3GF6A 2JG8A 2ZABA 4QPGC 4PDWA 4YW3A 1KS5A 2RS13 1RMU2 5HCAA 5J3UA 1NCRA 5JMCA 2ENRA 4XDQA 2XVLA 2BFUL 2ZACA 2JKBA 3HIFA 2DCYA 4FO9A 3OBTA 4IEWA 1H9WA 2MPFA 2WSUA 1F5JA 4ZKTB 2ATFA 3VL9A 1E57A 4LO8A 2OA2A 4JGYA 1G8WA 3MF6A 2BFUS 3R0RA 3ZFEB 2RE9A 1GSLA 4Q0QA 2BWCA 3J8F2 3MEPA 1PIV3 2GN7A 4XTPA 4Z92B 4BIFA 3RJRA 4UBGA 4XQ4A 1GQGA 2GMPA 2PAEA 1RUD1 4AFAA 1CAXB 3AZWA 1OPOA 3ZXEA 2VUAA 1VB4A 2GNTA 3W9AA 4CEYC 4NPRA 1DYKA 4RQPB 2X5IA 3E5QA 1PZ8A 3J9SA 3IKWA 1SLLA 3QD6A 5CU1A 1IKPA 3ILNA 1AZDA 1O4YA 1N47A 5JPMB 1DZRA 1ZZ8A 3H3ZA 1OOPB 1DGRN 2EIGA 2XJPA 3TOJA 1R1A3 3N3HA 1AX1A 3H8UA 5BNOA 3ZFFB 5BNOC 3LSDA 3WG1A 3V0BB 4KWJA 3GALA 1EYBA 3ILFA 1OFNA 4NN0A 4HN1A 4CEWC 4CP2A 5C33A 5GLVA 1KFUL 2PLV2 4MV2A 4B8EA 4NHLA 2BVBA 4LTAA 2GC3A 4QGLA 2D5FA 3ZSJA 5EV7A 3V0BA 3J8F1 3ZPYA 5FFOC 1WW4A 4EN0A 3RMXA 1CONA 1LU2A 1BK1A 3POYA 3BOWA 2VNOA 1VBC2 3UK9A 4I09A 2YXSA 2QDRA 2P37A 4LHLA 2OUHA 4OHVA 4U36A 1YI9A 3KGLA 4LBJA 1D0GA 1AR91 3HD8B 2NQYA 1AHSA 3NVCA 3JBG2 2XBO2 2ZKLA 4P9IA 4XFHA 2A73B 2BNNA 1DGRA 4TYSA 3VBFC 2SBAA 1LGNA 2PAMA 1U0AA 5F6LB 1H30A 4N9HA 1JTZX 4XXAA 1C57A 2QZ3A 5I93A 2FBEA 4OI0A 3KCXA 3IDCB 2JDZA 1RTVA 5KHHA 4RA0A 4BZ4A 2WS93 3AM2A 3P3PA 4NVPA 3WHTA 3B94A 4FPYA 3CNAA 1MEC2 2A6XA 4XHBA 5F5QA 3ZXGA 3VKFC 3B93A 4GULA 1R1ZA 3JUUA 4XZPA 4HSJA 5CG9A 3LA7A 4HVRA 4K7JA 3E6CC 2YV8A 1EP0A 2LUWA 1VRH2 2HWF3 4AK3A 3VBOB 1REEA 2WNUC 4UW5A 4EV0A 2UWAA 2YDEA 4XFAA 5T3NA 3A4UA 4LBMA 5DUUA 1Z7S1 4OLLA 3URFA 3AMQA 1O4TA 4GQ7A 1CJDA 3AFGA 5A33B 4K21A 4DQAA 1MZ6A 4LHNA 3KSCA 3O14A 4YARA 1H8VA 1TNRA 2E7QA 5GJ6A 1G86A 2ZGRA 3O0WA 1AR92 1POV0 3PVNA 3ZFFC 2OPKA 4XMIA 1RITA 5ACA3 2E51A 2VXRA 1ZZ6A 3DN7A 2OIIA 2YMZA 4OUSA 4AFBA 4CEWA 5JOYA 1YCIA 1WMDA 3NAPB 5FO9B 1VBD2 2WA4A 3R4SA 2BGCA 3I59B 4I0AA 2JE9A 2HWB3 1POV1 1MZFA 4AFCA 5F9TA 2VUJA 2JECA 2VW2A 5LRSA 3FLTA 1DDLA 2Z42A 2X8KA 5E88A 1J3PA 2R073 4IEZA 5K0UB 2ZS6B 3H9AA 4RR3B 4KH9A 1AR72 1AR62 2AH2A 1PO21 1LOAA 2KA3A 2XBO3 4JRLA 5BNPB 2DVFA 1R082 2P17A 2RS11 4IEQA 2HWD1 1VBA2 1UZZA 5SV8A 1UF2C 1VBC3 4WM7A 2VG9A 3RSJA 1YYNA 1BXHA 1MQTA 3A0KA 1COV3 1H8TB 1AYN2 3BTAA 4Q4W1 3MW2A 4QQHA 5DUWA 5DXDA 3DPRA 1D4M1 3QCWA 4YZ4A 4MGZE 4LEJA 4COZA 3WDWA 1UU6A 1NG0A 1RMU1 2N7GA 4BA6A 2PYTA 4FPEA 4RS5B 4XF1A 4YLZA 4Q2FA 1CR7A 1ZBA1 1W2UA 3WD5A 1GV9A 1FMD2 5DG2A 3FBYA 4E4ZA 1CPMA 2ETEA 1ULCA 2BVVA 2WNEA 4Y1UA 1ENXA 1MS4A 3OGGA 3IWZA 4X8NA 4Y20A 1UIJA 3D6EA 4Q0UA 5KHJA 2W39A 3MFCA 5JI7A 5BNQA 4BMBA 3ZMNA 3V65A 3WCSA 1R1A1 4YM2A 2WNUA 1H4GA 2IFWA 5GZDA 2WLPA 3NWKA 1PVXA 1V6IA 4XFGA 3AMMA 2RMU2 3J26N 5H9RA 5T55A 1VALA 1YWKA 4JDOA 3VBSA 2XKOA 3DKWA 4WVZA 5C9AB 1CPNA 5FQ0B 1QJY3 3FLPA 2XUMA 3KCYA 5KHGA 2RMU1 2LM3A 5JPNB 3ZO0B 1QGLA 2VMIA 1IS4A 3J8F3 4IEOA 3O0VA 4C1XA 5CG8A 2BQPA 4AVSA 1TME3 2DWRA 3MPBA 1AL22 1N1TA 4DOUA 4Q4V2 5SV5A 1ENQA 3JB8A 3LKJA 3B9CA 2R072 4N90A 5L7OC 2MEV1 4CDXA 4Q1PA 1KDKA 4OUMA 4C90A 1F5FA 3M3CA 3FLRA 3M2MA 1H0BA 2XJRA 1D2QA 1JOJA 4I30A 1S2BA 4GIQA 1GNHA 1SMVA 4H3WA 1BBT1 2ZPXA 2QQPA 3RNSA 3M3IA 4KNCA 1WA4A 1RUE2 3E5UA 3K48A 2D6OX 4L9BA 5EYYA 1CIWA 4FPFA 2X29A 2ZX4A 1HIXA 4Q4Y2 3WLUA 2DCJA 1FYUA 3AZYA 3O5SA 1AYN1 5E89A 2EXKA 5FOBB 4HANA 1ASJ3 4I0WB 4BWOA 4Q4X2 1UAIA 3ZX7A 3VKNA 3NW4A 2P2KA 1JYCA 2UU8A 3R6SA 1TME1 4HFSA 2VY0A 2WT1A 5BUVA 2PHXA 3AKQA 4FPOB 1PGL2 3ZSEA 5C8WA 4UW6A 1ND3A 1AR61 5HI0A 1PK6C 1GR3A 4L97A 1RIRA 1NCQA 1Z7S3 2HEYF 3NSTA 4I0BA 4YYOA 3B01A 3UJOA 2CWSA 3KT4A 2R062 2ILMA 4YGEA 4KG8A 2MNGA 2AZ5A 4RGAA 4HT1T 5DG1A 4RSUA 3H0OA 2XJUA 1A6CA 2CYFA 4FXKB 4LUKA 2ES3A 4WVVA 3WDYA 2DFCA 2MHFA 2PHFA 1WMEA 2HWE3 4DFSA 2PFWA 4E2QA 1LHVA 1XYPA 3M1HA 2IXHA 5T5PA 3VBUC 1NE4A 2EF6A 5C9AC 2GSYA 4DY3A 2FMYA 4CDWA 3N7KA 1AXYA 2TEPA 4FPLA 4FOYA 4XW3A 2Q1MA 4OVEA 4QHBA 3USUB 2TBVA 1QXRA 1QQP2 2R042 1RUI1 4BIOA 1FPN3 4YW1A 1GLHA 3HWJA 4PDWC 1PO11 1DLLA 1Y7BA 3ZFGA 3B5LB 1QH6A 4AHZA 1Q43A 4JQRA 3BCWA 5LRRA 3AP5A 3RYKA 3ROUA 3ASIA 4EJRA 2HWB2 1O3QA 2PTMA 1ZZBA 4NO4A 1M4WA 2EAKA 1IGOA 2YHJA 4TLFA 3AP7A 3POSA 2CTVA 4HBNA 1GNZA 3OGJA 4LE3A 3I59A 2ZMLA 2GMMA 1GZCA 4RFT0 1DGWX 1C28A 1RUI2 1XRUA 4N43B 1F9KA 2QZ2A 1ND2A 1NOVA 5JSRA 5CADA 4GMP1 3S30A 5ABJB 1NY72 3ME2A 2VPVA 3KD4A 3SLIA 1RUNA 1Q5OA 5T5LA 3CO2A 1UPSA 4ES9A 1B35B 2QUOA 1GZWB 5JWPA 4XHXA 1V70A 2DVAA 3IBMA 4JGYC 4YVWA 1NCRB 4MZUA 1RJ8A 1PNFA 1RUC3 1W6NA 2LALA 2XL7A 2BNMA 2D97A 3H50A 3MDPA 3WXPA 3ZXFA 4DMIA 4Z1VA 3FFZA 5J37A 4C1WA 2D6MA 3EQEA 5D8AC 3SISA 2CV6A 3AFKA 3DUIA 1O3RA 1QMJA 2WL1A 3KM5A 3NAPC 2DU0A 3ZDSA 1WUVA 2GALA 5CFCC 5H9PA 4CDWB 1A8DA 4NOTA 2O1QA 3FHIB 3VUOA 2A3XA 1UX6A 3WG3A 3LSEA 4S2DA 1NQDA 2UYAA 5EYXA 1S0JA 4M3CB 5BV6A 4SBVA 4AI2A 2QDNA 3O0XA 3SH3A 2CGNA 4P9JA 4JDMA 3MZHA 2ZGMA 2WZR1 5A33A 5JAXA 1PVC3 3VDDC 2C9AA 4H14A 4OI4A 2ZKNA 1KQRA 1RUJ3 1ZRDA 4MUVA 1LHUA 5GALA 5JOXA 1QY4A 2RJKA 1CD3G 1UW8A 4WVMB 1BQPA 3SITA 2O0OA 4CP1A 2DUPA 2NZ9A 1J1LA 1S55A 1NCQB 2VMHA 5ACA1 1JXNA 1Q8QA 1DG6A 3THTA 4AW7A 1WBLA 2EVXA 4H7LA 4NWWA 2ZMKA 3OTFA 1BKZA 4Q0VA 4MGYE 4AHYA 1W6OB 3VBRB 4P9XA 1SLBA 3OY8A 1IPKA 2ZAHA 5FDBA 3TAYA 5TSWA 4IETA 2HEWF 1QJX3 2JJ6A 1UZYA 2VVDA 3WY6A 1X50A 3ETQA 2D6KA 1NCRC 2XG3A 1RINA 2R071 4XF0A 3NL1A 4FAGA 4QPIC 1OD5A 2H6BA 3N7JA 4QPGA 1N1SA 3ZVXA 2NN8A 1LB2A 2DVGA 1FMD3 2WZR3 3S7IA 3OJBA 2CNAA 1VAMA 4GKXA 1RUJ1 2WA3A 1AX0A 2G4IA 3WW4A 1QH7A 4CDUC 4IV3B 2R063 1CN1A 3ZMOA 4ATFA 2JX9A 4XFFA 1COV1 1JUIA 4JGYB 4XIOA 2WINB 1EV13 3AYDA 4WV8A 1BZWA 1ZRRA 4Q4W3 5CFDB 4UBHA 3WDXA 5K9YA 1IPJA 3BOPA 1PMIA 4E4DX 4FP3A 4WM8C 5CFDC 3OF1A 4Y4YA 5L73A 2HWC1 3RPQA 4XPVA 2UY8A 3WNXA 1SCSA 3JQXA 4F83A 5F6KA 1R083 2XHKA 1TE1B 1ZA4A 4XXPA 1MS8A 4B3NA 1FAYA 1ZM1A 1QOSA 2SLIA 4R8HA 3H1YA 4KWKA 2RS52 1VBB3 4XF3A 1DQ6A 1DHKB 1WD4A 2D3PA 2QJVA 2XB6C 4B7EA 1KRIA 2O8QA 1ZBA3 3USSA 4JGZA 3MF9A 2PHRA 4XF9A 2YZ4A 1DYPA 5JZGC 2QCSB 3WP4A 1SLTA 3JZVA 4ASLA 2DCKA 1RUG1 3GZTB 3UV9A 1EPWA 5HCBA 3LWCA 1MVQA 4XETA 1FOD3 3KB5A 1QJY1 5CVRA 3N4MA 4FOVA 1HXS1 5C4WB 4LBKA 3AJZA 2WNVB 1HQLA 4GWNA 3SXWA 5FMOL 3ZYJB 4PBOA 1TME2 3LA2A 5T5OA 4E2SA 3ZFEA 4Z82A 2RR12 1SDWA 1SBDA 2VVFA 4IV3A 3U4XA 2DUOA 1NLSA 3AKTA 3AMPA 4FP2A 3OPZA 4Q0PA 4AVBA 3VDDB 4ITCA 4Q27A 5JVVA 2DCZA 3N36A 1WCSA 1AYM2 5HCFA 1BEV1 2XPJA 4RQPA 5GLTA 3ZFGC 1G9DA 2ET7A 5FO7B 1QU0A 4KQ7A 2R6QA 3GBFA 2JG9C 4LE4A 1LHWA 1X7NA 4Q8LA 1O4ZA 4CDQA 4YGCA 4W65A 1PGSA 4BOWA 5J96B 1R091 1HV0A 3LCPA 4JVAA 1U5IA 2MEV2 3MLLA 5IK4A 3FX3A 4HMZA 5KXEA 3PVEA 5I0UA 2Y0IA 5DZGA 2ZGKA 4QQOA 3VHOA 5ABJA 2X53S 3WUCA 3OYWA 2VW1A 5T52A 3THPA 4W6YA 2V5YA 1KDMA 1NA1C 4C0BA 3INAA 2DU1A 2PHWA 4L11A 3VDDA 2NP0A 3HT2A 1KXGA 4XFIA 3FUOA 2ZHNA 3AZXA 4I02A 2YGMA 2VGDA 2WQZC 1C8M3 1G7YA 2Z2SB 4XTMA 2IXIA 4XJZA 3VBRC 2YC0A 1H2MA 5CNAA 1QJU2 2YGLA 1V6JA 3MICA 5GLUA 4L92A 3GBWA 3QH7A 3AP6A 3ZN6B 1K5MC 1HLCA 3DPRB 3C3VA 1PIV1 2YYOA 3ACLA 3IN9A 4FTBA 2XL9A 1UMZA 4OZXA 2CGOA 4KBBA 3HQXA 2TNFA 3AK0A 1C3HA 1LR5A 1ZYBA 2C0ZA 4XILA 5E8AA 3KZ4C 4NWVA 4N53B 4R52A 1PVC2 1FV2A 2GNBA 4LULA 1YJLA 1KITA 1PZ7A 1LECA 3G7DA 1H2NA 3B02A 3EHKA 4JCKA 3KGZA 2NM1A 3QH6A 3PTYA 4QQ2A 1V6OA 5FLIA 3P3NA 3ZYRA 1VBD3 2H0BA 4JGZB 3CU7A 3H3UA 3M8LA 4RD7A 4K3UA 4Z8BA 5T54A 3WDTA 4AYUA 2BNOA 4DZGA 4ZXKA 2E7TA 5KXCA 2ARXA 1AJOA 1PO13 1AR93 2Y0OA 2WT2A 3HN1A 2OVUA