5L73A

Mam domain of human neuropilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
QDEFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Neuropilin-1 MAM Domain: Completing the Neuropilin-1 Ectodomain Picture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-1
total genus 34
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l73A00
4C1XA 2A5ZA 1DHKB 3N36A 1W6QA 2R0FA 4FOVA 5CNAA 1S1AA 2ZGSA 3I4IA 1Z0HA 1D2SA 3MW4A 4M3CE 4Y26A 3AP6A 1N3QA 2JJ6A 1G9BA 4AVVA 1VIWB 1U0AA 1EPWA 2D44A 1LEDA 4GALA 1N3OA 5GLTA 1KDMA 5EXOA 1N1SA 2D6NA 1YXWA 5DUXA 3WG4A 3N7MA 1DQ2A 1JN2P 1VAMA 2ZGLA 3APBA 2A6VA 2WQZC 4YG0A 2GMPA 3R4UA 1HKDA 1CVNA 2G4IA 1BZWA 3WHUA 1HLCA 3H0OA 3Q9OA 1AZDA 2DURA 1GZWA 3WCSA 2DTWA 2PELA 5JOZA 2A6ZA 1LODA 2DUPA 1URXA 2GMEA 1OQ1A 1S0FA 2E51A 1R1ZA 2R1BA 1D0HA 1LOEA 2HYKA 1KRIA 2ARXA 1SLCA 2RHPA 3N7LA 3AP5A 4I30A 3RS6A 3M1HA 2EF6A 2A3XA 2A71A 2ES3A 2NMNA 4M3CA 4CRQA 1LENA 3PVNA 1C1FA 1W6NA 3WHTA 3POSA 4M3CB 1UL9A 2JE7A 3POYA 4FPCA 5GJ6A 1S0IA 1WLCA 4OZXA 3AP7A 4ATEA 1KJLA 2B7YA 4FPGA 4FQ4A 4UW4A 2WJSA 4XBNA 5GALA 3AZZA 1LEMA 3OJBA 1Q8VA 2ERFA 5E8AA 2D6LX 3NWKA 1N47A 1Q8PA 1QKQA 2AH2A 1UZYA 3N3HA 4YM0A 2NN8A 1LOAA 2W68A 4YFZA 1DYPA 1V6KA 2ZHKA 2SBAA 1GV9A 2EXJA 1QU0A 1N1VA 4DFSA 1A8DA 1LOBA 3A0KA 4Y22A 1Q8OA 2CNAA 1V6OA 2ZGKA 3SITA 2AR6A 3IPVB 1W6PB 2A6YA 3AJYA 2AREA 3WDXA 5CA6A 2XG3A 1AX1A 4CTEA 4BMBA 2ZMKA 2D3SA 1W6OB 4XIKA 1MS9A 4PQ9A 2C9AA 2I2SA 3V0BA 1BYHA 3AYDA 4NOTA 4HANA 2PHRA 1SCSA 1V00A 2D43A 2UU8A 2ZA9A 1ULGA 3CNAA 1A3KA 3WVJA 1Q56A 1S0BA 2AENA 2CTVA 3WZ1A 1I1EA 1IKQA 4FPLA 3I8TA 4PCRA 4YG3A 3T1LA 3ZXFA 1G9CA 4Q8LA 3LSEA 3JUUA 4XJAA 2NM1A 3ENRA 4LBLA 1YRZA 4XYXA 1MS8A 1Q8QA 2NP0A 4YGCA 2H0BA 1G9DA 4C1WA 1JUIA 1N1TA 5CAZA 3W59A 4ASMB 1JXNA 1W0OA 5IUQA 1ENSA 1VALA 2DU1A 4DPNA 5DZFA 1GYKA 3V64A 4XIOA 3FLPA 3B3QE 3N7JA 4L8QA 1AX2A 1LOFC 3T1MA 2ZGMA 5CBLA 3AXDA 3FLRA 1FX5A 3M3OA 4Q1RA 4YGEA 3ILNA 1F31A 5DZGA 4AVTA 1H9WA 4BLJA 5GLUA 4FPHA 4Y20A 3WG1A 4BQ1A 1UZZA 2NZ9A 2YXSA 1DIWA 1KDKA 5KXCA 3IN9A 1LOCA 4Q8KA 2VU9A 1WW6A 4P14A 1DQ6A 2JDZA 2XB6C 1LCLA 3KM5A 3OY8A 5T55A 4LBKA 1DGLA 3O0VA 5H9PA 1CESA 1GANA 4XXAA 1WLWA 1S0CA 2A7AA 4AWDA 3V0AA 2W52A 1UX6A 2ZAAA 3FLTA 4YW1A 1CIWA 3HN1A 1QDOA 2Z42A 4JRAA 3LCPA 4XJ8A 1RITA 2GN3A 4LBJA 1MS4A 1LU2A 2YMZA 1IOAA 3C2UA 5H9QA 2P3KA 5T5OA 2ZGUA 1F9KA 2ZBJA 1LHNA 4XMAA 4Y24A 2ZHLA 3B9CA 3VKNA 1MS1A 1WW4A 4RL7A 1QOSA 2UWAA 5T5LA 2GNTA 3ZXJA 1F5FA 4YW3A 1JW6A 2R1DA 4ISQA 4RA0A 2DTYA 5JMCA 3USUA 1O4YA 1ONAA 1S0EA 2GN7A 2P3JA 1AJOA 4GWMA 4R9DA 2YZ4A 1SFYA 1IS3A 2YV8A 3O0XA 3WV6A 1FAYA 3W58A 5JDBA 4ISRA 4XILA 3R4SA 1DYKA 1SCRA 3PVOA 1CR7A 2JKBA 4P9XA 1HDKA 1V6MA 2EXIA 3M3QA 1ULCA 3ILFA 4MYEA 1Y7BA 2VY0A 1LHVA 1DQ4A 3OBRA 2ZKNA 2D6PA 5DXDA 1SLAA 2ZGNA 4FPYA 4GXLA 1MACA 4PBPA 4BPZA 3R05A 1JBCA 4LBOA 3IPVA 3TB0A 1W6PA 2LTNA 3A4UA 5CB7A 3RRDA 1GNHA 4K20A 3KQRA 3OYWB 3QCWA 3T2TA 5JOWA 4DQAA 1DBNA 1G7YA 2TEPA 1NLSA 2A70A 2D6MA 2ZGQA 2CWMA 1C4RA 1BQPA 5GLWA 1AX0A 5IK5A 2VW1A 4K21A 1KQRA 2WKKA 3NV4A 2D6OX 4FOYA 2KM2A 3HR9A 1JOJA 5F5QA 1GZ9A 2PHTA 3AYCA 2GNBA 2PHWA 4LBNA 3IM0A 1JYIA 1HQLA 2DYCA 2ENRA 3POWA 1N1YA 1MVEA 1MZ6A 2NYYA 4XTMA 3AYEA 4XOGA 3GNEA 2PHFA 5E89A 4M3CF 5DZEA 1QGLA 5JLVA 1MS3A 3PJQA 4YW4A 3OGGA 4ATFA 1V6JA 4Y1YA 5HCBA 4D69A 4FOQA 3ZYRA 1YI7A 4FPJA 2WLQA 3TAYA 1CPMA 4XJUA 4YM1A 2R49A 4FPKA 1G8WA 5HCAA 1A78A 1FYUA 4LBMA 5T52A 2ZHNA 1WBFA 3VKOA 5FREA 2CL2A 3RMXA 4YZ1A 2P3IA 5IK7A 1I3HA 2ZACA 3MEPA 2E7QA 2EXHA 4IQPA 2EALA 2VXRA 3NV2A 2CWSA 3SH4A 3UK9A 4XBQA 1AXZA 1LU1A 5KXEA 4KBBA 4Q2FA 3RQ0A 1WW5A 4XZPA 1V6IA 4LBQA 1IKPA 3L2YA 4P9YA 5HCFA 1ZM1A 2D7FA 5JVVA 1AVBA 1SBEA 3OY8B 1DLLA 3WLUA 1GZWB 3ZVXA 1W6MA 1LHOA 1ENQA 2ARBA 2ZABA 4GKYA 5FRAA 3WG3A 3SISA 1JYCA 1LGNA 3AX4A 4U2AA 3ZSJA 2DUQA 2C5DA 4LBQD 5T50A 1BXHA 3RG0A 3NV3A 1ULDA 4Y1UA 5L73A 2A6XA 4FPOB 2DUOA 3B00A 2PHXA 1QMJA 4GWNA 5GLZA 4YZ3A 4ZXKA 5LK5A 3MW3A 5DUUA 2W08A 1H9PA 1GSLA 2GNDA 4WZFA 3D4KA 5EYYA 3ZXEA 1QOTA 2FMDA 4Y20B 1GICA 1LGCA 3WUDA 1QNYA 2SLIA 5EWSA 1AJKA 3USUB 1RIRA 2CY6A 2ZZJA 1DQ5A 3DUIA 4YZ5A 2ZGTA 2ZMNA 5GZEA 1ZA4A 1XQNA 3M2MA 3PMEA 3ZYPA 2UWCA 2WT0A 4ZKTB 1CJPA 1IS4A 2A6WA 5IK8A 3AZVA 4XE9A 3WDVA 1LJ7A 3BOPA 4UW6A 3OPZA 4XJWA 2E7TA 3V0AB 1GBGA 1C57A 2OUJA 1CONA 2V73A 3VUOA 4GKXA 2AYHA 1W6OA 2A3WA 4YM3A 4FOWA 5DG2A 5KXDA 3JU9A 2D3PA 3BTAA 4XTPA 2P34A 2VH9A 3B01A 2A75A 5GZDA 3WDYA 4AGGA 1S0JA 4DRRA 1W6NB 3WUCA 3O0WA 4K1YA 4R9AA 4UW3A 1UKGA 1G86A 3HMYA 4FP3A 2AUYA 3MPPG 3VKLA 5GM0A 4XDQA 1PZ7A 1DQ1A 2DVGA 4FPFA 5DUVA 3UL2A 4WVVA 1QDCA 3VKMA 1WD3A 1DFQA 1W0PA 1TEIA 3ZXLA 4YG6A 5JOXA 1UMZA 4TZDA 3ZSMA 1GKBA 1SLTA 1OKQA 2DVDA 4P9WA 2WSVA 5GLVA 1FATA 2Q5TA 1UPSA 3B69A 2CYFA 4JCKA 1J1TA 2JD4A 4Y1ZA 3AZYA 3AZWA 3GALA 4YZ4A 1Q8SA 1W6QB 2WSUA 3SNMA 1Z78A 2P2KA 1ULEA 5KXBA 3D6EA 2W39A 3N7KA 3WDUA 1FNZA 2V5YA 3WDWA 2YROA 1LOGA 3ZSKA 4BM8A 5GZGA 1N3PA 3RMYA 2VW2A 2AGSA 1AXYA 3FUOA 2A3YA 3ASIA 1MS0A 3NV1A 4XJZA 1UN1A 3AP4A 4U36A 5EYXA 1QOOA 3VV1A 2YY1A 1SBFA 4UW5A 2DVAA 4W65A 4YLZA 4BOWA 3FFZA 2DVBA 4H55A 5H9RA 3ZPYA 1MVQA 5T54A 1W6MB 3AZXA 1WCSA 2E6VA 4YZ2A 1KITA 4TYSA 4YGDA 1OFSA 1AF9A 4WVWA 1WD4A 4GA9A 1S0DA 2BQPA 4XHBA 1X50A 4YGBA 3ZSLA 5IT6A 4K1ZA 1PZ9A 3VKFC 4AVSA 2WT1A 1VLNA 1WLDA 2FHRA 1VAVA 2ZMLA 2GNMA 3AJZA 4AYUA 4PBOA 1LESA 4BLIA 4HL0A 2OVUA 4Z8BA 4YFWA 3SH3A 3BIWE 1RINA 3OBTA 1BKZA 1IS6A 1BJQA 1LHWA 3IKWA 1SLBA 2JE9A 3AXEA 3M3EA 4LBQB 1SLLA 4XHXA 2DV9A 5E88A 4YW5A 5H9SA 3WDTA 4Q26A 5GZCA 3WNXA 1LHUA 2JECA 1CQ9A 1JHNA 3WCRA 4Y22B 2UURA 4DRVA 1MS5A 3N35A 5SV8A 1GZCA 1WBLA 1CPNA 4DS0A 5IK4A 1UAIA 3AFKA 2EXKA 3UJOA 3FBYA 2UWBA 4FQZA 1YIFA 2VUAA 2E53A 2OUHA 3ATGA 3FUQA 4BMEA 4FVVA 4Q27A 5DUWA 1AXKA 1WW7A 4FPEA 1YYNA 4ITCA 1DQ0A 3D5OA 3V65A 3O12A 3AK0A 4Y1XA 4YW2A 1QF3A 4R9BA 4AGVA 1FV2A 2WNEA 4XJ9A 1ULFA 5GZFA 2GALA 1FV3A 5JOYA 3INAA 2D3RA 3DGTA 3LSDA 1FNYA 2DWRA 1G9AA 2PHUA 1O4ZA 1YO8A 5BYNA 4YM2A 2VW0A 1C1LA 1LULA 5AVAA 3SLIA 4XBLA 4PF5A 2DU0A 2ZGRA 2P37A 3PVEA 4FP2A 4Q1PA 1LTEA 2DVFA 3UJQA 4NO4A 3ILRA 1WUVA 3A0NA 1MZ5A 1LGBA 1PZ8A 1QNWA 3QLQA 1LOFA 4F83A 2OW4A 5DG1A 4AGRA 1DZQA 3IMNA 3WG2A 1GNZA 3AP9A 3OYWA 2R16A 1H30A 1S0GA 3V0BB 1B09A 1LECA 1CN1A 3ZXKA 1ENRA 1SBDA 3RSJA 3O5SA 2EIGA 3BODA 4JC1A 4WV8A 2ZHMA 1KJRA 2GDFA 2GMMA 5T5JA 4XXPA 1V6LA 4R9CA 3SH5A 1HQWA 3AYAA 1MR5A 4XMIA 4M01A 1GLHA 1SLIA 2LALA 2WT2A 4CZSA 2ZGPA 3U4XA 1SACA 4Y1VA 4SLIA 2D6KA 2EAKA 1APNA 4M00A 1G9FA 1V6NA 5F9TA 2NMOA 2ZGOA 3M3CA 1NXD1 3MW2A 5T5PA 2R0HA 1IS5A 3WOGA
chains in the Genus database with same CATH superfamily
1EAH2 1IG0A 2A5ZA 3D8CA 5FOJB 1F5JA 1S1AA 2ZGSA 1Z0HA 3MW4A 4M3CE 2BERA 3CHXA 3PIJA 1W28A 2WS93 4AVVA 2BBAA 4E4ZA 5J7MA 1HB4A 2JG9B 4IV3B 5FYSA 3TNPB 4QXCA 3M70A 3WW3A 4Z1VA 2Q1ZB 1H4GA 1NT0A 4YW6A 5EXOA 5DUXA 3WW4A 4ZHNA 3C7GA 4DXSA 3N7MA 2E9QA 1JN2P 2TBVA 4A3ZA 1VAMA 2ZGLA 4YG0A 2WQZC 2GMPA 1ZREA 2RJKA 1BZWA 5A3OA 3T4HB 3FL7A 5CFDA 1AZDA 2DURA 4OCTA 2PELA 5CFCB 2D40A 3AMHA 3K75B 4E27A 5ACA1 3OD4A 1OQ1A 1TZOA 4LXLA 3RZLA 1ZZ8A 1Z7S2 5FZ6A 3LEMA 1RYYA 2ATFA 4I30A 2WS92 2DCYA 2EF6A 2VVEA 1VR3A 2ES3A 2J1SA 4EYUA 5E1RA 1RXFA 4CRQA 1OVPA 5FTTC 2BW8A 3WP3A 3OUHA 5A3NA 4M3CB 2WZPP 1QWRA 1UXZA 1EP0A 5AC91 4KWUA 3AP7A 2JDKA 4ATEA 1AR81 3OJBA 5F3EA 5C4WA 1NLQA 2RS51 1PK6C 1W90A 1AHSA 5E8AA 2E63A 2RR11 3JCIA 3VBUB 4CDXB 1N47A 1Q8PA 2AH2A 3I3EA 4IV1B 4YM0A 2W68A 2QQKA 3NNFA 2IFRA 1RUOA 1VP6A 4IEVA 3TEXA 3KVBA 1PGL1 2WAOA 1N1VA 3HBZA 1A8DA 4Z2WA 4RR3B 5ABJA 2BYVE 4QKNA 4BXSV 2CSGA 3PUAA 3ZXGA 1KEXA 1HN0A 2A6YA 3JXSA 2GAUA 1QXPA 4LA3A 5F7UA 3SC7X 2CDPA 4BMBA 5F6LB 2ZX0A 4PQ9A 2GZWA 1KFUL 2I2SA 3V0BA 1XXNA 3HD8B 4RGKA 2YFUA 3UT0A 5LCWL 2PHRA 1V00A 4OFGA 5FZ0A 4E2SA 2ZA9A 3WW1A 4OUEA 1OBNA 1Q56A 2WZ8A 2BWAA 1B35A 4EZ4A 3I8TA 4PCRA 3LZZA 4YG3A 4YWAA 4AI9A 1H4HA 4LE3A 5JZGA 4D94A 2BV4A 4RD7A 4ZU4A 3ENRA 1YRZA 1OH3A 4XFIA 5DABA 3HBKA 4C91A 1A6CA 2C1FA 3GBFA 4NPLA 3POFA 2E32A 1G9DA 2VTXJ 4C0HA 4SBVA 4BHPA 2FD8A 1W0OA 2BEOA 2JENA 3KV9A 1UD1A 1H8TA 4Q4V2 4BWOA 2DU1A 1O6UA 1BEV1 1H8TB 3ZFGB 1UYPA 4S2FA 4NRPA 5CISA 3FLPA 2FBEA 4CDWB 2RM22 3Q8CA 4MOAA 1AX2A 1SEFA 1SG3A 3JB4C 5CBLA 2JDAA 3SMHA 2YC4A 4Q1RA 4Q0PA 4YGEA 3ILNA 5K0UA 1D4VB 4E9KA 5LY1A 1HXS2 1W9WA 1YFWA 2NZ9A 3DN7A 1VE0A 2VR4A 2BGPA 5CFDC 2VQAA 1ASJ1 3ZYGA 3AKTA 1BVP1 3AB0A 4B1LA 4AZZA 1WW6A 1DQ6A 5HV0A 3KT7A 1LCLA 2JG8C 3JZVA 4N53B 3SCHA 1U5ZA 3CLPA 3JD72 4XF4A 4DY5A 4IEXA 5KC6A 4EROA 1W8HA 2CU5A 1D2QA 1OLRA 4IEUA 1OA3A 3J7HA 1GANA 3Q8FA 4CPBA 3NRUA 4AWDA 2W52A 4A41A 3ZN6A 4YW1A 1CIWA 3DEMA 1W9SA 3I3MA 3PL0A 3WNLA 4XJ8A 4CCEA 1J3QA 1RITA 2GN3A 4LBJA 4LNVA 5M0TA 5BPXA 4BIFA 1PGL2 2VQTA 2WNVA 1LU2A 1OPMA 1UOJA 1Z7S3 4MHUA 4HKLA 3TWIA 3ZYJB 2P3KA 2WNVB 4XMAA 3DYMA 3WQ0A 4Y24A 2ZHLA 1R1A2 2O1QA 2YG0A 1RUD2 4W6XA 2QKDA 2Y60A 4RL7A 5F2SA 4ZY9A 5T5LA 3VKNA 4Q4X3 4YW3A 1AR82 3WF2A 2DTYA 2HWB3 2PN5A 3FC0A 4GWMA 3VBUC 1NQDA 2WA4A 4QPIA 2W92A 5BNPA 3BTYA 1GQGA 2IUWA 1J58A 3WNKA 2VD7A 1GWLA 4OULA 4P9XA 1CR7A 4QD2A 2D5HA 4COVA 1QJU3 1ULPA 2EXIA 1IZ3A 2VPVA 3HJRA 4XUTA 1Z7S1 2IXCA 3J7MA 1LHVA 4GAZA 1KD7A 3RNSA 5FZOB 3WNOA 4JKLA 4BK4A 4GXLA 1MACA 3IPVA 3RRDA 3THCA 5D8AA 1GNHA 5FLIA 4DQAA 1WMEA 2PQQA 2TEPA 1NLSA 2A70A 2D6MA 3NJYA 4H14A 4Q5OA 2CWMA 3I97A 1AR83 2OKXA 2WNUA 3OUJA 1OOPB 2DDUA 5FY4A 3P6BA 5JSPA 2VW1A 5IK5A 3ZX7A 4XABA 4PHZA 3MO4A 2KM2A 5F5QA 1L7RA 4LBNA 3IM0A 4OHYA 1X8MA 1JYIA 1HQLA 5G04L 1W8WA 2ENRA 3POWA 3ZR6A 3LIGA 3IIAA 4Y4RA 4DXRA 2HWF2 3GNEA 1UOBA 4KGGA 1QH6A 4S2HA 4XOGA 4AEDB 1X36A 4IV1A 4YRDA 4YW4A 4EWDA 2HWB1 2YHJA 3IB3A 4FOQA 3DPRA 4W50A 4J25A 5FO9B 3ZYRA 4MGYE 3WNMA 1ZZ9A 1QIQA 2VECA 2XKOA 4NHMA 2V4AA 4AFDA 4AHYA 5LASA 1VBA3 5K0UC 1ZZBA 2R49A 1X9PA 2QQVA 2Y6JA 3DXTA 1H2NA 4FPKA 5KHHA 2J1RA 4LBMA 1CWPA 1L7LA 3MIEA 3IIIA 3VKOA 1VB2A 4BYYA 2W5FA 4V1PA 2C0ZA 1I3HA 1POV3 2ZACA 3MEPA 2EXHA 1R081 3NV2A 4OI2A 1E5HA 4CP1A 1PVC1 1S2KA 4I0WB 5HPOA 4KBBA 4NHXA 4Q2FA 4FAGA 1LAJA 4UFIA 4XFHA 4CDUC 4XZPA 1V6IA 1H1IA 1IKPA 3L2YA 1ZM1A 2VO5A 2Q8CA 3VZKA 3BIEA 1DLLA 1NA1C 2VUDA 2ZEXA 1GZWB 1RUH3 3NAPC 3ZVXA 4WM7B 1AR71 2XUEA 2BP6A 4CEYC 1PK6A 2B39A 4LBQD 4DUXA 3N9PA 3NV3A 4N43A 4ARXA 4Y1UA 4FFIA 4JGYC 2W1WA 4N43B 4QQPA 2DUOA 5HBAA 1P8JA 1IPKA 1FPN3 3ZIXA 2FDJA 3DCQA 4X8NA 1RVF2 5DUUA 1UOFA 1H9PA 5FZIA 1US2A 2RDRA 5IVBA 1GSLA 3LA3A 4WZFA 4V2VA 4MZUA 3ETPA 5EYYA 5HXVA 5BNNA 3O1PA 5FBZA 5FOBB 4RFRB 3GZAA 5I93A 4CA9A 2VAUA 2CDOA 3W5NA 5EWSA 2Y6KA 4UAPA 4YYOA 2RE9A 2ZPXA 3TRSB 2ZGTA 3ZYPA 1W8OA 2UWCA 1S55A 5ANQA 1IS4A 5F5CA 4AL9A 3I3DA 3OUIA 1B35C 2X09A 3WDVA 4UBHA 3FZ3A 1XSRA 2IVJA 3UESA 5JR2A 3K4ZA 5JZGC 3OPZA 3SCGA 1OA2A 4GH4C 4XUNA 2JEMA 4M0HA 3THTA 1OLQA 1YEWA 4KMQA 3T0DA 5J37A 2WA3A 1ND3A 1QJX3 2JB8A 2AACA 2VBDA 5IVEA 1ND2B 4UYBA 5G05L 3OCPA 1PO11 1DGWX 1UZVA 4E8DA 1VBD2 2D3PA 5JXIA 3WINE 2P34A 2WINB 5EZWA 3T2OA 5GZDA 4FXKB 3WDYA 4AGGA 5J09A 3I2KA 2OPWA 3O0WA 4NN0A 5FYVA 1OKOA 5JAXA 4CUBA 3RPQA 1JMUB 4QDQA 4IEOA 2J1TA 1NE6A 5GKAC 4AEDC 5FK7A 3AL5A 1QDCA 4XCAA 1WD3A 1W8TA 3WEZA 3ZXLA 3S5AA 4Q4V1 3TEZA 3GCWA 3W9AA 4N8MA 2WO1A 1OKQA 3H8UA 3WW2A 2DVDA 1POQA 4MG2A 5I0RA 2MEV3 2DFCA 1OI6A 2FCVA 4NIGA 5EQUA 3GJAA 3B69A 5F5AA 4G4FA 4Y1ZA 4FI9A 1K5MC 1VMJA 5A70A 4JDMA 5JMOA 5HV4A 1YWKA 3CJIA 5A7SA 3BUCA 4AHZA 5KXBA 3D6EA 3NKTA 5IAXA 3GGLA 4IGOA 3M4FA 5LBFA 2O14A 2K9ZA 3R0RA 3W21A 1LOGA 3K51A 4RS5C 2YBKA 3UKNA 4BM8A 1VBE1 2HWE1 3K4AA 2VW2A 4NHKA 1VRBA 3RMYA 3ZPOA 3FUOA 4TWTA 5BUVA 3GZEA 1C8M3 4XJZA 1NA1A 1VBD1 1DGWA 4N9IA 1UW8A 1U5IA 3VV1A 4AFAA 1NA1B 2VJXA 1SBFA 3FHAA 1VPHA 2DVAA 2AEYA 3OB8A 5A3WA 3B93A 4OI1A 1TG7A 5LA0A 2VMIA 4Q4W1 3HQUA 4MXVA 1L3JA 2CGNA 1JYNA 3DYOA 5H9RA 5T54A 2ARCA 1W0NA 2C4XA 3VLBB 4KL1A 2EIEA 5A7QA 2FDGA 4TSVA 1UU5A 5FFOC 1OFSA 1AF9A 3MIHA 3VGIA 2RR12 2A1XA 4QX2A 3GHMA 3LA7A 2OS2A 2XBO3 4YGBA 4UFLA 2WDBA 5FXVA 5IT6A 1DCSA 1OA4A 5B2GB 1NKGA 4LE4A 3WQ1A 2QQOA 2W46A 4LHSA 3ORJA 3K48A 4NWWA 3WNNA 5A80A 5C6CA 4E8CA 2WO7A 2WZR1 4BLIA 3ZXAC 5FJHA 5FY7A 3RGBA 4DINB 4XDPA 4Z8BA 5BXXA 1AR73 1RINA 3OBTA 4FTSA 1K42A 1BKZA 4A7KA 1W9FA 1IS6A 1BK0A 1OSGA 3IKWA 1PO23 1W2TA 2JE9A 2ZOEB 3HWJA 1VBC1 5E88A 5H9SA 3WDTA 1VB4A 4G9SB 3WNXA 4YVSA 3O1VA 2JECA 4Y22B 4WM8C 1MS5A 1OF4A 3VD7A 3J26N 4Y33A 1PK6B 4CDXC 1DU3D 3N9QA 2E26A 2C6SA 3OF1A 2QQIA 3KLSA 2OZ6A 4P00B 5D8AB 5FV3A 3T4VA 3ZOIA 1C28A 1X7NA 1HQNA 1YIFA 3ATGA 2JG9C 4IV3C 2B8MA 3ECQA 1JYWA 1AXKA 1QQP3 3PHMA 4FPEA 2R32A 3ES4A 4ITCA 3D5OA 4BQ2A 3PUQA 3AK0A 4Y1XA 5K4LA 1QF3A 1R082 3VBOA 3HNMA 3K77A 5FZLA 2G9GA 2G9ZA 4QGLA 2AC1A 2VZUA 1FV3A 4KBZA 5JOYA 1COV1 2WFF2 1EAH1 2D3RA 4AFBA 5LW9A 1ZBA1 4R4ZA 3F95A 4A4AA 1G9AA 2VUCA 2FDIA 4LLOA 1ST8A 1YO8A 4AQTA 3ME2A 3U75A 5D1IA 5AVAA 3SLIA 4Q1PA 1Y9MA 2I45A 2HWB2 3JBG1 5FMBA 3FWEA 1SPPA 1QNWA 1PZ8A 1UNBA 2QQLA 5C71A 1YC61 2HWF1 5DG1A 1DZQA 3IMNA 3LE0A 3WG2A 4MGSA 1GNZA 1PVC3 4XPVA 1JHJA 1ZRIA 1WMXA 3OYWA 2FZ2A 3ZDVA 1H30A 3QH7A 1YQ6A 1WZXA 3EB7A 4MUVA 3ZXKA 1QJEA 3FFQA 3OPTA 3IAPA 2EIGA 1RUE3 2JX9A 3BODA 3ZFGC 2GDFA 4IDZA 3ZYBA 2PMWB 2YYOA 4CCJA 4YVWA 2GMMA 5T5JA 3BTXA 3BCWA 3SH5A 1HQWA 3AYAA 1QQP1 1MR5A 1XU1A 1MQTA 2P5BA 4A6SA 1GLHA 3X29B 2LALA 2WT2A 3DF0A 5FPVA 4CZSA 4SLIA 2D6KA 1YLLA 1EY2A 3I3BA 5FZMA 1V6NA 2XJVA 2NMOA 2ZGOA 3M3CA 3PLQA 1AL23 4LK7A 4F8AA 1YJLA 5L9RA 1WWYA 1IS5A 3GF6A 1XNDA 3IAQA 3OGRA 3RWKX 2R0FA 1K45A 1NXMA 2BGCA 1MZEA 3CJIB 1OMIA 1D2SA 2MNGA 3KSCA 3UYJA 3KWVA 3NJXA 4QPYA 4UF0B 4EQVA 2XKPA 1EV13 3MPBA 1G9BA 4D0QA 4NWVA 1U0AA 4IE6A 5FZ1A 2NPIA 2D44A 1LEDA 1N3OA 5EPAA 3ZO0B 3TEWA 3KS7A 1KDMA 1NCQA 2PXJA 4MLOA 5A3UA 5FWEA 2D6NA 3N9MA 4AF9A 4AE2A 3MLJA 3PTYA 4P9JA 1JTZX 1OQEA 3BU7A 3APBA 1CVNA 2ORXA 3KF3A 5DDJ3 2D98A 3OGSA 2VZPA 2Z69A 3MV11 3ZFFA 1DG6A 3J4UH 3WCSA 2DTWA 5JOZA 4HPKB 1R1ZA 3K3OA 3SEPA 4B3NA 1ND3B 2WYSA 3AMPA 2GP5A 2RHPA 2GP3A 3M1HA 2WZR3 3B9IA 3I59A 2IZWA 1XOYA 3LGRA 5C5TA 1MEC2 2Y26A 3HQRA 1REEA 4ORFA 4ET7A 1RUJ1 2BVBA 2VMHA 1H2MA 3POSA 3GXUA 1UL9A 2JE7A 4FPCA 5GJ6A 1E5SA 1JU3A 1WLCA 2XJQA 1C8NA 4QPIB 1UMHA 5B4XA 4FPGA 4UWDA 4UW4A 2RM21 5GALA 3AZZA 4EN6B 1Q8VA 4A42A 4B8EA 1OOPC 5CKNA 5FR3A 5ANNA 3NWKA 4P5YA 2BZDA 3N3HA 3POBA 2HEYF 1AR61 4D6RA 1LOAA 3EMRA 2VBPA 2ZKLA 4CUCA 1DYPA 1V6KA 3VBSB 5C4WC 1DZTA 1GV9A 2EXJA 3OBAA 4MGZE 2JDPA 1REFA 2ZGKA 5IW0A 3SITA 1VRH1 3IPVB 1O4TA 2IVIB 1XPWA 1AX1A 3HQXA 3PIGA 4NRQA 4CTEA 4XETA 2ZMKA 4QX5A 2JDUA 2WUHA 1W04A 2C9AA 3RZGA 4HFSA 5FP3A 4NOTA 2GC3A 1OC1A 3CQOA 3E1F1 1GUIA 1SCSA 4GULA 1CAUA 4HANA 4GB33 4LO7A 2OYZA 3SHRA 2Y64A 3KCXA 5J98B 4D7SA 3PDQA 1BMV2 2AENA 3NSTA 1PX4A 4DXTA 3LPFA 4EV0A 1HRI2 1PIV1 3T1LA 3ZXFA 4A7YA 4Q4Y1 3LSEA 3OD0A 4CEYA 2PLV1 2RS11 4QMAA 4NROA 2W95A 3Q8EA 4EN0A 4N43C 1Q5OA 4D6SA 3O1MA 3BPZA 4COUA 1NX9A 2H0BA 1OLMA 3KGLA 4FO9A 1NQJA 1JXNA 5IUQA 1VALA 2RS33 4JQTA 1SPPB 4K40A 5FKCA 4DPNA 5IHRA 1JYVA 1I5ZA 1GYKA 4XIOA 5D2AA 4ZZ8A 1ZBE3 3H42B 2N7GA 4HLTA 5FP9A 5DZGA 4BLJA 4P9LA 1F31A 4AVTA 4L97A 3VD4A 3WG1A 3LDRA 4QGNA 4BQWA 4QPWA 1R1A3 1KDKA 2VC9A 2AZ5A 4QX1A 3WD5A 5DQ0A 4YVWB 3H3ZA 4ZONA 4YNIA 1UF2C 4K8FA 3OY8A 5F5IA 4AQSA 4QDSA 2V09A 3WP4A 4GB31 1DGLA 3HPNA 4HSLA 4P9GA 2B46X 2PLV3 2RS13 1S0CA 2A7AA 2R043 3V0AA 4OI0A 3OEAA 4GB32 2IXJA 1DLCA 1AR93 2PHDA 4JRAA 3I2HA 4CUAA 3KCCA 2R7EB 2J7MA 2WLPA 3UV9A 1V9U3 1R093 4QHBA 1GQPA 1HRV1 5AC93 1IOAA 2Y8KA 3C2UA 2QVSB 3HNYM 5T5OA 4AFCA 1EAH3 1F9KA 4S2GA 5A1LA 3B9CA 1MS1A 4P02B 5C3OA 2XLGA 5FPXA 1XNTA 1WMDA 2CGPA 2CV6A 2VOVA 2RR13 4RA0A 4ISQA 1CAVB 4PLMA 2JICA 1ONAA 1S0EA 2P17A 1US3A 4IETA 1UY3A 1GWKA 3RZJA 1F2NA 3MFCA 3GBWA 3MV01 3O0XA 4IL7A 2WBKA 5EJZB 4AQ6A 4CEWA 4CCKA 3BOWA 1ZBE2 4ISRA 1CX1A 1YFYA 2VCMA 4XZUG 1HDKA 4JGYB 5CEHA 1RMU2 4EE2A 2V5DA 3ZM8A 2MHFA 1HRV3 3FMGA 4OVEA 1DQ4A 3RDIA 5DXDA 2ZGNA 1W2AX 4FPYA 2VNGA 5A7WA 3AC0A 3VD3A 1RMU1 4PDWC 1PGW1 3A4UA 3CEWA 3LIHA 4NUBA 4XQDA 3QCWA 1JYXA 1DBNA 5CADA 2Q8DA 3MGUA 1C4RA 2WRAA 5I8SA 5B4NA 5FPZA 2QDRA 5GLWA 4GMP3 1RJ7A 3NJZA 3GJBA 5JCTA 4I0BA 4LO5B 2RDNA 4JRLA 5FKBA 5I8YA 1KQRA 2WKKA 3HR9A 1JOJA 1XNBA 3ZKYA 5DDJ2 5C9AC 2ZX3A 4M4RA 1AL21 4LMFA 1Y9GA 4HN1A 5JZGB 3RZKA 4JTNA 5FY0A 1D4M2 1ZRRA 5DZEA 1HRV2 1L7QA 1V6JA 5HCBA 3ZFEB 4CXXA 4DY3A 2IFWA 3K46A 3ALQA 5FYTA 3HVDA 3POGA 1YI7A 1CPMA 3ROUA 1AYN1 4XJUA 4YM1A 4I0AA 1O5UA 5HCAA 5CIRA 3DPRC 1FYUA 3MDPA 3MUY1 4H7MA 2ZHNA 2HEVF 3TBDA 2QQWA 3T2PA 2XPJA 4RGAA 2P3IA 5DAXA 4NHLA 4QB2A 2W1SA 2JE8A 4D6QA 1RUJ2 1QJX1 2EALA 2VXRA 3M7AA 4XF9A 3UNPA 4XBQA 5LEJA 2YU2A 1RMU3 1XNKA 4QKBA 5EP9A 3RQ0A 2Y6LA 1WW5A 3WNPA 5K8SA 3NKGA 4NR1A 3VBFB 4YVSC 5HCFA 4OMDA 4ZZ5A 2D7FA 1K5MA 5JVVA 3T2QA 4QKDA 4GMP1 5IATA 1NZIA 5C7GA 1H8TC 1ENQA 2ZZQA 2ZABA 4GKYA 2YGMA 4AOCA 5LZ6A 1DZRA 3SISA 3LQCA 3ZSJA 3EQEA 5T50A 3LD8A 1BXHA 3S7IA 4RS5A 1ULDA 3LDBA 2KD7A 4EZHA 1HW5A 2W9XA 3CL1A 4RS5B 1IGOA 3LB9A 3B00A 2C9KA 2QZ3A 4UBGA 2ZEZA 3VDDC 1QMJA 5GLZA 2BNNA 3GM8A 1R083 1GOFA 1KGYA 4W8JA 2GNDA 3VZLA 4ZU7A 4MO3M 4N53C 4Q4Y2 5CKMA 4E2QA 3ACGA 5J96B 3ZXEA 2WWUA 3B94A 4CU8A 3NMBA 1M06G 1TME1 2HLEA 1UZ0A 1QNYA 1OPOA 4BQ3A 2CY6A 5F32A 3TOJA 2YC2A 1UU6A 4META 4BIOA 3PMEA 1XQNA 3E6BA 1TNRA 2WT0A 4MH0E 4AFMA 2XONA 1RUI2 4PLOA 5IK8A 3AZVA 4XE9A 4AG4A 4LKSA 2I74A 4NE9A 1ODNA 2W2IA 4UT5A 1RGSA 5J36A 1R091 4UW6A 4XJWA 5FP7A 3V0AB 4CCCA 4X6RB 3OTFA 5FMCA 2B45X 1W8UA 2OUJA 5A3MA 4QDRA 5A3PA 1QQP2 1ZNPA 4JHZA 5LK7B 3RYPA 3LOBA 3B7MA 2AYHA 1W6OA 5F2WA 3AFGA 5FUIA 1QJFA 4FOWA 2YBSA 3BTAA 5C9AA 4XTPA 1VRH3 3EHKA 2VH9A 3O7OA 2VMGA 5KHGA 4LOTA 5C9AB 1XJAA 3WUCA 1TE1B 4R9AA 3HT1A 2QQUA 4X6QB 4CCOA 1G86A 3A23A 3HMYA 2AUYA 3MPPG 4FP3A 2DBNA 4XDQA 1DQ1A 3ETQA 3H9AA 5FZ3A 4GQ7A 1DFQA 1RUC2 2XJSA 3IWZA 2BFUL 4WM8B 4YG6A 1CAXB 5A7OA 3ZSMA 2XWJB 4OHVA 4QQOA 1SLTA 3VZJA 3POIA 1PMJX 2JDYA 2WSVA 4NAOA 2Q8EA 1FATA 1UYZA 2Q5TA 4XDOA 1XC6A 2KXLA 5D8AC 4Q4Y3 3VHOA 4BU2A 2JD4A 4H7LA 5FIXA 2EICA 2J1VA 2J1AA 3AZWA 3GALA 2FDHA 1Q8SA 2WSUA 1WLTA 1ZBA2 2ETEA 1OXCA 2QQMA 3PVBB 4K3UA 5A32A 4GIQA 2XL7A 5L19A 3WDUA 4CVUA 2V5YA 2VMDA 2VQ0A 4AI8A 2OIIA 4N9HA 2YROA 3H50A 1JZ3A 2G9FA 4BCUA 4I2OA 1N3PA 2P6HA 4XFBA 3BPSA 3LEGA 4OMCA 4PI0A 2A3YA 3S30A 3ZLIA 3RI9A 3H8RA 1ZRDA 2Q1FA 3VBFC 1MS0A 3NV1A 4P5HA 5FXXA 1UN1A 3AP4A 4HKWA 5EYXA 2IXKA 3S6PA 1A8MA 5IJRA 3T3YA 1YQ5A 4J1XA 3ZFFC 2YY1A 5IFTA 3DYPA 3RYKA 3KQ4B 2B9VA 1RHI2 1O3TA 2DVBA 4GZ9A 3THDA 5I0DA 3RI8A 3AL6A 3VZNA 3WF4A 4LKDA 4B1MA 4JVAA 3LPGA 3ZPYA 5FXZA 1W6MB 2JIGA 4QKFA 4E4HA 1EUUA 1UZWA 5F1RA 4QXBA 1ZBA3 3KV5A 4YGDA 2XQXA 2K2SA 1WD4A 4WVWA 1HJGA 2QCSB 2RG4A 4GA9A 1OVSA 3ZFGA 4QM9A 3VKFC 4CP9A 2HH9A 2R072 2VOXA 3IDAA 5C8WA 3NNJA 4XACA 3BU0A 4CXYA 4PDWA 3AJZA 3VL9A 4AYUA 4PBOA 3MI8A 3J9SA 4CU6A 3KVAA 4BQXA 3K2OA 1C5IA 5C4WB 3FJSA 2X8KA 5LA1A 2VL4A 4QPGA 2BFUS 1S2EA 1LHWA 1XE0A 2Y34A 4XHXA 1RUD3 1R64A 2DV9A 5F39A 1JH5A 4KWKA 2PTMA 1X33A 2VZ1A 5JSRA 3IMMA 4JGYA 4UXAA 1JHNA 3WCRA 2VVFA 2UURA 2R30A 1OUSA 1RUG2 2K0GA 5SV8A 1STMA 1WBLA 5BNQA 1CPNA 1OD5A 5A7WB 5IK4A 1UAIA 5JWPA 3PNAA 4LKFA 2EXKA 5FAXA 4CCLA 4FQZA 2XMLA 2VUAA 3MIBA 2OUHA 3FUQA 4BMEA 5JPMB 1KRIA 3OPWA 2OT7A 4FVVA 2QQPA 1YYNA 3VBHB 2BGOA 3LFIA 3V65A 2OZJA 3VD9A 2WFF1 4XFAA 3QD6A 4R9BA 2B4KA 4QQ2A 1UIJA 5FQ0B 1B35B 1HX6A 4F3JA 4C8DA 2XOMA 4A44A 3INAA 2BVVA 3DGTA 5A3TA 5FP4A 1GNYA 2PHUA 1F15A 4J6GA 4O9EA 4AI0A 5A7PA 1O4ZA 1OFNA 2VW0A 2ZXQA 4MXWA 1ASJ3 1SDWA 5FMOL 1LULA 5FZ7A 3VBSA 4CP2A 1UWWA 5FJKA 3ZFEA 1XSQA 2P37A 4MGKE 2DCZA 1LTEA 4IGQA 4L9BA 3RZZA 3UJQA 3ILRA 4CCMA 4BK5A 2VTFA 3A0NA 3QLQA 5BNOB 3U10A 1RVF3 3H1WA 2UYAA 4WZCA 4CDWA 5FZ8A 2X53S 2BPA2 5FY9A 2XJPA 4I3GA 2R16A 4DIQA 4XQWA 2NLRA 3LA2A 1SDDB 2H6CA 2W47A 1CN1A 4XFFA 1ENRA 4LOSA 1SBDA 3RSJA 4MGQA 3L2HA 4WV8A 4JC1A 5DMYA 3BALA 4Q4W3 1RJ8A 3WP6A 3KCYA 4XXPA 1V6LA 5DPNA 3VZOA 1UQXA 4N53A 4R9CA 5FMOS 4BXFA 4Z92B 5LWBA 4LT5A 3GYDA 2BBVA 1K5MB 4TTGA 5FYMA 1SLIA 2XVGA 4IEPA 1IG3A 2YUEA 1SACA 4Y1VA 3M8LA 3EYPA 3C3VA 4W6YA 5KHKA 3BN6A 1XYNA 3ZIWA 1NXD1 3RZMA 3WOGA 3FX3A 1RUC1 2ZCWA 1DHKB 1YIPA 1W6QA 2MPFA 3C7FA 5CNAA 4ZS3A 2X10A 3I4IA 1FMD3 1RUH2 2HWC1 1N3QA 4QGMA 4R52A 4Q4W2 4V2WA 1VIWB 3ACLA 1OUXA 4PIXA 4QPGC 4RQPC 4GALA 1MEC3 3WF3A 4A7ZA 5GLTA 3FN9A 1CAWA 1QJY1 1YXWA 4AAPA 4CDQA 5BNPB 5C5UA 2GC0A 2ARAA 4AEKA 1RXGA 1DQ2A 1H6XA 1XB9A 3ON7A 4Y5Z0 4A2UA 5ACA3 2VZRA 3R4UA 3KMHA 5CFDB 4HZFA 3WHUA 3E5UA 4B29A 1FPN2 3Q9OA 5IVYA 3UKVA 1GZWA 1VBC3 1LODA 5A7NA 1CIYA 2GMEA 3G7DA 5FZOA 4BJ0A 3GCXA 1Y43B 5CG8A 1S0FA 2E51A 2R1BA 4QU2A 4XQ4A 1D0HA 1RUI1 5FCCA 2Q4SA 4I01A 2ARXA 3RS6A 3N7LA 3AP5A 1NUKA 1W2NA 2ADDA 1AYM1 2CGOA 2ILMA 3HIFA 4L2NA 4BB3A 1J3PA 5L9BA 2A3XA 2A71A 2XBO2 2QFEA 2P6CA 1C8M2 3AKSA 4M3CA 3LEIA 5F6KA 1LENA 3PVNA 4XVHA 3TN92 1W6NA 1U5XA 3WHTA 3LKJA 4PDWB 2P1BA 4KWJA 1CAVA 3POYA 3VBOB 4QQLA 1S0IA 1GQHA 3KF5A 4OZXA 5LBCA 3NNLA 1S4CA 1YNAA 2VZTA 2WJSA 4XBNA 3ZFEC 1CGPA 1LEMA 5TSWA 2ERFA 5EIYB 3VDAA 2EIDA 2VOTA 1MPXA 1UZYA 3BB6A 4K9SA 2JKXA 3DPRB 4M0NA 4QQHA 5IAVA 2ZHKA 4AR2A 3ZXDA 3U78A 1HN1A 2RS53 4HVOA 5APAA 3RJRA 4DEQA 4DFSA 3IZOA 5ABJB 3P3PA 2QQJA 1V6OA 4CCNA 3BVCA 3T0AA 3G6JB 5CA6A 3VBRA 1GOGA 1RUI3 3CIHA 4LA2A 2D3SA 1RUJ3 4XIKA 1MS9A 3VBRB 3BGAA 1MZFA 4N7IA 5FYZA 3AYDA 1T6GC 3GZUC 4AEMA 1PNFA 2XQRA 3CJIC 5CVRA 3SXWA 5C3QA 2D43A 5C3SA 5C70A 3N4MA 5EJ3A 2I07B 4CEWC 2R063 3CZUA 1ULGA 3ZMNA 3CNAA 1S0BA 1AUYA 4FFFA 3WZ1A 5EHDA 5FDBA 2J22A 4RHV2 1VBB2 1XU2A 2HYXA 1AR63 4INDA 5A3LA 4Q8LA 3LDKA 2XJRA 3O1OA 3B5LB 3QBQA 5FYCA 3UGGA 4XJAA 4K7JA 4XEZA 5LBEA 1RVF1 3AMMA 5BY5A 1FOD2 4NPRA 4XYXA 4FTEA 2FCTA 1Q8QA 2NP0A 4YGCA 1J3RA 1GR3A 1UKRA 2ZJCA 3H1MA 3ZN4A 3D0JA 1JUIA 1N1TA 4BZ4A 4ES9A 5C8CB 3W59A 5CAZA 2LRPA 4AI2A 5A33A 4YSFA 1ENSA 2RMU2 3UETA 2YBPA 4B7EA 4PI2A 5BNOA 2LS6A 2O0OA 2RDSA 4I3PA 4RQPA 3V64A 4R8HA 3HEIA 4YW7A 4L8QA 1D7PM 4Z82A 3POJA 3AXDA 3FLRA 3M3OA 3WF0A 5BNPC 4FFHA 5E16A 1RUD1 4FPHA 3WXPA 1PO21 1UZZA 2YXSA 1ZZ6A 2HEWF 3P5BA 4LIUA 5KXCA 2VM9A 3IN9A 3WF1A 1LOCA 4Q8KA 4QX0A 4P14A 2IXHA 2XB6C 5CFCC 3KM5A 5T55A 4LEJA 5H9PA 1VMHA 3ZN6B 3C7OA 4XXAA 1H6YA 3U4SA 4P9IA 1FT9A 1UX6A 2ZAAA 3KT1A 5LRRA 2HWC3 3WY6A 3NAPB 3SQOA 3Q8AA 3VB9A 3HN1A 1EPZA 1QDOA 3LCPA 3EXUA 3IBMA 4HETA 4JKMA 2MEV1 3LOIA 3MIFA 1MS4A 2QQNA 5FXWA 2VNOA 4HK8A 5H9QA 1BHGA 2ZBJA 1LHNA 1OLME 4MGIE 4XF0A 3THPA 4Y4YA 2GNTA 4TN7A 5JXJA 1F5FA 4LPLA 4JTOA 2JG9A 4IV3A 4MVTA 4EJRA 5JXHA 3NO8A 2GN7A 2P3JA 3CKHA 4Y3OA 4IV1C 2GH2A 4JHTA 5CZKA 5CKQA 3VHRA 1IS3A 3I2OA 3O1SA 3JBG3 3WV6A 4BH9A 1FAYA 2Y6GA 1C8M1 4PF1A 2R042 3W58A 2XBO1 1RHI3 1DYKA 1SCRA 3R4SA 1RUF3 4RN5A 3POEA 3ACFA 1SFNA 2JG8A 1ULCA 1JODA 3ILFA 1NOVA 4L99A 1Y7BA 2VY0A 1X82A 4MYEA 2D6PA 3HT2A 1DYOA 2QZ2A 1R092 1SLAA 4OZOA 4BDVB 4BPZA 1SZBA 3R05A 4HVRA 5IFPA 1W6PA 2LTNA 3OBZA 3T2TA 4GH4B 4K20A 4BQ4A 1J83A 1ZVFA 1G7YA 1NY71 2EVXA 3NNGA 4FXGB 4XAEA 1BQPA 4NMIA 5JI7A 3ZN5A 1ZA7A 1AX0A 1ND2C 2YC0A 4DUVA 3VDCA 1OOPA 3NV4A 1NLRA 1TME2 2D6OX 5A1AA 1GZ9A 1QJY2 2PHTA 2GNBA 3MLLA 2R062 4AHWA 2UY9A 3C7EA 4UFKA 3TEYA 1JS9A 1N1YA 3DL3A 3SCFA 1MZ6A 3BI3A 1J1LA 1O5LA 4JGZC 2Z4FA 4XAAA 1QGLA 3MF6A 5IWFA 1W99A 4QPIC 4Z2AA 1BCXA 5JLVA 4ATFA 4D69A 5FMDA 1XYPA 5FZFA 4HMZA 4UFJA 5J3UA 4FPJA 3OOXA 1EUTA 3TAYA 3TYJA 2RS52 2PAMA 3JD73 3ACIA 5T52A 1SFPA 2R061 2DFBA 3U37A 3MHZA 1COV3 1WBFA 2JIJA 5FREA 4YZ1A 4XURA 2ZTNA 3WP5A 2BUKA 1IQAA 4QB1A 2CWSA 1PM7A 3SH4A 3UK9A 5FLHA 2FDFA 5KXEA 1NY72 1Y3TA 2JDHA 2W91A 3E97A 4BA6A 1QJX2 2VZSA 3FE5A 5A1FA 3WQ7A 4LBQA 4P9YA 4LR4A 1WCUA 1MQTB 5LATA 1VRH2 1RUG3 1JOPA 1SBEA 3OY8B 4IE5A 4TLGA 3WLUA 5AFBA 4NIHA 1W6MA 2ARBA 5DAWA 4QXKA 5FRAA 4LHKA 5KBFA 3W20A 1LGNA 3AX4A 3TNQA 2C5DA 2B5HA 3NL1A 3RG0A 4Q0VA 4A45A 2R041 3VBHC 2UYBA 2A6XA 5A33B 4FPOB 3AMQA 4D3WA 3AKQA 5AVPA 3H8XA 1D4M1 2QNKA 4GWNA 2QBXA 4YZ3A 4ZXKA 5LK5A 5FPUA 2IWGB 1H2LA 5BNNB 2J1UA 2XJUA 3D4KA 2XJTA 5I0SA 4LHLA 3MUZ1 3J8F3 3C7HA 3PUIA 1J59A 1QOTA 1XRUA 2FMDA 4E2GA 1LGCA 1NCQB 2Q1MA 4MHRA 3WUDA 1UX7A 3USUB 1ULOA 3CZJA 3KV6A 4B7KA 4OUMA 4BQYA 5GZEA 1D0GA 2YU1A 1A34A 2GSYA 2VVDA 4ZKTB 2ZEYA 5FZ9A 2XLAA 4TXWA 4URAA 5LY2A 2H6BA 2RS32 3JQXA 1LJ7A 1UU4A 1W9TA 3MICA 4LULA 4DNYA 3BOPA 2E7TA 2EA7A 4OYUA 2VTXA 1PO13 4RR3A 4DUWA 2JDMA 1CONA 1J84A 1H1AA 1AL0G 1LR5A 5L7OC 1ND2A 1HB1A 1RUG1 2PHLA 4GKXA 1RUNA 5I91A 2Z2SB 4QWNA 1W3XA 2A3WA 3ST7A 4YM3A 3H3UA 3KHCA 3VN4A 4QX3A 2E7AA 1PO22 4CPBD 3B01A 1GP5A 4DRRA 1S0JA 3U1XA 3UGHA 2EAAA 2J1EA 1DDLA 2QJVA 1BBT1 1UKGA 4UW3A 5DAVA 1OT5A 2VCBA 3J8F1 4HSJA 1PM4A 4XC9A 5DUVA 4COWA 2HKXA 4WVVA 3VKMA 2BOIA 1GP4A 5JOXA 4TZDA 1GKBA 4D8MA 2ZS6B 2WNOA 1O3RA 4P9WA 1UY0A 3RYRA 3FHIB 5GLVA 3VHPA 1TQ5A 4FTBA 1UPSA 1V0AA 2D5FA 3MBWA 4JCKA 3EJKA 1J1TA 4IESA 3R4DB 4O9GA 1LB2A 4YZ4A 1PNGA 5EJ1B 3SNMA 4EWAA 2ZX2A 1Z78A 2P2KA 4RQPB 1VBB1 4RHV1 1ULEA 5KWRA 2WO2A 1OQDA 1FNZA 2HWD3 3WDWA 1YUDA 3GZTB 2D93A 4DZGA 1AXYA 1CAUB 5I8TA 1ZZ7A 1POV0 2D97A 4CCDA 1HV1A 1QOOA 3CDZB 1OF3A 1IPJA 4J1WA 3K3NA 5FZHA 1O3QA 4UW5A 3ZYIB 4W65A 4H55A 1QH7A 4LO6B 2B9UA 1U12A 1H1MA 1W9YA 5LB6A 3QH6A 4WVMB 4JAAA 2E6VA 2WQ4A 4HPKA 4EN8B 4YZ2A 5E6HA 2HWD1 2YB7A 1QJU1 5FZ4A 5JXGA 4OQ9A 2RJ2A 1S0DA 2BQPA 4NPMA 4XHBA 4Z07A 2W94A 4MX3A 4K1ZA 1PZ9A 4AVSA 3VBOC 1WA4A 3TN93 1VLNA 5FZKA 2PLV2 2RS12 4IGPA 1VAVA 3ITQA 1UY1A 2HBUA 4AK3A 2QDNA 2ZMLA 1JU4A 2GNMA 2IC1A 4LTAA 2ORZA 2VOWA 4RYDA 2OVUA 4JV4A 4QHOA 4YFWA 3BIWE 2XWBB 4GD4A 5DAQA 4KG0A 3H1YA 4Q0SA 2BDRA 1BJQA 3M3EA 1SLBA 4LBQB 3U14A 4RR3C 4AAXA 2LM3A 1SLLA 3GDBA 2O8QA 1HRI3 3M3IA 1RC6A 3K4DA 1NZCA 2Q8OA 2VCCA 5CYYA 4WM7A 4XCBA 1M4WA 3VBRC 4YVSB 1GZCA 4DS0A 4XFCA 3AFKA 2Z79A 2X5IC 1RUF1 5I0UA 2YPDA 1V70A 1JUHA 3ZSEA 5DUWA 1JI6A 1WW7A 2Y6FA 3I54A 4E4DX 1ODMA 5ABJC 3OGVA 1YQ2A 2BU9A 1U5YA 1VBA1 2VZVA 3H7YA 4O65A 3ZKUA 1POV1 3VZMA 2WNEA 2XVKA 1ULFA 4NAMA 2GALA 3CF6E 4XJ9A 5FYUA 1RUH1 4S2DA 3FBMA 1DF0A 3D82A 1FNYA 1MEC1 4KU8A 2DWRA 4PIZA 5L36A 3JB8A 4NIIA 3O14A 4YM2A 5SV5A 5BYNA 1NYWA 4KNCA 3E5QA 4AEJA 2OQ6A 3NQHA 4XBLA 4PF5A 2ZGRA 1AR91 3PVEA 4HBNA 3VHNA 2DVFA 5JPNB 1IPSA 1WUVA 4X8PA 1ZRFA 2PYTA 4KWLA 2VG9A 5FO7B 1CD3G 1TVGA 2OW4A 4Q0UA 2WWJA 4AGRA 2DCJA 4XUQA 3HOBA 5A6YA 5HCHA 5FY5A 3ES1A 2W87A 3PU8A 4ZS2A 3VDBA 3V0BB 1LECA 2HJIA 2VGDA 2PQSA 3IDCB 2DBIA 5FY8A 3ZMOA 1FMD2 2PFWA 3VD5A 3PUSA 1GMMA 4L0PA 1V9U1 3B02A 3O5SA 3V56A 1AYM3 2ZHMA 1KJRA 2Y0OA 1ZX5A 3MFAA 4G3YC 1QY4A 4TLFA 4DOUA 3CU7A 3I2IA 5KR7A 4M01A 3U4XA 3D3AA 2ZGPA 5JUVA 4W4ZA 4GJZA 4DEVA 3NNMA 1GZTA 3ZYFA 2EAKA 1W8NA 4QHZA 1GFF2 4QX8A 5F9TA 1AYN2 1OH4A 3OG2A 1EV11 5T5PA 2R0HA 2WLQA 4PLNA 2JD9A 3PMSA 2XH6A 4URTA 4ASLA 4C1XA 3N36A 2WC2A 4FOVA 4B4PA 1ZRCA 1XNAA 5FUNA 2XUMA 4Y26A 3AP6A 2JJ6A 4NHYA 3T09A 4QM8A 5L7OA 3UKTA 3LEKA 5F8PA 1WMFA 5FZBA 1CZVA 1EPWA 1I9RA 1ZZCA 3MIGA 5DDJ1 5EV7A 2V4VA 4OUSA 4LKEA 1BBT2 1N1SA 2KA3A 3GHNA 5FPAA 3WG4A 1PO12 3I3QA 3WQBA 3KD4A 1YCIA 3SEEA 2RMU3 2ZAHA 2A6VA 4RGGA 4C0BA 4YARA 1Q43A 1UOGA 1HKDA 2MEV2 4IEYA 2G4IA 4CDQC 3O1UA 2RV9A 4JQRA 1HLCA 3H0OA 4QT6A 4AVCA 5FYBA 4D7TA 2A6ZA 4UI9L 2DUPA 4BE3A 1URXA 2X5IB 1PGW2 5AFEA 2RDQA 4O7XA 3E6DA 4W6WA 1LOEA 3WT3A 2HYKA 1WGPA 2YDEA 1SLCA 4HVQA 3U0ZA 3E5XA 4PJYA 2CAUA 3R6SA 3Q8BA 1FOD3 3KZ4C 4UFMA 2NMNA 3MYXA 5FWJA 1IQDC 1QJY3 1COV2 1C1FA 2CAVA 2RJLA 5A6ZA 1H2KA 1W8FA 4IE4A 1WCKA 5CU1A 4PIYA 1UO9A 3DKWA 5FLJA 2WFPA 4YPJA 5HI0A 1KJLA 2B7YA 2WNUC 4FQ4A 1VBD3 3O1RA 5FO8B 2D6LX 5FPBA 1QKQA 3L9JT 2RMU1 4RHV3 5FK8A 1O8SA 2NN8A 2DF7A 1YQ8A 4YFZA 1LKNA 2K46A 2SBAA 1DGRA 2GC2A 3PTRB 1QU0A 4CU7A 1S2BA 1LOBA 1W05A 1YJKA 3A0KA 4Y22A 1FOD1 1Q8OA 2CNAA 2XLFA 3A7QA 4WBBA 1NE4A 2AR6A 1W6PB 3CO2A 3AJYA 2AREA 3WDXA 1Q3EA 2XG3A 5FZDA 1W06A 1W6OB 2WIIB 3T30A 4K6BA 3HNBM 1BYHA 1PVC2 3S0MA 1TME3 4LO8A 3MF9A 2UU8A 4IW3A 4NIAA 2X29A 4AVBA 1A3KA 3WVJA 2WN2A 2CTVA 1I1EA 1IKQA 4FPLA 2JDNA 4CEYB 3ELNA 4ZPIA 1JZ2A 2G19A 2NQYA 1G9CA 3N9OA 1ALYA 3A21A 1RL3A 3JUUA 2NM1A 3N9NA 4IE7A 4KI5M 4LBLA 1BK1A 1E5IA 1F4AA 1MS8A 4WVMA 2YFZA 5I0TA 1JZ7A 3O1TA 1TNFA 4LIVA 4C1WA 4CDUB 4XUPA 4ASKA 1JZ8A 3I49A 3KB5A 3OGJA 4ASMB 3SKVA 3RWNA 3BKZA 5K7PA 2DCKA 5DZFA 4WM7C 1VMFA 1ENXA 3B3QE 3N7JA 3PJYA 1LOFC 1YHFA 2F17A 2VNVA 2ZGMA 3T1MA 5BNOC 4HKOA 3H8OA 1FX5A 2WZEA 1XBFA 1H9WA 2F4LA 2W1QA 3IT8A 4OI4A 4Y20A 5GLUA 5JR7B 1HRI1 1PIV2 2G1MA 1YFXA 3FHQA 3TN91 4BQ1A 1QXJA 1DIWA 3CJXA 2LW8A 4QAWA 1WA6X 1BMV1 4XF3A 5FYYA 4CDQB 1RTVA 1OURA 4DB5A 3S5QA 4K8RB 5JIUA 1AYM2 2C24A 2HWE2 1VBE2 2VU9A 2JDZA 1JZ4A 4ZU5A 2BTVC 3I2FA 4MGTA 1IHMA 4LBKA 3O0VA 3DXUA 4XW3A 5IVCA 1CESA 5JSOA 3W5MA 1WLWA 1O8PA 4GWIA 5CFCA 5F3IA 3FLTA 3ABZA 3USSA 3VL8A 3E6CC 2IXLA 3QOPA 1FPN1 2Z42A 2VCAA 1HIXA 1PMIA 2GU9A 3D0SA 2OXBA 4BISA 1JZ5A 5KC5A 2HWF3 2LUWA 1PMHX 1RUE1 5C8CC 2YMZA 1GOHA 4IERA 2Y6HA 1AR62 1WCDJ 2RVAA 2ZGUA 2WL1A 1KS4A 3P3NA 3RVHA 4IUGA 1WW4A 4NIDA 1DP0A 1QOSA 1W39A 2UWAA 4KQ7A 3ZXJA 1JW6A 2R1DA 5JMCA 1XYOA 3S57A 3USUA 3AVSA 1O4YA 2JWPA 4ZXEA 4H2AA 1AJOA 1ZYBA 4R9DA 2YZ4A 2OQ7A 3ZR5A 1GU3A 1SFYA 1W03A 4WM8A 4JZRA 4CEWB 4M4PA 2YV8A 5FY1A 5IVVA 4QPGB 2C26A 1UPIA 2H0VA 4CDXA 1T6BX 3HN3A 4RSUA 5JDBA 2IXIA 4XILA 4B4QA 1Y4WA 3PVOA 2JKBA 1BEV3 4PT6A 1V6MA 1DGRN 3M3QA 3CMGA 2VZQA 4HXCA 4DMIA 3KHBA 1WKYA 3OBRA 2ET7A 1REDA 2ZKNA 5A32B 4DO0A 4PBPA 5ERLA 1JBCA 4LBOA 3TB0A 4A3XA 5CB7A 2J42A 2W3JA 3KQRA 3OYWB 5JOWA 4LORA 4OHZA 4BQ5A 4D7YA 2F4PA 1O91A 1K3IA 1HJFA 2FMYA 2ZGQA 3I59B 4H3WA 2ZEWA 1VJ2A 3KGZA 4MV2A 4AI1A 4CDWC 1C5HA 1VAKA 1PX3A 4FOYA 4K21A 2FQPA 1HV0A 4JDNA 1UYYA 4FT8A 4LITA 3AYCA 2PHWA 5J1XA 2BNMA 2DYCA 3MLKA 2OA2A 1BEV2 1MVEA 3J7NA 4GJYA 2UY8A 2NYYA 4XTMA 3AYEA 3KT4A 5E89A 2PHFA 4MSVA 4LJHA 4M3CF 4AXOA 4EWEA 1HXS3 5FBJA 1MS3A 1RUE2 3PJQA 4CUGA 4N90A 3OGGA 3GBGA 4Y1YA 5FPLA 1EYBA 4OHWA 3VDDA 2A73B 3PUHA 3JQWA 4XF1A 3MIDA 2WFF3 4GMP0 4AI3A 1UIKA 4CP9B 1G8WA 1PGSA 4F7ZA 1A78A 5C3PA 5C33A 4ONUA 3RMXA 2CL2A 3WR0A 5A6XA 5IVJA 2VUJA 2WR9A 4LLFA 4QB6A 5IK7A 2RM23 1OHFA 2E7QA 2WWSA 4IQPA 3N9LA 1KFXL 3WX5A 1AXZA 1LU1A 2WNVC 2OX0A 2VMFA 2TUNA 3SKJE 5FZCA 2PAKA 1CJDA 3T0BA 4QU1A 4COYA 3H3LA 3OEBA 5KHJA 5LA9A 2Y33A 2BWCA 3CBNA 4EN7B 2PAEA 4O61A 3F2ZA 1AVBA 1KXGA 3ZFFB 1JYTA 2VE1A 1LHOA 2W1UA 4JDOA 4QX7A 2BJSA 1FXZA 2X5IA 1JYCA 4HOOA 3WG3A 4U2AA 2DUQA 3AKRA 3IDEA 3RFRA 5C3RA 2QUOA 1O7FA 5L73A 2VNRA 2YGLA 3JBG2 4XUOA 3I7DA 1F4HA 2PHXA 3I2JA 1LRHA 4Y5SA 5FZEA 4FAHA 1PHMA 2JXAA 2VULA 3VBHA 3H7JA 3MW3A 2W08A 2EIBA 4UFHA 5AC92 3LF7A 4I02A 2ZX1A 2BOJA 4Y20B 1GICA 1Y9QA 2P3YA 1CAWB 2SLIA 2XHNA 1AJKA 4A6OA 4AVAA 1RIRA 1YFUA 1H0BA 2ZZJA 2VZOA 1DQ5A 2YPJA 3DUIA 4YZ5A 1WCQA 2WS91 1ZA4A 2ZMNA 3M2MA 3EO6A 3BTZA 1EV12 4MXWB 1CJPA 4IEQA 4KGQA 2A6WA 5D21A 1QJZA 4LQRA 2F6BA 4ES8A 2KR2A 2QTWB 1SQ4A 2JG8B 1GBGA 1C57A 2XDVA 2XL9A 3T08A 3ACHA 2V73A 5LA2A 3VUOA 4DXZA 1C3HA 5F3GA 2WAAA 3LWCA 5BV6A 1RHI1 1JOBA 4QXHA 5DG2A 5KXDA 3I2DA 3JU9A 2WYFA 1VBC2 2JB4A 4MADA 4HN0A 2XXZA 1V9U2 1HB2A 2A75A 3A22A 2WABA 1UXXX 1W6NB 3RJ2X 1FMD1 4K1YA 2XGXA 5DN2A 1YQCA 2HWE3 4NJ4A 4KG8A 2AEZA 2WO3A 4UOJA 1KS5A 2QE3A 5GM0A 3VKLA 1PZ7A 2DVGA 2WZR2 4FPFA 1W3VA 1R1A1 4PQQA 3UL2A 1CAXA 1E57A 1H8VA 3ZYHA 5A6QA 1W0PA 1TEIA 4NRMA 1GP6A 3PURA 1UMZA 3VBUA 1TMF1 2HWC2 4IXLA 1AR92 2OPKA 5FZGA 4CDUA 1MQTC 4LHNA 2CYFA 3LFMA 3AZYA 4KU7A 2Q0AA 4Y5TA 1W6QB 1FI2A 4EN9B 4AQ2A 1BLZA 2W39A 2XVLA 3N7KA 1SMVA 4COZA 1NCRB 1UCXA 1UMIA 3JD71 1OD3A 5FUPA 3ZSKA 2Y0IA 4WVZA 5GZGA 1BBT3 1NCRA 1XNCA 2GH8A 1E5RA 2AGSA 1ASJ2 3ASIA 2WQ8A 4JGZB 1O59A 3P1IA 3NVCA 4U36A 2VZ3A 4JGZA 1HXS1 5FYIA 3DV8A 2VQUA 4YLZA 4B4RA 4BOWA 3FFZA 4CP0A 3I2GA 1RUF2 2TNFA 2P4EA 1X9TA 1NCQC 2ID4A 5FYHA 2CHHA 1W2UA 4OLLA 4L11A 5JIAA 1NG0A 5DAPA 1MVQA 3AZXA 1WCSA 3ZDSA 5HXMA 1TMF3 3S7EA 1KITA 2E33A 1QHDA 3KV4A 4TYSA 3U07A 1D4M3 5C8CA 3VDDB 5IYYA 4GWJA 5EFUA 4IE0A 4Q4X2 5F37A 2V72A 2XHKA 5KHIA 1XE7A 1X50A 3ZSLA 1F35A 2X05A 2WT1A 1WLDA 2FHRA 4UF0A 2Q30A 4P08A 5L7OB 4KH9A 1G6NA 4JX0A 4FCAA 4Q0QA 4XFGA 5K0UB 5K9YA 2XR4A 1ND3C 5JI9A 2E31A 1LESA 1W8ZA 3URFA 4Q4V3 5LEKA 4HL0A 5FP8A 2BNOA 4AHXA 2LROA 1I6XA 1CZTA 2R6QA 3SH3A 2ZX4A 4HG6B 3VBSC 1F8VA 1LNSA 3NJVA 4YW5A 3AXEA 3VBFA 1YI9A 5IVFA 2HWD2 2Y38A 4CU9A 4Q26A 4ARYA 5GZCA 1UYXA 1LHUA 4DRVA 1CQ9A 1O3SA 2O8OA 2GC1A 2HBTA 3N35A 4JKKA 3NAPA 4E4SA 2R073 5LBBA 4IEZA 1VBE3 3WSOA 3UJOA 3C8XA 1HB3A 3FBYA 2UWBA 2E53A 3AMNA 5CG9A 4Q27A 3AM2A 1K5JA 2DCTA 4LUKA 1DQ0A 2ET1A 3O12A 4OQ8A 4I09A 2L9LA 4YW2A 1AYN3 4LUMA 4AW7A 4AGVA 1FV2A 2VMCA 3J7LA 4C90A 1NAEA 5GZFA 4CE8A 5FQ0A 5BNNC 1XE8A 4IEWA 1VBA2 4Q29A 4NVPA 2WN3A 2VOKA 1K12A 5ISLA 1T2XA 3BYWA 1W2OA 3LSDA 3UGFA 4CYDA 3LAGA 1PVXA 2VMEA 1UY2A 1BVVA 4HK9A 1I5PA 4L92A 3U11A 4CSWA 4Q4X1 2R071 1C1LA 2B42B 4OHXA 2DU0A 1SHWB 4RFT0 4FP2A 2PA7A 2VBBA 5FZAA 4NO4A 1CX4A 1MZ5A 1LGBA 5LRSA 1LOFA 1NCRC 4F83A 5ACA2 3RZHA 1GWMA 3AP9A 1AL22 5J48A 2FCUA 1AR72 4GH4A 4FFGA 3QACA 4HT1T 1QEXA 3J8F2 1S0GA 1PIV3 4R4XA 1B09A 3IDBB 1UY4A 2W0XA 4YVWC 3AVRA 5F3CA 2WNUB 5T3NA 4FSJA 1RB8G 4LK6A 1X8EA 2VXJA 3PU3A 3NW4A 4HONA 1VBB3 5L9VA 1JZ6A 2ADEA 1QXRA 1CZSA 3EBRA 4LO4B 1ACCA 3DKQA 4XMIA 3MZHA 3OSDA 3AKPA 4CXWA 4AEDA 2FDKA 1RUC3 3DECA 2RS31 1APNA 4M00A 1G9FA 2FZ1A 2Z5WA 4N7UA 3HAGA 3MW2A 1QJU2 1TMF2 1ZBE1 4FBFA 2BRTA
chains in the Genus database with same CATH topology
1EAH2 2A5ZA 3D8CA 5FOJB 1F5JA 1S1AA 2ZGSA 1Z0HA 3MW4A 4M3CE 2WS93 4AVVA 5J7MA 4E4ZA 2JG9B 4IV3B 3TNPB 3M70A 3WW3A 4Z1VA 2Q1ZB 1H4GA 5EXOA 5DUXA 3WW4A 3N7MA 2E9QA 1JN2P 2TBVA 1VAMA 2ZGLA 4YG0A 2WQZC 2GMPA 1ZREA 2RJKA 1BZWA 5CFDA 1AZDA 2DURA 2PELA 5CFCB 2D40A 3AMHA 4E27A 5ACA1 3OD4A 1OQ1A 1ZZ8A 1Z7S2 2ATFA 4I30A 2WS92 2DCYA 2EF6A 2VVEA 1VR3A 2ES3A 5E1RA 4CRQA 5FTTC 2BW8A 3WP3A 4M3CB 2WZPP 1QWRA 1EP0A 5AC91 3AP7A 4ATEA 1AR81 3OJBA 5C4WA 2RS51 1PK6C 5E8AA 1AHSA 4CDXB 2E63A 2RR11 3JCIA 3VBUB 1N47A 1Q8PA 2AH2A 4IV1B 4YM0A 2W68A 2IFRA 1RUOA 1VP6A 4IEVA 1PGL1 1N1VA 3HBZA 1A8DA 4Z2WA 4RR3B 5ABJA 2BYVE 3ZXGA 2A6YA 2GAUA 1QXPA 4LA3A 4BMBA 5F6LB 2ZX0A 4PQ9A 2GZWA 1KFUL 2I2SA 3V0BA 1XXNA 3HD8B 2PHRA 1V00A 4OFGA 4E2SA 2ZA9A 3WW1A 1Q56A 2BWAA 1B35A 3I8TA 4PCRA 3LZZA 4YG3A 1H4HA 4LE3A 5JZGA 4D94A 4ZU4A 4RD7A 3ENRA 1YRZA 4XFIA 4C91A 1A6CA 2C1FA 3GBFA 1G9DA 4C0HA 4SBVA 4BHPA 1W0OA 2BEOA 2JENA 4BWOA 1UD1A 1H8TA 4Q4V2 2DU1A 1BEV1 1H8TB 3ZFGB 4S2FA 3FLPA 2FBEA 4CDWB 2RM22 1AX2A 1SEFA 3JB4C 5CBLA 3SMHA 4Q0PA 4Q1RA 4YGEA 3ILNA 5K0UA 1D4VB 4E9KA 1HXS2 1YFWA 3DN7A 2NZ9A 5CFDC 2VQAA 1ASJ1 3ZYGA 3AKTA 1BVP1 3AB0A 1WW6A 1DQ6A 3KT7A 1LCLA 2JG8C 3JZVA 4N53B 3SCHA 1U5ZA 3CLPA 3JD72 4XF4A 4DY5A 4IEXA 5KC6A 4EROA 1D2QA 1OLRA 4IEUA 1OA3A 1GANA 4AWDA 2W52A 3ZN6A 4YW1A 1CIWA 4XJ8A 1J3QA 1RITA 2GN3A 4LBJA 4LNVA 5BPXA 4BIFA 1PGL2 2WNVA 1LU2A 1OPMA 3TWIA 1Z7S3 4HKLA 3ZYJB 2P3KA 2WNVB 4XMAA 3WQ0A 4Y24A 2ZHLA 1R1A2 2O1QA 1RUD2 4W6XA 2QKDA 4RL7A 5T5LA 3VKNA 4Q4X3 4YW3A 1AR82 2DTYA 2HWB3 2PN5A 3FC0A 4GWMA 3VBUC 1NQDA 2WA4A 4QPIA 5BNPA 1GQGA 1J58A 4OULA 4P9XA 1CR7A 4QD2A 2D5HA 4COVA 1QJU3 2EXIA 1IZ3A 2VPVA 1Z7S1 2IXCA 3RNSA 1LHVA 1KD7A 4GXLA 1MACA 3IPVA 3RRDA 5D8AA 1GNHA 5FLIA 4DQAA 1WMEA 2TEPA 2PQQA 1NLSA 2A70A 2D6MA 4H14A 2CWMA 1AR83 2WNUA 1OOPB 5IK5A 5JSPA 2VW1A 3ZX7A 2KM2A 5F5QA 4LBNA 3IM0A 4OHYA 1X8MA 1JYIA 1HQLA 2ENRA 3POWA 3IIAA 5C8CC 2HWF2 3GNEA 4KGGA 4S2HA 1QH6A 4XOGA 4AEDB 1X36A 4IV1A 4YRDA 4YW4A 4EWDA 2HWB1 2YHJA 4FOQA 3DPRA 5FO9B 3ZYRA 4MGYE 1ZZ9A 2VECA 2XKOA 4NHMA 4AFDA 4AHYA 1VBA3 5K0UC 1ZZBA 2R49A 4FPKA 1H2NA 5KHHA 4LBMA 3MIEA 3VKOA 1VB2A 4BYYA 4V1PA 2C0ZA 2ZACA 1I3HA 1POV3 3MEPA 2EXHA 1R081 3NV2A 4OI2A 4CP1A 1PVC1 1S2KA 4I0WB 4KBBA 4Q2FA 4FAGA 4XFHA 4CDUC 4XZPA 1V6IA 1H1IA 1IKPA 3L2YA 1ZM1A 3VZKA 1DLLA 1NA1C 3NAPC 1GZWB 1RUH3 3ZVXA 4WM7B 1AR71 4CEYC 1PK6A 2B39A 4LBQD 3NV3A 4N43A 4Y1UA 4JGYC 4N43B 4QQPA 2DUOA 5HBAA 1IPKA 1FPN3 3ZIXA 4X8NA 1RVF2 5DUUA 1H9PA 1GSLA 3LA3A 4WZFA 4MZUA 5EYYA 5HXVA 5BNNA 5FBZA 5FOBB 3GZAA 5I93A 5EWSA 4YYOA 2RE9A 2ZPXA 3TRSB 2ZGTA 3ZYPA 2UWCA 1S55A 1IS4A 1B35C 3WDVA 4UBHA 3FZ3A 5JZGC 3OPZA 3SCGA 1OA2A 4GH4C 3THTA 2JEMA 4M0HA 1OLQA 5J37A 2WA3A 1ND3A 1QJX3 1ND2B 3OCPA 1PO11 1DGWX 1VBD2 2D3PA 3WINE 2P34A 2WINB 5EZWA 5GZDA 4FXKB 3WDYA 4AGGA 5J09A 3O0WA 4NN0A 5JAXA 3RPQA 4IEOA 1NE6A 5GKAC 4AEDC 1QDCA 1WD3A 3ZXLA 4Q4V1 3W9AA 3H8UA 1OKQA 3WW2A 2DVDA 5I0RA 2MEV3 2DFCA 1OI6A 3B69A 4G4FA 4Y1ZA 1K5MC 4JDMA 3CJIA 1YWKA 4AHZA 5KXBA 3D6EA 3NKTA 3M4FA 2K9ZA 3R0RA 1LOGA 3K51A 4RS5C 3UKNA 4BM8A 1O3SA 1VBE1 2HWE1 4NHKA 2VW2A 3RMYA 3FUOA 4TWTA 5BUVA 1C8M3 4XJZA 1NA1A 1VBD1 1DGWA 4N9IA 1UW8A 1U5IA 3VV1A 4AFAA 1NA1B 1SBFA 2DVAA 3B93A 4OI1A 2VMIA 4Q4W1 4MXVA 1L3JA 2CGNA 5H9RA 5T54A 3VLBB 4KL1A 4TSVA 1UU5A 5FFOC 1OFSA 1AF9A 3MIHA 3VGIA 2RR12 3GHMA 3LA7A 2XBO3 4YGBA 5IT6A 1OA4A 5B2GB 4LE4A 3WQ1A 3K48A 4NWWA 5C6CA 2WZR1 4BLIA 3ZXAC 4DINB 4Z8BA 5BXXA 1AR73 1RINA 3OBTA 4FTSA 1BKZA 4A7KA 1IS6A 1OSGA 3IKWA 1PO23 2JE9A 2ZOEB 5H9SA 3HWJA 1VBC1 5E88A 3WDTA 1VB4A 4G9SB 3WNXA 4YVSA 2JECA 4Y22B 4WM8C 1MS5A 3J26N 1PK6B 4CDXC 1DU3D 3OF1A 3KLSA 2OZ6A 5D8AB 1C28A 1X7NA 1HQNA 1YIFA 3ATGA 2JG9C 4IV3C 2B8MA 3ECQA 1AXKA 1QQP3 3PHMA 4FPEA 2R32A 3ES4A 4ITCA 3D5OA 3AK0A 4Y1XA 1QF3A 1R082 3VBOA 2G9GA 4QGLA 1FV3A 5JOYA 1COV1 2WFF2 1EAH1 2D3RA 4AFBA 1ZBA1 4R4ZA 1G9AA 4LLOA 1YO8A 4AQTA 3ME2A 5D1IA 5AVAA 3SLIA 4Q1PA 2I45A 2HWB2 3JBG1 3FWEA 1QNWA 1PZ8A 2HWF1 5DG1A 1DZQA 3IMNA 3WG2A 1GNZA 1PVC3 4XPVA 2FZ2A 3OYWA 1H30A 3QH7A 3ZXKA 4MUVA 3FFQA 3BODA 2EIGA 1RUE3 2JX9A 3ZFGC 2GDFA 2YYOA 4YVWA 2GMMA 5T5JA 3BCWA 3SH5A 1HQWA 3AYAA 1QQP1 1MR5A 1XU1A 1MQTA 1GLHA 3X29B 2LALA 2WT2A 3DF0A 4CZSA 4SLIA 2D6KA 1YLLA 1EY2A 1V6NA 2XJVA 2NMOA 2ZGOA 3M3CA 3PLQA 1AL23 4F8AA 1YJLA 1IS5A 3GF6A 1XNDA 2R0FA 3CJIB 1NXMA 2BGCA 1MZEA 1OMIA 1D2SA 2MNGA 3KSCA 4QPYA 2XKPA 1EV13 3MPBA 1G9BA 4NWVA 1U0AA 2NPIA 2D44A 1LEDA 1N3OA 3ZO0B 3KS7A 1KDMA 1NCQA 4MLOA 2D6NA 4AF9A 4AE2A 3MLJA 3PTYA 4P9JA 1JTZX 1OQEA 3BU7A 3APBA 1CVNA 5DDJ3 2D98A 2Z69A 3ZFFA 1DG6A 3J4UH 3WCSA 2DTWA 5JOZA 4HPKB 1R1ZA 4B3NA 1ND3B 3AMPA 2RHPA 3M1HA 2WZR3 3B9IA 3I59A 2IZWA 3LGRA 1MEC2 2Y26A 4ORFA 1REEA 1RUJ1 2BVBA 2VMHA 1H2MA 3POSA 1UL9A 2JE7A 4FPCA 5GJ6A 1WLCA 2XJQA 1C8NA 4QPIB 4FPGA 4UW4A 2RM21 5GALA 3AZZA 4EN6B 1Q8VA 4B8EA 1OOPC 3NWKA 3N3HA 2HEYF 1AR61 1LOAA 2ZKLA 5C4WC 1DYPA 1V6KA 3VBSB 1DZTA 1GV9A 2EXJA 4MGZE 1REFA 2ZGKA 3SITA 1VRH1 3IPVB 1O4TA 3HQXA 1AX1A 4CTEA 4XETA 2ZMKA 4QX5A 2C9AA 4HFSA 4NOTA 2GC3A 4HANA 4GULA 1SCSA 4LO7A 5C8WA 1CAUA 4GB33 2OYZA 3SHRA 3KCXA 5J98B 4D7SA 1BMV2 2AENA 3NSTA 4EV0A 1HRI2 1PIV1 3T1LA 3ZXFA 4A7YA 4Q4Y1 3LSEA 3OD0A 4CEYA 2PLV1 2RS11 4QMAA 4EN0A 4N43C 1Q5OA 3BPZA 4COUA 2H0BA 3KGLA 4FO9A 1NQJA 1JXNA 5IUQA 1VALA 2RS33 4K40A 4DPNA 1I5ZA 1GYKA 4XIOA 1ZBE3 2N7GA 4HLTA 5DZGA 4BLJA 4P9LA 1F31A 4AVTA 4L97A 3WG1A 4QGNA 1R1A3 1KDKA 2AZ5A 3WD5A 4YVWB 3H3ZA 4YNIA 1UF2C 4K8FA 3OY8A 4AQSA 2V09A 3WP4A 4GB31 1DGLA 4HSLA 4P9GA 2B46X 2PLV3 2RS13 1S0CA 2A7AA 2R043 3V0AA 4OI0A 4GB32 2IXJA 1AR93 2PHDA 4JRAA 3KCCA 2WLPA 3UV9A 1V9U3 1R093 4QHBA 1HRV1 5AC93 1IOAA 3C2UA 2QVSB 5T5OA 4AFCA 1EAH3 1F9KA 4S2GA 3B9CA 1MS1A 2XLGA 5FPXA 1WMDA 2CGPA 2CV6A 2VOVA 2RR13 4RA0A 4ISQA 1CAVB 4PLMA 2JICA 1ONAA 1S0EA 2P17A 4IETA 1F2NA 3MFCA 3GBWA 3O0XA 4IL7A 4AQ6A 4CEWA 3BOWA 1ZBE2 4ISRA 1YFYA 1HDKA 4JGYB 1RMU2 2MHFA 1HRV3 3FMGA 4OVEA 1DQ4A 3RDIA 5DXDA 2ZGNA 4FPYA 2VNGA 1RMU1 4PDWC 1PGW1 3A4UA 3CEWA 4XQDA 3QCWA 1DBNA 5CADA 3MGUA 1C4RA 5I8SA 5FPZA 2QDRA 5GLWA 4GMP3 1RJ7A 3NJZA 5JCTA 4I0BA 4LO5B 4JRLA 5I8YA 1KQRA 2WKKA 3HR9A 1JOJA 1XNBA 5DDJ2 5C9AC 2ZX3A 1AL21 4HN1A 5JZGB 4JTNA 1D4M2 1ZRRA 5DZEA 1HRV2 1V6JA 5HCBA 3ZFEB 4DY3A 2IFWA 3ALQA 1YI7A 1CPMA 3ROUA 1AYN1 4XJUA 4YM1A 4I0AA 1O5UA 5HCAA 5CIRA 3DPRC 1FYUA 3MDPA 4H7MA 2ZHNA 2HEVF 3TBDA 2XPJA 4RGAA 2P3IA 4NHLA 1RUJ2 1QJX1 2EALA 2VXRA 3M7AA 4XF9A 5LEJA 4XBQA 1RMU3 1XNKA 3RQ0A 1WW5A 5K8SA 3NKGA 4NR1A 3VBFB 4YVSC 5HCFA 2D7FA 1K5MA 5JVVA 4GMP1 1H8TC 1ENQA 2ZZQA 2ZABA 4GKYA 2YGMA 1DZRA 3SISA 3ZSJA 3EQEA 5T50A 3S7IA 1BXHA 4RS5A 1ULDA 1HW5A 3CL1A 4RS5B 1IGOA 3LB9A 3B00A 2QZ3A 4UBGA 3VDDC 1QMJA 5GLZA 2BNNA 1R083 2GNDA 3VZLA 4ZU7A 4Q4Y2 4N53C 4E2QA 5J96B 3ZXEA 3B94A 1M06G 1TME1 1QNYA 1OPOA 2CY6A 3TOJA 1UU6A 4META 4BIOA 3PMEA 1XQNA 3E6BA 1TNRA 2WT0A 4MH0E 4AFMA 1RUI2 4PLOA 5IK8A 3AZVA 4XE9A 4AG4A 2I74A 1RGSA 5J36A 1R091 4UW6A 4XJWA 3V0AB 4X6RB 3OTFA 2B45X 2OUJA 5A3MA 1QQP2 1ZNPA 5LK7B 3RYPA 3LOBA 3B7MA 2AYHA 1W6OA 3AFGA 4FOWA 3BTAA 5C9AA 4XTPA 1VRH3 3EHKA 2VH9A 3O7OA 2VMGA 5KHGA 5C9AB 3WUCA 1TE1B 4R9AA 3HT1A 4X6QB 1G86A 3HMYA 4FP3A 2AUYA 3MPPG 4XDQA 1DQ1A 3ETQA 3H9AA 4GQ7A 1DFQA 1RUC2 2XJSA 3IWZA 2BFUL 4WM8B 4YG6A 1CAXB 3ZSMA 2XWJB 4OHVA 4QQOA 1SLTA 3VZJA 2WSVA 1FATA 2Q5TA 2KXLA 5D8AC 4Q4Y3 3VHOA 2JD4A 4H7LA 3AZWA 3GALA 1Q8SA 2WSUA 1WLTA 1ZBA2 2ETEA 3PVBB 4K3UA 5A32A 4GIQA 2XL7A 5L19A 3WDUA 2V5YA 2VQ0A 4AI8A 2OIIA 4N9HA 2YROA 3H50A 2G9FA 4BCUA 4I2OA 1N3PA 4XFBA 2A3YA 3S30A 1ZRDA 3RI9A 3VBFC 1MS0A 3NV1A 4P5HA 3S6PA 1UN1A 3AP4A 4HKWA 5EYXA 2IXKA 1A8MA 4J1XA 3ZFFC 2YY1A 3RYKA 1O3TA 1RHI2 2DVBA 3RI8A 3VZNA 4JVAA 3ZPYA 1W6MB 5F1RA 1ZBA3 4YGDA 2K2SA 1WD4A 4WVWA 2QCSB 4GA9A 3ZFGA 4QM9A 3VKFC 2R072 2VOXA 4PDWA 3AJZA 3VL9A 4AYUA 4PBOA 3MI8A 3J9SA