5L73A

Mam domain of human neuropilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
QDEFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neuropilin-1
publication title Crystal Structure of the Neuropilin-1 MAM Domain: Completing the Neuropilin-1 Ectodomain Picture.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l73A00
2D6LX 4XXAA 5DZFA 1LEDA 5GZDA 3WNXA 1IOAA 3VKFC 1LHVA 3ZSMA 2CYFA 1OQ1A 2ZABA 1AX1A 4UW4A 4Z8BA 3CNAA 5GLTA 4P9WA 1LU1A 3WCSA 1CN1A 2ARXA 2Z42A 2ZHKA 5JOYA 3N7LA 1QDOA 4WV8A 3OJBA 4Y1ZA 1C4RA 3R4SA 1KRIA 1MS3A 4XIOA 1URXA 3POWA 1SLLA 3GALA 3ZSJA 5LK5A 1ZA4A 3WZ1A 2JDZA 1QGLA 3OYWB 1QNWA 5DG2A 1EPWA 2JE7A 3WHTA 4DRRA 4JC1A 3D6EA 1LHNA 2D7FA 2P3JA 1O4YA 1MZ5A 4FPHA 2ZGQA 4JRAA 4LBMA 4XJAA 2AH2A 2A6YA 2DYCA 1UN1A 4FP3A 3POSA 5T5OA 1FNZA 3WG3A 2ZGSA 2BQPA 1J1TA 1TEIA 4BOWA 1LGNA 2D6OX 3WCRA 4K20A 1ZM1A 4FPKA 1GYKA 5T55A 1KDMA 1QNYA 1GBGA 4XBNA 3O0WA 3KQRA 1ULCA 4LBJA 1F31A 1BJQA 2ZGOA 4Y22A 5L73A 4ITCA 3R05A 2ZMLA 2GN3A 3RQ0A 3MW4A 1HQWA 1QMJA 1I1EA 1G7YA 3Q9OA 1DBNA 1DQ4A 5GALA 4BQ1A 3QCWA 4WZFA 1CPNA 1GNHA 1GICA 1UMZA 3UJQA 2XG3A 4XDQA 4XJUA 3IPVB 5HCBA 4DRVA 1LODA 1MS5A 5GZCA 4LBNA 4Q8KA 2R1BA 1G9CA 5EXOA 2A3WA 3M3OA 1PZ8A 1V00A 1AZDA 2GNBA 4GWMA 2JE9A 1YRZA 5GLWA 4M01A 3AK0A 3M1HA 4Y1XA 2WT0A 1S1AA 1GANA 4DQAA 1VALA 4XHXA 2ZA9A 2EIGA 1D2SA 1W0OA 5T5PA 3TAYA 3N3HA 5E89A 4UW6A 4YM0A 5JMCA 1B09A 1I3HA 1V6MA 3O0VA 4R9CA 4YZ4A 1JYCA 3U4XA 4UW5A 1GNZA 1MS8A 1X50A 4UW3A 3B9CA 5GLZA 3T1MA 1DYPA 2A71A 1QOSA 2A3XA 3ZSKA 4YFWA 1UKGA 1WLDA 1WD4A 4LBQA 3ZXFA 4Y1VA 1BZWA 4ISRA 1LHWA 1UZZA 1MR5A 2AUYA 5GLUA 1Q8QA 1RITA 3L2YA 1ULGA 5F5QA 1G9DA 2EXJA 2AREA 2CWSA 3ILFA 4XMIA 3TB0A 3AJZA 4FPCA 1W6PA 3V0AA 4LBKA 4WVWA 5DUUA 1MVEA 4ISQA 5H9SA 1G9AA 1G9BA 1MZ6A 1W6QB 1LJ7A 1LOFA 2P2KA 4HL0A 4XJWA 1CPMA 1FX5A 4XHBA 4YW3A 4ASMB 1APNA 2PHWA 3LSEA 1VLNA 2R0HA 2HYKA 3IN9A 4FQZA 4FPLA 2DURA 3LSDA 2GMEA 2ES3A 2ZMKA 3VV1A 2Q5TA 3ZPYA 2I2SA 2YV8A 5JDBA 5KXBA 1LHOA 2YXSA 1QOTA 2YMZA 1S0DA 4FPOB 4BLJA 3AX4A 4L8QA 3W59A 1N1SA 2NP0A 1MVQA 1ONAA 1DIWA 2D43A 4YW2A 1HLCA 4TZDA 2PHTA 1IS5A 3N7MA 3PVNA 3T1LA 1Q8PA 4XIKA 4Q8LA 1ULFA 3OY8B 3RMXA 4ZKTB 1MS1A 5JLVA 1FV2A 1LGCA 1Z0HA 2P3KA 2WLQA 3D5OA 1SACA 2DV9A 4XJZA 3O0XA 2SLIA 3DGTA 5FRAA 3OPZA 3AP4A 2ZHLA 3OBTA 3MEPA 4R9DA 1Z78A 1S0BA 2ZKNA 1Q8OA 3WV6A 2P3IA 4FOWA 2PHFA 4M3CF 3BOPA 4FPEA 4XJ8A 2DVAA 1WW5A 3R4UA 4NO4A 1MS4A 1BYHA 2DTYA 4YGDA 2G4IA 2A6VA 1LU2A 2LALA 3A0KA 4LBQD 1N3QA 4FOYA 4LBLA 1WLWA 1DYKA 2ZGNA 1XQNA 5T52A 3FLRA 5KXCA 1UX6A 5IK5A 1W6OB 2LTNA 2EAKA 3USUB 1ENSA 1BQPA 1SLBA 1MS9A 5IK8A 2A7AA 3POYA 3OYWA 3BODA 2ZBJA 1IKQA 2A6ZA 1LECA 2W08A 1QDCA 4Q1RA 4XZPA 3RS6A 3D4KA 4BMBA 1QU0A 5DZGA 1KJLA 3WG2A 2E6VA 2NZ9A 4Y1YA 5KXEA 1JN2P 2EXIA 1AJKA 1AJOA 4U36A 3BTAA 1WD3A 4XBLA 4OZXA 1CESA 3SNMA 5T50A 3UL2A 3I8TA 2D6NA 3QLQA 3PVEA 1MACA 1F5FA 1KQRA 1JOJA 4D69A 1D0HA 2VU9A 3VKMA 1F9KA 4C1WA 2W39A 4WVVA 2NN8A 2E7TA 2PHRA 4YG3A 1NXD1 3N36A 1Y7BA 2KM2A 4Y20A 3RMYA 1LULA 3IPVA 3WDWA 2CNAA 4Y20B 3FFZA 3N35A 5CA6A 3AYEA 1UL9A 1WLCA 4P14A 4YFZA 3IM0A 1SLIA 1LCLA 2FHRA 2WT2A 3AJYA 3VKLA 4CRQA 3WG1A 1V6LA 1QKQA 2P34A 3AYCA 1Q56A 3AXEA 3UK9A 1GZ9A 3AZZA 1RINA 2DVGA 1V6KA 4P9YA 3NV1A 1Q8VA 1WCSA 4YG0A 2DU1A 3JU9A 4FPGA 2ZZJA 1AXYA 3MW3A 3KM5A 1ENQA 2R49A 4YW1A 3ATGA 3OGGA 5IK7A 4Q1PA 4Y1UA 1UPSA 3HMYA 1ENRA 1RIRA 2AENA 2A75A 2GNDA 3ILNA 4YGCA 1S0IA 5F9TA 2C9AA 2EALA 1WUVA 4YGBA 2JJ6A 1FATA 3B01A 4K21A 5CB7A 2D3PA 1YIFA 4YG6A 1G8WA 1LOEA 1H9PA 3IKWA 2VW0A 1LOAA 2GALA 4XE9A 1LOCA 3ZXEA 1LENA 4R9BA 3V64A 1ULEA 4FQ4A 1A8DA 4GKXA 2AYHA 2PELA 2YZ4A 2SBAA 3WUDA 4PF5A 4XILA 1W6QA 2CTVA 2ENRA 2WSUA 1DQ0A 4RL7A 5DUWA 1DQ6A 4ATEA 2ARBA 4YGEA 4CTEA 2DUQA 3MPPG 2YROA 4PBOA 4Y26A 4XBQA 2WSVA 4ZXKA 4XXPA 2RHPA 1KITA 2UURA 3N7JA 3VKNA 1JBCA 2VW1A 4YLZA 3APBA 3A0NA 3AP7A 5EWSA 3AYDA 2ZGRA 1WW6A 2ZGLA 3WLUA 3AZVA 3M3CA 5CBLA 3WVJA 1IS6A 1AX0A 3HR9A 2OUHA 5AVAA 2A6XA 3WDYA 1FYUA 1NLSA 1DQ1A 4AVTA 3FUOA 1IS4A 3NWKA 2ZGPA 5FREA 3WDUA 1YYNA 2ERFA 1CJPA 1HQLA 3AYAA 3OY8A 1U0AA 3BIWE 5HCFA 4AGGA 1A78A 3C2UA 4K1ZA 2DVFA 2EF6A 2DVBA 2VW2A 1SBDA 4PQ9A 1LOGA 4R9AA 1W6NB 2WT1A 5GM0A 2VY0A 3INAA 1S0CA 4AYUA 5DUVA 3A4UA 3IMNA 3WG4A 5IT6A 4YZ3A 3GNEA 4CZSA 1HDKA 3RSJA 4BPZA 1N47A 2UU8A 5EYYA 5GZGA 1PZ7A 1GLHA 1SLTA 2D3RA 3H0OA 4M00A 4M3CB 4JCKA 1JW6A 4AGVA 3V0BA 5EYXA 1KDKA 3V0BB 3SISA 4DPNA 1VAVA 2D3SA 1SBFA 4BLIA 1FNYA 1WBLA 2V73A 2JECA 4C1XA 1C1LA 2GMMA 4XTMA 3WDTA 2DVDA 4YM1A 1W6OA 3WDXA 3USUA 1DGLA 3DUIA 1CVNA 1N1VA 1GZWB 2EXKA 1CR7A 1N1TA 3PMEA 2V5YA 1O4ZA 4TYSA 4U2AA 3T2TA 1C1FA 2ZMNA 3AZWA 1QF3A 4FPFA 3B3QE 5JOZA 2NMNA 2R16A 4Y24A 3ZXKA 2ZHMA 3ZYRA 2ZGTA 3AP5A 3ZYPA 1GZCA 2UWBA 2CL2A 2P37A 3PJQA 1BXHA 3ZVXA 3W58A 4GKYA 2B7YA 2WKKA 3M3EA 2VUAA 2VH9A 2C5DA 2VXRA 4W65A 1DLLA 1SBEA 1S0JA 2JKBA 2GMPA 2NM1A 1OKQA 1DQ2A 3M3QA 1CONA 2A3YA 3WOGA 1G9FA 5CNAA 5H9PA 3O12A 2YY1A 4HANA 1W0PA 4XTPA 1WBFA 1V6JA 3WUCA 1YI7A 1LEMA 2OW4A 3HN1A 4FOVA 2DUPA 1AXZA 1FV3A 3AP6A 2A5ZA 4H55A 3RRDA 3SITA 4PCRA 1H9WA 2OVUA 3WHUA 3LCPA 5CAZA 1HKDA 1IKPA 3N7KA 4PBPA 1A3KA 2DTWA 4XYXA 3PVOA 5T5JA 3SH5A 1DHKB 4FPJA 1V6NA 4LBOA 3AFKA 4YM3A 5JOXA 2PHUA 3JUUA 4Y22B 4YM2A 2D6MA 3FLPA 1G86A 1V6IA 2NMOA 4Q27A 3ASIA 2AGSA 4M3CE 4I30A 4BMEA 4F83A 2AR6A 2A70A 2GNMA 2UWAA 2XB6C 2ZACA 1W6MA 2GNTA 5T5LA 5JVVA 2A6WA 3VUOA 1W6MB 1JYIA 4FVVA 1VIWB 1H30A 1YXWA 4Q26A 4MYEA 4AWDA 1DZQA 1IS3A 1S0EA 5DZEA 2W68A 3B00A 4GWNA 2CY6A 2ZGUA 4BM8A 4FPYA 4KBBA 2CWMA 2NYYA 3I4IA 4DFSA 4YZ1A 1LOBA 1CQ9A 4GXLA 2D44A 2GN7A 3MW2A 1WW7A 1LHUA 1QOOA 4AGRA 2WNEA 4IQPA 1JXNA 2ZGMA 5E8AA 2W52A 1JHNA 1SLCA 2EXHA 5H9QA 5IK4A 3NV4A 3VKOA 3AP9A 3ZXJA 1GSLA 1OFSA 1ULDA 3AZYA 2R1DA 3FBYA 4XJ9A 5DXDA 2D6PA 3SH4A 1AF9A 4ATFA 1GKBA 4XMAA 1KJRA 3FUQA 4GA9A 2DUOA 4XOGA 4YW5A 2WJSA 3B69A 1UAIA 1N1YA 4LBQB 4AVVA 2PHXA 3FLTA 2WQZC 3WDVA 3ZXLA 1AVBA 1GV9A 2E7QA 5E88A 2TEPA 3NV3A 1MS0A 4NOTA 1S0FA 5SV8A 5HCAA 4SLIA 1Q8SA 1S0GA 5IUQA 1AX2A 1DQ5A 3ZSLA 3V65A 1WW4A 1JUIA 4FOQA 3NV2A 1W6PB 3V0AB 1R1ZA 1LOFC 5DG1A 5JOWA 1N3OA 2ZGKA 1UZYA 3ENRA 1SCSA 2DWRA 2ZHNA 1C57A 4GALA 2H0BA 1W6NA 3RG0A 1CIWA 1V6OA 2R0FA 3SH3A 2E51A 4YW4A 2DU0A 2OUJA 5DUXA 3SLIA 3ILRA 1VAMA 5T54A 5H9RA 5GJ6A 2FMDA 2JD4A 4RA0A 1N3PA 2GDFA 5GZEA 4M3CA 1LESA 3OBRA 3M2MA 2D6KA 3AZXA 5GLVA 2ZAAA 2UWCA 4YZ2A 5GZFA 4K1YA 4Q2FA 5BYNA 1YO8A 1BKZA 1FAYA 2E53A 1LTEA 3AXDA 4DS0A 1LGBA 5KXDA 4YZ5A 4P9XA 4FP2A 3UJOA 1SCRA 1AXKA 3O5SA 1SLAA 1GZWA 1PZ9A 4AVSA 1DFQA 1SFYA
chains in the Genus database with same CATH superfamily
1HV1A 3FC0A 1JZ3A 2VOTA 3KZ4C 5LBBA 2QQKA 1C5HA 5FP4A 5C8CC 3WNXA 5CFDB 4Q4V2 2FQPA 2X10A 3L9JT 1W06A 4LE4A 3O1MA 5JZGA 4CCCA 1W8UA 4CP1A 3O1SA 1B35B 3THCA 1RUOA 2W1QA 1ZZCA 3WCSA 3OGJA 2WWJA 2Z42A 4LHKA 3DECA 4CSWA 3BTZA 2ZHKA 3J7MA 2X53S 3O14A 3VBFA 3ZKUA 2CGNA 2XJPA 1YUDA 1JOBA 4Y1ZA 3C7GA 5D8AA 2FBEA 5F6LB 5FXXA 5A33B 1PVXA 2P5BA 4NVPA 1SLLA 2JIJA 4AFBA 3K3OA 3RVHA 3S6PA 4DRRA 4JC1A 2D7FA 4XJAA 2LROA 1O4YA 2ZGQA 1VAKA 2YG0A 1NY72 1UN1A 1AR81 1FNZA 4MO3M 1W0NA 1J59A 4XFFA 1RHI3 1QJEA 1QJU3 1TEIA 4IXLA 1LGNA 3Q8BA 4I3GA 4MVTA 1QJU2 4N90A 3WCRA 2YPJA 4HSLA 4DNYA 1KDMA 2Y64A 2E7AA 3NJZA 3O0WA 5IWFA 2AEZA 2HEWF 4LBJA 4HKLA 3LEGA 3R05A 1JI6A 2GN3A 3C8XA 3MW4A 1QMJA 5J1XA 3CZUA 2KXLA 4NRMA 4QB6A 1DBNA 1DQ4A 5GALA 2CAVA 4L11A 1DGWA 3CU7A 3QCWA 5FYSA 1K42A 1JZ5A 2R043 2R042 3QD6A 5HXMA 3FX3A 2QQMA 1S2BA 1Y9GA 3B93A 2XKOA 4LBNA 2XJSA 3VDCA 4CP0A 1JZ4A 1XOYA 4ZY9A 4W4ZA 5HPOA 1VRH1 1G9CA 2JDYA 3FWEA 3JBG1 5C3OA 3KGLA 1E5RA 2PFWA 5DDJ1 3GZAA 5CADA 2FDFA 4DZGA 4G4FA 2TBVA 1YRZA 4GWMA 5GLWA 2Y38A 4EN7B 4Y1XA 2JG9A 3RJRA 4DQAA 1GANA 2DCKA 1K5JA 1HB1A 1WCDJ 3BYWA 1D2SA 4UFLA 1KFXL 1QIQA 2EIEA 3POBA 4HLTA 5E89A 3PVBB 2QNKA 1NT0A 1B09A 1I3HA 1YQ8A 4YM0A 5K4LA 4WVZA 2W0XA 4AG4A 5JMCA 3NNFA 3B9CA 3LWCA 5GLZA 1NA1A 2CDOA 3VL8A 1WCKA 1HRV3 3J8F3 1AYN3 3C3VA 4IEYA 1HRV2 5APAA 5JUVA 1AYN2 3ZXFA 1WD4A 4BQ3A 3KHCA 1BZWA 4CUBA 3MYXA 4DY5A 1ZZ6A 1MR5A 2E33A 1ULGA 2PQSA 2VNGA 3ILFA 3O7OA 3QH7A 4XMIA 1D2QA 2JWPA 4OMCA 4C91A 4FFIA 3BB6A 1FT9A 1R1A1 3AJZA 3UNPA 1W6PA 5FOJB 1UXZA 4LBKA 1K3IA 4ISQA 4Q4W3 1G9BA 3BKZA 4Q4W2 1LOFA 1UPIA 1W6QB 2ID4A 4XJWA 5FP3A 1CPMA 1FX5A 4PLNA 5FYTA 4QGLA 3LIHA 1APNA 2XOMA 3LSEA 4XFAA 4AFCA 4ASMB 4KG8A 4DXZA 4DXTA 2R0HA 2VD7A 5BNPA 5FK7A 5L9VA 3D3AA 4FPLA 4E4DX 3S7IA 3FN9A 2ZMKA 4S2HA 5FWJA 2GP5A 5JXHA 4LO4B 3EJKA 3ZPYA 1PGW1 2I2SA 2IUWA 4XAAA 5I8YA 3HBKA 4CP2A 4B4PA 5FP9A 4FTBA 2RS13 5FYVA 4TSVA 3T2OA 3G6JB 2RS12 3FBMA 3W59A 1OXCA 2NP0A 1ONAA 2G9FA 2D43A 2HEVF 5LA9A 5JSOA 1W2OA 4M0HA 2XL7A 3PVNA 3VBSB 4GQ7A 4MXWA 4BB3A 3LAGA 1FV2A 3BGAA 4GH4B 1GNYA 2VOXA 2VZVA 4NHXA 4XJZA 3O0XA 4AXOA 2SLIA 5BNNC 3OBTA 3MEPA 4HONA 2AZ5A 4R8HA 4R9DA 1Z78A 5AVPA 5DAQA 5KHHA 2OZJA 3BTXA 1Q8OA 3LE0A 2BW8A 4FOWA 2PHFA 1FXZA 3BOPA 4FPEA 4XJ8A 5A6YA 1MS4A 3WNPA 3T4VA 1O5LA 2G4IA 4EQVA 1IGOA 2WC2A 1CIYA 1F4AA 2LALA 4RGKA 4HXCA 2RDNA 1JYXA 1WLWA 5FY0A 1DYKA 4MGKE 4XDPA 3RWNA 1Z7S1 4KG0A 1SPPB 2PHDA 4EV0A 2JDHA 3WNLA 1CAVB 1W6OB 4ES8A 4PLOA 5FZMA 1W8WA 2A7AA 2VBDA 2WR9A 3HNMA 3HPNA 4O61A 2WO2A 3NKTA 4W8JA 3ZXDA 3GHMA 5EZWA 4XUQA 1LECA 4XZPA 3WF4A 3ZFEB 4AEMA 4I01A 2PYTA 3D4KA 2BOJA 3WF3A 4I02A 1QU0A 4BMBA 1CD3G 3I2OA 3WG2A 1STMA 1X33A 2E6VA 2HWB3 2NZ9A 2VGDA 3PIJA 2BZDA 2F4LA 2HWB2 4IL7A 2ZKLA 1ND2C 3BTAA 4XBLA 1VBB3 2HJIA 3VDBA 2RV9A 3KF3A 4Q5OA 1VBB2 5T50A 4LK6A 4NAMA 5D8AC 1O8PA 3NNJA 1RUC2 2B9VA 3B5LB 4WBBA 4QGMA 4OULA 3VKMA 3P3NA 1E57A 4C1WA 1IQDC 2W39A 5GKAC 5KC6A 2OXBA 2NN8A 3G7DA 4NAOA 3C7FA 2WNUB 4YG3A 4BYYA 2HWC3 4QAWA 3RMYA 1UZVA 2HWC2 4QX3A 4EN9B 2CNAA 1VB2A 4LHNA 3N35A 4QB2A 3MIHA 4JGZB 1UL9A 2KD7A 1FMD3 4N43C 1SLIA 2FHRA 3AJYA 1FMD2 4DIQA 3AL6A 4TTGA 4XF4A 1NY71 1V6LA 2GU9A 2P34A 4QM8A 5FO7B 3HAGA 3NRUA 5EPAA 4MHUA 1GZ9A 1ZRCA 2B4KA 4IV3C 1NCRB 2ARAA 4D7TA 5FPXA 1RHI1 1W2TA 1QJU1 2XR4A 4QDSA 3AC0A 3LDKA 3AL5A 4GIQA 4MV2A 1OVSA 1CAXB 1WCSA 4NHKA 3AKSA 3PTRB 4QKBA 4Z82A 2ZZJA 1AXYA 4OI1A 2ZCWA 4QX0A 5IVCA 4PDWB 2O1QA 1XNDA 3GBFA 3PIGA 3ATGA 5T3NA 5IK7A 3N9OA 1GR3A 4IV1B 4N53C 3BU0A 4Q1PA 4Y1UA 5A3PA 2WFPA 1ENRA 1GP5A 2A75A 2GNDA 1XXNA 4YGCA 3VD5A 5F9TA 4V2WA 2WLPA 2HLEA 3SCFA 2R041 2RE9A 2JJ6A 4IDZA 4K21A 4KL1A 5EQUA 4CCLA 4FBFA 3THPA 3T09A 1D0GA 2BP6A 2JDKA 1J83A 1G8WA 2JG9C 2QQPA 4FXGB 5KHKA 1GUIA 3P5BA 4X6QB 4XETA 4JDOA 3ZFFB 4BIOA 4LR4A 4J1XA 4XE9A 1RC6A 3RYPA 1W9FA 4HMZA 3WT3A 1XNBA 2R7EB 3MBWA 3U1XA 5FBZA 3KQ4B 5C3QA 1W6QA 2CTVA 2JDUA 4LNVA 4V2VA 4D6SA 4F3JA 1DQ6A 4UFHA 2ARBA 5FY8A 2DUQA 4Y26A 4D6RA 1VMHA 2WSVA 4CXYA 2BVVA 3FHQA 4XXPA 3VKNA 1F8VA 4I3PA 4XW3A 4YLZA 3APBA 1HIXA 2Y0IA 2FZ2A 2ZGRA 1WW6A 4NJ4A 2J1TA 2G9GA 2XQRA 4MOAA 5FZFA 2Q0AA 2ZX4A 3KSCA 4RYDA 3B02A 4A6OA 5JIUA 3W5NA 4OUEA 2IWGB 3LZZA 1HRV1 2OUHA 3WQBA 3J8F1 1AYN1 4KWKA 4AHWA 3RNSA 2RDSA 5FZ1A 2WO3A 3BN6A 3I2FA 1H2MA 1A6CA 2XLFA 4JHZA 1MZFA 1W2AX 4A41A 3HT2A 3VBSA 5FREA 4AVTA 1MQTA 2VECA 5FYUA 1CJPA 4QXKA 3SCHA 1U0AA 1BVVA 3PUSA 1A78A 3EXUA 1L7QA 5BNPC 3H8RA 2VW2A 1RUH3 4PQ9A 2DCJA 1RUH2 3H8UA 2VY0A 1BBT3 4Q4W1 1E5IA 3IMNA 3WG4A 2MPFA 1KXGA 3GNEA 1HDKA 4BPZA 4L2NA 1GQPA 2Y6GA 3RZZA 5A3TA 1RUF3 5GZGA 1RUF2 2YFZA 1DGWX 1NE6A 2X5IB 4XVHA 4LOSA 4M3CB 4AGVA 1WMEA 4QX2A 3TRSB 1QH6A 3EBRA 4ES9A 4Q0UA 4BXFA 2VXJA 4DPNA 1VAVA 2RS11 1SPPA 3ZO0B 1S2EA 1DGRN 4KU7A 4C1XA 4EZHA 4OHWA 1ALYA 1YFYA 4QHZA 1U5IA 1CAVA 1W6OA 2DVDA 4GMP0 1AR63 4DXRA 5J37A 1VR3A 1GZWB 1AR62 3PMEA 2V5YA 1ACCA 5CFDC 2ZMNA 1K5MB 2VQTA 4BA6A 3K77A 3AZWA 4EN6B 1J3QA 3ZFEA 5FZ9A 4MGYE 2BFUL 3ZYBA 4NIIA 4Y24A 3S30A 1XYNA 3BPSA 1B35C 3PNAA 3ZYPA 1XBFA 1GQHA 3ST7A 3ZVXA 4RN5A 4HN0A 4GKYA 4IEZA 3I3DA 2GC2A 3ACHA 3M3EA 4JDNA 2VUAA 2VH9A 4AOCA 2VXRA 4EE2A 3B94A 3PU8A 2GMPA 1OKQA 2VVFA 3WOGA 2A3YA 4MGQA 5DAPA 2V4AA 3AVSA 5H9PA 3O12A 2D93A 2C6SA 2OT7A 1V6JA 1PMHX 2Q1MA 4C0BA 2D98A 2WNUA 2C0ZA 1OLRA 2VZPA 3ME2A 1X36A 5FZ8A 3SITA 1OLMA 2OVUA 3LQCA 4J6GA 1UW8A 5L9RA 4AVCA 5KC5A 3N7KA 4FXKB 5J96B 4XYXA 1RUNA 4LE3A 3WQ7A 4AEDB 4IGQA 1OH3A 2R073 2HWB1 1NCRA 2VMEA 3NW4A 2R072 4QPGB 1CX1A 4YM2A 2D6MA 1NAEA 5LASA 3VBHB 1AYM3 1UOBA 4YW7A 1VBB1 5FUPA 3SCGA 1AYM2 1J3PA 2R063 3I3BA 3IAQA 2AGSA 4PDWA 2R062 2Y6HA 2AR6A 3D82A 2UWAA 2IXCA 4NPRA 4OVEA 5BXXA 3WF0A 2J1AA 2XB6C 3OGSA 2W92A 4LORA 2W46A 4DB5A 2VNRA 2DFCA 4OFGA 4YPJA 4BQYA 1JYIA 1NZIA 1H30A 4MYEA 2VQ0A 3KHBA 4CXXA 3WSOA 1ZZ9A 5J09A 5DZEA 2HWC1 2W68A 4CU9A 2MNGA 5L19A 2ZGUA 3AMHA 3NAPB 2ET7A 4KBBA 2YC0A 4ZZ8A 3I4IA 1MEC2 4YZ1A 1FMD1 4CDWB 2Q4SA 4OCTA 4GXLA 2GN7A 1I9RA 3TOJA 1JUHA 1QOOA 2HBTA 1VJ2A 1NX9A 1J58A 1JXNA 5E8AA 2TUNA 4WM7B 3VL9A 4XF9A 1PMIA 1SZBA 2L9LA 1Y9QA 2QZ2A 5D2AA 2VMHA 5DXDA 2R1DA 4E27A 3SH4A 1POV0 3ON7A 4ATFA 1KEXA 1XNKA 1KJRA 4XMAA 4GA9A 3ZN4A 2DUOA 4XOGA 4ZU5A 5A6QA 4N7IA 4CYDA 3W21A 2PHXA 3USSA 3N4MA 3WDVA 1OKOA 2O14A 5E88A 4NOTA 1MS0A 5IAXA 1S0FA 1NCQB 5FPLA 4SLIA 3THDA 3TNPB 1S0GA 4NE9A 5EFUA 1DQ5A 2VMGA 3ZSLA 3V65A 4COWA 1UX7A 2XVGA 1KS5A 3DXUA 4AAXA 1T2XA 2ZGKA 3PDQA 3ENRA 2DWRA 4JQRA 1C57A 4BOWA 2P6HA 2YBPA 1Y3TA 1RUE3 2VZ3A 1IHMA 1RUE2 4MGTA 3TEXA 2OUJA 2PMWB 1GOHA 4PLMA 2PHLA 5FYHA 5H9RA 5GZEA 2FMDA 4RA0A 4NWVA 4M3CA 3T08A 2ZOEB 3PUAA 3M2MA 5GLVA 2ZAAA 2UWCA 1QWRA 4YZ2A 2ZXQA 3VBSC 1YFWA 5AC93 4LMFA 5C4WB 2B46X 2FDJA 1OPOA 4GWJA 5AC92 1YQCA 4MZUA 2E53A 2XPJA 3AXDA 4GH4C 2AEYA 2JENA 4H7MA 2ZX1A 3DXTA 1PGSA 1DP0A 3WNKA 2FDIA 3RJ2X 1GZWA 1PZ9A 5E1RA 1UY3A 5CISA 1SFYA 2IXJA 1JYVA 2D6LX 1K5MA 1JYTA 3CKHA 5DQ0A 4QKFA 5KBFA 3M3IA 3VD9A 4GJZA 4BQXA 1RUH1 3D0SA 1LHVA 1W8OA 3HQXA 5JPNB 1BBT1 4UW4A 3E97A 4A7YA 2RJ2A 1H0BA 1QQP2 4QMAA 5FYYA 4AFDA 4P9WA 1UY4A 1RUF1 2XGXA 1WWYA 5JPMB 3KLSA 1V9U3 1QHDA 3N7LA 3R0RA 2VC9A 4WV8A 1DU3D 2W94A 1C4RA 3R4SA 3H42B 1KRIA 1IG3A 1MS3A 2DDUA 3GALA 2OX0A 3ZSJA 5LK5A 1ZA4A 2JDZA 1LNSA 1QNWA 2X09A 2JE7A 5LBFA 1EAH3 3GBGA 3AMQA 2RS33 1LHNA 1EAH2 3D6EA 4JRAA 4J25A 4FPHA 2RS32 1AR61 3FZ3A 2AC1A 2AH2A 4KU8A 5IAVA 2A6YA 1RJ8A 3MI8A 3GDBA 3MIEA 3Q8AA 4FP3A 4UFKA 2JEMA 5L9BA 4L99A 2ZGSA 1W8ZA 3UKNA 5FPAA 1S55A 4PJYA 1ZM1A 3N9PA 2YBSA 5A1AA 3I54A 3CLPA 5JXJA 2Y26A 4QPGA 2FZ1A 1F31A 1BJQA 1RTVA 1YWKA 2ZGOA 4HT1T 4K6BA 1QJZA 1Y43B 3JXSA 2V5DA 1HQWA 2A1XA 2WNUC 1I1EA 1G7YA 1R083 3Q9OA 3JQXA 3L2HA 2XJRA 1R082 4HVOA 3ZR6A 4B4RA 2W5FA 3ZN5A 1CPNA 3K75B 1GICA 4JGZC 4JHTA 4QDRA 4XDQA 4XJUA 3IPVB 3GCWA 3ZOIA 5I91A 5FV3A 3DV8A 4AR2A 2WYFA 1MS5A 4DRVA 4OQ9A 4Q8KA 4OHYA 1SDWA 1IG0A 1GWMA 4NPLA 2A3WA 3M3OA 3ZKYA 3POFA 3NAPA 3S5QA 3UKVA 1CWPA 2GNBA 4F7ZA 5FKCA 1O59A 4CDWA 1TMF2 2HKXA 2R6QA 4XHXA 2ZA9A 4PDWC 5F32A 2KA3A 4AF9A 2XUEA 2XDVA 4IV1C 2R071 2W3JA 3GBWA 4WM7A 3IT8A 3O0VA 1W9SA 3UV9A 3U4XA 2Y60A 1AYM1 1X50A 3DN7A 3HOBA 5F1RA 2R061 1HB3A 1TQ5A 4YW6A 3RYKA 1AL22 1NA1B 4MXVA 2A3XA 3ZSKA 4LO8A 4YFWA 1Q3EA 2I07B 2XWJB 1RUG3 4XUNA 3ZFFC 3H3LA 1XJAA 1OD5A 1PO12 2AUYA 1NCQA 4IEVA 3U11A 1Q8QA 3L2YA 5F5QA 1G9DA 1UNBA 2EXJA 2AREA 2MHFA 1TE1B 5A3UA 3RGBA 3TB0A 2IFRA 1ZBE3 4Y5SA 5IVJA 4WVWA 1MVEA 5L7OA 1G9AA 4QPWA 4RHV2 4P9JA 3TYJA 1LJ7A 1H2LA 2P2KA 4JGYC 2ZZQA 4XHBA 5HV4A 5F3GA 3SEPA 4QGNA 1VLNA 2VAUA 3OBZA 4RS5B 3MICA 4AE2A 5ABJC 2ES3A 3JCIA 5C71A 4PT6A 2Q5TA 5FP8A 3BUCA 4PIXA 5KXBA 3SHRA 4YVSB 1ZRFA 1QOTA 2YMZA 2Y6LA 1NUKA 4PF1A 3ZFGC 4LA2A 2FCUA 3AX4A 1N1SA 1OF4A 1DIWA 4ZS2A 5LW9A 3WY6A 5FXWA 5C4WA 5A6ZA 4ZU4A 2IZWA 1OT5A 2WNVB 1CAUB 3IDBB 4P9GA 3T1LA 3ZYHA 3HIFA 5I8SA 4Q8LA 4EJRA 1ULFA 3RMXA 4ZKTB 1BMV2 4NWWA 2C26A 2RJLA 3ZYJB 4GJYA 1LGCA 1UMIA 2P3KA 4AHZA 4CDXB 4AI2A 2JX9A 1RXGA 5FRAA 3VZKA 3ZR5A 1SQ4A 5DMYA 1T6GC 1BK1A 4Q4V3 3DPRC 5FMBA 4CEWA 2X5IC 5DAWA 2P3IA 3TNQA 1RUE1 4M3CF 2RMU3 2VTXA 4B1MA 4BE3A 2RMU2 2WNOA 2PAKA 3R4UA 4NO4A 3WP4A 1BYHA 2BUKA 2DTYA 4XAEA 5EV7A 3KCXA 4GB32 3KB5A 4F8AA 2E31A 2A6VA 1LU2A 3A0KA 3WW4A 1N3QA 4IEPA 4LBLA 4DUVA 4Z2WA 5JI9A 1XQNA 2VMDA 3MUZ1 1O4TA 3FLRA 1PGL2 4EROA 5AC91 4YVWC 5FJHA 3USUB 2Z2SB 4A7KA 2BU9A 1CZTA 1BQPA 1ENSA 3HQRA 5IK8A 3W20A 3POYA 5I0DA 1LAJA 4HG6B 1IKQA 3J9SA 2A6ZA 1QDCA 3IDAA 4A44A 5FMOS 3LA2A 3LOIA 4JVAA 1VPHA 4QPIC 5D1IA 3WEZA 1JN2P 5KXEA 4E8DA 1VB4A 5FZ0A 3VBRB 5A3LA 4MX3A 1CESA 3FL7A 5DN2A 5FMDA 4SBVA 2Q8OA 1TZOA 2D6NA 3PVEA 2VMIA 1KQRA 2HWE2 1JOJA 3PL0A 5FPVA 1D0HA 5C9AB 2HBUA 1V9U1 4AQ6A 3VHRA 2JXAA 5LATA 3NJXA 2VNOA 1O5UA 1YNAA 2E7TA 3KT7A 5SV5A 1NXD1 1YQ2A 5C70A 3N36A 2KM2A 4L97A 4LIVA 2BNMA 1LULA 3IPVA 2QCSB 3AYEA 4LKEA 5CA6A 4YFZA 4LITA 3IM0A 3VKLA 1LCLA 2Z79A 1EAH1 5AFEA 4CRQA 2RS31 4AEDC 4BWOA 2QE3A 3SC7X 1HJFA 1YIPA 3ACLA 4UYBA 3AYCA 3AXEA 4QPGC 3VHOA 2P17A 3OPTA 3VBHC 2O0OA 2PQQA 1V6KA 4HK8A 2YYOA 3QBQA 3NV1A 5LY1A 2V4VA 3K2OA 5IFPA 1UYPA 2DU1A 3GCXA 4YG0A 5FYZA 1VMFA 3MW3A 4BCUA 1SFPA 3BOWA 4DUWA 4NN0A 4OI4A 1UPSA 2WN2A 1RIRA 3H3UA 2AENA 3ILNA 1R081 2C9AA 2EALA 3ZX7A 1BEV3 1ZA7A 1BEV2 1JU4A 2Z69A 2WA3A 2XLGA 3B01A 4YGBA 5CB7A 2LW8A 1H8TC 1YIFA 4YG6A 4LUKA 5CZKA 1GP4A 3GXUA 4NIAA 3ZIXA 1QXRA 2VZOA 2XH6A 5A1LA 3ZM8A 1O3TA 1H9PA 1HQNA 4K9SA 1ST8A 4XURA 2GALA 2F17A 5FPBA 1LOCA 3ZXEA 1HN1A 4XFGA 1QJY2 3V64A 1ULEA 3PUIA 4FQ4A 1A8DA 4GMP3 3SEEA 2WZPP 4WM7C 4RR3C 4OLLA 1ZREA 4PF5A 3POJA 4XILA 3AB0A 1PM7A 4LIUA 4YGEA 1U5ZA 1UY2A 4OHVA 4RS5A 4A7ZA 1OF3A 4QHBA 1RUJ3 3POEA 5A7OA 1EUUA 1RUJ2 2ZGLA 3WLUA 3AZVA 1C5IA 3M3CA 5I8TA 4YVSA 5CBLA 1NCQC 4EWDA 2RDRA 1JODA 4PIZA 3QH6A 5K7PA 5F2SA 1RUG1 2KR2A 3WDYA 2WNVA 1CAUA 4IETA 4XABA 5G04L 3KV5A 5FIXA 5FP7A 3ROUA 3RZMA 3KVBA 1MQTB 2ZEYA 3A22A 2CGOA 3C2UA 1XC6A 4K1ZA 2DVBA 5F3CA 4CDXA 1ZBE1 4UOJA 5LBCA 4IEXA 4E9KA 5DUVA 1W2UA 5IT6A 2YPDA 5A70A 4WZCA 3WNOA 1OH4A 5EYYA 2Y8KA 4S2GA 3OUIA 1GLHA 2WFF3 3IIIA 4M00A 5FMCA 4CU8A 3SQOA 2WFF2 4L0PA 2PTMA 4GZ9A 2MEV2 2W1SA 3RPQA 4BQ2A 3LB9A 1H2KA 3MPBA 2E26A 5HXVA 4BLIA 4LO7A 2V73A 2JECA 2IVIB 2GMMA 2H0VA 1YJKA 4XFHA 4E4ZA 4A3XA 3ES4A 3USUA 1DGLA 4P14A 2EVXA 3A23A 5JCTA 1N1TA 4GAZA 4TYSA 4U2AA 1O4ZA 2YC2A 4XCBA 3HNYM 3T2TA 5IVBA 3RZJA 3T0AA 1OMIA 1QF3A 5FYBA 4EN0A 1W3VA 4QD2A 3OPWA 3Q8FA 3ZXKA 4DEQA 3HNBM 2YHJA 3AP5A 3J7NA 2E63A 3O1TA 2BERA 2CL2A 2P37A 3T0BA 1BXHA 1C8M3 3NQHA 4Q4V1 3VBRA 4PI2A 3VHPA 3O1RA 1C8M2 2WKKA 1XU2A 3U14A 1S0JA 2JKBA 4BU2A 2RMU1 3VBFC 1XE7A 1CONA 4R4ZA 1G9FA 2R30A 4V1PA 5CNAA 1RUC3 4M4PA 5HCHA 1HB2A 2GC0A 2YY1A 4XTPA 4OI2A 5C9AA 5LCWL 3WUCA 3KWVA 5JSRA 1QJFA 4QX1A 2BNNA 4QXBA 1W8TA 2DUPA 4MUVA 3P3PA 1XPWA 4J1WA 4BIFA 3AP6A 2A5ZA 1REDA 4IE6A 3ZYFA 5KHGA 1PGL1 4PCRA 4URTA 1H9WA 4FSJA 1XSRA 4RQPB 4BDVB 4KMQA 5K9YA 2VM9A 4E8CA 2GSYA 5DABA 5A7NA 2J42A 4P00B 3VBUB 4PBPA 1A3KA 3PVOA 5T5JA 3E5XA 3TEYA 5JZGB 1OVPA 5FKBA 2QZ3A 1NE4A 3RYRA 5EIYB 2NQYA 4TXWA 2PHUA 4Y22B 3PTYA 4Y5Z0 3K4ZA 5FY5A 1ENXA 2QDRA 5EJ1B 2DFBA 4JKLA 2A70A 3MIGA 2OKXA 5JVVA 3HQUA 4FVVA 4CPBA 1VIWB 4Y5TA 3CQOA 1DZQA 1F4HA 1ZZBA 2CGPA 5A3NA 3ETPA 1YFXA 2ZX0A 3WNNA 5FZIA 2FDGA 1RUD3 2H6CA 2Q8EA 2CY6A 3UETA 2DCTA 4URAA 1RUD2 4FPYA 4NIHA 2NYYA 3ZN6B 4KNCA 4P9LA 4LPLA 1IPSA 3TN92 4Y4YA 2P1BA 1XNAA 3GJBA 4KGQA 2D44A 4QU2A 2J22A 2YB7A 4LXLA 4QXCA 4ZS3A 5F3EA 1H1IA 5LA1A 2JICA 2VMFA 4AGRA 2WNEA 4IQPA 2ZGMA 2W52A 1UYXA 1WCUA 5H9QA 5IK4A 3NV4A 3AP9A 1NA1C 3FBYA 4XJ9A 3N9LA 1XSQA 5FPZA 2D6PA 1UY1A 3OEBA 4XFIA 4DO0A 5FZHA 1XE0A 1OURA 3GGLA 3U07A 1IQAA 4YW5A 3VD4A 2DCYA 1COV3 2WJSA 4BQ5A 1COV2 3ZYIB 1DZRA 4LBQB 2Z5WA 4AVVA 2WZR2 3OUJA 5FOBB 2JB4A 4OUMA 3ZXLA 2E7QA 1KGYA 3FFQA 1BEV1 4NIDA 4P5HA 3WR0A 1C28A 1MZEA 1Q8SA 3H7YA 5JMOA 1RVF3 2VE1A 1OD3A 2W1WA 1RVF2 2AACA 1JUIA 2ADDA 4AFMA 4H2AA 3I2IA 4RGGA 2ZX3A 1LOFC 2JD9A 1UOJA 3M7AA 5M0TA 5FDBA 1UZYA 3NL1A 4QXHA 1RMU3 2ZHNA 4RS5C 4GMP1 3KS7A 4OHZA 2H0BA 1RMU2 1R093 3RG0A 3DEMA 1R092 3H1YA 3IDCB 3T2QA 4TLFA 4G9SB 2VVEA 3SH3A 4E2QA 2E51A 3U0ZA 2PAMA 2P6CA 2IXKA 5GJ6A 2JD4A 4P9IA 1N3PA 1RUJ1 4HFSA 4LKDA 1LESA 5JSPA 1W03A 2XQXA 3LPGA 1VRBA 2K9ZA 2WAAA 2FDHA 3I2GA 2FCVA 1YO8A 1BKZA 3WINE 2VBBA 5FYIA 5BNQA 4YZ5A 2ZS6B 2BNOA 3DYMA 4FP2A 3O5SA 1AXKA 4XF1A 1SLAA 2RS53 3DL3A 5A7WB 2RS52 4XUTA 3ZMNA 2QQJA 4XXAA 5DZFA 1LEDA 1L7RA 3CL1A 5GZDA 4B7KA 3E6CC 5HI0A 1ZRRA 2Q1FA 5C8CB 4OMDA 4CVUA 3J7LA 2BDRA 4IW3A 2CYFA 5IVEA 4PHZA 3PJYA 4OHXA 1OQ1A 2ZABA 1AX1A 5FK8A 4QKNA 1REEA 4Z8BA 5FYMA 4W6YA 2QBXA 5GLTA 4XDOA 2D97A 1LU1A 2NPIA 5LEJA 4DY3A 2EA7A 1KS4A 4X8NA 2WFF1 1NQJA 1QDOA 4D6QA 2N7GA 5JR2A 2IXIA 1UWWA 3X29B 3K3NA 2CHHA 4N8MA 1LB2A 3ECQA 3VZMA 3D8CA 4D94A 3OYWB 2VQAA 5DG2A 4YYOA 3VZLA 4CUGA 4S2FA 1DLCA 4LBMA 4Q0PA 4RQPA 4D7SA 1X8EA 2W9XA 1H8VA 2DYCA 4BQWA 3ORJA 2VBPA 1X82A 3VBRC 3BPZA 3PLQA 1PMJX 2W1UA 5FBJA 5FZ7A 3VBUA 4AI9A 3FMGA 2QQOA 3MLJA 5C33A 1GFF2 4FFHA 1F15A 1GYKA 4FPKA 5CEHA 1QNYA 1GBGA 1UU6A 2WDBA 4XBNA 1O91A 4JAAA 2BPA2 3N9MA 1HV0A 3KQRA 4Y22A 5A6XA 1C8M1 2GZWA 4ITCA 4XC9A 3NJVA 2CSGA 5ERLA 4UWDA 4O65A 1BCXA 4X8PA 4TN7A 4I0AA 4OQ8A 2XVLA 4BQ1A 1RUC1 1GNHA 1XE8A 3UJQA 1OI6A 4BK4A 5A32B 1BLZA 1UKRA 4Q4Y3 3A21A 5HCBA 5D21A 3HBZA 5K0UA 1PVC3 4Q4Y2 1PVC2 5GZCA 5CKQA 1O3RA 3OF1A 5EXOA 4NHYA 3TWIA 1WA6X 1PZ8A 1V00A 3BALA 1AZDA 3VHNA 3ZN6A 2BWCA 1MEC3 5FQ0B 2JE9A 4KBZA 1D4M2 2JB8A 3H50A 1OQEA 2IC1A 3AK0A 4KWJA 5LZ6A 2WT0A 3EYPA 4DEVA 2VCAA 5F2WA 5A3MA 5CYYA 1UXXX 2EIGA 4NMIA 2VJXA 2Y6JA 3B9IA 5T5PA 5FXZA 3N3HA 4BK5A 1HXS3 3C7EA 2JDPA 4QX8A 5CIRA 1HXS2 1V6MA 4R9CA 1PHMA 3TBDA 4UW5A 5LEKA 3MO4A 4TWTA 2Y34A 4UW3A 3T1MA 5FY9A 1V0AA 3OEAA 3E5UA 5LB6A 4GULA 4AI8A 4B8EA 4UBGA 1QOSA 3T4HB 4QPYA 5F37A 2B45X 1WLDA 4LBQA 5ACA2 5IVVA 3WP5A 3VN4A 3JB8A 4EZ4A 2IVJA 1W2NA 1LHWA 3ITQA 1XB9A 5GLUA 1QEXA 1RUD1 2CWSA 4LA3A 2VUJA 2D5FA 4W50A 5ISLA 4FPCA 4LTAA 3CHXA 3OG2A 4KWUA 5L7OB 5FUNA 2YUEA 4XZUG 4FO9A 4D8MA 1IPKA 3LEMA 4CXWA 2PHWA 1JHJA 2ZJCA 3UESA 2HYKA 2VMCA 2DURA 1JH5A 2QUOA 3K46A 1X9PA 4WM8B 4CDQB 4COYA 2YV8A 3F2ZA 3E5QA 2VULA 1W39A 3OGRA 3E1F1 4L8QA 3VLBB 4C90A 2XJUA 1MVQA 1COV1 3I2DA 3M4FA 4COZA 1NG0A 2XJVA 3HD8B 4NUBA 1MQTC 3ZXGA 2PHTA 3O1UA 1TVGA 4B29A 3TEZA 1QXJA 5FJKA 3OY8B 4JTOA 1O8SA 3GZTB 1D7PM 4QQLA 5CFCB 1GU3A 1RVF1 1ND3B 4MGZE 5A7WA 5FWEA 2WLQA 1SACA 2DV9A 2W95A 2XWBB 5F5IA 5JXIA 3DGTA 3FHIB 4W6WA 2ZHLA 2ZTNA 1RMU1 5C8CA 4CEWB 1R091 2VTFA 3QOPA 2QQIA 3WP3A 2DVAA 4XACA 1QQP3 1UU5A 3LGRA 1NKGA 4XEZA 3T3YA 3W9AA 3ACIA 4ARXA 2JE8A 4FOYA 4A45A 1OA2A 1KFUL 2ZGNA 2PLV3 1GQGA 5T52A 1J84A 2PLV2 2WWSA 3ACGA 3J7HA 5KXCA 1CJDA 2BGOA 2EAKA 2RR13 5C3SA 5IW0A 1SLBA 1MS9A 2RR12 3A7QA 3OYWA 1VBA3 4UBHA 3BODA 2YFUA 1VBA2 3ZFEC 1HJGA 1OA4A 4DXSA 3AMPA 4Q1RA 3RS6A 3ZIWA 1W05A 2RS51 3H1WA 1U12A 4RFT0 1P8JA 4EN8B 1PX4A 4Y1YA 5F5CA 1HN0A 1PNFA 2EXIA 3LKJA 3CZJA 1EPZA 2BGCA 2BWAA 5I0SA 5FLHA 1ND2B 1S4CA 4OZXA 5IVFA 4O9GA 1CZVA 5KHJA 1ODMA 2QFEA 1Y9MA 2HWF3 5J98B 2VZRA 4BHPA 3QLQA 2B9UA 2HWF2 2LS6A 1F5FA 4FCAA 4H14A 2YU2A 4D69A 5FZDA 2JDNA 4INDA 5FZKA 1F9KA 5I0RA 2XLAA 4ZU7A 4WVVA 2IXHA 4Z07A 1NXMA 2PHRA 5LBEA 4Q29A 4QKDA 5A32A 4Y20A 3JBG2 3KD4A 4CUCA 1UCXA 1ZZ7A 1ZNPA 1ZZ8A 1OPMA 3CJIB 1WLCA 3VBUC 5L36A 2BRTA 1JZ6A 1L7LA 2HH9A 1E5HA 2QQUA 1YCIA 2X05A 4D3WA 1W9YA 4A4AA 4N43B 4MLOA 3C7HA 5FZEA 5FQ0A 3AKPA 3UK9A 1NCRC 1DDLA 1TMF3 5B4XA 2B8MA 1A8MA 2DVGA 1RINA 2FCTA 4P9YA 1LR5A 4OI0A 1Q8VA 4IV3B 1UYYA 2QVSB 3GYDA 4MGIE 4FPGA 4NHMA 4CEYB 4CCKA 1QXPA 5A7QA 3KM5A 2R49A 2G1MA 4YW1A 1A34A 3OGGA 3ALQA 3ES1A 2VNVA 2JIGA 5F8PA 3HMYA 4N53B 3VDDB 2JDAA 3MIDA 2B5HA 1AL23 1NLQA 4XUPA 1H2NA 1Y4WA 5A1FA 5I93A 4FT8A 4S2DA 3LOBA 2Y6KA 5KWRA 4QDQA 4Q4Y1 3I7DA 4P5YA 1PVC1 1W8NA 1PO13 3IKWA 5C6CA 1LOAA 1RL3A 2HWD3 4AAPA 1LENA 2WBKA 2HWD2 2K0GA 3HWJA 5CKNA 2AYHA 1MEC1 1W3XA 2JG8B 2SBAA 3WQ0A 4XCAA 1JYNA 4HKWA 5JIAA 4RHV3 1VBC3 5DUWA 1DQ0A 4RL7A 1VBC2 3P1IA 3ZLIA 4CTEA 2QJVA 5BUVA 3MPPG 2GC1A 5FLJA 3WW3A 4ZXKA 5FZGA 3EMRA 1UF2C 4AEJA 1HXS1 1JBCA 5CG8A 2QQVA 5EWSA 4CDQA 4WM8A 4JTNA 1NQDA 4RSUA 2WUHA 4UFIA 2OQ6A 4MHRA 2C4XA 1AX0A 3O1VA 1OA3A 3HR9A 4BQ4A 1XU1A 2XUMA 1UY0A 1OLME 3RZKA 1YFUA 2A6XA 1US3A 1FYUA 1NLSA 1DQ1A 1JTZX 2LUWA 3FUOA 2Q8CA 4COUA 2OQ7A 4ET7A 5HBAA 1GWLA 1YYNA 1EUTA 2ERFA 1HQLA 3OY8A 4AGGA 5HCFA 5CFCA 4AZZA 4N9IA 2UY8A 1ND3A 1EP0A 4R9AA 4CU6A 2VOWA 5GM0A 3INAA 1S0CA 3LD8A 4MH0E 4UAPA 5I0UA 3A4UA 1PO23 1PO22 4CZSA 3T0DA 4D7YA 5FR3A 1PZ7A 2VCCA 1SLTA 2WZ8A 3ACFA 3V0BA 2WINB 5EYXA 4JDMA 3HVDA 4GB33 3SISA 1RYYA 3ZDSA 3K51A 2BV4A 3U10A 4AQSA 4BXSV 2D3SA 2VOVA 5FAXA 1WBLA 1C1LA 4AVBA 3ZDVA 5EJ3A 3WDXA 1S2KA 3DUIA 4R4XA 1CVNA 3VD3A 2EXKA 2YC4A 4PIYA 1K5MC 3LEIA 4FTSA 4WVMA 1FOD3 2VZSA 4FPFA 1FOD2 3HT1A 2NMNA 4CCNA 1ZRIA 4QQHA 3PU3A 3ZYRA 2O8OA 5IHRA 5HV0A 4NROA 2UWBA 2E9QA 1UD1A 3PJQA 2YU1A 1QY4A 5LY2A 3WW1A 3K4DA 2ETEA 4AQTA 1ND2A 3VGIA 2C5DA 1DLLA 4ARYA 3LPFA 3M3QA 4E4SA 2NM1A 3HJRA 1FPN3 2ZX2A 5AFBA 1FPN2 3HN3A 1QQP1 2HWE3 4FAGA 1W0PA 3P6BA 4QX7A 1LEMA 1YEWA 1W9WA 4B3NA 4FOVA 5B4NA 5FZ4A 1AXZA 1E5SA 5KR7A 1FV3A 1XYPA 2ZEWA 2PLV1 3JD73 4H55A 2WABA 3JD72 5IFTA 2BTVC 3GM8A 3WHUA 2CAUA 2RR11 3CJIA 2BYVE 5FZBA 5JXGA 2XVKA 4AQ2A 1VBA1 5CAZA 3OB8A 1O6UA 4N43A 2WN3A 3M8LA 4ZHNA 1RHI2 3KV9A 3VBOB 3ABZA 4HKOA 3SH5A 1PX3A 4FPJA 4NRPA 1GZTA 1AHSA 5JOXA 3JUUA 1I5ZA 4IV3A 5KHIA 1XRUA 4CA9A 3FLPA 4LT5A 4BH9A 4UF0B 2ADEA 4CEYA 2NMOA 1BHGA 2WO1A 3NKGA 1VP6A 4M3CE 4BMEA 4F83A 3O1OA 2HWF1 3U75A 2ZACA 1W6MA 2GNTA 2ZPXA 2A6WA 3VUOA 4GD4A 1EYBA 4N53A 3VDDA 4AWDA 1GMMA 3AKTA 1IS3A 2BFUS 3WQ1A 1CAWB 3CF6E 3MFCA 1DF0A 1DG6A 1NYWA 4C0HA 3NAPC 1YQ5A 1CGPA 4BM8A 1YHFA 1H4GA 3HEIA 1SFNA 5C3RA 4Z92B 4CDWC 4B1LA 3PUQA 4RD7A 2ZEXA 1CQ9A 1QJY3 1W8FA 3DKQA 3I59B 1PNGA 1WW7A 3I49A 2JG8A 3WX5A 3FE5A 4HETA 1TMF1 4IEUA 2WQ4A 2BBVA 2ZAHA 1L3JA 1JHNA 2W2IA 4Z1VA 3ZXJA 1GSLA 1DZTA 1UQXA 1GOFA 3I2JA 4W6XA 3KT4A 3NNGA 3J8F2 3B69A 3ZXAC 2Q8DA 5C3PA 1N1YA 2UY9A 3LFMA 4IUGA 3FLTA 5C5TA 4I2OA 1AL21 1AVBA 2TEPA 3NV3A 2OPWA 4FI9A 5SV8A 5HCAA 4NPMA 1XYOA 4EWAA 1W90A 1NLRA 1UOFA 1US2A 2VZUA 3IBMA 2CDPA 1AX2A 2BVBA 4CE8A 3UGGA 4XUOA 2VTXJ 4FOQA 1PO11 5L7OC 3V0AB 5CG9A 1R1ZA 4LJHA 2HWD1 3K4AA 1N3OA 2GH2A 1SCSA 2QTWB 1Q43A 1DCSA 1QH7A 4LLOA 4CDQC 4WM8C 3POGA 4AFAA 1OOPB 1CIWA 1V6OA 4KGGA 1VBC1 4RHV1 3E6DA 2VOKA 1I6XA 3AKQA 1UZ0A 3U37A 5DUXA 4AW7A 5T54A 3UGHA 2DBIA 3MLLA 4CPBD 1CZSA 1K12A 2RDQA 2PXJA 3ZYGA 1UOGA 5DAVA 3OBRA 2D6KA 2MEV3 3AZXA 3OSDA 3URFA 5C4WC 1SG3A 3IMMA 5CFCC 3LFIA 5JI7A 1LTEA 4Y33A 4A42A 5JR7B 1ND3C 4QQ2A 3UJOA 3RI9A 1JYWA 2G9ZA 4AVSA 1R64A 2IXLA 3NO8A 1GWKA 1DFQA 4LKSA 4PQQA 1ODNA 4QM9A 5CFDA 3I3QA 1C3HA 4CEWC 5K8SA 1BMV1 4CDUB 1IOAA 1EY2A 2VCBA 3VKFC 2HYXA 3K48A 3ZSMA 4JKKA 3DF0A 1B35A 4Q0QA 3O1PA 2ATFA 1PO21 3CEWA 3CNAA 4CCDA 4NHLA 5A7PA 4OYUA 4OZOA 2J1UA 4AEKA 3UT0A 1CN1A 2ARXA 1JU3A 2I45A 1RGSA 4GWIA 4UXAA 5JOYA 5IYYA 4K40A 3OJBA 5A33A 3MZHA 4AL9A 4GB31 5JAXA 2OZ6A 4XIOA 1URXA 3POWA 4LO6B 3LDRA 5FZ6A 4JX0A 3WZ1A 5BNOB 4Q4X3 3IWZA 1POV3 1QGLA 3PMSA 4Q4X2 3CIHA 3WD5A 3WHTA 1EPWA 4HZFA 2V72A 2P3JA 1MZ5A 5EHDA 1BK0A 3GZUC 1SHWB 1PK6B 5FZLA 3POIA 5C5UA 1HW5A 4HPKB 1ASJ3 3POSA 5T5OA 3WG3A 3I3MA 2Z4FA 1ASJ2 4LUMA 1FOD1 2ILMA 2BQPA 1J1TA 4BJ0A 2D6OX 2B39A 2VQUA 1JS9A 4K20A 4P08A 3VBOA 1EV13 5T55A 4L9BA 1EV12 1U5XA 3QACA 1ULCA 2XBO3 4HVRA 5L73A 2XBO2 3WNMA 3RQ0A 2ZMLA 4UF0A 1C8NA 2GAUA 2VG9A 5EJZB 1UIKA 1FPN1 4Q0SA 5FY1A 1D4VB 4WZFA 5LRSA 4H7LA 2RVAA 2HWE1 1UMZA 3CJIC 3WW2A 1XNCA 3BVCA 2XG3A 3PHMA 3RZLA 1CAWA 1LODA 5K0UB 3KF5A 4NR1A 2R1BA 5C7GA 3OTFA 3JD71 2WS93 2D5HA 1WMDA 2WS92 4XFBA 5F7UA 2VCMA 2J1SA 2GH8A 3I2HA 4CP9B 4M01A 3TN93 3M1HA 2F4PA 1S1AA 1YLLA 4CCMA 1VALA 1H6YA 1ZBA3 3EB7A 4CEYC 1TNRA 3I59A 1ZBA2 1W0OA 3TAYA 1FI2A 4UW6A 3CJXA 3FHAA 4AVAA 4YZ4A 1CX4A 1JYCA 3VDDC 1GNZA 4ZXEA 1MS8A 4Y3OA 1JMUB 1RXFA 1X7NA 3AMNA 4AHYA 2P3YA 2Q1ZB 4O7XA 5FYCA 1DYPA 1F5JA 4HBNA 1IZ3A 2A71A 2BGPA 3PURA 4KWLA 3I97A 3Q8EA 4FFGA 1UKGA 3ETQA 1DYOA 2WZR3 4Y1VA 4ISRA 3LA3A 4QT6A 1UZZA 4B4QA 4I0WB 1RITA 3KCYA 3C7OA 3NVCA 2JG8C 1TNFA 3AM2A 3V0AA 2BOIA 4YARA 5DUUA 1ULOA 5H9SA 3J26N 1MZ6A 5A3WA 1QJY1 3KGZA 4HL0A 4K8FA 4YW3A 5LA2A 4QX5A 4JGYB 2RM23 5IATA 4ASKA 2RM22 1OOPA 3IN9A 4XQDA 4FQZA 2YGLA 3LSDA 1I5PA 2GMEA 3VV1A 3OD4A 5FMOL 4YVSC 2EICA 1F35A 3MHZA 3S7EA 2FDKA 5ABJB 3MV01 5JDBA 1LHOA 2YXSA 4LKFA 1S0DA 4FPOB 4ORFA 4BLJA 2JKXA 4QB1A 4YNIA 1AUYA 4JRLA 1RUI3 2XKPA 3ZFGB 4AI1A 1SDDB 1VBD3 2ZEZA 1RUI2 4D0QA 4YW2A 1HLCA 1VBD2 1JZ8A 4TZDA 2WNVC 4LQRA 4QQOA 5LRRA 4EYUA 1SEFA 3N7MA 1IS5A 1YJLA 2DBNA 1PIV3 2YGMA 4M4RA 2WZEA 2J1RA 1PIV2 1Q8PA 4XIKA 3NNLA 1O7FA 4GH4A 1MS1A 4LEJA 4CCOA 5JLVA 4XF3A 4CDXC 4AI3A 1Z0HA 3DYOA 3D5OA 3RDIA 3LDBA 5J36A 3GHNA 1BBT2 3IZOA 3OPZA 3AP4A 5FY4A 4CDUA 2GC3A 1JZ2A 1S0BA 2ZKNA 1QJX3 2QQNA 3DPRB 1QJX2 3OUHA 3WV6A 3TEWA 2WIIB 3RWKX 2CV6A 1WW5A 2VR4A 4E2SA 5FZCA 4YGDA 3UYJA 1OQDA 1DGRA 2OIIA 3SKJE 4LBQD 1O3QA 2R32A 1MPXA 2WL1A 5ANNA 5FZAA 5LWBA 2MEV1 5FLIA 4QU1A 3OD0A 5FZ3A 1UX6A 4JV4A 1M4WA 3JB4C 5IK5A 2LTNA 1OBNA 5BNOA 3ELNA 1WMXA 4YVWB 2H6BA 1TME3 4IE0A 1AR73 4UFJA 5BY5A 1TME2 2ZBJA 1AR72 1AR93 4NIGA 2W87A 3VB9A 1AR92 1H4HA 2W08A 1PK6A 4LOTA 5FFOC 1HB4A 4HPKA 3DCQA 5DZGA 1KJLA 5BV6A 2P4EA 2FMYA 4LLFA 1AJKA 1AJOA 4U36A 5LK7B 4QPIB 1WD3A 1UZWA 2J1EA 2OS2A 3SNMA 1GP6A 3UL2A 2B42B 1H1AA 1YC61 2VZQA 3I8TA 4XFCA 4LHLA 1Q5OA 3SXWA 5CKMA 1O3SA 3IAPA 1MACA 2XHKA 5C9AC 2J7MA 3I2KA 1ZX5A 3BU7A 2VU9A 3KVAA 2VVDA 4KH9A 4DINB 4I0BA 3F95A 1Y7BA 3CDZB 3R4DB 3WDWA 4JGZA 4RGAA 4Y20B 5FO8B 3FFZA 4Q4X1 3UKTA 4ASLA 1POV1 3MDPA 2BEOA 2WT2A 2CU5A 3VBOC 4EWEA 3WG1A 2K2SA 2WWUA 3GJAA 3MUY1 2J1VA 4KI5M 1QKQA 1YQ6A 4KQ7A 1Q56A 4CP9A 1D4M3 1ASJ1 3EQEA 3AZZA 1W28A 4QQPA 1KD7A 1WLTA 1CAXA 3MFAA 1EV11 3JU9A 1RJ7A 2Q30A 2PN5A 4IE7A 5DPNA 2XONA 3VZNA 4ZZ5A 1HRI3 1ENQA 2ORXA 2VL4A 1HRI2 1IPJA 1JOPA 2XBO1 4IV1A 2EIBA 2RG4A 5G05L 3ZPOA 3OGVA 5F5AA 2VO5A 1WZXA 1S0IA 5FPUA 4COVA 1K45A 1WUVA 3DYPA 5FZOB 3RFRA 5ACA3 1FATA 3J4UH 3NMBA 4M0NA 3H8OA 2D3PA 2XXZA 1AL0G 5FXVA 3ZFFA 3MF6A 1H8TB 1LOEA 1V70A 2PA7A 2VUDA 3KV6A 2VW0A 2GP3A 2WS91 3N9NA 4R9BA 4GKXA 2PELA 2YZ4A 1VBE3 3WUDA 3TN91 1VBE2 1XNTA 4RR3B 2WSUA 2ENRA 4IEQA 1NOVA 1ZBA1 2QQWA 3BCWA 4ATEA 1UO9A 2WA4A 3MLKA 2YROA 3MGUA 4JGYA 3EHKA 3I3EA 4PBOA 4XBQA 4XQ4A 5C8WA 2RHPA 1KITA 2UURA 3N7JA 2VW1A 4CCJA 3S0MA 3A0NA 3AP7A 4MADA 4CUAA 3AYDA 3M70A 3S5AA 1ZVFA 4FAHA 5ABJA 4IGOA 2XJTA 5TSWA 3AKRA 1REFA 3WVJA 1IS6A 5F39A 1W8HA 1HX6A 2OYZA 3RZHA 2E32A 2UYAA 4PI0A 4BISA 3ZFGA 4IESA 5AVAA 1OC1A 2PAEA 2WYSA 1H6XA 3WP6A 2WZR1 2Y33A 1IS4A 3NWKA 2ZGPA 3WDUA 4IE4A 2V09A 3LEKA 4E2GA 4IE5A 2JDMA 3AYAA 1WA4A 3BIWE 3AMMA 4QWNA 1J3RA 2DVFA 3CO2A 2EF6A 1OOPC 1SBDA 2ORZA 2Y6FA 1LOGA 2YDEA 4CCEA 1W6NB 2WT1A 4FFFA 1UMHA 3GF6A 4AYUA 4NRQA 4UFMA 2OA2A 4YZ3A 3SKVA 3RSJA 5BNNB 1N47A 3DPRA 2RM21 2UU8A 3JZVA 5E16A 2X5IA 5IJRA 2D3RA 1UYZA 3ZSEA 3H0OA 3OOXA 4FTEA 2D40A 4JCKA 1JW6A 5LA0A 3FJSA 3KV4A 3V0BB 1KDKA 5A7SA 1WCQA 2WRAA 1H1MA 1VE0A 1SBFA 1U5YA 3UGFA 4HOOA 1FNYA 2QKDA 1PM4A 1RUI1 2X8KA 1WGPA 1VBD1 4ZPIA 1OHFA 1WMFA 3MIBA 4XTMA 3WDTA 2XJQA 4DOUA 4YM1A 2EIDA 3T30A 1N1VA 1CR7A 3Q8CA 4YVWA 1AR83 1PIV1 4DMIA 3AVRA 3THTA 1AR82 4CDUC 1C1FA 3H8XA 3PUHA 2RJKA 5CU1A 4AI0A 4WVMB 4K8RB 3B3QE 3R6SA 3N9QA 2R16A 4R52A 4OUSA 5IVYA 2ZHMA 5JOZA 1M06G 1WKYA 2DF7A 2W47A 2WQ8A 2ZGTA 4ONUA 5DAXA 1GZCA 1OUXA 4ZONA 3RZGA 4QPIA 3W58A 5J3UA 4DUXA 2B7YA 2O8QA 3OCPA 1QJX1 4W65A 1SBEA 4Q2FA 3IDEA 1V9U2 2ARCA 1DQ2A 1RB8G 3S57A 5A3OA 3KT1A 3W5MA 3VBFB 4HANA 5D8AB 5BNOC 1WBFA 3V56A 4LHSA 1YI7A 2OW4A 3HN1A 2C1FA 1OLQA 3NSTA 5F3IA 2LRPA 3GZEA 1PK6C 3RRDA 1VRH3 4A2UA 4RQPC 3MF9A 3JBG3 2UYBA 1VRH2 3KCCA 5DDJ3 2QQLA 5DDJ2 5FCCA 5JWPA 1TME1 3NJYA 1AR71 2VPVA 3LCPA 2BJSA 2QDNA 4IGPA 5A80A 1HKDA 1IKPA 1AR91 2LM3A 1POQA 2XL9A 2VZ1A 4I09A 3LA7A 4HK9A 1OUSA 2DTWA 5JZGC 1OSGA 2HEYF 2VUCA 2WO7A 5EP9A 4AEDA 4YSFA 1DHKB 1V6NA 3B7MA 4LBOA 3AFKA 4LO5B 4YRDA 4YM3A 5F6KA 5B2GB 1X9TA 3VBHA 1BVP1 4MGSA 2C24A 4QHOA 4N9HA 1G86A 1LKNA 4AHXA 5FO9B 1V6IA 1YI9A 3DKWA 4LK7A 4Q27A 3ASIA 3H7JA 5FTTC 1ZRDA 4I30A 3SMHA 2GNMA 4JQTA 4BZ4A 2K46A 2C9KA 3RI8A 2IFWA 3VDAA 1W9TA 5T5LA 2VZTA 1TG7A 1W6MB 4C8DA 3NNMA 5K0UC 1UU4A 1YXWA 2X29A 4Q26A 3WF1A 4HVQA 2DCZA 2Y0OA 5E6HA 3VZOA 1T6BX 3LIGA 2WAOA 3ZMOA 1S0EA 5FZOA 2XMLA 3B00A 3MIFA 4GWNA 5BPXA 4TLGA 3U4SA 2CWMA 3KMHA 1H8TA 1R1A3 4P02B 4UT5A 4DFSA 1R1A2 1OFNA 1LOBA 2JG9B 2W91A 3CBNA 4L92A 4Y4RA 2YBKA 2A73B 3MW2A 4HN1A 3EO6A 3WF2A 1D4M1 1LHUA 4Z2AA 2NLRA 4RR3A 4N7UA 3WXPA 1SLCA 2EXHA 1W04A 3VKOA 4X6RB 1F2NA 3AZYA 1OFSA 1PGW2 1ULDA 3H1MA 4META 4AK3A 1AF9A 1HRI1 1GKBA 3E6BA 3U78A 2BBAA 3FUQA 4IERA 4K7JA 2EAAA 4CU7A 3OBAA 5J7MA 4E4HA 1W99A 1UAIA 3LF7A 1RUG2 4B7EA 2WQZC 1SMVA 1VMJA 4K3UA 1GV9A 4JZRA 4YWAA 3T2PA 4XF0A 3H3ZA 4G3YC 5ACA1 5IUQA 3VD7A 1WW4A 4O9EA 4IEOA 1ZBE2 1W6PB 3NV2A 1NZCA 5DG1A 5JOWA 4RFRB 1ZYBA 5J48A 4GALA 3CMGA 1G6NA 4LULA 5FY7A 1W6NA 1VBE1 4UI9L 5BNPB 3D0JA 4XQWA 2R0FA 2TNFA 4JKMA 4IEWA 5BNNA 4YW4A 2DU0A 1ULPA 3SLIA 1JZ7A 3ILRA 1VAMA 3VZJA 4MG2A 2ET1A 5CVRA 2I74A 4H3WA 2GDFA 4HSJA 1Z7S3 2G19A 1UIJA 1J1LA 3IB3A 1Z7S2 1GOGA 3IIAA 4XPVA 5GZFA 3AFGA 3BTYA 2FD8A 4A3ZA 2F6BA 4K1YA 5BYNA 1FAYA 2OPKA 4A6SA 3BI3A 3JQWA 3H9AA 4MXWB 1LGBA 4DS0A 5KXDA 1LRHA 4P9XA 5ANQA 2XHNA 1SCRA 1X8MA 3MV11 5I0TA 4MSVA 4Q0VA 3BIEA 5FUIA
chains in the Genus database with same CATH topology
1HV1A 3FC0A 3KZ4C 1C5HA 5C8CC 3WNXA 5CFDB 4Q4V2 2FQPA 3L9JT 4LE4A 4CP1A 1B35B 1RUOA 1ZZCA 3WCSA 3OGJA 2Z42A 4LHKA 2ZHKA 2X53S 3O14A 3VBFA 2CGNA 2XJPA 1YUDA 4Y1ZA 5D8AA 2FBEA 5F6LB 5A33B 1PVXA 4NVPA 1SLLA 4AFBA 3S6PA 4DRRA 4JC1A 2D7FA 4XJAA 1O4YA 2ZGQA 1VAKA 1NY72 1UN1A 1AR81 1FNZA 1J59A 4XFFA 1RHI3 4EJRA 1QJU3 1TEIA 4IXLA 1LGNA 4I3GA 4MVTA 3WCRA 1QJU2 4N90A 4BOWA 2YPJA 4HSLA 4DNYA 1KDMA 2E7AA 3NJZA 3O0WA 2HEWF 4LBJA 4HKLA 3R05A 2GN3A 3MW4A 1QMJA 2KXLA 5GALA 1DBNA 1DQ4A 2CAVA 4L11A 1DGWA 3CU7A 3QCWA 2R043 2R042 3QD6A 3FX3A 1S2BA 3B93A 2XKOA 4LBNA 2XJSA 4CP0A 1G9CA 1VRH1 3FWEA 3JBG1 3KGLA 2PFWA 5DDJ1 3GZAA 5CADA 4DZGA 4G4FA 2TBVA 1YRZA 4GWMA 5GLWA 2Y38A 4EN7B 4Y1XA 2JG9A 3RJRA 4DQAA 1GANA 2DCKA 1WCDJ 1D2SA 1KFXL 4HLTA 5E89A 3PVBB 2QNKA 4YM0A 1B09A 1I3HA 4AG4A 5JMCA 4WVZA 2W0XA 3B9CA 3LWCA 5GLZA 1NA1A 3VL8A 1WCKA 1HRV3 3J8F3 1AYN3 3C3VA 4IEYA 1HRV2 1AYN2 3ZXFA 1WD4A 1BZWA 3MYXA 4DY5A 1ZZ6A 1MR5A 1ULGA 2VNGA 3ILFA 3O7OA 3QH7A 4XMIA 1D2QA 4C91A 3BB6A 1FT9A 1R1A1 3AJZA 1W6PA 5FOJB 4LBKA 4ISQA 4Q4W3 4Q4W2 1LOFA 1UPIA 1W6QB 4XJWA 3WP5A 1CPMA 1FX5A 4PLNA 4AFCA 4QGLA 4ASMB 1APNA 4XFAA 3LSEA 4DXZA 4KG8A 2R0HA 5BNPA 4FPLA 4E4DX 3S7IA 4S2HA 2ZMKA 4LO4B 3EJKA 3ZPYA 1PGW1 2I2SA 5I8YA 4CP2A 4B4PA 4FTBA 2RS13 4TSVA 3G6JB 2RS12 3FBMA 3W59A 2NP0A 1ONAA 2G9FA 2D43A 2HEVF 5JSOA 4M0HA 2XL7A 3PVNA 3VBSB 4GQ7A 4MXWA 3LAGA 1FV2A 4GH4B 2VOXA 4XJZA 3O0XA 4AXOA 2SLIA 5BNNC 3OBTA 3MEPA 4R9DA 2AZ5A 4R8HA 1Z78A 5AVPA 5KHHA 2OZJA 1Q8OA 2BW8A 4FOWA 2PHFA 1FXZA 3BOPA 4FPEA 4XJ8A 1MS4A 1O5LA 2G4IA 1IGOA 2WC2A 2LALA 1WLWA 1DYKA 4MGKE 3RWNA 1Z7S1 4KG0A 2PHDA 4EV0A 1CAVB 1W6OB 4ES8A 4PLOA 2A7AA 3NKTA 3ZXDA 3GHMA 5EZWA 1LECA 4XZPA 3ZFEB 4AEMA 4I01A 2PYTA 3D4KA 4BMBA 4I02A 1QU0A 1CD3G 3WG2A 1X33A 2E6VA 2HWB3 2NZ9A 2VGDA 2HWB2 4IL7A 2ZKLA 1ND2C 3BTAA 4XBLA 1VBB3 2HJIA 1VBB2 5T50A 5D8AC 1RUC2 3B5LB 4WBBA 4QGMA 4OULA 3VKMA 3P3NA 1E57A 4C1WA 2W39A 5GKAC 5KC6A 3G7DA 2NN8A 2WNUB 4YG3A 4BYYA 2HWC3 3RMYA 2HWC2 4EN9B 2CNAA 1VB2A 4LHNA 3N35A 3MIHA 4JGZB 1UL9A 1FMD3 4N43C 1SLIA 2FHRA 3AJYA 1FMD2 4XF4A 1NY71 1V6LA 2GU9A 2P34A 4QM8A 5FO7B 3HAGA 1ZRCA 1GZ9A 4IV3C 1NCRB 4D7TA 5FPXA 1RHI1 1QJU1 4GIQA 4MV2A 1WCSA 1CAXB 4NHKA 4Z82A 3AKSA 2ZZJA 1AXYA 4OI1A 2ZCWA 4PDWB 2O1QA 1XNDA 3GBFA 3ATGA 5T3NA 5IK7A 1GR3A 4IV1B 4N53C 4Q1PA 4Y1UA 2WFPA 1ENRA 4YGCA 2A75A 2GNDA 1XXNA 5F9TA 2WLPA 3SCFA 2R041 2RE9A 2JJ6A 4K21A 4KL1A 4FBFA 3THPA 1D0GA 1G8WA 2JG9C 2QQPA 4FXGB 5KHKA 4X6QB 3ZFFB 4XETA 4BIOA 4JDOA 4LR4A 4J1XA 4XE9A 1RC6A 3RYPA 4HMZA 3WT3A 1XNBA 5FBZA 1W6QA 2CTVA 4LNVA 4F3JA 1DQ6A 2ARBA 2DUQA 4Y26A 2WSVA 2BVVA 4XXPA 3VKNA 1F8VA 4I3PA 4XW3A 4YLZA 3APBA 1HIXA 2Y0IA 2FZ2A 2ZGRA 1WW6A 2G9GA 2Q0AA 2ZX4A 3KSCA 3B02A 5JIUA 2IWGB 3LZZA 1HRV1 2OUHA 4AHWA 3J8F1 1AYN1 4KWKA 3RNSA 1H2MA 1A6CA 2XLFA 1MZFA 3HT2A 3VBSA 5FREA 4AVTA 1MQTA 2VECA 1CJPA 4QXKA 3SCHA 1U0AA 1BVVA 1A78A 3EXUA 5BNPC 2VW2A 1RUH3 4PQ9A 2DCJA 1RUH2 3H8UA 2VY0A 1BBT3 4Q4W1 3IMNA 3WG4A 2MPFA 1KXGA 3GNEA 1HDKA 4BPZA 4L2NA 3RZZA 1RUF3 5GZGA 1RUF2 1DGWX 1NE6A 2X5IB 4M3CB 4AGVA 1WMEA 3TRSB 1QH6A 3EBRA 4ES9A 4Q0UA 4DPNA 1VAVA 2RS11 3ZO0B 1DGRN 4KU7A 4C1XA 4OHWA 1ALYA 1YFYA 1U5IA 1CAVA 1W6OA 2DVDA 4GMP0 1AR63 5J37A 1VR3A 1GZWB 1AR62 3PMEA 2V5YA 5CFDC 2ZMNA 1K5MB 4BA6A 3AZWA 4EN6B 1J3QA 3ZFEA 4MGYE 2BFUL 4Y24A 3S30A 1XYNA 3PNAA 1B35C 3ZYPA 1GQHA 3ST7A 3ZVXA 4HN0A 4GKYA 4IEZA 2GC2A 3M3EA 4JDNA 2VUAA 2VH9A 2VXRA 3B94A 2GMPA 1OKQA 2VVFA 3WOGA 2A3YA 5H9PA 3O12A 2D93A 1V6JA 2Q1MA 4C0BA 2D98A 2WNUA 2C0ZA 1OLRA 3ME2A 1X36A 3SITA 2OVUA 4J6GA 1UW8A 4AVCA 5KC5A 3N7KA 4FXKB 5J96B 4XYXA 1RUNA 4LE3A 3WQ7A 4AEDB 2R073 2HWB1 1NCRA 3NW4A 2R072 4QPGB 4YM2A 2D6MA 3VBHB 1AYM3 1VBB1 3SCGA 1AYM2 1J3PA 2R063 2AGSA 4PDWA 2R062 3D82A 2AR6A 4NPRA 2UWAA 2IXCA 5BXXA 4OVEA 2XB6C 4DB5A 1JYIA 2VNRA 2DFCA 4OFGA 1H30A 4MYEA 2VQ0A 5J09A 1ZZ9A 5DZEA 2HWC1 2W68A 5L19A 2MNGA 2ZGUA 3AMHA 3NAPB 2ET7A 4KBBA 2YC0A 3I4IA 1MEC2 4YZ1A 1FMD1 4CDWB 2Q4SA 4GXLA 2GN7A 1I9RA 3TOJA 1JUHA 1QOOA 1VJ2A 1J58A 1JXNA 5E8AA 2TUNA 4WM7B 3VL9A 4XF9A 1PMIA 1Y9QA 2QZ2A 2VMHA 5DXDA 2R1DA 4E27A 3SH4A 1POV0 4ATFA 1XNKA 1KJRA 4XMAA 4GA9A 3ZN4A 2DUOA 4XOGA 4ZU5A 4N7IA 4CYDA 2PHXA 3USSA 3N4MA 3WDVA 5E88A 4NOTA 1MS0A 1S0FA 1NCQB 4SLIA 3TNPB 1S0GA 5EFUA 1DQ5A 2VMGA 3ZSLA 3V65A 4COWA 2XVGA 1KS5A 2ZGKA 3ENRA 2DWRA 4JQRA 1C57A 1Y3TA 1RUE3 1IHMA 1RUE2 2OUJA 4PLMA 2PHLA 5H9RA 5GZEA 2FMDA 4RA0A 4NWVA 4M3CA 2ZOEB 3M2MA 5GLVA 2ZAAA 2UWCA 1QWRA 4YZ2A 3VBSC 1YFWA 5AC93 5C4WB 2B46X 1OPOA 5AC92 4MZUA 2E53A 2XPJA 3AXDA 4GH4C 2JENA 4H7MA 2ZX1A 1PGSA 3RJ2X 1GZWA 1PZ9A 5E1RA 1SFYA 2IXJA 2D6LX 1K5MA 5KBFA 3M3IA 1RUH1 3D0SA 1LHVA 3HQXA 5JPNB 1BBT1 4UW4A 3E97A 4A7YA 1H0BA 1QQP2 4QMAA 4AFDA 4P9WA 1RUF1 2XGXA 5JPMB 3KLSA 1V9U3 1QHDA 3N7LA 3R0RA 4WV8A 1DU3D 1C4RA 3R4SA 1KRIA 1MS3A 3GALA 3ZSJA 5LK5A 1ZA4A 2JDZA 1QNWA 2JE7A 1EAH3 3GBGA 3AMQA 2RS33 1LHNA 1EAH2 3D6EA 4JRAA 1G9BA 4FPHA 2RS32 1AR61 3FZ3A 2AH2A 4KU8A 2A6YA 1RJ8A 3MI8A 3MIEA 4FP3A 2JEMA 4L99A 2ZGSA 3UKNA 1S55A 4PJYA 1ZM1A 3I54A 3CLPA 2Y26A 4QPGA 2FZ1A 1F31A 1BJQA 1RTVA 1YWKA 2ZGOA 4HT1T 4K6BA 1QJZA 1Y43B 1HQWA 2WNUC 1I1EA 1G7YA 1R083 3Q9OA 3JQXA 3L2HA 2XJRA 1R082 4HVOA 4B4RA 3ZN5A 1CPNA 1GICA 4JGZC 4XDQA 4XJUA 3IPVB 5I91A 3DV8A 4DRVA 1MS5A 4Q8KA 4OHYA 1SDWA 2A3WA 3M3OA 3NAPA 3UKVA 2GNBA 4F7ZA 4CDWA 1TMF2 2HKXA 2R6QA 4XHXA 2ZA9A 4PDWC 2KA3A 4AF9A 4IV1C 2R071 3GBWA 4WM7A 3IT8A 3O0VA 3UV9A 3U4XA 1AYM1 1X50A 3DN7A 5F1RA 2R061 1TQ5A 3RYKA 1AL22 1NA1B 4MXVA 2A3XA 3ZSKA 4LO8A 4YFWA 1Q3EA 2I07B 2XWJB 1RUG3 3ZFFC 1OD5A 1PO12 2AUYA 1NCQA 4IEVA 3U11A 1Q8QA 3L2YA 5F5QA 1G9DA 2EXJA 2AREA 2MHFA 1TE1B 3TB0A 2IFRA 1ZBE3 4WVWA 1MVEA 5L7OA 1G9AA 4RHV2 4P9JA 3TYJA 1LJ7A 1H2LA 2P2KA 4JGYC 2ZZQA 4XHBA 4QGNA 1VLNA 4RS5B 3MICA 4AE2A 5ABJC 2ES3A 3JCIA 2Q5TA 4PIXA 5KXBA 3SHRA 4YVSB 1ZRFA 1QOTA 2YMZA 3ZFGC 4LA2A 3AX4A 1N1SA 1DIWA 3WY6A 5C4WA 4ZU4A 2IZWA 2WNVB 1CAUB 3IDBB 4P9GA 3T1LA 3HIFA 5I8SA 4Q8LA 1ULFA 3RMXA 4ZKTB 1BMV2 4NWWA 2RJLA 3ZYJB 1LGCA 2P3KA 4AHZA 4CDXB 4AI2A 2JX9A 5FRAA 3VZKA 1SQ4A 1T6GC 1BK1A 4Q4V3 3DPRC 4CEWA 2X5IC 2P3IA 3TNQA 1RUE1 4M3CF 2RMU3 4BE3A 2RMU2 2PAKA 3R4UA 4NO4A 3WP4A 1BYHA 2BUKA 2DTYA 5EV7A 3KCXA 4GB32 3KB5A 4F8AA 2A6VA 1LU2A 3A0KA 3WW4A 1N3QA 4IEPA 4LBLA 4Z2WA 5JI9A 1XQNA 1O4TA 3FLRA 1PGL2 4EROA 5AC91 4YVWC 3USUB 2Z2SB 4A7KA 1ENSA 1BQPA 5IK8A 3POYA 1IKQA 3J9SA 2A6ZA 1QDCA 5FMOS 3LA2A 3LOIA 4JVAA 4QPIC 5D1IA 5KXEA 1JN2P 1VB4A 3VBRB 5A3LA 4MX3A 1CESA 2Q8OA 4SBVA 2D6NA 3PVEA 2VMIA 1KQRA 2HWE2 1JOJA 1D0HA 5C9AB 1V9U1 4AQ6A 3VHRA 2JXAA 2VNOA 1O5UA 1YNAA 2E7TA 3KT7A 5SV5A 1NXD1 3N36A 2KM2A 4L97A 2BNMA 1LULA 3IPVA 2QCSB 3AYEA 5CA6A 4YFZA 3IM0A 3VKLA 1LCLA 2Z79A 1EAH1 5AFEA 4CRQA 2RS31 4AEDC 4BWOA 2QE3A 3ACLA 1YIPA 3AYCA 3AXEA 4QPGC 3VHOA 2P17A 3VBHC 2O0OA 2PQQA 1V6KA 4HK8A 2YYOA 3QBQA 3NV1A 4YG0A 2DU1A 3MW3A 4BCUA 3BOWA 4NN0A 4OI4A 1UPSA 1RIRA 3H3UA 2AENA 3ILNA 1R081 2C9AA 2EALA 3ZX7A 1BEV3 1BEV2 2Z69A 2WA3A 2XLGA 3B01A 4YGBA 5CB7A 1H8TC 1YIFA 4YG6A 4LUKA 3ZIXA 1QXRA 1O3TA 2XH6A 1H9PA 1HQNA 4K9SA 2GALA 1LOCA 3ZXEA 4XFGA 3V64A 1QJY2 1ULEA 4FQ4A 1A8DA 4GMP3 2WZPP 4WM7C 4RR3C 4OLLA 1ZREA 4PF5A 4XILA 3AB0A 1PM7A 4YGEA 1U5ZA 4OHVA 4RS5A 4A7ZA 4QHBA 1RUJ3 1RUJ2 2ZGLA 3WLUA 3AZVA 1C5IA 3M3CA 5I8TA 4YVSA 5CBLA 1NCQC 4EWDA 4PIZA 3QH6A 5K7PA 1RUG1 3WDYA 2WNVA 1CAUA 4IETA 3ROUA 1MQTB 2CGOA 3C2UA 4K1ZA 2DVBA 4CDXA 1ZBE1 4IEXA 4E9KA 5DUVA 1W2UA 5IT6A 4WZCA 5EYYA 4S2GA 1GLHA 2WFF3 4M00A 2WFF2 2PTMA 2MEV2 3RPQA 3LB9A 1H2KA 3MPBA 5HXVA 4BLIA 4LO7A 2V73A 2JECA 4XFHA 2GMMA 2H0VA 1YJKA 4E4ZA 4A3XA 3ES4A 3USUA 1DGLA 4P14A 2EVXA 5JCTA 1N1TA 4TYSA 4U2AA 1O4ZA 3T2TA 1OMIA 1QF3A 4EN0A 4QD2A 3ZXKA 2YHJA 3AP5A 2E63A 2CL2A 2P37A 1BXHA 1C8M3 4Q4V1 3VBRA 3VHPA 1C8M2 2WKKA 1XU2A 1S0JA 2JKBA 2RMU1 3VBFC 1XE7A 1CONA 4R4ZA 1G9FA