3JD71

The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
270
structure length
270
Chain Sequence
b'GRVADTVGTGPTNSEAIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSVPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs.
pubmed doi rcsb
molecule tags Virus
total genus 32
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jd7100
3DPRC 2X5IC 4WM8C 2ZZQA 1ND2B 1HX6A 3JD71 2RR13 3VBFA 1RUC2 3VBUA 2PLV1 1D4M3 1VBC2 1ND2A 5FMOS 1FOD3 2BFUS 1R1A3 1F2NA 4RR3C 5C8CB 3VBHC 1B35B 2RS51 1HXS3 5C9AB 1TMF1 3TN92 1QJU3 4RHV2 5C8CA 1B35A 4CDWC 4CEYC 5C9AA 1HRV2 4JGYB 1PGL1 2HWB2 1V9U1 1HQNA 2RMU1 5DDJ1 2RS32 4IV3C 1COV1 1HRI3 4Q4Y1 3JD72 1QJX1 4SBVA 1F8VA 1QJY1 5CFCC 2PLV2 5CFDB 3VBOB 2HWD3 1ZBA3 4YVWA 1RHI1 2HWE3 1CD3G 1TMF2 2R073 3VBFC 5ACA3 1RVF3 4PDWA 3VBUC 4N43B 1QQP3 1QJZA 5C4WA 1PGL2 1EAH1 2RMU2 1PO13 1BBT3 4FTEA 2RS13 4Q4Y2 1AR93 5C8CC 1QJY2 1B35C 2XBO1 4LLFA 1C8M3 1MEC3 5C9AC 1NY72 1ASJ1 1RMU1 2R063 3VDDA 4NWWA 2VQ0A 1AR63 1POV1 2BUKA 4GH4C 3J8F2 5AC92 2WLPA 1EAH2 4YVWC 5D8AB 1VBD1 4GB31 1RUI1 3VBSB 2MEV3 2FZ1A 1NG0A 3DPRB 4WM8B 1OPOA 4PDWC 1BMV1 4GMP3 3VBSA 1RUD1 5C4WC 1ASJ2 2HWF3 1RUH1 3S6PA 4RR3B 3VBHB 5L7OA 5JZGA 1PO23 2WS91 1AL23 4CDWB 1RUG3 1TME1 4GB32 1RUI2 3VDDC 4CDXB 1RUC1 1ZBE2 4CDWA 3JBG3 4IV3B 2IZWA 2HWC3 1BMV2 1AR82 1K5MC 1RUD2 2RM23 4CDXA 1Z7S2 4Q4V3 1RUF3 1RUE2 1X33A 1RUH2 4RHV1 5BNPB 4RQPB 1HRV1 2QQPA 3VBSC 4CDUA 3VBFB 5BNPA 4RQPA 2RS31 3VBUB 1TME2 1NOVA 1PIV1 4QPGC 1AR71 1WCDJ 2WFF3 4Q4X3 1AYM3 4RFT0 5L7OC 1GFF2 5JZGC 1RUJ2 1VBC3 4FTSA 4Y4YA 5LK7B 4N53A 3TN93 2GSYA 1DDLA 4IV1C 4CDXC 2HWB3 4GH4B 1PIV2 1A6CA 1AR72 5FMOL 2BFUL 3JD73 4WM7A 4GH4A 4YVWB 2PLV3 1EV11 1NY71 4CDUC 5ABJA 3LOBA 5BNPC 4RQPC 1VBB1 4PDWB 1VBE1 2TBVA 5A32A 3JB8A 2RS53 4CEWA 5C4WB 1NCRC 1TMF3 3ZXAC 1BEV1 3J8F1 5AC91 5A33B 3HAGA 1V9U3 2RMU3 5DDJ3 2HWD2 1COV3 5A33A 3M8LA 4Q4W1 4Q4Y3 4N53C 1QJX3 1QJY3 3VDDB 1EV12 1NA1B 1PGW2 1VBB2 1VBE2 1FPN1 1K5MB 1NA1A 1RHI3 1VAKA 4WM7C 1CJDA 1VRH1 1BEV2 1K5MA 4AEDC 1AYN1 1AR92 5ABJC 1VBA1 1PVC1 1EAH3 4BCUA 1MQTB 2DF7A 4CEWC 3CJIC 1ZBE1 4Q4W2 2R041 4QPGB 1MQTA 5GKAC 2XBO3 1AR81 4YVSB 1AR62 3FBMA 1AUYA 5L7OB 1Z7S1 5JZGB 1ASJ3 1RUE1 4QPGA 4RS5C 1RMU3 1FPN2 4YVSA 1VB2A 4JGZB 1X36A 1POV3 1VRH2 1AYN2 3ZFGA 4JGZA 1VBA2 1PVC2 4IV1B 1VBD3 4GB33 5BNOB 1RUI3 1NA1C 2R042 2ZTNA 2WZR1 4IV1A 1RUJ1 5BNOA 5J98B 4GMP0 1RUD3 1R091 1FMD1 1R081 4CDUB 1RUH3 1IHMA 1AL22 4NWVA 1ND3C 1MQTC 2RR11 2WS93 1NCRB 1OOPA 1D4M1 3IDEA 1SMVA 5BNNC 1TME3 1FOD1 3ZFEB 4YVSC 1R1A1 1NCRA 4EJRA 2XPJA 1RUC3 1RUF2 1HXS1 2WZR2 1NCQB 3ZFEA 1QJU1 3NAPA 3ZFGC 4N53B 4JGZC 1R092 1FMD2 1R082 1NCQA 4CDQB 4RHV3 1C8NA 3ZFFA 1HRI1 1HRV3 2RR12 3VBRC 5BNOC 2WFF2 4Q4X2 1AYM2 2BBVA 4CDQA 4WM7B 2ZAHA 1D4M2 5FOJB 2RS33 4AEDB 1PIV3 2HWD1 1FOD2 1AR73 1R1A2 5ABJB 1ZBA1 1HXS2 4AEDA 2HWE1 5A32B 4CEWB 3CJIB 2R071 1QJU2 5ACA1 1PGW1 1RVF1 1OOPC 1QQP1 3CJIA 2BPA2 1PO11 1BBT1 1E57A 4RS5B 1HRI2 2RS11 3ZFEC 1AR91 4JGYA 3NAPC 4RS5A 1C8M1 1MEC1 1NCQC 1ZBA2 2R061 5CFDA 2HWE2 3ZFFC 2RS52 1AR61 2R072 3VBOA 1EV13 5ACA2 1RVF2 4CDQC 3JB4C 1VBB3 1VBE3 1QQP2 1ND2C 1PO12 1BBT2 1V9U2 5DDJ2 4QPIB 2RS12 4N43A 2MEV1 1COV2 4Y5Z0 1BEV3 3J8F3 5AC93 1QJX2 4QPIA 1C8M2 1MEC2 1ND3B 4GMP1 4Z92B 2R062 2HWF1 4Q4W3 5BNNB 1ND3A 1RHI2 4JGYC 1PO21 5BNNA 1H8TB 2GH8A 5K0UB 1FPN3 3ZFGB 1AL21 1RUG1 1OHFA 1H8TA 5CFDC 2MEV2 5K0UA 1VRH3 3VBOC 1AYN3 3JBG1 4FSJA 1VBA3 2HWC1 1PVC3 2X5IB 2XBO2 5D8AA 3VBRB 2RM21 4Q4V1 1RUF1 1ZBE3 2HWF2 3DPRA 2X5IA 1RMU2 2R043 4WM8A 4N43C 2WWSA 3VBRA 1AR83 1PO22 2FZ2A 1Z7S3 4QPIC 1RUE3 1RUG2 4RR3A 3VBHA 1OOPB 4CEYB 1AL0G 1VBD2 1POV0 2WFF1 4Q4X1 1AYM1 1VB4A 3JBG2 4CEYA 2HWC2 1VBC1 1W39A 2RM22 1RB8G 3NAPB 4Q4V2 4IV3A 5CFCB 1H8TC 2WZR3 2Y26A 5K0UC 1M06G 1RUJ3 3TN91 5CFCA 3ZFFB 1R093 5D8AC 1FMD3 2WS92 5J96B 1R083 4FTBA 2HWB1
chains in the Genus database with same CATH superfamily
4PHZA 5DAVA 4BYYA 4DUVA 4XHXA 1HJFA 3KS7A 4LE4A 4XZPA 2XUEA 5IUQA 3HN3A 3LEIA 1LODA 5H9PA 1HX6A 3ACFA 4IEVA 1B09A 3MDPA 2DYCA 4JDNA 3VBFA 4TTGA 2JDHA 4QM9A 3LSDA 5J48A 2VECA 1D4M3 4PIZA 4XBLA 3W21A 4N8MA 3QACA 5FMOS 3I49A 2D6KA 4IGOA 4YFWA 4YG3A 3HNMA 5C8CB 2DU0A 1G7YA 3VBHC 5LWBA 2WAOA 2JENA 5C9AB 4YG6A 2VUDA 2VULA 5E89A 1GZTA 5FZFA 4OUMA 1QHDA 5FO9B 4CDWC 1LAJA 3PVEA 4J1WA 4CEYC 4CP1A 1HRV2 1XE7A 2JEMA 1XNBA 4BIOA 5IK5A 1DGRN 4KGQA 5SV5A 1QNYA 1PM7A 4E2QA 5E16A 4Q0UA 1W6QB 5DDJ1 1VJ2A 4X8PA 1COV1 3QCWA 2FHRA 3RPQA 5T5LA 2BWAA 1JZ4A 3MIEA 4NHYA 3FX3A 1ZZ9A 5DABA 2QQNA 5FUIA 1US3A 4Y4RA 3UKTA 5CFCC 1JZ6A 2IXCA 5EHDA 1HV1A 1S4CA 2HWD3 2P6HA 5JPMB 2GC2A 3FFZA 4NVPA 4BU2A 1W8FA 2D3RA 3NV3A 4IL7A 2PELA 3K46A 5FZIA 2QQJA 4LHNA 1CD3G 4X6RB 3GZTB 1URXA 1UU5A 3NKGA 5FQ0A 4SLIA 1ZYBA 4A3ZA 3POYA 3CF6E 4QKFA 3K48A 1W9FA 3BODA 5EP9A 3C3VA 4IE0A 4YYOA 5FAXA 1MPXA 3AB0A 5C3QA 5GLVA 4CVUA 4Q4Y2 3UYJA 5LZ6A 3AP6A 4RYDA 4TSVA 4DXTA 1FV3A 1QJY2 1QDCA 2XVLA 4ZU4A 3MIGA 3VD9A 1C8M3 5FZOB 4UFMA 2E26A 3GCXA 4LUKA 1JOBA 4UBGA 2KD7A 4AI3A 4H3WA 1H1IA 3GHMA 3EHKA 3AZWA 1W8ZA 3LDBA 1TVGA 4AQTA 4AI0A 4FP3A 5FJKA 4MG2A 3HJRA 2R1DA 4UAPA 4GH4C 1Q5OA 2WO3A 1PHMA 2XLFA 2X29A 2P1BA 3A7QA 2WLPA 5GZDA 3SLIA 5BY5A 3BTZA 3MLKA 2JG8A 4XDOA 1K3IA 3JQXA 4OI2A 5D8AB 4YVWC 3VBSB 4Q2FA 1G9DA 2RG4A 4QX0A 2DUOA 2ZGNA 1W6MA 2DTYA 3LE0A 1BJQA 5C4WC 1D2QA 2GN3A 2WZEA 1ASJ2 5CADA 5A3NA 2VTFA 4Q5OA 3N7MA 3U07A 3BOPA 3I4IA 2EIGA 1HIXA 3I97A 3POGA 4BQ4A 4UF0B 4BLIA 4QXKA 5DUWA 4HKOA 4BA6A 2BNNA 1BYHA 4MXWB 1W2AX 4NAMA 4XF0A 4IW3A 5FPXA 5EJ1B 3I3BA 5CKMA 4IGQA 4IE6A 4XF1A 3OGGA 3SITA 2VZOA 1RUI2 3OGVA 4QDRA 4QM8A 3VDDC 3ITQA 4CDWA 2VOVA 3JBG3 1VAMA 2JDMA 3EQEA 5FZ0A 2IZWA 1RUD2 4CDXA 3T0DA 5FTTC 3KT7A 2FMYA 2ZGRA 2I07B 5L9RA 1LHVA 2Y6KA 1YFWA 1JOJA 4XAEA 5BNPB 1SBFA 4RQPB 5FLHA 3FLPA 3ST7A 3L2YA 5T3NA 3AXDA 3VBFB 4HK8A 2DCTA 3ZSMA 2ZHNA 3OPZA 2DBIA 1RJ7A 4QPGC 2D7FA 1ENXA 4P9XA 3FHQA 2WFF3 2WNVB 3KV9A 3M70A 4XQDA 4IETA 4Q8LA 4A7ZA 4UFJA 1WGPA 3AP5A 4K1ZA 1IZ3A 2GDFA 2CL2A 3HNBM 2NMOA 2ZXQA 1UKRA 1MZFA 2VTXA 4M4RA 5FYIA 1Q8QA 3ZXKA 3M7AA 3LPGA 4XJUA 3VKLA 5EXOA 1UW8A 4RFRB 5FYTA 3HT2A 4AGGA 5LK7B 1UYXA 3TN93 4QGLA 5K4LA 3I2OA 1XQNA 3Q8BA 4COZA 1SFPA 4KWLA 1UOGA 4MYEA 4CRQA 1PIV2 3MW2A 4LO7A 5JOXA 2A6VA 3FN9A 3KB5A 5FYSA 3ZDVA 2WNOA 4CU6A 4FPOB 4NUBA 4FFHA 2ZKNA 3JD73 2ZX1A 4WM7A 4GH4A 2UWAA 1Q8OA 1PMHX 4LBLA 3ZVXA 3AVRA 3ZYPA 1NE6A 1BCXA 3VUOA 1VBB1 3ELNA 5A7WA 1ODMA 3HEIA 3M3QA 3A0KA 2GZWA 3APBA 5FZ6A 2WSVA 5A32A 2A3WA 1V6LA 1WMEA 2DVFA 2RS53 3HWJA 3LQCA 3VHOA 4CEWA 5E1RA 3ZXAC 1GNZA 3D6EA 3GDBA 5A1FA 5JOWA 4AR2A 4PT6A 5AC91 2VZRA 5CG8A 4NRQA 2C0ZA 4MGKE 3SHRA 1V9U3 4R4XA 2RMU3 1DYOA 2BGPA 4IUGA 1K12A 1O5UA 4YRDA 5A33A 1IQAA 1OT5A 2VOXA 3CNAA 5FLIA 3WP6A 4A4AA 4C1WA 2EIBA 1JH5A 3G6JB 4TLFA 2ZEZA 1PNGA 2Q8DA 4O61A 1LU1A 4H2AA 1JN2P 1PGW2 2C5DA 3S7EA 2XG3A 2X53S 1FPN1 2QZ3A 4YW6A 4JHTA 5HV4A 4E9KA 2P17A 2W91A 3A21A 3NVCA 5FZEA 2C26A 2D6OX 3I2HA 2IFWA 5GJ6A 1LOEA 5LASA 2DCYA 3OD0A 2Y8KA 4OULA 4YM1A 5B4XA 3T09A 4GWNA 1VRH1 1BEV2 5AVPA 3THDA 4S2DA 1GANA 1F4AA 4OYUA 5C71A 5F3GA 5ABJC 3AYDA 1UU4A 4LITA 5FP8A 1RXFA 2A6ZA 2VQUA 4JC1A 5D1IA 3NSTA 1TZOA 4BCUA 4CCMA 2VBDA 3WDYA 2DF7A 1DCSA 4YWAA 2JX9A 4E4HA 2B8MA 4PI0A 1YRZA 2Q30A 2C9AA 2W94A 1WA6X 2B42B 4Q0QA 5A3UA 5LK5A 3OGSA 4AQSA 1W06A 2P4EA 2ZA9A 1AR81 3LKJA 4OHXA 4YVSB 5LBCA 1GP5A 4AVVA 1AUYA 1AR62 5FZ9A 4OQ8A 4WVVA 5FXZA 3LEGA 4W6WA 2J1VA 4QPGA 4WVWA 5IVJA 1RMU3 1UPIA 3GJAA 5FIXA 2NLRA 1NLQA 3DGTA 4B29A 2OUJA 2W92A 4R9CA 2BU9A 4Y22A 5T5PA 3RSJA 5GZEA 2WUHA 3O1VA 5FMDA 1MS0A 2WBKA 3E5QA 1DIWA 1V6NA 3AM2A 3B01A 4JGZA 4XUQA 2GNDA 2X05A 2IXJA 2H6BA 1WCSA 1UIJA 5BNOB 4CE8A 1NA1C 5KHJA 4P9LA 1PM4A 1NLSA 3DKWA 3T2TA 2HEVF 4P9IA 4BMEA 1LHUA 1S0CA 1CPMA 1MS9A 1RUJ1 1OH3A 3I59A 5FZGA 3MIDA 3HOBA 5KHGA 1GNYA 3K3NA 4AI2A 1R091 1RJ8A 1R081 2QVSB 2ZGLA 1SCRA 2RV9A 4P5HA 3ZYBA 5LRSA 3SH5A 1ZREA 3RGBA 2DV9A 4ES8A 1AL22 2AENA 4B4QA 1GZCA 2JE7A 2VC9A 3D3AA 4XFIA 4FPLA 4CUAA 2WS93 3GBGA 4INDA 1NCRB 1ONAA 3N4MA 1OOPA 1O8SA 3I2IA 3PHMA 1C4RA 4KWUA 1MS8A 1GZWA 2IXKA 2QQIA 4FPJA 4GXLA 4IERA 2JXAA 4META 4EN0A 3GXUA 3H8UA 4HN1A 3WXPA 1HXS1 2YU2A 2WWUA 1JBCA 5IW0A 1C3HA 2XOMA 3IPVB 1TE1B 5DAPA 3J7MA 5I91A 1HB3A 1S0BA 2D6NA 1VMJA 2JDNA 3SNMA 2ZPXA 5L19A 1BVVA 4EWDA 1NCQA 4NHMA 1IGOA 2D6MA 4PCRA 4Y33A 3SQOA 4JCKA 4HG6B 4XFAA 4MGZE 1I5PA 3J7LA 2WZ8A 3POBA 2W2IA 2Q0AA 1G8WA 1HRV3 4M00A 1VRBA 1ZNPA 4Q4X2 1AYM2 2ILMA 2BBVA 2HH9A 3CEWA 4WM7B 4CDQA 1D4M2 2WSUA 3S0MA 4A44A 1DGRA 1AR73 3AK0A 3OUJA 2BGCA 5LB6A 5FUPA 1PX4A 1STMA 1ZBA1 3E6BA 2IVJA 4DO0A 3IAQA 2RJ2A 2EIEA 5IVCA 1GLHA 2HWE1 5A32B 4CEWB 5F5AA 3T0AA 4FOYA 4CUCA 4MH0E 5ACA1 2EXIA 2WWJA 5DUUA 2XLGA 4QXCA 4CCNA 1ZZ7A 2JG9B 2X10A 1QQP1 2EXHA 4LQRA 4QB6A 3V56A 2ADDA 4RD7A 2WKKA 1PO11 2XQXA 1BBT1 4QQHA 2BP6A 4UT5A 1E57A 1LEDA 4Q27A 4DRVA 4QMAA 3PL0A 1LR5A 1Y9MA 2VZUA 2VNVA 4LHKA 5FZ8A 4A2UA 3ETPA 3NV1A 2P5BA 4UI9L 4CP9A 1DYKA 2XDVA 1ULFA 4YSFA 3FBYA 2OQ7A 2UY8A 1H2LA 3EJKA 4Y1YA 2R16A 5AVAA 2YUEA 3VBOA 4XF9A 1SDDB 1LJ7A 1G9BA 1X50A 2CHHA 4B8EA 4IESA 2WR9A 3HQXA 2JE8A 4BK4A 1OF4A 4J6GA 4CCKA 2B9VA 4DNYA 1WD3A 4D3WA 2VZ3A 2XR4A 5DDJ2 1UOFA 4DIQA 3MI8A 3U14A 2GH2A 4KMQA 1COV2 4Y5Z0 1UD1A 5CIRA 3KMHA 1TQ5A 1W03A 3LOIA 3E6DA 4LR4A 1C8M2 1ND3B 3ZSJA 4LA3A 1OH4A 4JRAA 4UOJA 1DQ1A 1CJPA 1DFQA 3M3OA 3UT0A 4IEUA 2HWF1 2RJLA 4FVVA 2FDJA 2JDYA 5DAXA 2PHTA 3A22A 5EJ3A 5I8TA 2XL9A 2Y6GA 1PK6C 3B94A 2GH8A 1ZA7A 1EPWA 1W9WA 4LT5A 2ET1A 3D5OA 3RZZA 3DECA 4FAGA 5BV6A 1H8TA 1W9SA 3ACGA 5CVRA 2AC1A 1GR3A 2QTWB 2VG9A 2VOWA 4YW3A 4FT8A 1DGLA 3DKQA 4Y1XA 5A6YA 1FI2A 1PVC3 2HWC1 4Z82A 3GNEA 3I59B 5B2GB 4DINB 4AEJA 3RDIA 1EYBA 3VZKA 4S2GA 1RUF1 1OVPA 3DPRA 1JMUB 1S2BA 3MIHA 1KEXA 4XFFA 5A6QA 2HYKA 4R52A 1MS1A 4N9HA 1W2TA 4GD4A 5FYVA 1OFNA 2VGDA 3FWEA 3ZXGA 5KBFA 2FMDA 2ZAAA 3AKQA 3KHBA 4RR3A 1IKPA 1OOPB 4HLTA 1GWKA 5I0DA 1QDOA 5JMCA 1POV0 1BHGA 3B5LB 5JI9A 1G6NA 2GC1A 1VB4A 3JBG2 2F4PA 4OHVA 4AG4A 2A75A 4BJ0A 1JZ7A 1IPSA 3ZYRA 1VBC1 2VM9A 3RYRA 1ZRIA 3TNPB 5HXVA 3AZXA 2Y0OA 4NPLA 2PTMA 3KT1A 4IV3A 1F5FA 2EAAA 4K40A 1XPWA 4YW5A 2JIGA 2Y26A 4AOCA 1Q56A 2VU9A 1NQDA 4UFIA 1OQEA 2W5FA 2JB8A 3CL1A 4QHBA 3S5AA 3HNYM 4YGCA 1FMD3 5D8AC 5J96B 5FZ3A 4D7SA 2VMHA 1K42A 2DDUA 4Y20A 5LATA 1U5IA 2YPJA 2B45X 4LOSA 3ILRA 1ZZ6A 2X5IC 1T6BX 2VOTA 2J1TA 2ZZQA 4FQ4A 4HPKB 4MSVA 1ND2B 2E7AA 3IIIA 2PLV1 5LRRA 3WOGA 5CG9A 3CU7A 4LO8A 3WY6A 3WP3A 3QD6A 4K21A 1VMFA 4I0WB 1R1A3 4QHOA 1B35B 3IIAA 4CTEA 3GGLA 1S2EA 5EYYA 1LOFC 1TMF1 3TN92 5C8CA 3FC0A 4CU8A 3T2QA 3TEWA 4QXBA 1S0IA 5C9AA 2WLQA 1V6JA 3RI9A 4IQPA 4P9WA 4CA9A 4DUXA 5A3OA 2LS6A 2YC2A 1A34A 4N90A 4ES9A 2Z79A 4XBNA 2V5DA 5DG2A 3ZO0B 3JD72 2ID4A 1QJX1 1W6QA 4SBVA 1F5JA 3U78A 2XKOA 1F8VA 3AP9A 3TOJA 1QXRA 2VVEA 3VBOB 2FCUA 4C91A 1GBGA 1O59A 3J9SA 3S7IA 1RIRA 3ZKYA 4ATEA 1WCKA 4AHZA 1X9PA 3HMYA 1JU4A 2O14A 3IZOA 4EE2A 5JSOA 2R073 1H2KA 5T55A 3VBFC 4PDWA 3ZSEA 4Q0VA 3FFQA 3JXSA 3WINE 1PGL2 4JKLA 3ZR5A 1EAH1 2QDNA 2RMU2 1XRUA 5JXIA 4XCAA 1MACA 4ORFA 3WNOA 5F3IA 4E2SA 2RS13 3THCA 1QKQA 1IG3A 2OXBA 5F3EA 5KHIA 2E51A 1LGNA 5EPAA 4XIOA 5HV0A 4CCCA 1O3TA 4Q26A 3RWNA 3HT1A 2TUNA 2UYAA 3ABZA 4PLOA 4I09A 2G4IA 4S2FA 2XLAA 3IDCB 2R063 2Y6HA 4AGVA 4CCDA 4DZGA 3BN6A 1O4TA 4NWWA 3VL9A 4DXRA 1AR63 4N7IA 4YGDA 1POV1 2R0FA 5JOZA 3SEEA 4JZRA 3NO8A 2BW8A 5FRAA 3PJQA 4PBPA 4CXWA 5AC92 4Q0PA 4NIIA 2A5ZA 2XWJB 1POQA 4W6XA 5IAVA 4UW3A 4W6YA 2W1SA 4CUGA 5JAXA 3MBWA 3R6SA 1W2NA 4GB31 1W8TA 2MEV3 1E5HA 5F32A 5F2SA 3NV2A 1OKQA 1V0AA 3S5QA 3DPRB 2B39A 3UKNA 1DU3D 1AX0A 3QH6A 5EYXA 4GMP3 4H14A 5FP3A 1DYPA 3VBSA 1J3QA 1XB9A 2D3PA 2PHFA 3GF6A 1GZ9A 3DYMA 3LFIA 1J58A 1RUH1 2VQTA 3WZ1A 2WA3A 2WO7A 4FXKB 4RR3B 4C0BA 3WUDA 2VR4A 1X7NA 2W68A 5JZGA 3RJ2X 2A71A 3GCWA 3KZ4C 4GJZA 4UF0A 4XFCA 1FV2A 4COUA 1FXZA 1AL23 3AP4A 1RUG3 1TME1 3ATGA 4MXWA 2E7QA 1ZVFA 3C7OA 3J7NA 3HD8B 3IKWA 2AZ5A 1A8MA 2YBPA 3VB9A 1J3PA 3WR0A 1GOGA 3TWIA 4IV3B 1UWWA 3T2PA 4B1LA 1VAVA 1VP6A 3QH7A 1HV0A 3ZMOA 3O1UA 2W3JA 1AR82 4LIUA 3RZLA 1BMV2 4KBBA 2BNOA 1H8VA 1EUTA 2LTNA 4NPRA 3CHXA 1PZ9A 3IDAA 4AFCA 4IE4A 2VZVA 4HSLA 5FV3A 3H0OA 4R9DA 3OGJA 1J59A 3CLPA 2XXZA 2QQPA 2IWGB 2G9ZA 4KWKA 2OIIA 3ZN6B 2CGOA 4JHZA 2D5HA 5EFUA 4CDUA 5KXEA 3UNPA 5BNPA 4RQPA 3WDVA 3WSOA 3AJZA 2RS31 3E6CC 3IBMA 1WLWA 3B7MA 3HQRA 2Q1MA 4IE5A 4URAA 4Q4X3 1W6PA 1AYM3 4RFT0 5FP4A 4ZKTB 1NZCA 1LECA 3VHRA 5FMCA 3VLBB 4YZ5A 1YO8A 4XOGA 1NE4A 1RUJ2 5FWJA 4NE9A 4QQ2A 2WNVA 5D2AA 2YC4A 2O8QA 5F6LB 3NV4A 3O1SA 4AW7A 4Y4YA 2AYHA 4MZUA 1A8DA 1REEA 4RL7A 1DZTA 2QQVA 5JUVA 4RGGA 1QOOA 3WP4A 2X8KA 4HZFA 5FPUA 1W9TA 2QQMA 2P34A 4CDXC 1KFUL 1E5IA 2HWB3 2XVKA 1E5SA 1JYCA 5LW9A 5K8SA 1A6CA 3OEBA 1AR72 5JVVA 1Y9GA 2AUYA 1LHWA 3GZAA 3PU3A 4IXLA 4LO6B 5FMOL 2KXLA 4KGGA 1QGLA 4GKXA 2QQKA 3I7DA 2OZ6A 3N7LA 1LOGA 1GQHA 4PF5A 1EV11 4WV8A 4Y1ZA 4D6SA 4IEPA 2OA2A 1CAVB 1SHWB 3ZN5A 1XSQA 4XXPA 4YW7A 2PHRA 1VBE1 2PN5A 4PDWB 2WRAA 2VPVA 1GV9A 1D0GA 1DGWX 3E97A 4K8FA 1NCRC 1MS5A 4IEYA 3MW3A 3ILNA 1NXD1 3CJXA 4XETA 4AVBA 3O14A 1HW5A 4AVAA 1W8OA 5DDJ3 1H9WA 1MVQA 1WW5A 3VDBA 4EROA 1COV3 1DBNA 1LU2A 4AHYA 4Q4W1 3CDZB 3O1OA 5DAQA 1YUDA 1OUSA 3KF3A 3THPA 2C24A 1KDMA 1V6KA 1GQPA 3DXTA 4GWJA 5CNAA 5LA1A 2YGLA 2QNKA 3WD5A 5JMOA 3BTYA 1D7PM 1NQJA 2Y34A 4HXCA 2MPFA 3K3OA 5FKCA 5FY5A 4C1XA 5FKBA 1WBLA 2PXJA 1VAKA 2PHLA 3ACIA 1DQ2A 4C8DA 4M3CE 1LHNA 5A3MA 4WM7C 2O0OA 2ZOEB 4Y24A 4HVQA 2TEPA 5L73A 5KC6A 1AYN1 4AVCA 2RDRA 1VBA1 3UJQA 4QDQA 4QX2A 3NJZA 1UY4A 4ISQA 1MQTB 1UY1A 5FZKA 4MGTA 2BQPA 4CEWC 2VVFA 1CAWB 1ZBE1 2J1SA 3FLRA 1RUOA 5FPVA 3SCFA 2R041 3KM5A 4W8JA 1XXNA 4R8HA 3LSEA 3N7JA 2AEZA 2JG9C 4A41A 5GKAC 3WDXA 2JWPA 1HB4A 2OPKA 1HLCA 2RE9A 2VMEA 3AMPA 3C8XA 3FBMA 1UY3A 2ZMKA 4I3PA 1UXZA 4TN7A 2VO5A 5JZGB 2KM2A 2J1UA 3TEZA 2ZEWA 3FLTA 4ZS2A 4YVSA 3E5UA 3U0ZA 1H0BA 1XC6A 3NNFA 4W65A 3MEPA 4ZS3A 1X36A 2G9GA 4JDMA 4M3CB 3WNPA 1JTZX 3CIHA 4XFBA 3ON7A 5ANNA 3H3ZA 3T4VA 4LXLA 3ZFGA 3ZYHA 5A1LA 1PVC2 5IVYA 3VZLA 1WA4A 4Y5SA 3WNXA 4HK9A 1VLNA 5DPNA 4XF4A 4DEVA 3MO4A 1KDKA 3N9LA 3VD4A 1SLCA 3AYAA 1K5JA 1ZX5A 3E1F1 3VKFC 5I8YA 2ZTNA 2WZR1 3E5XA 1UNBA 5BNOA 1W8NA 1BLZA 4D7YA 3P6BA 4LHSA 1LENA 5C3SA 5EV7A 1OLMA 3PIGA 3WQBA 2JICA 3OOXA 1UAIA 2CWMA 4CDUB 4Q8KA 4URTA 4CP0A 3SCHA 3LD8A 4UWDA 4P00B 4NWVA 4MOAA 4LORA 3N9MA 4QGNA 1ND3C 2Y60A 2IXHA 3B9CA 2RR11 2YGMA 2WABA 4K9SA 4YGBA 2E32A 1W6PB 1HDKA 3M3IA 2NPIA 3GBFA 3IDEA 3VN4A 2G9FA 4I0AA 1FOD1 3ZFEB 2Q8CA 4GALA 1NCRA 5FZ4A 4EJRA 2XPJA 4XUPA 1RUF2 3MLLA 1SLTA 3I8TA 3W59A 2DBNA 3V0BB 2HKXA 5FZAA 4D94A 4FPKA 3RNSA 4EN6B 1QJU1 4QB1A 3NAPA 1REFA 1F15A 1UOJA 1W90A 4JGZC 3RYKA 2ZGSA 1XJAA 5T52A 1FMD2 3H8RA 3UGGA 1ULEA 2CYFA 3IPVA 3MF6A 4B7EA 5BUVA 1PZ7A 3HN1A 4UW5A 3T2OA 4JQTA 3NNMA 2A6WA 1QOSA 3FZ3A 3ZR6A 1HRI1 5HCFA 5TSWA 1S0FA 1PMIA 4LTAA 4AAXA 5F37A 4OMDA 2A6XA 1JYNA 4BXSV 1O6UA 3IN9A 3O0XA 5FPZA 4R4ZA 4W50A 4J1XA 4A45A 5FOJB 1QH6A 4D0QA 3I3MA 2YV8A 1R1A2 3ME2A 4MGQA 1SBDA 2BVVA 5FK7A 3D0SA 1OLRA 3CJIB 1XU1A 4OI0A 1RVF1 2B9UA 2D40A 2EXJA 3WP5A 1JYIA 1OOPC 1NX9A 1W6NB 1H2NA 1UMIA 3K2OA 4QDSA 2ZGMA 5EWSA 4BQ3A 1PNFA 3I2JA 3M3EA 1KGYA 2YFZA 3QOPA 5E88A 3POJA 2BPA2 4FFIA 4H7MA 1OD5A 4RS5B 2JG9A 4UBHA 3RWKX 4PBOA 1AR91 2WQ4A 1DLCA 5FZBA 3UJOA 5A3LA 4FPFA 3LAGA 4AFAA 4I0BA 1VR3A 1Q8PA 4Q1PA 3ZPOA 1MEC1 5F7UA 5FYHA 1NCQC 3KVAA 1D0HA 4QX7A 4A3XA 4N7UA 2P3IA 5FZ1A 2BVBA 5BXXA 3Q8AA 4X6QB 2R072 1LOBA 4EZHA 1PVXA 2R7EB 4K1YA 4CDQC 2TNFA 1VBB3 1SFYA 4RSUA 2VBPA 5FMBA 5CISA 1ND2C 4F8AA 4JRLA 3ZMNA 2G19A 2H0VA 3LA2A 3LPFA 1NXMA 4QPIB 4EN8B 1GUIA 2RS12 2A7AA 1S2KA 4W4ZA 1WCUA 3I3EA 4OLLA 5AC93 3EYPA 2A73B 2ZGUA 3KGZA 1WLTA 4NHLA 1QJX2 4CU7A 3I3DA 3EB7A 3HQUA 4Z92B 3BIWE 2L9LA 4F3JA 2DFCA 4HETA 1PMJX 1KD7A 2CNAA 2R062 4P9YA 3B3QE 3WQ1A 5J3UA 5BNNB 1ND3A 2JKXA 4XC9A 3N9NA 5C7GA 4ZU7A 3U1XA 3KHCA 1OPMA 1YQ5A 4L9BA 1PO21 5CAZA 1V00A 1UZYA 5JSRA 2FDKA 1WKYA 4FPYA 1GQGA 4HFSA 5K0UB 1FPN3 3ZFGB 2NYYA 1OHFA 1UYYA 2VMCA 4GQ7A 2LRPA 2P3JA 1XNDA 4QKNA 1LCLA 2MEV2 4CPBA 1EY2A 1VRH3 1ULPA 1KITA 1XYPA 3TAYA 1H1MA 2ZBJA 1LOAA 3VBOC 4ASLA 4CPBD 4FSJA 1J1TA 3KLSA 1O91A 3R4SA 3SKJE 3VBRB 5FP9A 2RM21 2ZEYA 2LALA 4JKKA 1GSLA 3U10A 1TNFA 2W1UA 4Q4V1 3RZGA 2EALA 2ES3A 1CWPA 4WM8A 5GALA 1UY2A 4XJAA 1CX1A 3FJSA 3N9PA 3POFA 1AR83 3O5SA 3ACHA 3AVSA 1S55A 2NQYA 3CO2A 2FZ2A 4GIQA 1BVP1 3O1MA 3KQ4B 4XVHA 5EJZB 4NOTA 2GNMA 4P5YA 2OX0A 1RUG2 4XEZA 4FXGB 1ENSA 5HXMA 2F4LA 3P3PA 3M1HA 4RGKA 4PF1A 1XSRA 1SLBA 4CEYB 2D5FA 2CY6A 4K7JA 3WG4A 5I0RA 4DY3A 5EQUA 3PDQA 3WX5A 5C3OA 4WVZA 3AFKA 1W39A 3KCXA 3ZYIB 1DQ6A 4GWIA 3NAPB 1XYOA 3MICA 1YQ2A 4CZSA 1ZZ8A 2Y0IA 1H8TC 4O65A 5A3WA 5CFCB 4XPVA 2FDGA 5FLJA 2PHUA 2P6CA 2WNUA 1UYZA 1RUJ3 2QQLA 3NRUA 4FO9A 2VNOA 4FOVA 4QT6A 4UXAA 1M06G 2VMDA 4NO4A 4LBMA 1RINA 4BPZA 1R093 3RFRA 5FO7B 1R083 4E4ZA 3RRDA 4M0HA 1OD3A 2B7YA 3F2ZA 4D6RA 4BHPA 4QX8A 1G9FA 3DPRC 3MPBA 5AFEA 4HANA 2XJRA 4RGAA 2DFBA 1NYWA 4LKEA 4XBQA 4XXAA 1APNA 2XH6A 4ZZ5A 5FXXA 5C5TA 3VBUA 3L2HA 4HPKA 4LBJA 1S0DA 1UF2C 1ND2A 1TEIA 1SLAA 2Q1ZB 3OF1A 1DQ4A 3FE5A 2BFUS 5LBFA 4RR3C 4HKWA 4WZFA 1HXS3 5LEJA 1A3KA 5ERLA 2XB6C 5C5UA 3PLQA 2W87A 2Q5TA 4FPEA 1B35A 5FR3A 1CZSA 2CAVA 2HWB2 1DLLA 2OS2A 1UYPA 5DZEA 5JPNB 3O1RA 2RS32 4IV3C 4BOWA 2GAUA 3VGIA 5KHKA 2ARAA 1XOYA 2PHWA 3PUAA 4Q4Y1 4AI8A 5IATA 5JXHA 4BQYA 3PMEA 3NKTA 4Q29A 1N1SA 1OI6A 5I0UA 4LK6A 4UFKA 5FYCA 4ZHNA 1QJY1 4XJ9A 1JZ8A 2E53A 1UO9A 4IEOA 1MZ6A 1W28A 2FDIA 4O7XA 2VMIA 2VJXA 5G05L 1ZBA3 3WDTA 3M4FA 4AFBA 2PHXA 1RHI1 2HWE3 4LKFA 5KWRA 2WT2A 5ACA3 3AL6A 3BPZA 1WW6A 1SBEA 1QF3A 1QQP3 1QJZA 1WD4A 2GC0A 2R30A 3ECQA 4LULA 4DXSA 3F95A 2OQ6A 4YZ2A 1PO13 1BBT3 5IK4A 1W0OA 3ZKUA 5LBEA 2DCKA 2FBEA 3OPTA 3OY8B 4MLOA 5C8CC 1YFXA 1QEXA 2NZ9A 5FP7A 3UESA 3GALA 2XBO1 4OHZA 3B93A 4LLFA 3T08A 5C9AC 2Z69A 3AKSA 1V70A 2NN8A 1ASJ1 1CVNA 4DQAA 3INAA 4O9GA 4QAWA 4B1MA 3IMNA 3I2DA 2VQ0A 1WMXA 4KQ7A 5H9RA 5A80A 4ITCA 1H1AA 2BUKA 2PAEA 3T1LA 2W1QA 1ULGA 3IMMA 2YC0A 3SMHA 1NZIA 4ZXEA 4FFGA 3R0RA 3OEAA 1JODA 2DVGA 4KNCA 5C33A 1IOAA 1VBD1 4OMCA 1RUI1 4M0NA 2YU1A 3JUUA 4NR1A 2PAMA 4I01A 1UZ0A 3IM0A 5JXGA 5LY1A 1W6OB 4NIHA 2QZ2A 1RC6A 2D6LX 4WM8B 4LBNA 4DFSA 1HB1A 1AVBA 4PDWC 5KC5A 4LEJA 3RMYA 2ZMLA 3WV6A 2XQRA 1RUD1 1CAXB 3W58A 5I93A 5LA0A 4XF3A 4IGPA 2B46X 5CBLA 5JR2A 2MNGA 2HWF3 4K8RB 3WF3A 1UN1A 4OCTA 1LEMA 3LZZA 5IVEA 4D69A 1GU3A 2JE9A 5CKNA 2BV4A 5JLVA 5L7OA 4BZ4A 4AFDA 2K9ZA 2VUJA 1YQ8A 4LK7A 5FYYA 4LUMA 2EF6A 3BU7A 2YBSA 4Y26A 5CZKA 3CBNA 4L8QA 4LNVA 5J1XA 3ZLIA 1U12A 2LUWA 4BE3A 1SLLA 2VL4A 4C0HA 5C6CA 2AACA 3N9OA 1N1TA 3WHUA 2DU1A 1RUC1 2R32A 2NM1A 1ZBE2 2YROA 1C28A 3OUHA 4XIKA 4D7TA 3VZOA 4PLMA 2WDBA 2WN2A 4IE7A 4FQZA 2HWC3 3R4DB 2WNUB 1OBNA 2XUMA 3ILFA 1Y4WA 1RUF3 2VNGA 4NHKA 3WF1A 4ASKA 4RHV1 1RGSA 1YLLA 1GOHA 3H7YA 3BALA 3GJBA 2UWCA 1LHOA 3BGAA 5GLWA 3UL2A 4AE2A 1GMMA 3VBSC 1AZDA 4L0PA 5A6ZA 4COYA 3JCIA 3MIFA 4AVSA 3H8OA 3VBUB 1F31A 1NOVA 4J25A 1PIV1 1ACCA 1S1AA 3AMHA 1MZ5A 2VVDA 3NJXA 3ZN6A 4E4DX 2O8OA 1WCDJ 4XURA 1A78A 2LROA 4AK3A 4AL9A 4MGYE 3KV6A 5JZGC 1MZEA 2ZGPA 4XJWA 3RZKA 4CP2A 2YZ4A 4NJ4A 2XHKA 2JB4A 1PX3A 1VBC3 2GP3A 4FTSA 3H1MA 5BPXA 1LESA 2W1WA 4QX1A 4LMFA 3VDAA 2D43A 5IK7A 4A7YA 1MS4A 2ARCA 4XJ8A 4XTMA 1H4GA 4N53A 5DZFA 5J09A 1DDLA 1M4WA 5IFTA 2DCJA 3PTRB 1U5YA 3H42B 5FPBA 3UV9A 3BCWA 3W20A 4MADA 1H6XA 2W9XA 2VZ1A 1QWRA 2ZCWA 3AKTA 1JYWA 1UPSA 2PYTA 4ISRA 1O8PA 5IJRA 1ZRDA 1DHKB 2O1QA 1YFYA 2A6YA 1GKBA 4LBOA 4CU9A 1XNCA 2PLV3 4LKDA 1NY71 3LIHA 3U37A 1SQ4A 4NROA 4CDUC 4CCLA 3DYPA 4Z2AA 3U4SA 5BNPC 3OPWA 2KR2A 4RQPC 4L97A 3OTFA 5FREA 1X9TA 1FT9A 3WVJA 2BERA 3JB8A 1CAVA 1SEFA 2HYXA 2YXSA 2WC2A 1XBFA 4MGIE 2SLIA 1TMF3 1YWKA 5CYYA 3WW3A 4EWAA 2QQUA 5DUXA 5LY2A 4AXOA 1BEV1 3J8F1 2GN7A 2XKPA 1D4VB 2JDUA 3LA3A 4BQ5A 2WNVC 2W08A 2WJSA 4COVA 5K9YA 2ZABA 3AP7A 3HAGA 4BWOA 4YNIA 4I02A 1IPKA 5HBAA 3AXEA 3J26N 2W39A 3M8LA 2BTVC 3LEMA 4HMZA 3AFGA 1QJX3 4OZOA 1YCIA 2I2SA 2XWBB 3CKHA 4X8NA 1NA1B 1EPZA 2VE1A 1VBB2 5FBZA 2E6VA 1ODNA 2XJSA 1HJGA 1GOFA 5FXVA 2BOJA 4JX0A 1K5MB 1HN0A 2HEWF 2OT7A 3ZN4A 4DOUA 1V6IA 3SXWA 4KU8A 2GC3A 3WW2A 1CGPA 5FZMA 2WL1A 2WA4A 5DUVA 4BLJA 1AR92 4M01A 1LNSA 3ZYFA 1NUKA 3R4UA 1EAH3 4C90A 1YI9A 1SG3A 2CV6A 1KXGA 2I45A 3OB8A 5H9QA 3CJIC 4YPJA 4YLZA 2RVAA 4CCEA 1KJRA 2VZSA 3JZVA 1MQTA 5JDBA 1CIYA 1CAWA 1UZZA 3POEA 3ETQA 3HIFA 1Z7S1 3LCPA 1E5RA 1WW7A 2AGSA 5L7OB 1RUE1 5A7OA 4F83A 4RS5C 1FPN2 2QE3A 5A7PA 1O4ZA 3O0WA 4JKMA 2ARBA 3KF5A 5CKQA 1POV3 1VRH2 4YG0A 5ANQA 4AAPA 1WZXA 2EAKA 4QQPA 4TXWA 5LA9A 2ORXA 3SCGA 2OKXA 3OG2A 1UXXX 4BMBA 4M3CA 1Y9QA 3K77A 4COWA 4IV1B 1GP4A 2YG0A 1I1EA 2JECA 4GB33 4YZ1A 4P9JA 1F4HA 4L92A 5GLUA 4XE9A 2D97A 2VXRA 3NNJA 1CQ9A 5F5QA 2XL7A 1IG0A 3BTXA 5J98B 1I5ZA 1OA2A 1UKGA 2CSGA 3A0NA 3MLJA 4N9IA 5GZCA 5FO8B 5C3PA 1RUH3 1N1YA 3EXUA 2GMEA 1IHMA 2WZPP 1DZQA 1W8HA 2CDPA 2HEYF 2XJTA 1AHSA 3POSA 4JVAA 5FZHA 1QNWA 5FZ7A 4QGMA 1ZM1A 4UW6A 4YM2A 3VKOA 2GMPA 1W9YA 3NW4A 4AI1A 4Z1VA 4P9GA 3H8XA 1D4M1 2QUOA 4XCBA 2Q8EA 3WW1A 1TME3 5BNNC 4PI2A 4NHXA 1UCXA 2ARXA 2YPDA 5HCAA 4YVSC 2CU5A 2D3SA 4JTNA 5LEKA 4FBFA 4MHUA 2CDOA 4XUOA 5LCWL 1FAYA 2LW8A 1AF9A 2QFEA 2ZX2A 3AJYA 4ZY9A 3ZFEA 3V0AA 2ZACA 3OBZA 4QKBA 2Y6LA 3ZFGC 1US2A 2WN3A 4N53B 2UU8A 3WUCA 5A7QA 1R092 3V0BA 2ZGQA 5JR7B 1R082 2JD4A 4LPLA 1N1VA 3DL3A 1C8NA 4NRMA 3ZFFA 3Q8EA 3DF0A 3BPSA 2DTWA 2LM3A 3J7HA 3VBRC 4M4PA 2Y6FA 1W3VA 4PJYA 1CESA 1KS5A 1N47A 1QH7A 1ULOA 4MO3M 3ACLA 4G9SB 4QWNA 2RS33 4L99A 4FOQA 3GHNA 2BEOA 3GZUC 2HWD1 3T30A 4A6OA 4AEDB 1X82A 4NIAA 4HONA 2HJIA 1UQXA 2VCBA 4JTOA 1HXS2 3PURA 2ZHMA 1WUVA 2UYBA 2ZMNA 4XDQA 3TEYA 2WIIB 1TG7A 4WVMB 4AZZA 1OQ1A 2J1AA 1JOPA 4I30A 2ADEA 3CJIA 3MHZA 5FPAA 1CIWA 3MYXA 4BH9A 5IFPA 1T2XA 1PK6B 1W6NA 5B4NA 1O3SA 1GICA 4F7ZA 3WW4A 1YYNA 4JGYA 5DZGA 4YZ3A 3NAPC 1CONA 2J42A 4RS5A 2VCAA 1XU2A 1C8M1 4NAOA 1GP6A 4E2GA 1EP0A 3IDBB 4JQRA 2VCCA 3AL5A 1ZBA2 3ES1A 1WMFA 2V72A 3U75A 5CFDA 1OA4A 1Z78A 3USSA 2HWE2 1EV13 5ACA2 5JOYA 2RHPA 3JB4C 3B02A 2XGXA 1VBE3 1QQP2 3VD7A 4ZXKA 3Q8FA 2XJPA 4HL0A 3MIBA 3I3QA 1PO12 3JQWA 1BBT2 3LIGA 4XMIA 3VDCA 3WNMA 3SISA 1J84A 4N43A 1UMZA 1W3XA 1XNTA 1L7LA 1MR5A 3G7DA 4Y5TA 3V65A 3T4HB 4A42A 2J7MA 5FY8A 4E27A 2OZJA 4EN9B 5HCBA 3AYCA 4QPIA 1YNAA 4BXFA 3BOWA 3MV11 5DAWA 4O9EA 3U4XA 4QXHA 3HVDA 2BRTA 4Q4W3 1LGBA 1P8JA 4YW1A 3WQ7A 1KS4A 3MPPG 4AFMA 1QIQA 1RHI2 1OLQA 5DXDA 2N7GA 5LBBA 3C2UA 4KL1A 4L11A 5BNNA 3LA7A 4E4SA 2ZHKA 1JU3A 2C6SA 4FI9A 4ASMB 1RL3A 5FJHA 2PAKA 5FPLA 1Y7BA 4HOOA 2YYOA 4BQ1A 1AJOA 1CZTA 1IQDC 3VD5A 5K0UA 1Q43A 2XMLA 2DVAA 3KQRA 3OSDA 4E8DA 4EN7B 5KR7A 1T6GC 1AYN3 3JBG1 4NMIA 3KV5A 1X8EA 2WO1A 2ORZA 3DN7A 1VBA3 1XE8A 2X5IB 1MVEA 2XBO2 3RJRA 5A7NA 2WYFA 2ZGOA 1G9AA 4WBBA 1C5IA 3BUCA 3H1WA 3PTYA 3USUA 1ZBE3 2HWF2 1HKDA 3H3UA 2R043 1CZVA 4YFZA 3VBRA 1OQDA 3EO6A 1SLIA 1SFNA 1CPNA 2HBUA 4CCOA 4LKSA 4U36A 4AHXA 4QPWA 3VBHA 3LB9A 2VTXJ 2PQSA 1S0JA 1OKOA 1AL0G 1VBD2 2ZX0A 2WFF1 4HSJA 3QBQA 1UZVA 3GBWA 2DUQA 4R9BA 2AR6A 2HWC2 1GYKA 4IEZA 1FNZA 2A1XA 2ZZJA 4A7KA 4CEYA 3V0AB 3BIEA 5T50A 2JDZA 4DMIA 5FZCA 2V5YA 3NMBA 3POWA 2VZTA 4XFHA 1QXPA 4LO5B 2R6QA 1RYYA 4KBZA 4YW4A 2WZR3 2DURA 2EA7A 2XJQA 4ATFA 3TN91 2ZS6B 5CFCA 2CGNA 2VZPA 2ZHLA 1N3PA 2QJVA 2E9QA 3K75B 3PIJA 3ZFFB 2C9KA 4XQ4A 4FTBA 2WAAA 3PU8A 1RITA 2XHNA 1PZ8A 1MS3A 4NPMA 4EYUA 2Y38A 2V73A 3BYWA 4WM8C 3OYWA 5L9BA 2JD9A 4LJHA 2C1FA 1DF0A 4ARXA 4DY5A 3JD71 2RR13 5F5IA 1RUC2 1DZRA 3FUQA 3I2KA 3R05A 2BZDA 1VBC2 2W52A 2DCZA 1C5HA 1FOD3 2QCSB 1F2NA 2ZKLA 2FQPA 2RS51 4FPGA 1S0EA 4Y1UA 5DN2A 3BB6A 2QDRA 3PNAA 4HT1T 1QJU3 4RHV2 3H9AA 4WZCA 3LWCA 5JIAA 4YM3A 4QKDA 1BXHA 5FCCA 1IS4A 1CX4A 4JGYB 3MGUA 1PGL1 4CSWA 1V9U1 1HQNA 2RMU1 1IS3A 2EIDA 2RDSA 2JDPA 5FY1A 1HRI3 1TNRA 2WNUC 1IPJA 4YW2A 3WQ0A 3D0JA 3HBZA 4HVOA 2PLV2 3WG3A 4XAAA 5CFDB 1UIKA 5FUNA 2P3YA 3KWVA 4BQWA 2OVUA 2Z2SB 3NJVA 4BQXA 2BJSA 1L7QA 3N36A 2DWRA 4GWMA 3W5MA 3MUY1 3T1MA 1VIWB 3PVOA 4YVWA 3THTA 1G9CA 5FQ0B 4AHWA 4BK5A 3S30A 5T5JA 4XHBA 1JZ3A 1TMF2 4KH9A 1W05A 1AJKA 2VW0A 1RVF3 1BKZA 1DGWA 3IWZA 3NJYA 4MV2A 4N43B 3VBUC 2UURA 4B7KA 2Q1FA 3RZJA 5C4WA 2OYZA 3GYDA 3ZSLA 2H0BA 2P2KA 1WLCA 1G86A 4FTEA 5DMYA 3EBRA 2RDQA 3PUSA 5H9SA 3ZXLA 1ENRA 3DV8A 1ZRCA 1AR93 5C8WA 2B5HA 2D98A 1QJEA 2NP0A 1B35C 4MHRA 2IFRA 2P3KA 1MEC3 2E7TA 2VZQA 3M2MA 1NY72 3WNNA 3K4AA 3OY8A 5T54A 3MV01 2VXJA 1RMU1 1ST8A 4GAZA 4KU7A 3TB0A 1ZRRA 1WLDA 3VDDA 5FYZA 4TYSA 5FDBA 5FXWA 4TLGA 4RA0A 2AREA 3ZXEA 4LIVA 4NN0A 3RMXA 4KI5M 3TBDA 1HN1A 2JG8B 3UGFA 1JZ2A 1J1LA 3J8F2 3IT8A 1QMJA 1LRHA 3NWKA 5KXDA 4GULA 4DS0A 4YGEA 3RVHA 3UETA 3ZXDA 5F8PA 1EAH2 4MXVA 1W6MB 4XQWA 1O7FA 4YM0A 5A6XA 2VH9A 1ULDA 2FZ1A 3CZUA 1NG0A 4ARYA 3USUB 2VMFA 1C57A 1I9RA 1YIFA 1ZZCA 2EVXA 4HN0A 3N3HA 4XACA 3BI3A 1OPOA 1O4YA 3MW4A 3HR9A 1OLME 4QB2A 1BMV1 5KXCA 1LTEA 1XYNA 4KWJA 1W6OA 4AQ2A 2E63A 4CUBA 3J4UH 2FDHA 5F5CA 1QU0A 3FHAA 4FP2A 1OUXA 3W5NA 3KCYA 5JCTA 3C7EA 4UFHA 3S6PA 2H6CA 1CAXA 2Z5WA 4QQLA 4AEMA 4ZZ8A 3VBHB 2VCMA 2A3YA 3RZHA 3L9JT 1CR7A 3ASIA 1PO23 1GNHA 2ZJCA 4OUEA 2QKDA 5FFOC 3D4KA 3ZIXA 2WS91 5L36A 2A70A 3IAPA 5KHHA 3WDWA 4NIDA 1JYXA 4CDWB 2IUWA 2V4VA 1N3OA 5BYNA 4GB32 3B9IA 3AYEA 1PGSA 4CDXB 3AZVA 2DVBA 1BK1A 1UL9A 1WCQA 3PJYA 4XABA 2W47A 2GMMA 5FY9A 2J22A 1YI7A 3WLUA 1OURA 4QU2A 4XUTA 1K5MC 2RM23 4B4PA 5GLZA 1ENQA 1Z7S2 4Q4V3 4CCJA 2CAUA 1RUE2 1X33A 5AFBA 1RUH2 3T0BA 2F17A 5BNOC 1IS5A 1J83A 1NT0A 3PVBB 1YEWA 2MHFA 3VZNA 1QXJA 2ZGKA 4OUSA 3OCPA 3DCQA 3OYWB 1HRV1 4PIYA 4DB5A 5E8AA 2FCTA 3P1IA 4K20A 1TME2 5A3TA 2WQ8A 1YJLA 3MFCA 4HBNA 5EZWA 4Z2WA 1AR71 3KV4A 3WNLA 3B00A 4FPCA 4KG0A 3TEXA 4HKLA 3WF2A 1KRIA 1AXKA 1N3QA 3N35A 5L7OC 1GFF2 2C4XA 3MF9A 5FK8A 5ISLA 4MGSA 3S57A 1OMIA 3O7OA 1WW4A 2CWSA 3O1PA 2Q4SA 1UX7A 3PMSA 3PVNA 5GLTA 4UW4A 5JWPA 5I0TA 2PHDA 5CU1A 3FHIB 1Q8SA 3ZSKA 4A6SA 5IWFA 3PUIA 2GSYA 3WNKA 2VY0A 4XTPA 1QOTA 3AMQA 4IV1C 5FY4A 2P37A 3H7JA 4IEWA 3VZMA 2VNRA 5GZGA 4JAAA 4GH4B 1ZA4A 3ROUA 4B3NA 1W8WA 3MFAA 1UMHA 2VUAA 3ZXFA 5A1AA 4ZONA 5F3CA 4K3UA 2PQQA 3B69A 1L3JA 2BDRA 3IB3A 2ZEXA 2BFUL 4IEQA 3RQ0A 5A7WB 4YVWB 1JHJA 5JI7A 5JSPA 2X09A 3WEZA 3KVBA 4V1PA 2WINB 5FY0A 2BGOA 1FX5A 2JDKA 3V64A 5LA2A 5ABJA 3SEPA 3ENRA 3LOBA 5FYMA 4EV0A 4BM8A 4LHLA 5CEHA 1YXWA 2EICA 3OUIA 3ORJA 4XILA 2TBVA 5T5OA 2VQAA 3VV1A 3MUZ1 2VAUA 5C4WB 2PFWA 1SPPA 3URFA 2SBAA 3X29B 2BNMA 1RXGA 2BOIA 1FNYA 3M3CA 1F35A 4PIXA 5A33B 1VALA 4U2AA 3BVCA 1JYTA 2GNBA 2IXIA 2GALA 3I54A 3KCCA 2YFUA 1JS9A 2WYSA 2HWD2 1BZWA 4XJZA 4E8CA 1XNKA 3N9QA 4Q4Y3 2BYVE 1OSGA 4N53C 2IC1A 4XZUG 1RTVA 2WT1A 1QJY3 1REDA 3VDDB 4AWDA 1EV12 5A7SA 2D6PA 3LDKA 2VBBA 4AEKA 2AEYA 2ET7A 2GU9A 2VOKA 4NIGA 1VBE2 1U5ZA 1OC1A 2V09A 2W95A 3KD4A 4QPYA 1ULCA 3OGRA 5F39A 3C7GA 1NA1A 1RHI3 4G4FA 3RS6A 5D21A 3BU0A 1XNAA 4G3YC 4EWEA 2WO2A 1CJDA 1AXYA 1YC61 2ETEA 2VW1A 1K5MA 2XJUA 4QHZA 4AEDC 1H9PA 4DPNA 5K7PA 2ERFA 4OI1A 5FWEA 3UK9A 1KFXL 1PVC1 3ZYJB 3AC0A 3H3LA 1IKQA 2F6BA 2Z4FA 2YMZA 4EQVA 2ZX3A 4Q4W2 3WG1A 3FUOA 4RN5A 1W8UA 5CB7A 3WCSA 1I3HA 4QPGB 5DG1A 3P5BA 2XBO3 4GA9A 2ZX4A 3AMNA 4XMAA 4LE3A 3CQOA 4LBQA 4V2VA 5E6HA 4Y22B 1ASJ3 1WMDA 2YY1A 3KT4A 3ZIWA 2YB7A 4LBQD 1CAUA 1VB2A 1F9KA 4Q1RA 2Q8OA 4Y3OA 1SACA 1KQRA 4JGZB 2E31A 5JXJA 4OZXA 1FATA 2D93A 5F2WA 5EIYB 1R64A 1V6MA 1AYN2 3W9AA 3K4ZA 4OQ9A 5HPOA 4Z8BA 1VBA2 2RDNA 2BBAA 2A3XA 5I0SA 5FZDA 2QQOA 1VBD3 1J3RA 1W0NA 1RUI3 5FY7A 5FYBA 5FOBB 2ATFA 2W0XA 1OF3A 2R042 5IYYA 1LOCA 1JUHA 1JXNA 3CMGA 3Q9OA 4IV1A 3VZJA 1VPHA 1H4HA 2G1MA 2UY9A 1IS6A 2IXLA 4FOWA 4GMP0 3LEKA 1RUD3 2K0GA 3EMRA 1O3RA 1FMD1 1W99A 3C7HA 3H50A 4I3GA 2FDFA 3D82A 3NNLA 3RG0A 4H7LA 5FBJA 1EUUA 1Q8VA 4I2OA 4P02B 1SZBA 1GZWB 3I2FA 1MQTC 3O1TA 2E33A 3LGRA 3RZMA 3QLQA 4XUNA 2V4AA 1WBFA 2OPWA 3OBAA 4AGRA 1H30A 1FYUA 1SMVA 2QBXA 1AX2A 1Z0HA 2RJKA 3UGHA 1C1LA 3AX4A 1R1A1 4MUVA 2JIJA 3VHNA 5IVFA 1ZZBA 1RUC3 4LBKA 2VMGA 2DUPA 2WZR2 1OFSA 1YQ6A 2VW2A 3PUQA 1NCQB 4LO4B 3VKNA 4PQ9A 2OW4A 5F6KA 1H2MA 5F9TA 5M0TA 4ET7A 2W46A 4BDVB 2PA7A 4PQQA 3ZOIA 3K4DA 4PLNA 4OHYA 2VUCA 4CDQB 4RHV3 5C70A 3ALQA 1LB2A 5IVVA 2WT0A 3O0VA 1HQLA 1LGCA 1OA3A 3SKVA 2RR12 2WFF2 4XFGA 2WFPA 3JU9A 4QX3A 3ZM8A 4D8MA 2CGPA 5FZLA 3ZXJA 3WCRA 2ZAHA 5APAA 3SH4A 3AKRA 1W2UA 4D6QA 4CYDA 1S0GA 1PIV3 1FOD2 2XVGA 2JJ6A 4GKYA 3WG2A 4FPHA 2BWCA 5ABJB 4XYXA 1ALYA 1NKGA 4FCAA 3SC7X 3OJBA 3H1YA 4AQ6A 3FL7A 4AEDA 2AH2A 2UWBA 2J1EA 3VHPA 2R071 1H6YA 1QJU2 4B4RA 4YARA 1PGW1 1SPPB 4K6BA 3OD4A 3WF0A 3LF7A 1Y43B 3NNGA 3TYJA 4AVTA 2FD8A 4CXXA 1BQPA 3CZJA 4WVMA 3DYOA 3N7KA 2Y6JA 3KSCA 4UFLA 4CP9B 1HRI2 1QY4A 2RS11 1O3QA 4LLOA 3ZX7A 3ZFEC 2HLEA 1Y3TA 3ZPYA 4BIFA 1YFUA 2R0HA 1PK6A 1U5XA 1GWMA 1VMHA 5IK8A 4KG8A 1C1FA 2WNEA 3KGLA 1JYVA 1WWYA 2JKBA 2R061 1LKNA 3POIA 5A70A 1JZ5A 3GZEA 2QQWA 2CTVA 3ZFFC 2RS52 3ZYGA 4EZ4A 1AR61 5SV8A 5IHRA 4Z07A 2YHJA 1RVF2 1UZWA 5IVBA 3LFMA 3HBKA 3O12A 4V2WA 4ZPIA 4H55A 4DEQA 3SH3A 1K45A 1YQCA 3RYPA 2K46A 4TZDA 1JHNA 4ONUA 4XDPA 4ZU5A 1D2SA 1CN1A 3RI8A 1V9U2 2GNTA 4R9AA 4TWTA 5L9VA 2MEV1 4BB3A 3FMGA 4CXYA 3C7FA 1BEV3 3J8F3 4FAHA 4DXZA 3ES4A 1JW6A 3UKVA 1W04A 1VE0A 1JUIA 1BK0A 1DQ5A 1MEC2 3LDRA 4GMP1 4GZ9A 4P08A 3TNQA 1UX6A 5C3RA 2Z42A 3OBTA 3NQHA 4LBQB 1W0PA 4QU1A 5F1RA 4LOTA 5J7MA 4S2HA 2R1BA 2Y33A 4UYBA 2J1RA 3Q8CA 1V6OA 1CAUB 5BNQA 5FZOA 4DRRA 3BTAA 4JGYC 1UOBA 1YHFA 2I74A 1KJLA 4LA2A 4OVEA 1H8TB 4QD2A 1DQ0A 4BISA 1OXCA 1NAEA 3VKMA 1AL21 1RUG1 5G04L 5KXBA 5GM0A 1YIPA 5CFDC 1L7RA 5HCHA 3AZYA 4GJYA 1AX1A 4IEXA 4MX3A 2R49A 1W2OA 1QJFA 3HPNA 2GP5A 2D44A 3K51A 3DEMA 3OBRA 5HI0A 1HQWA 2WQZC 2XONA 2YDEA 5D8AA 4QQOA 1JI6A 4OI4A 1O5LA 2OUHA 4QX5A 3P3NA 1YJKA 2B4KA 1RMU2 2IVIB 2X5IA 4JV4A 5GZFA 4IDZA 2WWSA 3NL1A 3A4UA 4N43C 5J36A 5J37A 3T3YA 3DUIA 4YZ4A 1HB2A 1PO22 4DUWA 1R1ZA 2KA3A 2HBTA 3I2GA 1Z7S3 3GM8A 4QPIC 5DQ0A 1SCSA 1RUE3 2VD7A 4FFFA 1DG6A 3ZDSA 3VL8A 1I6XA 2YBKA 4JDOA 5IAXA 4L2NA 2JDAA 1GWLA 3U11A 4XW3A 3BKZA 1Q3EA 3PUHA 4Y1VA 3WF4A 2Y64A 5I8SA 2NMNA 2EXKA 2DVDA 1LULA 3TRSB 4BQ2A 4Q4X1 4M3CF 1LOFA 1AYM1 2ZGTA 2XJVA 3VD3A 2PMWB 1UY0A 2K2SA 2RM22 4HVRA 4OFGA 1RB8G 1ZRFA 1NLRA 3WT3A 4NRPA 3AKPA 4Q4V2 3D8CA 1X8MA 3A23A 4Q0SA 3WHTA 4AI9A 5A3PA 4MVTA 2JG8C 4P14A 5IT6A 3AZZA 5FYUA 5JIUA 5K0UC 4OHWA 4AYUA 4Y20B 2ENRA 3WDUA 3AMMA 5CA6A 1SDWA 1XE0A 1U0AA 2FCVA 1RUNA 4AF9A 2WS92 3MZHA 3DXUA 1DP0A 2HWB1 1UU6A 1OVSA 1AXZA
chains in the Genus database with same CATH topology
4BYYA 4XHXA 3KS7A 4LE4A 4XZPA 5IUQA 5H9PA 1LODA 1HX6A 4IEVA 4JDNA 1B09A 3MDPA 2DYCA 3VBFA 4QM9A 3LSDA 5J48A 2VECA 1D4M3 4PIZA 4XBLA 3QACA 5FMOS 2D6KA 4YFWA 4YG3A 5C8CB 2DU0A 1G7YA 3VBHC 2JENA 5C9AB 4YG6A 5E89A 2VULA 4OUMA 1QHDA 5FO9B 4CDWC 3PVEA 4J1WA 4CEYC 4CP1A 1HRV2 1XE7A 2JEMA 1XNBA 4BIOA 5IK5A 1DGRN 4KGQA 5SV5A 1QNYA 1PM7A 4E2QA 5E16A 4Q0UA 1W6QB 5DDJ1 1VJ2A 4X8PA 1COV1 3QCWA 2FHRA 3RPQA 5T5LA 2BWAA 3MIEA 3FX3A 1ZZ9A 5CFCC 3UKTA 2IXCA 1HV1A 2HWD3 5JPMB 2GC2A 3FFZA 4NVPA 2D3RA 3NV3A 4IL7A 2PELA 4LHNA 1CD3G 4X6RB 3GZTB 1URXA 1UU5A 3NKGA 5FQ0A 4SLIA 1ZYBA 3POYA 3CF6E 3K48A 3BODA 3C3VA 4YYOA 5FAXA 3AB0A 5GLVA 4Q4Y2 3AP6A 4TSVA 1FV3A 1QJY2 1QDCA 2XVLA 4ZU4A 3MIGA 1C8M3 4LUKA 4UBGA 4AI3A 4H3WA 1H1IA 3GHMA 3EHKA 3AZWA 4AQTA 4AI0A 4FP3A 2R1DA 4GH4C 1Q5OA 1PHMA 2XLFA 2X29A 3SLIA 5BY5A 2WLPA 5GZDA 3MLKA 2JG8A 3JQXA 4OI2A 5D8AB 4YVWC 3VBSB 4Q2FA 1G9DA 2DUOA 2ZGNA 1W6MA 2DTYA 1BJQA 5C4WC 1D2QA 2GN3A 5CADA 1ASJ2 3N7MA 3U07A 3BOPA 3I4IA 2EIGA 1HIXA 4BLIA 4QXKA 5DUWA 4HKOA 4BA6A 2BNNA 1BYHA 4MXWB 4XF0A 5FPXA 4XF1A 3OGGA 3SITA 1RUI2 4QM8A 3VDDC 4CDWA 2VOVA 3JBG3 1VAMA 3EQEA 2IZWA 1RUD2 4CDXA 5FTTC 3KT7A 2FMYA 2ZGRA 2I07B 1LHVA 1YFWA 1JOJA 5BNPB 1SBFA 4RQPB 5FLHA 3FLPA 3ST7A 3L2YA 5T3NA 3AXDA 3VBFB 4HK8A 2DCTA 3ZSMA 2ZHNA 3OPZA 1RJ7A 4QPGC 2D7FA 1ENXA 4P9XA 2WFF3 2WNVB 3M70A 4XQDA 4IETA 4Q8LA 4A7ZA 1WGPA 3AP5A 4K1ZA 1IZ3A 2GDFA 2CL2A 2NMOA 1UKRA 1MZFA 1Q8QA 3ZXKA 3M7AA 4XJUA 3VKLA 5EXOA 1UW8A 4AGGA 5LK7B 3HT2A 3TN93 4QGLA 1XQNA 4COZA 4KWLA 4MYEA 4CRQA 1PIV2 3MW2A 4LO7A 5JOXA 2A6VA 3KB5A 4FPOB 2ZKNA 3JD73 2ZX1A 4WM7A 4GH4A 2UWAA 1Q8OA 4LBLA 3ZYPA 1NE6A 1BCXA 3VUOA 1VBB1 3ELNA 3M3QA 3A0KA 2GZWA 3APBA 2WSVA 5A32A 2A3WA 1V6LA 1WMEA 2DVFA 2RS53 3HWJA 3VHOA 4CEWA 5E1RA 3ZXAC 1GNZA 3D6EA 5JOWA 5AC91 5CG8A 2C0ZA 4MGKE 3SHRA 1V9U3 4R4XA 2RMU3 1O5UA 4YRDA 5A33A 1IQAA 2VOXA 3CNAA 5FLIA 3WP6A 4C1WA 1JH5A 3G6JB 4TLFA 1PNGA 1LU1A 1JN2P 1PGW2 2C5DA 3S7EA 2XG3A 2X53S 1FPN1 2QZ3A 4E9KA 2P17A 3NVCA 5GJ6A 2D6OX 2IFWA 1LOEA 2DCYA 3OD0A 4OULA 4YM1A 4GWNA 1VRH1 1BEV2 5AVPA 4S2DA 1GANA 5ABJC 3AYDA 1UU4A 2A6ZA 4JC1A 5D1IA 3NSTA 4BCUA 3WDYA 2DF7A 2JX9A 2B8MA 1YRZA 2Q30A 2C9AA 4Q0QA 2B42B 5LK5A 4AQSA 2ZA9A 1AR81 3LKJA 4OHXA 4YVSB 4AVVA 1AR62 1AUYA 4WVVA 4W6WA 4QPGA 4WVWA 1RMU3 1UPIA 2NLRA 3DGTA 4B29A 2OUJA 4R9CA 4Y22A 5T5PA 3RSJA 5GZEA 1MS0A 3E5QA 1DIWA 1V6NA 3AM2A 3B01A 4JGZA 2GNDA 2IXJA 2H6BA 1WCSA 1UIJA 5BNOB 1NA1C 5KHJA 4P9LA 1NLSA 3DKWA 3T2TA 2HEVF 4P9IA 4BMEA 1LHUA 1S0CA 1CPMA 1MS9A 1RUJ1 3I59A 3MIDA 5KHGA 4AI2A 1R091 1RJ8A 1R081 2QVSB 2ZGLA 1SCRA 4P5HA 5LRSA 1ZREA 3SH5A 2DV9A 4ES8A 1AL22 2AENA 4B4QA 1GZCA 2JE7A 4XFIA 4FPLA 2WS93 3GBGA 4INDA 1NCRB 1ONAA 1OOPA 3PHMA 1C4RA 1MS8A 1GZWA 2IXKA 4FPJA 4GXLA 4IERA 2JXAA 4META 4EN0A 3H8UA 4HN1A 3WXPA 1HXS1 1JBCA 1C3HA 3IPVB 1TE1B 5I91A 1S0BA 2D6NA 3SNMA 5L19A 2ZPXA 1BVVA 4EWDA 1NCQA 4NHMA 1IGOA 2D6MA 4PCRA 4JCKA 4XFAA 4MGZE 2Q0AA 1G8WA 1HRV3 4M00A 1ZNPA 4Q4X2 1AYM2 2ILMA 2BBVA 4CDQA 3CEWA 4WM7B 1D4M2 2WSUA 3S0MA 1DGRA 1AR73 3AK0A 2BGCA 3E6BA 1ZBA1 1GLHA 2HWE1 5A32B 4CEWB 4FOYA 4MH0E 5ACA1 2EXIA 5DUUA 2XLGA 1ZZ7A 2JG9B 1QQP1 2EXHA 3V56A 4RD7A 2WKKA 1PO11 1BBT1 4QQHA 1E57A 1LEDA 4Q27A 4DRVA 4QMAA 1LR5A 4A2UA 4LHKA 3NV1A 1DYKA 1ULFA 4YSFA 3FBYA 2UY8A 1H2LA 3EJKA 4Y1YA 2R16A 5AVAA 2YUEA 3VBOA 4XF9A 1LJ7A 1G9BA 1X50A 4B8EA 4IESA 3HQXA 4J6GA 4DNYA 1WD3A 4D3WA 5DDJ2 3MI8A 2GH2A 1COV2 4Y5Z0 1UD1A 5CIRA 3KMHA 1TQ5A 3LOIA 3E6DA 4LR4A 1C8M2 1ND3B 3ZSJA 4LA3A 4JRAA 1DQ1A 1CJPA 1DFQA 3M3OA 4IEUA 2HWF1 2RJLA 4FVVA 2PHTA 5EJ3A 5I8TA 2XL9A 1PK6C 3B94A 2GH8A 1EPWA 4LT5A 2ET1A 3D5OA 3RZZA 4FAGA 5BV6A 1H8TA 5CVRA 1GR3A 2VOWA 2VG9A 4YW3A 4FT8A 1DGLA 4Y1XA 1FI2A 1PVC3 2HWC1 4Z82A 3GNEA 3I59B 5B2GB 4DINB 4AEJA 3RDIA 1EYBA 3VZKA 4S2GA 1RUF1 3DPRA 3MIHA 1S2BA 4XFFA 2HYKA 4R52A 1MS1A 4N9HA 1OFNA 2VGDA 3FWEA 3ZXGA 5KBFA 2FMDA 2ZAAA 3AKQA 4RR3A 1IKPA 1OOPB 4HLTA 1QDOA 5JMCA 1POV0 3B5LB 5JI9A 1G6NA 2GC1A 1VB4A 3JBG2 2F4PA 4OHVA 4AG4A 2A75A 3ZYRA 1VBC1 3RYRA 3TNPB 5HXVA 3AZXA 2Y0OA 2PTMA 3KT1A 4IV3A 1F5FA 2EAAA 4K40A 4YW5A 2Y26A 1Q56A 2VU9A 1NQDA 1OQEA 3CL1A 4QHBA 4YGCA 5D8AC 1FMD3 5J96B 4D7SA 2VMHA 4Y20A 1U5IA 2YPJA 2B45X 3ILRA 1ZZ6A 2X5IC 4HPKB 4FQ4A 4MSVA 2ZZQA 1ND2B 2E7AA 2PLV1 5LRRA 3WOGA 5CG9A 3CU7A 4LO8A 3WY6A 3WP3A 3QD6A 4K21A 4I0WB 1R1A3 1B35B 3IIAA 4CTEA 5EYYA 1LOFC 1TMF1 3TN92 5C8CA 3FC0A 1S0IA 5C9AA 2WLQA 1V6JA 3RI9A 4IQPA 4P9WA 4N90A 4ES9A 2Z79A 4XBNA 5DG2A 3ZO0B 3JD72 1QJX1 1W6QA 4SBVA 1F5JA 1F8VA 2XKOA 3AP9A 3TOJA 1QXRA 2VVEA 3VBOB 4C91A 1GBGA 3J9SA 3S7IA 1RIRA 4ATEA 1WCKA 4AHZA 3HMYA 5JSOA 2R073 1H2KA 5T55A 3VBFC 4PDWA 3ZSEA 4Q0VA 3FFQA 3WINE 1PGL2 1EAH1 2QDNA 2RMU2 1XRUA 1MACA 4ORFA 4E2SA 2RS13 1QKQA 5KHIA 2E51A 1LGNA 4XIOA 1O3TA 4Q26A 3RWNA 3HT1A 2TUNA 2UYAA 4PLOA 4I09A 2G4IA 4S2FA 2XLAA 3IDCB 2R063 4AGVA 4DZGA 1O4TA 4NWWA 3VL9A 1AR63 4N7IA 4YGDA 1POV1 2R0FA 5JOZA 5FRAA 3NO8A 2BW8A 3PJQA 4PBPA 5AC92 4Q0PA 2A5ZA 2XWJB 4W6XA 4UW3A 4W6YA 5JAXA 3R6SA 4GB31 2MEV3 3NV2A 1OKQA 3DPRB 2B39A 3UKNA 1DU3D 1AX0A 3QH6A 5EYXA 4GMP3 4H14A 3VBSA 1DYPA 1J3QA 2D3PA 2PHFA 3GF6A 1GZ9A 1J58A 1RUH1 3WZ1A 2WA3A 4FXKB 4RR3B 4C0BA 3WUDA 1X7NA 2W68A 5JZGA 3RJ2X 2A71A 3KZ4C 4XFCA 1FV2A 4COUA 1FXZA 1AL23 3AP4A 1RUG3 1TME1 3ATGA 4MXWA 2E7QA 1ZVFA 3HD8B 3IKWA 2AZ5A 1A8MA 3WR0A 1J3PA 3TWIA 4IV3B 1VAVA 1VP6A 3QH7A 1HV0A 3ZMOA 1BMV2 1AR82 4KBBA 2BNOA 1H8VA 2LTNA 4NPRA 1PZ9A 4AFCA 4HSLA 3H0OA 4R9DA 3OGJA 1J59A 3CLPA 2QQPA 2IWGB 4KWKA 2OIIA 3ZN6B 2CGOA 5EFUA 2D5HA 4CDUA 5KXEA 5BNPA 4RQPA 3WDVA 3AJZA 2RS31 3E6CC 3IBMA 1WLWA 3B7MA 2Q1MA 4Q4X3 1W6PA 1AYM3 4RFT0 4ZKTB 1NZCA 1LECA 3VHRA 3VLBB 4YZ5A 1YO8A 4XOGA 1NE4A 1RUJ2 4QQ2A 2WNVA 2O8QA 5F6LB 3NV4A 4AW7A 4Y4YA 2AYHA 4MZUA 1A8DA 1REEA 4RL7A 1DZTA 4RGGA 1QOOA 3WP4A 2X8KA 4HZFA 2P34A 4CDXC 1KFUL 2HWB3 2XVKA 1JYCA 5K8SA 1A6CA 1AR72 5JVVA 4IXLA 2AUYA 1LHWA 3GZAA 4LO6B 5FMOL 2KXLA 4KGGA 1QGLA 4GKXA 3I7DA 2OZ6A 3N7LA 1LOGA 1GQHA 4PF5A 1EV11 4WV8A 4Y1ZA 4IEPA 2OA2A 1CAVB 3ZN5A 4XXPA 2PHRA 1VBE1 2PN5A 4PDWB 2VPVA 1GV9A 1D0GA 1DGWX 3E97A 4K8FA 1NCRC 1MS5A 4IEYA 3MW3A 3ILNA 1NXD1 3CJXA 4XETA 4AVBA 3O14A 1HW5A 4AVAA 5DDJ3 1H9WA 1MVQA 1WW5A 4EROA 1COV3 1DBNA 1LU2A 4AHYA 4Q4W1 1YUDA 3THPA 1KDMA 1V6KA 5CNAA 2YGLA 2QNKA 3WD5A 1NQJA 2MPFA 4C1XA 1WBLA 1VAKA 2PHLA 1DQ2A 4M3CE 1LHNA 5A3MA 4WM7C 2O0OA 2ZOEB 4Y24A 4HVQA 2TEPA 5L73A 5KC6A 1AYN1 4AVCA 1VBA1 3UJQA 3NJZA 4ISQA 1MQTB 2BQPA 4CEWC 2VVFA 1CAWB 1ZBE1 3FLRA 1RUOA 3SCFA 2R041 3KM5A 1XXNA 4R8HA 3LSEA 3N7JA 2JG9C 5GKAC 3WDXA 2OPKA 1HLCA 2RE9A 3AMPA 3FBMA 4I3PA 2ZMKA 5JZGB 2KM2A 3FLTA 4YVSA 3E5UA 3U0ZA 1H0BA 4W65A 3MEPA 1X36A 2G9GA 4JDMA 4M3CB 1JTZX 4XFBA 3H3ZA 3ZFGA 1PVC2 3VZLA 1WA4A 3WNXA 4HK9A 1VLNA 4XF4A 1KDKA 1SLCA 3AYAA 1ZX5A 3VKFC 5I8YA 2ZTNA 2WZR1 3E5XA 5BNOA 4D7YA 1LENA 5EV7A 4Q8KA 2JICA 4CDUB 1UAIA 2CWMA 4URTA 4CP0A 3SCHA 4NWVA 4QGNA 1ND3C 2IXHA 3B9CA 2RR11 2YGMA 4K9SA 4YGBA 1W6PB 1HDKA 3M3IA 2NPIA 3GBFA 3IDEA 3VN4A 2G9FA 4I0AA 1FOD1 3ZFEB 4GALA 1NCRA 4EJRA 2XPJA 1RUF2 3MLLA 1SLTA 3I8TA 3W59A 3V0BB 2HKXA 4D94A 4FPKA 3RNSA 4EN6B 1QJU1 3NAPA 1REFA 4JGZC 3RYKA 2ZGSA 5T52A 1FMD2 1ULEA 2CYFA 3IPVA 3MF6A 4B7EA 5BUVA 1PZ7A 3HN1A 4UW5A 2A6WA 1QOSA 3FZ3A 1HRI1 5HCFA 5TSWA 1S0FA 1PMIA 4LTAA 2A6XA 3IN9A 3O0XA 5FPZA 4R4ZA 4J1XA 5FOJB 1QH6A 2YV8A 1R1A2 3ME2A 1SBDA 2BVVA 3D0SA 1OLRA 3CJIB 1XU1A 4OI0A 1RVF1 2B9UA 2D40A 2EXJA 3WP5A 1JYIA 1OOPC 1W6NB 1H2NA 2ZGMA 5EWSA 1PNFA 3QOPA 3M3EA 5E88A 2BPA2 4H7MA 1OD5A 4RS5B 2JG9A 4UBHA 4PBOA 1AR91 2WQ4A 5A3LA 3UJOA 4FPFA 3LAGA 4AFAA 4I0BA 1VR3A 1Q8PA 4Q1PA 1MEC1 1NCQC 1D0HA 4A3XA 4N7UA 2P3IA 2BVBA 5BXXA 4X6QB 2R072 1LOBA 1PVXA 4K1YA 4CDQC 2TNFA 1VBB3 1SFYA 4RSUA 1ND2C 4F8AA 4JRLA 3ZMNA 3LA2A 2H0VA 4EN8B 4QPIB 1NXMA 5JWPA 2RS12 2A7AA 1S2KA 4OLLA 5AC93 2A73B 2ZGUA 3KGZA 1WLTA 4NHLA 1QJX2 4Z92B 3BIWE 4F3JA 2DFCA 4HETA 1KD7A 2CNAA 2R062 4P9YA 3B3QE 3WQ1A 5J3UA 5BNNB 1ND3A 4ZU7A 1OPMA 4L9BA 1PO21 5CAZA 1V00A 1UZYA 5JSRA 4FPYA 1GQGA 4HFSA 5K0UB 1FPN3 3ZFGB 2NYYA 1OHFA 4GQ7A 2P3JA 1XNDA 1LCLA 2MEV2 1EY2A 1VRH3 1XYPA 1KITA 3TAYA 4ASLA 1H1MA 2ZBJA 1LOAA 3VBOC 4FSJA 1J1TA 3KLSA 1O91A 3R4SA 3VBRB 2RM21 2LALA 3U10A 1GSLA 1TNFA 4Q4V1 2EALA 2ES3A 4WM8A 5GALA 4XJAA 3FJSA 1AR83 3O5SA 1S55A 2NQYA 3CO2A 2FZ2A 4GIQA 1BVP1 4NOTA 2GNMA 1RUG2 4XEZA 4FXGB 1ENSA 3P3PA 3M1HA 4CEYB 1SLBA 2D5FA 2CY6A 4K7JA 3WG4A 5I0RA 4DY3A 3WX5A 4WVZA 3AFKA 1W39A 3KCXA 3ZYIB 1DQ6A 3NAPB 1XYOA 3MICA 4CZSA 1ZZ8A 2Y0IA 1H8TC 5CFCB 4XPVA 5FLJA 2PHUA 2WNUA 4FO9A 1RUJ3 4FOVA 1M06G 2VNOA 4UXAA 4QT6A 4NO4A 4LBMA 1RINA 4BPZA 1R093 5FO7B 1R083 4E4ZA 3RRDA 4M0HA 2B7YA 4BHPA 1G9FA 3DPRC 3MPBA 5AFEA 4HANA 2XJRA 4RGAA 2DFBA 1NYWA 4XBQA 4XXAA 1APNA 2XH6A 3VBUA 3L2HA 4HPKA 4LBJA 1S0DA 1UF2C 1ND2A 1TEIA 1SLAA 2Q1ZB 3OF1A 1DQ4A 3FE5A 2BFUS 4RR3C 4HKWA 4WZFA 1HXS3 5LEJA 1A3KA 2XB6C 3PLQA 2Q5TA 4FPEA 1B35A 2CAVA 2HWB2 1DLLA 5DZEA 5JPNB 2RS32 4IV3C 4BOWA 2GAUA 3VGIA 5KHKA 2PHWA 4AI8A 4Q4Y1 3PMEA 3NKTA 4Q29A 1N1SA 1OI6A 5I0UA 1QJY1 4XJ9A 2E53A 4IEOA 1MZ6A 2VMIA 1ZBA3 3WDTA 3M4FA 4AFBA 2PHXA 1RHI1 2HWE3 5KWRA 2WT2A 5ACA3 3BPZA 1WW6A 1SBEA 1QF3A 1QQP3 1QJZA 1WD4A 2GC0A 2R30A 3ECQA 4LULA 4YZ2A 1PO13 1BBT3 5IK4A 1W0OA 2DCKA 2FBEA 3OY8B 4MLOA 5C8CC 1YFXA 2NZ9A 3GALA 2XBO1 4OHZA 3B93A 4LLFA 5C9AC 2Z69A 3AKSA 1V70A 2NN8A 1ASJ1 1CVNA 4DQAA 3INAA 4O9GA 3IMNA 3I2DA 2VQ0A 5H9RA 4KQ7A 4ITCA 1H1AA 2BUKA 2PAEA 3T1LA 1ULGA 2YC0A 3SMHA 3R0RA 2DVGA 4KNCA 5C33A 1IOAA 1VBD1 1RUI1 4M0NA 3JUUA 4NR1A 2PAMA 4I01A 3IM0A 1W6OB 2QZ2A 1RC6A 2D6LX 4WM8B 4LBNA 4DFSA 4PDWC 1AVBA 5KC5A 4LEJA 3RMYA 2ZMLA 3WV6A 1RUD1 1CAXB 3W58A 5I93A 4XF3A 5CBLA 2B46X 2MNGA 2HWF3 1UN1A 1LEMA 3LZZA 4D69A 2JE9A 5JLVA 5L7OA 4BZ4A 4AFDA 2K9ZA 2VUJA 4LUMA 2EF6A 3BU7A 4Y26A 4L8QA 4LNVA 1U12A 2LUWA 4BE3A 1SLLA 4C0HA 5C6CA 1N1TA 3WHUA 2DU1A 1RUC1 2R32A 2NM1A 1ZBE2 2YROA 1C28A 4XIKA 4D7TA 3VZOA 4PLMA 4FQZA 2HWC3 3R4DB 2WNUB 2XUMA 3ILFA 1RUF3 2VNGA 4NHKA 4RHV1 1RGSA 1YLLA 3H7YA 3BALA 2UWCA 1LHOA 5GLWA 3UL2A 4AE2A 3VBSC 1AZDA 4COYA 3JCIA 3MIFA 4AVSA 3VBUB 1F31A 1NOVA 1PIV1 1S1AA 3AMHA 1MZ5A 2VVDA 3ZN6A 4E4DX 2O8OA 1WCDJ 4AK3A 1A78A 4MGYE 5JZGC 1MZEA 2ZGPA 4XJWA 4CP2A 2YZ4A 2XHKA 1VBC3 4FTSA 3H1MA 5BPXA 1LESA 2D43A 5IK7A 4A7YA 1MS4A 4XJ8A 4XTMA 1H4GA 4N53A 5DZFA 5J09A 1DDLA 1M4WA 2DCJA 3UV9A 1U5YA 3BCWA 1QWRA 2ZCWA 3AKTA 1UPSA 2PYTA 4ISRA 1ZRDA 1DHKB 2O1QA 1YFYA 2A6YA 1GKBA 4LBOA 1XNCA 2PLV3 1NY71 1SQ4A 4CDUC 5BNPC 4RQPC 4L97A