3JD71

The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
270
structure length
270
Chain Sequence
GRVADTVGTGPTNSEAIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSVPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs.
pubmed doi rcsb
molecule tags Virus
total genus 32
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jd7100
1COV3 1H8TC 4CEYB 2RS51 5JZGA 4IV3C 4RR3A 1PO12 4WM8A 4FTSA 2WLPA 2R063 1NCRC 1GFF2 2R042 2HWD2 2PLV2 1NA1B 1R091 1RMU2 5BNNC 1HXS3 1AR72 4CEWC 1RUH2 1AR62 1K5MC 1QJY1 4YVWB 4SBVA 3VDDB 1POV1 1HRI3 1PO11 5K0UC 4CDQA 4Q4W1 1AR82 1D4M1 4Y5Z0 3VBOC 5CFDC 1AUYA 1RHI3 1RUC1 2R041 2HWD1 4IV3A 4JGYB 4N43B 2PLV1 2IZWA 3HAGA 1AL23 4PDWB 1ASJ1 1NCRA 1AR71 5C9AC 1AR61 1QJU2 1AR93 3J8F2 4N53C 5ABJC 1ZBA2 3JBG2 2RS33 1PIV3 5BNNA 1TME3 1ND3B 2R073 4CEWA 1AR81 1K5MA 1NG0A 4RQPB 4FSJA 5K0UA 1HRV2 3VBOA 5A32A 3JD73 1RUI2 4GMP3 4GB33 5CFDA 4GH4C 3J8F1 1X33A 2WS93 5D8AB 1ZBA1 3JBG1 5C4WB 2HWC3 2HWB1 5CFCC 5C9AA 2ZTNA 1C8M3 3LOBA 5DDJ3 2MEV3 4EJRA 1ZBE2 3CJIB 1HRV1 4IV1C 1RUI1 3ZFGC 1R083 2BBVA 1CD3G 4CDWC 5ACA3 2HWE3 1RMU3 1CJDA 1RUF2 1RUD2 4FTEA 1HQNA 5C8CC 1EAH2 4JGZC 1VAKA 3VBFC 2HWF2 4BCUA 5CFCA 1ZBE1 2R061 3VBSA 4QPIB 4AEDB 4CEYC 1FPN3 4CDXB 4RFT0 1RUJ2 4IV1A 1B35B 1OOPA 2XBO3 3ZFGA 1PVC3 1RUF1 1QJU3 1RUD1 1RVF2 1AYM3 2GH8A 4FTBA 1R092 1VBD2 1VBC2 3ZFEA 3ZFFB 3VBHB 4YVWC 3VDDC 1AYN2 1MQTC 1PO23 4JGZA 4Q4X2 2BFUL 1RUJ1 4Q4W2 3DPRC 1D4M2 4Q4V2 1V9U3 1MEC3 1FMD2 1TMF3 4Q4Y3 4YVSB 4RS5A 4GMP0 1RUC2 4QPGB 1ND2C 1C8NA 4N43C 1RVF1 1RUE2 4PDWC 5JZGB 1ASJ2 1VBD1 1FOD3 4RR3B 4WM8B 2RM23 1VBC1 4WM7B 1VB4A 1AYN1 4Q4X1 2RMU3 1HX6A 4CDUA 4Q4V1 4NWVA 3VDDA 1FMD1 1H8TA 1MQTA 2WFF3 4RQPC 1BBT2 2WS91 5FMOL 3DPRA 4RHV2 1RUE1 1WCDJ 5FOJB 5BNPB 1RUG2 1ND2A 1QQP3 1W39A 4N43A 5BNOC 1QJX2 5C4WC 3TN92 4PDWA 1BEV2 1VBE3 1R1A3 3VBUB 2HWB2 1VRH3 1NCRB 1VBA2 5A33A 3NAPC 1BBT1 1NCQC 1EV12 2RS53 2BFUS 2ZAHA 2RS12 4RHV1 1Z7S2 1RUG1 4RQPA 4CEWB 2RR12 4LLFA 1K5MB 1QJX1 1VBB2 1E57A 3TN91 1BEV1 2WZR2 4Y4YA 5K0UB 3VBRB 5AC92 3VBOB 4N53A 5A32B 5ABJA 1COV2 2FZ1A 5BNOA 5C4WA 1VBA1 5CFDB 1QJY3 2Y26A 1POV3 1EV11 2R062 2RS11 1PO13 4Z92B 4QPIC 1Z7S1 4AEDC 3NAPA 1F2NA 1NCQA 2RR11 5FMOS 2R043 1AYM1 1RUC3 2HWD3 1VBB1 2PLV3 1HXS2 2WZR1 5AC91 1AR73 4GH4A 1COV1 1RUH3 1AR63 5L7OC 1HRI2 3ZXAC 1V9U1 3ZFFC 1MEC1 3VBHC 1AR83 1RHI2 2QQPA 1AL22 1HXS1 4QPIA 2RM21 4YVSC 1BMV2 1AR92 3VBSB 2FZ2A 2RS32 3J8F3 1NA1C 1PIV2 1ZBA3 3JBG3 1HRI1 4CDWA 1TME2 2R072 4WM8C 2HWB3 2X5IB 3FBMA 1OOPB 1OHFA 4WM7C 5C8CA 1RHI1 3ZFGB 5L7OA 3S6PA 1NOVA 1QJZA 3VBFA 3JD72 2GSYA 1AL21 3ZFFA 1F8VA 3VBHA 1HRV3 1RUI3 1PGL2 4CEYA 1BMV1 1AR91 3ZFEB 2WS92 4JGYC 2RS31 2XPJA 2HWC2 1PIV1 4JGZB 1TME1 5BNPC 2R071 5J96B 1C8M2 5DDJ2 1NA1A 2MEV2 4RS5B 3VBUC 1ND3C 3JD71 1POV0 1ZBE3 4GMP1 4GB31 4WM7A 1R082 4YVWA 1PGL1 1OPOA 2HWC1 5ACA2 2HWE2 4CDUB 4CDQB 3M8LA 4JGYA 1C8M1 5D8AC 5DDJ1 2ZZQA 1RUF3 1H8TB 1RUD3 1MQTB 2MEV1 1RB8G 1PGW2 1EAH3 5BNPA 4IV3B 3VBRC 2HWF3 3DPRB 1IHMA 1R081 2BUKA 1FPN2 3VBUA 1ND2B 1SMVA 1ND3A 3CJIC 3JB4C 1RUJ3 2XBO2 5ACA1 2HWE1 1RMU1 5BNNB 1PVC2 1RUH1 1AYM2 1A6CA 1M06G 5A33B 1RVF3 1PGW1 1R093 5J98B 1VBD3 1VBC3 3IDEA 5D8AA 1PO22 2DF7A 1AYN3 1FPN1 4Q4X3 3VBRA 1V9U2 1MEC2 1TMF2 2XBO1 4Q4W3 1D4M3 4Q4Y2 4Q4V3 2WWSA 1FMD3 1PVC1 5C9AB 1QJU1 4N53B 5ABJB 4CDXC 5BNOB 3CJIA 1B35C 1FOD2 1NY72 1RUE3 2RM22 1ASJ3 3VBSC 5GKAC 1X36A 1PO21 2RMU2 3NAPB 1NCQB 2BPA2 2X5IC 1TMF1 4Q4Y1 1OOPC 2WFF2 4GH4B 1BBT3 4RHV3 1FOD1 1NY71 5CFCB 4AEDA 1QQP2 1RUG3 3ZFEC 4QPGC 4NWWA 4CDXA 2TBVA 1VBE2 1R1A2 1QJX3 1B35A 2RMU1 3TN93 5JZGC 1BEV3 1VB2A 4RR3C 3JB8A 1VRH2 4IV1B 1AL0G 5LK7B 1DDLA 2WFF1 1VBA3 2RS52 4RS5C 2VQ0A 1EV13 2X5IA 2RS13 4GB32 4CDWB 1QQP1 1Z7S3 2RR13 1VBE1 5C8CB 1EAH1 1R1A1 5L7OB 1VBB3 2HWF1 3VBFB 4CDUC 2WZR3 4YVSA 4CDQC 1VRH1 4QPGA 5AC93 1QJY2
chains in the Genus database with same CATH superfamily
1WWYA 4E8DA 4OI2A 2PHXA 4CEYB 2RS51 4FQ4A 3BTYA 4BIOA 2BU9A 1WCQA 2OKXA 3IDAA 1ZRRA 4RR3A 2PHUA 2YDEA 3RYRA 3WDYA 4D0QA 3GBGA 5C3SA 5LCWL 2WLPA 3HQXA 1VMHA 4HL0A 4LEJA 2VZ1A 1TE1B 2CWMA 1NCRC 1DYOA 1GFF2 1SLAA 2QQKA 3SH5A 4BDVB 3V0AB 1GQPA 1RUOA 3OBAA 2A70A 3RYPA 1RJ7A 1WCSA 3POEA 2QQVA 2X10A 1HQWA 3AKRA 1O5LA 3WQ1A 3ZO0B 2OW4A 2Q8DA 1AR62 3I97A 2CL2A 5JOWA 1IKPA 5C5TA 4YVWB 4SBVA 1OF3A 3BGAA 1POV1 5F5CA 2G4IA 4UBGA 1ZYBA 4GULA 2P3JA 5FK7A 4CDQA 4Q4W1 1D4M1 2VZQA 5FPBA 3VBOC 4IESA 1JYTA 5SV5A 5T55A 3WDWA 3IPVB 3N9OA 5A7NA 1DGLA 4UW3A 4IW3A 2JG8B 4IV3A 5KHIA 3JXSA 3LEIA 5F3GA 4OMDA 1UWWA 2PLV1 4X6RB 5A3WA 4EWAA 2IZWA 4NPMA 1US3A 4PDWB 3H3ZA 5DAQA 3AX4A 5IVVA 3O1TA 1UY4A 2B46X 2WNUA 3SEPA 4BQ3A 2JJ6A 2QKDA 4H7MA 4CP2A 4MXWA 4TZDA 3HOBA 4QB2A 3O1VA 1AR93 5ANQA 3PVBB 1SLLA 1ZBA2 3JBG2 4FXKB 5GLVA 4AI2A 3WNPA 5HCAA 3VGIA 3VL8A 3MPPG 2B8MA 2OQ7A 4JDNA 1PNGA 5CEHA 3I2IA 3CLPA 3O1RA 2DU1A 1JHJA 2W1SA 4ATEA 4RL7A 4LKDA 2Q4SA 3CHXA 4A6OA 1F35A 3D6EA 1OT5A 5KHGA 3L9JT 1VRBA 3T3YA 4CU7A 5FRAA 3LSEA 3JD73 3UKTA 1RUI2 5C3PA 1UX7A 5CFDA 3MHZA 1BJQA 2VY0A 2VG9A 3PNAA 4D3WA 3ILRA 4DY3A 5IK4A 4E2GA 3PVOA 5BPXA 3M3QA 2LALA 4K40A 2GC1A 4ARYA 5JIUA 1GUIA 3AP5A 1NE6A 2C26A 4YGDA 3H9AA 1MZ5A 3RI8A 3MIEA 1FI2A 1S0DA 2Q30A 3RFRA 1C8M3 1X8EA 3ZYPA 4AFDA 3GDBA 2A73B 2FMDA 5KC6A 3H1MA 3HT2A 4Q8LA 1YHFA 1GP6A 5H9QA 5FWEA 3CJIB 1QOTA 3BALA 1HRV1 4IV1C 5AVAA 5KXEA 4MGSA 2WZEA 4YYOA 4RA0A 1S0CA 1RIRA 2Q0AA 3ES1A 1R083 4BIFA 3POSA 3O0XA 1H0BA 3FBYA 1UO9A 2N7GA 4E4HA 2ZCWA 1WA4A 4ARXA 1VPHA 4NRQA 3B7MA 1KS5A 4AFAA 1IPKA 1MACA 5FLHA 2HWE3 1RMU3 4PHZA 5ACA3 1CGPA 4OMCA 1Q56A 5LRRA 5DPNA 4ES8A 3LWCA 3NNFA 4MVTA 4QXHA 1EAH2 4XURA 3WUDA 1ONAA 2QQJA 4JGZC 4BCUA 5J3UA 2NYYA 4UYBA 3WHTA 1SPPA 3APBA 3C3VA 3QOPA 4A6SA 2ZA9A 1OQDA 2BGPA 1D2SA 1OLQA 4JC1A 1UXZA 4BWOA 2JD9A 3Q8FA 4LR4A 2VMGA 4LMFA 2VVDA 3VDCA 4DO0A 4AI0A 2YG0A 1ZZ8A 1K12A 1N1SA 2H6BA 1OOPA 2GU9A 2JICA 3POYA 4XZUG 5LA0A 1WW4A 3SNMA 5IK5A 1KXGA 1F9KA 1PGSA 3B9IA 3IAPA 1W9TA 2P3KA 2ZAAA 3I2JA 3PMEA 1YQ2A 4DY5A 2QVSB 1IQDC 5DUUA 3TNPB 3VBHB 4AI9A 4S2HA 1DGRN 3VDDC 3UL2A 1AYN2 5KWRA 1NYWA 2YU2A 3ZYGA 1PO23 4LE4A 2CHHA 2XKPA 4XOGA 4N90A 1RUJ1 2VH9A 1SLIA 4J1XA 1D4M2 4Q4W2 2RDSA 2JG9A 4Q4V2 2GNBA 1V9U3 4LBQD 5A7QA 1FMD2 1PHMA 1D2QA 3LFMA 2ZXQA 4YVSB 5FZ7A 4GMP0 2W94A 3CKHA 4QPGB 4NIHA 1C8NA 4N43C 1RVF1 5IATA 2BDRA 4RR3B 2PHRA 3SLIA 3SCGA 4URAA 2ERFA 3ZMNA 1GYKA 1W2TA 4I3GA 3RSJA 1OLME 4N9HA 2Y6HA 4LK6A 4YW6A 4LKSA 2ZX0A 3N7MA 4LHSA 4CDUA 5FZ6A 3NV3A 4OZOA 4CE8A 4M3CA 1HQLA 1JYXA 3V56A 3FC0A 4NWVA 2VL4A 1H8TA 4HT1T 4Y22B 1DGWX 4RQPC 3T2TA 3CU7A 1Q8SA 2JX9A 2WS91 4WV8A 3KB5A 1C1LA 3DPRA 4PCRA 2XLGA 5FMDA 3H8XA 2DCZA 1RUE1 3OBZA 5A7OA 4Q26A 4B1LA 4XAEA 4UXAA 4CCLA 3RI9A 1URXA 2VC9A 4W4ZA 3K77A 5GLWA 1Q5OA 1W39A 3TEWA 5BNOC 2CU5A 5C4WC 1GZCA 4YW5A 2RJLA 1QXPA 3L2HA 1HN1A 5JR7B 1DQ0A 4A41A 1KS4A 2ZZJA 4NAMA 4ZU7A 3O1SA 4H14A 5E8AA 3ETQA 1PZ7A 1VRH3 2G9FA 5BUVA 1MS1A 2J1RA 4YZ1A 4PIYA 2WNUB 3HVDA 4QHZA 1GOGA 4MXWB 3KMHA 1DU3D 1W2UA 2B42B 2Q1FA 2W08A 2ZAHA 1TNFA 3WG2A 4AHWA 4RHV1 3LEKA 3IIIA 2OX0A 1Z7S2 3NL1A 1RUG1 3H7JA 4EN8B 4O9EA 5DN2A 4M3CE 4CUBA 4NPRA 4LLFA 4CRQA 4IEOA 3SQOA 2YGLA 5B2GB 5J09A 1VBB2 3EBRA 2RE9A 4OULA 2WZR2 5FZHA 5A3OA 1J1TA 1ULFA 2JXAA 4N53A 2WWUA 5ABJA 3WF2A 4Y1ZA 1VBA1 5CFDB 3ZXDA 3TEYA 3SMHA 1EV11 4AHXA 3VHPA 2RDNA 5JXIA 4ZXKA 5C3RA 3PUHA 5F3EA 3O1PA 5F6KA 1JZ8A 4BISA 4LIUA 3MYXA 2JE9A 1V6IA 3I7DA 4NIIA 2DTWA 3OEBA 1F2NA 3NVCA 4KWLA 2VOVA 4YG3A 2R043 5FMOS 5FY4A 2UYBA 1W2NA 4OHXA 3OUHA 1JZ2A 3UETA 3AMQA 1CAUA 3AP9A 3RJ2X 1ZRFA 2X05A 3ZN5A 1H4HA 3BTAA 1AR73 4GH4A 4JV4A 1LNSA 4QQLA 4BLIA 4TN7A 1RUH3 4QAWA 5LRSA 3DN7A 2HJIA 4W8JA 1AR83 3NNLA 1J1LA 5FZGA 5DZEA 3I3BA 1ZM1A 3ZKYA 2WFPA 4GIQA 2O0OA 5I0UA 2HBUA 1O3TA 2E32A 2E7AA 3J9SA 3RZHA 3AB0A 4M4RA 3ILFA 1SPPB 5IFTA 5FYHA 3LCPA 4P5HA 4BOWA 5IJRA 3AMHA 3N7LA 4OCTA 3J8F3 4NOTA 1NA1C 5F3IA 5FZFA 1HRI1 3ZN6A 3C8XA 2YBKA 2R072 1JYWA 2FDJA 2JIJA 2VUJA 2X5IB 4K20A 5FYUA 3UGHA 1OOPB 3DECA 1OHFA 1GU3A 2DCYA 3NSTA 1RHI1 4DFSA 5C8CA 2BNOA 5L7OA 3S6PA 3BTXA 2Y6JA 3H0OA 2C6SA 1ZZCA 2JKBA 3VBFA 5C5UA 3OTFA 2XJTA 3ACLA 4AAXA 4CP0A 1JU3A 1AL21 3ZFFA 2VM9A 1Y43B 3ZXLA 4XABA 1NE4A 4YM1A 4MGTA 4E2SA 2IWGB 2WS92 3MIDA 4JGYC 1UZYA 1UZWA 4QM9A 5FPUA 5FY7A 1ZZBA 3T2PA 4AOCA 4MHUA 3U0ZA 1XNKA 2VE1A 2PHFA 2XQRA 1RGSA 5IT6A 3MI8A 2EXJA 1CWPA 2JG9B 2D43A 4A3ZA 5FQ0A 1GOHA 1SCSA 4BZ4A 4CCNA 2MEV2 3DV8A 2IC1A 3PUIA 4DXTA 1GWKA 1F15A 2BVVA 2D3RA 1QH7A 3VBUC 3BIEA 3AZVA 1ND3C 4CU6A 3T1LA 4GMP1 1KFUL 3ILNA 2ZOEB 4HN1A 4LO7A 5FBZA 3M2MA 3ZSKA 3B93A 3VZOA 1S0JA 1Q8VA 2W39A 5DZFA 2DCKA 3AZWA 2C0ZA 1AJKA 1YXWA 2WQ4A 3LFIA 4BQ1A 3DYPA 1F5JA 3KD4A 1WMXA 3KGZA 1IOAA 2HWC1 3ZXFA 2EICA 2WZ8A 5JPMB 1LU2A 1YJLA 2EIGA 3K4AA 1RYYA 4NJ4A 2QZ2A 5A80A 1W6MA 3LB9A 4CDUB 2ADDA 2WKKA 1YO8A 3OUJA 5EJ3A 1W3XA 4HONA 3CZUA 2XL9A 5D8AC 5DDJ1 2UURA 5F39A 5IYYA 1RUF3 1H8TB 1RUD3 1XNTA 1PGW2 5FZKA 2DWRA 2O1QA 5BNPA 4IEPA 3VBRC 2HWF3 3DPRB 5T5OA 1IHMA 4YW1A 2A6XA 3ZYBA 1KDMA 1W03A 3AP6A 2BUKA 4Y3OA 5CZKA 1BCXA 4PLOA 5KHHA 2ET1A 3P5BA 4I0AA 1AXYA 1SMVA 4ZS3A 3B69A 4ISQA 4BK4A 3JB4C 4JAAA 3ON7A 1G86A 2E26A 2RHPA 3O0WA 1QOSA 3AZYA 3I8TA 1O3SA 3NKGA 4KU7A 1W8OA 1OQ1A 4Q0QA 1HV1A 2JB8A 4XW3A 1A6CA 1M06G 2WO3A 3W59A 3EXUA 4IE6A 3U10A 1R093 3K3OA 2W95A 3THCA 4XF1A 1N1TA 4GXLA 4C1WA 3S7EA 5M0TA 2AREA 2YYOA 2W1WA 3D3AA 3SH4A 1ODNA 2QQOA 2RG4A 2VJXA 2XLFA 2DF7A 1JS9A 1FPN1 1JXNA 3DUIA 4FI9A 4HLTA 4OYUA 4KWUA 4AFCA 4BQ2A 1ULEA 1PK6A 4UI9L 1K5JA 3OEAA 3KT7A 1V6MA 1JYCA 4NPLA 2WWSA 4ASLA 1LECA 1QJU1 2PMWB 4N53B 1XSQA 3I54A 4AQTA 4CDXC 3KF3A 3KT1A 5ABJB 5JSRA 1FV2A 2WABA 1FOD2 2V4VA 1GP4A 1IQAA 2ZJCA 3HBZA 4Q1PA 1ASJ3 1QOOA 5JSPA 1ENQA 4OUMA 4L0PA 4G9SB 1X36A 1GANA 3VHNA 1LOEA 4FPKA 4YG0A 4CXYA 2AYHA 2V72A 3U78A 4LBKA 4HSLA 1GR3A 4BXSV 2UYAA 5LY2A 3LA3A 4FBFA 2WNVA 2ZPXA 4Q4Y1 1RJ8A 1CAUB 1ZVFA 3H8OA 2VCMA 2WAOA 3H7YA 2FDGA 1US2A 1NZCA 2O8OA 2XQXA 4GD4A 4GH4B 5CB7A 3THTA 3U07A 1BBT3 3QLQA 5C3QA 2D6LX 1JZ3A 1ZA4A 4FPFA 2VXJA 3BN6A 3I3MA 5CFCB 4L92A 3KVBA 1QQP2 5FBJA 4PT6A 3OB8A 3WEZA 3PLQA 5FXWA 1BXHA 5LEKA 4NWWA 4OLLA 5DUXA 3FWEA 2MPFA 3BYWA 2YHJA 1QJX3 1SFYA 1B35A 3I59A 3TN93 2Y6KA 1QXJA 5EWSA 3IMNA 1M4WA 2Q8OA 3HNBM 1WUVA 2ZMLA 3A0KA 1AL0G 4OI1A 3WF1A 1UZZA 4XUPA 2BW8A 1Y3TA 4GWIA 4RS5C 3S0MA 5IVJA 4PLMA 3BPZA 3P3PA 2JEMA 2XVGA 4B4RA 4CPBA 5FUNA 2D44A 3INAA 4OZXA 2Y33A 3AKTA 4JKKA 3GBWA 1KJLA 2LRPA 2EA7A 5FYSA 4Y5SA 3VKFC 1H8VA 4LBLA 2Y0OA 1S0FA 5FFOC 4GWNA 5KHJA 1V00A 1H2KA 2W52A 5FZOA 5FOBB 1VBE1 4ZY9A 4YPJA 5C8CB 5L7OB 4BHPA 3MW4A 3Q8AA 4F3JA 4QB1A 3VBFB 1J3PA 4PF1A 4OQ9A 2WDBA 1QJY2 1SBDA 4P9LA 5EHDA 1COV3 4D7SA 4YFZA 4HOOA 5JZGA 3LIGA 3ZIXA 1PO12 4WM8A 2XR4A 4XJUA 2FDHA 2BP6A 2A6VA 3RZGA 2QJVA 2R063 1A8MA 1W99A 3H8RA 3BVCA 1S0GA 2V5DA 2HWD2 2ZX4A 1XBFA 5HV0A 4DB5A 5FQ0B 2CGPA 3EHKA 5BNNC 1HXS3 2XKOA 3ACHA 3ZPYA 4P9IA 4BXFA 2QQMA 4B8EA 1K5MC 3GGLA 1KGYA 1UW8A 4XXAA 4B7KA 2Y60A 4FVVA 5EFUA 4DMIA 1CZTA 3ATGA 1OD3A 4TYSA 2ARCA 1J59A 4W6WA 5T5PA 5FYIA 1H1IA 3P3NA 4Y5Z0 2TUNA 2UY8A 2W46A 1UYXA 1BHGA 1W6MB 4HPKB 3NQHA 1AUYA 1LOAA 1RUC1 2WQ8A 1ODMA 3LZZA 5A1LA 3HJRA 4L2NA 3ZSMA 2BJSA 3ZX7A 5A70A 2Y0IA 1NCRA 4XEZA 3VD7A 2AH2A 2VZPA 2J7MA 4YZ5A 1I5PA 5C9AC 4F83A 1AR61 1KQRA 1QJU2 5LZ6A 4IE4A 3I2FA 3VD4A 1HV0A 2RS33 3WDVA 3FUQA 1PIV3 3SC7X 1OF4A 2DDUA 4BPZA 4QQ2A 1TME3 3WF3A 4MZUA 4KG8A 5C3OA 3OG2A 4XC9A 2NN8A 2JDPA 4QX7A 4AQ2A 1OKOA 2PAMA 3HBKA 5FZEA 3WP5A 2R7EB 4NROA 3FZ3A 2QQWA 4XUTA 2WA4A 3LDRA 3VBOA 4AE2A 3MBWA 5C70A 3O12A 4JRAA 2QQUA 2ZBJA 4YW3A 2ETEA 3LD8A 3RNSA 1WMEA 4FOWA 5FCCA 3THDA 2DBIA 3WQ0A 1ZBA1 3JBG1 5GM0A 3MF6A 5FZIA 2FCVA 3G7DA 3TBDA 1OBNA 3OD0A 3WNNA 1PK6B 4COUA 1F4HA 4YLZA 3UT0A 4JTOA 3WG4A 2WZPP 2AEZA 3ETPA 2PAEA 4F8AA 3ZYIB 2D6KA 3WLUA 4Y1VA 1UKGA 4ZU4A 3BKZA 2NMOA 1ZBE2 1F4AA 3I3DA 4JHTA 2WL1A 3IDBB 1RUI1 3RRDA 4KNCA 3ZFGC 4YGEA 2ZHLA 3WSOA 1NLSA 3J26N 3FN9A 5I0TA 2JWPA 3GZAA 1JZ4A 5T5JA 1HW5A 2GAUA 4M0NA 2XVKA 4CDWC 2OXBA 4HETA 5FZ0A 4YFWA 3OD4A 2WNVB 2GN3A 3JUUA 2NPIA 1HQNA 1Q43A 3VD5A 4CUGA 2FBEA 4IQPA 5JVVA 3PDQA 4ORFA 5EQUA 3TEZA 2VAUA 1VAKA 3F95A 3NNGA 1DZQA 1X8MA 4PF5A 3KV4A 3LKJA 4LBNA 1GZ9A 3PVEA 3QD6A 4QX8A 3ROUA 4QPIB 4Q29A 4CEYC 4NRPA 1JMUB 4WZCA 5LATA 3NKTA 3J7HA 3DKQA 2CGNA 3ACGA 2C9AA 4RFT0 1J3QA 3U4XA 4IV1A 1B35B 1OKQA 3I59B 3IMMA 2XBO3 1GOFA 3LEGA 4B4PA 1YFXA 1O59A 1W8FA 1PVC3 4QKBA 1AYM3 2GH8A 1V6KA 1SHWB 3W21A 3IBMA 3M70A 4Z2WA 1VBD2 3PTYA 3Q9OA 1XNAA 2GC0A 2YGMA 3T30A 1VBC2 2W2IA 2Z4FA 3ZFEA 4LBMA 4XUNA 4YVWC 4N7UA 3N9QA 3OYWA 4D94A 1MQTC 2HBTA 3O14A 5B4XA 4JGZA 4Q4X2 4XQDA 2BFUL 3LA7A 3RZMA 3ITQA 2VPVA 1AF9A 3WVJA 1HKDA 1AXKA 3LE0A 3CDZB 4PI0A 1TMF3 3OPWA 2VW1A 1BLZA 3DEMA 1RUC2 2R49A 2JG8C 1ND2C 4R52A 4JTNA 2AR6A 5KBFA 3ZPOA 4J1WA 2VXRA 4LOSA 5J36A 3TNQA 4PDWC 2NZ9A 4JKMA 5JZGB 4AVSA 4LJHA 1GNHA 4WM8B 2JE7A 4BA6A 4XFHA 4ZONA 2C1FA 1JYNA 4PJYA 4WVMB 2XXZA 4WM7B 1VB4A 1AYN1 1GWLA 4GA9A 4MHRA 1YLLA 5FZ4A 1UYZA 4A44A 2RMU3 1HX6A 4HKWA 1W2OA 3RS6A 3I49A 4IEYA 5FPVA 4BJ0A 3POIA 4Q4V1 4UFMA 4XTPA 3UGGA 4P14A 3VDDA 4A42A 1FMD1 1FAYA 2Y6GA 1H6YA 3W5NA 4YW7A 1LGNA 2WFF3 5L73A 5FXZA 4XACA 3I3QA 4YRDA 5F2SA 3GNEA 2XVLA 3HT1A 3KS7A 1WCDJ 4L99A 3AVSA 3M3IA 4XF9A 4XETA 4OHZA 3RWNA 5A6XA 2ZKLA 4CP9A 4LO8A 4PBPA 3X29B 3BOWA 4N43A 4NHMA 4U36A 3VL9A 3E6DA 5FZ8A 2DU0A 5T54A 1BEV2 1R1A3 4R9CA 4DRRA 4Q0SA 4UFLA 4DEVA 1YIPA 5FXXA 1QMJA 4C0HA 2WO7A 3E6BA 2R32A 1EPZA 1NCRB 5EJZB 1B09A 2VQAA 2Q5TA 3NAPC 1DGRA 2RS53 2IVIB 1FXZA 1WD3A 2RS12 3NV1A 4H2AA 4AG4A 2J1EA 4V2VA 5HCHA 2QDNA 2YPJA 1MVEA 1MPXA 4RQPA 1WMDA 1GWMA 2RR12 3GZEA 4UFKA 1W6QA 2ZEYA 2VTXA 5K9YA 5IW0A 1E57A 2H0VA 3HMYA 2W3JA 2DUPA 1EYBA 1O3QA 2UY9A 1CVNA 5AC92 1WCKA 3LDBA 3VBOB 5FPLA 5BNOA 2FZ1A 2J1VA 5C4WA 2VBPA 1ZRIA 1I3HA 2Y26A 1POV3 3CBNA 5F5AA 4PIZA 5J48A 2LTNA 4HXCA 3AC0A 1YJKA 4Z92B 4QKDA 4FP2A 5FUIA 4Q5OA 1YI7A 2ZX3A 1Z7S1 3ABZA 1NXMA 4QM8A 4XJ9A 4I3PA 4KH9A 3AZXA 3J4UH 1VBB1 2PLV3 4IL7A 5FY5A 1LJ7A 1POQA 4EYUA 1GNZA 2WZR1 3ELNA 4COWA 1KDKA 1YFWA 2ET7A 4LO5B 1IPSA 2XJVA 2V73A 1QDCA 5FR3A 1Y7BA 2DTYA 2CAVA 3RJRA 3I3EA 3CNAA 1V9U1 2XWBB 3VBHC 1V0AA 2EXIA 1CJPA 4UF0B 3FX3A 3AP7A 1RINA 1O4YA 2BERA 1UOJA 4G3YC 1LU1A 2AACA 3NO8A 4C8DA 3KCXA 4AAPA 3MIGA 4KI5M 4GJYA 4YVSC 1OVSA 1AR92 1BMV2 3MV01 1OLMA 1H1MA 1UOGA 2JDUA 2UWAA 4CPBD 5HXMA 2B5HA 4HK9A 5B4NA 4XF3A 1QDOA 3D5OA 1BK1A 4IE0A 5ERLA 4I02A 5GZGA 4NIDA 4A4AA 3AKSA 1Y9GA 3MFAA 2D97A 1O3RA 4ASMB 5E1RA 4RFRB 1JYVA 4FAGA 3RQ0A 1OUSA 2MNGA 2JB4A 4LBQB 4QX1A 3JD72 1A78A 1U5XA 2ZGPA 3WHUA 3ZR5A 1HRV3 1MVQA 1F5FA 3E6CC 3BUCA 1LCLA 2ENRA 1BVP1 4UAPA 1GICA 3HWJA 2PN5A 3ZFEB 5CIRA 4HMZA 1IS6A 1DIWA 1D0GA 3WP6A 5ANNA 5G04L 5FO8B 1Q3EA 4IXLA 4TTGA 4JGZB 2OS2A 2R071 1MZFA 1DCSA 1LHOA 1S4CA 1NLQA 2WWJA 4META 1C8M2 2G19A 4K7JA 4UWDA 4D7YA 4C91A 1DGWA 1NA1A 1W9WA 2WJSA 4HK8A 5T52A 3MEPA 3N7KA 4MGYE 5A6YA 3AYCA 2J1UA 5A1FA 4Y4RA 3MDPA 4LITA 1UU4A 4GB31 2EXKA 1R082 3DF0A 2WNUC 2RDRA 4MGKE 3CEWA 3TAYA 2A3WA 1F31A 5ISLA 3ZDVA 3ZMOA 3ACFA 4QX0A 5ACA2 2HWE2 4IGOA 3OGJA 5K4LA 1YIFA 1GSLA 2Z79A 3H3UA 2YFZA 3PJQA 4ZU5A 1J83A 1UF2C 2XJUA 4CDQB 4D8MA 4JGYA 2ZZQA 1VALA 4CU9A 3TB0A 1RB8G 2MEV1 3DGTA 1GV9A 5DZGA 4E4SA 4EN9B 2ZHKA 2E31A 4XDPA 4IV3B 4RD7A 3HN1A 5FO9B 2JDNA 2NQYA 2WC2A 5FPXA 3IB3A 3MF9A 4XBLA 1RC6A 1N3QA 1HB4A 5FK8A 5LBBA 5FKCA 4CP9B 3VBUA 5LEJA 3NJZA 1W0NA 1XE7A 4BQXA 1ND3A 1FX5A 3RG0A 4EN7B 1L3JA 1RUJ3 5IAXA 3K3NA 5G05L 2VU9A 4AGGA 1CX1A 3CO2A 1O91A 1JYIA 1YEWA 1RUH1 4AVCA 2PXJA 3WXPA 1JW6A 1WKYA 1CAXA 3AXEA 2VOTA 1RVF3 4XDQA 4MYEA 1PGW1 2AGSA 3FHAA 2AC1A 4KQ7A 3PVNA 4NAOA 3FLRA 1I5ZA 2MHFA 2WSVA 3IDEA 5D8AA 5CYYA 1PO22 2VZRA 2VMFA 1NKGA 3WW3A 4QXCA 4JZRA 1ULDA 5GZDA 4BE3A 1W6QB 4AEKA 4BMEA 1S2EA 3AMNA 3RPQA 3VBRA 1A34A 1SLTA 2ORZA 4TXWA 1V9U2 2NP0A 2ZX1A 4I0BA 2GMEA 2B9VA 1CN1A 2PQSA 4GKXA 1G9FA 5EP9A 4AFBA 1JZ6A 3EB7A 1RUNA 1CPNA 1WW5A 2DYCA 2VVEA 3T0BA 5BNOB 3KM5A 4C90A 5CKQA 2YPDA 4FOQA 3QACA 3WNKA 2Q8EA 1RUE3 1SDWA 4LK7A 4XJZA 2W91A 1H2NA 1UCXA 1HN0A 2ATFA 4P08A 2FCTA 1LEMA 4E2QA 1CZSA 4E27A 5GKAC 3K4ZA 3A22A 2Z42A 3O1UA 3TYJA 3MLLA 3PUAA 4QX3A 1JZ5A 1XYPA 1BYHA 1APNA 2VZUA 4P9YA 1JUIA 5JOXA 3NWKA 4MADA 2VQTA 2X5IC 3HD8B 4TLFA 2YC4A 1OOPC 2CAUA 3C7GA 2P17A 2BNNA 3D0SA 3ZXEA 4QPYA 5JXGA 3HR9A 4EE2A 3B01A 1JZ7A 4OI0A 3FJSA 4RHV3 1WLTA 1FOD1 4LO4B 1YNAA 2Z5WA 1QKQA 4UW6A 1W8NA 4AEDA 1RUG3 4XUOA 3T4VA 1JOBA 4FPLA 4CDXA 4KU8A 4X8NA 4QGMA 4I2OA 2Y6FA 5L9RA 4M00A 5JAXA 3WDUA 1V70A 4CCDA 5CISA 1REFA 1IS4A 2OA2A 5FAXA 3JB8A 3CF6E 1VRH2 4QPWA 5LK7B 5LBCA 1LR5A 3KV5A 2IXCA 4XBNA 1VBA3 4L97A 1RXGA 4CSWA 2VQ0A 4Y20A 3WNOA 1EV13 3WX5A 2D93A 1NX9A 4NHKA 4GB32 4QQPA 2W5FA 4YZ4A 4NO4A 4LOTA 5JI7A 2HEWF 3S30A 1QQP1 4OHVA 1UX6A 3V0BA 1H6XA 1K45A 5CKMA 5HPOA 4HN0A 4H55A 2HWF1 4IEQA 1QEXA 4CDUC 4L8QA 3BU0A 2BGOA 1MS5A 2OUJA 3MIFA 5HXVA 1WGPA 4AGRA 2X8KA 3AXDA 5BV6A 4MGIE 4NHYA 1H8TC 1QNWA 3AKPA 4K21A 3W9AA 2PAKA 1H9WA 2R6QA 1KJRA 4GALA 4FTSA 2P3YA 1NQJA 1R64A 2QUOA 4XIKA 4CCMA 3N4MA 2Z2SB 3KVAA 2V09A 2B4KA 1SFPA 2PQQA 3R4SA 1SLBA 1PM7A 3GHNA 2R042 3WG1A 4CA9A 4NR1A 2CSGA 2OPKA 3ASIA 4QDRA 2DUQA 5AVPA 2Y64A 2GN7A 3FHQA 2E33A 1NA1B 5DG2A 3KQ4B 1R091 3UK9A 3IKWA 1UY3A 5CA6A 2DVBA 1AR72 3K48A 2WN3A 2CV6A 3LAGA 4CEWC 1RUH2 3GHMA 5C71A 4M3CB 1QJY1 1W8UA 1JOPA 2KM2A 2P34A 4LBOA 1OLRA 1VAMA 2VZ3A 2WO1A 5E16A 3KCCA 1HRI3 1AX2A 2WUHA 4IERA 1PO11 5K0UC 4RN5A 4IDZA 1AR82 1E5HA 5F6LB 4HKLA 3T2QA 4BYYA 3POBA 4DPNA 3AL5A 3AMMA 1RHI3 4AZZA 4F7ZA 2HWD1 5HV4A 1WW6A 2GMPA 4FXGB 4JGYB 1WA6X 4IE5A 1ZX5A 1SBFA 2A3XA 4IGPA 1AL23 3AKQA 3UJQA 1ASJ1 1ULOA 3GJBA 3VHOA 4EN0A 4CUCA 4R9DA 3OSDA 4N53C 3J8F2 5ABJC 5A7WA 4YM3A 1DHKB 3BIWE 4ZZ8A 5A3UA 5BNNA 4S2GA 3S7IA 5FREA 1ND3B 2LW8A 5H9PA 1K5MA 1OC1A 4B3NA 2BBAA 2VOWA 5F3CA 2VTFA 4AI1A 2PHDA 2XJPA 1QJFA 3O0VA 2VECA 2BZDA 4YSFA 5A32A 1QU0A 2GH2A 4FFGA 4GMP3 1PZ9A 2WN2A 2R1DA 4AQSA 1CAWA 1OFNA 4GH4C 4QU1A 4OHWA 4P9JA 3ZSJA 1X33A 4LQRA 5D8AB 5FYBA 5FYZA 3SXWA 5HBAA 3T0AA 1YFYA 3THPA 2HWC3 1VR3A 1DQ2A 1MR5A 2HWB1 2JDHA 1UU6A 4BK5A 5CFCC 5KXDA 3RZKA 2VR4A 5C9AA 1UYYA 3WF4A 2Y8KA 1DYKA 1N3OA 3ZM8A 3ZR6A 4AFMA 2A7AA 1YCIA 4FPJA 4IGQA 1SACA 5DDJ3 3LOBA 1SFNA 2OQ6A 2WYFA 5LY1A 3V65A 4EJRA 1FNYA 4QGLA 3WW1A 2RDQA 2G9ZA 3EO6A 3WQBA 1ZREA 2EIBA 1DBNA 2GNTA 4Y26A 2VGDA 2O8QA 2XUMA 2OPWA 3AM2A 1P8JA 2GALA 2BBVA 5FP9A 5J1XA 1QNYA 1UOFA 3AYEA 4YZ2A 1CD3G 2EAAA 2XJRA 2WA3A 3BU7A 1S0IA 3VZJA 2WBKA 3H1WA 2GC3A 1WLCA 4Y1XA 3GBFA 1J3RA 5GZFA 4DZGA 1VMFA 3C7EA 4PLNA 1RUF2 1RUD2 4NE9A 4CZSA 4FTEA 5C8CC 4QKNA 1QGLA 3S5AA 1OQEA 3AMPA 4HVQA 3DYOA 3VBFC 2HWF2 3NJYA 4K8FA 3W20A 1OPMA 1ZBE1 2VBBA 2R061 3H42B 4FOVA 4MLOA 5FZAA 3RYKA 3VBSA 1ZRCA 3KT4A 2OUHA 3POFA 1T2XA 3B5LB 5C6CA 2ARBA 4AEDB 2I74A 2ES3A 2H0BA 2VOKA 2W0XA 4AI8A 4C0BA 1FPN3 1DG6A 4CDXB 2VW2A 4XFFA 2IVJA 1IS3A 1UY1A 4KG0A 4YG6A 3ZN6B 4E4DX 1OURA 3ZFGA 4MSVA 1UMHA 2DCTA 5DAPA 1YQ6A 1Z0HA 3VKMA 1UOBA 1QJU3 4LUMA 2Q8CA 5CG9A 1R092 2FDFA 5JR2A 3M7AA 5EIYB 4XFBA 2B45X 5C7GA 4Y20B 2XLAA 3WNMA 4RSUA 5DAVA 1DFQA 3ZFFB 4I0WB 4HBNA 3CIHA 2HH9A 2WLQA 4HG6B 2LM3A 5GLUA 5JLVA 2EIDA 1EP0A 3N9LA 4H7LA 1L7RA 5LBEA 2VNOA 3V0BB 4UBHA 3NMBA 4CU8A 1EY2A 3WUCA 1NAEA 5EV7A 3T2OA 2OZJA 2PA7A 4GZ9A 3NNMA 4KMQA 5JCTA 3SCFA 4IEZA 1HB2A 5FP8A 1MEC3 2C5DA 3MGUA 4Q4Y3 3AZZA 4MX3A 3LOIA 4RGGA 5BYNA 2VZSA 3MLJA 2X09A 5JI9A 3MUZ1 1DQ5A 4XILA 5DAWA 3UYJA 4LNVA 5TSWA 1PMIA 1ASJ2 4KBBA 1OVPA 2E63A 2YZ4A 1VBD1 2ZABA 2IFWA 3OGRA 2W9XA 5EYXA 2RM23 3F2ZA 3SHRA 1VBC1 4UFJA 1OMIA 2YC2A 2R16A 2YUEA 2F17A 1KITA 4Y1YA 4Q4X1 1A3KA 5JIAA 5FZDA 1DP0A 3WW2A 4CUAA 1E5RA 3AYDA 1GP5A 1YUDA 4ZXEA 3WINE 1S2KA 1XB9A 4ONUA 3DKWA 4W65A 5I8TA 3ZLIA 1J84A 1I9RA 1FATA 1MQTA 1YQ5A 4NUBA 5A7PA 1BBT2 3WP4A 4LHKA 5FMOL 5A3TA 1ENXA 5APAA 1IG0A 1LODA 5FLIA 1W9SA 4UT5A 5FOJB 5BNPB 2CNAA 2BOIA 2FCUA 1MS3A 1BKZA 2JG8A 1ND2A 3MW2A 2DFCA 4LKFA 5HCFA 1QJX2 3T09A 3OPZA 3TN92 1U0AA 4PDWA 5GALA 1VBE3 4AGVA 2HWB2 4Q0PA 5DQ0A 5LW9A 3B00A 5LB6A 1O8PA 3N3HA 2F4LA 4YNIA 2X29A 4O9GA 5FZLA 1JHNA 1PVXA 1SEFA 4EZ4A 1O7FA 1NCQC 1WZXA 4DINB 1JOJA 1W9YA 5A7WB 2ARAA 3KQRA 1XNDA 3B94A 4WZFA 3LPFA 5FY9A 1C28A 1IG3A 1XE0A 4X6QB 4XF4A 2VZOA 4KWJA 1K5MB 3N9NA 4QX2A 3WOGA 2K46A 1BEV1 3PIGA 1CPMA 3E5QA 1XYNA 2YU1A 5LA9A 2XL7A 4QB6A 5DUVA 3UESA 4INDA 3O7OA 1XSRA 1GLHA 2WNVC 5A32B 1COV2 3IM0A 4FFHA 4Q0VA 1LAJA 1WLWA 4HFSA 4Y5TA 5I8SA 3H50A 2R062 2RS11 4AVBA 4W6YA 2D6OX 4X8PA 4UW5A 1X82A 2D6NA 4QPIC 3I2OA 2ZX2A 1MS9A 4DIQA 3MZHA 3NAPA 4AVAA 4MG2A 2RR11 1AYM1 1RUC3 4ZHNA 3K75B 4JQTA 4H3WA 5I0SA 2CY6A 1H1AA 4ZS2A 1HXS2 4CTEA 4LHNA 4P9XA 4XF0A 5AC91 4OI4A 2G9GA 2BOJA 2OZ6A 2ZMKA 1U5IA 2QNKA 2XWJB 5LA2A 3ZIWA 5JOZA 2VMEA 3SKJE 1AR63 1RL3A 2BYVE 4ISRA 2VUAA 4DQAA 5EPAA 4KGGA 4S2FA 1TNRA 3BOPA 4COYA 5E89A 3W5MA 4LO6B 3ZYRA 2YC0A 4Y1UA 5FJHA 2RJ2A 2QQPA 2F4PA 1CESA 1WCUA 4EWEA 4Z8BA 4K1ZA 2DURA 3T0DA 4XDOA 4PI2A 3ZVXA 2BV4A 3MUY1 4Q8KA 5FP4A 4LHLA 1AX1A 3OBTA 4XFCA 3VBSB 3FUOA 1ALYA 2RS32 4LULA 1O5UA 5FMCA 1PIV2 1ZBA3 3JBG3 3IDCB 1TME2 3ACIA 2ZKNA 4AF9A 3USUA 4WM8C 3CMGA 3V64A 2C4XA 1DLCA 2VQUA 3FBMA 1X9TA 1L7QA 4WM7C 4FCAA 1NT0A 3ZFGB 4CP1A 3WY6A 1NOVA 1QJZA 1QWRA 4YZ3A 2SLIA 5CADA 4XAAA 5FZOB 4E9KA 3KZ4C 3IWZA 3VBHA 1UXXX 2PHLA 1RUI3 1PGL2 1W2AX 4I30A 1IS5A 1LOFC 1BMV1 1AR91 2VTXJ 2BWAA 2YY1A 5T5LA 4HSJA 2EALA 2CDOA 2WIIB 4FPOB 2ZGMA 4O7XA 4YARA 1G9DA 2QTWB 4XVHA 5FZMA 4CCJA 1LGCA 3BPSA 1IZ3A 4HANA 5H9RA 3HPNA 4IE7A 1XXNA 1SDDB 5A3MA 4W6XA 5IVFA 3OBRA 3WNXA 2K2SA 1E5IA 4BQWA 4XTMA 1D4VB 1ZA7A 3SKVA 5GLTA 1UY0A 4XJAA 5F5IA 5LASA 2SBAA 2FMYA 4I09A 5FLJA 3SH3A 1W8TA 3JD71 4HVRA 1G9AA 1C5HA 5EYYA 5I93A 1OI6A 1AX0A 4OFGA 4JQRA 1ULPA 1W6NA 3K51A 1OPOA 3SCHA 5IVEA 3I2DA 2XJSA 3KHCA 1S1AA 3DCQA 5D21A 4COVA 4Y22A 4NN0A 4QDSA 3M8LA 1C8M1 1HB1A 3EMRA 1MQTB 3G6JB 1C1FA 1XE8A 1EAH3 4YM2A 4AVVA 1Q8PA 1UPIA 4K6BA 4D6QA 3GYDA 5FMBA 4J6GA 3IT8A 4ASKA 2VZVA 1XNCA 5T3NA 2J1TA 2DCJA 3GZUC 1R081 1GBGA 3WQ7A 4CCOA 3T1MA 1ND2B 3OPTA 1J58A 4B29A 1SBEA 1W6OA 1PNFA 4D6RA 4DOUA 3CJIC 4E8CA 2XBO2 5ACA1 2VCCA 2HWE1 1RMU1 3OY8A 3Q8BA 4IEXA 3U1XA 2JKXA 4XUQA 1H2MA 5EZWA 1PVC2 4TLGA 2CYFA 1DLLA 2ZGQA 1AYM2 3E5XA 3LF7A 1IKQA 3WD5A 3ORJA 4B4QA 2IXHA 5AFEA 2KR2A 5J98B 3ALQA 2VUDA 3RMYA 4OHYA 4A2UA 4NIAA 3NV2A 1N3PA 1IPJA 2XONA 3POJA 1ZZ6A 5FP3A 5IHRA 1G9BA 1AYN3 5LWBA 4P9GA 2PYTA 3KSCA 3UKVA 2RV9A 4FPEA 1MS4A 4P9WA 1TMF2 2OIIA 4Q4W3 1D4M3 4V2WA 4BB3A 1DQ1A 4Q4V3 1AJOA 1DQ4A 1X50A 3FMGA 3N7JA 1FMD3 1AXZA 4LBJA 2VUCA 2OYZA 3K2OA 1W0OA 4YGBA 2ZGKA 1MZEA 4QD2A 1NY72 4Z07A 2VMCA 3PUSA 4XBQA 2WYSA 3PHMA 1UNBA 2FDIA 5FZBA 1X9PA 4GQ7A 3S5QA 1PO21 1AHSA 4Q27A 2BQPA 2RMU2 2G1MA 3NAPB 1W9FA 3ENRA 4FP3A 4HKOA 4WVZA 3ZXKA 1W05A 3QCWA 4EV0A 1HIXA 2ID4A 3C7FA 2WFF2 2E53A 4AI3A 2D3SA 2O14A 4QXKA 4GAZA 3DXUA 2GNDA 3POGA 3UNPA 3ZKUA 2A6YA 3N9MA 2F6BA 1TEIA 4XJ8A 2LS6A 4Y24A 1CX4A 1UD1A 3ZFEC 4CYDA 1CQ9A 4QPGC 1BK0A 4G4FA 1OD5A 1R1A2 3CL1A 5F9TA 3T08A 5C33A 5I0RA 3EYPA 5JXHA 3PUQA 1VB2A 3MFCA 1REEA 3FFQA 4RR3C 3R4DB 4XFIA 4DS0A 4FFFA 5KXBA 2OVUA 1SG3A 4IV1B 3FL7A 3CZJA 1OA2A 1DDLA 3QH7A 1QXRA 3KCYA 3LSDA 5FUPA 2RS52 3NRUA 1LULA 5A3LA 4N7IA 4O61A 4DUWA 1XU2A 5H9SA 5CKNA 2X5IA 5F5QA 1R1ZA 2RVAA 4JRLA 1Q8QA 3N36A 1LB2A 3I2KA 3MIBA 3USUB 1BZWA 3WCSA 1Z7S3 3N35A 1W06A 2WQZC 4QKFA 3PU3A 3A4UA 1SCRA 4FPGA 4JHZA 3WR0A 2J1SA 3HNMA 3OYWB 1VBB3 2VOXA 4RYDA 2WZR3 3AFKA 4CDQC 1VRH1 3UJOA 1XNBA 1UY2A 2JE8A 3AYAA 4BQ4A 1LTEA 4JCKA 2AUYA 2IFRA 4IV3C 4L9BA 3SEEA 1W6PA 5IUQA 4JDOA 4CCEA 1CIYA 2GDFA 2B39A 1LKNA 1G6NA 2QFEA 4QX5A 2VCBA 2PHTA 4A7KA 1G9CA 3PU8A 2E6VA 1DQ6A 3Q8CA 2PLV2 3ZOIA 5A7SA 4EWDA 4LT5A 1RMU2 1PZ8A 2D6PA 1NUKA 3KLSA 4QT6A 3TOJA 3VDBA 4UW4A 3BB6A 4IUGA 1ACCA 1C3HA 2ADEA 3R0RA 4LUKA 2A5ZA 3DL3A 1C57A 3VDDB 1W6NB 1AVBA 2A6ZA 2NLRA 4XPVA 2DVGA 1ZZ7A 1HLCA 5F1RA 4QQHA 3OUIA 1XJAA 2ZGSA 4CCKA 5E88A 3ES4A 2V4AA 4PIXA 4FPYA 2D98A 1W28A 1GZWA 3S57A 2R0FA 5CFDC 1I6XA 1JN2P 1DF0A 1IGOA 2BVBA 2R041 2W87A 4QQOA 4N43B 5T50A 4Y33A 1STMA 3NV4A 3HAGA 1W04A 2WINB 5FZ9A 3WDTA 5BNQA 3H1YA 3BODA 4NMIA 1AR71 3ZDSA 1VMJA 2NM1A 4DNYA 1N1YA 5K7PA 3GJAA 4D69A 4Z82A 2X53S 4UFHA 1TZOA 1DZRA 5FTTC 4JDMA 1W6OB 2A3YA 2R073 4Q0UA 1AR81 3VDAA 2HLEA 2C9KA 4CEWA 5K8SA 5JMOA 2GMMA 1NG0A 3NW4A 3OY8B 3R4UA 3RZJA 2VD7A 2D5HA 3WW4A 3VD9A 2EF6A 4RQPB 4M01A 4FSJA 1XU1A 5K0UA 4AW7A 4YW2A 4A3XA 2A6WA 1HRV2 4E4ZA 2VO5A 5EXOA 3RWKX 5A3NA 3R6SA 2RJKA 5I91A 4GB33 5DAXA 3VV1A 3OF1A 4MGQA 2YROA 1UIKA 3POWA 4NHLA 1FV3A 3E97A 2A75A 3J8F1 2WS93 4W50A 1YRZA 4XCBA 5C4WB 2E9QA 4EROA 4BH9A 2D3PA 2JD4A 1G7YA 1UPSA 1WBLA 3C2UA 4XHXA 3ECQA 1LOBA 2HEYF 5JDBA 5KXCA 3AVRA 4R9AA 4URTA 4AVTA 4DUXA 2ZTNA 3HIFA 3VHRA 4FO9A 2YFUA 1SLCA 2JIGA 2MEV3 4M0HA 2WT2A 4LA2A 3QBQA 4DXSA 1GZTA 1CAVA 2YBPA 4LA3A 1VIWB 4CVUA 1PM4A 1LHVA 1NXD1 2VMIA 3BCWA 2W47A 2YXSA 3EQEA 3DYMA 4GKYA 4BMBA 3K4DA 1HDKA 4OUSA 3WDXA 4WVWA 3H3LA 5JWPA 2GC2A 3ZYFA 2FD8A 3I2GA 2YMZA 4DEQA 2W92A 1ENSA 4IEUA 1KEXA 3MLKA 2GNMA 1UMIA 2P37A 3GALA 3ZSLA 1CJDA 3AJYA 2VNGA 3I4IA 3AK0A 2PELA 1UKRA 3OGSA 2QE3A 3GZTB 3WCRA 2QQIA 2CDPA 2WO2A 4U2AA 3LPGA 5CFCA 4P02B 4XJWA 4MH0E 4OVEA 3MO4A 4XFGA 2JG9C 1E5SA 4B7EA 1UQXA 5FY1A 3UKNA 1PMHX 3ZXGA 2VMDA 3C7HA 3RZZA 1O6UA 2P5BA 2PTMA 5FP7A 4YWAA 4CXWA 4XMAA 1RUJ2 5F7UA 2UU8A 3VKOA 2R0HA 5JOYA 4PQ9A 4MGZE 1GMMA 1O4TA 1SZBA 2E7QA 5FYVA 3VZLA 3FHIB 3MW3A 5FY8A 1RUF1 1RUD1 1RVF2 5A6ZA 3O5SA 4FTBA 1NLRA 2W1UA 5FV3A 4AYUA 2OT7A 2XMLA 3D82A 4XFAA 3ZSEA 1BQPA 1DYPA 3T4HB 3RGBA 1G8WA 4I01A 1ZRDA 4FT8A 4FPCA 1N47A 4R8HA 4FFIA 3K46A 4XMIA 2A1XA 4MXVA 1W90A 4D6SA 2BRTA 2EAKA 4O65A 5KC5A 2H6CA 3MIHA 1ENRA 1OFSA 1FT9A 1W8ZA 3ME2A 4GJZA 2D7FA 1WLDA 3DPRC 5KR7A 1S0EA 4S2DA 1GNYA 2KXLA 3C7OA 5LK5A 2JDYA 3TRSB 1SQ4A 4RS5A 4LLOA 1W8HA 3KWVA 4J25A 3TEXA 3BTZA 2LUWA 4LE3A 5JUVA 1OH4A 1XC6A 5BXXA 1RUE2 3P1IA 3B3QE 4AHYA 3NJVA 4GWJA 5F8PA 1FOD3 2E7TA 1W6PB 1YWKA 1YYNA 2PFWA 4XE9A 5GZCA 3URFA 4PBOA 5FZ3A 1GQHA 1JUHA 1U5YA 1VLNA 2PHWA 5GJ6A 1EUUA 5CU1A 3KV6A 3WV6A 1UZVA 5J7MA 5IVCA 4AEMA 1CZVA 2WNOA 1VJ2A 4COZA 4JVAA 5FKBA 1FYUA 1PX4A 5FPAA 3QH6A 1YI9A 2VW0A 5J37A 2P4EA 2UWCA 4SLIA 2WT0A 2IXLA 2ZEZA 4XXPA 2WR9A 2P3IA 2EXHA 5FJKA 2FDKA 1EUTA 4RHV2 1U5ZA 3EJKA 1CONA 5DABA 2XG3A 5FYYA 1RUG2 3GM8A 4HPKA 4UFIA 4A7YA 1QQP3 1GZWB 4R4ZA 4TWTA 1QJEA 4RGKA 2XHKA 3FLPA 2B7YA 3VBUB 1W8WA 1D0HA 1OH3A 3M3OA 2CTVA 2GZWA 5DG1A 1NQDA 3RMXA 4LTAA 2KA3A 4RGAA 1VBA2 2VCAA 5A33A 3OGGA 2EVXA 2BGCA 5A1AA 1AZDA 5FDBA 5JPNB 1BBT1 2Q1ZB 1EV12 2HEVF 2HYKA 3JCIA 2BFUS 4MV2A 4K8RB 1I1EA 2I45A 1O4ZA 1CAXB 1OA4A 5FPZA 1OA3A 3LEMA 4AL9A 3PMSA 1LGBA 2ZEXA 2XH6A 4CEWB 4XHBA 2P2KA 3JZVA 4EZHA 1QJX1 5AFBA 1YFUA 2D5FA 3RVHA 3U75A 2DVFA 4ZPIA 3TN91 1HJFA 3TWIA 2YBSA 1JODA 4CXXA 2CGOA 4Y4YA 4AHZA 5K0UB 3VBRB 1N1VA 3JQWA 4CCCA 3KF5A 5IK7A 4BLJA 3N9PA 4FQZA 4ITCA 5GLZA 1XYOA 1QJY3 1W3VA 2ORXA 3DXTA 2UWBA 5LBFA 1QY4A 3UGFA 3VZNA 4DXZA 4XZPA 4D7TA 5I8YA 1PO13 2P6HA 4K9SA 3KHBA 4Z1VA 4LPLA 2WNEA 1KRIA 1LOCA 4R9BA 5IAVA 4AEDC 1NCQA 1X7NA 1S55A 2AZ5A 1LOGA 2VBDA 2HWD3 3UV9A 2IXIA 5F32A 5JMCA 3O1OA 3IN9A 2WAAA 3J7MA 3VZKA 3U37A 2JDKA 2QQLA 1CAVB 4QXBA 1COV1 1VAVA 2L9LA 3GF6A 5L7OC 1HRI2 3BI3A 2C24A 1U12A 2ILMA 3A21A 4N9IA 3Q8EA 4ATFA 2VMHA 3ZXAC 3ZFFC 2Y34A 1MEC1 4LORA 5L9VA 2TNFA 4XYXA 2DVAA 4QWNA 1RHI2 2JDMA 4ET7A 3D8CA 5CAZA 2JENA 4P5YA 2XHNA 4XIOA 5BY5A 2WRAA 5CG8A 3FFZA 3LGRA 4AQ6A 4HVOA 1ST8A 1LHUA 1AL22 2EIEA 1Z78A 1TVGA 1HXS1 3CQOA 3GXUA 1Y9QA 3D0JA 1QF3A 4MOAA 4QPIA 2RM21 3M3CA 5F37A 3USSA 4OQ8A 1H30A 2V5YA 4ES9A 4QGNA 1V6NA 3PL0A 2J1AA 4ZKTB 2FZ2A 1MS8A 3OJBA 4C1XA 3OGVA 3J7NA 4M4PA 1QIQA 4CDWA 3M4FA 4QU2A 5DMYA 3J7LA 3IIAA 3HEIA 1V6LA 2HWB3 5FZ1A 1FNZA 3WNLA 2Q1MA 1KFXL 1V6OA 2BWCA 2ZGUA 4QMAA 4AXOA 1WW7A 4XCAA 1YC61 2JDZA 5FY0A 1JTZX 2GSYA 5HI0A 5D2AA 1F8VA 2CWSA 1V6JA 5IVYA 5FYTA 4CEYA 2IXKA 4TSVA 3JQXA 5SV8A 5IFPA 1PX3A 2XB6C 3JU9A 4K3UA 4YGCA 2AEYA 2RS31 5LA1A 3B9CA 2XPJA 3WP3A 2HWC2 4UOJA 1PIV1 2W1QA 4NVPA 4IEVA 1TME1 1Q8OA 3PURA 1WD4A 5BNPC 3V0AA 3ZXJA 3LQCA 2QZ3A 4JKLA 5J96B 2JECA 1UZ0A 2WT1A 5CNAA 5DDJ2 2I2SA 3KGLA 1JH5A 1C5IA 1VP6A 1S2BA 4NHXA 5IWFA 2A71A 1H2LA 4P00B 4RS5B 3SISA 1GQGA 5IVBA 4LIVA 4HZFA 3FE5A 1POV0 1JU4A 1XRUA 1ZBE3 2LROA 3H8UA 2IXJA 3ZN4A 1UN1A 2XUEA 3NNJA 4WVMA 2VVFA 3A7QA 3FLTA 4WM7A 4YVWA 2YB7A 1PGL1 2HYXA 1D7PM 2VULA 1W0PA 1GKBA 5C8WA 2FQPA 4IETA 2I07B 4Q1RA 2ZS6B 4QDQA 4KWKA 4R4XA 3LA2A 1K3IA 2Z69A 1UMZA 4XQWA 3WG3A 2W68A 3MPBA 1UL9A 3IPVA 1OSGA 4MUVA 4Z2AA 1LOFA 5L19A 1UU5A 5FIXA 2QQNA 3VLBB 4L11A 4NIGA 2BNMA 4M3CF 1TG7A 2KD7A 5F2WA 1ULGA 3D4KA 1K42A 2FHRA 3GCWA 1OUXA 1UAIA 2P1BA 4QHBA 1RITA 2QCSB 1PK6C 1C4RA 2XJQA 4FOYA 3AP4A 4WBBA 5D1IA 2VNRA 1TQ5A 1FPN2 2XGXA 1OXCA 3E1F1 3LIHA 4A7ZA 4GWMA 5FXVA 1YQ8A 1LHWA 2TEPA 1QH6A 3B02A 2D6MA 5DXDA 5FYMA 3VUOA 1YQCA 2HKXA 1HB3A 2QDRA 2DBNA 4Q2FA 1LEDA 1NZIA 5L9BA 3U14A 3I2HA 5BNNB 1LESA 2K0GA 3U11A 4AEJA 5A3PA 1UYPA 2J22A 2Y38A 2R1BA 4MO3M 4FPHA 3ZYHA 4YM0A 3E5UA 4ZZ5A 4WVVA 3PJYA 1Y9MA 1L7LA 1XQNA 4KGQA 5A33B 1O8SA 1CR7A 2ZGOA 5DUWA 2ZACA 2BEOA 3WT3A 1VBD3 3HNYM 3A23A 1VBC3 3WZ1A 1MS0A 1REDA 1UIJA 5JSOA 5IK8A 2ZGLA 3ST7A 4AWDA 3AL6A 1CAWB 3M1HA 4KL1A 4Q4X3 1LHNA 3ZYJB 4A45A 1LENA 5E6HA 1H9PA 1MEC2 1LRHA 1T6BX 2E51A 2XBO1 4Q4Y2 1S0BA 3SITA 5GZEA 2DFBA 2J42A 4FAHA 1PVC1 1QHDA 5C9AB 1VE0A 3O1MA 5JXJA 3VKNA 3CJIA 4BQ5A 1A8DA 2ZGRA 4EQVA 1KD7A 1WBFA 5A6QA 1B35C 3PIJA 2RM22 4NRMA 3A0NA 4AR2A 3VZMA 2VZTA 2DVDA 2BTVC 2WSUA 3VBSC 5KHKA 3NJXA 3OCPA 3AJZA 5CVRA 3AFGA 2GP5A 1XPWA 1NCQB 3MICA 5FZCA 1XOYA 2YV8A 1ULCA 3IZOA 3WF0A 1RTVA 4BU2A 2BPA2 4B1MA 2ZMNA 1TMF1 2GP3A 5CBLA 2XDVA 1ZNPA 3P6BA 2ARXA 2D40A 2R30A 4BM8A 5FYCA 1NY71 4UF0A 3RDIA 4DRVA 2P6CA 2VNVA 1ZZ9A 3OOXA 4YW4A 2DV9A 2AENA 4AK3A 1Y4WA 2TBVA 1VBE2 3CJXA 4BQYA 1JBCA 4EN6B 2QBXA 1BVVA 2JDAA 2RMU1 3M3EA 5JZGC 1CIWA 1BEV3 4DUVA 4V1PA 2ZHMA 3GCXA 3LDKA 2Y6LA 2B9UA 1T6GC 3U4SA 2IUWA 4K1YA 2WFF1 4QHOA 3PTRB 2XOMA 4N8MA 2NMNA 3RZLA 3HN3A 3MV11 1PMJX 3R05A 4XQ4A 5FO7B 5L36A 2RS13 3IAQA 4CDWB 4IEWA 1DZTA 3VD3A 1EPWA 5HCBA 2ZGNA 2ZGTA 5FWJA 5I0DA 1HJGA 2RR13 2DUOA 4LBQA 4LXLA 1WMFA 1H4GA 3HQUA 3VB9A 1EAH1 1MZ6A 1R1A1 2K9ZA 3KV9A 3L2YA 4JX0A 5EJ1B 3W58A 3HQRA 3VKLA 4DXRA 4YVSA 4KBZA 1RXFA 4OUEA 3VN4A 2ZHNA 4PQQA 4QPGA 5AC93 2ZEWA 4LKEA 1JI6A
chains in the Genus database with same CATH topology
4OI2A 2PHXA 4CEYB 2RS51 4FQ4A 4BIOA 1ZRRA 4RR3A 2PHUA 2YDEA 3RYRA 3WDYA 3GBGA 2WLPA 3HQXA 4HL0A 4LEJA 1TE1B 2CWMA 1NCRC 1GFF2 1SLAA 1RUOA 3SH5A 3V0AB 2A70A 3RYPA 1RJ7A 1WCSA 1HQWA 3AKRA 1O5LA 3WQ1A 3ZO0B 2OW4A 1AR62 2CL2A 5JOWA 1IKPA 4YVWB 4SBVA 1POV1 2G4IA 4UBGA 1ZYBA 4GULA 2P3JA 4CDQA 4Q4W1 1D4M1 3VBOC 4IESA 5SV5A 5T55A 3WDWA 3IPVB 1DGLA 4UW3A 2JG8B 4IV3A 5KHIA 2PLV1 4X6RB 4EWAA 2IZWA 4PDWB 3H3ZA 3AX4A 2B46X 2WNUA 2JJ6A 2QKDA 4H7MA 4CP2A 4MXWA 4TZDA 1AR93 3PVBB 1SLLA 1ZBA2 3JBG2 4FXKB 5GLVA 4AI2A 5HCAA 3VGIA 3VL8A 3MPPG 2B8MA 4JDNA 1PNGA 3CLPA 2DU1A 4ATEA 4RL7A 2Q4SA 3D6EA 5KHGA 3L9JT 5FRAA 3LSEA 3JD73 3UKTA 1RUI2 5CFDA 1BJQA 2VY0A 2VG9A 3PNAA 4D3WA 3ILRA 4DY3A 5IK4A 4E2GA 3PVOA 5BPXA 3M3QA 2LALA 4K40A 2GC1A 5JIUA 3AP5A 1NE6A 4YGDA 3H9AA 1MZ5A 3RI8A 3MIEA 1FI2A 1S0DA 2Q30A 1C8M3 1X8EA 3ZYPA 4AFDA 2A73B 2FMDA 5KC6A 3H1MA 3HT2A 4Q8LA 1YHFA 5H9QA 3CJIB 1QOTA 3BALA 1HRV1 4IV1C 5AVAA 5KXEA 4YYOA 4RA0A 1S0CA 1RIRA 2Q0AA 3ES1A 1R083 4BIFA 3POSA 3O0XA 1H0BA 3FBYA 2N7GA 2ZCWA 1WA4A 3B7MA 1KS5A 4AFAA 1IPKA 1MACA 5FLHA 2HWE3 1RMU3 5ACA3 1CGPA 1Q56A 5LRRA 4ES8A 3LWCA 4MVTA 1EAH2 3WUDA 1ONAA 4JGZC 4BCUA 5J3UA 2NYYA 3WHTA 3APBA 3C3VA 3QOPA 2ZA9A 1OQDA 1D2SA 1OLQA 4JC1A 4BWOA 4LR4A 2VMGA 2VVDA 4AI0A 1ZZ8A 1N1SA 2GU9A 1OOPA 2H6BA 2JICA 3POYA 1WW4A 3SNMA 5IK5A 1KXGA 1F9KA 1PGSA 3B9IA 2P3KA 2ZAAA 3PMEA 4DY5A 2QVSB 5DUUA 3TNPB 3VBHB 4S2HA 1DGRN 3VDDC 3UL2A 1AYN2 5KWRA 1NYWA 3ZYGA 1PO23 4LE4A 2XKPA 4XOGA 4N90A 1RUJ1 2VH9A 1SLIA 4J1XA 1D4M2 4Q4W2 2JG9A 4Q4V2 2GNBA 1V9U3 4LBQD 1FMD2 1PHMA 1D2QA 4YVSB 4GMP0 4QPGB 1C8NA 4N43C 1RVF1 4RR3B 2PHRA 3SLIA 3SCGA 2ERFA 3ZMNA 1GYKA 4I3GA 3RSJA 4N9HA 2ZX0A 3N7MA 4CDUA 3NV3A 4M3CA 1HQLA 3V56A 3FC0A 4NWVA 1H8TA 4HT1T 4Y22B 1DGWX 4RQPC 3T2TA 3CU7A 1Q8SA 2JX9A 2WS91 4WV8A 3KB5A 1C1LA 3DPRA 4PCRA 2XLGA 2DCZA 1RUE1 4Q26A 4UXAA 3RI9A 1URXA 5GLWA 1Q5OA 1W39A 5BNOC 5C4WC 1GZCA 4YW5A 2RJLA 1QXPA 3L2HA 5JR7B 1DQ0A 1KS4A 2ZZJA 4ZU7A 4H14A 5E8AA 3ETQA 1PZ7A 1VRH3 2G9FA 5BUVA 1MS1A 4YZ1A 4PIYA 2WNUB 4MXWB 3KMHA 1DU3D 1W2UA 2B42B 2W08A 2ZAHA 4AHWA 1TNFA 3WG2A 4RHV1 1Z7S2 3NL1A 1RUG1 3H7JA 4EN8B 4O9EA 4M3CE 4NPRA 4LLFA 4CRQA 4IEOA 2YGLA 5B2GB 5J09A 1VBB2 3EBRA 2RE9A 4OULA 2WZR2 1J1TA 1ULFA 2JXAA 4N53A 5ABJA 4Y1ZA 1VBA1 5CFDB 3ZXDA 3SMHA 1EV11 4AHXA 3VHPA 4ZXKA 5F6KA 3MYXA 2JE9A 1V6IA 3I7DA 2DTWA 1F2NA 3NVCA 4KWLA 2VOVA 4YG3A 2R043 5FMOS 2UYBA 4OHXA 3AMQA 1CAUA 3AP9A 3RJ2X 1ZRFA 3ZN5A 1H4HA 3BTAA 1AR73 4GH4A 4JV4A 4QQLA 4BLIA 1RUH3 5LRSA 3DN7A 2HJIA 1AR83 1J1LA 5DZEA 1ZM1A 2WFPA 4GIQA 2O0OA 5I0UA 1O3TA 2E7AA 3J9SA 3AB0A 3ILFA 3LCPA 4P5HA 4BOWA 3AMHA 3N7LA 3J8F3 4NOTA 1NA1C 1HRI1 3ZN6A 2R072 2VUJA 4K20A 2X5IB 1OOPB 3NSTA 1OHFA 4DFSA 2DCYA 5C8CA 1RHI1 5L7OA 2BNOA 3S6PA 3H0OA 1ZZCA 2JKBA 3VBFA 3OTFA 2XJTA 3ACLA 4CP0A 1AL21 3ZFFA 1Y43B 3ZXLA 1NE4A 4YM1A 4E2SA 2IWGB 2WS92 3MIDA 4JGYC 1UZYA 4QM9A 1ZZBA 3U0ZA 1XNKA 2PHFA 5IT6A 1RGSA 3MI8A 2EXJA 2JG9B 2D43A 5FQ0A 1SCSA 4BZ4A 2MEV2 3DV8A 2IC1A 2BVVA 3VBUC 2D3RA 1QH7A 3AZVA 1ND3C 3T1LA 4GMP1 1KFUL 3ILNA 2ZOEB 4HN1A 4LO7A 5FBZA 3M2MA 3ZSKA 3B93A 3VZOA 1S0JA 1Q8VA 2W39A 5DZFA 2DCKA 3AZWA 2C0ZA 1AJKA 1YXWA 2WQ4A 4BQ1A 1F5JA 3KD4A 3KGZA 1IOAA 2HWC1 3ZXFA 5JPMB 1LU2A 1YJLA 2EIGA 2QZ2A 1W6MA 3LB9A 4CDUB 2WKKA 1YO8A 5EJ3A 2XL9A 5D8AC 5DDJ1 2UURA 1RUF3 1H8TB 1RUD3 1PGW2 2DWRA 2O1QA 5BNPA 4IEPA 3VBRC 2HWF3 3DPRB 5T5OA 1IHMA 4YW1A 2A6XA 1KDMA 3AP6A 2BUKA 1BCXA 4PLOA 5KHHA 2ET1A 4I0AA 1AXYA 1SMVA 3B69A 4ISQA 3JB4C 4JAAA 1G86A 2RHPA 3O0WA 1QOSA 3AZYA 3I8TA 1O3SA 3NKGA 4KU7A 1OQ1A 4Q0QA 1HV1A 4XW3A 1A6CA 1M06G 3W59A 3EXUA 3U10A 1R093 4XF1A 1N1TA 4GXLA 4C1WA 3S7EA 2AREA 2YYOA 3SH4A 2XLFA 2DF7A 1JXNA 1FPN1 3DUIA 4HLTA 4AFCA 1ULEA 1PK6A 3KT7A 1V6MA 1JYCA 2WWSA 4ASLA 1LECA 1QJU1 4N53B 5ABJB 3I54A 4AQTA 4CDXC 3KT1A 5JSRA 1FV2A 1FOD2 2ZJCA 3HBZA 1IQAA 4Q1PA 1ASJ3 1QOOA 5JSPA 1ENQA 4OUMA 4G9SB 1X36A 1GANA 3VHNA 1LOEA 4FPKA 4YG0A 2AYHA 4LBKA 4HSLA 1GR3A 2UYAA 3LA3A 4FBFA 2WNVA 2ZPXA 4Q4Y1 1RJ8A 1CAUB 1ZVFA 3H7YA 4GH4B 1NZCA 2O8OA 5CB7A 3THTA 3U07A 1BBT3 3QLQA 2D6LX 1ZA4A 4FPFA 5CFCB 4L92A 1QQP2 5LEKA 3PLQA 1BXHA 4NWWA 4OLLA 5DUXA 3FWEA 2MPFA 2YHJA 1QJX3 1SFYA 1B35A 3I59A 3TN93 1QXJA 5EWSA 3IMNA 1M4WA 2Q8OA 1WUVA 2ZMLA 3A0KA 1AL0G 4OI1A 1UZZA 2BW8A 1Y3TA 4RS5C 3S0MA 4PLMA 3BPZA 3P3PA 2JEMA 2XVGA 4B4RA 2D44A 3INAA 4OZXA 3AKTA 3GBWA 1KJLA 2EA7A 3VKFC 1H8VA 4LBLA 2Y0OA 1S0FA 5FFOC 4GWNA 5KHJA 1V00A 1H2KA 2W52A 5FOBB 1VBE1 5C8CB 5L7OB 4BHPA 3MW4A 4F3JA 3VBFB 1J3PA 1QJY2 1SBDA 4P9LA 1COV3 4D7SA 4YFZA 5JZGA 3ZIXA 1PO12 4WM8A 4XJUA 2A6VA 2QJVA 2R063 1A8MA 1S0GA 2ZX4A 2HWD2 4DB5A 5FQ0B 2CGPA 3EHKA 5BNNC 1HXS3 2XKOA 3ZPYA 4P9IA 4B8EA 1K5MC 1UW8A 4XXAA 4B7KA 4FVVA 5EFUA 4DMIA 3ATGA 4TYSA 1J59A 4W6WA 5T5PA 1H1IA 3P3NA 4Y5Z0 2TUNA 2UY8A 1W6MB 4HPKB 1AUYA 1LOAA 1RUC1 3LZZA 3ZSMA 4L2NA 3ZX7A 2Y0IA 1NCRA 4XEZA 2AH2A 4YZ5A 5C9AC 4F83A 1AR61 1KQRA 1QJU2 1HV0A 2RS33 3WDVA 3FUQA 1PIV3 4BPZA 4QQ2A 1TME3 4MZUA 4KG8A 2NN8A 4AQ2A 2PAMA 3WP5A 3FZ3A 2WA4A 4AE2A 3VBOA 3O12A 4JRAA 2ZBJA 4YW3A 2ETEA 3RNSA 1WMEA 4FOWA 5FCCA 3WQ0A 1ZBA1 3JBG1 5GM0A 3MF6A 3G7DA 3TBDA 3OD0A 4COUA 1PK6B 4YLZA 4JTOA 3WG4A 2WZPP 2PAEA 4F8AA 3ZYIB 2D6KA 3WLUA 4Y1VA 1UKGA 4ZU4A 2NMOA 1ZBE2 2WL1A 3IDBB 1RUI1 3RRDA 4KNCA 3ZFGC 4YGEA 2ZHLA 1NLSA 3J26N 5I0TA 3GZAA 5T5JA 1HW5A 2GAUA 4M0NA 2XVKA 4CDWC 4HETA 4YFWA 3OD4A 2WNVB 2GN3A 3JUUA 2NPIA 1HQNA 1Q43A 2FBEA 4IQPA 5JVVA 4ORFA 1VAKA 4PF5A 1DZQA 1X8MA 3LKJA 4LBNA 1GZ9A 3PVEA 3QD6A 3ROUA 4QPIB 4Q29A 4CEYC 4WZCA 3NKTA 3U4XA 2CGNA 4RFT0 2C9AA 1J3QA 4IV1A 1B35B 1OKQA 3I59B 2XBO3 4B4PA 1YFXA 1PVC3 1AYM3 2GH8A 1V6KA 3IBMA 3M70A 4Z2WA 1VBD2 3PTYA 3Q9OA 2GC0A 2YGMA 1VBC2 3ZFEA 4LBMA 4YVWC 4N7UA 3OYWA 4D94A 1MQTC 3O14A 4JGZA 4Q4X2 4XQDA 2BFUL 3LA7A 2VPVA 1AF9A 3WVJA 1HKDA 1AXKA 1TMF3 2VW1A 1RUC2 2R49A 2JG8C 1ND2C 4R52A 4JTNA 2AR6A 5KBFA 4J1WA 2VXRA 5J36A 3TNQA 4PDWC 2NZ9A 5JZGB 4AVSA 1GNHA 4WM8B 2JE7A 4XFHA 2C1FA 4PJYA 4WVMB 4WM7B 1VB4A 1AYN1 4GA9A 1YLLA 2RMU3 1HX6A 4HKWA 3RS6A 4IEYA 4Q4V1 4XTPA 4P14A 3VDDA 1FMD1 1FAYA 1LGNA 2WFF3 5L73A 4YRDA 3GNEA 2XVLA 3HT1A 3KS7A 1WCDJ 4L99A 3M3IA 4XF9A 4XETA 4OHZA 3RWNA 2ZKLA 4LO8A 4PBPA 3X29B 3BOWA 4N43A 4NHMA 4U36A 3VL9A 3E6DA 2DU0A 5T54A 1BEV2 1R1A3 4R9CA 4DRRA 4Q0SA 1YIPA 1QMJA 4C0HA 3E6BA 2R32A 1EPZA 1NCRB 1B09A 2VQAA 2Q5TA 3NAPC 1DGRA 2RS53 1FXZA 1WD3A 2RS12 3NV1A 4AG4A 2QDNA 2YPJA 1MVEA 4RQPA 1WMDA 2RR12 1W6QA 5K9YA 1E57A 2H0VA 3HMYA 2DUPA 1EYBA 1O3QA 2UY9A 1CVNA 5AC92 1WCKA 3VBOB 5BNOA 2FZ1A 5C4WA 1I3HA 2Y26A 1POV3 4PIZA 5J48A 2LTNA 1YJKA 4Z92B 4FP2A 1YI7A 2ZX3A 1Z7S1 1NXMA 4QM8A 4XJ9A 4I3PA 4KH9A 3AZXA 3J4UH 1VBB1 2PLV3 4IL7A 1LJ7A 1GNZA 2WZR1 3ELNA 4COWA 1KDKA 1YFWA 2ET7A 4LO5B 2XJVA 2V73A 1QDCA 1Y7BA 2DTYA 2CAVA 3RJRA 3CNAA 1V9U1 2XWBB 3VBHC 2EXIA 1CJPA 3FX3A 3AP7A 1RINA 1O4YA 4G3YC 1LU1A 3NO8A 3KCXA 3MIGA 4YVSC 1BMV2 1AR92 1H1MA 2UWAA 2B5HA 4HK9A 4XF3A 1QDOA 3D5OA 1BK1A 4I02A 5GZGA 3AKSA 3MFAA 2D97A 1O3RA 4ASMB 5E1RA 4FAGA 3RQ0A 2MNGA 4LBQB 3JD72 1A78A 1U5XA 2ZGPA 3WHUA 1HRV3 1MVQA 1F5FA 3E6CC 1LCLA 2ENRA 1BVP1 1GICA 3HWJA 2PN5A 3ZFEB 5CIRA 4HMZA 1IS6A 1DIWA 1D0GA 3WP6A 5FO8B 1Q3EA 4IXLA 4JGZB 2R071 1MZFA 1LHOA 4META 1C8M2 4K7JA 4D7YA 4C91A 1DGWA 1NA1A 2WJSA 4HK8A 5T52A 3MEPA 3N7KA 4MGYE 3AYCA 3MDPA 1UU4A 4GB31 2EXKA 1R082 3DF0A 2WNUC 4MGKE 3TAYA 3CEWA 2A3WA 1F31A 3ZMOA 5ACA2 2HWE2 3OGJA 1YIFA 1GSLA 2Z79A 3H3UA 3PJQA 4ZU5A 1UF2C 2XJUA 4CDQB 4JGYA 2ZZQA 1VALA 3TB0A 1RB8G 2MEV1 3DGTA 1GV9A 5DZGA 4E4SA 4EN9B 2ZHKA 4IV3B 4RD7A 3HN1A 5FO9B 5FPXA 2NQYA 2WC2A 4XBLA 3MF9A 1RC6A 1N3QA 5LEJA 3VBUA 3NJZA 1XE7A 4EN7B 1ND3A 1FX5A 3RG0A 1L3JA 1RUJ3 2VU9A 4AGGA 3CO2A 1O91A 1JYIA 1RUH1 4AVCA 3WXPA 1JW6A 1CAXA 3AXEA 1RVF3 4XDQA 4MYEA 1PGW1 2AGSA 4KQ7A 3PVNA 3FLRA 1I5ZA 2MHFA 2WSVA 3IDEA 5D8AA 1PO22 3WW3A 1ULDA 5GZDA 4BE3A 1W6QB 4AEKA 4BMEA 3VBRA 3AMNA 3RPQA 1SLTA 1V9U2 2NP0A 2ZX1A 4I0BA 2GMEA 4GKXA 1CN1A 4AFBA 1RUNA 1G9FA 1CPNA 1WW5A 2DYCA 2VVEA 5BNOB 3KM5A 4C90A 4FOQA 3QACA 1RUE3 1SDWA 4XJZA 1H2NA 1UCXA 2ATFA 1LEMA 4E2QA 4E27A 5GKAC 2Z42A 3TYJA 3MLLA 1XYPA 1BYHA 1APNA 4P9YA 1JUIA 5JOXA 3NWKA 2X5IC 3HD8B 4TLFA 1OOPC 2CAUA 2P17A 2BNNA 3D0SA 3ZXEA 4QPYA 3HR9A 3B01A 4OI0A 3FJSA 4RHV3 1WLTA 1FOD1 4LO4B 1YNAA 2Z5WA 1QKQA 4UW6A 4AEDA 1RUG3 4FPLA 4CDXA 4KU8A 4X8NA 4QGMA 4I2OA 4M00A 5JAXA 3WDUA 1V70A 1REFA 1IS4A 2OA2A 5FAXA 3JB8A 3CF6E 1VRH2 5LK7B 1LR5A 2IXCA 4XBNA 1VBA3 4L97A 2VQ0A 4Y20A 1EV13 3WX5A 2D93A 4NHKA 4GB32 4QQPA 4YZ4A 4NO4A 5JI7A 2HEWF 3S30A 1QQP1 4OHVA 1UX6A 3V0BA 4HN0A 4H55A 2HWF1 4IEQA 4CDUC 4L8QA 1MS5A 2OUJA 3MIFA 5HXVA 1WGPA 4AGRA 2X8KA 3AXDA 5BV6A 4MGIE 1H8TC 1QNWA 3AKPA 4K21A 3W9AA 2PAKA 1H9WA 2R6QA 1KJRA 4GALA 4FTSA 1NQJA 2QUOA 4XIKA 3N4MA 2Z2SB 2V09A 2PQQA 3R4SA 1SLBA 1PM7A 3GHNA 2R042 3WG1A 4NR1A 2OPKA 3ASIA 5AVPA 2DUQA 2GN7A 1NA1B 5DG2A 1R091 3UK9A 3IKWA 5CA6A 2DVBA 1AR72 3K48A 2CV6A 3LAGA 4CEWC 1RUH2 3GHMA 4M3CB 1QJY1 2KM2A 2P34A 4LBOA 1OLRA 1VAMA 5E16A 3KCCA 1HRI3 1AX2A 4IERA 1PO11 5K0UC 1AR82 5F6LB 4HKLA 4BYYA 4DPNA 3AMMA 1RHI3 4F7ZA 2HWD1 1WW6A 2GMPA 4FXGB 4JGYB 1ZX5A 1SBFA 2A3XA 1AL23 3AKQA 3UJQA 1ASJ1 3VHOA 4EN0A 4R9DA 4N53C 3J8F2 5ABJC 4YM3A 1DHKB 3BIWE 5BNNA 4S2GA 3S7IA 5FREA 1ND3B 5H9PA 1K5MA 4B3NA 2VOWA 4AI1A 2PHDA 2XJPA 3O0VA 2VECA 4YSFA 5A32A 1QU0A 2GH2A 4GMP3 1PZ9A 2R1DA 4AQSA 1CAWA 1OFNA 4GH4C 4OHWA 4P9JA 3ZSJA 1X33A 5D8AB 5HBAA 3SXWA 1YFYA 3THPA 2HWC3 1VR3A 1DQ2A 1MR5A 2HWB1 5CFCC 1UU6A 5KXDA 5C9AA 1DYKA 1N3OA 4AFMA 2A7AA 1YCIA 4FPJA 3LOBA 1SACA 5DDJ3 1SFNA 3V65A 4EJRA 1FNYA 4QGLA 3WW1A 3EO6A 1ZREA 2GNTA 1DBNA 4Y26A 2VGDA 2O8QA 2XUMA 3AM2A 2GALA 2BBVA 1QNYA 3AYEA 4YZ2A 1CD3G 2EAAA 2XJRA 2WA3A 3BU7A 1S0IA 3VZJA 3H1WA 2GC3A 1WLCA 4Y1XA 3GBFA 1J3RA 5GZFA 4DZGA 4PLNA 1RUF2 1RUD2 4CZSA 4FTEA 5C8CC 1QGLA 1OQEA 3AMPA 4HVQA 3VBFC 2HWF2 4K8FA 1OPMA 1ZBE1 2R061 4FOVA 4MLOA 3RYKA 3VBSA 1ZRCA 3KT4A 2OUHA 3B5LB 5C6CA 2ARBA 4AEDB 2I74A 2ES3A 2H0BA 2VOKA 2W0XA 4AI8A 4C0BA 1FPN3 1DG6A 4CDXB 2VW2A 4XFFA 4KG0A 1IS3A 4YG6A 3ZN6B 4E4DX 3ZFGA 4MSVA 2DCTA 1Z0HA 3VKMA 1QJU3 4LUMA 5CG9A 1R092 3M7AA 4XFBA 2B45X 4Y20B 2XLAA 4RSUA 3ZFFB 1DFQA 4I0WB 4HBNA 2WLQA 5GLUA 2LM3A 5JLVA 1EP0A 4H7LA 2VNOA 3V0BB 4UBHA 1EY2A 3WUCA 5EV7A 2OZJA 2PA7A 5JCTA 3SCFA 4IEZA 1MEC3 2C5DA 3MGUA 4Q4Y3 3AZZA 4MX3A 3LOIA 4RGGA 5BYNA 3MLJA 5JI9A 1DQ5A 4XILA 4LNVA 5TSWA 1PMIA 1ASJ2 4KBBA 2E63A 2ZABA 2YZ4A 1VBD1 2IFWA 5EYXA 2RM23 3SHRA 1VBC1 1OMIA 2R16A 2YUEA 1KITA 4Y1YA