3JD71

The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
270
structure length
270
Chain Sequence
GRVADTVGTGPTNSEAIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSVPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 32
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jd7100
4JGYB 2ZAHA 3JBG1 1MQTA 4Q4W1 5BNNA 1HRV1 2RM22 4Q4Y1 5FMOS 3ZXAC 2WS91 1RUG2 5ABJA 2FZ2A 4RFT0 1VRH1 3JBG3 1F2NA 1TME3 1AR61 4EJRA 5BNPA 3VDDB 2RMU3 1COV1 5K0UA 1C8M1 3ZFGA 2R061 1PVC1 4WM8B 5C8CB 2MEV1 1QQP3 4CEWB 2R072 5C9AC 3VBUA 3VBSB 2WFF2 1RHI3 2HWD2 2RS12 2RR13 2RMU2 4CDXC 3VBUC 4NWWA 1RVF3 1IHMA 1AR72 3HAGA 1EAH2 1MEC2 1FOD3 1PO22 5C4WC 2RS31 1AUYA 1RUG3 1VB2A 4QPGC 1FPN3 4RHV3 4JGZA 1RUH1 1R1A2 4GMP3 4Q4W2 2BBVA 3JD72 4RR3C 1AR91 4N53B 5D8AC 2HWB2 1QJU1 3JB4C 1R091 2X5IB 5BNOB 1NA1C 4CDXB 2XBO2 4Q4X3 4PDWB 1PGW2 1OOPA 3VBSC 1EV11 1FOD1 4GMP0 1CD3G 1RVF1 4CDWB 4CEWC 5L7OA 4IV1C 1C8NA 2RR11 1RHI1 5BNNC 1PVC2 5C8CC 2X5IC 4CEYA 1RUE1 1RUI2 1HRI1 1B35A 1HX6A 4RS5C 2RS11 2MEV3 3NAPB 5DDJ3 1HXS3 2R043 1RUC1 4JGZC 1NOVA 5ACA2 1B35C 4SBVA 4N43A 1VAKA 4FSJA 4YVSB 1PO23 4CDUA 1RUJ2 5CFCB 1TME1 1PO21 1K5MC 3VBRB 1RUC3 1AL22 4GH4A 1F8VA 5A33B 1VBA2 4Q4Y3 1PIV2 5GKAC 1VB4A 4WM7C 1R081 1HRI3 4Q4W3 2R042 1QQP2 3VBOB 1ZBE2 1CJDA 1ZBA2 2R071 4CEWA 5L7OC 1VBE3 5C4WA 2RM21 1H8TB 4JGYA 2RS52 2TBVA 1POV1 4GB33 3VBFB 4CDUB 5CFDA 3ZFFB 5JZGC 2WFF3 2XPJA 1TME2 1ND2C 5ACA3 2HWF2 1AR73 4WM8C 5ABJB 1AR62 1VBB2 1EV12 1D4M1 1AL23 1AYM3 4Q4V1 5K0UB 3VBHB 4GMP1 1ZBA1 5AC92 1SMVA 2WZR2 4RS5B 1NCRA 3JD73 1WCDJ 1H8TC 1X33A 3ZFGC 3DPRA 1VBC3 2HWB3 2HWB1 1ASJ2 1VBE2 1RUG1 1ZBE3 1AYN2 2RS33 4CDWC 3VBFC 2X5IA 3TN91 1RHI2 2HWD3 1FMD3 1D4M2 5FMOL 4LLFA 1POV0 5A32B 1FPN2 1AR82 2BUKA 1VBB3 4RHV2 1VBA3 5AC93 4FTEA 1PIV1 1RUF1 1RVF2 5CFDC 4CDWA 5FOJB 1PO13 1HRI2 4CDQB 4RQPC 5CFCA 2PLV1 1BEV3 1RMU3 4JGZB 1QJX2 4Y4YA 2DF7A 1QQP1 3VBOC 5ACA1 1RUE2 1RUI1 2RS53 2HWE1 2WFF1 1C8M3 4GB31 2RMU1 1AR83 1NCQC 2HWF3 1HXS2 4QPIC 4YVSC 1BBT3 1NG0A 1AR63 3VBRC 2GSYA 2RS32 1RUF2 1MQTB 1ND3C 3VDDC 1AYM2 3VBRA 3DPRB 4CEYC 2PLV2 3ZFEC 1C8M2 3NAPC 2WZR3 3CJIB 5J98B 2MEV2 3ZFGB 1AR92 5BNOC 5DDJ2 1BMV2 5C9AA 5BNPB 1R092 1HXS1 3S6PA 4RR3B 2RS51 1RUI3 4QPGA 1QJY3 5BNPC 5JZGB 1K5MA 2PLV3 1BBT2 1NY72 1PO11 4N53A 1RB8G 5ABJC 1RUF3 3ZFEB 1PIV3 1Z7S1 1VBA1 2HWC1 4WM7A 4AEDB 5AC91 1DDLA 1FMD1 3DPRC 1BEV2 2GH8A 1ND3B 1ASJ1 1ZBE1 4JGYC 1E57A 4GB32 4Q4Y2 4Q4X1 1AYN1 1V9U2 1NCRB 1VBC1 1R1A3 1NCQB 1R093 3TN92 4IV1A 3FBMA 1AR93 3ZFFA 5CFDB 1ZBA3 3J8F2 1PGL2 2XBO1 3CJIA 3M8LA 5A33A 3VBSA 1AYM1 1AL21 4CDXA 1R1A1 1D4M3 5C9AB 1FPN1 4RHV1 3CJIC 1TMF1 4RR3A 3VBHC 4WM8A 2HWE2 5BNNB 5D8AA 5C8CA 4N43C 1OOPB 2Y26A 1H8TA 3JBG2 1RMU2 1VBC2 1PGW1 1W39A 1POV3 4RS5A 1OOPC 2RM23 1VBE1 1QJZA 1VBD1 3VDDA 1EAH1 1MEC1 4QPIB 1NA1B 4CEYB 4Z92B 1R083 3J8F3 2QQPA 4NWVA 4YVWC 1PO12 1TMF2 1RUD2 4YVWA 1QJX3 4RQPB 4FTBA 1FMD2 4IV3B 1QJX1 2IZWA 2WZR1 5L7OB 3ZFEA 1VRH3 1QJU2 2R041 5DDJ1 1BMV1 1AL0G 2WS93 4QPIA 1NY71 2RS13 1HRV3 3J8F1 4Y5Z0 1RUE3 5A32A 1QJY2 4QPGB 4AEDC 1B35B 1MEC3 1EAH3 1FOD2 1VBD3 1BBT1 1K5MB 1PGL1 2HWF1 1R082 1AR81 4CDQC 4YVSA 4IV3A 2HWE3 2VQ0A 1Z7S2 1COV2 2HWC2 1RUD3 2BFUL 2WWSA 1EV13 4Q4X2 5K0UC 1GFF2 1RMU1 5LK7B 1BEV1 5BNOA 2BPA2 1TMF3 1A6CA 1ND3A 4BCUA 4PDWA 1VBD2 1QJU3 1V9U3 1VBB1 3NAPA 2WS92 2XBO3 1ND2B 1RUJ1 2HWD1 3TN93 4PDWC 1VRH2 4IV1B 4YVWB 2FZ1A 1RUH3 4RQPA 3VBHA 1MQTC 2R062 5JZGA 2ZTNA 3VBFA 2WLPA 3IDEA 1M06G 3LOBA 1AYN3 1OPOA 2BFUS 3JD71 1HQNA 1ASJ3 4WM7B 4AEDA 4CDUC 5J96B 1RUJ3 4N53C 5D8AB 4N43B 4Q4V3 1Z7S3 1V9U1 2HWC3 3VBOA 4CDQA 4GH4C 1HRV2 1RUC2 3JB8A 1X36A 4IV3C 5C4WB 3ZFFC 1NCRC 1NCQA 3VBUB 4GH4B 1AR71 1OHFA 1QJY1 1RUD1 1NA1A 1PVC3 2R063 4FTSA 5CFCC 1COV3 4Q4V2 1RUH2 2R073 2RR12 2ZZQA 1ND2A
chains in the Genus database with same CATH superfamily
4JGYB 3JBG1 1MS4A 4AAXA 3WG4A 1HQWA 2YXSA 1GNHA 4K6BA 4CPBA 5JPNB 4XVHA 1QDOA 2WNVC 5ANQA 4Q4Y1 3ENRA 2W39A 2CU5A 2JB8A 2V4AA 5FZCA 1KJRA 2LUWA 4YGBA 4UFJA 3AMMA 1RUG2 3CJXA 1VRH1 4ITCA 3U4SA 1RUNA 1GZCA 5IK8A 3POWA 4CPBD 1CX1A 2D6PA 4EJRA 2GC1A 4QKFA 1UY0A 1D2SA 1F5JA 2RMU3 1COV1 4LHLA 5K0UA 3FFZA 1Q43A 2CAVA 4K1ZA 4AF9A 5DUWA 3P3PA 4DMIA 4ET7A 2LRPA 3L2HA 1HKDA 2WNOA 1UXZA 5C8CB 1W9YA 2MEV1 3URFA 3D0SA 1NT0A 4GULA 4LITA 2K46A 1MR5A 4AGVA 3D0JA 1DZQA 3EO6A 5GZGA 5J37A 5FP9A 3QH7A 1XJAA 1Q8PA 3ZSKA 4N9IA 4P5HA 3VZLA 1QOSA 1UF2C 2Y6FA 5CZKA 1NE6A 2WFF2 2NMNA 4NR1A 1UKRA 1UWWA 1K5JA 4FFGA 4HN1A 4QGNA 2RR13 4CDXC 1T2XA 4NRMA 1W0OA 2JDZA 1AR72 1IHMA 5FUIA 1MEC2 3FLTA 4GXLA 4IGPA 2XMLA 3C7EA 1W2OA 4LBQA 3AK0A 1W9WA 2Q0AA 3I7DA 1RC6A 4GALA 4Q0QA 2VPVA 2SBAA 4HOOA 5FO9B 4QPGC 4E4HA 1U5ZA 3U07A 1ZRCA 2H0VA 2W2IA 4WZCA 4XZPA 2ZXQA 4JGZA 4MHRA 4AK3A 4C8DA 2P34A 2ZMNA 2WN2A 3AKQA 4UOJA 2VBDA 2GU9A 3MIGA 4GMP3 2ZS6B 3I59A 1EYBA 4N53B 5D8AC 1ZZ6A 1JYCA 5FP3A 2ZGMA 3JB4C 3MIFA 4YZ4A 4GWIA 5FZ1A 3ZOIA 4QX5A 2XLAA 4EZ4A 1Z78A 1NA1C 2JENA 2XBO2 3W5NA 3MIBA 5APAA 1W6MB 1PGW2 1IQDC 4YARA 2ARXA 3O1RA 3LDKA 1BZWA 1HDKA 1L7QA 4CUBA 3LSEA 1CR7A 1FOD1 3R4SA 2VOTA 3FHQA 4QQPA 5L7OA 3O1PA 4XF3A 2DUQA 4IV1C 3KT1A 1GBGA 5JUVA 2JIGA 2D6NA 5FPAA 2PXJA 4UW3A 4WV8A 4GKXA 5BNNC 5C8CC 4M3CA 1YI9A 2XJSA 4CCCA 5C3PA 1JZ8A 2ZCWA 2Q30A 1YXWA 4HMZA 1RUE1 4WVMB 1BJQA 5CYYA 1DP0A 4TXWA 1W9SA 3V0BB 1WLWA 2RS11 2MEV3 2F17A 2XHNA 2VMDA 3LA7A 2QZ2A 4KL1A 4LA2A 5JWPA 2W46A 4YZ5A 5A3LA 3ZVXA 2R043 4BPZA 5DZEA 2D3SA 1B35C 1ZX5A 5IJRA 4OI4A 5FY5A 4CDUA 4O65A 1U5YA 5E88A 4YM2A 5LATA 5KWRA 4HXCA 4N90A 5T5PA 5CFCB 4R9BA 4Q8LA 2D5FA 2Y34A 3IAQA 3VD4A 1VMHA 2VMGA 3VBRB 2RE9A 4V2WA 2VZ1A 2VR4A 3B3QE 1WUVA 3P3NA 1N3QA 4GH4A 3RWNA 3BTXA 1C4RA 5A33B 5FPXA 2EAAA 5FK8A 1OKQA 4Q4Y3 3RSJA 3FE5A 1VB4A 3POEA 4WM7C 4BK5A 1R081 3OPZA 2WT1A 3AMPA 1OF3A 3JCIA 4Q4W3 4XBNA 5AVAA 1VJ2A 5DMYA 1V6OA 3O14A 3RYPA 3MW3A 1SBEA 1RYYA 1ZBE2 2ZBJA 2EIEA 5DN2A 3W59A 3WF4A 5LZ6A 4LT5A 3AP9A 4BH9A 1CQ9A 2WO1A 1S4CA 4HK9A 3I2DA 4JGYA 2TBVA 1URXA 2ZEYA 3ZFFB 2GZWA 5F5AA 4CDUB 4UFKA 3MUZ1 2QUOA 4I0BA 3BPSA 3GJBA 3WQ7A 3HNBM 1CAXB 2PMWB 4XQ4A 3N4MA 1C28A 1NLQA 4JHTA 4X6RB 1EV12 2WNVA 2YV8A 4AI3A 3RQ0A 2QQUA 4BQ4A 1UY4A 1NXMA 5A70A 1D4M1 4UXAA 5GZCA 4NHKA 3RJ2X 3POFA 4YRDA 5T55A 2PYTA 1EPZA 4JC1A 4Q4V1 5JSRA 4ZS3A 2YPDA 2DU1A 1W04A 2P3JA 4P9XA 3B02A 3N9QA 4YZ2A 3IIIA 2WZ8A 3VKLA 1SHWB 2E7TA 5F2WA 4Y5TA 2UYAA 1SMVA 5TSWA 2XKOA 3SQOA 4UW4A 4RS5B 1N1VA 4DNYA 4P9JA 1NCRA 1WCDJ 2JEMA 2VNOA 2CV6A 4M00A 1VBC3 3OD0A 3ACLA 2MNGA 2JDAA 3FUOA 1ASJ2 1SLBA 1VBE2 1XU2A 2BP6A 5A3PA 1RUG1 1J3QA 1IKPA 1AZDA 1J1LA 2X29A 5KHKA 5C3RA 4IEQA 4OQ9A 3AC0A 3TN91 2HWD3 2W47A 4XILA 4KG8A 4LLFA 4ZU5A 1FPN2 3OYWA 1JYNA 1PMJX 1VBB3 5FCCA 3T3YA 3SEEA 1PIV1 1CESA 3B7MA 3LEIA 3POGA 3ZYHA 4OCTA 4AEKA 3ZYFA 4CDWA 5CFDC 4NHMA 1PO13 1QMJA 3K51A 4RQPC 5CFCA 1UKGA 1BVVA 2A70A 4AHWA 5T5LA 2RDQA 3L9JT 1BEV3 5DAXA 3LOIA 3PNAA 5FXVA 3IM0A 3R6SA 2DF7A 5ACA1 1RUE2 5A3NA 3AM2A 4PBOA 5DUUA 3ZYBA 1OQEA 3AXDA 3N9OA 5EXOA 3IKWA 3LDBA 3EQEA 1YFYA 4EWAA 3ETQA 4COWA 2C0ZA 5LRRA 3KGZA 4OHVA 1NCQC 4OI0A 1O4YA 4QPIC 3WG2A 3RMXA 2BGCA 4AI1A 1B09A 1AR63 4CP9B 1WLTA 5JOXA 5E6HA 2RS32 3RPQA 4OI1A 1RUF2 5SV8A 1WLDA 4COUA 5FDBA 1YYNA 2D7FA 1AYM2 2VZQA 3MIEA 3T2OA 1GSLA 4YGDA 3IAPA 2QQJA 2ZMKA 3GM8A 4EWEA 4IE6A 1WWYA 4MV2A 4LLOA 4M01A 2QQVA 1OA4A 1Y9QA 2YC0A 1O91A 4FPEA 3S30A 3ZFEC 3CJIB 3HJRA 4QQLA 4Q1RA 4NPMA 2VVDA 3ZFGB 3FLRA 2VZTA 3K3NA 5C9AA 1PZ9A 2EVXA 5IATA 5AVPA 3ZSLA 4DOUA 2WIIB 4RR3B 2I2SA 3AKTA 1JW6A 4MHUA 4QQHA 4YG3A 2NYYA 4HN0A 1QJY3 4YGCA 2EXJA 4QDQA 4S2FA 1O3TA 4Z82A 4Q2FA 3PU3A 2XUMA 1K5MA 1AVBA 3WNPA 1UOBA 5A7PA 2AGSA 2VUAA 2OXBA 5GLUA 3ILNA 2D44A 3I97A 3ZYRA 5CG9A 4Z1VA 2R1BA 3ZSJA 2JD4A 4N53A 5T3NA 3POSA 3D4KA 3GZTB 3LQCA 5ERLA 3O0VA 2ZHNA 3T09A 4AEDB 3DXTA 5IVJA 3SITA 2VBPA 3WP5A 3DPRC 1SFPA 4KH9A 1X82A 5BXXA 4R9DA 1BEV2 2R32A 4HANA 3RGBA 1UOGA 2AYHA 3WW2A 3ZKUA 5JIUA 3KQ4B 5FZOA 3LF7A 3J9SA 4JGYC 4NPRA 3BIEA 1E57A 4GB32 4Q4Y2 4Q4X1 1KRIA 1PNFA 2BW8A 2X10A 1VBC1 3APBA 4J1WA 1W0PA 1R1A3 4KWJA 2WKKA 5DG1A 1ZREA 2DBIA 4FFHA 3RYRA 5C6CA 5HV4A 1G86A 2I74A 2WR9A 3PHMA 4H55A 3DKWA 2XBO1 3DN7A 3WDVA 4FQZA 4A6OA 1QXPA 3M1HA 5CADA 3SH3A 5CG8A 3MIHA 2J1AA 1AL21 3RDIA 4CDXA 3GBGA 1R1A1 1D4M3 3MW4A 4OZOA 3S7IA 5IVEA 2GC2A 4RHV1 5HXVA 2YDEA 3NJYA 1CZVA 1XYNA 3SHRA 3TBDA 2Y6GA 3Q8FA 4U2AA 2CTVA 4MGKE 4NJ4A 5GZFA 3FMGA 2DCJA 1IG3A 2HH9A 3NVCA 4WM8A 2ZHMA 4DIQA 3VZMA 5KBFA 4QKDA 4QQOA 3LPFA 5A3WA 4QXHA 1H8TA 3HWJA 3JBG2 3NV3A 5K7PA 4YW3A 5LB6A 2A1XA 1FATA 3B94A 4YWAA 2XH6A 3RFRA 1HB4A 4RS5A 2Y33A 2RM23 1VBE1 3HPNA 2Q8DA 3WOGA 1QJZA 1XC6A 1NZCA 2VZUA 3KZ4C 5FPBA 1DZRA 4YW4A 5C33A 5JSOA 1W28A 1MEC1 1FXZA 5FZ0A 2CWMA 3DECA 4HONA 4A41A 1LOAA 2Y0IA 5FPLA 4AGGA 1JYTA 1FI2A 3WNMA 1R083 1ZZ9A 1GNYA 3BTYA 4O9EA 4IEYA 2QQPA 1JXNA 1Y4WA 4JKMA 5BUVA 4FFFA 2B7YA 4XUTA 3GF6A 3TEZA 1TMF2 2W5FA 5GM0A 3VUOA 3M3CA 5IFPA 3T2PA 1RUD2 1ZRIA 1OLQA 4YG6A 4YVWA 1UW8A 4EN0A 3WVJA 1QJX3 4N9HA 4RQPB 1FMD2 4D0QA 4FTBA 1Q5OA 2OPWA 2WUHA 4IV3B 4O9GA 4E2SA 2OW4A 2WN3A 2WZR1 4TZDA 4IEVA 1H1IA 4K3UA 4M3CE 3HQRA 4XBQA 3ZFEA 5CISA 4IL7A 1QJU2 1SPPA 4OMCA 4ATFA 1SACA 2NZ9A 5A6QA 1AL0G 1H2LA 1HN1A 1QH6A 1WMFA 2WS93 3MICA 4QPIA 2RS13 1SCSA 3F2ZA 5FRAA 1FV2A 1HRV3 4AEJA 2VNGA 1BVP1 2VUDA 4JRAA 1FX5A 1PX4A 1ONAA 1SBFA 3OPWA 2RG4A 4FPOB 3WEZA 5JLVA 1WW6A 3F95A 1EY2A 3WW1A 4GJZA 5JR7B 3WW4A 1W8NA 1PMHX 2P3YA 4LKSA 2HWF1 1R082 4JDOA 2VULA 1OURA 1UMZA 4OQ8A 1OA3A 2HLEA 4PIZA 4PQQA 3AMHA 1PK6A 4Y3OA 1HJFA 4IV3A 1Q8OA 4YVSA 2XUEA 5FP7A 4BLIA 2BFUL 2WWSA 4XTMA 2R16A 2WFPA 1GFF2 2VTFA 3MYXA 2L9LA 2BPA2 4W6WA 3O5SA 4NHYA 1PK6C 2VNVA 3KHCA 5I8YA 1W6MA 3GDBA 1KDKA 5JI9A 4XFBA 5CAZA 5K9YA 3AVRA 4GKYA 5FBJA 4AOCA 1VBB1 3KB5A 3NAPA 3HNYM 4YW2A 2JJ6A 4DFSA 1ND2B 1RUJ1 3TN93 1VRH2 1OXCA 1WW4A 2LW8A 4MSVA 4PT6A 1H4GA 1MQTC 4EZHA 3OPTA 2R062 1E5IA 3FHIB 3HBKA 5T5OA 1UOFA 3TRSB 2CGNA 4J1XA 3VBFA 1W3VA 3CHXA 5FYSA 3S7EA 2BNOA 1AYN3 5FZFA 3KCYA 2HEWF 2PQQA 2NLRA 1IOAA 1S0GA 1A8MA 1T6BX 2BFUS 2E7QA 1JOBA 3GYDA 4Y26A 4FPKA 3WHUA 4D8MA 1YQ5A 4WM7B 4GWNA 4LKFA 4CDUC 4CP9A 5J96B 1RUJ3 4N53C 2C5DA 5D8AB 2ETEA 3LZZA 4JDMA 4YM1A 2O1QA 4N43B 4Q4V3 1NAEA 5FZAA 4UF0A 4CU8A 1DLCA 2Q1FA 2XDVA 4RD7A 5C4WB 4KWUA 4Q0VA 5FXWA 3ZFFC 4HG6B 3FN9A 5K8SA 3KWVA 5H9SA 3JQWA 5GLVA 4OHWA 4CXXA 4K7JA 1NCRC 3OGRA 4J25A 5J09A 3PUHA 1W9TA 4L11A 4PIXA 2F6BA 4MXWB 1CVNA 3ZIXA 2P1BA 4HVRA 3N35A 3LIHA 3AXEA 1PVC3 1GQGA 2ZMLA 2OUHA 5FZMA 4H2AA 3U11A 2BGOA 3WNKA 2HBTA 5I0SA 2WAOA 5KHJA 4GJYA 3ZSEA 4CU9A 2ZZQA 1OVSA 1UIKA 3M3QA 5I8TA 2G1MA 3PVEA 2VH9A 2DUPA 2VQTA 1UX6A 2D6KA 4AVVA 2Z5WA 1S0JA 5C71A 1UOJA 3NKTA 5F6LB 1HRV1 1LHWA 4I0WB 4QHZA 3E5UA 5DXDA 1LOEA 3OBAA 3O12A 2W87A 5FZGA 4DUWA 4TLGA 1LOFC 3IPVB 3VZNA 5ABJA 5EFUA 2FZ2A 3LWCA 4YLZA 2BNNA 4B4RA 5LWBA 1CN1A 3A22A 3OOXA 1IS6A 1TME3 2FDKA 1AR61 1DQ1A 2DFCA 2VO5A 1PM4A 5FZ9A 3TYJA 3OBTA 2JDUA 3I3QA 1PVC1 3AYDA 3USUA 3AZXA 2OS2A 1CAWA 3LEGA 4JDNA 3RVHA 1P8JA 1YJKA 2JD9A 4IEZA 5IYYA 1CZSA 2H6CA 2Y8KA 1JZ5A 2PN5A 1QOTA 2R30A 5HCFA 3OGJA 3WNXA 3KV5A 3HT2A 1GWLA 5A7QA 1DF0A 1T6GC 3I2GA 1JOJA 5FZIA 4LO5B 1GMMA 3AKRA 4UI9L 1F15A 4QPWA 3VBSB 1GQPA 1RHI3 4B7KA 4XCBA 3USSA 1LESA 2EXIA 2XKPA 3H8XA 1YNAA 1GOHA 2YFUA 4JTNA 3VBUC 2JDKA 2ARAA 5JIAA 1VPHA 2WNVB 1SEFA 1U12A 4XF0A 1NUKA 5C4WC 4UFMA 3RG0A 2QZ3A 3LE0A 3A4UA 1AUYA 4XYXA 1S0CA 1CAWB 1VB2A 1XNCA 2P3KA 2WSVA 4WBBA 5JI7A 3WF3A 5LA9A 2JXAA 2BOJA 2G9GA 5FYMA 4FAHA 4BIOA 5EV7A 2CY6A 1LOGA 3I3DA 4Q4W2 2J1RA 3JD72 2C1FA 3WNNA 4RR3C 2PHRA 3U78A 4OI2A 5F9TA 1DG6A 3E6CC 2QQOA 4IE4A 1R091 1UCXA 5FUNA 3ELNA 3CBNA 3ZIWA 3UJQA 4H7MA 4P08A 3POIA 4INDA 1OOPA 1V6IA 4BMBA 4XJWA 2AACA 2VC9A 1O6UA 2BZDA 5A7SA 4W8JA 5E16A 3WNLA 3BI3A 1QNWA 5D21A 4LMFA 2RDNA 1D7PM 3AVSA 5IHRA 2JDPA 3J26N 4LXLA 1XSRA 4TYSA 1NZIA 3PUAA 1EPWA 1TEIA 2BVVA 1C8NA 4ISQA 2RR11 4F8AA 4S2GA 1LU2A 3RI8A 1QIQA 4Y22B 1PVC2 3NMBA 4Z2AA 1VMJA 2VCCA 2X5IC 3THDA 1C3HA 3AZYA 3EMRA 2WNUB 3WDYA 3GZUC 4YGEA 1DGWX 3BKZA 2O0OA 2DCYA 4MVTA 4B7EA 2KA3A 2W94A 3ZXFA 5F7UA 1AX2A 2V73A 1B35A 1HX6A 1EUUA 5KR7A 2XGXA 4YW7A 2P37A 3C7FA 3WZ1A 2WA4A 1SZBA 5DDJ3 2FDJA 4FPCA 3WG1A 1HXS3 2XQXA 2OVUA 4RYDA 1YLLA 3AP6A 3GGLA 1NOVA 3NNMA 1LULA 4N43A 5KHIA 5LW9A 1PO23 2PHWA 3HMYA 3AYAA 5F6KA 2B4KA 4KI5M 5GZDA 3MEPA 3PIJA 4DINB 1W8HA 1TME1 3CLPA 1A78A 4M3CF 3VZOA 1PO21 1IS4A 1DCSA 3KT4A 3PVBB 1ALYA 2VMIA 3BODA 4QT6A 3ZR5A 4CP1A 4DB5A 4DO0A 1RUC3 4XUOA 4BISA 4XUNA 3CNAA 4MXWA 1UPSA 1VBA2 3KQRA 4CVUA 3O0XA 2JE7A 4CA9A 1PIV2 3ZN6B 4P02B 1TQ5A 1YQ8A 1MPXA 4PF1A 1TVGA 4MO3M 3RZGA 4MXVA 2QBXA 2R042 1J59A 4OHZA 5A3UA 4A3XA 1UYYA 2VQAA 3H9AA 4XPVA 2FMYA 3A7QA 4LO8A 4ZY9A 2WWUA 4PBPA 1NLSA 3DYOA 4FI9A 4CCMA 1CJDA 2WO3A 4V1PA 1WLCA 4K8RB 2BWAA 4NIIA 2JE8A 4MLOA 1MS8A 2RM21 4D7TA 4JQRA 2EIGA 2YFZA 1OLME 2JG8C 4QGMA 2ZGLA 4XFGA 2G9FA 2GNBA 4AEMA 2ZX1A 4BLJA 3O1TA 3E5XA 2UU8A 3PIGA 3K4AA 3ACIA 5FKCA 4CXWA 4MADA 4XHXA 4FVVA 3WY6A 1F4AA 3ZO0B 1AR73 4IESA 4WM8C 5ABJB 5F3CA 2BGPA 2WT0A 5F39A 4KG0A 3ZX7A 4BQWA 4I02A 1W9FA 2ET1A 2N7GA 2OZJA 2Z79A 4LBKA 2VMEA 2VCMA 1FT9A 1TNFA 1U0AA 3T0BA 2VAUA 1AL23 3ZXJA 2QQMA 1W8UA 5HXMA 5DAQA 4ZU4A 5FO7B 5FZBA 3WLUA 3TNPB 5T54A 3VBHB 3WQ0A 4CCJA 3H8UA 1UZYA 1ZBA1 4GMP1 2E9QA 4HFSA 3OG2A 3KLSA 2VTXJ 4AQSA 2FCTA 1OQDA 3ETPA 1UX7A 1X7NA 1ENXA 4QX0A 3MPBA 3VLBB 4LKEA 1LB2A 2BJSA 4URAA 2PHXA 3IBMA 2FDFA 4UT5A 5D2AA 2HWB3 4XFHA 4QXKA 5FAXA 2R6QA 2PQSA 2VVFA 3CQOA 4NHLA 2IXIA 4A45A 4EN9B 2XL9A 2C6SA 4XFCA 1DGRN 2D93A 4XACA 4CTEA 4XMIA 2H0BA 2RS33 3J7NA 3IMNA 2QKDA 4CDWC 5EIYB 5B2GB 3SH5A 4LE4A 1FMD3 2YGMA 4HT1T 3MFAA 1SDWA 4EN7B 2ZA9A 1POV0 2SLIA 4RHV2 1AR82 1VBA3 4O61A 3KMHA 1DHKB 1RVF2 4LOSA 1DLLA 5FOJB 1HRI2 1WMDA 4AZZA 1OPMA 2EXKA 3OY8B 2HBUA 1F31A 2VZRA 1X9PA 4DY5A 5M0TA 2PLV1 3N7JA 1N1SA 3N7KA 1RMU3 4Y4YA 4BA6A 2VQUA 1QQP1 3BN6A 2PHFA 3BTZA 2G9ZA 2RS53 4FPFA 2HWE1 1ULGA 3OGVA 2B39A 4Q0UA 3K77A 1WBFA 1Q8SA 2WFF1 3IDCB 4LE3A 3GHMA 1C8M3 4GB31 5FXZA 2DV9A 4YYOA 1WZXA 4R4XA 1H2NA 4YVSC 3HIFA 4AHXA 2BWCA 1HB1A 2W3JA 5H9QA 1UZWA 4DQAA 1JI6A 1UU5A 1QJEA 2CAUA 1IG0A 3J7HA 2GSYA 3T0DA 3JU9A 3KD4A 3UL2A 4NO4A 4KNCA 4YM3A 2RVAA 3MI8A 1MQTB 3E97A 3NNLA 2XG3A 4AQ2A 3VDDC 3OY8A 5JOZA 1APNA 1LGNA 3DPRB 3POYA 4HLTA 4D69A 4AAPA 5CKQA 4AHYA 1NXD1 2Y0OA 4FT8A 4V2VA 5I0RA 5F3EA 1WA6X 2VZOA 3FL7A 3NAPC 4E4DX 4SLIA 3PU8A 3VD5A 4BXFA 4XJUA 4LUMA 5J98B 1VAVA 1BQPA 2ZGRA 2ZX2A 1G9CA 1GZTA 1VIWB 1LHVA 5FTTC 1OA2A 5L36A 1R092 3VHNA 1F35A 3QBQA 5KXEA 1HXS1 5FZ6A 4AQTA 2DVDA 1G9BA 3UGGA 4NROA 4P9WA 3M3IA 4YFWA 1C1LA 4Q0PA 3RZHA 2WQ4A 3Q8AA 2ZAAA 2XXZA 3NWKA 4ZU7A 1HN0A 3W5MA 4XQDA 5FZ4A 1HW5A 1I9RA 1XNAA 1PO11 1POQA 4D7SA 4NOTA 1RB8G 2K0GA 2GP5A 4XJAA 3ZFEB 2C9KA 2GN7A 1VBA1 3NL1A 4WM7A 5T5JA 1SLCA 1XE8A 1DDLA 4UFIA 2AR6A 4QB6A 3K4ZA 5DQ0A 1LHOA 3MBWA 4IGQA 2VMCA 3HVDA 1UPIA 2GMMA 4YM0A 1REDA 1XYOA 4IEXA 3DV8A 3KF3A 1VE0A 2Z42A 3AP5A 5G04L 4ZKTB 5EP9A 5EQUA 1UU4A 4I0AA 4HETA 4KQ7A 4RN5A 4UBGA 4D6SA 2B42B 1R093 1ENQA 3ME2A 4MGSA 3VD3A 4RSUA 5FXXA 4AL9A 4EQVA 2A6WA 4EWDA 2ZHLA 4M3CB 3UJOA 5CFDB 5J3UA 2GP3A 4LBMA 2Q1ZB 1GNZA 2QQIA 4AVBA 3M8LA 3CF6E 4BYYA 5A33A 2NN8A 3N9MA 4E2GA 1AYM1 1WKYA 1GR3A 1WA4A 2EIDA 5FYZA 1DU3D 4DEVA 2VG9A 3AJYA 1FPN1 4UBHA 2ID4A 3K4DA 1YEWA 2C4XA 4XZUG 3OCPA 2ZZJA 3VBHC 3I49A 2TEPA 1OKOA 1GOGA 3NV2A 2HWE2 1JZ3A 3VZJA 3PJQA 2O8OA 2XVLA 3POJA 5D8AA 5I0UA 1ZVFA 4CYDA 1RIRA 1RTVA 3SCHA 4R4ZA 4BQYA 2B45X 4Q1PA 5CBLA 2DWRA 3OEBA 5A6XA 2PHDA 2AEZA 3LCPA 2JDYA 4XQWA 1W39A 1SDDB 1LCLA 4I3GA 1POV3 1NQDA 5FZLA 2ZX3A 2E6VA 2WQ8A 4A2UA 3V0BA 2C26A 2VMHA 2HKXA 3VHPA 4ATEA 1W8WA 1YFXA 4FP3A 3ZDVA 3ZXKA 4QPIB 5FKBA 1Q8VA 2AENA 2WL1A 2Y6LA 5BYNA 4ZHNA 4LHKA 5F3IA 4Q8KA 5DAVA 4KU7A 2ATFA 2P4EA 2VW0A 4I01A 4BOWA 2D43A 1Q56A 4ZPIA 4YVWC 4AVSA 4WVZA 1S1AA 2P2KA 1PO12 2VOWA 3HBZA 1SBDA 3MDPA 4UF0B 3SLIA 2EAKA 2XQRA 3V64A 4FBFA 1IS5A 1RINA 1ULFA 5FPZA 2A3YA 5DG2A 5H9RA 1I6XA 3VHOA 5GZEA 4L97A 4XJ9A 1JTZX 4XCAA 2DU0A 2IZWA 1CAVB 4AFDA 4B4PA 1N1TA 4I3PA 4XXPA 2WC2A 2XJQA 4UFHA 3TNQA 2E31A 4D6QA 1VRH3 4HKLA 5JCTA 3BIWE 4W50A 5L9BA 3JXSA 1BK1A 5FREA 1NY71 3U0ZA 1K42A 5FY1A 1JYIA 3C7GA 5FZ8A 3U75A 2ZGOA 1QF3A 1GWKA 4K21A 4MH0E 3O1VA 2JE9A 2YC4A 4QPGB 4AEDC 1CX4A 1H9PA 5I93A 1MEC3 2V5YA 1FOD2 3E5QA 3WQBA 1UYXA 3C8XA 4LTAA 4MGIE 4RA0A 1Y9MA 5CKMA 5CNAA 2FD8A 1GWMA 3N36A 3GBWA 5EYYA 3U1XA 2YGLA 4FPYA 1R64A 4IEPA 3ZLIA 4DUXA 2WYSA 2IXKA 2HWE3 3GCWA 1Z7S2 2HWC2 3NQHA 4FO9A 3KT7A 3H7JA 4KBBA 1EV13 4ZS2A 5FYCA 3T2TA 4CE8A 5CKNA 1YFWA 5K0UC 5LK7B 1BEV1 4D94A 1A6CA 1ZA4A 1ND3A 1Q3EA 4LQRA 4BCUA 1JHJA 4FOVA 3GHNA 5DUVA 4AW7A 1W8TA 1UMHA 3OYWB 1H9WA 4BM8A 3TWIA 2XONA 1W2UA 5FR3A 2WS92 4AI2A 2HWD1 5FYYA 4PDWC 5A1LA 2A6VA 3I2JA 4IV1B 3THTA 2FZ1A 2FCVA 5HPOA 1IPSA 4XABA 5DAWA 5EYXA 4B8EA 3H0OA 1L3JA 1YCIA 3OTFA 1DGRA 2ZTNA 1GZWA 3IDEA 3WP6A 1I5PA 3FZ3A 5FZDA 5IUQA 4BQ3A 1M06G 5IK7A 3G7DA 1RL3A 1OPOA 2IXCA 3JD71 4PI2A 1UNBA 2LTNA 3PMEA 4BHPA 4MOAA 2JG8B 4E8CA 3J7MA 5EWSA 3D5OA 5KXDA 5FZEA 2W08A 1CIYA 1ULOA 3NNJA 3H42B 4Y20A 1OQ1A 4JKKA 1S0FA 3HOBA 4CDQA 5F1RA 5JOWA 1H8VA 4PLMA 3H8RA 2VNRA 4QX1A 4BQXA 3WINE 1PZ8A 4QHOA 3AKPA 4QM9A 2DCKA 1OHFA 1YWKA 2LALA 2G4IA 5BY5A 2NM1A 3RNSA 1RUD1 1IS3A 2YHJA 2BV4A 3I3BA 5I0DA 4PJYA 4FP2A 1DQ4A 2E33A 4S2HA 2R063 4FTSA 2P3IA 3LEMA 5CFCC 4ISRA 4FXKB 2VUJA 4LIVA 3BYWA 5FJKA 1QXRA 3GBFA 3FLPA 4YW6A 3N7LA 4XJZA 4XDQA 2RR12 2X5IB 2IC1A 3LA2A 1O3QA 5T50A 3WF2A 3ZMNA 1W06A 3VDBA 2DURA 2W91A 3A0NA 2ARCA 3OB8A 2DVFA 4Q4W1 3WCSA 5BNNA 3C2UA 3U14A 1KEXA 1BXHA 2RM22 5FMOS 3ZXGA 3M70A 4I30A 2WS91 2F4PA 2GDFA 3ZR6A 1KXGA 3M7AA 4Y1ZA 2XJRA 3ACHA 1PM7A 3JBG3 4CCOA 1F2NA 5FYVA 2WJSA 3AZWA 1UAIA 4IEWA 3Q8EA 4EE2A 1QEXA 3AX4A 5BNPA 2LROA 3P5BA 1HJGA 1JU3A 5LK5A 3W21A 2XR4A 4JV4A 5A3TA 3LAGA 1C8M1 1LKNA 3DF0A 3KHBA 2VJXA 1GQHA 3OGSA 3WSOA 4AVCA 2VU9A 5FYHA 2E26A 1GANA 3WUDA 2GC0A 5FYIA 4CSWA 2GNDA 1QQP3 4HKWA 4GAZA 3L2YA 3ACGA 3E6DA 3CDZB 3SISA 2F4LA 2V4VA 4AFAA 3RZLA 1JZ7A 1L7RA 2R072 2PHLA 4Q26A 1KJLA 3TEXA 3KS7A 5C9AC 5GLWA 1U5IA 3VBUA 2GMPA 1I1EA 5FMDA 4AGRA 3I3EA 2TUNA 4AFMA 1VMFA 4PCRA 4UWDA 2VCBA 4X6QB 2RMU2 2A5ZA 2R49A 4Y1YA 1PZ7A 2BQPA 2ORXA 2PFWA 2YROA 3GJAA 4JKLA 4NWWA 4PQ9A 4QXCA 5IFTA 2NP0A 3HAGA 4HVOA 3DL3A 1EAH2 4IE0A 3RI9A 2RS31 3R4DB 3ST7A 5ANNA 1GLHA 3HN3A 1RUG3 3I4IA 2WDBA 3QACA 4GZ9A 1S2KA 2YY1A 2D6MA 3ZMOA 1PGSA 1JBCA 5FPVA 3CIHA 4K20A 4RHV3 2DVGA 4AI8A 5C5UA 4FXGB 1GYKA 3EJKA 4TWTA 4W6XA 1SFNA 1C5HA 4Z8BA 1MVQA 4F3JA 2AZ5A 4URTA 3LGRA 1RUH1 4BDVB 2BBVA 2VOKA 2EF6A 2VUCA 2XL7A 2W1UA 4L0PA 1AXZA 1AR91 1US3A 1VALA 1CONA 2DYCA 3B9CA 2J1SA 2HWB2 4P5YA 2Y6JA 1ODNA 1J58A 4LNVA 1K12A 1OLMA 4XIOA 1ZRFA 5LCWL 4ARXA 3ITQA 4G3YC 3WCRA 1AX1A 4PDWB 4AHZA 1US2A 3NJVA 1HIXA 3ZPOA 2DBNA 3FFQA 3VBSC 3BGAA 5FOBB 3U10A 2ORZA 5I0TA 2BRTA 3MHZA 4QX8A 1REEA 1X50A 5J36A 3ACFA 5F3GA 4LULA 4CDWB 1NYWA 1DQ6A 4IUGA 2VVEA 1LTEA 2VECA 4HVQA 1RHI1 2AH2A 3H1WA 4LK7A 1ENRA 3ZPYA 4CEYA 4YW5A 3AL6A 3WR0A 1LAJA 3M4FA 3Q8BA 5G05L 1RUI2 5HI0A 3HNMA 4ASKA 1IKQA 1HRI1 2AUYA 3H50A 4RS5C 2ZGUA 2ES3A 3AZVA 3CO2A 4DXTA 5LEJA 5JPMB 3O1SA 1M4WA 1XQNA 3OF1A 3C7HA 3B69A 4GQ7A 1LU1A 4JGZC 5ACA2 4SBVA 1SLIA 1XNTA 1VAKA 4FQ4A 1CPMA 1UY3A 2GNMA 4YVSB 1AJOA 1XNBA 2ZGQA 1RUJ2 5GLZA 3VB9A 1ZNPA 4BE3A 2BDRA 1LR5A 5FK7A 3QD6A 4YW1A 1H2MA 4AVAA 3VHRA 4QX7A 4E4ZA 1XB9A 3WF0A 2ZKNA 2YBSA 3I2KA 3RZMA 5LBFA 3BB6A 1RJ8A 3OUJA 3R4UA 5GKAC 1V0AA 4U36A 3EB7A 2JDMA 4FFIA 3UYJA 4LO6B 1H30A 5F5IA 1W03A 3ZN4A 4NIHA 1FAYA 3POBA 1QQP2 1J1TA 3AL5A 5FV3A 1QNYA 3KV9A 3VBOB 4G4FA 4CEWA 5FY0A 1OUXA 2R1DA 4IDZA 5GALA 1VBE3 1H0BA 1H8TB 1XE0A 3ASIA 4C91A 3VBFB 4TLFA 5FWEA 5CFDA 5JZGC 1LRHA 3V56A 1QJFA 2DTYA 3VKMA 4A3ZA 4D6RA 5AFEA 1TME2 4KU8A 4Q29A 2HWF2 1ULCA 4NRQA 5ACA3 5AFBA 5FYTA 4HZFA 1H6YA 2Z4FA 4PLNA 3H3UA 5J1XA 2AEYA 5DUXA 1BCXA 3NV1A 3QLQA 4NIDA 3V0AA 2J1TA 5IAXA 1GZ9A 2JKXA 5IT6A 2ILMA 2GMEA 2QVSB 3N3HA 3J4UH 3UESA 3JUUA 3ZXLA 3LSDA 2QQLA 1UD1A 3H3ZA 3OJBA 4EV0A 1X8EA 4EYUA 5AC92 3MW2A 1JOPA 4MX3A 2E51A 2WZR2 3ON7A 4XHBA 5K4LA 5C70A 1LHUA 5IVBA 3T08A 1IQAA 5A7WA 3C3VA 1X33A 2JECA 3IZOA 3PJYA 3ZFGC 3RWKX 4CP0A 3DPRA 5DAPA 5FZ7A 2XJPA 3B5LB 4CUAA 2FDIA 1WCQA 1OMIA 2CYFA 5LASA 1OFNA 5FMBA 5FY9A 1ZBE3 1KS4A 3WD5A 1AYN2 3LD8A 3ZYJB 5CVRA 2KM2A 4NAOA 1JZ6A 3UK9A 4E2QA 2Y38A 5BV6A 3GXUA 1RHI2 3HR9A 1D4M2 2DCZA 4ZXKA 5A32B 3N9NA 2OT7A 4FTEA 1UU6A 3VGIA 2JB4A 4PF5A 2CWSA 1F9KA 1JU4A 4QWNA 2Q1MA 3EYPA 2QCSB 5BNQA 4E8DA 1OH3A 4LUKA 4HK8A 4HBNA 4COZA 4JX0A 2IWGB 5DZGA 3WG3A 2QDRA 1VLNA 4LBNA 1QU0A 2ADEA 4JHZA 1DBNA 3VBOC 1RUI1 3I2FA 4KGQA 3ZXDA 1LODA 2V5DA 4BQ5A 3DYPA 1RUOA 5F5CA 1GP5A 5DZFA 3B93A 4IETA 1YUDA 3CU7A 1UXXX 4MGYE 1BBT3 1GU3A 1W8FA 2YBKA 4NE9A 3H3LA 3BU0A 2YZ4A 4QX2A 4BJ0A 4Y24A 1WCSA 2B5HA 2R7EB 5A6YA 1LOBA 2UY9A 1UZ0A 2ZACA 1QDCA 5JVVA 4DXSA 2VTXA 3WNOA 1ND3C 2J42A 5IK5A 3ILRA 1W6PB 5CA6A 3MLLA 4Z2WA 4L8QA 4CEYC 4A7ZA 2A7AA 4P9IA 1UMIA 4R9CA 2W68A 1AX0A 2WO2A 1OUSA 2WZR3 1HV1A 5C8WA 1AXKA 1QY4A 4FPJA 1G9DA 1W6OB 1ZRRA 4XF4A 4AQ6A 4IERA 4KWLA 2PHTA 1ZZ8A 5BNOC 2JDHA 1MS0A 1S0EA 2VW2A 3MV01 5IAVA 3S5AA 2GH2A 1RXFA 3O7OA 4QM8A 3EBRA 1Y9GA 2QFEA 3WV6A 2QNKA 3S6PA 1RUI3 2DUOA 4QPGA 4C0HA 3ALQA 3HQXA 4QU1A 4NIGA 1YIFA 4A44A 2D6OX 2PAKA 3BCWA 2K2SA 1BBT2 1NY72 2HEVF 1W6QA 2G19A 3I3MA 1W6PA 2FBEA 5IWFA 2YMZA 1IPJA 2A75A 5ABJC 3AFKA 1RUF3 3P1IA 3BALA 1PIV3 2DVAA 4HSJA 1Z7S1 2HWC1 4CU6A 1K45A 2DFBA 5AC91 1OFSA 4WVVA 4H3WA 4XFFA 2KD7A 5KHHA 3K2OA 4JAAA 3K48A 1UY1A 1W6OA 3LDRA 2EA7A 1LEDA 4LJHA 4CXYA 2GH8A 1J3RA 4QKBA 4N8MA 4CUCA 1ASJ1 3HT1A 5IVCA 1ZBE1 4MUVA 2W1QA 3VL9A 3KVBA 1FNZA 1YC61 1AYN1 1V9U2 4XE9A 2GNTA 3AYCA 1NCRB 3IWZA 5LA1A 3I2OA 5FLJA 1ULDA 2ERFA 3DGTA 4Y1XA 5B4XA 1NCQB 1LJ7A 2ZGPA 1I5ZA 1V6KA 3TN92 4AVTA 1SFYA 1E5HA 2EIBA 1W6QB 2VL4A 5EJ3A 3SEPA 4DY3A 2HYKA 1A3KA 2XWJB 1ZBA3 3J8F2 3RZZA 5DABA 2XB6C 4FPHA 4LIUA 2OA2A 5ISLA 1L7LA 4BWOA 4IXLA 4JRLA 2NQYA 4L92A 3CKHA 1N3PA 1O4TA 1S55A 4ZZ8A 3B9IA 2ZABA 5C9AB 4M0HA 2XLGA 5KC5A 1W99A 2LS6A 1WMEA 3CJIC 2VOXA 3ABZA 3K3OA 2MPFA 2Q5TA 2RJ2A 3B00A 1XBFA 5BNNB 3H1MA 5C8CA 3X29B 1OOPB 1PHMA 2P6CA 4QQ2A 4E27A 4QB2A 3NKGA 1X9TA 1RMU2 1VBC2 2J1EA 5FBZA 1PGW1 3W58A 3DEMA 2GC3A 4Y22A 3TEYA 2WZEA 2CDOA 3IMMA 1PK6B 1OOPC 5BPXA 1A34A 3ZSMA 4O7XA 4NUBA 4COVA 1KFUL 1XSQA 3T1LA 5GJ6A 3BU7A 1VBD1 3AYEA 3KGLA 1I3HA 1W3XA 1RITA 3MLKA 4HPKB 4XXAA 1YI7A 1EAH1 1XYPA 1CIWA 1JUHA 3PURA 3NW4A 3FWEA 4ONUA 4Z92B 2VCAA 3A23A 1DGLA 3J8F3 3PTRB 1WGPA 1IZ3A 4NWVA 2IVJA 2OX0A 3LIGA 1NKGA 4XF1A 2HYXA 2VD7A 3CMGA 1GOFA 4Y20B 1OD5A 1SQ4A 5B4NA 3D3AA 2ZKLA 2Q4SA 1HV0A 1W2NA 2A3WA 5E1RA 4L9BA 4F83A 4CCLA 5EJ1B 4Q5OA 1GP6A 2JG9C 2ZGTA 2X09A 2DTWA 2R041 2XLFA 4XETA 4LKDA 2YC2A 3VV1A 1OT5A 4ES9A 1CPNA 3J8F1 3SMHA 4Y5Z0 2JG8A 3PUSA 1W2TA 3S57A 1O8PA 4X8PA 5JAXA 1DGWA 3OUIA 3M3OA 1OSGA 4NMIA 3WDTA 4OZXA 2ZOEB 2VM9A 1BBT1 1K5MB 2WBKA 5C3QA 4CDQC 1Y43B 5CIRA 5LY1A 1NX9A 3NJZA 4FCAA 1S0BA 4JVAA 4M4RA 3FJSA 4XMAA 4PI0A 4Y1VA 1COV2 3DKQA 3IT8A 4NPLA 1QGLA 4Q4X2 2ZEXA 4PLOA 4QXBA 3PVOA 5L9VA 3W9AA 1F5FA 2VXJA 5FP4A 4WVMA 2RDRA 1BK0A 5FZOB 2OUJA 4PDWA 5C3SA 5JMOA 5I8SA 1VBD2 2QE3A 2J1UA 1MS9A 5EJZB 2D40A 1V9U3 2FDHA 1EUTA 3NNFA 3U37A 1XNDA 2RJKA 4QB1A 1KDMA 2DVBA 2XBO3 4LPLA 3AP4A 4CCNA 2GAUA 1H4HA 1RUH3 3CZJA 1VAMA 2K9ZA 5FZ3A 3VBHA 2WRAA 5A6ZA 3BOPA 4LHSA 1XNKA 3D82A 1WW7A 4A42A 4MG2A 3RRDA 3WW3A 2ZHKA 3IPVA 1E5SA 1MVEA 3FX3A 2PELA 1V70A 2MHFA 1SCRA 4XUQA 1BHGA 1ASJ3 4G9SB 3SCGA 3UV9A 3AJZA 4IEOA 4LO4B 3CEWA 1D4VB 4AYUA 3AFGA 5HV0A 1UYPA 1DQ0A 3UGHA 3NRUA 3ZYGA 4K40A 3ECQA 1V9U1 2QJVA 4GWMA 2D97A 2JG9B 1G7YA 2OIIA 1CJPA 2WAAA 4CP2A 2OZ6A 4QDSA 1RUC2 1V6LA 3WDUA 3R05A 4IV3C 3MF6A 2YB7A 5J48A 4OHXA 4BIFA 1EP0A 1NCQA 3VBUB 4UW6A 1AR71 2P17A 2WWJA 2CSGA 3RMYA 4AFCA 3CZUA 3SKVA 2RHPA 1NA1A 2WINB 3PLQA 3N7MA 5DPNA 1V6MA 4P9LA 5FWJA 3MF9A 1COV3 2CGOA 4TN7A 1VRBA 3PMSA 2R073 4HSLA 4BK4A 3CL1A 1Z0HA 1W2AX 1ND2A 4GA9A 1ACCA 5H9PA 1C1FA 2ZAHA 1MQTA 1Y3TA 1PVXA 1MZ5A 3BTAA 1S0DA 3R0RA 4CZSA 5F37A 4RL7A 4L99A 2C9AA 3ZDSA 1HB3A 5LBEA 3ZXAC 4IW3A 4H7LA 4XBLA 1SLTA 4FAGA 3HN1A 2W0XA 4A4AA 3H1YA 3OBRA 4RFT0 3MGUA 5A1FA 1C5IA 2RJLA 1K3IA 4A7YA 4LBJA 4OFGA 2XJTA 1GICA 1HB2A 4XTPA 1XOYA 2ZEWA 2BU9A 1W0NA 3ZKYA 5JXHA 1DYPA 2YYOA 4OULA 3VDDB 4E9KA 4Z07A 3DXUA 1WW5A 2VMFA 3ZFGA 2ZX4A 2R061 4WM8B 5CB7A 4KBZA 1F4HA 1W8ZA 2YG0A 3VL8A 4EN8B 4DS0A 3AB0A 1J83A 5A7WB 1LGBA 3IB3A 4CEWB 5LEKA 2ET7A 4K1YA 2B9UA 4CU7A 3AMNA 2FCUA 3NO8A 5FO8B 2X53S 4Y33A 4B3NA 1V6NA 2TNFA 2Y6HA 5J7MA 2HWD2 3VKNA 2RS12 3BPZA 2WNUA 2Y6KA 3EHKA 4LEJA 1RVF3 1DZTA 1O8SA 4WZFA 1JS9A 1FOD3 1PO22 3ILFA 5FP8A 3JQXA 3RZKA 2PTMA 4BQ1A 2VOVA 3KCCA 1UYZA 4EROA 1MS3A 3H8OA 4Y4RA 3D8CA 1KFXL 4OUEA 4FOWA 1C57A 3J7LA 2JIJA 3ES4A 1FPN3 3UKNA 3E1F1 2J7MA 3THCA 3UKVA 4OHYA 3OSDA 1R1A2 2O8QA 5F5QA 4XOGA 2XWBB 4MGZE 4OLLA 1NQJA 4C0BA 1QOOA 3OD4A 5C7GA 5IW0A 4NHXA 4XDPA 5HCBA 1MACA 2QQWA 2IUWA 3QH6A 2IXJA 1QJU1 1TE1B 5BNOB 3V0AB 5L73A 2XVKA 3SNMA 3GNEA 5FPUA 2CGPA 4A7KA 5E89A 4CDXB 1OLRA 4Q4X3 5FUPA 2XHKA 3USUB 3TOJA 4OYUA 4NIAA 3SCFA 4C1WA 5FZKA 4IQPA 3LPGA 3T2QA 1EV11 1DQ5A 1G9AA 2Y60A 3I2IA 4JCKA 3WF1A 3C7OA 4GMP0 1CD3G 1RVF1 2JKBA 3VKOA 4CEWC 2VW1A 2UY8A 1JUIA 2R0FA 2ZPXA 4AI9A 2W92A 2XOMA 4DRVA 2A73B 4J6GA 4YSFA 1N47A 5L19A 5HCAA 1UIJA 2RV9A 3W20A 4UFLA 1YO8A 3DCQA 2Y64A 5LBCA 4ZZ5A 2IFRA 1JYVA 1REFA 4YNIA 2ENRA 3IDAA 2J1VA 1W90A 5LY2A 4N7UA 4XUPA 5IVYA 1FV3A 2WSUA 4QPYA 4DEQA 1N1YA 3VN4A 4KWKA 4MGQA 1H1AA 3NAPB 5HCHA 3WUCA 2GALA 2UWBA 5I91A 4LR4A 1RUC1 1KGYA 2A6ZA 4NRPA 4LBLA 3BOWA 4XEZA 1QH7A 4K8FA 3B01A 1E5RA 4JZRA 2ZX0A 4AWDA 2D3RA 2W9XA 1K5MC 1MZ6A 3RS6A 1AL22 2WA3A 5CU1A 1ZRDA 3PDQA 3SXWA 4ES8A 5C5TA 2ADDA 1F8VA 3A0KA 3ZYPA 1XXNA 4C90A 5FJHA 1GUIA 3G6JB 4S2DA 1YQ2A 2HEYF 2BBAA 1UQXA 1HRI3 3MPPG 2WYFA 3MUY1 3PUIA 1TZOA 1ENSA 4NAMA 1YJLA 1O4ZA 1KD7A 1ZBA2 2R071 3MLJA 1DIWA 1XRUA 2X8KA 2YBPA 3T4VA 1TG7A 5L7OC 4UW5A 5C4WA 1V00A 2RS52 3MFCA 1POV1 1GZWB 1S2EA 2VZPA 4GB33 3I8TA 4QU2A 4YZ3A 5FZHA 1CGPA 2WFF3 3MZHA 3SC7X 4AG4A 2XPJA 1ND2C 3I59B 1J84A 5FQ0A 2Q8CA 2PAMA 3WHTA 1QXJA 4XURA 5D1IA 1AR62 1VBB2 4IEUA 4D3WA 4R9AA 1AJKA 3UNPA 1YHFA 4DRRA 4FPGA 3THPA 2WT2A 1ULPA 1V6JA 1AYM3 2VZ3A 4DUVA 1ZZBA 5K0UB 3I2HA 1U5XA 2VXRA 2BVBA 3T4HB 1SLLA 3DUIA 3PUQA 1OI6A 3P6BA 1WCUA 2PAEA 3UKTA 4P9GA 3OEAA 3Q8CA 4OVEA 3ROUA 2DDUA 2ZGNA 1JMUB 1H8TC 3JD73 4HKOA 3QOPA 4DPNA 5FFOC 3VDAA 5JXGA 1YFUA 3NSTA 1KQRA 4XW3A 2OQ6A 1XE7A 1MS1A 2WNUC 4B4QA 1S2BA 2HWB1 1CAXA 3GZEA 2WABA 2WQZC 1O5LA 5FQ0B 1SPPB 2BEOA 3PL0A 1ZZCA 5A1AA 4A6SA 2OKXA 3VBFC 2JDNA 2X5IA 3KV6A 4LOTA 3TEWA 2ZJCA 1LENA 5FMOL 1BYHA 1N3OA 1VP6A 2H6BA 2BUKA 4PIYA 1AHSA 5FYUA 5AC93 5FMCA 1RUF1 4WVWA 1Y7BA 5CEHA 3OBZA 4QDRA 2UYBA 4XFAA 1WD3A 1GV9A 4CDQB 2B46X 3D6EA 5LA2A 1YIPA 1OF4A 1GKBA 4JGZB 1QJX2 4IE7A 2X05A 3WX5A 4FSJA 2Q8EA 2WNEA 5A3MA 1G6NA 1LEMA 3AKSA 4RGKA 2FQPA 4PHZA 1UZVA 3ATGA 2QTWB 2IVIB 4LBQD 4I09A 2RMU1 1AR83 2HWF3 5KXBA 1HXS2 2OQ7A 1NG0A 2PHUA 3DYMA 4ZXEA 3VBRC 1BKZA 1J3PA 1LHNA 1SG3A 1XPWA 3OGGA 2OPKA 2FDGA 4W6YA 2ARBA 2V72A 1UY2A 4X8NA 1KITA 4QKNA 2JX9A 3T0AA 3VBRA 1CAUA 2BERA 2PLV2 3UT0A 5IVVA 5JMCA 1C8M2 2YUEA 3QCWA 3O1OA 3KM5A 2MEV2 1AR92 1OD3A 3MIDA 4R8HA 4XAAA 4P00B 5DDJ2 1BMV2 3WQ1A 2KXLA 5F32A 2FMDA 5BNPB 2NPIA 3A21A 4FPLA 1MZEA 4M0NA 2EALA 4OUSA 4QX3A 4DXRA 2RS51 4CCEA 1R1ZA 1NLRA 1WBLA 3ORJA 2AREA 4KMQA 2GN3A 1PMIA 1LOCA 4CRQA 5BNPC 3TAYA 4AFBA 1FNYA 3PVNA 5JZGB 5KC6A 2PLV3 2IXHA 3OUHA 4QMAA 4XF9A 2I45A 2YPJA 2OYZA 1LGCA 3VZKA 5JDBA 3MV11 4P14A 3AZZA 2BOIA 5A3OA 2AC1A 1XU1A 2A71A 4I2OA 4H14A 1X8MA 4HPKA 1JODA 4GIQA 1FMD1 1O7FA 4FOYA 4CUGA 4RFRB 3NV4A 2XJVA 4YFZA 1ND3B 2VZVA 2Z2SB 1SLAA 3IN9A 3NNGA 3FHAA 3TB0A 4BQ2A 1JYWA 3RZJA 3VD7A 2J22A 3MO4A 3ES1A 2W52A 4BMEA 3WP4A 1O59A 2BYVE 5KHGA 4M4PA 5F8PA 3KSCA 5FYBA 2VY0A 2VE1A 4B1MA 2W95A 4XC9A 1A8DA 4OMDA 5A7OA 3LEKA 4ASMB 4IV1A 1AF9A 2V09A 3FBMA 4Y5SA 2DCTA 1AR93 5FLHA 5L9RA 4EN6B 3ZFFA 1CAVA 3VKFC 3BUCA 1RXGA 3EXUA 1PGL2 2VGDA 3I54A 4GD4A 3CJIA 3VBSA 4NN0A 2RDSA 4QHBA 1NE4A 4L2NA 5KXCA 3O0WA 4ZONA 2E53A 3HEIA 4AXOA 2JICA 2CDPA 1PNGA 1TNRA 3LFIA 3S5QA 2EICA 2B8MA 3KF5A 2VZSA 1TMF1 4ORFA 4RR3A 1MZFA 4AE2A 1YQ6A 1OC1A 3M3EA 3AP7A 3NJXA 4N43C 4BXSV 2Y26A 4LBQB 1O5UA 2CHHA 4XIKA 5C3OA 3KV4A 1VR3A 3LKJA 3RJRA 3WXPA 4DZGA 1W6NA 3KCXA 5JOYA 4AI0A 4FOQA 3VD9A 1YRZA 3O1UA 4IGOA 3SH4A 4BZ4A 2YU1A 4XDOA 1IGOA 2PA7A 2NMOA 3VDDA 3WDWA 1Q8QA 4YZ1A 3KVAA 1WD4A 1NA1B 4CEYB 4BB3A 3HD8B 4Q0SA 1G8WA 4LO7A 3ZN5A 4NVPA 1CZTA 1RJ7A 2D6LX 1H6XA 1DFQA 4N7IA 2ZGSA 2A3XA 2QDNA 2D5HA 3V65A 4BU2A 3INAA 2O14A 4LBOA 3FUQA 4YPJA 1QKQA 1H2KA 4LA3A 3UGFA 3U4XA 2JG9A 3GZAA 1DYOA 3HQUA 5FLIA 5FIXA 2LM3A 5JXIA 4B1LA 1UL9A 1H1MA 5FY7A 1QJX1 2E32A 3K75B 4KGGA 4COYA 1QWRA 2E7AA 5L7OB 5SV5A 2D98A 4C1XA 4TTGA 4MYEA 4W65A 1ULEA 5DDJ1 1QHDA 1D0HA 4QAWA 1BMV1 2WO7A 3WDXA 3M2MA 2BNMA 3K46A 2QQNA 5JXJA 4META 3AMQA 1WCKA 1RUE3 3ZN6A 5A32A 1QJY2 4F7ZA 1B35B 5E8AA 4CCKA 2UURA 1EAH3 2YU2A 2IFWA 5JR2A 2P6HA 1JZ2A 2VBBA 4P9YA 5EZWA 1VBD3 3N9PA 5FY4A 1LOFA 1OH4A 3VDCA 2R0HA 4K9SA 4ASLA 1HQLA 1LNSA 1PGL1 1AR81 1JH5A 2UWAA 2A6XA 2XVGA 3E6BA 1LECA 4JQTA 4UYBA 2C24A 3UETA 1JZ4A 1RGSA 1D0GA 4YG0A 2VQ0A 3ZM8A 1RUD3 1ZZ7A 1YQCA 1S0IA 3WP3A 2W1SA 5FY8A 3RYKA 1RMU1 1DQ2A 5BNOA 4D7YA 1W8OA 2D3PA 1TMF3 5IK4A 3LA3A 1KS5A 1JN2P 2Q8OA 1O3SA 4IE5A 3ZXEA 2WLQA 2FHRA 3WT3A 2Z69A 5LBBA 1QJU3 2W1WA 2E63A 1AXYA 4OUMA 2QQKA 1GP4A 4LK6A 3FBYA 4CCDA 5A80A 4LHNA 1PX3A 2A6YA 4UAPA 4YVWB 3BVCA 5T52A 1ZM1A 4RQPA 2XJUA 3SKJE 5HBAA 5JSPA 1W6NB 2CL2A 4RGAA 4Y1UA 2UWCA 4AR2A 4W4ZA 2CNAA 5JZGA 1OBNA 2B9VA 2WLPA 1ST8A 1JYXA 1G9FA 3LB9A 5IVFA 3LOBA 2P5BA 3T1MA 2BTVC 1MS5A 3JZVA 1JHNA 1IPKA 4RGGA 5F2SA 3IDBB 1HQNA 1W05A 4TSVA 5GLTA 2JWPA 4AEDA 5A7NA 1DYKA 4GWJA 5EHDA 3ZYIB 1CWPA 3FC0A 1BLZA 2KR2A 2ZEZA 1Z7S3 2HWC3 5LRSA 3VBOA 4MGTA 4GH4C 1HRV2 2HJIA 3O1MA 3JB8A 4Q27A 1X36A 1CAUB 4LORA 4QGLA 4XAEA 3H7YA 3T30A 3S0MA 1STMA 4GH4B 4QD2A 2IXLA 1QJY1 4ARYA 1UZZA 4B29A 3GCXA 5EPAA 2ZGKA 2I07B 1ZYBA 1O3RA 4XFIA 2WZPP 5LA0A 3N9LA 3LFMA 4JTOA 4E4SA 4XJ8A 4MZUA 1FYUA 1WMXA 3IIAA 4Q4V2 1RUH2 2EXHA 1ODMA 4R52A 1HLCA 1D2QA 4HL0A 4DXZA 1UO9A 3Q9OA 3PTYA 1UN1A 3GALA 1OVPA 1ZA7A
chains in the Genus database with same CATH topology
4JGYB 3JBG1 1MS4A 3WG4A 1HQWA 2YXSA 1GNHA 4K6BA 5JPNB 1QDOA 2WNVC 4Q4Y1 3ENRA 2W39A 1KJRA 2LUWA 4YGBA 3AMMA 1RUG2 3CJXA 1VRH1 4ITCA 1RUNA 1GZCA 5IK8A 3POWA 2D6PA 4EJRA 2GC1A 1D2SA 1F5JA 2RMU3 1COV1 4LHLA 5K0UA 3FFZA 1Q43A 2CAVA 4K1ZA 4AF9A 5DUWA 3P3PA 4DMIA 3L2HA 1HKDA 5C8CB 2MEV1 3URFA 3D0SA 4GULA 1MR5A 4AGVA 3D0JA 1DZQA 3EO6A 5GZGA 5J37A 3QH7A 1Q8PA 3ZSKA 4N9IA 4P5HA 3VZLA 1QOSA 1UF2C 1NE6A 2WFF2 2NMNA 4NR1A 1UKRA 4QGNA 4HN1A 2RR13 4CDXC 1W0OA 2JDZA 1AR72 1IHMA 1MEC2 3FLTA 4GXLA 4LBQA 3AK0A 2Q0AA 3I7DA 1RC6A 4GALA 4Q0QA 2VPVA 2SBAA 5FO9B 4QPGC 1U5ZA 3U07A 1ZRCA 2H0VA 4WZCA 4XZPA 4JGZA 4AK3A 2P34A 2ZMNA 3AKQA 2GU9A 3MIGA 4GMP3 2ZS6B 3I59A 1EYBA 4N53B 5D8AC 1ZZ6A 1JYCA 2ZGMA 3JB4C 3MIFA 4YZ4A 4QX5A 2XLAA 1Z78A 1NA1C 2JENA 2XBO2 3MIBA 1W6MB 1PGW2 4YARA 2ARXA 1BZWA 1HDKA 3LSEA 1CR7A 1FOD1 3R4SA 4QQPA 5L7OA 4XF3A 2DUQA 4IV1C 3KT1A 1GBGA 2D6NA 4WV8A 4UW3A 5BNNC 4GKXA 5C8CC 4M3CA 1YI9A 2XJSA 2ZCWA 2Q30A 1YXWA 4HMZA 1RUE1 4WVMB 1BJQA 3V0BB 1WLWA 2RS11 2MEV3 3LA7A 2QZ2A 4KL1A 4LA2A 5JWPA 4YZ5A 5A3LA 3ZVXA 2R043 4BPZA 5DZEA 2D3SA 1B35C 1ZX5A 4OI4A 4CDUA 5E88A 1U5YA 4YM2A 5KWRA 4N90A 5T5PA 5CFCB 4R9BA 4Q8LA 2D5FA 2VMGA 3VBRB 2RE9A 3P3NA 3B3QE 4GH4A 1WUVA 3RWNA 1N3QA 1C4RA 5A33B 5FPXA 2EAAA 1OKQA 4Q4Y3 3RSJA 3FE5A 1VB4A 4WM7C 1R081 3OPZA 2WT1A 3AMPA 3JCIA 4Q4W3 4XBNA 5AVAA 1VJ2A 1V6OA 3O14A 3RYPA 3MW3A 1SBEA 1ZBE2 2ZBJA 3W59A 4LT5A 3AP9A 4BH9A 1CQ9A 4HK9A 3I2DA 4JGYA 2TBVA 1URXA 4CDUB 3ZFFB 2GZWA 2QUOA 4I0BA 3WQ7A 1CAXB 4XQ4A 3N4MA 1C28A 4X6RB 1EV12 2WNVA 2YV8A 4AI3A 3RQ0A 1NXMA 1D4M1 4UXAA 5GZCA 4NHKA 3RJ2X 4YRDA 5T55A 2PYTA 1EPZA 4JC1A 4Q4V1 5JSRA 2DU1A 2P3JA 4P9XA 3B02A 4YZ2A 3VKLA 2E7TA 2UYAA 1SMVA 5TSWA 2XKOA 4UW4A 4RS5B 1N1VA 4DNYA 4P9JA 1NCRA 1WCDJ 2JEMA 2VNOA 2CV6A 4M00A 1VBC3 3OD0A 3ACLA 2MNGA 3FUOA 1ASJ2 1SLBA 1VBE2 1XU2A 1RUG1 1J3QA 1IKPA 1AZDA 1J1LA 2X29A 5KHKA 4IEQA 3TN91 2HWD3 4XILA 4KG8A 4LLFA 4ZU5A 1FPN2 3OYWA 1VBB3 5FCCA 1PIV1 1CESA 3B7MA 4AEKA 5CFDC 4CDWA 4NHMA 1PO13 1QMJA 3K51A 4RQPC 5CFCA 1UKGA 1BVVA 2A70A 4AHWA 5T5LA 3L9JT 1BEV3 3LOIA 3PNAA 3IM0A 3R6SA 2DF7A 5ACA1 1RUE2 3AM2A 4PBOA 5DUUA 1OQEA 3AXDA 5EXOA 3IKWA 3EQEA 1YFYA 4EWAA 3ETQA 4COWA 2C0ZA 5LRRA 3KGZA 4OHVA 1NCQC 4OI0A 1O4YA 4QPIC 3WG2A 3RMXA 2BGCA 4AI1A 1B09A 1AR63 5JOXA 1WLTA 2RS32 3RPQA 4OI1A 1RUF2 5SV8A 1WLDA 4COUA 5FDBA 1YYNA 2D7FA 1AYM2 3MIEA 1GSLA 4YGDA 4EWEA 2ZMKA 4MV2A 4LLOA 4M01A 4FPEA 1OA4A 1Y9QA 2YC0A 1O91A 3S30A 3ZFEC 3CJIB 4QQLA 4Q1RA 2VVDA 3ZFGB 3FLRA 5C9AA 1PZ9A 2EVXA 5AVPA 3ZSLA 4DOUA 2WIIB 4RR3B 2I2SA 3AKTA 1JW6A 4QQHA 4YG3A 2NYYA 4HN0A 1QJY3 4YGCA 2EXJA 4S2FA 1O3TA 4Z82A 4Q2FA 2XUMA 1K5MA 1AVBA 2AGSA 2VUAA 5GLUA 3ZYRA 3ILNA 2D44A 5CG9A 4Z1VA 2R1BA 3ZSJA 2JD4A 4N53A 5T3NA 3POSA 3D4KA 3GZTB 3O0VA 2ZHNA 4AEDB 3SITA 3WP5A 3DPRC 5BXXA 4KH9A 1X82A 4R9DA 1BEV2 2R32A 4HANA 2AYHA 3WW2A 5JIUA 3J9SA 4JGYC 4NPRA 1E57A 4GB32 4Q4Y2 4Q4X1 1KRIA 1PNFA 2BW8A 1VBC1 3APBA 4J1WA 1W0PA 1R1A3 4KWJA 2WKKA 5DG1A 1ZREA 3RYRA 5C6CA 1G86A 2I74A 3PHMA 4H55A 3DKWA 2XBO1 3DN7A 3WDVA 4FQZA 1QXPA 3M1HA 5CADA 3SH3A 5CG8A 3MIHA 1AL21 3RDIA 4CDXA 3GBGA 1R1A1 1D4M3 3MW4A 3S7IA 2GC2A 4RHV1 5HXVA 2YDEA 3TBDA 1XYNA 3SHRA 4U2AA 2CTVA 4MGKE 5GZFA 3FMGA 2DCJA 3NVCA 4WM8A 2ZHMA 3VZMA 5KBFA 4QQOA 1H8TA 3HWJA 3JBG2 3NV3A 5K7PA 4YW3A 1FATA 3B94A 2XH6A 4RS5A 2RM23 1VBE1 3WOGA 1QJZA 1NZCA 3KZ4C 1DZRA 4YW4A 5C33A 5JSOA 1MEC1 1FXZA 2CWMA 1LOAA 2Y0IA 4AGGA 1FI2A 1R083 1ZZ9A 4O9EA 4IEYA 2QQPA 1JXNA 5BUVA 2B7YA 3GF6A 1TMF2 5GM0A 3VUOA 3M3CA 1RUD2 1OLQA 4YG6A 4YVWA 1UW8A 4EN0A 3WVJA 1QJX3 4N9HA 4RQPB 1FMD2 4FTBA 1Q5OA 4IV3B 4O9GA 4E2SA 2OW4A 2WZR1 4TZDA 4IEVA 1H1IA 4K3UA 4M3CE 3ZFEA 4XBQA 4IL7A 1QJU2 4ATFA 1SACA 2NZ9A 1AL0G 1H2LA 1QH6A 1WMFA 2WS93 3MICA 4QPIA 2RS13 1SCSA 5FRAA 1FV2A 1HRV3 4AEJA 2VNGA 1BVP1 4JRAA 1FX5A 1ONAA 1SBFA 5JLVA 4FPOB 1WW6A 1EY2A 3WW1A 5JR7B 3WW4A 2HWF1 1R082 4JDOA 2VULA 1UMZA 1OA3A 4PIZA 4YVSA 3AMHA 1PK6A 4IV3A 1Q8OA 4BLIA 2BFUL 2WWSA 4XTMA 2R16A 2WFPA 1GFF2 3MYXA 2BPA2 4W6WA 3O5SA 1PK6C 5I8YA 1W6MA 1KDKA 5JI9A 4XFBA 5CAZA 5K9YA 4GKYA 1VBB1 3KB5A 3NAPA 4YW2A 2JJ6A 4DFSA 1ND2B 1RUJ1 3TN93 1VRH2 1WW4A 4MSVA 1H4GA 1MQTC 2R062 3FHIB 5T5OA 3TRSB 2CGNA 4J1XA 3VBFA 3S7EA 2BNOA 1AYN3 3KCYA 2HEWF 2PQQA 2NLRA 1IOAA 1S0GA 1A8MA 2BFUS 2E7QA 3GYDA 3WHUA 4Y26A 3V0BA 4FPKA 4WM7B 4GWNA 4CDUC 5J96B 1RUJ3 4N53C 2C5DA 5D8AB 2ETEA 3LZZA 4JDMA 4YM1A 2O1QA 4N43B 4Q4V3 4RD7A 5C4WB 4Q0VA 3ZFFC 5K8SA 5H9SA 3JQWA 5GLVA 4OHWA 5J09A 4K7JA 1NCRC 4L11A 4PIXA 2F6BA 4MXWB 1CVNA 3ZIXA 4HVRA 3N35A 3AXEA 1PVC3 1GQGA 2ZMLA 2OUHA 3U11A 5I0SA 5KHJA 3ZSEA 2ZZQA 1UIKA 3M3QA 5I8TA 3PVEA 2VH9A 2DUPA 1UX6A 2D6KA 4AVVA 2Z5WA 1S0JA 3NKTA 5F6LB 1HRV1 1LHWA 4I0WB 5DXDA 3E5UA 1LOEA 3O12A 1LOFC 3IPVB 3VZNA 5ABJA 5EFUA 2FZ2A 3LWCA 4YLZA 2BNNA 4B4RA 1CN1A 1IS6A 1TME3 1AR61 1DQ1A 2DFCA 3TYJA 3OBTA 1PVC1 3AYDA 3USUA 3AZXA 1CAWA 4JDNA 1YJKA 4IEZA 2H6CA 2PN5A 1QOTA 2R30A 5HCFA 3OGJA 3WNXA 3HT2A 1DF0A 1T6GC 1JOJA 4LO5B 3AKRA 3VBSB 1RHI3 4B7KA 3USSA 1LESA 2EXIA 2XKPA 1YNAA 4JTNA 3VBUC 5JIAA 2WNVB 1SEFA 1U12A 4XF0A 5C4WC 3RG0A 2QZ3A 3A4UA 1AUYA 4XYXA 1S0CA 1CAWB 1VB2A 1XNCA 2P3KA 2WSVA 4WBBA 5JI7A 2JXAA 2G9GA 4FAHA 4BIOA 5EV7A 2CY6A 1LOGA 4Q4W2 3JD72 2C1FA 4RR3C 2PHRA 5F9TA 4OI2A 1DG6A 3E6CC 1R091 1UCXA 3ELNA 3ZIWA 3UJQA 4H7MA 4INDA 1OOPA 1V6IA 4BMBA 4XJWA 5E16A 1QNWA 3J26N 4TYSA 1EPWA 1TEIA 2BVVA 1C8NA 4ISQA 2RR11 4F8AA 4S2GA 1LU2A 3RI8A 4Y22B 1PVC2 2X5IC 1C3HA 3AZYA 2WNUB 3WDYA 3GZUC 4YGEA 1DGWX 2O0OA 2DCYA 4MVTA 4B7EA 2KA3A 3ZXFA 1AX2A 2V73A 1B35A 1HX6A 2XGXA 2P37A 3WZ1A 2WA4A 5DDJ3 4FPCA 3WG1A 1HXS3 2OVUA 1YLLA 3AP6A 1NOVA 1LULA 4N43A 5KHIA 1PO23 2PHWA 3HMYA 3AYAA 5F6KA 5GZDA 3MEPA 4DINB 1TME1 3CLPA 1A78A 4M3CF 3VZOA 1PO21 1IS4A 4QT6A 3KT4A 3PVBB 1ALYA 2VMIA 3BODA 4CP1A 4DB5A 1RUC3 3CNAA 4MXWA 1UPSA 1VBA2 3KQRA 3O0XA 2JE7A 1PIV2 3ZN6B 1TQ5A 4MXVA 2R042 1J59A 4OHZA 4A3XA 2VQAA 3H9AA 4XPVA 2FMYA 4LO8A 4PBPA 1NLSA 1CJDA 4V1PA 1WLCA 2BWAA 4MLOA 1MS8A 2RM21 4D7TA 4JQRA 2EIGA 2JG8C 4QGMA 2ZGLA 4XFGA 2G9FA 2GNBA 4AEMA 2ZX1A 4BLJA 3E5XA 2UU8A 4XHXA 4FVVA 3WY6A 3ZO0B 1AR73 4IESA 4WM8C 5ABJB 2WT0A 3ZX7A 4KG0A 4I02A 2ET1A 2N7GA 2OZJA 2Z79A 4LBKA 1FT9A 1TNFA 1U0AA 1AL23 3ZXJA 4ZU4A 5FO7B 3WLUA 3TNPB 5T54A 3VBHB 3WQ0A 3H8UA 1UZYA 1ZBA1 4GMP1 2E9QA 4HFSA 3KLSA 4AQSA 1OQDA 1X7NA 1ENXA 3VLBB 3MPBA 1LB2A 2PHXA 3IBMA 2HWB3 4XFHA 4QXKA 5FAXA 2R6QA 2VVFA 4NHLA 2IXIA 4EN9B 2XL9A 4XFCA 1DGRN 2D93A 4CTEA 4XMIA 2H0BA 2RS33 3IMNA 2QKDA 4CDWC 5B2GB 3SH5A 4LE4A 1FMD3 2YGMA 4HT1T 3MFAA 1SDWA 4EN7B 2ZA9A 1POV0 2SLIA 4RHV2 1AR82 1VBA3 3KMHA 1DHKB 1RVF2 1DLLA 5FOJB 1HRI2 1WMDA 1OPMA 2EXKA 3OY8B 1F31A 4DY5A 2PLV1 3N7JA 1N1SA 3N7KA 1RMU3 4Y4YA 4BA6A 1QQP1 2PHFA 4FPFA 2RS53 2HWE1 1ULGA 4Q0UA 2B39A 1WBFA 1Q8SA 2WFF1 3IDCB 4LE3A 3GHMA 1C8M3 4GB31 2DV9A 4YYOA 4R4XA 1H2NA 4YVSC 3HIFA 4AHXA 2BWCA 5H9QA 4DQAA 1UU5A 2CAUA 2GSYA 3JU9A 3KD4A 3UL2A 4NO4A 4KNCA 4YM3A 3MI8A 1MQTB 3E97A 2XG3A 4AQ2A 3VDDC 3OY8A 5JOZA 1APNA 1LGNA 3DPRB 3POYA 4HLTA 4D69A 4AHYA 1NXD1 2Y0OA 4FT8A 5I0RA 4E4DX 3NAPC 4SLIA 4XJUA 4LUMA 5J98B 1VAVA 1BQPA 2ZGRA 2ZX2A 1G9CA 1VIWB 1LHVA 5FTTC 1OA2A 5L36A 1R092 3VHNA 3QBQA 5KXEA 1HXS1 4AQTA 1G9BA 2DVDA 4P9WA 3M3IA 4YFWA 1C1LA 4Q0PA 2WQ4A 2ZAAA 3NWKA 4ZU7A 4XQDA 1HW5A 1I9RA 1PO11 4D7SA 4NOTA 1RB8G 2K0GA 4XJAA 3ZFEB 2GN7A 1VBA1 3NL1A 4WM7A 5T5JA 1SLCA 1XE8A 1DDLA 2AR6A 1LHOA 1UPIA 2GMMA 4YM0A 1REDA 1XYOA 4IEXA 3DV8A 2Z42A 3AP5A 4ZKTB 1UU4A 4I0AA 4HETA 4KQ7A 4UBGA 2B42B 1R093 1ENQA 3ME2A 4RSUA 2A6WA 4EWDA 2ZHLA 4M3CB 3UJOA 5CFDB 5J3UA 4LBMA 2Q1ZB 1GNZA 4AVBA 4BYYA 3M8LA 3CF6E 5A33A 2NN8A 4E2GA 1AYM1 1GR3A 1WA4A 1DU3D 2VG9A 3AJYA 1FPN1 4UBHA 3OCPA 2ZZJA 3VBHC 2TEPA 3NV2A 2HWE2 3VZJA 3PJQA 2O8OA 2XVLA 5D8AA 5I0UA 1ZVFA 4CYDA 1RIRA 1RTVA 3SCHA 4R4ZA 2B45X 4Q1PA 5CBLA 2DWRA 2PHDA 3LCPA 4XQWA 1W39A 1LCLA 4I3GA 1POV3 1NQDA 2ZX3A 2E6VA 4A2UA 3VHPA 2VMHA 2HKXA 4ATEA 1YFXA 4FP3A 3ZXKA 4QPIB 1Q8VA 2AENA 2WL1A 5BYNA 4LHKA 4Q8KA 4KU7A 2ATFA 2VW0A 4I01A 4BOWA 2D43A 1Q56A 4YVWC 4AVSA 4WVZA 1S1AA 2P2KA 1PO12 2VOWA 3HBZA 1SBDA 3MDPA 3SLIA 2EAKA 3V64A 4FBFA 1IS5A 1RINA 1ULFA 5FPZA 2A3YA 5DG2A 5H9RA 1I6XA 3VHOA 5GZEA 4L97A 4XJ9A 1JTZX 2DU0A 2IZWA 1CAVB 4AFDA 4B4PA 1N1TA 4I3PA 4XXPA 2WC2A 2XJQA 3TNQA 5JCTA 1VRH3 4HKLA 3BIWE 1BK1A 5FREA 1NY71 3U0ZA 1JYIA 2ZGOA 1QF3A 4K21A 4MH0E 2JE9A 4AEDC 4QPGB 1CX4A 1H9PA 5I93A 1MEC3 2V5YA 1FOD2 3E5QA 4LTAA 4MGIE 5CNAA 4RA0A 3N36A 3GBWA 5EYYA 2YGLA 4FPYA 4IEPA 2IXKA 2HWE3 1Z7S2 2HWC2 4FO9A 3KT7A 3H7JA 4KBBA 1EV13 3T2TA 5K0UC 1YFWA 5LK7B 1BEV1 4D94A 1A6CA 1ZA4A 1ND3A 1Q3EA 4BCUA 4FOVA 3GHNA 5DUVA 4AW7A 3OYWB 1H9WA 4BM8A 3TWIA 1W2UA 2WS92 4AI2A 2HWD1 4PDWC 2A6VA 4IV1B 3THTA 2FZ1A 5EYXA 4B8EA 3H0OA 1L3JA 1YCIA 3OTFA 1DGRA 2ZTNA 1GZWA 3IDEA 3WP6A 3FZ3A 5IUQA 1M06G 5IK7A 3G7DA 1RL3A 1OPOA 2IXCA 3JD71 2LTNA 3PMEA 4BHPA 2JG8B 5EWSA 3D5OA 5KXDA 2W08A 4Y20A 1OQ1A 1S0FA 5JOWA 4CDQA 5F1RA 1H8VA 4PLMA 2VNRA 3WINE 1PZ8A 3AKPA 4QM9A 2DCKA 1OHFA 1YWKA 2LALA 2G4IA 5BY5A 2NM1A 3RNSA 1RUD1 1IS3A 2YHJA 4PJYA 4FP2A 1DQ4A 4S2HA 2R063 4FTSA 2P3IA 5CFCC 4ISRA 4FXKB 2VUJA 1QXRA 3GBFA 3FLPA 3N7LA 4XJZA 4XDQA 2RR12 2X5IB 2IC1A 3LA2A 1O3QA 5T50A 3ZMNA 2DURA 3A0NA 4Q4W1 3WCSA 2DVFA 5BNNA 3C2UA 1BXHA 2RM22 5FMOS 3ZXGA 3M70A 4I30A 2WS91 2F4PA 2GDFA 1KXGA 3M7AA 4Y1ZA 2XJRA 1PM7A 3JBG3 1F2NA 2WJSA 3AZWA 1UAIA 4IEWA 3AX4A 5BNPA 5LK5A 4JV4A 3LAGA 1C8M1 1LKNA 3DF0A 1GQHA 4AVCA 2VU9A 1GANA 3WUDA 2GC0A 2GNDA 1QQP3 4HKWA 3L2YA 3E6DA 3SISA 4AFAA 2R072 4Q26A 2PHLA 5C9AC 1KJLA 3KS7A 5GLWA 1U5IA 3VBUA 2GMPA 1I1EA 4AGRA 2TUNA 4AFMA 4PCRA 4X6QB 4Y1YA 2RMU2 2A5ZA 2R49A 1PZ7A 2BQPA 2PFWA 2YROA 2NP0A 4NWWA 4PQ9A 3HAGA 4HVOA 3DL3A 1EAH2 3RI9A 2RS31 3R4DB 3ST7A 1GLHA 3I4IA 1RUG3 3QACA 1S2KA 2YY1A 2D6MA 3ZMOA 1PGSA 1JBCA 4AI8A 4K20A 4RHV3 2DVGA 4FXGB 1GYKA 3EJKA 4TWTA 4W6XA 1SFNA 1C5HA 4Z8BA 1MVQA 4F3JA 2AZ5A 4URTA 3LGRA 1RUH1 2BBVA 2VOKA 2EF6A 2XL7A 1AXZA 1AR91 1VALA 1CONA 2DYCA 3B9CA 2HWB2 4LNVA 1J58A 1ZRFA 4XIOA 4G3YC 3WCRA 1AX1A 4PDWB 4AHZA 1HIXA 3FFQA 3VBSC 5FOBB 3U10A 5I0TA 1REEA 1X50A 5J36A 4LULA 4CDWB 1NYWA 1DQ6A 2VVEA 1LTEA 2VECA 4HVQA 1RHI1 2AH2A 3H1WA 3ZPYA 1ENRA 4CEYA 4YW5A 3WR0A 3M4FA 1RUI2 5HI0A 1IKQA 1HRI1 2AUYA 3H50A 4RS5C 2ZGUA 2ES3A 3AZVA 3CO2A 5LEJA 5JPMB 1M4WA 1XQNA 3OF1A 3B69A 4GQ7A 1LU1A 4JGZC 5ACA2 4SBVA 1SLIA 4FQ4A 1VAKA 4FSJA 1CPMA 2GNMA 4YVSB 1AJOA 1XNBA 2ZGQA 1RUJ2 5GLZA 1ZNPA 4BE3A 1LR5A 3QD6A 4YW1A 1H2MA 4AVAA 3