3JD71

The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
270
structure length
270
Chain Sequence
GRVADTVGTGPTNSEAIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSVPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title The novel asymmetric entry intermediate of a picornavirus captured with nanodiscs.
pubmed doi rcsb
molecule tags Virus
total genus 32
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jd7100
1AUYA 4Q4X3 2HWF3 1ZBA3 1X36A 1AL22 1QQP2 1AL21 1QQP1 1VBB3 1VBD2 4CEYA 1VBD1 4FTEA 3LOBA 4CDXC 3VDDB 1RUG3 4CEYB 3VDDC 1BBT3 4Q4Y3 3VBOA 4JGZA 5ACA2 5ACA1 1RUE2 4CDQA 1RUE1 1EV13 2GH8A 4CEYC 4PDWA 3JD73 1C8M3 1RUF3 1MQTA 4GMP0 3ZFEA 1AR93 1RUH3 5ABJA 1MEC2 1ND3A 1MEC1 4PDWB 1VBC3 1HRI3 4PDWC 3VBHA 3ZFEB 5ABJB 1M06G 1ND3B 1OHFA 1ND2A 1F8VA 1AYN2 5ABJC 1AYN1 2WFF3 4IV3A 2RMU3 5BNPA 1RUI2 2R072 2HWE2 2R071 1PGL2 2RS13 1RHI3 4WM7B 3JB8A 1R083 1EAH2 4IV3B 1EAH1 1H8TA 5C8CB 5BNPB 3HAGA 1VBA3 4WM7C 4RR3A 4IV3C 5D8AB 5BNOA 1E57A 1NA1A 5BNPC 1QJY3 5C8CC 1AR62 1AR61 1AYM3 5C9AB 1Z7S3 3JBG3 1QJZA 2Y26A 5D8AC 1NCRA 4N53B 4YVWA 5J96B 4Y5Z0 4CEWA 5BNOB 5C9AC 5L7OB 1NA1B 2RS33 4N53C 4Q4W3 5L7OC 5BNOC 1NA1C 1QJU3 1R1A3 1QJX3 5CFCB 1CD3G 5CFCC 1ZBA2 1ZBA1 5A32B 1RMU3 4Q4V3 4AEDA 3ZXAC 5AC93 5K0UB 2HWC3 3JB4C 4N43B 4RS5A 4AEDB 4JGYA 5K0UC 1RUG2 1RUG1 4N43C 4AEDC 3DPRB 4Q4Y2 4Q4Y1 1EV12 1EV11 3DPRC 4GMP1 4NWWA 4FTSA 4CDWA 5C4WA 3JD71 1PVC3 1C8M2 1RUJ3 1C8M1 2R043 1OPOA 1POV0 1RUH2 1AR91 1RUH1 4GB32 4GB31 5LK7B 1ASJ3 2WLPA 1NG0A 1HRI1 1IHMA 2DF7A 5BNNA 1PO23 4IV1B 4CDXA 5BNNB 1FPN3 2RMU1 4IV1C 2RS12 2RS11 3VDDA 5BNNC 1R082 1R081 4CDXB 1RUD2 1RUD1 5CFDB 2HWD3 2RM22 1VBA2 2RM21 1VBA1 1BEV3 2R063 2WZR3 5CFDC 2XBO3 1Z7S2 1NCQC 1Z7S1 1VB4A 3JBG1 3JBG2 2PLV3 3VBUB 1FMD3 2RS32 3NAPA 2RS31 1V9U3 3IDEA 4Q4W1 1TMF2 4GH4B 1TMF1 4Q4W2 3VBUC 1R1A2 1R1A1 2RS53 1QJX2 1QJX1 4GH4C 1CJDA 4Y4YA 3NAPB 5A33B 3NAPC 2MEV3 4WM7A 3J8F3 5AC92 5AC91 1VBE3 2HWC2 5DDJ3 2HWC1 5C8CA 4QPGA 3S6PA 5FMOS 1TME2 5D8AA 1TME1 4BCUA 1HRV3 1RB8G 5C9AA 1HXS3 4QPIC 1K5MB 2GSYA 4QPGB 4N53A 4YVSA 5L7OA 1POV1 3TN93 1K5MC 2WS93 4LLFA 4QPGC 1R093 1RUJ2 1RUJ1 1RVF2 2R042 1RVF1 2R041 1ZBE2 2ZTNA 1ZBE1 4YVSB 5CFCA 2BFUL 3CJIB 1VRH2 1VRH1 1ASJ2 1ASJ1 4YVSC 2IZWA 1QQP3 3CJIC 3VBSA 5A32A 1VBD3 1PO21 4CDUB 4Q4X2 4Q4X1 2HWF2 2HWF1 3VBSB 4CDUC 5K0UA 1PO13 4N43A 5ACA3 1RUE3 3VBSC 1VBB2 1GFF2 1VBB1 3DPRA 2HWD2 2HWD1 1AR73 2WZR1 3ZFFB 4RHV3 1BBT2 1BBT1 2PLV2 2PLV1 2ZZQA 3ZFFC 2BBVA 4RQPA 1HQNA 1FMD2 1FMD1 2BPA2 3JD72 5JZGB 1V9U1 1AYN3 1RUF2 1RUC3 1RUF1 1AR83 1AR92 4RQPB 5JZGC 1FOD3 1NY72 1NY71 1RUI3 2R073 1VBC2 2HWE3 1VBC1 5J98B 1HRI2 3ZFGA 4RQPC 4IV1A 4Z92B 2MEV1 1B35A 3ZFGB 3J8F2 2WFF2 3J8F1 2WFF1 1VBE2 2RMU2 1VBE1 5DDJ1 5DDJ2 5GKAC 5CFDA 3ZFGC 1PIV3 1B35B 3VBFC 1NCQA 1RHI2 1RHI1 1B35C 2XPJA 1NCQB 1DDLA 3TN92 1QJY2 3TN91 1QJY1 1AYM2 3VBUA 1AYM1 2WS92 2WS91 1R091 4GH4A 1F2NA 4FTBA 2BUKA 1SMVA 5A33A 1QJU2 1QJU1 1VB2A 2ZAHA 1C8NA 5FMOL 1PO12 1PO11 1RMU2 4Q4V2 1RMU1 1X33A 4Q4V1 4QPIA 1COV3 4GMP3 2VQ0A 1D4M3 2FZ1A 1AL0G 2X5IA 3VBOB 1K5MA 4JGZB 1AR72 4QPIB 1AR71 4CDQB 2RR13 4GB33 3VBOC 4RHV2 4JGZC 4RHV1 4CDQC 2X5IB 3M8LA 4EJRA 1MQTB 2HWB3 2X5IC 3CJIA 1MQTC 1PVC2 1PVC1 3ZFEC 1RUC2 1RUC1 1ND3C 3VBHB 1AR82 1W39A 1AR81 1FOD2 1ND2B 1FOD1 3VBRA 4CDUA 1RUI1 2HWE1 1PGL1 3VBHC 1AL23 1ND2C 1RUD3 2RM23 1PO22 3VBRB 2TBVA 2QQPA 3VBRC 1FPN2 1H8TB 1FPN1 1A6CA 4SBVA 1PIV2 1PIV1 1VAKA 4NWVA 4RR3B 1H8TC 4RFT0 3ZFFA 4RR3C 1TMF3 1NCRB 1BEV2 1PGW2 1BEV1 1PGW1 2R062 2R061 2WZR2 4YVWB 4CEWB 1BMV2 1BMV1 2XBO2 2XBO1 1MEC3 2FZ2A 1NCRC 4YVWC 5JZGA 4CEWC 4FSJA 2BFUS 5FOJB 1V9U2 1NOVA 2RS52 2RS51 4WM8A 1TME3 3VBFA 1EAH3 2MEV2 4RS5B 4WM8B 4JGYB 1HX6A 1COV2 1COV1 1POV3 1OOPA 3VBFB 1AR63 4RS5C 4WM8C 1D4M2 1D4M1 4JGYC 3FBMA 1WCDJ 2WWSA 1RVF3 1ZBE3 1HRV2 2RR12 1HRV1 1OOPB 2RR11 1VRH3 4CDWB 5C4WB 1HXS2 1HXS1 1OOPC 4CDWC 5C4WC 2HWB2 2HWB1 1R092
chains in the Genus database with same CATH superfamily
4Q4X3 2QCSB 2XL7A 4C0BA 2J22A 3OD0A 5D2AA 2VY0A 4KGGA 5HV4A 5FZGA 2ZX0A 4KBZA 4KH9A 4HSJA 3DECA 5E16A 2DVDA 4IEWA 3FMGA 3DEMA 1BXHA 4DRRA 1JTZX 3UJOA 2R0HA 2JDPA 4WZFA 5I0TA 4H7MA 3VLBB 1OT5A 1I1EA 1HQWA 3VDCA 1UZVA 3U78A 4CA9A 5FYMA 4AF9A 3E5QA 4FAHA 4Z8BA 4JC1A 1GLHA 3VDDB 5GZEA 1T6BX 2O14A 2PHTA 3NNMA 2WINB 4P5YA 4CXWA 3HNBM 4XZPA 5ACA2 5ACA1 3SEEA 4R9CA 5H9PA 4XYXA 5DAQA 3AFKA 2WDBA 1DGWA 1W6QA 2Q4SA 4UFKA 4A7KA 1Y9QA 4A7ZA 1TQ5A 4FT8A 2FBEA 3IDCB 1C8M3 1RXGA 2ETEA 1MQTA 2VD7A 4BZ4A 4KWJA 2D98A 4A42A 5FPVA 1W6QB 3NQHA 2DU0A 3AKRA 1ND3A 4M0NA 4P00B 4U2AA 4XMIA 4LIUA 3ILFA 2C9KA 2R7EB 3I3EA 4BB3A 4BQ2A 4CSWA 1HRI3 4QMAA 1UXZA 2FDHA 1TG7A 1OA3A 3A0KA 3LEKA 4CE8A 4UF0A 4YW2A 1M06G 3V65A 1ND3B 1OHFA 3I2GA 4M01A 2W1QA 4LKEA 4KGQA 4IL7A 5ABJC 1D2QA 1SEFA 2WFF3 1LOBA 2RMU3 5C8CC 4UF0B 5BNPA 3KV9A 5FP9A 3K77A 4OI2A 2A3XA 5K7PA 2HWE2 5FV3A 5FZAA 4CCDA 4LHKA 2VL4A 1JZ7A 3AZWA 5FZ7A 5C8CB 1OF3A 1RC6A 2BV4A 5BNPB 1I5PA 1ZRRA 2VZPA 5T52A 4DFSA 4DMIA 1YQ5A 4WVVA 2YC4A 5B4XA 4IV3C 3SMHA 1E57A 2OQ6A 3E5UA 1V6KA 1J83A 1VALA 2AH2A 2V4AA 1GZCA 3R05A 2DTWA 2EXJA 4CPBA 4YSFA 1NCRA 3OGJA 5IWFA 3ZSEA 5I93A 4COZA 1IS6A 1Q5OA 4XUPA 4Y5Z0 4A41A 5F3GA 4CEWA 1BK1A 2XWBB 1W05A 3N7JA 3N9OA 2E63A 4JDOA 4L99A 2UWBA 4N53C 5FP4A 1AX1A 3SCHA 5L7OC 3WZ1A 2DVGA 2A73B 3CBNA 5K8SA 3LA3A 1QJX3 2WT1A 1GMMA 1W8TA 1SHWB 3ALQA 1C5IA 2RJ2A 2ARXA 3MV11 3B69A 1CD3G 3FHAA 4NROA 4AVVA 3LEMA 5FZFA 2WIIB 2WC2A 5JR7B 3POWA 2LUWA 2Y8KA 3OYWA 3ZXEA 5HBAA 1OFSA 5C6CA 3BCWA 1H4HA 4IE4A 3IBMA 2SLIA 5K0UB 4TSVA 3K3NA 1BVP1 3WF4A 4N43B 2W9XA 4ATEA 4JGYA 1HV1A 1MPXA 3W58A 1TNFA 4AAXA 1PMJX 2GNDA 1XNTA 2ZGNA 3J7MA 1W2TA 3CZJA 4UW4A 1EYBA 3V0AB 4OLLA 3T09A 3O1VA 1YQCA 2C5DA 4WVZA 3DPRC 4LBQA 2W39A 4LOSA 3ACHA 4NWWA 3IAPA 1KS4A 1C8M2 1RUJ3 1C8M1 2G9FA 4MHUA 1W6PA 4LBQB 3BOWA 4QU1A 1YRZA 3ON7A 4PHZA 3ITQA 5LA0A 1ASJ3 4P9LA 1YYNA 2WLPA 4LO6B 2A7AA 4DOUA 4DUXA 3UNPA 1XE8A 1HRI1 2GC1A 2Z69A 4CXYA 1GP5A 4H7LA 5HCBA 2ZGSA 2KD7A 5BNNA 1GKBA 4FFFA 2BWCA 2WZPP 2QQNA 1NLQA 2B5HA 4E4ZA 2W5FA 4HPKA 4AQ6A 3KCXA 2VMHA 2EIGA 2VOTA 1YIPA 1ZYBA 2P3IA 1PX3A 5BNNB 4QX0A 2RMU1 3B02A 1OD5A 1APNA 1CQ9A 1XJAA 5FP3A 2AENA 4HPKB 4IV1C 5LZ6A 3NNJA 1J3QA 3BTYA 2A6YA 5FPAA 3ACLA 4Y1VA 4YW4A 4Q1RA 4W6XA 2JWPA 1YC61 3VD7A 3ES4A 5CFDB 1JZ6A 3J4UH 1WWYA 1SG3A 3TBDA 4FVVA 1LULA 3GYDA 3NNGA 3C7GA 1LR5A 2I45A 5KR7A 4IUGA 3H1MA 4DNYA 2VJXA 1HB1A 3VBUB 5FYZA 4RSUA 5LA2A 5APAA 1XQNA 1W06A 3PL0A 3NAPA 1H9PA 2JD9A 1TMF2 1TMF1 2FCTA 4M3CE 4BOWA 1R64A 5GLTA 1QJX2 1QJX1 1UY0A 3AMHA 1H0BA 4GH4C 4Y4YA 3NAPB 1DGWX 3IIAA 2J7MA 3OPWA 1IGOA 4IGOA 2JJ6A 5FY5A 2XJPA 1M4WA 2XB6C 1JBCA 3SXWA 3K2OA 3QLQA 3ZM8A 2VCBA 4GA9A 2A6XA 4ASKA 3R6SA 5IVFA 4IE6A 1WA6X 2JX9A 4XAEA 2UY8A 4PBOA 4HL0A 4C90A 1VBE3 2E7QA 5DDJ3 1S4CA 3SH3A 2F17A 4AEJA 5FCCA 1RUNA 5FMOS 5D8AA 3W21A 4BCUA 4P02B 1PZ9A 5FPUA 1GOHA 3TYJA 2FMYA 1RYYA 3WHUA 2VCMA 3IMMA 2PHDA 2P37A 3DUIA 3LA2A 3VDAA 1KDMA 2YFUA 5T5OA 3TN93 3AVSA 3WQ0A 2HEYF 2HH9A 2WS93 4NRQA 4Z2AA 3FFZA 1MS9A 3RZKA 1JUIA 2DBNA 2YU2A 4PI0A 1RUJ2 3P1IA 1RUJ1 1JUHA 3HBZA 4QHZA 3MZHA 4AI3A 2IWGB 1TE1B 2WR9A 1ASJ2 3SLIA 1ASJ1 3BU0A 2ZGMA 4UOJA 5IHRA 5IYYA 1Y9MA 1SDWA 2IZWA 1QQP3 5CZKA 3WR0A 1DLLA 2W47A 1ULDA 5C3PA 3VBSA 5A32A 2GMMA 2ET7A 3ILNA 1HJGA 1VBD3 2XL9A 4MGYE 4X6RB 5FXWA 1W0PA 4CDUB 1MS4A 5A3UA 1C57A 2HWF2 2HWF1 2ZHLA 2A3WA 1H2NA 2WQZC 3VBSB 4HN1A 4B1LA 3PLQA 1AZDA 4MG2A 3I2FA 1DG6A 2VZ1A 4JTOA 2WAOA 3THDA 1RUE3 4LJHA 5FRAA 2N7GA 4NMIA 4FO9A 1GFF2 4UFHA 2VXJA 3HPNA 3MBWA 2VOXA 4AGVA 1N3QA 4MX3A 3ZR5A 4QX5A 3VKFC 2PHLA 3KHCA 1CJPA 1JU3A 3ZFFB 1E5RA 3EJKA 1UW8A 3IT8A 2DTYA 3I2DA 1F15A 1US2A 2FCVA 2ZZQA 3ASIA 1UOJA 2VVFA 3GBWA 2QUOA 1E5HA 4ONUA 4AI9A 2BPA2 4TXWA 5JZGB 3AJZA 2Z79A 2XOMA 4OUEA 5BV6A 2Y6KA 1UY1A 3DF0A 3PDQA 4QX2A 5FWEA 5FBJA 3UYJA 3ZPYA 5HV0A 2XUMA 1AR92 3BOPA 2P5BA 5AVAA 4FPHA 1FOD3 3UT0A 1UMIA 3E5XA 1NKGA 1VBC2 1VBC1 1AF9A 3HQXA 4O7XA 5GLVA 1WLWA 2B4KA 1MACA 4M3CA 1LCLA 2R0FA 4Z92B 1B35A 3HMYA 1LECA 1G7YA 5ANNA 5IVBA 4JRAA 1YFUA 1W6NA 3HNMA 4XTMA 3U10A 2YFZA 5T5PA 3VZMA 1VBE2 5DDJ2 1VBE1 5DDJ1 5EQUA 4PBPA 1B35B 3ZSJA 1W99A 1VMFA 3K51A 4QQLA 4NIIA 5KC5A 5JUVA 4G9SB 4MGQA 1W6NB 5FO7B 4D94A 1Q8QA 1N1VA 4KWLA 3RFRA 3AXDA 4NHLA 4GKXA 5L19A 2JG8A 3MV01 1OUXA 1JW6A 1JOBA 1QJY2 2VMGA 1QJY1 2WT0A 5D21A 3TN92 3TN91 2PAEA 2WS92 2WS91 4KL1A 5EYXA 2CGPA 1H9WA 2QQWA 3LFIA 3SNMA 4Q0QA 2JG8B 5CYYA 5G05L 4Y22A 3ZMNA 2D5HA 3V0BB 1YJKA 1WW5A 5FREA 4DINB 4MXWB 1HN1A 4FP3A 3Q8EA 3N7MA 4EN6B 5EV7A 1SMVA 5FMCA 1HV0A 1O91A 4Y22B 5JAXA 5AFEA 2HBTA 1WMDA 2VGDA 2XVKA 1YXWA 2W1WA 4LXLA 4E8CA 5A3NA 3OJBA 4QB1A 1UYXA 2W0XA 1BQPA 3O1UA 1XNKA 1IPJA 2F6BA 2ZAHA 1C8NA 1IOAA 3AYDA 1ZRDA 3KMHA 3H7JA 3UJQA 3MUZ1 1CAWA 4NHKA 5E8AA 4HKWA 2K46A 4COVA 1WUVA 5CISA 2FHRA 5CKMA 1SLAA 3TNPB 4Y1ZA 3MIDA 1W04A 5LBCA 1ZZBA 5A80A 2WT2A 3U75A 1K5MA 1ZZCA 1CAWB 2TEPA 3SH5A 5A7SA 4W6WA 4BQ1A 4XQ4A 5L9BA 4CDQB 5FR3A 4PJYA 2WUHA 4YZ5A 5FO8B 5JWPA 4JGZC 2XHNA 5CG8A 5JCTA 5I0SA 3OCPA 5KHKA 1W9SA 3M8LA 4FAGA 1JYWA 3LEGA 4NIHA 1W2OA 2ORXA 4EN0A 1UX6A 3BTZA 1U0AA 1YQ2A 2Q1ZB 2W1SA 3LIGA 3OGRA 4LULA 3M3OA 1OUSA 5SV5A 3ZFEC 5FYUA 2VQTA 5IK4A 2VW0A 4Y1XA 3WDYA 2Z5WA 1FOD2 1FOD1 3JZVA 1PGL1 3ZIXA 2DDUA 2HEVF 2A6VA 1ENXA 3LKJA 1RUD3 1W9WA 1H6XA 3VZOA 2RM23 2JG9C 2TBVA 4QHBA 1GSLA 4M4RA 5FMDA 5C33A 3LQCA 4KWUA 3WG4A 4E8DA 1S0FA 3AXEA 2FDFA 3UGFA 3LOIA 2VG9A 1XSQA 3N3HA 4FPOB 4NRMA 1SBDA 5JI9A 2I07B 3KLSA 4LQRA 4XDOA 2EVXA 2BVBA 2LTNA 2YBSA 5FXZA 2ZXQA 3ZDVA 4GWMA 1ZX5A 2DCYA 2H6CA 2WZR2 2CV6A 3Q8BA 2CNAA 1BYHA 1MVEA 1QDCA 3BODA 4L0PA 4A4AA 4D7TA 4EZHA 4B7EA 2VMCA 4FXGB 1LGCA 5FP7A 2C4XA 4FSJA 4PIXA 2YMZA 3MPPG 3M3QA 2LS6A 2WZ8A 2BGCA 3MO4A 5G04L 2TNFA 2WA3A 4YG0A 4I0BA 5DZEA 4YG3A 4WBBA 3ZLIA 1LHNA 1V9U2 2ZABA 3KB5A 3WQ7A 3U0ZA 4RL7A 2JE8A 1RUOA 2RS52 2RS51 3GALA 4K1ZA 1CIYA 1X9TA 2EIEA 4H14A 5HI0A 1QF3A 3M3IA 1Q8VA 1KGYA 3WQ1A 3VBFA 3AM2A 5A6ZA 4HKLA 1EAH3 4Z82A 3GF6A 4RS5B 3HBKA 5HCAA 3RZMA 1U5YA 2ZKNA 5DABA 4C0HA 3DXTA 3IMNA 3VZJA 1CVNA 3LSDA 1O4YA 1POV3 4L2NA 5FUIA 3VBFB 4UT5A 4P9IA 4AQ2A 4D69A 2E32A 1WCUA 1J1LA 1WCKA 3RZLA 1GQPA 2WWSA 4HVRA 1NAEA 4BQ3A 1GV9A 1HRV2 1UZ0A 1HRV1 4UW5A 5SV8A 2W46A 2BNNA 5C4WB 4J25A 1W90A 1KEXA 2OZ6A 2JIGA 3AMNA 1F4AA 3JXSA 5A3LA 1DYOA 4XE9A 1OOPC 5F6LB 4CDWC 2VR4A 3IPVA 2GC2A 3WNXA 2EALA 4AFMA 1S2KA 1DQ0A 4XVHA 1VLNA 1OD3A 2H6BA 2JDKA 1XBFA 4HZFA 1IS4A 2ZEYA 1O4TA 1X36A 2Y60A 3PUHA 4A2UA 2BOJA 3OY8A 3RVHA 1W8WA 3LEIA 1VBB3 1YI7A 3FZ3A 3N9PA 4XETA 3ZN6A 5FZ1A 3QACA 5GJ6A 3N4MA 4NUBA 4YW6A 5LRRA 4CDXC 3VKMA 1G9AA 4Q5OA 3BUCA 4A44A 1GUIA 3UKVA 4P9JA 4OQ9A 5J36A 4RFRB 2D6KA 3DYOA 3ST7A 3IN9A 3NJVA 2HEWF 3ZN6B 3K46A 5DAXA 1W0NA 3VBOA 2W3JA 4Q4Y3 4PI2A 4LO5B 5L36A 3SKJE 1SCSA 1GP6A 5T54A 2GH8A 4CEYC 4OHWA 1JN2P 4EROA 1RJ7A 3JD73 5KC6A 2DWRA 2JDAA 1CZVA 1RUF3 2PYTA 1GP4A 4FPFA 3D8CA 5ABJA 1ALYA 1RUH3 1V70A 3LE0A 2E31A 2BNOA 2VUJA 4KI5M 1LESA 1OURA 1CGPA 3DGTA 1IG0A 1OPMA 1KQRA 4PDWC 1CAUA 3VBHA 4HFSA 5ABJB 1XYOA 5FZOA 3UGGA 1ND2A 2Q0AA 1AHSA 4XCBA 1O5UA 1NZCA 4OHXA 5BUVA 3RZJA 1AYN2 1AYN1 1D0HA 2E26A 3FUOA 4AXOA 2WNUA 1CAUB 4IV3A 4PF5A 5CBLA 4M0HA 5FZOB 3NWKA 2C9AA 2YGMA 2PN5A 1XC6A 2WWJA 3EQEA 5DXDA 3H8RA 4QAWA 3O1OA 1R083 1PMIA 2D97A 1EAH2 4FPCA 1EAH1 1H8TA 4IV3B 1UCXA 1EY2A 5J48A 3PIJA 3HAGA 3FLTA 2CGOA 1UX7A 4WM7C 4CCMA 4RR3A 4OHVA 1LOGA 5JMCA 5DAVA 4AL9A 2P4EA 1ZM1A 2Y6GA 4INDA 3ZXJA 1KD7A 5C3OA 3TEZA 1I9RA 4MADA 2VZVA 3EBRA 4UBGA 4CCKA 4N53B 4YVWA 4D7YA 5L7OB 5C9AC 4QX1A 4META 4XF0A 4PLMA 4DXTA 2ZX2A 4NIGA 1ODMA 4Q4W3 2VMEA 5LB6A 5DPNA 1NA1C 3MYXA 5L9RA 4ES8A 5HPOA 3GJBA 5FDBA 5FYBA 3AMPA 1W8HA 2WL1A 3DXUA 1QHDA 2Z4FA 5CFCC 4OFGA 1SBFA 4EN9B 1J59A 1L7QA 3WOGA 5LRSA 5F5AA 5H9RA 1W9TA 1HIXA 4L92A 2V72A 4C1WA 3OBAA 4COYA 5AC93 2J1VA 5GM0A 3L2HA 5A1FA 2XJVA 4F83A 1UPIA 2GNBA 1X82A 2WNVC 1W6OA 1U5IA 3MI8A 5KHIA 3DPRB 2I74A 2XJRA 5L73A 4Q4Y2 2BZDA 4Q4Y1 3MUY1 4QT6A 1QY4A 1REEA 5CNAA 2HLEA 1DP0A 1UOBA 3IWZA 4GMP1 4GJZA 1W6OB 4FTSA 4JDNA 4K40A 1AXYA 3JD71 1UIJA 4SLIA 2JDMA 2ZHNA 1WLDA 2JICA 3WDVA 5ERLA 4D0QA 3OG2A 4UW6A 1RUH2 2HYXA 1RUH1 4GB32 4GB31 4XACA 2PQSA 1V00A 3GZEA 4WVWA 1S2BA 3U11A 5C5UA 1NG0A 3S0MA 1IHMA 3O1RA 1IQAA 2YBKA 2ZGOA 5DUVA 4URTA 4XJWA 3M4FA 4R9DA 2B7YA 2OS2A 5FYSA 4Q0UA 1HKDA 1VMHA 3DCQA 4XJAA 4GZ9A 1SACA 4IV1B 4CU8A 1O3SA 4JKMA 4BK5A 2VQUA 1UMZA 4K8RB 5IK7A 1FPN3 3OBRA 5EFUA 3SH4A 5FZ3A 4BU2A 4AEKA 4CP9A 2ZJCA 3VDDA 5CVRA 3TAYA 2GU9A 1R082 1R081 2OQ7A 2BU9A 3LDRA 1H1MA 3K48A 1Y9GA 1JI6A 3PUAA 4NPLA 3OOXA 4MLOA 4CP9B 2IVJA 3NSTA 2R063 2D6LX 1WW7A 4KWKA 2QZ2A 3SKVA 4O9GA 4CPBD 2QE3A 4HVQA 2ZACA 4IQPA 1NCQC 1CR7A 3LAGA 3QH6A 2WLQA 2PLV3 3OSDA 2D6MA 1XSRA 3WP4A 1EPZA 5EPAA 1LHUA 3VKNA 4Q8LA 1FMD3 4AWDA 3D6EA 4FQZA 4YG6A 5K4LA 3UETA 4Q4W2 3IDEA 1A8MA 4GH4B 3E6DA 4Q4W1 3TOJA 5KXDA 3SITA 4NJ4A 2ZX4A 5GLUA 3KV5A 1WW4A 3T2TA 3BGAA 4S2DA 4LE3A 4QX7A 3TEWA 3C7OA 4FCAA 5A33B 1DQ6A 4Q1PA 2VAUA 3JCIA 3MIGA 2VE1A 2FDIA 3RI8A 3MDPA 1NQDA 2MEV3 3OPTA 4CRQA 2YY1A 3MF6A 5EWSA 2VOKA 3AP6A 3HOBA 5GLWA 1VJ2A 2ID4A 4I2OA 3J26N 5AC92 3DYPA 4D6RA 5AC91 3PUIA 5C8CA 1ZREA 3GZAA 2O8QA 1NT0A 1WMFA 5FZKA 1F4HA 3WLUA 4EWAA 2ZGQA 4LMFA 1J3RA 4ARXA 1H1IA 1TME2 5FIXA 1TME1 5FJKA 1RB8G 1IQDC 1J1TA 3VHNA 4DXZA 3MIHA 3EB7A 2VMFA 2DUQA 3WG3A 1QDOA 3KF5A 2VVDA 5B2GB 4LBQD 2WRAA 2GSYA 4I3PA 4AQSA 5F5CA 1SPPB 2ARAA 4UFMA 4FP2A 4Z07A 2ZBJA 2PMWB 3NV2A 5DAPA 5E1RA 3PMSA 1JYCA 1HW5A 1R093 1C1FA 1OVSA 1LAJA 1WZXA 1CONA 2BDRA 5CG9A 1RVF2 1RVF1 2EIBA 2WZEA 1ZBE2 1A8DA 1K3IA 1ZBE1 2BW8A 2NMNA 2ZTNA 4HONA 3LDBA 3RYPA 3T4HB 5KHHA 4A3XA 3I8TA 4GWNA 2GALA 3M70A 4HMZA 1OXCA 1GWKA 2WKKA 3H50A 1XU2A 3C7HA 2BNMA 3CJIC 1ZA4A 2B42B 3ZMOA 3NNFA 3KV6A 2WO3A 4EE2A 4NO4A 1YI9A 2FMDA 1UZZA 5IVYA 3RI9A 1V6MA 4Q4X2 4Q4X1 4QXCA 4E4SA 3RZHA 2KR2A 4YFWA 5K0UA 1PO13 3AP4A 3I7DA 3O7OA 1WGPA 3LGRA 4N43A 4TYSA 2CL2A 3TRSB 3OUJA 3POJA 5FZLA 1PK6C 3X29B 3CDZB 4EYUA 4AGGA 1JOPA 4UFJA 3H7YA 1F31A 3S5QA 3W5NA 4YLZA 3V0AA 1XPWA 2DCKA 3ORJA 4JRLA 1QXJA 5LEKA 1S0GA 4LNVA 3P6BA 4RHV3 1LOCA 2QJVA 1ENRA 3LB9A 4AHZA 3HIFA 2ZA9A 1D4VB 3VB9A 2PLV2 2PLV1 1MR5A 1UF2C 1FV3A 1OLRA 4M4PA 4XFHA 4DB5A 1OH3A 5I0DA 5IVEA 2ZMLA 4K7JA 1FMD2 2BBVA 1FMD1 3CO2A 1UU6A 5JR2A 1KDKA 4ES9A 3B93A 4FOWA 4CUCA 1RUC3 4HBNA 2KXLA 3NKTA 1SLLA 1UWWA 2Y64A 2QTWB 3R0RA 4K8FA 1AR83 4UFLA 1UN1A 5FTTC 5FYCA 1LOFC 1GICA 4C1XA 5C71A 2XG3A 1RUI3 1HLCA 1LKNA 2R073 2WAAA 5IAXA 5FLHA 1HRI2 2CAVA 4RQPC 4NPRA 2VCAA 3B01A 4LO7A 2P3JA 4QGLA 5F3IA 4QM8A 2MEV1 3RZGA 3THTA 1KXGA 1LEMA 2WO7A 1SLCA 1VE0A 4RGAA 4S2FA 1ODNA 2HYKA 2WFF2 2WFF1 2RMU2 1LTEA 4MGZE 3O0WA 5CFDA 1PIV3 3POIA 4NHXA 2E7TA 2Y34A 2V09A 4EWEA 3SC7X 2VNGA 4NVPA 2XPJA 5LA9A 1CESA 2W92A 1DDLA 4BM8A 3FUQA 3TWIA 2BBAA 3VBUA 1V6IA 5GZDA 4DIQA 4BXSV 1R091 1Q56A 3IDAA 1W9YA 1SLIA 4LORA 3O14A 3URFA 1P8JA 4AVBA 1W8NA 1NLRA 1RIRA 4FTBA 4Y1UA 2P34A 2BUKA 4HSLA 5BPXA 4AGRA 3WW1A 1T2XA 3BTXA 4H3WA 2XDVA 1OBNA 1QOOA 3AJYA 3KWVA 4OCTA 5FXXA 4GXLA 2V4VA 3NV4A 1YUDA 4M3CF 4HN0A 4LA3A 4LHLA 5FMOL 3VD4A 3T4VA 4GAZA 3U1XA 1PO12 3AB0A 1PO11 4XF4A 2PAKA 3C2UA 3PMEA 4AW7A 5F8PA 4YM3A 2ZZJA 2RDSA 4QPIA 3C8XA 1COV3 4N7IA 4QKFA 1V6NA 1YJLA 4XQDA 5LY1A 4B1MA 3A0NA 5FPBA 1Q3EA 2CU5A 2FZ1A 1W6MA 3E6CC 2ZKLA 1UZWA 4JGZB 5JI7A 4P14A 4Q2FA 2P2KA 1DLCA 4QPIB 1G9BA 2A3YA 3MGUA 1GR3A 1PM7A 3ZN5A 4CCEA 4RHV2 4XAAA 4RHV1 1W6MB 5FZMA 1H4GA 3AKSA 2RG4A 3WNMA 5C3QA 1I3HA 1H1AA 1RITA 1W8UA 2EAKA 1HJFA 2DUPA 2AACA 4EN8B 2XWJB 2DBIA 2X5IC 5FP8A 1JZ3A 1MQTC 2VW2A 3ABZA 3WP6A 2WSVA 1T6GC 4LBMA 1RUC2 3KD4A 1RUC1 4Q8KA 1LNSA 1GU3A 1ND3C 4LITA 1AR82 1W39A 1AR81 2ZGTA 3KT4A 5CB7A 2C6SA 3RMXA 3KCCA 4CDUA 1RUI1 2BRTA 5KXBA 3RQ0A 4PIZA 1W8OA 3HT1A 2JG9B 3IAQA 1G9FA 2VW1A 3MLKA 4U36A 1QH6A 2VZOA 4JX0A 5JMOA 4DUVA 2OPKA 1WD4A 3EYPA 4BDVB 1H8VA 3I97A 2EA7A 5KBFA 4AQTA 3VZLA 1S0CA 2ADEA 1XYNA 3POBA 2PAMA 1DHKB 2YG0A 2D43A 1MS5A 1WBFA 3VBRC 2AREA 2CYFA 4SBVA 1A6CA 5F5QA 5A1AA 3ACFA 3RZZA 3AZXA 1F5FA 1FNZA 1PIV2 3K4DA 1PIV1 3O12A 3VUOA 1DQ2A 4NE9A 3S30A 1J84A 1N3OA 2YC2A 3ZFFA 1CAVB 4AG4A 5JOYA 1OI6A 2OUHA 4DO0A 3KSCA 4R4ZA 1A78A 4XILA 4K1YA 5LCWL 3N9QA 1UOFA 5FZHA 1PGW2 2VNOA 1PGW1 4CCNA 4JKLA 1AJOA 5DQ0A 4BWOA 5JOZA 2XJUA 5EJ3A 2E53A 3WNKA 2L9LA 4RGKA 1DZQA 1U12A 2C1FA 1NCRC 2D40A 1QU0A 5JZGA 5F1RA 4CEWC 4EQVA 1G9CA 4XIKA 2XLFA 2OUJA 4BJ0A 5JOWA 1CZSA 1YQ8A 5FOJB 2W95A 4AHWA 2QQIA 4OI1A 3I3DA 4GJYA 3O0XA 1N1TA 1GANA 2ADDA 3R4SA 4PT6A 2BTVC 2BYVE 3POGA 2BGPA 4JHTA 3SCGA 3NJXA 3G7DA 4ORFA 3KM5A 4KG0A 1CWPA 1HN0A 2Q5TA 4BPZA 4QPWA 2R30A 4FPEA 3WY6A 2UYBA 2WYSA 4FFIA 4TTGA 3ZVXA 3WNPA 1G9DA 5A3OA 3U4SA 4XFGA 1PMHX 3ZYHA 1COV2 1VIWB 1COV1 2H0BA 1C1LA 4F3JA 1OOPA 3WD5A 1AR63 5CAZA 1PGSA 4JGYC 1WCDJ 3FL7A 5M0TA 3N9NA 2X53S 5A70A 4XW3A 1I5ZA 3B7MA 4QGNA 1OOPB 1VRH3 3L2YA 4CDWB 3WINE 4TN7A 2JDUA 5GZCA 1CN1A 4NAMA 3QCWA 4XFBA 4GQ7A 1YFYA 2ZHMA 3NNLA 4DPNA 3V0BA 2IXCA 3AYCA 4Y5TA 4LKFA 4LUKA 4MXWA 1AUYA 3VKOA 4AE2A 1UPSA 1ULOA 4V2VA 5F2SA 2YC0A 2VOVA 3GDBA 5IAVA 2DCTA 1H30A 1ZBA3 3Q8FA 4ITCA 4QKDA 4HOOA 4XFAA 3WP5A 4ZONA 5EJ1B 4B4QA 3FC0A 5AFBA 5CKNA 3T2PA 4AI1A 3ME2A 2PFWA 1QQP2 1QQP1 1S0BA 5JXHA 1Q8SA 5FPXA 1OVPA 1VBD2 1VBD1 4CEYA 2JENA 2O1QA 3NJZA 4FTEA 1GOGA 2A71A 1DF0A 1LHWA 2Y38A 1NLSA 4AVTA 4Q0SA 1RUG3 2IXHA 5FZ0A 5IFTA 3UL2A 1JHJA 2KA3A 2VBBA 4CEYB 1BBT3 2VXRA 2XGXA 3EHKA 1N47A 2ZGRA 4AK3A 4IEXA 1YHFA 1RUE2 4CDQA 1RUE1 4E2GA 1ZA7A 2PHUA 5T55A 3RRDA 1IZ3A 1UY3A 4PDWA 3CZUA 3VHPA 4KG8A 3C7EA 4XFCA 2PTMA 4BXFA 3N7KA 2GNTA 1FXZA 2J1UA 3N7LA 2ZAAA 4GMP0 4MGTA 4ZZ5A 5C5TA 5IJRA 3WDXA 4PDWB 4CVUA 1YEWA 1W9FA 3IM0A 5TSWA 5CIRA 2VMIA 3LF7A 3V64A 1I6XA 1QGLA 5I8TA 2UYAA 1UU4A 2W1UA 1H6YA 3I3QA 3LPFA 3FLPA 2Y0IA 2W08A 3IZOA 1O5LA 3AZYA 2PHXA 1FNYA 1N1SA 3MW2A 1LHVA 2LM3A 4BE3A 4K9SA 3V56A 3J7LA 4MXVA 3WVJA 2UWAA 4PF1A 1PGL2 5ANQA 4AI2A 1EP0A 2YROA 1RHI3 4A6OA 3H42B 4OI4A 4WM7B 3JB8A 5FFOC 3NVCA 4LK7A 2GMEA 1MVQA 5E88A 4HXCA 5FQ0B 4UAPA 4P5HA 2XQRA 3Q8AA 3TEXA 2VVEA 5EJZB 1NA1A 1AR62 2XVLA 1AR61 1AYM3 1JYNA 1ONAA 4JV4A 5C9AB 3I2OA 1XE0A 3JBG3 4QQPA 1QJZA 2B9VA 3WF2A 5D8AC 4AI0A 3LD8A 3GBFA 3OB8A 2V5DA 1UXXX 4FOYA 5E6HA 5HCFA 1NA1B 4LA2A 4XEZA 5JXJA 5F2WA 3IB3A 2RS33 2W91A 3RYRA 4LBJA 3VZKA 2VNVA 4LBLA 5BNOC 1F5JA 1QJU3 1R1A3 5DG1A 4YZ2A 3RDIA 3VV1A 2R1BA 3AKQA 5CFCB 2QFEA 3AX4A 1SBEA 1DGRN 3LFMA 3H1WA 3WDWA 2ZX1A 2ZPXA 1OQDA 1ULFA 2D6OX 1V6LA 3Q8CA 2P6CA 1ZBA2 4NRPA 1ZBA1 5FZBA 4AFDA 1ZNPA 1UY4A 2J42A 3RNSA 4FPYA 1R1ZA 5I0RA 1RMU3 4Q4V3 1ST8A 1WCQA 1BKZA 2VZQA 4BIOA 4JZRA 2Y0OA 4GWIA 5JIAA 1UKGA 1ZZ7A 5T3NA 4N9IA 4DQAA 2JB8A 4IDZA 2MPFA 2XMLA 1OKOA 2EXIA 3VL9A 4BQYA 3WNOA 2ZOEB 2HWC3 2WNVB 2C26A 3P5BA 4RS5A 2B8MA 4IEVA 1ACCA 4UBHA 2DVAA 1F9KA 1ULEA 2GN3A 2VZ3A 2WNEA 1GZWB 4FFGA 4TLFA 1RUG2 3THCA 1RUG1 1JYIA 3GZUC 3H3ZA 1K12A 5A3MA 2QKDA 3WNLA 4AEDC 2MNGA 2X29A 1W28A 2VQAA 2R49A 3MW3A 3T1LA 4D8MA 3J9SA 4LHNA 3CKHA 4P08A 1JOJA 4OQ8A 2QVSB 4ZS2A 1SLTA 2I2SA 5C4WA 2JIJA 4URAA 1PVC3 1QEXA 4D6SA 5ISLA 3FE5A 2VUAA 4QDSA 1SLBA 2GMPA 4MH0E 4WVMA 1KITA 2E7AA 4YM2A 3ZYFA 2XLGA 4N90A 5F7UA 1ZRCA 5LK7B 4IEUA 1HB4A 3MEPA 1WMXA 2YPJA 3W59A 2YZ4A 2DF7A 1AXKA 4HG6B 4WVMB 1A34A 4Z1VA 1DYPA 4MOAA 3CQOA 2NPIA 4CP0A 1PO23 2JE9A 4YRDA 5FYHA 1HDKA 3ZXFA 1O4ZA 5FYYA 4CZSA 3D0JA 4I0WB 4MZUA 5LW9A 2K0GA 5L9VA 2J1SA 1AXZA 1RTVA 1KFXL 3ELNA 3K4AA 4LK6A 4IXLA 4LPLA 4MVTA 4N8MA 2VULA 3AYAA 3H8UA 4A45A 5JXIA 1LOEA 4QQ2A 1UZYA 2GN7A 4OZOA 5GLZA 4JQRA 5KXCA 2QDRA 4COWA 3FBYA 1RUD2 1RUD1 1OA2A 2HWD3 2RM22 5FLIA 2RM21 1UIKA 3OF1A 5KHGA 2VTFA 3ACGA 1BEV3 3F2ZA 2XBO3 2WA4A 3G6JB 4O65A 4Q26A 1IPKA 3JBG2 1VB4A 3JBG1 1VAVA 4QXHA 2J1TA 5FUPA 2VH9A 4HETA 2PHRA 5FPZA 4GWJA 4XMAA 2A1XA 2YBPA 2RS32 1WKYA 2RS31 4I3GA 4BK4A 2ARBA 3OTFA 2DVBA 2WO1A 1R1A2 4QQOA 1R1A1 4UWDA 5E89A 4M00A 1PX4A 2PHWA 3GHMA 3MHZA 4DEVA 1ZVFA 3APBA 4GULA 1JH5A 5EP9A 3SQOA 2ZGKA 4F7ZA 3BI3A 2CSGA 1NX9A 1V0AA 3EO6A 3LCPA 5EHDA 4IESA 2WSUA 3P3NA 4FOQA 4BIFA 3HN1A 5FZDA 2XKOA 3WDUA 1GWMA 3B3QE 1WLCA 3J8F3 5FXVA 4CCOA 4NIDA 2AEZA 2B9UA 2HWC2 1SZBA 2HWC1 3FJSA 3AZZA 3RGBA 2D93A 4BQWA 1STMA 4KQ7A 4L11A 1HXS3 4AAPA 1X8EA 4QM9A 4ATFA 1JU4A 4CUGA 5A3PA 1BHGA 3B5LB 4N53A 4DXSA 4H2AA 5L7OA 1POV1 3OGGA 3LA7A 1K5MC 4PLNA 4QPGC 1US3A 2HJIA 1MS0A 2OVUA 3N9LA 3POSA 2CAUA 3ETPA 4DZGA 1O3QA 2Q1FA 2WNOA 4DXRA 2QQLA 3H9AA 4K6BA 2BFUL 3CJIB 3ROUA 2A5ZA 4UI9L 1E5IA 2AR6A 1URXA 1WA4A 4ZU7A 2RDQA 4YVSC 2RHPA 2VBDA 4KU7A 3DYMA 3ATGA 4KMQA 2CGNA 5GZFA 3VHRA 1PO21 1OKQA 2BERA 4AZZA 3D4KA 4XUOA 3CU7A 4OHYA 1W8FA 3H3UA 4IE5A 3JQWA 2Q8EA 3OD4A 2FDKA 1PK6B 3ILRA 4Y5SA 3AVRA 3I3BA 3WUCA 1ZZ8A 3LPGA 3T2QA 4DRVA 1DGLA 5ACA3 3FFQA 1JYTA 1L7RA 3VHOA 2QQJA 1W2UA 4NAOA 1XRUA 4OZXA 2ERFA 4YNIA 5IUQA 1VBB2 1O7FA 1VBB1 2B46X 3DPRA 2HWD2 2HWD1 3OBTA 1OLMA 5HXMA 5JSRA 1RXFA 4CUBA 4X8PA 4AHYA 2YDEA 1SFYA 2VBPA 5LBEA 2RJLA 3H8XA 3ZYRA 1POQA 2Q30A 3WG1A 4MV2A 3GBGA 2VTXA 4G4FA 4JVAA 1RINA 3USSA 5J09A 5JOXA 4XUQA 1Y3TA 4RQPA 1AX0A 1ENQA 3JD72 2CTVA 4LOTA 3ZDSA 4IEYA 1RUF2 1RUF1 4Q0PA 4ET7A 4YZ3A 1UMHA 4RQPB 2YUEA 1AVBA 2WWUA 3PUSA 2VZTA 2AEYA 1NY72 1QXPA 1NY71 4PQ9A 1DZTA 2HWE3 2JDHA 4E9KA 5IW0A 4IV1A 2IXKA 4I30A 3WP3A 3W5MA 1N3PA 1C5HA 1Y43B 5IVJA 2Q8DA 4BLIA 2BWAA 3BTAA 3M3CA 1KJRA 3J8F2 5JDBA 1H2MA 3J8F1 3ZR6A 2ZEWA 5GKAC 1DYKA 4QB2A 4XF3A 4A3ZA 4CCLA 1U5ZA 4CCJA 5FZEA 4XDQA 3ZFGC 1VAMA 4CP1A 2ZGLA 5IVCA 3VBFC 2EXHA 3FHIB 4JKKA 2NLRA 4AEMA 1XNDA 4BHPA 3JU9A 4WV8A 2C0ZA 1JXNA 3M2MA 2WN3A 2Y6LA 2Q8OA 1QKQA 5CADA 4W4ZA 3B00A 2BP6A 5DUWA 1YLLA 4FPGA 3AYEA 4IGQA 1C28A 1F35A 1YWKA 4XBNA 2GP3A 2BOIA 4GH4A 1SQ4A 1BCXA 3CJXA 1NUKA 3DN7A 1RGSA 4DEQA 5FK8A 1BVVA 5FY8A 5FZCA 1GNYA 2OW4A 1KFUL 3ECQA 1JMUB 1W3VA 5T50A 3CL1A 2BVVA 5A33A 4XXPA 5FO9B 5AVPA 4LEJA 2P3KA 1C3HA 3OPZA 3NKGA 1NXD1 1IG3A 4S2HA 1VB2A 5T5JA 2LALA 1Y4WA 1J3PA 4QHOA 1LJ7A 2BJSA 4Y33A 4FXKB 1JZ8A 3KQ4B 3U07A 5JIUA 5C70A 3GGLA 4EV0A 4XHXA 3CMGA 5IATA 5J96B 1QJEA 1W8ZA 4YPJA 1VR3A 3HVDA 2XLAA 3D0SA 3HQUA 2A75A 2PELA 1WBLA 4ASLA 3BIEA 3W9AA 5BNQA 1D4M3 1LOAA 1AL0G 3AL6A 3K4ZA 2X5IA 4A6SA 5FYIA 1KJLA 4P9WA 3RJ2X 2ARCA 1SPPA 4BA6A 2P3YA 3WXPA 4PQQA 4OMDA 1DQ5A 1QH7A 4OYUA 3EXUA 3VBOC 5LASA 3VGIA 5BYNA 3ZPOA 2W52A 2X5IB 3VD3A 3GM8A 1BK0A 3U37A 1MQTB 3FX3A 2G9ZA 4LBNA 4ZPIA 4W6YA 2ET1A 5HCHA 2RDNA 4NPMA 2D3SA 3UESA 3ZKUA 4TWTA 4AOCA 4Z2WA 5KXEA 2DCJA 1YFWA 4EZ4A 5CEHA 1FYUA 1GNZA 1XOYA 3HR9A 1UD1A 2Q1MA 4X8NA 2DFBA 4XF9A 3WF1A 4E27A 3OEBA 4ZS3A 3VBRA 3AFGA 4OULA 3PJYA 4Y4RA 2HWE1 4P9GA 3VBHC 1NZIA 3HQRA 1PZ8A 1AL23 1DQ1A 1VMJA 2QNKA 1XE7A 3BPZA 1ND2C 3GHNA 3PJQA 1OH4A 5DUXA 5LATA 4OUSA 1IKPA 2XUEA 2H0VA 3MIFA 3VBRB 4RA0A 2WNUC 1ZZ9A 3F95A 4YW1A 5EXOA 2ILMA 2GNMA 3MIBA 1FPN2 1FPN1 1XB9A 4B7KA 1UO9A 5DG2A 5KWRA 1CPMA 1VAKA 2OZJA 5FBZA 3N35A 2MHFA 1H8TC 1MS3A 5IK5A 2CHHA 3L9JT 4RFT0 3ZKYA 4CU7A 2NZ9A 3D3AA 2P6HA 4N7UA 4RR3C 1XNBA 4OI0A 2BGOA 1TMF3 3JUUA 3RYKA 1NCRB 5FKCA 2R062 4CEWB 2R061 2WYFA 1BMV2 2CY6A 1BMV1 1VP6A 5A3WA 1QNYA 4EN7B 1MEC3 4CXXA 3NV3A 2FZ2A 2AC1A 4YVWC 3MFAA 2VNRA 2D3PA 4FPLA 4XJUA 5LBFA 3BN6A 5FZ8A 3T0AA 2RVAA 4BQ5A 2RJKA 2NN8A 4Y26A 4BMBA 3A4UA 1LGBA 1NYWA 1NE6A 3D82A 3OBZA 3A21A 3AKTA 2JDZA 1LEDA 4L8QA 4FI9A 2E51A 4JCKA 1OQ1A 5F37A 3HEIA 1LENA 3KZ4C 3GCWA 1NOVA 3WCRA 2JEMA 3O5SA 4GKYA 3OYWB 3BALA 3I2HA 1YIFA 4N9HA 3GZTB 2G4IA 1MZ6A 4AR2A 1GNHA 2LW8A 2OPWA 3ZYPA 5J7MA 3C3VA 3RSJA 3FLRA 1AX2A 4Y1YA 4LT5A 2MEV2 3BPSA 1YCIA 5C8WA 4JGYB 3T1MA 3U14A 4NIAA 5C3RA 4WM8C 1D4M2 1AJKA 1D4M1 2GAUA 4GALA 5FZ9A 2YV8A 3K75B 2KM2A 5F6KA 4AFAA 5A7WA 4A7YA 3PIGA 3O1PA 1YQ6A 2B45X 1D2SA 3ZYIB 2HKXA 3ZSMA 4JHZA 3UV9A 3LIHA 5C7GA 1X8MA 2ORZA 4QDRA 3ZIWA 1W6PB 3J7NA 3DV8A 3PTYA 5FJHA 5A7WB 4HANA 1MZ5A 4XABA 1O6UA 2DV9A 3RWNA 1CAXA 3CF6E 1R092 1G8WA 5IK8A 2HWF3 2B39A 3UGHA 5FY9A 4PIYA 3VKLA 3AP9A 4XUTA 1UQXA 1FAYA 1UYPA 1CAXB 1QNWA 4XZUG 3GJAA 3VD9A 2JDNA 2J1EA 3O0VA 1AL22 5FAXA 1AL21 4J1WA 3RS6A 4I09A 5JLVA 3W20A 1QJFA 3WUDA 2UWCA 5CU1A 4LBKA 3KHBA 1PNGA 5DN2A 4CU6A 3LOBA 1V6OA 4CCCA 1W2NA 3N36A 3PVNA 3UKNA 4IERA 4QGMA 3H1YA 2X05A 3VDDC 3ZXGA 4JGZA 1H2LA 4TLGA 3VN4A 1EV13 2VO5A 2UY9A 3FN9A 2SBAA 3ZXDA 2CWMA 4OHZA 3RMYA 1YNAA 5A1LA 2F4LA 1SFPA 2EICA 2QQVA 2VCCA 4QX3A 1OA4A 1RJ8A 3IDBB 1D0GA 3S5AA 2ZS6B 3ZFEA 1AR93 5I0UA 1DFQA 1MEC2 3CIHA 1MEC1 3NV1A 4LTAA 3WW2A 2XJQA 2ZX3A 2YU1A 4FQ4A 4B8EA 4DY3A 1VBC3 1LRHA 5T5LA 2O0OA 3K3OA 2AUYA 3H0OA 1WMEA 2XKPA 4JAAA 5FY0A 3ZXLA 4QB6A 3ZFEB 4XQWA 1FT9A 1TVGA 1F8VA 3PHMA 2FDJA 5CKQA 5H9QA 4OUMA 3WX5A 1X50A 1DU3D 1EUTA 3MPBA 1SCRA 2JG9A 3FHQA 3POEA 4C91A 5JVVA 2JXAA 3E6BA 4ZXKA 2ZCWA 1LODA 1RUI2 2FD8A 2R072 2R071 1NXMA 2IUWA 3T30A 4YARA 2RS13 3QD6A 5I91A 5LBBA 2D44A 4J6GA 1O8PA 2ZMNA 3Q9OA 2PA7A 4XFIA 2NP0A 2LROA 4K21A 4ZU5A 1TEIA 4R9AA 1UNBA 1UYZA 1G86A 1VBA3 2E33A 1JZ2A 2ZGPA 1W03A 3KQRA 3PURA 3CHXA 2F4PA 3LSEA 2A70A 5D8AB 5BNOA 1GZ9A 1QJY3 3OUHA 1CAVA 5BNPC 5FY7A 4CTEA 3HJRA 1A3KA 1Z7S3 4LO8A 4PCRA 2RV9A 2Y26A 4L9BA 5IT6A 1UOGA 3H3LA 2JB4A 3DKQA 5BNOB 4XJ8A 3CNAA 4JTNA 3B9IA 1UKRA 3WCSA 3ZO0B 4B4RA 4CYDA 4QKBA 2W68A 3ZOIA 1EUUA 4YZ4A 2QQUA 1S0DA 3LZZA 4HK9A 4HKOA 5FZIA 1GYKA 1Q43A 2IXJA 4FOVA 2XJSA 3PVBB 4IGPA 3QH7A 1KS5A 2OIIA 4BMEA 1S0IA 4XTPA 4LIVA 2YYOA 1REDA 2E6VA 1LGNA 5A32B 4XOGA 3NJYA 4AEDA 4LO4B 2YPDA 4DY5A 5CA6A 3ZXAC 1MZFA 3SCFA 1WLTA 3MICA 1XNCA 3GNEA 3JB4C 2QBXA 3ZX7A 4MGSA 4AEDB 4UYBA 2ZGUA 3KVBA 1X7NA 4RN5A 3RWKX 5J37A 3SISA 2UURA 2PHFA 5K0UC 4Y3OA 2WABA 4N43C 4QXBA 4XUNA 4GD4A 4W8JA 5BY5A 1O3TA 2IXIA 3MF9A 4S2GA 3PU3A 4ASMB 1IS3A 4FFHA 2VECA 5F39A 5FZ6A 1CX1A 1EV12 4I0AA 1EV11 1HB2A 3WHTA 5FMBA 4CDWA 5FY4A 2DU1A 2Y33A 4LHSA 3PU8A 2VPVA 4XURA 2R043 3ZYBA 1OPOA 1POV0 4LKDA 1AR91 2EXKA 2Q8CA 1OMIA 3MFCA 1GQHA 5JSOA 2FQPA 3CLPA 2PXJA 1UU5A 3PTRB 4JDMA 3RJRA 3O1MA 4ZKTB 3I3MA 2CDPA 4YGCA 3ZYJB 1JYVA 2ATFA 2V5YA 5A6QA 1O3RA 1KRIA 4BISA 4ZY9A 2BQPA 3BYWA 3HT2A 3OUIA 4OMCA 4CDXA 1LU2A 1B09A 3PVEA 4M3CB 2JECA 3P3PA 4XCAA 2ZEXA 1LHOA 3S7IA 1S0JA 5LK5A 4K20A 4IEZA 2RS12 4LE4A 2RS11 2AZ5A 4LR4A 5BNNC 2NYYA 2V73A 3AK0A 5C3SA 3IKWA 5F3CA 5J3UA 3AKPA 4IE7A 4CDXB 2AYHA 4NN0A 1ULPA 3U4XA 4UW3A 4AFBA 4D6QA 1VBA2 2IFRA 1VBA1 2OX0A 5LA1A 2WZR3 5BXXA 5CFDC 4AYUA 4B29A 4IEPA 1Z7S2 1Z7S1 4DUWA 1WW6A 4MSVA 2DYCA 4YW5A 1JODA 3M1HA 4MGIE 2Y6FA 3PVOA 1GOFA 4XBQA 3ZSKA 1ENSA 4D3WA 1V9U3 1WD3A 4HLTA 4NHYA 3VBUC 2CDOA 5GALA 5FPLA 4O61A 2RS53 4P9YA 1MS8A 1U5XA 2JE7A 3POFA 2Z2SB 4RYDA 2XHKA 4XIOA 5DMYA 1CJDA 1Q8PA 3AC0A 1DCSA 5I8SA 4XJZA 2GDFA 3GCXA 1GWLA 4L97A 2WFPA 3I2KA 4X6QB 3T0BA 3TNQA 2W2IA 3C7FA 3NAPC 1BZWA 3WG2A 2WJSA 1YO8A 2XH6A 1JS9A 4MO3M 4I02A 4WM7A 1RL3A 2IC1A 5A7QA 4BYYA 5FQ0A 5HXVA 2DCZA 2GC0A 4QPGA 4E2QA 2QZ3A 2WO2A 3AMQA 3S6PA 3T2OA 5K9YA 3WNNA 3T08A 1W3XA 1HRV3 1EPWA 2R32A 3OGVA 1PVXA 5C9AA 2NM1A 3KGZA 4QPIC 1K5MB 4QPGB 3CEWA 4FPKA 1GZTA 4QU2A 1WCSA 4YVSA 2JDYA 4LKSA 2VMDA 2EAAA 2VUDA 4UFIA 4LLFA 4F8AA 2A6WA 1PZ7A 2R042 1S2EA 2R041 3HN3A 4YVSB 1DIWA 5CFCA 4H55A 3S57A 1VRH2 1VRH1 2GH2A 2WN2A 3R4DB 2VZUA 3UKTA 4XPVA 5D1IA 2IXLA 3H8OA 4RGGA 4QDQA 3KVAA 3INAA 2DURA 5DZFA 5JXGA 3NW4A 1TNRA 5DUUA 3TEYA 2YGLA 4R52A 3J7HA 5F5IA 3JQXA 5FKBA 2R6QA 1QWRA 2OKXA 5IFPA 3M7AA 4CDUC 2K9ZA 2WNVA 1NE4A 2JKBA 5FZ4A 1UL9A 1PNFA 1OC1A 1OQEA 3OGSA 3A7QA 4Q0VA 3VBSC 5I8YA 1GZWA 3WSOA 5A6YA 1CPNA 2X8KA 4V2WA 3AP7A 2LRPA 4HT1T 1L7LA 2WBKA 4NR1A 3MIEA 1V6JA 4YGDA 4QX8A 1AR73 4E2SA 3BU7A 3BKZA 2WZR1 4AVSA 3R4UA 1UAIA 4Q29A 1O59A 1Z0HA 5LWBA 5DAWA 3KCYA 3WF3A 1BBT2 1BBT1 2X10A 4ZHNA 4ZXEA 4YZ1A 2D6PA 1DGRA 3ZFFC 5IVVA 4BQXA 2TUNA 1HQNA 1FX5A 4XF1A 4W50A 3SEPA 4AVAA 1V9U1 1OF4A 4IETA 3A23A 4AFCA 1AYN3 5FWJA 3I49A 1DZRA 2WQ4A 4IE0A 5JZGC 4CUAA 2XQXA 4ARYA 1J58A 5J98B 3ZFGA 4IEOA 4DS0A 4R4XA 1PHMA 1ZZ6A 3A22A 2UU8A 2Z42A 3KF3A 5KHJA 2VZSA 4D7SA 4QPYA 2FCUA 2GZWA 3ZFGB 3D5OA 4YWAA 4E4HA 2W87A 1K45A 1OLME 3USUA 2VTXJ 4XDPA 4QKNA 3VD5A 4MHRA 2D5FA 3KGLA 1NCQA 3ENRA 4LUMA 4Y24A 2CWSA 2JKXA 1RHI2 2WQ8A 1RHI1 3BB6A 3T3YA 3MW4A 4V1PA 4BQ4A 4BH9A 3OEAA 1B35C 1FATA 2NQYA 2O8OA 5FUNA 3USUB 2GC3A 4QWNA 3E97A 1NCQB 1Z78A 3MLJA 4CU9A 3EMRA 3GXUA 2OYZA 5GZGA 4YM1A 1LB2A 1W0OA 4QD2A 3NL1A 1AYM2 1AYM1 4MUVA 4WZCA 5EYYA 2YXSA 3ETQA 4XFFA 4AI8A 1G6NA 2OT7A 3IPVB 3AL5A 1OSGA 1F2NA 2VU9A 3FWEA 3MLLA 2JG8C 2IFWA 4Q27A 4XXAA 5F3EA 5JSPA 1QOTA 1QJU2 1LU1A 1QJU1 3I2JA 1XXNA 2RE9A 5EZWA 5EIYB 2R16A 1OLQA 4KBBA 2VUCA 3BIWE 5LY2A 2X09A 4MGKE 4Y20A 3I2IA 2QQMA 2R1DA 3OY8B 4XBLA 2EF6A 2XVGA 5FYVA 4LBOA 5FK7A 1RMU2 4Q4V2 1RMU1 1GQGA 1X33A 4Q4V1 4Y20B 2QDNA 4R9BA 4ZU4A 1CZTA 1S1AA 2D3RA 4GMP3 4HVOA 3WV6A 4YFZA 1UY2A 3NMBA 2EIDA 5DZGA 4IW3A 5F32A 1MZEA 2VQ0A 3KS7A 3BVCA 4B3NA 5JPMB 3T0DA 4W65A 3VBOB 2VZRA 5JPNB 4BLJA 2D6NA 2VM9A 2FDGA 1AR72 1AR71 3WDTA 1ZRIA 3ZXKA 2RR13 4NHMA 4GB33 1QXRA 5A7PA 3WW3A 5B4NA 4XC9A 1JZ5A 1H2KA 2DVFA 2RDRA 2NMOA 4CDQC 4EJRA 1JHNA 3PUQA 4CP2A 1SFNA 1IKQA 2XONA 2QQKA 2HWB3 4ZZ8A 2PQQA 3CJIA 1UYYA 2ZMKA 2P17A 1PVC2 4YGBA 1PVC1 4JQTA 5FYTA 2ENRA 1BLZA 1TZOA 3E1F1 3S7EA 1QOSA 1PM4A 3VBHB 3NO8A 1JZ4A 2HBUA 3VDBA 3ZYGA 4XHBA 1HB3A 3ES1A 1ND2B 1GBGA 1QIQA 1REFA 4QQHA 3VL8A 2BEOA 4QXKA 4TZDA 2IVIB 4GIQA 2WNUB 2G9GA 5J1XA 1PK6A 4YM0A 1PO22 2ZEZA 5A7OA 3ZN4A 3VZNA 3WEZA 1QMJA 3B9CA 3N9MA 4J1XA 4YYOA 1VRBA 2YB7A 2QQPA 1H8TB 2XR4A 2ZHKA 3KT1A 3SHRA 3DKWA 1XNAA 1CIWA 3WQBA 5A6XA 4NWVA 4RR3B 3RG0A 3M3EA 4YW7A 2ES3A 1FI2A 4YW3A 1FV2A 1NQJA 3KT7A 4AVCA 2J1AA 3O1TA 5FY1A 2XXZA 5A7NA 1JYXA 3UK9A 1BEV2 4YVWB 1BEV1 1IS5A 3I59A 1CX4A 4XJ9A 5LEJA 1W2AX 1VPHA 2XBO2 2XBO1 1BJQA 3WF0A 3DL3A 2Y6HA 3B94A 4AHXA 1ULGA 1HQLA 1LOFA 1ULCA 2YHJA 3AMMA 2J1RA 3LWCA 2BFUS 4LLOA 5A3TA 3I59B 4R8HA 3WW4A 4FBFA 4K3UA 1K5JA 4YGEA 4PLOA 2DFCA 2C24A 4ISRA 1L3JA 4MYEA 1ZRFA 2JD4A 2Y6JA 3THPA 4P9XA 3RPQA 4C8DA 3HNYM 1DBNA 1YFXA 2A6ZA 3KV4A 1K42A 5FOBB 1XU1A 4KU8A 3AP5A 4HK8A 4WM8A 1Q8OA 3HWJA 3NRUA 1MS1A 1OFNA 4FPJA 3IIIA 1TME3 2E9QA 2AGSA 5H9SA 1E5SA 4EWDA 1X9PA 4G3YC 3AZVA 5F9TA 4RD7A 2XJTA 4WM8B 3O1SA 2K2SA 1HX6A 1Y7BA 2VOWA 1XYPA 4KNCA 3QOPA 4UXAA 3ACIA 3PNAA 4RS5C 3I4IA 2W94A 4B4PA 2VC9A 3LDKA 1O8SA 1S0EA 2G1MA 3FBMA 3QBQA 1RVF3 2OXBA 3HD8B 1ZBE3 2RR12 4E4DX 2RR11 1D7PM 1N1YA 2P1BA 3ZSLA 1IPSA 2G19A 1HXS2 2D7FA 1HXS1 2DUOA 2QQOA 2GP5A 3POYA 4NOTA 4IEQA 5FLJA 1C4RA 3I54A 4ISQA 3WT3A 4I01A 5C4WC 2HWB2 1DQ4A 2HWB1 1S55A 2OA2A 4O9EA 4OVEA 3TB0A 1SDDB 4COUA
chains in the Genus database with same CATH topology
4Q4X3 2QCSB 2XL7A 4C0BA 3OD0A 2VY0A 4KGGA 2ZX0A 4KH9A 4HSJA 5E16A 2DVDA 4IEWA 3FMGA 1BXHA 4DRRA 1JTZX 3UJOA 2R0HA 4WZFA 5I0TA 3VLBB 4H7MA 1I1EA 1HQWA 4FAHA 4Z8BA 4AF9A 3E5QA 4JC1A 1GLHA 3VDDB 5GZEA 2PHTA 2WINB 4XZPA 5ACA2 5ACA1 4R9CA 5H9PA 4XYXA 3AFKA 1DGWA 1W6QA 2Q4SA 4A7KA 1Y9QA 4A7ZA 1TQ5A 4FT8A 2FBEA 3IDCB 1C8M3 2ETEA 1MQTA 4BZ4A 4KWJA 2D98A 1W6QB 4M0NA 2DU0A 3AKRA 1ND3A 4U2AA 4XMIA 3ILFA 1HRI3 4QMAA 1OA3A 3A0KA 4YW2A 1M06G 3V65A 1ND3B 1OHFA 4M01A 4KGQA 4IL7A 5ABJC 1D2QA 1SEFA 2WFF3 1LOBA 2RMU3 5BNPA 4OI2A 2A3XA 5K7PA 2HWE2 4LHKA 3AZWA 5C8CB 1RC6A 5BNPB 1ZRRA 5T52A 4DFSA 4DMIA 4WVVA 4IV3C 3SMHA 1E57A 3E5UA 1V6KA 1VALA 2AH2A 1GZCA 3R05A 2DTWA 2EXJA 4YSFA 5I93A 1NCRA 3OGJA 3ZSEA 4COZA 1IS6A 1Q5OA 4Y5Z0 4CEWA 5J96B 1BK1A 2XWBB 3N7JA 2E63A 4JDOA 4L99A 2UWBA 4N53C 3SCHA 1AX1A 5L7OC 3WZ1A 2DVGA 2A73B 5K8SA 3LA3A 1QJX3 2WT1A 3ALQA 1C5IA 2ARXA 3B69A 1CD3G 4AVVA 2WIIB 2WC2A 5JR7B 3POWA 2LUWA 3ZXEA 3OYWA 5HBAA 1OFSA 5C6CA 3BCWA 1H4HA 3IBMA 2SLIA 5K0UB 4TSVA 1BVP1 4N43B 4ATEA 4JGYA 1HV1A 3W58A 1TNFA 2GNDA 2ZGNA 4UW4A 1EYBA 3V0AB 4OLLA 2C5DA 4WVZA 3DPRC 4LBQA 2W39A 4NWWA 1KS4A 1C8M2 1RUJ3 1C8M1 2G9FA 1W6PA 4LBQB 3BOWA 1YRZA 1ASJ3 4P9LA 1YYNA 2WLPA 4LO6B 2A7AA 4DOUA 1XE8A 1HRI1 2GC1A 2Z69A 4H7LA 5HCBA 2ZGSA 5BNNA 1GKBA 2BWCA 2WZPP 4E4ZA 2B5HA 4AQ6A 4HPKA 3KCXA 2VMHA 2EIGA 1YIPA 1ZYBA 2P3IA 5BNNB 2RMU1 3B02A 1OD5A 1APNA 1CQ9A 2AENA 4HPKB 4IV1C 1J3QA 2A6YA 3ACLA 4Y1VA 4YW4A 4Q1RA 4W6XA 3ES4A 5CFDB 3J4UH 3TBDA 4FVVA 1LULA 3GYDA 1LR5A 2I45A 3H1MA 4DNYA 3VBUB 4RSUA 1XQNA 3NAPA 1H9PA 1TMF2 1TMF1 4BOWA 4M3CE 5GLTA 1QJX2 1QJX1 3AMHA 1H0BA 4GH4C 4Y4YA 3NAPB 1DGWX 3IIAA 1IGOA 2JJ6A 2XJPA 1M4WA 2XB6C 1JBCA 3SXWA 3QLQA 4GA9A 2A6XA 3R6SA 2JX9A 2UY8A 4PBOA 4HL0A 4C90A 1VBE3 2E7QA 5DDJ3 3SH3A 4AEJA 5FCCA 1RUNA 5FMOS 5D8AA 4BCUA 1PZ9A 3TYJA 2FMYA 3WHUA 2PHDA 2P37A 3DUIA 3LA2A 1KDMA 5T5OA 3TN93 3WQ0A 2HEYF 2WS93 3FFZA 1MS9A 1JUIA 1RUJ2 1RUJ1 1JUHA 3HBZA 3MZHA 4AI3A 2IWGB 1TE1B 3SLIA 1ASJ2 1ASJ1 2ZGMA 1SDWA 2IZWA 1QQP3 3WR0A 1DLLA 1ULDA 3VBSA 5A32A 2GMMA 2ET7A 3ILNA 1VBD3 4MGYE 2XL9A 4X6RB 4CDUB 1W0PA 1MS4A 1C57A 2HWF2 2HWF1 2ZHLA 2A3WA 1H2NA 2WQZC 3VBSB 4HN1A 3PLQA 1AZDA 1DG6A 4JTOA 1RUE3 5FRAA 2N7GA 4FO9A 1GFF2 2VOXA 4AGVA 1N3QA 4MX3A 4QX5A 3VKFC 2PHLA 1CJPA 3ZFFB 3EJKA 1UW8A 3IT8A 2DTYA 3I2DA 2ZZQA 3ASIA 2VVFA 3GBWA 2QUOA 4ONUA 2BPA2 5JZGB 3AJZA 2Z79A 5BV6A 3ZPYA 3DF0A 2XUMA 1AR92 3BOPA 5AVAA 4FPHA 1FOD3 3E5XA 1VBC2 1VBC1 1AF9A 3HQXA 5GLVA 1WLWA 4M3CA 1MACA 1LCLA 2R0FA 4Z92B 1B35A 3HMYA 1LECA 1G7YA 4JRAA 1YFUA 1W6NA 4XTMA 3U10A 5T5PA 3VZMA 1VBE2 5DDJ2 1VBE1 5DDJ1 4PBPA 1B35B 3ZSJA 3K51A 4QQLA 5KC5A 4G9SB 1W6NB 5FO7B 4D94A 1Q8QA 1N1VA 4KWLA 3AXDA 4NHLA 4GKXA 5L19A 2JG8A 1JW6A 2VMGA 1QJY2 2WT0A 1QJY1 3TN92 3TN91 2PAEA 2WS92 2WS91 4KL1A 5EYXA 2CGPA 1H9WA 3SNMA 4Q0QA 2JG8B 4Y22A 3ZMNA 2D5HA 3V0BB 1YJKA 1WW5A 5FREA 4DINB 4MXWB 4FP3A 3N7MA 4EN6B 5EV7A 1SMVA 1HV0A 1O91A 4Y22B 5JAXA 5AFEA 1WMDA 2VGDA 2XVKA 1YXWA 3OJBA 2W0XA 1BQPA 1XNKA 1IPJA 2F6BA 2ZAHA 1C8NA 1IOAA 3AYDA 1ZRDA 3KMHA 3H7JA 3UJQA 1CAWA 4NHKA 5E8AA 4HKWA 4COVA 1WUVA 2FHRA 1SLAA 3TNPB 4Y1ZA 3MIDA 1ZZBA 2WT2A 1K5MA 1ZZCA 1CAWB 2TEPA 3SH5A 4W6WA 4BQ1A 4XQ4A 4CDQB 4PJYA 4YZ5A 5FO8B 5JWPA 4JGZC 5CG8A 5JCTA 5I0SA 3OCPA 5KHKA 3M8LA 4FAGA 4EN0A 1UX6A 1U0AA 2Q1ZB 4LULA 3M3OA 5SV5A 3ZFEC 5IK4A 2VW0A 4Y1XA 3WDYA 2Z5WA 1FOD2 1FOD1 3JZVA 1PGL1 3ZIXA 2HEVF 2A6VA 1ENXA 3LKJA 1RUD3 3VZOA 2RM23 2JG9C 2TBVA 4QHBA 1GSLA 5C33A 3WG4A 1S0FA 3AXEA 3LOIA 2VG9A 3N3HA 4FPOB 1SBDA 5JI9A 2I07B 3KLSA 2EVXA 2BVBA 2LTNA 4GWMA 1ZX5A 2DCYA 2H6CA 2WZR2 2CV6A 4D7TA 2CNAA 1BYHA 1MVEA 1QDCA 3BODA 4B7EA 4FXGB 1LGCA 4FSJA 4PIXA 2YMZA 3MPPG 3M3QA 2BGCA 2TNFA 2WA3A 4YG0A 4I0BA 5DZEA 4YG3A 4WBBA 1LHNA 1V9U2 2ZABA 3KB5A 3WQ7A 3U0ZA 4RL7A 1RUOA 2RS52 2RS51 3GALA 4K1ZA 4H14A 5HI0A 1QF3A 3M3IA 1Q8VA 3WQ1A 3VBFA 3AM2A 4HKLA 1EAH3 4Z82A 3GF6A 4RS5B 5HCAA 1U5YA 2ZKNA 4C0HA 3IMNA 3VZJA 1CVNA 3LSDA 1O4YA 1POV3 4L2NA 3VBFB 4P9IA 4AQ2A 4D69A 1J1LA 1WCKA 2WWSA 4HVRA 1GV9A 1HRV2 5SV8A 1HRV1 4UW5A 2BNNA 5C4WB 3AMNA 2OZ6A 5A3LA 4XE9A 1OOPC 5F6LB 4CDWC 3IPVA 2GC2A 3WNXA 2EALA 4AFMA 1S2KA 1DQ0A 1VLNA 2H6BA 4HZFA 1IS4A 1O4TA 1X36A 4A2UA 3OY8A 4XETA 1VBB3 1YI7A 3FZ3A 3ZN6A 3QACA 5GJ6A 3N4MA 5LRRA 4CDXC 3VKMA 1G9AA 3UKVA 4P9JA 5J36A 2D6KA 3ST7A 3IN9A 3ZN6B 2HEWF 3VBOA 4Q4Y3 4LO5B 5L36A 1SCSA 5T54A 2GH8A 4CEYC 4OHWA 1JN2P 4EROA 1RJ7A 3JD73 5KC6A 2DWRA 1RUF3 2PYTA 4FPFA 3D8CA 5ABJA 1ALYA 1RUH3 1V70A 2BNOA 2VUJA 1LESA 3DGTA 1OPMA 1KQRA 4PDWC 1CAUA 3VBHA 4HFSA 5ABJB 1XYOA 1ND2A 2Q0AA 1AHSA 1O5UA 1NZCA 4OHXA 5BUVA 1AYN2 1AYN1 1D0HA 3FUOA 4AXOA 2WNUA 1CAUB 4IV3A 4PF5A 5CBLA 4M0HA 3NWKA 2C9AA 2YGMA 2PN5A 3EQEA 5DXDA 1R083 1PMIA 2D97A 1EAH2 4FPCA 1EAH1 1H8TA 4IV3B 1UCXA 1EY2A 5J48A 3HAGA 3FLTA 2CGOA 4WM7C 4RR3A 4OHVA 1LOGA 5JMCA 1ZM1A 4INDA 3ZXJA 1KD7A 1I9RA 3EBRA 4UBGA 4N53B 4YVWA 4D7YA 5L7OB 5C9AC 4META 4XF0A 4PLMA 2ZX2A 4Q4W3 1NA1C 3MYXA 4ES8A 5FDBA 3AMPA 2WL1A 1QHDA 5CFCC 4OFGA 1SBFA 4EN9B 1J59A 3WOGA 5LRSA 5H9RA 1HIXA 4L92A 4C1WA 4COYA 5AC93 5GM0A 3L2HA 2XJVA 4F83A 1UPIA 2GNBA 1X82A 2WNVC 1W6OA 1U5IA 3MI8A 5KHIA 3DPRB 2I74A 2XJRA 5L73A 4Q4Y2 4Q4Y1 4QT6A 1QY4A 1REEA 5CNAA 3IWZA 4GMP1 1W6OB 4FTSA 4JDNA 4K40A 1AXYA 3JD71 1UIJA 4SLIA 2ZHNA 1WLDA 2JICA 3WDVA 4UW6A 1RUH2 1RUH1 4GB32 4GB31 1V00A 4WVWA 1S2BA 3U11A 1NG0A 3S0MA 1IHMA 1IQAA 2ZGOA 5DUVA 4URTA 4XJWA 3M4FA 4R9DA 2B7YA 4Q0UA 1HKDA 4XJAA 1SACA 4IV1B 1O3SA 1UMZA 5IK7A 1FPN3 3OBRA 5EFUA 3SH4A 4AEKA 2ZJCA 3VDDA 5CVRA 3TAYA 2GU9A 1R082 1R081 1H1MA 3K48A 4MLOA 3NSTA 2R063 2D6LX 1WW7A 4KWKA 2QZ2A 4O9GA 2QE3A 4HVQA 2ZACA 4IQPA 1NCQC 1CR7A 3LAGA 3QH6A 2WLQA 2PLV3 2D6MA 3WP4A 1EPZA 1LHUA 3VKNA 4Q8LA 1FMD3 4AWDA 3D6EA 4FQZA 4YG6A 4Q4W2 3IDEA 1A8MA 4GH4B 3E6DA 4Q4W1 3TOJA 5KXDA 3SITA 2ZX4A 5GLUA 1WW4A 3T2TA 4S2DA 4LE3A 4FCAA 5A33B 1DQ6A 4Q1PA 3JCIA 3MIGA 3RI8A 3MDPA 1NQDA 2MEV3 4CRQA 2YY1A 3MF6A 5EWSA 2VOKA 3AP6A 5GLWA 1VJ2A 4I2OA 3J26N 5AC92 5AC91 1ZREA 5C8CA 3GZAA 2O8QA 3WLUA 1WMFA 4EWAA 2ZGQA 1J3RA 1H1IA 1TME2 1RB8G 1TME1 1J1TA 3VHNA 4DXZA 3MIHA 2DUQA 3WG3A 1QDOA 5B2GB 2VVDA 4LBQD 4I3PA 2GSYA 4AQSA 4FP2A 4Z07A 2ZBJA 3NV2A 5E1RA 3PMSA 1JYCA 1HW5A 1R093 1C1FA 1CONA 5CG9A 1RVF2 1RVF1 3WX5A 1ZBE2 1A8DA 1ZBE1 2NMNA 2BW8A 2ZTNA 3RYPA 5KHHA 4A3XA 3I8TA 4GWNA 2GALA 3M70A 4HMZA 2WKKA 3H50A 1XU2A 2BNMA 3CJIC 1ZA4A 2B42B 3ZMOA 4NO4A 1YI9A 2FMDA 1UZZA 3RI9A 1V6MA 4Q4X2 4Q4X1 4E4SA 4YFWA 5K0UA 1PO13 3AP4A 3I7DA 3O7OA 1WGPA 3LGRA 4N43A 4TYSA 2CL2A 3TRSB 1PK6C 3X29B 4AGGA 3H7YA 1F31A 4YLZA 3V0AA 2DCKA 4JRLA 1QXJA 5LEKA 1S0GA 4LNVA 4RHV3 1LOCA 2QJVA 1ENRA 3LB9A 4AHZA 3HIFA 2ZA9A 1D4VB 2PLV2 2PLV1 1MR5A 1UF2C 1FV3A 1OLRA 4XFHA 4DB5A 2BBVA 2ZMLA 4K7JA 1FMD2 1FMD1 3CO2A 1UU6A 1KDKA 4ES9A 3B93A 4FOWA 1RUC3 4HBNA 2KXLA 3NKTA 1SLLA 3R0RA 4K8FA 1AR83 5FTTC 1UN1A 1LOFC 1GICA 4C1XA 2XG3A 1RUI3 1HLCA 1LKNA 2R073 5FLHA 1HRI2 2CAVA 4RQPC 4NPRA 3B01A 4LO7A 2P3JA 4QGLA 4QM8A 2MEV1 3THTA 1KXGA 1LEMA 1SLCA 4S2FA 4RGAA 2HYKA 2WFF2 2WFF1 2RMU2 1LTEA 4MGZE 3O0WA 5CFDA 1PIV3 2E7TA 4EWEA 2V09A 2VNGA 4NVPA 2XPJA 1CESA 1DDLA 4BM8A 3FUQA 3TWIA 3VBUA 1V6IA 5GZDA 1R091 1Q56A 1SLIA 3O14A 3URFA 4AVBA 1NLRA 1RIRA 4FTBA 4Y1UA 2P34A 2BUKA 4HSLA 5BPXA 4AGRA 3WW1A 4H3WA 1QOOA 3AJYA 4GXLA 3NV4A 1YUDA 4M3CF 4HN0A 4LA3A 4LHLA 5FMOL 1PO12 3AB0A 1PO11 4XF4A 2PAKA 3C2UA 3PMEA 4AW7A 4YM3A 2ZZJA 4QPIA 1COV3 4N7IA 1V6NA 1YJLA 4XQDA 3A0NA 1Q3EA 2FZ1A 1W6MA 3E6CC 2ZKLA 4JGZB 5JI7A 4P14A 4Q2FA 2P2KA 4QPIB 1G9BA 2A3YA 3MGUA 1GR3A 1PM7A 3ZN5A 4RHV2 4RHV1 1W6MB 1H4GA 3AKSA 1I3HA 1H1AA 1RITA 2EAKA 2DUPA 4EN8B 2XWJB 2X5IC 1MQTC 2VW2A 3WP6A 2WSVA 1T6GC 4LBMA 1RUC2 3KD4A 1RUC1 4Q8KA 1ND3C 1AR82 1W39A 1AR81 2ZGTA 3KT4A 5CB7A 3RMXA 3KCCA 4CDUA 1RUI1 5KXBA 3RQ0A 4PIZA 3HT1A 3MLKA 2JG9B 1G9FA 2VW1A 4U36A 1QH6A 2OPKA 1WD4A 1H8VA 2EA7A 5KBFA 4AQTA 3VZLA 1S0CA 1XYNA 2PAMA 1DHKB 2D43A 1MS5A 1WBFA 3VBRC 2AREA 2CYFA 4SBVA 1A6CA 5F5QA 3RZZA 3VUOA 3AZXA 1F5FA 1FNZA 1PIV2 3O12A 1PIV1 1DQ2A 3S30A 1N3OA 3ZFFA 1CAVB 4AG4A 5JOYA 1OI6A 2OUHA 3KSCA 4R4ZA 1A78A 4XILA 4K1YA 1PGW2 2VNOA 1PGW1 1AJOA 4BWOA 5JOZA 2XJUA 5EJ3A 2E53A 1DZQA 1U12A 2C1FA 1NCRC 2D40A 1QU0A 5JZGA 5F1RA 4CEWC 1G9CA 4XIKA 2XLFA 2OUJA 5JOWA 5FOJB 4AHWA 4OI1A 3O0XA 1N1TA 1GANA 3R4SA 2BTVC 2BYVE 3SCGA 3G7DA 4ORFA 3KM5A 4KG0A 2Q5TA 4BPZA 2R30A 4FPEA 3WY6A 2UYBA 3ZVXA 1G9DA 4XFGA 1COV2 1VIWB 1COV1 2H0BA 1C1LA 4F3JA 1OOPA 3WD5A 1AR63 5CAZA 1PGSA 4JGYC 1WCDJ 2X53S 4XW3A 1I5ZA 3B7MA 4QGNA 1OOPB 1VRH3 3L2YA 4CDWB 3WINE 5GZCA 1CN1A 3QCWA 4XFBA 4GQ7A 1YFYA 2ZHMA 4DPNA 3V0BA 2IXCA 3AYCA 4LUKA 4MXWA 1AUYA 3VKOA 4AE2A 1UPSA 3ZYRA 2YC0A 2VOVA 2DCTA 1H30A 1ZBA3 4ITCA 4XFAA 3WP5A 4B4QA 3FC0A 5AFBA 4AI1A 3ME2A 2PFWA 1QQP2 1QQP1 1S0BA 1Q8SA 5FPXA 1VBD2 4CEYA 1VBD1 4FTEA 2JENA 2O1QA 3NJZA 2A71A 1DF0A 1LHWA 2Y38A 1NLSA 4AVTA 4Q0SA 1RUG3 2IXHA 3UL2A 2KA3A 4CEYB 1BBT3 2VXRA 2XGXA 3EHKA 1N47A 2ZGRA 4AK3A 4IEXA 1YHFA 1RUE2 4CDQA 1RUE1 4E2GA 2PHUA 5T55A 3RRDA 1IZ3A 4PDWA 3VHPA 4KG8A 4XFCA 2PTMA 3N7KA 2GNTA 1FXZA 3N7LA 2ZAAA 4GMP0 3WDXA 4PDWB 3IM0A 5TSWA 5CIRA 2VMIA 3V64A 1I6XA 1QGLA 5I8TA 2UYAA 1UU4A 3FLPA 2Y0IA 2W08A 1O5LA 3AZYA 2PHXA 1FNYA 1N1SA 3MW2A 1LHVA 2LM3A 4BE3A 4K9SA 3V56A 4MXVA 3WVJA 2UWAA 1PGL2 4AI2A 1EP0A 2YROA 1RHI3 4OI4A 4WM7B 3JB8A 5FFOC 3NVCA 2GMEA 1MVQA 5E88A 5FQ0B 4P5HA 2VVEA 1NA1A 1AR62 2XVLA 1AR61 1AYM3 1ONAA 4JV4A 5C9AB 3JBG3 4QQPA 1QJZA 4AI0A 5D8AC 3GBFA 4FOYA 5HCFA 1NA1B 4LA2A 4XEZA 2RS33 3RYRA 4LBJA 3VZKA 4LBLA 5BNOC 1F5JA 1QJU3 1R1A3 5DG1A 4YZ2A 3RDIA 3VV1A 2R1BA 3AKQA 5CFCB 2QFEA 3AX4A 1SBEA 1DGRN 3H1WA 3WDWA 2ZX1A 2ZPXA 1OQDA 1ULFA 2D6OX 1V6LA 1ZBA2 1ZBA1 4AFDA 1ZNPA 3RNSA 4FPYA 1R1ZA 5I0RA 1RMU3 4Q4V3 4BIOA 1BKZA 2Y0OA 5JIAA 1UKGA 1ZZ7A 5T3NA 4N9IA 4DQAA 2MPFA 3VL9A 2EXIA 2ZOEB 2HWC3 2WNVB 4RS5A 2B8MA 4IEVA 4UBHA 2DVAA 1F9KA 1ULEA 2GN3A 2WNEA 4TLFA 1GZWB 3TNQA 1JYIA 1RUG2 1RUG1 3GZUC 3H3ZA 5A3MA 2QKDA 4AEDC 2MNGA 2X29A 2VQAA 2R49A 3MW3A 3T1LA 3J9SA 4LHNA 1JOJA 2QVSB 1SLTA 2I2SA 5C4WA 1PVC3 3FE5A 2VUAA 4YM2A 1SLBA 2GMPA 4MH0E 4WVMA 1KITA 2E7AA 2XLGA 4N90A 1ZRCA 5LK7B 4IEUA 3MEPA 2YPJA 3W59A 2YZ4A 2DF7A 1AXKA 4WVMB 4Z1VA 1DYPA 2NPIA 4CP0A 1PO23 2JE9A 4YRDA 1HDKA 3ZXFA 1O4ZA 4CZSA 3D0JA 4I0WB 4MZUA 2K0GA 1AXZA 1RTVA 1KFXL 3ELNA 4MVTA 4IXLA 2VULA 3AYAA 3H8UA 1LOEA 4QQ2A 1UZYA 2GN7A 5GLZA 4JQRA 5KXCA 2QDRA 4COWA 3FBYA 1RUD2 1RUD1 1OA2A 2HWD3 2RM22 5FLIA 2RM21 1UIKA 3OF1A 5KHGA 1BEV3 2XBO3