1UY4A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy4A00
1HN1A 2JE8A 5IFPA 3MV01 3DYOA 4OUEA 4DUXA 2VTFA 2W1SA 1XPWA 3I3BA 3OGSA 3K77A 1CZTA 5IFTA 4A41A 1L7RA 3IB3A 4E8DA 4GZ9A 1XNAA 5IJRA 3EB7A 2WO2A 1D7PM 1J84A 4QB1A 5B4XA 2VZOA 5CZKA 1L7QA 3MBWA 1LNSA 1K12A 1W9TA 2CDPA 1US3A 3HPNA 3GXUA 2R7EB 3A22A 4OZOA 2DCKA 3NNGA 2OKXA 1JZ4A 3SKJE 2WAAA 4PF1A 2VZQA 1UMIA 2J1AA 1K3IA 3WNMA 3OEBA 2EICA 3WNKA 1UY2A 2Y6KA 5JMOA 2WBKA 2VJXA 3E1F1 1W9SA 5LA1A 4XUQA 3WNNA 2V5DA 4MGSA 4ZZ5A 1NAEA 3I2HA 1UY4A 3C7OA 3P6BA 2EIDA 1H6XA 4W4ZA 3EYPA 5EJZB 3LQCA 1UY0A 5I0DA 5JR2A 1SHWB 1SG3A 2XOMA 5A1AA 3ACFA 4L0PA 1XNTA 3FL7A 4QX3A 2W92A 4A3ZA 3ACHA 2BGOA 1UZ0A 3W5NA 2J1VA 3HOBA 2B4KA 1W99A 3CZUA 2VQTA 2YG0A 1GOGA 1UMHA 1MPXA 2VCAA 2VMEA 3GGLA 5DMYA 1TVGA 5J1XA 5G05L 4CU9A 3T2PA 3J7HA 3LE0A 3I2IA 2ZEXA 3BN6A 1DP0A 1JU3A 3HEIA 4XVHA 2HYXA 4CUBA 1EUUA 2BZDA 3HN3A 1CZVA 2WAOA 4A6OA 3VD5A 1KEXA 1OH4A 3NQHA 4FI9A 4M4PA 4AAXA 4BXSV 3W5MA 5LA2A 2W1WA 2J22A 2W94A 3IIIA 1BHGA 2C9KA 2J1TA 3MUZ1 2C4XA 2ID4A 4QX1A 4CU7A 4A44A 2QQNA 1NX9A 1R64A 1JZ3A 4AG4A 3C7EA 3I2FA 3MV11 2WO1A 3C7GA 3ECQA 1F4HA 4JKMA 3UETA 4PQQA 5EIYB 2X09A 4MO3M 2QQLA 2YC4A 4ARXA 2QQOA 4UI9L 3LEKA 2XQXA 5CYYA 4DUVA 2J1EA 2VMFA 2Y8KA 2JDAA 2YC2A 3PUIA 4CU6A 2JD9A 2RV9A 2ZXQA 3OGRA 3MO4A 4D0QA 3WNPA 3ETPA 3WQBA 4QDRA 1T2XA 4LHSA 3T2QA 4P00B 5C70A 1W8OA 4A45A 2QQIA 2L9LA 5IYYA 3P1IA 2BGPA 4CUCA 5JXGA 4CU8A 3FHAA 3K4AA 1JYNA 1CIYA 5LA0A 2W1UA 4OMDA 2VZVA 3ABZA 4BK4A 1JZ6A 4YPJA 4QX0A 1PX3A 4BJ0A 2E33A 4HG6B 3T0DA 5DPNA 2VC9A 3HNBM 3IAPA 4Z2AA 1W0NA 3VD3A 1WKYA 1JYXA 1XC6A 4P5YA 4DEVA 4JKKA 1J83A 1JI6A 4UAPA 4XUTA 4P02B 2VR4A 3LEIA 4QAWA 2ZEYA 3DYMA 3NJXA 1UYXA 1GMMA 2QBXA 1GU3A 3GDBA 2X10A 3JXSA 2QQMA 4XUPA 3IAQA 2DDUA 2B9VA 3T0BA 2WUHA 1JYVA 2Y6LA 4KI5M 3T08A 1UXXX 1DYOA 2W3JA 3WNOA 4GWJA 2ZEZA 3C7FA 3C7HA 1UY3A 3WSOA 3OG2A 2V4VA 2EIEA 2Y6JA 1CZSA 5HXMA 3VD7A 3K75B 2J7MA 2QQJA 4TXWA 4XZUG 2VO5A 5IHRA 1US2A 4DEQA 2RJ2A 3K4DA 4QB2A 3VD9A 5JXIA 4OYUA 3F2ZA 1O8PA 1OF4A 4QDQA 4RYDA 3ACIA 4XUOA 1GUIA 4QX2A 2J1SA 4DXRA 5G04L 1K42A 4DXSA 2VCCA 1GOFA 2W95A 4OMCA 3T0AA 4TTGA 2VZ1A 1UXZA 3CMGA 4ET7A 3ACGA 2WDBA 3SEPA 2VZ3A 2VL4A 4UOJA 3CIHA 1O8SA 4BK5A 4QB6A 2WZ8A 3OGVA 2W87A 4MGQA 4A4AA 4QDSA 2VCBA 3UESA 1UYZA 3K4ZA 3VDCA 2JKXA 2WZEA 1NKGA 3CQOA 5FUIA 2YB7A 5DN2A 1F4AA 2VMDA 3BGAA 2Y6HA 3VD4A 1P8JA 1RYYA 3WNLA 3WF2A 3VDBA 2WN2A 2RVAA 2VZTA 5LCWL 2J1RA 1UY1A 1W8NA 3A7QA 2LS6A 2EIBA 2WYSA 1KGYA 3GM8A 4JKLA 2BBAA 3FHQA 5EJ1B 2XHNA 4ZY9A 1JZ2A 3HNYM 2V72A 3CKHA 3WF3A 5F7UA 3I2JA 4CVUA 2VZSA 3NJVA 2Y64A 3THDA 4XUNA 3FN9A 3LPGA 4BDVB 1JZ8A 4ZZ8A 1DLCA 2W47A 4E8CA 1W9WA 3C8XA 2ZEWA 3I3EA 3ZM8A 2E31A 3CZJA 2VZRA 5JXJA 3DECA 1UYYA 3I3DA 1GQPA 2BERA 3U37A 3I2GA 4W8JA 4DUWA 1JZ5A 1PX4A 2E26A 1UWWA 4GWIA 4RN5A 2VZUA 2J1UA 1O59A 3WF0A 1JYWA 1OF3A 3SEEA 4M4RA 3LPFA 3I97A 2VOTA 4MADA 3OBAA 1ULPA 4DXTA 3AC0A 1I5PA 2ORXA 3THCA 2C26A 3PUHA 3OB8A 1JHJA 3A23A 3UNPA 3D3AA 1ULOA 1SDDB 4KWUA 4XURA 2W5FA 3I2KA 3LEGA 1UX7A 1JZ7A 1OD3A 4MOAA 1OT5A 2VMCA 2X05A 3HJRA 1GNYA 1H6YA 2XONA 2YFZA 2W46A 5JXHA 2W91A 2KD7A 3A21A 3T09A 1K45A 4LPLA 3HNMA 2WABA 4LQRA 2W9XA 4W50A 5C71A 1CX1A 1EUTA 2YFUA 2DCJA 2HLEA 4ZXEA 1NUKA 3IDAA 3T2OA 1WCQA 4LKSA 1PMHX 5B4NA 2PQSA 3WEZA 2WQ8A 2Y6GA 4JX0A 2QQKA 3OEAA 4JHZA 2W1QA 2Z4FA 3MUY1 4IUGA 1TG7A 5C7GA 3K46A 4ARYA 4QPWA 4PT6A 2ORZA 1GOHA 3CDZB 3WF1A 1JU4A 2VM9A 3WF4A 3VDAA 4A42A 5DQ0A 3SKVA 5HPOA 1YQ2A 5JUVA 1IQDC 2VZPA 2VQUA 4CUAA 2WN3A 2WO3A 2CDOA 3DYPA 3NRUA 1PMJX 4P08A 2LW8A 4KMQA 2E32A 4D8MA
chains in the Genus database with same CATH superfamily
1ND2B 1RJ8A 1VPHA 3RZMA 1WA6X 1UAIA 3HT2A 2WZR1 4K20A 4IE7A 4XBQA 4CTEA 1H8TB 4IEYA 3DYOA 3PIJA 4NRPA 3BYWA 1X36A 4AYUA 2BDRA 3ZSJA 4OHWA 1PNFA 3VBRC 3VZKA 1LHNA 1OOPC 2BVBA 5C5TA 2YYOA 4XDQA 2CTVA 3I8TA 3SLIA 5IFTA 1W28A 2PQQA 3FFZA 1L7RA 2DBNA 1H2KA 4RHV3 2WNUB 4URTA 1XBFA 1LEDA 1W6OA 4MV2A 5FZ9A 4ASKA 4E4ZA 5J09A 2GH8A 4CEWC 5C4WC 1K12A 2CDPA 4A7ZA 3OSDA 1LU2A 2GZWA 3HPNA 5LBBA 4S2GA 1YI9A 3IBMA 3TEZA 2R7EB 3AZWA 3D0SA 4XHBA 1RTVA 3HR9A 5FPAA 3FLTA 4UFJA 4XJ9A 3DXUA 2DYCA 2EXIA 3WT3A 4IGQA 5FLHA 3H1WA 3WOGA 4YW2A 4D7YA 2EAKA 2HH9A 1OQEA 1NQJA 2RS52 3RSJA 1MS1A 2J1AA 3WINE 1YIFA 4J1WA 4LK7A 1GZWA 3KMHA 1NLRA 4JVAA 3CU7A 3ZFFC 3ZYGA 4OHXA 4EWEA 1HRV1 1QQP2 1YC61 4IEOA 3ZPYA 2D43A 3IPVA 2D6OX 2Y6KA 3Q8EA 2V4AA 4RR3B 3ZXFA 5JMOA 1H2NA 1RUE3 1QDCA 2WBKA 4XJZA 3W58A 2FQPA 1W8HA 1LB2A 3E1F1 5LA1A 2DCTA 3FHIB 4LITA 3WQ0A 3WNNA 1NY71 2G19A 2R0HA 4HKLA 3URFA 3NNFA 4LNVA 3BTYA 3I2HA 4QHZA 5F5IA 1KS5A 4UWDA 4DINB 3P6BA 2EIDA 1H6XA 2WNVB 3EYPA 1YFXA 3E6CC 5JDBA 5IVBA 1QOOA 3WUDA 4JZRA 1SHWB 5FZGA 1PGW1 5HXVA 1OC1A 2WNVA 1RUJ3 2ET1A 2OX0A 1SZBA 5GALA 5J7MA 3RJRA 5D21A 1LOFA 2Y34A 3HBZA 3J7MA 1XNTA 3FL7A 4LBJA 3SH5A 3GZUC 1RHI1 1VBD3 3ZXDA 5F3IA 5A1FA 1V6JA 4A3ZA 4U2AA 1FMD1 2DU1A 3FJSA 5A1LA 3W5NA 4GMP0 1RVF3 1URXA 3HOBA 3N36A 3BVCA 1ENSA 5FYSA 3CZUA 2O14A 2HYKA 3AKRA 5FPXA 1QKQA 1IPKA 2TBVA 2DCZA 5JIAA 3LAGA 1K5MC 1LHUA 4IV1B 1QJY1 2F17A 2Q8CA 3ORJA 5KXCA 1HXS3 1R091 4CP2A 1J3QA 5H9SA 4IV1A 4AI9A 1CAWB 4AFAA 4B7EA 4CU9A 1RMU3 1UKGA 3RS6A 2YZ4A 3SCGA 3ZXKA 1TME2 2ZHLA 3VHOA 3GHMA 3UKNA 3BN6A 4HSJA 3HEIA 4FPYA 1SEFA 3K2OA 1J1TA 1EUUA 4HXCA 1NG0A 4HLTA 2JDUA 4CUBA 2BZDA 4DOUA 2WLQA 1CZVA 1RUE2 3ILFA 3HD8B 4GWNA 3KZ4C 2YV8A 3HQRA 4CPBD 4TZDA 5CG9A 2IUWA 3MHZA 5LA2A 1PZ8A 2XPJA 3IIIA 4ORFA 2J1TA 4CU7A 2WFF3 1MS3A 3ZR5A 1CWPA 1NX9A 3BODA 1NLQA 1X82A 2G4IA 5FP4A 3T2TA 1JZ3A 4LTAA 2ES3A 4AG4A 1SFNA 3JB4C 3Q9OA 1QXRA 1OXCA 3ECQA 4XABA 3VHPA 3VBOC 4JKMA 4XF3A 4XOGA 1DZRA 1UL9A 1POV0 4MO3M 2ZTNA 1OPMA 1OQ1A 2QQOA 5FZ4A 5KHHA 1OURA 4J1XA 4UI9L 5CFDB 2XQXA 3LGRA 3NWKA 1AF9A 1D4M3 3A0NA 1VBD2 5FXVA 4LK6A 5CFDA 4H14A 2JDAA 2D5FA 4CU6A 3ELNA 2JD9A 3USUA 1RVF2 2C0ZA 4NAOA 3OGRA 4ES8A 3M70A 3WNPA 4XFAA 5HCBA 1ACCA 2AGSA 5FWEA 1ZRFA 4Q4V1 4SBVA 5FY1A 3GNEA 2ARBA 3ZFEB 4DIQA 2RM23 3RFRA 3ZYFA 1DGRN 1W8OA 4A45A 2QQIA 2ARAA 1HXS2 1VRH1 5D8AB 1C8NA 1N3OA 2L9LA 5C3QA 4GKYA 3KV9A 3P1IA 5JSRA 2ZGTA 5BUVA 5JZGA 1JYIA 3D5OA 2BGPA 4CU8A 2E51A 2ZACA 1H1AA 5F2WA 5F8PA 5LA0A 2KXLA 5I93A 2IXLA 1RUG1 3BPSA 2VOWA 4YVWC 3BU7A 3ABZA 3THPA 4YPJA 4COWA 2X5IB 5JOWA 3MW2A 3WLUA 4JRLA 3FUOA 3TBDA 1I6XA 1W9FA 3WDUA 1CAVA 2D6NA 2E33A 2HWD1 2VULA 4YFWA 2F6BA 2X5IA 4LT5A 2GP3A 4JDOA 3U78A 2VC9A 2OUHA 1RL3A 2WFF2 4F8AA 3RRDA 2DTWA 1W0NA 1GANA 1STMA 3POJA 2EXHA 1MS9A 3CJIA 2BQPA 4UFKA 1AUYA 2MNGA 2FHRA 4DZGA 4OFGA 1POQA 1RUI1 2XKOA 2VUJA 5A3OA 1AYN3 1J83A 3ZIXA 1V6OA 1B35C 1OUXA 1WBFA 2VR4A 5C5UA 5FZHA 1HDKA 4UW3A 4IV3A 5BY5A 4RHV1 5DUXA 1W2UA 1DYPA 3NJXA 4XMAA 1EPZA 2JG8C 2A5ZA 1R082 2OT7A 1TE1B 2ARCA 4FOQA 1OA3A 2BFUL 2QQMA 3IAQA 4DRRA 2RDSA 5DDJ3 3HQXA 1W6QB 3RMYA 3T0BA 2V5YA 3BUCA 2W3JA 2KR2A 2RM22 1GQGA 2HWE2 4YG6A 4YGBA 3SISA 3VBHB 4Q5OA 5JR7B 4QQ2A 3C7FA 1W6PB 3ZSMA 1XE8A 4NRQA 2JG9B 4NRMA 5FUNA 1UY3A 4B7KA 2QUOA 3WSOA 4X8PA 1KDKA 2V4VA 2EIEA 1ZRIA 1BEV1 1R1A3 2ZCWA 2JG9A 5HV0A 1QJEA 2VH9A 1UOFA 1C57A 2A3XA 1HX6A 4LORA 3K75B 4UBHA 3J8F2 5IHRA 1DDLA 5E6HA 3DV8A 1DQ2A 3K4DA 1GKBA 1LU1A 2YPJA 5IW0A 3VD9A 4QPIA 5FIXA 4Y5TA 4Q0VA 3F2ZA 3AKPA 4P9JA 2ZOEB 4ZPIA 1RUD1 2AUYA 2FCVA 2P6CA 1GP4A 2BU9A 3ACIA 1AYM3 4YW3A 4YNIA 4JGZA 5FP9A 3WW3A 4AZZA 1A6CA 1YWKA 4P9IA 1RUH3 1UNBA 4AEDB 5G04L 4D3WA 5GZDA 1GOFA 1RUJ1 1V9U3 3RNSA 4IW3A 1PM7A 5FR3A 4PCRA 4QM8A 4BA6A 5GKAC 1VBD1 2YY1A 3WDVA 1IGOA 4I0BA 3RZJA 4ZU4A 3M2MA 4GB32 1RVF1 3EXUA 4IGOA 1IS6A 4HT1T 3SEPA 3I59A 4IEQA 5F32A 2ZGRA 5LA9A 3V0BA 5FZIA 2CY6A 4XACA 1O8SA 1VE0A 2UY9A 5DDJ2 1HXS1 3CBNA 1JTZX 2F4LA 2W2IA 2JECA 3RQ0A 2W68A 2P3IA 3AYCA 4K6BA 1RMU1 3DF0A 2YPDA 3RZZA 2JKXA 1NKGA 1WCUA 4AFCA 5DN2A 4XF9A 3WP4A 3N9NA 1WW7A 3H7YA 1DG6A 1QMJA 1OFNA 1S2BA 2OVUA 4QGLA 3BTZA 4GH4A 3FLPA 2G9ZA 4EN8B 4E27A 3GBFA 3AZXA 4OUSA 5K0UB 1TZOA 4OI0A 3PLQA 1W8TA 3ETQA 4WM7B 5GZGA 4DPNA 4CE8A 2IXCA 4MXWB 4OI1A 2DV9A 2WFF1 1YFWA 5L19A 3WCSA 2WLPA 3I54A 1IG3A 5I0TA 2WWJA 2VCMA 3E5XA 4NHKA 3N7MA 3A7QA 2LS6A 5FZOA 1KGYA 1DGWA 3GM8A 4COVA 5L7OA 4CDWB 4P5HA 3FHQA 4O61A 2O8OA 3LIHA 3JD72 2PHRA 3HNYM 4AVBA 2J42A 3WF3A 4BM8A 3I2JA 3BIEA 2OIIA 1ASJ2 4XMIA 1RUH2 4XTPA 3TNPB 1BLZA 1DQ0A 2ZJCA 4CVUA 1DZTA 1V9U2 4M3CA 5BNNA 2QZ2A 3THDA 4CXWA 4AI0A 2WYFA 4AGGA 5GZCA 1GFF2 1D4M1 5T5PA 1MEC3 2DFBA 1ST8A 4M3CE 4META 2W47A 1IHMA 4NMIA 3I3EA 2JDKA 3M7AA 2WT0A 3R05A 3BPZA 1BMV1 1XSQA 2VPVA 2ZAHA 3DECA 1Z7S3 3I3DA 5EYXA 2BGCA 1GQPA 3S5QA 5FP8A 1FAYA 3RZGA 4JHTA 4QT6A 1YYNA 2BERA 3WCRA 5C8WA 5KHIA 2I2SA 3AB0A 2FDJA 3VDDC 3HWJA 5KWRA 4IQPA 3IMMA 4XAEA 3L2HA 4R52A 2E26A 1UWWA 4RN5A 2BNMA 1MVQA 4KBZA 2B8MA 3OGGA 1O59A 3M3IA 5DAXA 3WF0A 4CCJA 3PVBB 2RS32 2G1MA 2PYTA 3LPFA 4M4RA 5GZEA 4XFGA 5CFCA 3T1LA 3POSA 1XNCA 4FT8A 3NO8A 5LY2A 5T5LA 4CZSA 2BJSA 4MGKE 4JC1A 1V6NA 2XLFA 4LR4A 3TOJA 2R6QA 5CB7A 1ENRA 3JBG1 5FY9A 2HJIA 2GALA 3WNXA 1BXHA 3UNPA 3T1MA 2PAKA 4QQPA 1HLCA 5EWSA 4L9BA 4ZKTB 1WW4A 3O1PA 1AYN1 5IK4A 2B45X 2EF6A 4YZ5A 2UURA 1OT5A 1LEMA 3NJZA 4W6XA 3AX4A 1H6YA 3PJYA 3IDBB 4LBKA 1G8WA 4INDA 1LAJA 2R043 2W91A 2XBO1 3A21A 3F95A 1J3RA 4R9BA 1K45A 3N9LA 4KH9A 1AR62 1MS0A 3CF6E 4LQRA 4Q8KA 2UY8A 1NXD1 5FO9B 4OCTA 4YSFA 5FBJA 1V00A 1H0BA 1QEXA 3RZKA 3VBSC 5HV4A 1O3RA 2D5HA 4LUMA 2VTXJ 2DUOA 3RVHA 5J48A 2BWAA 1QIQA 3GF6A 2YFUA 1Z7S2 1GWLA 1JN2P 4ZXEA 2XWJB 1Q8QA 4D69A 1W9YA 2JDZA 2OQ6A 4RQPA 5JPNB 1ZREA 3T2OA 4Q4Y3 1REEA 2A71A 3VHRA 2VW0A 4AEJA 1UU5A 2GN7A 3SITA 1V6MA 4IETA 1WCQA 2PQSA 3KQRA 4MLOA 2Y6GA 1R1A1 1W6MB 2PHWA 2QQUA 4QX8A 2FDHA 2LUWA 2HWF3 1QJU2 3OD4A 4IUGA 2EAAA 4D6RA 5C7GA 3DKQA 2JDPA 2PELA 3MF6A 5DXDA 2XR4A 4AF9A 4PT6A 1H8VA 2HEWF 3WF1A 3WX5A 5LCWL 3AL6A 2D6PA 3NAPC 4FP2A 4MYEA 3LSDA 4NWVA 3KQ4B 3U4SA 4HN1A 2FDIA 4QHOA 3NV2A 3J4UH 1YJLA 2VM9A 4KBBA 5GJ6A 4CDUA 1MQTC 2K0GA 5LATA 1IKPA 1IPJA 1AYM1 5T54A 3PVNA 3UJQA 5A70A 2OPKA 1NLSA 1RUH1 2BFUS 2ZABA 2R063 1KQRA 3WUCA 2XJRA 3I49A 3J7LA 5C9AC 4A6SA 4ATFA 3NV1A 3OD0A 1CQ9A 2B46X 4GA9A 2JIGA 4N8MA 1IOAA 2ZKLA 2WN3A 5KHJA 3OUHA 4CXXA 4JDMA 4YGCA 1TNRA 3ZDSA 3PNAA 3NRUA 3QH6A 4O9GA 3GZEA 3A4UA 1AX1A 4PDWB 1JW6A 3L2YA 2Y33A 2IXKA 5KXBA 4JCKA 2C24A 2ZHMA 3L9JT 4ZXKA 2JE8A 3OY8B 4N7UA 5FPUA 1E5HA 1YI7A 4EROA 2K2SA 4JGYA 5L36A 2ZGQA 2IVIB 3PTRB 3MV01 4H3WA 2JE7A 4MSVA 3ZXEA 4QQOA 4OUEA 5FQ0B 4DUXA 3AMQA 3PU3A 4GALA 4CDQA 3VBUB 1EV11 2VTFA 3OGJA 1TMF3 4LIVA 5BXXA 4AWDA 4FPKA 2FCTA 2LROA 4NPLA 4S2HA 5CKNA 5L9VA 1WD3A 2VVEA 2JDMA 5FQ0A 3AMNA 2RDQA 1IS3A 1C4RA 4E4SA 1ZZ6A 4Q0UA 2GSYA 5FLIA 2HWF2 1WUVA 4I3PA 5IJRA 2VY0A 2NP0A 3EB7A 5B4XA 5C3SA 1MVEA 5FZCA 3H42B 3THTA 1WMFA 1Y4WA 4D7TA 5C8CB 4NHMA 2GU9A 3SH4A 4P9WA 3GXUA 1AHSA 1S0DA 2WZR2 3R4SA 5FCCA 4AL9A 4ASMB 3WV6A 1SQ4A 4OZOA 2YC0A 3NNGA 2Y26A 3SKJE 1X50A 4YVSC 4OQ9A 5A3UA 2WAAA 5JLVA 1G9BA 4R8HA 4ITCA 3BI3A 3O12A 5DUVA 1QNYA 4HN0A 5LEJA 2R062 2ZMKA 4QXCA 4BISA 1W8UA 4H2AA 4NIHA 4HL0A 4BQ2A 2JEMA 4M0NA 1NA1B 1UKRA 1WLTA 2VQAA 4XBNA 3OEBA 4M01A 1MEC1 1ZVFA 5SV5A 3NNJA 3U75A 4EV0A 4BQ3A 4IE6A 1JBCA 4N43B 1OOPA 3VBRA 3WG2A 2P1BA 1AR83 3H8RA 4NN0A 2A1XA 1QJY3 2V5DA 2BOJA 1C3HA 4N43A 4AHWA 4DXZA 4ZZ5A 5C4WB 4HFSA 3ZYIB 3LDRA 5I0RA 1UY4A 1PVXA 3C7OA 4GKXA 2NMOA 4CEWA 3VB9A 4W4ZA 5C4WA 4CSWA 3B94A 5J37A 2CV6A 3MFAA 5DAWA 5J36A 1GYKA 3VBFB 4LBNA 2AYHA 4QPGC 1JUIA 2E53A 4CCEA 3FWEA 5JR2A 1QJX1 1XU1A 2NPIA 3POEA 2JX9A 2OXBA 1HRV2 3P3NA 5E89A 2HBTA 1AZDA 4L0PA 4ZS2A 4CDXC 4HSLA 4NR1A 5T5JA 4RFRB 3ACHA 3WP3A 2BGOA 4FPOB 2GMMA 5DUUA 1CVNA 2B4KA 2VVFA 3U11A 1W99A 1UQXA 3ZFFA 1C8M3 4GJZA 2IFRA 1N1VA 1AJOA 4RA0A 1K5JA 1W8ZA 2YG0A 4YM0A 5AC93 1MS5A 4JQRA 1WD4A 1UMHA 4XW3A 1HB2A 2D6MA 2JWPA 1H30A 2P37A 3B01A 4TLGA 1BJQA 2ZX1A 1VR3A 2VMEA 1F5JA 3AZZA 2PAMA 5DMYA 2Q1FA 4AOCA 4AI1A 5IWFA 2YU2A 4CEYC 2BNOA 1J58A 1FMD2 4L2NA 3GZAA 2R041 4B8EA 3S5AA 1YFYA 2AR6A 4XFBA 1PM4A 1AX2A 3AM2A 1AJKA 1NE4A 2XJUA 3DKWA 1OH4A 3EQEA 3NQHA 4FPLA 4M4PA 3VD5A 3W59A 4AAXA 3U1XA 2J22A 3O5SA 1QJY2 2NM1A 1UZVA 2V73A 4XCAA 2C4XA 2ID4A 2PHTA 3PDQA 5FZBA 5BNPB 1DU3D 3ZPOA 4CP0A 3IMNA 3T30A 4M3CF 5IT6A 3WP6A 1YQ6A 3S7EA 2ET7A 1AXZA 3C7EA 1X33A 4GJYA 2WO1A 3C7GA 4A3XA 4UF0B 3CL1A 4Q4Y1 4W6WA 1RUG3 4PQQA 5EIYB 2K9ZA 1K5MA 4GULA 5T55A 4Y22B 4XCBA 1X9PA 1ZRDA 1LOGA 2Q5TA 3B7MA 2BBVA 1GWKA 1ODMA 5LBEA 4DUVA 2Z42A 2PHDA 2ERFA 1UX6A 5ABJC 2VMFA 4Y22A 4I3GA 4WVMB 2UWAA 2YC2A 4XXAA 2TNFA 2RV9A 4WM8C 4IEUA 4C0HA 5J98B 1C8M2 4WVMA 2R1BA 3WQBA 1S4CA 1L3JA 4AE2A 2XL9A 5LASA 1T2XA 1QGLA 4LHSA 3SH3A 1RUI3 1AR93 5FK7A 3TRSB 1OSGA 4ES9A 1UW8A 1LENA 4AGRA 2A6WA 1J3PA 4XJ8A 4TYSA 4BU2A 1LGBA 3UGGA 1W6OB 2HBUA 3KV4A 4HETA 1S0EA 2XMLA 2R061 4M0HA 4UFLA 3SC7X 4Y4YA 3BALA 4MGTA 5AVAA 2DUPA 3K4AA 5CEHA 4HKOA 4XF0A 1CIYA 2RDNA 1NCRC 4H7LA 5DAQA 3ST7A 3ZN5A 5IVVA 2DFCA 2XHKA 1BCXA 2CGOA 2Y0IA 3AJYA 3PMSA 4BK4A 4COUA 1KJRA 3N7JA 1EYBA 4YW4A 3LA2A 5ACA3 2MHFA 1PX3A 3ZLIA 5FOJB 3B5LB 5FZDA 3V0AA 4Q4V2 4XFIA 3GHNA 3ZFGC 3MIGA 1LESA 3NL1A 3HNBM 5H9QA 1MS4A 1GZWB 1W39A 2DF7A 4FOYA 3VV1A 1SLAA 4Z2AA 1VRH2 1SLTA 2F4PA 2XJTA 5LB6A 1N1TA 4FSJA 3VD3A 2I07B 4ZU7A 1JOJA 4FPCA 3MGUA 3IPVB 5LRRA 4N53C 1XC6A 3KB5A 1JOPA 4DEVA 4BE3A 1TMF1 4JDNA 1BEV3 1UOBA 4NPRA 1HN0A 3KSCA 4BCUA 4UAPA 1RUG2 1VAMA 1ODNA 3OPZA 4XUTA 3ZKUA 2WA3A 2NMNA 4QAWA 3H3LA 4CXYA 1HV1A 1PIV3 4UFHA 2ZEYA 1SBDA 3DYMA 1VB4A 4FTBA 3R0RA 1HB1A 2HWD2 3DPRC 3NJYA 4YZ4A 1OKQA 4BLIA 3WVJA 3LCPA 2JKBA 5LRSA 3KHBA 1RUD3 3ZN6A 1DGRA 4ONUA 1HIXA 3JXSA 4YVWA 4XUPA 1M4WA 1YUDA 5IUQA 1GQHA 5HCHA 1ZZ8A 1JYVA 2Y6LA 4RL7A 1RUI2 4KI5M 3T08A 2VOKA 4LOTA 1CD3G 4MGZE 4YG3A 5CADA 3FFQA 2P3YA 3VLBB 4D6SA 3KVBA 2Y38A 5A3PA 2VBPA 4RHV2 3I3MA 4HBNA 5EPAA 1ULGA 2DVAA 2P6HA 5HXMA 1CZSA 1YHFA 4QKDA 2I74A 5ANNA 4D7SA 3ZSEA 3VD7A 3KCCA 5GLZA 3H0OA 2QQJA 1B35A 2VNOA 1AR81 2QKDA 4QM9A 4XZUG 5FJHA 4OI2A 4FAGA 2D97A 1RGSA 4XF1A 2OUJA 5FZ1A 1PK6B 4ZU5A 4I02A 4QB2A 4WZFA 2WSUA 3VN4A 1O8PA 4QDQA 1QNWA 3ES1A 5EZWA 1PK6A 4XUOA 1XYNA 2GH2A 1XQNA 1GUIA 2DUQA 3Q8BA 4BMEA 4QX2A 3PMEA 2WT1A 4HVOA 1BQPA 4OMCA 1BEV2 2QDRA 1SLLA 4ET7A 2WWSA 2ZZQA 4EN7B 1UN1A 3VL9A 1W8WA 5FZ0A 1SBEA 3MLJA 4XFHA 2SBAA 3QBQA 2VAUA 2WJSA 1UOJA 3JCIA 3OCPA 2VL4A 1C8M1 1E57A 1RUF1 5LW9A 2PLV3 3ZO0B 2ATFA 4WVZA 1RUD2 3VL8A 5AC91 4DO0A 1DLLA 4BK5A 5AFBA 2CNAA 3NV4A 4UBGA 2WZ8A 2WZPP 3OJBA 1ND2C 2W87A 4COYA 4MGQA 1LHOA 1RUJ2 4QDSA 2QDNA 1O4YA 2JE9A 4LHLA 4OHYA 4FPHA 4F83A 1W06A 3WDYA 3UESA 3R4DB 1UYZA 4MGYE 3USUB 1KXGA 3VDCA 1IPSA 1H8TC 3KT7A 4AEKA 5FUIA 1LECA 4PJYA 4MGIE 1LULA 2PHLA 1YQ5A 1NT0A 3BGAA 2Y6HA 4AFMA 1D2QA 2WQZC 4NIIA 2FDGA 1P8JA 1GNZA 2WNUC 4S2FA 5F5CA 5JZGB 3VDBA 3T4VA 2HKXA 2RVAA 4HPKA 4N7IA 4HK9A 2VZTA 1SACA 2IFWA 1I1EA 3J7NA 1UY1A 4YZ1A 1VBB3 3M8LA 2E7TA 1IS4A 2WYSA 1S0IA 1KDMA 1RMU2 2G9FA 2XGXA 4NHXA 5LK5A 1JZ2A 1R1ZA 4XQDA 4QX7A 3POFA 2V72A 1FXZA 2IXHA 5F7UA 2EXJA 2VZSA 4BZ4A 1CAVB 2JENA 1DZQA 1XNKA 2W52A 2XG3A 4V2VA 4XUNA 4IEPA 1OH3A 1LKNA 5FO7B 3POYA 2O0OA 4AAPA 1WW5A 4BDVB 1TEIA 3CJIB 3INAA 1JZ8A 2E6VA 3JBG3 4E8CA 2ZBJA 2ZS6B 4NIAA 4RR3C 4N9IA 3ZM8A 1NYWA 2CSGA 4YGEA 4XETA 3LOBA 4COZA 4HOOA 1AR91 3WW2A 2YHJA 4XJUA 2VNGA 2VNVA 4IV3B 3RYRA 3WQ1A 5JMCA 2P3KA 4LA2A 4YYOA 4IE4A 2HWC3 3U37A 1OKOA 1VLNA 3LA7A 3N9MA 3ROUA 2RG4A 3AZYA 5FZ3A 4DUWA 2Z79A 3VZMA 1D4M2 1JZ5A 3WG1A 2XBO3 4H55A 4DY3A 5GLVA 4HKWA 3ZDVA 3W20A 1OF3A 3PVOA 3MLKA 2YDEA 5FKBA 3ZN4A 3I3QA 2OQ7A 5ACA1 3WG3A 4QGMA 1BMV2 4NO4A 5FUPA 1ULPA 2XJSA 3OUJA 5H9PA 3HN1A 3B9CA 2XXZA 1MS8A 1WCKA 1CPMA 3B00A 2W39A 4KU7A 1S0BA 3QH7A 5FZ8A 1H4HA 3B9IA 1I5PA 1DCSA 5FJKA 3OB8A 4QQLA 2GC1A 3MYXA 4KWUA 4XURA 4I0AA 2WQ4A 1WA4A 1HJFA 5D1IA 2Z69A 4MOAA 2B39A 2X05A 2C9AA 1U5ZA 3GCWA 3R6SA 4QPIB 4B4RA 3POBA 1PIV1 4LE3A 5LEKA 4OI4A 2FBEA 3BTAA 1RXGA 4JGZB 4HANA 3WHUA 3ZYBA 1N1SA 2ZGUA 4G9SB 4NHYA 3JBG2 1GNHA 2W9XA 3KLSA 4W50A 2YGLA 1ULCA 4PF5A 1CJPA 1CONA 4UXAA 5A6ZA 1AL23 1VP6A 2BEOA 3ZMOA 1EUTA 1HQNA 3AFGA 1AYN2 1NUKA 1VBA3 2IVJA 5E88A 4BLJA 3I59B 2HWC2 1U5IA 4ZS3A 1XJAA 2FZ1A 3V0BB 5IVEA 3ZYPA 4RGAA 1PMHX 3WG4A 2WQ8A 2XBO2 4JX0A 5FYYA 2QQKA 3OEAA 2BV4A 2YXSA 4C1WA 2AREA 1HRI1 3MUY1 5CFDC 2R0FA 4ARYA 3BKZA 3O0WA 2SLIA 2ZX3A 4XJAA 5FMCA 4N90A 1Q56A 1JU4A 5FTTC 4YLZA 5AFEA 1OLRA 2DVBA 3M3OA 1JOBA 1W2TA 3D0JA 3D6EA 3VDAA 1EV13 1QOTA 2XLGA 4GH4B 2B9UA 5BPXA 5CNAA 2DVGA 2VU9A 3QACA 1LGNA 3D82A 3VBSA 4Z07A 1X8EA 3ZFEC 5JUVA 3IT8A 5A33A 1SPPA 3PHMA 5D8AC 1D0GA 1KFUL 1R1A2 5BV6A 3B3QE 4D94A 3WW4A 2N7GA 4P9XA 3W21A 1U5XA 2JB8A 2P3JA 5FZOB 4Y1UA 2GP5A 2WO3A 5L7OB 1HQLA 3U4XA 3DYPA 1PMJX 4KG8A 5FMOL 4KMQA 2PLV1 2X5IC 4R9DA 1AYM2 3LSEA 4M3CB 1NOVA 5BNNB 1GBGA 4C90A 5EP9A 1AL22 1DQ6A 3NAPA 1W3VA 4FQ4A 1FV3A 3QLQA 5ANQA 4B4PA 1IS5A 4PBOA 3MPPG 4XC9A 2ZX0A 3ILNA 3WP5A 2W1SA 1DIWA 3FLRA 4FFGA 1MQTA 1XPWA 1XU2A 4YZ3A 5AVPA 2RJLA 5FY5A 3T3YA 4DMIA 3AVSA 4RFT0 3RWKX 2W08A 1Y3TA 3K77A 3QOPA 2QFEA 1Y43B 1CZTA 5FWJA 3IB3A 4E8DA 1YRZA 2PHXA 4CCNA 4CP1A 3RZHA 5C9AA 2WO2A 1D7PM 4QB1A 2E63A 2GNBA 5CZKA 1L7QA 3LDBA 3MBWA 1E5RA 3OPTA 4BQ4A 2DVFA 1MZEA 3I7DA 1HKDA 5CU1A 1GP5A 1S2KA 2FDKA 4TLFA 4O7XA 1BBT1 1VBB1 4TSVA 4QXBA 4Y1XA 5L9BA 3IDEA 3SHRA 1QJX3 1LTEA 2DCKA 1JZ4A 2RS13 1EV12 1YQ8A 3JB8A 1FNZA 3AYEA 2VZQA 3KCXA 3OOXA 4PF1A 1REDA 5CFCB 1BK0A 2BVVA 1AR73 1UMIA 2R073 2JXAA 4WBBA 3VBHC 1K3IA 4AGVA 4XZPA 3WNMA 2JG9C 2ARXA 2WL1A 1APNA 1LOCA 5KHGA 5F5AA 2O1QA 1Q8VA 1E5IA 2VJXA 5T3NA 3N9PA 4LOSA 5LY1A 1A34A 5A3LA 4XUQA 5DZGA 4MGSA 1NXMA 4LHKA 2ZX4A 4XIKA 1YFUA 3DXTA 3S0MA 3RZLA 1QXPA 4RGGA 4IXLA 3VZJA 1F15A 1WZXA 1UY0A 1V6KA 3LFIA 3LQCA 2HWC1 2FMYA 5F2SA 4YFZA 2CWMA 4AVSA 5A1AA 1CAUA 1MEC2 3ACFA 4AEDC 4YVSA 5J96B 2ETEA 4ISQA 1DGWX 3O7OA 4AFBA 5C3RA 4OQ8A 1DHKB 1PVC3 3PUSA 4QGNA 5JOXA 3V64A 1OBNA 4RQPB 5IK7A 3UJOA 4UW5A 2Q8DA 3WR0A 1C1LA 3JQXA 4Q1RA 1GOGA 3ZSLA 2Z2SB 3TN93 1MPXA 2LALA 3GCXA 3MPBA 4DS0A 2FZ2A 4HONA 3FUQA 2WC2A 1QJX2 3R4UA 4FFIA 1FV2A 4Y24A 3GGLA 2RS12 3APBA 3EBRA 4QQHA 5T52A 3CJXA 1Q8SA 1G9AA 4B29A 2D98A 4EN6B 3LE0A 3I2IA 5E1RA 5EHDA 1DP0A 1D2SA 1XE7A 5JOYA 1ZX5A 4PLOA 2CU5A 2HYXA 4BB3A 4CDUB 4Q8LA 4QPGA 1I3HA 3DUIA 3MIHA 3NMBA 5DABA 2Q30A 2AC1A 3IDCB 3HN3A 5JI9A 4FP3A 1YCIA 4BIOA 1XOYA 1KEXA 4CCOA 3HQUA 4CDXA 3W5MA 2XLAA 3GBWA 5A3MA 4LKDA 2W1WA 1VIWB 5K0UC 4Y20A 4ZHNA 1ZA7A 2JDYA 2MPFA 2WS91 2DBIA 3MUZ1 1AL21 4WM7C 1GP6A 4A44A 1POV1 2B42B 3LFMA 4KGGA 4DRVA 3IIAA 1XSRA 4K21A 1JXNA 1VBA1 4XXPA 3S57A 4LE4A 3UKTA 2C6SA 1YIPA 4EN0A 4CDWC 3BOPA 5JPMB 3MIDA 2X09A 4Q4W1 4R9CA 2QQLA 3POGA 5CA6A 1H1MA 2R042 3N9QA 5F37A 3AXEA 4FPEA 4H7MA 1RB8G 3U10A 1ULFA 4JV4A 3LEKA 4HMZA 2D40A 4E9KA 1Q43A 1OA4A 1Y9GA 5DG2A 3DCQA 3UT0A 1W2AX 1VJ2A 3VGIA 3G6JB 4JGYB 3QD6A 1ALYA 1DYKA 4P9LA 4CEYA 3AMPA 2Y8KA 1M06G 5I8TA 4KWKA 4MVTA 1GSLA 4AI8A 5HCAA 3ZR6A 3V56A 4Q1PA 2QJVA 2ZXQA 3M1HA 4TN7A 3TWIA 3MLLA 4B4QA 3MO4A 1AXKA 4IGPA 4CDQB 4D0QA 5FDBA 1DQ5A 4AVAA 1B09A 3RYKA 5H9RA 3SNMA 2TUNA 5IVYA 4I2OA 2BUKA 1ND3B 4NUBA 4Q4Y2 4AHXA 1S1AA 4NROA 4NIGA 5IATA 1W2OA 3M3QA 1S0FA 3BU0A 1ND3A 3E6BA 3LZZA 1D4VB 1ZZ7A 4LBQA 3POWA 4PBPA 1LJ7A 1J1LA 2ZHKA 2W1UA 2OPWA 4YM3A 3Q8FA 2OYZA 1J59A 4XBLA 1RITA 5KR7A 3N3HA 4JTOA 3KT4A 3OUIA 1FX5A 2UYAA 1VBE3 4QX0A 2OZJA 4BJ0A 5BNOC 3P3PA 5FY8A 4WVVA 3T0DA 3LEMA 1OHFA 3GZTB 4Y5SA 4QD2A 1QDOA 5DPNA 5ABJA 1HW5A 4XEZA 1NZCA 1LGCA 1PO23 4C8DA 1QF3A 2IWGB 4FOWA 5HCFA 3VBRB 1OOPB 4F7ZA 4P5YA 1DF0A 3AZVA 3KVAA 3ZXGA 3S30A 2WR9A 1TQ5A 1UYPA 3AMHA 2XJVA 4P02B 3C3VA 2VW1A 4Q27A 5A80A 5C3PA 5I8YA 4NIDA 3ZIWA 3T4HB 1COV3 4PIZA 1UIKA 2JJ6A 5A32A 5EXOA 4Y1ZA 4BH9A 4CEWB 1GMMA 4LO7A 5I8SA 4C1XA 4CCDA 3GDBA 1NCRA 2BRTA 2WWUA 3MIFA 4OULA 4XFFA 3KWVA 3WQ7A 2RDRA 4CA9A 4XDOA 3BCWA 4HZFA 1G86A 2R1DA 4Y3OA 2DDUA 2B9VA 1UZZA 2RS11 1TMF2 3OBTA 1QXJA 4EQVA 4BQXA 3ZFGA 4QX5A 3MF9A 3USSA 1AR71 4LO5B 4GWJA 1G9FA 1MZFA 2R071 2ZEZA 3C7HA 3PURA 4YGDA 5DAPA 3EHKA 3VZLA 3N9OA 3ZFFB 3UK9A 1WCDJ 2P2KA 3KF3A 4LLOA 1LOEA 1O4TA 2G9GA 2Y6JA 3M4FA 4N53A 5LBFA 5FXWA 5K7PA 2CAUA 5CBLA 1RUF3 5FP3A 1GWMA 2UWBA 4MZUA 2CHHA 2HEVF 4KGQA 1EPWA 2JB4A 2X8KA 3TB0A 4CCKA 2VO5A 3D4KA 2AACA 3OTFA 4X6QB 3DPRB 4U36A 5FREA 4AVCA 2RJ2A 3OYWA 2Q1MA 1OVSA 1OA2A 3DPRA 1MZ6A 1OF4A 2D93A 2X53S 3NW4A 4RYDA 2EALA 2H6BA 3Q8CA 1VMHA 3CLPA 2VTXA 4Q29A 4Y26A 1UZYA 2VOXA 2QQPA 5CISA 1K42A 4Y1YA 1UMZA 4R9AA 5FZ7A 2W95A 3I4IA 1JUHA 1OQDA 1RUC3 4J25A 3FX3A 4TTGA 1UXZA 3CMGA 4I01A 1H9PA 5GLTA 1O3SA 1NQDA 2AEZA 3WXPA 4L97A 1CAXA 1AR82 2ZMLA 3U07A 1COV2 1PVC1 3ACGA 4EWDA 5IVCA 4UYBA 1RIRA 1OLQA 2VGDA 3PIGA 1NCQC 5JI7A 5JSPA 4LBOA 3VKNA 3DGTA 1K5MB 4IEWA 2VW2A 4PDWC 4QWNA 2BPA2 1AL0G 1A8MA 4Z82A 3TN91 4QB6A 4IESA 1ZBA3 4SLIA 5I0SA 2R16A 2ILMA 5FZLA 1RJ7A 2YUEA 3CNAA 4A4AA 4PHZA 4K1YA 2VCBA 4NJ4A 3ON7A 1QH7A 5IAXA 5JSOA 2WZEA 4YM2A 2Y60A 1PNGA 1G7YA 3BB6A 4CYDA 1W0PA 3CQOA 3RWNA 2YB7A 4YRDA 4HK8A 2HEYF 3VBUC 3E5UA 4FXKB 5HBAA 2A75A 2PN5A 4L8QA 2E9QA 1W6NA 3ZXLA 4DB5A 1C5HA 1RUF2 5F3CA 3K3NA 4LULA 1IQAA 1RYYA 3SQOA 5AC92 3WNLA 3AL5A 3WF2A 3JUUA 4QU1A 4BQ5A 2WN2A 5A7OA 4BOWA 1WMXA 1CJDA 1W05A 1HJGA 1UU6A 4XPVA 2YBPA 3I2DA 5C8CC 2J1RA 2A3YA 3JU9A 5JVVA 3WDWA 4FTSA 1W8NA 1O3TA 2EIBA 4K8FA 3VBOB 1VALA 1UIJA 5BNQA 5EJ1B 1SFYA 4ZY9A 2GC3A 4RS5C 3VKFC 1FATA 2FDFA 3CKHA 1O4ZA 3VBOA 4EZHA 4C91A 2CL2A 3V0AB 3WZ1A 4MHUA 2XVGA 5KC5A 1ND2A 4YW5A 4K1ZA 5FXXA 1RUC2 1C5IA 2XL7A 4LHNA 2WINB 4QHBA 3NSTA 3H1YA 4NHLA 2RHPA 1NA1C 1Z78A 1H8TA 2A70A 4BHPA 3UV9A 4ZZ8A 3H3UA 1YQCA 2Z5WA 3K48A 4NOTA 3JQWA 1W9WA 3C8XA 1AVBA 2ZEWA 3KGLA 4MXVA 4N43C 1JH5A 1O6UA 2K46A 1S0CA 2VZRA 5A3TA 3NVCA 1UYYA 1H2MA 2H0BA 4YW7A 2WNUA 1ZBA2 3AYDA 4DNYA 4LXLA 5J3UA 2A3WA 3I2GA 2QTWB 2A7AA 4W8JA 3ZN6B 3VBFC 4YVWB 3RI8A 1RC6A 3NKGA 1XYPA 4KU8A 3VHNA 1XE0A 2J1UA 1TME3 4PI2A 1JYWA 2QQVA 1PGL1 5FAXA 3SCFA 3AP4A 5A6YA 2VOTA 1VBE1 3NNMA 4WVWA 4JQTA 3RYPA 3ZSKA 4DXTA 5IK5A 3MIEA 1AR92 5LWBA 2KA3A 3AC0A 4K3UA 1CX4A 1YLLA 4RSUA 4ASLA 3THCA 1PO21 1D0HA 2ZHNA 3PUHA 1JHJA 3A23A 4QU2A 5JCTA 1T6GC 3NKTA 4RR3A 1ULOA 4Q4X3 2W5FA 4AQ6A 1B35B 3LEGA 1JMUB 1UX7A 3LA3A 1UZWA 2OA2A 2LRPA 3K3OA 4K40A 4S2DA 3ZMNA 2VMCA 1HRI3 3HJRA 4IEXA 1HV0A 4X6RB 1F8VA 2D44A 1GNYA 4FFHA 1QU0A 2XONA 4QKBA 1COV1 1EY2A 2VE1A 5ACA2 2JG8B 1BVVA 2W46A 2FMDA 1VMJA 3WDTA 3T09A 3CO2A 3HNMA 4CRQA 1DQ4A 2JG8A 5FXZA 1ZZ9A 3DL3A 2BYVE 2IC1A 5K4LA 3TYJA 5C71A 3HIFA 4P9YA 3ME2A 3H8UA 4KWLA 1GZTA 3OBRA 2DCJA 2HLEA 5BNPC 3IDAA 2PAEA 1LCLA 5FYUA 4OLLA 5DG1A 3H9AA 3HMYA 3MW4A 1PIV2 2VVDA 3HVDA 1UPSA 5FFOC 5A7PA 3UKVA 5FZAA 4BQ1A 4LKSA 4W6YA 5B4NA 1NE6A 4JHZA 3ASIA 4PIYA 2W1QA 2Z4FA 1F35A 4XILA 3X29B 3PL0A 1SDWA 1GLHA 1PZ7A 1L7LA 2WNOA 4EN9B 4QPWA 1RUOA 3H7JA 2ORZA 4XTMA 2Q8EA 1CAWA 1GOHA 2XDVA 3AP9A 2A6XA 1E5SA 4OHVA 3HT1A 5IK8A 3J9SA 1WCSA 4IE5A 3WF4A 1XXNA 1BZWA 1CIWA 1VMFA 4HVQA 1Y9QA 4A42A 4FFFA 1OMIA 5DQ0A 2A6ZA 2PXJA 5HPOA 5FYTA 1ENQA 4Q4X2 2GNDA 1IQDC 1IKQA 2VZPA 1YXWA 2VQUA 1RUC1 1G6NA 1TNFA 4HPKB 4CUAA 4TWTA 1HRI2 1W04A 3D8CA 4CPBA 4LA3A 4ZONA 1S55A 1W0OA 1UCXA 1Y7BA 3KS7A 4FPFA 5D2AA 3PJQA 4KQ7A 2CDOA 4UW4A 1QH6A 3ZXJA 1OPOA 4Z2WA 1WWYA 1BBT3 2H0VA 4AHYA 5KBFA 1HB4A 3V65A 1EAH3 1JYCA 3FE5A 2NN8A 1R083 4D8MA 1HN1A 4XQ4A 2ZA9A 1ZBA1 2C5DA 4GIQA 3ATGA 5IFPA 1U0AA 3P5BA 4AQSA 1WW6A 1ZNPA 4URAA 2OS2A 3N35A 4AI2A 3I3BA 5I91A 4OVEA 3OGSA 2HWE3 3GJAA 3PVEA 3GBGA 4AW7A 1RINA 3KM5A 2RS51 5F1RA 4A41A 3KV5A 3ZFEA 5ISLA 4FVVA 3BIWE 3MICA 1OFSA 2PLV2 3DN7A 2AENA 4GZ9A 5D8AA 1XNAA 1QQP1 5FLJA 1J84A 4LKFA 2VZOA 2PA7A 5FPLA 1KITA 1LNSA 2Q4SA 4LO8A 1W9TA 4J6GA 5FKCA 3ACLA 3J8F3 1US3A 2RMU3 2VBBA 4YW6A 1OI6A 5FYIA 1O7FA 3VKLA 1JYTA 4MG2A 1XYOA 2WNVC 3A22A 2GC0A 4FTEA 1X9TA 1QWRA 2OKXA 4YM1A 1LOFC 1BYHA 4GMP3 1KS4A 4XHXA 3ZYHA 4XIOA 5EYYA 3RJ2X 3RGBA 2E7QA 4Z8BA 1Q3EA 3MZHA 4AFDA 5B2GB 1YNAA 1ZRRA 1F5FA 2ADEA 1V6IA 4AEMA 1KD7A 2EICA 2GMEA 4HVRA 3WNKA 3DEMA 5C33A 1UY2A 2MEV3 2OZ6A 1W9SA 3U14A 1UPIA 3FMGA 1BBT2 1VBB2 4GB33 4M00A 4NPMA 2V09A 4Q2FA 1DBNA 5FY7A 4E2QA 3LWCA 4LKEA 3EO6A 1EAH2 4IV1C 1NAEA 4LMFA 2BNNA 2KM2A 1PK6C 2CAVA 2VNRA 4LUKA 4UT5A 5KC6A 4AXOA 1A8DA 3VDDB 1UOGA 4Q26A 5DUWA 4I0WB 5EJZB 2DURA 3ES4A 3WDXA 2GNTA 5I0DA 2FD8A 2WA4A 1SG3A 4Y1VA 1KJLA 5FZFA 2P4EA 2XOMA 3VDDA 4NE9A 4Y4RA 3UYJA 3NNLA 2ZGNA 5DZFA 2QVSB 1XNDA 5CG8A 2RR13 1A78A 2UWCA 3RG0A 1TME1 1BK1A 1W6QA 2QCSB 2VECA 2VXRA 1CPNA 2W92A 4QX3A 5JIUA 4OUMA 1N3QA 3LOIA 5FV3A 2A6VA 1UZ0A 3TEYA 5FYHA 2HWB3 2J1VA 2WS93 5L73A 4EWAA 3VBHA 2AH2A 1W6PA 1POV3 3B69A 5GZFA 4K8RB 3LIGA 1FT9A 2VQTA 4EJRA 1FI2A 1RUE1 1PZ9A 4EZ4A 3ZYRA 1QJZA 2RMU2 2WIIB 2NZ9A 3KCYA 4PLNA 1H4GA 3MIBA 3SCHA 1YEWA 4AK3A 2EIGA 4Q4W3 4Q4X1 5CIRA 2VCAA 2D3RA 3AP6A 1TVGA 5EJ3A 5J1XA 5G05L 1Q5OA 2VBDA 1T6BX 5GLUA 3J7HA 3T2PA 3ZOIA 4E2SA 2ZEXA 3JD73 1JU3A 3AP7A 2CYFA 4XVHA 3RDIA 4WV8A 3WY6A 1ASJ3 5HI0A 2W0XA 3FBYA 3AYAA 4QKFA 4L92A 1QHDA 2MEV2 2WAOA 5F39A 1DFQA 4Q0PA 3VBSB 4A6OA 4FI9A 5F6KA 3UL2A 4AEDA 4BXSV 5A33B 3I2OA 3O1OA 3AKSA 1EP0A 1O5LA 1SPPB 4XAAA 2W94A 5CKQA 2R30A 1BHGA 2C9KA 1VAKA 3OBZA 4QX1A 1VAVA 5I0UA 4EYUA 4FAHA 1ZZCA 5JZGC 2VD7A 2QQNA 4I09A 4XE9A 4DY5A 1R64A 3KD4A 4K9SA 4FO9A 3POIA 5CAZA 4D6QA 1KFXL 3I2FA 3MV11 1F4HA 4JAAA 3UETA 1H1IA 3MI8A 4O9EA 2YC4A 4G4FA 4ARXA 4IEZA 4Z1VA 1WMDA 5K9YA 5CYYA 4YARA 2RR12 2XWBB 2ZGOA 2VXJA 2PFWA 1BKZA 2J1EA 5A6XA 5KXDA 3FZ3A 2YU1A 3NAPB 3NV3A 4QPYA 3H50A 3PUIA 3QCWA 3FC0A 2HWB2 2WS92 3LF7A 3CJIC 2RS33 4LO6B 3KT1A 4A2UA 5LK7B 1CGPA 1MQTB 3ETPA 2BWCA 1RUNA 2IXJA 4QDRA 4CCCA 4FQZA 5C6CA 1VBA2 4P14A 3T2QA 3UGFA 4P00B 1BVP1 1GZCA 4N9HA 5CKMA 5C70A 4XFCA 3O0VA 1W90A 5EV7A 1XNBA 2PHFA 4O65A 4Q4W2 4YW1A 5GLWA 4IV3C 1WLCA 5K0UA 3UGHA 5C9AB 5IYYA 4OZXA 2LM3A 1SCSA 4L11A 4WM7A 2D6KA 2RJKA 1OVPA 4MXWA 4CUCA 5JXGA 3FHAA 4AQTA 1S2EA 1ZBE3 3BOWA 1JYNA 1LRHA 4GXLA 4LBMA 2VUDA 4OMDA 1ZYBA 3M3EA 2VZVA 2WSVA 3S7IA 5FZKA 2NLRA 1Q8PA 4CDWA 1JZ6A 3Q8AA 3ITQA 1Z0HA 5KXEA 5FOBB 1FPN3 4LBLA 2ZGMA 2VOVA 1EAH1 4HG6B 5FYVA 4KWJA 1AR63 5F3GA 4AQ2A 1R081 5BYNA 1S0GA 4KL1A 2E7AA 3IAPA 3MEPA 5KHKA 1V70A 2RE9A 4ATEA 1SFPA 4LO4B 3GJBA 3SMHA 4B1MA 1WKYA 3JZVA 1REFA 1JYXA 2AZ5A 2WO7A 4JKKA 4XQWA 5F5QA 3AP5A 2RM21 3MFCA 1JI6A 1ULDA 2R32A 1GV9A 2HWE1 3GYDA 3VZNA 2DWRA 3O1VA 3LEIA 4G3YC 5F6LB 4Q0QA 1PO13 4F3JA 4QPIC 4V1PA 5GM0A 3LB9A 1N47A 1UYXA 2XVLA 2QBXA 2XKPA 1GU3A 1LOBA 5FYZA 5A7NA 3RPQA 4AVTA 1CESA 1QJU3 2X10A 1QY4A 1H9WA 1WMEA 4JGZC 3ZX7A 3J8F1 2RMU1 1CAUB 2WNEA 5BNOB 4RD7A 4A7YA 4YVSB 4NVPA 1SBFA 1V6LA 4JTNA 3E6DA 3ENRA 3PUQA 2WUHA 4MHRA 3LKJA 4GMP1 3G7DA 2O8QA 5T5OA 5L9RA 1UXXX 1DYOA 3O0XA 5BNOA 5LZ6A 2GDFA 4AHZA 3WNOA 3TEWA 2EXKA 2Y6FA 2GC2A 5SV8A 4E4HA 4IDZA 3N4MA 2ZZJA 4EE2A 1O3QA 1PGSA 2D3SA 3OG2A 2P34A 4L99A 1ZBE2 1N3PA 1ZM1A 3AKQA 5M0TA 3LD8A 2MEV1 3WW1A 1GR3A 2YROA 4QKNA 4XF4A 4W65A 2J7MA 4TXWA 2EVXA 2VUAA 3O1SA 2XQRA 1US2A 2PHUA 5FZEA 4DQAA 2DTYA 4GB31 4DEQA 1FPN2 2D6LX 1FOD3 3PTYA 4QXKA 2H6CA 4B1LA 5JXIA 1AX0A 3AJZA 4OYUA 1Y9MA 1HQWA 3IZOA 1C1FA 4JRAA 4QPGB 2D3PA 1AR72 3VKMA 2R072 2I45A 4KG0A 2ZGPA 2J1SA 5DDJ1 4DXRA 4CCLA 2NQYA 3HBKA 4GH4C 4DXSA 2VCCA 4CDXB 3E5QA 2VG9A 2QZ3A 2GN3A 4PLMA 3T0AA 2ZGKA 2BTVC 4Y20B 2VZ1A 3C2UA 2RR11 2JIJA 5K8SA 3PUAA 1WLWA 1CN1A 1WGPA 2D7FA 1KRIA 2B5HA 3ZYJB 1PO12 1CR7A 2HWB1 2XVKA 3VUOA 2WDBA 2LTNA 1A3KA 1O5UA 2VZ3A 3CEWA 3IKWA 2QQWA 1JS9A 2VMIA 3N7LA 3PU8A 4RGKA 1VBC3 5L7OC 3MDPA 4UOJA 4X8NA 3CIHA 5FBZA 2ZGSA 1W6MA 3IWZA 3TEXA 5JAXA 2C1FA 3OGVA 5DAVA 3WHTA 5BNNC 3U0ZA 4Y33A 1LODA 4CEYB 2ZAAA 1I9RA 1U12A 3O14A 1ONAA 2WZR3 3H1MA 3H3ZA 3N7KA 4GWMA 4KNCA 3MW3A 5FZMA 5A7QA 1MR5A 1W2NA 3K4ZA 5IAVA 4BQYA 3O1RA 3O1UA 2DVDA 1YO8A 3JD71 2A6YA 1Q8OA 4C0BA 1I5ZA 1PVC2 1ASJ1 1F4AA 2YGMA 4FXGB 4FOVA 1V9U1 2VMDA 5E16A 3VZOA 3ZKYA 4E2GA 5E8AA 3VD4A 2XJPA 4Y5Z0 2ZMNA 4BPZA 4LBQD 4K7JA 3TAYA 2VMHA 2OW4A 1V0AA 5FPBA 3TN92 1NCQB 4PI0A 5A6QA 4LBQB 5APAA 1FOD2 4NWWA 1H2LA 4QMAA 4YZ2A 5IVJA 2BP6A 4OHZA 2X29A 4JKLA 1NCQA 3B93A 3BTXA 2BBAA 1IZ3A 1SLBA 2XHNA 4P9GA 4IERA 1LOAA 3SXWA 4PDWA 4BXFA 2ZKNA 5FO8B 3ZXAC 5CFCC 5FP7A 3WD5A 3NJVA 2DCYA 2Y64A 4I30A 5JWPA 1F31A 3OY8A 1U5YA 4FBFA 5ABJB 4BQWA 1OLMA 4QXHA 1OUSA 5FRAA 3O1MA 1HRV3 3FN9A 3LPGA 1S0JA 2YMZA 2GAUA 4WM8B 2XJQA 4PQ9A 1UU4A 4R4XA 2DU0A 2VQ0A 4CP9B 4V2WA 1DLCA 5FY4A 2Y0OA 2RS31 3VBUA 1OLME 5FY0A 4AVVA 4WM8A 2E31A 3CZJA 1NZIA 4E4DX 1DGLA 1VBC2 4CP9A 1VB2A 2WFPA 2JICA 5JXJA 2GNMA 2IXIA 5FYBA 2UYBA 4XJWA 1ZZBA 4LJHA 5F9TA 2PMWB 1ZA4A 5A32B 4GQ7A 1N1YA 2YBSA 2FCUA 3KGZA 3K51A 3IN9A 4IL7A 5FYCA 4UFMA 1SCRA 1VRBA 2PTMA 2QE3A 4FPGA 2QNKA 5C8CA 1GZ9A 1NCRB 4RS5B 1XRUA 3GALA 1PX4A 2ZX2A 1ZBE1 4MX3A 4GWIA 3H8OA 2ADDA 5FMDA 2VZUA 1UD1A 2R49A 4RS5A 4WZCA 2CGPA 1RHI3 2Q1ZB 4YWAA 3VKOA 3SEEA 5F3EA 1FMD3 2JD4A 3I97A 4MADA 2A73B 5LBCA 1RXFA 1FPN1 5FYMA 3OBAA 1HB3A 3ZFGB 4Z92B 1C28A 2BW8A 2IZWA 1MZ5A 5FMOS 5FK8A 1UF2C 2XUEA 1AR61 4RQPC 2P5BA 1NA1A 1X8MA 4YG0A 2ORXA 1PHMA 1WLDA 4NAMA 2C26A 4N53B 3AKTA 4UW6A 4AI3A 3D3AA 1PMIA 1R093 1SDDB 1QOSA 1UO9A 2VUCA 3W9AA 2UU8A 3I2KA 4BIFA 1Z7S1 1JZ7A 4IE0A 1FYUA 1OD3A 3ILRA 2AEYA 2XUMA 4Q0SA 3OYWB 5DZEA 5EQUA 3M3CA 2XH6A 4AR2A 5FMBA 1PGL2 1X7NA 3AFKA 1SMVA 2YFZA 1PO11 1SLCA 1VBE2 1LHWA 2CGNA 3EJKA 1XB9A 5JXHA 2KD7A 3S6PA 4CDUC 1G9CA 4LPLA 3VBFA 2WABA 1QJU1 3H8XA 1W03A 4R4ZA 3TNQA 2TEPA 2WRAA 3RI9A 1PO22 1JHNA 2GMPA 4BYYA 1WBLA 3KHCA 1NY72 3A0KA 1CX1A 2Q8OA 4B3NA 1LHVA 1CAXB 5IVFA 1SLIA 3IM0A 1YJKA 3AXDA 2Q0AA 1LR5A 3J26N 3ALQA 4XDPA 4ISRA 4MH0E 1G9DA 3O1TA 1PGW2 5FZ6A 2ENRA 3WEZA 3OF1A 1GICA 4FPJA 4UFIA 3ZVXA 3B02A 2NYYA 5EFUA 3KV6A 5CVRA 2ZGLA 2WKKA 5A3NA 1ULEA 1TG7A 1RHI2 3K46A 1F9KA 5A7WB 4BWOA 2WT2A 5C3OA 4JGYC 3AK0A 2VMGA 3CDZB 2ZPXA 1QJFA 1FOD1 4XYXA 3FBMA 4LLFA 5A7WA 3AMMA 1ENXA 1JODA 4CDQC 4DFSA 1W8FA 1W3XA 4Q4V3 5TSWA 4GD4A 3HAGA 4IEVA 1W6NB 4LEJA 5JOZA 2JDHA 3CHXA 2XB6C 3SKVA 1YQ2A 1FNYA 1R092 1ND3C 1VRH3 4A7KA 5FPVA 4PIXA 2RS53 3OPWA 3KF5A 2JDNA 5A3WA 1OD5A 1O91A 4MUVA 3LDKA 5FPZA 4GAZA 4CCMA 5BNPA 1ZRCA 1QQP3 2CWSA 3AVRA 4FCAA 2P17A 3E97A 3EMRA 2YBKA 3RMXA 2EA7A 4BMBA 1F2NA 4CUGA 5T50A 4P08A 4UF0A 5A7SA 1AXYA 2B7YA 2LW8A 1IG0A 2HWF1 1VBC1 4LIUA 5ERLA 2HWD3 1DQ1A 2E32A 1MACA 2BOIA
chains in the Genus database with same CATH topology
1HN1A 2JE8A 5IFPA 3MV01 3DYOA 4OUEA 4DUXA 2VTFA 2W1SA 1XPWA 3I3BA 3OGSA 3K77A 1CZTA 5IFTA 4A41A 1L7RA 3IB3A 4E8DA 4GZ9A 1XNAA 5IJRA 3EB7A 2WO2A 1D7PM 1J84A 4QB1A 5B4XA 2VZOA 5CZKA 1L7QA 3MBWA 1LNSA 1K12A 1W9TA 2CDPA 1US3A 3HPNA 3GXUA 2R7EB 3A22A 4OZOA 2DCKA 3NNGA 2OKXA 1JZ4A 3SKJE 2WAAA 4PF1A 2VZQA 1UMIA 2J1AA 1K3IA 3WNMA 3OEBA 2EICA 3WNKA 1UY2A 2Y6KA 5JMOA 2WBKA 2VJXA 3E1F1 1W9SA 5LA1A 4XUQA 3WNNA 2V5DA 4MGSA 4ZZ5A 1NAEA 3I2HA 1UY4A 3C7OA 3P6BA 2EIDA 1H6XA 4W4ZA 3EYPA 5EJZB 3LQCA 1UY0A 5I0DA 5JR2A 1SHWB 1SG3A 2XOMA 5A1AA 3ACFA 4L0PA 1XNTA 3FL7A 4QX3A 2W92A 4A3ZA 3ACHA 2BGOA 1UZ0A 3W5NA 2J1VA 3HOBA 2B4KA 1W99A 3CZUA 2VQTA 2YG0A 1GOGA 1UMHA 1MPXA 2VCAA 2VMEA 3GGLA 5DMYA 1TVGA 5J1XA 5G05L 4CU9A 3T2PA 3J7HA 3LE0A 3I2IA 2ZEXA 3BN6A 1DP0A 1JU3A 3HEIA 4XVHA 2HYXA 4CUBA 1EUUA 2BZDA 3HN3A 1CZVA 2WAOA 4A6OA 3VD5A 1KEXA 1OH4A 3NQHA 4FI9A 4M4PA 4AAXA 4BXSV 3W5MA 5LA2A 2W1WA 2J22A 2W94A 3IIIA 1BHGA 2C9KA 2J1TA 3MUZ1 2C4XA 2ID4A 4QX1A 4CU7A 4A44A 2QQNA 1NX9A 1R64A 1JZ3A 4AG4A 3C7EA 3I2FA 3MV11 2WO1A 3C7GA 3ECQA 1F4HA 4JKMA 3UETA 4PQQA 5EIYB 2X09A 4MO3M 2QQLA 2YC4A 4ARXA 2QQOA 4UI9L 3LEKA 2XQXA 5CYYA 4DUVA 2J1EA 2VMFA 2Y8KA 2JDAA 2YC2A 3PUIA 4CU6A 2JD9A 2RV9A 2ZXQA 3OGRA 3MO4A 4D0QA 3WNPA 3ETPA 3WQBA 4QDRA 1T2XA 4LHSA 3T2QA 4P00B 5C70A 1W8OA 4A45A 2QQIA 2L9LA 5IYYA 3P1IA 2BGPA 4CUCA 5JXGA 4CU8A 3FHAA 3K4AA 1JYNA 1CIYA 5LA0A 2W1UA 4OMDA 2VZVA 3ABZA 4BK4A 1JZ6A 4YPJA 4QX0A 1PX3A 4BJ0A 2E33A 4HG6B 3T0DA 5DPNA 2VC9A 3HNBM 3IAPA 4Z2AA 1W0NA 3VD3A 1WKYA 1JYXA 1XC6A 4P5YA 4DEVA 4JKKA 1J83A 1JI6A 4UAPA 4XUTA 4P02B 2VR4A 3LEIA 4QAWA 2ZEYA 3DYMA 3NJXA 1UYXA 1GMMA 2QBXA 1GU3A 3GDBA 2X10A 3JXSA 2QQMA 4XUPA 3IAQA 2DDUA 2B9VA 3T0BA 2WUHA 1JYVA 2Y6LA 4KI5M 3T08A 1UXXX 1DYOA 2W3JA 3WNOA 4GWJA 2ZEZA 3C7FA 3C7HA 1UY3A 3WSOA 3OG2A 2V4VA 2EIEA 2Y6JA 1CZSA 5HXMA 3VD7A 3K75B 2J7MA 2QQJA 4TXWA 4XZUG 2VO5A 5IHRA 1US2A 4DEQA 2RJ2A 3K4DA 4QB2A 3VD9A 5JXIA 4OYUA 3F2ZA 1O8PA 1OF4A 4QDQA 4RYDA 3ACIA 4XUOA 1GUIA 4QX2A 2J1SA 4DXRA 5G04L 1K42A 4DXSA 2VCCA 1GOFA 2W95A 4OMCA 3T0AA 4TTGA 2VZ1A 1UXZA 3CMGA 4ET7A 3ACGA 2WDBA 3SEPA 2VZ3A 2VL4A 4UOJA 3CIHA 1O8SA 4BK5A 4QB6A 2WZ8A 3OGVA 2W87A 4MGQA 4A4AA 4QDSA 2VCBA 3UESA 1UYZA 3K4ZA 3VDCA 2JKXA 2WZEA 1NKGA 3CQOA 5FUIA 2YB7A 5DN2A 1F4AA 2VMDA 3BGAA 2Y6HA 3VD4A 1P8JA 1RYYA 3WNLA 3WF2A 3VDBA 2WN2A 2RVAA 2VZTA 5LCWL 2J1RA 1UY1A 1W8NA 3A7QA 2LS6A 2EIBA 2WYSA 1KGYA 3GM8A 4JKLA 2BBAA 3FHQA 5EJ1B 2XHNA 4ZY9A 1JZ2A 3HNYM 2V72A 3CKHA 3WF3A 5F7UA 3I2JA 4CVUA 2VZSA 3NJVA 2Y64A 3THDA 4XUNA 3FN9A 3LPGA 4BDVB 1JZ8A 4ZZ8A 1DLCA 2W47A 4E8CA 1W9WA 3C8XA 2ZEWA 3I3EA 3ZM8A 2E31A 3CZJA 2VZRA 5JXJA 3DECA 1UYYA 3I3DA 1GQPA 2BERA 3U37A 3I2GA 4W8JA 4DUWA 1JZ5A 1PX4A 2E26A 1UWWA 4GWIA 4RN5A 2VZUA 2J1UA 1O59A 3WF0A 1JYWA 1OF3A 3SEEA 4M4RA 3LPFA 3I97A 2VOTA 4MADA 3OBAA 1ULPA 4DXTA 3AC0A 1I5PA 2ORXA 3THCA 2C26A 3PUHA 3OB8A 1JHJA 3A23A 3UNPA 3D3AA 1ULOA 1SDDB 4KWUA 4XURA 2W5FA 3I2KA 3LEGA 1UX7A 1JZ7A 1OD3A 4MOAA 1OT5A 2VMCA 2X05A 3HJRA 1GNYA 1H6YA 2XONA 2YFZA 2W46A 5JXHA 2W91A 2KD7A 3A21A 3T09A 1K45A 4LPLA 3HNMA 2WABA 4LQRA 2W9XA 4W50A 5C71A 1CX1A 1EUTA 2YFUA 2DCJA 2HLEA 4ZXEA 1NUKA 3IDAA 3T2OA 1WCQA 4LKSA 1PMHX 5B4NA 2PQSA 3WEZA 2WQ8A 2Y6GA 4JX0A 2QQKA 3OEAA 4JHZA 2W1QA 2Z4FA 3MUY1 4IUGA 1TG7A 5C7GA 3K46A 4ARYA 4QPWA 4PT6A 2ORZA 1GOHA 3CDZB 3WF1A 1JU4A 2VM9A 3WF4A 3VDAA 4A42A 5DQ0A 3SKVA 5HPOA 1YQ2A 5JUVA 1IQDC 2VZPA 2VQUA 4CUAA 2WN3A 2WO3A 2CDOA 3DYPA 3NRUA 1PMJX 4P08A 2LW8A 4KMQA 2E32A 4D8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HN1 A;  2JE8 A;  5IFP A;  3MV0 1;  3DYO A;  4OUE A;  4DUX A;  2VTF A;  2W1S A;  1XPW A;  3I3B A;  3OGS A;  3K77 A;  1CZT A;  5IFT A;  4A41 A;  1L7R A;  3IB3 A;  4E8D A;  4GZ9 A;  1XNA A;  5IJR A;  3EB7 A;  2WO2 A;  1D7P M;  1J84 A;  4QB1 A;  5B4X A;  2VZO A;  5CZK A;  1L7Q A;  3MBW A;  1LNS A;  1K12 A;  1W9T A;  2CDP A;  1US3 A;  3HPN A;  3GXU A;  2R7E B;  3A22 A;  4OZO A;  2DCK A;  3NNG A;  2OKX A;  1JZ4 A;  3SKJ E;  2WAA A;  4PF1 A;  2VZQ A;  1UMI A;  2J1A A;  1K3I A;  3WNM A;  3OEB A;  2EIC A;  3WNK A;  1UY2 A;  2Y6K A;  5JMO A;  2WBK A;  2VJX A;  3E1F 1;  1W9S A;  5LA1 A;  4XUQ A;  3WNN A;  2V5D A;  4MGS A;  4ZZ5 A;  1NAE A;  3I2H A;  1UY4 A;  3C7O A;  3P6B A;  2EID A;  1H6X A;  4W4Z A;  3EYP A;  5EJZ B;  3LQC A;  1UY0 A;  5I0D A;  5JR2 A;  1SHW B;  1SG3 A;  2XOM A;  5A1A A;  3ACF A;  4L0P A;  1XNT A;  3FL7 A;  4QX3 A;  2W92 A;  4A3Z A;  3ACH A;  2BGO A;  1UZ0 A;  3W5N A;  2J1V A;  3HOB A;  2B4K A;  1W99 A;  3CZU A;  2VQT A;  2YG0 A;  1GOG A;  1UMH A;  1MPX A;  2VCA A;  2VME A;  3GGL A;  5DMY A;  1TVG A;  5J1X A;  5G05 L;  4CU9 A;  3T2P A;  3J7H A;  3LE0 A;  3I2I A;  2ZEX A;  3BN6 A;  1DP0 A;  1JU3 A;  3HEI A;  4XVH A;  2HYX A;  4CUB A;  1EUU A;  2BZD A;  3HN3 A;  1CZV A;  2WAO A;  4A6O A;  3VD5 A;  1KEX A;  1OH4 A;  3NQH A;  4FI9 A;  4M4P A;  4AAX A;  4BXS V;  3W5M A;  5LA2 A;  2W1W A;  2J22 A;  2W94 A;  3III A;  1BHG A;  2C9K A;  2J1T A;  3MUZ 1;  2C4X A;  2ID4 A;  4QX1 A;  4CU7 A;  4A44 A;  2QQN A;  1NX9 A;  1R64 A;  1JZ3 A;  4AG4 A;  3C7E A;  3I2F A;  3MV1 1;  2WO1 A;  3C7G A;  3ECQ A;  1F4H A;  4JKM A;  3UET A;  4PQQ A;  5EIY B;  2X09 A;  4MO3 M;  2QQL A;  2YC4 A;  4ARX A;  2QQO A;  4UI9 L;  3LEK A;  2XQX A;  5CYY A;  4DUV A;  2J1E A;  2VMF A;  2Y8K A;  2JDA A;  2YC2 A;  3PUI A;  4CU6 A;  2JD9 A;  2RV9 A;  2ZXQ A;  3OGR A;  3MO4 A;  4D0Q A;  3WNP A;  3ETP A;  3WQB A;  4QDR A;  1T2X A;  4LHS A;  3T2Q A;  4P00 B;  5C70 A;  1W8O A;  4A45 A;  2QQI A;  2L9L A;  5IYY A;  3P1I A;  2BGP A;  4CUC A;  5JXG A;  4CU8 A;  3FHA A;  3K4A A;  1JYN A;  1CIY A;  5LA0 A;  2W1U A;  4OMD A;  2VZV A;  3ABZ A;  4BK4 A;  1JZ6 A;  4YPJ A;  4QX0 A;  1PX3 A;  4BJ0 A;  2E33 A;  4HG6 B;  3T0D A;  5DPN A;  2VC9 A;  3HNB M;  3IAP A;  4Z2A A;  1W0N A;  3VD3 A;  1WKY A;  1JYX A;  1XC6 A;  4P5Y A;  4DEV A;  4JKK A;  1J83 A;  1JI6 A;  4UAP A;  4XUT A;  4P02 B;  2VR4 A;  3LEI A;  4QAW A;  2ZEY A;  3DYM A;  3NJX A;  1UYX A;  1GMM A;  2QBX A;  1GU3 A;  3GDB A;  2X10 A;  3JXS A;  2QQM A;  4XUP A;  3IAQ A;  2DDU A;  2B9V A;  3T0B A;  2WUH A;  1JYV A;  2Y6L A;  4KI5 M;  3T08 A;  1UXX X;  1DYO A;  2W3J A;  3WNO A;  4GWJ A;  2ZEZ A;  3C7F A;  3C7H A;  1UY3 A;  3WSO A;  3OG2 A;  2V4V A;  2EIE A;  2Y6J A;  1CZS A;  5HXM A;  3VD7 A;  3K75 B;  2J7M A;  2QQJ A;  4TXW A;  4XZU G;  2VO5 A;  5IHR A;  1US2 A;  4DEQ A;  2RJ2 A;  3K4D A;  4QB2 A;  3VD9 A;  5JXI A;  4OYU A;  3F2Z A;  1O8P A;  1OF4 A;  4QDQ A;  4RYD A;  3ACI A;  4XUO A;  1GUI A;  4QX2 A;  2J1S A;  4DXR A;  5G04 L;  1K42 A;  4DXS A;  2VCC A;  1GOF A;  2W95 A;  4OMC A;  3T0A A;  4TTG A;  2VZ1 A;  1UXZ A;  3CMG A;  4ET7 A;  3ACG A;  2WDB A;  3SEP A;  2VZ3 A;  2VL4 A;  4UOJ A;  3CIH A;  1O8S A;  4BK5 A;  4QB6 A;  2WZ8 A;  3OGV A;  2W87 A;  4MGQ A;  4A4A A;  4QDS A;  2VCB A;  3UES A;  1UYZ A;  3K4Z A;  3VDC A;  2JKX A;  2WZE A;  1NKG A;  3CQO A;  5FUI A;  2YB7 A;  5DN2 A;  1F4A A;  2VMD A;  3BGA A;  2Y6H A;  3VD4 A;  1P8J A;  1RYY A;  3WNL A;  3WF2 A;  3VDB A;  2WN2 A;  2RVA A;  2VZT A;  5LCW L;  2J1R A;  1UY1 A;  1W8N A;  3A7Q A;  2LS6 A;  2EIB A;  2WYS A;  1KGY A;  3GM8 A;  4JKL A;  2BBA A;  3FHQ A;  5EJ1 B;  2XHN A;  4ZY9 A;  1JZ2 A;  3HNY M;  2V72 A;  3CKH A;  3WF3 A;  5F7U A;  3I2J A;  4CVU A;  2VZS A;  3NJV A;  2Y64 A;  3THD A;  4XUN A;  3FN9 A;  3LPG A;  4BDV B;  1JZ8 A;  4ZZ8 A;  1DLC A;  2W47 A;  4E8C A;  1W9W A;  3C8X A;  2ZEW A;  3I3E A;  3ZM8 A;  2E31 A;  3CZJ A;  2VZR A;  5JXJ A;  3DEC A;  1UYY A;  3I3D A;  1GQP A;  2BER A;  3U37 A;  3I2G A;  4W8J A;  4DUW A;  1JZ5 A;  1PX4 A;  2E26 A;  1UWW A;  4GWI A;  4RN5 A;  2VZU A;  2J1U A;  1O59 A;  3WF0 A;  1JYW A;  1OF3 A;  3SEE A;  4M4R A;  3LPF A;  3I97 A;  2VOT A;  4MAD A;  3OBA A;  1ULP A;  4DXT A;  3AC0 A;  1I5P A;  2ORX A;  3THC A;  2C26 A;  3PUH A;  3OB8 A;  1JHJ A;  3A23 A;  3UNP A;  3D3A A;  1ULO A;  1SDD B;  4KWU A;  4XUR A;  2W5F A;  3I2K A;  3LEG A;  1UX7 A;  1JZ7 A;  1OD3 A;  4MOA A;  1OT5 A;  2VMC A;  2X05 A;  3HJR A;  1GNY A;  1H6Y A;  2XON A;  2YFZ A;  2W46 A;  5JXH A;  2W91 A;  2KD7 A;  3A21 A;  3T09 A;  1K45 A;  4LPL A;  3HNM A;  2WAB A;  4LQR A;  2W9X A;  4W50 A;  5C71 A;  1CX1 A;  1EUT A;  2YFU A;  2DCJ A;  2HLE A;  4ZXE A;  1NUK A;  3IDA A;  3T2O A;  1WCQ A;  4LKS A;  1PMH X;  5B4N A;  2PQS A;  3WEZ A;  2WQ8 A;  2Y6G A;  4JX0 A;  2QQK A;  3OEA A;  4JHZ A;  2W1Q A;  2Z4F A;  3MUY 1;  4IUG A;  1TG7 A;  5C7G A;  3K46 A;  4ARY A;  4QPW A;  4PT6 A;  2ORZ A;  1GOH A;  3CDZ B;  3WF1 A;  1JU4 A;  2VM9 A;  3WF4 A;  3VDA A;  4A42 A;  5DQ0 A;  3SKV A;  5HPO A;  1YQ2 A;  5JUV A;  1IQD C;  2VZP A;  2VQU A;  4CUA A;  2WN3 A;  2WO3 A;  2CDO A;  3DYP A;  3NRU A;  1PMJ X;  4P08 A;  2LW8 A;  4KMQ A;  2E32 A;  4D8M A; 
#chains in the Genus database with same CATH topology
 1ND2 B;  1RJ8 A;  1VPH A;  3RZM A;  1WA6 X;  1UAI A;  3HT2 A;  2WZR 1;  4K20 A;  4IE7 A;  4XBQ A;  4CTE A;  1H8T B;  4IEY A;  3DYO A;  3PIJ A;  4NRP A;  3BYW A;  1X36 A;  4AYU A;  2BDR A;  3ZSJ A;  4OHW A;  1PNF A;  3VBR C;  3VZK A;  1LHN A;  1OOP C;  2BVB A;  5C5T A;  2YYO A;  4XDQ A;  2CTV A;  3I8T A;  3SLI A;  5IFT A;  1W28 A;  2PQQ A;  3FFZ A;  1L7R A;  2DBN A;  1H2K A;  4RHV 3;  2WNU B;  4URT A;  1XBF A;  1LED A;  1W6O A;  4MV2 A;  5FZ9 A;  4ASK A;  4E4Z A;  5J09 A;  2GH8 A;  4CEW C;  5C4W C;  1K12 A;  2CDP A;  4A7Z A;  3OSD A;  1LU2 A;  2GZW A;  3HPN A;  5LBB A;  4S2G A;  1YI9 A;  3IBM A;  3TEZ A;  2R7E B;  3AZW A;  3D0S A;  4XHB A;  1RTV A;  3HR9 A;  5FPA A;  3FLT A;  4UFJ A;  4XJ9 A;  3DXU A;  2DYC A;  2EXI A;  3WT3 A;  4IGQ A;  5FLH A;  3H1W A;  3WOG A;  4YW2 A;  4D7Y A;  2EAK A;  2HH9 A;  1OQE A;  1NQJ A;  2RS5 2;  3RSJ A;  1MS1 A;  2J1A A;  3WIN E;  1YIF A;  4J1W A;  4LK7 A;  1GZW A;  3KMH A;  1NLR A;  4JVA A;  3CU7 A;  3ZFF C;  3ZYG A;  4OHX A;  4EWE A;  1HRV 1;  1QQP 2;  1YC6 1;  4IEO A;  3ZPY A;  2D43 A;  3IPV A;  2D6O X;  2Y6K A;  3Q8E A;  2V4A A;  4RR3 B;  3ZXF A;  5JMO A;  1H2N A;  1RUE 3;  1QDC A;  2WBK A;  4XJZ A;  3W58 A;  2FQP A;  1W8H A;  1LB2 A;  3E1F 1;  5LA1 A;  2DCT A;  3FHI B;  4LIT A;  3WQ0 A;  3WNN A;  1NY7 1;  2G19 A;  2R0H A;  4HKL A;  3URF A;  3NNF A;  4LNV A;  3BTY A;  3I2H A;  4QHZ A;  5F5I A;  1KS5 A;  4UWD A;  4DIN B;  3P6B A;  2EID A;  1H6X A;  2WNV B;  3EYP A;  1YFX A;  3E6C C;  5JDB A;  5IVB A;  1QOO A;  3WUD A;  4JZR A;  1SHW B;  5FZG A;  1PGW 1;  5HXV A;  1OC1 A;  2WNV A;  1RUJ 3;  2ET1 A;  2OX0 A;  1SZB A;  5GAL A;  5J7M A;  3RJR A;  5D21 A;  1LOF A;  2Y34 A;  3HBZ A;  3J7M A;  1XNT A;  3FL7 A;  4LBJ A;  3SH5 A;  3GZU C;  1RHI 1;  1VBD 3;  3ZXD A;  5F3I A;  5A1F A;  1V6J A;  4A3Z A;  4U2A A;  1FMD 1;  2DU1 A;  3FJS A;  5A1L A;  3W5N A;  4GMP 0;  1RVF 3;  1URX A;  3HOB A;  3N36 A;  3BVC A;  1ENS A;  5FYS A;  3CZU A;  2O14 A;  2HYK A;  3AKR A;  5FPX A;  1QKQ A;  1IPK A;  2TBV A;  2DCZ A;  5JIA A;  3LAG A;  1K5M C;  1LHU A;  4IV1 B;  1QJY 1;  2F17 A;  2Q8C A;  3ORJ A;  5KXC A;  1HXS 3;  1R09 1;  4CP2 A;  1J3Q A;  5H9S A;  4IV1 A;  4AI9 A;  1CAW B;  4AFA A;  4B7E A;  4CU9 A;  1RMU 3;  1UKG A;  3RS6 A;  2YZ4 A;  3SCG A;  3ZXK A;  1TME 2;  2ZHL A;  3VHO A;  3GHM A;  3UKN A;  3BN6 A;  4HSJ A;  3HEI A;  4FPY A;  1SEF A;  3K2O A;  1J1T A;  1EUU A;  4HXC A;  1NG0 A;  4HLT A;  2JDU A;  4CUB A;  2BZD A;  4DOU A;  2WLQ A;  1CZV A;  1RUE 2;  3ILF A;  3HD8 B;  4GWN A;  3KZ4 C;  2YV8 A;  3HQR A;  4CPB D;  4TZD A;  5CG9 A;  2IUW A;  3MHZ A;  5LA2 A;  1PZ8 A;  2XPJ A;  3III A;  4ORF A;  2J1T A;  4CU7 A;  2WFF 3;  1MS3 A;  3ZR5 A;  1CWP A;  1NX9 A;  3BOD A;  1NLQ A;  1X82 A;  2G4I A;  5FP4 A;  3T2T A;  1JZ3 A;  4LTA A;  2ES3 A;  4AG4 A;  1SFN A;  3JB4 C;  3Q9O A;  1QXR A;  1OXC A;  3ECQ A;  4XAB A;  3VHP A;  3VBO C;  4JKM A;  4XF3 A;  4XOG A;  1DZR A;  1UL9 A;  1POV 0;  4MO3 M;  2ZTN A;  1OPM A;  1OQ1 A;  2QQO A;  5FZ4 A;  5KHH A;  1OUR A;  4J1X A;  4UI9 L;  5CFD B;  2XQX A;  3LGR A;  3NWK A;  1AF9 A;  1D4M 3;  3A0N A;  1VBD 2;  5FXV A;  4LK6 A;  5CFD A;  4H14 A;  2JDA A;  2D5F A;  4CU6 A;  3ELN A;  2JD9 A;  3USU A;  1RVF 2;  2C0Z A;  4NAO A;  3OGR A;  4ES8 A;  3M70 A;  3WNP A;  4XFA A;  5HCB A;  1ACC A;  2AGS A;  5FWE A;  1ZRF A;  4Q4V 1;  4SBV A;  5FY1 A;  3GNE A;  2ARB A;  3ZFE B;  4DIQ A;  2RM2 3;  3RFR A;  3ZYF A;  1DGR N;  1W8O A;  4A45 A;  2QQI A;  2ARA A;  1HXS 2;  1VRH 1;  5D8A B;  1C8N A;  1N3O A;  2L9L A;  5C3Q A;  4GKY A;  3KV9 A;  3P1I A;  5JSR A;  2ZGT A;  5BUV A;  5JZG A;  1JYI A;  3D5O A;  2BGP A;  4CU8 A;  2E51 A;  2ZAC A;  1H1A A;  5F2W A;  5F8P A;  5LA0 A;  2KXL A;  5I93 A;  2IXL A;  1RUG 1;  3BPS A;  2VOW A;  4YVW C;  3BU7 A;  3ABZ A;  3THP A;  4YPJ A;  4COW A;  2X5I B;  5JOW A;  3MW2 A;  3WLU A;  4JRL A;  3FUO A;  3TBD A;  1I6X A;  1W9F A;  3WDU A;  1CAV A;  2D6N A;  2E33 A;  2HWD 1;  2VUL A;  4YFW A;  2F6B A;  2X5I A;  4LT5 A;  2GP3 A;  4JDO A;  3U78 A;  2VC9 A;  2OUH A;  1RL3 A;  2WFF 2;  4F8A A;  3RRD A;  2DTW A;  1W0N A;  1GAN A;  1STM A;  3POJ A;  2EXH A;  1MS9 A;  3CJI A;  2BQP A;  4UFK A;  1AUY A;  2MNG A;  2FHR A;  4DZG A;  4OFG A;  1POQ A;  1RUI 1;  2XKO A;  2VUJ A;  5A3O A;  1AYN 3;  1J83 A;  3ZIX A;  1V6O A;  1B35 C;  1OUX A;  1WBF A;  2VR4 A;  5C5U A;  5FZH A;  1HDK A;  4UW3 A;  4IV3 A;  5BY5 A;  4RHV 1;  5DUX A;  1W2U A;  1DYP A;  3NJX A;  4XMA A;  1EPZ A;  2JG8 C;  2A5Z A;  1R08 2;  2OT7 A;  1TE1 B;  2ARC A;  4FOQ A;  1OA3 A;  2BFU L;  2QQM A;  3IAQ A;  4DRR A;  2RDS A;  5DDJ 3;  3HQX A;  1W6Q B;  3RMY A;  3T0B A;  2V5Y A;  3BUC A;  2W3J A;  2KR2 A;  2RM2 2;  1GQG A;  2HWE 2;  4YG6 A;  4YGB A;  3SIS A;  3VBH B;  4Q5O A;  5JR7 B;  4QQ2 A;  3C7F A;  1W6P B;  3ZSM A;  1XE8 A;  4NRQ A;  2JG9 B;  4NRM A;  5FUN A;  1UY3 A;  4B7K A;  2QUO A;  3WSO A;  4X8P A;  1KDK A;  2V4V A;  2EIE A;  1ZRI A;  1BEV 1;  1R1A 3;  2ZCW A;  2JG9 A;  5HV0 A;  1QJE A;  2VH9 A;  1UOF A;  1C57 A;  2A3X A;  1HX6 A;  4LOR A;  3K75 B;  4UBH A;  3J8F 2;  5IHR A;  1DDL A;  5E6H A;  3DV8 A;  1DQ2 A;  3K4D A;  1GKB A;  1LU1 A;  2YPJ A;  5IW0 A;  3VD9 A;  4QPI A;  5FIX A;  4Y5T A;  4Q0V A;  3F2Z A;  3AKP A;  4P9J A;  2ZOE B;  4ZPI A;  1RUD 1;  2AUY A;  2FCV A;  2P6C A;  1GP4 A;  2BU9 A;  3ACI A;  1AYM 3;  4YW3 A;  4YNI A;  4JGZ A;  5FP9 A;  3WW3 A;  4AZZ A;  1A6C A;  1YWK A;  4P9I A;  1RUH 3;  1UNB A;  4AED B;  5G04 L;  4D3W A;  5GZD A;  1GOF A;  1RUJ 1;  1V9U 3;  3RNS A;  4IW3 A;  1PM7 A;  5FR3 A;  4PCR A;  4QM8 A;  4BA6 A;  5GKA C;  1VBD 1;  2YY1 A;  3WDV A;  1IGO A;  4I0B A;  3RZJ A;  4ZU4 A;  3M2M A;  4GB3 2;  1RVF 1;  3EXU A;  4IGO A;  1IS6 A;  4HT1 T;  3SEP A;  3I59 A;  4IEQ A;  5F32 A;  2ZGR A;  5LA9 A;  3V0B A;  5FZI A;  2CY6 A;  4XAC A;  1O8S A;  1VE0 A;  2UY9 A;  5DDJ 2;  1HXS 1;  3CBN A;  1JTZ X;  2F4L A;  2W2I A;  2JEC A;  3RQ0 A;  2W68 A;  2P3I A;  3AYC A;  4K6B A;  1RMU 1;  3DF0 A;  2YPD A;  3RZZ A;  2JKX A;  1NKG A;  1WCU A;  4AFC A;  5DN2 A;  4XF9 A;  3WP4 A;  3N9N A;  1WW7 A;  3H7Y A;  1DG6 A;  1QMJ A;  1OFN A;  1S2B A;  2OVU A;  4QGL A;  3BTZ A;  4GH4 A;  3FLP A;  2G9Z A;  4EN8 B;  4E27 A;  3GBF A;  3AZX A;  4OUS A;  5K0U B;  1TZO A;  4OI0 A;  3PLQ A;  1W8T A;  3ETQ A;  4WM7 B;  5GZG A;  4DPN A;  4CE8 A;  2IXC A;  4MXW B;  4OI1 A;  2DV9 A;  2WFF 1;  1YFW A;  5L19 A;  3WCS A;  2WLP A;  3I54 A;  1IG3 A;  5I0T A;  2WWJ A;  2VCM A;  3E5X A;  4NHK A;  3N7M A;  3A7Q A;  2LS6 A;  5FZO A;  1KGY A;  1DGW A;  3GM8 A;  4COV A;  5L7O A;  4CDW B;  4P5H A;  3FHQ A;  4O61 A;  2O8O A;  3LIH A;  3JD7 2;  2PHR A;  3HNY M;  4AVB A;  2J42 A;  3WF3 A;  4BM8 A;  3I2J A;  3BIE A;  2OII A;  1ASJ 2;  4XMI A;  1RUH 2;  4XTP A;  3TNP B;  1BLZ A;  1DQ0 A;  2ZJC A;  4CVU A;  1DZT A;  1V9U 2;  4M3C A;  5BNN A;  2QZ2 A;  3THD A;  4CXW A;  4AI0 A;  2WYF A;  4AGG A;  5GZC A;  1GFF 2;  1D4M 1;  5T5P A;  1MEC 3;  2DFB A;  1ST8 A;  4M3C E;  4MET A;  2W47 A;  1IHM A;  4NMI A;  3I3E A;  2JDK A;  3M7A A;  2WT0 A;  3R05 A;  3BPZ A;  1BMV 1;  1XSQ A;  2VPV A;  2ZAH A;  3DEC A;  1Z7S 3;  3I3D A;  5EYX A;  2BGC A;  1GQP A;  3S5Q A;  5FP8 A;  1FAY A;  3RZG A;  4JHT A;  4QT6 A;  1YYN A;  2BER A;  3WCR A;  5C8W A;  5KHI A;  2I2S A;  3AB0 A;  2FDJ A;  3VDD C;  3HWJ A;  5KWR A;  4IQP A;  3IMM A;  4XAE A;  3L2H A;  4R52 A;  2E26 A;  1UWW A;  4RN5 A;  2BNM A;  1MVQ A;  4KBZ A;  2B8M A;  3OGG A;  1O59 A;  3M3I A;  5DAX A;  3WF0 A;  4CCJ A;  3PVB B;  2RS3 2;  2G1M A;  2PYT A;  3LPF A;  4M4R A;  5GZE A;  4XFG A;  5CFC A;  3T1L A;  3POS A;  1XNC A;  4FT8 A;  3NO8 A;  5LY2 A;  5T5L A;  4CZS A;  2BJS A;  4MGK E;  4JC1 A;  1V6N A;  2XLF A;  4LR4 A;  3TOJ A;  2R6Q A;  5CB7 A;  1ENR A;  3JBG 1;  5FY9 A;  2HJI A;  2GAL A;  3WNX A;  1BXH A;  3UNP A;  3T1M A;  2PAK A;  4QQP A;  1HLC A;  5EWS A;  4L9B A;  4ZKT B;  1WW4 A;  3O1P A;  1AYN 1;  5IK4 A;  2B45 X;  2EF6 A;  4YZ5 A;  2UUR A;  1OT5 A;  1LEM A;  3NJZ A;  4W6X A;  3AX4 A;  1H6Y A;  3PJY A;  3IDB B;  4LBK A;  1G8W A;  4IND A;  1LAJ A;  2R04 3;  2W91 A;  2XBO 1;  3A21 A;  3F95 A;  1J3R A;  4R9B A;  1K45 A;  3N9L A;  4KH9 A;  1AR6 2;  1MS0 A;  3CF6 E;  4LQR A;  4Q8K A;  2UY8 A;  1NXD 1;  5FO9 B;  4OCT A;  4YSF A;  5FBJ A;  1V00 A;  1H0B A;  1QEX A;  3RZK A;  3VBS C;  5HV4 A;  1O3R A;  2D5H A;  4LUM A;  2VTX J;  2DUO A;  3RVH A;  5J48 A;  2BWA A;  1QIQ A;  3GF6 A;  2YFU A;  1Z7S 2;  1GWL A;  1JN2 P;  4ZXE A;  2XWJ B;  1Q8Q A;  4D69 A;  1W9Y A;  2JDZ A;  2OQ6 A;  4RQP A;  5JPN B;  1ZRE A;  3T2O A;  4Q4Y 3;  1REE A;  2A71 A;  3VHR A;  2VW0 A;  4AEJ A;  1UU5 A;  2GN7 A;  3SIT A;  1V6M A;  4IET A;  1WCQ A;  2PQS A;  3KQR A;  4MLO A;  2Y6G A;  1R1A 1;  1W6M B;  2PHW A;  2QQU A;  4QX8 A;  2FDH A;  2LUW A;  2HWF 3;  1QJU 2;  3OD4 A;  4IUG A;  2EAA A;  4D6R A;  5C7G A;  3DKQ A;  2JDP A;  2PEL A;  3MF6 A;  5DXD A;  2XR4 A;  4AF9 A;  4PT6 A;  1H8V A;  2HEW F;  3WF1 A;  3WX5 A;  5LCW L;  3AL6 A;  2D6P A;  3NAP C;  4FP2 A;  4MYE A;  3LSD A;  4NWV A;  3KQ4 B;  3U4S A;  4HN1 A;  2FDI A;  4QHO A;  3NV2 A;  3J4U H;  1YJL A;  2VM9 A;  4KBB A;  5GJ6 A;  4CDU A;  1MQT C;  2K0G A;  5LAT A;  1IKP A;  1IPJ A;  1AYM 1;  5T54 A;  3PVN A;  3UJQ A;  5A70 A;  2OPK A;  1NLS A;  1RUH 1;  2BFU S;  2ZAB A;  2R06 3;  1KQR A;  3WUC A;  2XJR A;  3I49 A;  3J7L A;  5C9A C;  4A6S A;  4ATF A;  3NV1 A;  3OD0 A;  1CQ9 A;  2B46 X;  4GA9 A;  2JIG A;  4N8M A;  1IOA A;  2ZKL A;  2WN3 A;  5KHJ A;  3OUH A;  4CXX A;  4JDM A;  4YGC A;  1TNR A;  3ZDS A;  3PNA A;  3NRU A;  3QH6 A;  4O9G A;  3GZE A;  3A4U A;  1AX1 A;  4PDW B;  1JW6 A;  3L2Y A;  2Y33 A;  2IXK A;  5KXB A;  4JCK A;  2C24 A;  2ZHM A;  3L9J T;  4ZXK A;  2JE8 A;  3OY8 B;  4N7U A;  5FPU A;  1E5H A;  1YI7 A;  4ERO A;  2K2S A;  4JGY A;  5L36 A;  2ZGQ A;  2IVI B;  3PTR B;  3MV0 1;  4H3W A;  2JE7 A;  4MSV A;  3ZXE A;  4QQO A;  4OUE A;  5FQ0 B;  4DUX A;  3AMQ A;  3PU3 A;  4GAL A;  4CDQ A;  3VBU B;  1EV1 1;  2VTF A;  3OGJ A;  1TMF 3;  4LIV A;  5BXX A;  4AWD A;  4FPK A;  2FCT A;  2LRO A;  4NPL A;  4S2H A;  5CKN A;  5L9V A;  1WD3 A;  2VVE A;  2JDM A;  5FQ0 A;  3AMN A;  2RDQ A;  1IS3 A;  1C4R A;  4E4S A;  1ZZ6 A;  4Q0U A;  2GSY A;  5FLI A;  2HWF 2;  1WUV A;  4I3P A;  5IJR A;  2VY0 A;  2NP0 A;  3EB7 A;  5B4X A;  5C3S A;  1MVE A;  5FZC A;  3H42 B;  3THT A;  1WMF A;  1Y4W A;  4D7T A;  5C8C B;  4NHM A;  2GU9 A;  3SH4 A;  4P9W A;  3GXU A;  1AHS A;  1S0D A;  2WZR 2;  3R4S A;  5FCC A;  4AL9 A;  4ASM B;  3WV6 A;  1SQ4 A;  4OZO A;  2YC0 A;  3NNG A;  2Y26 A;  3SKJ E;  1X50 A;  4YVS C;  4OQ9 A;  5A3U A;  2WAA A;  5JLV A;  1G9B A;  4R8H A;  4ITC A;  3BI3 A;  3O12 A;  5DUV A;  1QNY A;  4HN0 A;  5LEJ A;  2R06 2;  2ZMK A;  4QXC A;  4BIS A;  1W8U A;  4H2A A;  4NIH A;  4HL0 A;  4BQ2 A;  2JEM A;  4M0N A;  1NA1 B;  1UKR A;  1WLT A;  2VQA A;  4XBN A;  3OEB A;  4M01 A;  1MEC 1;  1ZVF A;  5SV5 A;  3NNJ A;  3U75 A;  4EV0 A;  4BQ3 A;  4IE6 A;  1JBC A;  4N43 B;  1OOP A;  3VBR A;  3WG2 A;  2P1B A;  1AR8 3;  3H8R A;  4NN0 A;  2A1X A;  1QJY 3;  2V5D A;  2BOJ A;  1C3H A;  4N43 A;  4AHW A;  4DXZ A;  4ZZ5 A;  5C4W B;  4HFS A;  3ZYI B;  3LDR A;  5I0R A;  1UY4 A;  1PVX A;  3C7O A;  4GKX A;  2NMO A;  4CEW A;  3VB9 A;  4W4Z A;  5C4W A;  4CSW A;  3B94 A;  5J37 A;  2CV6 A;  3MFA A;  5DAW A;  5J36 A;  1GYK A;  3VBF B;  4LBN A;  2AYH A;  4QPG C;  1JUI A;  2E53 A;  4CCE A;  3FWE A;  5JR2 A;  1QJX 1;  1XU1 A;  2NPI A;  3POE A;  2JX9 A;  2OXB A;  1HRV 2;  3P3N A;  5E89 A;  2HBT A;  1AZD A;  4L0P A;  4ZS2 A;  4CDX C;  4HSL A;  4NR1 A;  5T5J A;  4RFR B;  3ACH A;  3WP3 A;  2BGO A;  4FPO B;  2GMM A;  5DUU A;  1CVN A;  2B4K A;  2VVF A;  3U11 A;  1W99 A;  1UQX A;  3ZFF A;  1C8M 3;  4GJZ A;  2IFR A;  1N1V A;  1AJO A;  4RA0 A;  1K5J A;  1W8Z A;  2YG0 A;  4YM0 A;  5AC9 3;  1MS5 A;  4JQR A;  1WD4 A;  1UMH A;  4XW3 A;  1HB2 A;  2D6M A;  2JWP A;  1H30 A;  2P37 A;  3B01 A;  4TLG A;  1BJQ A;  2ZX1 A;  1VR3 A;  2VME A;  1F5J A;  3AZZ A;  2PAM A;  5DMY A;  2Q1F A;  4AOC A;  4AI1 A;  5IWF A;  2YU2 A;  4CEY C;  2BNO A;  1J58 A;  1FMD 2;  4L2N A;  3GZA A;  2R04 1;  4B8E A;  3S5A A;  1YFY A;  2AR6 A;  4XFB A;  1PM4 A;  1AX2 A;  3AM2 A;  1AJK A;  1NE4 A;  2XJU A;  3DKW A;  1OH4 A;  3EQE A;  3NQH A;  4FPL A;  4M4P A;  3VD5 A;  3W59 A;  4AAX A;  3U1X A;  2J22 A;  3O5S A;  1QJY 2;  2NM1 A;  1UZV A;  2V73 A;  4XCA A;  2C4X A;  2ID4 A;  2PHT A;  3PDQ A;  5FZB A;  5BNP B;  1DU3 D;  3ZPO A;  4CP0 A;  3IMN A;  3T30 A;  4M3C F;  5IT6 A;  3WP6 A;  1YQ6 A;  3S7E A;  2ET7 A;  1AXZ A;  3C7E A;  1X33 A;  4GJY A;  2WO1 A;  3C7G A;  4A3X A;  4UF0 B;  3CL1 A;  4Q4Y 1;  4W6W A;  1RUG 3;  4PQQ A;  5EIY B;  2K9Z A;  1K5M A;  4GUL A;  5T55 A;  4Y22 B;  4XCB A;  1X9P A;  1ZRD A;  1LOG A;  2Q5T A;  3B7M A;  2BBV A;  1GWK A;  1ODM A;  5LBE A;  4DUV A;  2Z42 A;  2PHD A;  2ERF A;  1UX6 A;  5ABJ C;  2VMF A;  4Y22 A;  4I3G A;  4WVM B;  2UWA A;  2YC2 A;  4XXA A;  2TNF A;  2RV9 A;  4WM8 C;  4IEU A;  4C0H A;  5J98 B;  1C8M 2;  4WVM A;  2R1B A;  3WQB A;  1S4C A;  1L3J A;  4AE2 A;  2XL9 A;  5LAS A;  1T2X A;  1QGL A;  4LHS A;  3SH3 A;  1RUI 3;  1AR9 3;  5FK7 A;  3TRS B;  1OSG A;  4ES9 A;  1UW8 A;  1LEN A;  4AGR A;  2A6W A;  1J3P A;  4XJ8 A;  4TYS A;  4BU2 A;  1LGB A;  3UGG A;  1W6O B;  2HBU A;  3KV4 A;  4HET A;  1S0E A;  2XML A;  2R06 1;  4M0H A;  4UFL A;  3SC7 X;  4Y4Y A;  3BAL A;  4MGT A;  5AVA A;  2DUP A;  3K4A A;  5CEH A;  4HKO A;  4XF0 A;  1CIY A;  2RDN A;  1NCR C;  4H7L A;  5DAQ A;  3ST7 A;  3ZN5 A;  5IVV A;  2DFC A;  2XHK A;  1BCX A;  2CGO A;  2Y0I A;  3AJY A;  3PMS A;  4BK4 A;  4COU A;  1KJR A;  3N7J A;  1EYB A;  4YW4 A;  3LA2 A;  5ACA 3;  2MHF A;  1PX3 A;  3ZLI A;  5FOJ B;  3B5L B;  5FZD A;  3V0A A;  4Q4V 2;  4XFI A;  3GHN A;  3ZFG C;  3MIG A;  1LES A;  3NL1 A;  3HNB M;  5H9Q A;  1MS4 A;  1GZW B;  1W39 A;  2DF7 A;  4FOY A;  3VV1 A;  1SLA A;  4Z2A A;  1VRH 2;  1SLT A;  2F4P A;  2XJT A;  5LB6 A;  1N1T A;  4FSJ A;  3VD3 A;  2I07 B;  4ZU7 A;  1JOJ A;  4FPC A;  3MGU A;  3IPV B;  5LRR A;  4N53 C;  1XC6 A;  3KB5 A;  1JOP A;  4DEV A;  4BE3 A;  1TMF 1;  4JDN A;  1BEV 3;  1UOB A;  4NPR A;  1HN0 A;  3KSC A;  4BCU A;  4UAP A;  1RUG 2;  1VAM A;  1ODN A;  3OPZ A;  4XUT A;  3ZKU A;  2WA3 A;  2NMN A;  4QAW A;  3H3L A;  4CXY A;  1HV1 A;  1PIV 3;  4UFH A;  2ZEY A;  1SBD A;  3DYM A;  1VB4 A;  4FTB A;  3R0R A;  1HB1 A;  2HWD 2;  3DPR C;  3NJY A;  4YZ4 A;  1OKQ A;  4BLI A;  3WVJ A;  3LCP A;  2JKB A;  5LRS A;  3KHB A;  1RUD 3;  3ZN6 A;  1DGR A;  4ONU A;  1HIX A;  3JXS A;  4YVW A;  4XUP A;  1M4W A;  1YUD A;  5IUQ A;  1GQH A;  5HCH A;  1ZZ8 A;  1JYV A;  2Y6L A;  4RL7 A;  1RUI 2;  4KI5 M;  3T08 A;  2VOK A;  4LOT A;  1CD3 G;  4MGZ E;  4YG3 A;  5CAD A;  3FFQ A;  2P3Y A;  3VLB B;  4D6S A;  3KVB A;  2Y38 A;  5A3P A;  2VBP A;  4RHV 2;  3I3M A;  4HBN A;  5EPA A;  1ULG A;  2DVA A;  2P6H A;  5HXM A;  1CZS A;  1YHF A;  4QKD A;  2I74 A;  5ANN A;  4D7S A;  3ZSE A;  3VD7 A;  3KCC A;  5GLZ A;  3H0O A;  2QQJ A;  1B35 A;  2VNO A;  1AR8 1;  2QKD A;  4QM9 A;  4XZU G;  5FJH A;  4OI2 A;  4FAG A;  2D97 A;  1RGS A;  4XF1 A;  2OUJ A;  5FZ1 A;  1PK6 B;  4ZU5 A;  4I02 A;  4QB2 A;  4WZF A;  2WSU A;  3VN4 A;  1O8P A;  4QDQ A;  1QNW A;  3ES1 A;  5EZW A;  1PK6 A;  4XUO A;  1XYN A;  2GH2 A;  1XQN A;  1GUI A;  2DUQ A;  3Q8B A;  4BME A;  4QX2 A;  3PME A;  2WT1 A;  4HVO A;  1BQP A;  4OMC A;  1BEV 2;  2QDR A;  1SLL A;  4ET7 A;  2WWS A;  2ZZQ A;  4EN7 B;  1UN1 A;  3VL9 A;  1W8W A;  5FZ0 A;  1SBE A;  3MLJ A;  4XFH A;  2SBA A;  3QBQ A;  2VAU A;  2WJS A;  1UOJ A;  3JCI A;  3OCP A;  2VL4 A;  1C8M 1;  1E57 A;  1RUF 1;  5LW9 A;  2PLV 3;  3ZO0 B;  2ATF A;  4WVZ A;  1RUD 2;  3VL8 A;  5AC9 1;  4DO0 A;  1DLL A;  4BK5 A;  5AFB A;  2CNA A;  3NV4 A;  4UBG A;  2WZ8 A;  2WZP P;  3OJB A;  1ND2 C;  2W87 A;  4COY A;  4MGQ A;  1LHO A;  1RUJ 2;  4QDS A;  2QDN A;  1O4Y A;  2JE9 A;  4LHL A;  4OHY A;  4FPH A;  4F83 A;  1W06 A;  3WDY A;  3UES A;  3R4D B;  1UYZ A;  4MGY E;  3USU B;  1KXG A;  3VDC A;  1IPS A;  1H8T C;  3KT7 A;  4AEK A;  5FUI A;  1LEC A;  4PJY A;  4MGI E;  1LUL A;  2PHL A;  1YQ5 A;  1NT0 A;  3BGA A;  2Y6H A;  4AFM A;  1D2Q A;  2WQZ C;  4NII A;  2FDG A;  1P8J A;  1GNZ A;  2WNU C;  4S2F A;  5F5C A;  5JZG B;  3VDB A;  3T4V A;  2HKX A;  2RVA A;  4HPK A;  4N7I A;  4HK9 A;  2VZT A;  1SAC A;  2IFW A;  1I1E A;  3J7N A;  1UY1 A;  4YZ1 A;  1VBB 3;  3M8L A;  2E7T A;  1IS4 A;  2WYS A;  1S0I A;  1KDM A;  1RMU 2;  2G9F A;  2XGX A;  4NHX A;  5LK5 A;  1JZ2 A;  1R1Z A;  4XQD A;  4QX7 A;  3POF A;  2V72 A;  1FXZ A;  2IXH A;  5F7U A;  2EXJ A;  2VZS A;  4BZ4 A;  1CAV B;  2JEN A;  1DZQ A;  1XNK A;  2W52 A;  2XG3 A;  4V2V A;  4XUN A;  4IEP A;  1OH3 A;  1LKN A;  5FO7 B;  3POY A;  2O0O A;  4AAP A;  1WW5 A;  4BDV B;  1TEI A;  3CJI B;  3INA A;  1JZ8 A;  2E6V A;  3JBG 3;  4E8C A;  2ZBJ A;  2ZS6 B;  4NIA A;  4RR3 C;  4N9I A;  3ZM8 A;  1NYW A;  2CSG A;  4YGE A;  4XET A;  3LOB A;  4COZ A;  4HOO A;  1AR9 1;  3WW2 A;  2YHJ A;  4XJU A;  2VNG A;  2VNV A;  4IV3 B;  3RYR A;  3WQ1 A;  5JMC A;  2P3K A;  4LA2 A;  4YYO A;  4IE4 A;  2HWC 3;  3U37 A;  1OKO A;  1VLN A;  3LA7 A;  3N9M A;  3ROU A;  2RG4 A;  3AZY A;  5FZ3 A;  4DUW A;  2Z79 A;  3VZM A;  1D4M 2;  1JZ5 A;  3WG1 A;  2XBO 3;  4H55 A;  4DY3 A;  5GLV A;  4HKW A;  3ZDV A;  3W20 A;  1OF3 A;  3PVO A;  3MLK A;  2YDE A;  5FKB A;  3ZN4 A;  3I3Q A;  2OQ7 A;  5ACA 1;  3WG3 A;  4QGM A;  1BMV 2;  4NO4 A;  5FUP A;  1ULP A;  2XJS A;  3OUJ A;  5H9P A;  3HN1 A;  3B9C A;  2XXZ A;  1MS8 A;  1WCK A;  1CPM A;  3B00 A;  2W39 A;  4KU7 A;  1S0B A;  3QH7 A;  5FZ8 A;  1H4H A;  3B9I A;  1I5P A;  1DCS A;  5FJK A;  3OB8 A;  4QQL A;  2GC1 A;  3MYX A;  4KWU A;  4XUR A;  4I0A A;  2WQ4 A;  1WA4 A;  1HJF A;  5D1I A;  2Z69 A;  4MOA A;  2B39 A;  2X05 A;  2C9A A;  1U5Z A;  3GCW A;  3R6S A;  4QPI B;  4B4R A;  3POB A;  1PIV 1;  4LE3 A;  5LEK A;  4OI4 A;  2FBE A;  3BTA A;  1RXG A;  4JGZ B;  4HAN A;  3WHU A;  3ZYB A;  1N1S A;  2ZGU A;  4G9S B;  4NHY A;  3JBG 2;  1GNH A;  2W9X A;  3KLS A;  4W50 A;  2YGL A;  1ULC A;  4PF5 A;  1CJP A;  1CON A;  4UXA A;  5A6Z A;  1AL2 3;  1VP6 A;  2BEO A;  3ZMO A;  1EUT A;  1HQN A;  3AFG A;  1AYN 2;  1NUK A;  1VBA 3;  2IVJ A;  5E88 A;  4BLJ A;  3I59 B;  2HWC 2;  1U5I A;  4ZS3 A;  1XJA A;  2FZ1 A;  3V0B B;  5IVE A;  3ZYP A;  4RGA A;  1PMH X;  3WG4 A;  2WQ8 A;  2XBO 2;  4JX0 A;  5FYY A;  2QQK A;  3OEA A;  2BV4 A;  2YXS A;  4C1W A;  2ARE A;  1HRI 1;  3MUY 1;  5CFD C;  2R0F A;  4ARY A;  3BKZ A;  3O0W A;  2SLI A;  2ZX3 A;  4XJA A;  5FMC A;  4N90 A;  1Q56 A;  1JU4 A;  5FTT C;  4YLZ A;  5AFE A;  1OLR A;  2DVB A;  3M3O A;  1JOB A;  1W2T A;  3D0J A;  3D6E A;  3VDA A;  1EV1 3;  1QOT A;  2XLG A;  4GH4 B;  2B9U A;  5BPX A;  5CNA A;  2DVG A;  2VU9 A;  3QAC A;  1LGN A;  3D82 A;  3VBS A;  4Z07 A;  1X8E A;  3ZFE C;  5JUV A;  3IT8 A;  5A33 A;  1SPP A;  3PHM A;  5D8A C;  1D0G A;  1KFU L;  1R1A 2;  5BV6 A;  3B3Q E;  4D94 A;  3WW4 A;  2N7G A;  4P9X A;  3W21 A;  1U5X A;  2JB8 A;  2P3J A;  5FZO B;  4Y1U A;  2GP5 A;  2WO3 A;  5L7O B;  1HQL A;  3U4X A;  3DYP A;  1PMJ X;  4KG8 A;  5FMO L;  4KMQ A;  2PLV 1;  2X5I C;  4R9D A;  1AYM 2;  3LSE A;  4M3C B;  1NOV A;  5BNN B;  1GBG A;  4C90 A;  5EP9 A;  1AL2 2;  1DQ6 A;  3NAP A;  1W3V A;  4FQ4 A;  1FV3 A;  3QLQ A;  5ANQ A;  4B4P A;  1IS5 A;  4PBO A;  3MPP G;  4XC9 A;  2ZX0 A;  3ILN A;  3WP5 A;  2W1S A;  1DIW A;  3FLR A;  4FFG A;  1MQT A;  1XPW A;  1XU2 A;  4YZ3 A;  5AVP A;  2RJL A;  5FY5 A;  3T3Y A;  4DMI A;  3AVS A;  4RFT 0;  3RWK X;  2W08 A;  1Y3T A;  3K77 A;  3QOP A;  2QFE A;  1Y43 B;  1CZT A;  5FWJ A;  3IB3 A;  4E8D A;  1YRZ A;  2PHX A;  4CCN A;  4CP1 A;  3RZH A;  5C9A A;  2WO2 A;  1D7P M;  4QB1 A;  2E63 A;  2GNB A;  5CZK A;  1L7Q A;  3LDB A;  3MBW A;  1E5R A;  3OPT A;  4BQ4 A;  2DVF A;  1MZE A;  3I7D A;  1HKD A;  5CU1 A;  1GP5 A;  1S2K A;  2FDK A;  4TLF A;  4O7X A;  1BBT 1;  1VBB 1;  4TSV A;  4QXB A;  4Y1X A;  5L9B A;  3IDE A;  3SHR A;  1QJX 3;  1LTE A;  2DCK A;  1JZ4 A;  2RS1 3;  1EV1 2;  1YQ8 A;  3JB8 A;  1FNZ A;  3AYE A;  2VZQ A;  3KCX A;  3OOX A;  4PF1 A;  1RED A;  5CFC B;  1BK0 A;  2BVV A;  1AR7 3;  1UMI A;  2R07 3;  2JXA A;  4WBB A;  3VBH C;  1K3I A;  4AGV A;  4XZP A;  3WNM A;  2JG9 C;  2ARX A;  2WL1 A;  1APN A;  1LOC A;  5KHG A;  5F5A A;  2O1Q A;  1Q8V A;  1E5I A;  2VJX A;  5T3N A;  3N9P A;  4LOS A;  5LY1 A;  1A34 A;  5A3L A;  4XUQ A;  5DZG A;  4MGS A;  1NXM A;  4LHK A;  2ZX4 A;  4XIK A;  1YFU A;  3DXT A;  3S0M A;  3RZL A;  1QXP A;  4RGG A;  4IXL A;  3VZJ A;  1F15 A;  1WZX A;  1UY0 A;  1V6K A;  3LFI A;  3LQC A;  2HWC 1;  2FMY A;  5F2S A;  4YFZ A;  2CWM A;  4AVS A;  5A1A A;  1CAU A;  1MEC 2;  3ACF A;  4AED C;  4YVS A;  5J96 B;  2ETE A;  4ISQ A;  1DGW X;  3O7O A;  4AFB A;  5C3R A;  4OQ8 A;  1DHK B;  1PVC 3;  3PUS A;  4QGN A;  5JOX A;  3V64 A;  1OBN A;  4RQP B;  5IK7 A;  3UJO A;  4UW5 A;  2Q8D A;  3WR0 A;  1C1L A;  3JQX A;  4Q1R A;  1GOG A;  3ZSL A;  2Z2S B;  3TN9 3;  1MPX A;  2LAL A;  3GCX A;  3MPB A;  4DS0 A;  2FZ2 A;  4HON A;  3FUQ A;  2WC2 A;  1QJX 2;  3R4U A;  4FFI A;  1FV2 A;  4Y24 A;  3GGL A;  2RS1 2;  3APB A;  3EBR A;  4QQH A;  5T52 A;  3CJX A;  1Q8S A;  1G9A A;  4B29 A;  2D98 A;  4EN6 B;  3LE0 A;  3I2I A;  5E1R A;  5EHD A;  1DP0 A;  1D2S A;  1XE7 A;  5JOY A;  1ZX5 A;  4PLO A;  2CU5 A;  2HYX A;  4BB3 A;  4CDU B;  4Q8L A;  4QPG A;  1I3H A;  3DUI A;  3MIH A;  3NMB A;  5DAB A;  2Q30 A;  2AC1 A;  3IDC B;  3HN3 A;  5JI9 A;  4FP3 A;  1YCI A;  4BIO A;  1XOY A;  1KEX A;  4CCO A;  3HQU A;  4CDX A;  3W5M A;  2XLA A;  3GBW A;  5A3M A;  4LKD A;  2W1W A;  1VIW B;  5K0U C;  4Y20 A;  4ZHN A;  1ZA7 A;  2JDY A;  2MPF A;  2WS9 1;  2DBI A;  3MUZ 1;  1AL2 1;  4WM7 C;  1GP6 A;  4A44 A;  1POV 1;  2B42 B;  3LFM A;  4KGG A;  4DRV A;  3IIA A;  1XSR A;  4K21 A;  1JXN A;  1VBA 1;  4XXP A;  3S57 A;  4LE4 A;  3UKT A;  2C6S A;  1YIP A;  4EN0 A;  4CDW C;  3BOP A;  5JPM B;  3MID A;  2X09 A;  4Q4W 1;  4R9C A;  2QQL A;  3POG A;  5CA6 A;  1H1M A;  2R04 2;  3N9Q A;  5F37 A;  3AXE A;  4FPE A;  4H7M A;  1RB8 G;  3U10 A;  1ULF A;  4JV4 A;  3LEK A;  4HMZ A;  2D40 A;  4E9K A;  1Q43 A;  1OA4 A;  1Y9G A;  5DG2 A;  3DCQ A;  3UT0 A;  1W2A X;  1VJ2 A;  3VGI A;  3G6J B;  4JGY B;  3QD6 A;  1ALY A;  1DYK A;  4P9L A;  4CEY A;  3AMP A;  2Y8K A;  1M06 G;  5I8T A;  4KWK A;  4MVT A;  1GSL A;  4AI8 A;  5HCA A;  3ZR6 A;  3V56 A;  4Q1P A;  2QJV A;  2ZXQ A;  3M1H A;  4TN7 A;  3TWI A;  3MLL A;  4B4Q A;  3MO4 A;  1AXK A;  4IGP A;  4CDQ B;  4D0Q A;  5FDB A;  1DQ5 A;  4AVA A;  1B09 A;  3RYK A;  5H9R A;  3SNM A;  2TUN A;  5IVY A;  4I2O A;  2BUK A;  1ND3 B;  4NUB A;  4Q4Y 2;  4AHX A;  1S1A A;  4NRO A;  4NIG A;  5IAT A;  1W2O A;  3M3Q A;  1S0F A;  3BU0 A;  1ND3 A;  3E6B A;  3LZZ A;  1D4V B;  1ZZ7 A;  4LBQ A;  3POW A;  4PBP A;  1LJ7 A;  1J1L A;  2ZHK A;  2W1U A;  2OPW A;  4YM3 A;  3Q8F A;  2OYZ A;  1J59 A;  4XBL A;  1RIT A;  5KR7 A;  3N3H A;  4JTO A;  3KT4 A;  3OUI A;  1FX5 A;  2UYA A;  1VBE 3;  4QX0 A;  2OZJ A;  4BJ0 A;  5BNO C;  3P3P A;  5FY8 A;  4WVV A;  3T0D A;  3LEM A;  1OHF A;  3GZT B;  4Y5S A;  4QD2 A;  1QDO A;  5DPN A;  5ABJ A;  1HW5 A;  4XEZ A;  1NZC A;  1LGC A;  1PO2 3;  4C8D A;  1QF3 A;  2IWG B;  4FOW A;  5HCF A;  3VBR B;  1OOP B;  4F7Z A;  4P5Y A;  1DF0 A;  3AZV A;  3KVA A;  3ZXG A;  3S30 A;  2WR9 A;  1TQ5 A;  1UYP A;  3AMH A;  2XJV A;  4P02 B;  3C3V A;  2VW1 A;  4Q27 A;  5A80 A;  5C3P A;  5I8Y A;  4NID A;  3ZIW A;  3T4H B;  1COV 3;  4PIZ A;  1UIK A;  2JJ6 A;  5A32 A;  5EXO A;  4Y1Z A;  4BH9 A;  4CEW B;  1GMM A;  4LO7 A;  5I8S A;  4C1X A;  4CCD A;  3GDB A;  1NCR A;  2BRT A;  2WWU A;  3MIF A;  4OUL A;  4XFF A;  3KWV A;  3WQ7 A;  2RDR A;  4CA9 A;  4XDO A;  3BCW A;  4HZF A;  1G86 A;  2R1D A;  4Y3O A;  2DDU A;  2B9V A;  1UZZ A;  2RS1 1;  1TMF 2;  3OBT A;  1QXJ A;  4EQV A;  4BQX A;  3ZFG A;  4QX5 A;  3MF9 A;  3USS A;  1AR7 1;  4LO5 B;  4GWJ A;  1G9F A;  1MZF A;  2R07 1;  2ZEZ A;  3C7H A;  3PUR A;  4YGD A;  5DAP A;  3EHK A;  3VZL A;  3N9O A;  3ZFF B;  3UK9 A;  1WCD J;  2P2K A;  3KF3 A;  4LLO A;  1LOE A;  1O4T A;  2G9G A;  2Y6J A;  3M4F A;  4N53 A;  5LBF A;  5FXW A;  5K7P A;  2CAU A;  5CBL A;  1RUF 3;  5FP3 A;  1GWM A;  2UWB A;  4MZU A;  2CHH A;  2HEV F;  4KGQ A;  1EPW A;  2JB4 A;  2X8K A;  3TB0 A;  4CCK A;  2VO5 A;  3D4K A;  2AAC A;  3OTF A;  4X6Q B;  3DPR B;  4U36 A;  5FRE A;  4AVC A;  2RJ2 A;  3OYW A;  2Q1M A;  1OVS A;  1OA2 A;  3DPR A;  1MZ6 A;  1OF4 A;  2D93 A;  2X53 S;  3NW4 A;  4RYD A;  2EAL A;  2H6B A;  3Q8C A;  1VMH A;  3CLP A;  2VTX A;  4Q29 A;  4Y26 A;  1UZY A;  2VOX A;  2QQP A;  5CIS A;  1K42 A;  4Y1Y A;  1UMZ A;  4R9A A;  5FZ7 A;  2W95 A;  3I4I A;  1JUH A;  1OQD A;  1RUC 3;  4J25 A;  3FX3 A;  4TTG A;  1UXZ A;  3CMG A;  4I01 A;  1H9P A;  5GLT A;  1O3S A;  1NQD A;  2AEZ A;  3WXP A;  4L97 A;  1CAX A;  1AR8 2;  2ZML A;  3U07 A;  1COV 2;  1PVC 1;  3ACG A;  4EWD A;  5IVC A;  4UYB A;  1RIR A;  1OLQ A;  2VGD A;  3PIG A;  1NCQ C;  5JI7 A;  5JSP A;  4LBO A;  3VKN A;  3DGT A;  1K5M B;  4IEW A;  2VW2 A;  4PDW C;  4QWN A;  2BPA 2;  1AL0 G;  1A8M A;  4Z82 A;  3TN9 1;  4QB6 A;  4IES A;  1ZBA 3;  4SLI A;  5I0S A;  2R16 A;  2ILM A;  5FZL A;  1RJ7 A;  2YUE A;  3CNA A;  4A4A A;  4PHZ A;  4K1Y A;  2VCB A;  4NJ4 A;  3ON7 A;  1QH7 A;  5IAX A;  5JSO A;  2WZE A;  4YM2 A;  2Y60 A;  1PNG A;  1G7Y A;  3BB6 A;  4CYD A;  1W0P A;  3CQO A;  3RWN A;  2YB7 A;  4YRD A;  4HK8 A;  2HEY F;  3VBU C;  3E5U A;  4FXK B;  5HBA A;  2A75 A;  2PN5 A;  4L8Q A;  2E9Q A;  1W6N A;  3ZXL A;  4DB5 A;  1C5H A;  1RUF 2;  5F3C A;  3K3N A;  4LUL A;  1IQA A;  1RYY A;  3SQO A;  5AC9 2;  3WNL A;  3AL5 A;  3WF2 A;  3JUU A;  4QU1 A;  4BQ5 A;  2WN2 A;  5A7O A;  4BOW A;  1WMX A;  1CJD A;  1W05 A;  1HJG A;  1UU6 A;  4XPV A;  2YBP A;  3I2D A;  5C8C C;  2J1R A;  2A3Y A;  3JU9 A;  5JVV A;  3WDW A;  4FTS A;  1W8N A;  1O3T A;  2EIB A;  4K8F A;  3VBO B;  1VAL A;  1UIJ A;  5BNQ A;  5EJ1 B;  1SFY A;  4ZY9 A;  2GC3 A;  4RS5 C;  3VKF C;  1FAT A;  2FDF A;  3CKH A;  1O4Z A;  3VBO A;  4EZH A;  4C91 A;  2CL2 A;  3V0A B;  3WZ1 A;  4MHU A;  2XVG A;  5KC5 A;  1ND2 A;  4YW5 A;  4K1Z A;  5FXX A;  1RUC 2;  1C5I A;  2XL7 A;  4LHN A;  2WIN B;  4QHB A;  3NST A;  3H1Y A;  4NHL A;  2RHP A;  1NA1 C;  1Z78 A;  1H8T A;  2A70 A;  4BHP A;  3UV9 A;  4ZZ8 A;  3H3U A;  1YQC A;  2Z5W A;  3K48 A;  4NOT A;  3JQW A;  1W9W A;  3C8X A;  1AVB A;  2ZEW A;  3KGL A;  4MXV A;  4N43 C;  1JH5 A;  1O6U A;  2K46 A;  1S0C A;  2VZR A;  5A3T A;  3NVC A;  1UYY A;  1H2M A;  2H0B A;  4YW7 A;  2WNU A;  1ZBA 2;  3AYD A;  4DNY A;  4LXL A;  5J3U A;  2A3W A;  3I2G A;  2QTW B;  2A7A A;  4W8J A;  3ZN6 B;  3VBF C;  4YVW B;  3RI8 A;  1RC6 A;  3NKG A;  1XYP A;  4KU8 A;  3VHN A;  1XE0 A;  2J1U A;  1TME 3;  4PI2 A;  1JYW A;  2QQV A;  1PGL 1;  5FAX A;  3SCF A;  3AP4 A;  5A6Y A;  2VOT A;  1VBE 1;  3NNM A;  4WVW A;  4JQT A;  3RYP A;  3ZSK A;  4DXT A;  5IK5 A;  3MIE A;  1AR9 2;  5LWB A;  2KA3 A;  3AC0 A;  4K3U A;  1CX4 A;  1YLL A;  4RSU A;  4ASL A;  3THC A;  1PO2 1;  1D0H A;  2ZHN A;  3PUH A;  1JHJ A;  3A23 A;  4QU2 A;  5JCT A;  1T6G C;  3NKT A;  4RR3 A;  1ULO A;  4Q4X 3;  2W5F A;  4AQ6 A;  1B35 B;  3LEG A;  1JMU B;  1UX7 A;  3LA3 A;  1UZW A;  2OA2 A;  2LRP A;  3K3O A;  4K40 A;  4S2D A;  3ZMN A;  2VMC A;  1HRI 3;  3HJR A;  4IEX A;  1HV0 A;  4X6R B;  1F8V A;  2D44 A;  1GNY A;  4FFH A;  1QU0 A;  2XON A;  4QKB A;  1COV 1;  1EY2 A;  2VE1 A;  5ACA 2;  2JG8 B;  1BVV A;  2W46 A;  2FMD A;  1VMJ A;  3WDT A;  3T09 A;  3CO2 A;  3HNM A;  4CRQ A;  1DQ4 A;  2JG8 A;  5FXZ A;  1ZZ9 A;  3DL3 A;  2BYV E;  2IC1 A;  5K4L A;  3TYJ A;  5C71 A;  3HIF A;  4P9Y A;  3ME2 A;  3H8U A;  4KWL A;  1GZT A;  3OBR A;  2DCJ A;  2HLE A;  5BNP C;  3IDA A;  2PAE A;  1LCL A;  5FYU A;  4OLL A;  5DG1 A;  3H9A A;  3HMY A;  3MW4 A;  1PIV 2;  2VVD A;  3HVD A;  1UPS A;  5FFO C;  5A7P A;  3UKV A;  5FZA A;  4BQ1 A;  4LKS A;  4W6Y A;  5B4N A;  1NE6 A;  4JHZ A;  3ASI A;  4PIY A;  2W1Q A;  2Z4F A;  1F35 A;  4XIL A;  3X29 B;  3PL0 A;  1SDW A;  1GLH A;  1PZ7 A;  1L7L A;  2WNO A;  4EN9 B;  4QPW A;  1RUO A;  3H7J A;  2ORZ A;  4XTM A;  2Q8E A;  1CAW A;  1GOH A;  2XDV A;  3AP9 A;  2A6X A;  1E5S A;  4OHV A;  3HT1 A;  5IK8 A;  3J9S A;  1WCS A;  4IE5 A;  3WF4 A;  1XXN A;  1BZW A;  1CIW A;  1VMF A;  4HVQ A;  1Y9Q A;  4A42 A;  4FFF A;  1OMI A;  5DQ0 A;  2A6Z A;  2PXJ A;  5HPO A;  5FYT A;  1ENQ A;  4Q4X 2;  2GND A;  1IQD C;  1IKQ A;  2VZP A;  1YXW A;  2VQU A;  1RUC 1;  1G6N A;  1TNF A;  4HPK B;  4CUA A;  4TWT A;  1HRI 2;  1W04 A;  3D8C A;  4CPB A;  4LA3 A;  4ZON A;  1S55 A;  1W0O A;  1UCX A;  1Y7B A;  3KS7 A;  4FPF A;  5D2A A;  3PJQ A;  4KQ7 A;  2CDO A;  4UW4 A;  1QH6 A;  3ZXJ A;  1OPO A;  4Z2W A;  1WWY A;  1BBT 3;  2H0V A;  4AHY A;  5KBF A;  1HB4 A;  3V65 A;  1EAH 3;  1JYC A;  3FE5 A;  2NN8 A;  1R08 3;  4D8M A;  1HN1 A;  4XQ4 A;  2ZA9 A;  1ZBA 1;  2C5D A;  4GIQ A;  3ATG A;  5IFP A;  1U0A A;  3P5B A;  4AQS A;  1WW6 A;  1ZNP A;  4URA A;  2OS2 A;  3N35 A;  4AI2 A;  3I3B A;  5I91 A;  4OVE A;  3OGS A;  2HWE 3;  3GJA A;  3PVE A;  3GBG A;  4AW7 A;  1RIN A;  3KM5 A;  2RS5 1;  5F1R A;  4A41 A;  3KV5 A;  3ZFE A;  5ISL A;  4FVV A;  3BIW E;  3MIC A;  1OFS A;  2PLV 2;  3DN7 A;  2AEN A;  4GZ9 A;  5D8A A;  1XNA A;  1QQP 1;  5FLJ A;  1J84 A;  4LKF A;  2VZO A;  2PA7 A;  5FPL A;  1KIT A;  1LNS A;  2Q4S A;  4LO8 A;  1W9T A;  4J6G A;  5FKC A;  3ACL A;  3J8F 3;  1US3 A;  2RMU 3;  2VBB A;  4YW6 A;  1OI6 A;  5FYI A;  1O7F A;  3VKL A;  1JYT A;  4MG2 A;  1XYO A;  2WNV C;  3A22 A;  2GC0 A;  4FTE A;  1X9T A;  1QWR A;  2OKX A;  4YM1 A;  1LOF C;  1BYH A;  4GMP 3;  1KS4 A;  4XHX A;  3ZYH A;  4XIO A;  5EYY A;  3RJ2 X;  3RGB A;  2E7Q A;  4Z8B A;  1Q3E A;  3MZH A;  4AFD A;  5B2G B;  1YNA A;  1ZRR A;  1F5F A;  2ADE A;  1V6I A;  4AEM A;  1KD7 A;  2EIC A;  2GME A;  4HVR A;  3WNK A;  3DEM A;  5C33 A;  1UY2 A;  2MEV 3;  2OZ6 A;  1W9S A;  3U14 A;  1UPI A;  3FMG A;  1BBT 2;  1VBB 2;  4GB3 3;  4M00 A;  4NPM A;  2V09 A;  4Q2F A;  1DBN A;  5FY7 A;  4E2Q A;  3LWC A;  4LKE A;  3EO6 A;  1EAH 2;  4IV1 C;  1NAE A;  4LMF A;  2BNN A;  2KM2 A;  1PK6 C;  2CAV A;  2VNR A;  4LUK A;  4UT5 A;  5KC6 A;  4AXO A;  1A8D A;  3VDD B;  1UOG A;  4Q26 A;  5DUW A;  4I0W B;  5EJZ B;  2DUR A;  3ES4 A;  3WDX A;  2GNT A;  5I0D A;  2FD8 A;  2WA4 A;  1SG3 A;  4Y1V A;  1KJL A;  5FZF A;  2P4E A;  2XOM A;  3VDD A;  4NE9 A;  4Y4R A;  3UYJ A;  3NNL A;  2ZGN A;  5DZF A;  2QVS B;  1XND A;  5CG8 A;  2RR1 3;  1A78 A;  2UWC A;  3RG0 A;  1TME 1;  1BK1 A;  1W6Q A;  2QCS B;  2VEC A;  2VXR A;  1CPN A;  2W92 A;  4QX3 A;  5JIU A;  4OUM A;  1N3Q A;  3LOI A;  5FV3 A;  2A6V A;  1UZ0 A;  3TEY A;  5FYH A;  2HWB 3;  2J1V A;  2WS9 3;  5L73 A;  4EWA A;  3VBH A;  2AH2 A;  1W6P A;  1POV 3;  3B69 A;  5GZF A;  4K8R B;  3LIG A;  1FT9 A;  2VQT A;  4EJR A;  1FI2 A;  1RUE 1;  1PZ9 A;  4EZ4 A;  3ZYR A;  1QJZ A;  2RMU 2;  2WII B;  2NZ9 A;  3KCY A;  4PLN A;  1H4G A;  3MIB A;  3SCH A;  1YEW A;  4AK3 A;  2EIG A;  4Q4W 3;  4Q4X 1;  5CIR A;  2VCA A;  2D3R A;  3AP6 A;  1TVG A;  5EJ3 A;  5J1X A;  5G05 L;  1Q5O A;  2VBD A;  1T6B X;  5GLU A;  3J7H A;  3T2P A;  3ZOI A;  4E2S A;  2ZEX A;  3JD7 3;  1JU3 A;  3AP7 A;  2CYF A;  4XVH A;  3RDI A;  4WV8 A;  3WY6 A;  1ASJ 3;  5HI0 A;  2W0X A;  3FBY A;  3AYA A;  4QKF A;  4L92 A;  1QHD A;  2MEV 2;  2WAO A;  5F39 A;  1DFQ A;  4Q0P A;  3VBS B;  4A6O A;  4FI9 A;  5F6K A;  3UL2 A;  4AED A;  4BXS V;  5A33 B;  3I2O A;  3O1O A;  3AKS A;  1EP0 A;  1O5L A;  1SPP B;  4XAA A;  2W94 A;  5CKQ A;  2R30 A;  1BHG A;  2C9K A;  1VAK A;  3OBZ A;  4QX1 A;  1VAV A;  5I0U A;  4EYU A;  4FAH A;  1ZZC A;  5JZG C;  2VD7 A;  2QQN A;  4I09 A;  4XE9 A;  4DY5 A;  1R64 A;  3KD4 A;  4K9S A;  4FO9 A;  3POI A;  5CAZ A;  4D6Q A;  1KFX L;  3I2F A;  3MV1 1;  1F4H A;  4JAA A;  3UET A;  1H1I A;  3MI8 A;  4O9E A;  2YC4 A;  4G4F A;  4ARX A;  4IEZ A;  4Z1V A;  1WMD A;  5K9Y A;  5CYY A;  4YAR A;  2RR1 2;  2XWB B;  2ZGO A;  2VXJ A;  2PFW A;  1BKZ A;  2J1E A;  5A6X A;  5KXD A;  3FZ3 A;  2YU1 A;  3NAP B;  3NV3 A;  4QPY A;  3H50 A;  3PUI A;  3QCW A;  3FC0 A;  2HWB 2;  2WS9 2;  3LF7 A;  3CJI C;  2RS3 3;  4LO6 B;  3KT1 A;  4A2U A;  5LK7 B;  1CGP A;  1MQT B;  3ETP A;  2BWC A;  1RUN A;  2IXJ A;  4QDR A;  4CCC A;  4FQZ A;  5C6C A;  1VBA 2;  4P14 A;  3T2Q A;  3UGF A;  4P00 B;  1BVP 1;  1GZC A;  4N9H A;  5CKM A;  5C70 A;  4XFC A;  3O0V A;  1W90 A;  5EV7 A;  1XNB A;  2PHF A;  4O65 A;  4Q4W 2;  4YW1 A;  5GLW A;  4IV3 C;  1WLC A;  5K0U A;  3UGH A;  5C9A B;  5IYY A;  4OZX A;  2LM3 A;  1SCS A;  4L11 A;  4WM7 A;  2D6K A;  2RJK A;  1OVP A;  4MXW A;  4CUC A;  5JXG A;  3FHA A;  4AQT A;  1S2E A;  1ZBE 3;  3BOW A;  1JYN A;  1LRH A;  4GXL A;  4LBM A;  2VUD A;  4OMD A;  1ZYB A;  3M3E A;  2VZV A;  2WSV A;  3S7I A;  5FZK A;  2NLR A;  1Q8P A;  4CDW A;  1JZ6 A;  3Q8A A;  3ITQ A;  1Z0H A;  5KXE A;  5FOB B;  1FPN 3;  4LBL A;  2ZGM A;  2VOV A;  1EAH 1;  4HG6 B;  5FYV A;  4KWJ A;  1AR6 3;  5F3G A;  4AQ2 A;  1R08 1;  5BYN A;  1S0G A;  4KL1 A;  2E7A A;  3IAP A;  3MEP A;  5KHK A;  1V70 A;  2RE9 A;  4ATE A;  1SFP A;  4LO4 B;  3GJB A;  3SMH A;  4B1M A;  1WKY A;  3JZV A;  1REF A;  1JYX A;  2AZ5 A;  2WO7 A;  4JKK A;  4XQW A;  5F5Q A;  3AP5 A;  2RM2 1;  3MFC A;  1JI6 A;  1ULD A;  2R32 A;  1GV9 A;  2HWE 1;  3GYD A;  3VZN A;  2DWR A;  3O1V A;  3LEI A;  4G3Y C;  5F6L B;  4Q0Q A;  1PO1 3;  4F3J A;  4QPI C;  4V1P A;  5GM0 A;  3LB9 A;  1N47 A;  1UYX A;  2XVL A;  2QBX A;  2XKP A;  1GU3 A;  1LOB A;  5FYZ A;  5A7N A;  3RPQ A;  4AVT A;  1CES A;  1QJU 3;  2X10 A;  1QY4 A;  1H9W A;  1WME A;  4JGZ C;  3ZX7 A;  3J8F 1;  2RMU 1;  1CAU B;  2WNE A;  5BNO B;  4RD7 A;  4A7Y A;  4YVS B;  4NVP A;  1SBF A;  1V6L A;  4JTN A;  3E6D A;  3ENR A;  3PUQ A;  2WUH A;  4MHR A;  3LKJ A;  4GMP 1;  3G7D A;  2O8Q A;  5T5O A;  5L9R A;  1UXX X;  1DYO A;  3O0X A;  5BNO A;  5LZ6 A;  2GDF A;  4AHZ A;  3WNO A;  3TEW A;  2EXK A;  2Y6F A;  2GC2 A;  5SV8 A;  4E4H A;  4IDZ A;  3N4M A;  2ZZJ A;  4EE2 A;  1O3Q A;  1PGS A;  2D3S A;  3OG2 A;  2P34 A;  4L99 A;  1ZBE 2;  1N3P A;  1ZM1 A;  3AKQ A;  5M0T A;  3LD8 A;  2MEV 1;  3WW1 A;  1GR3 A;  2YRO A;  4QKN A;  4XF4 A;  4W65 A;  2J7M A;  4TXW A;  2EVX A;  2VUA A;  3O1S A;  2XQR A;  1US2 A;  2PHU A;  5FZE A;  4DQA A;  2DTY A;  4GB3 1;  4DEQ A;  1FPN 2;  2D6L X;  1FOD 3;  3PTY A;  4QXK A;  2H6C A;  4B1L A;  5JXI A;  1AX0 A;  3AJZ A;  4OYU A;  1Y9M A;  1HQW A;  3IZO A;  1C1F A;  4JRA A;  4QPG B;  2D3P A;  1AR7 2;  3VKM A;  2R07 2;  2I45 A;  4KG0 A;  2ZGP A;  2J1S A;  5DDJ 1;  4DXR A;  4CCL A;  2NQY A;  3HBK A;  4GH4 C;  4DXS A;  2VCC A;  4CDX B;  3E5Q A;  2VG9 A;  2QZ3 A;  2GN3 A;  4PLM A;  3T0A A;  2ZGK A;  2BTV C;  4Y20 B;  2VZ1 A;  3C2U A;  2RR1 1;  2JIJ A;  5K8S A;  3PUA A;  1WLW A;  1CN1 A;  1WGP A;  2D7F A;  1KRI A;  2B5H A;  3ZYJ B;  1PO1 2;  1CR7 A;  2HWB 1;  2XVK A;  3VUO A;  2WDB A;  2LTN A;  1A3K A;  1O5U A;  2VZ3 A;  3CEW A;  3IKW A;  2QQW A;  1JS9 A;  2VMI A;  3N7L A;  3PU8 A;  4RGK A;  1VBC 3;  5L7O C;  3MDP A;  4UOJ A;  4X8N A;  3CIH A;  5FBZ A;  2ZGS A;  1W6M A;  3IWZ A;  3TEX A;  5JAX A;  2C1F A;  3OGV A;  5DAV A;  3WHT A;  5BNN C;  3U0Z A;  4Y33 A;  1LOD A;  4CEY B;  2ZAA A;  1I9R A;  1U12 A;  3O14 A;  1ONA A;  2WZR 3;  3H1M A;  3H3Z A;  3N7K A;  4GWM A;  4KNC A;  3MW3 A;  5FZM A;  5A7Q A;  1MR5 A;  1W2N A;  3K4Z A;  5IAV A;  4BQY A;  3O1R A;  3O1U A;  2DVD A;  1YO8 A;  3JD7 1;  2A6Y A;  1Q8O A;  4C0B A;  1I5Z A;  1PVC 2;  1ASJ 1;  1F4A A;  2YGM A;  4FXG B;  4FOV A;  1V9U 1;  2VMD A;  5E16 A;  3VZO A;  3ZKY A;  4E2G A;  5E8A A;  3VD4 A;  2XJP A;  4Y5Z 0;  2ZMN A;  4BPZ A;  4LBQ D;  4K7J A;  3TAY A;  2VMH A;  2OW4 A;  1V0A A;  5FPB A;  3TN9 2;  1NCQ B;  4PI0 A;  5A6Q A;  4LBQ B;  5APA A;  1FOD 2;  4NWW A;  1H2L A;  4QMA A;  4YZ2 A;  5IVJ A;  2BP6 A;  4OHZ A;  2X29 A;  4JKL A;  1NCQ A;  3B93 A;  3BTX A;  2BBA A;  1IZ3 A;  1SLB A;  2XHN A;  4P9G A;  4IER A;  1LOA A;  3SXW A;  4PDW A;  4BXF A;  2ZKN A;  5FO8 B;  3ZXA C;  5CFC C;  5FP7 A;  3WD5 A;  3NJV A;  2DCY A;  2Y64 A;  4I30 A;  5JWP A;  1F31 A;  3OY8 A;  1U5Y A;  4FBF A;  5ABJ B;  4BQW A;  1OLM A;  4QXH A;  1OUS A;  5FRA A;  3O1M A;  1HRV 3;  3FN9 A;  3LPG A;  1S0J A;  2YMZ A;  2GAU A;  4WM8 B;  2XJQ A;  4PQ9 A;  1UU4 A;  4R4X A;  2DU0 A;  2VQ0 A;  4CP9 B;  4V2W A;  1DLC A;  5FY4 A;  2Y0O A;  2RS3 1;  3VBU A;  1OLM E;  5FY0 A;  4AVV A;  4WM8 A;  2E31 A;  3CZJ A;  1NZI A;  4E4D X;  1DGL A;  1VBC 2;  4CP9 A;  1VB2 A;  2WFP A;  2JIC A;  5JXJ A;  2GNM A;  2IXI A;  5FYB A;  2UYB A;  4XJW A;  1ZZB A;  4LJH A;  5F9T A;  2PMW B;  1ZA4 A;  5A32 B;  4GQ7 A;  1N1Y A;  2YBS A;  2FCU A;  3KGZ A;  3K51 A;  3IN9 A;  4IL7 A;  5FYC A;  4UFM A;  1SCR A;  1VRB A;  2PTM A;  2QE3 A;  4FPG A;  2QNK A;  5C8C A;  1GZ9 A;  1NCR B;  4RS5 B;  1XRU A;  3GAL A;  1PX4 A;  2ZX2 A;  1ZBE 1;  4MX3 A;  4GWI A;  3H8O A;  2ADD A;  5FMD A;  2VZU A;  1UD1 A;  2R49 A;  4RS5 A;  4WZC A;  2CGP A;  1RHI 3;  2Q1Z B;  4YWA A;  3VKO A;  3SEE A;  5F3E A;  1FMD 3;  2JD4 A;  3I97 A;  4MAD A;  2A73 B;  5LBC A;  1RXF A;  1FPN 1;  5FYM A;  3OBA A;  1HB3 A;  3ZFG B;  4Z92 B;  1C28 A;  2BW8 A;  2IZW A;  1MZ5 A;  5FMO S;  5FK8 A;  1UF2 C;  2XUE A;  1AR6 1;  4RQP C;  2P5B A;  1NA1 A;  1X8M A;  4YG0 A;  2ORX A;  1PHM A;  1WLD A;  4NAM A;  2C26 A;  4N53 B;  3AKT A;  4UW6 A;  4AI3 A;  3D3A A;  1PMI A;  1R09 3;  1SDD B;  1QOS A;  1UO9 A;  2VUC A;  3W9A A;  2UU8 A;  3I2K A;  4BIF A;  1Z7S 1;  1JZ7 A;  4IE0 A;  1FYU A;  1OD3 A;  3ILR A;  2AEY A;  2XUM A;  4Q0S A;  3OYW B;  5DZE A;  5EQU A;  3M3C A;  2XH6 A;  4AR2 A;  5FMB A;  1PGL 2;  1X7N A;  3AFK A;  1SMV A;  2YFZ A;  1PO1 1;  1SLC A;  1VBE 2;  1LHW A;  2CGN A;  3EJK A;  1XB9 A;  5JXH A;  2KD7 A;  3S6P A;  4CDU C;  1G9C A;  4LPL A;  3VBF A;  2WAB A;  1QJU 1;  3H8X A;  1W03 A;  4R4Z A;  3TNQ A;  2TEP A;  2WRA A;  3RI9 A;  1PO2 2;  1JHN A;  2GMP A;  4BYY A;  1WBL A;  3KHC A;  1NY7 2;  3A0K A;  1CX1 A;  2Q8O A;  4B3N A;  1LHV A;  1CAX B;  5IVF A;  1SLI A;  3IM0 A;  1YJK A;  3AXD A;  2Q0A A;  1LR5 A;  3J26 N;  3ALQ A;  4XDP A;  4ISR A;  4MH0 E;  1G9D A;  3O1T A;  1PGW 2;  5FZ6 A;  2ENR A;  3WEZ A;  3OF1 A;  1GIC A;  4FPJ A;  4UFI A;  3ZVX A;  3B02 A;  2NYY A;  5EFU A;  3KV6 A;  5CVR A;  2ZGL A;  2WKK A;  5A3N A;  1ULE A;  1TG7 A;  1RHI 2;  3K46 A;  1F9K A;  5A7W B;  4BWO A;  2WT2 A;  5C3O A;  4JGY C;  3AK0 A;  2VMG A;  3CDZ B;  2ZPX A;  1QJF A;  1FOD 1;  4XYX A;  3FBM A;  4LLF A;  5A7W A;  3AMM A;  1ENX A;  1JOD A;  4CDQ C;  4DFS A;  1W8F A;  1W3X A;  4Q4V 3;  5TSW A;  4GD4 A;  3HAG A;  4IEV A;  1W6N B;  4LEJ A;  5JOZ A;  2JDH A;  3CHX A;  2XB6 C;  3SKV A;  1YQ2 A;  1FNY A;  1R09 2;  1ND3 C;  1VRH 3;  4A7K A;  5FPV A;  4PIX A;  2RS5 3;  3OPW A;  3KF5 A;  2JDN A;  5A3W A;  1OD5 A;  1O91 A;  4MUV A;  3LDK A;  5FPZ A;  4GAZ A;  4CCM A;  5BNP A;  1ZRC A;  1QQP 3;  2CWS A;  3AVR A;  4FCA A;  2P17 A;  3E97 A;  3EMR A;  2YBK A;  3RMX A;  2EA7 A;  4BMB A;  1F2N A;  4CUG A;  5T50 A;  4P08 A;  4UF0 A;  5A7S A;  1AXY A;  2B7Y A;  2LW8 A;  1IG0 A;  2HWF 1;  1VBC 1;  4LIU A;  5ERL A;  2HWD 3;  1DQ1 A;  2E32 A;  1MAC A;  2BOI A; 
#chains in the Genus database with same CATH homology
 1HN1 A;  2JE8 A;  5IFP A;  3MV0 1;  3DYO A;  4OUE A;  4DUX A;  2VTF A;  2W1S A;  1XPW A;  3I3B A;  3OGS A;  3K77 A;  1CZT A;  5IFT A;  4A41 A;  1L7R A;  3IB3 A;  4E8D A;  4GZ9 A;  1XNA A;  5IJR A;  3EB7 A;  2WO2 A;  1D7P M;  1J84 A;  4QB1 A;  5B4X A;  2VZO A;  5CZK A;  1L7Q A;  3MBW A;  1LNS A;  1K12 A;  1W9T A;  2CDP A;  1US3 A;  3HPN A;  3GXU A;  2R7E B;  3A22 A;  4OZO A;  2DCK A;  3NNG A;  2OKX A;  1JZ4 A;  3SKJ E;  2WAA A;  4PF1 A;  2VZQ A;  1UMI A;  2J1A A;  1K3I A;  3WNM A;  3OEB A;  2EIC A;  3WNK A;  1UY2 A;  2Y6K A;  5JMO A;  2WBK A;  2VJX A;  3E1F 1;  1W9S A;  5LA1 A;  4XUQ A;  3WNN A;  2V5D A;  4MGS A;  4ZZ5 A;  1NAE A;  3I2H A;  1UY4 A;  3C7O A;  3P6B A;  2EID A;  1H6X A;  4W4Z A;  3EYP A;  5EJZ B;  3LQC A;  1UY0 A;  5I0D A;  5JR2 A;  1SHW B;  1SG3 A;  2XOM A;  5A1A A;  3ACF A;  4L0P A;  1XNT A;  3FL7 A;  4QX3 A;  2W92 A;  4A3Z A;  3ACH A;  2BGO A;  1UZ0 A;  3W5N A;  2J1V A;  3HOB A;  2B4K A;  1W99 A;  3CZU A;  2VQT A;  2YG0 A;  1GOG A;  1UMH A;  1MPX A;  2VCA A;  2VME A;  3GGL A;  5DMY A;  1TVG A;  5J1X A;  5G05 L;  4CU9 A;  3T2P A;  3J7H A;  3LE0 A;  3I2I A;  2ZEX A;  3BN6 A;  1DP0 A;  1JU3 A;  3HEI A;  4XVH A;  2HYX A;  4CUB A;  1EUU A;  2BZD A;  3HN3 A;  1CZV A;  2WAO A;  4A6O A;  3VD5 A;  1KEX A;  1OH4 A;  3NQH A;  4FI9 A;  4M4P A;  4AAX A;  4BXS V;  3W5M A;  5LA2 A;  2W1W A;  2J22 A;  2W94 A;  3III A;  1BHG A;  2C9K A;  2J1T A;  3MUZ 1;  2C4X A;  2ID4 A;  4QX1 A;  4CU7 A;  4A44 A;  2QQN A;  1NX9 A;  1R64 A;  1JZ3 A;  4AG4 A;  3C7E A;  3I2F A;  3MV1 1;  2WO1 A;  3C7G A;  3ECQ A;  1F4H A;  4JKM A;  3UET A;  4PQQ A;  5EIY B;  2X09 A;  4MO3 M;  2QQL A;  2YC4 A;  4ARX A;  2QQO A;  4UI9 L;  3LEK A;  2XQX A;  5CYY A;  4DUV A;  2J1E A;  2VMF A;  2Y8K A;  2JDA A;  2YC2 A;  3PUI A;  4CU6 A;  2JD9 A;  2RV9 A;  2ZXQ A;  3OGR A;  3MO4 A;  4D0Q A;  3WNP A;  3ETP A;  3WQB A;  4QDR A;  1T2X A;  4LHS A;  3T2Q A;  4P00 B;  5C70 A;  1W8O A;  4A45 A;  2QQI A;  2L9L A;  5IYY A;  3P1I A;  2BGP A;  4CUC A;  5JXG A;  4CU8 A;  3FHA A;  3K4A A;  1JYN A;  1CIY A;  5LA0 A;  2W1U A;  4OMD A;  2VZV A;  3ABZ A;  4BK4 A;  1JZ6 A;  4YPJ A;  4QX0 A;  1PX3 A;  4BJ0 A;  2E33 A;  4HG6 B;  3T0D A;  5DPN A;  2VC9 A;  3HNB M;  3IAP A;  4Z2A A;  1W0N A;  3VD3 A;  1WKY A;  1JYX A;  1XC6 A;  4P5Y A;  4DEV A;  4JKK A;  1J83 A;  1JI6 A;  4UAP A;  4XUT A;  4P02 B;  2VR4 A;  3LEI A;  4QAW A;  2ZEY A;  3DYM A;  3NJX A;  1UYX A;  1GMM A;  2QBX A;  1GU3 A;  3GDB A;  2X10 A;  3JXS A;  2QQM A;  4XUP A;  3IAQ A;  2DDU A;  2B9V A;  3T0B A;  2WUH A;  1JYV A;  2Y6L A;  4KI5 M;  3T08 A;  1UXX X;  1DYO A;  2W3J A;  3WNO A;  4GWJ A;  2ZEZ A;  3C7F A;  3C7H A;  1UY3 A;  3WSO A;  3OG2 A;  2V4V A;  2EIE A;  2Y6J A;  1CZS A;  5HXM A;  3VD7 A;  3K75 B;  2J7M A;  2QQJ A;  4TXW A;  4XZU G;  2VO5 A;  5IHR A;  1US2 A;  4DEQ A;  2RJ2 A;  3K4D A;  4QB2 A;  3VD9 A;  5JXI A;  4OYU A;  3F2Z A;  1O8P A;  1OF4 A;  4QDQ A;  4RYD A;  3ACI A;  4XUO A;  1GUI A;  4QX2 A;  2J1S A;  4DXR A;  5G04 L;  1K42 A;  4DXS A;  2VCC A;  1GOF A;  2W95 A;  4OMC A;  3T0A A;  4TTG A;  2VZ1 A;  1UXZ A;  3CMG A;  4ET7 A;  3ACG A;  2WDB A;  3SEP A;  2VZ3 A;  2VL4 A;  4UOJ A;  3CIH A;  1O8S A;  4BK5 A;  4QB6 A;  2WZ8 A;  3OGV A;  2W87 A;  4MGQ A;  4A4A A;  4QDS A;  2VCB A;  3UES A;  1UYZ A;  3K4Z A;  3VDC A;  2JKX A;  2WZE A;  1NKG A;  3CQO A;  5FUI A;  2YB7 A;  5DN2 A;  1F4A A;  2VMD A;  3BGA A;  2Y6H A;  3VD4 A;  1P8J A;  1RYY A;  3WNL A;  3WF2 A;  3VDB A;  2WN2 A;  2RVA A;  2VZT A;  5LCW L;  2J1R A;  1UY1 A;  1W8N A;  3A7Q A;  2LS6 A;  2EIB A;  2WYS A;  1KGY A;  3GM8 A;  4JKL A;  2BBA A;  3FHQ A;  5EJ1 B;  2XHN A;  4ZY9 A;  1JZ2 A;  3HNY M;  2V72 A;  3CKH A;  3WF3 A;  5F7U A;  3I2J A;  4CVU A;  2VZS A;  3NJV A;  2Y64 A;  3THD A;  4XUN A;  3FN9 A;  3LPG A;  4BDV B;  1JZ8 A;  4ZZ8 A;  1DLC A;  2W47 A;  4E8C A;  1W9W A;  3C8X A;  2ZEW A;  3I3E A;  3ZM8 A;  2E31 A;  3CZJ A;  2VZR A;  5JXJ A;  3DEC A;  1UYY A;  3I3D A;  1GQP A;  2BER A;  3U37 A;  3I2G A;  4W8J A;  4DUW A;  1JZ5 A;  1PX4 A;  2E26 A;  1UWW A;  4GWI A;  4RN5 A;  2VZU A;  2J1U A;  1O59 A;  3WF0 A;  1JYW A;  1OF3 A;  3SEE A;  4M4R A;  3LPF A;  3I97 A;  2VOT A;  4MAD A;  3OBA A;  1ULP A;  4DXT A;  3AC0 A;  1I5P A;  2ORX A;  3THC A;  2C26 A;  3PUH A;  3OB8 A;  1JHJ A;  3A23 A;  3UNP A;  3D3A A;  1ULO A;  1SDD B;  4KWU A;  4XUR A;  2W5F A;  3I2K A;  3LEG A;  1UX7 A;  1JZ7 A;  1OD3 A;  4MOA A;  1OT5 A;  2VMC A;  2X05 A;  3HJR A;  1GNY A;  1H6Y A;  2XON A;  2YFZ A;  2W46 A;  5JXH A;  2W91 A;  2KD7 A;  3A21 A;  3T09 A;  1K45 A;  4LPL A;  3HNM A;  2WAB A;  4LQR A;  2W9X A;  4W50 A;  5C71 A;  1CX1 A;  1EUT A;  2YFU A;  2DCJ A;  2HLE A;  4ZXE A;  1NUK A;  3IDA A;  3T2O A;  1WCQ A;  4LKS A;  1PMH X;  5B4N A;  2PQS A;  3WEZ A;  2WQ8 A;  2Y6G A;  4JX0 A;  2QQK A;  3OEA A;  4JHZ A;  2W1Q A;  2Z4F A;  3MUY 1;  4IUG A;  1TG7 A;  5C7G A;  3K46 A;  4ARY A;  4QPW A;  4PT6 A;  2ORZ A;  1GOH A;  3CDZ B;  3WF1 A;  1JU4 A;  2VM9 A;  3WF4 A;  3VDA A;  4A42 A;  5DQ0 A;  3SKV A;  5HPO A;  1YQ2 A;  5JUV A;  1IQD C;  2VZP A;  2VQU A;  4CUA A;  2WN3 A;  2WO3 A;  2CDO A;  3DYP A;  3NRU A;  1PMJ X;  4P08 A;  2LW8 A;  4KMQ A;  2E32 A;  4D8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...