1UY4A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
total genus 32
structure length 132
sequence length 132
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy4A00
2WO3A 1CX1A 2C9KA 3MV01 4P02B 2VCAA 4LQRA 1UYYA 3ACHA 3VD3A 1GNYA 3WEZA 4MOAA 1PMJX 3K77A 1UMHA 3OGSA 1DLCA 3WQBA 5C71A 1O8SA 1ULOA 2YC2A 3NJXA 3T0AA 1TG7A 1UXZA 2R7EB 3I2JA 3SEEA 4GWIA 3E1F1 2OKXA 2VC9A 2J1EA 3PUHA 1NKGA 2QQKA 4RYDA 3U37A 1W9WA 1EUUA 2BGOA 1PX4A 4CUBA 5HPOA 3NRUA 1UXXX 3C7GA 3GXUA 3MV11 4M4PA 2WABA 4A44A 5LCWL 3P6BA 4QX2A 2E33A 2QQNA 4LPLA 2EICA 1JI6A 1UY2A 4YPJA 4PT6A 2C26A 3SEPA 4ZZ5A 1UYXA 2RV9A 3GDBA 4BXSV 3IB3A 5FUIA 3CDZB 4UAPA 1UY0A 2W3JA 3OGRA 3WNKA 1W8OA 4P08A 3GM8A 1K3IA 3WF2A 3BN6A 1K12A 2WBKA 5IJRA 4E8CA 4OYUA 2W1SA 1XNTA 2X10A 2W1UA 2VZUA 2ORXA 3LPFA 4BDVB 1UY3A 2J1UA 3C8XA 2WO1A 3ECQA 3K75B 2CDOA 3T2OA 1W9TA 3I2KA 4JHZA 1CZTA 4W4ZA 3I3EA 3C7EA 3LEKA 2XOMA 3K4ZA 5IFTA 2ZEXA 2QQIA 3A21A 3MO4A 5LA1A 1GUIA 2V72A 1R64A 1SDDB 4DEVA 4JX0A 2XONA 1UX7A 2VZVA 2X05A 1JZ3A 2W87A 4QB1A 4ZZ8A 4A42A 5DPNA 2ZEYA 4QX3A 1H6YA 1JZ8A 4D0QA 2YC4A 1OT5A 4DXSA 3IAQA 2VOTA 3HNBM 3AC0A 3MUZ1 5DMYA 1W0NA 4HG6B 5JXHA 1OD3A 2PQSA 3HJRA 2YFUA 1RYYA 2DDUA 3WNPA 2Y6LA 2J1SA 2HLEA 4CU7A 2WQ8A 5DN2A 1TVGA 4DUXA 2VZRA 2BGPA 1CIYA 2VM9A 4JKMA 1K42A 3WF1A 2C4XA 5A1AA 4PQQA 2RJ2A 1JYNA 1NUKA 4TXWA 3LEGA 3K4DA 4ARXA 1L7RA 2JDAA 2WZEA 2VZOA 3ZM8A 4QPWA 3THCA 4W50A 2ZEWA 1P8JA 1JYVA 1US3A 2WN3A 4QB2A 2BZDA 2QQLA 3T09A 2VJXA 4XURA 3CKHA 3SKVA 1CZVA 3DECA 2J1AA 5JXIA 2YFZA 1PX3A 4CU6A 2JE8A 5G05L 1DP0A 4IUGA 4UI9L 2W1WA 3LE0A 4ARYA 3IDAA 4P00B 2CDPA 3T0BA 3LPGA 5IHRA 4XUNA 2J7MA 1OF3A 3NNGA 1JZ6A 1JYWA 3OEBA 4A41A 2Y64A 3J7HA 3HOBA 3CQOA 4MO3M 2W47A 5B4XA 4A6OA 4RN5A 2VMEA 1F4AA 1GMMA 1UZ0A 5HXMA 2WN2A 3ABZA 4QAWA 1EUTA 2Y6HA 4CUAA 1UMIA 1IQDC 2ORZA 3WF3A 3ACFA 3ETPA 2BBAA 4DEQA 3WNMA 2EIBA 5J1XA 2ZXQA 5C70A 3HNMA 3OGVA 3UNPA 4QDQA 2VMDA 3FN9A 3P1IA 3EB7A 4JKKA 3WF4A 4XUTA 2KD7A 3I2IA 4DXTA 3HEIA 2XQXA 4XZUG 4XUQA 4MGQA 1F4HA 2JKXA 1WKYA 2Y8KA 1UYZA 4DXRA 3I97A 3SKJE 1NX9A 4JKLA 1SG3A 5CYYA 4OMDA 1W99A 2J1RA 3A23A 2VR4A 2VTFA 5EJZB 4QB6A 3UESA 4OUEA 3W5NA 1KEXA 1GU3A 3IIIA 3UETA 3C7OA 3VD5A 3A7QA 3WNOA 1US2A 2YG0A 1OF4A 2W91A 3WNLA 4Z2AA 2LS6A 3OBAA 3DYPA 2WAOA 2B4KA 3F2ZA 2W92A 2VQUA 2W5FA 4XVHA 1W9SA 2WDBA 5CZKA 3I2FA 3IAPA 3ACGA 3NQHA 4A45A 3WF0A 4D8MA 4UOJA 1J84A 1JU3A 1JU4A 5LA0A 1XPWA 1NAEA 3FL7A 4QX0A 5C7GA 3OEAA 1JZ5A 3CIHA 1WCQA 1J83A 4E8DA 2VQTA 2V5DA 3WNNA 2VCCA 3MBWA 5F7UA 2QQJA 2E31A 2W9XA 2W94A 4KMQA 2W1QA 4CVUA 2VMFA 5JMOA 1XNAA 4QDSA 4OZOA 4AAXA 4BK4A 2X09A 2RVAA 1GOFA 3VDAA 3I2HA 3PUIA 4KI5M 4ZXEA 4DUWA 2VL4A 4OMCA 4PF1A 2VZSA 3HNYM 3I3BA 4BK5A 2VCBA 2L9LA 1T2XA 1ULPA 1O8PA 1UY1A 1CZSA 4AG4A 3CMGA 1KGYA 1W8NA 3C7HA 2DCKA 3VD4A 3C7FA 1OH4A 2J22A 2VZ3A 2J1TA 2WO2A 1JZ7A 5IFPA 2VZTA 1UWWA 4L0PA 1O59A 3FHQA 1JZ2A 1D7PM 2DCJA 1JYXA 3JXSA 3W5MA 4LHSA 3LQCA 3BGAA 4CUCA 4W8JA 5JXJA 4BJ0A 2WYSA 1JZ4A 1GQPA 1L7QA 3VD7A 4ZY9A 1H6XA 2VZQA 1UY4A 3T2PA 5EJ1B 5B4NA 4P5YA 4CU9A 1PMHX 3K4AA 3HPNA 2JD9A 2WUHA 4TTGA 4FI9A 3MUY1 3HN3A 5IYYA 2ZEZA 2J1VA 1HN1A 3THDA 1BHGA 2Z4FA 2VMCA 1DYOA 3FHAA 3D3AA 3WSOA 5G04L 3K46A 4MADA 2WAAA 1SHWB 1I5PA 2Y6KA 5I0DA 5JXGA 3T2QA 3VDBA 2W95A 2BERA 3DYMA 2Y6JA 1LNSA 4LKSA 3T0DA 2VZ1A 2LW8A 2VO5A 2EIEA 2Y6GA 3I2GA 3DYOA 3CZUA 3I3DA 2YB7A 2W46A 5JR2A 4GZ9A 4M4RA 2QQOA 3OB8A 3A22A 1JHJA 5JUVA 5EIYB 2E32A 4MGSA 2QBXA 2VZPA 3LEIA 2QQMA 2B9VA 1GOHA 1MPXA 4A3ZA 3NJVA 1XC6A 2V4VA 3EYPA 3VDCA 2HYXA 3VD9A 5LA2A 3T08A 4ET7A 3ACIA 4XUOA 3CZJA 1K45A 1YQ2A 2E26A 2ID4A 4QX1A 4DUVA 2XHNA 5DQ0A 3OG2A 4A4AA 2EIDA 4CU8A 3GGLA 4XUPA 2WZ8A 4KWUA 1GOGA 4GWJA 4QDRA
chains in the Genus database with same CATH superfamily
2IXCA 1CX1A 5EQUA 2VE1A 2C9KA 3NJZA 1H2KA 3MV01 1ND2A 3NV4A 1SACA 2FDJA 4B4PA 4MXWA 1QH6A 4LORA 4K8FA 5A6QA 5JI7A 1HB2A 1DDLA 2ZHLA 2ZOEB 2R073 3VD3A 1SEFA 1LEDA 2C0ZA 4FPKA 3ZXJA 3WEZA 4MOAA 5FQ0A 3BTZA 3VHNA 5C9AB 1G9BA 2VVFA 3K77A 1W90A 3OGSA 3WDXA 4D6SA 3AMQA 3BB6A 1W8FA 2IXJA 4N90A 2A5ZA 4QXBA 4CDXB 5LBEA 3NJXA 1IPSA 1BBT2 4XDPA 1SFNA 4YW7A 2E7AA 2RJLA 1V0AA 5FP3A 3KCCA 1RITA 2D93A 3E1F1 1O7FA 4JRLA 2J1EA 3WP5A 2FZ1A 1RTVA 2E9QA 2QQKA 4XFHA 3AXEA 3U37A 4OHWA 3I2OA 3CJXA 1W9FA 3VL9A 1PX4A 5FPXA 4L97A 1UXXX 3GCWA 5FK8A 3VHPA 1ASJ2 3HQXA 3J7NA 2WABA 4WM8B 4YNIA 1BVVA 1XNCA 5GZCA 2GZWA 4M3CF 4CXXA 4MHUA 5FZOB 3FBYA 5JZGC 1REEA 3P6BA 4QX2A 2QQNA 1ASJ1 1JI6A 1QJX3 1H9WA 1L7LA 4WVMB 3UGHA 2ZHNA 4DRVA 1W3VA 1S2BA 4H3WA 3U4XA 2RV9A 4K1ZA 1LHVA 1PGSA 3R0RA 3CL1A 4LK7A 2ZX4A 3SITA 2ES3A 1HIXA 4AXOA 3DPRC 3IB3A 4WM7C 2ZKNA 5FR3A 2ETEA 2HKXA 5BXXA 1UY0A 4P08A 3WF2A 2X5IC 3BN6A 1O4YA 3GHNA 1PO23 1WCKA 1C4RA 2W1UA 3WY6A 4OI4A 3UV9A 5IVBA 3B9IA 4C91A 1IZ3A 4OHZA 1UY3A 1FPN2 2JG8B 2VNOA 1XYOA 2ZA9A 3I8TA 4JCKA 3I59A 3EO6A 3IMNA 4FPJA 1XNDA 4XFCA 3T2OA 4BQXA 3LEMA 3PVOA 2SLIA 3I2KA 5FLHA 4RHV3 2D3SA 2HWF1 4RD7A 1JTZX 2OT7A 4NROA 2HJIA 4RGKA 4XEZA 2CAVA 5BNNB 4W4ZA 5L7OC 1PIV2 4OULA 2AREA 2XOMA 3LEKA 2YROA 3K4ZA 3KM5A 3FBMA 4M0NA 5IFTA 3Q8EA 5AFBA 2R072 5F3EA 3RQ0A 1GSLA 1R64A 1SDDB 3BTAA 4HSJA 5A32A 4JX0A 2XONA 5JLVA 1HDKA 3IDEA 1U5YA 1SZBA 2VZVA 5I0RA 3POIA 4P9GA 3Q8BA 2X05A 5CEHA 1JZ3A 2R071 4A42A 1QU0A 4AVCA 5FXVA 3O14A 4LHLA 2LROA 4LXLA 1KJLA 3M4FA 1FOD3 1IGOA 3IAQA 4TYSA 2N7GA 3CO2A 3HWJA 1LHUA 2KA3A 2PHFA 1D0GA 2RS33 4OUMA 4GKYA 3UT0A 3RYPA 2V73A 4YM0A 5H9SA 5IT6A 1Q5OA 2VCMA 4FOVA 2PQSA 3ILRA 2DDUA 1LU1A 3GYDA 2VOKA 1AYM3 4Z1VA 5IW0A 4B7EA 4XABA 3ZFEA 1PK6B 2HEYF 3O5SA 4V2WA 1TVGA 1YC61 4DUXA 1CR7A 4NR1A 2BTVC 1HQLA 1K5JA 1G86A 1QJX2 4CDWC 1RHI3 4XE9A 5BY5A 4L9BA 3TOJA 3JBG3 4L99A 2D6NA 3ILFA 4KU7A 5IAVA 1FYUA 1VBA3 2BWAA 1DQ6A 1OA4A 4CA9A 2DFCA 3DUIA 4MGTA 2JEMA 4Y26A 3GNEA 3AKPA 2GNBA 1QJX1 4QU1A 4MG2A 1AL0G 2EA7A 3HBZA 3GJAA 4LIUA 4ZONA 4DQAA 3FUQA 1DQ0A 4UW4A 1QJY3 4N43A 2Q8EA 2W39A 2AEZA 5D8AA 4CP0A 3T1MA 2JDUA 2VZOA 1VP6A 3KMHA 2R16A 2Y0OA 3WDVA 5BNOA 3THCA 5FMBA 4RR3A 1XE8A 4LUMA 4Q4X3 1PO22 2IC1A 1P8JA 2MNGA 1W6PA 2PELA 1US3A 5DAPA 3KVBA 4G3YC 4NHMA 1A3KA 1RL3A 2BOJA 4YGDA 2BZDA 4YW5A 3T09A 3WHUA 3K3NA 4NRPA 1PO21 3BIWE 3S57A 1A78A 2Z5WA 3DECA 2EXIA 3LF7A 3USUA 1HXS3 2ZCWA 3LCPA 2YFZA 1DIWA 3MPBA 1ZM1A 1BYHA 2H6BA 2TNFA 1GWMA 3RZKA 3DEMA 3LB9A 1RUI3 2AR6A 2ZAHA 3IKWA 1W03A 2WNUB 4RHV1 2WWUA 3LE0A 3ZFGC 4YZ5A 5A1LA 2BVBA 4WM7A 3VBFB 2XDVA 1ZBE3 3LPGA 5FY4A 5FY8A 1UOBA 4FXGB 3JQXA 3ZN5A 4GB33 1OLRA 4S2HA 3H3LA 4COWA 3OEBA 1MQTB 1QF3A 2HEWF 4V1PA 5JOZA 1W06A 3AMPA 3HOBA 2V4AA 4EN0A 4MO3M 4NAOA 5B4XA 3AP4A 2TEPA 1FOD2 1W2NA 1WW6A 2PN5A 3KF3A 4N9IA 3SNMA 3ZPOA 1F4AA 1UZ0A 4DIQA 2RS32 5C3SA 2WN2A 5FDBA 1CWPA 2Y6HA 3OTFA 2NPIA 4XJAA 1U5ZA 4XHBA 2YDEA 3ACFA 3USSA 1AYM2 3ETPA 2RS31 4H7LA 3POSA 5IK4A 4IV3B 2FMYA 4X8NA 2ZXQA 5K4LA 2VOVA 3HNMA 3OGVA 5CFCB 5CG9A 5FZ3A 3UNPA 2YGLA 1AYM1 3QBQA 2RM23 1I3HA 2DVAA 4WZCA 1RHI2 2R6QA 4YZ4A 1TNFA 1OFNA 5FAXA 4BH9A 5DUVA 1QGLA 2D6LX 3JBG2 3N36A 3VHOA 4XUTA 2KD7A 1VBA2 3GHMA 1GKBA 2CHHA 3D8CA 2XQXA 3HEIA 4W6WA 2A6WA 1AR92 5DUWA 3T2TA 4E2SA 1F4HA 2GC1A 4BQ4A 1RHI1 4D7TA 5K9YA 3E97A 2CV6A 3JBG1 4Q0VA 1QJY2 1OLME 1UZZA 1VBA1 1BZWA 1AUYA 4FFGA 3WDWA 1NX9A 4AGGA 4AVTA 5LEJA 4JKLA 1SG3A 2UY9A 5CYYA 2AZ5A 2PHXA 3OUIA 4Q26A 2CSGA 1CPMA 3A23A 4Q4X2 2VR4A 1TE1B 1VBC1 2VQ0A 3Q8CA 3UESA 4OUEA 1QJY1 3N9NA 2OXBA 1SLLA 4URAA 1NG0A 2W52A 4LR4A 5KHJA 1KEXA 3LKJA 1S0IA 2BWCA 3UETA 1IS4A 1Y4WA 4YG6A 1DQ2A 4FOWA 3KD4A 4Q4X1 3A7QA 1QIQA 1G9FA 3MW3A 3WNOA 2D3PA 2D98A 3OUHA 4MVTA 1HXS2 3ZIXA 4D3WA 3ELNA 3M3OA 5A7WB 4YFWA 3IZOA 1X9PA 2B4KA 2QUOA 4PBOA 1BVP1 4HVQA 5FXZA 1MEC3 1RUI2 1EP0A 2DBNA 4O65A 5BNPA 2GN7A 1HXS1 1JW6A 5C3PA 2WDBA 3TRSB 1YHFA 5D2AA 2O0OA 3PUSA 4KWLA 1OPMA 5LRSA 3AFKA 3LA3A 5H9PA 3D0JA 1H8TA 4QX5A 4EJRA 1H0BA 2EXHA 1E57A 1ND3C 2XMLA 4B8EA 5CBLA 4AEMA 1RUI1 1ZBE2 3DKWA 3LFIA 2OIIA 4FT8A 4Z8BA 3B00A 1FI2A 1QDCA 2EF6A 2RHPA 4GB32 5FRAA 5ISLA 1ZZ6A 1JOPA 3ZYGA 1J84A 2GNMA 1JU3A 4KWKA 4WBBA 4XFBA 3SMHA 4BISA 5LA0A 1IOAA 1ZBE1 1BK0A 3HMYA 1RC6A 3SH4A 2BGCA 1NAEA 4S2DA 1W04A 2WSVA 4I0BA 4GB31 4N9HA 3O0WA 1CAWB 1LCLA 2YPJA 2ZZJA 4PIYA 4ZXKA 4XIOA 4AEDB 3MYXA 4OLLA 5DZEA 4XBQA 1CX4A 2UURA 4OHVA 4NOTA 3U75A 3WNNA 2XR4A 1PNFA 4FSJA 3H3UA 4LBJA 2JG9C 3ZFFC 2LRPA 3AFGA 4XXPA 1GZTA 4CP1A 5JMOA 4CVUA 4MLOA 4JRAA 3FUOA 3H8UA 3ITQA 1W2OA 1CONA 3JU9A 4OZOA 5A7OA 4YGEA 4AAXA 1YIPA 4RSUA 3JUUA 3H8OA 5F39A 2EXJA 2IUWA 1WW7A 4CDUC 2RM22 3KB5A 4Q5OA 2RVAA 2XLFA 4IGOA 2Y6FA 4QHBA 4XJ8A 2P2KA 1SDWA 4XTMA 4L8QA 3ST7A 1ZBA1 1SLCA 2EIGA 1QJFA 5BPXA 3PUIA 3GBFA 3RZGA 1Y9GA 1AX2A 3NNJA 1N3OA 4OMCA 2RM21 3HR9A 5KXEA 1OFSA 4GA9A 1FATA 4IE5A 5L9VA 2L9LA 1UYPA 3LD8A 2IVIB 4FFFA 1VBE3 1T2XA 3KV6A 3OBRA 4FOYA 1GYKA 4FP2A 4QQHA 4I3PA 4SLIA 2WC2A 4BYYA 1EPZA 2Y33A 1ULPA 4GWNA 5K0UB 1XNKA 1V6KA 3AZXA 3N9PA 3VZKA 1JODA 1R1A3 2VNVA 1Y9QA 4FP3A 4GIQA 3RWKX 2ERFA 1J1TA 1OH4A 5C5UA 1FXZA 1VALA 2J22A 2VNRA 4CYDA 3MIEA 5LK7B 1CAXB 4PHZA 4EN7B 3UGGA 4YVWA 1JZ7A 2JX9A 1WA6X 4E4ZA 2WWJA 4Y22B 1W6QB 2VZTA 3VDDB 4ATEA 1MEC2 3OYWB 1NE6A 2DCJA 2G9FA 2JB8A 3LQCA 3BGAA 4YLZA 1UKGA 4Q1RA 1JZ4A 3VBOB 3GBWA 1H2MA 2QCSB 1L7QA 2PHLA 2ZTNA 1MEC1 1CJPA 4NWWA 2P3YA 2A3XA 1WCSA 3CNAA 3NVCA 2VZQA 1LENA 4MZUA 2BNMA 3LFMA 3N7LA 5FZ0A 5B4NA 4LO6B 2W2IA 3DXTA 1VMFA 4YRDA 1AJOA 4LIVA 4CU9A 3K4AA 2CY6A 2I45A 2G9GA 3AYCA 2JD9A 4NVPA 3RVHA 3U78A 4TTGA 2AGSA 2BV4A 3MUY1 4IQPA 3BU7A 4B4QA 3I3QA 4GH4B 5A3WA 4LO7A 4K20A 3THDA 1F15A 1HQWA 2GH8A 3H1WA 1DYOA 3NMBA 1O4ZA 2Q30A 5DG2A 2VG9A 3RI9A 4DXZA 3GF6A 3WSOA 4EZ4A 1CPNA 1ZZ7A 2AENA 5C33A 2ARCA 1PGW2 1O5LA 2ZAAA 1KQRA 1PMIA 4XILA 3D6EA 5JXGA 2OQ6A 1LU2A 1ND3A 3VDBA 2OPKA 4OI2A 2BERA 1IKPA 1I5ZA 4HBNA 3B93A 5JSOA 1LNSA 1PGW1 1WBLA 3MPPG 1RUE3 5JOWA 1GWKA 1RVF1 4J1XA 1SBEA 4GWMA 4DY5A 5IAXA 4AF9A 2JWPA 3BKZA 3OPTA 4QGNA 2LW8A 5FP8A 2A1XA 5DXDA 1V9U3 3JZVA 4E4SA 3I2GA 1UL9A 3H1YA 4YW3A 2XJVA 2NZ9A 5KXDA 4JZRA 4PIZA 5FJKA 1VBE2 1AYN3 3OB8A 3A22A 3QH6A 4XIKA 1U0AA 2PYTA 1GZ9A 3N35A 5EJ3A 5ABJB 2KXLA 4FCAA 4HKOA 4BIOA 4HXCA 2Y38A 1VBD2 1NE4A 1VAKA 1Z7S3 1B35B 2E53A 1VBE1 2B5HA 2QQMA 2VMHA 1R1A2 4H14A 3VZJA 3OBTA 3KWVA 1XC6A 2V4VA 4CPBD 2HYXA 3NW4A 3T08A 4ET7A 1BJQA 3ACIA 1H30A 1ZA4A 3AZYA 1XBFA 1R1A1 4CDUA 1F5JA 3E5XA 3IPVA 3ZR6A 1YQCA 2E26A 4BE3A 4DUVA 3IT8A 2WT1A 4C90A 4A4AA 2EIDA 3OGGA 3OGJA 4YW1A 1OA3A 2D44A 4KWUA 4Y20B 4NIAA 5GZEA 1RUD3 4IDZA 2WZR1 4BLJA 3AYAA 1RB8G 1NXD1 3MIFA 2P37A 1XE7A 3CJIC 1XQNA 1UPSA 4UWDA 4OHYA 5JOYA 3BTYA 1GP5A 1QJZA 4XJUA 4LQRA 5FZMA 1HKDA 3P3NA 1VBB3 5FYCA 1UAIA 1GLHA 1PMJX 4HVOA 2BRTA 3WHTA 4N7UA 3NO8A 2Z42A 3KT1A 4CEYC 1UD1A 4M00A 4ITCA 2YC2A 3IIAA 2XH6A 1TG7A 1NCRC 3AX4A 2Z79A 2A70A 2R7EB 4DB5A 2WYFA 3NAPA 5FMOS 4YGBA 4BPZA 1C1LA 4QPGA 1LHNA 3PUHA 4QM9A 1UO9A 1CAVB 2YMZA 1FAYA 1LKNA 3DV8A 2BGOA 2B9UA 2FQPA 3ZVXA 4F8AA 3PHMA 4CUBA 2WFPA 1CAUA 2UWCA 1PVC3 5FLIA 4SBVA 1SCSA 4IEQA 2VD7A 3GXUA 1YUDA 1UX6A 1RUE2 3VBRB 4AE2A 2FDIA 1UZYA 4LEJA 2VW2A 3FZ3A 5FPUA 2QQVA 5FO8B 5JI9A 1QY4A 5IK5A 1V9U2 3BUCA 1BXHA 3K51A 1ZZ8A 1XU1A 3EHKA 2C26A 1AYN2 4NMIA 1JOBA 3MLJA 1HB3A 1VB2A 2Y60A 2ARXA 3MI8A 3ZYPA 4P9IA 2XJSA 1YFXA 2DCTA 1U12A 2VBBA 4QPIB 4HKLA 5KXBA 1NCQB 3HT1A 4IV1B 3E6CC 4CCMA 3WNKA 1AYN1 5A6ZA 1H9PA 5FFOC 3WD5A 4ATFA 1K3IA 2NYYA 4R9BA 5HCHA 4KGQA 1PZ9A 4RS5C 5FZ6A 4LITA 5T5OA 4OYUA 1J58A 1TQ5A 4ZU5A 3F95A 2VZUA 3AZVA 1ND2B 2ORXA 1W8UA 1X8MA 3PU8A 1Z7S1 2HBTA 3H42B 4MUVA 2TUNA 4QX8A 3LAGA 1SFYA 4MXWB 4Y4RA 5DZFA 1OSGA 5J48A 4CCNA 3T1LA 1R083 3OPWA 4IE0A 4RQPC 3CBNA 4N53A 4YVSA 4J25A 1W9TA 3QH7A 2IXLA 1POV0 2F4PA 2ZZQA 4JHZA 4QXCA 4QT6A 1RUD2 4XF4A 3PJYA 3FLPA 2GMPA 1OVSA 5L73A 1QXRA 2VMGA 3WP4A 2WFF3 5FCCA 3DF0A 3V64A 5DG1A 3RZMA 5KR7A 4IERA 1ENSA 4Z2WA 5IK8A 2SBAA 5EZWA 2PMWB 1RUD1 1F35A 1OOPC 1C5IA 4COUA 3MO4A 4UF0A 4Y1XA 1VBB2 2V72A 3POGA 4EN9B 4ISQA 1WW4A 1Q56A 1Y43B 2G4IA 3PUAA 4HETA 4NHXA 2AYHA 1SMVA 1FT9A 4CCDA 5F32A 3RJRA 4AL9A 3ORJA 2R043 2WNVC 3VBUC 3V0AA 2P5BA 2W87A 4QB1A 4JGZC 1D2QA 1BKZA 4DFSA 3O1MA 1VBB1 3U4SA 1LOAA 4AHZA 4HANA 1H6YA 5F6LB 1JZ8A 1O3TA 4DOUA 3B3QE 3NNFA 2P6CA 2A3YA 4RFRB 3O1UA 2BFUL 4G4FA 3HNBM 3AC0A 4AYUA 5DMYA 1W0NA 3M70A 4HG6B 4AI3A 2PHDA 2PAMA 1OD3A 3HJRA 2QTWB 3EBRA 1PVC2 3RZZA 3I54A 3WNPA 2UY8A 2JENA 3LA2A 4JVAA 1O3RA 1IPJA 5JVVA 3ILNA 2J1SA 1XE0A 3E5QA 2JDPA 4HPKA 3TB0A 4PIXA 4MGIE 4CU7A 2DVBA 1PVC1 4CDXC 3OD4A 4ZKTB 2WNOA 5C4WA 2QDRA 4HMZA 3H1MA 4CCOA 3OUJA 4N8MA 2I07B 1K42A 1AHSA 1OA2A 1NZCA 3WF1A 4CEYA 5A1AA 4PQQA 1HB4A 1YCIA 3I59B 3KLSA 1ZRFA 5C6CA 1NCRA 4Q0PA 4YM2A 4MGZE 1JYNA 1NUKA 1CVNA 1I6XA 1KFUL 4TXWA 1OQ1A 1ZRDA 3POEA 1QEXA 4UFIA 2A6YA 4XMAA 4PJYA 2X8KA 2VULA 4KBBA 4NN0A 1XOYA 2WZEA 2RS11 2QDNA 3WZ1A 3MZHA 1W6MA 4WVWA 4ZS2A 4P9JA 4FAHA 4W50A 3QD6A 1WMEA 4WM8C 3ETQA 2JE7A 4JGYA 2XKOA 5FO7B 1LOFA 4FPLA 5J3UA 3UGFA 4BQWA 3AZZA 1YQ6A 5KXCA 1DQ4A 1R082 4IGPA 3NWKA 2DFBA 2P6HA 4Q0SA 1POV3 5LBFA 4QKDA 3SKVA 2ZKLA 1RIRA 1N1VA 2J1AA 1YJKA 5A32B 3M3IA 4LA3A 3WDYA 1PX3A 3DKQA 4ORFA 5T5PA 1R081 1T6GC 2WLQA 5A80A 3IM0A 2FDKA 2ZMLA 1VMHA 2XJRA 1V6NA 5DAQA 3ZO0B 5CKNA 2W1WA 4AVSA 2ZGOA 4CPBA 1WBFA 3DXUA 2YU2A 1FNYA 3AZWA 3IDAA 4IEYA 4P00B 4AI1A 1JYTA 4RFT0 2BNNA 2WFF1 3LWCA 3WQ0A 4XUNA 3ZYRA 4PF5A 2J7MA 4LKDA 5FYHA 2JJ6A 2JG8C 3NNGA 5F5AA 1VLNA 3PMSA 4Q0QA 3UKVA 3VZMA 4A41A 4BU2A 1HQNA 2R042 2WA4A 5FZDA 3SH5A 3R4UA 1KD7A 3IWZA 4QQPA 1A34A 2K0GA 3X29B 5A33B 2IXHA 1LOBA 2VBDA 3ZFEB 1H2NA 1YXWA 2W47A 1JUHA 1S0BA 2JD4A 4FAGA 2XUEA 4RN5A 2W0XA 4R9DA 1CQ9A 4XPVA 2R041 2R32A 1TME1 5BNNC 3BCWA 3L9JT 1QXJA 1YI7A 3ABZA 1OI6A 1NQDA 1EUTA 4I09A 5GLTA 1SPPA 4FPGA 2VUCA 5FZEA 4P9XA 1UW8A 1UZWA 1UMIA 1GBGA 2ORZA 1EAH3 5I93A 1IHMA 3U0ZA 2VU9A 5GLUA 1RUOA 2HWF2 1V6OA 2HEVF 1W8ZA 1NA1A 1VB4A 2VXRA 4N43B 5J1XA 5D8AB 2VXJA 1NOVA 5FZIA 1S4CA 4DZGA 1UIJA 5BNOB 3O1SA 4Y1VA 1AR83 5JDBA 5JAXA 4E4DX 1BMV2 4RR3B 4BQYA 3EB7A 4JKKA 3SQOA 3BPZA 1W6PB 4M3CE 5JMCA 4K3UA 2EALA 4XFAA 1YQ8A 2MPFA 1BMV1 4MGQA 3PIGA 5HXVA 2Q8OA 3USUB 3URFA 3I97A 5C3OA 1QOSA 3SKJE 5A6YA 3VL8A 4B7KA 1XJAA 3M1HA 4OMDA 1W99A 2J1RA 1IG3A 2FHRA 2VUJA 4QXHA 5GZDA 5F9TA 5EJZB 4LBKA 1PK6C 2DWRA 3L2HA 4QB6A 1OKOA 3I3MA 2D6KA 4Y1ZA 4AFBA 2ENRA 3IIIA 4GJYA 1DGRA 3VD5A 3O1PA 5EYYA 4I01A 3WLUA 3N7MA 1US2A 1UMZA 1V6JA 3SLIA 4CCCA 4I0AA 5EXOA 4U36A 2LS6A 3ZSLA 4CDXA 4LJHA 4A7ZA 4BOWA 3W21A 4C1XA 2DYCA 1WWYA 3O1OA 2QNKA 1POV1 2W5FA 4A7YA 1JYCA 4HONA 1AF9A 5F1RA 1H4GA 1WLTA 4U2AA 5CZKA 3ZXDA 4I0WB 4HLTA 5JR7B 1XSQA 3ACGA 4FPCA 3WCRA 5J37A 4BQ1A 3NQHA 4A45A 4NIGA 4HK9A 4OQ9A 3WF0A 1RUC3 4RL7A 4WZFA 2W08A 2FCUA 3BODA 2LTNA 3IMMA 4ZPIA 1WLCA 1Z0HA 3N9OA 1JU4A 1E5HA 3R6SA 2UU8A 2WT2A 3O1VA 2QQPA 2NN8A 3BIEA 5FZOA 5CG8A 1W8TA 3AP9A 1YO8A 3FWEA 1XPWA 4O9EA 1N1TA 3ATGA 3FL7A 1KXGA 2ZGMA 5FYZA 3OEAA 3O0XA 1VBC3 5LRRA 2ATFA 1WCQA 2WR9A 1F2NA 1J83A 4IW3A 4UW5A 4LBQD 5LEKA 5FZ9A 2WNUC 3PIJA 4DY3A 5CKMA 4BWOA 4FPHA 1OD5A 2VCCA 2QQJA 2E31A 1XNBA 2W9XA 3N7KA 1N3PA 1EAH2 1YYNA 4KMQA 3FX3A 3VBFC 4YFZA 3LDBA 4DS0A 5FYBA 2WQ4A 4LLFA 1V6MA 4MX3A 3EJKA 4JDMA 4NJ4A 1AR82 5JZGA 1MQTC 2FMDA 5F3CA 1EAH1 1IS3A 1V6IA 3ME2A 4JDNA 3M8LA 4RHV2 2YU1A 4HFSA 3NV2A 2DVGA 4XBNA 5L19A 5ERLA 3VZOA 3VDAA 1MS9A 3I2HA 4KI5M 5J09A 1AR81 4DUWA 4RA0A 4PF1A 5JIUA 2VZSA 3ZXLA 1URXA 3DPRA 2A6VA 2JKBA 2O1QA 4I3GA 5JSPA 4Q4Y3 1AR63 1Q43A 2X5IA 4OUSA 3OY8B 5DZGA 1DYKA 1YQ5A 4LUKA 4IV3C 4QWNA 5FUPA 4LBMA 5BNPB 4CXWA 4Y33A 5CFCC 3J8F3 3RZJA 2WQZC 3C7HA 5FWEA 1ACCA 3AVRA 4NO4A 5FP7A 3M3QA 1H8TB 1V00A 1RINA 3J26N 3RFRA 1IG0A 1QNWA 1POQA 4MV2A 2VZ3A 2J1TA 5FZGA 1VRBA 3S7EA 5IFPA 2H0BA 3D4KA 4FFHA 3W59A 3WVJA 4NWVA 1F9KA 4Z92B 4L0PA 4IEUA 3D82A 1FV3A 1U5IA 5L7OA 4EN8B 1JYXA 5LWBA 3W5MA 4LHSA 1JOJA 5IVYA 2OUHA 1X50A 2WYSA 5KHIA 5FLJA 1ZBA3 1E5RA 4XF0A 4YM1A 2DU0A 5T5JA 1RUC2 4KU8A 1H1MA 5FWJA 2XLAA 2OW4A 5SV5A 2Y0IA 5E88A 5EJ1B 1PK6A 3AYDA 4AVBA 5JOXA 3WUDA 4XFFA 4UBHA 1RUC1 1REDA 2VNGA 1GFF2 1PMHX 3HPNA 5E89A 3ES4A 4FPEA 2WUHA 1WLWA 1WMXA 3FC0A 4LO8A 1VBC2 5IYYA 1KRIA 3V65A 2J1VA 4K7JA 1Y7BA 2XJPA 5A7PA 3QLQA 4R9CA 5IVEA 2V5YA 2VMCA 3MF9A 2ARAA 1UF2C 3D3AA 4JC1A 5ANQA 3WP3A 2VW1A 5G04L 4QD2A 2AUYA 1SHWB 5FY5A 1I5PA 2Y6KA 1JN2P 3I49A 5FZCA 2FBEA 4KQ7A 5F3IA 1VPHA 3T2QA 1J1LA 5E8AA 3GBGA 4TSVA 2Y6JA 5FPBA 1RUF3 1J59A 1J3PA 5EWSA 4YZ3A 3O1TA 4ZU4A 3NV1A 2NQYA 1XXNA 3B9CA 4CDWA 2RDSA 3T0DA 4BXFA 4MSVA 1SBDA 5IWFA 2VO5A 4AFAA 2ZPXA 4AEDC 3PTRB 4KNCA 3MLLA 1VE0A 1AR73 2RDRA 2YB7A 3I3DA 3MGUA 4IEPA 4CE8A 2IFWA 3KCYA 4RGGA 4BQ2A 5JR2A 1OXCA 1UNBA 4M4RA 3WQ7A 4YVWB 2RMU3 4LNVA 4Q4Y2 3WW1A 4CP2A 1JHJA 2ZX1A 3KHCA 3RZHA 3WR0A 1ODNA 4ZHNA 1XU2A 2D97A 2VZPA 5APAA 4FQ4A 1N3QA 3J8F2 3VBFA 2NMOA 1MPXA 4Q4Y1 1HN0A 2UWAA 4A3ZA 4BQ5A 2WKKA 1AR61 3EYPA 3VDCA 1STMA 3VD9A 4CEWB 1CIWA 4AGRA 1IS5A 1WA4A 3MIGA 2QQUA 5FYYA 4R4XA 1NLSA 3K3OA 1MQTA 3CZJA 1Q8QA 2QFEA 3J8F1 1YQ2A 2ID4A 2BPA2 5FYVA 3KSCA 1FNZA 4L92A 4RGAA 5DQ0A 2VUAA 3OG2A 4QKFA 3JB8A 4KG0A 1A6CA 4W6XA 1QNYA 3GGLA 2A75A 1ULFA 4B29A 3T4HB 1GOGA 3IN9A 4Q29A 1AX0A 1RVF3 3ZFGA 3RNSA 3GZEA 4Q8LA 5K0UC 5KHGA 1ZBA2 3CLPA 1H4HA 3WG1A 1C3HA 5A3PA 1DHKB 3VBSB 4JTOA 1JUIA 2VCAA 3WQ1A 2ET1A 2DBIA 4IV3A 1NYWA 1SQ4A 3ACHA 4XF3A 3MF6A 1LRHA 1GNYA 1I1EA 3KS7A 5KWRA 1R091 3E5UA 1YRZA 2DUQA 3EMRA 1HRV1 2HWC3 4BB3A 1UMHA 4AEJA 1DLCA 2XJUA 3VDDC 3O12A 1ULOA 2VY0A 3T0AA 1UXZA 4DO0A 1G9AA 2CYFA 5EP9A 3MHZA 3NSTA 3J9SA 4JQRA 3VBOC 1RXGA 4NHLA 4E27A 1YLLA 2JE9A 5FPVA 2OKXA 1C8NA 3SH3A 2TBVA 4RYDA 1LAJA 1HLCA 1W9WA 1ULEA 3H9AA 2FDGA 2CWSA 3HQRA 5FZ8A 3GCXA 5HPOA 5BNQA 3NRUA 3EQEA 2D5FA 4FO9A 3ZOIA 4D69A 5F3GA 5LA9A 1RUF2 3AJYA 3C7GA 4QGMA 1QMJA 5FV3A 1QDOA 2WZR3 4Q4W3 1QHDA 2VBPA 3WDTA 2QVSB 3KQRA 3AP5A 1RUF1 2E33A 3O0VA 2EICA 2XG3A 4GH4C 4LBQA 1WZXA 1Q8OA 4LBNA 2DUPA 4YPJA 3VBHB 4FBFA 1OC1A 1RMU3 3W20A 3SEPA 5GM0A 3N7JA 4ZZ5A 4IEOA 1UYXA 2RMU2 3IPVB 5HBAA 3KV5A 3FJSA 4MXVA 4TZDA 4BXSV 1CESA 1W6NA 1OLQA 3MFAA 2QKDA 4FQZA 1AR71 4AZZA 1HB1A 2BUKA 3OGRA 2W3JA 4COYA 4CDQB 2RMU1 2VOWA 4BZ4A 2JICA 2WBKA 4IE6A 5IJRA 3ZXEA 2HWB3 2W1SA 3HT2A 1XNTA 2X10A 4XF1A 3VHRA 2AACA 4OI0A 3SXWA 1ZRCA 2YGMA 3IDBB 3LPFA 3HQUA 3HVDA 1JXNA 2J1UA 5ACA3 4XOGA 3ECQA 3K75B 4META 1HV0A 1C28A 3OSDA 3V0BB 2CDOA 1CAWA 3S6PA 4J1WA 3ZN6A 2XPJA 1GNZA 1RVF2 5ABJC 1WMDA 1ONAA 4LOTA 1OUSA 5HCFA 4UFLA 1B09A 2BNOA 1B35C 3I3EA 5DABA 1K5MB 3C7EA 5J98B 1YJLA 2UYBA 4CCLA 3AKQA 5F6KA 3NAPB 5FBJA 2CGOA 4EZHA 4COZA 3TEZA 4QPGB 3A21A 3SCGA 3WG2A 5FPLA 2ZBJA 4DEVA 3SC7X 3T30A 2VW0A 1FMD3 4M3CA 5I8TA 3Q9OA 3T3YA 3ZYJB 3ZXAC 5F2WA 5F37A 2XJTA 4QQ2A 5C8CC 3WG3A 4D0QA 2HWC1 2A6XA 1MS8A 1G6NA 2VOTA 2JG9A 3ZFFA 4AVAA 3MUZ1 4QMAA 2ZACA 5CFDB 1UCXA 4IESA 3OJBA 1D4M3 1SLIA 2A73B 5E16A 1BCXA 1MZFA 1O5UA 1LHOA 5A3UA 2HLEA 1QOOA 2WZR2 4Q4W2 3H8RA 3AKTA 2K46A 2JB4A 2FDHA 2OUJA 2VZRA 2BGPA 2ZX0A 3SCFA 3ZX7A 2VM9A 4XXAA 2WO7A 4XHXA 4A3XA 1RMU2 4K40A 4Y22A 3ES1A 4Q4W1 5CA6A 1CGPA 3VDDA 5K8SA 1VRH3 1LESA 2JDYA 3OYWA 1ENXA 1HX6A 1UN1A 1JH5A 2RJ2A 4N53B 4YVSB 4TN7A 2VQAA 1TZOA 3KVAA 4ISRA 5LZ6A 1RMU1 3VBOA 1RJ7A 2PAKA 5C3RA 1DGLA 1AJKA 2JDAA 3ZM8A 4KG8A 2QQWA 4QPWA 2GP3A 3JD73 5AVPA 5HCBA 4JQTA 3ZPYA 4DPNA 3VBRC 2HWB2 3JB4C 2ZEWA 2XXZA 3BOWA 3MW2A 2XJQA 4DMIA 3BOPA 2NMNA 2BW8A 2B45X 4AI8A 2WN3A 5ACA2 1W05A 4FVVA 1KJRA 3GZTB 4PDWB 4XURA 4W6YA 2HWB1 4UF0B 4XDOA 3TWIA 3PLQA 1CZVA 5DDJ3 3A0NA 3ZIWA 1TNRA 5ACA1 4Y1YA 2BEOA 3CEWA 3ROUA 3RWNA 4AI2A 4QPIC 3V0AB 3H7JA 1DU3D 2I74A 5G05L 1NCQC 3ZXFA 4IV1C 1DP0A 3AL5A 3JQWA 4IUGA 2HYKA 3KV4A 4UI9L 5EHDA 1KITA 1QH7A 3ZMNA 4H55A 2JDKA 1NZIA 2QE3A 3ON7A 4GXLA 2B42B 4QKBA 3VB9A 3PURA 1UOGA 1VR3A 2IXKA 1ND2C 1S0DA 3AP7A 1X82A 3QOPA 4EN6B 4YZ2A 1H1AA 2WNEA 4XAAA 1ZZCA 4HKWA 1OF3A 1FMD2 4O61A 1W6OA 5GLVA 1OBNA 2JDHA 4AHWA 1M4WA 2G9ZA 2YV8A 3AMHA 4O7XA 3MFCA 2Y64A 3J7HA 4Y5TA 2RS13 4HPKB 2AH2A 1PZ7A 2MHFA 3CQOA 5GKAC 3W9AA 4EV0A 3UK9A 5AFEA 1FMD1 4HK8A 1W8WA 1FV2A 5FY7A 3ZSKA 1Z7S2 5C4WB 2ZS6B 1S2KA 1W9YA 1TEIA 4XJWA 1UPIA 4MGKE 1DG6A 1D4M2 1J3QA 3WUCA 5FKBA 4GMP3 4CUAA 5CIRA 1DLLA 5K7PA 2B39A 1C5HA 4DNYA 1IQDC 3WF3A 4AEKA 4BMEA 4TLFA 2ZJCA 2Y26A 4DEQA 2A3WA 1D4M1 1VAVA 1JBCA 5A3TA 3BTXA 1Q8VA 3ZYIB 3ZLIA 2RG4A 5C70A 5I91A 4NPMA 1XSRA 1W6MB 5FQ0B 3FHIB 4QDQA 3RSJA 5A7SA 2X53S 1AL23 1J3RA 2VTXJ 3P1IA 3ZMOA 1QJEA 4JGYB 4LOSA 3VKOA 3LOIA 4CP9A 4CCKA 4YYOA 5KHKA 4A2UA 4I02A 1VRH2 4K8RB 2QZ3A 3M2MA 4JAAA 2CGNA 4DXTA 4XUQA 1JYIA 1BLZA 5C8CA 1RUNA 2JKXA 4LO5B 4Y20A 4JHTA 1OHFA 1GQHA 1WKYA 5F5CA 4YSFA 3DGTA 2Q1ZB 3ZYBA 4CZSA 1C8M3 4HN0A 4YW2A 2RS51 3WW4A 4DXRA 1VRH1 1BBT3 1G8WA 2WL1A 4EQVA 1KDKA 5C5TA 4QXKA 2ADDA 1PM4A 3LIHA 5IVJA 2XUMA 2VTFA 3ZXGA 3H8XA 2GNTA 4D6RA 1WD4A 4ASMB 3VUOA 1TME3 1UU6A 2ZGLA 4EWEA 2B8MA 3W5NA 2D3RA 1GU3A 1QXPA 2JXAA 3JD71 5FO9B 5IVFA 3C7OA 4K21A 4NIIA 4BA6A 4COVA 5FKCA 3KF5A 2PHUA 1ALYA 2YG0A 4D7YA 4HN1A 1OF4A 2W91A 2OX0A 2YC0A 2WRAA 3OBAA 5DDJ2 5GLZA 4Z2AA 3DYPA 3RMYA 2WAOA 4FTEA 1QWRA 1IS6A 1G7YA 3F2ZA 3WNXA 1W0PA 4C0BA 2W92A 3MEPA 5A1FA 1KS4A 2VQUA 3EXUA 4IGQA 5A3LA 4XVHA 1W8HA 5DDJ1 1W2TA 2BP6A 1ST8A 1X8EA 3CJIA 3ZKUA 4P9LA 1CAVA 3IAPA 5C9AC 2ZX2A 4BQ3A 2E63A 2WSUA 4QQLA 2PLV3 1W2UA 2JDZA 1SPPB 4UXAA 3RS6A 1LTEA 2XVGA 1NY72 3VBRA 4UOJA 2P3KA 4FTSA 2BYVE 4TWTA 4XFGA 3TEXA 5CVRA 3LSEA 3BYWA 2RS12 1ENRA 2HWE1 4MYEA 4Z07A 1NA1B 1SLTA 1MVQA 1WGPA 4LHNA 4PQ9A 1CD3G 1NY71 1OUXA 2GMEA 3GALA 4QX0A 5C7GA 1JZ5A 3CIHA 4Y4YA 1UOJA 4AHYA 1AXZA 2VPVA 3WW3A 4FOQA 3LOBA 3NL1A 3APBA 4S2GA 3N9QA 2V5DA 1TMF3 5JCTA 2P34A 3MBWA 2R49A 2BFUS 4IV1A 4R8HA 5F5IA 5F7UA 1E5SA 2W94A 2RE9A 2FDFA 2VMFA 1XNAA 4QDSA 2UWBA 1GZWA 2HWD3 1JS9A 4GMP1 2F17A 5JIAA 1PIV3 1GP6A 4WVVA 5LASA 2XKPA 4BK4A 2R063 4B1LA 3LSDA 3C3VA 1AL22 4F83A 3ZFEC 5L9RA 2K9ZA 2CL2A 4JDOA 3WT3A 2VECA 3RRDA 2F6BA 1NLRA 4MHRA 3J7MA 2WFF2 2WLPA 4ZXEA 4V2VA 5ANNA 3AXDA 1VMJA 4PLOA 4BK5A 3UKTA 5T55A 1AL21 1GANA 1SBFA 2VCBA 3HN1A 5GJ6A 2R30A 5FZAA 2D7FA 1C8M2 1PVXA 3ZDSA 5FY0A 1HJFA 1O8PA 1UY1A 3G7DA 3KZ4C 4RS5A 4XQWA 1CZSA 5FP4A 4AG4A 3CMGA 4N43C 2ET7A 5D8AC 1W8NA 2DTYA 4BMBA 1C8M1 1TME2 3AB0A 4P9WA 2F4LA 5BNOC 5J7MA 4LE4A 1BBT1 5D21A 3RYKA 2DCKA 4RR3C 3VD4A 2CU5A 3C7FA 4RQPA 4UFMA 2YYOA 1QJU3 5I0TA 3OPZA 3UJQA 3N9LA 1IKQA 2FCVA 4FTBA 2G1MA 2C24A 3HAGA 4NRMA 1UWWA 1W28A 4LULA 1MS5A 1DGWX 1O59A 2D5HA 3FHQA 4HVRA 1JZ2A 3LGRA 3WV6A 1UU4A 4QGLA 4CUCA 4K1YA 3KT7A 4FPFA 1S1AA 1UQXA 1X9TA 1DFQA 1GQPA 2XQRA 2ZABA 1OOPA 2FZ2A 2QZ2A 5DAXA 2PLV2 3MW4A 3THTA 4R4ZA 3SCHA 2VVDA 3VKNA 1LHWA 5CU1A 1DCSA 1V70A 4AFMA 3WCSA 1OKQA 4QHOA 1UY4A 3UJOA 5KBFA 1H8VA 2GC3A 3VBUA 2WNVA 4LK6A 2PLV1 2YBSA 4JGZA 5CAZA 4P5YA 4Q0UA 4NHYA 3H7YA 2XL7A 3I7DA 2PHRA 3PNAA 1Z78A 5JZGB 3B7MA 3HN3A 3INAA 3R05A 4Z82A 1HN1A 4XZPA 4UBGA 1YFWA 2IFRA 3B02A 3JCIA 3UKNA 3N3HA 1ZREA 1TMF2 2XGXA 2VOXA 2XVLA 2ZGPA 3B01A 2O8QA 3J7LA 4Y1UA 4URTA 1FPN1 4AQTA 2KM2A 4MADA 3ASIA 3DPRB 4NAMA 5C9AA 1JHNA 1UIKA 2HWD2 3NKTA 1TMF1 3PVNA 4WM7B 3WDUA 4D94A 3E6BA 1LEMA 3DYMA 5BUVA 2X5IB 2YZ4A 2R062 5E6HA 2IXIA 1N1SA 5T3NA 5IUQA 1SCRA 4XTPA 1SFPA 2OVUA 4LKSA 2HWD1 1T6BX 2YBKA 1PIV1 2EIEA 4BHPA 5FY9A 1UOFA 2Y6GA 5M0TA 2R061 4OHXA 5H9QA 4ASLA 4XETA 4TLGA 3M3EA 4EE2A 3DYOA 3CZUA 1OMIA 3FE5A 4UFJA 5IVVA 2D6MA 2PHTA 4CUGA 5DUXA 1YWKA 2RR13 4GZ9A 5FP9A 3VV1A 1OQDA 5JUVA 5EIYB 4N7IA 2E32A 1QQP3 2LUWA 1ZX5A 4LO4B 1CN1A 2YPDA 3MDPA 4LBLA 1S0JA 1ZNPA 4WM8A 1MVEA 2WIIB 5L7OB 2OZJA 2B9VA 2VVEA 2Z69A 3AK0A 1MZ6A 1GV9A 2ZGNA 3KQ4B 4Y5SA 3UL2A 3TEWA 3PL0A 2DCZA 5LK5A 1QJU2 5LA2A 4NUBA 4WVMA 2ZGSA 4PCRA 1ZZ9A 4LE3A 5A33A 1H1IA 3PVBB 5A7QA 2VMIA 2ZHKA 3TNPB 1O6UA 2PXJA 2XWBB 5DAVA 1C1FA 5E1RA 1QJU1 1VAMA 1GWLA 2A71A 2MEV3 4CU8A 3Q8FA 3FMGA 4XUPA 3M7AA 2WZ8A 3D5OA 1LOCA 1HV1A 5L9BA 1BK1A 2WO3A 4Y24A 1RUJ3 3MIDA 1MS3A 3BPSA 4LBOA 3BVCA 5BNPC 5FBZA 5FZ1A 2EXKA 3AMMA 3PU3A 3RMXA 1AR93 3U10A 2JDMA 4I30A 4OVEA 4P02B 3H0OA 4HT1T 5A6XA 2JG8A 1H8TC 5DAWA 1MS0A 5TSWA 4A6SA 2WWSA 1UYYA 1BQPA 4XCBA 3NJYA 1GICA 4X8PA 4H7MA 4P5HA 2DF7A 3WQBA 5C71A 1EV13 1UZVA 1O8SA 1M06G 2CTVA 5BNNA 4XQDA 3HBKA 5A3OA 5CNAA 4CDWB 2XB6C 2ZGTA 5LB6A 3I2JA 2ZGRA 3SEEA 1WD3A 1H2LA 4GWIA 2G19A 3SHRA 2VC9A 3NKGA 2ZMKA 5T5LA 3TN93 4OFGA 1ODMA 4OCTA 1NKGA 2WZPP 2KR2A 3N4MA 2QJVA 1DQ1A 1EUUA 2OA2A 2VH9A 5FZHA 1RJ8A 1F31A 1OURA 4LTAA 4KBZA 4AHXA 1VIWB 3MV11 4B3NA 3ZXKA 4M4PA 4ES9A 1XRUA 4NIDA 1AX1A 4A44A 5LCWL 4YWAA 1DZRA 2FCTA 2WS93 5SV8A 1Q8SA 4LPLA 5I8SA 4CRQA 4I2OA 4W65A 1LECA 1UY2A 4PT6A 4KGGA 3WW2A 3GZAA 2RR12 2ZGUA 4PLNA 2HH9A 1VJ2A 1ZRRA 3GDBA 1R093 4IL7A 5LATA 5B2GB 1QQP2 3A4UA 1HRV3 5FUIA 5A7NA 3CDZB 4LA2A 2ADEA 1E5IA 3LZZA 4UAPA 2RR11 2LALA 3B94A 1W8OA 1N47A 1AXYA 1GZCA 1W39A 3GM8A 3RDIA 3ZFGB 1K12A 4GKXA 1QQP1 4E8CA 1A8DA 2GH2A 2Q4SA 3IBMA 1FOD1 2GNDA 3A0KA 1JMUB 4XACA 4FPOB 3MLKA 3PTYA 4BDVB 1S0FA 3M3CA 4Y3OA 3C8XA 3ZSMA 5BV6A 2WO1A 1YNAA 3OOXA 5FYSA 5I0SA 3OBZA 4XDQA 3S5QA 2MEV2 1G9DA 2JIGA 2BU9A 4YVWC 5FZFA 3WINE 4XW3A 1CZTA 2GDFA 4AR2A 1RUJ2 1CJDA 1OPOA 2ZGQA 4EWAA 2ZMNA 5A3MA 2MEV1 4NE9A 4BM8A 2CWMA 1LJ7A 1PZ8A 2ZEXA 1W2AX 2QQIA 1AVBA 4FPYA 4C8DA 5GZFA 3OCPA 1RUG3 1RUJ1 4CEWC 5LA1A 1GUIA 5GALA 4B1MA 3ZSJA 1AR91 1COV3 1PO13 3K48A 2HBUA 1UX7A 2PFWA 3E6DA 1A8MA 1RUH3 4WVZA 4CXYA 1EV12 1W0OA 2XL9A 4ZZ8A 5FYIA 5DPNA 2ZEYA 4QX3A 4S2FA 4G9SB 2LM3A 5A70A 1AR62 2BDRA 3G6JB 2WNUA 1HW5A 3MICA 3NNLA 2YC4A 4J6GA 5FPZA 1OT5A 3VKLA 4DXSA 1S2EA 4KWJA 2I2SA 1EV11 3TN92 3T4VA 5J36A 4LBQB 1PHMA 4YARA 2IVJA 4LKFA 5GZGA 3VBSC 3RGBA 5JXHA 5I0UA 3OY8A 1GP4A 2GU9A 3AM2A 2YFUA 1RYYA 3QCWA 1W6NB 1LULA 2Y6LA 3TN91 4AOCA 2XBO3 3VGIA 4ZS3A 3VN4A 4AQSA 3V56A 2WQ8A 1LOEA 2NLRA 2YHJA 4JTNA 5DN2A 2WS92 4R9AA 3ENRA 3THPA 4AQ6A 4E2QA 4UT5A 5FMDA 2RDQA 4K9SA 1CIYA 4E2GA 4JKMA 3KGZA 5FZ4A 5AC93 4INDA 4QM8A 2RDNA 4CCEA 2C4XA 2Q8CA 3PVEA 2WS91 4YGCA 2K2SA 4GAZA 1R092 1IQAA 2DURA 1GQGA 4GD4A 1HRV2 3TNQA 2YXSA 2OPWA 3POYA 2O8OA 3IDCB 3LEGA 3K4DA 3VLBB 3WOGA 1L7RA 4ARXA 1EPWA 2H6CA 5CADA 5FOBB 4UW6A 3ZN6B 5CFCA 5JPNB 3PMEA 4CTEA 1APNA 1NQJA 2XWJB 2Z2SB 5T54A 4AQ2A 3AYEA 1LODA 3D0SA 1ND3B 5FIXA 1JYVA 3NNMA 4DINB 2VGDA 4YG0A 5FZLA 4QB2A 2QQLA 3CF6E 3FFQA 2VJXA 4IE7A 4QPYA 5LY2A 3VBHC 4AVVA 5HV4A 3RYRA 4UFHA 3CKHA 4D6QA 2BJSA 1DGRN 5J96B 2GSYA 5JXIA 3LA7A 4M3CB 4CU6A 4NIHA 1O3QA 4OZXA 1Q8PA 3KT4A 2JE8A 2Q5TA 2W68A 3TYJA 3DCQA 3WG4A 2D6PA 1NXMA 2GN3A 4CDQC 4ARYA 2BVVA 2A7AA 1S0CA 1WMFA 2JG9B 3ZFFB 4OQ8A 1RUG2 2D40A 5IVCA 3BI3A 2YBPA 2CDPA 3T0BA 3RI8A 5IHRA 1Y9MA 5EV7A 3FLTA 5FUNA 2PA7A 1COV2 1PO12 2YUEA 1WLDA 5A7WA 1JZ6A 2DUOA 1JYWA 1AR72 1VBD3 1RUH2 1KDMA 3KV9A 4UW3A 1SLAA 3RPQA 1LB2A 1RUG1 4CDUB 1S0EA 2R1DA 4XFIA 4PBPA 1COV1 1PO11 1WCDJ 4A6OA 4ES8A 2GP5A 1O4TA 3AJZA 2H0VA 1DZTA 2CNAA 2VMEA 1RUH1 4EROA 4C0HA 3ZYHA 1GMMA 1OQEA 4NHKA 5HXMA 4QAWA 3K2OA 1K5MC 3R4SA 4HZFA 2A6ZA 3U14A 2C1FA 4AFDA 3NAPC 1UKRA 3Q8AA 5T50A 4QPGC 4QKNA 2BBVA 4K6BA 4XC9A 2XBO2 1S55A 2BBAA 4PI0A 1ZRIA 1AXKA 1D4VB 1ULGA 2E7TA 2EIBA 3WNMA 5FTTC 4CEWA 4AAPA 1Q3EA 4LLOA 2VMDA 1DGWA 3FN9A 1DBNA 4AEDA 2XBO1 1S0GA 1ZA7A 4LHKA 4YM3A 1EYBA 5KHHA 5AC92 3OD0A 3OF1A 3RJ2X 3WF4A 3I2IA 2ILMA 4OI1A 2BQPA 4XZUG 3PJQA 1NLQA 3VKMA 3ZDVA 5CFDC 4BIFA 4GJZA 1LGBA 1WUVA 2Y8KA 4Y5Z0 5JSRA 2ARBA 1DZQA 2WA3A 1UYZA 5DUUA 4YZ1A 5AC91 1PM7A 3PDQA 2FD8A 2C6SA 4ONUA 1XYPA 3MIHA 5CISA 3VBSA 2ZGKA 2RJKA 2HWC2 1CAUB 4JV4A 4IEVA 1LOGA 5HV0A 4X6QB 1MR5A 3W58A 4Q4V3 4Q8KA 2Q8DA 1R1ZA 3BALA 2IZWA 1MZ5A 5LBCA 5H9RA 1F8VA 3U1XA 3WNLA 5FOJB 1KS5A 1W6OB 3KGLA 1G9CA 4LT5A 3ZN4A 4AW7A 4N53C 4YVSC 5FXWA 4F7ZA 2WINB 2P4EA 2OYZA 4R52A 5K0UA 4XJ9A 4Q27A 1O91A 4XQ4A 2E7QA 3B69A 4GMP0 3GJBA 4NPRA 5FK7A 1W3XA 1W9SA 1YI9A 3I2FA 2JECA 4O9GA 4HOOA 3VZNA 5EYXA 2D43A 4Q2FA 5BYNA 1XB9A 3RZLA 4D8MA 1ZVFA 4XCAA 1CAXA 1V6LA 5IATA 4BCUA 4PDWC 5FREA 1LGNA 1BEV3 1GR3A 1QOTA 1W6QA 3DL3A 5HCAA 2RS53 5IK7A 2Q1FA 3KHBA 3VKFC 2OS2A 4E9KA 1HJGA 4A7KA 1RGSA 2PQQA 3CU7A 3VBHA 3POFA 2DVFA 1WW5A 1VBD1 4QU2A 5FMOL 3AKSA 4LKEA 4UYBA 3N9MA 4X6RB 2P3IA 2OQ7A 2XLGA 3AMNA 4L2NA 1LR5A 2GAUA 4P9YA 5FJHA 4CP9B 2VQTA 4E8DA 2NM1A 3S30A 4UFKA 4XF9A 2W1QA 4YG3A 4AFCA 4CDQA 4ZU7A 5C8CB 4XJZA 3U11A 5FYMA 3H3ZA 3TBDA 5FMCA 1YFYA 3J4UH 5KC5A 1ZYBA 5HI0A 1D0HA 2X09A 3VZLA 1RXFA 3POBA 4GH4A 2P17A 5FPAA 3S0MA 1GOFA 1MACA 3RG0A 5C8WA 5I8YA 3V0BA 3HD8B 3LDKA 4GALA 2OZ6A 2AC1A 4GULA 4XAEA 5FYTA 5C4WC 4XYXA 2VL4A 5EPAA 3WX5A 3HNYM 3I3BA 2D6OX 1DF0A 3O7OA 1FX5A 1X33A 3WP6A 2VTXA 3SISA 5JWPA 2XVKA 3ACLA 5LW9A 4IXLA 5CKQA 2HWE3 1HRI3 1XYNA 1K5MA 4HSLA 1MS1A 4XMIA 3H50A 3QACA 4F3JA 3CHXA 5LY1A 5T52A 4QHZA 2P3JA 4ASKA 5KC6A 1AZDA 1KGYA 3LDRA 2DVDA 3CJIB 2B46X 2DTWA 4Q4V2 1QKQA 2C9AA 5A3NA 1OH3A 4P14A 2CGPA 1O3SA 4NPLA 1YFUA 4JGYC 5C3QA 1LOFC 5F5QA 1D2SA 2Q1MA 3L2YA 5FXXA 2WO2A 1L3JA 2JIJA 4Q4V1 3UYJA 4EYUA 4AGVA 5ABJA 5D1IA 4QX7A 4L11A 1REFA 4CEYB 3ZYFA 1D7PM 5CFDA 1B35A 1C57A 3JXSA 1NCRB 2ZHMA 5F8PA 1RUE1 4XBLA 4W8JA 3DN7A 5JXJA 4IETA 3ZR5A 4BJ0A 3PUQA 2BOIA 2ZX3A 1F5FA 4QQOA 5AVAA 3VD7A 1IPKA 2EAAA 5CB7A 1LGCA 4CSWA 1V9U1 3AVSA 2R0FA 2DV9A 4HL0A 1I9RA 1ZZBA 4ZY9A 1H6XA 4AWDA 3T2PA 1Y3TA 1BEV2 4KL1A 2RS52 2CAUA 1MS4A 1N1YA 3FFZA 4YW6A 1GZWB 2J42A 2E51A 2GC2A 2Y34A 2GALA 1GNHA 4NRQA 2NP0A 2GC0A 3P5BA 4FI9A 1ULCA 1BEV1 5GLWA 2ZEZA 1MZEA 3AP6A 5L36A 3I2DA 3I4IA 5FY1A 4AK3A 4CCJA 1PGL2 1BHGA 3JD72 2Z4FA 4IEWA 4PI2A 3ZKYA 3FHAA 4YW4A 4B4RA 1U5XA 3S7IA 1DQ5A 2V09A 3K46A 4H2AA 4PLMA 4AI9A 2WAAA 4DRRA 1PGL1 1YEWA 2YY1A 3POWA 3S5AA 5I0DA 2EVXA 1ULDA 3BU0A 3U07A 2P1BA 4BLIA 2W95A 3P3PA 2WJSA 4RS5B 1ASJ3 4E4HA 4FXKB 3LIGA 1NA1C 4M0HA 1UU5A 4IEZA 4PDWA 2VZ1A 4MH0E 1KFXL 4FFIA 3AL6A 2E6VA 4MGYE 3ZSEA 2DCYA 2DU1A 1DYPA 3R4DB 5JPMB 3O1RA 1YIFA 3TEYA 2EAKA 2X29A 4RQPB 1SLBA 2VAUA 2W46A 3KCXA 4LMFA 2QQOA 2PAEA 4IEXA 4AI0A 1OVPA 3GZUC 1NT0A 5FYUA 2HWE2 1HRI2 1EY2A 5FZKA 1OLMA 4MGSA 2QBXA 2PTMA 3LEIA 2AEYA 2GMMA 1GOHA 4D7SA 2C5DA 3NV3A 2VUDA 3AKRA 4GQ7A 1HRI1 2R0HA 3NJVA 2XHKA 1OOPB 4C1WA 1X7NA 3MIBA 4Q1PA 2UYAA 4XUOA 4EWDA 2B7YA 3WXPA 1ENQA 4WV8A 1K45A 5FZ7A 5LBBA 2HWF3 3TAYA 1FPN3 2IWGB 2PHWA 2R1BA 3FLRA 3ALQA 4QX1A 5EFUA 3B5LB 3HIFA 2XHNA 3VBUB 2WNVB 3POJA 1PNGA 1WCUA 4QPIA 4IE4A 4JGZB 1NCQA 2JDNA 2WT0A 4M01A 2O14A 2Q0AA 1X36A 3C2UA 5FZBA 5F2SA 4GWJA 4QDRA 4KH9A
chains in the Genus database with same CATH topology
2WO3A 1CX1A 2C9KA 3MV01 4P02B 2VCAA 4LQRA 1UYYA 3ACHA 3VD3A 1GNYA 3WEZA 4MOAA 1PMJX 3K77A 1UMHA 3OGSA 1DLCA 3WQBA 5C71A 1O8SA 1ULOA 2YC2A 3NJXA 3T0AA 1TG7A 1UXZA 2R7EB 3I2JA 3SEEA 4GWIA 3E1F1 2OKXA 2VC9A 2J1EA 3PUHA 1NKGA 2QQKA 4RYDA 3U37A 1W9WA 1EUUA 2BGOA 1PX4A 4CUBA 5HPOA 3NRUA 1UXXX 3C7GA 3GXUA 3MV11 4M4PA 2WABA 4A44A 5LCWL 3P6BA 4QX2A 2E33A 2QQNA 4LPLA 2EICA 1JI6A 1UY2A 4YPJA 4PT6A 2C26A 3SEPA 4ZZ5A 1UYXA 2RV9A 3GDBA 4BXSV 3IB3A 5FUIA 3CDZB 4UAPA 1UY0A 2W3JA 3OGRA 3WNKA 1W8OA 4P08A 3GM8A 1K3IA 3WF2A 3BN6A 1K12A 2WBKA 5IJRA 4E8CA 4OYUA 2W1SA 1XNTA 2X10A 2W1UA 2VZUA 2ORXA 3LPFA 4BDVB 1UY3A 2J1UA 3C8XA 2WO1A 3ECQA 3K75B 2CDOA 3T2OA 1W9TA 3I2KA 4JHZA 1CZTA 4W4ZA 3I3EA 3C7EA 3LEKA 2XOMA 3K4ZA 5IFTA 2ZEXA 2QQIA 3A21A 3MO4A 5LA1A 1GUIA 2V72A 1R64A 1SDDB 4DEVA 4JX0A 2XONA 1UX7A 2VZVA 2X05A 1JZ3A 2W87A 4QB1A 4ZZ8A 4A42A 5DPNA 2ZEYA 4QX3A 1H6YA 1JZ8A 4D0QA 2YC4A 1OT5A 4DXSA 3IAQA 2VOTA 3HNBM 3AC0A 3MUZ1 5DMYA 1W0NA 4HG6B 5JXHA 1OD3A 2PQSA 3HJRA 2YFUA 1RYYA 2DDUA 3WNPA 2Y6LA 2J1SA 2HLEA 4CU7A 2WQ8A 5DN2A 1TVGA 4DUXA 2VZRA 2BGPA 1CIYA 2VM9A 4JKMA 1K42A 3WF1A 2C4XA 5A1AA 4PQQA 2RJ2A 1JYNA 1NUKA 4TXWA 3LEGA 3K4DA 4ARXA 1L7RA 2JDAA 2WZEA 2VZOA 3ZM8A 4QPWA 3THCA 4W50A 2ZEWA 1P8JA 1JYVA 1US3A 2WN3A 4QB2A 2BZDA 2QQLA 3T09A 2VJXA 4XURA 3CKHA 3SKVA 1CZVA 3DECA 2J1AA 5JXIA 2YFZA 1PX3A 4CU6A 2JE8A 5G05L 1DP0A 4IUGA 4UI9L 2W1WA 3LE0A 4ARYA 3IDAA 4P00B 2CDPA 3T0BA 3LPGA 5IHRA 4XUNA 2J7MA 1OF3A 3NNGA 1JZ6A 1JYWA 3OEBA 4A41A 2Y64A 3J7HA 3HOBA 3CQOA 4MO3M 2W47A 5B4XA 4A6OA 4RN5A 2VMEA 1F4AA 1GMMA 1UZ0A 5HXMA 2WN2A 3ABZA 4QAWA 1EUTA 2Y6HA 4CUAA 1UMIA 1IQDC 2ORZA 3WF3A 3ACFA 3ETPA 2BBAA 4DEQA 3WNMA 2EIBA 5J1XA 2ZXQA 5C70A 3HNMA 3OGVA 3UNPA 4QDQA 2VMDA 3FN9A 3P1IA 3EB7A 4JKKA 3WF4A 4XUTA 2KD7A 3I2IA 4DXTA 3HEIA 2XQXA 4XZUG 4XUQA 4MGQA 1F4HA 2JKXA 1WKYA 2Y8KA 1UYZA 4DXRA 3I97A 3SKJE 1NX9A 4JKLA 1SG3A 5CYYA 4OMDA 1W99A 2J1RA 3A23A 2VR4A 2VTFA 5EJZB 4QB6A 3UESA 4OUEA 3W5NA 1KEXA 1GU3A 3IIIA 3UETA 3C7OA 3VD5A 3A7QA 3WNOA 1US2A 2YG0A 1OF4A 2W91A 3WNLA 4Z2AA 2LS6A 3OBAA 3DYPA 2WAOA 2B4KA 3F2ZA 2W92A 2VQUA 2W5FA 4XVHA 1W9SA 2WDBA 5CZKA 3I2FA 3IAPA 3ACGA 3NQHA 4A45A 3WF0A 4D8MA 4UOJA 1J84A 1JU3A 1JU4A 5LA0A 1XPWA 1NAEA 3FL7A 4QX0A 5C7GA 3OEAA 1JZ5A 3CIHA 1WCQA 1J83A 4E8DA 2VQTA 2V5DA 3WNNA 2VCCA 3MBWA 5F7UA 2QQJA 2E31A 2W9XA 2W94A 4KMQA 2W1QA 4CVUA 2VMFA 5JMOA 1XNAA 4QDSA 4OZOA 4AAXA 4BK4A 2X09A 2RVAA 1GOFA 3VDAA 3I2HA 3PUIA 4KI5M 4ZXEA 4DUWA 2VL4A 4OMCA 4PF1A 2VZSA 3HNYM 3I3BA 4BK5A 2VCBA 2L9LA 1T2XA 1ULPA 1O8PA 1UY1A 1CZSA 4AG4A 3CMGA 1KGYA 1W8NA 3C7HA 2DCKA 3VD4A 3C7FA 1OH4A 2J22A 2VZ3A 2J1TA 2WO2A 1JZ7A 5IFPA 2VZTA 1UWWA 4L0PA 1O59A 3FHQA 1JZ2A 1D7PM 2DCJA 1JYXA 3JXSA 3W5MA 4LHSA 3LQCA 3BGAA 4CUCA 4W8JA 5JXJA 4BJ0A 2WYSA 1JZ4A 1GQPA 1L7QA 3VD7A 4ZY9A 1H6XA 2VZQA 1UY4A 3T2PA 5EJ1B 5B4NA 4P5YA 4CU9A 1PMHX 3K4AA 3HPNA 2JD9A 2WUHA 4TTGA 4FI9A 3MUY1 3HN3A 5IYYA 2ZEZA 2J1VA 1HN1A 3THDA 1BHGA 2Z4FA 2VMCA 1DYOA 3FHAA 3D3AA 3WSOA 5G04L 3K46A 4MADA 2WAAA 1SHWB 1I5PA 2Y6KA 5I0DA 5JXGA 3T2QA 3VDBA 2W95A 2BERA 3DYMA 2Y6JA 1LNSA 4LKSA 3T0DA 2VZ1A 2LW8A 2VO5A 2EIEA 2Y6GA 3I2GA 3DYOA 3CZUA 3I3DA 2YB7A 2W46A 5JR2A 4GZ9A 4M4RA 2QQOA 3OB8A 3A22A 1JHJA 5JUVA 5EIYB 2E32A 4MGSA 2QBXA 2VZPA 3LEIA 2QQMA 2B9VA 1GOHA 1MPXA 4A3ZA 3NJVA 1XC6A 2V4VA 3EYPA 3VDCA 2HYXA 3VD9A 5LA2A 3T08A 4ET7A 3ACIA 4XUOA 3CZJA 1K45A 1YQ2A 2E26A 2ID4A 4QX1A 4DUVA 2XHNA 5DQ0A 3OG2A 4A4AA 2EIDA 4CU8A 3GGLA 4XUPA 2WZ8A 4KWUA 1GOGA 4GWJA 4QDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO3 A;  1CX1 A;  2C9K A;  3MV0 1;  4P02 B;  2VCA A;  4LQR A;  1UYY A;  3ACH A;  3VD3 A;  1GNY A;  3WEZ A;  4MOA A;  1PMJ X;  3K77 A;  1UMH A;  3OGS A;  1DLC A;  3WQB A;  5C71 A;  1O8S A;  1ULO A;  2YC2 A;  3NJX A;  3T0A A;  1TG7 A;  1UXZ A;  2R7E B;  3I2J A;  3SEE A;  4GWI A;  3E1F 1;  2OKX A;  2VC9 A;  2J1E A;  3PUH A;  1NKG A;  2QQK A;  4RYD A;  3U37 A;  1W9W A;  1EUU A;  2BGO A;  1PX4 A;  4CUB A;  5HPO A;  3NRU A;  1UXX X;  3C7G A;  3GXU A;  3MV1 1;  4M4P A;  2WAB A;  4A44 A;  5LCW L;  3P6B A;  4QX2 A;  2E33 A;  2QQN A;  4LPL A;  2EIC A;  1JI6 A;  1UY2 A;  4YPJ A;  4PT6 A;  2C26 A;  3SEP A;  4ZZ5 A;  1UYX A;  2RV9 A;  3GDB A;  4BXS V;  3IB3 A;  5FUI A;  3CDZ B;  4UAP A;  1UY0 A;  2W3J A;  3OGR A;  3WNK A;  1W8O A;  4P08 A;  3GM8 A;  1K3I A;  3WF2 A;  3BN6 A;  1K12 A;  2WBK A;  5IJR A;  4E8C A;  4OYU A;  2W1S A;  1XNT A;  2X10 A;  2W1U A;  2VZU A;  2ORX A;  3LPF A;  4BDV B;  1UY3 A;  2J1U A;  3C8X A;  2WO1 A;  3ECQ A;  3K75 B;  2CDO A;  3T2O A;  1W9T A;  3I2K A;  4JHZ A;  1CZT A;  4W4Z A;  3I3E A;  3C7E A;  3LEK A;  2XOM A;  3K4Z A;  5IFT A;  2ZEX A;  2QQI A;  3A21 A;  3MO4 A;  5LA1 A;  1GUI A;  2V72 A;  1R64 A;  1SDD B;  4DEV A;  4JX0 A;  2XON A;  1UX7 A;  2VZV A;  2X05 A;  1JZ3 A;  2W87 A;  4QB1 A;  4ZZ8 A;  4A42 A;  5DPN A;  2ZEY A;  4QX3 A;  1H6Y A;  1JZ8 A;  4D0Q A;  2YC4 A;  1OT5 A;  4DXS A;  3IAQ A;  2VOT A;  3HNB M;  3AC0 A;  3MUZ 1;  5DMY A;  1W0N A;  4HG6 B;  5JXH A;  1OD3 A;  2PQS A;  3HJR A;  2YFU A;  1RYY A;  2DDU A;  3WNP A;  2Y6L A;  2J1S A;  2HLE A;  4CU7 A;  2WQ8 A;  5DN2 A;  1TVG A;  4DUX A;  2VZR A;  2BGP A;  1CIY A;  2VM9 A;  4JKM A;  1K42 A;  3WF1 A;  2C4X A;  5A1A A;  4PQQ A;  2RJ2 A;  1JYN A;  1NUK A;  4TXW A;  3LEG A;  3K4D A;  4ARX A;  1L7R A;  2JDA A;  2WZE A;  2VZO A;  3ZM8 A;  4QPW A;  3THC A;  4W50 A;  2ZEW A;  1P8J A;  1JYV A;  1US3 A;  2WN3 A;  4QB2 A;  2BZD A;  2QQL A;  3T09 A;  2VJX A;  4XUR A;  3CKH A;  3SKV A;  1CZV A;  3DEC A;  2J1A A;  5JXI A;  2YFZ A;  1PX3 A;  4CU6 A;  2JE8 A;  5G05 L;  1DP0 A;  4IUG A;  4UI9 L;  2W1W A;  3LE0 A;  4ARY A;  3IDA A;  4P00 B;  2CDP A;  3T0B A;  3LPG A;  5IHR A;  4XUN A;  2J7M A;  1OF3 A;  3NNG A;  1JZ6 A;  1JYW A;  3OEB A;  4A41 A;  2Y64 A;  3J7H A;  3HOB A;  3CQO A;  4MO3 M;  2W47 A;  5B4X A;  4A6O A;  4RN5 A;  2VME A;  1F4A A;  1GMM A;  1UZ0 A;  5HXM A;  2WN2 A;  3ABZ A;  4QAW A;  1EUT A;  2Y6H A;  4CUA A;  1UMI A;  1IQD C;  2ORZ A;  3WF3 A;  3ACF A;  3ETP A;  2BBA A;  4DEQ A;  3WNM A;  2EIB A;  5J1X A;  2ZXQ A;  5C70 A;  3HNM A;  3OGV A;  3UNP A;  4QDQ A;  2VMD A;  3FN9 A;  3P1I A;  3EB7 A;  4JKK A;  3WF4 A;  4XUT A;  2KD7 A;  3I2I A;  4DXT A;  3HEI A;  2XQX A;  4XZU G;  4XUQ A;  4MGQ A;  1F4H A;  2JKX A;  1WKY A;  2Y8K A;  1UYZ A;  4DXR A;  3I97 A;  3SKJ E;  1NX9 A;  4JKL A;  1SG3 A;  5CYY A;  4OMD A;  1W99 A;  2J1R A;  3A23 A;  2VR4 A;  2VTF A;  5EJZ B;  4QB6 A;  3UES A;  4OUE A;  3W5N A;  1KEX A;  1GU3 A;  3III A;  3UET A;  3C7O A;  3VD5 A;  3A7Q A;  3WNO A;  1US2 A;  2YG0 A;  1OF4 A;  2W91 A;  3WNL A;  4Z2A A;  2LS6 A;  3OBA A;  3DYP A;  2WAO A;  2B4K A;  3F2Z A;  2W92 A;  2VQU A;  2W5F A;  4XVH A;  1W9S A;  2WDB A;  5CZK A;  3I2F A;  3IAP A;  3ACG A;  3NQH A;  4A45 A;  3WF0 A;  4D8M A;  4UOJ A;  1J84 A;  1JU3 A;  1JU4 A;  5LA0 A;  1XPW A;  1NAE A;  3FL7 A;  4QX0 A;  5C7G A;  3OEA A;  1JZ5 A;  3CIH A;  1WCQ A;  1J83 A;  4E8D A;  2VQT A;  2V5D A;  3WNN A;  2VCC A;  3MBW A;  5F7U A;  2QQJ A;  2E31 A;  2W9X A;  2W94 A;  4KMQ A;  2W1Q A;  4CVU A;  2VMF A;  5JMO A;  1XNA A;  4QDS A;  4OZO A;  4AAX A;  4BK4 A;  2X09 A;  2RVA A;  1GOF A;  3VDA A;  3I2H A;  3PUI A;  4KI5 M;  4ZXE A;  4DUW A;  2VL4 A;  4OMC A;  4PF1 A;  2VZS A;  3HNY M;  3I3B A;  4BK5 A;  2VCB A;  2L9L A;  1T2X A;  1ULP A;  1O8P A;  1UY1 A;  1CZS A;  4AG4 A;  3CMG A;  1KGY A;  1W8N A;  3C7H A;  2DCK A;  3VD4 A;  3C7F A;  1OH4 A;  2J22 A;  2VZ3 A;  2J1T A;  2WO2 A;  1JZ7 A;  5IFP A;  2VZT A;  1UWW A;  4L0P A;  1O59 A;  3FHQ A;  1JZ2 A;  1D7P M;  2DCJ A;  1JYX A;  3JXS A;  3W5M A;  4LHS A;  3LQC A;  3BGA A;  4CUC A;  4W8J A;  5JXJ A;  4BJ0 A;  2WYS A;  1JZ4 A;  1GQP A;  1L7Q A;  3VD7 A;  4ZY9 A;  1H6X A;  2VZQ A;  1UY4 A;  3T2P A;  5EJ1 B;  5B4N A;  4P5Y A;  4CU9 A;  1PMH X;  3K4A A;  3HPN A;  2JD9 A;  2WUH A;  4TTG A;  4FI9 A;  3MUY 1;  3HN3 A;  5IYY A;  2ZEZ A;  2J1V A;  1HN1 A;  3THD A;  1BHG A;  2Z4F A;  2VMC A;  1DYO A;  3FHA A;  3D3A A;  3WSO A;  5G04 L;  3K46 A;  4MAD A;  2WAA A;  1SHW B;  1I5P A;  2Y6K A;  5I0D A;  5JXG A;  3T2Q A;  3VDB A;  2W95 A;  2BER A;  3DYM A;  2Y6J A;  1LNS A;  4LKS A;  3T0D A;  2VZ1 A;  2LW8 A;  2VO5 A;  2EIE A;  2Y6G A;  3I2G A;  3DYO A;  3CZU A;  3I3D A;  2YB7 A;  2W46 A;  5JR2 A;  4GZ9 A;  4M4R A;  2QQO A;  3OB8 A;  3A22 A;  1JHJ A;  5JUV A;  5EIY B;  2E32 A;  4MGS A;  2QBX A;  2VZP A;  3LEI A;  2QQM A;  2B9V A;  1GOH A;  1MPX A;  4A3Z A;  3NJV A;  1XC6 A;  2V4V A;  3EYP A;  3VDC A;  2HYX A;  3VD9 A;  5LA2 A;  3T08 A;  4ET7 A;  3ACI A;  4XUO A;  3CZJ A;  1K45 A;  1YQ2 A;  2E26 A;  2ID4 A;  4QX1 A;  4DUV A;  2XHN A;  5DQ0 A;  3OG2 A;  4A4A A;  2EID A;  4CU8 A;  3GGL A;  4XUP A;  2WZ8 A;  4KWU A;  1GOG A;  4GWJ A;  4QDR A; 
#chains in the Genus database with same CATH topology
 2IXC A;  1CX1 A;  5EQU A;  2VE1 A;  2C9K A;  3NJZ A;  1H2K A;  3MV0 1;  1ND2 A;  3NV4 A;  1SAC A;  2FDJ A;  4B4P A;  4MXW A;  1QH6 A;  4LOR A;  4K8F A;  5A6Q A;  5JI7 A;  1HB2 A;  1DDL A;  2ZHL A;  2ZOE B;  2R07 3;  3VD3 A;  1SEF A;  1LED A;  2C0Z A;  4FPK A;  3ZXJ A;  3WEZ A;  4MOA A;  5FQ0 A;  3BTZ A;  3VHN A;  5C9A B;  1G9B A;  2VVF A;  3K77 A;  1W90 A;  3OGS A;  3WDX A;  4D6S A;  3AMQ A;  3BB6 A;  1W8F A;  2IXJ A;  4N90 A;  2A5Z A;  4QXB A;  4CDX B;  5LBE A;  3NJX A;  1IPS A;  1BBT 2;  4XDP A;  1SFN A;  4YW7 A;  2E7A A;  2RJL A;  1V0A A;  5FP3 A;  3KCC A;  1RIT A;  2D93 A;  3E1F 1;  1O7F A;  4JRL A;  2J1E A;  3WP5 A;  2FZ1 A;  1RTV A;  2E9Q A;  2QQK A;  4XFH A;  3AXE A;  3U37 A;  4OHW A;  3I2O A;  3CJX A;  1W9F A;  3VL9 A;  1PX4 A;  5FPX A;  4L97 A;  1UXX X;  3GCW A;  5FK8 A;  3VHP A;  1ASJ 2;  3HQX A;  3J7N A;  2WAB A;  4WM8 B;  4YNI A;  1BVV A;  1XNC A;  5GZC A;  2GZW A;  4M3C F;  4CXX A;  4MHU A;  5FZO B;  3FBY A;  5JZG C;  1REE A;  3P6B A;  4QX2 A;  2QQN A;  1ASJ 1;  1JI6 A;  1QJX 3;  1H9W A;  1L7L A;  4WVM B;  3UGH A;  2ZHN A;  4DRV A;  1W3V A;  1S2B A;  4H3W A;  3U4X A;  2RV9 A;  4K1Z A;  1LHV A;  1PGS A;  3R0R A;  3CL1 A;  4LK7 A;  2ZX4 A;  3SIT A;  2ES3 A;  1HIX A;  4AXO A;  3DPR C;  3IB3 A;  4WM7 C;  2ZKN A;  5FR3 A;  2ETE A;  2HKX A;  5BXX A;  1UY0 A;  4P08 A;  3WF2 A;  2X5I C;  3BN6 A;  1O4Y A;  3GHN A;  1PO2 3;  1WCK A;  1C4R A;  2W1U A;  3WY6 A;  4OI4 A;  3UV9 A;  5IVB A;  3B9I A;  4C91 A;  1IZ3 A;  4OHZ A;  1UY3 A;  1FPN 2;  2JG8 B;  2VNO A;  1XYO A;  2ZA9 A;  3I8T A;  4JCK A;  3I59 A;  3EO6 A;  3IMN A;  4FPJ A;  1XND A;  4XFC A;  3T2O A;  4BQX A;  3LEM A;  3PVO A;  2SLI A;  3I2K A;  5FLH A;  4RHV 3;  2D3S A;  2HWF 1;  4RD7 A;  1JTZ X;  2OT7 A;  4NRO A;  2HJI A;  4RGK A;  4XEZ A;  2CAV A;  5BNN B;  4W4Z A;  5L7O C;  1PIV 2;  4OUL A;  2ARE A;  2XOM A;  3LEK A;  2YRO A;  3K4Z A;  3KM5 A;  3FBM A;  4M0N A;  5IFT A;  3Q8E A;  5AFB A;  2R07 2;  5F3E A;  3RQ0 A;  1GSL A;  1R64 A;  1SDD B;  3BTA A;  4HSJ A;  5A32 A;  4JX0 A;  2XON A;  5JLV A;  1HDK A;  3IDE A;  1U5Y A;  1SZB A;  2VZV A;  5I0R A;  3POI A;  4P9G A;  3Q8B A;  2X05 A;  5CEH A;  1JZ3 A;  2R07 1;  4A42 A;  1QU0 A;  4AVC A;  5FXV A;  3O14 A;  4LHL A;  2LRO A;  4LXL A;  1KJL A;  3M4F A;  1FOD 3;  1IGO A;  3IAQ A;  4TYS A;  2N7G A;  3CO2 A;  3HWJ A;  1LHU A;  2KA3 A;  2PHF A;  1D0G A;  2RS3 3;  4OUM A;  4GKY A;  3UT0 A;  3RYP A;  2V73 A;  4YM0 A;  5H9S A;  5IT6 A;  1Q5O A;  2VCM A;  4FOV A;  2PQS A;  3ILR A;  2DDU A;  1LU1 A;  3GYD A;  2VOK A;  1AYM 3;  4Z1V A;  5IW0 A;  4B7E A;  4XAB A;  3ZFE A;  1PK6 B;  2HEY F;  3O5S A;  4V2W A;  1TVG A;  1YC6 1;  4DUX A;  1CR7 A;  4NR1 A;  2BTV C;  1HQL A;  1K5J A;  1G86 A;  1QJX 2;  4CDW C;  1RHI 3;  4XE9 A;  5BY5 A;  4L9B A;  3TOJ A;  3JBG 3;  4L99 A;  2D6N A;  3ILF A;  4KU7 A;  5IAV A;  1FYU A;  1VBA 3;  2BWA A;  1DQ6 A;  1OA4 A;  4CA9 A;  2DFC A;  3DUI A;  4MGT A;  2JEM A;  4Y26 A;  3GNE A;  3AKP A;  2GNB A;  1QJX 1;  4QU1 A;  4MG2 A;  1AL0 G;  2EA7 A;  3HBZ A;  3GJA A;  4LIU A;  4ZON A;  4DQA A;  3FUQ A;  1DQ0 A;  4UW4 A;  1QJY 3;  4N43 A;  2Q8E A;  2W39 A;  2AEZ A;  5D8A A;  4CP0 A;  3T1M A;  2JDU A;  2VZO A;  1VP6 A;  3KMH A;  2R16 A;  2Y0O A;  3WDV A;  5BNO A;  3THC A;  5FMB A;  4RR3 A;  1XE8 A;  4LUM A;  4Q4X 3;  1PO2 2;  2IC1 A;  1P8J A;  2MNG A;  1W6P A;  2PEL A;  1US3 A;  5DAP A;  3KVB A;  4G3Y C;  4NHM A;  1A3K A;  1RL3 A;  2BOJ A;  4YGD A;  2BZD A;  4YW5 A;  3T09 A;  3WHU A;  3K3N A;  4NRP A;  1PO2 1;  3BIW E;  3S57 A;  1A78 A;  2Z5W A;  3DEC A;  2EXI A;  3LF7 A;  3USU A;  1HXS 3;  2ZCW A;  3LCP A;  2YFZ A;  1DIW A;  3MPB A;  1ZM1 A;  1BYH A;  2H6B A;  2TNF A;  1GWM A;  3RZK A;  3DEM A;  3LB9 A;  1RUI 3;  2AR6 A;  2ZAH A;  3IKW A;  1W03 A;  2WNU B;  4RHV 1;  2WWU A;  3LE0 A;  3ZFG C;  4YZ5 A;  5A1L A;  2BVB A;  4WM7 A;  3VBF B;  2XDV A;  1ZBE 3;  3LPG A;  5FY4 A;  5FY8 A;  1UOB A;  4FXG B;  3JQX A;  3ZN5 A;  4GB3 3;  1OLR A;  4S2H A;  3H3L A;  4COW A;  3OEB A;  1MQT B;  1QF3 A;  2HEW F;  4V1P A;  5JOZ A;  1W06 A;  3AMP A;  3HOB A;  2V4A A;  4EN0 A;  4MO3 M;  4NAO A;  5B4X A;  3AP4 A;  2TEP A;  1FOD 2;  1W2N A;  1WW6 A;  2PN5 A;  3KF3 A;  4N9I A;  3SNM A;  3ZPO A;  1F4A A;  1UZ0 A;  4DIQ A;  2RS3 2;  5C3S A;  2WN2 A;  5FDB A;  1CWP A;  2Y6H A;  3OTF A;  2NPI A;  4XJA A;  1U5Z A;  4XHB A;  2YDE A;  3ACF A;  3USS A;  1AYM 2;  3ETP A;  2RS3 1;  4H7L A;  3POS A;  5IK4 A;  4IV3 B;  2FMY A;  4X8N A;  2ZXQ A;  5K4L A;  2VOV A;  3HNM A;  3OGV A;  5CFC B;  5CG9 A;  5FZ3 A;  3UNP A;  2YGL A;  1AYM 1;  3QBQ A;  2RM2 3;  1I3H A;  2DVA A;  4WZC A;  1RHI 2;  2R6Q A;  4YZ4 A;  1TNF A;  1OFN A;  5FAX A;  4BH9 A;  5DUV A;  1QGL A;  2D6L X;  3JBG 2;  3N36 A;  3VHO A;  4XUT A;  2KD7 A;  1VBA 2;  3GHM A;  1GKB A;  2CHH A;  3D8C A;  2XQX A;  3HEI A;  4W6W A;  2A6W A;  1AR9 2;  5DUW A;  3T2T A;  4E2S A;  1F4H A;  2GC1 A;  4BQ4 A;  1RHI 1;  4D7T A;  5K9Y A;  3E97 A;  2CV6 A;  3JBG 1;  4Q0V A;  1QJY 2;  1OLM E;  1UZZ A;  1VBA 1;  1BZW A;  1AUY A;  4FFG A;  3WDW A;  1NX9 A;  4AGG A;  4AVT A;  5LEJ A;  4JKL A;  1SG3 A;  2UY9 A;  5CYY A;  2AZ5 A;  2PHX A;  3OUI A;  4Q26 A;  2CSG A;  1CPM A;  3A23 A;  4Q4X 2;  2VR4 A;  1TE1 B;  1VBC 1;  2VQ0 A;  3Q8C A;  3UES A;  4OUE A;  1QJY 1;  3N9N A;  2OXB A;  1SLL A;  4URA A;  1NG0 A;  2W52 A;  4LR4 A;  5KHJ A;  1KEX A;  3LKJ A;  1S0I A;  2BWC A;  3UET A;  1IS4 A;  1Y4W A;  4YG6 A;  1DQ2 A;  4FOW A;  3KD4 A;  4Q4X 1;  3A7Q A;  1QIQ A;  1G9F A;  3MW3 A;  3WNO A;  2D3P A;  2D98 A;  3OUH A;  4MVT A;  1HXS 2;  3ZIX A;  4D3W A;  3ELN A;  3M3O A;  5A7W B;  4YFW A;  3IZO A;  1X9P A;  2B4K A;  2QUO A;  4PBO A;  1BVP 1;  4HVQ A;  5FXZ A;  1MEC 3;  1RUI 2;  1EP0 A;  2DBN A;  4O65 A;  5BNP A;  2GN7 A;  1HXS 1;  1JW6 A;  5C3P A;  2WDB A;  3TRS B;  1YHF A;  5D2A A;  2O0O A;  3PUS A;  4KWL A;  1OPM A;  5LRS A;  3AFK A;  3LA3 A;  5H9P A;  3D0J A;  1H8T A;  4QX5 A;  4EJR A;  1H0B A;  2EXH A;  1E57 A;  1ND3 C;  2XML A;  4B8E A;  5CBL A;  4AEM A;  1RUI 1;  1ZBE 2;  3DKW A;  3LFI A;  2OII A;  4FT8 A;  4Z8B A;  3B00 A;  1FI2 A;  1QDC A;  2EF6 A;  2RHP A;  4GB3 2;  5FRA A;  5ISL A;  1ZZ6 A;  1JOP A;  3ZYG A;  1J84 A;  2GNM A;  1JU3 A;  4KWK A;  4WBB A;  4XFB A;  3SMH A;  4BIS A;  5LA0 A;  1IOA A;  1ZBE 1;  1BK0 A;  3HMY A;  1RC6 A;  3SH4 A;  2BGC A;  1NAE A;  4S2D A;  1W04 A;  2WSV A;  4I0B A;  4GB3 1;  4N9H A;  3O0W A;  1CAW B;  1LCL A;  2YPJ A;  2ZZJ A;  4PIY A;  4ZXK A;  4XIO A;  4AED B;  3MYX A;  4OLL A;  5DZE A;  4XBQ A;  1CX4 A;  2UUR A;  4OHV A;  4NOT A;  3U75 A;  3WNN A;  2XR4 A;  1PNF A;  4FSJ A;  3H3U A;  4LBJ A;  2JG9 C;  3ZFF C;  2LRP A;  3AFG A;  4XXP A;  1GZT A;  4CP1 A;  5JMO A;  4CVU A;  4MLO A;  4JRA A;  3FUO A;  3H8U A;  3ITQ A;  1W2O A;  1CON A;  3JU9 A;  4OZO A;  5A7O A;  4YGE A;  4AAX A;  1YIP A;  4RSU A;  3JUU A;  3H8O A;  5F39 A;  2EXJ A;  2IUW A;  1WW7 A;  4CDU C;  2RM2 2;  3KB5 A;  4Q5O A;  2RVA A;  2XLF A;  4IGO A;  2Y6F A;  4QHB A;  4XJ8 A;  2P2K A;  1SDW A;  4XTM A;  4L8Q A;  3ST7 A;  1ZBA 1;  1SLC A;  2EIG A;  1QJF A;  5BPX A;  3PUI A;  3GBF A;  3RZG A;  1Y9G A;  1AX2 A;  3NNJ A;  1N3O A;  4OMC A;  2RM2 1;  3HR9 A;  5KXE A;  1OFS A;  4GA9 A;  1FAT A;  4IE5 A;  5L9V A;  2L9L A;  1UYP A;  3LD8 A;  2IVI B;  4FFF A;  1VBE 3;  1T2X A;  3KV6 A;  3OBR A;  4FOY A;  1GYK A;  4FP2 A;  4QQH A;  4I3P A;  4SLI A;  2WC2 A;  4BYY A;  1EPZ A;  2Y33 A;  1ULP A;  4GWN A;  5K0U B;  1XNK A;  1V6K A;  3AZX A;  3N9P A;  3VZK A;  1JOD A;  1R1A 3;  2VNV A;  1Y9Q A;  4FP3 A;  4GIQ A;  3RWK X;  2ERF A;  1J1T A;  1OH4 A;  5C5U A;  1FXZ A;  1VAL A;  2J22 A;  2VNR A;  4CYD A;  3MIE A;  5LK7 B;  1CAX B;  4PHZ A;  4EN7 B;  3UGG A;  4YVW A;  1JZ7 A;  2JX9 A;  1WA6 X;  4E4Z A;  2WWJ A;  4Y22 B;  1W6Q B;  2VZT A;  3VDD B;  4ATE A;  1MEC 2;  3OYW B;  1NE6 A;  2DCJ A;  2G9F A;  2JB8 A;  3LQC A;  3BGA A;  4YLZ A;  1UKG A;  4Q1R A;  1JZ4 A;  3VBO B;  3GBW A;  1H2M A;  2QCS B;  1L7Q A;  2PHL A;  2ZTN A;  1MEC 1;  1CJP A;  4NWW A;  2P3Y A;  2A3X A;  1WCS A;  3CNA A;  3NVC A;  2VZQ A;  1LEN A;  4MZU A;  2BNM A;  3LFM A;  3N7L A;  5FZ0 A;  5B4N A;  4LO6 B;  2W2I A;  3DXT A;  1VMF A;  4YRD A;  1AJO A;  4LIV A;  4CU9 A;  3K4A A;  2CY6 A;  2I45 A;  2G9G A;  3AYC A;  2JD9 A;  4NVP A;  3RVH A;  3U78 A;  4TTG A;  2AGS A;  2BV4 A;  3MUY 1;  4IQP A;  3BU7 A;  4B4Q A;  3I3Q A;  4GH4 B;  5A3W A;  4LO7 A;  4K20 A;  3THD A;  1F15 A;  1HQW A;  2GH8 A;  3H1W A;  1DYO A;  3NMB A;  1O4Z A;  2Q30 A;  5DG2 A;  2VG9 A;  3RI9 A;  4DXZ A;  3GF6 A;  3WSO A;  4EZ4 A;  1CPN A;  1ZZ7 A;  2AEN A;  5C33 A;  2ARC A;  1PGW 2;  1O5L A;  2ZAA A;  1KQR A;  1PMI A;  4XIL A;  3D6E A;  5JXG A;  2OQ6 A;  1LU2 A;  1ND3 A;  3VDB A;  2OPK A;  4OI2 A;  2BER A;  1IKP A;  1I5Z A;  4HBN A;  3B93 A;  5JSO A;  1LNS A;  1PGW 1;  1WBL A;  3MPP G;  1RUE 3;  5JOW A;  1GWK A;  1RVF 1;  4J1X A;  1SBE A;  4GWM A;  4DY5 A;  5IAX A;  4AF9 A;  2JWP A;  3BKZ A;  3OPT A;  4QGN A;  2LW8 A;  5FP8 A;  2A1X A;  5DXD A;  1V9U 3;  3JZV A;  4E4S A;  3I2G A;  1UL9 A;  3H1Y A;  4YW3 A;  2XJV A;  2NZ9 A;  5KXD A;  4JZR A;  4PIZ A;  5FJK A;  1VBE 2;  1AYN 3;  3OB8 A;  3A22 A;  3QH6 A;  4XIK A;  1U0A A;  2PYT A;  1GZ9 A;  3N35 A;  5EJ3 A;  5ABJ B;  2KXL A;  4FCA A;  4HKO A;  4BIO A;  4HXC A;  2Y38 A;  1VBD 2;  1NE4 A;  1VAK A;  1Z7S 3;  1B35 B;  2E53 A;  1VBE 1;  2B5H A;  2QQM A;  2VMH A;  1R1A 2;  4H14 A;  3VZJ A;  3OBT A;  3KWV A;  1XC6 A;  2V4V A;  4CPB D;  2HYX A;  3NW4 A;  3T08 A;  4ET7 A;  1BJQ A;  3ACI A;  1H30 A;  1ZA4 A;  3AZY A;  1XBF A;  1R1A 1;  4CDU A;  1F5J A;  3E5X A;  3IPV A;  3ZR6 A;  1YQC A;  2E26 A;  4BE3 A;  4DUV A;  3IT8 A;  2WT1 A;  4C90 A;  4A4A A;  2EID A;  3OGG A;  3OGJ A;  4YW1 A;  1OA3 A;  2D44 A;  4KWU A;  4Y20 B;  4NIA A;  5GZE A;  1RUD 3;  4IDZ A;  2WZR 1;  4BLJ A;  3AYA A;  1RB8 G;  1NXD 1;  3MIF A;  2P37 A;  1XE7 A;  3CJI C;  1XQN A;  1UPS A;  4UWD A;  4OHY A;  5JOY A;  3BTY A;  1GP5 A;  1QJZ A;  4XJU A;  4LQR A;  5FZM A;  1HKD A;  3P3N A;  1VBB 3;  5FYC A;  1UAI A;  1GLH A;  1PMJ X;  4HVO A;  2BRT A;  3WHT A;  4N7U A;  3NO8 A;  2Z42 A;  3KT1 A;  4CEY C;  1UD1 A;  4M00 A;  4ITC A;  2YC2 A;  3IIA A;  2XH6 A;  1TG7 A;  1NCR C;  3AX4 A;  2Z79 A;  2A70 A;  2R7E B;  4DB5 A;  2WYF A;  3NAP A;  5FMO S;  4YGB A;  4BPZ A;  1C1L A;  4QPG A;  1LHN A;  3PUH A;  4QM9 A;  1UO9 A;  1CAV B;  2YMZ A;  1FAY A;  1LKN A;  3DV8 A;  2BGO A;  2B9U A;  2FQP A;  3ZVX A;  4F8A A;  3PHM A;  4CUB A;  2WFP A;  1CAU A;  2UWC A;  1PVC 3;  5FLI A;  4SBV A;  1SCS A;  4IEQ A;  2VD7 A;  3GXU A;  1YUD A;  1UX6 A;  1RUE 2;  3VBR B;  4AE2 A;  2FDI A;  1UZY A;  4LEJ A;  2VW2 A;  3FZ3 A;  5FPU A;  2QQV A;  5FO8 B;  5JI9 A;  1QY4 A;  5IK5 A;  1V9U 2;  3BUC A;  1BXH A;  3K51 A;  1ZZ8 A;  1XU1 A;  3EHK A;  2C26 A;  1AYN 2;  4NMI A;  1JOB A;  3MLJ A;  1HB3 A;  1VB2 A;  2Y60 A;  2ARX A;  3MI8 A;  3ZYP A;  4P9I A;  2XJS A;  1YFX A;  2DCT A;  1U12 A;  2VBB A;  4QPI B;  4HKL A;  5KXB A;  1NCQ B;  3HT1 A;  4IV1 B;  3E6C C;  4CCM A;  3WNK A;  1AYN 1;  5A6Z A;  1H9P A;  5FFO C;  3WD5 A;  4ATF A;  1K3I A;  2NYY A;  4R9B A;  5HCH A;  4KGQ A;  1PZ9 A;  4RS5 C;  5FZ6 A;  4LIT A;  5T5O A;  4OYU A;  1J58 A;  1TQ5 A;  4ZU5 A;  3F95 A;  2VZU A;  3AZV A;  1ND2 B;  2ORX A;  1W8U A;  1X8M A;  3PU8 A;  1Z7S 1;  2HBT A;  3H42 B;  4MUV A;  2TUN A;  4QX8 A;  3LAG A;  1SFY A;  4MXW B;  4Y4R A;  5DZF A;  1OSG A;  5J48 A;  4CCN A;  3T1L A;  1R08 3;  3OPW A;  4IE0 A;  4RQP C;  3CBN A;  4N53 A;  4YVS A;  4J25 A;  1W9T A;  3QH7 A;  2IXL A;  1POV 0;  2F4P A;  2ZZQ A;  4JHZ A;  4QXC A;  4QT6 A;  1RUD 2;  4XF4 A;  3PJY A;  3FLP A;  2GMP A;  1OVS A;  5L73 A;  1QXR A;  2VMG A;  3WP4 A;  2WFF 3;  5FCC A;  3DF0 A;  3V64 A;  5DG1 A;  3RZM A;  5KR7 A;  4IER A;  1ENS A;  4Z2W A;  5IK8 A;  2SBA A;  5EZW A;  2PMW B;  1RUD 1;  1F35 A;  1OOP C;  1C5I A;  4COU A;  3MO4 A;  4UF0 A;  4Y1X A;  1VBB 2;  2V72 A;  3POG A;  4EN9 B;  4ISQ A;  1WW4 A;  1Q56 A;  1Y43 B;  2G4I A;  3PUA A;  4HET A;  4NHX A;  2AYH A;  1SMV A;  1FT9 A;  4CCD A;  5F32 A;  3RJR A;  4AL9 A;  3ORJ A;  2R04 3;  2WNV C;  3VBU C;  3V0A A;  2P5B A;  2W87 A;  4QB1 A;  4JGZ C;  1D2Q A;  1BKZ A;  4DFS A;  3O1M A;  1VBB 1;  3U4S A;  1LOA A;  4AHZ A;  4HAN A;  1H6Y A;  5F6L B;  1JZ8 A;  1O3T A;  4DOU A;  3B3Q E;  3NNF A;  2P6C A;  2A3Y A;  4RFR B;  3O1U A;  2BFU L;  4G4F A;  3HNB M;  3AC0 A;  4AYU A;  5DMY A;  1W0N A;  3M70 A;  4HG6 B;  4AI3 A;  2PHD A;  2PAM A;  1OD3 A;  3HJR A;  2QTW B;  3EBR A;  1PVC 2;  3RZZ A;  3I54 A;  3WNP A;  2UY8 A;  2JEN A;  3LA2 A;  4JVA A;  1O3R A;  1IPJ A;  5JVV A;  3ILN A;  2J1S A;  1XE0 A;  3E5Q A;  2JDP A;  4HPK A;  3TB0 A;  4PIX A;  4MGI E;  4CU7 A;  2DVB A;  1PVC 1;  4CDX C;  3OD4 A;  4ZKT B;  2WNO A;  5C4W A;  2QDR A;  4HMZ A;  3H1M A;  4CCO A;  3OUJ A;  4N8M A;  2I07 B;  1K42 A;  1AHS A;  1OA2 A;  1NZC A;  3WF1 A;  4CEY A;  5A1A A;  4PQQ A;  1HB4 A;  1YCI A;  3I59 B;  3KLS A;  1ZRF A;  5C6C A;  1NCR A;  4Q0P A;  4YM2 A;  4MGZ E;  1JYN A;  1NUK A;  1CVN A;  1I6X A;  1KFU L;  4TXW A;  1OQ1 A;  1ZRD A;  3POE A;  1QEX A;  4UFI A;  2A6Y A;  4XMA A;  4PJY A;  2X8K A;  2VUL A;  4KBB A;  4NN0 A;  1XOY A;  2WZE A;  2RS1 1;  2QDN A;  3WZ1 A;  3MZH A;  1W6M A;  4WVW A;  4ZS2 A;  4P9J A;  4FAH A;  4W50 A;  3QD6 A;  1WME A;  4WM8 C;  3ETQ A;  2JE7 A;  4JGY A;  2XKO A;  5FO7 B;  1LOF A;  4FPL A;  5J3U A;  3UGF A;  4BQW A;  3AZZ A;  1YQ6 A;  5KXC A;  1DQ4 A;  1R08 2;  4IGP A;  3NWK A;  2DFB A;  2P6H A;  4Q0S A;  1POV 3;  5LBF A;  4QKD A;  3SKV A;  2ZKL A;  1RIR A;  1N1V A;  2J1A A;  1YJK A;  5A32 B;  3M3I A;  4LA3 A;  3WDY A;  1PX3 A;  3DKQ A;  4ORF A;  5T5P A;  1R08 1;  1T6G C;  2WLQ A;  5A80 A;  3IM0 A;  2FDK A;  2ZML A;  1VMH A;  2XJR A;  1V6N A;  5DAQ A;  3ZO0 B;  5CKN A;  2W1W A;  4AVS A;  2ZGO A;  4CPB A;  1WBF A;  3DXU A;  2YU2 A;  1FNY A;  3AZW A;  3IDA A;  4IEY A;  4P00 B;  4AI1 A;  1JYT A;  4RFT 0;  2BNN A;  2WFF 1;  3LWC A;  3WQ0 A;  4XUN A;  3ZYR A;  4PF5 A;  2J7M A;  4LKD A;  5FYH A;  2JJ6 A;  2JG8 C;  3NNG A;  5F5A A;  1VLN A;  3PMS A;  4Q0Q A;  3UKV A;  3VZM A;  4A41 A;  4BU2 A;  1HQN A;  2R04 2;  2WA4 A;  5FZD A;  3SH5 A;  3R4U A;  1KD7 A;  3IWZ A;  4QQP A;  1A34 A;  2K0G A;  3X29 B;  5A33 B;  2IXH A;  1LOB A;  2VBD A;  3ZFE B;  1H2N A;  1YXW A;  2W47 A;  1JUH A;  1S0B A;  2JD4 A;  4FAG A;  2XUE A;  4RN5 A;  2W0X A;  4R9D A;  1CQ9 A;  4XPV A;  2R04 1;  2R32 A;  1TME 1;  5BNN C;  3BCW A;  3L9J T;  1QXJ A;  1YI7 A;  3ABZ A;  1OI6 A;  1NQD A;  1EUT A;  4I09 A;  5GLT A;  1SPP A;  4FPG A;  2VUC A;  5FZE A;  4P9X A;  1UW8 A;  1UZW A;  1UMI A;  1GBG A;  2ORZ A;  1EAH 3;  5I93 A;  1IHM A;  3U0Z A;  2VU9 A;  5GLU A;  1RUO A;  2HWF 2;  1V6O A;  2HEV F;  1W8Z A;  1NA1 A;  1VB4 A;  2VXR A;  4N43 B;  5J1X A;  5D8A B;  2VXJ A;  1NOV A;  5FZI A;  1S4C A;  4DZG A;  1UIJ A;  5BNO B;  3O1S A;  4Y1V A;  1AR8 3;  5JDB A;  5JAX A;  4E4D X;  1BMV 2;  4RR3 B;  4BQY A;  3EB7 A;  4JKK A;  3SQO A;  3BPZ A;  1W6P B;  4M3C E;  5JMC A;  4K3U A;  2EAL A;  4XFA A;  1YQ8 A;  2MPF A;  1BMV 1;  4MGQ A;  3PIG A;  5HXV A;  2Q8O A;  3USU B;  3URF A;  3I97 A;  5C3O A;  1QOS A;  3SKJ E;  5A6Y A;  3VL8 A;  4B7K A;  1XJA A;  3M1H A;  4OMD A;  1W99 A;  2J1R A;  1IG3 A;  2FHR A;  2VUJ A;  4QXH A;  5GZD A;  5F9T A;  5EJZ B;  4LBK A;  1PK6 C;  2DWR A;  3L2H A;  4QB6 A;  1OKO A;  3I3M A;  2D6K A;  4Y1Z A;  4AFB A;  2ENR A;  3III A;  4GJY A;  1DGR A;  3VD5 A;  3O1P A;  5EYY A;  4I01 A;  3WLU A;  3N7M A;  1US2 A;  1UMZ A;  1V6J A;  3SLI A;  4CCC A;  4I0A A;  5EXO A;  4U36 A;  2LS6 A;  3ZSL A;  4CDX A;  4LJH A;  4A7Z A;  4BOW A;  3W21 A;  4C1X A;  2DYC A;  1WWY A;  3O1O A;  2QNK A;  1POV 1;  2W5F A;  4A7Y A;  1JYC A;  4HON A;  1AF9 A;  5F1R A;  1H4G A;  1WLT A;  4U2A A;  5CZK A;  3ZXD A;  4I0W B;  4HLT A;  5JR7 B;  1XSQ A;  3ACG A;  4FPC A;  3WCR A;  5J37 A;  4BQ1 A;  3NQH A;  4A45 A;  4NIG A;  4HK9 A;  4OQ9 A;  3WF0 A;  1RUC 3;  4RL7 A;  4WZF A;  2W08 A;  2FCU A;  3BOD A;  2LTN A;  3IMM A;  4ZPI A;  1WLC A;  1Z0H A;  3N9O A;  1JU4 A;  1E5H A;  3R6S A;  2UU8 A;  2WT2 A;  3O1V A;  2QQP A;  2NN8 A;  3BIE A;  5FZO A;  5CG8 A;  1W8T A;  3AP9 A;  1YO8 A;  3FWE A;  1XPW A;  4O9E A;  1N1T A;  3ATG A;  3FL7 A;  1KXG A;  2ZGM A;  5FYZ A;  3OEA A;  3O0X A;  1VBC 3;  5LRR A;  2ATF A;  1WCQ A;  2WR9 A;  1F2N A;  1J83 A;  4IW3 A;  4UW5 A;  4LBQ D;  5LEK A;  5FZ9 A;  2WNU C;  3PIJ A;  4DY3 A;  5CKM A;  4BWO A;  4FPH A;  1OD5 A;  2VCC A;  2QQJ A;  2E31 A;  1XNB A;  2W9X A;  3N7K A;  1N3P A;  1EAH 2;  1YYN A;  4KMQ A;  3FX3 A;  3VBF C;  4YFZ A;  3LDB A;  4DS0 A;  5FYB A;  2WQ4 A;  4LLF A;  1V6M A;  4MX3 A;  3EJK A;  4JDM A;  4NJ4 A;  1AR8 2;  5JZG A;  1MQT C;  2FMD A;  5F3C A;  1EAH 1;  1IS3 A;  1V6I A;  3ME2 A;  4JDN A;  3M8L A;  4RHV 2;  2YU1 A;  4HFS A;  3NV2 A;  2DVG A;  4XBN A;  5L19 A;  5ERL A;  3VZO A;  3VDA A;  1MS9 A;  3I2H A;  4KI5 M;  5J09 A;  1AR8 1;  4DUW A;  4RA0 A;  4PF1 A;  5JIU A;  2VZS A;  3ZXL A;  1URX A;  3DPR A;  2A6V A;  2JKB A;  2O1Q A;  4I3G A;  5JSP A;  4Q4Y 3;  1AR6 3;  1Q43 A;  2X5I A;  4OUS A;  3OY8 B;  5DZG A;  1DYK A;  1YQ5 A;  4LUK A;  4IV3 C;  4QWN A;  5FUP A;  4LBM A;  5BNP B;  4CXW A;  4Y33 A;  5CFC C;  3J8F 3;  3RZJ A;  2WQZ C;  3C7H A;  5FWE A;  1ACC A;  3AVR A;  4NO4 A;  5FP7 A;  3M3Q A;  1H8T B;  1V00 A;  1RIN A;  3J26 N;  3RFR A;  1IG0 A;  1QNW A;  1POQ A;  4MV2 A;  2VZ3 A;  2J1T A;  5FZG A;  1VRB A;  3S7E A;  5IFP A;  2H0B A;  3D4K A;  4FFH A;  3W59 A;  3WVJ A;  4NWV A;  1F9K A;  4Z92 B;  4L0P A;  4IEU A;  3D82 A;  1FV3 A;  1U5I A;  5L7O A;  4EN8 B;  1JYX A;  5LWB A;  3W5M A;  4LHS A;  1JOJ A;  5IVY A;  2OUH A;  1X50 A;  2WYS A;  5KHI A;  5FLJ A;  1ZBA 3;  1E5R A;  4XF0 A;  4YM1 A;  2DU0 A;  5T5J A;  1RUC 2;  4KU8 A;  1H1M A;  5FWJ A;  2XLA A;  2OW4 A;  5SV5 A;  2Y0I A;  5E88 A;  5EJ1 B;  1PK6 A;  3AYD A;  4AVB A;  5JOX A;  3WUD A;  4XFF A;  4UBH A;  1RUC 1;  1RED A;  2VNG A;  1GFF 2;  1PMH X;  3HPN A;  5E89 A;  3ES4 A;  4FPE A;  2WUH A;  1WLW A;  1WMX A;  3FC0 A;  4LO8 A;  1VBC 2;  5IYY A;  1KRI A;  3V65 A;  2J1V A;  4K7J A;  1Y7B A;  2XJP A;  5A7P A;  3QLQ A;  4R9C A;  5IVE A;  2V5Y A;  2VMC A;  3MF9 A;  2ARA A;  1UF2 C;  3D3A A;  4JC1 A;  5ANQ A;  3WP3 A;  2VW1 A;  5G04 L;  4QD2 A;  2AUY A;  1SHW B;  5FY5 A;  1I5P A;  2Y6K A;  1JN2 P;  3I49 A;  5FZC A;  2FBE A;  4KQ7 A;  5F3I A;  1VPH A;  3T2Q A;  1J1L A;  5E8A A;  3GBG A;  4TSV A;  2Y6J A;  5FPB A;  1RUF 3;  1J59 A;  1J3P A;  5EWS A;  4YZ3 A;  3O1T A;  4ZU4 A;  3NV1 A;  2NQY A;  1XXN A;  3B9C A;  4CDW A;  2RDS A;  3T0D A;  4BXF A;  4MSV A;  1SBD A;  5IWF A;  2VO5 A;  4AFA A;  2ZPX A;  4AED C;  3PTR B;  4KNC A;  3MLL A;  1VE0 A;  1AR7 3;  2RDR A;  2YB7 A;  3I3D A;  3MGU A;  4IEP A;  4CE8 A;  2IFW A;  3KCY A;  4RGG A;  4BQ2 A;  5JR2 A;  1OXC A;  1UNB A;  4M4R A;  3WQ7 A;  4YVW B;  2RMU 3;  4LNV A;  4Q4Y 2;  3WW1 A;  4CP2 A;  1JHJ A;  2ZX1 A;  3KHC A;  3RZH A;  3WR0 A;  1ODN A;  4ZHN A;  1XU2 A;  2D97 A;  2VZP A;  5APA A;  4FQ4 A;  1N3Q A;  3J8F 2;  3VBF A;  2NMO A;  1MPX A;  4Q4Y 1;  1HN0 A;  2UWA A;  4A3Z A;  4BQ5 A;  2WKK A;  1AR6 1;  3EYP A;  3VDC A;  1STM A;  3VD9 A;  4CEW B;  1CIW A;  4AGR A;  1IS5 A;  1WA4 A;  3MIG A;  2QQU A;  5FYY A;  4R4X A;  1NLS A;  3K3O A;  1MQT A;  3CZJ A;  1Q8Q A;  2QFE A;  3J8F 1;  1YQ2 A;  2ID4 A;  2BPA 2;  5FYV A;  3KSC A;  1FNZ A;  4L92 A;  4RGA A;  5DQ0 A;  2VUA A;  3OG2 A;  4QKF A;  3JB8 A;  4KG0 A;  1A6C A;  4W6X A;  1QNY A;  3GGL A;  2A75 A;  1ULF A;  4B29 A;  3T4H B;  1GOG A;  3IN9 A;  4Q29 A;  1AX0 A;  1RVF 3;  3ZFG A;  3RNS A;  3GZE A;  4Q8L A;  5K0U C;  5KHG A;  1ZBA 2;  3CLP A;  1H4H A;  3WG1 A;  1C3H A;  5A3P A;  1DHK B;  3VBS B;  4JTO A;  1JUI A;  2VCA A;  3WQ1 A;  2ET1 A;  2DBI A;  4IV3 A;  1NYW A;  1SQ4 A;  3ACH A;  4XF3 A;  3MF6 A;  1LRH A;  1GNY A;  1I1E A;  3KS7 A;  5KWR A;  1R09 1;  3E5U A;  1YRZ A;  2DUQ A;  3EMR A;  1HRV 1;  2HWC 3;  4BB3 A;  1UMH A;  4AEJ A;  1DLC A;  2XJU A;  3VDD C;  3O12 A;  1ULO A;  2VY0 A;  3T0A A;  1UXZ A;  4DO0 A;  1G9A A;  2CYF A;  5EP9 A;  3MHZ A;  3NST A;  3J9S A;  4JQR A;  3VBO C;  1RXG A;  4NHL A;  4E27 A;  1YLL A;  2JE9 A;  5FPV A;  2OKX A;  1C8N A;  3SH3 A;  2TBV A;  4RYD A;  1LAJ A;  1HLC A;  1W9W A;  1ULE A;  3H9A A;  2FDG A;  2CWS A;  3HQR A;  5FZ8 A;  3GCX A;  5HPO A;  5BNQ A;  3NRU A;  3EQE A;  2D5F A;  4FO9 A;  3ZOI A;  4D69 A;  5F3G A;  5LA9 A;  1RUF 2;  3AJY A;  3C7G A;  4QGM A;  1QMJ A;  5FV3 A;  1QDO A;  2WZR 3;  4Q4W 3;  1QHD A;  2VBP A;  3WDT A;  2QVS B;  3KQR A;  3AP5 A;  1RUF 1;  2E33 A;  3O0V A;  2EIC A;  2XG3 A;  4GH4 C;  4LBQ A;  1WZX A;  1Q8O A;  4LBN A;  2DUP A;  4YPJ A;  3VBH B;  4FBF A;  1OC1 A;  1RMU 3;  3W20 A;  3SEP A;  5GM0 A;  3N7J A;  4ZZ5 A;  4IEO A;  1UYX A;  2RMU 2;  3IPV B;  5HBA A;  3KV5 A;  3FJS A;  4MXV A;  4TZD A;  4BXS V;  1CES A;  1W6N A;  1OLQ A;  3MFA A;  2QKD A;  4FQZ A;  1AR7 1;  4AZZ A;  1HB1 A;  2BUK A;  3OGR A;  2W3J A;  4COY A;  4CDQ B;  2RMU 1;  2VOW A;  4BZ4 A;  2JIC A;  2WBK A;  4IE6 A;  5IJR A;  3ZXE A;  2HWB 3;  2W1S A;  3HT2 A;  1XNT A;  2X10 A;  4XF1 A;  3VHR A;  2AAC A;  4OI0 A;  3SXW A;  1ZRC A;  2YGM A;  3IDB B;  3LPF A;  3HQU A;  3HVD A;  1JXN A;  2J1U A;  5ACA 3;  4XOG A;  3ECQ A;  3K75 B;  4MET A;  1HV0 A;  1C28 A;  3OSD A;  3V0B B;  2CDO A;  1CAW A;  3S6P A;  4J1W A;  3ZN6 A;  2XPJ A;  1GNZ A;  1RVF 2;  5ABJ C;  1WMD A;  1ONA A;  4LOT A;  1OUS A;  5HCF A;  4UFL A;  1B09 A;  2BNO A;  1B35 C;  3I3E A;  5DAB A;  1K5M B;  3C7E A;  5J98 B;  1YJL A;  2UYB A;  4CCL A;  3AKQ A;  5F6K A;  3NAP B;  5FBJ A;  2CGO A;  4EZH A;  4COZ A;  3TEZ A;  4QPG B;  3A21 A;  3SCG A;  3WG2 A;  5FPL A;  2ZBJ A;  4DEV A;  3SC7 X;  3T30 A;  2VW0 A;  1FMD 3;  4M3C A;  5I8T A;  3Q9O A;  3T3Y A;  3ZYJ B;  3ZXA C;  5F2W A;  5F37 A;  2XJT A;  4QQ2 A;  5C8C C;  3WG3 A;  4D0Q A;  2HWC 1;  2A6X A;  1MS8 A;  1G6N A;  2VOT A;  2JG9 A;  3ZFF A;  4AVA A;  3MUZ 1;  4QMA A;  2ZAC A;  5CFD B;  1UCX A;  4IES A;  3OJB A;  1D4M 3;  1SLI A;  2A73 B;  5E16 A;  1BCX A;  1MZF A;  1O5U A;  1LHO A;  5A3U A;  2HLE A;  1QOO A;  2WZR 2;  4Q4W 2;  3H8R A;  3AKT A;  2K46 A;  2JB4 A;  2FDH A;  2OUJ A;  2VZR A;  2BGP A;  2ZX0 A;  3SCF A;  3ZX7 A;  2VM9 A;  4XXA A;  2WO7 A;  4XHX A;  4A3X A;  1RMU 2;  4K40 A;  4Y22 A;  3ES1 A;  4Q4W 1;  5CA6 A;  1CGP A;  3VDD A;  5K8S A;  1VRH 3;  1LES A;  2JDY A;  3OYW A;  1ENX A;  1HX6 A;  1UN1 A;  1JH5 A;  2RJ2 A;  4N53 B;  4YVS B;  4TN7 A;  2VQA A;  1TZO A;  3KVA A;  4ISR A;  5LZ6 A;  1RMU 1;  3VBO A;  1RJ7 A;  2PAK A;  5C3R A;  1DGL A;  1AJK A;  2JDA A;  3ZM8 A;  4KG8 A;  2QQW A;  4QPW A;  2GP3 A;  3JD7 3;  5AVP A;  5HCB A;  4JQT A;  3ZPY A;  4DPN A;  3VBR C;  2HWB 2;  3JB4 C;  2ZEW A;  2XXZ A;  3BOW A;  3MW2 A;  2XJQ A;  4DMI A;  3BOP A;  2NMN A;  2BW8 A;  2B45 X;  4AI8 A;  2WN3 A;  5ACA 2;  1W05 A;  4FVV A;  1KJR A;  3GZT B;  4PDW B;  4XUR A;  4W6Y A;  2HWB 1;  4UF0 B;  4XDO A;  3TWI A;  3PLQ A;  1CZV A;  5DDJ 3;  3A0N A;  3ZIW A;  1TNR A;  5ACA 1;  4Y1Y A;  2BEO A;  3CEW A;  3ROU A;  3RWN A;  4AI2 A;  4QPI C;  3V0A B;  3H7J A;  1DU3 D;  2I74 A;  5G05 L;  1NCQ C;  3ZXF A;  4IV1 C;  1DP0 A;  3AL5 A;  3JQW A;  4IUG A;  2HYK A;  3KV4 A;  4UI9 L;  5EHD A;  1KIT A;  1QH7 A;  3ZMN A;  4H55 A;  2JDK A;  1NZI A;  2QE3 A;  3ON7 A;  4GXL A;  2B42 B;  4QKB A;  3VB9 A;  3PUR A;  1UOG A;  1VR3 A;  2IXK A;  1ND2 C;  1S0D A;  3AP7 A;  1X82 A;  3QOP A;  4EN6 B;  4YZ2 A;  1H1A A;  2WNE A;  4XAA A;  1ZZC A;  4HKW A;  1OF3 A;  1FMD 2;  4O61 A;  1W6O A;  5GLV A;  1OBN A;  2JDH A;  4AHW A;  1M4W A;  2G9Z A;  2YV8 A;  3AMH A;  4O7X A;  3MFC A;  2Y64 A;  3J7H A;  4Y5T A;  2RS1 3;  4HPK B;  2AH2 A;  1PZ7 A;  2MHF A;  3CQO A;  5GKA C;  3W9A A;  4EV0 A;  3UK9 A;  5AFE A;  1FMD 1;  4HK8 A;  1W8W A;  1FV2 A;  5FY7 A;  3ZSK A;  1Z7S 2;  5C4W B;  2ZS6 B;  1S2K A;  1W9Y A;  1TEI A;  4XJW A;  1UPI A;  4MGK E;  1DG6 A;  1D4M 2;  1J3Q A;  3WUC A;  5FKB A;  4GMP 3;  4CUA A;  5CIR A;  1DLL A;  5K7P A;  2B39 A;  1C5H A;  4DNY A;  1IQD C;  3WF3 A;  4AEK A;  4BME A;  4TLF A;  2ZJC A;  2Y26 A;  4DEQ A;  2A3W A;  1D4M 1;  1VAV A;  1JBC A;  5A3T A;  3BTX A;  1Q8V A;  3ZYI B;  3ZLI A;  2RG4 A;  5C70 A;  5I91 A;  4NPM A;  1XSR A;  1W6M B;  5FQ0 B;  3FHI B;  4QDQ A;  3RSJ A;  5A7S A;  2X53 S;  1AL2 3;  1J3R A;  2VTX J;  3P1I A;  3ZMO A;  1QJE A;  4JGY B;  4LOS A;  3VKO A;  3LOI A;  4CP9 A;  4CCK A;  4YYO A;  5KHK A;  4A2U A;  4I02 A;  1VRH 2;  4K8R B;  2QZ3 A;  3M2M A;  4JAA A;  2CGN A;  4DXT A;  4XUQ A;  1JYI A;  1BLZ A;  5C8C A;  1RUN A;  2JKX A;  4LO5 B;  4Y20 A;  4JHT A;  1OHF A;  1GQH A;  1WKY A;  5F5C A;  4YSF A;  3DGT A;  2Q1Z B;  3ZYB A;  4CZS A;  1C8M 3;  4HN0 A;  4YW2 A;  2RS5 1;  3WW4 A;  4DXR A;  1VRH 1;  1BBT 3;  1G8W A;  2WL1 A;  4EQV A;  1KDK A;  5C5T A;  4QXK A;  2ADD A;  1PM4 A;  3LIH A;  5IVJ A;  2XUM A;  2VTF A;  3ZXG A;  3H8X A;  2GNT A;  4D6R A;  1WD4 A;  4ASM B;  3VUO A;  1TME 3;  1UU6 A;  2ZGL A;  4EWE A;  2B8M A;  3W5N A;  2D3R A;  1GU3 A;  1QXP A;  2JXA A;  3JD7 1;  5FO9 B;  5IVF A;  3C7O A;  4K21 A;  4NII A;  4BA6 A;  4COV A;  5FKC A;  3KF5 A;  2PHU A;  1ALY A;  2YG0 A;  4D7Y A;  4HN1 A;  1OF4 A;  2W91 A;  2OX0 A;  2YC0 A;  2WRA A;  3OBA A;  5DDJ 2;  5GLZ A;  4Z2A A;  3DYP A;  3RMY A;  2WAO A;  4FTE A;  1QWR A;  1IS6 A;  1G7Y A;  3F2Z A;  3WNX A;  1W0P A;  4C0B A;  2W92 A;  3MEP A;  5A1F A;  1KS4 A;  2VQU A;  3EXU A;  4IGQ A;  5A3L A;  4XVH A;  1W8H A;  5DDJ 1;  1W2T A;  2BP6 A;  1ST8 A;  1X8E A;  3CJI A;  3ZKU A;  4P9L A;  1CAV A;  3IAP A;  5C9A C;  2ZX2 A;  4BQ3 A;  2E63 A;  2WSU A;  4QQL A;  2PLV 3;  1W2U A;  2JDZ A;  1SPP B;  4UXA A;  3RS6 A;  1LTE A;  2XVG A;  1NY7 2;  3VBR A;  4UOJ A;  2P3K A;  4FTS A;  2BYV E;  4TWT A;  4XFG A;  3TEX A;  5CVR A;  3LSE A;  3BYW A;  2RS1 2;  1ENR A;  2HWE 1;  4MYE A;  4Z07 A;  1NA1 B;  1SLT A;  1MVQ A;  1WGP A;  4LHN A;  4PQ9 A;  1CD3 G;  1NY7 1;  1OUX A;  2GME A;  3GAL A;  4QX0 A;  5C7G A;  1JZ5 A;  3CIH A;  4Y4Y A;  1UOJ A;  4AHY A;  1AXZ A;  2VPV A;  3WW3 A;  4FOQ A;  3LOB A;  3NL1 A;  3APB A;  4S2G A;  3N9Q A;  2V5D A;  1TMF 3;  5JCT A;  2P34 A;  3MBW A;  2R49 A;  2BFU S;  4IV1 A;  4R8H A;  5F5I A;  5F7U A;  1E5S A;  2W94 A;  2RE9 A;  2FDF A;  2VMF A;  1XNA A;  4QDS A;  2UWB A;  1GZW A;  2HWD 3;  1JS9 A;  4GMP 1;  2F17 A;  5JIA A;  1PIV 3;  1GP6 A;  4WVV A;  5LAS A;  2XKP A;  4BK4 A;  2R06 3;  4B1L A;  3LSD A;  3C3V A;  1AL2 2;  4F83 A;  3ZFE C;  5L9R A;  2K9Z A;  2CL2 A;  4JDO A;  3WT3 A;  2VEC A;  3RRD A;  2F6B A;  1NLR A;  4MHR A;  3J7M A;  2WFF 2;  2WLP A;  4ZXE A;  4V2V A;  5ANN A;  3AXD A;  1VMJ A;  4PLO A;  4BK5 A;  3UKT A;  5T55 A;  1AL2 1;  1GAN A;  1SBF A;  2VCB A;  3HN1 A;  5GJ6 A;  2R30 A;  5FZA A;  2D7F A;  1C8M 2;  1PVX A;  3ZDS A;  5FY0 A;  1HJF A;  1O8P A;  1UY1 A;  3G7D A;  3KZ4 C;  4RS5 A;  4XQW A;  1CZS A;  5FP4 A;  4AG4 A;  3CMG A;  4N43 C;  2ET7 A;  5D8A C;  1W8N A;  2DTY A;  4BMB A;  1C8M 1;  1TME 2;  3AB0 A;  4P9W A;  2F4L A;  5BNO C;  5J7M A;  4LE4 A;  1BBT 1;  5D21 A;  3RYK A;  2DCK A;  4RR3 C;  3VD4 A;  2CU5 A;  3C7F A;  4RQP A;  4UFM A;  2YYO A;  1QJU 3;  5I0T A;  3OPZ A;  3UJQ A;  3N9L A;  1IKQ A;  2FCV A;  4FTB A;  2G1M A;  2C24 A;  3HAG A;  4NRM A;  1UWW A;  1W28 A;  4LUL A;  1MS5 A;  1DGW X;  1O59 A;  2D5H A;  3FHQ A;  4HVR A;  1JZ2 A;  3LGR A;  3WV6 A;  1UU4 A;  4QGL A;  4CUC A;  4K1Y A;  3KT7 A;  4FPF A;  1S1A A;  1UQX A;  1X9T A;  1DFQ A;  1GQP A;  2XQR A;  2ZAB A;  1OOP A;  2FZ2 A;  2QZ2 A;  5DAX A;  2PLV 2;  3MW4 A;  3THT A;  4R4Z A;  3SCH A;  2VVD A;  3VKN A;  1LHW A;  5CU1 A;  1DCS A;  1V70 A;  4AFM A;  3WCS A;  1OKQ A;  4QHO A;  1UY4 A;  3UJO A;  5KBF A;  1H8V A;  2GC3 A;  3VBU A;  2WNV A;  4LK6 A;  2PLV 1;  2YBS A;  4JGZ A;  5CAZ A;  4P5Y A;  4Q0U A;  4NHY A;  3H7Y A;  2XL7 A;  3I7D A;  2PHR A;  3PNA A;  1Z78 A;  5JZG B;  3B7M A;  3HN3 A;  3INA A;  3R05 A;  4Z82 A;  1HN1 A;  4XZP A;  4UBG A;  1YFW A;  2IFR A;  3B02 A;  3JCI A;  3UKN A;  3N3H A;  1ZRE A;  1TMF 2;  2XGX A;  2VOX A;  2XVL A;  2ZGP A;  3B01 A;  2O8Q A;  3J7L A;  4Y1U A;  4URT A;  1FPN 1;  4AQT A;  2KM2 A;  4MAD A;  3ASI A;  3DPR B;  4NAM A;  5C9A A;  1JHN A;  1UIK A;  2HWD 2;  3NKT A;  1TMF 1;  3PVN A;  4WM7 B;  3WDU A;  4D94 A;  3E6B A;  1LEM A;  3DYM A;  5BUV A;  2X5I B;  2YZ4 A;  2R06 2;  5E6H A;  2IXI A;  1N1S A;  5T3N A;  5IUQ A;  1SCR A;  4XTP A;  1SFP A;  2OVU A;  4LKS A;  2HWD 1;  1T6B X;  2YBK A;  1PIV 1;  2EIE A;  4BHP A;  5FY9 A;  1UOF A;  2Y6G A;  5M0T A;  2R06 1;  4OHX A;  5H9Q A;  4ASL A;  4XET A;  4TLG A;  3M3E A;  4EE2 A;  3DYO A;  3CZU A;  1OMI A;  3FE5 A;  4UFJ A;  5IVV A;  2D6M A;  2PHT A;  4CUG A;  5DUX A;  1YWK A;  2RR1 3;  4GZ9 A;  5FP9 A;  3VV1 A;  1OQD A;  5JUV A;  5EIY B;  4N7I A;  2E32 A;  1QQP 3;  2LUW A;  1ZX5 A;  4LO4 B;  1CN1 A;  2YPD A;  3MDP A;  4LBL A;  1S0J A;  1ZNP A;  4WM8 A;  1MVE A;  2WII B;  5L7O B;  2OZJ A;  2B9V A;  2VVE A;  2Z69 A;  3AK0 A;  1MZ6 A;  1GV9 A;  2ZGN A;  3KQ4 B;  4Y5S A;  3UL2 A;  3TEW A;  3PL0 A;  2DCZ A;  5LK5 A;  1QJU 2;  5LA2 A;  4NUB A;  4WVM A;  2ZGS A;  4PCR A;  1ZZ9 A;  4LE3 A;  5A33 A;  1H1I A;  3PVB B;  5A7Q A;  2VMI A;  2ZHK A;  3TNP B;  1O6U A;  2PXJ A;  2XWB B;  5DAV A;  1C1F A;  5E1R A;  1QJU 1;  1VAM A;  1GWL A;  2A71 A;  2MEV 3;  4CU8 A;  3Q8F A;  3FMG A;  4XUP A;  3M7A A;  2WZ8 A;  3D5O A;  1LOC A;  1HV1 A;  5L9B A;  1BK1 A;  2WO3 A;  4Y24 A;  1RUJ 3;  3MID A;  1MS3 A;  3BPS A;  4LBO A;  3BVC A;  5BNP C;  5FBZ A;  5FZ1 A;  2EXK A;  3AMM A;  3PU3 A;  3RMX A;  1AR9 3;  3U10 A;  2JDM A;  4I30 A;  4OVE A;  4P02 B;  3H0O A;  4HT1 T;  5A6X A;  2JG8 A;  1H8T C;  5DAW A;  1MS0 A;  5TSW A;  4A6S A;  2WWS A;  1UYY A;  1BQP A;  4XCB A;  3NJY A;  1GIC A;  4X8P A;  4H7M A;  4P5H A;  2DF7 A;  3WQB A;  5C71 A;  1EV1 3;  1UZV A;  1O8S A;  1M06 G;  2CTV A;  5BNN A;  4XQD A;  3HBK A;  5A3O A;  5CNA A;  4CDW B;  2XB6 C;  2ZGT A;  5LB6 A;  3I2J A;  2ZGR A;  3SEE A;  1WD3 A;  1H2L A;  4GWI A;  2G19 A;  3SHR A;  2VC9 A;  3NKG A;  2ZMK A;  5T5L A;  3TN9 3;  4OFG A;  1ODM A;  4OCT A;  1NKG A;  2WZP P;  2KR2 A;  3N4M A;  2QJV A;  1DQ1 A;  1EUU A;  2OA2 A;  2VH9 A;  5FZH A;  1RJ8 A;  1F31 A;  1OUR A;  4LTA A;  4KBZ A;  4AHX A;  1VIW B;  3MV1 1;  4B3N A;  3ZXK A;  4M4P A;  4ES9 A;  1XRU A;  4NID A;  1AX1 A;  4A44 A;  5LCW L;  4YWA A;  1DZR A;  2FCT A;  2WS9 3;  5SV8 A;  1Q8S A;  4LPL A;  5I8S A;  4CRQ A;  4I2O A;  4W65 A;  1LEC A;  1UY2 A;  4PT6 A;  4KGG A;  3WW2 A;  3GZA A;  2RR1 2;  2ZGU A;  4PLN A;  2HH9 A;  1VJ2 A;  1ZRR A;  3GDB A;  1R09 3;  4IL7 A;  5LAT A;  5B2G B;  1QQP 2;  3A4U A;  1HRV 3;  5FUI A;  5A7N A;  3CDZ B;  4LA2 A;  2ADE A;  1E5I A;  3LZZ A;  4UAP A;  2RR1 1;  2LAL A;  3B94 A;  1W8O A;  1N47 A;  1AXY A;  1GZC A;  1W39 A;  3GM8 A;  3RDI A;  3ZFG B;  1K12 A;  4GKX A;  1QQP 1;  4E8C A;  1A8D A;  2GH2 A;  2Q4S A;  3IBM A;  1FOD 1;  2GND A;  3A0K A;  1JMU B;  4XAC A;  4FPO B;  3MLK A;  3PTY A;  4BDV B;  1S0F A;  3M3C A;  4Y3O A;  3C8X A;  3ZSM A;  5BV6 A;  2WO1 A;  1YNA A;  3OOX A;  5FYS A;  5I0S A;  3OBZ A;  4XDQ A;  3S5Q A;  2MEV 2;  1G9D A;  2JIG A;  2BU9 A;  4YVW C;  5FZF A;  3WIN E;  4XW3 A;  1CZT A;  2GDF A;  4AR2 A;  1RUJ 2;  1CJD A;  1OPO A;  2ZGQ A;  4EWA A;  2ZMN A;  5A3M A;  2MEV 1;  4NE9 A;  4BM8 A;  2CWM A;  1LJ7 A;  1PZ8 A;  2ZEX A;  1W2A X;  2QQI A;  1AVB A;  4FPY A;  4C8D A;  5GZF A;  3OCP A;  1RUG 3;  1RUJ 1;  4CEW C;  5LA1 A;  1GUI A;  5GAL A;  4B1M A;  3ZSJ A;  1AR9 1;  1COV 3;  1PO1 3;  3K48 A;  2HBU A;  1UX7 A;  2PFW A;  3E6D A;  1A8M A;  1RUH 3;  4WVZ A;  4CXY A;  1EV1 2;  1W0O A;  2XL9 A;  4ZZ8 A;  5FYI A;  5DPN A;  2ZEY A;  4QX3 A;  4S2F A;  4G9S B;  2LM3 A;  5A70 A;  1AR6 2;  2BDR A;  3G6J B;  2WNU A;  1HW5 A;  3MIC A;  3NNL A;  2YC4 A;  4J6G A;  5FPZ A;  1OT5 A;  3VKL A;  4DXS A;  1S2E A;  4KWJ A;  2I2S A;  1EV1 1;  3TN9 2;  3T4V A;  5J36 A;  4LBQ B;  1PHM A;  4YAR A;  2IVJ A;  4LKF A;  5GZG A;  3VBS C;  3RGB A;  5JXH A;  5I0U A;  3OY8 A;  1GP4 A;  2GU9 A;  3AM2 A;  2YFU A;  1RYY A;  3QCW A;  1W6N B;  1LUL A;  2Y6L A;  3TN9 1;  4AOC A;  2XBO 3;  3VGI A;  4ZS3 A;  3VN4 A;  4AQS A;  3V56 A;  2WQ8 A;  1LOE A;  2NLR A;  2YHJ A;  4JTN A;  5DN2 A;  2WS9 2;  4R9A A;  3ENR A;  3THP A;  4AQ6 A;  4E2Q A;  4UT5 A;  5FMD A;  2RDQ A;  4K9S A;  1CIY A;  4E2G A;  4JKM A;  3KGZ A;  5FZ4 A;  5AC9 3;  4IND A;  4QM8 A;  2RDN A;  4CCE A;  2C4X A;  2Q8C A;  3PVE A;  2WS9 1;  4YGC A;  2K2S A;  4GAZ A;  1R09 2;  1IQA A;  2DUR A;  1GQG A;  4GD4 A;  1HRV 2;  3TNQ A;  2YXS A;  2OPW A;  3POY A;  2O8O A;  3IDC B;  3LEG A;  3K4D A;  3VLB B;  3WOG A;  1L7R A;  4ARX A;  1EPW A;  2H6C A;  5CAD A;  5FOB B;  4UW6 A;  3ZN6 B;  5CFC A;  5JPN B;  3PME A;  4CTE A;  1APN A;  1NQJ A;  2XWJ B;  2Z2S B;  5T54 A;  4AQ2 A;  3AYE A;  1LOD A;  3D0S A;  1ND3 B;  5FIX A;  1JYV A;  3NNM A;  4DIN B;  2VGD A;  4YG0 A;  5FZL A;  4QB2 A;  2QQL A;  3CF6 E;  3FFQ A;  2VJX A;  4IE7 A;  4QPY A;  5LY2 A;  3VBH C;  4AVV A;  5HV4 A;  3RYR A;  4UFH A;  3CKH A;  4D6Q A;  2BJS A;  1DGR N;  5J96 B;  2GSY A;  5JXI A;  3LA7 A;  4M3C B;  4CU6 A;  4NIH A;  1O3Q A;  4OZX A;  1Q8P A;  3KT4 A;  2JE8 A;  2Q5T A;  2W68 A;  3TYJ A;  3DCQ A;  3WG4 A;  2D6P A;  1NXM A;  2GN3 A;  4CDQ C;  4ARY A;  2BVV A;  2A7A A;  1S0C A;  1WMF A;  2JG9 B;  3ZFF B;  4OQ8 A;  1RUG 2;  2D40 A;  5IVC A;  3BI3 A;  2YBP A;  2CDP A;  3T0B A;  3RI8 A;  5IHR A;  1Y9M A;  5EV7 A;  3FLT A;  5FUN A;  2PA7 A;  1COV 2;  1PO1 2;  2YUE A;  1WLD A;  5A7W A;  1JZ6 A;  2DUO A;  1JYW A;  1AR7 2;  1VBD 3;  1RUH 2;  1KDM A;  3KV9 A;  4UW3 A;  1SLA A;  3RPQ A;  1LB2 A;  1RUG 1;  4CDU B;  1S0E A;  2R1D A;  4XFI A;  4PBP A;  1COV 1;  1PO1 1;  1WCD J;  4A6O A;  4ES8 A;  2GP5 A;  1O4T A;  3AJZ A;  2H0V A;  1DZT A;  2CNA A;  2VME A;  1RUH 1;  4ERO A;  4C0H A;  3ZYH A;  1GMM A;  1OQE A;  4NHK A;  5HXM A;  4QAW A;  3K2O A;  1K5M C;  3R4S A;  4HZF A;  2A6Z A;  3U14 A;  2C1F A;  4AFD A;  3NAP C;  1UKR A;  3Q8A A;  5T50 A;  4QPG C;  4QKN A;  2BBV A;  4K6B A;  4XC9 A;  2XBO 2;  1S55 A;  2BBA A;  4PI0 A;  1ZRI A;  1AXK A;  1D4V B;  1ULG A;  2E7T A;  2EIB A;  3WNM A;  5FTT C;  4CEW A;  4AAP A;  1Q3E A;  4LLO A;  2VMD A;  1DGW A;  3FN9 A;  1DBN A;  4AED A;  2XBO 1;  1S0G A;  1ZA7 A;  4LHK A;  4YM3 A;  1EYB A;  5KHH A;  5AC9 2;  3OD0 A;  3OF1 A;  3RJ2 X;  3WF4 A;  3I2I A;  2ILM A;  4OI1 A;  2BQP A;  4XZU G;  3PJQ A;  1NLQ A;  3VKM A;  3ZDV A;  5CFD C;  4BIF A;  4GJZ A;  1LGB A;  1WUV A;  2Y8K A;  4Y5Z 0;  5JSR A;  2ARB A;  1DZQ A;  2WA3 A;  1UYZ A;  5DUU A;  4YZ1 A;  5AC9 1;  1PM7 A;  3PDQ A;  2FD8 A;  2C6S A;  4ONU A;  1XYP A;  3MIH A;  5CIS A;  3VBS A;  2ZGK A;  2RJK A;  2HWC 2;  1CAU B;  4JV4 A;  4IEV A;  1LOG A;  5HV0 A;  4X6Q B;  1MR5 A;  3W58 A;  4Q4V 3;  4Q8K A;  2Q8D A;  1R1Z A;  3BAL A;  2IZW A;  1MZ5 A;  5LBC A;  5H9R A;  1F8V A;  3U1X A;  3WNL A;  5FOJ B;  1KS5 A;  1W6O B;  3KGL A;  1G9C A;  4LT5 A;  3ZN4 A;  4AW7 A;  4N53 C;  4YVS C;  5FXW A;  4F7Z A;  2WIN B;  2P4E A;  2OYZ A;  4R52 A;  5K0U A;  4XJ9 A;  4Q27 A;  1O91 A;  4XQ4 A;  2E7Q A;  3B69 A;  4GMP 0;  3GJB A;  4NPR A;  5FK7 A;  1W3X A;  1W9S A;  1YI9 A;  3I2F A;  2JEC A;  4O9G A;  4HOO A;  3VZN A;  5EYX A;  2D43 A;  4Q2F A;  5BYN A;  1XB9 A;  3RZL A;  4D8M A;  1ZVF A;  4XCA A;  1CAX A;  1V6L A;  5IAT A;  4BCU A;  4PDW C;  5FRE A;  1LGN A;  1BEV 3;  1GR3 A;  1QOT A;  1W6Q A;  3DL3 A;  5HCA A;  2RS5 3;  5IK7 A;  2Q1F A;  3KHB A;  3VKF C;  2OS2 A;  4E9K A;  1HJG A;  4A7K A;  1RGS A;  2PQQ A;  3CU7 A;  3VBH A;  3POF A;  2DVF A;  1WW5 A;  1VBD 1;  4QU2 A;  5FMO L;  3AKS A;  4LKE A;  4UYB A;  3N9M A;  4X6R B;  2P3I A;  2OQ7 A;  2XLG A;  3AMN A;  4L2N A;  1LR5 A;  2GAU A;  4P9Y A;  5FJH A;  4CP9 B;  2VQT A;  4E8D A;  2NM1 A;  3S30 A;  4UFK A;  4XF9 A;  2W1Q A;  4YG3 A;  4AFC A;  4CDQ A;  4ZU7 A;  5C8C B;  4XJZ A;  3U11 A;  5FYM A;  3H3Z A;  3TBD A;  5FMC A;  1YFY A;  3J4U H;  5KC5 A;  1ZYB A;  5HI0 A;  1D0H A;  2X09 A;  3VZL A;  1RXF A;  3POB A;  4GH4 A;  2P17 A;  5FPA A;  3S0M A;  1GOF A;  1MAC A;  3RG0 A;  5C8W A;  5I8Y A;  3V0B A;  3HD8 B;  3LDK A;  4GAL A;  2OZ6 A;  2AC1 A;  4GUL A;  4XAE A;  5FYT A;  5C4W C;  4XYX A;  2VL4 A;  5EPA A;  3WX5 A;  3HNY M;  3I3B A;  2D6O X;  1DF0 A;  3O7O A;  1FX5 A;  1X33 A;  3WP6 A;  2VTX A;  3SIS A;  5JWP A;  2XVK A;  3ACL A;  5LW9 A;  4IXL A;  5CKQ A;  2HWE 3;  1HRI 3;  1XYN A;  1K5M A;  4HSL A;  1MS1 A;  4XMI A;  3H50 A;  3QAC A;  4F3J A;  3CHX A;  5LY1 A;  5T52 A;  4QHZ A;  2P3J A;  4ASK A;  5KC6 A;  1AZD A;  1KGY A;  3LDR A;  2DVD A;  3CJI B;  2B46 X;  2DTW A;  4Q4V 2;  1QKQ A;  2C9A A;  5A3N A;  1OH3 A;  4P14 A;  2CGP A;  1O3S A;  4NPL A;  1YFU A;  4JGY C;  5C3Q A;  1LOF C;  5F5Q A;  1D2S A;  2Q1M A;  3L2Y A;  5FXX A;  2WO2 A;  1L3J A;  2JIJ A;  4Q4V 1;  3UYJ A;  4EYU A;  4AGV A;  5ABJ A;  5D1I A;  4QX7 A;  4L11 A;  1REF A;  4CEY B;  3ZYF A;  1D7P M;  5CFD A;  1B35 A;  1C57 A;  3JXS A;  1NCR B;  2ZHM A;  5F8P A;  1RUE 1;  4XBL A;  4W8J A;  3DN7 A;  5JXJ A;  4IET A;  3ZR5 A;  4BJ0 A;  3PUQ A;  2BOI A;  2ZX3 A;  1F5F A;  4QQO A;  5AVA A;  3VD7 A;  1IPK A;  2EAA A;  5CB7 A;  1LGC A;  4CSW A;  1V9U 1;  3AVS A;  2R0F A;  2DV9 A;  4HL0 A;  1I9R A;  1ZZB A;  4ZY9 A;  1H6X A;  4AWD A;  3T2P A;  1Y3T A;  1BEV 2;  4KL1 A;  2RS5 2;  2CAU A;  1MS4 A;  1N1Y A;  3FFZ A;  4YW6 A;  1GZW B;  2J42 A;  2E51 A;  2GC2 A;  2Y34 A;  2GAL A;  1GNH A;  4NRQ A;  2NP0 A;  2GC0 A;  3P5B A;  4FI9 A;  1ULC A;  1BEV 1;  5GLW A;  2ZEZ A;  1MZE A;  3AP6 A;  5L36 A;  3I2D A;  3I4I A;  5FY1 A;  4AK3 A;  4CCJ A;  1PGL 2;  1BHG A;  3JD7 2;  2Z4F A;  4IEW A;  4PI2 A;  3ZKY A;  3FHA A;  4YW4 A;  4B4R A;  1U5X A;  3S7I A;  1DQ5 A;  2V09 A;  3K46 A;  4H2A A;  4PLM A;  4AI9 A;  2WAA A;  4DRR A;  1PGL 1;  1YEW A;  2YY1 A;  3POW A;  3S5A A;  5I0D A;  2EVX A;  1ULD A;  3BU0 A;  3U07 A;  2P1B A;  4BLI A;  2W95 A;  3P3P A;  2WJS A;  4RS5 B;  1ASJ 3;  4E4H A;  4FXK B;  3LIG A;  1NA1 C;  4M0H A;  1UU5 A;  4IEZ A;  4PDW A;  2VZ1 A;  4MH0 E;  1KFX L;  4FFI A;  3AL6 A;  2E6V A;  4MGY E;  3ZSE A;  2DCY A;  2DU1 A;  1DYP A;  3R4D B;  5JPM B;  3O1R A;  1YIF A;  3TEY A;  2EAK A;  2X29 A;  4RQP B;  1SLB A;  2VAU A;  2W46 A;  3KCX A;  4LMF A;  2QQO A;  2PAE A;  4IEX A;  4AI0 A;  1OVP A;  3GZU C;  1NT0 A;  5FYU A;  2HWE 2;  1HRI 2;  1EY2 A;  5FZK A;  1OLM A;  4MGS A;  2QBX A;  2PTM A;  3LEI A;  2AEY A;  2GMM A;  1GOH A;  4D7S A;  2C5D A;  3NV3 A;  2VUD A;  3AKR A;  4GQ7 A;  1HRI 1;  2R0H A;  3NJV A;  2XHK A;  1OOP B;  4C1W A;  1X7N A;  3MIB A;  4Q1P A;  2UYA A;  4XUO A;  4EWD A;  2B7Y A;  3WXP A;  1ENQ A;  4WV8 A;  1K45 A;  5FZ7 A;  5LBB A;  2HWF 3;  3TAY A;  1FPN 3;  2IWG B;  2PHW A;  2R1B A;  3FLR A;  3ALQ A;  4QX1 A;  5EFU A;  3B5L B;  3HIF A;  2XHN A;  3VBU B;  2WNV B;  3POJ A;  1PNG A;  1WCU A;  4QPI A;  4IE4 A;  4JGZ B;  1NCQ A;  2JDN A;  2WT0 A;  4M01 A;  2O14 A;  2Q0A A;  1X36 A;  3C2U A;  5FZB A;  5F2S A;  4GWJ A;  4QDR A;  4KH9 A; 
#chains in the Genus database with same CATH homology
 2WO3 A;  1CX1 A;  2C9K A;  3MV0 1;  4P02 B;  2VCA A;  4LQR A;  1UYY A;  3ACH A;  3VD3 A;  1GNY A;  3WEZ A;  4MOA A;  1PMJ X;  3K77 A;  1UMH A;  3OGS A;  1DLC A;  3WQB A;  5C71 A;  1O8S A;  1ULO A;  2YC2 A;  3NJX A;  3T0A A;  1TG7 A;  1UXZ A;  2R7E B;  3I2J A;  3SEE A;  4GWI A;  3E1F 1;  2OKX A;  2VC9 A;  2J1E A;  3PUH A;  1NKG A;  2QQK A;  4RYD A;  3U37 A;  1W9W A;  1EUU A;  2BGO A;  1PX4 A;  4CUB A;  5HPO A;  3NRU A;  1UXX X;  3C7G A;  3GXU A;  3MV1 1;  4M4P A;  2WAB A;  4A44 A;  5LCW L;  3P6B A;  4QX2 A;  2E33 A;  2QQN A;  4LPL A;  2EIC A;  1JI6 A;  1UY2 A;  4YPJ A;  4PT6 A;  2C26 A;  3SEP A;  4ZZ5 A;  1UYX A;  2RV9 A;  3GDB A;  4BXS V;  3IB3 A;  5FUI A;  3CDZ B;  4UAP A;  1UY0 A;  2W3J A;  3OGR A;  3WNK A;  1W8O A;  4P08 A;  3GM8 A;  1K3I A;  3WF2 A;  3BN6 A;  1K12 A;  2WBK A;  5IJR A;  4E8C A;  4OYU A;  2W1S A;  1XNT A;  2X10 A;  2W1U A;  2VZU A;  2ORX A;  3LPF A;  4BDV B;  1UY3 A;  2J1U A;  3C8X A;  2WO1 A;  3ECQ A;  3K75 B;  2CDO A;  3T2O A;  1W9T A;  3I2K A;  4JHZ A;  1CZT A;  4W4Z A;  3I3E A;  3C7E A;  3LEK A;  2XOM A;  3K4Z A;  5IFT A;  2ZEX A;  2QQI A;  3A21 A;  3MO4 A;  5LA1 A;  1GUI A;  2V72 A;  1R64 A;  1SDD B;  4DEV A;  4JX0 A;  2XON A;  1UX7 A;  2VZV A;  2X05 A;  1JZ3 A;  2W87 A;  4QB1 A;  4ZZ8 A;  4A42 A;  5DPN A;  2ZEY A;  4QX3 A;  1H6Y A;  1JZ8 A;  4D0Q A;  2YC4 A;  1OT5 A;  4DXS A;  3IAQ A;  2VOT A;  3HNB M;  3AC0 A;  3MUZ 1;  5DMY A;  1W0N A;  4HG6 B;  5JXH A;  1OD3 A;  2PQS A;  3HJR A;  2YFU A;  1RYY A;  2DDU A;  3WNP A;  2Y6L A;  2J1S A;  2HLE A;  4CU7 A;  2WQ8 A;  5DN2 A;  1TVG A;  4DUX A;  2VZR A;  2BGP A;  1CIY A;  2VM9 A;  4JKM A;  1K42 A;  3WF1 A;  2C4X A;  5A1A A;  4PQQ A;  2RJ2 A;  1JYN A;  1NUK A;  4TXW A;  3LEG A;  3K4D A;  4ARX A;  1L7R A;  2JDA A;  2WZE A;  2VZO A;  3ZM8 A;  4QPW A;  3THC A;  4W50 A;  2ZEW A;  1P8J A;  1JYV A;  1US3 A;  2WN3 A;  4QB2 A;  2BZD A;  2QQL A;  3T09 A;  2VJX A;  4XUR A;  3CKH A;  3SKV A;  1CZV A;  3DEC A;  2J1A A;  5JXI A;  2YFZ A;  1PX3 A;  4CU6 A;  2JE8 A;  5G05 L;  1DP0 A;  4IUG A;  4UI9 L;  2W1W A;  3LE0 A;  4ARY A;  3IDA A;  4P00 B;  2CDP A;  3T0B A;  3LPG A;  5IHR A;  4XUN A;  2J7M A;  1OF3 A;  3NNG A;  1JZ6 A;  1JYW A;  3OEB A;  4A41 A;  2Y64 A;  3J7H A;  3HOB A;  3CQO A;  4MO3 M;  2W47 A;  5B4X A;  4A6O A;  4RN5 A;  2VME A;  1F4A A;  1GMM A;  1UZ0 A;  5HXM A;  2WN2 A;  3ABZ A;  4QAW A;  1EUT A;  2Y6H A;  4CUA A;  1UMI A;  1IQD C;  2ORZ A;  3WF3 A;  3ACF A;  3ETP A;  2BBA A;  4DEQ A;  3WNM A;  2EIB A;  5J1X A;  2ZXQ A;  5C70 A;  3HNM A;  3OGV A;  3UNP A;  4QDQ A;  2VMD A;  3FN9 A;  3P1I A;  3EB7 A;  4JKK A;  3WF4 A;  4XUT A;  2KD7 A;  3I2I A;  4DXT A;  3HEI A;  2XQX A;  4XZU G;  4XUQ A;  4MGQ A;  1F4H A;  2JKX A;  1WKY A;  2Y8K A;  1UYZ A;  4DXR A;  3I97 A;  3SKJ E;  1NX9 A;  4JKL A;  1SG3 A;  5CYY A;  4OMD A;  1W99 A;  2J1R A;  3A23 A;  2VR4 A;  2VTF A;  5EJZ B;  4QB6 A;  3UES A;  4OUE A;  3W5N A;  1KEX A;  1GU3 A;  3III A;  3UET A;  3C7O A;  3VD5 A;  3A7Q A;  3WNO A;  1US2 A;  2YG0 A;  1OF4 A;  2W91 A;  3WNL A;  4Z2A A;  2LS6 A;  3OBA A;  3DYP A;  2WAO A;  2B4K A;  3F2Z A;  2W92 A;  2VQU A;  2W5F A;  4XVH A;  1W9S A;  2WDB A;  5CZK A;  3I2F A;  3IAP A;  3ACG A;  3NQH A;  4A45 A;  3WF0 A;  4D8M A;  4UOJ A;  1J84 A;  1JU3 A;  1JU4 A;  5LA0 A;  1XPW A;  1NAE A;  3FL7 A;  4QX0 A;  5C7G A;  3OEA A;  1JZ5 A;  3CIH A;  1WCQ A;  1J83 A;  4E8D A;  2VQT A;  2V5D A;  3WNN A;  2VCC A;  3MBW A;  5F7U A;  2QQJ A;  2E31 A;  2W9X A;  2W94 A;  4KMQ A;  2W1Q A;  4CVU A;  2VMF A;  5JMO A;  1XNA A;  4QDS A;  4OZO A;  4AAX A;  4BK4 A;  2X09 A;  2RVA A;  1GOF A;  3VDA A;  3I2H A;  3PUI A;  4KI5 M;  4ZXE A;  4DUW A;  2VL4 A;  4OMC A;  4PF1 A;  2VZS A;  3HNY M;  3I3B A;  4BK5 A;  2VCB A;  2L9L A;  1T2X A;  1ULP A;  1O8P A;  1UY1 A;  1CZS A;  4AG4 A;  3CMG A;  1KGY A;  1W8N A;  3C7H A;  2DCK A;  3VD4 A;  3C7F A;  1OH4 A;  2J22 A;  2VZ3 A;  2J1T A;  2WO2 A;  1JZ7 A;  5IFP A;  2VZT A;  1UWW A;  4L0P A;  1O59 A;  3FHQ A;  1JZ2 A;  1D7P M;  2DCJ A;  1JYX A;  3JXS A;  3W5M A;  4LHS A;  3LQC A;  3BGA A;  4CUC A;  4W8J A;  5JXJ A;  4BJ0 A;  2WYS A;  1JZ4 A;  1GQP A;  1L7Q A;  3VD7 A;  4ZY9 A;  1H6X A;  2VZQ A;  1UY4 A;  3T2P A;  5EJ1 B;  5B4N A;  4P5Y A;  4CU9 A;  1PMH X;  3K4A A;  3HPN A;  2JD9 A;  2WUH A;  4TTG A;  4FI9 A;  3MUY 1;  3HN3 A;  5IYY A;  2ZEZ A;  2J1V A;  1HN1 A;  3THD A;  1BHG A;  2Z4F A;  2VMC A;  1DYO A;  3FHA A;  3D3A A;  3WSO A;  5G04 L;  3K46 A;  4MAD A;  2WAA A;  1SHW B;  1I5P A;  2Y6K A;  5I0D A;  5JXG A;  3T2Q A;  3VDB A;  2W95 A;  2BER A;  3DYM A;  2Y6J A;  1LNS A;  4LKS A;  3T0D A;  2VZ1 A;  2LW8 A;  2VO5 A;  2EIE A;  2Y6G A;  3I2G A;  3DYO A;  3CZU A;  3I3D A;  2YB7 A;  2W46 A;  5JR2 A;  4GZ9 A;  4M4R A;  2QQO A;  3OB8 A;  3A22 A;  1JHJ A;  5JUV A;  5EIY B;  2E32 A;  4MGS A;  2QBX A;  2VZP A;  3LEI A;  2QQM A;  2B9V A;  1GOH A;  1MPX A;  4A3Z A;  3NJV A;  1XC6 A;  2V4V A;  3EYP A;  3VDC A;  2HYX A;  3VD9 A;  5LA2 A;  3T08 A;  4ET7 A;  3ACI A;  4XUO A;  3CZJ A;  1K45 A;  1YQ2 A;  2E26 A;  2ID4 A;  4QX1 A;  4DUV A;  2XHN A;  5DQ0 A;  3OG2 A;  4A4A A;  2EID A;  4CU8 A;  3GGL A;  4XUP A;  2WZ8 A;  4KWU A;  1GOG A;  4GWJ A;  4QDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...